1WYWB

Crystal structure of sumo1-conjugated thymine dna glycosylase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
b'GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wywB00
2HTHA 4G0NB 2MCNB 3DVNU 2NPTA 3TL5A 4IW0A 2O6VD 4FHKA 4ANXA 2C7HA 3IFWB 1P1AA 1WMHB 3AU4A 1V9JA 3DVGY 3K9OB 2KK8A 2KTRB 1NI2A 3L16A 4DHZE 1WM3A 3PLUA 3ENEA 1C3TA 1YX5B 3SDLC 3ZNGC 4BKSD 2CR5A 2LVOA 1FXTB 4NQKE 2GBJA 4IUMB 4BBNF 3L10B 3W1YA 2N9PC 4KDIC 4EUTA 2DZJA 3GOEA 1KLVA 1HE8A 4FJZA 2N9XA 4I6PA 4MGIE 4ANWA 4WWNA 1WI0A 3PREA 3RYTA 1WJNA 4MJSB 3T9LA 4PYUA 4FHJA 2NBUA 4BKGA 4OVUA 4W9EA 3DBLI 3MHSD 2KFJA 2JVCA 1E7VA 2ZVNA 2KDIA 2G45B 2XEWA 3B0AA 3CMMB 2LVPA 4K7WA 3WAPA 3ZRCA 4B95A 3ECIA 2WWZA 2J0MA 3ZVVA 1WGYA 4JGHB 4K7UA 2BGFA 4ZRJA 1WE6A 3K9PB 2CS4A 3WANA 3IBEA 2D07B 1WJ4A 4N9F4 2ZNVC 3PLVA 4GSWA 2ZPNA 2D10A 2IY1B 2CHZA 2RGFA 3RZFA 4AJWA 5CHWA 4DHZB 4W9HA 2NS5A 1WMHA 3UQAA 3R3MA 2KDFB 2KTRA 3LDZE 3EFUA 3H6NA 4ZRIA 2DAFA 3QCAA 3OAWA 3ZNZB 4E3CA 3L13A 4AWJA 5AZFA 3ZKJC 1E8YA 4KV2A 4NY0A 3VTUA 2LUEA 3RCZA 4HPLB 2JXXA 4W9DA 1WX9A 3DDCB 3VTWA 2CU1A 4G3XB 4M8NA 5CTRC 4MGKE 5TR5A 1MG8A 3R7RA 1AARA 2C9WB 1TBEA 1C1YB 3H7PA 3ZNID 2Z0EB 3O65B 2PJHA 2JRHA 3QWZB 2JPHA 2MRPA 2OOBB 4MELA 3NZSA 1NBFC 3Q3FA 4MJSA 4PYZA 3B08A 3DBHI 4WJNA 1WXSA 2N4FA 3CSTA 2FCQA 3N30A 1G6JA 2LGYA 1V6EA 1RLFA 3C0RB 3QAQA 2MLBA 5DPRA 4IM3A 2FNJB 5DPWA 4HK2A 2MX2A 4IM0A 4TKNA 1I35A 4HDOA 4J6IA 5L95C 4PS3A 1IYFA 3PVLA 3SD5A 4GMVA 3LJ3A 1I42A 1WM2A 1SGHA 1WX7A 3M95A 3U7DA 3R66C 4FJVB 2DYOA 3DBSA 2KFKB 4GDLA 3WAMA 1SE9A 2KQ7A 4I6LB 2B3AA 4M0WB 2O6VB 3HM6X 2K1FA 1WFYA 4GIVA 3RUIB 3H7SA 3V60A 2ASQA 1TZ1A 4F1SA 5C1ZA 3QK0A 1WGHA 4KVGB 4DDID 3HM3A 2MP2A 4GDKB 2GBKA 4AUQC 1WYWB 3P2BA 3X23A 2KMCA 2KDBA 2LVQA 3QIJA 4LDTD 2LASA 3B1LX 3RD2A 1YJ1A 3S2AA 1PQSA 4MGZE 3ML8A 3WALA 4JLCA 3PHWB 1Y8RC 4NAWB 3RULA 3VQIA 2WX1A 3VXWA 2RPQA 1WIAA 2J0JA 3NS8A 4GU2A 4IWQA 4HCNB 4MDKE 3VH3B 2KXJA 2M17A 5CHVC 2JWZA 1A5RA 1LFDA 1V81A 3UGBB 1KM7A 3PSEB 3ALBA 2AYOB 2IYDB 4LJOB 5IAAC 3PGEA 2KKCA 2LJ5A 4KIKA 3ZDTA 1WRDB 2ZEQA 4DXAB 2KFKA 3ZUNA 5EDSA 2K6QA 2KD0A 2KWUB 3M3JA 2C7MB 2O6VA 3L17A 3DQVA 3VUYA 2OJRA 3DBRI 3A9JB 2KVRA 4GOCA 2N7EA 4GN1A 2HD5B 2DX5B 3L54A 5G2NA 5J17A 3WA0A 2PEAA 3NHEB 1RAXA 4M8MA 2PPHA 2V3SA 2JZ3B 2KC1A 3QHTA 3W1SC 2D3GA 1V5TA 1ISNA 1E8WA 1P3QU 4KSLC 4P7IA 1BT0A 5DPSA 1R4NI 3APFA 3BINA 3M62B 5LXHA 3KH0A 4NAWA 3RT3B 1GG3A 1UBQA 3DOWA 3L0WB 1V2YA 3NY5A 1WGDA 5E6PA 4F8CB 3WIMA 3TIXA 3VAWA 4MM3A 2KJHB 2KWCA 4WJOA 4GXBA 1RFAA 3PS6A 4TUUA 4BKTA 4ICUA 1YQBA 4HLEA 2R2QA 4EFOA 3QA8A 5CHFA 3PT2B 2FIDA 2LGDA 2BYFA 2FCMA 3L08A 2KDEB 3A1QB 4A20A 2BYVE 2KO3A 4ANUA 5GMVA 2Z59B 1ZKHA 1D3ZA 2IY0B 3AULA 4RMAA 4TQ1A 1J0GA 2IO0B 3ZRFA 3A9JA 4HVBA 2DENB 2DYBA 3DCGA 5JZEB 1UZXB 4F7ZA 4FN2A 3A4RA 2I1KA 3PTFC 3QX1A 1L2NA 4WWOA 3N32A 5FR6A 5J18A 4NJ6A 2LRUA 2ZCCA 2EKEC 1Z5SB 3H1UA 1Q1OA 3SU8X 1P9DU 2PE6B 4XX5A 3IVFA 2K25A 3CSFA 4LCDE 4MSQB 2JRIB 3T8MA 1WJ6A 3KUDB 3UF8A 1UH6A 2BKRB 1WXMA 2GMIC 4E74A 2L76A 2C60A 3UQBA 4LDTB 3VFKA 2LWPA 2A4ZA 1NDDA 3H9DA 3QJZA 2XK5B 4W9LA 2BYEA 1WY8A 2D2QA 2N7DA 3V6EB 3UINB 1UELA 1XD3B 1WR1A 2DYMA 1H4RA 4MH0E 2WDTB 4B9KA 2O2VB 1VCBA 4TQ0A 2IO3B 3MJWA 1X1MA 2DZKA 4A3OA 1Q5WB 1EF5A 4EZKA 5J2RA 4HXDA 3OLMD 4RM9A 1KJTA 4W9FA 4WQOB 2LXAA 3IHPC 1EO6A 4WJPA 2WX0A 2LZ6A 5G55A 4II2B 4EKUA 4ICVA 3PHXB 2NBWB 4DDGD 1ZGUB 4BVUC 4FBJB 2KNBA 2N1WA 3PZDA 4MSMB 2NVUI 3EECA 2FCNA 1SIFA 2J0KA 2MBOA 3DVGX 1WJUA 2KJRA 5KHQA 2YVCA 3KUZA 4HPMB 3U30A 2UYZB 2CHWA 2L00B 1YD8U 5C23A 1J19A 4EZJA 5AEKB 1L7YA 4NNJB 2RD0A 1XQQA 2L3ZA 3W1SA 3WAOA 4LJPB 2UWQA 3HHMA 4XC2A 2C7NB 2FAZA 2D11A 4AOFA 2XK5A 3RZWC 4ANVA 3A9KB 2JF5A 2KOXA 3R7QA 3ZW3A 3QARA 3ZLZA 2HE7A 4EZLA 2LI5A 2DHZA 2NPTB 3HIZA 3V61A 4NPNA 2CKHB 2JUOA 1GC6A 4CO7A 1S3SG 2ZZPB 4FJYA 1WR6E 2MWSB 2N9EB 4IWPA 4FA6A 3Q3JA 2BF8B 2N1VA 2CHXA 2M0XA 4II3B 2AL3A 2L0FA 1OQYA 3A4SC 5DCNA 2M8SA 5JHAA 2ZPYA 2NBVB 3V6CB 2EMSA 3PRPB 4DBGA 1WZ0A 4ZRKA 1JRUA 3JSVB 4FADA 2K8CA 3ONSA 4URKA 4AP4C 1E7UA 1LM8B 4DHJD 1F9JA 1WX8A 2KWVB 2NR2A 4BOZB 4BOSC 2L0TA 4GDKA 3VHTC 4WJQA 3GZNI 4BKSA 4ZDVA 2XBBC 4NQLB 1R4MI 2DZIA 3KVFB 1IPGA 2MBBB 4K81A 2GBRA 3A33B 3DPDA 4TV3A 4X57B 1OEYA 1V5OA 3VUWA 5IA7A 1V80A 1TTNA 1WXVA 3EHVA 4W9GA 5DPTA 1J8CA 1Q0WB 2G4SA 2L05A 2IBIB 1E5WA 2KLGA 1Z2MA 2MBQA 1WE7A 3VDZA 4FLHA 5D6JB 2DAJA 3MTNB 2R2OA 3OJ4B 5AZGA 4OVVA 2LXCA 3VUXA 2LGXA 2IZVB 1WGGA 2KQSA 1E8ZA 2KHWB 2AEHA 2IO2B 2LRWA 3PRZA 4IM2A 3TJPA 4W9CA 2KANA 1WXAA 1M94A 2G3QB 4JIOU 1QZEA 3D32A 2Z0DB 2M4NA 2KMAA 3UIOB 2RR9A 2L8JA 3JSVA 3QC8B 4FULA 4KZ0A 5D2MB 5E6OA 3H7PB 3EC8A 1YX6B 4AJYB 2G4DB 2JZZA 4IG7B 3HK0A 2A5UA 3AU5A 2K39A 2V1YA 1GJZA 4CYEA 2BKFA 1ZW7A 1GNUA 2PE9A 4PS7A 4I6NB 4HCPB 5AZHA 2KZRA 5JH5C 1E90A 3QQ8B 2KX0A 2J7QB 2K6DB 2I1JA 3X0WA 2MW5A 1CMXB 1OEYJ 1UGMA 2REXA 2Y5BB 2BWES 3APCA 2M1MA 4ZYNA 1GUAB 2QHOA 3KW5B 1KOTA 4BFRA 3ZIMA 2DZMA 4IWOA 4DK5A 3V62A 3TCAA 4CHKA 4GDLB 2K8BA 4GGQA 1V86A 2LD9A 3VTVA 3BY4B 3I3TB 3A1QA 3PV1A 3VVWB 2BPSA 4WWPA 3TBLD 3DVNV 1EF1A 3JYUA 2FUHB 4HDQA 2JT4B 2MBHA 3JW0X 3M63B 2MP2B 4XZ4A 4E71A 4ASWC 2KTFA 4RM8A 5L83A 1S1QB 4BBNC 3NZUA 4GB9A 5D94A 4MEMA 4PS8A 1XT9B 2ZVOA 1WF9A 4IC7B 1WGRA 2AWTA 4W9KA 3APDA 3PPAA 3VH4B 4DHJB 4DWFA 2EMTA 3IG3A 2KX3A 3AXCA 2MBEA 4K7SA 2KC2A 2V4LA 4KSKC 4HWIB 2KLCA 3KYDD 4G50A 3ZO5B 3PRMB 2YLMA 1UBIA 1WZ3A 5LLIA 2MQJA 2GBMA 2FCSA 3OJ3A 3ZDMC 1U4AA 1H8CA 2NCNA 4KIKB 5HKHA 2ZNVB 1OTRB 1OGWA 1K8RB 3KUCB 2K8HA 4JQWC 2VRRB 4YL8A 5JHBA 2IO1B 1GC7A 4EEWA 2O2VA 1E8XA 5D7GA 1T0YA 2JY6A 4EOYA 1TGZB 1UD7A 3TMPB 4B6WA 3ZNHB 2BWFA 2HJ8A 2GBNA 1EUVB 2L7RA 3ZTCA 2W9NA 4G11A 4KZCA 4NJ7A 2GOWA 1P98A 4JL9A 1P0RA 3CF6E 2WYQA 3KYCD 4A3PA 4K1RB 3NOBA 4HJKA 3N3KB 3JVZX 1WH3A 5CX3A 2KJ6A 3UIPB 3ML9A 1V49A 2MA9B 2KN5A 4KDLB 3SHQA 1RRBA 1YIWA 5BO4B 1VD2A 5LXIB 4WAAA 5E6NA 3ZTDA 4W9JA 1IP9A 1LXDA 2RSUA 5KHOA 4MGYE 2ZJDA 1LQBA 2AL6A 2ZCBA 4W9IA 3A9KA 3U8ZA 2C5LC 2MSED 3AI5A 2FIFA
chains in the Genus database with same CATH superfamily
4G0NB 3DVNU 2NPTA 2O6VD 4ANXA 2C7HA 3H8HA 2KVZA 1WMHB 3DVGY 4DHZE 1XCQL 5G5HA 3AMZA 3ZNGC 4BKSD 3Q3NC 3ZJUA 3ZQ4A 4IKGA 2GBJA 4IUMB 4JWSC 4C4VA 4BBNF 1HQRD 2WHIA 3GOEA 3DBLB 3PREA 3RYTA 1WJNA 3VRBB 3E9SA 4FHJA 2NBUA 4PYUA 3MHSD 2KFJA 1ZXIA 1V97A 5IKCM 2WWZA 2J0MA 4JGHB 2BGFA 4ZRJA 1WE6A 4M02A 3IBEA 2D07B 4N9F4 2ZNVC 4GSWA 3RZFA 1L6UA 4DHZB 4W9HA 3UQAA 3R3MA 1GAQB 1QT9A 4NAMA 4AWJA 2LUEA 1PGAA 1FM0D 3DDCB 2CU1A 1TBEA 3ZNID 3H7PA 2Z0EB 4N6EB 2LHDA 2NMQA 3J9CA 4MELA 2MRPA 3URYA 1IGDA 3DBHI 1WXSA 3N30A 3EUB2 2LGYA 1V6EA 3C0RB 1NVID 5DPWA 2MX2A 4C56C 4TKNA 4J6IA 1R7SA 5E6JA 4PS3A 1VZ6A 3SD5A 3VRAB 1WX7A 5EE1A 4I6LB 2KN4A 4F1SA 5C1ZA 1WGHA 1A70A 2MP2A 1N61A 3P2BA 2KMCA 2KDBA 2ZW0A 3Q2AC 3QIJA 1HZ6A 3PHWB 4MH8A 3RULA 1WIAA 1HTQA 1UWXA 3NS8A 4IWQA 4HCNB 1TS3A 2N9LA 2JWZA 1A5RA 1IGCA 1JWSD 1KM7A 2LFIA 1P7FA 5HI1A 1C9FA 5IAAC 2ZEQA 2KFKA 2BB6A 2QILA 2OJRA 3DBRI 2KVRA 4GOCA 4FXCA 1FCCC 3WA0A 4YSXB 2GI9A 3T3OA 1PFDA 1R4NB 4M8MA 1CK1A 2PPHA 2D3GA 1P3QU 4NAWA 1UBQA 3L0WB 1V2YA 3ZJVA 4MM3A 3AE8B 1D4BA 4WJOA 4GXBA 2WXJA 2WNMA 1F0ZA 2R2QA 3FKYA 5CHFA 1K51A 2BYFA 2KDEB 2BYVE 2KO3A 5GMVA 1TJEA 2Z59B 1ZKHA 4WURA 3ZRFA 3A9JA 4YT0B 2DYBA 1UZXB 4FN2A 3A4RA 3PTFC 5FK9C 3AE9B 2GB1A 4NJ6A 1WGKA 2ZCCA 3TEYA 2HTME 3I63C 4EE2A 2PE6B 1TKGA 1FPYA 3KUDB 5TSSA 1B1ZA 2A4ZA 2Y3AA 2KMMA 2BYEA 1M4VA 2D2QA 3V6EB 3TEWA 3IT6B 1WR1A 4QAYA 2IO3B 1X1MA 4A3OA 4EZKA 4RGOS 3OLMD 4W9FA 4WQOB 2QSDA 3IHPC 3AE6B 1EO6A 2WX0A 2W3SA 2V9HA 2FE8A 3PHXB 2WXLA 2L1AA 1ZGUB 3PZDA 4YTNB 2NVUI 3EECA 2FCNA 4OW0A 3Q3MC 1YQ3B 3R2TA 2UYZB 2CHWA 3ZYYX 5AEKB 1IUEA 1MPEA 2L3ZA 4RFBA 3W1SA 2K9XA 2TSSA 1MHHE 2XK5A 2JF5A 3R7QA 2LI5A 2DHZA 1BUIC 1GC6A 2RMMA 1WYGA 2MWSB 3RNBC 3Q3JA 2CHXA 3W2DA 2AL3A 3RI7C 5DCNA 1SE2A 1SE4A 2WP9B 3PRPB 3MC0B 1WZ0A 4M0WA 1E7UA 1F9JA 2NR2A 2L0TA 3MC8A 3KQ4A 4GDKA 5C2TB 1OQRA 4K81A 4TV3A 4X57B 1OEYA 3NJTA 2B76B 1ZPSA 2BT6A 3MFGA 4JE3B 4N59A 2KLGA 1Z2MA 1T5XD 5D6JB 2DAJA 3OJ4B 2LGXA 3AH7A 3PRZA 4IM2A 1FNVA 3AB5A 4JIOU 2MHJA 1JROA 1NYQA 3P4RB 2JZZA 2WXQA 4IG7B 1ET9A 1GJZA 3BYTB 4CYEA 4OHJA 2PE9A 2MH7A 2R61A 2KZRA 2IGHA 3QQ8B 2KX0A 1SXTA 1PDXA 2MW5A 1OEYJ 2BWES 2M1MA 4ZYNA 3KW5B 4BFRA 1FXAA 1I4RA 4IWOA 2NTSA 5BYSA 3TCAA 3OWEB 1V86A 3PV1A 2BPSA 1MI0A 2WXGA 1FCLA 1EF1A 3JYUA 4ARCA 4HDQA 3M63B 4A9AA 3PZ8A 2KTFA 4ASWC 1F52A 1T3QA 1XT9B 3BVGA 1WF9A 3AE4B 5BMGA 5BMHA 4W9KA 3VH4B 3Q8FA 4MT5A 4YSZB 2MBEA 2KC2A 1N63A 4NZLB 3KYDD 1MHXA 3OJ3A 1JALA 1F77A 3KUCB 2K8HA 4JQWC 1YN3A 2IO1B 2INNE 4EEWA 2O2VA 1T0YA 2JY6A 3N20C 2BWFA 3GE3C 2L7RA 3ZTCA 2W9NA 2GOWA 1P98A 1P0RA 3LYYA 3KYCD 4K1RB 3NOBA 1WH3A 2M56B 1PGBA 3MHZA 4WWMA 5CX3A 3UIPB 1V49A 4KDLB 5T8IA 2M0AA 1VD2A 1J7CA 5LXIB 4WAAA 4OVZA 1IP9A 1QKZA 1I4QA 2ZJDA 4KGSA 1XLQA 4RGMA 1XLPA 1KLUD 2I2YA 3NVVA 3L4PA 3E56A 2MCNB 2CJNA 3IFWB 3KLSX 3L16A 2KTRB 2EKIA 1C3TA 3SDLC 4HPPA 2LVOA 1UUPA 1CQVA 1FXTB 1ZE3D 1C77A 4HJGE 4EUTA 2MJEA 4FJZA 4H2AA 2N9XA 4MGIE 4ANWA 1IBXB 3BK1A 4OVUA 3CIRB 4W9EA 2ZVNA 1E7VA 2KDIA 2G45B 4B95A 4HVBA 4IDIA 4K7UA 3WANA 2CS4A 1WRIA 1AWDA 1QOGA 1RYJA 1ZDVA 2IY1B 3PZ7A 3DWGC 2NS5A 1WMHA 4ZRIA 2OJWA 1E6EB 3QCAA 2V3PA 5AZFA 1YOVB 4NY0A 4DQOC 3RCZA 4HPLB 4W9DA 1WX9A 3VTWA 1SE3A 4LNOA 4M8NA 4MGKE 5TR5A 3BK2A 5FKAC 3RNFC 3O65B 1V8CA 3DBHB 2PJHA 2WDRB 2JPHA 2OOBB 1CZPA 1TKYA 1G6JA 3CSTA 5DPRA 3QAQA 2MLBA 2E3TA 3AECB 4IM0A 1I35A 4HDOA 2PW9A 4GMVA 4B0EA 3Q3OC 1SGHA 4KKIA 2FBWB 2VH2A 3M95A 3R66C 2DYOA 4FJVB 2QIEB 4GDLA 3WAMA 1SE9A 2KQ7A 2O6VB 2ACZB 2WXFA 3H7SA 1NENB 2D3BA 3BIID 3RUIB 2D5GA 4HRSA 1TZ1A 4KVGB 3HM3A 2GBKA 2PMVA 3X23A 4HEA1 2LVQA 2V0GA 1YJ1A 1PQSA 4MGZE 4ZHPA 2WU5B 3VXWA 1FRRA 4HKQA 4GU2A 4MDKE 2M17A 1V81A 3UGBB 2AYOB 3DBRB 2KKCA 2LJ5A 3PGEA 4KIKA 4LK0M 1WRDB 5EDSA 3P1MA 3DQVA 2N7EA 3AE3B 2HD5B 2DX5B 4D2KA 2SEBD 4O1NA 1YJJA 2PEAA 3NHEB 1L5PA 1K52A 1QQRA 2KC1A 1FEHA 1YJIA 4RH6A 1TYGB 1NYRA 3DOWA 4S0RA 3NY5A 1WGDA 3WIMA 3TSSA 1KLGD 1RFAA 3PS6A 4EFOA 3QA8A 5BYQA 2FIDA 2BQQA 2QMTA 1E9MA 4ANUA 2DBYA 2IY0B 2IO0B 3QX1A 1L2NA 2M19A 3NVYA 5J18A 2LRUA 2EKEC 1Q1OA 3SU8X 2PKOA 5IN7A 1JMLA 5GXGB 2N0SB 1UH6A 2WXPA 2BKRB 2GMIC 2L76A 2H89B 1QLBB 3H9DA 2N7DA 1FD6A 1XD3B 3W9CB 1H4RA 1RM6C 4B9KA 3Q8CA 3N1XC 3AEAB 5J2RA 4HXDA 2UU7A 4M01A 2WS3B 2LZ6A 3DHGC 4II2B 5G55A 4ICVA 1PUTA 1N5XA 3B2GA 2MBOA 3DVGX 2JQRB 5KHQA 3U30A 1J19A 1L7YA 1VZ8A 3HRDD 4M00A 4P16A 2WGSA 1I4PA 2C7NB 2FAZA 1BMLC 1XO3A 2KOXA 2X8XX 1WSPA 3HIZA 2NPTB 2QEJC 4CO7A 2SAKA 1BXTA 1S3SG 4FJYA 1WR6E 4ZYSA 1MVKA 3KWVA 1TS4A 2N1VA 4II3B 1ZXHA 2W82A 5JHAA 2EMSA 3NZ3A 3JSVB 4TMAB 3ONSA 1C4PA 4URKA 4DHJD 4BOSC 4WJQA 4ZDVA 2XBBC 1TS5A 1L4DB 1R4MI 4WAFA 2MBBB 3A33B 3DPDA 1KFYB 1V1PA 3EHVA 4W9GA 3RNEC 1HEZE 2MBQA 5BYRA 4FLHA 1RWSA 2K5PA 2K22A 1ZUD2 4REZA 1F2RI 2LXCA 3HVZA 2KQSA 2KHWB 2OHFA 2LRWA 4W9CA 3D32A 1SIJA 1TZOA 4FULA 3H7PB 4L23A 1TY2A 2G4DB 3HK0A 2A5UA 3LB8C 1SEBD 1DOYA 2K39A 2LUMA 3CWIA 1ZW7A 2BKFA 4I6NB 1HA5A 2J7QB 2K6DB 5EE9A 4YTPB 1UGMA 1N6ZA 1V1OA 2REXA 2QHOA 2NTTA 3N9YC 3ETRA 2DZMA 2BVCA 1VR9A 3V62A 1TIFA 4CHKA 2WXOA 3BY4B 3I3TB 3A1QA 3VVWB 2X38A 1L6VA 2LEKA 3JW0X 2MP2B 3BYYB 4RF0A 4ZHOA 4IC7B 1WGRA 3C8YA 3APDA 3RMKC 2EMTA 4HWIB 2KLCA 3RFZB 4G50A 3EGRA 3ZO5B 3NVZA 3PO0A 5IP4D 2K0PA 2MQJA 2ON8A 1U4AA 1H8CA 2NCNA 3HUIA 1NI3A 3FAHA 1K8RB 2IGGA 3HVDA 4YL8A 5JHBA 4A8XC 1E8XA 5D7GA 1NEKB 2AQ2B 1TGZB 2PVGC 2BTEA 1FIQA 2HJ8A 2GBNA 1EUVB 3TEZA 3T3NA 1MG4A 2KDMA 4KZCA 4JL9A 1HTOA 2WYQA 4ZOHC 3N3KB 3ML9A 1EWYC 2KN5A 1RRBA 5BO4B 4MM3B 2RPVA 1MJDA 5E6NA 4XWWA 2RSUA 4MGYE 3TEXA 4US8A 2AL6A 3A9KA 2V4IB 2HTHA 1N60A 4IW0A 4FHKA 1P1AA 3AEEB 1V9JA 3K9OB 1NI2A 2ONQA 1AW7A 2CR5A 2PLPA 4JWUC 3L10B 2QCZA 4KDIC 2DZJA 1KLVA 4WWNA 1L0XB 4MJSB 3T9LA 3AV8A 4BKGA 2LJIA 2JVCA 4LTUA 3DHHC 3WAPA 3CMMB 2XEWA 2LVPA 1D5ZC 3ZRCA 3ECIA 3ZVVA 1WGYA 2Q5WD 3K9PB 1AN8A 2D10A 2CHZA 4AS1A 5FR3A 2KTRA 2DAFA 3OAWA 3AEGB 2INPE 3L13A 3ZNZB 3ZKJC 1SBBB 2K3UA 4KV2A 2JXXA 4LNKA 4G3XB 2PTLA 1MG8A 3R7RA 1AARA 2C9WB 4YXDB 1C1YB 1D5XC 1DOIA 3NUHB 2JRHA 1IBXA 3NZSA 3B08A 4UDUC 1VRAB 1RLFA 4HK2A 2KACA 1FNWA 2J53A 5L95C 5HFYA 4RGTA 1IYFA 3LJ3A 1I42A 4R3DA 1WM2A 1E10A 3DBSA 4RF1A 3C19A 4M0WB 2B3AA 1GOZA 3BZDB 3NG0A 1ACCA 3HM6X 2K1FA 1EWCA 2ASQA 2KWDA 3QK0A 2GLSA 4N58A 2WXMA 4GDKB 4PK1A 1ET6A 3U2SC 4AUQC 1FFUA 1WYWB 2INDC 3AE5B 2CJOA 1QILA 4LDTD 2LASA 3B1LX 3RD2A 3ZXRA 3ML8A 3IAM1 2KAJA 1ZDXA 2WX1A 2WXRA 2JZPA 2YEPB 2WU2B 2J0JA 3VH3B 2KXJA 4WQMA 1LFDA 5D3IB 1SF0A 3FILA 3ZUNA 2BS3B 2K6QA 2KD0A 2C7MB 2O6VA 3L17A 1OQQA 2JX5A 4GN1A 5G2NA 1EU4A 1FXIA 2V3SA 2JZ3B 3V05A 3W1SC 5H8YE 4KSLC 1E8WA 1BT0A 5LXHA 3ZGZA 3APFA 3M62B 3KH0A 3RT3B 2Z8LA 1GG3A 2KYWA 1XEEA 1L0YB 3VAWA 2KJHB 4HKZE 2G9HD 3U4EG 4ICUA 1YQ4B 1C4AA 3PT2B 2JU6X 2LGDA 3I9V1 4A20A 1D3ZA 3EA6A 4RMAA 3DHIC 4F7ZA 2I1KA 4ITKA 3N32A 1Z5SB 3H1UA 1P9DU 4XX5A 3IVFA 4LCDE 2BW2A 5EE3A 4YTMB 4MSQB 3T8MA 1WJ6A 1ESFA 5D3DA 1WXMA 3Q8BA 2C60A 3VFKA 1NDDA 3QJZA 4W9LA 1UELA 3AEBB 2DYMA 4MH0E 2O2VB 1JW9D 4RM9A 1KJTA 1UF0A 3MJ5A 3N1YC 1I4GA 4EKUA 2BS4B 1VDVA 4DDGD 1GPXA 2VZKD 4BVUC 2WXHA 1WJUA 3KUZA 2L00B 4OZAA 4S17A 3AE1B 2UWQA 3ABVB 1GB1A 2D11A 4ANVA 2HE7A 2XN9C 1SSNA 1JWMD 3V61A 2CKHB 2JUOA 2ZZPB 3R8BA 2QDFA 2N9EB 3VR9B 4IWPA 2BF8B 2M0XA 3A4SC 2M8SA 2WDQB 2NBVB 3V6CB 1T0SC 2ICIA 4ZRKA 1JRUA 4C80A 4AP4C 1LM8B 2AQ1B 1WX8A 1R4MB 5JXVA 1D5MC 4L1BA 2BBCA 3VHTC 4OZBA 3GZNI 4NQLB 3V3XA 1V5OA 3VUWA 1V80A 1WXVA 5DPTA 2L52A 2IBIB 1E5WA 3AN1A 1YNTE 1XCTL 2H88B 3VDZA 2YEPF 3MTNB 5AZGA 1KTKA 4K3BA 3VUXA 2IZVB 1VLBA 1E8ZA 2AEHA 2W55A 4KGRA 5AUKA 2HDEA 1WXAA 3Q6BA 1QZEA 4CQNA 2M4NA 3BVMA 1PYWD 3UIOB 1FO4A 2RR9A 5G5GA 2L8JA 3JSVA 4KZ0A 2W54A 5H92C 1YX6B 3IXSA 4ZRPA 4AJYB 2WDVB 3AU5A 2V1YA 3I57A 1GNUA 4HCPB 5AZHA 5JH5C 3P4QB 3X0WA 1CMXB 3NRZA 1YMHE 3ZIMA 4LNIA 1I7HA 1OFFA 4DK5A 1SB3C 4XDDA 4GDLB 1DGJA 2RDGA 4GGQA 2IDYA 3VTVA 1GB4A 3R2IA 3TBLD 3DVNV 2FUHB 3O13A 2JT4B 4J3OD 4P6VF 4E71A 4RM8A 1S1QB 2WXKA 5C3JB 3NVWA 1C79A 2AWTA 3PPAA 2BB5A 4DHJB 4DWFA 2FUG1 4KSKC 1QOBA 2YLMA 1UBIA 1WZ3A 4C7ZA 2N9KA 1F2RC 2GBMA 4C7YA 4KIKB 4L2YA 5HKHA 1OTRB 1OGWA 2VRRB 1GC7A 4EOYA 2JYEA 1UNSA 4B6WA 3ZNHB 3IT4B 1XXGA 3OG5A 4DXFA 1XLOA 1I4HA 4A3PA 2WXNA 4HJKA 4C4VB 2KJ6A 2MA9B 3SHQA 1YIWA 4JPSA 2QJLA 1T0RC 2L32A 4W9JA 1TKEA 3LXFA 3U8ZA 5EE0A 2C5LC 2D3CA 2VH1A 4RNAA 4MACA 5LNK1 3TL5A 2L83A 3AU4A 1FMAD 2KK8A 1WM3A 2J52A 3PLUA 3ENEA 2BS2B 1YX5B 2I38A 1KF6B 1ZP0B 4NQKE 3Q8AA 2PVOD 2MEKA 4K3CA 3W1YA 2N9PC 1B9RA 3FC4A 3AE7B 1HE8A 4XWTA 4I6PA 1WI0A 4A6QA 3DBLI 3B0AA 4K7WA 1FNUA 1T6BX 2JXTA 1SJED 1WJ4A 3PLVA 2ZPNA 4AJWA 2RGFA 5CHWA 2XNAC 1JRPA 4OZCA 2KDFB 3LDZE 3EFUA 3H6NA 4E3CA 1N5WA 1E8YA 3VTUA 3U7ZA 3I5JC 2IGDA 5CTRC 1XLNA 1JWUD 3EFCA 3QWZB 2KT7A 1J7AA 4PYZA 1NBFC 3Q3FA 4MJSA 3SFDB 4LNFA 4WJNA 2N4FA 2FCQA 4IM3A 4P1CC 2FNJB 3P42A 4ACFA 4JX1C 2KQ4X 3PVLA 4US9A 2OEDA 3U7DA 4A90A 2KFKB 1YN4A 1JWBD 1ENFA 1RFKA 1WFYA 4GIVA 1K53A 3Q14C 3V60A 2IJ0A 4DDID 1SJHD 2IPKD 4A55A 1V1PB 3S2AA 3UI3A 3WALA 5MPOA 4JLCA 2GRIA 1K50A 2LGSA 1Y8RC 4NAWB 1JWAD 3VQIA 2RPQA 3TUOA 1WXQA 3AEDB 1FRDA 1P7EA 3WCQA 2J42A 3DWMA 2AX5A 5CHVC 4NJCA 1T0QC 3PSEB 3ALBA 3IAS1 2IYDB 4LJOB 3ZDTA 3P4SB 4DXAB 3MP9A 4ARIA 2KWUB 3M3JA 3VUYA 3A9JB 2D3AA 4C00A 5IOIA 3L54A 5J17A 3GE8C 4YWGG 1RAXA 2JWUA 5BMIA 1DYQA 2V3NA 3QHTA 3MC9A 1V5TA 1ISNA 4P7IA 5DPSA 1R4NI 3BINA 1AYFA 2WQYB 5E6PA 3GP7A 4F8CB 3KWLA 2WXIA 3TIXA 2KWCA 4TUUA 4BKTA 4HLEA 1YQBA 1FFVA 1LGRA 4IOIE 2FCMA 3L08A 3A1QB 3RNCC 5HHDG 4Q2JA 1JCKB 1C78A 3AULA 4TQ1A 1J0GA 2DENB 3DCGA 5JZEB 3ZJTA 1KH0A 3P4PB 4RGNA 4WWOA 5FR6A 3VR8B 2EELA 1MFWA 4XE0A 4KX6B 2K25A 3CSFA 3Q69A 3UF8A 2JRIB 1PGXA 4E74A 3UQBA 4LDTB 1ROEA 2LWPA 1HXYD 2RDBC 2XK5B 1WY8A 3UINB 2LHEA 5AUIA 1E7PB 2WDTB 1VCBA 4TQ0A 3MJWA 2DZKA 1Q5WB 1EF5A 2LXAA 1C4CA 4WJPA 2NBWB 4RCOA 4FBJB 2KNBA 2N1WA 4MSMB 3Q8EA 1UGJA 2J0KA 1SIFA 2KJRA 1J7BA 2YVCA 4HPMB 2BYTA 2AQ3B 3AEFB 5C23A 1YD8U 4EZJA 4NNJB 2RD0A 1XQQA 2N7JA 3WAOA 4LJPB 3HHMA 4XC2A 3RNGC 4AOFA 3RZWC 3A9KB 3B2FA 3ZW3A 3QARA 3ZLZA 2E6XA 1KRHA 4EZLA 4NPNA 4TSSA 1CJEA 1YN5A 4ZRQA 4FA6A 2L0FA 1OQYA 2LGIA 2ZPYA 1STEA 4B0MA 4DBGA 2INCC 4FADA 2K8CA 4LNNA 3AM9A 4PT5A 3GZNB 2J4XA 5I4DA 2KWVB 4BOZB 4P1BC 1LO5D 4BKSA 4YSYB 3BWUD 4KKJA 2DZIA 3KVFB 1IPGA 2GBRA 2HJ1A 5HG2A 5IA7A 3RPFC 4KGTA 1TTNA 2DWQA 1J8CA 1Q0WB 2G4SA 2L05A 2ZW1A 4USAA 1WE7A 3N1ZC 2R2OA 4OVVA 1WGGA 2IO2B 3TJPA 2QC8A 2KANA 3AE2B 1M94A 2G3QB 2Z0DB 3GB1A 2W3RA 2KMAA 1Y56A 1TY0A 5E6OA 3QC8B 5D2MB 2MJ3A 3EC8A 3ZXVA 3W5VB 2JSVX 2VZKB 3BVZA 4GLSC 1C76A 4PS7A 1L4ZB 4BZAA 1Q10A 4AQ7A 1E90A 3B9JA 2I1JA 2Y5BB 3APCA 1VJKA 1UWMA 1GUAB 1KOTA 2WLBA 2CU3A 1L0VB 1F1HA 1E0ZA 4DXGA 2K8BA 2RDHA 2LD9A 1TS2A 4WWPA 1JQ4A 1N62A 2MBHA 2Y5CA 3GS2A 4XZ4A 5L83A 1DOXA 4BBNC 2G1EA 3NZUA 4GB9A 5D94A 4MEMA 4PS8A 3U52E 3P63A 4HROA 2ZVOA 2PIAA 1QF6A 3IG3A 2KX3A 3RN9C 3AXCA 4K7SA 1ZOYB 2V4LA 2DNFA 1QOAA 1I4XA 3PRMB 5LLIA 2FCSA 3ZDMC 3SR6A 2ZNVB 3FILB 4XGAB 3NS1A 1UD7A 3TMPB 1HZ5A 3RNAC 2DLBA 3SEBA 1EM7A 2Y5PA 4WIPA 4G11A 4NJ7A 3CF6E 2MJDA 3SFEB 3JVZX 1TT5B 2LMCA 3W5UB 4BAXA 4XDCA 1D6EC 1EU3A 4LLGM 1VZ7A 4XYCA 3ZTDA 1XF5L 1LXDA 5KHOA 1QOFA 1LQBA 4WH4A 5IO9A 2ZCBA 2JYTA 4W9IA 1WWTA 2MSED 3AI5A 2FIFA
chains in the Genus database with same CATH topology
2HTHA 4G0NB 2MCNB 3DVNU 2NPTA 3TL5A 4IW0A 2O6VD 4FHKA 4ANXA 2C7HA 3IFWB 1P1AA 1WMHB 3AU4A 1V9JA 3DVGY 3K9OB 2KK8A 2KTRB 1NI2A 3L16A 4DHZE 1WM3A 3PLUA 3ENEA 1C3TA 1YX5B 3SDLC 3ZNGC 4BKSD 2CR5A 2LVOA 1FXTB 4NQKE 2GBJA 4IUMB 4BBNF 3L10B 3W1YA 2N9PC 4KDIC 4EUTA 2DZJA 3GOEA 1KLVA 1HE8A 4FJZA 2N9XA 4I6PA 4MGIE 4ANWA 4WWNA 1WI0A 3PREA 3RYTA 1WJNA 4MJSB 3T9LA 4PYUA 4FHJA 2NBUA 4BKGA 4OVUA 4W9EA 3DBLI 3MHSD 2KFJA 2JVCA 1E7VA 2ZVNA 2KDIA 2G45B 2XEWA 3B0AA 3CMMB 2LVPA 4K7WA 3WAPA 3ZRCA 4B95A 3ECIA 2WWZA 2J0MA 3ZVVA 1WGYA 4JGHB 4K7UA 2BGFA 4ZRJA 1WE6A 3K9PB 2CS4A 3WANA 3IBEA 2D07B 1WJ4A 4N9F4 2ZNVC 3PLVA 4GSWA 2ZPNA 2D10A 2IY1B 2CHZA 2RGFA 3RZFA 4AJWA 5CHWA 4DHZB 4W9HA 2NS5A 1WMHA 3UQAA 3R3MA 2KDFB 2KTRA 3LDZE 3EFUA 3H6NA 4ZRIA 2DAFA 3QCAA 3OAWA 3ZNZB 4E3CA 3L13A 4AWJA 5AZFA 3ZKJC 1E8YA 4KV2A 4NY0A 3VTUA 2LUEA 3RCZA 4HPLB 2JXXA 4W9DA 1WX9A 3DDCB 3VTWA 2CU1A 4G3XB 4M8NA 5CTRC 4MGKE 5TR5A 1MG8A 3R7RA 1AARA 2C9WB 1TBEA 1C1YB 3H7PA 3ZNID 2Z0EB 3O65B 2PJHA 2JRHA 3QWZB 2JPHA 2MRPA 2OOBB 4MELA 3NZSA 1NBFC 3Q3FA 4MJSA 4PYZA 3B08A 3DBHI 4WJNA 1WXSA 2N4FA 3CSTA 2FCQA 3N30A 1G6JA 2LGYA 1V6EA 1RLFA 3C0RB 3QAQA 2MLBA 5DPRA 4IM3A 2FNJB 5DPWA 4HK2A 2MX2A 4IM0A 4TKNA 1I35A 4HDOA 4J6IA 5L95C 4PS3A 1IYFA 3PVLA 3SD5A 4GMVA 3LJ3A 1I42A 1WM2A 1SGHA 1WX7A 3M95A 3U7DA 3R66C 4FJVB 2DYOA 3DBSA 2KFKB 4GDLA 3WAMA 1SE9A 2KQ7A 4I6LB 2B3AA 4M0WB 2O6VB 3HM6X 2K1FA 1WFYA 4GIVA 3RUIB 3H7SA 3V60A 2ASQA 1TZ1A 4F1SA 5C1ZA 3QK0A 1WGHA 4KVGB 4DDID 3HM3A 2MP2A 4GDKB 2GBKA 4AUQC 1WYWB 3P2BA 3X23A 2KMCA 2KDBA 2LVQA 3QIJA 4LDTD 2LASA 3B1LX 3RD2A 1YJ1A 3S2AA 1PQSA 4MGZE 3ML8A 3WALA 4JLCA 3PHWB 1Y8RC 4NAWB 3RULA 3VQIA 2WX1A 3VXWA 2RPQA 1WIAA 2J0JA 3NS8A 4GU2A 4IWQA 4HCNB 4MDKE 3VH3B 2KXJA 2M17A 5CHVC 2JWZA 1A5RA 1LFDA 1V81A 3UGBB 1KM7A 3PSEB 3ALBA 2AYOB 2IYDB 4LJOB 5IAAC 3PGEA 2KKCA 2LJ5A 4KIKA 3ZDTA 1WRDB 2ZEQA 4DXAB 2KFKA 3ZUNA 5EDSA 2K6QA 2KD0A 2KWUB 3M3JA 2C7MB 2O6VA 3L17A 3DQVA 3VUYA 2OJRA 3DBRI 3A9JB 2KVRA 4GOCA 2N7EA 4GN1A 2HD5B 2DX5B 3L54A 5G2NA 5J17A 3WA0A 2PEAA 3NHEB 1RAXA 4M8MA 2PPHA 2V3SA 2JZ3B 2KC1A 3QHTA 3W1SC 2D3GA 1V5TA 1ISNA 1E8WA 1P3QU 4KSLC 4P7IA 1BT0A 5DPSA 1R4NI 3APFA 3BINA 3M62B 5LXHA 3KH0A 4NAWA 3RT3B 1GG3A 1UBQA 3DOWA 3L0WB 1V2YA 3NY5A 1WGDA 5E6PA 4F8CB 3WIMA 3TIXA 3VAWA 4MM3A 2KJHB 2KWCA 4WJOA 4GXBA 1RFAA 3PS6A 4TUUA 4BKTA 4ICUA 1YQBA 4HLEA 2R2QA 4EFOA 3QA8A 5CHFA 3PT2B 2FIDA 2LGDA 2BYFA 2FCMA 3L08A 2KDEB 3A1QB 4A20A 2BYVE 2KO3A 4ANUA 5GMVA 2Z59B 1ZKHA 1D3ZA 2IY0B 3AULA 4RMAA 4TQ1A 1J0GA 2IO0B 3ZRFA 3A9JA 4HVBA 2DENB 2DYBA 3DCGA 5JZEB 1UZXB 4F7ZA 4FN2A 3A4RA 2I1KA 3PTFC 3QX1A 1L2NA 4WWOA 3N32A 5FR6A 5J18A 4NJ6A 2LRUA 2ZCCA 2EKEC 1Z5SB 3H1UA 1Q1OA 3SU8X 1P9DU 2PE6B 4XX5A 3IVFA 2K25A 3CSFA 4LCDE 4MSQB 2JRIB 3T8MA 1WJ6A 3KUDB 3UF8A 1UH6A 2BKRB 1WXMA 2GMIC 4E74A 2L76A 2C60A 3UQBA 4LDTB 3VFKA 2LWPA 2A4ZA 1NDDA 3H9DA 3QJZA 2XK5B 4W9LA 2BYEA 1WY8A 2D2QA 2N7DA 3V6EB 3UINB 1UELA 1XD3B 1WR1A 2DYMA 1H4RA 4MH0E 2WDTB 4B9KA 2O2VB 1VCBA 4TQ0A 2IO3B 3MJWA 1X1MA 2DZKA 4A3OA 1Q5WB 1EF5A 4EZKA 5J2RA 4HXDA 3OLMD 4RM9A 1KJTA 4W9FA 4WQOB 2LXAA 3IHPC 1EO6A 4WJPA 2WX0A 2LZ6A 5G55A 4II2B 4EKUA 4ICVA 3PHXB 2NBWB 4DDGD 1ZGUB 4BVUC 4FBJB 2KNBA 2N1WA 3PZDA 4MSMB 2NVUI 3EECA 2FCNA 1SIFA 2J0KA 2MBOA 3DVGX 1WJUA 2KJRA 5KHQA 2YVCA 3KUZA 4HPMB 3U30A 2UYZB 2CHWA 2L00B 1YD8U 5C23A 1J19A 4EZJA 5AEKB 1L7YA 4NNJB 2RD0A 1XQQA 2L3ZA 3W1SA 3WAOA 4LJPB 2UWQA 3HHMA 4XC2A 2C7NB 2FAZA 2D11A 4AOFA 2XK5A 3RZWC 4ANVA 3A9KB 2JF5A 2KOXA 3R7QA 3ZW3A 3QARA 3ZLZA 2HE7A 4EZLA 2LI5A 2DHZA 2NPTB 3HIZA 3V61A 4NPNA 2CKHB 2JUOA 1GC6A 4CO7A 1S3SG 2ZZPB 4FJYA 1WR6E 2MWSB 2N9EB 4IWPA 4FA6A 3Q3JA 2BF8B 2N1VA 2CHXA 2M0XA 4II3B 2AL3A 2L0FA 1OQYA 3A4SC 5DCNA 2M8SA 5JHAA 2ZPYA 2NBVB 3V6CB 2EMSA 3PRPB 4DBGA 1WZ0A 4ZRKA 1JRUA 3JSVB 4FADA 2K8CA 3ONSA 4URKA 4AP4C 1E7UA 1LM8B 4DHJD 1F9JA 1WX8A 2KWVB 2NR2A 4BOZB 4BOSC 2L0TA 4GDKA 3VHTC 4WJQA 3GZNI 4BKSA 4ZDVA 2XBBC 4NQLB 1R4MI 2DZIA 3KVFB 1IPGA 2MBBB 4K81A 2GBRA 3A33B 3DPDA 4TV3A 4X57B 1OEYA 1V5OA 3VUWA 5IA7A 1V80A 1TTNA 1WXVA 3EHVA 4W9GA 5DPTA 1J8CA 1Q0WB 2G4SA 2L05A 2IBIB 1E5WA 2KLGA 1Z2MA 2MBQA 1WE7A 3VDZA 4FLHA 5D6JB 2DAJA 3MTNB 2R2OA 3OJ4B 5AZGA 4OVVA 2LXCA 3VUXA 2LGXA 2IZVB 1WGGA 2KQSA 1E8ZA 2KHWB 2AEHA 2IO2B 2LRWA 3PRZA 4IM2A 3TJPA 4W9CA 2KANA 1WXAA 1M94A 2G3QB 4JIOU 1QZEA 3D32A 2Z0DB 2M4NA 2KMAA 3UIOB 2RR9A 2L8JA 3JSVA 3QC8B 4FULA 4KZ0A 5D2MB 5E6OA 3H7PB 3EC8A 1YX6B 4AJYB 2G4DB 2JZZA 4IG7B 3HK0A 2A5UA 3AU5A 2K39A 2V1YA 1GJZA 4CYEA 2BKFA 1ZW7A 1GNUA 2PE9A 4PS7A 4I6NB 4HCPB 5AZHA 2KZRA 5JH5C 1E90A 3QQ8B 2KX0A 2J7QB 2K6DB 2I1JA 3X0WA 2MW5A 1CMXB 1OEYJ 1UGMA 2REXA 2Y5BB 2BWES 3APCA 2M1MA 4ZYNA 1GUAB 2QHOA 3KW5B 1KOTA 4BFRA 3ZIMA 2DZMA 4IWOA 4DK5A 3V62A 3TCAA 4CHKA 4GDLB 2K8BA 4GGQA 1V86A 2LD9A 3VTVA 3BY4B 3I3TB 3A1QA 3PV1A 3VVWB 2BPSA 4WWPA 3TBLD 3DVNV 1EF1A 3JYUA 2FUHB 4HDQA 2JT4B 2MBHA 3JW0X 3M63B 2MP2B 4XZ4A 4E71A 4ASWC 2KTFA 4RM8A 5L83A 1S1QB 4BBNC 3NZUA 4GB9A 5D94A 4MEMA 4PS8A 1XT9B 2ZVOA 1WF9A 4IC7B 1WGRA 2AWTA 4W9KA 3APDA 3PPAA 3VH4B 4DHJB 4DWFA 2EMTA 3IG3A 2KX3A 3AXCA 2MBEA 4K7SA 2KC2A 2V4LA 4KSKC 4HWIB 2KLCA 3KYDD 4G50A 3ZO5B 3PRMB 2YLMA 1UBIA 1WZ3A 5LLIA 2MQJA 2GBMA 2FCSA 3OJ3A 3ZDMC 1U4AA 1H8CA 2NCNA 4KIKB 5HKHA 2ZNVB 1OTRB 1OGWA 1K8RB 3KUCB 2K8HA 4JQWC 2VRRB 4YL8A 5JHBA 2IO1B 1GC7A 4EEWA 2O2VA 1E8XA 5D7GA 1T0YA 2JY6A 4EOYA 1TGZB 1UD7A 3TMPB 4B6WA 3ZNHB 2BWFA 2HJ8A 2GBNA 1EUVB 2L7RA 3ZTCA 2W9NA 4G11A 4KZCA 4NJ7A 2GOWA 1P98A 4JL9A 1P0RA 3CF6E 2WYQA 3KYCD 4A3PA 4K1RB 3NOBA 4HJKA 3N3KB 3JVZX 1WH3A 5CX3A 2KJ6A 3UIPB 3ML9A 1V49A 2MA9B 2KN5A 4KDLB 3SHQA 1RRBA 1YIWA 5BO4B 1VD2A 5LXIB 4WAAA 5E6NA 3ZTDA 4W9JA 1IP9A 1LXDA 2RSUA 5KHOA 4MGYE 2ZJDA 1LQBA 2AL6A 2ZCBA 4W9IA 3A9KA 3U8ZA 2C5LC 2MSED 3AI5A 2FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTH A;  4G0N B;  2MCN B;  3DVN U;  2NPT A;  3TL5 A;  4IW0 A;  2O6V D;  4FHK A;  4ANX A;  2C7H A;  3IFW B;  1P1A A;  1WMH B;  3AU4 A;  1V9J A;  3DVG Y;  3K9O B;  2KK8 A;  2KTR B;  1NI2 A;  3L16 A;  4DHZ E;  1WM3 A;  3PLU A;  3ENE A;  1C3T A;  1YX5 B;  3SDL C;  3ZNG C;  4BKS D;  2CR5 A;  2LVO A;  1FXT B;  4NQK E;  2GBJ A;  4IUM B;  4BBN F;  3L10 B;  3W1Y A;  2N9P C;  4KDI C;  4EUT A;  2DZJ A;  3GOE A;  1KLV A;  1HE8 A;  4FJZ A;  2N9X A;  4I6P A;  4MGI E;  4ANW A;  4WWN A;  1WI0 A;  3PRE A;  3RYT A;  1WJN A;  4MJS B;  3T9L A;  4PYU A;  4FHJ A;  2NBU A;  4BKG A;  4OVU A;  4W9E A;  3DBL I;  3MHS D;  2KFJ A;  2JVC A;  1E7V A;  2ZVN A;  2KDI A;  2G45 B;  2XEW A;  3B0A A;  3CMM B;  2LVP A;  4K7W A;  3WAP A;  3ZRC A;  4B95 A;  3ECI A;  2WWZ A;  2J0M A;  3ZVV A;  1WGY A;  4JGH B;  4K7U A;  2BGF A;  4ZRJ A;  1WE6 A;  3K9P B;  2CS4 A;  3WAN A;  3IBE A;  2D07 B;  1WJ4 A;  4N9F 4;  2ZNV C;  3PLV A;  4GSW A;  2ZPN A;  2D10 A;  2IY1 B;  2CHZ A;  2RGF A;  3RZF A;  4AJW A;  5CHW A;  4DHZ B;  4W9H A;  2NS5 A;  1WMH A;  3UQA A;  3R3M A;  2KDF B;  2KTR A;  3LDZ E;  3EFU A;  3H6N A;  4ZRI A;  2DAF A;  3QCA A;  3OAW A;  3ZNZ B;  4E3C A;  3L13 A;  4AWJ A;  5AZF A;  3ZKJ C;  1E8Y A;  4KV2 A;  4NY0 A;  3VTU A;  2LUE A;  3RCZ A;  4HPL B;  2JXX A;  4W9D A;  1WX9 A;  3DDC B;  3VTW A;  2CU1 A;  4G3X B;  4M8N A;  5CTR C;  4MGK E;  5TR5 A;  1MG8 A;  3R7R A;  1AAR A;  2C9W B;  1TBE A;  1C1Y B;  3H7P A;  3ZNI D;  2Z0E B;  3O65 B;  2PJH A;  2JRH A;  3QWZ B;  2JPH A;  2MRP A;  2OOB B;  4MEL A;  3NZS A;  1NBF C;  3Q3F A;  4MJS A;  4PYZ A;  3B08 A;  3DBH I;  4WJN A;  1WXS A;  2N4F A;  3CST A;  2FCQ A;  3N30 A;  1G6J A;  2LGY A;  1V6E A;  1RLF A;  3C0R B;  3QAQ A;  2MLB A;  5DPR A;  4IM3 A;  2FNJ B;  5DPW A;  4HK2 A;  2MX2 A;  4IM0 A;  4TKN A;  1I35 A;  4HDO A;  4J6I A;  5L95 C;  4PS3 A;  1IYF A;  3PVL A;  3SD5 A;  4GMV A;  3LJ3 A;  1I42 A;  1WM2 A;  1SGH A;  1WX7 A;  3M95 A;  3U7D A;  3R66 C;  4FJV B;  2DYO A;  3DBS A;  2KFK B;  4GDL A;  3WAM A;  1SE9 A;  2KQ7 A;  4I6L B;  2B3A A;  4M0W B;  2O6V B;  3HM6 X;  2K1F A;  1WFY A;  4GIV A;  3RUI B;  3H7S A;  3V60 A;  2ASQ A;  1TZ1 A;  4F1S A;  5C1Z A;  3QK0 A;  1WGH A;  4KVG B;  4DDI D;  3HM3 A;  2MP2 A;  4GDK B;  2GBK A;  4AUQ C;  1WYW B;  3P2B A;  3X23 A;  2KMC A;  2KDB A;  2LVQ A;  3QIJ A;  4LDT D;  2LAS A;  3B1L X;  3RD2 A;  1YJ1 A;  3S2A A;  1PQS A;  4MGZ E;  3ML8 A;  3WAL A;  4JLC A;  3PHW B;  1Y8R C;  4NAW B;  3RUL A;  3VQI A;  2WX1 A;  3VXW A;  2RPQ A;  1WIA A;  2J0J A;  3NS8 A;  4GU2 A;  4IWQ A;  4HCN B;  4MDK E;  3VH3 B;  2KXJ A;  2M17 A;  5CHV C;  2JWZ A;  1A5R A;  1LFD A;  1V81 A;  3UGB B;  1KM7 A;  3PSE B;  3ALB A;  2AYO B;  2IYD B;  4LJO B;  5IAA C;  3PGE A;  2KKC A;  2LJ5 A;  4KIK A;  3ZDT A;  1WRD B;  2ZEQ A;  4DXA B;  2KFK A;  3ZUN A;  5EDS A;  2K6Q A;  2KD0 A;  2KWU B;  3M3J A;  2C7M B;  2O6V A;  3L17 A;  3DQV A;  3VUY A;  2OJR A;  3DBR I;  3A9J B;  2KVR A;  4GOC A;  2N7E A;  4GN1 A;  2HD5 B;  2DX5 B;  3L54 A;  5G2N A;  5J17 A;  3WA0 A;  2PEA A;  3NHE B;  1RAX A;  4M8M A;  2PPH A;  2V3S A;  2JZ3 B;  2KC1 A;  3QHT A;  3W1S C;  2D3G A;  1V5T A;  1ISN A;  1E8W A;  1P3Q U;  4KSL C;  4P7I A;  1BT0 A;  5DPS A;  1R4N I;  3APF A;  3BIN A;  3M62 B;  5LXH A;  3KH0 A;  4NAW A;  3RT3 B;  1GG3 A;  1UBQ A;  3DOW A;  3L0W B;  1V2Y A;  3NY5 A;  1WGD A;  5E6P A;  4F8C B;  3WIM A;  3TIX A;  3VAW A;  4MM3 A;  2KJH B;  2KWC A;  4WJO A;  4GXB A;  1RFA A;  3PS6 A;  4TUU A;  4BKT A;  4ICU A;  1YQB A;  4HLE A;  2R2Q A;  4EFO A;  3QA8 A;  5CHF A;  3PT2 B;  2FID A;  2LGD A;  2BYF A;  2FCM A;  3L08 A;  2KDE B;  3A1Q B;  4A20 A;  2BYV E;  2KO3 A;  4ANU A;  5GMV A;  2Z59 B;  1ZKH A;  1D3Z A;  2IY0 B;  3AUL A;  4RMA A;  4TQ1 A;  1J0G A;  2IO0 B;  3ZRF A;  3A9J A;  4HVB A;  2DEN B;  2DYB A;  3DCG A;  5JZE B;  1UZX B;  4F7Z A;  4FN2 A;  3A4R A;  2I1K A;  3PTF C;  3QX1 A;  1L2N A;  4WWO A;  3N32 A;  5FR6 A;  5J18 A;  4NJ6 A;  2LRU A;  2ZCC A;  2EKE C;  1Z5S B;  3H1U A;  1Q1O A;  3SU8 X;  1P9D U;  2PE6 B;  4XX5 A;  3IVF A;  2K25 A;  3CSF A;  4LCD E;  4MSQ B;  2JRI B;  3T8M A;  1WJ6 A;  3KUD B;  3UF8 A;  1UH6 A;  2BKR B;  1WXM A;  2GMI C;  4E74 A;  2L76 A;  2C60 A;  3UQB A;  4LDT B;  3VFK A;  2LWP A;  2A4Z A;  1NDD A;  3H9D A;  3QJZ A;  2XK5 B;  4W9L A;  2BYE A;  1WY8 A;  2D2Q A;  2N7D A;  3V6E B;  3UIN B;  1UEL A;  1XD3 B;  1WR1 A;  2DYM A;  1H4R A;  4MH0 E;  2WDT B;  4B9K A;  2O2V B;  1VCB A;  4TQ0 A;  2IO3 B;  3MJW A;  1X1M A;  2DZK A;  4A3O A;  1Q5W B;  1EF5 A;  4EZK A;  5J2R A;  4HXD A;  3OLM D;  4RM9 A;  1KJT A;  4W9F A;  4WQO B;  2LXA A;  3IHP C;  1EO6 A;  4WJP A;  2WX0 A;  2LZ6 A;  5G55 A;  4II2 B;  4EKU A;  4ICV A;  3PHX B;  2NBW B;  4DDG D;  1ZGU B;  4BVU C;  4FBJ B;  2KNB A;  2N1W A;  3PZD A;  4MSM B;  2NVU I;  3EEC A;  2FCN A;  1SIF A;  2J0K A;  2MBO A;  3DVG X;  1WJU A;  2KJR A;  5KHQ A;  2YVC A;  3KUZ A;  4HPM B;  3U30 A;  2UYZ B;  2CHW A;  2L00 B;  1YD8 U;  5C23 A;  1J19 A;  4EZJ A;  5AEK B;  1L7Y A;  4NNJ B;  2RD0 A;  1XQQ A;  2L3Z A;  3W1S A;  3WAO A;  4LJP B;  2UWQ A;  3HHM A;  4XC2 A;  2C7N B;  2FAZ A;  2D11 A;  4AOF A;  2XK5 A;  3RZW C;  4ANV A;  3A9K B;  2JF5 A;  2KOX A;  3R7Q A;  3ZW3 A;  3QAR A;  3ZLZ A;  2HE7 A;  4EZL A;  2LI5 A;  2DHZ A;  2NPT B;  3HIZ A;  3V61 A;  4NPN A;  2CKH B;  2JUO A;  1GC6 A;  4CO7 A;  1S3S G;  2ZZP B;  4FJY A;  1WR6 E;  2MWS B;  2N9E B;  4IWP A;  4FA6 A;  3Q3J A;  2BF8 B;  2N1V A;  2CHX A;  2M0X A;  4II3 B;  2AL3 A;  2L0F A;  1OQY A;  3A4S C;  5DCN A;  2M8S A;  5JHA A;  2ZPY A;  2NBV B;  3V6C B;  2EMS A;  3PRP B;  4DBG A;  1WZ0 A;  4ZRK A;  1JRU A;  3JSV B;  4FAD A;  2K8C A;  3ONS A;  4URK A;  4AP4 C;  1E7U A;  1LM8 B;  4DHJ D;  1F9J A;  1WX8 A;  2KWV B;  2NR2 A;  4BOZ B;  4BOS C;  2L0T A;  4GDK A;  3VHT C;  4WJQ A;  3GZN I;  4BKS A;  4ZDV A;  2XBB C;  4NQL B;  1R4M I;  2DZI A;  3KVF B;  1IPG A;  2MBB B;  4K81 A;  2GBR A;  3A33 B;  3DPD A;  4TV3 A;  4X57 B;  1OEY A;  1V5O A;  3VUW A;  5IA7 A;  1V80 A;  1TTN A;  1WXV A;  3EHV A;  4W9G A;  5DPT A;  1J8C A;  1Q0W B;  2G4S A;  2L05 A;  2IBI B;  1E5W A;  2KLG A;  1Z2M A;  2MBQ A;  1WE7 A;  3VDZ A;  4FLH A;  5D6J B;  2DAJ A;  3MTN B;  2R2O A;  3OJ4 B;  5AZG A;  4OVV A;  2LXC A;  3VUX A;  2LGX A;  2IZV B;  1WGG A;  2KQS A;  1E8Z A;  2KHW B;  2AEH A;  2IO2 B;  2LRW A;  3PRZ A;  4IM2 A;  3TJP A;  4W9C A;  2KAN A;  1WXA A;  1M94 A;  2G3Q B;  4JIO U;  1QZE A;  3D32 A;  2Z0D B;  2M4N A;  2KMA A;  3UIO B;  2RR9 A;  2L8J A;  3JSV A;  3QC8 B;  4FUL A;  4KZ0 A;  5D2M B;  5E6O A;  3H7P B;  3EC8 A;  1YX6 B;  4AJY B;  2G4D B;  2JZZ A;  4IG7 B;  3HK0 A;  2A5U A;  3AU5 A;  2K39 A;  2V1Y A;  1GJZ A;  4CYE A;  2BKF A;  1ZW7 A;  1GNU A;  2PE9 A;  4PS7 A;  4I6N B;  4HCP B;  5AZH A;  2KZR A;  5JH5 C;  1E90 A;  3QQ8 B;  2KX0 A;  2J7Q B;  2K6D B;  2I1J A;  3X0W A;  2MW5 A;  1CMX B;  1OEY J;  1UGM A;  2REX A;  2Y5B B;  2BWE S;  3APC A;  2M1M A;  4ZYN A;  1GUA B;  2QHO A;  3KW5 B;  1KOT A;  4BFR A;  3ZIM A;  2DZM A;  4IWO A;  4DK5 A;  3V62 A;  3TCA A;  4CHK A;  4GDL B;  2K8B A;  4GGQ A;  1V86 A;  2LD9 A;  3VTV A;  3BY4 B;  3I3T B;  3A1Q A;  3PV1 A;  3VVW B;  2BPS A;  4WWP A;  3TBL D;  3DVN V;  1EF1 A;  3JYU A;  2FUH B;  4HDQ A;  2JT4 B;  2MBH A;  3JW0 X;  3M63 B;  2MP2 B;  4XZ4 A;  4E71 A;  4ASW C;  2KTF A;  4RM8 A;  5L83 A;  1S1Q B;  4BBN C;  3NZU A;  4GB9 A;  5D94 A;  4MEM A;  4PS8 A;  1XT9 B;  2ZVO A;  1WF9 A;  4IC7 B;  1WGR A;  2AWT A;  4W9K A;  3APD A;  3PPA A;  3VH4 B;  4DHJ B;  4DWF A;  2EMT A;  3IG3 A;  2KX3 A;  3AXC A;  2MBE A;  4K7S A;  2KC2 A;  2V4L A;  4KSK C;  4HWI B;  2KLC A;  3KYD D;  4G50 A;  3ZO5 B;  3PRM B;  2YLM A;  1UBI A;  1WZ3 A;  5LLI A;  2MQJ A;  2GBM A;  2FCS A;  3OJ3 A;  3ZDM C;  1U4A A;  1H8C A;  2NCN A;  4KIK B;  5HKH A;  2ZNV B;  1OTR B;  1OGW A;  1K8R B;  3KUC B;  2K8H A;  4JQW C;  2VRR B;  4YL8 A;  5JHB A;  2IO1 B;  1GC7 A;  4EEW A;  2O2V A;  1E8X A;  5D7G A;  1T0Y A;  2JY6 A;  4EOY A;  1TGZ B;  1UD7 A;  3TMP B;  4B6W A;  3ZNH B;  2BWF A;  2HJ8 A;  2GBN A;  1EUV B;  2L7R A;  3ZTC A;  2W9N A;  4G11 A;  4KZC A;  4NJ7 A;  2GOW A;  1P98 A;  4JL9 A;  1P0R A;  3CF6 E;  2WYQ A;  3KYC D;  4A3P A;  4K1R B;  3NOB A;  4HJK A;  3N3K B;  3JVZ X;  1WH3 A;  5CX3 A;  2KJ6 A;  3UIP B;  3ML9 A;  1V49 A;  2MA9 B;  2KN5 A;  4KDL B;  3SHQ A;  1RRB A;  1YIW A;  5BO4 B;  1VD2 A;  5LXI B;  4WAA A;  5E6N A;  3ZTD A;  4W9J A;  1IP9 A;  1LXD A;  2RSU A;  5KHO A;  4MGY E;  2ZJD A;  1LQB A;  2AL6 A;  2ZCB A;  4W9I A;  3A9K A;  3U8Z A;  2C5L C;  2MSE D;  3AI5 A;  2FIF A; 
#chains in the Genus database with same CATH topology
 4G0N B;  3DVN U;  2NPT A;  2O6V D;  4ANX A;  2C7H A;  3H8H A;  2KVZ A;  1WMH B;  3DVG Y;  4DHZ E;  1XCQ L;  5G5H A;  3AMZ A;  3ZNG C;  4BKS D;  3Q3N C;  3ZJU A;  3ZQ4 A;  4IKG A;  2GBJ A;  4IUM B;  4JWS C;  4C4V A;  4BBN F;  1HQR D;  2WHI A;  3GOE A;  3DBL B;  3PRE A;  3RYT A;  1WJN A;  3VRB B;  3E9S A;  4FHJ A;  2NBU A;  4PYU A;  3MHS D;  2KFJ A;  1ZXI A;  1V97 A;  5IKC M;  2WWZ A;  2J0M A;  4JGH B;  2BGF A;  4ZRJ A;  1WE6 A;  4M02 A;  3IBE A;  2D07 B;  4N9F 4;  2ZNV C;  4GSW A;  3RZF A;  1L6U A;  4DHZ B;  4W9H A;  3UQA A;  3R3M A;  1GAQ B;  1QT9 A;  4NAM A;  4AWJ A;  2LUE A;  1PGA A;  1FM0 D;  3DDC B;  2CU1 A;  1TBE A;  3ZNI D;  3H7P A;  2Z0E B;  4N6E B;  2LHD A;  2NMQ A;  3J9C A;  4MEL A;  2MRP A;  3URY A;  1IGD A;  3DBH I;  1WXS A;  3N30 A;  3EUB 2;  2LGY A;  1V6E A;  3C0R B;  1NVI D;  5DPW A;  2MX2 A;  4C56 C;  4TKN A;  4J6I A;  1R7S A;  5E6J A;  4PS3 A;  1VZ6 A;  3SD5 A;  3VRA B;  1WX7 A;  5EE1 A;  4I6L B;  2KN4 A;  4F1S A;  5C1Z A;  1WGH A;  1A70 A;  2MP2 A;  1N61 A;  3P2B A;  2KMC A;  2KDB A;  2ZW0 A;  3Q2A C;  3QIJ A;  1HZ6 A;  3PHW B;  4MH8 A;  3RUL A;  1WIA A;  1HTQ A;  1UWX A;  3NS8 A;  4IWQ A;  4HCN B;  1TS3 A;  2N9L A;  2JWZ A;  1A5R A;  1IGC A;  1JWS D;  1KM7 A;  2LFI A;  1P7F A;  5HI1 A;  1C9F A;  5IAA C;  2ZEQ A;  2KFK A;  2BB6 A;  2QIL A;  2OJR A;  3DBR I;  2KVR A;  4GOC A;  4FXC A;  1FCC C;  3WA0 A;  4YSX B;  2GI9 A;  3T3O A;  1PFD A;  1R4N B;  4M8M A;  1CK1 A;  2PPH A;  2D3G A;  1P3Q U;  4NAW A;  1UBQ A;  3L0W B;  1V2Y A;  3ZJV A;  4MM3 A;  3AE8 B;  1D4B A;  4WJO A;  4GXB A;  2WXJ A;  2WNM A;  1F0Z A;  2R2Q A;  3FKY A;  5CHF A;  1K51 A;  2BYF A;  2KDE B;  2BYV E;  2KO3 A;  5GMV A;  1TJE A;  2Z59 B;  1ZKH A;  4WUR A;  3ZRF A;  3A9J A;  4YT0 B;  2DYB A;  1UZX B;  4FN2 A;  3A4R A;  3PTF C;  5FK9 C;  3AE9 B;  2GB1 A;  4NJ6 A;  1WGK A;  2ZCC A;  3TEY A;  2HTM E;  3I63 C;  4EE2 A;  2PE6 B;  1TKG A;  1FPY A;  3KUD B;  5TSS A;  1B1Z A;  2A4Z A;  2Y3A A;  2KMM A;  2BYE A;  1M4V A;  2D2Q A;  3V6E B;  3TEW A;  3IT6 B;  1WR1 A;  4QAY A;  2IO3 B;  1X1M A;  4A3O A;  4EZK A;  4RGO S;  3OLM D;  4W9F A;  4WQO B;  2QSD A;  3IHP C;  3AE6 B;  1EO6 A;  2WX0 A;  2W3S A;  2V9H A;  2FE8 A;  3PHX B;  2WXL A;  2L1A A;  1ZGU B;  3PZD A;  4YTN B;  2NVU I;  3EEC A;  2FCN A;  4OW0 A;  3Q3M C;  1YQ3 B;  3R2T A;  2UYZ B;  2CHW A;  3ZYY X;  5AEK B;  1IUE A;  1MPE A;  2L3Z A;  4RFB A;  3W1S A;  2K9X A;  2TSS A;  1MHH E;  2XK5 A;  2JF5 A;  3R7Q A;  2LI5 A;  2DHZ A;  1BUI C;  1GC6 A;  2RMM A;  1WYG A;  2MWS B;  3RNB C;  3Q3J A;  2CHX A;  3W2D A;  2AL3 A;  3RI7 C;  5DCN A;  1SE2 A;  1SE4 A;  2WP9 B;  3PRP B;  3MC0 B;  1WZ0 A;  4M0W A;  1E7U A;  1F9J A;  2NR2 A;  2L0T A;  3MC8 A;  3KQ4 A;  4GDK A;  5C2T B;  1OQR A;  4K81 A;  4TV3 A;  4X57 B;  1OEY A;  3NJT A;  2B76 B;  1ZPS A;  2BT6 A;  3MFG A;  4JE3 B;  4N59 A;  2KLG A;  1Z2M A;  1T5X D;  5D6J B;  2DAJ A;  3OJ4 B;  2LGX A;  3AH7 A;  3PRZ A;  4IM2 A;  1FNV A;  3AB5 A;  4JIO U;  2MHJ A;  1JRO A;  1NYQ A;  3P4R B;  2JZZ A;  2WXQ A;  4IG7 B;  1ET9 A;  1GJZ A;  3BYT B;  4CYE A;  4OHJ A;  2PE9 A;  2MH7 A;  2R61 A;  2KZR A;  2IGH A;  3QQ8 B;  2KX0 A;  1SXT A;  1PDX A;  2MW5 A;  1OEY J;  2BWE S;  2M1M A;  4ZYN A;  3KW5 B;  4BFR A;  1FXA A;  1I4R A;  4IWO A;  2NTS A;  5BYS A;  3TCA A;  3OWE B;  1V86 A;  3PV1 A;  2BPS A;  1MI0 A;  2WXG A;  1FCL A;  1EF1 A;  3JYU A;  4ARC A;  4HDQ A;  3M63 B;  4A9A A;  3PZ8 A;  2KTF A;  4ASW C;  1F52 A;  1T3Q A;  1XT9 B;  3BVG A;  1WF9 A;  3AE4 B;  5BMG A;  5BMH A;  4W9K A;  3VH4 B;  3Q8F A;  4MT5 A;  4YSZ B;  2MBE A;  2KC2 A;  1N63 A;  4NZL B;  3KYD D;  1MHX A;  3OJ3 A;  1JAL A;  1F77 A;  3KUC B;  2K8H A;  4JQW C;  1YN3 A;  2IO1 B;  2INN E;  4EEW A;  2O2V A;  1T0Y A;  2JY6 A;  3N20 C;  2BWF A;  3GE3 C;  2L7R A;  3ZTC A;  2W9N A;  2GOW A;  1P98 A;  1P0R A;  3LYY A;  3KYC D;  4K1R B;  3NOB A;  1WH3 A;  2M56 B;  1PGB A;  3MHZ A;  4WWM A;  5CX3 A;  3UIP B;  1V49 A;  4KDL B;  5T8I A;  2M0A A;  1VD2 A;  1J7C A;  5LXI B;  4WAA A;  4OVZ A;  1IP9 A;  1QKZ A;  1I4Q A;  2ZJD A;  4KGS A;  1XLQ A;  4RGM A;  1XLP A;  1KLU D;  2I2Y A;  3NVV A;  3L4P A;  3E56 A;  2MCN B;  2CJN A;  3IFW B;  3KLS X;  3L16 A;  2KTR B;  2EKI A;  1C3T A;  3SDL C;  4HPP A;  2LVO A;  1UUP A;  1CQV A;  1FXT B;  1ZE3 D;  1C77 A;  4HJG E;  4EUT A;  2MJE A;  4FJZ A;  4H2A A;  2N9X A;  4MGI E;  4ANW A;  1IBX B;  3BK1 A;  4OVU A;  3CIR B;  4W9E A;  2ZVN A;  1E7V A;  2KDI A;  2G45 B;  4B95 A;  4HVB A;  4IDI A;  4K7U A;  3WAN A;  2CS4 A;  1WRI A;  1AWD A;  1QOG A;  1RYJ A;  1ZDV A;  2IY1 B;  3PZ7 A;  3DWG C;  2NS5 A;  1WMH A;  4ZRI A;  2OJW A;  1E6E B;  3QCA A;  2V3P A;  5AZF A;  1YOV B;  4NY0 A;  4DQO C;  3RCZ A;  4HPL B;  4W9D A;  1WX9 A;  3VTW A;  1SE3 A;  4LNO A;  4M8N A;  4MGK E;  5TR5 A;  3BK2 A;  5FKA C;  3RNF C;  3O65 B;  1V8C A;  3DBH B;  2PJH A;  2WDR B;  2JPH A;  2OOB B;  1CZP A;  1TKY A;  1G6J A;  3CST A;  5DPR A;  3QAQ A;  2MLB A;  2E3T A;  3AEC B;  4IM0 A;  1I35 A;  4HDO A;  2PW9 A;  4GMV A;  4B0E A;  3Q3O C;  1SGH A;  4KKI A;  2FBW B;  2VH2 A;  3M95 A;  3R66 C;  2DYO A;  4FJV B;  2QIE B;  4GDL A;  3WAM A;  1SE9 A;  2KQ7 A;  2O6V B;  2ACZ B;  2WXF A;  3H7S A;  1NEN B;  2D3B A;  3BII D;  3RUI B;  2D5G A;  4HRS A;  1TZ1 A;  4KVG B;  3HM3 A;  2GBK A;  2PMV A;  3X23 A;  4HEA 1;  2LVQ A;  2V0G A;  1YJ1 A;  1PQS A;  4MGZ E;  4ZHP A;  2WU5 B;  3VXW A;  1FRR A;  4HKQ A;  4GU2 A;  4MDK E;  2M17 A;  1V81 A;  3UGB B;  2AYO B;  3DBR B;  2KKC A;  2LJ5 A;  3PGE A;  4KIK A;  4LK0 M;  1WRD B;  5EDS A;  3P1M A;  3DQV A;  2N7E A;  3AE3 B;  2HD5 B;  2DX5 B;  4D2K A;  2SEB D;  4O1N A;  1YJJ A;  2PEA A;  3NHE B;  1L5P A;  1K52 A;  1QQR A;  2KC1 A;  1FEH A;  1YJI A;  4RH6 A;  1TYG B;  1NYR A;  3DOW A;  4S0R A;  3NY5 A;  1WGD A;  3WIM A;  3TSS A;  1KLG D;  1RFA A;  3PS6 A;  4EFO A;  3QA8 A;  5BYQ A;  2FID A;  2BQQ A;  2QMT A;  1E9M A;  4ANU A;  2DBY A;  2IY0 B;  2IO0 B;  3QX1 A;  1L2N A;  2M19 A;  3NVY A;  5J18 A;  2LRU A;  2EKE C;  1Q1O A;  3SU8 X;  2PKO A;  5IN7 A;  1JML A;  5GXG B;  2N0S B;  1UH6 A;  2WXP A;  2BKR B;  2GMI C;  2L76 A;  2H89 B;  1QLB B;  3H9D A;  2N7D A;  1FD6 A;  1XD3 B;  3W9C B;  1H4R A;  1RM6 C;  4B9K A;  3Q8C A;  3N1X C;  3AEA B;  5J2R A;  4HXD A;  2UU7 A;  4M01 A;  2WS3 B;  2LZ6 A;  3DHG C;  4II2 B;  5G55 A;  4ICV A;  1PUT A;  1N5X A;  3B2G A;  2MBO A;  3DVG X;  2JQR B;  5KHQ A;  3U30 A;  1J19 A;  1L7Y A;  1VZ8 A;  3HRD D;  4M00 A;  4P16 A;  2WGS A;  1I4P A;  2C7N B;  2FAZ A;  1BML C;  1XO3 A;  2KOX A;  2X8X X;  1WSP A;  3HIZ A;  2NPT B;  2QEJ C;  4CO7 A;  2SAK A;  1BXT A;  1S3S G;  4FJY A;  1WR6 E;  4ZYS A;  1MVK A;  3KWV A;  1TS4 A;  2N1V A;  4II3 B;  1ZXH A;  2W82 A;  5JHA A;  2EMS A;  3NZ3 A;  3JSV B;  4TMA B;  3ONS A;  1C4P A;  4URK A;  4DHJ D;  4BOS C;  4WJQ A;  4ZDV A;  2XBB C;  1TS5 A;  1L4D B;  1R4M I;  4WAF A;  2MBB B;  3A33 B;  3DPD A;  1KFY B;  1V1P A;  3EHV A;  4W9G A;  3RNE C;  1HEZ E;  2MBQ A;  5BYR A;  4FLH A;  1RWS A;  2K5P A;  2K22 A;  1ZUD 2;  4REZ A;  1F2R I;  2LXC A;  3HVZ A;  2KQS A;  2KHW B;  2OHF A;  2LRW A;  4W9C A;  3D32 A;  1SIJ A;  1TZO A;  4FUL A;  3H7P B;  4L23 A;  1TY2 A;  2G4D B;  3HK0 A;  2A5U A;  3LB8 C;  1SEB D;  1DOY A;  2K39 A;  2LUM A;  3CWI A;  1ZW7 A;  2BKF A;  4I6N B;  1HA5 A;  2J7Q B;  2K6D B;  5EE9 A;  4YTP B;  1UGM A;  1N6Z A;  1V1O A;  2REX A;  2QHO A;  2NTT A;  3N9Y C;  3ETR A;  2DZM A;  2BVC A;  1VR9 A;  3V62 A;  1TIF A;  4CHK A;  2WXO A;  3BY4 B;  3I3T B;  3A1Q A;  3VVW B;  2X38 A;  1L6V A;  2LEK A;  3JW0 X;  2MP2 B;  3BYY B;  4RF0 A;  4ZHO A;  4IC7 B;  1WGR A;  3C8Y A;  3APD A;  3RMK C;  2EMT A;  4HWI B;  2KLC A;  3RFZ B;  4G50 A;  3EGR A;  3ZO5 B;  3NVZ A;  3PO0 A;  5IP4 D;  2K0P A;  2MQJ A;  2ON8 A;  1U4A A;  1H8C A;  2NCN A;  3HUI A;  1NI3 A;  3FAH A;  1K8R B;  2IGG A;  3HVD A;  4YL8 A;  5JHB A;  4A8X C;  1E8X A;  5D7G A;  1NEK B;  2AQ2 B;  1TGZ B;  2PVG C;  2BTE A;  1FIQ A;  2HJ8 A;  2GBN A;  1EUV B;  3TEZ A;  3T3N A;  1MG4 A;  2KDM A;  4KZC A;  4JL9 A;  1HTO A;  2WYQ A;  4ZOH C;  3N3K B;  3ML9 A;  1EWY C;  2KN5 A;  1RRB A;  5BO4 B;  4MM3 B;  2RPV A;  1MJD A;  5E6N A;  4XWW A;  2RSU A;  4MGY E;  3TEX A;  4US8 A;  2AL6 A;  3A9K A;  2V4I B;  2HTH A;  1N60 A;  4IW0 A;  4FHK A;  1P1A A;  3AEE B;  1V9J A;  3K9O B;  1NI2 A;  2ONQ A;  1AW7 A;  2CR5 A;  2PLP A;  4JWU C;  3L10 B;  2QCZ A;  4KDI C;  2DZJ A;  1KLV A;  4WWN A;  1L0X B;  4MJS B;  3T9L A;  3AV8 A;  4BKG A;  2LJI A;  2JVC A;  4LTU A;  3DHH C;  3WAP A;  3CMM B;  2XEW A;  2LVP A;  1D5Z C;  3ZRC A;  3ECI A;  3ZVV A;  1WGY A;  2Q5W D;  3K9P B;  1AN8 A;  2D10 A;  2CHZ A;  4AS1 A;  5FR3 A;  2KTR A;  2DAF A;  3OAW A;  3AEG B;  2INP E;  3L13 A;  3ZNZ B;  3ZKJ C;  1SBB B;  2K3U A;  4KV2 A;  2JXX A;  4LNK A;  4G3X B;  2PTL A;  1MG8 A;  3R7R A;  1AAR A;  2C9W B;  4YXD B;  1C1Y B;  1D5X C;  1DOI A;  3NUH B;  2JRH A;  1IBX A;  3NZS A;  3B08 A;  4UDU C;  1VRA B;  1RLF A;  4HK2 A;  2KAC A;  1FNW A;  2J53 A;  5L95 C;  5HFY A;  4RGT A;  1IYF A;  3LJ3 A;  1I42 A;  4R3D A;  1WM2 A;  1E10 A;  3DBS A;  4RF1 A;  3C19 A;  4M0W B;  2B3A A;  1GOZ A;  3BZD B;  3NG0 A;  1ACC A;  3HM6 X;  2K1F A;  1EWC A;  2ASQ A;  2KWD A;  3QK0 A;  2GLS A;  4N58 A;  2WXM A;  4GDK B;  4PK1 A;  1ET6 A;  3U2S C;  4AUQ C;  1FFU A;  1WYW B;  2IND C;  3AE5 B;  2CJO A;  1QIL A;  4LDT D;  2LAS A;  3B1L X;  3RD2 A;  3ZXR A;  3ML8 A;  3IAM 1;  2KAJ A;  1ZDX A;  2WX1 A;  2WXR A;  2JZP A;  2YEP B;  2WU2 B;  2J0J A;  3VH3 B;  2KXJ A;  4WQM A;  1LFD A;  5D3I B;  1SF0 A;  3FIL A;  3ZUN A;  2BS3 B;  2K6Q A;  2KD0 A;  2C7M B;  2O6V A;  3L17 A;  1OQQ A;  2JX5 A;  4GN1 A;  5G2N A;  1EU4 A;  1FXI A;  2V3S A;  2JZ3 B;  3V05 A;  3W1S C;  5H8Y E;  4KSL C;  1E8W A;  1BT0 A;  5LXH A;  3ZGZ A;  3APF A;  3M62 B;  3KH0 A;  3RT3 B;  2Z8L A;  1GG3 A;  2KYW A;  1XEE A;  1L0Y B;  3VAW A;  2KJH B;  4HKZ E;  2G9H D;  3U4E G;  4ICU A;  1YQ4 B;  1C4A A;  3PT2 B;  2JU6 X;  2LGD A;  3I9V 1;  4A20 A;  1D3Z A;  3EA6 A;  4RMA A;  3DHI C;  4F7Z A;  2I1K A;  4ITK A;  3N32 A;  1Z5S B;  3H1U A;  1P9D U;  4XX5 A;  3IVF A;  4LCD E;  2BW2 A;  5EE3 A;  4YTM B;  4MSQ B;  3T8M A;  1WJ6 A;  1ESF A;  5D3D A;  1WXM A;  3Q8B A;  2C60 A;  3VFK A;  1NDD A;  3QJZ A;  4W9L A;  1UEL A;  3AEB B;  2DYM A;  4MH0 E;  2O2V B;  1JW9 D;  4RM9 A;  1KJT A;  1UF0 A;  3MJ5 A;  3N1Y C;  1I4G A;  4EKU A;  2BS4 B;  1VDV A;  4DDG D;  1GPX A;  2VZK D;  4BVU C;  2WXH A;  1WJU A;  3KUZ A;  2L00 B;  4OZA A;  4S17 A;  3AE1 B;  2UWQ A;  3ABV B;  1GB1 A;  2D11 A;  4ANV A;  2HE7 A;  2XN9 C;  1SSN A;  1JWM D;  3V61 A;  2CKH B;  2JUO A;  2ZZP B;  3R8B A;  2QDF A;  2N9E B;  3VR9 B;  4IWP A;  2BF8 B;  2M0X A;  3A4S C;  2M8S A;  2WDQ B;  2NBV B;  3V6C B;  1T0S C;  2ICI A;  4ZRK A;  1JRU A;  4C80 A;  4AP4 C;  1LM8 B;  2AQ1 B;  1WX8 A;  1R4M B;  5JXV A;  1D5M C;  4L1B A;  2BBC A;  3VHT C;  4OZB A;  3GZN I;  4NQL B;  3V3X A;  1V5O A;  3VUW A;  1V80 A;  1WXV A;  5DPT A;  2L52 A;  2IBI B;  1E5W A;  3AN1 A;  1YNT E;  1XCT L;  2H88 B;  3VDZ A;  2YEP F;  3MTN B;  5AZG A;  1KTK A;  4K3B A;  3VUX A;  2IZV B;  1VLB A;  1E8Z A;  2AEH A;  2W55 A;  4KGR A;  5AUK A;  2HDE A;  1WXA A;  3Q6B A;  1QZE A;  4CQN A;  2M4N A;  3BVM A;  1PYW D;  3UIO B;  1FO4 A;  2RR9 A;  5G5G A;  2L8J A;  3JSV A;  4KZ0 A;  2W54 A;  5H92 C;  1YX6 B;  3IXS A;  4ZRP A;  4AJY B;  2WDV B;  3AU5 A;  2V1Y A;  3I57 A;  1GNU A;  4HCP B;  5AZH A;  5JH5 C;  3P4Q B;  3X0W A;  1CMX B;  3NRZ A;  1YMH E;  3ZIM A;  4LNI A;  1I7H A;  1OFF A;  4DK5 A;  1SB3 C;  4XDD A;  4GDL B;  1DGJ A;  2RDG A;  4GGQ A;  2IDY A;  3VTV A;  1GB4 A;  3R2I A;  3TBL D;  3DVN V;  2FUH B;  3O13 A;  2JT4 B;  4J3O D;  4P6V F;  4E71 A;  4RM8 A;  1S1Q B;  2WXK A;  5C3J B;  3NVW A;  1C79 A;  2AWT A;  3PPA A;  2BB5 A;  4DHJ B;  4DWF A;  2FUG 1;  4KSK C;  1QOB A;  2YLM A;  1UBI A;  1WZ3 A;  4C7Z A;  2N9K A;  1F2R C;  2GBM A;  4C7Y A;  4KIK B;  4L2Y A;  5HKH A;  1OTR B;  1OGW A;  2VRR B;  1GC7 A;  4EOY A;  2JYE A;  1UNS A;  4B6W A;  3ZNH B;  3IT4 B;  1XXG A;  3OG5 A;  4DXF A;  1XLO A;  1I4H A;  4A3P A;  2WXN A;  4HJK A;  4C4V B;  2KJ6 A;  2MA9 B;  3SHQ A;  1YIW A;  4JPS A;  2QJL A;  1T0R C;  2L32 A;  4W9J A;  1TKE A;  3LXF A;  3U8Z A;  5EE0 A;  2C5L C;  2D3C A;  2VH1 A;  4RNA A;  4MAC A;  5LNK 1;  3TL5 A;  2L83 A;  3AU4 A;  1FMA D;  2KK8 A;  1WM3 A;  2J52 A;  3PLU A;  3ENE A;  2BS2 B;  1YX5 B;  2I38 A;  1KF6 B;  1ZP0 B;  4NQK E;  3Q8A A;  2PVO D;  2MEK A;  4K3C A;  3W1Y A;  2N9P C;  1B9R A;  3FC4 A;  3AE7 B;  1HE8 A;  4XWT A;  4I6P A;  1WI0 A;  4A6Q A;  3DBL I;  3B0A A;  4K7W A;  1FNU A;  1T6B X;  2JXT A;  1SJE D;  1WJ4 A;  3PLV A;  2ZPN A;  4AJW A;  2RGF A;  5CHW A;  2XNA C;  1JRP A;  4OZC A;  2KDF B;  3LDZ E;  3EFU A;  3H6N A;  4E3C A;  1N5W A;  1E8Y A;  3VTU A;  3U7Z A;  3I5J C;  2IGD A;  5CTR C;  1XLN A;  1JWU D;  3EFC A;  3QWZ B;  2KT7 A;  1J7A A;  4PYZ A;  1NBF C;  3Q3F A;  4MJS A;  3SFD B;  4LNF A;  4WJN A;  2N4F A;  2FCQ A;  4IM3 A;  4P1C C;  2FNJ B;  3P42 A;  4ACF A;  4JX1 C;  2KQ4 X;  3PVL A;  4US9 A;  2OED A;  3U7D A;  4A90 A;  2KFK B;  1YN4 A;  1JWB D;  1ENF A;  1RFK A;  1WFY A;  4GIV A;  1K53 A;  3Q14 C;  3V60 A;  2IJ0 A;  4DDI D;  1SJH D;  2IPK D;  4A55 A;  1V1P B;  3S2A A;  3UI3 A;  3WAL A;  5MPO A;  4JLC A;  2GRI A;  1K50 A;  2LGS A;  1Y8R C;  4NAW B;  1JWA D;  3VQI A;  2RPQ A;  3TUO A;  1WXQ A;  3AED B;  1FRD A;  1P7E A;  3WCQ A;  2J42 A;  3DWM A;  2AX5 A;  5CHV C;  4NJC A;  1T0Q C;  3PSE B;  3ALB A;  3IAS 1;  2IYD B;  4LJO B;  3ZDT A;  3P4S B;  4DXA B;  3MP9 A;  4ARI A;  2KWU B;  3M3J A;  3VUY A;  3A9J B;  2D3A A;  4C00 A;  5IOI A;  3L54 A;  5J17 A;  3GE8 C;  4YWG G;  1RAX A;  2JWU A;  5BMI A;  1DYQ A;  2V3N A;  3QHT A;  3MC9 A;  1V5T A;  1ISN A;  4P7I A;  5DPS A;  1R4N I;  3BIN A;  1AYF A;  2WQY B;  5E6P A;  3GP7 A;  4F8C B;  3KWL A;  2WXI A;  3TIX A;  2KWC A;  4TUU A;  4BKT A;  4HLE A;  1YQB A;  1FFV A;  1LGR A;  4IOI E;  2FCM A;  3L08 A;  3A1Q B;  3RNC C;  5HHD G;  4Q2J A;  1JCK B;  1C78 A;  3AUL A;  4TQ1 A;  1J0G A;  2DEN B;  3DCG A;  5JZE B;  3ZJT A;  1KH0 A;  3P4P B;  4RGN A;  4WWO A;  5FR6 A;  3VR8 B;  2EEL A;  1MFW A;  4XE0 A;  4KX6 B;  2K25 A;  3CSF A;  3Q69 A;  3UF8 A;  2JRI B;  1PGX A;  4E74 A;  3UQB A;  4LDT B;  1ROE A;  2LWP A;  1HXY D;  2RDB C;  2XK5 B;  1WY8 A;  3UIN B;  2LHE A;  5AUI A;  1E7P B;  2WDT B;  1VCB A;  4TQ0 A;  3MJW A;  2DZK A;  1Q5W B;  1EF5 A;  2LXA A;  1C4C A;  4WJP A;  2NBW B;  4RCO A;  4FBJ B;  2KNB A;  2N1W A;  4MSM B;  3Q8E A;  1UGJ A;  2J0K A;  1SIF A;  2KJR A;  1J7B A;  2YVC A;  4HPM B;  2BYT A;  2AQ3 B;  3AEF B;  5C23 A;  1YD8 U;  4EZJ A;  4NNJ B;  2RD0 A;  1XQQ A;  2N7J A;  3WAO A;  4LJP B;  3HHM A;  4XC2 A;  3RNG C;  4AOF A;  3RZW C;  3A9K B;  3B2F A;  3ZW3 A;  3QAR A;  3ZLZ A;  2E6X A;  1KRH A;  4EZL A;  4NPN A;  4TSS A;  1CJE A;  1YN5 A;  4ZRQ A;  4FA6 A;  2L0F A;  1OQY A;  2LGI A;  2ZPY A;  1STE A;  4B0M A;  4DBG A;  2INC C;  4FAD A;  2K8C A;  4LNN A;  3AM9 A;  4PT5 A;  3GZN B;  2J4X A;  5I4D A;  2KWV B;  4BOZ B;  4P1B C;  1LO5 D;  4BKS A;  4YSY B;  3BWU D;  4KKJ A;  2DZI A;  3KVF B;  1IPG A;  2GBR A;  2HJ1 A;  5HG2 A;  5IA7 A;  3RPF C;  4KGT A;  1TTN A;  2DWQ A;  1J8C A;  1Q0W B;  2G4S A;  2L05 A;  2ZW1 A;  4USA A;  1WE7 A;  3N1Z C;  2R2O A;  4OVV A;  1WGG A;  2IO2 B;  3TJP A;  2QC8 A;  2KAN A;  3AE2 B;  1M94 A;  2G3Q B;  2Z0D B;  3GB1 A;  2W3R A;  2KMA A;  1Y56 A;  1TY0 A;  5E6O A;  3QC8 B;  5D2M B;  2MJ3 A;  3EC8 A;  3ZXV A;  3W5V B;  2JSV X;  2VZK B;  3BVZ A;  4GLS C;  1C76 A;  4PS7 A;  1L4Z B;  4BZA A;  1Q10 A;  4AQ7 A;  1E90 A;  3B9J A;  2I1J A;  2Y5B B;  3APC A;  1VJK A;  1UWM A;  1GUA B;  1KOT A;  2WLB A;  2CU3 A;  1L0V B;  1F1H A;  1E0Z A;  4DXG A;  2K8B A;  2RDH A;  2LD9 A;  1TS2 A;  4WWP A;  1JQ4 A;  1N62 A;  2MBH A;  2Y5C A;  3GS2 A;  4XZ4 A;  5L83 A;  1DOX A;  4BBN C;  2G1E A;  3NZU A;  4GB9 A;  5D94 A;  4MEM A;  4PS8 A;  3U52 E;  3P63 A;  4HRO A;  2ZVO A;  2PIA A;  1QF6 A;  3IG3 A;  2KX3 A;  3RN9 C;  3AXC A;  4K7S A;  1ZOY B;  2V4L A;  2DNF A;  1QOA A;  1I4X A;  3PRM B;  5LLI A;  2FCS A;  3ZDM C;  3SR6 A;  2ZNV B;  3FIL B;  4XGA B;  3NS1 A;  1UD7 A;  3TMP B;  1HZ5 A;  3RNA C;  2DLB A;  3SEB A;  1EM7 A;  2Y5P A;  4WIP A;  4G11 A;  4NJ7 A;  3CF6 E;  2MJD A;  3SFE B;  3JVZ X;  1TT5 B;  2LMC A;  3W5U B;  4BAX A;  4XDC A;  1D6E C;  1EU3 A;  4LLG M;  1VZ7 A;  4XYC A;  3ZTD A;  1XF5 L;  1LXD A;  5KHO A;  1QOF A;  1LQB A;  4WH4 A;  5IO9 A;  2ZCB A;  2JYT A;  4W9I A;  1WWT A;  2MSE D;  3AI5 A;  2FIF A; 
#chains in the Genus database with same CATH homology
 2HTH A;  4G0N B;  2MCN B;  3DVN U;  2NPT A;  3TL5 A;  4IW0 A;  2O6V D;  4FHK A;  4ANX A;  2C7H A;  3IFW B;  1P1A A;  1WMH B;  3AU4 A;  1V9J A;  3DVG Y;  3K9O B;  2KK8 A;  2KTR B;  1NI2 A;  3L16 A;  4DHZ E;  1WM3 A;  3PLU A;  3ENE A;  1C3T A;  1YX5 B;  3SDL C;  3ZNG C;  4BKS D;  2CR5 A;  2LVO A;  1FXT B;  4NQK E;  2GBJ A;  4IUM B;  4BBN F;  3L10 B;  3W1Y A;  2N9P C;  4KDI C;  4EUT A;  2DZJ A;  3GOE A;  1KLV A;  1HE8 A;  4FJZ A;  2N9X A;  4I6P A;  4MGI E;  4ANW A;  4WWN A;  1WI0 A;  3PRE A;  3RYT A;  1WJN A;  4MJS B;  3T9L A;  4PYU A;  4FHJ A;  2NBU A;  4BKG A;  4OVU A;  4W9E A;  3DBL I;  3MHS D;  2KFJ A;  2JVC A;  1E7V A;  2ZVN A;  2KDI A;  2G45 B;  2XEW A;  3B0A A;  3CMM B;  2LVP A;  4K7W A;  3WAP A;  3ZRC A;  4B95 A;  3ECI A;  2WWZ A;  2J0M A;  3ZVV A;  1WGY A;  4JGH B;  4K7U A;  2BGF A;  4ZRJ A;  1WE6 A;  3K9P B;  2CS4 A;  3WAN A;  3IBE A;  2D07 B;  1WJ4 A;  4N9F 4;  2ZNV C;  3PLV A;  4GSW A;  2ZPN A;  2D10 A;  2IY1 B;  2CHZ A;  2RGF A;  3RZF A;  4AJW A;  5CHW A;  4DHZ B;  4W9H A;  2NS5 A;  1WMH A;  3UQA A;  3R3M A;  2KDF B;  2KTR A;  3LDZ E;  3EFU A;  3H6N A;  4ZRI A;  2DAF A;  3QCA A;  3OAW A;  3ZNZ B;  4E3C A;  3L13 A;  4AWJ A;  5AZF A;  3ZKJ C;  1E8Y A;  4KV2 A;  4NY0 A;  3VTU A;  2LUE A;  3RCZ A;  4HPL B;  2JXX A;  4W9D A;  1WX9 A;  3DDC B;  3VTW A;  2CU1 A;  4G3X B;  4M8N A;  5CTR C;  4MGK E;  5TR5 A;  1MG8 A;  3R7R A;  1AAR A;  2C9W B;  1TBE A;  1C1Y B;  3H7P A;  3ZNI D;  2Z0E B;  3O65 B;  2PJH A;  2JRH A;  3QWZ B;  2JPH A;  2MRP A;  2OOB B;  4MEL A;  3NZS A;  1NBF C;  3Q3F A;  4MJS A;  4PYZ A;  3B08 A;  3DBH I;  4WJN A;  1WXS A;  2N4F A;  3CST A;  2FCQ A;  3N30 A;  1G6J A;  2LGY A;  1V6E A;  1RLF A;  3C0R B;  3QAQ A;  2MLB A;  5DPR A;  4IM3 A;  2FNJ B;  5DPW A;  4HK2 A;  2MX2 A;  4IM0 A;  4TKN A;  1I35 A;  4HDO A;  4J6I A;  5L95 C;  4PS3 A;  1IYF A;  3PVL A;  3SD5 A;  4GMV A;  3LJ3 A;  1I42 A;  1WM2 A;  1SGH A;  1WX7 A;  3M95 A;  3U7D A;  3R66 C;  4FJV B;  2DYO A;  3DBS A;  2KFK B;  4GDL A;  3WAM A;  1SE9 A;  2KQ7 A;  4I6L B;  2B3A A;  4M0W B;  2O6V B;  3HM6 X;  2K1F A;  1WFY A;  4GIV A;  3RUI B;  3H7S A;  3V60 A;  2ASQ A;  1TZ1 A;  4F1S A;  5C1Z A;  3QK0 A;  1WGH A;  4KVG B;  4DDI D;  3HM3 A;  2MP2 A;  4GDK B;  2GBK A;  4AUQ C;  1WYW B;  3P2B A;  3X23 A;  2KMC A;  2KDB A;  2LVQ A;  3QIJ A;  4LDT D;  2LAS A;  3B1L X;  3RD2 A;  1YJ1 A;  3S2A A;  1PQS A;  4MGZ E;  3ML8 A;  3WAL A;  4JLC A;  3PHW B;  1Y8R C;  4NAW B;  3RUL A;  3VQI A;  2WX1 A;  3VXW A;  2RPQ A;  1WIA A;  2J0J A;  3NS8 A;  4GU2 A;  4IWQ A;  4HCN B;  4MDK E;  3VH3 B;  2KXJ A;  2M17 A;  5CHV C;  2JWZ A;  1A5R A;  1LFD A;  1V81 A;  3UGB B;  1KM7 A;  3PSE B;  3ALB A;  2AYO B;  2IYD B;  4LJO B;  5IAA C;  3PGE A;  2KKC A;  2LJ5 A;  4KIK A;  3ZDT A;  1WRD B;  2ZEQ A;  4DXA B;  2KFK A;  3ZUN A;  5EDS A;  2K6Q A;  2KD0 A;  2KWU B;  3M3J A;  2C7M B;  2O6V A;  3L17 A;  3DQV A;  3VUY A;  2OJR A;  3DBR I;  3A9J B;  2KVR A;  4GOC A;  2N7E A;  4GN1 A;  2HD5 B;  2DX5 B;  3L54 A;  5G2N A;  5J17 A;  3WA0 A;  2PEA A;  3NHE B;  1RAX A;  4M8M A;  2PPH A;  2V3S A;  2JZ3 B;  2KC1 A;  3QHT A;  3W1S C;  2D3G A;  1V5T A;  1ISN A;  1E8W A;  1P3Q U;  4KSL C;  4P7I A;  1BT0 A;  5DPS A;  1R4N I;  3APF A;  3BIN A;  3M62 B;  5LXH A;  3KH0 A;  4NAW A;  3RT3 B;  1GG3 A;  1UBQ A;  3DOW A;  3L0W B;  1V2Y A;  3NY5 A;  1WGD A;  5E6P A;  4F8C B;  3WIM A;  3TIX A;  3VAW A;  4MM3 A;  2KJH B;  2KWC A;  4WJO A;  4GXB A;  1RFA A;  3PS6 A;  4TUU A;  4BKT A;  4ICU A;  1YQB A;  4HLE A;  2R2Q A;  4EFO A;  3QA8 A;  5CHF A;  3PT2 B;  2FID A;  2LGD A;  2BYF A;  2FCM A;  3L08 A;  2KDE B;  3A1Q B;  4A20 A;  2BYV E;  2KO3 A;  4ANU A;  5GMV A;  2Z59 B;  1ZKH A;  1D3Z A;  2IY0 B;  3AUL A;  4RMA A;  4TQ1 A;  1J0G A;  2IO0 B;  3ZRF A;  3A9J A;  4HVB A;  2DEN B;  2DYB A;  3DCG A;  5JZE B;  1UZX B;  4F7Z A;  4FN2 A;  3A4R A;  2I1K A;  3PTF C;  3QX1 A;  1L2N A;  4WWO A;  3N32 A;  5FR6 A;  5J18 A;  4NJ6 A;  2LRU A;  2ZCC A;  2EKE C;  1Z5S B;  3H1U A;  1Q1O A;  3SU8 X;  1P9D U;  2PE6 B;  4XX5 A;  3IVF A;  2K25 A;  3CSF A;  4LCD E;  4MSQ B;  2JRI B;  3T8M A;  1WJ6 A;  3KUD B;  3UF8 A;  1UH6 A;  2BKR B;  1WXM A;  2GMI C;  4E74 A;  2L76 A;  2C60 A;  3UQB A;  4LDT B;  3VFK A;  2LWP A;  2A4Z A;  1NDD A;  3H9D A;  3QJZ A;  2XK5 B;  4W9L A;  2BYE A;  1WY8 A;  2D2Q A;  2N7D A;  3V6E B;  3UIN B;  1UEL A;  1XD3 B;  1WR1 A;  2DYM A;  1H4R A;  4MH0 E;  2WDT B;  4B9K A;  2O2V B;  1VCB A;  4TQ0 A;  2IO3 B;  3MJW A;  1X1M A;  2DZK A;  4A3O A;  1Q5W B;  1EF5 A;  4EZK A;  5J2R A;  4HXD A;  3OLM D;  4RM9 A;  1KJT A;  4W9F A;  4WQO B;  2LXA A;  3IHP C;  1EO6 A;  4WJP A;  2WX0 A;  2LZ6 A;  5G55 A;  4II2 B;  4EKU A;  4ICV A;  3PHX B;  2NBW B;  4DDG D;  1ZGU B;  4BVU C;  4FBJ B;  2KNB A;  2N1W A;  3PZD A;  4MSM B;  2NVU I;  3EEC A;  2FCN A;  1SIF A;  2J0K A;  2MBO A;  3DVG X;  1WJU A;  2KJR A;  5KHQ A;  2YVC A;  3KUZ A;  4HPM B;  3U30 A;  2UYZ B;  2CHW A;  2L00 B;  1YD8 U;  5C23 A;  1J19 A;  4EZJ A;  5AEK B;  1L7Y A;  4NNJ B;  2RD0 A;  1XQQ A;  2L3Z A;  3W1S A;  3WAO A;  4LJP B;  2UWQ A;  3HHM A;  4XC2 A;  2C7N B;  2FAZ A;  2D11 A;  4AOF A;  2XK5 A;  3RZW C;  4ANV A;  3A9K B;  2JF5 A;  2KOX A;  3R7Q A;  3ZW3 A;  3QAR A;  3ZLZ A;  2HE7 A;  4EZL A;  2LI5 A;  2DHZ A;  2NPT B;  3HIZ A;  3V61 A;  4NPN A;  2CKH B;  2JUO A;  1GC6 A;  4CO7 A;  1S3S G;  2ZZP B;  4FJY A;  1WR6 E;  2MWS B;  2N9E B;  4IWP A;  4FA6 A;  3Q3J A;  2BF8 B;  2N1V A;  2CHX A;  2M0X A;  4II3 B;  2AL3 A;  2L0F A;  1OQY A;  3A4S C;  5DCN A;  2M8S A;  5JHA A;  2ZPY A;  2NBV B;  3V6C B;  2EMS A;  3PRP B;  4DBG A;  1WZ0 A;  4ZRK A;  1JRU A;  3JSV B;  4FAD A;  2K8C A;  3ONS A;  4URK A;  4AP4 C;  1E7U A;  1LM8 B;  4DHJ D;  1F9J A;  1WX8 A;  2KWV B;  2NR2 A;  4BOZ B;  4BOS C;  2L0T A;  4GDK A;  3VHT C;  4WJQ A;  3GZN I;  4BKS A;  4ZDV A;  2XBB C;  4NQL B;  1R4M I;  2DZI A;  3KVF B;  1IPG A;  2MBB B;  4K81 A;  2GBR A;  3A33 B;  3DPD A;  4TV3 A;  4X57 B;  1OEY A;  1V5O A;  3VUW A;  5IA7 A;  1V80 A;  1TTN A;  1WXV A;  3EHV A;  4W9G A;  5DPT A;  1J8C A;  1Q0W B;  2G4S A;  2L05 A;  2IBI B;  1E5W A;  2KLG A;  1Z2M A;  2MBQ A;  1WE7 A;  3VDZ A;  4FLH A;  5D6J B;  2DAJ A;  3MTN B;  2R2O A;  3OJ4 B;  5AZG A;  4OVV A;  2LXC A;  3VUX A;  2LGX A;  2IZV B;  1WGG A;  2KQS A;  1E8Z A;  2KHW B;  2AEH A;  2IO2 B;  2LRW A;  3PRZ A;  4IM2 A;  3TJP A;  4W9C A;  2KAN A;  1WXA A;  1M94 A;  2G3Q B;  4JIO U;  1QZE A;  3D32 A;  2Z0D B;  2M4N A;  2KMA A;  3UIO B;  2RR9 A;  2L8J A;  3JSV A;  3QC8 B;  4FUL A;  4KZ0 A;  5D2M B;  5E6O A;  3H7P B;  3EC8 A;  1YX6 B;  4AJY B;  2G4D B;  2JZZ A;  4IG7 B;  3HK0 A;  2A5U A;  3AU5 A;  2K39 A;  2V1Y A;  1GJZ A;  4CYE A;  2BKF A;  1ZW7 A;  1GNU A;  2PE9 A;  4PS7 A;  4I6N B;  4HCP B;  5AZH A;  2KZR A;  5JH5 C;  1E90 A;  3QQ8 B;  2KX0 A;  2J7Q B;  2K6D B;  2I1J A;  3X0W A;  2MW5 A;  1CMX B;  1OEY J;  1UGM A;  2REX A;  2Y5B B;  2BWE S;  3APC A;  2M1M A;  4ZYN A;  1GUA B;  2QHO A;  3KW5 B;  1KOT A;  4BFR A;  3ZIM A;  2DZM A;  4IWO A;  4DK5 A;  3V62 A;  3TCA A;  4CHK A;  4GDL B;  2K8B A;  4GGQ A;  1V86 A;  2LD9 A;  3VTV A;  3BY4 B;  3I3T B;  3A1Q A;  3PV1 A;  3VVW B;  2BPS A;  4WWP A;  3TBL D;  3DVN V;  1EF1 A;  3JYU A;  2FUH B;  4HDQ A;  2JT4 B;  2MBH A;  3JW0 X;  3M63 B;  2MP2 B;  4XZ4 A;  4E71 A;  4ASW C;  2KTF A;  4RM8 A;  5L83 A;  1S1Q B;  4BBN C;  3NZU A;  4GB9 A;  5D94 A;  4MEM A;  4PS8 A;  1XT9 B;  2ZVO A;  1WF9 A;  4IC7 B;  1WGR A;  2AWT A;  4W9K A;  3APD A;  3PPA A;  3VH4 B;  4DHJ B;  4DWF A;  2EMT A;  3IG3 A;  2KX3 A;  3AXC A;  2MBE A;  4K7S A;  2KC2 A;  2V4L A;  4KSK C;  4HWI B;  2KLC A;  3KYD D;  4G50 A;  3ZO5 B;  3PRM B;  2YLM A;  1UBI A;  1WZ3 A;  5LLI A;  2MQJ A;  2GBM A;  2FCS A;  3OJ3 A;  3ZDM C;  1U4A A;  1H8C A;  2NCN A;  4KIK B;  5HKH A;  2ZNV B;  1OTR B;  1OGW A;  1K8R B;  3KUC B;  2K8H A;  4JQW C;  2VRR B;  4YL8 A;  5JHB A;  2IO1 B;  1GC7 A;  4EEW A;  2O2V A;  1E8X A;  5D7G A;  1T0Y A;  2JY6 A;  4EOY A;  1TGZ B;  1UD7 A;  3TMP B;  4B6W A;  3ZNH B;  2BWF A;  2HJ8 A;  2GBN A;  1EUV B;  2L7R A;  3ZTC A;  2W9N A;  4G11 A;  4KZC A;  4NJ7 A;  2GOW A;  1P98 A;  4JL9 A;  1P0R A;  3CF6 E;  2WYQ A;  3KYC D;  4A3P A;  4K1R B;  3NOB A;  4HJK A;  3N3K B;  3JVZ X;  1WH3 A;  5CX3 A;  2KJ6 A;  3UIP B;  3ML9 A;  1V49 A;  2MA9 B;  2KN5 A;  4KDL B;  3SHQ A;  1RRB A;  1YIW A;  5BO4 B;  1VD2 A;  5LXI B;  4WAA A;  5E6N A;  3ZTD A;  4W9J A;  1IP9 A;  1LXD A;  2RSU A;  5KHO A;  4MGY E;  2ZJD A;  1LQB A;  2AL6 A;  2ZCB A;  4W9I A;  3A9K A;  3U8Z A;  2C5L C;  2MSE D;  3AI5 A;  2FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...