1MHHE

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
b'EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEWTADLEDGGNHMNIKFAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 18
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhhE00
4KGRA 1XCTL 2RPVA 2RMMA 1HZ6A 2JXTA 2N9KA 2LGIA 1K53A 2LHEA 1MHHE 2I38A 2KWDA 1ZXHA 5JXVA 1PGAA 4OZCA 4OZBA 1XF5L 1Q10A 1UWXA 1XCQL 4HKZE 1JMLA 1F2RC 2LHDA 3FILA 2IGHA 2KACA 1K50A 4IOIE 3FILB 3V3XA 1IGDA 3UI3A 2ON8A 2J53A 5HFYA 1C9FA 1HZ5A 1GB1A 1MHXA 1K52A 1GB4A 2ONQA 2N9LA 4WH4A 1MVKA 5BMIA 4OZAA 2J52A 2JSVX 1PGBA 2KQ4X 2N7JA 5BMGA 1P7EA 2KN4A 4GLSC 1KH0A 1PGXA 1EM7A 2K0PA 2I2YA 2PW9A 4D2KA 2ZW1A 1MI0A 2GB1A 5HI1A 2JZPA 1F2RI 2NMQA 2PLPA 2ZW0A 2OEDA 4KGTA 3MP9A 1QKZA 1IBXA 2QSDA 1FCLA 2GI9A 2JU6X 4KGSA 3GB1A 5HHDG 1K51A 1IBXB 2QMTA 1P7FA 2LUMA 2KDMA 1YMHE 5BMHA 4MACA 4IKGA 4HJGE 2IGDA 1MPEA 2IGGA 1IGCA 1FD6A 1FCCC 1D4BA 5HG2A 2JWUA 2EELA 1HEZE 2PTLA 1YNTE
chains in the Genus database with same CATH superfamily
3W1YA 4DHJD 5IO9A 4CHKA 1XD3B 4JL9A 4EKUA 3LXFA 3PRZA 3KYDD 1SIFA 4I6NB 2JZ3B 2AL3A 2OJRA 3RFZB 2I38A 1RFKA 4KV2A 2WXIA 2WXLA 2WHIA 4II2B 4YTMB 4OZBA 3MFGA 1Q10A 2CJNA 5I4DA 4FBJB 3M3JA 3WAOA 2X8XX 1JMLA 3QX1A 3JVZX 1OQRA 3H7SA 4DHZE 2IGHA 1ZUD2 3VFKA 4G0NB 3BWUD 4UDUC 1IYFA 1V9JA 3BK2A 1R4MB 4LCDE 1GC6A 1YJ1A 4J6IA 2MP2A 4E3CA 4AQ7A 3SHQA 3PHWB 2KJHB 3ZW3A 2J7QB 2MJ3A 4WIPA 2YEPF 3RUIB 1C77A 4WAAA 2ICIA 3ETRA 3GOEA 4RGNA 3AE7B 3R2IA 1F2RI 4HJKA 1XLQA 2VH1A 4KGTA 4PYZA 4NAWB 4REZA 3P4PB 1C1YB 3SEBA 2MCNB 1T0SC 2M0AA 2WXRA 2JVCA 3Q3JA 4JWUC 4XE0A 4MACA 4IKGA 1ZDXA 3VRBB 4IDIA 1PFDA 1UGJA 2KK8A 1KJTA 4NQLB 2L0TA 2OJWA 2KJ6A 4NJ7A 4R3DA 3VH4B 1YJIA 2M0XA 1D4BA 4KSLC 4TQ0A 2VZKB 4ZRJA 4KIKB 2D07B 2SEBD 2PTLA 4RGOS 2M1MA 4IC7B 2YLMA 4LDTD 1T3QA 1XCTL 5DCNA 3AN1A 3PREA 3M62B 4RFBA 3KLSX 1TKEA 1YX5B 4M8MA 2WNMA 2SAKA 3QARA 4G11A 1D5ZC 1P98A 2BWES 1E7PB 4RF0A 3A9JB 2ZPNA 3QK0A 2BWFA 2L1AA 3DPDA 3N3KB 2MRPA 1AWDA 2BB6A 2MWSB 4YSYB 1WGHA 2E6XA 3PT2B 3D32A 2ZZPB 1MHXA 5D94A 4P7IA 2K8HA 3ABVB 3WIMA 5J2RA 2WXPA 1BMLC 3H9DA 2G4SA 1DOXA 3P42A 1EU3A 2WXMA 4ZHPA 2N7JA 1P7EA 3AXCA 2XEWA 2KN4A 2QJLA 1EM7A 2KTRB 1SE9A 4X57B 2W54A 4MM3B 3ZJUA 4TUUA 3L08A 1E8ZA 2LRWA 2AQ2B 1E8WA 3DWGC 4ZRQA 4GDKB 4GGQA 2KKCA 4E74A 4HDOA 5LNK1 3VUYA 1WR1A 2C9WB 3RNEC 2KX3A 3ZDMC 4ZRKA 4BZAA 2CKHB 4A3OA 4BFRA 5TR5A 3O65B 2MQJA 2BYVE 5CHFA 2G9HD 3BVGA 3VQIA 2BS3B 4DHJB 3OWEB 4HCPB 2OOBB 3SU8X 3KH0A 2W55A 4NPNA 3I57A 1GPXA 2WGSA 1E8YA 3AULA 2PJHA 3VTVA 2QILA 3LB8C 4IM2A 2KXJA 4PK1A 4LNIA 4JLCA 3Q3FA 4XX5A 2HD5B 1UELA 2KQSA 2W9NA 3H6NA 3P1MA 4HVBA 1D5MC 1WM3A 2JZZA 2KACA 4ANWA 4WWPA 1WXAA 4CO7A 2WU2B 4M01A 4M00A 2KYWA 4ZOHC 2L00B 2N9XA 4A3PA 3MJ5A 3P4QB 2PE9A 3A4SC 2AQ1B 1AARA 1L0VB 4KKJA 4CYEA 3ZVVA 4KVGB 2V4LA 3NRZA 4MH8A 2QIEB 1JCKB 1FPYA 4IW0A 2KWVB 3P2BA 3IXSA 4NY0A 3DVNU 4GLSC 4RM8A 1JWUD 4DXAB 4GIVA 3ML9A 4W9DA 5CX3A 2YVCA 1N60A 1H4RA 4FADA 1KFYB 2LGYA 1AYFA 4NAWA 4HPPA 2JQRB 3BVMA 2KFKB 2Z8LA 2DYMA 2JYEA 3UIPB 3AV8A 1I4QA 4EZLA 4KZ0A 2DLBA 4P1BC 4WJOA 4HCNB 3U7ZA 1WWTA 3PLVA 1TY2A 1WH3A 4KIKA 4IM0A 1RWSA 3U52E 3AB5A 3TEXA 3RZFA 1IUEA 5G5GA 1WGYA 3W5VB 2JF5A 3L13A 1VJKA 3PZ7A 4EZKA 1EWYC 2KVZA 3ML8A 2D3AA 3W1SA 1D5XC 1ET6A 2IO1B 1EU4A 3MTNB 4HK2A 3HM6X 4K3CA 2Y5PA 1QOAA 3J9CA 1V1OA 4K7WA 2KANA 2LMCA 2NCNA 5J18A 4OZCA 1TTNA 4FJYA 2UWQA 1WMHB 3B2GA 1CZPA 3A9JA 4A8XC 1F2RC 2C60A 3MHZA 4HWIB 5FK9C 3X23A 1RM6C 4AUQC 3RNCC 2K25A 2LWPA 3Q8BA 4LNKA 1C3TA 1WGDA 1WRIA 5IOIA 2HJ8A 3I3TB 3W2DA 4WH4A 1F52A 3RMKC 4LJOB 3EC8A 2J4XA 3A33B 2J52A 2JSVX 4BKGA 3PRMB 1L4DB 1C4PA 2KTRA 2FNJB 1QOGA 3SD5A 4MM3A 1RLFA 3IT6B 1ISNA 1MI0A 4XC2A 4IG7B 2MEKA 3P4SB 3OG5A 4GDKA 3MC8A 1WFYA 3FAHA 2RD0A 3UQBA 3KWVA 2NBUA 4IUMB 3TEYA 4FXCA 3MC0B 5JH5C 4MELA 3IBEA 3TIXA 1YN4A 2J42A 2V1YA 1P7FA 2QEJC 1L4ZB 1ZDVA 2G3QB 4TQ1A 1Q1OA 1GOZA 4M8NA 1XO3A 2MLBA 4EE2A 1MPEA 4W9CA 3U2SC 2IGGA 3TUOA 3QAQA 4P6VF 3IVFA 3T3NA 1Y56A 3I63C 4MH0E 2L76A 2WXOA 1T0QC 3BVZA 1FFUA 3GZNI 3VH3B 3QWZB 4YWGG 2BGFA 5EE1A 5C1ZA 3APFA 2Z0DB 1R7SA 1UZXB 2RDHA 1E7UA 4K7UA 2RGFA 1SEBD 1UBQA 3B9JA 4HLEA 2HJ1A 1OQYA 3DHIC 1WIAA 3ZYYX 5L83A 2KDBA 1T0RC 2WU5B 3WA0A 2I1JA 2N9LA 3DBLB 4EZJA 5EDSA 3AEBB 3NVYA 3PS6A 4BOZB 1QLBB 1WYWB 2BTEA 2K0PA 2CS4A 5BO4B 3NZSA 5G5HA 4AWJA 3B2FA 3VRAB 2FIFA 5AUKA 1I42A 3VVWB 1FO4A 2MBQA 2AL6A 2BT6A 4MDKE 2KFKA 2D3BA 1A70A 2H89B 4RCOA 2BB5A 2RDBC 4RNAA 4IWPA 1K51A 1IBXB 1L0XB 1RFAA 1XLPA 4XYCA 2DYOA 1V86A 4M02A 3ZXRA 4BKSA 3Q14C 4ZYSA 4W9IA 2GMIC 4MGYE 1V97A 1E90A 2Y5BB 2HTHA 3ZJVA 1TJEA 3OLMD 1JALA 3X0WA 2CHZA 1KF6B 1YX6B 1JROA 2GOWA 5E6OA 1B1ZA 1HTQA 1K53A 2FAZA 1UF0A 2MX2A 1Z2MA 1SBBB 1WMHA 2LGDA 3TEWA 3KQ4A 4RF1A 1M4VA 2AEHA 3DBRB 1WF9A 3NOBA 1ZW7A 3EFUA 1E0ZA 3DBHI 2C5LC 1HXYD 4CQNA 5DPRA 1L2NA 4PS7A 3EGRA 1V81A 3RNFC 2NBVB 3JYUA 3FILB 1NENB 3NVVA 5JHAA 2ON8A 4MJSB 1C9FA 3N30A 4ZRIA 3KWLA 4MEMA 4NJ6A 4WQMA 3IFWB 2LASA 2N0SB 3BYYB 1WRDB 2IZVB 4Q2JA 1VZ8A 2AX5A 4YT0B 2BKFA 4K81A 2WYQA 4DBGA 3OAWA 3UF8A 1VDVA 3LYYA 1IPGA 1WI0A 5HI1A 4WWOA 1E9MA 3ZRFA 4B0EA 3Q8FA 3V61A 2ASQA 1N5XA 4MSQB 3UQAA 2G4DB 1ROEA 1XLNA 3NS1A 4KGSA 2YEPB 2WDQB 1FNWA 3VUWA 2ZCBA 1YMHE 1TY0A 1S3SG 2WXKA 1GJZA 3DVNV 1F77A 3EECA 5CHVC 3AM9A 2L05A 2MBHA 2CR5A 2ZEQA 4KDIC 3AE4B 2I1KA 2WX1A 2WX0A 2LI5A 2OHFA 2RPVA 2K8BA 1UH6A 1JWSD 2PKOA 3ZKJC 2MBEA 2V0GA 1QF6A 2WXNA 3U4EG 1CQVA 2LVQA 5D6JB 2IY1B 4HPLB 4W9FA 3VXWA 3GP7A 2O2VA 3BINA 1PUTA 2LD9A 4E71A 3V3XA 3VAWA 4FJZA 3L16A 2INDC 4RM9A 4DWFA 4DHZB 2HDEA 3K9PB 1I35A 4AOFA 1PDXA 3V60A 1N6ZA 1FMAD 2LFIA 4JIOU 2C7MB 4MGIE 2KMAA 1J7BA 4RGMA 3QCAA 1A5RA 4TMAB 4C7YA 4G50A 3A9KB 2R2OA 4K3BA 2I2YA 1ZOYB 3T8MA 5BYQA 5L95C 2V9HA 3ZDTA 4HKQA 1E6EB 4ANXA 2PLPA 3URYA 3H8HA 5E6NA 1TZ1A 1QKZA 1IBXA 3ZTDA 4IM3A 2NBWB 2K6DB 2IPKD 5EE0A 2Y3AA 3AE8B 3MC9A 4GOCA 1KRHA 4ICVA 4ZHOA 3AE5B 3WALA 5CHWA 5HG2A 3FKYA 4YXDB 3AMZA 1R4NB 2UYZB 1KLVA 1TYGB 2N7DA 1V6EA 3GE8C 3APDA 1HA5A 1I4HA 5D3IB 2JXTA 5KHOA 1FXTB 4P16A 3PZ8A 5C3JB 2ACZB 3KUCB 1TZOA 4US9A 2B76B 1GNUA 2DYBA 2MH7A 4F1SA 4XDDA 3PGEA 1EWCA 3VTUA 3AEEB 1NYQA 1XCQL 2NPTB 4S0RA 4DDGD 5AZGA 1ZP0B 1V1PB 2FCQA 2ZVOA 2O6VD 1Y8RC 4JWSC 2N1WA 3FILA 3ECIA 5C2TB 3NHEB 4MJSA 1VD2A 2IO0B 1DOYA 3BY4B 1HTOA 2NVUI 2WXJA 1GB1A 5FR3A 3NG0A 1LFDA 2R61A 3K9OB 1WE6A 3A1QB 3DHHC 2EKIA 4OVZA 3TMPB 2WS3B 2R2QA 1RAXA 3N20C 3HVDA 1OEYJ 1PGXA 1FXIA 3ZO5B 3WAMA 2LGSA 3ZGZA 3PO0A 4YL8A 2BYFA 5AZFA 2LUEA 2L3ZA 4ZYNA 2KDEB 3GE3C 3GB1A 1OEYA 2BS2B 1TIFA 4FHJA 1YOVB 3MJWA 3CMMB 5FR6A 1MJDA 4HJGE 4H2AA 2W3RA 4JQWC 3PRPB 1OQQA 5JZEB 5G55A 5IKCM 1FCCC 4MGZE 2V3SA 2LXAA 2JWUA 4AJYB 4HPMB 2HTME 5E6JA 3IT4B 1SJED 3IG3A 3T3OA 4YSXB 4KGRA 1VZ6A 1P9DU 5D2MB 4NNJB 4L1BA 1T5XD 1WSPA 3RNGC 1EF5A 2PE6B 5IA7A 2PEAA 1T0YA 1NDDA 4HROA 2ZJDA 2LHDA 1QOFA 3RNAC 3QC8B 4LDTB 3ZNID 1WYGA 2W3SA 3PHXB 3N1ZC 3QA8A 2J53A 2M19A 2GBJA 1ZGUB 3DCGA 2M17A 2GBRA 3AE6B 5CTRC 3HUIA 1I4PA 1VLBA 2MW5A 3Q3OC 1MVKA 3C0RB 4N6EB 2VH2A 1SGHA 1HQRD 2M4NA 3A9KA 1TS2A 2L8JA 1DYQA 4GDLA 2ZPYA 3HK0A 1N63A 1NI3A 3M63B 4DK5A 1WGGA 3VHTC 1B9RA 3ZUNA 2IDYA 5GMVA 1ZKHA 2JX5A 2AQ3B 3R7RA 1K8RB 1P3QU 3R7QA 2KMCA 4KSKC 5LLIA 3V6EB 1FIQA 4W9JA 2JWZA 2IGDA 4F7ZA 5LXHA 4MSMB 2BF8B 2X38A 3PPAA 1IGCA 5EE9A 2K5PA 4WJQA 1ENFA 1F0ZA 3DHGC 1WM2A 2JUOA 3AH7A 3L4PA 5TSSA 3LDZE 4GN1A 2XK5B 3ZNHB 1JWBD 4BBNF 2KT7A 3JW0X 1GAQB 3N1YC 3I5JC 1XLOA 3PVLA 3ENEA 3TL5A 3NY5A 1L5PA 2LVPA 2NPTA 2JY6A 1V1PA 3Q8CA 4MT5A 1CMXB 4WURA 2IY0B 4HKZE 2O6VB 2KC1A 3C8YA 4XWWA 1J8CA 2WP9B 1R4MI 2FBWB 4B6WA 2IJ0A 3P63A 4NJCA 3UI3A 3DVGX 1CK1A 3DDCB 2NR2A 3A1QA 4JGHB 1PYWD 3KW5B 3E56A 3NUHB 2PVOD 2D2QA 2K1FA 1UD7A 2XN9C 3FC4A 2KQ7A 1J19A 1PGBA 2O2VB 4ACFA 2WLBA 2PIAA 5J17A 1GG3A 1E10A 4N58A 3AE2B 3UINB 2PPHA 1AN8A 2DWQA 1C78A 4XZ4A 3NZ3A 2NMQA 1DGJA 3Q3NC 2VZKD 3ZLZA 1BXTA 2MBBB 4C00A 4BOSC 2HE7A 2RPQA 2WWZA 4BBNC 3AI5A 4LLGM 1SIJA 2J0MA 1SSNA 3ZXVA 1FNVA 3WANA 2N4FA 4HEA1 2L32A 2KLCA 2L52A 1F1HA 2FCSA 1SB3C 1TT5B 1BT0A 4EUTA 4RMAA 1UWMA 1YIWA 3DQVA 4AP4C 1YQ3B 1SE2A 1UUPA 1VZ7A 2XNAC 4LJPB 2MSED 4JX1C 1WXMA 3KUDB 3TEZA 2KAJA 3ALBA 2K39A 2ZNVC 2QDFA 1EUVB 2K9XA 2LHEA 1AW7A 1RYJA 4W9HA 2AYOB 1V80A 1ZE3D 1PGAA 4ASWC 1FRDA 2JRHA 1UWXA 1PQSA 2ZVNA 2GBNA 4RGTA 1ZXIA 4YTNB 2KMMA 4NAMA 4FN2A 5GXGB 4RH6A 3AU4A 2KD0A 2TSSA 2FCNA 2LJIA 3O13A 4US8A 2DX5B 4PT5A 5G2NA 3E9SA 2Q5WD 1FFVA 2AWTA 3DVGY 1KOTA 1QILA 2E3TA 1TKYA 4KZCA 2M8SA 3RPFC 3EFCA 1WZ3A 1WE7A 4LK0M 4C4VB 2QCZA 1C4CA 4BKTA 2NTTA 3V62A 3HIZA 2ZW0A 2M56B 5KHQA 1U4AA 3QIJA 1GC7A 2FUHB 5HHDG 4HRSA 4EEWA 2LUMA 1QZEA 5BMHA 1JW9D 2KLGA 3ZNZB 1SXTA 1TS5A 2KWCA 3U30A 3B08A 3RT3B 4BVUC 1JRUA 4PS8A 1L0YB 2JXXA 3Q2AC 3JSVB 2XK5A 5DPSA 2WXGA 1JWMD 4W9KA 2RMMA 2BW2A 2N1VA 4FJVB 2N9KA 4AS1A 2LGIA 1JWAD 2IO2B 3SFEB 3GZNB 1ZXHA 2V3PA 2WXFA 2O6VA 4GSWA 3R2TA 4GMVA 1WZ0A 4C80A 1WGKA 1XQQA 3T9LA 4IOIE 5D7GA 3SFDB 1UNSA 5H8YE 2A4ZA 4TV3A 4WWMA 1E7VA 2MJEA 1KLUD 3ONSA 1WXSA 2DBYA 4OVVA 1I4XA 1I4GA 3H7PB 3V05A 3TBLD 2V3NA 2DNFA 3EA6A 3KYCD 4DXFA 1UBIA 2LEKA 4LNNA 2EMSA 4L2YA 3RULA 1D6EC 2KDFB 2C7HA 1KH0A 4K7SA 4D2KA 3ZJTA 4YSZB 2JPHA 1JQ4A 4I6PA 3PV1A 4A20A 3AE1B 4BKSD 4WWNA 4EOYA 2QC8A 1P1AA 3B1LX 4GU2A 5T8IA 1WXQA 3H1UA 3AU5A 3CWIA 4M0WB 3ZIMA 2KDMA 1UGMA 3RCZA 1GUAB 1V8CA 2LVOA 2QHOA 5IP4D 3VUXA 1KTKA 4GDLB 1N5WA 4LNFA 3R3MA 2VRRB 1JRPA 1WXVA 4W9GA 4J3OD 2EELA 1J7CA 1P0RA 1FM0D 1E5WA 3Q8EA 2DZIA 2DHZA 3Q6BA 3IAM1 4OVUA 2RR9A 2D5GA 2CU3A 4N59A 3QHTA 1C79A 4JPSA 3HHMA 1OTRB 4IWOA 2L7RA 3WCQA 3VR9B 3U8ZA 1XEEA 2RSUA 2RDGA 2BKRB 4JE3B 4F8CB 4QAYA 2BYEA 1E8XA 1FEHA 4ITKA 3DBHB 3W5UB 1L6UA 1IP9A 1IGDA 1Z5SB 2WXQA 1G6JA 3RZWC 1QQRA 1V49A 3C19A 4L23A 1QOBA 1FRRA 1FXAA 5BMIA 1TGZB 1S1QB 1TKGA 4LTUA 2BBCA 4NQKE 5BYRA 2KQ4X 2FE8A 4C4VA 5BMGA 2K3UA 2KZRA 5IAAC 4PYUA 3W1SC 2FIDA 3OJ4B 4ARCA 3IHPC 3PLUA 1EF1A 1NBFC 1ZPSA 3NZUA 2H88B 1Q0WB 1EO6A 1DOIA 1T6BX 1KM7A 2KJRA 3QQ8B 1LO5D 1TS3A 2JRIB 1WR6E 2KN5A 3AEAB 4NZLB 3TJPA 3U7DA 1YD8U 2GBMA 3N9YC 5HKHA 4A55A 1XXGA 3RYTA 3AEGB 3CF6E 3N32A 2V4IB 4EFOA 3JSVA 2K22A 1YNTE 3SR6A 3HVZA 4ICUA 2J0JA 1V5OA 3HRDD 3OJ3A 3VR8B 1WX7A 4GXBA 2KVRA 1HZ6A 1LQBA 2N7EA 1WJNA 4ZRPA 3RI7C 2FCMA 1STEA 3APCA 3Q8AA 4OW0A 4WJNA 5DPTA 1I7HA 1WX9A 4A6QA 1NEKB 2INCC 1H8CA 1N62A 5H92C 3ZRCA 1VRAB 1LGRA 4YTPB 4IWQA 2Z0EB 3DBLI 5MPOA 2LGXA 4B95A 4FULA 3H7PA 4XGAB 2ONQA 4ANUA 2MBOA 3CIRB 1ET9A 3NS8A 1SE3A 2BS4B 3A4RA 1LXDA 4W9EA 3Q69A 1NYRA 1WJ6A 2KHWB 2BYTA 4FHKA 2CHXA 2UU7A 2GB1A 4OHJA 5DPWA 2JZPA 3L10B 4I6LB 1YN3A 2OEDA 2KX0A 4P1CC 1TS4A 3MP9A 2LXCA 4M0WA 1M94A 2QMTA 2DAFA 3LJ3A 3I9V1 1F9JA 2EMTA 3NJTA 2G1EA 4HXDA 2D10A 3AECB 1WGRA 2REXA 3L17A 5C23A 3TCAA 3MHSD 2PVGC 3BK1A 1V2YA 2KO3A 2LZ6A 5EE3A 1NI2A 4W9LA 4WAFA 2WDTB 1WX8A 3DBSA 3DOWA 1MHHE 1SJHD 4FLHA 3DBRI 1OFFA 3AEFB 3Q3MC 2J0KA 2EKEC 2W82A 3AE9B 3L0WB 1XF5L 4BAXA 1WY8A 2DZJA 4ANVA 5E6PA 3UGBB 3R8BA 1Q5WB 2KTFA 2DZKA 1L6VA 3CSFA 5HFYA 2CHWA 1HZ5A 2GBKA 2WQYB 2INPE 1K52A 1GB4A 2Y5CA 1CJEA 2DZMA 3UIOB 2NS5A 2MP2B 1J7AA 3QJZA 2D3CA 2WDVB 3ZNGC 3PSEB 4TSSA 3GS2A 4A9AA 4XDCA 1I4RA 1BUIC 4GB9A 2CJOA 2NTSA 4DQOC 2ZNVB 2MA9B 2WDRB 1C76A 2ZW1A 5FKAC 2IBIB 2BPSA 3PTFC 5D3DA 3VDZA 1FCLA 2GI9A 4B0MA 3KVFB 5AEKB 4DXGA 2INNE 3NVWA 1LM8B 2LJ5A 3VTWA 3N1XC 4ZDVA 5LXIB 3BYTB 2A5UA 4URKA 1MG4A 2N9PC 2JYTA 1HE8A 4WJPA 3WAPA 4N9F4 1FD6A 2BVCA 1RRBA 4HDQA 3TSSA 2G45B 1HEZE 2CU1A 2K8CA 2WXHA 3PZDA 1C4AA 2L83A 1N61A 2L0FA 2KFJA 3EHVA 4C56C 3RNBC 1SE4A 3BZDB 2KWUB 3BIID 4KX6B 3CSTA 4KDLB 1XT9B 1ACCA 1SF0A 4PS3A 2KWDA 1YQBA 5JXVA 1J0GA 4C7ZA 3M95A 2K6QA 5BYSA 4LNOA 4B9KA 1YN5A 2MJDA 2D3GA 3B0AA 1QT9A 1X1MA 4MGKE 3AE3B 4K1RB 1MFWA 2B3AA 3V6CB 1MG8A 2FUG1 4XWTA 5IN7A 1K50A 2N9EB 2LRUA 3DWMA 2BQQA 1D3ZA 3L54A 1KLGD 3ZQ4A 4TKNA 3IAS1 2DAJA 3W9CB 3AEDB 1OGWA 2IYDB 2KDIA 1NVID 2DENB 1VR9A 1ESFA 4OZAA 4ARIA 4DDID 1L7YA 2XBBC 2KNBA 3RD2A 4USAA 2GRIA 4KKIA 5JHBA 5AUIA 3ZTCA 2PW9A 4WQOB 3P4RB 3HM3A 2KOXA 3R66C 3SDLC 3KUZA 2QSDA 4FA6A 1FNUA 2JU6X 4O1NA 4A90A 4G3XB 1TBEA 1V5TA 2KC2A 2PMVA 2GLSA 3EUB2 2IO3B 3NVZA 2Z59B 3RN9C 3S2AA 1R4NI 1YJJA 4S17A 4AJWA 2ZCCA 2C7NB 2D11A 2MHJA 1WJUA 1VCBA 5AZHA 1WJ4A 2JT4B 4II3B 1YQ4B
chains in the Genus database with same CATH topology
3IAM1 3T3OA 4YSXB 4KGRA 2D5GA 3BVZA 1VZ6A 1FFUA 2CU3A 4N59A 4JPSA 1C79A 3LXFA 4YWGG 5EE1A 4L1BA 1T5XD 1WSPA 3WCQA 3RFZB 2I38A 1R7SA 1RFKA 2WXIA 2RDHA 3VR9B 2WXLA 1XEEA 4YTMB 4OZBA 3MFGA 2RDGA 1Q10A 2CJNA 4JE3B 5I4DA 4HROA 1JMLA 1SEBD 1OQRA 3IT4B 2LHDA 1QOFA 1FEHA 4ITKA 2IGHA 1WYGA 1ZUD2 3B9JA 3BWUD 3W5UB 1L6UA 4UDUC 1IGDA 2W3SA 2J53A 2M19A 2WXQA 3ZYYX 3BK2A 1QQRA 4L23A 2WU5B 3AE6B 3HUIA 1QOBA 1I4PA 1VLBA 1FRRA 1FXAA 2N9LA 4AQ7A 1MVKA 3AEBB 5BMIA 3NVYA 4N6EB 1QLBB 1TKGA 1HQRD 4LTUA 2BBCA 5BYRA 2KQ4X 1TS2A 2FE8A 2MJ3A 4WIPA 2YEPF 5BMGA 1DYQA 1C77A 2K3UA 2BTEA 2ICIA 2K0PA 3ETRA 5G5HA 3B2FA 3VRAB 1N63A 1NI3A 5AUKA 4ARCA 4RGNA 1FO4A 1ZPSA 2BT6A 3AE7B 3R2IA 1F2RI 1B9RA 1XLQA 1A70A 2H88B 4KGTA 1DOIA 2H89B 1T6BX 4RCOA 2IDYA 2BB5A 4NAWB 2JX5A 1SJED 4REZA 4RNAA 3P4PB 1K51A 1IBXB 1L0XB 1LO5D 3SEBA 2AQ3B 2M0AA 1TS3A 2WXRA 1XLPA 4JWUC 4XE0A 4MACA 4IKGA 1ZDXA 3AEAB 3VRBB 2DYOA 4NZLB 4IDIA 1PFDA 1UGJA 1FIQA 3N9YC 4ZYSA 2IGDA 4A55A 1V97A 1XXGA 2X38A 3AEGB 1IGCA 4R3DA 1YJIA 1D4BA 2V4IB 4TQ0A 5EE9A 2K5PA 2VZKB 1ENFA 2K22A 3ZJVA 1F0ZA 2SEBD 1TJEA 2PTLA 1YNTE 4RGOS 3SR6A 3HVZA 1JALA 3HRDD 3AH7A 3VR8B 3L4PA 5TSSA 1T3QA 1XCTL 1KF6B 3AN1A 1HZ6A 1JROA 1JWBD 4RFBA 3KLSX 4ZRPA 1GAQB 1TKEA 1B1ZA 1K53A 1STEA 1XLOA 3Q8AA 4OW0A 1SBBB 2WNMA 2SAKA 1L5PA 1D5ZC 1I7HA 1V1PA 3KQ4A 4RF1A 3Q8CA 3TEWA 4A6QA 1NEKB 1M4VA 4MT5A 4WURA 4HKZE 1E0ZA 1E7PB 1HXYD 4RF0A 4CQNA 1N62A 5H92C 1VRAB 2L1AA 3C8YA 3EGRA 4XWWA 2WP9B 2FBWB 3FILB 1NENB 1AWDA 2IJ0A 3P63A 4NJCA 4YTPB 2BB6A 3UI3A 3NVVA 2ON8A 4YSYB 5MPOA 2E6XA 1C9FA 1CK1A 3KWLA 1MHXA 1PYWD 3E56A 3NUHB 2ONQA 4WQMA 3ABVB 2PVOD 2WXPA 1BMLC 3CIRB 1ET9A 1DOXA 2N0SB 3P42A 1SE3A 2BS4B 3BYYB 1EU3A 4Q2JA 1VZ8A 2AX5A 2XN9C 3Q69A 2WXMA 3FC4A 1PGBA 1NYRA 4YT0B 4ZHPA 2N7JA 1P7EA 2PIAA 2WLBA 2KN4A 2BYTA 2QJLA 1E10A 1EM7A 4N58A 3AE2B 2W54A 1VDVA 4MM3B 3LYYA 2GB1A 3ZJUA 1AN8A 2DWQA 4OHJA 5HI1A 1E9MA 2JZPA 1C78A 4B0EA 3NZ3A 3Q8FA 2NMQA 1YN3A 2AQ2B 2OEDA 1DGJA 2VZKD 3DWGC 1TS4A 1BXTA 3MP9A 1N5XA 4ZRQA 4GDKB 1ROEA 1XLNA 4M0WA 3NS1A 4KGSA 2YEPB 2WDQB 5LNK1 2QMTA 4LLGM 1SIJA 1FNWA 3I9V1 1YMHE 1TY0A 1SSNA 2WXKA 2G1EA 1FNVA 4HEA1 2L32A 2L52A 3AECB 1F77A 3AM9A 1SB3C 1UWMA 2PVGC 1YQ3B 3AE4B 1SE2A 1UUPA 3BK1A 2G9HD 1VZ7A 3BVGA 2XNAC 3VQIA 5EE3A 4JX1C 2BS3B 3OWEB 3TEZA 2KAJA 2OHFA 2RPVA 4WAFA 1JWSD 2PKOA 2V0GA 1QF6A 2WXNA 2W55A 3U4EG 2K9XA 3I57A 2LHEA 1MHHE 1GPXA 1SJHD 1AW7A 1CQVA 1RYJA 2QILA 1OFFA 3AEFB 3LB8C 2W82A 3AE9B 1ZE3D 1PGAA 1FRDA 3GP7A 1XF5L 1PUTA 1UWXA 3P1MA 1D5MC 4RGTA 1ZXIA 3R8BA 2KACA 4YTNB 2WU2B 3V3XA 2KMMA 4NAMA 1L6VA 5HFYA 4ZOHC 5GXGB 1HZ5A 3MJ5A 4RH6A 3P4QB 2TSSA 2WQYB 2HDEA 2INPE 2AQ1B 1K52A 1GB4A 1PDXA 2Y5CA 1L0VB 4KKJA 1FMAD 2LFIA 2LJIA 1CJEA 3O13A 4US8A 3NRZA 4MH8A 4PT5A 2QIEB 3E9SA 1J7BA 2Q5WD 1FFVA 1JCKB 1J7AA 4RGMA 3IXSA 1QILA 2WDVB 4TMAB 2E3TA 1TKYA 3RPFC 4C7YA 4TSSA 3GS2A 4A9AA 4XDCA 4GLSC 1I4RA 1BUIC 4LK0M 2CJOA 2NTSA 4DQOC 2I2YA 2WDRB 1ZOYB 1C76A 1JWUD 2ZW1A 5FKAC 1C4CA 5BYQA 2NTTA 1N60A 4HKQA 5D3DA 1E6EB 1KFYB 2PLPA 2ZW0A 2M56B 1AYFA 3URYA 3H8HA 1QKZA 2JQRB 3BVMA 1IBXA 1FCLA 2GI9A 4B0MA 2Z8LA 5HHDG 4DXGA 2JYEA 2DYMA 2INNE 2IPKD 3AV8A 1I4QA 3NVWA 2Y3AA 4HRSA 5EE0A 3AE8B 2LUMA 2DLBA 5BMHA 1JW9D 1KRHA 4ZHOA 1SXTA 3AE5B 3BYTB 1TS5A 3U7ZA 1WWTA 1TY2A 2JYTA 1RWSA 1FD6A 3U52E 3AB5A 3TEXA 5HG2A 1L0YB 3TSSA 1IUEA 5G5GA 1HEZE 4YXDB 3AMZA 3W5VB 1TYGB 2WXHA 1C4AA 2L83A 1N61A 1HA5A 1VJKA 2WXGA 1JWMD 3PZ7A 1EWYC 1I4HA 4C56C 1SE4A 2RMMA 3BZDB 2BW2A 5D3IB 3W1SA 1D5XC 3BIID 2JXTA 1ET6A 2N9KA 4AS1A 1EU4A 1JWAD 2LGIA 4KX6B 4P16A 3SFEB 1ACCA 3PZ8A 2Y5PA 1QOAA 5C3JB 2ACZB 1SF0A 3J9CA 1V1OA 1TZOA 4US9A 2KWDA 2LMCA 2B76B 1ZXHA 2MH7A 5JXVA 4XDDA 4OZCA 2V3PA 2WXFA 4C7ZA 1EWCA 3R2TA 3B2GA 1CZPA 1NYQA 1XCQL 3AEEB 5BYSA 4C80A 1ZP0B 1V1PB 4A8XC 1F2RC 1YN5A 2MJDA 4JWSC 1QT9A 3MHZA 3FILA 1WGKA 3AE3B 5C2TB 5FK9C 2FUG1 4XWTA 1K50A 4IOIE 3DWMA 1RM6C 5D7GA 3SFDB 1UNSA 5H8YE 1DOYA 3Q8BA 1KLGD 4WWMA 3ZQ4A 1WRIA 2MJEA 1KLUD 3IAS1 2WXJA 1GB1A 5FR3A 3W9CB 3AEDB 3W2DA 2DBYA 4WH4A 2R61A 1I4XA 1I4GA 2EKIA 3V05A 1NVID 1VR9A 4OVZA 2V3NA 1ESFA 4OZAA 2J4XA 2J52A 2JSVX 3EA6A 4ARIA 4DXFA 2LEKA 1L4DB 2WS3B 1C4PA 4USAA 4L2YA 1QOGA 3HVDA 1D6EC 2GRIA 1KH0A 1PGXA 4KKIA 5AUIA 2PW9A 1FXIA 4D2KA 3IT6B 3ZJTA 4YSZB 3P4RB 1MI0A 1JQ4A 3ZGZA 3PO0A 2MEKA 3AE1B 3P4SB 3FAHA 3KWVA 5T8IA 1WXQA 2QSDA 3TEYA 4FXCA 3MC0B 1FNUA 2JU6X 4O1NA 3CWIA 3GB1A 4A90A 1YN4A 2BS2B 2J42A 1P7FA 2PMVA 3EUB2 2QEJC 2KDMA 3NVZA 1V8CA 1L4ZB 1ZDVA 4HJGE 4H2AA 4TQ1A 1GOZA 1XO3A 1KTKA 4GDLB 1N5WA 1MPEA 4EE2A 2W3RA 3U2SC 1OQQA 1YJJA 1JRPA 2IGGA 1FCCC 3TUOA 4J3OD 4P6VF 3T3NA 2JWUA 2EELA 1J7CA 1Y56A 1FM0D 2WXOA 2HTME 3Q8EA 5E6JA 1YQ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGR A;  1XCT L;  2RPV A;  2RMM A;  1HZ6 A;  2JXT A;  2N9K A;  2LGI A;  1K53 A;  2LHE A;  1MHH E;  2I38 A;  2KWD A;  1ZXH A;  5JXV A;  1PGA A;  4OZC A;  4OZB A;  1XF5 L;  1Q10 A;  1UWX A;  1XCQ L;  4HKZ E;  1JML A;  1F2R C;  2LHD A;  3FIL A;  2IGH A;  2KAC A;  1K50 A;  4IOI E;  3FIL B;  3V3X A;  1IGD A;  3UI3 A;  2ON8 A;  2J53 A;  5HFY A;  1C9F A;  1HZ5 A;  1GB1 A;  1MHX A;  1K52 A;  1GB4 A;  2ONQ A;  2N9L A;  4WH4 A;  1MVK A;  5BMI A;  4OZA A;  2J52 A;  2JSV X;  1PGB A;  2KQ4 X;  2N7J A;  5BMG A;  1P7E A;  2KN4 A;  4GLS C;  1KH0 A;  1PGX A;  1EM7 A;  2K0P A;  2I2Y A;  2PW9 A;  4D2K A;  2ZW1 A;  1MI0 A;  2GB1 A;  5HI1 A;  2JZP A;  1F2R I;  2NMQ A;  2PLP A;  2ZW0 A;  2OED A;  4KGT A;  3MP9 A;  1QKZ A;  1IBX A;  2QSD A;  1FCL A;  2GI9 A;  2JU6 X;  4KGS A;  3GB1 A;  5HHD G;  1K51 A;  1IBX B;  2QMT A;  1P7F A;  2LUM A;  2KDM A;  1YMH E;  5BMH A;  4MAC A;  4IKG A;  4HJG E;  2IGD A;  1MPE A;  2IGG A;  1IGC A;  1FD6 A;  1FCC C;  1D4B A;  5HG2 A;  2JWU A;  2EEL A;  1HEZ E;  2PTL A;  1YNT E; 
#chains in the Genus database with same CATH topology
 3W1Y A;  4DHJ D;  5IO9 A;  4CHK A;  1XD3 B;  4JL9 A;  4EKU A;  3LXF A;  3PRZ A;  3KYD D;  1SIF A;  4I6N B;  2JZ3 B;  2AL3 A;  2OJR A;  3RFZ B;  2I38 A;  1RFK A;  4KV2 A;  2WXI A;  2WXL A;  2WHI A;  4II2 B;  4YTM B;  4OZB A;  3MFG A;  1Q10 A;  2CJN A;  5I4D A;  4FBJ B;  3M3J A;  3WAO A;  2X8X X;  1JML A;  3QX1 A;  3JVZ X;  1OQR A;  3H7S A;  4DHZ E;  2IGH A;  1ZUD 2;  3VFK A;  4G0N B;  3BWU D;  4UDU C;  1IYF A;  1V9J A;  3BK2 A;  1R4M B;  4LCD E;  1GC6 A;  1YJ1 A;  4J6I A;  2MP2 A;  4E3C A;  4AQ7 A;  3SHQ A;  3PHW B;  2KJH B;  3ZW3 A;  2J7Q B;  2MJ3 A;  4WIP A;  2YEP F;  3RUI B;  1C77 A;  4WAA A;  2ICI A;  3ETR A;  3GOE A;  4RGN A;  3AE7 B;  3R2I A;  1F2R I;  4HJK A;  1XLQ A;  2VH1 A;  4KGT A;  4PYZ A;  4NAW B;  4REZ A;  3P4P B;  1C1Y B;  3SEB A;  2MCN B;  1T0S C;  2M0A A;  2WXR A;  2JVC A;  3Q3J A;  4JWU C;  4XE0 A;  4MAC A;  4IKG A;  1ZDX A;  3VRB B;  4IDI A;  1PFD A;  1UGJ A;  2KK8 A;  1KJT A;  4NQL B;  2L0T A;  2OJW A;  2KJ6 A;  4NJ7 A;  4R3D A;  3VH4 B;  1YJI A;  2M0X A;  1D4B A;  4KSL C;  4TQ0 A;  2VZK B;  4ZRJ A;  4KIK B;  2D07 B;  2SEB D;  2PTL A;  4RGO S;  2M1M A;  4IC7 B;  2YLM A;  4LDT D;  1T3Q A;  1XCT L;  5DCN A;  3AN1 A;  3PRE A;  3M62 B;  4RFB A;  3KLS X;  1TKE A;  1YX5 B;  4M8M A;  2WNM A;  2SAK A;  3QAR A;  4G11 A;  1D5Z C;  1P98 A;  2BWE S;  1E7P B;  4RF0 A;  3A9J B;  2ZPN A;  3QK0 A;  2BWF A;  2L1A A;  3DPD A;  3N3K B;  2MRP A;  1AWD A;  2BB6 A;  2MWS B;  4YSY B;  1WGH A;  2E6X A;  3PT2 B;  3D32 A;  2ZZP B;  1MHX A;  5D94 A;  4P7I A;  2K8H A;  3ABV B;  3WIM A;  5J2R A;  2WXP A;  1BML C;  3H9D A;  2G4S A;  1DOX A;  3P42 A;  1EU3 A;  2WXM A;  4ZHP A;  2N7J A;  1P7E A;  3AXC A;  2XEW A;  2KN4 A;  2QJL A;  1EM7 A;  2KTR B;  1SE9 A;  4X57 B;  2W54 A;  4MM3 B;  3ZJU A;  4TUU A;  3L08 A;  1E8Z A;  2LRW A;  2AQ2 B;  1E8W A;  3DWG C;  4ZRQ A;  4GDK B;  4GGQ A;  2KKC A;  4E74 A;  4HDO A;  5LNK 1;  3VUY A;  1WR1 A;  2C9W B;  3RNE C;  2KX3 A;  3ZDM C;  4ZRK A;  4BZA A;  2CKH B;  4A3O A;  4BFR A;  5TR5 A;  3O65 B;  2MQJ A;  2BYV E;  5CHF A;  2G9H D;  3BVG A;  3VQI A;  2BS3 B;  4DHJ B;  3OWE B;  4HCP B;  2OOB B;  3SU8 X;  3KH0 A;  2W55 A;  4NPN A;  3I57 A;  1GPX A;  2WGS A;  1E8Y A;  3AUL A;  2PJH A;  3VTV A;  2QIL A;  3LB8 C;  4IM2 A;  2KXJ A;  4PK1 A;  4LNI A;  4JLC A;  3Q3F A;  4XX5 A;  2HD5 B;  1UEL A;  2KQS A;  2W9N A;  3H6N A;  3P1M A;  4HVB A;  1D5M C;  1WM3 A;  2JZZ A;  2KAC A;  4ANW A;  4WWP A;  1WXA A;  4CO7 A;  2WU2 B;  4M01 A;  4M00 A;  2KYW A;  4ZOH C;  2L00 B;  2N9X A;  4A3P A;  3MJ5 A;  3P4Q B;  2PE9 A;  3A4S C;  2AQ1 B;  1AAR A;  1L0V B;  4KKJ A;  4CYE A;  3ZVV A;  4KVG B;  2V4L A;  3NRZ A;  4MH8 A;  2QIE B;  1JCK B;  1FPY A;  4IW0 A;  2KWV B;  3P2B A;  3IXS A;  4NY0 A;  3DVN U;  4GLS C;  4RM8 A;  1JWU D;  4DXA B;  4GIV A;  3ML9 A;  4W9D A;  5CX3 A;  2YVC A;  1N60 A;  1H4R A;  4FAD A;  1KFY B;  2LGY A;  1AYF A;  4NAW A;  4HPP A;  2JQR B;  3BVM A;  2KFK B;  2Z8L A;  2DYM A;  2JYE A;  3UIP B;  3AV8 A;  1I4Q A;  4EZL A;  4KZ0 A;  2DLB A;  4P1B C;  4WJO A;  4HCN B;  3U7Z A;  1WWT A;  3PLV A;  1TY2 A;  1WH3 A;  4KIK A;  4IM0 A;  1RWS A;  3U52 E;  3AB5 A;  3TEX A;  3RZF A;  1IUE A;  5G5G A;  1WGY A;  3W5V B;  2JF5 A;  3L13 A;  1VJK A;  3PZ7 A;  4EZK A;  1EWY C;  2KVZ A;  3ML8 A;  2D3A A;  3W1S A;  1D5X C;  1ET6 A;  2IO1 B;  1EU4 A;  3MTN B;  4HK2 A;  3HM6 X;  4K3C A;  2Y5P A;  1QOA A;  3J9C A;  1V1O A;  4K7W A;  2KAN A;  2LMC A;  2NCN A;  5J18 A;  4OZC A;  1TTN A;  4FJY A;  2UWQ A;  1WMH B;  3B2G A;  1CZP A;  3A9J A;  4A8X C;  1F2R C;  2C60 A;  3MHZ A;  4HWI B;  5FK9 C;  3X23 A;  1RM6 C;  4AUQ C;  3RNC C;  2K25 A;  2LWP A;  3Q8B A;  4LNK A;  1C3T A;  1WGD A;  1WRI A;  5IOI A;  2HJ8 A;  3I3T B;  3W2D A;  4WH4 A;  1F52 A;  3RMK C;  4LJO B;  3EC8 A;  2J4X A;  3A33 B;  2J52 A;  2JSV X;  4BKG A;  3PRM B;  1L4D B;  1C4P A;  2KTR A;  2FNJ B;  1QOG A;  3SD5 A;  4MM3 A;  1RLF A;  3IT6 B;  1ISN A;  1MI0 A;  4XC2 A;  4IG7 B;  2MEK A;  3P4S B;  3OG5 A;  4GDK A;  3MC8 A;  1WFY A;  3FAH A;  2RD0 A;  3UQB A;  3KWV A;  2NBU A;  4IUM B;  3TEY A;  4FXC A;  3MC0 B;  5JH5 C;  4MEL A;  3IBE A;  3TIX A;  1YN4 A;  2J42 A;  2V1Y A;  1P7F A;  2QEJ C;  1L4Z B;  1ZDV A;  2G3Q B;  4TQ1 A;  1Q1O A;  1GOZ A;  4M8N A;  1XO3 A;  2MLB A;  4EE2 A;  1MPE A;  4W9C A;  3U2S C;  2IGG A;  3TUO A;  3QAQ A;  4P6V F;  3IVF A;  3T3N A;  1Y56 A;  3I63 C;  4MH0 E;  2L76 A;  2WXO A;  1T0Q C;  3BVZ A;  1FFU A;  3GZN I;  3VH3 B;  3QWZ B;  4YWG G;  2BGF A;  5EE1 A;  5C1Z A;  3APF A;  2Z0D B;  1R7S A;  1UZX B;  2RDH A;  1E7U A;  4K7U A;  2RGF A;  1SEB D;  1UBQ A;  3B9J A;  4HLE A;  2HJ1 A;  1OQY A;  3DHI C;  1WIA A;  3ZYY X;  5L83 A;  2KDB A;  1T0R C;  2WU5 B;  3WA0 A;  2I1J A;  2N9L A;  3DBL B;  4EZJ A;  5EDS A;  3AEB B;  3NVY A;  3PS6 A;  4BOZ B;  1QLB B;  1WYW B;  2BTE A;  2K0P A;  2CS4 A;  5BO4 B;  3NZS A;  5G5H A;  4AWJ A;  3B2F A;  3VRA B;  2FIF A;  5AUK A;  1I42 A;  3VVW B;  1FO4 A;  2MBQ A;  2AL6 A;  2BT6 A;  4MDK E;  2KFK A;  2D3B A;  1A70 A;  2H89 B;  4RCO A;  2BB5 A;  2RDB C;  4RNA A;  4IWP A;  1K51 A;  1IBX B;  1L0X B;  1RFA A;  1XLP A;  4XYC A;  2DYO A;  1V86 A;  4M02 A;  3ZXR A;  4BKS A;  3Q14 C;  4ZYS A;  4W9I A;  2GMI C;  4MGY E;  1V97 A;  1E90 A;  2Y5B B;  2HTH A;  3ZJV A;  1TJE A;  3OLM D;  1JAL A;  3X0W A;  2CHZ A;  1KF6 B;  1YX6 B;  1JRO A;  2GOW A;  5E6O A;  1B1Z A;  1HTQ A;  1K53 A;  2FAZ A;  1UF0 A;  2MX2 A;  1Z2M A;  1SBB B;  1WMH A;  2LGD A;  3TEW A;  3KQ4 A;  4RF1 A;  1M4V A;  2AEH A;  3DBR B;  1WF9 A;  3NOB A;  1ZW7 A;  3EFU A;  1E0Z A;  3DBH I;  2C5L C;  1HXY D;  4CQN A;  5DPR A;  1L2N A;  4PS7 A;  3EGR A;  1V81 A;  3RNF C;  2NBV B;  3JYU A;  3FIL B;  1NEN B;  3NVV A;  5JHA A;  2ON8 A;  4MJS B;  1C9F A;  3N30 A;  4ZRI A;  3KWL A;  4MEM A;  4NJ6 A;  4WQM A;  3IFW B;  2LAS A;  2N0S B;  3BYY B;  1WRD B;  2IZV B;  4Q2J A;  1VZ8 A;  2AX5 A;  4YT0 B;  2BKF A;  4K81 A;  2WYQ A;  4DBG A;  3OAW A;  3UF8 A;  1VDV A;  3LYY A;  1IPG A;  1WI0 A;  5HI1 A;  4WWO A;  1E9M A;  3ZRF A;  4B0E A;  3Q8F A;  3V61 A;  2ASQ A;  1N5X A;  4MSQ B;  3UQA A;  2G4D B;  1ROE A;  1XLN A;  3NS1 A;  4KGS A;  2YEP B;  2WDQ B;  1FNW A;  3VUW A;  2ZCB A;  1YMH E;  1TY0 A;  1S3S G;  2WXK A;  1GJZ A;  3DVN V;  1F77 A;  3EEC A;  5CHV C;  3AM9 A;  2L05 A;  2MBH A;  2CR5 A;  2ZEQ A;  4KDI C;  3AE4 B;  2I1K A;  2WX1 A;  2WX0 A;  2LI5 A;  2OHF A;  2RPV A;  2K8B A;  1UH6 A;  1JWS D;  2PKO A;  3ZKJ C;  2MBE A;  2V0G A;  1QF6 A;  2WXN A;  3U4E G;  1CQV A;  2LVQ A;  5D6J B;  2IY1 B;  4HPL B;  4W9F A;  3VXW A;  3GP7 A;  2O2V A;  3BIN A;  1PUT A;  2LD9 A;  4E71 A;  3V3X A;  3VAW A;  4FJZ A;  3L16 A;  2IND C;  4RM9 A;  4DWF A;  4DHZ B;  2HDE A;  3K9P B;  1I35 A;  4AOF A;  1PDX A;  3V60 A;  1N6Z A;  1FMA D;  2LFI A;  4JIO U;  2C7M B;  4MGI E;  2KMA A;  1J7B A;  4RGM A;  3QCA A;  1A5R A;  4TMA B;  4C7Y A;  4G50 A;  3A9K B;  2R2O A;  4K3B A;  2I2Y A;  1ZOY B;  3T8M A;  5BYQ A;  5L95 C;  2V9H A;  3ZDT A;  4HKQ A;  1E6E B;  4ANX A;  2PLP A;  3URY A;  3H8H A;  5E6N A;  1TZ1 A;  1QKZ A;  1IBX A;  3ZTD A;  4IM3 A;  2NBW B;  2K6D B;  2IPK D;  5EE0 A;  2Y3A A;  3AE8 B;  3MC9 A;  4GOC A;  1KRH A;  4ICV A;  4ZHO A;  3AE5 B;  3WAL A;  5CHW A;  5HG2 A;  3FKY A;  4YXD B;  3AMZ A;  1R4N B;  2UYZ B;  1KLV A;  1TYG B;  2N7D A;  1V6E A;  3GE8 C;  3APD A;  1HA5 A;  1I4H A;  5D3I B;  2JXT A;  5KHO A;  1FXT B;  4P16 A;  3PZ8 A;  5C3J B;  2ACZ B;  3KUC B;  1TZO A;  4US9 A;  2B76 B;  1GNU A;  2DYB A;  2MH7 A;  4F1S A;  4XDD A;  3PGE A;  1EWC A;  3VTU A;  3AEE B;  1NYQ A;  1XCQ L;  2NPT B;  4S0R A;  4DDG D;  5AZG A;  1ZP0 B;  1V1P B;  2FCQ A;  2ZVO A;  2O6V D;  1Y8R C;  4JWS C;  2N1W A;  3FIL A;  3ECI A;  5C2T B;  3NHE B;  4MJS A;  1VD2 A;  2IO0 B;  1DOY A;  3BY4 B;  1HTO A;  2NVU I;  2WXJ A;  1GB1 A;  5FR3 A;  3NG0 A;  1LFD A;  2R61 A;  3K9O B;  1WE6 A;  3A1Q B;  3DHH C;  2EKI A;  4OVZ A;  3TMP B;  2WS3 B;  2R2Q A;  1RAX A;  3N20 C;  3HVD A;  1OEY J;  1PGX A;  1FXI A;  3ZO5 B;  3WAM A;  2LGS A;  3ZGZ A;  3PO0 A;  4YL8 A;  2BYF A;  5AZF A;  2LUE A;  2L3Z A;  4ZYN A;  2KDE B;  3GE3 C;  3GB1 A;  1OEY A;  2BS2 B;  1TIF A;  4FHJ A;  1YOV B;  3MJW A;  3CMM B;  5FR6 A;  1MJD A;  4HJG E;  4H2A A;  2W3R A;  4JQW C;  3PRP B;  1OQQ A;  5JZE B;  5G55 A;  5IKC M;  1FCC C;  4MGZ E;  2V3S A;  2LXA A;  2JWU A;  4AJY B;  4HPM B;  2HTM E;  5E6J A;  3IT4 B;  1SJE D;  3IG3 A;  3T3O A;  4YSX B;  4KGR A;  1VZ6 A;  1P9D U;  5D2M B;  4NNJ B;  4L1B A;  1T5X D;  1WSP A;  3RNG C;  1EF5 A;  2PE6 B;  5IA7 A;  2PEA A;  1T0Y A;  1NDD A;  4HRO A;  2ZJD A;  2LHD A;  1QOF A;  3RNA C;  3QC8 B;  4LDT B;  3ZNI D;  1WYG A;  2W3S A;  3PHX B;  3N1Z C;  3QA8 A;  2J53 A;  2M19 A;  2GBJ A;  1ZGU B;  3DCG A;  2M17 A;  2GBR A;  3AE6 B;  5CTR C;  3HUI A;  1I4P A;  1VLB A;  2MW5 A;  3Q3O C;  1MVK A;  3C0R B;  4N6E B;  2VH2 A;  1SGH A;  1HQR D;  2M4N A;  3A9K A;  1TS2 A;  2L8J A;  1DYQ A;  4GDL A;  2ZPY A;  3HK0 A;  1N63 A;  1NI3 A;  3M63 B;  4DK5 A;  1WGG A;  3VHT C;  1B9R A;  3ZUN A;  2IDY A;  5GMV A;  1ZKH A;  2JX5 A;  2AQ3 B;  3R7R A;  1K8R B;  1P3Q U;  3R7Q A;  2KMC A;  4KSK C;  5LLI A;  3V6E B;  1FIQ A;  4W9J A;  2JWZ A;  2IGD A;  4F7Z A;  5LXH A;  4MSM B;  2BF8 B;  2X38 A;  3PPA A;  1IGC A;  5EE9 A;  2K5P A;  4WJQ A;  1ENF A;  1F0Z A;  3DHG C;  1WM2 A;  2JUO A;  3AH7 A;  3L4P A;  5TSS A;  3LDZ E;  4GN1 A;  2XK5 B;  3ZNH B;  1JWB D;  4BBN F;  2KT7 A;  3JW0 X;  1GAQ B;  3N1Y C;  3I5J C;  1XLO A;  3PVL A;  3ENE A;  3TL5 A;  3NY5 A;  1L5P A;  2LVP A;  2NPT A;  2JY6 A;  1V1P A;  3Q8C A;  4MT5 A;  1CMX B;  4WUR A;  2IY0 B;  4HKZ E;  2O6V B;  2KC1 A;  3C8Y A;  4XWW A;  1J8C A;  2WP9 B;  1R4M I;  2FBW B;  4B6W A;  2IJ0 A;  3P63 A;  4NJC A;  3UI3 A;  3DVG X;  1CK1 A;  3DDC B;  2NR2 A;  3A1Q A;  4JGH B;  1PYW D;  3KW5 B;  3E56 A;  3NUH B;  2PVO D;  2D2Q A;  2K1F A;  1UD7 A;  2XN9 C;  3FC4 A;  2KQ7 A;  1J19 A;  1PGB A;  2O2V B;  4ACF A;  2WLB A;  2PIA A;  5J17 A;  1GG3 A;  1E10 A;  4N58 A;  3AE2 B;  3UIN B;  2PPH A;  1AN8 A;  2DWQ A;  1C78 A;  4XZ4 A;  3NZ3 A;  2NMQ A;  1DGJ A;  3Q3N C;  2VZK D;  3ZLZ A;  1BXT A;  2MBB B;  4C00 A;  4BOS C;  2HE7 A;  2RPQ A;  2WWZ A;  4BBN C;  3AI5 A;  4LLG M;  1SIJ A;  2J0M A;  1SSN A;  3ZXV A;  1FNV A;  3WAN A;  2N4F A;  4HEA 1;  2L32 A;  2KLC A;  2L52 A;  1F1H A;  2FCS A;  1SB3 C;  1TT5 B;  1BT0 A;  4EUT A;  4RMA A;  1UWM A;  1YIW A;  3DQV A;  4AP4 C;  1YQ3 B;  1SE2 A;  1UUP A;  1VZ7 A;  2XNA C;  4LJP B;  2MSE D;  4JX1 C;  1WXM A;  3KUD B;  3TEZ A;  2KAJ A;  3ALB A;  2K39 A;  2ZNV C;  2QDF A;  1EUV B;  2K9X A;  2LHE A;  1AW7 A;  1RYJ A;  4W9H A;  2AYO B;  1V80 A;  1ZE3 D;  1PGA A;  4ASW C;  1FRD A;  2JRH A;  1UWX A;  1PQS A;  2ZVN A;  2GBN A;  4RGT A;  1ZXI A;  4YTN B;  2KMM A;  4NAM A;  4FN2 A;  5GXG B;  4RH6 A;  3AU4 A;  2KD0 A;  2TSS A;  2FCN A;  2LJI A;  3O13 A;  4US8 A;  2DX5 B;  4PT5 A;  5G2N A;  3E9S A;  2Q5W D;  1FFV A;  2AWT A;  3DVG Y;  1KOT A;  1QIL A;  2E3T A;  1TKY A;  4KZC A;  2M8S A;  3RPF C;  3EFC A;  1WZ3 A;  1WE7 A;  4LK0 M;  4C4V B;  2QCZ A;  1C4C A;  4BKT A;  2NTT A;  3V62 A;  3HIZ A;  2ZW0 A;  2M56 B;  5KHQ A;  1U4A A;  3QIJ A;  1GC7 A;  2FUH B;  5HHD G;  4HRS A;  4EEW A;  2LUM A;  1QZE A;  5BMH A;  1JW9 D;  2KLG A;  3ZNZ B;  1SXT A;  1TS5 A;  2KWC A;  3U30 A;  3B08 A;  3RT3 B;  4BVU C;  1JRU A;  4PS8 A;  1L0Y B;  2JXX A;  3Q2A C;  3JSV B;  2XK5 A;  5DPS A;  2WXG A;  1JWM D;  4W9K A;  2RMM A;  2BW2 A;  2N1V A;  4FJV B;  2N9K A;  4AS1 A;  2LGI A;  1JWA D;  2IO2 B;  3SFE B;  3GZN B;  1ZXH A;  2V3P A;  2WXF A;  2O6V A;  4GSW A;  3R2T A;  4GMV A;  1WZ0 A;  4C80 A;  1WGK A;  1XQQ A;  3T9L A;  4IOI E;  5D7G A;  3SFD B;  1UNS A;  5H8Y E;  2A4Z A;  4TV3 A;  4WWM A;  1E7V A;  2MJE A;  1KLU D;  3ONS A;  1WXS A;  2DBY A;  4OVV A;  1I4X A;  1I4G A;  3H7P B;  3V05 A;  3TBL D;  2V3N A;  2DNF A;  3EA6 A;  3KYC D;  4DXF A;  1UBI A;  2LEK A;  4LNN A;  2EMS A;  4L2Y A;  3RUL A;  1D6E C;  2KDF B;  2C7H A;  1KH0 A;  4K7S A;  4D2K A;  3ZJT A;  4YSZ B;  2JPH A;  1JQ4 A;  4I6P A;  3PV1 A;  4A20 A;  3AE1 B;  4BKS D;  4WWN A;  4EOY A;  2QC8 A;  1P1A A;  3B1L X;  4GU2 A;  5T8I A;  1WXQ A;  3H1U A;  3AU5 A;  3CWI A;  4M0W B;  3ZIM A;  2KDM A;  1UGM A;  3RCZ A;  1GUA B;  1V8C A;  2LVO A;  2QHO A;  5IP4 D;  3VUX A;  1KTK A;  4GDL B;  1N5W A;  4LNF A;  3R3M A;  2VRR B;  1JRP A;  1WXV A;  4W9G A;  4J3O D;  2EEL A;  1J7C A;  1P0R A;  1FM0 D;  1E5W A;  3Q8E A;  2DZI A;  2DHZ A;  3Q6B A;  3IAM 1;  4OVU A;  2RR9 A;  2D5G A;  2CU3 A;  4N59 A;  3QHT A;  1C79 A;  4JPS A;  3HHM A;  1OTR B;  4IWO A;  2L7R A;  3WCQ A;  3VR9 B;  3U8Z A;  1XEE A;  2RSU A;  2RDG A;  2BKR B;  4JE3 B;  4F8C B;  4QAY A;  2BYE A;  1E8X A;  1FEH A;  4ITK A;  3DBH B;  3W5U B;  1L6U A;  1IP9 A;  1IGD A;  1Z5S B;  2WXQ A;  1G6J A;  3RZW C;  1QQR A;  1V49 A;  3C19 A;  4L23 A;  1QOB A;  1FRR A;  1FXA A;  5BMI A;  1TGZ B;  1S1Q B;  1TKG A;  4LTU A;  2BBC A;  4NQK E;  5BYR A;  2KQ4 X;  2FE8 A;  4C4V A;  5BMG A;  2K3U A;  2KZR A;  5IAA C;  4PYU A;  3W1S C;  2FID A;  3OJ4 B;  4ARC A;  3IHP C;  3PLU A;  1EF1 A;  1NBF C;  1ZPS A;  3NZU A;  2H88 B;  1Q0W B;  1EO6 A;  1DOI A;  1T6B X;  1KM7 A;  2KJR A;  3QQ8 B;  1LO5 D;  1TS3 A;  2JRI B;  1WR6 E;  2KN5 A;  3AEA B;  4NZL B;  3TJP A;  3U7D A;  1YD8 U;  2GBM A;  3N9Y C;  5HKH A;  4A55 A;  1XXG A;  3RYT A;  3AEG B;  3CF6 E;  3N32 A;  2V4I B;  4EFO A;  3JSV A;  2K22 A;  1YNT E;  3SR6 A;  3HVZ A;  4ICU A;  2J0J A;  1V5O A;  3HRD D;  3OJ3 A;  3VR8 B;  1WX7 A;  4GXB A;  2KVR A;  1HZ6 A;  1LQB A;  2N7E A;  1WJN A;  4ZRP A;  3RI7 C;  2FCM A;  1STE A;  3APC A;  3Q8A A;  4OW0 A;  4WJN A;  5DPT A;  1I7H A;  1WX9 A;  4A6Q A;  1NEK B;  2INC C;  1H8C A;  1N62 A;  5H92 C;  3ZRC A;  1VRA B;  1LGR A;  4YTP B;  4IWQ A;  2Z0E B;  3DBL I;  5MPO A;  2LGX A;  4B95 A;  4FUL A;  3H7P A;  4XGA B;  2ONQ A;  4ANU A;  2MBO A;  3CIR B;  1ET9 A;  3NS8 A;  1SE3 A;  2BS4 B;  3A4R A;  1LXD A;  4W9E A;  3Q69 A;  1NYR A;  1WJ6 A;  2KHW B;  2BYT A;  4FHK A;  2CHX A;  2UU7 A;  2GB1 A;  4OHJ A;  5DPW A;  2JZP A;  3L10 B;  4I6L B;  1YN3 A;  2OED A;  2KX0 A;  4P1C C;  1TS4 A;  3MP9 A;  2LXC A;  4M0W A;  1M94 A;  2QMT A;  2DAF A;  3LJ3 A;  3I9V 1;  1F9J A;  2EMT A;  3NJT A;  2G1E A;  4HXD A;  2D10 A;  3AEC B;  1WGR A;  2REX A;  3L17 A;  5C23 A;  3TCA A;  3MHS D;  2PVG C;  3BK1 A;  1V2Y A;  2KO3 A;  2LZ6 A;  5EE3 A;  1NI2 A;  4W9L A;  4WAF A;  2WDT B;  1WX8 A;  3DBS A;  3DOW A;  1MHH E;  1SJH D;  4FLH A;  3DBR I;  1OFF A;  3AEF B;  3Q3M C;  2J0K A;  2EKE C;  2W82 A;  3AE9 B;  3L0W B;  1XF5 L;  4BAX A;  1WY8 A;  2DZJ A;  4ANV A;  5E6P A;  3UGB B;  3R8B A;  1Q5W B;  2KTF A;  2DZK A;  1L6V A;  3CSF A;  5HFY A;  2CHW A;  1HZ5 A;  2GBK A;  2WQY B;  2INP E;  1K52 A;  1GB4 A;  2Y5C A;  1CJE A;  2DZM A;  3UIO B;  2NS5 A;  2MP2 B;  1J7A A;  3QJZ A;  2D3C A;  2WDV B;  3ZNG C;  3PSE B;  4TSS A;  3GS2 A;  4A9A A;  4XDC A;  1I4R A;  1BUI C;  4GB9 A;  2CJO A;  2NTS A;  4DQO C;  2ZNV B;  2MA9 B;  2WDR B;  1C76 A;  2ZW1 A;  5FKA C;  2IBI B;  2BPS A;  3PTF C;  5D3D A;  3VDZ A;  1FCL A;  2GI9 A;  4B0M A;  3KVF B;  5AEK B;  4DXG A;  2INN E;  3NVW A;  1LM8 B;  2LJ5 A;  3VTW A;  3N1X C;  4ZDV A;  5LXI B;  3BYT B;  2A5U A;  4URK A;  1MG4 A;  2N9P C;  2JYT A;  1HE8 A;  4WJP A;  3WAP A;  4N9F 4;  1FD6 A;  2BVC A;  1RRB A;  4HDQ A;  3TSS A;  2G45 B;  1HEZ E;  2CU1 A;  2K8C A;  2WXH A;  3PZD A;  1C4A A;  2L83 A;  1N61 A;  2L0F A;  2KFJ A;  3EHV A;  4C56 C;  3RNB C;  1SE4 A;  3BZD B;  2KWU B;  3BII D;  4KX6 B;  3CST A;  4KDL B;  1XT9 B;  1ACC A;  1SF0 A;  4PS3 A;  2KWD A;  1YQB A;  5JXV A;  1J0G A;  4C7Z A;  3M95 A;  2K6Q A;  5BYS A;  4LNO A;  4B9K A;  1YN5 A;  2MJD A;  2D3G A;  3B0A A;  1QT9 A;  1X1M A;  4MGK E;  3AE3 B;  4K1R B;  1MFW A;  2B3A A;  3V6C B;  1MG8 A;  2FUG 1;  4XWT A;  5IN7 A;  1K50 A;  2N9E B;  2LRU A;  3DWM A;  2BQQ A;  1D3Z A;  3L54 A;  1KLG D;  3ZQ4 A;  4TKN A;  3IAS 1;  2DAJ A;  3W9C B;  3AED B;  1OGW A;  2IYD B;  2KDI A;  1NVI D;  2DEN B;  1VR9 A;  1ESF A;  4OZA A;  4ARI A;  4DDI D;  1L7Y A;  2XBB C;  2KNB A;  3RD2 A;  4USA A;  2GRI A;  4KKI A;  5JHB A;  5AUI A;  3ZTC A;  2PW9 A;  4WQO B;  3P4R B;  3HM3 A;  2KOX A;  3R66 C;  3SDL C;  3KUZ A;  2QSD A;  4FA6 A;  1FNU A;  2JU6 X;  4O1N A;  4A90 A;  4G3X B;  1TBE A;  1V5T A;  2KC2 A;  2PMV A;  2GLS A;  3EUB 2;  2IO3 B;  3NVZ A;  2Z59 B;  3RN9 C;  3S2A A;  1R4N I;  1YJJ A;  4S17 A;  4AJW A;  2ZCC A;  2C7N B;  2D11 A;  2MHJ A;  1WJU A;  1VCB A;  5AZH A;  1WJ4 A;  2JT4 B;  4II3 B;  1YQ4 B; 
#chains in the Genus database with same CATH homology
 3IAM 1;  3T3O A;  4YSX B;  4KGR A;  2D5G A;  3BVZ A;  1VZ6 A;  1FFU A;  2CU3 A;  4N59 A;  4JPS A;  1C79 A;  3LXF A;  4YWG G;  5EE1 A;  4L1B A;  1T5X D;  1WSP A;  3WCQ A;  3RFZ B;  2I38 A;  1R7S A;  1RFK A;  2WXI A;  2RDH A;  3VR9 B;  2WXL A;  1XEE A;  4YTM B;  4OZB A;  3MFG A;  2RDG A;  1Q10 A;  2CJN A;  4JE3 B;  5I4D A;  4HRO A;  1JML A;  1SEB D;  1OQR A;  3IT4 B;  2LHD A;  1QOF A;  1FEH A;  4ITK A;  2IGH A;  1WYG A;  1ZUD 2;  3B9J A;  3BWU D;  3W5U B;  1L6U A;  4UDU C;  1IGD A;  2W3S A;  2J53 A;  2M19 A;  2WXQ A;  3ZYY X;  3BK2 A;  1QQR A;  4L23 A;  2WU5 B;  3AE6 B;  3HUI A;  1QOB A;  1I4P A;  1VLB A;  1FRR A;  1FXA A;  2N9L A;  4AQ7 A;  1MVK A;  3AEB B;  5BMI A;  3NVY A;  4N6E B;  1QLB B;  1TKG A;  1HQR D;  4LTU A;  2BBC A;  5BYR A;  2KQ4 X;  1TS2 A;  2FE8 A;  2MJ3 A;  4WIP A;  2YEP F;  5BMG A;  1DYQ A;  1C77 A;  2K3U A;  2BTE A;  2ICI A;  2K0P A;  3ETR A;  5G5H A;  3B2F A;  3VRA B;  1N63 A;  1NI3 A;  5AUK A;  4ARC A;  4RGN A;  1FO4 A;  1ZPS A;  2BT6 A;  3AE7 B;  3R2I A;  1F2R I;  1B9R A;  1XLQ A;  1A70 A;  2H88 B;  4KGT A;  1DOI A;  2H89 B;  1T6B X;  4RCO A;  2IDY A;  2BB5 A;  4NAW B;  2JX5 A;  1SJE D;  4REZ A;  4RNA A;  3P4P B;  1K51 A;  1IBX B;  1L0X B;  1LO5 D;  3SEB A;  2AQ3 B;  2M0A A;  1TS3 A;  2WXR A;  1XLP A;  4JWU C;  4XE0 A;  4MAC A;  4IKG A;  1ZDX A;  3AEA B;  3VRB B;  2DYO A;  4NZL B;  4IDI A;  1PFD A;  1UGJ A;  1FIQ A;  3N9Y C;  4ZYS A;  2IGD A;  4A55 A;  1V97 A;  1XXG A;  2X38 A;  3AEG B;  1IGC A;  4R3D A;  1YJI A;  1D4B A;  2V4I B;  4TQ0 A;  5EE9 A;  2K5P A;  2VZK B;  1ENF A;  2K22 A;  3ZJV A;  1F0Z A;  2SEB D;  1TJE A;  2PTL A;  1YNT E;  4RGO S;  3SR6 A;  3HVZ A;  1JAL A;  3HRD D;  3AH7 A;  3VR8 B;  3L4P A;  5TSS A;  1T3Q A;  1XCT L;  1KF6 B;  3AN1 A;  1HZ6 A;  1JRO A;  1JWB D;  4RFB A;  3KLS X;  4ZRP A;  1GAQ B;  1TKE A;  1B1Z A;  1K53 A;  1STE A;  1XLO A;  3Q8A A;  4OW0 A;  1SBB B;  2WNM A;  2SAK A;  1L5P A;  1D5Z C;  1I7H A;  1V1P A;  3KQ4 A;  4RF1 A;  3Q8C A;  3TEW A;  4A6Q A;  1NEK B;  1M4V A;  4MT5 A;  4WUR A;  4HKZ E;  1E0Z A;  1E7P B;  1HXY D;  4RF0 A;  4CQN A;  1N62 A;  5H92 C;  1VRA B;  2L1A A;  3C8Y A;  3EGR A;  4XWW A;  2WP9 B;  2FBW B;  3FIL B;  1NEN B;  1AWD A;  2IJ0 A;  3P63 A;  4NJC A;  4YTP B;  2BB6 A;  3UI3 A;  3NVV A;  2ON8 A;  4YSY B;  5MPO A;  2E6X A;  1C9F A;  1CK1 A;  3KWL A;  1MHX A;  1PYW D;  3E56 A;  3NUH B;  2ONQ A;  4WQM A;  3ABV B;  2PVO D;  2WXP A;  1BML C;  3CIR B;  1ET9 A;  1DOX A;  2N0S B;  3P42 A;  1SE3 A;  2BS4 B;  3BYY B;  1EU3 A;  4Q2J A;  1VZ8 A;  2AX5 A;  2XN9 C;  3Q69 A;  2WXM A;  3FC4 A;  1PGB A;  1NYR A;  4YT0 B;  4ZHP A;  2N7J A;  1P7E A;  2PIA A;  2WLB A;  2KN4 A;  2BYT A;  2QJL A;  1E10 A;  1EM7 A;  4N58 A;  3AE2 B;  2W54 A;  1VDV A;  4MM3 B;  3LYY A;  2GB1 A;  3ZJU A;  1AN8 A;  2DWQ A;  4OHJ A;  5HI1 A;  1E9M A;  2JZP A;  1C78 A;  4B0E A;  3NZ3 A;  3Q8F A;  2NMQ A;  1YN3 A;  2AQ2 B;  2OED A;  1DGJ A;  2VZK D;  3DWG C;  1TS4 A;  1BXT A;  3MP9 A;  1N5X A;  4ZRQ A;  4GDK B;  1ROE A;  1XLN A;  4M0W A;  3NS1 A;  4KGS A;  2YEP B;  2WDQ B;  5LNK 1;  2QMT A;  4LLG M;  1SIJ A;  1FNW A;  3I9V 1;  1YMH E;  1TY0 A;  1SSN A;  2WXK A;  2G1E A;  1FNV A;  4HEA 1;  2L32 A;  2L52 A;  3AEC B;  1F77 A;  3AM9 A;  1SB3 C;  1UWM A;  2PVG C;  1YQ3 B;  3AE4 B;  1SE2 A;  1UUP A;  3BK1 A;  2G9H D;  1VZ7 A;  3BVG A;  2XNA C;  3VQI A;  5EE3 A;  4JX1 C;  2BS3 B;  3OWE B;  3TEZ A;  2KAJ A;  2OHF A;  2RPV A;  4WAF A;  1JWS D;  2PKO A;  2V0G A;  1QF6 A;  2WXN A;  2W55 A;  3U4E G;  2K9X A;  3I57 A;  2LHE A;  1MHH E;  1GPX A;  1SJH D;  1AW7 A;  1CQV A;  1RYJ A;  2QIL A;  1OFF A;  3AEF B;  3LB8 C;  2W82 A;  3AE9 B;  1ZE3 D;  1PGA A;  1FRD A;  3GP7 A;  1XF5 L;  1PUT A;  1UWX A;  3P1M A;  1D5M C;  4RGT A;  1ZXI A;  3R8B A;  2KAC A;  4YTN B;  2WU2 B;  3V3X A;  2KMM A;  4NAM A;  1L6V A;  5HFY A;  4ZOH C;  5GXG B;  1HZ5 A;  3MJ5 A;  4RH6 A;  3P4Q B;  2TSS A;  2WQY B;  2HDE A;  2INP E;  2AQ1 B;  1K52 A;  1GB4 A;  1PDX A;  2Y5C A;  1L0V B;  4KKJ A;  1FMA D;  2LFI A;  2LJI A;  1CJE A;  3O13 A;  4US8 A;  3NRZ A;  4MH8 A;  4PT5 A;  2QIE B;  3E9S A;  1J7B A;  2Q5W D;  1FFV A;  1JCK B;  1J7A A;  4RGM A;  3IXS A;  1QIL A;  2WDV B;  4TMA B;  2E3T A;  1TKY A;  3RPF C;  4C7Y A;  4TSS A;  3GS2 A;  4A9A A;  4XDC A;  4GLS C;  1I4R A;  1BUI C;  4LK0 M;  2CJO A;  2NTS A;  4DQO C;  2I2Y A;  2WDR B;  1ZOY B;  1C76 A;  1JWU D;  2ZW1 A;  5FKA C;  1C4C A;  5BYQ A;  2NTT A;  1N60 A;  4HKQ A;  5D3D A;  1E6E B;  1KFY B;  2PLP A;  2ZW0 A;  2M56 B;  1AYF A;  3URY A;  3H8H A;  1QKZ A;  2JQR B;  3BVM A;  1IBX A;  1FCL A;  2GI9 A;  4B0M A;  2Z8L A;  5HHD G;  4DXG A;  2JYE A;  2DYM A;  2INN E;  2IPK D;  3AV8 A;  1I4Q A;  3NVW A;  2Y3A A;  4HRS A;  5EE0 A;  3AE8 B;  2LUM A;  2DLB A;  5BMH A;  1JW9 D;  1KRH A;  4ZHO A;  1SXT A;  3AE5 B;  3BYT B;  1TS5 A;  3U7Z A;  1WWT A;  1TY2 A;  2JYT A;  1RWS A;  1FD6 A;  3U52 E;  3AB5 A;  3TEX A;  5HG2 A;  1L0Y B;  3TSS A;  1IUE A;  5G5G A;  1HEZ E;  4YXD B;  3AMZ A;  3W5V B;  1TYG B;  2WXH A;  1C4A A;  2L83 A;  1N61 A;  1HA5 A;  1VJK A;  2WXG A;  1JWM D;  3PZ7 A;  1EWY C;  1I4H A;  4C56 C;  1SE4 A;  2RMM A;  3BZD B;  2BW2 A;  5D3I B;  3W1S A;  1D5X C;  3BII D;  2JXT A;  1ET6 A;  2N9K A;  4AS1 A;  1EU4 A;  1JWA D;  2LGI A;  4KX6 B;  4P16 A;  3SFE B;  1ACC A;  3PZ8 A;  2Y5P A;  1QOA A;  5C3J B;  2ACZ B;  1SF0 A;  3J9C A;  1V1O A;  1TZO A;  4US9 A;  2KWD A;  2LMC A;  2B76 B;  1ZXH A;  2MH7 A;  5JXV A;  4XDD A;  4OZC A;  2V3P A;  2WXF A;  4C7Z A;  1EWC A;  3R2T A;  3B2G A;  1CZP A;  1NYQ A;  1XCQ L;  3AEE B;  5BYS A;  4C80 A;  1ZP0 B;  1V1P B;  4A8X C;  1F2R C;  1YN5 A;  2MJD A;  4JWS C;  1QT9 A;  3MHZ A;  3FIL A;  1WGK A;  3AE3 B;  5C2T B;  5FK9 C;  2FUG 1;  4XWT A;  1K50 A;  4IOI E;  3DWM A;  1RM6 C;  5D7G A;  3SFD B;  1UNS A;  5H8Y E;  1DOY A;  3Q8B A;  1KLG D;  4WWM A;  3ZQ4 A;  1WRI A;  2MJE A;  1KLU D;  3IAS 1;  2WXJ A;  1GB1 A;  5FR3 A;  3W9C B;  3AED B;  3W2D A;  2DBY A;  4WH4 A;  2R61 A;  1I4X A;  1I4G A;  2EKI A;  3V05 A;  1NVI D;  1VR9 A;  4OVZ A;  2V3N A;  1ESF A;  4OZA A;  2J4X A;  2J52 A;  2JSV X;  3EA6 A;  4ARI A;  4DXF A;  2LEK A;  1L4D B;  2WS3 B;  1C4P A;  4USA A;  4L2Y A;  1QOG A;  3HVD A;  1D6E C;  2GRI A;  1KH0 A;  1PGX A;  4KKI A;  5AUI A;  2PW9 A;  1FXI A;  4D2K A;  3IT6 B;  3ZJT A;  4YSZ B;  3P4R B;  1MI0 A;  1JQ4 A;  3ZGZ A;  3PO0 A;  2MEK A;  3AE1 B;  3P4S B;  3FAH A;  3KWV A;  5T8I A;  1WXQ A;  2QSD A;  3TEY A;  4FXC A;  3MC0 B;  1FNU A;  2JU6 X;  4O1N A;  3CWI A;  3GB1 A;  4A90 A;  1YN4 A;  2BS2 B;  2J42 A;  1P7F A;  2PMV A;  3EUB 2;  2QEJ C;  2KDM A;  3NVZ A;  1V8C A;  1L4Z B;  1ZDV A;  4HJG E;  4H2A A;  4TQ1 A;  1GOZ A;  1XO3 A;  1KTK A;  4GDL B;  1N5W A;  1MPE A;  4EE2 A;  2W3R A;  3U2S C;  1OQQ A;  1YJJ A;  1JRP A;  2IGG A;  1FCC C;  3TUO A;  4J3O D;  4P6V F;  3T3N A;  2JWU A;  2EEL A;  1J7C A;  1Y56 A;  1FM0 D;  2WXO A;  2HTM E;  3Q8E A;  5E6J A;  1YQ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...