4BKSD

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 102
sequence length 102
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bksD00
5AZGA 3MTNB 2DX5B 1V49A 2PJHA 1KOTA 2LZ6A 2PE9A 2G3QB 2KJHB 1YD8U 5DPWA 5AZFA 2LD9A 3L17A 2NPTA 2CKHB 2L7RA 4HCPB 5G55A 4E71A 1J0GA 2IY1B 1U4AA 3PRZA 1J8CA 3EHVA 1J19A 1I42A 2BKFA 4MGYE 4X57B 4CYEA 3WALA 1KM7A 2GBRA 5J18A 1GC7A 1LFDA 3KYCD 1UZXB 4FBJB 5CHFA 2KC2A 4NNJB 4I6LB 2JZ3B 1UGMA 3M63B 5J17A 2KMCA 4FHKA 5D6JB 2MBEA 5JZEB 2GBJA 3SD5A 4HPLB 4AJYB 1WGDA 2HTHA 2UYZB 3QQ8B 2KDBA 1PQSA 2N9EB 4ZRJA 2IO1B 2MCNB 3PVLA 3PT2B 3APFA 3ONSA 1GG3A 3VFKA 3I3TB 1I35A 5KHOA 2KMAA 1IPGA 4AOFA 3L10B 4EZJA 2DYBA 3KH0A 3ENEA 3PZDA 3Q3JA 2V1YA 3WAOA 4GDLB 4K81A 1P1AA 2K8HA 3EECA 3DBRI 4J6IA 2L76A 2CU1A 4EOYA 1RLFA 2M17A 4PS3A 1EF5A 4AP4C 4GGQA 2KWVB 4MSMB 1GNUA 2L00B 4G3XB 5FR6A 2KJ6A 3KUZA 4IC7B 2LVQA 1E8WA 1YJ1A 1F9JA 4B95A 4BBNC 1WM3A 4MJSA 2M8SA 1YX6B 2MSED 3ZKJC 2D11A 2LRUA 3L13A 4I6PA 4M8MA 2J0JA 4GN1A 3R7QA 3X23A 2MBQA 3VH4B 2FCQA 4WWPA 3WAPA 2KD0A 3NY5A 2LUEA 3ZDMC 2DHZA 2B3AA 2WWZA 4MJSB 3TL5A 3UQAA 2MA9B 4AJWA 4F1SA 4HJKA 1G6JA 2KTRB 3PREA 1E8ZA 5CHVC 1TTNA 2KC1A 2C7HA 3A4SC 4FN2A 1V2YA 1WXSA 3AULA 1LXDA 2JT4B 2CHXA 3ML8A 3UIOB 4ICUA 4ZRKA 1V86A 3M95A 4RM9A 1WJ6A 3PLVA 4II2B 3K9PB 3A9JA 3RCZA 4M8NA 4WJNA 4GU2A 2RR9A 3HM6X 3GOEA 3L0WB 4KSLC 4NQKE 4W9GA 2KZRA 1WI0A 2D3GA 3H1UA 4IM0A 2O6VB 1V6EA 3B0AA 4LDTD 1C3TA 4XX5A 2VRRB 4II3B 1TGZB 4LCDE 3U30A 1GUAB 2KO3A 4GXBA 3V6CB 3VTWA 4ANWA 4FADA 2DZJA 4ANVA 2NR2A 1YIWA 2N4FA 1Z5SB 4IW0A 4TUUA 2DZKA 2L0FA 1WH3A 1HE8A 4FJVB 4WJOA 2R2QA 3TJPA 3QK0A 3HIZA 3HHMA 3TIXA 3PV1A 4G11A 5D7GA 4FLHA 5IAAC 3PTFC 2LGXA 1TBEA 1WX7A 2MX2A 4A3PA 2DYMA 2J0KA 1WFYA 2BF8B 2KHWB 2KKCA 4WAAA 4HVBA 2G45B 4FJYA 2M4NA 1ZW7A 3AI5A 3EFUA 4MH0E 1VD2A 3RD2A 3U7DA 3M62B 2GBKA 1UBQA 5E6PA 1X1MA 2MWSB 3KUDB 3KYDD 3VTUA 4MGIE 2KLCA 2L0TA 2N9XA 3L54A 3VXWA 2GOWA 4HXDA 1M94A 2LVPA 4ZDVA 2C7MB 2LJ5A 4AWJA 4A20A 2N7DA 2PE6B 1UH6A 1WX8A 1V81A 1E8YA 4EFOA 1H8CA 3QC8B 4FJZA 4HPMB 2C5LC 5AZHA 1SE9A 1WMHA 4W9IA 1BT0A 1Y8RC 2G4SA 4MM3A 3PRPB 1KJTA 3V6EB 4JGHB 1P3QU 3OJ4B 3ZW3A 4BKSA 2CR5A 4GDKB 2ZJDA 5LXIB 3R66C 2N7EA 2ZVNA 4EUTA 2ZCCA 4ANUA 4FA6A 3V62A 1T0YA 2KX3A 1WMHB 3LJ3A 3H9DA 2XK5B 1P0RA 1Q5WB 3N3KB 4XC2A 2FAZA 3ZIMA 3SHQA 4GDLA 2BYEA 4RM8A 2C60A 4IM2A 3B1LX 3T8MA 3JSVA 4B9KA 1AARA 1YX5B 3UF8A 2KWUB 1TZ1A 4F8CB 3DBHI 4HDQA 1UD7A 4EKUA 2N9PC 3MHSD 1WGRA 2DAFA 3WIMA 3R3MA 3QX1A 1YQBA 5GMVA 1WX9A 2LVOA 3JSVB 2K25A 4W9FA 2DZMA 2M1MA 2I1JA 2UWQA 1WIAA 3DVGX 2ZZPB 3B08A 2RSUA 1LQBA 2C7NB 2XEWA 4K7SA 2KANA 3RYTA 4MEMA 2KNBA 2J7QB 2HJ8A 4WJPA 1FXTB 2A4ZA 2MBHA 2KTRA 3DCGA 4TQ1A 4W9LA 5CTRC 4DDGD 5J2RA 1L7YA 4YL8A 3ALBA 1OEYA 3HM3A 3ZTCA 3NZUA 2KXJA 2LRWA 4N9F4 3VTVA 2IYDB 1NI2A 4TV3A 2IO0B 3QA8A 5EDSA 2BPSA 3ZVVA 2YVCA 1P9DU 1UELA 2MBOA 4KDIC 2KWCA 1C1YB 3KUCB 3PRMB 1H4RA 2L8JA 3DBSA 2GBNA 3S2AA 3UQBA 5C23A 4OVUA 2XBBC 4EZLA 3RZWC 3O65B 3ZLZA 3VHTC 2O6VA 5JHBA 1XT9B 3R7RA 4URKA 3GZNI 4DXAB 3ZRCA 4BVUC 1IYFA 4HDOA 2L3ZA 2YLMA 4DDID 2JF5A 1WJ4A 2JVCA 4IWQA 2CS4A 3CF6E 5IA7A 4DBGA 4GOCA 3NS8A 3WA0A 2FIFA 2JWZA 1WY8A 2LASA 2NVUI 4K7UA 3KVFB 5DPSA 3V60A 2ZEQA 2ZNVB 1GJZA 3ZUNA 3N32A 5DPRA 5KHQA 2D2QA 3NOBA 2REXA 4MDKE 1WE7A 1V5OA 2G4DB 2KFJA 2V3SA 2MQJA 4NQLB 4PYUA 4BOZB 2KN5A 4IUMB 5BO4B 3ZNHB 1SGHA 2FUHB 1WE6A 1LM8B 2DAJA 3A9KB 2L05A 1XQQA 2MBBB 3UIPB 4HCNB 2FCNA 2J0MA 1OGWA 4W9JA 4DK5A 3APCA 3WANA 4BKSD 2K8BA 2IO3B 2RGFA 4ANXA 1WF9A 5CX3A 3QCAA 2RD0A 3BY4B 3PLUA 4WWOA 2IO2B 4P7IA 2K8CA 2KQSA 3HK0A 4KIKA 3DVNV 4E74A 4G50A 1WXMA 3U8ZA 2BYVE 1V5TA 2WX1A 3DVGY 3PSEB 3VUWA 4A3OA 1WXVA 4BBNF 4K1RB 2ZNVC 2LWPA 3IG3A 1JRUA 3VAWA 2Z59B 3NHEB 2KDEB 2AYOB 4MSQB 4DHZE 4KIKB 3SU8X 2KDIA 4BOSC 5HKHA 2AL6A 4GDKA 3C0RB 1WZ0A 5DCNA 5L95C 3PHXB 1E8XA 2V4LA 3A4RA 5G2NA 3RZFA 2QHOA 1K8RB 4NAWA 2XK5A 5L83A 4KSKC 2JXXA 2NCNA 3APDA 1E90A 3H7PB 2KDFB 3JW0X 3ML9A 3NZSA 2IY0B 3IBEA 1S3SG 1GC6A 2GBMA 2IZVB 1UBIA 4WQOB 2K6QA 4IG7B 2ZPYA 4WJQA 1R4NI 4NAWB 3L16A 4BKTA 5JHAA 2K1FA 2MLBA 2NBVB 4W9HA 3DDCB 2BWFA 1Q1OA 3RULA 2JRIB 2M0XA 2AEHA 3CSFA 4B6WA 1KLVA 3BINA 2FCSA 4PS7A 1VCBA 3AXCA 3N30A 1R4MI 2O2VA 2A5UA 3QJZA 4E3CA 3CSTA 1NDDA 4LDTB 1D3ZA 4RMAA 2NBUA 1P98A 2LXAA 2MP2A 5LXHA 1WYWB 2RPQA 2Y5BB 2O6VD 1WJNA 4NY0A 3UINB 3CMMB 2JPHA 2O2VB 3W1YA 3T9LA 2WX0A 3W1SC 4GIVA 3A1QA 2GMIC 3M3JA 2NPTB 2KOXA 1OEYJ 3H7SA 4OVVA 2DZIA 2D10A 3AU4A 4MGZE 3TCAA 4DHJB 5JH5C 3AU5A 3PPAA 2MP2B 1OQYA 4WWNA 4NJ7A 3IVFA 3UGBB 1EO6A 3TMPB 4TQ0A 5E6NA 4GMVA 5E6OA 3QWZB 2K6DB 3A1QB 2CHZA 4HK2A 2BYFA 2LGYA 1XD3B 1ZKHA 2C9WB 2JUOA 3LDZE 4LJPB 3QHTA 4F7ZA 3VQIA 3IFWB 2Z0EB 1NBFC 5C1ZA 2KVRA 1S1QB 2FCMA 3WAMA 1WXAA 1ISNA 2AL3A 4IWOA 2AWTA 4BKGA 1A5RA 4JL9A 2D07B 2FIDA 4W9CA 4NPNA 4W9KA 2ZVOA 1WR6E 3X0WA 3DVNU 3D32A 2PEAA 1E7VA 1WGYA 4JIOU 4ASWC 1WM2A 4KZCA 2CHWA 5DPTA 4FHJA 4G0NB 3ZNGC 1RRBA 4NJ6A 4PS8A 2KJRA 4DHZB 3A9KA 1CMXB 4XZ4A 3OAWA 4FULA 3A33B 4M0WB 1OTRB 5D94A 3VUXA 2ASQA 1Z2MA 1WGHA 3PS6A 2JZZA 2DENB 2K39A 1E7UA 3RUIB 4I6NB 3QARA 2W9NA 2LXCA 2KK8A 2KFKA 4GB9A 4KDLB 3PHWB 3ZNID 4IWPA 2DYOA 4ZYNA 2R2OA 3EC8A 2Z0DB 5AEKB 4W9DA 1RFAA 1WR1A 3ECIA 3QAQA 4W9EA 1IP9A 3ZO5B 4TKNA 1WJUA 4CO7A 2HD5B 3DQVA 4MELA 3ZNZB 3ZRFA 4KV2A 4LJOB 2BGFA 2PPHA 4CHKA 2MRPA 2LGDA 2KFKB 4AUQC 2NS5A 3JYUA 2EMSA 2EKEC 3A9JB 3KW5B 2WDTB 3JVZX 5TR5A 4K7WA 4EZKA 4KVGB 4KZ0A 3MJWA 1RAXA 2KLGA 2OJRA 5D2MB 4MGKE 5LLIA 1Q0WB 2OOBB 3V61A 4ZRIA 4BFRA 2WYQA 4DWFA 1V9JA 3W1SA 3VDZA 4DHJD 2FNJB 2ZPNA 3L08A 3H7PA 2BKRB 3VVWB 3DBLI 2HE7A 4HLEA 1EUVB 4EEWA 1WGGA 2N1VA 1WZ3A 4HWIB 4JLCA 3VH3B 3QIJA 3OJ3A 2EMTA 3VUYA 3IHPC 2BWES 5CHWA 2NBWB 4IM3A 1EF1A 3ZTDA 3H6NA 2JRHA 3DPDA 3PGEA 3SDLC 2JY6A 2MW5A 3DOWA 2KTFA 4JQWC 3Q3FA 2KX0A 3OLMD 1L2NA 1SIFA 3K9OB 1V80A 2ZCBA 1MG8A 2I1KA 4GSWA 3TBLD 3ZDTA 2IBIB 1E5WA 4ICVA 3RT3B 1ZGUB 1WRDB 1QZEA 2N1WA 3P2BA 2LI5A 2KQ7A 4PYZA
chains in the Genus database with same CATH superfamily
4WQMA 2PJHA 4MT5A 2KJHB 3DBLB 1J8CA 5HHDG 2BKFA 4LNIA 1SF0A 4L1BA 4YSXB 4KGRA 2GBRA 1UZXB 1DOIA 2BTEA 1J7BA 4I6LB 1UGMA 2V4IB 3M63B 2KMCA 1C4PA 5D6JB 4AJYB 1WGDA 5BMHA 2V0GA 2KDBA 1PQSA 3ONSA 1ZXIA 1I35A 1IPGA 2CJOA 3L10B 3Q3JA 3IT4B 2V1YA 3C19A 1P1AA 3EECA 2CU1A 4YSYB 1GNUA 4G3XB 1EWYC 3VR8B 1YJ1A 1F1HA 4BBNC 2M8SA 3B2GA 4GN1A 3X23A 2MBQA 1L6UA 2FCQA 4WWPA 2DHZA 2B3AA 3UQAA 2MA9B 3Q8AA 2KC1A 3A4SC 3VRAB 3RI7C 1LXDA 1D6EC 3K9PB 3AM9A 4GU2A 4A6QA 4KSLC 4S0RA 4OHJA 3AECB 4IM0A 2LHEA 3ZGZA 1C4CA 1C3TA 4XX5A 1F2RI 4ANVA 5IN7A 4TUUA 3BVMA 1YOVB 5H8YE 1NENB 5LNK1 2W82A 1Q10A 3TJPA 1FXAA 4FLHA 5IAAC 1P7EA 3MHZA 1WX7A 2DYMA 1WFYA 5E6JA 3U7DA 5IOIA 2KYWA 3M62B 1UBQA 2PVGC 2QMTA 4MGIE 2KLCA 3VXWA 2GRIA 3SEBA 1GOZA 2JSVX 4S17A 2LJ5A 1J7CA 1UH6A 2L52A 1V81A 1E8YA 1GB4A 1Y8RC 4KKIA 3PRPB 2N9KA 2PKOA 1YQ3B 2WP9B 4GDKB 2ZJDA 3R66C 1YNTE 2N7EA 2ZVNA 2ZCCA 4ANUA 3W5UB 1HXYD 3LJ3A 1QKZA 4KGTA 3ZIMA 4RM8A 2C60A 1AARA 2WXRA 1I4XA 1TZ1A 4HDQA 4EKUA 2N9PC 2WXKA 4IDIA 2K5PA 4DXFA 5GMVA 2L32A 4W9FA 2DZMA 3W9CB 3U2SC 1ESFA 2I1JA 1SBBB 1B9RA 2Q5WD 2UWQA 3B08A 1LQBA 4K7SA 4WJPA 2A4ZA 1R4NB 3AE5B 3DCGA 1ZE3D 1JWAD 3HM3A 3ZTCA 2LRWA 1FNUA 3ZXVA 1NI2A 4TV3A 4P6VF 2IO0B 3QA8A 5EDSA 2YVCA 4WWMA 2BT6A 2KWCA 3DBSA 1NI3A 2W3SA 4EZLA 2E3TA 2NTTA 1XT9B 4BVUC 4HDOA 2JVCA 2WLBA 1PDXA 4IWQA 5IA7A 3WA0A 3MC8A 2JZPA 1GJZA 2MQJA 2OJWA 3ZQ4A 3EA6A 3AE4B 2NTSA 1SGHA 3FKYA 2FUHB 5HI1A 2MBBB 4TMAB 1QILA 2J0MA 4W9JA 4BKSD 2IO3B 4ANXA 3BY4B 3PLUA 4YWGG 3DVGY 1WXVA 4BBNF 1JALA 1FRRA 1T0RC 2AYOB 2LFIA 4DHZE 3SU8X 4BOSC 3N1ZC 3C0RB 5DCNA 1IGDA 3PHXB 1E8XA 3I57A 3T3OA 1JMLA 1K8RB 4NAWA 2JXXA 3APDA 3ML9A 2WXMA 2BS3B 2BBCA 3AEDB 2IZVB 4NAWB 1VJKA 2NBVB 2WXNA 1FCCC 2JRIB 2M0XA 2FCSA 4PS7A 3N1XC 2EELA 4E3CA 3CSTA 2PMVA 2Y3AA 2JX5A 2WXOA 3TSSA 1P98A 2RPQA 1RFKA 2Y5BB 3Q3MC 1OEYJ 4MGZE 3CIRB 4PT5A 1OQYA 1SE2A 1T3QA 3OG5A 1DOYA 3L4PA 4TQ0A 4PK1A 2KACA 2BYFA 4XDCA 3LDZE 2SAKA 4YT0B 4LJPB 1IGCA 3MC0B 2D3BA 4F7ZA 3VQIA 3IFWB 5GXGB 1NBFC 1ZXHA 1S1QB 2FCMA 1WXAA 2AL3A 5HG2A 2FIDA 2V3NA 4M0WA 2PEAA 2RDHA 1WGYA 1WM2A 4KZCA 5DPTA 4DHZB 1CMXB 3GE8C 1CZPA 4M0WB 4EE2A 2JZZA 1ZPSA 4I6NB 2MHJA 2N0SB 5AUIA 4YTNB 3AEEB 1K52A 4ZYNA 3EC8A 2Z0DB 3ECIA 3SFDB 4W9EA 3ZO5B 4CO7A 2HD5B 3DQVA 4LJOB 2BS4B 2PPHA 4J3OD 3TUOA 1YJJA 2WHIA 3JVZX 5TR5A 3KQ4A 2OJRA 1JWUD 2ONQA 2J52A 2OOBB 1PGAA 4MGKE 5D2MB 3V61A 1V9JA 2KN4A 3AEFB 3W1SA 4A90A 3L08A 1QOFA 2BKRB 3AEGB 1EUVB 1IUEA 1WGGA 1WZ3A 2AQ2B 3OJ3A 3QIJA 3N9YC 4HEA1 3DPDA 2WDQB 1PUTA 2PVOD 2KX0A 1SIFA 3K9OB 1QF6A 4RGNA 2JYTA 2E6XA 4ICVA 3RT3B 1ZGUB 1AW7A 2LI5A 4P1CC 3MTNB 5DPWA 2LD9A 3L17A 2NPTA 2J4XA 1J0GA 2IY1B 3PRZA 3EHVA 4JWSC 1I42A 4MGYE 1IBXA 3AN1A 1GC7A 4LNNA 4IKGA 5CHFA 2QDFA 2JU6X 4MM3B 4NNJB 2WU2B 2MBEA 4RCOA 4OVZA 2N9EB 2CU3A 3PVLA 3GS2A 1GG3A 4XWTA 3I3TB 3KH0A 3PZDA 1A70A 3I9V1 4GDLB 3DBRI 4EOYA 2Z8LA 3SR6A 4MSMB 2L00B 5FR6A 2LVQA 4C4VB 4URKA 3ZKJC 1YX6B 2LRUA 4HKZE 4ACFA 1KF6B 2OEDA 3R7QA 1HEZE 3VH4B 1CQVA 1UWMA 3WAPA 1SJED 3KLSX 2ICIA 3NY5A 3ZDMC 2WWZA 1QOGA 4AJWA 4F1SA 4C80A 4HJKA 4RF1A 2KTRB 1G6JA 2AQ3B 2KMMA 1I4QA 5CHVC 1TTNA 1V2YA 1WXSA 1FRDA 4IOIE 2CHXA 2FBWB 4ICUA 4RM9A 2I2YA 1I4RA 4M8NA 3GOEA 2O6VB 4KKJA 3R2TA 4LCDE 4ANWA 4D2KA 1GUAB 3HVZA 4GXBA 4FADA 1C78A 4IW0A 1N63A 1YN5A 2UU7A 4WJOA 1K50A 2R2QA 3HIZA 4G11A 2W54A 5D7GA 2LGXA 5IP4D 1TBEA 2LJIA 1MG4A 2WDRB 2MX2A 1C76A 1TS2A 2BF8B 2KHWB 2G45B 4FJYA 3RD2A 4MH0E 1SB3C 2GBKA 1F77A 2MWSB 1ZOYB 1V1PA 3VTUA 1I4PA 2WS3B 4C00A 4HXDA 3N20C 1M94A 3PZ7A 4ZDVA 1PGXA 4LNOA 2BB6A 1TKGA 2N7DA 5C2TB 1V1PB 2N9LA 4FJZA 1SE9A 1WMHA 2YEPB 1BT0A 3J9CA 1KJTA 3V6EB 4JGHB 1P3QU 3OJ4B 4BKSA 2CR5A 2ON8A 1MHHE 1NVID 2KX3A 1WMHB 1Q5WB 3NJTA 4XC2A 2FAZA 1UWXA 2BYEA 3T8MA 2WDVB 1YX5B 2KWUB 5JXVA 5AUKA 1FCLA 3QX1A 4RGMA 4KX6B 4YTMB 4Q2JA 1MI0A 2ZZPB 2RSUA 3RFZB 1HA5A 4M02A 2J7QB 1UGJA 2HJ8A 2VZKD 1TS4A 1ZDVA 1OEYA 2KDMA 1HTOA 3NS1A 4N9F4 2QIEB 1FEHA 1UUPA 1P9DU 1UELA 2MBOA 1C1YB 3KUCB 1H4RA 1MHXA 4OVUA 2K0PA 2XBBC 3RZWC 3O65B 3VHTC 3R7RA 2M19A 2HJ1A 2L3ZA 4ZRPA 2YLMA 2CS4A 2LASA 3KVFB 3V60A 5DPRA 5KHQA 1FD6A 2D2QA 2G4DB 2V3SA 1FIQA 2KT7A 2DAJA 3A9KB 1EWCA 3UIPB 1XLOA 4ZHOA 1N5XA 2JYEA 4DK5A 3APCA 3WANA 4B0MA 4JPSA 2RGFA 1OFFA 1K53A 3R8BA 4WWOA 3HK0A 4KIKA 3DVNV 1PYWD 3U8ZA 1V5TA 4LK0M 1D5XC 3ZJTA 2LUMA 1T6BX 2LWPA 1JRUA 1SXTA 3NHEB 2KDEB 4MSQB 1T0QC 4KIKB 2L83A 2AL6A 2L1AA 4GDKA 1WZ0A 4R3DA 2QHOA 2NCNA 3NZSA 3H7PB 4RH6A 2IGDA 1HZ6A 1FFVA 1GC6A 2QILA 1KFYB 1N5WA 4RNAA 2K6QA 4IG7B 1E9MA 4WJQA 1R4NI 4BKTA 1MVKA 3L16A 2MLBA 3DDCB 2BWFA 3CSFA 4B6WA 3PO0A 3Q8FA 2X8XX 2A5UA 3CWIA 3QJZA 2VH1A 2LXAA 2O6VD 2WXIA 3UINB 3CMMB 1TS3A 2B76B 3W1YA 3T9LA 4OZCA 3H7SA 2D10A 3PPAA 4NJ7A 4L23A 3TMPB 4GMVA 4K3BA 3U4EG 1FNWA 1ZKHA 1FPYA 3QHTA 4A9AA 3DWMA 4XYCA 4US9A 2Z0EB 1TIFA 1ISNA 4ZHPA 2HDEA 3X0WA 1FNVA 4JIOU 2V9HA 4OW0A 3ZNGC 4PS8A 3C8YA 2H88B 2DLBA 5D94A 1Z2MA 3T3NA 1SE3A 2K39A 1E7UA 3RUIB 2KK8A 2KFKA 4GB9A 2XNAC 4DXGA 4W9DA 1RFAA 1WR1A 3QAQA 4TKNA 2FUG1 3ZRFA 1YMHE 2BGFA 4OZBA 4HROA 2LGDA 2KFKB 2FE8A 3MJ5A 1ACCA 2NS5A 2LEKA 3KW5B 2YEPF 3A9JB 2N7JA 2MH7A 3IXSA 1TYGB 5LLIA 1Q0WB 4ZRIA 4DWFA 2W3RA 3IT6B 1GPXA 2FNJB 2ZPNA 4TSSA 2HE7A 1VLBA 4HLEA 3RNAC 2N1VA 4HJGE 1FO4A 1HZ5A 4HWIB 4JLCA 5EE0A 3VUYA 3P1MA 1XLNA 2NBWB 1VR9A 1EF1A 3P63A 1MFWA 3PGEA 2JY6A 3FILA 2MW5A 3P4SB 5C3JB 2ZCBA 2WQYB 4GSWA 3TBLD 3ZDTA 3O13A 2AQ1B 2SEBD 4C56C 3P2BA 2C7MB 3FILB 1VZ6A 2DX5B 3P4PB 1XXGA 1E0ZA 2LZ6A 2PE9A 2G3QB 3GB1A 5AZFA 4HCPB 4UDUC 4E71A 1J19A 3TEYA 4CYEA 2M0AA 1KM7A 5J18A 1LFDA 1RM6C 2KC2A 4JWUC 2JZ3B 3Q2AC 4FHKA 2WXGA 5JZEB 5MPOA 4HPLB 1UNSA 2UYZB 3KWLA 2MCNB 3APFA 2WXJA 3VFKA 5KHOA 2KMAA 2INNE 4EZJA 2DYBA 4XGAB 3WAOA 2QJLA 2PW9A 2AX5A 4J6IA 2L76A 1RLFA 2M17A 1EF5A 4AP4C 2EKIA 2KJ6A 3FC4A 4REZA 1E8WA 2MSED 4XWWA 3AMZA 4ITKA 4I6PA 1OQQA 5D3DA 3VRBB 4RF0A 2LUEA 1XCTL 5BYQA 1ZUD2 2WGSA 4LNFA 3PREA 1E8ZA 3DBHB 2C7HA 1TKEA 4ARIA 2JT4B 1N62A 3ML8A 3UIOB 4ZRKA 3M95A 1QLBB 5IKCM 3RCZA 4WJNA 4W9GA 3H1UA 3I63C 1ZDXA 2IDYA 2VRRB 1TGZB 3U30A 3VTWA 3V6CB 2KO3A 2DZJA 3URYA 1YIWA 2N4FA 4RFBA 2KAJA 2L0FA 1HE8A 4HKQA 1GAQB 4FJVB 3TEZA 1SEBD 3QK0A 3HHMA 1LO5D 3TIXA 4YTPB 3PTFC 2VZKB 2MJDA 4A3PA 2J0KA 3BVZA 4HVBA 3GZNB 2KKCA 2M4NA 1ZW7A 3AI5A 3EFUA 1JWMD 3U7ZA 2BB5A 2N9XA 2L0TA 3R2IA 1DYQA 2LVPA 4DQOC 1TKYA 1JW9D 2PE6B 4JX1C 1WWTA 4EFOA 1NYQA 3QC8B 4HPMB 2C5LC 5AZHA 4W9IA 3AEAB 2G4SA 3LXFA 4MM3A 3GP7A 1RYJA 1L0YB 2V3PA 1B1ZA 3V62A 1T0YA 3H9DA 2XK5B 3N3KB 2IPKD 2INDC 4BAXA 3SHQA 4GDLA 1XLQA 3NG0A 4IM2A 1T0SC 3JSVA 4B9KA 4F8CB 3RNEC 4C4VA 5TSSA 3WIMA 3AE8B 1K51A 1YQBA 3JSVB 2LVOA 2K25A 1JWBD 3AH7A 2X38A 3Q69A 2M1MA 3RNCC 2XEWA 2KANA 2KNBA 1SE4A 1FXTB 2MBHA 5CTRC 2KTRA 3AE6B 4W9LA 4DDGD 5J2RA 1EU3A 1L7YA 4YL8A 2TSSA 2LGIA 1JCKB 3VTVA 2BPSA 2JXTA 3ZVVA 4KDIC 3NZ3A 3PRMB 2L8JA 3S2AA 3UQBA 1ET6A 1I4HA 3ZLZA 2O6VA 3AE9B 5JHBA 1WGKA 1L6VA 1C77A 1WRIA 4NAMA 4DDID 2JF5A 4L2YA 3B9JA 4GOCA 3NS8A 2FIFA 2JWZA 4XE0A 2NVUI 2ZEQA 2ZNVB 2PLPA 3NOBA 2REXA 1V5OA 4PYUA 3SFEB 4BOZB 4IUMB 5BMIA 3RN9C 2BS2B 1WE6A 5FKAC 2L05A 1XQQA 4HCNB 2FCNA 1OGWA 2WU5B 3P42A 3Q3NC 4OZAA 2GI9A 2WXHA 3AV8A 3EGRA 1WF9A 2QCZA 3N1YC 2G9HD 2MJ3A 3QCAA 2RD0A 2IO2B 4P7IA 3V05A 1KLGD 4G50A 2DBYA 2WX1A 4K1RB 2ZNVC 3BK1A 3VAWA 1OQRA 2G1EA 2Z59B 2BQQA 4P16A 2OHFA 2MJEA 3MFGA 2KDIA 5L95C 1LGRA 5HFYA 2W55A 2KQ4X 4KSKC 2KDFB 3BZDB 3RNBC 4C7ZA 1I4GA 1NEKB 1UBIA 4WQOB 4CQNA 3HUIA 2ZPYA 5JHAA 2K1FA 5EE1A 5EE3A 3RULA 2AEHA 2DNFA 3AXCA 3N30A 1R4MI 2O2VA 4LDTB 1D3ZA 4RMAA 2ZW1A 2NBUA 1RWSA 1TJEA 1WYWB 2JPHA 2O2VB 4B0EA 3A1QA 2GMIC 3M3JA 2DZIA 3DHGC 3OWEB 3IVFA 1HQRD 2IGHA 1E7PB 3AE7B 1R7SA 5E6OA 3A1QB 2LGSA 2LGYA 2JUOA 1WXQA 1N60A 1R4MB 1TZOA 4M00A 4N58A 1NYRA 2KVRA 1L0XB 3WAMA 1D4BA 2AWTA 4W9CA 1CK1A 1XF5L 4W9KA 2ZVOA 1WR6E 2J42A 1E7VA 1TY2A 2QC8A 4ASWC 5G5GA 4G0NB 1RRBA 4NJ6A 2KJRA 4FXCA 3A9KA 4JE3B 4XZ4A 3OAWA 4FULA 2ZW0A 2I38A 1JRPA 3PS6A 1WGHA 3VR9B 1VRAB 2Y5PA 2H89B 1VZ7A 3PHWB 3ZNID 4IWPA 2DYOA 4A55A 1IP9A 1WJUA 3ZNZB 4KV2A 4CHKA 2MRPA 3ZJUA 3JYUA 2EMSA 3EUB2 3MC9A 1C79A 4K7WA 4KVGB 4KZ0A 2GLSA 1FFUA 2JQRB 2XN9C 2RDBC 2WYQA 2QSDA 4DHJD 3H7PA 3VVWB 3NVZA 1SIJA 4WURA 2EMTA 5CHWA 2BWES 4IM3A 1BMLC 1HTQA 2GB1A 3H6NA 3HVDA 2JRHA 1FM0D 1VZ8A 2INCC 2KTFA 3AE2B 1DOXA 3NVYA 1MG8A 1XO3A 1QZEA 2N1WA 5AZGA 3LYYA 3TEXA 1V49A 4ZYSA 4M01A 1KOTA 5EE9A 1YJIA 1YD8U 1STEA 3KWVA 2CJNA 2CKHB 2L7RA 5G55A 1U4AA 3MP9A 4X57B 3WALA 3RPFC 1JQ4A 3BIID 3KYCD 4FBJB 1JWSD 1E6EB 3P4QB 1P7FA 3DWGC 5J17A 2GBJA 3SD5A 4HPPA 2HTHA 3QQ8B 4RGOS 4ZRJA 2IO1B 3AEBB 1F2RC 3PT2B 5IO9A 4AOFA 3ENEA 1KH0A 4K81A 3ETRA 2K8HA 3I5JC 2INPE 3Q8CA 2M56B 4PS3A 4GGQA 2KWVB 5BMGA 3ZXRA 3KUZA 2MEKA 4IC7B 4B95A 1F9JA 1WM3A 4MJSA 2D11A 3ZYYX 3L13A 4M8MA 2J0JA 1CJEA 2KD0A 1QQRA 4MJSB 3TL5A 1L5PA 3BVGA 4FN2A 2WNMA 3AULA 5D3IB 2QEJC 1AYFA 1V86A 1WJ6A 3PLVA 4II2B 3A9JA 2RR9A 3HM6X 3L0WB 4NQKE 4ZRQA 2KZRA 1WI0A 2D3GA 3B0AA 1V6EA 4LDTD 1QT9A 3GE3C 3Q8EA 4II3B 1V8CA 2NR2A 1C9FA 5G5HA 1MJDA 1Z5SB 2RPVA 3NVVA 2DZKA 1WH3A 3DHHC 3PV1A 4HRSA 1DGJA 4YSZB 3B2FA 3PZ8A 1L4DB 4WAAA 3AE3B 3RMKC 1VD2A 5E6PA 1X1MA 3P4RB 3KUDB 3KYDD 3DHIC 4WAFA 3L54A 2D3AA 2GOWA 4YXDB 1F52A 4MH8A 4AS1A 4AWJA 4A20A 1T5XD 4O1NA 3FAHA 4ARCA 1WX8A 1EU4A 4A8XC 1H8CA 2RDGA 1JROA 3ZW3A 5LXIB 1N61A 4EUTA 1FXIA 4FA6A 2NMQA 1AWDA 1XEEA 1P0RA 2WXQA 4WH4A 4AQ7A 1SSNA 1TY0A 3B1LX 1YN4A 2J53A 2K3UA 1KRHA 3UF8A 3DBHI 1UD7A 3U52E 3MHSD 1WGRA 2DAFA 3R3MA 1WX9A 3EFCA 3HRDD 4WIPA 1WIAA 3DVGX 2C7NB 3RYTA 4MEMA 2VH2A 4TQ1A 2K22A 2IGGA 3NRZA 3ALBA 2Y5CA 2ACZB 3NZUA 2KXJA 1BXTA 3W5VB 2IYDB 2KWDA 2PTLA 3BK2A 2GBNA 5C23A 2LHDA 4RGTA 1XCQL 2WXFA 2BYTA 3GZNI 4DXAB 3ZRCA 1IYFA 1YN3A 3TEWA 1WJ4A 3CF6E 4DBGA 2IJ0A 1WY8A 4K7UA 1L4ZB 3ZJVA 5DPSA 3ZUNA 3N32A 4MDKE 1WE7A 2KFJA 1BUIC 4NQLB 1F0ZA 2KN5A 3ZNHB 5BO4B 1ENFA 1I7HA 5T8IA 1LM8B 3V3XA 1TS5A 1XLPA 2K8BA 1Y56A 1C4AA 5CX3A 3BYTB 4LNKA 5FR3A 2K8CA 2KQSA 1PGBA 2D3CA 4E74A 2RMMA 1WXMA 3Q8BA 2BYVE 3PSEB 3VUWA 4A3OA 2K9XA 3IG3A 4C7YA 1YQ4B 3BWUD 5HKHA 2KVZA 1M4VA 4USAA 2HTME 4ZOHC 2V4LA 5G2NA 3A4RA 3RZFA 1WSPA 2XK5A 3IAM1 5L83A 3JW0X 1E90A 3H8HA 3LB8C 2IY0B 3IBEA 1S3SG 2GBMA 4MACA 2BVCA 4QAYA 4W9HA 1Q1OA 1AN8A 1KLVA 3BINA 1VCBA 5H92C 4NZLB 5BYSA 4N6EB 1NDDA 2JWUA 1ROEA 2PIAA 2MP2A 5FK9C 5LXHA 1TT5B 1WJNA 1V1OA 4NY0A 2WX0A 3W1SC 1QOBA 2NPTB 2KOXA 1A5RA 4OVVA 5JH5C 3AU4A 3TCAA 4DHJB 3AU5A 4N59A 2MP2B 4WWNA 1IBXB 3UGBB 1EO6A 5E6NA 3WCQA 1KTKA 3AB5A 3QWZB 2K6DB 2CHZA 4HK2A 3E56A 1XD3B 2C9WB 5I4DA 4K3CA 1L0VB 5C1ZA 4IWOA 4NJCA 4BKGA 1GB1A 1UF0A 2D07B 4JL9A 3UI3A 2LMCA 4NPNA 4GLSC 3AE1B 3DVNU 3D32A 4US8A 2CHWA 3Q6BA 4FHJA 3Q14C 1ZP0B 3E9SA 4BZAA 1D5ZC 3NUHB 3RNGC 1PFDA 3RNFC 3A33B 2DWQA 1OTRB 3VUXA 2ASQA 2DENB 3DBRB 3QARA 2D5GA 2W9NA 2LXCA 2WXLA 4KDLB 1QOAA 2R2OA 2R61A 5AEKB 4KGSA 2BW2A 4MELA 4AUQC 1KLUD 1J7AA 4LTUA 2EKEC 2WDTB 3ABVB 4EZKA 3MJWA 1E10A 1RAXA 2KLGA 4BFRA 5BYRA 3Q3OC 3VDZA 1D5MC 2WXPA 3DBLI 4EEWA 1WYGA 3BYYB 1FMAD 1SJHD 4LLGM 3VH3B 3IHPC 3NVWA 3ZTDA 4XDDA 1VDVA 1N6ZA 1ET9A 4P1BC 4H2AA 3SDLC 3DOWA 4JQWC 1EM7A 3IAS1 3Q3FA 1MPEA 3OLMD 1L2NA 1V97A 1V80A 2I1KA 2IBIB 1E5WA 3W2DA 1WRDB 4GIVA 2KQ7A 4PYZA
chains in the Genus database with same CATH topology
5AZGA 3MTNB 2DX5B 1V49A 2PJHA 1KOTA 2LZ6A 2PE9A 2G3QB 2KJHB 1YD8U 5DPWA 5AZFA 2LD9A 3L17A 2NPTA 2CKHB 2L7RA 4HCPB 5G55A 4E71A 1J0GA 2IY1B 1U4AA 3PRZA 1J8CA 3EHVA 1J19A 1I42A 2BKFA 4MGYE 4X57B 4CYEA 3WALA 1KM7A 2GBRA 5J18A 1GC7A 1LFDA 3KYCD 1UZXB 4FBJB 5CHFA 2KC2A 4NNJB 4I6LB 2JZ3B 1UGMA 3M63B 5J17A 2KMCA 4FHKA 5D6JB 2MBEA 5JZEB 2GBJA 3SD5A 4HPLB 4AJYB 1WGDA 2HTHA 2UYZB 3QQ8B 2KDBA 1PQSA 2N9EB 4ZRJA 2IO1B 2MCNB 3PVLA 3PT2B 3APFA 3ONSA 1GG3A 3VFKA 3I3TB 1I35A 5KHOA 2KMAA 1IPGA 4AOFA 3L10B 4EZJA 2DYBA 3KH0A 3ENEA 3PZDA 3Q3JA 2V1YA 3WAOA 4GDLB 4K81A 1P1AA 2K8HA 3EECA 3DBRI 4J6IA 2L76A 2CU1A 4EOYA 1RLFA 2M17A 4PS3A 1EF5A 4AP4C 4GGQA 2KWVB 4MSMB 1GNUA 2L00B 4G3XB 5FR6A 2KJ6A 3KUZA 4IC7B 2LVQA 1E8WA 1YJ1A 1F9JA 4B95A 4BBNC 1WM3A 4MJSA 2M8SA 1YX6B 2MSED 3ZKJC 2D11A 2LRUA 3L13A 4I6PA 4M8MA 2J0JA 4GN1A 3R7QA 3X23A 2MBQA 3VH4B 2FCQA 4WWPA 3WAPA 2KD0A 3NY5A 2LUEA 3ZDMC 2DHZA 2B3AA 2WWZA 4MJSB 3TL5A 3UQAA 2MA9B 4AJWA 4F1SA 4HJKA 1G6JA 2KTRB 3PREA 1E8ZA 5CHVC 1TTNA 2KC1A 2C7HA 3A4SC 4FN2A 1V2YA 1WXSA 3AULA 1LXDA 2JT4B 2CHXA 3ML8A 3UIOB 4ICUA 4ZRKA 1V86A 3M95A 4RM9A 1WJ6A 3PLVA 4II2B 3K9PB 3A9JA 3RCZA 4M8NA 4WJNA 4GU2A 2RR9A 3HM6X 3GOEA 3L0WB 4KSLC 4NQKE 4W9GA 2KZRA 1WI0A 2D3GA 3H1UA 4IM0A 2O6VB 1V6EA 3B0AA 4LDTD 1C3TA 4XX5A 2VRRB 4II3B 1TGZB 4LCDE 3U30A 1GUAB 2KO3A 4GXBA 3V6CB 3VTWA 4ANWA 4FADA 2DZJA 4ANVA 2NR2A 1YIWA 2N4FA 1Z5SB 4IW0A 4TUUA 2DZKA 2L0FA 1WH3A 1HE8A 4FJVB 4WJOA 2R2QA 3TJPA 3QK0A 3HIZA 3HHMA 3TIXA 3PV1A 4G11A 5D7GA 4FLHA 5IAAC 3PTFC 2LGXA 1TBEA 1WX7A 2MX2A 4A3PA 2DYMA 2J0KA 1WFYA 2BF8B 2KHWB 2KKCA 4WAAA 4HVBA 2G45B 4FJYA 2M4NA 1ZW7A 3AI5A 3EFUA 4MH0E 1VD2A 3RD2A 3U7DA 3M62B 2GBKA 1UBQA 5E6PA 1X1MA 2MWSB 3KUDB 3KYDD 3VTUA 4MGIE 2KLCA 2L0TA 2N9XA 3L54A 3VXWA 2GOWA 4HXDA 1M94A 2LVPA 4ZDVA 2C7MB 2LJ5A 4AWJA 4A20A 2N7DA 2PE6B 1UH6A 1WX8A 1V81A 1E8YA 4EFOA 1H8CA 3QC8B 4FJZA 4HPMB 2C5LC 5AZHA 1SE9A 1WMHA 4W9IA 1BT0A 1Y8RC 2G4SA 4MM3A 3PRPB 1KJTA 3V6EB 4JGHB 1P3QU 3OJ4B 3ZW3A 4BKSA 2CR5A 4GDKB 2ZJDA 5LXIB 3R66C 2N7EA 2ZVNA 4EUTA 2ZCCA 4ANUA 4FA6A 3V62A 1T0YA 2KX3A 1WMHB 3LJ3A 3H9DA 2XK5B 1P0RA 1Q5WB 3N3KB 4XC2A 2FAZA 3ZIMA 3SHQA 4GDLA 2BYEA 4RM8A 2C60A 4IM2A 3B1LX 3T8MA 3JSVA 4B9KA 1AARA 1YX5B 3UF8A 2KWUB 1TZ1A 4F8CB 3DBHI 4HDQA 1UD7A 4EKUA 2N9PC 3MHSD 1WGRA 2DAFA 3WIMA 3R3MA 3QX1A 1YQBA 5GMVA 1WX9A 2LVOA 3JSVB 2K25A 4W9FA 2DZMA 2M1MA 2I1JA 2UWQA 1WIAA 3DVGX 2ZZPB 3B08A 2RSUA 1LQBA 2C7NB 2XEWA 4K7SA 2KANA 3RYTA 4MEMA 2KNBA 2J7QB 2HJ8A 4WJPA 1FXTB 2A4ZA 2MBHA 2KTRA 3DCGA 4TQ1A 4W9LA 5CTRC 4DDGD 5J2RA 1L7YA 4YL8A 3ALBA 1OEYA 3HM3A 3ZTCA 3NZUA 2KXJA 2LRWA 4N9F4 3VTVA 2IYDB 1NI2A 4TV3A 2IO0B 3QA8A 5EDSA 2BPSA 3ZVVA 2YVCA 1P9DU 1UELA 2MBOA 4KDIC 2KWCA 1C1YB 3KUCB 3PRMB 1H4RA 2L8JA 3DBSA 2GBNA 3S2AA 3UQBA 5C23A 4OVUA 2XBBC 4EZLA 3RZWC 3O65B 3ZLZA 3VHTC 2O6VA 5JHBA 1XT9B 3R7RA 4URKA 3GZNI 4DXAB 3ZRCA 4BVUC 1IYFA 4HDOA 2L3ZA 2YLMA 4DDID 2JF5A 1WJ4A 2JVCA 4IWQA 2CS4A 3CF6E 5IA7A 4DBGA 4GOCA 3NS8A 3WA0A 2FIFA 2JWZA 1WY8A 2LASA 2NVUI 4K7UA 3KVFB 5DPSA 3V60A 2ZEQA 2ZNVB 1GJZA 3ZUNA 3N32A 5DPRA 5KHQA 2D2QA 3NOBA 2REXA 4MDKE 1WE7A 1V5OA 2G4DB 2KFJA 2V3SA 2MQJA 4NQLB 4PYUA 4BOZB 2KN5A 4IUMB 5BO4B 3ZNHB 1SGHA 2FUHB 1WE6A 1LM8B 2DAJA 3A9KB 2L05A 1XQQA 2MBBB 3UIPB 4HCNB 2FCNA 2J0MA 1OGWA 4W9JA 4DK5A 3APCA 3WANA 4BKSD 2K8BA 2IO3B 2RGFA 4ANXA 1WF9A 5CX3A 3QCAA 2RD0A 3BY4B 3PLUA 4WWOA 2IO2B 4P7IA 2K8CA 2KQSA 3HK0A 4KIKA 3DVNV 4E74A 4G50A 1WXMA 3U8ZA 2BYVE 1V5TA 2WX1A 3DVGY 3PSEB 3VUWA 4A3OA 1WXVA 4BBNF 4K1RB 2ZNVC 2LWPA 3IG3A 1JRUA 3VAWA 2Z59B 3NHEB 2KDEB 2AYOB 4MSQB 4DHZE 4KIKB 3SU8X 2KDIA 4BOSC 5HKHA 2AL6A 4GDKA 3C0RB 1WZ0A 5DCNA 5L95C 3PHXB 1E8XA 2V4LA 3A4RA 5G2NA 3RZFA 2QHOA 1K8RB 4NAWA 2XK5A 5L83A 4KSKC 2JXXA 2NCNA 3APDA 1E90A 3H7PB 2KDFB 3JW0X 3ML9A 3NZSA 2IY0B 3IBEA 1S3SG 1GC6A 2GBMA 2IZVB 1UBIA 4WQOB 2K6QA 4IG7B 2ZPYA 4WJQA 1R4NI 4NAWB 3L16A 4BKTA 5JHAA 2K1FA 2MLBA 2NBVB 4W9HA 3DDCB 2BWFA 1Q1OA 3RULA 2JRIB 2M0XA 2AEHA 3CSFA 4B6WA 1KLVA 3BINA 2FCSA 4PS7A 1VCBA 3AXCA 3N30A 1R4MI 2O2VA 2A5UA 3QJZA 4E3CA 3CSTA 1NDDA 4LDTB 1D3ZA 4RMAA 2NBUA 1P98A 2LXAA 2MP2A 5LXHA 1WYWB 2RPQA 2Y5BB 2O6VD 1WJNA 4NY0A 3UINB 3CMMB 2JPHA 2O2VB 3W1YA 3T9LA 2WX0A 3W1SC 4GIVA 3A1QA 2GMIC 3M3JA 2NPTB 2KOXA 1OEYJ 3H7SA 4OVVA 2DZIA 2D10A 3AU4A 4MGZE 3TCAA 4DHJB 5JH5C 3AU5A 3PPAA 2MP2B 1OQYA 4WWNA 4NJ7A 3IVFA 3UGBB 1EO6A 3TMPB 4TQ0A 5E6NA 4GMVA 5E6OA 3QWZB 2K6DB 3A1QB 2CHZA 4HK2A 2BYFA 2LGYA 1XD3B 1ZKHA 2C9WB 2JUOA 3LDZE 4LJPB 3QHTA 4F7ZA 3VQIA 3IFWB 2Z0EB 1NBFC 5C1ZA 2KVRA 1S1QB 2FCMA 3WAMA 1WXAA 1ISNA 2AL3A 4IWOA 2AWTA 4BKGA 1A5RA 4JL9A 2D07B 2FIDA 4W9CA 4NPNA 4W9KA 2ZVOA 1WR6E 3X0WA 3DVNU 3D32A 2PEAA 1E7VA 1WGYA 4JIOU 4ASWC 1WM2A 4KZCA 2CHWA 5DPTA 4FHJA 4G0NB 3ZNGC 1RRBA 4NJ6A 4PS8A 2KJRA 4DHZB 3A9KA 1CMXB 4XZ4A 3OAWA 4FULA 3A33B 4M0WB 1OTRB 5D94A 3VUXA 2ASQA 1Z2MA 1WGHA 3PS6A 2JZZA 2DENB 2K39A 1E7UA 3RUIB 4I6NB 3QARA 2W9NA 2LXCA 2KK8A 2KFKA 4GB9A 4KDLB 3PHWB 3ZNID 4IWPA 2DYOA 4ZYNA 2R2OA 3EC8A 2Z0DB 5AEKB 4W9DA 1RFAA 1WR1A 3ECIA 3QAQA 4W9EA 1IP9A 3ZO5B 4TKNA 1WJUA 4CO7A 2HD5B 3DQVA 4MELA 3ZNZB 3ZRFA 4KV2A 4LJOB 2BGFA 2PPHA 4CHKA 2MRPA 2LGDA 2KFKB 4AUQC 2NS5A 3JYUA 2EMSA 2EKEC 3A9JB 3KW5B 2WDTB 3JVZX 5TR5A 4K7WA 4EZKA 4KVGB 4KZ0A 3MJWA 1RAXA 2KLGA 2OJRA 5D2MB 4MGKE 5LLIA 1Q0WB 2OOBB 3V61A 4ZRIA 4BFRA 2WYQA 4DWFA 1V9JA 3W1SA 3VDZA 4DHJD 2FNJB 2ZPNA 3L08A 3H7PA 2BKRB 3VVWB 3DBLI 2HE7A 4HLEA 1EUVB 4EEWA 1WGGA 2N1VA 1WZ3A 4HWIB 4JLCA 3VH3B 3QIJA 3OJ3A 2EMTA 3VUYA 3IHPC 2BWES 5CHWA 2NBWB 4IM3A 1EF1A 3ZTDA 3H6NA 2JRHA 3DPDA 3PGEA 3SDLC 2JY6A 2MW5A 3DOWA 2KTFA 4JQWC 3Q3FA 2KX0A 3OLMD 1L2NA 1SIFA 3K9OB 1V80A 2ZCBA 1MG8A 2I1KA 4GSWA 3TBLD 3ZDTA 2IBIB 1E5WA 4ICVA 3RT3B 1ZGUB 1WRDB 1QZEA 2N1WA 3P2BA 2LI5A 2KQ7A 4PYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AZG A;  3MTN B;  2DX5 B;  1V49 A;  2PJH A;  1KOT A;  2LZ6 A;  2PE9 A;  2G3Q B;  2KJH B;  1YD8 U;  5DPW A;  5AZF A;  2LD9 A;  3L17 A;  2NPT A;  2CKH B;  2L7R A;  4HCP B;  5G55 A;  4E71 A;  1J0G A;  2IY1 B;  1U4A A;  3PRZ A;  1J8C A;  3EHV A;  1J19 A;  1I42 A;  2BKF A;  4MGY E;  4X57 B;  4CYE A;  3WAL A;  1KM7 A;  2GBR A;  5J18 A;  1GC7 A;  1LFD A;  3KYC D;  1UZX B;  4FBJ B;  5CHF A;  2KC2 A;  4NNJ B;  4I6L B;  2JZ3 B;  1UGM A;  3M63 B;  5J17 A;  2KMC A;  4FHK A;  5D6J B;  2MBE A;  5JZE B;  2GBJ A;  3SD5 A;  4HPL B;  4AJY B;  1WGD A;  2HTH A;  2UYZ B;  3QQ8 B;  2KDB A;  1PQS A;  2N9E B;  4ZRJ A;  2IO1 B;  2MCN B;  3PVL A;  3PT2 B;  3APF A;  3ONS A;  1GG3 A;  3VFK A;  3I3T B;  1I35 A;  5KHO A;  2KMA A;  1IPG A;  4AOF A;  3L10 B;  4EZJ A;  2DYB A;  3KH0 A;  3ENE A;  3PZD A;  3Q3J A;  2V1Y A;  3WAO A;  4GDL B;  4K81 A;  1P1A A;  2K8H A;  3EEC A;  3DBR I;  4J6I A;  2L76 A;  2CU1 A;  4EOY A;  1RLF A;  2M17 A;  4PS3 A;  1EF5 A;  4AP4 C;  4GGQ A;  2KWV B;  4MSM B;  1GNU A;  2L00 B;  4G3X B;  5FR6 A;  2KJ6 A;  3KUZ A;  4IC7 B;  2LVQ A;  1E8W A;  1YJ1 A;  1F9J A;  4B95 A;  4BBN C;  1WM3 A;  4MJS A;  2M8S A;  1YX6 B;  2MSE D;  3ZKJ C;  2D11 A;  2LRU A;  3L13 A;  4I6P A;  4M8M A;  2J0J A;  4GN1 A;  3R7Q A;  3X23 A;  2MBQ A;  3VH4 B;  2FCQ A;  4WWP A;  3WAP A;  2KD0 A;  3NY5 A;  2LUE A;  3ZDM C;  2DHZ A;  2B3A A;  2WWZ A;  4MJS B;  3TL5 A;  3UQA A;  2MA9 B;  4AJW A;  4F1S A;  4HJK A;  1G6J A;  2KTR B;  3PRE A;  1E8Z A;  5CHV C;  1TTN A;  2KC1 A;  2C7H A;  3A4S C;  4FN2 A;  1V2Y A;  1WXS A;  3AUL A;  1LXD A;  2JT4 B;  2CHX A;  3ML8 A;  3UIO B;  4ICU A;  4ZRK A;  1V86 A;  3M95 A;  4RM9 A;  1WJ6 A;  3PLV A;  4II2 B;  3K9P B;  3A9J A;  3RCZ A;  4M8N A;  4WJN A;  4GU2 A;  2RR9 A;  3HM6 X;  3GOE A;  3L0W B;  4KSL C;  4NQK E;  4W9G A;  2KZR A;  1WI0 A;  2D3G A;  3H1U A;  4IM0 A;  2O6V B;  1V6E A;  3B0A A;  4LDT D;  1C3T A;  4XX5 A;  2VRR B;  4II3 B;  1TGZ B;  4LCD E;  3U30 A;  1GUA B;  2KO3 A;  4GXB A;  3V6C B;  3VTW A;  4ANW A;  4FAD A;  2DZJ A;  4ANV A;  2NR2 A;  1YIW A;  2N4F A;  1Z5S B;  4IW0 A;  4TUU A;  2DZK A;  2L0F A;  1WH3 A;  1HE8 A;  4FJV B;  4WJO A;  2R2Q A;  3TJP A;  3QK0 A;  3HIZ A;  3HHM A;  3TIX A;  3PV1 A;  4G11 A;  5D7G A;  4FLH A;  5IAA C;  3PTF C;  2LGX A;  1TBE A;  1WX7 A;  2MX2 A;  4A3P A;  2DYM A;  2J0K A;  1WFY A;  2BF8 B;  2KHW B;  2KKC A;  4WAA A;  4HVB A;  2G45 B;  4FJY A;  2M4N A;  1ZW7 A;  3AI5 A;  3EFU A;  4MH0 E;  1VD2 A;  3RD2 A;  3U7D A;  3M62 B;  2GBK A;  1UBQ A;  5E6P A;  1X1M A;  2MWS B;  3KUD B;  3KYD D;  3VTU A;  4MGI E;  2KLC A;  2L0T A;  2N9X A;  3L54 A;  3VXW A;  2GOW A;  4HXD A;  1M94 A;  2LVP A;  4ZDV A;  2C7M B;  2LJ5 A;  4AWJ A;  4A20 A;  2N7D A;  2PE6 B;  1UH6 A;  1WX8 A;  1V81 A;  1E8Y A;  4EFO A;  1H8C A;  3QC8 B;  4FJZ A;  4HPM B;  2C5L C;  5AZH A;  1SE9 A;  1WMH A;  4W9I A;  1BT0 A;  1Y8R C;  2G4S A;  4MM3 A;  3PRP B;  1KJT A;  3V6E B;  4JGH B;  1P3Q U;  3OJ4 B;  3ZW3 A;  4BKS A;  2CR5 A;  4GDK B;  2ZJD A;  5LXI B;  3R66 C;  2N7E A;  2ZVN A;  4EUT A;  2ZCC A;  4ANU A;  4FA6 A;  3V62 A;  1T0Y A;  2KX3 A;  1WMH B;  3LJ3 A;  3H9D A;  2XK5 B;  1P0R A;  1Q5W B;  3N3K B;  4XC2 A;  2FAZ A;  3ZIM A;  3SHQ A;  4GDL A;  2BYE A;  4RM8 A;  2C60 A;  4IM2 A;  3B1L X;  3T8M A;  3JSV A;  4B9K A;  1AAR A;  1YX5 B;  3UF8 A;  2KWU B;  1TZ1 A;  4F8C B;  3DBH I;  4HDQ A;  1UD7 A;  4EKU A;  2N9P C;  3MHS D;  1WGR A;  2DAF A;  3WIM A;  3R3M A;  3QX1 A;  1YQB A;  5GMV A;  1WX9 A;  2LVO A;  3JSV B;  2K25 A;  4W9F A;  2DZM A;  2M1M A;  2I1J A;  2UWQ A;  1WIA A;  3DVG X;  2ZZP B;  3B08 A;  2RSU A;  1LQB A;  2C7N B;  2XEW A;  4K7S A;  2KAN A;  3RYT A;  4MEM A;  2KNB A;  2J7Q B;  2HJ8 A;  4WJP A;  1FXT B;  2A4Z A;  2MBH A;  2KTR A;  3DCG A;  4TQ1 A;  4W9L A;  5CTR C;  4DDG D;  5J2R A;  1L7Y A;  4YL8 A;  3ALB A;  1OEY A;  3HM3 A;  3ZTC A;  3NZU A;  2KXJ A;  2LRW A;  4N9F 4;  3VTV A;  2IYD B;  1NI2 A;  4TV3 A;  2IO0 B;  3QA8 A;  5EDS A;  2BPS A;  3ZVV A;  2YVC A;  1P9D U;  1UEL A;  2MBO A;  4KDI C;  2KWC A;  1C1Y B;  3KUC B;  3PRM B;  1H4R A;  2L8J A;  3DBS A;  2GBN A;  3S2A A;  3UQB A;  5C23 A;  4OVU A;  2XBB C;  4EZL A;  3RZW C;  3O65 B;  3ZLZ A;  3VHT C;  2O6V A;  5JHB A;  1XT9 B;  3R7R A;  4URK A;  3GZN I;  4DXA B;  3ZRC A;  4BVU C;  1IYF A;  4HDO A;  2L3Z A;  2YLM A;  4DDI D;  2JF5 A;  1WJ4 A;  2JVC A;  4IWQ A;  2CS4 A;  3CF6 E;  5IA7 A;  4DBG A;  4GOC A;  3NS8 A;  3WA0 A;  2FIF A;  2JWZ A;  1WY8 A;  2LAS A;  2NVU I;  4K7U A;  3KVF B;  5DPS A;  3V60 A;  2ZEQ A;  2ZNV B;  1GJZ A;  3ZUN A;  3N32 A;  5DPR A;  5KHQ A;  2D2Q A;  3NOB A;  2REX A;  4MDK E;  1WE7 A;  1V5O A;  2G4D B;  2KFJ A;  2V3S A;  2MQJ A;  4NQL B;  4PYU A;  4BOZ B;  2KN5 A;  4IUM B;  5BO4 B;  3ZNH B;  1SGH A;  2FUH B;  1WE6 A;  1LM8 B;  2DAJ A;  3A9K B;  2L05 A;  1XQQ A;  2MBB B;  3UIP B;  4HCN B;  2FCN A;  2J0M A;  1OGW A;  4W9J A;  4DK5 A;  3APC A;  3WAN A;  4BKS D;  2K8B A;  2IO3 B;  2RGF A;  4ANX A;  1WF9 A;  5CX3 A;  3QCA A;  2RD0 A;  3BY4 B;  3PLU A;  4WWO A;  2IO2 B;  4P7I A;  2K8C A;  2KQS A;  3HK0 A;  4KIK A;  3DVN V;  4E74 A;  4G50 A;  1WXM A;  3U8Z A;  2BYV E;  1V5T A;  2WX1 A;  3DVG Y;  3PSE B;  3VUW A;  4A3O A;  1WXV A;  4BBN F;  4K1R B;  2ZNV C;  2LWP A;  3IG3 A;  1JRU A;  3VAW A;  2Z59 B;  3NHE B;  2KDE B;  2AYO B;  4MSQ B;  4DHZ E;  4KIK B;  3SU8 X;  2KDI A;  4BOS C;  5HKH A;  2AL6 A;  4GDK A;  3C0R B;  1WZ0 A;  5DCN A;  5L95 C;  3PHX B;  1E8X A;  2V4L A;  3A4R A;  5G2N A;  3RZF A;  2QHO A;  1K8R B;  4NAW A;  2XK5 A;  5L83 A;  4KSK C;  2JXX A;  2NCN A;  3APD A;  1E90 A;  3H7P B;  2KDF B;  3JW0 X;  3ML9 A;  3NZS A;  2IY0 B;  3IBE A;  1S3S G;  1GC6 A;  2GBM A;  2IZV B;  1UBI A;  4WQO B;  2K6Q A;  4IG7 B;  2ZPY A;  4WJQ A;  1R4N I;  4NAW B;  3L16 A;  4BKT A;  5JHA A;  2K1F A;  2MLB A;  2NBV B;  4W9H A;  3DDC B;  2BWF A;  1Q1O A;  3RUL A;  2JRI B;  2M0X A;  2AEH A;  3CSF A;  4B6W A;  1KLV A;  3BIN A;  2FCS A;  4PS7 A;  1VCB A;  3AXC A;  3N30 A;  1R4M I;  2O2V A;  2A5U A;  3QJZ A;  4E3C A;  3CST A;  1NDD A;  4LDT B;  1D3Z A;  4RMA A;  2NBU A;  1P98 A;  2LXA A;  2MP2 A;  5LXH A;  1WYW B;  2RPQ A;  2Y5B B;  2O6V D;  1WJN A;  4NY0 A;  3UIN B;  3CMM B;  2JPH A;  2O2V B;  3W1Y A;  3T9L A;  2WX0 A;  3W1S C;  4GIV A;  3A1Q A;  2GMI C;  3M3J A;  2NPT B;  2KOX A;  1OEY J;  3H7S A;  4OVV A;  2DZI A;  2D10 A;  3AU4 A;  4MGZ E;  3TCA A;  4DHJ B;  5JH5 C;  3AU5 A;  3PPA A;  2MP2 B;  1OQY A;  4WWN A;  4NJ7 A;  3IVF A;  3UGB B;  1EO6 A;  3TMP B;  4TQ0 A;  5E6N A;  4GMV A;  5E6O A;  3QWZ B;  2K6D B;  3A1Q B;  2CHZ A;  4HK2 A;  2BYF A;  2LGY A;  1XD3 B;  1ZKH A;  2C9W B;  2JUO A;  3LDZ E;  4LJP B;  3QHT A;  4F7Z A;  3VQI A;  3IFW B;  2Z0E B;  1NBF C;  5C1Z A;  2KVR A;  1S1Q B;  2FCM A;  3WAM A;  1WXA A;  1ISN A;  2AL3 A;  4IWO A;  2AWT A;  4BKG A;  1A5R A;  4JL9 A;  2D07 B;  2FID A;  4W9C A;  4NPN A;  4W9K A;  2ZVO A;  1WR6 E;  3X0W A;  3DVN U;  3D32 A;  2PEA A;  1E7V A;  1WGY A;  4JIO U;  4ASW C;  1WM2 A;  4KZC A;  2CHW A;  5DPT A;  4FHJ A;  4G0N B;  3ZNG C;  1RRB A;  4NJ6 A;  4PS8 A;  2KJR A;  4DHZ B;  3A9K A;  1CMX B;  4XZ4 A;  3OAW A;  4FUL A;  3A33 B;  4M0W B;  1OTR B;  5D94 A;  3VUX A;  2ASQ A;  1Z2M A;  1WGH A;  3PS6 A;  2JZZ A;  2DEN B;  2K39 A;  1E7U A;  3RUI B;  4I6N B;  3QAR A;  2W9N A;  2LXC A;  2KK8 A;  2KFK A;  4GB9 A;  4KDL B;  3PHW B;  3ZNI D;  4IWP A;  2DYO A;  4ZYN A;  2R2O A;  3EC8 A;  2Z0D B;  5AEK B;  4W9D A;  1RFA A;  1WR1 A;  3ECI A;  3QAQ A;  4W9E A;  1IP9 A;  3ZO5 B;  4TKN A;  1WJU A;  4CO7 A;  2HD5 B;  3DQV A;  4MEL A;  3ZNZ B;  3ZRF A;  4KV2 A;  4LJO B;  2BGF A;  2PPH A;  4CHK A;  2MRP A;  2LGD A;  2KFK B;  4AUQ C;  2NS5 A;  3JYU A;  2EMS A;  2EKE C;  3A9J B;  3KW5 B;  2WDT B;  3JVZ X;  5TR5 A;  4K7W A;  4EZK A;  4KVG B;  4KZ0 A;  3MJW A;  1RAX A;  2KLG A;  2OJR A;  5D2M B;  4MGK E;  5LLI A;  1Q0W B;  2OOB B;  3V61 A;  4ZRI A;  4BFR A;  2WYQ A;  4DWF A;  1V9J A;  3W1S A;  3VDZ A;  4DHJ D;  2FNJ B;  2ZPN A;  3L08 A;  3H7P A;  2BKR B;  3VVW B;  3DBL I;  2HE7 A;  4HLE A;  1EUV B;  4EEW A;  1WGG A;  2N1V A;  1WZ3 A;  4HWI B;  4JLC A;  3VH3 B;  3QIJ A;  3OJ3 A;  2EMT A;  3VUY A;  3IHP C;  2BWE S;  5CHW A;  2NBW B;  4IM3 A;  1EF1 A;  3ZTD A;  3H6N A;  2JRH A;  3DPD A;  3PGE A;  3SDL C;  2JY6 A;  2MW5 A;  3DOW A;  2KTF A;  4JQW C;  3Q3F A;  2KX0 A;  3OLM D;  1L2N A;  1SIF A;  3K9O B;  1V80 A;  2ZCB A;  1MG8 A;  2I1K A;  4GSW A;  3TBL D;  3ZDT A;  2IBI B;  1E5W A;  4ICV A;  3RT3 B;  1ZGU B;  1WRD B;  1QZE A;  2N1W A;  3P2B A;  2LI5 A;  2KQ7 A;  4PYZ A; 
#chains in the Genus database with same CATH topology
 4WQM A;  2PJH A;  4MT5 A;  2KJH B;  3DBL B;  1J8C A;  5HHD G;  2BKF A;  4LNI A;  1SF0 A;  4L1B A;  4YSX B;  4KGR A;  2GBR A;  1UZX B;  1DOI A;  2BTE A;  1J7B A;  4I6L B;  1UGM A;  2V4I B;  3M63 B;  2KMC A;  1C4P A;  5D6J B;  4AJY B;  1WGD A;  5BMH A;  2V0G A;  2KDB A;  1PQS A;  3ONS A;  1ZXI A;  1I35 A;  1IPG A;  2CJO A;  3L10 B;  3Q3J A;  3IT4 B;  2V1Y A;  3C19 A;  1P1A A;  3EEC A;  2CU1 A;  4YSY B;  1GNU A;  4G3X B;  1EWY C;  3VR8 B;  1YJ1 A;  1F1H A;  4BBN C;  2M8S A;  3B2G A;  4GN1 A;  3X23 A;  2MBQ A;  1L6U A;  2FCQ A;  4WWP A;  2DHZ A;  2B3A A;  3UQA A;  2MA9 B;  3Q8A A;  2KC1 A;  3A4S C;  3VRA B;  3RI7 C;  1LXD A;  1D6E C;  3K9P B;  3AM9 A;  4GU2 A;  4A6Q A;  4KSL C;  4S0R A;  4OHJ A;  3AEC B;  4IM0 A;  2LHE A;  3ZGZ A;  1C4C A;  1C3T A;  4XX5 A;  1F2R I;  4ANV A;  5IN7 A;  4TUU A;  3BVM A;  1YOV B;  5H8Y E;  1NEN B;  5LNK 1;  2W82 A;  1Q10 A;  3TJP A;  1FXA A;  4FLH A;  5IAA C;  1P7E A;  3MHZ A;  1WX7 A;  2DYM A;  1WFY A;  5E6J A;  3U7D A;  5IOI A;  2KYW A;  3M62 B;  1UBQ A;  2PVG C;  2QMT A;  4MGI E;  2KLC A;  3VXW A;  2GRI A;  3SEB A;  1GOZ A;  2JSV X;  4S17 A;  2LJ5 A;  1J7C A;  1UH6 A;  2L52 A;  1V81 A;  1E8Y A;  1GB4 A;  1Y8R C;  4KKI A;  3PRP B;  2N9K A;  2PKO A;  1YQ3 B;  2WP9 B;  4GDK B;  2ZJD A;  3R66 C;  1YNT E;  2N7E A;  2ZVN A;  2ZCC A;  4ANU A;  3W5U B;  1HXY D;  3LJ3 A;  1QKZ A;  4KGT A;  3ZIM A;  4RM8 A;  2C60 A;  1AAR A;  2WXR A;  1I4X A;  1TZ1 A;  4HDQ A;  4EKU A;  2N9P C;  2WXK A;  4IDI A;  2K5P A;  4DXF A;  5GMV A;  2L32 A;  4W9F A;  2DZM A;  3W9C B;  3U2S C;  1ESF A;  2I1J A;  1SBB B;  1B9R A;  2Q5W D;  2UWQ A;  3B08 A;  1LQB A;  4K7S A;  4WJP A;  2A4Z A;  1R4N B;  3AE5 B;  3DCG A;  1ZE3 D;  1JWA D;  3HM3 A;  3ZTC A;  2LRW A;  1FNU A;  3ZXV A;  1NI2 A;  4TV3 A;  4P6V F;  2IO0 B;  3QA8 A;  5EDS A;  2YVC A;  4WWM A;  2BT6 A;  2KWC A;  3DBS A;  1NI3 A;  2W3S A;  4EZL A;  2E3T A;  2NTT A;  1XT9 B;  4BVU C;  4HDO A;  2JVC A;  2WLB A;  1PDX A;  4IWQ A;  5IA7 A;  3WA0 A;  3MC8 A;  2JZP A;  1GJZ A;  2MQJ A;  2OJW A;  3ZQ4 A;  3EA6 A;  3AE4 B;  2NTS A;  1SGH A;  3FKY A;  2FUH B;  5HI1 A;  2MBB B;  4TMA B;  1QIL A;  2J0M A;  4W9J A;  4BKS D;  2IO3 B;  4ANX A;  3BY4 B;  3PLU A;  4YWG G;  3DVG Y;  1WXV A;  4BBN F;  1JAL A;  1FRR A;  1T0R C;  2AYO B;  2LFI A;  4DHZ E;  3SU8 X;  4BOS C;  3N1Z C;  3C0R B;  5DCN A;  1IGD A;  3PHX B;  1E8X A;  3I57 A;  3T3O A;  1JML A;  1K8R B;  4NAW A;  2JXX A;  3APD A;  3ML9 A;  2WXM A;  2BS3 B;  2BBC A;  3AED B;  2IZV B;  4NAW B;  1VJK A;  2NBV B;  2WXN A;  1FCC C;  2JRI B;  2M0X A;  2FCS A;  4PS7 A;  3N1X C;  2EEL A;  4E3C A;  3CST A;  2PMV A;  2Y3A A;  2JX5 A;  2WXO A;  3TSS A;  1P98 A;  2RPQ A;  1RFK A;  2Y5B B;  3Q3M C;  1OEY J;  4MGZ E;  3CIR B;  4PT5 A;  1OQY A;  1SE2 A;  1T3Q A;  3OG5 A;  1DOY A;  3L4P A;  4TQ0 A;  4PK1 A;  2KAC A;  2BYF A;  4XDC A;  3LDZ E;  2SAK A;  4YT0 B;  4LJP B;  1IGC A;  3MC0 B;  2D3B A;  4F7Z A;  3VQI A;  3IFW B;  5GXG B;  1NBF C;  1ZXH A;  1S1Q B;  2FCM A;  1WXA A;  2AL3 A;  5HG2 A;  2FID A;  2V3N A;  4M0W A;  2PEA A;  2RDH A;  1WGY A;  1WM2 A;  4KZC A;  5DPT A;  4DHZ B;  1CMX B;  3GE8 C;  1CZP A;  4M0W B;  4EE2 A;  2JZZ A;  1ZPS A;  4I6N B;  2MHJ A;  2N0S B;  5AUI A;  4YTN B;  3AEE B;  1K52 A;  4ZYN A;  3EC8 A;  2Z0D B;  3ECI A;  3SFD B;  4W9E A;  3ZO5 B;  4CO7 A;  2HD5 B;  3DQV A;  4LJO B;  2BS4 B;  2PPH A;  4J3O D;  3TUO A;  1YJJ A;  2WHI A;  3JVZ X;  5TR5 A;  3KQ4 A;  2OJR A;  1JWU D;  2ONQ A;  2J52 A;  2OOB B;  1PGA A;  4MGK E;  5D2M B;  3V61 A;  1V9J A;  2KN4 A;  3AEF B;  3W1S A;  4A90 A;  3L08 A;  1QOF A;  2BKR B;  3AEG B;  1EUV B;  1IUE A;  1WGG A;  1WZ3 A;  2AQ2 B;  3OJ3 A;  3QIJ A;  3N9Y C;  4HEA 1;  3DPD A;  2WDQ B;  1PUT A;  2PVO D;  2KX0 A;  1SIF A;  3K9O B;  1QF6 A;  4RGN A;  2JYT A;  2E6X A;  4ICV A;  3RT3 B;  1ZGU B;  1AW7 A;  2LI5 A;  4P1C C;  3MTN B;  5DPW A;  2LD9 A;  3L17 A;  2NPT A;  2J4X A;  1J0G A;  2IY1 B;  3PRZ A;  3EHV A;  4JWS C;  1I42 A;  4MGY E;  1IBX A;  3AN1 A;  1GC7 A;  4LNN A;  4IKG A;  5CHF A;  2QDF A;  2JU6 X;  4MM3 B;  4NNJ B;  2WU2 B;  2MBE A;  4RCO A;  4OVZ A;  2N9E B;  2CU3 A;  3PVL A;  3GS2 A;  1GG3 A;  4XWT A;  3I3T B;  3KH0 A;  3PZD A;  1A70 A;  3I9V 1;  4GDL B;  3DBR I;  4EOY A;  2Z8L A;  3SR6 A;  4MSM B;  2L00 B;  5FR6 A;  2LVQ A;  4C4V B;  4URK A;  3ZKJ C;  1YX6 B;  2LRU A;  4HKZ E;  4ACF A;  1KF6 B;  2OED A;  3R7Q A;  1HEZ E;  3VH4 B;  1CQV A;  1UWM A;  3WAP A;  1SJE D;  3KLS X;  2ICI A;  3NY5 A;  3ZDM C;  2WWZ A;  1QOG A;  4AJW A;  4F1S A;  4C80 A;  4HJK A;  4RF1 A;  2KTR B;  1G6J A;  2AQ3 B;  2KMM A;  1I4Q A;  5CHV C;  1TTN A;  1V2Y A;  1WXS A;  1FRD A;  4IOI E;  2CHX A;  2FBW B;  4ICU A;  4RM9 A;  2I2Y A;  1I4R A;  4M8N A;  3GOE A;  2O6V B;  4KKJ A;  3R2T A;  4LCD E;  4ANW A;  4D2K A;  1GUA B;  3HVZ A;  4GXB A;  4FAD A;  1C78 A;  4IW0 A;  1N63 A;  1YN5 A;  2UU7 A;  4WJO A;  1K50 A;  2R2Q A;  3HIZ A;  4G11 A;  2W54 A;  5D7G A;  2LGX A;  5IP4 D;  1TBE A;  2LJI A;  1MG4 A;  2WDR B;  2MX2 A;  1C76 A;  1TS2 A;  2BF8 B;  2KHW B;  2G45 B;  4FJY A;  3RD2 A;  4MH0 E;  1SB3 C;  2GBK A;  1F77 A;  2MWS B;  1ZOY B;  1V1P A;  3VTU A;  1I4P A;  2WS3 B;  4C00 A;  4HXD A;  3N20 C;  1M94 A;  3PZ7 A;  4ZDV A;  1PGX A;  4LNO A;  2BB6 A;  1TKG A;  2N7D A;  5C2T B;  1V1P B;  2N9L A;  4FJZ A;  1SE9 A;  1WMH A;  2YEP B;  1BT0 A;  3J9C A;  1KJT A;  3V6E B;  4JGH B;  1P3Q U;  3OJ4 B;  4BKS A;  2CR5 A;  2ON8 A;  1MHH E;  1NVI D;  2KX3 A;  1WMH B;  1Q5W B;  3NJT A;  4XC2 A;  2FAZ A;  1UWX A;  2BYE A;  3T8M A;  2WDV B;  1YX5 B;  2KWU B;  5JXV A;  5AUK A;  1FCL A;  3QX1 A;  4RGM A;  4KX6 B;  4YTM B;  4Q2J A;  1MI0 A;  2ZZP B;  2RSU A;  3RFZ B;  1HA5 A;  4M02 A;  2J7Q B;  1UGJ A;  2HJ8 A;  2VZK D;  1TS4 A;  1ZDV A;  1OEY A;  2KDM A;  1HTO A;  3NS1 A;  4N9F 4;  2QIE B;  1FEH A;  1UUP A;  1P9D U;  1UEL A;  2MBO A;  1C1Y B;  3KUC B;  1H4R A;  1MHX A;  4OVU A;  2K0P A;  2XBB C;  3RZW C;  3O65 B;  3VHT C;  3R7R A;  2M19 A;  2HJ1 A;  2L3Z A;  4ZRP A;  2YLM A;  2CS4 A;  2LAS A;  3KVF B;  3V60 A;  5DPR A;  5KHQ A;  1FD6 A;  2D2Q A;  2G4D B;  2V3S A;  1FIQ A;  2KT7 A;  2DAJ A;  3A9K B;  1EWC A;  3UIP B;  1XLO A;  4ZHO A;  1N5X A;  2JYE A;  4DK5 A;  3APC A;  3WAN A;  4B0M A;  4JPS A;  2RGF A;  1OFF A;  1K53 A;  3R8B A;  4WWO A;  3HK0 A;  4KIK A;  3DVN V;  1PYW D;  3U8Z A;  1V5T A;  4LK0 M;  1D5X C;  3ZJT A;  2LUM A;  1T6B X;  2LWP A;  1JRU A;  1SXT A;  3NHE B;  2KDE B;  4MSQ B;  1T0Q C;  4KIK B;  2L83 A;  2AL6 A;  2L1A A;  4GDK A;  1WZ0 A;  4R3D A;  2QHO A;  2NCN A;  3NZS A;  3H7P B;  4RH6 A;  2IGD A;  1HZ6 A;  1FFV A;  1GC6 A;  2QIL A;  1KFY B;  1N5W A;  4RNA A;  2K6Q A;  4IG7 B;  1E9M A;  4WJQ A;  1R4N I;  4BKT A;  1MVK A;  3L16 A;  2MLB A;  3DDC B;  2BWF A;  3CSF A;  4B6W A;  3PO0 A;  3Q8F A;  2X8X X;  2A5U A;  3CWI A;  3QJZ A;  2VH1 A;  2LXA A;  2O6V D;  2WXI A;  3UIN B;  3CMM B;  1TS3 A;  2B76 B;  3W1Y A;  3T9L A;  4OZC A;  3H7S A;  2D10 A;  3PPA A;  4NJ7 A;  4L23 A;  3TMP B;  4GMV A;  4K3B A;  3U4E G;  1FNW A;  1ZKH A;  1FPY A;  3QHT A;  4A9A A;  3DWM A;  4XYC A;  4US9 A;  2Z0E B;  1TIF A;  1ISN A;  4ZHP A;  2HDE A;  3X0W A;  1FNV A;  4JIO U;  2V9H A;  4OW0 A;  3ZNG C;  4PS8 A;  3C8Y A;  2H88 B;  2DLB A;  5D94 A;  1Z2M A;  3T3N A;  1SE3 A;  2K39 A;  1E7U A;  3RUI B;  2KK8 A;  2KFK A;  4GB9 A;  2XNA C;  4DXG A;  4W9D A;  1RFA A;  1WR1 A;  3QAQ A;  4TKN A;  2FUG 1;  3ZRF A;  1YMH E;  2BGF A;  4OZB A;  4HRO A;  2LGD A;  2KFK B;  2FE8 A;  3MJ5 A;  1ACC A;  2NS5 A;  2LEK A;  3KW5 B;  2YEP F;  3A9J B;  2N7J A;  2MH7 A;  3IXS A;  1TYG B;  5LLI A;  1Q0W B;  4ZRI A;  4DWF A;  2W3R A;  3IT6 B;  1GPX A;  2FNJ B;  2ZPN A;  4TSS A;  2HE7 A;  1VLB A;  4HLE A;  3RNA C;  2N1V A;  4HJG E;  1FO4 A;  1HZ5 A;  4HWI B;  4JLC A;  5EE0 A;  3VUY A;  3P1M A;  1XLN A;  2NBW B;  1VR9 A;  1EF1 A;  3P63 A;  1MFW A;  3PGE A;  2JY6 A;  3FIL A;  2MW5 A;  3P4S B;  5C3J B;  2ZCB A;  2WQY B;  4GSW A;  3TBL D;  3ZDT A;  3O13 A;  2AQ1 B;  2SEB D;  4C56 C;  3P2B A;  2C7M B;  3FIL B;  1VZ6 A;  2DX5 B;  3P4P B;  1XXG A;  1E0Z A;  2LZ6 A;  2PE9 A;  2G3Q B;  3GB1 A;  5AZF A;  4HCP B;  4UDU C;  4E71 A;  1J19 A;  3TEY A;  4CYE A;  2M0A A;  1KM7 A;  5J18 A;  1LFD A;  1RM6 C;  2KC2 A;  4JWU C;  2JZ3 B;  3Q2A C;  4FHK A;  2WXG A;  5JZE B;  5MPO A;  4HPL B;  1UNS A;  2UYZ B;  3KWL A;  2MCN B;  3APF A;  2WXJ A;  3VFK A;  5KHO A;  2KMA A;  2INN E;  4EZJ A;  2DYB A;  4XGA B;  3WAO A;  2QJL A;  2PW9 A;  2AX5 A;  4J6I A;  2L76 A;  1RLF A;  2M17 A;  1EF5 A;  4AP4 C;  2EKI A;  2KJ6 A;  3FC4 A;  4REZ A;  1E8W A;  2MSE D;  4XWW A;  3AMZ A;  4ITK A;  4I6P A;  1OQQ A;  5D3D A;  3VRB B;  4RF0 A;  2LUE A;  1XCT L;  5BYQ A;  1ZUD 2;  2WGS A;  4LNF A;  3PRE A;  1E8Z A;  3DBH B;  2C7H A;  1TKE A;  4ARI A;  2JT4 B;  1N62 A;  3ML8 A;  3UIO B;  4ZRK A;  3M95 A;  1QLB B;  5IKC M;  3RCZ A;  4WJN A;  4W9G A;  3H1U A;  3I63 C;  1ZDX A;  2IDY A;  2VRR B;  1TGZ B;  3U30 A;  3VTW A;  3V6C B;  2KO3 A;  2DZJ A;  3URY A;  1YIW A;  2N4F A;  4RFB A;  2KAJ A;  2L0F A;  1HE8 A;  4HKQ A;  1GAQ B;  4FJV B;  3TEZ A;  1SEB D;  3QK0 A;  3HHM A;  1LO5 D;  3TIX A;  4YTP B;  3PTF C;  2VZK B;  2MJD A;  4A3P A;  2J0K A;  3BVZ A;  4HVB A;  3GZN B;  2KKC A;  2M4N A;  1ZW7 A;  3AI5 A;  3EFU A;  1JWM D;  3U7Z A;  2BB5 A;  2N9X A;  2L0T A;  3R2I A;  1DYQ A;  2LVP A;  4DQO C;  1TKY A;  1JW9 D;  2PE6 B;  4JX1 C;  1WWT A;  4EFO A;  1NYQ A;  3QC8 B;  4HPM B;  2C5L C;  5AZH A;  4W9I A;  3AEA B;  2G4S A;  3LXF A;  4MM3 A;  3GP7 A;  1RYJ A;  1L0Y B;  2V3P A;  1B1Z A;  3V62 A;  1T0Y A;  3H9D A;  2XK5 B;  3N3K B;  2IPK D;  2IND C;  4BAX A;  3SHQ A;  4GDL A;  1XLQ A;  3NG0 A;  4IM2 A;  1T0S C;  3JSV A;  4B9K A;  4F8C B;  3RNE C;  4C4V A;  5TSS A;  3WIM A;  3AE8 B;  1K51 A;  1YQB A;  3JSV B;  2LVO A;  2K25 A;  1JWB D;  3AH7 A;  2X38 A;  3Q69 A;  2M1M A;  3RNC C;  2XEW A;  2KAN A;  2KNB A;  1SE4 A;  1FXT B;  2MBH A;  5CTR C;  2KTR A;  3AE6 B;  4W9L A;  4DDG D;  5J2R A;  1EU3 A;  1L7Y A;  4YL8 A;  2TSS A;  2LGI A;  1JCK B;  3VTV A;  2BPS A;  2JXT A;  3ZVV A;  4KDI C;  3NZ3 A;  3PRM B;  2L8J A;  3S2A A;  3UQB A;  1ET6 A;  1I4H A;  3ZLZ A;  2O6V A;  3AE9 B;  5JHB A;  1WGK A;  1L6V A;  1C77 A;  1WRI A;  4NAM A;  4DDI D;  2JF5 A;  4L2Y A;  3B9J A;  4GOC A;  3NS8 A;  2FIF A;  2JWZ A;  4XE0 A;  2NVU I;  2ZEQ A;  2ZNV B;  2PLP A;  3NOB A;  2REX A;  1V5O A;  4PYU A;  3SFE B;  4BOZ B;  4IUM B;  5BMI A;  3RN9 C;  2BS2 B;  1WE6 A;  5FKA C;  2L05 A;  1XQQ A;  4HCN B;  2FCN A;  1OGW A;  2WU5 B;  3P42 A;  3Q3N C;  4OZA A;  2GI9 A;  2WXH A;  3AV8 A;  3EGR A;  1WF9 A;  2QCZ A;  3N1Y C;  2G9H D;  2MJ3 A;  3QCA A;  2RD0 A;  2IO2 B;  4P7I A;  3V05 A;  1KLG D;  4G50 A;  2DBY A;  2WX1 A;  4K1R B;  2ZNV C;  3BK1 A;  3VAW A;  1OQR A;  2G1E A;  2Z59 B;  2BQQ A;  4P16 A;  2OHF A;  2MJE A;  3MFG A;  2KDI A;  5L95 C;  1LGR A;  5HFY A;  2W55 A;  2KQ4 X;  4KSK C;  2KDF B;  3BZD B;  3RNB C;  4C7Z A;  1I4G A;  1NEK B;  1UBI A;  4WQO B;  4CQN A;  3HUI A;  2ZPY A;  5JHA A;  2K1F A;  5EE1 A;  5EE3 A;  3RUL A;  2AEH A;  2DNF A;  3AXC A;  3N30 A;  1R4M I;  2O2V A;  4LDT B;  1D3Z A;  4RMA A;  2ZW1 A;  2NBU A;  1RWS A;  1TJE A;  1WYW B;  2JPH A;  2O2V B;  4B0E A;  3A1Q A;  2GMI C;  3M3J A;  2DZI A;  3DHG C;  3OWE B;  3IVF A;  1HQR D;  2IGH A;  1E7P B;  3AE7 B;  1R7S A;  5E6O A;  3A1Q B;  2LGS A;  2LGY A;  2JUO A;  1WXQ A;  1N60 A;  1R4M B;  1TZO A;  4M00 A;  4N58 A;  1NYR A;  2KVR A;  1L0X B;  3WAM A;  1D4B A;  2AWT A;  4W9C A;  1CK1 A;  1XF5 L;  4W9K A;  2ZVO A;  1WR6 E;  2J42 A;  1E7V A;  1TY2 A;  2QC8 A;  4ASW C;  5G5G A;  4G0N B;  1RRB A;  4NJ6 A;  2KJR A;  4FXC A;  3A9K A;  4JE3 B;  4XZ4 A;  3OAW A;  4FUL A;  2ZW0 A;  2I38 A;  1JRP A;  3PS6 A;  1WGH A;  3VR9 B;  1VRA B;  2Y5P A;  2H89 B;  1VZ7 A;  3PHW B;  3ZNI D;  4IWP A;  2DYO A;  4A55 A;  1IP9 A;  1WJU A;  3ZNZ B;  4KV2 A;  4CHK A;  2MRP A;  3ZJU A;  3JYU A;  2EMS A;  3EUB 2;  3MC9 A;  1C79 A;  4K7W A;  4KVG B;  4KZ0 A;  2GLS A;  1FFU A;  2JQR B;  2XN9 C;  2RDB C;  2WYQ A;  2QSD A;  4DHJ D;  3H7P A;  3VVW B;  3NVZ A;  1SIJ A;  4WUR A;  2EMT A;  5CHW A;  2BWE S;  4IM3 A;  1BML C;  1HTQ A;  2GB1 A;  3H6N A;  3HVD A;  2JRH A;  1FM0 D;  1VZ8 A;  2INC C;  2KTF A;  3AE2 B;  1DOX A;  3NVY A;  1MG8 A;  1XO3 A;  1QZE A;  2N1W A;  5AZG A;  3LYY A;  3TEX A;  1V49 A;  4ZYS A;  4M01 A;  1KOT A;  5EE9 A;  1YJI A;  1YD8 U;  1STE A;  3KWV A;  2CJN A;  2CKH B;  2L7R A;  5G55 A;  1U4A A;  3MP9 A;  4X57 B;  3WAL A;  3RPF C;  1JQ4 A;  3BII D;  3KYC D;  4FBJ B;  1JWS D;  1E6E B;  3P4Q B;  1P7F A;  3DWG C;  5J17 A;  2GBJ A;  3SD5 A;  4HPP A;  2HTH A;  3QQ8 B;  4RGO S;  4ZRJ A;  2IO1 B;  3AEB B;  1F2R C;  3PT2 B;  5IO9 A;  4AOF A;  3ENE A;  1KH0 A;  4K81 A;  3ETR A;  2K8H A;  3I5J C;  2INP E;  3Q8C A;  2M56 B;  4PS3 A;  4GGQ A;  2KWV B;  5BMG A;  3ZXR A;  3KUZ A;  2MEK A;  4IC7 B;  4B95 A;  1F9J A;  1WM3 A;  4MJS A;  2D11 A;  3ZYY X;  3L13 A;  4M8M A;  2J0J A;  1CJE A;  2KD0 A;  1QQR A;  4MJS B;  3TL5 A;  1L5P A;  3BVG A;  4FN2 A;  2WNM A;  3AUL A;  5D3I B;  2QEJ C;  1AYF A;  1V86 A;  1WJ6 A;  3PLV A;  4II2 B;  3A9J A;  2RR9 A;  3HM6 X;  3L0W B;  4NQK E;  4ZRQ A;  2KZR A;  1WI0 A;  2D3G A;  3B0A A;  1V6E A;  4LDT D;  1QT9 A;  3GE3 C;  3Q8E A;  4II3 B;  1V8C A;  2NR2 A;  1C9F A;  5G5H A;  1MJD A;  1Z5S B;  2RPV A;  3NVV A;  2DZK A;  1WH3 A;  3DHH C;  3PV1 A;  4HRS A;  1DGJ A;  4YSZ B;  3B2F A;  3PZ8 A;  1L4D B;  4WAA A;  3AE3 B;  3RMK C;  1VD2 A;  5E6P A;  1X1M A;  3P4R B;  3KUD B;  3KYD D;  3DHI C;  4WAF A;  3L54 A;  2D3A A;  2GOW A;  4YXD B;  1F52 A;  4MH8 A;  4AS1 A;  4AWJ A;  4A20 A;  1T5X D;  4O1N A;  3FAH A;  4ARC A;  1WX8 A;  1EU4 A;  4A8X C;  1H8C A;  2RDG A;  1JRO A;  3ZW3 A;  5LXI B;  1N61 A;  4EUT A;  1FXI A;  4FA6 A;  2NMQ A;  1AWD A;  1XEE A;  1P0R A;  2WXQ A;  4WH4 A;  4AQ7 A;  1SSN A;  1TY0 A;  3B1L X;  1YN4 A;  2J53 A;  2K3U A;  1KRH A;  3UF8 A;  3DBH I;  1UD7 A;  3U52 E;  3MHS D;  1WGR A;  2DAF A;  3R3M A;  1WX9 A;  3EFC A;  3HRD D;  4WIP A;  1WIA A;  3DVG X;  2C7N B;  3RYT A;  4MEM A;  2VH2 A;  4TQ1 A;  2K22 A;  2IGG A;  3NRZ A;  3ALB A;  2Y5C A;  2ACZ B;  3NZU A;  2KXJ A;  1BXT A;  3W5V B;  2IYD B;  2KWD A;  2PTL A;  3BK2 A;  2GBN A;  5C23 A;  2LHD A;  4RGT A;  1XCQ L;  2WXF A;  2BYT A;  3GZN I;  4DXA B;  3ZRC A;  1IYF A;  1YN3 A;  3TEW A;  1WJ4 A;  3CF6 E;  4DBG A;  2IJ0 A;  1WY8 A;  4K7U A;  1L4Z B;  3ZJV A;  5DPS A;  3ZUN A;  3N32 A;  4MDK E;  1WE7 A;  2KFJ A;  1BUI C;  4NQL B;  1F0Z A;  2KN5 A;  3ZNH B;  5BO4 B;  1ENF A;  1I7H A;  5T8I A;  1LM8 B;  3V3X A;  1TS5 A;  1XLP A;  2K8B A;  1Y56 A;  1C4A A;  5CX3 A;  3BYT B;  4LNK A;  5FR3 A;  2K8C A;  2KQS A;  1PGB A;  2D3C A;  4E74 A;  2RMM A;  1WXM A;  3Q8B A;  2BYV E;  3PSE B;  3VUW A;  4A3O A;  2K9X A;  3IG3 A;  4C7Y A;  1YQ4 B;  3BWU D;  5HKH A;  2KVZ A;  1M4V A;  4USA A;  2HTM E;  4ZOH C;  2V4L A;  5G2N A;  3A4R A;  3RZF A;  1WSP A;  2XK5 A;  3IAM 1;  5L83 A;  3JW0 X;  1E90 A;  3H8H A;  3LB8 C;  2IY0 B;  3IBE A;  1S3S G;  2GBM A;  4MAC A;  2BVC A;  4QAY A;  4W9H A;  1Q1O A;  1AN8 A;  1KLV A;  3BIN A;  1VCB A;  5H92 C;  4NZL B;  5BYS A;  4N6E B;  1NDD A;  2JWU A;  1ROE A;  2PIA A;  2MP2 A;  5FK9 C;  5LXH A;  1TT5 B;  1WJN A;  1V1O A;  4NY0 A;  2WX0 A;  3W1S C;  1QOB A;  2NPT B;  2KOX A;  1A5R A;  4OVV A;  5JH5 C;  3AU4 A;  3TCA A;  4DHJ B;  3AU5 A;  4N59 A;  2MP2 B;  4WWN A;  1IBX B;  3UGB B;  1EO6 A;  5E6N A;  3WCQ A;  1KTK A;  3AB5 A;  3QWZ B;  2K6D B;  2CHZ A;  4HK2 A;  3E56 A;  1XD3 B;  2C9W B;  5I4D A;  4K3C A;  1L0V B;  5C1Z A;  4IWO A;  4NJC A;  4BKG A;  1GB1 A;  1UF0 A;  2D07 B;  4JL9 A;  3UI3 A;  2LMC A;  4NPN A;  4GLS C;  3AE1 B;  3DVN U;  3D32 A;  4US8 A;  2CHW A;  3Q6B A;  4FHJ A;  3Q14 C;  1ZP0 B;  3E9S A;  4BZA A;  1D5Z C;  3NUH B;  3RNG C;  1PFD A;  3RNF C;  3A33 B;  2DWQ A;  1OTR B;  3VUX A;  2ASQ A;  2DEN B;  3DBR B;  3QAR A;  2D5G A;  2W9N A;  2LXC A;  2WXL A;  4KDL B;  1QOA A;  2R2O A;  2R61 A;  5AEK B;  4KGS A;  2BW2 A;  4MEL A;  4AUQ C;  1KLU D;  1J7A A;  4LTU A;  2EKE C;  2WDT B;  3ABV B;  4EZK A;  3MJW A;  1E10 A;  1RAX A;  2KLG A;  4BFR A;  5BYR A;  3Q3O C;  3VDZ A;  1D5M C;  2WXP A;  3DBL I;  4EEW A;  1WYG A;  3BYY B;  1FMA D;  1SJH D;  4LLG M;  3VH3 B;  3IHP C;  3NVW A;  3ZTD A;  4XDD A;  1VDV A;  1N6Z A;  1ET9 A;  4P1B C;  4H2A A;  3SDL C;  3DOW A;  4JQW C;  1EM7 A;  3IAS 1;  3Q3F A;  1MPE A;  3OLM D;  1L2N A;  1V97 A;  1V80 A;  2I1K A;  2IBI B;  1E5W A;  3W2D A;  1WRD B;  4GIV A;  2KQ7 A;  4PYZ A; 
#chains in the Genus database with same CATH homology
 5AZG A;  3MTN B;  2DX5 B;  1V49 A;  2PJH A;  1KOT A;  2LZ6 A;  2PE9 A;  2G3Q B;  2KJH B;  1YD8 U;  5DPW A;  5AZF A;  2LD9 A;  3L17 A;  2NPT A;  2CKH B;  2L7R A;  4HCP B;  5G55 A;  4E71 A;  1J0G A;  2IY1 B;  1U4A A;  3PRZ A;  1J8C A;  3EHV A;  1J19 A;  1I42 A;  2BKF A;  4MGY E;  4X57 B;  4CYE A;  3WAL A;  1KM7 A;  2GBR A;  5J18 A;  1GC7 A;  1LFD A;  3KYC D;  1UZX B;  4FBJ B;  5CHF A;  2KC2 A;  4NNJ B;  4I6L B;  2JZ3 B;  1UGM A;  3M63 B;  5J17 A;  2KMC A;  4FHK A;  5D6J B;  2MBE A;  5JZE B;  2GBJ A;  3SD5 A;  4HPL B;  4AJY B;  1WGD A;  2HTH A;  2UYZ B;  3QQ8 B;  2KDB A;  1PQS A;  2N9E B;  4ZRJ A;  2IO1 B;  2MCN B;  3PVL A;  3PT2 B;  3APF A;  3ONS A;  1GG3 A;  3VFK A;  3I3T B;  1I35 A;  5KHO A;  2KMA A;  1IPG A;  4AOF A;  3L10 B;  4EZJ A;  2DYB A;  3KH0 A;  3ENE A;  3PZD A;  3Q3J A;  2V1Y A;  3WAO A;  4GDL B;  4K81 A;  1P1A A;  2K8H A;  3EEC A;  3DBR I;  4J6I A;  2L76 A;  2CU1 A;  4EOY A;  1RLF A;  2M17 A;  4PS3 A;  1EF5 A;  4AP4 C;  4GGQ A;  2KWV B;  4MSM B;  1GNU A;  2L00 B;  4G3X B;  5FR6 A;  2KJ6 A;  3KUZ A;  4IC7 B;  2LVQ A;  1E8W A;  1YJ1 A;  1F9J A;  4B95 A;  4BBN C;  1WM3 A;  4MJS A;  2M8S A;  1YX6 B;  2MSE D;  3ZKJ C;  2D11 A;  2LRU A;  3L13 A;  4I6P A;  4M8M A;  2J0J A;  4GN1 A;  3R7Q A;  3X23 A;  2MBQ A;  3VH4 B;  2FCQ A;  4WWP A;  3WAP A;  2KD0 A;  3NY5 A;  2LUE A;  3ZDM C;  2DHZ A;  2B3A A;  2WWZ A;  4MJS B;  3TL5 A;  3UQA A;  2MA9 B;  4AJW A;  4F1S A;  4HJK A;  1G6J A;  2KTR B;  3PRE A;  1E8Z A;  5CHV C;  1TTN A;  2KC1 A;  2C7H A;  3A4S C;  4FN2 A;  1V2Y A;  1WXS A;  3AUL A;  1LXD A;  2JT4 B;  2CHX A;  3ML8 A;  3UIO B;  4ICU A;  4ZRK A;  1V86 A;  3M95 A;  4RM9 A;  1WJ6 A;  3PLV A;  4II2 B;  3K9P B;  3A9J A;  3RCZ A;  4M8N A;  4WJN A;  4GU2 A;  2RR9 A;  3HM6 X;  3GOE A;  3L0W B;  4KSL C;  4NQK E;  4W9G A;  2KZR A;  1WI0 A;  2D3G A;  3H1U A;  4IM0 A;  2O6V B;  1V6E A;  3B0A A;  4LDT D;  1C3T A;  4XX5 A;  2VRR B;  4II3 B;  1TGZ B;  4LCD E;  3U30 A;  1GUA B;  2KO3 A;  4GXB A;  3V6C B;  3VTW A;  4ANW A;  4FAD A;  2DZJ A;  4ANV A;  2NR2 A;  1YIW A;  2N4F A;  1Z5S B;  4IW0 A;  4TUU A;  2DZK A;  2L0F A;  1WH3 A;  1HE8 A;  4FJV B;  4WJO A;  2R2Q A;  3TJP A;  3QK0 A;  3HIZ A;  3HHM A;  3TIX A;  3PV1 A;  4G11 A;  5D7G A;  4FLH A;  5IAA C;  3PTF C;  2LGX A;  1TBE A;  1WX7 A;  2MX2 A;  4A3P A;  2DYM A;  2J0K A;  1WFY A;  2BF8 B;  2KHW B;  2KKC A;  4WAA A;  4HVB A;  2G45 B;  4FJY A;  2M4N A;  1ZW7 A;  3AI5 A;  3EFU A;  4MH0 E;  1VD2 A;  3RD2 A;  3U7D A;  3M62 B;  2GBK A;  1UBQ A;  5E6P A;  1X1M A;  2MWS B;  3KUD B;  3KYD D;  3VTU A;  4MGI E;  2KLC A;  2L0T A;  2N9X A;  3L54 A;  3VXW A;  2GOW A;  4HXD A;  1M94 A;  2LVP A;  4ZDV A;  2C7M B;  2LJ5 A;  4AWJ A;  4A20 A;  2N7D A;  2PE6 B;  1UH6 A;  1WX8 A;  1V81 A;  1E8Y A;  4EFO A;  1H8C A;  3QC8 B;  4FJZ A;  4HPM B;  2C5L C;  5AZH A;  1SE9 A;  1WMH A;  4W9I A;  1BT0 A;  1Y8R C;  2G4S A;  4MM3 A;  3PRP B;  1KJT A;  3V6E B;  4JGH B;  1P3Q U;  3OJ4 B;  3ZW3 A;  4BKS A;  2CR5 A;  4GDK B;  2ZJD A;  5LXI B;  3R66 C;  2N7E A;  2ZVN A;  4EUT A;  2ZCC A;  4ANU A;  4FA6 A;  3V62 A;  1T0Y A;  2KX3 A;  1WMH B;  3LJ3 A;  3H9D A;  2XK5 B;  1P0R A;  1Q5W B;  3N3K B;  4XC2 A;  2FAZ A;  3ZIM A;  3SHQ A;  4GDL A;  2BYE A;  4RM8 A;  2C60 A;  4IM2 A;  3B1L X;  3T8M A;  3JSV A;  4B9K A;  1AAR A;  1YX5 B;  3UF8 A;  2KWU B;  1TZ1 A;  4F8C B;  3DBH I;  4HDQ A;  1UD7 A;  4EKU A;  2N9P C;  3MHS D;  1WGR A;  2DAF A;  3WIM A;  3R3M A;  3QX1 A;  1YQB A;  5GMV A;  1WX9 A;  2LVO A;  3JSV B;  2K25 A;  4W9F A;  2DZM A;  2M1M A;  2I1J A;  2UWQ A;  1WIA A;  3DVG X;  2ZZP B;  3B08 A;  2RSU A;  1LQB A;  2C7N B;  2XEW A;  4K7S A;  2KAN A;  3RYT A;  4MEM A;  2KNB A;  2J7Q B;  2HJ8 A;  4WJP A;  1FXT B;  2A4Z A;  2MBH A;  2KTR A;  3DCG A;  4TQ1 A;  4W9L A;  5CTR C;  4DDG D;  5J2R A;  1L7Y A;  4YL8 A;  3ALB A;  1OEY A;  3HM3 A;  3ZTC A;  3NZU A;  2KXJ A;  2LRW A;  4N9F 4;  3VTV A;  2IYD B;  1NI2 A;  4TV3 A;  2IO0 B;  3QA8 A;  5EDS A;  2BPS A;  3ZVV A;  2YVC A;  1P9D U;  1UEL A;  2MBO A;  4KDI C;  2KWC A;  1C1Y B;  3KUC B;  3PRM B;  1H4R A;  2L8J A;  3DBS A;  2GBN A;  3S2A A;  3UQB A;  5C23 A;  4OVU A;  2XBB C;  4EZL A;  3RZW C;  3O65 B;  3ZLZ A;  3VHT C;  2O6V A;  5JHB A;  1XT9 B;  3R7R A;  4URK A;  3GZN I;  4DXA B;  3ZRC A;  4BVU C;  1IYF A;  4HDO A;  2L3Z A;  2YLM A;  4DDI D;  2JF5 A;  1WJ4 A;  2JVC A;  4IWQ A;  2CS4 A;  3CF6 E;  5IA7 A;  4DBG A;  4GOC A;  3NS8 A;  3WA0 A;  2FIF A;  2JWZ A;  1WY8 A;  2LAS A;  2NVU I;  4K7U A;  3KVF B;  5DPS A;  3V60 A;  2ZEQ A;  2ZNV B;  1GJZ A;  3ZUN A;  3N32 A;  5DPR A;  5KHQ A;  2D2Q A;  3NOB A;  2REX A;  4MDK E;  1WE7 A;  1V5O A;  2G4D B;  2KFJ A;  2V3S A;  2MQJ A;  4NQL B;  4PYU A;  4BOZ B;  2KN5 A;  4IUM B;  5BO4 B;  3ZNH B;  1SGH A;  2FUH B;  1WE6 A;  1LM8 B;  2DAJ A;  3A9K B;  2L05 A;  1XQQ A;  2MBB B;  3UIP B;  4HCN B;  2FCN A;  2J0M A;  1OGW A;  4W9J A;  4DK5 A;  3APC A;  3WAN A;  4BKS D;  2K8B A;  2IO3 B;  2RGF A;  4ANX A;  1WF9 A;  5CX3 A;  3QCA A;  2RD0 A;  3BY4 B;  3PLU A;  4WWO A;  2IO2 B;  4P7I A;  2K8C A;  2KQS A;  3HK0 A;  4KIK A;  3DVN V;  4E74 A;  4G50 A;  1WXM A;  3U8Z A;  2BYV E;  1V5T A;  2WX1 A;  3DVG Y;  3PSE B;  3VUW A;  4A3O A;  1WXV A;  4BBN F;  4K1R B;  2ZNV C;  2LWP A;  3IG3 A;  1JRU A;  3VAW A;  2Z59 B;  3NHE B;  2KDE B;  2AYO B;  4MSQ B;  4DHZ E;  4KIK B;  3SU8 X;  2KDI A;  4BOS C;  5HKH A;  2AL6 A;  4GDK A;  3C0R B;  1WZ0 A;  5DCN A;  5L95 C;  3PHX B;  1E8X A;  2V4L A;  3A4R A;  5G2N A;  3RZF A;  2QHO A;  1K8R B;  4NAW A;  2XK5 A;  5L83 A;  4KSK C;  2JXX A;  2NCN A;  3APD A;  1E90 A;  3H7P B;  2KDF B;  3JW0 X;  3ML9 A;  3NZS A;  2IY0 B;  3IBE A;  1S3S G;  1GC6 A;  2GBM A;  2IZV B;  1UBI A;  4WQO B;  2K6Q A;  4IG7 B;  2ZPY A;  4WJQ A;  1R4N I;  4NAW B;  3L16 A;  4BKT A;  5JHA A;  2K1F A;  2MLB A;  2NBV B;  4W9H A;  3DDC B;  2BWF A;  1Q1O A;  3RUL A;  2JRI B;  2M0X A;  2AEH A;  3CSF A;  4B6W A;  1KLV A;  3BIN A;  2FCS A;  4PS7 A;  1VCB A;  3AXC A;  3N30 A;  1R4M I;  2O2V A;  2A5U A;  3QJZ A;  4E3C A;  3CST A;  1NDD A;  4LDT B;  1D3Z A;  4RMA A;  2NBU A;  1P98 A;  2LXA A;  2MP2 A;  5LXH A;  1WYW B;  2RPQ A;  2Y5B B;  2O6V D;  1WJN A;  4NY0 A;  3UIN B;  3CMM B;  2JPH A;  2O2V B;  3W1Y A;  3T9L A;  2WX0 A;  3W1S C;  4GIV A;  3A1Q A;  2GMI C;  3M3J A;  2NPT B;  2KOX A;  1OEY J;  3H7S A;  4OVV A;  2DZI A;  2D10 A;  3AU4 A;  4MGZ E;  3TCA A;  4DHJ B;  5JH5 C;  3AU5 A;  3PPA A;  2MP2 B;  1OQY A;  4WWN A;  4NJ7 A;  3IVF A;  3UGB B;  1EO6 A;  3TMP B;  4TQ0 A;  5E6N A;  4GMV A;  5E6O A;  3QWZ B;  2K6D B;  3A1Q B;  2CHZ A;  4HK2 A;  2BYF A;  2LGY A;  1XD3 B;  1ZKH A;  2C9W B;  2JUO A;  3LDZ E;  4LJP B;  3QHT A;  4F7Z A;  3VQI A;  3IFW B;  2Z0E B;  1NBF C;  5C1Z A;  2KVR A;  1S1Q B;  2FCM A;  3WAM A;  1WXA A;  1ISN A;  2AL3 A;  4IWO A;  2AWT A;  4BKG A;  1A5R A;  4JL9 A;  2D07 B;  2FID A;  4W9C A;  4NPN A;  4W9K A;  2ZVO A;  1WR6 E;  3X0W A;  3DVN U;  3D32 A;  2PEA A;  1E7V A;  1WGY A;  4JIO U;  4ASW C;  1WM2 A;  4KZC A;  2CHW A;  5DPT A;  4FHJ A;  4G0N B;  3ZNG C;  1RRB A;  4NJ6 A;  4PS8 A;  2KJR A;  4DHZ B;  3A9K A;  1CMX B;  4XZ4 A;  3OAW A;  4FUL A;  3A33 B;  4M0W B;  1OTR B;  5D94 A;  3VUX A;  2ASQ A;  1Z2M A;  1WGH A;  3PS6 A;  2JZZ A;  2DEN B;  2K39 A;  1E7U A;  3RUI B;  4I6N B;  3QAR A;  2W9N A;  2LXC A;  2KK8 A;  2KFK A;  4GB9 A;  4KDL B;  3PHW B;  3ZNI D;  4IWP A;  2DYO A;  4ZYN A;  2R2O A;  3EC8 A;  2Z0D B;  5AEK B;  4W9D A;  1RFA A;  1WR1 A;  3ECI A;  3QAQ A;  4W9E A;  1IP9 A;  3ZO5 B;  4TKN A;  1WJU A;  4CO7 A;  2HD5 B;  3DQV A;  4MEL A;  3ZNZ B;  3ZRF A;  4KV2 A;  4LJO B;  2BGF A;  2PPH A;  4CHK A;  2MRP A;  2LGD A;  2KFK B;  4AUQ C;  2NS5 A;  3JYU A;  2EMS A;  2EKE C;  3A9J B;  3KW5 B;  2WDT B;  3JVZ X;  5TR5 A;  4K7W A;  4EZK A;  4KVG B;  4KZ0 A;  3MJW A;  1RAX A;  2KLG A;  2OJR A;  5D2M B;  4MGK E;  5LLI A;  1Q0W B;  2OOB B;  3V61 A;  4ZRI A;  4BFR A;  2WYQ A;  4DWF A;  1V9J A;  3W1S A;  3VDZ A;  4DHJ D;  2FNJ B;  2ZPN A;  3L08 A;  3H7P A;  2BKR B;  3VVW B;  3DBL I;  2HE7 A;  4HLE A;  1EUV B;  4EEW A;  1WGG A;  2N1V A;  1WZ3 A;  4HWI B;  4JLC A;  3VH3 B;  3QIJ A;  3OJ3 A;  2EMT A;  3VUY A;  3IHP C;  2BWE S;  5CHW A;  2NBW B;  4IM3 A;  1EF1 A;  3ZTD A;  3H6N A;  2JRH A;  3DPD A;  3PGE A;  3SDL C;  2JY6 A;  2MW5 A;  3DOW A;  2KTF A;  4JQW C;  3Q3F A;  2KX0 A;  3OLM D;  1L2N A;  1SIF A;  3K9O B;  1V80 A;  2ZCB A;  1MG8 A;  2I1K A;  4GSW A;  3TBL D;  3ZDT A;  2IBI B;  1E5W A;  4ICV A;  3RT3 B;  1ZGU B;  1WRD B;  1QZE A;  2N1W A;  3P2B A;  2LI5 A;  2KQ7 A;  4PYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...