4BKSD

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 102
sequence length 102
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bksD00
2HD5B 2D07B 5CTRC 1GC7A 4YL8A 2KC1A 3IHPC 3S2AA 3ZTCA 2OOBB 4GSWA 3DVNU 4ZDVA 1UD7A 3R7RA 1J0GA 1YD8U 3TMPB 1WXSA 4BKSA 4FA6A 4FHKA 4A20A 2GOWA 3UQBA 4HJKA 4IWPA 4BBNF 4MGZE 2KLGA 2KO3A 3KUZA 4KDLB 3DVGY 4P7IA 3L0WB 4I6PA 5G55A 2JY6A 3OLMD 1YX5B 1CMXB 2MW5A 3C0RB 1UGMA 4GGQA 2LUEA 4A3PA 1S3SG 4RM9A 4GXBA 4W9CA 5L83A 2DYOA 3VDZA 2KQ7A 2KWVB 4KSKC 3U8ZA 3DVNV 2JPHA 2GMIC 5CHFA 2C60A 2GBNA 3ONSA 2KJRA 2DAFA 1EO6A 1V6EA 4F8CB 2JVCA 1V80A 5KHOA 2C7HA 2WYQA 3EHVA 1KJTA 3PRMB 4GN1A 2Z59B 3APFA 4MEMA 4JLCA 2KX0A 2JZ3B 2G4SA 1HE8A 1NBFC 2GBRA 3HK0A 1WM3A 3IFWB 2DX5B 2DYBA 1WGRA 4HDOA 2FCMA 1VCBA 5J2RA 4XZ4A 2K6QA 4AJWA 4OVUA 3SD5A 1GC6A 1WXMA 1ZW7A 3OJ4B 4TV3A 4FJZA 2DYMA 3IG3A 3R66C 3ZNGC 2LVQA 3VHTC 1GUAB 1LFDA 3KYDD 4DWFA 2CHXA 3QWZB 3CSTA 4EZKA 4ZRIA 1YIWA 4TKNA 3CMMB 2KDFB 2KOXA 3APDA 2MLBA 1WFYA 3AI5A 2KNBA 3OAWA 5AEKB 1BT0A 2C9WB 2IO0B 4KV2A 4II3B 1OTRB 2PEAA 4IM3A 2VRRB 3DOWA 4NQLB 2IY1B 2J0KA 1WY8A 3BY4B 3VUXA 2IBIB 4M0WB 1XQQA 4EFOA 2G4DB 1KM7A 2LGXA 3NY5A 1IYFA 4E71A 1P0RA 3PREA 4TQ1A 2ASQA 4W9GA 4HVBA 2KZRA 1WJNA 2L00B 4KSLC 2MRPA 2BF8B 3PLVA 3TIXA 4M8NA 2NCNA 2K25A 2B3AA 2KANA 2ZNVB 1SGHA 3N32A 2LGDA 5C1ZA 1E5WA 2N1WA 4XX5A 1TTNA 3QJZA 1UELA 4NY0A 4BBNC 3K9PB 2D10A 4KIKB 3QX1A 5D6JB 4J6IA 1C3TA 3ECIA 3ZW3A 2R2OA 5CHWA 3KVFB 4ANUA 3APCA 3ZDTA 1R4MI 2RPQA 2V1YA 2GBJA 2CU1A 3DQVA 2EKEC 3VH4B 2NS5A 3MJWA 4W9KA 2L0FA 3TJPA 4BKTA 4HLEA 2FIFA 1LM8B 5LXIB 2AWTA 1OGWA 2IYDB 3L17A 4HPLB 4IWQA 1OEYA 2DZIA 1WX8A 3W1SC 1WF9A 4GMVA 1E8XA 1LQBA 2CS4A 2ZZPB 4G3XB 4IUMB 3VUWA 3ZNZB 4II2B 3A9KB 1SIFA 2D11A 2XBBC 2FIDA 4W9JA 3ZNID 2NVUI 3UIOB 4WWOA 2IZVB 3DVGX 4A3OA 4GB9A 4KIKA 4K7UA 3ZDMC 1KOTA 1X1MA 2NBWB 2G3QB 4HK2A 4IW0A 2RGFA 2I1JA 2YVCA 3ENEA 3VTVA 2M8SA 4F7ZA 1YJ1A 1E90A 4K7WA 2N1VA 2KK8A 3PV1A 1TBEA 4NPNA 4NJ6A 5CHVC 3QARA 2LZ6A 3DBRI 3H6NA 2LVPA 5C23A 4IM0A 5BO4B 3T8MA 4MJSA 1WXAA 5DPSA 5JHBA 1WJUA 3X0WA 2LGYA 2ZJDA 4FN2A 3PHWB 4DBGA 3PS6A 4TQ0A 3L54A 2OJRA 4DDGD 4FJYA 1RAXA 4E3CA 1ZGUB 4ZRKA 3A4SC 3A9KA 3VTWA 4DHZB 2BYEA 3JW0X 3UINB 3QHTA 4G11A 4LDTD 5GMVA 2BYFA 4AJYB 4ANXA 4HWIB 1XT9B 1LXDA 2AEHA 3A1QB 5E6PA 4ANVA 2MBEA 3DBHI 4W9LA 4AP4C 1V5OA 3ML8A 1L2NA 2KWCA 3R7QA 5J18A 2FUHB 2KN5A 3B0AA 2DHZA 5JZEB 5IAAC 2LJ5A 4HPMB 3B08A 2PJHA 1C1YB 4NJ7A 1WXVA 5JHAA 3NHEB 4WWPA 3UIPB 4NAWB 1ISNA 4B6WA 3AU5A 2MBBB 4WJOA 2KDBA 2AYOB 2ZVOA 1Z5SB 2KC2A 3KUDB 3KYCD 4KDIC 3RULA 4MGYE 4BFRA 3PHXB 4W9DA 4DK5A 1WE7A 2BKRB 2KDEB 1H4RA 4CHKA 3VQIA 3PLUA 1TZ1A 4IM2A 3RYTA 5FR6A 2C7MB 1UZXB 1VD2A 3NZSA 5D7GA 3VFKA 1SE9A 2MP2B 1I35A 2K8HA 2N7EA 5AZHA 3WANA 3A1QA 2KFKB 1I42A 2NBUA 3JSVB 5LXHA 3SDLC 4GDKB 2REXA 4FHJA 4JGHB 2BPSA 3SHQA 4B9KA 3N30A 3KH0A 2KMAA 1UH6A 2MX2A 4PS3A 4EOYA 3A9JB 4LJOB 4G50A 3I3TB 3N3KB 2LASA 2M1MA 1WE6A 2L0TA 4E74A 1WR6E 2CR5A 2MBQA 1PQSA 1RLFA 2JZZA 3VXWA 3HM6X 3M3JA 4FLHA 2KWUB 3V6CB 3DBSA 2DAJA 3NZUA 4W9FA 2CHWA 3ML9A 1WGYA 2A4ZA 3U30A 4RM8A 2FCQA 1EF1A 4ZRJA 3PSEB 3W1YA 1JRUA 2MP2A 3WAOA 4FJVB 4BKGA 4HCPB 2KKCA 2KFKA 2MWSB 3V60A 1WMHB 2NPTB 4GDKA 4KZCA 1YQBA 2BKFA 1UBIA 3KW5B 2ZCBA 3L10B 2PE6B 3ZLZA 2HE7A 5G2NA 3A9JA 1WGHA 4F1SA 4KVGB 2ZPYA 2Y5BB 3RZWC 3JYUA 3CF6E 4MELA 2MCNB 1L7YA 4FULA 3QCAA 1NDDA 3PTFC 1UBQA 2BYVE 2JF5A 1P1AA 4JL9A 3ZRCA 2AL3A 3TCAA 3DDCB 2O6VD 2HJ8A 3U7DA 1WX9A 2CKHB 1WGDA 1ZKHA 2I1KA 4KZ0A 4HXDA 2K8BA 1P98A 2GBKA 3VTUA 3H9DA 4BKSD 2K1FA 2UYZB 3PRPB 2KLCA 4EUTA 3V62A 3RD2A 1WMHA 2NPTA 4NQKE 2NR2A 5E6OA 4JQWC 5KHQA 2FCNA 2LXAA 2C7NB 2DZKA 1TGZB 4DHJD 2FNJB 3DPDA 4EKUA 3H1UA 5E6NA 4URKA 1R4NI 2M17A 1WIAA 3NOBA 2N9XA 1V9JA 2FAZA 3ALBA 3H7SA 4WAAA 2KTRB 3P2BA 3UGBB 3VVWB 1V2YA 1EF5A 2LRUA 4HDQA 2LD9A 1GG3A 4W9IA 2N4FA 4K1RB 4ANWA 1A5RA 2BWFA 4MH0E 2J0MA 3HIZA 2V4LA 3Q3FA 2CHZA 1WZ0A 2GBMA 4N9F4 3X23A 3OJ3A 4LCDE 5D2MB 4MM3A 1WR1A 2RSUA 4K7SA 4BVUC 4GU2A 3ZKJC 2KJ6A 2MBOA 1GJZA 5JH5C 2O2VB 2K8CA 2WX0A 3LJ3A 2Z0DB 2IO1B 3DCGA 1E7UA 1WGGA 4X57B 1FXTB 3JVZX 3HHMA 4FADA 1U4AA 2DZMA 3GOEA 5D94A 2L8JA 3A33B 4MGKE 3WA0A 5EDSA 2KTRA 2LXCA 4FBJB 3R3MA 2NBVB 2WX1A 2L3ZA 4TUUA 2KJHB 4AOFA 4CO7A 3EFUA 4LDTB 4NNJB 1WJ4A 1Q5WB 2KVRA 4GOCA 4RMAA 5AZGA 4DXAB 1Y8RC 3L16A 4I6NB 4BOZB 1K8RB 1V49A 3V61A 2Z0EB 1G6JA 4WWNA 3QK0A 2N7DA 2DZJA 1V81A 1WJ6A 2XEWA 3ZO5B 3EECA 2O2VA 4WJPA 2EMSA 2ZPNA 1OQYA 3AU4A 3ZIMA 3IBEA 3VAWA 3L08A 4EZJA 4B95A 2WWZA 2W9NA 5DPRA 3H7PB 4JIOU 4IWOA 4WQOB 4DHZE 2XK5B 3RCZA 4PS8A 2JWZA 2IO3B 1E8ZA 2D3GA 2K6DB 2D2QA 2L05A 3A4RA 1XD3B 3PZDA 3RT3B 4IG7B 2KMCA 2MBHA 2PPHA 4PYZA 2EMTA 3UF8A 4ICVA 3BINA 3HM3A 2ZVNA 3AULA 1GNUA 4AWJA 1OEYJ 1WRDB 2J0JA 1AARA 4NAWA 4BOSC 4HCNB 5CX3A 3RUIB 2G45B 2M0XA 4I6LB 1H8CA 2BGFA 4GDLB 4DDID 2KX3A 2IY0B 1WX7A 2N9EB 3QA8A 2C5LC 3D32A 4XC2A 2MQJA 3VH3B 2R2QA 1WH3A 3IVFA 3ZUNA 4WJNA 2LWPA 3MHSD 5IA7A 2K39A 3WALA 1T0YA 4WJQA 3QC8B 3QAQA 1YX6B 3H7PA 2RD0A 3AXCA 2XK5A 3TBLD 2KD0A 5J17A 3RZFA 5AZFA 1IP9A 2JRHA 3JSVA 2AL6A 3M63B 5LLIA 4EEWA 2WDTB 2L7RA 4MDKE 4M8MA 3ZNHB 4EZLA 1KLVA 3L13A 3M95A 1WZ3A 1J8CA 2V3SA 3KUCB 3WIMA 2UWQA 3DBLI 4AUQC 4ICUA 3T9LA 3PGEA 4GDLA 2JRIB 1F9JA 4W9EA 1P9DU 3V6EB 1WYWB 3TL5A 2MSED 4GIVA 2LRWA 2RR9A 3NS8A 1IPGA 1WI0A 4LJPB 3UQAA 3WAMA 3PVLA 3K9OB 3PPAA 4G0NB 3ZRFA 2KQSA 2KTFA 5TR5A 2LI5A 2J7QB 4MSQB 1Z2MA 1V86A 2IO2B 2ZEQA 4IC7B 3MTNB 1EUVB 2QHOA 1E8WA 2O6VB 3O65B 2KHWB 1RFAA 5DCNA 2PE9A 1S1QB 3B1LX 5DPWA 5HKHA 4W9HA 1V5TA 3LDZE 1E7VA 1QZEA 4OVVA 2FCSA 2N9PC 2JUOA 2KFJA 4K81A 1WM2A 2ZNVC 4MSMB 5DPTA 3WAPA 3W1SA 3ZTDA 1E8YA 2JT4B 2JXXA 3GZNI 2KDIA 3PRZA 3ZVVA 5L95C 3Q3JA 4MJSB 3QQ8B 2BWES 2MA9B 1MG8A 2DENB 2M4NA 4ZYNA 4DHJB 1Q0WB 2KXJA 1D3ZA 3CSFA 1P3QU 1J19A 1Q1OA 4ASWC 1NI2A 3SU8X 3M62B 2ZCCA 1RRBA 3QIJA 2HTHA 4MGIE 3VUYA 2L76A 2LVOA 1M94A 3EC8A 3PT2B 2A5UA 4PS7A 2YLMA 4PYUA 2O6VA 4CYEA
chains in the Genus database with same CATH superfamily
3GS2A 2MJ3A 2KDMA 4FA6A 4FHKA 4BAXA 3UQBA 3U4EG 1KTKA 2KO3A 3P4PB 2JY6A 3OLMD 1YX5B 1L0YB 1ZOYB 2H89B 2KQ7A 3U8ZA 2C60A 1QQRA 4RFBA 1FXAA 4F8CB 1XLOA 1AWDA 3PRMB 2Z59B 4MT5A 3BVZA 2JZ3B 1NBFC 2WXFA 1VCBA 4XZ4A 3UI3A 3BK2A 1P7EA 2K6QA 4L23A 1WXMA 3OJ4B 3SD5A 2V0GA 4LLGM 4RGOS 1L4ZB 3VHTC 1LFDA 3KYDD 4WURA 4M01A 4EZKA 3AE9B 1PGAA 4ZRIA 5EE1A 2KNBA 2PTLA 2C9WB 2IO0B 3BWUD 4II3B 5D3DA 3P4RB 2VRRB 3IAM1 1L0XB 3PO0A 3ZYYX 1I4PA 2PW9A 2J0KA 1WY8A 3BY4B 2IBIB 4EFOA 5JXVA 1P0RA 4JWUC 1V1PA 4KSLC 4FXCA 5IOIA 3DHIC 2K25A 2KANA 2ZNVB 2L52A 5T8IA 1RWSA 4XX5A 1TTNA 1WXQA 1TYGB 3AEFB 4BBNC 5AUIA 4N6EB 3ZW3A 4C4VA 1R4MB 1MI0A 3VRAB 1R4MI 2RPQA 4Q2JA 3V3XA 1L0VB 3VH4B 1I4QA 2EKIA 2L0FA 4HLEA 5LXIB 2QMTA 1UF0A 2N9KA 4AQ7A 4IWQA 1WX8A 1SIJA 4AS1A 4IUMB 2ONQA 1E0ZA 3RNGC 2W55A 4W9JA 2NVUI 3UIOB 2IZVB 4GB9A 4KIKA 1VZ7A 2RGFA 2YVCA 1KLGD 2LFIA 1YQ3B 3NRZA 2MHJA 2PVGC 4K7WA 4LNNA 3QARA 1JCKB 4IM0A 1WXAA 2JYEA 1C9FA 2K3UA 4P1CC 2LGYA 4DDGD 4E3CA 1ZGUB 3A4SC 4DHZB 3AV8A 3UINB 3DBHB 2BYFA 4ANXA 2AEHA 2WXKA 3DBHI 2BT6A 1WGKA 3AE8B 5IAAC 2PJHA 1C1YB 1WXVA 4NAWB 1STEA 2M19A 3AU5A 2MBBB 2KDBA 2AYOB 2ZVOA 3KUDB 4CQNA 1L4DB 2PKOA 4US9A 3PHXB 4W9DA 2ZW1A 4DK5A 1WE7A 3P4SB 2KDEB 1H4RA 4CHKA 3PLUA 4IM2A 3AE2B 3NZSA 1SE9A 1GB1A 2NBUA 3JSVB 5LXHA 2KT7A 2BPSA 3KH0A 2MX2A 4OW0A 1FRRA 3A9JB 4HPPA 4LJOB 4EOYA 5IP4D 5LNK1 2LASA 2QJLA 3AH7A 1MJDA 2MBQA 3AE7B 4K3BA 2OEDA 2KWUB 3DBSA 2A4ZA 1QOBA 3BIID 4ZRJA 1JRUA 3WAOA 1UNSA 1TS5A 2NPTB 2DBYA 4MACA 1OQQA 1FIQA 3L10B 5BMGA 4F1SA 3N1XC 2Y5BB 1TS2A 3RZWC 4ZHOA 4MELA 1L7YA 2JF5A 1P1AA 1IBXA 1WX9A 4K3CA 2CKHB 1ZKHA 2GBKA 4HJGE 1FXIA 2UYZB 2KLCA 3V62A 4ARIA 2C7NB 3ZGZA 3ZXVA 2YEPB 1WIAA 3ALBA 4A8XC 2K5PA 2HJ1A 3UGBB 1YJJA 1EF5A 3VR9B 1GG3A 4YTNB 1A5RA 2BWFA 1TS4A 1WZ0A 3X23A 3OJ3A 4K7SA 2X8XX 3R8BA 5AUKA 2K8CA 2WX0A 4X57B 3HHMA 1U4AA 3GOEA 5D94A 2WXGA 3RNCC 4MGKE 4WAFA 2UU7A 4TUUA 4LNKA 1C4CA 2WXHA 4GOCA 4RMAA 4DXAB 1Y8RC 3L16A 3NS1A 4I6NB 1K8RB 1V49A 2KVZA 1K51A 3RI7C 3V61A 4WWNA 2N7DA 1V81A 1WJ6A 4REZA 3VRBB 4WJPA 2EMSA 1SBBB 3VAWA 4DXFA 5EE9A 4B95A 5DPRA 4B0EA 2JU6X 4IWOA 1YMHE 2D3GA 1XD3B 3RT3B 2PPHA 2EMTA 2MJDA 3AULA 1FCLA 2BS4B 2Q5WD 1XF5L 3TUOA 3RUIB 3AECB 4C00A 2M0XA 4I6LB 1H8CA 2BGFA 4GDLB 1V1PB 4C7YA 1ESFA 4USAA 3ZUNA 3Q8FA 3O13A 1PFDA 3MHSD 1KFYB 2K39A 3MHZA 2WDRB 3W2DA 4RCOA 3QAQA 3AXCA 1EWCA 2MH7A 3M63B 4P6VF 2L7RA 4M8MA 1GPXA 2WDVB 3TEYA 3Q8BA 4AUQC 3PGEA 2VH1A 2MSED 3NS8A 4LJPB 2LGIA 1XLPA 3ZRFA 2KQSA 4HRSA 1V86A 2ZEQA 1C78A 1E8WA 5HFYA 2KHWB 2W3RA 5DPWA 3NVYA 1QZEA 4OVVA 3U52E 2N9PC 2KFJA 1TKYA 5C2TB 3ZTDA 1E8YA 1AN8A 2KDIA 3PRZA 5L95C 3DHHC 2M4NA 2AQ1B 1Q0WB 1D3ZA 4DXGA 3CSFA 2W82A 2LHEA 2HDEA 3PT2B 2YLMA 2O6VA 4CYEA 2IGDA 4YL8A 2KC1A 1PDXA 3IHPC 3ZTCA 4GSWA 4ZDVA 2QCZA 3J9CA 2LEKA 1GOZA 4ZOHC 2FE8A 4BBNF 4MGZE 1XCTL 3KUZA 3DVGY 3L0WB 4I6PA 1GB4A 1CMXB 2MJEA 2MW5A 5HG2A 4GGQA 3BYTB 4RM9A 5L83A 2DYOA 4KSKC 3DVNV 5CHFA 2GBNA 2KJRA 2DAFA 4XDCA 1V6EA 2JVCA 1V80A 2C7HA 2H88B 4GN1A 2GBRA 2BW2A 3HK0A 3LXFA 4HDOA 1T6BX 2WQYB 4WWMA 5J2RA 4TMAB 4L1BA 4AJWA 4OVUA 3FC4A 1YQ4B 2LVQA 1GUAB 3FKYA 1HA5A 4DWFA 3CSTA 1YIWA 4TKNA 2KDFB 2ZW0A 3APDA 2MLBA 5AEKB 1XEEA 2RDHA 1P7FA 4IM3A 2N7JA 1MPEA 2RDBC 3Q69A 1FEHA 1IYFA 1D5MC 1ZXHA 2BYTA 1IBXB 4W9GA 2KZRA 1J7BA 3I63C 4M8NA 3MC0B 3AB5A 2NCNA 3PZ7A 3Q8CA 1SGHA 2LGDA 1TZOA 2WU5B 5C1ZA 3QJZA 2D10A 1F2RI 3QX1A 5D6JB 4J6IA 1WSPA 3AE4B 1FD6A 3ECIA 5CHWA 3NVWA 4ANUA 3APCA 4M0WA 2R61A 3DQVA 1LO5D 2EKEC 2NS5A 3MJWA 2AWTA 1OGWA 2AQ2B 3NZ3A 1E8XA 1LQBA 2ZZPB 1TJEA 3B2FA 3A9KB 1D5ZC 2XBBC 1R4NB 4A3OA 1FO4A 4K7UA 1TY2A 1FMAD 1X1MA 2G3QB 2NBWB 2KN4A 1BXTA 4IW0A 2I1JA 1AW7A 2ON8A 2M8SA 2N1VA 1TBEA 4NJ6A 2LZ6A 2LVPA 1WWTA 5BO4B 4XGAB 4LNFA 5JHBA 2ZJDA 3MJ5A 3L54A 4FJYA 3VTWA 2BYEA 2WHIA 1YNTE 4IDIA 2K9XA 3W5VB 3AE5B 4AJYB 4A6QA 1XT9B 2MBEA 3ML8A 2M0AA 3R7QA 5J18A 1K53A 2FUHB 1NEKB 2DHZA 3KQ4A 2PIAA 3B08A 5JHAA 3FILB 3UIPB 4B6WA 3R7RA 1IUEA 2KC2A 3RULA 2QEJC 1NYQA 1FNVA 1RFKA 3RYTA 5FR6A 3E9SA 1VD2A 3BZDB 1FCCC 5D7GA 1QOGA 4XDDA 3A1QA 1I42A 2D3CA 1L5PA 1F52A 3ZJUA 1PYWD 1Q10A 5GXGB 4B0MA 5IN7A 4ARCA 3CWIA 1SE4A 2L0TA 1WR6E 2G1EA 3VXWA 3HM6X 1GAQB 2INPE 4FLHA 3V6CB 2VZKD 4W9FA 4LNOA 2JXTA 4YSXB 3U30A 1EF1A 3W1YA 1VZ6A 2MP2A 4FJVB 2KFKA 2MWSB 1T3QA 1WMHB 2BTEA 1XXGA 4GDKA 4KZCA 4KX6B 3KW5B 1NYRA 4JX1C 2HE7A 5G2NA 3DBLB 1JWAD 2MCNB 1RM6C 5E6JA 1NDDA 2WXQA 2AL3A 3TCAA 1FNWA 3URYA 1WGDA 2WDQB 4KZ0A 1ZDVA 1P98A 3I5JC 2LHDA 4NQKE 4O1NA 2NR2A 5E6OA 1SB3C 5KHQA 4EKUA 2FNJB 3H1UA 2M17A 3NOBA 3RNEC 4WAAA 2KTRB 1IGDA 3VVWB 1V2YA 3KLSX 2BVCA 1CQVA 2N4FA 3AEEB 1HXYD 4YXDB 4MH0E 2J0MA 3HIZA 1ACCA 1HTQA 4MM3A 1WR1A 3B9JA 4OZAA 5TSSA 2MBOA 1GJZA 2O2VB 3P42A 3LJ3A 1E7PB 2Z0DB 3ABVB 2WXRA 1E7UA 2DZMA 2L8JA 3A33B 3WA0A 1ZP0B 2WX1A 2L3ZA 4PT5A 4C56C 3DHGC 1Q5WB 2KVRA 4OVZA 1I4RA 5AZGA 4BOZB 4IKGA 1G6JA 3DWGC 2IDYA 2DZJA 2NTSA 3ZO5B 3EA6A 2WXMA 2ZPNA 3IBEA 1XO3A 3V05A 1VR9A 5C3JB 3RNAC 3H7PB 2IGHA 2XK5B 3VR8B 2IO3B 3N1ZC 1JMLA 1E8ZA 2K6DB 2D2QA 3A4RA 4NAMA 2KMCA 2MBHA 3IT6B 3UF8A 1JW9D 3BINA 1NVID 3IXSA 1KF6B 2V3NA 2L32A 3C8YA 5EE0A 2KX3A 2KYWA 2N9EB 3MC8A 1C79A 1XCQL 3RNBC 3IVFA 1WH3A 2Y3AA 5IA7A 1J7AA 3P1MA 1ET6A 5D3IB 2Y5CA 3RZFA 1C4AA 1XLQA 2VZKB 3ZNHB 4EZLA 3ZQ4A 3KUCB 3E56A 2UWQA 5MPOA 3T9LA 1KLUD 3TL5A 2DNFA 2LRWA 4WQMA 3UQAA 3WAMA 2KTFA 4MSQB 1Z2MA 2QHOA 4N58A 5H8YE 1RFAA 3B1LX 4ACFA 2X38A 1V5TA 3LDZE 1TIFA 1E7VA 1Y56A 1SF0A 2ZNVC 1N5XA 3WAPA 1C76A 3AEAB 2JXXA 4ZHPA 1FPYA 3U7ZA 3QQ8B 2MA9B 2KXJA 2L83A 2K22A 1P3QU 1J19A 4ASWC 2QSDA 1NI2A 4ITKA 1E9MA 1K50A 2ICIA 1RRBA 4MGIE 3VUYA 2L76A 3MC9A 1I7HA 2A5UA 4BZAA 4PS7A 4PYUA 2HD5B 1ROEA 3AN1A 1GC7A 5CTRC 2OOBB 3DVNU 1J0GA 1YD8U 3C19A 3GE8C 4BKSA 3DBRB 2GOWA 4HJKA 1TKEA 1JQ4A 2KMMA 4HEA1 3Q3MC 3GB1A 3C0RB 1UGMA 3I57A 1S3SG 4GXBA 4W9CA 2V9HA 2KWVB 2JPHA 2GMIC 2BBCA 1HEZE 3SFEB 3OWEB 1EO6A 2D5GA 2WYQA 3Q3OC 1KJTA 4XWWA 4EE2A 2IGGA 3APFA 4MEMA 2KX0A 2G4SA 1HE8A 1WYGA 1WM3A 3IFWB 2DX5B 1WGRA 3DWMA 3PZ8A 2GLSA 1GC6A 3AE1B 4FJZA 4TV3A 2DYMA 3BVMA 3IG3A 3R66C 1OQRA 1JWMD 1WRIA 1HTOA 3QWZB 1IGCA 2KOXA 3GE3C 3AI5A 4M02A 1QT9A 4KV2A 1OTRB 2PEAA 4C4VB 1XQQA 2G9HD 2G4DB 1KM7A 2Z8LA 4E71A 1D4BA 4TQ1A 4HVBA 1WJNA 1UGJA 2MRPA 2BF8B 3PLVA 2B3AA 5FKAC 1E5WA 2N1WA 4RGNA 4A9AA 1T5XD 1UELA 4NY0A 3K9PB 2EELA 4KIKB 1ZXIA 1C3TA 2R2OA 4DQOC 3KVFB 3ZDTA 2V1YA 1ET9A 3AEDB 4JPSA 3TJPA 3GP7A 2IYDB 2DZIA 2L1AA 3W1SC 1WF9A 4GMVA 4H2AA 2CS4A 3ZNZB 3VUWA 1DOIA 2D11A 2JZPA 3ZNID 4WWOA 3DVGX 1TY0A 3ZDMC 5G5GA 4OHJA 3W5UB 1KOTA 3VTVA 4F7ZA 1E90A 2KK8A 3PV1A 3Q14C 2XNAC 5DPSA 1E6EB 1WJUA 4FN2A 4DBGA 2I2YA 4TQ0A 4RGMA 3AE3B 1RAXA 1F0ZA 4ZRKA 3JW0X 3QHTA 5GMVA 4WIPA 1TKGA 2JX5A 5E6PA 1LXDA 4ANVA 2NTTA 4AP4C 1FM0D 1L2NA 2KWCA 3HRDD 1SE2A 5JZEB 4HPMB 5I4DA 3CIRB 1F1HA 4WJOA 1MFWA 3KYCD 4MGYE 4BFRA 2V3PA 1QLBB 2C7MB 3T3OA 3VFKA 2PLPA 2K8HA 5AZHA 3WANA 4US8A 3MFGA 4FHJA 3HVDA 4JGHB 4B9KA 2B76B 4PS3A 1JWSD 4G50A 1WE6A 5BYQA 2J42A 1RLFA 3TSSA 2DAJA 1EU4A 1WGYA 1PGBA 2DWQA 4RM8A 2FCQA 2WP9B 4C7ZA 5BMIA 2RMMA 2J4XA 2KKCA 3V60A 2BS3B 2AX5A 4RF1A 3AEBB 1YQBA 2SEBD 2ZCBA 2PE6B 3A9JA 2ZPYA 4YTPB 3CF6E 1R7SA 4KGSA 3DDCB 2O6VD 3N1YC 2WXNA 3U7DA 3AE6B 2WXPA 4HXDA 2K8BA 3R2TA 4EUTA 3RD2A 2NPTA 2IPKD 4JQWC 2FCNA 2DZKA 2GRIA 4URKA 1R4NI 4A55A 2N9XA 1V9JA 3P2BA 2LRUA 4HDQA 1T0SC 3HVZA 4W9IA 4K1RB 1I4GA 1A70A 3Q3FA 2CHZA 2GBMA 4N9F4 4LCDE 3H8HA 4KGTA 5BMHA 2FUG1 3T3NA 3NVVA 1NI3A 2KJ6A 1JWUD 3HUIA 3Q3NC 3RFZB 1PGXA 4FADA 5EDSA 3BVGA 4FBJB 3R3MA 2NBVB 2E3TA 2INNE 2WGSA 4NJCA 4NNJB 2JSVX 2Z0EB 3QK0A 1JRPA 1PUTA 2XEWA 3EECA 1OQYA 3AU4A 4HKQA 3L08A 2PVOD 4JIOU 4RNAA 3P63A 1V97A 2L05A 3PZDA 4IG7B 3ZJVA 4PYZA 3HM3A 1MVKA 4YTMB 1OEYJ 2J0JA 1AARA 2GB1A 2G45B 2IY0B 1WX7A 3QA8A 2J53A 2C5LC 3D32A 4XC2A 3VH3B 3Q8EA 4WJNA 5FR3A 2LWPA 2LUMA 3WALA 1T0YA 2RDGA 2WLBA 3AEGB 2RD0A 2BB5A 3SFDB 3TBLD 5AZFA 1VRAB 1IP9A 2JRHA 2QIEB 4EEWA 2QC8A 1I4HA 2WDTB 1JROA 3EGRA 1KLVA 1WZ3A 1J8CA 3WIMA 2ACZB 3AMZA 4NZLB 2LJIA 3DBLI 1VZ8A 4GDLA 2JRIB 1F9JA 1QKZA 1P9DU 3V6EB 5G5HA 3KWVA 2WXJA 2RR9A 1IPGA 1WI0A 1MHXA 3K9OB 3PVLA 4G0NB 5TR5A 2LI5A 2J7QB 4IC7B 2IO2B 2SAKA 3MTNB 4ZRPA 1EUVB 2MEKA 2O6VB 3O65B 4ZYSA 2PE9A 1S1QB 1J7CA 4W9HA 1QF6A 2HTME 1WM2A 3GZNB 4L2YA 5DPTA 3BK1A 3KWLA 1F2RC 3GZNI 1CZPA 3Q3JA 2BWES 1MG8A 1SSNA 2W3SA 1Q1OA 2FBWB 2BQQA 3SU8X 3M62B 3BYYB 3OG5A 3LB8C 3QIJA 4J3OD 1M94A 3TEXA 4LNIA 2DLBA 1YN5A 2D07B 3S2AA 4TSSA 1UD7A 4LTUA 4RF0A 3TMPB 1V1OA 1WXSA 4YT0B 2D3BA 4A20A 4IWPA 5G55A 2KLGA 4KDLB 4P7IA 3Q6BA 2LUEA 4A3PA 1UUPA 1BMLC 3VDZA 3W9CB 1T0QC 3ONSA 4PK1A 3SEBA 4QAYA 1B9RA 1JWBD 5KHOA 3EHVA 3RN9C 4RGTA 4JLCA 2DYBA 2N0SB 2WU2B 3RNFC 2FCMA 2VH2A 2JQRB 1ZW7A 4S17A 3ZNGC 4C80A 1B1ZA 2CHXA 2YEPF 4P16A 3CMMB 1WFYA 3OAWA 1ZPSA 4M00A 3R2IA 1BT0A 4R3DA 3DOWA 4NQLB 2IY1B 3VUXA 4M0WB 3NY5A 2LGXA 2KWDA 3PREA 2W54A 2ASQA 2L00B 4GLSC 1QOFA 1F77A 3TIXA 3N9YC 3N32A 4HKZE 1L6UA 4IOIE 5IO9A 1ZUD2 3P4QB 1C77A 2GBJA 1ZE3D 2CU1A 1LGRA 4W9KA 4BKTA 2FIFA 1LM8B 3L17A 1D6EC 4HPLB 1EWYC 1OEYA 4P1BC 4XE0A 4G3XB 1I4XA 4II2B 1SIFA 2FIDA 5HI1A 2LGSA 4HK2A 2JYTA 2K0PA 3EUB2 2RPVA 3ENEA 3LYYA 1DYQA 1YJ1A 5CHVC 4NPNA 3DBRI 2WNMA 3H6NA 5C23A 3T8MA 4A90A 4MJSA 4LK0M 3NG0A 1RYJA 3X0WA 3ZJTA 3PHWB 3PS6A 2LMCA 2OJRA 1V8CA 3A9KA 4S0RA 4G11A 4LDTD 2CJOA 4HWIB 3A1QB 1FFUA 4W9LA 4JWSC 1V5OA 3N20C 3B0AA 2KN5A 2LJ5A 1VDVA 4NJ7A 3NHEB 4HROA 1K52A 4WWPA 1L6VA 1N60A 1DOXA 1ISNA 4KDIC 1Z5SB 4OZCA 1AYFA 1YOVB 4KKIA 1YJIA 2BKRB 2V4IB 3VQIA 1N61A 1TZ1A 1M4VA 1UZXB 2MP2B 1I35A 2N7EA 2BB6A 1KH0A 5IKCM 2KFKB 1NENB 3SDLC 4GDKB 2REXA 3NUHB 4KKJA 1KRHA 1SE3A 1SJHD 1XLNA 3SHQA 3N30A 2KMAA 1UH6A 3FILA 2OHFA 3I3TB 3N3KB 2M1MA 1OFFA 4E74A 1DGJA 2CR5A 1PQSA 2JZZA 1QILA 3M3JA 3NZUA 2CHWA 3ML9A 2M56B 3PSEB 3I9V1 4BKGA 1UWXA 4HCPB 4N59A 4KGRA 3U2SC 2WXOA 1SJED 2N9LA 3SR6A 2BKFA 1UBIA 2CJNA 2E6XA 3ZLZA 1MHHE 1WGHA 1N6ZA 4KVGB 3JYUA 4FULA 3QCAA 3PTFC 4JL9A 1UBQA 2BYVE 3ZRCA 2I38A 2HJ8A 4XYCA 4YSYB 2I1KA 3TEZA 4MM3B 3TEWA 5BYRA 2Y5PA 3VTUA 3H9DA 1MG4A 4BKSD 1JALA 2K1FA 3PRPB 5EE3A 1WMHA 1YN4A 2LXAA 1FFVA 1TGZB 4DHJD 3DPDA 2BS2B 5E6NA 1T0RC 1TT5B 1EM7A 2FAZA 3H7SA 3AM9A 4MH8A 1HZ5A 3ETRA 2LD9A 2QILA 2QDFA 4ANWA 1FRDA 2V4LA 5D2MB 2RSUA 1DOYA 5H92C 4BVUC 4GU2A 3EFCA 2GI9A 3ZKJC 3WCQA 3FAHA 5JH5C 1SXTA 3NJTA 2IO1B 2WXIA 3DCGA 1WGGA 2IJ0A 1FXTB 3JVZX 2TSSA 1VLBA 4OZBA 4ZRQA 2KTRA 2LXCA 1HQRD 2KJHB 4AOFA 4CO7A 3EFUA 2PMVA 3NVZA 4LDTB 4YWGG 3RMKC 1WJ4A 1CJEA 2JWUA 2AQ3B 4JE3B 3Q2AC 3ZXRA 2O2VA 3IT4B 3ZIMA 4EZJA 2WWZA 3Q8AA 2W9NA 2KACA 4WQOB 4DHZE 3RCZA 4PS8A 2JWZA 1VJKA 1E10A 5FK9C 5BYSA 3MP9A 4ICVA 2ZVNA 2INDC 1GNUA 4AWJA 4XWTA 1TS3A 1WRDB 4NAWA 4BOSC 4HCNB 1EU3A 2D3AA 5CX3A 1ZDXA 4DDID 4YSZB 2MQJA 2R2QA 4WJQA 3QC8B 4UDUC 1YX6B 3H7PA 2XK5A 1ENFA 2KD0A 5J17A 3JSVA 2AL6A 5LLIA 3IAS1 4MDKE 2KAJA 3L13A 3M95A 2WXLA 2V3SA 3B2GA 1FNUA 1CK1A 4ICUA 1N63A 4W9EA 1QOAA 1WYWB 4GIVA 2XN9C 1HZ6A 3PPAA 4D2KA 4WH4A 5DCNA 3RPFC 2WS3B 5HKHA 3L4PA 2NMQA 1UWMA 2FCSA 4K81A 2JUOA 2INCC 2J52A 4MSMB 3W1SA 2JT4B 1C4PA 3ZVVA 5HHDG 2CU3A 4MJSB 2KQ4X 2DENB 4ZYNA 4DHJB 1N62A 1SEBD 4RH6A 1N5WA 1BUIC 2ZCCA 1YN3A 2HTHA 2OJWA 2LVOA 3EC8A 1D5XC
chains in the Genus database with same CATH topology
2HD5B 2D07B 5CTRC 1GC7A 4YL8A 2KC1A 3IHPC 3S2AA 3ZTCA 2OOBB 4GSWA 3DVNU 4ZDVA 1UD7A 3R7RA 1J0GA 1YD8U 3TMPB 1WXSA 4BKSA 4FA6A 4FHKA 4A20A 2GOWA 3UQBA 4HJKA 4IWPA 4BBNF 4MGZE 2KLGA 2KO3A 3KUZA 4KDLB 3DVGY 4P7IA 3L0WB 4I6PA 5G55A 2JY6A 3OLMD 1YX5B 1CMXB 2MW5A 3C0RB 1UGMA 4GGQA 2LUEA 4A3PA 1S3SG 4RM9A 4GXBA 4W9CA 5L83A 2DYOA 3VDZA 2KQ7A 2KWVB 4KSKC 3U8ZA 3DVNV 2JPHA 2GMIC 5CHFA 2C60A 2GBNA 3ONSA 2KJRA 2DAFA 1EO6A 1V6EA 4F8CB 2JVCA 1V80A 5KHOA 2C7HA 2WYQA 3EHVA 1KJTA 3PRMB 4GN1A 2Z59B 3APFA 4MEMA 4JLCA 2KX0A 2JZ3B 2G4SA 1HE8A 1NBFC 2GBRA 3HK0A 1WM3A 3IFWB 2DX5B 2DYBA 1WGRA 4HDOA 2FCMA 1VCBA 5J2RA 4XZ4A 2K6QA 4AJWA 4OVUA 3SD5A 1GC6A 1WXMA 1ZW7A 3OJ4B 4TV3A 4FJZA 2DYMA 3IG3A 3R66C 3ZNGC 2LVQA 3VHTC 1GUAB 1LFDA 3KYDD 4DWFA 2CHXA 3QWZB 3CSTA 4EZKA 4ZRIA 1YIWA 4TKNA 3CMMB 2KDFB 2KOXA 3APDA 2MLBA 1WFYA 3AI5A 2KNBA 3OAWA 5AEKB 1BT0A 2C9WB 2IO0B 4KV2A 4II3B 1OTRB 2PEAA 4IM3A 2VRRB 3DOWA 4NQLB 2IY1B 2J0KA 1WY8A 3BY4B 3VUXA 2IBIB 4M0WB 1XQQA 4EFOA 2G4DB 1KM7A 2LGXA 3NY5A 1IYFA 4E71A 1P0RA 3PREA 4TQ1A 2ASQA 4W9GA 4HVBA 2KZRA 1WJNA 2L00B 4KSLC 2MRPA 2BF8B 3PLVA 3TIXA 4M8NA 2NCNA 2K25A 2B3AA 2KANA 2ZNVB 1SGHA 3N32A 2LGDA 5C1ZA 1E5WA 2N1WA 4XX5A 1TTNA 3QJZA 1UELA 4NY0A 4BBNC 3K9PB 2D10A 4KIKB 3QX1A 5D6JB 4J6IA 1C3TA 3ECIA 3ZW3A 2R2OA 5CHWA 3KVFB 4ANUA 3APCA 3ZDTA 1R4MI 2RPQA 2V1YA 2GBJA 2CU1A 3DQVA 2EKEC 3VH4B 2NS5A 3MJWA 4W9KA 2L0FA 3TJPA 4BKTA 4HLEA 2FIFA 1LM8B 5LXIB 2AWTA 1OGWA 2IYDB 3L17A 4HPLB 4IWQA 1OEYA 2DZIA 1WX8A 3W1SC 1WF9A 4GMVA 1E8XA 1LQBA 2CS4A 2ZZPB 4G3XB 4IUMB 3VUWA 3ZNZB 4II2B 3A9KB 1SIFA 2D11A 2XBBC 2FIDA 4W9JA 3ZNID 2NVUI 3UIOB 4WWOA 2IZVB 3DVGX 4A3OA 4GB9A 4KIKA 4K7UA 3ZDMC 1KOTA 1X1MA 2NBWB 2G3QB 4HK2A 4IW0A 2RGFA 2I1JA 2YVCA 3ENEA 3VTVA 2M8SA 4F7ZA 1YJ1A 1E90A 4K7WA 2N1VA 2KK8A 3PV1A 1TBEA 4NPNA 4NJ6A 5CHVC 3QARA 2LZ6A 3DBRI 3H6NA 2LVPA 5C23A 4IM0A 5BO4B 3T8MA 4MJSA 1WXAA 5DPSA 5JHBA 1WJUA 3X0WA 2LGYA 2ZJDA 4FN2A 3PHWB 4DBGA 3PS6A 4TQ0A 3L54A 2OJRA 4DDGD 4FJYA 1RAXA 4E3CA 1ZGUB 4ZRKA 3A4SC 3A9KA 3VTWA 4DHZB 2BYEA 3JW0X 3UINB 3QHTA 4G11A 4LDTD 5GMVA 2BYFA 4AJYB 4ANXA 4HWIB 1XT9B 1LXDA 2AEHA 3A1QB 5E6PA 4ANVA 2MBEA 3DBHI 4W9LA 4AP4C 1V5OA 3ML8A 1L2NA 2KWCA 3R7QA 5J18A 2FUHB 2KN5A 3B0AA 2DHZA 5JZEB 5IAAC 2LJ5A 4HPMB 3B08A 2PJHA 1C1YB 4NJ7A 1WXVA 5JHAA 3NHEB 4WWPA 3UIPB 4NAWB 1ISNA 4B6WA 3AU5A 2MBBB 4WJOA 2KDBA 2AYOB 2ZVOA 1Z5SB 2KC2A 3KUDB 3KYCD 4KDIC 3RULA 4MGYE 4BFRA 3PHXB 4W9DA 4DK5A 1WE7A 2BKRB 2KDEB 1H4RA 4CHKA 3VQIA 3PLUA 1TZ1A 4IM2A 3RYTA 5FR6A 2C7MB 1UZXB 1VD2A 3NZSA 5D7GA 3VFKA 1SE9A 2MP2B 1I35A 2K8HA 2N7EA 5AZHA 3WANA 3A1QA 2KFKB 1I42A 2NBUA 3JSVB 5LXHA 3SDLC 4GDKB 2REXA 4FHJA 4JGHB 2BPSA 3SHQA 4B9KA 3N30A 3KH0A 2KMAA 1UH6A 2MX2A 4PS3A 4EOYA 3A9JB 4LJOB 4G50A 3I3TB 3N3KB 2LASA 2M1MA 1WE6A 2L0TA 4E74A 1WR6E 2CR5A 2MBQA 1PQSA 1RLFA 2JZZA 3VXWA 3HM6X 3M3JA 4FLHA 2KWUB 3V6CB 3DBSA 2DAJA 3NZUA 4W9FA 2CHWA 3ML9A 1WGYA 2A4ZA 3U30A 4RM8A 2FCQA 1EF1A 4ZRJA 3PSEB 3W1YA 1JRUA 2MP2A 3WAOA 4FJVB 4BKGA 4HCPB 2KKCA 2KFKA 2MWSB 3V60A 1WMHB 2NPTB 4GDKA 4KZCA 1YQBA 2BKFA 1UBIA 3KW5B 2ZCBA 3L10B 2PE6B 3ZLZA 2HE7A 5G2NA 3A9JA 1WGHA 4F1SA 4KVGB 2ZPYA 2Y5BB 3RZWC 3JYUA 3CF6E 4MELA 2MCNB 1L7YA 4FULA 3QCAA 1NDDA 3PTFC 1UBQA 2BYVE 2JF5A 1P1AA 4JL9A 3ZRCA 2AL3A 3TCAA 3DDCB 2O6VD 2HJ8A 3U7DA 1WX9A 2CKHB 1WGDA 1ZKHA 2I1KA 4KZ0A 4HXDA 2K8BA 1P98A 2GBKA 3VTUA 3H9DA 4BKSD 2K1FA 2UYZB 3PRPB 2KLCA 4EUTA 3V62A 3RD2A 1WMHA 2NPTA 4NQKE 2NR2A 5E6OA 4JQWC 5KHQA 2FCNA 2LXAA 2C7NB 2DZKA 1TGZB 4DHJD 2FNJB 3DPDA 4EKUA 3H1UA 5E6NA 4URKA 1R4NI 2M17A 1WIAA 3NOBA 2N9XA 1V9JA 2FAZA 3ALBA 3H7SA 4WAAA 2KTRB 3P2BA 3UGBB 3VVWB 1V2YA 1EF5A 2LRUA 4HDQA 2LD9A 1GG3A 4W9IA 2N4FA 4K1RB 4ANWA 1A5RA 2BWFA 4MH0E 2J0MA 3HIZA 2V4LA 3Q3FA 2CHZA 1WZ0A 2GBMA 4N9F4 3X23A 3OJ3A 4LCDE 5D2MB 4MM3A 1WR1A 2RSUA 4K7SA 4BVUC 4GU2A 3ZKJC 2KJ6A 2MBOA 1GJZA 5JH5C 2O2VB 2K8CA 2WX0A 3LJ3A 2Z0DB 2IO1B 3DCGA 1E7UA 1WGGA 4X57B 1FXTB 3JVZX 3HHMA 4FADA 1U4AA 2DZMA 3GOEA 5D94A 2L8JA 3A33B 4MGKE 3WA0A 5EDSA 2KTRA 2LXCA 4FBJB 3R3MA 2NBVB 2WX1A 2L3ZA 4TUUA 2KJHB 4AOFA 4CO7A 3EFUA 4LDTB 4NNJB 1WJ4A 1Q5WB 2KVRA 4GOCA 4RMAA 5AZGA 4DXAB 1Y8RC 3L16A 4I6NB 4BOZB 1K8RB 1V49A 3V61A 2Z0EB 1G6JA 4WWNA 3QK0A 2N7DA 2DZJA 1V81A 1WJ6A 2XEWA 3ZO5B 3EECA 2O2VA 4WJPA 2EMSA 2ZPNA 1OQYA 3AU4A 3ZIMA 3IBEA 3VAWA 3L08A 4EZJA 4B95A 2WWZA 2W9NA 5DPRA 3H7PB 4JIOU 4IWOA 4WQOB 4DHZE 2XK5B 3RCZA 4PS8A 2JWZA 2IO3B 1E8ZA 2D3GA 2K6DB 2D2QA 2L05A 3A4RA 1XD3B 3PZDA 3RT3B 4IG7B 2KMCA 2MBHA 2PPHA 4PYZA 2EMTA 3UF8A 4ICVA 3BINA 3HM3A 2ZVNA 3AULA 1GNUA 4AWJA 1OEYJ 1WRDB 2J0JA 1AARA 4NAWA 4BOSC 4HCNB 5CX3A 3RUIB 2G45B 2M0XA 4I6LB 1H8CA 2BGFA 4GDLB 4DDID 2KX3A 2IY0B 1WX7A 2N9EB 3QA8A 2C5LC 3D32A 4XC2A 2MQJA 3VH3B 2R2QA 1WH3A 3IVFA 3ZUNA 4WJNA 2LWPA 3MHSD 5IA7A 2K39A 3WALA 1T0YA 4WJQA 3QC8B 3QAQA 1YX6B 3H7PA 2RD0A 3AXCA 2XK5A 3TBLD 2KD0A 5J17A 3RZFA 5AZFA 1IP9A 2JRHA 3JSVA 2AL6A 3M63B 5LLIA 4EEWA 2WDTB 2L7RA 4MDKE 4M8MA 3ZNHB 4EZLA 1KLVA 3L13A 3M95A 1WZ3A 1J8CA 2V3SA 3KUCB 3WIMA 2UWQA 3DBLI 4AUQC 4ICUA 3T9LA 3PGEA 4GDLA 2JRIB 1F9JA 4W9EA 1P9DU 3V6EB 1WYWB 3TL5A 2MSED 4GIVA 2LRWA 2RR9A 3NS8A 1IPGA 1WI0A 4LJPB 3UQAA 3WAMA 3PVLA 3K9OB 3PPAA 4G0NB 3ZRFA 2KQSA 2KTFA 5TR5A 2LI5A 2J7QB 4MSQB 1Z2MA 1V86A 2IO2B 2ZEQA 4IC7B 3MTNB 1EUVB 2QHOA 1E8WA 2O6VB 3O65B 2KHWB 1RFAA 5DCNA 2PE9A 1S1QB 3B1LX 5DPWA 5HKHA 4W9HA 1V5TA 3LDZE 1E7VA 1QZEA 4OVVA 2FCSA 2N9PC 2JUOA 2KFJA 4K81A 1WM2A 2ZNVC 4MSMB 5DPTA 3WAPA 3W1SA 3ZTDA 1E8YA 2JT4B 2JXXA 3GZNI 2KDIA 3PRZA 3ZVVA 5L95C 3Q3JA 4MJSB 3QQ8B 2BWES 2MA9B 1MG8A 2DENB 2M4NA 4ZYNA 4DHJB 1Q0WB 2KXJA 1D3ZA 3CSFA 1P3QU 1J19A 1Q1OA 4ASWC 1NI2A 3SU8X 3M62B 2ZCCA 1RRBA 3QIJA 2HTHA 4MGIE 3VUYA 2L76A 2LVOA 1M94A 3EC8A 3PT2B 2A5UA 4PS7A 2YLMA 4PYUA 2O6VA 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HD5 B;  2D07 B;  5CTR C;  1GC7 A;  4YL8 A;  2KC1 A;  3IHP C;  3S2A A;  3ZTC A;  2OOB B;  4GSW A;  3DVN U;  4ZDV A;  1UD7 A;  3R7R A;  1J0G A;  1YD8 U;  3TMP B;  1WXS A;  4BKS A;  4FA6 A;  4FHK A;  4A20 A;  2GOW A;  3UQB A;  4HJK A;  4IWP A;  4BBN F;  4MGZ E;  2KLG A;  2KO3 A;  3KUZ A;  4KDL B;  3DVG Y;  4P7I A;  3L0W B;  4I6P A;  5G55 A;  2JY6 A;  3OLM D;  1YX5 B;  1CMX B;  2MW5 A;  3C0R B;  1UGM A;  4GGQ A;  2LUE A;  4A3P A;  1S3S G;  4RM9 A;  4GXB A;  4W9C A;  5L83 A;  2DYO A;  3VDZ A;  2KQ7 A;  2KWV B;  4KSK C;  3U8Z A;  3DVN V;  2JPH A;  2GMI C;  5CHF A;  2C60 A;  2GBN A;  3ONS A;  2KJR A;  2DAF A;  1EO6 A;  1V6E A;  4F8C B;  2JVC A;  1V80 A;  5KHO A;  2C7H A;  2WYQ A;  3EHV A;  1KJT A;  3PRM B;  4GN1 A;  2Z59 B;  3APF A;  4MEM A;  4JLC A;  2KX0 A;  2JZ3 B;  2G4S A;  1HE8 A;  1NBF C;  2GBR A;  3HK0 A;  1WM3 A;  3IFW B;  2DX5 B;  2DYB A;  1WGR A;  4HDO A;  2FCM A;  1VCB A;  5J2R A;  4XZ4 A;  2K6Q A;  4AJW A;  4OVU A;  3SD5 A;  1GC6 A;  1WXM A;  1ZW7 A;  3OJ4 B;  4TV3 A;  4FJZ A;  2DYM A;  3IG3 A;  3R66 C;  3ZNG C;  2LVQ A;  3VHT C;  1GUA B;  1LFD A;  3KYD D;  4DWF A;  2CHX A;  3QWZ B;  3CST A;  4EZK A;  4ZRI A;  1YIW A;  4TKN A;  3CMM B;  2KDF B;  2KOX A;  3APD A;  2MLB A;  1WFY A;  3AI5 A;  2KNB A;  3OAW A;  5AEK B;  1BT0 A;  2C9W B;  2IO0 B;  4KV2 A;  4II3 B;  1OTR B;  2PEA A;  4IM3 A;  2VRR B;  3DOW A;  4NQL B;  2IY1 B;  2J0K A;  1WY8 A;  3BY4 B;  3VUX A;  2IBI B;  4M0W B;  1XQQ A;  4EFO A;  2G4D B;  1KM7 A;  2LGX A;  3NY5 A;  1IYF A;  4E71 A;  1P0R A;  3PRE A;  4TQ1 A;  2ASQ A;  4W9G A;  4HVB A;  2KZR A;  1WJN A;  2L00 B;  4KSL C;  2MRP A;  2BF8 B;  3PLV A;  3TIX A;  4M8N A;  2NCN A;  2K25 A;  2B3A A;  2KAN A;  2ZNV B;  1SGH A;  3N32 A;  2LGD A;  5C1Z A;  1E5W A;  2N1W A;  4XX5 A;  1TTN A;  3QJZ A;  1UEL A;  4NY0 A;  4BBN C;  3K9P B;  2D10 A;  4KIK B;  3QX1 A;  5D6J B;  4J6I A;  1C3T A;  3ECI A;  3ZW3 A;  2R2O A;  5CHW A;  3KVF B;  4ANU A;  3APC A;  3ZDT A;  1R4M I;  2RPQ A;  2V1Y A;  2GBJ A;  2CU1 A;  3DQV A;  2EKE C;  3VH4 B;  2NS5 A;  3MJW A;  4W9K A;  2L0F A;  3TJP A;  4BKT A;  4HLE A;  2FIF A;  1LM8 B;  5LXI B;  2AWT A;  1OGW A;  2IYD B;  3L17 A;  4HPL B;  4IWQ A;  1OEY A;  2DZI A;  1WX8 A;  3W1S C;  1WF9 A;  4GMV A;  1E8X A;  1LQB A;  2CS4 A;  2ZZP B;  4G3X B;  4IUM B;  3VUW A;  3ZNZ B;  4II2 B;  3A9K B;  1SIF A;  2D11 A;  2XBB C;  2FID A;  4W9J A;  3ZNI D;  2NVU I;  3UIO B;  4WWO A;  2IZV B;  3DVG X;  4A3O A;  4GB9 A;  4KIK A;  4K7U A;  3ZDM C;  1KOT A;  1X1M A;  2NBW B;  2G3Q B;  4HK2 A;  4IW0 A;  2RGF A;  2I1J A;  2YVC A;  3ENE A;  3VTV A;  2M8S A;  4F7Z A;  1YJ1 A;  1E90 A;  4K7W A;  2N1V A;  2KK8 A;  3PV1 A;  1TBE A;  4NPN A;  4NJ6 A;  5CHV C;  3QAR A;  2LZ6 A;  3DBR I;  3H6N A;  2LVP A;  5C23 A;  4IM0 A;  5BO4 B;  3T8M A;  4MJS A;  1WXA A;  5DPS A;  5JHB A;  1WJU A;  3X0W A;  2LGY A;  2ZJD A;  4FN2 A;  3PHW B;  4DBG A;  3PS6 A;  4TQ0 A;  3L54 A;  2OJR A;  4DDG D;  4FJY A;  1RAX A;  4E3C A;  1ZGU B;  4ZRK A;  3A4S C;  3A9K A;  3VTW A;  4DHZ B;  2BYE A;  3JW0 X;  3UIN B;  3QHT A;  4G11 A;  4LDT D;  5GMV A;  2BYF A;  4AJY B;  4ANX A;  4HWI B;  1XT9 B;  1LXD A;  2AEH A;  3A1Q B;  5E6P A;  4ANV A;  2MBE A;  3DBH I;  4W9L A;  4AP4 C;  1V5O A;  3ML8 A;  1L2N A;  2KWC A;  3R7Q A;  5J18 A;  2FUH B;  2KN5 A;  3B0A A;  2DHZ A;  5JZE B;  5IAA C;  2LJ5 A;  4HPM B;  3B08 A;  2PJH A;  1C1Y B;  4NJ7 A;  1WXV A;  5JHA A;  3NHE B;  4WWP A;  3UIP B;  4NAW B;  1ISN A;  4B6W A;  3AU5 A;  2MBB B;  4WJO A;  2KDB A;  2AYO B;  2ZVO A;  1Z5S B;  2KC2 A;  3KUD B;  3KYC D;  4KDI C;  3RUL A;  4MGY E;  4BFR A;  3PHX B;  4W9D A;  4DK5 A;  1WE7 A;  2BKR B;  2KDE B;  1H4R A;  4CHK A;  3VQI A;  3PLU A;  1TZ1 A;  4IM2 A;  3RYT A;  5FR6 A;  2C7M B;  1UZX B;  1VD2 A;  3NZS A;  5D7G A;  3VFK A;  1SE9 A;  2MP2 B;  1I35 A;  2K8H A;  2N7E A;  5AZH A;  3WAN A;  3A1Q A;  2KFK B;  1I42 A;  2NBU A;  3JSV B;  5LXH A;  3SDL C;  4GDK B;  2REX A;  4FHJ A;  4JGH B;  2BPS A;  3SHQ A;  4B9K A;  3N30 A;  3KH0 A;  2KMA A;  1UH6 A;  2MX2 A;  4PS3 A;  4EOY A;  3A9J B;  4LJO B;  4G50 A;  3I3T B;  3N3K B;  2LAS A;  2M1M A;  1WE6 A;  2L0T A;  4E74 A;  1WR6 E;  2CR5 A;  2MBQ A;  1PQS A;  1RLF A;  2JZZ A;  3VXW A;  3HM6 X;  3M3J A;  4FLH A;  2KWU B;  3V6C B;  3DBS A;  2DAJ A;  3NZU A;  4W9F A;  2CHW A;  3ML9 A;  1WGY A;  2A4Z A;  3U30 A;  4RM8 A;  2FCQ A;  1EF1 A;  4ZRJ A;  3PSE B;  3W1Y A;  1JRU A;  2MP2 A;  3WAO A;  4FJV B;  4BKG A;  4HCP B;  2KKC A;  2KFK A;  2MWS B;  3V60 A;  1WMH B;  2NPT B;  4GDK A;  4KZC A;  1YQB A;  2BKF A;  1UBI A;  3KW5 B;  2ZCB A;  3L10 B;  2PE6 B;  3ZLZ A;  2HE7 A;  5G2N A;  3A9J A;  1WGH A;  4F1S A;  4KVG B;  2ZPY A;  2Y5B B;  3RZW C;  3JYU A;  3CF6 E;  4MEL A;  2MCN B;  1L7Y A;  4FUL A;  3QCA A;  1NDD A;  3PTF C;  1UBQ A;  2BYV E;  2JF5 A;  1P1A A;  4JL9 A;  3ZRC A;  2AL3 A;  3TCA A;  3DDC B;  2O6V D;  2HJ8 A;  3U7D A;  1WX9 A;  2CKH B;  1WGD A;  1ZKH A;  2I1K A;  4KZ0 A;  4HXD A;  2K8B A;  1P98 A;  2GBK A;  3VTU A;  3H9D A;  4BKS D;  2K1F A;  2UYZ B;  3PRP B;  2KLC A;  4EUT A;  3V62 A;  3RD2 A;  1WMH A;  2NPT A;  4NQK E;  2NR2 A;  5E6O A;  4JQW C;  5KHQ A;  2FCN A;  2LXA A;  2C7N B;  2DZK A;  1TGZ B;  4DHJ D;  2FNJ B;  3DPD A;  4EKU A;  3H1U A;  5E6N A;  4URK A;  1R4N I;  2M17 A;  1WIA A;  3NOB A;  2N9X A;  1V9J A;  2FAZ A;  3ALB A;  3H7S A;  4WAA A;  2KTR B;  3P2B A;  3UGB B;  3VVW B;  1V2Y A;  1EF5 A;  2LRU A;  4HDQ A;  2LD9 A;  1GG3 A;  4W9I A;  2N4F A;  4K1R B;  4ANW A;  1A5R A;  2BWF A;  4MH0 E;  2J0M A;  3HIZ A;  2V4L A;  3Q3F A;  2CHZ A;  1WZ0 A;  2GBM A;  4N9F 4;  3X23 A;  3OJ3 A;  4LCD E;  5D2M B;  4MM3 A;  1WR1 A;  2RSU A;  4K7S A;  4BVU C;  4GU2 A;  3ZKJ C;  2KJ6 A;  2MBO A;  1GJZ A;  5JH5 C;  2O2V B;  2K8C A;  2WX0 A;  3LJ3 A;  2Z0D B;  2IO1 B;  3DCG A;  1E7U A;  1WGG A;  4X57 B;  1FXT B;  3JVZ X;  3HHM A;  4FAD A;  1U4A A;  2DZM A;  3GOE A;  5D94 A;  2L8J A;  3A33 B;  4MGK E;  3WA0 A;  5EDS A;  2KTR A;  2LXC A;  4FBJ B;  3R3M A;  2NBV B;  2WX1 A;  2L3Z A;  4TUU A;  2KJH B;  4AOF A;  4CO7 A;  3EFU A;  4LDT B;  4NNJ B;  1WJ4 A;  1Q5W B;  2KVR A;  4GOC A;  4RMA A;  5AZG A;  4DXA B;  1Y8R C;  3L16 A;  4I6N B;  4BOZ B;  1K8R B;  1V49 A;  3V61 A;  2Z0E B;  1G6J A;  4WWN A;  3QK0 A;  2N7D A;  2DZJ A;  1V81 A;  1WJ6 A;  2XEW A;  3ZO5 B;  3EEC A;  2O2V A;  4WJP A;  2EMS A;  2ZPN A;  1OQY A;  3AU4 A;  3ZIM A;  3IBE A;  3VAW A;  3L08 A;  4EZJ A;  4B95 A;  2WWZ A;  2W9N A;  5DPR A;  3H7P B;  4JIO U;  4IWO A;  4WQO B;  4DHZ E;  2XK5 B;  3RCZ A;  4PS8 A;  2JWZ A;  2IO3 B;  1E8Z A;  2D3G A;  2K6D B;  2D2Q A;  2L05 A;  3A4R A;  1XD3 B;  3PZD A;  3RT3 B;  4IG7 B;  2KMC A;  2MBH A;  2PPH A;  4PYZ A;  2EMT A;  3UF8 A;  4ICV A;  3BIN A;  3HM3 A;  2ZVN A;  3AUL A;  1GNU A;  4AWJ A;  1OEY J;  1WRD B;  2J0J A;  1AAR A;  4NAW A;  4BOS C;  4HCN B;  5CX3 A;  3RUI B;  2G45 B;  2M0X A;  4I6L B;  1H8C A;  2BGF A;  4GDL B;  4DDI D;  2KX3 A;  2IY0 B;  1WX7 A;  2N9E B;  3QA8 A;  2C5L C;  3D32 A;  4XC2 A;  2MQJ A;  3VH3 B;  2R2Q A;  1WH3 A;  3IVF A;  3ZUN A;  4WJN A;  2LWP A;  3MHS D;  5IA7 A;  2K39 A;  3WAL A;  1T0Y A;  4WJQ A;  3QC8 B;  3QAQ A;  1YX6 B;  3H7P A;  2RD0 A;  3AXC A;  2XK5 A;  3TBL D;  2KD0 A;  5J17 A;  3RZF A;  5AZF A;  1IP9 A;  2JRH A;  3JSV A;  2AL6 A;  3M63 B;  5LLI A;  4EEW A;  2WDT B;  2L7R A;  4MDK E;  4M8M A;  3ZNH B;  4EZL A;  1KLV A;  3L13 A;  3M95 A;  1WZ3 A;  1J8C A;  2V3S A;  3KUC B;  3WIM A;  2UWQ A;  3DBL I;  4AUQ C;  4ICU A;  3T9L A;  3PGE A;  4GDL A;  2JRI B;  1F9J A;  4W9E A;  1P9D U;  3V6E B;  1WYW B;  3TL5 A;  2MSE D;  4GIV A;  2LRW A;  2RR9 A;  3NS8 A;  1IPG A;  1WI0 A;  4LJP B;  3UQA A;  3WAM A;  3PVL A;  3K9O B;  3PPA A;  4G0N B;  3ZRF A;  2KQS A;  2KTF A;  5TR5 A;  2LI5 A;  2J7Q B;  4MSQ B;  1Z2M A;  1V86 A;  2IO2 B;  2ZEQ A;  4IC7 B;  3MTN B;  1EUV B;  2QHO A;  1E8W A;  2O6V B;  3O65 B;  2KHW B;  1RFA A;  5DCN A;  2PE9 A;  1S1Q B;  3B1L X;  5DPW A;  5HKH A;  4W9H A;  1V5T A;  3LDZ E;  1E7V A;  1QZE A;  4OVV A;  2FCS A;  2N9P C;  2JUO A;  2KFJ A;  4K81 A;  1WM2 A;  2ZNV C;  4MSM B;  5DPT A;  3WAP A;  3W1S A;  3ZTD A;  1E8Y A;  2JT4 B;  2JXX A;  3GZN I;  2KDI A;  3PRZ A;  3ZVV A;  5L95 C;  3Q3J A;  4MJS B;  3QQ8 B;  2BWE S;  2MA9 B;  1MG8 A;  2DEN B;  2M4N A;  4ZYN A;  4DHJ B;  1Q0W B;  2KXJ A;  1D3Z A;  3CSF A;  1P3Q U;  1J19 A;  1Q1O A;  4ASW C;  1NI2 A;  3SU8 X;  3M62 B;  2ZCC A;  1RRB A;  3QIJ A;  2HTH A;  4MGI E;  3VUY A;  2L76 A;  2LVO A;  1M94 A;  3EC8 A;  3PT2 B;  2A5U A;  4PS7 A;  2YLM A;  4PYU A;  2O6V A;  4CYE A; 
#chains in the Genus database with same CATH topology
 3GS2 A;  2MJ3 A;  2KDM A;  4FA6 A;  4FHK A;  4BAX A;  3UQB A;  3U4E G;  1KTK A;  2KO3 A;  3P4P B;  2JY6 A;  3OLM D;  1YX5 B;  1L0Y B;  1ZOY B;  2H89 B;  2KQ7 A;  3U8Z A;  2C60 A;  1QQR A;  4RFB A;  1FXA A;  4F8C B;  1XLO A;  1AWD A;  3PRM B;  2Z59 B;  4MT5 A;  3BVZ A;  2JZ3 B;  1NBF C;  2WXF A;  1VCB A;  4XZ4 A;  3UI3 A;  3BK2 A;  1P7E A;  2K6Q A;  4L23 A;  1WXM A;  3OJ4 B;  3SD5 A;  2V0G A;  4LLG M;  4RGO S;  1L4Z B;  3VHT C;  1LFD A;  3KYD D;  4WUR A;  4M01 A;  4EZK A;  3AE9 B;  1PGA A;  4ZRI A;  5EE1 A;  2KNB A;  2PTL A;  2C9W B;  2IO0 B;  3BWU D;  4II3 B;  5D3D A;  3P4R B;  2VRR B;  3IAM 1;  1L0X B;  3PO0 A;  3ZYY X;  1I4P A;  2PW9 A;  2J0K A;  1WY8 A;  3BY4 B;  2IBI B;  4EFO A;  5JXV A;  1P0R A;  4JWU C;  1V1P A;  4KSL C;  4FXC A;  5IOI A;  3DHI C;  2K25 A;  2KAN A;  2ZNV B;  2L52 A;  5T8I A;  1RWS A;  4XX5 A;  1TTN A;  1WXQ A;  1TYG B;  3AEF B;  4BBN C;  5AUI A;  4N6E B;  3ZW3 A;  4C4V A;  1R4M B;  1MI0 A;  3VRA B;  1R4M I;  2RPQ A;  4Q2J A;  3V3X A;  1L0V B;  3VH4 B;  1I4Q A;  2EKI A;  2L0F A;  4HLE A;  5LXI B;  2QMT A;  1UF0 A;  2N9K A;  4AQ7 A;  4IWQ A;  1WX8 A;  1SIJ A;  4AS1 A;  4IUM B;  2ONQ A;  1E0Z A;  3RNG C;  2W55 A;  4W9J A;  2NVU I;  3UIO B;  2IZV B;  4GB9 A;  4KIK A;  1VZ7 A;  2RGF A;  2YVC A;  1KLG D;  2LFI A;  1YQ3 B;  3NRZ A;  2MHJ A;  2PVG C;  4K7W A;  4LNN A;  3QAR A;  1JCK B;  4IM0 A;  1WXA A;  2JYE A;  1C9F A;  2K3U A;  4P1C C;  2LGY A;  4DDG D;  4E3C A;  1ZGU B;  3A4S C;  4DHZ B;  3AV8 A;  3UIN B;  3DBH B;  2BYF A;  4ANX A;  2AEH A;  2WXK A;  3DBH I;  2BT6 A;  1WGK A;  3AE8 B;  5IAA C;  2PJH A;  1C1Y B;  1WXV A;  4NAW B;  1STE A;  2M19 A;  3AU5 A;  2MBB B;  2KDB A;  2AYO B;  2ZVO A;  3KUD B;  4CQN A;  1L4D B;  2PKO A;  4US9 A;  3PHX B;  4W9D A;  2ZW1 A;  4DK5 A;  1WE7 A;  3P4S B;  2KDE B;  1H4R A;  4CHK A;  3PLU A;  4IM2 A;  3AE2 B;  3NZS A;  1SE9 A;  1GB1 A;  2NBU A;  3JSV B;  5LXH A;  2KT7 A;  2BPS A;  3KH0 A;  2MX2 A;  4OW0 A;  1FRR A;  3A9J B;  4HPP A;  4LJO B;  4EOY A;  5IP4 D;  5LNK 1;  2LAS A;  2QJL A;  3AH7 A;  1MJD A;  2MBQ A;  3AE7 B;  4K3B A;  2OED A;  2KWU B;  3DBS A;  2A4Z A;  1QOB A;  3BII D;  4ZRJ A;  1JRU A;  3WAO A;  1UNS A;  1TS5 A;  2NPT B;  2DBY A;  4MAC A;  1OQQ A;  1FIQ A;  3L10 B;  5BMG A;  4F1S A;  3N1X C;  2Y5B B;  1TS2 A;  3RZW C;  4ZHO A;  4MEL A;  1L7Y A;  2JF5 A;  1P1A A;  1IBX A;  1WX9 A;  4K3C A;  2CKH B;  1ZKH A;  2GBK A;  4HJG E;  1FXI A;  2UYZ B;  2KLC A;  3V62 A;  4ARI A;  2C7N B;  3ZGZ A;  3ZXV A;  2YEP B;  1WIA A;  3ALB A;  4A8X C;  2K5P A;  2HJ1 A;  3UGB B;  1YJJ A;  1EF5 A;  3VR9 B;  1GG3 A;  4YTN B;  1A5R A;  2BWF A;  1TS4 A;  1WZ0 A;  3X23 A;  3OJ3 A;  4K7S A;  2X8X X;  3R8B A;  5AUK A;  2K8C A;  2WX0 A;  4X57 B;  3HHM A;  1U4A A;  3GOE A;  5D94 A;  2WXG A;  3RNC C;  4MGK E;  4WAF A;  2UU7 A;  4TUU A;  4LNK A;  1C4C A;  2WXH A;  4GOC A;  4RMA A;  4DXA B;  1Y8R C;  3L16 A;  3NS1 A;  4I6N B;  1K8R B;  1V49 A;  2KVZ A;  1K51 A;  3RI7 C;  3V61 A;  4WWN A;  2N7D A;  1V81 A;  1WJ6 A;  4REZ A;  3VRB B;  4WJP A;  2EMS A;  1SBB B;  3VAW A;  4DXF A;  5EE9 A;  4B95 A;  5DPR A;  4B0E A;  2JU6 X;  4IWO A;  1YMH E;  2D3G A;  1XD3 B;  3RT3 B;  2PPH A;  2EMT A;  2MJD A;  3AUL A;  1FCL A;  2BS4 B;  2Q5W D;  1XF5 L;  3TUO A;  3RUI B;  3AEC B;  4C00 A;  2M0X A;  4I6L B;  1H8C A;  2BGF A;  4GDL B;  1V1P B;  4C7Y A;  1ESF A;  4USA A;  3ZUN A;  3Q8F A;  3O13 A;  1PFD A;  3MHS D;  1KFY B;  2K39 A;  3MHZ A;  2WDR B;  3W2D A;  4RCO A;  3QAQ A;  3AXC A;  1EWC A;  2MH7 A;  3M63 B;  4P6V F;  2L7R A;  4M8M A;  1GPX A;  2WDV B;  3TEY A;  3Q8B A;  4AUQ C;  3PGE A;  2VH1 A;  2MSE D;  3NS8 A;  4LJP B;  2LGI A;  1XLP A;  3ZRF A;  2KQS A;  4HRS A;  1V86 A;  2ZEQ A;  1C78 A;  1E8W A;  5HFY A;  2KHW B;  2W3R A;  5DPW A;  3NVY A;  1QZE A;  4OVV A;  3U52 E;  2N9P C;  2KFJ A;  1TKY A;  5C2T B;  3ZTD A;  1E8Y A;  1AN8 A;  2KDI A;  3PRZ A;  5L95 C;  3DHH C;  2M4N A;  2AQ1 B;  1Q0W B;  1D3Z A;  4DXG A;  3CSF A;  2W82 A;  2LHE A;  2HDE A;  3PT2 B;  2YLM A;  2O6V A;  4CYE A;  2IGD A;  4YL8 A;  2KC1 A;  1PDX A;  3IHP C;  3ZTC A;  4GSW A;  4ZDV A;  2QCZ A;  3J9C A;  2LEK A;  1GOZ A;  4ZOH C;  2FE8 A;  4BBN F;  4MGZ E;  1XCT L;  3KUZ A;  3DVG Y;  3L0W B;  4I6P A;  1GB4 A;  1CMX B;  2MJE A;  2MW5 A;  5HG2 A;  4GGQ A;  3BYT B;  4RM9 A;  5L83 A;  2DYO A;  4KSK C;  3DVN V;  5CHF A;  2GBN A;  2KJR A;  2DAF A;  4XDC A;  1V6E A;  2JVC A;  1V80 A;  2C7H A;  2H88 B;  4GN1 A;  2GBR A;  2BW2 A;  3HK0 A;  3LXF A;  4HDO A;  1T6B X;  2WQY B;  4WWM A;  5J2R A;  4TMA B;  4L1B A;  4AJW A;  4OVU A;  3FC4 A;  1YQ4 B;  2LVQ A;  1GUA B;  3FKY A;  1HA5 A;  4DWF A;  3CST A;  1YIW A;  4TKN A;  2KDF B;  2ZW0 A;  3APD A;  2MLB A;  5AEK B;  1XEE A;  2RDH A;  1P7F A;  4IM3 A;  2N7J A;  1MPE A;  2RDB C;  3Q69 A;  1FEH A;  1IYF A;  1D5M C;  1ZXH A;  2BYT A;  1IBX B;  4W9G A;  2KZR A;  1J7B A;  3I63 C;  4M8N A;  3MC0 B;  3AB5 A;  2NCN A;  3PZ7 A;  3Q8C A;  1SGH A;  2LGD A;  1TZO A;  2WU5 B;  5C1Z A;  3QJZ A;  2D10 A;  1F2R I;  3QX1 A;  5D6J B;  4J6I A;  1WSP A;  3AE4 B;  1FD6 A;  3ECI A;  5CHW A;  3NVW A;  4ANU A;  3APC A;  4M0W A;  2R61 A;  3DQV A;  1LO5 D;  2EKE C;  2NS5 A;  3MJW A;  2AWT A;  1OGW A;  2AQ2 B;  3NZ3 A;  1E8X A;  1LQB A;  2ZZP B;  1TJE A;  3B2F A;  3A9K B;  1D5Z C;  2XBB C;  1R4N B;  4A3O A;  1FO4 A;  4K7U A;  1TY2 A;  1FMA D;  1X1M A;  2G3Q B;  2NBW B;  2KN4 A;  1BXT A;  4IW0 A;  2I1J A;  1AW7 A;  2ON8 A;  2M8S A;  2N1V A;  1TBE A;  4NJ6 A;  2LZ6 A;  2LVP A;  1WWT A;  5BO4 B;  4XGA B;  4LNF A;  5JHB A;  2ZJD A;  3MJ5 A;  3L54 A;  4FJY A;  3VTW A;  2BYE A;  2WHI A;  1YNT E;  4IDI A;  2K9X A;  3W5V B;  3AE5 B;  4AJY B;  4A6Q A;  1XT9 B;  2MBE A;  3ML8 A;  2M0A A;  3R7Q A;  5J18 A;  1K53 A;  2FUH B;  1NEK B;  2DHZ A;  3KQ4 A;  2PIA A;  3B08 A;  5JHA A;  3FIL B;  3UIP B;  4B6W A;  3R7R A;  1IUE A;  2KC2 A;  3RUL A;  2QEJ C;  1NYQ A;  1FNV A;  1RFK A;  3RYT A;  5FR6 A;  3E9S A;  1VD2 A;  3BZD B;  1FCC C;  5D7G A;  1QOG A;  4XDD A;  3A1Q A;  1I42 A;  2D3C A;  1L5P A;  1F52 A;  3ZJU A;  1PYW D;  1Q10 A;  5GXG B;  4B0M A;  5IN7 A;  4ARC A;  3CWI A;  1SE4 A;  2L0T A;  1WR6 E;  2G1E A;  3VXW A;  3HM6 X;  1GAQ B;  2INP E;  4FLH A;  3V6C B;  2VZK D;  4W9F A;  4LNO A;  2JXT A;  4YSX B;  3U30 A;  1EF1 A;  3W1Y A;  1VZ6 A;  2MP2 A;  4FJV B;  2KFK A;  2MWS B;  1T3Q A;  1WMH B;  2BTE A;  1XXG A;  4GDK A;  4KZC A;  4KX6 B;  3KW5 B;  1NYR A;  4JX1 C;  2HE7 A;  5G2N A;  3DBL B;  1JWA D;  2MCN B;  1RM6 C;  5E6J A;  1NDD A;  2WXQ A;  2AL3 A;  3TCA A;  1FNW A;  3URY A;  1WGD A;  2WDQ B;  4KZ0 A;  1ZDV A;  1P98 A;  3I5J C;  2LHD A;  4NQK E;  4O1N A;  2NR2 A;  5E6O A;  1SB3 C;  5KHQ A;  4EKU A;  2FNJ B;  3H1U A;  2M17 A;  3NOB A;  3RNE C;  4WAA A;  2KTR B;  1IGD A;  3VVW B;  1V2Y A;  3KLS X;  2BVC A;  1CQV A;  2N4F A;  3AEE B;  1HXY D;  4YXD B;  4MH0 E;  2J0M A;  3HIZ A;  1ACC A;  1HTQ A;  4MM3 A;  1WR1 A;  3B9J A;  4OZA A;  5TSS A;  2MBO A;  1GJZ A;  2O2V B;  3P42 A;  3LJ3 A;  1E7P B;  2Z0D B;  3ABV B;  2WXR A;  1E7U A;  2DZM A;  2L8J A;  3A33 B;  3WA0 A;  1ZP0 B;  2WX1 A;  2L3Z A;  4PT5 A;  4C56 C;  3DHG C;  1Q5W B;  2KVR A;  4OVZ A;  1I4R A;  5AZG A;  4BOZ B;  4IKG A;  1G6J A;  3DWG C;  2IDY A;  2DZJ A;  2NTS A;  3ZO5 B;  3EA6 A;  2WXM A;  2ZPN A;  3IBE A;  1XO3 A;  3V05 A;  1VR9 A;  5C3J B;  3RNA C;  3H7P B;  2IGH A;  2XK5 B;  3VR8 B;  2IO3 B;  3N1Z C;  1JML A;  1E8Z A;  2K6D B;  2D2Q A;  3A4R A;  4NAM A;  2KMC A;  2MBH A;  3IT6 B;  3UF8 A;  1JW9 D;  3BIN A;  1NVI D;  3IXS A;  1KF6 B;  2V3N A;  2L32 A;  3C8Y A;  5EE0 A;  2KX3 A;  2KYW A;  2N9E B;  3MC8 A;  1C79 A;  1XCQ L;  3RNB C;  3IVF A;  1WH3 A;  2Y3A A;  5IA7 A;  1J7A A;  3P1M A;  1ET6 A;  5D3I B;  2Y5C A;  3RZF A;  1C4A A;  1XLQ A;  2VZK B;  3ZNH B;  4EZL A;  3ZQ4 A;  3KUC B;  3E56 A;  2UWQ A;  5MPO A;  3T9L A;  1KLU D;  3TL5 A;  2DNF A;  2LRW A;  4WQM A;  3UQA A;  3WAM A;  2KTF A;  4MSQ B;  1Z2M A;  2QHO A;  4N58 A;  5H8Y E;  1RFA A;  3B1L X;  4ACF A;  2X38 A;  1V5T A;  3LDZ E;  1TIF A;  1E7V A;  1Y56 A;  1SF0 A;  2ZNV C;  1N5X A;  3WAP A;  1C76 A;  3AEA B;  2JXX A;  4ZHP A;  1FPY A;  3U7Z A;  3QQ8 B;  2MA9 B;  2KXJ A;  2L83 A;  2K22 A;  1P3Q U;  1J19 A;  4ASW C;  2QSD A;  1NI2 A;  4ITK A;  1E9M A;  1K50 A;  2ICI A;  1RRB A;  4MGI E;  3VUY A;  2L76 A;  3MC9 A;  1I7H A;  2A5U A;  4BZA A;  4PS7 A;  4PYU A;  2HD5 B;  1ROE A;  3AN1 A;  1GC7 A;  5CTR C;  2OOB B;  3DVN U;  1J0G A;  1YD8 U;  3C19 A;  3GE8 C;  4BKS A;  3DBR B;  2GOW A;  4HJK A;  1TKE A;  1JQ4 A;  2KMM A;  4HEA 1;  3Q3M C;  3GB1 A;  3C0R B;  1UGM A;  3I57 A;  1S3S G;  4GXB A;  4W9C A;  2V9H A;  2KWV B;  2JPH A;  2GMI C;  2BBC A;  1HEZ E;  3SFE B;  3OWE B;  1EO6 A;  2D5G A;  2WYQ A;  3Q3O C;  1KJT A;  4XWW A;  4EE2 A;  2IGG A;  3APF A;  4MEM A;  2KX0 A;  2G4S A;  1HE8 A;  1WYG A;  1WM3 A;  3IFW B;  2DX5 B;  1WGR A;  3DWM A;  3PZ8 A;  2GLS A;  1GC6 A;  3AE1 B;  4FJZ A;  4TV3 A;  2DYM A;  3BVM A;  3IG3 A;  3R66 C;  1OQR A;  1JWM D;  1WRI A;  1HTO A;  3QWZ B;  1IGC A;  2KOX A;  3GE3 C;  3AI5 A;  4M02 A;  1QT9 A;  4KV2 A;  1OTR B;  2PEA A;  4C4V B;  1XQQ A;  2G9H D;  2G4D B;  1KM7 A;  2Z8L A;  4E71 A;  1D4B A;  4TQ1 A;  4HVB A;  1WJN A;  1UGJ A;  2MRP A;  2BF8 B;  3PLV A;  2B3A A;  5FKA C;  1E5W A;  2N1W A;  4RGN A;  4A9A A;  1T5X D;  1UEL A;  4NY0 A;  3K9P B;  2EEL A;  4KIK B;  1ZXI A;  1C3T A;  2R2O A;  4DQO C;  3KVF B;  3ZDT A;  2V1Y A;  1ET9 A;  3AED B;  4JPS A;  3TJP A;  3GP7 A;  2IYD B;  2DZI A;  2L1A A;  3W1S C;  1WF9 A;  4GMV A;  4H2A A;  2CS4 A;  3ZNZ B;  3VUW A;  1DOI A;  2D11 A;  2JZP A;  3ZNI D;  4WWO A;  3DVG X;  1TY0 A;  3ZDM C;  5G5G A;  4OHJ A;  3W5U B;  1KOT A;  3VTV A;  4F7Z A;  1E90 A;  2KK8 A;  3PV1 A;  3Q14 C;  2XNA C;  5DPS A;  1E6E B;  1WJU A;  4FN2 A;  4DBG A;  2I2Y A;  4TQ0 A;  4RGM A;  3AE3 B;  1RAX A;  1F0Z A;  4ZRK A;  3JW0 X;  3QHT A;  5GMV A;  4WIP A;  1TKG A;  2JX5 A;  5E6P A;  1LXD A;  4ANV A;  2NTT A;  4AP4 C;  1FM0 D;  1L2N A;  2KWC A;  3HRD D;  1SE2 A;  5JZE B;  4HPM B;  5I4D A;  3CIR B;  1F1H A;  4WJO A;  1MFW A;  3KYC D;  4MGY E;  4BFR A;  2V3P A;  1QLB B;  2C7M B;  3T3O A;  3VFK A;  2PLP A;  2K8H A;  5AZH A;  3WAN A;  4US8 A;  3MFG A;  4FHJ A;  3HVD A;  4JGH B;  4B9K A;  2B76 B;  4PS3 A;  1JWS D;  4G50 A;  1WE6 A;  5BYQ A;  2J42 A;  1RLF A;  3TSS A;  2DAJ A;  1EU4 A;  1WGY A;  1PGB A;  2DWQ A;  4RM8 A;  2FCQ A;  2WP9 B;  4C7Z A;  5BMI A;  2RMM A;  2J4X A;  2KKC A;  3V60 A;  2BS3 B;  2AX5 A;  4RF1 A;  3AEB B;  1YQB A;  2SEB D;  2ZCB A;  2PE6 B;  3A9J A;  2ZPY A;  4YTP B;  3CF6 E;  1R7S A;  4KGS A;  3DDC B;  2O6V D;  3N1Y C;  2WXN A;  3U7D A;  3AE6 B;  2WXP A;  4HXD A;  2K8B A;  3R2T A;  4EUT A;  3RD2 A;  2NPT A;  2IPK D;  4JQW C;  2FCN A;  2DZK A;  2GRI A;  4URK A;  1R4N I;  4A55 A;  2N9X A;  1V9J A;  3P2B A;  2LRU A;  4HDQ A;  1T0S C;  3HVZ A;  4W9I A;  4K1R B;  1I4G A;  1A70 A;  3Q3F A;  2CHZ A;  2GBM A;  4N9F 4;  4LCD E;  3H8H A;  4KGT A;  5BMH A;  2FUG 1;  3T3N A;  3NVV A;  1NI3 A;  2KJ6 A;  1JWU D;  3HUI A;  3Q3N C;  3RFZ B;  1PGX A;  4FAD A;  5EDS A;  3BVG A;  4FBJ B;  3R3M A;  2NBV B;  2E3T A;  2INN E;  2WGS A;  4NJC A;  4NNJ B;  2JSV X;  2Z0E B;  3QK0 A;  1JRP A;  1PUT A;  2XEW A;  3EEC A;  1OQY A;  3AU4 A;  4HKQ A;  3L08 A;  2PVO D;  4JIO U;  4RNA A;  3P63 A;  1V97 A;  2L05 A;  3PZD A;  4IG7 B;  3ZJV A;  4PYZ A;  3HM3 A;  1MVK A;  4YTM B;  1OEY J;  2J0J A;  1AAR A;  2GB1 A;  2G45 B;  2IY0 B;  1WX7 A;  3QA8 A;  2J53 A;  2C5L C;  3D32 A;  4XC2 A;  3VH3 B;  3Q8E A;  4WJN A;  5FR3 A;  2LWP A;  2LUM A;  3WAL A;  1T0Y A;  2RDG A;  2WLB A;  3AEG B;  2RD0 A;  2BB5 A;  3SFD B;  3TBL D;  5AZF A;  1VRA B;  1IP9 A;  2JRH A;  2QIE B;  4EEW A;  2QC8 A;  1I4H A;  2WDT B;  1JRO A;  3EGR A;  1KLV A;  1WZ3 A;  1J8C A;  3WIM A;  2ACZ B;  3AMZ A;  4NZL B;  2LJI A;  3DBL I;  1VZ8 A;  4GDL A;  2JRI B;  1F9J A;  1QKZ A;  1P9D U;  3V6E B;  5G5H A;  3KWV A;  2WXJ A;  2RR9 A;  1IPG A;  1WI0 A;  1MHX A;  3K9O B;  3PVL A;  4G0N B;  5TR5 A;  2LI5 A;  2J7Q B;  4IC7 B;  2IO2 B;  2SAK A;  3MTN B;  4ZRP A;  1EUV B;  2MEK A;  2O6V B;  3O65 B;  4ZYS A;  2PE9 A;  1S1Q B;  1J7C A;  4W9H A;  1QF6 A;  2HTM E;  1WM2 A;  3GZN B;  4L2Y A;  5DPT A;  3BK1 A;  3KWL A;  1F2R C;  3GZN I;  1CZP A;  3Q3J A;  2BWE S;  1MG8 A;  1SSN A;  2W3S A;  1Q1O A;  2FBW B;  2BQQ A;  3SU8 X;  3M62 B;  3BYY B;  3OG5 A;  3LB8 C;  3QIJ A;  4J3O D;  1M94 A;  3TEX A;  4LNI A;  2DLB A;  1YN5 A;  2D07 B;  3S2A A;  4TSS A;  1UD7 A;  4LTU A;  4RF0 A;  3TMP B;  1V1O A;  1WXS A;  4YT0 B;  2D3B A;  4A20 A;  4IWP A;  5G55 A;  2KLG A;  4KDL B;  4P7I A;  3Q6B A;  2LUE A;  4A3P A;  1UUP A;  1BML C;  3VDZ A;  3W9C B;  1T0Q C;  3ONS A;  4PK1 A;  3SEB A;  4QAY A;  1B9R A;  1JWB D;  5KHO A;  3EHV A;  3RN9 C;  4RGT A;  4JLC A;  2DYB A;  2N0S B;  2WU2 B;  3RNF C;  2FCM A;  2VH2 A;  2JQR B;  1ZW7 A;  4S17 A;  3ZNG C;  4C80 A;  1B1Z A;  2CHX A;  2YEP F;  4P16 A;  3CMM B;  1WFY A;  3OAW A;  1ZPS A;  4M00 A;  3R2I A;  1BT0 A;  4R3D A;  3DOW A;  4NQL B;  2IY1 B;  3VUX A;  4M0W B;  3NY5 A;  2LGX A;  2KWD A;  3PRE A;  2W54 A;  2ASQ A;  2L00 B;  4GLS C;  1QOF A;  1F77 A;  3TIX A;  3N9Y C;  3N32 A;  4HKZ E;  1L6U A;  4IOI E;  5IO9 A;  1ZUD 2;  3P4Q B;  1C77 A;  2GBJ A;  1ZE3 D;  2CU1 A;  1LGR A;  4W9K A;  4BKT A;  2FIF A;  1LM8 B;  3L17 A;  1D6E C;  4HPL B;  1EWY C;  1OEY A;  4P1B C;  4XE0 A;  4G3X B;  1I4X A;  4II2 B;  1SIF A;  2FID A;  5HI1 A;  2LGS A;  4HK2 A;  2JYT A;  2K0P A;  3EUB 2;  2RPV A;  3ENE A;  3LYY A;  1DYQ A;  1YJ1 A;  5CHV C;  4NPN A;  3DBR I;  2WNM A;  3H6N A;  5C23 A;  3T8M A;  4A90 A;  4MJS A;  4LK0 M;  3NG0 A;  1RYJ A;  3X0W A;  3ZJT A;  3PHW B;  3PS6 A;  2LMC A;  2OJR A;  1V8C A;  3A9K A;  4S0R A;  4G11 A;  4LDT D;  2CJO A;  4HWI B;  3A1Q B;  1FFU A;  4W9L A;  4JWS C;  1V5O A;  3N20 C;  3B0A A;  2KN5 A;  2LJ5 A;  1VDV A;  4NJ7 A;  3NHE B;  4HRO A;  1K52 A;  4WWP A;  1L6V A;  1N60 A;  1DOX A;  1ISN A;  4KDI C;  1Z5S B;  4OZC A;  1AYF A;  1YOV B;  4KKI A;  1YJI A;  2BKR B;  2V4I B;  3VQI A;  1N61 A;  1TZ1 A;  1M4V A;  1UZX B;  2MP2 B;  1I35 A;  2N7E A;  2BB6 A;  1KH0 A;  5IKC M;  2KFK B;  1NEN B;  3SDL C;  4GDK B;  2REX A;  3NUH B;  4KKJ A;  1KRH A;  1SE3 A;  1SJH D;  1XLN A;  3SHQ A;  3N30 A;  2KMA A;  1UH6 A;  3FIL A;  2OHF A;  3I3T B;  3N3K B;  2M1M A;  1OFF A;  4E74 A;  1DGJ A;  2CR5 A;  1PQS A;  2JZZ A;  1QIL A;  3M3J A;  3NZU A;  2CHW A;  3ML9 A;  2M56 B;  3PSE B;  3I9V 1;  4BKG A;  1UWX A;  4HCP B;  4N59 A;  4KGR A;  3U2S C;  2WXO A;  1SJE D;  2N9L A;  3SR6 A;  2BKF A;  1UBI A;  2CJN A;  2E6X A;  3ZLZ A;  1MHH E;  1WGH A;  1N6Z A;  4KVG B;  3JYU A;  4FUL A;  3QCA A;  3PTF C;  4JL9 A;  1UBQ A;  2BYV E;  3ZRC A;  2I38 A;  2HJ8 A;  4XYC A;  4YSY B;  2I1K A;  3TEZ A;  4MM3 B;  3TEW A;  5BYR A;  2Y5P A;  3VTU A;  3H9D A;  1MG4 A;  4BKS D;  1JAL A;  2K1F A;  3PRP B;  5EE3 A;  1WMH A;  1YN4 A;  2LXA A;  1FFV A;  1TGZ B;  4DHJ D;  3DPD A;  2BS2 B;  5E6N A;  1T0R C;  1TT5 B;  1EM7 A;  2FAZ A;  3H7S A;  3AM9 A;  4MH8 A;  1HZ5 A;  3ETR A;  2LD9 A;  2QIL A;  2QDF A;  4ANW A;  1FRD A;  2V4L A;  5D2M B;  2RSU A;  1DOY A;  5H92 C;  4BVU C;  4GU2 A;  3EFC A;  2GI9 A;  3ZKJ C;  3WCQ A;  3FAH A;  5JH5 C;  1SXT A;  3NJT A;  2IO1 B;  2WXI A;  3DCG A;  1WGG A;  2IJ0 A;  1FXT B;  3JVZ X;  2TSS A;  1VLB A;  4OZB A;  4ZRQ A;  2KTR A;  2LXC A;  1HQR D;  2KJH B;  4AOF A;  4CO7 A;  3EFU A;  2PMV A;  3NVZ A;  4LDT B;  4YWG G;  3RMK C;  1WJ4 A;  1CJE A;  2JWU A;  2AQ3 B;  4JE3 B;  3Q2A C;  3ZXR A;  2O2V A;  3IT4 B;  3ZIM A;  4EZJ A;  2WWZ A;  3Q8A A;  2W9N A;  2KAC A;  4WQO B;  4DHZ E;  3RCZ A;  4PS8 A;  2JWZ A;  1VJK A;  1E10 A;  5FK9 C;  5BYS A;  3MP9 A;  4ICV A;  2ZVN A;  2IND C;  1GNU A;  4AWJ A;  4XWT A;  1TS3 A;  1WRD B;  4NAW A;  4BOS C;  4HCN B;  1EU3 A;  2D3A A;  5CX3 A;  1ZDX A;  4DDI D;  4YSZ B;  2MQJ A;  2R2Q A;  4WJQ A;  3QC8 B;  4UDU C;  1YX6 B;  3H7P A;  2XK5 A;  1ENF A;  2KD0 A;  5J17 A;  3JSV A;  2AL6 A;  5LLI A;  3IAS 1;  4MDK E;  2KAJ A;  3L13 A;  3M95 A;  2WXL A;  2V3S A;  3B2G A;  1FNU A;  1CK1 A;  4ICU A;  1N63 A;  4W9E A;  1QOA A;  1WYW B;  4GIV A;  2XN9 C;  1HZ6 A;  3PPA A;  4D2K A;  4WH4 A;  5DCN A;  3RPF C;  2WS3 B;  5HKH A;  3L4P A;  2NMQ A;  1UWM A;  2FCS A;  4K81 A;  2JUO A;  2INC C;  2J52 A;  4MSM B;  3W1S A;  2JT4 B;  1C4P A;  3ZVV A;  5HHD G;  2CU3 A;  4MJS B;  2KQ4 X;  2DEN B;  4ZYN A;  4DHJ B;  1N62 A;  1SEB D;  4RH6 A;  1N5W A;  1BUI C;  2ZCC A;  1YN3 A;  2HTH A;  2OJW A;  2LVO A;  3EC8 A;  1D5X C; 
#chains in the Genus database with same CATH homology
 2HD5 B;  2D07 B;  5CTR C;  1GC7 A;  4YL8 A;  2KC1 A;  3IHP C;  3S2A A;  3ZTC A;  2OOB B;  4GSW A;  3DVN U;  4ZDV A;  1UD7 A;  3R7R A;  1J0G A;  1YD8 U;  3TMP B;  1WXS A;  4BKS A;  4FA6 A;  4FHK A;  4A20 A;  2GOW A;  3UQB A;  4HJK A;  4IWP A;  4BBN F;  4MGZ E;  2KLG A;  2KO3 A;  3KUZ A;  4KDL B;  3DVG Y;  4P7I A;  3L0W B;  4I6P A;  5G55 A;  2JY6 A;  3OLM D;  1YX5 B;  1CMX B;  2MW5 A;  3C0R B;  1UGM A;  4GGQ A;  2LUE A;  4A3P A;  1S3S G;  4RM9 A;  4GXB A;  4W9C A;  5L83 A;  2DYO A;  3VDZ A;  2KQ7 A;  2KWV B;  4KSK C;  3U8Z A;  3DVN V;  2JPH A;  2GMI C;  5CHF A;  2C60 A;  2GBN A;  3ONS A;  2KJR A;  2DAF A;  1EO6 A;  1V6E A;  4F8C B;  2JVC A;  1V80 A;  5KHO A;  2C7H A;  2WYQ A;  3EHV A;  1KJT A;  3PRM B;  4GN1 A;  2Z59 B;  3APF A;  4MEM A;  4JLC A;  2KX0 A;  2JZ3 B;  2G4S A;  1HE8 A;  1NBF C;  2GBR A;  3HK0 A;  1WM3 A;  3IFW B;  2DX5 B;  2DYB A;  1WGR A;  4HDO A;  2FCM A;  1VCB A;  5J2R A;  4XZ4 A;  2K6Q A;  4AJW A;  4OVU A;  3SD5 A;  1GC6 A;  1WXM A;  1ZW7 A;  3OJ4 B;  4TV3 A;  4FJZ A;  2DYM A;  3IG3 A;  3R66 C;  3ZNG C;  2LVQ A;  3VHT C;  1GUA B;  1LFD A;  3KYD D;  4DWF A;  2CHX A;  3QWZ B;  3CST A;  4EZK A;  4ZRI A;  1YIW A;  4TKN A;  3CMM B;  2KDF B;  2KOX A;  3APD A;  2MLB A;  1WFY A;  3AI5 A;  2KNB A;  3OAW A;  5AEK B;  1BT0 A;  2C9W B;  2IO0 B;  4KV2 A;  4II3 B;  1OTR B;  2PEA A;  4IM3 A;  2VRR B;  3DOW A;  4NQL B;  2IY1 B;  2J0K A;  1WY8 A;  3BY4 B;  3VUX A;  2IBI B;  4M0W B;  1XQQ A;  4EFO A;  2G4D B;  1KM7 A;  2LGX A;  3NY5 A;  1IYF A;  4E71 A;  1P0R A;  3PRE A;  4TQ1 A;  2ASQ A;  4W9G A;  4HVB A;  2KZR A;  1WJN A;  2L00 B;  4KSL C;  2MRP A;  2BF8 B;  3PLV A;  3TIX A;  4M8N A;  2NCN A;  2K25 A;  2B3A A;  2KAN A;  2ZNV B;  1SGH A;  3N32 A;  2LGD A;  5C1Z A;  1E5W A;  2N1W A;  4XX5 A;  1TTN A;  3QJZ A;  1UEL A;  4NY0 A;  4BBN C;  3K9P B;  2D10 A;  4KIK B;  3QX1 A;  5D6J B;  4J6I A;  1C3T A;  3ECI A;  3ZW3 A;  2R2O A;  5CHW A;  3KVF B;  4ANU A;  3APC A;  3ZDT A;  1R4M I;  2RPQ A;  2V1Y A;  2GBJ A;  2CU1 A;  3DQV A;  2EKE C;  3VH4 B;  2NS5 A;  3MJW A;  4W9K A;  2L0F A;  3TJP A;  4BKT A;  4HLE A;  2FIF A;  1LM8 B;  5LXI B;  2AWT A;  1OGW A;  2IYD B;  3L17 A;  4HPL B;  4IWQ A;  1OEY A;  2DZI A;  1WX8 A;  3W1S C;  1WF9 A;  4GMV A;  1E8X A;  1LQB A;  2CS4 A;  2ZZP B;  4G3X B;  4IUM B;  3VUW A;  3ZNZ B;  4II2 B;  3A9K B;  1SIF A;  2D11 A;  2XBB C;  2FID A;  4W9J A;  3ZNI D;  2NVU I;  3UIO B;  4WWO A;  2IZV B;  3DVG X;  4A3O A;  4GB9 A;  4KIK A;  4K7U A;  3ZDM C;  1KOT A;  1X1M A;  2NBW B;  2G3Q B;  4HK2 A;  4IW0 A;  2RGF A;  2I1J A;  2YVC A;  3ENE A;  3VTV A;  2M8S A;  4F7Z A;  1YJ1 A;  1E90 A;  4K7W A;  2N1V A;  2KK8 A;  3PV1 A;  1TBE A;  4NPN A;  4NJ6 A;  5CHV C;  3QAR A;  2LZ6 A;  3DBR I;  3H6N A;  2LVP A;  5C23 A;  4IM0 A;  5BO4 B;  3T8M A;  4MJS A;  1WXA A;  5DPS A;  5JHB A;  1WJU A;  3X0W A;  2LGY A;  2ZJD A;  4FN2 A;  3PHW B;  4DBG A;  3PS6 A;  4TQ0 A;  3L54 A;  2OJR A;  4DDG D;  4FJY A;  1RAX A;  4E3C A;  1ZGU B;  4ZRK A;  3A4S C;  3A9K A;  3VTW A;  4DHZ B;  2BYE A;  3JW0 X;  3UIN B;  3QHT A;  4G11 A;  4LDT D;  5GMV A;  2BYF A;  4AJY B;  4ANX A;  4HWI B;  1XT9 B;  1LXD A;  2AEH A;  3A1Q B;  5E6P A;  4ANV A;  2MBE A;  3DBH I;  4W9L A;  4AP4 C;  1V5O A;  3ML8 A;  1L2N A;  2KWC A;  3R7Q A;  5J18 A;  2FUH B;  2KN5 A;  3B0A A;  2DHZ A;  5JZE B;  5IAA C;  2LJ5 A;  4HPM B;  3B08 A;  2PJH A;  1C1Y B;  4NJ7 A;  1WXV A;  5JHA A;  3NHE B;  4WWP A;  3UIP B;  4NAW B;  1ISN A;  4B6W A;  3AU5 A;  2MBB B;  4WJO A;  2KDB A;  2AYO B;  2ZVO A;  1Z5S B;  2KC2 A;  3KUD B;  3KYC D;  4KDI C;  3RUL A;  4MGY E;  4BFR A;  3PHX B;  4W9D A;  4DK5 A;  1WE7 A;  2BKR B;  2KDE B;  1H4R A;  4CHK A;  3VQI A;  3PLU A;  1TZ1 A;  4IM2 A;  3RYT A;  5FR6 A;  2C7M B;  1UZX B;  1VD2 A;  3NZS A;  5D7G A;  3VFK A;  1SE9 A;  2MP2 B;  1I35 A;  2K8H A;  2N7E A;  5AZH A;  3WAN A;  3A1Q A;  2KFK B;  1I42 A;  2NBU A;  3JSV B;  5LXH A;  3SDL C;  4GDK B;  2REX A;  4FHJ A;  4JGH B;  2BPS A;  3SHQ A;  4B9K A;  3N30 A;  3KH0 A;  2KMA A;  1UH6 A;  2MX2 A;  4PS3 A;  4EOY A;  3A9J B;  4LJO B;  4G50 A;  3I3T B;  3N3K B;  2LAS A;  2M1M A;  1WE6 A;  2L0T A;  4E74 A;  1WR6 E;  2CR5 A;  2MBQ A;  1PQS A;  1RLF A;  2JZZ A;  3VXW A;  3HM6 X;  3M3J A;  4FLH A;  2KWU B;  3V6C B;  3DBS A;  2DAJ A;  3NZU A;  4W9F A;  2CHW A;  3ML9 A;  1WGY A;  2A4Z A;  3U30 A;  4RM8 A;  2FCQ A;  1EF1 A;  4ZRJ A;  3PSE B;  3W1Y A;  1JRU A;  2MP2 A;  3WAO A;  4FJV B;  4BKG A;  4HCP B;  2KKC A;  2KFK A;  2MWS B;  3V60 A;  1WMH B;  2NPT B;  4GDK A;  4KZC A;  1YQB A;  2BKF A;  1UBI A;  3KW5 B;  2ZCB A;  3L10 B;  2PE6 B;  3ZLZ A;  2HE7 A;  5G2N A;  3A9J A;  1WGH A;  4F1S A;  4KVG B;  2ZPY A;  2Y5B B;  3RZW C;  3JYU A;  3CF6 E;  4MEL A;  2MCN B;  1L7Y A;  4FUL A;  3QCA A;  1NDD A;  3PTF C;  1UBQ A;  2BYV E;  2JF5 A;  1P1A A;  4JL9 A;  3ZRC A;  2AL3 A;  3TCA A;  3DDC B;  2O6V D;  2HJ8 A;  3U7D A;  1WX9 A;  2CKH B;  1WGD A;  1ZKH A;  2I1K A;  4KZ0 A;  4HXD A;  2K8B A;  1P98 A;  2GBK A;  3VTU A;  3H9D A;  4BKS D;  2K1F A;  2UYZ B;  3PRP B;  2KLC A;  4EUT A;  3V62 A;  3RD2 A;  1WMH A;  2NPT A;  4NQK E;  2NR2 A;  5E6O A;  4JQW C;  5KHQ A;  2FCN A;  2LXA A;  2C7N B;  2DZK A;  1TGZ B;  4DHJ D;  2FNJ B;  3DPD A;  4EKU A;  3H1U A;  5E6N A;  4URK A;  1R4N I;  2M17 A;  1WIA A;  3NOB A;  2N9X A;  1V9J A;  2FAZ A;  3ALB A;  3H7S A;  4WAA A;  2KTR B;  3P2B A;  3UGB B;  3VVW B;  1V2Y A;  1EF5 A;  2LRU A;  4HDQ A;  2LD9 A;  1GG3 A;  4W9I A;  2N4F A;  4K1R B;  4ANW A;  1A5R A;  2BWF A;  4MH0 E;  2J0M A;  3HIZ A;  2V4L A;  3Q3F A;  2CHZ A;  1WZ0 A;  2GBM A;  4N9F 4;  3X23 A;  3OJ3 A;  4LCD E;  5D2M B;  4MM3 A;  1WR1 A;  2RSU A;  4K7S A;  4BVU C;  4GU2 A;  3ZKJ C;  2KJ6 A;  2MBO A;  1GJZ A;  5JH5 C;  2O2V B;  2K8C A;  2WX0 A;  3LJ3 A;  2Z0D B;  2IO1 B;  3DCG A;  1E7U A;  1WGG A;  4X57 B;  1FXT B;  3JVZ X;  3HHM A;  4FAD A;  1U4A A;  2DZM A;  3GOE A;  5D94 A;  2L8J A;  3A33 B;  4MGK E;  3WA0 A;  5EDS A;  2KTR A;  2LXC A;  4FBJ B;  3R3M A;  2NBV B;  2WX1 A;  2L3Z A;  4TUU A;  2KJH B;  4AOF A;  4CO7 A;  3EFU A;  4LDT B;  4NNJ B;  1WJ4 A;  1Q5W B;  2KVR A;  4GOC A;  4RMA A;  5AZG A;  4DXA B;  1Y8R C;  3L16 A;  4I6N B;  4BOZ B;  1K8R B;  1V49 A;  3V61 A;  2Z0E B;  1G6J A;  4WWN A;  3QK0 A;  2N7D A;  2DZJ A;  1V81 A;  1WJ6 A;  2XEW A;  3ZO5 B;  3EEC A;  2O2V A;  4WJP A;  2EMS A;  2ZPN A;  1OQY A;  3AU4 A;  3ZIM A;  3IBE A;  3VAW A;  3L08 A;  4EZJ A;  4B95 A;  2WWZ A;  2W9N A;  5DPR A;  3H7P B;  4JIO U;  4IWO A;  4WQO B;  4DHZ E;  2XK5 B;  3RCZ A;  4PS8 A;  2JWZ A;  2IO3 B;  1E8Z A;  2D3G A;  2K6D B;  2D2Q A;  2L05 A;  3A4R A;  1XD3 B;  3PZD A;  3RT3 B;  4IG7 B;  2KMC A;  2MBH A;  2PPH A;  4PYZ A;  2EMT A;  3UF8 A;  4ICV A;  3BIN A;  3HM3 A;  2ZVN A;  3AUL A;  1GNU A;  4AWJ A;  1OEY J;  1WRD B;  2J0J A;  1AAR A;  4NAW A;  4BOS C;  4HCN B;  5CX3 A;  3RUI B;  2G45 B;  2M0X A;  4I6L B;  1H8C A;  2BGF A;  4GDL B;  4DDI D;  2KX3 A;  2IY0 B;  1WX7 A;  2N9E B;  3QA8 A;  2C5L C;  3D32 A;  4XC2 A;  2MQJ A;  3VH3 B;  2R2Q A;  1WH3 A;  3IVF A;  3ZUN A;  4WJN A;  2LWP A;  3MHS D;  5IA7 A;  2K39 A;  3WAL A;  1T0Y A;  4WJQ A;  3QC8 B;  3QAQ A;  1YX6 B;  3H7P A;  2RD0 A;  3AXC A;  2XK5 A;  3TBL D;  2KD0 A;  5J17 A;  3RZF A;  5AZF A;  1IP9 A;  2JRH A;  3JSV A;  2AL6 A;  3M63 B;  5LLI A;  4EEW A;  2WDT B;  2L7R A;  4MDK E;  4M8M A;  3ZNH B;  4EZL A;  1KLV A;  3L13 A;  3M95 A;  1WZ3 A;  1J8C A;  2V3S A;  3KUC B;  3WIM A;  2UWQ A;  3DBL I;  4AUQ C;  4ICU A;  3T9L A;  3PGE A;  4GDL A;  2JRI B;  1F9J A;  4W9E A;  1P9D U;  3V6E B;  1WYW B;  3TL5 A;  2MSE D;  4GIV A;  2LRW A;  2RR9 A;  3NS8 A;  1IPG A;  1WI0 A;  4LJP B;  3UQA A;  3WAM A;  3PVL A;  3K9O B;  3PPA A;  4G0N B;  3ZRF A;  2KQS A;  2KTF A;  5TR5 A;  2LI5 A;  2J7Q B;  4MSQ B;  1Z2M A;  1V86 A;  2IO2 B;  2ZEQ A;  4IC7 B;  3MTN B;  1EUV B;  2QHO A;  1E8W A;  2O6V B;  3O65 B;  2KHW B;  1RFA A;  5DCN A;  2PE9 A;  1S1Q B;  3B1L X;  5DPW A;  5HKH A;  4W9H A;  1V5T A;  3LDZ E;  1E7V A;  1QZE A;  4OVV A;  2FCS A;  2N9P C;  2JUO A;  2KFJ A;  4K81 A;  1WM2 A;  2ZNV C;  4MSM B;  5DPT A;  3WAP A;  3W1S A;  3ZTD A;  1E8Y A;  2JT4 B;  2JXX A;  3GZN I;  2KDI A;  3PRZ A;  3ZVV A;  5L95 C;  3Q3J A;  4MJS B;  3QQ8 B;  2BWE S;  2MA9 B;  1MG8 A;  2DEN B;  2M4N A;  4ZYN A;  4DHJ B;  1Q0W B;  2KXJ A;  1D3Z A;  3CSF A;  1P3Q U;  1J19 A;  1Q1O A;  4ASW C;  1NI2 A;  3SU8 X;  3M62 B;  2ZCC A;  1RRB A;  3QIJ A;  2HTH A;  4MGI E;  3VUY A;  2L76 A;  2LVO A;  1M94 A;  3EC8 A;  3PT2 B;  2A5U A;  4PS7 A;  2YLM A;  4PYU A;  2O6V A;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...