1MHHE

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 18
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhhE00
1GB4A 1IGCA 1FD6A 4HJGE 1F2RC 1MI0A 2J53A 2PTLA 2JXTA 2N9LA 4HKZE 4OZBA 5BMIA 5HFYA 4MACA 2EELA 2N7JA 5HG2A 1MHXA 2QSDA 1QKZA 2J52A 2KQ4X 1PGXA 2QMTA 2KWDA 3UI3A 2ON8A 1JMLA 2JSVX 1XCTL 3FILB 2KN4A 2IGHA 2PLPA 1HZ5A 2ZW1A 1MVKA 1PGBA 4KGTA 1K53A 2I38A 2GB1A 1UWXA 2LHDA 4GLSC 5BMHA 4IKGA 2ONQA 2IGGA 4WH4A 1IGDA 3GB1A 2N9KA 1P7EA 4KGRA 1EM7A 1IBXB 2GI9A 1ZXHA 2KDMA 1P7FA 1F2RI 1XF5L 3V3XA 3FILA 4KGSA 4IOIE 4OZAA 1FCLA 1C9FA 2IGDA 2KACA 2JU6X 1XCQL 2OEDA 1K51A 1PGAA 1GB1A 2PW9A 2RPVA 4OZCA 5HHDG 1KH0A 2LUMA 1K52A 3MP9A 2I2YA 1MHHE 4D2KA 1HEZE 1Q10A 1IBXA 2K0PA 2LHEA 2JZPA 1FCCC 2RMMA 2JWUA 1MPEA 1YNTE 1K50A 2NMQA 5HI1A 1D4BA 5JXVA 1HZ6A 1YMHE 5BMGA 2LGIA 2ZW0A
chains in the Genus database with same CATH superfamily
4W9EA 1DOXA 1TGZB 1VZ7A 3RNFC 1P1AA 2DZMA 3PO0A 1TT5B 2K8CA 2JF5A 4XWWA 3RI7C 1WXMA 3DOWA 3BVGA 3ML8A 2L05A 2N9LA 2DAJA 4HKZE 2EELA 2XN9C 2R2OA 2JZ3B 1H4RA 3ALBA 2GOWA 1WZ3A 2WHIA 2KTFA 4DQOC 4LNOA 4IW0A 4URKA 2OOBB 5E6OA 3SFDB 3T3NA 4JE3B 2IY0B 4ZDVA 2KN4A 3PZ7A 1KF6B 2BQQA 1D5MC 1BUIC 1K53A 3DBHB 1V8CA 4GB9A 2JWZA 3A4RA 3UINB 2WXOA 5D3DA 2J7QB 3TCAA 1AW7A 3ZGZA 1OEYA 1L6UA 4PT5A 4W9IA 3PVLA 3KUZA 2KDMA 5L95C 1QOFA 4O1NA 2NBWB 3U52E 2IDYA 4TV3A 1C9FA 4JLCA 3AB5A 3RYTA 4P16A 1V1PB 5GMVA 3Q8CA 1K51A 3RNAC 4LJPB 1XLQA 1FO4A 2WXMA 1D3ZA 5D94A 1HEZE 3JSVB 2L00B 3FAHA 3UF8A 5G5HA 1L0YB 1F52A 3AEGB 4WIPA 1FIQA 3A33B 4M0WA 3KLSX 1RRBA 2SAKA 4GU2A 1YD8U 4W9FA 5C2TB 3WAMA 4C56C 2K39A 3AM9A 1IGCA 1F1HA 4WURA 1F2RC 3L10B 3DBSA 1PQSA 2JXTA 1WE7A 3E56A 5HFYA 1ZP0B 3PS6A 1SBBB 3DCGA 4US8A 1HTOA 4MGZE 2BWFA 3SU8X 2ON8A 2VZKD 2INPE 1V5OA 2N4FA 2CJOA 2NR2A 3Q8FA 4WWNA 3ZDTA 5CHWA 5EDSA 2L3ZA 1RM6C 2CR5A 4RMAA 2V9HA 2KJ6A 3P63A 5C1ZA 1YJ1A 2B3AA 3DBHI 4HK2A 5J17A 4TQ1A 5LNK1 1VD2A 2RDHA 3TEWA 3Q3JA 2Q5WD 2LVPA 3NVWA 4GXBA 1UWMA 4DXAB 4RGOS 4W9CA 4FADA 2KC1A 2KTRB 1U4AA 2K9XA 2IBIB 4AJWA 3V3XA 4R3DA 1WX8A 3RNGC 1VJKA 2MW5A 3A9KA 4P7IA 3CSFA 2GBNA 3KYDD 3DHHC 1Y8RC 2PEAA 3PRPB 4WAFA 2RPVA 3MP9A 5AZGA 4LLGM 3SHQA 1FFUA 4HDOA 4B0EA 2WXKA 4TSSA 1Q10A 4K81A 3DVNV 4HROA 4HCNB 1QOBA 3L13A 2GBMA 1EU3A 1YNTE 1AN8A 3OJ3A 2ZNVB 3NHEB 3M95A 3W9CB 2O2VB 2KFKA 3VRBB 4MSMB 2LGIA 1IUEA 1GB4A 1HTQA 3SD5A 4K7SA 5MPOA 3R66C 3URYA 1LQBA 3N30A 1EO6A 4LK0M 4ZYSA 1QT9A 4MT5A 1YN4A 4Q2JA 1ISNA 4EUTA 4YSXB 4C80A 3PHXB 3I63C 1JMLA 3EECA 2W55A 2V4LA 2V3SA 3ZJVA 1C76A 3PZDA 4AWJA 4WWOA 3MJ5A 3DBLI 3QWZB 2MBBB 4YT0B 1FMAD 4X57B 4ASWC 2DZJA 3ETRA 1STEA 4IKGA 1QQRA 3TEZA 3ZLZA 1V2YA 3VXWA 4FLHA 4W9GA 1E10A 3JVZX 2WXHA 1OFFA 2NVUI 2WXPA 2OJWA 3MC9A 4ARCA 1WR1A 4LJOB 2FCQA 2LUEA 1P3QU 3TSSA 2PJHA 3MTNB 3AV8A 3ML9A 2KDBA 3B2GA 4A55A 3MC0B 3A1QA 3N1ZC 1UH6A 2GBJA 1LXDA 1JRPA 2M0AA 2PW9A 2WXQA 3V05A 5HHDG 1WYGA 1KJTA 3N1YC 3L17A 2MP2A 1BMLC 3H8HA 4RM8A 1RFKA 2KMMA 1PUTA 3A9JB 3AEEB 1J7CA 1FCCC 4WWMA 1CJEA 1TYGB 3DVGX 2WGSA 1FNVA 2PKOA 2E3TA 4IWQA 2NMQA 1GG3A 1QOGA 3T3OA 1R4NB 2KX3A 5DPRA 3WAOA 3BVZA 4DXGA 2QCZA 1FD6A 1V80A 1NEKB 2LASA 4MEMA 1XT9B 1PYWD 2RDGA 1WY8A 4JQWC 5E6NA 4ZRKA 3R3MA 4CO7A 3U8ZA 4ZRQA 1IP9A 1ET9A 3LB8C 2AL6A 1JALA 1JCKB 5CTRC 3V60A 4BVUC 1V97A 1SEBD 2ICIA 4WAAA 3VAWA 4BZAA 4RFBA 4EZJA 2ZW1A 4ZOHC 4LDTD 1TY0A 2WX0A 2ZVOA 3EFCA 4ICUA 2XBBC 4HJKA 1T0QC 2KT7A 3IAS1 1GJZA 1J7AA 1N5XA 2ONQA 4GIVA 2AQ1B 3AI5A 2BKFA 3C8YA 2GBRA 1ZXHA 2KZRA 2DYMA 3ZRCA 1EWCA 3Q8BA 1RAXA 4OZAA 3RULA 3Q2AC 2J4XA 2W3SA 3VFKA 4CYEA 1ZUD2 3D32A 4K7WA 1L0XB 1DYQA 1NI3A 1E9MA 2CHXA 1YJIA 2LRWA 3AE9B 2AWTA 3AN1A 3TEYA 3UQBA 1WM3A 1ACCA 1I7HA 3EHVA 3L08A 2O6VD 2YEPF 3TIXA 2JUOA 4HXDA 2KXJA 4B95A 3HM3A 2EMTA 2MQJA 3L0WB 3PHWB 1I4RA 2D3CA 5JXVA 2BPSA 2M1MA 1WX9A 1ROEA 1WZ0A 4PYUA 4XDDA 1R4NI 2VH2A 4AS1A 2BKRB 2MBQA 5D2MB 1TS3A 2H88B 5IN7A 4EOYA 5BMIA 3BWUD 3CF6E 2AQ3B 3HVZA 1WMHB 4RCOA 3NVVA 3RZWC 3DPDA 2O6VB 3GS2A 3CSTA 1JWMD 2DYBA 1QILA 2ZPNA 1N5WA 2BF8B 2M0XA 3VH3B 4DDGD 2VRRB 3AE1B 1T0SC 5KHQA 2G9HD 2I38A 3IT4B 5J2RA 3H6NA 2GB1A 4GLSC 3JW0X 2QDFA 3ONSA 2WNMA 3VTUA 2KDIA 2MA9B 3APCA 1TS5A 1EM7A 2IO0B 2WYQA 3L54A 1IBXB 5C23A 2NS5A 1GC6A 2DX5B 4A20A 1L5PA 2AEHA 2G45B 2BW2A 2NBUA 3NJTA 3ZNID 2W3RA 2LRUA 4REZA 4BBNC 2MSED 3WIMA 2FCMA 3MJWA 1PFDA 1V6EA 4TKNA 1XLOA 4IC7B 3UIPB 1V1PA 5CX3A 3APFA 5TR5A 3I9V1 4HDQA 4C7YA 4C4VB 2AL3A 2N0SB 2LFIA 5E6JA 3S2AA 2K0PA 3JSVA 4G0NB 3LDZE 3BVMA 3MFGA 4MM3A 2JYEA 2KK8A 3H7PB 5LXIB 1AWDA 4GSWA 1K50A 3AXCA 1S3SG 3QX1A 3VRAB 4MH8A 5JH5C 3M3JA 3IT6B 3V62A 2GMIC 2L52A 3ZNGC 2BS4B 4KV2A 2LZ6A 3T8MA 4NAMA 3L16A 1TS2A 1YN3A 4BFRA 1TBEA 1OQRA 4N58A 4EZKA 4WQOB 3UI3A 2K22A 2N7EA 1XLPA 4YL8A 1EWYC 2CU3A 3HM6X 1JWUD 1JWAD 4I6PA 4K3BA 4N9F4 4HPLB 4KGTA 3QA8A 4RF1A 5G55A 2FCSA 2LXCA 2KDFB 3W2DA 1C4PA 4AUQC 5BMHA 2MEKA 1I4QA 2PE6B 2IO1B 1N63A 2DNFA 3AE7B 4ANXA 1RLFA 2BS3B 1D6EC 1WGHA 2K6DB 2I1KA 4XX5A 2KTRA 3OWEB 3PZ8A 4P6VF 4KVGB 1CMXB 3DWMA 3QK0A 1V86A 4KIKB 3HIZA 1TKGA 1V49A 1ZDXA 2INDC 3ZVVA 2K3UA 2N1WA 2FAZA 1K52A 1T0YA 1ZOYB 1MHHE 4TMAB 5BYQA 1WI0A 2DHZA 3AE8B 5KHOA 2BYVE 4E71A 3ZUNA 2CHZA 2L0FA 5IKCM 2WDVB 5GXGB 1VCBA 4ARIA 4NY0A 1FEHA 1NI2A 2MLBA 2HJ1A 2KVZA 2O2VA 1NENB 4DDID 2M17A 3IFWB 2GBKA 2HD5B 5L83A 1WJUA 4I6LB 2K6QA 1ZPSA 3NUHB 1ZGUB 3MC8A 2J52A 1SJED 5FK9C 2D07B 4KSLC 2M8SA 2KD0A 1UGMA 4G3XB 1FXAA 5CHFA 1E90A 2HTME 2WQYB 3TBLD 4BKSA 1XCTL 3WAPA 1UZXB 2PVGC 3BINA 3NS1A 4MGIE 3VH4B 1SE9A 4EE2A 2VH1A 1FXTB 4DWFA 3HK0A 2RDBC 5DPWA 4XWTA 1HE8A 1SJHD 3ZRFA 1KOTA 5JHBA 1MJDA 1F77A 1RFAA 3H7SA 1ZDVA 5EE3A 3FILA 5AEKB 2LJ5A 1S1QB 1WXQA 3U4EG 4IG7B 4ANWA 2MHJA 3ZIMA 2WLBA 4OZCA 1WJ4A 1SIJA 4GDLB 3P4SB 3WA0A 4JL9A 4D2KA 3Q3FA 3QIJA 4EKUA 1VDVA 2VZKB 1WJ6A 1LM8B 4IM3A 1DGJA 3KH0A 2JZPA 2BVCA 4J3OD 2QC8A 3B2FA 3A9JA 2AQ2B 3X0WA 4KSKC 3Q3NC 5HI1A 2DLBA 4EFOA 1YMHE 4CQNA 3MHSD 4XE0A 4EEWA 2CS4A 2LMCA 2REXA 2KFJA 4KKJA 2D11A 3MHZA 5FR3A 1T0RC 2J53A 3Q8EA 1JQ4A 3V61A 1WFYA 3UQAA 3AH7A 1WGKA 1HA5A 4AJYB 1Q1OA 2C7MB 5DPSA 3RUIB 1EUVB 2R2QA 4BKSD 3W5UB 1TY2A 3QAQA 2DBYA 2BWES 2WU2B 2J42A 3PV1A 2HE7A 3P42A 4A3OA 2NTSA 4L23A 3CMMB 1GNUA 2J0JA 1P7FA 1L6VA 4NNJB 1PDXA 2XNAC 1BXTA 2PE9A 4NQLB 4K1RB 4IOIE 4DHJD 2KQSA 4FJZA 1TZ1A 1PGAA 2QEJC 1WF9A 3DDCB 2ZJDA 2D3GA 2I2YA 3ZJUA 2DWQA 1SE2A 2KC2A 3P4QB 2Z59B 2IO3B 4E3CA 1L4ZB 1WE6A 1J0GA 3EUB2 1M94A 5G5GA 2WDTB 3N32A 1B1ZA 3IHPC 3HHMA 2KMCA 1J8CA 2JXXA 4DHJB 5EE0A 4XZ4A 3UIOB 1L2NA 4FULA 3RMKC 3HVDA 5AZHA 5HKHA 1WRDB 3R2TA 4FBJB 3C0RB 2KO3A 1XQQA 3KQ4A 1YX6B 4YTMB 3OG5A 3NY5A 2Z0DB 4PS8A 1WMHA 2UYZB 4HPPA 3HUIA 3BZDB 2A5UA 3VDZA 5DPTA 3B0AA 4II2B 2LEKA 2QHOA 3N1XC 1VRAB 2WXLA 3QJZA 4PS3A 4BBNF 1UBQA 4JWUC 3AE6B 1Q5WB 1UWXA 4GN1A 1A70A 4L2YA 2CHWA 2KJHB 3RCZA 3RNCC 4KGRA 3T9LA 5I4DA 2LVQA 2MBHA 3NZ3A 1RYJA 3ECIA 3ZO5B 2JRHA 2KAJA 2AYOB 4H2AA 3R8BA 2YEPB 1LGRA 3GE3C 3AECB 2DZIA 2BGFA 5BYSA 3AEBB 4FXCA 3DVGY 3TL5A 3AU4A 2KFKB 1G6JA 3ZXVA 1TTNA 2TSSA 4PK1A 5IP4D 3IVFA 3IXSA 4NJ6A 3H9DA 4XC2A 4IUMB 4UDUC 2INCC 2FIDA 4C4VA 1Q0WB 1KLGD 2RGFA 1R4MB 4YTPB 2IZVB 4IM0A 3LYYA 3AEDB 4LDTB 4LNIA 4II3B 3Q69A 2C9WB 3QARA 1KRHA 4P1BC 2N1VA 3AU5A 2WXNA 4CHKA 1VZ6A 1MI0A 3HRDD 5D7GA 2ZVNA 2QJLA 4FHKA 3RNBC 3PRMB 4MACA 4K3CA 2MJDA 4NZLB 2JYTA 1K8RB 4NAWA 3DWGC 4JPSA 1XEEA 3DHIC 2ZCCA 4A8XC 3R7QA 4KX6B 5IA7A 3Q8AA 2BB5A 2KKCA 2W9NA 4MSQB 1YOVB 2KJRA 2IGHA 3WCQA 1HZ5A 2L76A 4KDIC 2V3NA 2J0KA 1KLVA 2H89B 2UWQA 2KHWB 1WGYA 1KTKA 4AP4C 2NPTB 1E7UA 3GP7A 3PGEA 5LLIA 2HTHA 4MGYE 1WWTA 1I4XA 4M02A 1MFWA 2ZNVC 3NVYA 1EF5A 3BYTB 2MCNB 1L7YA 4A3PA 3QCAA 2NCNA 1OTRB 4E74A 2CJNA 2D3AA 1IYFA 1XCQL 1NVID 2EKIA 4MGKE 2V3PA 2BYTA 2NBVB 4NPNA 2C5LC 4RGMA 1WJNA 4WJNA 4GGQA 1SF0A 3O13A 4HCPB 2IY1B 3RD2A 4B9KA 5H92C 3U30A 1WGDA 1R4MI 2G4SA 3J9CA 2K25A 2Y5BB 1HZ6A 1DOIA 2KLGA 2MH7A 1C4AA 2LGDA 4YWGG 3KW5B 4LNKA 2K8HA 1LO5D 2MJ3A 2IJ0A 3U7DA 2N7JA 1C77A 3NZUA 2QSDA 3AMZA 1E8XA 3APDA 4QAYA 1WXAA 4OW0A 2QMTA 1NYRA 1N62A 2WDRB 2LGYA 1R7SA 4OHJA 1WRIA 1WR6E 3GZNB 3PSEB 3WANA 2ZPYA 2LHDA 2IGGA 4DBGA 2XK5B 3ZTCA 1I42A 3I57A 2Y3AA 2M4NA 3P4PB 3Q14C 1F2RI 4RGTA 4FA6A 2C7HA 5AZFA 3ZNHB 2Z8LA 2Y5CA 4HWIB 3VUWA 3E9SA 1JWBD 3ZXRA 2LGSA 2NTTA 4GDKB 4ITKA 1T3QA 1X1MA 3P1MA 5T8IA 1SXTA 2WS3B 3VUXA 2OJRA 2LUMA 4G50A 1TKEA 5D3IB 3SDLC 2CU1A 4GDLA 3SR6A 1ZKHA 3IBEA 3DQVA 3ZKJC 2BBCA 2LHEA 4MJSB 4G11A 1C4CA 1IPGA 2WXJA 5FR6A 3ZTDA 1WXSA 1WGGA 4ZRPA 1AARA 1XO3A 3V6CB 2ACZB 1UUPA 3DHGC 1GPXA 2WXGA 1L0VB 1N61A 2MWSB 3NRZA 4OVUA 4B0MA 1EU4A 2G3QB 1C1YB 4LTUA 2DAFA 3IAM1 3PPAA 1TJEA 3B08A 4LNNA 1I4GA 3SEBA 4JGHB 1MG4A 3VTVA 3O65B 2ZZPB 1E8ZA 3EC8A 3CIRB 3RT3B 1MG8A 3NG0A 3GZNI 3U7ZA 4HVBA 3AULA 2B76B 4HKQA 1IGDA 1UGJA 2RR9A 3H1UA 5IO9A 4F7ZA 1ZE3D 3BK1A 2KN5A 2BS2B 2MX2A 4MM3B 3X23A 5AUIA 4A9AA 1L4DB 4GMVA 1C78A 1F9JA 4ZYNA 4NJ7A 2WP9B 2UU7A 4NQKE 1SSNA 2Z0EB 1E8WA 1WSPA 4XDCA 4ACFA 1B9RA 2WU5B 4N59A 4US9A 2GLSA 3KUCB 4ANUA 2JY6A 1NYQA 2D5GA 2N7DA 4FN2A 1P0RA 2MJEA 1XLNA 4IWPA 4DHZE 1XD3B 3EFUA 3WALA 4EZLA 2QILA 2KOXA 3QQ8B 2LVOA 2L83A 4DHZB 4RF0A 1FFVA 1JRUA 2D3BA 2KLCA 5BMGA 4P1CC 2LI5A 3Q3MC 3DBLB 3KUDB 2R61A 1SGHA 1E6EB 2OHFA 2DYOA 2JRIB 1UELA 3ZYYX 3P4RB 1EF1A 2YVCA 1YQ3B 1VR9A 3K9PB 2JVCA 1QF6A 5HG2A 1MHXA 4RM9A 1QKZA 3BY4B 2N9PC 2IO2B 2KQ4X 1PGXA 4YSYB 4FJVB 2INNE 2ZEQA 5H8YE 3KYCD 2D2QA 2IPKD 4F8CB 2FE8A 3QC8B 4HLEA 1MVKA 3KWVA 4XYCA 2V1YA 4DXFA 2BT6A 4HPMB 2JT4B 4WH4A 2KWVB 2KNBA 2N9KA 1HXYD 4C00A 3NOBA 3TMPB 4KZCA 2N9EB 4L1BA 2HJ8A 1N6ZA 1XF5L 1YQ4B 2WXIA 1E7VA 2CKHB 3OJ4B 3B9JA 4BOZB 1FCLA 3TJPA 2E6XA 1AYFA 3L4PA 2OEDA 1ENFA 5JZEB 5EE1A 4ICVA 3A4SC 2PIAA 1QZEA 1V81A 2ASQA 4WJPA 2EMSA 1ZXIA 2W54A 2M56B 2MRPA 4W9LA 2MBOA 4M0WB 3M63B 5E6PA 4ZHOA 1D5ZC 1C79A 1MPEA 3RN9C 4IDIA 2KQ7A 3AE2B 3TEXA 2FCNA 3Q6BA 1J19A 1I4HA 1TKYA 2KVRA 2LWPA 2BTEA 4TQ0A 3KWLA 3DBRB 1HQRD 1I35A 2PTLA 4OZBA 1DOYA 1GUAB 2K1FA 5FKAC 3N3KB 4NJCA 2KMAA 2D10A 5DCNA 1N60A 3FC4A 3W1SC 1RWSA 2G4DB 4S0RA 1WX7A 3VVWB 1WH3A 3DVNU 1CZPA 3FILB 1JROA 1FRRA 4TUUA 2C60A 3K9OB 3SFEB 3CWIA 2MBEA 2K5PA 4K7UA 2RD0A 3PTFC 1SE4A 2K8BA 5IAAC 3W1YA 3EGRA 2X38A 3N9YC 5BYRA 4IWOA 4YSZB 1FRDA 2NPTA 2O6VA 4M01A 1SIFA 3GE8C 2RSUA 2RPQA 3IG3A 4FHJA 3ZW3A 1D5XC 5CHVC 3RZFA 3A9KB 2LGXA 1F0ZA 4S17A 1SB3C 1WGRA 2IGDA 2KACA 2JQRB 3ZJTA 1E8YA 4WJQA 3M62B 2LD9A 1NBFC 2X8XX 3RFZB 1H8CA 5J18A 1IBXA 4KDLB 4M8NA 4M8MA 2HDEA 4I6NB 3I3TB 2WX1A 4BKGA 4RH6A 2FBWB 5BO4B 3PREA 4A90A 2JWUA 1OEYJ 1CK1A 3C19A 3AEFB 4YTNB 4F1SA 4RGNA 1D4BA 1C3TA 1P98A 2KYWA 3N20C 4ZHPA 1QOAA 1KLUD 1FXIA 2FUG1 3PT2B 5IOIA 5TSSA 2LXAA 2ZCBA 1OGWA 4HJGE 4M00A 2L7RA 1E0ZA 1FNWA 2I1JA 4HEA1 4XGAB 3NZSA 2KX0A 4WWPA 3UGBB 1ET6A 2FIFA 3DBRI 1YQBA 1M4VA 2L0TA 3Q3OC 1XXGA 1VLBA 4AOFA 3H7PA 4PYZA 1E7PB 1JWSD 2JSVX 3PRZA 4JX1C 1WM2A 2C7NB 3AE4B 2SEBD 2YLMA 2PLPA 4W9DA 3VR9B 3U2SC 1T5XD 1PGBA 2WXRA 2IYDB 5G2NA 4ZRIA 3GOEA 4B6WA 3PLVA 2DENB 4A6QA 1KFYB 1YX5B 2JZZA 2BYEA 1SE3A 2L32A 2XEWA 4W9JA 2W82A 5AUKA 3AE5B 5C3JB 3LJ3A 2AX5A 3V6EB 5JHAA 3TUOA 2XK5A 2GI9A 4AQ7A 2V4IB 2N9XA 4BKTA 1TS4A 2WDQB 4J6IA 3LXFA 3VR8B 4MH0E 3OAWA 1ESFA 4W9HA 3VHTC 3A1QB 4KGSA 2GRIA 2JU6X 3FKYA 4BOSC 1P9DU 4GDKA 2JX5A 2MP2B 4KZ0A 3PLUA 1KH0A 3ZNZB 4GOCA 1BT0A 5EE9A 1Y56A 4USAA 3QHTA 1J7BA 4YXDB 2EKEC 3JYUA 3NS8A 2A4ZA 3BK2A 2RMMA 1YJJA 2PMVA 4MJSA 2PPHA 4JIOU 1OQQA 2FUHB 4RNAA 3VUYA 3OLMD 1JW9D 3W1SA 3P2BA 4KIKA 1GAQB 1UD7A 1GC7A 1FNUA 1Z2MA 2ZW0A 2WXFA 2J0MA 3VQIA 2WWZA 1UNSA 1VZ8A 1V9JA 4BAXA 1QLBB 3B1LX 3R7RA 1KM7A 4FJYA 2BB6A 2KDEB 2G1EA 5D6JB 4LCDE 1E5WA 3BIID 1NDDA 4C7ZA 3ABVB 4PS7A 2KWDA 4KKIA 1CQVA 4ANVA 1LFDA 1I4PA 4OVVA 2L8JA 3ZQ4A 4IM2A 1UF0A 1WYWB 1FM0D 1WXVA 1OQYA 1YN5A 2PVOD 4OVZA 3W5VB 1Z5SB 2FNJB 2BYFA 1TZOA 5LXHA 1ZW7A 3GB1A 1P7EA 3I5JC 4ZRJA 2QIEB 2V0GA 3R2IA 3RNEC 1A5RA 3ENEA 1YIWA 2LJIA 1UBIA 2M19A 4MELA 4HRSA 4JWSC 2Y5PA 1T6BX 1WIAA 2DZKA 2KANA 3ZDMC 3EA6A 1GB1A 2KWCA 4W9KA 4LNFA 3VTWA 3NVZA 3BYYB 1V1OA 4DK5A 3RPFC 2L1AA 4MDKE 4WQMA 1V5TA 3KVFB 2JPHA 4WJOA 4NAWB 4N6EB 3AE3B 1GOZA 1TIFA 2KWUB 1FPYA 3AEAB
chains in the Genus database with same CATH topology
1ROEA 1DOXA 1VZ7A 4XDDA 2R61A 3HVDA 4AS1A 3R2TA 3PO0A 1E6EB 1TS3A 4XWWA 2OHFA 2DYOA 2H88B 3BVGA 3ZYYX 2N9LA 3P4RB 4HKZE 5BMIA 3BWUD 2EELA 2XN9C 1YQ3B 1VR9A 2AQ3B 3HVZA 3KQ4A 1QF6A 5HG2A 1MHXA 4RCOA 4YTMB 3NVVA 1QKZA 3GS2A 2KQ4X 4DQOC 1PGXA 4YSYB 2INNE 1JWMD 5H8YE 2IPKD 3HUIA 1QILA 3BZDB 1N5WA 3SFDB 3T3NA 2FE8A 4JE3B 2KN4A 3PZ7A 1MVKA 1KF6B 2LEKA 1D5MC 1VRAB 3KWVA 2WXLA 1BUIC 3AE1B 1K53A 4JWUC 2G9HD 2I38A 3AE6B 3IT4B 1V8CA 4DXFA 2BT6A 1UWXA 2GB1A 4GLSC 2WXOA 2WNMA 4WH4A 5D3DA 1A70A 4L2YA 1AW7A 2N9KA 3ZGZA 1HXYD 1L6UA 1TS5A 1EM7A 4KGRA 4PT5A 5I4DA 1IBXB 3NZ3A 1RYJA 2KDMA 2KAJA 1QOFA 4H2AA 4O1NA 4L1BA 3R8BA 1L5PA 2YEPB 3AECB 2WXIA 1XF5L 1YQ4B 2BW2A 5BYSA 3AEBB 4FXCA 3U52E 2IDYA 2W3RA 3B9JA 1FCLA 4REZA 1C9FA 3AB5A 2E6XA 4P16A 1AYFA 1V1PB 2OEDA 1K51A 3L4PA 3Q8CA 1PFDA 1ENFA 2TSSA 1XLOA 1V1PA 5EE1A 1XLQA 2PIAA 3I9V1 1FO4A 2WXMA 3IXSA 4C7YA 1ZXIA 2N0SB 2W54A 4UDUC 1HEZE 2M56B 2LFIA 3FAHA 5G5HA 1L0YB 5E6JA 2K0PA 3AEGB 1KLGD 4WIPA 4ZHOA 1FIQA 1D5ZC 4YTPB 3BVMA 1C79A 3MFGA 1MPEA 3LYYA 4M0WA 2JYEA 3AEDB 4IDIA 3KLSX 2SAKA 1AWDA 1K50A 3Q69A 3AE2B 3VRAB 4MH8A 3TEXA 1KRHA 5C2TB 3IT6B 4C56C 2WXNA 1I4HA 3AM9A 1IGCA 1TKYA 2BTEA 4WURA 4TQ0A 1VZ6A 1F2RC 1MI0A 3HRDD 5D7GA 2QJLA 3KWLA 2L52A 1HQRD 2BS4B 2PTLA 2JXTA 4OZBA 3E56A 5HFYA 4MACA 4NAMA 1DOYA 5FKAC 2MJDA 1ZP0B 1TS2A 4NZLB 1SBBB 4NJCA 1YN3A 4US8A 1OQRA 2JYTA 4N58A 3DWGC 1N60A 3FC4A 4JPSA 2K22A 1XEEA 3UI3A 2ON8A 1RWSA 4A8XC 1XLPA 2VZKD 4KX6B 1EWYC 2INPE 3Q8AA 2BB5A 2CU3A 2CJOA 1JWUD 3Q8FA 1JWAD 1CZPA 3FILB 1JROA 1FRRA 2IGHA 3WCQA 1HZ5A 1RM6C 3SFEB 3CWIA 4KGTA 2K5PA 2V3NA 4RF1A 2H89B 3P63A 1SE4A 3W2DA 1C4PA 1KTKA 5BMHA 2MEKA 3GP7A 1I4QA 3EGRA 2X38A 3N9YC 4TQ1A 5BYRA 4YSZB 1WWTA 5LNK1 2RDHA 1I4XA 1FRDA 3TEWA 1N63A 2Q5WD 3NVWA 3AE7B 3NVYA 1UWMA 2BS3B 3BYTB 4RGOS 1D6EC 2K9XA 1D5XC 3V3XA 1F0ZA 3OWEB 3PZ8A 1SB3C 4P6VF 4R3DA 1VJKA 2IGDA 2KACA 3DWMA 2JQRB 3ZJTA 2CJNA 1XCQL 1NVID 2EKIA 1TKGA 2V3PA 1ZDXA 4WAFA 2RPVA 2K3UA 2BYTA 1K52A 3MP9A 4LLGM 1FFUA 1ZOYB 1MHHE 4TMAB 4RGMA 5BYQA 4B0EA 3RFZB 2WXKA 4TSSA 1Q10A 1IBXA 3AE8B 2HDEA 1SF0A 3O13A 4HROA 1QOBA 4RH6A 2FBWB 4A90A 1EU3A 5H92C 2JWUA 1CK1A 1YNTE 3AEFB 4YTNB 4RGNA 1AN8A 2WDVB 3J9CA 1D4BA 3W9CB 1HZ6A 5GXGB 3VRBB 1DOIA 4ARIA 2MH7A 1C4AA 4ZHPA 1FEHA 2LGIA 1IUEA 1QOAA 1KLUD 1FXIA 2FUG1 5TSSA 1GB4A 4YWGG 5MPOA 1NENB 4HJGE 1E0ZA 1FNWA 3URYA 4HEA1 4LK0M 4ZYSA 1LO5D 2MJ3A 1QT9A 1ET6A 2IJ0A 4MT5A 2N7JA 1YN4A 1ZPSA 4Q2JA 1C77A 1M4VA 2QSDA 3AMZA 1XXGA 1VLBA 3NUHB 2J52A 1SJED 4OW0A 5FK9C 4C80A 4YSXB 2QMTA 1NYRA 1FXAA 1E7PB 1JWSD 2JSVX 1JMLA 1N62A 2WDRB 2HTME 2WQYB 4JX1C 1R7SA 1XCTL 2W55A 4OHJA 1WRIA 3AE4B 3ZJVA 2SEBD 2PLPA 1C76A 3VR9B 2PVGC 3U2SC 1T5XD 1PGBA 3MJ5A 2WXRA 4YT0B 3NS1A 4EE2A 2LHDA 1FMAD 4A6QA 1KFYB 3ETRA 1STEA 1SE3A 4IKGA 4XWTA 2IGGA 1QQRA 3TEZA 2L32A 1SJHD 2W82A 3AE5B 5AUKA 5C3JB 2AX5A 1E10A 1F77A 2WXHA 3I57A 1OFFA 3TUOA 2GI9A 2Y3AA 2WXPA 3P4PB 4AQ7A 2V4IB 4ARCA 1TS4A 1F2RI 4RGTA 2WDQB 3LXFA 3VR8B 1ZDVA 1ESFA 3TSSA 5EE3A 2Z8LA 3FILA 4KGSA 2Y5CA 3AV8A 3E9SA 1JWBD 2NTTA 1WXQA 3B2GA 4A55A 3MC0B 2JU6X 2GRIA 4GDKB 4ITKA 1T3QA 3U4EG 1JRPA 2M0AA 3P1MA 5T8IA 1SXTA 2WS3B 2PW9A 2WXQA 2JX5A 3V05A 2WLBA 4OZCA 5HHDG 1KH0A 1WYGA 2LUMA 1SIJA 4GDLB 3P4SB 1TKEA 5D3IB 5EE9A 1Y56A 1BMLC 3H8HA 4D2KA 3SR6A 1RFKA 4USAA 1VDVA 1J7BA 2VZKB 2KMMA 4YXDB 1PUTA 2BBCA 2LHEA 1DGJA 3AEEB 1J7CA 2JZPA 1FCCC 3BK2A 4J3OD 2RMMA 4WWMA 1C4CA 1YJJA 2PMVA 2WXJA 1CJEA 1TYGB 3B2FA 2AQ2B 1FNVA 2PKOA 1OQQA 2E3TA 2NMQA 5HI1A 4RNAA 3W1SA 1JW9D 1QOGA 2DLBA 3T3OA 1GAQB 1YMHE 4CQNA 4XE0A 1FNUA 4ZRPA 2ZW0A 2WXFA 3BVZA 1XO3A 2LMCA 3VQIA 2ACZB 4DXGA 1UNSA 1UUPA 1FD6A 4KKJA 1VZ8A 3MHZA 1GPXA 2WXGA 1L0VB 1N61A 5FR3A 1QLBB 3NRZA 2J53A 1NEKB 3Q8EA 1JQ4A 4B0MA 1PYWD 1EU4A 2BB6A 2RDGA 2G1EA 3AH7A 1WGKA 3BIID 1HA5A 4ZRQA 4LTUA 4C7ZA 3ABVB 2KWDA 4KKIA 1CQVA 1ET9A 3IAM1 1I4PA 3LB8C 1TJEA 1JALA 1JCKB 3ZQ4A 1I4GA 3SEBA 1V97A 1SEBD 2ICIA 4RFBA 2ZW1A 4ZOHC 1FM0D 1TY0A 1YN5A 3CIRB 2PVOD 4OVZA 3W5VB 3W5UB 1TY2A 3IAS1 2DBYA 3U7ZA 1TZOA 2WU2B 1J7AA 1N5XA 2J42A 2ONQA 4HKQA 2B76B 1IGDA 3GB1A 3P42A 1UGJA 1P7EA 2AQ1B 2NTSA 2QIEB 3C8YA 4L23A 2V0GA 1ZXHA 2DYMA 1P7FA 1ZE3D 3BK1A 1L6VA 1EWCA 3Q8BA 3R2IA 1PDXA 2XNAC 2BS2B 4MM3B 2LJIA 5AUIA 1BXTA 4A9AA 1L4DB 2M19A 1C78A 4IOIE 4OZAA 4HRSA 2J4XA 2W3SA 4JWSC 2Y5PA 1T6BX 1ZUD2 2WP9B 1L0XB 1PGAA 1DYQA 1SSNA 2QEJC 1NI3A 1E9MA 3EA6A 1GB1A 1YJIA 4XDCA 1WSPA 1B9RA 3NVZA 2WU5B 3BYYB 1V1OA 4N59A 2I2YA 3AE9B 3AN1A 4US9A 3TEYA 3ZJUA 3RPFC 2DWQA 2L1AA 1ACCA 1I7HA 1SE2A 1NYQA 3P4QB 2D5GA 4WQMA 1L4ZB 2YEPF 2MJEA 1XLNA 4NAWB 3EUB2 5G5GA 2QILA 4N6EB 1B1ZA 2L83A 1I4RA 3AE3B 4RF0A 5JXVA 1FFVA 1GOZA 5EE0A 5BMGA 3AEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB4 A;  1IGC A;  1FD6 A;  4HJG E;  1F2R C;  1MI0 A;  2J53 A;  2PTL A;  2JXT A;  2N9L A;  4HKZ E;  4OZB A;  5BMI A;  5HFY A;  4MAC A;  2EEL A;  2N7J A;  5HG2 A;  1MHX A;  2QSD A;  1QKZ A;  2J52 A;  2KQ4 X;  1PGX A;  2QMT A;  2KWD A;  3UI3 A;  2ON8 A;  1JML A;  2JSV X;  1XCT L;  3FIL B;  2KN4 A;  2IGH A;  2PLP A;  1HZ5 A;  2ZW1 A;  1MVK A;  1PGB A;  4KGT A;  1K53 A;  2I38 A;  2GB1 A;  1UWX A;  2LHD A;  4GLS C;  5BMH A;  4IKG A;  2ONQ A;  2IGG A;  4WH4 A;  1IGD A;  3GB1 A;  2N9K A;  1P7E A;  4KGR A;  1EM7 A;  1IBX B;  2GI9 A;  1ZXH A;  2KDM A;  1P7F A;  1F2R I;  1XF5 L;  3V3X A;  3FIL A;  4KGS A;  4IOI E;  4OZA A;  1FCL A;  1C9F A;  2IGD A;  2KAC A;  2JU6 X;  1XCQ L;  2OED A;  1K51 A;  1PGA A;  1GB1 A;  2PW9 A;  2RPV A;  4OZC A;  5HHD G;  1KH0 A;  2LUM A;  1K52 A;  3MP9 A;  2I2Y A;  1MHH E;  4D2K A;  1HEZ E;  1Q10 A;  1IBX A;  2K0P A;  2LHE A;  2JZP A;  1FCC C;  2RMM A;  2JWU A;  1MPE A;  1YNT E;  1K50 A;  2NMQ A;  5HI1 A;  1D4B A;  5JXV A;  1HZ6 A;  1YMH E;  5BMG A;  2LGI A;  2ZW0 A; 
#chains in the Genus database with same CATH topology
 4W9E A;  1DOX A;  1TGZ B;  1VZ7 A;  3RNF C;  1P1A A;  2DZM A;  3PO0 A;  1TT5 B;  2K8C A;  2JF5 A;  4XWW A;  3RI7 C;  1WXM A;  3DOW A;  3BVG A;  3ML8 A;  2L05 A;  2N9L A;  2DAJ A;  4HKZ E;  2EEL A;  2XN9 C;  2R2O A;  2JZ3 B;  1H4R A;  3ALB A;  2GOW A;  1WZ3 A;  2WHI A;  2KTF A;  4DQO C;  4LNO A;  4IW0 A;  4URK A;  2OOB B;  5E6O A;  3SFD B;  3T3N A;  4JE3 B;  2IY0 B;  4ZDV A;  2KN4 A;  3PZ7 A;  1KF6 B;  2BQQ A;  1D5M C;  1BUI C;  1K53 A;  3DBH B;  1V8C A;  4GB9 A;  2JWZ A;  3A4R A;  3UIN B;  2WXO A;  5D3D A;  2J7Q B;  3TCA A;  1AW7 A;  3ZGZ A;  1OEY A;  1L6U A;  4PT5 A;  4W9I A;  3PVL A;  3KUZ A;  2KDM A;  5L95 C;  1QOF A;  4O1N A;  2NBW B;  3U52 E;  2IDY A;  4TV3 A;  1C9F A;  4JLC A;  3AB5 A;  3RYT A;  4P16 A;  1V1P B;  5GMV A;  3Q8C A;  1K51 A;  3RNA C;  4LJP B;  1XLQ A;  1FO4 A;  2WXM A;  1D3Z A;  5D94 A;  1HEZ E;  3JSV B;  2L00 B;  3FAH A;  3UF8 A;  5G5H A;  1L0Y B;  1F52 A;  3AEG B;  4WIP A;  1FIQ A;  3A33 B;  4M0W A;  3KLS X;  1RRB A;  2SAK A;  4GU2 A;  1YD8 U;  4W9F A;  5C2T B;  3WAM A;  4C56 C;  2K39 A;  3AM9 A;  1IGC A;  1F1H A;  4WUR A;  1F2R C;  3L10 B;  3DBS A;  1PQS A;  2JXT A;  1WE7 A;  3E56 A;  5HFY A;  1ZP0 B;  3PS6 A;  1SBB B;  3DCG A;  4US8 A;  1HTO A;  4MGZ E;  2BWF A;  3SU8 X;  2ON8 A;  2VZK D;  2INP E;  1V5O A;  2N4F A;  2CJO A;  2NR2 A;  3Q8F A;  4WWN A;  3ZDT A;  5CHW A;  5EDS A;  2L3Z A;  1RM6 C;  2CR5 A;  4RMA A;  2V9H A;  2KJ6 A;  3P63 A;  5C1Z A;  1YJ1 A;  2B3A A;  3DBH I;  4HK2 A;  5J17 A;  4TQ1 A;  5LNK 1;  1VD2 A;  2RDH A;  3TEW A;  3Q3J A;  2Q5W D;  2LVP A;  3NVW A;  4GXB A;  1UWM A;  4DXA B;  4RGO S;  4W9C A;  4FAD A;  2KC1 A;  2KTR B;  1U4A A;  2K9X A;  2IBI B;  4AJW A;  3V3X A;  4R3D A;  1WX8 A;  3RNG C;  1VJK A;  2MW5 A;  3A9K A;  4P7I A;  3CSF A;  2GBN A;  3KYD D;  3DHH C;  1Y8R C;  2PEA A;  3PRP B;  4WAF A;  2RPV A;  3MP9 A;  5AZG A;  4LLG M;  3SHQ A;  1FFU A;  4HDO A;  4B0E A;  2WXK A;  4TSS A;  1Q10 A;  4K81 A;  3DVN V;  4HRO A;  4HCN B;  1QOB A;  3L13 A;  2GBM A;  1EU3 A;  1YNT E;  1AN8 A;  3OJ3 A;  2ZNV B;  3NHE B;  3M95 A;  3W9C B;  2O2V B;  2KFK A;  3VRB B;  4MSM B;  2LGI A;  1IUE A;  1GB4 A;  1HTQ A;  3SD5 A;  4K7S A;  5MPO A;  3R66 C;  3URY A;  1LQB A;  3N30 A;  1EO6 A;  4LK0 M;  4ZYS A;  1QT9 A;  4MT5 A;  1YN4 A;  4Q2J A;  1ISN A;  4EUT A;  4YSX B;  4C80 A;  3PHX B;  3I63 C;  1JML A;  3EEC A;  2W55 A;  2V4L A;  2V3S A;  3ZJV A;  1C76 A;  3PZD A;  4AWJ A;  4WWO A;  3MJ5 A;  3DBL I;  3QWZ B;  2MBB B;  4YT0 B;  1FMA D;  4X57 B;  4ASW C;  2DZJ A;  3ETR A;  1STE A;  4IKG A;  1QQR A;  3TEZ A;  3ZLZ A;  1V2Y A;  3VXW A;  4FLH A;  4W9G A;  1E10 A;  3JVZ X;  2WXH A;  1OFF A;  2NVU I;  2WXP A;  2OJW A;  3MC9 A;  4ARC A;  1WR1 A;  4LJO B;  2FCQ A;  2LUE A;  1P3Q U;  3TSS A;  2PJH A;  3MTN B;  3AV8 A;  3ML9 A;  2KDB A;  3B2G A;  4A55 A;  3MC0 B;  3A1Q A;  3N1Z C;  1UH6 A;  2GBJ A;  1LXD A;  1JRP A;  2M0A A;  2PW9 A;  2WXQ A;  3V05 A;  5HHD G;  1WYG A;  1KJT A;  3N1Y C;  3L17 A;  2MP2 A;  1BML C;  3H8H A;  4RM8 A;  1RFK A;  2KMM A;  1PUT A;  3A9J B;  3AEE B;  1J7C A;  1FCC C;  4WWM A;  1CJE A;  1TYG B;  3DVG X;  2WGS A;  1FNV A;  2PKO A;  2E3T A;  4IWQ A;  2NMQ A;  1GG3 A;  1QOG A;  3T3O A;  1R4N B;  2KX3 A;  5DPR A;  3WAO A;  3BVZ A;  4DXG A;  2QCZ A;  1FD6 A;  1V80 A;  1NEK B;  2LAS A;  4MEM A;  1XT9 B;  1PYW D;  2RDG A;  1WY8 A;  4JQW C;  5E6N A;  4ZRK A;  3R3M A;  4CO7 A;  3U8Z A;  4ZRQ A;  1IP9 A;  1ET9 A;  3LB8 C;  2AL6 A;  1JAL A;  1JCK B;  5CTR C;  3V60 A;  4BVU C;  1V97 A;  1SEB D;  2ICI A;  4WAA A;  3VAW A;  4BZA A;  4RFB A;  4EZJ A;  2ZW1 A;  4ZOH C;  4LDT D;  1TY0 A;  2WX0 A;  2ZVO A;  3EFC A;  4ICU A;  2XBB C;  4HJK A;  1T0Q C;  2KT7 A;  3IAS 1;  1GJZ A;  1J7A A;  1N5X A;  2ONQ A;  4GIV A;  2AQ1 B;  3AI5 A;  2BKF A;  3C8Y A;  2GBR A;  1ZXH A;  2KZR A;  2DYM A;  3ZRC A;  1EWC A;  3Q8B A;  1RAX A;  4OZA A;  3RUL A;  3Q2A C;  2J4X A;  2W3S A;  3VFK A;  4CYE A;  1ZUD 2;  3D32 A;  4K7W A;  1L0X B;  1DYQ A;  1NI3 A;  1E9M A;  2CHX A;  1YJI A;  2LRW A;  3AE9 B;  2AWT A;  3AN1 A;  3TEY A;  3UQB A;  1WM3 A;  1ACC A;  1I7H A;  3EHV A;  3L08 A;  2O6V D;  2YEP F;  3TIX A;  2JUO A;  4HXD A;  2KXJ A;  4B95 A;  3HM3 A;  2EMT A;  2MQJ A;  3L0W B;  3PHW B;  1I4R A;  2D3C A;  5JXV A;  2BPS A;  2M1M A;  1WX9 A;  1ROE A;  1WZ0 A;  4PYU A;  4XDD A;  1R4N I;  2VH2 A;  4AS1 A;  2BKR B;  2MBQ A;  5D2M B;  1TS3 A;  2H88 B;  5IN7 A;  4EOY A;  5BMI A;  3BWU D;  3CF6 E;  2AQ3 B;  3HVZ A;  1WMH B;  4RCO A;  3NVV A;  3RZW C;  3DPD A;  2O6V B;  3GS2 A;  3CST A;  1JWM D;  2DYB A;  1QIL A;  2ZPN A;  1N5W A;  2BF8 B;  2M0X A;  3VH3 B;  4DDG D;  2VRR B;  3AE1 B;  1T0S C;  5KHQ A;  2G9H D;  2I38 A;  3IT4 B;  5J2R A;  3H6N A;  2GB1 A;  4GLS C;  3JW0 X;  2QDF A;  3ONS A;  2WNM A;  3VTU A;  2KDI A;  2MA9 B;  3APC A;  1TS5 A;  1EM7 A;  2IO0 B;  2WYQ A;  3L54 A;  1IBX B;  5C23 A;  2NS5 A;  1GC6 A;  2DX5 B;  4A20 A;  1L5P A;  2AEH A;  2G45 B;  2BW2 A;  2NBU A;  3NJT A;  3ZNI D;  2W3R A;  2LRU A;  4REZ A;  4BBN C;  2MSE D;  3WIM A;  2FCM A;  3MJW A;  1PFD A;  1V6E A;  4TKN A;  1XLO A;  4IC7 B;  3UIP B;  1V1P A;  5CX3 A;  3APF A;  5TR5 A;  3I9V 1;  4HDQ A;  4C7Y A;  4C4V B;  2AL3 A;  2N0S B;  2LFI A;  5E6J A;  3S2A A;  2K0P A;  3JSV A;  4G0N B;  3LDZ E;  3BVM A;  3MFG A;  4MM3 A;  2JYE A;  2KK8 A;  3H7P B;  5LXI B;  1AWD A;  4GSW A;  1K50 A;  3AXC A;  1S3S G;  3QX1 A;  3VRA B;  4MH8 A;  5JH5 C;  3M3J A;  3IT6 B;  3V62 A;  2GMI C;  2L52 A;  3ZNG C;  2BS4 B;  4KV2 A;  2LZ6 A;  3T8M A;  4NAM A;  3L16 A;  1TS2 A;  1YN3 A;  4BFR A;  1TBE A;  1OQR A;  4N58 A;  4EZK A;  4WQO B;  3UI3 A;  2K22 A;  2N7E A;  1XLP A;  4YL8 A;  1EWY C;  2CU3 A;  3HM6 X;  1JWU D;  1JWA D;  4I6P A;  4K3B A;  4N9F 4;  4HPL B;  4KGT A;  3QA8 A;  4RF1 A;  5G55 A;  2FCS A;  2LXC A;  2KDF B;  3W2D A;  1C4P A;  4AUQ C;  5BMH A;  2MEK A;  1I4Q A;  2PE6 B;  2IO1 B;  1N63 A;  2DNF A;  3AE7 B;  4ANX A;  1RLF A;  2BS3 B;  1D6E C;  1WGH A;  2K6D B;  2I1K A;  4XX5 A;  2KTR A;  3OWE B;  3PZ8 A;  4P6V F;  4KVG B;  1CMX B;  3DWM A;  3QK0 A;  1V86 A;  4KIK B;  3HIZ A;  1TKG A;  1V49 A;  1ZDX A;  2IND C;  3ZVV A;  2K3U A;  2N1W A;  2FAZ A;  1K52 A;  1T0Y A;  1ZOY B;  1MHH E;  4TMA B;  5BYQ A;  1WI0 A;  2DHZ A;  3AE8 B;  5KHO A;  2BYV E;  4E71 A;  3ZUN A;  2CHZ A;  2L0F A;  5IKC M;  2WDV B;  5GXG B;  1VCB A;  4ARI A;  4NY0 A;  1FEH A;  1NI2 A;  2MLB A;  2HJ1 A;  2KVZ A;  2O2V A;  1NEN B;  4DDI D;  2M17 A;  3IFW B;  2GBK A;  2HD5 B;  5L83 A;  1WJU A;  4I6L B;  2K6Q A;  1ZPS A;  3NUH B;  1ZGU B;  3MC8 A;  2J52 A;  1SJE D;  5FK9 C;  2D07 B;  4KSL C;  2M8S A;  2KD0 A;  1UGM A;  4G3X B;  1FXA A;  5CHF A;  1E90 A;  2HTM E;  2WQY B;  3TBL D;  4BKS A;  1XCT L;  3WAP A;  1UZX B;  2PVG C;  3BIN A;  3NS1 A;  4MGI E;  3VH4 B;  1SE9 A;  4EE2 A;  2VH1 A;  1FXT B;  4DWF A;  3HK0 A;  2RDB C;  5DPW A;  4XWT A;  1HE8 A;  1SJH D;  3ZRF A;  1KOT A;  5JHB A;  1MJD A;  1F77 A;  1RFA A;  3H7S A;  1ZDV A;  5EE3 A;  3FIL A;  5AEK B;  2LJ5 A;  1S1Q B;  1WXQ A;  3U4E G;  4IG7 B;  4ANW A;  2MHJ A;  3ZIM A;  2WLB A;  4OZC A;  1WJ4 A;  1SIJ A;  4GDL B;  3P4S B;  3WA0 A;  4JL9 A;  4D2K A;  3Q3F A;  3QIJ A;  4EKU A;  1VDV A;  2VZK B;  1WJ6 A;  1LM8 B;  4IM3 A;  1DGJ A;  3KH0 A;  2JZP A;  2BVC A;  4J3O D;  2QC8 A;  3B2F A;  3A9J A;  2AQ2 B;  3X0W A;  4KSK C;  3Q3N C;  5HI1 A;  2DLB A;  4EFO A;  1YMH E;  4CQN A;  3MHS D;  4XE0 A;  4EEW A;  2CS4 A;  2LMC A;  2REX A;  2KFJ A;  4KKJ A;  2D11 A;  3MHZ A;  5FR3 A;  1T0R C;  2J53 A;  3Q8E A;  1JQ4 A;  3V61 A;  1WFY A;  3UQA A;  3AH7 A;  1WGK A;  1HA5 A;  4AJY B;  1Q1O A;  2C7M B;  5DPS A;  3RUI B;  1EUV B;  2R2Q A;  4BKS D;  3W5U B;  1TY2 A;  3QAQ A;  2DBY A;  2BWE S;  2WU2 B;  2J42 A;  3PV1 A;  2HE7 A;  3P42 A;  4A3O A;  2NTS A;  4L23 A;  3CMM B;  1GNU A;  2J0J A;  1P7F A;  1L6V A;  4NNJ B;  1PDX A;  2XNA C;  1BXT A;  2PE9 A;  4NQL B;  4K1R B;  4IOI E;  4DHJ D;  2KQS A;  4FJZ A;  1TZ1 A;  1PGA A;  2QEJ C;  1WF9 A;  3DDC B;  2ZJD A;  2D3G A;  2I2Y A;  3ZJU A;  2DWQ A;  1SE2 A;  2KC2 A;  3P4Q B;  2Z59 B;  2IO3 B;  4E3C A;  1L4Z B;  1WE6 A;  1J0G A;  3EUB 2;  1M94 A;  5G5G A;  2WDT B;  3N32 A;  1B1Z A;  3IHP C;  3HHM A;  2KMC A;  1J8C A;  2JXX A;  4DHJ B;  5EE0 A;  4XZ4 A;  3UIO B;  1L2N A;  4FUL A;  3RMK C;  3HVD A;  5AZH A;  5HKH A;  1WRD B;  3R2T A;  4FBJ B;  3C0R B;  2KO3 A;  1XQQ A;  3KQ4 A;  1YX6 B;  4YTM B;  3OG5 A;  3NY5 A;  2Z0D B;  4PS8 A;  1WMH A;  2UYZ B;  4HPP A;  3HUI A;  3BZD B;  2A5U A;  3VDZ A;  5DPT A;  3B0A A;  4II2 B;  2LEK A;  2QHO A;  3N1X C;  1VRA B;  2WXL A;  3QJZ A;  4PS3 A;  4BBN F;  1UBQ A;  4JWU C;  3AE6 B;  1Q5W B;  1UWX A;  4GN1 A;  1A70 A;  4L2Y A;  2CHW A;  2KJH B;  3RCZ A;  3RNC C;  4KGR A;  3T9L A;  5I4D A;  2LVQ A;  2MBH A;  3NZ3 A;  1RYJ A;  3ECI A;  3ZO5 B;  2JRH A;  2KAJ A;  2AYO B;  4H2A A;  3R8B A;  2YEP B;  1LGR A;  3GE3 C;  3AEC B;  2DZI A;  2BGF A;  5BYS A;  3AEB B;  4FXC A;  3DVG Y;  3TL5 A;  3AU4 A;  2KFK B;  1G6J A;  3ZXV A;  1TTN A;  2TSS A;  4PK1 A;  5IP4 D;  3IVF A;  3IXS A;  4NJ6 A;  3H9D A;  4XC2 A;  4IUM B;  4UDU C;  2INC C;  2FID A;  4C4V A;  1Q0W B;  1KLG D;  2RGF A;  1R4M B;  4YTP B;  2IZV B;  4IM0 A;  3LYY A;  3AED B;  4LDT B;  4LNI A;  4II3 B;  3Q69 A;  2C9W B;  3QAR A;  1KRH A;  4P1B C;  2N1V A;  3AU5 A;  2WXN A;  4CHK A;  1VZ6 A;  1MI0 A;  3HRD D;  5D7G A;  2ZVN A;  2QJL A;  4FHK A;  3RNB C;  3PRM B;  4MAC A;  4K3C A;  2MJD A;  4NZL B;  2JYT A;  1K8R B;  4NAW A;  3DWG C;  4JPS A;  1XEE A;  3DHI C;  2ZCC A;  4A8X C;  3R7Q A;  4KX6 B;  5IA7 A;  3Q8A A;  2BB5 A;  2KKC A;  2W9N A;  4MSQ B;  1YOV B;  2KJR A;  2IGH A;  3WCQ A;  1HZ5 A;  2L76 A;  4KDI C;  2V3N A;  2J0K A;  1KLV A;  2H89 B;  2UWQ A;  2KHW B;  1WGY A;  1KTK A;  4AP4 C;  2NPT B;  1E7U A;  3GP7 A;  3PGE A;  5LLI A;  2HTH A;  4MGY E;  1WWT A;  1I4X A;  4M02 A;  1MFW A;  2ZNV C;  3NVY A;  1EF5 A;  3BYT B;  2MCN B;  1L7Y A;  4A3P A;  3QCA A;  2NCN A;  1OTR B;  4E74 A;  2CJN A;  2D3A A;  1IYF A;  1XCQ L;  1NVI D;  2EKI A;  4MGK E;  2V3P A;  2BYT A;  2NBV B;  4NPN A;  2C5L C;  4RGM A;  1WJN A;  4WJN A;  4GGQ A;  1SF0 A;  3O13 A;  4HCP B;  2IY1 B;  3RD2 A;  4B9K A;  5H92 C;  3U30 A;  1WGD A;  1R4M I;  2G4S A;  3J9C A;  2K25 A;  2Y5B B;  1HZ6 A;  1DOI A;  2KLG A;  2MH7 A;  1C4A A;  2LGD A;  4YWG G;  3KW5 B;  4LNK A;  2K8H A;  1LO5 D;  2MJ3 A;  2IJ0 A;  3U7D A;  2N7J A;  1C77 A;  3NZU A;  2QSD A;  3AMZ A;  1E8X A;  3APD A;  4QAY A;  1WXA A;  4OW0 A;  2QMT A;  1NYR A;  1N62 A;  2WDR B;  2LGY A;  1R7S A;  4OHJ A;  1WRI A;  1WR6 E;  3GZN B;  3PSE B;  3WAN A;  2ZPY A;  2LHD A;  2IGG A;  4DBG A;  2XK5 B;  3ZTC A;  1I42 A;  3I57 A;  2Y3A A;  2M4N A;  3P4P B;  3Q14 C;  1F2R I;  4RGT A;  4FA6 A;  2C7H A;  5AZF A;  3ZNH B;  2Z8L A;  2Y5C A;  4HWI B;  3VUW A;  3E9S A;  1JWB D;  3ZXR A;  2LGS A;  2NTT A;  4GDK B;  4ITK A;  1T3Q A;  1X1M A;  3P1M A;  5T8I A;  1SXT A;  2WS3 B;  3VUX A;  2OJR A;  2LUM A;  4G50 A;  1TKE A;  5D3I B;  3SDL C;  2CU1 A;  4GDL A;  3SR6 A;  1ZKH A;  3IBE A;  3DQV A;  3ZKJ C;  2BBC A;  2LHE A;  4MJS B;  4G11 A;  1C4C A;  1IPG A;  2WXJ A;  5FR6 A;  3ZTD A;  1WXS A;  1WGG A;  4ZRP A;  1AAR A;  1XO3 A;  3V6C B;  2ACZ B;  1UUP A;  3DHG C;  1GPX A;  2WXG A;  1L0V B;  1N61 A;  2MWS B;  3NRZ A;  4OVU A;  4B0M A;  1EU4 A;  2G3Q B;  1C1Y B;  4LTU A;  2DAF A;  3IAM 1;  3PPA A;  1TJE A;  3B08 A;  4LNN A;  1I4G A;  3SEB A;  4JGH B;  1MG4 A;  3VTV A;  3O65 B;  2ZZP B;  1E8Z A;  3EC8 A;  3CIR B;  3RT3 B;  1MG8 A;  3NG0 A;  3GZN I;  3U7Z A;  4HVB A;  3AUL A;  2B76 B;  4HKQ A;  1IGD A;  1UGJ A;  2RR9 A;  3H1U A;  5IO9 A;  4F7Z A;  1ZE3 D;  3BK1 A;  2KN5 A;  2BS2 B;  2MX2 A;  4MM3 B;  3X23 A;  5AUI A;  4A9A A;  1L4D B;  4GMV A;  1C78 A;  1F9J A;  4ZYN A;  4NJ7 A;  2WP9 B;  2UU7 A;  4NQK E;  1SSN A;  2Z0E B;  1E8W A;  1WSP A;  4XDC A;  4ACF A;  1B9R A;  2WU5 B;  4N59 A;  4US9 A;  2GLS A;  3KUC B;  4ANU A;  2JY6 A;  1NYQ A;  2D5G A;  2N7D A;  4FN2 A;  1P0R A;  2MJE A;  1XLN A;  4IWP A;  4DHZ E;  1XD3 B;  3EFU A;  3WAL A;  4EZL A;  2QIL A;  2KOX A;  3QQ8 B;  2LVO A;  2L83 A;  4DHZ B;  4RF0 A;  1FFV A;  1JRU A;  2D3B A;  2KLC A;  5BMG A;  4P1C C;  2LI5 A;  3Q3M C;  3DBL B;  3KUD B;  2R61 A;  1SGH A;  1E6E B;  2OHF A;  2DYO A;  2JRI B;  1UEL A;  3ZYY X;  3P4R B;  1EF1 A;  2YVC A;  1YQ3 B;  1VR9 A;  3K9P B;  2JVC A;  1QF6 A;  5HG2 A;  1MHX A;  4RM9 A;  1QKZ A;  3BY4 B;  2N9P C;  2IO2 B;  2KQ4 X;  1PGX A;  4YSY B;  4FJV B;  2INN E;  2ZEQ A;  5H8Y E;  3KYC D;  2D2Q A;  2IPK D;  4F8C B;  2FE8 A;  3QC8 B;  4HLE A;  1MVK A;  3KWV A;  4XYC A;  2V1Y A;  4DXF A;  2BT6 A;  4HPM B;  2JT4 B;  4WH4 A;  2KWV B;  2KNB A;  2N9K A;  1HXY D;  4C00 A;  3NOB A;  3TMP B;  4KZC A;  2N9E B;  4L1B A;  2HJ8 A;  1N6Z A;  1XF5 L;  1YQ4 B;  2WXI A;  1E7V A;  2CKH B;  3OJ4 B;  3B9J A;  4BOZ B;  1FCL A;  3TJP A;  2E6X A;  1AYF A;  3L4P A;  2OED A;  1ENF A;  5JZE B;  5EE1 A;  4ICV A;  3A4S C;  2PIA A;  1QZE A;  1V81 A;  2ASQ A;  4WJP A;  2EMS A;  1ZXI A;  2W54 A;  2M56 B;  2MRP A;  4W9L A;  2MBO A;  4M0W B;  3M63 B;  5E6P A;  4ZHO A;  1D5Z C;  1C79 A;  1MPE A;  3RN9 C;  4IDI A;  2KQ7 A;  3AE2 B;  3TEX A;  2FCN A;  3Q6B A;  1J19 A;  1I4H A;  1TKY A;  2KVR A;  2LWP A;  2BTE A;  4TQ0 A;  3KWL A;  3DBR B;  1HQR D;  1I35 A;  2PTL A;  4OZB A;  1DOY A;  1GUA B;  2K1F A;  5FKA C;  3N3K B;  4NJC A;  2KMA A;  2D10 A;  5DCN A;  1N60 A;  3FC4 A;  3W1S C;  1RWS A;  2G4D B;  4S0R A;  1WX7 A;  3VVW B;  1WH3 A;  3DVN U;  1CZP A;  3FIL B;  1JRO A;  1FRR A;  4TUU A;  2C60 A;  3K9O B;  3SFE B;  3CWI A;  2MBE A;  2K5P A;  4K7U A;  2RD0 A;  3PTF C;  1SE4 A;  2K8B A;  5IAA C;  3W1Y A;  3EGR A;  2X38 A;  3N9Y C;  5BYR A;  4IWO A;  4YSZ B;  1FRD A;  2NPT A;  2O6V A;  4M01 A;  1SIF A;  3GE8 C;  2RSU A;  2RPQ A;  3IG3 A;  4FHJ A;  3ZW3 A;  1D5X C;  5CHV C;  3RZF A;  3A9K B;  2LGX A;  1F0Z A;  4S17 A;  1SB3 C;  1WGR A;  2IGD A;  2KAC A;  2JQR B;  3ZJT A;  1E8Y A;  4WJQ A;  3M62 B;  2LD9 A;  1NBF C;  2X8X X;  3RFZ B;  1H8C A;  5J18 A;  1IBX A;  4KDL B;  4M8N A;  4M8M A;  2HDE A;  4I6N B;  3I3T B;  2WX1 A;  4BKG A;  4RH6 A;  2FBW B;  5BO4 B;  3PRE A;  4A90 A;  2JWU A;  1OEY J;  1CK1 A;  3C19 A;  3AEF B;  4YTN B;  4F1S A;  4RGN A;  1D4B A;  1C3T A;  1P98 A;  2KYW A;  3N20 C;  4ZHP A;  1QOA A;  1KLU D;  1FXI A;  2FUG 1;  3PT2 B;  5IOI A;  5TSS A;  2LXA A;  2ZCB A;  1OGW A;  4HJG E;  4M00 A;  2L7R A;  1E0Z A;  1FNW A;  2I1J A;  4HEA 1;  4XGA B;  3NZS A;  2KX0 A;  4WWP A;  3UGB B;  1ET6 A;  2FIF A;  3DBR I;  1YQB A;  1M4V A;  2L0T A;  3Q3O C;  1XXG A;  1VLB A;  4AOF A;  3H7P A;  4PYZ A;  1E7P B;  1JWS D;  2JSV X;  3PRZ A;  4JX1 C;  1WM2 A;  2C7N B;  3AE4 B;  2SEB D;  2YLM A;  2PLP A;  4W9D A;  3VR9 B;  3U2S C;  1T5X D;  1PGB A;  2WXR A;  2IYD B;  5G2N A;  4ZRI A;  3GOE A;  4B6W A;  3PLV A;  2DEN B;  4A6Q A;  1KFY B;  1YX5 B;  2JZZ A;  2BYE A;  1SE3 A;  2L32 A;  2XEW A;  4W9J A;  2W82 A;  5AUK A;  3AE5 B;  5C3J B;  3LJ3 A;  2AX5 A;  3V6E B;  5JHA A;  3TUO A;  2XK5 A;  2GI9 A;  4AQ7 A;  2V4I B;  2N9X A;  4BKT A;  1TS4 A;  2WDQ B;  4J6I A;  3LXF A;  3VR8 B;  4MH0 E;  3OAW A;  1ESF A;  4W9H A;  3VHT C;  3A1Q B;  4KGS A;  2GRI A;  2JU6 X;  3FKY A;  4BOS C;  1P9D U;  4GDK A;  2JX5 A;  2MP2 B;  4KZ0 A;  3PLU A;  1KH0 A;  3ZNZ B;  4GOC A;  1BT0 A;  5EE9 A;  1Y56 A;  4USA A;  3QHT A;  1J7B A;  4YXD B;  2EKE C;  3JYU A;  3NS8 A;  2A4Z A;  3BK2 A;  2RMM A;  1YJJ A;  2PMV A;  4MJS A;  2PPH A;  4JIO U;  1OQQ A;  2FUH B;  4RNA A;  3VUY A;  3OLM D;  1JW9 D;  3W1S A;  3P2B A;  4KIK A;  1GAQ B;  1UD7 A;  1GC7 A;  1FNU A;  1Z2M A;  2ZW0 A;  2WXF A;  2J0M A;  3VQI A;  2WWZ A;  1UNS A;  1VZ8 A;  1V9J A;  4BAX A;  1QLB B;  3B1L X;  3R7R A;  1KM7 A;  4FJY A;  2BB6 A;  2KDE B;  2G1E A;  5D6J B;  4LCD E;  1E5W A;  3BII D;  1NDD A;  4C7Z A;  3ABV B;  4PS7 A;  2KWD A;  4KKI A;  1CQV A;  4ANV A;  1LFD A;  1I4P A;  4OVV A;  2L8J A;  3ZQ4 A;  4IM2 A;  1UF0 A;  1WYW B;  1FM0 D;  1WXV A;  1OQY A;  1YN5 A;  2PVO D;  4OVZ A;  3W5V B;  1Z5S B;  2FNJ B;  2BYF A;  1TZO A;  5LXH A;  1ZW7 A;  3GB1 A;  1P7E A;  3I5J C;  4ZRJ A;  2QIE B;  2V0G A;  3R2I A;  3RNE C;  1A5R A;  3ENE A;  1YIW A;  2LJI A;  1UBI A;  2M19 A;  4MEL A;  4HRS A;  4JWS C;  2Y5P A;  1T6B X;  1WIA A;  2DZK A;  2KAN A;  3ZDM C;  3EA6 A;  1GB1 A;  2KWC A;  4W9K A;  4LNF A;  3VTW A;  3NVZ A;  3BYY B;  1V1O A;  4DK5 A;  3RPF C;  2L1A A;  4MDK E;  4WQM A;  1V5T A;  3KVF B;  2JPH A;  4WJO A;  4NAW B;  4N6E B;  3AE3 B;  1GOZ A;  1TIF A;  2KWU B;  1FPY A;  3AEA B; 
#chains in the Genus database with same CATH homology
 1ROE A;  1DOX A;  1VZ7 A;  4XDD A;  2R61 A;  3HVD A;  4AS1 A;  3R2T A;  3PO0 A;  1E6E B;  1TS3 A;  4XWW A;  2OHF A;  2DYO A;  2H88 B;  3BVG A;  3ZYY X;  2N9L A;  3P4R B;  4HKZ E;  5BMI A;  3BWU D;  2EEL A;  2XN9 C;  1YQ3 B;  1VR9 A;  2AQ3 B;  3HVZ A;  3KQ4 A;  1QF6 A;  5HG2 A;  1MHX A;  4RCO A;  4YTM B;  3NVV A;  1QKZ A;  3GS2 A;  2KQ4 X;  4DQO C;  1PGX A;  4YSY B;  2INN E;  1JWM D;  5H8Y E;  2IPK D;  3HUI A;  1QIL A;  3BZD B;  1N5W A;  3SFD B;  3T3N A;  2FE8 A;  4JE3 B;  2KN4 A;  3PZ7 A;  1MVK A;  1KF6 B;  2LEK A;  1D5M C;  1VRA B;  3KWV A;  2WXL A;  1BUI C;  3AE1 B;  1K53 A;  4JWU C;  2G9H D;  2I38 A;  3AE6 B;  3IT4 B;  1V8C A;  4DXF A;  2BT6 A;  1UWX A;  2GB1 A;  4GLS C;  2WXO A;  2WNM A;  4WH4 A;  5D3D A;  1A70 A;  4L2Y A;  1AW7 A;  2N9K A;  3ZGZ A;  1HXY D;  1L6U A;  1TS5 A;  1EM7 A;  4KGR A;  4PT5 A;  5I4D A;  1IBX B;  3NZ3 A;  1RYJ A;  2KDM A;  2KAJ A;  1QOF A;  4H2A A;  4O1N A;  4L1B A;  3R8B A;  1L5P A;  2YEP B;  3AEC B;  2WXI A;  1XF5 L;  1YQ4 B;  2BW2 A;  5BYS A;  3AEB B;  4FXC A;  3U52 E;  2IDY A;  2W3R A;  3B9J A;  1FCL A;  4REZ A;  1C9F A;  3AB5 A;  2E6X A;  4P16 A;  1AYF A;  1V1P B;  2OED A;  1K51 A;  3L4P A;  3Q8C A;  1PFD A;  1ENF A;  2TSS A;  1XLO A;  1V1P A;  5EE1 A;  1XLQ A;  2PIA A;  3I9V 1;  1FO4 A;  2WXM A;  3IXS A;  4C7Y A;  1ZXI A;  2N0S B;  2W54 A;  4UDU C;  1HEZ E;  2M56 B;  2LFI A;  3FAH A;  5G5H A;  1L0Y B;  5E6J A;  2K0P A;  3AEG B;  1KLG D;  4WIP A;  4ZHO A;  1FIQ A;  1D5Z C;  4YTP B;  3BVM A;  1C79 A;  3MFG A;  1MPE A;  3LYY A;  4M0W A;  2JYE A;  3AED B;  4IDI A;  3KLS X;  2SAK A;  1AWD A;  1K50 A;  3Q69 A;  3AE2 B;  3VRA B;  4MH8 A;  3TEX A;  1KRH A;  5C2T B;  3IT6 B;  4C56 C;  2WXN A;  1I4H A;  3AM9 A;  1IGC A;  1TKY A;  2BTE A;  4WUR A;  4TQ0 A;  1VZ6 A;  1F2R C;  1MI0 A;  3HRD D;  5D7G A;  2QJL A;  3KWL A;  2L52 A;  1HQR D;  2BS4 B;  2PTL A;  2JXT A;  4OZB A;  3E56 A;  5HFY A;  4MAC A;  4NAM A;  1DOY A;  5FKA C;  2MJD A;  1ZP0 B;  1TS2 A;  4NZL B;  1SBB B;  4NJC A;  1YN3 A;  4US8 A;  1OQR A;  2JYT A;  4N58 A;  3DWG C;  1N60 A;  3FC4 A;  4JPS A;  2K22 A;  1XEE A;  3UI3 A;  2ON8 A;  1RWS A;  4A8X C;  1XLP A;  2VZK D;  4KX6 B;  1EWY C;  2INP E;  3Q8A A;  2BB5 A;  2CU3 A;  2CJO A;  1JWU D;  3Q8F A;  1JWA D;  1CZP A;  3FIL B;  1JRO A;  1FRR A;  2IGH A;  3WCQ A;  1HZ5 A;  1RM6 C;  3SFE B;  3CWI A;  4KGT A;  2K5P A;  2V3N A;  4RF1 A;  2H89 B;  3P63 A;  1SE4 A;  3W2D A;  1C4P A;  1KTK A;  5BMH A;  2MEK A;  3GP7 A;  1I4Q A;  3EGR A;  2X38 A;  3N9Y C;  4TQ1 A;  5BYR A;  4YSZ B;  1WWT A;  5LNK 1;  2RDH A;  1I4X A;  1FRD A;  3TEW A;  1N63 A;  2Q5W D;  3NVW A;  3AE7 B;  3NVY A;  1UWM A;  2BS3 B;  3BYT B;  4RGO S;  1D6E C;  2K9X A;  1D5X C;  3V3X A;  1F0Z A;  3OWE B;  3PZ8 A;  1SB3 C;  4P6V F;  4R3D A;  1VJK A;  2IGD A;  2KAC A;  3DWM A;  2JQR B;  3ZJT A;  2CJN A;  1XCQ L;  1NVI D;  2EKI A;  1TKG A;  2V3P A;  1ZDX A;  4WAF A;  2RPV A;  2K3U A;  2BYT A;  1K52 A;  3MP9 A;  4LLG M;  1FFU A;  1ZOY B;  1MHH E;  4TMA B;  4RGM A;  5BYQ A;  4B0E A;  3RFZ B;  2WXK A;  4TSS A;  1Q10 A;  1IBX A;  3AE8 B;  2HDE A;  1SF0 A;  3O13 A;  4HRO A;  1QOB A;  4RH6 A;  2FBW B;  4A90 A;  1EU3 A;  5H92 C;  2JWU A;  1CK1 A;  1YNT E;  3AEF B;  4YTN B;  4RGN A;  1AN8 A;  2WDV B;  3J9C A;  1D4B A;  3W9C B;  1HZ6 A;  5GXG B;  3VRB B;  1DOI A;  4ARI A;  2MH7 A;  1C4A A;  4ZHP A;  1FEH A;  2LGI A;  1IUE A;  1QOA A;  1KLU D;  1FXI A;  2FUG 1;  5TSS A;  1GB4 A;  4YWG G;  5MPO A;  1NEN B;  4HJG E;  1E0Z A;  1FNW A;  3URY A;  4HEA 1;  4LK0 M;  4ZYS A;  1LO5 D;  2MJ3 A;  1QT9 A;  1ET6 A;  2IJ0 A;  4MT5 A;  2N7J A;  1YN4 A;  1ZPS A;  4Q2J A;  1C77 A;  1M4V A;  2QSD A;  3AMZ A;  1XXG A;  1VLB A;  3NUH B;  2J52 A;  1SJE D;  4OW0 A;  5FK9 C;  4C80 A;  4YSX B;  2QMT A;  1NYR A;  1FXA A;  1E7P B;  1JWS D;  2JSV X;  1JML A;  1N62 A;  2WDR B;  2HTM E;  2WQY B;  4JX1 C;  1R7S A;  1XCT L;  2W55 A;  4OHJ A;  1WRI A;  3AE4 B;  3ZJV A;  2SEB D;  2PLP A;  1C76 A;  3VR9 B;  2PVG C;  3U2S C;  1T5X D;  1PGB A;  3MJ5 A;  2WXR A;  4YT0 B;  3NS1 A;  4EE2 A;  2LHD A;  1FMA D;  4A6Q A;  1KFY B;  3ETR A;  1STE A;  1SE3 A;  4IKG A;  4XWT A;  2IGG A;  1QQR A;  3TEZ A;  2L32 A;  1SJH D;  2W82 A;  3AE5 B;  5AUK A;  5C3J B;  2AX5 A;  1E10 A;  1F77 A;  2WXH A;  3I57 A;  1OFF A;  3TUO A;  2GI9 A;  2Y3A A;  2WXP A;  3P4P B;  4AQ7 A;  2V4I B;  4ARC A;  1TS4 A;  1F2R I;  4RGT A;  2WDQ B;  3LXF A;  3VR8 B;  1ZDV A;  1ESF A;  3TSS A;  5EE3 A;  2Z8L A;  3FIL A;  4KGS A;  2Y5C A;  3AV8 A;  3E9S A;  1JWB D;  2NTT A;  1WXQ A;  3B2G A;  4A55 A;  3MC0 B;  2JU6 X;  2GRI A;  4GDK B;  4ITK A;  1T3Q A;  3U4E G;  1JRP A;  2M0A A;  3P1M A;  5T8I A;  1SXT A;  2WS3 B;  2PW9 A;  2WXQ A;  2JX5 A;  3V05 A;  2WLB A;  4OZC A;  5HHD G;  1KH0 A;  1WYG A;  2LUM A;  1SIJ A;  4GDL B;  3P4S B;  1TKE A;  5D3I B;  5EE9 A;  1Y56 A;  1BML C;  3H8H A;  4D2K A;  3SR6 A;  1RFK A;  4USA A;  1VDV A;  1J7B A;  2VZK B;  2KMM A;  4YXD B;  1PUT A;  2BBC A;  2LHE A;  1DGJ A;  3AEE B;  1J7C A;  2JZP A;  1FCC C;  3BK2 A;  4J3O D;  2RMM A;  4WWM A;  1C4C A;  1YJJ A;  2PMV A;  2WXJ A;  1CJE A;  1TYG B;  3B2F A;  2AQ2 B;  1FNV A;  2PKO A;  1OQQ A;  2E3T A;  2NMQ A;  5HI1 A;  4RNA A;  3W1S A;  1JW9 D;  1QOG A;  2DLB A;  3T3O A;  1GAQ B;  1YMH E;  4CQN A;  4XE0 A;  1FNU A;  4ZRP A;  2ZW0 A;  2WXF A;  3BVZ A;  1XO3 A;  2LMC A;  3VQI A;  2ACZ B;  4DXG A;  1UNS A;  1UUP A;  1FD6 A;  4KKJ A;  1VZ8 A;  3MHZ A;  1GPX A;  2WXG A;  1L0V B;  1N61 A;  5FR3 A;  1QLB B;  3NRZ A;  2J53 A;  1NEK B;  3Q8E A;  1JQ4 A;  4B0M A;  1PYW D;  1EU4 A;  2BB6 A;  2RDG A;  2G1E A;  3AH7 A;  1WGK A;  3BII D;  1HA5 A;  4ZRQ A;  4LTU A;  4C7Z A;  3ABV B;  2KWD A;  4KKI A;  1CQV A;  1ET9 A;  3IAM 1;  1I4P A;  3LB8 C;  1TJE A;  1JAL A;  1JCK B;  3ZQ4 A;  1I4G A;  3SEB A;  1V97 A;  1SEB D;  2ICI A;  4RFB A;  2ZW1 A;  4ZOH C;  1FM0 D;  1TY0 A;  1YN5 A;  3CIR B;  2PVO D;  4OVZ A;  3W5V B;  3W5U B;  1TY2 A;  3IAS 1;  2DBY A;  3U7Z A;  1TZO A;  2WU2 B;  1J7A A;  1N5X A;  2J42 A;  2ONQ A;  4HKQ A;  2B76 B;  1IGD A;  3GB1 A;  3P42 A;  1UGJ A;  1P7E A;  2AQ1 B;  2NTS A;  2QIE B;  3C8Y A;  4L23 A;  2V0G A;  1ZXH A;  2DYM A;  1P7F A;  1ZE3 D;  3BK1 A;  1L6V A;  1EWC A;  3Q8B A;  3R2I A;  1PDX A;  2XNA C;  2BS2 B;  4MM3 B;  2LJI A;  5AUI A;  1BXT A;  4A9A A;  1L4D B;  2M19 A;  1C78 A;  4IOI E;  4OZA A;  4HRS A;  2J4X A;  2W3S A;  4JWS C;  2Y5P A;  1T6B X;  1ZUD 2;  2WP9 B;  1L0X B;  1PGA A;  1DYQ A;  1SSN A;  2QEJ C;  1NI3 A;  1E9M A;  3EA6 A;  1GB1 A;  1YJI A;  4XDC A;  1WSP A;  1B9R A;  3NVZ A;  2WU5 B;  3BYY B;  1V1O A;  4N59 A;  2I2Y A;  3AE9 B;  3AN1 A;  4US9 A;  3TEY A;  3ZJU A;  3RPF C;  2DWQ A;  2L1A A;  1ACC A;  1I7H A;  1SE2 A;  1NYQ A;  3P4Q B;  2D5G A;  4WQM A;  1L4Z B;  2YEP F;  2MJE A;  1XLN A;  4NAW B;  3EUB 2;  5G5G A;  2QIL A;  4N6E B;  1B1Z A;  2L83 A;  1I4R A;  3AE3 B;  4RF0 A;  5JXV A;  1FFV A;  1GOZ A;  5EE0 A;  5BMG A;  3AEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...