2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1CQVA 1D5XC 1RCVD 1ESFA 3BZDB 2ICIA 1D5ZC 3W2DA 1SBBB 1EU4A 1LT6D 1SXTA 3CHBD 4RGTA 1CHPD 2AQ3B 3DWQA 4ZYSA 3OWEB 1F77A 1V1OA 2WV6D 1AW7A 1LT4D 3BVGA 2RDHA 1SEBD 1JR0D 1XTCD 3O13A 1G8ZD 4DXGA 1M4VA 1BCPD 1JQYD 1LTID 1EEID 2XRQD 1HXYD 1TS3A 2R61A 1BCPB 1PTOH 1L0YB 1LT3D 1RD9D 5ELDA 1KTKA 1BCPF 1YN5A 1PZKD 4OHJA 4Z9CB 1SE4A 3MC0B 1ENFA 1RDPD 1KLUD 5FKAC 1I4PA 3V05A 4RCOA 1LLRD 2CHBD 1V1PA 2NTTA 1PZID 3EFXD 4BWGB 3EA6A 2Z8LA 1I4GA 4UDUC 1ET6A 3DWPA 4RGOS 5I4DA 3TSSA 1V1PB 1HQRD 2XN9C 4K6LA 1CT1D 2TSSA 2NTSA 2IJ0A 1LT5D 5D3DA 1DYQA 1PRTF 2XNAC 5D3IB 1BCPC 3SEBA 1B1ZA 1PYWD 1D5MC 1LO5D 1TS5A 2QILA 4L63B 1EEFD 2J4XA 1PTOD 1UNSA 5ELBA 1SJHD 1PTOB 1L0XB 1PTOF 1EWCA 3BYTB 4NZLB 1CHQD 1B44D 1HA5A 1S5CD 1YN3A 1S5FD 1S5ED 1FNVA 1FNWA 1EFID 4RHRA 3MFGA 5ELFA 2IPKD 1FGBD 3BVMA 1JWMD 3R2IA 1T5XD 4C56C 5TSSA 1ET9A 1PRTD 1LTAD 1JWUD 1PRTB 5ELEA 1I4QA 3R2TA 4RGMA 1FNUA 3GP7A 1I4XA 1AN8A 1LTSD 1D6EC 1HTLD 1STEA 2AQ2B 2XRSD 4O1NA 4L6TB 1XXGA 1KLGD 2RDGA 1TS4A 3BYYB 1TY0A 1JWSD 4DXFA 3R8BA 4TSSA 1SE3A 1PTOC 1TY2A 1JCKB 4RFBA 3DWAA 1SJED 5ELCA 4RH6A 2G9HD 1S5BD 1SE2A 3BVZA 3URYA 1I4RA 1MD2D 1TS2A 1EU3A 1GOZA 4RHSA 1LTRD 1FD7D 2O2LD 2QEJC 1QILA 1DJRD 1YN4A 1S5DD 1PRTC 1LTTD 2SEBD 1I4HA 5FK9C 1LTBD 3KLSX 2AQ1B 4RGNA 1RF2D 1BXTA 1LTGD 1CK1A 1UUPA 1PZJD
chains in the Genus database with same CATH superfamily
5M5XB 3DM3A 4DV7L 2YU9H 3DLLA 3Q8BA 1D5XC 3S16B 1E1TA 3K5OA 3GQBA 1R4NI 2G1EA 1FIQA 3IBEA 5M5WH 1O7ZA 1I6HH 4IFDI 1TYGB 5AJ3Q 5LHY1 1KOTA 4KD4A 2BDOA 2V1CC 3QK0A 2W3RA 2L5TA 3DVNU 1H95A 1KNAA 4OEMB 3LNNA 4KY5A 4ZYNA 4JLCA 1JMLA 4DR3L 4G7OC 2A69D 3BDLA 3V61A 2YTYA 3DBHB 2JK8A 1WE7A 2M4NA 1VZ6A 1B50A 2K22A 2EXZA 1HXYD 1EZ6A 3CF6E 4HCNB 1X6OA 4A3JH 2BF8B 1JE5A 4B3ML 3DBLI 2NZOA 2KJ6A 4A93G 1GUOA 2H89B 4PZ6A 3GTPH 4OZCA 3VXWA 2K1FA 2FCSA 3L17A 1WYWB 2MQHA 4BWGB 3P7JA 4EQ5A 1ILQA 2NB0A 1UE1A 3AU7A 1YVCA 2KBNA 4OIJA 4C3HG 2WDTB 2CKHB 4WAFA 1XWEA 3B08A 4PZ8A 3DVGY 1DGSA 1J8CA 3HKZB 1XYIA 1GNUA 2B39A 4P16A 1JORA 2O2VB 2DZMA 4ZCKA 5FLMH 3IT6B 1U0LA 4EQPA 1XNRL 1TKYA 4XYOA 5ELNA 2K6AA 2J0JA 4P1CC 3KVFB 4GZYC 1EF5A 2MEKA 3UDIA 4A3FH 4LF6Q 3EIVA 3H9DA 4IM3A 3VR6A 1Y69U 1GO3E 3KWVA 2L12A 3TBIB 4HCPB 2K50A 2DZKA 4HPLB 1HTQA 3PV0A 3Q23A 2R7ZH 1WY8A 3E9HA 2HJ8A 2EXDA 2IY1B 1J5EL 3A1QA 1F9SA 1R4QB 5EGTA 4LFCL 1PGXA 5H92C 5EJWA 4M0WA 2MSED 1KABA 2WB1G 4ZUIA 4DV2L 3UI3A 2C7MB 2F0OA 3OMGA 1NE3A 4IOCA 2IWHA 3PO2H 1FGUA 1ZKHA 3MC8A 4QCLA 3TP6A 2ZJPA 2GRIA 3T9LA 4OIKA 4YSXB 1C76A 2XWBB 2K04A 3TDQA 1O78A 3CCJA 3NSWA 1CI3M 4CO7A 5E6NA 1MJDA 2C5CA 2K5PA 2DN8A 2R7DA 2F0FA 3G48A 2KDBA 3RN5A 4DR6Q 3FAHA 2PW9A 2VB2X 1HJPA 2R7FA 3H0GH 1SYBA 2R93B 1IYFA 5E7NA 5JEAJ 1YNND 3S2DB 2ZCCA 2I46A 1N33Q 3Q8AA 2WQYB 2D11A 2DAFA 3GOEA 4LNQA 4JWSC 4GN5A 2PZWA 4LK1C 4DGZA 1I35A 1SB3C 1WXSA 1OXUA 5A2QL 3GTQB 2BQQA 1CZPA 1WGYA 4EEWA 2QMTA 1PHJA 4JI2Q 1MVKA 1A5RA 1FD7D 1S3SG 4W9JA 3QHTA 1YQBA 4HR7B 2UXBQ 2LSSA 1FFVA 5IP9H 1QUQB 4AYBG 2E2IB 1HZBA 1OQYA 2KMMA 3U30A 2Y5BB 2B2UC 1LV9A 2KANA 1B7YB 1N5WA 4NJCA 1HCZA 1CK1A 2B2VA 3K5MA 4WQOB 4C3JH 2JXXA 3AEVA 2NBWB 1AH9A 1KAWA 1NMFA 3M62B 5LMNQ 2L52A 1UEBA 4KY7A 2Z9HA 4M8NA 5EDSA 1EU4A 2ZM6L 2XVSA 2JYOA 4B0EA 2KLCA 3NS1A 3J7ZC 4IPCA 4CDCC 1V2YA 3QARA 4UP9A 1LXDA 4NY0A 4BXXG 3TUOA 2PE9A 4K7UA 3IAYA 5JOBA 4A3GH 2ZJDA 3OIQA 3EQLC 3CU7A 3RN2A 3UDGA 1HFNA 1WTPA 2JA7B 2CHZA 4DV1Q 5LNK1 2EYOA 2MBEA 4LF6L 1X65A 1V1QA 3S1RB 2XEWA 1CZWA 1HQMC 4P74A 3CCQA 2INDC 2R2OA 4MGZE 4EQOA 4HSPA 1MBYA 4Q0FA 3CCEA 1WX8A 3QC8B 5AZFA 3BJUA 4BA2I 2EY5A 1AARA 4MJSB 4RF1A 3DHQA 3K7UC 4KI0A 2KCNA 1EOTA 5NUCA 2YU9B 3OTOQ 3NTIA 5I4DA 1J9OA 4G0NB 5D65A 4B9XA 4POFA 4S17A 3LGJA 3DHGC 4CBVA 2VXWA 5M5WB 1I6HB 1G6PA 1P98A 2XNAC 5JXVA 2ON8A 4LW1A 4A3IH 5IN7A 3ONAB 2A69C 2A73B 2OT2A 1DOLA 4H2AA 5E4XA 1K0RA 3G6EA 1GD7A 2O5IC 3W1GA 2MX2A 2K8HA 1UNSA 4DR4Q 1SJHD 4XZ4A 2WP9B 4A3JB 2AX5A 2DWQA 2B2WC 3PRPB 5TR5A 1Z9FA 3WDNA 2FIDA 3OOCA 3A9JB 4BY1G 2PLPA 1FM0D 1F2RC 4DDID 3ZJVA 2DGYA 3M4PA 2UWQA 2E2HH 4E74A 3H1UA 1HZCA 2KHIA 3R2IA 2J0TD 1YX5B 3RNCC 5KRUA 2UXBL 3Q3OC 5LXIB 2HIVA 3G4SA 1U4AA 1O7LA 1FNUA 3A54A 3S1MH 4LFBL 1D1IA 1HE8A 2UXCQ 2BS3B 3HM6X 3KW5B 4LNIA 3RN9C 4B3TQ 3FHWA 2G3QB 1KLGD 2L11A 2D3AA 4BKGA 3BU2A 3QAQA 3ZRCA 3ZO5B 4ITKA 5LMNL 4OXPA 3NZ3A 3ZXRA 5K5PA 1W3SA 2SDFA 1VQAA 4B3SQ 3N1YC 1SE3A 2EQSA 4RMAA 2C9WB 2JP1A 4A3EH 5ELCA 1SJED 4A3FB 1WTQA 2KT7A 1NY4A 3BK1A 3OG5A 3ETRA 3ERQA 4WJPA 3PUWA 2I5MX 2N0SB 3SR1A 3QR8A 1MSHA 4BOSC 1EU3A 1SNDA 2F0TA 1P8LA 3I63C 4FF3A 3LXFA 2ZEQA 4K7SA 2F03A 2E76C 3P2BA 4ZOHC 2NUCA 1VD2A 3W1SA 1FVIA 2NN6I 5JPNC 4E71A 1WRDB 1Q1EA 3PO2B 4BKSA 1SF0A 2HTME 1EF1A 2F0DA 2KWDA 3MP9A 1GXDC 3G71A 1XPUA 2HD5B 1EYGA 4GDKB 4CGYB 3H7SA 1E10A 1P7EA 4C3IH 5IGGA 1QT9A 1A62A 2A19A 4CKBA 1J8IA 1L6UA 1N63A 3DPDA 1YNNC 1RKNA 2GBNA 2V3NA 3P42A 1VQ8A 3C46A 3P1MA 2WXPA 1JR0D 4ALPA 4M8MA 1B3AA 2J7QB 3I4MG 1EEID 4B3RL 1PTOH 1L0YB 4PG3A 3N52A 4JE3B 1K53A 1WM2A 2O6VB 3R93A 2BH8A 4OHJA 3PO3G 4A3DH 4I7ZC 2PI2E 2RSNA 4ZLTF 4IPHA 1KLUD 2B63B 4DR4L 1I4PA 2OEDA 4RCNA 2VB3X 1SLJA 1QOBA 4JPBW 4NPNA 2UU7A 2F0VA 5CGKA 2PQEA 3ZNHB 3AV8A 3VR3A 4ZQ3A 4PV1C 3PF4A 4KMUC 2FMCA 2B8FA 3IT4B 1F2RI 5LXHA 3ML9A 1NR4A 3PLVA 1PUTA 4DHZE 2CQOA 5KEEA 3A1QB 3CC2A 2E2JH 4NXML 2F4VQ 2QDFA 5DPSA 5H1SE 1N9WA 1C0AA 1E22A 2E5LL 4CJ1B 2GBJA 4REZA 1X3GA 4C7ZA 4DV4L 4B3TL 4M0WB 1IBKQ 1UD7A 3AE6B 3APFA 4PS7A 3T8MA 2BYFA 3EN2A 4R4TA 3QOLA 3HOYH 4IFDJ 4MZ9A 2NVQB 5CV5A 2LASA 4WAAA 1TS5A 1BT0A 1QZEA 3J80L 3WOFA 3WANA 3NE5B 2FFKB 2IX3A 1LQBA 3M3JA 2F0EA 4LUOA 1KD1C 2AUJD 3BYTB 1S5CD 2PYKA 2AEHA 1RODA 2EYFA 1Z6HA 2UYZB 2N55A 2WU5B 3QJZA 2FCMA 1NJIC 2V3PA 5DM73 2VQEL 4YCVA 4DAVA 1PH9A 2FNJB 1Y1VG 3FRPB 1V81A 4OO1G 2LY7A 1WI0A 1WJ6A 1B9MA 4JI6Q 2LHDA 3E0JA 1PFDA 2WXMA 2NVYH 3HOVH 2K5QA 3CRKC 4K14A 1IYUA 4OX9Q 1I4XA 1AN8A 1WH3A 1B3QA 2PMVA 1N6ZA 2V9HA 2B29A 1SGHA 3PUVA 3MXNB 3BYYB 4JBKA 4GLXA 4N8FA 4DBGA 1J19A 3MC9A 4GLAC 1KC8C 4TSSA 1SYCA 3GDEA 4ZK9B 5DPRA 2W82A 4FXKC 3VR2A 2I0QA 4WJ4A 2NPTA 3P4PB 1X9NA 4QAYA 2ZXPA 4POGA 4KLKA 2KNBA 1K0SA 3CSTA 2Y5CA 4O0AA 2BE5D 2D3BA 1MG4A 3D32A 1EYCA 2ZVNA 3SDZA 3H09A 1NENB 2M0AA 4MEMA 4C4VA 5DPWA 3I70A 3KFUA 4IC7B 1JB3A 1GG3A 2JT4B 3VUYA 5FJ8H 3MEHA 1EYAA 4L5TA 4F87A 1HZAA 3QJYA 5I6YA 5IP7G 3D4DA 1SNCA 2IHEA 4P72A 2MLBA 4GKKQ 2ZJQA 3Q14C 5HG2A 4ME3A 2Y0SB 1Y1WH 1C9OA 3HRZC 2NR2A 3S1MB 4M1UB 3JC66 4FF2A 1TKEA 2KJRA 1WF9A 2OJRA 1PH3A 3JSVB 2G9DA 3M4OH 1JWAD 2R2QA 1D5ZC 4IZ8A 2KDFB 3ALBA 1QOGA 2HUGA 3ECIA 1EWYC 3DCGA 1CHPD 4LDTB 1HZ9A 1QCBD 2ALYB 2MJEA 1U4PA 3HUIA 2H4OA 2D0PA 4YHHL 4IWOA 5GMVA 3VRAB 1NMGA 5JHAA 1IP9A 4K1RB 3TIXA 4GIVA 2A5UA 3EFCA 5DPTA 4A6QA 1JRPA 1II3A 4A3BH 4HJ9A 4KHPQ 3EROA 4FNFA 3HVDA 5EE3A 1IBKL 3ZQ4A 4KZ0A 2O6VD 4NAWB 1RD9D 2OQKA 1EQVA 1VQ9A 4UY8C 2JA7G 1E8XA 2CJOA 1N34Q 1UBQA 4LNKA 1STAA 1LYLA 4LCDE 2N8NA 2B2YC 2A6ED 2AL3A 5IYCG 4IW0A 4IALA 1ML0D 2CWAA 1TJEA 2WX0A 3S2AA 4LJZC 1BOSA 2CHWA 1K3RA 1ZEQX 1A8VA 2CVRA 1IXRA 3GTKH 4XDDA 1G291 1X3FA 4DWFA 4ABNA 1KQSA 2EIFA 3KLWA 3QWNA 1O7IA 2XN9C 2UUCQ 3JVZX 2QKIC 4C3IB 5CORA 2NBUA 1CT1D 4RG1A 4JI3L 4CHTB 3OHXC 4G7HC 2KQ4X 4WWPA 5G2NA 4PK1A 1SROA 2JQRB 3PREA 4DAMA 1IBLL 3AE8B 3CWIA 3I9V1 1C4AA 2F3VA 2D5GA 2M19A 2NZ1D 3NBHB 2OOBB 2N9LA 3T51B 3CD6A 4EVOA 4HK2A 4MGKE 3RCZA 1KRTA 1PTOB 4YY3Q 1V97A 3PQIA 1D7QA 1F2LA 2MWSB 4LNFA 1SDFA 1XT9B 4NZLB 3K5LA 2L4NA 1NVID 5CX3A 4A3DB 2PNRC 2WGSA 4A3JG 2JRHA 3P4RB 3GD7A 4RHRA 1SAPA 4ICVA 4QF4A 2K5HA 4GU2A 3TN2A 3AXCA 4A3PA 1RRBA 2E75C 4DUZQ 2VH2A 1RFKA 5CR3A 1ET9A 3NWSA 1YIWA 1WM3A 1E6EB 2K4KA 3TQYA 4YCWA 4MGYE 2VQFL 4OO1I 3T1YQ 4QJFA 3E9IA 5LMUQ 3S1NH 3HK0A 4A20A 3J7AV 4K2KA 1G51A 2KMCA 4F7XA 1XPRA 2KMAA 4RAUC 3RULA 3M9BA 2RCNA 4IUMB 4DV3Q 1PV4A 4XT1B 5C4JH 1L0WA 1FPYA 3APDA 3I57A 2IGHA 1WGRA 5IOIA 1MJEA 1OEYA 1SYFA 5C44H 3HOYB 3MXUA 1B8AA 3MAQA 3NVZA 5FLMG 3TP5A 2SNSA 3RZDH 2J0MA 3S1QH 2WHIA 1EQQA 4IM0A 1FO4A 1CTMA 4N9F4 3J81i 4NJ6A 1H9MA 4ZRJA 4J15A 1VQBA 2EYHA 3IKJA 3ZJYC 4DR1Q 4A3FG 1NYQA 3D8GA 3NG0A 1C4QA 2VY3A 2QEJC 2R7ZG 1U4LA 4E3CA 1DJRD 2J0KA 1VQFA 1E7PB 4ANXA 1L6VA 2K28A 2MRPA 3S16H 1Z47A 1FEHA 4OWTB 1LUZA 1EO6A 2C7HA 4OW0A 2NVYB 3HOVB 2Y3AA 1E24A 3PO2G 2ZXOA 3L10B 3K0XA 2YTXA 4BAXA 1STBA 1UWVA 4HEA1 2PI2A 3CCRA 1OQRA 2ZW1A 5IIFA 1NI3A 1BUVT 2I5LX 3W2DA 1NAPA 4KHVA 3RPFC 1H9SA 2CJNA 3CHBD 4RGTA 2NBVB 3FKYA 2CR5A 2KFKB 3HOWH 1IGDA 4ACFA 1B9NA 4YWGG 1EQTA 3PRZA 4K3CA 4LJOB 2EY2A 1Q10A 3PHWB 3H0GG 1YJWA 2XRQD 1H8CA 3EBEA 1WTHA 2BE5C 1GJZA 4WURA 4LFAQ 1VQLA 1VR9A 3SDLC 4DKAC 3GV3A 4DF7A 1CKNB 2WDQB 1C79A 5JVH3 1DXMA 3L2PA 1Q3LA 1H4RA 3A4SC 1RTOA 1LLRD 2A6HD 2ZXRA 1PH4A 2JPHA 3T3NA 2V1YA 1VQ7A 2HTHA 3OLMD 4XX5A 1TTNA 2VUMH 1C7YA 3L08A 3AE1B 4HIOA 3IG3A 5BYRA 1XJVA 1B9RA 2DHZA 2ZT9C 3NK9A 3ERSX 4DUZL 4OWWB 4HLEA 4UAIA 2FE8A 4HXDA 2GBKA 3UQBA 3VHTC 1MFWA 3M4OB 1A2UA 4C3JG 2K0PA 2Z6BA 1N60A 2LFNA 3BZCA 2NTSA 3W5OA 3H3VH 5K36H 3PLUA 5LMUL 1TT2A 4FHJA 2R92H 2MHVA 2G45B 5IGFA 3NVWA 1I50B 1LO5D 4YSYB 2DNFA 2BW2A 4URKA 4BOZB 1NBWA 1PTOD 2HQLA 3SK4A 2LXKA 2ZTCA 1PTOF 4A3GG 3KF6A 5C4XB 2LMCA 4FN2A 3RUIB 1CHQD 2KECA 1PYSB 4DV7Q 2XWJB 3AE5B 3HOXG 1FNVA 2K9XA 3TEHB 4DR1L 3KBXA 4N9PA 4KX6B 4DFAA 2KCCA 1NSNS 3PIOA 5FR3A 3HVZA 2WXRA 3V2TA 1Q81C 4MM3A 5FLXc 1CM9A 3N20C 3QQ8B 1PGAA 4II2B 4DR3Q 1JQ4A 1C3TA 2PTLA 3KLSA 3L13A 3EJIA 3VH3B 4YWMA 2JSVX 3TMEA 1H9KA 2AQ2B 2C35B 4O1NA 2R93H 1MPEA 2MA9B 3MHBA 2RDGA 3S2DH 5G3LF 1VQEA 1XCTL 4B3MQ 2N9KA 5JHBA 1DD2A 3NEMA 3HP3A 5IGCA 3PSEB 2LFIA 3VTWA 4NJ7A 5JH5C 1YNXA 3R8BA 1TY2A 3CXCA 2B2TA 3BDCA 1MHWC 4A3IG 1JCKB 3DVNV 1ZPSA 3OPOA 4XYCA 5FLXL 3AEEB 3J81c 3NY5A 4OVUA 4K3BA 2PQAA 1HR0W 2E2IH 1BR9A 1WWTA 2DYOA 3S9WA 2LD9A 5D94A 2D3CA 1VCBA 1Z2MA 5AZGA 1A2TA 1D1KA 5E3FA 3E0EA 3M3YH 3BZKA 1S5DD 2X69A 1EL0A 2JXTA 1UE6A 1LTBD 1OGWA 4P71A 1E9MA 1FL0A 4B08A 3LDZE 1XNRQ 5E6JA 5M3MH 1Q5WB 2ZZPB 2LUMA 2JF5A 2JSOA 2K03A 3A7LA 1WD1A 3S1NB 3CMMB 2MQJA 2Y0SG 1GC6A 1YJJA 2N7DA 4NQLB 1SBBB 2LZ6A 4LF9L 4GDLB 5FOBB 1ISNA 3KYDD 1UBIA 3DWQA 3HG9A 2GA4B 1J5EQ 2WV6D 5C4JB 2C5LC 4XXEA 4LFCQ 5A35A 3CRLC 2XK5A 3L0WB 4KTAA 3VYUA 5C44B 2H88B 3E6ZX 1XTCD 4DNRB 4J1MA 5C6AA 1VQHA 4MIUA 2ASBA 4DK1A 3OYYA 4DV2Q 1VQDA 4DXGA 1V5TA 3V3XA 4F8CB 3E3XA 2KDEB 4GOPC 4GXBA 3FKIH 3D3RA 3K7AH 2UUBL 1M8AA 4A3EG 2DYBA 2LUEA 1I94L 2GVBA 2I5HA 4RM9A 3A8KE 2IYDB 1J0GA 4V0BA 2EZVA 4S0RA 4W9IA 5JAVA 2KYWA 3S2HH 2JA8H 1VLBA 1Y56A 3R7RA 1T6BX 4KN7C 1QKZA 1W6JA 3GTGH 1QVGA 1ET6A 1WTWA 3F8TA 3RNFC 3MA2B 5BO4B 3HM3A 5HURA 3D4WA 1VS0A 4DNTB 1WZ0A 4WWMA 4A3KH 2HJ1A 4LF5L 5EQ0A 3APCA 3CC4A 3TMPB 4RF0A 2EKEC 3UDFA 3M85A 4C3IG 1A3VA 4B9WA 1T3QA 4JW0A 2M00A 5IO9A 3HOWB 4I7AA 3KF8B 3K58A 1LTLA 1WXVA 4DK5A 2L1BA 2PE6B 1S1QB 4FJYA 1NCVA 4XDCA 2N1WA 1WJJA 5CTRC 2ES2A 2KEEA 4BFRA 3PO0A 2I07B 3NUCA 3A55A 4R8IA 1IPGA 2WYQA 1B44D 1YN3A 4XQJA 2A6HC 2L83A 4B9KA 3UE1A 5E6OA 3ZYYX 3TRZA 2D10A 2ATWA 2Z1CA 4KV2A 2ZM6Q 5FO9B 4A3DG 3VR4A 3OJ4B 1SNPA 2L9HA 5IE8A 1XMQL 1OEYJ 3CP0A 2P5ZX 2B8GA 1RLFA 2TMPA 2VUMB 2WB1E 2X6LA 1IL8A 3AFPA 2E6XA 4A55A 5L83A 3GP7A 2YTVA 3Q3MC 2K75A 1PDQA 1PH5A 1HTLD 1WGDA 1SNQA 3DMUA 3H15A 2WX1A 3GV6A 5IT9c 2OWOA 2DUDA 2BCOA 1GUWA 4BBRG 1ZXIA 1ZW7A 1PH2A 1X55A 4JI1L 2HCIA 2R92B 2VZKB 3F2UA 3D0FA 4HPPA 4L2YA 4NNJB 1QZHA 1PTOC 4UPAA 2BKRB 1ZDVA 4K6DA 4RFBA 1B4OA 1VDZA 2BPSA 2MBHA 3CCLA 3HOYG 2KOXA 3GS2A 3SU8X 3VRBB 1KM7A 1FD6A 2KN5A 3MHSD 2WAQG 3ZIMA 1LTRD 4JCVE 4U68A 2Z59B 1H9SB 3A74A 1WJ4A 2WKDA 1QILA 4MHEA 1RM6C 5IT9L 1H9RA 4JI8L 2KTRA 1JRUA 1WMHA 5EBDA 5FK9C 5C3EB 3T1HQ 4PT5A 5C3WA 2GBRA 3WIMA 3L0OA 4AYBE 2VNUD 2WDRB 5IA7A 1AFPA 4JGHB 2F0PA 2HHHL 3GZNB 3I3TB 1RTNA 1DOYA 2KUMA 2O4XA 1A63A 1TWHH 5AFWA 3HOVG 4JVZA 3O65B 3FPUB 3I7FA 3DBRI 2WP8J 3CCVA 1QG7A 3Q69A 3W1SC 2JVCA 2WDVB 1V1OA 1E7UA 1IYJB 2MGSA 2LRWA 3J81E 4FDBA 2A1AA 1CA5A 4LF8L 3U7DA 1CSQA 2LJ5A 2PMZE 1CA6A 3DWMA 2B63H 1AEXA 1TS3A 2LKVA 1QF6A 5C4ZA 4IUNA 4XDXA 4QGUA 3U9OA 3MTNB 4P6VF 2WKCA 3DOWA 4LFBQ 4JOIA 2GN5A 1NEKB 1V5OA 3V05A 2AL6A 2LGYA 1EIFA 3M3YB 4ME5A 3DHIC 3A5UA 3DHHC 3CKIB 2ZNVB 5M9OA 5CHVC 3D4RA 3P4SB 3X23A 3Q6BA 2C9OA 1A3TA 2MPMA 2LXCA 2F0MA 5FJ8G 3TL5A 5M3MB 4ANVA 4NKLA 2RDFA 1U4MA 2ACZB 2RSOA 3NP8A 5G55A 3ZW3A 3FILA 1P7FA 1VMCA 4HAEA 1DM0B 4PZ7A 4TMAB 3KF6B 3P1HA 2K33A 2KEDA 2MO0A 4KY6A 3KYHC 1Y1WG 2NVQH 4IFDH 1VRAB 3RLNA 4FXDA 4MGIE 3WAMA 2IL8A 5HGQA 4C00A 5D3IB 3NXWA 3N32A 3ER0A 2Q2IA 3GTJB 1J7CA 2QSDA 3DQVA 4B95A 4XGAB 1EY6A 2EYJA 1NNXA 5CV9A 1LGRA 4TQUS 4K7WA 1BKBA 3VVWB 4FADA 1F2ZA 4MSQB 5I6WA 3FKIB 1YQ4B 2HD3A 3K7AB 4A3BG 2I38A 3J80i 2JA6B 2WXOA 1I5FA 4YXDB 2FINB 2RMMA 3ZTDA 4AQ7A 5BN3A 4WH4A 4OVVA 3DEPA 1FNWA 2KENA 3UGBB 3I5JC 3C1FA 5C3XA 1YMHE 3V6CB 3NHHA 3J7YW 3S2HB 2JA8B 4R9WA 1YBYA 5KYLA 2BDNA 1UE7A 3GTGB 3HHMA 1LTAD 4MN3A 1I7HA 3CQZB 3T1HL 3HRDD 3W5VB 4Y7NH 1ESRA 2PQAB 4A3KB 1WIAA 3CF5A 4B3RQ 3RZOB 3LJ3A 4J6HA 3Q8DA 2OTJA 2MUYA 2JWZA 1SYGA 1YI2A 3WAOA 1YOVB 1HH2P 4LAAA 2Z4HA 2DLBA 4IN3A 5I9OA 4A9AA 5HY6A 2JEBI 1WJUA 4FBJB 1QWYA 2V4DA 2Z0SA 4TVAB 2RVLA 3CW2C 3JYUA 1ZXHA 3AE2B 3QOJA 3ULPA 3AMZA 4KZCA 4NAMA 3PHXB 2VW9A 5E1FA 1Q90A 5ELOA 3J7AF 4I65A 1UGMA 1P16A 3CMEA 3MVVA 1XLOA 4XWWA 1QQRA 4WJOA 2PVGC 4NXMQ 3TS2A 3L16A 1YHBA 1I4HA 2E5LQ 2XK5B 4DV4Q 3Q0AA 4GGQA 2KCMA 4AS1A 3T53B 1P9DU 2F0SA 1CQVA 4GN3B 3VR5A 3CMAA 1Q1BA 3BIID 3TJPA 4EE2A 1RCVD 4JI5L 1BQQT 3DXJC 4LLGM 4IUTA 2BA0A 3SK5A 2K6QA 4ZUJA 4X3SA 1QZGA 3E5SA 1PDXA 1WXMA 1DOIA 4ICUA 1AW7A 5JJLA 5AUIA 3NWTA 1DOMA 1C1YB 4L5SA 2KJHB 4ZRKA 4LJPB 2VQEQ 5CMDA 1LTID 5A2QE 4NMZA 4DHJB 4JBJA 1UGJA 1ACCA 1LM8B 3B1LX 3B2GA 2L3ZA 1D4BA 1U4RA 1TWAH 4Z9CB 2K01A 3X3NA 4IPDA 3VTVA 1RDPD 2WACA 4QQBX 5CBAE 3U58A 4EZJA 3N9YC 2GOWA 2JQOA 4KD3A 2IY0B 1SSOA 4IOAA 1V1PA 4EUTA 1EY9A 5C5LA 2DYMA 3EA6A 2A5HA 2L15A 3DM1A 3U9SA 2ZPNA 3HIZA 4UDUC 2M2LA 1CQFA 1DGJA 4I6LB 3SFEB 2IGDA 4DV6L 2IO2B 3KWLA 3PTFC 2JXMB 3SD5A 3A4RA 1XQQA 1WFQA 4NQKE 2CWPA 2X38A 2MBOA 2ZTDA 2IDYA 1TWHB 1CFMA 2TSSA 4LUZA 3BS1A 4X65Q 4CKEA 1HNWL 1KH0A 3BWUD 1STYA 5C0XH 3QO2A 2AHOB 3SHQA 1O7YA 4KN4C 2GMIC 4DAPA 3A8IE 2FIFA 4A75A 2IGGA 3MXPA 4PMBA 3GTMH 2LJIA 1L1OA 3Q6SA 1L4DB 1TR5A 4EOYA 1WTRA 4I6PA 3HOWG 3AE7B 2V4IB 4N8X1 4HWIB 2J53A 1XF5L 3UF8A 4DU9A 1VQGA 4IG7B 1EWCA 3QX1A 3J80c 4ZRIA 1E0ZA 2E2DC 1WTOA 3AFQA 2B2UA 1KL9A 1E8WA 1FGBD 4IOIE 3SXHA 1E90A 2Q8RE 4RWSC 4YHHQ 3RNBC 2NS5A 3SFDB 3HKZG 1DONA 3PZDA 2V3SA 2EYLA 4G57A 1WFYA 1LTSD 1R4NB 2KVRA 2LVPA 3LYYA 3NELA 4KIKA 1ZKOA 4HKQA 1TS4A 2WXLA 5EPLA 3J7A5 3Q8CA 2XSCA 5KYIA 1A0IA 1KJTA 2EJFC 5BR8L 4ZRPA 4EZLA 1WMHB 4DXFA 3X3MA 5K36G 3N3KB 3MJWA 2OXPA 4BBNF 1Y8NB 1B70B 3CIRB 2QGQA 2R92G 3SK6A 1HNZL 1R4MI 3C8YA 5C1ZA 5GQOA 5JJZA 2ONQA 4L5RC 3EC8A 1KDCA 1F1HA 1K51A 3DBLB 2OHFA 4L1BA 4R4CA 2NWGA 1XX8A 2BVCA 3PPAA 1F9QA 4DK3C 3D6CA 1GUGA 1ICFB 5KIXA 1VQMA 1K73C 1SIFA 4RNAA 3KDFA 4JI3Q 4N58A 3RFZB 3ZNGC 1HFGA 1VMPA 3PRMB 3PIO3 1UWXA 2EE1A 1IBLQ 2BS4B 5HFYA 4IUPA 1T0SC 4BY7H 2NYZD 2MJ3A 1E0BA 1H9JA 1BUIC 1XLPA 3H3VC 3TS0A 5M3FH 4Y7NB 3V62A 4L23A 3VQIA 1X54A 1VQCA 1MHXA 2LHEA 3B2FA 3K5NA 3R3OA 4FVMA 4LF4L 1QLBB 3U2SC 3JW0X 5I2YA 1N36L 2FCQA 3OW7A 1QVCA 1SNOA 4KHZA 2R93G 4JI4L 3A9KA 4IKGA 4OONA 1GJXA 2MBQA 3KLRA 4C1NK 5IY0A 4X65L 2BA1A 3U52E 2E74C 3GTLH 4IWPA 3T16A 4UP8A 4WRDA 1XMOL 1JWBD 4DHJD 2H5XA 3PUXA 1S40A 1BCPB 1STNA 1SFOH 2KDIA 2KXJA 3FILB 2EJMA 2JZ3B 4ARCA 2VQFQ 2HCCA 4YSZB 2LS01 4MACA 3A0JA 1XCQL 3PZ8A 3Q24A 5BYSA 4PMCA 1YNTE 4HTHA 1WZ3A 4S3SA 1KF6B 4WJNA 4DN4M 1K50A 1NBFC 2NN6H 4KKSA 2BTEA 4KKJA 4A90A 2FMMA 2INNE 2LGSA 3S17B 2KTFA 2JN4A 1AZPA 3FMCA 1PVOA 1JW9D 1X3QA 2I2YA 3FDTA 3U50C 1TGZB 5M3MG 2HQEA 3RUZA 2KZRA 3VTUA 1I50H 1LT5D 4FXCA 1PRTF 1GKHA 2B3AA 3Q22A 3H7PA 2PW7A 3RNEC 3PUYA 1SYDA 3EECA 3IRBA 3N6RA 2ID0A 1A15A 3SEBA 5C4XH 2M8SA 1PYWD 4DR5L 4BXXH 1TKWB 2WXNA 4BVUC 4ZDVA 4PYUA 3DBHI 3E56A 4BS9A 3AH7A 3RI7C 1TIFA 3J9CA 1S72A 3AEFB 3GB1A 3KUZA 1L0XB 3SHLA 2QDLA 2JEAI 1TWAB 2F3IA 4UP7A 2MNAA 2ZNVC 2YV5A 3FKIG 1NI2A 1S5FD 2RKSA 3IAM1 3HOUH 1UH6A 4N6EB 4G7ZC 3UDXA 5HKHA 1JWMD 1WGKA 1A6XA 3IL8A 4GN1A 3IHPC 3LB8C 2A4ZA 2JA8G 4ODGA 1F9PA 3RNAC 2KOLA 1MSGA 4KV6A 4ASWC 1PFNA 3ZNZB 4EKUA 1VQ6A 4CJ0B 4W9CA 5F2DA 3AULA 3F2DA 2WINB 4A3KG 4R3DA 3NVVA 1WYGA 2D9UA 3RT3B 4MTNA 4K2LA 5KGUA 3MEFA 3J80E 1FJGL 5C3JB 3GTMB 2F0GA 4GOCA 4IUQA 3H3VI 1MHHE 3I56A 4DK6C 4ZRZA 1XNQQ 2KVZA 4RH6A 1HZ5A 3KJOA 2CHXA 1S5BD 3VFKA 1JOQA 4ANWA 1DOKA 2AUKA 2F1MA 4QL5A 3ZLZA 1UEAB 4ZHPA 3L54A 1CKOA 4A3CH 1SN8A 4BY1H 3KUPA 1OFFA 4HJGE 3D6WA 4DV0L 2Z0EB 1WVLA 2DX5B 1G6ZA 1YEZA 2HIXA 3QG1A 5IP4D 5EBCA 2LGXA 1GB4A 4FYDA 4H13C 1A70A 1LTGD 1UUPA 5J3BA 2X6GA 5ISRA 5EE0A 4C3HB 1BNZA 1CUKA 2Z4IA 4JBMA 2DJGC 2BB6A 2KWVB 3ABVB 3HZXA 1KFYB 4BBNC 2IY5B 4ILWA 4ZYSA 2Q2HA 5CHWA 1IL2A 4ZHOA 4OGQC 5IYBH 1PA6A 2WXHA 4XC2A 1SEBD 2WU2B 2F0JA 1EZ8A 2D2CC 2N1VA 4MDKE 1EUJA 5L95C 3NTHA 2MW5A 3F2CA 1BCPD 1YNJD 5COYA 1WX7A 1IKLA 5IWAL 2KX3A 3M63B 1BCPF 4Q2JA 4KGRA 1M90C 2OCEA 1K28A 3HGBA 1VQJA 1RJTA 3MC0B 3CCUA 2M9VA 2J52A 4RCOA 4DXAB 3K9OB 4MH0E 3NQIA 2N9PC 1EWHA 3NJTA 4KSKC 3K6OA 1RFAA 2Z8LA 1L1OB 2O2VA 2QEXA 1FRDA 4ID6A 4BY7B 3BINA 3NVYA 4LDTD 1QVFA 2FUHB 5J2RA 2KQSA 2MCNB 2GVAA 5M3FB 4CQNA 1RL2A 4QMGA 4GSWA 2LVQA 4MT5A 4ZKBB 2Z6KC 2JZPA 3V6EB 1BDOA 2L7RA 2OF1A 2F4IA 2PZUA 5G5HA 1F52A 1VQOA 2Q8IB 1FRRA 1WXQA 3GTLB 3JAMc 3NBIA 2L00B 2BYVE 4L63B 1I3QH 1J6QA 1EY5A 3L3OC 4EQNA 1SFOB 1ZXTA 3RLFA 2B63G 1OXSC 4KIKB 1XNQL 3H6NA 4IQZA 3PO3H 1HR0L 2HT1A 1P0RA 2KWCA 5IP9G 2K52A 2CCZA 1GUAB 5ELFA 1GPXA 4QY7A 4LF9Q 1P1AA 1WTVA 3PIPA 4XQNA 3FC4A 5JPMC 4AYBB 2IX1A 1VZ8A 5C5MA 2MP2A 1SIJA 1Q46A 4KGSA 2HE7A 2EELA 5GADC 1UWMA 1Q12A 1G6JA 3JAML 3Q2AC 1SYEA 3T13A 2V4LA 4DAYA 1K83B 2MHJA 3V60A 4L6TB 1AWDA 2KD0A 2UUBQ 3DUZA 1N32L 2WWZA 1I94Q 5IAAC 1E2VA 3D31A 4WWOA 3IFDA 1OXXK 1BBXC 3OW2A 4WQMA 2IX0A 1KDBA 2EYMA 3PV1A 3SR6A 2MH7A 4LF7L 3ZDMC 3PSIA 1QUQA 4IDIA 1SE2A 4V190 1K8MA 4GLVB 2B2YA 4B0MA 3RMHA 3URYA 3VA7A 5C3EH 4Q5VA 1SMYD 4L5QA 1IGCA 2MBBB 3UE0A 1E1OA 4LF5Q 4JIOU 2JRIB 3UQAA 2OTLA 2RSUA 4OWXB 3A8JE 3FVQA 4N9TA 4NW2A 3HOUB 2NPTB 4RM8A 5G3LD 1NYRA 3P20A 5IYDH 1TKGA 1EIYB 2WXIA 2KC2A 1C48A 5JEAH 1SMXA 1NUCA 5G5GA 1JOKA 2IT1A 3EHVA 3PS6A 4C4VB 3VUWA 3BK2A 3T4AC 4HCSA 1FCCC 2JY6A 4DV5L 4MELA 3M4YA 4O2DA 5KNBA 4BKSD 1SXTA 1IZ6A 2Y0SE 1GHJA 1GUSA 3OWEB 4X66L 1IUEA 1X32A 2R3ZA 2D0OA 2B76B 3TZDA 3AB9A 3BVGA 3TBLD 4HEDA 2F0HA 2K1BA 1VDVA 1YITA 2QJLA 5GXGB 1G8ZD 1XMQQ 1HTPA 2KHWB 1KNEA 3SE0A 3AYHB 2F0QA 1GB1A 5HI1A 1WD0A 1RAXA 2M17A 4PS8A 1X3PA 4JYAL 2PVOD 1WCMH 1VQ5A 3KUCB 3NRZA 3QWZB 1V86A 1ZYRD 2CHBD 4BY1B 5T1GA 4J3OD 2GBMA 4DR2Q 2KQ7A 3H7PB 2DNEA 1C77A 1NR2A 4DQOC 4KKIA 1B53A 3AE3B 1L5PA 2R6GA 4JI1Q 2CS4A 5AEKB 1PH7A 3AU4A 2KVMA 3KYCD 2L0CA 4MSMB 5BMGA 4W9GA 1ILPA 1AYFA 2KDMA 2AYOB 2CH4W 5EE1A 3GTJH 2B2VC 4J8QA 5GAHC 2MO1A 4K81A 1Z5SB 2EYPA 3I8ZA 4K0KQ 3QIJA 1KRHA 2Z0DB 4TUUA 1KIXA 2INCC 1JMCA 2JA6H 1BCPC 1YNJC 1D5MC 1R9TB 4JI8Q 1C8CA 2UXDQ 1YX6B 3I90A 4C7YA 3FP9A 5L37A 3N1XC 1YJ9A 3PGEA 1IBXA 2K5NA 4W9LA 2HHHQ 4AQYL 1RYJA 3F2BA 4HN7A 3HOZH 3RLOA 4X62Q 3DBSA 4GNXA 4JV5L 1EFID 5BN4A 3ML8A 3MFGA 2JYEA 2XBBC 2KCTA 3CQZH 2EMSA 3S15H 4C56C 1TWFH 2SOBA 3EGRA 1E7VA 4KK7A 3RZOH 3AE9B 4F88A 3BY4B 4LF8Q 4ANUA 1EM7A 1U9RA 5DLQE 3ZXVA 3QIAA 3H91A 1WSPA 4WFN3 2N49A 1STEA 4EZKA 1TWCH 4XQQA 4HJ7A 2D5DA 2CW0C 4E6IA 3WCQA 1L7YA 3MJ5A 2BYEA 1WJNA 1M1KC 4IJLA 3E9SA 5IGDA 4USAA 1TWGH 5C0XG 3KUDB 3PVLA 4BZAA 2BYTA 4YT0B 2N78A 1I3QB 3I4MB 5D2MB 4X3UA 5M5YH 4IURA 1VCIA 1TS2A 3KJPA 2BGFA 1AE3A 1EY0A 3KK7A 1KXLA 1S3OA 5CBEE 4A3MH 3PO3B 1E3PA 1T0YA 1CJEA 3IFWB 1KLVA 2WAQE 1FCLA 3TP8A 3F1ZA 1JALA 1FXTB 1GAQB 4GDKA 2WLBA 1N61A 4JI7L 3I4NH 4KKUA 2PKOA 1XEEA 5DCNA 1RF2D 4TKOB 2B3GA 3EFXD 4K8IA 2QA4A 4DR2L 2MJ8A 2PPBC 3RYTA 1AP0A 1DCZA 1LABA 3NENA 3VDYA 4NPSA 4W9HA 1V8QA 1K8AC 3UIPB 4QIWE 3SGIA 4DR7L 2DBYA 5EKLA 2RDBC 1XPOA 4JI0L 1F77A 3WWVA 2O6VA 1AZQA 5FO8B 2NVXH 4K0KL 1HNXL 3R7QA 5EPJA 5T1IA 1VF5C 3ZUNA 1MIUA 5FLXE 3I55A 1TU2B 1M4VA 4EFOA 5TSSA 2L1AA 3U4VA 4AOFA 2KK8A 1MI0A 1LT3D 3IVFA 1KTKA 1W2BA 4LNNA 1SMYC 4KJOA 1PZKD 2UUAL 2UXDL 2C7NB 2BT6A 1Q8KA 1OO9B 3PZ7A 4HRSA 1E2ZA 1YHQA 4M8AA 3Q8FA 3ZGZA 2NCNA 2LEKA 1PZID 2BB5A 1UE5A 4K5VA 2H1EA 3RD4A 4DHZB 3K0YA 4X62L 4KGTA 4YL8A 3TEXA 3RR5A 1Y1VB 1W6KA 3DWPA 3P63A 5D7GA 3ND9A 2WXQA 4BY7G 3LWUA 3QA8A 4FULA 2OJWA 4IM2A 1L2NA 1EY8A 4HSVA 1ZUD2 3NHEB 1V8CA 4KKTA 2YLMA 5M3FG 1K3BC 1XTDA 4RA8A 3ZVVA 1ZE3D 4US8A 4C80A 5BYQA 2L55A 4XT3B 5HGTA 3CCMA 1V9JA 3ZRFA 2QILA 2MP2B 3CSFA 1EEFD 2J4XA 2MFIA 2Q2TA 1BO0A 3G7LA 4A3LH 4H44C 4Y52H 2IW3A 1IW7D 5AJ3L 2XIWA 4DAYB 1HA5A 1DZ1A 1WCMB 1ZYRC 3W9CB 2JZZA 5IGEA 4DDGD 4FLHA 1PFMA 3TZUA 1TBEA 4JI5Q 1JE4A 1L1OC 3C0RB 2PO4A 3GTOB 2IPKD 1WTXA 2WS3B 4ZKCB 5C23A 2A74C 1CSPA 1MI2A 1PH8A 1M94A 1V43A 2EJGC 2LMCB 2XTIA 4GKJQ 2KO3A 3MXNA 4HDOA 5ELEA 2YVCA 1YZ6A 2NN6G 1JOOA 3OMCA 5KHQA 1ZDXA 4L8JA 4AIMA 4FF4A 3AEDB 1GM5A 1D6EC 1EIGA 5J17A 4MM3B 4K5WA 2DNCA 3M95A 1IBMQ 1PH1A 3WA0A 2KHSA 3SVMA 3ZTCA 3MWYW 5IOCA 4GOPA 4PYZA 2YYZA 4II3B 1KHIA 1OTCA 4MH8A 3NZUA 5JJKA 5CHFA 5C0XI 5C4XG 2PPHA 5JJIA 1G2SA 3I91A 4DV6Q 4HJ5A 4BBSH 4JC0A 5AUKA 3QB3A 4RHSA 5MPOA 4TRDA 1C9FA 3H6MA 3HOZB 1K8OA 4HVBA 1JICA 1R4PB 2AWOA 1K52A 1YJ1A 2ZW0A 5EE9A 5HHDG 1GUNA 2PNHA 3HOXH 1HNWQ 1SSNA 3JSVA 2G4DB 1K9MC 3S15B 3IAS1 1DOXA 1TWFB 3KLSX 4K8JA 2AQ1B 5GAGC 3HOUG 5JVG3 1C78A 3R3MA 2LWPA 3RMKC 2IBIB 1PZJD 4R4QA 2IO3B 2VZKD 3NQTA 1TVXA 2JA5H 1I42A 1STGA 2WXKA 4HDQA 1FMAD 1TWCB 2J42A 1CMXB 3FEWX 4RKLA 4TQ1A 3H94A 4NAWA 2AQ3B 4OZBA 3FPPA 4F7ZA 3P4QB 4DUYQ 1JJ2A 3VR9B 1VQIA 5IODA 1PXUA 1VQKA 5KNCA 1JJCB 3O13A 1TWGB 2K3UA 4HMJA 5CYUA 4ZAIA 1KRSA 3B9JA 2NBFA 5BN5A 5ELDA 3IXSA 3TEWA 5LL6S 5M5YB 1HHVA 1YN5A 2RR9A 4APVA 1YQ3B 2L0TA 1Z7TA 1SE4A 3B6YA 4DR6L 4KSLC 4OZAA 3MXGA 5FKAC 4A3MB 5IT9E 4EX5A 2O5JC 2K32A 5JZEB 1BVSA 3S17H 2REXA 5IKCM 2NTTA 2QHOA 1PMRA 1N33L 3W5UB 2RGFA 1NTGA 3I4NB 4A3CG 3KQ4A 5BR8Q 3C3LA 2X8XX 3GTPB 2ZVOA 1GHKA 1QNUA 2NVTH 1PGBA 4BA1I 2G5DA 3M7NA 2NVUI 2W9NA 1T5EA 1QB5D 4JI2L 1HNZQ 2WXGA 2K8CA 2F0WA 1Q7YC 4GKJL 1IBXB 1VQ4A 3NBHA 3R66C 4C2MH 3VAWA 1TZ1A 1Y8PB 2AWNA 1V80A 1V9PA 1Q0WB 1ZOYB 3DEOA 4GNXB 2KKCA 4X3TA 4W9KA 5I2XA 5C44G 1WYDA 2CH4A 3S24A 2NVXB 4FA6A 1VQNA 1IBML 3CAMA 4A4IA 5IYBG 4HPMB 4U673 4JWUC 4HJKA 2PIAA 2EKIA 1JB7A 1LM0A 4DA2A 1UELA 2HDMA 1VJKA 4TQ0A 2EY6A 5I9PA 2INPE 2LXJA 3ITPA 5LL6X 4LF4Q 2KFJA 1N8RC 1SR3A 3C2PA 2R7ZB 1ENAA 1N36Q 2L05A 3RD2A 1T5XD 4JI4Q 4DV1L 5DM63 1PRTB 3ND8A 3S14H 1E2WA 2SAKA 4FJVB 2KQ3A 4QB4A 2JE6I 2K5VA 1D2BA 4X6AH 1XMOQ 1Q8IA 2XRSD 5J1ZA 4BKTA 3PT2B 3HKZE 2Q8TA 2N9XA 4YTMB 2JA9A 1F2YA 3HS0C 2Q5WD 1JWSD 3OIPA 5DEHA 1MG8A 4G11A 3CCSA 3GE3C 3EUB2 4G50A 3OTOL 1FXAA 2KN4A 1Y8RC 4DUYL 1IW7C 4HIKA 2QC8A 2RD0A 2WNMA 2MP1A 3H0GB 4A93H 1EY7A 3BVZA 1MD2D 4FO2A 1Y8OB 2KC1A 1VF7A 2VS1A 3VYSA 5CV4A 1BF4A 2RA4A 3RZWC 4CDEC 1GUTA 4C3HH 1STHA 2VUMG 2CQAA 5DAUA 5E4WC 3PIP3 3CPWA 1QJOA 4RGNA 1ROEA 3GE8C 2IHFA 4HCEA 5D3DA 4DR5Q 2KFKA 2G4SA 4X57B 2OQ0A 3H8HA 2KTRB 3HEJA 2ICIA 2L0FA 1VQPA 4ZRQA 1L0VB 1WGHA 3QCAA 3PMFA 5LMNW 1ICWA 4C3JB 2VL6A 4I6NB 5J22A 4HKZE 2I1KA 4BBRH 2FUG1 2LVOA 4CHKA 2QDBA 3AE4B 3ZNID 1CKNA 2RDHA 3I4OA 1E5WA 3NTKA 3STBD 2DJFC 4JL9A 3K8AA 2UXCL 3MTSA 4P7IA 1JT8A 1MKHA 2K5DA 2R61A 2L8JA 1J7BA 1PYBA 1BBWA 4LUVA 3K9PB 4B6WA 4BBSB 2QW7A 3AM9A 3OJ3A 4G4KA 4M02A 1ENFA 3I73A 4A3GB 2JWUA 1R7SA 4B3SL 2F0NA 3A7AB 1C4CA 4FXGC 5C3EG 3HOXB 1XLNA 2E3TA 2N7JA 5FR6A 2MJDA 2JUOA 2D62A 2NMQA 3W1YA 4M00A 2BOSA 1X56A 2A68D 3BDOA 2PJHA 1C4PA 3ULJA 4WIPA 4JK1C 2VRRB 4YTNB 1AE2A 5EKKA 4C1NI 1FJGQ 5E6PA 3WALA 1SE9A 1U5KA 2CFMA 3K81C 5IYDG 2GI9A 4TKNA 1YIJA 1HQRD 3AQQA 4K6LA 5JEAG 2JA5B 1E8ZA 1L4ZB 2IJ0A 1EOVA 2WFWA 3LX0A 4YIJA 1K8RB 2LI5A 2B2WA 3Q3NC 1PFBA 1ZGUB 2BKFA 1WXAA 5D14A 4F1SA 1JROA 2V0GA 3BG3A 3VYTA 4DV0Q 2HDLA 2C60A 2RPQA 2K5WA 1TQOA 3TEYA 4A3IB 2ZCBA 2FHTA 2W54A 3UI2A 2FXQA 3VA5A 1WGGA 3AN1A 2L76A 4PS3A 3KBGA 3OWFA 1TXYA 5J39A 1XD3B 2IZVB 2FJ2A 1A3UA 4PQXA 3ZJTA 1WCMG 3BVMA 4GOPB 3MFYA 4IUUA 1K83H 1PRTD 4OELB 1LFDA 2M0XA 4AJYB 3I72A 5FO7B 2NVTB 3R2TA 2E2HB 4RGMA 3RNUA 1V49A 4JG2A 2J7ZA 4C2MB 5IWAQ 2E8GA 3JAMi 3DBRB 4A8XC 1G91A 1YD8U 3MZ5A 2K39A 5C2TB 1UF0A 3TEZA 1HUNA 3U8ZA 3ZKJC 4CYEA 1RWSA 1UZXB 3DWAA 1QNKA 2FAZA 3DWGC 2RCFA 2KX0A 2JA6G 2G9HD 4LNOA 4GN4B 4DNIA 1PLFA 3NOBA 4G3XB 2F4VL 4WWNA 5C4HA 4IJHA 5IGBA 3AECB 2CU1A 1Q82C 4A3EB 1ASZA 4NXNQ 1F2MA 1T9HA 3AI5A 4FHKA 3ENEA 2DENB 3NZSA 1EWIA 3HOZG 1LTTD 2KJXA 4MTKA 2QCZA 1HZ6A 4US9A 4GDLA 1WI5A 2AKWB 4AP4C 2BBCA 3S14B 2BH2A 4NDXA 5BMIA 3LWEA 2JJQA 2F0KA 4XE0A 1WR1A 1D8LA 1ESFA 4OL7A 4XWTA 2XGTA 1LT6D 4WJWA 1F9JA 1HUMA 4IO9A 4XYQA 1WRIA 3N1ZC 4ARIA 3T3OA 3AEGB 4KDLB 2QCPX 1HR0Q 1PH6A 1FYCA 2A8VA 4JI6L 2DZIA 2NZHA 2FCNA 2N88A 2YEPB 4OX9L 2ZPYA 2B2TC 4A93B 4HJAA 2ZTEA 3L7ZC 4HIDA 5C0XJ 2ENBA 1IYVA 3KH0A 3SK8A 2ZJRA 1K8GA 2ICEC 3B0AA 1UAPA 1N32Q 4A3MG 2CKZB 3PGZA 5EKIA 4ULLA 1I4GA 3U7ZA 2AWTA 1SNMA 1JC7A 1IKMA 3I4NG 2KHJA 2D2QA 4H7BA 3TP7A 3GZNI 3KF8A 4WORA 2EVBA 3TSSA 3K59A 1V1PB 4LF7Q 1JJGA 1T0QC 3L4PA 4W9FA 1MJCA 1IHZA 2RPVA 4W9DA 1R9TH 1DYQA 2N7EA 4JX1C 4X3KA 1TT5B 4YCUA 3STBC 2N3SA 3C19A 4BBRB 4GKKL 1S4ZA 1B1ZA 3I2ZA 3ICEA 1TIID 2E2JB 4OVZA 2K7VA 3C1EA 5BMHA 4IWQA 1HEZE 5DNFA 3A5ZB 2F0LA 3PCOB 2WB1B 2WAQB 1S5ED 4DV5Q 4AUQC 1HPCA 3PUZA 4QUCA 1GVPA 2K05A 4P75A 4LK0M 2A68C 4R4IA 4NXNL 4KHPL 4PNYA 4RKBA 3G6JB 4X66Q 5CC4A 2DZJA 5EAYA 1JWUD 2FBWB 1BBUA 4JPSA 1I4QA 4X64Q 5M5XH 1B2TA 1CKMA 1VZ7A 4FF1A 1N34L 3U4EG 5CV6A 2CW0D 4R4OA 4GNXC 4QIWB 1E8YA 1GC7A 1N5XA 3Q8EA 4A3OA 1FR3A 2LGDA 3L9AX 4H02A 4JYAQ 3AU5A 4DK0A 3W1BA 1Q86C 3ZJUA 3NPPA 4CDFC 1EY4A 1WX9A 3I4MH 1X3EA 1KAAA 2EY1A 2AMCB 2EPBA 2M1MA 3W3AA 2RF4A 4R1JA 4M01A 1V6EA 2UUCL 4IUVA 1BMLC 1SRUA 2N4FA 4GMVA 2PW5A 5LLIA 1GOZA 4HROA 4KDIC 4JBWA 3T56B 4A3LG 4DPGA 3VYRA 2JX5A 2O2LD 4N59A 2F52A 1QOAA 2IO0B 4H0LC 2N9EB 2WXFA 5GAEC 1YN4A 1LACA 4TV3A 1PRTC 2IO1B 3TCAA 2SEBD 2EMTA 3DVGX 4KVGB 2UU9Q 3IFTA 4YY3L 1RIPA 1BXTA 1SE8A 4HJ8A 1EUVB 4D2KA 4A76A 3P75A 3KDFB 4IFDG 4RMFA 2DAJA 3DDCB 3UIOB 3BZDB 3AMUA 3I4LA 3U4ZA 2VH1A 2PMZB 4YWLA 1J7AA 1Y1WB 2KWUB 1L2FA 3RZFA 4AQYQ 4YWKA 3EFUA 3VDZA 3WOEA 4WJQA 5T8IA 2VZAA 4YTPB 1LT4D 4XTCS 4JV5Q 2DY8A 5D6JB 2KLGA 3HKSA 1X1MA 2K6DB 4CKCA 3T1YL 4LWCA 2YEPF 5EPKA 1EQRA 1JQYD 2KACA 3N30A 2F0UA 2PZTA 2EOTA 4CJ2C 3AEAB 4JQWC 4LTUA 3ZDTA 1QE6A 3A9KB 3VH4B 2RHQB 1ZP0B 4DV3L 3K80C 4A3BB 4J6IA 3OSOA 2M56B 1PFSA 3CC7A 1Y1VH 1EFWA 4BBSG 3MHZA 3K57A 1ONLA 2K8BA 4OO1H 2Q2UA 2F3WA 5CV7A 2QIEB 1XO3A 4R8NA 1PQSA 3Q3FA 2A6EC 1FFUA 3M4QA 1FXIA 2EDGA 3GO5A 4HMIA 2SNMA 4EGVA 4AJWA 1ENCA 3HFZB 3UINB 1QOHA 1N62A 4RGOS 2GB1A 5CV8A 4K5XA 1KDAA 3PF5A 4X64L 2BS2B 3GTKB 2D07B 4O42A 2JA5G 4P73A 4HIMA 1QOFA 3TREA 1OTRB 2BWES 2DY7A 3AB5A 2OEOA 1YJIA 4KJNA 4MJSA 2D3GA 1R4MB 4FJZA 4JI7Q 5AZHA 4GLSC 5ELBA 4QUFA 3GTOH 1F0ZA 3GTQH 2KAJA 1ASYA 1XLQA 4W9EA 4GS3A 4NP5A 1Q1OA 1NDDA 2CU3A 4WJ3M 5IP7H 1MGSA 4IPGA 3OAWA 4DR7Q 2LGIA 1YHAA 1P3QU 3X0WA 4FP5D 4JOIC 4JI0Q 4F8MA 1Y14B 4GB9A 4NB3A 3V96A 4AH6A 4XIGS 2LRUA 4LFAL 1OXVA 1HNXQ 1HA6A 3A33B 5J18A 2RHSB 1I6VC 2BWFA 2L32A 2UU9L 4MNOA 2WIIB 3RNGC 1TZOA 3NS8A 1XXGA 2K25A 1CZGA 3EVQA 3A9JA 1WOCA 3I3CA 4UHVA 2UUAQ 3AEBB 3M7GA 1TY0A 4LMQD 3ONSA 4PMWA 3KOJA 1HTOA 3A56A 3J81L 1HRJA 2Y5PA 5KHOA 2W3SA 2KA7A 5KNDA 2WXJA 1G2TA 2QF7A 3VR8B 3J81j 1RHPA 2JA7H 3WAPA 2F0IA 3Q3JA 2RBMA 1I4RA 2W55A 5GROA 3ULLA 5IYCH 3RZDB 2GLSA 3CPFA 3S1QB 3S1RH 1T0RC 2JYTA 4P1BC 1EIHA 5H8YE 2PCFB 2LXAA 4CDDC 1F9RA 2RQXA 1WE6A 2I1JA 3VUXA 1D3ZA 4P2CB 1YJNA 2JU6X 1OXTA 1EYDA 1O80A 2HDEA 4AWJA 2ASQA 1WR6E 2PEAA 1E7ZA 3JAME 2K14A 1OQQA 3NUHB 2Z6KA
chains in the Genus database with same CATH topology
5M5XB 3Q8BA 1D5XC 3S16B 3K5OA 2G1EA 3GQBA 1FIQA 1O7ZA 4IFDI 1TYGB 5LHY1 4KD4A 2BDOA 2W3RA 2L5TA 1KNAA 3LNNA 4KY5A 1JMLA 4G7OC 2A69D 3BDLA 1VZ6A 1B50A 2K22A 2EXZA 1HXYD 1EZ6A 2H89B 1GUOA 4OZCA 4BWGB 3P7JA 1ILQA 2NB0A 3AU7A 4OIJA 4C3HG 4WAFA 1XWEA 3HKZB 1XYIA 2B39A 4P16A 1JORA 3IT6B 4EQPA 1TKYA 4XYOA 2K6AA 4GZYC 2MEKA 3VR6A 1Y69U 3KWVA 2L12A 3TBIB 3PV0A 3Q23A 1F9SA 1R4QB 5EGTA 1PGXA 5H92C 5EJWA 4M0WA 1KABA 3UI3A 4ZUIA 2F0OA 3OMGA 2IWHA 4QCLA 3TP6A 2GRIA 4OIKA 4YSXB 1C76A 2XWBB 2K04A 3TDQA 1O78A 3NSWA 1CI3M 2C5CA 2K5PA 2DN8A 2F0FA 3FAHA 2PW9A 2VB2X 1SYBA 2R93B 5JEAJ 1YNND 3S2DB 2I46A 3Q8AA 4JWSC 2WQYB 4LK1C 2PZWA 4DGZA 1SB3C 1OXUA 5A2QL 3GTQB 1CZPA 2QMTA 1MVKA 1FD7D 4HR7B 1FFVA 2E2IB 2KMMA 2B2UC 1LV9A 1N5WA 4NJCA 1HCZA 1CK1A 2B2VA 3K5MA 2L52A 4KY7A 1EU4A 2XVSA 2JYOA 4B0EA 3NS1A 3TUOA 3IAYA 5JOBA 3EQLC 3CU7A 3OIQA 1HFNA 1WTPA 2JA7B 5LNK1 2EYOA 3S1RB 1CZWA 1HQMC 4EQOA 4HSPA 1MBYA 4Q0FA 4BA2I 2EY5A 4RF1A 3DHQA 4KI0A 2KCNA 1EOTA 5NUCA 2YU9B 3NTIA 5I4DA 1J9OA 5D65A 4B9XA 4CBVA 2VXWA 5M5WB 1I6HB 2XNAC 5JXVA 2ON8A 3ONAB 2A69C 2A73B 2OT2A 1DOLA 4H2AA 5E4XA 2O5IC 1UNSA 1SJHD 2WP9B 4A3JB 2AX5A 2DWQA 2B2WC 3WDNA 3OOCA 3ZJVA 2PLPA 1FM0D 1F2RC 3R2IA 2J0TD 5KRUA 1O7LA 1FNUA 3A54A 2BS3B 1D1IA 1KLGD 2L11A 4ITKA 3NZ3A 5K5PA 2SDFA 1SE3A 2JP1A 5ELCA 1SJED 4A3FB 1WTQA 3BK1A 3ETRA 3ERQA 3PUWA 2N0SB 3SR1A 1MSHA 1EU3A 1SNDA 2F0TA 4FF3A 3LXFA 2F03A 2E76C 4ZOHC 2NUCA 3W1SA 2NN6I 5JPNC 1Q1EA 3PO2B 1SF0A 2HTME 2F0DA 2KWDA 3MP9A 1GXDC 4GDKB 4CGYB 1E10A 1P7EA 5IGGA 1QT9A 4CKBA 1J8IA 1L6UA 1N63A 1YNNC 1RKNA 3P42A 2V3NA 3C46A 3P1MA 2WXPA 1JR0D 1B3AA 1EEID 1PTOH 1L0YB 4JE3B 3N52A 1K53A 3R93A 4OHJA 4I7ZC 4ZLTF 2RSNA 1KLUD 2B63B 1I4PA 2OEDA 4RCNA 2VB3X 1QOBA 2F0VA 5CGKA 2PQEA 3AV8A 3VR3A 4ZQ3A 4PV1C 4KMUC 2FMCA 2B8FA 3IT4B 1F2RI 1NR4A 1PUTA 5KEEA 4REZA 4CJ1B 4C7ZA 3AE6B 3QOLA 4IFDJ 2NVQB 5CV5A 1TS5A 3J80L 3WOFA 3NE5B 2FFKB 2IX3A 2F0EA 2AUJD 3BYTB 1S5CD 2PYKA 1RODA 2EYFA 1Z6HA 2N55A 2WU5B 2V3PA 5DM73 4DAVA 3FRPB 4OO1G 2LY7A 1B9MA 2LHDA 3E0JA 1PFDA 2WXMA 2K5QA 3CRKC 4K14A 1IYUA 1I4XA 1AN8A 2PMVA 3PUVA 3BYYB 4TSSA 1SYCA 4ZK9B 2W82A 4FXKC 3VR2A 3P4PB 2ZXPA 2Y5CA 2BE5D 1EYCA 3SDZA 3H09A 1NENB 2M0AA 3I70A 1JB3A 3MEHA 1EYAA 4F87A 3QJYA 5I6YA 3D4DA 1SNCA 5HG2A 2Y0SB 3HRZC 3S1MB 4M1UB 4FF2A 1TKEA 2G9DA 1JWAD 1D5ZC 4IZ8A 1QOGA 2HUGA 1EWYC 1CHPD 1QCBD 2MJEA 1U4PA 3HUIA 2H4OA 3VRAB 4A6QA 1JRPA 1II3A 3EROA 4FNFA 3HVDA 5EE3A 3ZQ4A 4NAWB 1RD9D 1EQVA 2CJOA 1STAA 2B2YC 2A6ED 4IALA 1ML0D 1TJEA 4LJZC 1BOSA 1ZEQX 2CVRA 4XDDA 1G291 4ABNA 3QWNA 2XN9C 2QKIC 4C3IB 5CORA 1CT1D 4CHTB 4G7HC 3OHXC 2KQ4X 2JQRB 3AE8B 3I9V1 3CWIA 1C4AA 2F3VA 2D5GA 2M19A 2NZ1D 2N9LA 3T51B 4EVOA 1PTOB 1V97A 1F2LA 1SDFA 4NZLB 3K5LA 2L4NA 1NVID 4A3DB 2PNRC 3P4RB 3GD7A 4RHRA 1SAPA 4QF4A 3TN2A 2E75C 1RFKA 5CR3A 1ET9A 3NWSA 1E6EB 4OO1I 3J7AV 4K2KA 4F7XA 4RAUC 4XT1B 3I57A 2IGHA 1SYFA 3HOYB 3MXUA 3MAQA 3NVZA 3TP5A 2SNSA 1FO4A 1CTMA 1H9MA 2EYHA 1NYQA 3IKJA 3D8GA 1C4QA 2QEJC 1U4LA 1DJRD 1E7PB 1L6VA 2K28A 1Z47A 1FEHA 4OW0A 2NVYB 3HOVB 2Y3AA 2ZXOA 1STBA 4HEA1 2ZW1A 1OQRA 5IIFA 1NI3A 1BUVT 3W2DA 3RPFC 1NAPA 4KHVA 1H9SA 2CJNA 3CHBD 4RGTA 1IGDA 1B9NA 4YWGG 1EQTA 2EY2A 1Q10A 2XRQD 2BE5C 4WURA 1VR9A 3GV3A 4DF7A 2WDQB 1C79A 5JVH3 1DXMA 1Q3LA 1RTOA 1LLRD 2A6HD 2ZXRA 3T3NA 3AE1B 5BYRA 1B9RA 2ZT9C 3NK9A 4UAIA 2FE8A 3M4OB 1A2UA 4C3JG 2K0PA 1N60A 2LFNA 2NTSA 5K36H 1TT2A 2MHVA 5IGFA 3NVWA 1I50B 1LO5D 4YSYB 2BW2A 1PTOD 3SK4A 1PTOF 5C4XB 2LMCA 1CHQD 2KECA 2XWJB 3AE5B 1FNVA 2K9XA 3KBXA 4N9PA 4KX6B 4DFAA 2KCCA 1NSNS 5FR3A 3HVZA 2WXRA 3V2TA 1CM9A 1PGAA 1JQ4A 2PTLA 3KLSA 3EJIA 2JSVX 3TMEA 1H9KA 2AQ2B 1MPEA 4O1NA 3AE9B 3MHBA 2RDGA 5G3LF 1XCTL 2N9KA 1DD2A 3HP3A 5IGCA 2LFIA 3R8BA 1TY2A 2B2TA 3BDCA 1JCKB 1ZPSA 3OPOA 5FLXL 3AEEB 1WWTA 2DYOA 1BR9A 3S9WA 1A2TA 1D1KA 5E3FA 1S5DD 2X69A 1EL0A 2JXTA 1LTBD 1E9MA 4B08A 5E6JA 2LUMA 2JSOA 2K03A 3A7LA 1WD1A 3S1NB 1YJJA 1SBBB 4GDLB 5FOBB 3DWQA 3HG9A 2GA4B 2WV6D 5C4JB 4XXEA 5A35A 3CRLC 4KTAA 3VYUA 5C44B 2H88B 3E6ZX 1XTCD 4DNRB 4J1MA 5C6AA 4MIUA 4DK1A 4DXGA 3V3XA 3D3RA 1M8AA 3A8KE 4V0BA 2EZVA 5JAVA 1VLBA 1Y56A 1T6BX 4KN7C 1QKZA 1W6JA 1ET6A 1WTWA 3MA2B 5HURA 3D4WA 4DNTB 4WWMA 5EQ0A 4RF0A 3M85A 4C3IG 1A3VA 4B9WA 1T3QA 2M00A 3HOWB 3K58A 2L1BA 1NCVA 4XDCA 2KEEA 3PO0A 2I07B 3NUCA 3A55A 4R8IA 1B44D 1YN3A 4XQJA 2A6HC 2L83A 3ZYYX 2Z1CA 5FO9B 3VR4A 1SNPA 2L9HA 2B8GA 2TMPA 2VUMB 2X6LA 1IL8A 2E6XA 4A55A 3GP7A 1PDQA 1HTLD 1SNQA 3DMUA 3GV6A 1GUWA 2BCOA 1ZXIA 2HCIA 2R92B 2VZKB 3F2UA 4L2YA 1PTOC 1ZDVA 4K6DA 4RFBA 1B4OA 1VDZA 3GS2A 3VRBB 1FD6A 1LTRD 4U68A 1H9SB 2WKDA 1QILA 4MHEA 1RM6C 5IT9L 1H9RA 5EBDA 5FK9C 5C3EB 4PT5A 5C3WA 2VNUD 2WDRB 1AFPA 2F0PA 1RTNA 1DOYA 2KUMA 2O4XA 5AFWA 3FPUB 2WP8J 1QG7A 3Q69A 2WDVB 1V1OA 2MGSA 3J81E 1CA5A 1CA6A 3DWMA 1AEXA 1TS3A 2LKVA 1QF6A 5C4ZA 4IUNA 4XDXA 3U9OA 4P6VF 2WKCA 1NEKB 3V05A 3M3YB 4ME5A 3CKIB 5M9OA 3D4RA 3P4SB 2C9OA 1A3TA 2MPMA 2F0MA 5M3MB 4NKLA 2RDFA 1U4MA 2ACZB 2RSOA 3NP8A 3FILA 1P7FA 1VMCA 4HAEA 1DM0B 4TMAB 2KEDA 2K33A 3P1HA 1VRAB 4KY6A 4IFDH 4FXDA 2IL8A 5D3IB 3NXWA 3GTJB 1J7CA 2QSDA 5CV9A 1EY6A 2EYJA 4TQUS 1F2ZA 5I6WA 3FKIB 1YQ4B 3K7AB 2I38A 2JA6B 2WXOA 4YXDB 2FINB 2RMMA 4AQ7A 5BN3A 4WH4A 3DEPA 1FNWA 3C1FA 5C3XA 1YMHE 3NHHA 3J7YW 3S2HB 2JA8B 4R9WA 5KYLA 2BDNA 3GTGB 1LTAD 4MN3A 1I7HA 3CQZB 3HRDD 3W5VB 1ESRA 4A3KB 3RZOB 4J6HA 2MUYA 1SYGA 4LAAA 2Z4HA 2DLBA 4IN3A 5I9OA 4A9AA 2JEBI 1QWYA 2V4DA 2RVLA 1ZXHA 3AE2B 3QOJA 3AMZA 4NAMA 5E1FA 1Q90A 3J7AF 4I65A 3MVVA 1XLOA 4XWWA 1QQRA 2PVGC 1I4HA 3Q0AA 4AS1A 3T53B 2F0SA 1CQVA 3VR5A 1Q1BA 3BIID 4EE2A 1RCVD 1BQQT 3DXJC 4LLGM 4IUTA 2BA0A 3SK5A 4ZUJA 4X3SA 1PDXA 3E5SA 5AUIA 1DOIA 1AW7A 3NWTA 1DOMA 5CMDA 1LTID 5A2QE 4NMZA 1UGJA 1ACCA 3B2GA 1D4BA 1U4RA 4Z9CB 2K01A 3X3NA 1RDPD 2WACA 5CBAE 3N9YC 4KD3A 1SSOA 1V1PA 1EY9A 5C5LA 2DYMA 3EA6A 2A5HA 3U9SA 3DM1A 4UDUC 2M2LA 1CQFA 1DGJA 3SFEB 2IGDA 3KWLA 2JXMB 2X38A 2IDYA 1TWHB 1CFMA 2TSSA 3BS1A 4CKEA 1KH0A 3BWUD 1STYA 5C0XH 3QO2A 1O7YA 4KN4C 4DAPA 3A8IE 2IGGA 3MXPA 4PMBA 2LJIA 3Q6SA 1L4DB 1TR5A 1WTRA 3AE7B 2V4IB 2J53A 1XF5L 4DU9A 1EWCA 1E0ZA 2E2DC 1WTOA 2B2UA 1FGBD 4IOIE 3SXHA 2Q8RE 4RWSC 3SFDB 1DONA 2EYLA 4G57A 3LYYA 1LTSD 1ZKOA 4HKQA 1TS4A 2WXLA 5EPLA 3Q8CA 2XSCA 5KYIA 2EJFC 4ZRPA 4DXFA 3X3MA 5K36G 2OXPA 1Y8NB 3CIRB 3ZGZA 3SK6A 3C8YA 5JJZA 2ONQA 1KDCA 1K51A 2OHFA 4L1BA 2NWGA 1XX8A 1F9QA 3D6CA 1GUGA 5KIXA 4RNAA 4N58A 3RFZB 1HFGA 1VMPA 3PIO3 1UWXA 2EE1A 5HFYA 2BS4B 4IUPA 2NYZD 2MJ3A 1E0BA 1H9JA 1BUIC 1XLPA 3H3VC 4Y7NB 4L23A 3VQIA 1MHXA 2LHEA 3B2FA 3K5NA 3R3OA 4FVMA 1QLBB 3U2SC 5I2YA 3OW7A 1SNOA 4KHZA 4IKGA 1GJXA 3KLRA 4C1NK 3U52E 2BA1A 2E74C 3T16A 4WRDA 1JWBD 3PUXA 1BCPB 1STNA 3FILB 2EJMA 4ARCA 2HCCA 4YSZB 2LS01 4MACA 1XCQL 3PZ8A 3Q24A 5BYSA 4PMCA 1YNTE 4HTHA 4S3SA 1KF6B 4DN4M 1K50A 2NN6H 4KKSA 2BTEA 4KKJA 4A90A 2FMMA 2INNE 3S17B 1AZPA 1JW9D 3FMCA 1X3QA 2I2YA 3FDTA 2HQEA 3RUZA 1LT5D 4FXCA 1PRTF 3Q22A 2PW7A 3PUYA 1SYDA 3N6RA 2ID0A 1A15A 3SEBA 1PYWD 1TKWB 2WXNA 3E56A 4BS9A 3AH7A 3J9CA 3AEFB 3GB1A 1L0XB 3SHLA 2JEAI 1TWAB 1S5FD 2RKSA 3IAM1 4N6EB 4G7ZC 1JWMD 1WGKA 1A6XA 3IL8A 3LB8C 4ODGA 1F9PA 2KOLA 1MSGA 4KV6A 1PFNA 4CJ0B 5F2DA 2WINB 4R3DA 3NVVA 1WYGA 2D9UA 4K2LA 5KGUA 3J80E 5C3JB 3GTMB 2F0GA 4IUQA 1MHHE 4ZRZA 4RH6A 1HZ5A 1S5BD 1JOQA 1DOKA 2AUKA 2F1MA 4ZHPA 1UEAB 1OFFA 3KUPA 4HJGE 3D6WA 1WVLA 1G6ZA 3QG1A 5EBCA 1GB4A 4FYDA 4H13C 1A70A 1LTGD 1UUPA 5ISRA 2X6GA 5EE0A 4C3HB 1BNZA 2BB6A 2Z4IA 3ABVB 3HZXA 1KFYB 4ILWA 4ZYSA 4ZHOA 4OGQC 2WXHA 1SEBD 2WU2B 2F0JA 1EZ8A 2D2CC 3NTHA 1BCPD 1YNJD 5COYA 1IKLA 1BCPF 4Q2JA 4KGRA 3HGBA 1RJTA 3MC0B 2M9VA 2J52A 4RCOA 3NQIA 1EWHA 3K6OA 2Z8LA 1FRDA 4ID6A 4BY7B 3NVYA 5M3FB 4CQNA 4QMGA 4MT5A 4ZKBB 2JZPA 1BDOA 2OF1A 2F4IA 2PZUA 5G5HA 2Q8IB 1FRRA 1WXQA 3GTLB 3NBIA 4L63B 1EY5A 3L3OC 4EQNA 1SFOB 1ZXTA 3RLFA 1OXSC 4IQZA 5ELFA 1GPXA 1WTVA 4XQNA 3FC4A 5JPMC 4AYBB 2IX1A 1VZ8A 5C5MA 1SIJA 4KGSA 2EELA 1UWMA 1Q12A 3JAML 1SYEA 3T13A 4DAYA 1K83B 4L6TB 1AWDA 3DUZA 1E2VA 3D31A 3IFDA 1OXXK 1BBXC 4WQMA 2IX0A 1KDBA 2EYMA 3SR6A 2MH7A 4IDIA 1SE2A 4V190 1K8MA 2B2YA 4B0MA 3RMHA 3URYA 3VA7A 4Q5VA 1SMYD 1IGCA 3A8JE 3FVQA 4N9TA 4NW2A 3HOUB 5G3LD 1NYRA 3P20A 1TKGA 2WXIA 1C48A 5JEAH 1NUCA 5G5GA 1JOKA 2IT1A 3BK2A 3T4AC 4HCSA 1FCCC 3M4YA 5KNBA 1SXTA 1GHJA 1GUSA 3OWEB 1IUEA 1X32A 2R3ZA 2B76B 3TZDA 3AB9A 3BVGA 4HEDA 2F0HA 2K1BA 1VDVA 2QJLA 5GXGB 1G8ZD 1HTPA 1KNEA 3SE0A 1GB1A 2F0QA 5HI1A 1WD0A 1X3PA 2PVOD 3NRZA 1ZYRD 2CHBD 4BY1B 5T1GA 4J3OD 4DQOC 2DNEA 1C77A 1NR2A 4KKIA 1B53A 3AE3B 1L5PA 2R6GA 2KVMA 2L0CA 5BMGA 1ILPA 1AYFA 2KDMA 5EE1A 2B2VC 4J8QA 2EYPA 3I8ZA 1KRHA 1BCPC 1YNJC 1D5MC 1R9TB 1C8CA 3I90A 4C7YA 1IBXA 1RYJA 4HN7A 1EFID 5BN4A 3MFGA 2JYEA 4C56C 2SOBA 3EGRA 4KK7A 4F88A 1EM7A 1U9RA 3QIAA 3H91A 1WSPA 4WFN3 1STEA 4XQQA 2D5DA 2CW0C 4E6IA 3WCQA 3MJ5A 4USAA 3E9SA 5IGDA 5C0XG 2BYTA 4YT0B 1I3QB 3I4MB 4X3UA 4IURA 1VCIA 1TS2A 1EY0A 3KK7A 3PO3B 5CBEE 1CJEA 1FCLA 3TP8A 1JALA 1GAQB 2WLBA 1N61A 4KKUA 2PKOA 1XEEA 1RF2D 4TKOB 3EFXD 4K8IA 2PPBC 2MJ8A 1AP0A 1DCZA 1LABA 1V8QA 2DBYA 5EKLA 1F77A 1AZQA 5FO8B 5EPJA 5T1IA 1VF5C 5FLXE 1TU2B 1M4VA 5TSSA 2L1AA 1MI0A 1LT3D 1KTKA 1SMYC 4KJOA 1PZKD 2BT6A 1OO9B 3PZ7A 4HRSA 1E2ZA 4M8AA 3Q8FA 2LEKA 1PZID 2BB5A 4K5VA 2H1EA 3RD4A 3K0YA 4KGTA 3TEXA 1Y1VB 1W6KA 3DWPA 3P63A 5D7GA 3ND9A 2WXQA 3LWUA 1EY8A 4HSVA 1ZUD2 1V8CA 4KKTA 4US8A 4RA8A 1ZE3D 4C80A 5BYQA 2L55A 4XT3B 5HGTA 2QILA 1EEFD 2J4XA 1BO0A 3G7LA 4H44C 2IW3A 1IW7D 2XIWA 1HA5A 1DZ1A 1WCMB 1ZYRC 3W9CB 5IGEA 1PFMA 3TZUA 1JE4A 2PO4A 3GTOB 2IPKD 1WTXA 2WS3B 4ZKCB 2A74C 1MI2A 1V43A 2EJGC 2LMCB 3MXNA 5ELEA 2NN6G 1JOOA 3OMCA 1ZDXA 4L8JA 4FF4A 3AEDB 1D6EC 1EIGA 4MM3B 4K5WA 2DNCA 2KHSA 3SVMA 3MWYW 5IOCA 2YYZA 4MH8A 5C0XI 1G2SA 3I91A 5AUKA 3QB3A 4RHSA 5MPOA 4TRDA 1C9FA 3H6MA 3HOZB 1K8OA 1JICA 1R4PB 2AWOA 1K52A 2ZW0A 5EE9A 1GUNA 1SSNA 3S15B 3IAS1 1DOXA 1TWFB 3KLSX 4K8JA 2AQ1B 5JVG3 1C78A 1PZJD 2VZKD 3NQTA 1TVXA 1STGA 2WXKA 1FMAD 1TWCB 2J42A 3FEWX 4RKLA 4TQ1A 3H94A 2AQ3B 4OZBA 3FPPA 3P4QB 3VR9B 5IODA 1PXUA 5KNCA 3O13A 2K3UA 1TWGB 4HMJA 5CYUA 4ZAIA 3B9JA 2NBFA 5BN5A 5ELDA 3IXSA 3TEWA 5LL6S 5M5YB 1HHVA 1YN5A 1YQ3B 1Z7TA 1SE4A 4OZAA 3MXGA 5FKAC 4A3MB 5IT9E 2O5JC 2K32A 2NTTA 1PMRA 3W5UB 3I4NB 3KQ4A 3C3LA 3GTPB 1GHKA 1QNUA 1PGBA 4BA1I 3M7NA 2WXGA 1T5EA 1QB5D 2F0WA 1IBXB 3NBHA 1Y8PB 2AWNA 1ZOYB 3DEOA 4X3TA 5I2XA 2NVXB 4U673 4JWUC 2PIAA 2EKIA 4DA2A 2HDMA 1VJKA 4TQ0A 2EY6A 5I9PA 2INPE 3ITPA 5LL6X 3C2PA 2R7ZB 1ENAA 1T5XD 5DM63 1PRTB 3ND8A 1E2WA 2SAKA 2KQ3A 4QB4A 2JE6I 1D2BA 1Q8IA 2XRSD 5J1ZA 2Q8TA 4YTMB 1F2YA 3HS0C 2Q5WD 1JWSD 3OIPA 5DEHA 3EUB2 1FXAA 2KN4A 1IW7C 2WNMA 2MP1A 3H0GB 1EY7A 3BVZA 1MD2D 4FO2A 1Y8OB 1VF7A 3VYSA 5CV4A 1BF4A 2RA4A 1GUTA 1STHA 2CQAA 5DAUA 5E4WC 3PIP3 1QJOA 4RGNA 1ROEA 4HCEA 5D3DA 3H8HA 3HEJA 2ICIA 4ZRQA 1L0VB 3PMFA 1ICWA 4C3JB 5J22A 4HKZE 2FUG1 2QDBA 3AE4B 2RDHA 3NTKA 3MTSA 2K5DA 2R61A 1J7BA 4BBSB 3AM9A 4G4KA 1ENFA 3I73A 4A3GB 2JWUA 1R7SA 2F0NA 3A7AB 1C4CA 4FXGC 1XLNA 3HOXB 2E3TA 2N7JA 2MJDA 2D62A 2NMQA 2BOSA 2A68D 4YTNB 3BDOA 5HHDG 1C4PA 4WIPA 4JK1C 5EKKA 4C1NI 2GI9A 1HQRD 4K6LA 5JEAG 2JA5B 1L4ZB 2IJ0A 4YIJA 3LX0A 2B2WA 1PFBA 5D14A 1JROA 2V0GA 3BG3A 3VYTA 2HDLA 2K5WA 1TQOA 3TEYA 4A3IB 2FHTA 2W54A 3UI2A 3VA5A 3AN1A 3KBGA 3OWFA 5J39A 2FJ2A 1A3UA 4PQXA 3ZJTA 3BVMA 3MFYA 4IUUA 1PRTD 3I72A 5FO7B 2NVTB 3R2TA 2E2HB 4RGMA 2J7ZA 4C2MB 4A8XC 1G91A 3MZ5A 5C2TB 3TEZA 1HUNA 1RWSA 3DWAA 1QNKA 3DWGC 2G9HD 1PLFA 5C4HA 5IGBA 3AECB 4A3EB 1F2MA 1LTTD 2KJXA 4US9A 1HZ6A 2BBCA 3S14B 4NDXA 5BMIA 3LWEA 4XE0A 2F0KA 1ESFA 4OL7A 4XWTA 1LT6D 4WJWA 1HUMA 1WRIA 4XYQA 4ARIA 3T3OA 3AEGB 2QCPX 1FYCA 2N88A 2YEPB 2B2TC 4A93B 3L7ZC 5C0XJ 2ENBA 1IYVA 3SK8A 2ICEC 1UAPA 5EKIA 4ULLA 1I4GA 3U7ZA 1SNMA 1JC7A 1IKMA 4H7BA 3TP7A 3KF8A 4WORA 2EVBA 3TSSA 3K59A 1V1PB 3L4PA 1IHZA 2RPVA 1DYQA 4JX1C 4X3KA 4BBRB 1S4ZA 1B1ZA 2E2JB 1TIID 4OVZA 2K7VA 3C1EA 5BMHA 1HEZE 5DNFA 2F0LA 2WB1B 2WAQB 1S5ED 1HPCA 3PUZA 4QUCA 2K05A 4LK0M 2A68C 4PNYA 4RKBA 3G6JB 5CC4A 4JPSA 1JWUD 2FBWB 1I4QA 1B2TA 1VZ7A 4FF1A 3U4EG 5CV6A 2CW0D 3Q8EA 4QIWB 1N5XA 1FR3A 3L9AX 4DK0A 3ZJUA 3NPPA 1EY4A 1KAAA 2EY1A 2EPBA 3W3AA 4IUVA 1BMLC 2PW5A 1GOZA 4HROA 4JBWA 3T56B 3VYRA 2JX5A 2O2LD 4N59A 2WXFA 1QOAA 4H0LC 1YN4A 1LACA 1PRTC 2SEBD 3IFTA 1BXTA 4D2KA 3P75A 4IFDG 3BZDB 3AMUA 3I4LA 2PMZB 1J7AA 1Y1WB 3WOEA 5T8IA 4YTPB 1LT4D 4XTCS 2DY8A 4CKCA 2YEPF 5EPKA 1JQYD 2KACA 2F0UA 2PZTA 2EOTA 4CJ2C 3AEAB 4LTUA 1QE6A 1ZP0B 4A3BB 3OSOA 2M56B 3MHZA 3K57A 1ONLA 4OO1H 2QIEB 2F3WA 5CV7A 1XO3A 4R8NA 2A6EC 1FFUA 1FXIA 2EDGA 3GO5A 4HMIA 2SNMA 4EGVA 1ENCA 1QOHA 1N62A 4RGOS 2GB1A 5CV8A 4K5XA 1KDAA 2BS2B 3GTKB 4O42A 1QOFA 2DY7A 3AB5A 2OEOA