1WYWB

Crystal structure of sumo1-conjugated thymine dna glycosylase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wywB00
4ICUA 5D6JB 1UD7A 1A5RA 2FUHB 1E7UA 1ZKHA 3K9OB 4FJYA 4PS3A 2N4FA 3K9PB 5JHAA 3PT2B 4FADA 4MGIE 1EUVB 1XQQA 3PS6A 3B08A 2O2VB 2XEWA 5CHVC 1AARA 3B0AA 1VCBA 3RD2A 3TL5A 3PHXB 4BKSD 4JGHB 3TBLD 2Z0EB 3A33B 3NZUA 4EUTA 1XD3B 2KKCA 5G2NA 3PVLA 2LXCA 3PPAA 2BKRB 3M95A 3TJPA 1C1YB 1GG3A 4K1RB 2ZZPB 2DYBA 2K1FA 2NVUI 4RMAA 4W9CA 1SGHA 1I35A 3PSEB 2KN5A 2FCQA 3DBLI 4GDKA 3R7RA 1U4AA 2JZZA 2D3GA 2WDTB 1UGMA 1L7YA 2K39A 3BINA 3SHQA 4DHJD 2LVPA 2ASQA 2MBQA 3V6EB 3PLVA 4KDIC 4MM3A 2L0TA 3APFA 3EC8A 2L8JA 3A9JA 2L0FA 2DYOA 1RFAA 3SD5A 3A1QB 2N1VA 3PRMB 4WAAA 1GC6A 5CX3A 2KMCA 2KJHB 1RLFA 2B3AA 2ZVOA 4JIOU 4K7SA 2K6DB 2LWPA 2W9NA 2N9PC 3VVWB 1GNUA 4MSQB 3EHVA 2DENB 2BGFA 3DBRI 3DVGX 2L05A 4IM0A 1I42A 1IP9A 1WZ3A 2EMTA 4FA6A 2AWTA 1WRDB 4I6PA 4NJ6A 3JYUA 3VFKA 4IG7B 3KUDB 3VUYA 2K8BA 2K6QA 2KLGA 3U7DA 1WYWB 1H8CA 3KVFB 4G0NB 1LM8B 3ZTCA 4W9KA 4IW0A 2MLBA 4WJNA 2L7RA 2MWSB 4ICVA 2KQSA 3HHMA 3KH0A 3H6NA 3ZO5B 2ZEQA 1WR6E 3H9DA 2KQ7A 2ZNVC 5GMVA 2MCNB 4WWOA 4FBJB 3TMPB 2DZIA 2JVCA 2Z59B 3ZW3A 2RR9A 4PYZA 3L08A 1S3SG 2KX3A 2BPSA 4BOZB 2D07B 4MEMA 5AZHA 2KDEB 3AULA 4DBGA 1WY8A 1M94A 2MBBB 1BT0A 3L13A 4IWOA 4W9EA 3UQBA 3ZKJC 1Z2MA 2KC2A 3LDZE 3RZWC 4F8CB 4IC7B 4AP4C 4AOFA 4G3XB 2EKEC 3DVGY 2MW5A 2DX5B 4NY0A 3VUXA 1CMXB 2ZVNA 2GBMA 4ZDVA 3M62B 1WIAA 2G4SA 2KO3A 4GU2A 3X23A 1XT9B 2WYQA 2YVCA 2A4ZA 5DPWA 1NDDA 1UH6A 5D2MB 2KTRB 4EEWA 5J2RA 3OAWA 3ENEA 3JW0X 4GGQA 1Q0WB 1WF9A 2M1MA 2XK5B 2MBHA 3UINB 4CHKA 5AZFA 2BKFA 4RM8A 4GN1A 5HKHA 5E6OA 1KM7A 3MJWA 4NPNA 5CHFA 2XBBC 1FXTB 4WQOB 1WXVA 2JT4B 2MP2A 3WALA 2LVOA 3IHPC 3A1QA 3QC8B 4XX5A 2LASA 2K8HA 2KANA 4IWPA 2IO1B 3SDLC 2ZNVB 1SE9A 1YJ1A 1UBQA 3A9KB 4GOCA 3QHTA 2BYFA 3ZRCA 4TUUA 1LFDA 1E8XA 3ALBA 3H7SA 1V9JA 4II3B 2FIDA 1LQBA 3JSVB 2AEHA 3ML9A 1V2YA 1WGRA 1ZGUB 2KX0A 2NCNA 1J8CA 2NPTB 3VTVA 1WJUA 3MHSD 1E5WA 3ZUNA 2J0MA 2IZVB 4GB9A 3QWZB 3WAPA 4KIKA 3R3MA 1C3TA 2IO0B 2CHZA 4FJVB 4GDLB 2AL3A 3NHEB 2PE9A 3NOBA 1WMHA 2HE7A 3H7PB 4MELA 2LRUA 4CO7A 5DPRA 4ANUA 3QCAA 4YL8A 4E74A 3AU4A 1P3QU 3RUIB 4P7IA 5FR6A 4ANVA 2MA9B 4FLHA 1WGHA 1WZ0A 5C23A 1YX6B 2A5UA 4EFOA 2O6VB 2ZCBA 2FNJB 3AI5A 3OJ3A 3RT3B 3ZRFA 2NBVB 4HPMB 3VH4B 3W1SA 3ZDMC 4KSLC 4PS7A 2FAZA 3W1YA 2PE6B 3GOEA 2RGFA 4ZRIA 5G55A 2LGDA 3U30A 4BKGA 1R4NI 2MQJA 1P9DU 1WX7A 2DHZA 3QK0A 3A4SC 4FULA 3DBSA 2IBIB 4KV2A 2DYMA 2PPHA 2CHWA 2KTRA 4BBNF 2JWZA 1YD8U 2NBWB 4MDKE 2XK5A 1WH3A 4MGYE 1PQSA 4E3CA 4FHJA 3RULA 4M8MA 2L00B 3VH3B 3CMMB 2KJ6A 4HCPB 1V5TA 2KWVB 1WGDA 2IYDB 4EZJA 4G11A 4NNJB 3U8ZA 4E71A 5BO4B 4DK5A 2LI5A 2JY6A 3V60A 4LCDE 2J0KA 4MJSB 4GSWA 2C7NB 2JRIB 2ZPYA 3VUWA 2V3SA 1P98A 4HXDA 3WA0A 4NQKE 1TBEA 4B9KA 5J18A 2KDFB 3N32A 4W9GA 3JSVA 2KFJA 3Q3JA 5IAAC 3WAMA 1WE7A 1Z5SB 2NPTA 2N1WA 4DDGD 3VAWA 1IYFA 2LJ5A 2C7MB 2PJHA 4HK2A 4F1SA 3AXCA 1RRBA 2NBUA 2LUEA 4LJPB 4BBNC 1R4MI 2JZ3B 2K25A 1QZEA 4AUQC 2GMIC 2RSUA 3PZDA 3DPDA 3UIOB 5LXIB 4AJWA 4JQWC 1MG8A 2HTHA 3EFUA 1OQYA 4HVBA 2O2VA 3I3TB 1ISNA 1UZXB 1WGGA 2JPHA 2ZJDA 4NJ7A 3L0WB 2L3ZA 2GOWA 1RAXA 5CTRC 1V80A 4ZRKA 4I6LB 1J0GA 1X1MA 3GZNI 4OVVA 3QAQA 1OGWA 4XC2A 1S1QB 2CS4A 1Y8RC 4DHJB 5D94A 3HM6X 1H4RA 2BYVE 1WJNA 4W9LA 3EECA 4DDID 1E8YA 1HE8A 5LLIA 4M8NA 1WJ6A 4EZLA 3NZSA 3APCA 1NBFC 2FIFA 1E90A 2KZRA 1UELA 1WX9A 3IFWB 4IUMB 3IBEA 3CF6E 3Q3FA 2G4DB 4TKNA 3UGBB 4JL9A 4K7UA 1T0YA 3RZFA 1E7VA 2LD9A 4II2B 2L76A 2KWCA 2R2OA 2V1YA 4GDKB 4K81A 3OJ4B 4RM9A 3RYTA 4WWNA 1E8WA 3NS8A 3CSTA 1OTRB 2RD0A 3HM3A 2PEAA 3DDCB 3ECIA 3QQ8B 1WXAA 4W9HA 5JHBA 1WXSA 1JRUA 2GBKA 2I1KA 2REXA 1J19A 1VD2A 1WFYA 3A9JB 1WX8A 4MGKE 5E6PA 4ASWC 1WM3A 5C1ZA 5LXHA 4MJSA 2AYOB 4EKUA 2JXXA 2DZKA 1OEYJ 3R7QA 2KK8A 2D10A 1V5OA 3HK0A 4G50A 2BF8B 3DBHI 2LVQA 4WWPA 3VTWA 4CYEA 4IM2A 2YLMA 2LZ6A 2LRWA 1WGYA 1V49A 1GC7A 3AU5A 3MTNB 5EDSA 3ML8A 3HIZA 3KW5B 3ZLZA 2JF5A 2Z0DB 3PV1A 3T9LA 3ZTDA 3WIMA 5D7GA 3IG3A 2OOBB 1SIFA 3PREA 4PS8A 3KYDD 1UBIA 3BY4B 2AL6A 1OEYA 3M63B 2GBJA 3PRPB 4LJOB 3N3KB 3ZNZB 3ZIMA 4HDQA 1GJZA 2C5LC 2I1JA 4OVUA 2BWFA 3WAOA 1EF1A 1P1AA 4ZRJA 2M4NA 3RCZA 3OLMD 3WANA 3QX1A 4J6IA 4FJZA 4FHKA 3QJZA 4TV3A 2MBEA 2KJRA 2DAJA 2KHWB 2DZJA 2ZPNA 1F9JA 2K8CA 3L10B 3P2BA 4LDTB 2N9XA 3PLUA 4A20A 1WI0A 3M3JA 1WJ4A 2KOXA 1V81A 4HDOA 2G45B 5CHWA 3VTUA 2KLCA 3PRZA 2FCSA 2HD5B 3T8MA 3UIPB 1YQBA 3UF8A 4ZYNA 1TZ1A 2KDIA 4AWJA 2KD0A 3DQVA 2RPQA 3DOWA 2J7QB 4MSMB 3PGEA 2M17A 4HJKA 2N7EA 3O65B 1EO6A 2OJRA 3VXWA 3CSFA 1TGZB 4X57B 2C7HA 1LXDA 1WR1A 2CKHB 2NS5A 4AJYB 4NQLB 3IVFA 3VQIA 3A9KA 3N30A 4NAWB 2CHXA 2WX0A 3V62A 3W1SC 3VHTC 2MBOA 2WX1A 2MP2B 3L17A 2GBRA 2C60A 3H1UA 1TTNA 4BVUC 1NI2A 5J17A 4KZCA 4URKA 5L95C 2KVRA 2KC1A 4ANXA 3KUZA 1GUAB 2N9EB 3L16A 5JZEB 2IO2B 2V4LA 3R66C 4KDLB 2DAFA 1L2NA 1ZW7A 1Q5WB 2R2QA 2WWZA 1K8RB 4GDLA 2FCNA 2KFKB 3QARA 4BOSC 4FN2A 3H7PA 4HLEA 4GMVA 1P0RA 2DZMA 4HWIB 3V61A 4IM3A 5JH5C 3QA8A 3VDZA 1WXMA 4WJQA 4A3PA 1IPGA 4KIKB 1WE6A 2UYZB 4EOYA 4TQ1A 1KLVA 2BWES 2D2QA 4KVGB 2O6VA 1WMHB 3ZDTA 4W9FA 4DWFA 4A3OA 3KUCB 4KZ0A 2KMAA 2C9WB 2M8SA 4MH0E 2BYEA 5DCNA 2NR2A 4W9DA 4DHZE 2MRPA 2LGYA 3DCGA 3TIXA 1KOTA 2LXAA 2QHOA 4WJOA 2Y5BB 3QIJA 3NY5A 4TQ0A 4WJPA 2HJ8A 3D32A 4JLCA 3ZNID 4M0WB 4W9JA 3L54A 5L83A 1Q1OA 5DPSA 5AEKB 1YX5B 3JVZX 5KHOA 4PYUA 4DHZB 2JRHA 3TCAA 1V86A 2M0XA 3B1LX 2O6VD 1EF5A 3DVNV 1G6JA 2VRRB 2JUOA 3V6CB 3SU8X 1V6EA 2IY0B 2IY1B 5TR5A 5KHQA 2ZCCA 2MX2A 3ZNHB 1D3ZA 4LDTD 3APDA 4F7ZA 2MSED 2KDBA 4GXBA 4NAWA 5DPTA 3S2AA 3UQAA 2IO3B 2KTFA 5IA7A 3C0RB 4GIVA 4IWQA 3ONSA 2FCMA 3KYCD 1KJTA 2EMSA 3DVNU 5AZGA 4MGZE 5E6NA 2N7DA 2KWUB 4BKTA 4W9IA 3X0WA 3PTFC 2CR5A 3LJ3A 4I6NB 2D11A 4XZ4A 4ANWA 3ZNGC 2J0JA 4N9F4 4HPLB 4BKSA 2LGXA 4DXAB 4B95A 4EZKA 2UWQA 3PHWB 1YIWA 2KFKA 1WM2A 2CU1A 2GBNA 4HCNB 4B6WA 4K7WA 3ZVVA 4BFRA 2G3QB 1E8ZA 4KSKC 2KNBA 2KXJA 3A4RA
chains in the Genus database with same CATH superfamily
4YTPB 2WXKA 4LK0M 3B9JA 3AEFB 4FJYA 3MP9A 2N4FA 4PS3A 3K9PB 4FADA 4MGIE 3B2GA 2XEWA 1SSNA 1AARA 1Q10A 3PHXB 4DXFA 4BKSD 1C4PA 3OWEB 5G2NA 3PVLA 2BKRB 3M95A 3TJPA 1C1YB 4C00A 3PZ7A 4K1RB 2ZZPB 2K1FA 2OJWA 4BAXA 4W9CA 1IBXB 3PSEB 1FCCC 2FCQA 2JZZA 3TSSA 1FCLA 2KWDA 1N61A 3AE1B 2K39A 3KLSX 3SHQA 2ASQA 1ROEA 3APFA 1B9RA 1RWSA 2L0FA 2DYOA 4WAAA 2KMCA 4K7SA 2J52A 4NJCA 3VVWB 3AE9B 2L05A 4IM0A 1I42A 2EMTA 1NENB 4FA6A 1WRDB 4I6PA 4KKIA 4NJ6A 3JYUA 2WXIA 3AN1A 3VFKA 4IG7B 4PT5A 4US8A 3KVFB 3N20C 1D5ZC 2MLBA 3KWVA 4JWUC 2MWSB 3HHMA 3AE3B 4HJGE 3NUHB 2QJLA 3H9DA 4C56C 3DWGC 3ZW3A 2MJDA 4YTMB 1S3SG 2KX3A 2WXNA 2PVGC 4MEMA 2K5PA 3UQBA 2MBBB 1A5RA 3ZKJC 1PDXA 4IC7B 4AP4C 2N9LA 5I4DA 1FNVA 1FFVA 4NY0A 1F1HA 3LYYA 2KDMA 4GU2A 1XT9B 2YVCA 1KRHA 4YWGG 1L0XB 1EWYC 1NDDA 5J2RA 3MJ5A 3JW0X 5T8IA 1Q0WB 2XK5B 3UINB 5AZFA 4RM8A 1UUPA 5E6OA 4NPNA 3AE7B 3NVWA 2M19A 2JT4B 5FR3A 1JROA 3WALA 1I4PA 2LVOA 3QC8B 2K8HA 2IO1B 4XGAB 3SDLC 2ZNVB 1YJ1A 4GOCA 1UBQA 2BYTA 4TUUA 1E8XA 1V9JA 2B76B 2KT7A 1WGRA 1J8CA 4WQMA 2NPTB 1GOZA 3MC9A 4KIKA 4OZBA 4FJVB 2AL3A 3NHEB 1TJEA 5IO9A 3NOBA 2LRUA 4CO7A 4YL8A 4E74A 1QF6A 2DWQA 3AU4A 2BQQA 2D3AA 2MA9B 1QLBB 3GB1A 3T3OA 2M0AA 1YX6B 5FKAC 3W5UB 2VH1A 4EFOA 2O6VB 3E56A 3RT3B 3ZRFA 3VH4B 3W1SA 4LNNA 4KSLC 2JX5A 1EM7A 2LHDA 5G55A 3U30A 2LGDA 4BKGA 1R4NI 4L1BA 1P9DU 3AH7A 5HHDG 1PFDA 2DHZA 2IBIB 4KV2A 2XK5A 3P4RB 1PQSA 1YN3A 3VH3B 3CMMB 3ZXRA 1WGDA 1EU3A 1TS2A 2KYWA 4G11A 1JCKB 3I63C 4NNJB 3NS1A 1TKYA 4LCDE 4GSWA 1TS4A 2ZPYA 4HXDA 1J7CA 3Q3JA 3WAMA 1Z5SB 2NPTA 3HVDA 3DWMA 2NBUA 4BBNC 4C4VB 2MJ3A 4TSSA 1MG8A 3T3NA 1OQYA 2O2VA 3I3TB 2IPKD 3Q3OC 1RAXA 2LMCA 1V80A 3BVGA 2JXTA 4DDID 5LLIA 2QCZA 3RNAC 1JRPA 1WJ6A 2WXFA 2KZRA 3CIRB 3VRBB 4TKNA 3RZFA 1OQRA 2LD9A 2MJEA 4K81A 4YSYB 1I4RA 4WWNA 1AW7A 2WXRA 4C7ZA 3AEAB 1UNSA 3ECIA 2WDVB 5JHBA 2WXQA 1WXSA 2GBKA 2REXA 5E6PA 4ASWC 1WM3A 5C1ZA 2JXXA 1WRIA 4G50A 1JWBD 2WHIA 4CYEA 4IM2A 4FXCA 1V8CA 3ZJTA 1GC7A 1TY0A 3ZLZA 2EELA 4C4VA 5EE1A 2OOBB 4PS8A 5H92C 3BY4B 3RN9C 1OEYA 4LJOB 2GBJA 3ZNZB 1GJZA 4OVUA 3U7ZA 4ZRJA 1NYRA 2KQ4X 4UDUC 3WANA 2IJ0A 3TEYA 4J6IA 2ICIA 1AYFA 1UGJA 3P2BA 2KJRA 2DZJA 4LDTB 1TZOA 3VR9B 3PLUA 3AE6B 3M3JA 1V81A 2G45B 5CHWA 3VTUA 3PRZA 4C80A 2HD5B 4ZYNA 1FIQA 1TZ1A 1ZE3D 5BYRA 4HJKA 1WSPA 3O65B 1VJKA 3CSFA 3SFEB 1PGAA 1YJJA 4NQLB 3TEZA 4P16A 1SE2A 2MBOA 2WX1A 2MP2B 1KLGD 2GBRA 2C60A 3AB5A 2TSSA 1VDVA 3N9YC 3I9V1 2Q5WD 4KGTA 1FXAA 3RNGC 2KVRA 3BVMA 4ANXA 5JZEB 2IO2B 3R66C 1L2NA 2L83A 1K8RB 1E10A 4HLEA 3H7PA 4GMVA 2DZMA 4HWIB 3V61A 4WJQA 1IPGA 3BYYB 3SR6A 1B1ZA 4JE3B 1HQRD 3ZDTA 2L32A 3KWLA 5BYQA 2C9WB 3AE8B 4W9DA 1L0YB 1KOTA 1FNUA 3MFGA 4XYCA 3MHZA 4WJPA 4BZAA 4JLCA 4M0WB 1YX5B 3RMKC 1V86A 5BMIA 2VRRB 2IY0B 4MM3B 5KHQA 1FM0D 4AQ7A 4F7ZA 2MSED 3S2AA 1IGCA 4OHJA 2WS3B 4WIPA 4IWQA 2FCMA 3KYCD 3E9SA 5E6NA 3Q8EA 2N7DA 1V1OA 2J0JA 2GI9A 4EZKA 1WM2A 2JWUA 4JWSC 1C79A 1CK1A 4BFRA 1SJED 1E8ZA 1UF0A 2KXJA 3A4RA 1UD7A 1E7UA 3ZYYX 1JQ4A 3GP7A 1EUVB 3PS6A 4A90A 2JYTA 3UI3A 4JGHB 2Z0EB 3A33B 4CQNA 1GG3A 4RMAA 3C19A 5C3JB 5JXVA 1I35A 2KN5A 3DBLI 4GDKA 1U4AA 2N9KA 1RYJA 3IT6B 1L7YA 4ARIA 3BINA 3J9CA 2LVPA 3V6EB 3PLVA 4MM3A 2INPE 4RF1A 2L0TA 2L8JA 2LHEA 2N1VA 5CX3A 1GC6A 1RLFA 2B3AA 4JIOU 1GNUA 3DBRI 1WXQA 4XWTA 2KLGA 1WYGA 2D5GA 3ZTCA 4W9KA 4WJNA 1HTQA 2L7RA 2KQSA 3H6NA 3ZO5B 4DXGA 2VZKD 2WXPA 2BVCA 2XN9C 2CJOA 2RR9A 1DOXA 4PYZA 3L08A 2KDEB 2BT6A 3AULA 3L13A 3N1XC 2KC2A 1J7AA 3DVGY 3EA6A 2DX5B 4OZCA 2ZVNA 2GBMA 1WIAA 3X23A 2INDC 1UH6A 5D2MB 4EEWA 4XDCA 3FILB 3ENEA 1WF9A 2LGIA 5HKHA 2XBBC 1FPYA 1FXTB 4WQOB 1BXTA 1FMAD 1SBBB 2JU6X 3IHPC 3PO0A 1FRRA 3GE3C 4IWPA 3BYTB 1SE9A 3QHTA 1L6VA 1LFDA 3NVZA 3JSVB 2AEHA 3ML9A 1XLOA 2KX0A 3MHSD 2IZVB 4GB9A 3QWZB 3R3MA 5D3DA 4YXDB 4GDLB 2PE9A 1WMHA 2G1EA 2ONQA 5DPRA 3QCAA 2IGHA 3WCQA 1P3QU 1D5MC 4P7IA 4FLHA 1K51A 1WGHA 3ZGZA 2ZCBA 3TEWA 3AI5A 1QOBA 4HPMB 1XLNA 3GZNB 4JPSA 1D4BA 3BK1A 3W1YA 1SB3C 4ZRIA 1YMHE 2MQJA 2JZPA 2JSVX 2Y3AA 3QK0A 1MFWA 3A4SC 2CHWA 4BBNF 1T6BX 3NZ3A 1YD8U 4MGYE 1PGXA 4ZHPA 4E3CA 4FHJA 3RULA 4A9AA 4ZRQA 1V5TA 1ZOYB 2WP9B 4EZJA 1HEZE 5BO4B 4DK5A 2JY6A 1GB1A 2MHJA 3VUWA 2V3SA 1P98A 4B9KA 4A8XC 4NQKE 3RNFC 1V1PB 2KDFB 3N32A 4W9GA 3JSVA 3R2TA 2G9HD 2KFJA 4DDGD 1IYFA 3DBHB 2PJHA 3RNBC 4LNIA 2LUEA 1R4MI 4US9A 2K3UA 2K22A 1QZEA 2GMIC 1C9FA 3OG5A 3UIOB 5LXIB 3IT4B 2HTHA 3EFUA 1UZXB 3Q8FA 2WXHA 4NJ7A 3L0WB 2L3ZA 2GOWA 5CTRC 1I4GA 2IDYA 3NJTA 1OQQA 3QAQA 2BS4B 3HM6X 1IBXA 1ENFA 1E8YA 1I4HA 4MT5A 3Q8AA 4M8NA 3RNCC 1NBFC 1T3QA 3IFWB 2J4XA 3IBEA 3Q6BA 1E7VA 2L76A 2KWCA 1HXYD 2V4IB 1ZDVA 1CZPA 3RYTA 1VZ8A 1OTRB 1ET6A 2WXMA 3HM3A 1WXAA 4W9HA 1N6ZA 2PIAA 2I1KA 1WFYA 3A9JB 1SJHD 1XXGA 5G5GA 4EKUA 3R7QA 2VZKB 1V5OA 3HK0A 2LVQA 2LZ6A 2K9XA 1C78A 1JALA 2LRWA 3AU5A 3ML8A 2JF5A 3T9LA 3ZTDA 1E0ZA 1RM6C 3WIMA 5D7GA 3IG3A 1KF6B 3PREA 3ZIMA 1FFUA 3M63B 2C5LC 3SEBA 1ZDXA 3OLMD 4FJZA 4FHKA 3L10B 2DAJA 2K8CA 2N0SB 2PVOD 2KDIA 3DQVA 3DOWA 4MSMB 2J7QB 2V9HA 1N62A 4A55A 4ZOHC 1EO6A 2OJRA 3VXWA 1L5PA 1V97A 2CKHB 3IVFA 3W1SC 3AEEB 2PTLA 2E6XA 4B0EA 4NZLB 1ZP0B 2KMMA 1YN5A 5EE3A 1GB4A 5J17A 3LB8C 1C4CA 1GUAB 2DNFA 2N9EB 2RMMA 1ZW7A 2WWZA 1ZXHA 2KFKB 3QARA 3U52E 1VRAB 1P0RA 2YEPF 4IM3A 5BYSA 4XWWA 4A3PA 2BS2B 2L52A 1WE6A 4EOYA 1XCTL 4DQOC 2BWES 2O6VA 3NRZA 3AE5B 4W9FA 4A3OA 3KUCB 4J3OD 2KMAA 2BYEA 5DCNA 1UWXA 2NR2A 2MRPA 2LGYA 3DCGA 1M4VA 3TIXA 1A70A 4IOIE 1T0RC 5AEKB 3JVZX 5KHOA 4PYUA 4DHZB 1DYQA 1JMLA 1EF5A 3DVNV 1G6JA 3P63A 4P1CC 4PK1A 1V6EA 1TYGB 1D3ZA 1YNTE 2KDBA 1D5XC 2KTFA 5IA7A 1C77A 1QOGA 2ON8A 4KKJA 1KJTA 2KACA 4MGZE 2KWUB 4BKTA 4W9IA 4KGSA 3ZNGC 4N9F4 4HPLB 3AEBB 5H8YE 4BKSA 4B95A 3W5VB 1YIWA 2KFKA 2GBNA 4B6WA 2G3QB 2KNBA 1ZXIA 5D6JB 2FUHB 1ZKHA 1XQQA 3RPFC 4GLSC 2AX5A 3TL5A 1TKGA 3TBLD 3NZUA 2KKCA 3PPAA 2IGGA 1E9MA 3V05A 1FEHA 1NI3A 3W9CB 4ITKA 1T0SC 1YN4A 4MACA 4P1BC 2QMTA 3CWIA 2K0PA 4RNAA 1UGMA 1XCQL 3O13A 4DHJD 4YSZB 1CJEA 4YSXB 2I38A 4KDIC 3EC8A 3SD5A 2W3RA 3PRMB 1N5XA 3IXSA 1DOYA 4K3BA 2LWPA 2W9NA 2N9PC 3EHVA 1MG4A 1QKZA 2DENB 3AE4B 4ZYSA 3FAHA 3DVGX 1WZ3A 2D3CA 4OZAA 2FE8A 2QIEB 1MHXA 3KUDB 2SEBD 3VUYA 2DLBA 2JYEA 3U7DA 1WYWB 1KTKA 5IP4D 1H8CA 4G0NB 1LM8B 1ACCA 4IW0A 3KH0A 2KQ7A 1QOFA 2MCNB 2CJNA 4WWOA 2JVCA 2XNAC 3AEGB 4R3DA 1UWMA 4BOZB 1M94A 4IWOA 1DOIA 1Z2MA 2WQYB 4RGOS 3RZWC 3TUOA 4F8CB 3ZJVA 2WGSA 4G3XB 1D6EC 2MW5A 1CMXB 4ZDVA 1RFKA 2KO3A 4LNFA 1N5WA 3ETRA 5DPWA 1R4NB 2ZW1A 2I2YA 3PZ8A 1FXIA 4YTNB 1KM7A 2LUMA 1WXVA 2MP2A 1QOAA 3U2SC 2LASA 2KANA 4HRSA 3A9KB 2BB6A 3KQ4A 3ALBA 3H7SA 4II3B 5IKCM 2FIDA 3NG0A 1ET9A 1V2YA 2SAKA 3VTVA 1HA5A 1E5WA 1C3TA 4KGRA 5IOIA 1FO4A 4RFBA 4MELA 4ANUA 3AV8A 2W3SA 5HG2A 3RUIB 5FR6A 3C8YA 2NMQA 2NTSA 1NEKB 2A5UA 3OJ3A 2NBVB 4L23A 3ZDMC 4PS7A 4M0WA 3ABVB 1SE4A 4K3CA 1WX7A 2DYMA 3AEDB 2FBWB 2BBCA 1WH3A 4M8MA 1HZ5A 4HCPB 2KJ6A 2KWVB 4XDDA 2QILA 4ZRPA 2LEKA 1L4DB 1TS3A 4O1NA 2E3TA 2C7NB 1XF5L 4H2AA 5J18A 5IAAC 4WURA 5HFYA 2MEKA 2C7MB 4HK2A 2DBYA 3AXCA 2UU7A 2K25A 4AUQC 2RSUA 4JQWC 4RGNA 4HVBA 3DHGC 1ISNA 1WGGA 2ZJDA 1YQ3B 1WGKA 3RFZB 3BZDB 4YT0B 4D2KA 1J0GA 1QQRA 1OGWA 4XC2A 4B0MA 1S1QB 2BB5A 3AM9A 2CS4A 1Y8RC 4DHJB 5D94A 2H89B 1SEBD 2BYVE 4W9LA 4RH6A 1HE8A 3NVYA 4EZLA 3APCA 2FIFA 3ZXVA 1UELA 2KVZA 3CF6E 4K7UA 1T0YA 2V1YA 4RGMA 1I4QA 3NS8A 3CSTA 2HDEA 1AWDA 3QQ8B 1JRUA 1QILA 1J19A 2BTEA 2AYOB 3B2FA 2W82A 1OEYJ 2BF8B 1N60A 1Y56A 3URYA 1AN8A 5EDSA 5FK9C 3HIZA 3H8HA 2Z0DB 1SIFA 2X8XX 5IN7A 1UBIA 3PRPB 3N3KB 4HDQA 1F2RI 2I1JA 1FD6A 2BWFA 3WAOA 3RI7C 1BUIC 1P1AA 2D3BA 3QX1A 3QJZA 2MBEA 1F9JA 2N9XA 4QAYA 4A20A 1WI0A 1WJ4A 1IGDA 4HDOA 3I57A 4LNOA 3FILA 1E7PB 2FCSA 1E6EB 3UIPB 1YQBA 4N59A 4AWJA 2KD0A 1HTOA 2RPQA 4HKZE 2HTME 1YJIA 3HVZA 1ZUD2 4X57B 5MPOA 2C7HA 2GB1A 1LXDA 2NS5A 4AJYB 3MC0B 3VQIA 2CHXA 2WX0A 4ACFA 4NAMA 4S17A 3V62A 1YQ4B 2IGDA 3L17A 2AQ3B 3H1UA 4BVUC 4KZCA 3BVZA 5LNK1 3AMZA 5L95C 1FNWA 3AE2B 1F77A 2KC1A 4Q2JA 3L16A 2V4LA 3FC4A 2DAFA 1Q5WB 3U4EG 4GDLA 3IAS1 2FCNA 4BOSC 2WLBA 5JH5C 2QEJC 1WXMA 2BW2A 2UYZB 4KIKB 2RDBC 3Q8BA 5HI1A 2D2QA 4KVGB 1FRDA 1YOVB 4DWFA 4IKGA 4KZ0A 3GE8C 2QSDA 4MH0E 2WU5B 2LXAA 2QHOA 2Y5BB 3QIJA 1T0QC 3NY5A 2HJ8A 4WH4A 3L54A 5DPSA 1F52A 4IDIA 1JWMD 2LFIA 3DBLB 2KN4A 3MC8A 2IY1B 4KX6B 2MX2A 4LDTD 4LTUA 3UQAA 2LJIA 1V1PA 3C0RB 3ONSA 3V3XA 1I4XA 3LXFA 3DBRB 2Y5PA 3PTFC 2WXGA 2D11A 4XZ4A 2WDQB 3PHWB 2CU1A 4K7WA 2ZW0A 3EGRA 1BMLC 4ICUA 4HKQA 1ZPSA 4MH8A 3K9OB 5JHAA 3PT2B 3B08A 2O2VB 5CHVC 3B0AA 5AUIA 1VCBA 3RD2A 2OHFA 4EUTA 1XD3B 2LXCA 2V0GA 3Q3NC 2DYBA 2NVUI 1SGHA 1TS5A 3R7RA 3P4SB 2D3GA 2X38A 2WDTB 2WDRB 1N63A 2MBQA 3FKYA 1GAQB 3A9JA 1RFAA 3A1QB 2BS3B 2KJHB 2ZVOA 3BIID 2K6DB 4MSQB 2R61A 3Q69A 1KH0A 4A6QA 2BGFA 1IP9A 2AWTA 4XE0A 2N7JA 2K8BA 2K6QA 1PYWD 2CU3A 4ICVA 2ZEQA 1WR6E 2WXJA 2ZNVC 5GMVA 1PUTA 4L2YA 1GPXA 4FBJB 3TMPB 2DZIA 2JQRB 2Z59B 3TEXA 2BPSA 2D07B 5AZHA 4N58A 1MI0A 4DBGA 4N6EB 1WY8A 4W9EA 1BT0A 3LDZE 3P42A 4AOFA 2EKEC 1MVKA 3VUXA 1OFFA 4TMAB 3M62B 2G4SA 2WYQA 2A4ZA 2QC8A 1STEA 4REZA 2KTRB 5G5HA 3OAWA 4GGQA 3RNEC 2M1MA 5EE9A 2MBHA 1NYQA 4CHKA 2BKFA 4GN1A 2W55A 3MJWA 3SFDB 2AQ2B 5CHFA 3I5JC 1KFYB 1JWSD 3P4PB 3A1QA 3Q8CA 4XX5A 4HPPA 4ZHOA 2AQ1B 3DHHC 2BYFA 3ZRCA 2L1AA 1LQBA 1ZGUB 2NCNA 1WJUA 3ZUNA 2J0MA 3N1ZC 3WAPA 2IO0B 2CHZA 1TKEA 3ZQ4A 5EE0A 2HE7A 3H7PB 1R4MB 2YEPB 1JWAD 4ANVA 2PKOA 1TIFA 1WZ0A 3W2DA 5C23A 4ARCA 1VZ7A 1TT5B 4LNKA 1JWUD 1LGRA 1HZ6A 5GXGB 2FAZA 2PE6B 2Z8LA 2OEDA 3GOEA 2RGFA 2VH2A 1T5XD 1MHHE 4RF0A 1ESFA 1SIJA 1XLPA 4FULA 3DBSA 2PPHA 2KTRA 1F2RC 2JWZA 2NBWB 4MDKE 2L00B 1VR9A 2IYDB 4E71A 3U8ZA 2LI5A 3V60A 3ZJUA 2J0KA 4MJSB 2JRIB 2Y5CA 4M02A 3WA0A 1TBEA 1WE7A 2N1WA 3VAWA 4S0RA 2LJ5A 4F1SA 2J53A 1EU4A 4C7YA 1RRBA 4LJPB 1KLUD 4LLGM 2JZ3B 3PZDA 3DPDA 4AJWA 2NTTA 1WWTA 1K52A 2JPHA 3VR8B 3P1MA 4ZRKA 4I6LB 1L0VB 1X1MA 3GZNI 4OVVA 3Q2AC 2GLSA 4OW0A 1IUEA 1H4RA 1R7SA 1WJNA 3EECA 1C4AA 4AS1A 4JX1C 3EUB2 3NZSA 3N1YC 1E90A 1WX9A 4IUMB 3Q3FA 3UGBB 2G4DB 1JW9D 4JL9A 1CQVA 4II2B 2R2OA 4GDKB 1J7BA 3OJ4B 4RM9A 2J42A 1NVID 1E8WA 2RD0A 1I7HA 2PEAA 3DDCB 2V3PA 4HROA 1DGJA 5E6JA 3B1LX 4MGKE 1SF0A 1VD2A 1WX8A 5LXHA 4MJSA 1MPEA 2DZKA 2KK8A 2D10A 3DBHI 4HEA1 4WWPA 3VTWA 2FUG1 3P4QB 3EFCA 2YLMA 2EKIA 3Q3MC 1WGYA 1V49A 3MTNB 3KW5B 3PV1A 5TSSA 2ACZB 3R2IA 2GRIA 1XEEA 3KYDD 1L6UA 2AL6A 4WWMA 1K53A 3IAM1 1EF1A 4RGTA 2M4NA 2HJ1A 3RCZA 2WNMA 2QDFA 4TV3A 2KHWB 2ZPNA 2RDGA 2H88B 2KOXA 4USAA 2INCC 2KLCA 3T8MA 3BWUD 3UF8A 2V3NA 2M56B 3PGEA 2M17A 4M01A 2N7EA 1XO3A 2WXOA 3Q14C 1TGZB 2LGSA 1F0ZA 1WR1A 1C76A 3NVVA 5AUKA 3A9KA 3N30A 4NAWB 1L4ZB 3VHTC 5BMHA 3AECB 2KAJA 4WAFA 1TTNA 1NI2A 4URKA 4M00A 3HUIA 3KUZA 4KDLB 2R2QA 2WU2B 3L4PA 4FN2A 3R8BA 3QA8A 3VDZA 2WXLA 1VLBA 4TQ1A 1KLVA 1P7FA 4OVZA 1WMHB 4RCOA 2INNE 2MH7A 2W54A 1QT9A 3DHIC 2M8SA 4DHZE 4WJOA 1K50A 4TQ0A 3D32A 2PLPA 3ZNID 5BMGA 4W9JA 5L83A 1Q1OA 5C2TB 4P6VF 2JRHA 2RPVA 3TCAA 2M0XA 2O6VD 1SE3A 2JUOA 3V6CB 3SU8X 1EWCA 5TR5A 3BK2A 2ZCCA 3ZNHB 3HRDD 5D3IB 3APDA 4NAWA 1P7EA 4GXBA 5DPTA 2IO3B 4GIVA 2PMVA 1TY2A 2EMSA 3DVNU 5AZGA 3GS2A 3X0WA 2CR5A 3LJ3A 4I6NB 4ANWA 1MJDA 2LGXA 4DXAB 1LO5D 2UWQA 1PGBA 4HCNB 2RDHA 1XLQA 1VZ6A 1SXTA 3ZVVA 2PW9A 4EE2A 4KSKC 3VRAB 2FNJB
chains in the Genus database with same CATH topology
4ICUA 5D6JB 1UD7A 1A5RA 2FUHB 1E7UA 1ZKHA 3K9OB 4FJYA 4PS3A 2N4FA 3K9PB 5JHAA 3PT2B 4FADA 4MGIE 1EUVB 1XQQA 3PS6A 3B08A 2O2VB 2XEWA 5CHVC 1AARA 3B0AA 1VCBA 3RD2A 3TL5A 3PHXB 4BKSD 4JGHB 3TBLD 2Z0EB 3A33B 3NZUA 4EUTA 1XD3B 2KKCA 5G2NA 3PVLA 2LXCA 3PPAA 2BKRB 3M95A 3TJPA 1C1YB 1GG3A 4K1RB 2ZZPB 2DYBA 2K1FA 2NVUI 4RMAA 4W9CA 1SGHA 1I35A 3PSEB 2KN5A 2FCQA 3DBLI 4GDKA 3R7RA 1U4AA 2JZZA 2D3GA 2WDTB 1UGMA 1L7YA 2K39A 3BINA 3SHQA 4DHJD 2LVPA 2ASQA 2MBQA 3V6EB 3PLVA 4KDIC 4MM3A 2L0TA 3APFA 3EC8A 2L8JA 3A9JA 2L0FA 2DYOA 1RFAA 3SD5A 3A1QB 2N1VA 3PRMB 4WAAA 1GC6A 5CX3A 2KMCA 2KJHB 1RLFA 2B3AA 2ZVOA 4JIOU 4K7SA 2K6DB 2LWPA 2W9NA 2N9PC 3VVWB 1GNUA 4MSQB 3EHVA 2DENB 2BGFA 3DBRI 3DVGX 2L05A 4IM0A 1I42A 1IP9A 1WZ3A 2EMTA 4FA6A 2AWTA 1WRDB 4I6PA 4NJ6A 3JYUA 3VFKA 4IG7B 3KUDB 3VUYA 2K8BA 2K6QA 2KLGA 3U7DA 1WYWB 1H8CA 3KVFB 4G0NB 1LM8B 3ZTCA 4W9KA 4IW0A 2MLBA 4WJNA 2L7RA 2MWSB 4ICVA 2KQSA 3HHMA 3KH0A 3H6NA 3ZO5B 2ZEQA 1WR6E 3H9DA 2KQ7A 2ZNVC 5GMVA 2MCNB 4WWOA 4FBJB 3TMPB 2DZIA 2JVCA 2Z59B 3ZW3A 2RR9A 4PYZA 3L08A 1S3SG 2KX3A 2BPSA 4BOZB 2D07B 4MEMA 5AZHA 2KDEB 3AULA 4DBGA 1WY8A 1M94A 2MBBB 1BT0A 3L13A 4IWOA 4W9EA 3UQBA 3ZKJC 1Z2MA 2KC2A 3LDZE 3RZWC 4F8CB 4IC7B 4AP4C 4AOFA 4G3XB 2EKEC 3DVGY 2MW5A 2DX5B 4NY0A 3VUXA 1CMXB 2ZVNA 2GBMA 4ZDVA 3M62B 1WIAA 2G4SA 2KO3A 4GU2A 3X23A 1XT9B 2WYQA 2YVCA 2A4ZA 5DPWA 1NDDA 1UH6A 5D2MB 2KTRB 4EEWA 5J2RA 3OAWA 3ENEA 3JW0X 4GGQA 1Q0WB 1WF9A 2M1MA 2XK5B 2MBHA 3UINB 4CHKA 5AZFA 2BKFA 4RM8A 4GN1A 5HKHA 5E6OA 1KM7A 3MJWA 4NPNA 5CHFA 2XBBC 1FXTB 4WQOB 1WXVA 2JT4B 2MP2A 3WALA 2LVOA 3IHPC 3A1QA 3QC8B 4XX5A 2LASA 2K8HA 2KANA 4IWPA 2IO1B 3SDLC 2ZNVB 1SE9A 1YJ1A 1UBQA 3A9KB 4GOCA 3QHTA 2BYFA 3ZRCA 4TUUA 1LFDA 1E8XA 3ALBA 3H7SA 1V9JA 4II3B 2FIDA 1LQBA 3JSVB 2AEHA 3ML9A 1V2YA 1WGRA 1ZGUB 2KX0A 2NCNA 1J8CA 2NPTB 3VTVA 1WJUA 3MHSD 1E5WA 3ZUNA 2J0MA 2IZVB 4GB9A 3QWZB 3WAPA 4KIKA 3R3MA 1C3TA 2IO0B 2CHZA 4FJVB 4GDLB 2AL3A 3NHEB 2PE9A 3NOBA 1WMHA 2HE7A 3H7PB 4MELA 2LRUA 4CO7A 5DPRA 4ANUA 3QCAA 4YL8A 4E74A 3AU4A 1P3QU 3RUIB 4P7IA 5FR6A 4ANVA 2MA9B 4FLHA 1WGHA 1WZ0A 5C23A 1YX6B 2A5UA 4EFOA 2O6VB 2ZCBA 2FNJB 3AI5A 3OJ3A 3RT3B 3ZRFA 2NBVB 4HPMB 3VH4B 3W1SA 3ZDMC 4KSLC 4PS7A 2FAZA 3W1YA 2PE6B 3GOEA 2RGFA 4ZRIA 5G55A 2LGDA 3U30A 4BKGA 1R4NI 2MQJA 1P9DU 1WX7A 2DHZA 3QK0A 3A4SC 4FULA 3DBSA 2IBIB 4KV2A 2DYMA 2PPHA 2CHWA 2KTRA 4BBNF 2JWZA 1YD8U 2NBWB 4MDKE 2XK5A 1WH3A 4MGYE 1PQSA 4E3CA 4FHJA 3RULA 4M8MA 2L00B 3VH3B 3CMMB 2KJ6A 4HCPB 1V5TA 2KWVB 1WGDA 2IYDB 4EZJA 4G11A 4NNJB 3U8ZA 4E71A 5BO4B 4DK5A 2LI5A 2JY6A 3V60A 4LCDE 2J0KA 4MJSB 4GSWA 2C7NB 2JRIB 2ZPYA 3VUWA 2V3SA 1P98A 4HXDA 3WA0A 4NQKE 1TBEA 4B9KA 5J18A 2KDFB 3N32A 4W9GA 3JSVA 2KFJA 3Q3JA 5IAAC 3WAMA 1WE7A 1Z5SB 2NPTA 2N1WA 4DDGD 3VAWA 1IYFA 2LJ5A 2C7MB 2PJHA 4HK2A 4F1SA 3AXCA 1RRBA 2NBUA 2LUEA 4LJPB 4BBNC 1R4MI 2JZ3B 2K25A 1QZEA 4AUQC 2GMIC 2RSUA 3PZDA 3DPDA 3UIOB 5LXIB 4AJWA 4JQWC 1MG8A 2HTHA 3EFUA 1OQYA 4HVBA 2O2VA 3I3TB 1ISNA 1UZXB 1WGGA 2JPHA 2ZJDA 4NJ7A 3L0WB 2L3ZA 2GOWA 1RAXA 5CTRC 1V80A 4ZRKA 4I6LB 1J0GA 1X1MA 3GZNI 4OVVA 3QAQA 1OGWA 4XC2A 1S1QB 2CS4A 1Y8RC 4DHJB 5D94A 3HM6X 1H4RA 2BYVE 1WJNA 4W9LA 3EECA 4DDID 1E8YA 1HE8A 5LLIA 4M8NA 1WJ6A 4EZLA 3NZSA 3APCA 1NBFC 2FIFA 1E90A 2KZRA 1UELA 1WX9A 3IFWB 4IUMB 3IBEA 3CF6E 3Q3FA 2G4DB 4TKNA 3UGBB 4JL9A 4K7UA 1T0YA 3RZFA 1E7VA 2LD9A 4II2B 2L76A 2KWCA 2R2OA 2V1YA 4GDKB 4K81A 3OJ4B 4RM9A 3RYTA 4WWNA 1E8WA 3NS8A 3CSTA 1OTRB 2RD0A 3HM3A 2PEAA 3DDCB 3ECIA 3QQ8B 1WXAA 4W9HA 5JHBA 1WXSA 1JRUA 2GBKA 2I1KA 2REXA 1J19A 1VD2A 1WFYA 3A9JB 1WX8A 4MGKE 5E6PA 4ASWC 1WM3A 5C1ZA 5LXHA 4MJSA 2AYOB 4EKUA 2JXXA 2DZKA 1OEYJ 3R7QA 2KK8A 2D10A 1V5OA 3HK0A 4G50A 2BF8B 3DBHI 2LVQA 4WWPA 3VTWA 4CYEA 4IM2A 2YLMA 2LZ6A 2LRWA 1WGYA 1V49A 1GC7A 3AU5A 3MTNB 5EDSA 3ML8A 3HIZA 3KW5B 3ZLZA 2JF5A 2Z0DB 3PV1A 3T9LA 3ZTDA 3WIMA 5D7GA 3IG3A 2OOBB 1SIFA 3PREA 4PS8A 3KYDD 1UBIA 3BY4B 2AL6A 1OEYA 3M63B 2GBJA 3PRPB 4LJOB 3N3KB 3ZNZB 3ZIMA 4HDQA 1GJZA 2C5LC 2I1JA 4OVUA 2BWFA 3WAOA 1EF1A 1P1AA 4ZRJA 2M4NA 3RCZA 3OLMD 3WANA 3QX1A 4J6IA 4FJZA 4FHKA 3QJZA 4TV3A 2MBEA 2KJRA 2DAJA 2KHWB 2DZJA 2ZPNA 1F9JA 2K8CA 3L10B 3P2BA 4LDTB 2N9XA 3PLUA 4A20A 1WI0A 3M3JA 1WJ4A 2KOXA 1V81A 4HDOA 2G45B 5CHWA 3VTUA 2KLCA 3PRZA 2FCSA 2HD5B 3T8MA 3UIPB 1YQBA 3UF8A 4ZYNA 1TZ1A 2KDIA 4AWJA 2KD0A 3DQVA 2RPQA 3DOWA 2J7QB 4MSMB 3PGEA 2M17A 4HJKA 2N7EA 3O65B 1EO6A 2OJRA 3VXWA 3CSFA 1TGZB 4X57B 2C7HA 1LXDA 1WR1A 2CKHB 2NS5A 4AJYB 4NQLB 3IVFA 3VQIA 3A9KA 3N30A 4NAWB 2CHXA 2WX0A 3V62A 3W1SC 3VHTC 2MBOA 2WX1A 2MP2B 3L17A 2GBRA 2C60A 3H1UA 1TTNA 4BVUC 1NI2A 5J17A 4KZCA 4URKA 5L95C 2KVRA 2KC1A 4ANXA 3KUZA 1GUAB 2N9EB 3L16A 5JZEB 2IO2B 2V4LA 3R66C 4KDLB 2DAFA 1L2NA 1ZW7A 1Q5WB 2R2QA 2WWZA 1K8RB 4GDLA 2FCNA 2KFKB 3QARA 4BOSC 4FN2A 3H7PA 4HLEA 4GMVA 1P0RA 2DZMA 4HWIB 3V61A 4IM3A 5JH5C 3QA8A 3VDZA 1WXMA 4WJQA 4A3PA 1IPGA 4KIKB 1WE6A 2UYZB 4EOYA 4TQ1A 1KLVA 2BWES 2D2QA 4KVGB 2O6VA 1WMHB 3ZDTA 4W9FA 4DWFA 4A3OA 3KUCB 4KZ0A 2KMAA 2C9WB 2M8SA 4MH0E 2BYEA 5DCNA 2NR2A 4W9DA 4DHZE 2MRPA 2LGYA 3DCGA 3TIXA 1KOTA 2LXAA 2QHOA 4WJOA 2Y5BB 3QIJA 3NY5A 4TQ0A 4WJPA 2HJ8A 3D32A 4JLCA 3ZNID 4M0WB 4W9JA 3L54A 5L83A 1Q1OA 5DPSA 5AEKB 1YX5B 3JVZX 5KHOA 4PYUA 4DHZB 2JRHA 3TCAA 1V86A 2M0XA 3B1LX 2O6VD 1EF5A 3DVNV 1G6JA 2VRRB 2JUOA 3V6CB 3SU8X 1V6EA 2IY0B 2IY1B 5TR5A 5KHQA 2ZCCA 2MX2A 3ZNHB 1D3ZA 4LDTD 3APDA 4F7ZA 2MSED 2KDBA 4GXBA 4NAWA 5DPTA 3S2AA 3UQAA 2IO3B 2KTFA 5IA7A 3C0RB 4GIVA 4IWQA 3ONSA 2FCMA 3KYCD 1KJTA 2EMSA 3DVNU 5AZGA 4MGZE 5E6NA 2N7DA 2KWUB 4BKTA 4W9IA 3X0WA 3PTFC 2CR5A 3LJ3A 4I6NB 2D11A 4XZ4A 4ANWA 3ZNGC 2J0JA 4N9F4 4HPLB 4BKSA 2LGXA 4DXAB 4B95A 4EZKA 2UWQA 3PHWB 1YIWA 2KFKA 1WM2A 2CU1A 2GBNA 4HCNB 4B6WA 4K7WA 3ZVVA 4BFRA 2G3QB 1E8ZA 4KSKC 2KNBA 2KXJA 3A4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICU A;  5D6J B;  1UD7 A;  1A5R A;  2FUH B;  1E7U A;  1ZKH A;  3K9O B;  4FJY A;  4PS3 A;  2N4F A;  3K9P B;  5JHA A;  3PT2 B;  4FAD A;  4MGI E;  1EUV B;  1XQQ A;  3PS6 A;  3B08 A;  2O2V B;  2XEW A;  5CHV C;  1AAR A;  3B0A A;  1VCB A;  3RD2 A;  3TL5 A;  3PHX B;  4BKS D;  4JGH B;  3TBL D;  2Z0E B;  3A33 B;  3NZU A;  4EUT A;  1XD3 B;  2KKC A;  5G2N A;  3PVL A;  2LXC A;  3PPA A;  2BKR B;  3M95 A;  3TJP A;  1C1Y B;  1GG3 A;  4K1R B;  2ZZP B;  2DYB A;  2K1F A;  2NVU I;  4RMA A;  4W9C A;  1SGH A;  1I35 A;  3PSE B;  2KN5 A;  2FCQ A;  3DBL I;  4GDK A;  3R7R A;  1U4A A;  2JZZ A;  2D3G A;  2WDT B;  1UGM A;  1L7Y A;  2K39 A;  3BIN A;  3SHQ A;  4DHJ D;  2LVP A;  2ASQ A;  2MBQ A;  3V6E B;  3PLV A;  4KDI C;  4MM3 A;  2L0T A;  3APF A;  3EC8 A;  2L8J A;  3A9J A;  2L0F A;  2DYO A;  1RFA A;  3SD5 A;  3A1Q B;  2N1V A;  3PRM B;  4WAA A;  1GC6 A;  5CX3 A;  2KMC A;  2KJH B;  1RLF A;  2B3A A;  2ZVO A;  4JIO U;  4K7S A;  2K6D B;  2LWP A;  2W9N A;  2N9P C;  3VVW B;  1GNU A;  4MSQ B;  3EHV A;  2DEN B;  2BGF A;  3DBR I;  3DVG X;  2L05 A;  4IM0 A;  1I42 A;  1IP9 A;  1WZ3 A;  2EMT A;  4FA6 A;  2AWT A;  1WRD B;  4I6P A;  4NJ6 A;  3JYU A;  3VFK A;  4IG7 B;  3KUD B;  3VUY A;  2K8B A;  2K6Q A;  2KLG A;  3U7D A;  1WYW B;  1H8C A;  3KVF B;  4G0N B;  1LM8 B;  3ZTC A;  4W9K A;  4IW0 A;  2MLB A;  4WJN A;  2L7R A;  2MWS B;  4ICV A;  2KQS A;  3HHM A;  3KH0 A;  3H6N A;  3ZO5 B;  2ZEQ A;  1WR6 E;  3H9D A;  2KQ7 A;  2ZNV C;  5GMV A;  2MCN B;  4WWO A;  4FBJ B;  3TMP B;  2DZI A;  2JVC A;  2Z59 B;  3ZW3 A;  2RR9 A;  4PYZ A;  3L08 A;  1S3S G;  2KX3 A;  2BPS A;  4BOZ B;  2D07 B;  4MEM A;  5AZH A;  2KDE B;  3AUL A;  4DBG A;  1WY8 A;  1M94 A;  2MBB B;  1BT0 A;  3L13 A;  4IWO A;  4W9E A;  3UQB A;  3ZKJ C;  1Z2M A;  2KC2 A;  3LDZ E;  3RZW C;  4F8C B;  4IC7 B;  4AP4 C;  4AOF A;  4G3X B;  2EKE C;  3DVG Y;  2MW5 A;  2DX5 B;  4NY0 A;  3VUX A;  1CMX B;  2ZVN A;  2GBM A;  4ZDV A;  3M62 B;  1WIA A;  2G4S A;  2KO3 A;  4GU2 A;  3X23 A;  1XT9 B;  2WYQ A;  2YVC A;  2A4Z A;  5DPW A;  1NDD A;  1UH6 A;  5D2M B;  2KTR B;  4EEW A;  5J2R A;  3OAW A;  3ENE A;  3JW0 X;  4GGQ A;  1Q0W B;  1WF9 A;  2M1M A;  2XK5 B;  2MBH A;  3UIN B;  4CHK A;  5AZF A;  2BKF A;  4RM8 A;  4GN1 A;  5HKH A;  5E6O A;  1KM7 A;  3MJW A;  4NPN A;  5CHF A;  2XBB C;  1FXT B;  4WQO B;  1WXV A;  2JT4 B;  2MP2 A;  3WAL A;  2LVO A;  3IHP C;  3A1Q A;  3QC8 B;  4XX5 A;  2LAS A;  2K8H A;  2KAN A;  4IWP A;  2IO1 B;  3SDL C;  2ZNV B;  1SE9 A;  1YJ1 A;  1UBQ A;  3A9K B;  4GOC A;  3QHT A;  2BYF A;  3ZRC A;  4TUU A;  1LFD A;  1E8X A;  3ALB A;  3H7S A;  1V9J A;  4II3 B;  2FID A;  1LQB A;  3JSV B;  2AEH A;  3ML9 A;  1V2Y A;  1WGR A;  1ZGU B;  2KX0 A;  2NCN A;  1J8C A;  2NPT B;  3VTV A;  1WJU A;  3MHS D;  1E5W A;  3ZUN A;  2J0M A;  2IZV B;  4GB9 A;  3QWZ B;  3WAP A;  4KIK A;  3R3M A;  1C3T A;  2IO0 B;  2CHZ A;  4FJV B;  4GDL B;  2AL3 A;  3NHE B;  2PE9 A;  3NOB A;  1WMH A;  2HE7 A;  3H7P B;  4MEL A;  2LRU A;  4CO7 A;  5DPR A;  4ANU A;  3QCA A;  4YL8 A;  4E74 A;  3AU4 A;  1P3Q U;  3RUI B;  4P7I A;  5FR6 A;  4ANV A;  2MA9 B;  4FLH A;  1WGH A;  1WZ0 A;  5C23 A;  1YX6 B;  2A5U A;  4EFO A;  2O6V B;  2ZCB A;  2FNJ B;  3AI5 A;  3OJ3 A;  3RT3 B;  3ZRF A;  2NBV B;  4HPM B;  3VH4 B;  3W1S A;  3ZDM C;  4KSL C;  4PS7 A;  2FAZ A;  3W1Y A;  2PE6 B;  3GOE A;  2RGF A;  4ZRI A;  5G55 A;  2LGD A;  3U30 A;  4BKG A;  1R4N I;  2MQJ A;  1P9D U;  1WX7 A;  2DHZ A;  3QK0 A;  3A4S C;  4FUL A;  3DBS A;  2IBI B;  4KV2 A;  2DYM A;  2PPH A;  2CHW A;  2KTR A;  4BBN F;  2JWZ A;  1YD8 U;  2NBW B;  4MDK E;  2XK5 A;  1WH3 A;  4MGY E;  1PQS A;  4E3C A;  4FHJ A;  3RUL A;  4M8M A;  2L00 B;  3VH3 B;  3CMM B;  2KJ6 A;  4HCP B;  1V5T A;  2KWV B;  1WGD A;  2IYD B;  4EZJ A;  4G11 A;  4NNJ B;  3U8Z A;  4E71 A;  5BO4 B;  4DK5 A;  2LI5 A;  2JY6 A;  3V60 A;  4LCD E;  2J0K A;  4MJS B;  4GSW A;  2C7N B;  2JRI B;  2ZPY A;  3VUW A;  2V3S A;  1P98 A;  4HXD A;  3WA0 A;  4NQK E;  1TBE A;  4B9K A;  5J18 A;  2KDF B;  3N32 A;  4W9G A;  3JSV A;  2KFJ A;  3Q3J A;  5IAA C;  3WAM A;  1WE7 A;  1Z5S B;  2NPT A;  2N1W A;  4DDG D;  3VAW A;  1IYF A;  2LJ5 A;  2C7M B;  2PJH A;  4HK2 A;  4F1S A;  3AXC A;  1RRB A;  2NBU A;  2LUE A;  4LJP B;  4BBN C;  1R4M I;  2JZ3 B;  2K25 A;  1QZE A;  4AUQ C;  2GMI C;  2RSU A;  3PZD A;  3DPD A;  3UIO B;  5LXI B;  4AJW A;  4JQW C;  1MG8 A;  2HTH A;  3EFU A;  1OQY A;  4HVB A;  2O2V A;  3I3T B;  1ISN A;  1UZX B;  1WGG A;  2JPH A;  2ZJD A;  4NJ7 A;  3L0W B;  2L3Z A;  2GOW A;  1RAX A;  5CTR C;  1V80 A;  4ZRK A;  4I6L B;  1J0G A;  1X1M A;  3GZN I;  4OVV A;  3QAQ A;  1OGW A;  4XC2 A;  1S1Q B;  2CS4 A;  1Y8R C;  4DHJ B;  5D94 A;  3HM6 X;  1H4R A;  2BYV E;  1WJN A;  4W9L A;  3EEC A;  4DDI D;  1E8Y A;  1HE8 A;  5LLI A;  4M8N A;  1WJ6 A;  4EZL A;  3NZS A;  3APC A;  1NBF C;  2FIF A;  1E90 A;  2KZR A;  1UEL A;  1WX9 A;  3IFW B;  4IUM B;  3IBE A;  3CF6 E;  3Q3F A;  2G4D B;  4TKN A;  3UGB B;  4JL9 A;  4K7U A;  1T0Y A;  3RZF A;  1E7V A;  2LD9 A;  4II2 B;  2L76 A;  2KWC A;  2R2O A;  2V1Y A;  4GDK B;  4K81 A;  3OJ4 B;  4RM9 A;  3RYT A;  4WWN A;  1E8W A;  3NS8 A;  3CST A;  1OTR B;  2RD0 A;  3HM3 A;  2PEA A;  3DDC B;  3ECI A;  3QQ8 B;  1WXA A;  4W9H A;  5JHB A;  1WXS A;  1JRU A;  2GBK A;  2I1K A;  2REX A;  1J19 A;  1VD2 A;  1WFY A;  3A9J B;  1WX8 A;  4MGK E;  5E6P A;  4ASW C;  1WM3 A;  5C1Z A;  5LXH A;  4MJS A;  2AYO B;  4EKU A;  2JXX A;  2DZK A;  1OEY J;  3R7Q A;  2KK8 A;  2D10 A;  1V5O A;  3HK0 A;  4G50 A;  2BF8 B;  3DBH I;  2LVQ A;  4WWP A;  3VTW A;  4CYE A;  4IM2 A;  2YLM A;  2LZ6 A;  2LRW A;  1WGY A;  1V49 A;  1GC7 A;  3AU5 A;  3MTN B;  5EDS A;  3ML8 A;  3HIZ A;  3KW5 B;  3ZLZ A;  2JF5 A;  2Z0D B;  3PV1 A;  3T9L A;  3ZTD A;  3WIM A;  5D7G A;  3IG3 A;  2OOB B;  1SIF A;  3PRE A;  4PS8 A;  3KYD D;  1UBI A;  3BY4 B;  2AL6 A;  1OEY A;  3M63 B;  2GBJ A;  3PRP B;  4LJO B;  3N3K B;  3ZNZ B;  3ZIM A;  4HDQ A;  1GJZ A;  2C5L C;  2I1J A;  4OVU A;  2BWF A;  3WAO A;  1EF1 A;  1P1A A;  4ZRJ A;  2M4N A;  3RCZ A;  3OLM D;  3WAN A;  3QX1 A;  4J6I A;  4FJZ A;  4FHK A;  3QJZ A;  4TV3 A;  2MBE A;  2KJR A;  2DAJ A;  2KHW B;  2DZJ A;  2ZPN A;  1F9J A;  2K8C A;  3L10 B;  3P2B A;  4LDT B;  2N9X A;  3PLU A;  4A20 A;  1WI0 A;  3M3J A;  1WJ4 A;  2KOX A;  1V81 A;  4HDO A;  2G45 B;  5CHW A;  3VTU A;  2KLC A;  3PRZ A;  2FCS A;  2HD5 B;  3T8M A;  3UIP B;  1YQB A;  3UF8 A;  4ZYN A;  1TZ1 A;  2KDI A;  4AWJ A;  2KD0 A;  3DQV A;  2RPQ A;  3DOW A;  2J7Q B;  4MSM B;  3PGE A;  2M17 A;  4HJK A;  2N7E A;  3O65 B;  1EO6 A;  2OJR A;  3VXW A;  3CSF A;  1TGZ B;  4X57 B;  2C7H A;  1LXD A;  1WR1 A;  2CKH B;  2NS5 A;  4AJY B;  4NQL B;  3IVF A;  3VQI A;  3A9K A;  3N30 A;  4NAW B;  2CHX A;  2WX0 A;  3V62 A;  3W1S C;  3VHT C;  2MBO A;  2WX1 A;  2MP2 B;  3L17 A;  2GBR A;  2C60 A;  3H1U A;  1TTN A;  4BVU C;  1NI2 A;  5J17 A;  4KZC A;  4URK A;  5L95 C;  2KVR A;  2KC1 A;  4ANX A;  3KUZ A;  1GUA B;  2N9E B;  3L16 A;  5JZE B;  2IO2 B;  2V4L A;  3R66 C;  4KDL B;  2DAF A;  1L2N A;  1ZW7 A;  1Q5W B;  2R2Q A;  2WWZ A;  1K8R B;  4GDL A;  2FCN A;  2KFK B;  3QAR A;  4BOS C;  4FN2 A;  3H7P A;  4HLE A;  4GMV A;  1P0R A;  2DZM A;  4HWI B;  3V61 A;  4IM3 A;  5JH5 C;  3QA8 A;  3VDZ A;  1WXM A;  4WJQ A;  4A3P A;  1IPG A;  4KIK B;  1WE6 A;  2UYZ B;  4EOY A;  4TQ1 A;  1KLV A;  2BWE S;  2D2Q A;  4KVG B;  2O6V A;  1WMH B;  3ZDT A;  4W9F A;  4DWF A;  4A3O A;  3KUC B;  4KZ0 A;  2KMA A;  2C9W B;  2M8S A;  4MH0 E;  2BYE A;  5DCN A;  2NR2 A;  4W9D A;  4DHZ E;  2MRP A;  2LGY A;  3DCG A;  3TIX A;  1KOT A;  2LXA A;  2QHO A;  4WJO A;  2Y5B B;  3QIJ A;  3NY5 A;  4TQ0 A;  4WJP A;  2HJ8 A;  3D32 A;  4JLC A;  3ZNI D;  4M0W B;  4W9J A;  3L54 A;  5L83 A;  1Q1O A;  5DPS A;  5AEK B;  1YX5 B;  3JVZ X;  5KHO A;  4PYU A;  4DHZ B;  2JRH A;  3TCA A;  1V86 A;  2M0X A;  3B1L X;  2O6V D;  1EF5 A;  3DVN V;  1G6J A;  2VRR B;  2JUO A;  3V6C B;  3SU8 X;  1V6E A;  2IY0 B;  2IY1 B;  5TR5 A;  5KHQ A;  2ZCC A;  2MX2 A;  3ZNH B;  1D3Z A;  4LDT D;  3APD A;  4F7Z A;  2MSE D;  2KDB A;  4GXB A;  4NAW A;  5DPT A;  3S2A A;  3UQA A;  2IO3 B;  2KTF A;  5IA7 A;  3C0R B;  4GIV A;  4IWQ A;  3ONS A;  2FCM A;  3KYC D;  1KJT A;  2EMS A;  3DVN U;  5AZG A;  4MGZ E;  5E6N A;  2N7D A;  2KWU B;  4BKT A;  4W9I A;  3X0W A;  3PTF C;  2CR5 A;  3LJ3 A;  4I6N B;  2D11 A;  4XZ4 A;  4ANW A;  3ZNG C;  2J0J A;  4N9F 4;  4HPL B;  4BKS A;  2LGX A;  4DXA B;  4B95 A;  4EZK A;  2UWQ A;  3PHW B;  1YIW A;  2KFK A;  1WM2 A;  2CU1 A;  2GBN A;  4HCN B;  4B6W A;  4K7W A;  3ZVV A;  4BFR A;  2G3Q B;  1E8Z A;  4KSK C;  2KNB A;  2KXJ A;  3A4R A; 
#chains in the Genus database with same CATH topology
 4YTP B;  2WXK A;  4LK0 M;  3B9J A;  3AEF B;  4FJY A;  3MP9 A;  2N4F A;  4PS3 A;  3K9P B;  4FAD A;  4MGI E;  3B2G A;  2XEW A;  1SSN A;  1AAR A;  1Q10 A;  3PHX B;  4DXF A;  4BKS D;  1C4P A;  3OWE B;  5G2N A;  3PVL A;  2BKR B;  3M95 A;  3TJP A;  1C1Y B;  4C00 A;  3PZ7 A;  4K1R B;  2ZZP B;  2K1F A;  2OJW A;  4BAX A;  4W9C A;  1IBX B;  3PSE B;  1FCC C;  2FCQ A;  2JZZ A;  3TSS A;  1FCL A;  2KWD A;  1N61 A;  3AE1 B;  2K39 A;  3KLS X;  3SHQ A;  2ASQ A;  1ROE A;  3APF A;  1B9R A;  1RWS A;  2L0F A;  2DYO A;  4WAA A;  2KMC A;  4K7S A;  2J52 A;  4NJC A;  3VVW B;  3AE9 B;  2L05 A;  4IM0 A;  1I42 A;  2EMT A;  1NEN B;  4FA6 A;  1WRD B;  4I6P A;  4KKI A;  4NJ6 A;  3JYU A;  2WXI A;  3AN1 A;  3VFK A;  4IG7 B;  4PT5 A;  4US8 A;  3KVF B;  3N20 C;  1D5Z C;  2MLB A;  3KWV A;  4JWU C;  2MWS B;  3HHM A;  3AE3 B;  4HJG E;  3NUH B;  2QJL A;  3H9D A;  4C56 C;  3DWG C;  3ZW3 A;  2MJD A;  4YTM B;  1S3S G;  2KX3 A;  2WXN A;  2PVG C;  4MEM A;  2K5P A;  3UQB A;  2MBB B;  1A5R A;  3ZKJ C;  1PDX A;  4IC7 B;  4AP4 C;  2N9L A;  5I4D A;  1FNV A;  1FFV A;  4NY0 A;  1F1H A;  3LYY A;  2KDM A;  4GU2 A;  1XT9 B;  2YVC A;  1KRH A;  4YWG G;  1L0X B;  1EWY C;  1NDD A;  5J2R A;  3MJ5 A;  3JW0 X;  5T8I A;  1Q0W B;  2XK5 B;  3UIN B;  5AZF A;  4RM8 A;  1UUP A;  5E6O A;  4NPN A;  3AE7 B;  3NVW A;  2M19 A;  2JT4 B;  5FR3 A;  1JRO A;  3WAL A;  1I4P A;  2LVO A;  3QC8 B;  2K8H A;  2IO1 B;  4XGA B;  3SDL C;  2ZNV B;  1YJ1 A;  4GOC A;  1UBQ A;  2BYT A;  4TUU A;  1E8X A;  1V9J A;  2B76 B;  2KT7 A;  1WGR A;  1J8C A;  4WQM A;  2NPT B;  1GOZ A;  3MC9 A;  4KIK A;  4OZB A;  4FJV B;  2AL3 A;  3NHE B;  1TJE A;  5IO9 A;  3NOB A;  2LRU A;  4CO7 A;  4YL8 A;  4E74 A;  1QF6 A;  2DWQ A;  3AU4 A;  2BQQ A;  2D3A A;  2MA9 B;  1QLB B;  3GB1 A;  3T3O A;  2M0A A;  1YX6 B;  5FKA C;  3W5U B;  2VH1 A;  4EFO A;  2O6V B;  3E56 A;  3RT3 B;  3ZRF A;  3VH4 B;  3W1S A;  4LNN A;  4KSL C;  2JX5 A;  1EM7 A;  2LHD A;  5G55 A;  3U30 A;  2LGD A;  4BKG A;  1R4N I;  4L1B A;  1P9D U;  3AH7 A;  5HHD G;  1PFD A;  2DHZ A;  2IBI B;  4KV2 A;  2XK5 A;  3P4R B;  1PQS A;  1YN3 A;  3VH3 B;  3CMM B;  3ZXR A;  1WGD A;  1EU3 A;  1TS2 A;  2KYW A;  4G11 A;  1JCK B;  3I63 C;  4NNJ B;  3NS1 A;  1TKY A;  4LCD E;  4GSW A;  1TS4 A;  2ZPY A;  4HXD A;  1J7C A;  3Q3J A;  3WAM A;  1Z5S B;  2NPT A;  3HVD A;  3DWM A;  2NBU A;  4BBN C;  4C4V B;  2MJ3 A;  4TSS A;  1MG8 A;  3T3N A;  1OQY A;  2O2V A;  3I3T B;  2IPK D;  3Q3O C;  1RAX A;  2LMC A;  1V80 A;  3BVG A;  2JXT A;  4DDI D;  5LLI A;  2QCZ A;  3RNA C;  1JRP A;  1WJ6 A;  2WXF A;  2KZR A;  3CIR B;  3VRB B;  4TKN A;  3RZF A;  1OQR A;  2LD9 A;  2MJE A;  4K81 A;  4YSY B;  1I4R A;  4WWN A;  1AW7 A;  2WXR A;  4C7Z A;  3AEA B;  1UNS A;  3ECI A;  2WDV B;  5JHB A;  2WXQ A;  1WXS A;  2GBK A;  2REX A;  5E6P A;  4ASW C;  1WM3 A;  5C1Z A;  2JXX A;  1WRI A;  4G50 A;  1JWB D;  2WHI A;  4CYE A;  4IM2 A;  4FXC A;  1V8C A;  3ZJT A;  1GC7 A;  1TY0 A;  3ZLZ A;  2EEL A;  4C4V A;  5EE1 A;  2OOB B;  4PS8 A;  5H92 C;  3BY4 B;  3RN9 C;  1OEY A;  4LJO B;  2GBJ A;  3ZNZ B;  1GJZ A;  4OVU A;  3U7Z A;  4ZRJ A;  1NYR A;  2KQ4 X;  4UDU C;  3WAN A;  2IJ0 A;  3TEY A;  4J6I A;  2ICI A;  1AYF A;  1UGJ A;  3P2B A;  2KJR A;  2DZJ A;  4LDT B;  1TZO A;  3VR9 B;  3PLU A;  3AE6 B;  3M3J A;  1V81 A;  2G45 B;  5CHW A;  3VTU A;  3PRZ A;  4C80 A;  2HD5 B;  4ZYN A;  1FIQ A;  1TZ1 A;  1ZE3 D;  5BYR A;  4HJK A;  1WSP A;  3O65 B;  1VJK A;  3CSF A;  3SFE B;  1PGA A;  1YJJ A;  4NQL B;  3TEZ A;  4P16 A;  1SE2 A;  2MBO A;  2WX1 A;  2MP2 B;  1KLG D;  2GBR A;  2C60 A;  3AB5 A;  2TSS A;  1VDV A;  3N9Y C;  3I9V 1;  2Q5W D;  4KGT A;  1FXA A;  3RNG C;  2KVR A;  3BVM A;  4ANX A;  5JZE B;  2IO2 B;  3R66 C;  1L2N A;  2L83 A;  1K8R B;  1E10 A;  4HLE A;  3H7P A;  4GMV A;  2DZM A;  4HWI B;  3V61 A;  4WJQ A;  1IPG A;  3BYY B;  3SR6 A;  1B1Z A;  4JE3 B;  1HQR D;  3ZDT A;  2L32 A;  3KWL A;  5BYQ A;  2C9W B;  3AE8 B;  4W9D A;  1L0Y B;  1KOT A;  1FNU A;  3MFG A;  4XYC A;  3MHZ A;  4WJP A;  4BZA A;  4JLC A;  4M0W B;  1YX5 B;  3RMK C;  1V86 A;  5BMI A;  2VRR B;  2IY0 B;  4MM3 B;  5KHQ A;  1FM0 D;  4AQ7 A;  4F7Z A;  2MSE D;  3S2A A;  1IGC A;  4OHJ A;  2WS3 B;  4WIP A;  4IWQ A;  2FCM A;  3KYC D;  3E9S A;  5E6N A;  3Q8E A;  2N7D A;  1V1O A;  2J0J A;  2GI9 A;  4EZK A;  1WM2 A;  2JWU A;  4JWS C;  1C79 A;  1CK1 A;  4BFR A;  1SJE D;  1E8Z A;  1UF0 A;  2KXJ A;  3A4R A;  1UD7 A;  1E7U A;  3ZYY X;  1JQ4 A;  3GP7 A;  1EUV B;  3PS6 A;  4A90 A;  2JYT A;  3UI3 A;  4JGH B;  2Z0E B;  3A33 B;  4CQN A;  1GG3 A;  4RMA A;  3C19 A;  5C3J B;  5JXV A;  1I35 A;  2KN5 A;  3DBL I;  4GDK A;  1U4A A;  2N9K A;  1RYJ A;  3IT6 B;  1L7Y A;  4ARI A;  3BIN A;  3J9C A;  2LVP A;  3V6E B;  3PLV A;  4MM3 A;  2INP E;  4RF1 A;  2L0T A;  2L8J A;  2LHE A;  2N1V A;  5CX3 A;  1GC6 A;  1RLF A;  2B3A A;  4JIO U;  1GNU A;  3DBR I;  1WXQ A;  4XWT A;  2KLG A;  1WYG A;  2D5G A;  3ZTC A;  4W9K A;  4WJN A;  1HTQ A;  2L7R A;  2KQS A;  3H6N A;  3ZO5 B;  4DXG A;  2VZK D;  2WXP A;  2BVC A;  2XN9 C;  2CJO A;  2RR9 A;  1DOX A;  4PYZ A;  3L08 A;  2KDE B;  2BT6 A;  3AUL A;  3L13 A;  3N1X C;  2KC2 A;  1J7A A;  3DVG Y;  3EA6 A;  2DX5 B;  4OZC A;  2ZVN A;  2GBM A;  1WIA A;  3X23 A;  2IND C;  1UH6 A;  5D2M B;  4EEW A;  4XDC A;  3FIL B;  3ENE A;  1WF9 A;  2LGI A;  5HKH A;  2XBB C;  1FPY A;  1FXT B;  4WQO B;  1BXT A;  1FMA D;  1SBB B;  2JU6 X;  3IHP C;  3PO0 A;  1FRR A;  3GE3 C;  4IWP A;  3BYT B;  1SE9 A;  3QHT A;  1L6V A;  1LFD A;  3NVZ A;  3JSV B;  2AEH A;  3ML9 A;  1XLO A;  2KX0 A;  3MHS D;  2IZV B;  4GB9 A;  3QWZ B;  3R3M A;  5D3D A;  4YXD B;  4GDL B;  2PE9 A;  1WMH A;  2G1E A;  2ONQ A;  5DPR A;  3QCA A;  2IGH A;  3WCQ A;  1P3Q U;  1D5M C;  4P7I A;  4FLH A;  1K51 A;  1WGH A;  3ZGZ A;  2ZCB A;  3TEW A;  3AI5 A;  1QOB A;  4HPM B;  1XLN A;  3GZN B;  4JPS A;  1D4B A;  3BK1 A;  3W1Y A;  1SB3 C;  4ZRI A;  1YMH E;  2MQJ A;  2JZP A;  2JSV X;  2Y3A A;  3QK0 A;  1MFW A;  3A4S C;  2CHW A;  4BBN F;  1T6B X;  3NZ3 A;  1YD8 U;  4MGY E;  1PGX A;  4ZHP A;  4E3C A;  4FHJ A;  3RUL A;  4A9A A;  4ZRQ A;  1V5T A;  1ZOY B;  2WP9 B;  4EZJ A;  1HEZ E;  5BO4 B;  4DK5 A;  2JY6 A;  1GB1 A;  2MHJ A;  3VUW A;  2V3S A;  1P98 A;  4B9K A;  4A8X C;  4NQK E;  3RNF C;  1V1P B;  2KDF B;  3N32 A;  4W9G A;  3JSV A;  3R2T A;  2G9H D;  2KFJ A;  4DDG D;  1IYF A;  3DBH B;  2PJH A;  3RNB C;  4LNI A;  2LUE A;  1R4M I;  4US9 A;  2K3U A;  2K22 A;  1QZE A;  2GMI C;  1C9F A;  3OG5 A;  3UIO B;  5LXI B;  3IT4 B;  2HTH A;  3EFU A;  1UZX B;  3Q8F A;  2WXH A;  4NJ7 A;  3L0W B;  2L3Z A;  2GOW A;  5CTR C;  1I4G A;  2IDY A;  3NJT A;  1OQQ A;  3QAQ A;  2BS4 B;  3HM6 X;  1IBX A;  1ENF A;  1E8Y A;  1I4H A;  4MT5 A;  3Q8A A;  4M8N A;  3RNC C;  1NBF C;  1T3Q A;  3IFW B;  2J4X A;  3IBE A;  3Q6B A;  1E7V A;  2L76 A;  2KWC A;  1HXY D;  2V4I B;  1ZDV A;  1CZP A;  3RYT A;  1VZ8 A;  1OTR B;  1ET6 A;  2WXM A;  3HM3 A;  1WXA A;  4W9H A;  1N6Z A;  2PIA A;  2I1K A;  1WFY A;  3A9J B;  1SJH D;  1XXG A;  5G5G A;  4EKU A;  3R7Q A;  2VZK B;  1V5O A;  3HK0 A;  2LVQ A;  2LZ6 A;  2K9X A;  1C78 A;  1JAL A;  2LRW A;  3AU5 A;  3ML8 A;  2JF5 A;  3T9L A;  3ZTD A;  1E0Z A;  1RM6 C;  3WIM A;  5D7G A;  3IG3 A;  1KF6 B;  3PRE A;  3ZIM A;  1FFU A;  3M63 B;  2C5L C;  3SEB A;  1ZDX A;  3OLM D;  4FJZ A;  4FHK A;  3L10 B;  2DAJ A;  2K8C A;  2N0S B;  2PVO D;  2KDI A;  3DQV A;  3DOW A;  4MSM B;  2J7Q B;  2V9H A;  1N62 A;  4A55 A;  4ZOH C;  1EO6 A;  2OJR A;  3VXW A;  1L5P A;  1V97 A;  2CKH B;  3IVF A;  3W1S C;  3AEE B;  2PTL A;  2E6X A;  4B0E A;  4NZL B;  1ZP0 B;  2KMM A;  1YN5 A;  5EE3 A;  1GB4 A;  5J17 A;  3LB8 C;  1C4C A;  1GUA B;  2DNF A;  2N9E B;  2RMM A;  1ZW7 A;  2WWZ A;  1ZXH A;  2KFK B;  3QAR A;  3U52 E;  1VRA B;  1P0R A;  2YEP F;  4IM3 A;  5BYS A;  4XWW A;  4A3P A;  2BS2 B;  2L52 A;  1WE6 A;  4EOY A;  1XCT L;  4DQO C;  2BWE S;  2O6V A;  3NRZ A;  3AE5 B;  4W9F A;  4A3O A;  3KUC B;  4J3O D;  2KMA A;  2BYE A;  5DCN A;  1UWX A;  2NR2 A;  2MRP A;  2LGY A;  3DCG A;  1M4V A;  3TIX A;  1A70 A;  4IOI E;  1T0R C;  5AEK B;  3JVZ X;  5KHO A;  4PYU A;  4DHZ B;  1DYQ A;  1JML A;  1EF5 A;  3DVN V;  1G6J A;  3P63 A;  4P1C C;  4PK1 A;  1V6E A;  1TYG B;  1D3Z A;  1YNT E;  2KDB A;  1D5X C;  2KTF A;  5IA7 A;  1C77 A;  1QOG A;  2ON8 A;  4KKJ A;  1KJT A;  2KAC A;  4MGZ E;  2KWU B;  4BKT A;  4W9I A;  4KGS A;  3ZNG C;  4N9F 4;  4HPL B;  3AEB B;  5H8Y E;  4BKS A;  4B95 A;  3W5V B;  1YIW A;  2KFK A;  2GBN A;  4B6W A;  2G3Q B;  2KNB A;  1ZXI A;  5D6J B;  2FUH B;  1ZKH A;  1XQQ A;  3RPF C;  4GLS C;  2AX5 A;  3TL5 A;  1TKG A;  3TBL D;  3NZU A;  2KKC A;  3PPA A;  2IGG A;  1E9M A;  3V05 A;  1FEH A;  1NI3 A;  3W9C B;  4ITK A;  1T0S C;  1YN4 A;  4MAC A;  4P1B C;  2QMT A;  3CWI A;  2K0P A;  4RNA A;  1UGM A;  1XCQ L;  3O13 A;  4DHJ D;  4YSZ B;  1CJE A;  4YSX B;  2I38 A;  4KDI C;  3EC8 A;  3SD5 A;  2W3R A;  3PRM B;  1N5X A;  3IXS A;  1DOY A;  4K3B A;  2LWP A;  2W9N A;  2N9P C;  3EHV A;  1MG4 A;  1QKZ A;  2DEN B;  3AE4 B;  4ZYS A;  3FAH A;  3DVG X;  1WZ3 A;  2D3C A;  4OZA A;  2FE8 A;  2QIE B;  1MHX A;  3KUD B;  2SEB D;  3VUY A;  2DLB A;  2JYE A;  3U7D A;  1WYW B;  1KTK A;  5IP4 D;  1H8C A;  4G0N B;  1LM8 B;  1ACC A;  4IW0 A;  3KH0 A;  2KQ7 A;  1QOF A;  2MCN B;  2CJN A;  4WWO A;  2JVC A;  2XNA C;  3AEG B;  4R3D A;  1UWM A;  4BOZ B;  1M94 A;  4IWO A;  1DOI A;  1Z2M A;  2WQY B;  4RGO S;  3RZW C;  3TUO A;  4F8C B;  3ZJV A;  2WGS A;  4G3X B;  1D6E C;  2MW5 A;  1CMX B;  4ZDV A;  1RFK A;  2KO3 A;  4LNF A;  1N5W A;  3ETR A;  5DPW A;  1R4N B;  2ZW1 A;  2I2Y A;  3PZ8 A;  1FXI A;  4YTN B;  1KM7 A;  2LUM A;  1WXV A;  2MP2 A;  1QOA A;  3U2S C;  2LAS A;  2KAN A;  4HRS A;  3A9K B;  2BB6 A;  3KQ4 A;  3ALB A;  3H7S A;  4II3 B;  5IKC M;  2FID A;  3NG0 A;  1ET9 A;  1V2Y A;  2SAK A;  3VTV A;  1HA5 A;  1E5W A;  1C3T A;  4KGR A;  5IOI A;  1FO4 A;  4RFB A;  4MEL A;  4ANU A;  3AV8 A;  2W3S A;  5HG2 A;  3RUI B;  5FR6 A;  3C8Y A;  2NMQ A;  2NTS A;  1NEK B;  2A5U A;  3OJ3 A;  2NBV B;  4L23 A;  3ZDM C;  4PS7 A;  4M0W A;  3ABV B;  1SE4 A;  4K3C A;  1WX7 A;  2DYM A;  3AED B;  2FBW B;  2BBC A;  1WH3 A;  4M8M A;  1HZ5 A;  4HCP B;  2KJ6 A;  2KWV B;  4XDD A;  2QIL A;  4ZRP A;  2LEK A;  1L4D B;  1TS3 A;  4O1N A;  2E3T A;  2C7N B;  1XF5 L;  4H2A A;  5J18 A;  5IAA C;  4WUR A;  5HFY A;  2MEK A;  2C7M B;  4HK2 A;  2DBY A;  3AXC A;  2UU7 A;  2K25 A;  4AUQ C;  2RSU A;  4JQW C;  4RGN A;  4HVB A;  3DHG C;  1ISN A;  1WGG A;  2ZJD A;  1YQ3 B;  1WGK A;  3RFZ B;  3BZD B;  4YT0 B;  4D2K A;  1J0G A;  1QQR A;  1OGW A;  4XC2 A;  4B0M A;  1S1Q B;  2BB5 A;  3AM9 A;  2CS4 A;  1Y8R C;  4DHJ B;  5D94 A;  2H89 B;  1SEB D;  2BYV E;  4W9L A;  4RH6 A;  1HE8 A;  3NVY A;  4EZL A;  3APC A;  2FIF A;  3ZXV A;  1UEL A;  2KVZ A;  3CF6 E;  4K7U A;  1T0Y A;  2V1Y A;  4RGM A;  1I4Q A;  3NS8 A;  3CST A;  2HDE A;  1AWD A;  3QQ8 B;  1JRU A;  1QIL A;  1J19 A;  2BTE A;  2AYO B;  3B2F A;  2W82 A;  1OEY J;  2BF8 B;  1N60 A;  1Y56 A;  3URY A;  1AN8 A;  5EDS A;  5FK9 C;  3HIZ A;  3H8H A;  2Z0D B;  1SIF A;  2X8X X;  5IN7 A;  1UBI A;  3PRP B;  3N3K B;  4HDQ A;  1F2R I;  2I1J A;  1FD6 A;  2BWF A;  3WAO A;  3RI7 C;  1BUI C;  1P1A A;  2D3B A;  3QX1 A;  3QJZ A;  2MBE A;  1F9J A;  2N9X A;  4QAY A;  4A20 A;  1WI0 A;  1WJ4 A;  1IGD A;  4HDO A;  3I57 A;  4LNO A;  3FIL A;  1E7P B;  2FCS A;  1E6E B;  3UIP B;  1YQB A;  4N59 A;  4AWJ A;  2KD0 A;  1HTO A;  2RPQ A;  4HKZ E;  2HTM E;  1YJI A;  3HVZ A;  1ZUD 2;  4X57 B;  5MPO A;  2C7H A;  2GB1 A;  1LXD A;  2NS5 A;  4AJY B;  3MC0 B;  3VQI A;  2CHX A;  2WX0 A;  4ACF A;  4NAM A;  4S17 A;  3V62 A;  1YQ4 B;  2IGD A;  3L17 A;  2AQ3 B;  3H1U A;  4BVU C;  4KZC A;  3BVZ A;  5LNK 1;  3AMZ A;  5L95 C;  1FNW A;  3AE2 B;  1F77 A;  2KC1 A;  4Q2J A;  3L16 A;  2V4L A;  3FC4 A;  2DAF A;  1Q5W B;  3U4E G;  4GDL A;  3IAS 1;  2FCN A;  4BOS C;  2WLB A;  5JH5 C;  2QEJ C;  1WXM A;  2BW2 A;  2UYZ B;  4KIK B;  2RDB C;  3Q8B A;  5HI1 A;  2D2Q A;  4KVG B;  1FRD A;  1YOV B;  4DWF A;  4IKG A;  4KZ0 A;  3GE8 C;  2QSD A;  4MH0 E;  2WU5 B;  2LXA A;  2QHO A;  2Y5B B;  3QIJ A;  1T0Q C;  3NY5 A;  2HJ8 A;  4WH4 A;  3L54 A;  5DPS A;  1F52 A;  4IDI A;  1JWM D;  2LFI A;  3DBL B;  2KN4 A;  3MC8 A;  2IY1 B;  4KX6 B;  2MX2 A;  4LDT D;  4LTU A;  3UQA A;  2LJI A;  1V1P A;  3C0R B;  3ONS A;  3V3X A;  1I4X A;  3LXF A;  3DBR B;  2Y5P A;  3PTF C;  2WXG A;  2D11 A;  4XZ4 A;  2WDQ B;  3PHW B;  2CU1 A;  4K7W A;  2ZW0 A;  3EGR A;  1BML C;  4ICU A;  4HKQ A;  1ZPS A;  4MH8 A;  3K9O B;  5JHA A;  3PT2 B;  3B08 A;  2O2V B;  5CHV C;  3B0A A;  5AUI A;  1VCB A;  3RD2 A;  2OHF A;  4EUT A;  1XD3 B;  2LXC A;  2V0G A;  3Q3N C;  2DYB A;  2NVU I;  1SGH A;  1TS5 A;  3R7R A;  3P4S B;  2D3G A;  2X38 A;  2WDT B;  2WDR B;  1N63 A;  2MBQ A;  3FKY A;  1GAQ B;  3A9J A;  1RFA A;  3A1Q B;  2BS3 B;  2KJH B;  2ZVO A;  3BII D;  2K6D B;  4MSQ B;  2R61 A;  3Q69 A;  1KH0 A;  4A6Q A;  2BGF A;  1IP9 A;  2AWT A;  4XE0 A;  2N7J A;  2K8B A;  2K6Q A;  1PYW D;  2CU3 A;  4ICV A;  2ZEQ A;  1WR6 E;  2WXJ A;  2ZNV C;  5GMV A;  1PUT A;  4L2Y A;  1GPX A;  4FBJ B;  3TMP B;  2DZI A;  2JQR B;  2Z59 B;  3TEX A;  2BPS A;  2D07 B;  5AZH A;  4N58 A;  1MI0 A;  4DBG A;  4N6E B;  1WY8 A;  4W9E A;  1BT0 A;  3LDZ E;  3P42 A;  4AOF A;  2EKE C;  1MVK A;  3VUX A;  1OFF A;  4TMA B;  3M62 B;  2G4S A;  2WYQ A;  2A4Z A;  2QC8 A;  1STE A;  4REZ A;  2KTR B;  5G5H A;  3OAW A;  4GGQ A;  3RNE C;  2M1M A;  5EE9 A;  2MBH A;  1NYQ A;  4CHK A;  2BKF A;  4GN1 A;  2W55 A;  3MJW A;  3SFD B;  2AQ2 B;  5CHF A;  3I5J C;  1KFY B;  1JWS D;  3P4P B;  3A1Q A;  3Q8C A;  4XX5 A;  4HPP A;  4ZHO A;  2AQ1 B;  3DHH C;  2BYF A;  3ZRC A;  2L1A A;  1LQB A;  1ZGU B;  2NCN A;  1WJU A;  3ZUN A;  2J0M A;  3N1Z C;  3WAP A;  2IO0 B;  2CHZ A;  1TKE A;  3ZQ4 A;  5EE0 A;  2HE7 A;  3H7P B;  1R4M B;  2YEP B;  1JWA D;  4ANV A;  2PKO A;  1TIF A;  1WZ0 A;  3W2D A;  5C23 A;  4ARC A;  1VZ7 A;  1TT5 B;  4LNK A;  1JWU D;  1LGR A;  1HZ6 A;  5GXG B;  2FAZ A;  2PE6 B;  2Z8L A;  2OED A;  3GOE A;  2RGF A;  2VH2 A;  1T5X D;  1MHH E;  4RF0 A;  1ESF A;  1SIJ A;  1XLP A;  4FUL A;  3DBS A;  2PPH A;  2KTR A;  1F2R C;  2JWZ A;  2NBW B;  4MDK E;  2L00 B;  1VR9 A;  2IYD B;  4E71 A;  3U8Z A;  2LI5 A;  3V60 A;  3ZJU A;  2J0K A;  4MJS B;  2JRI B;  2Y5C A;  4M02 A;  3WA0 A;  1TBE A;  1WE7 A;  2N1W A;  3VAW A;  4S0R A;  2LJ5 A;  4F1S A;  2J53 A;  1EU4 A;  4C7Y A;  1RRB A;  4LJP B;  1KLU D;  4LLG M;  2JZ3 B;  3PZD A;  3DPD A;  4AJW A;  2NTT A;  1WWT A;  1K52 A;  2JPH A;  3VR8 B;  3P1M A;  4ZRK A;  4I6L B;  1L0V B;  1X1M A;  3GZN I;  4OVV A;  3Q2A C;  2GLS A;  4OW0 A;  1IUE A;  1H4R A;  1R7S A;  1WJN A;  3EEC A;  1C4A A;  4AS1 A;  4JX1 C;  3EUB 2;  3NZS A;  3N1Y C;  1E90 A;  1WX9 A;  4IUM B;  3Q3F A;  3UGB B;  2G4D B;  1JW9 D;  4JL9 A;  1CQV A;  4II2 B;  2R2O A;  4GDK B;  1J7B A;  3OJ4 B;  4RM9 A;  2J42 A;  1NVI D;  1E8W A;  2RD0 A;  1I7H A;  2PEA A;  3DDC B;  2V3P A;  4HRO A;  1DGJ A;  5E6J A;  3B1L X;  4MGK E;  1SF0 A;  1VD2 A;  1WX8 A;  5LXH A;  4MJS A;  1MPE A;  2DZK A;  2KK8 A;  2D10 A;  3DBH I;  4HEA 1;  4WWP A;  3VTW A;  2FUG 1;  3P4Q B;  3EFC A;  2YLM A;  2EKI A;  3Q3M C;  1WGY A;  1V49 A;  3MTN B;  3KW5 B;  3PV1 A;  5TSS A;  2ACZ B;  3R2I A;  2GRI A;  1XEE A;  3KYD D;  1L6U A;  2AL6 A;  4WWM A;  1K53 A;  3IAM 1;  1EF1 A;  4RGT A;  2M4N A;  2HJ1 A;  3RCZ A;  2WNM A;  2QDF A;  4TV3 A;  2KHW B;  2ZPN A;  2RDG A;  2H88 B;  2KOX A;  4USA A;  2INC C;  2KLC A;  3T8M A;  3BWU D;  3UF8 A;  2V3N A;  2M56 B;  3PGE A;  2M17 A;  4M01 A;  2N7E A;  1XO3 A;  2WXO A;  3Q14 C;  1TGZ B;  2LGS A;  1F0Z A;  1WR1 A;  1C76 A;  3NVV A;  5AUK A;  3A9K A;  3N30 A;  4NAW B;  1L4Z B;  3VHT C;  5BMH A;  3AEC B;  2KAJ A;  4WAF A;  1TTN A;  1NI2 A;  4URK A;  4M00 A;  3HUI A;  3KUZ A;  4KDL B;  2R2Q A;  2WU2 B;  3L4P A;  4FN2 A;  3R8B A;  3QA8 A;  3VDZ A;  2WXL A;  1VLB A;  4TQ1 A;  1KLV A;  1P7F A;  4OVZ A;  1WMH B;  4RCO A;  2INN E;  2MH7 A;  2W54 A;  1QT9 A;  3DHI C;  2M8S A;  4DHZ E;  4WJO A;  1K50 A;  4TQ0 A;  3D32 A;  2PLP A;  3ZNI D;  5BMG A;  4W9J A;  5L83 A;  1Q1O A;  5C2T B;  4P6V F;  2JRH A;  2RPV A;  3TCA A;  2M0X A;  2O6V D;  1SE3 A;  2JUO A;  3V6C B;  3SU8 X;  1EWC A;  5TR5 A;  3BK2 A;  2ZCC A;  3ZNH B;  3HRD D;  5D3I B;  3APD A;  4NAW A;  1P7E A;  4GXB A;  5DPT A;  2IO3 B;  4GIV A;  2PMV A;  1TY2 A;  2EMS A;  3DVN U;  5AZG A;  3GS2 A;  3X0W A;  2CR5 A;  3LJ3 A;  4I6N B;  4ANW A;  1MJD A;  2LGX A;  4DXA B;  1LO5 D;  2UWQ A;  1PGB A;  4HCN B;  2RDH A;  1XLQ A;  1VZ6 A;  1SXT A;  3ZVV A;  2PW9 A;  4EE2 A;  4KSK C;  3VRA B;  2FNJ B; 
#chains in the Genus database with same CATH homology
 4ICU A;  5D6J B;  1UD7 A;  1A5R A;  2FUH B;  1E7U A;  1ZKH A;  3K9O B;  4FJY A;  4PS3 A;  2N4F A;  3K9P B;  5JHA A;  3PT2 B;  4FAD A;  4MGI E;  1EUV B;  1XQQ A;  3PS6 A;  3B08 A;  2O2V B;  2XEW A;  5CHV C;  1AAR A;  3B0A A;  1VCB A;  3RD2 A;  3TL5 A;  3PHX B;  4BKS D;  4JGH B;  3TBL D;  2Z0E B;  3A33 B;  3NZU A;  4EUT A;  1XD3 B;  2KKC A;  5G2N A;  3PVL A;  2LXC A;  3PPA A;  2BKR B;  3M95 A;  3TJP A;  1C1Y B;  1GG3 A;  4K1R B;  2ZZP B;  2DYB A;  2K1F A;  2NVU I;  4RMA A;  4W9C A;  1SGH A;  1I35 A;  3PSE B;  2KN5 A;  2FCQ A;  3DBL I;  4GDK A;  3R7R A;  1U4A A;  2JZZ A;  2D3G A;  2WDT B;  1UGM A;  1L7Y A;  2K39 A;  3BIN A;  3SHQ A;  4DHJ D;  2LVP A;  2ASQ A;  2MBQ A;  3V6E B;  3PLV A;  4KDI C;  4MM3 A;  2L0T A;  3APF A;  3EC8 A;  2L8J A;  3A9J A;  2L0F A;  2DYO A;  1RFA A;  3SD5 A;  3A1Q B;  2N1V A;  3PRM B;  4WAA A;  1GC6 A;  5CX3 A;  2KMC A;  2KJH B;  1RLF A;  2B3A A;  2ZVO A;  4JIO U;  4K7S A;  2K6D B;  2LWP A;  2W9N A;  2N9P C;  3VVW B;  1GNU A;  4MSQ B;  3EHV A;  2DEN B;  2BGF A;  3DBR I;  3DVG X;  2L05 A;  4IM0 A;  1I42 A;  1IP9 A;  1WZ3 A;  2EMT A;  4FA6 A;  2AWT A;  1WRD B;  4I6P A;  4NJ6 A;  3JYU A;  3VFK A;  4IG7 B;  3KUD B;  3VUY A;  2K8B A;  2K6Q A;  2KLG A;  3U7D A;  1WYW B;  1H8C A;  3KVF B;  4G0N B;  1LM8 B;  3ZTC A;  4W9K A;  4IW0 A;  2MLB A;  4WJN A;  2L7R A;  2MWS B;  4ICV A;  2KQS A;  3HHM A;  3KH0 A;  3H6N A;  3ZO5 B;  2ZEQ A;  1WR6 E;  3H9D A;  2KQ7 A;  2ZNV C;  5GMV A;  2MCN B;  4WWO A;  4FBJ B;  3TMP B;  2DZI A;  2JVC A;  2Z59 B;  3ZW3 A;  2RR9 A;  4PYZ A;  3L08 A;  1S3S G;  2KX3 A;  2BPS A;  4BOZ B;  2D07 B;  4MEM A;  5AZH A;  2KDE B;  3AUL A;  4DBG A;  1WY8 A;  1M94 A;  2MBB B;  1BT0 A;  3L13 A;  4IWO A;  4W9E A;  3UQB A;  3ZKJ C;  1Z2M A;  2KC2 A;  3LDZ E;  3RZW C;  4F8C B;  4IC7 B;  4AP4 C;  4AOF A;  4G3X B;  2EKE C;  3DVG Y;  2MW5 A;  2DX5 B;  4NY0 A;  3VUX A;  1CMX B;  2ZVN A;  2GBM A;  4ZDV A;  3M62 B;  1WIA A;  2G4S A;  2KO3 A;  4GU2 A;  3X23 A;  1XT9 B;  2WYQ A;  2YVC A;  2A4Z A;  5DPW A;  1NDD A;  1UH6 A;  5D2M B;  2KTR B;  4EEW A;  5J2R A;  3OAW A;  3ENE A;  3JW0 X;  4GGQ A;  1Q0W B;  1WF9 A;  2M1M A;  2XK5 B;  2MBH A;  3UIN B;  4CHK A;  5AZF A;  2BKF A;  4RM8 A;  4GN1 A;  5HKH A;  5E6O A;  1KM7 A;  3MJW A;  4NPN A;  5CHF A;  2XBB C;  1FXT B;  4WQO B;  1WXV A;  2JT4 B;  2MP2 A;  3WAL A;  2LVO A;  3IHP C;  3A1Q A;  3QC8 B;  4XX5 A;  2LAS A;  2K8H A;  2KAN A;  4IWP A;  2IO1 B;  3SDL C;  2ZNV B;  1SE9 A;  1YJ1 A;  1UBQ A;  3A9K B;  4GOC A;  3QHT A;  2BYF A;  3ZRC A;  4TUU A;  1LFD A;  1E8X A;  3ALB A;  3H7S A;  1V9J A;  4II3 B;  2FID A;  1LQB A;  3JSV B;  2AEH A;  3ML9 A;  1V2Y A;  1WGR A;  1ZGU B;  2KX0 A;  2NCN A;  1J8C A;  2NPT B;  3VTV A;  1WJU A;  3MHS D;  1E5W A;  3ZUN A;  2J0M A;  2IZV B;  4GB9 A;  3QWZ B;  3WAP A;  4KIK A;  3R3M A;  1C3T A;  2IO0 B;  2CHZ A;  4FJV B;  4GDL B;  2AL3 A;  3NHE B;  2PE9 A;  3NOB A;  1WMH A;  2HE7 A;  3H7P B;  4MEL A;  2LRU A;  4CO7 A;  5DPR A;  4ANU A;  3QCA A;  4YL8 A;  4E74 A;  3AU4 A;  1P3Q U;  3RUI B;  4P7I A;  5FR6 A;  4ANV A;  2MA9 B;  4FLH A;  1WGH A;  1WZ0 A;  5C23 A;  1YX6 B;  2A5U A;  4EFO A;  2O6V B;  2ZCB A;  2FNJ B;  3AI5 A;  3OJ3 A;  3RT3 B;  3ZRF A;  2NBV B;  4HPM B;  3VH4 B;  3W1S A;  3ZDM C;  4KSL C;  4PS7 A;  2FAZ A;  3W1Y A;  2PE6 B;  3GOE A;  2RGF A;  4ZRI A;  5G55 A;  2LGD A;  3U30 A;  4BKG A;  1R4N I;  2MQJ A;  1P9D U;  1WX7 A;  2DHZ A;  3QK0 A;  3A4S C;  4FUL A;  3DBS A;  2IBI B;  4KV2 A;  2DYM A;  2PPH A;  2CHW A;  2KTR A;  4BBN F;  2JWZ A;  1YD8 U;  2NBW B;  4MDK E;  2XK5 A;  1WH3 A;  4MGY E;  1PQS A;  4E3C A;  4FHJ A;  3RUL A;  4M8M A;  2L00 B;  3VH3 B;  3CMM B;  2KJ6 A;  4HCP B;  1V5T A;  2KWV B;  1WGD A;  2IYD B;  4EZJ A;  4G11 A;  4NNJ B;  3U8Z A;  4E71 A;  5BO4 B;  4DK5 A;  2LI5 A;  2JY6 A;  3V60 A;  4LCD E;  2J0K A;  4MJS B;  4GSW A;  2C7N B;  2JRI B;  2ZPY A;  3VUW A;  2V3S A;  1P98 A;  4HXD A;  3WA0 A;  4NQK E;  1TBE A;  4B9K A;  5J18 A;  2KDF B;  3N32 A;  4W9G A;  3JSV A;  2KFJ A;  3Q3J A;  5IAA C;  3WAM A;  1WE7 A;  1Z5S B;  2NPT A;  2N1W A;  4DDG D;  3VAW A;  1IYF A;  2LJ5 A;  2C7M B;  2PJH A;  4HK2 A;  4F1S A;  3AXC A;  1RRB A;  2NBU A;  2LUE A;  4LJP B;  4BBN C;  1R4M I;  2JZ3 B;  2K25 A;  1QZE A;  4AUQ C;  2GMI C;  2RSU A;  3PZD A;  3DPD A;  3UIO B;  5LXI B;  4AJW A;  4JQW C;  1MG8 A;  2HTH A;  3EFU A;  1OQY A;  4HVB A;  2O2V A;  3I3T B;  1ISN A;  1UZX B;  1WGG A;  2JPH A;  2ZJD A;  4NJ7 A;  3L0W B;  2L3Z A;  2GOW A;  1RAX A;  5CTR C;  1V80 A;  4ZRK A;  4I6L B;  1J0G A;  1X1M A;  3GZN I;  4OVV A;  3QAQ A;  1OGW A;  4XC2 A;  1S1Q B;  2CS4 A;  1Y8R C;  4DHJ B;  5D94 A;  3HM6 X;  1H4R A;  2BYV E;  1WJN A;  4W9L A;  3EEC A;  4DDI D;  1E8Y A;  1HE8 A;  5LLI A;  4M8N A;  1WJ6 A;  4EZL A;  3NZS A;  3APC A;  1NBF C;  2FIF A;  1E90 A;  2KZR A;  1UEL A;  1WX9 A;  3IFW B;  4IUM B;  3IBE A;  3CF6 E;  3Q3F A;  2G4D B;  4TKN A;  3UGB B;  4JL9 A;  4K7U A;  1T0Y A;  3RZF A;  1E7V A;  2LD9 A;  4II2 B;  2L76 A;  2KWC A;  2R2O A;  2V1Y A;  4GDK B;  4K81 A;  3OJ4 B;  4RM9 A;  3RYT A;  4WWN A;  1E8W A;  3NS8 A;  3CST A;  1OTR B;  2RD0 A;  3HM3 A;  2PEA A;  3DDC B;  3ECI A;  3QQ8 B;  1WXA A;  4W9H A;  5JHB A;  1WXS A;  1JRU A;  2GBK A;  2I1K A;  2REX A;  1J19 A;  1VD2 A;  1WFY A;  3A9J B;  1WX8 A;  4MGK E;  5E6P A;  4ASW C;  1WM3 A;  5C1Z A;  5LXH A;  4MJS A;  2AYO B;  4EKU A;  2JXX A;  2DZK A;  1OEY J;  3R7Q A;  2KK8 A;  2D10 A;  1V5O A;  3HK0 A;  4G50 A;  2BF8 B;  3DBH I;  2LVQ A;  4WWP A;  3VTW A;  4CYE A;  4IM2 A;  2YLM A;  2LZ6 A;  2LRW A;  1WGY A;  1V49 A;  1GC7 A;  3AU5 A;  3MTN B;  5EDS A;  3ML8 A;  3HIZ A;  3KW5 B;  3ZLZ A;  2JF5 A;  2Z0D B;  3PV1 A;  3T9L A;  3ZTD A;  3WIM A;  5D7G A;  3IG3 A;  2OOB B;  1SIF A;  3PRE A;  4PS8 A;  3KYD D;  1UBI A;  3BY4 B;  2AL6 A;  1OEY A;  3M63 B;  2GBJ A;  3PRP B;  4LJO B;  3N3K B;  3ZNZ B;  3ZIM A;  4HDQ A;  1GJZ A;  2C5L C;  2I1J A;  4OVU A;  2BWF A;  3WAO A;  1EF1 A;  1P1A A;  4ZRJ A;  2M4N A;  3RCZ A;  3OLM D;  3WAN A;  3QX1 A;  4J6I A;  4FJZ A;  4FHK A;  3QJZ A;  4TV3 A;  2MBE A;  2KJR A;  2DAJ A;  2KHW B;  2DZJ A;  2ZPN A;  1F9J A;  2K8C A;  3L10 B;  3P2B A;  4LDT B;  2N9X A;  3PLU A;  4A20 A;  1WI0 A;  3M3J A;  1WJ4 A;  2KOX A;  1V81 A;  4HDO A;  2G45 B;  5CHW A;  3VTU A;  2KLC A;  3PRZ A;  2FCS A;  2HD5 B;  3T8M A;  3UIP B;  1YQB A;  3UF8 A;  4ZYN A;  1TZ1 A;  2KDI A;  4AWJ A;  2KD0 A;  3DQV A;  2RPQ A;  3DOW A;  2J7Q B;  4MSM B;  3PGE A;  2M17 A;  4HJK A;  2N7E A;  3O65 B;  1EO6 A;  2OJR A;  3VXW A;  3CSF A;  1TGZ B;  4X57 B;  2C7H A;  1LXD A;  1WR1 A;  2CKH B;  2NS5 A;  4AJY B;  4NQL B;  3IVF A;  3VQI A;  3A9K A;  3N30 A;  4NAW B;  2CHX A;  2WX0 A;  3V62 A;  3W1S C;  3VHT C;  2MBO A;  2WX1 A;  2MP2 B;  3L17 A;  2GBR A;  2C60 A;  3H1U A;  1TTN A;  4BVU C;  1NI2 A;  5J17 A;  4KZC A;  4URK A;  5L95 C;  2KVR A;  2KC1 A;  4ANX A;  3KUZ A;  1GUA B;  2N9E B;  3L16 A;  5JZE B;  2IO2 B;  2V4L A;  3R66 C;  4KDL B;  2DAF A;  1L2N A;  1ZW7 A;  1Q5W B;  2R2Q A;  2WWZ A;  1K8R B;  4GDL A;  2FCN A;  2KFK B;  3QAR A;  4BOS C;  4FN2 A;  3H7P A;  4HLE A;  4GMV A;  1P0R A;  2DZM A;  4HWI B;  3V61 A;  4IM3 A;  5JH5 C;  3QA8 A;  3VDZ A;  1WXM A;  4WJQ A;  4A3P A;  1IPG A;  4KIK B;  1WE6 A;  2UYZ B;  4EOY A;  4TQ1 A;  1KLV A;  2BWE S;  2D2Q A;  4KVG B;  2O6V A;  1WMH B;  3ZDT A;  4W9F A;  4DWF A;  4A3O A;  3KUC B;  4KZ0 A;  2KMA A;  2C9W B;  2M8S A;  4MH0 E;  2BYE A;  5DCN A;  2NR2 A;  4W9D A;  4DHZ E;  2MRP A;  2LGY A;  3DCG A;  3TIX A;  1KOT A;  2LXA A;  2QHO A;  4WJO A;  2Y5B B;  3QIJ A;  3NY5 A;  4TQ0 A;  4WJP A;  2HJ8 A;  3D32 A;  4JLC A;  3ZNI D;  4M0W B;  4W9J A;  3L54 A;  5L83 A;  1Q1O A;  5DPS A;  5AEK B;  1YX5 B;  3JVZ X;  5KHO A;  4PYU A;  4DHZ B;  2JRH A;  3TCA A;  1V86 A;  2M0X A;  3B1L X;  2O6V D;  1EF5 A;  3DVN V;  1G6J A;  2VRR B;  2JUO A;  3V6C B;  3SU8 X;  1V6E A;  2IY0 B;  2IY1 B;  5TR5 A;  5KHQ A;  2ZCC A;  2MX2 A;  3ZNH B;  1D3Z A;  4LDT D;  3APD A;  4F7Z A;  2MSE D;  2KDB A;  4GXB A;  4NAW A;  5DPT A;  3S2A A;  3UQA A;  2IO3 B;  2KTF A;  5IA7 A;  3C0R B;  4GIV A;  4IWQ A;  3ONS A;  2FCM A;  3KYC D;  1KJT A;  2EMS A;  3DVN U;  5AZG A;  4MGZ E;  5E6N A;  2N7D A;  2KWU B;  4BKT A;  4W9I A;  3X0W A;  3PTF C;  2CR5 A;  3LJ3 A;  4I6N B;  2D11 A;  4XZ4 A;  4ANW A;  3ZNG C;  2J0J A;  4N9F 4;  4HPL B;  4BKS A;  2LGX A;  4DXA B;  4B95 A;  4EZK A;  2UWQ A;  3PHW B;  1YIW A;  2KFK A;  1WM2 A;  2CU1 A;  2GBN A;  4HCN B;  4B6W A;  4K7W A;  3ZVV A;  4BFR A;  2G3Q B;  1E8Z A;  4KSK C;  2KNB A;  2KXJ A;  3A4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...