1PGXA

The 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
ELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEMVTEVPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title 1.67-A X-ray structure of the B2 immunoglobulin-binding domain of streptococcal protein G and comparison to the NMR structure of the B1 domain.
pubmed doi rcsb
source organism Streptococcus
molecule tags Immunoglobulin binding protein
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1992-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgxA00
2ZW1A 5HG2A 5HFYA 1XF5L 1UWXA 3V3XA 1XCTL 1MPEA 1YNTE 1JMLA 1FD6A 2KWDA 1MI0A 1F2RI 5HI1A 2IGHA 1EM7A 2EELA 2GI9A 2JWUA 5BMGA 2N7JA 2RPVA 1K53A 3FILB 1MVKA 2NMQA 2KQ4X 2KACA 1QKZA 5JXVA 1ZXHA 4OZAA 1GB1A 2JZPA 3GB1A 2I2YA 1GB4A 2LUMA 1D4BA 2KN4A 1C9FA 2JXTA 2K0PA 1K51A 2JU6X 4IKGA 1XCQL 3UI3A 2N9LA 2N9KA 2PW9A 1K50A 5HHDG 4OZCA 1MHXA 1HEZE 2IGGA 2LHEA 4IOIE 2OEDA 4HJGE 4D2KA 1FCCC 4OZBA 2PLPA 1PGBA 1Q10A 2GB1A 1IGDA 2QSDA 3FILA 4HKZE 1HZ5A 1HZ6A 1IBXB 1KH0A 2J52A 1MHHE 1PGXA 4KGTA 1IGCA 1F2RC 2KDMA 4MACA 2ON8A 2QMTA 1K52A 2PTLA 3MP9A 1PGAA 2RMMA 4GLSC 1YMHE 1P7FA 4KGSA 5BMHA 2IGDA 2ZW0A 1FCLA 2LGIA 4WH4A 1IBXA 2JSVX 5BMIA 2LHDA 2J53A 1P7EA 4KGRA 2I38A 2ONQA
chains in the Genus database with same CATH superfamily
2WDRB 1TY0A 4EFOA 2IDYA 1V2YA 4ZRIA 2ZPNA 4ANUA 3FC4A 1T5XD 2KANA 3NZUA 4FJYA 3ZXVA 1F2RI 2B3AA 2V9HA 1ZKHA 5E6PA 2ICIA 1E6EB 2GBNA 3X23A 2CHXA 1TIFA 2WDQB 2GMIC 2LI5A 4AQ7A 2G9HD 3OG5A 3L4PA 3VQIA 2KAJA 2J4XA 4HDQA 2BS4B 2N9XA 2BYTA 3U4EG 1AW7A 3S2AA 1XLQA 2OJRA 2J0KA 4ITKA 3HM3A 4M8MA 1VD2A 3A1QA 2JY6A 1SJHD 4HJGE 1C77A 4S17A 3RFZB 3NZ3A 3DVNV 1FXIA 4ZRPA 1P1AA 2WQYB 1DOXA 4ARCA 2LGSA 2DZKA 2LFIA 1F0ZA 2G3QB 2NBVB 4PS8A 3TUOA 1FNVA 4P16A 1L0VB 1UGMA 5G5HA 1M94A 4ZHPA 1T6BX 2JRHA 3ZNID 2KN5A 3KQ4A 1TS2A 2IBIB 2BGFA 2LGIA 4WH4A 2JSVX 3RNGC 4AJWA 3BZDB 4RM8A 4W9IA 2MBOA 1TZOA 3PZDA 3PRZA 1I4RA 2BKFA 4YL8A 3LDZE 3Q3JA 2C60A 4GXBA 3V3XA 2R2QA 2JYTA 2KYWA 3PPAA 2IO1B 2WHIA 1K8RB 3VDZA 1TS3A 3TEYA 3KWLA 3SDLC 4EE2A 1AWDA 2JWUA 3UIPB 3ZO5B 2WXOA 3RNAC 2LGYA 1GJZA 1T0QC 3HHMA 2LUEA 1ZGUB 4EZLA 1WJUA 1YQ4B 1FEHA 1S3SG 1WRIA 1GC7A 3ZW3A 3NS8A 2RR9A 4C7ZA 2QEJC 4BZAA 3JVZX 4GDLB 3Q3NC 1PYWD 1SBBB 2AYOB 4FJVB 2KVRA 1OQYA 1V97A 5BYRA 1BXTA 5J17A 4URKA 4LNOA 2KFKB 3ZLZA 3EFUA 1G6JA 4DHJD 2DZIA 1AYFA 4IG7B 3L10B 3HM6X 5G2NA 4S0RA 5AUIA 3W5VB 1BUIC 3BWUD 1L6UA 1HTOA 3I3TB 1QT9A 1F2RC 2ZCCA 2M1MA 3WA0A 4ZRQA 1RM6C 5D2MB 4GSWA 4GLSC 3AE9B 2FNJB 2KTFA 5BMHA 1SE3A 2YEPF 4LK0M 3PHWB 1SE9A 5IA7A 1TYGB 3N20C 1OTRB 1KOTA 4FADA 5E6OA 2NTTA 3VUWA 5FKAC 1JWBD 3RD2A 4KVGB 2NS5A 5KHQA 1C4CA 1JMLA 3HK0A 2GOWA 4KIKB 5T8IA 1YN5A 1E8YA 1OEYA 2PE6B 2NBUA 3KUZA 1XLOA 2M0AA 2N7JA 2MRPA 1J0GA 3KWVA 4F8CB 3Q3OC 2KACA 1PDXA 2MH7A 2L00B 1E8XA 2WXLA 2KKCA 2IZVB 2FBWB 4LDTB 4IM0A 1GG3A 4K7WA 1CJEA 2WU5B 3UF8A 1C9FA 5G55A 2O6VD 1R4MB 2FUHB 4PT5A 3AE8B 2QC8A 2DAJA 2CU3A 4NAMA 3O65B 4RGNA 4GGQA 3EFCA 1WMHB 1FPYA 3ZJTA 2PEAA 3X0WA 4IWQA 4N58A 2E6XA 1ZE3D 3AECB 2GBJA 4XDDA 3AEAB 2JRIB 4MSMB 2KTRA 2Y5PA 4IM3A 1IGDA 1VZ6A 4EZJA 3M95A 2L8JA 5DPSA 2LVPA 5G5GA 3CSTA 4BOSC 1OFFA 1UNSA 1WX7A 3V6CB 1L4ZB 2KMAA 3DWGC 1E9MA 3AI5A 1RWSA 4MGYE 2FUG1 2KZRA 1YD8U 2IYDB 4B95A 3MP9A 1R4NI 2D3CA 4MH8A 1UELA 3P42A 2ZW0A 1FNWA 3QCAA 4LLGM 3L08A 2DWQA 2L3ZA 4RF0A 1MG8A 2QILA 2JF5A 2O6VA 2QJLA 3ZNHB 3OAWA 2D2QA 1CMXB 2WWZA 2V1YA 5FR3A 3IXSA 1UD7A 1WX8A 3NRZA 2PKOA 2WXMA 1C76A 4AP4C 1DGJA 3PTFC 2MJEA 1E0ZA 2AL3A 3FILB 1XXGA 3AE6B 4USAA 2C7NB 4RGOS 3N9YC 5I4DA 3VR8B 3GB1A 4DXAB 1WWTA 1WXSA 4NZLB 3Q8FA 4JPSA 2O2VA 2WXNA 1Z5SB 2ASQA 4HPLB 5FR6A 2ZVOA 4BKSD 3Q8BA 3ZUNA 3PSEB 3DBHI 3KYCD 4HPPA 4M0WA 2PW9A 4HROA 1K50A 5GMVA 3R7RA 2SEBD 2C7HA 2Z8LA 2C7MB 3APFA 3BVMA 1VDVA 1EUVB 3URYA 2XEWA 3W9CB 3IFWB 2DYBA 3TSSA 4D2KA 2HTME 4PK1A 3NVZA 1YX6B 2WYQA 2PLPA 3I9V1 2VZKD 2LJIA 2M4NA 2BB5A 3AE5B 1F52A 4OW0A 1QOBA 3R2IA 2J52A 3WALA 3UQBA 4GDKB 3R2TA 3A9JA 4XC2A 2QMTA 4G0NB 2Y3AA 1E8ZA 1NYRA 4A3OA 4KSLC 4WIPA 1TZ1A 4DBGA 3RI7C 4GIVA 4BKSA 3MHSD 4PYUA 3L0WB 2K3UA 1CK1A 1Q5WB 2BPSA 1QILA 1V49A 1WFYA 2I1JA 2B76B 1WYGA 4W9JA 3QA8A 4I6PA 3SU8X 4FN2A 2KC1A 4F1SA 4WJNA 3VXWA 2KNBA 4M8NA 2LJ5A 4N59A 3ZTCA 4WJPA 1NI2A 1XEEA 3NVYA 1YJIA 4K81A 4OVUA 3T8MA 2I2YA 1WYWB 1E10A 4P6VF 2ACZB 2K6QA 3NJTA 1WM2A 1ZUD2 4BOZB 2KN4A 4II3B 2JQRB 3ZYYX 1XCQL 4GB9A 3EA6A 1LO5D 3EGRA 3MJ5A 2ZNVB 1Y8RC 1X1MA 2L05A 3NVVA 4ANVA 3AEBB 2V0GA 1L4DB 2MEKA 3A33B 3TEWA 4YWGG 4DQOC 4I6LB 4WJOA 2G1EA 2DENB 1YJ1A 2GB1A 5C2TB 1M4VA 1WXMA 1ROEA 4JWUC 5LXIB 2L76A 2JX5A 4JWSC 3Q69A 1XQQA 3AEFB 1WR6E 1KLUD 2IJ0A 2PTLA 1EU3A 3UINB 1WJNA 4KGSA 1QLBB 3RCZA 4OHJA 1N5XA 1D5XC 4G3XB 4KKIA 1UF0A 2VRRB 3P4RB 5GXGB 1J19A 4TQ0A 1TKYA 2ONQA 4M01A 4GN1A 1WJ4A 2K39A 1UWXA 2LMCA 4CYEA 3PHXB 1YNTE 4MJSB 3OJ3A 4LTUA 4L2YA 1FD6A 4ZRKA 2ZPYA 1P3QU 5AZHA 4KSKC 3AU5A 2K6DB 2KVZA 3KH0A 1C4AA 2YVCA 4UDUC 1ESFA 1TKGA 3RNCC 2PJHA 4HDOA 1YIWA 4E74A 4XZ4A 3PLVA 4FULA 4BAXA 3ENEA 2JZZA 4KDIC 4FLHA 1RYJA 3KUDB 4A6QA 2JZPA 2IO2B 1GNUA 2K8CA 3VAWA 4QAYA 2KLGA 4LNIA 1EO6A 1MJDA 3B0AA 2V3SA 3DHIC 3ZJVA 3DVNU 3QHTA 3PLUA 3M3JA 1JWAD 2KDFB 1FMAD 4MDKE 1TKEA 1HEZE 2IO0B 3APCA 5JHAA 1N63A 2Z59B 1TY2A 1VLBA 4JGHB 3Q8AA 3QARA 4BKTA 3K9OB 2KD0A 3IAM1 2AX5A 1QOAA 1SXTA 4GDLA 1N6ZA 2LXAA 4RF1A 2J0MA 1C78A 1HZ5A 4HWIB 4IC7B 3ZQ4A 3ML9A 4LNFA 3L17A 4KDLB 4P7IA 1KLGD 4YXDB 2K8BA 3TEZA 2KFKA 2L83A 4TQ1A 1SEBD 3AEDB 3IHPC 1Y56A 2IGDA 3H7PB 2W54A 2K5PA 4RNAA 4P1BC 3VRAB 4KGRA 2I38A 2KT7A 4KZCA 1BT0A 4HCPB 2Y5CA 3QX1A 3RNFC 1WY8A 2MW5A 2WS3B 2IGHA 3KVFB 3H8HA 4OVZA 3KW5B 1KTKA 3P4QB 1RAXA 1LGRA 4GOCA 2WX1A 2LD9A 4N9F4 3NY5A 1GB4A 3HRDD 3JYUA 2JUOA 3JSVA 1UWMA 1WJ6A 5D94A 3EHVA 2KXJA 1PQSA 4HEA1 2PVGC 1WXVA 2ZZPB 4YTMB 2N9LA 5CHWA 1FFVA 4I6NB 4DHZB 2KOXA 4XWTA 4FA6A 5CHVC 2D3AA 2N7DA 3MC8A 4LNNA 3VRBB 3JW0X 2SAKA 3RMKC 1V1PB 2QDFA 5DCNA 3PT2B 1A5RA 4W9KA 3VH4B 4IM2A 3V62A 3DBLB 2LZ6A 1WMHA 4MM3B 1FM0D 2WX0A 1WH3A 3AE1B 2FIDA 1KH0A 2OOBB 4NAWA 3U2SC 3B2FA 2FAZA 2TSSA 3AE2B 2K25A 5IP4D 3FKYA 4JIOU 4NQLB 1V8CA 3SR6A 1R4MI 1P7FA 2MQJA 1CZPA 2C5LC 5DPTA 1FCLA 2HTHA 1N61A 4WURA 2LHDA 4ICVA 2W82A 2BVCA 3L54A 2D5GA 1V81A 1ZW7A 1EF5A 3DBRI 4C80A 1OQRA 3QAQA 2D07B 3UGBB 1EM7A 4XDCA 1YOVB 5L83A 3NG0A 4E3CA 2HJ1A 3ALBA 2WXKA 2KQ4X 4AWJA 4WWMA 2AQ3B 2HDEA 2WGSA 3RULA 2DZJA 2LVQA 2RPQA 3A9KB 2YEPB 1EWCA 2PPHA 3GZNI 1TS5A 5DPWA 5C3JB 2KWCA 2BWFA 2K0PA 3RYTA 2PE9A 2CJOA 4XYCA 3DVGY 1SE2A 1C79A 5KHOA 4IW0A 2NPTA 3C0RB 1QF6A 2XNAC 2GBMA 2KJ6A 1PFDA 4A55A 4LJOB 2CHWA 4A9AA 1UUPA 1I4GA 3TCAA 3GS2A 2MBBB 1Q10A 2LXCA 2EKEC 1YQ3B 3MJWA 3ZKJC 1HZ6A 2N7EA 1IBXB 4A3PA 3LXFA 1V5OA 1WGKA 4B0MA 4HLEA 2DZMA 4MACA 2HD5B 4YT0B 1Q1OA 3VR9B 3V61A 2CKHB 1YX5B 3UQAA 4A90A 1DOYA 1IUEA 2K1FA 1RLFA 4PS7A 1H8CA 4GMVA 4MGKE 2FCNA 3PZ7A 1V6EA 2MP2A 3H7SA 4ZYNA 3TBLD 3VUXA 5BO4B 3BINA 2BYEA 5CTRC 2KDBA 1J7AA 3P2BA 5HFYA 3T3NA 4C56C 2N1VA 1E7PB 1RFAA 3N1ZC 2L32A 3AH7A 3BYTB 1L0XB 3VTUA 3AE7B 2CU1A 1YN3A 2BYVE 3IT4B 4N6EB 5HI1A 3V6EB 1HQRD 1F1HA 2WDVB 3E56A 1K53A 1WGYA 4BKGA 5EE0A 4MGZE 3RNBC 2KK8A 3H6NA 3VUYA 3ABVB 2LGDA 1WGGA 2G45B 4BBNC 2BQQA 3ZNZB 3VTWA 1SSNA 4WJQA 1SF0A 4YSYB 3OJ4B 4MT5A 5AUKA 3UIOB 4RGTA 2XK5B 4TV3A 1AN8A 4OZCA 3C8YA 3W2DA 1XT9B 2LHEA 2NBWB 4K7SA 3WIMA 3D32A 4K3CA 2L7RA 1I4QA 4JLCA 5C1ZA 2OJWA 4REZA 1RFKA 2DYMA 1V86A 4WQOB 4P1CC 5JZEB 4FXCA 3ZTDA 4HXDA 2Z0DB 3NHEB 2KX3A 4RCOA 3SEBA 1NDDA 3R3MA 4C4VB 2MSED 3KYDD 2KDMA 4DHJB 2R2OA 1PGAA 2INDC 2M0XA 2KHWB 1D6EC 3EUB2 1NI3A 5BMIA 3ETRA 1P98A 5LLIA 3TMPB 4G11A 3ECIA 5HG2A 1XF5L 3AEEB 1KM7A 3A4RA 3CIRB 4KV2A 4KKJA 3H1UA 2RGFA 4OVVA 2BS3B 2KWDA 2VH2A 1R4NB 3DPDA 1MI0A 3W1SA 4LCDE 3U7ZA 1SE4A 2KTRB 5BMGA 3H9DA 1SB3C 3RZWC 1TBEA 3TEXA 4EUTA 3RUIB 3AMZA 2W55A 1KLVA 4YSXB 3AEGB 1UBIA 4JE3B 2A4ZA 4W9FA 3W1YA 5BYQA 2GLSA 4B9KA 2MCNB 3W5UB 1B9RA 4RH6A 2O6VB 1TJEA 1Q0WB 3IT6B 4IOIE 4AOFA 4HKQA 1OGWA 5FK9C 4YTNB 3B2GA 3P1MA 2M56B 2PVOD 1V9JA 3A4SC 1YQBA 2W3RA 1I4PA 2CHZA 1WGHA 4WWNA 3DBHB 2J42A 2FCQA 1L7YA 1J8CA 1JW9D 3PV1A 3WANA 4DDGD 4W9DA 3ZDMC 2K9XA 2KDEB 2N9PC 2N1WA 2D11A 4B6WA 3KUCB 4RFBA 2MLBA 1YMHE 2MA9B 2O2VB 4JL9A 5D3DA 1UBQA 2ZJDA 1JRPA 3VTVA 3J9CA 3HVDA 4US8A 1T0RC 1YN4A 1QOGA 4M0WB 4ICUA 1P7EA 1ISNA 2EMSA 2KJHB 3GP7A 2WLBA 2BT6A 5CX3A 2UU7A 3QK0A 4US9A 3QIJA 5AEKB 2IO3B 4W9GA 2GI9A 2WXQA 3AE4B 5IO9A 4HRSA 1H4RA 1SGHA 4IWOA 2BKRB 1QKZA 2WDTB 4GU2A 1TTNA 4ARIA 1FRRA 2AQ1B 1HXYD 2LUMA 2W3SA 1BMLC 1FO4A 1E7VA 3DVGX 2REXA 4NJ6A 5L95C 3RNEC 4DDID 3CMMB 5JH5C 4M02A 3ZRFA 5H8YE 3TJPA 5H92C 1V1OA 5HHDG 1D5MC 4A8XC 4PYZA 3TL5A 2KFJA 3WCQA 1OQQA 5C23A 4BFRA 4FJZA 4YSZB 2N9EB 2J0JA 3ZIMA 1FNUA 3PVLA 2JYEA 1WI0A 1F9JA 4II2B 1XO3A 4RM9A 4WQMA 2HE7A 1E5WA 4NPNA 2X8XX 1I42A 2JPHA 3ZDTA 1ACCA 2WXGA 2RD0A 5JHBA 2DNFA 3QC8B 1WGRA 2VZKB 4X57B 2AL6A 4DXFA 3I63C 4L23A 3I5JC 3ZVVA 2NTSA 2RMMA 1B1ZA 1AARA 4MM3A 4HK2A 1E7UA 4C7YA 2QCZA 3FAHA 3CSFA 3QQ8B 2IPKD 2MX2A 1STEA 3P63A 5EE9A 2ZEQA 2D3GA 1R7SA 1KRHA 2CJNA 2ZW1A 3BY4B 1WGDA 2INNE 4H2AA 3W1SC 1MPEA 4FBJB 4K1RB 4MSQB 2BYFA 2X38A 3AB5A 3DBLI 4RMAA 1PUTA 2RDBC 4NQKE 2DX5B 4WWOA 5D3IB 1XLPA 3RN9C 2WXJA 3MTNB 1WX9A 4LDTD 4DHZE 1ZDXA 1E8WA 1MVKA 2NMQA 2KMMA 1ZXHA 1JRUA 5AZFA 4OZAA 3SD5A 1GB1A 4ZRJA 2XN9C 1D4BA 2G4DB 1IP9A 2LASA 1ZP0B 1GOZA 4HCNB 2MWSB 2K8HA 1NENB 3RT3B 4NJ7A 1L5PA 2JZ3B 2ZCBA 3LJ3A 3AULA 3MFGA 4CO7A 1MHXA 3PREA 1DOIA 4LJPB 3A9KA 1P9DU 4KIKA 1WZ0A 4A20A 2L1AA 4IWPA 5MPOA 2MBQA 1FXAA 2C9WB 3VFKA 4NNJB 2D10A 3N30A 1WXAA 1C1YB 2LRWA 4HKZE 2JXXA 1TS4A 1JWSD 4AUQC 2DYOA 2QHOA 3N1XC 3EC8A 1VZ8A 1WIAA 4KGTA 2WNMA 4ACFA 3M63B 1K52A 5EDSA 2NVUI 2BF8B 1IPGA 4MEMA 3L16A 2MJDA 4W9CA 1I35A 2M8SA 3N3KB 2WXPA 2R61A 2LEKA 3ONSA 1IBXA 3B9JA 1VCBA 1C4PA 3ML8A 2K22A 1VZ7A 5J2RA 1HA5A 1YJJA 3ZRCA 3BVZA 2LRUA 2WXFA 3PRMB 5DPRA 1UGJA 2L0TA 3O13A 2UYZB 2LWPA 1ZOYB 2J7QB 3DHGC 5CHFA 4CHKA 2RDGA 4E71A 1J7CA 1T3QA 2QIEB 2I1KA 1GC6A 2GBKA 2JWZA 2RPVA 4HPMB 4EKUA 3PS6A 3AXCA 4DWFA 1ZXIA 2FCSA 1KFYB 3HUIA 3KLSX 3A1QB 2INPE 3U52E 2Q5WD 2XBBC 2BW2A 3WAMA 1I4XA 1E90A 4MELA 3MHZA 1FRDA 4TUUA 2DHZA 2E3TA 2V3NA 2PIAA 4K7UA 2NR2A 3DCGA 2BS2B 4XX5A 1SIFA 1GPXA 1LQBA 2OEDA 3AV8A 2MBHA 3QWZB 4FHKA 1FCCC 3PGEA 3ZGZA 2KX0A 1WR1A 1J7BA 2NCNA 1PGBA 2XK5A 2V4LA 2PMVA 2QSDA 3FILA 2KMCA 4EOYA 4YTPB 3SHQA 1UZXB 3AU4A 2M17A 4BBNF 3RPFC 2IY0B 2BB6A 4B0EA 1IGCA 3LB8C 4W9LA 1GAQB 3RZFA 3Q6BA 3PO0A 5IAAC 3JSVB 4NJCA 2KQSA 4XWWA 1WXQA 1TGZB 2Z0EB 3BIID 3Q14C 4C4VA 3V60A 2J53A 2LVOA 3ZNGC 4ZHOA 3QJZA 1WE6A 4TKNA 1LFDA 3R66C 2UWQA 4NY0A 4ZOHC 3R8BA 1EU4A 3M62B 1LXDA 1HTQA 1LM8B 1L2NA 3SFEB 3BYYB 1WRDB 1F77A 2GBRA 2HJ8A 4L1BA 4GDKA 1ZPSA 3N32A 3ZXRA 3Q3FA 4WWPA 4NAWB 2WU2B 3K9PB 2IY1B 1WE7A 3L13A 4AJYB 3P4PB 4ZDVA 1I4HA 3DBRB 3EECA 1V80A 3B1LX 3Q3MC 4IUMB 4EZKA 1FIQA 1KJTA 3IBEA 2JXTA 4WAFA 2V3PA 2JU6X 1QZEA 4IKGA 1IYFA 1JALA 3AE3B 3GE8C 3VHTC 3VH3B 3BK2A 5E6JA 4XE0A 3VVWB 2DLBA 3P4SB 2BBCA 2ZVNA 3GZNB 4TMAB 3Q8EA 1D5ZC 1C3TA 1JROA 5EE3A 3R7QA 5IOIA 3NS1A 1L6VA 1V5TA 3NOBA 2MJ3A 2AWTA 3U7DA 1D3ZA 1MHHE 3NZSA 3PRPB 3IAS1 2ON8A 3DDCB 2MHJA 1A70A 1ENFA 4O1NA 1CQVA 3NUHB 5IN7A 4W9EA 2EMTA 4IDIA 4MH0E 2A5UA 1I7HA 1MG4A 1N60A 3UI3A 2INCC 1OEYJ 2NPTB 2EKIA 1XCTL 1QQRA 3OLMD 1EWYC 2KQ7A 2KO3A 3DOWA 1JWUD 5D6JB 4ANWA 2Y5BB 1HE8A 4LNKA 2MBEA 1XLNA 1FXTB 3GOEA 5JXVA 2VH1A 4ASWC 4F7ZA 2LGXA 1TT5B 2CR5A 1GUAB 3Q8CA 1JWMD 3WAPA 5E6NA 3IVFA 4J6IA 1K51A 3DBSA 4M00A 4PS3A 2H88B 4Q2JA 1NYQA 5D7GA 3U8ZA 1SJED 2KLCA 1JQ4A 4MGIE 1P0RA 3PZ8A 2W9NA 2IGGA 2MP2B 4MJSA 5EE1A 1JCKB 3CWIA 4CQNA 3AM9A 4OZBA 3TIXA 2M19A 4G50A 2L52A 1WF9A 2L0FA 3E9SA 1NBFC 3Q2AC 2H89B 1VR9A 2DAFA 3DWMA 5LNK1 1ZDVA 3APDA 4FHJA 2WXRA 2FE8A 4JX1C 3U30A 1Z2MA 1L0YB 2JT4B 3WAOA 2BTEA 1ET6A 3ZJUA 3DHHC 1VJKA 1KF6B 4TSSA 3SFDB 2AEHA 3I57A 1NEKB 2BWES 4EEWA 5J18A 2YLMA 2WXIA 2OHFA 3T3OA 5AZGA 1WZ3A 1WM3A 2N4FA 2EELA 4C00A 4ZYSA 4HJKA 1QOFA 3HVZA 5LXHA 3NVWA 4J3OD 1T0SC 2FCMA 4AS1A 3MC9A 4RGMA 2RDHA 2KJRA 5TSSA 3B08A 4BVUC 4KX6B 4DXGA 3GE3C 2N0SB 3H7PA 2CS4A 2KWVB 2WXHA 5IKCM 5BYSA 1WSPA 2KWUB 3BVGA 2N9KA 1RRBA 3DQVA 3BK1A 1EF1A 1XD3B 2JVCA 3CF6E 4KZ0A 3A9JB 1VRAB 2WP9B 1T0YA 2GRIA 2KC2A 3C19A 4ANXA 2G4SA 4XGAB 3N1YC 3V05A 1FFUA 3OWEB 2D3BA 1MFWA 1PGXA 1S1QB 3IG3A 2FIFA 2AQ2B 1UH6A 1N5WA 4R3DA 3T9LA 1NVID 2RSUA 2DBYA 2ZNVC 1DYQA 3MC0B 5HKHA 2V4IB 4W9HA 4HVBA 4DK5A 4JQWC 3AN1A 3LYYA 1ET9A 5TR5A 4K3BA 2KDIA 1SIJA 1U4AA 3HIZA 4WAAA 1N62A 1V1PA
chains in the Genus database with same CATH topology
1HA5A 1CK1A 1J7AA 1YJJA 5HFYA 2WDRB 3BVZA 1TY0A 3T3NA 4C56C 2WXFA 1E7PB 1QILA 2IDYA 2B76B 1WYGA 2L32A 3AH7A 3BYTB 1L0XB 3FC4A 1T5XD 3AE7B 1UGJA 1YN3A 4N6EB 1F2RI 3IT4B 3O13A 5HI1A 1ZOYB 2RDGA 1HQRD 1J7CA 1T3QA 2WDVB 2QIEB 3E56A 2RPVA 1K53A 4N59A 5EE0A 2ICIA 1E6EB 1ZXIA 3HUIA 1KFYB 1XEEA 3NVYA 3KLSX 1YJIA 2I2YA 3ABVB 1E10A 2WDQB 4P6VF 2ACZB 2INPE 1SSNA 1ZUD2 4AQ7A 2G9HD 1SF0A 3U52E 2Q5WD 2KN4A 3L4PA 4YSYB 2BW2A 3VQIA 2KAJA 2JQRB 2J4XA 1I4XA 4MT5A 5AUKA 2BS4B 2BYTA 3U4EG 3ZYYX 1AW7A 3MHZA 1FRDA 1XLQA 2E3TA 2V3NA 2PIAA 1XCQL 4RGTA 3EA6A 4ITKA 1LO5D 3EGRA 3MJ5A 1AN8A 4OZCA 3C8YA 3W2DA 2BS2B 2LHEA 3NVVA 1GPXA 1SJHD 3AEBB 2OEDA 3AV8A 4HJGE 1L4DB 2MEKA 2V0GA 1C77A 1FCCC 3RFZB 3TEWA 4YWGG 4DQOC 3NZ3A 3ZGZA 1J7BA 1I4QA 1PGBA 2G1EA 2GB1A 4REZA 2PMVA 2QSDA 3FILA 5C2TB 1M4VA 1FXIA 1RFKA 2DYMA 4ZRPA 2WQYB 4FXCA 4ARCA 1DOXA 1ROEA 4YTPB 4JWUC 4RCOA 3SEBA 3RPFC 2BB6A 2LFIA 4B0EA 1IGCA 3LB8C 2JX5A 1F0ZA 4JWSC 3Q69A 1GAQB 3TUOA 2KDMA 3AEFB 1FNVA 4P16A 1L0VB 5G5HA 1KLUD 2IJ0A 2PTLA 3PO0A 1EU3A 4ZHPA 1T6BX 1PGAA 4NJCA 4KGSA 1D6EC 3EUB2 1QLBB 3KQ4A 1TS2A 1WXQA 4XWWA 4OHJA 2LGIA 4WH4A 1N5XA 1NI3A 2JSVX 3BIID 3ETRA 5BMIA 1D5XC 4KKIA 3BZDB 3P4RB 1TZOA 5GXGB 4TQ0A 1I4RA 2J53A 1TKYA 2ONQA 4ZHOA 5HG2A 1XF5L 1UWXA 3AEEB 2LMCA 3V3XA 4ZOHC 2JYTA 3CIRB 1YNTE 3R8BA 4KKJA 1EU4A 1FD6A 4LTUA 4L2YA 2BS3B 2KWDA 1MI0A 1TS3A 3TEYA 1C4AA 3W1SA 3KWLA 4UDUC 4EE2A 1AWDA 1ESFA 3SFEB 1TKGA 3U7ZA 1SE4A 2JWUA 3BYYB 5BMGA 1F77A 1SB3C 2WXOA 4L1BA 3TEXA 1ZPSA 1RYJA 4NAWB 4A6QA 2JZPA 2WU2B 3AMZA 2W55A 4YSXB 3P4PB 1I4HA 1YQ4B 3AEGB 1FEHA 1WRIA 4JE3B 1FIQA 2JXTA 3ZJVA 4WAFA 2V3PA 4C7ZA 2JU6X 4IKGA 5BYQA 2QEJC 1JWAD 4GDLB 3W5UB 1FMAD 1B9RA 4RH6A 1TKEA 1PYWD 1JALA 3AE3B 1HEZE 1SBBB 3BK2A 5E6JA 1TJEA 3IT6B 4IOIE 1N63A 4XE0A 4HKQA 5FK9C 4YTNB 3B2GA 1TY2A 1V97A 2DLBA 1VLBA 3P1MA 3P4SB 5BYRA 1BXTA 2M56B 2PVOD 3Q8AA 2BBCA 3IAM1 2AX5A 1QOAA 2W3RA 1I4PA 1SXTA 4TMAB 3Q8EA 1D5ZC 1JROA 5EE3A 4RF1A 1AYFA 3NS1A 2J42A 1C78A 1L6VA 1HZ5A 3ZQ4A 2MJ3A 1JW9D 5AUIA 3W5VB 1MHHE 2K9XA 1BUIC 3BWUD 1L6UA 1QT9A 1F2RC 3IAS1 2ON8A 4RFBA 1KLGD 4YXDB 4ZRQA 3TEZA 2L83A 1RM6C 1A70A 4TQ1A 1SEBD 3AEDB 4GLSC 1YMHE 3AE9B 5D3DA 1Y56A 1ENFA 4O1NA 1SE3A 2IGDA 2YEPF 4LK0M 5BMHA 1JRPA 1TYGB 2W54A 2K5PA 4RNAA 1CQVA 3NUHB 3J9CA 3HVDA 4US8A 1YN4A 4IDIA 1QOGA 1I7HA 3VRAB 1P7EA 4KGRA 2NTTA 2I38A 1N60A 3UI3A 5FKAC 1JWBD 2Y5CA 2EKIA 1XCTL 1QQRA 1EWYC 1C4CA 1JMLA 2WS3B 3GP7A 2WLBA 2BT6A 5T8IA 1JWUD 1YN5A 2IGHA 4US9A 2GI9A 3H8HA 1XLOA 2M0AA 2WXQA 3AE4B 2N7JA 4HRSA 1XLNA 4OVZA 1KTKA 3KWVA 3P4QB 2KACA 1QKZA 1PDXA 5JXVA 4ARIA 1FRRA 2MH7A 2AQ1B 1HXYD 2LUMA 1GB4A 2W3SA 1BMLC 3HRDD 2WXLA 2FBWB 1FO4A 1UWMA 3Q8CA 1JWMD 1CJEA 2WU5B 1C9FA 4HEA1 1K51A 2PVGC 4PT5A 3AE8B 2H88B 4YTMB 4Q2JA 1NYQA 2CU3A 4NAMA 5H8YE 2N9LA 5D7GA 1SJED 4RGNA 1FFVA 5H92C 1V1OA 5HHDG 1D5MC 1JQ4A 4A8XC 3ZJTA 4XWTA 3PZ8A 3WCQA 1OQQA 2IGGA 4N58A 2E6XA 3VRBB 1ZE3D 4YSZB 3AECB 2SAKA 1V1PB 4XDDA 1FNUA 2JYEA 3AEAB 1JCKB 3CWIA 5EE1A 4CQNA 3AM9A 4OZBA 1XO3A 2M19A 2Y5PA 4WQMA 1IGDA 2L52A 4MM3B 1VZ6A 1FM0D 1ACCA 3AE1B 3E9SA 2WXGA 5G5GA 1KH0A 2H89B 1OFFA 1UNSA 1VR9A 3U2SC 1L4ZB 3B2FA 2TSSA 2VZKB 3AE2B 3DWGC 1E9MA 4DXFA 3DWMA 1RWSA 5LNK1 2FUG1 1ZDVA 4L23A 2WXRA 3MP9A 1V8CA 2NTSA 2RMMA 3SR6A 1B1ZA 4MH8A 1P7FA 1CZPA 2FE8A 3P42A 4JX1C 2ZW0A 1FNWA 4C7YA 3FAHA 1FCLA 4LLGM 2IPKD 2DWQA 1L0YB 1N61A 4RF0A 4WURA 2LHDA 2QILA 2BTEA 1STEA 1ET6A 3P63A 5EE9A 3ZJUA 2W82A 1VJKA 1KF6B 4TSSA 3SFDB 2QJLA 2D5GA 3I57A 1NEKB 1R7SA 1KRHA 2CJNA 2ZW1A 2INNE 4H2AA 2WXIA 5FR3A 3IXSA 2OHFA 1MPEA 3T3OA 4C80A 1OQRA 2X38A 3AB5A 3NRZA 2PKOA 1PUTA 2WXMA 1C76A 5D3IB 1XLPA 2WXJA 1DGJA 1EM7A 2EELA 4XDCA 2MJEA 1E0ZA 4ZYSA 1QOFA 3FILB 1ZDXA 1XXGA 1MVKA 3HVZA 3AE6B 2NMQA 2KMMA 2WXKA 4USAA 2KQ4X 3NVWA 4RGOS 4WWMA 1ZXHA 3N9YC 2AQ3B 4OZAA 2HDEA 4J3OD 5I4DA 1GB1A 3VR8B 4AS1A 3GB1A 2XN9C 4RGMA 1WWTA 2RDHA 4NZLB 1D4BA 3Q8FA 4JPSA 5TSSA 1ZP0B 2WXNA 1GOZA 2YEPB 1EWCA 1TS5A 1NENB 4KX6B 4DXGA 5C3JB 1L5PA 2N0SB 2K0PA 3Q8BA 2WXHA 5BYSA 4M0WA 1WSPA 3BVGA 2CJOA 2N9KA 1K50A 2PW9A 4HROA 2SEBD 1SE2A 2Z8LA 3MFGA 1C79A 3BVMA 1MHXA 1VDVA 1DOIA 3BK1A 3URYA 3W9CB 1QF6A 2XNAC 3TSSA 4D2KA 2HTME 1PFDA 4A55A 2L1AA 1VRAB 2WP9B 4A9AA 5MPOA 1UUPA 1I4GA 3NVZA 1FXAA 2GRIA 2PLPA 3GS2A 3I9V1 2VZKD 2LJIA 1Q10A 4HKZE 1TS4A 1JWSD 1YQ3B 2BB5A 3AE5B 2DYOA 3V05A 1HZ6A 1FFUA 3OWEB 4OW0A 1IBXB 1QOBA 2J52A 3LXFA 1PGXA 3R2IA 1VZ8A 1WGKA 4KGTA 2AQ2B 4GDKB 4B0MA 2WNMA 3R2TA 1N5WA 4R3DA 4MACA 2QMTA 2Y3AA 1K52A 1NYRA 4YT0B 3VR9B 1NVID 2DBYA 2MJDA 1DYQA 3MC0B 2V4IB 4A90A 4WIPA 1DOYA 1IUEA 2WXPA 3AN1A 2R61A 2LEKA 3LYYA 1ET9A 1IBXA 3B9JA 1SIJA 3PZ7A 1C4PA 2K22A 1N62A 1VZ7A 1V1PA 2K3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW1 A;  5HG2 A;  5HFY A;  1XF5 L;  1UWX A;  3V3X A;  1XCT L;  1MPE A;  1YNT E;  1JML A;  1FD6 A;  2KWD A;  1MI0 A;  1F2R I;  5HI1 A;  2IGH A;  1EM7 A;  2EEL A;  2GI9 A;  2JWU A;  5BMG A;  2N7J A;  2RPV A;  1K53 A;  3FIL B;  1MVK A;  2NMQ A;  2KQ4 X;  2KAC A;  1QKZ A;  5JXV A;  1ZXH A;  4OZA A;  1GB1 A;  2JZP A;  3GB1 A;  2I2Y A;  1GB4 A;  2LUM A;  1D4B A;  2KN4 A;  1C9F A;  2JXT A;  2K0P A;  1K51 A;  2JU6 X;  4IKG A;  1XCQ L;  3UI3 A;  2N9L A;  2N9K A;  2PW9 A;  1K50 A;  5HHD G;  4OZC A;  1MHX A;  1HEZ E;  2IGG A;  2LHE A;  4IOI E;  2OED A;  4HJG E;  4D2K A;  1FCC C;  4OZB A;  2PLP A;  1PGB A;  1Q10 A;  2GB1 A;  1IGD A;  2QSD A;  3FIL A;  4HKZ E;  1HZ5 A;  1HZ6 A;  1IBX B;  1KH0 A;  2J52 A;  1MHH E;  1PGX A;  4KGT A;  1IGC A;  1F2R C;  2KDM A;  4MAC A;  2ON8 A;  2QMT A;  1K52 A;  2PTL A;  3MP9 A;  1PGA A;  2RMM A;  4GLS C;  1YMH E;  1P7F A;  4KGS A;  5BMH A;  2IGD A;  2ZW0 A;  1FCL A;  2LGI A;  4WH4 A;  1IBX A;  2JSV X;  5BMI A;  2LHD A;  2J53 A;  1P7E A;  4KGR A;  2I38 A;  2ONQ A; 
#chains in the Genus database with same CATH topology
 2WDR B;  1TY0 A;  4EFO A;  2IDY A;  1V2Y A;  4ZRI A;  2ZPN A;  4ANU A;  3FC4 A;  1T5X D;  2KAN A;  3NZU A;  4FJY A;  3ZXV A;  1F2R I;  2B3A A;  2V9H A;  1ZKH A;  5E6P A;  2ICI A;  1E6E B;  2GBN A;  3X23 A;  2CHX A;  1TIF A;  2WDQ B;  2GMI C;  2LI5 A;  4AQ7 A;  2G9H D;  3OG5 A;  3L4P A;  3VQI A;  2KAJ A;  2J4X A;  4HDQ A;  2BS4 B;  2N9X A;  2BYT A;  3U4E G;  1AW7 A;  3S2A A;  1XLQ A;  2OJR A;  2J0K A;  4ITK A;  3HM3 A;  4M8M A;  1VD2 A;  3A1Q A;  2JY6 A;  1SJH D;  4HJG E;  1C77 A;  4S17 A;  3RFZ B;  3NZ3 A;  3DVN V;  1FXI A;  4ZRP A;  1P1A A;  2WQY B;  1DOX A;  4ARC A;  2LGS A;  2DZK A;  2LFI A;  1F0Z A;  2G3Q B;  2NBV B;  4PS8 A;  3TUO A;  1FNV A;  4P16 A;  1L0V B;  1UGM A;  5G5H A;  1M94 A;  4ZHP A;  1T6B X;  2JRH A;  3ZNI D;  2KN5 A;  3KQ4 A;  1TS2 A;  2IBI B;  2BGF A;  2LGI A;  4WH4 A;  2JSV X;  3RNG C;  4AJW A;  3BZD B;  4RM8 A;  4W9I A;  2MBO A;  1TZO A;  3PZD A;  3PRZ A;  1I4R A;  2BKF A;  4YL8 A;  3LDZ E;  3Q3J A;  2C60 A;  4GXB A;  3V3X A;  2R2Q A;  2JYT A;  2KYW A;  3PPA A;  2IO1 B;  2WHI A;  1K8R B;  3VDZ A;  1TS3 A;  3TEY A;  3KWL A;  3SDL C;  4EE2 A;  1AWD A;  2JWU A;  3UIP B;  3ZO5 B;  2WXO A;  3RNA C;  2LGY A;  1GJZ A;  1T0Q C;  3HHM A;  2LUE A;  1ZGU B;  4EZL A;  1WJU A;  1YQ4 B;  1FEH A;  1S3S G;  1WRI A;  1GC7 A;  3ZW3 A;  3NS8 A;  2RR9 A;  4C7Z A;  2QEJ C;  4BZA A;  3JVZ X;  4GDL B;  3Q3N C;  1PYW D;  1SBB B;  2AYO B;  4FJV B;  2KVR A;  1OQY A;  1V97 A;  5BYR A;  1BXT A;  5J17 A;  4URK A;  4LNO A;  2KFK B;  3ZLZ A;  3EFU A;  1G6J A;  4DHJ D;  2DZI A;  1AYF A;  4IG7 B;  3L10 B;  3HM6 X;  5G2N A;  4S0R A;  5AUI A;  3W5V B;  1BUI C;  3BWU D;  1L6U A;  1HTO A;  3I3T B;  1QT9 A;  1F2R C;  2ZCC A;  2M1M A;  3WA0 A;  4ZRQ A;  1RM6 C;  5D2M B;  4GSW A;  4GLS C;  3AE9 B;  2FNJ B;  2KTF A;  5BMH A;  1SE3 A;  2YEP F;  4LK0 M;  3PHW B;  1SE9 A;  5IA7 A;  1TYG B;  3N20 C;  1OTR B;  1KOT A;  4FAD A;  5E6O A;  2NTT A;  3VUW A;  5FKA C;  1JWB D;  3RD2 A;  4KVG B;  2NS5 A;  5KHQ A;  1C4C A;  1JML A;  3HK0 A;  2GOW A;  4KIK B;  5T8I A;  1YN5 A;  1E8Y A;  1OEY A;  2PE6 B;  2NBU A;  3KUZ A;  1XLO A;  2M0A A;  2N7J A;  2MRP A;  1J0G A;  3KWV A;  4F8C B;  3Q3O C;  2KAC A;  1PDX A;  2MH7 A;  2L00 B;  1E8X A;  2WXL A;  2KKC A;  2IZV B;  2FBW B;  4LDT B;  4IM0 A;  1GG3 A;  4K7W A;  1CJE A;  2WU5 B;  3UF8 A;  1C9F A;  5G55 A;  2O6V D;  1R4M B;  2FUH B;  4PT5 A;  3AE8 B;  2QC8 A;  2DAJ A;  2CU3 A;  4NAM A;  3O65 B;  4RGN A;  4GGQ A;  3EFC A;  1WMH B;  1FPY A;  3ZJT A;  2PEA A;  3X0W A;  4IWQ A;  4N58 A;  2E6X A;  1ZE3 D;  3AEC B;  2GBJ A;  4XDD A;  3AEA B;  2JRI B;  4MSM B;  2KTR A;  2Y5P A;  4IM3 A;  1IGD A;  1VZ6 A;  4EZJ A;  3M95 A;  2L8J A;  5DPS A;  2LVP A;  5G5G A;  3CST A;  4BOS C;  1OFF A;  1UNS A;  1WX7 A;  3V6C B;  1L4Z B;  2KMA A;  3DWG C;  1E9M A;  3AI5 A;  1RWS A;  4MGY E;  2FUG 1;  2KZR A;  1YD8 U;  2IYD B;  4B95 A;  3MP9 A;  1R4N I;  2D3C A;  4MH8 A;  1UEL A;  3P42 A;  2ZW0 A;  1FNW A;  3QCA A;  4LLG M;  3L08 A;  2DWQ A;  2L3Z A;  4RF0 A;  1MG8 A;  2QIL A;  2JF5 A;  2O6V A;  2QJL A;  3ZNH B;  3OAW A;  2D2Q A;  1CMX B;  2WWZ A;  2V1Y A;  5FR3 A;  3IXS A;  1UD7 A;  1WX8 A;  3NRZ A;  2PKO A;  2WXM A;  1C76 A;  4AP4 C;  1DGJ A;  3PTF C;  2MJE A;  1E0Z A;  2AL3 A;  3FIL B;  1XXG A;  3AE6 B;  4USA A;  2C7N B;  4RGO S;  3N9Y C;  5I4D A;  3VR8 B;  3GB1 A;  4DXA B;  1WWT A;  1WXS A;  4NZL B;  3Q8F A;  4JPS A;  2O2V A;  2WXN A;  1Z5S B;  2ASQ A;  4HPL B;  5FR6 A;  2ZVO A;  4BKS D;  3Q8B A;  3ZUN A;  3PSE B;  3DBH I;  3KYC D;  4HPP A;  4M0W A;  2PW9 A;  4HRO A;  1K50 A;  5GMV A;  3R7R A;  2SEB D;  2C7H A;  2Z8L A;  2C7M B;  3APF A;  3BVM A;  1VDV A;  1EUV B;  3URY A;  2XEW A;  3W9C B;  3IFW B;  2DYB A;  3TSS A;  4D2K A;  2HTM E;  4PK1 A;  3NVZ A;  1YX6 B;  2WYQ A;  2PLP A;  3I9V 1;  2VZK D;  2LJI A;  2M4N A;  2BB5 A;  3AE5 B;  1F52 A;  4OW0 A;  1QOB A;  3R2I A;  2J52 A;  3WAL A;  3UQB A;  4GDK B;  3R2T A;  3A9J A;  4XC2 A;  2QMT A;  4G0N B;  2Y3A A;  1E8Z A;  1NYR A;  4A3O A;  4KSL C;  4WIP A;  1TZ1 A;  4DBG A;  3RI7 C;  4GIV A;  4BKS A;  3MHS D;  4PYU A;  3L0W B;  2K3U A;  1CK1 A;  1Q5W B;  2BPS A;  1QIL A;  1V49 A;  1WFY A;  2I1J A;  2B76 B;  1WYG A;  4W9J A;  3QA8 A;  4I6P A;  3SU8 X;  4FN2 A;  2KC1 A;  4F1S A;  4WJN A;  3VXW A;  2KNB A;  4M8N A;  2LJ5 A;  4N59 A;  3ZTC A;  4WJP A;  1NI2 A;  1XEE A;  3NVY A;  1YJI A;  4K81 A;  4OVU A;  3T8M A;  2I2Y A;  1WYW B;  1E10 A;  4P6V F;  2ACZ B;  2K6Q A;  3NJT A;  1WM2 A;  1ZUD 2;  4BOZ B;  2KN4 A;  4II3 B;  2JQR B;  3ZYY X;  1XCQ L;  4GB9 A;  3EA6 A;  1LO5 D;  3EGR A;  3MJ5 A;  2ZNV B;  1Y8R C;  1X1M A;  2L05 A;  3NVV A;  4ANV A;  3AEB B;  2V0G A;  1L4D B;  2MEK A;  3A33 B;  3TEW A;  4YWG G;  4DQO C;  4I6L B;  4WJO A;  2G1E A;  2DEN B;  1YJ1 A;  2GB1 A;  5C2T B;  1M4V A;  1WXM A;  1ROE A;  4JWU C;  5LXI B;  2L76 A;  2JX5 A;  4JWS C;  3Q69 A;  1XQQ A;  3AEF B;  1WR6 E;  1KLU D;  2IJ0 A;  2PTL A;  1EU3 A;  3UIN B;  1WJN A;  4KGS A;  1QLB B;  3RCZ A;  4OHJ A;  1N5X A;  1D5X C;  4G3X B;  4KKI A;  1UF0 A;  2VRR B;  3P4R B;  5GXG B;  1J19 A;  4TQ0 A;  1TKY A;  2ONQ A;  4M01 A;  4GN1 A;  1WJ4 A;  2K39 A;  1UWX A;  2LMC A;  4CYE A;  3PHX B;  1YNT E;  4MJS B;  3OJ3 A;  4LTU A;  4L2Y A;  1FD6 A;  4ZRK A;  2ZPY A;  1P3Q U;  5AZH A;  4KSK C;  3AU5 A;  2K6D B;  2KVZ A;  3KH0 A;  1C4A A;  2YVC A;  4UDU C;  1ESF A;  1TKG A;  3RNC C;  2PJH A;  4HDO A;  1YIW A;  4E74 A;  4XZ4 A;  3PLV A;  4FUL A;  4BAX A;  3ENE A;  2JZZ A;  4KDI C;  4FLH A;  1RYJ A;  3KUD B;  4A6Q A;  2JZP A;  2IO2 B;  1GNU A;  2K8C A;  3VAW A;  4QAY A;  2KLG A;  4LNI A;  1EO6 A;  1MJD A;  3B0A A;  2V3S A;  3DHI C;  3ZJV A;  3DVN U;  3QHT A;  3PLU A;  3M3J A;  1JWA D;  2KDF B;  1FMA D;  4MDK E;  1TKE A;  1HEZ E;  2IO0 B;  3APC A;  5JHA A;  1N63 A;  2Z59 B;  1TY2 A;  1VLB A;  4JGH B;  3Q8A A;  3QAR A;  4BKT A;  3K9O B;  2KD0 A;  3IAM 1;  2AX5 A;  1QOA A;  1SXT A;  4GDL A;  1N6Z A;  2LXA A;  4RF1 A;  2J0M A;  1C78 A;  1HZ5 A;  4HWI B;  4IC7 B;  3ZQ4 A;  3ML9 A;  4LNF A;  3L17 A;  4KDL B;  4P7I A;  1KLG D;  4YXD B;  2K8B A;  3TEZ A;  2KFK A;  2L83 A;  4TQ1 A;  1SEB D;  3AED B;  3IHP C;  1Y56 A;  2IGD A;  3H7P B;  2W54 A;  2K5P A;  4RNA A;  4P1B C;  3VRA B;  4KGR A;  2I38 A;  2KT7 A;  4KZC A;  1BT0 A;  4HCP B;  2Y5C A;  3QX1 A;  3RNF C;  1WY8 A;  2MW5 A;  2WS3 B;  2IGH A;  3KVF B;  3H8H A;  4OVZ A;  3KW5 B;  1KTK A;  3P4Q B;  1RAX A;  1LGR A;  4GOC A;  2WX1 A;  2LD9 A;  4N9F 4;  3NY5 A;  1GB4 A;  3HRD D;  3JYU A;  2JUO A;  3JSV A;  1UWM A;  1WJ6 A;  5D94 A;  3EHV A;  2KXJ A;  1PQS A;  4HEA 1;  2PVG C;  1WXV A;  2ZZP B;  4YTM B;  2N9L A;  5CHW A;  1FFV A;  4I6N B;  4DHZ B;  2KOX A;  4XWT A;  4FA6 A;  5CHV C;  2D3A A;  2N7D A;  3MC8 A;  4LNN A;  3VRB B;  3JW0 X;  2SAK A;  3RMK C;  1V1P B;  2QDF A;  5DCN A;  3PT2 B;  1A5R A;  4W9K A;  3VH4 B;  4IM2 A;  3V62 A;  3DBL B;  2LZ6 A;  1WMH A;  4MM3 B;  1FM0 D;  2WX0 A;  1WH3 A;  3AE1 B;  2FID A;  1KH0 A;  2OOB B;  4NAW A;  3U2S C;  3B2F A;  2FAZ A;  2TSS A;  3AE2 B;  2K25 A;  5IP4 D;  3FKY A;  4JIO U;  4NQL B;  1V8C A;  3SR6 A;  1R4M I;  1P7F A;  2MQJ A;  1CZP A;  2C5L C;  5DPT A;  1FCL A;  2HTH A;  1N61 A;  4WUR A;  2LHD A;  4ICV A;  2W82 A;  2BVC A;  3L54 A;  2D5G A;  1V81 A;  1ZW7 A;  1EF5 A;  3DBR I;  4C80 A;  1OQR A;  3QAQ A;  2D07 B;  3UGB B;  1EM7 A;  4XDC A;  1YOV B;  5L83 A;  3NG0 A;  4E3C A;  2HJ1 A;  3ALB A;  2WXK A;  2KQ4 X;  4AWJ A;  4WWM A;  2AQ3 B;  2HDE A;  2WGS A;  3RUL A;  2DZJ A;  2LVQ A;  2RPQ A;  3A9K B;  2YEP B;  1EWC A;  2PPH A;  3GZN I;  1TS5 A;  5DPW A;  5C3J B;  2KWC A;  2BWF A;  2K0P A;  3RYT A;  2PE9 A;  2CJO A;  4XYC A;  3DVG Y;  1SE2 A;  1C79 A;  5KHO A;  4IW0 A;  2NPT A;  3C0R B;  1QF6 A;  2XNA C;  2GBM A;  2KJ6 A;  1PFD A;  4A55 A;  4LJO B;  2CHW A;  4A9A A;  1UUP A;  1I4G A;  3TCA A;  3GS2 A;  2MBB B;  1Q10 A;  2LXC A;  2EKE C;  1YQ3 B;  3MJW A;  3ZKJ C;  1HZ6 A;  2N7E A;  1IBX B;  4A3P A;  3LXF A;  1V5O A;  1WGK A;  4B0M A;  4HLE A;  2DZM A;  4MAC A;  2HD5 B;  4YT0 B;  1Q1O A;  3VR9 B;  3V61 A;  2CKH B;  1YX5 B;  3UQA A;  4A90 A;  1DOY A;  1IUE A;  2K1F A;  1RLF A;  4PS7 A;  1H8C A;  4GMV A;  4MGK E;  2FCN A;  3PZ7 A;  1V6E A;  2MP2 A;  3H7S A;  4ZYN A;  3TBL D;  3VUX A;  5BO4 B;  3BIN A;  2BYE A;  5CTR C;  2KDB A;  1J7A A;  3P2B A;  5HFY A;  3T3N A;  4C56 C;  2N1V A;  1E7P B;  1RFA A;  3N1Z C;  2L32 A;  3AH7 A;  3BYT B;  1L0X B;  3VTU A;  3AE7 B;  2CU1 A;  1YN3 A;  2BYV E;  3IT4 B;  4N6E B;  5HI1 A;  3V6E B;  1HQR D;  1F1H A;  2WDV B;  3E56 A;  1K53 A;  1WGY A;  4BKG A;  5EE0 A;  4MGZ E;  3RNB C;  2KK8 A;  3H6N A;  3VUY A;  3ABV B;  2LGD A;  1WGG A;  2G45 B;  4BBN C;  2BQQ A;  3ZNZ B;  3VTW A;  1SSN A;  4WJQ A;  1SF0 A;  4YSY B;  3OJ4 B;  4MT5 A;  5AUK A;  3UIO B;  4RGT A;  2XK5 B;  4TV3 A;  1AN8 A;  4OZC A;  3C8Y A;  3W2D A;  1XT9 B;  2LHE A;  2NBW B;  4K7S A;  3WIM A;  3D32 A;  4K3C A;  2L7R A;  1I4Q A;  4JLC A;  5C1Z A;  2OJW A;  4REZ A;  1RFK A;  2DYM A;  1V86 A;  4WQO B;  4P1C C;  5JZE B;  4FXC A;  3ZTD A;  4HXD A;  2Z0D B;  3NHE B;  2KX3 A;  4RCO A;  3SEB A;  1NDD A;  3R3M A;  4C4V B;  2MSE D;  3KYD D;  2KDM A;  4DHJ B;  2R2O A;  1PGA A;  2IND C;  2M0X A;  2KHW B;  1D6E C;  3EUB 2;  1NI3 A;  5BMI A;  3ETR A;  1P98 A;  5LLI A;  3TMP B;  4G11 A;  3ECI A;  5HG2 A;  1XF5 L;  3AEE B;  1KM7 A;  3A4R A;  3CIR B;  4KV2 A;  4KKJ A;  3H1U A;  2RGF A;  4OVV A;  2BS3 B;  2KWD A;  2VH2 A;  1R4N B;  3DPD A;  1MI0 A;  3W1S A;  4LCD E;  3U7Z A;  1SE4 A;  2KTR B;  5BMG A;  3H9D A;  1SB3 C;  3RZW C;  1TBE A;  3TEX A;  4EUT A;  3RUI B;  3AMZ A;  2W55 A;  1KLV A;  4YSX B;  3AEG B;  1UBI A;  4JE3 B;  2A4Z A;  4W9F A;  3W1Y A;  5BYQ A;  2GLS A;  4B9K A;  2MCN B;  3W5U B;  1B9R A;  4RH6 A;  2O6V B;  1TJE A;  1Q0W B;  3IT6 B;  4IOI E;  4AOF A;  4HKQ A;  1OGW A;  5FK9 C;  4YTN B;  3B2G A;  3P1M A;  2M56 B;  2PVO D;  1V9J A;  3A4S C;  1YQB A;  2W3R A;  1I4P A;  2CHZ A;  1WGH A;  4WWN A;  3DBH B;  2J42 A;  2FCQ A;  1L7Y A;  1J8C A;  1JW9 D;  3PV1 A;  3WAN A;  4DDG D;  4W9D A;  3ZDM C;  2K9X A;  2KDE B;  2N9P C;  2N1W A;  2D11 A;  4B6W A;  3KUC B;  4RFB A;  2MLB A;  1YMH E;  2MA9 B;  2O2V B;  4JL9 A;  5D3D A;  1UBQ A;  2ZJD A;  1JRP A;  3VTV A;  3J9C A;  3HVD A;  4US8 A;  1T0R C;  1YN4 A;  1QOG A;  4M0W B;  4ICU A;  1P7E A;  1ISN A;  2EMS A;  2KJH B;  3GP7 A;  2WLB A;  2BT6 A;  5CX3 A;  2UU7 A;  3QK0 A;  4US9 A;  3QIJ A;  5AEK B;  2IO3 B;  4W9G A;  2GI9 A;  2WXQ A;  3AE4 B;  5IO9 A;  4HRS A;  1H4R A;  1SGH A;  4IWO A;  2BKR B;  1QKZ A;  2WDT B;  4GU2 A;  1TTN A;  4ARI A;  1FRR A;  2AQ1 B;  1HXY D;  2LUM A;  2W3S A;  1BML C;  1FO4 A;  1E7V A;  3DVG X;  2REX A;  4NJ6 A;  5L95 C;  3RNE C;  4DDI D;  3CMM B;  5JH5 C;  4M02 A;  3ZRF A;  5H8Y E;  3TJP A;  5H92 C;  1V1O A;  5HHD G;  1D5M C;  4A8X C;  4PYZ A;  3TL5 A;  2KFJ A;  3WCQ A;  1OQQ A;  5C23 A;  4BFR A;  4FJZ A;  4YSZ B;  2N9E B;  2J0J A;  3ZIM A;  1FNU A;  3PVL A;  2JYE A;  1WI0 A;  1F9J A;  4II2 B;  1XO3 A;  4RM9 A;  4WQM A;  2HE7 A;  1E5W A;  4NPN A;  2X8X X;  1I42 A;  2JPH A;  3ZDT A;  1ACC A;  2WXG A;  2RD0 A;  5JHB A;  2DNF A;  3QC8 B;  1WGR A;  2VZK B;  4X57 B;  2AL6 A;  4DXF A;  3I63 C;  4L23 A;  3I5J C;  3ZVV A;  2NTS A;  2RMM A;  1B1Z A;  1AAR A;  4MM3 A;  4HK2 A;  1E7U A;  4C7Y A;  2QCZ A;  3FAH A;  3CSF A;  3QQ8 B;  2IPK D;  2MX2 A;  1STE A;  3P63 A;  5EE9 A;  2ZEQ A;  2D3G A;  1R7S A;  1KRH A;  2CJN A;  2ZW1 A;  3BY4 B;  1WGD A;  2INN E;  4H2A A;  3W1S C;  1MPE A;  4FBJ B;  4K1R B;  4MSQ B;  2BYF A;  2X38 A;  3AB5 A;  3DBL I;  4RMA A;  1PUT A;  2RDB C;  4NQK E;  2DX5 B;  4WWO A;  5D3I B;  1XLP A;  3RN9 C;  2WXJ A;  3MTN B;  1WX9 A;  4LDT D;  4DHZ E;  1ZDX A;  1E8W A;  1MVK A;  2NMQ A;  2KMM A;  1ZXH A;  1JRU A;  5AZF A;  4OZA A;  3SD5 A;  1GB1 A;  4ZRJ A;  2XN9 C;  1D4B A;  2G4D B;  1IP9 A;  2LAS A;  1ZP0 B;  1GOZ A;  4HCN B;  2MWS B;  2K8H A;  1NEN B;  3RT3 B;  4NJ7 A;  1L5P A;  2JZ3 B;  2ZCB A;  3LJ3 A;  3AUL A;  3MFG A;  4CO7 A;  1MHX A;  3PRE A;  1DOI A;  4LJP B;  3A9K A;  1P9D U;  4KIK A;  1WZ0 A;  4A20 A;  2L1A A;  4IWP A;  5MPO A;  2MBQ A;  1FXA A;  2C9W B;  3VFK A;  4NNJ B;  2D10 A;  3N30 A;  1WXA A;  1C1Y B;  2LRW A;  4HKZ E;  2JXX A;  1TS4 A;  1JWS D;  4AUQ C;  2DYO A;  2QHO A;  3N1X C;  3EC8 A;  1VZ8 A;  1WIA A;  4KGT A;  2WNM A;  4ACF A;  3M63 B;  1K52 A;  5EDS A;  2NVU I;  2BF8 B;  1IPG A;  4MEM A;  3L16 A;  2MJD A;  4W9C A;  1I35 A;  2M8S A;  3N3K B;  2WXP A;  2R61 A;  2LEK A;  3ONS A;  1IBX A;  3B9J A;  1VCB A;  1C4P A;  3ML8 A;  2K22 A;  1VZ7 A;  5J2R A;  1HA5 A;  1YJJ A;  3ZRC A;  3BVZ A;  2LRU A;  2WXF A;  3PRM B;  5DPR A;  1UGJ A;  2L0T A;  3O13 A;  2UYZ B;  2LWP A;  1ZOY B;  2J7Q B;  3DHG C;  5CHF A;  4CHK A;  2RDG A;  4E71 A;  1J7C A;  1T3Q A;  2QIE B;  2I1K A;  1GC6 A;  2GBK A;  2JWZ A;  2RPV A;  4HPM B;  4EKU A;  3PS6 A;  3AXC A;  4DWF A;  1ZXI A;  2FCS A;  1KFY B;  3HUI A;  3KLS X;  3A1Q B;  2INP E;  3U52 E;  2Q5W D;  2XBB C;  2BW2 A;  3WAM A;  1I4X A;  1E90 A;  4MEL A;  3MHZ A;  1FRD A;  4TUU A;  2DHZ A;  2E3T A;  2V3N A;  2PIA A;  4K7U A;  2NR2 A;  3DCG A;  2BS2 B;  4XX5 A;  1SIF A;  1GPX A;  1LQB A;  2OED A;  3AV8 A;  2MBH A;  3QWZ B;  4FHK A;  1FCC C;  3PGE A;  3ZGZ A;  2KX0 A;  1WR1 A;  1J7B A;  2NCN A;  1PGB A;  2XK5 A;  2V4L A;  2PMV A;  2QSD A;  3FIL A;  2KMC A;  4EOY A;  4YTP B;  3SHQ A;  1UZX B;  3AU4 A;  2M17 A;  4BBN F;  3RPF C;  2IY0 B;  2BB6 A;  4B0E A;  1IGC A;  3LB8 C;  4W9L A;  1GAQ B;  3RZF A;  3Q6B A;  3PO0 A;  5IAA C;  3JSV B;  4NJC A;  2KQS A;  4XWW A;  1WXQ A;  1TGZ B;  2Z0E B;  3BII D;  3Q14 C;  4C4V A;  3V60 A;  2J53 A;  2LVO A;  3ZNG C;  4ZHO A;  3QJZ A;  1WE6 A;  4TKN A;  1LFD A;  3R66 C;  2UWQ A;  4NY0 A;  4ZOH C;  3R8B A;  1EU4 A;  3M62 B;  1LXD A;  1HTQ A;  1LM8 B;  1L2N A;  3SFE B;  3BYY B;  1WRD B;  1F77 A;  2GBR A;  2HJ8 A;  4L1B A;  4GDK A;  1ZPS A;  3N32 A;  3ZXR A;  3Q3F A;  4WWP A;  4NAW B;  2WU2 B;  3K9P B;  2IY1 B;  1WE7 A;  3L13 A;  4AJY B;  3P4P B;  4ZDV A;  1I4H A;  3DBR B;  3EEC A;  1V80 A;  3B1L X;  3Q3M C;  4IUM B;  4EZK A;  1FIQ A;  1KJT A;  3IBE A;  2JXT A;  4WAF A;  2V3P A;  2JU6 X;  1QZE A;  4IKG A;  1IYF A;  1JAL A;  3AE3 B;  3GE8 C;  3VHT C;  3VH3 B;  3BK2 A;  5E6J A;  4XE0 A;  3VVW B;  2DLB A;  3P4S B;  2BBC A;  2ZVN A;  3GZN B;  4TMA B;  3Q8E A;  1D5Z C;  1C3T A;  1JRO A;  5EE3 A;  3R7Q A;  5IOI A;  3NS1 A;  1L6V A;  1V5T A;  3NOB A;  2MJ3 A;  2AWT A;  3U7D A;  1D3Z A;  1MHH E;  3NZS A;  3PRP B;  3IAS 1;  2ON8 A;  3DDC B;  2MHJ A;  1A70 A;  1ENF A;  4O1N A;  1CQV A;  3NUH B;  5IN7 A;  4W9E A;  2EMT A;  4IDI A;  4MH0 E;  2A5U A;  1I7H A;  1MG4 A;  1N60 A;  3UI3 A;  2INC C;  1OEY J;  2NPT B;  2EKI A;  1XCT L;  1QQR A;  3OLM D;  1EWY C;  2KQ7 A;  2KO3 A;  3DOW A;  1JWU D;  5D6J B;  4ANW A;  2Y5B B;  1HE8 A;  4LNK A;  2MBE A;  1XLN A;  1FXT B;  3GOE A;  5JXV A;  2VH1 A;  4ASW C;  4F7Z A;  2LGX A;  1TT5 B;  2CR5 A;  1GUA B;  3Q8C A;  1JWM D;  3WAP A;  5E6N A;  3IVF A;  4J6I A;  1K51 A;  3DBS A;  4M00 A;  4PS3 A;  2H88 B;  4Q2J A;  1NYQ A;  5D7G A;  3U8Z A;  1SJE D;  2KLC A;  1JQ4 A;  4MGI E;  1P0R A;  3PZ8 A;  2W9N A;  2IGG A;  2MP2 B;  4MJS A;  5EE1 A;  1JCK B;  3CWI A;  4CQN A;  3AM9 A;  4OZB A;  3TIX A;  2M19 A;  4G50 A;  2L52 A;  1WF9 A;  2L0F A;  3E9S A;  1NBF C;  3Q2A C;  2H89 B;  1VR9 A;  2DAF A;  3DWM A;  5LNK 1;  1ZDV A;  3APD A;  4FHJ A;  2WXR A;  2FE8 A;  4JX1 C;  3U30 A;  1Z2M A;  1L0Y B;  2JT4 B;  3WAO A;  2BTE A;  1ET6 A;  3ZJU A;  3DHH C;  1VJK A;  1KF6 B;  4TSS A;  3SFD B;  2AEH A;  3I57 A;  1NEK B;  2BWE S;  4EEW A;  5J18 A;  2YLM A;  2WXI A;  2OHF A;  3T3O A;  5AZG A;  1WZ3 A;  1WM3 A;  2N4F A;  2EEL A;  4C00 A;  4ZYS A;  4HJK A;  1QOF A;  3HVZ A;  5LXH A;  3NVW A;  4J3O D;  1T0S C;  2FCM A;  4AS1 A;  3MC9 A;  4RGM A;  2RDH A;  2KJR A;  5TSS A;  3B08 A;  4BVU C;  4KX6 B;  4DXG A;  3GE3 C;  2N0S B;  3H7P A;  2CS4 A;  2KWV B;  2WXH A;  5IKC M;  5BYS A;  1WSP A;  2KWU B;  3BVG A;  2N9K A;  1RRB A;  3DQV A;  3BK1 A;  1EF1 A;  1XD3 B;  2JVC A;  3CF6 E;  4KZ0 A;  3A9J B;  1VRA B;  2WP9 B;  1T0Y A;  2GRI A;  2KC2 A;  3C19 A;  4ANX A;  2G4S A;  4XGA B;  3N1Y C;  3V05 A;  1FFU A;  3OWE B;  2D3B A;  1MFW A;  1PGX A;  1S1Q B;  3IG3 A;  2FIF A;  2AQ2 B;  1UH6 A;  1N5W A;  4R3D A;  3T9L A;  1NVI D;  2RSU A;  2DBY A;  2ZNV C;  1DYQ A;  3MC0 B;  5HKH A;  2V4I B;  4W9H A;  4HVB A;  4DK5 A;  4JQW C;  3AN1 A;  3LYY A;  1ET9 A;  5TR5 A;  4K3B A;  2KDI A;  1SIJ A;  1U4A A;  3HIZ A;  4WAA A;  1N62 A;  1V1P A; 
#chains in the Genus database with same CATH homology
 1HA5 A;  1CK1 A;  1J7A A;  1YJJ A;  5HFY A;  2WDR B;  3BVZ A;  1TY0 A;  3T3N A;  4C56 C;  2WXF A;  1E7P B;  1QIL A;  2IDY A;  2B76 B;  1WYG A;  2L32 A;  3AH7 A;  3BYT B;  1L0X B;  3FC4 A;  1T5X D;  3AE7 B;  1UGJ A;  1YN3 A;  4N6E B;  1F2R I;  3IT4 B;  3O13 A;  5HI1 A;  1ZOY B;  2RDG A;  1HQR D;  1J7C A;  1T3Q A;  2WDV B;  2QIE B;  3E56 A;  2RPV A;  1K53 A;  4N59 A;  5EE0 A;  2ICI A;  1E6E B;  1ZXI A;  3HUI A;  1KFY B;  1XEE A;  3NVY A;  3KLS X;  1YJI A;  2I2Y A;  3ABV B;  1E10 A;  2WDQ B;  4P6V F;  2ACZ B;  2INP E;  1SSN A;  1ZUD 2;  4AQ7 A;  2G9H D;  1SF0 A;  3U52 E;  2Q5W D;  2KN4 A;  3L4P A;  4YSY B;  2BW2 A;  3VQI A;  2KAJ A;  2JQR B;  2J4X A;  1I4X A;  4MT5 A;  5AUK A;  2BS4 B;  2BYT A;  3U4E G;  3ZYY X;  1AW7 A;  3MHZ A;  1FRD A;  1XLQ A;  2E3T A;  2V3N A;  2PIA A;  1XCQ L;  4RGT A;  3EA6 A;  4ITK A;  1LO5 D;  3EGR A;  3MJ5 A;  1AN8 A;  4OZC A;  3C8Y A;  3W2D A;  2BS2 B;  2LHE A;  3NVV A;  1GPX A;  1SJH D;  3AEB B;  2OED A;  3AV8 A;  4HJG E;  1L4D B;  2MEK A;  2V0G A;  1C77 A;  1FCC C;  3RFZ B;  3TEW A;  4YWG G;  4DQO C;  3NZ3 A;  3ZGZ A;  1J7B A;  1I4Q A;  1PGB A;  2G1E A;  2GB1 A;  4REZ A;  2PMV A;  2QSD A;  3FIL A;  5C2T B;  1M4V A;  1FXI A;  1RFK A;  2DYM A;  4ZRP A;  2WQY B;  4FXC A;  4ARC A;  1DOX A;  1ROE A;  4YTP B;  4JWU C;  4RCO A;  3SEB A;  3RPF C;  2BB6 A;  2LFI A;  4B0E A;  1IGC A;  3LB8 C;  2JX5 A;  1F0Z A;  4JWS C;  3Q69 A;  1GAQ B;  3TUO A;  2KDM A;  3AEF B;  1FNV A;  4P16 A;  1L0V B;  5G5H A;  1KLU D;  2IJ0 A;  2PTL A;  3PO0 A;  1EU3 A;  4ZHP A;  1T6B X;  1PGA A;  4NJC A;  4KGS A;  1D6E C;  3EUB 2;  1QLB B;  3KQ4 A;  1TS2 A;  1WXQ A;  4XWW A;  4OHJ A;  2LGI A;  4WH4 A;  1N5X A;  1NI3 A;  2JSV X;  3BII D;  3ETR A;  5BMI A;  1D5X C;  4KKI A;  3BZD B;  3P4R B;  1TZO A;  5GXG B;  4TQ0 A;  1I4R A;  2J53 A;  1TKY A;  2ONQ A;  4ZHO A;  5HG2 A;  1XF5 L;  1UWX A;  3AEE B;  2LMC A;  3V3X A;  4ZOH C;  2JYT A;  3CIR B;  1YNT E;  3R8B A;  4KKJ A;  1EU4 A;  1FD6 A;  4LTU A;  4L2Y A;  2BS3 B;  2KWD A;  1MI0 A;  1TS3 A;  3TEY A;  1C4A A;  3W1S A;  3KWL A;  4UDU C;  4EE2 A;  1AWD A;  1ESF A;  3SFE B;  1TKG A;  3U7Z A;  1SE4 A;  2JWU A;  3BYY B;  5BMG A;  1F77 A;  1SB3 C;  2WXO A;  4L1B A;  3TEX A;  1ZPS A;  1RYJ A;  4NAW B;  4A6Q A;  2JZP A;  2WU2 B;  3AMZ A;  2W55 A;  4YSX B;  3P4P B;  1I4H A;  1YQ4 B;  3AEG B;  1FEH A;  1WRI A;  4JE3 B;  1FIQ A;  2JXT A;  3ZJV A;  4WAF A;  2V3P A;  4C7Z A;  2JU6 X;  4IKG A;  5BYQ A;  2QEJ C;  1JWA D;  4GDL B;  3W5U B;  1FMA D;  1B9R A;  4RH6 A;  1TKE A;  1PYW D;  1JAL A;  3AE3 B;  1HEZ E;  1SBB B;  3BK2 A;  5E6J A;  1TJE A;  3IT6 B;  4IOI E;  1N63 A;  4XE0 A;  4HKQ A;  5FK9 C;  4YTN B;  3B2G A;  1TY2 A;  1V97 A;  2DLB A;  1VLB A;  3P1M A;  3P4S B;  5BYR A;  1BXT A;  2M56 B;  2PVO D;  3Q8A A;  2BBC A;  3IAM 1;  2AX5 A;  1QOA A;  2W3R A;  1I4P A;  1SXT A;  4TMA B;  3Q8E A;  1D5Z C;  1JRO A;  5EE3 A;  4RF1 A;  1AYF A;  3NS1 A;  2J42 A;  1C78 A;  1L6V A;  1HZ5 A;  3ZQ4 A;  2MJ3 A;  1JW9 D;  5AUI A;  3W5V B;  1MHH E;  2K9X A;  1BUI C;  3BWU D;  1L6U A;  1QT9 A;  1F2R C;  3IAS 1;  2ON8 A;  4RFB A;  1KLG D;  4YXD B;  4ZRQ A;  3TEZ A;  2L83 A;  1RM6 C;  1A70 A;  4TQ1 A;  1SEB D;  3AED B;  4GLS C;  1YMH E;  3AE9 B;  5D3D A;  1Y56 A;  1ENF A;  4O1N A;  1SE3 A;  2IGD A;  2YEP F;  4LK0 M;  5BMH A;  1JRP A;  1TYG B;  2W54 A;  2K5P A;  4RNA A;  1CQV A;  3NUH B;  3J9C A;  3HVD A;  4US8 A;  1YN4 A;  4IDI A;  1QOG A;  1I7H A;  3VRA B;  1P7E A;  4KGR A;  2NTT A;  2I38 A;  1N60 A;  3UI3 A;  5FKA C;  1JWB D;  2Y5C A;  2EKI A;  1XCT L;  1QQR A;  1EWY C;  1C4C A;  1JML A;  2WS3 B;  3GP7 A;  2WLB A;  2BT6 A;  5T8I A;  1JWU D;  1YN5 A;  2IGH A;  4US9 A;  2GI9 A;  3H8H A;  1XLO A;  2M0A A;  2WXQ A;  3AE4 B;  2N7J A;  4HRS A;  1XLN A;  4OVZ A;  1KTK A;  3KWV A;  3P4Q B;  2KAC A;  1QKZ A;  1PDX A;  5JXV A;  4ARI A;  1FRR A;  2MH7 A;  2AQ1 B;  1HXY D;  2LUM A;  1GB4 A;  2W3S A;  1BML C;  3HRD D;  2WXL A;  2FBW B;  1FO4 A;  1UWM A;  3Q8C A;  1JWM D;  1CJE A;  2WU5 B;  1C9F A;  4HEA 1;  1K51 A;  2PVG C;  4PT5 A;  3AE8 B;  2H88 B;  4YTM B;  4Q2J A;  1NYQ A;  2CU3 A;  4NAM A;  5H8Y E;  2N9L A;  5D7G A;  1SJE D;  4RGN A;  1FFV A;  5H92 C;  1V1O A;  5HHD G;  1D5M C;  1JQ4 A;  4A8X C;  3ZJT A;  4XWT A;  3PZ8 A;  3WCQ A;  1OQQ A;  2IGG A;  4N58 A;  2E6X A;  3VRB B;  1ZE3 D;  4YSZ B;  3AEC B;  2SAK A;  1V1P B;  4XDD A;  1FNU A;  2JYE A;  3AEA B;  1JCK B;  3CWI A;  5EE1 A;  4CQN A;  3AM9 A;  4OZB A;  1XO3 A;  2M19 A;  2Y5P A;  4WQM A;  1IGD A;  2L52 A;  4MM3 B;  1VZ6 A;  1FM0 D;  1ACC A;  3AE1 B;  3E9S A;  2WXG A;  5G5G A;  1KH0 A;  2H89 B;  1OFF A;  1UNS A;  1VR9 A;  3U2S C;  1L4Z B;  3B2F A;  2TSS A;  2VZK B;  3AE2 B;  3DWG C;  1E9M A;  4DXF A;  3DWM A;  1RWS A;  5LNK 1;  2FUG 1;  1ZDV A;  4L23 A;  2WXR A;  3MP9 A;  1V8C A;  2NTS A;  2RMM A;  3SR6 A;  1B1Z A;  4MH8 A;  1P7F A;  1CZP A;  2FE8 A;  3P42 A;  4JX1 C;  2ZW0 A;  1FNW A;  4C7Y A;  3FAH A;  1FCL A;  4LLG M;  2IPK D;  2DWQ A;  1L0Y B;  1N61 A;  4RF0 A;  4WUR A;  2LHD A;  2QIL A;  2BTE A;  1STE A;  1ET6 A;  3P63 A;  5EE9 A;  3ZJU A;  2W82 A;  1VJK A;  1KF6 B;  4TSS A;  3SFD B;  2QJL A;  2D5G A;  3I57 A;  1NEK B;  1R7S A;  1KRH A;  2CJN A;  2ZW1 A;  2INN E;  4H2A A;  2WXI A;  5FR3 A;  3IXS A;  2OHF A;  1MPE A;  3T3O A;  4C80 A;  1OQR A;  2X38 A;  3AB5 A;  3NRZ A;  2PKO A;  1PUT A;  2WXM A;  1C76 A;  5D3I B;  1XLP A;  2WXJ A;  1DGJ A;  1EM7 A;  2EEL A;  4XDC A;  2MJE A;  1E0Z A;  4ZYS A;  1QOF A;  3FIL B;  1ZDX A;  1XXG A;  1MVK A;  3HVZ A;  3AE6 B;  2NMQ A;  2KMM A;  2WXK A;  4USA A;  2KQ4 X;  3NVW A;  4RGO S;  4WWM A;  1ZXH A;  3N9Y C;  2AQ3 B;  4OZA A;  2HDE A;  4J3O D;  5I4D A;  1GB1 A;  3VR8 B;  4AS1 A;  3GB1 A;  2XN9 C;  4RGM A;  1WWT A;  2RDH A;  4NZL B;  1D4B A;  3Q8F A;  4JPS A;  5TSS A;  1ZP0 B;  2WXN A;  1GOZ A;  2YEP B;  1EWC A;  1TS5 A;  1NEN B;  4KX6 B;  4DXG A;  5C3J B;  1L5P A;  2N0S B;  2K0P A;  3Q8B A;  2WXH A;  5BYS A;  4M0W A;  1WSP A;  3BVG A;  2CJO A;  2N9K A;  1K50 A;  2PW9 A;  4HRO A;  2SEB D;  1SE2 A;  2Z8L A;  3MFG A;  1C79 A;  3BVM A;  1MHX A;  1VDV A;  1DOI A;  3BK1 A;  3URY A;  3W9C B;  1QF6 A;  2XNA C;  3TSS A;  4D2K A;  2HTM E;  1PFD A;  4A55 A;  2L1A A;  1VRA B;  2WP9 B;  4A9A A;  5MPO A;  1UUP A;  1I4G A;  3NVZ A;  1FXA A;  2GRI A;  2PLP A;  3GS2 A;  3I9V 1;  2VZK D;  2LJI A;  1Q10 A;  4HKZ E;  1TS4 A;  1JWS D;  1YQ3 B;  2BB5 A;  3AE5 B;  2DYO A;  3V05 A;  1HZ6 A;  1FFU A;  3OWE B;  4OW0 A;  1IBX B;  1QOB A;  2J52 A;  3LXF A;  1PGX A;  3R2I A;  1VZ8 A;  1WGK A;  4KGT A;  2AQ2 B;  4GDK B;  4B0M A;  2WNM A;  3R2T A;  1N5W A;  4R3D A;  4MAC A;  2QMT A;  2Y3A A;  1K52 A;  1NYR A;  4YT0 B;  3VR9 B;  1NVI D;  2DBY A;  2MJD A;  1DYQ A;  3MC0 B;  2V4I B;  4A90 A;  4WIP A;  1DOY A;  1IUE A;  2WXP A;  3AN1 A;  2R61 A;  2LEK A;  3LYY A;  1ET9 A;  1IBX A;  3B9J A;  1SIJ A;  3PZ7 A;  1C4P A;  2K22 A;  1N62 A;  1VZ7 A;  1V1P A;  2K3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...