2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1PTOC 1HA5A 1JWUD 1UUPA 5FK9C 3MC0B 3TSSA 1I4XA 4RH6A 3R8BA 1CK1A 1LT5D 2Z8LA 1LTTD 2SEBD 1D5MC 1JQYD 5ELCA 1LTSD 1TS4A 2J4XA 1TS5A 2TSSA 1LTID 4Z9CB 1TS3A 1YN4A 1SEBD 1PRTC 4L63B 1PRTD 2CHBD 3MFGA 1D5XC 1UNSA 2NTSA 1PTOD 1CQVA 1TS2A 1RCVD 3DWAA 1PZKD 2RDGA 1B1ZA 1DYQA 3EFXD 1LTRD 1EFID 1FGBD 3OWEB 4DXGA 5ELDA 2AQ3B 1HXYD 1KLGD 1BXTA 1T5XD 3CHBD 5ELBA 1PRTB 1LTBD 3SEBA 1EEFD 4RHSA 4NZLB 1PTOB 1ESFA 1FNUA 2R61A 1PZJD 2NTTA 1L0XB 2RDHA 1FNVA 3BVZA 1STEA 1JWMD 1M4VA 4UDUC 1YN3A 1EU4A 1B44D 5D3IB 1F77A 1AW7A 1S5DD 1PRTF 1RD9D 1D5ZC 1RF2D 1TY2A 1AN8A 1CHPD 1PZID 2XRSD 1EU3A 1I4RA 2XRQD 3DWPA 1SE2A 4ZYSA 1V1OA 1DJRD 1ET6A 2QEJC 1LO5D 1MD2D 1BCPC 3O13A 1BCPD 2AQ1B 4RGTA 1JWSD 3DWQA 1LT3D 1S5BD 3BYYB 1KTKA 4RCOA 5TSSA 5FKAC 1LTAD 4RFBA 4OHJA 4RGMA 3BVMA 2XNAC 2XN9C 1RDPD 1BCPB 4C56C 3R2IA 1CT1D 1PTOF 4TSSA 3URYA 4BWGB 4L6TB 1GOZA 2O2LD 1HTLD 1V1PA 2QILA 1YN5A 3BYTB 1FD7D 1TY0A 1BCPF 1S5ED 1I4GA 1S5FD 5I4DA 1PYWD 1LLRD 5D3DA 1JCKB 1ENFA 5ELEA 3BVGA 1PTOH 3R2TA 3W2DA 1I4HA 1QILA 2AQ2B 2IPKD 2WV6D 4RHRA 1V1PB 1FNWA 1SXTA 1ET9A 3BZDB 4RGNA 1LT6D 4RGOS 1D6EC 1XXGA 1EWCA 1L0YB 1JR0D 1SE3A 4K6LA 1G8ZD 2ICIA 3KLSX 1SJED 1SJHD 1CHQD 1XTCD 1I4QA 1S5CD 2G9HD 1LT4D 2IJ0A 3V05A 1LTGD 4DXFA 4O1NA 1I4PA 5ELFA 1EEID 1KLUD 1SBBB 3EA6A 1SE4A 1HQRD 3GP7A
chains in the Genus database with same CATH superfamily
4JOIA 5M5WB 2WDRB 1VQOA 1C78A 2WX0A 3NRZA 1A0IA 1IP9A 1U4LA 3WAPA 4A55A 1NMGA 1WMHA 4GN5A 1IBKL 5J2RA 1D4BA 1K83H 2F52A 2EJFC 4UY8C 1WGYA 3CF5A 3ZRFA 4I7ZC 4DPGA 4BY1G 5IYDG 5G5HA 4IJHA 4F8MA 1R4QB 3A1QB 3T9LA 1XTDA 3AB9A 2R2OA 2IHEA 2Y5CA 1KIXA 2UUAL 4G7OC 2M8SA 2KQ4X 5L83A 4L5QA 1XWEA 1TU2B 2OEOA 1J5EL 1GAQB 1JC7A 3K7UC 5C0XJ 2WXHA 4KZ0A 1TS3A 3TREA 2P5ZX 4HJAA 5A2QL 2E5LL 3A7AB 1ZDXA 1UGJA 3AEEB 4C3JG 1TS2A 2M19A 2EOTA 4A3BB 4PMCA 2QJLA 3CD6A 1EFID 2WP8J 4X66L 2V4IB 4M0WB 4W9IA 3SR6A 1CI3M 4KIKA 2C9OA 4C2MB 3GTKH 2QIEB 1WR6E 2M2LA 3VR4A 4A3JG 4NZLB 3HM6X 4HKZE 3D4RA 3WIMA 1BNZA 1YMHE 2VW9A 4LNQA 3G4SA 3R93A 5GAHC 1MI0A 2ZXPA 2NMQA 3VAWA 2CVRA 2AKWB 2JJQA 2XRSD 3Q69A 4DK5A 1J0GA 2XRQD 2L0FA 3V61A 3U52E 1HFNA 3I73A 2KNBA 1SMYD 1AZPA 1SMYC 3QWZB 3A5ZB 2I1KA 5JPNC 1OQRA 1MGSA 2BH2A 3M7NA 5CORA 4A3EB 4ME3A 3OJ4B 2HIVA 3PS6A 2ATWA 2K5QA 4ARIA 4HK2A 4BBSH 1K8RB 1TBEA 2SNSA 2NVXB 4M8MA 3ML8A 2C9WB 3DBSA 3NUCA 3WDNA 2N7JA 2ZXRA 2YVCA 3QG1A 2RHQB 3OTOQ 1N34Q 2K5VA 4O0AA 2IGDA 1Y8PB 2HT1A 1V81A 1V1PA 1YHAA 1MHXA 1NTGA 2PLPA 3P75A 2FE8A 2BCOA 3NPPA 1RFKA 2HJ8A 4KGSA 2JN4A 2F3WA 4JK1C 2MP2A 3D6WA 4LFAQ 4DV0Q 2GLSA 1S5FD 1HRJA 1E8ZA 1XLPA 3HOYB 3W1SC 5BR8L 2KHJA 3C3LA 4ZOHC 1BUVT 2D5GA 1GB1A 3RLNA 3I4NH 3MJ5A 2XWBB 2KC2A 1B53A 2L1BA 4PV1C 3TS2A 1I35A 1PXUA 1YIJA 4BBRG 1NI2A 3DVNV 4DNTB 1HH2P 3MZ5A 2EZVA 2JXXA 3M85A 1XTCD 3ZTCA 1S4ZA 2FFKB 1XEEA 3AV8A 1LTGD 1TZOA 1VQGA 4R3DA 2BDNA 4CKBA 1CZWA 1SBBB 2KUMA 1ROEA 2RPVA 3DVGX 4ANXA 4LUVA 4XTCS 3T3OA 1TVXA 2BBCA 1VQFA 5CHVC 2IX0A 3HOXG 3ZJUA 2AMCB 3OIQA 3L16A 3RFZB 4OO1H 2HTHA 1IBLL 2BYFA 3RT3B 3KUCB 5FLXc 2MW5A 4WRDA 2KJRA 1FEHA 4XDDA 3WA0A 1PDXA 2E2HB 4HJ7A 5CR3A 3D31A 2FHTA 2GBJA 2C35B 2R7FA 1F0ZA 1KL9A 1CA6A 1F9JA 1LTID 1MHWC 2I5MX 1DD2A 3TN2A 1WH3A 2UYZB 4G11A 2B3GA 3VQIA 1G91A 2LGYA 4F8CB 5J22A 3HFZB 4GKKL 1K3RA 2J0KA 3OWFA 2KANA 3MC8A 3MXUA 2Y0SE 4L63B 4X65L 3IG3A 4YTPB 1UNSA 2UXDQ 2PEAA 2OTLA 2Z0DB 2K28A 4ZRKA 4C1NK 5HGQA 1FXIA 2D11A 1C48A 1ISNA 4PT5A 1RTOA 1FGBD 1QNKA 3H6NA 4WORA 1PH1A 1IBML 1HXYD 1CKNA 3RZDB 2DENB 1CM9A 3WAOA 4JWUC 2BWFA 3HKZG 3IKJA 3U58A 3ABVB 3MXPA 5LNK1 3CW2C 4RHSA 2D2QA 4HRSA 2QW7A 1CKOA 3GZNI 1PZJD 4ZHOA 1CSPA 3X0WA 3A4SC 3EROA 1M4VA 1TWFB 1LYLA 2B63G 4J8QA 1A2UA 2GA4B 2ID0A 3H8HA 4XYQA 2DBYA 3W5UB 1RD9D 2EYHA 5IP9H 2CFMA 1CHPD 4M00A 1DOYA 4IUQA 1F9PA 2MRPA 5IO9A 4B08A 2F4VQ 1T0QC 1GPXA 3BYYB 5DPWA 1RAXA 2IY1B 3LJ3A 1ILPA 3AU7A 1ICFB 5FKAC 3PHXB 4W9LA 2EYJA 2ZJQA 3DDCB 5E1FA 2N7EA 2KTFA 2X8XX 5IT9L 2XNAC 4FXGC 3J80E 2R93B 3STBC 3RD4A 2MO0A 4HIMA 3FEWX 4DV0L 1C76A 4ZCKA 2A6HD 3ER0A 2UUBQ 2BE5D 4NJ6A 5JPMC 5EPJA 2KEEA 3CCJA 4EQ5A 2KMAA 5LMUQ 3KDFB 4X66Q 1K0RA 3S1NB 4AH6A 2G4SA 3ZNHB 4P72A 2V1YA 3NHEB 3K9OB 4ZAIA 1BCPF 2CH4A 2EMTA 2PQEA 5BYRA 3N52A 5C4ZA 2ZPNA 1WZ3A 4CDDC 3G7LA 4B9WA 3OTOL 3PRMB 5I4DA 1PA6A 3KBGA 1PQSA 2JA7G 2A4ZA 3ERQA 1YQBA 4QIWE 1WGRA 2KTRB 4W9EA 3PREA 4C7ZA 1O7YA 4MDKE 1V2YA 5IIFA 2WXIA 2QKIC 2V4DA 5GAEC 4LNNA 3STBD 2YTXA 1V8CA 2L32A 4C4VA 3WALA 4RGNA 4YSXB 2DZMA 1TT2A 2R92G 2O5JC 1F52A 2ICIA 1TWAH 3J81j 2VQFQ 1FRDA 2LVPA 3NHHA 2PPHA 3TBLD 2Z9HA 2HE7A 3F2BA 2KFKB 3BWUD 4CDFC 2WXLA 2Z0SA 1EEID 3K6OA 3CCMA 5EPLA 4A75A 3VYUA 1D7QA 1OFFA 5E7NA 3QOLA 2V1CC 3S14B 4KDLB 3WANA 2F0UA 1ZP0B 2K5NA 4DHJD 1WJ6A 2F0PA 4BY7G 2GOWA 4PS8A 3RYTA 2REXA 3FILA 1H9SB 5FR3A 2EY2A 1B3QA 2RR9A 1PH5A 2JA7H 1VDZA 3GZNB 3N3KB 3JYUA 5C0XH 2ZM6L 1WOCA 4B3RL 1QF6A 3PLUA 3ZUNA 4FXKC 4NB3A 1C4AA 3KH0A 2TSSA 3ZGZA 1PDQA 3I4MG 4QL5A 1VF5C 2PE9A 3EQLC 4FYDA 1FXTB 1CKMA 4Z9CB 1GJZA 1BT0A 2MSED 4WJOA 1PH9A 1IGCA 1RYJA 2BKFA 4FO2A 4A3KB 4NMZA 1SE9A 5K5PA 2E6XA 1GUGA 4LUZA 2M9VA 1FM0D 2DYOA 4XYCA 1RIPA 4KN4C 1E2ZA 3EFXD 3T16A 1QLBB 2AYOB 5CBEE 3SFEB 2KA7A 5LMUL 4F88A 1F2RC 2GRIA 1AYFA 3CCSA 1IBKQ 1VZ7A 2D9UA 1EIGA 3EIVA 5KYIA 2KT7A 2WHIA 1KDAA 1M94A 2GN5A 1G291 4DA2A 5BYQA 1C4CA 1N60A 3OMCA 4LW1A 4B95A 3S17H 1G51A 1HR0L 2RVLA 4K6DA 4DAPA 2QA4A 4OWTB 4ANUA 1JRUA 1JB7A 5HFYA 1C7YA 4KMUC 1JJGA 3CAMA 2KX3A 2ENBA 3LB8C 1SSNA 1EU3A 3DWPA 4WJ4A 2EY6A 2UWQA 3TEZA 3DVGY 5FO7B 5C3WA 2LXCA 1X32A 1MD2D 4K8IA 4A93B 3KWVA 4BAXA 2LHDA 3SDZA 1OXTA 2F0EA 2L12A 5JJKA 2JA8H 3J81L 1K0SA 3AU4A 2EQSA 3NZSA 2NN6G 1MIUA 5IP9G 2ZJPA 5HGTA 4MN3A 2M4NA 4B0EA 1YJJA 4BY1B 3K57A 4K7SA 2O4XA 4RFBA 2Y0SG 1HNWQ 2IW3A 2N9EB 4XT1B 3B08A 4YTMB 3C1EA 1GC6A 2KAJA 4M0WA 2RBMA 2GBMA 2HDMA 4P6VF 3PHWB 1N5XA 1S40A 1WE7A 2JA8G 1HHVA 3CCRA 4IFDI 2JU6X 4MSMB 1NYQA 2PW7A 5JAVA 3L0OA 4BY7B 2L7RA 3OLMD 3P63A 3U9SA 4DV7Q 3QK0A 2QILA 3NZUA 3BYTB 3HVDA 4MJSA 1ZYRC 2WAQG 3E0JA 4A3DG 2I1JA 2KJXA 3E0EA 4NAWA 1SNCA 1K8AC 5DPTA 1BF4A 4A3CH 1G6PA 1E6EB 1R4PB 1K50A 3JW0X 3UINB 5C3XA 3QR8A 1Q81C 1EQQA 2ZCBA 3UGBB 4DR3Q 1IUEA 1D1IA 1X65A 2ON8A 3UI3A 4IURA 5AJ3L 1TIFA 2O6VB 1YD8U 1WVLA 2QMTA 4JV5L 3PUXA 1AEXA 4DUYL 1M90C 3TL5A 4GB9A 4OWWB 4IOAA 3VFKA 2F4VL 3DXJC 2LY7A 3NBHB 1EQVA 3AEAB 3PV0A 4G50A 2A1AA 1AH9A 2CQAA 1YEZA 4PZ8A 2MBBB 3J9CA 4JI0L 3P4QB 3RNGC 1GUOA 2B2WA 2WINB 4MSQB 1SDFA 3ZJYC 2DN8A 3FMCA 2WKDA 4DR7Q 1QOHA 2OTJA 4DUZQ 5CX3A 5DEHA 4TQUS 4XQJA 3X3NA 4A90A 1C9FA 2B3AA 3K7AB 2Z8LA 1AP0A 3Q8EA 4GLSC 1WYGA 2SEBD 2CW0D 5FLXL 3HOZG 3VA5A 1VRAB 1NR4A 3A8KE 4POGA 2WYQA 3S1QH 1I50B 3Q23A 1YJWA 4KX6B 4QIWB 3S17B 4A93G 1OXXK 4BXXH 5DAUA 3ECIA 4YY3Q 1U9RA 2B2TA 2L0TA 2MHJA 5LHY1 3OPOA 2EDGA 4WIPA 1WIAA 1LACA 5EE1A 2RSOA 4LFAL 2D3CA 2B63B 2AEHA 3HOYG 4AWJA 2MQHA 1LTRD 3KYHC 1PHJA 1JT8A 3KVFB 2AQ3B 4YWMA 1L6VA 5FLMG 2EYMA 3AFQA 3M4PA 5ELBA 5F2DA 3CIRB 4KV6A 2IY0B 2BA1A 4P75A 4MEMA 4W9KA 3ZW3A 1DOLA 1Q8IA 2R61A 4TVAB 4C3IB 4HSVA 2FNJB 2K6QA 2O5IC 3SK8A 4CJ2C 4HTHA 3N1XC 3NOBA 2R92B 2HHHQ 2G3QB 1UWMA 1A3UA 3AQQA 3A33B 3OMGA 4XQQA 1HPCA 4PS3A 4W9CA 3BS1A 1NY4A 5CYUA 3P4SB 2MUYA 2L4NA 4KKTA 2O6VD 3GTJH 2K1FA 4US9A 4QMGA 4OIKA 1Q82C 4GXBA 2RKSA 4RGTA 5JJIA 3B2FA 3BDCA 5HG2A 4HDQA 1E8XA 3HKSA 2HD3A 3M4OB 2KFJA 2Y3AA 3NS1A 1IL8A 2VL6A 1PH3A 4UPAA 3GTGB 1V80A 1BKBA 2BGFA 5HHDG 3BINA 5CV4A 1EWHA 2JEAI 1YZ6A 4TV3A 2N7DA 2MPMA 3CCQA 4IDIA 4WWOA 3QO2A 2N49A 4DV5Q 4GOPB 1HZAA 4BFRA 3V60A 1GHJA 1WCMG 4YSYB 4JV5Q 3M3JA 2PCFB 4C3JH 2MHVA 5D3DA 1HZ9A 4LLGM 1JCKB 3NTHA 1U4PA 5KHQA 4U68A 2A74C 4XXEA 4KKUA 2EMSA 2DNFA 1C3TA 3VUXA 3A8IE 4IUVA 1FYCA 3TRZA 1ZE3D 4ZYNA 3N20C 2DNEA 2L76A 1Y8NB 5BMIA 1OGWA 2LHEA 1L0YB 1WCMH 3KJPA 1O80A 1XJVA 2IJ0A 4JBWA 2WACA 5KNBA 2K5HA 1QOAA 5T1IA 3AN1A 2INNE 3Q3NC 1GVPA 3BY4B 4HPLB 4L1BA 2F0OA 4P7IA 3P20A 2K5DA 4A3BH 3MC0B 1A8VA 4I6NB 1FGUA 1NAPA 5AZFA 2L15A 2J53A 1TWCB 4NNJB 1N5WA 2K22A 3Q8DA 3CPWA 1QJOA 1NENB 2F0IA 2L55A 2Y0SB 3I7FA 4QB4A 1W3SA 4LFCL 1PLFA 1QVCA 3H9DA 4JI6Q 3HOXH 2N9LA 2MJ3A 3HRDD 2J7QB 3KWLA 2EYLA 2RHSB 4IUPA 2L52A 4OZAA 3EFCA 2XTIA 3CMAA 3LDZE 3NBIA 4P1BC 4DV3L 3S2HB 1N63A 2QDFA 3DEPA 5FLMH 4N9F4 4ZRJA 1DOXA 1X9NA 2CHBD 4PS7A 3EUB2 4LF7L 4PQXA 3HOWB 2EKIA 1JOOA 5IT9E 1HNZL 1K52A 3HOYH 4DUYQ 3CPFA 4YIJA 3GE8C 3GTJB 4YWGG 1JALA 1VQIA 4OZBA 2JRIB 2L3ZA 3H15A 1IBXA 1RWSA 4TMAB 4G4KA 2MWSB 1FNUA 3MTSA 2JWZA 3NUHB 2RDHA 4F7ZA 3IFTA 4HPMB 5M5XB 2LVOA 5C3EG 1E7VA 3ONSA 4JI7L 4UDUC 4NXNL 1P9DU 2N9XA 2K4KA 1U4RA 1H9SA 2F0QA 1EY6A 3BZKA 3S1QB 1NCVA 1ZGUB 1QNUA 1WD1A 3CCEA 1D5ZC 3K5OA 2BKRB 3A9JA 4M8NA 1Q3LA 1N62A 2XK5B 5CTRC 5KHOA 2F0HA 2OCEA 3O13A 1BCPD 3DQVA 3NEMA 4WJPA 3DWQA 3P1HA 2NB0A 4IOIE 2JA6B 2RCNA 4JI3L 4FF1A 1X3QA 2KVZA 4KDIC 4WAFA 4GMVA 3BVMA 3HKZE 3DM1A 3SR1A 1PFDA 2NPTA 2XK5A 3E5SA 4K0KQ 4IW0A 2BVCA 1KH0A 2K9XA 4F7XA 3ICEA 4JGHB 3B1LX 4EZJA 2EYPA 3DUZA 3EVQA 3I56A 4DNRB 5IYBG 2PW5A 2C7MB 4GN3B 2D10A 3DBLB 3VTUA 3I4OA 1ZEQX 3OJ3A 4A3KG 2E2JH 3UQBA 2F0WA 5E4WC 4A3OA 2Z59B 4K1RB 4DXAB 3WOFA 3I57A 3PV1A 3K58A 1I6HH 4X6AH 2NZHA 2HCIA 3KLRA 5IWAQ 2FXQA 2K1BA 2XSCA 3TEXA 4W9JA 2MJDA 2OF1A 1STNA 3CQZH 5DM63 2AQ2B 3N30A 1FNWA 1RRBA 3ZDMC 1E7ZA 3NS8A 1I5FA 3KUPA 4DKAC 3BZDB 2KDBA 1LT6D 1H9RA 1NYRA 5I2XA 1JR0D 2EE1A 2DZKA 3PLVA 4DDID 2DJFC 4DAYB 2RDBC 2BS2B 4II2B 3N1ZC 2Z6KC 3PUYA 5G3LD 3S1NH 5BO4B 2LXKA 3AE6B 2CW0C 4XWTA 2K52A 1PTOC 1V8QA 2PPBC 3I3TB 5C3EB 2E2IB 3I3CA 3Q3MC 4KGTA 1V6EA 4ZK9B 1WZ0A 1LFDA 2B76B 3GTOH 2KQ7A 1YNTE 2KOXA 1Q1EA 2VH1A 1LT5D 2A68D 3J7AV 3BK2A 2OEDA 4IC7B 5LMNL 4JE3B 2Q8TA 1B7YB 1XF5L 5D2MB 4GIVA 2LJ5A 2N4FA 5ELCA 2I0QA 2ZPYA 4KY6A 3GQBA 2FJ2A 1EIHA 1CKNB 3SHLA 1VZ6A 4XDCA 3A0JA 4A3EG 4BOSC 2JYOA 1NI3A 1TKYA 3H7PA 1TXYA 4PYZA 4NJCA 2MJEA 4Y52H 2V4LA 1D8LA 4XDXA 4BA2I 1Y1WB 1DONA 1Z5SB 4E74A 2ES2A 1LM8B 3OOCA 4HJ9A 4KHPL 1D5XC 4JI4Q 2A5HA 1CQVA 1K3BC 3BDLA 4QF4A 4KGRA 1LM0A 2RDGA 4L2YA 4KY5A 1J9OA 2K14A 3PPAA 4HMJA 1WFYA 3A56A 3E3XA 3V6CB 3W1SA 5IYCH 1KLGD 2PTLA 4K81A 1IBLQ 4LMQD 3SVMA 4FN2A 2CHWA 1Q12A 2VUMB 1FRRA 1EEFD 3H0GG 1WXSA 1Q10A 3FKIG 3PO3B 1ZYRD 5IA7A 1N33Q 1JE5A 1L1OA 2E75C 1F1HA 2NTTA 3I4MH 1QOBA 1F2YA 4JI5L 3SK4A 2JK8A 2EELA 1OTRB 4KK7A 3Q22A 4O2DA 3MXGA 2B29A 5CV7A 3TP5A 3G6EA 5LMNW 4IM2A 3IAYA 1AW7A 1S5DD 3MHBA 3VTVA 1Q46A 4AQ7A 1D2BA 1BO0A 4RWSC 4ZYSA 1IYUA 1DJRD 1SR3A 3NTKA 2G4DB 1LO5D 2HDEA 3EECA 1ZXHA 2NR2A 2EY5A 2BQQA 3B2GA 4DR7L 2M00A 2ASQA 4C3IG 3DOWA 1C79A 1RL2A 4EQPA 2K5PA 3CKIB 3HS0C 4RGMA 3Q3JA 3EC8A 3RNAC 4W9DA 3ZRCA 4GDLB 4NQKE 1LV9A 1N36Q 5A35A 5DM73 2CJOA 1E2VA 1VMCA 3GDEA 5CGKA 4X62Q 3BIID 3SDLC 3VH4B 1AFPA 4V190 5C0XG 5CV8A 1N8RC 1T9HA 4HJ5A 2ICEC 3B9JA 4JIOU 2FMCA 4DR1Q 2B2YA 2MH7A 1SROA 2LXAA 4DN4M 4DR2L 5C1ZA 5JJZA 4R1JA 1Z7TA 1TTNA 1I4GA 5CC4A 3G6JB 2DJGC 4DR4L 1TZ1A 2VZKD 3QX1A 3BVGA 3G71A 1IBMQ 4BBRB 2WFWA 4C3IH 2KLGA 3ZYYX 1EY4A 2JUOA 3Q14C 3EN2A 4GKJQ 2JZZA 1BMLC 2ZTEA 2KOLA 1D6EC 2KHSA 1Y69U 2NCNA 1X3FA 1JMCA 2LMCB 1NE3A 3CSTA 3KLSX 4AP4C 3VR6A 3KF6A 4CHTB 3VTWA 1PH2A 1YJ1A 3Q8CA 1VQ8A 2KVRA 1MJEA 2ZW1A 4KI0A 2WQYB 1G6JA 2KYWA 2KX0A 2W82A 3S1MB 1EY9A 4B3MQ 3ZTDA 4PK1A 2VY3A 2N78A 3QB3A 4CGYB 1N34L 2PNHA 2KECA 4PMBA 4KD4A 1JMLA 1GG3A 2AWTA 5FK9C 2IYDB 4KLKA 1KDCA 2WNMA 4HCEA 1F2ZA 5IYCG 2KQ3A 1B8AA 4U673 4RH6A 2KDIA 1VJKA 1JE4A 3HIZA 4LK0M 4AUQC 3MP9A 3IFWB 3Q2AC 3VR3A 4G57A 1JQYD 2JE6I 3T8MA 3ZKJC 4AYBB 2EXDA 5KIXA 4JI8L 1TS4A 1XMQL 1STBA 2JF5A 4HCSA 5ISRA 5JOBA 2JZ3B 4N6EB 3M9BA 4DGZA 3CC7A 1FJGL 5JHAA 2VQEQ 5IGBA 2F3VA 1ZPSA 3I9V1 5AFWA 2PVGC 3Q8FA 2K50A 3SFDB 5IOIA 1SMXA 1YNJD 4DAMA 3MAQA 1WTHA 5M9OA 4MNOA 1YHQA 2KCNA 5GXGB 1VR9A 4RMFA 5GMVA 3GD7A 4LCDE 2QGQA 1UAPA 3CC2A 3N32A 4FF2A 4RG1A 1EQTA 1DYQA 4OIJA 3NQTA 3OWEB 1E10A 1WRDB 4YSZB 3QOJA 1GUNA 4JC0A 1UD7A 3S14H 4XT3B 1T5XD 1ENCA 2CHZA 1KNEA 4US8A 3J81c 3ZLZA 1KHIA 3ZNGC 3RN9C 4MJSB 5J3BA 2B2VC 4MHEA 4OELB 1ZXIA 4LJOB 2ZVOA 4LK1C 5LXIB 1I50H 4DV3Q 3LYYA 5D3IB 3BU2A 3HOUH 1WJNA 4LNKA 1L4ZB 1AN8A 2LD9A 2F0TA 2WXOA 3JC66 4LF7Q 1NDDA 2IGGA 3E9SA 1Z9FA 2KEDA 3KF8A 5J1ZA 3IXSA 4DV1Q 1XMOQ 1Q86C 1QKZA 2CHXA 5T8IA 1A3VA 1WJ4A 4TKOB 5IY0A 1S5BD 4N8FA 2LGXA 3F2DA 1CUKA 4G7ZC 1K53A 4W9HA 4A3FB 1AE3A 3KUZA 2DYMA 3FC4A 1ZOYB 4JI1L 1OTCA 1NMFA 2RQXA 4LFCQ 5HI1A 1X6OA 5E6PA 1VLBA 4C56C 1IKLA 2YU9H 1U4AA 3PVLA 3PO2H 2FIFA 2JRHA 4YHHL 1WXVA 2Z0EB 1B9RA 2K39A 2L05A 2FCNA 5H8YE 1ILQA 2F0KA 4N9TA 3NTIA 2D0OA 1KF6B 1DOKA 4AOFA 4BKSA 3DPDA 4MELA 4GN4B 2OQ0A 2I5HA 2UXDL 1WXQA 4WWNA 5D94A 1R4MI 4YCWA 3AEBB 3U30A 1FJGQ 1VQAA 4K8JA 3RLOA 4N8X1 2BYEA 2WXFA 1WTQA 2IPKD 2N3SA 3ZXVA 5M5YH 4ACFA 1V1PB 1XNRL 4DAVA 1ET9A 4IM0A 1RODA 3QCAA 5JZEB 2V9HA 2C60A 5I6WA 4NP5A 4WH4A 1K28A 3PT2B 2W3RA 2D5DA 2FCMA 3DEOA 2ASBA 1LT4D 3FKIB 2HDLA 2B2UC 1GXDC 1XPOA 2Q2UA 4LF4Q 1U4MA 3PO3G 2FBWB 3IVFA 1WI5A 1I4PA 1A5RA 4LF6L 1H9KA 4TQ1A 1SIFA 4RMAA 1AE2A 3GE3C 3DBHB 3VUWA 4CJ0B 4IUTA 2UUAQ 2VQEL 3C0RB 3PO0A 2E2DC 2CKZB 3TSSA 2RSNA 3I2ZA 1P16A 2NVUI 4CYEA 1YNJC 2PMZE 1IYJB 4JI2Q 3PO2G 2R93H 2KCCA 3RZFA 1YHBA 3OIPA 1I42A 1D5MC 3S1MH 2EKEC 4FHKA 4N59A 4ITKA 3DWGC 4IQZA 2EXZA 3OYYA 3RNBC 2VZKB 3AE2B 5KRUA 3WAMA 5L37A 2WX1A 4JI2L 1MJCA 3KW5B 2INPE 2XEWA 4MZ9A 4FHJA 4KSKC 1RTNA 4YXDB 4JI0Q 4HJKA 3FP9A 1W6KA 1KC8C 3H3VH 3OHXC 5I9PA 1PGXA 3ZJTA 3M95A 4LF9Q 1IL2A 1E22A 2K01A 3S1RB 1STAA 2IO1B 4WQOB 4KKSA 1KXLA 2C7HA 1QUQB 2KTRA 3JAMi 3FPPA 4UP7A 3SEBA 3TDQA 2ZVNA 3ONAB 1VQNA 1JWBD 1SNOA 2JWUA 3JSVA 1IGDA 3R66C 4OX9Q 2Q2HA 1V5TA 1KAAA 2PZUA 5BR8Q 4B3ML 1FNVA 5FJ8G 1XPUA 1TKWB 2F03A 3Q3FA 2R7ZB 1FFUA 3H6MA 3VYSA 3MFYA 5C0XI 1EU4A 1J7AA 1EFWA 2FIDA 2H4OA 1KABA 2CCZA 2UUCQ 2UU9L 1WRIA 4ZRPA 2ZT9C 3GTGH 1A70A 1HTQA 4LF8L 3PUZA 1Z6HA 4A3FG 2PMZB 2OHFA 4O42A 3J7YW 4WJNA 3SU8X 4L5RC 4XWWA 1XX8A 5IYDH 3I70A 3AE5B 3TMPB 2JA5B 4JOIC 4DBGA 2JA5G 1WGKA 1ZKHA 1PFMA 4K2LA 2J0TD 4CJ1B 1ZW7A 5EKKA 3AXCA 1PH6A 3QIJA 1SYCA 1EZ6A 1VD2A 4FJVB 2Z4HA 5HURA 4H0LC 3CU7A 3NG0A 3R2IA 2KN4A 3I8ZA 4FNFA 1SAPA 1KLVA 1DXMA 4L6TB 1HTLD 3AE4B 4ZRQA 5H1SE 2BYVE 4Y7NB 1NUCA 4GDKB 3FDTA 1MFWA 3IBEA 2CJNA 5G3LF 2GVAA 1BBUA 3E9HA 3CSFA 4KTAA 2KDEB 3MHZA 1QVFA 4WJQA 1OEYJ 4FVMA 2WLBA 5ELEA 5JEAG 3Q24A 4NXML 3R2TA 4HR7B 4HCPB 2IDYA 2DY7A 3QJYA 4JW0A 2IY5B 4DQOC 4RF0A 2PO4A 3AI5A 4TKNA 2F3IA 3LWEA 3L4PA 5C23A 4RGOS 3HG9A 3TS0A 4GOCA 1SFOH 4LF5L 3J80L 3NWTA 1JJCB 4E6IA 3AMUA 2AL6A 1WGGA 2G5DA 4IALA 1T0YA 3FPUB 3TBIB 4GOPA 2HQEA 2F0VA 4O1NA 3SXHA 1WTVA 1V86A 3S2HH 5L95C 3GTKB 1F9SA 2E2JB 2LGDA 5I9OA 4DHJB 3K0XA 1HTPA 1STGA 3WWVA 3JAML 3PIPA 1BBXC 1TGZB 1WWTA 1N33L 3P1MA 3PO2B 4IFDH 3GV6A 3V96A 3K81C 3U8ZA 2R7ZG 1K8MA 1SYBA 3P42A 4XQNA 4G0NB 3UE0A 4LFBQ 1KRSA 2N9PC 4II3B 4MT5A 3HOVG 2MNAA 2Q8RE 1EYGA 1SLJA 3T13A 2X6GA 1BUIC 1DM0B 2EIFA 2NVXH 2K7VA 4DWFA 3HRZC 2J4XA 3S15B 4JWSC 4ARCA 4JQWC 3MC9A 1E24A 3LNNA 2K0PA 2LEKA 3J80i 2R7ZH 1MKHA 1P7FA 2A68C 4J6HA 4BXXG 3BK1A 1TKGA 3CRKC 1I7HA 2M1MA 1HZBA 1CFMA 3F2UA 4JYAQ 4K3BA 1PRTD 3UDXA 3TJPA 1PTOD 1O7ZA 2CQOA 1P98A 2BWES 4XYOA 4R8IA 3FKIH 5EBCA 3ENEA 2L00B 3DHGC 4A3DB 2FINB 4BKTA 1X3GA 1H95A 4QQBX 3QARA 1BXTA 2JQOA 3W9CB 4F87A 4POFA 2J0JA 2MP2B 1E3PA 2WXQA 2KKCA 2SAKA 1E5WA 1XNQQ 2UXCQ 1TWAB 1XYIA 1YNNC 1U5KA 3VH3B 2DZJA 3RNEC 1IYFA 4K14A 4J15A 3ND8A 4I7AA 3ZVVA 2JX5A 3MWYW 1PRTF 3A74A 1MI2A 2N1WA 2NZOA 1Q8KA 3DCGA 1EUVB 3DBRI 4K3CA 1XPRA 4LAAA 2HUGA 4LJZC 3VHTC 4BBSB 3RI7C 3EJIA 1ENAA 4A3GG 1Q1OA 1LT3D 1UZXB 2JXTA 3A55A 3E6ZX 4JBMA 1FCCC 2ZZPB 4FLHA 1V49A 4BZAA 2M56B 2HQLA 4JPSA 4BVUC 4Y7NH 2WB1G 2JSOA 2LGIA 2Y5PA 1PH8A 1XMQQ 4RA8A 1UE6A 3OSOA 2PE6B 4X3KA 1FIQA 3PGZA 2JA5H 1J7CA 1CT1D 3T51B 1JB3A 4F1SA 2EYFA 2PNRC 4IPDA 4P1CC 1N9WA 2WU2B 1UWXA 4EGVA 3TEHB 2JT4B 1LXDA 2KWUB 4DUZL 3LWUA 2IX3A 1EUJA 3D0FA 5JHBA 3W2DA 5BN4A 1HNXQ 1P8LA 4N9PA 1ACCA 3C19A 3U9OA 3S2AA 1GKHA 1GJXA 2DNCA 1DOIA 4XE0A 1CQFA 4UAIA 4K5XA 1IKMA 2N8NA 1H4RA 3J7ZC 4HXDA 4X64L 1KJTA 1UH6A 1LGRA 5AEKB 1G2SA 4K2KA 1YJIA 1S5CD 2G9HD 2ZTCA 1E8YA 2BYTA 1II3A 4B3SQ 1VQJA 3M4YA 4LUOA 2W54A 1JOQA 4FF3A 1XNQL 2UXCL 1VQPA 1X3PA 4KHPQ 3C2PA 2LMCA 1T0SC 4ID6A 1E9MA 3AE3B 1T3QA 2WS3B 3HOXB 1GUWA 4HEA1 2XWJB 4OGQC 5BN5A 5H92C 3S24A 4DU9A 1SF0A 1CK1A 5IYBH 1O78A 3EBEA 1EYDA 2BB6A 5LXHA 1CMXB 1UBIA 1SNQA 2R7DA 5EKIA 5IP7G 4KN7C 4CKEA 4HIDA 1N36L 1TWCH 1EWYC 2LUMA 4ILWA 4IWQA 5AUKA 3ERSX 3NVZA 4GSWA 3C1FA 5KYLA 3A4RA 3U7ZA 4C7YA 2D3GA 2GBNA 2MQJA 1SN8A 1MPEA 1MSHA 3GO5A 2KACA 1LUZA 4WJWA 3ND9A 1A3TA 1XT9B 1YN4A 4JYAL 4MTNA 4MGZE 2V0GA 1SNDA 1J8CA 1WI0A 1VCBA 2ZCCA 4HJGE 2F0NA 1Y1WG 1FO4A 2WB1B 4ANWA 1NSNS 3VA7A 1B2TA 3UF8A 5HKHA 3F2CA 4L5TA 5C2TB 1VCIA 3I4LA 4WWPA 2VXWA 3L13A 2WGSA 3EFUA 1WCMB 3VVWB 1E2WA 1QQRA 1XCTL 1R4NI 3PMFA 5DPSA 2A6EC 2V3PA 5K36G 2VRRB 3PRPB 3UDGA 4FJZA 2ZXOA 4KD3A 2IZVB 4C80A 2AWOA 2A73B 4FA6A 1HNXL 2NBUA 2KXJA 3TMEA 1E1TA 3GTMH 3I5JC 1WD0A 1N32L 1QOFA 3S9WA 4A3MG 3T53B 3W1BA 5D6JB 3T1HL 1IW7D 2K6AA 5DNFA 2IO0B 4NAWB 3M4OH 3OW7A 1VDVA 2K32A 4XGAB 3HVZA 4YCUA 1E90A 3FKYA 3TUOA 4AJYB 1HTOA 2A69C 5JEAH 3H3VC 3TEYA 2E2HH 4MTKA 1V9PA 4A3IB 1HR0W 3E9IA 1RDPD 3FAHA 4DHZB 1RHPA 1LABA 3AEFB 1WM3A 5AZGA 3TEWA 2AUKA 4QY7A 1B9MA 2BS3B 2MA9B 4ICUA 1RLFA 1WR1A 5FOBB 1K9MC 4LF8Q 1YN5A 3QC8B 1HUMA 1HA6A 2W55A 5M3MG 4DV4L 4KV2A 1Z47A 3P7JA 2UUCL 2XIWA 1PH4A 3NVVA 4HPPA 2DAFA 1YI2A 1R7SA 4ICVA 4GNXC 4HDOA 2K6DB 4UP8A 1TWFH 3HZXA 1QT9A 3B0AA 4A3BG 4GKKQ 3GB1A 3Q0AA 1UBQA 1XLQA 4HIOA 4R4TA 2CH4W 3TP7A 3KDFA 4V0BA 5J39A 2LFIA 3VUYA 5MPOA 4PG3A 4IWOA 3BJUA 1TWHB 1ZXTA 3L7ZC 4H02A 4IFDJ 1SNMA 1N61A 4LF9L 2KDFB 1S72A 2RCFA 4EQOA 3HHMA 2WB1E 3MEHA 2Q8IB 2O2VA 1U0LA 2YV5A 2RMMA 4LF6Q 1B9NA 1WM2A 1EOVA 1PFBA 2B2WC 3ZNZB 1VQBA 2FUG1 5JJLA 5GADC 3ZXRA 1UUPA 2WDQB 3H1UA 1ICWA 4G3XB 2WIIB 2L9HA 3QHTA 4N58A 4GKJL 3M4QA 2UU9Q 2Q2IA 2PMVA 4BY1H 4DV7L 2ZEQA 2DGYA 1XLOA 4DFAA 1H9JA 4K0KL 3LX0A 1TS5A 1OQQA 3K59A 1K73C 3IHPC 3D32A 4XC2A 1NJIC 2J52A 3K8AA 1UF0A 1SE8A 3NBHA 4EQNA 5IE8A 2VNUD 1I6VC 2K5WA 1ZKOA 2Z6BA 4A3JB 2OXPA 4L23A 4HIKA 3VR8B 5DLQE 1SEBD 1EZ8A 3M3YB 1SNPA 1WJJA 3FILB 1VQKA 1NBWA 1WF9A 3DBLI 3WOEA 1PZKD 1EIYB 1KM7A 1B1ZA 3PZDA 2FMMA 5LLIA 4DXGA 5M5XH 2AX5A 4RF1A 4DDGD 2MFIA 1FFVA 2LRWA 3NXWA 4JI1Q 2K25A 4ZRIA 5M3MB 2KFKA 4DV6L 1XNRQ 2KVMA 1VQ6A 4GGQA 1FD6A 3NZ3A 3AFPA 1PTOB 1J7BA 5D65A 4C2MH 1KQSA 2V3NA 2IO3B 1TWGH 1FPYA 3ZO5B 4JI5Q 1EYCA 5LL6S 4IG7B 2PI2A 3H09A 4MACA 2E5LQ 4B6WA 3PO3H 1EYAA 1B44D 4URKA 4JI3Q 3SK5A 5KEEA 4ZHPA 1YVCA 1EWIA 1YITA 5EDSA 1BBWA 2R93G 3AEGB 5IAAC 1PFNA 4IPGA 2IBIB 1JROA 4JBKA 3DVNU 2CWPA 2PIAA 1FCLA 1Y56A 3UDFA 2KCTA 2A19A 2NVYB 4W9GA 4J1MA 5C5MA 1VQ7A 4NAMA 2FCQA 4A93H 4AS1A 1Y1WH 2QC8A 4OHJA 3S16H 3F1ZA 1Q0WB 1W6JA 1P1AA 2CR5A 4KIKB 5IKCM 2XN9C 3GTQB 2A8VA 4PNYA 5IGDA 4B3TL 5C44G 1WFQA 1BOSA 3W5OA 3AB5A 4P16A 1WYDA 1EOTA 4ZUIA 1E1OA 3PIO3 2PQAA 1XD3B 2DY8A 3NP8A 4BWGB 1C8CA 1MJDA 4J3OD 4LJPB 1YQ3B 3DHIC 1I3QB 1TY0A 2ZJDA 4ULLA 3CCLA 4GLXA 1IPGA 2BH8A 3L08A 3QA8A 3CQZB 3S2DB 1OO9B 4HCNB 1PV4A 4A6QA 4JVZA 1QZHA 2J42A 1EO6A 1X3EA 3APFA 4ZDVA 1UWVA 4PZ6A 1P0RA 3PCOB 2LRUA 5KGUA 1PUTA 4FF4A 2VUMH 2KJHB 4WQMA 4BS9A 2QEXA 4X3UA 1AARA 1YX5B 2BDOA 2M0XA 4IUMB 3M7GA 3CRLC 1V97A 4OX9L 1G2TA 2M0AA 3AECB 4MM3B 2VQFL 3X23A 5IOCA 3HUIA 3L10B 1I4QA 2KENA 2PZWA 3HOUG 1J8IA 2YTYA 1EM7A 2MEKA 4OZCA 4Q2JA 2SNMA 3MA2B 5M3FH 3APCA 1Y1VG 3U50C 3M3YH 1O7IA 4A8XC 4JBJA 1MG4A 1BR9A 1HQRD 3CCVA 2A6ED 3GP7A 2JQRB 4A3JH 2WDVB 1QCBD 1UE1A 4R4IA 3IL8A 2GBKA 1C9OA 2JA6H 2L11A 4R4CA 1ZDVA 1YNND 1EY8A 3P2BA 2H5XA 4IZ8A 5I2YA 2WU5B 3Q3OC 5JEAJ 2BS4B 2IGHA 3NENA 4IWPA 2KWDA 1E8WA 2KZRA 1QOGA 1XQQA 4C1NI 4P2CB 5EGTA 2LUEA 2I2YA 2QHOA 1LTSD 1V9JA 1DGJA 2OQKA 3T1YL 1WX8A 1SYEA 4KJNA 1X55A 4DR4Q 2LZ6A 3B6YA 1L2NA 1MSGA 3MXNB 4HROA 1R4MB 5J18A 5D14A 3N6RA 5EE3A 4H13C 4AYBE 1H8CA 4D2KA 2GVBA 5E6NA 1PRTC 4B3SL 4RKLA 3AH7A 2CS4A 3T1YQ 2Y5BB 4DV2Q 1D3ZA 1IHZA 1CTMA 4XIGS 1JOKA 2NN6H 1PVOA 3ML9A 3KK7A 2AWNA 4MGIE 3ULLA 3JVZX 3BZCA 3MXNA 5C44B 3EHVA 4OEMB 1KFYB 2HJ1A 4S0RA 1J6QA 2DUDA 2HHHL 3J7AF 3KUDB 4TQ0A 3ULJA 5BN3A 3K5MA 4HN7A 2OJRA 1WSPA 1ESFA 2A6HC 4NPNA 2DYBA 1VZ8A 3L17A 4OO1I 1HJPA 4TUUA 3DM3A 1YN3A 3DBHI 3V2TA 2J7ZA 1F77A 2F0JA 2ALYB 3S15H 4I65A 1CJEA 3K9PB 3W1YA 1GB4A 2B2UA 5IGFA 3Q6SA 3I4NB 1I4RA 4CQNA 1SE2A 1OXVA 1V1OA 2GB1A 4ZUJA 2OOBB 1C1YB 3NJTA 4HAEA 3W1GA 5EPKA 4B3TQ 2MBOA 2ZTDA 1P3QU 2W3SA 2M17A 2YEPB 4EZLA 4GS3A 4B3RQ 3S2DH 1JWSD 4RCOA 4USAA 2QCPX 3M62B 3PIOA 3AEVA 4MM3A 3RZOH 4P74A 1EF5A 2QSDA 3RUIB 1C77A 5DCNA 1CA5A 4K7WA 2KWVB 3BG3A 5EAYA 3AE8B 1JW9D 4QCLA 1SRUA 2KQSA 4BY7H 2BE5C 4IOCA 3RN2A 1XO3A 2JYTA 4C3HH 3HOWG 1C0AA 1PTOF 2FUHB 5IP4D 3TP8A 4IUNA 2B2TC 5EKLA 1I94L 2O2LD 1X54A 3TIXA 3S16B 2MLBA 5M3FB 4A3MH 1C4QA 1FD7D 3VYRA 1NEKB 3APDA 3RNCC 1K83B 1ZUD2 3I63C 2F0GA 4GU2A 3ZDTA 1S1QB 1V43A 4ANVA 3NELA 1B70B 4WJ3M 1ENFA 2IO2B 3DMUA 3U4VA 5C3JB 3IT6B 3I55A 1D1KA 2JZPA 4DV4Q 2K75A 4RHRA 2NWGA 2Z1CA 3J80c 1WTPA 5IGEA 1TR5A 1NVID 3NK9A 5AJ3Q 3FRPB 1WE6A 4DV1L 1XMOL 3RZDH 3PZ8A 4EKUA 5BMGA 4RKBA 5EBDA 1HZ5A 1SJHD 4C3HG 3HOWH 2KDMA 1CHQD 4L8JA 1F9QA 4NDXA 4C3HB 3HOVH 5JXVA 2D3AA 5C4JB 3LXFA 1X56A 3T56B 4A4IA 3OG5A 3ZJVA 2L0CA 3ETRA 3A54A 2NZ1D 2KHIA 5GQOA 3PQIA 4A3LG 2OWOA 2GI9A 2DX5B 2HIXA 2WXJA 4RM9A 3UIPB 2B8FA 4NW2A 4X57B 4HEDA 2F0MA 5FO8B 1HA5A 1C4PA 1K51A 2LS01 5C4XG 3TQYA 4YY3L 2AL3A 1X1MA 3KQ4A 1N32Q 5LMNQ 1MVKA 4GDLA 1DOMA 4CO7A 3PSIA 2E74C 2DHZA 4LNOA 2JY6A 1P7EA 4YWKA 1FL0A 3T4AC 1E7UA 2NVQH 3ZNID 2ZM6Q 1LQBA 2ACZB 4REZA 4RCNA 2NS5A 1Q90A 2RDFA 3H0GH 3Q8BA 3UDIA 2R2QA 4B9XA 2WXGA 2EVBA 5C4JH 1WMHB 1BVSA 5T1GA 3AE9B 1HE8A 4EOYA 2I5LX 5JVG3 3KBXA 1EY0A 1EY7A 2YTVA 4H7BA 5M5YB 1RCVD 3H7SA 4DK3C 5TR5A 4OXPA 1SB3C 2MBEA 4ZKBB 1TWGB 4W9FA 2ZJRA 3PF4A 1VQHA 1QVGA 1DCZA 3NWSA 1I94Q 3CHBD 3VR2A 2B8GA 3RMHA 1S3OA 5CBAE 5HY6A 3AMZA 1YNXA 3L9AX 5FLXE 2UXBL 5DPRA 1UGMA 1L0XB 3BVZA 4BOZB 1WGHA 4QGUA 5EE0A 1GC7A 1QB5D 2WWZA 4NPSA 5AUIA 4R4QA 3D3RA 1WJUA 2KC1A 4YHHQ 1RF2D 2H89B 5IODA 1PZID 2IHFA 4R8NA 3GS2A 3H0GB 4WWMA 3RCZA 4MGYE 2WAQE 3HEJA 1BCPC 2D2CC 4A3FH 4JI7Q 2JA6G 2BT6A 4GLAC 5TSSA 1QG7A 2N55A 4AYBG 2IT1A 2IX1A 3MVVA 2KK8A 4E3CA 4XZ4A 5M3FG 2V3SA 1STYA 4HSPA 2JEBI 2NVTB 4KJOA 1Q7YC 2BW2A 2K05A 5G55A 4KHVA 3J7A5 4FULA 4X64Q 1VF7A 4A3IG 1GOZA 2AUJD 5M5WH 4WFN3 3HM3A 2EJGC 3GTLH 2CKHB 2K03A 3I91A 3QJZA 3A8JE 2KN5A 3U4EG 3HKZB 4FXCA 3GTMB 3V62A 1CZGA 1UEAB 2VUMG 1R9TB 3DWMA 3R7QA 1S5ED 2EY1A 2NYZD 3HOVB 2A5UA 1IBXB 3HOUB 2NBWB 4DNIA 3Q6BA 4OL7A 3HP3A 5C4HA 1BQQT 3MTNB 1TQOA 3OW2A 1SFOB 4H2AA 3A9KB 3GTPH 3P4RB 1I4HA 3AYHB 2IWHA 1IZ6A 3ULPA 3T3NA 4RNAA 4A3KH 4BBRH 1XXGA 4NKLA 1Z2MA 1G8ZD 4M1UB 3H3VI 1AWDA 4AJWA 3RUZA 3JSVB 5IN7A 4L5SA 4DAYA 2B39A 2SOBA 3A9KA 2E8GA 2KBNA 3RPFC 5CHWA 2NUCA 2LVQA 3CP0A 3HOZB 5ELFA 2R6GA 2WDTB 3J81E 4FDBA 3EA6A 1KRHA 2QDLA 3I4NG 2RPQA 2PQAB 1SE4A 4JI8Q 5C44H 4K6LA 2RSUA 3G48A 2CU1A 2BB5A 5E6OA 4FXDA 4NXNQ 4LDTD 1JWUD 2NVQB 1A6XA 2G1EA 2ZNVB 3RN5A 5I6YA 1E0BA 1I4XA 4KSLC 3R8BA 1SYDA 1VQDA 3KYCD 1ML0D 1G6ZA 5COYA 1F2RI 1PYSB 1LTTD 4DR3L 4OVUA 2HCCA 1A15A 4K5VA 4NY0A 1VQEA 2JPHA 4DR6L 5C3EH 2E2IH 4JI4L 1F2LA 1F9RA 2YU9B 2VB3X 4A3GB 2JA7B 1EF1A 1YOVB 3H91A 4A9AA 4BBSG 1ESRA 4IFDG 5BYSA 2WAQB 4JCVE 3NSWA 1GD7A 3DHHC 1OQYA 3V6EB 2E3TA 3RZWC 4KVGB 3NVYA 1WTXA 1FMAD 3A7LA 3MFGA 4DR6Q 1OEYA 3PRZA 2RD0A 4LNFA 1UE5A 2C5CA 2LSSA 3WCQA 2UXBQ 5J17A 3ITPA 5CV6A 4IO9A 1HNZQ 3I4MB 2I38A 2ZNVC 2K3UA 2YEPF 3N9YC 3KYDD 1IXRA 1KD1C 3QIAA 4NJ7A 4BBNF 5JH5C 2LKVA 3FHWA 3NY5A 4Q0FA 1PRTB 2B2VA 3PF5A 3R3OA 1YX6B 5BMHA 2MBHA 3H94A 1AZQA 3AE7B 4BKGA 5IGGA 2BOSA 3L0WB 2MGSA 2D62A 5E6JA 4OWXB 1HR0Q 1JWMD 1V1QA 1L7YA 2AHOB 2PW9A 1XCQL 1VQMA 2LI5A 1Y8RC 2MCNB 1E7PB 2JA9A 1FXAA 3R7RA 2PZTA 3E56A 4IN3A 5GAGC 1RKNA 4X65Q 1PFSA 4OVVA 1JRPA 1FVIA 2AQ1B 4QUFA 4ZLTF 1HZCA 1ONLA 3RNUA 1RM6C 4WAAA 5AZHA 2F1MA 2NN6I 4DV2L 3V3XA 2F0DA 4B9KA 4UHVA 4OW0A 4EZKA 1JICA 1R9TH 1DZ1A 3OAWA 1GUAB 1LTAD 3TZDA 3TZUA 3AEDB 1M1KC 2JVCA 5ELOA 4M02A 1TIID 2PJHA 5ELNA 5LL6X 1ASYA 3W5VB 4AIMA 4TSSA 3D6CA 3J81i 2BF8B 5G5GA 2QCZA 4IPHA 3VDZA 3L3OC 3GV3A 3I90A 4DHZE 1F2MA 1R4NB 1KNAA 4JPBW 3T1HQ 4TRDA 3U4ZA 1TWHH 2XBBC 3A1QA 2K04A 2F0FA 3QAQA 3RLFA 3IT4B 1B4OA 2NBFA 1WTWA 3PTFC 4X62L 4YWLA 1EL0A 4IPCA 1PYWD 1LLRD 2RA4A 3KF8B 5FJ8H 5IT9c 4B0MA 3MEFA 2CWAA 4J6IA 1PGAA 1KAWA 1LTLA 4C3JB 3VXWA 5M3MH 4IUUA 4FJYA 1HCZA 4DV6Q 4EUTA 1DGSA 1HFGA 2PI2E 2N0SB 2MJ8A 2GMIC 4Q5VA 1EWCA 3JAME 1BDOA 4A3PA 3GTPB 1N6ZA 2KJ6A 3VYTA 2JP1A 1SYGA 2PYKA 4OONA 4DXFA 1KLUD 2UU7A 5CV9A 3AU5A 4YCVA 4GOPC 4OVZA 2BPSA 3RD2A 4ASWC 3NVWA 3A9JB 3PZ7A 4GDKA 1HZ6A 1Y8OB 3RZOB 2FCSA 4QAYA 2QF7A 4MH8A 1K8OA 1H9MA 2MX2A 4HKQA 3VRAB 3UE1A 3KJOA 1VQ9A 1J19A 4CBVA 1QZGA 1J5EQ 2PKOA 1WXMA 1T0RC 1S3SG 3IFDA 3CWIA 1YQ4B 2WXKA 3IAS1 2LXJA 2D0PA 3DLLA 4DK0A 2K8BA 2C5LC 1L1OB 1PH7A 3KFUA 2BA0A 1GO3E 2G45B 2N1VA 3K5LA 2K8HA 2WXRA 1VQ5A 4ALPA 5EJWA 1V5OA 2EPBA 2I07B 4JI6L 2I46A 2NTSA 4JLCA 3HOZH 3HGBA 3QWNA 5K36H 4FP5D 4K5WA 4X3TA 3D4DA 4QUCA 3UQAA 2JSVX 3AULA 3EGRA 4PMWA 2LJIA 5KNDA 2O2VB 1VS0A 2JYEA 1Q1BA 2DLBA 1YIWA 3H7PB 4KKJA 2JXMB 2XGTA 2X69A 4S3SA 1QUQA 4CHKA 2LWPA 4ZRZA 1WTOA 1L1OC 3RMKC 1O7LA 4PYUA 4E71A 2KWCA 1EY5A 2D3BA 3ZQ4A 1I6HB 3SGIA 1GUSA 2RGFA 1OXUA 1TYGB 2TMPA 4GZYC 5C4XB 1ET6A 4LF5Q 2DAJA 1QE6A 1KRTA 1WTRA 4QJFA 3TCAA 1EIFA 1PMRA 1SSOA 1KTKA 2LFNA 4C00A 4GN1A 1M8AA 3DBRB 3CF6E 4I6LB 4IKGA 1IW7C 1UE7A 4ME5A 1BCPB 4CKCA 5IP7H 1HEZE 2BTEA 4LNIA 1VQCA 2WP9B 1L0VB 3JAMc 3IRBA 5JVH3 1PGBA 2DWQA 4AQYQ 4A3EH 2JA8B 3URYA 3DHQA 3L2PA 4KZCA 4P71A 3TP6A 4CDEC 4A3IH 2KD0A 2HD5B 4DR1L 3RULA 1GM5A 1VQLA 3SHQA 3K7AH 2DZIA 1JORA 4R4OA 3BDOA 3KLSA 4BKSD 1K8GA 3PUVA 4A3CG 4EVOA 1T6BX 3CMEA 2L1AA 3N1YC 4FBJB 5D7GA 4A3DH 2L8JA 2N9KA 3PUWA 3A5UA 4I6PA 2EJMA 4HLEA 5CV5A 3CXCA 1TT5B 4MIUA 2GBRA 1WXAA 3X3MA 1ASZA 2K8CA 5C5LA 1HNWL 3UIOB 2WXPA 5C6AA 2WXMA 3GTLB 2ONQA 2VZAA 2X6LA 1A63A 4ZQ3A 1SE3A 4RM8A 4LWCA 3K0YA 3UI2A 4IJLA 2MO1A 1MHHE 2Z6KA 3PGEA 4A20A 1YJ9A 4LFBL 1Y1VB 4CDCC 1IYVA 4DF7A 1CZPA 4HVBA 1WGDA 2PVOD 1GNUA 2QDBA 2INCC 3IAM1 4A3MB 3CCUA 2E76C 1FR3A 2FAZA 4BA1I 3O65B 4JX1C 3RR5A 2LGSA 4A3GH 4ZKCB 1WY8A 4LF4L 1JWAD 1HUNA 2NPTB 1HQMC 2RF4A 2G9DA 3NQIA 4DR5Q 4A76A 3KOJA 2R3ZA 4K7UA 2KCMA 1STHA 3PIP3 4JG2A 3W3AA 3GTOB 4GNXB 1JQ4A 1Q5WB 1VMPA 1NBFC 5E4XA 5E3FA 4OO1G 5NUCA 4LDTB 3VR9B 4LTUA 5EE9A 2Z4IA 1QZEA 4ODGA 1RFAA 5CMDA 2OJWA 4G7HC 4NXMQ 4A3LH 3CMMB 4EFOA 4EE2A 4HWIB 1Y1VH 4YT0B 3DWAA 2NBVB 2L83A 4H44C 4KY7A 3C8YA 5A2QE 2VB2X 1L0WA 4M01A 3K5NA 1JJ2A 5C4XH 5ELDA 2Q2TA 4S17A 2KMCA 1TJEA 4X3SA 3PSEB 1KDBA 1Y14B 1NNXA 1LTBD 4BBNC 2KO3A 2L5TA 1CSQA 4NQLB 2J0MA 5CHFA 2VS1A 2WXNA 2HTME 1WX9A 3QQ8B 4DK1A 2Q5WD 1STEA 3S1RH 2CU3A 3MJWA 3AM9A 4DV5L 3AE1B 3KLWA 3LGJA 1NR2A 1L4DB 2INDC 5FR6A 3I72A 3C46A 4R9WA 1E0ZA 1TY2A 1SIJA 4KKIA 1WX7A 2D07B 4YTNB 2QEJC 1B50A 4MGKE 1RJTA 5IGCA 2ZW0A 4JL9A 4XX5A 2YLMA 4KHZA 5EQ0A 4AQYL 1B3AA 2NVTH 3VRBB 2UUBL 3GOEA 1OXSC 2EYOA 2W9NA 3VR5A 2SDFA 2MP1A 1I3QH 2XVSA 2KLCA 1L6UA 2O6VA 1XLNA 3U2SC 1SYFA 2NVYH 1L5PA 4PZ7A 5KNCA 4WURA 2F0LA 1TKEA 4YL8A 5FO9B 2WKCA 2YYZA 3F8TA 3CC4A 4DR5L 2R92H 3HK0A 2MBQA 3RNFC 3SK6A 2F4IA 5GROA 3GTQH 4M8AA 4ABNA 3SD5A 1L2FA 4GLVB 4EX5A 2KHWB 2B2YC 2A69D 1VQ4A 3MHSD 3P4PB 4P73A 4APVA 1T5EA 1WYWB 3R3MA 2LASA 2X38A 4EEWA 4FADA 1UELA 4IM3A 2H1EA 4UP9A 2K33A 3D8GA 5IWAL 2OT2A 1UEBA 4GNXA 2N88A 1PTOH 2VH2A 3KF6B 4MH0E 3U7DA 1GUTA 1QILA 1QWYA 2WV6D 1GHKA 1W2BA 1MG8A 2KMMA 4DK6C 4DR2Q 1SXTA 4HJ8A 1SGHA 2H88B 1A62A 4C4VB 3NE5B 3K80C 4HMIA 3L54A 3ZIMA 2IL8A 1PYBA 3D4WA 1SJED 1MBYA 3SE0A 3Q8AA 2F0SA 1EQRA 3V05A 3FVQA 2B63H 4RAUC 1YBYA 5G2NA 3M63B 1KOTA 1A2TA 2C7NB 3ALBA 1YJNA 3VDYA
chains in the Genus database with same CATH topology
5M5WB 2WDRB 1C78A 3NRZA 1U4LA 4A55A 1D4BA 2EJFC 4I7ZC 5G5HA 4F8MA 1R4QB 3AB9A 2Y5CA 4G7OC 2KQ4X 1XWEA 1TU2B 2OEOA 1GAQB 1JC7A 2WXHA 5C0XJ 1TS3A 5A2QL 3A7AB 1ZDXA 1UGJA 3AEEB 4C3JG 1TS2A 2M19A 2EOTA 4A3BB 4PMCA 2QJLA 1EFID 2WP8J 2V4IB 1CI3M 2C9OA 4C2MB 2QIEB 2M2LA 3VR4A 4NZLB 4HKZE 3D4RA 1BNZA 1YMHE 3R93A 1MI0A 2ZXPA 2NMQA 2CVRA 2XRSD 3Q69A 2XRQD 3U52E 1HFNA 3I73A 1SMYD 1AZPA 1SMYC 5JPNC 1OQRA 1MGSA 3M7NA 5CORA 4A3EB 2K5QA 4ARIA 2SNSA 2NVXB 3NUCA 3WDNA 2N7JA 2ZXRA 3QG1A 2IGDA 1Y8PB 1V1PA 1MHXA 2PLPA 3P75A 2FE8A 2BCOA 3NPPA 1RFKA 4KGSA 2F3WA 4JK1C 3D6WA 1S5FD 1HRJA 1XLPA 3HOYB 3C3LA 4ZOHC 1BUVT 2D5GA 1GB1A 3MJ5A 2XWBB 1B53A 2L1BA 4PV1C 1PXUA 4DNTB 3MZ5A 2EZVA 3M85A 1XTCD 1S4ZA 2FFKB 1XEEA 3AV8A 1LTGD 1TZOA 4R3DA 2BDNA 4CKBA 1CZWA 1SBBB 2KUMA 1ROEA 2RPVA 3T3OA 4XTCS 1TVXA 2BBCA 2IX0A 3ZJUA 3OIQA 3RFZB 4OO1H 4WRDA 1FEHA 4XDDA 1PDXA 2E2HB 5CR3A 3D31A 2FHTA 1F0ZA 1CA6A 1LTID 1DD2A 3TN2A 3VQIA 1G91A 5J22A 3OWFA 3MXUA 4L63B 4YTPB 1UNSA 2K28A 4C1NK 1FXIA 1C48A 4PT5A 1RTOA 1FGBD 1QNKA 4WORA 1HXYD 3RZDB 1CM9A 4JWUC 3IKJA 3ABVB 3MXPA 5LNK1 4RHSA 4HRSA 1PZJD 4ZHOA 3EROA 1M4VA 1TWFB 4J8QA 1A2UA 2GA4B 2ID0A 3H8HA 4XYQA 2DBYA 3W5UB 1RD9D 2EYHA 1CHPD 1DOYA 4IUQA 1F9PA 4B08A 1GPXA 3BYYB 1ILPA 3AU7A 5FKAC 2EYJA 5E1FA 5IT9L 2XNAC 4FXGC 3J80E 2R93B 3RD4A 3FEWX 1C76A 2A6HD 2BE5D 5JPMC 5EPJA 2KEEA 3S1NB 4ZAIA 1BCPF 2PQEA 5BYRA 3N52A 5C4ZA 3G7LA 4B9WA 5I4DA 3KBGA 3ERQA 4C7ZA 1O7YA 5IIFA 2WXIA 2QKIC 2V4DA 1V8CA 2L32A 4RGNA 4YSXB 1TT2A 2O5JC 3J9CA 2ICIA 1FRDA 3NHHA 3BWUD 2WXLA 1EEID 3K6OA 5EPLA 1OFFA 3VYUA 3QOLA 3S14B 2F0UA 1ZP0B 2F0PA 3FILA 1H9SB 5FR3A 2EY2A 1VDZA 5C0XH 1QF6A 4FXKC 1C4AA 2TSSA 3ZGZA 1PDQA 1VF5C 3EQLC 4FYDA 4Z9CB 1IGCA 1RYJA 4FO2A 4A3KB 4NMZA 5K5PA 2E6XA 1GUGA 2M9VA 2DYOA 1FM0D 3T16A 4KN4C 1E2ZA 3EFXD 1QLBB 5CBEE 3SFEB 2KA7A 4F88A 1F2RC 2GRIA 1AYFA 1VZ7A 2D9UA 1EIGA 5KYIA 1KDAA 1G291 4DA2A 5BYQA 1C4CA 1N60A 3OMCA 2RVLA 4K6DA 4DAPA 5HFYA 4KMUC 3LB8C 2ENBA 1SSNA 1EU3A 3DWPA 2EY6A 3TEZA 5FO7B 5C3WA 1X32A 1MD2D 4K8IA 4A93B 3KWVA 2LHDA 3SDZA 1OXTA 2F0EA 2L12A 3J81L 2NN6G 5HGTA 4MN3A 4B0EA 1YJJA 4BY1B 3K57A 2O4XA 4RFBA 2IW3A 4XT1B 4YTMB 3C1EA 4M0WA 2KAJA 2RBMA 2HDMA 4P6VF 1N5XA 1HHVA 4IFDI 2JU6X 1NYQA 2PW7A 5JAVA 4BY7B 3P63A 3U9SA 2QILA 3BYTB 3HVDA 1ZYRC 3E0JA 2KJXA 1SNCA 1BF4A 1E6EB 1K50A 1R4PB 5C3XA 1IUEA 1D1IA 2ON8A 3UI3A 4IURA 2QMTA 1WVLA 3PUXA 1AEXA 3DXJC 2LY7A 1EQVA 3AEAB 3PV0A 2CQAA 3P4QB 1GUOA 2B2WA 2WINB 1SDFA 2DN8A 3FMCA 2WKDA 1QOHA 5DEHA 4XQJA 4TQUS 3X3NA 4A90A 1C9FA 3K7AB 2Z8LA 1AP0A 3Q8EA 4GLSC 1WYGA 2SEBD 2CW0D 5FLXL 3VA5A 1VRAB 1NR4A 3A8KE 1I50B 3Q23A 4KX6B 4QIWB 3S17B 1OXXK 5DAUA 1U9RA 2B2TA 5LHY1 3OPOA 2EDGA 4WIPA 1LACA 5EE1A 2RSOA 2B63B 1LTRD 2AQ3B 1L6VA 2EYMA 5ELBA 5F2DA 3CIRB 4KV6A 2BA1A 1DOLA 1Q8IA 2R61A 4C3IB 4HSVA 2O5IC 3SK8A 4CJ2C 4HTHA 2R92B 1UWMA 1A3UA 4XQQA 3OMGA 1HPCA 3BS1A 5CYUA 3P4SB 2MUYA 2L4NA 4KKTA 4US9A 4QMGA 4OIKA 2RKSA 4RGTA 3B2FA 3BDCA 5HG2A 3M4OB 3NS1A 2Y3AA 1IL8A 3GTGB 5HHDG 5CV4A 1EWHA 2JEAI 2MPMA 4IDIA 3QO2A 1GHJA 4YSYB 2PCFB 2MHVA 5D3DA 4LLGM 1JCKB 3NTHA 1U4PA 4U68A 4XXEA 2A74C 4KKUA 3A8IE 4IUVA 1FYCA 1ZE3D 2DNEA 1Y8NB 5BMIA 2LHEA 1L0YB 1O80A 2IJ0A 4JBWA 2WACA 5KNBA 1QOAA 5T1IA 3AN1A 2INNE 4L1BA 2F0OA 3P20A 2K5DA 3MC0B 1NAPA 2J53A 1TWCB 1N5WA 2K22A 1QJOA 1NENB 2F0IA 2L55A 2Y0SB 4QB4A 1PLFA 2N9LA 2MJ3A 3HRDD 3KWLA 2EYLA 4IUPA 2L52A 4OZAA 3NBIA 3S2HB 1N63A 3DEPA 1DOXA 2CHBD 3EUB2 4PQXA 3HOWB 2EKIA 1JOOA 5IT9E 1K52A 4YIJA 3GTJB 4YWGG 1JALA 4OZBA 1IBXA 1RWSA 4TMAB 4G4KA 1FNUA 3MTSA 3NUHB 2RDHA 3IFTA 5M5XB 4UDUC 1U4RA 1H9SA 2F0QA 1EY6A 3S1QB 1NCVA 1QNUA 1WD1A 1D5ZC 3K5OA 1Q3LA 1N62A 2F0HA 3O13A 1BCPD 3DWQA 3P1HA 2NB0A 4IOIE 2JA6B 4FF1A 1X3QA 4WAFA 3BVMA 3DM1A 3SR1A 1PFDA 3E5SA 1KH0A 2K9XA 4F7XA 2EYPA 3DUZA 3EVQA 4DNRB 2PW5A 1ZEQX 2F0WA 5E4WC 3WOFA 3I57A 3K58A 2HCIA 3KLRA 2K1BA 2XSCA 3TEXA 2MJDA 2OF1A 1STNA 5DM63 2AQ2B 1FNWA 3KUPA 3BZDB 1LT6D 1H9RA 1NYRA 5I2XA 1JR0D 2EE1A 2BS2B 3PUYA 5G3LD 3AE6B 2CW0C 4XWTA 1PTOC 1V8QA 2PPBC 5C3EB 2E2IB 3I3CA 4KGTA 4ZK9B 2B76B 1YNTE 1Q1EA 1LT5D 2A68D 3J7AV 3BK2A 2OEDA 4JE3B 2Q8TA 1XF5L 5ELCA 4KY6A 3GQBA 2FJ2A 1EIHA 3SHLA 1VZ6A 4XDCA 2JYOA 1NI3A 1TKYA 4NJCA 2MJEA 4XDXA 4BA2I 1Y1WB 1DONA 3OOCA 1D5XC 2A5HA 1CQVA 4KGRA 3BDLA 4QF4A 2RDGA 4L2YA 4KY5A 1J9OA 4HMJA 3A56A 3W1SA 1KLGD 2PTLA 4LMQD 3SVMA 1Q12A 2VUMB 1FRRA 1EEFD 1Q10A 3PO3B 1ZYRD 2E75C 2NTTA 1QOBA 1F2YA 3SK4A 2EELA 4KK7A 3Q22A 3MXGA 5CV7A 3TP5A 3IAYA 1AW7A 1S5DD 3MHBA 4AQ7A 1D2BA 1BO0A 4RWSC 4ZYSA 1IYUA 1DJRD 3NTKA 1LO5D 2HDEA 1ZXHA 2EY5A 3B2GA 2M00A 4C3IG 1C79A 4EQPA 2K5PA 3CKIB 3HS0C 4RGMA 4GDLB 1LV9A 5A35A 5DM73 2CJOA 1E2VA 1VMCA 5CGKA 3BIID 1AFPA 4V190 5C0XG 5CV8A 2ICEC 3B9JA 2FMCA 2B2YA 2MH7A 4DN4M 5JJZA 1Z7TA 1I4GA 5CC4A 3G6JB 2VZKD 3BVGA 4BBRB 3ZYYX 1EY4A 1BMLC 2KOLA 1D6EC 2KHSA 1Y69U 2LMCB 3KLSX 3VR6A 4CHTB 3Q8CA 2ZW1A 4KI0A 2WQYB 2W82A 3S1MB 1EY9A 3QB3A 4CGYB 4PMBA 2KECA 4KD4A 1JMLA 5FK9C 1KDCA 2WNMA 4HCEA 1F2ZA 2KQ3A 4U673 4RH6A 4LK0M 1VJKA 1JE4A 3MP9A 3VR3A 4G57A 1JQYD 2JE6I 4AYBB 4H2AA 5KIXA 1TS4A 4N6EB 1STBA 4HCSA 5ISRA 5JOBA 4DGZA 5IGBA 2F3VA 1ZPSA 3I9V1 5AFWA 2PVGC 3Q8FA 3SFDB 1YNJD 3MAQA 5M9OA 2KCNA 5GXGB 1VR9A 3GD7A 1UAPA 4FF2A 1EQTA 1DYQA 4OIJA 3NQTA 3OWEB 1E10A 4YSZB 3QOJA 1GUNA 4XT3B 1T5XD 1ENCA 1KNEA 4US8A 2B2VC 4MHEA 1ZXIA 4LK1C 3LYYA 5D3IB 1L4ZB 1AN8A 2F0TA 2WXOA 2IGGA 3E9SA 2KEDA 3KF8A 5J1ZA 3IXSA 1QKZA 4C7YA 5T8IA 1A3VA 4TKOB 1S5BD 1K53A 4G7ZC 4A3FB 2DYMA 3FC4A 1ZOYB 2RQXA 5HI1A 1VLBA 4C56C 1IKLA 1B9RA 5H8YE 1ILQA 2F0KA 4N9TA 3NTIA 1KF6B 1DOKA 1WXQA 3AEBB 4K8JA 2WXFA 1WTQA 2IPKD 1V1PB 4DAVA 1ET9A 1RODA 5I6WA 4NP5A 4WH4A 2W3RA 2D5DA 3DEOA 1LT4D 2HDLA 3FKIB 2B2UC 1GXDC 2FBWB 1U4MA 1I4PA 1H9KA 4TQ1A 4CJ0B 4IUTA 3PO0A 2E2DC 3TSSA 2RSNA 1YNJC 2KCCA 3OIPA 1D5MC 4N59A 4ITKA 3DWGC 4IQZA 2EXZA 2VZKB 3AE2B 5KRUA 2INPE 1RTNA 4YXDB 1W6KA 3OHXC 5I9PA 1PGXA 3ZJTA 2K01A 3S1RB 1STAA 4KKSA 3FPPA 3SEBA 3TDQA 3ONAB 1JWBD 2JWUA 1SNOA 1IGDA 1KAAA 2PZUA 1FNVA 1TKWB 2F03A 2R7ZB 1FFUA 3H6MA 3VYSA 5C0XI 3MFYA 1EU4A 1J7AA 2H4OA 1KABA 1WRIA 4ZRPA 2ZT9C 1A70A 3PUZA 1Z6HA 2PMZB 2OHFA 4O42A 3J7YW 4XWWA 1XX8A 3AE5B 3I70A 2JA5B 1WGKA 1PFMA 4K2LA 2J0TD 4CJ1B 5EKKA 1SYCA 1EZ6A 2Z4HA 5HURA 4H0LC 3CU7A 3R2IA 2KN4A 3I8ZA 4FNFA 1SAPA 1DXMA 4L6TB 1HTLD 3AE4B 4ZRQA 4Y7NB 1NUCA 4GDKB 3FDTA 2CJNA 5G3LF 4KTAA 3MHZA 2WLBA 4FVMA 3Q24A 5JEAG 5ELEA 3R2TA 4HR7B 2IDYA 2DY7A 3QJYA 4DQOC 4RF0A 2PO4A 3LWEA 3L4PA 4RGOS 3HG9A 3J80L 3NWTA 4E6IA 3AMUA 4IALA 3FPUB 3TBIB 2HQEA 2F0VA 1WTVA 4O1NA 3SXHA 3GTKB 1F9SA 2E2JB 5I9OA 3JAML 1HTPA 1STGA 1BBXC 1WWTA 3P1MA 3PO2B 4IFDH 3GV6A 3V96A 1K8MA 1SYBA 3P42A 4XQNA 4MT5A 2Q8RE 3T13A 2X6GA 1BUIC 1DM0B 2K7VA 3HRZC 2J4XA 3S15B 4JWSC 4ARCA 3LNNA 2K0PA 2LEKA 1P7FA 2A68C 4J6HA 3BK1A 1TKGA 3CRKC 1I7HA 3F2UA 1CFMA 1PRTD 1PTOD 1O7ZA 4XYOA 4R8IA 5EBCA 4A3DB 2FINB 1BXTA 3W9CB 4F87A 2WXQA 2SAKA 1TWAB 1XYIA 1YNNC 4K14A 3ND8A 2JX5A 3MWYW 1PRTF 1MI2A 4LAAA 2HUGA 4LJZC 4BBSB 3EJIA 1ENAA 2JXTA 1LT3D 3A55A 3E6ZX 1FCCC 2M56B 4JPSA 2JSOA 2LGIA 2Y5PA 4RA8A 3OSOA 4X3KA 1FIQA 1J7CA 1CT1D 3T51B 1JB3A 2EYFA 2PNRC 2WU2B 1UWXA 4EGVA 3LWUA 2IX3A 3W2DA 5BN4A 4N9PA 1ACCA 3U9OA 1GJXA 2DNCA 1DOIA 4XE0A 1CQFA 4UAIA 4K5XA 1IKMA 1G2SA 4K2KA 1YJIA 1S5CD 2G9HD 2BYTA 1II3A 3M4YA 2W54A 1JOQA 4FF3A 1X3PA 3C2PA 2LMCA 4ID6A 1E9MA 3AE3B 1T3QA 2WS3B 3HOXB 1GUWA 4HEA1 2XWJB 4OGQC 5BN5A 5H92C 4DU9A 1SF0A 1CK1A 1O78A 1EYDA 2BB6A 1SNQA 5EKIA 4KN7C 4CKEA 5AUKA 1EWYC 2LUMA 4ILWA 3NVZA 3C1FA 5KYLA 3U7ZA 1MPEA 1MSHA 3GO5A 2KACA 4WJWA 3ND9A 1A3TA 1YN4A 2V0GA 1SNDA 4HJGE 2F0NA 1FO4A 2WB1B 1NSNS 3VA7A 1B2TA 5C2TB 1VCIA 3I4LA 2VXWA 1WCMB 1E2WA 1QQRA 1XCTL 3PMFA 2A6EC 2V3PA 5K36G 2ZXOA 4KD3A 4C80A 2AWOA 2A73B 3TMEA 1WD0A 1QOFA 3S9WA 3T53B 1IW7D 2K6AA 5DNFA 4NAWB 3OW7A 1VDVA 2K32A 3HVZA 3TUOA 2A69C 5JEAH 3H3VC 3TEYA 4A3IB 1RDPD 3FAHA 1RHPA 1LABA 3AEFB 3TEWA 2AUKA 1B9MA 2BS3B 5FOBB 1YN5A 1HUMA 1HA6A 2W55A 1Z47A 3P7JA 3NVVA 2XIWA 1R7SA 3HZXA 1QT9A 3GB1A 3Q0AA 1XLQA 3TP7A 4V0BA 5J39A 2LFIA 5MPOA 1TWHB 1ZXTA 3L7ZC 4IFDJ 1SNMA 1N61A 4EQOA 3MEHA 2Q8IB 2RMMA 1B9NA 1PFBA 2B2WC 2FUG1 1UUPA 2WDQB 1ICWA 2WIIB 2L9HA 4N58A 2PMVA 1XLOA 4DFAA 1H9JA 3LX0A 1TS5A 1OQQA 3K59A 2J52A 3NBHA 4EQNA 2VNUD 1I6VC 2K5WA 1ZKOA 4A3JB 2OXPA 4L23A 3VR8B 1SEBD 1EZ8A 3M3YB 1SNPA 3FILB 3WOEA 1PZKD 1B1ZA 2FMMA 4DXGA 2AX5A 4RF1A 1FFVA 3NXWA 5M3MB 2KVMA 1FD6A 3NZ3A 1PTOB 1J7BA 5D65A 2V3NA 1EYCA 5LL6S 4MACA 3H09A 1EYAA 1B44D 3SK5A 5KEEA 4ZHPA 3AEGB 1PFNA 1JROA 2PIAA 1FCLA 1Y56A 2NVYB 4J1MA 5C5MA 4NAMA 4AS1A 4OHJA 1W6JA 2XN9C 3GTQB 4PNYA 5IGDA 1BOSA 3AB5A 4P16A 4ZUIA 1EOTA 3PIO3 2DY8A 3NP8A 4BWGB 1C8CA 4J3OD 1YQ3B 1I3QB 1TY0A 4ULLA 3CQZB 3S2DB 1OO9B 4A6QA 2J42A 5KGUA 1PUTA 4FF4A 4WQMA 4BS9A 4X3UA 2BDOA 3M7GA 3CRLC 1V97A 1G2TA 2M0AA 3AECB 4MM3B 5IOCA 3HUIA 1I4QA 2PZWA 1J8IA 1EM7A 2MEKA 4OZCA 4Q2JA 2SNMA 3MA2B 4A8XC 1BR9A 1HQRD 2A6ED 3GP7A 2JQRB 2WDVB 1QCBD 3IL8A 2L11A 1ZDVA 1YNND 1EY8A 4IZ8A 5I2YA 2WU5B 5JEAJ 2BS4B 2IGHA 2KWDA 1QOGA 2I2YA 4C1NI 4P2CB 5EGTA 1LTSD 1DGJA 1SYEA 4KJNA 1MSGA 4HROA 5D14A 3N6RA 5EE3A 4H13C 4D2KA 1PRTC 4RKLA 3AH7A 1IHZA 1CTMA 4XIGS 1JOKA 2NN6H 3KK7A 2AWNA 3MXNA 5C44B 1KFYB 3J7AF 4TQ0A 5BN3A 3K5MA 4HN7A 1WSPA 1ESFA 2A6HC 1VZ8A 4OO1I 1YN3A 3V2TA 2J7ZA 1F77A 2F0JA 1CJEA 4I65A 1GB4A 2B2UA 5IGFA 3Q6SA 3I4NB 1I4RA 4CQNA 1SE2A 1V1OA 1OXVA 2GB1A 4ZUJA 3SR6A 4HAEA 2YEPB 5EPKA 2W3SA 1JWSD 4RCOA 4USAA 2QCPX 2QSDA 1C77A 1CA5A 3BG3A 3AE8B 1JW9D 4QCLA 2BE5C 1XO3A 2JYTA 1PTOF 3TP8A 4IUNA 2B2TC 5EKLA 2O2LD 3S16B 5M3FB 1NEKB 1C4QA 1FD7D 3VYRA 1K83B 1ZUD2 2F0GA 1V43A 1ENFA 3DMUA 5C3JB 3IT6B 1D1KA 2JZPA 4RHRA 2NWGA 2Z1CA 1WTPA 5IGEA 1TR5A 1NVID 3NK9A 3FRPB 3PZ8A 5BMGA 4RKBA 5EBDA 1HZ5A 1SJHD 4C3HG 2KDMA 1CHQD 4L8JA 1F9QA 4NDXA 4C3HB 5JXVA 5C4JB 3LXFA 3T56B 3ZJVA 2L0CA 3ETRA 3A54A 2NZ1D 2GI9A 2WXJA 2B8FA 4NW2A 4HEDA 2F0MA 5FO8B 1HA5A 1C4PA 1K51A 2LS01 3KQ4A 1MVKA 1DOMA 2E74C 1P7EA 3T4AC 2ACZB 4REZA 4RCNA 3Q8BA 1Q90A 2RDFA 2WXGA 4B9XA 2EVBA 5T1GA 3AE9B 5JVG3 3KBXA 1EY0A 1EY7A 4H7BA 5M5YB 1RCVD 1SB3C 4ZKBB 1TWGB 1DCZA 3NWSA 3CHBD 3VR2A 2B8GA 3RMHA 5CBAE 3AMZA 3L9AX 5FLXE 1L0XB 3BVZA 5EE0A 1QB5D 5AUIA 3D3RA 1RF2D 2H89B 5IODA 1PZID 4R8NA 3GS2A 4WWMA 3H0GB 3HEJA 1BCPC 2D2CC 2BT6A 5TSSA 1QG7A 2N55A 2IT1A 2IX1A 3MVVA 1STYA 4HSPA 2JEBI 2NVTB 4KJOA 2BW2A 2K05A 4KHVA 1VF7A 1GOZA 2AUJD 4WFN3 2EJGC 2K03A 3I91A 3A8JE 3U4EG 3HKZB 4FXCA 3GTMB 1CZGA 1UEAB 3DWMA 1R9TB 1S5ED 2EY1A 2NYZD 3HOVB 1IBXB 3HOUB 4OL7A 3HP3A 5C4HA 1BQQT 1TQOA 1SFOB 3P4RB 1I4HA 2IWHA 3T3NA 4RNAA 1XXGA 4NKLA 1G8ZD 4M1UB 1AWDA 3RUZA 4DAYA 2B39A 2SOBA 3RPFC 2NUCA 3HOZB 5ELFA 2R6GA 3J81E 3EA6A 1KRHA 1SE4A 4K6LA 2BB5A 4FXDA 1JWUD 2NVQB 1A6XA 2G1EA 5I6YA 1E0BA 1I4XA 3R8BA 1SYDA 1ML0D 1G6ZA 5COYA 1F2RI 1LTTD 2HCCA 1A15A 4K5VA 4A3GB 1F2LA 1F9RA 2YU9B 2VB3X 4A9AA 2JA7B 3H91A 1ESRA 4IFDG 5BYSA 2WAQB 3NSWA 2E3TA 3NVYA 1WTXA 1FMAD 3A7LA 3MFGA 2C5CA 3WCQA 3ITPA 5CV6A 3I4MB 2I38A 2K3UA 2YEPF 3N9YC 3QIAA 2LKVA 4Q0FA 1PRTB 2B2VA 3R3OA 5BMHA 3AE7B 3H94A 1AZQA 5IGGA 2BOSA 2MGSA 2D62A 5E6JA 1JWMD 2PW9A 1XCQL 1E7PB 1FXAA 2PZTA 3E56A 4IN3A 1RKNA 1JRPA 2AQ1B 4QUFA 4ZLTF 1ONLA 1RM6C 2F1MA 2NN6I 3V3XA 2F0DA 4OW0A 1JICA 1DZ1A 1LTAD 3TZDA 3TZUA 3AEDB 1TIID 5LL6X 3W5VB 4TSSA 3D6CA 5G5GA 3L3OC 3GV3A 3I90A 1F2MA 1KNAA 4TRDA 2K04A 2F0FA 3RLFA 3IT4B 1B4OA 2NBFA 1WTWA 1EL0A 1PYWD 1LLRD 2RA4A 4B0MA 1PGAA 4C3JB 4IUUA 1HCZA 1HFGA 2N0SB 2MJ8A 4Q5VA 1EWCA 3JAME 1BDOA 3GTPB 3VYTA 2JP1A 1SYGA 2PYKA 4DXFA 1KLUD 5CV9A 4OVZA 3NVWA 3PZ7A 1HZ6A 1Y8OB 3RZOB 2QF7A 4MH8A 1K8OA 1H9MA 4HKQA 3VRAB 4CBVA 2PKOA 3IFDA 3CWIA 1YQ4B 2WXKA 3IAS1 4DK0A 2BA0A 3K5LA 2WXRA 5EJWA 2EPBA 2I07B 2I46A 2NTSA 3HGBA 3QWNA 5K36H 4FP5D 4K5WA 4X3TA 3D4DA 4QUCA 2JSVX 3EGRA 4PMWA 2LJIA 5KNDA 2JYEA 1Q1BA 2DLBA 4KKJA 2JXMB 2X69A 4S3SA 4ZRZA 1WTOA 1O7LA 1EY5A 3ZQ4A 1I6HB 1GUSA 1OXUA 1TYGB 2TMPA 4GZYC 5C4XB 1ET6A 1QE6A 1WTRA 1PMRA 1SSOA 1KTKA 2LFNA 1M8AA 4IKGA 1IW7C 4ME5A 4CKCA 1BCPB 1HEZE 2BTEA 2WP9B 1L0VB 5JVH3 1PGBA 2DWQA 2JA8B 3URYA 3DHQA 3TP6A 1JORA 3BDOA 3KLSA 3PUVA 1T6BX 4EVOA 2L1AA 5D7GA 2N9KA 3PUWA 2EJMA 5CV5A 4MIUA 3X3MA 5C5LA 2WXPA 5C6AA 2WXMA 3GTLB 2ONQA 2X6LA 4ZQ3A 1SE3A 3K0YA 3UI2A 1MHHE 1Y1VB 1IYVA 4DF7A 1CZPA 2PVOD 3IAM1 2QDBA 4A3MB 2E76C 1FR3A 4BA1I 4JX1C 4ZKCB 1JWAD 1HUNA 1HQMC 2G9DA 3NQIA 2R3ZA 1STHA 3PIP3 3W3AA 3GTOB 1JQ4A 1VMPA 5E4XA 5E3FA 4OO1G 5NUCA 3VR9B 4LTUA 5EE9A 2Z4IA 4ODGA 5CMDA 4G7HC 4EE2A 4YT0B 3DWAA 2L83A 4H44C 4KY7A 3C8YA 5A2QE 2VB2X 3K5NA 5ELDA 1TJEA 4X3SA 1KDBA 1LTBD 2L5TA 2WXNA 2HTME 4DK1A 2Q5WD 1STEA 2CU3A 3AM9A 3AE1B 1L4DB 1NR2A 3C46A 3I72A 4R9WA 1E0ZA 1TY2A 1SIJA 4KKIA