3X0WA

Crystal structure of plekhm1 lir-fused human lc3b_2-119
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
EWVNVGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title PLEKHM1 Regulates Autophagosome-Lysosome Fusion through HOPS Complex and LC3/GABARAP Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3x0wA00
3ZRFA 3ZTCA 5KHQA 2L0FA 4AJWA 2KTRB 3C0RB 1RAXA 2YLMA 1V9JA 3VVWB 1EUVB 2DYMA 2K6QA 2DAFA 4FLHA 5DPTA 4GIVA 4FJZA 1D3ZA 1PQSA 2PEAA 4GOCA 1WH3A 3AI5A 3DVGX 2PE6B 3DPDA 1IP9A 2R2OA 4M8NA 2KLGA 2KDBA 3JSVB 4I6PA 2LVOA 2KFKB 3N32A 4W9LA 4W9FA 1QZEA 1WR1A 4WWOA 4W9EA 3ZLZA 1WX8A 4KDLB 2KJRA 2ZVOA 3VFKA 5IA7A 3PPAA 3T9LA 4FULA 4PS8A 5AZGA 4RM9A 4TV3A 3QHTA 1Q0WB 1TGZB 2FCQA 3A9KB 4NQKE 1OTRB 3H7PA 5DPRA 3ZRCA 5D7GA 4I6NB 3BY4B 2O6VB 1UZXB 4M0WB 3VAWA 1OGWA 3U7DA 2AL3A 4BBNC 2N4FA 3PVLA 4LCDE 4CO7A 2KD0A 2AL6A 2BKFA 3SDLC 2KHWB 1LFDA 4K81A 2MW5A 2PJHA 4URKA 2IO0B 2ZNVC 3ZNGC 2N7DA 4GSWA 4ICVA 5FR6A 1EO6A 2HE7A 1GG3A 3N3KB 3H1UA 1WGYA 3L17A 2KTRA 3QA8A 2PPHA 3L16A 3ZIMA 5G2NA 2LI5A 2LUEA 4MSQB 3D32A 3N30A 2IZVB 4EEWA 4F8CB 3ALBA 4TKNA 3M3JA 4IC7B 1UBQA 3ML8A 3KH0A 3R66C 4HK2A 2WWZA 3QAQA 3A9JB 4IWQA 3UIPB 1WFYA 3K9PB 3VHTC 4ZYNA 3WIMA 2KFKA 4B95A 4FBJB 4BOSC 4LDTB 4B6WA 2JUOA 3A1QB 3O65B 4PS7A 4PYUA 2JF5A 4JIOU 4K1RB 4BOZB 2UYZB 3APDA 2I1KA 2XEWA 1C3TA 1NI2A 2DHZA 2MRPA 3U30A 2FIDA 4DHZB 4ZRKA 2MBHA 2IY1B 2LGYA 5JHAA 3A9KA 1FXTB 4K7SA 3ZDMC 4MGIE 2O6VA 1WYWB 4XX5A 4IWOA 2LJ5A 4IG7B 3DDCB 2KLCA 2JT4B 3W1SC 2CHWA 4HDOA 3RULA 3EC8A 3ZDTA 2ZJDA 2LGDA 2FCSA 2J7QB 2G3QB 1XQQA 1ZW7A 1J0GA 3S2AA 1WM2A 2LXAA 4P7IA 3JYUA 3PRMB 5E6OA 4W9CA 3T8MA 2V3SA 1OEYA 3ZNHB 3PS6A 2EMTA 1Q5WB 3PLVA 1WGDA 3TCAA 1P9DU 3VQIA 1NBFC 2XBBC 2MWSB 4AP4C 2L7RA 4FHKA 2RPQA 4AUQC 3ZNZB 5G55A 3ZO5B 2BYEA 2KVRA 2KQSA 4TQ1A 5AZHA 1E8ZA 3Q3JA 4MJSB 2KN5A 4W9JA 1Q1OA 2D3GA 3A9JA 2G4DB 3PGEA 2GBJA 2IO3B 1R4MI 2IY0B 1XT9B 2IBIB 2KOXA 4TUUA 1E5WA 2KFJA 2KK8A 4ANWA 4GDKB 2MP2B 4RMAA 3A1QA 2FCMA 2MA9B 4B9KA 2JPHA 4DDGD 3WAPA 4ZRIA 4FJYA 2C7HA 3DOWA 2NBUA 4NQLB 1Y8RC 4A3OA 1M94A 3DBHI 1P0RA 1TZ1A 1WJ4A 5EDSA 2WYQA 4X57B 2C9WB 1WZ3A 4MELA 3MJWA 3GOEA 2KMCA 2WX0A 1E8WA 2GOWA 4JGHB 2BF8B 2LASA 2FCNA 1P98A 2LWPA 2IO1B 4WAAA 3QC8B 4BKTA 3X23A 3ZUNA 2G4SA 2JZ3B 5IAAC 2EKEC 4WJPA 1V5TA 1Z2MA 4RM8A 2KDIA 4I6LB 4YL8A 3WA0A 4A3PA 4DBGA 2V4LA 5LXHA 5LXIB 2MX2A 1P1AA 3QX1A 1OEYJ 1F9JA 3PV1A 4DWFA 2MBOA 5J18A 1GUAB 1WX9A 3ZKJC 3ENEA 1GC6A 3ECIA 2LXCA 5D2MB 4W9IA 1TBEA 1WE6A 3QCAA 4HJKA 2KX3A 3AU4A 2UWQA 2GMIC 4LJPB 2K1FA 4WJQA 3VUXA 3LDZE 3Q3FA 3DVNV 3EFUA 4GN1A 4KDIC 3VH3B 2DZJA 3L08A 3PRZA 1YQBA 2CS4A 3NY5A 1YJ1A 1U4AA 3MHSD 4MJSA 4XZ4A 4ANVA 3AULA 2BWES 2L76A 4MDKE 3W1SA 3JW0X 3APCA 3TL5A 3QK0A 3SHQA 4K7UA 5L95C 3I3TB 1GNUA 3AU5A 3MTNB 2MP2A 2NS5A 4GDKA 3WAOA 3H6NA 3HM3A 2A5UA 3U8ZA 4BKSA 2I1JA 2GBKA 3QWZB 2ZPNA 4IM2A 2FAZA 2O6VD 3L0WB 4XC2A 3DVNU 1VD2A 4CHKA 2KDFB 1LQBA 2KWUB 3WANA 2LZ6A 4CYEA 2D10A 1VCBA 2K25A 2MQJA 3IFWB 4KVGB 5KHOA 4HLEA 3DBLI 1J8CA 2DZKA 2Z0DB 5D6JB 4TQ0A 4IW0A 2HD5B 4AWJA 3M63B 4NAWB 3UINB 1WXMA 2Z0EB 2ZZPB 3WALA 2M8SA 1YX6B 4HDQA 3EECA 2ZNVB 1E90A 3APFA 3HK0A 3VTWA 1RFAA 1RRBA 2D11A 2DX5B 2DYOA 3NHEB 4W9HA 1YD8U 3CMMB 4IUMB 3R3MA 4HWIB 1P3QU 1H8CA 3NZSA 2BWFA 2N1VA 3ML9A 2G45B 4MGZE 4E71A 3KW5B 2IO2B 2DYBA 1NDDA 1XD3B 3SU8X 2RD0A 4GDLA 4LDTD 5HKHA 2ASQA 1UD7A 3L10B 3V60A 1GJZA 1KM7A 2Z59B 3HM6X 1V86A 4NPNA 1J19A 2O2VB 3HHMA 3QIJA 2YVCA 3KUCB 5TR5A 2J0MA 4EZKA 2NBWB 2LD9A 1SE9A 2JZZA 1WGHA 3CSTA 3VUWA 4GU2A 3ZW3A 2RSUA 3B0AA 2N9EB 1WIAA 2DZMA 4W9DA 1K8RB 3IBEA 3PHXB 1E7VA 3R7QA 3PZDA 3RCZA 1I35A 2CHZA 2J0JA 2LRWA 4HPMB 2KMAA 3DQVA 3RZFA 3AXCA 4J6IA 3BINA 2WX1A 2LVQA 2KQ7A 4FHJA 4ZRJA 2N9PC 4NAWA 1V80A 4DHJB 2HJ8A 2LGXA 4WWPA 3VUYA 1EF1A 1KLVA 3KVFB 3PREA 5CHFA 3VH4B 2K8CA 4JLCA 2XK5B 2KXJA 3H9DA 2M4NA 3A4RA 1E8YA 3TMPB 2M0XA 2NR2A 1WMHB 4HCNB 5JHBA 4ZDVA 2LRUA 2JY6A 2ZVNA 4PYZA 4EUTA 1V6EA 4HVBA 4KV2A 3TJPA 1AARA 1WZ0A 1YIWA 4OVUA 5BO4B 3PHWB 2MSED 4II3B 4DHJD 4F1SA 2K8BA 2NVUI 2KJ6A 2ZPYA 3LJ3A 3CSFA 2KKCA 2D07B 2DENB 1L7YA 2ZCCA 4EOYA 4DK5A 3ONSA 4BKSD 1MG8A 3H7SA 2CU1A 4K7WA 2N1WA 4JL9A 2L8JA 2O2VA 5C23A 3DBRI 2R2QA 3OLMD 2WDTB 1GC7A 2NBVB 3UGBB 3PTFC 3IG3A 2JVCA 4NY0A 3IVFA 4W9KA 2NCNA 3ZNID 4BVUC 5AEKB 4ICUA 4EKUA 2DAJA 3RD2A 2MBQA 3DVGY 3V62A 2CR5A 4DHZE 4KSLC 3KYCD 5DPSA 2RR9A 2QHOA 3IHPC 3UF8A 2FNJB 4EZLA 5D94A 2M1MA 2W9NA 1TTNA 2BYVE 4GGQA 2KC2A 3KYDD 3PLUA 2JXXA 3KUDB 4GDLB 5CTRC 3W1YA 4BFRA 1G6JA 2A4ZA 2KNBA 4LJOB 2MBBB 2JRHA 2L3ZA 4G11A 4NJ6A 5J17A 1LXDA 4FN2A 1ISNA 1SIFA 2KJHB 2V1YA 4G0NB 4KZCA 1WX7A 3DCGA 3L54A 4NNJB 3R7RA 4A20A 4WQOB 4FADA 2ZCBA 2FIFA 1S1QB 5CX3A 5E6PA 4ASWC 5L83A 2OJRA 3RYTA 4MSMB 2XK5A 1V2YA 2J0KA 3M62B 2AYOB 3QQ8B 2MCNB 1C1YB 1H4RA 2BKRB 2KWCA 4KSKC 3A33B 3PRPB 1WMHA 2GBMA 1IYFA 2LVPA 3UQAA 3QARA 3DBSA 2BYFA 4FJVB 5GMVA 2NPTB 5CHVC 2CKHB 2GBRA 4WJNA 2HTHA 5JH5C 3WAMA 1WJUA 3UQBA 4DXAB 1ZKHA 2JWZA 4MH0E 1WRDB 1L2NA 1KOTA 4ANUA 2GBNA 2JRIB 4OVVA 4KIKB 2ZEQA 4NJ7A 1WJ6A 2K6DB 1WI0A 4MM3A 3VTVA 1WY8A 2CHXA 4IM0A 4M8MA 3V6CB 2L00B 4GMVA 4JQWC 2KANA 3KUZA 3PT2B 1WXVA 3VDZA 2C7MB 3V61A 2BGFA 3HIZA 1CMXB 4EZJA 1WXSA 4WJOA 1UBIA 2MBEA 3L13A 2MLBA 2DZIA 3UIOB 2AWTA 4N9F4 3NOBA 4PS3A 1IPGA 4HPLB 3JSVA 2L05A 3ZVVA 1WGGA 2KWVB 3RZWC 2N9XA 1A5RA 1WM3A 4MGKE 1V5OA 1Z5SB 1ZGUB 4ANXA 3RUIB 3TBLD 1EF5A 2PE9A 1OQYA 5J2RA 4DDID 4MGYE 3JVZX 4HCPB 3V6EB 4FA6A 2KZRA 3EHVA 2C5LC 3NZUA 2KTFA 2KO3A 2AEHA 3A4SC 5CHWA 3OAWA 3OJ4B 2Y5BB 1LM8B 4AOFA 1UELA 5DPWA 1V81A 2NPTA 1WXAA 1WR6E 3CF6E 5E6NA 1BT0A 2KX0A 4BKGA 5C1ZA 1S3SG 3SD5A 3M95A 5AZFA 3PSEB 1RLFA 1I42A 3VXWA 4II2B 3GZNI 1X1MA 2VRRB 4KIKA 3B1LX 1R4NI 2EMSA 2IYDB 2N7EA 1HE8A 4G3XB 3OJ3A 4MEMA 5LLIA 2B3AA 2BPSA 1E8XA 3QJZA 1WJNA 2M17A 4GB9A 1T0YA 4WWNA 1E7UA 3TIXA 4G50A 2D2QA 2K8HA 4IM3A 4EFOA 2KDEB 3B08A 3RT3B 3H7PB 2C7NB 4BBNF 4W9GA 1UGMA 2FUHB 5DCNA 1WF9A 3X0WA 1V49A 2RGFA 4E74A 2C60A 5JZEB 3ZTDA 1UH6A 4E3CA 1SGHA 1WE7A 4HXDA 4IWPA 2REXA 2L0TA 4KZ0A 2KC1A 3K9OB 2OOBB 2K39A 1KJTA 3P2BA 1YX5B 4F7ZA 1WGRA 4GXBA 3NS8A 1JRUA 4AJYB 3VTUA
chains in the Genus database with same CATH superfamily
4NAMA 5IOIA 5KHQA 1T6BX 4AJWA 3IAS1 2DAFA 4GIVA 3IAM1 4FJZA 1QOFA 3VR8B 1PQSA 2PEAA 1WH3A 3DVGX 3DPDA 1IP9A 2KDBA 4KGSA 2LVOA 2INCC 2UU7A 3DBHB 4LTUA 4W9FA 1HA5A 1L4DB 4RFBA 1WR1A 4WWOA 4C56C 2I2YA 2LMCA 1OTRB 3H7PA 5DPRA 1UZXB 1OGWA 2Q5WD 1P7EA 2N4FA 4CO7A 3HVZA 1VZ8A 1DGJA 2KT7A 5MPOA 2ZNVC 2HE7A 1FPYA 2PPHA 3ZIMA 2LI5A 2LUEA 1PYWD 4IC7B 1QQRA 3DWMA 2WWZA 5FR3A 1AN8A 4ZYNA 2KFKA 5FKAC 1ZXHA 4NJCA 3DBLB 1N5XA 1T0RC 1L6UA 3APDA 1C3TA 2DHZA 4DHZB 1GOZA 1TKYA 2INDC 4P1CC 1YQ3B 4OZCA 4IWOA 5G5HA 3LYYA 4C7ZA 2CU3A 2FE8A 1FFVA 3Q6BA 2L1AA 3RULA 4RF0A 3Q14C 2MJEA 1XEEA 2V3SA 5FK9C 3ZNHB 3VQIA 1EWCA 3FC4A 2L7RA 2RPQA 3ZNZB 3ZO5B 2BYEA 4TQ1A 5AZHA 1E8ZA 4MJSB 4HEA1 2D3GA 3PGEA 2IY0B 2KK8A 3FILA 3VRBB 1ACCA 4KGRA 1SXTA 4FJYA 4DXGA 3V3XA 4NQLB 1YMHE 1TZ1A 5EDSA 4ZOHC 2WYQA 2WXRA 4X57B 1K51A 1WZ3A 3ZYYX 1P98A 4LNIA 3ZQ4A 3X23A 3ZJUA 3ZUNA 2G4SA 2KAJA 2EKEC 4WJPA 4YL8A 1D5ZC 4DBGA 2V4LA 1FEHA 3U52E 1F9JA 1JALA 3PV1A 4WH4A 1N62A 1WX9A 1JWUD 3ZKJC 3ECIA 3DHIC 2J4XA 3QCAA 1MJDA 2KMMA 2WXMA 2K1FA 3BYTB 3PRZA 2CS4A 3MHSD 1GAQB 3AULA 1QKZA 1NENB 3JW0X 1QOAA 1FCCC 2INPE 3SHQA 3I3TB 1UUPA 3MTNB 2VZKD 4GDKA 3ZXRA 2IJ0A 3HM3A 3IT6B 3L0WB 3RI7C 1VD2A 1KFYB 2KDFB 2CJNA 1LQBA 4KVGB 1OQQA 2K25A 3IFWB 3I63C 4LNOA 2BBCA 1L5PA 3M63B 1AW7A 4NAWB 1PUTA 2Z0EB 4TMAB 3ZJTA 3GE3C 4HDQA 3APFA 3W5UB 3TEXA 1YD8U 4IUMB 1SSNA 4HWIB 2NTTA 4E71A 1XD3B 5EE3A 4GDLA 1RFKA 4LDTD 4PK1A 3NVVA 1UD7A 3BWUD 3L10B 1GJZA 2CJOA 1XF5L 1TS3A 1GB4A 2YVCA 4EZKA 1JWMD 1WGHA 3CSTA 3VUWA 2RSUA 3B0AA 1K8RB 3PHXB 4AQ7A 3PZDA 3C19A 1I35A 4HPMB 2AX5A 1L0VB 1TKGA 2WX1A 4C4VA 3URYA 2KQ7A 3KLSX 3NG0A 3N20C 4DHJB 2HJ8A 1I4RA 1KLVA 1B1ZA 3VH4B 2XK5B 1FCLA 5JHBA 2JY6A 1CQVA 1AARA 5IP4D 3I9V1 2GLSA 2KJ6A 3CSFA 4EOYA 4DK5A 3ONSA 3EFCA 5BMGA 1MG8A 2MH7A 3H7SA 2ZW0A 1QT9A 3HUIA 2WDTB 2NBVB 3UGBB 4BVUC 3IVFA 4ICUA 4ARCA 2DAJA 2RR9A 3BIID 4LNFA 2FNJB 2KC2A 3KWLA 2WXPA 3KUDB 3RNEC 3W1YA 2A4ZA 1C79A 1LXDA 3U2SC 2KJHB 4G0NB 4S0RA 3L54A 4FADA 2OJRA 1PFDA 1SE3A 2MCNB 1IGCA 2WXIA 2QILA 3A33B 1WMHA 1KLGD 4IKGA 5CHVC 2LEKA 1T0SC 3UQBA 3WAMA 1VDVA 2IGHA 1FRDA 2GBNA 4KIKB 4NJ7A 4YSXB 1SIJA 1XLOA 2K6DB 3VTVA 2J53A 1ET6A 1VR9A 4IM0A 3V6CB 2XN9C 1NI3A 3HIZA 1TS4A 2DZIA 3UIOB 2WDVB 4KGTA 3ZVVA 1D4BA 2W55A 2KWVB 4JE3B 1FXIA 1A5RA 1ZGUB 2QMTA 3RUIB 3TBLD 1EF5A 2PE9A 1K52A 3V6EB 3MC9A 3OAWA 5HG2A 1CZPA 2BYTA 1UELA 1WXAA 5C1ZA 4YTMB 3NVWA 4DQOC 3SD5A 3M95A 1I42A 3W5VB 1PGXA 2D5GA 4P1BC 5C3JB 1HQRD 4LNKA 3RNCC 3AEDB 3UI3A 5IO9A 4HKQA 3Q3MC 2BPSA 2YEPB 3QJZA 2M17A 4WWNA 3TIXA 1E7UA 2D2QA 2G9HD 4IM3A 3RT3B 4XGAB 1TKEA 3NRZA 1R4NB 1V49A 2EELA 1SE4A 2C60A 4E74A 3ZTDA 3OWEB 1WE7A 4HXDA 2LGIA 2REXA 2L0TA 2WXOA 2DNFA 2K39A 1KJTA 1YX5B 1WGRA 1JCKB 4HJGE 2QDFA 3VTUA 3C0RB 1RAXA 2WXNA 3L4PA 4FLHA 1CJEA 2AQ3B 4USAA 4ZHPA 3N32A 4W9LA 1QZEA 4W9EA 1WX8A 4KDLB 1HTQA 2R61A 2ZVOA 5IA7A 5AZGA 3QHTA 4P16A 1TGZB 3A9KB 4WQMA 3ZRCA 4I6NB 4M0WB 5IKCM 2AL3A 3N1XC 4US9A 2KHWB 2MW5A 3N9YC 4URKA 5FR6A 1J7CA 2D3AA 3L17A 2KTRA 3LB8C 1QOGA 1QF6A 3D32A 1F1HA 2QCZA 3ALBA 3B2GA 4TKNA 3M3JA 1UBQA 3R66C 2DWQA 4IWQA 1WFYA 3VHTC 3WIMA 4FBJB 4BOSC 1LGRA 3LXFA 3O65B 2JF5A 4JIOU 4BOZB 1NI2A 3U30A 2MBHA 2IY1B 3ZDMC 4MGIE 1VLBA 2O6VA 2LJ5A 4IG7B 3DDCB 2KLCA 2JT4B 3AH7A 1IGDA 4RCOA 2FCSA 1QOBA 1J0GA 1ZW7A 2BB6A 3JYUA 4OHJA 2WP9B 1ZDVA 3T8MA 2EMTA 1P9DU 4HRSA 1NBFC 1WWTA 2ON8A 1YQ4B 2KVRA 2KN5A 3A9JA 2G4DB 1FNWA 2KOXA 2IBIB 5D3IB 3A1QA 2FCMA 2MA9B 2JPHA 1VJKA 2N9LA 1OFFA 1Y8RC 1R4MB 2C9WB 1HXYD 1J7AA 2KMCA 1RYJA 2LASA 2LWPA 4BKTA 3MJ5A 5IAAC 4XYCA 5H92C 1DOYA 4RM8A 4A3PA 3WA0A 5LXHA 4A9AA 1P1AA 4XWWA 3BK2A 2MBOA 1GUAB 4RGNA 2W82A 3ENEA 1GC6A 1I4QA 2LXCA 1TBEA 4HJKA 3NUHB 2GMIC 3AEGB 2XNAC 3VUXA 3Q3FA 3RNAC 3VH3B 4KDIC 1YQBA 1YJ1A 1U4AA 1M4VA 2E6XA 2BWES 2L76A 1WGKA 4MDKE 3W1SA 1SJED 1CK1A 1GNUA 2MP2A 3WAOA 2I1JA 3MFGA 4IM2A 2FAZA 2O6VD 4ZRPA 3AEAB 1WYGA 3I57A 2DBYA 5JXVA 4IOIE 1MG4A 1UWXA 2KWUB 4CYEA 4FA6A 2D10A 3P4QB 1HZ6A 4RNAA 1J8CA 2Z0DB 4A6QA 2HD5B 3AE3B 1BUIC 1JWBD 4AWJA 3UINB 2KVZA 4C7YA 4JWSC 1T5XD 2IGDA 3WALA 1YX6B 1TYGB 3RNBC 1E90A 3HK0A 1RRBA 1YNTE 4W9HA 2SEBD 1N63A 4MACA 2V0GA 1P3QU 3RNFC 1JWAD 2G45B 1NDDA 3J9CA 5HKHA 2JWUA 1KM7A 2Z59B 2RDBC 1OQRA 2O2VB 5TR5A 4C00A 3Q8EA 3ZW3A 1WIAA 2DZMA 4W9DA 3IBEA 3I5JC 1J7BA 2LRWA 3DQVA 3RZFA 3AE7B 1FIQA 4FHJA 2N9PC 1EF1A 2WQYB 4A55A 2K8CA 4JLCA 1E8YA 2K9XA 1JW9D 4HCNB 3EA6A 2ZVNA 4PYZA 1QILA 1V6EA 3U7ZA 1XLPA 4KV2A 3TJPA 1SB3C 1WZ0A 5BO4B 2LGSA 4DHJD 2WU2B 5BYQA 4YT0B 3TEWA 2DENB 2BB5A 3BZDB 4MM3B 2FUG1 2CU1A 2N1WA 2L8JA 3DBRI 3SR6A 3NJTA 1F52A 2HJ1A 3IG3A 4W9KA 3W9CB 2MBQA 2HDEA 2CR5A 4FXCA 3KYCD 5DPSA 2QHOA 3IHPC 4EZLA 5D94A 2M1MA 2W9NA 2BYVE 3KYDD 2X8XX 4KX6B 2MBBB 4NJ6A 3B2FA 4FN2A 1SIFA 5G55A 4F8CB 1WX7A 4TSSA 1L4ZB 5L83A 5E6PA 4MSMB 2AYOB 1H4RA 2LVPA 3UQAA 4FJVB 3DBSA 3QARA 2NPTB 4WJNA 1E6EB 2HTHA 2Y3AA 2ONQA 1WJUA 5JH5C 1ZP0B 1ZKHA 2JWZA 3DWGC 1L2NA 4OVVA 2ZEQA 1WI0A 1NYQA 1TY2A 3WCQA 2NTSA 1XCTL 4GMVA 4JQWC 1DYQA 3PT2B 1A70A 1N61A 2C7MB 3V61A 2MJ3A 2BGFA 1WXSA 3B9JA 2MBEA 5E6JA 1P7FA 1SJHD 1RM6C 3AN1A 2RDGA 1SE2A 4O1NA 1V1PA 1WM3A 3Q8FA 2M56B 1OQYA 4MGYE 2RPVA 5TSSA 1TJEA 3EHVA 3AEEB 4M0WA 4Q2JA 5DPWA 5AUIA 1WR6E 5E6NA 1BT0A 3RNGC 2KX0A 1F2RC 1RLFA 3VXWA 4II2B 3GZNI 2VRRB 2PLPA 2EMSA 1HE8A 4G3XB 3GB1A 4MEMA 4S17A 5LLIA 1C4PA 1I7HA 1T0YA 2K8HA 3P4PB 2W3SA 3H7PB 2FUHB 5DCNA 1WF9A 2WXKA 2W54A 4N6EB 5JZEB 1UH6A 2HTME 4IWPA 4DXFA 4IDIA 3ZJVA 4F7ZA 4GXBA 2WXLA 3ZTCA 4ZHOA 2L0FA 1EWYC 2DYMA 2LJIA 1C78A 2PVOD 1IBXA 3GP7A 5HFYA 3Q8CA 5EE0A 4YTNB 2R2OA 2KLGA 2KFKB 2QIEB 1KRHA 3W2DA 3AE2B 4M01A 3ZLZA 4OVZA 2KJRA 3PPAA 4FULA 4PS8A 2BS4B 4TV3A 1Y56A 1YN3A 2FCQA 1ROEA 3DHHC 2YEPF 1ZXIA 4BBNC 2AQ1B 3PVLA 2KD0A 2AL6A 2IO0B 4ICVA 1EO6A 2WXFA 3N3KB 3H1UA 5BMHA 3QA8A 3L16A 2V9HA 5G2NA 3N30A 4EEWA 3ML8A 3QAQA 2INNE 1JMLA 3K9PB 5AUKA 1DOIA 3AEFB 4R3DA 3P63A 4LDTB 4B6WA 2JUOA 3U4EG 4PS7A 1JQ4A 4PYUA 3ZGZA 1EM7A 3IT4B 2XEWA 2FIDA 4ZRKA 1E10A 2LGYA 1C4AA 5JHAA 1FXTB 4XX5A 1RWSA 1PDXA 3W1SC 2TSSA 2CHWA 3AMZA 3EC8A 3ZDTA 2ZJDA 2EKIA 4N59A 3SEBA 1XLNA 2J7QB 1XQQA 1YOVB 5E6OA 4W9CA 3AE6B 1OEYA 4XWTA 4XDDA 1F2RI 1WGDA 3Q2AC 2L83A 4JPSA 2XBBC 2MWSB 4AP4C 3C8YA 3Q3JA 2D3CA 4GLSC 4W9JA 1Q1OA 2GBJA 2IO3B 1ZDXA 4TUUA 1XT9B 1E5WA 2KFJA 3TUOA 4GDKB 4RMAA 4B9KA 4DDGD 3Q8BA 3WAPA 3BK1A 3N1ZC 4ZRIA 3DOWA 2NBUA 4A3OA 1N6ZA 4M02A 1P0RA 1WJ4A 4MELA 3MJWA 4YSYB 3GOEA 1E8WA 4JGHB 4WAAA 4B0MA 3AEBB 2JZ3B 1FRRA 1V5TA 2KDIA 3AB5A 2JQRB 4DWFA 5J18A 4WAFA 5HHDG 4C80A 2BVCA 3AV8A 1F0ZA 2QSDA 4W9IA 1WE6A 4YXDB 2ZW1A 3AU4A 4ACFA 4LJPB 3LDZE 2PVGC 3DVNV 3EFUA 3L08A 4MJSA 4XZ4A 4ANVA 3APCA 3TL5A 1TS5A 3NS1A 5L95C 2LUMA 2MEKA 2RDHA 1TY0A 2A5UA 3U8ZA 1E7PB 4BKSA 2MHJA 1MFWA 3QWZB 4N58A 4XC2A 5IN7A 2D3BA 2N7JA 1KH0A 1NYRA 4HLEA 4TQ0A 4IW0A 4C4VB 4RH6A 2ZZPB 1SBBB 4P6VF 3EECA 2ZNVB 1RFAA 3V05A 2DX5B 3NHEB 2SAKA 3IXSA 1V97A 1FNVA 1UNSA 2BWFA 2N1VA 3ML9A 4ARIA 3T3OA 3KW5B 2IO2B 3NZ3A 3BVMA 2RD0A 2X38A 1E9MA 4L1BA 2ASQA 3V60A 2PKOA 3HM6X 1V86A 3KUCB 2NBWB 3P4RB 3PO0A 2N9EB 3RCZA 2CHZA 2J0JA 4XE0A 1IUEA 3P4SB 3RFZB 1L6VA 3AE9B 3BINA 4NAWA 2WGSA 4AS1A 2Y5CA 3RN9C 1MHHE 3PREA 3TMPB 2JYTA 2BQQA 2M0XA 2V4IB 1WMHB 2PMVA 3MC0B 2LRUA 3BVZA 2DLBA 4EUTA 1MI0A 2H88B 2J52A 1YIWA 4BAXA 3PHWB 2MSED 4II3B 4F1SA 2NVUI 3LJ3A 2KKCA 2D07B 2ZCCA 2L32A 4BKSD 1V1OA 4NZLB 4YTPB 4K7WA 5C23A 4HROA 5D3DA 3OLMD 3VRAB 1GC7A 5AEKB 4NY0A 3ZNID 2NCNA 3DHGC 1DOXA 4K3BA 2GRIA 4EKUA 1ENFA 3RD2A 3DVGY 3UF8A 2FBWB 3PLUA 2QJLA 2JXXA 5CTRC 3H8HA 4LJOB 2JRHA 2L3ZA 4YWGG 1ISNA 3ABVB 4A20A 2FIFA 1S1QB 4ASWC 3RYTA 4A90A 2XK5A 3QQ8B 3Q3NC 1C1YB 2BKRB 2KDMA 2KWCA 4KSKC 1IYFA 5H8YE 2BTEA 4H2AA 1MHXA 1K53A 3AE4B 4MH0E 4B0EA 4ANUA 2JRIB 3MHZA 1WJ6A 1WY8A 3MC8A 3AM9A 3KUZA 1WRIA 1WXVA 2KN4A 2LHEA 4EZJA 4WJOA 3L13A 2MLBA 5BYSA 2AWTA 4KKJA 4N9F4 1HEZE 3NOBA 2ACZB 4PS3A 1N60A 3NVYA 4HPLB 2L05A 1WGGA 2N9XA 2KACA 2LHDA 1XLQA 1Z5SB 4ANXA 5J2RA 2Z8LA 4HCPB 4HKZE 2C5LC 3NZUA 2KO3A 3A4SC 4KKIA 3OJ4B 1FXAA 1LM8B 4AOFA 1YJIA 1V81A 3R2TA 2OJWA 3CF6E 4L23A 4RGTA 5AZFA 3GS2A 4LK0M 2JYEA 5G5GA 4KIKA 4K3CA 1R4NI 2IYDB 3Q3OC 1AYFA 1E8XA 4G50A 2BS2B 4EFOA 3AE8B 2KDEB 4BBNF 2C7NB 3RMKC 1UGMA 2KYWA 2RGFA 1GPXA 4E3CA 1SGHA 2K5PA 1JRUA 4AJYB 4ZRQA 2K3UA 3ZRFA 2ICIA 3CWIA 1PGBA 1N5WA 2KTRB 2YLMA 3VVWB 1V9JA 2GI9A 1EUVB 2E3TA 2N9KA 2K6QA 5DPTA 5I4DA 2WLBA 2PTLA 1K50A 1D3ZA 4GOCA 2OEDA 3AI5A 1JRPA 2PE6B 5EE9A 1FMAD 4M8NA 3JSVB 2JSVX 4I6PA 1R7SA 3SFEB 1FO4A 4RGMA 2WDQB 3VFKA 3T9LA 1ET9A 4RM9A 1FNUA 1Q0WB 2WHIA 1VZ6A 4NQKE 5D7GA 3BY4B 2O6VB 3P1MA 3VAWA 4D2KA 3U7DA 4REZA 3CIRB 4BZAA 2W3RA 4LCDE 1L0YB 2BKFA 3SDLC 2BS3B 1LFDA 4K81A 2PJHA 4PT5A 2NMQA 3ZNGC 4ZYSA 2N7DA 2WU5B 4GSWA 1KF6B 2KWDA 1GG3A 3T3NA 1WGYA 4MSQB 1I4GA 2IZVB 4L2YA 2JXTA 3FAHA 1EU3A 1BMLC 2WXQA 2V3PA 3KH0A 4HK2A 3R8BA 3A9JB 3UIPB 4B95A 2WXHA 3A1QB 4K1RB 2UYZB 4EE2A 2I1KA 1TT5B 1YN4A 2MRPA 4J3OD 3A9KA 4K7SA 1WYWB 2WXGA 3TSSA 4A8XC 2M19A 2G1EA 3TEZA 2J42A 3HVDA 4HDOA 5BYRA 2LGDA 2G3QB 3S2AA 1WM2A 2LXAA 4P7IA 3PRMB 3PS6A 1I4HA 2N0SB 1Q5WB 3PLVA 3TCAA 2OHFA 1KTKA 3OG5A 4FHKA 4AUQC 4QAYA 4CQNA 1WXQA 2KQSA 2KQ4X 2VH2A 5GXGB 3BVGA 1BXTA 1B9RA 1R4MI 1YN5A 2IDYA 3TEYA 1C4CA 4ANWA 2JU6X 2MP2B 1VRAB 4OW0A 1F77A 2C7HA 3PZ7A 3Q69A 1M94A 3DBHI 3KQ4A 1NEKB 2WNMA 1STEA 5BMIA 2WX0A 2GOWA 2BF8B 2FCNA 2IO1B 1JWSD 2LFIA 3QC8B 1Z2MA 4I6LB 5LXIB 2MX2A 4OZAA 3QX1A 1OEYJ 4JX1C 2JX5A 5D2MB 2VZKB 5HI1A 1AWDA 3P42A 2KX3A 2UWQA 4UDUC 4WJQA 4MH8A 1T3QA 3EGRA 4GN1A 2DZJA 3NY5A 2BW2A 1YJJA 1E0ZA 3BYYB 1JROA 3QK0A 4K7UA 3AU5A 2NS5A 2L52A 3H6NA 2GBKA 2ZPNA 3EUB2 2BT6A 3DVNU 1MPEA 4CHKA 4XDCA 2LZ6A 5KHOA 1VCBA 2MQJA 1I4XA 1XXGA 3DBLI 2DZKA 5D6JB 5T8IA 1T0QC 1WXMA 1TS2A 1UF0A 2M8SA 3FILB 3VTWA 3E56A 2D11A 2DYOA 2WDRB 3CMMB 3R3MA 1SF0A 3HRDD 1ZE3D 3NZSA 1H8CA 1D6EC 1LO5D 4MGZE 3O13A 2DYBA 3MP9A 3SU8X 2VH1A 3R2IA 4OZBA 4JWUC 1D5XC 4NPNA 4YSZB 1J19A 4HPPA 3HHMA 3QIJA 1PGAA 2J0MA 1TZOA 2LD9A 1SE9A 2JZZA 4GU2A 1E7VA 3R7QA 5C2TB 4RGOS 1GB1A 2KMAA 3AXCA 3E9SA 2WXJA 4J6IA 2LVQA 1MVKA 4ZRJA 1V80A 4WWPA 2LGXA 3VUYA 3KVFB 2K22A 5CHFA 2RMMA 4ITKA 2KXJA 3H9DA 2IGGA 2M4NA 3A4RA 1ZPSA 1C77A 2NR2A 4ZDVA 1C9FA 4MT5A 5EE1A 4HVBA 1EU4A 1UGJA 2PIAA 2PW9A 4OVUA 1UWMA 1HTOA 1FM0D 2K8BA 2ZPYA 1L7YA 1FD6A 5LNK1 2GB1A 4JL9A 2O2VA 1HZ5A 2K0PA 2R2QA 2Y5PA 4LNNA 4WWMA 3PTFC 2JVCA 3V62A 4DHZE 4KSLC 3AE5B 3DBRB 1SEBD 4GGQA 1TTNA 1Q10A 1C76A 4RF1A 4GDLB 3ZXVA 4BFRA 1G6JA 2KNBA 4G11A 1V1PB 5J17A 4NNJB 2V1YA 3WANA 3PZ8A 4KZCA 3R7RA 3DCGA 4WQOB 2JZPA 2ZCBA 5CX3A 1V2YA 1KLUD 2J0KA 3M62B 3RPFC 3PRPB 3KWVA 3AE1B 2GBMA 2QEJC 2MJDA 1ZOYB 2BYFA 3N1YC 5GMVA 3Q8AA 1XO3A 3ETRA 2CKHB 2GBRA 4DXAB 1WRDB 1KOTA 2QC8A 4MM3A 2CHXA 4M8MA 2V3NA 2L00B 1ESFA 1VZ7A 2AQ2B 2KANA 1ZUD2 3VDZA 1V8CA 1CMXB 1UBIA 4WURA 2IPKD 4WIPA 1IPGA 3JSVA 3RZWC 4MGKE 1V5OA 4US8A 1NVID 3NVZA 4DDID 3JVZX 2KZRA 2KTFA 2AEHA 1TIFA 5CHWA 1WSPA 2Y5BB 1FFUA 3VR9B 1IBXB 3FKYA 2NPTA 3GE8C 3AECB 4BKGA 1S3SG 2H89B 3PSEB 1I4PA 3SFDB 1X1MA 3B1LX 2N7EA 1L0XB 3OJ3A 2B3AA 1WJNA 4GB9A 1D5MC 1QLBB 3B08A 2B76B 3GZNB 2I38A 4W9GA 3X0WA 4LLGM 2WS3B 4KZ0A 4M00A 2KC1A 3K9OB 2OOBB 1XCQL 3P2BA 3NS8A 2M0AA
chains in the Genus database with same CATH topology
3ZRFA 3ZTCA 5KHQA 2L0FA 4AJWA 2KTRB 3C0RB 1RAXA 2YLMA 1V9JA 3VVWB 1EUVB 2DYMA 2K6QA 2DAFA 4FLHA 5DPTA 4GIVA 4FJZA 1D3ZA 1PQSA 2PEAA 4GOCA 1WH3A 3AI5A 3DVGX 2PE6B 3DPDA 1IP9A 2R2OA 4M8NA 2KLGA 2KDBA 3JSVB 4I6PA 2LVOA 2KFKB 3N32A 4W9LA 4W9FA 1QZEA 1WR1A 4WWOA 4W9EA 3ZLZA 1WX8A 4KDLB 2KJRA 2ZVOA 3VFKA 5IA7A 3PPAA 3T9LA 4FULA 4PS8A 5AZGA 4RM9A 4TV3A 3QHTA 1Q0WB 1TGZB 2FCQA 3A9KB 4NQKE 1OTRB 3H7PA 5DPRA 3ZRCA 5D7GA 4I6NB 3BY4B 2O6VB 1UZXB 4M0WB 3VAWA 1OGWA 3U7DA 2AL3A 4BBNC 2N4FA 3PVLA 4LCDE 4CO7A 2KD0A 2AL6A 2BKFA 3SDLC 2KHWB 1LFDA 4K81A 2MW5A 2PJHA 4URKA 2IO0B 2ZNVC 3ZNGC 2N7DA 4GSWA 4ICVA 5FR6A 1EO6A 2HE7A 1GG3A 3N3KB 3H1UA 1WGYA 3L17A 2KTRA 3QA8A 2PPHA 3L16A 3ZIMA 5G2NA 2LI5A 2LUEA 4MSQB 3D32A 3N30A 2IZVB 4EEWA 4F8CB 3ALBA 4TKNA 3M3JA 4IC7B 1UBQA 3ML8A 3KH0A 3R66C 4HK2A 2WWZA 3QAQA 3A9JB 4IWQA 3UIPB 1WFYA 3K9PB 3VHTC 4ZYNA 3WIMA 2KFKA 4B95A 4FBJB 4BOSC 4LDTB 4B6WA 2JUOA 3A1QB 3O65B 4PS7A 4PYUA 2JF5A 4JIOU 4K1RB 4BOZB 2UYZB 3APDA 2I1KA 2XEWA 1C3TA 1NI2A 2DHZA 2MRPA 3U30A 2FIDA 4DHZB 4ZRKA 2MBHA 2IY1B 2LGYA 5JHAA 3A9KA 1FXTB 4K7SA 3ZDMC 4MGIE 2O6VA 1WYWB 4XX5A 4IWOA 2LJ5A 4IG7B 3DDCB 2KLCA 2JT4B 3W1SC 2CHWA 4HDOA 3RULA 3EC8A 3ZDTA 2ZJDA 2LGDA 2FCSA 2J7QB 2G3QB 1XQQA 1ZW7A 1J0GA 3S2AA 1WM2A 2LXAA 4P7IA 3JYUA 3PRMB 5E6OA 4W9CA 3T8MA 2V3SA 1OEYA 3ZNHB 3PS6A 2EMTA 1Q5WB 3PLVA 1WGDA 3TCAA 1P9DU 3VQIA 1NBFC 2XBBC 2MWSB 4AP4C 2L7RA 4FHKA 2RPQA 4AUQC 3ZNZB 5G55A 3ZO5B 2BYEA 2KVRA 2KQSA 4TQ1A 5AZHA 1E8ZA 3Q3JA 4MJSB 2KN5A 4W9JA 1Q1OA 2D3GA 3A9JA 2G4DB 3PGEA 2GBJA 2IO3B 1R4MI 2IY0B 1XT9B 2IBIB 2KOXA 4TUUA 1E5WA 2KFJA 2KK8A 4ANWA 4GDKB 2MP2B 4RMAA 3A1QA 2FCMA 2MA9B 4B9KA 2JPHA 4DDGD 3WAPA 4ZRIA 4FJYA 2C7HA 3DOWA 2NBUA 4NQLB 1Y8RC 4A3OA 1M94A 3DBHI 1P0RA 1TZ1A 1WJ4A 5EDSA 2WYQA 4X57B 2C9WB 1WZ3A 4MELA 3MJWA 3GOEA 2KMCA 2WX0A 1E8WA 2GOWA 4JGHB 2BF8B 2LASA 2FCNA 1P98A 2LWPA 2IO1B 4WAAA 3QC8B 4BKTA 3X23A 3ZUNA 2G4SA 2JZ3B 5IAAC 2EKEC 4WJPA 1V5TA 1Z2MA 4RM8A 2KDIA 4I6LB 4YL8A 3WA0A 4A3PA 4DBGA 2V4LA 5LXHA 5LXIB 2MX2A 1P1AA 3QX1A 1OEYJ 1F9JA 3PV1A 4DWFA 2MBOA 5J18A 1GUAB 1WX9A 3ZKJC 3ENEA 1GC6A 3ECIA 2LXCA 5D2MB 4W9IA 1TBEA 1WE6A 3QCAA 4HJKA 2KX3A 3AU4A 2UWQA 2GMIC 4LJPB 2K1FA 4WJQA 3VUXA 3LDZE 3Q3FA 3DVNV 3EFUA 4GN1A 4KDIC 3VH3B 2DZJA 3L08A 3PRZA 1YQBA 2CS4A 3NY5A 1YJ1A 1U4AA 3MHSD 4MJSA 4XZ4A 4ANVA 3AULA 2BWES 2L76A 4MDKE 3W1SA 3JW0X 3APCA 3TL5A 3QK0A 3SHQA 4K7UA 5L95C 3I3TB 1GNUA 3AU5A 3MTNB 2MP2A 2NS5A 4GDKA 3WAOA 3H6NA 3HM3A 2A5UA 3U8ZA 4BKSA 2I1JA 2GBKA 3QWZB 2ZPNA 4IM2A 2FAZA 2O6VD 3L0WB 4XC2A 3DVNU 1VD2A 4CHKA 2KDFB 1LQBA 2KWUB 3WANA 2LZ6A 4CYEA 2D10A 1VCBA 2K25A 2MQJA 3IFWB 4KVGB 5KHOA 4HLEA 3DBLI 1J8CA 2DZKA 2Z0DB 5D6JB 4TQ0A 4IW0A 2HD5B 4AWJA 3M63B 4NAWB 3UINB 1WXMA 2Z0EB 2ZZPB 3WALA 2M8SA 1YX6B 4HDQA 3EECA 2ZNVB 1E90A 3APFA 3HK0A 3VTWA 1RFAA 1RRBA 2D11A 2DX5B 2DYOA 3NHEB 4W9HA 1YD8U 3CMMB 4IUMB 3R3MA 4HWIB 1P3QU 1H8CA 3NZSA 2BWFA 2N1VA 3ML9A 2G45B 4MGZE 4E71A 3KW5B 2IO2B 2DYBA 1NDDA 1XD3B 3SU8X 2RD0A 4GDLA 4LDTD 5HKHA 2ASQA 1UD7A 3L10B 3V60A 1GJZA 1KM7A 2Z59B 3HM6X 1V86A 4NPNA 1J19A 2O2VB 3HHMA 3QIJA 2YVCA 3KUCB 5TR5A 2J0MA 4EZKA 2NBWB 2LD9A 1SE9A 2JZZA 1WGHA 3CSTA 3VUWA 4GU2A 3ZW3A 2RSUA 3B0AA 2N9EB 1WIAA 2DZMA 4W9DA 1K8RB 3IBEA 3PHXB 1E7VA 3R7QA 3PZDA 3RCZA 1I35A 2CHZA 2J0JA 2LRWA 4HPMB 2KMAA 3DQVA 3RZFA 3AXCA 4J6IA 3BINA 2WX1A 2LVQA 2KQ7A 4FHJA 4ZRJA 2N9PC 4NAWA 1V80A 4DHJB 2HJ8A 2LGXA 4WWPA 3VUYA 1EF1A 1KLVA 3KVFB 3PREA 5CHFA 3VH4B 2K8CA 4JLCA 2XK5B 2KXJA 3H9DA 2M4NA 3A4RA 1E8YA 3TMPB 2M0XA 2NR2A 1WMHB 4HCNB 5JHBA 4ZDVA 2LRUA 2JY6A 2ZVNA 4PYZA 4EUTA 1V6EA 4HVBA 4KV2A 3TJPA 1AARA 1WZ0A 1YIWA 4OVUA 5BO4B 3PHWB 2MSED 4II3B 4DHJD 4F1SA 2K8BA 2NVUI 2KJ6A 2ZPYA 3LJ3A 3CSFA 2KKCA 2D07B 2DENB 1L7YA 2ZCCA 4EOYA 4DK5A 3ONSA 4BKSD 1MG8A 3H7SA 2CU1A 4K7WA 2N1WA 4JL9A 2L8JA 2O2VA 5C23A 3DBRI 2R2QA 3OLMD 2WDTB 1GC7A 2NBVB 3UGBB 3PTFC 3IG3A 2JVCA 4NY0A 3IVFA 4W9KA 2NCNA 3ZNID 4BVUC 5AEKB 4ICUA 4EKUA 2DAJA 3RD2A 2MBQA 3DVGY 3V62A 2CR5A 4DHZE 4KSLC 3KYCD 5DPSA 2RR9A 2QHOA 3IHPC 3UF8A 2FNJB 4EZLA 5D94A 2M1MA 2W9NA 1TTNA 2BYVE 4GGQA 2KC2A 3KYDD 3PLUA 2JXXA 3KUDB 4GDLB 5CTRC 3W1YA 4BFRA 1G6JA 2A4ZA 2KNBA 4LJOB 2MBBB 2JRHA 2L3ZA 4G11A 4NJ6A 5J17A 1LXDA 4FN2A 1ISNA 1SIFA 2KJHB 2V1YA 4G0NB 4KZCA 1WX7A 3DCGA 3L54A 4NNJB 3R7RA 4A20A 4WQOB 4FADA 2ZCBA 2FIFA 1S1QB 5CX3A 5E6PA 4ASWC 5L83A 2OJRA 3RYTA 4MSMB 2XK5A 1V2YA 2J0KA 3M62B 2AYOB 3QQ8B 2MCNB 1C1YB 1H4RA 2BKRB 2KWCA 4KSKC 3A33B 3PRPB 1WMHA 2GBMA 1IYFA 2LVPA 3UQAA 3QARA 3DBSA 2BYFA 4FJVB 5GMVA 2NPTB 5CHVC 2CKHB 2GBRA 4WJNA 2HTHA 5JH5C 3WAMA 1WJUA 3UQBA 4DXAB 1ZKHA 2JWZA 4MH0E 1WRDB 1L2NA 1KOTA 4ANUA 2GBNA 2JRIB 4OVVA 4KIKB 2ZEQA 4NJ7A 1WJ6A 2K6DB 1WI0A 4MM3A 3VTVA 1WY8A 2CHXA 4IM0A 4M8MA 3V6CB 2L00B 4GMVA 4JQWC 2KANA 3KUZA 3PT2B 1WXVA 3VDZA 2C7MB 3V61A 2BGFA 3HIZA 1CMXB 4EZJA 1WXSA 4WJOA 1UBIA 2MBEA 3L13A 2MLBA 2DZIA 3UIOB 2AWTA 4N9F4 3NOBA 4PS3A 1IPGA 4HPLB 3JSVA 2L05A 3ZVVA 1WGGA 2KWVB 3RZWC 2N9XA 1A5RA 1WM3A 4MGKE 1V5OA 1Z5SB 1ZGUB 4ANXA 3RUIB 3TBLD 1EF5A 2PE9A 1OQYA 5J2RA 4DDID 4MGYE 3JVZX 4HCPB 3V6EB 4FA6A 2KZRA 3EHVA 2C5LC 3NZUA 2KTFA 2KO3A 2AEHA 3A4SC 5CHWA 3OAWA 3OJ4B 2Y5BB 1LM8B 4AOFA 1UELA 5DPWA 1V81A 2NPTA 1WXAA 1WR6E 3CF6E 5E6NA 1BT0A 2KX0A 4BKGA 5C1ZA 1S3SG 3SD5A 3M95A 5AZFA 3PSEB 1RLFA 1I42A 3VXWA 4II2B 3GZNI 1X1MA 2VRRB 4KIKA 3B1LX 1R4NI 2EMSA 2IYDB 2N7EA 1HE8A 4G3XB 3OJ3A 4MEMA 5LLIA 2B3AA 2BPSA 1E8XA 3QJZA 1WJNA 2M17A 4GB9A 1T0YA 4WWNA 1E7UA 3TIXA 4G50A 2D2QA 2K8HA 4IM3A 4EFOA 2KDEB 3B08A 3RT3B 3H7PB 2C7NB 4BBNF 4W9GA 1UGMA 2FUHB 5DCNA 1WF9A 3X0WA 1V49A 2RGFA 4E74A 2C60A 5JZEB 3ZTDA 1UH6A 4E3CA 1SGHA 1WE7A 4HXDA 4IWPA 2REXA 2L0TA 4KZ0A 2KC1A 3K9OB 2OOBB 2K39A 1KJTA 3P2BA 1YX5B 4F7ZA 1WGRA 4GXBA 3NS8A 1JRUA 4AJYB 3VTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRF A;  3ZTC A;  5KHQ A;  2L0F A;  4AJW A;  2KTR B;  3C0R B;  1RAX A;  2YLM A;  1V9J A;  3VVW B;  1EUV B;  2DYM A;  2K6Q A;  2DAF A;  4FLH A;  5DPT A;  4GIV A;  4FJZ A;  1D3Z A;  1PQS A;  2PEA A;  4GOC A;  1WH3 A;  3AI5 A;  3DVG X;  2PE6 B;  3DPD A;  1IP9 A;  2R2O A;  4M8N A;  2KLG A;  2KDB A;  3JSV B;  4I6P A;  2LVO A;  2KFK B;  3N32 A;  4W9L A;  4W9F A;  1QZE A;  1WR1 A;  4WWO A;  4W9E A;  3ZLZ A;  1WX8 A;  4KDL B;  2KJR A;  2ZVO A;  3VFK A;  5IA7 A;  3PPA A;  3T9L A;  4FUL A;  4PS8 A;  5AZG A;  4RM9 A;  4TV3 A;  3QHT A;  1Q0W B;  1TGZ B;  2FCQ A;  3A9K B;  4NQK E;  1OTR B;  3H7P A;  5DPR A;  3ZRC A;  5D7G A;  4I6N B;  3BY4 B;  2O6V B;  1UZX B;  4M0W B;  3VAW A;  1OGW A;  3U7D A;  2AL3 A;  4BBN C;  2N4F A;  3PVL A;  4LCD E;  4CO7 A;  2KD0 A;  2AL6 A;  2BKF A;  3SDL C;  2KHW B;  1LFD A;  4K81 A;  2MW5 A;  2PJH A;  4URK A;  2IO0 B;  2ZNV C;  3ZNG C;  2N7D A;  4GSW A;  4ICV A;  5FR6 A;  1EO6 A;  2HE7 A;  1GG3 A;  3N3K B;  3H1U A;  1WGY A;  3L17 A;  2KTR A;  3QA8 A;  2PPH A;  3L16 A;  3ZIM A;  5G2N A;  2LI5 A;  2LUE A;  4MSQ B;  3D32 A;  3N30 A;  2IZV B;  4EEW A;  4F8C B;  3ALB A;  4TKN A;  3M3J A;  4IC7 B;  1UBQ A;  3ML8 A;  3KH0 A;  3R66 C;  4HK2 A;  2WWZ A;  3QAQ A;  3A9J B;  4IWQ A;  3UIP B;  1WFY A;  3K9P B;  3VHT C;  4ZYN A;  3WIM A;  2KFK A;  4B95 A;  4FBJ B;  4BOS C;  4LDT B;  4B6W A;  2JUO A;  3A1Q B;  3O65 B;  4PS7 A;  4PYU A;  2JF5 A;  4JIO U;  4K1R B;  4BOZ B;  2UYZ B;  3APD A;  2I1K A;  2XEW A;  1C3T A;  1NI2 A;  2DHZ A;  2MRP A;  3U30 A;  2FID A;  4DHZ B;  4ZRK A;  2MBH A;  2IY1 B;  2LGY A;  5JHA A;  3A9K A;  1FXT B;  4K7S A;  3ZDM C;  4MGI E;  2O6V A;  1WYW B;  4XX5 A;  4IWO A;  2LJ5 A;  4IG7 B;  3DDC B;  2KLC A;  2JT4 B;  3W1S C;  2CHW A;  4HDO A;  3RUL A;  3EC8 A;  3ZDT A;  2ZJD A;  2LGD A;  2FCS A;  2J7Q B;  2G3Q B;  1XQQ A;  1ZW7 A;  1J0G A;  3S2A A;  1WM2 A;  2LXA A;  4P7I A;  3JYU A;  3PRM B;  5E6O A;  4W9C A;  3T8M A;  2V3S A;  1OEY A;  3ZNH B;  3PS6 A;  2EMT A;  1Q5W B;  3PLV A;  1WGD A;  3TCA A;  1P9D U;  3VQI A;  1NBF C;  2XBB C;  2MWS B;  4AP4 C;  2L7R A;  4FHK A;  2RPQ A;  4AUQ C;  3ZNZ B;  5G55 A;  3ZO5 B;  2BYE A;  2KVR A;  2KQS A;  4TQ1 A;  5AZH A;  1E8Z A;  3Q3J A;  4MJS B;  2KN5 A;  4W9J A;  1Q1O A;  2D3G A;  3A9J A;  2G4D B;  3PGE A;  2GBJ A;  2IO3 B;  1R4M I;  2IY0 B;  1XT9 B;  2IBI B;  2KOX A;  4TUU A;  1E5W A;  2KFJ A;  2KK8 A;  4ANW A;  4GDK B;  2MP2 B;  4RMA A;  3A1Q A;  2FCM A;  2MA9 B;  4B9K A;  2JPH A;  4DDG D;  3WAP A;  4ZRI A;  4FJY A;  2C7H A;  3DOW A;  2NBU A;  4NQL B;  1Y8R C;  4A3O A;  1M94 A;  3DBH I;  1P0R A;  1TZ1 A;  1WJ4 A;  5EDS A;  2WYQ A;  4X57 B;  2C9W B;  1WZ3 A;  4MEL A;  3MJW A;  3GOE A;  2KMC A;  2WX0 A;  1E8W A;  2GOW A;  4JGH B;  2BF8 B;  2LAS A;  2FCN A;  1P98 A;  2LWP A;  2IO1 B;  4WAA A;  3QC8 B;  4BKT A;  3X23 A;  3ZUN A;  2G4S A;  2JZ3 B;  5IAA C;  2EKE C;  4WJP A;  1V5T A;  1Z2M A;  4RM8 A;  2KDI A;  4I6L B;  4YL8 A;  3WA0 A;  4A3P A;  4DBG A;  2V4L A;  5LXH A;  5LXI B;  2MX2 A;  1P1A A;  3QX1 A;  1OEY J;  1F9J A;  3PV1 A;  4DWF A;  2MBO A;  5J18 A;  1GUA B;  1WX9 A;  3ZKJ C;  3ENE A;  1GC6 A;  3ECI A;  2LXC A;  5D2M B;  4W9I A;  1TBE A;  1WE6 A;  3QCA A;  4HJK A;  2KX3 A;  3AU4 A;  2UWQ A;  2GMI C;  4LJP B;  2K1F A;  4WJQ A;  3VUX A;  3LDZ E;  3Q3F A;  3DVN V;  3EFU A;  4GN1 A;  4KDI C;  3VH3 B;  2DZJ A;  3L08 A;  3PRZ A;  1YQB A;  2CS4 A;  3NY5 A;  1YJ1 A;  1U4A A;  3MHS D;  4MJS A;  4XZ4 A;  4ANV A;  3AUL A;  2BWE S;  2L76 A;  4MDK E;  3W1S A;  3JW0 X;  3APC A;  3TL5 A;  3QK0 A;  3SHQ A;  4K7U A;  5L95 C;  3I3T B;  1GNU A;  3AU5 A;  3MTN B;  2MP2 A;  2NS5 A;  4GDK A;  3WAO A;  3H6N A;  3HM3 A;  2A5U A;  3U8Z A;  4BKS A;  2I1J A;  2GBK A;  3QWZ B;  2ZPN A;  4IM2 A;  2FAZ A;  2O6V D;  3L0W B;  4XC2 A;  3DVN U;  1VD2 A;  4CHK A;  2KDF B;  1LQB A;  2KWU B;  3WAN A;  2LZ6 A;  4CYE A;  2D10 A;  1VCB A;  2K25 A;  2MQJ A;  3IFW B;  4KVG B;  5KHO A;  4HLE A;  3DBL I;  1J8C A;  2DZK A;  2Z0D B;  5D6J B;  4TQ0 A;  4IW0 A;  2HD5 B;  4AWJ A;  3M63 B;  4NAW B;  3UIN B;  1WXM A;  2Z0E B;  2ZZP B;  3WAL A;  2M8S A;  1YX6 B;  4HDQ A;  3EEC A;  2ZNV B;  1E90 A;  3APF A;  3HK0 A;  3VTW A;  1RFA A;  1RRB A;  2D11 A;  2DX5 B;  2DYO A;  3NHE B;  4W9H A;  1YD8 U;  3CMM B;  4IUM B;  3R3M A;  4HWI B;  1P3Q U;  1H8C A;  3NZS A;  2BWF A;  2N1V A;  3ML9 A;  2G45 B;  4MGZ E;  4E71 A;  3KW5 B;  2IO2 B;  2DYB A;  1NDD A;  1XD3 B;  3SU8 X;  2RD0 A;  4GDL A;  4LDT D;  5HKH A;  2ASQ A;  1UD7 A;  3L10 B;  3V60 A;  1GJZ A;  1KM7 A;  2Z59 B;  3HM6 X;  1V86 A;  4NPN A;  1J19 A;  2O2V B;  3HHM A;  3QIJ A;  2YVC A;  3KUC B;  5TR5 A;  2J0M A;  4EZK A;  2NBW B;  2LD9 A;  1SE9 A;  2JZZ A;  1WGH A;  3CST A;  3VUW A;  4GU2 A;  3ZW3 A;  2RSU A;  3B0A A;  2N9E B;  1WIA A;  2DZM A;  4W9D A;  1K8R B;  3IBE A;  3PHX B;  1E7V A;  3R7Q A;  3PZD A;  3RCZ A;  1I35 A;  2CHZ A;  2J0J A;  2LRW A;  4HPM B;  2KMA A;  3DQV A;  3RZF A;  3AXC A;  4J6I A;  3BIN A;  2WX1 A;  2LVQ A;  2KQ7 A;  4FHJ A;  4ZRJ A;  2N9P C;  4NAW A;  1V80 A;  4DHJ B;  2HJ8 A;  2LGX A;  4WWP A;  3VUY A;  1EF1 A;  1KLV A;  3KVF B;  3PRE A;  5CHF A;  3VH4 B;  2K8C A;  4JLC A;  2XK5 B;  2KXJ A;  3H9D A;  2M4N A;  3A4R A;  1E8Y A;  3TMP B;  2M0X A;  2NR2 A;  1WMH B;  4HCN B;  5JHB A;  4ZDV A;  2LRU A;  2JY6 A;  2ZVN A;  4PYZ A;  4EUT A;  1V6E A;  4HVB A;  4KV2 A;  3TJP A;  1AAR A;  1WZ0 A;  1YIW A;  4OVU A;  5BO4 B;  3PHW B;  2MSE D;  4II3 B;  4DHJ D;  4F1S A;  2K8B A;  2NVU I;  2KJ6 A;  2ZPY A;  3LJ3 A;  3CSF A;  2KKC A;  2D07 B;  2DEN B;  1L7Y A;  2ZCC A;  4EOY A;  4DK5 A;  3ONS A;  4BKS D;  1MG8 A;  3H7S A;  2CU1 A;  4K7W A;  2N1W A;  4JL9 A;  2L8J A;  2O2V A;  5C23 A;  3DBR I;  2R2Q A;  3OLM D;  2WDT B;  1GC7 A;  2NBV B;  3UGB B;  3PTF C;  3IG3 A;  2JVC A;  4NY0 A;  3IVF A;  4W9K A;  2NCN A;  3ZNI D;  4BVU C;  5AEK B;  4ICU A;  4EKU A;  2DAJ A;  3RD2 A;  2MBQ A;  3DVG Y;  3V62 A;  2CR5 A;  4DHZ E;  4KSL C;  3KYC D;  5DPS A;  2RR9 A;  2QHO A;  3IHP C;  3UF8 A;  2FNJ B;  4EZL A;  5D94 A;  2M1M A;  2W9N A;  1TTN A;  2BYV E;  4GGQ A;  2KC2 A;  3KYD D;  3PLU A;  2JXX A;  3KUD B;  4GDL B;  5CTR C;  3W1Y A;  4BFR A;  1G6J A;  2A4Z A;  2KNB A;  4LJO B;  2MBB B;  2JRH A;  2L3Z A;  4G11 A;  4NJ6 A;  5J17 A;  1LXD A;  4FN2 A;  1ISN A;  1SIF A;  2KJH B;  2V1Y A;  4G0N B;  4KZC A;  1WX7 A;  3DCG A;  3L54 A;  4NNJ B;  3R7R A;  4A20 A;  4WQO B;  4FAD A;  2ZCB A;  2FIF A;  1S1Q B;  5CX3 A;  5E6P A;  4ASW C;  5L83 A;  2OJR A;  3RYT A;  4MSM B;  2XK5 A;  1V2Y A;  2J0K A;  3M62 B;  2AYO B;  3QQ8 B;  2MCN B;  1C1Y B;  1H4R A;  2BKR B;  2KWC A;  4KSK C;  3A33 B;  3PRP B;  1WMH A;  2GBM A;  1IYF A;  2LVP A;  3UQA A;  3QAR A;  3DBS A;  2BYF A;  4FJV B;  5GMV A;  2NPT B;  5CHV C;  2CKH B;  2GBR A;  4WJN A;  2HTH A;  5JH5 C;  3WAM A;  1WJU A;  3UQB A;  4DXA B;  1ZKH A;  2JWZ A;  4MH0 E;  1WRD B;  1L2N A;  1KOT A;  4ANU A;  2GBN A;  2JRI B;  4OVV A;  4KIK B;  2ZEQ A;  4NJ7 A;  1WJ6 A;  2K6D B;  1WI0 A;  4MM3 A;  3VTV A;  1WY8 A;  2CHX A;  4IM0 A;  4M8M A;  3V6C B;  2L00 B;  4GMV A;  4JQW C;  2KAN A;  3KUZ A;  3PT2 B;  1WXV A;  3VDZ A;  2C7M B;  3V61 A;  2BGF A;  3HIZ A;  1CMX B;  4EZJ A;  1WXS A;  4WJO A;  1UBI A;  2MBE A;  3L13 A;  2MLB A;  2DZI A;  3UIO B;  2AWT A;  4N9F 4;  3NOB A;  4PS3 A;  1IPG A;  4HPL B;  3JSV A;  2L05 A;  3ZVV A;  1WGG A;  2KWV B;  3RZW C;  2N9X A;  1A5R A;  1WM3 A;  4MGK E;  1V5O A;  1Z5S B;  1ZGU B;  4ANX A;  3RUI B;  3TBL D;  1EF5 A;  2PE9 A;  1OQY A;  5J2R A;  4DDI D;  4MGY E;  3JVZ X;  4HCP B;  3V6E B;  4FA6 A;  2KZR A;  3EHV A;  2C5L C;  3NZU A;  2KTF A;  2KO3 A;  2AEH A;  3A4S C;  5CHW A;  3OAW A;  3OJ4 B;  2Y5B B;  1LM8 B;  4AOF A;  1UEL A;  5DPW A;  1V81 A;  2NPT A;  1WXA A;  1WR6 E;  3CF6 E;  5E6N A;  1BT0 A;  2KX0 A;  4BKG A;  5C1Z A;  1S3S G;  3SD5 A;  3M95 A;  5AZF A;  3PSE B;  1RLF A;  1I42 A;  3VXW A;  4II2 B;  3GZN I;  1X1M A;  2VRR B;  4KIK A;  3B1L X;  1R4N I;  2EMS A;  2IYD B;  2N7E A;  1HE8 A;  4G3X B;  3OJ3 A;  4MEM A;  5LLI A;  2B3A A;  2BPS A;  1E8X A;  3QJZ A;  1WJN A;  2M17 A;  4GB9 A;  1T0Y A;  4WWN A;  1E7U A;  3TIX A;  4G50 A;  2D2Q A;  2K8H A;  4IM3 A;  4EFO A;  2KDE B;  3B08 A;  3RT3 B;  3H7P B;  2C7N B;  4BBN F;  4W9G A;  1UGM A;  2FUH B;  5DCN A;  1WF9 A;  3X0W A;  1V49 A;  2RGF A;  4E74 A;  2C60 A;  5JZE B;  3ZTD A;  1UH6 A;  4E3C A;  1SGH A;  1WE7 A;  4HXD A;  4IWP A;  2REX A;  2L0T A;  4KZ0 A;  2KC1 A;  3K9O B;  2OOB B;  2K39 A;  1KJT A;  3P2B A;  1YX5 B;  4F7Z A;  1WGR A;  4GXB A;  3NS8 A;  1JRU A;  4AJY B;  3VTU A; 
#chains in the Genus database with same CATH topology
 4NAM A;  5IOI A;  5KHQ A;  1T6B X;  4AJW A;  3IAS 1;  2DAF A;  4GIV A;  3IAM 1;  4FJZ A;  1QOF A;  3VR8 B;  1PQS A;  2PEA A;  1WH3 A;  3DVG X;  3DPD A;  1IP9 A;  2KDB A;  4KGS A;  2LVO A;  2INC C;  2UU7 A;  3DBH B;  4LTU A;  4W9F A;  1HA5 A;  1L4D B;  4RFB A;  1WR1 A;  4WWO A;  4C56 C;  2I2Y A;  2LMC A;  1OTR B;  3H7P A;  5DPR A;  1UZX B;  1OGW A;  2Q5W D;  1P7E A;  2N4F A;  4CO7 A;  3HVZ A;  1VZ8 A;  1DGJ A;  2KT7 A;  5MPO A;  2ZNV C;  2HE7 A;  1FPY A;  2PPH A;  3ZIM A;  2LI5 A;  2LUE A;  1PYW D;  4IC7 B;  1QQR A;  3DWM A;  2WWZ A;  5FR3 A;  1AN8 A;  4ZYN A;  2KFK A;  5FKA C;  1ZXH A;  4NJC A;  3DBL B;  1N5X A;  1T0R C;  1L6U A;  3APD A;  1C3T A;  2DHZ A;  4DHZ B;  1GOZ A;  1TKY A;  2IND C;  4P1C C;  1YQ3 B;  4OZC A;  4IWO A;  5G5H A;  3LYY A;  4C7Z A;  2CU3 A;  2FE8 A;  1FFV A;  3Q6B A;  2L1A A;  3RUL A;  4RF0 A;  3Q14 C;  2MJE A;  1XEE A;  2V3S A;  5FK9 C;  3ZNH B;  3VQI A;  1EWC A;  3FC4 A;  2L7R A;  2RPQ A;  3ZNZ B;  3ZO5 B;  2BYE A;  4TQ1 A;  5AZH A;  1E8Z A;  4MJS B;  4HEA 1;  2D3G A;  3PGE A;  2IY0 B;  2KK8 A;  3FIL A;  3VRB B;  1ACC A;  4KGR A;  1SXT A;  4FJY A;  4DXG A;  3V3X A;  4NQL B;  1YMH E;  1TZ1 A;  5EDS A;  4ZOH C;  2WYQ A;  2WXR A;  4X57 B;  1K51 A;  1WZ3 A;  3ZYY X;  1P98 A;  4LNI A;  3ZQ4 A;  3X23 A;  3ZJU A;  3ZUN A;  2G4S A;  2KAJ A;  2EKE C;  4WJP A;  4YL8 A;  1D5Z C;  4DBG A;  2V4L A;  1FEH A;  3U52 E;  1F9J A;  1JAL A;  3PV1 A;  4WH4 A;  1N62 A;  1WX9 A;  1JWU D;  3ZKJ C;  3ECI A;  3DHI C;  2J4X A;  3QCA A;  1MJD A;  2KMM A;  2WXM A;  2K1F A;  3BYT B;  3PRZ A;  2CS4 A;  3MHS D;  1GAQ B;  3AUL A;  1QKZ A;  1NEN B;  3JW0 X;  1QOA A;  1FCC C;  2INP E;  3SHQ A;  3I3T B;  1UUP A;  3MTN B;  2VZK D;  4GDK A;  3ZXR A;  2IJ0 A;  3HM3 A;  3IT6 B;  3L0W B;  3RI7 C;  1VD2 A;  1KFY B;  2KDF B;  2CJN A;  1LQB A;  4KVG B;  1OQQ A;  2K25 A;  3IFW B;  3I63 C;  4LNO A;  2BBC A;  1L5P A;  3M63 B;  1AW7 A;  4NAW B;  1PUT A;  2Z0E B;  4TMA B;  3ZJT A;  3GE3 C;  4HDQ A;  3APF A;  3W5U B;  3TEX A;  1YD8 U;  4IUM B;  1SSN A;  4HWI B;  2NTT A;  4E71 A;  1XD3 B;  5EE3 A;  4GDL A;  1RFK A;  4LDT D;  4PK1 A;  3NVV A;  1UD7 A;  3BWU D;  3L10 B;  1GJZ A;  2CJO A;  1XF5 L;  1TS3 A;  1GB4 A;  2YVC A;  4EZK A;  1JWM D;  1WGH A;  3CST A;  3VUW A;  2RSU A;  3B0A A;  1K8R B;  3PHX B;  4AQ7 A;  3PZD A;  3C19 A;  1I35 A;  4HPM B;  2AX5 A;  1L0V B;  1TKG A;  2WX1 A;  4C4V A;  3URY A;  2KQ7 A;  3KLS X;  3NG0 A;  3N20 C;  4DHJ B;  2HJ8 A;  1I4R A;  1KLV A;  1B1Z A;  3VH4 B;  2XK5 B;  1FCL A;  5JHB A;  2JY6 A;  1CQV A;  1AAR A;  5IP4 D;  3I9V 1;  2GLS A;  2KJ6 A;  3CSF A;  4EOY A;  4DK5 A;  3ONS A;  3EFC A;  5BMG A;  1MG8 A;  2MH7 A;  3H7S A;  2ZW0 A;  1QT9 A;  3HUI A;  2WDT B;  2NBV B;  3UGB B;  4BVU C;  3IVF A;  4ICU A;  4ARC A;  2DAJ A;  2RR9 A;  3BII D;  4LNF A;  2FNJ B;  2KC2 A;  3KWL A;  2WXP A;  3KUD B;  3RNE C;  3W1Y A;  2A4Z A;  1C79 A;  1LXD A;  3U2S C;  2KJH B;  4G0N B;  4S0R A;  3L54 A;  4FAD A;  2OJR A;  1PFD A;  1SE3 A;  2MCN B;  1IGC A;  2WXI A;  2QIL A;  3A33 B;  1WMH A;  1KLG D;  4IKG A;  5CHV C;  2LEK A;  1T0S C;  3UQB A;  3WAM A;  1VDV A;  2IGH A;  1FRD A;  2GBN A;  4KIK B;  4NJ7 A;  4YSX B;  1SIJ A;  1XLO A;  2K6D B;  3VTV A;  2J53 A;  1ET6 A;  1VR9 A;  4IM0 A;  3V6C B;  2XN9 C;  1NI3 A;  3HIZ A;  1TS4 A;  2DZI A;  3UIO B;  2WDV B;  4KGT A;  3ZVV A;  1D4B A;  2W55 A;  2KWV B;  4JE3 B;  1FXI A;  1A5R A;  1ZGU B;  2QMT A;  3RUI B;  3TBL D;  1EF5 A;  2PE9 A;  1K52 A;  3V6E B;  3MC9 A;  3OAW A;  5HG2 A;  1CZP A;  2BYT A;  1UEL A;  1WXA A;  5C1Z A;  4YTM B;  3NVW A;  4DQO C;  3SD5 A;  3M95 A;  1I42 A;  3W5V B;  1PGX A;  2D5G A;  4P1B C;  5C3J B;  1HQR D;  4LNK A;  3RNC C;  3AED B;  3UI3 A;  5IO9 A;  4HKQ A;  3Q3M C;  2BPS A;  2YEP B;  3QJZ A;  2M17 A;  4WWN A;  3TIX A;  1E7U A;  2D2Q A;  2G9H D;  4IM3 A;  3RT3 B;  4XGA B;  1TKE A;  3NRZ A;  1R4N B;  1V49 A;  2EEL A;  1SE4 A;  2C60 A;  4E74 A;  3ZTD A;  3OWE B;  1WE7 A;  4HXD A;  2LGI A;  2REX A;  2L0T A;  2WXO A;  2DNF A;  2K39 A;  1KJT A;  1YX5 B;  1WGR A;  1JCK B;  4HJG E;  2QDF A;  3VTU A;  3C0R B;  1RAX A;  2WXN A;  3L4P A;  4FLH A;  1CJE A;  2AQ3 B;  4USA A;  4ZHP A;  3N32 A;  4W9L A;  1QZE A;  4W9E A;  1WX8 A;  4KDL B;  1HTQ A;  2R61 A;  2ZVO A;  5IA7 A;  5AZG A;  3QHT A;  4P16 A;  1TGZ B;  3A9K B;  4WQM A;  3ZRC A;  4I6N B;  4M0W B;  5IKC M;  2AL3 A;  3N1X C;  4US9 A;  2KHW B;  2MW5 A;  3N9Y C;  4URK A;  5FR6 A;  1J7C A;  2D3A A;  3L17 A;  2KTR A;  3LB8 C;  1QOG A;  1QF6 A;  3D32 A;  1F1H A;  2QCZ A;  3ALB A;  3B2G A;  4TKN A;  3M3J A;  1UBQ A;  3R66 C;  2DWQ A;  4IWQ A;  1WFY A;  3VHT C;  3WIM A;  4FBJ B;  4BOS C;  1LGR A;  3LXF A;  3O65 B;  2JF5 A;  4JIO U;  4BOZ B;  1NI2 A;  3U30 A;  2MBH A;  2IY1 B;  3ZDM C;  4MGI E;  1VLB A;  2O6V A;  2LJ5 A;  4IG7 B;  3DDC B;  2KLC A;  2JT4 B;  3AH7 A;  1IGD A;  4RCO A;  2FCS A;  1QOB A;  1J0G A;  1ZW7 A;  2BB6 A;  3JYU A;  4OHJ A;  2WP9 B;  1ZDV A;  3T8M A;  2EMT A;  1P9D U;  4HRS A;  1NBF C;  1WWT A;  2ON8 A;  1YQ4 B;  2KVR A;  2KN5 A;  3A9J A;  2G4D B;  1FNW A;  2KOX A;  2IBI B;  5D3I B;  3A1Q A;  2FCM A;  2MA9 B;  2JPH A;  1VJK A;  2N9L A;  1OFF A;  1Y8R C;  1R4M B;  2C9W B;  1HXY D;  1J7A A;  2KMC A;  1RYJ A;  2LAS A;  2LWP A;  4BKT A;  3MJ5 A;  5IAA C;  4XYC A;  5H92 C;  1DOY A;  4RM8 A;  4A3P A;  3WA0 A;  5LXH A;  4A9A A;  1P1A A;  4XWW A;  3BK2 A;  2MBO A;  1GUA B;  4RGN A;  2W82 A;  3ENE A;  1GC6 A;  1I4Q A;  2LXC A;  1TBE A;  4HJK A;  3NUH B;  2GMI C;  3AEG B;  2XNA C;  3VUX A;  3Q3F A;  3RNA C;  3VH3 B;  4KDI C;  1YQB A;  1YJ1 A;  1U4A A;  1M4V A;  2E6X A;  2BWE S;  2L76 A;  1WGK A;  4MDK E;  3W1S A;  1SJE D;  1CK1 A;  1GNU A;  2MP2 A;  3WAO A;  2I1J A;  3MFG A;  4IM2 A;  2FAZ A;  2O6V D;  4ZRP A;  3AEA B;  1WYG A;  3I57 A;  2DBY A;  5JXV A;  4IOI E;  1MG4 A;  1UWX A;  2KWU B;  4CYE A;  4FA6 A;  2D10 A;  3P4Q B;  1HZ6 A;  4RNA A;  1J8C A;  2Z0D B;  4A6Q A;  2HD5 B;  3AE3 B;  1BUI C;  1JWB D;  4AWJ A;  3UIN B;  2KVZ A;  4C7Y A;  4JWS C;  1T5X D;  2IGD A;  3WAL A;  1YX6 B;  1TYG B;  3RNB C;  1E90 A;  3HK0 A;  1RRB A;  1YNT E;  4W9H A;  2SEB D;  1N63 A;  4MAC A;  2V0G A;  1P3Q U;  3RNF C;  1JWA D;  2G45 B;  1NDD A;  3J9C A;  5HKH A;  2JWU A;  1KM7 A;  2Z59 B;  2RDB C;  1OQR A;  2O2V B;  5TR5 A;  4C00 A;  3Q8E A;  3ZW3 A;  1WIA A;  2DZM A;  4W9D A;  3IBE A;  3I5J C;  1J7B A;  2LRW A;  3DQV A;  3RZF A;  3AE7 B;  1FIQ A;  4FHJ A;  2N9P C;  1EF1 A;  2WQY B;  4A55 A;  2K8C A;  4JLC A;  1E8Y A;  2K9X A;  1JW9 D;  4HCN B;  3EA6 A;  2ZVN A;  4PYZ A;  1QIL A;  1V6E A;  3U7Z A;  1XLP A;  4KV2 A;  3TJP A;  1SB3 C;  1WZ0 A;  5BO4 B;  2LGS A;  4DHJ D;  2WU2 B;  5BYQ A;  4YT0 B;  3TEW A;  2DEN B;  2BB5 A;  3BZD B;  4MM3 B;  2FUG 1;  2CU1 A;  2N1W A;  2L8J A;  3DBR I;  3SR6 A;  3NJT A;  1F52 A;  2HJ1 A;  3IG3 A;  4W9K A;  3W9C B;  2MBQ A;  2HDE A;  2CR5 A;  4FXC A;  3KYC D;  5DPS A;  2QHO A;  3IHP C;  4EZL A;  5D94 A;  2M1M A;  2W9N A;  2BYV E;  3KYD D;  2X8X X;  4KX6 B;  2MBB B;  4NJ6 A;  3B2F A;  4FN2 A;  1SIF A;  5G55 A;  4F8C B;  1WX7 A;  4TSS A;  1L4Z B;  5L83 A;  5E6P A;  4MSM B;  2AYO B;  1H4R A;  2LVP A;  3UQA A;  4FJV B;  3DBS A;  3QAR A;  2NPT B;  4WJN A;  1E6E B;  2HTH A;  2Y3A A;  2ONQ A;  1WJU A;  5JH5 C;  1ZP0 B;  1ZKH A;  2JWZ A;  3DWG C;  1L2N A;  4OVV A;  2ZEQ A;  1WI0 A;  1NYQ A;  1TY2 A;  3WCQ A;  2NTS A;  1XCT L;  4GMV A;  4JQW C;  1DYQ A;  3PT2 B;  1A70 A;  1N61 A;  2C7M B;  3V61 A;  2MJ3 A;  2BGF A;  1WXS A;  3B9J A;  2MBE A;  5E6J A;  1P7F A;  1SJH D;  1RM6 C;  3AN1 A;  2RDG A;  1SE2 A;  4O1N A;  1V1P A;  1WM3 A;  3Q8F A;  2M56 B;  1OQY A;  4MGY E;  2RPV A;  5TSS A;  1TJE A;  3EHV A;  3AEE B;  4M0W A;  4Q2J A;  5DPW A;  5AUI A;  1WR6 E;  5E6N A;  1BT0 A;  3RNG C;  2KX0 A;  1F2R C;  1RLF A;  3VXW A;  4II2 B;  3GZN I;  2VRR B;  2PLP A;  2EMS A;  1HE8 A;  4G3X B;  3GB1 A;  4MEM A;  4S17 A;  5LLI A;  1C4P A;  1I7H A;  1T0Y A;  2K8H A;  3P4P B;  2W3S A;  3H7P B;  2FUH B;  5DCN A;  1WF9 A;  2WXK A;  2W54 A;  4N6E B;  5JZE B;  1UH6 A;  2HTM E;  4IWP A;  4DXF A;  4IDI A;  3ZJV A;  4F7Z A;  4GXB A;  2WXL A;  3ZTC A;  4ZHO A;  2L0F A;  1EWY C;  2DYM A;  2LJI A;  1C78 A;  2PVO D;  1IBX A;  3GP7 A;  5HFY A;  3Q8C A;  5EE0 A;  4YTN B;  2R2O A;  2KLG A;  2KFK B;  2QIE B;  1KRH A;  3W2D A;  3AE2 B;  4M01 A;  3ZLZ A;  4OVZ A;  2KJR A;  3PPA A;  4FUL A;  4PS8 A;  2BS4 B;  4TV3 A;  1Y56 A;  1YN3 A;  2FCQ A;  1ROE A;  3DHH C;  2YEP F;  1ZXI A;  4BBN C;  2AQ1 B;  3PVL A;  2KD0 A;  2AL6 A;  2IO0 B;  4ICV A;  1EO6 A;  2WXF A;  3N3K B;  3H1U A;  5BMH A;  3QA8 A;  3L16 A;  2V9H A;  5G2N A;  3N30 A;  4EEW A;  3ML8 A;  3QAQ A;  2INN E;  1JML A;  3K9P B;  5AUK A;  1DOI A;  3AEF B;  4R3D A;  3P63 A;  4LDT B;  4B6W A;  2JUO A;  3U4E G;  4PS7 A;  1JQ4 A;  4PYU A;  3ZGZ A;  1EM7 A;  3IT4 B;  2XEW A;  2FID A;  4ZRK A;  1E10 A;  2LGY A;  1C4A A;  5JHA A;  1FXT B;  4XX5 A;  1RWS A;  1PDX A;  3W1S C;  2TSS A;  2CHW A;  3AMZ A;  3EC8 A;  3ZDT A;  2ZJD A;  2EKI A;  4N59 A;  3SEB A;  1XLN A;  2J7Q B;  1XQQ A;  1YOV B;  5E6O A;  4W9C A;  3AE6 B;  1OEY A;  4XWT A;  4XDD A;  1F2R I;  1WGD A;  3Q2A C;  2L83 A;  4JPS A;  2XBB C;  2MWS B;  4AP4 C;  3C8Y A;  3Q3J A;  2D3C A;  4GLS C;  4W9J A;  1Q1O A;  2GBJ A;  2IO3 B;  1ZDX A;  4TUU A;  1XT9 B;  1E5W A;  2KFJ A;  3TUO A;  4GDK B;  4RMA A;  4B9K A;  4DDG D;  3Q8B A;  3WAP A;  3BK1 A;  3N1Z C;  4ZRI A;  3DOW A;  2NBU A;  4A3O A;  1N6Z A;  4M02 A;  1P0R A;  1WJ4 A;  4MEL A;  3MJW A;  4YSY B;  3GOE A;  1E8W A;  4JGH B;  4WAA A;  4B0M A;  3AEB B;  2JZ3 B;  1FRR A;  1V5T A;  2KDI A;  3AB5 A;  2JQR B;  4DWF A;  5J18 A;  4WAF A;  5HHD G;  4C80 A;  2BVC A;  3AV8 A;  1F0Z A;  2QSD A;  4W9I A;  1WE6 A;  4YXD B;  2ZW1 A;  3AU4 A;  4ACF A;  4LJP B;  3LDZ E;  2PVG C;  3DVN V;  3EFU A;  3L08 A;  4MJS A;  4XZ4 A;  4ANV A;  3APC A;  3TL5 A;  1TS5 A;  3NS1 A;  5L95 C;  2LUM A;  2MEK A;  2RDH A;  1TY0 A;  2A5U A;  3U8Z A;  1E7P B;  4BKS A;  2MHJ A;  1MFW A;  3QWZ B;  4N58 A;  4XC2 A;  5IN7 A;  2D3B A;  2N7J A;  1KH0 A;  1NYR A;  4HLE A;  4TQ0 A;  4IW0 A;  4C4V B;  4RH6 A;  2ZZP B;  1SBB B;  4P6V F;  3EEC A;  2ZNV B;  1RFA A;  3V05 A;  2DX5 B;  3NHE B;  2SAK A;  3IXS A;  1V97 A;  1FNV A;  1UNS A;  2BWF A;  2N1V A;  3ML9 A;  4ARI A;  3T3O A;  3KW5 B;  2IO2 B;  3NZ3 A;  3BVM A;  2RD0 A;  2X38 A;  1E9M A;  4L1B A;  2ASQ A;  3V60 A;  2PKO A;  3HM6 X;  1V86 A;  3KUC B;  2NBW B;  3P4R B;  3PO0 A;  2N9E B;  3RCZ A;  2CHZ A;  2J0J A;  4XE0 A;  1IUE A;  3P4S B;  3RFZ B;  1L6V A;  3AE9 B;  3BIN A;  4NAW A;  2WGS A;  4AS1 A;  2Y5C A;  3RN9 C;  1MHH E;  3PRE A;  3TMP B;  2JYT A;  2BQQ A;  2M0X A;  2V4I B;  1WMH B;  2PMV A;  3MC0 B;  2LRU A;  3BVZ A;  2DLB A;  4EUT A;  1MI0 A;  2H88 B;  2J52 A;  1YIW A;  4BAX A;  3PHW B;  2MSE D;  4II3 B;  4F1S A;  2NVU I;  3LJ3 A;  2KKC A;  2D07 B;  2ZCC A;  2L32 A;  4BKS D;  1V1O A;  4NZL B;  4YTP B;  4K7W A;  5C23 A;  4HRO A;  5D3D A;  3OLM D;  3VRA B;  1GC7 A;  5AEK B;  4NY0 A;  3ZNI D;  2NCN A;  3DHG C;  1DOX A;  4K3B A;  2GRI A;  4EKU A;  1ENF A;  3RD2 A;  3DVG Y;  3UF8 A;  2FBW B;  3PLU A;  2QJL A;  2JXX A;  5CTR C;  3H8H A;  4LJO B;  2JRH A;  2L3Z A;  4YWG G;  1ISN A;  3ABV B;  4A20 A;  2FIF A;  1S1Q B;  4ASW C;  3RYT A;  4A90 A;  2XK5 A;  3QQ8 B;  3Q3N C;  1C1Y B;  2BKR B;  2KDM A;  2KWC A;  4KSK C;  1IYF A;  5H8Y E;  2BTE A;  4H2A A;  1MHX A;  1K53 A;  3AE4 B;  4MH0 E;  4B0E A;  4ANU A;  2JRI B;  3MHZ A;  1WJ6 A;  1WY8 A;  3MC8 A;  3AM9 A;  3KUZ A;  1WRI A;  1WXV A;  2KN4 A;  2LHE A;  4EZJ A;  4WJO A;  3L13 A;  2MLB A;  5BYS A;  2AWT A;  4KKJ A;  4N9F 4;  1HEZ E;  3NOB A;  2ACZ B;  4PS3 A;  1N60 A;  3NVY A;  4HPL B;  2L05 A;  1WGG A;  2N9X A;  2KAC A;  2LHD A;  1XLQ A;  1Z5S B;  4ANX A;  5J2R A;  2Z8L A;  4HCP B;  4HKZ E;  2C5L C;  3NZU A;  2KO3 A;  3A4S C;  4KKI A;  3OJ4 B;  1FXA A;  1LM8 B;  4AOF A;  1YJI A;  1V81 A;  3R2T A;  2OJW A;  3CF6 E;  4L23 A;  4RGT A;  5AZF A;  3GS2 A;  4LK0 M;  2JYE A;  5G5G A;  4KIK A;  4K3C A;  1R4N I;  2IYD B;  3Q3O C;  1AYF A;  1E8X A;  4G50 A;  2BS2 B;  4EFO A;  3AE8 B;  2KDE B;  4BBN F;  2C7N B;  3RMK C;  1UGM A;  2KYW A;  2RGF A;  1GPX A;  4E3C A;  1SGH A;  2K5P A;  1JRU A;  4AJY B;  4ZRQ A;  2K3U A;  3ZRF A;  2ICI A;  3CWI A;  1PGB A;  1N5W A;  2KTR B;  2YLM A;  3VVW B;  1V9J A;  2GI9 A;  1EUV B;  2E3T A;  2N9K A;  2K6Q A;  5DPT A;  5I4D A;  2WLB A;  2PTL A;  1K50 A;  1D3Z A;  4GOC A;  2OED A;  3AI5 A;  1JRP A;  2PE6 B;  5EE9 A;  1FMA D;  4M8N A;  3JSV B;  2JSV X;  4I6P A;  1R7S A;  3SFE B;  1FO4 A;  4RGM A;  2WDQ B;  3VFK A;  3T9L A;  1ET9 A;  4RM9 A;  1FNU A;  1Q0W B;  2WHI A;  1VZ6 A;  4NQK E;  5D7G A;  3BY4 B;  2O6V B;  3P1M A;  3VAW A;  4D2K A;  3U7D A;  4REZ A;  3CIR B;  4BZA A;  2W3R A;  4LCD E;  1L0Y B;  2BKF A;  3SDL C;  2BS3 B;  1LFD A;  4K81 A;  2PJH A;  4PT5 A;  2NMQ A;  3ZNG C;  4ZYS A;  2N7D A;  2WU5 B;  4GSW A;  1KF6 B;  2KWD A;  1GG3 A;  3T3N A;  1WGY A;  4MSQ B;  1I4G A;  2IZV B;  4L2Y A;  2JXT A;  3FAH A;  1EU3 A;  1BML C;  2WXQ A;  2V3P A;  3KH0 A;  4HK2 A;  3R8B A;  3A9J B;  3UIP B;  4B95 A;  2WXH A;  3A1Q B;  4K1R B;  2UYZ B;  4EE2 A;  2I1K A;  1TT5 B;  1YN4 A;  2MRP A;  4J3O D;  3A9K A;  4K7S A;  1WYW B;  2WXG A;  3TSS A;  4A8X C;  2M19 A;  2G1E A;  3TEZ A;  2J42 A;  3HVD A;  4HDO A;  5BYR A;  2LGD A;  2G3Q B;  3S2A A;  1WM2 A;  2LXA A;  4P7I A;  3PRM B;  3PS6 A;  1I4H A;  2N0S B;  1Q5W B;  3PLV A;  3TCA A;  2OHF A;  1KTK A;  3OG5 A;  4FHK A;  4AUQ C;  4QAY A;  4CQN A;  1WXQ A;  2KQS A;  2KQ4 X;  2VH2 A;  5GXG B;  3BVG A;  1BXT A;  1B9R A;  1R4M I;  1YN5 A;  2IDY A;  3TEY A;  1C4C A;  4ANW A;  2JU6 X;  2MP2 B;  1VRA B;  4OW0 A;  1F77 A;  2C7H A;  3PZ7 A;  3Q69 A;  1M94 A;  3DBH I;  3KQ4 A;  1NEK B;  2WNM A;  1STE A;  5BMI A;  2WX0 A;  2GOW A;  2BF8 B;  2FCN A;  2IO1 B;  1JWS D;  2LFI A;  3QC8 B;  1Z2M A;  4I6L B;  5LXI B;  2MX2 A;  4OZA A;  3QX1 A;  1OEY J;  4JX1 C;  2JX5 A;  5D2M B;  2VZK B;  5HI1 A;  1AWD A;  3P42 A;  2KX3 A;  2UWQ A;  4UDU C;  4WJQ A;  4MH8 A;  1T3Q A;  3EGR A;  4GN1 A;  2DZJ A;  3NY5 A;  2BW2 A;  1YJJ A;  1E0Z A;  3BYY B;  1JRO A;  3QK0 A;  4K7U A;  3AU5 A;  2NS5 A;  2L52 A;  3H6N A;  2GBK A;  2ZPN A;  3EUB 2;  2BT6 A;  3DVN U;  1MPE A;  4CHK A;  4XDC A;  2LZ6 A;  5KHO A;  1VCB A;  2MQJ A;  1I4X A;  1XXG A;  3DBL I;  2DZK A;  5D6J B;  5T8I A;  1T0Q C;  1WXM A;  1TS2 A;  1UF0 A;  2M8S A;  3FIL B;  3VTW A;  3E56 A;  2D11 A;  2DYO A;  2WDR B;  3CMM B;  3R3M A;  1SF0 A;  3HRD D;  1ZE3 D;  3NZS A;  1H8C A;  1D6E C;  1LO5 D;  4MGZ E;  3O13 A;  2DYB A;  3MP9 A;  3SU8 X;  2VH1 A;  3R2I A;  4OZB A;  4JWU C;  1D5X C;  4NPN A;  4YSZ B;  1J19 A;  4HPP A;  3HHM A;  3QIJ A;  1PGA A;  2J0M A;  1TZO A;  2LD9 A;  1SE9 A;  2JZZ A;  4GU2 A;  1E7V A;  3R7Q A;  5C2T B;  4RGO S;  1GB1 A;  2KMA A;  3AXC A;  3E9S A;  2WXJ A;  4J6I A;  2LVQ A;  1MVK A;  4ZRJ A;  1V80 A;  4WWP A;  2LGX A;  3VUY A;  3KVF B;  2K22 A;  5CHF A;  2RMM A;  4ITK A;  2KXJ A;  3H9D A;  2IGG A;  2M4N A;  3A4R A;  1ZPS A;  1C77 A;  2NR2 A;  4ZDV A;  1C9F A;  4MT5 A;  5EE1 A;  4HVB A;  1EU4 A;  1UGJ A;  2PIA A;  2PW9 A;  4OVU A;  1UWM A;  1HTO A;  1FM0 D;  2K8B A;  2ZPY A;  1L7Y A;  1FD6 A;  5LNK 1;  2GB1 A;  4JL9 A;  2O2V A;  1HZ5 A;  2K0P A;  2R2Q A;  2Y5P A;  4LNN A;  4WWM A;  3PTF C;  2JVC A;  3V62 A;  4DHZ E;  4KSL C;  3AE5 B;  3DBR B;  1SEB D;  4GGQ A;  1TTN A;  1Q10 A;  1C76 A;  4RF1 A;  4GDL B;  3ZXV A;  4BFR A;  1G6J A;  2KNB A;  4G11 A;  1V1P B;  5J17 A;  4NNJ B;  2V1Y A;  3WAN A;  3PZ8 A;  4KZC A;  3R7R A;  3DCG A;  4WQO B;  2JZP A;  2ZCB A;  5CX3 A;  1V2Y A;  1KLU D;  2J0K A;  3M62 B;  3RPF C;  3PRP B;  3KWV A;  3AE1 B;  2GBM A;  2QEJ C;  2MJD A;  1ZOY B;  2BYF A;  3N1Y C;  5GMV A;  3Q8A A;  1XO3 A;  3ETR A;  2CKH B;  2GBR A;  4DXA B;  1WRD B;  1KOT A;  2QC8 A;  4MM3 A;  2CHX A;  4M8M A;  2V3N A;  2L00 B;  1ESF A;  1VZ7 A;  2AQ2 B;  2KAN A;  1ZUD 2;  3VDZ A;  1V8C A;  1CMX B;  1UBI A;  4WUR A;  2IPK D;  4WIP A;  1IPG A;  3JSV A;  3RZW C;  4MGK E;  1V5O A;  4US8 A;  1NVI D;  3NVZ A;  4DDI D;  3JVZ X;  2KZR A;  2KTF A;  2AEH A;  1TIF A;  5CHW A;  1WSP A;  2Y5B B;  1FFU A;  3VR9 B;  1IBX B;  3FKY A;  2NPT A;  3GE8 C;  3AEC B;  4BKG A;  1S3S G;  2H89 B;  3PSE B;  1I4P A;  3SFD B;  1X1M A;  3B1L X;  2N7E A;  1L0X B;  3OJ3 A;  2B3A A;  1WJN A;  4GB9 A;  1D5M C;  1QLB B;  3B08 A;  2B76 B;  3GZN B;  2I38 A;  4W9G A;  3X0W A;  4LLG M;  2WS3 B;  4KZ0 A;  4M00 A;  2KC1 A;  3K9O B;  2OOB B;  1XCQ L;  3P2B A;  3NS8 A;  2M0A A; 
#chains in the Genus database with same CATH homology
 3ZRF A;  3ZTC A;  5KHQ A;  2L0F A;  4AJW A;  2KTR B;  3C0R B;  1RAX A;  2YLM A;  1V9J A;  3VVW B;  1EUV B;  2DYM A;  2K6Q A;  2DAF A;  4FLH A;  5DPT A;  4GIV A;  4FJZ A;  1D3Z A;  1PQS A;  2PEA A;  4GOC A;  1WH3 A;  3AI5 A;  3DVG X;  2PE6 B;  3DPD A;  1IP9 A;  2R2O A;  4M8N A;  2KLG A;  2KDB A;  3JSV B;  4I6P A;  2LVO A;  2KFK B;  3N32 A;  4W9L A;  4W9F A;  1QZE A;  1WR1 A;  4WWO A;  4W9E A;  3ZLZ A;  1WX8 A;  4KDL B;  2KJR A;  2ZVO A;  3VFK A;  5IA7 A;  3PPA A;  3T9L A;  4FUL A;  4PS8 A;  5AZG A;  4RM9 A;  4TV3 A;  3QHT A;  1Q0W B;  1TGZ B;  2FCQ A;  3A9K B;  4NQK E;  1OTR B;  3H7P A;  5DPR A;  3ZRC A;  5D7G A;  4I6N B;  3BY4 B;  2O6V B;  1UZX B;  4M0W B;  3VAW A;  1OGW A;  3U7D A;  2AL3 A;  4BBN C;  2N4F A;  3PVL A;  4LCD E;  4CO7 A;  2KD0 A;  2AL6 A;  2BKF A;  3SDL C;  2KHW B;  1LFD A;  4K81 A;  2MW5 A;  2PJH A;  4URK A;  2IO0 B;  2ZNV C;  3ZNG C;  2N7D A;  4GSW A;  4ICV A;  5FR6 A;  1EO6 A;  2HE7 A;  1GG3 A;  3N3K B;  3H1U A;  1WGY A;  3L17 A;  2KTR A;  3QA8 A;  2PPH A;  3L16 A;  3ZIM A;  5G2N A;  2LI5 A;  2LUE A;  4MSQ B;  3D32 A;  3N30 A;  2IZV B;  4EEW A;  4F8C B;  3ALB A;  4TKN A;  3M3J A;  4IC7 B;  1UBQ A;  3ML8 A;  3KH0 A;  3R66 C;  4HK2 A;  2WWZ A;  3QAQ A;  3A9J B;  4IWQ A;  3UIP B;  1WFY A;  3K9P B;  3VHT C;  4ZYN A;  3WIM A;  2KFK A;  4B95 A;  4FBJ B;  4BOS C;  4LDT B;  4B6W A;  2JUO A;  3A1Q B;  3O65 B;  4PS7 A;  4PYU A;  2JF5 A;  4JIO U;  4K1R B;  4BOZ B;  2UYZ B;  3APD A;  2I1K A;  2XEW A;  1C3T A;  1NI2 A;  2DHZ A;  2MRP A;  3U30 A;  2FID A;  4DHZ B;  4ZRK A;  2MBH A;  2IY1 B;  2LGY A;  5JHA A;  3A9K A;  1FXT B;  4K7S A;  3ZDM C;  4MGI E;  2O6V A;  1WYW B;  4XX5 A;  4IWO A;  2LJ5 A;  4IG7 B;  3DDC B;  2KLC A;  2JT4 B;  3W1S C;  2CHW A;  4HDO A;  3RUL A;  3EC8 A;  3ZDT A;  2ZJD A;  2LGD A;  2FCS A;  2J7Q B;  2G3Q B;  1XQQ A;  1ZW7 A;  1J0G A;  3S2A A;  1WM2 A;  2LXA A;  4P7I A;  3JYU A;  3PRM B;  5E6O A;  4W9C A;  3T8M A;  2V3S A;  1OEY A;  3ZNH B;  3PS6 A;  2EMT A;  1Q5W B;  3PLV A;  1WGD A;  3TCA A;  1P9D U;  3VQI A;  1NBF C;  2XBB C;  2MWS B;  4AP4 C;  2L7R A;  4FHK A;  2RPQ A;  4AUQ C;  3ZNZ B;  5G55 A;  3ZO5 B;  2BYE A;  2KVR A;  2KQS A;  4TQ1 A;  5AZH A;  1E8Z A;  3Q3J A;  4MJS B;  2KN5 A;  4W9J A;  1Q1O A;  2D3G A;  3A9J A;  2G4D B;  3PGE A;  2GBJ A;  2IO3 B;  1R4M I;  2IY0 B;  1XT9 B;  2IBI B;  2KOX A;  4TUU A;  1E5W A;  2KFJ A;  2KK8 A;  4ANW A;  4GDK B;  2MP2 B;  4RMA A;  3A1Q A;  2FCM A;  2MA9 B;  4B9K A;  2JPH A;  4DDG D;  3WAP A;  4ZRI A;  4FJY A;  2C7H A;  3DOW A;  2NBU A;  4NQL B;  1Y8R C;  4A3O A;  1M94 A;  3DBH I;  1P0R A;  1TZ1 A;  1WJ4 A;  5EDS A;  2WYQ A;  4X57 B;  2C9W B;  1WZ3 A;  4MEL A;  3MJW A;  3GOE A;  2KMC A;  2WX0 A;  1E8W A;  2GOW A;  4JGH B;  2BF8 B;  2LAS A;  2FCN A;  1P98 A;  2LWP A;  2IO1 B;  4WAA A;  3QC8 B;  4BKT A;  3X23 A;  3ZUN A;  2G4S A;  2JZ3 B;  5IAA C;  2EKE C;  4WJP A;  1V5T A;  1Z2M A;  4RM8 A;  2KDI A;  4I6L B;  4YL8 A;  3WA0 A;  4A3P A;  4DBG A;  2V4L A;  5LXH A;  5LXI B;  2MX2 A;  1P1A A;  3QX1 A;  1OEY J;  1F9J A;  3PV1 A;  4DWF A;  2MBO A;  5J18 A;  1GUA B;  1WX9 A;  3ZKJ C;  3ENE A;  1GC6 A;  3ECI A;  2LXC A;  5D2M B;  4W9I A;  1TBE A;  1WE6 A;  3QCA A;  4HJK A;  2KX3 A;  3AU4 A;  2UWQ A;  2GMI C;  4LJP B;  2K1F A;  4WJQ A;  3VUX A;  3LDZ E;  3Q3F A;  3DVN V;  3EFU A;  4GN1 A;  4KDI C;  3VH3 B;  2DZJ A;  3L08 A;  3PRZ A;  1YQB A;  2CS4 A;  3NY5 A;  1YJ1 A;  1U4A A;  3MHS D;  4MJS A;  4XZ4 A;  4ANV A;  3AUL A;  2BWE S;  2L76 A;  4MDK E;  3W1S A;  3JW0 X;  3APC A;  3TL5 A;  3QK0 A;  3SHQ A;  4K7U A;  5L95 C;  3I3T B;  1GNU A;  3AU5 A;  3MTN B;  2MP2 A;  2NS5 A;  4GDK A;  3WAO A;  3H6N A;  3HM3 A;  2A5U A;  3U8Z A;  4BKS A;  2I1J A;  2GBK A;  3QWZ B;  2ZPN A;  4IM2 A;  2FAZ A;  2O6V D;  3L0W B;  4XC2 A;  3DVN U;  1VD2 A;  4CHK A;  2KDF B;  1LQB A;  2KWU B;  3WAN A;  2LZ6 A;  4CYE A;  2D10 A;  1VCB A;  2K25 A;  2MQJ A;  3IFW B;  4KVG B;  5KHO A;  4HLE A;  3DBL I;  1J8C A;  2DZK A;  2Z0D B;  5D6J B;  4TQ0 A;  4IW0 A;  2HD5 B;  4AWJ A;  3M63 B;  4NAW B;  3UIN B;  1WXM A;  2Z0E B;  2ZZP B;  3WAL A;  2M8S A;  1YX6 B;  4HDQ A;  3EEC A;  2ZNV B;  1E90 A;  3APF A;  3HK0 A;  3VTW A;  1RFA A;  1RRB A;  2D11 A;  2DX5 B;  2DYO A;  3NHE B;  4W9H A;  1YD8 U;  3CMM B;  4IUM B;  3R3M A;  4HWI B;  1P3Q U;  1H8C A;  3NZS A;  2BWF A;  2N1V A;  3ML9 A;  2G45 B;  4MGZ E;  4E71 A;  3KW5 B;  2IO2 B;  2DYB A;  1NDD A;  1XD3 B;  3SU8 X;  2RD0 A;  4GDL A;  4LDT D;  5HKH A;  2ASQ A;  1UD7 A;  3L10 B;  3V60 A;  1GJZ A;  1KM7 A;  2Z59 B;  3HM6 X;  1V86 A;  4NPN A;  1J19 A;  2O2V B;  3HHM A;  3QIJ A;  2YVC A;  3KUC B;  5TR5 A;  2J0M A;  4EZK A;  2NBW B;  2LD9 A;  1SE9 A;  2JZZ A;  1WGH A;  3CST A;  3VUW A;  4GU2 A;  3ZW3 A;  2RSU A;  3B0A A;  2N9E B;  1WIA A;  2DZM A;  4W9D A;  1K8R B;  3IBE A;  3PHX B;  1E7V A;  3R7Q A;  3PZD A;  3RCZ A;  1I35 A;  2CHZ A;  2J0J A;  2LRW A;  4HPM B;  2KMA A;  3DQV A;  3RZF A;  3AXC A;  4J6I A;  3BIN A;  2WX1 A;  2LVQ A;  2KQ7 A;  4FHJ A;  4ZRJ A;  2N9P C;  4NAW A;  1V80 A;  4DHJ B;  2HJ8 A;  2LGX A;  4WWP A;  3VUY A;  1EF1 A;  1KLV A;  3KVF B;  3PRE A;  5CHF A;  3VH4 B;  2K8C A;  4JLC A;  2XK5 B;  2KXJ A;  3H9D A;  2M4N A;  3A4R A;  1E8Y A;  3TMP B;  2M0X A;  2NR2 A;  1WMH B;  4HCN B;  5JHB A;  4ZDV A;  2LRU A;  2JY6 A;  2ZVN A;  4PYZ A;  4EUT A;  1V6E A;  4HVB A;  4KV2 A;  3TJP A;  1AAR A;  1WZ0 A;  1YIW A;  4OVU A;  5BO4 B;  3PHW B;  2MSE D;  4II3 B;  4DHJ D;  4F1S A;  2K8B A;  2NVU I;  2KJ6 A;  2ZPY A;  3LJ3 A;  3CSF A;  2KKC A;  2D07 B;  2DEN B;  1L7Y A;  2ZCC A;  4EOY A;  4DK5 A;  3ONS A;  4BKS D;  1MG8 A;  3H7S A;  2CU1 A;  4K7W A;  2N1W A;  4JL9 A;  2L8J A;  2O2V A;  5C23 A;  3DBR I;  2R2Q A;  3OLM D;  2WDT B;  1GC7 A;  2NBV B;  3UGB B;  3PTF C;  3IG3 A;  2JVC A;  4NY0 A;  3IVF A;  4W9K A;  2NCN A;  3ZNI D;  4BVU C;  5AEK B;  4ICU A;  4EKU A;  2DAJ A;  3RD2 A;  2MBQ A;  3DVG Y;  3V62 A;  2CR5 A;  4DHZ E;  4KSL C;  3KYC D;  5DPS A;  2RR9 A;  2QHO A;  3IHP C;  3UF8 A;  2FNJ B;  4EZL A;  5D94 A;  2M1M A;  2W9N A;  1TTN A;  2BYV E;  4GGQ A;  2KC2 A;  3KYD D;  3PLU A;  2JXX A;  3KUD B;  4GDL B;  5CTR C;  3W1Y A;  4BFR A;  1G6J A;  2A4Z A;  2KNB A;  4LJO B;  2MBB B;  2JRH A;  2L3Z A;  4G11 A;  4NJ6 A;  5J17 A;  1LXD A;  4FN2 A;  1ISN A;  1SIF A;  2KJH B;  2V1Y A;  4G0N B;  4KZC A;  1WX7 A;  3DCG A;  3L54 A;  4NNJ B;  3R7R A;  4A20 A;  4WQO B;  4FAD A;  2ZCB A;  2FIF A;  1S1Q B;  5CX3 A;  5E6P A;  4ASW C;  5L83 A;  2OJR A;  3RYT A;  4MSM B;  2XK5 A;  1V2Y A;  2J0K A;  3M62 B;  2AYO B;  3QQ8 B;  2MCN B;  1C1Y B;  1H4R A;  2BKR B;  2KWC A;  4KSK C;  3A33 B;  3PRP B;  1WMH A;  2GBM A;  1IYF A;  2LVP A;  3UQA A;  3QAR A;  3DBS A;  2BYF A;  4FJV B;  5GMV A;  2NPT B;  5CHV C;  2CKH B;  2GBR A;  4WJN A;  2HTH A;  5JH5 C;  3WAM A;  1WJU A;  3UQB A;  4DXA B;  1ZKH A;  2JWZ A;  4MH0 E;  1WRD B;  1L2N A;  1KOT A;  4ANU A;  2GBN A;  2JRI B;  4OVV A;  4KIK B;  2ZEQ A;  4NJ7 A;  1WJ6 A;  2K6D B;  1WI0 A;  4MM3 A;  3VTV A;  1WY8 A;  2CHX A;  4IM0 A;  4M8M A;  3V6C B;  2L00 B;  4GMV A;  4JQW C;  2KAN A;  3KUZ A;  3PT2 B;  1WXV A;  3VDZ A;  2C7M B;  3V61 A;  2BGF A;  3HIZ A;  1CMX B;  4EZJ A;  1WXS A;  4WJO A;  1UBI A;  2MBE A;  3L13 A;  2MLB A;  2DZI A;  3UIO B;  2AWT A;  4N9F 4;  3NOB A;  4PS3 A;  1IPG A;  4HPL B;  3JSV A;  2L05 A;  3ZVV A;  1WGG A;  2KWV B;  3RZW C;  2N9X A;  1A5R A;  1WM3 A;  4MGK E;  1V5O A;  1Z5S B;  1ZGU B;  4ANX A;  3RUI B;  3TBL D;  1EF5 A;  2PE9 A;  1OQY A;  5J2R A;  4DDI D;  4MGY E;  3JVZ X;  4HCP B;  3V6E B;  4FA6 A;  2KZR A;  3EHV A;  2C5L C;  3NZU A;  2KTF A;  2KO3 A;  2AEH A;  3A4S C;  5CHW A;  3OAW A;  3OJ4 B;  2Y5B B;  1LM8 B;  4AOF A;  1UEL A;  5DPW A;  1V81 A;  2NPT A;  1WXA A;  1WR6 E;  3CF6 E;  5E6N A;  1BT0 A;  2KX0 A;  4BKG A;  5C1Z A;  1S3S G;  3SD5 A;  3M95 A;  5AZF A;  3PSE B;  1RLF A;  1I42 A;  3VXW A;  4II2 B;  3GZN I;  1X1M A;  2VRR B;  4KIK A;  3B1L X;  1R4N I;  2EMS A;  2IYD B;  2N7E A;  1HE8 A;  4G3X B;  3OJ3 A;  4MEM A;  5LLI A;  2B3A A;  2BPS A;  1E8X A;  3QJZ A;  1WJN A;  2M17 A;  4GB9 A;  1T0Y A;  4WWN A;  1E7U A;  3TIX A;  4G50 A;  2D2Q A;  2K8H A;  4IM3 A;  4EFO A;  2KDE B;  3B08 A;  3RT3 B;  3H7P B;  2C7N B;  4BBN F;  4W9G A;  1UGM A;  2FUH B;  5DCN A;  1WF9 A;  3X0W A;  1V49 A;  2RGF A;  4E74 A;  2C60 A;  5JZE B;  3ZTD A;  1UH6 A;  4E3C A;  1SGH A;  1WE7 A;  4HXD A;  4IWP A;  2REX A;  2L0T A;  4KZ0 A;  2KC1 A;  3K9O B;  2OOB B;  2K39 A;  1KJT A;  3P2B A;  1YX5 B;  4F7Z A;  1WGR A;  4GXB A;  3NS8 A;  1JRU A;  4AJY B;  3VTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...