2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
4RHSA 1CHQD 5ELFA 1I4RA 3CHBD 5FKAC 1PZJD 1YN5A 4BWGB 1LT4D 2XNAC 1LTID 1AN8A 2AQ3B 1SEBD 1PTOC 4O1NA 1D6EC 1PZID 4RFBA 1JCKB 2NTSA 3W2DA 1I4PA 1DYQA 3BZDB 2RDGA 1AW7A 3KLSX 3DWQA 1XXGA 4RH6A 1EU3A 1MD2D 1DJRD 1PTOB 1M4VA 1SE3A 1CQVA 3URYA 1JR0D 1S5BD 4UDUC 1PRTB 1LTRD 3R2IA 4ZYSA 3GP7A 1HXYD 1QILA 1RD9D 1S5ED 1EEID 1KTKA 2Z8LA 4Z9CB 1S5FD 4C56C 4L6TB 1D5MC 1ESFA 1B44D 1FNVA 1TS4A 1EWCA 1HA5A 1LTAD 2XN9C 3DWPA 5I4DA 3DWAA 3BVZA 2AQ1B 5ELDA 1PTOH 2ICIA 2TSSA 1JWUD 5D3IB 1JQYD 5FK9C 1B1ZA 1BCPD 1L0YB 1LLRD 2CHBD 2QEJC 1TY2A 1STEA 1BCPF 3EA6A 4DXGA 3R2TA 2IPKD 1BCPC 1KLUD 3BVMA 1PTOF 3EFXD 5ELCA 2NTTA 1TS3A 1RDPD 1EFID 2WV6D 1I4QA 1ET9A 1CT1D 1SJHD 1PZKD 1LO5D 1LT5D 1PTOD 2IJ0A 1ENFA 1I4XA 3V05A 1ET6A 1JWMD 3MC0B 1PYWD 1KLGD 1BCPB 1PRTD 1YN3A 1D5ZC 3TSSA 3BVGA 2XRSD 1SE4A 1FNUA 1G8ZD 1V1PA 1FNWA 1D5XC 1HTLD 1CK1A 1FD7D 1LTSD 2SEBD 3O13A 3SEBA 4DXFA 1LT3D 1S5DD 2R61A 1GOZA 4RGTA 4RGNA 3R8BA 1EEFD 4NZLB 5ELEA 4OHJA 1EU4A 1BXTA 1TY0A 1L0XB 2QILA 4L63B 1XTCD 3OWEB 1HQRD 1LTTD 1UNSA 1I4HA 5TSSA 2G9HD 1UUPA 1YN4A 1T5XD 1TS5A 1RCVD 3BYTB 4K6LA 1I4GA 2XRQD 1JWSD 1SBBB 2RDHA 1TS2A 1CHPD 4RGOS 1F77A 2AQ2B 4RCOA 1PRTF 4RHRA 3BYYB 1PRTC 2J4XA 1LT6D 1SJED 4RGMA 5D3DA 5ELBA 1V1OA 4TSSA 1V1PB 2O2LD 1RF2D 1LTBD 1SE2A 3MFGA 1S5CD 1FGBD 1LTGD 1SXTA
chains in the Genus database with same CATH superfamily
1WH3A 2BB6A 1CHQD 4LFBL 2UXCQ 3I70A 3CCUA 4OL7A 2V4IB 2N9KA 5T8IA 2H88B 1VQGA 3WWVA 1YJ9A 3A1QB 2KN5A 3TP5A 4DR1L 3Q3OC 4XWTA 2IT1A 2L32A 2Q2UA 5H8YE 3ZTDA 2FFKB 1I6HB 1WXQA 2F0TA 4HEDA 1B3AA 3ZDTA 4RH6A 3TS2A 5C0XH 5K36H 2Q5WD 2PPBC 4PS7A 1LFDA 4MT5A 3EFCA 1IBLQ 2INNE 4NPSA 2NYZD 3LGJA 4J1MA 1VMCA 2MWSB 2X38A 3H94A 3TIXA 2XVSA 4OVUA 2BYEA 3VUXA 1JMLA 1HXYD 4XYCA 2Y0SB 2G9DA 5AJ3L 3UQAA 2ASQA 4DPGA 1KTKA 3AEEB 3DM3A 4L5TA 3OOCA 2D10A 1JOOA 1GC7A 1QZGA 3UI2A 1EWCA 2ONQA 4WQOB 4BOSC 1VMPA 4KKJA 3C46A 5E4WC 2CW0C 3FMCA 4P75A 1WOCA 1ACCA 3VR3A 2CJNA 2VQEQ 1QNKA 5FK9C 4C3HH 2MFIA 3PO3H 4HWIB 3UDFA 4USAA 1N33L 2PZUA 2FCNA 3SK6A 4MACA 1K3RA 4HJGE 3NG0A 4A75A 2V3PA 3KYCD 2OOBB 1WMHB 4BY7H 2JYEA 3ML9A 4DF7A 3AXCA 4M01A 3FHWA 4JI1L 1UWMA 1Z7TA 1TXYA 2Q8RE 3R2TA 3N1YC 3W1SA 4A20A 2K5VA 3UE0A 3BDLA 4AYBG 3PZDA 3MWYW 1S40A 4I7ZC 1Y1VH 4FJZA 4XWWA 3B6YA 1YOVB 1I4QA 4WQMA 4C3JH 1Y8NB 2LD9A 2KC1A 1V9PA 2XEWA 4C4VB 4DQOC 1G6JA 1ASZA 4DNIA 3PTFC 4OWXB 2PMZE 4FXGC 2UUBL 1UGJA 3KLRA 1P16A 1T6BX 3M7GA 3V05A 2ZJDA 4OIKA 3QOJA 4EGVA 1T3QA 2PZTA 2IWHA 3N20C 1E2VA 1VQNA 2K3UA 4ME3A 1OEYA 3VA7A 2OXPA 4IM0A 5LMNQ 1IBLL 3ZJVA 1PQSA 3EFUA 4GIVA 1HFGA 3ENEA 1KRHA 2F3VA 2NVXB 2K8HA 4JE3B 4IFDG 4IUMB 1IZ6A 2NBWB 2D2CC 1L4ZB 3FILB 3SFEB 4BOZB 5ELEA 1QOBA 2OF1A 4NQKE 1NUCA 2EZVA 1OQQA 5EE1A 1B8AA 2QILA 4N58A 1Y69U 2UUAL 2E3TA 4DV2Q 2A1AA 4MN3A 4MTKA 5A2QE 2ASBA 5TSSA 5LXIB 1R7SA 4HXDA 1GO3E 2Z0EB 2KTFA 4L5SA 1ZUD2 3OW7A 1WTQA 2PEAA 4R9WA 5I6YA 5JPNC 2J4XA 2K05A 2SDFA 3U4ZA 4A3JG 3L9AX 4DR4L 5C3EB 1E90A 3CWIA 3AEDB 2OEOA 2KEEA 4OXPA 1WCMH 4C2MB 5CX3A 4TVAB 3SR1A 4X62L 1LTBD 3KVFB 4FJYA 1BBUA 2B63H 4QCLA 3ALBA 3ZJYC 4A3JB 5M3FG 1FGBD 3I4NB 2IO1B 5D94A 5FJ8G 2QJLA 4GN1A 1E10A 4WJ4A 4XZ4A 1SE8A 1FCCC 4A8XC 1GUGA 2NVYB 1ZDXA 4HPPA 4JQWC 1PYSB 4NAMA 1QWYA 3HM3A 5IGEA 4ZDVA 2EYHA 3ZDMC 3HOVG 1TKYA 2KX3A 2VRRB 1UE7A 1SDFA 2B8FA 1IL2A 3PRZA 1FGUA 1OXUA 3NTHA 4C3IB 4WFN3 1EY9A 3ERSX 1EYGA 3VH3B 2O4XA 1S5BD 4DGZA 3VR6A 2C9WB 2DX5B 3P4PB 3RR5A 4MTNA 2EYFA 3R2IA 2JA5G 3HOUB 2GBRA 1WXMA 1STYA 2MHJA 4BY1B 1ROEA 2V1CC 5GAGC 3R7RA 4DV2L 1O7IA 2B76B 3DWPA 2K6QA 1EOVA 1Z6HA 4BY1G 2WXHA 3EGRA 3VR2A 4ZOHC 2NUCA 1FM0D 4KHZA 2WS3B 3C19A 3DPDA 5GAHC 4DR4Q 2INCC 3UDGA 4HEA1 2HDMA 1J5EQ 4DK5A 2R93B 4FN2A 1SYFA 5BYSA 4WWMA 5JOBA 3VDZA 4OZCA 2JA8G 1UAPA 2RPQA 3GTOB 2JRIB 4JPBW 4DAVA 4DV4L 3AN1A 2V9HA 4MJSA 4YL8A 4DV1L 5ELCA 1DOLA 1EO6A 2W3SA 5EE0A 2OTLA 5F2DA 3TDQA 2BWFA 2BF8B 1KRSA 3WOFA 3NWSA 1GUSA 4KTAA 2LXAA 1WJ4A 3HVZA 1XPRA 3ZRFA 2XK5A 1J0GA 4X66L 5JJKA 3U50C 2F0FA 1WGGA 1OQRA 3S14H 3Q8CA 2C9OA 3TSSA 5KYLA 3NHEB 1UBIA 2BGFA 3Q8AA 1HNZQ 4G7OC 1V6EA 1YNND 2ZNVC 3KJOA 2MJDA 3VRBB 1VQBA 4BXXG 4Q5VA 1S5DD 2BDOA 4I7AA 1XPUA 3A7LA 4GLAC 4RGTA 4QJFA 3KUZA 1TT2A 2F0VA 1VLBA 3APCA 3FKIB 3BU2A 2CWAA 1KJTA 3RD2A 5G3LD 3UDXA 3IKJA 3Q2AC 2L3ZA 4Q2JA 3JAMc 5IYDH 2K0PA 3R3OA 4LK0M 4BKTA 1DCZA 2CVRA 3MHZA 4ITKA 5FLMH 3VAWA 5LLIA 2CQAA 3AEAB 5G55A 3W1BA 1ZKOA 2K5WA 1KFYB 1EZ8A 2L05A 4JIOU 2I5LX 4RNAA 3RZWC 1J5EL 1LT6D 4IUNA 1WY8A 1WE7A 3IT4B 1P7FA 2D3AA 4ULLA 3AMUA 1RF2D 1STHA 3MFGA 1C79A 4LWCA 5C44B 2B2TA 3DVGY 4M02A 3A4SC 4DV1Q 4ZK9B 4RHSA 1GM5A 3NHHA 1KNEA 4RG1A 1QZEA 2HTHA 4OWTB 1YNTE 1K0RA 2UXBL 1A0IA 2WXGA 2LHDA 2AQ3B 1LTLA 3V62A 2JA5B 1RKNA 2X6GA 3CMEA 1AP0A 4JV5Q 4V0BA 1EWYC 1XQQA 1TWAB 2KBNA 4IJLA 2RD0A 2NBFA 3L0OA 3DWQA 1HNZL 3JSVB 1XCQL 3SR6A 3U7DA 5C6AA 4HCEA 2L0FA 1CQVA 3R93A 1Q5WB 2HQEA 4WORA 1WI0A 1XF5L 2AHOB 3LJ3A 1HH2P 2WX1A 4HIKA 1E8XA 5D6JB 1E7VA 4ILWA 2JXXA 5BN4A 3PHXB 5IT9L 2K9XA 1BVSA 3I73A 4C3JB 4MZ9A 2K75A 2NVQB 1J8CA 1ESFA 4NXNL 3OW2A 1B44D 3E0EA 5M5YB 5EQ0A 3AU4A 2B2YA 4A3GG 2QKIC 1G6ZA 3AE1B 4YY3L 1VQLA 2F0EA 5E4XA 1AZPA 3CCQA 3OTOQ 3DOWA 1W6JA 4ME5A 5LL6S 2L1BA 4BY7B 1JORA 2DLBA 5EE9A 2I5HA 4B0MA 4KMUC 2RCFA 4R4OA 5BR8L 1MSHA 2KUMA 4FBJB 5HG2A 1VF5C 1V9JA 3AYHB 1CQFA 1MIUA 2EJFC 4A3IG 3AB5A 3GTLH 4EVOA 2SNMA 1N63A 2YEPF 3D32A 3A74A 1C4PA 2LUEA 4P7IA 3PUWA 3H7SA 1NDDA 4G11A 2UXBQ 5JHAA 2YV5A 3R66C 1N6ZA 5BYRA 2Z59B 3PUZA 2ZVNA 3H8HA 5AUIA 4IOCA 1L4DB 3N1XC 3VTWA 3DLLA 2BA0A 3HHMA 3APFA 1V1QA 1WGRA 4MM3B 1BCPB 1WR1A 4CQNA 1Q0WB 1P7EA 1SE4A 2WACA 2LZ6A 3TJPA 3J7YW 4K0KQ 3H0GH 3ECIA 2LI5A 1B9NA 3VR5A 1TBEA 3NZSA 3EUB2 1VZ6A 2LFNA 4DV7L 1GPXA 1EU4A 5JAVA 2RSNA 3H15A 1F52A 2WDQB 3GZNB 1WGKA 4GN5A 3ML8A 3V61A 3P4SB 2E2DC 4DV3L 2AKWB 4NXNQ 5C3XA 1A3VA 3RLOA 4GKKQ 1SF0A 4DAPA 2KTRB 1A8VA 4L1BA 4C7YA 2KANA 1YN4A 4TUUA 4PQXA 3G48A 2KA7A 1KAWA 2NR2A 2RDHA 4JI2L 1TS2A 1CM9A 4OO1H 2KWUB 3T51B 2PI2E 3VR8B 4M1UB 2O6VB 2BYFA 4RM8A 1Q8IA 4RGMA 3S1RH 4KD3A 1J7AA 3VXWA 3OIQA 3S9WA 2FUG1 3CF5A 1AE2A 4A3CH 1G6PA 1EY5A 4EQNA 1UELA 2E2IB 4KDLB 4US9A 2LSSA 2JA7H 1MI2A 2IL8A 4ICUA 1I35A 2LMCA 2W3RA 1D1KA 4RCNA 1U4MA 2HQLA 3K5OA 1NJIC 2CU3A 1MI0A 2PVGC 4XX5A 4BWGB 2MQJA 1S1QB 1OGWA 3I72A 3OYYA 1KDAA 2UWQA 2CW0D 2WU5B 3I8ZA 3W2DA 2R2QA 2MO0A 1NI3A 2DWQA 2RDGA 1R9TH 2A8VA 2KCMA 2VUMG 1L5PA 2JWZA 1OTCA 2REXA 3AB9A 3HRZC 3A8IE 1WYDA 3TCAA 1GD7A 1HR0Q 2Z6KA 4OELB 4K0KL 5C4XG 2N9XA 4B6WA 1XPOA 1K50A 4NKLA 3SVMA 5JJZA 3K9OB 1FL0A 1VRAB 2RDFA 4M8AA 2KJHB 3D0FA 4TQ1A 1RTNA 3J9CA 3Q0AA 1QILA 1YQ3B 1RD9D 3MZ5A 1STBA 3QOLA 2VXWA 4BXXH 3IRBA 3S2DB 4GKKL 1WXSA 3VQIA 2N7DA 3PIO3 1M94A 2MJ3A 1P8LA 4IKGA 2PPHA 5C3WA 1P1AA 3BVZA 2L0CA 4J6HA 1Q81C 1OXVA 1WYGA 2ZPNA 5GQOA 4JI2Q 2RR9A 2KWCA 3PO3G 2FAZA 5HURA 3CMAA 1W2BA 2PLPA 5C1ZA 2WKCA 4A3OA 1MFWA 4A3LH 2NVTB 5EKIA 3G6JB 5CC4A 2WFWA 3BIID 4QUFA 4KSKC 4FA6A 1SNMA 3IBEA 4TQ0A 2MO1A 1WTVA 2D62A 1C77A 2KDFB 2QIEB 1L7YA 1IBMQ 3I4MH 3PO2G 1BR9A 3K80C 5EPLA 3ZW3A 1FXIA 1TWCB 2G45B 4I6LB 3MHSD 4A3EH 4L5QA 2KFKB 2SNSA 5HGTA 2WB1G 3AV8A 4LW1A 4ZUIA 1PH1A 4C3IH 2JYTA 4YTPB 1CMXB 5I2YA 2RDBC 2EIFA 1SJHD 3KF8A 4ZHPA 1VQDA 2K01A 1EQVA 1HEZE 2IO2B 3AM9A 2INDC 3QK0A 4NPNA 4GZYC 3DHQA 2B2UC 3FEWX 1CTMA 4LUZA 4E71A 1HRJA 3GTGH 2WQYB 1KLGD 3NS8A 4NMZA 2ZW0A 1BKBA 4LK1C 2EY2A 1YQ4B 4K2KA 3L13A 2AUKA 3QJZA 4TKNA 4YTMB 5IYBH 2B2YC 2HE7A 2Z4IA 5KEEA 3GTOH 4XQNA 2L1AA 1F2YA 1PH6A 2RPVA 1ZGUB 2DN8A 3GV6A 4A3KH 2KC2A 2DJGC 2RQXA 1K3BC 1NE3A 3KBGA 1WF9A 2V1YA 2J0KA 1VDVA 5JEAJ 1X9NA 3AE6B 4XDDA 4HDOA 1C9FA 2F03A 4HJ9A 1VQKA 4JBKA 4W9KA 1SMYD 3FP9A 4UHVA 3IFTA 2RVLA 1Q86C 5M3MH 2XBBC 1FR3A 4LJPB 3SDLC 1RODA 1LQBA 4P1CC 1XO3A 3NY5A 1B9MA 5CBEE 1Q1OA 3GTGB 2O6VD 4DV6Q 3J7A5 2R7ZH 4A93G 1WM3A 1CSQA 2GA4B 4RGOS 2M17A 4H02A 2AQ2B 2I1JA 5G2NA 2KVRA 4BKSA 1N60A 2N55A 1KD1C 4B95A 4YHHL 5D3DA 3CQZB 1BUVT 3RN2A 1TKGA 4EQ5A 4BA1I 3J7AF 1Y8PB 3P7JA 2F4VQ 1R4MI 4YTNB 1JB3A 1PFBA 1GHJA 1S3SG 4ANXA 4PMBA 1SE2A 3LX0A 3AE4B 4G7ZC 3D31A 1RTOA 3RZFA 5EE3A 1XLQA 3CF6E 2K04A 2MEKA 3DHIC 4EZJA 2WXMA 2XNAC 4CKCA 4FF1A 1UH6A 4WWOA 3J7ZC 4DAMA 2EY5A 5IYCH 3I4LA 3M4OH 1YQBA 1LACA 2KDBA 2KD0A 3PGEA 2KDIA 2FHTA 4LFBQ 4GOCA 3UIPB 2R92B 4AWJA 1L2FA 2QDBA 1K8OA 1FFVA 1IL8A 5CYUA 2NPTB 1O78A 1MD2D 2KQ7A 4LCDE 2VY3A 4RWSC 4QIWE 2F0HA 3HOZH 3ZNZB 4IURA 4MNOA 2KFJA 4DR1Q 3HOXH 4FF4A 4F87A 5C4XH 1VQ7A 2R92G 5K36G 1NTGA 5BN3A 4FLHA 4KN7C 2M19A 4ZQ3A 5BMHA 2PTLA 3GS2A 3H6NA 2Z8LA 4C7ZA 4G50A 4E3CA 2NVTH 1YNJD 1V43A 4W9CA 2KDMA 2IYDB 3J7AV 1VDZA 1SYDA 1DD2A 2K5DA 1E7PB 2FINB 3EIVA 3RNBC 2NZOA 3S16H 1TS4A 2BKFA 4IW0A 5I4DA 2MP2A 3PPAA 1ZYRC 1I3QB 2Z9HA 3STBC 1MHHE 4KX6B 3RT3B 2XK5B 3WA0A 2BYVE 2RSOA 3F2CA 3W1SC 3NTIA 5L37A 3HG9A 2DENB 4DK0A 2KECA 1PHJA 4EKUA 2X69A 1PUTA 1U9RA 3WAPA 3TMEA 3L08A 4ZKBB 2HDEA 4AYBB 3I3CA 3Q8DA 2DYMA 2ZPYA 1ZW7A 1STEA 2INPE 2BQQA 1F0ZA 3VHTC 2MCNB 3GE8C 3BVMA 3EFXD 2NMQA 3QA8A 1ZXHA 1E8ZA 3LDZE 4HPMB 5JJIA 2PW5A 1H9JA 1CT1D 2N7EA 3HOXG 1JROA 4MEMA 1SROA 5NUCA 5C0XJ 1T0SC 2IJ0A 4K7SA 4K14A 3JVZX 4KGRA 2F0OA 2CS4A 2O5JC 2MRPA 3HRDD 1EY4A 2WXRA 1L0VB 2B2TC 4ZAIA 5E6JA 4ANWA 4JVZA 3VYUA 2LWPA 2YLMA 1SNQA 4DU9A 1KXLA 5DPWA 4MGZE 3SEBA 2ES2A 4LAAA 3U4VA 1ASYA 4WJ3M 1PXUA 4KY6A 4GOPC 2VH1A 4CKBA 4NAWB 3ZNID 3AMZA 3R8BA 4X3UA 3AE7B 1DONA 3FDTA 1EUVB 4BZAA 3HEJA 3T3OA 4DK6C 4KIKB 1MJEA 2IGDA 2BCOA 2RBMA 2N9LA 5LMNL 4C80A 2CR5A 2M0AA 3IAM1 1K83B 3PQIA 3PUXA 2M0XA 1GB1A 4QB4A 4ANUA 2L7RA 4RF0A 3BYTB 4OONA 3SDZA 1C4CA 4F8CB 1CHPD 2WIIB 2HIVA 5T1IA 5FLXE 3KH0A 4OW0A 4HLEA 1WSPA 4HJ5A 3I57A 1GUAB 1YJ1A 2R7ZG 3U8ZA 1PMRA 1TT5B 1WI5A 2UUAQ 3CSTA 3NJTA 2B3GA 2UU9L 2O2LD 4JX1C 2KQSA 2VB2X 4M00A 4OWWB 2JYOA 3J81E 2CWPA 2K6DB 1XJVA 3ICEA 5FLXL 3UI3A 4GNXB 1UEBA 1FYCA 1DYQA 1SXTA 5C3EG 1HNWQ 3DXJC 4W9IA 3AU5A 5C5LA 3C3LA 2F4IA 3Q6SA 4XXEA 4AP4C 4KY5A 2J0JA 3U4EG 4GOPB 2X8XX 2PQEA 1SB3C 4M8MA 3EBEA 2MUYA 1LYLA 2WAQB 2EXDA 4BAXA 2KLCA 1NENB 3BZDB 1IKMA 2D3CA 4FULA 2QDLA 1U4PA 1STNA 3OAWA 1AW7A 3D8GA 4P74A 3H6MA 1QLBB 1TWGH 2QGQA 4IPCA 5FO7B 1QVGA 3RZOH 3UGBB 5C44G 1H9RA 3MXPA 1N5XA 3M63B 1M4VA 2EYPA 1R9TB 2Z4HA 3N52A 3B0AA 3DVGX 3FVQA 4XT1B 4A3LG 5J22A 2GVBA 4KV6A 4C3IG 4CDCC 2J53A 4AUQC 1K8RB 1SE9A 4R4QA 1WTWA 4C56C 4CHKA 2K39A 3N1ZC 4DAYB 1CKNA 2M56B 4DNRB 4IWQA 4KDIC 3I4MG 2KOLA 4JI6Q 1FNVA 2UU7A 5HHDG 3I3TB 1WTHA 2B2WA 3DDCB 2E2IH 1OFFA 2H4OA 2HTME 1QB5D 2JXMB 1TYGB 1RJTA 2MBOA 1UGMA 1XT9B 2WLBA 2C35B 4BKGA 1CKNB 1WFYA 2YU9H 4C4VA 5DEHA 1ZKHA 3K9PB 4W9EA 2HUGA 2Q2HA 1QE6A 1YIWA 2WXNA 4O0AA 1MVKA 1V2YA 2NN6G 3S2DH 4KSLC 2R2OA 1JOKA 4YWMA 1UD7A 2K22A 2AWNA 2K1BA 2FCQA 2WV6D 1EZ6A 1N32Q 3U58A 2BE5D 5HI1A 1YHAA 3T8MA 3HK0A 3NZUA 2KJXA 2WXKA 2G5DA 1ENFA 3ND9A 1IBXB 3A4RA 4FXKC 4R4TA 5CV4A 4HIMA 3RUIB 3MAQA 3J80L 4JI7L 2FIDA 4DV4Q 3EJIA 2LGYA 4BBNC 4A4IA 1SYBA 1IPGA 4WRDA 3IG3A 3T56B 3CCLA 2QC8A 3K58A 1DOXA 1HZ5A 3AEGB 1SMYC 1SYCA 3JAMi 3P4QB 1MG8A 1R4QB 1FRDA 1RYJA 1FD7D 5FR6A 1LTSD 1VCBA 1CZWA 4KKSA 1SFOB 3DBHI 1WTPA 1G51A 1GOZA 1J8IA 2DUDA 1EQRA 1WTOA 4X66Q 1EEFD 4XC2A 2WGSA 1V86A 3F8TA 4A93H 1BXTA 3CU7A 3ULJA 5CHWA 2KTRA 2W55A 1Y1WB 4JI6L 1ICWA 1UNSA 3NWTA 5C0XG 2XWJB 3ZLZA 2Q2IA 4A90A 4ZYNA 2OTJA 5MPOA 1SIFA 3K5LA 3RNUA 3M4PA 1CFMA 3QX1A 2L12A 2J42A 2WAQG 4JGHB 3CCJA 5C4JH 1B7YB 4GN3B 3PZ8A 1V1PB 5C0XI 4JK1C 2Y5BB 4KVGB 2LGDA 4AQYL 3QAQA 5D65A 4MM3A 2LHEA 1S5CD 2VL6A 1ZOYB 1MG4A 2DAFA 4K2LA 4AJYB 4MJSB 4LF6L 2NVQH 1PZJD 2DGYA 3IHPC 1TTNA 5IGGA 3JAME 2A6ED 2A73B 3HOUG 1TWFH 1EY0A 4REZA 4J8QA 3Q8EA 3H3VI 5GAEC 4RFBA 3GTPB 2I38A 4JI7Q 2RHSB 1L0WA 2HT1A 2BTEA 1TWHB 2KYWA 5E6OA 5G3LF 2C60A 1JE5A 2WDRB 1KNAA 4HJKA 1F9PA 2WB1E 5IT9c 2RGFA 4ZHOA 4MIUA 5DNFA 2E2JH 3DWGC 1JR0D 3J81i 1YD8U 1PGXA 4FDBA 3U2SC 4DHZB 2RSUA 1PRTB 2PYKA 2C5CA 3GP7A 2TMPA 1KHIA 2O2VB 5C4HA 4H7BA 1IUEA 2EY6A 2HDLA 1D5MC 3Q69A 1XTDA 4YCVA 3TZDA 3QQ8B 1LV9A 3HOWH 2IBIB 1I7HA 3U9OA 1F2ZA 4FP5D 2EYLA 1YX6B 3ZGZA 3BZCA 3HP3A 3BY4B 4RM9A 5J2RA 1C3TA 4GS3A 1JWUD 3PSIA 3M85A 5IE8A 4A3IB 2BH8A 2G4SA 1HCZA 3PF4A 2WXQA 2ZVOA 2JJQA 5C2TB 2R7FA 4C1NK 4YT0B 1E9MA 3TEWA 2CHBD 1QNUA 2OT2A 2PKOA 2D0PA 2HCIA 4KKUA 2MSED 4X65L 1WR6E 5E3FA 4A3EG 1G2TA 1QT9A 1STAA 1BCPC 1X65A 3GQBA 3B1LX 3TEYA 4LF6Q 3EROA 2F0JA 1RWSA 1EFID 2LXCA 3S24A 3S1RB 4DFAA 2O2VA 2WINB 3A56A 1FMAD 3L16A 1KDCA 2DNFA 3BDCA 3KF6A 4MHEA 3Q3JA 2Y0SE 1K8AC 3OG5A 2JA7B 4QMGA 1L2NA 5CBAE 3UINB 1KRTA 2WXLA 4EFOA 4DR6L 3SD5A 3BVGA 4GLVB 5IGDA 3TL5A 4I65A 4B9KA 1TKWB 1J19A 3SK8A 1XD3B 2V4DA 2I07B 1AARA 5KRUA 4M0WA 1PH7A 4LUOA 3H3VC 1X3GA 3K59A 1R4NI 1H95A 1K73C 2QHOA 5C3JB 4A3DB 1L0XB 3HGBA 1A6XA 2KCTA 3T16A 3S17H 1TGZB 2AMCB 3KK7A 1WVLA 3JSVA 4BBSG 3J80E 3N30A 1S4ZA 1T5XD 4A76A 2EMTA 1NR4A 3RN9C 1VQ6A 3DBSA 4DV7Q 1WRDB 3PS6A 5JXVA 2A68D 5K5PA 3M3JA 1CZGA 3LB8C 3ZRCA 2PMZB 4RHRA 5EJWA 3ZJUA 1I42A 2K50A 4DV3Q 2JA8H 4TSSA 4A9AA 1UEAB 1N62A 2KLGA 4J6IA 3K6OA 3VR4A 2NVXH 3Q14C 1VR9A 4H44C 3HIZA 2HD3A 1X1MA 1ONLA 1Y56A 4Y7NH 4LF8L 3HOYG 4C3HG 5D7GA 1EY7A 1SSNA 2DNCA 1BMLC 4B3RL 4KN4C 1BBWA 3X23A 1ZP0B 1K51A 1SRUA 3J81c 1SEBD 4IFDI 4C3HB 4DUZQ 3A9KA 2M8SA 5KHQA 5GADC 2BT6A 5C4XB 4I6PA 2LMCB 1GAQB 1I4PA 3DBHB 4ZRZA 2JSVX 1STGA 1CJEA 1TQOA 4Q0FA 5I6WA 3EQLC 5EPKA 4DR6Q 1BUIC 2MBEA 2LGSA 4IJHA 5M5XB 4F1SA 4R8IA 4B3ML 3T3NA 5CHFA 2A5UA 4RF1A 1B3QA 4WIPA 4II3B 4C2MH 5IOCA 4JCVE 1A3TA 1X54A 1WZ0A 2ZEQA 5E6PA 1C0AA 1VQCA 3S1QH 1UE5A 5ELOA 3H3VH 3W9CB 4L6TB 2K32A 4AOFA 2BYTA 4X64L 5JVH3 5IGCA 4JLCA 2KMCA 3DM1A 1LTAD 3C8YA 3DWAA 3B2FA 2KHWB 1QZHA 3IAYA 4DR3Q 2R93H 5ELDA 1WCMB 3H0GB 4GSWA 3PO2B 1BCPD 3IFWB 1CI3M 2KFKA 3A1QA 1DOIA 2ACZB 1D4BA 1WCMG 4DK3C 2IX3A 5IP7G 3OPOA 1BF4A 1TIFA 3L10B 3NZ3A 4F8MA 3ZNGC 2K25A 2DNEA 1ILQA 5FR3A 4LF8Q 3QARA 4EEWA 4B3RQ 5M3MB 1E1TA 1F2RI 4HK2A 2RCNA 3KDFB 2I5MX 4K8JA 4WAAA 1SYGA 4XGAB 1PZKD 2MGSA 4XE0A 2EJGC 4DUZL 1PA6A 1XCTL 3SFDB 3T1HQ 3PLUA 4DR5L 3GTLB 4A3DG 1VZ8A 2M00A 2JRHA 3U7ZA 4E74A 1QUQA 4K3BA 4IZ8A 4UP8A 1CKOA 4J3OD 4M8NA 1JQ4A 4BKSD 3FPUB 3PV0A 3A8JE 4AYBE 4DK1A 4B3MQ 3D6CA 2IGGA 2WDVB 3OJ4B 4NW2A 4WWNA 2C7NB 3VYRA 3GTQH 4NAWA 4JBMA 5AEKB 1DGJA 2HJ8A 1E8YA 4G3XB 2KVMA 1CKMA 3H7PB 3HOZB 3W1GA 1B4OA 2WNMA 2A68C 4L23A 1HZAA 5LMNW 4EQPA 2CKZB 2VZAA 1P9DU 4X64Q 1RIPA 4RAUC 5M5WB 4PZ7A 1ZXIA 2GBJA 2O6VA 5IKCM 1DXMA 1HQRD 1VS0A 3PHWB 1GUWA 2L5TA 3QIAA 3LNNA 1QJOA 4K6LA 4OVZA 5IP4D 1IYFA 4TRDA 2GOWA 3GTQB 4B3SL 3ZUNA 2EKEC 2FUHB 2DY7A 2ZXOA 4BS9A 3MJWA 2LFIA 2QCZA 3FC4A 2Z0SA 3SK5A 3A9JA 3WOEA 5LL6X 3WIMA 4A93B 4ARCA 3GTMH 3MVVA 2DYBA 4S0RA 4IALA 3W5UB 1QOHA 4CO7A 5JEAH 2KHIA 1OQYA 1XEEA 2LGIA 3H7PA 4G0NB 2EQSA 2IZVB 1LTID 1AN8A 2F4VL 1NI2A 3PSEB 1YZ6A 1T0YA 4L2YA 4DR5Q 1K8GA 2FJ2A 2BVCA 3A9KB 1E0ZA 2KENA 1H9SB 2MJ8A 3K7AB 1F1HA 2K6AA 3GOEA 4B9XA 3ABVB 5JZEB 1XXGA 2JVCA 2L83A 4A3BB 1NNXA 3BJUA 1PTOB 4J15A 4GB9A 1EF1A 3MXUA 4NP5A 4GLXA 2OJRA 1GJXA 1K8MA 2A74C 1NY4A 2L4NA 3CSFA 4MH8A 4X3KA 4X3TA 3A5UA 4ZCKA 4HKQA 2E76C 3PGZA 5IGFA 2NPTA 4Z9CB 1S5FD 3KWVA 1SIJA 4KV2A 2OQ0A 3ZVVA 1FXTB 1K0SA 5IN7A 1Q7YC 3CD6A 1EM7A 2JP1A 3H1UA 1CA5A 4B3SQ 2G4DB 2N49A 3P20A 3OMCA 3DCGA 1K9MC 4LNNA 1UF0A 4MGKE 4DAYA 4R3DA 3Q23A 1YBYA 2UUCL 2UXDL 1RLFA 3W1YA 4ODGA 2KJRA 4W9HA 1HFNA 4FJVB 4URKA 2LJIA 4LJZC 2RHQB 3WALA 1WWTA 3E9SA 3I9V1 2HJ1A 2A6HD 4JW0A 3M4OB 4YWKA 2GI9A 1QOAA 1PTOF 4IUQA 2ZZPB 3IT6B 4K5WA 4C1NI 1E7UA 4LJOB 4OO1G 5ELNA 1F9RA 1Y14B 4UP7A 4CDFC 1Y8OB 2KJ6A 4US8A 2B2WC 2B29A 5LXHA 4W9LA 3I91A 4R1JA 2YTXA 4RA8A 1IP9A 1JWMD 5FJ8H 2W54A 3NSWA 5JJLA 4PNYA 5JEAG 4ID6A 5LHY1 2GRIA 1YN3A 3B2GA 2JA8B 2JQRB 4PT5A 5I2XA 5EKLA 5FLXc 4JYAL 1XMOQ 1D5XC 1YIJA 3O13A 2BDNA 3QJYA 2N78A 1SLJA 1IBXA 3F1ZA 4QQBX 4IFDJ 4GNXA 2CU1A 3V60A 3A55A 1YJNA 5IP9G 3S1MB 1X6OA 4HJ8A 3BINA 5IA7A 1LM8B 3VUYA 3S15H 4XIGS 3V3XA 4EX5A 1TWGB 1EUJA 2H1EA 4POGA 2GVAA 3KQ4A 3G71A 1TY0A 2A6EC 4MSMB 3RN5A 4K3CA 2L0TA 3L0WB 3KYHC 1XTCD 3S1MH 2D07B 1X3FA 2KDEB 3MA2B 1I4HA 1WJJA 4ICVA 2JE6I 3Q3NC 4GXBA 2QCPX 1BNZA 2FXQA 3HFZB 1KABA 2LJ5A 2KWDA 3H9DA 5FOBB 3HKZE 1K83H 4A3PA 2F0UA 5T1GA 4LF4Q 4XQQA 1V1OA 2Z6KC 4A3FB 1O7YA 1UWXA 1Q12A 5C4ZA 2Q2TA 1JW9D 4LFAQ 1ISNA 4FHJA 5AUKA 4TKOB 3AE2B 4PK1A 4A3BG 3IXSA 1MHWC 2Z1CA 3CHBD 5G5GA 4F88A 3Q6BA 4CDDC 1E3PA 3J80i 3KJPA 3BS1A 4NJ6A 3C2PA 1Q1BA 2UU9Q 1WZ3A 1ICFB 3AH7A 1T0RC 5H92C 1T0QC 4DXAB 5IYBG 1HZ9A 2GBKA 1TWCH 1HNWL 3V2TA 4JPSA 4XYQA 3KLSX 4JWSC 1VQOA 4G57A 3EECA 3SE0A 1VCIA 1DJRD 2HCCA 4GKJQ 4A3MH 2NWGA 4ZRPA 3GD7A 4WJNA 4UDUC 4L8JA 1WX7A 1PFMA 4Y7NB 3D4WA 2D2QA 3NBIA 4BA2I 2N4FA 3VUWA 2ZTDA 5L83A 3GO5A 3KW5B 1QUQB 3FKYA 3MC8A 1S5ED 1UE1A 4KKTA 4LNKA 4LDTB 1W3SA 3RCZA 4HKZE 2RF4A 3PUVA 4R8NA 1HTOA 4ZRKA 1HNXQ 1D3ZA 1HUMA 1SN8A 4UAIA 3TEXA 1BT0A 4JOIA 2D5GA 2F0WA 1CSPA 1ZDVA 3AU7A 1FPYA 2EYOA 3OJ3A 3LYYA 3M95A 1X3QA 2AQ1B 4HSPA 2F0QA 2KK8A 3GTJB 2MP2B 2PVOD 2B8GA 4HCNB 1GKHA 2V3SA 4NXML 3R7QA 2KZRA 2F0IA 1D2BA 4JI8L 1B1ZA 1KIXA 4DR7L 4LF4L 4QUCA 4B0EA 2Q8TA 5CV5A 1AH9A 5CV6A 2IX1A 1RM6C 3PVLA 1F2LA 2ZXPA 3F2UA 4DV0Q 4BBNF 4DHJD 3TP8A 4A3CG 2LEKA 4LFAL 2MBQA 2IDYA 2BW2A 3T13A 1PVOA 2ZJRA 1XNRQ 1IYJB 1YITA 2OWOA 1U4LA 2YU9B 4YIJA 2N9PC 1WX8A 3DVNU 3NBHA 1YEZA 3DMUA 4FHKA 4DWFA 3EN2A 4BY7G 4W9DA 2X6LA 3ZQ4A 2YEPB 1PTOD 2G1EA 4PZ6A 2LVQA 3GTMB 1B70B 1FVIA 4IUUA 1PYWD 3ERQA 3QIJA 2F1MA 1WFQA 5M5YH 2ZM6L 3JYUA 3SHLA 1L6VA 4HCSA 3PV1A 2XRSD 1N32L 2L11A 4EOYA 2QA4A 4GKJL 5IOIA 4IC7B 2OHFA 5C5MA 4Y52H 4XT3B 2LGXA 1QG7A 1X55A 1MHXA 1FJGQ 4HJAA 2K5PA 4JI5L 3T9LA 1EY6A 4YXDB 3H09A 4PMCA 4NZLB 4GN4B 2R92H 3S2HH 1EWHA 1J7CA 1NAPA 2JA7G 3VTUA 2K1FA 2BBCA 1HNXL 4YSZB 1RRBA 1L1OB 1TKEA 5LNK1 1PDQA 4N9F4 4KHPL 2L76A 2V3NA 3AULA 5GMVA 1SBBB 3H91A 1JRPA 1C4AA 1E2WA 2VUMH 1SFOH 3E56A 4JI8Q 4DN4M 3AEVA 4DR7Q 1Z5SB 2Q8IB 4JC0A 2EJMA 1UBQA 4DV0L 3CCVA 4IUTA 2ZNVB 5CHVC 4NDXA 1B9RA 4RMFA 5GXGB 2PMVA 2K8BA 3K7UC 3OSOA 2KNBA 3NS1A 2F3WA 1D7QA 1N61A 1N36L 3HKZG 2AWTA 4QGUA 1MKHA 3NQIA 3S15B 2MNAA 1RFKA 4AQYQ 1D6EC 1EIGA 2YYZA 1ILPA 2MPMA 3VYTA 3MHBA 2DZIA 1PFSA 2N3SA 2GN5A 3S17B 2K4KA 2ZM6Q 2LKVA 4FXCA 3VTVA 1KQSA 1JWBD 1MPEA 4MSQB 1D1IA 1EU3A 1YNJC 5DAUA 3TREA 1C1YB 2CHWA 5BN5A 1Q82C 2HIXA 3MC9A 2WKDA 4M0WB 2ENBA 1PH5A 1RAXA 3GTKB 2IY5B 1WJ6A 2L00B 3FPPA 4JI5Q 4FF2A 1EIYB 1FEHA 4A3GB 3PREA 1WM2A 4EZLA 1HE8A 3TN2A 5FO8B 2F52A 5IODA 2VZKD 2ZXRA 4YSYB 4PS3A 2MBHA 3E9HA 1UZXB 1ESRA 4W9JA 1GJZA 1YI2A 2PI2A 1HA5A 2Y3AA 4PMWA 4CGYB 3UIOB 5IGBA 1J7BA 2GLSA 1A2TA 1YHQA 1B53A 4IUVA 4QIWB 2B3AA 2KACA 2N1WA 3L7ZC 4B08A 2BS4B 2ZTEA 3NXWA 2EELA 4GDKB 2NS5A 2N9EB 4JI0Q 3OIPA 2KKCA 4A3BH 4BFRA 1VQPA 3KUPA 3VRAB 4KIKA 3R3MA 2ZJQA 4BBRH 4A3GH 1G2SA 3HM6X 2WYQA 4EQOA 1IGCA 2FBWB 3C1FA 1BO0A 2RKSA 3RULA 3WDNA 1VQEA 3EA6A 1H9SA 4XDCA 3GTJH 1A5RA 1ZEQX 2AYOB 3HVDA 1L6UA 3S2AA 3TMPB 2PE9A 4IPHA 3G7LA 1VD2A 1TS3A 2PW7A 1N36Q 2LVOA 3AEBB 1TU2B 5IP7H 5IT9E 3HOUH 1D8LA 2NVUI 3ER0A 3OHXC 2RMMA 2ALYB 3AQQA 1ENCA 5J18A 1B2TA 4GLSC 2R6GA 1N34L 2ID0A 4X65Q 1EYCA 3A5ZB 3DWMA 1QQRA 2L8JA 4RMAA 4CJ2C 1V8CA 5IO9A 4GNXC 2PO4A 3FAHA 4YWLA 2CQOA 4JBJA 2QEXA 3A9JB 4WH4A 1VQHA 3TS0A 3BG3A 3V6CB 2K03A 4X57B 1JJCB 4HJ7A 1HA6A 2CHXA 4OIJA 1QOGA 4RGNA 4KD4A 2KMMA 5DLQE 4RKLA 2WWZA 3ULPA 3SGIA 1Y1VB 1GG3A 2VB3X 4ASWC 3L54A 4L63B 1E7ZA 4LF5L 1LTTD 5KNBA 1M8AA 3L3OC 3Q8FA 1EF5A 2W9NA 4JI3Q 1DOKA 1GC6A 1PH4A 1WX9A 3AFQA 1Y1VG 2EKIA 3NENA 1QVFA 1WXVA 3Q3FA 2KQ4X 3K81C 4N9PA 5G5HA 3BWUD 1SJED 1TR5A 2ZTCA 3MXGA 5FLMG 3RZDH 4HMJA 4FYDA 2KOXA 2B2VC 2E6XA 4YCWA 5FO9B 5HGQA 3S14B 1DOYA 3CC4A 2VW9A 2LVPA 2M4NA 1EQQA 4HN7A 3QC8B 4UPAA 3RD4A 3BZKA 4F7ZA 4XTCS 2VQFL 5E7NA 4FNFA 4KK7A 1LT4D 1K52A 1TZ1A 4B3TL 1P0RA 4NQLB 5AZHA 3HOYB 4WWPA 2LRUA 2C7HA 1IW7C 4IPDA 1N34Q 2NTSA 4MGIE 2B39A 5IWAQ 2D5DA 3PO0A 5EDSA 1LXDA 4S17A 1Y1WH 3M4QA 3P4RB 3PCOB 4ZRJA 2N88A 1XLNA 2NN6H 3PLVA 1C48A 4ANVA 3WANA 2CKHB 3NBHB 1X3PA 1KOTA 2MH7A 1SE3A 2KHJA 4OGQC 1NMGA 3VYSA 4BBRG 4H13C 4EZKA 4A3MG 4YWGG 5HY6A 1GNUA 2JK8A 4DR2L 1WJUA 4MGYE 3P63A 1TJEA 2D11A 3G6EA 1BDOA 1U0LA 3LXFA 3MJ5A 4NNJB 3DHGC 3W5OA 3AI5A 4A3MB 3HOVH 1F2RC 3Q8BA 2M1MA 4EUTA 4LF5Q 3DBRI 4HVBA 3B08A 3NVVA 1K28A 2OCEA 1YNXA 2A19A 2TSSA 2WX0A 4WAFA 1VQIA 1L0YB 2PNHA 1JALA 3BK1A 2V4LA 1FFUA 4WJOA 2B63G 3A0JA 1TIID 2E5LQ 1TY2A 2ON8A 1Q3LA 4PYUA 3KF8B 2JPHA 2Y5CA 3RNEC 2JSOA 4DR3L 1WD1A 3T1YQ 1H4RA 1Z9FA 3HZXA 2AX5A 3PZ7A 4LUVA 4IOAA 1E5WA 2FMMA 2JT4B 2DZKA 1UWVA 2IW3A 5E1FA 1HHVA 4ZRQA 1R4PB 1WYWB 1FD6A 4N6EB 1E24A 1CZPA 1IYUA 5CV8A 2F0SA 4OZAA 2PQAA 5M3MG 5BYQA 2ICEC 3MP9A 5M3FH 1EFWA 2EOTA 3PIP3 4GDKA 3KDFA 3TEHB 3ZXVA 4LMQD 4A6QA 3U52E 4JWUC 1YX5B 1KLVA 5I9OA 1AFPA 5J17A 3QWZB 4P71A 3FILA 5HFYA 4YCUA 4N9TA 1GUOA 3T1HL 3M3YH 3ETRA 4AS1A 4HROA 4DV5Q 4I6NB 4U68A 4LF9L 3DEOA 3L4PA 2V0GA 1E22A 2QSDA 3G4SA 2A69C 2JEAI 4PV1C 1ENAA 2F0DA 3IFDA 2J52A 3M9BA 3D6WA 2EE1A 1NSNS 2EDGA 3CPWA 1EY8A 4FXDA 2IY1B 3PIOA 2XRQD 2JWUA 4LDTD 2BA1A 1YJJA 1C78A 2HHHQ 1NVID 1U5KA 2AL6A 3DBRB 5EGTA 3NPPA 3QWNA 1WD0A 3IL8A 3I5JC 4OEMB 3RFZB 4N8X1 5KYIA 2K8CA 2E2HB 1C8CA 1T9HA 3I7FA 2VUMB 1JWAD 1GB4A 3VA5A 1SNPA 1X56A 1Q90A 2MJEA 3UF8A 1FCLA 5D2MB 3OWFA 2F0NA 4BBRB 2L52A 1XX8A 4LFCL 5FKAC 4WURA 3X0WA 3N9YC 4O42A 4AQ7A 4KZ0A 1JT8A 1ZE3D 5BO4B 1A3UA 2D3GA 1AEXA 2MLBA 5KHOA 1YVCA 2W82A 1IKLA 1ML0D 4K8IA 3CKIB 3E9IA 2NCNA 3NUCA 3PUYA 1LUZA 3I63C 4NJCA 5AJ3Q 1EIFA 4ACFA 5C23A 2NVYH 1C4QA 1MGSA 3JC66 4IUPA 2D3BA 3URYA 2JEBI 5M9OA 3EVQA 1F9SA 4QF4A 3PO3B 1A2UA 4DV5L 3K8AA 2OJWA 3ZXRA 4FADA 1NBWA 3MFYA 1TZOA 3T53B 2IHEA 1MJDA 2E74C 3E6ZX 4X3SA 2GBNA 3KOJA 2VH2A 2EMSA 3RNAC 3ULLA 4KZCA 1VQ4A 3NRZA 3SU8X 1JE4A 3CQZH 2ZCBA 1JICA 2XN9C 2JX5A 4APVA 2G3QB 3CP0A 2WB1B 4JI1Q 1A63A 4A55A 5KNDA 1PTOH 2L9HA 3AEFB 2IX0A 2F0PA 3K7AH 3TZUA 3PIPA 4GMVA 3DEPA 1XNQL 3TBLD 1EYDA 2WXOA 2MBBB 4TQUS 1Q46A 2K33A 3AFPA 5TR5A 1QOFA 1IYVA 4PS8A 1JMCA 3ZIMA 2UUBQ 1PH2A 1E6EB 3GTPH 3ONSA 3M7NA 2MA9B 4DXGA 2IPKD 3C1EA 3NQTA 1TWFB 4W9GA 4DDGD 4G7HC 1GVPA 1KDBA 1WRIA 2K5HA 4YSXB 3RUZA 4LFCQ 2UUCQ 1RDPD 3CAMA 2UXDQ 2Z6BA 2MP1A 1AWDA 3N3KB 1LO5D 1LT5D 1XYIA 1I3QH 1X32A 4P2CB 3RLFA 2CHZA 3SXHA 3HOZG 1I4XA 1NYQA 1J6QA 1SNOA 4HMIA 3EHVA 3GV3A 4LNFA 2CFMA 1MJCA 4CYEA 2E2JB 1EL0A 3NVYA 2LRWA 3HS0C 3HOXB 2EXZA 1N5WA 4P1BC 1FNUA 1OXXK 3QB3A 1FNWA 1V1PA 2B2VA 2A69D 3A54A 3K57A 1VQ9A 2WXJA 2NZHA 1LT3D 1HZBA 3NP8A 3JAML 3K5MA 2JUOA 3KUCB 4WJQA 2WDTB 2J0TD 3CCEA 2PIAA 1XMQQ 3KFUA 4KJOA 1HQMC 4JYAQ 1YNNC 4CJ0B 4IM2A 3K0YA 1XMOL 5EPJA 5JVG3 1M90C 1QF6A 1YJIA 3HKSA 1II3A 1BQQT 1OEYJ 2K7VA 1JRUA 2G9HD 2K52A 3K0XA 4X62Q 4CJ1B 4A3FG 3NTKA 2MHVA 3B9JA 1HUNA 2LY7A 1DGSA 4LLGM 1K53A 4RCOA 3KWLA 2KO3A 2I2YA 3CC2A 5DM73 4P73A 2H5XA 2K5NA 1I50B 2E8GA 1XNQQ 2FCSA 3BDOA 4N59A 3N32A 4P6VF 3F2BA 1O80A 1R4NB 4NB3A 1XLPA 1WGHA 2C5LC 4K7WA 1MSGA 2JN4A 2BS3B 1E0BA 2R7ZB 3NOBA 5ISRA 1H9MA 3E5SA 5KIXA 5C3EH 3I4OA 3VFKA 4IQZA 1PDXA 1VQMA 2E75C 4LF7L 5KGUA 3NUHB 4BVUC 4ALPA 1WGDA 3HOVB 5A2QL 3TBIB 4DA2A 1I5FA 3Q3MC 1BBXC 2DBYA 2BS2B 2LS01 2NBUA 1PZID 1PV4A 2J0MA 1GUNA 2PW9A 4OX9Q 3P1HA 2YTYA 3C0RB 1SNCA 4IDIA 4GOPA 1HZ6A 1XLOA 3PO2H 2N7JA 4OVVA 5L95C 1I50H 4ZKCB 2MX2A 3KBXA 1E8WA 3RNCC 2Z0DB 3EC8A 1JJGA 4DHJB 4HIOA 4KJNA 3TEZA 3VR9B 3IAS1 4UY8C 1XMQL 2IO0B 1BOSA 2XWBB 1IBKL 3KLWA 5IIFA 4H0LC 2GMIC 4XYOA 3AE3B 4QAYA 1L1OA 3OLMD 2QF7A 3LWEA 5JPMC 2NB0A 1LABA 3GE3C 5DPSA 4K7UA 1V49A 2L15A 4DUYQ 2EPBA 2JF5A 1OO9B 3E0JA 2NBVB 2XTIA 3I4MB 1JQYD 4PYZA 1FXAA 2F0GA 1N8RC 1J9OA 3CRLC 3CC7A 1PGAA 5CORA 4HAEA 4ZLTF 5EAYA 2DAJA 1FRRA 4IPGA 4C3JG 5J39A 1VJKA 1BCPF 1WIAA 1SMXA 1B50A 1WMHA 1DM0B 4NXMQ 4G4KA 4LF7Q 2NTTA 1HPCA 3QG1A 3J80c 3N6RA 3UE1A 5M5XH 3SHQA 1ZPSA 2JA6H 5LMUL 2F0LA 4GU2A 4BBSH 4KLKA 1KM7A 1PGBA 1IGDA 5BMIA 3NK9A 1XNRL 3KLSA 1ET6A 4OX9L 3M4YA 2JZZA 4HSVA 3RNGC 2BH2A 4DHZE 2AWOA 5H1SE 3J81L 2R7DA 3DBLI 1YHBA 1VQ5A 3VVWB 1G8ZD 2E2HH 1CK1A 4ABNA 3PMFA 3V6EB 1CA6A 1XWEA 4DDID 1SNDA 2DY8A 4KI0A 3S2HB 1JOQA 3CRKC 3NE5B 3D3RA 1TWHH 2R61A 2ZT9C 4II2B 4LNIA 3A33B 3L17A 1CUKA 3CPFA 1MBYA 2AUJD 2A4ZA 2GB1A 1VZ7A 1N9WA 2WU2B 1T5EA 1R4MB 4O2DA 1IBKQ 4LTUA 4LNOA 4IWOA 4MELA 3TP7A 1YJWA 4CBVA 4FF3A 2BKRB 4IOIE 3VH4B 4NY0A 2IGHA 3OWEB 4TMAB 1IW7D 3FKIH 4K6DA 4QL5A 4UP9A 5M3FB 3I4NG 4N8FA 2BWES 3QO2A 1TS5A 1RCVD 3P1MA 4FVMA 5EBCA 1FJGL 5E6NA 4DUYL 2QDFA 1Y1WG 2WHIA 1A70A 1S3OA 3M3YB 1PRTF 3BYYB 1HZCA 1EYAA 2JZPA 2JU6X 1LGRA 3JW0X 2SOBA 1HJPA 3DVNV 2CH4W 1NBFC 4EE2A 3GTKH 1V97A 3HKZB 4R4CA 4KHPQ 4PZ8A 4JV5L 1PH9A 3A8KE 2QMTA 2LUMA 2PE6B 5M5WH 1YN5A 3ZYYX 2DZJA 1H9KA 1S72A 5LMUQ 3UDIA 5COYA 1I6VC 2MW5A 1JJ2A 2J7QB 2Y5PA 2P5ZX 1AE3A 4KGSA 5J1ZA 3CXCA 1WGYA 3NELA 3D4RA 1JCKB 4K81A 1VF7A 4V190 3PRPB 3AE9B 3RMHA 2PCFB 3I55A 1WTRA 3Q22A 1VQFA 1WE6A 4MH0E 2JA5H 3RI7C 3NVWA 2CH4A 1GHKA 2BOSA 3VDYA 2KCCA 1AYFA 4TV3A 4ZUJA 4K5VA 3MTNB 2WXIA 2GBMA 4YY3Q 5C44H 1LTRD 3HOWB 4XQJA 3OTOL 2JA6B 2VZKB 2DHZA 3ZJTA 1GXDC 2R93G 1F2MA 1EEID 4CHTB 4JI4L 4PG3A 4JOIC 5IY0A 5BR8Q 4GGQA 4X6AH 4A3IH 3HOWG 2N0SB 3QHTA 2F3IA 1C76A 1SAPA 4XDXA 5JHBA 1O7ZA 3GZNI 1Z47A 2A6HC 2ICIA 1Q1EA 3W3AA 2A5HA 3T4AC 4JL9A 4A3DH 1AZQA 2SAKA 1TVXA 3GDEA 1LLRD 3AE5B 2BPSA 2KT7A 2WP8J 2B2UA 3PF5A 3RMKC 1HTQA 4F7XA 3TRZA 3X3MA 1ZYRD 3STBD 1EWIA 2C7MB 2WP9B 4KKIA 1KH0A 4HRSA 1WXAA 3J81j 3RYTA 1V8QA 3APDA 2QW7A 3S16B 4JI0L 3ITPA 3I2ZA 4HIDA 3ZTCA 4IO9A 1ET9A 4A3FH 1WJNA 1E1OA 4HCPB 1TWAH 1ZXTA 3S1QB 1P3QU 3I4NH 3FKIG 2LXJA 4H2AA 1PFDA 3W5VB 1NYRA 3KUDB 1FIQA 5IYDG 2NN6I 4JBWA 4LNQA 1C9OA 2B63B 1V5TA 3RPFC 1KF6B 2FCMA 3WCQA 2VNUD 4FO2A 3RNFC 3K5NA 1PRTD 4POFA 1V80A 1D5ZC 1HR0W 1HTLD 1EIHA 1UE6A 5BMGA 2SEBD 1PH8A 5GROA 5A35A 2KXJA 2I0QA 4DBGA 2FMCA 4WJWA 3S1NB 5DM63 1Q10A 2KQ3A 5EKKA 3RLNA 1VQ8A 3X3NA 1RL2A 3CIRB 2WAQE 4OHJA 4S3SA 3GB1A 2D9UA 2LASA 4JI4Q 5AFWA 2JZ3B 5CTRC 3MEFA 4B9WA 1Q8KA 1IXRA 2KWVB 3WAMA 4L5RC 3ZNHB 1PYBA 1UUPA 3CCSA 4A3KB 3PT2B 1G91A 4P72A 2IY0B 3ZKJC 4OO1I 2EVBA 2KHSA 1F77A 3AE8B 2KMAA 2M9VA 4AH6A 1W6KA 3I90A 2RA4A 2JY6A 3U30A 3P2BA 4W9FA 1IHZA 2FNJB 1HTPA 4JI3L 2BB5A 2K28A 1PLFA 3S1NH 2D0OA 2ZCCA 1SYEA 4CKEA 1QKZA 3CMMB 1NMFA 3HOYH 2K14A 1U4RA 3DUZA 5ELFA 2YVCA 2I46A 1I4RA 4ARIA 2L55A 4IFDH 1G291 5EBDA 4C00A 1HR0L 3SK4A 2JA6G 3ND8A 5CGKA 1F9QA 1PTOC 4O1NA 5IAAC 1FO4A 4IG7B 3NEMA 1I94Q 2ATWA 3UQBA 1PFNA 3LWUA 4NJ7A 2F0KA 2R3ZA 4R4IA 4IM3A 1O7LA 2VQFQ 3RZDB 2EYJA 4AJWA 3F2DA 4AIMA 4IWPA 5CR3A 4B3TQ 5JH5C 2YTVA 3D4DA 1E2ZA 4D2KA 5IWAL 1EQTA 4WJPA 3OMGA 3CW2C 2O5IC 5CV9A 1RHPA 5C4JB 1KAAA 4ZYSA 3CCMA 2LXKA 1DZ1A 3O65B 5J3BA 3TUOA 4MDKE 1GUTA 4KY7A 5DPRA 4KHVA 3DQVA 1JB7A 4QY7A 2AEHA 3H0GG 1LM0A 1NEKB 2KN4A 4A3EB 2PQAB 2KCNA 4DR2Q 1DOMA 1V5OA 1P98A 1EOTA 1IBML 2PNRC 1V81A 4OZBA 2K5QA 2IO3B 5D3IB 2JXTA 4JG2A 4ZRIA 3ONAB 1PH3A 3QR8A 4RKBA 4HDQA 1OTRB 2Y0SG 2QEJC 3I56A 1I6HH 2DYOA 2DZMA 3AECB 3IVFA 1NR2A 5I9PA 3KYDD 1RFAA 3DBLB 2KVZA 5DPTA 2I1KA 5CV7A 1KLUD 4KGTA 5DCNA 2FIFA 2VS1A 1OXSC 2UXCL 2AL3A 3RZOB 1NCVA 1U4AA 2KAJA 2E5LL 4GDLA 1H8CA 2OEDA 5D14A 1VQJA 2EY1A 3ZO5B 1I94L 3T1YL 2N1VA 2MQHA 3KF6B 3MC0B 4CDEC 2WXFA 3M62B 1Y8RC 3NVZA 4HPLB 3Q24A 1C7YA 2OQKA 2CJOA 1SR3A 2EYMA 4BY1H 4K5XA 4BBSB 1KL9A 2KX0A 4K1RB 5IYCG 3MXNB 5IP9H 2XGTA 4A3KG 4IN3A 2BE5C 3FRPB 3V96A 3L2PA 4DXFA 2WXPA 1JC7A 3BK2A 5AZFA 5HKHA 1F9JA 2DJFC 2JA9A 5CMDA 3DHHC 4HTHA 3CCRA 1WTXA 4DV6L 3U9SA 3QCAA 2ZJPA 3MEHA 2XSCA 1KC8C 3PRMB 3MTSA 4P16A 2UYZB 2ZW1A 2IHFA 1SSOA 4YHHQ 1M1KC 5AZGA 1QVCA 2NZ1D 4E6IA 2PJHA 4GDLB 5KNCA 1QCBD 1I4GA 4LF9Q 1JWSD 4A3JH 4DKAC 4DNTB 3A7AB 1A15A 3E3XA 3HUIA 3P42A 2VQEL 3TQYA 1SGHA 2PZWA 4HR7B 2XIWA 2CCZA 3P75A 5ELBA 1YMHE 1PRTC 2N8NA 1N33Q 1Z2MA 2F0MA 1VQAA 2KEDA 1OXTA 2H89B 2FE8A 3MXNA 3TP6A 1L1OC 2JQOA 1A62A 2M2LA 2J7ZA 3WAOA 1X3EA 2HD5B 2HHHL 1LTGD 4U673
chains in the Genus database with same CATH topology
2BB6A 1CHQD 3I70A 2V4IB 4OL7A 2N9KA 2H88B 3TP5A 4XWTA 2IT1A 2L32A 5H8YE 2FFKB 1I6HB 1WXQA 2F0TA 4HEDA 1B3AA 4RH6A 5C0XH 5K36H 2Q5WD 2PPBC 4MT5A 2INNE 2NYZD 4J1MA 1VMCA 2X38A 3H94A 2XVSA 1JMLA 1HXYD 2Y0SB 2G9DA 3AEEB 1KTKA 3OOCA 1JOOA 3UI2A 1EWCA 2ONQA 1VMPA 4KKJA 3C46A 5E4WC 2CW0C 3FMCA 1ACCA 3VR3A 2CJNA 1QNKA 5FK9C 4USAA 2PZUA 3SK6A 4MACA 4HJGE 2V3PA 2JYEA 4DF7A 1UWMA 1Z7TA 2Q8RE 3R2TA 3W1SA 3BDLA 3MWYW 4I7ZC 4XWWA 1I4QA 4WQMA 1Y8NB 4DQOC 4FXGC 1UGJA 3KLRA 1T6BX 3M7GA 3V05A 4OIKA 3QOJA 4EGVA 1T3QA 2PZTA 2IWHA 1E2VA 2K3UA 3VA7A 2OXPA 3ZJVA 1HFGA 1KRHA 2F3VA 2NVXB 4JE3B 4IFDG 2D2CC 1L4ZB 3FILB 3SFEB 5ELEA 1QOBA 2OF1A 1NUCA 2EZVA 1OQQA 5EE1A 2QILA 4N58A 1Y69U 2E3TA 4MN3A 5A2QE 5TSSA 1R7SA 1ZUD2 3OW7A 1WTQA 4R9WA 5I6YA 5JPNC 2J4XA 2K05A 2SDFA 3L9AX 3CWIA 5C3EB 2OEOA 2KEEA 4C2MB 3SR1A 1LTBD 4QCLA 4A3JB 1FGBD 3I4NB 2QJLA 1E10A 1FCCC 1GUGA 2NVYB 1ZDXA 4NAMA 1QWYA 5IGEA 2EYHA 1TKYA 1SDFA 2B8FA 1OXUA 3NTHA 4C3IB 4WFN3 1EY9A 2O4XA 1S5BD 4DGZA 3VR6A 3P4PB 2EYFA 3R2IA 3HOUB 1STYA 4BY1B 1ROEA 2B76B 3DWPA 1Z6HA 2WXHA 3EGRA 3VR2A 4ZOHC 2NUCA 1FM0D 4KHZA 2WS3B 4HEA1 2HDMA 2R93B 1SYFA 5BYSA 4WWMA 5JOBA 4OZCA 1UAPA 3GTOB 4DAVA 3AN1A 5ELCA 1DOLA 2W3SA 5EE0A 5F2DA 3TDQA 3WOFA 3NWSA 1GUSA 4KTAA 3HVZA 2F0FA 1OQRA 3Q8CA 2C9OA 3TSSA 5KYLA 3Q8AA 4G7OC 1YNND 2MJDA 3VRBB 4Q5VA 1S5DD 2BDOA 3A7LA 4RGTA 1TT2A 2F0VA 1VLBA 3FKIB 5G3LD 3IKJA 4Q2JA 2K0PA 3R3OA 4LK0M 1DCZA 2CVRA 3MHZA 4ITKA 2CQAA 3AEAB 1ZKOA 2K5WA 1KFYB 1EZ8A 4RNAA 1LT6D 4IUNA 3IT4B 1P7FA 4ULLA 3AMUA 1RF2D 1STHA 3MFGA 1C79A 5C44B 2B2TA 4ZK9B 4RHSA 3NHHA 1KNEA 1YNTE 2WXGA 2LHDA 2AQ3B 2JA5B 1RKNA 2X6GA 1AP0A 4V0BA 1EWYC 1TWAB 2NBFA 3DWQA 3SR6A 1XCQL 5C6AA 4HCEA 1CQVA 3R93A 2HQEA 4WORA 1XF5L 4ILWA 5BN4A 5IT9L 2K9XA 3I73A 4C3JB 2NVQB 1ESFA 1B44D 5M5YB 5EQ0A 2B2YA 2QKIC 1G6ZA 3AE1B 2F0EA 5E4XA 1AZPA 1W6JA 4ME5A 5LL6S 2L1BA 4BY7B 1JORA 2DLBA 5EE9A 4B0MA 4KMUC 1MSHA 2KUMA 5HG2A 1VF5C 1CQFA 2EJFC 3AB5A 4EVOA 2SNMA 1N63A 2YEPF 1C4PA 3PUWA 5BYRA 3PUZA 3H8HA 5AUIA 1L4DB 2BA0A 4MM3B 1BCPB 4CQNA 1P7EA 1SE4A 2WACA 3J7YW 1B9NA 3VR5A 3EUB2 1VZ6A 2LFNA 1GPXA 1EU4A 5JAVA 2RSNA 2WDQB 1WGKA 3P4SB 2E2DC 5C3XA 1A3VA 1SF0A 4L1BA 4DAPA 4C7YA 1YN4A 4PQXA 2KA7A 2RDHA 4OO1H 1TS2A 1CM9A 3T51B 3VR8B 4M1UB 1Q8IA 4RGMA 1J7AA 4KD3A 3OIQA 3S9WA 2FUG1 1EY5A 4EQNA 2E2IB 4US9A 1MI2A 2IL8A 2LMCA 2W3RA 1D1KA 4RCNA 1U4MA 2CU3A 3K5OA 1MI0A 2PVGC 4BWGB 3I72A 1KDAA 2CW0D 2WU5B 3I8ZA 3W2DA 1NI3A 2DWQA 2RDGA 1L5PA 3AB9A 3HRZC 3A8IE 1K50A 4NKLA 3SVMA 5JJZA 1VRAB 2RDFA 4M8AA 4TQ1A 1RTNA 3J9CA 3Q0AA 1QILA 1YQ3B 1RD9D 3MZ5A 1STBA 3QOLA 2VXWA 3S2DB 3VQIA 3PIO3 2MJ3A 4IKGA 5C3WA 3BVZA 2L0CA 4J6HA 1OXVA 1WYGA 5HURA 2PLPA 2WKCA 2NVTB 5EKIA 3G6JB 5CC4A 3BIID 4QUFA 1SNMA 4TQ0A 1WTVA 2D62A 1C77A 2QIEB 1BR9A 5EPLA 1FXIA 1TWCB 2SNSA 5HGTA 3AV8A 4ZUIA 4YTPB 2JYTA 5I2YA 1SJHD 3KF8A 4ZHPA 2K01A 1EQVA 1HEZE 3AM9A 4GZYC 3DHQA 2B2UC 3FEWX 1CTMA 1HRJA 2WQYB 1KLGD 4NMZA 2ZW0A 2EY2A 4LK1C 1YQ4B 4K2KA 2AUKA 4YTMB 2B2YC 2Z4IA 5KEEA 4XQNA 2L1AA 1F2YA 2RPVA 2DN8A 3GV6A 3FILA 4YWGG 2RQXA 3KBGA 1VDVA 5JEAJ 3AE6B 4XDDA 1C9FA 2F03A 1SMYD 3IFTA 2RVLA 1FR3A 1RODA 1XO3A 1B9MA 5CBEE 3GTGB 2GA4B 4RGOS 2AQ2B 1N60A 2N55A 5D3DA 3CQZB 1BUVT 1TKGA 4BA1I 3J7AF 1Y8PB 3P7JA 4YTNB 1JB3A 1PFBA 1GHJA 4PMBA 1SE2A 3LX0A 3AE4B 4G7ZC 3D31A 1RTOA 5EE3A 1XLQA 2K04A 2MEKA 2WXMA 2XNAC 4CKCA 4FF1A 2EY5A 3I4LA 1LACA 2FHTA 2R92B 2QDBA 1K8OA 1FFVA 1IL8A 5CYUA 1MD2D 1O78A 4RWSC 2F0HA 4IURA 4FF4A 4F87A 5K36G 5BN3A 4KN7C 2M19A 4ZQ3A 5BMHA 2PTLA 3GS2A 2Z8LA 4C7ZA 1YNJD 1V43A 2KDMA 3J7AV 1VDZA 1SYDA 1DD2A 2K5DA 1E7PB 2FINB 1TS4A 5I4DA 4KX6B 1ZYRC 1I3QB 1MHHE 2RSOA 3NTIA 3HG9A 4DK0A 2KECA 2X69A 1PUTA 1U9RA 3TMEA 4ZKBB 2HDEA 4AYBB 3I3CA 2DYMA 1STEA 2INPE 1F0ZA 3BVMA 3EFXD 2NMQA 1ZXHA 2PW5A 1H9JA 1CT1D 1JROA 5NUCA 5C0XJ 2IJ0A 4K14A 2F0OA 2O5JC 3HRDD 1EY4A 2WXRA 1L0VB 2B2TC 4ZAIA 5E6JA 3VYUA 1SNQA 4DU9A 3SEBA 4LAAA 1PXUA 4KY6A 4CKBA 4NAWB 3AMZA 3R8BA 4X3UA 3AE7B 1DONA 3FDTA 3T3OA 3HEJA 2IGDA 2BCOA 2RBMA 2N9LA 4C80A 2M0AA 3IAM1 1K83B 3PUXA 1GB1A 4QB4A 4RF0A 3BYTB 3SDZA 1C4CA 1CHPD 2WIIB 5T1IA 5FLXE 4OW0A 1WSPA 3I57A 1PMRA 2O2LD 4JX1C 2VB2X 2JYOA 3J81E 5FLXL 3UI3A 1FYCA 1DYQA 1SXTA 3DXJC 5C5LA 3C3LA 2F4IA 3Q6SA 4XXEA 4KY5A 3U4EG 2PQEA 1SB3C 2MUYA 2WAQB 1NENB 3BZDB 1IKMA 1U4PA 1STNA 1AW7A 3D8GA 3H6MA 1QLBB 5FO7B 1H9RA 3MXPA 1N5XA 1M4VA 2EYPA 1R9TB 2Z4HA 3N52A 3FVQA 4XT1B 5J22A 4KV6A 4C3IG 2J53A 1WTWA 4C56C 4OZAA 2M56B 4DNRB 2KOLA 5HHDG 1FNVA 2B2WA 1OFFA 2H4OA 2HTME 1QB5D 2JXMB 1TYGB 1RJTA 2WLBA 5DEHA 2HUGA 1QE6A 2WXNA 1MVKA 2NN6G 1JOKA 2K22A 2AWNA 2K1BA 2WV6D 1EZ6A 2BE5D 5HI1A 2KJXA 2WXKA 1ENFA 3ND9A 1IBXB 4FXKC 5CV4A 3MAQA 3J80L 3EJIA 1SYBA 1DOXA 4WRDA 3T56B 3K58A 1HZ5A 3AEGB 1SMYC 1SYCA 3P4QB 1R4QB 1FRDA 1RYJA 1FD7D 1LTSD 1CZWA 4KKSA 1SFOB 1WTPA 1J8IA 1GOZA 1WTOA 1EEFD 1BXTA 3CU7A 2W55A 1Y1WB 1ICWA 1UNSA 3NWTA 5C0XG 2XWJB 4A90A 5MPOA 3K5LA 1CFMA 2L12A 2J42A 3PZ8A 1V1PB 5C0XI 4JK1C 5D65A 2LHEA 1S5CD 1ZOYB 4K2LA 1PZJD 5IGGA 3JAME 2A6ED 2A73B 1EY0A 4REZA 4J8QA 3Q8EA 2I38A 4RFBA 3GTPB 2BTEA 1TWHB 5G3LF 2WDRB 1KNAA 1F9PA 4ZHOA 4MIUA 5DNFA 3DWGC 1JR0D 1PGXA 3U2SC 1PRTB 2PYKA 2C5CA 3GP7A 2TMPA 5C4HA 4H7BA 1IUEA 2EY6A 2HDLA 1D5MC 3Q69A 3TZDA 1LV9A 1I7HA 3U9OA 1F2ZA 4FP5D 2EYLA 3ZGZA 3HP3A 1JWUD 3M85A 4A8XC 2WXQA 4A3IB 1HCZA 5C2TB 4C1NK 4YT0B 1E9MA 3TEWA 2CHBD 1QNUA 2OT2A 2PKOA 2HCIA 4KKUA 5E3FA 1G2TA 1QT9A 1STAA 1BCPC 3GQBA 3TEYA 3EROA 2F0JA 1RWSA 1EFID 3S1RB 4DFAA 2WINB 3A56A 1FMAD 1KDCA 3BDCA 4MHEA 2JA7B 4QMGA 5CBAE 2WXLA 3BVGA 5IGDA 4I65A 1TKWB 3SK8A 2V4DA 2I07B 5KRUA 4M0WA 3H3VC 3K59A 5C3JB 4A3DB 1L0XB 3HGBA 1A6XA 3T16A 3KK7A 1WVLA 3J80E 1S4ZA 1T5XD 1NR4A 5JXVA 2A68D 5K5PA 1CZGA 3LB8C 2PMZB 4RHRA 5EJWA 3ZJUA 4TSSA 4A9AA 1UEAB 1N62A 3K6OA 3VR4A 1VR9A 4H44C 1ONLA 1Y56A 4C3HG 5D7GA 1EY7A 1SSNA 2DNCA 1BMLC 4KN4C 1ZP0B 1K51A 1SEBD 4IFDI 4C3HB 2BT6A 5C4XB 2LMCB 1GAQB 1I4PA 4ZRZA 2JSVX 1STGA 1CJEA 1TQOA 4Q0FA 5I6WA 3EQLC 5EPKA 1BUIC 5M5XB 4R8IA 3T3NA 4RF1A 4WIPA 5IOCA 1A3TA 3W9CB 4L6TB 2K32A 2BYTA 5JVH3 5IGCA 3DM1A 1LTAD 3C8YA 3DWAA 3B2FA 3IAYA 5ELDA 1WCMB 3H0GB 3PO2B 1BCPD 1CI3M 1DOIA 2ACZB 1D4BA 2IX3A 1BF4A 3OPOA 3NZ3A 4F8MA 5FR3A 2DNEA 1ILQA 5M3MB 1F2RI 4K8JA 1SYGA 4XE0A 1PZKD 2MGSA 2EJGC 1XCTL 3SFDB 3GTLB 1VZ8A 2M00A 3U7ZA 4IZ8A 4J3OD 1JQ4A 3FPUB 3PV0A 3A8JE 4DK1A 3D6CA 2IGGA 2WDVB 4NW2A 3VYRA 1DGJA 2KVMA 3HOZB 2WNMA 1B4OA 4L23A 2A68C 4KGRA 4EQPA 5M5WB 4RAUC 1ZXIA 1DXMA 1HQRD 1GUWA 2L5TA 3QIAA 3LNNA 1QJOA 4K6LA 4OVZA 4TRDA 3GTQB 2DY7A 2ZXOA 4BS9A 2LFIA 3FC4A 3SK5A 3WOEA 5LL6X 4A93B 4ARCA 3MVVA 3W5UB 4IALA 1QOHA 5JEAH 1XEEA 2LGIA 1LTID 1AN8A 4L2YA 2FJ2A 1E0ZA 1H9SB 2MJ8A 3K7AB 2K6AA 4B9XA 3ABVB 1XXGA 2L83A 4A3BB 1PTOB 3MXUA 4NP5A 1GJXA 1K8MA 2A74C 4MH8A 2L4NA 4X3KA 4X3TA 4HKQA 2E76C 5IGFA 4Z9CB 1S5FD 3KWVA 1SIJA 1EM7A 2JP1A 1CA5A 3P20A 3OMCA 4DAYA 4R3DA 3Q23A 4ODGA 1HFNA 2LJIA 4LJZC 1WWTA 3E9SA 3I9V1 2A6HD 3M4OB 2GI9A 1QOAA 1PTOF 4IUQA 3IT6B 4K5WA 4C1NI 4OO1G 1F9RA 1Y8OB 4US8A 2B2WC 3I91A 4RA8A 1JWMD 2W54A 3NSWA 4PNYA 5JEAG 4ID6A 5LHY1 2GRIA 1YN3A 3B2GA 2JA8B 2JQRB 4PT5A 5I2XA 5EKLA 1D5XC 3O13A 2BDNA 3QJYA 1IBXA 4IFDJ 3A55A 3S1MB 4XIGS 3V3XA 1TWGB 2H1EA 3KQ4A 1TY0A 2A6EC 1XTCD 3MA2B 1I4HA 2JE6I 2QCPX 1BNZA 1KABA 2KWDA 5FOBB 2F0UA 5T1GA 4XQQA 1V1OA 4A3FB 1O7YA 1UWXA 1Q12A 1LTGD 1JW9D 5AUKA 4TKOB 3AE2B 3IXSA 2Z1CA 3CHBD 5G5GA 4F88A 3BS1A 3C2PA 1Q1BA 3AH7A 5H92C 3V2TA 4JPSA 4XYQA 3KLSX 4JWSC 4G57A 3SE0A 1VCIA 1DJRD 2HCCA 2NWGA 4ZRPA 3GD7A 4UDUC 4L8JA 1PFMA 4Y7NB 3D4WA 3NBIA 4BA2I 3GO5A 1S5ED 4KKTA 4HKZE 3PUVA 4R8NA 1HUMA 4UAIA 3TEXA 2D5GA 2F0WA 1ZDVA 3AU7A 2EYOA 3LYYA 1X3QA 2AQ1B 4HSPA 2F0QA 3GTJB 2PVOD 2B8GA 2F0IA 1D2BA 1B1ZA 4QUCA 4B0EA 2Q8TA 5CV5A 5CV6A 2IX1A 1RM6C 1F2LA 2ZXPA 3F2UA 3TP8A 2LEKA 2IDYA 2BW2A 3T13A 1U4LA 2YU9B 4YIJA 3NBHA 3DMUA 2X6LA 3ZQ4A 2YEPB 1PTOD 2G1EA 3GTMB 4IUUA 1PYWD 3ERQA 2F1MA 3SHLA 1L6VA 4HCSA 2XRSD 2L11A 2OHFA 5C5MA 4XT3B 1QG7A 1MHXA 2K5PA 1EY6A 4YXDB 3H09A 4PMCA 4NZLB 1J7CA 1EWHA 1NAPA 4YSZB 2BBCA 1TKEA 5LNK1 1PDQA 2V3NA 1SBBB 3H91A 1JRPA 1C4AA 1E2WA 3E56A 4DN4M 2Q8IB 2EJMA 4IUTA 4NDXA 1B9RA 5GXGB 2PMVA 3OSOA 3NS1A 2F3WA 1N61A 3NQIA 3S15B 1RFKA 1D6EC 1EIGA 2YYZA 1ILPA 2MPMA 3VYTA 3MHBA 3S17B 4FXCA 2LKVA 1JWBD 1MPEA 1D1IA 1EU3A 1YNJC 5DAUA 5BN5A 2WKDA 2ENBA 3GTKB 3FPPA 4FF2A 1FEHA 4A3GB 3TN2A 5FO8B 5IODA 2VZKD 2ZXRA 4YSYB 1ESRA 1HA5A 2Y3AA 4PMWA 4CGYB 5IGBA 1J7BA 2KACA 1A2TA 1B53A 4IUVA 4QIWB 3L7ZC 4B08A 2BS4B 2EELA 3NXWA 4GDKB 3OIPA 3KUPA 3VRAB 1G2SA 4EQOA 1IGCA 2FBWB 3C1FA 1BO0A 2RKSA 3WDNA 3EA6A 1H9SA 4XDCA 1ZEQX 3HVDA 1L6UA 3G7LA 1TS3A 2PW7A 3AEBB 1TU2B 5IT9E 3OHXC 2RMMA 1ENCA 1B2TA 4GLSC 2R6GA 2ID0A 3DWMA 1EYCA 1QQRA 4CJ2C 1V8CA 2PO4A 3FAHA 4WH4A 3BG3A 2K03A 1HA6A 4OIJA 1QOGA 4RGNA 4KD4A 2KMMA 4RKLA 1Y1VB 2VB3X 4L63B 1LTTD 5KNBA 1M8AA 3L3OC 3Q8FA 1DOKA 2EKIA 2KQ4X 4N9PA 3BWUD 1SJED 1TR5A 3MXGA 4FYDA 4HMJA 2B2VC 2E6XA 5FO9B 3S14B 1DOYA 4HN7A 3RD4A 4XTCS 4FNFA 4KK7A 1LT4D 1K52A 3HOYB 1IW7C 2NTSA 2B39A 2D5DA 3PO0A 3P4RB 2N88A 1XLNA 2NN6H 1C48A 1X3PA 2MH7A 1SE3A 4OGQC 3VYSA 4H13C 3P63A 1TJEA 1BDOA 3MJ5A 3LXFA 4A3MB 1F2RC 3Q8BA 3NVVA 2TSSA 4WAFA 1L0YB 1JALA 3BK1A 1FFUA 1TIID 1TY2A 2ON8A 1Q3LA 2Y5CA 2JSOA 1WD1A 3HZXA 2AX5A 3PZ7A 2FMMA 2IW3A 5E1FA 1HHVA 4ZRQA 1R4PB 1FD6A 1CZPA 1IYUA 5CV8A 2F0SA 5BYQA 2ICEC 3MP9A 2EOTA 3PIP3 4A6QA 4LMQD 3U52E 4JWUC 5I9OA 1AFPA 5HFYA 4N9TA 1GUOA 4AS1A 3ETRA 4HROA 4U68A 3DEOA 3L4PA 2V0GA 2QSDA 2A69C 2JEAI 4PV1C 1ENAA 2F0DA 3IFDA 2J52A 3D6WA 2EE1A 1NSNS 2EDGA 4FXDA 1EY8A 2XRQD 2JWUA 2BA1A 1YJJA 1C78A 1NVID 5EGTA 3NPPA 3QWNA 1WD0A 3IL8A 3RFZB 5KYIA 2E2HB 1C8CA 2VUMB 1JWAD 1GB4A 3VA5A 1SNPA 1Q90A 2MJEA 1FCLA 3OWFA 2F0NA 4BBRB 2L52A 1XX8A 5FKAC 4WURA 3N9YC 4O42A 4AQ7A 1ZE3D 1A3UA 1AEXA 2W82A 1IKLA 1ML0D 4K8IA 3CKIB 3NUCA 3PUYA 4NJCA 1C4QA 1MGSA 4IUPA 3URYA 2JEBI 5M9OA 3EVQA 1F9SA 4QF4A 3PO3B 1A2UA 3MFYA 1TZOA 3T53B 4N6EB 5T8IA 2E74C 3E6ZX 4X3SA 3NRZA 1JE4A 1JICA 2XN9C 2JX5A 2WB1B 4A55A 5KNDA 1PTOH 2L9HA 3AEFB 2IX0A 2F0PA 3TZUA 3DEPA 1EYDA 2WXOA 4TQUS 2K33A 1QOFA 1IYVA 1E6EB 3M7NA 4DXGA 2IPKD 3C1EA 3NQTA 1TWFB 4YSXB 4G7HC 1WRIA 1KDBA 3RUZA 1RDPD 2MP1A 1AWDA 1LO5D 1LT5D 1XYIA 1X32A 4P2CB 3RLFA 3SXHA 1NYQA 1I4XA 1SNOA 4HMIA 3GV3A 2E2JB 1EL0A 3NVYA 3HS0C 3HOXB 2EXZA 1N5WA 1FNUA 1OXXK 3QB3A 1FNWA 1V1PA 2B2VA 2A69D 3A54A 3K57A 2WXJA 1LT3D 3NP8A 3JAML 3K5MA 2J0TD 2PIAA 4KJOA 1HQMC 1YNNC 4CJ0B 3K0YA 5EPJA 5JVG3 1QF6A 1YJIA 1BQQT 1II3A 2K7VA 2G9HD 3B9JA 4CJ1B 3NTKA 2MHVA 1HUNA 2LY7A 4LLGM 1K53A 4RCOA 3KWLA 2I2YA 5DM73 1I50B 4N59A 3BDOA 4P6VF 1O80A 1XLPA 1MSGA 2BS3B 1E0BA 2R7ZB 5ISRA 1H9MA 3E5SA 5KIXA 4IQZA 1PDXA 2E75C 3NUHB 5KGUA 3HOVB 5A2QL 3TBIB 4DA2A 1BBXC 2DBYA 2BS2B 2LS01 1PZID 1GUNA 2PW9A 3P1HA 1SNCA 4IDIA 1HZ6A 2N7JA 1XLOA 4ZKCB 3KBXA 4KJNA 3TEZA 3VR9B 3IAS1 1BOSA 2XWBB 5IIFA 4H0LC 4XYOA 3AE3B 2QF7A 3LWEA 5JPMC 2NB0A 1LABA 2EPBA 1OO9B 3E0JA 3I4MB 1JQYD 1FXAA 2F0GA 1J9OA 3CRLC 1PGAA 5CORA 4HAEA 4ZLTF 1FRRA 4C3JG 5J39A 1VJKA 1BCPF 1B50A 1DM0B 4G4KA 2NTTA 1HPCA 3QG1A 3N6RA 1ZPSA 2F0LA 1PGBA 1IGDA 5BMIA 3NK9A 3KLSA 1ET6A 3M4YA 4HSVA 2AWOA 3J81L 1G8ZD 1CK1A 4ABNA 3PMFA 1CA6A 1XWEA 1SNDA 2DY8A 4KI0A 3S2HB 1JOQA 3CRKC 3D3RA 3NE5B 2R61A 2ZT9C 5G5HA 1MBYA 2AUJD 2GB1A 1VZ7A 2WU2B 1T5EA 4LTUA 3TP7A 4CBVA 4FF3A 4IOIE 2IGHA 3OWEB 4TMAB 1IW7D 4K6DA 5M3FB 3QO2A 1TS5A 1RCVD 3P1MA 4FVMA 5EBCA 1A70A 3M3YB 1PRTF 3BYYB 2JZPA 1EYAA 2JU6X 2SOBA 1V97A 3HKZB 3A8KE 2QMTA 2LUMA 1YN5A 3ZYYX 1H9KA 5COYA 1I6VC 4KGSA 2Y5PA 5J1ZA 3D4RA 1JCKB 1VF7A 4V190 3AE9B 3RMHA 2PCFB 1WTRA 3Q22A 3NVWA 1GHKA 2BOSA 2KCCA 1AYFA 4ZUJA 4K5VA 2WXIA 1LTRD 3HOWB 4XQJA 2JA6B 2VZKB 3ZJTA 1GXDC 1F2MA 1EEID 4CHTB 2N0SB 1C76A 1SAPA 4XDXA 1O7ZA 1Z47A 2A6HC 2ICIA 1Q1EA 3W3AA 2A5HA 3T4AC 2SAKA 1AZQA 1TVXA 1LLRD 3AE5B 2WP8J 2B2UA 4F7XA 3X3MA 1ZYRD 2WP9B 4KKIA 1KH0A 4HRSA 1V8QA 3S16B 3ITPA 1ET9A 1ZXTA 3S1QB 3W5VB 4H2AA 1PFDA 1NYRA 1FIQA 2B63B 2NN6I 4JBWA 3WCQA 3RPFC 1KF6B 2VNUD 4FO2A 3K5NA 1PRTD 1D5ZC 1HTLD 1EIHA 5BMGA 2SEBD 5A35A 2FMCA 4WJWA 3S1NB 5DM63 1Q10A 2KQ3A 5EKKA 3X3NA 3CIRB 4S3SA 4OHJA 3GB1A 2D9UA 5AFWA 4B9WA 1UUPA 4A3KB 1G91A 4OO1I 2EVBA 2KHSA 1F77A 3AE8B 2M9VA 1W6KA 3I90A 2RA4A 1IHZA 1HTPA 2BB5A 2K28A 1PLFA 1SYEA 4CKEA 1QKZA 1U4RA 3DUZA 5ELFA 2I46A 1I4RA 4ARIA 2L55A 4IFDH 1G291 5EBDA 3SK4A 3ND8A 5CGKA 1F9QA 1PTOC 4O1NA 1FO4A 1PFNA 3LWUA 2F0KA 2R3ZA 1O7LA 3RZDB 2EYJA 5CR3A 3D4DA 1E2ZA 4D2KA 1EQTA 3OMGA 2O5IC 5CV9A 1RHPA 5C4JB 1KAAA 4ZYSA 1DZ1A 3TUOA 1GUTA 4KY7A 4KHVA 1NEKB 2KN4A 4A3EB 2KCNA 1DOMA 1EOTA 4OZBA 2PNRC 2K5QA 5D3IB 2JXTA 3ONAB 4RKBA 2QEJC 3AECB 2DYOA 1NR2A 5I9PA 5CV7A 1KLUD 4KGTA 1OXSC