1PGXA

The 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
ELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEMVTEVPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.67-A X-ray structure of the B2 immunoglobulin-binding domain of streptococcal protein G and comparison to the NMR structure of the B1 domain.
pubmed doi rcsb
source organism Streptococcus
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1992-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgxA00
2KWDA 4MACA 1YNTE 2K0PA 5HHDG 2KN4A 2KDMA 2IGDA 1HEZE 1Q10A 4WH4A 1UWXA 2GB1A 1PGAA 1MPEA 2NMQA 2LHDA 2OEDA 1P7FA 2ON8A 1K50A 5JXVA 3FILA 2RPVA 2QSDA 4IOIE 1IGDA 4IKGA 1GB1A 2KQ4X 2IGGA 2J52A 1P7EA 2QMTA 2N7JA 1D4BA 1EM7A 1MI0A 2I38A 4HJGE 1QKZA 5BMHA 1IBXA 4KGSA 1PGXA 4HKZE 2ONQA 2JSVX 1IGCA 1XCQL 2PW9A 1MHXA 1C9FA 1PGBA 2LHEA 2JWUA 1ZXHA 2RMMA 2LUMA 2ZW0A 2JU6X 2PLPA 2KACA 1FD6A 2JZPA 1MHHE 1FCCC 3MP9A 2EELA 3FILB 4KGTA 3UI3A 1JMLA 2JXTA 1HZ6A 2I2YA 2PTLA 5HG2A 2IGHA 2GI9A 3V3XA 1XCTL 1FCLA 1XF5L 2LGIA 2N9LA 1K53A 2J53A 3GB1A 1IBXB 4GLSC 4D2KA 1F2RC 1YMHE 5BMGA 4OZCA 1HZ5A 1F2RI 1GB4A 4OZAA 5HI1A 5BMIA 2N9KA 5HFYA 4KGRA 2ZW1A 1MVKA 1K52A 4OZBA 1K51A 1KH0A
chains in the Genus database with same CATH superfamily
2CHWA 2WX0A 1OQRA 2VZKD 3A4RA 4HWIB 3KWLA 2K6QA 4MACA 1NI2A 2IY1B 4W9LA 4N59A 3DBSA 2IGDA 1HEZE 2KD0A 2QJLA 2KX3A 3ZUNA 1XLQA 4G50A 2LXAA 2DWQA 2VRRB 2LWPA 4UDUC 3DWGC 2WLBA 1WF9A 2O2VA 2HE7A 3AECB 3PS6A 2ZCCA 3OG5A 1XLPA 3QC8B 2GRIA 4JL9A 2ZVOA 1ENFA 2FCNA 2KC1A 4GDKB 1I4RA 3GE8C 4RCOA 1OQYA 2INCC 2JSVX 3P4RB 3OJ4B 4W9IA 1NDDA 2VH2A 4FBJB 4MDKE 2G4SA 2I1JA 3L4PA 4FN2A 3OLMD 2LHEA 2BKFA 3ML9A 4X57B 2N0SB 3VVWB 3TCAA 1A5RA 5IN7A 4BOZB 3FILB 3UI3A 5CHFA 2KC2A 3NUHB 1SE9A 4R3DA 3WAMA 1J7BA 1WGKA 2FUG1 2KWCA 3WA0A 1EF1A 3ZXRA 2FIDA 3FKYA 3LXFA 2MJDA 1YX5B 5EE3A 3ZTCA 2CR5A 1FFUA 5DCNA 1GG3A 3HVDA 2CS4A 2L0TA 4GDLA 3KYDD 5BYQA 1IBXB 3KH0A 2RDHA 3AE3B 1RFAA 1KM7A 2TSSA 1NVID 3NJTA 2E6XA 1T0YA 4AS1A 3UINB 4XE0A 2JY6A 3NHEB 4C7YA 3WANA 4OZAA 3APDA 4II3B 2R61A 3DWMA 2L7RA 3JW0X 1C1YB 2DBYA 2WDVB 2X38A 1KH0A 1XEEA 2AQ1B 2WXFA 1TZOA 1PQSA 4XGAB 2WU5B 4S17A 4RGMA 1FXIA 4W9KA 1Q10A 2KJ6A 3UIOB 5C1ZA 2XEWA 1RWSA 3SDLC 1MG4A 5G55A 4YSXB 1ZKHA 2KTRB 3M95A 2QSDA 3GS2A 2RD0A 2PMVA 2D2QA 1VZ6A 4W9DA 3BYTB 1V1OA 1V49A 2MW5A 2QMTA 2WXQA 5C3JB 3PREA 3ZTDA 2SEBD 2M8SA 2NTSA 4DHJD 3JVZX 5BYSA 5FR3A 1WMHB 3VQIA 3ML8A 5JH5C 3IBEA 1TY0A 5D3IB 1SE3A 3DBLI 1UGJA 3O65B 3B0AA 2MQJA 4WJOA 4LJOB 4F8CB 3UQAA 5TR5A 2FUHB 3PTFC 2JU6X 1SE2A 2AEHA 2RDGA 2V0GA 4WQMA 2FCSA 1KTKA 4YSYB 2GBJA 1VLBA 2DHZA 1VRAB 1N63A 1R4MB 2J0MA 1OEYA 3I9V1 4JQWC 4ZRQA 4DBGA 3L10B 5KHOA 1FNVA 1QT9A 1TS4A 2KZRA 3SFEB 4RMAA 1WMHA 1YOVB 2GBMA 2K9XA 5D94A 3DOWA 3DBRB 2NPTA 3IVFA 3N9YC 1ZXIA 1HZ5A 1I4PA 1J8CA 1QOGA 1TBEA 4XC2A 1EWYC 4AQ7A 1V6EA 2OJWA 2KMMA 4MGYE 3BK2A 4B0MA 5G2NA 2D10A 3LYYA 1FEHA 4A6QA 2K0PA 1SEBD 4FXCA 5IKCM 4J3OD 2WNMA 2WXPA 3ZNZB 2R2QA 4HRSA 3B1LX 4W9GA 2BWFA 1IP9A 3CSTA 2NVUI 4GN1A 4NZLB 3A9KA 2MHJA 3R7QA 4PS7A 4RGNA 5G5HA 3DVNV 4P6VF 4EUTA 1WJUA 4ARIA 3AMZA 1I4HA 3Q3JA 3FAHA 1KFYB 4MM3B 1RLFA 1QKZA 1YJJA 2JPHA 2WXLA 3M63B 3KQ4A 4DWFA 2KMCA 4C4VB 5LXIB 2KFJA 2RSUA 1OGWA 2BPSA 2LUMA 2D3BA 4RM8A 4IM2A 1FCCC 3DBLB 1JMLA 2FCMA 2J0KA 3Q6BA 2KWUB 3L16A 1R7SA 1TKEA 4MM3A 3T3OA 5EDSA 3AXCA 2LGDA 2WGSA 4NQKE 1ZP0B 4GLSC 3QQ8B 3S2AA 1F0ZA 3KW5B 3R3MA 3DHHC 1NI3A 1JROA 3BY4B 5E6PA 1FPYA 3AEFB 3AULA 1T0SC 4A9AA 4DXFA 1TT5B 3AN1A 3I3TB 3P4QB 3SHQA 2SAKA 3CIRB 1N5WA 1QQRA 2K3UA 2KXJA 1XO3A 1B9RA 4WJPA 1FNUA 3K9OB 2GB1A 1SGHA 2N4FA 2ON8A 3ETRA 2MJEA 3ZRFA 1I4QA 4MJSA 4FHJA 3W5VB 3WCQA 2PVGC 1GB1A 1FNWA 3AE7B 3V61A 3VHTC 1D6EC 3NZUA 4HJKA 4HJGE 4RF1A 4TSSA 2IPKD 3MHSD 3PHXB 4I6LB 4KGSA 4JE3B 4FJVB 1PFDA 5BYRA 2DYBA 5G5GA 4KZ0A 3GP7A 5L95C 3IAM1 2UYZB 1NYQA 4JWSC 2Z0EB 2K8CA 4HROA 4LNIA 1NENB 1R4MI 2A4ZA 2PLPA 3VDZA 2M0XA 3NVVA 2OJRA 3DBHB 3ZNID 2LVPA 2WXMA 2LGYA 5CX3A 4KGTA 4KIKB 4A3OA 3CMMB 2WXOA 2LGXA 1HZ6A 1WXVA 1WXMA 3EC8A 2HJ1A 1MG8A 3DBRI 4OHJA 2MP2B 2N7DA 1FRDA 2MX2A 2CHXA 3IT4B 1FMAD 2NBVB 4L2YA 3VR9B 2BYTA 1UGMA 3ZXVA 2RPQA 3PZ8A 4WJQA 1GB4A 5T8IA 2M4NA 1XD3B 3QARA 1SJED 2ZW1A 5IAAC 2INDC 1QLBB 2UU7A 2KWDA 2BQQA 2RDBC 1DOYA 5BO4B 4MH0E 1NYRA 1RAXA 3RNEC 3U30A 3ONSA 4HPMB 2DZIA 1IPGA 4GB9A 4WH4A 2L00B 4IDIA 3EGRA 1C4PA 3JSVB 1SSNA 4URKA 1AN8A 3MC8A 4A90A 4A55A 1CJEA 3N1ZC 3HVZA 3FILA 3PRPB 2J4XA 4DDID 1L5PA 4E3CA 3APFA 3URYA 2WYQA 5DPTA 4GSWA 1IYFA 3A33B 1WXSA 4HEA1 3VTVA 1P7EA 1JW9D 3N20C 3DHGC 4C4VA 2KX0A 4L23A 2Y5BB 2BWES 2D5GA 2H88B 2N1VA 3RI7C 4ZYSA 1XCQL 2KT7A 5LXHA 5KHQA 3KYCD 2D11A 2GMIC 5AZGA 2L32A 4GXBA 2PJHA 2GBNA 2FNJB 1Q0WB 5CTRC 5DPWA 2W55A 2K39A 3V05A 2Y3AA 4TQ0A 1E90A 1JWUD 1FM0D 3N1YC 4KSLC 2L05A 3DQVA 1CZPA 1X1MA 2QIEB 1KLGD 3V3XA 3X0WA 3PZ7A 3C0RB 4US8A 1WZ0A 5H92C 1D5MC 2WS3B 4FADA 2K5PA 4MJSB 1JWAD 2NS5A 4LNOA 1WGRA 2KKCA 4MT5A 5HI1A 1JRUA 3AB5A 3GOEA 1ET9A 3B9JA 2O2VB 3TEWA 4MSMB 1G6JA 4C7ZA 2KQ7A 2NPTB 1WH3A 4XZ4A 3WAPA 1VDVA 2L52A 2NTTA 4GGQA 1S1QB 3HIZA 1SJHD 2IO2B 2KHWB 3WALA 2GBRA 2QC8A 3AEEB 2HTHA 1MPEA 2NBUA 5TSSA 1UNSA 3NZSA 3EFCA 4RF0A 3RNBC 3ABVB 2CKHB 3MJWA 1C78A 3QJZA 2KQSA 4M0WB 2IDYA 3APCA 3ZGZA 2KLCA 1EF5A 1WI0A 3W9CB 1WM2A 1ZW7A 1IBXA 2LUEA 5DPRA 1PGXA 2MBBB 2KDIA 3DDCB 2MJ3A 3EFUA 1EUVB 3I63C 2QILA 3VUWA 2B3AA 4FULA 2GBKA 2M19A 3A9JA 1NBFC 4BKSA 1FD6A 1TZ1A 2JZPA 3NVZA 3NVYA 2N9EB 1ACCA 1ROEA 2HTME 1P1AA 3O13A 4DQOC 1BMLC 2AQ3B 2YEPB 2QHOA 3WAOA 1JWBD 1GC7A 3V6EB 5LNK1 4I6NB 4PYZA 1E7UA 3KWVA 3VRAB 2AWTA 2ZPYA 3ZNGC 1YN4A 4JPSA 3Q3OC 1M94A 3I57A 4A3PA 2J42A 2L0FA 4BKTA 3AU5A 2V1YA 4LNNA 2C7NB 4M01A 4ICVA 1KRHA 3U7ZA 1WJNA 4JX1C 4EZLA 1UD7A 1E8YA 1B1ZA 1F77A 2KTFA 1MJDA 1TKGA 3E9SA 3PZDA 1DOXA 1C79A 3PPAA 3Q3FA 3GZNI 1STEA 3R7RA 3TUOA 2N7JA 5D7GA 3CWIA 2BYVE 3MTNB 2REXA 5J17A 3QHTA 3ZW3A 2ZPNA 4HKZE 3BYYB 3HHMA 3ZKJC 2PW9A 4USAA 2M17A 1C9FA 3H9DA 3SD5A 1T0QC 4MELA 3AE8B 4HPPA 4EE2A 1T3QA 1C76A 3L13A 2LXCA 3N32A 2W82A 4KKJA 4EEWA 3RCZA 1SIJA 4K81A 2DENB 1BXTA 3EHVA 3P42A 1TKYA 3C8YA 2L1AA 1HTQA 1ISNA 3VH4B 4YTPB 5L83A 1CK1A 3PRZA 2C7MB 1WYGA 4M8MA 4MGKE 4HDQA 1FRRA 2BS2B 3U7DA 2J0JA 3RD2A 3KUCB 1F2RC 1I4GA 2H89B 1C4AA 3MC0B 5LLIA 3RN9C 4LLGM 1EU4A 3R2IA 1VZ8A 1L4DB 1K52A 4OZBA 2Z8LA 1K51A 4BOSC 4PS3A 4HKQA 2KVZA 4HVBA 4M02A 2W9NA 2XK5B 5H8YE 2ZNVB 5DPSA 1F52A 2M56B 4N9F4 4BKGA 1QOBA 2OEDA 2OOBB 2L3ZA 3SFDB 1YJIA 3L0WB 1AYFA 4IKGA 1CMXB 4YT0B 4ZHOA 3RFZB 4E74A 1WE7A 3BZDB 1MFWA 2W3RA 2BT6A 2IO1B 4ANWA 3H7SA 1GOZA 3W5UB 4F1SA 1RFKA 3TEXA 4KDLB 1KLUD 1OQQA 1WE6A 4PS8A 4LNFA 1IGCA 3TSSA 3AU4A 4PT5A 2V3NA 2AQ2B 4IC7B 3UIPB 3RT3B 1TS5A 2R2OA 1TTNA 4MSQB 3Q69A 3VFKA 5J2RA 1WGDA 1IUEA 3PLVA 4N6EB 2K25A 3H6NA 1QOAA 3AV8A 2MA9B 2ACZB 4GOCA 4W9FA 2L8JA 1TIFA 1WRIA 2CJOA 3P63A 1XF5L 2KWVB 3ZIMA 2MP2A 4B95A 1YQ3B 4ICUA 2LZ6A 5AZHA 2KFKB 4ANVA 1FXAA 1HQRD 3ZJTA 2J7QB 2WDQB 1FXTB 1P98A 3AI5A 2INPE 3P2BA 3QIJA 1A70A 4E71A 3PV1A 3CSFA 5E6NA 4EKUA 3L54A 4MGZE 2KN4A 2KDMA 3AH7A 4AUQC 4CYEA 3Q3MC 1V8CA 2MCNB 2NMQA 1WJ6A 2JT4B 2MWSB 4OVVA 4KIKA 2W3SA 4AOFA 1GPXA 3M62B 1KOTA 1EWCA 4BBNC 1JQ4A 2IBIB 3V60A 1UH6A 2QCZA 4O1NA 2PE9A 4IWOA 3MFGA 3AEAB 1P3QU 3VRBB 2DYOA 2AL3A 2KMAA 3IAS1 3AEBB 1WX8A 2PPHA 1JRPA 1MHXA 3EECA 2N1WA 1PGBA 3NVWA 1ESFA 1H4RA 1ZUD2 1ZXHA 4W9JA 3VXWA 1YN3A 1SIFA 2DYMA 4EOYA 2KACA 1L6VA 2AYOB 4HCNB 1RYJA 4LNKA 5C23A 2JXXA 3N1XC 3HRDD 2N7EA 3TJPA 3EUB2 3T8MA 5JHBA 4M8NA 3KUDB 5HG2A 4CQNA 2IGHA 2AX5A 2JX5A 3NY5A 1XCTL 2LGIA 5FK9C 2N9PC 4NAWA 4YWGG 2WX1A 3SR6A 1WSPA 1NEKB 2K22A 3J9CA 4OZCA 2KJHB 1WGYA 4XWWA 1VD2A 3VR8B 2CJNA 1E7PB 5CHVC 4HCPB 2FE8A 3U8ZA 1FFVA 3HM3A 2BB5A 2BW2A 4RGOS 1EU3A 1UZXB 2WHIA 1E6EB 3QX1A 3GE3C 4EZKA 3LDZE 4REZA 1KLVA 1XT9B 2ZJDA 2XK5A 3ZJVA 4HDOA 1UWMA 3KVFB 2LJ5A 1QZEA 3RUIB 3PSEB 1Z5SB 4C00A 2MSED 3AEDB 5I4DA 3VAWA 1HA5A 2JRIB 1R4NI 4M0WA 4NAWB 4FLHA 1VZ7A 2XBBC 4MGIE 1WXQA 4GDLB 4JWUC 2K1FA 1TY2A 1LM8B 3QA8A 4K7UA 3UGBB 2G9HD 2FCQA 1LFDA 3D32A 1E7VA 3A9KB 3ENEA 4ITKA 1L7YA 2WXHA 2JUOA 2I2YA 1PYWD 1CQVA 5FR6A 3DVGX 4F7ZA 3RNGC 1QILA 2BF8B 2LD9A 4G11A 4ZRPA 3HK0A 3KLSX 4HK2A 2XN9C 3OJ3A 4S0RA 2PVOD 1J0GA 2JYEA 4JGHB 4BFRA 3MJ5A 3Q8AA 3U4EG 2IYDB 5BMGA 2N9XA 2YLMA 1HE8A 3BVZA 4IUMB 3VUXA 2WXJA 4NJ7A 2V3PA 2X8XX 2RR9A 5AUIA 2LEKA 4WURA 3CF6E 4ZOHC 1I7HA 1EO6A 4ZRKA 1C77A 4ZRJA 1I35A 3BVMA 2CU1A 4FHKA 1Q1OA 1ZGUB 4WAAA 4P16A 1C4CA 2GOWA 2BYEA 1S3SG 2KLGA 2V9HA 2PE6B 1E10A 4NY0A 1P7FA 1WGHA 1Y56A 4OVUA 3AE9B 4CHKA 4IG7B 1IGDA 1D3ZA 1SE4A 3RYTA 4W9CA 1AARA 2KANA 4KKIA 3ZDTA 2EKIA 1V97A 1D4BA 2VH1A 3RPFC 4W9HA 4K7WA 4NJCA 2KDFB 2VZKB 3ALBA 3DBHI 4YTMB 2L76A 3EA6A 1N62A 5GMVA 2LRUA 1ET6A 2C60A 5D3DA 3OWEB 4WQOB 2WXGA 3BWUD 2LFIA 3TBLD 4XDDA 1GC6A 1LO5D 4BZAA 2KTRA 1FO4A 4BVUC 2WXRA 1V1PA 2EKEC 1M4VA 4DHZE 2PTLA 4TV3A 1XXGA 1ZDXA 2DZKA 2LJIA 3SEBA 4YXDB 3R2TA 2G3QB 1WZ3A 2KNBA 4TQ1A 1SF0A 4W9EA 3B08A 2BKRB 3ECIA 2KOXA 2ZEQA 5AZFA 3HUIA 2LVOA 3IHPC 3T3NA 3VH3B 1AW7A 3BVGA 1KF6B 3AE1B 4YSZB 3P4PB 3U52E 4PYUA 2V4IB 1YX6B 3V62A 5HHDG 4AWJA 5AEKB 2LGSA 4XX5A 4RGTA 2OHFA 5IP4D 3NG0A 1E9MA 1D5ZC 1U4AA 1YIWA 3VUYA 1Y8RC 2LHDA 2D3GA 2Y5PA 1R4NB 1T5XD 5EE9A 1WR6E 2WU2B 3PVLA 2BGFA 4WIPA 2IGGA 1SB3C 2D07B 4WWNA 3M3JA 1ZOYB 4RNAA 4IW0A 3E56A 5IA7A 1TJEA 2MBOA 2XNAC 2WDTB 2MBHA 2JZ3B 3AE5B 2KVRA 4M00A 4I6PA 4LDTB 2LVQA 3Q14C 3MHZA 4HPLB 2EELA 2ICIA 1K8RB 2Y5CA 1SBBB 4G3XB 1P9DU 2GI9A 1VCBA 2CU3A 5MPOA 3TMPB 4WAFA 2N9LA 2J53A 2MLBA 5HKHA 3A1QA 3IG3A 1V1PB 3U2SC 1GJZA 1WX9A 2NBWB 2O6VB 4DK5A 3A4SC 5J18A 2C9WB 2JZZA 3ZYYX 2G1EA 5BMIA 4JLCA 3QAQA 3UF8A 4KDIC 5JHAA 3LB8C 4K3CA 2L83A 4H2AA 4ZRIA 2KYWA 1AWDA 2I1KA 1HXYD 1XLOA 2BTEA 1WFYA 3IFWB 1N6ZA 1N5XA 1QF6A 2Q5WD 3W1YA 3C19A 3ZLZA 1BUIC 2ASQA 3ZNHB 3Q8EA 1GNUA 2Z59B 2KDEB 4K7SA 1PGAA 3PT2B 3NS1A 1OTRB 4HLEA 1K50A 1RRBA 5C2TB 1FIQA 3HM6X 4IOIE 2O6VA 4ANUA 4IWQA 4LCDE 5IOIA 2K8BA 3TEYA 3K9PB 2DX5B 4B9KA 2J52A 2ZCBA 2FIFA 2A5UA 1H8CA 1EM7A 3P4SB 3N3KB 2MBQA 4P1BC 4FA6A 1L2NA 2EMSA 1YD8U 4ZYNA 4FJZA 3AE4B 2NR2A 3TEZA 3H1UA 4WWOA 4TMAB 3MC9A 1YJ1A 1ZDVA 1D5XC 1V5OA 1DOIA 1UBIA 3AE2B 4KV2A 3DPDA 3WIMA 1MHHE 3DHIC 3MP9A 1E5WA 4KX6B 1ZPSA 3T9LA 2ZZPB 3ZDMC 4PK1A 1I4XA 3V6CB 2JYTA 1L0XB 5GXGB 3NZ3A 4OVZA 3H8HA 4DHZB 4QAYA 3PRMB 3ZJUA 2DAJA 1DYQA 4C80A 1T0RC 2EMTA 4L1BA 4IM0A 1P0RA 4GDKA 4BKSD 4LTUA 4P7IA 4FJYA 2MH7A 5E6OA 3AM9A 1E8ZA 1OEYJ 4DXAB 3W1SC 4WWMA 5HFYA 2WP9B 4LJPB 1MVKA 1Z2MA 4XYCA 2HDEA 2E3TA 4KZCA 2KFKA 3DVNU 1OFFA 2QDFA 4ZDVA 1TYGB 4YL8A 1TS3A 3W2DA 1UWXA 3DCGA 3IT6B 5JZEB 1L4ZB 4B6WA 2AL6A 3PLUA 1SXTA 2WXIA 1LXDA 2QEJC 3Q8CA 3GZNB 2HD5B 2RPVA 2GLSA 3I5JC 1LGRA 3R8BA 2KQ4X 4MEMA 4XDCA 1WRDB 4N58A 2IZVB 1XQQA 1KJTA 4RH6A 2I38A 1UF0A 3AE6B 1PDXA 1L0YB 3QK0A 2BB6A 4ARCA 1T6BX 2ONQA 1YQ4B 3RZFA 2DNFA 2MEKA 1V81A 1E8WA 1F9JA 2YEPF 3UQBA 3Q2AC 4KSKC 2WQYB 3H7PA 3BK1A 4DHJB 3KUZA 4AJWA 2ZW0A 2DZJA 1F1HA 3A9JB 4MH8A 5AUKA 4NQLB 3W1SA 1WJ4A 2JF5A 4A20A 4ASWC 1TGZB 1E0ZA 2LRWA 1UELA 5D6JB 2B76B 1K53A 1BT0A 3GB1A 2PEAA 3B2GA 2KDBA 1V9JA 2INNE 4B0EA 1YMHE 1TS2A 1VJKA 4GMVA 4WJNA 4LDTD 2M0AA 3SU8X 2IO3B 4WWPA 3ZQ4A 3JYUA 2K6DB 2MRPA 3PGEA 4J6IA 2BYFA 2KK8A 3QWZB 4CO7A 1YNTE 3JSVA 4BBNF 3QCAA 3RNFC 3L08A 1VR9A 2BVCA 4YTNB 3NRZA 4OW0A 1J7AA 4K1RB 4XWTA 2FAZA 4LK0M 4EFOA 3R66C 4II2B 2Z0DB 1Q5WB 3ZO5B 2HJ8A 2BBCA 1V5TA 2FBWB 1N60A 1XLNA 2WXNA 2RGFA 1WX7A 2G45B 1UUPA 1WIAA 4HXDA 4DXGA 1MI0A 2K8HA 3A1QB 1YN5A 2ZNVC 1JCKB 5FKAC 3Q8BA 1JALA 4TUUA 4AJYB 4P1CC 3B2FA 2V4LA 1JWSD 3N30A 1GAQB 2O6VD 1WM3A 3ZVVA 2BS4B 4BAXA 4ACFA 1WWTA 1V86A 4IWPA 2ZVNA 2C7HA 4KVGB 4NJ6A 1WY8A 4G0NB 1WR1A 4AP4C 1PUTA 1V80A 4A8XC 1V2YA 4GIVA 3RULA 4GU2A 1C3TA 3PO0A 3BIID 4ANXA 2JRHA 2NCNA 4NNJB 3ZRCA 2LASA 3BINA 1L6UA 2N9KA 2IY0B 4NPNA 3NOBA 4KGRA 1WXAA 2YVCA 3AEGB 4C56C 2D3AA 2KN5A 3TL5A 2PKOA 2KAJA 1GUAB 3RMKC 2WXKA 1E8XA 2DZMA 1UBQA 2BS3B 4K3BA 2WWZA 2PIAA 2C5LC 4Q2JA 2DAFA 3RNCC 4EZJA 2KJRA 1HTOA 2D3CA 5JXVA 2UWQA 2V3SA 3DVGY 3VTUA 4DDGD 4US9A 2IO0B 1WGGA 3L17A 2MBEA 5BMHA 4TKNA 2JVCA 2WDRB 1QOFA 3RNAC 4ZHPA 4IM3A 3P1MA 3IXSA 3VTWA 3RZWC 2JWUA 2LMCA 1L0VB 2RMMA 2M1MA 2W54A 3OAWA 2IJ0A 1JWMD 1RM6C 1YQBA 2G4DB 3TIXA 5CHWA 3X23A 3H7PB 3FC4A 2JXTA 5E6JA 1J19A 3LJ3A 5EE0A 3NS8A 4RFBA 2DLBA 2JWZA 2CHZA 1FCLA 1DGJA 1ZE3D 5IO9A 1J7CA 1WYWB 1LQBA 4D2KA 2LI5A 4JIOU 5EE1A 1I42A 3PHWB 4NAMA 4RM9A 1F2RI 5D2MB 1N61A 3Q3NC 2KO3A 3Q8FA 2JQRB
chains in the Genus database with same CATH topology
2KWDA 4H2AA 1OQRA 2VZKD 1DOYA 1AWDA 1HXYD 1XLOA 3KWLA 2BTEA 4MACA 1NYRA 1QF6A 1N5XA 2Q5WD 2KN4A 2KDMA 3AH7A 4N59A 1BUIC 3Q8EA 2IGDA 1HEZE 4WH4A 2QJLA 4IDIA 3EGRA 1C4PA 1PGAA 1SSNA 1V8CA 1XLQA 1AN8A 2DWQA 4A90A 4A55A 2NMQA 3NS1A 4UDUC 1CJEA 3DWGC 1K50A 2W3SA 5C2TB 3HVZA 3FILA 2J4XA 1FIQA 4IOIE 2WLBA 1L5PA 1GPXA 1EWCA 3URYA 1JQ4A 3AECB 3TEYA 4HEA1 1XLPA 4O1NA 2J52A 1P7EA 1JW9D 3MFGA 3AEAB 3VRBB 2GRIA 1ENFA 4L23A 1EM7A 4GDKB 3P4SB 2DYOA 1I4RA 2D5GA 2H88B 3IAS1 3AEBB 4RCOA 2JSVX 3P4RB 4ZYSA 1XCQL 1JRPA 3AE4B 3TEZA 1MHXA 1PGBA 3L4PA 3NVWA 1ESFA 2LHEA 4TMAB 1ZUD2 1ZXHA 1ZDVA 2L32A 1D5XC 2N0SB 1DOIA 1YN3A 2DYMA 3AE2B 2KACA 1L6VA 1MHHE 2W55A 3MP9A 4KX6B 1RYJA 3FILB 1ZPSA 3UI3A 3V05A 3HRDD 3NUHB 4R3DA 2Y3AA 4TQ0A 1I4XA 1J7BA 3EUB2 2JYTA 1L0XB 2FUG1 1JWUD 1WGKA 5GXGB 3NZ3A 4OVZA 1FM0D 3H8HA 3ZJUA 5HG2A 3LXFA 2MJDA 1DYQA 2IGHA 2AX5A 2JX5A 1CZPA 5EE3A 4C80A 4CQNA 4L1BA 1FFUA 2QIEB 1KLGD 3V3XA 3HVDA 1XCTL 3PZ7A 4LTUA 2LGIA 5FK9C 4YWGG 4US8A 5BYQA 2MH7A 3SR6A 1WSPA 1IBXB 5H92C 1D5MC 2RDHA 2WS3B 1NEKB 3AE3B 2K22A 3AM9A 2K5PA 2TSSA 3J9CA 1NVID 1JWAD 2E6XA 4OZCA 4AS1A 4XE0A 4XWWA 4MT5A 4C7YA 3VR8B 4OZAA 5HI1A 2CJNA 1E7PB 3AB5A 4WWMA 2R61A 5HFYA 1ET9A 2FE8A 2WP9B 3DWMA 3B9JA 1MVKA 2DBYA 3TEWA 2HDEA 2WDVB 2X38A 4C7ZA 2E3TA 1KH0A 1FFVA 1VDVA 2L52A 2NTTA 2BB5A 2BW2A 1XEEA 4RGOS 2AQ1B 2WXFA 1TZOA 1OFFA 1EU3A 2WU5B 1E6EB 1SJHD 1TYGB 4REZA 4RGMA 1FXIA 1TS3A 1Q10A 3W2DA 1UWXA 1RWSA 3AEEB 3IT6B 4YSXB 1L4ZB 1MPEA 3ZJVA 1UWMA 1SXTA 1UNSA 5TSSA 2WXIA 4RF0A 2QEJC 3ABVB 3Q8CA 1C78A 2RPVA 2QSDA 3GS2A 2PMVA 2IDYA 3R8BA 2KQ4X 3AEDB 1VZ6A 4XDCA 3ZGZA 4N58A 3BYTB 5I4DA 1V1OA 2QMTA 1HA5A 2WXQA 5C3JB 4RH6A 4M0WA 4NAWB 3W9CB 2I38A 2SEBD 1VZ7A 3AE6B 1PDXA 1L0YB 2NTSA 1IBXA 2BB6A 5BYSA 5FR3A 4ARCA 1T6BX 1PGXA 3VQIA 1WXQA 2ONQA 1YQ4B 4GDLB 4JWUC 1TY0A 2MJ3A 5D3IB 2MEKA 1SE3A 1UGJA 2QILA 1TY2A 2YEPF 2WQYB 3BK1A 2G9HD 2M19A 2ZW0A 2JU6X 1SE2A 1FD6A 2JZPA 3NVZA 2RDGA 4MH8A 5AUKA 2V0GA 4WQMA 4ITKA 4YSYB 1KTKA 1VLBA 2WXHA 3NVYA 3W1SA 1ACCA 1ROEA 1VRAB 2I2YA 1N63A 1PYWD 2HTME 3O13A 1CQVA 3I9V1 4ZRQA 4DQOC 1BMLC 1FNVA 1QT9A 2AQ3B 1QILA 2YEPB 1TS4A 1E0ZA 4ZRPA 3KLSX 1JWBD 2XN9C 3SFEB 5LNK1 2B76B 2PVOD 1K53A 3GB1A 2JYEA 3B2GA 2K9XA 3KWVA 2INNE 3MJ5A 3Q8AA 3VRAB 3N9YC 4B0EA 1YMHE 1TS2A 1VJKA 3U4EG 5BMGA 1ZXIA 1I4PA 1HZ5A 3BVZA 2M0AA 2WXJA 1QOGA 1YN4A 2V3PA 1EWYC 4AQ7A 5AUIA 2KMMA 2LEKA 4JPSA 4WURA 3ZQ4A 3BK2A 4ZOHC 1I7HA 3I57A 4B0MA 2J42A 3LYYA 1FEHA 4A6QA 1YNTE 1C77A 2K0PA 1SEBD 3BVMA 4FXCA 1VR9A 4P16A 4J3OD 2WNMA 4YTNB 1C4CA 2WXPA 4HRSA 3NRZA 4OW0A 1KRHA 1E10A 1J7AA 3U7ZA 4JX1C 4XWTA 1P7FA 1Y56A 4NZLB 3AE9B 1B1ZA 1F77A 4LK0M 1IGDA 4RGNA 1TKGA 3E9SA 2BBCA 1SE4A 5G5HA 2FBWB 1DOXA 4P6VF 1N60A 1XLNA 2WXNA 4KKIA 1C79A 1STEA 1UUPA 3TUOA 2N7JA 2EKIA 4ARIA 1V97A 3AMZA 5D7GA 1D4BA 1I4HA 4DXGA 1MI0A 3FAHA 1KFYB 4MM3B 3RPFC 3CWIA 1QKZA 1YJJA 4NJCA 2WXLA 1YN5A 2VZKB 3KQ4A 1JCKB 4HKZE 3BYYB 5FKAC 2PW9A 4YTMB 3Q8BA 4USAA 1C9FA 1JALA 3EA6A 1N62A 3B2FA 1ET6A 5D3DA 1JWSD 1GAQB 3OWEB 2LUMA 2WXGA 3AE8B 4EE2A 3BWUD 1T3QA 1C76A 2LFIA 2BS4B 1FCCC 4KKJA 1WWTA 2W82A 4XDDA 1SIJA 1LO5D 1JMLA 1FO4A 2WXRA 1BXTA 1V1PA 1M4VA 3P42A 2PTLA 1TKYA 3C8YA 1XXGA 2L1AA 1ZDXA 1R7SA 2LJIA 1TKEA 3SEBA 4YXDB 4YTPB 3T3OA 3R2TA 1PUTA 1CK1A 1WYGA 4A8XC 4TQ1A 1SF0A 3PO0A 1ZP0B 4GLSC 1FRRA 2BS2B 3BIID 1F2RC 1F0ZA 1I4GA 2H89B 1C4AA 3HUIA 1NI3A 1JROA 3MC0B 4LLGM 3T3NA 1L6UA 2N9KA 4KGRA 1EU4A 3R2IA 1VZ8A 1AW7A 1K52A 1L4DB 2Z8LA 1KF6B 3AEFB 3AE1B 1K51A 3BVGA 3P4PB 4OZBA 4YSZB 3AEGB 3U52E 4C56C 4HKQA 4A9AA 4DXFA 3AN1A 2V4IB 3P4QB 2PKOA 2SAKA 2KAJA 5HHDG 2WXKA 3CIRB 1N5WA 1QQRA 5H8YE 4RGTA 2BS3B 2K3UA 1XO3A 2OHFA 1B9RA 1FNUA 2PIAA 2GB1A 2M56B 1E9MA 1D5ZC 4Q2JA 2LHDA 1QOBA 2OEDA 2ON8A 2Y5PA 5JXVA 3ETRA 2MJEA 1T5XD 5EE9A 2WU2B 3SFDB 1I4QA 1YJIA 1AYFA 4IKGA 4YT0B 3W5VB 3WCQA 4ZHOA 2PVGC 1GB1A 3RFZB 3BZDB 4WIPA 1FNWA 2W3RA 2IGGA 4US9A 2BT6A 3AE7B 1SB3C 1GOZA 3W5UB 1RFKA 3TEXA 1ZOYB 1D6EC 1KLUD 1OQQA 4HJGE 4RF1A 4TSSA 2IPKD 4RNAA 3E56A 5BMHA 4KGSA 4JE3B 1TJEA 2WDRB 1PFDA 2XNAC 1QOFA 5BYRA 4ZHPA 1IGCA 3TSSA 5G5GA 3GP7A 4PT5A 3P1MA 2V3NA 2AQ2B 3IAM1 4JWSC 1NYQA 3IXSA 1TS5A 2JWUA 2LMCA 3AE5B 4HROA 1L0VB 2RMMA 1NENB 2W54A 3Q69A 2PLPA 3NVVA 3MHZA 2WXMA 2IJ0A 1JWMD 1RM6C 2EELA 1IUEA 4KGTA 2ICIA 2WXOA 3FC4A 4N6EB 2JXTA 1HZ6A 5E6JA 2Y5CA 1SBBB 1QOAA 3AV8A 5EE0A 2ACZB 4OHJA 2GI9A 1WRIA 2CJOA 2DLBA 3P63A 4RFBA 1FRDA 3IT4B 1XF5L 1FCLA 1DGJA 1FMAD 1ZE3D 2CU3A 4L2YA 5MPOA 3VR9B 4WAFA 2BYTA 2N9LA 2J53A 1J7CA 1YQ3B 4D2KA 5EE1A 3U2SC 1V1PB 4NAMA 1FXAA 1HQRD 3PZ8A 3ZJTA 1F2RI 1GB4A 5T8IA 3ZYYX 2WDQB 2G1EA 5BMIA 1N61A 1SJED 2INPE 2ZW1A 1QLBB 3LB8C 3Q8FA 2JQRB 2L83A 1A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWD A;  4MAC A;  1YNT E;  2K0P A;  5HHD G;  2KN4 A;  2KDM A;  2IGD A;  1HEZ E;  1Q10 A;  4WH4 A;  1UWX A;  2GB1 A;  1PGA A;  1MPE A;  2NMQ A;  2LHD A;  2OED A;  1P7F A;  2ON8 A;  1K50 A;  5JXV A;  3FIL A;  2RPV A;  2QSD A;  4IOI E;  1IGD A;  4IKG A;  1GB1 A;  2KQ4 X;  2IGG A;  2J52 A;  1P7E A;  2QMT A;  2N7J A;  1D4B A;  1EM7 A;  1MI0 A;  2I38 A;  4HJG E;  1QKZ A;  5BMH A;  1IBX A;  4KGS A;  1PGX A;  4HKZ E;  2ONQ A;  2JSV X;  1IGC A;  1XCQ L;  2PW9 A;  1MHX A;  1C9F A;  1PGB A;  2LHE A;  2JWU A;  1ZXH A;  2RMM A;  2LUM A;  2ZW0 A;  2JU6 X;  2PLP A;  2KAC A;  1FD6 A;  2JZP A;  1MHH E;  1FCC C;  3MP9 A;  2EEL A;  3FIL B;  4KGT A;  3UI3 A;  1JML A;  2JXT A;  1HZ6 A;  2I2Y A;  2PTL A;  5HG2 A;  2IGH A;  2GI9 A;  3V3X A;  1XCT L;  1FCL A;  1XF5 L;  2LGI A;  2N9L A;  1K53 A;  2J53 A;  3GB1 A;  1IBX B;  4GLS C;  4D2K A;  1F2R C;  1YMH E;  5BMG A;  4OZC A;  1HZ5 A;  1F2R I;  1GB4 A;  4OZA A;  5HI1 A;  5BMI A;  2N9K A;  5HFY A;  4KGR A;  2ZW1 A;  1MVK A;  1K52 A;  4OZB A;  1K51 A;  1KH0 A; 
#chains in the Genus database with same CATH topology
 2CHW A;  2WX0 A;  1OQR A;  2VZK D;  3A4R A;  4HWI B;  3KWL A;  2K6Q A;  4MAC A;  1NI2 A;  2IY1 B;  4W9L A;  4N59 A;  3DBS A;  2IGD A;  1HEZ E;  2KD0 A;  2QJL A;  2KX3 A;  3ZUN A;  1XLQ A;  4G50 A;  2LXA A;  2DWQ A;  2VRR B;  2LWP A;  4UDU C;  3DWG C;  2WLB A;  1WF9 A;  2O2V A;  2HE7 A;  3AEC B;  3PS6 A;  2ZCC A;  3OG5 A;  1XLP A;  3QC8 B;  2GRI A;  4JL9 A;  2ZVO A;  1ENF A;  2FCN A;  2KC1 A;  4GDK B;  1I4R A;  3GE8 C;  4RCO A;  1OQY A;  2INC C;  2JSV X;  3P4R B;  3OJ4 B;  4W9I A;  1NDD A;  2VH2 A;  4FBJ B;  4MDK E;  2G4S A;  2I1J A;  3L4P A;  4FN2 A;  3OLM D;  2LHE A;  2BKF A;  3ML9 A;  4X57 B;  2N0S B;  3VVW B;  3TCA A;  1A5R A;  5IN7 A;  4BOZ B;  3FIL B;  3UI3 A;  5CHF A;  2KC2 A;  3NUH B;  1SE9 A;  4R3D A;  3WAM A;  1J7B A;  1WGK A;  2FUG 1;  2KWC A;  3WA0 A;  1EF1 A;  3ZXR A;  2FID A;  3FKY A;  3LXF A;  2MJD A;  1YX5 B;  5EE3 A;  3ZTC A;  2CR5 A;  1FFU A;  5DCN A;  1GG3 A;  3HVD A;  2CS4 A;  2L0T A;  4GDL A;  3KYD D;  5BYQ A;  1IBX B;  3KH0 A;  2RDH A;  3AE3 B;  1RFA A;  1KM7 A;  2TSS A;  1NVI D;  3NJT A;  2E6X A;  1T0Y A;  4AS1 A;  3UIN B;  4XE0 A;  2JY6 A;  3NHE B;  4C7Y A;  3WAN A;  4OZA A;  3APD A;  4II3 B;  2R61 A;  3DWM A;  2L7R A;  3JW0 X;  1C1Y B;  2DBY A;  2WDV B;  2X38 A;  1KH0 A;  1XEE A;  2AQ1 B;  2WXF A;  1TZO A;  1PQS A;  4XGA B;  2WU5 B;  4S17 A;  4RGM A;  1FXI A;  4W9K A;  1Q10 A;  2KJ6 A;  3UIO B;  5C1Z A;  2XEW A;  1RWS A;  3SDL C;  1MG4 A;  5G55 A;  4YSX B;  1ZKH A;  2KTR B;  3M95 A;  2QSD A;  3GS2 A;  2RD0 A;  2PMV A;  2D2Q A;  1VZ6 A;  4W9D A;  3BYT B;  1V1O A;  1V49 A;  2MW5 A;  2QMT A;  2WXQ A;  5C3J B;  3PRE A;  3ZTD A;  2SEB D;  2M8S A;  2NTS A;  4DHJ D;  3JVZ X;  5BYS A;  5FR3 A;  1WMH B;  3VQI A;  3ML8 A;  5JH5 C;  3IBE A;  1TY0 A;  5D3I B;  1SE3 A;  3DBL I;  1UGJ A;  3O65 B;  3B0A A;  2MQJ A;  4WJO A;  4LJO B;  4F8C B;  3UQA A;  5TR5 A;  2FUH B;  3PTF C;  2JU6 X;  1SE2 A;  2AEH A;  2RDG A;  2V0G A;  4WQM A;  2FCS A;  1KTK A;  4YSY B;  2GBJ A;  1VLB A;  2DHZ A;  1VRA B;  1N63 A;  1R4M B;  2J0M A;  1OEY A;  3I9V 1;  4JQW C;  4ZRQ A;  4DBG A;  3L10 B;  5KHO A;  1FNV A;  1QT9 A;  1TS4 A;  2KZR A;  3SFE B;  4RMA A;  1WMH A;  1YOV B;  2GBM A;  2K9X A;  5D94 A;  3DOW A;  3DBR B;  2NPT A;  3IVF A;  3N9Y C;  1ZXI A;  1HZ5 A;  1I4P A;  1J8C A;  1QOG A;  1TBE A;  4XC2 A;  1EWY C;  4AQ7 A;  1V6E A;  2OJW A;  2KMM A;  4MGY E;  3BK2 A;  4B0M A;  5G2N A;  2D10 A;  3LYY A;  1FEH A;  4A6Q A;  2K0P A;  1SEB D;  4FXC A;  5IKC M;  4J3O D;  2WNM A;  2WXP A;  3ZNZ B;  2R2Q A;  4HRS A;  3B1L X;  4W9G A;  2BWF A;  1IP9 A;  3CST A;  2NVU I;  4GN1 A;  4NZL B;  3A9K A;  2MHJ A;  3R7Q A;  4PS7 A;  4RGN A;  5G5H A;  3DVN V;  4P6V F;  4EUT A;  1WJU A;  4ARI A;  3AMZ A;  1I4H A;  3Q3J A;  3FAH A;  1KFY B;  4MM3 B;  1RLF A;  1QKZ A;  1YJJ A;  2JPH A;  2WXL A;  3M63 B;  3KQ4 A;  4DWF A;  2KMC A;  4C4V B;  5LXI B;  2KFJ A;  2RSU A;  1OGW A;  2BPS A;  2LUM A;  2D3B A;  4RM8 A;  4IM2 A;  1FCC C;  3DBL B;  1JML A;  2FCM A;  2J0K A;  3Q6B A;  2KWU B;  3L16 A;  1R7S A;  1TKE A;  4MM3 A;  3T3O A;  5EDS A;  3AXC A;  2LGD A;  2WGS A;  4NQK E;  1ZP0 B;  4GLS C;  3QQ8 B;  3S2A A;  1F0Z A;  3KW5 B;  3R3M A;  3DHH C;  1NI3 A;  1JRO A;  3BY4 B;  5E6P A;  1FPY A;  3AEF B;  3AUL A;  1T0S C;  4A9A A;  4DXF A;  1TT5 B;  3AN1 A;  3I3T B;  3P4Q B;  3SHQ A;  2SAK A;  3CIR B;  1N5W A;  1QQR A;  2K3U A;  2KXJ A;  1XO3 A;  1B9R A;  4WJP A;  1FNU A;  3K9O B;  2GB1 A;  1SGH A;  2N4F A;  2ON8 A;  3ETR A;  2MJE A;  3ZRF A;  1I4Q A;  4MJS A;  4FHJ A;  3W5V B;  3WCQ A;  2PVG C;  1GB1 A;  1FNW A;  3AE7 B;  3V61 A;  3VHT C;  1D6E C;  3NZU A;  4HJK A;  4HJG E;  4RF1 A;  4TSS A;  2IPK D;  3MHS D;  3PHX B;  4I6L B;  4KGS A;  4JE3 B;  4FJV B;  1PFD A;  5BYR A;  2DYB A;  5G5G A;  4KZ0 A;  3GP7 A;  5L95 C;  3IAM 1;  2UYZ B;  1NYQ A;  4JWS C;  2Z0E B;  2K8C A;  4HRO A;  4LNI A;  1NEN B;  1R4M I;  2A4Z A;  2PLP A;  3VDZ A;  2M0X A;  3NVV A;  2OJR A;  3DBH B;  3ZNI D;  2LVP A;  2WXM A;  2LGY A;  5CX3 A;  4KGT A;  4KIK B;  4A3O A;  3CMM B;  2WXO A;  2LGX A;  1HZ6 A;  1WXV A;  1WXM A;  3EC8 A;  2HJ1 A;  1MG8 A;  3DBR I;  4OHJ A;  2MP2 B;  2N7D A;  1FRD A;  2MX2 A;  2CHX A;  3IT4 B;  1FMA D;  2NBV B;  4L2Y A;  3VR9 B;  2BYT A;  1UGM A;  3ZXV A;  2RPQ A;  3PZ8 A;  4WJQ A;  1GB4 A;  5T8I A;  2M4N A;  1XD3 B;  3QAR A;  1SJE D;  2ZW1 A;  5IAA C;  2IND C;  1QLB B;  2UU7 A;  2KWD A;  2BQQ A;  2RDB C;  1DOY A;  5BO4 B;  4MH0 E;  1NYR A;  1RAX A;  3RNE C;  3U30 A;  3ONS A;  4HPM B;  2DZI A;  1IPG A;  4GB9 A;  4WH4 A;  2L00 B;  4IDI A;  3EGR A;  1C4P A;  3JSV B;  1SSN A;  4URK A;  1AN8 A;  3MC8 A;  4A90 A;  4A55 A;  1CJE A;  3N1Z C;  3HVZ A;  3FIL A;  3PRP B;  2J4X A;  4DDI D;  1L5P A;  4E3C A;  3APF A;  3URY A;  2WYQ A;  5DPT A;  4GSW A;  1IYF A;  3A33 B;  1WXS A;  4HEA 1;  3VTV A;  1P7E A;  1JW9 D;  3N20 C;  3DHG C;  4C4V A;  2KX0 A;  4L23 A;  2Y5B B;  2BWE S;  2D5G A;  2H88 B;  2N1V A;  3RI7 C;  4ZYS A;  1XCQ L;  2KT7 A;  5LXH A;  5KHQ A;  3KYC D;  2D11 A;  2GMI C;  5AZG A;  2L32 A;  4GXB A;  2PJH A;  2GBN A;  2FNJ B;  1Q0W B;  5CTR C;  5DPW A;  2W55 A;  2K39 A;  3V05 A;  2Y3A A;  4TQ0 A;  1E90 A;  1JWU D;  1FM0 D;  3N1Y C;  4KSL C;  2L05 A;  3DQV A;  1CZP A;  1X1M A;  2QIE B;  1KLG D;  3V3X A;  3X0W A;  3PZ7 A;  3C0R B;  4US8 A;  1WZ0 A;  5H92 C;  1D5M C;  2WS3 B;  4FAD A;  2K5P A;  4MJS B;  1JWA D;  2NS5 A;  4LNO A;  1WGR A;  2KKC A;  4MT5 A;  5HI1 A;  1JRU A;  3AB5 A;  3GOE A;  1ET9 A;  3B9J A;  2O2V B;  3TEW A;  4MSM B;  1G6J A;  4C7Z A;  2KQ7 A;  2NPT B;  1WH3 A;  4XZ4 A;  3WAP A;  1VDV A;  2L52 A;  2NTT A;  4GGQ A;  1S1Q B;  3HIZ A;  1SJH D;  2IO2 B;  2KHW B;  3WAL A;  2GBR A;  2QC8 A;  3AEE B;  2HTH A;  1MPE A;  2NBU A;  5TSS A;  1UNS A;  3NZS A;  3EFC A;  4RF0 A;  3RNB C;  3ABV B;  2CKH B;  3MJW A;  1C78 A;  3QJZ A;  2KQS A;  4M0W B;  2IDY A;  3APC A;  3ZGZ A;  2KLC A;  1EF5 A;  1WI0 A;  3W9C B;  1WM2 A;  1ZW7 A;  1IBX A;  2LUE A;  5DPR A;  1PGX A;  2MBB B;  2KDI A;  3DDC B;  2MJ3 A;  3EFU A;  1EUV B;  3I63 C;  2QIL A;  3VUW A;  2B3A A;  4FUL A;  2GBK A;  2M19 A;  3A9J A;  1NBF C;  4BKS A;  1FD6 A;  1TZ1 A;  2JZP A;  3NVZ A;  3NVY A;  2N9E B;  1ACC A;  1ROE A;  2HTM E;  1P1A A;  3O13 A;  4DQO C;  1BML C;  2AQ3 B;  2YEP B;  2QHO A;  3WAO A;  1JWB D;  1GC7 A;  3V6E B;  5LNK 1;  4I6N B;  4PYZ A;  1E7U A;  3KWV A;  3VRA B;  2AWT A;  2ZPY A;  3ZNG C;  1YN4 A;  4JPS A;  3Q3O C;  1M94 A;  3I57 A;  4A3P A;  2J42 A;  2L0F A;  4BKT A;  3AU5 A;  2V1Y A;  4LNN A;  2C7N B;  4M01 A;  4ICV A;  1KRH A;  3U7Z A;  1WJN A;  4JX1 C;  4EZL A;  1UD7 A;  1E8Y A;  1B1Z A;  1F77 A;  2KTF A;  1MJD A;  1TKG A;  3E9S A;  3PZD A;  1DOX A;  1C79 A;  3PPA A;  3Q3F A;  3GZN I;  1STE A;  3R7R A;  3TUO A;  2N7J A;  5D7G A;  3CWI A;  2BYV E;  3MTN B;  2REX A;  5J17 A;  3QHT A;  3ZW3 A;  2ZPN A;  4HKZ E;  3BYY B;  3HHM A;  3ZKJ C;  2PW9 A;  4USA A;  2M17 A;  1C9F A;  3H9D A;  3SD5 A;  1T0Q C;  4MEL A;  3AE8 B;  4HPP A;  4EE2 A;  1T3Q A;  1C76 A;  3L13 A;  2LXC A;  3N32 A;  2W82 A;  4KKJ A;  4EEW A;  3RCZ A;  1SIJ A;  4K81 A;  2DEN B;  1BXT A;  3EHV A;  3P42 A;  1TKY A;  3C8Y A;  2L1A A;  1HTQ A;  1ISN A;  3VH4 B;  4YTP B;  5L83 A;  1CK1 A;  3PRZ A;  2C7M B;  1WYG A;  4M8M A;  4MGK E;  4HDQ A;  1FRR A;  2BS2 B;  3U7D A;  2J0J A;  3RD2 A;  3KUC B;  1F2R C;  1I4G A;  2H89 B;  1C4A A;  3MC0 B;  5LLI A;  3RN9 C;  4LLG M;  1EU4 A;  3R2I A;  1VZ8 A;  1L4D B;  1K52 A;  4OZB A;  2Z8L A;  1K51 A;  4BOS C;  4PS3 A;  4HKQ A;  2KVZ A;  4HVB A;  4M02 A;  2W9N A;  2XK5 B;  5H8Y E;  2ZNV B;  5DPS A;  1F52 A;  2M56 B;  4N9F 4;  4BKG A;  1QOB A;  2OED A;  2OOB B;  2L3Z A;  3SFD B;  1YJI A;  3L0W B;  1AYF A;  4IKG A;  1CMX B;  4YT0 B;  4ZHO A;  3RFZ B;  4E74 A;  1WE7 A;  3BZD B;  1MFW A;  2W3R A;  2BT6 A;  2IO1 B;  4ANW A;  3H7S A;  1GOZ A;  3W5U B;  4F1S A;  1RFK A;  3TEX A;  4KDL B;  1KLU D;  1OQQ A;  1WE6 A;  4PS8 A;  4LNF A;  1IGC A;  3TSS A;  3AU4 A;  4PT5 A;  2V3N A;  2AQ2 B;  4IC7 B;  3UIP B;  3RT3 B;  1TS5 A;  2R2O A;  1TTN A;  4MSQ B;  3Q69 A;  3VFK A;  5J2R A;  1WGD A;  1IUE A;  3PLV A;  4N6E B;  2K25 A;  3H6N A;  1QOA A;  3AV8 A;  2MA9 B;  2ACZ B;  4GOC A;  4W9F A;  2L8J A;  1TIF A;  1WRI A;  2CJO A;  3P63 A;  1XF5 L;  2KWV B;  3ZIM A;  2MP2 A;  4B95 A;  1YQ3 B;  4ICU A;  2LZ6 A;  5AZH A;  2KFK B;  4ANV A;  1FXA A;  1HQR D;  3ZJT A;  2J7Q B;  2WDQ B;  1FXT B;  1P98 A;  3AI5 A;  2INP E;  3P2B A;  3QIJ A;  1A70 A;  4E71 A;  3PV1 A;  3CSF A;  5E6N A;  4EKU A;  3L54 A;  4MGZ E;  2KN4 A;  2KDM A;  3AH7 A;  4AUQ C;  4CYE A;  3Q3M C;  1V8C A;  2MCN B;  2NMQ A;  1WJ6 A;  2JT4 B;  2MWS B;  4OVV A;  4KIK A;  2W3S A;  4AOF A;  1GPX A;  3M62 B;  1KOT A;  1EWC A;  4BBN C;  1JQ4 A;  2IBI B;  3V60 A;  1UH6 A;  2QCZ A;  4O1N A;  2PE9 A;  4IWO A;  3MFG A;  3AEA B;  1P3Q U;  3VRB B;  2DYO A;  2AL3 A;  2KMA A;  3IAS 1;  3AEB B;  1WX8 A;  2PPH A;  1JRP A;  1MHX A;  3EEC A;  2N1W A;  1PGB A;  3NVW A;  1ESF A;  1H4R A;  1ZUD 2;  1ZXH A;  4W9J A;  3VXW A;  1YN3 A;  1SIF A;  2DYM A;  4EOY A;  2KAC A;  1L6V A;  2AYO B;  4HCN B;  1RYJ A;  4LNK A;  5C23 A;  2JXX A;  3N1X C;  3HRD D;  2N7E A;  3TJP A;  3EUB 2;  3T8M A;  5JHB A;  4M8N A;  3KUD B;  5HG2 A;  4CQN A;  2IGH A;  2AX5 A;  2JX5 A;  3NY5 A;  1XCT L;  2LGI A;  5FK9 C;  2N9P C;  4NAW A;  4YWG G;  2WX1 A;  3SR6 A;  1WSP A;  1NEK B;  2K22 A;  3J9C A;  4OZC A;  2KJH B;  1WGY A;  4XWW A;  1VD2 A;  3VR8 B;  2CJN A;  1E7P B;  5CHV C;  4HCP B;  2FE8 A;  3U8Z A;  1FFV A;  3HM3 A;  2BB5 A;  2BW2 A;  4RGO S;  1EU3 A;  1UZX B;  2WHI A;  1E6E B;  3QX1 A;  3GE3 C;  4EZK A;  3LDZ E;  4REZ A;  1KLV A;  1XT9 B;  2ZJD A;  2XK5 A;  3ZJV A;  4HDO A;  1UWM A;  3KVF B;  2LJ5 A;  1QZE A;  3RUI B;  3PSE B;  1Z5S B;  4C00 A;  2MSE D;  3AED B;  5I4D A;  3VAW A;  1HA5 A;  2JRI B;  1R4N I;  4M0W A;  4NAW B;  4FLH A;  1VZ7 A;  2XBB C;  4MGI E;  1WXQ A;  4GDL B;  4JWU C;  2K1F A;  1TY2 A;  1LM8 B;  3QA8 A;  4K7U A;  3UGB B;  2G9H D;  2FCQ A;  1LFD A;  3D32 A;  1E7V A;  3A9K B;  3ENE A;  4ITK A;  1L7Y A;  2WXH A;  2JUO A;  2I2Y A;  1PYW D;  1CQV A;  5FR6 A;  3DVG X;  4F7Z A;  3RNG C;  1QIL A;  2BF8 B;  2LD9 A;  4G11 A;  4ZRP A;  3HK0 A;  3KLS X;  4HK2 A;  2XN9 C;  3OJ3 A;  4S0R A;  2PVO D;  1J0G A;  2JYE A;  4JGH B;  4BFR A;  3MJ5 A;  3Q8A A;  3U4E G;  2IYD B;  5BMG A;  2N9X A;  2YLM A;  1HE8 A;  3BVZ A;  4IUM B;  3VUX A;  2WXJ A;  4NJ7 A;  2V3P A;  2X8X X;  2RR9 A;  5AUI A;  2LEK A;  4WUR A;  3CF6 E;  4ZOH C;  1I7H A;  1EO6 A;  4ZRK A;  1C77 A;  4ZRJ A;  1I35 A;  3BVM A;  2CU1 A;  4FHK A;  1Q1O A;  1ZGU B;  4WAA A;  4P16 A;  1C4C A;  2GOW A;  2BYE A;  1S3S G;  2KLG A;  2V9H A;  2PE6 B;  1E10 A;  4NY0 A;  1P7F A;  1WGH A;  1Y56 A;  4OVU A;  3AE9 B;  4CHK A;  4IG7 B;  1IGD A;  1D3Z A;  1SE4 A;  3RYT A;  4W9C A;  1AAR A;  2KAN A;  4KKI A;  3ZDT A;  2EKI A;  1V97 A;  1D4B A;  2VH1 A;  3RPF C;  4W9H A;  4K7W A;  4NJC A;  2KDF B;  2VZK B;  3ALB A;  3DBH I;  4YTM B;  2L76 A;  3EA6 A;  1N62 A;  5GMV A;  2LRU A;  1ET6 A;  2C60 A;  5D3D A;  3OWE B;  4WQO B;  2WXG A;  3BWU D;  2LFI A;  3TBL D;  4XDD A;  1GC6 A;  1LO5 D;  4BZA A;  2KTR A;  1FO4 A;  4BVU C;  2WXR A;  1V1P A;  2EKE C;  1M4V A;  4DHZ E;  2PTL A;  4TV3 A;  1XXG A;  1ZDX A;  2DZK A;  2LJI A;  3SEB A;  4YXD B;  3R2T A;  2G3Q B;  1WZ3 A;  2KNB A;  4TQ1 A;  1SF0 A;  4W9E A;  3B08 A;  2BKR B;  3ECI A;  2KOX A;  2ZEQ A;  5AZF A;  3HUI A;  2LVO A;  3IHP C;  3T3N A;  3VH3 B;  1AW7 A;  3BVG A;  1KF6 B;  3AE1 B;  4YSZ B;  3P4P B;  3U52 E;  4PYU A;  2V4I B;  1YX6 B;  3V62 A;  5HHD G;  4AWJ A;  5AEK B;  2LGS A;  4XX5 A;  4RGT A;  2OHF A;  5IP4 D;  3NG0 A;  1E9M A;  1D5Z C;  1U4A A;  1YIW A;  3VUY A;  1Y8R C;  2LHD A;  2D3G A;  2Y5P A;  1R4N B;  1T5X D;  5EE9 A;  1WR6 E;  2WU2 B;  3PVL A;  2BGF A;  4WIP A;  2IGG A;  1SB3 C;  2D07 B;  4WWN A;  3M3J A;  1ZOY B;  4RNA A;  4IW0 A;  3E56 A;  5IA7 A;  1TJE A;  2MBO A;  2XNA C;  2WDT B;  2MBH A;  2JZ3 B;  3AE5 B;  2KVR A;  4M00 A;  4I6P A;  4LDT B;  2LVQ A;  3Q14 C;  3MHZ A;  4HPL B;  2EEL A;  2ICI A;  1K8R B;  2Y5C A;  1SBB B;  4G3X B;  1P9D U;  2GI9 A;  1VCB A;  2CU3 A;  5MPO A;  3TMP B;  4WAF A;  2N9L A;  2J53 A;  2MLB A;  5HKH A;  3A1Q A;  3IG3 A;  1V1P B;  3U2S C;  1GJZ A;  1WX9 A;  2NBW B;  2O6V B;  4DK5 A;  3A4S C;  5J18 A;  2C9W B;  2JZZ A;  3ZYY X;  2G1E A;  5BMI A;  4JLC A;  3QAQ A;  3UF8 A;  4KDI C;  5JHA A;  3LB8 C;  4K3C A;  2L83 A;  4H2A A;  4ZRI A;  2KYW A;  1AWD A;  2I1K A;  1HXY D;  1XLO A;  2BTE A;  1WFY A;  3IFW B;  1N6Z A;  1N5X A;  1QF6 A;  2Q5W D;  3W1Y A;  3C19 A;  3ZLZ A;  1BUI C;  2ASQ A;  3ZNH B;  3Q8E A;  1GNU A;  2Z59 B;  2KDE B;  4K7S A;  1PGA A;  3PT2 B;  3NS1 A;  1OTR B;  4HLE A;  1K50 A;  1RRB A;  5C2T B;  1FIQ A;  3HM6 X;  4IOI E;  2O6V A;  4ANU A;  4IWQ A;  4LCD E;  5IOI A;  2K8B A;  3TEY A;  3K9P B;  2DX5 B;  4B9K A;  2J52 A;  2ZCB A;  2FIF A;  2A5U A;  1H8C A;  1EM7 A;  3P4S B;  3N3K B;  2MBQ A;  4P1B C;  4FA6 A;  1L2N A;  2EMS A;  1YD8 U;  4ZYN A;  4FJZ A;  3AE4 B;  2NR2 A;  3TEZ A;  3H1U A;  4WWO A;  4TMA B;  3MC9 A;  1YJ1 A;  1ZDV A;  1D5X C;  1V5O A;  1DOI A;  1UBI A;  3AE2 B;  4KV2 A;  3DPD A;  3WIM A;  1MHH E;  3DHI C;  3MP9 A;  1E5W A;  4KX6 B;  1ZPS A;  3T9L A;  2ZZP B;  3ZDM C;  4PK1 A;  1I4X A;  3V6C B;  2JYT A;  1L0X B;  5GXG B;  3NZ3 A;  4OVZ A;  3H8H A;  4DHZ B;  4QAY A;  3PRM B;  3ZJU A;  2DAJ A;  1DYQ A;  4C80 A;  1T0R C;  2EMT A;  4L1B A;  4IM0 A;  1P0R A;  4GDK A;  4BKS D;  4LTU A;  4P7I A;  4FJY A;  2MH7 A;  5E6O A;  3AM9 A;  1E8Z A;  1OEY J;  4DXA B;  3W1S C;  4WWM A;  5HFY A;  2WP9 B;  4LJP B;  1MVK A;  1Z2M A;  4XYC A;  2HDE A;  2E3T A;  4KZC A;  2KFK A;  3DVN U;  1OFF A;  2QDF A;  4ZDV A;  1TYG B;  4YL8 A;  1TS3 A;  3W2D A;  1UWX A;  3DCG A;  3IT6 B;  5JZE B;  1L4Z B;  4B6W A;  2AL6 A;  3PLU A;  1SXT A;  2WXI A;  1LXD A;  2QEJ C;  3Q8C A;  3GZN B;  2HD5 B;  2RPV A;  2GLS A;  3I5J C;  1LGR A;  3R8B A;  2KQ4 X;  4MEM A;  4XDC A;  1WRD B;  4N58 A;  2IZV B;  1XQQ A;  1KJT A;  4RH6 A;  2I38 A;  1UF0 A;  3AE6 B;  1PDX A;  1L0Y B;  3QK0 A;  2BB6 A;  4ARC A;  1T6B X;  2ONQ A;  1YQ4 B;  3RZF A;  2DNF A;  2MEK A;  1V81 A;  1E8W A;  1F9J A;  2YEP F;  3UQB A;  3Q2A C;  4KSK C;  2WQY B;  3H7P A;  3BK1 A;  4DHJ B;  3KUZ A;  4AJW A;  2ZW0 A;  2DZJ A;  1F1H A;  3A9J B;  4MH8 A;  5AUK A;  4NQL B;  3W1S A;  1WJ4 A;  2JF5 A;  4A20 A;  4ASW C;  1TGZ B;  1E0Z A;  2LRW A;  1UEL A;  5D6J B;  2B76 B;  1K53 A;  1BT0 A;  3GB1 A;  2PEA A;  3B2G A;  2KDB A;  1V9J A;  2INN E;  4B0E A;  1YMH E;  1TS2 A;  1VJK A;  4GMV A;  4WJN A;  4LDT D;  2M0A A;  3SU8 X;  2IO3 B;  4WWP A;  3ZQ4 A;  3JYU A;  2K6D B;  2MRP A;  3PGE A;  4J6I A;  2BYF A;  2KK8 A;  3QWZ B;  4CO7 A;  1YNT E;  3JSV A;  4BBN F;  3QCA A;  3RNF C;  3L08 A;  1VR9 A;  2BVC A;  4YTN B;  3NRZ A;  4OW0 A;  1J7A A;  4K1R B;  4XWT A;  2FAZ A;  4LK0 M;  4EFO A;  3R66 C;  4II2 B;  2Z0D B;  1Q5W B;  3ZO5 B;  2HJ8 A;  2BBC A;  1V5T A;  2FBW B;  1N60 A;  1XLN A;  2WXN A;  2RGF A;  1WX7 A;  2G45 B;  1UUP A;  1WIA A;  4HXD A;  4DXG A;  1MI0 A;  2K8H A;  3A1Q B;  1YN5 A;  2ZNV C;  1JCK B;  5FKA C;  3Q8B A;  1JAL A;  4TUU A;  4AJY B;  4P1C C;  3B2F A;  2V4L A;  1JWS D;  3N30 A;  1GAQ B;  2O6V D;  1WM3 A;  3ZVV A;  2BS4 B;  4BAX A;  4ACF A;  1WWT A;  1V86 A;  4IWP A;  2ZVN A;  2C7H A;  4KVG B;  4NJ6 A;  1WY8 A;  4G0N B;  1WR1 A;  4AP4 C;  1PUT A;  1V80 A;  4A8X C;  1V2Y A;  4GIV A;  3RUL A;  4GU2 A;  1C3T A;  3PO0 A;  3BII D;  4ANX A;  2JRH A;  2NCN A;  4NNJ B;  3ZRC A;  2LAS A;  3BIN A;  1L6U A;  2N9K A;  2IY0 B;  4NPN A;  3NOB A;  4KGR A;  1WXA A;  2YVC A;  3AEG B;  4C56 C;  2D3A A;  2KN5 A;  3TL5 A;  2PKO A;  2KAJ A;  1GUA B;  3RMK C;  2WXK A;  1E8X A;  2DZM A;  1UBQ A;  2BS3 B;  4K3B A;  2WWZ A;  2PIA A;  2C5L C;  4Q2J A;  2DAF A;  3RNC C;  4EZJ A;  2KJR A;  1HTO A;  2D3C A;  5JXV A;  2UWQ A;  2V3S A;  3DVG Y;  3VTU A;  4DDG D;  4US9 A;  2IO0 B;  1WGG A;  3L17 A;  2MBE A;  5BMH A;  4TKN A;  2JVC A;  2WDR B;  1QOF A;  3RNA C;  4ZHP A;  4IM3 A;  3P1M A;  3IXS A;  3VTW A;  3RZW C;  2JWU A;  2LMC A;  1L0V B;  2RMM A;  2M1M A;  2W54 A;  3OAW A;  2IJ0 A;  1JWM D;  1RM6 C;  1YQB A;  2G4D B;  3TIX A;  5CHW A;  3X23 A;  3H7P B;  3FC4 A;  2JXT A;  5E6J A;  1J19 A;  3LJ3 A;  5EE0 A;  3NS8 A;  4RFB A;  2DLB A;  2JWZ A;  2CHZ A;  1FCL A;  1DGJ A;  1ZE3 D;  5IO9 A;  1J7C A;  1WYW B;  1LQB A;  4D2K A;  2LI5 A;  4JIO U;  5EE1 A;  1I42 A;  3PHW B;  4NAM A;  4RM9 A;  1F2R I;  5D2M B;  1N61 A;  3Q3N C;  2KO3 A;  3Q8F A;  2JQR B; 
#chains in the Genus database with same CATH homology
 2KWD A;  4H2A A;  1OQR A;  2VZK D;  1DOY A;  1AWD A;  1HXY D;  1XLO A;  3KWL A;  2BTE A;  4MAC A;  1NYR A;  1QF6 A;  1N5X A;  2Q5W D;  2KN4 A;  2KDM A;  3AH7 A;  4N59 A;  1BUI C;  3Q8E A;  2IGD A;  1HEZ E;  4WH4 A;  2QJL A;  4IDI A;  3EGR A;  1C4P A;  1PGA A;  1SSN A;  1V8C A;  1XLQ A;  1AN8 A;  2DWQ A;  4A90 A;  4A55 A;  2NMQ A;  3NS1 A;  4UDU C;  1CJE A;  3DWG C;  1K50 A;  2W3S A;  5C2T B;  3HVZ A;  3FIL A;  2J4X A;  1FIQ A;  4IOI E;  2WLB A;  1L5P A;  1GPX A;  1EWC A;  3URY A;  1JQ4 A;  3AEC B;  3TEY A;  4HEA 1;  1XLP A;  4O1N A;  2J52 A;  1P7E A;  1JW9 D;  3MFG A;  3AEA B;  3VRB B;  2GRI A;  1ENF A;  4L23 A;  1EM7 A;  4GDK B;  3P4S B;  2DYO A;  1I4R A;  2D5G A;  2H88 B;  3IAS 1;  3AEB B;  4RCO A;  2JSV X;  3P4R B;  4ZYS A;  1XCQ L;  1JRP A;  3AE4 B;  3TEZ A;  1MHX A;  1PGB A;  3L4P A;  3NVW A;  1ESF A;  2LHE A;  4TMA B;  1ZUD 2;  1ZXH A;  1ZDV A;  2L32 A;  1D5X C;  2N0S B;  1DOI A;  1YN3 A;  2DYM A;  3AE2 B;  2KAC A;  1L6V A;  1MHH E;  2W55 A;  3MP9 A;  4KX6 B;  1RYJ A;  3FIL B;  1ZPS A;  3UI3 A;  3V05 A;  3HRD D;  3NUH B;  4R3D A;  2Y3A A;  4TQ0 A;  1I4X A;  1J7B A;  3EUB 2;  2JYT A;  1L0X B;  2FUG 1;  1JWU D;  1WGK A;  5GXG B;  3NZ3 A;  4OVZ A;  1FM0 D;  3H8H A;  3ZJU A;  5HG2 A;  3LXF A;  2MJD A;  1DYQ A;  2IGH A;  2AX5 A;  2JX5 A;  1CZP A;  5EE3 A;  4C80 A;  4CQN A;  4L1B A;  1FFU A;  2QIE B;  1KLG D;  3V3X A;  3HVD A;  1XCT L;  3PZ7 A;  4LTU A;  2LGI A;  5FK9 C;  4YWG G;  4US8 A;  5BYQ A;  2MH7 A;  3SR6 A;  1WSP A;  1IBX B;  5H92 C;  1D5M C;  2RDH A;  2WS3 B;  1NEK B;  3AE3 B;  2K22 A;  3AM9 A;  2K5P A;  2TSS A;  3J9C A;  1NVI D;  1JWA D;  2E6X A;  4OZC A;  4AS1 A;  4XE0 A;  4XWW A;  4MT5 A;  4C7Y A;  3VR8 B;  4OZA A;  5HI1 A;  2CJN A;  1E7P B;  3AB5 A;  4WWM A;  2R61 A;  5HFY A;  1ET9 A;  2FE8 A;  2WP9 B;  3DWM A;  3B9J A;  1MVK A;  2DBY A;  3TEW A;  2HDE A;  2WDV B;  2X38 A;  4C7Z A;  2E3T A;  1KH0 A;  1FFV A;  1VDV A;  2L52 A;  2NTT A;  2BB5 A;  2BW2 A;  1XEE A;  4RGO S;  2AQ1 B;  2WXF A;  1TZO A;  1OFF A;  1EU3 A;  2WU5 B;  1E6E B;  1SJH D;  1TYG B;  4REZ A;  4RGM A;  1FXI A;  1TS3 A;  1Q10 A;  3W2D A;  1UWX A;  1RWS A;  3AEE B;  3IT6 B;  4YSX B;  1L4Z B;  1MPE A;  3ZJV A;  1UWM A;  1SXT A;  1UNS A;  5TSS A;  2WXI A;  4RF0 A;  2QEJ C;  3ABV B;  3Q8C A;  1C78 A;  2RPV A;  2QSD A;  3GS2 A;  2PMV A;  2IDY A;  3R8B A;  2KQ4 X;  3AED B;  1VZ6 A;  4XDC A;  3ZGZ A;  4N58 A;  3BYT B;  5I4D A;  1V1O A;  2QMT A;  1HA5 A;  2WXQ A;  5C3J B;  4RH6 A;  4M0W A;  4NAW B;  3W9C B;  2I38 A;  2SEB D;  1VZ7 A;  3AE6 B;  1PDX A;  1L0Y B;  2NTS A;  1IBX A;  2BB6 A;  5BYS A;  5FR3 A;  4ARC A;  1T6B X;  1PGX A;  3VQI A;  1WXQ A;  2ONQ A;  1YQ4 B;  4GDL B;  4JWU C;  1TY0 A;  2MJ3 A;  5D3I B;  2MEK A;  1SE3 A;  1UGJ A;  2QIL A;  1TY2 A;  2YEP F;  2WQY B;  3BK1 A;  2G9H D;  2M19 A;  2ZW0 A;  2JU6 X;  1SE2 A;  1FD6 A;  2JZP A;  3NVZ A;  2RDG A;  4MH8 A;  5AUK A;  2V0G A;  4WQM A;  4ITK A;  4YSY B;  1KTK A;  1VLB A;  2WXH A;  3NVY A;  3W1S A;  1ACC A;  1ROE A;  1VRA B;  2I2Y A;  1N63 A;  1PYW D;  2HTM E;  3O13 A;  1CQV A;  3I9V 1;  4ZRQ A;  4DQO C;  1BML C;  1FNV A;  1QT9 A;  2AQ3 B;  1QIL A;  2YEP B;  1TS4 A;  1E0Z A;  4ZRP A;  3KLS X;  1JWB D;  2XN9 C;  3SFE B;  5LNK 1;  2B76 B;  2PVO D;  1K53 A;  3GB1 A;  2JYE A;  3B2G A;  2K9X A;  3KWV A;  2INN E;  3MJ5 A;  3Q8A A;  3VRA B;  3N9Y C;  4B0E A;  1YMH E;  1TS2 A;  1VJK A;  3U4E G;  5BMG A;  1ZXI A;  1I4P A;  1HZ5 A;  3BVZ A;  2M0A A;  2WXJ A;  1QOG A;  1YN4 A;  2V3P A;  1EWY C;  4AQ7 A;  5AUI A;  2KMM A;  2LEK A;  4JPS A;  4WUR A;  3ZQ4 A;  3BK2 A;  4ZOH C;  1I7H A;  3I57 A;  4B0M A;  2J42 A;  3LYY A;  1FEH A;  4A6Q A;  1YNT E;  1C77 A;  2K0P A;  1SEB D;  3BVM A;  4FXC A;  1VR9 A;  4P16 A;  4J3O D;  2WNM A;  4YTN B;  1C4C A;  2WXP A;  4HRS A;  3NRZ A;  4OW0 A;  1KRH A;  1E10 A;  1J7A A;  3U7Z A;  4JX1 C;  4XWT A;  1P7F A;  1Y56 A;  4NZL B;  3AE9 B;  1B1Z A;  1F77 A;  4LK0 M;  1IGD A;  4RGN A;  1TKG A;  3E9S A;  2BBC A;  1SE4 A;  5G5H A;  2FBW B;  1DOX A;  4P6V F;  1N60 A;  1XLN A;  2WXN A;  4KKI A;  1C79 A;  1STE A;  1UUP A;  3TUO A;  2N7J A;  2EKI A;  4ARI A;  1V97 A;  3AMZ A;  5D7G A;  1D4B A;  1I4H A;  4DXG A;  1MI0 A;  3FAH A;  1KFY B;  4MM3 B;  3RPF C;  3CWI A;  1QKZ A;  1YJJ A;  4NJC A;  2WXL A;  1YN5 A;  2VZK B;  3KQ4 A;  1JCK B;  4HKZ E;  3BYY B;  5FKA C;  2PW9 A;  4YTM B;  3Q8B A;  4USA A;  1C9F A;  1JAL A;  3EA6 A;  1N62 A;  3B2F A;  1ET6 A;  5D3D A;  1JWS D;  1GAQ B;  3OWE B;  2LUM A;  2WXG A;  3AE8 B;  4EE2 A;  3BWU D;  1T3Q A;  1C76 A;  2LFI A;  2BS4 B;  1FCC C;  4KKJ A;  1WWT A;  2W82 A;  4XDD A;  1SIJ A;  1LO5 D;  1JML A;  1FO4 A;  2WXR A;  1BXT A;  1V1P A;  1M4V A;  3P42 A;  2PTL A;  1TKY A;  3C8Y A;  1XXG A;  2L1A A;  1ZDX A;  1R7S A;  2LJI A;  1TKE A;  3SEB A;  4YXD B;  4YTP B;  3T3O A;  3R2T A;  1PUT A;  1CK1 A;  1WYG A;  4A8X C;  4TQ1 A;  1SF0 A;  3PO0 A;  1ZP0 B;  4GLS C;  1FRR A;  2BS2 B;  3BII D;  1F2R C;  1F0Z A;  1I4G A;  2H89 B;  1C4A A;  3HUI A;  1NI3 A;  1JRO A;  3MC0 B;  4LLG M;  3T3N A;  1L6U A;  2N9K A;  4KGR A;  1EU4 A;  3R2I A;  1VZ8 A;  1AW7 A;  1K52 A;  1L4D B;  2Z8L A;  1KF6 B;  3AEF B;  3AE1 B;  1K51 A;  3BVG A;  3P4P B;  4OZB A;  4YSZ B;  3AEG B;  3U52 E;  4C56 C;  4HKQ A;  4A9A A;  4DXF A;  3AN1 A;  2V4I B;  3P4Q B;  2PKO A;  2SAK A;  2KAJ A;  5HHD G;  2WXK A;  3CIR B;  1N5W A;  1QQR A;  5H8Y E;  4RGT A;  2BS3 B;  2K3U A;  1XO3 A;  2OHF A;  1B9R A;  1FNU A;  2PIA A;  2GB1 A;  2M56 B;  1E9M A;  1D5Z C;  4Q2J A;  2LHD A;  1QOB A;  2OED A;  2ON8 A;  2Y5P A;  5JXV A;  3ETR A;  2MJE A;  1T5X D;  5EE9 A;  2WU2 B;  3SFD B;  1I4Q A;  1YJI A;  1AYF A;  4IKG A;  4YT0 B;  3W5V B;  3WCQ A;  4ZHO A;  2PVG C;  1GB1 A;  3RFZ B;  3BZD B;  4WIP A;  1FNW A;  2W3R A;  2IGG A;  4US9 A;  2BT6 A;  3AE7 B;  1SB3 C;  1GOZ A;  3W5U B;  1RFK A;  3TEX A;  1ZOY B;  1D6E C;  1KLU D;  1OQQ A;  4HJG E;  4RF1 A;  4TSS A;  2IPK D;  4RNA A;  3E56 A;  5BMH A;  4KGS A;  4JE3 B;  1TJE A;  2WDR B;  1PFD A;  2XNA C;  1QOF A;  5BYR A;  4ZHP A;  1IGC A;  3TSS A;  5G5G A;  3GP7 A;  4PT5 A;  3P1M A;  2V3N A;  2AQ2 B;  3IAM 1;  4JWS C;  1NYQ A;  3IXS A;  1TS5 A;  2JWU A;  2LMC A;  3AE5 B;  4HRO A;  1L0V B;  2RMM A;  1NEN B;  2W54 A;  3Q69 A;  2PLP A;  3NVV A;  3MHZ A;  2WXM A;  2IJ0 A;  1JWM D;  1RM6 C;  2EEL A;  1IUE A;  4KGT A;  2ICI A;  2WXO A;  3FC4 A;  4N6E B;  2JXT A;  1HZ6 A;  5E6J A;  2Y5C A;  1SBB B;  1QOA A;  3AV8 A;  5EE0 A;  2ACZ B;  4OHJ A;  2GI9 A;  1WRI A;  2CJO A;  2DLB A;  3P63 A;  4RFB A;  1FRD A;  3IT4 B;  1XF5 L;  1FCL A;  1DGJ A;  1FMA D;  1ZE3 D;  2CU3 A;  4L2Y A;  5MPO A;  3VR9 B;  4WAF A;  2BYT A;  2N9L A;  2J53 A;  1J7C A;  1YQ3 B;  4D2K A;  5EE1 A;  3U2S C;  1V1P B;  4NAM A;  1FXA A;  1HQR D;  3PZ8 A;  3ZJT A;  1F2R I;  1GB4 A;  5T8I A;  3ZYY X;  2WDQ B;  2G1E A;  5BMI A;  1N61 A;  1SJE D;  2INP E;  2ZW1 A;  1QLB B;  3LB8 C;  3Q8F A;  2JQR B;  2L83 A;  1A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...