2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1RDPD 3MFGA 1ESFA 1PRTF 1I4GA 5TSSA 2NTTA 1D5ZC 1JCKB 1STEA 1KTKA 4O1NA 1RCVD 4RHSA 5ELEA 5ELFA 1PTOC 1LTID 1S5ED 3CHBD 3R2TA 1EFID 1LTGD 3DWAA 1DJRD 1LT5D 1TS5A 1V1OA 3W2DA 2XRSD 2AQ1B 1LLRD 5FK9C 1YN4A 4RHRA 4RGTA 1LTTD 1UNSA 1SJED 2O2LD 1M4VA 1D5XC 1I4XA 4ZYSA 1B1ZA 1CK1A 1SJHD 4L63B 1BCPB 4RFBA 4NZLB 1I4QA 1PTOH 1ENFA 1BCPC 1D6EC 2Z8LA 1PTOF 3SEBA 1TY2A 1YN5A 2QILA 1JWMD 1QILA 4TSSA 2RDGA 3BVGA 4RGMA 1CQVA 2J4XA 1L0YB 1GOZA 1JWUD 3BVZA 3BYYB 1HA5A 2XRQD 1LT3D 1HQRD 4C56C 1BCPD 2AQ3B 3BYTB 4RGOS 1SE3A 2XNAC 3MC0B 1RD9D 2QEJC 1MD2D 1I4HA 1G8ZD 4DXFA 5D3DA 1F77A 2G9HD 1ET6A 1UUPA 1PZID 3O13A 5ELCA 1V1PA 1JWSD 1L0XB 1PZKD 2ICIA 5I4DA 1AW7A 1SE2A 4Z9CB 3R2IA 1PRTB 2XN9C 1FNWA 1JR0D 1S5BD 4RGNA 1PRTC 3GP7A 5ELDA 1SEBD 4DXGA 1EU3A 4RCOA 5FKAC 1XXGA 3TSSA 2IPKD 2SEBD 3EA6A 4K6LA 4RH6A 1S5DD 3BVMA 1TS3A 1SBBB 3BZDB 2IJ0A 1EWCA 1PZJD 1FD7D 3EFXD 1PRTD 1YN3A 1FNUA 5D3IB 4BWGB 2CHBD 1AN8A 1HTLD 2NTSA 1LT4D 2TSSA 3DWQA 2AQ2B 1CHPD 2WV6D 1TS2A 2R61A 3URYA 1BCPF 1I4RA 1JQYD 1PTOB 5ELBA 1B44D 1EU4A 1LTRD 3V05A 3R8BA 1BXTA 1FNVA 3KLSX 1CHQD 1LTAD 1EEFD 4OHJA 4L6TB 1EEID 1LT6D 1KLUD 3OWEB 1DYQA 1LO5D 2RDHA 1ET9A 1XTCD 1S5FD 1FGBD 1T5XD 1TS4A 3DWPA 1PTOD 1SXTA 1SE4A 1LTSD 1RF2D 1S5CD 1HXYD 1I4PA 1KLGD 1LTBD 4UDUC 1D5MC 1TY0A 1CT1D 1V1PB 1PYWD
chains in the Genus database with same CATH superfamily
1E10A 2P5ZX 2B3AA 2KUMA 1R4MB 1I4GA 3KFUA 3CXCA 4GDLB 1B9NA 3H3VI 3RYTA 1J8IA 4A3EG 1H9SA 4HCPB 3I70A 1MBYA 3M4QA 1R9TH 2C60A 3OMGA 3I73A 5C44B 1HUMA 2N9LA 1V1OA 1FFUA 2KOXA 2K6QA 3PUYA 4H2AA 1A2UA 1BF4A 4IALA 5IYBG 1STYA 1FJGL 4DR7L 4LFAQ 2ONQA 2K28A 1HEZE 2BB5A 4GS3A 3SFEB 4WAFA 3OPOA 4ZRKA 1MHWC 4IO9A 4MSQB 3A0JA 1OEYJ 2DY7A 1XNRQ 3APDA 3I2ZA 4YWMA 1GUGA 3QOJA 4G7OC 1J5EL 1EWHA 3W5OA 5I6YA 2WGSA 4DK5A 4BY7G 2EPBA 3HFZB 1K3RA 5G5HA 4HMIA 2Z0SA 4AQYQ 1OGWA 1SAPA 5C44H 1IL8A 2BA0A 3WOFA 3ITPA 1XD3B 2B29A 5CV8A 3DBHI 1Q1EA 1LUZA 1G2TA 2WXIA 3CCEA 4RM8A 4JOIA 2CHZA 2FINB 3GS2A 3U8ZA 4KD4A 5FO9B 3EHVA 4HEDA 4KY5A 3B2FA 3Q8AA 1I5FA 2QEJC 2CW0C 1QE6A 2K22A 2I5HA 3H7PA 2D11A 2NUCA 1WH3A 4NY0A 2F3VA 1PZID 1I3QB 5C0XG 2UU9L 4ZYNA 2G9DA 3U4ZA 1PZKD 1VQMA 5EE3A 2KWDA 1HNWQ 3D4WA 3AB9A 3N9YC 2G5DA 1HR0L 1N32Q 3HKZE 4IQZA 5DNFA 3T56B 4F8CB 1L0WA 5ELOA 1XMOL 1ACCA 2D3GA 4IZ8A 4TQUS 3NRZA 5I9OA 1IBKQ 2D07B 4B08A 4GN1A 4RCOA 2CHWA 1MI0A 2SEBD 3EA6A 4JW0A 3AYHB 3CCRA 3A4SC 4HJ7A 1K50A 2IJ0A 1QWYA 2HHHQ 5BMIA 2Q2IA 1D4BA 1VF7A 4C3IB 4KGSA 1I3QH 2VXWA 3CPFA 4QL5A 4K7UA 3F2BA 5HURA 1WR6E 2J7QB 1W2BA 3SU8X 3ZDTA 3DWQA 2TSSA 5IGDA 3ECIA 1QZGA 4K3CA 1PGAA 3SR1A 3R7QA 5FO7B 4OELB 4MIUA 1C4PA 1PGBA 2ZVOA 3QWZB 2JA7B 1RLFA 2V1CC 1WIAA 1I94L 2WP9B 4FADA 4QAYA 1IYFA 2I1KA 1L7YA 2LI5A 5LMNW 2NZHA 3DVNV 3TN2A 2KC1A 4G50A 2WS3B 1IBLL 4HMJA 2RSOA 4XYQA 2Q8IB 2LUMA 4A20A 1VQAA 1KLUD 2UUAQ 1F52A 4MHEA 4C3IH 2XSCA 1EYAA 5CBAE 2LRWA 2KD0A 3X3MA 5CHWA 1C4AA 2PJHA 4DF7A 1PYBA 3PGZA 4GLXA 1G51A 1WGDA 1B8AA 2BA1A 2K6AA 2WKDA 3IFWB 4TKOB 4IOCA 3DUZA 2KDBA 1EY4A 2E74C 1HXYD 2JA7H 4A3BG 1RTNA 3AEAB 5DPWA 1QUQB 4LJPB 1DXMA 2CCZA 1H4RA 2N1WA 3KVFB 1ESFA 4K7SA 5BR8L 3EJIA 2L0FA 4JPSA 4V0BA 4AYBE 1BBXC 2X69A 4A3IG 3L13A 1KOTA 4IKGA 2WXJA 2OQKA 3Q3OC 2LJ5A 4FJVB 1KAAA 1YBYA 2J0KA 2K1FA 1FVIA 1LT5D 2VZAA 1LV9A 1ZP0B 2KDIA 3D31A 1TS5A 4BBRG 4LWCA 1RYJA 4KIKA 4A3MH 1PH4A 3AN1A 2WXQA 5IT9L 4NNJB 2B2TC 1U0LA 2FAZA 3MXPA 3MC8A 2MNAA 3VDYA 2GOWA 4B3RL 3VHTC 1JC7A 4CDFC 4JI5Q 2DZIA 2I46A 4L63B 2X8XX 3SDZA 1RRBA 1RAXA 3OJ4B 4KX6B 3SE0A 2F0PA 1UF0A 4IW0A 1MHXA 4CKBA 1MHHE 4X65L 4B9XA 1X6OA 3TMPB 5J3BA 2EYMA 4RGMA 2W9NA 4F1SA 3DHQA 2PPHA 5IODA 1A62A 5GQOA 2WWZA 1HQRD 1CM9A 1PFBA 2EY1A 1VMCA 3HOUH 4PS7A 2INDC 3TZDA 2E2HB 2NPTA 2K01A 4GKKL 2Q2HA 1UBQA 4P6VF 1VQ6A 4MGYE 4FF3A 4XT3B 1GB4A 1P7EA 3OIQA 4GLVB 4ID6A 3J81L 2LHDA 3F2DA 2DZMA 1HQMC 2L00B 5D6JB 3HZXA 1EZ8A 1KL9A 2ASBA 3J7ZC 1C77A 1S1QB 1CKNB 3BDOA 1UE7A 2BTEA 4HCSA 2IO1B 2IGDA 1LYLA 3GTKB 3Q24A 3FILA 3HS0C 1HA6A 3PZ8A 1F9SA 4YSZB 1FXTB 4OW0A 4I7AA 1WXAA 4IM3A 3ND8A 1CFMA 5IWAQ 2JA8B 3PZDA 2Q2TA 3GTLB 4HAEA 1MKHA 2E2HH 3A9KA 3JAML 4B0MA 4X3KA 2WDVB 4DV1L 1TKYA 2NBFA 2JA5G 4P75A 1VQOA 2Y0SG 1SNDA 1Z6HA 4RA8A 4GOPA 2M8SA 3AE2B 1BUIC 3Q8CA 1O7IA 4X3UA 2WAQE 1VQKA 1NENB 1N8RC 1GO3E 2L1BA 2NTSA 4S0RA 4PT5A 2D3AA 2NN6I 2L3ZA 3NVWA 5C2TB 2VL6A 3NZSA 4DV0Q 4H13C 3TIXA 3GTKH 1ISNA 5G3LF 3QG1A 1XCTL 2H5XA 3K6OA 5C3EB 5D65A 2IX1A 1LTRD 2O2VA 3CSTA 2A6HD 2JA8H 4YTNB 4JBWA 2BGFA 2DWQA 3V6CB 2K25A 4LTUA 3IAYA 1DCZA 4HJ5A 3GTLH 1VDVA 3PREA 1EL0A 2DNCA 1J0GA 2NZ1D 1F2RC 4PV1C 2KHSA 1LT6D 3OWEB 1FM0D 4EFOA 4JVZA 2EMTA 4P16A 3VTVA 1JJGA 5J22A 1N33Q 1PDQA 3U4EG 4AYBB 2JZ3B 1E7PB 1WGKA 3DWPA 3WA0A 4FVMA 3MXNB 2YU9B 2XWBB 4DKAC 3MJ5A 1NNXA 3SK5A 4M00A 1FD6A 2L5TA 1STHA 5AUIA 2CFMA 3CKIB 1BBWA 3U50C 5BN4A 1I7HA 5C3EH 4A3DG 1Q10A 4IWOA 3UGBB 4B3TL 2PZWA 1PYWD 1L1OA 5M9OA 4DV4Q 1BVSA 1WM2A 1OQQA 1E5WA 4LNOA 2NZOA 1O78A 1KTKA 5ELEA 3HG9A 3S1RB 4KSLC 5KEEA 3VRBB 3C46A 3RLFA 3QJYA 2L9HA 4JI7Q 3HOVG 1FCCC 1K8RB 3TUOA 4A3GG 2AKWB 1C4QA 3S1NB 1NCVA 4KTAA 2HIVA 2OF1A 4R8IA 1K52A 2YU9H 3ULPA 3EGRA 3CW2C 1FGUA 4JPBW 3DMUA 4DV7L 1N36L 2ACZB 5DAUA 1XLQA 2W3RA 3HUIA 2IO3B 4IOAA 1PXUA 2KCNA 3NS1A 3NZUA 4FN2A 3KUZA 3MEHA 2N9EB 5EE1A 1SLJA 5HHDG 4AOFA 2A1AA 3OWFA 3S1RH 1J7AA 5FLXc 4R1JA 3ALBA 2FNJB 2A69C 3SK8A 2KCTA 4HJ9A 3PV1A 1QILA 5CYUA 4TSSA 3CWIA 5GMVA 3ZW3A 4JI2L 1G6JA 3KH0A 2VQFL 4XIGS 1UD7A 2WXLA 3RZWC 5DM63 2E5LL 1VQDA 2XNAC 5H92C 5DLQE 2BVCA 3ZUNA 4F8MA 2AMCB 1X3EA 3K7UC 4FXGC 3CC4A 1OQRA 3Q2AC 4CQNA 2KYWA 5CV5A 1MI2A 2CR5A 1WD1A 4DUZQ 2BE5C 1BR9A 4BOZB 3KWLA 4H0LC 3CRKC 3GB1A 2AEHA 4IURA 4IFDH 3GTJB 1WYDA 1X1MA 5IP7H 2BYTA 4USAA 2IY1B 1F2MA 1JJCB 2MA9B 5HI1A 3VR3A 4B3SL 4N9F4 4JIOU 2DGYA 4RKBA 1ZXTA 2N8NA 5ELDA 2WAQB 3A8IE 5IIFA 1WFQA 2A68D 2BDOA 5FKAC 3H6MA 5BO4B 1TS3A 3PIOA 4A4IA 3KF6A 3H15A 4MGZE 5E6PA 1B53A 2NN6G 2N0SB 2JT4B 3AQQA 3K0XA 3AEEB 2A6ED 1VQIA 2F0NA 1WTRA 4GB9A 2XWJB 4A93H 2ENBA 1T0YA 2CS4A 2JJQA 1SYCA 2MPMA 1PUTA 1TZOA 5AZHA 2WDQB 3FKIB 2L12A 3UDXA 2WXFA 3GTJH 1JOKA 1LACA 4FYDA 3T1YQ 2KQ4X 1C7YA 2KA7A 1X3FA 1UGJA 5J18A 2CJOA 1PTOB 2DBYA 4QF4A 3W1SA 1RJTA 3J7AV 3L16A 2K32A 1LGRA 2KCMA 3AULA 1EEFD 5C3WA 4PZ8A 2YTVA 4HCEA 3OIPA 4GNXB 3EIVA 1HZBA 1STGA 4XXEA 3WDNA 5BYRA 1Q7YC 3OOCA 2DZJA 5TR5A 3V6EB 4GNXC 4BBSG 2DHZA 3QIJA 4W9JA 4ZCKA 2FMMA 3FKIH 4XTCS 4HJGE 1BNZA 1B50A 3HIZA 1SE8A 1G291 1TWGH 1ZEQX 2BBCA 2L0TA 2MBBB 2MSED 2JRHA 3N52A 3PIPA 3VH4B 3HVDA 3E9IA 4DHJD 1D5MC 2PW7A 3K59A 3DBRB 1TT5B 2IWHA 1E0ZA 1SMXA 2H1EA 1PFMA 3P1HA 4DK0A 5IYCH 3H6NA 2DY8A 5DCNA 2K75A 1JRPA 5K36H 3NHEB 3EQLC 1CSPA 3AMZA 3UI2A 2ICEC 3I72A 4B95A 2I5LX 2PQAA 3TS0A 2D9UA 3T16A 4HIOA 3P2BA 1PLFA 2EY2A 4AH6A 4JL9A 3M4YA 4K81A 2KC2A 4N9PA 1GUTA 3G48A 3N3KB 3JSVA 2BKFA 3TEHB 4X3SA 3KJPA 4IWPA 1STBA 4UP8A 3WAOA 5C5MA 2M17A 5T1IA 3PF4A 4GDKB 4XE0A 5AFWA 1L6VA 3NVVA 3QARA 4YHHQ 4G11A 1I4QA 5GAEC 2PQEA 1D6EC 1YZ6A 3KLRA 1PTOF 3SEBA 5A35A 4LF9Q 1MJEA 2C7MB 5KNBA 1RL2A 1F2ZA 2G4SA 4B0EA 1JE4A 5DPRA 3NQIA 4HKZE 4N8FA 5JVH3 1N34Q 3IAS1 5GXGB 2N9XA 1WFYA 5HY6A 3K57A 3PF5A 4HEA1 3HOZB 2JVCA 4W9HA 4XYCA 2AQ3B 4BFRA 3MC0B 1U4RA 1XPUA 2B2UA 1BUVT 5D3DA 2I5MX 2V4DA 2JQRB 1Q81C 3TEZA 1WR1A 3CQZB 2WXOA 3NVYA 2R92B 4DV6L 3PO3G 3S14H 3JC66 4D2KA 2KHJA 1TT2A 2JA9A 5AJ3L 3ZGZA 4DR6L 2ZEQA 2FJ2A 5JVG3 3AI5A 4MSMB 1KHIA 5LLIA 1JR0D 2CKZB 2LMCB 2ZNVB 2F1MA 4QMGA 4GN5A 4PMWA 4IC7B 3QK0A 1H9RA 4H44C 2ZNVC 4C7ZA 3L54A 1NYQA 3QQ8B 5M3FG 1QNUA 1DZ1A 2LVQA 2WXRA 1EU3A 1J7BA 4LDTD 3NBHA 1RFAA 3TSSA 2IPKD 2XK5B 4X62Q 3HOZH 4DR5L 3HVZA 5KHQA 3LWEA 3C2PA 3CQZH 2X6GA 2R92H 3H1UA 2OT2A 2MO0A 1E7ZA 4GLAC 4IJHA 2RA4A 3VAWA 1LT4D 2F4VQ 3CC2A 1NBWA 3SHQA 4KGTA 1E8YA 1YEZA 1V81A 4C3HB 2R61A 2JA6B 1PQSA 1WF9A 1IW7D 2G1EA 2MCNB 5IYDG 3V60A 1I42A 2HD5B 1EUVB 4UP7A 4R4TA 2X6LA 2BS2B 1NDDA 2WQYB 3N1ZC 3I91A 1BO0A 3FKYA 3Q3NC 3AFPA 4HRSA 3MFYA 3TBLD 3J81j 2WP8J 3P63A 4GGQA 4HCNB 4LF5Q 2HJ8A 4M02A 3TDQA 1VQHA 4FXDA 3P42A 3TL5A 1ZKOA 1R7SA 1ILQA 2KBNA 3DVNU 2SDFA 1JE5A 2VUMG 1N60A 1AE2A 4NAWB 4TUUA 1ET9A 1Y8PB 5DPTA 1FGBD 1K28A 4OWTB 4A3CH 4C3HH 2JA6H 4QIWB 5E7NA 3M3YB 1NJIC 4B3SQ 2KVMA 1N5WA 4EQNA 3GDEA 3VYSA 4V190 3FAHA 2LVPA 4LFAL 3PMFA 1ZUD2 5EKLA 1WSPA 3L08A 2MWSB 3I4OA 4HIKA 2B63G 3K80C 2EIFA 5C4ZA 1XNRL 1KAWA 1WCMB 1TKWB 1TIID 2K14A 1PH3A 3CAMA 2K6DB 2D0PA 3AEDB 4ME3A 3STBD 4ZRQA 4FF4A 4WWMA 2W54A 4JGHB 1YQ3B 2ID0A 4LNIA 3UDIA 1E90A 4AQYL 2O6VA 2WXMA 4E71A 2MBHA 1F0ZA 3M3YH 3A1QA 3ZIMA 2HD3A 4IUVA 1JW9D 1R4MI 2F0OA 3ZTDA 4BXXH 1XPRA 4JE3B 1WCMH 4G7HC 3ULLA 2KX3A 2G4DB 3GE8C 4NJ6A 2EELA 1WWTA 3PRZA 3CCQA 1YIWA 1HNWL 1P0RA 3ZNHB 2PI2E 1N32L 1AP0A 1L0YB 3BVZA 1CMXB 3KLSA 2B2YA 1KRTA 3P4QB 3Q6BA 5EBDA 1QOGA 1W6KA 3GTOB 4TV3A 2Q8RE 2EY5A 1B9MA 3TEYA 3V2TA 1IBKL 3PCOB 2FFKB 1GPXA 3NK9A 1VQEA 1F2YA 2D3BA 2JYTA 3RNUA 2RHQB 4A3LH 2OQ0A 2EXZA 1IBXB 2HHHL 3WANA 2C5CA 4ZKCB 5M3MB 4Y7NB 4HJAA 3D8GA 2MRPA 4MJSA 2XN9C 3IAM1 2A4ZA 1WRDB 1EQQA 5CBEE 3GP7A 3T3NA 1PGXA 1EYCA 2LKVA 2DX5B 3SD5A 1MJDA 5IGFA 3GTOH 4RH6A 1A2TA 3BVMA 2UUBL 3I4NB 2KQ7A 3DDCB 4P1CC 1II3A 2ES2A 5EJWA 1TWCB 1PRTD 4QB4A 4JI4Q 5EDSA 2LFNA 1F9JA 2KDFB 2L05A 3SGIA 4BWGB 3T4AC 1DOIA 3I63C 3L0WB 1HTLD 5M3MH 3MXUA 4KY6A 4Y7NH 2UUAL 4F7ZA 1TKGA 2E8GA 4ILWA 1OEYA 4Y52H 1FCLA 3U9OA 4JI8Q 3SR6A 2CKHB 4K5XA 3B9JA 3IFDA 3K8AA 4F87A 2QHOA 3FP9A 2KKCA 2KDEB 4RWSC 1CHQD 4DUYQ 2OEDA 1G91A 3H91A 4DV5Q 3I4NH 4L6TB 2MJ3A 2IW3A 5JOBA 1U4MA 2LUEA 2ZVNA 5EPLA 5FLMG 3T51B 2V3SA 2CQAA 2RR9A 5JHBA 1TWCH 5D14A 3Q8DA 3ZNGC 2MHVA 1ILPA 1E7VA 4LUZA 2BH8A 1SB3C 2PVOD 4BKTA 4R8NA 1LTSD 4DU9A 2UUCL 1FEHA 4II2B 1I35A 4L5TA 3M3JA 1BQQT 1CI3M 3FPUB 2HDMA 2W55A 4CJ1B 3E0EA 2BPSA 1Q1OA 1GUAB 4JI5L 2JSVX 3NBIA 1OTRB 3R2TA 2JYEA 1Q12A 3DWAA 4N59A 2JRIB 4DV2Q 4NKLA 1ZW7A 5KYIA 4NJ7A 1OXTA 2LXJA 3I3CA 2GBJA 1KRHA 1XJVA 1M90C 2RF4A 5C44G 2O2LD 2FCMA 1WM3A 4C3JB 1E8WA 4K14A 4PG3A 2MEKA 1B4OA 3E3XA 4L5QA 2W3SA 2PZUA 1Y1VB 3UF8A 3Q8EA 1Q0WB 4RF0A 1SNCA 5HGQA 2RDGA 3DBLB 4LNQA 3GOEA 1IYUA 1H9SB 3Q22A 2LXCA 1GOZA 3PO2H 3W1YA 3BZCA 2JEAI 2L32A 4L1BA 1V1QA 1J7CA 3DWGC 5C6AA 1Q90A 4AS1A 3EUB2 1ZXIA 3KWVA 5IWAL 4C4VA 4C3JH 2GN5A 4NPSA 2B3GA 1EOVA 2KQ3A 2F0LA 2A68C 4CDCC 5IA7A 3TS2A 3KJOA 5A2QE 3UINB 3S24A 1MJCA 1EQTA 2L8JA 3L10B 4KN4C 1SNOA 3ONAB 4RKLA 1Y1VH 2A6EC 2EYFA 1WTQA 2GRIA 3OLMD 3RPFC 3TP7A 3S1QB 1SF0A 2FIDA 2QSDA 1T6BX 2MJEA 4DV0L 4LFCQ 1U4PA 2R6GA 2JZZA 4AJWA 3B6YA 4P73A 2UXBQ 3U52E 1ZPSA 1HNZQ 4H02A 2D10A 2WX0A 2IDYA 3CP0A 1TKEA 4W9KA 3BZDB 1P9DU 1HJPA 4JOIC 3HOXB 4NMZA 1JWBD 5BN5A 1KRSA 2WDTB 3DHIC 1MG8A 4RF1A 3VXWA 1FNUA 4QGUA 2WU5B 1Y8NB 2CHBD 4BS9A 2NCNA 4BKGA 1AE3A 2OXPA 4A3EB 1Z5SB 3H7PB 5AZFA 3U7ZA 5FLXL 1EIGA 1J6QA 1N33L 1PH6A 3KUPA 3S1QH 2QDLA 1IPGA 4OIJA 2GLSA 1JQYD 5HG2A 2GVAA 1LTLA 1E24A 4US8A 1T0RC 3VYUA 3V05A 1HE8A 2F0SA 1Y8OB 1LABA 1SMYD 3IRBA 2JXTA 2HQLA 4DHJB 2EMSA 2JA7G 4DAMA 2KFKB 4DV4L 2EYPA 3PHWB 3DEOA 3G7LA 3HOXH 3NEMA 4XDDA 4G0NB 4C00A 3PGEA 4WJQA 1A3TA 3IL8A 3VRAB 2IT1A 1K83B 4JI7L 4BY7B 3NTIA 1SE4A 1MPEA 1MGSA 1SNQA 3R3OA 4JBMA 1FFVA 3VR8B 4B6WA 5EKKA 1CA5A 2KENA 2UXDQ 2CHXA 3ETRA 4RMAA 3NWSA 1VLBA 3A56A 5CTRC 1F2RI 2OHFA 1KABA 3J80i 4A3MG 4ACFA 2RPVA 2UUBQ 3PRPB 4KI0A 3H09A 1JCKB 4KJOA 3BS1A 4TVAB 4B9WA 3PRMB 4DA2A 1LTGD 3PHXB 2R2OA 3AU5A 4IG7B 1K83H 3LJ3A 1XNQQ 3C1FA 2XRSD 1YNJD 3ZTCA 3M85A 1WX7A 1ZGUB 4HDOA 1X3QA 1UNSA 1IHZA 4PMCA 4J3OD 1SR3A 3M7NA 3W5VB 4POFA 1V9JA 4ZYSA 5L83A 4LF4Q 3L3OC 2PMZB 3D3RA 4P72A 3BJUA 1ENFA 2A8VA 3HOUG 2YYZA 3LWUA 2EE1A 2DAFA 3S1MB 5GROA 4AUQC 1ROEA 2K9XA 4DUZL 2DENB 3DM1A 4XC2A 1N62A 2IO2B 2L83A 5C0XH 4I6LB 1EM7A 2AWTA 2LSSA 1N6ZA 2F0VA 3ML8A 3D6CA 2UUCQ 3ZXRA 3CPWA 2D62A 3J80E 1NVID 4B3MQ 2WINB 4QQBX 1RM6C 1T0QC 1WI0A 3NJTA 2XTIA 5C4JB 1I4HA 1RFKA 4LDTB 1GB1A 4ICUA 1DOMA 2MJ8A 1KJTA 3HOYB 2LHEA 1A63A 3HKZG 2FMCA 1JWSD 4K6DA 3NUCA 2KMAA 2K50A 3U30A 2Q8TA 5I4DA 1H9KA 4JI6Q 3ZO5B 3S1MH 1K8OA 5EBCA 4JWSC 4LK1C 3EECA 3X3NA 1DD2A 2B2WC 4YWLA 1X55A 1UZXB 3BY4B 4DQOC 1Q3LA 1EUJA 3RNCC 2RQXA 3T1YL 2O6VD 4K3BA 4PNYA 1C76A 2KJHB 4ABNA 3E9SA 2YLMA 1VQBA 2MP2A 4TQ0A 1IW7C 1IGDA 1P98A 4CYEA 3RD2A 3ENEA 5CV6A 5C4JH 1DONA 2RCFA 2N4FA 3VR5A 2UXCQ 3GV6A 1D3ZA 1F9PA 3HOYH 5L95C 2RDFA 4FLHA 4X57B 1JOOA 5D3IB 1IZ6A 3UIPB 1TQOA 2ZXOA 1AN8A 4A3IB 2NPTB 1S40A 4WJ4A 3TMEA 2K05A 4US9A 2KTRA 4C7YA 1N5XA 3M9BA 2MFIA 2L1AA 3CC7A 1WTHA 4YY3L 1AYFA 2NMQA 2KHIA 5GAHC 3OSOA 1Y56A 4CHKA 4BBRB 3RNGC 2Q5WD 1B44D 5AEKB 4R3DA 1OXSC 3R8BA 3H3VH 1SSNA 3IHPC 4W9LA 3MVVA 3ZKJC 2JWUA 4MTNA 2LVOA 2ZPNA 5LXIB 5JPMC 5IKCM 5C3EG 4EZLA 1YJ9A 4NQLB 1A15A 4XDCA 2F03A 3DBHB 3NZ3A 3P4SB 1KDAA 3GTPB 4YXDB 2K5WA 2NVTB 1XTCD 3A9KB 4M0WA 4YL8A 1WZ3A 4IPDA 2DJGC 2F0IA 2KQSA 2IY5B 1L5PA 1VQCA 1J9OA 4GOPB 3RN2A 1GJXA 2JXMB 4IJLA 3STBC 2K8CA 3E56A 3QJZA 1I4PA 2RDBC 2ZJQA 1LTBD 4BBRH 1UWXA 3F2CA 4AYBG 4JI0Q 5HKHA 3DPDA 3BU2A 4XWTA 2CVRA 3TP6A 1EF5A 4OL7A 2FUHB 2WXHA 4E3CA 2M2LA 1F9QA 5EPKA 4IM0A 2O2VB 4YHHL 1I6VC 1EY6A 2K3UA 4HPPA 4C80A 2N9PC 3GTPH 2RSNA 4LF9L 2NVTH 2LGIA 2OEOA 3HP3A 3TEWA 1LLRD 4FP5D 1HZAA 1I50B 2VB3X 2CJNA 1N34L 1BT0A 1YQ4B 4YTPB 1TU2B 2LRUA 3ABVB 4FXKC 5KYLA 4LJOB 1MSHA 1YVCA 3I4MB 4A3KB 2BKRB 3VR9B 3K5LA 1UE5A 4PZ6A 4BAXA 4XZ4A 5JXVA 3CMEA 1QT9A 1GHKA 4GZYC 4DWFA 4AWJA 1SYGA 1PFNA 1S4ZA 4S3SA 1FXIA 2LJIA 1JWMD 2Y0SB 3PSIA 5CGKA 5IP9H 3X0WA 4KLKA 1AH9A 2IY0B 2HQEA 3P1MA 3NE5B 1I50H 1DM0B 2J53A 1BCPD 5IP7G 3ZVVA 2N9KA 1YJWA 3N32A 1JT8A 3I4MH 1KF6B 4A3KH 4RMFA 4X62L 2DJFC 1WGHA 2PYKA 1XQQA 2OCEA 3O13A 2MGSA 2LGYA 1C1YB 1S72A 1X32A 4BOSC 4LAAA 3U2SC 4GMVA 2NB0A 2KLCA 2AUJD 4YT0B 1PRTB 4MT5A 2HDLA 2Z6KA 2A19A 1A3VA 1P8LA 4FF1A 2M0XA 2WFWA 1IYJB 1PRTC 4A93G 2F4VL 2C5LC 2RD0A 3DVGX 1VCIA 2ZTEA 2D3CA 2DNEA 1YIJA 1LM8B 5KHOA 3OG5A 1C48A 4K6LA 3W1BA 3S1NH 3KYCD 1V2YA 2WACA 2K4KA 1YHBA 4OZBA 3A7LA 3OTOQ 2WAQG 4A3DB 1SRUA 1IXRA 3V96A 3U7DA 3GV3A 1YJ1A 2ZJRA 2MQJA 4LF7Q 3M62B 4LF5L 3ONSA 1WJUA 3ML9A 1BMLC 2KJRA 4FHKA 2C7NB 2G3QB 4YCUA 2BT6A 1P16A 2NVXB 3HOVB 1DOYA 5GADC 4JYAQ 3VR6A 2Y5CA 1YHQA 2GMIC 4GIVA 1EYGA 4KSKC 4DR2Q 1TGZB 3FKIG 2LXAA 4ZK9B 5IGGA 1PH1A 3DOWA 2EKIA 1JB3A 1T3QA 2YTYA 4KKTA 4A3DH 4GKJL 1JROA 2RCNA 1HRJA 4ARCA 1PH7A 3KF6B 5NUCA 1E1OA 5G55A 3D0FA 5K36G 1K8GA 1C78A 4HPLB 2NVXH 1UAPA 3EN2A 4LF6Q 4MN3A 1TYGB 1OFFA 2KVZA 4K5WA 4HXDA 3TCAA 5CV7A 1XWEA 1S5CD 4LMQD 2REXA 4IPHA 4N8X1 3MC9A 5BYQA 2LGXA 4DR3L 3H0GB 1KM7A 4ASWC 2XBBC 1PRTF 3C19A 2NS5A 1TIFA 1D5ZC 3RNFC 4DBGA 4F7XA 5C4XB 1KNAA 2KN5A 1XLOA 3PQIA 1ML0D 1PTOC 2KTFA 2KEDA 3CHBD 2SAKA 3I57A 4ZUJA 1KIXA 2V4IB 3W1SC 4WWOA 3KUDB 3H8HA 2QEXA 1DJRD 2D2QA 2RVLA 4BA1I 2JK8A 1HFGA 1R4QB 2AL3A 2GBRA 2FBWB 1GG3A 1CTMA 3B08A 4YY3Q 4WJ3M 5IO9A 2ZXRA 2K5DA 2A74C 2EJFC 1KC8C 2DN8A 2Z0DB 4IDIA 2E75C 2MUYA 2IHEA 2K5QA 1YMHE 2MQHA 4CKEA 3H0GH 2R2QA 3ZNZB 2EYJA 1BDOA 3NUHB 1PTOH 1N9WA 4F88A 1YNXA 1T9HA 5C4XH 3PUVA 3Q3MC 1IKLA 2K5VA 2YTXA 2Z8LA 3PUWA 2VQEQ 3B1LX 2M1MA 2CW0D 1QZHA 2F3WA 1Q8IA 2K5NA 1A6XA 1KD1C 1ASYA 5H8YE 2JQOA 2O5JC 4DK6C 4E74A 2KCCA 1M1KC 4JBKA 2BWFA 2NWGA 2PQAB 4CBVA 1UE6A 4QIWE 1HZ5A 3HOWG 1CZGA 1E3PA 1OXXK 2M0AA 3JW0X 3BK2A 3PLVA 5JJIA 5IAAC 4C56C 2JP1A 3NP8A 1SE3A 3V3XA 1GVPA 4DAYB 3JSVB 2HT1A 2PE9A 1ESRA 1XCQL 2QF7A 3CSFA 4HVBA 2PKOA 1L0XB 5I6WA 1NE3A 4KHVA 4QUCA 4Q2JA 2NN6H 2GBNA 3KK7A 3AU4A 3KF8A 4JI4L 4OZCA 4IFDJ 3ZJUA 3K9OB 4BBSB 2BQQA 3UI3A 3AEGB 1X9NA 2R92G 1VQ8A 3WAPA 1OTCA 1EFWA 1SEBD 4XDXA 2NVQB 1TWHB 2GBMA 3AE8B 3Q6SA 1QB5D 4JI8L 1SROA 1XXGA 1TWAB 1C3TA 4KDLB 4WFN3 2WXNA 3MWYW 3L7ZC 3SHLA 5CC4A 5LMUQ 1G6PA 4MM3A 4O2DA 4DUYL 1EWIA 2N88A 4GN3B 4DV5L 1Y8RC 4GDKA 2JZPA 4WQMA 1UE1A 1VQ7A 1CKMA 1SMYC 3P75A 1JRUA 3I55A 1V8CA 1XMQQ 3OW7A 1Q86C 4BBSH 4A90A 4K8JA 1XEEA 5EKIA 1WMHB 2DZKA 4PS8A 4WQOB 1SNMA 2IX3A 3VUXA 2ZCBA 3K5OA 2YV5A 4KKSA 4JI1L 1TWAH 3M95A 3GO5A 3NTHA 4A3CG 3K7AB 2ZZPB 3KBXA 1LTAD 4C3HG 4E6IA 4W9CA 4OGQC 1AEXA 3OMCA 2CWPA 1WTWA 2H88B 2HTME 4BVUC 2TMPA 1MIUA 2EOTA 2JY6A 4HPMB 3NBHB 3J9CA 2F0QA 3CIRB 2QKIC 4OVUA 5IGCA 3DQVA 3UIOB 3RZOB 2V3NA 5CMDA 2XGTA 4ZDVA 1QLBB 4EEWA 4DV2L 2ZTCA 2F0EA 5IE8A 4EUTA 1CUKA 1VZ6A 5BMHA 1WXVA 1O7ZA 4UDUC 4A3JB 3FC4A 1G6ZA 3RZFA 4NXMQ 1WTVA 1V1PB 3I5JC 1GJZA 2K04A 1YNJC 1HZ9A 3K7AH 4LNNA 1PFDA 3W9CB 4IUPA 2XK5A 4RHSA 1EY9A 2CQOA 1K9MC 3RUIB 3J7YW 4UPAA 3VA7A 2KLGA 2FCSA 4MDKE 1EFID 5G2NA 3D6WA 5ISRA 3PO3B 2J0JA 4BXXG 2X38A 1YJIA 1YJJA 1AZQA 2L0CA 2CU3A 2QCZA 1ZOYB 1STNA 1YN4A 1HHVA 2M00A 1JJ2A 4K8IA 1VQ9A 3E6ZX 4A3JH 5CR3A 2LD9A 1M4VA 2HCIA 5DM73 4REZA 2BYVE 1U4AA 5M3FB 1R4PB 1J19A 3GQBA 4RG1A 2E2IB 1YHAA 4N9TA 4NZLB 3DBSA 2KECA 1K0SA 4DR1Q 2RBMA 4PQXA 5KRUA 2B8GA 3RMHA 4GKJQ 1IYVA 2M19A 1R4NI 3J81i 4OXPA 4CDDC 1GC7A 3PO3H 3K81C 2BYFA 3FMCA 3IFTA 4A3LG 4BKSA 4NAWA 2GA4B 4A55A 5IT9E 2PO4A 4ALPA 1X3GA 4JWUC 1WJ4A 1YNND 2J0TD 2O6VB 4LFCL 1O7YA 2N78A 3MXGA 4C1NI 2WB1B 4DXFA 4DR3Q 2E2IH 1IGCA 2UXBL 4I6NB 1E8XA 1HNZL 2MBQA 4N6EB 5HFYA 2M9VA 3JAMi 2KMMA 1FXAA 3RLNA 4DDID 1C9FA 3AEBB 5LL6S 3ZJVA 4KHPQ 1V86A 4IUNA 4ZAIA 3GZNB 4J6IA 3DBLI 1NUCA 2AX5A 1FNWA 1V43A 2VUMB 4GLSC 2IGGA 3WAMA 2WXKA 3EVQA 4J6HA 2C7HA 3DVGY 3FHWA 5M3MG 3I4LA 1XPOA 2XIWA 1F1HA 2EVBA 5IYDH 2IO0B 4DV3Q 3U58A 1WGGA 3APFA 5J2RA 2N7EA 3M7GA 2GVBA 4A3FG 3A55A 3G6JB 1D8LA 1L0VB 1Q5WB 2JU6X 1EY8A 4OO1H 2RHSB 1K8AC 1EO6A 2D2CC 2CWAA 3J81E 3AE1B 3I4NG 2AQ2B 1CHPD 3CCJA 1TS2A 1WI5A 3MHZA 5DEHA 2KT7A 4WJNA 2DYBA 2VUMH 1WGYA 3EFCA 2IL8A 3N6RA 1HPCA 2G45B 2B39A 3KBGA 1BXTA 1GUOA 2UXDL 2KEEA 3RD4A 1KXLA 5T8IA 4EZKA 2OTLA 4X3TA 1JOQA 4RNAA 3PIO3 3JAME 3A5UA 3VUYA 3OHXC 1DYQA 1UGMA 3S16B 5BYSA 2Y5PA 2L15A 2SNSA 2INCC 1TS4A 1Y1WB 3BWUD 4KHZA 2HIXA 2A6HC 1C8CA 5JJZA 1NMGA 5LMNQ 1WJJA 1XNQL 2YVCA 5AUKA 2L7RA 1CKOA 2KN4A 4ANXA 2R93G 2AHOB 1UEAB 1AFPA 2E3TA 3MFGA 1WTXA 4W9EA 2M4NA 4X64Q 2RMMA 4MACA 4XX5A 3G71A 4O1NA 4LF4L 4HSPA 3S2HB 1QZEA 1XLNA 2VZKD 4AQ7A 4NB3A 4BY1B 1QQRA 5D94A 3W3AA 1UWVA 1ZYRD 2K33A 4W9DA 4KY7A 3S16H 2ZJDA 4DR4Q 4K2KA 3QHTA 1HTOA 1Y1WH 2IYDB 3A9JA 5C1ZA 2XVSA 4LFBQ 2A69D 1QCBD 2B2VA 4IWQA 3TJPA 4WRDA 1BBUA 1B3AA 4JK1C 2L55A 3LB8C 2Z4IA 2WIIB 5C3XA 2L4NA 2WLBA 1KQSA 5IN7A 1B1ZA 3PIP3 3PVLA 1E2WA 4JX1C 4JI1Q 2HE7A 4JV5Q 1BCPB 1QVCA 3PO2G 1LXDA 4B3ML 2PPBC 4X66Q 2KOLA 4Q5VA 3TRZA 1KLVA 1BCPC 1TR5A 2ASQA 2D5GA 3S2HH 3NSWA 4I7ZC 4FJZA 2R7ZB 1IBMQ 4BY1H 3W5UB 4NXNQ 3T9LA 4ITKA 1SYEA 2N55A 3FPPA 4C3JG 3GTGB 4JI6L 1VR9A 2BYEA 4EQPA 1Q1BA 2WHIA 4FHJA 4O0AA 4HLEA 2VNUD 2J0MA 3PO0A 3ZXVA 1PMRA 2PEAA 2XRQD 1Y1VG 3WWVA 3KDFA 1Q82C 3BYTB 3GTMB 1FMAD 3C8YA 5F2DA 1YX5B 5CX3A 1MD2D 3QWNA 3G6EA 3RFZB 4LF8Q 1F77A 3NS8A 2RKSA 4UAIA 1UUPA 1VQNA 4KKIA 3A7AB 2OOBB 2R7ZH 4POGA 2UXCL 4CDEC 2AL6A 2V4LA 1NI3A 4LLGM 2EKEC 1EY7A 1EQVA 4ANUA 2LGSA 5C3JB 2H89B 4YCVA 3GTMH 2DAJA 3VQIA 5KNCA 3HHMA 2PMZE 1PYSB 1VD2A 1U5KA 3G4SA 1UH6A 2C9WB 2PI2A 2OWOA 1GUNA 4DAVA 4QJFA 4WJOA 5JEAH 4C4VB 4LUVA 1VS0A 1KNEA 5FLMH 1FO4A 2H4OA 3UDGA 3J80c 5BMGA 3URYA 2J7ZA 1BCPF 2EJMA 3HOXG 1X54A 4FBJB 4GDLA 5FR6A 4EE2A 1GKHA 2EY6A 3MTSA 1CSQA 3QIAA 5ELBA 2KACA 1T5EA 2ZM6Q 3VUWA 4OIKA 1WJNA 2F0GA 1D7QA 4G3XB 4KV2A 4JI0L 4P7IA 2LXKA 1FRDA 4DGZA 3SDLC 1VQGA 3Q3FA 4XQJA 3FVQA 1S5FD 1T5XD 4P74A 3IXSA 4OX9Q 4P1BC 4L8JA 4HK2A 3SXHA 4GU2A 5JAVA 2ZCCA 3LDZE 1QF6A 1GUSA 1DGJA 3DHGC 3QA8A 4ZUIA 3NXWA 1HZ6A 4EGVA 4ZQ3A 4C3IG 1RIPA 5FJ8H 3RN5A 5E3FA 3E0JA 1LFDA 1HTPA 1NR4A 2WKCA 4AP4C 2JYOA 1HCZA 3RNBC 3W1GA 3GD7A 2JF5A 3IBEA 3Q8FA 2MBEA 3PSEB 4WH4A 5EAYA 2E76C 1JB7A 1WY8A 3HK0A 1S3SG 1HFNA 4HROA 4ARIA 2QW7A 4WORA 1GXDC 4TMAB 4BZAA 2KMCA 4RCNA 2VH2A 5IY0A 2M56B 4A3EH 2PE6B 1D5XC 5COYA 4NQKE 3AEFB 1B70B 4IUUA 5KIXA 1WE7A 5LHY1 1U4LA 4KKJA 2EQSA 3ZQ4A 1VQLA 4JI3Q 3ER0A 1BOSA 4JG2A 5IYBH 1M94A 2JWZA 1TY2A 3AB5A 1E8ZA 3PTFC 2KFKA 1PH9A 2QILA 1SN8A 1F9RA 1Z47A 2MP1A 1K73C 3APCA 4MELA 3BVGA 4C2MB 3L9AX 3F2UA 1P3QU 4MGIE 2J4XA 4KJNA 3BYYB 3T1HQ 4YCWA 3MHBA 2F0HA 5JPNC 4A3PA 4BY7H 4K0KQ 1SGHA 1WZ0A 2LY7A 5C5LA 4IN3A 3WOEA 5JEAJ 2G9HD 3AXCA 1NR2A 2CH4W 5ELCA 2HTHA 3AE5B 3VVWB 2JUOA 4DHZE 3OTOL 4K2LA 2MW5A 3S17B 2ALYB 5KNDA 1NMFA 1VQ4A 4LF7L 2QJLA 3D4RA 3K5NA 2QMTA 4OONA 1HH2P 4R4OA 1ENCA 3HOYG 4C2MH 3ZNID 1L2FA 2MO1A 2JPHA 4JYAL 5JZEB 4WJPA 1X3PA 3VTWA 3UQBA 5CV9A 4UHVA 4DR2L 1Z7TA 4HJ8A 1VF5C 2EDGA 1XYIA 4XGAB 3R7RA 1KDBA 2OTJA 1SE9A 3FRPB 1FPYA 2Z1CA 3ULJA 4DPGA 1HNXQ 3S2DB 2PMVA 1XTDA 3ZRCA 1A3UA 4A3MB 4NJCA 3DHHC 4KIKB 1H8CA 3AE3B 4L5SA 4IUTA 2RSUA 3AE9B 2R7FA 4DNRB 1A8VA 3S17H 1QUQA 3BG3A 2Y0SE 5E4XA 1RODA 3R66C 2ZPYA 4IFDI 4XYOA 3CCMA 5EGTA 4LF6L 3HKSA 3ZJYC 4BKSD 5LXHA 2FCNA 4IUMB 3MAQA 3J7AF 3K0YA 1L6UA 2UYZB 3MP9A 4OHJA 2MLBA 3IVFA 2QGQA 3NWTA 5BN3A 1TVXA 4J15A 2R7DA 1EEID 4MNOA 3S2DH 1TBEA 1O7LA 4U673 2K39A 2B2TA 3MHSD 4N58A 1VZ8A 4YWGG 3ZRFA 4A3BB 2PZTA 4C1NK 2MP2B 4J1MA 3H3VC 4WURA 3RUZA 5E6NA 1QOBA 3HOUB 2KO3A 4FXCA 1K3BC 2FXQA 2JA8G 1MFWA 1Q46A 1V80A 5JJKA 4KGRA 2B2WA 4APVA 1E7UA 3VFKA 1JICA 2BOSA 1KLGD 1N61A 2KTRB 4ANWA 1RDPD 3NTKA 3HM3A 2NTTA 3ICEA 5J1ZA 1TZ1A 5IOIA 1LTID 1S5ED 4ME5A 5LL6X 5CHFA 3C0RB 4A76A 1DOKA 4A3BH 3FILB 3AFQA 3I90A 3LXFA 2D5DA 1WGRA 2VQEL 3HKZB 1V6EA 1VJKA 4A3OA 1SSOA 1WOCA 3W2DA 4DNTB 3RNEC 3Q0AA 3RNAC 4KK7A 4RGTA 4A3IH 1WXMA 3AE7B 2KWVB 1VMPA 1ZKHA 4M0WB 4L2YA 3E5SA 5IP9G 3RLOA 5EE9A 1I4XA 2A5UA 1D2BA 1VRAB 4DNIA 4GOPC 1CKNA 2CH4A 3Q8BA 1CQFA 1FL0A 2JSOA 3QX1A 3UQAA 4GN4B 2PW9A 1YNNC 2A73B 1MG4A 3I4MG 4FA6A 4A3KG 2J42A 2JX5A 5FO8B 1FJGQ 4DR7Q 1NEKB 3A33B 4DHZB 5C0XJ 5D2MB 1C0AA 3RI7C 4DK3C 1V5OA 1SYFA 1JWUD 1QOAA 1IP9A 3ZJTA 3I3TB 2K7VA 4WIPA 1VQFA 1YX6B 3DXJC 1J5EQ 1H95A 4B9KA 1OXVA 3GE3C 4MEMA 3DBRI 3WALA 3ZLZA 1KFYB 1TWFB 2JE6I 3C1EA 3SFDB 5LMUL 2ICIA 1PA6A 2ZW1A 4JC0A 1C79A 1E6EB 4XWWA 2L52A 1OQYA 4JBJA 4KDIC 5DPSA 1XMQL 2K5PA 1L1OB 3FDTA 2RGFA 4DXGA 2JA5B 4DDGD 1L1OC 1PVOA 2I1JA 2J52A 2FE8A 2HUGA 3SVMA 4A6QA 4HDQA 1GC6A 3P20A 5CV4A 2BS4B 2LGDA 1O80A 1WYGA 4OVVA 3H9DA 3VDZA 2UU9Q 3M4OB 4HIDA 3ND9A 4IFDG 1WX9A 4JCVE 5IP4D 4W9FA 3MXNA 1XX8A 1TWFH 4AIMA 3DLLA 4LJZC 1HR0Q 5M5YB 1L4ZB 1WXQA 1YN3A 1KDCA 2O4XA 1ZXHA 3BIID 3OAWA 1K51A 4WWNA 2K0PA 1XMOQ 5GAGC 5C4HA 2BW2A 1FIQA 4CJ0B 2Z0EB 3KYDD 3N20C 1JORA 3P4RB 1F2LA 1I4RA 4OWWB 3CCSA 4FJYA 1SYDA 4JQWC 3A74A 3AECB 5I9PA 2JA5H 3NOBA 2BDNA 2MJDA 1GM5A 1MVKA 2IGHA 1HZCA 2F0MA 1FNVA 3IKJA 1LQBA 2Z6KC 4CGYB 4NXML 1X65A 2F0UA 3M4OH 2EYLA 4PS3A 3Q23A 5M5YH 4EZJA 1VZ7A 3LX0A 4IM2A 2N1VA 1V97A 2VZKB 1S3OA 5E6JA 1SDFA 2I07B 1Z2MA 1I94Q 1IUEA 1BKBA 4MZ9A 4ULLA 4KZ0A 1L2NA 1EY0A 1RF2D 3TP8A 3B2GA 5I2YA 2V0GA 1ZYRC 3MEFA 3QOLA 2FCQA 2PTLA 4NPNA 5AZGA 1PFSA 1IBLQ 5EPJA 2LFIA 3H94A 4KKUA 1Z9FA 1ASZA 5LNK1 4YIJA 4A3GB 5TSSA 3OW2A 2F0DA 2LWPA 4XQNA 2HCCA 4R4QA 4YSYB 2K5HA 4IPGA 4QCLA 4WWPA 4HR7B 2N49A 3AU7A 4L23A 1NYRA 4WJWA 4RAUC 3TQYA 3H0GG 3RCZA 2PW5A 4DR1L 3IT4B 5IGBA 2JXXA 4R9WA 5C4XG 3PS6A 4K1RB 4ZOHC 1EWYC 4OZAA 1VQJA 3NG0A 1YITA 5IYCG 2DLBA 4IPCA 4OWXB 5M5WB 1K8MA 2NVUI 4JLCA 2XEWA 3AMUA 4A93B 2YEPB 5BR8Q 1ZDVA 3HOVH 1TJEA 3IG3A 3R93A 5KGUA 1SJHD 1AARA 4O42A 2QC8A 4A3GH 3KUCB 2K03A 2KHWB 5A2QL 3D4DA 4PYZA 3VR2A 2KWUB 1YN5A 3WCQA 3U4VA 5CORA 3LNNA 1GD7A 3TEXA 2K52A 4KHPL 3TREA 1VQPA 4ODGA 1VCBA 3CF5A 3PUZA 1CQVA 4FDBA 4B3RQ 1YNTE 1B3QA 4IOIE 1LT3D 3X23A 5M5WH 3AH7A 1QOHA 2QIEB 3R3MA 3CMAA 2C35B 3PUXA 2N7DA 4ZHOA 1RD9D 1NSNS 4MH0E 5J17A 1G8ZD 5ELNA 1Y69U 1ET6A 2LASA 1TWGB 4DV3L 4ZLTF 1LM0A 4X65Q 3QC8B 2C9OA 1WE6A 1AW7A 4KV6A 1SE2A 3R2IA 3L4PA 4HKQA 4GNXA 1PV4A 3AM9A 1V8QA 2KAJA 5I2XA 3NPPA 4GKKQ 5T1GA 1E22A 2NBWB 3S9WA 1PHJA 4MH8A 2WDRB 4S17A 2NR2A 4OO1I 4CHTB 3H7SA 4DAPA 1K0RA 4EX5A 3CD6A 3GZNI 2WX1A 3JYUA 5IT9c 2YEPF 1JWAD 2NYZD 3DM3A 3HOZG 1B7YB 4FNFA 1U9RA 3CCVA 2INPE 2EZVA 1EY5A 3KF8B 4NW2A 1EU4A 4W9IA 5LMNL 4UY8C 1GHJA 3I8ZA 4KMUC 1E9MA 4DV1Q 3KLSX 4TKNA 2LS01 1E0BA 2WB1E 4G4KA 2MH7A 2BF8B 3QAQA 4X64L 1WD0A 3TZUA 1N63A 2KANA 1LO5D 4DAYA 3I56A 1DOLA 3KQ4A 2FHTA 4CO7A 3L2PA 2R3ZA 2KJ6A 4MM3B 3PV0A 1PH2A 3BK1A 3M63B 2QCPX 2MHJA 4HSVA 5FLXE 2WXPA 4TQ1A 4DR4L 2AWOA 4DN4M 3HEJA 2KFJA 2LEKA 3JVZX 3Q3JA 3NELA 2B2UC 3S14B 4LFBL 3NHHA 1UBIA 3HOWB 5JHAA 3V62A 2K8BA 3MJWA 4A8XC 2F52A 3J81c 1YOVB 2NVQH 1TWHH 5ELFA 5FR3A 4J8QA 1RCVD 4IUQA 2ZT9C 5L37A 4JV5L 4A3JG 2GI9A 3PZ7A 4FULA 4DK1A 4X66L 1DOXA 2JA6G 1SFOB 2F0JA 3A54A 4ANVA 3QB3A 2BWES 4NP5A 1P1AA 1RHPA 2KJXA 1IBML 2DNFA 2FIFA 4NXNL 1FR3A 4ZRJA 2SOBA 2EYOA 1A70A 3A8JE 3DCGA 2D0OA 4EKUA 1SYBA 4B3TQ 1EIYB 1WVLA 1LTTD 3J80L 3JAMc 3RZDB 1SJED 4YWKA 5J39A 2INNE 3A4RA 2Y5BB 1WMHA 2KX0A 2MBOA 2DUDA 4PZ7A 3HOWH 1B9RA 3VYTA 1ZE3D 1EOTA 2ZW0A 4M8AA 2HJ1A 2WXGA 2LMCA 1HR0W 4LK0M 1AWDA 3I7FA 4QUFA 1CA6A 1CZPA 4KZCA 4LF8L 4H7BA 2VRRB 3VH3B 3VTUA 2Y3AA 1SFOH 4LW1A 3I9V1 1PH5A 4OVZA 3RMKC 2PCFB 4EQ5A 1W6JA 2VB2X 3MA2B 1X56A 4DV7Q 1QVGA 1N36Q 3VYRA 1PDXA 4UP9A 1DGSA 3RZOH 3BINA 1HA5A 2PIAA 4M8NA 4LNKA 2OJRA 2B76B 1XT9B 4BBNC 3QCAA 3RZDH 5G3LD 2Q2UA 1WCMG 2PNRC 4L5RC 4MTKA 1QKZA 2GB1A 2HDEA 2F0KA 1NY4A 3VA5A 2JEBI 4KD3A 1ICWA 4WAAA 3CCLA 1UEBA 1V1PA 2ZTDA 4XT1B 3BDCA 4HTHA 2I38A 4MGKE 1NAPA 4A9AA 4JI2Q 2QDBA 4Z9CB 1I6HB 2VQFQ 2WB1G 2MX2A 2BCOA 4RGNA 3BZKA 3T13A 2IHFA 3KYHC 3EFUA 4OO1G 1AZPA 3MZ5A 2E5LQ 2IX0A 4G57A 4ZRIA 2UU7A 1WTOA 3Q69A 1S5DD 4M1UB 1NTGA 1RKNA 1WTPA 3U9SA 1JQ4A 2ATWA 2AYOB 2ZM6L 1EWCA 1PZJD 4M01A 2F0WA 1XF5L 3EC8A 1ICFB 1WRIA 2V3PA 5HGTA 3TBIB 5M3FH 1WYWB 3AE6B 5C23A 1RTOA 3EROA 1GUWA 1D1KA 3A1QB 4CJ2C 3UE1A 2L76A 2WV6D 1I6HH 4AJYB 3S15B 2AUKA 4P2CB 2F0TA 1C9OA 3ZYYX 4ZKBB 1TTNA 1GAQB 3RR5A 3ZDMC 4OX9L 2WNMA 3UE0A 5CHVC 2EYHA 4I6PA 3DEPA 3HGBA 2WU2B 2NVYB 2OJWA 4Q0FA 4II3B 3QO2A 3N1YC 2FUG1 2KWCA 4NDXA 2IBIB 4W9GA 4QY7A 3VR4A 1T0SC 2V9HA 2N3SA 2EXDA 4URKA 1SNPA 3E9HA 2SNMA 2UWQA 4BBNF 4PMBA 4BA2I 1YI2A 2DYOA 2RDHA 5E6OA 2A5HA 3LYYA 1WX8A 2B8FA 2B2YC 2EJGC 3S15H 1L4DB 1UELA 5G5GA 4DFAA 1PH8A 2B63B 2E6XA 2GBKA 4EVOA 4I65A 3FEWX 5E4WC 2BS3B 2VH1A 1E2ZA 2W82A 1OXUA 1Y14B 4U68A 3SK4A 1Y1WG 4YTMB 3RULA 1M8AA 2NVYH 3NQTA 3AEVA 1C4CA 3F8TA 2BB6A 5JJLA 2ZJPA 4ZHPA 1STEA 2Z9HA 5EQ0A 4MJSB 3T53B 2CU1A 1D1IA 2E2DC 2VW9A 4HN7A 4JI3L 3A8KE 3CRLC 2PVGC 1V9PA 3HRZC 3NENA 3P7JA 3S2AA 2I0QA 4K5VA 1VDZA 4P71A 2KXJA 1IKMA 2AQ1B 1HUNA 4PK1A 1QNKA 2QA4A 5FK9C 3HRDD 2B63H 1GNUA 4BY1G 4RHRA 3L17A 5MPOA 2F3IA 4M8MA 2WYQA 3CCUA 3T1HL 2BH2A 1IBXA 1CZWA 1CK1A 3ERQA 2KZRA 2RPQA 1JMCA 2QDFA 4K0KL 3QR8A 3CU7A 4RFBA 1A5RA 1XLPA 4TRDA 3MTNB 1H9MA 1KH0A 3PT2B 3L0OA 1STAA 4GOCA 3SK6A 4A3FB 2O5IC 3AE4B 3T3OA 1A0IA 1YD8U 4NAMA 4EQOA 3V61A 2F0FA 1QG7A 1VQ5A 2R7ZG 2KVRA 5D7GA 3C3LA 1UWMA 4FF2A 4EOYA 3IT6B 2I2YA 4RGOS 3A5ZB 4GXBA 1IL2A 1W3SA 1B2TA 2E2JB 2ON8A 3D32A 3A9JB 2NBUA 4X6AH 2LZ6A 1EIFA 1SIFA 1H9JA 3M4PA 1ENAA 2L11A 2NBVB 4A75A 3PLUA 4HWIB 2B2VC 1HNXL 2K8HA 1TXYA 5H1SE 3GTQB 1QJOA 2KDMA 3O65B 4K7WA 1K53A 3RT3B 4A3FH 2Z59B 3NY5A 1S5BD 1YQBA 5C0XI 3DWMA 5IOCA 2DYMA 5JEAG 1ONLA 4CKCA 4LNFA 4HIMA 1FYCA 2VY3A 3CMMB 3J7A5 2BE5D 4ICVA 5M5XB 3F1ZA 4PYUA 3T8MA 1OO9B 1SBBB 3HM6X 4DV6Q 2E2JH 2V1YA 4HJKA 5JH5C 2R93B 1EYDA 5AJ3Q 2PLPA 3PPAA 3N30A 1FD7D 3EFXD 4DR6Q 3B0AA 3KDFB 2F4IA 1EF1A 3K5MA 1NBFC 1RWSA 1EQRA 3OJ3A 3GTQH 1EIHA 1FRRA 3KLWA 4DXAB 1E2VA 2AWNA 2Z4HA 3TP5A 5EE0A 2KNBA 1V5TA 5K5PA 1JALA 4R4IA 1QOFA 3BDLA 1P7FA 3K58A 1WXSA 3AV8A 1G2SA 4DR5Q 3GTGH 1XO3A 3UDFA 3P4PB 4R4CA 1EZ6A 5M5XH 2ZXPA 2K1BA 4GSWA 4YSXB 3KW5B 3NVZA 4OEMB 5IGEA 2JN4A 1NI2A 2PNHA 3LGJA 2R93H 1R4NB 2VS1A 1QVFA 5FOBB 1J8CA 3K9PB 2KK8A 4LCDE 4G7ZC 1R9TB 3RN9C 3PO2B 3CF6E 4FO2A 3EBEA 4KN7C 5FJ8G 1CJEA 3OYYA 1YJNA 2Z6BA 4LUOA 1HTQA 1PTOD 1SXTA 1JMLA 2N7JA 1ZDXA 3Q14C 4ZRZA 1V49A 1E1TA 1WJ6A 4KVGB 4RM9A 3WIMA 3N1XC 1Q8KA 4ZRPA 5E1FA 3ERSX 1SIJA 4XQQA 1TY0A 3KOJA 2IZVB 1CT1D 1MSGA
chains in the Genus database with same CATH topology
1E10A 2KUMA 1I4GA 4GDLB 1B9NA 1J8IA 1H9SA 3I70A 1MBYA 3OMGA 3I73A 5C44B 1HUMA 2N9LA 1V1OA 1FFUA 3PUYA 4H2AA 1A2UA 1BF4A 4IALA 1STYA 2ONQA 2K28A 1HEZE 2BB5A 3SFEB 4WAFA 3OPOA 2DY7A 1GUGA 3QOJA 4G7OC 1EWHA 5I6YA 2EPBA 5G5HA 4HMIA 1SAPA 1IL8A 2BA0A 3WOFA 3ITPA 5CV8A 1Q1EA 1G2TA 2WXIA 2FINB 3GS2A 4KD4A 5FO9B 4HEDA 4KY5A 3B2FA 3Q8AA 2QEJC 2CW0C 1QE6A 2K22A 2NUCA 2F3VA 1PZID 1I3QB 5C0XG 2G9DA 5EE3A 1PZKD 2KWDA 3D4WA 3AB9A 3N9YC 4IQZA 5DNFA 3T56B 1ACCA 3NRZA 4IZ8A 4TQUS 5I9OA 4B08A 4RCOA 1MI0A 2SEBD 3EA6A 1K50A 2IJ0A 1QWYA 5BMIA 1D4BA 1VF7A 4C3IB 4KGSA 2VXWA 5HURA 3DWQA 2TSSA 5IGDA 1PGAA 3SR1A 5FO7B 4MIUA 1C4PA 1PGBA 2JA7B 2WP9B 3TN2A 2WS3B 4HMJA 4XYQA 2RSOA 2Q8IB 2LUMA 1KLUD 4MHEA 2XSCA 1EYAA 5CBAE 3X3MA 1C4AA 4DF7A 2BA1A 2K6AA 2WKDA 4TKOB 3DUZA 1EY4A 2E74C 1HXYD 1RTNA 3AEAB 1DXMA 1ESFA 3EJIA 4JPSA 4V0BA 1BBXC 2X69A 4IKGA 2WXJA 1KAAA 1LT5D 1ZP0B 1LV9A 3D31A 1TS5A 1RYJA 3AN1A 2WXQA 5IT9L 2B2TC 3MXPA 1JC7A 2I46A 4L63B 3SDZA 4KX6B 3SE0A 2F0PA 1MHXA 4CKBA 1MHHE 4B9XA 2EYMA 4RGMA 3DHQA 5IODA 1HQRD 1CM9A 1PFBA 2EY1A 1VMCA 3TZDA 2E2HB 2K01A 4P6VF 4FF3A 4XT3B 1GB4A 1P7EA 3OIQA 4ID6A 3J81L 2LHDA 1HQMC 3HZXA 1EZ8A 1C77A 3BDOA 2BTEA 4HCSA 2IGDA 3GTKB 3Q24A 3FILA 3HS0C 1HA6A 3PZ8A 1F9SA 4YSZB 4OW0A 3ND8A 1CFMA 2JA8B 3GTLB 4HAEA 4B0MA 3JAML 4X3KA 2WDVB 1TKYA 2NBFA 1SNDA 1Z6HA 4RA8A 3Q8CA 3AE2B 1BUIC 4X3UA 1NENB 2NTSA 2L1BA 4PT5A 2NN6I 3NVWA 5C2TB 4H13C 5G3LF 3QG1A 1XCTL 3K6OA 5C3EB 5D65A 2IX1A 1LTRD 2A6HD 4YTNB 4JBWA 2DWQA 4LTUA 3IAYA 1DCZA 1VDVA 1EL0A 2DNCA 2NZ1D 1F2RC 4PV1C 2KHSA 1LT6D 3OWEB 1FM0D 4P16A 5J22A 3U4EG 1PDQA 4AYBB 1E7PB 1WGKA 3DWPA 4FVMA 2YU9B 2XWBB 3MJ5A 3SK5A 1FD6A 2L5TA 1STHA 5AUIA 3CKIB 1I7HA 1Q10A 5BN4A 2PZWA 1PYWD 5M9OA 1OQQA 1O78A 1KTKA 5ELEA 3HG9A 3S1RB 3VRBB 5KEEA 3C46A 3RLFA 3QJYA 2L9HA 1FCCC 3TUOA 1C4QA 3S1NB 1NCVA 4KTAA 4R8IA 2OF1A 1K52A 3EGRA 2ACZB 3DMUA 5DAUA 1XLQA 2W3RA 3HUIA 1PXUA 2KCNA 3NS1A 3MEHA 5EE1A 5HHDG 3OWFA 1J7AA 2A69C 3SK8A 1QILA 5CYUA 4TSSA 3CWIA 4XIGS 2WXLA 5DM63 5H92C 2XNAC 4F8MA 1OQRA 4FXGC 4CQNA 5CV5A 1MI2A 1WD1A 2BE5C 1BR9A 3KWLA 4H0LC 3CRKC 3GB1A 4IURA 4IFDH 3GTJB 2BYTA 4USAA 1F2MA 5HI1A 3VR3A 4RKBA 1ZXTA 5ELDA 2WAQB 3A8IE 5IIFA 2A68D 5FKAC 2BDOA 3H6MA 1TS3A 1B53A 2NN6G 2N0SB 3AEEB 2A6ED 2F0NA 1WTRA 2XWJB 2ENBA 1SYCA 2MPMA 1PUTA 1TZOA 2WDQB 3FKIB 2L12A 2WXFA 1JOKA 1LACA 4FYDA 2KQ4X 2KA7A 1UGJA 2CJOA 1PTOB 2DBYA 4QF4A 3W1SA 1RJTA 3J7AV 2K32A 1EEFD 5C3WA 4HCEA 3OIPA 5BYRA 4XXEA 1STGA 3WDNA 3OOCA 2FMMA 4XTCS 4HJGE 1BNZA 1B50A 2BBCA 1G291 1ZEQX 3N52A 3HVDA 1D5MC 2PW7A 3K59A 1E0ZA 2IWHA 2H1EA 1PFMA 3P1HA 4DK0A 2DY8A 1JRPA 5K36H 3EQLC 3AMZA 3UI2A 2ICEC 3I72A 2D9UA 3T16A 1PLFA 2EY2A 3M4YA 4N9PA 1GUTA 4X3SA 1STBA 5C5MA 5T1IA 4GDKB 4XE0A 5AFWA 1L6VA 3NVVA 1I4QA 2PQEA 1D6EC 3KLRA 1PTOF 3SEBA 5A35A 5KNBA 1F2ZA 4B0EA 1JE4A 3NQIA 4HKZE 5JVH3 3IAS1 5GXGB 3K57A 4HEA1 3HOZB 2AQ3B 3MC0B 1U4RA 2B2UA 1BUVT 5D3DA 2V4DA 2JQRB 3TEZA 3CQZB 3NVYA 2R92B 4D2KA 1TT2A 3ZGZA 2FJ2A 5JVG3 1JR0D 2LMCB 2F1MA 4QMGA 4PMWA 1H9RA 4H44C 4C7ZA 1NYQA 1QNUA 1DZ1A 2WXRA 1EU3A 1J7BA 3NBHA 3TSSA 2IPKD 3HVZA 3LWEA 3C2PA 2X6GA 2OT2A 2RA4A 1LT4D 4KGTA 4C3HB 2R61A 2JA6B 2G1EA 1IW7D 2X6LA 2BS2B 2WQYB 3I91A 1BO0A 4HRSA 3MFYA 2WP8J 3P63A 3TDQA 4FXDA 3P42A 1ZKOA 1R7SA 1ILQA 2SDFA 4NAWB 1N60A 1ET9A 1Y8PB 1FGBD 4QIWB 3M3YB 2KVMA 1N5WA 4EQNA 3VYSA 4V190 3FAHA 3PMFA 1ZUD2 5EKLA 1WSPA 5C4ZA 1WCMB 1TKWB 1TIID 3AEDB 4ZRQA 4FF4A 4WWMA 2W54A 1YQ3B 2ID0A 2WXMA 1F0ZA 4IUVA 1JW9D 2F0OA 4JE3B 4G7HC 2EELA 1WWTA 1AP0A 1L0YB 3BVZA 3KLSA 2B2YA 3P4QB 5EBDA 1QOGA 1W6KA 3GTOB 2Q8RE 2EY5A 1B9MA 3TEYA 3V2TA 2FFKB 1GPXA 3NK9A 1F2YA 2JYTA 2EXZA 1IBXB 2C5CA 4ZKCB 5M3MB 4Y7NB 3D8GA 2XN9C 3IAM1 5CBEE 3GP7A 3T3NA 1PGXA 1EYCA 2LKVA 5IGFA 4RH6A 1A2TA 3BVMA 3I4NB 1II3A 5EJWA 1TWCB 1PRTD 4QB4A 2LFNA 4BWGB 3T4AC 1DOIA 1HTLD 3MXUA 4KY6A 1TKGA 4ILWA 1FCLA 3U9OA 3SR6A 4K5XA 3B9JA 3IFDA 4F87A 4RWSC 1CHQD 2OEDA 1G91A 3H91A 4L6TB 2MJ3A 2IW3A 5JOBA 1U4MA 5EPLA 3T51B 2CQAA 5D14A 2MHVA 1ILPA 1SB3C 2PVOD 4R8NA 1LTSD 4DU9A 1FEHA 1BQQT 1CI3M 3FPUB 2HDMA 2W55A 4CJ1B 2JSVX 3NBIA 3R2TA 2JYEA 1Q12A 3DWAA 4N59A 4NKLA 5KYIA 1OXTA 3I3CA 1KRHA 2O2LD 4C3JB 4K14A 2MEKA 1B4OA 2W3SA 2PZUA 1Y1VB 3Q8EA 4RF0A 1SNCA 2RDGA 1IYUA 1H9SB 3Q22A 1GOZA 2JEAI 2L32A 4L1BA 1J7CA 3DWGC 5C6AA 1Q90A 4AS1A 3EUB2 1ZXIA 3KWVA 2KQ3A 2F0LA 2A68C 5A2QE 1EQTA 4KN4C 1SNOA 3ONAB 4RKLA 2A6EC 2EYFA 1WTQA 2GRIA 3RPFC 3TP7A 3S1QB 1SF0A 2QSDA 1T6BX 2MJEA 1U4PA 2R6GA 3U52E 1ZPSA 2IDYA 1TKEA 3BZDB 3HOXB 4NMZA 1JWBD 5BN5A 4RF1A 1FNUA 2WU5B 1Y8NB 2CHBD 4BS9A 2OXPA 4A3EB 3U7ZA 5FLXL 1EIGA 3KUPA 4OIJA 1JQYD 5HG2A 4US8A 3VYUA 3V05A 2F0SA 1Y8OB 1LABA 1SMYD 2JXTA 2EYPA 3DEOA 3G7LA 4XDDA 1A3TA 3IL8A 3VRAB 2IT1A 1K83B 4BY7B 3NTIA 1SE4A 1MPEA 1MGSA 1SNQA 3R3OA 1FFVA 3VR8B 5EKKA 1CA5A 3ETRA 3NWSA 1VLBA 3A56A 1F2RI 2OHFA 1KABA 2RPVA 4KI0A 3H09A 1JCKB 4KJOA 3BS1A 4B9WA 4DA2A 1LTGD 3C1FA 2XRSD 1YNJD 3M85A 1X3QA 1UNSA 1IHZA 4PMCA 4J3OD 3M7NA 3W5VB 4ZYSA 3L3OC 2PMZB 3D3RA 1ENFA 2YYZA 3LWUA 2EE1A 3S1MB 1ROEA 2K9XA 3DM1A 1N62A 2L83A 5C0XH 1EM7A 2F0VA 3D6CA 2D62A 3J80E 1NVID 2WINB 1RM6C 1GB1A 5C4JB 1I4HA 1RFKA 1DOMA 2MJ8A 3HOYB 2LHEA 2WXOA 2FMCA 1JWSD 4K6DA 3NUCA 2Q8TA 5I4DA 1H9KA 1K8OA 5EBCA 4JWSC 4LK1C 3X3NA 1DD2A 2B2WC 4DQOC 1Q3LA 2RQXA 4PNYA 1C76A 4ABNA 3E9SA 4TQ0A 1IW7C 1IGDA 5CV6A 1DONA 3VR5A 3GV6A 1F9PA 2RDFA 1JOOA 5D3IB 1TQOA 2ZXOA 1AN8A 4A3IB 3TMEA 2K05A 4US9A 4C7YA 1N5XA 2L1AA 1AYFA 2NMQA 3OSOA 1Y56A 4BBRB 2Q5WD 1B44D 4R3DA 1OXSC 3R8BA 1SSNA 3MVVA 2JWUA 5JPMC 1A15A 4XDCA 2F03A 3NZ3A 3P4SB 1KDAA 3GTPB 4YXDB 2K5WA 2NVTB 1XTCD 4M0WA 2F0IA 1L5PA 1J9OA 1GJXA 2JXMB 3E56A 1I4PA 1UWXA 1LTBD 4XWTA 2CVRA 3TP6A 4OL7A 2WXHA 2M2LA 1F9QA 5EPKA 1I6VC 1EY6A 2K3UA 4C80A 2RSNA 2LGIA 2OEOA 3HP3A 3TEWA 1LLRD 4FP5D 1I50B 2VB3X 2CJNA 4YTPB 1YQ4B 1TU2B 3ABVB 4FXKC 5KYLA 1MSHA 3I4MB 4A3KB 3VR9B 3K5LA 5JXVA 1QT9A 1GHKA 4GZYC 1SYGA 1PFNA 1S4ZA 4S3SA 1FXIA 2LJIA 1JWMD 2Y0SB 5CGKA 2HQEA 3P1MA 3NE5B 1DM0B 2J53A 1BCPD 2N9KA 1KF6B 2PYKA 3O13A 2MGSA 1X32A 4LAAA 3U2SC 2NB0A 2AUJD 4YT0B 1PRTB 4MT5A 2HDLA 1A3VA 4FF1A 1PRTC 1VCIA 2DNEA 1C48A 4K6LA 2WACA 4OZBA 3A7LA 4A3DB 3V96A 3GV3A 4XWWA 1BMLC 2BT6A 2NVXB 3HOVB 1DOYA 3VR6A 2Y5CA 4ZK9B 5IGGA 2EKIA 1JB3A 1T3QA 4KKTA 1JROA 1HRJA 4ARCA 5NUCA 5K36G 1C78A 1UAPA 4MN3A 1TYGB 1OFFA 4K5WA 5CV7A 1XWEA 1S5CD 4LMQD 5BYQA 3H0GB 1PRTF 1D5ZC 4F7XA 5C4XB 1KNAA 1XLOA 1ML0D 1PTOC 2SAKA 2KEDA 3CHBD 3I57A 4ZUJA 2V4IB 3H8HA 1DJRD 2RVLA 4BA1I 1HFGA 1R4QB 2FBWB 1CTMA 2ZXRA 2K5DA 2A74C 2EJFC 2DN8A 4IDIA 2E75C 2MUYA 2K5QA 1YMHE 4CKEA 2EYJA 1BDOA 3NUHB 1PTOH 4F88A 3PUVA 1IKLA 2Z8LA 3PUWA 2CW0D 2F3WA 1Q8IA 1A6XA 5H8YE 2O5JC 2KCCA 2NWGA 4CBVA 1HZ5A 1CZGA 1OXXK 2M0AA 3BK2A 4C56C 2JP1A 3NP8A 1SE3A 3V3XA 1ESRA 1XCQL 2QF7A 2PKOA 1L0XB 5I6WA 4QUCA 4KHVA 4Q2JA 2NN6H 3KK7A 4OZCA 3KF8A 3ZJUA 4IFDJ 4BBSB 3UI3A 3AEGB 1SEBD 4XDXA 2NVQB 1TWHB 3AE8B 3Q6SA 1QB5D 1XXGA 1TWAB 4WFN3 2WXNA 3MWYW 3L7ZC 3SHLA 5CC4A 2N88A 4WQMA 2JZPA 1SMYC 3P75A 1V8CA 3OW7A 4A90A 4K8JA 1XEEA 5EKIA 1SNMA 2IX3A 3K5OA 4KKSA 3GO5A 3NTHA 3K7AB 3KBXA 1LTAD 4C3HG 4E6IA 4OGQC 1AEXA 3OMCA 1WTWA 2H88B 2HTME 2TMPA 2EOTA 3J9CA 2F0QA 3CIRB 2QKIC 5IGCA 3RZOB 2V3NA 5CMDA 1QLBB 2F0EA 1VZ6A 5BMHA 1O7ZA 4UDUC 4A3JB 3FC4A 1G6ZA 1WTVA 1V1PB 2K04A 1YNJC 1PFDA 3W9CB 4IUPA 4RHSA 1EY9A 3J7YW 3VA7A 1EFID 3D6WA 5ISRA 3PO3B 2X38A 1YJIA 1YJJA 1AZQA 2L0CA 2CU3A 1ZOYB 1STNA 1YN4A 1HHVA 2M00A 4K8IA 3E6ZX 5CR3A 4REZA 1M4VA 2HCIA 5DM73 5M3FB 1R4PB 3GQBA 2E2IB 4N9TA 4NZLB 2KECA 2RBMA 4PQXA 5KRUA 2B8GA 3RMHA 2M19A 1IYVA 3FMCA 3IFTA 2GA4B 4A55A 5IT9E 2PO4A 1YNND 2J0TD 1O7YA 3MXGA 4C1NI 4DXFA 2WB1B 1IGCA 4JWUC 5HFYA 4N6EB 2M9VA 2KMMA 1C9FA 1FXAA 3AEBB 5LL6S 3ZJVA 4IUNA 4ZAIA 1NUCA 2AX5A 1FNWA 1V43A 2VUMB 4GLSC 2IGGA 2WXKA 3EVQA 4J6HA 3I4LA 2XIWA 2EVBA 3M7GA 2JU6X 3A55A 3G6JB 1L0VB 1EY8A 4OO1H 2D2CC 3J81E 3AE1B 2AQ2B 1CHPD 1TS2A 3MHZA 5DEHA 2IL8A 3N6RA 1HPCA 2B39A 3KBGA 1BXTA 1GUOA 2KEEA 3RD4A 5T8IA 4X3TA 1JOQA 4RNAA 3PIO3 3JAME 3OHXC 1DYQA 3S16B 5BYSA 2Y5PA 2SNSA 1TS4A 1Y1WB 3BWUD 4KHZA 2A6HC 1C8CA 5JJZA 5AUKA 2KN4A 1UEAB 1AFPA 2E3TA 3MFGA 1WTXA 2RMMA 4MACA 4O1NA 4HSPA 3S2HB 1XLNA 2VZKD 4AQ7A 4BY1B 1QQRA 3W3AA 1ZYRD 2K33A 4KY7A 4K2KA 2XVSA 2A69D 1QCBD 2B2VA 4WRDA 1B3AA 4JK1C 2L55A 3LB8C 2Z4IA 2WIIB 5C3XA 2L4NA 2WLBA 1B1ZA 3PIP3 4JX1C 1E2WA 1BCPB 2PPBC 4Q5VA 2KOLA 1BCPC 1TR5A 2D5GA 3NSWA 4I7ZC 2R7ZB 3W5UB 4ITKA 1SYEA 2N55A 3FPPA 4C3JG 3GTGB 1VR9A 4EQPA 1Q1BA 2VNUD 3PO0A 1PMRA 2XRQD 3GTMB 3C8YA 3BYTB 1FMAD 5F2DA 1MD2D 3QWNA 3RFZB 1F77A 2RKSA 4UAIA 1UUPA 4KKIA 3A7AB 1NI3A 4LLGM 1EY7A 1EQVA 5C3JB 2H89B 3VQIA 5KNCA 1GUNA 4DAVA 5JEAH 1KNEA 1FO4A 2H4OA 5BMGA 3URYA 2J7ZA 1BCPF 2EJMA 4EE2A 2EY6A 3MTSA 3QIAA 5ELBA 2KACA 1T5EA 4OIKA 2F0GA 1FRDA 4DGZA 4XQJA 3FVQA 1S5FD 1T5XD 3IXSA 4L8JA 3SXHA 5JAVA 1QF6A 1GUSA 1DGJA 4ZUIA 3NXWA 1HZ6A 4EGVA 4ZQ3A 4C3IG 5E3FA 3E0JA 1HTPA 1NR4A 2WKCA 2JYOA 1HCZA 3GD7A 3Q8FA 4WH4A 4HROA 2E76C 1HFNA 4ARIA 4WORA 1GXDC 4TMAB 4RCNA 2M56B 1D5XC 5COYA 3AEFB 4IUUA 5KIXA 5LHY1 1U4LA 4KKJA 3ZQ4A 1BOSA 1TY2A 3AB5A 2QILA 1F9RA 1Z47A 2MP1A 3BVGA 4C2MB 3L9AX 3F2UA 2J4XA 4KJNA 3BYYB 3MHBA 2F0HA 5JPNC 2LY7A 5C5LA 4IN3A 3WOEA 5JEAJ 2G9HD 1NR2A 5ELCA 3AE5B 4K2LA 3S17B 5KNDA 2QJLA 3D4RA 3K5NA 2QMTA 1ENCA 1X3PA 5CV9A 1Z7TA 1XYIA 1VF5C 2EDGA 1KDBA 3FRPB 2Z1CA 3S2DB 2PMVA 1A3UA 4A3MB 4NJCA 3AE3B 4IUTA 3AE9B 4DNRB 3BG3A 5E4XA 1RODA 4IFDI 4XYOA 5EGTA 3MAQA 3J7AF 3K0YA 1L6UA 3MP9A 4OHJA 3NWTA 5BN3A 1TVXA 1EEID 1O7LA 4U673 4N58A 2B2TA 4YWGG 1VZ8A 4A3BB 2PZTA 4C1NK 4J1MA 3H3VC 4WURA 3RUZA 1QOBA 3HOUB 4FXCA 4KGRA 2B2WA 1JICA 2BOSA 1KLGD 1N61A 1RDPD 3NTKA 2NTTA 5J1ZA 1LTID 1S5ED 4ME5A 5LL6X 1DOKA 3FILB 3I90A 3LXFA 2D5DA 3HKZB 1VJKA 1SSOA 4DNTB 3W2DA 3Q0AA 4KK7A 4RGTA 3AE7B 1VMPA 4L2YA 5EE9A 3E5SA 1I4XA 1D2BA 1VRAB 3Q8BA 1CQFA 2JSOA 2PW9A 1YNNC 2A73B 2J42A 2JX5A 5FO8B 1NEKB 5C0XJ 1SYFA 1JWUD 1QOAA 3ZJTA 2K7VA 4WIPA 3DXJC 1OXVA 1KFYB 1TWFB 2JE6I 3C1EA 3SFDB 2ICIA 2ZW1A 1C79A 1E6EB 2L52A 2K5PA 3FDTA 4DXGA 2JA5B 2J52A 2FE8A 2HUGA 3SVMA 4A6QA 2BS4B 3P20A 5CV4A 1O80A 1WYGA 3M4OB 3ND9A 4IFDG 3MXNA 1XX8A 5M5YB 4LJZC 1L4ZB 1WXQA 1YN3A 1KDCA 2O4XA 1ZXHA 3BIID 1K51A 2K0PA 5C4HA 2BW2A 1FIQA 4CJ0B 3P4RB 1JORA 1F2LA 1I4RA 1SYDA 3AECB 5I9PA 2BDNA 2MJDA 1MVKA 2IGHA 2F0MA 1FNVA 3IKJA 4CGYB 2F0UA 2EYLA 3Q23A 1VZ7A 3LX0A 1V97A 2VZKB 5E6JA 1SDFA 2I07B 1IUEA 4ULLA 1EY0A 1RF2D 3TP8A 3B2GA 5I2YA 2V0GA 1ZYRC 3QOLA 2PTLA 5EPJA 2LFIA 3H94A 4KKUA 5LNK1 4YIJA 4A3GB 5TSSA 2F0DA 4XQNA 2HCCA 4YSYB 4QCLA 4HR7B 3AU7A 4L23A 1NYRA 4WJWA 4RAUC 2PW5A 3IT4B 5IGBA 4R9WA 4ZOHC 1EWYC 4OZAA 2DLBA 5M5WB 1K8MA 2YEPB 3AMUA 4A93B 1ZDVA 1TJEA 3R93A 5KGUA 1SJHD 4O42A 2K03A 5A2QL 3D4DA 3VR2A 1YN5A 3WCQA 5CORA 3LNNA 3TEXA 4ODGA 3PUZA 1CQVA 1YNTE 4IOIE 1LT3D 3AH7A 1QOHA 2QIEB 3PUXA 4ZHOA 1RD9D 1NSNS 1G8ZD 1Y69U 1ET6A 1TWGB 4ZLTF 2C9OA 1AW7A 4KV6A 1SE2A 3R2IA 3L4PA 4HKQA 3AM9A 1V8QA 2KAJA 5I2XA 3NPPA 5T1GA 3S9WA 4MH8A 2WDRB 4OO1I 4CHTB 4DAPA 2YEPF 1JWAD 2NYZD 2INPE 4FNFA 1U9RA 2EZVA 1EY5A 4NW2A 1EU4A 1GHJA 3I8ZA 4KMUC 1E9MA 3KLSX 2LS01 1E0BA 4G4KA 2MH7A 1WD0A 3TZUA 1N63A 1LO5D 4DAYA 1DOLA 3KQ4A 2FHTA 2R3ZA 4MM3B 3PV0A 3BK1A 2QCPX 4HSVA 5FLXE 2WXPA 4TQ1A 2AWOA 4DN4M 3HEJA 2LEKA 3S14B 2B2UC 3NHHA 3HOWB 4A8XC 5FR3A 5ELFA 4J8QA 1RCVD 4IUQA 2ZT9C 2GI9A 3PZ7A 1DOXA 4DK1A 1SFOB 2F0JA 3A54A 3QB3A 4NP5A 1RHPA 2KJXA 1FR3A 2SOBA 2EYOA 1A70A 3A8JE 1SYBA 1WVLA 1LTTD 3J80L 3RZDB 2INNE 1SJED 5J39A 1B9RA 3VYTA 1ZE3D 1EOTA 2ZW0A 4M8AA 2WXGA 2LMCA 4LK0M 1AWDA 4QUFA 1CA6A 1CZPA 4H7BA 2Y3AA 3I9V1 4OVZA 2PCFB 1W6JA 2VB2X 3MA2B 3VYRA 1PDXA 1HA5A 2PIAA 2B76B 5G3LD 2HDEA 1QKZA 2PNRC 2GB1A 2F0KA 3VA5A 2JEBI 4KD3A 1ICWA 1V1PA 4XT1B 3BDCA 4HTHA 2I38A 1NAPA 4A9AA 2QDBA 4Z9CB 1I6HB 2BCOA 4RGNA 3T13A 4OO1G 1AZPA 3MZ5A 2IX0A 4G57A 1WTOA 3Q69A 1S5DD 4M1UB 1RKNA 1WTPA 3U9SA 1JQ4A 1EWCA 1PZJD 2F0WA 1XF5L 1WRIA 2V3PA 5HGTA 3TBIB 3AE6B 1RTOA 3EROA 1GUWA 1D1KA 4CJ2C 2WV6D 3S15B 2AUKA 4P2CB 2F0TA 4ZKBB 3ZYYX 1GAQB 2WNMA 2EYHA 3DEPA 3HGBA 2WU2B 2NVYB 4Q0FA 3QO2A 2FUG1 4NDXA 3VR4A 1SNPA 2SNMA 4PMBA 4BA2I 2DYOA 2RDHA 2A5HA 3LYYA 2B8FA 2B2YC 2EJGC 1L4DB 5G5GA 4DFAA 2B63B 2E6XA 4EVOA 4I65A 3FEWX 5E4WC 2BS3B 1E2ZA 2W82A 1OXUA 4U68A 3SK4A 4YTMB 1M8AA 3NQTA 1C4CA 2BB6A 4ZHPA 5EQ0A 1STEA 3T53B 1D1IA 2E2DC 4HN7A 3A8KE 3CRLC 2PVGC 3HRZC 3P7JA 4K5VA 1VDZA 1IKMA 2AQ1B 1HUNA 1QNKA 5FK9C 3HRDD 4RHRA 5MPOA 1IBXA 1CZWA 1CK1A 3ERQA 4RFBA 3CU7A 1XLPA 4TRDA 1H9MA 1KH0A 1STAA 3SK6A 4A3FB 2O5IC 3AE4B 3T3OA 4NAMA 4EQOA 2F0FA 1QG7A 5D7GA 3C3LA 1UWMA 4FF2A 3IT6B 2I2YA 4RGOS 1B2TA 2ON8A 2E2JB 1H9JA 1ENAA 2L11A 2B2VC 3GTQB 1QJOA 2KDMA 1K53A