1WYWB

Crystal structure of sumo1-conjugated thymine dna glycosylase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wywB00
3PGEA 3AU4A 2KX3A 3N3KB 1V6EA 4GOCA 3ZUNA 2KANA 4FBJB 2C7NB 3EC8A 2K8CA 3B08A 1IPGA 2KLGA 3B1LX 2RD0A 3VDZA 4MEMA 3CSFA 4KIKB 3RT3B 3U8ZA 2KFJA 5EDSA 3SHQA 2DYOA 3M3JA 2K1FA 2IY0B 3GOEA 1UZXB 2KO3A 4GDLB 1Z5SB 3PHWB 3QA8A 4FULA 1X1MA 3TL5A 1C3TA 2IY1B 3C0RB 2CKHB 3KVFB 3OJ4B 4GDKA 5L83A 2BKFA 2MCNB 3PVLA 1C1YB 2WDTB 3PTFC 4CYEA 4FADA 1Z2MA 2KDBA 2FNJB 2MLBA 3UIOB 3VUWA 1V86A 3PHXB 4EZJA 4DHZB 1GG3A 3R7RA 2XBBC 4PYZA 3TBLD 4W9DA 3L13A 3DBHI 1WYWB 2L00B 4G11A 4BKTA 4A3OA 1R4MI 2D3GA 2RR9A 5KHQA 2MP2A 3PV1A 2LRWA 4N9F4 1WZ3A 1E5WA 2JUOA 3K9OB 2VRRB 3ZNID 4K7WA 4MGYE 2MQJA 2J0JA 3NHEB 4GGQA 2O2VB 4MELA 1UBQA 2KQSA 3HHMA 2KTFA 3X23A 4BKSD 3QQ8B 4EKUA 2EMTA 4NJ6A 4RM8A 2JY6A 5J17A 2MBBB 1SE9A 2L7RA 2LI5A 4W9HA 4W9IA 5D94A 4E74A 4DBGA 1EO6A 2WX1A 5CHWA 1L7YA 3BINA 1WJNA 2NPTA 4DXAB 2L0FA 1WGRA 2D10A 4G3XB 4GXBA 4HCPB 1WI0A 2CHWA 2DYMA 2IO3B 2ZVOA 4RMAA 1V81A 4NQLB 2MBEA 2DZMA 1WXMA 5DPRA 4BKGA 5HKHA 3ZNGC 4FLHA 2ZPNA 2KZRA 1XQQA 3Q3JA 2CHXA 2G4DB 2ZNVB 3N32A 4AUQC 3NZUA 2V4LA 2NBUA 3PT2B 4JL9A 3ENEA 4DHZE 4FA6A 1WX9A 1OQYA 2UYZB 4XZ4A 2V3SA 3NS8A 2J0MA 2KOXA 3QIJA 4WJQA 3M63B 3CSTA 3KUCB 3ZIMA 2DENB 1LQBA 1E90A 2BYVE 1GC7A 1WGYA 5LXIB 1I35A 4E3CA 3RZFA 4FJVB 2L76A 4NPNA 3ALBA 1AARA 2M4NA 3KUDB 3PRZA 4IW0A 2M0XA 1PQSA 5E6OA 1V5OA 2RGFA 3OAWA 3H7PA 4X57B 3QC8B 1BT0A 5JHAA 4GDKB 2KN5A 4G50A 4JIOU 2ZVNA 2KJRA 5CHVC 4HXDA 2FCQA 4BKSA 1KOTA 2NCNA 4EEWA 2DX5B 1SIFA 4KZ0A 2HD5B 5DPSA 2RPQA 2C7HA 3HIZA 4URKA 1WXVA 1ZW7A 2K8HA 1V9JA 3JW0X 5C23A 3V62A 1E8YA 4M8MA 3ZDMC 4MGKE 3WA0A 1NBFC 1ZKHA 2MP2B 2BPSA 2V1YA 3V6CB 1R4NI 2IZVB 4HCNB 4HPLB 2ZPYA 4RM9A 1Q1OA 3JSVA 4JQWC 2BYEA 2KD0A 4KZCA 3QAQA 3QCAA 1RLFA 2O6VD 3L54A 4MM3A 5AZFA 3AU5A 4I6NB 1YD8U 5IAAC 1E8ZA 3R66C 2KC1A 4KVGB 4WWNA 4WJNA 2KHWB 1LFDA 4NY0A 4W9CA 3WIMA 4ANUA 4W9FA 5JH5C 1YJ1A 3IFWB 3DQVA 2YLMA 1WGHA 2DZKA 3CMMB 1E8WA 1E8XA 2WX0A 1T0YA 2IO2B 4GSWA 1GNUA 2D2QA 2NPTB 1EUVB 2G3QB 2KK8A 3DVNU 3VHTC 1E7UA 4FJZA 1P9DU 1L2NA 3RCZA 3QHTA 2OJRA 2LZ6A 3L0WB 4F1SA 1LM8B 1KLVA 4HDOA 4MDKE 2GOWA 2PJHA 2BWES 3WAOA 1WX8A 4DHJD 1WFYA 4ASWC 2KJ6A 1VCBA 4B95A 2REXA 4DHJB 4P7IA 4B9KA 1SGHA 2JZ3B 3M62B 2GBMA 2N7DA 1Q0WB 5AEKB 1J0GA 4WQOB 4K7SA 2JRHA 5CTRC 2C60A 2LD9A 3BY4B 2MA9B 3QJZA 2MW5A 2BF8B 2CU1A 4WJPA 2FCMA 1WGDA 2R2OA 1TTNA 1V49A 2KTRB 4K7UA 4IM2A 1RFAA 3PLVA 4BOZB 2G4SA 3T9LA 1UGMA 3OLMD 3QK0A 5E6NA 5TR5A 1WJ6A 3OJ3A 4HK2A 4ZDVA 4A3PA 3H7PB 2I1JA 5AZHA 3V6EB 4WAAA 1ZGUB 2O6VA 1V5TA 3ZRCA 3LJ3A 3H1UA 3DOWA 3DVNV 2EMSA 4YL8A 3UINB 3DCGA 5DCNA 2C9WB 1V2YA 2K25A 2N9EB 5D2MB 2FAZA 2KFKB 1FXTB 2LVPA 3A9JA 3QARA 2NS5A 3ZTDA 2PE6B 4IM0A 4FJYA 3MHSD 3U30A 2LASA 2MRPA 3PPAA 2LGYA 1U4AA 1WMHA 2GBNA 4ZRIA 4FHJA 3VQIA 5KHOA 4ANVA 5GMVA 2EKEC 5G55A 3R3MA 2I1KA 3JSVB 3D32A 3QWZB 4NAWA 1WXAA 4IWPA 1UH6A 1WX7A 1WY8A 3TIXA 4A20A 5C1ZA 2MBQA 2N1VA 2CR5A 2GBKA 4OVUA 2JXXA 2MWSB 4I6PA 5JHBA 1WIAA 2LJ5A 4EFOA 1IP9A 3RD2A 2XK5A 4BBNF 1A5RA 1YX6B 5J18A 3PREA 1WH3A 2KWCA 2ZCCA 5BO4B 3VH4B 3ZO5B 2LVQA 1P98A 2FCSA 4MGIE 2NBWB 2Y5BB 3JYUA 2K8BA 3N30A 2K39A 3P2BA 4LCDE 3SD5A 3ECIA 2OOBB 2MBOA 3APCA 4GN1A 4W9GA 1K8RB 2ZCBA 3TJPA 2KTRA 2KDIA 1WJUA 3W1YA 5AZGA 4EOYA 4MJSA 2QHOA 3VH3B 2D11A 2DAJA 2AL3A 2A4ZA 2C7MB 4W9JA 2N4FA 1M94A 3VUXA 1GC6A 4CO7A 4TV3A 2IBIB 3PRPB 2PEAA 4MSQB 4W9EA 1OTRB 1NI2A 4NJ7A 1J8CA 2FIDA 2KMAA 3EFUA 3WALA 2KFKA 3RULA 3RYTA 3W1SA 3VXWA 3DDCB 2FCNA 3JVZX 5DPTA 2JT4B 3IVFA 2A5UA 5J2RA 4PYUA 4AP4C 4J6IA 3S2AA 4IG7B 4GMVA 2LRUA 4KV2A 3ZW3A 3DVGY 3UGBB 5JZEB 1I42A 2JPHA 2AYOB 3DVGX 2JWZA 2KLCA 1G6JA 3KYCD 3SU8X 2C5LC 1EF1A 3QX1A 3ZTCA 2PPHA 4M0WB 4OVVA 2O6VB 4PS8A 3PLUA 3SDLC 4DK5A 4EUTA 1P0RA 3ONSA 3UQAA 5G2NA 1LXDA 2IO0B 2KC2A 2KXJA 2MX2A 2DZIA 2ZNVC 4WWPA 3VFKA 2DZJA 3PZDA 1WRDB 2CHZA 2JF5A 3A9JB 2KMCA 3HK0A 1CMXB 2D07B 3V60A 4KDLB 2J7QB 4BFRA 4PS3A 1WJ4A 1WMHB 2YVCA 3VAWA 3L17A 3B0AA 1KJTA 1V80A 4IWOA 4BOSC 3M95A 1QZEA 2JZZA 4NAWB 4B6WA 3ML8A 1RRBA 3IBEA 2UWQA 5IA7A 2XEWA 3AXCA 3APFA 4JLCA 3R7QA 2XK5B 4LJPB 3ZNZB 2NR2A 1P3QU 2PE9A 4LJOB 1Y8RC 1S1QB 3Q3FA 3WAMA 4W9KA 1WXSA 2ZZPB 4TQ1A 3L16A 2LGDA 2HTHA 1IYFA 2N7EA 3GZNI 4FHKA 4MJSB 1D3ZA 2WWZA 1MG8A 2HJ8A 4AOFA 3A1QA 4WJOA 1WM3A 1P1AA 4ICUA 1WR6E 1GUAB 3TMPB 3UF8A 2GBRA 2KVRA 2KJHB 3K9PB 1XT9B 3AI5A 4DWFA 3PSEB 4JGHB 4HVBA 1UELA 1Q5WB 2KNBA 2Z0EB 4TQ0A 2J0KA 3EHVA 3VTWA 2IYDB 1WE6A 3NZSA 2NBVB 4ICVA 1OEYA 1UD7A 3APDA 4IM3A 1YIWA 4W9LA 3WAPA 1OGWA 3ZNHB 5LXHA 4F7ZA 3VTVA 1KM7A 3WANA 1WZ0A 2WYQA 4FN2A 2KKCA 1RAXA 4EZLA 3UQBA 4E71A 1WR1A 3A33B 3NY5A 2B3AA 2N1WA 2DHZA 3MTNB 3I3TB 1WGGA 4KSKC 2ZJDA 2HE7A 2KDEB 2K6QA 2AL6A 3EECA 3IHPC 1EF5A 4GIVA 3X0WA 4HJKA 4HLEA 4GB9A 2L8JA 5CX3A 5D7GA 4KIKA 1WM2A 4HWIB 3T8MA 2ZEQA 5CHFA 3A9KB 4G0NB 4WWOA 2R2QA 4GDLA 5E6PA 4K81A 1YQBA 4F8CB 2W9NA 2KWUB 2LXCA 5D6JB 1ISNA 4IC7B 5L95C 4BBNC 4DDID 4IUMB 2KQ7A 2LXAA 3ZVVA 4IWQA 4PS7A 3H9DA 2L0TA 1UBIA 3HM3A 4HPMB 4CHKA 1OEYJ 2G45B 2CS4A 1NDDA 2RSUA 3ZDTA 4DDGD 2KWVB 4TUUA 1YX5B 4EZKA 3CF6E 2GBJA 2BYFA 3KH0A 4TKNA 4XC2A 3ZLZA 3H6NA 4II2B 2AEHA 2Z59B 3A4SC 4NNJB 3ZKJC 4KSLC 1WE7A 3AULA 2LUEA 2K6DB 2FIFA 3L10B 5DPWA 4ZRKA 3MJWA 1F9JA 2AWTA 2L3ZA 3LDZE 2LWPA 3VUYA 3H7SA 3W1SC 3IG3A 4AJWA 4MGZE 2O2VA 2IO1B 3KYDD 3L08A 4MH0E 2DAFA 1GJZA 4AJYB 3A1QB 1HE8A 1WF9A 2NVUI 3DBRI 3U7DA 3UIPB 3ZRFA 4K1RB 1TBEA 2Z0DB 3DBLI 3RUIB 3VTUA 2N9XA 4BVUC 1E7VA 3VVWB 2BGFA 4M8NA 4II3B 2M17A 1TZ1A 3PS6A 3TCAA 3KUZA 4GU2A 2FUHB 2KDFB 4MSMB 3NOBA 1VD2A 4ANWA 1H8CA 3ML9A 2JVCA 4NQKE 4AWJA 2DYBA 2M1MA 2L05A 3A9KA 2MSED 1S3SG 4LDTD 1XD3B 2N9PC 1H4RA 2ASQA 1TGZB 2JRIB 3A4RA 4XX5A 4HDQA 4LDTB 3PRMB 4ANXA 2BWFA 2MBHA 4ZRJA 5FR6A 3RZWC 2GMIC 3DPDA 2LGXA 2LVOA 5LLIA 3HM6X 3O65B 4ZYNA 4I6LB 1J19A 2KX0A 2M8SA 1JRUA 3DBSA 3KW5B 3V61A 4KDIC 2BKRB
chains in the Genus database with same CATH superfamily
3PGEA 3AU4A 1V6EA 1KRHA 4FBJB 2KLGA 4MEMA 1DGJA 1FCLA 3RT3B 3U8ZA 3SHQA 4LLGM 2K1FA 2IY0B 4J3OD 1X1MA 4KGRA 3KVFB 2CKHB 1J7CA 1N5WA 4XE0A 2BKFA 2HDEA 1C1YB 2WDTB 3PTFC 4CYEA 1Z2MA 2MLBA 3PHXB 3T3OA 2XBBC 4PYZA 3TBLD 2BT6A 3DBHI 2L00B 4KGTA 1GPXA 1R4MI 2D3GA 2RR9A 3IAM1 3PV1A 4N9F4 4ARIA 1E5WA 4N6EB 2JUOA 3K9OB 4K7WA 1PDXA 2MQJA 3SFDB 2J0JA 3NHEB 4GGQA 4LNIA 4MELA 1UBQA 5EE3A 3U2SC 5E6JA 1SE9A 2FUG1 2LI5A 3AECB 2WX1A 4KKJA 1L7YA 3Q8CA 1WJNA 1ROEA 2NPTA 2DNFA 1IGDA 3E56A 3E9SA 2CHWA 2IO3B 2ZVOA 2MBEA 1RWSA 3ZNGC 1XQQA 4REZA 2G4DB 2INDC 1GB4A 3ENEA 4DHZE 4FA6A 2V3SA 3QIJA 1NEKB 1OFFA 3M63B 3KUCB 2QMTA 2BYVE 5LXIB 2IGDA 1ESFA 4E3CA 1QOFA 3RZFA 3P42A 1EU4A 3KUDB 3OAWA 2WXOA 3DBLB 2MEKA 4G50A 3W9CB 2KJRA 5CHVC 3ZXVA 4HXDA 4BKSA 1C4CA 2DX5B 2KT7A 4XWTA 1WXVA 2N0SB 3BK2A 5EE1A 5C23A 3ZDMC 3WA0A 1ZKHA 3TUOA 1M4VA 3TEWA 2KD0A 3QCAA 1SXTA 1RLFA 3R66C 4WWNA 1SEBD 2QSDA 4WJNA 2KHWB 3U52E 3DQVA 3AE9B 1WGHA 2WX0A 1T0YA 3RNFC 2NPTB 1EUVB 2KK8A 3VHTC 1V1OA 4FJZA 3GZNB 3QHTA 5BYRA 4HDOA 4MDKE 4PK1A 1C4AA 2D3CA 4B95A 3Q8EA 4B9KA 3M62B 2N7DA 1XF5L 3ZGZA 5CTRC 4C80A 3I9V1 2INNE 3Q8AA 1RFAA 1T0SC 4P1BC 3NUHB 3OJ3A 4HK2A 3L4PA 5AZHA 3BVMA 1KLUD 2PKOA 3H1UA 3DOWA 4YL8A 2K25A 1KLGD 2FAZA 3A9JA 3QARA 2MRPA 4ZRIA 2GBNA 1FNWA 5KHOA 1N63A 2EKEC 1FM0D 3D32A 1VJKA 3QWZB 5C1ZA 3URYA 1VZ7A 2KYWA 2LJ5A 1L6UA 1YX6B 5HI1A 1TZOA 2LVQA 1P98A 2FCSA 3P2BA 2K39A 1TKEA 2OOBB 1K8RB 4BAXA 2ZCBA 1XLQA 4EOYA 2QHOA 3Q69A 1EWYC 2R61A 2C7MB 1IBXA 3EA6A 1JWSD 3DBRB 3VUXA 1GC6A 4TV3A 1AW7A 2PEAA 4K3CA 4NJ7A 3EFUA 3WALA 2WXIA 2KFKA 1R4NB 2JT4B 3Q3NC 4PT5A 2LRUA 3DVGY 2AYOB 2BS2B 1KFYB 2JWZA 2KLCA 4CQNA 3AEBB 2PPHA 1ZDVA 5G5HA 3ZXRA 1JROA 4P1CC 3PLUA 3NVVA 1XEEA 2IO0B 2KC2A 1VDVA 4A8XC 3RFZB 1VZ8A 1WRDB 2CHZA 2JF5A 3A9JB 1T0RC 4OZCA 1CMXB 2D07B 2LGIA 2LHDA 1ET9A 2J7QB 1JCKB 2GI9A 3VAWA 3L17A 4ZOHC 1KH0A 3ML8A 1RRBA 2UWQA 1QLBB 2D3AA 3APFA 3AE6B 1ENFA 1FNUA 1SE3A 3ZNZB 1TKYA 1E6EB 1JRPA 2KMMA 1FXAA 3WAMA 2ZZPB 1TYGB 1TT5B 2G9HD 2H89B 1TS4A 1D3ZA 1QOGA 1IBXB 2HJ8A 4D2KA 3A1QA 3SFEB 1FCCC 1WM3A 1P1AA 1GUAB 3TMPB 2GBRA 5AUIA 2KJHB 3AI5A 4HVBA 1Q5WB 1K51A 1WE6A 2QILA 1UWXA 2JYTA 1YIWA 3RI7C 4W9LA 3WAPA 1MG4A 2AQ3B 3VTVA 1WZ0A 3UQBA 2KKCA 2WXNA 2HTME 2MJDA 3NY5A 2B3AA 2DHZA 1WGGA 5IOIA 2KDEB 3X0WA 1EF5A 1D6EC 4HJKA 2L8JA 4KIKA 1WM2A 4YSXB 2WXGA 2ZEQA 5H92C 4C7YA 1C78A 5E6PA 4ZYSA 4K81A 4F8CB 2KWUB 1VLBA 3CWIA 4WH4A 1UWMA 1T3QA 4FXCA 3AEEB 4IWQA 1GOZA 3U7ZA 3HM3A 4CHKA 4KGSA 4MH8A 2KWVB 1YX5B 3CF6E 2BYFA 4XC2A 3W5VB 2AEHA 4NNJB 1V1PB 2N9LA 1WE7A 3AULA 3L10B 2OHFA 1SF0A 4ZRKA 2N7JA 3W1SC 4AJWA 1ACCA 4OW0A 1E7PB 1HZ5A 3A1QB 3R2IA 1E9MA 1TBEA 1NYQA 3RUIB 2BYTA 4TMAB 2BGFA 2M17A 4QAYA 4MSMB 2KDFB 3ML9A 1TS5A 1UF0A 3WCQA 3A9KA 1S3SG 1H4RA 2ASQA 4HDQA 3FKYA 2BWFA 1ZXHA 5FR6A 2MH7A 3RZWC 2GMIC 1D4BA 4ZYNA 4I6LB 1J19A 1JRUA 4KDIC 3NVWA 2BKRB 1T6BX 2VH1A 2KANA 2JXTA 3ZUNA 2QC8A 3B1LX 1IPGA 4KIKB 3FC4A 4NAMA 5EDSA 2DYOA 3M3JA 1UZXB 2VZKD 3AE4B 1UUPA 1Z5SB 2VZKB 1C3TA 3C0RB 4HKQA 1D5MC 3PVLA 3GE3C 2FNJB 3UIOB 2QIEB 4DHZB 1I4RA 3VR8B 2E3TA 4W9DA 4G11A 4LNKA 1WZ3A 3AE5B 4HKZE 1TS2A 1L0VB 3BYYB 3NS1A 2KN4A 4A9AA 2JY6A 2MBBB 5BMGA 2L7RA 2CJOA 4W9IA 5D94A 2WXPA 4DBGA 2WXFA 4DXAB 2L0FA 4GXBA 4RMAA 4MT5A 1V81A 2DZMA 1WXMA 5DPRA 2AQ2B 4BKGA 5HKHA 2LHEA 3Q3OC 2LJIA 3N32A 3AEFB 3PT2B 4JL9A 1WX9A 3NS8A 2KOXA 3GP7A 4HJGE 3CSTA 1E90A 1WGYA 4YSZB 1I35A 2JX5A 1AARA 2M4NA 3TEXA 1PQSA 3P4RB 3SR6A 4JIOU 4YTMB 1KOTA 1YOVB 1J7BA 3LXFA 2HD5B 4URKA 3V62A 1V9JA 1NBFC 1JWAD 4RM9A 3JSVA 1YMHE 3AE3B 2O6VD 1JWUD 3L54A 2JYEA 3AU5A 5IAAC 4KVGB 2G1EA 2W3SA 1T0QC 4NY0A 4W9CA 3WIMA 1IUEA 1C76A 3KQ4A 1ZP0B 1L0XB 1FXIA 2DZKA 3CMMB 4L1BA 4XWWA 4JX1C 4LTUA 1T5XD 4RFBA 3RCZA 2OJRA 1LM8B 1IGCA 2GOWA 2PJHA 2WHIA 4ASWC 2BS4B 2REXA 5H8YE 2RDGA 3DBHB 2LD9A 3BY4B 2W82A 3RN9C 1P7EA 1WSPA 1TTNA 1STEA 1FRDA 3T9LA 5E6NA 5TR5A 1I4HA 1WJ6A 2SAKA 4ZDVA 1I4GA 4XGAB 2EMSA 1V2YA 4KX6B 1LGRA 1YJIA 2LVPA 2NS5A 3ZTDA 4IM0A 2LASA 2GB1A 4JPSA 1U4AA 1WMHA 1YJJA 2BB6A 5G55A 2I1KA 3JSVB 3MP9A 4Q2JA 4NAWA 4A20A 1UH6A 1WY8A 4WAFA 1L4ZB 5IN7A 2CR5A 4AS1A 5HG2A 3RNCC 4OVUA 1DYQA 2MWSB 2RMMA 1WIAA 1IP9A 4A6QA 3Q3MC 3RD2A 4BBNF 1A5RA 3NJTA 1L5PA 4MGIE 4XDDA 3JYUA 2BQQA 2LGSA 3TJPA 2GLSA 2KDIA 3FILA 2AL3A 2A4ZA 3ABVB 1M94A 5C3JB 2IBIB 2L52A 3GB1A 4MSQB 3TEZA 4R3DA 1NI2A 3ZQ4A 1YN3A 2KMAA 3GS2A 3W1SA 3VXWA 3R8BA 3DDCB 3JVZX 5J2RA 4A90A 4AP4C 1N5XA 4GMVA 5JZEB 4HEA1 2JPHA 1G6JA 2C5LC 2D3BA 3ZTCA 3I57A 4OVVA 1SIJA 5IP4D 3SDLC 1P0RA 4HROA 1LXDA 1VZ6A 2KXJA 2DZIA 4WQMA 3PZDA 1J7AA 4C4VB 3HK0A 3V60A 4KDLB 4WWMA 1WMHB 2YVCA 2WXHA 3W2DA 1WXQA 1XXGA 4IWOA 3N1YC 4NAWB 1F2RI 1BUIC 3AXCA 2OEDA 4JLCA 5D3IB 2PE9A 1Y8RC 1F0ZA 1VR9A 1SJED 2Z8LA 4W9KA 2GRIA 1FO4A 3MFGA 2HTHA 1IYFA 2N7EA 3GZNI 1Y56A 3NG0A 3FILB 2WWZA 1MG8A 4ICUA 4BZAA 3IXSA 3KWLA 3PSEB 2ICIA 4DXGA 4TQ0A 1F1HA 3HRDD 2NBVB 2RPVA 4IM3A 4YTPB 1OGWA 2FBWB 3I5JC 3ZNHB 5BMIA 4FN2A 3EUB2 3A33B 5AUKA 3MTNB 4KSKC 2LFIA 5GXGB 3EECA 3IHPC 1NYRA 3RNEC 4IDIA 1L6VA 2QJLA 1AYFA 3OG5A 1VRAB 1YQBA 4M02A 5D6JB 3CIRB 4BBNC 4DDID 1C77A 3ZVVA 2L0TA 1FEHA 4HPMB 2CS4A 2RSUA 1UGJA 2TSSA 2GBJA 4TKNA 2I2YA 3H6NA 2Z59B 2WLBA 5DPWA 3MJWA 1F9JA 2AWTA 3AM9A 4AQ7A 4L23A 2PIAA 2IO1B 2DAFA 2N9KA 4AJYB 2NVUI 3DBRI 3AE2B 1MPEA 1FFUA 3UIPB 4LK0M 4K1RB 3VR9B 3VTUA 2WNMA 2N9XA 4BVUC 1TZ1A 3PS6A 2FUHB 3NOBA 1VD2A 1H8CA 2NTSA 1XLPA 3VRBB 1UNSA 1NVID 2BTEA 3PRMB 3B2GA 2J42A 2LVOA 3HM6X 2PTLA 3KW5B 2M56B 2ON8A 3MC8A 1YQ4B 2KX3A 2IDYA 3EC8A 2K8CA 2DLBA 3B08A 1V1PA 2PVGC 3VDZA 4RH6A 3J9CA 3BYTB 5D3DA 4P6VF 2BB5A 2KFJA 2KO3A 3PHWB 2L1AA 4FULA 3AV8A 3ETRA 3TL5A 3OJ4B 4GDKA 3BZDB 4YWGG 5L83A 2JWUA 5I4DA 2M0AA 1CK1A 3VUWA 4O1NA 4EZJA 3R7RA 3IT4B 3L13A 4A3OA 2LRWA 3RMKC 4MGYE 2KQSA 3O13A 3QQ8B 4EKUA 4NJ6A 4RM8A 4MACA 5J17A 2B76B 3MJ5A 1F52A 4W9HA 2WDVB 1TKGA 1EO6A 3BINA 1WGRA 2D10A 3MHZA 4G3XB 4HCPB 4L2YA 3BVZA 1WI0A 3NRZA 2DYMA 3DWGC 1HZ6A 1C4PA 1QOBA 3HVDA 2ZPNA 2KZRA 4MM3B 2CHXA 1YQ3B 3LYYA 4WURA 4C7ZA 1QF6A 1OQYA 4JWUC 1QT9A 4WJQA 3Q8FA 2DENB 1LQBA 1GC7A 2QCZA 4NPNA 3ALBA 4IW0A 2M0XA 5E6OA 1E0ZA 1V5OA 2RGFA 1SJHD 3QC8B 1B9RA 5JHAA 4GDKB 1QKZA 1V97A 2KDMA 2FCQA 2KVZA 1PYWD 2NCNA 4EEWA 1OQRA 1HTOA 5FR3A 3P1MA 2C7HA 1ZW7A 3JW0X 2ONQA 1AN8A 2L83A 4MGKE 2BPSA 2V1YA 3V6CB 4HCNB 1RM6C 4HPLB 1CJEA 2BYEA 2RDHA 4KZCA 2M19A 1TY2A 1YD8U 1K50A 1LFDA 5LNK1 1YJ1A 2NMQA 3IFWB 3Q8BA 1E10A 1D5XC 4RF1A 5T8IA 1E8WA 1QQRA 2IO2B 2D2QA 4IKGA 3T3NA 3ZJUA 2G3QB 1JQ4A 1E7UA 1P9DU 2V3NA 1L2NA 1EM7A 3R2TA 4C56C 2BWES 2WQYB 4DHJD 2KJ6A 1VCBA 2WXJA 1ET6A 4DHJB 1SGHA 2JZ3B 1OQQA 5AEKB 3MC9A 4K7SA 2C60A 3V05A 2MW5A 2CU1A 4WJPA 2FCMA 1WGDA 2R2OA 1DOXA 1V49A 3SEBA 1MI0A 2KTRB 4K7UA 4IM2A 1D5ZC 3PLVA 2G4SA 3QK0A 2W3RA 3PZ7A 4M0WA 2I1JA 2Y3AA 4LNOA 3DWMA 3V6EB 4WAAA 1ZGUB 2O6VA 1V5TA 3ZJVA 3LJ3A 1AWDA 2Y5PA 3DVNV 3UINB 3DCGA 2C9WB 2N9EB 1FFVA 2RDBC 1FXTB 1XO3A 2PE6B 3MHSD 2V0GA 3PPAA 2LGYA 3VQIA 1ZPSA 4ANVA 5GMVA 3TIXA 2MBQA 2N1VA 3DHIC 2GBKA 4OZBA 1LO5D 4I6PA 5JHBA 3BK1A 4RGMA 2XK5A 5J18A 3P4SB 2KWCA 3RNBC 5BO4B 2NBWB 2MBOA 3APCA 4GN1A 3Q14C 4W9GA 1TS3A 4US8A 1I4PA 5C2TB 1WJUA 4ITKA 3VH3B 2D11A 4DQOC 4W9JA 1GB1A 4CO7A 3BVGA 4KKIA 3PRPB 4W9EA 1OTRB 3P63A 4XYCA 2EKIA 2IJ0A 3RULA 4JWSC 2FCNA 5DPTA 2A5UA 4PYUA 4HRSA 4IG7B 1I42A 3KYCD 3SU8X 1EF1A 2JZPA 4M0WB 1B1ZA 3N1ZC 2O6VB 4PS8A 3UI3A 4B0EA 4DK5A 4EUTA 5G2NA 2V9HA 1EWCA 2DZJA 4UDUC 2KMCA 1XCQL 4BFRA 1WJ4A 1XLOA 3B0AA 1I4XA 4OHJA 2IGGA 4B6WA 4EE2A 3N9YC 5IA7A 1BXTA 1GAQB 2XK5B 2WS3B 3AB5A 1R4MB 1PGBA 4HPPA 1HA5A 1WXSA 2UU7A 3L16A 3MC0B 4P16A 4RCOA 1QOAA 4FHKA 3P4PB 1SB3C 4WJOA 3AN1A 1FIQA 2L32A 4DXFA 3K9PB 4DWFA 1UELA 2KNBA 2Z0EB 4S0RA 3EHVA 3VTWA 4C4VA 5MPOA 2V4IB 3NZSA 1UD7A 3APDA 3FAHA 1RYJA 1MVKA 1MHXA 2WDQB 3WANA 2WYQA 1RAXA 1K52A 4E71A 1WR1A 1A70A 2HE7A 3NZ3A 2QDFA 4GB9A 4HWIB 3T8MA 2K3UA 4G0NB 4WWOA 3AE8B 3KLSX 4GDLA 5JXVA 4YSYB 2W9NA 2LXCA 1HXYD 1ISNA 5L95C 1XCTL 2KQ7A 2X38A 3H9DA 2WDRB 2G45B 1BMLC 2V3PA 3ZDTA 1PUTA 1ZXIA 4TUUA 1FNVA 4II2B 4B0MA 2Y5CA 1L0YB 5FKAC 1MJDA 3VUYA 3LDZE 3H7SA 3IG3A 4MGZE 2O2VA 3KYDD 1FRRA 3HVZA 2Z0DB 3DBLI 4OVZA 1E7VA 3VVWB 3GE8C 4M8NA 4II3B 3TCAA 1QILA 3KUZA 4RGTA 1TY0A 1DOIA 1ZUD2 2DYBA 2M1MA 2L05A 1XD3B 3A4RA 1SE2A 4XX5A 4IOIE 4ZRJA 1ZDXA 3DPDA 2HJ1A 5LLIA 3O65B 3N20C 1K53A 3V61A 1F77A 3Q2AC 3N3KB 2K22A 4GOCA 2C7NB 2RD0A 3CSFA 2IPKD 3GOEA 4GDLB 1KTKA 2CU3A 2E6XA 2VH2A 3QA8A 2WP9B 2IY1B 2ACZB 2QEJC 3AEDB 4RNAA 2MCNB 2LEKA 2Q5WD 4FADA 2KDBA 1TIFA 1V86A 1GG3A 1P7FA 4BKTA 1WYWB 1WRIA 5KHQA 2MP2A 2VRRB 3ZNID 4M00A 2O2VB 1L4DB 3HHMA 2KTFA 3X23A 4BKSD 1HQRD 1WYGA 3RPFC 2EMTA 2X8XX 2BW2A 2JU6X 3AE7B 1PGAA 3W5UB 4E74A 5CHWA 5IKCM 2XN9C 4WIPA 4NQLB 4FLHA 2IGHA 3Q3JA 2ZNVB 4AUQC 3NZUA 2WXLA 2PW9A 5EE9A 2V4LA 2NBUA 3PZ8A 2J4XA 1JALA 2UYZB 4XZ4A 2J0MA 2OJWA 4RF0A 3ZIMA 4H2AA 3AE1B 4FJVB 2L76A 3PRZA 3AH7A 1MHHE 3ZJTA 4X57B 3H7PA 2K5PA 1BT0A 1YN4A 2KN5A 4ZHOA 5BYQA 2ZVNA 1JWBD 1FPYA 3EGRA 3H8HA 2SEBD 2K0PA 1SIFA 4KZ0A 5DPSA 2RPQA 3HIZA 1WGKA 2K8HA 1E8YA 4M8MA 4ZHPA 4YT0B 2MP2B 3NVYA 1R4NI 2IZVB 2ZPYA 1Q1OA 2K9XA 4JQWC 3QAQA 4K3BA 1I7HA 1RFKA 4MM3A 5AZFA 1KF6B 4I6NB 1E8ZA 2KC1A 1DOYA 1N62A 4ANUA 4W9FA 5JH5C 2JQRB 2YLMA 1E8XA 3LB8C 4GSWA 1GNUA 5HFYA 3EFCA 2AX5A 4USAA 3DVNU 1HTQA 4N58A 2INPE 1KLVA 2LZ6A 3L0WB 4F1SA 3AEAB 1NI3A 2LMCA 4ZRQA 3WAOA 1WX8A 1WFYA 4TSSA 1CQVA 4P7IA 3ZYYX 2GBMA 4YXDB 4ARCA 1Q0WB 3DHHC 3V3XA 1J0GA 4WQOB 2JRHA 2BVCA 2MA9B 3QJZA 3IAS1 2BF8B 2YEPB 3HUIA 3N1XC 1C79A 4BOZB 3U4EG 1UGMA 3OLMD 3B2FA 4ZRPA 4A3PA 3H7PB 3AMZA 2WU5B 3ZRCA 1F2RC 1N60A 5IO9A 2LUMA 5DCNA 3OWEB 5D2MB 2KFKB 5EE0A 1WWTA 4FJYA 3U30A 4FHJA 3IT6B 1PFDA 3RNGC 3R3MA 4US9A 1WXAA 4IWPA 1WX7A 2I38A 4OZAA 2J52A 4A55A 2JXXA 2YEPF 4EFOA 2W54A 2PLPA 2FE8A 2MJEA 3PREA 3Q6BA 1WH3A 2ZCCA 1FMAD 3VH4B 3ZO5B 3N30A 2Y5BB 2BS3B 2K8BA 4LCDE 3SD5A 3ECIA 2KTRA 1SSNA 3W1YA 5AZGA 4MJSA 2DAJA 4YTNB 1JMLA 3RNAC 5G5GA 3TEYA 2N4FA 2NTTA 1YN5A 1Q10A 1ZOYB 2ZW1A 1J8CA 2FIDA 2JSVX 2WU2B 3RYTA 2J53A 1V8CA 1HEZE 3IVFA 2WXKA 5HHDG 4LNFA 4J6IA 3S2AA 4KV2A 3ZW3A 3UGBB 1TJEA 3DVGX 3QX1A 2KAJA 2PVOD 3BWUD 4C00A 4S17A 3UQAA 3ONSA 4XDCA 2MX2A 1NENB 2ZNVC 3VRAB 3VFKA 4WWPA 1JWMD 2EELA 2D5GA 2DBYA 4M01A 1C9FA 4PS3A 1CZPA 1R7SA 1KJTA 1V80A 4BOSC 3C8YA 3M95A 1QZEA 1MFWA 2JZZA 2XNAC 3C19A 3IBEA 1PGXA 3I63C 2XEWA 4LNNA 2WXRA 3R7QA 4LJPB 2NR2A 1P3QU 4LJOB 3PO0A 1S1QB 3Q3FA 4TQ1A 2LGDA 4MJSB 4AOFA 4RGOS 3NVZA 1WR6E 3UF8A 5BYSA 1XLNA 2KVRA 1XT9B 2KACA 5FK9C 3P4QB 4JGHB 3AEGB 2W55A 2J0KA 2IYDB 4JE3B 4GLSC 1SBBB 4ICVA 4N59A 1OEYA 1EU3A 5LXHA 2CJNA 3TSSA 4F7ZA 1KM7A 1I4QA 4EZLA 2N1WA 3I3TB 2ZJDA 4RGNA 2K6QA 2AL6A 2DWQA 4GIVA 4HLEA 2KQ4X 5CX3A 5D7GA 5CHFA 3A9KB 2R2QA 1FD6A 2PMVA 1JW9D 5TSSA 4IC7B 4IUMB 2LXAA 4PS7A 1UBIA 1OEYJ 1NDDA 4DDGD 2H88B 4EZKA 3KH0A 3ZLZA 2WXMA 3A4SC 5BMHA 3ZKJC 4KSLC 2AQ1B 2BBCA 2LUEA 2MHJA 2K6DB 2FIFA 1SE4A 2L3ZA 2LWPA 1N6ZA 2MJ3A 3L08A 4MH0E 1GJZA 1HE8A 1WF9A 3U7DA 3ZRFA 2WGSA 2KWDA 3DHGC 3B9JA 4ACFA 4NZLB 4GU2A 1N61A 3BIID 4ANWA 1ZE3D 3KWVA 1YNTE 2JVCA 4NQKE 4AWJA 2MSED 2WXQA 4LDTD 2N9PC 2JRIB 1TGZB 4LDTB 4ANXA 2MBHA 2ZW0A 2LGXA 4NJCA 2INCC 2KX0A 2M8SA 3DBSA
chains in the Genus database with same CATH topology
3PGEA 3AU4A 2KX3A 3N3KB 1V6EA 4GOCA 3ZUNA 2KANA 4FBJB 2C7NB 3EC8A 2K8CA 3B08A 1IPGA 2KLGA 3B1LX 2RD0A 3VDZA 4MEMA 3CSFA 4KIKB 3RT3B 3U8ZA 2KFJA 5EDSA 3SHQA 2DYOA 3M3JA 2K1FA 2IY0B 3GOEA 1UZXB 2KO3A 4GDLB 1Z5SB 3PHWB 3QA8A 4FULA 1X1MA 3TL5A 1C3TA 2IY1B 3C0RB 2CKHB 3KVFB 3OJ4B 4GDKA 5L83A 2BKFA 2MCNB 3PVLA 1C1YB 2WDTB 3PTFC 4CYEA 4FADA 1Z2MA 2KDBA 2FNJB 2MLBA 3UIOB 3VUWA 1V86A 3PHXB 4EZJA 4DHZB 1GG3A 3R7RA 2XBBC 4PYZA 3TBLD 4W9DA 3L13A 3DBHI 1WYWB 2L00B 4G11A 4BKTA 4A3OA 1R4MI 2D3GA 2RR9A 5KHQA 2MP2A 3PV1A 2LRWA 4N9F4 1WZ3A 1E5WA 2JUOA 3K9OB 2VRRB 3ZNID 4K7WA 4MGYE 2MQJA 2J0JA 3NHEB 4GGQA 2O2VB 4MELA 1UBQA 2KQSA 3HHMA 2KTFA 3X23A 4BKSD 3QQ8B 4EKUA 2EMTA 4NJ6A 4RM8A 2JY6A 5J17A 2MBBB 1SE9A 2L7RA 2LI5A 4W9HA 4W9IA 5D94A 4E74A 4DBGA 1EO6A 2WX1A 5CHWA 1L7YA 3BINA 1WJNA 2NPTA 4DXAB 2L0FA 1WGRA 2D10A 4G3XB 4GXBA 4HCPB 1WI0A 2CHWA 2DYMA 2IO3B 2ZVOA 4RMAA 1V81A 4NQLB 2MBEA 2DZMA 1WXMA 5DPRA 4BKGA 5HKHA 3ZNGC 4FLHA 2ZPNA 2KZRA 1XQQA 3Q3JA 2CHXA 2G4DB 2ZNVB 3N32A 4AUQC 3NZUA 2V4LA 2NBUA 3PT2B 4JL9A 3ENEA 4DHZE 4FA6A 1WX9A 1OQYA 2UYZB 4XZ4A 2V3SA 3NS8A 2J0MA 2KOXA 3QIJA 4WJQA 3M63B 3CSTA 3KUCB 3ZIMA 2DENB 1LQBA 1E90A 2BYVE 1GC7A 1WGYA 5LXIB 1I35A 4E3CA 3RZFA 4FJVB 2L76A 4NPNA 3ALBA 1AARA 2M4NA 3KUDB 3PRZA 4IW0A 2M0XA 1PQSA 5E6OA 1V5OA 2RGFA 3OAWA 3H7PA 4X57B 3QC8B 1BT0A 5JHAA 4GDKB 2KN5A 4G50A 4JIOU 2ZVNA 2KJRA 5CHVC 4HXDA 2FCQA 4BKSA 1KOTA 2NCNA 4EEWA 2DX5B 1SIFA 4KZ0A 2HD5B 5DPSA 2RPQA 2C7HA 3HIZA 4URKA 1WXVA 1ZW7A 2K8HA 1V9JA 3JW0X 5C23A 3V62A 1E8YA 4M8MA 3ZDMC 4MGKE 3WA0A 1NBFC 1ZKHA 2MP2B 2BPSA 2V1YA 3V6CB 1R4NI 2IZVB 4HCNB 4HPLB 2ZPYA 4RM9A 1Q1OA 3JSVA 4JQWC 2BYEA 2KD0A 4KZCA 3QAQA 3QCAA 1RLFA 2O6VD 3L54A 4MM3A 5AZFA 3AU5A 4I6NB 1YD8U 5IAAC 1E8ZA 3R66C 2KC1A 4KVGB 4WWNA 4WJNA 2KHWB 1LFDA 4NY0A 4W9CA 3WIMA 4ANUA 4W9FA 5JH5C 1YJ1A 3IFWB 3DQVA 2YLMA 1WGHA 2DZKA 3CMMB 1E8WA 1E8XA 2WX0A 1T0YA 2IO2B 4GSWA 1GNUA 2D2QA 2NPTB 1EUVB 2G3QB 2KK8A 3DVNU 3VHTC 1E7UA 4FJZA 1P9DU 1L2NA 3RCZA 3QHTA 2OJRA 2LZ6A 3L0WB 4F1SA 1LM8B 1KLVA 4HDOA 4MDKE 2GOWA 2PJHA 2BWES 3WAOA 1WX8A 4DHJD 1WFYA 4ASWC 2KJ6A 1VCBA 4B95A 2REXA 4DHJB 4P7IA 4B9KA 1SGHA 2JZ3B 3M62B 2GBMA 2N7DA 1Q0WB 5AEKB 1J0GA 4WQOB 4K7SA 2JRHA 5CTRC 2C60A 2LD9A 3BY4B 2MA9B 3QJZA 2MW5A 2BF8B 2CU1A 4WJPA 2FCMA 1WGDA 2R2OA 1TTNA 1V49A 2KTRB 4K7UA 4IM2A 1RFAA 3PLVA 4BOZB 2G4SA 3T9LA 1UGMA 3OLMD 3QK0A 5E6NA 5TR5A 1WJ6A 3OJ3A 4HK2A 4ZDVA 4A3PA 3H7PB 2I1JA 5AZHA 3V6EB 4WAAA 1ZGUB 2O6VA 1V5TA 3ZRCA 3LJ3A 3H1UA 3DOWA 3DVNV 2EMSA 4YL8A 3UINB 3DCGA 5DCNA 2C9WB 1V2YA 2K25A 2N9EB 5D2MB 2FAZA 2KFKB 1FXTB 2LVPA 3A9JA 3QARA 2NS5A 3ZTDA 2PE6B 4IM0A 4FJYA 3MHSD 3U30A 2LASA 2MRPA 3PPAA 2LGYA 1U4AA 1WMHA 2GBNA 4ZRIA 4FHJA 3VQIA 5KHOA 4ANVA 5GMVA 2EKEC 5G55A 3R3MA 2I1KA 3JSVB 3D32A 3QWZB 4NAWA 1WXAA 4IWPA 1UH6A 1WX7A 1WY8A 3TIXA 4A20A 5C1ZA 2MBQA 2N1VA 2CR5A 2GBKA 4OVUA 2JXXA 2MWSB 4I6PA 5JHBA 1WIAA 2LJ5A 4EFOA 1IP9A 3RD2A 2XK5A 4BBNF 1A5RA 1YX6B 5J18A 3PREA 1WH3A 2KWCA 2ZCCA 5BO4B 3VH4B 3ZO5B 2LVQA 1P98A 2FCSA 4MGIE 2NBWB 2Y5BB 3JYUA 2K8BA 3N30A 2K39A 3P2BA 4LCDE 3SD5A 3ECIA 2OOBB 2MBOA 3APCA 4GN1A 4W9GA 1K8RB 2ZCBA 3TJPA 2KTRA 2KDIA 1WJUA 3W1YA 5AZGA 4EOYA 4MJSA 2QHOA 3VH3B 2D11A 2DAJA 2AL3A 2A4ZA 2C7MB 4W9JA 2N4FA 1M94A 3VUXA 1GC6A 4CO7A 4TV3A 2IBIB 3PRPB 2PEAA 4MSQB 4W9EA 1OTRB 1NI2A 4NJ7A 1J8CA 2FIDA 2KMAA 3EFUA 3WALA 2KFKA 3RULA 3RYTA 3W1SA 3VXWA 3DDCB 2FCNA 3JVZX 5DPTA 2JT4B 3IVFA 2A5UA 5J2RA 4PYUA 4AP4C 4J6IA 3S2AA 4IG7B 4GMVA 2LRUA 4KV2A 3ZW3A 3DVGY 3UGBB 5JZEB 1I42A 2JPHA 2AYOB 3DVGX 2JWZA 2KLCA 1G6JA 3KYCD 3SU8X 2C5LC 1EF1A 3QX1A 3ZTCA 2PPHA 4M0WB 4OVVA 2O6VB 4PS8A 3PLUA 3SDLC 4DK5A 4EUTA 1P0RA 3ONSA 3UQAA 5G2NA 1LXDA 2IO0B 2KC2A 2KXJA 2MX2A 2DZIA 2ZNVC 4WWPA 3VFKA 2DZJA 3PZDA 1WRDB 2CHZA 2JF5A 3A9JB 2KMCA 3HK0A 1CMXB 2D07B 3V60A 4KDLB 2J7QB 4BFRA 4PS3A 1WJ4A 1WMHB 2YVCA 3VAWA 3L17A 3B0AA 1KJTA 1V80A 4IWOA 4BOSC 3M95A 1QZEA 2JZZA 4NAWB 4B6WA 3ML8A 1RRBA 3IBEA 2UWQA 5IA7A 2XEWA 3AXCA 3APFA 4JLCA 3R7QA 2XK5B 4LJPB 3ZNZB 2NR2A 1P3QU 2PE9A 4LJOB 1Y8RC 1S1QB 3Q3FA 3WAMA 4W9KA 1WXSA 2ZZPB 4TQ1A 3L16A 2LGDA 2HTHA 1IYFA 2N7EA 3GZNI 4FHKA 4MJSB 1D3ZA 2WWZA 1MG8A 2HJ8A 4AOFA 3A1QA 4WJOA 1WM3A 1P1AA 4ICUA 1WR6E 1GUAB 3TMPB 3UF8A 2GBRA 2KVRA 2KJHB 3K9PB 1XT9B 3AI5A 4DWFA 3PSEB 4JGHB 4HVBA 1UELA 1Q5WB 2KNBA 2Z0EB 4TQ0A 2J0KA 3EHVA 3VTWA 2IYDB 1WE6A 3NZSA 2NBVB 4ICVA 1OEYA 1UD7A 3APDA 4IM3A 1YIWA 4W9LA 3WAPA 1OGWA 3ZNHB 5LXHA 4F7ZA 3VTVA 1KM7A 3WANA 1WZ0A 2WYQA 4FN2A 2KKCA 1RAXA 4EZLA 3UQBA 4E71A 1WR1A 3A33B 3NY5A 2B3AA 2N1WA 2DHZA 3MTNB 3I3TB 1WGGA 4KSKC 2ZJDA 2HE7A 2KDEB 2K6QA 2AL6A 3EECA 3IHPC 1EF5A 4GIVA 3X0WA 4HJKA 4HLEA 4GB9A 2L8JA 5CX3A 5D7GA 4KIKA 1WM2A 4HWIB 3T8MA 2ZEQA 5CHFA 3A9KB 4G0NB 4WWOA 2R2QA 4GDLA 5E6PA 4K81A 1YQBA 4F8CB 2W9NA 2KWUB 2LXCA 5D6JB 1ISNA 4IC7B 5L95C 4BBNC 4DDID 4IUMB 2KQ7A 2LXAA 3ZVVA 4IWQA 4PS7A 3H9DA 2L0TA 1UBIA 3HM3A 4HPMB 4CHKA 1OEYJ 2G45B 2CS4A 1NDDA 2RSUA 3ZDTA 4DDGD 2KWVB 4TUUA 1YX5B 4EZKA 3CF6E 2GBJA 2BYFA 3KH0A 4TKNA 4XC2A 3ZLZA 3H6NA 4II2B 2AEHA 2Z59B 3A4SC 4NNJB 3ZKJC 4KSLC 1WE7A 3AULA 2LUEA 2K6DB 2FIFA 3L10B 5DPWA 4ZRKA 3MJWA 1F9JA 2AWTA 2L3ZA 3LDZE 2LWPA 3VUYA 3H7SA 3W1SC 3IG3A 4AJWA 4MGZE 2O2VA 2IO1B 3KYDD 3L08A 4MH0E 2DAFA 1GJZA 4AJYB 3A1QB 1HE8A 1WF9A 2NVUI 3DBRI 3U7DA 3UIPB 3ZRFA 4K1RB 1TBEA 2Z0DB 3DBLI 3RUIB 3VTUA 2N9XA 4BVUC 1E7VA 3VVWB 2BGFA 4M8NA 4II3B 2M17A 1TZ1A 3PS6A 3TCAA 3KUZA 4GU2A 2FUHB 2KDFB 4MSMB 3NOBA 1VD2A 4ANWA 1H8CA 3ML9A 2JVCA 4NQKE 4AWJA 2DYBA 2M1MA 2L05A 3A9KA 2MSED 1S3SG 4LDTD 1XD3B 2N9PC 1H4RA 2ASQA 1TGZB 2JRIB 3A4RA 4XX5A 4HDQA 4LDTB 3PRMB 4ANXA 2BWFA 2MBHA 4ZRJA 5FR6A 3RZWC 2GMIC 3DPDA 2LGXA 2LVOA 5LLIA 3HM6X 3O65B 4ZYNA 4I6LB 1J19A 2KX0A 2M8SA 1JRUA 3DBSA 3KW5B 3V61A 4KDIC 2BKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGE A;  3AU4 A;  2KX3 A;  3N3K B;  1V6E A;  4GOC A;  3ZUN A;  2KAN A;  4FBJ B;  2C7N B;  3EC8 A;  2K8C A;  3B08 A;  1IPG A;  2KLG A;  3B1L X;  2RD0 A;  3VDZ A;  4MEM A;  3CSF A;  4KIK B;  3RT3 B;  3U8Z A;  2KFJ A;  5EDS A;  3SHQ A;  2DYO A;  3M3J A;  2K1F A;  2IY0 B;  3GOE A;  1UZX B;  2KO3 A;  4GDL B;  1Z5S B;  3PHW B;  3QA8 A;  4FUL A;  1X1M A;  3TL5 A;  1C3T A;  2IY1 B;  3C0R B;  2CKH B;  3KVF B;  3OJ4 B;  4GDK A;  5L83 A;  2BKF A;  2MCN B;  3PVL A;  1C1Y B;  2WDT B;  3PTF C;  4CYE A;  4FAD A;  1Z2M A;  2KDB A;  2FNJ B;  2MLB A;  3UIO B;  3VUW A;  1V86 A;  3PHX B;  4EZJ A;  4DHZ B;  1GG3 A;  3R7R A;  2XBB C;  4PYZ A;  3TBL D;  4W9D A;  3L13 A;  3DBH I;  1WYW B;  2L00 B;  4G11 A;  4BKT A;  4A3O A;  1R4M I;  2D3G A;  2RR9 A;  5KHQ A;  2MP2 A;  3PV1 A;  2LRW A;  4N9F 4;  1WZ3 A;  1E5W A;  2JUO A;  3K9O B;  2VRR B;  3ZNI D;  4K7W A;  4MGY E;  2MQJ A;  2J0J A;  3NHE B;  4GGQ A;  2O2V B;  4MEL A;  1UBQ A;  2KQS A;  3HHM A;  2KTF A;  3X23 A;  4BKS D;  3QQ8 B;  4EKU A;  2EMT A;  4NJ6 A;  4RM8 A;  2JY6 A;  5J17 A;  2MBB B;  1SE9 A;  2L7R A;  2LI5 A;  4W9H A;  4W9I A;  5D94 A;  4E74 A;  4DBG A;  1EO6 A;  2WX1 A;  5CHW A;  1L7Y A;  3BIN A;  1WJN A;  2NPT A;  4DXA B;  2L0F A;  1WGR A;  2D10 A;  4G3X B;  4GXB A;  4HCP B;  1WI0 A;  2CHW A;  2DYM A;  2IO3 B;  2ZVO A;  4RMA A;  1V81 A;  4NQL B;  2MBE A;  2DZM A;  1WXM A;  5DPR A;  4BKG A;  5HKH A;  3ZNG C;  4FLH A;  2ZPN A;  2KZR A;  1XQQ A;  3Q3J A;  2CHX A;  2G4D B;  2ZNV B;  3N32 A;  4AUQ C;  3NZU A;  2V4L A;  2NBU A;  3PT2 B;  4JL9 A;  3ENE A;  4DHZ E;  4FA6 A;  1WX9 A;  1OQY A;  2UYZ B;  4XZ4 A;  2V3S A;  3NS8 A;  2J0M A;  2KOX A;  3QIJ A;  4WJQ A;  3M63 B;  3CST A;  3KUC B;  3ZIM A;  2DEN B;  1LQB A;  1E90 A;  2BYV E;  1GC7 A;  1WGY A;  5LXI B;  1I35 A;  4E3C A;  3RZF A;  4FJV B;  2L76 A;  4NPN A;  3ALB A;  1AAR A;  2M4N A;  3KUD B;  3PRZ A;  4IW0 A;  2M0X A;  1PQS A;  5E6O A;  1V5O A;  2RGF A;  3OAW A;  3H7P A;  4X57 B;  3QC8 B;  1BT0 A;  5JHA A;  4GDK B;  2KN5 A;  4G50 A;  4JIO U;  2ZVN A;  2KJR A;  5CHV C;  4HXD A;  2FCQ A;  4BKS A;  1KOT A;  2NCN A;  4EEW A;  2DX5 B;  1SIF A;  4KZ0 A;  2HD5 B;  5DPS A;  2RPQ A;  2C7H A;  3HIZ A;  4URK A;  1WXV A;  1ZW7 A;  2K8H A;  1V9J A;  3JW0 X;  5C23 A;  3V62 A;  1E8Y A;  4M8M A;  3ZDM C;  4MGK E;  3WA0 A;  1NBF C;  1ZKH A;  2MP2 B;  2BPS A;  2V1Y A;  3V6C B;  1R4N I;  2IZV B;  4HCN B;  4HPL B;  2ZPY A;  4RM9 A;  1Q1O A;  3JSV A;  4JQW C;  2BYE A;  2KD0 A;  4KZC A;  3QAQ A;  3QCA A;  1RLF A;  2O6V D;  3L54 A;  4MM3 A;  5AZF A;  3AU5 A;  4I6N B;  1YD8 U;  5IAA C;  1E8Z A;  3R66 C;  2KC1 A;  4KVG B;  4WWN A;  4WJN A;  2KHW B;  1LFD A;  4NY0 A;  4W9C A;  3WIM A;  4ANU A;  4W9F A;  5JH5 C;  1YJ1 A;  3IFW B;  3DQV A;  2YLM A;  1WGH A;  2DZK A;  3CMM B;  1E8W A;  1E8X A;  2WX0 A;  1T0Y A;  2IO2 B;  4GSW A;  1GNU A;  2D2Q A;  2NPT B;  1EUV B;  2G3Q B;  2KK8 A;  3DVN U;  3VHT C;  1E7U A;  4FJZ A;  1P9D U;  1L2N A;  3RCZ A;  3QHT A;  2OJR A;  2LZ6 A;  3L0W B;  4F1S A;  1LM8 B;  1KLV A;  4HDO A;  4MDK E;  2GOW A;  2PJH A;  2BWE S;  3WAO A;  1WX8 A;  4DHJ D;  1WFY A;  4ASW C;  2KJ6 A;  1VCB A;  4B95 A;  2REX A;  4DHJ B;  4P7I A;  4B9K A;  1SGH A;  2JZ3 B;  3M62 B;  2GBM A;  2N7D A;  1Q0W B;  5AEK B;  1J0G A;  4WQO B;  4K7S A;  2JRH A;  5CTR C;  2C60 A;  2LD9 A;  3BY4 B;  2MA9 B;  3QJZ A;  2MW5 A;  2BF8 B;  2CU1 A;  4WJP A;  2FCM A;  1WGD A;  2R2O A;  1TTN A;  1V49 A;  2KTR B;  4K7U A;  4IM2 A;  1RFA A;  3PLV A;  4BOZ B;  2G4S A;  3T9L A;  1UGM A;  3OLM D;  3QK0 A;  5E6N A;  5TR5 A;  1WJ6 A;  3OJ3 A;  4HK2 A;  4ZDV A;  4A3P A;  3H7P B;  2I1J A;  5AZH A;  3V6E B;  4WAA A;  1ZGU B;  2O6V A;  1V5T A;  3ZRC A;  3LJ3 A;  3H1U A;  3DOW A;  3DVN V;  2EMS A;  4YL8 A;  3UIN B;  3DCG A;  5DCN A;  2C9W B;  1V2Y A;  2K25 A;  2N9E B;  5D2M B;  2FAZ A;  2KFK B;  1FXT B;  2LVP A;  3A9J A;  3QAR A;  2NS5 A;  3ZTD A;  2PE6 B;  4IM0 A;  4FJY A;  3MHS D;  3U30 A;  2LAS A;  2MRP A;  3PPA A;  2LGY A;  1U4A A;  1WMH A;  2GBN A;  4ZRI A;  4FHJ A;  3VQI A;  5KHO A;  4ANV A;  5GMV A;  2EKE C;  5G55 A;  3R3M A;  2I1K A;  3JSV B;  3D32 A;  3QWZ B;  4NAW A;  1WXA A;  4IWP A;  1UH6 A;  1WX7 A;  1WY8 A;  3TIX A;  4A20 A;  5C1Z A;  2MBQ A;  2N1V A;  2CR5 A;  2GBK A;  4OVU A;  2JXX A;  2MWS B;  4I6P A;  5JHB A;  1WIA A;  2LJ5 A;  4EFO A;  1IP9 A;  3RD2 A;  2XK5 A;  4BBN F;  1A5R A;  1YX6 B;  5J18 A;  3PRE A;  1WH3 A;  2KWC A;  2ZCC A;  5BO4 B;  3VH4 B;  3ZO5 B;  2LVQ A;  1P98 A;  2FCS A;  4MGI E;  2NBW B;  2Y5B B;  3JYU A;  2K8B A;  3N30 A;  2K39 A;  3P2B A;  4LCD E;  3SD5 A;  3ECI A;  2OOB B;  2MBO A;  3APC A;  4GN1 A;  4W9G A;  1K8R B;  2ZCB A;  3TJP A;  2KTR A;  2KDI A;  1WJU A;  3W1Y A;  5AZG A;  4EOY A;  4MJS A;  2QHO A;  3VH3 B;  2D11 A;  2DAJ A;  2AL3 A;  2A4Z A;  2C7M B;  4W9J A;  2N4F A;  1M94 A;  3VUX A;  1GC6 A;  4CO7 A;  4TV3 A;  2IBI B;  3PRP B;  2PEA A;  4MSQ B;  4W9E A;  1OTR B;  1NI2 A;  4NJ7 A;  1J8C A;  2FID A;  2KMA A;  3EFU A;  3WAL A;  2KFK A;  3RUL A;  3RYT A;  3W1S A;  3VXW A;  3DDC B;  2FCN A;  3JVZ X;  5DPT A;  2JT4 B;  3IVF A;  2A5U A;  5J2R A;  4PYU A;  4AP4 C;  4J6I A;  3S2A A;  4IG7 B;  4GMV A;  2LRU A;  4KV2 A;  3ZW3 A;  3DVG Y;  3UGB B;  5JZE B;  1I42 A;  2JPH A;  2AYO B;  3DVG X;  2JWZ A;  2KLC A;  1G6J A;  3KYC D;  3SU8 X;  2C5L C;  1EF1 A;  3QX1 A;  3ZTC A;  2PPH A;  4M0W B;  4OVV A;  2O6V B;  4PS8 A;  3PLU A;  3SDL C;  4DK5 A;  4EUT A;  1P0R A;  3ONS A;  3UQA A;  5G2N A;  1LXD A;  2IO0 B;  2KC2 A;  2KXJ A;  2MX2 A;  2DZI A;  2ZNV C;  4WWP A;  3VFK A;  2DZJ A;  3PZD A;  1WRD B;  2CHZ A;  2JF5 A;  3A9J B;  2KMC A;  3HK0 A;  1CMX B;  2D07 B;  3V60 A;  4KDL B;  2J7Q B;  4BFR A;  4PS3 A;  1WJ4 A;  1WMH B;  2YVC A;  3VAW A;  3L17 A;  3B0A A;  1KJT A;  1V80 A;  4IWO A;  4BOS C;  3M95 A;  1QZE A;  2JZZ A;  4NAW B;  4B6W A;  3ML8 A;  1RRB A;  3IBE A;  2UWQ A;  5IA7 A;  2XEW A;  3AXC A;  3APF A;  4JLC A;  3R7Q A;  2XK5 B;  4LJP B;  3ZNZ B;  2NR2 A;  1P3Q U;  2PE9 A;  4LJO B;  1Y8R C;  1S1Q B;  3Q3F A;  3WAM A;  4W9K A;  1WXS A;  2ZZP B;  4TQ1 A;  3L16 A;  2LGD A;  2HTH A;  1IYF A;  2N7E A;  3GZN I;  4FHK A;  4MJS B;  1D3Z A;  2WWZ A;  1MG8 A;  2HJ8 A;  4AOF A;  3A1Q A;  4WJO A;  1WM3 A;  1P1A A;  4ICU A;  1WR6 E;  1GUA B;  3TMP B;  3UF8 A;  2GBR A;  2KVR A;  2KJH B;  3K9P B;  1XT9 B;  3AI5 A;  4DWF A;  3PSE B;  4JGH B;  4HVB A;  1UEL A;  1Q5W B;  2KNB A;  2Z0E B;  4TQ0 A;  2J0K A;  3EHV A;  3VTW A;  2IYD B;  1WE6 A;  3NZS A;  2NBV B;  4ICV A;  1OEY A;  1UD7 A;  3APD A;  4IM3 A;  1YIW A;  4W9L A;  3WAP A;  1OGW A;  3ZNH B;  5LXH A;  4F7Z A;  3VTV A;  1KM7 A;  3WAN A;  1WZ0 A;  2WYQ A;  4FN2 A;  2KKC A;  1RAX A;  4EZL A;  3UQB A;  4E71 A;  1WR1 A;  3A33 B;  3NY5 A;  2B3A A;  2N1W A;  2DHZ A;  3MTN B;  3I3T B;  1WGG A;  4KSK C;  2ZJD A;  2HE7 A;  2KDE B;  2K6Q A;  2AL6 A;  3EEC A;  3IHP C;  1EF5 A;  4GIV A;  3X0W A;  4HJK A;  4HLE A;  4GB9 A;  2L8J A;  5CX3 A;  5D7G A;  4KIK A;  1WM2 A;  4HWI B;  3T8M A;  2ZEQ A;  5CHF A;  3A9K B;  4G0N B;  4WWO A;  2R2Q A;  4GDL A;  5E6P A;  4K81 A;  1YQB A;  4F8C B;  2W9N A;  2KWU B;  2LXC A;  5D6J B;  1ISN A;  4IC7 B;  5L95 C;  4BBN C;  4DDI D;  4IUM B;  2KQ7 A;  2LXA A;  3ZVV A;  4IWQ A;  4PS7 A;  3H9D A;  2L0T A;  1UBI A;  3HM3 A;  4HPM B;  4CHK A;  1OEY J;  2G45 B;  2CS4 A;  1NDD A;  2RSU A;  3ZDT A;  4DDG D;  2KWV B;  4TUU A;  1YX5 B;  4EZK A;  3CF6 E;  2GBJ A;  2BYF A;  3KH0 A;  4TKN A;  4XC2 A;  3ZLZ A;  3H6N A;  4II2 B;  2AEH A;  2Z59 B;  3A4S C;  4NNJ B;  3ZKJ C;  4KSL C;  1WE7 A;  3AUL A;  2LUE A;  2K6D B;  2FIF A;  3L10 B;  5DPW A;  4ZRK A;  3MJW A;  1F9J A;  2AWT A;  2L3Z A;  3LDZ E;  2LWP A;  3VUY A;  3H7S A;  3W1S C;  3IG3 A;  4AJW A;  4MGZ E;  2O2V A;  2IO1 B;  3KYD D;  3L08 A;  4MH0 E;  2DAF A;  1GJZ A;  4AJY B;  3A1Q B;  1HE8 A;  1WF9 A;  2NVU I;  3DBR I;  3U7D A;  3UIP B;  3ZRF A;  4K1R B;  1TBE A;  2Z0D B;  3DBL I;  3RUI B;  3VTU A;  2N9X A;  4BVU C;  1E7V A;  3VVW B;  2BGF A;  4M8N A;  4II3 B;  2M17 A;  1TZ1 A;  3PS6 A;  3TCA A;  3KUZ A;  4GU2 A;  2FUH B;  2KDF B;  4MSM B;  3NOB A;  1VD2 A;  4ANW A;  1H8C A;  3ML9 A;  2JVC A;  4NQK E;  4AWJ A;  2DYB A;  2M1M A;  2L05 A;  3A9K A;  2MSE D;  1S3S G;  4LDT D;  1XD3 B;  2N9P C;  1H4R A;  2ASQ A;  1TGZ B;  2JRI B;  3A4R A;  4XX5 A;  4HDQ A;  4LDT B;  3PRM B;  4ANX A;  2BWF A;  2MBH A;  4ZRJ A;  5FR6 A;  3RZW C;  2GMI C;  3DPD A;  2LGX A;  2LVO A;  5LLI A;  3HM6 X;  3O65 B;  4ZYN A;  4I6L B;  1J19 A;  2KX0 A;  2M8S A;  1JRU A;  3DBS A;  3KW5 B;  3V61 A;  4KDI C;  2BKR B; 
#chains in the Genus database with same CATH topology
 3PGE A;  3AU4 A;  1V6E A;  1KRH A;  4FBJ B;  2KLG A;  4MEM A;  1DGJ A;  1FCL A;  3RT3 B;  3U8Z A;  3SHQ A;  4LLG M;  2K1F A;  2IY0 B;  4J3O D;  1X1M A;  4KGR A;  3KVF B;  2CKH B;  1J7C A;  1N5W A;  4XE0 A;  2BKF A;  2HDE A;  1C1Y B;  2WDT B;  3PTF C;  4CYE A;  1Z2M A;  2MLB A;  3PHX B;  3T3O A;  2XBB C;  4PYZ A;  3TBL D;  2BT6 A;  3DBH I;  2L00 B;  4KGT A;  1GPX A;  1R4M I;  2D3G A;  2RR9 A;  3IAM 1;  3PV1 A;  4N9F 4;  4ARI A;  1E5W A;  4N6E B;  2JUO A;  3K9O B;  4K7W A;  1PDX A;  2MQJ A;  3SFD B;  2J0J A;  3NHE B;  4GGQ A;  4LNI A;  4MEL A;  1UBQ A;  5EE3 A;  3U2S C;  5E6J A;  1SE9 A;  2FUG 1;  2LI5 A;  3AEC B;  2WX1 A;  4KKJ A;  1L7Y A;  3Q8C A;  1WJN A;  1ROE A;  2NPT A;  2DNF A;  1IGD A;  3E56 A;  3E9S A;  2CHW A;  2IO3 B;  2ZVO A;  2MBE A;  1RWS A;  3ZNG C;  1XQQ A;  4REZ A;  2G4D B;  2IND C;  1GB4 A;  3ENE A;  4DHZ E;  4FA6 A;  2V3S A;  3QIJ A;  1NEK B;  1OFF A;  3M63 B;  3KUC B;  2QMT A;  2BYV E;  5LXI B;  2IGD A;  1ESF A;  4E3C A;  1QOF A;  3RZF A;  3P42 A;  1EU4 A;  3KUD B;  3OAW A;  2WXO A;  3DBL B;  2MEK A;  4G50 A;  3W9C B;  2KJR A;  5CHV C;  3ZXV A;  4HXD A;  4BKS A;  1C4C A;  2DX5 B;  2KT7 A;  4XWT A;  1WXV A;  2N0S B;  3BK2 A;  5EE1 A;  5C23 A;  3ZDM C;  3WA0 A;  1ZKH A;  3TUO A;  1M4V A;  3TEW A;  2KD0 A;  3QCA A;  1SXT A;  1RLF A;  3R66 C;  4WWN A;  1SEB D;  2QSD A;  4WJN A;  2KHW B;  3U52 E;  3DQV A;  3AE9 B;  1WGH A;  2WX0 A;  1T0Y A;  3RNF C;  2NPT B;  1EUV B;  2KK8 A;  3VHT C;  1V1O A;  4FJZ A;  3GZN B;  3QHT A;  5BYR A;  4HDO A;  4MDK E;  4PK1 A;  1C4A A;  2D3C A;  4B95 A;  3Q8E A;  4B9K A;  3M62 B;  2N7D A;  1XF5 L;  3ZGZ A;  5CTR C;  4C80 A;  3I9V 1;  2INN E;  3Q8A A;  1RFA A;  1T0S C;  4P1B C;  3NUH B;  3OJ3 A;  4HK2 A;  3L4P A;  5AZH A;  3BVM A;  1KLU D;  2PKO A;  3H1U A;  3DOW A;  4YL8 A;  2K25 A;  1KLG D;  2FAZ A;  3A9J A;  3QAR A;  2MRP A;  4ZRI A;  2GBN A;  1FNW A;  5KHO A;  1N63 A;  2EKE C;  1FM0 D;  3D32 A;  1VJK A;  3QWZ B;  5C1Z A;  3URY A;  1VZ7 A;  2KYW A;  2LJ5 A;  1L6U A;  1YX6 B;  5HI1 A;  1TZO A;  2LVQ A;  1P98 A;  2FCS A;  3P2B A;  2K39 A;  1TKE A;  2OOB B;  1K8R B;  4BAX A;  2ZCB A;  1XLQ A;  4EOY A;  2QHO A;  3Q69 A;  1EWY C;  2R61 A;  2C7M B;  1IBX A;  3EA6 A;  1JWS D;  3DBR B;  3VUX A;  1GC6 A;  4TV3 A;  1AW7 A;  2PEA A;  4K3C A;  4NJ7 A;  3EFU A;  3WAL A;  2WXI A;  2KFK A;  1R4N B;  2JT4 B;  3Q3N C;  4PT5 A;  2LRU A;  3DVG Y;  2AYO B;  2BS2 B;  1KFY B;  2JWZ A;  2KLC A;  4CQN A;  3AEB B;  2PPH A;  1ZDV A;  5G5H A;  3ZXR A;  1JRO A;  4P1C C;  3PLU A;  3NVV A;  1XEE A;  2IO0 B;  2KC2 A;  1VDV A;  4A8X C;  3RFZ B;  1VZ8 A;  1WRD B;  2CHZ A;  2JF5 A;  3A9J B;  1T0R C;  4OZC A;  1CMX B;  2D07 B;  2LGI A;  2LHD A;  1ET9 A;  2J7Q B;  1JCK B;  2GI9 A;  3VAW A;  3L17 A;  4ZOH C;  1KH0 A;  3ML8 A;  1RRB A;  2UWQ A;  1QLB B;  2D3A A;  3APF A;  3AE6 B;  1ENF A;  1FNU A;  1SE3 A;  3ZNZ B;  1TKY A;  1E6E B;  1JRP A;  2KMM A;  1FXA A;  3WAM A;  2ZZP B;  1TYG B;  1TT5 B;  2G9H D;  2H89 B;  1TS4 A;  1D3Z A;  1QOG A;  1IBX B;  2HJ8 A;  4D2K A;  3A1Q A;  3SFE B;  1FCC C;  1WM3 A;  1P1A A;  1GUA B;  3TMP B;  2GBR A;  5AUI A;  2KJH B;  3AI5 A;  4HVB A;  1Q5W B;  1K51 A;  1WE6 A;  2QIL A;  1UWX A;  2JYT A;  1YIW A;  3RI7 C;  4W9L A;  3WAP A;  1MG4 A;  2AQ3 B;  3VTV A;  1WZ0 A;  3UQB A;  2KKC A;  2WXN A;  2HTM E;  2MJD A;  3NY5 A;  2B3A A;  2DHZ A;  1WGG A;  5IOI A;  2KDE B;  3X0W A;  1EF5 A;  1D6E C;  4HJK A;  2L8J A;  4KIK A;  1WM2 A;  4YSX B;  2WXG A;  2ZEQ A;  5H92 C;  4C7Y A;  1C78 A;  5E6P A;  4ZYS A;  4K81 A;  4F8C B;  2KWU B;  1VLB A;  3CWI A;  4WH4 A;  1UWM A;  1T3Q A;  4FXC A;  3AEE B;  4IWQ A;  1GOZ A;  3U7Z A;  3HM3 A;  4CHK A;  4KGS A;  4MH8 A;  2KWV B;  1YX5 B;  3CF6 E;  2BYF A;  4XC2 A;  3W5V B;  2AEH A;  4NNJ B;  1V1P B;  2N9L A;  1WE7 A;  3AUL A;  3L10 B;  2OHF A;  1SF0 A;  4ZRK A;  2N7J A;  3W1S C;  4AJW A;  1ACC A;  4OW0 A;  1E7P B;  1HZ5 A;  3A1Q B;  3R2I A;  1E9M A;  1TBE A;  1NYQ A;  3RUI B;  2BYT A;  4TMA B;  2BGF A;  2M17 A;  4QAY A;  4MSM B;  2KDF B;  3ML9 A;  1TS5 A;  1UF0 A;  3WCQ A;  3A9K A;  1S3S G;  1H4R A;  2ASQ A;  4HDQ A;  3FKY A;  2BWF A;  1ZXH A;  5FR6 A;  2MH7 A;  3RZW C;  2GMI C;  1D4B A;  4ZYN A;  4I6L B;  1J19 A;  1JRU A;  4KDI C;  3NVW A;  2BKR B;  1T6B X;  2VH1 A;  2KAN A;  2JXT A;  3ZUN A;  2QC8 A;  3B1L X;  1IPG A;  4KIK B;  3FC4 A;  4NAM A;  5EDS A;  2DYO A;  3M3J A;  1UZX B;  2VZK D;  3AE4 B;  1UUP A;  1Z5S B;  2VZK B;  1C3T A;  3C0R B;  4HKQ A;  1D5M C;  3PVL A;  3GE3 C;  2FNJ B;  3UIO B;  2QIE B;  4DHZ B;  1I4R A;  3VR8 B;  2E3T A;  4W9D A;  4G11 A;  4LNK A;  1WZ3 A;  3AE5 B;  4HKZ E;  1TS2 A;  1L0V B;  3BYY B;  3NS1 A;  2KN4 A;  4A9A A;  2JY6 A;  2MBB B;  5BMG A;  2L7R A;  2CJO A;  4W9I A;  5D94 A;  2WXP A;  4DBG A;  2WXF A;  4DXA B;  2L0F A;  4GXB A;  4RMA A;  4MT5 A;  1V81 A;  2DZM A;  1WXM A;  5DPR A;  2AQ2 B;  4BKG A;  5HKH A;  2LHE A;  3Q3O C;  2LJI A;  3N32 A;  3AEF B;  3PT2 B;  4JL9 A;  1WX9 A;  3NS8 A;  2KOX A;  3GP7 A;  4HJG E;  3CST A;  1E90 A;  1WGY A;  4YSZ B;  1I35 A;  2JX5 A;  1AAR A;  2M4N A;  3TEX A;  1PQS A;  3P4R B;  3SR6 A;  4JIO U;  4YTM B;  1KOT A;  1YOV B;  1J7B A;  3LXF A;  2HD5 B;  4URK A;  3V62 A;  1V9J A;  1NBF C;  1JWA D;  4RM9 A;  3JSV A;  1YMH E;  3AE3 B;  2O6V D;  1JWU D;  3L54 A;  2JYE A;  3AU5 A;  5IAA C;  4KVG B;  2G1E A;  2W3S A;  1T0Q C;  4NY0 A;  4W9C A;  3WIM A;  1IUE A;  1C76 A;  3KQ4 A;  1ZP0 B;  1L0X B;  1FXI A;  2DZK A;  3CMM B;  4L1B A;  4XWW A;  4JX1 C;  4LTU A;  1T5X D;  4RFB A;  3RCZ A;  2OJR A;  1LM8 B;  1IGC A;  2GOW A;  2PJH A;  2WHI A;  4ASW C;  2BS4 B;  2REX A;  5H8Y E;  2RDG A;  3DBH B;  2LD9 A;  3BY4 B;  2W82 A;  3RN9 C;  1P7E A;  1WSP A;  1TTN A;  1STE A;  1FRD A;  3T9L A;  5E6N A;  5TR5 A;  1I4H A;  1WJ6 A;  2SAK A;  4ZDV A;  1I4G A;  4XGA B;  2EMS A;  1V2Y A;  4KX6 B;  1LGR A;  1YJI A;  2LVP A;  2NS5 A;  3ZTD A;  4IM0 A;  2LAS A;  2GB1 A;  4JPS A;  1U4A A;  1WMH A;  1YJJ A;  2BB6 A;  5G55 A;  2I1K A;  3JSV B;  3MP9 A;  4Q2J A;  4NAW A;  4A20 A;  1UH6 A;  1WY8 A;  4WAF A;  1L4Z B;  5IN7 A;  2CR5 A;  4AS1 A;  5HG2 A;  3RNC C;  4OVU A;  1DYQ A;  2MWS B;  2RMM A;  1WIA A;  1IP9 A;  4A6Q A;  3Q3M C;  3RD2 A;  4BBN F;  1A5R A;  3NJT A;  1L5P A;  4MGI E;  4XDD A;  3JYU A;  2BQQ A;  2LGS A;  3TJP A;  2GLS A;  2KDI A;  3FIL A;  2AL3 A;  2A4Z A;  3ABV B;  1M94 A;  5C3J B;  2IBI B;  2L52 A;  3GB1 A;  4MSQ B;  3TEZ A;  4R3D A;  1NI2 A;  3ZQ4 A;  1YN3 A;  2KMA A;  3GS2 A;  3W1S A;  3VXW A;  3R8B A;  3DDC B;  3JVZ X;  5J2R A;  4A90 A;  4AP4 C;  1N5X A;  4GMV A;  5JZE B;  4HEA 1;  2JPH A;  1G6J A;  2C5L C;  2D3B A;  3ZTC A;  3I57 A;  4OVV A;  1SIJ A;  5IP4 D;  3SDL C;  1P0R A;  4HRO A;  1LXD A;  1VZ6 A;  2KXJ A;  2DZI A;  4WQM A;  3PZD A;  1J7A A;  4C4V B;  3HK0 A;  3V60 A;  4KDL B;  4WWM A;  1WMH B;  2YVC A;  2WXH A;  3W2D A;  1WXQ A;  1XXG A;  4IWO A;  3N1Y C;  4NAW B;  1F2R I;  1BUI C;  3AXC A;  2OED A;  4JLC A;  5D3I B;  2PE9 A;  1Y8R C;  1F0Z A;  1VR9 A;  1SJE D;  2Z8L A;  4W9K A;  2GRI A;  1FO4 A;  3MFG A;  2HTH A;  1IYF A;  2N7E A;  3GZN I;  1Y56 A;  3NG0 A;  3FIL B;  2WWZ A;  1MG8 A;  4ICU A;  4BZA A;  3IXS A;  3KWL A;  3PSE B;  2ICI A;  4DXG A;  4TQ0 A;  1F1H A;  3HRD D;  2NBV B;  2RPV A;  4IM3 A;  4YTP B;  1OGW A;  2FBW B;  3I5J C;  3ZNH B;  5BMI A;  4FN2 A;  3EUB 2;  3A33 B;  5AUK A;  3MTN B;  4KSK C;  2LFI A;  5GXG B;  3EEC A;  3IHP C;  1NYR A;  3RNE C;  4IDI A;  1L6V A;  2QJL A;  1AYF A;  3OG5 A;  1VRA B;  1YQB A;  4M02 A;  5D6J B;  3CIR B;  4BBN C;  4DDI D;  1C77 A;  3ZVV A;  2L0T A;  1FEH A;  4HPM B;  2CS4 A;  2RSU A;  1UGJ A;  2TSS A;  2GBJ A;  4TKN A;  2I2Y A;  3H6N A;  2Z59 B;  2WLB A;  5DPW A;  3MJW A;  1F9J A;  2AWT A;  3AM9 A;  4AQ7 A;  4L23 A;  2PIA A;  2IO1 B;  2DAF A;  2N9K A;  4AJY B;  2NVU I;  3DBR I;  3AE2 B;  1MPE A;  1FFU A;  3UIP B;  4LK0 M;  4K1R B;  3VR9 B;  3VTU A;  2WNM A;  2N9X A;  4BVU C;  1TZ1 A;  3PS6 A;  2FUH B;  3NOB A;  1VD2 A;  1H8C A;  2NTS A;  1XLP A;  3VRB B;  1UNS A;  1NVI D;  2BTE A;  3PRM B;  3B2G A;  2J42 A;  2LVO A;  3HM6 X;  2PTL A;  3KW5 B;  2M56 B;  2ON8 A;  3MC8 A;  1YQ4 B;  2KX3 A;  2IDY A;  3EC8 A;  2K8C A;  2DLB A;  3B08 A;  1V1P A;  2PVG C;  3VDZ A;  4RH6 A;  3J9C A;  3BYT B;  5D3D A;  4P6V F;  2BB5 A;  2KFJ A;  2KO3 A;  3PHW B;  2L1A A;  4FUL A;  3AV8 A;  3ETR A;  3TL5 A;  3OJ4 B;  4GDK A;  3BZD B;  4YWG G;  5L83 A;  2JWU A;  5I4D A;  2M0A A;  1CK1 A;  3VUW A;  4O1N A;  4EZJ A;  3R7R A;  3IT4 B;  3L13 A;  4A3O A;  2LRW A;  3RMK C;  4MGY E;  2KQS A;  3O13 A;  3QQ8 B;  4EKU A;  4NJ6 A;  4RM8 A;  4MAC A;  5J17 A;  2B76 B;  3MJ5 A;  1F52 A;  4W9H A;  2WDV B;  1TKG A;  1EO6 A;  3BIN A;  1WGR A;  2D10 A;  3MHZ A;  4G3X B;  4HCP B;  4L2Y A;  3BVZ A;  1WI0 A;  3NRZ A;  2DYM A;  3DWG C;  1HZ6 A;  1C4P A;  1QOB A;  3HVD A;  2ZPN A;  2KZR A;  4MM3 B;  2CHX A;  1YQ3 B;  3LYY A;  4WUR A;  4C7Z A;  1QF6 A;  1OQY A;  4JWU C;  1QT9 A;  4WJQ A;  3Q8F A;  2DEN B;  1LQB A;  1GC7 A;  2QCZ A;  4NPN A;  3ALB A;  4IW0 A;  2M0X A;  5E6O A;  1E0Z A;  1V5O A;  2RGF A;  1SJH D;  3QC8 B;  1B9R A;  5JHA A;  4GDK B;  1QKZ A;  1V97 A;  2KDM A;  2FCQ A;  2KVZ A;  1PYW D;  2NCN A;  4EEW A;  1OQR A;  1HTO A;  5FR3 A;  3P1M A;  2C7H A;  1ZW7 A;  3JW0 X;  2ONQ A;  1AN8 A;  2L83 A;  4MGK E;  2BPS A;  2V1Y A;  3V6C B;  4HCN B;  1RM6 C;  4HPL B;  1CJE A;  2BYE A;  2RDH A;  4KZC A;  2M19 A;  1TY2 A;  1YD8 U;  1K50 A;  1LFD A;  5LNK 1;  1YJ1 A;  2NMQ A;  3IFW B;  3Q8B A;  1E10 A;  1D5X C;  4RF1 A;  5T8I A;  1E8W A;  1QQR A;  2IO2 B;  2D2Q A;  4IKG A;  3T3N A;  3ZJU A;  2G3Q B;  1JQ4 A;  1E7U A;  1P9D U;  2V3N A;  1L2N A;  1EM7 A;  3R2T A;  4C56 C;  2BWE S;  2WQY B;  4DHJ D;  2KJ6 A;  1VCB A;  2WXJ A;  1ET6 A;  4DHJ B;  1SGH A;  2JZ3 B;  1OQQ A;  5AEK B;  3MC9 A;  4K7S A;  2C60 A;  3V05 A;  2MW5 A;  2CU1 A;  4WJP A;  2FCM A;  1WGD A;  2R2O A;  1DOX A;  1V49 A;  3SEB A;  1MI0 A;  2KTR B;  4K7U A;  4IM2 A;  1D5Z C;  3PLV A;  2G4S A;  3QK0 A;  2W3R A;  3PZ7 A;  4M0W A;  2I1J A;  2Y3A A;  4LNO A;  3DWM A;  3V6E B;  4WAA A;  1ZGU B;  2O6V A;  1V5T A;  3ZJV A;  3LJ3 A;  1AWD A;  2Y5P A;  3DVN V;  3UIN B;  3DCG A;  2C9W B;  2N9E B;  1FFV A;  2RDB C;  1FXT B;  1XO3 A;  2PE6 B;  3MHS D;  2V0G A;  3PPA A;  2LGY A;  3VQI A;  1ZPS A;  4ANV A;  5GMV A;  3TIX A;  2MBQ A;  2N1V A;  3DHI C;  2GBK A;  4OZB A;  1LO5 D;  4I6P A;  5JHB A;  3BK1 A;  4RGM A;  2XK5 A;  5J18 A;  3P4S B;  2KWC A;  3RNB C;  5BO4 B;  2NBW B;  2MBO A;  3APC A;  4GN1 A;  3Q14 C;  4W9G A;  1TS3 A;  4US8 A;  1I4P A;  5C2T B;  1WJU A;  4ITK A;  3VH3 B;  2D11 A;  4DQO C;  4W9J A;  1GB1 A;  4CO7 A;  3BVG A;  4KKI A;  3PRP B;  4W9E A;  1OTR B;  3P63 A;  4XYC A;  2EKI A;  2IJ0 A;  3RUL A;  4JWS C;  2FCN A;  5DPT A;  2A5U A;  4PYU A;  4HRS A;  4IG7 B;  1I42 A;  3KYC D;  3SU8 X;  1EF1 A;  2JZP A;  4M0W B;  1B1Z A;  3N1Z C;  2O6V B;  4PS8 A;  3UI3 A;  4B0E A;  4DK5 A;  4EUT A;  5G2N A;  2V9H A;  1EWC A;  2DZJ A;  4UDU C;  2KMC A;  1XCQ L;  4BFR A;  1WJ4 A;  1XLO A;  3B0A A;  1I4X A;  4OHJ A;  2IGG A;  4B6W A;  4EE2 A;  3N9Y C;  5IA7 A;  1BXT A;  1GAQ B;  2XK5 B;  2WS3 B;  3AB5 A;  1R4M B;  1PGB A;  4HPP A;  1HA5 A;  1WXS A;  2UU7 A;  3L16 A;  3MC0 B;  4P16 A;  4RCO A;  1QOA A;  4FHK A;  3P4P B;  1SB3 C;  4WJO A;  3AN1 A;  1FIQ A;  2L32 A;  4DXF A;  3K9P B;  4DWF A;  1UEL A;  2KNB A;  2Z0E B;  4S0R A;  3EHV A;  3VTW A;  4C4V A;  5MPO A;  2V4I B;  3NZS A;  1UD7 A;  3APD A;  3FAH A;  1RYJ A;  1MVK A;  1MHX A;  2WDQ B;  3WAN A;  2WYQ A;  1RAX A;  1K52 A;  4E71 A;  1WR1 A;  1A70 A;  2HE7 A;  3NZ3 A;  2QDF A;  4GB9 A;  4HWI B;  3T8M A;  2K3U A;  4G0N B;  4WWO A;  3AE8 B;  3KLS X;  4GDL A;  5JXV A;  4YSY B;  2W9N A;  2LXC A;  1HXY D;  1ISN A;  5L95 C;  1XCT L;  2KQ7 A;  2X38 A;  3H9D A;  2WDR B;  2G45 B;  1BML C;  2V3P A;  3ZDT A;  1PUT A;  1ZXI A;  4TUU A;  1FNV A;  4II2 B;  4B0M A;  2Y5C A;  1L0Y B;  5FKA C;  1MJD A;  3VUY A;  3LDZ E;  3H7S A;  3IG3 A;  4MGZ E;  2O2V A;  3KYD D;  1FRR A;  3HVZ A;  2Z0D B;  3DBL I;  4OVZ A;  1E7V A;  3VVW B;  3GE8 C;  4M8N A;  4II3 B;  3TCA A;  1QIL A;  3KUZ A;  4RGT A;  1TY0 A;  1DOI A;  1ZUD 2;  2DYB A;  2M1M A;  2L05 A;  1XD3 B;  3A4R A;  1SE2 A;  4XX5 A;  4IOI E;  4ZRJ A;  1ZDX A;  3DPD A;  2HJ1 A;  5LLI A;  3O65 B;  3N20 C;  1K53 A;  3V61 A;  1F77 A;  3Q2A C;  3N3K B;  2K22 A;  4GOC A;  2C7N B;  2RD0 A;  3CSF A;  2IPK D;  3GOE A;  4GDL B;  1KTK A;  2CU3 A;  2E6X A;  2VH2 A;  3QA8 A;  2WP9 B;  2IY1 B;  2ACZ B;  2QEJ C;  3AED B;  4RNA A;  2MCN B;  2LEK A;  2Q5W D;  4FAD A;  2KDB A;  1TIF A;  1V86 A;  1GG3 A;  1P7F A;  4BKT A;  1WYW B;  1WRI A;  5KHQ A;  2MP2 A;  2VRR B;  3ZNI D;  4M00 A;  2O2V B;  1L4D B;  3HHM A;  2KTF A;  3X23 A;  4BKS D;  1HQR D;  1WYG A;  3RPF C;  2EMT A;  2X8X X;  2BW2 A;  2JU6 X;  3AE7 B;  1PGA A;  3W5U B;  4E74 A;  5CHW A;  5IKC M;  2XN9 C;  4WIP A;  4NQL B;  4FLH A;  2IGH A;  3Q3J A;  2ZNV B;  4AUQ C;  3NZU A;  2WXL A;  2PW9 A;  5EE9 A;  2V4L A;  2NBU A;  3PZ8 A;  2J4X A;  1JAL A;  2UYZ B;  4XZ4 A;  2J0M A;  2OJW A;  4RF0 A;  3ZIM A;  4H2A A;  3AE1 B;  4FJV B;  2L76 A;  3PRZ A;  3AH7 A;  1MHH E;  3ZJT A;  4X57 B;  3H7P A;  2K5P A;  1BT0 A;  1YN4 A;  2KN5 A;  4ZHO A;  5BYQ A;  2ZVN A;  1JWB D;  1FPY A;  3EGR A;  3H8H A;  2SEB D;  2K0P A;  1SIF A;  4KZ0 A;  5DPS A;  2RPQ A;  3HIZ A;  1WGK A;  2K8H A;  1E8Y A;  4M8M A;  4ZHP A;  4YT0 B;  2MP2 B;  3NVY A;  1R4N I;  2IZV B;  2ZPY A;  1Q1O A;  2K9X A;  4JQW C;  3QAQ A;  4K3B A;  1I7H A;  1RFK A;  4MM3 A;  5AZF A;  1KF6 B;  4I6N B;  1E8Z A;  2KC1 A;  1DOY A;  1N62 A;  4ANU A;  4W9F A;  5JH5 C;  2JQR B;  2YLM A;  1E8X A;  3LB8 C;  4GSW A;  1GNU A;  5HFY A;  3EFC A;  2AX5 A;  4USA A;  3DVN U;  1HTQ A;  4N58 A;  2INP E;  1KLV A;  2LZ6 A;  3L0W B;  4F1S A;  3AEA B;  1NI3 A;  2LMC A;  4ZRQ A;  3WAO A;  1WX8 A;  1WFY A;  4TSS A;  1CQV A;  4P7I A;  3ZYY X;  2GBM A;  4YXD B;  4ARC A;  1Q0W B;  3DHH C;  3V3X A;  1J0G A;  4WQO B;  2JRH A;  2BVC A;  2MA9 B;  3QJZ A;  3IAS 1;  2BF8 B;  2YEP B;  3HUI A;  3N1X C;  1C79 A;  4BOZ B;  3U4E G;  1UGM A;  3OLM D;  3B2F A;  4ZRP A;  4A3P A;  3H7P B;  3AMZ A;  2WU5 B;  3ZRC A;  1F2R C;  1N60 A;  5IO9 A;  2LUM A;  5DCN A;  3OWE B;  5D2M B;  2KFK B;  5EE0 A;  1WWT A;  4FJY A;  3U30 A;  4FHJ A;  3IT6 B;  1PFD A;  3RNG C;  3R3M A;  4US9 A;  1WXA A;  4IWP A;  1WX7 A;  2I38 A;  4OZA A;  2J52 A;  4A55 A;  2JXX A;  2YEP F;  4EFO A;  2W54 A;  2PLP A;  2FE8 A;  2MJE A;  3PRE A;  3Q6B A;  1WH3 A;  2ZCC A;  1FMA D;  3VH4 B;  3ZO5 B;  3N30 A;  2Y5B B;  2BS3 B;  2K8B A;  4LCD E;  3SD5 A;  3ECI A;  2KTR A;  1SSN A;  3W1Y A;  5AZG A;  4MJS A;  2DAJ A;  4YTN B;  1JML A;  3RNA C;  5G5G A;  3TEY A;  2N4F A;  2NTT A;  1YN5 A;  1Q10 A;  1ZOY B;  2ZW1 A;  1J8C A;  2FID A;  2JSV X;  2WU2 B;  3RYT A;  2J53 A;  1V8C A;  1HEZ E;  3IVF A;  2WXK A;  5HHD G;  4LNF A;  4J6I A;  3S2A A;  4KV2 A;  3ZW3 A;  3UGB B;  1TJE A;  3DVG X;  3QX1 A;  2KAJ A;  2PVO D;  3BWU D;  4C00 A;  4S17 A;  3UQA A;  3ONS A;  4XDC A;  2MX2 A;  1NEN B;  2ZNV C;  3VRA B;  3VFK A;  4WWP A;  1JWM D;  2EEL A;  2D5G A;  2DBY A;  4M01 A;  1C9F A;  4PS3 A;  1CZP A;  1R7S A;  1KJT A;  1V80 A;  4BOS C;  3C8Y A;  3M95 A;  1QZE A;  1MFW A;  2JZZ A;  2XNA C;  3C19 A;  3IBE A;  1PGX A;  3I63 C;  2XEW A;  4LNN A;  2WXR A;  3R7Q A;  4LJP B;  2NR2 A;  1P3Q U;  4LJO B;  3PO0 A;  1S1Q B;  3Q3F A;  4TQ1 A;  2LGD A;  4MJS B;  4AOF A;  4RGO S;  3NVZ A;  1WR6 E;  3UF8 A;  5BYS A;  1XLN A;  2KVR A;  1XT9 B;  2KAC A;  5FK9 C;  3P4Q B;  4JGH B;  3AEG B;  2W55 A;  2J0K A;  2IYD B;  4JE3 B;  4GLS C;  1SBB B;  4ICV A;  4N59 A;  1OEY A;  1EU3 A;  5LXH A;  2CJN A;  3TSS A;  4F7Z A;  1KM7 A;  1I4Q A;  4EZL A;  2N1W A;  3I3T B;  2ZJD A;  4RGN A;  2K6Q A;  2AL6 A;  2DWQ A;  4GIV A;  4HLE A;  2KQ4 X;  5CX3 A;  5D7G A;  5CHF A;  3A9K B;  2R2Q A;  1FD6 A;  2PMV A;  1JW9 D;  5TSS A;  4IC7 B;  4IUM B;  2LXA A;  4PS7 A;  1UBI A;  1OEY J;  1NDD A;  4DDG D;  2H88 B;  4EZK A;  3KH0 A;  3ZLZ A;  2WXM A;  3A4S C;  5BMH A;  3ZKJ C;  4KSL C;  2AQ1 B;  2BBC A;  2LUE A;  2MHJ A;  2K6D B;  2FIF A;  1SE4 A;  2L3Z A;  2LWP A;  1N6Z A;  2MJ3 A;  3L08 A;  4MH0 E;  1GJZ A;  1HE8 A;  1WF9 A;  3U7D A;  3ZRF A;  2WGS A;  2KWD A;  3DHG C;  3B9J A;  4ACF A;  4NZL B;  4GU2 A;  1N61 A;  3BII D;  4ANW A;  1ZE3 D;  3KWV A;  1YNT E;  2JVC A;  4NQK E;  4AWJ A;  2MSE D;  2WXQ A;  4LDT D;  2N9P C;  2JRI B;  1TGZ B;  4LDT B;  4ANX A;  2MBH A;  2ZW0 A;  2LGX A;  4NJC A;  2INC C;  2KX0 A;  2M8S A;  3DBS A; 
#chains in the Genus database with same CATH homology
 3PGE A;  3AU4 A;  2KX3 A;  3N3K B;  1V6E A;  4GOC A;  3ZUN A;  2KAN A;  4FBJ B;  2C7N B;  3EC8 A;  2K8C A;  3B08 A;  1IPG A;  2KLG A;  3B1L X;  2RD0 A;  3VDZ A;  4MEM A;  3CSF A;  4KIK B;  3RT3 B;  3U8Z A;  2KFJ A;  5EDS A;  3SHQ A;  2DYO A;  3M3J A;  2K1F A;  2IY0 B;  3GOE A;  1UZX B;  2KO3 A;  4GDL B;  1Z5S B;  3PHW B;  3QA8 A;  4FUL A;  1X1M A;  3TL5 A;  1C3T A;  2IY1 B;  3C0R B;  2CKH B;  3KVF B;  3OJ4 B;  4GDK A;  5L83 A;  2BKF A;  2MCN B;  3PVL A;  1C1Y B;  2WDT B;  3PTF C;  4CYE A;  4FAD A;  1Z2M A;  2KDB A;  2FNJ B;  2MLB A;  3UIO B;  3VUW A;  1V86 A;  3PHX B;  4EZJ A;  4DHZ B;  1GG3 A;  3R7R A;  2XBB C;  4PYZ A;  3TBL D;  4W9D A;  3L13 A;  3DBH I;  1WYW B;  2L00 B;  4G11 A;  4BKT A;  4A3O A;  1R4M I;  2D3G A;  2RR9 A;  5KHQ A;  2MP2 A;  3PV1 A;  2LRW A;  4N9F 4;  1WZ3 A;  1E5W A;  2JUO A;  3K9O B;  2VRR B;  3ZNI D;  4K7W A;  4MGY E;  2MQJ A;  2J0J A;  3NHE B;  4GGQ A;  2O2V B;  4MEL A;  1UBQ A;  2KQS A;  3HHM A;  2KTF A;  3X23 A;  4BKS D;  3QQ8 B;  4EKU A;  2EMT A;  4NJ6 A;  4RM8 A;  2JY6 A;  5J17 A;  2MBB B;  1SE9 A;  2L7R A;  2LI5 A;  4W9H A;  4W9I A;  5D94 A;  4E74 A;  4DBG A;  1EO6 A;  2WX1 A;  5CHW A;  1L7Y A;  3BIN A;  1WJN A;  2NPT A;  4DXA B;  2L0F A;  1WGR A;  2D10 A;  4G3X B;  4GXB A;  4HCP B;  1WI0 A;  2CHW A;  2DYM A;  2IO3 B;  2ZVO A;  4RMA A;  1V81 A;  4NQL B;  2MBE A;  2DZM A;  1WXM A;  5DPR A;  4BKG A;  5HKH A;  3ZNG C;  4FLH A;  2ZPN A;  2KZR A;  1XQQ A;  3Q3J A;  2CHX A;  2G4D B;  2ZNV B;  3N32 A;  4AUQ C;  3NZU A;  2V4L A;  2NBU A;  3PT2 B;  4JL9 A;  3ENE A;  4DHZ E;  4FA6 A;  1WX9 A;  1OQY A;  2UYZ B;  4XZ4 A;  2V3S A;  3NS8 A;  2J0M A;  2KOX A;  3QIJ A;  4WJQ A;  3M63 B;  3CST A;  3KUC B;  3ZIM A;  2DEN B;  1LQB A;  1E90 A;  2BYV E;  1GC7 A;  1WGY A;  5LXI B;  1I35 A;  4E3C A;  3RZF A;  4FJV B;  2L76 A;  4NPN A;  3ALB A;  1AAR A;  2M4N A;  3KUD B;  3PRZ A;  4IW0 A;  2M0X A;  1PQS A;  5E6O A;  1V5O A;  2RGF A;  3OAW A;  3H7P A;  4X57 B;  3QC8 B;  1BT0 A;  5JHA A;  4GDK B;  2KN5 A;  4G50 A;  4JIO U;  2ZVN A;  2KJR A;  5CHV C;  4HXD A;  2FCQ A;  4BKS A;  1KOT A;  2NCN A;  4EEW A;  2DX5 B;  1SIF A;  4KZ0 A;  2HD5 B;  5DPS A;  2RPQ A;  2C7H A;  3HIZ A;  4URK A;  1WXV A;  1ZW7 A;  2K8H A;  1V9J A;  3JW0 X;  5C23 A;  3V62 A;  1E8Y A;  4M8M A;  3ZDM C;  4MGK E;  3WA0 A;  1NBF C;  1ZKH A;  2MP2 B;  2BPS A;  2V1Y A;  3V6C B;  1R4N I;  2IZV B;  4HCN B;  4HPL B;  2ZPY A;  4RM9 A;  1Q1O A;  3JSV A;  4JQW C;  2BYE A;  2KD0 A;  4KZC A;  3QAQ A;  3QCA A;  1RLF A;  2O6V D;  3L54 A;  4MM3 A;  5AZF A;  3AU5 A;  4I6N B;  1YD8 U;  5IAA C;  1E8Z A;  3R66 C;  2KC1 A;  4KVG B;  4WWN A;  4WJN A;  2KHW B;  1LFD A;  4NY0 A;  4W9C A;  3WIM A;  4ANU A;  4W9F A;  5JH5 C;  1YJ1 A;  3IFW B;  3DQV A;  2YLM A;  1WGH A;  2DZK A;  3CMM B;  1E8W A;  1E8X A;  2WX0 A;  1T0Y A;  2IO2 B;  4GSW A;  1GNU A;  2D2Q A;  2NPT B;  1EUV B;  2G3Q B;  2KK8 A;  3DVN U;  3VHT C;  1E7U A;  4FJZ A;  1P9D U;  1L2N A;  3RCZ A;  3QHT A;  2OJR A;  2LZ6 A;  3L0W B;  4F1S A;  1LM8 B;  1KLV A;  4HDO A;  4MDK E;  2GOW A;  2PJH A;  2BWE S;  3WAO A;  1WX8 A;  4DHJ D;  1WFY A;  4ASW C;  2KJ6 A;  1VCB A;  4B95 A;  2REX A;  4DHJ B;  4P7I A;  4B9K A;  1SGH A;  2JZ3 B;  3M62 B;  2GBM A;  2N7D A;  1Q0W B;  5AEK B;  1J0G A;  4WQO B;  4K7S A;  2JRH A;  5CTR C;  2C60 A;  2LD9 A;  3BY4 B;  2MA9 B;  3QJZ A;  2MW5 A;  2BF8 B;  2CU1 A;  4WJP A;  2FCM A;  1WGD A;  2R2O A;  1TTN A;  1V49 A;  2KTR B;  4K7U A;  4IM2 A;  1RFA A;  3PLV A;  4BOZ B;  2G4S A;  3T9L A;  1UGM A;  3OLM D;  3QK0 A;  5E6N A;  5TR5 A;  1WJ6 A;  3OJ3 A;  4HK2 A;  4ZDV A;  4A3P A;  3H7P B;  2I1J A;  5AZH A;  3V6E B;  4WAA A;  1ZGU B;  2O6V A;  1V5T A;  3ZRC A;  3LJ3 A;  3H1U A;  3DOW A;  3DVN V;  2EMS A;  4YL8 A;  3UIN B;  3DCG A;  5DCN A;  2C9W B;  1V2Y A;  2K25 A;  2N9E B;  5D2M B;  2FAZ A;  2KFK B;  1FXT B;  2LVP A;  3A9J A;  3QAR A;  2NS5 A;  3ZTD A;  2PE6 B;  4IM0 A;  4FJY A;  3MHS D;  3U30 A;  2LAS A;  2MRP A;  3PPA A;  2LGY A;  1U4A A;  1WMH A;  2GBN A;  4ZRI A;  4FHJ A;  3VQI A;  5KHO A;  4ANV A;  5GMV A;  2EKE C;  5G55 A;  3R3M A;  2I1K A;  3JSV B;  3D32 A;  3QWZ B;  4NAW A;  1WXA A;  4IWP A;  1UH6 A;  1WX7 A;  1WY8 A;  3TIX A;  4A20 A;  5C1Z A;  2MBQ A;  2N1V A;  2CR5 A;  2GBK A;  4OVU A;  2JXX A;  2MWS B;  4I6P A;  5JHB A;  1WIA A;  2LJ5 A;  4EFO A;  1IP9 A;  3RD2 A;  2XK5 A;  4BBN F;  1A5R A;  1YX6 B;  5J18 A;  3PRE A;  1WH3 A;  2KWC A;  2ZCC A;  5BO4 B;  3VH4 B;  3ZO5 B;  2LVQ A;  1P98 A;  2FCS A;  4MGI E;  2NBW B;  2Y5B B;  3JYU A;  2K8B A;  3N30 A;  2K39 A;  3P2B A;  4LCD E;  3SD5 A;  3ECI A;  2OOB B;  2MBO A;  3APC A;  4GN1 A;  4W9G A;  1K8R B;  2ZCB A;  3TJP A;  2KTR A;  2KDI A;  1WJU A;  3W1Y A;  5AZG A;  4EOY A;  4MJS A;  2QHO A;  3VH3 B;  2D11 A;  2DAJ A;  2AL3 A;  2A4Z A;  2C7M B;  4W9J A;  2N4F A;  1M94 A;  3VUX A;  1GC6 A;  4CO7 A;  4TV3 A;  2IBI B;  3PRP B;  2PEA A;  4MSQ B;  4W9E A;  1OTR B;  1NI2 A;  4NJ7 A;  1J8C A;  2FID A;  2KMA A;  3EFU A;  3WAL A;  2KFK A;  3RUL A;  3RYT A;  3W1S A;  3VXW A;  3DDC B;  2FCN A;  3JVZ X;  5DPT A;  2JT4 B;  3IVF A;  2A5U A;  5J2R A;  4PYU A;  4AP4 C;  4J6I A;  3S2A A;  4IG7 B;  4GMV A;  2LRU A;  4KV2 A;  3ZW3 A;  3DVG Y;  3UGB B;  5JZE B;  1I42 A;  2JPH A;  2AYO B;  3DVG X;  2JWZ A;  2KLC A;  1G6J A;  3KYC D;  3SU8 X;  2C5L C;  1EF1 A;  3QX1 A;  3ZTC A;  2PPH A;  4M0W B;  4OVV A;  2O6V B;  4PS8 A;  3PLU A;  3SDL C;  4DK5 A;  4EUT A;  1P0R A;  3ONS A;  3UQA A;  5G2N A;  1LXD A;  2IO0 B;  2KC2 A;  2KXJ A;  2MX2 A;  2DZI A;  2ZNV C;  4WWP A;  3VFK A;  2DZJ A;  3PZD A;  1WRD B;  2CHZ A;  2JF5 A;  3A9J B;  2KMC A;  3HK0 A;  1CMX B;  2D07 B;  3V60 A;  4KDL B;  2J7Q B;  4BFR A;  4PS3 A;  1WJ4 A;  1WMH B;  2YVC A;  3VAW A;  3L17 A;  3B0A A;  1KJT A;  1V80 A;  4IWO A;  4BOS C;  3M95 A;  1QZE A;  2JZZ A;  4NAW B;  4B6W A;  3ML8 A;  1RRB A;  3IBE A;  2UWQ A;  5IA7 A;  2XEW A;  3AXC A;  3APF A;  4JLC A;  3R7Q A;  2XK5 B;  4LJP B;  3ZNZ B;  2NR2 A;  1P3Q U;  2PE9 A;  4LJO B;  1Y8R C;  1S1Q B;  3Q3F A;  3WAM A;  4W9K A;  1WXS A;  2ZZP B;  4TQ1 A;  3L16 A;  2LGD A;  2HTH A;  1IYF A;  2N7E A;  3GZN I;  4FHK A;  4MJS B;  1D3Z A;  2WWZ A;  1MG8 A;  2HJ8 A;  4AOF A;  3A1Q A;  4WJO A;  1WM3 A;  1P1A A;  4ICU A;  1WR6 E;  1GUA B;  3TMP B;  3UF8 A;  2GBR A;  2KVR A;  2KJH B;  3K9P B;  1XT9 B;  3AI5 A;  4DWF A;  3PSE B;  4JGH B;  4HVB A;  1UEL A;  1Q5W B;  2KNB A;  2Z0E B;  4TQ0 A;  2J0K A;  3EHV A;  3VTW A;  2IYD B;  1WE6 A;  3NZS A;  2NBV B;  4ICV A;  1OEY A;  1UD7 A;  3APD A;  4IM3 A;  1YIW A;  4W9L A;  3WAP A;  1OGW A;  3ZNH B;  5LXH A;  4F7Z A;  3VTV A;  1KM7 A;  3WAN A;  1WZ0 A;  2WYQ A;  4FN2 A;  2KKC A;  1RAX A;  4EZL A;  3UQB A;  4E71 A;  1WR1 A;  3A33 B;  3NY5 A;  2B3A A;  2N1W A;  2DHZ A;  3MTN B;  3I3T B;  1WGG A;  4KSK C;  2ZJD A;  2HE7 A;  2KDE B;  2K6Q A;  2AL6 A;  3EEC A;  3IHP C;  1EF5 A;  4GIV A;  3X0W A;  4HJK A;  4HLE A;  4GB9 A;  2L8J A;  5CX3 A;  5D7G A;  4KIK A;  1WM2 A;  4HWI B;  3T8M A;  2ZEQ A;  5CHF A;  3A9K B;  4G0N B;  4WWO A;  2R2Q A;  4GDL A;  5E6P A;  4K81 A;  1YQB A;  4F8C B;  2W9N A;  2KWU B;  2LXC A;  5D6J B;  1ISN A;  4IC7 B;  5L95 C;  4BBN C;  4DDI D;  4IUM B;  2KQ7 A;  2LXA A;  3ZVV A;  4IWQ A;  4PS7 A;  3H9D A;  2L0T A;  1UBI A;  3HM3 A;  4HPM B;  4CHK A;  1OEY J;  2G45 B;  2CS4 A;  1NDD A;  2RSU A;  3ZDT A;  4DDG D;  2KWV B;  4TUU A;  1YX5 B;  4EZK A;  3CF6 E;  2GBJ A;  2BYF A;  3KH0 A;  4TKN A;  4XC2 A;  3ZLZ A;  3H6N A;  4II2 B;  2AEH A;  2Z59 B;  3A4S C;  4NNJ B;  3ZKJ C;  4KSL C;  1WE7 A;  3AUL A;  2LUE A;  2K6D B;  2FIF A;  3L10 B;  5DPW A;  4ZRK A;  3MJW A;  1F9J A;  2AWT A;  2L3Z A;  3LDZ E;  2LWP A;  3VUY A;  3H7S A;  3W1S C;  3IG3 A;  4AJW A;  4MGZ E;  2O2V A;  2IO1 B;  3KYD D;  3L08 A;  4MH0 E;  2DAF A;  1GJZ A;  4AJY B;  3A1Q B;  1HE8 A;  1WF9 A;  2NVU I;  3DBR I;  3U7D A;  3UIP B;  3ZRF A;  4K1R B;  1TBE A;  2Z0D B;  3DBL I;  3RUI B;  3VTU A;  2N9X A;  4BVU C;  1E7V A;  3VVW B;  2BGF A;  4M8N A;  4II3 B;  2M17 A;  1TZ1 A;  3PS6 A;  3TCA A;  3KUZ A;  4GU2 A;  2FUH B;  2KDF B;  4MSM B;  3NOB A;  1VD2 A;  4ANW A;  1H8C A;  3ML9 A;  2JVC A;  4NQK E;  4AWJ A;  2DYB A;  2M1M A;  2L05 A;  3A9K A;  2MSE D;  1S3S G;  4LDT D;  1XD3 B;  2N9P C;  1H4R A;  2ASQ A;  1TGZ B;  2JRI B;  3A4R A;  4XX5 A;  4HDQ A;  4LDT B;  3PRM B;  4ANX A;  2BWF A;  2MBH A;  4ZRJ A;  5FR6 A;  3RZW C;  2GMI C;  3DPD A;  2LGX A;  2LVO A;  5LLI A;  3HM6 X;  3O65 B;  4ZYN A;  4I6L B;  1J19 A;  2KX0 A;  2M8S A;  1JRU A;  3DBS A;  3KW5 B;  3V61 A;  4KDI C;  2BKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...