1PGXA

The 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
ELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEMVTEVPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
publication title 1.67-A X-ray structure of the B2 immunoglobulin-binding domain of streptococcal protein G and comparison to the NMR structure of the B1 domain.
pubmed doi rcsb
source organism Streptococcus
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1992-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgxA00
2IGDA 2JWUA 1D4BA 2JXTA 2KDMA 5HI1A 1K51A 1F2RC 3FILA 2PLPA 2KACA 4MACA 2J52A 1K53A 1PGBA 5BMIA 1PGXA 2JZPA 2K0PA 4KGRA 4WH4A 3V3XA 3FILB 2IGHA 1UWXA 4OZAA 1XCQL 5BMHA 4KGSA 1F2RI 2ON8A 1XCTL 2GB1A 1MPEA 1YMHE 2I38A 1YNTE 2OEDA 2KN4A 1JMLA 1HEZE 2QSDA 2N9LA 1FCLA 1IGCA 1EM7A 2GI9A 1C9FA 4IOIE 1ZXHA 4GLSC 2LHDA 1Q10A 2EELA 1MI0A 2RMMA 2KWDA 3UI3A 3GB1A 2PTLA 2IGGA 4HKZE 2N9KA 2KQ4X 4KGTA 1IBXA 1KH0A 2QMTA 3MP9A 1MHHE 2LUMA 2LHEA 2PW9A 4IKGA 2ZW0A 4HJGE 4OZBA 1K52A 1MVKA 1MHXA 2N7JA 2RPVA 2ONQA 1P7EA 2LGIA 2NMQA 5HG2A 1IGDA 5BMGA 1P7FA 1HZ5A 1XF5L 2JSVX 2JU6X 5HHDG 1PGAA 1K50A 1GB4A 5JXVA 2I2YA 5HFYA 1QKZA 1FD6A 1IBXB 2J53A 1HZ6A 4D2KA 2ZW1A 4OZCA 1FCCC 1GB1A
chains in the Genus database with same CATH superfamily
1KM7A 3AE3B 3SDLC 2DZKA 2JXTA 1KOTA 3N1XC 2IJ0A 2KACA 1ET6A 4MT5A 4NZLB 3HHMA 2MEKA 3U52E 3MFGA 2JZPA 2K0PA 2JWZA 4ICVA 4KZCA 3KW5B 2KC2A 1ET9A 2HTHA 2CHWA 1ISNA 1L4ZB 2INPE 2K8HA 2ZVNA 2IYDB 4H2AA 5CHVC 1RWSA 2FIFA 2KK8A 2TSSA 1JWSD 4C7ZA 2O6VD 4Q2JA 5AUKA 1VCBA 2LGSA 3MHSD 1N5WA 4HK2A 2EELA 2MW5A 5D2MB 1NYRA 1M4VA 2WXIA 1ACCA 4MEMA 3A1QB 3R7RA 3URYA 3MHZA 2OOBB 3A4RA 4US8A 3RN9C 3E56A 2LHEA 4PK1A 3ZXVA 5IP4D 2M17A 2ZNVC 1FIQA 2KWUB 4JL9A 4YTNB 2N9PC 2REXA 2KDEB 1WXMA 3HIZA 2R2OA 5LNK1 1L0YB 4HPPA 2HD5B 5AZHA 4EUTA 2J0MA 1UD7A 3P4SB 4YTMB 1X1MA 3AE6B 5JXVA 3L4PA 2O2VA 3TCAA 3UQAA 2L3ZA 4KDIC 2LEKA 2VH1A 1WE6A 2MCNB 1JWMD 2Z0DB 5G2NA 3LXFA 3PPAA 1IYFA 2MJDA 1VZ8A 4CQNA 3ZTCA 4TSSA 1OEYA 1OQYA 2V1YA 3A1QA 2WXLA 3KUCB 4RF0A 3H9DA 2Z8LA 4DK5A 2BWFA 4K7WA 4PS8A 4KGSA 3VRBB 1JQ4A 1FPYA 3MC9A 3VVWB 2I38A 1MPEA 4BBNC 3DVGY 1LQBA 3QK0A 1RRBA 1WE7A 1L6UA 3DBHB 1PYWD 2LXCA 1V5TA 1T0QC 4JIOU 2K6DB 4P1BC 5AUIA 3I63C 1LM8B 4GDLB 4XYCA 2AL6A 2ZPNA 3S2AA 1QOBA 2MSED 1XEEA 2D5GA 3QHTA 1WRDB 2OHFA 1FMAD 3APFA 4DDGD 1NI3A 5L95C 4KSKC 5CHWA 2WXGA 2KKCA 4KZ0A 3RZWC 3AU4A 4DBGA 1MHXA 2QC8A 3B2GA 1HTOA 4OHJA 1YJJA 3ZYYX 3K9OB 4KSLC 3RD2A 5KHOA 1F77A 3KH0A 2N1VA 3W1SA 4W9FA 3ZGZA 2CR5A 2Z59B 2DZMA 2KFKB 3QAQA 4M01A 3AI5A 4X57B 4FJYA 2QCZA 4BOSC 3L54A 2WP9B 1ZW7A 2GRIA 2C5LC 3U2SC 1SIJA 1JRUA 1I35A 2GOWA 1D5MC 1E7UA 2N9XA 4GDLA 1PGBA 4RF1A 3U7DA 4C4VA 1FFVA 1HQRD 1SIFA 3NVVA 3FILB 1FEHA 2IGHA 4I6NB 1CQVA 3CWIA 1WXAA 2HDEA 4M02A 2XEWA 3LB8C 1E7VA 2B76B 1YOVB 3KYDD 2SEBD 1WR6E 5FK9C 1YQ3B 4FXCA 4MGIE 4ARIA 4URKA 3RNFC 4JPSA 2JVCA 2FNJB 4GLSC 1TIFA 2ZZPB 3PT2B 4PS3A 5T8IA 1NBFC 1V1OA 3ML9A 3SFEB 4BKSA 1M94A 4US9A 1KJTA 1A70A 1E90A 2QMTA 3A33B 4LTUA 2KLGA 1SJED 3WAPA 2EKEC 3EHVA 2KMCA 3V62A 4OW0A 2O6VB 3TMPB 3Q8EA 2FIDA 4DHJD 5D3IB 3IT4B 3ZVVA 2Y5PA 1TZOA 2RPVA 3OG5A 2BKRB 2KNBA 4NQLB 1WGHA 2K9XA 4W9KA 2JUOA 3AE5B 2MBEA 1PGAA 4DHZB 4XWWA 2WHIA 2GBNA 5CTRC 2PEAA 4FN2A 4F8CB 2ZPYA 2PVGC 1D4BA 2KDMA 1N5XA 1D5ZC 2KTFA 4NQKE 2FUG1 2BYFA 3Q8FA 4KIKA 3AN1A 1ZDVA 5BO4B 1K53A 1MFWA 5BMIA 1XLNA 1G6JA 1JWUD 4RH6A 2VH2A 4QAYA 1FXAA 4IWOA 1Q1OA 2HJ8A 2ON8A 2PPHA 1HE8A 1WWTA 2BB5A 4F1SA 5FR3A 3PTFC 2BYTA 2MP2B 2JQRB 2YVCA 1WYGA 1YNTE 3Q69A 1OGWA 3O13A 2K1FA 4AJYB 2WXRA 4A55A 4RGOS 2WXJA 3VH3B 2WXPA 1E9MA 2DYBA 2MJ3A 1SE9A 1ZXHA 4G0NB 2I1JA 4HLEA 1YD8U 5G55A 4ANUA 4FJZA 3ML8A 1MG8A 1I4HA 3R2IA 2DENB 3AU5A 2UWQA 3RNGC 1SE3A 5D6JB 1VLBA 3P4RB 4K1RB 1E10A 1ESFA 3VR9B 4HPMB 4GDKB 4OVUA 3GE8C 2CJOA 2XK5B 5D94A 5E6OA 3ZKJC 3TJPA 4K3CA 2FCNA 3Q8CA 1WFYA 1I4QA 3AEEB 1ZUD2 3RI7C 4XZ4A 2CJNA 1JWAD 4REZA 4EFOA 4BKTA 3U7ZA 3VDZA 4M8NA 2MX2A 3PO0A 4W9JA 1VRAB 1KF6B 5BYQA 4B95A 3V6CB 3NRZA 2OJRA 4C00A 4EZLA 3ZO5B 4CO7A 3SHQA 4JX1C 1FCCC 3RZFA 3IBEA 3RNAC 4E74A 1V8CA 2KT7A 3R7QA 2BT6A 2J52A 1UH6A 2ASQA 4AS1A 4JLCA 5LXIB 2WDRB 3DBSA 3ZW3A 2JX5A 3ZTDA 1J7CA 2KX3A 4ICUA 5DPTA 2NPTB 3HM3A 3EGRA 4RM9A 4GDKA 4BKGA 3R66C 3OWEB 4GSWA 4ACFA 1SF0A 2OEDA 2V3PA 4N58A 1V97A 2L76A 2K8BA 2IDYA 1C79A 2KQ7A 3DBRI 4BBNF 5IO9A 1V2YA 1TS4A 3MTNB 3BZDB 5G5HA 1E5WA 1WJ6A 3HVDA 4M0WA 4LNIA 5C1ZA 1TYGB 1KTKA 1H4RA 2IZVB 3T9LA 5EE1A 4HKZE 2WXFA 2N9KA 2FAZA 3NHEB 3TIXA 1Y8RC 1T6BX 3IAS1 1JRPA 2NCNA 2ZW0A 2KC1A 2BBCA 2GBKA 2K5PA 3T8MA 3TBLD 2ZNVB 2WNMA 1P7EA 1WI0A 4JWSC 1WY8A 3DVNV 2JSVX 4WQMA 4EKUA 2VZKD 4P16A 1TZ1A 2KDIA 3AB5A 2MQJA 4AOFA 3QC8B 4DHJB 3L08A 3TEYA 3VAWA 4YWGG 2EMTA 4MH0E 3C0RB 3R2TA 4ZRQA 5IA7A 2IGDA 1WGGA 1YJ1A 4TMAB 4RCOA 2D3CA 2CU3A 1JROA 1SXTA 2SAKA 2PLPA 2W54A 4M8MA 1WX9A 2LASA 1L7YA 4RGTA 2KO3A 2WX0A 4MM3B 4S0RA 4CYEA 3TEXA 4FULA 2AL3A 3AXCA 5BMHA 5BYSA 3PV1A 4NJ7A 3A9KA 4N59A 5IKCM 2QHOA 4LNFA 1JCKB 1FCLA 3TEZA 3FKYA 2WU2B 2W82A 4LDTB 1HTQA 2D3AA 3VUXA 2HE7A 3MJ5A 5EE0A 4P1CC 3KLSX 2KAJA 3PSEB 1TKYA 3BYYB 4B0EA 4XGAB 2LMCA 4KKJA 2MHJA 1T0YA 2JT4B 3SFDB 3V05A 4E71A 3ZNID 4GIVA 1ZDXA 1N6ZA 4GB9A 2G4SA 1TS2A 3NZ3A 1OFFA 1WJ4A 3CIRB 4OZBA 2M4NA 1ROEA 1DOXA 2N7JA 3GS2A 1GC7A 3QCAA 3AECB 2WYQA 4ZRJA 1WX8A 3AEGB 2LGIA 2WDVB 1U4AA 4N9F4 3B1LX 2PE6B 1UBIA 1MG4A 4S17A 1Q5WB 1D3ZA 2LRWA 1YQBA 2RDHA 1LGRA 1HZ6A 1CZPA 1S1QB 3JSVB 4OZCA 3TSSA 1QQRA 2FBWB 2PIAA 1MJDA 2E6XA 2W3SA 3IT6B 1FFUA 5C3JB 3N1YC 1TT5B 3W5UB 3U8ZA 2L1AA 3PVLA 3NOBA 1F2RI 3CSTA 2RGFA 2CKHB 3WAMA 1R4MI 3PRZA 2BKFA 1YMHE 1WJUA 4N6EB 2ZVOA 1IGCA 1EF1A 2QIEB 1R4NI 3ZDMC 2WXNA 2AX5A 3KUZA 2N4FA 1J8CA 4WWPA 2ACZB 1TKGA 1DOYA 1K8RB 3ZNGC 2BYVE 2D07B 3BK1A 4BFRA 4ZHPA 2KQSA 4PYUA 1A5RA 3ZLZA 1WH3A 1XLOA 2PKOA 1WZ0A 2V3NA 3JSVA 4USAA 1J19A 2PW9A 1V86A 1TS5A 1XQQA 4MJSB 5FR6A 3M63B 2M1MA 4A3PA 2ZEQA 3ONSA 3RPFC 1XD3B 3N3KB 1IP9A 1SGHA 4YL8A 4W9CA 1DYQA 4BVUC 4W9DA 4ZDVA 4ANXA 3GZNB 1WJNA 1UBQA 2MH7A 4YT0B 3VR8B 1VR9A 2I2YA 4EEWA 1NVID 2N1WA 1SSNA 2KXJA 4NPNA 5J2RA 4MSMB 1E6EB 3PS6A 1HA5A 4HDOA 2VZKB 2NBVB 4FJVB 3C19A 3L13A 4TV3A 4KGRA 3J9CA 3W1YA 5L83A 3BVMA 1GNUA 1NYQA 1N62A 2J42A 1XXGA 3JYUA 1SEBD 4DXAB 1J0GA 3T3NA 2D11A 4MJSA 1YQ4B 1JALA 1VJKA 4HCNB 3VUYA 1XLQA 1KLVA 1Q0WB 2LVPA 4ARCA 5DPWA 4XC2A 2D10A 4IOIE 2W3RA 4A20A 1QT9A 3SD5A 3GOEA 1N61A 1I4GA 1MI0A 4IM0A 4WURA 4LJPB 3GB1A 4AJWA 4BOZB 3AE4B 3RNCC 4KGTA 3WCQA 1GPXA 1FO4A 2CHXA 1MHHE 3ECIA 2LD9A 1RFAA 1D6EC 2IO3B 1QILA 1C78A 2KX0A 3U4EG 1OEYJ 2M19A 5H8YE 1XT9B 4TKNA 3ZUNA 4PS7A 4XWTA 3AE2B 1TJEA 2KTRB 2ONQA 2KFKA 2YEPF 2DAJA 1IGDA 1WXQA 3BVZA 3NVYA 3KVFB 3AULA 3EECA 3M95A 4CHKA 2G45B 3W1SC 3TEWA 1XLPA 5LLIA 1P1AA 2K22A 2AQ1B 1QKZA 3B9JA 4PT5A 3M3JA 4E3CA 3P2BA 1KFYB 3O65B 2PE9A 4K7SA 4B9KA 3U30A 2DAFA 1C77A 3DPDA 3FILA 1E0ZA 1V80A 3APCA 1L0VB 1RM6C 2DNFA 3BWUD 2PMVA 3BYTB 2CS4A 4YSXB 4B0MA 4LNKA 1GAQB 3BVGA 3NY5A 4XE0A 4FHKA 2BF8B 5AZFA 4TQ0A 2FCQA 2LGYA 1FM0D 4AWJA 5FKAC 1GG3A 4RGNA 3VRAB 3EFUA 1TS3A 1SB3C 2JRIB 5HKHA 3AEAB 2KTRA 3N20C 2X8XX 5EE3A 1NDDA 3ENEA 1VD2A 1LO5D 1VZ7A 1WR1A 1F1HA 1E8ZA 2J0JA 5IAAC 3QX1A 4HJKA 2A4ZA 1WIAA 1AARA 2RMMA 1Z2MA 2O6VA 4ZHOA 2IGGA 2ZCBA 2INDC 3MP9A 2QILA 2FCMA 4K7UA 4YSYB 2BS3B 2NTTA 3CMMB 2IO0B 4P6VF 3H6NA 1WRIA 5MPOA 4FBJB 1TTNA 1TY0A 1N63A 2IO2B 2YEPB 3L0WB 2KYWA 4B6WA 4DQOC 1YX5B 5HG2A 1FXIA 3RULA 2KFJA 5EE9A 3DVGX 3HM6X 4HCPB 1I4XA 1I4RA 1WGKA 3VTUA 4A8XC 4W9HA 2J53A 1UZXB 5CX3A 3KWLA 5HI1A 4ANWA 3ZJUA 4G50A 1VDVA 4W9LA 2W9NA 4MSQB 1T0SC 1EU4A 1E8XA 2PVOD 3KUDB 2IY1B 4ITKA 2MP2A 3V3XA 4K81A 3R8BA 4OZAA 2V4IB 2DYOA 3Q3JA 2IPKD 1WF9A 4WWNA 2H89B 3GP7A 1JMLA 3A9JB 3QWZB 3JW0X 2N9LA 1L2NA 2MRPA 3W9CB 2GI9A 4ZYNA 3QIJA 3VTVA 4WAFA 1IPGA 1ZE3D 1EWCA 3DHGC 4HPLB 3AEFB 1H8CA 3X0WA 3DBHI 1LXDA 3T3OA 4A9AA 2PTLA 2DHZA 4TQ1A 4HKQA 3DQVA 2N7DA 2XK5A 4RM8A 2JRHA 2XN9C 1ZPSA 2BGFA 4P7IA 3RCZA 4HVBA 5C23A 1V9JA 3NZUA 3ZXRA 2AQ3B 3AEDB 3N9YC 1C76A 2NMQA 2KMMA 4IWQA 2L0FA 3VFKA 2BVCA 2GLSA 1T5XD 1V49A 1GUAB 5JHAA 5HHDG 3PGEA 4WAAA 1FNWA 4GGQA 1WM2A 2L0TA 2E3TA 2AEHA 2A5UA 1T0RC 2G3QB 1QF6A 2HJ1A 4XDCA 2GMIC 2ZJDA 3Q3OC 4K3BA 1YJIA 4RFBA 4DXGA 3ZNHB 1P98A 3H7PB 3NVWA 3H1UA 1F2RC 2KJ6A 4MACA 4WJNA 5JZEB 3AE9B 4DWFA 2NPTA 3NJTA 2Y5CA 2NBWB 1FXTB 4W9EA 4MDKE 1GC6A 5IN7A 2D2QA 4MGZE 2NTSA 2BTEA 3PZDA 3KYCD 4KKIA 1L5PA 1CJEA 1UNSA 3W2DA 3KWVA 2EMSA 4GN1A 5IOIA 2RD0A 2KLCA 1QOFA 3ABVB 3PLVA 2KDBA 4MGKE 3HUIA 4C80A 1SE4A 4DXFA 1WXVA 4JGHB 3L17A 2K39A 1P3QU 2WU5B 2IY0B 3NS1A 1DOIA 3EFCA 1YN3A 2WXMA 4IWPA 4XX5A 3RT3B 1B9RA 3WA0A 2MBOA 4WJQA 3H7PA 1GJZA 3AM9A 1D5XC 3E9SA 1K52A 3VHTC 5D3DA 1GOZA 3H8HA 3IAM1 3RYTA 4I6PA 1RFKA 1P7FA 2R2QA 4IG7B 4JQWC 1B1ZA 4ZRIA 2WXQA 3P42A 1ZOYB 1C4AA 1BT0A 2NS5A 3W5VB 5G5GA 1BMLC 2KJRA 4ZRKA 2VRRB 2J7QB 2MBQA 1S3SG 4MM3A 3N30A 2BYEA 2O2VB 4UDUC 2L00B 1AN8A 4IDIA 1TY2A 2KHWB 3DWGC 2LGXA 4KX6B 2JXXA 4FHJA 2UU7A 4KDLB 3DWMA 4HDQA 2H88B 4OVZA 5JHBA 3Q14C 1C1YB 1SE2A 1KRHA 2MA9B 1V1PB 2KN4A 3UIOB 1OQQA 1EM7A 3N1ZC 4WQOB 3APDA 2WWZA 2WQYB 2HTME 1YN4A 2AYOB 2N9EB 3OLMD 4L1BA 2AQ2B 2L7RA 2LUMA 4XDDA 1QLBB 4FLHA 4YTPB 2K8CA 2WDQB 4GXBA 1NENB 4EZJA 2QDFA 5C2TB 1FRDA 3WANA 1QOGA 2LFIA 2LZ6A 4GMVA 1Z5SB 2G9HD 3DBLI 1E7PB 1EU3A 4R3DA 2V4LA 2K25A 2KN5A 2WXKA 1VZ6A 3SEBA 2DLBA 3V60A 1PFDA 1K50A 2X38A 1Y56A 3NUHB 1NEKB 5HFYA 1V1PA 3Q2AC 2FE8A 3KQ4A 1IBXB 1LFDA 2L05A 3PZ7A 1IUEA 4L2YA 2V0GA 2KANA 3ETRA 2XNAC 3IFWB 3LYYA 1K51A 2BB6A 4A6QA 5DPSA 2V9HA 5LXHA 2W55A 4HRSA 3AV8A 2LGDA 2G4DB 1PGXA 3AE7B 1T3QA 4A90A 1WGRA 2BWES 3PZ8A 4FA6A 1KLUD 1WYWB 2KWVB 2NBUA 5E6PA 3H7SA 3UQBA 3DBRB 4GU2A 4C4VB 4J3OD 3QA8A 4G3XB 1CMXB 5DCNA 2B3AA 4NAWB 4C56C 3M62B 3TL5A 2GBMA 4EOYA 1Q10A 3QQ8B 2JZZA 2WX1A 2K3UA 5CHFA 1EWYC 1V5OA 3UI3A 3P4QB 2RDBC 2BQQA 1KLGD 1QOAA 3ZQ4A 2KQ4X 1IBXA 3L10B 1I42A 1L6VA 2C7HA 4HEA1 3NVZA 2INNE 3ZRFA 2JYEA 2Q5WD 2MBHA 3V61A 3V6EB 4WJOA 4OVVA 1MVKA 2OJWA 3PREA 5I4DA 3RMKC 3A4SC 4NAMA 1ZXIA 3JVZX 1JWBD 1V81A 4EZKA 1AYFA 4NJ6A 2KMAA 5EDSA 2D3BA 2JY6A 1YIWA 2D3GA 2JU6X 3Q3NC 4JWUC 3UGBB 2KWCA 2M8SA 3LDZE 1HXYD 1ZKHA 1L0XB 3Q8AA 4AQ7A 1GB4A 5TR5A 1FD6A 4ZOHC 2WXOA 2BW2A 1NI2A 4G11A 4D2KA 2ZW1A 4NAWA 2QEJC 3RNEC 3MC8A 2JWUA 4W9IA 3I3TB 3DHHC 1WXSA 4DHZE 3IG3A 3D32A 1STEA 1OQRA 3B0AA 3DCGA 3BINA 4KV2A 2RSUA 1R7SA 4LK0M 1ENFA 4KIKB 2KD0A 1FNVA 1UWXA 1WSPA 2LUEA 2L52A 1EUVB 3AE8B 3AH7A 2LVOA 2JZ3B 2GB1A 4IM2A 1C3TA 2LI5A 5BYRA 1UELA 1ZP0B 2QSDA 3OAWA 3PLUA 2INCC 4YXDB 1SJHD 2M0AA 4IW0A 2LXAA 3AEBB 3OJ3A 2K6QA 2KWDA 2QJLA 3IHPC 1AW7A 3Q8BA 4WWMA 4HWIB 1N60A 2JF5A 5GXGB 4F7ZA 4TUUA 2KDFB 3C8YA 3FAHA 3P4PB 3PRPB 3BIID 2IBIB 1EO6A 1WMHB 3L16A 3PHXB 2BPSA 1CK1A 5JH5C 3ALBA 1UWMA 2KZRA 3DOWA 1HZ5A 1WZ3A 1XF5L 3DDCB 4MGYE 2LRUA 4LDTD 3CSFA 1YX6B 2RDGA 2J0KA 1UF0A 4MH8A 1C4PA 3SR6A 2C7NB 2GBRA 2WLBA 1PQSA 4RMAA 4DDID 4WIPA 1E8WA 1GB1A 3VQIA 4MELA 1UGJA 4LNNA 4BAXA 3VH4B 3EUB2 4HROA 4IUMB 3Q3FA 1L4DB 4RNAA 2L8JA 4YSZB 3P1MA 1R4MB 3UINB 1FRRA 1BXTA 3VUWA 1JW9D 3UIPB 4O1NA 2LJ5A 1V6EA 2DX5B 2FCSA 1XCTL 2KJHB 1R4NB 2DZJA 3DVNU 3IXSA 5J18A 3VTWA 2C7MB 2MBBB 1WMHA 4AUQC 4HXDA 2KVRA 3PHWB 1UGMA 3VXWA 1TBEA 3B2FA 2DWQA 3IVFA 1WX7A 3QJZA 1C9FA 3I5JC 3DBLB 4II2B 1J7BA 4JE3B 4LLGM 2I1KA 3BY4B 3HK0A 4RGMA 1OTRB 4M0WB 1C4CA 3I9V1 1KH0A 2BS2B 2R61A 2PJHA 3NG0A 3RNBC 2MJEA 4BZAA 3RUIB 2Z0EB 3LJ3A 4GOCA 1F9JA 4L23A 4IC7B 2RPQA 2LVQA 4NNJB 2V3SA 5TSSA 3ZDTA 2N0SB 1E8YA 1TKEA 5AZGA 3X23A 2ZCCA 2BS4B 2N7EA 1TGZB 1ZGUB 3N32A 2JYTA 5KHQA 3ZJVA 2Y3AA 2L83A 2MLBA 3R3MA 3RFZB 3QARA 3GZNI 3EA6A 5J17A 3ZJTA 5GMVA 3GE3C 4FADA 4II3B 5DPRA 4WJPA 4ANVA 4LNOA 3WALA 2FUHB 2JPHA 1WM3A 4I6LB 1PUTA 4J6IA 3MJWA 1FNUA 2LJIA 2NR2A 3Q3MC 4WH4A 1BUIC 1DGJA 1PDXA 2C9WB 4C7YA 2M0XA 1XCQL 2YLMA 3A9JA 2CU1A 3HRDD 3NZSA 2WXHA 4KVGB 3K9PB 1J7AA 1EF5A 4ASWC 3WIMA 1P9DU 1RYJA 2M56B 4NJCA 1HEZE 2KOXA 4M00A 2L32A 2EKIA 1F0ZA 3SU8X 5E6JA 3ZIMA 3A9KB 2LHDA 2J4XA 3BK2A 2DBYA 2NVUI 1XO3A 4ZRPA 1QZEA 2Y5BB 4EE2A 5D7GA 3ZRCA 4LCDE 2RR9A 4IM3A 3PRMB 3FC4A 3AMZA 2G1EA 3DHIC 3WAOA 4NY0A 3ZNZB 3P63A 2WGSA 3AE1B 4IKGA 5E6NA 3Q6BA 4LJOB 4BKSD 1WGYA 2IO1B 2DZIA 4HJGE 2DYMA 4ZYSA 3NS8A 3MC0B 1RAXA 2C60A 1F52A 3B08A 4A3OA 3HVZA 3OJ4B 3CF6E 2UYZB 4W9GA 1SBBB 5H92C 3TUOA 5AEKB 5BMGA 2AWTA 1I7HA 2KVZA 2WS3B 2XBBC 4PYZA 1WGDA 1RLFA 2ICIA 1UUPA 2LWPA 4AP4C 3I57A 1P0RA 1YN5A 1I4PA 2MWSB 2WDTB 2GBJA 3EC8A 3UF8A 1AWDA 4WWOA 2CHZA
chains in the Genus database with same CATH topology
4L2YA 2V0GA 3AE3B 3ETRA 1C77A 2JXTA 2XNAC 3LYYA 1K51A 1V8CA 2BB6A 4A6QA 3FILA 2IJ0A 1E0ZA 2KACA 1ET6A 2BT6A 4MT5A 2W55A 4NZLB 4HRSA 3AV8A 2J52A 1L0VB 1RM6C 2MEKA 3BWUD 3U52E 1PGXA 3AE7B 2JZPA 2PMVA 3MFGA 3BYTB 2K0PA 1T3QA 4A90A 4YSXB 4AS1A 4B0MA 1ET9A 3PZ8A 1GAQB 3BVGA 2WDRB 4XE0A 1KLUD 4TQ0A 2JX5A 1J7CA 1L4ZB 1FM0D 2INPE 4J3OD 5FKAC 4H2AA 4RGNA 3EGRA 1RWSA 3VRAB 3OWEB 1SF0A 1TS3A 2OEDA 1SB3C 2V3PA 2TSSA 4N58A 1V97A 4NAWB 2IDYA 1JWSD 1C79A 3AEAB 4C7ZA 5EE3A 4C56C 4Q2JA 1TS4A 5AUKA 1LO5D 1VZ7A 3BZDB 5G5HA 1N5WA 3HVDA 4M0WA 1Q10A 2EELA 2K3UA 1NYRA 2RMMA 1KTKA 1M4VA 1EWYC 2WXIA 1ACCA 3UI3A 3P4QB 3URYA 4ZHOA 4JX1C 1KLGD 2IGGA 1QOAA 2N9KA 2WXFA 3MHZA 4HKZE 5EE1A 2KQ4X 3ZQ4A 1IBXA 4US8A 3MP9A 1L6VA 2QILA 3E56A 4HEA1 2LHEA 3NVZA 2INNE 2JYEA 4YSYB 1T6BX 3IAS1 2BS3B 2NTTA 2Q5WD 1JRPA 2ZW0A 4P6VF 2BBCA 1WRIA 5MPOA 1MVKA 5I4DA 1TY0A 1FIQA 2K5PA 1N63A 4YTNB 4NAMA 2YEPB 1ZXIA 1JWBD 2WNMA 1P7EA 4DQOC 1AYFA 5LNK1 1L0YB 5HG2A 1FXIA 4JWSC 4JWUC 2JSVX 2JU6X 4WQMA 5EE9A 2VZKD 4P16A 1HXYD 3P4SB 4YTMB 1L0XB 3AB5A 3Q8AA 4AQ7A 3AE6B 1GB4A 5JXVA 3L4PA 1I4XA 1I4RA 1WGKA 3TEYA 1FD6A 4ZOHC 2WXOA 4YWGG 2BW2A 4A8XC 2J53A 3R2TA 4D2KA 4ZRQA 2ZW1A 2LEKA 2QEJC 2IGDA 1JWMD 2JWUA 4TMAB 4RCOA 3KWLA 5HI1A 3ZJUA 3LXFA 2CU3A 1JROA 1SXTA 1VDVA 2SAKA 2MJDA 2PLPA 1VZ8A 1EU4A 2W54A 4CQNA 4TSSA 2PVOD 4RGTA 1STEA 1OQRA 4ITKA 4MM3B 2WXLA 4LK0M 1R7SA 3V3XA 3R8BA 4RF0A 1ENFA 2Z8LA 3TEXA 1FNVA 1UWXA 1WSPA 4OZAA 2V4IB 2DYOA 2L52A 5BMHA 4KGSA 5BYSA 3AE8B 3VRBB 2IPKD 1JQ4A 3AH7A 2GB1A 1MPEA 2I38A 2H89B 3GP7A 4N59A 5BYRA 1JMLA 1ZP0B 2QSDA 2N9LA 1L6UA 1JCKB 1PYWD 3TEZA 1FCLA 4YXDB 3W9CB 2GI9A 1SJHD 2WU2B 2W82A 4WAFA 5AUIA 3MJ5A 1ZE3D 2M0AA 1EWCA 5EE0A 3KLSX 3AEFB 2KAJA 3AEBB 1TKYA 2KWDA 2QJLA 3BYYB 4GDLB 3T3OA 4B0EA 2LMCA 4KKJA 4A9AA 1AW7A 3Q8BA 3SFDB 4WWMA 2PTLA 3V05A 4TQ1A 1QOBA 4HKQA 1XEEA 2D5GA 1N60A 2OHFA 5GXGB 1FMAD 2XN9C 1NI3A 1ZDXA 1ZPSA 1TS2A 2WXGA 3C8YA 1OFFA 3FAHA 3NZ3A 3P4PB 3BIID 3CIRB 4OZBA 1ROEA 1MHXA 3B2GA 2N7JA 1DOXA 3GS2A 2AQ3B 3AECB 3AEDB 4OHJA 1CK1A 1YJJA 3N9YC 3ZYYX 1C76A 3AEGB 2NMQA 2LGIA 2KMMA 2WDVB 1UWMA 1F77A 1HZ5A 1T5XD 1XF5L 3W1SA 3ZGZA 5HHDG 2RDGA 1FNWA 2E3TA 4MH8A 1C4PA 3SR6A 1QF6A 2RDHA 4XDCA 2WLBA 1HZ6A 1CZPA 1YJIA 4OZCA 4WIPA 3TSSA 1QQRA 1GB1A 4RFBA 2FBWB 4DXGA 2PIAA 2WP9B 3VQIA 2GRIA 3U2SC 2E6XA 2W3SA 1UGJA 1SIJA 3IT6B 3NVWA 1F2RC 1FFUA 5C3JB 1D5MC 4MACA 3EUB2 4HROA 1L4DB 3AE9B 4RNAA 1PGBA 4YSZB 4RF1A 3P1MA 1FRRA 1FFVA 1BXTA 2Y5CA 1JW9D 3W5UB 1HQRD 3NVVA 3FILB 1FEHA 2IGHA 4O1NA 2L1AA 1F2RI 1CQVA 3CWIA 1XCTL 2NTSA 2BTEA 2HDEA 1YMHE 3IXSA 3LB8C 2B76B 4KKIA 4N6EB 1L5PA 2SEBD 1IGCA 1CJEA 1UNSA 3B2FA 3W2DA 2DWQA 5FK9C 1YQ3B 2QIEB 3KWVA 4FXCA 4ARIA 1C9FA 2WXNA 4JPSA 1QOFA 2AX5A 4GLSC 3ABVB 5T8IA 1J7BA 4JE3B 2ACZB 1V1OA 3HUIA 4C80A 4LLGM 1TKGA 1DOYA 1SE4A 4DXFA 3SFEB 3BK1A 4RGMA 4ZHPA 4US9A 1C4CA 1XLOA 3I9V1 1A70A 1KH0A 2QMTA 2PKOA 2BS2B 2WU5B 3NS1A 1DOIA 2R61A 2V3NA 4LTUA 1SJED 1YN3A 4USAA 2MJEA 2PW9A 2WXMA 4OW0A 1B9RA 3Q8EA 1TS5A 4L23A 3AM9A 1D5XC 3E9SA 1K52A 5D3IB 5TSSA 3IT4B 2Y5PA 5D3DA 1TZOA 2N0SB 1GOZA 2RPVA 1TKEA 3RPFC 3H8HA 2BS4B 3IAM1 1DYQA 2K9XA 1RFKA 1P7FA 2JYTA 1B1ZA 2MH7A 3AE5B 2WXQA 3P42A 4YT0B 3ZJVA 2Y3AA 1ZOYB 1PGAA 2L83A 1C4AA 3VR8B 4XWWA 1VR9A 2I2YA 3RFZB 3EA6A 5G5GA 1BMLC 3W5VB 3ZJTA 1NVID 1SSNA 2PVGC 1D4BA 2KDMA 1N5XA 1D5ZC 1E6EB 4UDUC 2FUG1 3Q8FA 3AN1A 1AN8A 1ZDVA 1HA5A 4IDIA 1TY2A 1PUTA 1K53A 2VZKB 3DWGC 4KX6B 5BMIA 1XLNA 1FNUA 2LJIA 3DWMA 4KGRA 1BUIC 1DGJA 1PDXA 1JWUD 3J9CA 4WH4A 4RH6A 4C7YA 2H88B 3BVMA 4OVZA 1NYQA 1N62A 1FXAA 2J42A 1XCQL 1XXGA 3HRDD 1SEBD 2ON8A 2WXHA 1WWTA 2BB5A 1SE2A 5FR3A 3T3NA 1KRHA 1J7AA 2BYTA 2JQRB 1RYJA 1WYGA 1YNTE 1JALA 1V1PB 1YQ4B 1VJKA 3Q69A 3O13A 2KN4A 1XLQA 2M56B 2WXRA 4NJCA 1HEZE 4A55A 4RGOS 2WXJA 1OQQA 2WXPA 1EM7A 2L32A 1E9MA 4ARCA 2EKIA 2MJ3A 1F0ZA 4IOIE 1ZXHA 5E6JA 2WQYB 2W3RA 1QT9A 2LHDA 2HTME 2J4XA 1N61A 2DBYA 3BK2A 1I4GA 1XO3A 1MI0A 1YN4A 4ZRPA 4EE2A 4WURA 5D7GA 1I4HA 3R2IA 3GB1A 3FC4A 3AMZA 2G1EA 4L1BA 3AE4B 4KGTA 1SE3A 3WCQA 1GPXA 1VLBA 2AQ2B 3P63A 1FO4A 1MHHE 3P4RB 1D6EC 2LUMA 3AE1B 1QILA 4IKGA 4XDDA 1C78A 1QLBB 3U4EG 1E10A 1ESFA 3VR9B 4YTPB 2WDQB 1NENB 2M19A 4GDKB 4HJGE 5H8YE 2DYMA 4ZYSA 5C2TB 1FRDA 2CJOA 3MC0B 4XWTA 3AE2B 1QOGA 1TJEA 2LFIA 3HVZA 3Q8CA 2ONQA 2G9HD 1E7PB 2YEPF 1SBBB 5H92C 3TUOA 1I4QA 1IGDA 3AEEB 1EU3A 4R3DA 5BMGA 1WXQA 3BVZA 3NVYA 1I7HA 1ZUD2 2WXKA 1VZ6A 2WS3B 2CJNA 3SEBA 1JWAD 4REZA 2DLBA 1PFDA 1K50A 2X38A 3U7ZA 1Y56A 1UUPA 2ICIA 3NUHB 3TEWA 3PO0A 1NEKB 1XLPA 5HFYA 3I57A 1V1PA 1VRAB 1KF6B 1YN5A 2AQ1B 1QKZA 2FE8A 2K22A 3KQ4A 5BYQA 1I4PA 3B9JA 4PT5A 1IBXB 3NRZA 1KFYB 1AWDA 1FCCC 3PZ7A 1TYGB 1IUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  2JWU A;  1D4B A;  2JXT A;  2KDM A;  5HI1 A;  1K51 A;  1F2R C;  3FIL A;  2PLP A;  2KAC A;  4MAC A;  2J52 A;  1K53 A;  1PGB A;  5BMI A;  1PGX A;  2JZP A;  2K0P A;  4KGR A;  4WH4 A;  3V3X A;  3FIL B;  2IGH A;  1UWX A;  4OZA A;  1XCQ L;  5BMH A;  4KGS A;  1F2R I;  2ON8 A;  1XCT L;  2GB1 A;  1MPE A;  1YMH E;  2I38 A;  1YNT E;  2OED A;  2KN4 A;  1JML A;  1HEZ E;  2QSD A;  2N9L A;  1FCL A;  1IGC A;  1EM7 A;  2GI9 A;  1C9F A;  4IOI E;  1ZXH A;  4GLS C;  2LHD A;  1Q10 A;  2EEL A;  1MI0 A;  2RMM A;  2KWD A;  3UI3 A;  3GB1 A;  2PTL A;  2IGG A;  4HKZ E;  2N9K A;  2KQ4 X;  4KGT A;  1IBX A;  1KH0 A;  2QMT A;  3MP9 A;  1MHH E;  2LUM A;  2LHE A;  2PW9 A;  4IKG A;  2ZW0 A;  4HJG E;  4OZB A;  1K52 A;  1MVK A;  1MHX A;  2N7J A;  2RPV A;  2ONQ A;  1P7E A;  2LGI A;  2NMQ A;  5HG2 A;  1IGD A;  5BMG A;  1P7F A;  1HZ5 A;  1XF5 L;  2JSV X;  2JU6 X;  5HHD G;  1PGA A;  1K50 A;  1GB4 A;  5JXV A;  2I2Y A;  5HFY A;  1QKZ A;  1FD6 A;  1IBX B;  2J53 A;  1HZ6 A;  4D2K A;  2ZW1 A;  4OZC A;  1FCC C;  1GB1 A; 
#chains in the Genus database with same CATH topology
 1KM7 A;  3AE3 B;  3SDL C;  2DZK A;  2JXT A;  1KOT A;  3N1X C;  2IJ0 A;  2KAC A;  1ET6 A;  4MT5 A;  4NZL B;  3HHM A;  2MEK A;  3U52 E;  3MFG A;  2JZP A;  2K0P A;  2JWZ A;  4ICV A;  4KZC A;  3KW5 B;  2KC2 A;  1ET9 A;  2HTH A;  2CHW A;  1ISN A;  1L4Z B;  2INP E;  2K8H A;  2ZVN A;  2IYD B;  4H2A A;  5CHV C;  1RWS A;  2FIF A;  2KK8 A;  2TSS A;  1JWS D;  4C7Z A;  2O6V D;  4Q2J A;  5AUK A;  1VCB A;  2LGS A;  3MHS D;  1N5W A;  4HK2 A;  2EEL A;  2MW5 A;  5D2M B;  1NYR A;  1M4V A;  2WXI A;  1ACC A;  4MEM A;  3A1Q B;  3R7R A;  3URY A;  3MHZ A;  2OOB B;  3A4R A;  4US8 A;  3RN9 C;  3E56 A;  2LHE A;  4PK1 A;  3ZXV A;  5IP4 D;  2M17 A;  2ZNV C;  1FIQ A;  2KWU B;  4JL9 A;  4YTN B;  2N9P C;  2REX A;  2KDE B;  1WXM A;  3HIZ A;  2R2O A;  5LNK 1;  1L0Y B;  4HPP A;  2HD5 B;  5AZH A;  4EUT A;  2J0M A;  1UD7 A;  3P4S B;  4YTM B;  1X1M A;  3AE6 B;  5JXV A;  3L4P A;  2O2V A;  3TCA A;  3UQA A;  2L3Z A;  4KDI C;  2LEK A;  2VH1 A;  1WE6 A;  2MCN B;  1JWM D;  2Z0D B;  5G2N A;  3LXF A;  3PPA A;  1IYF A;  2MJD A;  1VZ8 A;  4CQN A;  3ZTC A;  4TSS A;  1OEY A;  1OQY A;  2V1Y A;  3A1Q A;  2WXL A;  3KUC B;  4RF0 A;  3H9D A;  2Z8L A;  4DK5 A;  2BWF A;  4K7W A;  4PS8 A;  4KGS A;  3VRB B;  1JQ4 A;  1FPY A;  3MC9 A;  3VVW B;  2I38 A;  1MPE A;  4BBN C;  3DVG Y;  1LQB A;  3QK0 A;  1RRB A;  1WE7 A;  1L6U A;  3DBH B;  1PYW D;  2LXC A;  1V5T A;  1T0Q C;  4JIO U;  2K6D B;  4P1B C;  5AUI A;  3I63 C;  1LM8 B;  4GDL B;  4XYC A;  2AL6 A;  2ZPN A;  3S2A A;  1QOB A;  2MSE D;  1XEE A;  2D5G A;  3QHT A;  1WRD B;  2OHF A;  1FMA D;  3APF A;  4DDG D;  1NI3 A;  5L95 C;  4KSK C;  5CHW A;  2WXG A;  2KKC A;  4KZ0 A;  3RZW C;  3AU4 A;  4DBG A;  1MHX A;  2QC8 A;  3B2G A;  1HTO A;  4OHJ A;  1YJJ A;  3ZYY X;  3K9O B;  4KSL C;  3RD2 A;  5KHO A;  1F77 A;  3KH0 A;  2N1V A;  3W1S A;  4W9F A;  3ZGZ A;  2CR5 A;  2Z59 B;  2DZM A;  2KFK B;  3QAQ A;  4M01 A;  3AI5 A;  4X57 B;  4FJY A;  2QCZ A;  4BOS C;  3L54 A;  2WP9 B;  1ZW7 A;  2GRI A;  2C5L C;  3U2S C;  1SIJ A;  1JRU A;  1I35 A;  2GOW A;  1D5M C;  1E7U A;  2N9X A;  4GDL A;  1PGB A;  4RF1 A;  3U7D A;  4C4V A;  1FFV A;  1HQR D;  1SIF A;  3NVV A;  3FIL B;  1FEH A;  2IGH A;  4I6N B;  1CQV A;  3CWI A;  1WXA A;  2HDE A;  4M02 A;  2XEW A;  3LB8 C;  1E7V A;  2B76 B;  1YOV B;  3KYD D;  2SEB D;  1WR6 E;  5FK9 C;  1YQ3 B;  4FXC A;  4MGI E;  4ARI A;  4URK A;  3RNF C;  4JPS A;  2JVC A;  2FNJ B;  4GLS C;  1TIF A;  2ZZP B;  3PT2 B;  4PS3 A;  5T8I A;  1NBF C;  1V1O A;  3ML9 A;  3SFE B;  4BKS A;  1M94 A;  4US9 A;  1KJT A;  1A70 A;  1E90 A;  2QMT A;  3A33 B;  4LTU A;  2KLG A;  1SJE D;  3WAP A;  2EKE C;  3EHV A;  2KMC A;  3V62 A;  4OW0 A;  2O6V B;  3TMP B;  3Q8E A;  2FID A;  4DHJ D;  5D3I B;  3IT4 B;  3ZVV A;  2Y5P A;  1TZO A;  2RPV A;  3OG5 A;  2BKR B;  2KNB A;  4NQL B;  1WGH A;  2K9X A;  4W9K A;  2JUO A;  3AE5 B;  2MBE A;  1PGA A;  4DHZ B;  4XWW A;  2WHI A;  2GBN A;  5CTR C;  2PEA A;  4FN2 A;  4F8C B;  2ZPY A;  2PVG C;  1D4B A;  2KDM A;  1N5X A;  1D5Z C;  2KTF A;  4NQK E;  2FUG 1;  2BYF A;  3Q8F A;  4KIK A;  3AN1 A;  1ZDV A;  5BO4 B;  1K53 A;  1MFW A;  5BMI A;  1XLN A;  1G6J A;  1JWU D;  4RH6 A;  2VH2 A;  4QAY A;  1FXA A;  4IWO A;  1Q1O A;  2HJ8 A;  2ON8 A;  2PPH A;  1HE8 A;  1WWT A;  2BB5 A;  4F1S A;  5FR3 A;  3PTF C;  2BYT A;  2MP2 B;  2JQR B;  2YVC A;  1WYG A;  1YNT E;  3Q69 A;  1OGW A;  3O13 A;  2K1F A;  4AJY B;  2WXR A;  4A55 A;  4RGO S;  2WXJ A;  3VH3 B;  2WXP A;  1E9M A;  2DYB A;  2MJ3 A;  1SE9 A;  1ZXH A;  4G0N B;  2I1J A;  4HLE A;  1YD8 U;  5G55 A;  4ANU A;  4FJZ A;  3ML8 A;  1MG8 A;  1I4H A;  3R2I A;  2DEN B;  3AU5 A;  2UWQ A;  3RNG C;  1SE3 A;  5D6J B;  1VLB A;  3P4R B;  4K1R B;  1E10 A;  1ESF A;  3VR9 B;  4HPM B;  4GDK B;  4OVU A;  3GE8 C;  2CJO A;  2XK5 B;  5D94 A;  5E6O A;  3ZKJ C;  3TJP A;  4K3C A;  2FCN A;  3Q8C A;  1WFY A;  1I4Q A;  3AEE B;  1ZUD 2;  3RI7 C;  4XZ4 A;  2CJN A;  1JWA D;  4REZ A;  4EFO A;  4BKT A;  3U7Z A;  3VDZ A;  4M8N A;  2MX2 A;  3PO0 A;  4W9J A;  1VRA B;  1KF6 B;  5BYQ A;  4B95 A;  3V6C B;  3NRZ A;  2OJR A;  4C00 A;  4EZL A;  3ZO5 B;  4CO7 A;  3SHQ A;  4JX1 C;  1FCC C;  3RZF A;  3IBE A;  3RNA C;  4E74 A;  1V8C A;  2KT7 A;  3R7Q A;  2BT6 A;  2J52 A;  1UH6 A;  2ASQ A;  4AS1 A;  4JLC A;  5LXI B;  2WDR B;  3DBS A;  3ZW3 A;  2JX5 A;  3ZTD A;  1J7C A;  2KX3 A;  4ICU A;  5DPT A;  2NPT B;  3HM3 A;  3EGR A;  4RM9 A;  4GDK A;  4BKG A;  3R66 C;  3OWE B;  4GSW A;  4ACF A;  1SF0 A;  2OED A;  2V3P A;  4N58 A;  1V97 A;  2L76 A;  2K8B A;  2IDY A;  1C79 A;  2KQ7 A;  3DBR I;  4BBN F;  5IO9 A;  1V2Y A;  1TS4 A;  3MTN B;  3BZD B;  5G5H A;  1E5W A;  1WJ6 A;  3HVD A;  4M0W A;  4LNI A;  5C1Z A;  1TYG B;  1KTK A;  1H4R A;  2IZV B;  3T9L A;  5EE1 A;  4HKZ E;  2WXF A;  2N9K A;  2FAZ A;  3NHE B;  3TIX A;  1Y8R C;  1T6B X;  3IAS 1;  1JRP A;  2NCN A;  2ZW0 A;  2KC1 A;  2BBC A;  2GBK A;  2K5P A;  3T8M A;  3TBL D;  2ZNV B;  2WNM A;  1P7E A;  1WI0 A;  4JWS C;  1WY8 A;  3DVN V;  2JSV X;  4WQM A;  4EKU A;  2VZK D;  4P16 A;  1TZ1 A;  2KDI A;  3AB5 A;  2MQJ A;  4AOF A;  3QC8 B;  4DHJ B;  3L08 A;  3TEY A;  3VAW A;  4YWG G;  2EMT A;  4MH0 E;  3C0R B;  3R2T A;  4ZRQ A;  5IA7 A;  2IGD A;  1WGG A;  1YJ1 A;  4TMA B;  4RCO A;  2D3C A;  2CU3 A;  1JRO A;  1SXT A;  2SAK A;  2PLP A;  2W54 A;  4M8M A;  1WX9 A;  2LAS A;  1L7Y A;  4RGT A;  2KO3 A;  2WX0 A;  4MM3 B;  4S0R A;  4CYE A;  3TEX A;  4FUL A;  2AL3 A;  3AXC A;  5BMH A;  5BYS A;  3PV1 A;  4NJ7 A;  3A9K A;  4N59 A;  5IKC M;  2QHO A;  4LNF A;  1JCK B;  1FCL A;  3TEZ A;  3FKY A;  2WU2 B;  2W82 A;  4LDT B;  1HTQ A;  2D3A A;  3VUX A;  2HE7 A;  3MJ5 A;  5EE0 A;  4P1C C;  3KLS X;  2KAJ A;  3PSE B;  1TKY A;  3BYY B;  4B0E A;  4XGA B;  2LMC A;  4KKJ A;  2MHJ A;  1T0Y A;  2JT4 B;  3SFD B;  3V05 A;  4E71 A;  3ZNI D;  4GIV A;  1ZDX A;  1N6Z A;  4GB9 A;  2G4S A;  1TS2 A;  3NZ3 A;  1OFF A;  1WJ4 A;  3CIR B;  4OZB A;  2M4N A;  1ROE A;  1DOX A;  2N7J A;  3GS2 A;  1GC7 A;  3QCA A;  3AEC B;  2WYQ A;  4ZRJ A;  1WX8 A;  3AEG B;  2LGI A;  2WDV B;  1U4A A;  4N9F 4;  3B1L X;  2PE6 B;  1UBI A;  1MG4 A;  4S17 A;  1Q5W B;  1D3Z A;  2LRW A;  1YQB A;  2RDH A;  1LGR A;  1HZ6 A;  1CZP A;  1S1Q B;  3JSV B;  4OZC A;  3TSS A;  1QQR A;  2FBW B;  2PIA A;  1MJD A;  2E6X A;  2W3S A;  3IT6 B;  1FFU A;  5C3J B;  3N1Y C;  1TT5 B;  3W5U B;  3U8Z A;  2L1A A;  3PVL A;  3NOB A;  1F2R I;  3CST A;  2RGF A;  2CKH B;  3WAM A;  1R4M I;  3PRZ A;  2BKF A;  1YMH E;  1WJU A;  4N6E B;  2ZVO A;  1IGC A;  1EF1 A;  2QIE B;  1R4N I;  3ZDM C;  2WXN A;  2AX5 A;  3KUZ A;  2N4F A;  1J8C A;  4WWP A;  2ACZ B;  1TKG A;  1DOY A;  1K8R B;  3ZNG C;  2BYV E;  2D07 B;  3BK1 A;  4BFR A;  4ZHP A;  2KQS A;  4PYU A;  1A5R A;  3ZLZ A;  1WH3 A;  1XLO A;  2PKO A;  1WZ0 A;  2V3N A;  3JSV A;  4USA A;  1J19 A;  2PW9 A;  1V86 A;  1TS5 A;  1XQQ A;  4MJS B;  5FR6 A;  3M63 B;  2M1M A;  4A3P A;  2ZEQ A;  3ONS A;  3RPF C;  1XD3 B;  3N3K B;  1IP9 A;  1SGH A;  4YL8 A;  4W9C A;  1DYQ A;  4BVU C;  4W9D A;  4ZDV A;  4ANX A;  3GZN B;  1WJN A;  1UBQ A;  2MH7 A;  4YT0 B;  3VR8 B;  1VR9 A;  2I2Y A;  4EEW A;  1NVI D;  2N1W A;  1SSN A;  2KXJ A;  4NPN A;  5J2R A;  4MSM B;  1E6E B;  3PS6 A;  1HA5 A;  4HDO A;  2VZK B;  2NBV B;  4FJV B;  3C19 A;  3L13 A;  4TV3 A;  4KGR A;  3J9C A;  3W1Y A;  5L83 A;  3BVM A;  1GNU A;  1NYQ A;  1N62 A;  2J42 A;  1XXG A;  3JYU A;  1SEB D;  4DXA B;  1J0G A;  3T3N A;  2D11 A;  4MJS A;  1YQ4 B;  1JAL A;  1VJK A;  4HCN B;  3VUY A;  1XLQ A;  1KLV A;  1Q0W B;  2LVP A;  4ARC A;  5DPW A;  4XC2 A;  2D10 A;  4IOI E;  2W3R A;  4A20 A;  1QT9 A;  3SD5 A;  3GOE A;  1N61 A;  1I4G A;  1MI0 A;  4IM0 A;  4WUR A;  4LJP B;  3GB1 A;  4AJW A;  4BOZ B;  3AE4 B;  3RNC C;  4KGT A;  3WCQ A;  1GPX A;  1FO4 A;  2CHX A;  1MHH E;  3ECI A;  2LD9 A;  1RFA A;  1D6E C;  2IO3 B;  1QIL A;  1C78 A;  2KX0 A;  3U4E G;  1OEY J;  2M19 A;  5H8Y E;  1XT9 B;  4TKN A;  3ZUN A;  4PS7 A;  4XWT A;  3AE2 B;  1TJE A;  2KTR B;  2ONQ A;  2KFK A;  2YEP F;  2DAJ A;  1IGD A;  1WXQ A;  3BVZ A;  3NVY A;  3KVF B;  3AUL A;  3EEC A;  3M95 A;  4CHK A;  2G45 B;  3W1S C;  3TEW A;  1XLP A;  5LLI A;  1P1A A;  2K22 A;  2AQ1 B;  1QKZ A;  3B9J A;  4PT5 A;  3M3J A;  4E3C A;  3P2B A;  1KFY B;  3O65 B;  2PE9 A;  4K7S A;  4B9K A;  3U30 A;  2DAF A;  1C77 A;  3DPD A;  3FIL A;  1E0Z A;  1V80 A;  3APC A;  1L0V B;  1RM6 C;  2DNF A;  3BWU D;  2PMV A;  3BYT B;  2CS4 A;  4YSX B;  4B0M A;  4LNK A;  1GAQ B;  3BVG A;  3NY5 A;  4XE0 A;  4FHK A;  2BF8 B;  5AZF A;  4TQ0 A;  2FCQ A;  2LGY A;  1FM0 D;  4AWJ A;  5FKA C;  1GG3 A;  4RGN A;  3VRA B;  3EFU A;  1TS3 A;  1SB3 C;  2JRI B;  5HKH A;  3AEA B;  2KTR A;  3N20 C;  2X8X X;  5EE3 A;  1NDD A;  3ENE A;  1VD2 A;  1LO5 D;  1VZ7 A;  1WR1 A;  1F1H A;  1E8Z A;  2J0J A;  5IAA C;  3QX1 A;  4HJK A;  2A4Z A;  1WIA A;  1AAR A;  2RMM A;  1Z2M A;  2O6V A;  4ZHO A;  2IGG A;  2ZCB A;  2IND C;  3MP9 A;  2QIL A;  2FCM A;  4K7U A;  4YSY B;  2BS3 B;  2NTT A;  3CMM B;  2IO0 B;  4P6V F;  3H6N A;  1WRI A;  5MPO A;  4FBJ B;  1TTN A;  1TY0 A;  1N63 A;  2IO2 B;  2YEP B;  3L0W B;  2KYW A;  4B6W A;  4DQO C;  1YX5 B;  5HG2 A;  1FXI A;  3RUL A;  2KFJ A;  5EE9 A;  3DVG X;  3HM6 X;  4HCP B;  1I4X A;  1I4R A;  1WGK A;  3VTU A;  4A8X C;  4W9H A;  2J53 A;  1UZX B;  5CX3 A;  3KWL A;  5HI1 A;  4ANW A;  3ZJU A;  4G50 A;  1VDV A;  4W9L A;  2W9N A;  4MSQ B;  1T0S C;  1EU4 A;  1E8X A;  2PVO D;  3KUD B;  2IY1 B;  4ITK A;  2MP2 A;  3V3X A;  4K81 A;  3R8B A;  4OZA A;  2V4I B;  2DYO A;  3Q3J A;  2IPK D;  1WF9 A;  4WWN A;  2H89 B;  3GP7 A;  1JML A;  3A9J B;  3QWZ B;  3JW0 X;  2N9L A;  1L2N A;  2MRP A;  3W9C B;  2GI9 A;  4ZYN A;  3QIJ A;  3VTV A;  4WAF A;  1IPG A;  1ZE3 D;  1EWC A;  3DHG C;  4HPL B;  3AEF B;  1H8C A;  3X0W A;  3DBH I;  1LXD A;  3T3O A;  4A9A A;  2PTL A;  2DHZ A;  4TQ1 A;  4HKQ A;  3DQV A;  2N7D A;  2XK5 A;  4RM8 A;  2JRH A;  2XN9 C;  1ZPS A;  2BGF A;  4P7I A;  3RCZ A;  4HVB A;  5C23 A;  1V9J A;  3NZU A;  3ZXR A;  2AQ3 B;  3AED B;  3N9Y C;  1C76 A;  2NMQ A;  2KMM A;  4IWQ A;  2L0F A;  3VFK A;  2BVC A;  2GLS A;  1T5X D;  1V49 A;  1GUA B;  5JHA A;  5HHD G;  3PGE A;  4WAA A;  1FNW A;  4GGQ A;  1WM2 A;  2L0T A;  2E3T A;  2AEH A;  2A5U A;  1T0R C;  2G3Q B;  1QF6 A;  2HJ1 A;  4XDC A;  2GMI C;  2ZJD A;  3Q3O C;  4K3B A;  1YJI A;  4RFB A;  4DXG A;  3ZNH B;  1P98 A;  3H7P B;  3NVW A;  3H1U A;  1F2R C;  2KJ6 A;  4MAC A;  4WJN A;  5JZE B;  3AE9 B;  4DWF A;  2NPT A;  3NJT A;  2Y5C A;  2NBW B;  1FXT B;  4W9E A;  4MDK E;  1GC6 A;  5IN7 A;  2D2Q A;  4MGZ E;  2NTS A;  2BTE A;  3PZD A;  3KYC D;  4KKI A;  1L5P A;  1CJE A;  1UNS A;  3W2D A;  3KWV A;  2EMS A;  4GN1 A;  5IOI A;  2RD0 A;  2KLC A;  1QOF A;  3ABV B;  3PLV A;  2KDB A;  4MGK E;  3HUI A;  4C80 A;  1SE4 A;  4DXF A;  1WXV A;  4JGH B;  3L17 A;  2K39 A;  1P3Q U;  2WU5 B;  2IY0 B;  3NS1 A;  1DOI A;  3EFC A;  1YN3 A;  2WXM A;  4IWP A;  4XX5 A;  3RT3 B;  1B9R A;  3WA0 A;  2MBO A;  4WJQ A;  3H7P A;  1GJZ A;  3AM9 A;  1D5X C;  3E9S A;  1K52 A;  3VHT C;  5D3D A;  1GOZ A;  3H8H A;  3IAM 1;  3RYT A;  4I6P A;  1RFK A;  1P7F A;  2R2Q A;  4IG7 B;  4JQW C;  1B1Z A;  4ZRI A;  2WXQ A;  3P42 A;  1ZOY B;  1C4A A;  1BT0 A;  2NS5 A;  3W5V B;  5G5G A;  1BML C;  2KJR A;  4ZRK A;  2VRR B;  2J7Q B;  2MBQ A;  1S3S G;  4MM3 A;  3N30 A;  2BYE A;  2O2V B;  4UDU C;  2L00 B;  1AN8 A;  4IDI A;  1TY2 A;  2KHW B;  3DWG C;  2LGX A;  4KX6 B;  2JXX A;  4FHJ A;  2UU7 A;  4KDL B;  3DWM A;  4HDQ A;  2H88 B;  4OVZ A;  5JHB A;  3Q14 C;  1C1Y B;  1SE2 A;  1KRH A;  2MA9 B;  1V1P B;  2KN4 A;  3UIO B;  1OQQ A;  1EM7 A;  3N1Z C;  4WQO B;  3APD A;  2WWZ A;  2WQY B;  2HTM E;  1YN4 A;  2AYO B;  2N9E B;  3OLM D;  4L1B A;  2AQ2 B;  2L7R A;  2LUM A;  4XDD A;  1QLB B;  4FLH A;  4YTP B;  2K8C A;  2WDQ B;  4GXB A;  1NEN B;  4EZJ A;  2QDF A;  5C2T B;  1FRD A;  3WAN A;  1QOG A;  2LFI A;  2LZ6 A;  4GMV A;  1Z5S B;  2G9H D;  3DBL I;  1E7P B;  1EU3 A;  4R3D A;  2V4L A;  2K25 A;  2KN5 A;  2WXK A;  1VZ6 A;  3SEB A;  2DLB A;  3V60 A;  1PFD A;  1K50 A;  2X38 A;  1Y56 A;  3NUH B;  1NEK B;  5HFY A;  1V1P A;  3Q2A C;  2FE8 A;  3KQ4 A;  1IBX B;  1LFD A;  2L05 A;  3PZ7 A;  1IUE A;  4L2Y A;  2V0G A;  2KAN A;  3ETR A;  2XNA C;  3IFW B;  3LYY A;  1K51 A;  2BB6 A;  4A6Q A;  5DPS A;  2V9H A;  5LXH A;  2W55 A;  4HRS A;  3AV8 A;  2LGD A;  2G4D B;  1PGX A;  3AE7 B;  1T3Q A;  4A90 A;  1WGR A;  2BWE S;  3PZ8 A;  4FA6 A;  1KLU D;  1WYW B;  2KWV B;  2NBU A;  5E6P A;  3H7S A;  3UQB A;  3DBR B;  4GU2 A;  4C4V B;  4J3O D;  3QA8 A;  4G3X B;  1CMX B;  5DCN A;  2B3A A;  4NAW B;  4C56 C;  3M62 B;  3TL5 A;  2GBM A;  4EOY A;  1Q10 A;  3QQ8 B;  2JZZ A;  2WX1 A;  2K3U A;  5CHF A;  1EWY C;  1V5O A;  3UI3 A;  3P4Q B;  2RDB C;  2BQQ A;  1KLG D;  1QOA A;  3ZQ4 A;  2KQ4 X;  1IBX A;  3L10 B;  1I42 A;  1L6V A;  2C7H A;  4HEA 1;  3NVZ A;  2INN E;  3ZRF A;  2JYE A;  2Q5W D;  2MBH A;  3V61 A;  3V6E B;  4WJO A;  4OVV A;  1MVK A;  2OJW A;  3PRE A;  5I4D A;  3RMK C;  3A4S C;  4NAM A;  1ZXI A;  3JVZ X;  1JWB D;  1V81 A;  4EZK A;  1AYF A;  4NJ6 A;  2KMA A;  5EDS A;  2D3B A;  2JY6 A;  1YIW A;  2D3G A;  2JU6 X;  3Q3N C;  4JWU C;  3UGB B;  2KWC A;  2M8S A;  3LDZ E;  1HXY D;  1ZKH A;  1L0X B;  3Q8A A;  4AQ7 A;  1GB4 A;  5TR5 A;  1FD6 A;  4ZOH C;  2WXO A;  2BW2 A;  1NI2 A;  4G11 A;  4D2K A;  2ZW1 A;  4NAW A;  2QEJ C;  3RNE C;  3MC8 A;  2JWU A;  4W9I A;  3I3T B;  3DHH C;  1WXS A;  4DHZ E;  3IG3 A;  3D32 A;  1STE A;  1OQR A;  3B0A A;  3DCG A;  3BIN A;  4KV2 A;  2RSU A;  1R7S A;  4LK0 M;  1ENF A;  4KIK B;  2KD0 A;  1FNV A;  1UWX A;  1WSP A;  2LUE A;  2L52 A;  1EUV B;  3AE8 B;  3AH7 A;  2LVO A;  2JZ3 B;  2GB1 A;  4IM2 A;  1C3T A;  2LI5 A;  5BYR A;  1UEL A;  1ZP0 B;  2QSD A;  3OAW A;  3PLU A;  2INC C;  4YXD B;  1SJH D;  2M0A A;  4IW0 A;  2LXA A;  3AEB B;  3OJ3 A;  2K6Q A;  2KWD A;  2QJL A;  3IHP C;  1AW7 A;  3Q8B A;  4WWM A;  4HWI B;  1N60 A;  2JF5 A;  5GXG B;  4F7Z A;  4TUU A;  2KDF B;  3C8Y A;  3FAH A;  3P4P B;  3PRP B;  3BII D;  2IBI B;  1EO6 A;  1WMH B;  3L16 A;  3PHX B;  2BPS A;  1CK1 A;  5JH5 C;  3ALB A;  1UWM A;  2KZR A;  3DOW A;  1HZ5 A;  1WZ3 A;  1XF5 L;  3DDC B;  4MGY E;  2LRU A;  4LDT D;  3CSF A;  1YX6 B;  2RDG A;  2J0K A;  1UF0 A;  4MH8 A;  1C4P A;  3SR6 A;  2C7N B;  2GBR A;  2WLB A;  1PQS A;  4RMA A;  4DDI D;  4WIP A;  1E8W A;  1GB1 A;  3VQI A;  4MEL A;  1UGJ A;  4LNN A;  4BAX A;  3VH4 B;  3EUB 2;  4HRO A;  4IUM B;  3Q3F A;  1L4D B;  4RNA A;  2L8J A;  4YSZ B;  3P1M A;  1R4M B;  3UIN B;  1FRR A;  1BXT A;  3VUW A;  1JW9 D;  3UIP B;  4O1N A;  2LJ5 A;  1V6E A;  2DX5 B;  2FCS A;  1XCT L;  2KJH B;  1R4N B;  2DZJ A;  3DVN U;  3IXS A;  5J18 A;  3VTW A;  2C7M B;  2MBB B;  1WMH A;  4AUQ C;  4HXD A;  2KVR A;  3PHW B;  1UGM A;  3VXW A;  1TBE A;  3B2F A;  2DWQ A;  3IVF A;  1WX7 A;  3QJZ A;  1C9F A;  3I5J C;  3DBL B;  4II2 B;  1J7B A;  4JE3 B;  4LLG M;  2I1K A;  3BY4 B;  3HK0 A;  4RGM A;  1OTR B;  4M0W B;  1C4C A;  3I9V 1;  1KH0 A;  2BS2 B;  2R61 A;  2PJH A;  3NG0 A;  3RNB C;  2MJE A;  4BZA A;  3RUI B;  2Z0E B;  3LJ3 A;  4GOC A;  1F9J A;  4L23 A;  4IC7 B;  2RPQ A;  2LVQ A;  4NNJ B;  2V3S A;  5TSS A;  3ZDT A;  2N0S B;  1E8Y A;  1TKE A;  5AZG A;  3X23 A;  2ZCC A;  2BS4 B;  2N7E A;  1TGZ B;  1ZGU B;  3N32 A;  2JYT A;  5KHQ A;  3ZJV A;  2Y3A A;  2L83 A;  2MLB A;  3R3M A;  3RFZ B;  3QAR A;  3GZN I;  3EA6 A;  5J17 A;  3ZJT A;  5GMV A;  3GE3 C;  4FAD A;  4II3 B;  5DPR A;  4WJP A;  4ANV A;  4LNO A;  3WAL A;  2FUH B;  2JPH A;  1WM3 A;  4I6L B;  1PUT A;  4J6I A;  3MJW A;  1FNU A;  2LJI A;  2NR2 A;  3Q3M C;  4WH4 A;  1BUI C;  1DGJ A;  1PDX A;  2C9W B;  4C7Y A;  2M0X A;  1XCQ L;  2YLM A;  3A9J A;  2CU1 A;  3HRD D;  3NZS A;  2WXH A;  4KVG B;  3K9P B;  1J7A A;  1EF5 A;  4ASW C;  3WIM A;  1P9D U;  1RYJ A;  2M56 B;  4NJC A;  1HEZ E;  2KOX A;  4M00 A;  2L32 A;  2EKI A;  1F0Z A;  3SU8 X;  5E6J A;  3ZIM A;  3A9K B;  2LHD A;  2J4X A;  3BK2 A;  2DBY A;  2NVU I;  1XO3 A;  4ZRP A;  1QZE A;  2Y5B B;  4EE2 A;  5D7G A;  3ZRC A;  4LCD E;  2RR9 A;  4IM3 A;  3PRM B;  3FC4 A;  3AMZ A;  2G1E A;  3DHI C;  3WAO A;  4NY0 A;  3ZNZ B;  3P63 A;  2WGS A;  3AE1 B;  4IKG A;  5E6N A;  3Q6B A;  4LJO B;  4BKS D;  1WGY A;  2IO1 B;  2DZI A;  4HJG E;  2DYM A;  4ZYS A;  3NS8 A;  3MC0 B;  1RAX A;  2C60 A;  1F52 A;  3B08 A;  4A3O A;  3HVZ A;  3OJ4 B;  3CF6 E;  2UYZ B;  4W9G A;  1SBB B;  5H92 C;  3TUO A;  5AEK B;  5BMG A;  2AWT A;  1I7H A;  2KVZ A;  2WS3 B;  2XBB C;  4PYZ A;  1WGD A;  1RLF A;  2ICI A;  1UUP A;  2LWP A;  4AP4 C;  3I57 A;  1P0R A;  1YN5 A;  1I4P A;  2MWS B;  2WDT B;  2GBJ A;  3EC8 A;  3UF8 A;  1AWD A;  4WWO A;  2CHZ A; 
#chains in the Genus database with same CATH homology
 4L2Y A;  2V0G A;  3AE3 B;  3ETR A;  1C77 A;  2JXT A;  2XNA C;  3LYY A;  1K51 A;  1V8C A;  2BB6 A;  4A6Q A;  3FIL A;  2IJ0 A;  1E0Z A;  2KAC A;  1ET6 A;  2BT6 A;  4MT5 A;  2W55 A;  4NZL B;  4HRS A;  3AV8 A;  2J52 A;  1L0V B;  1RM6 C;  2MEK A;  3BWU D;  3U52 E;  1PGX A;  3AE7 B;  2JZP A;  2PMV A;  3MFG A;  3BYT B;  2K0P A;  1T3Q A;  4A90 A;  4YSX B;  4AS1 A;  4B0M A;  1ET9 A;  3PZ8 A;  1GAQ B;  3BVG A;  2WDR B;  4XE0 A;  1KLU D;  4TQ0 A;  2JX5 A;  1J7C A;  1L4Z B;  1FM0 D;  2INP E;  4J3O D;  5FKA C;  4H2A A;  4RGN A;  3EGR A;  1RWS A;  3VRA B;  3OWE B;  1SF0 A;  1TS3 A;  2OED A;  1SB3 C;  2V3P A;  2TSS A;  4N58 A;  1V97 A;  4NAW B;  2IDY A;  1JWS D;  1C79 A;  3AEA B;  4C7Z A;  5EE3 A;  4C56 C;  4Q2J A;  1TS4 A;  5AUK A;  1LO5 D;  1VZ7 A;  3BZD B;  5G5H A;  1N5W A;  3HVD A;  4M0W A;  1Q10 A;  2EEL A;  2K3U A;  1NYR A;  2RMM A;  1KTK A;  1M4V A;  1EWY C;  2WXI A;  1ACC A;  3UI3 A;  3P4Q B;  3URY A;  4ZHO A;  4JX1 C;  1KLG D;  2IGG A;  1QOA A;  2N9K A;  2WXF A;  3MHZ A;  4HKZ E;  5EE1 A;  2KQ4 X;  3ZQ4 A;  1IBX A;  4US8 A;  3MP9 A;  1L6V A;  2QIL A;  3E56 A;  4HEA 1;  2LHE A;  3NVZ A;  2INN E;  2JYE A;  4YSY B;  1T6B X;  3IAS 1;  2BS3 B;  2NTT A;  2Q5W D;  1JRP A;  2ZW0 A;  4P6V F;  2BBC A;  1WRI A;  5MPO A;  1MVK A;  5I4D A;  1TY0 A;  1FIQ A;  2K5P A;  1N63 A;  4YTN B;  4NAM A;  2YEP B;  1ZXI A;  1JWB D;  2WNM A;  1P7E A;  4DQO C;  1AYF A;  5LNK 1;  1L0Y B;  5HG2 A;  1FXI A;  4JWS C;  4JWU C;  2JSV X;  2JU6 X;  4WQM A;  5EE9 A;  2VZK D;  4P16 A;  1HXY D;  3P4S B;  4YTM B;  1L0X B;  3AB5 A;  3Q8A A;  4AQ7 A;  3AE6 B;  1GB4 A;  5JXV A;  3L4P A;  1I4X A;  1I4R A;  1WGK A;  3TEY A;  1FD6 A;  4ZOH C;  2WXO A;  4YWG G;  2BW2 A;  4A8X C;  2J53 A;  3R2T A;  4D2K A;  4ZRQ A;  2ZW1 A;  2LEK A;  2QEJ C;  2IGD A;  1JWM D;  2JWU A;  4TMA B;  4RCO A;  3KWL A;  5HI1 A;  3ZJU A;  3LXF A;  2CU3 A;  1JRO A;  1SXT A;  1VDV A;  2SAK A;  2MJD A;  2PLP A;  1VZ8 A;  1EU4 A;  2W54 A;  4CQN A;  4TSS A;  2PVO D;  4RGT A;  1STE A;  1OQR A;  4ITK A;  4MM3 B;  2WXL A;  4LK0 M;  1R7S A;  3V3X A;  3R8B A;  4RF0 A;  1ENF A;  2Z8L A;  3TEX A;  1FNV A;  1UWX A;  1WSP A;  4OZA A;  2V4I B;  2DYO A;  2L52 A;  5BMH A;  4KGS A;  5BYS A;  3AE8 B;  3VRB B;  2IPK D;  1JQ4 A;  3AH7 A;  2GB1 A;  1MPE A;  2I38 A;  2H89 B;  3GP7 A;  4N59 A;  5BYR A;  1JML A;  1ZP0 B;  2QSD A;  2N9L A;  1L6U A;  1JCK B;  1PYW D;  3TEZ A;  1FCL A;  4YXD B;  3W9C B;  2GI9 A;  1SJH D;  2WU2 B;  2W82 A;  4WAF A;  5AUI A;  3MJ5 A;  1ZE3 D;  2M0A A;  1EWC A;  5EE0 A;  3KLS X;  3AEF B;  2KAJ A;  3AEB B;  1TKY A;  2KWD A;  2QJL A;  3BYY B;  4GDL B;  3T3O A;  4B0E A;  2LMC A;  4KKJ A;  4A9A A;  1AW7 A;  3Q8B A;  3SFD B;  4WWM A;  2PTL A;  3V05 A;  4TQ1 A;  1QOB A;  4HKQ A;  1XEE A;  2D5G A;  1N60 A;  2OHF A;  5GXG B;  1FMA D;  2XN9 C;  1NI3 A;  1ZDX A;  1ZPS A;  1TS2 A;  2WXG A;  3C8Y A;  1OFF A;  3FAH A;  3NZ3 A;  3P4P B;  3BII D;  3CIR B;  4OZB A;  1ROE A;  1MHX A;  3B2G A;  2N7J A;  1DOX A;  3GS2 A;  2AQ3 B;  3AEC B;  3AED B;  4OHJ A;  1CK1 A;  1YJJ A;  3N9Y C;  3ZYY X;  1C76 A;  3AEG B;  2NMQ A;  2LGI A;  2KMM A;  2WDV B;  1UWM A;  1F77 A;  1HZ5 A;  1T5X D;  1XF5 L;  3W1S A;  3ZGZ A;  5HHD G;  2RDG A;  1FNW A;  2E3T A;  4MH8 A;  1C4P A;  3SR6 A;  1QF6 A;  2RDH A;  4XDC A;  2WLB A;  1HZ6 A;  1CZP A;  1YJI A;  4OZC A;  4WIP A;  3TSS A;  1QQR A;  1GB1 A;  4RFB A;  2FBW B;  4DXG A;  2PIA A;  2WP9 B;  3VQI A;  2GRI A;  3U2S C;  2E6X A;  2W3S A;  1UGJ A;  1SIJ A;  3IT6 B;  3NVW A;  1F2R C;  1FFU A;  5C3J B;  1D5M C;  4MAC A;  3EUB 2;  4HRO A;  1L4D B;  3AE9 B;  4RNA A;  1PGB A;  4YSZ B;  4RF1 A;  3P1M A;  1FRR A;  1FFV A;  1BXT A;  2Y5C A;  1JW9 D;  3W5U B;  1HQR D;  3NVV A;  3FIL B;  1FEH A;  2IGH A;  4O1N A;  2L1A A;  1F2R I;  1CQV A;  3CWI A;  1XCT L;  2NTS A;  2BTE A;  2HDE A;  1YMH E;  3IXS A;  3LB8 C;  2B76 B;  4KKI A;  4N6E B;  1L5P A;  2SEB D;  1IGC A;  1CJE A;  1UNS A;  3B2F A;  3W2D A;  2DWQ A;  5FK9 C;  1YQ3 B;  2QIE B;  3KWV A;  4FXC A;  4ARI A;  1C9F A;  2WXN A;  4JPS A;  1QOF A;  2AX5 A;  4GLS C;  3ABV B;  5T8I A;  1J7B A;  4JE3 B;  2ACZ B;  1V1O A;  3HUI A;  4C80 A;  4LLG M;  1TKG A;  1DOY A;  1SE4 A;  4DXF A;  3SFE B;  3BK1 A;  4RGM A;  4ZHP A;  4US9 A;  1C4C A;  1XLO A;  3I9V 1;  1A70 A;  1KH0 A;  2QMT A;  2PKO A;  2BS2 B;  2WU5 B;  3NS1 A;  1DOI A;  2R61 A;  2V3N A;  4LTU A;  1SJE D;  1YN3 A;  4USA A;  2MJE A;  2PW9 A;  2WXM A;  4OW0 A;  1B9R A;  3Q8E A;  1TS5 A;  4L23 A;  3AM9 A;  1D5X C;  3E9S A;  1K52 A;  5D3I B;  5TSS A;  3IT4 B;  2Y5P A;  5D3D A;  1TZO A;  2N0S B;  1GOZ A;  2RPV A;  1TKE A;  3RPF C;  3H8H A;  2BS4 B;  3IAM 1;  1DYQ A;  2K9X A;  1RFK A;  1P7F A;  2JYT A;  1B1Z A;  2MH7 A;  3AE5 B;  2WXQ A;  3P42 A;  4YT0 B;  3ZJV A;  2Y3A A;  1ZOY B;  1PGA A;  2L83 A;  1C4A A;  3VR8 B;  4XWW A;  1VR9 A;  2I2Y A;  3RFZ B;  3EA6 A;  5G5G A;  1BML C;  3W5V B;  3ZJT A;  1NVI D;  1SSN A;  2PVG C;  1D4B A;  2KDM A;  1N5X A;  1D5Z C;  1E6E B;  4UDU C;  2FUG 1;  3Q8F A;  3AN1 A;  1AN8 A;  1ZDV A;  1HA5 A;  4IDI A;  1TY2 A;  1PUT A;  1K53 A;  2VZK B;  3DWG C;  4KX6 B;  5BMI A;  1XLN A;  1FNU A;  2LJI A;  3DWM A;  4KGR A;  1BUI C;  1DGJ A;  1PDX A;  1JWU D;  3J9C A;  4WH4 A;  4RH6 A;  4C7Y A;  2H88 B;  3BVM A;  4OVZ A;  1NYQ A;  1N62 A;  1FXA A;  2J42 A;  1XCQ L;  1XXG A;  3HRD D;  1SEB D;  2ON8 A;  2WXH A;  1WWT A;  2BB5 A;  1SE2 A;  5FR3 A;  3T3N A;  1KRH A;  1J7A A;  2BYT A;  2JQR B;  1RYJ A;  1WYG A;  1YNT E;  1JAL A;  1V1P B;  1YQ4 B;  1VJK A;  3Q69 A;  3O13 A;  2KN4 A;  1XLQ A;  2M56 B;  2WXR A;  4NJC A;  1HEZ E;  4A55 A;  4RGO S;  2WXJ A;  1OQQ A;  2WXP A;  1EM7 A;  2L32 A;  1E9M A;  4ARC A;  2EKI A;  2MJ3 A;  1F0Z A;  4IOI E;  1ZXH A;  5E6J A;  2WQY B;  2W3R A;  1QT9 A;  2LHD A;  2HTM E;  2J4X A;  1N61 A;  2DBY A;  3BK2 A;  1I4G A;  1XO3 A;  1MI0 A;  1YN4 A;  4ZRP A;  4EE2 A;  4WUR A;  5D7G A;  1I4H A;  3R2I A;  3GB1 A;  3FC4 A;  3AMZ A;  2G1E A;  4L1B A;  3AE4 B;  4KGT A;  1SE3 A;  3WCQ A;  1GPX A;  1VLB A;  2AQ2 B;  3P63 A;  1FO4 A;  1MHH E;  3P4R B;  1D6E C;  2LUM A;  3AE1 B;  1QIL A;  4IKG A;  4XDD A;  1C78 A;  1QLB B;  3U4E G;  1E10 A;  1ESF A;  3VR9 B;  4YTP B;  2WDQ B;  1NEN B;  2M19 A;  4GDK B;  4HJG E;  5H8Y E;  2DYM A;  4ZYS A;  5C2T B;  1FRD A;  2CJO A;  3MC0 B;  4XWT A;  3AE2 B;  1QOG A;  1TJE A;  2LFI A;  3HVZ A;  3Q8C A;  2ONQ A;  2G9H D;  1E7P B;  2YEP F;  1SBB B;  5H92 C;  3TUO A;  1I4Q A;  1IGD A;  3AEE B;  1EU3 A;  4R3D A;  5BMG A;  1WXQ A;  3BVZ A;  3NVY A;  1I7H A;  1ZUD 2;  2WXK A;  1VZ6 A;  2WS3 B;  2CJN A;  3SEB A;  1JWA D;  4REZ A;  2DLB A;  1PFD A;  1K50 A;  2X38 A;  3U7Z A;  1Y56 A;  1UUP A;  2ICI A;  3NUH B;  3TEW A;  3PO0 A;  1NEK B;  1XLP A;  5HFY A;  3I57 A;  1V1P A;  1VRA B;  1KF6 B;  1YN5 A;  2AQ1 B;  1QKZ A;  2FE8 A;  2K22 A;  3KQ4 A;  5BYQ A;  1I4P A;  3B9J A;  4PT5 A;  1IBX B;  3NRZ A;  1KFY B;  1AWD A;  1FCC C;  3PZ7 A;  1TYG B;  1IUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...