2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1JCKB 2TSSA 1D5MC 1PRTB 1TY2A 1JWUD 4RGTA 3BVMA 1HXYD 1I4HA 4OHJA 1I4RA 1YN3A 1LTID 2XN9C 1YN4A 1F77A 1BCPD 1LTRD 1TS3A 1FNUA 5ELCA 1V1PB 1S5FD 1TS4A 1TY0A 1XXGA 2QEJC 4RGMA 4RHSA 2WV6D 1KLUD 4NZLB 5ELEA 2CHBD 5FKAC 1LTGD 1XTCD 1L0XB 1AW7A 1V1PA 4L6TB 5ELBA 1G8ZD 5ELFA 1FD7D 2IJ0A 1PTOB 3TSSA 1ESFA 1ET6A 3EA6A 5FK9C 2J4XA 1CHQD 1PRTD 1STEA 1PZKD 4Z9CB 1CK1A 1S5ED 2XNAC 3BVZA 3W2DA 1LO5D 4ZYSA 1ET9A 1LLRD 1LTTD 1LT4D 1ENFA 4L63B 1FNWA 4C56C 2ICIA 1EU3A 1LT3D 3BYYB 4RGOS 2SEBD 4O1NA 4UDUC 1CQVA 5TSSA 1D5XC 1QILA 1HQRD 1LTBD 2Z8LA 1DYQA 3DWPA 1I4QA 4K6LA 2RDGA 3MC0B 1RDPD 3SEBA 2NTSA 1HA5A 1SE4A 1EU4A 1L0YB 1DJRD 1BXTA 1LTAD 1PTOD 1PZID 1JR0D 1TS5A 1UUPA 1EWCA 1UNSA 1BCPC 1LTSD 1SE2A 1S5CD 2AQ1B 1CHPD 1EEFD 1BCPF 2QILA 4RH6A 5D3IB 4RFBA 3URYA 1SE3A 2IPKD 1D6EC 1SJED 4DXFA 1PTOH 2AQ2B 1I4GA 3BYTB 3DWAA 1D5ZC 3R2TA 3R8BA 1AN8A 1KLGD 2G9HD 1PRTC 1M4VA 2AQ3B 1FGBD 3MFGA 1I4XA 1PRTF 4RHRA 3CHBD 1T5XD 5I4DA 1S5BD 1GOZA 3KLSX 5ELDA 1S5DD 1SBBB 1RCVD 1LT5D 1B44D 4BWGB 3BZDB 4TSSA 4DXGA 1SJHD 4RCOA 1JWSD 1MD2D 3DWQA 1V1OA 1FNVA 2NTTA 2R61A 3O13A 4RGNA 1BCPB 3BVGA 1TS2A 1B1ZA 2XRSD 1I4PA 1EEID 1JWMD 1PTOC 1JQYD 1YN5A 1RF2D 1RD9D 5D3DA 1LT6D 1SXTA 3EFXD 1PTOF 1KTKA 3R2IA 1CT1D 1SEBD 3OWEB 2XRQD 1EFID 1HTLD 2O2LD 2RDHA 1PYWD 3V05A 3GP7A 1PZJD
chains in the Genus database with same CATH superfamily
1JCKB 2TSSA 1PH7A 4DV0L 4E74A 4JQWC 2K5PA 2M4NA 5L37A 3A1QB 3SFEB 4HMIA 2J0TD 3CMMB 1OXVA 2BE5D 3CCLA 2X6GA 2UU7A 4ANXA 1VZ8A 1Y1VH 5HY6A 4DUZL 4EQ5A 4FF3A 2PNRC 3A7LA 1K8AC 3J7AV 4W9HA 4DHJB 1BMLC 2R93H 2K04A 1P9DU 3P4QB 3KLWA 1TS4A 1TY0A 3PGZA 3R3OA 1Z47A 1I94Q 4A93B 1WM3A 2BQQA 4B0MA 3W5UB 1J7CA 2M8SA 4ANWA 2E6XA 5ELFA 5M3MB 4B3SQ 2FCSA 4ZRIA 4DAVA 2UUBQ 4A3LG 3K0YA 4AYBG 3Q8CA 2L32A 4KI0A 3TQYA 2XWBB 1IHZA 4AYBE 2G1EA 5FR6A 4LK1C 3TEWA 3TIXA 3NELA 1CTMA 1ZXIA 2EJFC 2ZXOA 3AE4B 1GKHA 2O6VB 1BUIC 5IT9L 3ZLZA 3IAM1 2EMSA 1KJTA 4HCNB 1RDPD 1GUAB 3SD5A 2KC2A 2EYJA 4IWQA 2JUOA 5IODA 5AEKB 3K8AA 1A70A 4DK5A 1DJRD 1RL2A 3B08A 4RG1A 3PZDA 4NXML 2JWZA 1WZ0A 1SE2A 2KCMA 3I73A 4WRDA 5JEAG 2ASBA 2JRIB 2D0PA 2LVPA 3ZNID 4ZDVA 4TQ0A 2DYOA 3PV1A 1OQYA 1NCVA 5FO8B 2ZTDA 1OEYJ 1WZ3A 2IDYA 4WAFA 2JRHA 3AU4A 4GOPB 1JRPA 1SJED 1BOSA 4G50A 1AFPA 3EQLC 3DWAA 3P2BA 3B6YA 3TBLD 1D5ZC 4GNXA 5C3JB 4HCSA 5IT9c 3S17B 1E5WA 2MCNB 2IX1A 4APVA 3HOUH 5CBEE 1UWXA 4DV5L 2G9HD 3ML9A 1E1TA 2JA7B 3PREA 5JZEB 4NW2A 3Q6SA 4BXXG 5JHBA 5I9PA 2LGXA 2H89B 4CQNA 3H0GG 1GOZA 3NUCA 2KXJA 2EVBA 3DCGA 4CDEC 4CJ2C 3MWYW 2M19A 4B3RL 4P7IA 4DHZE 2PI2A 3I5JC 4DR6Q 4K7UA 2WXHA 4C1NI 4IUUA 1GJZA 2J53A 2EXDA 3BZDB 2ONQA 1WFQA 5HHDG 3DWQA 5D94A 2NYZD 3HHMA 2R61A 2D2QA 3GTJB 4IPCA 3MXPA 2R92G 3RLOA 3N32A 3ZJYC 1K8OA 3I8ZA 2XK5A 3ND9A 1WD1A 1VCBA 3TS0A 1KD1C 5BN5A 3I57A 2RMMA 3HOVH 4B0EA 2Y0SE 3RLNA 1G6PA 1H9JA 3S1MH 3H91A 2OT2A 3VR6A 3IXSA 1JOOA 3U9OA 5C4HA 4W9EA 1C77A 5J2RA 3C3LA 1XPUA 3CCUA 4R4CA 4NB3A 5CV8A 1JWUD 5EPKA 4FDBA 1K51A 3WANA 1K83H 2Z0SA 1H4RA 3IT4B 5D7GA 1JRUA 5H1SE 2WP9B 1QVFA 2Q2TA 3PF5A 1R4NB 2C9WB 1WIAA 4USAA 3DBLB 2W82A 3HP3A 1M90C 2V9HA 4BOZB 5LMNW 5KNCA 3M63B 2RQXA 5ELEA 1IP9A 4DR4Q 2O2VA 3PO2B 2G3QB 4S0RA 2JA6H 2A74C 2JA8H 1UBIA 1A63A 1Z5SB 1D4BA 2UXBQ 2LUMA 2B63B 3BIID 2NR2A 3MTNB 3TSSA 2KJRA 3ZJTA 1HEZE 3EHVA 2KCTA 5JPMC 2WX0A 1XWEA 4CYEA 4ZQ3A 2CHZA 1VQIA 4EX5A 1BKBA 4A3MG 1XO3A 3W2DA 4W9DA 2I5MX 3OMGA 4IM3A 3VQIA 4HSPA 1F2RI 1Q81C 1LT4D 1PGXA 4XWWA 1FNWA 2VZKB 1IBKL 4Q2JA 3QHTA 2OF1A 2QF7A 1P7EA 4AQYQ 4HMJA 3PUXA 1IL2A 4PZ7A 2MBOA 1I50B 4N58A 2LVOA 2NTSA 5E6JA 2FNJB 4M0WA 2RF4A 5BMHA 4BBSB 3F8TA 4JWSC 1EL0A 4G7HC 4A3PA 1F1HA 4NJ7A 4C3JB 3S1QH 1PA6A 1KRTA 1GJXA 4ZYNA 2FBWB 4CHKA 1KAAA 2QILA 3JYUA 3L4PA 4YTMB 1JC7A 2E74C 3J80i 1B8AA 4IOAA 2N1WA 1Y1WG 2F3IA 2LMCA 3P20A 2NVTH 5GXGB 2LZ6A 4EQPA 1B50A 3A9KB 3NHEB 4ZUIA 2SNSA 1G91A 1W2BA 4IALA 4IW0A 3CWIA 4JPBW 4MZ9A 2WAQB 2LVQA 5IWAL 1H9MA 1QB5D 3J80E 1FGBD 4YTPB 4RHRA 2PVGC 1IPGA 4YHHQ 1TWCB 2RD0A 4MHEA 3PO3H 4KMUC 3VVWB 5EBDA 2GBRA 3CC2A 1RFKA 4BA1I 3NBIA 2ZW0A 5D2MB 2J7QB 1L1OB 1RTNA 4KD4A 4W9KA 4BY7H 3BDOA 3ZKJC 1PFBA 1YEZA 2UXDL 3PTFC 2V3NA 4LNKA 3E6ZX 4OX9L 1MD2D 4GKJQ 1WOCA 1S72A 1BF4A 5DPSA 3KDFB 4JBJA 1XTDA 2VUMG 2J0KA 3PHWB 5GAEC 2SAKA 2KA7A 3QR8A 3QWZB 4O42A 1MPEA 3HFZB 2AKWB 3FHWA 5IYCG 4K7WA 3L13A 3CRKC 1M94A 1VQGA 4LK0M 4DDGD 5BYQA 1DCZA 3I7FA 5CBAE 2KFKA 2KQSA 1SEBD 3OWEB 4C1NK 1S3SG 3QA8A 2CHXA 4K2KA 4LFAQ 4C00A 1HNXL 3MXUA 2E3TA 2EY6A 1D5MC 5M5XB 2R7ZG 3KK7A 2IBIB 3D32A 3SVMA 3K5NA 2L55A 1ZOYB 4XE0A 1FCLA 1WXQA 1EY8A 4JK1C 4A76A 2WXGA 5CTRC 2PNHA 4LF9L 1ZP0B 4JI0L 1E8YA 4EFOA 3HOZH 1TWFH 3Q0AA 4KY5A 1HNWQ 1C79A 4NP5A 3RNUA 2LXKA 3JC66 1FIQA 4KGSA 3RT3B 2QJLA 3PZ7A 5CMDA 3CCJA 3HVZA 1J19A 3NZSA 1YVCA 4G0NB 3NENA 4IUQA 3T53B 3W9CB 2ZXRA 2E5LQ 5ELBA 3FPPA 4LF6L 3PVLA 4DV2L 3S2HB 3ZRFA 2FFKB 1FYCA 2PZWA 4K5VA 1GUWA 1OXTA 2N88A 4Y7NB 4MNOA 1VQCA 3WOEA 4A3GH 2FCNA 1II3A 4L8JA 1PRTD 2ZM6Q 2KZRA 2VXWA 4GOPC 2AWNA 5JOBA 3TEXA 2HTME 2X6LA 4XDXA 2KMCA 1SE8A 4P2CB 3UI2A 3VR8B 3TRZA 5LMNL 4A75A 4BVUC 3HOWB 3RZFA 1E10A 4RF0A 2A6HD 1D5XC 3ULJA 2MP2A 1N9WA 4KKSA 1J0GA 3GTOB 4K6LA 5DAUA 1EWHA 1B7YB 3A8IE 3HOXB 1SSNA 4F8MA 1SSOA 4NQKE 4DDID 1TXYA 4H44C 3D0FA 1XNRL 4II3B 2BDNA 2K3UA 1TJEA 3F2BA 3Q8FA 1F2MA 1YIWA 4OWXB 3T1HQ 4RMAA 5BYSA 5FR3A 3GE3C 2B2UA 3KH0A 2D5GA 3EGRA 2NPTA 2DY7A 1SR3A 3P1MA 4HRSA 1GG3A 1L5PA 2MA9B 4EQNA 1ESRA 3MXNB 1AYFA 2QC8A 4RFBA 3GZNI 4KY7A 3URYA 3UDFA 1KQSA 4JI2L 4LNNA 1VQHA 1IKMA 1XMQL 2AQ2B 1B53A 3W1GA 5M3MH 1DOIA 2FCQA 1EOTA 1VQ9A 3RULA 1E1OA 5D65A 2UXCQ 3RN5A 2IY0B 2A5HA 4PS3A 1D3ZA 3V62A 1M4VA 1IGCA 4N8FA 5EQ0A 4FHKA 3CSFA 1WTQA 1FRDA 1VQ7A 1NBWA 3X3NA 3KYHC 1E9MA 2H88B 4LTUA 2K8BA 1NSNS 2AUJD 4B95A 1L0VB 2VQEL 1DOMA 1YI2A 2BA0A 2EKEC 2XWJB 1RRBA 2HHHQ 3FKYA 1A5RA 3U4EG 2EYOA 3O13A 2GVAA 4C3IB 4RGNA 4LF5L 3BVGA 2X69A 4LF7Q 2KDIA 4AWJA 4LJZC 1B3AA 4DN4M 4C4VB 2HJ8A 1EEID 2V1YA 4U673 4FF2A 2CKHB 2ZJQA 3PT2B 1GB4A 2F0UA 1NYQA 1KTKA 3K80C 3C1EA 1HTLD 4NNJB 3JVZX 2C5LC 3VYSA 4DNTB 4XGAB 2KWVB 3VR9B 3ZO5B 4CO7A 3HKZG 2C9OA 1WI5A 1I4HA 4D2KA 3RUIB 1N32L 3AFPA 3HKZE 3Q8DA 3I4MB 3S17H 1NENB 1WJ4A 3I9V1 4GLSC 4DUZQ 2XBBC 1KDCA 5C44G 2W55A 3JSVA 2GVBA 1FXTB 3UINB 1LM8B 2A68C 4S17A 2K5WA 4A3CH 3D3RA 4X3KA 1I6HB 1GUOA 3K7UC 2JA7H 3X3MA 3DBRI 1S5FD 1E24A 2RHQB 2WV6D 2KN4A 4NKLA 5IGFA 3ZXVA 2KLCA 3L08A 4DAYB 3APFA 3NSWA 2L00B 3S14B 1V97A 4L6TB 1OTRB 3VH4B 2DNCA 2EY1A 4O0AA 1PTOB 5C0XG 1E7VA 2WXPA 1SNPA 3Q8BA 5GAGC 1LFDA 3GTJH 2NWGA 3K57A 1J5EQ 4FJYA 3CSTA 1L0WA 3U52E 3S9WA 4MM3B 3GTMB 4OVUA 3UDIA 4OO1I 1LO5D 1XX8A 4HKZE 2GBKA 5KYIA 5IT9E 1PDQA 2WNMA 1Y1VG 2Q5WD 4HROA 2JU6X 2R93G 5LLIA 2NB0A 1UZXB 3SEBA 4YY3L 3G7LA 2IW3A 1L1OC 2RPQA 1SMYD 4ZAIA 2W3RA 3IFWB 1QUQA 3RZWC 3KJPA 2KWUB 4XC2A 4LUVA 4KDLB 2KX3A 1QNKA 4NXMQ 4IC7B 1EWCA 4KKJA 4LCDE 3NOBA 3I55A 1FCCC 2Y3AA 3P63A 1QZEA 3ZTCA 2JQRB 1SYDA 3KUDB 2F0IA 1TT2A 2PZUA 2DNFA 2YVCA 3PO2H 1CZPA 5CV9A 2LRWA 3IVFA 1C78A 1JWBD 2FUG1 3QARA 3BZKA 2B63H 2PE9A 1Y8NB 1C4AA 4MSQB 1VMPA 3D6WA 1GVPA 3GTLB 1J8IA 2D3BA 3G6JB 4LJOB 4DV5Q 1BUVT 2ON8A 4HJGE 1KLGD 2L0FA 3MAQA 4DR7Q 3S24A 4KHZA 3F2DA 2HTHA 2YEPF 4GOCA 1FL0A 2AQ3B 1L2NA 2F4VL 4GDLA 1JJCB 1KAWA 3MFGA 1GM5A 5CV7A 3HK0A 3ONAB 4P16A 2LD9A 4W9LA 2E8GA 2F0NA 4XDDA 1ZYRD 1T3QA 4KHPL 3DEOA 3KLSX 4GN3B 5E6OA 5JH5C 3L0WB 4DPGA 4JYAL 4XYCA 2CQAA 2F0TA 4JBWA 2LGSA 1RCVD 3DHIC 4DV3L 1O78A 5FLMH 2B2YC 3APCA 1DXMA 2WXIA 2XK5B 3GB1A 5HFYA 2A69D 1UELA 1PV4A 4MDKE 1I50H 2NVQB 4RAUC 1A6XA 4A6QA 1ILQA 4BBSH 4AS1A 4PS8A 4MGIE 2C7HA 1RF2D 4C3JH 1NE3A 4A8XC 1SXTA 4P73A 4DWFA 3H15A 4IQZA 4A3FB 4PT5A 5KRUA 1CT1D 3U4ZA 4J6IA 3HOUG 4K1RB 3K9OB 2IWHA 4AIMA 1V5TA 1X3PA 2MPMA 2A8VA 2HD3A 2KCCA 3VYUA 4X66Q 3VR3A 2MO1A 1X3EA 3J80L 3S15B 3QX1A 3BG3A 2D07B 2EMTA 4YTNB 3NTKA 2RGFA 1BR9A 2EE1A 3LDZE 4R9WA 1UWMA 3BY4B 2K8HA 4I7ZC 2A73B 4TVAB 4LNIA 4HJ9A 2O2VB 1ZEQX 4BA2I 3SU8X 1A2UA 1FVIA 4DK0A 1SFOB 2RKSA 1E8ZA 1TWCH 1N62A 1BBWA 2PYKA 2Z6KA 4X64L 1V43A 3SHLA 3EJIA 2K1FA 1XEEA 1VQKA 3NVWA 2L1BA 5C4XB 2UWQA 2LGIA 5CGKA 3FPUB 1I3QB 3HOVG 1FGUA 3RPFC 1VQBA 3KW5B 1E8WA 1C4PA 1STEA 2KJHB 1SNDA 4OIKA 3RZOB 1EWIA 3P42A 4RA8A 3KLSA 2PPHA 5C6AA 5FOBB 3PLUA 1LTTD 1TKWB 3MA2B 4JI8L 4GLXA 1G6ZA 5GAHC 2I1JA 2L0CA 1IBKQ 1TKEA 4DQOC 1LUZA 1YJJA 3IAS1 4QMGA 1IL8A 3MFYA 3ZXRA 4LAAA 3KYDD 3LGJA 5M5XH 4MH0E 4EE2A 5JVG3 2HCCA 3JAML 4OZAA 1FFVA 3VDZA 2FUHB 4R8IA 1NI2A 4JI5L 4KTAA 1A2TA 5IGDA 4CJ0B 1WE7A 2JA6G 2JA8G 1B3QA 1TS5A 2V4LA 5C3EB 3STBD 2EOTA 4JV5L 1YZ6A 1YHAA 5IIFA 2JE6I 5COYA 2LMCB 2RHSB 1ZDVA 3HOYB 3KOJA 2CCZA 1IBML 1K52A 2KT7A 1PLFA 4R4TA 5I9OA 1V8QA 2JZ3B 2B2TA 2F0SA 4EVOA 1WR6E 2UU9L 1U9RA 1NAPA 3S2HH 2CH4W 5T1IA 3OAWA 4J6HA 2JN4A 3IL8A 3I4OA 4A3IB 4Y7NH 1H8CA 2DY8A 2HJ1A 2I0QA 2LEKA 4HPPA 2Z1CA 4P71A 2ZJRA 1MG8A 4IUPA 1WI0A 3JAMc 4FN2A 1PRTF 2N9EB 5C5LA 3FKIB 2EDGA 3HOWH 1YNJC 1TR5A 2N9KA 3HIZA 3CCSA 2K5VA 2EYMA 3AN1A 1DOLA 1OXSC 2X8XX 2BYTA 3VDYA 1VQPA 3GTOH 4R4IA 1QQRA 2F3WA 1LGRA 1WXAA 2MP1A 3HOXH 1FJGL 3RZDB 1PQSA 2PE6B 5J18A 1PYSB 1Y14B 3TP8A 1J7BA 2M0AA 4LUZA 2F0DA 1WX7A 2MJEA 4HDQA 1ENAA 3PIO3 5BN3A 1C4QA 2KFKB 4OVVA 4KZCA 3CCMA 1PTOC 1HCZA 5D3DA 1ACCA 4KN7C 3IRBA 3KFUA 1TWGB 4S3SA 3QB3A 2ZW1A 4NJCA 2PMZB 5D6JB 3PS6A 2JSOA 2XRQD 3U7ZA 2WWZA 2O2LD 2WB1B 2WDQB 3GZNB 2N0SB 3B2FA 1Y69U 4MH8A 3N1XC 5AZHA 1NEKB 1MKHA 2MX2A 1EQTA 3RD4A 5HURA 3PO3G 4QY7A 4MEMA 5KHQA 1YN3A 4LF9Q 1E7UA 2HE7A 3B2GA 1LTID 2L9HA 4JI0Q 2JX5A 3DBHI 2YLMA 2O5JC 5CX3A 3P4PB 1A3UA 3TL5A 3RFZB 4JE3B 1SNCA 1DOXA 3SXHA 2AHOB 4DUYL 4UP8A 4HIMA 3T13A 5AUKA 2QEJC 2ZZPB 3L17A 2BS4B 2MEKA 1YD8U 1AP0A 1N36L 2DYBA 3S16B 1RFAA 2RPVA 2DZKA 5HI1A 3D31A 2CWPA 4LF6Q 1EY0A 3IBEA 4DV2Q 3DOWA 1STBA 4ACFA 3P75A 1F2LA 2AWTA 3AE1B 4HN7A 4C3IH 4LJPB 3GD7A 4GN4B 5E3FA 3N1ZC 1LTLA 2B2VA 2B76B 1S5ED 4Q5VA 2K5DA 4JG2A 4DNIA 2JYEA 2OTJA 4DR1Q 1MJDA 3MHZA 1Q0WB 1KM7A 4XIGS 1W6KA 3ZTDA 3BINA 1VQLA 4P74A 5IP7H 1N33Q 1EZ6A 3RN2A 4LNFA 2BPSA 3M95A 1TKYA 1WJ6A 4HWIB 4Q0FA 4YCVA 3WA0A 3FAHA 1C1YB 3DWPA 1I4QA 1HPCA 1QJOA 2EY2A 3TREA 1YQBA 3C8YA 1F2RC 1LABA 1SYEA 2JEAI 4IOCA 3I4MH 1SN8A 1CM9A 1U4AA 1V8CA 2DHZA 2WU5B 5L83A 2K8CA 1I6HH 2GB1A 1LV9A 1LTSD 5IOIA 1UEBA 4MELA 3DBRB 4A3GG 4KDIC 4PZ8A 2GBJA 2KTRA 3WAOA 1SYCA 4JI2Q 1YX6B 1UEAB 2UUCQ 3S14H 1ZGUB 2JF5A 3ZVVA 1XMQQ 5J17A 2Z0EB 1PTOH 4QB4A 5BR8L 2V0GA 2EYPA 3L2PA 4HJ5A 3FDTA 4WURA 3R8BA 3CPFA 1UE5A 5EE9A 1E0BA 4LFCL 5LNK1 3C19A 3GTMH 1ZKHA 4UP9A 3VYRA 2ZT9C 3QAQA 4GGQA 4A3OA 2DENB 4JI3L 1R9TB 2R2QA 3I4NB 1V2YA 4AOFA 4GN1A 3DWGC 1K0RA 2A19A 3V6CB 1ASZA 1PYBA 3H0GB 5NUCA 1B44D 3C0RB 5IGGA 1CKMA 4LW1A 3A9JB 2FIDA 4LF5Q 1PH6A 1H9SB 2ALYB 2KKCA 1C8CA 5CYUA 5IYDH 4X3UA 4JIOU 1K3RA 2KCNA 4HIOA 2OQ0A 4N6EB 2XSCA 4G4KA 2G5DA 1HZ6A 4JOIA 4OIJA 3WDNA 1Q1BA 3OMCA 3CQZB 5IGBA 1Q90A 1EF5A 5C4JB 2ZTCA 1XLNA 5M3MG 3H7PA 2K75A 4ZRKA 4XT1B 4JGHB 3QOJA 3R2IA 3N1YC 3A5ZB 4XZ4A 2OHFA 5LL6S 2R7DA 3MJ5A 5C23A 4BFRA 1SRUA 2L76A 4P75A 1F9JA 5EGTA 3Q14C 2NBWB 1WTHA 3FC4A 4RKLA 4EUTA 4F8CB 3QC8B 3RCZA 2GI9A 5JHAA 1KDBA 4B9WA 2ZTEA 2UYZB 2MHVA 2KD0A 3GTLH 4IPHA 4OHJA 4OGQC 5A2QL 3NVYA 1GHKA 1HTOA 4OEMB 2I07B 2JA5B 3T56B 2BYVE 4DR2L 3CXCA 4UY8C 2WYQA 1JWAD 4X65L 5H92C 5HGTA 3KF6A 1FNUA 1IW7D 2HUGA 3SGIA 3GTKB 1T0QC 1N8RC 3S1RB 1CA6A 3CD6A 2MBQA 2XTIA 2CFMA 4XYQA 4ZOHC 4QUCA 2KJ6A 2Y0SG 2KMAA 1SLJA 2QDLA 2WIIB 3OW2A 3CRLC 4A3BB 2WHIA 2JXMB 3NBHB 3PF4A 4WFN3 2H4OA 1HR0W 3GV6A 3AB5A 5T8IA 3HEJA 1F52A 4TKNA 2NVQH 3CIRB 1JB3A 2OJRA 5EBCA 5M5WB 4FF1A 5JVH3 1NI3A 1VQOA 4YCUA 1WXMA 2NMQA 2BB6A 4BKGA 2NZHA 3AH7A 2MQHA 2NCNA 1LM0A 1OXXK 2RR9A 2QGQA 1WYGA 4LMQD 1CZGA 1G2SA 4O1NA 3CCRA 2UUAL 1BDOA 2NN6I 5TSSA 3BS1A 1GXDC 1JJ2A 3ZUNA 4A3CG 3Q22A 2F0KA 1EIYB 1CJEA 5EPJA 4XQJA 2JA7G 3FILA 1X3GA 4QF4A 3S15H 2YYZA 1C3TA 2QDFA 1YJ1A 1EO6A 3OG5A 3RMHA 2A5UA 3R66C 1GC6A 2C7NB 1YBYA 2IO3B 4IUTA 1E90A 1SE4A 1OTCA 2IT1A 1JR0D 3CC7A 5G3LD 1WE6A 2E75C 1SFOH 2J52A 5EKIA 1AE3A 4G7ZC 2WXNA 1F9QA 1CHPD 4IFDI 2CW0D 1K0SA 2G4SA 1OO9B 1ICFB 5CR3A 3AEVA 4JCVE 5D3IB 1HE8A 2ES2A 4GXBA 3E0JA 4KLKA 4ICUA 1N34L 5E4XA 4PMWA 1ROEA 1WGHA 3U2SC 5C4XH 1IBXA 3UDXA 1D6EC 4G11A 4GSWA 1I3QH 1O7YA 4CDCC 4ZHPA 4RKBA 4ANVA 1EF1A 3EROA 1K8MA 2QMTA 2WXKA 1P8LA 1VQNA 5HGQA 3Q69A 4ARCA 2JYOA 5JJZA 2OEDA 1E8XA 1PMRA 3PCOB 3RZOH 3Q3JA 4PYUA 1YX5B 3T1YL 1I6VC 5IAAC 2KEEA 1T0RC 4K8IA 4GS3A 1WSPA 4JYAQ 1IXRA 2E2IB 4DV3Q 3TDQA 3ONSA 3TMPB 4X62L 4IDIA 3TJPA 3K5MA 4PQXA 1ILPA 1IKLA 3PUWA 3SE0A 4HPLB 1FNVA 4WWOA 4YL8A 2DJFC 2K0PA 2F0PA 2MGSA 3MC9A 2MUYA 1IYVA 3BDCA 3PO2G 1OFFA 2CQOA 3MZ5A 5ISRA 1KRSA 5C3EH 2B63G 2KO3A 3UE1A 5K5PA 3FEWX 4JBKA 1YNND 4XQQA 3HOYH 2D2CC 4TKOB 1WTOA 1K8GA 2LXJA 2RCNA 4GN5A 2DAJA 5JJKA 4TUUA 2YEPB 4YSYB 4HR7B 4K0KL 1YITA 3T51B 1B9RA 2QIEB 5HG2A 1IBLL 2AL3A 2HDEA 1RIPA 1HXYD 5EJWA 4GDKA 5BO4B 4A3IH 1BBUA 3H8HA 5IGEA 2R7ZB 5E1FA 1PH8A 3HM6X 1Z2MA 3SR6A 2IGGA 1XCQL 5KHOA 3SDZA 1VLBA 3ERQA 1YN4A 1VQMA 2WU2B 1AE2A 3DPDA 3MHSD 4LF4Q 5FLMG 1BCPD 1U4PA 4B3TL 5ELCA 4MSMB 2VY3A 2LXCA 4X64Q 1JE5A 1KLUD 3FKIH 4FULA 4NZLB 1K73C 2N49A 4BBSG 3NS1A 4DV6L 1VQ5A 1S1QB 4C3JG 4CBVA 3CF6E 1DM0B 1PFNA 4MJSA 4IFDJ 3RZDH 3QIAA 3FMCA 5E7NA 3Q8EA 3JAMi 4OONA 3J81c 3PV0A 4KX6B 4RNAA 4MGKE 1XLPA 2NZ1D 4RWSC 2K03A 3KF8A 3MVVA 4JI8Q 5C2TB 1TWGH 2F0LA 2D9UA 2F0JA 4LFBL 3BYYB 3DVGY 3TEHB 2L5TA 4DV1L 2LFIA 5FLXE 4F7ZA 3JAME 2N4FA 1LTBD 4FVMA 4HJ7A 4XYOA 2WAQE 1MBYA 5T1GA 2EZVA 3BWUD 1PFDA 4K2LA 5IN7A 3MXGA 2N3SA 4JI5Q 1KXLA 2BE5C 1VD2A 2MQJA 4HIKA 1N5WA 1TWAB 3FVQA 4JL9A 5EE3A 3A7AB 2JZZA 3PGEA 3DBHB 1D2BA 3A0JA 4WWPA 1WXSA 2QHOA 2EYLA 1A3VA 1SNMA 4POGA 4FJVB 2LSSA 2N55A 3TEYA 4XDCA 2RCFA 1UBQA 1CKNB 4RH6A 4KY6A 3NWTA 5C5MA 5M3FB 1PH1A 4QCLA 2Q8IB 2UU9Q 1PHJA 4TRDA 2D3CA 4US8A 3H94A 4TQUS 3PRZA 2KDEB 3VAWA 4K14A 3GS2A 3Q3NC 2B3GA 3PQIA 1S40A 1Q5WB 4ZHOA 1IYUA 3PPAA 3X23A 4IZ8A 4V0BA 3H6MA 4ME3A 3J7A5 1I4XA 2NBUA 1Y8PB 2JEBI 1P3QU 2LJ5A 4YXDB 3NRZA 3ZYYX 3K7AB 1CI3M 5IOCA 2IHEA 1L6UA 3ZNZB 4K7SA 4BWGB 4A93H 1T6BX 5KNDA 2OXPA 1VZ7A 1JWSD 2KHJA 3I90A 4BBRB 1LACA 2NTTA 3I70A 3J7ZC 4MACA 4EGVA 3C1FA 1ZUD2 2EY5A 4ASWC 3KUPA 4DFAA 1WR1A 3SHQA 1P7FA 2IX0A 3NQTA 3CKIB 1NMFA 1NVID 1IYFA 1JWMD 1YN5A 2DZMA 2KQ4X 3CP0A 1SF0A 2MWSB 3NEMA 1PH5A 3M4OB 3H09A 2JPHA 2DLBA 1VZ6A 2R7FA 2JT4B 3S2DB 4ZUJA 3SFDB 4B3SL 2KN5A 1Q1EA 2UUBL 1PRTB 2QEXA 2K52A 3D4RA 4DV7Q 5TR5A 3B1LX 1TZOA 2Y5BB 3HOWG 2NBVB 2W3SA 2BTEA 2MJ3A 2D3GA 5M5YB 4LDTD 4A3JB 2PQAB 4YIJA 3HUIA 4IWOA 4DUYQ 2L05A 4WJQA 2R6GA 4JVZA 3DM1A 1STAA 1E3PA 4RHSA 3HOXG 1R9TH 4OO1H 1PFSA 1L4ZB 1V49A 3I4NH 3APDA 4NPSA 3PO0A 1LYLA 4R4QA 3ZNHB 2PMVA 3SK8A 1K8RB 2EYFA 2VRRB 3V2TA 1WTVA 1WY8A 3RUZA 1MI0A 3H0GH 2O6VA 3AXCA 2Y5PA 1V1PA 2ZCCA 4JI7L 2DBYA 4W9JA 4C3HB 4ODGA 1YJ9A 1F0ZA 3QG1A 5I6YA 1TYGB 1GB1A 4DV0Q 2E2JB 4EZJA 4MIUA 3Q24A 1IW7C 2VH2A 3VTWA 1CK1A 1CUKA 2K05A 2JJQA 4WJNA 2RSOA 3LXFA 4YWLA 3AYHB 5C4JH 1LLRD 3IFTA 5MPOA 4DXAB 2DGYA 2KBNA 3LWEA 2ICIA 3PUZA 1GUGA 3EFUA 3UQBA 1HJPA 3UIPB 2ZXPA 2K32A 1QILA 1ENCA 2KVRA 4C7ZA 4BBNF 1HQMC 1Y8RC 4GOPA 2E2HB 2PPBC 2FHTA 3T4AC 2CU1A 2INPE 1XPRA 2V3PA 4KJNA 2Z0DB 3UDGA 2JA5H 1FXAA 5FJ8H 1JROA 2K1BA 1TWHB 3VUYA 4IURA 3RNAC 4KGTA 3GTKH 1NY4A 2MW5A 4C3IG 4XT3B 3S1RH 2IO0B 5DPWA 3WWVA 3PRMB 3S1NB 4EQOA 1O80A 1BT0A 2C7MB 1JICA 1JOQA 2N9XA 4A3BH 3CU7A 3RN9C 4UPAA 2OTLA 4WH4A 1VQDA 5BR8Q 4OWWB 4LWCA 2NVXB 4LF8L 4K5XA 3R2TA 4AQ7A 4WQMA 5IP7G 2GOWA 5M5WH 1WX9A 4LFCQ 3DBSA 4FXCA 4B3ML 1Q8IA 2JXXA 1WD0A 3QIJA 3K5OA 1AWDA 2F0VA 4JI3Q 1XF5L 2WXMA 4NJ6A 5ELNA 3V6EB 2A4ZA 1I35A 2AEHA 3I4MG 3NK9A 4BZAA 2K50A 5ELDA 1KABA 2C5CA 1SBBB 2KHIA 3U4VA 1WTPA 2BGFA 1L2FA 1LT5D 1V86A 2ZJDA 4BKTA 4E3CA 5I2YA 1AZPA 4IJLA 2K33A 2K01A 1QLBB 4GB9A 1K53A 2MHJA 4GNXB 3PZ8A 1RTOA 3HGBA 2EKIA 2AWOA 1WTXA 1B2TA 2WS3B 3BU2A 1WJUA 2BVCA 3L10B 3H7PB 4WORA 2I5HA 4BY1B 4OW0A 1NYRA 3A55A 3RNBC 1ZKOA 5BYRA 2OEOA 4A3KB 2D5DA 4W9IA 4HCEA 4IM0A 1QOBA 1X9NA 4DR4L 3J7YW 2R3ZA 1IGDA 3G48A 2ZVOA 3V61A 5G3LF 4HVBA 5DCNA 1A3TA 2M1MA 3RYTA 3NVZA 1GPXA 5A2QE 2FCMA 2KQ7A 3Q3MC 2GA4B 1TY2A 3OHXC 1FR3A 1EQQA 4B3RQ 1TTNA 4R8NA 1H9KA 2K5HA 3M3YB 4QQBX 2D3AA 4DR2Q 3TP7A 1WCMB 4WWNA 3GO5A 4IUNA 3DHQA 2WDRB 2MH7A 5JEAJ 1GO3E 1FM0D 2BKFA 3FRPB 3W1SC 4RGMA 3AEEB 3OYYA 1U5KA 4JX1C 3EBEA 5IYDG 2EPBA 4XTCS 1XYIA 4NXNL 1VF7A 1TGZB 2JK8A 1V9PA 4AQYL 1RWSA 4AP4C 1XTCD 4GIVA 4AUQC 1VJKA 1Q8KA 1TU2B 4OWTB 4CGYB 2YTVA 2KK8A 2H1EA 2WACA 3HOVB 5AJ3L 2JVCA 4OVZA 1MG4A 2A6ED 5LXIB 1L4DB 2PJHA 2KVZA 3VR2A 2INDC 1Q3LA 4QIWB 1XMOL 1D7QA 2UUAQ 2RVLA 4L2YA 2QA4A 3PUVA 3VHTC 2KDFB 4IKGA 4KN4C 2B29A 4N9PA 3GTGB 1CMXB 3H7SA 2RDGA 2LGDA 3ZW3A 1KOTA 3A9KA 3Q6BA 2R7ZH 3GTQB 2K5QA 4FA6A 1Q1OA 3Q2AC 4OZCA 3M4YA 1DGJA 3IT6B 4HJAA 3TP6A 4L5RC 2K4KA 1IBXB 1VQ6A 1JQ4A 2AQ1B 4EOYA 3I2ZA 2IGDA 1BCPF 3DDCB 2HT1A 1M1KC 1ISNA 4GKJL 1X6OA 1L1OA 4PMCA 5CHFA 1KLVA 3BK1A 3AQQA 1OQQA 1H9RA 1XT9B 5K36H 3UE0A 3TCAA 1EM7A 4QL5A 4MN3A 4M0WB 1ONLA 4FNFA 3WAMA 2EIFA 3HG9A 1PRTC 5FLXL 3T1YQ 4GZYC 4LUOA 3H3VI 1WRDB 3TEZA 1C48A 1T5XD 4REZA 1QVGA 2REXA 2N9PC 1EY6A 2XGTA 3FP9A 5EDSA 4HPMB 4AJYB 4A20A 1GUNA 3UQAA 1O7LA 4FLHA 4X62Q 4M8AA 1NR2A 4HXDA 2A1AA 2A6HC 2GLSA 4K81A 4PMBA 3GE8C 1PGBA 2IY1B 1J8CA 3VR4A 3J81i 2BT6A 1V1OA 3ML8A 4JBMA 4JI6L 3F2UA 2O5IC 1WF9A 2JYTA 3AULA 3RNFC 1TWAH 5IO9A 4W9CA 5C4XG 2QW7A 4DR5L 4E6IA 4DNRB 2BOSA 5DM63 2MNAA 1R4MI 1VR9A 3U30A 2B2YA 1X3FA 5IWAQ 1TZ1A 2RBMA 3J81E 5FLXc 2JXTA 5M3FH 1GNUA 2KLGA 3AEDB 4K0KQ 2B8GA 2DWQA 1XLOA 5CHWA 1IBLQ 4A3EB 1RAXA 1WGYA 2Q2UA 2BWES 2MSED 2ZNVB 2UXDQ 1PUTA 3KLRA 3OWFA 4OX9Q 4DU9A 4IOIE 1FD6A 1VQFA 1LTRD 2KDBA 3HKSA 1OEYA 1QOHA 5L95C 1RHPA 1V5OA 3MHBA 3ZDTA 4NAMA 4ICVA 1YQ3B 5AFWA 1N6ZA 2Z4IA 4IG7B 2CJNA 2GMIC 1NMGA 2XEWA 3K7AH 1HZ5A 3N30A 4BKSA 5FKAC 1EIFA 1P0RA 5G5HA 5C3EG 3RD2A 1G8ZD 1X32A 2VB3X 3N52A 1SAPA 4BBRH 3ZJVA 2M56B 1F2YA 1HNXQ 1SIFA 3T1HL 3HOYG 2K14A 4A3DB 2LFNA 2KOXA 3PMFA 2BS3B 1TVXA 3J7AF 2XNAC 2K6DB 1EY4A 4KIKA 1E22A 3J9CA 2PW5A 5JJLA 4DV4L 4A3IG 3M4OH 2K9XA 4DHJD 2L4NA 4BY7G 4H2AA 1YJWA 4OELB 2KMMA 3S2DH 1ASYA 1MSGA 1MSHA 1CQVA 4B9XA 1YOVB 2AYOB 4IM2A 2KVMA 2Z8LA 4P72A 5IP9H 2UXCL 4ZRPA 3A8KE 3MC0B 3FKIG 4WJ4A 1NBFC 2B3AA 3MJWA 5DNFA 3NUHB 1Q82C 1HRJA 2Y5CA 5JAVA 5M5YH 4A3JH 1L0YB 1LTAD 2LJIA 1QVCA 5LL6X 3B0AA 1X56A 1UUPA 3A8JE 4GNXC 1Z9FA 4JI1L 4FO2A 1NDDA 2EXZA 4YCWA 4POFA 1MFWA 4HSVA 1STYA 4OZBA 4EKUA 2Z9HA 4H0LC 4AYBB 2JWUA 3ENEA 5LMNQ 3DMUA 2MP2B 1WYDA 4JPSA 4GLVB 1RYJA 2L7RA 3G6EA 4LF7L 2K25A 2LI5A 3BJUA 4C3HH 2O6VD 4R4OA 2SDFA 4FF4A 2Z4HA 3PUYA 3HOZG 2E2JH 4DBGA 2EJMA 1HZCA 2PMZE 2WB1G 3A33B 3OW7A 2WB1E 2WX1A 5LXHA 1FEHA 1XNRQ 1ZXHA 2HIVA 1WGGA 3CHBD 2NPTB 1C76A 4F7XA 1S5BD 1YIJA 4KSKC 3VFKA 3R93A 2I5LX 4ALPA 3KBXA 5EE1A 2D62A 3CPWA 1S5DD 1EQVA 4YWMA 1FRRA 1WYWB 1B9NA 2E2HH 2K28A 3PSEB 1SJHD 1BQQT 2ZEQA 2AL6A 3CMAA 4ZRQA 2CH4A 2CWAA 1JW9D 4C7YA 4FADA 2N9LA 1SMYC 1PH3A 5DPTA 3MTSA 1WGDA 2D10A 2XRSD 1F9PA 4KKTA 4QUFA 4JI4L 1TWHH 3GTPB 5BMGA 3OIQA 4RF1A 3NP8A 5CC4A 2B2WA 3K0XA 3S1NH 1PYWD 4RMFA 4DAYA 3AEBB 1HA6A 2LUEA 3VTVA 1C7YA 1J5EL 2GRIA 2NVXH 3RMKC 3WALA 2VQEQ 1SIJA 4L5QA 4DHZB 4URKA 2NVYB 2B8FA 1EY5A 4I6LB 3L9AX 3RI7C 4KVGB 4EEWA 3BDLA 3PIPA 5C0XI 4A4IA 1CA5A 4A93G 4MM3A 1YQ4B 3KUCB 3ZIMA 1V1PB 3AE9B 5H8YE 1STNA 2QCPX 1D1KA 1EYDA 2XIWA 4R3DA 2M9VA 3AECB 1QE6A 1ZYRC 2R92B 4MTKA 2WXRA 4JWUC 1HNZL 5G2NA 4JI7Q 1J7AA 3OTOL 1L0XB 3K5LA 2CS4A 4YSXB 2NN6H 2Y0SB 4ZK9B 2IJ0A 5JXVA 3LX0A 3ULPA 3IKJA 2W9NA 2A69C 2VNUD 3LYYA 2WXOA 1JJGA 4BY1H 3JSVB 2HIXA 1N32Q 3E56A 1UWVA 1V1QA 1YMHE 4A90A 4A3KH 3KWVA 2F03A 3A5UA 2EELA 3VA5A 3P7JA 3I63C 1QOFA 3I4LA 2L12A 1CZWA 3QWNA 4IFDH 3GDEA 2MO0A 1D8LA 1Y8OB 3CMEA 1WWTA 2KWDA 2BYEA 1DYQA 3AM9A 3PRPB 5AZGA 3WCQA 4HLEA 2CR5A 2EJGC 4DR7L 4OO1G 4KD3A 4WJPA 3I4NG 3VXWA 4H13C 3M3YH 1Q10A 2A6EC 1AH9A 2QDBA 2L52A 3Q3OC 3ZRCA 1WCMH 5LMUL 2LWPA 4M8MA 1O7IA 1PH2A 2KAJA 3W5VB 3TS2A 3K9PB 2FJ2A 4DK6C 2OJWA 4I6NB 1M8AA 2F0GA 2KACA 2J42A 4KHVA 3DVNU 1EUJA 1RKNA 1G51A 1E2VA 2MJ8A 3AEGB 1CFMA 2Q8RE 2VL6A 1N60A 1PDXA 1SB3C 5A35A 1ZE3D 4NY0A 2IPKD 3SK4A 2L83A 2KUMA 4A3FH 3RNEC 4A3MB 4RCNA 1EIHA 2VZKD 4LF8Q 1I4GA 1CQFA 1QUQB 5KYLA 4B3MQ 2K22A 3CAMA 2A68D 1T0SC 3VTUA 1HHVA 4YY3Q 1WTRA 3M7NA 1EZ8A 2NBFA 2BKRB 2ZNVC 1NUCA 5I4DA 1HH2P 4Y52H 3WOFA 3V3XA 1KRHA 3M9BA 5C3XA 3RNCC 5KGUA 4PG3A 4X66L 2JA5G 3S2AA 1PH9A 5FJ8G 1IUEA 5C0XJ 4HJ8A 4DR3L 1F2ZA 3EVQA 4RCOA 1WTWA 2BDOA 3HS0C 1KDAA 4OL7A 3GTGH 1XCTL 1PFMA 4B6WA 4GKKL 3NVVA 4DGZA 1TIID 2Q2HA 2RA4A 3GTQH 2BS2B 3CCVA 2DJGC 3AB9A 3M7GA 4CKEA 1EYCA 4A3BG 3CW2C 1NTGA 3H1UA 1EFWA 4GDLB 4QAYA 1Y1WB 5FO9B 3PSIA 2D0OA 3K58A 3STBC 3AE3B 3D6CA 2K5NA 1VQJA 5KEEA 5LHY1 1SROA 1NNXA 1WRIA 5I2XA 2DX5B 2F4VQ 2CHWA 4LNOA 4KHPQ 3N3KB 3OLMD 1K28A 2ID0A 3EIVA 4CKBA 2VQFL 2WINB 1HUNA 1EQRA 3AE5B 3NHHA 4HK2A 3QK0A 2PW7A 2R2OA 4CJ1B 5IKCM 3V96A 2VZAA 2I2YA 1I5FA 1OXUA 2M00A 2WXJA 1GHJA 5HKHA 2XN9C 1XNQL 1MHXA 1X1MA 1QCBD 1K3BC 3L54A 1SYBA 3AU7A 3NZ3A 2AUKA 2E76C 3NZUA 3AE7B 4NAWA 4G3XB 1XXGA 1R4QB 4NXNQ 1ZW7A 1H95A 3VRBB 3RLFA 3I91A 2F52A 2KX0A 3TP5A 2VUMB 1UAPA 1SNOA 3DQVA 4KZ0A 2CHBD 4AH6A 3RNGC 1K9MC 2ZCBA 2KANA 2IY5B 3A74A 2BB5A 4E71A 1GUTA 4HKQA 2WXLA 2M2LA 4C2MB 1N5XA 1T0YA 4TV3A 5DM73 3VUWA 2ZVNA 2WKDA 3LNNA 2IX3A 5AJ3Q 2NS5A 4I65A 1CHQD 1PZKD 3J81L 2YV5A 1EY9A 1Y56A 3TZUA 2HQLA 2V1CC 4JLCA 2PCFB 1QOGA 2HD5B 3A56A 4F1SA 1XMOQ 1ENFA 4R1JA 2F0QA 4C56C 3VR5A 1R4MB 2ASQA 4RGOS 2EQSA 4FHJA 2C60A 4JW0A 4X3SA 2FMCA 1Q46A 2B2UC 2KYWA 3OPOA 2HCIA 4A3EH 3P4SB 3TMEA 1DOYA 4L5SA 2J0MA 2INNE 4IJHA 1VQ8A 3WIMA 5KIXA 2IO2B 5E6NA 2HDLA 3WAPA 5AUIA 4US9A 1PZID 2G45B 1O7ZA 1UE7A 1U4MA 1MGSA 2E2DC 1YHBA 2IL8A 1EEFD 4WQOB 4QGUA 3PLVA 1QOAA 2J0JA 2IYDB 5IYBH 5I6WA 3W1BA 3KQ4A 2K6QA 2MBEA 4J15A 2PZTA 4BKSD 4FXKC 3CC4A 4ULLA 3PHXB 5M9OA 1RODA 1STHA 3BYTB 3N20C 4HTHA 5CV5A 2WDVB 2NVUI 2WAQG 4KV6A 3D8GA 3NQIA 1VQEA 1JALA 1HR0L 4A3DH 3NWSA 1KNEA 2CVRA 3OJ4B 3K81C 1U0LA 2KQ3A 1BO0A 5GROA 3ITPA 3E9SA 5BMIA 2Q2IA 5C1ZA 4K8JA 2LS01 3RR5A 3T8MA 4QJFA 1R7SA 1WMHA 5F2DA 4JV5Q 3ALBA 4RM9A 3I56A 1HTPA 3M62B 2NUCA 2YU9B 3UI3A 3DVGX 2C35B 1DZ1A 4I7AA 1YJIA 4DXGA 1F9RA 3K59A 1IBMQ 4JI6Q 4J1MA 5IGCA 3S16H 3I3TB 1BCPB 4IUMB 4HEDA 4ME5A 2IGHA 4B9KA 5J39A 1QZHA 1KFYB 4I6PA 2J7ZA 4DR5Q 4NQLB 5EKKA 3DM3A 2FMMA 3E5SA 1RD9D 2OWOA 1LT6D 3MEFA 5K36G 4N9F4 1FXIA 4WAAA 5EAYA 3U9SA 4K6DA 2I1KA 4A3LH 4X6AH 4HDOA 3OSOA 1XJVA 3UGBB 2RDHA 3NE5B 2ZJPA 2F0WA 1HZ9A 5CV6A 1F9SA 3V05A 3E0EA 2K7VA 3M3JA 2PTLA 1CSPA 1WJJA 3VUXA 3ZGZA 1A8VA 3PIP3 2BYFA 4ARIA 2JZPA 1I4RA 3X0WA 2BF8B 1PGAA 3NJTA 2WFWA 4DR1L 3VRAB 1U4LA 1JOKA 4DAMA 3QJYA 1C9OA 1FJGQ 2KWCA 2LXAA 3A1QA 1X65A 4BOSC 2KEDA 1EUVB 1N33L 1WH3A 1B70B 1W6JA 1VS0A 1MJCA 2F3VA 4IPGA 4YWGG 3LWUA 2AMCB 1I94L 3BK2A 1XQQA 1S4ZA 4A9AA 2ICEC 2DNEA 1LTGD 3E9IA 2WGSA 5EE0A 3TUOA 1P1AA 4EZKA 1VQ4A 2IZVB 3MP9A 3HM3A 1SYGA 3TN2A 5JEAH 3G71A 1ESFA 4KIKB 2F0EA 3M4QA 1MJEA 3Q23A 2J4XA 5J22A 2BWFA 5M3FG 2KJXA 3KUZA 4W9FA 4Z9CB 1QNUA 2PIAA 3ABVB 5E6PA 1J9OA 4IUVA 3ZQ4A 4ABNA 4A55A 2JP1A 2M17A 3HKZB 4DV4Q 3GTPH 2P5ZX 4L63B 3QO2A 1RLFA 1UGMA 3LJ3A 1YNJD 2UUCL 3DXJC 3L3OC 4KKIA 1HZBA 1SYFA 1EU3A 1E0ZA 4K5WA 4BBNC 5C44B 4PZ6A 4RM8A 3D4DA 1HFNA 2WDTB 1HQRD 4H02A 3IAYA 1N36Q 5IE8A 2JQOA 3A54A 3L16A 1VCIA 4IN3A 3R7RA 2LY7A 4BXXH 4F87A 3AEAB 2ENBA 2DZJA 2NVYH 2O4XA 1MHWC 4DAPA 1G291 1SMXA 2WQYB 4X3TA 1PTOD 4DA2A 3AE8B 1BXTA 3VA7A 2N7EA 4JI1Q 2F1MA 1VQAA 1Q86C 2QSDA 1UNSA 3CF5A 4MGZE 2KENA 4H7BA 4BBRG 2FIFA 4L1BA 4CDDC 2R92H 2G9DA 3G4SA 1WGKA 3CQZH 2MFIA 2CU3A 2PVOD 4ID6A 4B08A 4FP5D 1X3QA 4DXFA 3A9JA 3DHHC 1H9SA 2L8JA 1FMAD 1WGRA 2V4DA 1Y1VB 3P1HA 3HRZC 1AN8A 3ERSX 3PIOA 1EYGA 1WM2A 2AX5A 1SE9A 2GBNA 3OOCA 3I72A 5IP9G 2R93B 1YHQA 4HIDA 3NY5A 1KHIA 5CHVC 1I42A 1TKGA 3OJ3A 2I46A 3GOEA 3LB8C 2KTRB 3EN2A 3AE6B 2LRUA 5C3WA 4A3JG 3ZJUA 5FO7B 4J3OD 3KBGA 3ICEA 4DR6L 3H3VC 3QCAA 4LDTB 2BA1A 2RSNA 1KC8C 4UHVA 1DGSA 2F0OA 2DN8A 4PK1A 1TS2A 3R7QA 1C4CA 1VDVA 4JI4Q 1QF6A 4G7OC 1I4PA 3VH3B 1UF0A 2D11A 1KIXA 2W54A 4C3HG 1HUMA 2WLBA 1GUSA 4KSLC 3HVDA 1DD2A 4WJOA 3L0OA 3J81j 1BNZA 4TMAB 2CW0C 1E7ZA 4DKAC 2RSUA 1W3SA 1BBXC 1PZJD 3NBHA 4A3MH 3U8ZA 2Z6KC 4RGTA 3BVMA 2G4DB 1E6EB 3W1YA 2NZOA 1N63A 2VH1A 1EOVA 1R4PB 3IFDA 3SDLC 3T3OA 5ELOA 2KC1A 1TBEA 2WP8J 4M1UB 3MEHA 4F88A 2L1AA 2LKVA 1T5EA 2JA9A 4XXEA 1X54A 1T9HA 4FYDA 3ETRA 3ECIA 1HNZQ 1NR4A 4M8NA 1FPYA 1Z6HA 3OTOQ 1TT5B 2PEAA 4WWMA 4YSZB 3H9DA 3D4WA 1VMCA 2H5XA 5IY0A 2PO4A 4L23A 1S3OA 1FD7D 2UXBL 2LGYA 3Q8AA 2OOBB 2JSVX 1ET6A 2OQKA 3ER0A 5FK9C 2F4IA 2BH8A 4ZRZA 3HOUB 3GV3A 5IA7A 2N78A 1G6JA 3ZNGC 2B39A 1OGWA 4FJZA 1V81A 2N7JA 3KF6B 2DYMA 1VF5C 1Y1WH 1N61A 2PW9A 4ZYSA 1SDFA 1ET9A 3M4PA 4ZKCB 3DLLA 1STGA 4PV1C 5IP4D 2MJDA 4X65Q 1YNNC 1C0AA 3UIOB 4KV2A 3AMZA 4M02A 2HQEA 2PKOA 1LXDA 1GD7A 3DUZA 4EZLA 2PLPA 4MT5A 2E2IH 2OCEA 1HTQA 1AARA 2Z6BA 4XQNA 4XWTA 2B2TC 4BS9A 4HJKA 5LMUQ 2L15A 3HRDD 1EU4A 2N8NA 1OQRA 1BVSA 3AFQA 4IWPA 5GMVA 1P16A 4G57A 2KFJA 3AE2B 2NN6G 3KYCD 3AU5A 1BCPC 2VW9A 5G55A 1E7PB 1S5CD 5CORA 1K50A 3H3VH 3I3CA 4IPDA 2VUMH 3S1MB 4HEA1 4BY1G 3HZXA 4M01A 3NTIA 3AMUA 4A3KG 3FILB 1GC7A 3AV8A 1XLQA 5IYCH 1EY7A 4C2MH 3QJZA 1V6EA 1ICWA 1K83B 3KWLA 1E2WA 4IFDG 4DF7A 5EKLA 1LQBA 1R4NI 2DAFA 3A4RA 3MC8A 4GMVA 1VDZA 2PQEA 2IO1B 2PI2E 1SNQA 4J8QA 3DBLI 4XX5A 4FXDA 2KHWB 1ML0D 3P4RB 4M00A 1B9MA 3NPPA 3R3MA 2LASA 2MBHA 1IZ6A 1GAQB 4YHHL 1X55A 2YTXA 3E9HA 2IHFA 1WCMG 4PS7A 2BBCA 5DEHA 2JA6B 2JA8B 2HDMA 4DR3Q 4GU2A 4TSSA 2KOLA 2GN5A 1RJTA 1N34Q 3SK6A 4L5TA 4GKKQ 4WJ3M 1L7YA 2FAZA 1YNXA 5GADC 1G2TA 4LNQA 1VRAB 2KECA 4LF4L 2BW2A 4LLGM 4KKUA 1IYJB 3U50C 4AJWA 3JW0X 4P6VF 1P98A 4A3FG 3Q3FA 1JQYD 3M85A 3AI5A 3KDFA 2FXQA 1WFYA 3C2PA 5CV4A 1JMLA 2I38A 4PYZA 2KNBA 4WIPA 2GBMA 1EFID 3T16A 2K6AA 2F0FA 4ZKBB 5J1ZA 3CCEA 1TQOA 2MLBA 3C46A 3GP7A 2VQFQ 3SK5A 4LFAL 2SOBA 3J80c 5JJIA 1HFGA 5BN4A 3GQBA 3W5OA 2BH2A 4NAWB 1Z7TA 1XNQQ 4FXGC 3EC8A 2V3SA 4X57B 2WKCA 4QIWE 3N6RA 1ZDXA 3EFCA 3KVFB 1C9FA 1QKZA 2DZIA 1F77A 4HAEA 4DK3C 1TS3A 5GQOA 4N8X1 3S1QB 1HNWL 1QG7A 2B2VC 4MTNA 4DK1A 3CCQA 1JMCA 1RM6C 5DPRA 3T9LA 2VB2X 3DWMA 4PNYA 3F1ZA 2CJOA 3UF8A 3V60A 1FO4A 2YU9H 1AW7A 1E2ZA 4WJWA 5D14A 1I7HA 4UP7A 2WXQA 2LHDA 4HCPB 5J3BA 2E5LL 4GDKB 1MIUA 1MHHE 4IO9A 2NVTB 1WJNA 2ZPYA 1A15A 2ZPNA 2QCZA 3ULLA 4W9GA 3EA6A 1PVOA 3EECA 3W1SA 3VYTA 3DEPA 4O2DA 4GLAC 5KNBA 1D1IA 1KH0A 4K3BA 4P1CC 2ZM6L 4KJOA 3N9YC 3BVZA 4CHTB 1CSQA 2M0XA 4OXPA 3BZCA 4II2B 3A4SC 2F0MA 1UD7A 2Z59B 2WXFA 3PO3B 3U58A 4U68A 1AEXA 1UE1A 1QT9A 1LT3D 5JPNC 4B3TQ 2FE8A 4KGRA 1UE6A 1CKNA 2SEBD 1J6QA 4UDUC 4K3CA 1JE4A 4BY7B 3U7DA 1HZAA 4P1BC 1JT8A 4ITKA 4MJSB 4C80A 2MBBB 4DV6Q 2RDFA 2VS1A 5EPLA 2X38A 4NMZA 1V80A 3NXWA 1HA5A 1CKOA 2Q8TA 1UH6A 4FBJB 4MGYE 3K6OA 1EWYC 3KF8B 3IHPC 3NTHA 1AZQA 5G5GA 2LHEA 3W3AA 1JORA 1QWYA 3B9JA 1A62A 4BAXA 1ZPSA 1YNTE 2L11A 2B2WC 4N9TA 2MRPA 2KDMA 2ACZB 4JC0A 4N59A 4YWKA 1SE3A 1U4RA 3NS8A 1DOKA 3TZDA 4LFBQ 2BCOA 4DV1Q 3DHGC 4ANUA 3O65B 2QKIC 3MXNA 1WVLA 3IG3A 1L6VA 1HR0Q 4ILWA 2TMPA 4NDXA 3SR1A 1B4OA 1ZXTA 3H6NA 1WMHB 3T3NA 1JB7A 1KNAA 1SGHA 3HOZB 2CKZB 1TWFB 2DUDA 4A3EG 1XD3B 4CKCA 4UAIA 4ZRJA 3DVNV 4NPNA 3ND8A 2V4IB 5C4ZA 4JOIC 2K39A 1KL9A 2N1VA 1V9JA 5C44H 1EYAA 2ATWA 4DV7L 1WXVA 4YT0B 1PH4A 3QOLA 5AZFA 2L3ZA 3OIPA 1A0IA 3TBIB 4ZLTF 4ZCKA 4CDFC 3KJOA 2HHHL 1EIGA 1Q12A 2SNMA 4A3GB 2JY6A 3L7ZC 2F0HA 3NG0A 5E4WC 3E3XA 5IYBG 2XVSA 3F2CA 5DLQE 2YTYA 1B1ZA 1PXUA 2EYHA 2PQAA 1DONA 1TIFA 2KTFA 1Q7YC 4KK7A 2N7DA 3EUB2 2RDBC 1QZGA 1MI2A 4V190 5C0XH 3EFXD 1PTOF 1UGJA 3AEFB 3QQ8B 2FINB 1YJNA 4TQ1A 1WX8A 2KHSA 4A3DG 1KF6B 1MVKA 2INCC 1FFUA 2L0TA 1NJIC 4C4VA 3ZDMC 1XPOA
chains in the Genus database with same CATH topology
1JCKB 2TSSA 2K5PA 3SFEB 4HMIA 2J0TD 1OXVA 2BE5D 2X6GA 1VZ8A 4FF3A 2PNRC 3A7LA 3J7AV 1BMLC 2K04A 3P4QB 1TS4A 1TY0A 3R3OA 1Z47A 4A93B 4B0MA 3W5UB 1J7CA 2E6XA 5ELFA 5M3MB 4DAVA 3K0YA 3Q8CA 2L32A 4KI0A 2XWBB 1IHZA 2G1EA 4LK1C 3TEWA 1CTMA 1ZXIA 2EJFC 2ZXOA 3AE4B 1BUIC 5IT9L 3IAM1 1RDPD 2EYJA 5IODA 1A70A 1DJRD 1SE2A 3I73A 4WRDA 5JEAG 4TQ0A 2DYOA 1NCVA 5FO8B 2IDYA 4WAFA 1JRPA 1SJED 1BOSA 1AFPA 3EQLC 3DWAA 1D5ZC 5C3JB 4HCSA 3S17B 2IX1A 5CBEE 1UWXA 2G9HD 2JA7B 4NW2A 3Q6SA 5I9PA 2H89B 4CQNA 1GOZA 3NUCA 2EVBA 4CJ2C 3MWYW 2M19A 2WXHA 4C1NI 4IUUA 2J53A 3BZDB 2ONQA 5HHDG 3DWQA 2NYZD 2R61A 3GTJB 3MXPA 1K8OA 3I8ZA 3ND9A 1WD1A 5BN5A 3I57A 2RMMA 4B0EA 1H9JA 3H91A 2OT2A 3VR6A 3IXSA 1JOOA 3U9OA 5C4HA 1C77A 3C3LA 5CV8A 1JWUD 5EPKA 1K51A 3IT4B 5D7GA 2WP9B 4USAA 2W82A 3HP3A 5KNCA 2RQXA 5ELEA 3PO2B 2A74C 1D4BA 2LUMA 2B63B 3BIID 3TSSA 3ZJTA 1HEZE 5JPMC 1XWEA 4ZQ3A 1XO3A 3W2DA 3VQIA 3OMGA 4HSPA 1F2RI 1PGXA 1LT4D 4XWWA 1FNWA 2VZKB 4Q2JA 2OF1A 2QF7A 1P7EA 4HMJA 3PUXA 1I50B 4N58A 2NTSA 5E6JA 4M0WA 5BMHA 4BBSB 4JWSC 1EL0A 4G7HC 4C3JB 1GJXA 2FBWB 1KAAA 2QILA 3L4PA 4YTMB 1JC7A 2E74C 2LMCA 3P20A 5GXGB 4EQPA 1B50A 4ZUIA 2SNSA 1G91A 4IALA 3CWIA 2WAQB 1H9MA 1QB5D 3J80E 1FGBD 4YTPB 4RHRA 2PVGC 1TWCB 4MHEA 4KMUC 5EBDA 1RFKA 4BA1I 3NBIA 2ZW0A 1RTNA 4KD4A 3BDOA 1PFBA 2V3NA 3E6ZX 1MD2D 1BF4A 2SAKA 2KA7A 4O42A 1MPEA 4LK0M 3CRKC 1DCZA 5CBAE 1SEBD 3OWEB 4C1NK 4K2KA 2E3TA 3MXUA 2EY6A 1D5MC 5M5XB 3KK7A 3SVMA 3K5NA 2L55A 1ZOYB 4XE0A 1FCLA 1WXQA 1EY8A 4JK1C 2WXGA 1ZP0B 3Q0AA 1C79A 4KY5A 4NP5A 4KGSA 1FIQA 2QJLA 3PZ7A 5CMDA 3HVZA 4IUQA 3T53B 3W9CB 2ZXRA 5ELBA 3FPPA 3S2HB 2FFKB 1FYCA 2PZWA 4K5VA 1GUWA 1OXTA 2N88A 4Y7NB 3WOEA 1II3A 4L8JA 1PRTD 2VXWA 2AWNA 5JOBA 3TEXA 2HTME 2X6LA 4XDXA 3VR8B 4P2CB 3UI2A 3HOWB 1E10A 4RF0A 2A6HD 1D5XC 4KKSA 3GTOB 4K6LA 5DAUA 1EWHA 3A8IE 3HOXB 1SSNA 4F8MA 1SSOA 4H44C 2BDNA 2K3UA 1TJEA 3Q8FA 5FR3A 1F2MA 2B2UA 2D5GA 3EGRA 2DY7A 3P1MA 4HRSA 1L5PA 4EQNA 1ESRA 1AYFA 4RFBA 4KY7A 3URYA 1IKMA 2AQ2B 1B53A 1DOIA 1EOTA 5D65A 2A5HA 1M4VA 1IGCA 5EQ0A 1WTQA 1FRDA 3X3NA 1E9MA 2H88B 4LTUA 1NSNS 2AUJD 1L0VB 1DOMA 2BA0A 2XWJB 3U4EG 2EYOA 3O13A 4C3IB 4RGNA 3BVGA 2X69A 4LJZC 1B3AA 4DN4M 1EEID 4U673 4FF2A 1GB4A 2F0UA 1NYQA 1KTKA 3C1EA 1HTLD 3VYSA 4DNTB 3VR9B 2C9OA 1I4HA 4D2KA 1NENB 3I4MB 4GLSC 3I9V1 1KDCA 2W55A 2A68C 2K5WA 3D3RA 4X3KA 1I6HB 1GUOA 3X3MA 1S5FD 2WV6D 2KN4A 4NKLA 5IGFA 3NSWA 3S14B 1V97A 4L6TB 2DNCA 2EY1A 1PTOB 5C0XG 2WXPA 3Q8BA 1SNPA 2NWGA 3K57A 3U52E 3S9WA 4MM3B 3GTMB 4OO1I 1LO5D 1XX8A 4HKZE 5KYIA 5IT9E 1PDQA 2WNMA 2Q5WD 4HROA 2JU6X 2NB0A 3SEBA 3G7LA 2IW3A 1SMYD 4ZAIA 2W3RA 1QNKA 1EWCA 4KKJA 1FCCC 2Y3AA 3P63A 2JQRB 1SYDA 2F0IA 1TT2A 2PZUA 1CZPA 5CV9A 1C78A 1JWBD 2FUG1 1Y8NB 1C4AA 1VMPA 3D6WA 3GTLB 1J8IA 3G6JB 1BUVT 2ON8A 4HJGE 1KLGD 3MAQA 4KHZA 2YEPF 2AQ3B 4P16A 3MFGA 5CV7A 4XDDA 3ONAB 2F0NA 1ZYRD 1T3QA 3DEOA 3KLSX 2CQAA 2F0TA 4JBWA 1RCVD 1O78A 2B2YC 3GB1A 1DXMA 2WXIA 5HFYA 2A69D 2NVQB 4RAUC 1A6XA 4A6QA 1ILQA 4AS1A 1RF2D 4A8XC 1SXTA 4IQZA 4A3FB 4PT5A 5KRUA 1CT1D 2IWHA 1X3PA 2MPMA 2KCCA 3VYUA 3VR3A 3J80L 3S15B 3BG3A 4YTNB 3NTKA 1BR9A 2EE1A 4R9WA 1UWMA 4I7ZC 2A73B 1ZEQX 4BA2I 1A2UA 4DK0A 1SFOB 2RKSA 1N62A 2PYKA 1V43A 3SHLA 3EJIA 1XEEA 3NVWA 2L1BA 5C4XB 2LGIA 5CGKA 3FPUB 1I3QB 3RPFC 1C4PA 1STEA 1SNDA 4OIKA 3RZOB 3P42A 4RA8A 3KLSA 5C6AA 5FOBB 1LTTD 1TKWB 3MA2B 1G6ZA 2L0CA 1TKEA 4DQOC 3IAS1 1YJJA 4QMGA 1IL8A 3MFYA 4LAAA 4EE2A 5JVG3 2HCCA 3JAML 4OZAA 1FFVA 4R8IA 5IGDA 4KTAA 1A2TA 4CJ0B 1TS5A 5C3EB 2EOTA 5IIFA 2JE6I 5COYA 2LMCB 1ZDVA 3HOYB 1K52A 1PLFA 5I9OA 1V8QA 2B2TA 2F0SA 4EVOA 1U9RA 1NAPA 5T1IA 4J6HA 3IL8A 4A3IB 2DY8A 2LEKA 2Z1CA 4IUPA 1PRTF 5C5LA 3FKIB 2EDGA 1YNJC 1TR5A 2N9KA 2EYMA 3AN1A 1DOLA 1OXSC 2BYTA 1QQRA 2F3WA 2MP1A 3RZDB 3TP8A 2M0AA 1J7BA 2F0DA 2MJEA 1ENAA 3PIO3 5BN3A 1C4QA 1PTOC 1HCZA 5D3DA 1ACCA 4KN7C 1TWGB 4S3SA 3QB3A 2ZW1A 4NJCA 2PMZB 2JSOA 2XRQD 3U7ZA 2O2LD 2WB1B 2WDQB 2N0SB 3B2FA 1Y69U 4MH8A 1NEKB 1EQTA 3RD4A 5HURA 1YN3A 3B2GA 1LTID 2L9HA 2JX5A 2O5JC 3P4PB 1A3UA 3RFZB 4JE3B 1SNCA 1DOXA 3SXHA 5AUKA 3T13A 2QEJC 2BS4B 2MEKA 1AP0A 3S16B 2RPVA 5HI1A 3D31A 1EY0A 1STBA 3P75A 1F2LA 3AE1B 4HN7A 3GD7A 5E3FA 2B2VA 2B76B 1S5ED 4Q5VA 2K5DA 2JYEA 3MHZA 4XIGS 1W6KA 1EZ6A 1TKYA 4Q0FA 3FAHA 3C8YA 3DWPA 1I4QA 1HPCA 1QJOA 2EY2A 1F2RC 1LABA 1SYEA 2JEAI 1CM9A 1V8CA 2WU5B 2GB1A 1LV9A 1LTSD 1SYCA 1UEAB 1PTOH 4QB4A 2V0GA 2EYPA 3FDTA 4WURA 3R8BA 5EE9A 1E0BA 5LNK1 3VYRA 2ZT9C 1R9TB 3I4NB 3DWGC 3H0GB 5NUCA 1B44D 5IGGA 1H9SB 1C8CA 5CYUA 4X3UA 2KCNA 4N6EB 2XSCA 4G4KA 1HZ6A 4OIJA 3WDNA 1Q1BA 3OMCA 3CQZB 5IGBA 1Q90A 5C4JB 1XLNA 4XT1B 1QF6A 3QOJA 3R2IA 2OHFA 5LL6S 3MJ5A 5EGTA 3FC4A 4RKLA 2GI9A 1KDBA 4B9WA 2MHVA 4OGQC 4OHJA 5A2QL 3NVYA 1GHKA 2I07B 2JA5B 3T56B 1JWAD 5H92C 5HGTA 1FNUA 1IW7D 2HUGA 3GTKB 3S1RB 1CA6A 4XYQA 4ZOHC 4QUCA 2WIIB 3CRLC 4A3BB 2JXMB 4WFN3 2H4OA 3GV6A 3AB5A 5T8IA 3HEJA 3CIRB 1JB3A 5EBCA 5M5WB 4FF1A 5JVH3 1NI3A 2NMQA 2BB6A 3AH7A 1OXXK 1WYGA 4LMQD 1CZGA 1G2SA 4O1NA 1BDOA 2NN6I 5TSSA 3BS1A 1GXDC 3Q22A 2F0KA 1CJEA 5EPJA 4XQJA 3FILA 4QF4A 2YYZA 3RMHA 4IUTA 1SE4A 2IT1A 1JR0D 5G3LD 2E75C 2J52A 5EKIA 4G7ZC 2WXNA 1F9QA 1CHPD 4IFDI 2CW0D 1OO9B 5CR3A 5D3IB 3E0JA 5E4XA 4PMWA 1ROEA 1IBXA 3U2SC 1D6EC 1O7YA 4ZHPA 4RKBA 3EROA 1K8MA 2QMTA 2WXKA 3Q69A 4ARCA 2JYOA 5JJZA 2OEDA 1PMRA 1I6VC 2KEEA 4K8IA 1WSPA 2E2IB 3TDQA 4IDIA 3K5MA 4PQXA 1ILPA 1IKLA 3PUWA 3SE0A 1FNVA 2K0PA 2F0PA 2MGSA 2MUYA 1IYVA 3BDCA 1OFFA 3MZ5A 5ISRA 5K5PA 3FEWX 1YNND 4XQQA 2D2CC 4TKOB 1WTOA 4YSYB 2YEPB 4HR7B 3T51B 1B9RA 2QIEB 5HG2A 2HDEA 1HXYD 5EJWA 3H8HA 5IGEA 2R7ZB 5E1FA 3SR6A 2IGGA 1XCQL 3SDZA 1VLBA 3ERQA 1YN4A 2WU2B 1BCPD 1U4PA 5ELCA 1KLUD 4NZLB 3NS1A 4C3JG 4CBVA 1DM0B 1PFNA 4IFDJ 3QIAA 3FMCA 3Q8EA 3PV0A 4KX6B 4RNAA 1XLPA 2NZ1D 4RWSC 2K03A 3KF8A 3MVVA 5C2TB 2F0LA 2D9UA 2F0JA 3BYYB 2L5TA 2LFIA 5FLXE 3JAME 1LTBD 4FVMA 4XYOA 1MBYA 5T1GA 2EZVA 3BWUD 1PFDA 4K2LA 3MXGA 2BE5C 1N5WA 1TWAB 3FVQA 5EE3A 3A7AB 1D2BA 2EYLA 1A3VA 1SNMA 2N55A 3TEYA 4XDCA 4RH6A 4KY6A 3NWTA 5C5MA 5M3FB 4QCLA 2Q8IB 4TRDA 4US8A 3H94A 4TQUS 4K14A 3GS2A 4ZHOA 1IYUA 4IZ8A 4V0BA 3H6MA 1I4XA 1Y8PB 2JEBI 4YXDB 3NRZA 3ZYYX 3K7AB 1CI3M 5IOCA 1L6UA 4BWGB 1T6BX 5KNDA 2OXPA 1VZ7A 1JWSD 3I90A 4BBRB 1LACA 2NTTA 3I70A 4MACA 4EGVA 3C1FA 1ZUD2 2EY5A 4DFAA 3KUPA 1P7FA 2IX0A 3CKIB 3NQTA 1NVID 1JWMD 1YN5A 2KQ4X 1SF0A 3M4OB 3H09A 2DLBA 1VZ6A 3S2DB 4ZUJA 3SFDB 1Q1EA 1PRTB 3D4RA 1TZOA 2W3SA 2BTEA 2MJ3A 5M5YB 4A3JB 4YIJA 3HUIA 2R6GA 3DM1A 1STAA 4RHSA 5BYQA 4OO1H 1L4ZB 3PO0A 2PMVA 3SK8A 2EYFA 3V2TA 1WTVA 3RUZA 1MI0A 2Y5PA 1V1PA 2DBYA 4C3HB 4ODGA 1F0ZA 3QG1A 5I6YA 1TYGB 1GB1A 2E2JB 4MIUA 3Q24A 1IW7C 1CK1A 2K05A 2RSOA 3LXFA 1LLRD 3IFTA 5MPOA 3LWEA 2ICIA 3PUZA 1GUGA 2ZXPA 2K32A 1QILA 1ENCA 4C7ZA 1HQMC 2E2HB 2FHTA 3T4AC 2INPE 2V3PA 4KJNA 1FXAA 1JROA 2K1BA 1TWHB 4IURA 4KGTA 4C3IG 4XT3B 3S1NB 4EQOA 1O80A 1JICA 1JOQA 3CU7A 4WH4A 2NVXB 4K5XA 3R2TA 4AQ7A 4WQMA 4FXCA 1Q8IA 1WD0A 3K5OA 1AWDA 2F0VA 2WXMA 1XF5L 3NK9A 5ELDA 1KABA 2C5CA 1SBBB 1WTPA 1LT5D 5I2YA 1AZPA 2K33A 2K01A 1QLBB 1K53A 3PZ8A 1RTOA 3HGBA 2EKIA 2AWOA 1WTXA 1B2TA 2WS3B 4OW0A 4WORA 4BY1B 1NYRA 3A55A 1ZKOA 5BYRA 2OEOA 4A3KB 2D5DA 4HCEA 1QOBA 3J7YW 2R3ZA 1IGDA 5G3LF 1A3TA 3NVZA 1GPXA 5A2QE 2GA4B 1TY2A 3OHXC 1FR3A 4R8NA 1H9KA 3M3YB 3TP7A 1WCMB 3GO5A 4IUNA 3DHQA 2WDRB 2MH7A 5JEAJ 1FM0D 3FRPB 4RGMA 3AEEB 4JX1C 2EPBA 4XTCS 1XYIA 1VF7A 1RWSA 1XTCD 1VJKA 1TU2B 4CGYB 2H1EA 2WACA 3HOVB 4OVZA 2A6ED 1L4DB 3VR2A 1Q3LA 4QIWB 2RVLA 4L2YA 3PUVA 4IKGA 4KN4C 4N9PA 3GTGB 2RDGA 3GTQB 2K5QA 4OZCA 3M4YA 1DGJA 3IT6B 3TP6A 1IBXB 1JQ4A 2AQ1B 2IGDA 1BCPF 4PMCA 3BK1A 1OQQA 1H9RA 5K36H 1EM7A 4MN3A 1ONLA 4FNFA 3HG9A 1PRTC 5FLXL 4GZYC 3TEZA 1C48A 1T5XD 4REZA 1EY6A 1GUNA 1O7LA 4M8AA 1NR2A 2A6HC 4PMBA 1PGBA 3VR4A 2BT6A 1V1OA 3F2UA 2O5IC 2JYTA 4E6IA 4DNRB 2BOSA 5DM63 1VR9A 2B2YA 2RBMA 3J81E 2JXTA 3AEDB 2B8GA 2DWQA 1XLOA 4A3EB 1PUTA 3KLRA 3OWFA 4DU9A 4IOIE 1FD6A 1LTRD 1QOHA 1RHPA 3MHBA 4NAMA 1YQ3B 5AFWA 2Z4IA 2CJNA 1HZ5A 5FKAC 5G5HA 1G8ZD 1X32A 2VB3X 3N52A 1SAPA 3ZJVA 2M56B 1F2YA 4A3DB 2LFNA 3PMFA 2BS3B 1TVXA 3J7AF 2XNAC 1EY4A 3J9CA 2PW5A 2K9XA 2L4NA 4H2AA 2KMMA 1MSGA 1MSHA 1CQVA 4B9XA 2KVMA 2Z8LA 4ZRPA 3A8KE 3MC0B 5DNFA 3NUHB 1HRJA 2Y5CA 5JAVA 1L0YB 1LTAD 2LJIA 5LL6X 1UUPA 3A8JE 4FO2A 2EXZA 4HSVA 1STYA 4OZBA 4H0LC 4AYBB 2JWUA 3DMUA 4JPSA 1RYJA 2SDFA 4FF4A 2Z4HA 3PUYA 2EJMA 3OW7A 1FEHA 1ZXHA 3CHBD 1C76A 4F7XA 1S5BD 3R93A 3KBXA 5EE1A 2D62A 1S5DD 1EQVA 1FRRA 1B9NA 2K28A 1SJHD 1BQQT 4ZRQA 1JW9D 4C7YA 2N9LA 1SMYC 3MTSA 2XRSD 1F9PA 4KKTA 4QUFA 3GTPB 5BMGA 3OIQA 4RF1A 3NP8A 5CC4A 2B2WA 1PYWD 4DAYA 3AEBB 1HA6A 2GRIA 1SIJA 2NVYB 2B8FA 1EY5A 3L9AX 3BDLA 5C0XI 1CA5A 1YQ4B 1V1PB 3AE9B 5H8YE 1STNA 2QCPX 1D1KA 1EYDA 2XIWA 4R3DA 2M9VA 3AECB 1QE6A 1ZYRC 2R92B 2WXRA 4JWUC 1J7AA 1L0XB 3K5LA 4YSXB 2NN6H 2Y0SB 4ZK9B 2IJ0A 5JXVA 3LX0A 3IKJA 2A69C 2VNUD 3LYYA 2WXOA 3E56A 1YMHE 4A90A 3KWVA 2F03A 2EELA 3VA5A 3P7JA 1QOFA 3I4LA 2L12A 1CZWA 3QWNA 4IFDH 1Y8OB 1WWTA 2KWDA 1DYQA 3AM9A 3WCQA 2EJGC 4OO1G 4KD3A 4H13C 1Q10A 2A6EC 2QDBA 2L52A 3W5VB 2KAJA 2FJ2A 1M8AA 2F0GA 2KACA 2J42A 4KHVA 1RKNA 1E2VA 2MJ8A 3AEGB 1CFMA 2Q8RE 1PDXA 1N60A 1SB3C 1ZE3D 5A35A 2IPKD 3SK4A 2L83A 2KUMA 4A3MB 4RCNA 1EIHA 2VZKD 1I4GA 1CQFA 5KYLA 2K22A 2A68D 1HHVA 1WTRA 3M7NA 1EZ8A 2NBFA 1NUCA 5I4DA 3WOFA 3V3XA 1KRHA 5C3XA 5KGUA 1IUEA 5C0XJ 2PPBC 1WTWA 1F2ZA 3EVQA 4RCOA 1XCTL 2BDOA 3HS0C 1KDAA 4OL7A 1PFMA 3NVVA 4DGZA 1TIID 2RA4A 2BS2B 3AB9A 3M7GA 4CKEA 1EYCA 4GDLB 1Y1WB 5FO9B 3K58A 3AE3B 5BYSA 3D6CA 5KEEA 5LHY1 1WRIA 5I2XA 2ID0A 4CKBA 3AE5B 2WINB 1HUNA 3NHHA 2PW7A 4CJ1B 3V96A 2I2YA 1OXUA 2WXJA 2M00A 1GHJA 2XN9C 1MHXA 1QCBD 3NZ3A 1SYBA 3AU7A 2AUKA 2E76C 3AE7B 1XXGA 1R4QB 3VRBB 3RLFA 3I91A 3TP5A 2VUMB 1UAPA 1SNOA 2CHBD 2BB5A 4HKQA 1GUTA 2WXLA 2M2LA 4C2MB 1N5XA 5DM73 2WKDA 3LNNA 2IX3A 4I65A 1CHQD 1PZKD 3J81L 1EY9A 1Y56A 3TZUA 2PCFB 1QOGA 3A56A 1ENFA 2F0QA 4C56C 3VR5A 4RGOS 4X3SA 2FMCA 2B2UC 3OPOA 2HCIA 3P4SB 1DOYA 3TMEA 2INNE 5KIXA 2HDLA 5AUIA 4US9A 1PZID 1O7ZA 1U4MA 1MGSA 2E2DC 2IL8A 1EEFD 1QOAA 5I6WA 3KQ4A 2PZTA 4FXKC 4ULLA 5M9OA 1RODA 1STHA 3BYTB 4HTHA 5CV5A 2WDVB 4KV6A 3D8GA 3NQIA 1JALA 3NWSA 1KNEA 2CVRA 2KQ3A 1BO0A 3ITPA 3E9SA 5BMIA 4K8JA 2LS01 1R7SA 5F2DA 1HTPA 2NUCA 2YU9B 3UI3A 1DZ1A 1YJIA 4DXGA 1F9RA 3K59A 4J1MA 5IGCA 1BCPB 4HEDA 4ME5A 2IGHA 5J39A 1KFYB 2J7ZA 5EKKA 2FMMA 3E5SA 1RD9D 1LT6D 5K36G 1FXIA 3U9SA 4K6DA 3OSOA 2RDHA 3NE5B 2F0WA 5CV6A 1F9SA 3V05A 2K7VA 2PTLA 3ZGZA 3PIP3 4ARIA 2JZPA 1I4RA 1PGAA 3VRAB 1U4LA 1JOKA 3QJYA 2KEDA 1W6JA 2F3VA 4YWGG 3LWUA 3BK2A 4A9AA 1S4ZA 2ICEC 2DNEA 1LTGD 3TUOA 5EE0A 3MP9A 1SYGA 3TN2A 5JEAH 1ESFA 2F0EA 3Q23A 2J4XA 5J22A 2KJXA 4Z9CB 1QNUA 2PIAA 3ABVB 1J9OA 4IUVA 3ZQ4A 4ABNA 4A55A 2JP1A 3HKZB 4L63B 3QO2A 4KKIA 1YNJD 3DXJC 3L3OC 1E0ZA 1SYFA 1EU3A 4K5WA 5C44B 3D4DA 1HFNA 1HQRD 3IAYA 3A54A 1VCIA 4IN3A 2LY7A 4F87A 3AEAB 2ENBA 2O4XA 4DAPA 1G291 2WQYB 4X3TA 1PTOD 4DA2A 3AE8B 1BXTA 3VA7A 2F1MA 2QSDA 1UNSA 4H7BA 4L1BA 2G9DA 1WGKA 2CU3A 2PVOD 4ID6A 4B08A 4FP5D 1X3QA 4DXFA 1H9SA 1FMAD 2V4DA 1Y1VB 3P1HA 3HRZC 1AN8A 2AX5A 3OOCA 3I72A 2R93B 1TKGA 2I46A 3LB8C 3AE6B 5C3WA 3ZJUA 5FO7B 4J3OD 3KBGA 3H3VC 2BA1A 2RSNA 2F0OA 2DN8A 1TS2A 1C4CA 1VDVA 4G7OC 1I4PA 2W54A 4C3HG 1HUMA 2WLBA 1GUSA 3HVDA 1DD2A 1BNZA 4TMAB 2CW0C 1BBXC 1PZJD 3NBHA 4RGTA 3BVMA 1E6EB 1N63A 3T3OA 1R4PB 3IFDA 2WP8J 4M1UB 3MEHA 4F88A 2L1AA 2LKVA 1T5EA 4XXEA 4FYDA 3ETRA 1NR4A 1Z6HA 4WWMA 4YSZB 3D4WA 1VMCA 4L23A 2PO4A 1FD7D 3Q8AA 2JSVX 1ET6A 5FK9C 2F4IA 4ZRZA 3HOUB 3GV3A 2B39A 2N7JA 2DYMA 1VF5C 2PW9A 1N61A 4ZYSA 1SDFA 1ET9A 4ZKCB 1STGA 4PV1C 2MJDA 1YNNC 3AMZA 2HQEA 2PKOA 3DUZA 2PLPA 4MT5A 4XWTA 4XQNA 2B2TC 4BS9A 3HRDD 1EU4A 1OQRA 4G57A 3AE2B 2NN6G 1BCPC 1E7PB 1S5CD 5CORA 1K50A 3I3CA 3S1MB 4HEA1 3HZXA 3NTIA 3AMUA 3FILB 3AV8A 1XLQA 1EY7A 1ICWA 1K83B 3KWLA 1E2WA 4IFDG 4DF7A 5EKLA 1VDZA 2PQEA 1SNQA 4J8QA 4FXDA 3P4RB 1ML0D 1B9MA 3NPPA 1GAQB 2BBCA 5DEHA 2JA6B 2JA8B 2HDMA 4TSSA 2KOLA 1RJTA 3SK6A 4LLGM 1G2TA 2BW2A 1VRAB 2KECA 4KKUA 4P6VF 1JQYD 3M85A 3C2PA 5CV4A 1JMLA 2I38A 4WIPA 1EFID 3T16A 2K6AA 2F0FA 4ZKBB 5J1ZA 1TQOA 3C46A 3GP7A 3SK5A 2SOBA 1HFGA 5BN4A 3GQBA 4NAWB 1Z7TA 4FXGC 2WKCA 1ZDXA 3N6RA 1C9FA 1QKZA 1F77A 4HAEA 1TS3A 3S1QB 1QG7A 2B2VC 4DK1A 1RM6C 2VB2X 3DWMA 4PNYA 2CJOA 1FO4A 1AW7A 1E2ZA 4WJWA 5D14A 1I7HA 2WXQA 2LHDA 4GDKB 1MHHE 2NVTB 1A15A 3EA6A 3W1SA 3VYTA 3DEPA 5KNBA 1D1IA 1KH0A 4KJOA 3N9YC 3BVZA 4CHTB 2F0MA 2WXFA 3PO3B 4U68A 1AEXA 1QT9A 2FE8A 1LT3D 5JPNC 4KGRA 2SEBD 4UDUC 1JE4A 4BY7B 4ITKA 4C80A 2RDFA 5EPLA 2X38A 4NMZA 3NXWA 1HA5A 2Q8TA 3K6OA 1EWYC 3NTHA 1AZQA 5G5GA 2LHEA 3W3AA 1JORA 1QWYA 3B9JA 1ZPSA