1WYWB

Crystal structure of sumo1-conjugated thymine dna glycosylase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wywB00
2C5LC 2FNJB 3UGBB 1E8YA 2DAJA 3ZVVA 4NPNA 4CHKA 3UQBA 4FLHA 5CHVC 3IBEA 1YJ1A 2LXAA 1GG3A 3PVLA 2XK5B 2KWVB 1WM2A 4GN1A 3P2BA 3UF8A 3V60A 2B3AA 2C7MB 1WMHB 1ISNA 2J0JA 2KOXA 4GOCA 2LZ6A 4W9GA 3PTFC 4G0NB 2YLMA 4W9KA 2MBQA 2IO0B 3VXWA 2AL6A 5D94A 4GDLB 1Q5WB 3UIPB 4DXAB 4MGYE 3RT3B 3QQ8B 2LVOA 3VQIA 2O2VA 3AU4A 2RD0A 4XX5A 3PZDA 2AL3A 1RRBA 2BYFA 2JVCA 2D10A 2LGDA 4I6LB 3RZFA 3WANA 3ZNZB 3JW0X 2LGYA 4HK2A 3APFA 4W9JA 2N7DA 2IBIB 4I6NB 4KIKB 1TZ1A 2QHOA 3QK0A 1GUAB 3X23A 5KHQA 1IYFA 2MA9B 4DHZE 3A1QA 2DHZA 2ZPYA 3EHVA 5LXIB 2MSED 2FCNA 1UELA 2HD5B 2NBWB 1Z2MA 1CMXB 2RSUA 2ZEQA 2FUHB 3W1SA 1JRUA 5C1ZA 1G6JA 4TUUA 2AWTA 5DPWA 5E6PA 3OJ3A 2D2QA 2DENB 4JIOU 3VTUA 1YIWA 5D7GA 3OJ4B 1M94A 5JH5C 2LJ5A 1V80A 1HE8A 3UINB 2WX1A 2L05A 2JF5A 3M3JA 4NNJB 2N7EA 3U30A 4IWOA 4JQWC 3R66C 1E7UA 1XQQA 5L83A 1WX7A 2BKRB 3PREA 4G3XB 2LVPA 2ZJDA 1XT9B 4FJYA 1WJNA 4NQLB 2KVRA 2L7RA 1WGDA 2PE6B 3NZUA 2W9NA 4W9FA 3M95A 4AJWA 2M17A 4KSKC 2MLBA 4DHZB 3QHTA 2M4NA 1P98A 3WIMA 5JHBA 3NOBA 4GGQA 2J0MA 2K39A 2KDEB 1RLFA 2GBRA 2BYVE 2KMAA 3L0WB 4G50A 4FADA 4IUMB 3DDCB 2J7QB 2MQJA 3D32A 4IM0A 4FJZA 3VTWA 1OEYJ 2L3ZA 1E8XA 2LRUA 2ZCCA 2RPQA 2NPTA 1WJ6A 2YVCA 3KVFB 4MGZE 2KWUB 3KYDD 1V5OA 1KM7A 2GBKA 1H8CA 4CO7A 1EF5A 3ALBA 1RFAA 1YD8U 2FAZA 3L08A 4IW0A 4FN2A 2DAFA 5E6NA 4F7ZA 4K7UA 2WWZA 2GMIC 3PLUA 4E3CA 3RZWC 3CF6E 4BBNF 4BKSA 1IPGA 1NI2A 1Y8RC 3ZO5B 2MP2A 2JXXA 1V81A 3WALA 3DOWA 5G2NA 4ASWC 5IA7A 2UYZB 1WX9A 4AWJA 3N30A 4ZRKA 4E74A 2EKEC 5AZFA 2JRHA 2JRIB 1WXVA 4P7IA 4WJOA 1TBEA 2BPSA 1WJUA 3DVNU 4WWNA 4B95A 4E71A 2PE9A 3CMMB 4M8NA 1VD2A 4W9LA 4K1RB 2JY6A 1L2NA 2BF8B 2ZVNA 5D2MB 1V2YA 1BT0A 2R2QA 3Q3JA 4HCPB 1WGHA 2KFKA 3VTVA 4KSLC 3IVFA 4EZLA 2MBHA 4FBJB 4X57B 4W9EA 4GDKA 2ZCBA 1YQBA 2KHWB 4M8MA 1WI0A 2KQSA 4PYUA 4MH0E 4ANXA 1WY8A 4BKTA 3RCZA 2KO3A 3BINA 4A3OA 4RMAA 2C7HA 5C23A 4EFOA 3IG3A 3H6NA 3IFWB 2O2VB 3DCGA 3H9DA 4TQ1A 2GBJA 4HJKA 4OVUA 4HDOA 3ML9A 4G11A 3KH0A 1F9JA 3JVZX 3K9OB 3KUDB 3CSFA 2KDIA 2ZVOA 4ZRIA 3APCA 4FJVB 1ZGUB 3PPAA 3L10B 2KLCA 4KZ0A 4WWOA 5BO4B 1TTNA 2IY1B 4W9IA 1LXDA 4PYZA 4AP4C 2KKCA 4KZCA 2FCSA 2KTFA 3PS6A 4II2B 2LVQA 4GSWA 3V62A 2PJHA 3A4SC 4A3PA 2FCQA 3A33B 5AZHA 2HE7A 1UBIA 4NQKE 3V6CB 1AARA 3V61A 3EFUA 3LDZE 3RD2A 1OTRB 1R4MI 2IO2B 2IYDB 4WJNA 2MCNB 4TQ0A 3H7SA 2PPHA 2JUOA 1L7YA 1VCBA 2M0XA 5CX3A 3VVWB 4CYEA 4HWIB 2KDFB 4EOYA 3UIOB 1KLVA 3ZTCA 1WMHA 1KOTA 1WR1A 2JPHA 4RM9A 2ZPNA 3T9LA 3TL5A 2NVUI 2KJHB 4MJSA 3ZLZA 2KX0A 2JZ3B 1H4RA 3R7RA 1C1YB 1GC6A 2K6QA 2R2OA 2M8SA 3KUCB 2KXJA 2NCNA 1WR6E 2WDTB 4PS3A 1YX5B 1WGRA 3PRMB 3ONSA 1NBFC 3APDA 3QC8B 2PEAA 4LCDE 4MSMB 5DPSA 4K7SA 3S2AA 4IM3A 3WAPA 4NJ6A 2IY0B 4FHKA 3B1LX 2CHZA 2AYOB 1U4AA 1WGGA 2L8JA 4M0WB 3AU5A 4GB9A 4IC7B 3UQAA 3DVGY 1WGYA 3ZW3A 4NAWA 4ZYNA 3OLMD 2N1VA 3ZIMA 2CHWA 3X0WA 1SIFA 4K7WA 2L0FA 2ZNVC 4TV3A 2GBNA 2V4LA 4HVBA 2L00B 1IP9A 2NPTB 2XBBC 2OJRA 3DVGX 2IZVB 1E7VA 1E8ZA 2KANA 5AZGA 5AEKB 3PHWB 3AXCA 1WYWB 2MBEA 4WJPA 3QA8A 3SU8X 2N9EB 3H7PA 3PV1A 5LLIA 2K8HA 4MGIE 2BKFA 2N9PC 2C60A 2KTRB 3ZNID 3ZDMC 3QX1A 1UD7A 2KJ6A 2ZNVB 4DWFA 5JHAA 3JSVA 3A9KB 2MP2B 2KFJA 1KJTA 3EC8A 1A5RA 3A9JA 2FIDA 4MM3A 4FHJA 2J0KA 3MHSD 2BGFA 2LGXA 3HK0A 1J19A 3TIXA 2AEHA 3C0RB 1V49A 2DZMA 2O6VD 1WX8A 4WQOB 3ZNGC 2EMTA 2O6VB 3SHQA 2KWCA 2CS4A 1J8CA 2DZIA 3L16A 4JLCA 4MELA 3NS8A 3MTNB 1GNUA 2LASA 3WA0A 2ZZPB 5HKHA 1WXMA 1GC7A 2KMCA 4EZJA 5E6OA 1WIAA 3O65B 3QWZB 2JWZA 3ZUNA 4HDQA 4ICUA 1WXAA 4W9DA 4EUTA 4KVGB 2FCMA 3AI5A 1S1QB 2A5UA 4LJPB 2D11A 1V86A 5LXHA 1I42A 3N32A 3L13A 2RR9A 4PS7A 1E8WA 1NDDA 2CKHB 2G4SA 5GMVA 1PQSA 2LD9A 2HTHA 3M62B 5DCNA 1EO6A 4AJYB 2Z0EB 4GIVA 2IO3B 2FIFA 4DDID 5CHWA 1C3TA 3MJWA 1OEYA 1WZ3A 4KDLB 3VUYA 4WWPA 4AUQC 5L95C 2LI5A 5DPRA 2C9WB 3RYTA 2KNBA 1P3QU 3L54A 5JZEB 2K25A 2XEWA 2KJRA 3SD5A 3A4RA 2MBBB 1WF9A 4DDGD 3KUZA 3U7DA 3DBSA 2JZZA 2KQ7A 3W1SC 1UBQA 2CU1A 3DBLI 3ZRCA 2MX2A 3VUXA 4EKUA 2NBUA 2Z59B 4HXDA 2K1FA 4TKNA 4XC2A 4FA6A 2D07B 3AULA 3HM3A 3OAWA 1I35A 5IAAC 3ZKJC 4HPLB 1Q1OA 3KW5B 3A1QB 2VRRB 3CSTA 3PGEA 1UZXB 3QAQA 3N3KB 4ZRJA 3NHEB 4ICVA 1LFDA 1WXSA 3GZNI 3VUWA 4I6PA 3HM6X 1WM3A 1V9JA 3ZNHB 1FXTB 2KC1A 1WE6A 1ZKHA 4MJSB 3R7QA 1WH3A 1ZW7A 4LJOB 3ZRFA 4B9KA 3M63B 4BOZB 4NY0A 4EZKA 4URKA 2V3SA 4W9HA 3H1UA 3DVNV 3WAOA 2K6DB 2XK5A 3JYUA 2LUEA 1E5WA 1SGHA 3KYCD 2MRPA 3U8ZA 4MSQB 3L17A 4GDLA 4HPMB 4MGKE 5CHFA 4DHJD 2DX5B 1P1AA 4II3B 4DHJB 1D3ZA 1S3SG 4NAWB 2UWQA 2REXA 4KDIC 4GU2A 3DBRI 4GMVA 4FULA 4YL8A 2MW5A 2DYOA 3SDLC 3QCAA 5TR5A 3VDZA 3VH3B 1OQYA 2DYMA 2NBVB 4KIKA 1YX6B 3PHXB 3WAMA 4ANUA 1GJZA 2NR2A 3IHPC 1OGWA 4BVUC 3HIZA 3W1YA 4IWQA 5EDSA 1X1MA 2CR5A 3GOEA 3H7PB 4DBGA 2OOBB 4K81A 5CTRC 4BOSC 4BBNC 1UGMA 1WE7A 1XD3B 2HJ8A 3PT2B 3QARA 4AOFA 2KX3A 4F1SA 1TGZB 2LRWA 3T8MA 1QZEA 2G3QB 3JSVB 5J17A 4GXBA 2NS5A 3B0AA 3Q3FA 3RUIB 1V5TA 3TMPB 1WZ0A 4W9CA 1P9DU 4WAAA 3EECA 1Q0WB 2BYEA 3VHTC 4BFRA 3A9JB 5D6JB 1WRDB 2V1YA 5G55A 2WX0A 4NJ7A 2BWFA 4BKSD 3I3TB 4XZ4A 1T0YA 3LJ3A 3BY4B 2IO1B 1LQBA 1SE9A 2ASQA 4HLEA 4IWPA 3DQVA 1MG8A 2DZKA 2JT4B 3ZTDA 4A20A 4ANVA 1EUVB 5FR6A 2GBMA 3TBLD 2KZRA 2KN5A 3VH4B 1V6EA 4HCNB 2M1MA 4ZDVA 2I1KA 4MDKE 4F8CB 1RAXA 1P0RA 1WFYA 3TCAA 1J0GA 1UH6A 2LXCA 4J6IA 2N4FA 2KK8A 2KC2A 2KFKB 4DK5A 2DYBA 4GDKB 2KLGA 4ANWA 2LWPA 2GOWA 1Z5SB 3V6EB 2L0TA 2Z0DB 3B08A 4IM2A 2Y5BB 1LM8B 3PRPB 2C7NB 4N9F4 2KDBA 2KTRA 3ECIA 2K8CA 3DPDA 3K9PB 3QIJA 4MEMA 2MWSB 1R4NI 1K8RB 2A4ZA 3RULA 2N9XA 2G45B 3PSEB 2D3GA 2K8BA 2N1WA 3TJPA 5J18A 3VAWA 1E90A 3A9KA 4EEWA 2CHXA 1WJ4A 2MBOA 2G4DB 3ENEA 3PRZA 4LDTD 4JGHB 5DPTA 4LDTB 2RGFA 2BWES 4RM8A 3NY5A 4OVVA 4JL9A 4KV2A 4WJQA 2O6VA 2KD0A 2EMSA 2WYQA 3PLVA 4B6WA 3VFKA 3ZDTA 3DBHI 2DZJA 3HHMA 2I1JA 2L76A 3ML8A 4IG7B 3QJZA 5KHOA 4BKGA 3R3MA 4PS8A 3NZSA 1EF1A 5J2RA
chains in the Genus database with same CATH superfamily
1WWTA 2Y3AA 3GB1A 2FNJB 3MHZA 4CHKA 2Z8LA 3IBEA 2E3TA 5EE0A 4P1BC 3P2BA 2VZKD 2B3AA 2J0JA 2YLMA 1PGBA 4MGYE 3RT3B 2LVOA 2O2VA 2RD0A 2KN4A 4W9JA 2IBIB 1TT5B 3NG0A 3AN1A 3IAS1 3N9YC 2MA9B 3EHVA 5LXIB 1IBXB 1UELA 2NBWB 2RSUA 3W1SA 1JRUA 5C1ZA 1G6JA 4TUUA 2AWTA 1FXIA 5H8YE 3OJ3A 4DXGA 5DPWA 1QF6A 4XGAB 2DENB 5D7GA 3I5JC 1M94A 3OJ4B 3UINB 1V80A 1HE8A 4UDUC 2QCZA 5FR3A 3CIRB 3U4EG 3MFGA 4LTUA 4WQMA 1UGJA 4ZRQA 1XQQA 2BKRB 2PW9A 2SEBD 2WDRB 2ZJDA 1XT9B 4NQLB 2KVRA 2L7RA 2PE6B 3RI7C 2W9NA 3RNBC 3BK1A 1R7SA 2M17A 4KSKC 4DHZB 3WIMA 3TEWA 1GOZA 4GGQA 2KDEB 4FADA 2BYVE 1MHXA 4IUMB 4A8XC 1ENFA 4IM0A 4FJZA 2RMMA 1E8XA 4KGRA 3KVFB 3KYDD 1I7HA 3ALBA 3MP9A 2DAFA 2INNE 1DGJA 1SB3C 4F7ZA 4K7UA 3EGRA 5BMHA 3GE8C 4BBNF 1Y8RC 3ZO5B 2JXXA 4RCOA 1WX9A 3N30A 4ZRKA 2WXKA 2IDYA 2QIEB 2BPSA 3DVNU 2AQ2B 2PVGC 4E71A 2PE9A 3CMMB 4M8NA 2N0SB 3MJ5A 1L2NA 2ZVNA 1V2YA 1BT0A 3GS2A 3Q3JA 3HRDD 4HCPB 4EZLA 4ARCA 5GXGB 3W5VB 1WI0A 1SXTA 2MJ3A 4MH0E 4DQOC 1TS3A 1WY8A 2W3SA 3RCZA 1ROEA 4A3OA 1TS2A 1MHHE 2PLPA 3Q3OC 3VRAB 4TQ1A 1JWSD 3KUDB 3CSFA 2KDIA 4FJVB 3PPAA 4OVZA 3L10B 3LXFA 1ZXHA 4KZ0A 3SEBA 3EFCA 1TTNA 1LXDA 3NVWA 3RFZB 4KZCA 4GSWA 2KMMA 3V62A 5AZHA 3LDZE 3GP7A 1DYQA 2IYDB 2WU5B 1FEHA 3H7SA 2IGHA 5CX3A 4KKIA 3TEYA 1YJJA 2ZPNA 5G5HA 2NVUI 4ITKA 1H4RA 1C1YB 3Q69A 2M8SA 2KXJA 1IGDA 5C2TB 1ESFA 3EUB2 1WGRA 3PRMB 4RNAA 1NBFC 1TYGB 1EWYC 3B1LX 3AU5A 4GB9A 1KLUD 2I38A 1SIFA 1IBXA 2BB6A 2GLSA 2XBBC 2IZVB 1E7VA 3PV1A 2WXRA 1DOYA 2N9PC 1YNTE 3ETRA 2ZNVB 4DWFA 3C19A 3JSVA 2INCC 2MP2B 5BMIA 1C4PA 3EC8A 3A9JA 1FNVA 1J19A 3C0RB 1CJEA 3FILB 3N20C 3L16A 4MELA 3NS8A 1GNUA 5IP4D 1MPEA 4NAMA 1GC7A 2Y5CA 2ON8A 3N1YC 2D3AA 3C8YA 4HDQA 1DOXA 4KVGB 3N32A 3L13A 2LGSA 4PS7A 1NDDA 2CKHB 2GI9A 2YEPF 2XN9C 2LMCA 5DCNA 3RMKC 3MC9A 2IO3B 2FIFA 1GAQB 3VUYA 4KDLB 4WWPA 2LI5A 2PVOD 2C9WB 5JZEB 2KNBA 4KX6B 2LFIA 3H8HA 1TS4A 5MPOA 1P7FA 1UBQA 3P1MA 5BYRA 2EKIA 1RM6C 1TY2A 4TKNA 3OAWA 3HM3A 4QAYA 1JROA 2VRRB 1UZXB 3QAQA 3N3KB 4ICVA 1PGXA 4B9KA 4BOZB 4JX1C 3H1UA 3JYUA 2LUEA 3KYCD 1L6UA 2WXLA 4MSQB 1T6BX 4DHJD 4MGKE 2V3NA 3BIID 4DHJB 1P1AA 4II3B 2KACA 1L0YB 3Q2AC 1TY0A 1QOAA 1F1HA 5C3JB 3SDLC 5TR5A 3VH3B 1OQYA 4KIKA 3WAMA 2INPE 3WCQA 1X1MA 4AS1A 3H7PB 2DWQA 1CZPA 1NYRA 4DBGA 4BOSC 3KWVA 4K81A 5CTRC 4BBNC 4R3DA 1UGMA 3QARA 4LNFA 3DBLB 3B0AA 3Q3FA 1V5TA 4ARIA 1P9DU 2L1AA 3LYYA 1Q0WB 3VHTC 4MM3B 1WRDB 3AE2B 2V1YA 4NJ7A 3I63C 4BKSD 2WXOA 1T0YA 3BY4B 2INDC 2K9XA 4WH4A 4LK0M 1MG8A 1UUPA 1YMHE 2GBMA 3TBLD 2KZRA 4HCNB 2I1KA 4MDKE 1N61A 1K51A 2LXCA 2N4FA 1VRAB 4GDKB 3Q3MC 4ANWA 4Q2JA 3B08A 2Y5BB 1LM8B 3PRPB 2C7NB 4B0MA 2KDBA 2K8CA 3QIJA 3ZJUA 3RULA 2N9XA 5J18A 3DBRB 1UF0A 1XXGA 4EEWA 1IGCA 2MBOA 4S17A 4LDTD 4LDTB 2WGSA 2N9LA 3E56A 4J3OD 1VDVA 3DBHI 3ML8A 2L76A 4BKGA 3P4RB 3QJZA 1FD6A 3R3MA 1TS5A 1EF1A 2C5LC 4C4VB 4ZHOA 2LGIA 3UQBA 4FLHA 5CHVC 1YJ1A 2OHFA 1GG3A 2XK5B 2RPVA 1WM2A 3P42A 4GN1A 3UF8A 4W9GA 1TKYA 2N7JA 2LZ6A 2CJOA 3PTFC 1YN4A 2MBQA 2IO0B 4REZA 4GDLB 3AM9A 3QQ8B 1WGKA 1DOIA 4XX5A 1IUEA 3PZDA 2AL3A 2D10A 3JW0X 3PO0A 3APFA 2N7DA 4I6NB 1E6EB 3QK0A 2M19A 1GUAB 4DHZE 3ZXVA 2M0AA 2MSED 2FCNA 3AV8A 2FUHB 2D2QA 2JYTA 4JIOU 1QLBB 5IO9A 2LJ5A 4HPPA 2WX1A 2L32A 1WRIA 4NNJB 5IN7A 1JW9D 4C56C 4JQWC 3CWIA 2LVPA 3NZUA 1C4CA 4LNNA 3M95A 2MJEA 3W2DA 1EU4A 2M4NA 1P98A 5JHBA 1RWSA 3Q8AA 1UNSA 3RNEC 2KMAA 1ZE3D 3L0WB 4HEA1 4YSXB 3DDCB 2J7QB 2MQJA 1E10A 1OEYJ 3HVZA 2L3ZA 2LRUA 2RPQA 5TSSA 2GBKA 1H8CA 1RFAA 3RNGC 1ZUD2 3R2TA 3PLUA 4B0EA 3RZWC 4BKSA 2PIAA 3T3NA 1FFVA 1YN5A 3AEAB 3AE7B 3WALA 1C79A 3DOWA 4ASWC 5IA7A 2UYZB 4AWJA 2AQ1B 2OEDA 5JXVA 1V1OA 2EKEC 1PFDA 4WJOA 1XCTL 4K1RB 2R2QA 3VTVA 1WGHA 4KSLC 4X57B 4W9EA 4GDKA 1B1ZA 2LHDA 2VH2A 1SIJA 3BINA 1F2RC 2QMTA 2GRIA 2OJWA 3P4QB 2GBJA 2VZKB 4HJKA 3U7ZA 3KH0A 1V97A 2NMQA 2ZVOA 4ZRIA 1ZGUB 5HG2A 1OQRA 3TSSA 4II2B 2LVQA 2PJHA 1KH0A 1AARA 1TZOA 1WXQA 4TQ0A 1T5XD 1WYGA 2JUOA 1L7YA 2M0XA 3VVWB 4CYEA 4HWIB 3UIOB 2EELA 3TL5A 1HXYD 3KUCB 1WR6E 2W82A 1PGAA 1YX5B 3APDA 1RFKA 2PEAA 1VZ7A 1SJHD 3BVGA 3WAPA 2IY0B 3AE8B 3DBHB 1WGGA 3SFEB 4M0WB 1L4ZB 2BT6A 4IC7B 3UQAA 4WIPA 3UI3A 3OLMD 1N5WA 1K53A 1VR9A 2CHWA 3AE5B 3X0WA 1N60A 1PUTA 4K7WA 2L0FA 3O13A 1IP9A 2NPTB 1J7AA 1QOBA 3DVGX 2KT7A 4HKZE 5AZGA 4ZHPA 3PHWB 1FNWA 1WYWB 2N9EB 5LLIA 2BKFA 3QX1A 1UD7A 5JHAA 3KWLA 1KJTA 3MHSD 2BGFA 1ET9A 1R4MB 2EMTA 2CS4A 1J8CA 2DZIA 1V1PB 2LASA 3AE4B 4IKGA 2KMCA 4EZJA 5E6OA 1JWMD 3B9JA 3OWEB 3LB8C 3AI5A 4LJPB 5LXHA 1V86A 1RYJA 1QILA 2BW2A 3W9CB 1E8WA 2HTHA 1ACCA 4AJYB 4HRSA 2JQRB 3BYTB 4DDID 1EWCA 3L54A 1FO4A 2XEWA 3A4RA 1WF9A 3Q14C 3DBLI 4YSZB 3ZRCA 3VUXA 4BAXA 2Z59B 2K1FA 2D07B 4XYCA 3ZKJC 4HPLB 1Q1OA 3VR8B 3A1QB 3PGEA 1UWMA 2IGDA 2J52A 2K5PA 1I4QA 1LFDA 3VUWA 1V9JA 3ZNHB 1FXTB 4MJSB 3ZRFA 1WH3A 4LJOB 4EZKA 4NY0A 3WAOA 2LHEA 1D4BA 4GLSC 3Q8BA 4KGSA 3RPFC 1T0QC 1S3SG 1VJKA 4NAWB 5LNK1 2UWQA 1QOFA 1I4GA 4KDIC 1TKEA 3DBRI 3ZQ4A 2DYMA 1K50A 1VZ8A 1YX6B 3PHXB 4ANUA 1C9FA 2MEKA 3I57A 3HIZA 5EDSA 1JWAD 1L5PA 2CU3A 2GB1A 4US8A 1HA5A 2CR5A 3BVMA 3GOEA 3MC8A 1FCCC 1XD3B 1QT9A 3PT2B 2JWUA 4AOFA 2KX3A 4F1SA 1TGZB 3AEBB 4C80A 5J17A 4GXBA 2V9HA 3TMPB 1WZ0A 4BFRA 2V4IB 1MFWA 2BWFA 3I3TB 2LUMA 1LQBA 4M0WA 1Y56A 4A55A 1JQ4A 4ANVA 2KWDA 4A90A 5FR6A 1FCLA 2KN5A 2V3PA 2WXQA 4ZDVA 1RAXA 1F52A 1P0RA 3RNAC 1UH6A 4N59A 2KK8A 2KFKB 4DK5A 1HQRD 2DYBA 1PDXA 1UWXA 3ZJTA 4PT5A 2BTEA 4C7YA 3ECIA 3K9PB 3AECB 2MWSB 1FFUA 3PSEB 2G45B 2D3GA 2N1WA 5EE3A 4RGMA 2CHXA 3ENEA 3PRZA 5DPTA 3TEXA 1AN8A 4JL9A 4M02A 4KV2A 1T3QA 2WYQA 4B6WA 3VFKA 1V1PA 1WSPA 5T8IA 3ZDTA 2DZJA 3HHMA 2I1JA 4IG7B 1KRHA 1P7EA 2Q5WD 3NZSA 4IM2A 4NPNA 3PVLA 3L4PA 1JWBD 4LLGM 1ZOYB 3VXWA 5D94A 2JYEA 3IAM1 1Q5WB 4DXAB 3AU4A 3VR9B 4HROA 2JVCA 3TEZA 4I6LB 2WXHA 1ZDXA 3WANA 1CK1A 4AQ7A 2PMVA 2M56B 3DHIC 3Q8CA 1V8CA 3HUIA 5D3DA 3X23A 4JE3B 5KHQA 3A1QA 2DHZA 2ZPYA 1MG4A 2HD5B 1R4NB 3BK2A 1CMXB 3OG5A 4RGTA 3VTUA 1YIWA 5H92C 1YJIA 1HTQA 2L05A 1J7BA 3M3JA 2N7EA 4L23A 3U30A 3FAHA 4WURA 3R66C 1E7UA 5L83A 3Q6BA 1WJNA 1KFYB 1TIFA 1LGRA 4S0RA 2MLBA 4RH6A 3DHGC 2WP9B 2J0MA 1ET6A 2KDMA 1RLFA 4G50A 3D32A 3VTWA 3AEDB 2ZCCA 2YVCA 2JSVX 1L0VB 2KQ4X 1EU3A 4KKJA 3HVDA 3AMZA 4CO7A 4IW0A 4FN2A 1AW7A 5HFYA 4HJGE 2WWZA 1XF5L 4N6EB 3CF6E 2B76B 1IPGA 3GE3C 1NI2A 2MP2A 1V81A 3P63A 3BVZA 5G2NA 1HZ5A 3NVVA 2IJ0A 5AZFA 4P7IA 4WWNA 3FILA 1WJUA 4B95A 2BS4B 1QQRA 4W9LA 1KTKA 4US9A 4N58A 1ZP0B 2KFKA 1NVID 2SAKA 4NJCA 2MBHA 2ZCBA 1YQBA 4K3CA 4ZYSA 4M8MA 1K52A 2KQSA 3MC0B 4L1BA 1T0RC 4C7ZA 4ANXA 2KO3A 5BMGA 5C23A 2O2VB 1FPYA 4G11A 3K9OB 4RFBA 1SBBB 3APCA 2KLCA 4WWOA 5BO4B 4WAFA 1CQVA 4W9IA 1I4RA 4AP4C 2KKCA 3BYYB 3PS6A 1C4AA 3A4SC 3Q8EA 1BXTA 2FCQA 4TMAB 2HE7A 3V61A 2WXMA 4JWUC 2BYTA 3RD2A 3PZ8A 1OTRB 1R4MI 1C78A 3IXSA 2MCNB 2PPHA 1D5MC 1VCBA 2KDFB 4EOYA 1BMLC 4ZOHC 1WR1A 1KOTA 2JPHA 1HEZE 1T0SC 3ZLZA 2KX0A 4YSYB 1GC6A 2LJIA 2K6QA 2DNFA 2NCNA 3AEGB 3NRZA 4PS3A 3BZDB 3ONSA 4MSMB 3QC8B 4LCDE 3NVZA 4K7SA 3S2AA 4IM3A 2H89B 2Y5PA 2CHZA 1U4AA 2L8JA 3AE6B 2WNMA 2N1VA 3P4PB 2NTSA 1C77A 4XWTA 3NJTA 2GBNA 2CJNA 4HVBA 1J7CA 2L00B 3Q3NC 2OJRA 1E8ZA 1GB1A 4M01A 4OZCA 3AXCA 1SSNA 3H7PA 2W3RA 1XCQL 2K8HA 4MGIE 2WHIA 2KTRB 4P1CC 2QDFA 2HDEA 5AUKA 4MH8A 1LO5D 1A5RA 4MM3A 4FHJA 2LGXA 3HK0A 2AEHA 4WQOB 2DZMA 2O6VD 1SJED 3ZNGC 3SHQA 2O6VB 2PKOA 4ACFA 4XDDA 4JLCA 3MTNB 1L6VA 1STEA 4P16A 5HKHA 1WXMA 2V0GA 2G1EA 1WIAA 3O65B 1SE2A 2JWZA 3QWZB 2JZPA 3VRBB 4RGNA 1WXAA 4W9DA 4EUTA 2FCMA 2A5UA 2N9KA 2WXGA 1I42A 2G4SA 5GMVA 2WXIA 3RNCC 1PQSA 5AUIA 1EO6A 2Z0EB 1B9RA 4GIVA 4OZAA 1C3TA 5CHWA 3MJWA 1OEYA 1WZ3A 2X8XX 5DPRA 2K25A 4YTNB 3SD5A 1KLGD 1MVKA 3KUZA 3W1SC 3IT6B 2KQ7A 2CU1A 2WDQB 4BZAA 4HXDA 3AULA 1I35A 1I4XA 1GPXA 3KW5B 2MH7A 3CSTA 2K3UA 1XLOA 4ZRJA 2PTLA 4ZRPA 3GZNI 4I6PA 1WM3A 2ZW1A 3BWUD 2L52A 3R7QA 1ZKHA 4C4VA 1ZW7A 4URKA 3M63B 2V3SA 4RF1A 4W9HA 1TJEA 2K6DB 3E9SA 2XK5A 1FRDA 1E5WA 2TSSA 2MRPA 2XNAC 3U8ZA 1QOGA 1ZPSA 3L17A 4GDLA 4HPMB 4IDIA 1D3ZA 4JWSC 1GB4A 5D3IB 2REXA 4GU2A 1VZ6A 2D3BA 2MW5A 2DYOA 3NVYA 4XE0A 3IHPC 2WXFA 4IWQA 3U2SC 3DHHC 3SFDB 1FNUA 3RN9C 2OOBB 3ZYYX 1WE7A 2HJ8A 2HJ1A 2WQYB 4OZBA 2LRWA 5E6JA 1QZEA 1NI3A 2G3QB 3JSVB 1L4DB 4O1NA 3RUIB 3V3XA 3EECA 2BYEA 1F77A 3A9JB 1N62A 5D6JB 5G55A 4XZ4A 4YTMB 3LJ3A 1SE9A 4HLEA 4USAA 4LNKA 3DQVA 2DZKA 3ZTDA 4A20A 2RDGA 2D5GA 3VH4B 4KGTA 2M1MA 4F8CB 4J6IA 1F0ZA 2HTME 2LWPA 2GOWA 2BS3B 1Z5SB 3V6EB 2L0TA 2Z0DB 2I2YA 4N9F4 2KTRA 2ONQA 3DPDA 1R4NI 1FMAD 2A4ZA 3VAWA 1E90A 2QC8A 4RGOS 4JGHB 2RGFA 2BWES 4OVVA 2O6VA 1NYQA 2KD0A 2EMSA 1YQ3B 1JCKB 2BS2B 2WXNA 4XDCA 4OHJA 2E6XA 3ZXRA 3UGBB 1E8YA 2DAJA 2RDBC 3ZVVA 2KVZA 1XEEA 2LXAA 3TUOA 2KWVB 3V60A 2C7MB 1WMHB 1ISNA 2KOXA 4GOCA 3FC4A 4G0NB 4W9KA 4YT0B 2AL6A 1EM7A 2IPKD 3UIPB 3VQIA 1FM0D 1RRBA 2BYFA 2LGDA 4NZLB 3RZFA 4K3BA 3ZNZB 2LGYA 4HK2A 2BQQA 4YWGG 4KIKB 1TZ1A 2QHOA 3DWGC 4H2AA 1PYWD 1IYFA 2ACZB 5EE1A 3ZGZA 2W54A 4EE2A 1Z2MA 1N6ZA 2ZEQA 5E6PA 3KQ4A 2WLBA 2R61A 3AEEB 5JH5C 2FUG1 1SF0A 2JF5A 1HTOA 1FRRA 5HI1A 4IWOA 2DBYA 1WX7A 3PREA 4G3XB 4FJYA 1BUIC 1XLNA 1WGDA 4W9FA 3N1XC 1MI0A 4WWMA 4AJWA 3J9CA 2DLBA 3QHTA 1D5XC 3GZNB 1D5ZC 3NOBA 3KLSX 2K39A 5BYQA 2VH1A 2GBRA 1F2RI 2NPTA 1WJ6A 4P6VF 3B2GA 3AE3B 1SE4A 2KWUB 4MGZE 1V5OA 1KM7A 1EF5A 4LNIA 4A6QA 1YD8U 2FAZA 3L08A 3R2IA 5E6NA 1FXAA 3R8BA 1A70A 5HHDG 4MACA 2GMIC 4E3CA 3NZ3A 1OFFA 1YOVB 1L0XB 4JPSA 4E74A 2JRHA 2JRIB 1WXVA 1TBEA 3T3OA 1XO3A 1C76A 1VD2A 2K22A 3DWMA 2JY6A 2BF8B 5D2MB 2MJDA 3IVFA 4FBJB 1ZXIA 2KHWB 4HKQA 1MJDA 4PYUA 4BKTA 4RMAA 2C7HA 4EFOA 3IG3A 3H6NA 2J4XA 3IFWB 3DCGA 3H9DA 5G5GA 4L2YA 4OVUA 4HDOA 3ML9A 1NEKB 3IT4B 1F9JA 3JVZX 1JRPA 4OW0A 2IY1B 4PYZA 2FCSA 2W55A 2KTFA 3Q8FA 4A3PA 2QEJC 1N63A 3A33B 1UBIA 4NQKE 3V6CB 3EFUA 2IO2B 4WJNA 4C00A 2FBWB 4CQNA 1KLVA 3ZTCA 1WMHA 5BYSA 3T9LA 4RM9A 2KJHB 4MJSA 2JZ3B 3R7RA 3SR6A 2R2OA 1E9MA 1E0ZA 2WDVB 3V05A 2WDTB 2ICIA 5DPSA 1TKGA 1JMLA 1I4PA 2FE8A 4NJ6A 3URYA 4FHKA 2AYOB 3DVGY 1WGYA 3ZW3A 4NAWA 4ZYNA 3ZIMA 1XLPA 2G9HD 2ZNVC 3N1ZC 4TV3A 2V4LA 3W5UB 1I4HA 2KANA 5AEKB 1SE3A 4WJPA 2MBEA 3QA8A 2BB5A 3SU8X 4MT5A 3U52E 2MHJA 2C60A 2L83A 4DXFA 3ZNID 3ZDMC 2KJ6A 4YXDB 4PK1A 3A9KB 2KFJA 5FK9C 3RNFC 2NTTA 2FIDA 2YEPB 2J0KA 3TIXA 1V49A 1WX8A 2KWCA 5I4DA 4RF0A 5FKAC 1N5XA 2WXPA 3WA0A 2ZZPB 3ZUNA 2ZW0A 4ICUA 1S1QB 2D11A 3NS1A 3PZ7A 2RR9A 1JALA 2JX5A 2LD9A 3M62B 4D2KA 3EA6A 5L95C 4AUQC 4FXCA 3RYTA 1P3QU 2KJRA 1KF6B 2MBBB 4DDGD 1E7PB 3U7DA 3DBSA 2JZZA 2RDHA 2MX2A 4EKUA 2NBUA 4XC2A 4FA6A 5IAAC 2QILA 3NHEB 1WXSA 3HM6X 2KC1A 1WE6A 3ZJVA 2JU6X 3DVNV 2LEKA 2WU2B 2J42A 4LNOA 1SGHA 2KYWA 2X38A 5CHFA 2DX5B 4GMVA 4FULA 4YL8A 2IGGA 4TSSA 3QCAA 3VDZA 1YN3A 1NENB 2NBVB 1GJZA 2NR2A 1OGWA 5EE9A 1VLBA 1AWDA 4BVUC 3W1YA 1FIQA 3AH7A 2BVCA 2AQ3B 3T8MA 2NS5A 1M4VA 4W9CA 4WAAA 2QJLA 3AB5A 1XLQA 2WX0A 5IKCM 1JWUD 2D3CA 2BBCA 2IO1B 2WXJA 1SEBD 2ASQA 2J53A 4IWPA 1D6EC 2H88B 2JT4B 2QSDA 3I9V1 1OQQA 1EUVB 3P4SB 4XWWA 3ABVB 1V6EA 3AE9B 3FKYA 2WS3B 1WFYA 3TCAA 1J0GA 2AX5A 1ZDVA 1Q10A 2KC2A 2UU7A 2KLGA 3AEFB 4IOIE 5IOIA 4MEMA 1K8RB 3B2FA 2K8BA 3TJPA 2K0PA 3A9KA 1WJ4A 2G4DB 3AE1B 4RM8A 1YQ4B 3NY5A 4WJQA 3NUHB 4A9AA 1HZ6A 3PLVA 2JXTA 5KHOA 4M00A 1QKZA 2KAJA 4PS8A 4YTPB 1AYFA 5J2RA
chains in the Genus database with same CATH topology
2C5LC 2FNJB 3UGBB 1E8YA 2DAJA 3ZVVA 4NPNA 4CHKA 3UQBA 4FLHA 5CHVC 3IBEA 1YJ1A 2LXAA 1GG3A 3PVLA 2XK5B 2KWVB 1WM2A 4GN1A 3P2BA 3UF8A 3V60A 2B3AA 2C7MB 1WMHB 1ISNA 2J0JA 2KOXA 4GOCA 2LZ6A 4W9GA 3PTFC 4G0NB 2YLMA 4W9KA 2MBQA 2IO0B 3VXWA 2AL6A 5D94A 4GDLB 1Q5WB 3UIPB 4DXAB 4MGYE 3RT3B 3QQ8B 2LVOA 3VQIA 2O2VA 3AU4A 2RD0A 4XX5A 3PZDA 2AL3A 1RRBA 2BYFA 2JVCA 2D10A 2LGDA 4I6LB 3RZFA 3WANA 3ZNZB 3JW0X 2LGYA 4HK2A 3APFA 4W9JA 2N7DA 2IBIB 4I6NB 4KIKB 1TZ1A 2QHOA 3QK0A 1GUAB 3X23A 5KHQA 1IYFA 2MA9B 4DHZE 3A1QA 2DHZA 2ZPYA 3EHVA 5LXIB 2MSED 2FCNA 1UELA 2HD5B 2NBWB 1Z2MA 1CMXB 2RSUA 2ZEQA 2FUHB 3W1SA 1JRUA 5C1ZA 1G6JA 4TUUA 2AWTA 5DPWA 5E6PA 3OJ3A 2D2QA 2DENB 4JIOU 3VTUA 1YIWA 5D7GA 3OJ4B 1M94A 5JH5C 2LJ5A 1V80A 1HE8A 3UINB 2WX1A 2L05A 2JF5A 3M3JA 4NNJB 2N7EA 3U30A 4IWOA 4JQWC 3R66C 1E7UA 1XQQA 5L83A 1WX7A 2BKRB 3PREA 4G3XB 2LVPA 2ZJDA 1XT9B 4FJYA 1WJNA 4NQLB 2KVRA 2L7RA 1WGDA 2PE6B 3NZUA 2W9NA 4W9FA 3M95A 4AJWA 2M17A 4KSKC 2MLBA 4DHZB 3QHTA 2M4NA 1P98A 3WIMA 5JHBA 3NOBA 4GGQA 2J0MA 2K39A 2KDEB 1RLFA 2GBRA 2BYVE 2KMAA 3L0WB 4G50A 4FADA 4IUMB 3DDCB 2J7QB 2MQJA 3D32A 4IM0A 4FJZA 3VTWA 1OEYJ 2L3ZA 1E8XA 2LRUA 2ZCCA 2RPQA 2NPTA 1WJ6A 2YVCA 3KVFB 4MGZE 2KWUB 3KYDD 1V5OA 1KM7A 2GBKA 1H8CA 4CO7A 1EF5A 3ALBA 1RFAA 1YD8U 2FAZA 3L08A 4IW0A 4FN2A 2DAFA 5E6NA 4F7ZA 4K7UA 2WWZA 2GMIC 3PLUA 4E3CA 3RZWC 3CF6E 4BBNF 4BKSA 1IPGA 1NI2A 1Y8RC 3ZO5B 2MP2A 2JXXA 1V81A 3WALA 3DOWA 5G2NA 4ASWC 5IA7A 2UYZB 1WX9A 4AWJA 3N30A 4ZRKA 4E74A 2EKEC 5AZFA 2JRHA 2JRIB 1WXVA 4P7IA 4WJOA 1TBEA 2BPSA 1WJUA 3DVNU 4WWNA 4B95A 4E71A 2PE9A 3CMMB 4M8NA 1VD2A 4W9LA 4K1RB 2JY6A 1L2NA 2BF8B 2ZVNA 5D2MB 1V2YA 1BT0A 2R2QA 3Q3JA 4HCPB 1WGHA 2KFKA 3VTVA 4KSLC 3IVFA 4EZLA 2MBHA 4FBJB 4X57B 4W9EA 4GDKA 2ZCBA 1YQBA 2KHWB 4M8MA 1WI0A 2KQSA 4PYUA 4MH0E 4ANXA 1WY8A 4BKTA 3RCZA 2KO3A 3BINA 4A3OA 4RMAA 2C7HA 5C23A 4EFOA 3IG3A 3H6NA 3IFWB 2O2VB 3DCGA 3H9DA 4TQ1A 2GBJA 4HJKA 4OVUA 4HDOA 3ML9A 4G11A 3KH0A 1F9JA 3JVZX 3K9OB 3KUDB 3CSFA 2KDIA 2ZVOA 4ZRIA 3APCA 4FJVB 1ZGUB 3PPAA 3L10B 2KLCA 4KZ0A 4WWOA 5BO4B 1TTNA 2IY1B 4W9IA 1LXDA 4PYZA 4AP4C 2KKCA 4KZCA 2FCSA 2KTFA 3PS6A 4II2B 2LVQA 4GSWA 3V62A 2PJHA 3A4SC 4A3PA 2FCQA 3A33B 5AZHA 2HE7A 1UBIA 4NQKE 3V6CB 1AARA 3V61A 3EFUA 3LDZE 3RD2A 1OTRB 1R4MI 2IO2B 2IYDB 4WJNA 2MCNB 4TQ0A 3H7SA 2PPHA 2JUOA 1L7YA 1VCBA 2M0XA 5CX3A 3VVWB 4CYEA 4HWIB 2KDFB 4EOYA 3UIOB 1KLVA 3ZTCA 1WMHA 1KOTA 1WR1A 2JPHA 4RM9A 2ZPNA 3T9LA 3TL5A 2NVUI 2KJHB 4MJSA 3ZLZA 2KX0A 2JZ3B 1H4RA 3R7RA 1C1YB 1GC6A 2K6QA 2R2OA 2M8SA 3KUCB 2KXJA 2NCNA 1WR6E 2WDTB 4PS3A 1YX5B 1WGRA 3PRMB 3ONSA 1NBFC 3APDA 3QC8B 2PEAA 4LCDE 4MSMB 5DPSA 4K7SA 3S2AA 4IM3A 3WAPA 4NJ6A 2IY0B 4FHKA 3B1LX 2CHZA 2AYOB 1U4AA 1WGGA 2L8JA 4M0WB 3AU5A 4GB9A 4IC7B 3UQAA 3DVGY 1WGYA 3ZW3A 4NAWA 4ZYNA 3OLMD 2N1VA 3ZIMA 2CHWA 3X0WA 1SIFA 4K7WA 2L0FA 2ZNVC 4TV3A 2GBNA 2V4LA 4HVBA 2L00B 1IP9A 2NPTB 2XBBC 2OJRA 3DVGX 2IZVB 1E7VA 1E8ZA 2KANA 5AZGA 5AEKB 3PHWB 3AXCA 1WYWB 2MBEA 4WJPA 3QA8A 3SU8X 2N9EB 3H7PA 3PV1A 5LLIA 2K8HA 4MGIE 2BKFA 2N9PC 2C60A 2KTRB 3ZNID 3ZDMC 3QX1A 1UD7A 2KJ6A 2ZNVB 4DWFA 5JHAA 3JSVA 3A9KB 2MP2B 2KFJA 1KJTA 3EC8A 1A5RA 3A9JA 2FIDA 4MM3A 4FHJA 2J0KA 3MHSD 2BGFA 2LGXA 3HK0A 1J19A 3TIXA 2AEHA 3C0RB 1V49A 2DZMA 2O6VD 1WX8A 4WQOB 3ZNGC 2EMTA 2O6VB 3SHQA 2KWCA 2CS4A 1J8CA 2DZIA 3L16A 4JLCA 4MELA 3NS8A 3MTNB 1GNUA 2LASA 3WA0A 2ZZPB 5HKHA 1WXMA 1GC7A 2KMCA 4EZJA 5E6OA 1WIAA 3O65B 3QWZB 2JWZA 3ZUNA 4HDQA 4ICUA 1WXAA 4W9DA 4EUTA 4KVGB 2FCMA 3AI5A 1S1QB 2A5UA 4LJPB 2D11A 1V86A 5LXHA 1I42A 3N32A 3L13A 2RR9A 4PS7A 1E8WA 1NDDA 2CKHB 2G4SA 5GMVA 1PQSA 2LD9A 2HTHA 3M62B 5DCNA 1EO6A 4AJYB 2Z0EB 4GIVA 2IO3B 2FIFA 4DDID 5CHWA 1C3TA 3MJWA 1OEYA 1WZ3A 4KDLB 3VUYA 4WWPA 4AUQC 5L95C 2LI5A 5DPRA 2C9WB 3RYTA 2KNBA 1P3QU 3L54A 5JZEB 2K25A 2XEWA 2KJRA 3SD5A 3A4RA 2MBBB 1WF9A 4DDGD 3KUZA 3U7DA 3DBSA 2JZZA 2KQ7A 3W1SC 1UBQA 2CU1A 3DBLI 3ZRCA 2MX2A 3VUXA 4EKUA 2NBUA 2Z59B 4HXDA 2K1FA 4TKNA 4XC2A 4FA6A 2D07B 3AULA 3HM3A 3OAWA 1I35A 5IAAC 3ZKJC 4HPLB 1Q1OA 3KW5B 3A1QB 2VRRB 3CSTA 3PGEA 1UZXB 3QAQA 3N3KB 4ZRJA 3NHEB 4ICVA 1LFDA 1WXSA 3GZNI 3VUWA 4I6PA 3HM6X 1WM3A 1V9JA 3ZNHB 1FXTB 2KC1A 1WE6A 1ZKHA 4MJSB 3R7QA 1WH3A 1ZW7A 4LJOB 3ZRFA 4B9KA 3M63B 4BOZB 4NY0A 4EZKA 4URKA 2V3SA 4W9HA 3H1UA 3DVNV 3WAOA 2K6DB 2XK5A 3JYUA 2LUEA 1E5WA 1SGHA 3KYCD 2MRPA 3U8ZA 4MSQB 3L17A 4GDLA 4HPMB 4MGKE 5CHFA 4DHJD 2DX5B 1P1AA 4II3B 4DHJB 1D3ZA 1S3SG 4NAWB 2UWQA 2REXA 4KDIC 4GU2A 3DBRI 4GMVA 4FULA 4YL8A 2MW5A 2DYOA 3SDLC 3QCAA 5TR5A 3VDZA 3VH3B 1OQYA 2DYMA 2NBVB 4KIKA 1YX6B 3PHXB 3WAMA 4ANUA 1GJZA 2NR2A 3IHPC 1OGWA 4BVUC 3HIZA 3W1YA 4IWQA 5EDSA 1X1MA 2CR5A 3GOEA 3H7PB 4DBGA 2OOBB 4K81A 5CTRC 4BOSC 4BBNC 1UGMA 1WE7A 1XD3B 2HJ8A 3PT2B 3QARA 4AOFA 2KX3A 4F1SA 1TGZB 2LRWA 3T8MA 1QZEA 2G3QB 3JSVB 5J17A 4GXBA 2NS5A 3B0AA 3Q3FA 3RUIB 1V5TA 3TMPB 1WZ0A 4W9CA 1P9DU 4WAAA 3EECA 1Q0WB 2BYEA 3VHTC 4BFRA 3A9JB 5D6JB 1WRDB 2V1YA 5G55A 2WX0A 4NJ7A 2BWFA 4BKSD 3I3TB 4XZ4A 1T0YA 3LJ3A 3BY4B 2IO1B 1LQBA 1SE9A 2ASQA 4HLEA 4IWPA 3DQVA 1MG8A 2DZKA 2JT4B 3ZTDA 4A20A 4ANVA 1EUVB 5FR6A 2GBMA 3TBLD 2KZRA 2KN5A 3VH4B 1V6EA 4HCNB 2M1MA 4ZDVA 2I1KA 4MDKE 4F8CB 1RAXA 1P0RA 1WFYA 3TCAA 1J0GA 1UH6A 2LXCA 4J6IA 2N4FA 2KK8A 2KC2A 2KFKB 4DK5A 2DYBA 4GDKB 2KLGA 4ANWA 2LWPA 2GOWA 1Z5SB 3V6EB 2L0TA 2Z0DB 3B08A 4IM2A 2Y5BB 1LM8B 3PRPB 2C7NB 4N9F4 2KDBA 2KTRA 3ECIA 2K8CA 3DPDA 3K9PB 3QIJA 4MEMA 2MWSB 1R4NI 1K8RB 2A4ZA 3RULA 2N9XA 2G45B 3PSEB 2D3GA 2K8BA 2N1WA 3TJPA 5J18A 3VAWA 1E90A 3A9KA 4EEWA 2CHXA 1WJ4A 2MBOA 2G4DB 3ENEA 3PRZA 4LDTD 4JGHB 5DPTA 4LDTB 2RGFA 2BWES 4RM8A 3NY5A 4OVVA 4JL9A 4KV2A 4WJQA 2O6VA 2KD0A 2EMSA 2WYQA 3PLVA 4B6WA 3VFKA 3ZDTA 3DBHI 2DZJA 3HHMA 2I1JA 2L76A 3ML8A 4IG7B 3QJZA 5KHOA 4BKGA 3R3MA 4PS8A 3NZSA 1EF1A 5J2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5L C;  2FNJ B;  3UGB B;  1E8Y A;  2DAJ A;  3ZVV A;  4NPN A;  4CHK A;  3UQB A;  4FLH A;  5CHV C;  3IBE A;  1YJ1 A;  2LXA A;  1GG3 A;  3PVL A;  2XK5 B;  2KWV B;  1WM2 A;  4GN1 A;  3P2B A;  3UF8 A;  3V60 A;  2B3A A;  2C7M B;  1WMH B;  1ISN A;  2J0J A;  2KOX A;  4GOC A;  2LZ6 A;  4W9G A;  3PTF C;  4G0N B;  2YLM A;  4W9K A;  2MBQ A;  2IO0 B;  3VXW A;  2AL6 A;  5D94 A;  4GDL B;  1Q5W B;  3UIP B;  4DXA B;  4MGY E;  3RT3 B;  3QQ8 B;  2LVO A;  3VQI A;  2O2V A;  3AU4 A;  2RD0 A;  4XX5 A;  3PZD A;  2AL3 A;  1RRB A;  2BYF A;  2JVC A;  2D10 A;  2LGD A;  4I6L B;  3RZF A;  3WAN A;  3ZNZ B;  3JW0 X;  2LGY A;  4HK2 A;  3APF A;  4W9J A;  2N7D A;  2IBI B;  4I6N B;  4KIK B;  1TZ1 A;  2QHO A;  3QK0 A;  1GUA B;  3X23 A;  5KHQ A;  1IYF A;  2MA9 B;  4DHZ E;  3A1Q A;  2DHZ A;  2ZPY A;  3EHV A;  5LXI B;  2MSE D;  2FCN A;  1UEL A;  2HD5 B;  2NBW B;  1Z2M A;  1CMX B;  2RSU A;  2ZEQ A;  2FUH B;  3W1S A;  1JRU A;  5C1Z A;  1G6J A;  4TUU A;  2AWT A;  5DPW A;  5E6P A;  3OJ3 A;  2D2Q A;  2DEN B;  4JIO U;  3VTU A;  1YIW A;  5D7G A;  3OJ4 B;  1M94 A;  5JH5 C;  2LJ5 A;  1V80 A;  1HE8 A;  3UIN B;  2WX1 A;  2L05 A;  2JF5 A;  3M3J A;  4NNJ B;  2N7E A;  3U30 A;  4IWO A;  4JQW C;  3R66 C;  1E7U A;  1XQQ A;  5L83 A;  1WX7 A;  2BKR B;  3PRE A;  4G3X B;  2LVP A;  2ZJD A;  1XT9 B;  4FJY A;  1WJN A;  4NQL B;  2KVR A;  2L7R A;  1WGD A;  2PE6 B;  3NZU A;  2W9N A;  4W9F A;  3M95 A;  4AJW A;  2M17 A;  4KSK C;  2MLB A;  4DHZ B;  3QHT A;  2M4N A;  1P98 A;  3WIM A;  5JHB A;  3NOB A;  4GGQ A;  2J0M A;  2K39 A;  2KDE B;  1RLF A;  2GBR A;  2BYV E;  2KMA A;  3L0W B;  4G50 A;  4FAD A;  4IUM B;  3DDC B;  2J7Q B;  2MQJ A;  3D32 A;  4IM0 A;  4FJZ A;  3VTW A;  1OEY J;  2L3Z A;  1E8X A;  2LRU A;  2ZCC A;  2RPQ A;  2NPT A;  1WJ6 A;  2YVC A;  3KVF B;  4MGZ E;  2KWU B;  3KYD D;  1V5O A;  1KM7 A;  2GBK A;  1H8C A;  4CO7 A;  1EF5 A;  3ALB A;  1RFA A;  1YD8 U;  2FAZ A;  3L08 A;  4IW0 A;  4FN2 A;  2DAF A;  5E6N A;  4F7Z A;  4K7U A;  2WWZ A;  2GMI C;  3PLU A;  4E3C A;  3RZW C;  3CF6 E;  4BBN F;  4BKS A;  1IPG A;  1NI2 A;  1Y8R C;  3ZO5 B;  2MP2 A;  2JXX A;  1V81 A;  3WAL A;  3DOW A;  5G2N A;  4ASW C;  5IA7 A;  2UYZ B;  1WX9 A;  4AWJ A;  3N30 A;  4ZRK A;  4E74 A;  2EKE C;  5AZF A;  2JRH A;  2JRI B;  1WXV A;  4P7I A;  4WJO A;  1TBE A;  2BPS A;  1WJU A;  3DVN U;  4WWN A;  4B95 A;  4E71 A;  2PE9 A;  3CMM B;  4M8N A;  1VD2 A;  4W9L A;  4K1R B;  2JY6 A;  1L2N A;  2BF8 B;  2ZVN A;  5D2M B;  1V2Y A;  1BT0 A;  2R2Q A;  3Q3J A;  4HCP B;  1WGH A;  2KFK A;  3VTV A;  4KSL C;  3IVF A;  4EZL A;  2MBH A;  4FBJ B;  4X57 B;  4W9E A;  4GDK A;  2ZCB A;  1YQB A;  2KHW B;  4M8M A;  1WI0 A;  2KQS A;  4PYU A;  4MH0 E;  4ANX A;  1WY8 A;  4BKT A;  3RCZ A;  2KO3 A;  3BIN A;  4A3O A;  4RMA A;  2C7H A;  5C23 A;  4EFO A;  3IG3 A;  3H6N A;  3IFW B;  2O2V B;  3DCG A;  3H9D A;  4TQ1 A;  2GBJ A;  4HJK A;  4OVU A;  4HDO A;  3ML9 A;  4G11 A;  3KH0 A;  1F9J A;  3JVZ X;  3K9O B;  3KUD B;  3CSF A;  2KDI A;  2ZVO A;  4ZRI A;  3APC A;  4FJV B;  1ZGU B;  3PPA A;  3L10 B;  2KLC A;  4KZ0 A;  4WWO A;  5BO4 B;  1TTN A;  2IY1 B;  4W9I A;  1LXD A;  4PYZ A;  4AP4 C;  2KKC A;  4KZC A;  2FCS A;  2KTF A;  3PS6 A;  4II2 B;  2LVQ A;  4GSW A;  3V62 A;  2PJH A;  3A4S C;  4A3P A;  2FCQ A;  3A33 B;  5AZH A;  2HE7 A;  1UBI A;  4NQK E;  3V6C B;  1AAR A;  3V61 A;  3EFU A;  3LDZ E;  3RD2 A;  1OTR B;  1R4M I;  2IO2 B;  2IYD B;  4WJN A;  2MCN B;  4TQ0 A;  3H7S A;  2PPH A;  2JUO A;  1L7Y A;  1VCB A;  2M0X A;  5CX3 A;  3VVW B;  4CYE A;  4HWI B;  2KDF B;  4EOY A;  3UIO B;  1KLV A;  3ZTC A;  1WMH A;  1KOT A;  1WR1 A;  2JPH A;  4RM9 A;  2ZPN A;  3T9L A;  3TL5 A;  2NVU I;  2KJH B;  4MJS A;  3ZLZ A;  2KX0 A;  2JZ3 B;  1H4R A;  3R7R A;  1C1Y B;  1GC6 A;  2K6Q A;  2R2O A;  2M8S A;  3KUC B;  2KXJ A;  2NCN A;  1WR6 E;  2WDT B;  4PS3 A;  1YX5 B;  1WGR A;  3PRM B;  3ONS A;  1NBF C;  3APD A;  3QC8 B;  2PEA A;  4LCD E;  4MSM B;  5DPS A;  4K7S A;  3S2A A;  4IM3 A;  3WAP A;  4NJ6 A;  2IY0 B;  4FHK A;  3B1L X;  2CHZ A;  2AYO B;  1U4A A;  1WGG A;  2L8J A;  4M0W B;  3AU5 A;  4GB9 A;  4IC7 B;  3UQA A;  3DVG Y;  1WGY A;  3ZW3 A;  4NAW A;  4ZYN A;  3OLM D;  2N1V A;  3ZIM A;  2CHW A;  3X0W A;  1SIF A;  4K7W A;  2L0F A;  2ZNV C;  4TV3 A;  2GBN A;  2V4L A;  4HVB A;  2L00 B;  1IP9 A;  2NPT B;  2XBB C;  2OJR A;  3DVG X;  2IZV B;  1E7V A;  1E8Z A;  2KAN A;  5AZG A;  5AEK B;  3PHW B;  3AXC A;  1WYW B;  2MBE A;  4WJP A;  3QA8 A;  3SU8 X;  2N9E B;  3H7P A;  3PV1 A;  5LLI A;  2K8H A;  4MGI E;  2BKF A;  2N9P C;  2C60 A;  2KTR B;  3ZNI D;  3ZDM C;  3QX1 A;  1UD7 A;  2KJ6 A;  2ZNV B;  4DWF A;  5JHA A;  3JSV A;  3A9K B;  2MP2 B;  2KFJ A;  1KJT A;  3EC8 A;  1A5R A;  3A9J A;  2FID A;  4MM3 A;  4FHJ A;  2J0K A;  3MHS D;  2BGF A;  2LGX A;  3HK0 A;  1J19 A;  3TIX A;  2AEH A;  3C0R B;  1V49 A;  2DZM A;  2O6V D;  1WX8 A;  4WQO B;  3ZNG C;  2EMT A;  2O6V B;  3SHQ A;  2KWC A;  2CS4 A;  1J8C A;  2DZI A;  3L16 A;  4JLC A;  4MEL A;  3NS8 A;  3MTN B;  1GNU A;  2LAS A;  3WA0 A;  2ZZP B;  5HKH A;  1WXM A;  1GC7 A;  2KMC A;  4EZJ A;  5E6O A;  1WIA A;  3O65 B;  3QWZ B;  2JWZ A;  3ZUN A;  4HDQ A;  4ICU A;  1WXA A;  4W9D A;  4EUT A;  4KVG B;  2FCM A;  3AI5 A;  1S1Q B;  2A5U A;  4LJP B;  2D11 A;  1V86 A;  5LXH A;  1I42 A;  3N32 A;  3L13 A;  2RR9 A;  4PS7 A;  1E8W A;  1NDD A;  2CKH B;  2G4S A;  5GMV A;  1PQS A;  2LD9 A;  2HTH A;  3M62 B;  5DCN A;  1EO6 A;  4AJY B;  2Z0E B;  4GIV A;  2IO3 B;  2FIF A;  4DDI D;  5CHW A;  1C3T A;  3MJW A;  1OEY A;  1WZ3 A;  4KDL B;  3VUY A;  4WWP A;  4AUQ C;  5L95 C;  2LI5 A;  5DPR A;  2C9W B;  3RYT A;  2KNB A;  1P3Q U;  3L54 A;  5JZE B;  2K25 A;  2XEW A;  2KJR A;  3SD5 A;  3A4R A;  2MBB B;  1WF9 A;  4DDG D;  3KUZ A;  3U7D A;  3DBS A;  2JZZ A;  2KQ7 A;  3W1S C;  1UBQ A;  2CU1 A;  3DBL I;  3ZRC A;  2MX2 A;  3VUX A;  4EKU A;  2NBU A;  2Z59 B;  4HXD A;  2K1F A;  4TKN A;  4XC2 A;  4FA6 A;  2D07 B;  3AUL A;  3HM3 A;  3OAW A;  1I35 A;  5IAA C;  3ZKJ C;  4HPL B;  1Q1O A;  3KW5 B;  3A1Q B;  2VRR B;  3CST A;  3PGE A;  1UZX B;  3QAQ A;  3N3K B;  4ZRJ A;  3NHE B;  4ICV A;  1LFD A;  1WXS A;  3GZN I;  3VUW A;  4I6P A;  3HM6 X;  1WM3 A;  1V9J A;  3ZNH B;  1FXT B;  2KC1 A;  1WE6 A;  1ZKH A;  4MJS B;  3R7Q A;  1WH3 A;  1ZW7 A;  4LJO B;  3ZRF A;  4B9K A;  3M63 B;  4BOZ B;  4NY0 A;  4EZK A;  4URK A;  2V3S A;  4W9H A;  3H1U A;  3DVN V;  3WAO A;  2K6D B;  2XK5 A;  3JYU A;  2LUE A;  1E5W A;  1SGH A;  3KYC D;  2MRP A;  3U8Z A;  4MSQ B;  3L17 A;  4GDL A;  4HPM B;  4MGK E;  5CHF A;  4DHJ D;  2DX5 B;  1P1A A;  4II3 B;  4DHJ B;  1D3Z A;  1S3S G;  4NAW B;  2UWQ A;  2REX A;  4KDI C;  4GU2 A;  3DBR I;  4GMV A;  4FUL A;  4YL8 A;  2MW5 A;  2DYO A;  3SDL C;  3QCA A;  5TR5 A;  3VDZ A;  3VH3 B;  1OQY A;  2DYM A;  2NBV B;  4KIK A;  1YX6 B;  3PHX B;  3WAM A;  4ANU A;  1GJZ A;  2NR2 A;  3IHP C;  1OGW A;  4BVU C;  3HIZ A;  3W1Y A;  4IWQ A;  5EDS A;  1X1M A;  2CR5 A;  3GOE A;  3H7P B;  4DBG A;  2OOB B;  4K81 A;  5CTR C;  4BOS C;  4BBN C;  1UGM A;  1WE7 A;  1XD3 B;  2HJ8 A;  3PT2 B;  3QAR A;  4AOF A;  2KX3 A;  4F1S A;  1TGZ B;  2LRW A;  3T8M A;  1QZE A;  2G3Q B;  3JSV B;  5J17 A;  4GXB A;  2NS5 A;  3B0A A;  3Q3F A;  3RUI B;  1V5T A;  3TMP B;  1WZ0 A;  4W9C A;  1P9D U;  4WAA A;  3EEC A;  1Q0W B;  2BYE A;  3VHT C;  4BFR A;  3A9J B;  5D6J B;  1WRD B;  2V1Y A;  5G55 A;  2WX0 A;  4NJ7 A;  2BWF A;  4BKS D;  3I3T B;  4XZ4 A;  1T0Y A;  3LJ3 A;  3BY4 B;  2IO1 B;  1LQB A;  1SE9 A;  2ASQ A;  4HLE A;  4IWP A;  3DQV A;  1MG8 A;  2DZK A;  2JT4 B;  3ZTD A;  4A20 A;  4ANV A;  1EUV B;  5FR6 A;  2GBM A;  3TBL D;  2KZR A;  2KN5 A;  3VH4 B;  1V6E A;  4HCN B;  2M1M A;  4ZDV A;  2I1K A;  4MDK E;  4F8C B;  1RAX A;  1P0R A;  1WFY A;  3TCA A;  1J0G A;  1UH6 A;  2LXC A;  4J6I A;  2N4F A;  2KK8 A;  2KC2 A;  2KFK B;  4DK5 A;  2DYB A;  4GDK B;  2KLG A;  4ANW A;  2LWP A;  2GOW A;  1Z5S B;  3V6E B;  2L0T A;  2Z0D B;  3B08 A;  4IM2 A;  2Y5B B;  1LM8 B;  3PRP B;  2C7N B;  4N9F 4;  2KDB A;  2KTR A;  3ECI A;  2K8C A;  3DPD A;  3K9P B;  3QIJ A;  4MEM A;  2MWS B;  1R4N I;  1K8R B;  2A4Z A;  3RUL A;  2N9X A;  2G45 B;  3PSE B;  2D3G A;  2K8B A;  2N1W A;  3TJP A;  5J18 A;  3VAW A;  1E90 A;  3A9K A;  4EEW A;  2CHX A;  1WJ4 A;  2MBO A;  2G4D B;  3ENE A;  3PRZ A;  4LDT D;  4JGH B;  5DPT A;  4LDT B;  2RGF A;  2BWE S;  4RM8 A;  3NY5 A;  4OVV A;  4JL9 A;  4KV2 A;  4WJQ A;  2O6V A;  2KD0 A;  2EMS A;  2WYQ A;  3PLV A;  4B6W A;  3VFK A;  3ZDT A;  3DBH I;  2DZJ A;  3HHM A;  2I1J A;  2L76 A;  3ML8 A;  4IG7 B;  3QJZ A;  5KHO A;  4BKG A;  3R3M A;  4PS8 A;  3NZS A;  1EF1 A;  5J2R A; 
#chains in the Genus database with same CATH topology
 1WWT A;  2Y3A A;  3GB1 A;  2FNJ B;  3MHZ A;  4CHK A;  2Z8L A;  3IBE A;  2E3T A;  5EE0 A;  4P1B C;  3P2B A;  2VZK D;  2B3A A;  2J0J A;  2YLM A;  1PGB A;  4MGY E;  3RT3 B;  2LVO A;  2O2V A;  2RD0 A;  2KN4 A;  4W9J A;  2IBI B;  1TT5 B;  3NG0 A;  3AN1 A;  3IAS 1;  3N9Y C;  2MA9 B;  3EHV A;  5LXI B;  1IBX B;  1UEL A;  2NBW B;  2RSU A;  3W1S A;  1JRU A;  5C1Z A;  1G6J A;  4TUU A;  2AWT A;  1FXI A;  5H8Y E;  3OJ3 A;  4DXG A;  5DPW A;  1QF6 A;  4XGA B;  2DEN B;  5D7G A;  3I5J C;  1M94 A;  3OJ4 B;  3UIN B;  1V80 A;  1HE8 A;  4UDU C;  2QCZ A;  5FR3 A;  3CIR B;  3U4E G;  3MFG A;  4LTU A;  4WQM A;  1UGJ A;  4ZRQ A;  1XQQ A;  2BKR B;  2PW9 A;  2SEB D;  2WDR B;  2ZJD A;  1XT9 B;  4NQL B;  2KVR A;  2L7R A;  2PE6 B;  3RI7 C;  2W9N A;  3RNB C;  3BK1 A;  1R7S A;  2M17 A;  4KSK C;  4DHZ B;  3WIM A;  3TEW A;  1GOZ A;  4GGQ A;  2KDE B;  4FAD A;  2BYV E;  1MHX A;  4IUM B;  4A8X C;  1ENF A;  4IM0 A;  4FJZ A;  2RMM A;  1E8X A;  4KGR A;  3KVF B;  3KYD D;  1I7H A;  3ALB A;  3MP9 A;  2DAF A;  2INN E;  1DGJ A;  1SB3 C;  4F7Z A;  4K7U A;  3EGR A;  5BMH A;  3GE8 C;  4BBN F;  1Y8R C;  3ZO5 B;  2JXX A;  4RCO A;  1WX9 A;  3N30 A;  4ZRK A;  2WXK A;  2IDY A;  2QIE B;  2BPS A;  3DVN U;  2AQ2 B;  2PVG C;  4E71 A;  2PE9 A;  3CMM B;  4M8N A;  2N0S B;  3MJ5 A;  1L2N A;  2ZVN A;  1V2Y A;  1BT0 A;  3GS2 A;  3Q3J A;  3HRD D;  4HCP B;  4EZL A;  4ARC A;  5GXG B;  3W5V B;  1WI0 A;  1SXT A;  2MJ3 A;  4MH0 E;  4DQO C;  1TS3 A;  1WY8 A;  2W3S A;  3RCZ A;  1ROE A;  4A3O A;  1TS2 A;  1MHH E;  2PLP A;  3Q3O C;  3VRA B;  4TQ1 A;  1JWS D;  3KUD B;  3CSF A;  2KDI A;  4FJV B;  3PPA A;  4OVZ A;  3L10 B;  3LXF A;  1ZXH A;  4KZ0 A;  3SEB A;  3EFC A;  1TTN A;  1LXD A;  3NVW A;  3RFZ B;  4KZC A;  4GSW A;  2KMM A;  3V62 A;  5AZH A;  3LDZ E;  3GP7 A;  1DYQ A;  2IYD B;  2WU5 B;  1FEH A;  3H7S A;  2IGH A;  5CX3 A;  4KKI A;  3TEY A;  1YJJ A;  2ZPN A;  5G5H A;  2NVU I;  4ITK A;  1H4R A;  1C1Y B;  3Q69 A;  2M8S A;  2KXJ A;  1IGD A;  5C2T B;  1ESF A;  3EUB 2;  1WGR A;  3PRM B;  4RNA A;  1NBF C;  1TYG B;  1EWY C;  3B1L X;  3AU5 A;  4GB9 A;  1KLU D;  2I38 A;  1SIF A;  1IBX A;  2BB6 A;  2GLS A;  2XBB C;  2IZV B;  1E7V A;  3PV1 A;  2WXR A;  1DOY A;  2N9P C;  1YNT E;  3ETR A;  2ZNV B;  4DWF A;  3C19 A;  3JSV A;  2INC C;  2MP2 B;  5BMI A;  1C4P A;  3EC8 A;  3A9J A;  1FNV A;  1J19 A;  3C0R B;  1CJE A;  3FIL B;  3N20 C;  3L16 A;  4MEL A;  3NS8 A;  1GNU A;  5IP4 D;  1MPE A;  4NAM A;  1GC7 A;  2Y5C A;  2ON8 A;  3N1Y C;  2D3A A;  3C8Y A;  4HDQ A;  1DOX A;  4KVG B;  3N32 A;  3L13 A;  2LGS A;  4PS7 A;  1NDD A;  2CKH B;  2GI9 A;  2YEP F;  2XN9 C;  2LMC A;  5DCN A;  3RMK C;  3MC9 A;  2IO3 B;  2FIF A;  1GAQ B;  3VUY A;  4KDL B;  4WWP A;  2LI5 A;  2PVO D;  2C9W B;  5JZE B;  2KNB A;  4KX6 B;  2LFI A;  3H8H A;  1TS4 A;  5MPO A;  1P7F A;  1UBQ A;  3P1M A;  5BYR A;  2EKI A;  1RM6 C;  1TY2 A;  4TKN A;  3OAW A;  3HM3 A;  4QAY A;  1JRO A;  2VRR B;  1UZX B;  3QAQ A;  3N3K B;  4ICV A;  1PGX A;  4B9K A;  4BOZ B;  4JX1 C;  3H1U A;  3JYU A;  2LUE A;  3KYC D;  1L6U A;  2WXL A;  4MSQ B;  1T6B X;  4DHJ D;  4MGK E;  2V3N A;  3BII D;  4DHJ B;  1P1A A;  4II3 B;  2KAC A;  1L0Y B;  3Q2A C;  1TY0 A;  1QOA A;  1F1H A;  5C3J B;  3SDL C;  5TR5 A;  3VH3 B;  1OQY A;  4KIK A;  3WAM A;  2INP E;  3WCQ A;  1X1M A;  4AS1 A;  3H7P B;  2DWQ A;  1CZP A;  1NYR A;  4DBG A;  4BOS C;  3KWV A;  4K81 A;  5CTR C;  4BBN C;  4R3D A;  1UGM A;  3QAR A;  4LNF A;  3DBL B;  3B0A A;  3Q3F A;  1V5T A;  4ARI A;  1P9D U;  2L1A A;  3LYY A;  1Q0W B;  3VHT C;  4MM3 B;  1WRD B;  3AE2 B;  2V1Y A;  4NJ7 A;  3I63 C;  4BKS D;  2WXO A;  1T0Y A;  3BY4 B;  2IND C;  2K9X A;  4WH4 A;  4LK0 M;  1MG8 A;  1UUP A;  1YMH E;  2GBM A;  3TBL D;  2KZR A;  4HCN B;  2I1K A;  4MDK E;  1N61 A;  1K51 A;  2LXC A;  2N4F A;  1VRA B;  4GDK B;  3Q3M C;  4ANW A;  4Q2J A;  3B08 A;  2Y5B B;  1LM8 B;  3PRP B;  2C7N B;  4B0M A;  2KDB A;  2K8C A;  3QIJ A;  3ZJU A;  3RUL A;  2N9X A;  5J18 A;  3DBR B;  1UF0 A;  1XXG A;  4EEW A;  1IGC A;  2MBO A;  4S17 A;  4LDT D;  4LDT B;  2WGS A;  2N9L A;  3E56 A;  4J3O D;  1VDV A;  3DBH I;  3ML8 A;  2L76 A;  4BKG A;  3P4R B;  3QJZ A;  1FD6 A;  3R3M A;  1TS5 A;  1EF1 A;  2C5L C;  4C4V B;  4ZHO A;  2LGI A;  3UQB A;  4FLH A;  5CHV C;  1YJ1 A;  2OHF A;  1GG3 A;  2XK5 B;  2RPV A;  1WM2 A;  3P42 A;  4GN1 A;  3UF8 A;  4W9G A;  1TKY A;  2N7J A;  2LZ6 A;  2CJO A;  3PTF C;  1YN4 A;  2MBQ A;  2IO0 B;  4REZ A;  4GDL B;  3AM9 A;  3QQ8 B;  1WGK A;  1DOI A;  4XX5 A;  1IUE A;  3PZD A;  2AL3 A;  2D10 A;  3JW0 X;  3PO0 A;  3APF A;  2N7D A;  4I6N B;  1E6E B;  3QK0 A;  2M19 A;  1GUA B;  4DHZ E;  3ZXV A;  2M0A A;  2MSE D;  2FCN A;  3AV8 A;  2FUH B;  2D2Q A;  2JYT A;  4JIO U;  1QLB B;  5IO9 A;  2LJ5 A;  4HPP A;  2WX1 A;  2L32 A;  1WRI A;  4NNJ B;  5IN7 A;  1JW9 D;  4C56 C;  4JQW C;  3CWI A;  2LVP A;  3NZU A;  1C4C A;  4LNN A;  3M95 A;  2MJE A;  3W2D A;  1EU4 A;  2M4N A;  1P98 A;  5JHB A;  1RWS A;  3Q8A A;  1UNS A;  3RNE C;  2KMA A;  1ZE3 D;  3L0W B;  4HEA 1;  4YSX B;  3DDC B;  2J7Q B;  2MQJ A;  1E10 A;  1OEY J;  3HVZ A;  2L3Z A;  2LRU A;  2RPQ A;  5TSS A;  2GBK A;  1H8C A;  1RFA A;  3RNG C;  1ZUD 2;  3R2T A;  3PLU A;  4B0E A;  3RZW C;  4BKS A;  2PIA A;  3T3N A;  1FFV A;  1YN5 A;  3AEA B;  3AE7 B;  3WAL A;  1C79 A;  3DOW A;  4ASW C;  5IA7 A;  2UYZ B;  4AWJ A;  2AQ1 B;  2OED A;  5JXV A;  1V1O A;  2EKE C;  1PFD A;  4WJO A;  1XCT L;  4K1R B;  2R2Q A;  3VTV A;  1WGH A;  4KSL C;  4X57 B;  4W9E A;  4GDK A;  1B1Z A;  2LHD A;  2VH2 A;  1SIJ A;  3BIN A;  1F2R C;  2QMT A;  2GRI A;  2OJW A;  3P4Q B;  2GBJ A;  2VZK B;  4HJK A;  3U7Z A;  3KH0 A;  1V97 A;  2NMQ A;  2ZVO A;  4ZRI A;  1ZGU B;  5HG2 A;  1OQR A;  3TSS A;  4II2 B;  2LVQ A;  2PJH A;  1KH0 A;  1AAR A;  1TZO A;  1WXQ A;  4TQ0 A;  1T5X D;  1WYG A;  2JUO A;  1L7Y A;  2M0X A;  3VVW B;  4CYE A;  4HWI B;  3UIO B;  2EEL A;  3TL5 A;  1HXY D;  3KUC B;  1WR6 E;  2W82 A;  1PGA A;  1YX5 B;  3APD A;  1RFK A;  2PEA A;  1VZ7 A;  1SJH D;  3BVG A;  3WAP A;  2IY0 B;  3AE8 B;  3DBH B;  1WGG A;  3SFE B;  4M0W B;  1L4Z B;  2BT6 A;  4IC7 B;  3UQA A;  4WIP A;  3UI3 A;  3OLM D;  1N5W A;  1K53 A;  1VR9 A;  2CHW A;  3AE5 B;  3X0W A;  1N60 A;  1PUT A;  4K7W A;  2L0F A;  3O13 A;  1IP9 A;  2NPT B;  1J7A A;  1QOB A;  3DVG X;  2KT7 A;  4HKZ E;  5AZG A;  4ZHP A;  3PHW B;  1FNW A;  1WYW B;  2N9E B;  5LLI A;  2BKF A;  3QX1 A;  1UD7 A;  5JHA A;  3KWL A;  1KJT A;  3MHS D;  2BGF A;  1ET9 A;  1R4M B;  2EMT A;  2CS4 A;  1J8C A;  2DZI A;  1V1P B;  2LAS A;  3AE4 B;  4IKG A;  2KMC A;  4EZJ A;  5E6O A;  1JWM D;  3B9J A;  3OWE B;  3LB8 C;  3AI5 A;  4LJP B;  5LXH A;  1V86 A;  1RYJ A;  1QIL A;  2BW2 A;  3W9C B;  1E8W A;  2HTH A;  1ACC A;  4AJY B;  4HRS A;  2JQR B;  3BYT B;  4DDI D;  1EWC A;  3L54 A;  1FO4 A;  2XEW A;  3A4R A;  1WF9 A;  3Q14 C;  3DBL I;  4YSZ B;  3ZRC A;  3VUX A;  4BAX A;  2Z59 B;  2K1F A;  2D07 B;  4XYC A;  3ZKJ C;  4HPL B;  1Q1O A;  3VR8 B;  3A1Q B;  3PGE A;  1UWM A;  2IGD A;  2J52 A;  2K5P A;  1I4Q A;  1LFD A;  3VUW A;  1V9J A;  3ZNH B;  1FXT B;  4MJS B;  3ZRF A;  1WH3 A;  4LJO B;  4EZK A;  4NY0 A;  3WAO A;  2LHE A;  1D4B A;  4GLS C;  3Q8B A;  4KGS A;  3RPF C;  1T0Q C;  1S3S G;  1VJK A;  4NAW B;  5LNK 1;  2UWQ A;  1QOF A;  1I4G A;  4KDI C;  1TKE A;  3DBR I;  3ZQ4 A;  2DYM A;  1K50 A;  1VZ8 A;  1YX6 B;  3PHX B;  4ANU A;  1C9F A;  2MEK A;  3I57 A;  3HIZ A;  5EDS A;  1JWA D;  1L5P A;  2CU3 A;  2GB1 A;  4US8 A;  1HA5 A;  2CR5 A;  3BVM A;  3GOE A;  3MC8 A;  1FCC C;  1XD3 B;  1QT9 A;  3PT2 B;  2JWU A;  4AOF A;  2KX3 A;  4F1S A;  1TGZ B;  3AEB B;  4C80 A;  5J17 A;  4GXB A;  2V9H A;  3TMP B;  1WZ0 A;  4BFR A;  2V4I B;  1MFW A;  2BWF A;  3I3T B;  2LUM A;  1LQB A;  4M0W A;  1Y56 A;  4A55 A;  1JQ4 A;  4ANV A;  2KWD A;  4A90 A;  5FR6 A;  1FCL A;  2KN5 A;  2V3P A;  2WXQ A;  4ZDV A;  1RAX A;  1F52 A;  1P0R A;  3RNA C;  1UH6 A;  4N59 A;  2KK8 A;  2KFK B;  4DK5 A;  1HQR D;  2DYB A;  1PDX A;  1UWX A;  3ZJT A;  4PT5 A;  2BTE A;  4C7Y A;  3ECI A;  3K9P B;  3AEC B;  2MWS B;  1FFU A;  3PSE B;  2G45 B;  2D3G A;  2N1W A;  5EE3 A;  4RGM A;  2CHX A;  3ENE A;  3PRZ A;  5DPT A;  3TEX A;  1AN8 A;  4JL9 A;  4M02 A;  4KV2 A;  1T3Q A;  2WYQ A;  4B6W A;  3VFK A;  1V1P A;  1WSP A;  5T8I A;  3ZDT A;  2DZJ A;  3HHM A;  2I1J A;  4IG7 B;  1KRH A;  1P7E A;  2Q5W D;  3NZS A;  4IM2 A;  4NPN A;  3PVL A;  3L4P A;  1JWB D;  4LLG M;  1ZOY B;  3VXW A;  5D94 A;  2JYE A;  3IAM 1;  1Q5W B;  4DXA B;  3AU4 A;  3VR9 B;  4HRO A;  2JVC A;  3TEZ A;  4I6L B;  2WXH A;  1ZDX A;  3WAN A;  1CK1 A;  4AQ7 A;  2PMV A;  2M56 B;  3DHI C;  3Q8C A;  1V8C A;  3HUI A;  5D3D A;  3X23 A;  4JE3 B;  5KHQ A;  3A1Q A;  2DHZ A;  2ZPY A;  1MG4 A;  2HD5 B;  1R4N B;  3BK2 A;  1CMX B;  3OG5 A;  4RGT A;  3VTU A;  1YIW A;  5H92 C;  1YJI A;  1HTQ A;  2L05 A;  1J7B A;  3M3J A;  2N7E A;  4L23 A;  3U30 A;  3FAH A;  4WUR A;  3R66 C;  1E7U A;  5L83 A;  3Q6B A;  1WJN A;  1KFY B;  1TIF A;  1LGR A;  4S0R A;  2MLB A;  4RH6 A;  3DHG C;  2WP9 B;  2J0M A;  1ET6 A;  2KDM A;  1RLF A;  4G50 A;  3D32 A;  3VTW A;  3AED B;  2ZCC A;  2YVC A;  2JSV X;  1L0V B;  2KQ4 X;  1EU3 A;  4KKJ A;  3HVD A;  3AMZ A;  4CO7 A;  4IW0 A;  4FN2 A;  1AW7 A;  5HFY A;  4HJG E;  2WWZ A;  1XF5 L;  4N6E B;  3CF6 E;  2B76 B;  1IPG A;  3GE3 C;  1NI2 A;  2MP2 A;  1V81 A;  3P63 A;  3BVZ A;  5G2N A;  1HZ5 A;  3NVV A;  2IJ0 A;  5AZF A;  4P7I A;  4WWN A;  3FIL A;  1WJU A;  4B95 A;  2BS4 B;  1QQR A;  4W9L A;  1KTK A;  4US9 A;  4N58 A;  1ZP0 B;  2KFK A;  1NVI D;  2SAK A;  4NJC A;  2MBH A;  2ZCB A;  1YQB A;  4K3C A;  4ZYS A;  4M8M A;  1K52 A;  2KQS A;  3MC0 B;  4L1B A;  1T0R C;  4C7Z A;  4ANX A;  2KO3 A;  5BMG A;  5C23 A;  2O2V B;  1FPY A;  4G11 A;  3K9O B;  4RFB A;  1SBB B;  3APC A;  2KLC A;  4WWO A;  5BO4 B;  4WAF A;  1CQV A;  4W9I A;  1I4R A;  4AP4 C;  2KKC A;  3BYY B;  3PS6 A;  1C4A A;  3A4S C;  3Q8E A;  1BXT A;  2FCQ A;  4TMA B;  2HE7 A;  3V61 A;  2WXM A;  4JWU C;  2BYT A;  3RD2 A;  3PZ8 A;  1OTR B;  1R4M I;  1C78 A;  3IXS A;  2MCN B;  2PPH A;  1D5M C;  1VCB A;  2KDF B;  4EOY A;  1BML C;  4ZOH C;  1WR1 A;  1KOT A;  2JPH A;  1HEZ E;  1T0S C;  3ZLZ A;  2KX0 A;  4YSY B;  1GC6 A;  2LJI A;  2K6Q A;  2DNF A;  2NCN A;  3AEG B;  3NRZ A;  4PS3 A;  3BZD B;  3ONS A;  4MSM B;  3QC8 B;  4LCD E;  3NVZ A;  4K7S A;  3S2A A;  4IM3 A;  2H89 B;  2Y5P A;  2CHZ A;  1U4A A;  2L8J A;  3AE6 B;  2WNM A;  2N1V A;  3P4P B;  2NTS A;  1C77 A;  4XWT A;  3NJT A;  2GBN A;  2CJN A;  4HVB A;  1J7C A;  2L00 B;  3Q3N C;  2OJR A;  1E8Z A;  1GB1 A;  4M01 A;  4OZC A;  3AXC A;  1SSN A;  3H7P A;  2W3R A;  1XCQ L;  2K8H A;  4MGI E;  2WHI A;  2KTR B;  4P1C C;  2QDF A;  2HDE A;  5AUK A;  4MH8 A;  1LO5 D;  1A5R A;  4MM3 A;  4FHJ A;  2LGX A;  3HK0 A;  2AEH A;  4WQO B;  2DZM A;  2O6V D;  1SJE D;  3ZNG C;  3SHQ A;  2O6V B;  2PKO A;  4ACF A;  4XDD A;  4JLC A;  3MTN B;  1L6V A;  1STE A;  4P16 A;  5HKH A;  1WXM A;  2V0G A;  2G1E A;  1WIA A;  3O65 B;  1SE2 A;  2JWZ A;  3QWZ B;  2JZP A;  3VRB B;  4RGN A;  1WXA A;  4W9D A;  4EUT A;  2FCM A;  2A5U A;  2N9K A;  2WXG A;  1I42 A;  2G4S A;  5GMV A;  2WXI A;  3RNC C;  1PQS A;  5AUI A;  1EO6 A;  2Z0E B;  1B9R A;  4GIV A;  4OZA A;  1C3T A;  5CHW A;  3MJW A;  1OEY A;  1WZ3 A;  2X8X X;  5DPR A;  2K25 A;  4YTN B;  3SD5 A;  1KLG D;  1MVK A;  3KUZ A;  3W1S C;  3IT6 B;  2KQ7 A;  2CU1 A;  2WDQ B;  4BZA A;  4HXD A;  3AUL A;  1I35 A;  1I4X A;  1GPX A;  3KW5 B;  2MH7 A;  3CST A;  2K3U A;  1XLO A;  4ZRJ A;  2PTL A;  4ZRP A;  3GZN I;  4I6P A;  1WM3 A;  2ZW1 A;  3BWU D;  2L52 A;  3R7Q A;  1ZKH A;  4C4V A;  1ZW7 A;  4URK A;  3M63 B;  2V3S A;  4RF1 A;  4W9H A;  1TJE A;  2K6D B;  3E9S A;  2XK5 A;  1FRD A;  1E5W A;  2TSS A;  2MRP A;  2XNA C;  3U8Z A;  1QOG A;  1ZPS A;  3L17 A;  4GDL A;  4HPM B;  4IDI A;  1D3Z A;  4JWS C;  1GB4 A;  5D3I B;  2REX A;  4GU2 A;  1VZ6 A;  2D3B A;  2MW5 A;  2DYO A;  3NVY A;  4XE0 A;  3IHP C;  2WXF A;  4IWQ A;  3U2S C;  3DHH C;  3SFD B;  1FNU A;  3RN9 C;  2OOB B;  3ZYY X;  1WE7 A;  2HJ8 A;  2HJ1 A;  2WQY B;  4OZB A;  2LRW A;  5E6J A;  1QZE A;  1NI3 A;  2G3Q B;  3JSV B;  1L4D B;  4O1N A;  3RUI B;  3V3X A;  3EEC A;  2BYE A;  1F77 A;  3A9J B;  1N62 A;  5D6J B;  5G55 A;  4XZ4 A;  4YTM B;  3LJ3 A;  1SE9 A;  4HLE A;  4USA A;  4LNK A;  3DQV A;  2DZK A;  3ZTD A;  4A20 A;  2RDG A;  2D5G A;  3VH4 B;  4KGT A;  2M1M A;  4F8C B;  4J6I A;  1F0Z A;  2HTM E;  2LWP A;  2GOW A;  2BS3 B;  1Z5S B;  3V6E B;  2L0T A;  2Z0D B;  2I2Y A;  4N9F 4;  2KTR A;  2ONQ A;  3DPD A;  1R4N I;  1FMA D;  2A4Z A;  3VAW A;  1E90 A;  2QC8 A;  4RGO S;  4JGH B;  2RGF A;  2BWE S;  4OVV A;  2O6V A;  1NYQ A;  2KD0 A;  2EMS A;  1YQ3 B;  1JCK B;  2BS2 B;  2WXN A;  4XDC A;  4OHJ A;  2E6X A;  3ZXR A;  3UGB B;  1E8Y A;  2DAJ A;  2RDB C;  3ZVV A;  2KVZ A;  1XEE A;  2LXA A;  3TUO A;  2KWV B;  3V60 A;  2C7M B;  1WMH B;  1ISN A;  2KOX A;  4GOC A;  3FC4 A;  4G0N B;  4W9K A;  4YT0 B;  2AL6 A;  1EM7 A;  2IPK D;  3UIP B;  3VQI A;  1FM0 D;  1RRB A;  2BYF A;  2LGD A;  4NZL B;  3RZF A;  4K3B A;  3ZNZ B;  2LGY A;  4HK2 A;  2BQQ A;  4YWG G;  4KIK B;  1TZ1 A;  2QHO A;  3DWG C;  4H2A A;  1PYW D;  1IYF A;  2ACZ B;  5EE1 A;  3ZGZ A;  2W54 A;  4EE2 A;  1Z2M A;  1N6Z A;  2ZEQ A;  5E6P A;  3KQ4 A;  2WLB A;  2R61 A;  3AEE B;  5JH5 C;  2FUG 1;  1SF0 A;  2JF5 A;  1HTO A;  1FRR A;  5HI1 A;  4IWO A;  2DBY A;  1WX7 A;  3PRE A;  4G3X B;  4FJY A;  1BUI C;  1XLN A;  1WGD A;  4W9F A;  3N1X C;  1MI0 A;  4WWM A;  4AJW A;  3J9C A;  2DLB A;  3QHT A;  1D5X C;  3GZN B;  1D5Z C;  3NOB A;  3KLS X;  2K39 A;  5BYQ A;  2VH1 A;  2GBR A;  1F2R I;  2NPT A;  1WJ6 A;  4P6V F;  3B2G A;  3AE3 B;  1SE4 A;  2KWU B;  4MGZ E;  1V5O A;  1KM7 A;  1EF5 A;  4LNI A;  4A6Q A;  1YD8 U;  2FAZ A;  3L08 A;  3R2I A;  5E6N A;  1FXA A;  3R8B A;  1A70 A;  5HHD G;  4MAC A;  2GMI C;  4E3C A;  3NZ3 A;  1OFF A;  1YOV B;  1L0X B;  4JPS A;  4E74 A;  2JRH A;  2JRI B;  1WXV A;  1TBE A;  3T3O A;  1XO3 A;  1C76 A;  1VD2 A;  2K22 A;  3DWM A;  2JY6 A;  2BF8 B;  5D2M B;  2MJD A;  3IVF A;  4FBJ B;  1ZXI A;  2KHW B;  4HKQ A;  1MJD A;  4PYU A;  4BKT A;  4RMA A;  2C7H A;  4EFO A;  3IG3 A;  3H6N A;  2J4X A;  3IFW B;  3DCG A;  3H9D A;  5G5G A;  4L2Y A;  4OVU A;  4HDO A;  3ML9 A;  1NEK B;  3IT4 B;  1F9J A;  3JVZ X;  1JRP A;  4OW0 A;  2IY1 B;  4PYZ A;  2FCS A;  2W55 A;  2KTF A;  3Q8F A;  4A3P A;  2QEJ C;  1N63 A;  3A33 B;  1UBI A;  4NQK E;  3V6C B;  3EFU A;  2IO2 B;  4WJN A;  4C00 A;  2FBW B;  4CQN A;  1KLV A;  3ZTC A;  1WMH A;  5BYS A;  3T9L A;  4RM9 A;  2KJH B;  4MJS A;  2JZ3 B;  3R7R A;  3SR6 A;  2R2O A;  1E9M A;  1E0Z A;  2WDV B;  3V05 A;  2WDT B;  2ICI A;  5DPS A;  1TKG A;  1JML A;  1I4P A;  2FE8 A;  4NJ6 A;  3URY A;  4FHK A;  2AYO B;  3DVG Y;  1WGY A;  3ZW3 A;  4NAW A;  4ZYN A;  3ZIM A;  1XLP A;  2G9H D;  2ZNV C;  3N1Z C;  4TV3 A;  2V4L A;  3W5U B;  1I4H A;  2KAN A;  5AEK B;  1SE3 A;  4WJP A;  2MBE A;  3QA8 A;  2BB5 A;  3SU8 X;  4MT5 A;  3U52 E;  2MHJ A;  2C60 A;  2L83 A;  4DXF A;  3ZNI D;  3ZDM C;  2KJ6 A;  4YXD B;  4PK1 A;  3A9K B;  2KFJ A;  5FK9 C;  3RNF C;  2NTT A;  2FID A;  2YEP B;  2J0K A;  3TIX A;  1V49 A;  1WX8 A;  2KWC A;  5I4D A;  4RF0 A;  5FKA C;  1N5X A;  2WXP A;  3WA0 A;  2ZZP B;  3ZUN A;  2ZW0 A;  4ICU A;  1S1Q B;  2D11 A;  3NS1 A;  3PZ7 A;  2RR9 A;  1JAL A;  2JX5 A;  2LD9 A;  3M62 B;  4D2K A;  3EA6 A;  5L95 C;  4AUQ C;  4FXC A;  3RYT A;  1P3Q U;  2KJR A;  1KF6 B;  2MBB B;  4DDG D;  1E7P B;  3U7D A;  3DBS A;  2JZZ A;  2RDH A;  2MX2 A;  4EKU A;  2NBU A;  4XC2 A;  4FA6 A;  5IAA C;  2QIL A;  3NHE B;  1WXS A;  3HM6 X;  2KC1 A;  1WE6 A;  3ZJV A;  2JU6 X;  3DVN V;  2LEK A;  2WU2 B;  2J42 A;  4LNO A;  1SGH A;  2KYW A;  2X38 A;  5CHF A;  2DX5 B;  4GMV A;  4FUL A;  4YL8 A;  2IGG A;  4TSS A;  3QCA A;  3VDZ A;  1YN3 A;  1NEN B;  2NBV B;  1GJZ A;  2NR2 A;  1OGW A;  5EE9 A;  1VLB A;  1AWD A;  4BVU C;  3W1Y A;  1FIQ A;  3AH7 A;  2BVC A;  2AQ3 B;  3T8M A;  2NS5 A;  1M4V A;  4W9C A;  4WAA A;  2QJL A;  3AB5 A;  1XLQ A;  2WX0 A;  5IKC M;  1JWU D;  2D3C A;  2BBC A;  2IO1 B;  2WXJ A;  1SEB D;  2ASQ A;  2J53 A;  4IWP A;  1D6E C;  2H88 B;  2JT4 B;  2QSD A;  3I9V 1;  1OQQ A;  1EUV B;  3P4S B;  4XWW A;  3ABV B;  1V6E A;  3AE9 B;  3FKY A;  2WS3 B;  1WFY A;  3TCA A;  1J0G A;  2AX5 A;  1ZDV A;  1Q10 A;  2KC2 A;  2UU7 A;  2KLG A;  3AEF B;  4IOI E;  5IOI A;  4MEM A;  1K8R B;  3B2F A;  2K8B A;  3TJP A;  2K0P A;  3A9K A;  1WJ4 A;  2G4D B;  3AE1 B;  4RM8 A;  1YQ4 B;  3NY5 A;  4WJQ A;  3NUH B;  4A9A A;  1HZ6 A;  3PLV A;  2JXT A;  5KHO A;  4M00 A;  1QKZ A;  2KAJ A;  4PS8 A;  4YTP B;  1AYF A;  5J2R A; 
#chains in the Genus database with same CATH homology
 2C5L C;  2FNJ B;  3UGB B;  1E8Y A;  2DAJ A;  3ZVV A;  4NPN A;  4CHK A;  3UQB A;  4FLH A;  5CHV C;  3IBE A;  1YJ1 A;  2LXA A;  1GG3 A;  3PVL A;  2XK5 B;  2KWV B;  1WM2 A;  4GN1 A;  3P2B A;  3UF8 A;  3V60 A;  2B3A A;  2C7M B;  1WMH B;  1ISN A;  2J0J A;  2KOX A;  4GOC A;  2LZ6 A;  4W9G A;  3PTF C;  4G0N B;  2YLM A;  4W9K A;  2MBQ A;  2IO0 B;  3VXW A;  2AL6 A;  5D94 A;  4GDL B;  1Q5W B;  3UIP B;  4DXA B;  4MGY E;  3RT3 B;  3QQ8 B;  2LVO A;  3VQI A;  2O2V A;  3AU4 A;  2RD0 A;  4XX5 A;  3PZD A;  2AL3 A;  1RRB A;  2BYF A;  2JVC A;  2D10 A;  2LGD A;  4I6L B;  3RZF A;  3WAN A;  3ZNZ B;  3JW0 X;  2LGY A;  4HK2 A;  3APF A;  4W9J A;  2N7D A;  2IBI B;  4I6N B;  4KIK B;  1TZ1 A;  2QHO A;  3QK0 A;  1GUA B;  3X23 A;  5KHQ A;  1IYF A;  2MA9 B;  4DHZ E;  3A1Q A;  2DHZ A;  2ZPY A;  3EHV A;  5LXI B;  2MSE D;  2FCN A;  1UEL A;  2HD5 B;  2NBW B;  1Z2M A;  1CMX B;  2RSU A;  2ZEQ A;  2FUH B;  3W1S A;  1JRU A;  5C1Z A;  1G6J A;  4TUU A;  2AWT A;  5DPW A;  5E6P A;  3OJ3 A;  2D2Q A;  2DEN B;  4JIO U;  3VTU A;  1YIW A;  5D7G A;  3OJ4 B;  1M94 A;  5JH5 C;  2LJ5 A;  1V80 A;  1HE8 A;  3UIN B;  2WX1 A;  2L05 A;  2JF5 A;  3M3J A;  4NNJ B;  2N7E A;  3U30 A;  4IWO A;  4JQW C;  3R66 C;  1E7U A;  1XQQ A;  5L83 A;  1WX7 A;  2BKR B;  3PRE A;  4G3X B;  2LVP A;  2ZJD A;  1XT9 B;  4FJY A;  1WJN A;  4NQL B;  2KVR A;  2L7R A;  1WGD A;  2PE6 B;  3NZU A;  2W9N A;  4W9F A;  3M95 A;  4AJW A;  2M17 A;  4KSK C;  2MLB A;  4DHZ B;  3QHT A;  2M4N A;  1P98 A;  3WIM A;  5JHB A;  3NOB A;  4GGQ A;  2J0M A;  2K39 A;  2KDE B;  1RLF A;  2GBR A;  2BYV E;  2KMA A;  3L0W B;  4G50 A;  4FAD A;  4IUM B;  3DDC B;  2J7Q B;  2MQJ A;  3D32 A;  4IM0 A;  4FJZ A;  3VTW A;  1OEY J;  2L3Z A;  1E8X A;  2LRU A;  2ZCC A;  2RPQ A;  2NPT A;  1WJ6 A;  2YVC A;  3KVF B;  4MGZ E;  2KWU B;  3KYD D;  1V5O A;  1KM7 A;  2GBK A;  1H8C A;  4CO7 A;  1EF5 A;  3ALB A;  1RFA A;  1YD8 U;  2FAZ A;  3L08 A;  4IW0 A;  4FN2 A;  2DAF A;  5E6N A;  4F7Z A;  4K7U A;  2WWZ A;  2GMI C;  3PLU A;  4E3C A;  3RZW C;  3CF6 E;  4BBN F;  4BKS A;  1IPG A;  1NI2 A;  1Y8R C;  3ZO5 B;  2MP2 A;  2JXX A;  1V81 A;  3WAL A;  3DOW A;  5G2N A;  4ASW C;  5IA7 A;  2UYZ B;  1WX9 A;  4AWJ A;  3N30 A;  4ZRK A;  4E74 A;  2EKE C;  5AZF A;  2JRH A;  2JRI B;  1WXV A;  4P7I A;  4WJO A;  1TBE A;  2BPS A;  1WJU A;  3DVN U;  4WWN A;  4B95 A;  4E71 A;  2PE9 A;  3CMM B;  4M8N A;  1VD2 A;  4W9L A;  4K1R B;  2JY6 A;  1L2N A;  2BF8 B;  2ZVN A;  5D2M B;  1V2Y A;  1BT0 A;  2R2Q A;  3Q3J A;  4HCP B;  1WGH A;  2KFK A;  3VTV A;  4KSL C;  3IVF A;  4EZL A;  2MBH A;  4FBJ B;  4X57 B;  4W9E A;  4GDK A;  2ZCB A;  1YQB A;  2KHW B;  4M8M A;  1WI0 A;  2KQS A;  4PYU A;  4MH0 E;  4ANX A;  1WY8 A;  4BKT A;  3RCZ A;  2KO3 A;  3BIN A;  4A3O A;  4RMA A;  2C7H A;  5C23 A;  4EFO A;  3IG3 A;  3H6N A;  3IFW B;  2O2V B;  3DCG A;  3H9D A;  4TQ1 A;  2GBJ A;  4HJK A;  4OVU A;  4HDO A;  3ML9 A;  4G11 A;  3KH0 A;  1F9J A;  3JVZ X;  3K9O B;  3KUD B;  3CSF A;  2KDI A;  2ZVO A;  4ZRI A;  3APC A;  4FJV B;  1ZGU B;  3PPA A;  3L10 B;  2KLC A;  4KZ0 A;  4WWO A;  5BO4 B;  1TTN A;  2IY1 B;  4W9I A;  1LXD A;  4PYZ A;  4AP4 C;  2KKC A;  4KZC A;  2FCS A;  2KTF A;  3PS6 A;  4II2 B;  2LVQ A;  4GSW A;  3V62 A;  2PJH A;  3A4S C;  4A3P A;  2FCQ A;  3A33 B;  5AZH A;  2HE7 A;  1UBI A;  4NQK E;  3V6C B;  1AAR A;  3V61 A;  3EFU A;  3LDZ E;  3RD2 A;  1OTR B;  1R4M I;  2IO2 B;  2IYD B;  4WJN A;  2MCN B;  4TQ0 A;  3H7S A;  2PPH A;  2JUO A;  1L7Y A;  1VCB A;  2M0X A;  5CX3 A;  3VVW B;  4CYE A;  4HWI B;  2KDF B;  4EOY A;  3UIO B;  1KLV A;  3ZTC A;  1WMH A;  1KOT A;  1WR1 A;  2JPH A;  4RM9 A;  2ZPN A;  3T9L A;  3TL5 A;  2NVU I;  2KJH B;  4MJS A;  3ZLZ A;  2KX0 A;  2JZ3 B;  1H4R A;  3R7R A;  1C1Y B;  1GC6 A;  2K6Q A;  2R2O A;  2M8S A;  3KUC B;  2KXJ A;  2NCN A;  1WR6 E;  2WDT B;  4PS3 A;  1YX5 B;  1WGR A;  3PRM B;  3ONS A;  1NBF C;  3APD A;  3QC8 B;  2PEA A;  4LCD E;  4MSM B;  5DPS A;  4K7S A;  3S2A A;  4IM3 A;  3WAP A;  4NJ6 A;  2IY0 B;  4FHK A;  3B1L X;  2CHZ A;  2AYO B;  1U4A A;  1WGG A;  2L8J A;  4M0W B;  3AU5 A;  4GB9 A;  4IC7 B;  3UQA A;  3DVG Y;  1WGY A;  3ZW3 A;  4NAW A;  4ZYN A;  3OLM D;  2N1V A;  3ZIM A;  2CHW A;  3X0W A;  1SIF A;  4K7W A;  2L0F A;  2ZNV C;  4TV3 A;  2GBN A;  2V4L A;  4HVB A;  2L00 B;  1IP9 A;  2NPT B;  2XBB C;  2OJR A;  3DVG X;  2IZV B;  1E7V A;  1E8Z A;  2KAN A;  5AZG A;  5AEK B;  3PHW B;  3AXC A;  1WYW B;  2MBE A;  4WJP A;  3QA8 A;  3SU8 X;  2N9E B;  3H7P A;  3PV1 A;  5LLI A;  2K8H A;  4MGI E;  2BKF A;  2N9P C;  2C60 A;  2KTR B;  3ZNI D;  3ZDM C;  3QX1 A;  1UD7 A;  2KJ6 A;  2ZNV B;  4DWF A;  5JHA A;  3JSV A;  3A9K B;  2MP2 B;  2KFJ A;  1KJT A;  3EC8 A;  1A5R A;  3A9J A;  2FID A;  4MM3 A;  4FHJ A;  2J0K A;  3MHS D;  2BGF A;  2LGX A;  3HK0 A;  1J19 A;  3TIX A;  2AEH A;  3C0R B;  1V49 A;  2DZM A;  2O6V D;  1WX8 A;  4WQO B;  3ZNG C;  2EMT A;  2O6V B;  3SHQ A;  2KWC A;  2CS4 A;  1J8C A;  2DZI A;  3L16 A;  4JLC A;  4MEL A;  3NS8 A;  3MTN B;  1GNU A;  2LAS A;  3WA0 A;  2ZZP B;  5HKH A;  1WXM A;  1GC7 A;  2KMC A;  4EZJ A;  5E6O A;  1WIA A;  3O65 B;  3QWZ B;  2JWZ A;  3ZUN A;  4HDQ A;  4ICU A;  1WXA A;  4W9D A;  4EUT A;  4KVG B;  2FCM A;  3AI5 A;  1S1Q B;  2A5U A;  4LJP B;  2D11 A;  1V86 A;  5LXH A;  1I42 A;  3N32 A;  3L13 A;  2RR9 A;  4PS7 A;  1E8W A;  1NDD A;  2CKH B;  2G4S A;  5GMV A;  1PQS A;  2LD9 A;  2HTH A;  3M62 B;  5DCN A;  1EO6 A;  4AJY B;  2Z0E B;  4GIV A;  2IO3 B;  2FIF A;  4DDI D;  5CHW A;  1C3T A;  3MJW A;  1OEY A;  1WZ3 A;  4KDL B;  3VUY A;  4WWP A;  4AUQ C;  5L95 C;  2LI5 A;  5DPR A;  2C9W B;  3RYT A;  2KNB A;  1P3Q U;  3L54 A;  5JZE B;  2K25 A;  2XEW A;  2KJR A;  3SD5 A;  3A4R A;  2MBB B;  1WF9 A;  4DDG D;  3KUZ A;  3U7D A;  3DBS A;  2JZZ A;  2KQ7 A;  3W1S C;  1UBQ A;  2CU1 A;  3DBL I;  3ZRC A;  2MX2 A;  3VUX A;  4EKU A;  2NBU A;  2Z59 B;  4HXD A;  2K1F A;  4TKN A;  4XC2 A;  4FA6 A;  2D07 B;  3AUL A;  3HM3 A;  3OAW A;  1I35 A;  5IAA C;  3ZKJ C;  4HPL B;  1Q1O A;  3KW5 B;  3A1Q B;  2VRR B;  3CST A;  3PGE A;  1UZX B;  3QAQ A;  3N3K B;  4ZRJ A;  3NHE B;  4ICV A;  1LFD A;  1WXS A;  3GZN I;  3VUW A;  4I6P A;  3HM6 X;  1WM3 A;  1V9J A;  3ZNH B;  1FXT B;  2KC1 A;  1WE6 A;  1ZKH A;  4MJS B;  3R7Q A;  1WH3 A;  1ZW7 A;  4LJO B;  3ZRF A;  4B9K A;  3M63 B;  4BOZ B;  4NY0 A;  4EZK A;  4URK A;  2V3S A;  4W9H A;  3H1U A;  3DVN V;  3WAO A;  2K6D B;  2XK5 A;  3JYU A;  2LUE A;  1E5W A;  1SGH A;  3KYC D;  2MRP A;  3U8Z A;  4MSQ B;  3L17 A;  4GDL A;  4HPM B;  4MGK E;  5CHF A;  4DHJ D;  2DX5 B;  1P1A A;  4II3 B;  4DHJ B;  1D3Z A;  1S3S G;  4NAW B;  2UWQ A;  2REX A;  4KDI C;  4GU2 A;  3DBR I;  4GMV A;  4FUL A;  4YL8 A;  2MW5 A;  2DYO A;  3SDL C;  3QCA A;  5TR5 A;  3VDZ A;  3VH3 B;  1OQY A;  2DYM A;  2NBV B;  4KIK A;  1YX6 B;  3PHX B;  3WAM A;  4ANU A;  1GJZ A;  2NR2 A;  3IHP C;  1OGW A;  4BVU C;  3HIZ A;  3W1Y A;  4IWQ A;  5EDS A;  1X1M A;  2CR5 A;  3GOE A;  3H7P B;  4DBG A;  2OOB B;  4K81 A;  5CTR C;  4BOS C;  4BBN C;  1UGM A;  1WE7 A;  1XD3 B;  2HJ8 A;  3PT2 B;  3QAR A;  4AOF A;  2KX3 A;  4F1S A;  1TGZ B;  2LRW A;  3T8M A;  1QZE A;  2G3Q B;  3JSV B;  5J17 A;  4GXB A;  2NS5 A;  3B0A A;  3Q3F A;  3RUI B;  1V5T A;  3TMP B;  1WZ0 A;  4W9C A;  1P9D U;  4WAA A;  3EEC A;  1Q0W B;  2BYE A;  3VHT C;  4BFR A;  3A9J B;  5D6J B;  1WRD B;  2V1Y A;  5G55 A;  2WX0 A;  4NJ7 A;  2BWF A;  4BKS D;  3I3T B;  4XZ4 A;  1T0Y A;  3LJ3 A;  3BY4 B;  2IO1 B;  1LQB A;  1SE9 A;  2ASQ A;  4HLE A;  4IWP A;  3DQV A;  1MG8 A;  2DZK A;  2JT4 B;  3ZTD A;  4A20 A;  4ANV A;  1EUV B;  5FR6 A;  2GBM A;  3TBL D;  2KZR A;  2KN5 A;  3VH4 B;  1V6E A;  4HCN B;  2M1M A;  4ZDV A;  2I1K A;  4MDK E;  4F8C B;  1RAX A;  1P0R A;  1WFY A;  3TCA A;  1J0G A;  1UH6 A;  2LXC A;  4J6I A;  2N4F A;  2KK8 A;  2KC2 A;  2KFK B;  4DK5 A;  2DYB A;  4GDK B;  2KLG A;  4ANW A;  2LWP A;  2GOW A;  1Z5S B;  3V6E B;  2L0T A;  2Z0D B;  3B08 A;  4IM2 A;  2Y5B B;  1LM8 B;  3PRP B;  2C7N B;  4N9F 4;  2KDB A;  2KTR A;  3ECI A;  2K8C A;  3DPD A;  3K9P B;  3QIJ A;  4MEM A;  2MWS B;  1R4N I;  1K8R B;  2A4Z A;  3RUL A;  2N9X A;  2G45 B;  3PSE B;  2D3G A;  2K8B A;  2N1W A;  3TJP A;  5J18 A;  3VAW A;  1E90 A;  3A9K A;  4EEW A;  2CHX A;  1WJ4 A;  2MBO A;  2G4D B;  3ENE A;  3PRZ A;  4LDT D;  4JGH B;  5DPT A;  4LDT B;  2RGF A;  2BWE S;  4RM8 A;  3NY5 A;  4OVV A;  4JL9 A;  4KV2 A;  4WJQ A;  2O6V A;  2KD0 A;  2EMS A;  2WYQ A;  3PLV A;  4B6W A;  3VFK A;  3ZDT A;  3DBH I;  2DZJ A;  3HHM A;  2I1J A;  2L76 A;  3ML8 A;  4IG7 B;  3QJZ A;  5KHO A;  4BKG A;  3R3M A;  4PS8 A;  3NZS A;  1EF1 A;  5J2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...