1MHHE

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
total genus 18
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhhE00
4OZBA 1JMLA 1K53A 1K52A 1MHXA 2PLPA 1IBXA 2KACA 2OEDA 1XCQL 1PGBA 1UWXA 2KN4A 2ZW1A 3FILA 2LHEA 1F2RC 1XF5L 2J52A 2KDMA 2JSVX 1C9FA 1QKZA 5JXVA 1IGDA 1GB4A 1YNTE 2ON8A 2J53A 1IGCA 1MHHE 1YMHE 1IBXB 4KGSA 2ZW0A 1FCCC 1F2RI 1PGAA 3MP9A 5HI1A 2GI9A 2LHDA 1Q10A 5BMHA 4HKZE 3FILB 1K50A 1D4BA 2QSDA 2I38A 1P7FA 2N9LA 1HEZE 1FCLA 1MPEA 4IKGA 2KQ4X 2GB1A 2RPVA 5HG2A 1MI0A 2QMTA 2K0PA 2PW9A 1FD6A 4GLSC 2JZPA 2JXTA 1PGXA 1XCTL 4MACA 4HJGE 2LUMA 5HFYA 1HZ6A 2N7JA 3V3XA 1MVKA 4IOIE 5BMGA 2ONQA 4OZCA 2IGGA 1P7EA 2JWUA 4KGRA 2NMQA 2IGDA 5BMIA 2N9KA 5HHDG 3UI3A 4OZAA 2LGIA 2IGHA 1GB1A 3GB1A 1HZ5A 1ZXHA 2RMMA 4WH4A 2I2YA 1EM7A 1K51A 4D2KA 1KH0A 2KWDA 2JU6X 4KGTA 2EELA 2PTLA
chains in the Genus database with same CATH superfamily
4PS8A 4JWUC 4DHZB 4RF1A 3VR8B 4B0MA 2PLPA 1IBXA 4XGAB 4HDOA 1TZ1A 4AP4C 2MP2B 3BVGA 4RCOA 2BWFA 1PGBA 2GBMA 2IO3B 1KLGD 4ANVA 4HPPA 3V05A 1QLBB 3Q8EA 2DHZA 4BOZB 4GDKB 3ZTCA 3UINB 1QT9A 3JW0X 1YN4A 1E8YA 3RNFC 1WXSA 1ZPSA 1CK1A 4M00A 4GSWA 1YMHE 3N1YC 2ZW0A 3TJPA 2FAZA 3HVZA 3B08A 2IY1B 2FIDA 5TSSA 3M3JA 5IA7A 4BAXA 2D3BA 1JALA 1JRUA 4N9F4 3MHZA 3LJ3A 3N30A 4XC2A 4M8NA 4A90A 1NYQA 3WANA 4ANXA 2AQ3B 2B3AA 3A1QB 3EA6A 3PRMB 2PVGC 4P16A 1GC7A 3TSSA 2NBVB 2WU5B 3KLSX 3IT6B 4ANWA 1F52A 4YTMB 1P0RA 2O2VB 2ONQA 2UYZB 5H8YE 4PT5A 1WZ3A 5IKCM 2D2QA 4ZOHC 3WA0A 4BKSA 3Q3JA 1G6JA 2QIEB 2LVOA 2DWQA 4HKQA 4M02A 1SB3C 5FKAC 1Y56A 2LGYA 4OZBA 2L0FA 3DBRI 4HK2A 2MJDA 3MC9A 5E6NA 1NI3A 3NZ3A 4DBGA 2KDIA 2M17A 2ZW1A 3IVFA 3H6NA 5G2NA 3PLUA 4A9AA 1V6EA 1MG4A 3I5JC 1NDDA 1VD2A 3GOEA 2VZKB 1YNTE 3Q3OC 4WWPA 2YEPB 4FADA 4P6VF 4IC7B 1VZ7A 4LNKA 2GRIA 1V1OA 4BFRA 1WJ4A 4RGMA 2KJRA 5TR5A 4CHKA 1FFUA 1V9JA 1T0RC 3H1UA 3AE5B 4M8MA 1V5TA 1FPYA 2RDBC 4IM3A 2QMTA 2KLGA 1IP9A 4MH0E 2BWES 3AEEB 1PGXA 4OVVA 3BIID 5DCNA 3B0AA 3GE8C 3AEDB 1N60A 2LXAA 3B9JA 3BK1A 2Y5PA 3T9LA 3W1SC 3JVZX 1KTKA 4MGKE 5MPOA 2R2QA 3ABVB 2AL3A 4ZDVA 1WGKA 5E6JA 3ZIMA 2V9HA 1E5WA 3M95A 2D3AA 2INCC 4ICUA 3QWZB 3TL5A 4ZRPA 2NMQA 4USAA 1DGJA 2KC1A 3O13A 4K1RB 2C60A 4OZAA 2BPSA 1GB1A 4TKNA 4MH8A 4WH4A 1SGHA 1TKEA 1VDVA 3O65B 4RGTA 1ZE3D 3NOBA 1ROEA 2FE8A 1QILA 3PTFC 2D07B 3VRBB 1L0XB 4XYCA 3C8YA 2FCQA 4BKTA 1FMAD 2M0AA 2PJHA 1TGZB 1JROA 1JW9D 1VJKA 3QIJA 2IDYA 2KYWA 4RGNA 4P7IA 2K6QA 1QKZA 3GS2A 3SU8X 1F0ZA 3U52E 3BY4B 1XLPA 2ZZPB 4XDCA 1SEBD 2M19A 3QX1A 4A3PA 3A9JB 1J7AA 1P98A 4KIKB 3OAWA 4AJYB 4LK0M 4KZ0A 2V0GA 2IBIB 3DQVA 3U7ZA 4NJ6A 1LM8B 1T0YA 2DZIA 1DYQA 4IM0A 4REZA 1I4HA 4WJOA 4KSLC 4IKGA 1GUAB 2RPVA 3JSVB 1MI0A 1B1ZA 2DNFA 2BQQA 1TS2A 1J0GA 1ZXIA 3ZLZA 2NTTA 3NVZA 2N9PC 3APFA 1HZ6A 5BMGA 2H88B 3QHTA 4NJCA 3MJ5A 4XWWA 2INPE 2LGSA 2G4SA 2VH2A 3IAM1 2PMVA 2UWQA 2QILA 2PEAA 2KANA 3PGEA 4US9A 3Q3MC 2EMSA 4FULA 5JZEB 2E6XA 4G50A 4TUUA 3ZRFA 2LJIA 3DWMA 3TIXA 2MW5A 3PRZA 2Y5BB 3SHQA 3W5UB 4XE0A 5H92C 2PTLA 4ARIA 1K53A 2ASQA 2YLMA 3X23A 2KTFA 3H7SA 4BBNF 1U4AA 1WXMA 1VRAB 2GOWA 4FJZA 3L13A 3UIOB 3TEZA 1MG8A 2PE9A 4WJNA 2KJHB 2Z59B 2DZJA 3JYUA 2G9HD 1IPGA 2KDFB 1WE7A 1L7YA 2K8HA 2MEKA 2SAKA 3Q6BA 4OVUA 2K9XA 2D11A 3HM3A 3R2IA 4C00A 2X8XX 1UBQA 1XT9B 4L2YA 2KJ6A 3FILB 3IBEA 3A4RA 3AE4B 2KFKA 1SE4A 2KDBA 4W9CA 1MPEA 2KQ4X 3AEGB 3NHEB 1B9RA 2BTEA 3ZDMC 4HJGE 3PREA 4C80A 1LXDA 2VH1A 3X0WA 2KNBA 2WXFA 3V62A 4OZCA 4HDQA 2V4LA 1E8ZA 3AE8B 4NQLB 1P3QU 3TCAA 5BMIA 3D32A 3NY5A 4DXFA 5AUIA 1WY8A 3NVVA 5GXGB 1CMXB 2KLCA 3K9OB 1YQBA 2A5UA 2EKIA 2JRHA 2NPTA 2JU6X 5HKHA 4C7ZA 3I63C 4W9EA 3L10B 5C3JB 3WAOA 3MC0B 1UWMA 2C7HA 3NJTA 4MM3A 2N9XA 4XWTA 3ALBA 4CQNA 3DBHB 1XCQL 4GOCA 4IWOA 4RM8A 3ZO5B 1WX8A 1VR9A 4YSXB 5FR3A 2BS4B 1SJED 5KHOA 2QC8A 3KYCD 3LYYA 4G0NB 5JXVA 3BYTB 2CHXA 2JX5A 1IGCA 4KGSA 1BT0A 1FCCC 1E90A 3IAS1 3L0WB 2HDEA 1KLUD 1R7SA 4KDIC 1FFVA 2WXRA 1WI0A 3V61A 3RD2A 4M0WB 2WXOA 3DVGX 1L2NA 4AS1A 1XXGA 5JH5C 2N9LA 2O6VD 1T0QC 1HEZE 3A33B 1OFFA 1PFDA 1QOBA 2CHZA 1XLNA 3TMPB 2W9NA 2WXNA 2XBBC 4B0EA 4IDIA 2RD0A 2XN9C 3VAWA 4XZ4A 2NBWB 4BZAA 1ENFA 3BYYB 3P2BA 1S1QB 3R66C 2XK5B 2BYEA 2JZ3B 3SR6A 2LWPA 4E71A 2JQRB 1N5WA 3AEAB 2JWUA 1E6EB 2WXPA 4AUQC 1N5XA 2K22A 2LGIA 2W54A 1KRHA 2KMMA 3GB1A 4NAWA 3SFEB 4AWJA 3HM6X 2RMMA 3FKYA 4FN2A 3ZJTA 2D10A 2MH7A 2PPHA 1AWDA 3UF8A 4RF0A 2NR2A 3APDA 3BINA 2EELA 1LQBA 2KTRA 5BYSA 3PVLA 3WAMA 4AJWA 1WX7A 5AEKB 4GU2A 1MJDA 2QCZA 1WIAA 4W9GA 4J3OD 1WH3A 2C7NB 1UH6A 3NUHB 4TMAB 2MQJA 1V81A 4ASWC 1XF5L 2XNAC 2L3ZA 1FNWA 3SFDB 1C9FA 3AEFB 3Q3FA 4JQWC 2ON8A 2JWZA 1D6EC 3KUZA 1PGAA 2WLBA 3OJ4B 2FCMA 3UGBB 4JE3B 2G4DB 4BOSC 3L16A 1WXQA 3HUIA 1P9DU 2B76B 4W9DA 1YQ4B 1I4GA 3EGRA 1QOGA 1FM0D 1QOFA 2KFKB 1CQVA 5LXHA 4NNJB 2KZRA 3PHXB 1FD6A 1TY2A 2NCNA 3VQIA 2WDQB 2OJWA 2INNE 2N7EA 3RMKC 1NVID 1F77A 1NI2A 2RDHA 1P7EA 1SIJA 1SE9A 2D5GA 1PQSA 2KVRA 3LDZE 1BXTA 3DBHI 1C78A 1ET6A 2Y3AA 2KKCA 2R61A 1KFYB 3RNCC 2BVCA 3EUB2 2NPTB 4FA6A 2UU7A 4PYZA 3IT4B 2DENB 2W82A 4MGIE 4WQMA 2WYQA 1GC6A 2RGFA 4JLCA 4DWFA 5JHAA 4BKSD 3EFUA 3N9YC 1QOAA 2L83A 1ZDVA 5LXIB 3H8HA 3VTUA 1L0VB 1ZW7A 3Q8FA 1A5RA 1KOTA 4LTUA 3KUCB 3NRZA 3BZDB 1HQRD 3DHIC 2AYOB 1YN3A 1V97A 3Q8BA 5CHWA 4K3CA 1WGDA 3IXSA 1HE8A 3PLVA 2CU1A 4BBNC 2M56B 3I9V1 3P42A 3PPAA 2RPQA 2M1MA 4L1BA 2QSDA 1GNUA 5EE0A 1XEEA 1R4NI 2O6VB 1FRDA 2WDTB 1Z2MA 4KKIA 2WXKA 1JWSD 3VH3B 1RM6C 3AECB 4MJSA 1XQQA 3K9PB 3PS6A 2MBHA 2WXIA 3Q8CA 2WX0A 4HCNB 4HLEA 1T0SC 2ZCBA 4IWQA 3AMZA 4JX1C 2KVZA 1S3SG 3B2FA 5J18A 5GMVA 3RNAC 5AZHA 1T6BX 2CKHB 4HJKA 2MWSB 4TQ0A 3T8MA 4W9KA 4YXDB 3RYTA 3UQAA 4F8CB 4GIVA 4W9FA 2J0KA 2KTRB 1C77A 2KQ7A 3VH4B 5IAAC 1AW7A 2KACA 2WP9B 3DBLI 4ZYNA 2K3UA 3MHSD 4K7UA 3E56A 3URYA 2I1KA 2WNMA 3P4QB 2ZCCA 2K8CA 2NTSA 5EDSA 2LHEA 5EE3A 3AH7A 5DPSA 4HWIB 2JSVX 1HTOA 3RZFA 1TT5B 2YEPF 2LMCA 2KK8A 1V8CA 5IP4D 2J53A 1IBXB 1MHHE 4EZKA 1V2YA 2KD0A 3DWGC 2C7MB 4ZYSA 1T5XD 1L0YB 1E7PB 1WM2A 4HKZE 4ZRIA 4JL9A 4DQOC 2LVQA 1FNVA 5D94A 2ICIA 5EE1A 3QC8B 2QDFA 5DPWA 1JWBD 2MBOA 1I35A 3I3TB 2BGFA 2MBQA 4HPLB 2JZPA 3H7PA 4HPMB 4MACA 1TIFA 1A70A 4GDLA 3A9KA 2Z0EB 2W3RA 3NS8A 4MSQB 2N7JA 4CYEA 1GAQB 4AOFA 3AE1B 2IGGA 2JY6A 4P1BC 1WMHA 1LGRA 1UGMA 4IG7B 1I4RA 2IGDA 2GBRA 2FBWB 2JT4B 1N6ZA 2G45B 4FHJA 1WR6E 2IGHA 1D5MC 1VLBA 1HXYD 4OHJA 1N63A 3AI5A 3U30A 2N1VA 2MRPA 1WJ6A 2K8BA 2NS5A 2GBKA 2WHIA 3U4EG 3NVYA 3U2SC 3KYDD 4RFBA 2EMTA 2BT6A 3VVWB 1WXAA 4A20A 1D5XC 2OEDA 2ZPNA 3TUOA 2KN4A 2BF8B 2J4XA 4FHKA 2KX0A 1NBFC 3Q8AA 4DK5A 5C1ZA 2KDMA 3BK2A 4IWPA 3ZYYX 1FIQA 3RULA 1SIFA 1XO3A 3B2GA 4IW0A 2MBBB 1X1MA 3WCQA 1J19A 1XLOA 2D3GA 3WIMA 3GE3C 5IOIA 4US8A 1V1PA 4C4VA 3ZNZB 4RH6A 2GI9A 3Q69A 5G55A 5FK9C 3AN1A 3KVFB 2KT7A 3P4SB 3SD5A 2MSED 1FXIA 4DDGD 3MJWA 1WJUA 4ZHPA 2ZEQA 5CX3A 1WM3A 4I6PA 5G5GA 3U8ZA 2K0PA 4HCPB 4GLSC 3AE6B 3W9CB 4JIOU 3GZNI 1WF9A 2A4ZA 1JWUD 5DPTA 5KHQA 2LXCA 3ENEA 2N1WA 1RFAA 2IO1B 2V4IB 4WJQA 2KQSA 1YOVB 2IY0B 3NZSA 1L6UA 1MFWA 5IN7A 4RGOS 2LGDA 3TBLD 1K8RB 2QJLA 4HXDA 2MP2A 4LJOB 4K3BA 4DXAB 5C23A 3H9DA 4A8XC 5EE9A 1K51A 1KH0A 4GDKA 1EF5A 4ITKA 2KDEB 1D5ZC 3ZNID 2JVCA 1TTNA 4NQKE 2G1EA 4NY0A 1YJ1A 2M0XA 4ICVA 5T8IA 4FBJB 2DBYA 1WGHA 5E6OA 2WQYB 3RUIB 2NVUI 4LJPB 2LASA 2D3CA 1UGJA 1F2RC 5BO4B 4F7ZA 4ZRKA 3ZNHB 4R3DA 1GB4A 2J7QB 5D3IB 1J7BA 3A1QA 4FXCA 2JYEA 3M62B 5AZGA 4YTPB 4HROA 4F1SA 1ZDXA 1J7CA 4LNFA 1C1YB 2SEBD 2O2VA 1LO5D 2LI5A 2BYVE 2E3TA 1FXTB 3PO0A 1C76A 2PKOA 1NENB 3PSEB 4GXBA 1JWMD 3MTNB 3P4PB 2WXGA 2C9WB 2OHFA 2ZNVC 3H7PB 3P1MA 3QAQA 2DLBA 4LNOA 3A9KB 1GPXA 2PIAA 4MGZE 1P1AA 2W3SA 4NZLB 1F1HA 1MVKA 4YL8A 1IUEA 3ONSA 2M8SA 2GBJA 2HTHA 4HEA1 4TV3A 3VXWA 2IO2B 1L4ZB 4O1NA 2KXJA 3UI3A 3CWIA 2BS3B 1RYJA 1ZXHA 3W2DA 2L0TA 1E7VA 3AE9B 2AWTA 4II2B 2G3QB 3R3MA 3VUWA 4NJ7A 2QHOA 2BKRB 1E10A 3Q14C 1TJEA 1MHXA 4PYUA 1R4NB 3APCA 1Q5WB 2H89B 2JXXA 2JYTA 2MBEA 3V60A 1STEA 3UIPB 3R7RA 4E3CA 1EF1A 1TZOA 4YWGG 1RFKA 4OVZA 1M94A 3ZW3A 1UBIA 1EU3A 4FLHA 4W9IA 2DYOA 4XX5A 2WXLA 3PV1A 2KWUB 2L7RA 1Q10A 3WAPA 2MJEA 1K50A 2CU3A 4ZHOA 1D4BA 4GGQA 1WSPA 4ARCA 2FIFA 1V80A 2C5LC 3EHVA 1TBEA 4KVGB 2L05A 3KW5B 2KMCA 3QK0A 3M63B 3KH0A 2WDVB 3DBLB 1OGWA 5D7GA 3E9SA 1WXVA 3OLMD 2RDGA 3RFZB 5DPRA 2N7DA 5D3DA 2WDRB 5FR6A 4JGHB 1H8CA 1Q0WB 4I6LB 4G3XB 2K39A 2WXHA 2Y5CA 3DHHC 4WQOB 4CO7A 5HHDG 4JPSA 3RNGC 1OQYA 3ZJVA 4WWMA 2REXA 3PHWB 4BVUC 3P63A 4JWSC 2ZJDA 4II3B 1YN5A 3R2TA 3B1LX 2ACZB 1UELA 4D2KA 1UF0A 2DAFA 1YIWA 1RLFA 5L83A 1EO6A 3J9CA 1H4RA 4ACFA 2GMIC 1WX9A 3ZDTA 2ZNVB 3QQ8B 1ZUD2 3V6EB 1VZ6A 5LLIA 4KV2A 3A9JA 4A6QA 5C2TB 4KIKA 3AM9A 2BYFA 2L8JA 1PYWD 3OG5A 3N32A 1OQRA 2WXQA 1EWCA 2LGXA 4WJPA 4URKA 2WXMA 1E8XA 2CJOA 3JSVA 4LDTD 4MM3B 3L17A 3ETRA 2MJ3A 3DPDA 1WGGA 1L6VA 4YT0B 1ZOYB 3AU5A 3Q2AC 2YVCA 2LHDA 5JHBA 2OJRA 1FRRA 1UUPA 3IHPC 4TQ1A 1JRPA 4MELA 5E6PA 1OEYJ 3KWLA 4J6IA 1P7FA 1QQRA 3ZTDA 1V5OA 1M4VA 2W55A 1FCLA 3N20C 3HRDD 4PS7A 4ZRQA 4BKGA 3R8BA 2JXTA 1JCKB 2AEHA 4LCDE 5BYQA 3PZDA 4I6NB 1RRBA 3R7QA 3W5VB 2IYDB 1AN8A 1YJIA 3AE3B 1C4AA 2HD5B 3ZJUA 2ZPYA 4WAAA 1KF6B 3W1SA 1CZPA 4DHJD 2BBCA 1LFDA 2FCNA 1HZ5A 1HTQA 2TSSA 4DDID 3L08A 1RAXA 2CHWA 4MGYE 1C3TA 2Z0DB 1SJHD 1ESFA 2FUG1 3MC8A 1KLVA 1ZGUB 3QJZA 2L1AA 3QARA 3DVNV 4W9JA 3ZXRA 1K52A 1WYWB 3RT3B 1SF0A 1XD3B 4EUTA 5LNK1 3MFGA 3SEBA 1ZP0B 3TEXA 3GZNB 3N1XC 4NAWB 1WFYA 3LXFA 3DHGC 3FILA 2DYBA 4OW0A 1SE3A 2M4NA 1ET9A 4WAFA 3ZVVA 3Q3NC 5D6JB 1TS4A 2BW2A 4AQ7A 2PE6B 1EU4A 1WR1A 1IGDA 1E8WA 3ML8A 1FEHA 3L54A 3C0RB 3PZ8A 3CSTA 1FO4A 2INDC 1JQ4A 1F2RI 5HI1A 4PK1A 4K7WA 2R2OA 3C19A 1N62A 2CS4A 3NS1A 4P1CC 3N1ZC 5AUKA 2V3SA 2MHJA 4UDUC 2LZ6A 4EFOA 1AARA 1I4QA 3NG0A 2GB1A 5G5HA 3DVNU 2KMAA 1OTRB 1TS3A 1XCTL 3P4RB 1WGYA 1Y8RC 1FNUA 3ZUNA 3V3XA 2IJ0A 2WX1A 2AQ1B 2MLBA 1TKYA 4B95A 2L00B 3KWVA 4KGRA 4NAMA 1AYFA 4N6EB 2AX5A 1I4XA 3PZ7A 3HIZA 2DYMA 2XEWA 1T3QA 1OEYA 4MEMA 2JRIB 1YQ3B 2J0MA 3FAHA 3HHMA 4RNAA 3T3NA 5J2RA 3CSFA 3BVMA 3LB8C 1TKGA 4H2AA 2IO0B 3AB5A 1FXAA 2KFJA 2CR5A 1GJZA 1EWYC 2LFIA 3DBSA 4K81A 4A55A 4X57B 4WWOA 3AU4A 3CIRB 1DOIA 1UWXA 2KC2A 2WGSA 4M0WA 1KM7A 2J52A 5I4DA 2DZMA 1VCBA 3IG3A 1R4MB 3PRPB 5J17A 2K6DB 2BB5A 1SE2A 4MDKE 3VUXA 4KZCA 5D2MB 3VR9B 3ZQ4A 4RMAA 4LDTB 2KOXA 4B6WA 1UZXB 3PT2B 4EKUA 2FNJB 2XK5A 2KHWB 4IM2A 1PUTA 3EC8A 2BS2B 1N61A 3AE2B 1DOYA 3TEYA 2LVPA 3HVDA 3VTWA 2PW9A 4L23A 4KDLB 3VHTC 4TSSA 1C4CA 1DOXA 4M01A 2J42A 3DCGA 2AQ2B 4GN1A 3DDCB 3AE7B 1WE6A 2HJ1A 2HJ8A 1TYGB 2VRRB 3VTVA 2EKEC 3EECA 2ZVNA 4DHZE 2J0JA 3RZWC 3AXCA 2N9KA 4EEWA 4EE2A 3QA8A 3OJ3A 2K1FA 2BB6A 2L76A 2MA9B 3SDLC 3VRAB 1RWSA 2K5PA 3AULA 4MJSB 4DHJB 4HVBA 1EM7A 1BUIC 4EOYA 4MSMB 1JMLA 5CTRC 3QCAA 1WGRA 2N0SB 3BWUD 2Z8LA 1E0ZA 4WURA 3DVGY 4LNIA 4DXGA 1YJJA 3ZNGC 3U7DA 3S2AA 1C79A 2GBNA 2V3NA 1TS5A 1QF6A 3ECIA 1WRIA 4KSKC 1SBBB 1L5PA 4N59A 1IYFA 4WIPA 4HRSA 1J8CA 2WU2B 1C4PA 1SSNA 3V6CB 3MP9A 4EZLA 1ZKHA 3CF6E 3IFWB 3W1YA 4EZJA 1NYRA 3NVWA 2IZVB 4K7SA 1NEKB 2AL6A 2OOBB 2CJNA 2PVOD 2HE7A 4W9LA 4XDDA 1Z5SB 2BKFA 1JWAD 2WXJA 5CHVC 3RCZA 3GP7A 1I42A 5L95C 3WALA 1ACCA 1E9MA 2KAJA 2Q5WD 4GMVA 1F9JA 2KWVB 1CJEA 2HTME 3ZKJC 2LJ5A 2LEKA 3RNEC 3RI7C 2LRUA 3I57A 3RPFC 4QAYA 1WRDB 1WZ0A 2KN5A 4YSYB 4MT5A 1SXTA 4GDLB 4C7YA 3KQ4A 1QZEA 2RSUA 3OWEB 4YSZB 1HA5A 4RM9A 1WYGA 2KWDA 4KGTA 1UD7A 1R4MI 3ZXVA 5AZFA 4KX6B 3BVZA 3UQBA 1WMHB 2FUHB 3VFKA 1XLQA 2V3PA 4C56C 2GLSA 3RNBC 4ANUA 2RR9A 2JPHA 2V1YA 1V49A 2LRWA 4W9HA 2X38A 4G11A 1UNSA 1L4DB 3L4PA 2BYTA 2VZKD 3A4SC 2I1JA 3EFCA 3ZGZA 2MCNB 4WWNA 3T3OA 2JUOA 2K25A 2O6VA 2IPKD 3DBRB 5BYRA 1ISNA 2KO3A 2ZVOA 4FJYA 2DZKA 3KUDB 2MX2A 1BMLC 1OQQA 4PS3A 5BMHA 2NBUA 2KX3A 3TEWA 4LLGM 2DX5B 5CHFA 1I7HA 2I38A 1E7UA 2JF5A 4LNNA 4FJVB 3NZUA 3AV8A 3RN9C 1TY0A 3ML9A 5HG2A 1WWTA 2N9EB 1D3ZA 4S0RA 4GB9A 2JZZA 3VDZA 2WWZA 3ZRCA 1V1PB 2LUMA 4C4VB 4B9KA 1VZ8A 4KKJA 5IO9A 1Q1OA 2LD9A 3DOWA 5HFYA 4E74A 3FC4A 2WS3B 2N4FA 4IOIE 3AEBB 1YX5B 1GOZA 4N58A 3VUYA 2DAJA 4ZRJA 1WJNA 1I4PA 1GG3A 4S17A 3CMMB 2QEJC 2KWCA 4Q2JA 1KJTA 4NPNA 4A3OA 3HK0A 2I2YA 2L32A 3N3KB 1EUVB 4YTNB 4IUMB 2LUEA 2L52A 1YX6B 1YD8U 1V86A 2FCSA 1PDXA
chains in the Genus database with same CATH topology
3MC0B 1UWMA 2L1AA 4JWUC 3U2SC 4RF1A 3VR8B 4B0MA 1K52A 4RFBA 2PLPA 1IBXA 4XWTA 2BT6A 1SF0A 5LNK1 3MFGA 4CQNA 3BVGA 4RCOA 1D5XC 2OEDA 3SEBA 1XCQL 1ZP0B 1PGBA 3TEXA 3TUOA 4NAWB 2KN4A 1KLGD 3LXFA 2J4XA 3FILA 3V05A 3Q8AA 1QLBB 4OW0A 3Q8EA 1SE3A 1VR9A 4YSXB 5FR3A 2KDMA 2BS4B 4GDKB 1ET9A 1SJED 3BK2A 4WAFA 1QT9A 3ZYYX 1FIQA 1TS4A 2BW2A 4AQ7A 1EU4A 1YN4A 1XO3A 3B2GA 3LYYA 5JXVA 1IGDA 3BYTB 1ZPSA 1CK1A 1FEHA 3WCQA 2JX5A 1IGCA 1XLOA 1YMHE 3PZ8A 4KGSA 1FO4A 2ZW0A 1FCCC 4US8A 3HVZA 1JQ4A 1V1PA 1F2RI 5HI1A 3IAS1 2HDEA 1KLUD 4RH6A 1R7SA 2GI9A 5TSSA 3Q69A 3NS1A 1N62A 1FFVA 5FK9C 3AN1A 2WXRA 5AUKA 2WXOA 3P4SB 4UDUC 4AS1A 1JALA 1XXGA 1FXIA 2N9LA 1HEZE 1OFFA 4ZHPA 1I4QA 3MHZA 2GB1A 1PFDA 5G5GA 1QOBA 5G5HA 2K0PA 4GLSC 1TS3A 1XLNA 3AE6B 3W9CB 1XCTL 3P4RB 1NYQA 4A90A 2AQ3B 2WXNA 3EA6A 4B0EA 4IDIA 2PVGC 2XN9C 4P16A 1JWUD 3TSSA 1ENFA 2WU5B 3BYYB 3KLSX 3IT6B 1FNUA 2V4IB 3V3XA 2IJ0A 2AQ1B 4YTMB 3SR6A 1L6UA 1TKYA 2ONQA 5H8YE 2JQRB 1N5WA 4PT5A 3KWVA 3AEAB 2JWUA 4KGRA 4NAMA 4RGOS 1AYFA 4N6EB 2AX5A 1I4XA 1E6EB 3PZ7A 2QJLA 2DYMA 2WXPA 1N5XA 2K22A 2LGIA 2W54A 1KRHA 4ZOHC 2KMMA 3GB1A 3SFEB 1T3QA 2RMMA 2QIEB 1YQ3B 3ZJTA 3FAHA 4RNAA 5EE9A 4A8XC 1K51A 2DWQA 1AWDA 2MH7A 1KH0A 3T3NA 4ITKA 4HKQA 1D5ZC 1SB3C 4RF0A 5FKAC 3BVMA 3LB8C 2EELA 1TKGA 1Y56A 4H2AA 3AB5A 2G1EA 1FXAA 4OZBA 5BYSA 5T8IA 1EWYC 2MJDA 2DBYA 2WQYB 2LFIA 1NI3A 3NZ3A 4A55A 3CIRB 1DOIA 4J3OD 1UWXA 1UGJA 2ZW1A 3NUHB 4TMAB 4M0WA 1F2RC 1XF5L 2J52A 2XNAC 5I4DA 4A9AA 1FNWA 3SFDB 1C9FA 2BB5A 3AEFB 4R3DA 1SE2A 1GB4A 2VZKB 1YNTE 5D3IB 2ON8A 2YEPB 1D6EC 3VR9B 3ZQ4A 1J7BA 4P6VF 1PGAA 4FXCA 1VZ7A 2JYEA 2GRIA 1V1OA 2WLBA 4RGMA 4YTPB 4HROA 4JE3B 1ZDXA 1FFUA 1WXQA 3HUIA 2B76B 1J7CA 2SEBD 1I4GA 1LO5D 1PUTA 3AE5B 3EGRA 2E3TA 1QOGA 2BS2B 1FM0D 1QOFA 3PO0A 1N61A 1CQVA 3AE2B 1C76A 2PKOA 3HVDA 1NENB 3TEYA 1DOYA 2QMTA 1JWMD 3P4PB 2PW9A 2WXGA 1FD6A 2OHFA 3AEEB 4L23A 1PGXA 1TY2A 3BIID 3P1MA 3VQIA 3AEDB 2DLBA 2WDQB 1N60A 4TSSA 3B9JA 3BK1A 1C4CA 2INNE 2Y5PA 1KTKA 1DOXA 1GPXA 1NVID 2PIAA 5MPOA 2J42A 2AQ2B 1F77A 3ABVB 1WGKA 5E6JA 2W3SA 4NZLB 3AE7B 1MVKA 1IUEA 1TYGB 2RDHA 4HEA1 1P7EA 4ZRPA 1SIJA 2NMQA 4USAA 1L4ZB 1DGJA 2D5GA 4O1NA 3O13A 1BXTA 2N9KA 3UI3A 1C78A 3CWIA 4OZAA 2BS3B 4EE2A 1ET6A 2Y3AA 1GB1A 1RYJA 2BB6A 3VRAB 1RWSA 2K5PA 4MH8A 1ZXHA 4WH4A 3W2DA 2R61A 1KFYB 3AE9B 1EM7A 3EUB2 3IT4B 1TKEA 1VDVA 1BUIC 2W82A 4RGTA 4WQMA 1ZE3D 1ROEA 1JMLA 1E10A 1TJEA 2FE8A 1MHXA 1QILA 2N0SB 3N9YC 1QOAA 2L83A 2H89B 3VRBB 1L0XB 1ZDVA 2JYTA 2Z8LA 3BWUD 1E0ZA 4WURA 3C8YA 3H8HA 4DXGA 1YJJA 1STEA 1L0VB 1FMAD 2M0AA 1C79A 1TZOA 2V3NA 1TS5A 3Q8FA 1JROA 1QF6A 4YWGG 1JW9D 1RFKA 4OVZA 1VJKA 4LTUA 1WRIA 2IDYA 4RGNA 1QKZA 3GS2A 1SBBB 3NRZA 1L5PA 3BZDB 4N59A 1HQRD 1F0ZA 1EU3A 3U52E 4WIPA 4HRSA 1XLPA 2DYOA 1YN3A 1V97A 2WU2B 1C4PA 4XDCA 1SSNA 3Q8BA 1SEBD 2M19A 3MP9A 2WXLA 1J7AA 3IXSA 4LK0M 1Q10A 2V0GA 2M56B 3I9V1 2MJEA 3P42A 1K50A 2CU3A 4ZHOA 1D4BA 4L1BA 1NYRA 3U7ZA 3NVWA 2QSDA 1NEKB 1WSPA 5EE0A 2CJNA 1DYQA 4REZA 1I4HA 2PVOD 4ARCA 4IKGA 2RPVA 4XDDA 1XEEA 1MI0A 1FRDA 1B1ZA 1TS2A 1ZXIA 1JWAD 2WDVB 4KKIA 2WXKA 2WXJA 1JWSD 2NTTA 1RM6C 3AECB 5D7GA 3E9SA 3GP7A 3NVZA 2WXIA 3Q8CA 1ACCA 2RDGA 3RFZB 1HZ6A 5D3DA 2WDRB 5BMGA 2H88B 1E9MA 4NJCA 2KAJA 2Q5WD 3AMZA 3MJ5A 4JX1C 4XWWA 2INPE 1CJEA 2HTME 2WXHA 2Y5CA 3B2FA 2LEKA 5HHDG 4JPSA 3IAM1 3ZJVA 1T6BX 3I57A 4WWMA 2PMVA 3RPFC 2QILA 3P63A 4US9A 4JWSC 2E6XA 4YSYB 4MT5A 1SXTA 4GDLB 1YN5A 3R2TA 3KQ4A 4C7YA 3OWEB 2ACZB 2LJIA 4YSZB 4D2KA 1HA5A 3DWMA 1WYGA 2KWDA 4KGTA 3J9CA 4TQ0A 4YXDB 3W5UB 4KX6B 4XE0A 5H92C 2PTLA 4ARIA 3BVZA 1C77A 1K53A 1ZUD2 1VZ6A 1AW7A 1XLQA 2KACA 2V3PA 2WP9B 4C56C 1VRAB 3URYA 2K3UA 3E56A 4A6QA 5C2TB 2WNMA 3AM9A 3TEZA 3P4QB 2NTSA 1PYWD 2X38A 1UNSA 2LHEA 1L4DB 5EE3A 3L4PA 2BYTA 1OQRA 3AH7A 2WXQA 2JSVX 2VZKD 1EWCA 2YEPF 2G9HD 2WXMA 3ZGZA 3T3OA 2LMCA 2CJOA 1V8CA 2MEKA 2SAKA 2IPKD 4MM3B 2J53A 3ETRA 2K9XA 5BYRA 2MJ3A 1MHHE 1IBXB 1L6VA 3DWGC 4YT0B 1ZOYB 3R2IA 4ZYSA 1T5XD 1BMLC 2LHDA 1L0YB 1E7PB 1FRRA 1OQQA 1UUPA 4L2YA 4TQ1A 4HKZE 1JRPA 5BMHA 3FILB 3TEWA 4LLGM 4DQOC 3KWLA 1I7HA 1P7FA 2I38A 1QQRA 3AE4B 1FNVA 2ICIA 5EE1A 3AV8A 1M4VA 1JWBD 1TY0A 1SE4A 2W55A 1FCLA 1MPEA 2KQ4X 5HG2A 1WWTA 3AEGB 3HRDD 4ZRQA 2BTEA 1B9RA 2JZPA 3R8BA 2JXTA 1JCKB 4MACA 4HJGE 4C80A 1A70A 1V1PB 2LUMA 1VZ8A 4KKJA 5BYQA 2W3RA 2WXFA 5HFYA 2N7JA 3FC4A 3W5VB 1GAQB 2WS3B 4IOIE 3AE1B 4OZCA 3AEBB 1AN8A 2IGGA 1YJIA 3AE3B 1C4AA 1GOZA 4N58A 1I4RA 3AE8B 2IGDA 3ZJUA 2FBWB 5BMIA 1I4PA 4DXFA 1KF6B 3W1SA 1CZPA 2QEJC 4Q2JA 2IGHA 2BBCA 5AUIA 1D5MC 1VLBA 1HZ5A 1HXYD 2TSSA 4OHJA 3NVVA 1N63A 5GXGB 2EKIA 2I2YA 2L32A 4YTNB 2JU6X 2L52A 4C7ZA 1SJHD 1ESFA 2FUG1 5C3JB 3U4EG 1YQ4B 3NVYA 1PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZB A;  1JML A;  1K53 A;  1K52 A;  1MHX A;  2PLP A;  1IBX A;  2KAC A;  2OED A;  1XCQ L;  1PGB A;  1UWX A;  2KN4 A;  2ZW1 A;  3FIL A;  2LHE A;  1F2R C;  1XF5 L;  2J52 A;  2KDM A;  2JSV X;  1C9F A;  1QKZ A;  5JXV A;  1IGD A;  1GB4 A;  1YNT E;  2ON8 A;  2J53 A;  1IGC A;  1MHH E;  1YMH E;  1IBX B;  4KGS A;  2ZW0 A;  1FCC C;  1F2R I;  1PGA A;  3MP9 A;  5HI1 A;  2GI9 A;  2LHD A;  1Q10 A;  5BMH A;  4HKZ E;  3FIL B;  1K50 A;  1D4B A;  2QSD A;  2I38 A;  1P7F A;  2N9L A;  1HEZ E;  1FCL A;  1MPE A;  4IKG A;  2KQ4 X;  2GB1 A;  2RPV A;  5HG2 A;  1MI0 A;  2QMT A;  2K0P A;  2PW9 A;  1FD6 A;  4GLS C;  2JZP A;  2JXT A;  1PGX A;  1XCT L;  4MAC A;  4HJG E;  2LUM A;  5HFY A;  1HZ6 A;  2N7J A;  3V3X A;  1MVK A;  4IOI E;  5BMG A;  2ONQ A;  4OZC A;  2IGG A;  1P7E A;  2JWU A;  4KGR A;  2NMQ A;  2IGD A;  5BMI A;  2N9K A;  5HHD G;  3UI3 A;  4OZA A;  2LGI A;  2IGH A;  1GB1 A;  3GB1 A;  1HZ5 A;  1ZXH A;  2RMM A;  4WH4 A;  2I2Y A;  1EM7 A;  1K51 A;  4D2K A;  1KH0 A;  2KWD A;  2JU6 X;  4KGT A;  2EEL A;  2PTL A; 
#chains in the Genus database with same CATH topology
 4PS8 A;  4JWU C;  4DHZ B;  4RF1 A;  3VR8 B;  4B0M A;  2PLP A;  1IBX A;  4XGA B;  4HDO A;  1TZ1 A;  4AP4 C;  2MP2 B;  3BVG A;  4RCO A;  2BWF A;  1PGB A;  2GBM A;  2IO3 B;  1KLG D;  4ANV A;  4HPP A;  3V05 A;  1QLB B;  3Q8E A;  2DHZ A;  4BOZ B;  4GDK B;  3ZTC A;  3UIN B;  1QT9 A;  3JW0 X;  1YN4 A;  1E8Y A;  3RNF C;  1WXS A;  1ZPS A;  1CK1 A;  4M00 A;  4GSW A;  1YMH E;  3N1Y C;  2ZW0 A;  3TJP A;  2FAZ A;  3HVZ A;  3B08 A;  2IY1 B;  2FID A;  5TSS A;  3M3J A;  5IA7 A;  4BAX A;  2D3B A;  1JAL A;  1JRU A;  4N9F 4;  3MHZ A;  3LJ3 A;  3N30 A;  4XC2 A;  4M8N A;  4A90 A;  1NYQ A;  3WAN A;  4ANX A;  2AQ3 B;  2B3A A;  3A1Q B;  3EA6 A;  3PRM B;  2PVG C;  4P16 A;  1GC7 A;  3TSS A;  2NBV B;  2WU5 B;  3KLS X;  3IT6 B;  4ANW A;  1F52 A;  4YTM B;  1P0R A;  2O2V B;  2ONQ A;  2UYZ B;  5H8Y E;  4PT5 A;  1WZ3 A;  5IKC M;  2D2Q A;  4ZOH C;  3WA0 A;  4BKS A;  3Q3J A;  1G6J A;  2QIE B;  2LVO A;  2DWQ A;  4HKQ A;  4M02 A;  1SB3 C;  5FKA C;  1Y56 A;  2LGY A;  4OZB A;  2L0F A;  3DBR I;  4HK2 A;  2MJD A;  3MC9 A;  5E6N A;  1NI3 A;  3NZ3 A;  4DBG A;  2KDI A;  2M17 A;  2ZW1 A;  3IVF A;  3H6N A;  5G2N A;  3PLU A;  4A9A A;  1V6E A;  1MG4 A;  3I5J C;  1NDD A;  1VD2 A;  3GOE A;  2VZK B;  1YNT E;  3Q3O C;  4WWP A;  2YEP B;  4FAD A;  4P6V F;  4IC7 B;  1VZ7 A;  4LNK A;  2GRI A;  1V1O A;  4BFR A;  1WJ4 A;  4RGM A;  2KJR A;  5TR5 A;  4CHK A;  1FFU A;  1V9J A;  1T0R C;  3H1U A;  3AE5 B;  4M8M A;  1V5T A;  1FPY A;  2RDB C;  4IM3 A;  2QMT A;  2KLG A;  1IP9 A;  4MH0 E;  2BWE S;  3AEE B;  1PGX A;  4OVV A;  3BII D;  5DCN A;  3B0A A;  3GE8 C;  3AED B;  1N60 A;  2LXA A;  3B9J A;  3BK1 A;  2Y5P A;  3T9L A;  3W1S C;  3JVZ X;  1KTK A;  4MGK E;  5MPO A;  2R2Q A;  3ABV B;  2AL3 A;  4ZDV A;  1WGK A;  5E6J A;  3ZIM A;  2V9H A;  1E5W A;  3M95 A;  2D3A A;  2INC C;  4ICU A;  3QWZ B;  3TL5 A;  4ZRP A;  2NMQ A;  4USA A;  1DGJ A;  2KC1 A;  3O13 A;  4K1R B;  2C60 A;  4OZA A;  2BPS A;  1GB1 A;  4TKN A;  4MH8 A;  4WH4 A;  1SGH A;  1TKE A;  1VDV A;  3O65 B;  4RGT A;  1ZE3 D;  3NOB A;  1ROE A;  2FE8 A;  1QIL A;  3PTF C;  2D07 B;  3VRB B;  1L0X B;  4XYC A;  3C8Y A;  2FCQ A;  4BKT A;  1FMA D;  2M0A A;  2PJH A;  1TGZ B;  1JRO A;  1JW9 D;  1VJK A;  3QIJ A;  2IDY A;  2KYW A;  4RGN A;  4P7I A;  2K6Q A;  1QKZ A;  3GS2 A;  3SU8 X;  1F0Z A;  3U52 E;  3BY4 B;  1XLP A;  2ZZP B;  4XDC A;  1SEB D;  2M19 A;  3QX1 A;  4A3P A;  3A9J B;  1J7A A;  1P98 A;  4KIK B;  3OAW A;  4AJY B;  4LK0 M;  4KZ0 A;  2V0G A;  2IBI B;  3DQV A;  3U7Z A;  4NJ6 A;  1LM8 B;  1T0Y A;  2DZI A;  1DYQ A;  4IM0 A;  4REZ A;  1I4H A;  4WJO A;  4KSL C;  4IKG A;  1GUA B;  2RPV A;  3JSV B;  1MI0 A;  1B1Z A;  2DNF A;  2BQQ A;  1TS2 A;  1J0G A;  1ZXI A;  3ZLZ A;  2NTT A;  3NVZ A;  2N9P C;  3APF A;  1HZ6 A;  5BMG A;  2H88 B;  3QHT A;  4NJC A;  3MJ5 A;  4XWW A;  2INP E;  2LGS A;  2G4S A;  2VH2 A;  3IAM 1;  2PMV A;  2UWQ A;  2QIL A;  2PEA A;  2KAN A;  3PGE A;  4US9 A;  3Q3M C;  2EMS A;  4FUL A;  5JZE B;  2E6X A;  4G50 A;  4TUU A;  3ZRF A;  2LJI A;  3DWM A;  3TIX A;  2MW5 A;  3PRZ A;  2Y5B B;  3SHQ A;  3W5U B;  4XE0 A;  5H92 C;  2PTL A;  4ARI A;  1K53 A;  2ASQ A;  2YLM A;  3X23 A;  2KTF A;  3H7S A;  4BBN F;  1U4A A;  1WXM A;  1VRA B;  2GOW A;  4FJZ A;  3L13 A;  3UIO B;  3TEZ A;  1MG8 A;  2PE9 A;  4WJN A;  2KJH B;  2Z59 B;  2DZJ A;  3JYU A;  2G9H D;  1IPG A;  2KDF B;  1WE7 A;  1L7Y A;  2K8H A;  2MEK A;  2SAK A;  3Q6B A;  4OVU A;  2K9X A;  2D11 A;  3HM3 A;  3R2I A;  4C00 A;  2X8X X;  1UBQ A;  1XT9 B;  4L2Y A;  2KJ6 A;  3FIL B;  3IBE A;  3A4R A;  3AE4 B;  2KFK A;  1SE4 A;  2KDB A;  4W9C A;  1MPE A;  2KQ4 X;  3AEG B;  3NHE B;  1B9R A;  2BTE A;  3ZDM C;  4HJG E;  3PRE A;  4C80 A;  1LXD A;  2VH1 A;  3X0W A;  2KNB A;  2WXF A;  3V62 A;  4OZC A;  4HDQ A;  2V4L A;  1E8Z A;  3AE8 B;  4NQL B;  1P3Q U;  3TCA A;  5BMI A;  3D32 A;  3NY5 A;  4DXF A;  5AUI A;  1WY8 A;  3NVV A;  5GXG B;  1CMX B;  2KLC A;  3K9O B;  1YQB A;  2A5U A;  2EKI A;  2JRH A;  2NPT A;  2JU6 X;  5HKH A;  4C7Z A;  3I63 C;  4W9E A;  3L10 B;  5C3J B;  3WAO A;  3MC0 B;  1UWM A;  2C7H A;  3NJT A;  4MM3 A;  2N9X A;  4XWT A;  3ALB A;  4CQN A;  3DBH B;  1XCQ L;  4GOC A;  4IWO A;  4RM8 A;  3ZO5 B;  1WX8 A;  1VR9 A;  4YSX B;  5FR3 A;  2BS4 B;  1SJE D;  5KHO A;  2QC8 A;  3KYC D;  3LYY A;  4G0N B;  5JXV A;  3BYT B;  2CHX A;  2JX5 A;  1IGC A;  4KGS A;  1BT0 A;  1FCC C;  1E90 A;  3IAS 1;  3L0W B;  2HDE A;  1KLU D;  1R7S A;  4KDI C;  1FFV A;  2WXR A;  1WI0 A;  3V61 A;  3RD2 A;  4M0W B;  2WXO A;  3DVG X;  1L2N A;  4AS1 A;  1XXG A;  5JH5 C;  2N9L A;  2O6V D;  1T0Q C;  1HEZ E;  3A33 B;  1OFF A;  1PFD A;  1QOB A;  2CHZ A;  1XLN A;  3TMP B;  2W9N A;  2WXN A;  2XBB C;  4B0E A;  4IDI A;  2RD0 A;  2XN9 C;  3VAW A;  4XZ4 A;  2NBW B;  4BZA A;  1ENF A;  3BYY B;  3P2B A;  1S1Q B;  3R66 C;  2XK5 B;  2BYE A;  2JZ3 B;  3SR6 A;  2LWP A;  4E71 A;  2JQR B;  1N5W A;  3AEA B;  2JWU A;  1E6E B;  2WXP A;  4AUQ C;  1N5X A;  2K22 A;  2LGI A;  2W54 A;  1KRH A;  2KMM A;  3GB1 A;  4NAW A;  3SFE B;  4AWJ A;  3HM6 X;  2RMM A;  3FKY A;  4FN2 A;  3ZJT A;  2D10 A;  2MH7 A;  2PPH A;  1AWD A;  3UF8 A;  4RF0 A;  2NR2 A;  3APD A;  3BIN A;  2EEL A;  1LQB A;  2KTR A;  5BYS A;  3PVL A;  3WAM A;  4AJW A;  1WX7 A;  5AEK B;  4GU2 A;  1MJD A;  2QCZ A;  1WIA A;  4W9G A;  4J3O D;  1WH3 A;  2C7N B;  1UH6 A;  3NUH B;  4TMA B;  2MQJ A;  1V81 A;  4ASW C;  1XF5 L;  2XNA C;  2L3Z A;  1FNW A;  3SFD B;  1C9F A;  3AEF B;  3Q3F A;  4JQW C;  2ON8 A;  2JWZ A;  1D6E C;  3KUZ A;  1PGA A;  2WLB A;  3OJ4 B;  2FCM A;  3UGB B;  4JE3 B;  2G4D B;  4BOS C;  3L16 A;  1WXQ A;  3HUI A;  1P9D U;  2B76 B;  4W9D A;  1YQ4 B;  1I4G A;  3EGR A;  1QOG A;  1FM0 D;  1QOF A;  2KFK B;  1CQV A;  5LXH A;  4NNJ B;  2KZR A;  3PHX B;  1FD6 A;  1TY2 A;  2NCN A;  3VQI A;  2WDQ B;  2OJW A;  2INN E;  2N7E A;  3RMK C;  1NVI D;  1F77 A;  1NI2 A;  2RDH A;  1P7E A;  1SIJ A;  1SE9 A;  2D5G A;  1PQS A;  2KVR A;  3LDZ E;  1BXT A;  3DBH I;  1C78 A;  1ET6 A;  2Y3A A;  2KKC A;  2R61 A;  1KFY B;  3RNC C;  2BVC A;  3EUB 2;  2NPT B;  4FA6 A;  2UU7 A;  4PYZ A;  3IT4 B;  2DEN B;  2W82 A;  4MGI E;  4WQM A;  2WYQ A;  1GC6 A;  2RGF A;  4JLC A;  4DWF A;  5JHA A;  4BKS D;  3EFU A;  3N9Y C;  1QOA A;  2L83 A;  1ZDV A;  5LXI B;  3H8H A;  3VTU A;  1L0V B;  1ZW7 A;  3Q8F A;  1A5R A;  1KOT A;  4LTU A;  3KUC B;  3NRZ A;  3BZD B;  1HQR D;  3DHI C;  2AYO B;  1YN3 A;  1V97 A;  3Q8B A;  5CHW A;  4K3C A;  1WGD A;  3IXS A;  1HE8 A;  3PLV A;  2CU1 A;  4BBN C;  2M56 B;  3I9V 1;  3P42 A;  3PPA A;  2RPQ A;  2M1M A;  4L1B A;  2QSD A;  1GNU A;  5EE0 A;  1XEE A;  1R4N I;  2O6V B;  1FRD A;  2WDT B;  1Z2M A;  4KKI A;  2WXK A;  1JWS D;  3VH3 B;  1RM6 C;  3AEC B;  4MJS A;  1XQQ A;  3K9P B;  3PS6 A;  2MBH A;  2WXI A;  3Q8C A;  2WX0 A;  4HCN B;  4HLE A;  1T0S C;  2ZCB A;  4IWQ A;  3AMZ A;  4JX1 C;  2KVZ A;  1S3S G;  3B2F A;  5J18 A;  5GMV A;  3RNA C;  5AZH A;  1T6B X;  2CKH B;  4HJK A;  2MWS B;  4TQ0 A;  3T8M A;  4W9K A;  4YXD B;  3RYT A;  3UQA A;  4F8C B;  4GIV A;  4W9F A;  2J0K A;  2KTR B;  1C77 A;  2KQ7 A;  3VH4 B;  5IAA C;  1AW7 A;  2KAC A;  2WP9 B;  3DBL I;  4ZYN A;  2K3U A;  3MHS D;  4K7U A;  3E56 A;  3URY A;  2I1K A;  2WNM A;  3P4Q B;  2ZCC A;  2K8C A;  2NTS A;  5EDS A;  2LHE A;  5EE3 A;  3AH7 A;  5DPS A;  4HWI B;  2JSV X;  1HTO A;  3RZF A;  1TT5 B;  2YEP F;  2LMC A;  2KK8 A;  1V8C A;  5IP4 D;  2J53 A;  1IBX B;  1MHH E;  4EZK A;  1V2Y A;  2KD0 A;  3DWG C;  2C7M B;  4ZYS A;  1T5X D;  1L0Y B;  1E7P B;  1WM2 A;  4HKZ E;  4ZRI A;  4JL9 A;  4DQO C;  2LVQ A;  1FNV A;  5D94 A;  2ICI A;  5EE1 A;  3QC8 B;  2QDF A;  5DPW A;  1JWB D;  2MBO A;  1I35 A;  3I3T B;  2BGF A;  2MBQ A;  4HPL B;  2JZP A;  3H7P A;  4HPM B;  4MAC A;  1TIF A;  1A70 A;  4GDL A;  3A9K A;  2Z0E B;  2W3R A;  3NS8 A;  4MSQ B;  2N7J A;  4CYE A;  1GAQ B;  4AOF A;  3AE1 B;  2IGG A;  2JY6 A;  4P1B C;  1WMH A;  1LGR A;  1UGM A;  4IG7 B;  1I4R A;  2IGD A;  2GBR A;  2FBW B;  2JT4 B;  1N6Z A;  2G45 B;  4FHJ A;  1WR6 E;  2IGH A;  1D5M C;  1VLB A;  1HXY D;  4OHJ A;  1N63 A;  3AI5 A;  3U30 A;  2N1V A;  2MRP A;  1WJ6 A;  2K8B A;  2NS5 A;  2GBK A;  2WHI A;  3U4E G;  3NVY A;  3U2S C;  3KYD D;  4RFB A;  2EMT A;  2BT6 A;  3VVW B;  1WXA A;  4A20 A;  1D5X C;  2OED A;  2ZPN A;  3TUO A;  2KN4 A;  2BF8 B;  2J4X A;  4FHK A;  2KX0 A;  1NBF C;  3Q8A A;  4DK5 A;  5C1Z A;  2KDM A;  3BK2 A;  4IWP A;  3ZYY X;  1FIQ A;  3RUL A;  1SIF A;  1XO3 A;  3B2G A;  4IW0 A;  2MBB B;  1X1M A;  3WCQ A;  1J19 A;  1XLO A;  2D3G A;  3WIM A;  3GE3 C;  5IOI A;  4US8 A;  1V1P A;  4C4V A;  3ZNZ B;  4RH6 A;  2GI9 A;  3Q69 A;  5G55 A;  5FK9 C;  3AN1 A;  3KVF B;  2KT7 A;  3P4S B;  3SD5 A;  2MSE D;  1FXI A;  4DDG D;  3MJW A;  1WJU A;  4ZHP A;  2ZEQ A;  5CX3 A;  1WM3 A;  4I6P A;  5G5G A;  3U8Z A;  2K0P A;  4HCP B;  4GLS C;  3AE6 B;  3W9C B;  4JIO U;  3GZN I;  1WF9 A;  2A4Z A;  1JWU D;  5DPT A;  5KHQ A;  2LXC A;  3ENE A;  2N1W A;  1RFA A;  2IO1 B;  2V4I B;  4WJQ A;  2KQS A;  1YOV B;  2IY0 B;  3NZS A;  1L6U A;  1MFW A;  5IN7 A;  4RGO S;  2LGD A;  3TBL D;  1K8R B;  2QJL A;  4HXD A;  2MP2 A;  4LJO B;  4K3B A;  4DXA B;  5C23 A;  3H9D A;  4A8X C;  5EE9 A;  1K51 A;  1KH0 A;  4GDK A;  1EF5 A;  4ITK A;  2KDE B;  1D5Z C;  3ZNI D;  2JVC A;  1TTN A;  4NQK E;  2G1E A;  4NY0 A;  1YJ1 A;  2M0X A;  4ICV A;  5T8I A;  4FBJ B;  2DBY A;  1WGH A;  5E6O A;  2WQY B;  3RUI B;  2NVU I;  4LJP B;  2LAS A;  2D3C A;  1UGJ A;  1F2R C;  5BO4 B;  4F7Z A;  4ZRK A;  3ZNH B;  4R3D A;  1GB4 A;  2J7Q B;  5D3I B;  1J7B A;  3A1Q A;  4FXC A;  2JYE A;  3M62 B;  5AZG A;  4YTP B;  4HRO A;  4F1S A;  1ZDX A;  1J7C A;  4LNF A;  1C1Y B;  2SEB D;  2O2V A;  1LO5 D;  2LI5 A;  2BYV E;  2E3T A;  1FXT B;  3PO0 A;  1C76 A;  2PKO A;  1NEN B;  3PSE B;  4GXB A;  1JWM D;  3MTN B;  3P4P B;  2WXG A;  2C9W B;  2OHF A;  2ZNV C;  3H7P B;  3P1M A;  3QAQ A;  2DLB A;  4LNO A;  3A9K B;  1GPX A;  2PIA A;  4MGZ E;  1P1A A;  2W3S A;  4NZL B;  1F1H A;  1MVK A;  4YL8 A;  1IUE A;  3ONS A;  2M8S A;  2GBJ A;  2HTH A;  4HEA 1;  4TV3 A;  3VXW A;  2IO2 B;  1L4Z B;  4O1N A;  2KXJ A;  3UI3 A;  3CWI A;  2BS3 B;  1RYJ A;  1ZXH A;  3W2D A;  2L0T A;  1E7V A;  3AE9 B;  2AWT A;  4II2 B;  2G3Q B;  3R3M A;  3VUW A;  4NJ7 A;  2QHO A;  2BKR B;  1E10 A;  3Q14 C;  1TJE A;  1MHX A;  4PYU A;  1R4N B;  3APC A;  1Q5W B;  2H89 B;  2JXX A;  2JYT A;  2MBE A;  3V60 A;  1STE A;  3UIP B;  3R7R A;  4E3C A;  1EF1 A;  1TZO A;  4YWG G;  1RFK A;  4OVZ A;  1M94 A;  3ZW3 A;  1UBI A;  1EU3 A;  4FLH A;  4W9I A;  2DYO A;  4XX5 A;  2WXL A;  3PV1 A;  2KWU B;  2L7R A;  1Q10 A;  3WAP A;  2MJE A;  1K50 A;  2CU3 A;  4ZHO A;  1D4B A;  4GGQ A;  1WSP A;  4ARC A;  2FIF A;  1V80 A;  2C5L C;  3EHV A;  1TBE A;  4KVG B;  2L05 A;  3KW5 B;  2KMC A;  3QK0 A;  3M63 B;  3KH0 A;  2WDV B;  3DBL B;  1OGW A;  5D7G A;  3E9S A;  1WXV A;  3OLM D;  2RDG A;  3RFZ B;  5DPR A;  2N7D A;  5D3D A;  2WDR B;  5FR6 A;  4JGH B;  1H8C A;  1Q0W B;  4I6L B;  4G3X B;  2K39 A;  2WXH A;  2Y5C A;  3DHH C;  4WQO B;  4CO7 A;  5HHD G;  4JPS A;  3RNG C;  1OQY A;  3ZJV A;  4WWM A;  2REX A;  3PHW B;  4BVU C;  3P63 A;  4JWS C;  2ZJD A;  4II3 B;  1YN5 A;  3R2T A;  3B1L X;  2ACZ B;  1UEL A;  4D2K A;  1UF0 A;  2DAF A;  1YIW A;  1RLF A;  5L83 A;  1EO6 A;  3J9C A;  1H4R A;  4ACF A;  2GMI C;  1WX9 A;  3ZDT A;  2ZNV B;  3QQ8 B;  1ZUD 2;  3V6E B;  1VZ6 A;  5LLI A;  4KV2 A;  3A9J A;  4A6Q A;  5C2T B;  4KIK A;  3AM9 A;  2BYF A;  2L8J A;  1PYW D;  3OG5 A;  3N32 A;  1OQR A;  2WXQ A;  1EWC A;  2LGX A;  4WJP A;  4URK A;  2WXM A;  1E8X A;  2CJO A;  3JSV A;  4LDT D;  4MM3 B;  3L17 A;  3ETR A;  2MJ3 A;  3DPD A;  1WGG A;  1L6V A;  4YT0 B;  1ZOY B;  3AU5 A;  3Q2A C;  2YVC A;  2LHD A;  5JHB A;  2OJR A;  1FRR A;  1UUP A;  3IHP C;  4TQ1 A;  1JRP A;  4MEL A;  5E6P A;  1OEY J;  3KWL A;  4J6I A;  1P7F A;  1QQR A;  3ZTD A;  1V5O A;  1M4V A;  2W55 A;  1FCL A;  3N20 C;  3HRD D;  4PS7 A;  4ZRQ A;  4BKG A;  3R8B A;  2JXT A;  1JCK B;  2AEH A;  4LCD E;  5BYQ A;  3PZD A;  4I6N B;  1RRB A;  3R7Q A;  3W5V B;  2IYD B;  1AN8 A;  1YJI A;  3AE3 B;  1C4A A;  2HD5 B;  3ZJU A;  2ZPY A;  4WAA A;  1KF6 B;  3W1S A;  1CZP A;  4DHJ D;  2BBC A;  1LFD A;  2FCN A;  1HZ5 A;  1HTQ A;  2TSS A;  4DDI D;  3L08 A;  1RAX A;  2CHW A;  4MGY E;  1C3T A;  2Z0D B;  1SJH D;  1ESF A;  2FUG 1;  3MC8 A;  1KLV A;  1ZGU B;  3QJZ A;  2L1A A;  3QAR A;  3DVN V;  4W9J A;  3ZXR A;  1K52 A;  1WYW B;  3RT3 B;  1SF0 A;  1XD3 B;  4EUT A;  5LNK 1;  3MFG A;  3SEB A;  1ZP0 B;  3TEX A;  3GZN B;  3N1X C;  4NAW B;  1WFY A;  3LXF A;  3DHG C;  3FIL A;  2DYB A;  4OW0 A;  1SE3 A;  2M4N A;  1ET9 A;  4WAF A;  3ZVV A;  3Q3N C;  5D6J B;  1TS4 A;  2BW2 A;  4AQ7 A;  2PE6 B;  1EU4 A;  1WR1 A;  1IGD A;  1E8W A;  3ML8 A;  1FEH A;  3L54 A;  3C0R B;  3PZ8 A;  3CST A;  1FO4 A;  2IND C;  1JQ4 A;  1F2R I;  5HI1 A;  4PK1 A;  4K7W A;  2R2O A;  3C19 A;  1N62 A;  2CS4 A;  3NS1 A;  4P1C C;  3N1Z C;  5AUK A;  2V3S A;  2MHJ A;  4UDU C;  2LZ6 A;  4EFO A;  1AAR A;  1I4Q A;  3NG0 A;  2GB1 A;  5G5H A;  3DVN U;  2KMA A;  1OTR B;  1TS3 A;  1XCT L;  3P4R B;  1WGY A;  1Y8R C;  1FNU A;  3ZUN A;  3V3X A;  2IJ0 A;  2WX1 A;  2AQ1 B;  2MLB A;  1TKY A;  4B95 A;  2L00 B;  3KWV A;  4KGR A;  4NAM A;  1AYF A;  4N6E B;  2AX5 A;  1I4X A;  3PZ7 A;  3HIZ A;  2DYM A;  2XEW A;  1T3Q A;  1OEY A;  4MEM A;  2JRI B;  1YQ3 B;  2J0M A;  3FAH A;  3HHM A;  4RNA A;  3T3N A;  5J2R A;  3CSF A;  3BVM A;  3LB8 C;  1TKG A;  4H2A A;  2IO0 B;  3AB5 A;  1FXA A;  2KFJ A;  2CR5 A;  1GJZ A;  1EWY C;  2LFI A;  3DBS A;  4K81 A;  4A55 A;  4X57 B;  4WWO A;  3AU4 A;  3CIR B;  1DOI A;  1UWX A;  2KC2 A;  2WGS A;  4M0W A;  1KM7 A;  2J52 A;  5I4D A;  2DZM A;  1VCB A;  3IG3 A;  1R4M B;  3PRP B;  5J17 A;  2K6D B;  2BB5 A;  1SE2 A;  4MDK E;  3VUX A;  4KZC A;  5D2M B;  3VR9 B;  3ZQ4 A;  4RMA A;  4LDT B;  2KOX A;  4B6W A;  1UZX B;  3PT2 B;  4EKU A;  2FNJ B;  2XK5 A;  2KHW B;  4IM2 A;  1PUT A;  3EC8 A;  2BS2 B;  1N61 A;  3AE2 B;  1DOY A;  3TEY A;  2LVP A;  3HVD A;  3VTW A;  2PW9 A;  4L23 A;  4KDL B;  3VHT C;  4TSS A;  1C4C A;  1DOX A;  4M01 A;  2J42 A;  3DCG A;  2AQ2 B;  4GN1 A;  3DDC B;  3AE7 B;  1WE6 A;  2HJ1 A;  2HJ8 A;  1TYG B;  2VRR B;  3VTV A;  2EKE C;  3EEC A;  2ZVN A;  4DHZ E;  2J0J A;  3RZW C;  3AXC A;  2N9K A;  4EEW A;  4EE2 A;  3QA8 A;  3OJ3 A;  2K1F A;  2BB6 A;  2L76 A;  2MA9 B;  3SDL C;  3VRA B;  1RWS A;  2K5P A;  3AUL A;  4MJS B;  4DHJ B;  4HVB A;  1EM7 A;  1BUI C;  4EOY A;  4MSM B;  1JML A;  5CTR C;  3QCA A;  1WGR A;  2N0S B;  3BWU D;  2Z8L A;  1E0Z A;  4WUR A;  3DVG Y;  4LNI A;  4DXG A;  1YJJ A;  3ZNG C;  3U7D A;  3S2A A;  1C79 A;  2GBN A;  2V3N A;  1TS5 A;  1QF6 A;  3ECI A;  1WRI A;  4KSK C;  1SBB B;  1L5P A;  4N59 A;  1IYF A;  4WIP A;  4HRS A;  1J8C A;  2WU2 B;  1C4P A;  1SSN A;  3V6C B;  3MP9 A;  4EZL A;  1ZKH A;  3CF6 E;  3IFW B;  3W1Y A;  4EZJ A;  1NYR A;  3NVW A;  2IZV B;  4K7S A;  1NEK B;  2AL6 A;  2OOB B;  2CJN A;  2PVO D;  2HE7 A;  4W9L A;  4XDD A;  1Z5S B;  2BKF A;  1JWA D;  2WXJ A;  5CHV C;  3RCZ A;  3GP7 A;  1I42 A;  5L95 C;  3WAL A;  1ACC A;  1E9M A;  2KAJ A;  2Q5W D;  4GMV A;  1F9J A;  2KWV B;  1CJE A;  2HTM E;  3ZKJ C;  2LJ5 A;  2LEK A;  3RNE C;  3RI7 C;  2LRU A;  3I57 A;  3RPF C;  4QAY A;  1WRD B;  1WZ0 A;  2KN5 A;  4YSY B;  4MT5 A;  1SXT A;  4GDL B;  4C7Y A;  3KQ4 A;  1QZE A;  2RSU A;  3OWE B;  4YSZ B;  1HA5 A;  4RM9 A;  1WYG A;  2KWD A;  4KGT A;  1UD7 A;  1R4M I;  3ZXV A;  5AZF A;  4KX6 B;  3BVZ A;  3UQB A;  1WMH B;  2FUH B;  3VFK A;  1XLQ A;  2V3P A;  4C56 C;  2GLS A;  3RNB C;  4ANU A;  2RR9 A;  2JPH A;  2V1Y A;  1V49 A;  2LRW A;  4W9H A;  2X38 A;  4G11 A;  1UNS A;  1L4D B;  3L4P A;  2BYT A;  2VZK D;  3A4S C;  2I1J A;  3EFC A;  3ZGZ A;  2MCN B;  4WWN A;  3T3O A;  2JUO A;  2K25 A;  2O6V A;  2IPK D;  3DBR B;  5BYR A;  1ISN A;  2KO3 A;  2ZVO A;  4FJY A;  2DZK A;  3KUD B;  2MX2 A;  1BML C;  1OQQ A;  4PS3 A;  5BMH A;  2NBU A;  2KX3 A;  3TEW A;  4LLG M;  2DX5 B;  5CHF A;  1I7H A;  2I38 A;  1E7U A;  2JF5 A;  4LNN A;  4FJV B;  3NZU A;  3AV8 A;  3RN9 C;  1TY0 A;  3ML9 A;  5HG2 A;  1WWT A;  2N9E B;  1D3Z A;  4S0R A;  4GB9 A;  2JZZ A;  3VDZ A;  2WWZ A;  3ZRC A;  1V1P B;  2LUM A;  4C4V B;  4B9K A;  1VZ8 A;  4KKJ A;  5IO9 A;  1Q1O A;  2LD9 A;  3DOW A;  5HFY A;  4E74 A;  3FC4 A;  2WS3 B;  2N4F A;  4IOI E;  3AEB B;  1YX5 B;  1GOZ A;  4N58 A;  3VUY A;  2DAJ A;  4ZRJ A;  1WJN A;  1I4P A;  1GG3 A;  4S17 A;  3CMM B;  2QEJ C;  2KWC A;  4Q2J A;  1KJT A;  4NPN A;  4A3O A;  3HK0 A;  2I2Y A;  2L32 A;  3N3K B;  1EUV B;  4YTN B;  4IUM B;  2LUE A;  2L52 A;  1YX6 B;  1YD8 U;  1V86 A;  2FCS A;  1PDX A; 
#chains in the Genus database with same CATH homology
 3MC0 B;  1UWM A;  2L1A A;  4JWU C;  3U2S C;  4RF1 A;  3VR8 B;  4B0M A;  1K52 A;  4RFB A;  2PLP A;  1IBX A;  4XWT A;  2BT6 A;  1SF0 A;  5LNK 1;  3MFG A;  4CQN A;  3BVG A;  4RCO A;  1D5X C;  2OED A;  3SEB A;  1XCQ L;  1ZP0 B;  1PGB A;  3TEX A;  3TUO A;  4NAW B;  2KN4 A;  1KLG D;  3LXF A;  2J4X A;  3FIL A;  3V05 A;  3Q8A A;  1QLB B;  4OW0 A;  3Q8E A;  1SE3 A;  1VR9 A;  4YSX B;  5FR3 A;  2KDM A;  2BS4 B;  4GDK B;  1ET9 A;  1SJE D;  3BK2 A;  4WAF A;  1QT9 A;  3ZYY X;  1FIQ A;  1TS4 A;  2BW2 A;  4AQ7 A;  1EU4 A;  1YN4 A;  1XO3 A;  3B2G A;  3LYY A;  5JXV A;  1IGD A;  3BYT B;  1ZPS A;  1CK1 A;  1FEH A;  3WCQ A;  2JX5 A;  1IGC A;  1XLO A;  1YMH E;  3PZ8 A;  4KGS A;  1FO4 A;  2ZW0 A;  1FCC C;  4US8 A;  3HVZ A;  1JQ4 A;  1V1P A;  1F2R I;  5HI1 A;  3IAS 1;  2HDE A;  1KLU D;  4RH6 A;  1R7S A;  2GI9 A;  5TSS A;  3Q69 A;  3NS1 A;  1N62 A;  1FFV A;  5FK9 C;  3AN1 A;  2WXR A;  5AUK A;  2WXO A;  3P4S B;  4UDU C;  4AS1 A;  1JAL A;  1XXG A;  1FXI A;  2N9L A;  1HEZ E;  1OFF A;  4ZHP A;  1I4Q A;  3MHZ A;  2GB1 A;  1PFD A;  5G5G A;  1QOB A;  5G5H A;  2K0P A;  4GLS C;  1TS3 A;  1XLN A;  3AE6 B;  3W9C B;  1XCT L;  3P4R B;  1NYQ A;  4A90 A;  2AQ3 B;  2WXN A;  3EA6 A;  4B0E A;  4IDI A;  2PVG C;  2XN9 C;  4P16 A;  1JWU D;  3TSS A;  1ENF A;  2WU5 B;  3BYY B;  3KLS X;  3IT6 B;  1FNU A;  2V4I B;  3V3X A;  2IJ0 A;  2AQ1 B;  4YTM B;  3SR6 A;  1L6U A;  1TKY A;  2ONQ A;  5H8Y E;  2JQR B;  1N5W A;  4PT5 A;  3KWV A;  3AEA B;  2JWU A;  4KGR A;  4NAM A;  4RGO S;  1AYF A;  4N6E B;  2AX5 A;  1I4X A;  1E6E B;  3PZ7 A;  2QJL A;  2DYM A;  2WXP A;  1N5X A;  2K22 A;  2LGI A;  2W54 A;  1KRH A;  4ZOH C;  2KMM A;  3GB1 A;  3SFE B;  1T3Q A;  2RMM A;  2QIE B;  1YQ3 B;  3ZJT A;  3FAH A;  4RNA A;  5EE9 A;  4A8X C;  1K51 A;  2DWQ A;  1AWD A;  2MH7 A;  1KH0 A;  3T3N A;  4ITK A;  4HKQ A;  1D5Z C;  1SB3 C;  4RF0 A;  5FKA C;  3BVM A;  3LB8 C;  2EEL A;  1TKG A;  1Y56 A;  4H2A A;  3AB5 A;  2G1E A;  1FXA A;  4OZB A;  5BYS A;  5T8I A;  1EWY C;  2MJD A;  2DBY A;  2WQY B;  2LFI A;  1NI3 A;  3NZ3 A;  4A55 A;  3CIR B;  1DOI A;  4J3O D;  1UWX A;  1UGJ A;  2ZW1 A;  3NUH B;  4TMA B;  4M0W A;  1F2R C;  1XF5 L;  2J52 A;  2XNA C;  5I4D A;  4A9A A;  1FNW A;  3SFD B;  1C9F A;  2BB5 A;  3AEF B;  4R3D A;  1SE2 A;  1GB4 A;  2VZK B;  1YNT E;  5D3I B;  2ON8 A;  2YEP B;  1D6E C;  3VR9 B;  3ZQ4 A;  1J7B A;  4P6V F;  1PGA A;  4FXC A;  1VZ7 A;  2JYE A;  2GRI A;  1V1O A;  2WLB A;  4RGM A;  4YTP B;  4HRO A;  4JE3 B;  1ZDX A;  1FFU A;  1WXQ A;  3HUI A;  2B76 B;  1J7C A;  2SEB D;  1I4G A;  1LO5 D;  1PUT A;  3AE5 B;  3EGR A;  2E3T A;  1QOG A;  2BS2 B;  1FM0 D;  1QOF A;  3PO0 A;  1N61 A;  1CQV A;  3AE2 B;  1C76 A;  2PKO A;  3HVD A;  1NEN B;  3TEY A;  1DOY A;  2QMT A;  1JWM D;  3P4P B;  2PW9 A;  2WXG A;  1FD6 A;  2OHF A;  3AEE B;  4L23 A;  1PGX A;  1TY2 A;  3BII D;  3P1M A;  3VQI A;  3AED B;  2DLB A;  2WDQ B;  1N60 A;  4TSS A;  3B9J A;  3BK1 A;  1C4C A;  2INN E;  2Y5P A;  1KTK A;  1DOX A;  1GPX A;  1NVI D;  2PIA A;  5MPO A;  2J42 A;  2AQ2 B;  1F77 A;  3ABV B;  1WGK A;  5E6J A;  2W3S A;  4NZL B;  3AE7 B;  1MVK A;  1IUE A;  1TYG B;  2RDH A;  4HEA 1;  1P7E A;  4ZRP A;  1SIJ A;  2NMQ A;  4USA A;  1L4Z B;  1DGJ A;  2D5G A;  4O1N A;  3O13 A;  1BXT A;  2N9K A;  3UI3 A;  1C78 A;  3CWI A;  4OZA A;  2BS3 B;  4EE2 A;  1ET6 A;  2Y3A A;  1GB1 A;  1RYJ A;  2BB6 A;  3VRA B;  1RWS A;  2K5P A;  4MH8 A;  1ZXH A;  4WH4 A;  3W2D A;  2R61 A;  1KFY B;  3AE9 B;  1EM7 A;  3EUB 2;  3IT4 B;  1TKE A;  1VDV A;  1BUI C;  2W82 A;  4RGT A;  4WQM A;  1ZE3 D;  1ROE A;  1JML A;  1E10 A;  1TJE A;  2FE8 A;  1MHX A;  1QIL A;  2N0S B;  3N9Y C;  1QOA A;  2L83 A;  2H89 B;  3VRB B;  1L0X B;  1ZDV A;  2JYT A;  2Z8L A;  3BWU D;  1E0Z A;  4WUR A;  3C8Y A;  3H8H A;  4DXG A;  1YJJ A;  1STE A;  1L0V B;  1FMA D;  2M0A A;  1C79 A;  1TZO A;  2V3N A;  1TS5 A;  3Q8F A;  1JRO A;  1QF6 A;  4YWG G;  1JW9 D;  1RFK A;  4OVZ A;  1VJK A;  4LTU A;  1WRI A;  2IDY A;  4RGN A;  1QKZ A;  3GS2 A;  1SBB B;  3NRZ A;  1L5P A;  3BZD B;  4N59 A;  1HQR D;  1F0Z A;  1EU3 A;  3U52 E;  4WIP A;  4HRS A;  1XLP A;  2DYO A;  1YN3 A;  1V97 A;  2WU2 B;  1C4P A;  4XDC A;  1SSN A;  3Q8B A;  1SEB D;  2M19 A;  3MP9 A;  2WXL A;  1J7A A;  3IXS A;  4LK0 M;  1Q10 A;  2V0G A;  2M56 B;  3I9V 1;  2MJE A;  3P42 A;  1K50 A;  2CU3 A;  4ZHO A;  1D4B A;  4L1B A;  1NYR A;  3U7Z A;  3NVW A;  2QSD A;  1NEK B;  1WSP A;  5EE0 A;  2CJN A;  1DYQ A;  4REZ A;  1I4H A;  2PVO D;  4ARC A;  4IKG A;  2RPV A;  4XDD A;  1XEE A;  1MI0 A;  1FRD A;  1B1Z A;  1TS2 A;  1ZXI A;  1JWA D;  2WDV B;  4KKI A;  2WXK A;  2WXJ A;  1JWS D;  2NTT A;  1RM6 C;  3AEC B;  5D7G A;  3E9S A;  3GP7 A;  3NVZ A;  2WXI A;  3Q8C A;  1ACC A;  2RDG A;  3RFZ B;  1HZ6 A;  5D3D A;  2WDR B;  5BMG A;  2H88 B;  1E9M A;  4NJC A;  2KAJ A;  2Q5W D;  3AMZ A;  3MJ5 A;  4JX1 C;  4XWW A;  2INP E;  1CJE A;  2HTM E;  2WXH A;  2Y5C A;  3B2F A;  2LEK A;  5HHD G;  4JPS A;  3IAM 1;  3ZJV A;  1T6B X;  3I57 A;  4WWM A;  2PMV A;  3RPF C;  2QIL A;  3P63 A;  4US9 A;  4JWS C;  2E6X A;  4YSY B;  4MT5 A;  1SXT A;  4GDL B;  1YN5 A;  3R2T A;  3KQ4 A;  4C7Y A;  3OWE B;  2ACZ B;  2LJI A;  4YSZ B;  4D2K A;  1HA5 A;  3DWM A;  1WYG A;  2KWD A;  4KGT A;  3J9C A;  4TQ0 A;  4YXD B;  3W5U B;  4KX6 B;  4XE0 A;  5H92 C;  2PTL A;  4ARI A;  3BVZ A;  1C77 A;  1K53 A;  1ZUD 2;  1VZ6 A;  1AW7 A;  1XLQ A;  2KAC A;  2V3P A;  2WP9 B;  4C56 C;  1VRA B;  3URY A;  2K3U A;  3E56 A;  4A6Q A;  5C2T B;  2WNM A;  3AM9 A;  3TEZ A;  3P4Q B;  2NTS A;  1PYW D;  2X38 A;  1UNS A;  2LHE A;  1L4D B;  5EE3 A;  3L4P A;  2BYT A;  1OQR A;  3AH7 A;  2WXQ A;  2JSV X;  2VZK D;  1EWC A;  2YEP F;  2G9H D;  2WXM A;  3ZGZ A;  3T3O A;  2LMC A;  2CJO A;  1V8C A;  2MEK A;  2SAK A;  2IPK D;  4MM3 B;  2J53 A;  3ETR A;  2K9X A;  5BYR A;  2MJ3 A;  1MHH E;  1IBX B;  1L6V A;  3DWG C;  4YT0 B;  1ZOY B;  3R2I A;  4ZYS A;  1T5X D;  1BML C;  2LHD A;  1L0Y B;  1E7P B;  1FRR A;  1OQQ A;  1UUP A;  4L2Y A;  4TQ1 A;  4HKZ E;  1JRP A;  5BMH A;  3FIL B;  3TEW A;  4LLG M;  4DQO C;  3KWL A;  1I7H A;  1P7F A;  2I38 A;  1QQR A;  3AE4 B;  1FNV A;  2ICI A;  5EE1 A;  3AV8 A;  1M4V A;  1JWB D;  1TY0 A;  1SE4 A;  2W55 A;  1FCL A;  1MPE A;  2KQ4 X;  5HG2 A;  1WWT A;  3AEG B;  3HRD D;  4ZRQ A;  2BTE A;  1B9R A;  2JZP A;  3R8B A;  2JXT A;  1JCK B;  4MAC A;  4HJG E;  4C80 A;  1A70 A;  1V1P B;  2LUM A;  1VZ8 A;  4KKJ A;  5BYQ A;  2W3R A;  2WXF A;  5HFY A;  2N7J A;  3FC4 A;  3W5V B;  1GAQ B;  2WS3 B;  4IOI E;  3AE1 B;  4OZC A;  3AEB B;  1AN8 A;  2IGG A;  1YJI A;  3AE3 B;  1C4A A;  1GOZ A;  4N58 A;  1I4R A;  3AE8 B;  2IGD A;  3ZJU A;  2FBW B;  5BMI A;  1I4P A;  4DXF A;  1KF6 B;  3W1S A;  1CZP A;  2QEJ C;  4Q2J A;  2IGH A;  2BBC A;  5AUI A;  1D5M C;  1VLB A;  1HZ5 A;  1HXY D;  2TSS A;  4OHJ A;  3NVV A;  1N63 A;  5GXG B;  2EKI A;  2I2Y A;  2L32 A;  4YTN B;  2JU6 X;  2L52 A;  4C7Z A;  1SJH D;  1ESF A;  2FUG 1;  5C3J B;  3U4E G;  1YQ4 B;  3NVY A;  1PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...