4BKSD

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 102
sequence length 102
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bksD00
1SGHA 1Q5WB 4ANWA 3MTNB 4JL9A 3B08A 2PE6B 3SU8X 1H8CA 4NNJB 2NBWB 2LGDA 2N4FA 3GOEA 3PV1A 3PVLA 5DPRA 4DHJD 1E8WA 1GG3A 4HVBA 1WJNA 2EMSA 4JGHB 4G3XB 3A9JB 3IVFA 3DBRI 3OJ4B 3U30A 4EZJA 4KDIC 5C23A 4EFOA 1EF1A 4B9KA 2DYOA 2YLMA 4ANXA 2LRUA 2AYOB 3RT3B 2ZNVC 5JHBA 2L00B 4I6LB 3WAPA 1U4AA 3DCGA 1WXMA 2MSED 3LDZE 2M4NA 4ANVA 2LWPA 1WM2A 3H9DA 2KANA 4ASWC 4HJKA 2O6VD 2FIFA 2FIDA 2CHXA 1BT0A 2KDEB 3L16A 5C1ZA 2C7HA 2KC2A 2ZPNA 2ZNVB 2KWCA 3EFUA 2D07B 4DHZB 3V62A 1E7VA 4AJWA 3DVGY 3BINA 4EKUA 2ZVOA 2N1WA 4EZKA 5GMVA 3NOBA 3Q3JA 3DDCB 4NJ7A 1WR6E 2AWTA 4PS8A 5E6PA 1Z5SB 4A20A 5HKHA 5LXIB 4BBNF 2FUHB 2FCQA 2QHOA 4X57B 1WIAA 4MGKE 2HJ8A 5CHVC 2KJRA 3ZLZA 2ZJDA 3R3MA 2MBBB 3H7SA 1WMHA 4LDTB 4HPLB 2L0FA 3C0RB 3OJ3A 4NAWA 4B95A 2IO3B 3PLUA 4XZ4A 4KVGB 4HDOA 4MEMA 1Y8RC 4HDQA 3ZDTA 1SE9A 1YQBA 2NPTB 3CSTA 2I1JA 4PS7A 5D6JB 1F9JA 1WX8A 2PE9A 5IAAC 2ZCCA 4PS3A 3U7DA 1GC7A 1V80A 4TV3A 1RLFA 4BKTA 1CMXB 1WX7A 2KTFA 2B3AA 2BPSA 2J0JA 3TL5A 3PPAA 1P9DU 3X0WA 4IG7B 2KFKA 1V9JA 3A4RA 2NBVB 3HK0A 3ZNHB 2KX3A 5L83A 4HPMB 5LLIA 1L7YA 4G11A 2IZVB 4K7WA 3VTUA 3OAWA 2PEAA 2DYBA 1WXSA 2IY1B 4A3PA 2PJHA 2ZZPB 2MLBA 2I1KA 2DX5B 2KN5A 3OLMD 1IP9A 4OVUA 2RR9A 3W1SC 2FCMA 3TJPA 1NBFC 4EZLA 4A3OA 5CX3A 2M8SA 4GB9A 4BFRA 1Z2MA 4NQKE 3L17A 1Q0WB 2W9NA 4GDLB 1J0GA 2BGFA 2CU1A 2DZJA 1LXDA 3A9JA 2MP2B 3HM6X 4AP4C 1GC6A 1WYWB 3L13A 1WJUA 3SD5A 4JLCA 2JY6A 2HD5B 2Y5BB 1OEYJ 4DDID 3TIXA 3DBLI 2KWVB 1WGDA 2D3GA 3KUDB 1HE8A 4IM2A 3A9KB 2V4LA 1GUAB 2FCSA 4LJPB 2LXAA 3WAMA 2K8BA 1NI2A 1WGYA 4W9HA 1WXAA 2MCNB 4FJVB 1YD8U 4WQOB 3UIPB 3WIMA 1WF9A 5AEKB 1LM8B 5IA7A 5J18A 1YX5B 4IM0A 3K9PB 4JQWC 4W9FA 3P2BA 2K8HA 3NY5A 2C9WB 4DK5A 4II3B 1RRBA 2KC1A 2C7MB 4WJQA 3L54A 1WRDB 1WH3A 1A5RA 4W9IA 1LFDA 3PZDA 4ZRIA 2CR5A 3QX1A 2N7DA 2G4DB 2G45B 2LVPA 2KLGA 1VD2A 2GBNA 2C60A 2MX2A 2KTRB 5E6NA 3UINB 2GMIC 2DHZA 2IO2B 1E7UA 4RM9A 2KK8A 4ICUA 4IW0A 1P3QU 2DZIA 2L05A 4W9GA 3VVWB 4IC7B 3AXCA 4HCPB 4ANUA 2JUOA 3HM3A 5J17A 3QJZA 1UD7A 1QZEA 3ZW3A 2BWFA 2DZMA 2NPTA 4KV2A 4EEWA 1WFYA 2XK5B 1WGRA 1WJ4A 2BKRB 3M95A 2G4SA 3ZUNA 4MGZE 1R4NI 4KIKB 4F8CB 3WANA 1ZGUB 2AL3A 3A1QB 3MHSD 4FBJB 5EDSA 2LXCA 3W1YA 3WAOA 5JH5C 3QQ8B 2BYVE 3HHMA 4I6PA 3B0AA 3ZNZB 1OEYA 3ZRCA 4IWPA 4GOCA 4NPNA 3A33B 1E90A 1YX6B 5D7GA 3VXWA 2IYDB 2LGXA 3ZO5B 1AARA 1X1MA 2NCNA 3QARA 3H7PB 3ZTCA 2L8JA 3QA8A 4WWNA 1WE6A 2NR2A 2LRWA 4GU2A 1ISNA 3KH0A 4M8NA 2MRPA 4WJNA 2KO3A 4KSLC 4G50A 4HWIB 1V49A 1UH6A 3UQBA 3APDA 1WGHA 1K8RB 2FAZA 4P7IA 3PRPB 4WAAA 4ICVA 1KJTA 2K25A 4LDTD 4GDLA 2N9PC 4FJZA 3K9OB 2V3SA 2KX0A 4RM8A 1J19A 4F1SA 2L7RA 2KJ6A 3W1SA 3ZTDA 4E71A 1JRUA 2WYQA 2Z0DB 4ZDVA 2LGYA 1R4MI 3AU5A 1E5WA 5KHOA 2L0TA 4XC2A 2KQSA 3ECIA 3JW0X 3KW5B 3N30A 3VUWA 3RUIB 4AJYB 1UGMA 1TTNA 2KNBA 1OGWA 1I42A 1EO6A 3EHVA 1D3ZA 1ZKHA 3NHEB 2UYZB 1WGGA 3O65B 3H1UA 3KYDD 1V81A 3M63B 5DCNA 3Q3FA 2BYFA 4AWJA 3H6NA 2MW5A 3BY4B 3ONSA 4CYEA 1WJ6A 3U8ZA 1GJZA 5DPTA 2AEHA 2MQJA 1M94A 1WE7A 3M62B 4ZYNA 3UQAA 5BO4B 1S1QB 4F7ZA 4MJSB 2KTRA 3APFA 4MGYE 3V60A 4BKGA 3RULA 3AULA 4BOSC 2MBOA 2MBEA 1UBIA 3V61A 2MBHA 2J7QB 2XK5A 3IBEA 3KUZA 5CHWA 4YL8A 5D94A 3DBHI 3QK0A 5FR6A 3PTFC 2JRHA 1OQYA 1V5TA 4J6IA 4KIKA 3ZVVA 1PQSA 1XT9B 4NJ6A 4BBNC 4HXDA 4BKSD 2K39A 4W9JA 4WWPA 3A1QA 5TR5A 1T0YA 4RMAA 1V6EA 3PLVA 4HK2A 3CMMB 3KYCD 2GBJA 2Z0EB 4GMVA 3NZUA 5G55A 3VUXA 1C3TA 4IUMB 4PYUA 1P98A 1UBQA 1V2YA 1WM3A 2K6QA 2KWUB 2LVOA 2N1VA 2JT4B 2M17A 3ML9A 3NZSA 4EUTA 3ML8A 2KJHB 3H7PA 3QC8B 4NAWB 4EOYA 3JVZX 3ZIMA 4WWOA 4KZ0A 5JZEB 5L95C 2NS5A 3PHWB 2OOBB 3VTWA 5J2RA 2N7EA 3IFWB 1WX9A 1EF5A 2EKEC 2Z59B 3VH3B 2HTHA 4GIVA 1ZW7A 5AZHA 2KZRA 3V6CB 4TKNA 5LXHA 2R2QA 1MG8A 3JSVB 3R7QA 3SDLC 1GNUA 3RYTA 2L3ZA 1TZ1A 2BF8B 2IBIB 2JRIB 1UZXB 2ASQA 1RFAA 4BVUC 2IO0B 4K7SA 4N9F4 3RZFA 1WZ3A 2K8CA 4PYZA 3RD2A 3S2AA 1KLVA 2M1MA 1NDDA 4ZRJA 2XBBC 1IPGA 3QIJA 3VFKA 2G3QB 2ZVNA 2OJRA 1EUVB 3UIOB 1H4RA 4W9DA 2PPHA 3VHTC 3UF8A 2KDFB 3PSEB 3PRMB 2WWZA 2REXA 4WJPA 1VCBA 4JIOU 1TBEA 3PHXB 3V6EB 4GN1A 2KHWB 2EMTA 4W9EA 4FHKA 3N3KB 2WDTB 2FCNA 4MM3A 2IY0B 4DHJB 5CTRC 3EC8A 2ZPYA 2JZ3B 1SIFA 3L08A 4DWFA 2VRRB 1V5OA 3DQVA 3DVNU 1WXVA 1C1YB 5E6OA 4BOZB 3LJ3A 2CHWA 2JVCA 2R2OA 4FN2A 4MJSA 3TBLD 2CKHB 2FNJB 4GDKB 3ENEA 3NS8A 3TMPB 3ZNID 5JHAA 2YVCA 1WR1A 1KM7A 2DENB 2M0XA 2WX1A 4NY0A 2J0KA 3VAWA 4GGQA 3VTVA 3R7RA 2O6VB 2MP2A 2RSUA 4AUQC 1P0RA 2K1FA 3RZWC 2NVUI 4WJOA 2CHZA 4KZCA 1OTRB 1UELA 2JWZA 2KQ7A 3D32A 3CSFA 3A9KA 3IG3A 4LJOB 4MGIE 4URKA 3KUCB 5DPWA 3B1LX 1WY8A 4XX5A 2CS4A 2AL6A 2N9EB 2N9XA 2JF5A 2O2VB 2KMCA 3N32A 2LZ6A 4BKSA 4HLEA 2K6DB 4TQ0A 1G6JA 4G0NB 3PT2B 4K7UA 2BYEA 2KFJA 4HCNB 2GBMA 4K1RB 4M0WB 4MSQB 1IYFA 2C5LC 2LJ5A 4KSKC 3DVGX 3ZNGC 4AOFA 3PREA 1TGZB 3DPDA 2LASA 1XQQA 2LUEA 3IHPC 2HE7A 4DBGA 3GZNI 2DZKA 4DHZE 2KKCA 2ZCBA 1S3SG 4FJYA 4GXBA 2MWSB 4DXAB 4MSMB 5DPSA 2IO1B 4W9LA 2RGFA 2RPQA 3WA0A 2GBKA 2MBQA 2GBRA 4FLHA 1E8YA 4MELA 5AZFA 1V86A 5D2MB 2BKFA 2BWES 2DAFA 4LCDE 4IM3A 4KDLB 3JSVA 2D11A 3L10B 4B6WA 1FXTB 3JYUA 5KHQA 2KVRA 3X23A 4TUUA 3PRZA 5G2NA 2D10A 3WALA 4NQLB 4E3CA 3AI5A 3QAQA 3PS6A 4M8MA 3L0WB 2DAJA 3AU4A 3HIZA 4GSWA 2J0MA 3DBSA 4II2B 3T9LA 4FULA 2L76A 3ZKJC 3ZRFA 4CHKA 2XEWA 3VUYA 4W9KA 2KOXA 2KLCA 2D2QA 5AZGA 2GOWA 5CHFA 2KDIA 4IWOA 4TQ1A 1LQBA 1XD3B 3T8MA 3DOWA 2JXXA 1WMHB 2UWQA 2V1YA 3CF6E 3MJWA 1WZ0A 3PGEA 3SHQA 4OVVA 1Q1OA 3EECA 3A4SC 3QWZB 1E8XA 4E74A 3RCZA 2NBUA 1J8CA 2DYMA 2JPHA 1E8ZA 4GDKA 1RAXA 2RD0A 3UGBB 1KOTA 4DDGD 4W9CA 3QHTA 2KDBA 2KMAA 4K81A 3R66C 2KXJA 1L2NA 4FADA 3ALBA 2LVQA 4IWQA 3I3TB 3DVNV 2O6VA 2MA9B 1I35A 2JZZA 2C7NB 2LD9A 1YIWA 3QCAA 2WX0A 4MH0E 1YJ1A 3VDZA 4ZRKA 3VQIA 3VH4B 1P1AA 2KFKB 3ZDMC 2A4ZA 4FA6A 2KD0A 3APCA 4I6NB 2O2VA 1WI0A 3KVFB 4MDKE 4FHJA 3TCAA 4CO7A 2A5UA 3M3JA 2LI5A 2ZEQA
chains in the Genus database with same CATH superfamily
3MTNB 4C80A 2PE6B 2EKIA 1KLGD 3GOEA 1E8WA 2J4XA 3A9JB 4EZJA 4KDIC 2ACZB 2FBWB 4I6LB 1SE4A 1U4AA 1WXMA 2MSED 2M4NA 2ZW0A 2RPVA 2BS3B 2QMTA 1EWYC 4HJKA 2O6VD 2KDEB 1KLUD 2KC2A 2D07B 1D5ZC 1ZE3D 1T0SC 2AQ2B 1WR6E 4PS8A 1Z5SB 5HKHA 5LXIB 2UU7A 2JU6X 5H8YE 1IBXA 4X57B 3Q6BA 4MGKE 5D3DA 3TEXA 3DHHC 2L0FA 1KTKA 2AQ1B 2KYWA 4NAWA 4XZ4A 2QILA 4MEMA 4KKIA 1C79A 2NPTB 1TKGA 4YTPB 1MVKA 1F9JA 1WX8A 2PE9A 2ZCCA 3U7DA 2KTFA 2BPSA 2CJOA 1P9DU 3HK0A 3B9JA 2BB6A 2IZVB 4K7WA 3VTUA 2PEAA 2DYBA 5EE3A 4O1NA 2VZKB 2E6XA 2I1KA 2KN5A 1IP9A 2JX5A 3W1SC 2FCMA 1NBFC 1MI0A 5CX3A 2SEBD 3IAM1 2Q5WD 4GB9A 4LNKA 1UGJA 2D5GA 3I9V1 4AP4C 2MP2B 3SD5A 2HD5B 1VJKA 3E9SA 1OEYJ 1M4VA 1WGDA 2D3GA 4KX6B 4MACA 1HE8A 1GUAB 2V3NA 1WGYA 3GB1A 4WQOB 4IDIA 1LM8B 5J18A 1FD6A 1A70A 5IKCM 1XO3A 5IN7A 3RN9C 2K8HA 1RRBA 4K3CA 2C7MB 1D6EC 1A5RA 2M0AA 4YT0B 3QX1A 3RNFC 2MX2A 1DOXA 1XLOA 1GOZA 3T3NA 2DZIA 4W9GA 4IC7B 4HCPB 4RGMA 1UD7A 2K3UA 2INDC 2DZMA 1TY0A 1I4XA 4EEWA 5HHDG 2XK5B 2BKRB 3DHGC 2WXQA 4F8CB 4XGAB 1HTOA 2PMVA 3Q3NC 5EDSA 3QQ8B 3B0AA 1F1HA 1JW9D 1E90A 3VXWA 4A9AA 1AARA 4EE2A 1I4HA 3ZTCA 1WE6A 1L6UA 5LNK1 4GU2A 3KH0A 4M8NA 4DQOC 3APDA 1K8RB 2HDEA 4LDTD 2KWDA 2WXMA 1K51A 4US8A 2HTME 1J19A 4R3DA 1AWDA 1DGJA 2WP9B 2Z0DB 3DBRB 2OJWA 2D3CA 3VUWA 2FE8A 5FKAC 1FO4A 1XLQA 3EHVA 3VRAB 5D3IB 2GI9A 1LGRA 4RH6A 5BMIA 3O65B 5DCNA 3FAHA 3BY4B 1V1PB 1K52A 1WJ6A 5DPTA 2MQJA 1M94A 3M62B 2PTLA 1FM0D 3APFA 4MGYE 5I4DA 3LYYA 1R7SA 2V9HA 3IBEA 1EU3A 1J7BA 5CHWA 1FEHA 3PTFC 1OQYA 1D5XC 4KIKA 4NJ6A 4BKSD 3CWIA 3VR8B 1N61A 1TY2A 1T0YA 2JZPA 3PLVA 1ET9A 1PDXA 2ONQA 4US9A 2Z0EB 3VUXA 3KUCB 1PFDA 2N1VA 2K6QA 2Y3AA 4A6QA 2WDRB 3NZSA 1HEZE 3H7PA 4KZ0A 5IOIA 1WX9A 2Z59B 1ZW7A 5AZHA 3BVGA 3AE3B 3R7QA 2SAKA 3L4PA 3C8YA 2IBIB 3H8HA 3BVZA 4K7SA 1WZ3A 3MC8A 3DBLB 4ZRJA 3VFKA 1IPGA 2IGHA 3QIJA 4PK1A 2ZVNA 2OJRA 3RNAC 1H4RA 3VHTC 3TSSA 3NS1A 2WWZA 1VCBA 4JIOU 3WCQA 1TBEA 3PHXB 3V6EB 2KVZA 4DHJB 2FCNA 2IY0B 5CTRC 3GE8C 1KRHA 2ZPYA 2JZ3B 4BZAA 1V5OA 4UDUC 4BOZB 4MJSA 2FNJB 3NS8A 4REZA 5JHAA 2GRIA 3TEWA 2RDGA 2M0XA 2J0KA 3VTVA 4GGQA 3R7RA 1JWMD 1P0RA 3DWGC 2D3BA 4WH4A 2CHZA 4MGIE 2LGSA 1SBBB 2N9XA 2ON8A 4BKSA 2K6DB 1R4NB 5EE1A 2BYEA 4HCNB 2GBMA 4K1RB 4M0WB 1IYFA 3DVGX 4JX1C 3PREA 2LASA 2LUEA 3BIID 5BMGA 4OVZA 4DHZE 4FJYA 1FXIA 1V1OA 4DXAB 1UF0A 2XNAC 4MSMB 4W9LA 2RPQA 2GBKA 2Y5PA 2MBQA 4FLHA 1E8YA 4MELA 4KDLB 2E3TA 4JWSC 4B6WA 3JYUA 3PRZA 4E3CA 4NQLB 2WXIA 3QAQA 3PS6A 4M8MA 3HIZA 4GSWA 1KH0A 2L83A 2J52A 2QDFA 3RI7C 1YN4A 1TYGB 2XEWA 2KLCA 4RFBA 1RFKA 3R8BA 4IWOA 4TQ1A 1LQBA 3T8MA 2KDMA 3DOWA 1UUPA 4LNOA 1L0XB 2WS3B 2KT7A 1HA5A 3C19A 4L23A 3Q3MC 3RCZA 5TSSA 2X8XX 3RFZB 4DDGD 3P42A 1WYGA 5IO9A 2KXJA 1J7AA 3UI3A 2LD9A 5AUIA 2WX0A 1P1AA 1VRAB 2GLSA 1OFFA 1WI0A 3MHZA 4FHJA 2LI5A 2D2QA 2ZEQA 1Q5WB 4JL9A 4LTUA 3DHIC 3SU8X 1H8CA 4NNJB 2NBWB 1ZDVA 2N4FA 3PVLA 2QCZA 1TJEA 5DPRA 4JGHB 1CZPA 3IVFA 3OJ4B 3EUB2 2I38A 4EFOA 2LGIA 1C76A 4ANXA 1QLBB 2LRUA 2ZNVC 5JHBA 3AE8B 3WAPA 3DCGA 3LDZE 1JALA 2LWPA 1K53A 1SSNA 2FIFA 1BT0A 2M19A 2QIEB 3L16A 5C1ZA 2C7HA 2KWCA 3AEAB 3DVGY 1K50A 3NVVA 2LMCA 2XN9C 2ZVOA 2B76B 2AQ3B 2V0GA 3DDCB 3HVDA 5E6PA 1RWSA 2QHOA 4ARCA 1WSPA 1L4DB 2LHDA 2MBBB 4JWUC 4YSYB 3C0RB 1ET6A 3P4PB 4KVGB 3FKYA 3ZDTA 4HDQA 1SE9A 1YQBA 1FMAD 5IAAC 4PS3A 4TV3A 2H89B 4BKTA 4KGTA 3X0WA 2KFKA 1V9JA 3A4RA 3ZNHB 1V97A 3EGRA 3OAWA 1NYRA 2ZZPB 3OLMD 3TJPA 4A3OA 2M8SA 4BFRA 1Z2MA 3L17A 2R61A 1YJIA 2W9NA 4GDLB 1J0GA 2MHJA 2BGFA 2CU1A 2L32A 3A9JA 3HM6X 1P7EA 2BT6A 3GS2A 1GC6A 3BVMA 1WJUA 4JLCA 3Q8AA 3TIXA 4XE0A 3VRBB 4LJPB 3N1XC 1NI2A 2KN4A 3WIMA 4OZBA 5AEKB 2W54A 1YX5B 4WWMA 3K9PB 3KLSX 4JQWC 4HEA1 4ARIA 1T0RC 4KGRA 4DK5A 1LFDA 2PLPA 2G4DB 2G45B 2LVPA 2KLGA 2C60A 2WXHA 2Z8LA 5E6NA 3ZQ4A 2DHZA 2JXTA 2IO2B 2WXKA 1E7UA 1XEEA 2KK8A 1P3QU 2L05A 2INPE 2QC8A 3P1MA 4ITKA 1SB3C 4AS1A 1QZEA 2NPTA 2RMMA 1WGRA 1WJ4A 2G4SA 1PYWD 2J42A 4RGOS 4FBJB 1E7PB 3ZNZB 4N6EB 1F77A 4XWWA 4USAA 5D7GA 2LGXA 3ZJVA 5BMHA 2NR2A 2MRPA 4WJNA 2KO3A 4YWGG 1V49A 1UH6A 1YJJA 1SF0A 3PRPB 4WAAA 1MG4A 2EELA 4F1SA 1HQRD 2K5PA 2ZW1A 3ZTDA 1FIQA 1JRUA 2LGYA 3AU5A 5KHOA 2L0TA 4AJYB 3JW0X 3N30A 3RUIB 2IGGA 2WXGA 2KNBA 3AE5B 1I42A 1D3ZA 1ZKHA 3NHEB 1TS3A 4LNIA 4HRSA 1WGGA 4MH8A 1I4PA 4AWJA 2QEJC 3H6NA 2MW5A 4MM3B 2K0PA 1ZPSA 1YQ4B 1TZOA 2AEHA 2QSDA 1WE7A 3AM9A 4ZYNA 3UQAA 1L5PA 4F7ZA 4LNFA 2N7JA 3HVZA 3RULA 1P7FA 2MBOA 3BYTB 1E0ZA 2MBHA 4FXCA 3SFEB 2XK5A 3KUZA 5D94A 5HI1A 3DBHI 3QK0A 5FR6A 3AE7B 3AEDB 1N5XA 3SR6A 4BBNC 4D2KA 4W9JA 4WWPA 5TR5A 3AN1A 1V6EA 2AX5A 4HK2A 2K22A 1L0VB 3CMMB 5C2TB 4TMAB 2I2YA 1C3TA 3LB8C 3NZUA 4IUMB 2DLBA 4PYUA 1UBQA 1WM3A 3AE4B 3R2TA 4NAWB 3EFCA 3W5UB 3ZIMA 1EWCA 5JZEB 1WGKA 2OOBB 5J2RA 2LFIA 4C7YA 1EF5A 2EKEC 2MH7A 1PGAA 1T3QA 5EE0A 3JSVB 4XDDA 1JWBD 1NI3A 5BYQA 2ASQA 1TT5B 3RZFA 2K8CA 2M1MA 3IT4B 2WXNA 2XBBC 1JCKB 1TS2A 2PPHA 3DWMA 3PRMB 2NTTA 4ZHOA 2WU2B 2KHWB 1SEBD 4OZCA 1V1PA 2QJLA 3AV8A 3L08A 4DWFA 2VRRB 3DQVA 3DVNU 3VR9B 1WXVA 1DOYA 2JVCA 4FN2A 2CKHB 3AMZA 1YN3A 3ZXVA 2MJ3A 2DENB 2O6VB 2RSUA 3RZWC 2NVUI 1OTRB 3Q14C 3LXFA 3D32A 3A9KA 1HTQA 3B1LX 2LHEA 1WY8A 4XX5A 2CS4A 2N9EB 2O2VB 2JF5A 2KMCA 3N32A 4YSZB 1G6JA 4A55A 1ZP0B 4KSKC 4C00A 1SE3A 4AOFA 1TGZB 2PKOA 2L1AA 1ZOYB 2ZCBA 4GXBA 2BB5A 2BYTA 1N63A 5DPSA 2RGFA 2GBRA 3AE9B 2BKFA 2DAFA 4IM3A 1FFVA 2M56B 3P4SB 2WXFA 5KHQA 2KVRA 4TUUA 2D10A 4OHJA 2WGSA 2DAJA 4L2YA 4II2B 3T9LA 3ZKJC 3MC0B 5MPOA 3ZJUA 2JWUA 5AZGA 1JRPA 1XD3B 3Q2AC 3AEBB 2WXJA 1WMHB 3PGEA 1WZ0A 3EECA 4HJGE 1WRIA 1E8XA 1L6VA 4C56C 4E74A 4P1CC 1TIFA 1J8CA 1I4GA 4ZRPA 1KOTA 3QHTA 2KMAA 3R66C 2LVQA 3I3TB 2MA9B 2JZZA 2WDVB 3VDZA 3QCAA 4MH0E 1YJ1A 3VQIA 3VH4B 1KF6B 3ZDMC 2A4ZA 4ZOHC 3RMKC 2Y5CA 4YTMB 4RCOA 2PVOD 3NUHB 4CO7A 2A5UA 3I5JC 4ANWA 2INNE 5IP4D 4LK0M 4BAXA 1TKYA 2LJIA 1GG3A 3AECB 5C3JB 1ZXIA 1N5WA 3DBRI 4HKQA 3IAS1 1PUTA 2RDBC 1EF1A 2DYOA 2AYOB 1RYJA 2JSVX 1WM2A 1TS5A 3RNEC 2CHXA 1N6ZA 4DHZB 4M00A 1E7VA 4AJWA 1C4AA 3BINA 4EKUA 2N1WA 5GMVA 4QAYA 3HRDD 3Q3JA 3RNCC 4NJ7A 4A20A 1CQVA 2FUHB 1J7CA 1GAQB 2HJ8A 1DOIA 3ZLZA 3R3MA 3H7SA 4LDTB 4HPLB 1VDVA 3OJ3A 1FFUA 2IO3B 1XF5L 4RF1A 3CSTA 3MFGA 1GC7A 1V80A 1WX7A 1C9FA 3SEBA 3NVWA 1MHXA 2WXPA 3PPAA 1AW7A 1KFYB 1VZ6A 1ZDXA 2KX3A 5L83A 5LLIA 2IGDA 4G11A 1R4MB 3B2FA 4GLSC 4YTNB 4OVUA 4WURA 1FRDA 5EE9A 4NQKE 1Q0WB 2BS4B 2BVCA 2DZJA 4MT5A 2WU5B 1GPXA 2JY6A 3O13A 2Y5BB 4DDID 3GZNB 3DBLI 2KWVB 3KUDB 2CU3A 2W3SA 5JXVA 2CJNA 3WAMA 2MCNB 1B1ZA 4K3BA 1E6EB 1WF9A 3ZYYX 5IA7A 3AE6B 1HZ6A 3NVZA 3P2BA 4CQNA 2C9WB 4II3B 2KC1A 5FK9C 1WH3A 3CIRB 1HZ5A 4ZRIA 2BW2A 1WWTA 1UWXA 2GBNA 4N59A 2KTRB 2GMIC 1F2RI 4IW0A 2VH2A 2BTEA 4ANUA 3HUIA 1ZUD2 2JYEA 1DYQA 3NJTA 3GE3C 2BWFA 3N9YC 4ZYSA 1MHHE 3R2IA 4MGZE 1R4NI 2AL3A 3A1QB 1GB4A 1F0ZA 1Q10A 2LXCA 3W1YA 3WAOA 3EA6A 1YMHE 3HHMA 3ZRCA 1OEYA 4P6VF 1FNUA 4IWPA 4NPNA 3A33B 5HFYA 1N62A 1X1MA 2BBCA 2NCNA 3QARA 4WWNA 4IKGA 1SIJA 4KSLC 3UQBA 1WGHA 2FAZA 4NJCA 1KJTA 4KGSA 3NVYA 4GDLA 2N9PC 3J9CA 3K9OB 2V3SA 4RM8A 2WXRA 4ZDVA 2WYQA 1R4MI 3RNBC 3ECIA 2DNFA 4JPSA 4TSSA 1OGWA 1XCQL 1CK1A 2UYZB 2WLBA 3W9CB 2K9XA 1ACCA 1XCTL 3ONSA 2VZKD 3U8ZA 1YNTE 2WXOA 4P1BC 3Q8FA 2J53A 4BKGA 4HPPA 4BOSC 2MBEA 1UBIA 1TKEA 1T0QC 3V61A 2PW9A 2J7QB 1PQSA 1XT9B 3P63A 4XYCA 2K39A 2W55A 2H88B 4C7ZA 2GBJA 1RM6C 5G55A 2LVOA 4S0RA 2JT4B 3ML8A 2KJHB 4EOYA 2V4IB 2W82A 4WWOA 5L95C 2NS5A 3PHWB 3IFWB 3MJ5A 2WNMA 1AN8A 2HTHA 2MJDA 4WQMA 1QOAA 3V6CB 4TKNA 5LXHA 1MG8A 5G5GA 2BQQA 1IGDA 3BZDB 1TZ1A 2BF8B 2JRIB 2RDHA 1I4RA 1IGCA 3S2AA 1KLVA 3I57A 3IXSA 2KQ4X 2G3QB 2GB1A 3UIOB 4S17A 2KDFB 3PSEB 2REXA 4C4VB 4JE3B 1NENB 2EMTA 4FHKA 3N3KB 2WDTB 4MM3A 3AB5A 3EC8A 3ABVB 1ENFA 1F2RC 3FILB 3BWUD 1C1YB 5E6OA 3LJ3A 2CHWA 2R2OA 3TBLD 4GDKB 2N0SB 4LLGM 1WR1A 1KM7A 1SE2A 1XLNA 1NVID 2MP2A 1BXTA 1JMLA 4WJOA 1UELA 4URKA 4LJOB 1VZ8A 5DPWA 1YQ3B 2AL6A 4HLEA 3AEFB 2LZ6A 1I7HA 4TQ0A 4G0NB 3PT2B 4K7UA 1PGXA 1STEA 2KFJA 4MSQB 5H92C 2C5LC 2LJ5A 2LEKA 3DPDA 1XQQA 1SXTA 3IHPC 4DBGA 2DZKA 2KKCA 2N9LA 2IO1B 4ACFA 1JQ4A 3PO0A 1FXAA 5D2MB 3JSVA 4KKJA 2D11A 3L10B 1FXTB 1QOFA 2V3PA 5G2NA 1EM7A 3WALA 3B2GA 3AI5A 4FULA 2L76A 4Q2JA 3ZRFA 4CHKA 1IBXB 2KDIA 1MPEA 3SHQA 3CF6E 3MJWA 3PZ8A 1Q1OA 3QWZB 1SJHD 2NBUA 2JPHA 1VLBA 1RAXA 2RD0A 1QQRA 3UGBB 3U7ZA 4XWTA 1L2NA 3NRZA 3ZJTA 2O6VA 3TUOA 3KWLA 5AUKA 2NMQA 1I35A 2C7NB 2WQYB 4ZRKA 3AEGB 1E10A 1T5XD 1N60A 1QT9A 1L4ZB 2O2VA 3KVFB 4MDKE 3TCAA 3N20C 1SGHA 3B08A 2LGDA 3PV1A 4DHJD 1FPYA 4HVBA 1WJNA 2EMSA 4G3XB 2BS2B 1MFWA 3U30A 5C23A 5GXGB 4B9KA 2YLMA 1XLPA 1JROA 3RT3B 4RNAA 3N1ZC 2L00B 4HROA 3AEEB 4ANVA 2FUG1 3H9DA 3NG0A 2NTSA 2WXLA 5BYRA 2KANA 4ASWC 2FIDA 2IJ0A 3ETRA 2ZPNA 2ZNVB 3EFUA 3V62A 1TS4A 4EZKA 3NOBA 1FCLA 3U4EG 1D5MC 4YXDB 3KWVA 2YEPF 2AWTA 3W2DA 4BBNF 4WIPA 2FCQA 3ZXRA 1WIAA 5CHVC 2KJRA 2KMMA 2ZJDA 1V8CA 4M02A 3V3XA 1WMHA 2PIAA 1QOBA 2D3AA 2N9KA 4B95A 1BUIC 4L1BA 3PLUA 4HDOA 2WHIA 4B0EA 1Y8RC 2I1JA 4PS7A 2OEDA 2PVGC 5D6JB 3AE2B 3OG5A 1RLFA 1CMXB 3TL5A 2B3AA 2J0JA 4IG7B 3OWEB 2NBVB 1BMLC 4NAMA 2MJEA 4HPMB 1L7YA 4M01A 1PGBA 5E6JA 1WXSA 2IY1B 3AH7A 2PJHA 4A3PA 2INCC 2MLBA 1WXQA 2DX5B 3AE1B 1T6BX 2RR9A 4EZLA 2MEKA 1XXGA 2OHFA 4H2AA 5T8IA 1LXDA 4PT5A 1WYWB 3L13A 3Q8CA 2G1EA 4IM2A 3A9KB 3TEYA 2V4LA 2FCSA 2LXAA 2K8BA 1ZXHA 4W9HA 1WXAA 4FJVB 1YD8U 2G9HD 3UIPB 4NZLB 1JWSD 4IM0A 4W9FA 1C4PA 3NY5A 1MJDA 4WJQA 3L54A 1WRDB 4W9IA 3PZDA 1JWAD 2CR5A 2N7DA 3MC9A 3FC4A 4M0WA 1VD2A 2X38A 3UINB 1UNSA 4RM9A 4ICUA 3PZ7A 3VVWB 3AXCA 2JUOA 3HM3A 5J17A 3QJZA 3ZW3A 4KV2A 4WAFA 3Q8EA 1UWMA 1WFYA 3M95A 3BYYB 3ZUNA 4KIKB 4HKZE 2IDYA 3WANA 3W5VB 3RNGC 1ZGUB 3MHSD 5JH5C 1SJED 2BYVE 4I6PA 1VZ7A 4GOCA 4DXFA 1YX6B 2IYDB 4XDCA 3ZO5B 2JQRB 3H7PB 2L8JA 3QA8A 2LRWA 1ISNA 2DWQA 4G50A 4HWIB 1YOVB 1NYQA 4P7IA 2KAJA 3SFDB 4ICVA 2K25A 3URYA 4FJZA 3V05A 2KX0A 4LNNA 4A8XC 2L7RA 2JYTA 2KJ6A 3W1SA 4ZRQA 4E71A 5G5HA 2ICIA 1E5WA 4XC2A 2KQSA 3KW5B 2WDQB 1NEKB 1UGMA 1TTNA 1EO6A 3H1UA 3KYDD 1V81A 3M63B 4RGTA 3Q3FA 2BYFA 3GP7A 1FRRA 3P4RB 4CYEA 1GJZA 1HXYD 1QF6A 5BO4B 1S1QB 1OQQA 4RGNA 4MJSB 2KTRA 1C4CA 3V60A 3NZ3A 3AULA 4J3OD 2DBYA 3Q3OC 1FNVA 4YL8A 2KACA 4AQ7A 1EU4A 1JWUD 1V5TA 2JRHA 4J6IA 3ZVVA 3KQ4A 4HXDA 3A1QA 4RMAA 3I63C 3P4QB 2IPKD 3U2SC 1ESFA 4N58A 3KYCD 4GMVA 1P98A 2YEPB 1V2YA 2KWUB 2M17A 3ML9A 4EUTA 4OZAA 1D4BA 3QC8B 3JVZX 4YSXB 1FNWA 3VTWA 2N7EA 1B9RA 3VH3B 4GIVA 2KZRA 2R2QA 3SDLC 2TSSA 1GNUA 3RYTA 2L3ZA 1OQRA 1F52A 1UZXB 1RFAA 4BVUC 2IO0B 4N9F4 4PYZA 3RD2A 1NDDA 1EUVB 1E9MA 3TEZA 4W9DA 3UF8A 1ROEA 1QOGA 4WJPA 4GN1A 4W9EA 1L0YB 1SIFA 5BYSA 3TMPB 3ENEA 3ZNID 3N1YC 2YVCA 1FCCC 2WX1A 4NY0A 3VAWA 4AUQC 2K1FA 1I4QA 4KZCA 2JWZA 2KQ7A 3CSFA 3IG3A 2HJ1A 2W3RA 1LO5D 1VR9A 2VH1A 3MP9A 3ZNGC 1AYFA 4IOIE 1IUEA 3IT6B 4RF0A 2HE7A 3GZNI 3Q8BA 1C78A 1S3SG 5FR3A 3T3OA 2MWSB 4A90A 3WA0A 5AZFA 1V86A 2BWES 4LCDE 4OW0A 3X23A 1QILA 3Q69A 3L0WB 3AU4A 1QKZA 2J0MA 3DBSA 4B0MA 3VUYA 4W9KA 2KOXA 1GB1A 1C77A 4P16A 2GOWA 5CHFA 4C4VA 3U52E 2JXXA 2V1YA 2UWQA 4OVVA 5HG2A 3A4SC 3RPFC 3E56A 3FILA 3BK1A 2DYMA 1E8ZA 4GDKA 4W9CA 4ZHPA 4K81A 2KDBA 4FADA 3ALBA 4IWQA 4DXGA 3DVNV 3ZGZA 1CJEA 1YIWA 2L52A 1YN5A 2LUMA 2KFKB 4FA6A 1Y56A 2KD0A 3APCA 4I6NB 3DBHB 3M3JA 3BK2A
chains in the Genus database with same CATH topology
1SGHA 1Q5WB 4ANWA 3MTNB 4JL9A 3B08A 2PE6B 3SU8X 1H8CA 4NNJB 2NBWB 2LGDA 2N4FA 3GOEA 3PV1A 3PVLA 5DPRA 4DHJD 1E8WA 1GG3A 4HVBA 1WJNA 2EMSA 4JGHB 4G3XB 3A9JB 3IVFA 3DBRI 3OJ4B 3U30A 4EZJA 4KDIC 5C23A 4EFOA 1EF1A 4B9KA 2DYOA 2YLMA 4ANXA 2LRUA 2AYOB 3RT3B 2ZNVC 5JHBA 2L00B 4I6LB 3WAPA 1U4AA 3DCGA 1WXMA 2MSED 3LDZE 2M4NA 4ANVA 2LWPA 1WM2A 3H9DA 2KANA 4ASWC 4HJKA 2O6VD 2FIFA 2FIDA 2CHXA 1BT0A 2KDEB 3L16A 5C1ZA 2C7HA 2KC2A 2ZPNA 2ZNVB 2KWCA 3EFUA 2D07B 4DHZB 3V62A 1E7VA 4AJWA 3DVGY 3BINA 4EKUA 2ZVOA 2N1WA 4EZKA 5GMVA 3NOBA 3Q3JA 3DDCB 4NJ7A 1WR6E 2AWTA 4PS8A 5E6PA 1Z5SB 4A20A 5HKHA 5LXIB 4BBNF 2FUHB 2FCQA 2QHOA 4X57B 1WIAA 4MGKE 2HJ8A 5CHVC 2KJRA 3ZLZA 2ZJDA 3R3MA 2MBBB 3H7SA 1WMHA 4LDTB 4HPLB 2L0FA 3C0RB 3OJ3A 4NAWA 4B95A 2IO3B 3PLUA 4XZ4A 4KVGB 4HDOA 4MEMA 1Y8RC 4HDQA 3ZDTA 1SE9A 1YQBA 2NPTB 3CSTA 2I1JA 4PS7A 5D6JB 1F9JA 1WX8A 2PE9A 5IAAC 2ZCCA 4PS3A 3U7DA 1GC7A 1V80A 4TV3A 1RLFA 4BKTA 1CMXB 1WX7A 2KTFA 2B3AA 2BPSA 2J0JA 3TL5A 3PPAA 1P9DU 3X0WA 4IG7B 2KFKA 1V9JA 3A4RA 2NBVB 3HK0A 3ZNHB 2KX3A 5L83A 4HPMB 5LLIA 1L7YA 4G11A 2IZVB 4K7WA 3VTUA 3OAWA 2PEAA 2DYBA 1WXSA 2IY1B 4A3PA 2PJHA 2ZZPB 2MLBA 2I1KA 2DX5B 2KN5A 3OLMD 1IP9A 4OVUA 2RR9A 3W1SC 2FCMA 3TJPA 1NBFC 4EZLA 4A3OA 5CX3A 2M8SA 4GB9A 4BFRA 1Z2MA 4NQKE 3L17A 1Q0WB 2W9NA 4GDLB 1J0GA 2BGFA 2CU1A 2DZJA 1LXDA 3A9JA 2MP2B 3HM6X 4AP4C 1GC6A 1WYWB 3L13A 1WJUA 3SD5A 4JLCA 2JY6A 2HD5B 2Y5BB 1OEYJ 4DDID 3TIXA 3DBLI 2KWVB 1WGDA 2D3GA 3KUDB 1HE8A 4IM2A 3A9KB 2V4LA 1GUAB 2FCSA 4LJPB 2LXAA 3WAMA 2K8BA 1NI2A 1WGYA 4W9HA 1WXAA 2MCNB 4FJVB 1YD8U 4WQOB 3UIPB 3WIMA 1WF9A 5AEKB 1LM8B 5IA7A 5J18A 1YX5B 4IM0A 3K9PB 4JQWC 4W9FA 3P2BA 2K8HA 3NY5A 2C9WB 4DK5A 4II3B 1RRBA 2KC1A 2C7MB 4WJQA 3L54A 1WRDB 1WH3A 1A5RA 4W9IA 1LFDA 3PZDA 4ZRIA 2CR5A 3QX1A 2N7DA 2G4DB 2G45B 2LVPA 2KLGA 1VD2A 2GBNA 2C60A 2MX2A 2KTRB 5E6NA 3UINB 2GMIC 2DHZA 2IO2B 1E7UA 4RM9A 2KK8A 4ICUA 4IW0A 1P3QU 2DZIA 2L05A 4W9GA 3VVWB 4IC7B 3AXCA 4HCPB 4ANUA 2JUOA 3HM3A 5J17A 3QJZA 1UD7A 1QZEA 3ZW3A 2BWFA 2DZMA 2NPTA 4KV2A 4EEWA 1WFYA 2XK5B 1WGRA 1WJ4A 2BKRB 3M95A 2G4SA 3ZUNA 4MGZE 1R4NI 4KIKB 4F8CB 3WANA 1ZGUB 2AL3A 3A1QB 3MHSD 4FBJB 5EDSA 2LXCA 3W1YA 3WAOA 5JH5C 3QQ8B 2BYVE 3HHMA 4I6PA 3B0AA 3ZNZB 1OEYA 3ZRCA 4IWPA 4GOCA 4NPNA 3A33B 1E90A 1YX6B 5D7GA 3VXWA 2IYDB 2LGXA 3ZO5B 1AARA 1X1MA 2NCNA 3QARA 3H7PB 3ZTCA 2L8JA 3QA8A 4WWNA 1WE6A 2NR2A 2LRWA 4GU2A 1ISNA 3KH0A 4M8NA 2MRPA 4WJNA 2KO3A 4KSLC 4G50A 4HWIB 1V49A 1UH6A 3UQBA 3APDA 1WGHA 1K8RB 2FAZA 4P7IA 3PRPB 4WAAA 4ICVA 1KJTA 2K25A 4LDTD 4GDLA 2N9PC 4FJZA 3K9OB 2V3SA 2KX0A 4RM8A 1J19A 4F1SA 2L7RA 2KJ6A 3W1SA 3ZTDA 4E71A 1JRUA 2WYQA 2Z0DB 4ZDVA 2LGYA 1R4MI 3AU5A 1E5WA 5KHOA 2L0TA 4XC2A 2KQSA 3ECIA 3JW0X 3KW5B 3N30A 3VUWA 3RUIB 4AJYB 1UGMA 1TTNA 2KNBA 1OGWA 1I42A 1EO6A 3EHVA 1D3ZA 1ZKHA 3NHEB 2UYZB 1WGGA 3O65B 3H1UA 3KYDD 1V81A 3M63B 5DCNA 3Q3FA 2BYFA 4AWJA 3H6NA 2MW5A 3BY4B 3ONSA 4CYEA 1WJ6A 3U8ZA 1GJZA 5DPTA 2AEHA 2MQJA 1M94A 1WE7A 3M62B 4ZYNA 3UQAA 5BO4B 1S1QB 4F7ZA 4MJSB 2KTRA 3APFA 4MGYE 3V60A 4BKGA 3RULA 3AULA 4BOSC 2MBOA 2MBEA 1UBIA 3V61A 2MBHA 2J7QB 2XK5A 3IBEA 3KUZA 5CHWA 4YL8A 5D94A 3DBHI 3QK0A 5FR6A 3PTFC 2JRHA 1OQYA 1V5TA 4J6IA 4KIKA 3ZVVA 1PQSA 1XT9B 4NJ6A 4BBNC 4HXDA 4BKSD 2K39A 4W9JA 4WWPA 3A1QA 5TR5A 1T0YA 4RMAA 1V6EA 3PLVA 4HK2A 3CMMB 3KYCD 2GBJA 2Z0EB 4GMVA 3NZUA 5G55A 3VUXA 1C3TA 4IUMB 4PYUA 1P98A 1UBQA 1V2YA 1WM3A 2K6QA 2KWUB 2LVOA 2N1VA 2JT4B 2M17A 3ML9A 3NZSA 4EUTA 3ML8A 2KJHB 3H7PA 3QC8B 4NAWB 4EOYA 3JVZX 3ZIMA 4WWOA 4KZ0A 5JZEB 5L95C 2NS5A 3PHWB 2OOBB 3VTWA 5J2RA 2N7EA 3IFWB 1WX9A 1EF5A 2EKEC 2Z59B 3VH3B 2HTHA 4GIVA 1ZW7A 5AZHA 2KZRA 3V6CB 4TKNA 5LXHA 2R2QA 1MG8A 3JSVB 3R7QA 3SDLC 1GNUA 3RYTA 2L3ZA 1TZ1A 2BF8B 2IBIB 2JRIB 1UZXB 2ASQA 1RFAA 4BVUC 2IO0B 4K7SA 4N9F4 3RZFA 1WZ3A 2K8CA 4PYZA 3RD2A 3S2AA 1KLVA 2M1MA 1NDDA 4ZRJA 2XBBC 1IPGA 3QIJA 3VFKA 2G3QB 2ZVNA 2OJRA 1EUVB 3UIOB 1H4RA 4W9DA 2PPHA 3VHTC 3UF8A 2KDFB 3PSEB 3PRMB 2WWZA 2REXA 4WJPA 1VCBA 4JIOU 1TBEA 3PHXB 3V6EB 4GN1A 2KHWB 2EMTA 4W9EA 4FHKA 3N3KB 2WDTB 2FCNA 4MM3A 2IY0B 4DHJB 5CTRC 3EC8A 2ZPYA 2JZ3B 1SIFA 3L08A 4DWFA 2VRRB 1V5OA 3DQVA 3DVNU 1WXVA 1C1YB 5E6OA 4BOZB 3LJ3A 2CHWA 2JVCA 2R2OA 4FN2A 4MJSA 3TBLD 2CKHB 2FNJB 4GDKB 3ENEA 3NS8A 3TMPB 3ZNID 5JHAA 2YVCA 1WR1A 1KM7A 2DENB 2M0XA 2WX1A 4NY0A 2J0KA 3VAWA 4GGQA 3VTVA 3R7RA 2O6VB 2MP2A 2RSUA 4AUQC 1P0RA 2K1FA 3RZWC 2NVUI 4WJOA 2CHZA 4KZCA 1OTRB 1UELA 2JWZA 2KQ7A 3D32A 3CSFA 3A9KA 3IG3A 4LJOB 4MGIE 4URKA 3KUCB 5DPWA 3B1LX 1WY8A 4XX5A 2CS4A 2AL6A 2N9EB 2N9XA 2JF5A 2O2VB 2KMCA 3N32A 2LZ6A 4BKSA 4HLEA 2K6DB 4TQ0A 1G6JA 4G0NB 3PT2B 4K7UA 2BYEA 2KFJA 4HCNB 2GBMA 4K1RB 4M0WB 4MSQB 1IYFA 2C5LC 2LJ5A 4KSKC 3DVGX 3ZNGC 4AOFA 3PREA 1TGZB 3DPDA 2LASA 1XQQA 2LUEA 3IHPC 2HE7A 4DBGA 3GZNI 2DZKA 4DHZE 2KKCA 2ZCBA 1S3SG 4FJYA 4GXBA 2MWSB 4DXAB 4MSMB 5DPSA 2IO1B 4W9LA 2RGFA 2RPQA 3WA0A 2GBKA 2MBQA 2GBRA 4FLHA 1E8YA 4MELA 5AZFA 1V86A 5D2MB 2BKFA 2BWES 2DAFA 4LCDE 4IM3A 4KDLB 3JSVA 2D11A 3L10B 4B6WA 1FXTB 3JYUA 5KHQA 2KVRA 3X23A 4TUUA 3PRZA 5G2NA 2D10A 3WALA 4NQLB 4E3CA 3AI5A 3QAQA 3PS6A 4M8MA 3L0WB 2DAJA 3AU4A 3HIZA 4GSWA 2J0MA 3DBSA 4II2B 3T9LA 4FULA 2L76A 3ZKJC 3ZRFA 4CHKA 2XEWA 3VUYA 4W9KA 2KOXA 2KLCA 2D2QA 5AZGA 2GOWA 5CHFA 2KDIA 4IWOA 4TQ1A 1LQBA 1XD3B 3T8MA 3DOWA 2JXXA 1WMHB 2UWQA 2V1YA 3CF6E 3MJWA 1WZ0A 3PGEA 3SHQA 4OVVA 1Q1OA 3EECA 3A4SC 3QWZB 1E8XA 4E74A 3RCZA 2NBUA 1J8CA 2DYMA 2JPHA 1E8ZA 4GDKA 1RAXA 2RD0A 3UGBB 1KOTA 4DDGD 4W9CA 3QHTA 2KDBA 2KMAA 4K81A 3R66C 2KXJA 1L2NA 4FADA 3ALBA 2LVQA 4IWQA 3I3TB 3DVNV 2O6VA 2MA9B 1I35A 2JZZA 2C7NB 2LD9A 1YIWA 3QCAA 2WX0A 4MH0E 1YJ1A 3VDZA 4ZRKA 3VQIA 3VH4B 1P1AA 2KFKB 3ZDMC 2A4ZA 4FA6A 2KD0A 3APCA 4I6NB 2O2VA 1WI0A 3KVFB 4MDKE 4FHJA 3TCAA 4CO7A 2A5UA 3M3JA 2LI5A 2ZEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGH A;  1Q5W B;  4ANW A;  3MTN B;  4JL9 A;  3B08 A;  2PE6 B;  3SU8 X;  1H8C A;  4NNJ B;  2NBW B;  2LGD A;  2N4F A;  3GOE A;  3PV1 A;  3PVL A;  5DPR A;  4DHJ D;  1E8W A;  1GG3 A;  4HVB A;  1WJN A;  2EMS A;  4JGH B;  4G3X B;  3A9J B;  3IVF A;  3DBR I;  3OJ4 B;  3U30 A;  4EZJ A;  4KDI C;  5C23 A;  4EFO A;  1EF1 A;  4B9K A;  2DYO A;  2YLM A;  4ANX A;  2LRU A;  2AYO B;  3RT3 B;  2ZNV C;  5JHB A;  2L00 B;  4I6L B;  3WAP A;  1U4A A;  3DCG A;  1WXM A;  2MSE D;  3LDZ E;  2M4N A;  4ANV A;  2LWP A;  1WM2 A;  3H9D A;  2KAN A;  4ASW C;  4HJK A;  2O6V D;  2FIF A;  2FID A;  2CHX A;  1BT0 A;  2KDE B;  3L16 A;  5C1Z A;  2C7H A;  2KC2 A;  2ZPN A;  2ZNV B;  2KWC A;  3EFU A;  2D07 B;  4DHZ B;  3V62 A;  1E7V A;  4AJW A;  3DVG Y;  3BIN A;  4EKU A;  2ZVO A;  2N1W A;  4EZK A;  5GMV A;  3NOB A;  3Q3J A;  3DDC B;  4NJ7 A;  1WR6 E;  2AWT A;  4PS8 A;  5E6P A;  1Z5S B;  4A20 A;  5HKH A;  5LXI B;  4BBN F;  2FUH B;  2FCQ A;  2QHO A;  4X57 B;  1WIA A;  4MGK E;  2HJ8 A;  5CHV C;  2KJR A;  3ZLZ A;  2ZJD A;  3R3M A;  2MBB B;  3H7S A;  1WMH A;  4LDT B;  4HPL B;  2L0F A;  3C0R B;  3OJ3 A;  4NAW A;  4B95 A;  2IO3 B;  3PLU A;  4XZ4 A;  4KVG B;  4HDO A;  4MEM A;  1Y8R C;  4HDQ A;  3ZDT A;  1SE9 A;  1YQB A;  2NPT B;  3CST A;  2I1J A;  4PS7 A;  5D6J B;  1F9J A;  1WX8 A;  2PE9 A;  5IAA C;  2ZCC A;  4PS3 A;  3U7D A;  1GC7 A;  1V80 A;  4TV3 A;  1RLF A;  4BKT A;  1CMX B;  1WX7 A;  2KTF A;  2B3A A;  2BPS A;  2J0J A;  3TL5 A;  3PPA A;  1P9D U;  3X0W A;  4IG7 B;  2KFK A;  1V9J A;  3A4R A;  2NBV B;  3HK0 A;  3ZNH B;  2KX3 A;  5L83 A;  4HPM B;  5LLI A;  1L7Y A;  4G11 A;  2IZV B;  4K7W A;  3VTU A;  3OAW A;  2PEA A;  2DYB A;  1WXS A;  2IY1 B;  4A3P A;  2PJH A;  2ZZP B;  2MLB A;  2I1K A;  2DX5 B;  2KN5 A;  3OLM D;  1IP9 A;  4OVU A;  2RR9 A;  3W1S C;  2FCM A;  3TJP A;  1NBF C;  4EZL A;  4A3O A;  5CX3 A;  2M8S A;  4GB9 A;  4BFR A;  1Z2M A;  4NQK E;  3L17 A;  1Q0W B;  2W9N A;  4GDL B;  1J0G A;  2BGF A;  2CU1 A;  2DZJ A;  1LXD A;  3A9J A;  2MP2 B;  3HM6 X;  4AP4 C;  1GC6 A;  1WYW B;  3L13 A;  1WJU A;  3SD5 A;  4JLC A;  2JY6 A;  2HD5 B;  2Y5B B;  1OEY J;  4DDI D;  3TIX A;  3DBL I;  2KWV B;  1WGD A;  2D3G A;  3KUD B;  1HE8 A;  4IM2 A;  3A9K B;  2V4L A;  1GUA B;  2FCS A;  4LJP B;  2LXA A;  3WAM A;  2K8B A;  1NI2 A;  1WGY A;  4W9H A;  1WXA A;  2MCN B;  4FJV B;  1YD8 U;  4WQO B;  3UIP B;  3WIM A;  1WF9 A;  5AEK B;  1LM8 B;  5IA7 A;  5J18 A;  1YX5 B;  4IM0 A;  3K9P B;  4JQW C;  4W9F A;  3P2B A;  2K8H A;  3NY5 A;  2C9W B;  4DK5 A;  4II3 B;  1RRB A;  2KC1 A;  2C7M B;  4WJQ A;  3L54 A;  1WRD B;  1WH3 A;  1A5R A;  4W9I A;  1LFD A;  3PZD A;  4ZRI A;  2CR5 A;  3QX1 A;  2N7D A;  2G4D B;  2G45 B;  2LVP A;  2KLG A;  1VD2 A;  2GBN A;  2C60 A;  2MX2 A;  2KTR B;  5E6N A;  3UIN B;  2GMI C;  2DHZ A;  2IO2 B;  1E7U A;  4RM9 A;  2KK8 A;  4ICU A;  4IW0 A;  1P3Q U;  2DZI A;  2L05 A;  4W9G A;  3VVW B;  4IC7 B;  3AXC A;  4HCP B;  4ANU A;  2JUO A;  3HM3 A;  5J17 A;  3QJZ A;  1UD7 A;  1QZE A;  3ZW3 A;  2BWF A;  2DZM A;  2NPT A;  4KV2 A;  4EEW A;  1WFY A;  2XK5 B;  1WGR A;  1WJ4 A;  2BKR B;  3M95 A;  2G4S A;  3ZUN A;  4MGZ E;  1R4N I;  4KIK B;  4F8C B;  3WAN A;  1ZGU B;  2AL3 A;  3A1Q B;  3MHS D;  4FBJ B;  5EDS A;  2LXC A;  3W1Y A;  3WAO A;  5JH5 C;  3QQ8 B;  2BYV E;  3HHM A;  4I6P A;  3B0A A;  3ZNZ B;  1OEY A;  3ZRC A;  4IWP A;  4GOC A;  4NPN A;  3A33 B;  1E90 A;  1YX6 B;  5D7G A;  3VXW A;  2IYD B;  2LGX A;  3ZO5 B;  1AAR A;  1X1M A;  2NCN A;  3QAR A;  3H7P B;  3ZTC A;  2L8J A;  3QA8 A;  4WWN A;  1WE6 A;  2NR2 A;  2LRW A;  4GU2 A;  1ISN A;  3KH0 A;  4M8N A;  2MRP A;  4WJN A;  2KO3 A;  4KSL C;  4G50 A;  4HWI B;  1V49 A;  1UH6 A;  3UQB A;  3APD A;  1WGH A;  1K8R B;  2FAZ A;  4P7I A;  3PRP B;  4WAA A;  4ICV A;  1KJT A;  2K25 A;  4LDT D;  4GDL A;  2N9P C;  4FJZ A;  3K9O B;  2V3S A;  2KX0 A;  4RM8 A;  1J19 A;  4F1S A;  2L7R A;  2KJ6 A;  3W1S A;  3ZTD A;  4E71 A;  1JRU A;  2WYQ A;  2Z0D B;  4ZDV A;  2LGY A;  1R4M I;  3AU5 A;  1E5W A;  5KHO A;  2L0T A;  4XC2 A;  2KQS A;  3ECI A;  3JW0 X;  3KW5 B;  3N30 A;  3VUW A;  3RUI B;  4AJY B;  1UGM A;  1TTN A;  2KNB A;  1OGW A;  1I42 A;  1EO6 A;  3EHV A;  1D3Z A;  1ZKH A;  3NHE B;  2UYZ B;  1WGG A;  3O65 B;  3H1U A;  3KYD D;  1V81 A;  3M63 B;  5DCN A;  3Q3F A;  2BYF A;  4AWJ A;  3H6N A;  2MW5 A;  3BY4 B;  3ONS A;  4CYE A;  1WJ6 A;  3U8Z A;  1GJZ A;  5DPT A;  2AEH A;  2MQJ A;  1M94 A;  1WE7 A;  3M62 B;  4ZYN A;  3UQA A;  5BO4 B;  1S1Q B;  4F7Z A;  4MJS B;  2KTR A;  3APF A;  4MGY E;  3V60 A;  4BKG A;  3RUL A;  3AUL A;  4BOS C;  2MBO A;  2MBE A;  1UBI A;  3V61 A;  2MBH A;  2J7Q B;  2XK5 A;  3IBE A;  3KUZ A;  5CHW A;  4YL8 A;  5D94 A;  3DBH I;  3QK0 A;  5FR6 A;  3PTF C;  2JRH A;  1OQY A;  1V5T A;  4J6I A;  4KIK A;  3ZVV A;  1PQS A;  1XT9 B;  4NJ6 A;  4BBN C;  4HXD A;  4BKS D;  2K39 A;  4W9J A;  4WWP A;  3A1Q A;  5TR5 A;  1T0Y A;  4RMA A;  1V6E A;  3PLV A;  4HK2 A;  3CMM B;  3KYC D;  2GBJ A;  2Z0E B;  4GMV A;  3NZU A;  5G55 A;  3VUX A;  1C3T A;  4IUM B;  4PYU A;  1P98 A;  1UBQ A;  1V2Y A;  1WM3 A;  2K6Q A;  2KWU B;  2LVO A;  2N1V A;  2JT4 B;  2M17 A;  3ML9 A;  3NZS A;  4EUT A;  3ML8 A;  2KJH B;  3H7P A;  3QC8 B;  4NAW B;  4EOY A;  3JVZ X;  3ZIM A;  4WWO A;  4KZ0 A;  5JZE B;  5L95 C;  2NS5 A;  3PHW B;  2OOB B;  3VTW A;  5J2R A;  2N7E A;  3IFW B;  1WX9 A;  1EF5 A;  2EKE C;  2Z59 B;  3VH3 B;  2HTH A;  4GIV A;  1ZW7 A;  5AZH A;  2KZR A;  3V6C B;  4TKN A;  5LXH A;  2R2Q A;  1MG8 A;  3JSV B;  3R7Q A;  3SDL C;  1GNU A;  3RYT A;  2L3Z A;  1TZ1 A;  2BF8 B;  2IBI B;  2JRI B;  1UZX B;  2ASQ A;  1RFA A;  4BVU C;  2IO0 B;  4K7S A;  4N9F 4;  3RZF A;  1WZ3 A;  2K8C A;  4PYZ A;  3RD2 A;  3S2A A;  1KLV A;  2M1M A;  1NDD A;  4ZRJ A;  2XBB C;  1IPG A;  3QIJ A;  3VFK A;  2G3Q B;  2ZVN A;  2OJR A;  1EUV B;  3UIO B;  1H4R A;  4W9D A;  2PPH A;  3VHT C;  3UF8 A;  2KDF B;  3PSE B;  3PRM B;  2WWZ A;  2REX A;  4WJP A;  1VCB A;  4JIO U;  1TBE A;  3PHX B;  3V6E B;  4GN1 A;  2KHW B;  2EMT A;  4W9E A;  4FHK A;  3N3K B;  2WDT B;  2FCN A;  4MM3 A;  2IY0 B;  4DHJ B;  5CTR C;  3EC8 A;  2ZPY A;  2JZ3 B;  1SIF A;  3L08 A;  4DWF A;  2VRR B;  1V5O A;  3DQV A;  3DVN U;  1WXV A;  1C1Y B;  5E6O A;  4BOZ B;  3LJ3 A;  2CHW A;  2JVC A;  2R2O A;  4FN2 A;  4MJS A;  3TBL D;  2CKH B;  2FNJ B;  4GDK B;  3ENE A;  3NS8 A;  3TMP B;  3ZNI D;  5JHA A;  2YVC A;  1WR1 A;  1KM7 A;  2DEN B;  2M0X A;  2WX1 A;  4NY0 A;  2J0K A;  3VAW A;  4GGQ A;  3VTV A;  3R7R A;  2O6V B;  2MP2 A;  2RSU A;  4AUQ C;  1P0R A;  2K1F A;  3RZW C;  2NVU I;  4WJO A;  2CHZ A;  4KZC A;  1OTR B;  1UEL A;  2JWZ A;  2KQ7 A;  3D32 A;  3CSF A;  3A9K A;  3IG3 A;  4LJO B;  4MGI E;  4URK A;  3KUC B;  5DPW A;  3B1L X;  1WY8 A;  4XX5 A;  2CS4 A;  2AL6 A;  2N9E B;  2N9X A;  2JF5 A;  2O2V B;  2KMC A;  3N32 A;  2LZ6 A;  4BKS A;  4HLE A;  2K6D B;  4TQ0 A;  1G6J A;  4G0N B;  3PT2 B;  4K7U A;  2BYE A;  2KFJ A;  4HCN B;  2GBM A;  4K1R B;  4M0W B;  4MSQ B;  1IYF A;  2C5L C;  2LJ5 A;  4KSK C;  3DVG X;  3ZNG C;  4AOF A;  3PRE A;  1TGZ B;  3DPD A;  2LAS A;  1XQQ A;  2LUE A;  3IHP C;  2HE7 A;  4DBG A;  3GZN I;  2DZK A;  4DHZ E;  2KKC A;  2ZCB A;  1S3S G;  4FJY A;  4GXB A;  2MWS B;  4DXA B;  4MSM B;  5DPS A;  2IO1 B;  4W9L A;  2RGF A;  2RPQ A;  3WA0 A;  2GBK A;  2MBQ A;  2GBR A;  4FLH A;  1E8Y A;  4MEL A;  5AZF A;  1V86 A;  5D2M B;  2BKF A;  2BWE S;  2DAF A;  4LCD E;  4IM3 A;  4KDL B;  3JSV A;  2D11 A;  3L10 B;  4B6W A;  1FXT B;  3JYU A;  5KHQ A;  2KVR A;  3X23 A;  4TUU A;  3PRZ A;  5G2N A;  2D10 A;  3WAL A;  4NQL B;  4E3C A;  3AI5 A;  3QAQ A;  3PS6 A;  4M8M A;  3L0W B;  2DAJ A;  3AU4 A;  3HIZ A;  4GSW A;  2J0M A;  3DBS A;  4II2 B;  3T9L A;  4FUL A;  2L76 A;  3ZKJ C;  3ZRF A;  4CHK A;  2XEW A;  3VUY A;  4W9K A;  2KOX A;  2KLC A;  2D2Q A;  5AZG A;  2GOW A;  5CHF A;  2KDI A;  4IWO A;  4TQ1 A;  1LQB A;  1XD3 B;  3T8M A;  3DOW A;  2JXX A;  1WMH B;  2UWQ A;  2V1Y A;  3CF6 E;  3MJW A;  1WZ0 A;  3PGE A;  3SHQ A;  4OVV A;  1Q1O A;  3EEC A;  3A4S C;  3QWZ B;  1E8X A;  4E74 A;  3RCZ A;  2NBU A;  1J8C A;  2DYM A;  2JPH A;  1E8Z A;  4GDK A;  1RAX A;  2RD0 A;  3UGB B;  1KOT A;  4DDG D;  4W9C A;  3QHT A;  2KDB A;  2KMA A;  4K81 A;  3R66 C;  2KXJ A;  1L2N A;  4FAD A;  3ALB A;  2LVQ A;  4IWQ A;  3I3T B;  3DVN V;  2O6V A;  2MA9 B;  1I35 A;  2JZZ A;  2C7N B;  2LD9 A;  1YIW A;  3QCA A;  2WX0 A;  4MH0 E;  1YJ1 A;  3VDZ A;  4ZRK A;  3VQI A;  3VH4 B;  1P1A A;  2KFK B;  3ZDM C;  2A4Z A;  4FA6 A;  2KD0 A;  3APC A;  4I6N B;  2O2V A;  1WI0 A;  3KVF B;  4MDK E;  4FHJ A;  3TCA A;  4CO7 A;  2A5U A;  3M3J A;  2LI5 A;  2ZEQ A; 
#chains in the Genus database with same CATH topology
 3MTN B;  4C80 A;  2PE6 B;  2EKI A;  1KLG D;  3GOE A;  1E8W A;  2J4X A;  3A9J B;  4EZJ A;  4KDI C;  2ACZ B;  2FBW B;  4I6L B;  1SE4 A;  1U4A A;  1WXM A;  2MSE D;  2M4N A;  2ZW0 A;  2RPV A;  2BS3 B;  2QMT A;  1EWY C;  4HJK A;  2O6V D;  2KDE B;  1KLU D;  2KC2 A;  2D07 B;  1D5Z C;  1ZE3 D;  1T0S C;  2AQ2 B;  1WR6 E;  4PS8 A;  1Z5S B;  5HKH A;  5LXI B;  2UU7 A;  2JU6 X;  5H8Y E;  1IBX A;  4X57 B;  3Q6B A;  4MGK E;  5D3D A;  3TEX A;  3DHH C;  2L0F A;  1KTK A;  2AQ1 B;  2KYW A;  4NAW A;  4XZ4 A;  2QIL A;  4MEM A;  4KKI A;  1C79 A;  2NPT B;  1TKG A;  4YTP B;  1MVK A;  1F9J A;  1WX8 A;  2PE9 A;  2ZCC A;  3U7D A;  2KTF A;  2BPS A;  2CJO A;  1P9D U;  3HK0 A;  3B9J A;  2BB6 A;  2IZV B;  4K7W A;  3VTU A;  2PEA A;  2DYB A;  5EE3 A;  4O1N A;  2VZK B;  2E6X A;  2I1K A;  2KN5 A;  1IP9 A;  2JX5 A;  3W1S C;  2FCM A;  1NBF C;  1MI0 A;  5CX3 A;  2SEB D;  3IAM 1;  2Q5W D;  4GB9 A;  4LNK A;  1UGJ A;  2D5G A;  3I9V 1;  4AP4 C;  2MP2 B;  3SD5 A;  2HD5 B;  1VJK A;  3E9S A;  1OEY J;  1M4V A;  1WGD A;  2D3G A;  4KX6 B;  4MAC A;  1HE8 A;  1GUA B;  2V3N A;  1WGY A;  3GB1 A;  4WQO B;  4IDI A;  1LM8 B;  5J18 A;  1FD6 A;  1A70 A;  5IKC M;  1XO3 A;  5IN7 A;  3RN9 C;  2K8H A;  1RRB A;  4K3C A;  2C7M B;  1D6E C;  1A5R A;  2M0A A;  4YT0 B;  3QX1 A;  3RNF C;  2MX2 A;  1DOX A;  1XLO A;  1GOZ A;  3T3N A;  2DZI A;  4W9G A;  4IC7 B;  4HCP B;  4RGM A;  1UD7 A;  2K3U A;  2IND C;  2DZM A;  1TY0 A;  1I4X A;  4EEW A;  5HHD G;  2XK5 B;  2BKR B;  3DHG C;  2WXQ A;  4F8C B;  4XGA B;  1HTO A;  2PMV A;  3Q3N C;  5EDS A;  3QQ8 B;  3B0A A;  1F1H A;  1JW9 D;  1E90 A;  3VXW A;  4A9A A;  1AAR A;  4EE2 A;  1I4H A;  3ZTC A;  1WE6 A;  1L6U A;  5LNK 1;  4GU2 A;  3KH0 A;  4M8N A;  4DQO C;  3APD A;  1K8R B;  2HDE A;  4LDT D;  2KWD A;  2WXM A;  1K51 A;  4US8 A;  2HTM E;  1J19 A;  4R3D A;  1AWD A;  1DGJ A;  2WP9 B;  2Z0D B;  3DBR B;  2OJW A;  2D3C A;  3VUW A;  2FE8 A;  5FKA C;  1FO4 A;  1XLQ A;  3EHV A;  3VRA B;  5D3I B;  2GI9 A;  1LGR A;  4RH6 A;  5BMI A;  3O65 B;  5DCN A;  3FAH A;  3BY4 B;  1V1P B;  1K52 A;  1WJ6 A;  5DPT A;  2MQJ A;  1M94 A;  3M62 B;  2PTL A;  1FM0 D;  3APF A;  4MGY E;  5I4D A;  3LYY A;  1R7S A;  2V9H A;  3IBE A;  1EU3 A;  1J7B A;  5CHW A;  1FEH A;  3PTF C;  1OQY A;  1D5X C;  4KIK A;  4NJ6 A;  4BKS D;  3CWI A;  3VR8 B;  1N61 A;  1TY2 A;  1T0Y A;  2JZP A;  3PLV A;  1ET9 A;  1PDX A;  2ONQ A;  4US9 A;  2Z0E B;  3VUX A;  3KUC B;  1PFD A;  2N1V A;  2K6Q A;  2Y3A A;  4A6Q A;  2WDR B;  3NZS A;  1HEZ E;  3H7P A;  4KZ0 A;  5IOI A;  1WX9 A;  2Z59 B;  1ZW7 A;  5AZH A;  3BVG A;  3AE3 B;  3R7Q A;  2SAK A;  3L4P A;  3C8Y A;  2IBI B;  3H8H A;  3BVZ A;  4K7S A;  1WZ3 A;  3MC8 A;  3DBL B;  4ZRJ A;  3VFK A;  1IPG A;  2IGH A;  3QIJ A;  4PK1 A;  2ZVN A;  2OJR A;  3RNA C;  1H4R A;  3VHT C;  3TSS A;  3NS1 A;  2WWZ A;  1VCB A;  4JIO U;  3WCQ A;  1TBE A;  3PHX B;  3V6E B;  2KVZ A;  4DHJ B;  2FCN A;  2IY0 B;  5CTR C;  3GE8 C;  1KRH A;  2ZPY A;  2JZ3 B;  4BZA A;  1V5O A;  4UDU C;  4BOZ B;  4MJS A;  2FNJ B;  3NS8 A;  4REZ A;  5JHA A;  2GRI A;  3TEW A;  2RDG A;  2M0X A;  2J0K A;  3VTV A;  4GGQ A;  3R7R A;  1JWM D;  1P0R A;  3DWG C;  2D3B A;  4WH4 A;  2CHZ A;  4MGI E;  2LGS A;  1SBB B;  2N9X A;  2ON8 A;  4BKS A;  2K6D B;  1R4N B;  5EE1 A;  2BYE A;  4HCN B;  2GBM A;  4K1R B;  4M0W B;  1IYF A;  3DVG X;  4JX1 C;  3PRE A;  2LAS A;  2LUE A;  3BII D;  5BMG A;  4OVZ A;  4DHZ E;  4FJY A;  1FXI A;  1V1O A;  4DXA B;  1UF0 A;  2XNA C;  4MSM B;  4W9L A;  2RPQ A;  2GBK A;  2Y5P A;  2MBQ A;  4FLH A;  1E8Y A;  4MEL A;  4KDL B;  2E3T A;  4JWS C;  4B6W A;  3JYU A;  3PRZ A;  4E3C A;  4NQL B;  2WXI A;  3QAQ A;  3PS6 A;  4M8M A;  3HIZ A;  4GSW A;  1KH0 A;  2L83 A;  2J52 A;  2QDF A;  3RI7 C;  1YN4 A;  1TYG B;  2XEW A;  2KLC A;  4RFB A;  1RFK A;  3R8B A;  4IWO A;  4TQ1 A;  1LQB A;  3T8M A;  2KDM A;  3DOW A;  1UUP A;  4LNO A;  1L0X B;  2WS3 B;  2KT7 A;  1HA5 A;  3C19 A;  4L23 A;  3Q3M C;  3RCZ A;  5TSS A;  2X8X X;  3RFZ B;  4DDG D;  3P42 A;  1WYG A;  5IO9 A;  2KXJ A;  1J7A A;  3UI3 A;  2LD9 A;  5AUI A;  2WX0 A;  1P1A A;  1VRA B;  2GLS A;  1OFF A;  1WI0 A;  3MHZ A;  4FHJ A;  2LI5 A;  2D2Q A;  2ZEQ A;  1Q5W B;  4JL9 A;  4LTU A;  3DHI C;  3SU8 X;  1H8C A;  4NNJ B;  2NBW B;  1ZDV A;  2N4F A;  3PVL A;  2QCZ A;  1TJE A;  5DPR A;  4JGH B;  1CZP A;  3IVF A;  3OJ4 B;  3EUB 2;  2I38 A;  4EFO A;  2LGI A;  1C76 A;  4ANX A;  1QLB B;  2LRU A;  2ZNV C;  5JHB A;  3AE8 B;  3WAP A;  3DCG A;  3LDZ E;  1JAL A;  2LWP A;  1K53 A;  1SSN A;  2FIF A;  1BT0 A;  2M19 A;  2QIE B;  3L16 A;  5C1Z A;  2C7H A;  2KWC A;  3AEA B;  3DVG Y;  1K50 A;  3NVV A;  2LMC A;  2XN9 C;  2ZVO A;  2B76 B;  2AQ3 B;  2V0G A;  3DDC B;  3HVD A;  5E6P A;  1RWS A;  2QHO A;  4ARC A;  1WSP A;  1L4D B;  2LHD A;  2MBB B;  4JWU C;  4YSY B;  3C0R B;  1ET6 A;  3P4P B;  4KVG B;  3FKY A;  3ZDT A;  4HDQ A;  1SE9 A;  1YQB A;  1FMA D;  5IAA C;  4PS3 A;  4TV3 A;  2H89 B;  4BKT A;  4KGT A;  3X0W A;  2KFK A;  1V9J A;  3A4R A;  3ZNH B;  1V97 A;  3EGR A;  3OAW A;  1NYR A;  2ZZP B;  3OLM D;  3TJP A;  4A3O A;  2M8S A;  4BFR A;  1Z2M A;  3L17 A;  2R61 A;  1YJI A;  2W9N A;  4GDL B;  1J0G A;  2MHJ A;  2BGF A;  2CU1 A;  2L32 A;  3A9J A;  3HM6 X;  1P7E A;  2BT6 A;  3GS2 A;  1GC6 A;  3BVM A;  1WJU A;  4JLC A;  3Q8A A;  3TIX A;  4XE0 A;  3VRB B;  4LJP B;  3N1X C;  1NI2 A;  2KN4 A;  3WIM A;  4OZB A;  5AEK B;  2W54 A;  1YX5 B;  4WWM A;  3K9P B;  3KLS X;  4JQW C;  4HEA 1;  4ARI A;  1T0R C;  4KGR A;  4DK5 A;  1LFD A;  2PLP A;  2G4D B;  2G45 B;  2LVP A;  2KLG A;  2C60 A;  2WXH A;  2Z8L A;  5E6N A;  3ZQ4 A;  2DHZ A;  2JXT A;  2IO2 B;  2WXK A;  1E7U A;  1XEE A;  2KK8 A;  1P3Q U;  2L05 A;  2INP E;  2QC8 A;  3P1M A;  4ITK A;  1SB3 C;  4AS1 A;  1QZE A;  2NPT A;  2RMM A;  1WGR A;  1WJ4 A;  2G4S A;  1PYW D;  2J42 A;  4RGO S;  4FBJ B;  1E7P B;  3ZNZ B;  4N6E B;  1F77 A;  4XWW A;  4USA A;  5D7G A;  2LGX A;  3ZJV A;  5BMH A;  2NR2 A;  2MRP A;  4WJN A;  2KO3 A;  4YWG G;  1V49 A;  1UH6 A;  1YJJ A;  1SF0 A;  3PRP B;  4WAA A;  1MG4 A;  2EEL A;  4F1S A;  1HQR D;  2K5P A;  2ZW1 A;  3ZTD A;  1FIQ A;  1JRU A;  2LGY A;  3AU5 A;  5KHO A;  2L0T A;  4AJY B;  3JW0 X;  3N30 A;  3RUI B;  2IGG A;  2WXG A;  2KNB A;  3AE5 B;  1I42 A;  1D3Z A;  1ZKH A;  3NHE B;  1TS3 A;  4LNI A;  4HRS A;  1WGG A;  4MH8 A;  1I4P A;  4AWJ A;  2QEJ C;  3H6N A;  2MW5 A;  4MM3 B;  2K0P A;  1ZPS A;  1YQ4 B;  1TZO A;  2AEH A;  2QSD A;  1WE7 A;  3AM9 A;  4ZYN A;  3UQA A;  1L5P A;  4F7Z A;  4LNF A;  2N7J A;  3HVZ A;  3RUL A;  1P7F A;  2MBO A;  3BYT B;  1E0Z A;  2MBH A;  4FXC A;  3SFE B;  2XK5 A;  3KUZ A;  5D94 A;  5HI1 A;  3DBH I;  3QK0 A;  5FR6 A;  3AE7 B;  3AED B;  1N5X A;  3SR6 A;  4BBN C;  4D2K A;  4W9J A;  4WWP A;  5TR5 A;  3AN1 A;  1V6E A;  2AX5 A;  4HK2 A;  2K22 A;  1L0V B;  3CMM B;  5C2T B;  4TMA B;  2I2Y A;  1C3T A;  3LB8 C;  3NZU A;  4IUM B;  2DLB A;  4PYU A;  1UBQ A;  1WM3 A;  3AE4 B;  3R2T A;  4NAW B;  3EFC A;  3W5U B;  3ZIM A;  1EWC A;  5JZE B;  1WGK A;  2OOB B;  5J2R A;  2LFI A;  4C7Y A;  1EF5 A;  2EKE C;  2MH7 A;  1PGA A;  1T3Q A;  5EE0 A;  3JSV B;  4XDD A;  1JWB D;  1NI3 A;  5BYQ A;  2ASQ A;  1TT5 B;  3RZF A;  2K8C A;  2M1M A;  3IT4 B;  2WXN A;  2XBB C;  1JCK B;  1TS2 A;  2PPH A;  3DWM A;  3PRM B;  2NTT A;  4ZHO A;  2WU2 B;  2KHW B;  1SEB D;  4OZC A;  1V1P A;  2QJL A;  3AV8 A;  3L08 A;  4DWF A;  2VRR B;  3DQV A;  3DVN U;  3VR9 B;  1WXV A;  1DOY A;  2JVC A;  4FN2 A;  2CKH B;  3AMZ A;  1YN3 A;  3ZXV A;  2MJ3 A;  2DEN B;  2O6V B;  2RSU A;  3RZW C;  2NVU I;  1OTR B;  3Q14 C;  3LXF A;  3D32 A;  3A9K A;  1HTQ A;  3B1L X;  2LHE A;  1WY8 A;  4XX5 A;  2CS4 A;  2N9E B;  2O2V B;  2JF5 A;  2KMC A;  3N32 A;  4YSZ B;  1G6J A;  4A55 A;  1ZP0 B;  4KSK C;  4C00 A;  1SE3 A;  4AOF A;  1TGZ B;  2PKO A;  2L1A A;  1ZOY B;  2ZCB A;  4GXB A;  2BB5 A;  2BYT A;  1N63 A;  5DPS A;  2RGF A;  2GBR A;  3AE9 B;  2BKF A;  2DAF A;  4IM3 A;  1FFV A;  2M56 B;  3P4S B;  2WXF A;  5KHQ A;  2KVR A;  4TUU A;  2D10 A;  4OHJ A;  2WGS A;  2DAJ A;  4L2Y A;  4II2 B;  3T9L A;  3ZKJ C;  3MC0 B;  5MPO A;  3ZJU A;  2JWU A;  5AZG A;  1JRP A;  1XD3 B;  3Q2A C;  3AEB B;  2WXJ A;  1WMH B;  3PGE A;  1WZ0 A;  3EEC A;  4HJG E;  1WRI A;  1E8X A;  1L6V A;  4C56 C;  4E74 A;  4P1C C;  1TIF A;  1J8C A;  1I4G A;  4ZRP A;  1KOT A;  3QHT A;  2KMA A;  3R66 C;  2LVQ A;  3I3T B;  2MA9 B;  2JZZ A;  2WDV B;  3VDZ A;  3QCA A;  4MH0 E;  1YJ1 A;  3VQI A;  3VH4 B;  1KF6 B;  3ZDM C;  2A4Z A;  4ZOH C;  3RMK C;  2Y5C A;  4YTM B;  4RCO A;  2PVO D;  3NUH B;  4CO7 A;  2A5U A;  3I5J C;  4ANW A;  2INN E;  5IP4 D;  4LK0 M;  4BAX A;  1TKY A;  2LJI A;  1GG3 A;  3AEC B;  5C3J B;  1ZXI A;  1N5W A;  3DBR I;  4HKQ A;  3IAS 1;  1PUT A;  2RDB C;  1EF1 A;  2DYO A;  2AYO B;  1RYJ A;  2JSV X;  1WM2 A;  1TS5 A;  3RNE C;  2CHX A;  1N6Z A;  4DHZ B;  4M00 A;  1E7V A;  4AJW A;  1C4A A;  3BIN A;  4EKU A;  2N1W A;  5GMV A;  4QAY A;  3HRD D;  3Q3J A;  3RNC C;  4NJ7 A;  4A20 A;  1CQV A;  2FUH B;  1J7C A;  1GAQ B;  2HJ8 A;  1DOI A;  3ZLZ A;  3R3M A;  3H7S A;  4LDT B;  4HPL B;  1VDV A;  3OJ3 A;  1FFU A;  2IO3 B;  1XF5 L;  4RF1 A;  3CST A;  3MFG A;  1GC7 A;  1V80 A;  1WX7 A;  1C9F A;  3SEB A;  3NVW A;  1MHX A;  2WXP A;  3PPA A;  1AW7 A;  1KFY B;  1VZ6 A;  1ZDX A;  2KX3 A;  5L83 A;  5LLI A;  2IGD A;  4G11 A;  1R4M B;  3B2F A;  4GLS C;  4YTN B;  4OVU A;  4WUR A;  1FRD A;  5EE9 A;  4NQK E;  1Q0W B;  2BS4 B;  2BVC A;  2DZJ A;  4MT5 A;  2WU5 B;  1GPX A;  2JY6 A;  3O13 A;  2Y5B B;  4DDI D;  3GZN B;  3DBL I;  2KWV B;  3KUD B;  2CU3 A;  2W3S A;  5JXV A;  2CJN A;  3WAM A;  2MCN B;  1B1Z A;  4K3B A;  1E6E B;  1WF9 A;  3ZYY X;  5IA7 A;  3AE6 B;  1HZ6 A;  3NVZ A;  3P2B A;  4CQN A;  2C9W B;  4II3 B;  2KC1 A;  5FK9 C;  1WH3 A;  3CIR B;  1HZ5 A;  4ZRI A;  2BW2 A;  1WWT A;  1UWX A;  2GBN A;  4N59 A;  2KTR B;  2GMI C;  1F2R I;  4IW0 A;  2VH2 A;  2BTE A;  4ANU A;  3HUI A;  1ZUD 2;  2JYE A;  1DYQ A;  3NJT A;  3GE3 C;  2BWF A;  3N9Y C;  4ZYS A;  1MHH E;  3R2I A;  4MGZ E;  1R4N I;  2AL3 A;  3A1Q B;  1GB4 A;  1F0Z A;  1Q10 A;  2LXC A;  3W1Y A;  3WAO A;  3EA6 A;  1YMH E;  3HHM A;  3ZRC A;  1OEY A;  4P6V F;  1FNU A;  4IWP A;  4NPN A;  3A33 B;  5HFY A;  1N62 A;  1X1M A;  2BBC A;  2NCN A;  3QAR A;  4WWN A;  4IKG A;  1SIJ A;  4KSL C;  3UQB A;  1WGH A;  2FAZ A;  4NJC A;  1KJT A;  4KGS A;  3NVY A;  4GDL A;  2N9P C;  3J9C A;  3K9O B;  2V3S A;  4RM8 A;  2WXR A;  4ZDV A;  2WYQ A;  1R4M I;  3RNB C;  3ECI A;  2DNF A;  4JPS A;  4TSS A;  1OGW A;  1XCQ L;  1CK1 A;  2UYZ B;  2WLB A;  3W9C B;  2K9X A;  1ACC A;  1XCT L;  3ONS A;  2VZK D;  3U8Z A;  1YNT E;  2WXO A;  4P1B C;  3Q8F A;  2J53 A;  4BKG A;  4HPP A;  4BOS C;  2MBE A;  1UBI A;  1TKE A;  1T0Q C;  3V61 A;  2PW9 A;  2J7Q B;  1PQS A;  1XT9 B;  3P63 A;  4XYC A;  2K39 A;  2W55 A;  2H88 B;  4C7Z A;  2GBJ A;  1RM6 C;  5G55 A;  2LVO A;  4S0R A;  2JT4 B;  3ML8 A;  2KJH B;  4EOY A;  2V4I B;  2W82 A;  4WWO A;  5L95 C;  2NS5 A;  3PHW B;  3IFW B;  3MJ5 A;  2WNM A;  1AN8 A;  2HTH A;  2MJD A;  4WQM A;  1QOA A;  3V6C B;  4TKN A;  5LXH A;  1MG8 A;  5G5G A;  2BQQ A;  1IGD A;  3BZD B;  1TZ1 A;  2BF8 B;  2JRI B;  2RDH A;  1I4R A;  1IGC A;  3S2A A;  1KLV A;  3I57 A;  3IXS A;  2KQ4 X;  2G3Q B;  2GB1 A;  3UIO B;  4S17 A;  2KDF B;  3PSE B;  2REX A;  4C4V B;  4JE3 B;  1NEN B;  2EMT A;  4FHK A;  3N3K B;  2WDT B;  4MM3 A;  3AB5 A;  3EC8 A;  3ABV B;  1ENF A;  1F2R C;  3FIL B;  3BWU D;  1C1Y B;  5E6O A;  3LJ3 A;  2CHW A;  2R2O A;  3TBL D;  4GDK B;  2N0S B;  4LLG M;  1WR1 A;  1KM7 A;  1SE2 A;  1XLN A;  1NVI D;  2MP2 A;  1BXT A;  1JML A;  4WJO A;  1UEL A;  4URK A;  4LJO B;  1VZ8 A;  5DPW A;  1YQ3 B;  2AL6 A;  4HLE A;  3AEF B;  2LZ6 A;  1I7H A;  4TQ0 A;  4G0N B;  3PT2 B;  4K7U A;  1PGX A;  1STE A;  2KFJ A;  4MSQ B;  5H92 C;  2C5L C;  2LJ5 A;  2LEK A;  3DPD A;  1XQQ A;  1SXT A;  3IHP C;  4DBG A;  2DZK A;  2KKC A;  2N9L A;  2IO1 B;  4ACF A;  1JQ4 A;  3PO0 A;  1FXA A;  5D2M B;  3JSV A;  4KKJ A;  2D11 A;  3L10 B;  1FXT B;  1QOF A;  2V3P A;  5G2N A;  1EM7 A;  3WAL A;  3B2G A;  3AI5 A;  4FUL A;  2L76 A;  4Q2J A;  3ZRF A;  4CHK A;  1IBX B;  2KDI A;  1MPE A;  3SHQ A;  3CF6 E;  3MJW A;  3PZ8 A;  1Q1O A;  3QWZ B;  1SJH D;  2NBU A;  2JPH A;  1VLB A;  1RAX A;  2RD0 A;  1QQR A;  3UGB B;  3U7Z A;  4XWT A;  1L2N A;  3NRZ A;  3ZJT A;  2O6V A;  3TUO A;  3KWL A;  5AUK A;  2NMQ A;  1I35 A;  2C7N B;  2WQY B;  4ZRK A;  3AEG B;  1E10 A;  1T5X D;  1N60 A;  1QT9 A;  1L4Z B;  2O2V A;  3KVF B;  4MDK E;  3TCA A;  3N20 C;  1SGH A;  3B08 A;  2LGD A;  3PV1 A;  4DHJ D;  1FPY A;  4HVB A;  1WJN A;  2EMS A;  4G3X B;  2BS2 B;  1MFW A;  3U30 A;  5C23 A;  5GXG B;  4B9K A;  2YLM A;  1XLP A;  1JRO A;  3RT3 B;  4RNA A;  3N1Z C;  2L00 B;  4HRO A;  3AEE B;  4ANV A;  2FUG 1;  3H9D A;  3NG0 A;  2NTS A;  2WXL A;  5BYR A;  2KAN A;  4ASW C;  2FID A;  2IJ0 A;  3ETR A;  2ZPN A;  2ZNV B;  3EFU A;  3V62 A;  1TS4 A;  4EZK A;  3NOB A;  1FCL A;  3U4E G;  1D5M C;  4YXD B;  3KWV A;  2YEP F;  2AWT A;  3W2D A;  4BBN F;  4WIP A;  2FCQ A;  3ZXR A;  1WIA A;  5CHV C;  2KJR A;  2KMM A;  2ZJD A;  1V8C A;  4M02 A;  3V3X A;  1WMH A;  2PIA A;  1QOB A;  2D3A A;  2N9K A;  4B95 A;  1BUI C;  4L1B A;  3PLU A;  4HDO A;  2WHI A;  4B0E A;  1Y8R C;  2I1J A;  4PS7 A;  2OED A;  2PVG C;  5D6J B;  3AE2 B;  3OG5 A;  1RLF A;  1CMX B;  3TL5 A;  2B3A A;  2J0J A;  4IG7 B;  3OWE B;  2NBV B;  1BML C;  4NAM A;  2MJE A;  4HPM B;  1L7Y A;  4M01 A;  1PGB A;  5E6J A;  1WXS A;  2IY1 B;  3AH7 A;  2PJH A;  4A3P A;  2INC C;  2MLB A;  1WXQ A;  2DX5 B;  3AE1 B;  1T6B X;  2RR9 A;  4EZL A;  2MEK A;  1XXG A;  2OHF A;  4H2A A;  5T8I A;  1LXD A;  4PT5 A;  1WYW B;  3L13 A;  3Q8C A;  2G1E A;  4IM2 A;  3A9K B;  3TEY A;  2V4L A;  2FCS A;  2LXA A;  2K8B A;  1ZXH A;  4W9H A;  1WXA A;  4FJV B;  1YD8 U;  2G9H D;  3UIP B;  4NZL B;  1JWS D;  4IM0 A;  4W9F A;  1C4P A;  3NY5 A;  1MJD A;  4WJQ A;  3L54 A;  1WRD B;  4W9I A;  3PZD A;  1JWA D;  2CR5 A;  2N7D A;  3MC9 A;  3FC4 A;  4M0W A;  1VD2 A;  2X38 A;  3UIN B;  1UNS A;  4RM9 A;  4ICU A;  3PZ7 A;  3VVW B;  3AXC A;  2JUO A;  3HM3 A;  5J17 A;  3QJZ A;  3ZW3 A;  4KV2 A;  4WAF A;  3Q8E A;  1UWM A;  1WFY A;  3M95 A;  3BYY B;  3ZUN A;  4KIK B;  4HKZ E;  2IDY A;  3WAN A;  3W5V B;  3RNG C;  1ZGU B;  3MHS D;  5JH5 C;  1SJE D;  2BYV E;  4I6P A;  1VZ7 A;  4GOC A;  4DXF A;  1YX6 B;  2IYD B;  4XDC A;  3ZO5 B;  2JQR B;  3H7P B;  2L8J A;  3QA8 A;  2LRW A;  1ISN A;  2DWQ A;  4G50 A;  4HWI B;  1YOV B;  1NYQ A;  4P7I A;  2KAJ A;  3SFD B;  4ICV A;  2K25 A;  3URY A;  4FJZ A;  3V05 A;  2KX0 A;  4LNN A;  4A8X C;  2L7R A;  2JYT A;  2KJ6 A;  3W1S A;  4ZRQ A;  4E71 A;  5G5H A;  2ICI A;  1E5W A;  4XC2 A;  2KQS A;  3KW5 B;  2WDQ B;  1NEK B;  1UGM A;  1TTN A;  1EO6 A;  3H1U A;  3KYD D;  1V81 A;  3M63 B;  4RGT A;  3Q3F A;  2BYF A;  3GP7 A;  1FRR A;  3P4R B;  4CYE A;  1GJZ A;  1HXY D;  1QF6 A;  5BO4 B;  1S1Q B;  1OQQ A;  4RGN A;  4MJS B;  2KTR A;  1C4C A;  3V60 A;  3NZ3 A;  3AUL A;  4J3O D;  2DBY A;  3Q3O C;  1FNV A;  4YL8 A;  2KAC A;  4AQ7 A;  1EU4 A;  1JWU D;  1V5T A;  2JRH A;  4J6I A;  3ZVV A;  3KQ4 A;  4HXD A;  3A1Q A;  4RMA A;  3I63 C;  3P4Q B;  2IPK D;  3U2S C;  1ESF A;  4N58 A;  3KYC D;  4GMV A;  1P98 A;  2YEP B;  1V2Y A;  2KWU B;  2M17 A;  3ML9 A;  4EUT A;  4OZA A;  1D4B A;  3QC8 B;  3JVZ X;  4YSX B;  1FNW A;  3VTW A;  2N7E A;  1B9R A;  3VH3 B;  4GIV A;  2KZR A;  2R2Q A;  3SDL C;  2TSS A;  1GNU A;  3RYT A;  2L3Z A;  1OQR A;  1F52 A;  1UZX B;  1RFA A;  4BVU C;  2IO0 B;  4N9F 4;  4PYZ A;  3RD2 A;  1NDD A;  1EUV B;  1E9M A;  3TEZ A;  4W9D A;  3UF8 A;  1ROE A;  1QOG A;  4WJP A;  4GN1 A;  4W9E A;  1L0Y B;  1SIF A;  5BYS A;  3TMP B;  3ENE A;  3ZNI D;  3N1Y C;  2YVC A;  1FCC C;  2WX1 A;  4NY0 A;  3VAW A;  4AUQ C;  2K1F A;  1I4Q A;  4KZC A;  2JWZ A;  2KQ7 A;  3CSF A;  3IG3 A;  2HJ1 A;  2W3R A;  1LO5 D;  1VR9 A;  2VH1 A;  3MP9 A;  3ZNG C;  1AYF A;  4IOI E;  1IUE A;  3IT6 B;  4RF0 A;  2HE7 A;  3GZN I;  3Q8B A;  1C78 A;  1S3S G;  5FR3 A;  3T3O A;  2MWS B;  4A90 A;  3WA0 A;  5AZF A;  1V86 A;  2BWE S;  4LCD E;  4OW0 A;  3X23 A;  1QIL A;  3Q69 A;  3L0W B;  3AU4 A;  1QKZ A;  2J0M A;  3DBS A;  4B0M A;  3VUY A;  4W9K A;  2KOX A;  1GB1 A;  1C77 A;  4P16 A;  2GOW A;  5CHF A;  4C4V A;  3U52 E;  2JXX A;  2V1Y A;  2UWQ A;  4OVV A;  5HG2 A;  3A4S C;  3RPF C;  3E56 A;  3FIL A;  3BK1 A;  2DYM A;  1E8Z A;  4GDK A;  4W9C A;  4ZHP A;  4K81 A;  2KDB A;  4FAD A;  3ALB A;  4IWQ A;  4DXG A;  3DVN V;  3ZGZ A;  1CJE A;  1YIW A;  2L52 A;  1YN5 A;  2LUM A;  2KFK B;  4FA6 A;  1Y56 A;  2KD0 A;  3APC A;  4I6N B;  3DBH B;  3M3J A;  3BK2 A; 
#chains in the Genus database with same CATH homology
 1SGH A;  1Q5W B;  4ANW A;  3MTN B;  4JL9 A;  3B08 A;  2PE6 B;  3SU8 X;  1H8C A;  4NNJ B;  2NBW B;  2LGD A;  2N4F A;  3GOE A;  3PV1 A;  3PVL A;  5DPR A;  4DHJ D;  1E8W A;  1GG3 A;  4HVB A;  1WJN A;  2EMS A;  4JGH B;  4G3X B;  3A9J B;  3IVF A;  3DBR I;  3OJ4 B;  3U30 A;  4EZJ A;  4KDI C;  5C23 A;  4EFO A;  1EF1 A;  4B9K A;  2DYO A;  2YLM A;  4ANX A;  2LRU A;  2AYO B;  3RT3 B;  2ZNV C;  5JHB A;  2L00 B;  4I6L B;  3WAP A;  1U4A A;  3DCG A;  1WXM A;  2MSE D;  3LDZ E;  2M4N A;  4ANV A;  2LWP A;  1WM2 A;  3H9D A;  2KAN A;  4ASW C;  4HJK A;  2O6V D;  2FIF A;  2FID A;  2CHX A;  1BT0 A;  2KDE B;  3L16 A;  5C1Z A;  2C7H A;  2KC2 A;  2ZPN A;  2ZNV B;  2KWC A;  3EFU A;  2D07 B;  4DHZ B;  3V62 A;  1E7V A;  4AJW A;  3DVG Y;  3BIN A;  4EKU A;  2ZVO A;  2N1W A;  4EZK A;  5GMV A;  3NOB A;  3Q3J A;  3DDC B;  4NJ7 A;  1WR6 E;  2AWT A;  4PS8 A;  5E6P A;  1Z5S B;  4A20 A;  5HKH A;  5LXI B;  4BBN F;  2FUH B;  2FCQ A;  2QHO A;  4X57 B;  1WIA A;  4MGK E;  2HJ8 A;  5CHV C;  2KJR A;  3ZLZ A;  2ZJD A;  3R3M A;  2MBB B;  3H7S A;  1WMH A;  4LDT B;  4HPL B;  2L0F A;  3C0R B;  3OJ3 A;  4NAW A;  4B95 A;  2IO3 B;  3PLU A;  4XZ4 A;  4KVG B;  4HDO A;  4MEM A;  1Y8R C;  4HDQ A;  3ZDT A;  1SE9 A;  1YQB A;  2NPT B;  3CST A;  2I1J A;  4PS7 A;  5D6J B;  1F9J A;  1WX8 A;  2PE9 A;  5IAA C;  2ZCC A;  4PS3 A;  3U7D A;  1GC7 A;  1V80 A;  4TV3 A;  1RLF A;  4BKT A;  1CMX B;  1WX7 A;  2KTF A;  2B3A A;  2BPS A;  2J0J A;  3TL5 A;  3PPA A;  1P9D U;  3X0W A;  4IG7 B;  2KFK A;  1V9J A;  3A4R A;  2NBV B;  3HK0 A;  3ZNH B;  2KX3 A;  5L83 A;  4HPM B;  5LLI A;  1L7Y A;  4G11 A;  2IZV B;  4K7W A;  3VTU A;  3OAW A;  2PEA A;  2DYB A;  1WXS A;  2IY1 B;  4A3P A;  2PJH A;  2ZZP B;  2MLB A;  2I1K A;  2DX5 B;  2KN5 A;  3OLM D;  1IP9 A;  4OVU A;  2RR9 A;  3W1S C;  2FCM A;  3TJP A;  1NBF C;  4EZL A;  4A3O A;  5CX3 A;  2M8S A;  4GB9 A;  4BFR A;  1Z2M A;  4NQK E;  3L17 A;  1Q0W B;  2W9N A;  4GDL B;  1J0G A;  2BGF A;  2CU1 A;  2DZJ A;  1LXD A;  3A9J A;  2MP2 B;  3HM6 X;  4AP4 C;  1GC6 A;  1WYW B;  3L13 A;  1WJU A;  3SD5 A;  4JLC A;  2JY6 A;  2HD5 B;  2Y5B B;  1OEY J;  4DDI D;  3TIX A;  3DBL I;  2KWV B;  1WGD A;  2D3G A;  3KUD B;  1HE8 A;  4IM2 A;  3A9K B;  2V4L A;  1GUA B;  2FCS A;  4LJP B;  2LXA A;  3WAM A;  2K8B A;  1NI2 A;  1WGY A;  4W9H A;  1WXA A;  2MCN B;  4FJV B;  1YD8 U;  4WQO B;  3UIP B;  3WIM A;  1WF9 A;  5AEK B;  1LM8 B;  5IA7 A;  5J18 A;  1YX5 B;  4IM0 A;  3K9P B;  4JQW C;  4W9F A;  3P2B A;  2K8H A;  3NY5 A;  2C9W B;  4DK5 A;  4II3 B;  1RRB A;  2KC1 A;  2C7M B;  4WJQ A;  3L54 A;  1WRD B;  1WH3 A;  1A5R A;  4W9I A;  1LFD A;  3PZD A;  4ZRI A;  2CR5 A;  3QX1 A;  2N7D A;  2G4D B;  2G45 B;  2LVP A;  2KLG A;  1VD2 A;  2GBN A;  2C60 A;  2MX2 A;  2KTR B;  5E6N A;  3UIN B;  2GMI C;  2DHZ A;  2IO2 B;  1E7U A;  4RM9 A;  2KK8 A;  4ICU A;  4IW0 A;  1P3Q U;  2DZI A;  2L05 A;  4W9G A;  3VVW B;  4IC7 B;  3AXC A;  4HCP B;  4ANU A;  2JUO A;  3HM3 A;  5J17 A;  3QJZ A;  1UD7 A;  1QZE A;  3ZW3 A;  2BWF A;  2DZM A;  2NPT A;  4KV2 A;  4EEW A;  1WFY A;  2XK5 B;  1WGR A;  1WJ4 A;  2BKR B;  3M95 A;  2G4S A;  3ZUN A;  4MGZ E;  1R4N I;  4KIK B;  4F8C B;  3WAN A;  1ZGU B;  2AL3 A;  3A1Q B;  3MHS D;  4FBJ B;  5EDS A;  2LXC A;  3W1Y A;  3WAO A;  5JH5 C;  3QQ8 B;  2BYV E;  3HHM A;  4I6P A;  3B0A A;  3ZNZ B;  1OEY A;  3ZRC A;  4IWP A;  4GOC A;  4NPN A;  3A33 B;  1E90 A;  1YX6 B;  5D7G A;  3VXW A;  2IYD B;  2LGX A;  3ZO5 B;  1AAR A;  1X1M A;  2NCN A;  3QAR A;  3H7P B;  3ZTC A;  2L8J A;  3QA8 A;  4WWN A;  1WE6 A;  2NR2 A;  2LRW A;  4GU2 A;  1ISN A;  3KH0 A;  4M8N A;  2MRP A;  4WJN A;  2KO3 A;  4KSL C;  4G50 A;  4HWI B;  1V49 A;  1UH6 A;  3UQB A;  3APD A;  1WGH A;  1K8R B;  2FAZ A;  4P7I A;  3PRP B;  4WAA A;  4ICV A;  1KJT A;  2K25 A;  4LDT D;  4GDL A;  2N9P C;  4FJZ A;  3K9O B;  2V3S A;  2KX0 A;  4RM8 A;  1J19 A;  4F1S A;  2L7R A;  2KJ6 A;  3W1S A;  3ZTD A;  4E71 A;  1JRU A;  2WYQ A;  2Z0D B;  4ZDV A;  2LGY A;  1R4M I;  3AU5 A;  1E5W A;  5KHO A;  2L0T A;  4XC2 A;  2KQS A;  3ECI A;  3JW0 X;  3KW5 B;  3N30 A;  3VUW A;  3RUI B;  4AJY B;  1UGM A;  1TTN A;  2KNB A;  1OGW A;  1I42 A;  1EO6 A;  3EHV A;  1D3Z A;  1ZKH A;  3NHE B;  2UYZ B;  1WGG A;  3O65 B;  3H1U A;  3KYD D;  1V81 A;  3M63 B;  5DCN A;  3Q3F A;  2BYF A;  4AWJ A;  3H6N A;  2MW5 A;  3BY4 B;  3ONS A;  4CYE A;  1WJ6 A;  3U8Z A;  1GJZ A;  5DPT A;  2AEH A;  2MQJ A;  1M94 A;  1WE7 A;  3M62 B;  4ZYN A;  3UQA A;  5BO4 B;  1S1Q B;  4F7Z A;  4MJS B;  2KTR A;  3APF A;  4MGY E;  3V60 A;  4BKG A;  3RUL A;  3AUL A;  4BOS C;  2MBO A;  2MBE A;  1UBI A;  3V61 A;  2MBH A;  2J7Q B;  2XK5 A;  3IBE A;  3KUZ A;  5CHW A;  4YL8 A;  5D94 A;  3DBH I;  3QK0 A;  5FR6 A;  3PTF C;  2JRH A;  1OQY A;  1V5T A;  4J6I A;  4KIK A;  3ZVV A;  1PQS A;  1XT9 B;  4NJ6 A;  4BBN C;  4HXD A;  4BKS D;  2K39 A;  4W9J A;  4WWP A;  3A1Q A;  5TR5 A;  1T0Y A;  4RMA A;  1V6E A;  3PLV A;  4HK2 A;  3CMM B;  3KYC D;  2GBJ A;  2Z0E B;  4GMV A;  3NZU A;  5G55 A;  3VUX A;  1C3T A;  4IUM B;  4PYU A;  1P98 A;  1UBQ A;  1V2Y A;  1WM3 A;  2K6Q A;  2KWU B;  2LVO A;  2N1V A;  2JT4 B;  2M17 A;  3ML9 A;  3NZS A;  4EUT A;  3ML8 A;  2KJH B;  3H7P A;  3QC8 B;  4NAW B;  4EOY A;  3JVZ X;  3ZIM A;  4WWO A;  4KZ0 A;  5JZE B;  5L95 C;  2NS5 A;  3PHW B;  2OOB B;  3VTW A;  5J2R A;  2N7E A;  3IFW B;  1WX9 A;  1EF5 A;  2EKE C;  2Z59 B;  3VH3 B;  2HTH A;  4GIV A;  1ZW7 A;  5AZH A;  2KZR A;  3V6C B;  4TKN A;  5LXH A;  2R2Q A;  1MG8 A;  3JSV B;  3R7Q A;  3SDL C;  1GNU A;  3RYT A;  2L3Z A;  1TZ1 A;  2BF8 B;  2IBI B;  2JRI B;  1UZX B;  2ASQ A;  1RFA A;  4BVU C;  2IO0 B;  4K7S A;  4N9F 4;  3RZF A;  1WZ3 A;  2K8C A;  4PYZ A;  3RD2 A;  3S2A A;  1KLV A;  2M1M A;  1NDD A;  4ZRJ A;  2XBB C;  1IPG A;  3QIJ A;  3VFK A;  2G3Q B;  2ZVN A;  2OJR A;  1EUV B;  3UIO B;  1H4R A;  4W9D A;  2PPH A;  3VHT C;  3UF8 A;  2KDF B;  3PSE B;  3PRM B;  2WWZ A;  2REX A;  4WJP A;  1VCB A;  4JIO U;  1TBE A;  3PHX B;  3V6E B;  4GN1 A;  2KHW B;  2EMT A;  4W9E A;  4FHK A;  3N3K B;  2WDT B;  2FCN A;  4MM3 A;  2IY0 B;  4DHJ B;  5CTR C;  3EC8 A;  2ZPY A;  2JZ3 B;  1SIF A;  3L08 A;  4DWF A;  2VRR B;  1V5O A;  3DQV A;  3DVN U;  1WXV A;  1C1Y B;  5E6O A;  4BOZ B;  3LJ3 A;  2CHW A;  2JVC A;  2R2O A;  4FN2 A;  4MJS A;  3TBL D;  2CKH B;  2FNJ B;  4GDK B;  3ENE A;  3NS8 A;  3TMP B;  3ZNI D;  5JHA A;  2YVC A;  1WR1 A;  1KM7 A;  2DEN B;  2M0X A;  2WX1 A;  4NY0 A;  2J0K A;  3VAW A;  4GGQ A;  3VTV A;  3R7R A;  2O6V B;  2MP2 A;  2RSU A;  4AUQ C;  1P0R A;  2K1F A;  3RZW C;  2NVU I;  4WJO A;  2CHZ A;  4KZC A;  1OTR B;  1UEL A;  2JWZ A;  2KQ7 A;  3D32 A;  3CSF A;  3A9K A;  3IG3 A;  4LJO B;  4MGI E;  4URK A;  3KUC B;  5DPW A;  3B1L X;  1WY8 A;  4XX5 A;  2CS4 A;  2AL6 A;  2N9E B;  2N9X A;  2JF5 A;  2O2V B;  2KMC A;  3N32 A;  2LZ6 A;  4BKS A;  4HLE A;  2K6D B;  4TQ0 A;  1G6J A;  4G0N B;  3PT2 B;  4K7U A;  2BYE A;  2KFJ A;  4HCN B;  2GBM A;  4K1R B;  4M0W B;  4MSQ B;  1IYF A;  2C5L C;  2LJ5 A;  4KSK C;  3DVG X;  3ZNG C;  4AOF A;  3PRE A;  1TGZ B;  3DPD A;  2LAS A;  1XQQ A;  2LUE A;  3IHP C;  2HE7 A;  4DBG A;  3GZN I;  2DZK A;  4DHZ E;  2KKC A;  2ZCB A;  1S3S G;  4FJY A;  4GXB A;  2MWS B;  4DXA B;  4MSM B;  5DPS A;  2IO1 B;  4W9L A;  2RGF A;  2RPQ A;  3WA0 A;  2GBK A;  2MBQ A;  2GBR A;  4FLH A;  1E8Y A;  4MEL A;  5AZF A;  1V86 A;  5D2M B;  2BKF A;  2BWE S;  2DAF A;  4LCD E;  4IM3 A;  4KDL B;  3JSV A;  2D11 A;  3L10 B;  4B6W A;  1FXT B;  3JYU A;  5KHQ A;  2KVR A;  3X23 A;  4TUU A;  3PRZ A;  5G2N A;  2D10 A;  3WAL A;  4NQL B;  4E3C A;  3AI5 A;  3QAQ A;  3PS6 A;  4M8M A;  3L0W B;  2DAJ A;  3AU4 A;  3HIZ A;  4GSW A;  2J0M A;  3DBS A;  4II2 B;  3T9L A;  4FUL A;  2L76 A;  3ZKJ C;  3ZRF A;  4CHK A;  2XEW A;  3VUY A;  4W9K A;  2KOX A;  2KLC A;  2D2Q A;  5AZG A;  2GOW A;  5CHF A;  2KDI A;  4IWO A;  4TQ1 A;  1LQB A;  1XD3 B;  3T8M A;  3DOW A;  2JXX A;  1WMH B;  2UWQ A;  2V1Y A;  3CF6 E;  3MJW A;  1WZ0 A;  3PGE A;  3SHQ A;  4OVV A;  1Q1O A;  3EEC A;  3A4S C;  3QWZ B;  1E8X A;  4E74 A;  3RCZ A;  2NBU A;  1J8C A;  2DYM A;  2JPH A;  1E8Z A;  4GDK A;  1RAX A;  2RD0 A;  3UGB B;  1KOT A;  4DDG D;  4W9C A;  3QHT A;  2KDB A;  2KMA A;  4K81 A;  3R66 C;  2KXJ A;  1L2N A;  4FAD A;  3ALB A;  2LVQ A;  4IWQ A;  3I3T B;  3DVN V;  2O6V A;  2MA9 B;  1I35 A;  2JZZ A;  2C7N B;  2LD9 A;  1YIW A;  3QCA A;  2WX0 A;  4MH0 E;  1YJ1 A;  3VDZ A;  4ZRK A;  3VQI A;  3VH4 B;  1P1A A;  2KFK B;  3ZDM C;  2A4Z A;  4FA6 A;  2KD0 A;  3APC A;  4I6N B;  2O2V A;  1WI0 A;  3KVF B;  4MDK E;  4FHJ A;  3TCA A;  4CO7 A;  2A5U A;  3M3J A;  2LI5 A;  2ZEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...