2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1TY0A 3MFGA 1TS5A 5FKAC 1SJHD 3BYTB 1BCPB 1LT3D 1EEFD 1BXTA 2QEJC 1CHQD 4C56C 4K6LA 1ESFA 1FD7D 1LTID 1SBBB 3R8BA 1PZID 1FNVA 4RFBA 1MD2D 1HA5A 2IPKD 1PRTC 1L0YB 1V1OA 2TSSA 1EWCA 3BVZA 3DWPA 2XRSD 1I4PA 2CHBD 1ET9A 1I4RA 1SXTA 1F77A 1RDPD 2R61A 1AN8A 3BVGA 1S5FD 1KLUD 1XXGA 5ELBA 1SE2A 2RDGA 1YN5A 1PRTF 1JQYD 2XRQD 1PTOB 1CK1A 4DXGA 5TSSA 1S5CD 1D5ZC 1PZJD 1TS2A 4RHRA 1UUPA 1LT4D 1S5BD 3BYYB 1JWUD 3SEBA 1UNSA 1DJRD 1M4VA 4L63B 1I4XA 2Z8LA 5FK9C 4O1NA 1EU4A 1BCPC 4Z9CB 4RHSA 1QILA 3R2TA 1T5XD 1PTOC 1I4HA 2XNAC 1HXYD 1PYWD 2ICIA 2QILA 1FNWA 1S5DD 4OHJA 1JR0D 1YN3A 1LTSD 1HQRD 1LTTD 1EFID 1I4GA 2RDHA 1TS4A 3CHBD 1PZKD 4RH6A 3MC0B 4RGNA 1LTBD 1SJED 1CHPD 1JWMD 3OWEB 1LT6D 3KLSX 3DWQA 1KLGD 1DYQA 1CT1D 3R2IA 1CQVA 1EU3A 4RGMA 1EEID 1S5ED 1D5XC 2NTTA 2NTSA 1LTRD 1L0XB 1SEBD 1YN4A 3W2DA 2SEBD 1RF2D 1PTOF 5ELCA 1GOZA 1PRTB 3EFXD 2G9HD 3TSSA 1V1PB 4RGTA 1BCPD 4RGOS 1ENFA 4NZLB 3DWAA 1B1ZA 1ET6A 5D3IB 1SE3A 1V1PA 1XTCD 2J4XA 1G8ZD 2AQ3B 1JWSD 1LLRD 3URYA 4BWGB 1KTKA 5D3DA 1LO5D 2AQ2B 1JCKB 1D5MC 3GP7A 5ELFA 1TY2A 2O2LD 1PTOH 4UDUC 2IJ0A 4TSSA 5ELDA 1BCPF 4ZYSA 1STEA 1SE4A 1D6EC 1FGBD 1LTGD 3BZDB 3EA6A 2WV6D 1FNUA 1LTAD 3O13A 4DXFA 1PRTD 1PTOD 1LT5D 5I4DA 1RCVD 3V05A 1I4QA 4RCOA 5ELEA 1RD9D 3BVMA 4L6TB 2XN9C 1AW7A 1B44D 1HTLD 2AQ1B 1TS3A
chains in the Genus database with same CATH superfamily
1SRUA 3PCOB 2NYZD 1WRDB 4KY5A 5L83A 1K83B 1SYGA 4LF6L 3H3VH 3AU5A 3IRBA 1HFNA 2K04A 3HKZG 5JXVA 1NE3A 4EQNA 2CS4A 2WU5B 4A3MB 2MX2A 2KD0A 4ILWA 4DR2L 1E5WA 1WZ0A 3ZDMC 2KHSA 3CQZB 3PUWA 1I4PA 1ET9A 4B0EA 1AN8A 1QNKA 2BOSA 4JI4Q 2D11A 4P16A 4DK5A 3AE5B 1U4RA 2RDGA 4I7AA 1L2NA 4A3GB 1STBA 5IP9H 1SIFA 1UZXB 1Y1VH 2LEKA 4JI1L 2QDFA 4WAAA 2O2VA 2V1CC 4QJFA 4JLCA 4TQ1A 3JC66 1WE7A 1L6UA 1WY8A 4NW2A 1A8VA 3BJUA 3QOJA 3Q23A 4J6IA 3MJWA 1I35A 4LNQA 2NB0A 4A3EG 4QAYA 1WFQA 3DBRB 5DPRA 4C00A 4MN3A 2DAFA 4JWUC 4XDCA 5CV9A 5FLXc 3HOXG 4GNXB 2CQOA 1ICFB 4C4VB 1PYWD 1E22A 1YIJA 2MPMA 1GHKA 1V8QA 5GXGB 2ZXRA 4H0LC 2NBUA 2WU2B 2PPBC 2AUKA 3C8YA 4DV0L 4RF1A 2SAKA 3AFQA 3NVYA 1TS4A 3KUDB 2DYMA 1CQFA 2C35B 3QG1A 2QA4A 1L0VB 5HGQA 4MGYE 2JYOA 2BH2A 3ITPA 2AX5A 1E6EB 1UD7A 4Y52H 2JA5B 2EYFA 1CZPA 2SNMA 4ZHOA 4IKGA 2RDFA 1VF7A 1G51A 5JHAA 4J8QA 2GA4B 4DR1Q 4MH8A 2MH7A 4GKJL 5HGTA 1VQJA 1S3SG 3ZVVA 2M8SA 3HUIA 1EYAA 1I94Q 5IODA 2B8GA 1L6VA 3D6WA 2JZPA 5AUIA 1SDFA 2RF4A 4A3KB 3SXHA 2WX1A 3PS6A 3PF5A 1N62A 4DV1Q 3UI2A 4C3JB 2EXZA 2Z1CA 3CW2C 3Q8DA 2VZKD 1IHZA 4W9CA 2BA0A 1ET6A 1HPCA 1N5XA 4PS3A 4RG1A 4DR5L 3VRAB 3DBLI 5IYBG 4AYBE 2NZ1D 1XTCD 1A3UA 3C3LA 4BWGB 4L23A 1OFFA 3CCMA 2NVXB 1J6QA 5CHWA 3PIO3 1Q5WB 2KVRA 4Y7NB 3I4MH 3I8ZA 4P7IA 2ONQA 3CWIA 1PTOH 4JI6L 4OWWB 1F2RI 4LF9Q 4ZYSA 2DBYA 3WALA 2IY0B 5JVH3 1FEHA 4ZRZA 3O13A 4A3IB 1C0AA 2J0TD 2WINB 2W3SA 1JJ2A 3RR5A 3PZDA 5IGBA 2SOBA 2E2IB 4DV6Q 3NTIA 3OYYA 3GTKB 2RCFA 3BVMA 4DR7Q 5FR3A 3RNUA 5AZFA 1QKZA 1L0WA 3GZNB 1KABA 4OONA 2H89B 2R2OA 2B2YC 1HUMA 4RMAA 3VQIA 1CA6A 3GTPB 1TT5B 5LXHA 5CBAE 3F2BA 1TKWB 2RHQB 3K5NA 1C79A 3RD2A 2BF8B 2F0KA 1Q0WB 2IYDB 3J7AV 2Z6BA 1X3FA 4PMCA 2HHHQ 2FCQA 2O5JC 2ZVOA 2TSSA 1VQFA 3NSWA 3W1BA 1F9PA 3NVWA 3H6MA 5EPKA 1GUWA 3PZ8A 4R4OA 5J17A 3AEFB 4L5TA 3BVGA 2MLBA 1AE2A 1EQVA 1FYCA 1KAWA 3NK9A 1N60A 5EBDA 3T13A 3TREA 3N6RA 3WAMA 5KYIA 3AE1B 3CMMB 4IC7B 3AYHB 3OPOA 4X66L 2CU1A 2A68C 3C2PA 4NDXA 3SFEB 2MGSA 5JJKA 1QLBB 2IO3B 3V96A 1S5BD 3JVZX 3NWTA 1Q7YC 3A4SC 3PLUA 2KTFA 4JG2A 3LWEA 4M0WB 3QQ8B 5C5MA 3UDGA 3RNBC 1V6EA 4ZRPA 5FK9C 4O1NA 3DHGC 3Q3OC 2G5DA 1XMOQ 2FFKB 2H88B 2N78A 2NPTB 2PNHA 2F0HA 1SYFA 4X62L 1QZHA 1B7YB 1Q8IA 3S2DB 2BGFA 1SNDA 2QILA 1PH9A 1R4NI 2XIWA 2RSNA 1JR0D 1JMLA 1NVID 3LXFA 3Q3JA 4GSWA 4LNKA 5HY6A 1HQRD 4DHJD 1N6ZA 2NS5A 4I6PA 4RH6A 4AYBG 4W9LA 3CSTA 1ZUD2 2DN8A 5JPMC 2UUAL 4A3FH 2BCOA 1EQTA 2L00B 4JIOU 1N32Q 2PZUA 3DWQA 3Q2AC 1E7VA 3NELA 3TEYA 3GTGB 3PF4A 1DYQA 1OQQA 2LHEA 4AIMA 2PO4A 4APVA 1IPGA 1XO3A 3SK5A 2IZVB 4GN1A 4AQ7A 3T56B 2M00A 4WWPA 2YEPF 3Q69A 4HDQA 2NTTA 5KGUA 3PUXA 4ID6A 2N7JA 3DPDA 2B2YA 2SEBD 1KJTA 1H4RA 2YEPB 5ELCA 3B2GA 1P9DU 2E2DC 5C3EG 4LK0M 1KHIA 4DNTB 1H9MA 3NXWA 2E75C 2R92H 3K9PB 3VVWB 3EN2A 4IWPA 2PW5A 3VYSA 1PFBA 1RHPA 2BT6A 2LXCA 3GV6A 2Y0SB 3M7GA 4C7ZA 1SB3C 3I72A 1VZ8A 2AQ2B 1VQ7A 1WWTA 3NJTA 2EJMA 5E3FA 2B2UA 2GVAA 3CPFA 2A5UA 4RKLA 1QOAA 3AU7A 4R4QA 2DWQA 2KJRA 2OCEA 1IBKQ 2KQ7A 3FVQA 3FKYA 2Z4IA 1VDZA 3ENEA 1KRHA 1RRBA 2EJGC 1Z7TA 2JXMB 4XTCS 1UAPA 2Q2IA 1XQQA 2VRRB 3CP0A 3U50C 3HRDD 1W6KA 1X3GA 5C3JB 3QB3A 3S16B 1B2TA 2MBEA 5C3EH 2AQ1B 3VR3A 3CCEA 1QVGA 2VB2X 4WORA 4CKEA 4FF2A 4Q0FA 2IY5B 1CKNB 2GBKA 1HUNA 2E2JH 2WQYB 1OQYA 2FJ2A 2PVOD 3R8BA 4MNOA 1SYEA 2D62A 3S17B 2WXJA 4BKSD 2CCZA 1CSPA 1E8XA 1QT9A 2LS01 5BYSA 1WTQA 3KQ4A 3DM3A 3UQAA 2OOBB 3BK2A 2XRSD 2F0UA 1SXTA 2MNAA 3QX1A 1PA6A 4KN7C 1ZXHA 5E4XA 2GI9A 4ZLTF 2UUBL 4JV5Q 2FAZA 4IWQA 3SDLC 4B3SQ 3P1MA 4LFAQ 3OMGA 1CKMA 4YCWA 3VYUA 3SR1A 1J8CA 4NXMQ 2K8BA 4EFOA 4KHPL 2NN6I 3W1SA 1UNSA 4CQNA 3NZ3A 5EBCA 4PYUA 3K9OB 1F2LA 5D7GA 1WD1A 1FD6A 2XGTA 1WXMA 4A3DH 4YSZB 3S9WA 5EE9A 1I3QH 2N3SA 1B50A 3NS8A 1IW7D 2I5LX 3GTLB 4NY0A 5D6JB 3B08A 1I4HA 1PVOA 5BN3A 2XSCA 2KUMA 2EYLA 3I7FA 2N0SB 2JA6H 1FNWA 1EY5A 1TQOA 1G6ZA 1AE3A 4KX6B 2ZXPA 2BB6A 1VCBA 3H6NA 4MSQB 1TKGA 4J6HA 2VXWA 1L1OA 4OX9L 1I6HH 1WRIA 4ZRKA 3MXNB 5A2QL 4CJ0B 1LTBD 4A3EB 2N9PC 4MACA 1H9RA 3LWUA 3KLSX 2K5HA 4OO1G 3ZNID 4JBKA 2RPQA 4K8IA 4HIDA 1ONLA 3S24A 4GNXA 2B29A 5DNFA 5E7NA 4DR2Q 3ZYYX 2WXHA 3M4QA 1H9SA 4PZ7A 1RTOA 1F2ZA 4BA2I 1U9RA 3NZSA 1NYQA 1HCZA 1K8MA 2WXKA 2PVGC 2XVSA 2K39A 2G9HD 3TSSA 5M5YH 4R1JA 2K25A 1NBWA 2NN6H 2ZJQA 1G2TA 1GUTA 1EY4A 4RGOS 2G45B 1ENFA 1BUIC 1JMCA 1RLFA 2KOXA 5IA7A 3IAS1 4P71A 1C48A 1XPUA 1FXIA 4IUUA 1GAQB 1B1ZA 3U4ZA 2LJ5A 1V1PA 5IP4D 2UU9Q 4WJOA 1GUOA 4W9HA 1VQ6A 2YLMA 1K53A 1RKNA 2RR9A 1ZKOA 1V86A 1LO5D 2K6AA 1JCKB 3I57A 3GP7A 4C80A 1WM2A 3K7AH 3CCVA 2K9XA 4II2B 4AJYB 5C4XH 4R3DA 2L5TA 2L3ZA 1CFMA 3K6OA 3I4NG 1D6EC 3RFZB 3V60A 4EGVA 4G0NB 3UE0A 4DXFA 3GTJB 2MBOA 1RAXA 1AP0A 2EIFA 2WDQB 2QJLA 2NVTH 4XWWA 4RCOA 2C9WB 5HHDG 5C4XB 1LABA 1Y8RC 3U9SA 1BMLC 4RKBA 2KYWA 1B8AA 2F03A 4IUVA 2Q8IB 1CI3M 4KY7A 2KMAA 2OHFA 5DPTA 1A5RA 4A3GG 4ZUIA 5I2YA 3HOWG 2IGHA 1STNA 1ZE3D 3J7AF 4S17A 3ABVB 4N9TA 2V4LA 1PZID 2HIXA 3A4RA 4RFBA 1WXSA 1DOYA 2H1EA 2ZTEA 3W5UB 1GHJA 2MUYA 1Y1WH 2XTIA 2KNBA 1PH2A 2R3ZA 4CHTB 2A4ZA 4CGYB 4X65Q 5CGKA 2CJOA 3ERSX 1SMYC 5E6PA 3X3NA 3T51B 1FJGQ 3B1LX 3VUXA 2M56B 1NJIC 2V9HA 2EMTA 4HCNB 4REZA 4CBVA 4YTPB 3AEVA 2J52A 4A90A 1BF4A 3N52A 3PIP3 1HTOA 3W9CB 1IBXB 3KJOA 1HNXL 4Q5VA 2LXKA 2Z8LA 2N9LA 4A9AA 4NQLB 3GZNI 4JI7L 2KJXA 4EQ5A 2J7QB 4A93G 2VQFQ 3T1HQ 5IP7H 1K8AC 4X6AH 4EX5A 1V97A 4LNOA 4CDCC 2M0AA 3OW2A 1SE9A 4LW1A 2FE8A 2M2LA 3DUZA 3NWSA 1C8CA 1P7EA 3OWFA 2RDBC 2B63G 3M4PA 2K5DA 2CU3A 1HNZL 4A3DB 1L2FA 3DBSA 2JF5A 4HCEA 1U4LA 1YI2A 4EEWA 3F8TA 1PV4A 3TQYA 2I07B 1VQMA 1M94A 2KACA 2CW0D 2LVPA 2FMCA 1K9MC 4JBMA 4DK6C 1SMXA 4ZRJA 2UXBL 4ULLA 4IPGA 1F9SA 4QMGA 2F0TA 3ZRCA 3GE3C 3S15B 4JWSC 1E0BA 1EEID 3PIPA 4USAA 2VS1A 5G2NA 4KD3A 3RLOA 1A6XA 1OXVA 4RAUC 1BBWA 2MRPA 2BS3B 3K81C 1H8CA 4LF7Q 4FF4A 4KVGB 1HR0Q 5IP9G 1P16A 5T1IA 2AL6A 5LL6S 2QCPX 1HA6A 4NZLB 3W3AA 1PGBA 4B3ML 1TWFH 4BY7B 4R8NA 5T8IA 1LFDA 3B6YA 5BR8Q 1HTPA 3URYA 2KWUB 4F1SA 1ASZA 3HOVH 2LVQA 2FMMA 2Q8RE 1FL0A 4F87A 2V4IB 3I4OA 2JA7H 2WXGA 3ZKJC 1TY2A 2O2LD 3HEJA 3N1ZC 3RN9C 3IFTA 1TR5A 2F0LA 4XQNA 2X8XX 3AE3B 4C3HG 3H94A 3PO2H 5CTRC 3PIOA 2OEDA 1LTGD 1JORA 3UDXA 3KJPA 1KDBA 2O4XA 4A4IA 4JYAQ 5LMNQ 4KKTA 4DR3L 1RFKA 1DGSA 3KLWA 1C4CA 1Q90A 3V61A 2B76B 1MIUA 3I2ZA 4L6TB 2NUCA 5C0XH 3AM9A 2KMMA 1AW7A 2UUAQ 5IGEA 1C76A 2KMCA 5M5XB 4GOCA 4DHZE 2JQRB 1SROA 4P75A 4ME3A 1N32L 5CHVC 4JI3Q 3PO2G 5J18A 2LGSA 1WCMB 4K2KA 3SR6A 1PUTA 4ARCA 1GNUA 2K28A 1ESFA 2FINB 4K6LA 2INNE 4H2AA 5KNCA 5DCNA 2R92B 2EY6A 1TWAH 5A35A 4A3DG 3BINA 2L1BA 4U68A 1V1OA 3PQIA 2JA7G 1YVCA 4A3BG 3CC7A 2UYZB 2G4SA 1RDPD 2HD3A 2K5VA 2D2CC 4GDLB 1VQ9A 4K1RB 2FXQA 2DGYA 4R9WA 2RGFA 5JEAJ 1STAA 1I7HA 2IHEA 4NQKE 1YD8U 3X0WA 3AE9B 3TMPB 1SLJA 2UUCL 3MXUA 1KXLA 2PEAA 5AZGA 3TUOA 1N34L 4KY6A 2I46A 2LUEA 3I90A 1PZJD 2MQJA 1JWUD 1DJRD 4GKJQ 3RD4A 5BN4A 4X3UA 4TVAB 1AARA 2JA8G 2ZXOA 1HZAA 2CKZB 2F0DA 1TGZB 3DDCB 4IN3A 1FIQA 1P8LA 2JXTA 2QDBA 1MPEA 1VS0A 1L7YA 1WXAA 1SSOA 2JA9A 2MBHA 3H1UA 3N20C 3FEWX 5C4XG 5DEHA 4DV1L 3EHVA 3RCZA 2NMQA 4MEMA 1MG8A 2V3PA 3TS2A 1EYCA 4DR5Q 4DAYB 4A76A 5IYCH 1MG4A 2L1AA 1E2ZA 3FC4A 1RJTA 2PCFB 3NP8A 3AE6B 3L0WB 1A2TA 2PYKA 3ZRFA 1G6JA 2BS4B 5HKHA 1SJED 4IUQA 4KKUA 1KIXA 3K57A 3OWEB 1EWIA 3GS2A 2KCCA 2NN6G 3FILB 1EWYC 2Z9HA 4LTUA 3RPFC 3C46A 1WTWA 1JE5A 1EWHA 3A8KE 5EKLA 2PI2A 3VYTA 4ANXA 2KHIA 3DEOA 1XYIA 2LGXA 3Q14C 4QQBX 3J80L 4OGQC 4N8FA 1IBLQ 4OO1H 4AP4C 4L5RC 2KWCA 2HJ8A 2WXFA 1TWGH 3D3RA 1XWEA 2C5CA 1SFOH 2K5PA 4HIOA 1PDQA 4LLGM 2VUMH 4F8MA 1QOGA 3MXNA 3EFXD 2PNRC 4O42A 5IWAQ 4BBSB 4RGTA 4V190 2BBCA 1Y14B 3HKZB 4GNXC 2OTLA 4XT3B 4DV2L 4L5SA 4ZCKA 4FXDA 2OXPA 4DK1A 2NVQH 3KLRA 4NXML 2DZIA 2GBJA 3PVLA 4HLEA 3S2AA 1D4BA 1GG3A 1B3QA 1PH6A 3WDNA 1FXTB 3P4PB 2A68D 4HIKA 5BO4B 4MTKA 1RODA 5K5PA 4WJNA 1Y69U 1TWCH 5ELFA 1WGKA 1X1MA 4LMQD 4UDUC 2IJ0A 2DZJA 5ELDA 4ZAIA 1WMHB 2M19A 1ICWA 4WWNA 3EA6A 4DV4Q 3PPAA 2E2IH 4C1NI 4NJ6A 4FJZA 2JA6B 2IT1A 1YNXA 3HKSA 3A9JB 3ZGZA 4XDDA 1KNAA 1I94L 2XWJB 1XLQA 1WZ3A 4IG7B 1GO3E 2JA8B 4X66Q 5FJ8G 1BUVT 1I3QB 4EZLA 1K51A 3E9HA 4G50A 2WAQE 1IBML 1V9PA 1VCIA 3HRZC 4ARIA 1DOMA 1VQEA 1LUZA 2AEHA 1BCPB 3V2TA 1EEFD 4KV6A 2EYMA 2C7NB 1D7QA 4ICVA 3FILA 4X62Q 2V1YA 1MD2D 5I9PA 1KC8C 3NUHB 1OO9B 2EY1A 2JZZA 1T0YA 2ASBA 4XX5A 1UE6A 3H8HA 3H09A 1E3PA 1JWBD 4FF3A 3PUZA 1KLUD 3K5LA 4FLHA 3J80E 1FMAD 1SE2A 3FKIH 4AWJA 2PE9A 1JALA 4BOZB 3AULA 5FLXE 1YN5A 3I5JC 1H9KA 2FCSA 4KGSA 1OEYA 4LF8Q 2NZOA 3S17H 3K59A 3GQBA 1XTDA 1CKOA 2BDOA 1JJCB 3EROA 3FKIB 4GOPA 2UU9L 2R7ZB 1NAPA 4HDOA 2ZW1A 3AN1A 4IFDJ 1L1OB 3F2DA 3VYRA 4MJSB 3SEBA 1JJGA 4GLVB 3AFPA 1F2YA 1MSHA 3TP7A 1WTRA 3I3CA 1GD7A 1KH0A 1O7ZA 3T4AC 5KIXA 5C3EB 4KI0A 2E3TA 2MJ8A 4Z9CB 1NSNS 4HR7B 3HOUH 2ZW0A 4UP7A 4RHSA 4HEA1 4EE2A 1Q82C 1C4PA 1PTOC 5EGTA 2MQHA 1VRAB 2C5LC 3WCQA 4LK1C 2HQLA 1WCMH 3OMCA 1CZWA 3W1GA 1SIJA 1L1OC 3DVGX 2EMSA 4YHHL 3AB5A 2A6EC 1K3RA 4JI8L 1WE6A 3M95A 1ESRA 3IL8A 5CV7A 1S72A 4B3TQ 3CHBD 1PXUA 3N1XC 3MC0B 4YCUA 1STGA 2WXNA 2BYTA 2I2YA 4E74A 3TN2A 3N30A 2DZMA 5IN7A 1QQRA 3MHBA 3VDZA 3KFUA 4HIMA 4K7UA 4L1BA 1AZPA 1ZXTA 1C3TA 1GUGA 4A3GH 2K75A 3TEZA 4E3CA 2PZTA 3DBLB 2KDBA 1SNQA 4ZKCB 4POFA 3BDCA 2AWOA 4C3HH 2K6DB 2L7RA 4ANWA 3W2DA 3T3NA 3K5OA 4X65L 3HOVB 2FHTA 3ONSA 5J39A 1GVPA 1RIPA 3AMUA 4DV3Q 3B9JA 4JI4L 1BCPD 4DAMA 1YZ6A 4KDLB 1DOXA 3MP9A 3OJ4B 1QOFA 1V1QA 1NUCA 4OIJA 3QCAA 2C7HA 3A1QB 4K7WA 2K05A 4AUQC 1K83H 1TIID 1LLRD 1TWGB 1HNXQ 1VD2A 4B3RL 4DGZA 1RWSA 3B0AA 2LKVA 2EYOA 3MAQA 3J9CA 3S14B 4HAEA 3KWLA 3MHZA 3AMZA 4BVUC 3EBEA 1P3QU 2RHSB 3A54A 1K8GA 4W9EA 3N1YC 1FFUA 2DJFC 1VQPA 5JHBA 4AYBB 5IOCA 2KCNA 2D2QA 1EYDA 4NMZA 2JPHA 3SHQA 1LTAD 4PNYA 1QOBA 4IDIA 3IAM1 3VA7A 4KZ0A 2DY7A 1XF5L 1PRTD 1MBYA 3R93A 2MJDA 4M01A 1PFSA 4HKZE 3A74A 4I7ZC 1RCVD 4CJ1B 2KZRA 4KN4C 2YTXA 4GN3B 2ZCBA 4TMAB 1T6BX 1YJNA 1O7YA 1EOTA 2WLBA 4K0KQ 3MWYW 4WWMA 4TQUS 4YTMB 1BXTA 3UF8A 3HOYH 2FUHB 4BBNC 2NZHA 5DLQE 2KDIA 1Y8PB 2WHIA 3DOWA 3E6ZX 2A19A 2DJGC 3A8JE 2F0IA 2LZ6A 3HFZB 3W1YA 1X9NA 2ZM6Q 1I4RA 5KNBA 3W5OA 1WGYA 1II3A 4RWSC 5ELBA 1K0SA 2OTJA 4KIKA 4MM3B 2M4NA 1ML0D 2OT2A 1N33L 2UXCQ 2XRQD 2BPSA 1MGSA 4B3MQ 3FMCA 4ME5A 3D31A 3WA0A 1YNNC 2K22A 4FXKC 2VY3A 1X3QA 1KRTA 4V0BA 4NP5A 1GPXA 1LT4D 1WI0A 3JW0X 3TDQA 1TZOA 1WI5A 1HZ5A 1H9JA 1WD0A 3G6EA 3IKJA 1XNQL 1TZ1A 2E5LQ 3GTKH 4KKIA 3VR5A 3M63B 5D94A 2G9DA 1A2UA 4K3CA 4A3PA 1K8RB 2XNAC 4PS7A 5IO9A 4C3IG 4A3IH 1UBIA 4DQOC 4WJPA 5F2DA 5GADC 2PW9A 4OELB 2L8JA 1LTSD 2XK5B 2R93H 1YQ3B 2HJ1A 2BVCA 2UUBQ 1CTMA 2HDMA 2L05A 1QVFA 3C0RB 4M8NA 4LCDE 1XMQL 2FIDA 5JJZA 1UELA 2HQEA 3APDA 1HHVA 4UPAA 1YHBA 3I70A 5EAYA 5GQOA 3SGIA 4AH6A 3SHLA 4KMUC 5CV8A 4ZKBB 3PO2B 3DLLA 4W9IA 3FP9A 2GBRA 3QJZA 4BKTA 2I1JA 4UHVA 4C3JH 4PV1C 2JYEA 1QCBD 5EE1A 4CO7A 3CCJA 2HHHL 1HTQA 1AFPA 3M9BA 5M3FG 1FO4A 4G7ZC 3QAQA 5FO7B 3RZDH 1EO6A 1GOZA 3H7PB 2R7ZH 2MSED 1BBUA 1TWFB 1PH1A 1V1PB 4BY7H 2B3GA 1MHWC 4IOAA 2NVYB 1EY9A 2QIEB 1QJOA 2IL8A 1WYWB 3IXSA 2EDGA 3BDLA 1K50A 5EKKA 5M5YB 4OX9Q 2ACZB 4S0RA 2JK8A 1WJ4A 3PGZA 3KDFA 5D3DA 1XX8A 3L9AX 3A7LA 5EKIA 3DWGC 2UXDQ 1F52A 2B2WA 4IM2A 1VQAA 1EF5A 3FPPA 2LJIA 4CJ2C 3NBHB 1EF1A 3PMFA 1NI3A 4GIVA 4A3MG 1FJGL 3RZWC 3ZW3A 1EZ8A 3OIQA 2K8CA 4LF4L 2E8GA 2FNJB 3UIOB 4DXAB 3KBXA 1TKYA 2HIVA 3E0JA 4HRSA 1I6HB 1PGAA 4DFAA 3HOXB 4JI5Q 4IQZA 1QZEA 4TUUA 3CCQA 1FM0D 1VQ4A 3NRZA 3P63A 1K73C 1TKEA 2JVCA 3OJ3A 5CV5A 1GC6A 3OW7A 1HRJA 2BQQA 4MHEA 4FA6A 2D3AA 3HIZA 4X3KA 4C2MB 4JI7Q 4DK3C 4OEMB 2KK8A 3U4EG 5HURA 3GTLH 5M9OA 1L5PA 2NR2A 1R4QB 1V81A 4KK7A 4NKLA 1V43A 1TWCB 1IBLL 3T9LA 3I4MG 3I73A 3FRPB 5C3XA 4IFDG 3AH7A 1C78A 2RQXA 4JW0A 5D65A 2QDLA 4BOSC 2MEKA 3AI5A 3LJ3A 3HS0C 2WACA 1HNZQ 3OIPA 4DV2Q 3DVGY 2VUMG 4D2KA 1F9QA 4P2CB 4A3MH 1CM9A 4K81A 4DXGA 2ZNVC 1S5CD 3NE5B 3S1MB 2BB5A 3K0YA 2KWDA 2AMCB 4GDLA 4AQYQ 5H1SE 2IO1B 3BYYB 4FN2A 2LMCB 4OVVA 3PREA 2VNUD 3I4NH 4K7SA 3J7A5 2H5XA 1DM0B 2NVYH 1PH8A 5COYA 3LB8C 3OSOA 1MSGA 2Y3AA 5IKCM 1EQRA 2MP1A 4CDDC 3H3VI 2E2JB 5L37A 2NWGA 4J1MA 2AHOB 2RBMA 4LF7L 1PH5A 4YWLA 4DUZQ 1FRDA 2D0OA 2ICIA 3H0GG 3ZJTA 5AJ3L 1BR9A 1OXSC 2BYVE 4GDKA 2F52A 4FHKA 4MGIE 4YY3Q 1UE1A 4QUCA 2Z0DB 4ITKA 4LNIA 1N36Q 3GTMH 3CKIB 4XZ4A 1VQOA 1XLNA 3TEWA 3GTQH 3GTJH 2B2TA 1HNWQ 2IGDA 5IYCG 2BW2A 3TS0A 2C7MB 3R7RA 1JWMD 3UGBB 5IP7G 4HJKA 4DBGA 2N55A 4P74A 2Z4HA 3ULPA 4RM8A 4R8IA 1VMCA 2AWNA 3T1YL 1DXMA 2F4IA 4QCLA 2Z0SA 2O6VA 1F0ZA 3ZUNA 4GLXA 1VJKA 2B2UC 2IW3A 4IZ8A 4HN7A 5C0XJ 3PTFC 1RF2D 1WX7A 4TKOB 1BO0A 4BKSA 1VMPA 4KSLC 4HJAA 3AEDB 3M62B 2BTEA 4MJSA 4A8XC 1M1KC 5I6YA 2IX0A 4PMBA 3BWUD 3AEGB 3S2HH 3H91A 1GUSA 4JBJA 5EJWA 3CMEA 1XCQL 4J15A 4B95A 2KFKA 3G4SA 2AQ3B 1JWSD 4QUFA 5C0XI 3J7ZC 3L10B 4PYZA 4B6WA 4LF5L 4A93H 4XT1B 1UE7A 2KCTA 2KEDA 2KTRA 3VR4A 3L17A 2KXJA 3CRLC 1B3AA 3G7LA 4U673 3GTGH 3MXGA 4DV7L 1BT0A 2K8HA 3DBRI 5JEAH 3APCA 2PMZE 1CJEA 4XWTA 1KQSA 4KGTA 4L8JA 4JI2Q 2R6GA 2F0VA 4IW0A 3EFCA 2KHJA 2K6QA 2JZ3B 4B3TL 2NVTB 1OXTA 3HOYB 2YTYA 2I5HA 5FLMG 3S1RB 2L52A 4KIKB 1TS5A 2KBNA 2D3CA 5GROA 3CU7A 3ZTCA 1F9RA 2OJWA 1E9MA 3HG9A 2RMMA 1BQQT 2K4KA 4KKSA 1DD2A 2D07B 3RNEC 2CJNA 5IGGA 2D3BA 5GMVA 1OXUA 1WTVA 1AEXA 1GB1A 5DPSA 2LGYA 4NXNQ 3CCUA 1PLFA 4XQJA 2JT4B 2DYOA 4DV3L 3HVDA 2EYHA 4YXDB 1HZ9A 2OWOA 1YQ4B 5JOBA 4HCPB 4OW0A 3I63C 4RA8A 5LMNL 1JQYD 2TMPA 2LGDA 1PFNA 3SE0A 1Q10A 4JE3B 1DZ1A 1GJXA 4FF1A 4OVZA 3F1ZA 3T16A 2JP1A 4M8AA 2K14A 4NAMA 2LFNA 2RSOA 4L63B 1RFAA 2EELA 3Q8FA 3JSVB 2O5IC 2WXQA 4BKGA 2PQEA 3CRKC 3PHWB 4JI0L 3KYDD 3QK0A 2I5MX 1QILA 3R2TA 3DCGA 1V9JA 2F0OA 5M3MG 2VQEQ 4A3KG 5J2RA 2F3VA 2N88A 1N5WA 1E8WA 2LRUA 3MTSA 4GU2A 1NMFA 5LMUQ 1OQRA 3TJPA 2DLBA 3ND9A 2WP8J 4FXGC 4RGNA 1CZGA 4WQMA 4R4TA 2UUCQ 2R7ZG 2EE1A 4IJHA 2IX1A 2EPBA 4CDEC 2JA5G 4OZCA 1ZYRC 3NOBA 4EUTA 1HH2P 5G3LF 1LTLA 4DV4L 5CC4A 1JOKA 4BY1G 2L0TA 2INCC 2QHOA 3RNCC 3RT3B 2ZM6L 3Q8AA 3OTOL 3DBHB 4HSVA 3P4QB 1ILQA 1PRTB 5AZHA 1WR6E 5BYQA 5MPOA 4XC2A 4FYDA 1WJ6A 1SAPA 2J7ZA 1IBMQ 4JCVE 4ABNA 2AUJD 5DM73 3A9KA 4URKA 2N1VA 1TT2A 2WXLA 3H7SA 4OWTB 4MGKE 4E71A 3Q8BA 1WMHA 3OLMD 1E8ZA 2CH4A 2DNFA 3NZUA 4HROA 1A15A 1JB7A 5E1FA 4A20A 2REXA 3CAMA 1VQ5A 1UWMA 3A5UA 1DOIA 4X3SA 3EECA 3P4SB 1FNUA 2K5QA 1ISNA 2F0WA 2G3QB 5G55A 1K28A 4RM9A 1D1KA 1SNOA 3V05A 1MI2A 3KBGA 5ELEA 2BS2B 5EE0A 4IWOA 4HMIA 2NCNA 1FVIA 3D4WA 3KF6B 1GB4A 1GUNA 4E6IA 3S2DH 1C4QA 4WJ4A 3I4LA 3BYTB 4ANVA 2MO0A 1EQQA 2D0PA 2AL3A 1P98A 4WURA 2MHVA 4HJ9A 3VAWA 2K50A 5C3WA 1ZGUB 5IT9E 1U4PA 1C77A 4NPSA 3IT6B 4BAXA 2C60A 4A55A 2LMCA 3RUZA 3TP8A 2JA8H 3F2UA 1Y1VG 1J7CA 3ZJUA 1M8AA 2KC1A 1WJJA 3MC9A 3PZ7A 2CFMA 3CCRA 3NS1A 4AOFA 2CHBD 1F77A 1O7LA 2R61A 2GMIC 2QEXA 3A33B 2RKSA 1QWYA 4LWCA 2KVMA 1L4DB 5M3FB 3WOFA 1IZ6A 1CK1A 4A3LG 4L2YA 3HOZG 4X64L 4QIWB 1D5ZC 4IPCA 4LUZA 4KJNA 2J0JA 5LNK1 2GBNA 4RHRA 3P75A 1Z47A 4YWKA 2K01A 5IGFA 2KHWB 4KSKC 2NVQB 3NQTA 2BKFA 1YJWA 2QCZA 3UDFA 3AEEB 4A3BH 4K3BA 3V3XA 5GAHC 2EJFC 5CX3A 3DBHI 5FO8B 2VUMB 3L16A 4DUYL 1SFOB 2O6VB 4DPGA 1N8RC 4WAFA 2KJ6A 3WOEA 1XJVA 2J0KA 4JYAL 1EIHA 2F0FA 1IP9A 4KDIC 4OHJA 5K36H 1U4MA 3WANA 3M4OB 3RUIB 1WTOA 1IKLA 1PZKD 4O2DA 1VQIA 4I65A 2R92G 3PHXB 4M00A 3L3OC 2JRHA 3DHQA 4GKKQ 1ZXIA 3Q6BA 1SYDA 2F0MA 1E2VA 1KD1C 2EY5A 3EIVA 4CKCA 3VA5A 4C3IH 1YBYA 4OVUA 4O0AA 3SFDB 1OGWA 3A8IE 2K3UA 1NTGA 1K8OA 1JT8A 1OTCA 1MI0A 4HEDA 1S5ED 1D5XC 1PYSB 1WOCA 2L9HA 2VB3X 2DNEA 3HOZB 2FUG1 2LI5A 1E7UA 4YL8A 2L4NA 4HJ7A 4ICUA 2KDFB 5LXIB 3J81L 1EM7A 4DDID 1UWVA 4EZJA 2QSDA 1RL2A 1NBFC 1V8CA 1PQSA 1EY6A 2JE6I 4A3FG 5D14A 4N8X1 1ZYRD 1N34Q 4GXBA 3TMEA 3E5SA 2D5GA 2KANA 2F1MA 2YTVA 1Q1EA 3R66C 2V0GA 3N9YC 1TXYA 2WAQG 1UBQA 1R4NB 2WXMA 4UP9A 3VUWA 2L12A 1K52A 2A1AA 2MJEA 3UQBA 3EVQA 4HWIB 2A6ED 1Z9FA 1FGBD 3CF6E 2JSVX 3NY5A 2GN5A 2L55A 3R3OA 3NVZA 2ENBA 1KAAA 1NEKB 1N33Q 4C3HB 3KYHC 2NBWB 4DR6L 1LT5D 2E74C 1VQNA 4LUOA 1SYCA 2VL6A 5JJLA 1XD3B 2HDLA 5AUKA 4HVBA 4NB3A 3H9DA 2I38A 3QC8B 2K32A 3VH4B 5J3BA 1ZEQX 3DMUA 2QKIC 1XNQQ 3HZXA 4R4IA 5M5XH 3M3YB 4GZYC 1T0RC 3T1YQ 2NPTA 3GOEA 3OG5A 5LLIA 5IT9c 1PYBA 4B3RQ 2IO2B 1FNVA 3HHMA 3PV0A 2F3IA 2JY6A 5E6OA 1VF5C 3DWMA 2Z6KA 4OZAA 5IAAC 1Q81C 1IL2A 2JX5A 1EWCA 2OEOA 2INDC 4ZOHC 2E76C 3A7AB 2KJHB 5E6NA 1C9OA 1KLVA 4IFDI 2J53A 5FOBB 2ON8A 1SF0A 3KLSA 4F7XA 1ROEA 1SGHA 1WR1A 3A5ZB 1S4ZA 2BYEA 1SN8A 5C4ZA 3AE7B 3HOUB 2G1EA 5IWAL 4LDTB 4ZRIA 1PRTF 4L5QA 2M1MA 1XNRL 3UIPB 1LACA 1XLPA 2Q2UA 1ILPA 3S1QH 4YWGG 3LDZE 1E90A 1F2RC 3NENA 2B39A 2LY7A 4GN4B 4DR4Q 1G6PA 1G2SA 3MC8A 2F4VL 4CHKA 4C7YA 3D4RA 2N4FA 2EKEC 5TR5A 3WWVA 5FO9B 3PRMB 4YSYB 2ZPNA 4N6EB 4JPSA 3R7QA 2INPE 1T5XD 3DM1A 4MH0E 1N61A 1FCLA 4XDXA 1YQBA 4JI2L 2DHZA 1DONA 2EYJA 2LSSA 3L0OA 4BFRA 4QGUA 4MT5A 1D8LA 3S15H 3M7NA 3TEXA 1STYA 3X3MA 4CDFC 3A55A 2ZNVB 1ACCA 3DHHC 2ICEC 2FIFA 2Y0SE 2IY1B 4DNRB 2HT1A 3AXCA 2UXCL 2D9UA 1V2YA 2MO1A 2KO3A 1JRPA 1CHPD 4QB4A 2XK5A 1LT6D 1WX8A 4KZCA 1Q86C 1B70B 4WJ3M 3AU4A 2IWHA 2XBBC 2D3GA 2A73B 1Y1WG 4NAWB 3PO3H 3HOUG 3KOJA 3J80c 5C44G 4JVZA 2FCNA 2ZPYA 2PZWA 1EU3A 4RGMA 4DK0A 1LM8B 3AV8A 2L32A 1VQ8A 4ODGA 2NTSA 5BN5A 3U9OA 4FP5D 3KF8B 1QOHA 4ANUA 3LGJA 4LF4Q 4NNJB 1V5TA 1IYJB 2OJRA 2IDYA 3VUYA 4DNIA 2MP2A 4JI5L 4GOPB 1X32A 2PI2E 2Q2TA 2PJHA 4WH4A 2JRIB 1HFGA 3T8MA 4DHZB 3STBC 3BY4B 3J81i 2Z0EB 4DA2A 3H0GH 4LUVA 4UY8C 4LF8L 2ZTCA 2KQSA 4XYCA 4PQXA 5C23A 3STBD 4KGRA 1FGUA 3H3VC 2J0MA 4K8JA 3ETRA 1PFDA 3CD6A 2RVLA 1PMRA 5FR6A 1XMQQ 4F88A 3PO0A 4ZUJA 1D5MC 4LDTD 2R2QA 1IYUA 2V3NA 2KAJA 2BDNA 4B9XA 1CSQA 1FR3A 1I6VC 5C6AA 4ALPA 3RZOH 3GTPH 2MBBB 4BBSH 1IGCA 1WTPA 2YU9H 4NAWA 3V6CB 4RNAA 2LXAA 5C44H 2F0GA 2PTLA 2K5NA 3K0XA 4MELA 1HEZE 2GOWA 1Y1WB 1U5KA 1CMXB 4P6VF 3SD5A 2JA6G 4YHHQ 1NMGA 3ALBA 1Q3LA 2B2VC 4JI8Q 5I9OA 2L83A 3U52E 1TY0A 1SJHD 4DU9A 2IX3A 1MJEA 2KQ4X 5GAEC 4FULA 5I2XA 3IAYA 2IHFA 2BYFA 3ZIMA 3DEPA 3ML9A 1E0ZA 5KRUA 3H0GB 5BMIA 4KJOA 1SNPA 4ZQ3A 2CWAA 1A63A 4WWOA 2SDFA 1UWXA 2L0FA 3TL5A 3VFKA 5EPLA 3NG0A 1HA5A 5IIFA 2JU6X 2MCNB 3BVZA 5ELOA 4XXEA 4Y7NH 2WDRB 4EZKA 2WB1G 1VQHA 2ZEQA 4C1NK 2B2TC 5C4HA 1J19A 4DWFA 4IUMB 3G48A 2LWPA 1V49A 4IUPA 4HPMB 4JK1C 1OEYJ 4I6NB 2QW7A 2JN4A 1IL8A 3ONAB 3L4PA 4HPLB 5D2MB 3U2SC 4B9KA 3K7AB 1VLBA 1HNWL 3PT2B 3CXCA 4A3JH 2R93G 2O6VD 2KECA 1C1YB 4QF4A 3CF5A 4A3KH 1NR2A 4NJCA 5IE8A 3KUCB 1UUPA 3L13A 3RNGC 1YJIA 3IBEA 1JROA 2WKDA 2EY2A 5K36G 4W9DA 4H02A 2Q2HA 4W9JA 1H9SB 4LJPB 1W3SA 3X23A 1YNTE 1JC7A 3C1EA 3J81c 3CMAA 1GUAB 3I55A 4BBRH 4ASWC 2V4DA 4IO9A 2XWBB 4NPNA 5EE3A 2JA5H 1ZDXA 1A3VA 1HXYD 3I56A 1EYGA 2F3WA 1GKHA 4WJWA 4W9FA 3MEFA 4FNFA 2ZJPA 4JC0A 5DPWA 1TWAB 2KQ3A 1EFID 1I4GA 2JWZA 3I3TB 2ZTDA 5M3MH 3C19A 4LNNA 1EY7A 5JAVA 5JJIA 5BMGA 3LX0A 4LF5Q 1Q8KA 2K52A 4FHJA 4OL7A 4HSPA 4K0KL 4MSMB 2AYOB 4G7OC 2RSUA 4AQYL 1JICA 2D10A 1CQVA 1WIAA 1YOVB 1IXRA 4DV7Q 1N63A 3TIXA 2FCMA 4IJLA 3ZLZA 4R4CA 3PSIA 1PTOF 1Y1VB 2PMVA 5JPNC 2ES2A 1LXDA 3QOLA 4A3JG 3DHIC 3GTOB 4DN4M 1F1HA 3VR6A 2WDTB 2WDVB 2WXIA 2F0SA 2LASA 2N7DA 1JW9D 3B2FA 2B2VA 3ZJVA 1GM5A 5AJ3Q 2JA7B 3P7JA 4YY3L 4BY7G 4JL9A 1G8ZD 4BY1B 2BE5C 3HGBA 3CQZH 4P73A 4A75A 4K14A 2ID0A 2Y5PA 2GVBA 3ZJYC 2DENB 4G11A 3W1SC 1WX9A 5BMHA 3VR9B 3GV3A 3DXJC 3NHEB 2MWSB 1QNUA 2OQKA 4BBRG 2OQ0A 2ZJRA 1N9WA 2PLPA 4IM3A 5AFWA 3MHSD 4QL5A 2B2WC 3T3OA 1STEA 3UDIA 3UE1A 2KFKB 1VQGA 2E5LL 3A1QA 1QZGA 3ZXRA 1J9OA 1BOSA 1JOOA 2KX3A 3U4VA 1FXAA 2KTRB 4IM0A 1VQBA 1JRUA 4KD4A 3EQLC 1F9JA 2HD5B 2W54A 2ATWA 1Q1OA 1WSPA 3O65B 3SU8X 3BZCA 2Q8TA 4BBRB 1YIWA 2CHZA 1I4QA 1U4AA 2LXJA 4JPBW 4JI1Q 2N1WA 4ZYNA 4I6LB 1UEAB 4MM3A 1TS3A 1B9NA 1X6OA 2HCCA 3G71A 1WTXA 1Y56A 2V3SA 3Q3FA 3ZDTA 1T5EA 5T1GA 3KWVA 2PPHA 1A62A 3ERQA 3HOWB 5GAGC 1CHQD 3RN2A 2QC8A 2WP9B 3S16H 5JH5C 1YNND 4LJZC 1YEZA 4A3JB 2DY8A 2PIAA 4HJGE 3HP3A 4EQPA 5C2TB 4PK1A 1SMYD 2YYZA 5IGDA 3DWPA 1J5EL 1WGDA 1LQBA 1PDXA 3PUYA 4DV0Q 2DYBA 3MEHA 2JEAI 2LHDA 1VZ7A 3Q3NC 3MVVA 1EIYB 1E8YA 4MTNA 1D3ZA 3RNFC 3ER0A 2QMTA 1A0IA 4GLSC 3MJ5A 4DR1L 3Q24A 4IURA 2WS3B 3AECB 5E4WC 3NBHA 5LHY1 1YJJA 1NI2A 1R7SA 3TZDA 4BBSG 2K03A 1I5FA 2CW0C 4PZ6A 4LF6Q 1J8IA 4BBNF 1EU4A 3NHHA 2RCNA 4QY7A 1SNCA 5LL6X 4WFN3 2PMZB 2UXDL 2WWZA 3DQVA 4P1BC 4ZDVA 1LV9A 3R3MA 1X56A 1P0RA 4HJ8A 2R7FA 5C44B 1ZOYB 1ENCA 2L0CA 3AQQA 5M5WH 3APFA 4NXNL 1NNXA 1LM0A 2QF7A 2JSOA 2EQSA 2WKCA 4IUTA 4KKJA 5L95C 4K5VA 2FBWB 3HKZE 3MA2B 3A56A 4PZ8A 3VR2A 1QG7A 4DAVA 3CC4A 1EY8A 4N9F4 2DX5B 3IT4B 3OOCA 4K5WA 2B63H 2E2HH 3CC2A 3JYUA 1K3BC 2IBIB 1MJCA 4YTNB 4JI6Q 2E6XA 4ZRQA 4A3FB 1KLGD 4H7BA 1JWAD 1IGDA 1E24A 2WGSA 2KN4A 2HE7A 3R2IA 2Z6KC 1E1TA 3PGEA 3VHTC 3QO2A 1BDOA 2LRWA 1G291 1VR9A 1LTRD 2M17A 2EKIA 1I50B 4OIKA 4MGZE 1EIFA 1GC7A 4B3SL 1VQLA 2F0NA 4DR7L 1WXVA 2HTHA 1R9TH 4LFBL 2VQEL 4IPHA 2BE5D 2CHXA 4UP8A 2L76A 1P1AA 3ZQ4A 2LGIA 1SE3A 3JAMc 2K7VA 4KHPQ 3U58A 1RYJA 5LMUL 4B08A 2K1FA 4LNFA 2KCMA 4GLAC 3P1HA 1I50H 1WGHA 1C9FA 1VDVA 1JOQA 1QVCA 1JB3A 4RF0A 3ULLA 2L11A 4IPDA 5JEAG 2KN5A 3LNNA 4WJQA 2VH2A 3HOVG 2VZAA 1ZP0B 3D4DA 3FDTA 4DV5Q 4GGQA 5CMDA 3AE4B 1M90C 2PQAA 4RMFA 1JE4A 2WV6D 1E10A 3E3XA 1YNJC 3A0JA 4PG3A 1J7BA 1UGJA 2C9OA 2JJQA 3NUCA 3KF6A 4DUZL 1PTOD 5JVG3 4X64Q 2VW9A 1CUKA 1RD9D 1BBXC 2N9KA 2NBVB 2DUDA 1YMHE 1N36L 5CV6A 4IOIE 1GJZA 4FVMA 3A9KB 2KEEA 1FPYA 3E0EA 3RZFA 3CIRB 4A3EH 1LT3D 1QUQA 2QGQA 3GO5A 3SK8A 3NTKA 1HE8A 3U7ZA 3RULA 1YITA 4C3JG 1SBBB 3S1QB 4LFCQ 4CKBA 2W3RA 5EPJA 4DUYQ 3KF8A 2JEBI 2KENA 2Z59B 1PRTC 1L0YB 5C1ZA 3F2CA 1XEEA 4LF9L 3SK6A 3QHTA 1PFMA 4A3CG 2YVCA 3SVMA 1S5FD 1XXGA 1F2MA 5FJ8H 4ZK9B 3IVFA 1MKHA 3N3KB 3U8ZA 3P2BA 3EJIA 4HXDA 1PTOB 2MA9B 4M1UB 3ZXVA 3FKIG 1V5OA 2NVXH 4ACFA 1UGMA 2K5WA 1ASYA 1AWDA 2ZCCA 3RNAC 1I4XA 3L2PA 3J80i 1AH9A 3Q8CA 4BZAA 4KHVA 1HZ6A 4HK2A 1EY0A 1QUQB 2JQOA 3MFYA 4UAIA 1BCPC 1T9HA 3PRZA 1PH7A 1O80A 1SR3A 2H4OA 2KLGA 3EUB2 4FJVB 3NTHA 3ZTDA 3PO3G 4IOCA 4AJWA 2EYPA 3GD7A 1S5DD 2CKHB 4B9WA 1YN3A 3QWZB 4HCSA 1LTTD 1UF0A 2RDHA 3JAME 2CHWA 2KA7A 4QIWE 1PGXA 1IKMA 1WGRA 1FFVA 1QB5D 2GBMA 1EOVA 1WJNA 5C0XG 2MBQA 5HI1A 3K8AA 2K33A 3HM6X 2BKRB 3AE2B 1X65A 3TEHB 1TWHH 2WXOA 1KRSA 4P1CC 1A3TA 1WH3A 3RMKC 1CT1D 2P5ZX 4H13C 3EFUA 1C7YA 2ZZPB 1S1QB 4IFDH 4KLKA 2A74C 3BDOA 3ML8A 4KV2A 2DZKA 1EUJA 3P20A 2KOLA 2DNCA 4DR6Q 3PLVA 4J3OD 4FJYA 4FO2A 1P7FA 2B3AA 4BXXH 3NBIA 1PHJA 3HOZH 5KHQA 1IBXA 1D2BA 1V80A 4P72A 1GXDC 3D6CA 2HCIA 3DWAA 5KHOA 1K0RA 4G3XB 3BU2A 3LYYA 2MW5A 2KLCA 3PSEB 2J4XA 1BNZA 4JBWA 2GLSA 1ENAA 1U0LA 3K80C 3J81j 3NVVA 1S3OA 1IYFA 3VDYA 3S1RH 1TJEA 2LUMA 4JOIC 3M85A 2A69C 2F0PA 3KVFB 1RM6C 5H8YE 3SK4A 3I91A 2D5DA 3M4OH 1BCPF 1XCTL 2GB1A 3P42A 4WQOB 3U30A 4JI0Q 1I42A 1VZ6A 2IGGA 3AEBB 3PV1A 3BZDB 3RN5A 4OZBA 4XIGS 5HG2A 4YWMA 1T3QA 1TU2B 1A70A 1HZBA 3MXPA 3CSFA 1WF9A 1XPOA 2LD9A 5I4DA 4WRDA 2W9NA 1ZW7A 1EFWA 4A3BB 4TRDA 3VTWA 1DOKA 3K7UC 2OF1A 1TVXA 2F4VQ 4BXXG 2YV5A 4A3LH 3MFGA 5FKAC 2W55A 4DAPA 2X38A 3M3JA 3D32A 4X3TA 1L4ZB 2AWTA 4F8CB 1DCZA 1HJPA 2UXBQ 1IUEA 3V6EB 5A2QE 1TIFA 1AZQA 3H15A 1W2BA 4YSXB 5M3FH 1WM3A 3JAML 3ZO5B 4M8MA 1X3EA 3Q3MC 2IPKD 3RLNA 2CH4W 3MZ5A 3QARA 2WB1B 2BWFA 4JQWC 3ZNZB 1E7ZA 2WYQA 5CHFA 3OTOQ 2M9VA 3BG3A 4MDKE 1R4PB 5FLMH 1HR0L 2KX0A 2X69A 1KL9A 1IBKL 2PW7A 1HR0W 3AB9A 4XYQA 3K5MA 5ELNA 3CCSA 3PRPB 3NPPA 2KC2A 2N49A 5J22A 1MFWA 2WNMA 2KKCA 2LFIA 5TSSA 2X6GA 1BVSA 1WVLA 3S1NH 3QIJA 4A6QA 4PMWA 1MJDA 3E9IA 4G57A 2N7EA 2RPVA 3G6JB 4YT0B 1J0GA 4HMJA 1Q1BA 4S3SA 5AEKB 1M4VA 5CBEE 2PKOA 3P4RB 3TP6A 3CCLA 4WIPA 3K58A 1TYGB 2JUOA 3ZNGC 3GB1A 3UI3A 3GTMB 4ZHPA 2BH8A 1NR4A 5DAUA 3L7ZC 2PE6B 3HVZA 3J7YW 1Q12A 1WXQA 4TKNA 2X6LA 1TWHB 3RMHA 3SDZA 4HTHA 3Q8EA 3RI7C 4DF7A 3ICEA 4DR3Q 2EZVA 3RYTA 1S40A 3VTUA 2E2HB 5I6WA 2ZVNA 4AS1A 3GE8C 2KDMA 4NJ7A 1KDCA 1IYVA 4DV6L 1WCMG 5KEEA 3QJYA 4LJOB 4GS3A 4JGHB 3KK7A 3I4NB 5M5WB 1UE5A 1XNRQ 1VQDA 1WYDA 1YHQA 1UH6A 1KNEA 4FXCA 3VH3B 2WIIB 1EL0A 3Q0AA 3KUPA 3S1MH 2UWQA 3PUVA 1EIGA 1KFYB 1TBEA 2WB1E 4TV3A 4MIUA 2KT7A 5JZEB 1NENB 3U7DA 2HDEA 3OHXC 3KYCD 4M0WA 4W9GA 4RCNA 1J5EQ 1YJ1A 1YN4A 2G4DB 3NQIA 4POGA 3FAHA 2WXRA 4BY1H 1C4AA 1H95A 4IALA 1EUVB 1WGGA 4DDGD 1O7IA 3ECIA 2L15A 3WAPA 4K6DA 2K0PA 5CORA 5LMNW 4EKUA 1D1IA 4A3CH 1TTNA 2VH1A 1B9RA 3TBIB 3GTOH 4EOYA 4N59A 3I4MB 4GN5A 1OXXK 4II3B 1KF6B 1RTNA 2MHJA 1Y8NB 1XT9B 2GRIA 2CWPA 4C2MH 2MP2B 4US8A 3IG3A 1SSNA 1KTKA 4N58A 2SNSA 4OO1I 2HTME 2R7DA 1FRRA 1SNMA 2LVOA 2EOTA 3VR8B 4BA1I 5C4JB 3KUZA 1EZ6A 1Y8OB 2N8NA 3HOXH 2Y5CA 4XYOA 3W5VB 3TRZA 4TQ0A 2F0JA 1KOTA 1CA5A 3PO3B 3J81E 2I0QA 1XLOA 1VQKA 2CQAA 2N9EB 4DKAC 1XMOL 2RA4A 5IYDH 5IYBH 4X57B 1JQ4A 2VZKB 1SE8A 2BA1A 5J1ZA 5EDSA 1WJUA 2ASQA 3QIAA 3CPWA 4MZ9A 3L08A 5M3MB 4A3IG 5KYLA 4YIJA 2M0XA 5EQ0A 4B0MA 1HTLD 3HK0A 3BK1A 4W9KA 5IOIA 5CV4A 4Q2JA 3KH0A 2XEWA 3WAOA 2K1BA 2EVBA 3QR8A 4JX1C 2A69D 4GKKL 1UEBA 3TZUA 2QEJC 4C56C 3IFDA 1PH4A 1AYFA 3E9SA 1FD7D 3EC8A 5H92C 3H7PA 1LTID 1R4MI 2KFJA 5ISRA 3QA8A 3TBLD 1E7PB 3RLFA 4F7ZA 3T53B 1HZCA 3JAMi 3Q6SA 3RZDB 2MFIA 1VQCA 4DAYA 1XPRA 2MJ3A 5KNDA 3FHWA 4BS9A 1NYRA 4LFBQ 2Q5WD 3IFWB 1Z5SB 3IHPC 3EGRA 4N9PA 1X54A 3VXWA 2KDEB 4G4KA 1E2WA 1FCCC 1R9TB 5IYDG 3WIMA 4C4VA 1QF6A 1Z2MA 4US9A 5C4JH 1KDAA 3DVNV 1G91A 3VRBB 1E1OA 5IGCA 5IY0A 2A5HA 3V62A 1TS2A 1B53A 3C1FA 2N9XA 1Q46A 2WAQB 3AE8B 4GB9A 5G5GA 5G3LD 4A3OA 2JWUA 4DHJB 3NEMA 2IO0B 2PQAB 1ZKHA 2ZJDA 1WFYA 5BYRA 4DV5L 1W6JA 5NUCA 3TP5A 3BS1A 1B4OA 1PH3A 2R93B 3MTNB 4FDBA 3HOYG 2A6HC 4M02A 3M3YH 2Y5BB 3KDFB 3N32A 3D0FA 1MHHE 3Q22A 1ZPSA 1O78A 4EVOA 2B63B 1YX5B 4K5XA 1NCVA 5DM63 2A8VA 5BR8L 3A9JA 2BWES 3HM3A 4CYEA 3QWNA 4K2LA 4A93B 2EXDA 5IT9L 4XQQA 1YX6B 2B8FA 3KW5B 2KVZA 2YU9B 1WTHA 4PT5A 4LFCL 2WXPA 3S2HB 3RZOB 3D8GA 2Y0SG 2HUGA 5FLXL 5CR3A 2F0QA 1KM7A 2NVUI 1HQMC 1QE6A 4OXPA 3E56A 3OAWA 4GMVA 4GOPC 1X55A 2WFWA 1MHXA 3JSVA 4YCVA 2O2VB 4FADA 1L0XB 1SEBD 1BKBA 2I1KA 4JOIA 3DVNU 2W82A 2F0EA 4KTAA 2VQFL 4OWXB 3T1HL 1LGRA 3TCAA 1DOLA 3VTVA 4LAAA 2WX0A 3FPUB 1NDDA 4JV5L 5C5LA 5E6JA 2JXXA 3ZNHB 2UU7A 2JYTA 4JI3L 4XE0A 4GDKB 4LFAL 5D3IB 1OTRB 1J7AA 1STHA 1LYLA 1YJ9A 4DR4L 1YHAA 3BZKA 3GTQB 3UINB 5CYUA 4HKQA 2RD0A 3S1NB 2J42A 4TSSA 5G5HA 4EQOA 1T0QC 1ZDVA 4PS8A 1SE4A 4IUNA 1Z6HA 4C3IB 1MVKA 3L54A 4HPPA 3M4YA 1CKNA 3ND8A 4H44C 4HJ5A 3HOWH 4KHZA 2DAJA 2KWVB 2CVRA 3GDEA 4XGAB 4G7HC 3I9V1 2ZT9C 3BIID 2NBFA 1X3PA 1R4MB 1NY4A 3ULJA 2A6HD 1DGJA 2ALYB 5HFYA 2AKWB 1SYBA 1IW7C 2CR5A 1YNJD 1T0SC 1WYGA 2XN9C 1B9MA 3S14H 4FBJB 1B44D 3AEAB
chains in the Genus database with same CATH topology
2NYZD 4KY5A 1K83B 1SYGA 1HFNA 2K04A 5JXVA 4EQNA 2WU5B 4A3MB 4ILWA 2KHSA 3CQZB 3PUWA 1I4PA 1ET9A 4B0EA 1AN8A 1QNKA 2BOSA 4P16A 3AE5B 1U4RA 2RDGA 4A3GB 1STBA 2LEKA 4TQ1A 1L6UA 4NW2A 3QOJA 3Q23A 2NB0A 4MN3A 4JWUC 4XDCA 5CV9A 1PYWD 5GXGB 2MPMA 1GHKA 1V8QA 2ZXRA 4H0LC 2WU2B 2PPBC 2AUKA 3C8YA 4RF1A 2SAKA 3NVYA 1TS4A 2DYMA 1CQFA 3QG1A 1L0VB 2JYOA 2AX5A 3ITPA 1E6EB 2JA5B 2EYFA 1CZPA 2SNMA 4ZHOA 4IKGA 2RDFA 1VF7A 4J8QA 2GA4B 4MH8A 2MH7A 5HGTA 3HUIA 1EYAA 5IODA 2B8GA 1L6VA 3D6WA 2JZPA 5AUIA 1SDFA 4A3KB 3SXHA 1N62A 3UI2A 4C3JB 2EXZA 2Z1CA 2VZKD 1IHZA 2BA0A 1ET6A 1HPCA 1N5XA 3VRAB 2NZ1D 1XTCD 1A3UA 3C3LA 4BWGB 4L23A 1OFFA 2NVXB 3PIO3 4Y7NB 3I8ZA 2ONQA 3CWIA 1PTOH 1F2RI 4ZYSA 2DBYA 5JVH3 1FEHA 4ZRZA 3O13A 4A3IB 2J0TD 2WINB 2W3SA 5IGBA 2SOBA 2E2IB 3NTIA 3GTKB 3BVMA 5FR3A 1QKZA 1KABA 2H89B 2B2YC 1HUMA 3VQIA 1CA6A 3GTPB 5CBAE 1TKWB 1C79A 3K5NA 2F0KA 3J7AV 4PMCA 2O5JC 2TSSA 3NSWA 3NVWA 1F9PA 3H6MA 5EPKA 1GUWA 3PZ8A 3AEFB 3BVGA 1EQVA 1FYCA 3NK9A 1N60A 5EBDA 3T13A 3N6RA 5KYIA 3AE1B 3OPOA 2A68C 3C2PA 4NDXA 3SFEB 2MGSA 1QLBB 3V96A 1S5BD 3NWTA 3LWEA 5C5MA 4ZRPA 5FK9C 4O1NA 2H88B 2FFKB 2F0HA 1SYFA 1Q8IA 3S2DB 1SNDA 2QILA 2XIWA 2RSNA 1JR0D 1JMLA 1NVID 3LXFA 1HQRD 4RH6A 1ZUD2 2DN8A 5JPMC 2BCOA 1EQTA 2PZUA 3DWQA 3TEYA 3GTGB 1OQQA 1DYQA 2LHEA 2PO4A 1XO3A 3SK5A 4AQ7A 3T56B 2M00A 2YEPF 3Q69A 2NTTA 5KGUA 3PUXA 4ID6A 2N7JA 2B2YA 2SEBD 2YEPB 5ELCA 3B2GA 2E2DC 4LK0M 4DNTB 1H9MA 3NXWA 2E75C 2PW5A 3VYSA 1PFBA 1RHPA 2BT6A 3GV6A 2Y0SB 3M7GA 4C7ZA 1SB3C 3I72A 1VZ8A 2AQ2B 1WWTA 2EJMA 5E3FA 2B2UA 4RKLA 1QOAA 3AU7A 2DWQA 3FVQA 2Z4IA 1VDZA 1KRHA 2EJGC 1Z7TA 2JXMB 4XTCS 1UAPA 3HRDD 1W6KA 5C3JB 3QB3A 3S16B 1B2TA 2AQ1B 3VR3A 2VB2X 4WORA 4CKEA 4FF2A 4Q0FA 1HUNA 2WQYB 2FJ2A 2PVOD 3R8BA 1SYEA 2D62A 3S17B 2WXJA 1QT9A 2LS01 5BYSA 1WTQA 3KQ4A 3BK2A 2XRSD 2F0UA 1SXTA 4KN7C 1ZXHA 5E4XA 2GI9A 4ZLTF 3P1MA 3OMGA 3VYUA 3SR1A 2NN6I 3W1SA 1UNSA 4CQNA 3NZ3A 5EBCA 1F2LA 5D7GA 1WD1A 1FD6A 3S9WA 5EE9A 1B50A 1IW7D 3GTLB 1I4HA 5BN3A 2XSCA 2KUMA 2EYLA 2N0SB 1FNWA 1EY5A 1TQOA 1G6ZA 4KX6B 2ZXPA 2BB6A 1TKGA 4J6HA 2VXWA 1WRIA 5A2QL 4CJ0B 1LTBD 4A3EB 4MACA 1H9RA 3LWUA 3KLSX 4OO1G 4K8IA 1ONLA 5DNFA 2WXHA 3ZYYX 1H9SA 1RTOA 1F2ZA 4BA2I 1U9RA 1NYQA 1HCZA 1K8MA 2WXKA 2PVGC 2XVSA 2G9HD 3TSSA 2NN6H 1G2TA 2WXPA 1GUTA 1EY4A 4RGOS 1ENFA 1BUIC 3IAS1 1C48A 1FXIA 1GAQB 4IUUA 1B1ZA 1V1PA 1GUOA 1K53A 1RKNA 1ZKOA 1LO5D 2K6AA 1JCKB 3I57A 3GP7A 4C80A 2K9XA 4R3DA 2L5TA 1CFMA 3K6OA 1D6EC 3RFZB 4EGVA 4DXFA 3GTJB 1AP0A 2WDQB 2QJLA 4XWWA 4RCOA 5HHDG 5C4XB 1LABA 3U9SA 1BMLC 4RKBA 2F03A 4IUVA 2Q8IB 1CI3M 4KY7A 2OHFA 2IGHA 4ZUIA 5I2YA 1STNA 1ZE3D 3J7AF 3ABVB 4N9TA 1PZID 4RFBA 1DOYA 2H1EA 3W5UB 1GHJA 2MUYA 2R3ZA 4CHTB 4CGYB 5CGKA 2CJOA 1SMYC 3X3NA 3T51B 2M56B 4REZA 4CBVA 4YTPB 2J52A 4A90A 1BF4A 3N52A 3PIP3 3W9CB 1IBXB 4Q5VA 2Z8LA 2N9LA 4A9AA 2KJXA 1V97A 2M0AA 2FE8A 2M2LA 3DUZA 3NWSA 1C8CA 1P7EA 3OWFA 2K5DA 2CU3A 4A3DB 4HCEA 1U4LA 2I07B 2KACA 2CW0D 2FMCA 4ULLA 1F9SA 4QMGA 2F0TA 3S15B 4JWSC 1E0BA 1EEID 4USAA 4KD3A 1A6XA 1OXVA 4RAUC 2BS3B 4FF4A 5T1IA 5LL6S 2QCPX 1HA6A 4NZLB 3W3AA 1PGBA 4BY7B 5T8IA 4R8NA 1HTPA 3URYA 2FMMA 2Q8RE 4F87A 2V4IB 2WXGA 1TY2A 2O2LD 3HEJA 3IFTA 1TR5A 2F0LA 4XQNA 3AE3B 4C3HG 3H94A 2OEDA 1LTGD 1JORA 1KDBA 2O4XA 4KKTA 1RFKA 1C4CA 1Q90A 2B76B 4L6TB 5C0XH 2NUCA 3AM9A 2KMMA 1AW7A 1C76A 5IGEA 5M5XB 2JQRB 1WCMB 4K2KA 3SR6A 1PUTA 4ARCA 2K28A 1ESFA 2FINB 4K6LA 2INNE 4H2AA 5KNCA 2R92B 2EY6A 5A35A 2L1BA 4U68A 1V1OA 1RDPD 2D2CC 4GDLB 4R9WA 5JEAJ 1STAA 1I7HA 3AE9B 3MXUA 3TUOA 4KY6A 2I46A 3I90A 1PZJD 1JWUD 1DJRD 3RD4A 5BN4A 4X3UA 2ZXOA 2F0DA 4IN3A 1FIQA 2JXTA 2QDBA 1MPEA 1SSOA 3FEWX 5DEHA 2NMQA 2V3PA 1EYCA 2L1AA 1E2ZA 3FC4A 1RJTA 2PCFB 3NP8A 3AE6B 1A2TA 2PYKA 2BS4B 1SJED 4IUQA 4KKUA 3K57A 3OWEB 3GS2A 2KCCA 2NN6G 3FILB 1EWYC 4LTUA 3RPFC 3C46A 1WTWA 1EWHA 3A8KE 5EKLA 3VYTA 3DEOA 1XYIA 3J80L 4OGQC 4OO1H 2WXFA 3D3RA 1XWEA 2C5CA 2K5PA 4LLGM 1PDQA 4F8MA 1QOGA 3MXNA 3EFXD 2PNRC 4O42A 4BBSB 2BBCA 4RGTA 4V190 3HKZB 4XT3B 4FXDA 2OXPA 4DK1A 3KLRA 1D4BA 3WDNA 3P4PB 2A68D 1RODA 5K5PA 1Y69U 5ELFA 1WGKA 4LMQD 4UDUC 2IJ0A 5ELDA 4ZAIA 2M19A 1ICWA 3EA6A 4C1NI 2JA6B 2IT1A 3ZGZA 4XDDA 1KNAA 2XWJB 1XLQA 2JA8B 1BUVT 1I3QB 1K51A 1VCIA 3HRZC 4ARIA 1DOMA 1BCPB 3V2TA 1EEFD 4KV6A 2EYMA 3FILA 1MD2D 5I9PA 3NUHB 1OO9B 2EY1A 3H8HA 3H09A 1JWBD 4FF3A 3PUZA 1KLUD 3K5LA 3J80E 1FMAD 1SE2A 1JALA 5FLXE 1YN5A 1H9KA 4KGSA 3K59A 3GQBA 3EROA 2BDOA 3FKIB 2R7ZB 1NAPA 2ZW1A 3AN1A 4IFDJ 3VYRA 3SEBA 3TP7A 1F2YA 1MSHA 1WTRA 3I3CA 1KH0A 1O7ZA 3T4AC 5KIXA 5C3EB 4KI0A 2E3TA 2MJ8A 4Z9CB 1NSNS 4HR7B 4EE2A 4HEA1 4RHSA 1C4PA 1PTOC 5EGTA 1VRAB 3WCQA 4LK1C 3OMCA 1CZWA 1SIJA 3AB5A 2A6EC 1ESRA 3IL8A 5CV7A 3CHBD 1PXUA 3MC0B 1STGA 2WXNA 2BYTA 2I2YA 3TN2A 1QQRA 3MHBA 4L1BA 1AZPA 1ZXTA 1GUGA 3TEZA 2PZTA 1SNQA 4ZKCB 3BDCA 2AWOA 3W2DA 3T3NA 3K5OA 3HOVB 2FHTA 5J39A 3AMUA 3B9JA 1BCPD 1DOXA 3MP9A 1QOFA 1NUCA 4OIJA 2K05A 1TIID 1TWGB 1LLRD 4DGZA 1RWSA 2LKVA 2EYOA 3MAQA 3J9CA 3S14B 4HAEA 3KWLA 3MHZA 3AMZA 3A54A 1FFUA 4AYBB 5IOCA 2KCNA 1EYDA 4NMZA 1LTAD 4PNYA 1QOBA 4IDIA 3IAM1 3VA7A 2DY7A 1XF5L 1PRTD 1MBYA 3R93A 2MJDA 4HKZE 4I7ZC 1RCVD 4CJ1B 4KN4C 4TMAB 1T6BX 1O7YA 1EOTA 2WLBA 3MWYW 4WWMA 4TQUS 4YTMB 1BXTA 1Y8PB 3E6ZX 3A8JE 2F0IA 1I4RA 5KNBA 1II3A 4RWSC 5ELBA 4MM3B 1ML0D 2OT2A 2XRQD 1MGSA 3FMCA 4ME5A 3D31A 1YNNC 2K22A 4FXKC 1X3QA 4V0BA 4NP5A 1GPXA 1LT4D 3TDQA 1TZOA 1HZ5A 1H9JA 1WD0A 3IKJA 4KKIA 3VR5A 2G9DA 1A2UA 2XNAC 4C3IG 4DQOC 5F2DA 2PW9A 1LTSD 1YQ3B 1CTMA 2HDMA 5JJZA 2HQEA 1HHVA 3I70A 3PO2B 4ZKBB 3SHLA 4KMUC 5CV8A 4PV1C 2JYEA 1QCBD 5EE1A 1AFPA 1FO4A 4G7ZC 5FO7B 1GOZA 1TWFB 1V1PB 2NVYB 1EY9A 2QIEB 1QJOA 2IL8A 3IXSA 2EDGA 3BDLA 1K50A 5EKKA 5M5YB 2ACZB 5D3DA 1XX8A 3L9AX 3A7LA 5EKIA 3DWGC 2B2WA 3FPPA 2LJIA 4CJ2C 3PMFA 1NI3A 1EZ8A 3OIQA 3KBXA 1TKYA 3E0JA 4HRSA 1I6HB 1PGAA 4DFAA 3HOXB 4IQZA 1FM0D 3NRZA 3P63A 1TKEA 5CV5A 3OW7A 1HRJA 4MHEA 4X3KA 4C2MB 3U4EG 5HURA 5M9OA 1L5PA 1R4QB 4KK7A 4NKLA 1V43A 1TWCB 3I73A 3FRPB 5C3XA 4IFDG 3AH7A 1C78A 2RQXA 5D65A 2MEKA 3HS0C 2WACA 3OIPA 4D2KA 1F9QA 4P2CB 1CM9A 4DXGA 1S5CD 3NE5B 3S1MB 2BB5A 3K0YA 2KWDA 3BYYB 2LMCB 2VNUD 1DM0B 5COYA 3LB8C 3OSOA 1MSGA 2Y3AA 2MP1A 2E2JB 2NWGA 4J1MA 2RBMA 1FRDA 2ICIA 3ZJTA 1BR9A 1OXSC 4QUCA 4ITKA 3CKIB 1XLNA 3TEWA 2IGDA 2B2TA 2BW2A 1JWMD 2N55A 2Z4HA 4R8IA 1VMCA 2AWNA 1DXMA 2F4IA 4QCLA 1F0ZA 1VJKA 2B2UC 2IW3A 4IZ8A 4HN7A 5C0XJ 1RF2D 4TKOB 1BO0A 1VMPA 3AEDB 2BTEA 4A8XC 5I6YA 2IX0A 4PMBA 3BWUD 3AEGB 3H91A 1GUSA 5EJWA 1XCQL 2AQ3B 1JWSD 4QUFA 5C0XI 4XT1B 2KEDA 3VR4A 3CRLC 1B3AA 3G7LA 4U673 3MXGA 5JEAH 1CJEA 4XWTA 4KGTA 4L8JA 2R6GA 2F0VA 2NVTB 3HOYB 1OXTA 3S1RB 2L52A 1TS5A 3CU7A 1F9RA 1E9MA 3HG9A 2RMMA 1BQQT 4KKSA 1DD2A 2CJNA 5IGGA 1OXUA 1WTVA 1AEXA 1GB1A 1PLFA 4XQJA 2DYOA 3HVDA 2EYHA 4YXDB 1YQ4B 4OW0A 5JOBA 4RA8A 1JQYD 2TMPA 4JE3B 1PFNA 3SE0A 1Q10A 1DZ1A 1GJXA 4FF1A 4OVZA 3T16A 2JP1A 4M8AA 4NAMA 2LFNA 2RSOA 4L63B 2EELA 3Q8FA 2O5IC 2WXQA 2PQEA 3CRKC 1QILA 3R2TA 2F0OA 2F3VA 2N88A 1N5WA 3MTSA 1OQRA 2DLBA 3ND9A 2WP8J 4FXGC 4RGNA 1CZGA 4WQMA 2EE1A 2IX1A 2EPBA 4OZCA 1ZYRC 5G3LF 5CC4A 1JOKA 3Q8AA 4HSVA 3P4QB 1ILQA 1PRTB 5BYQA 5MPOA 4FYDA 1SAPA 2J7ZA 4ABNA 5DM73 2AUJD 1TT2A 2WXLA 3Q8BA 4HROA 1A15A 5E1FA 1UWMA 1DOIA 4X3SA 3P4SB 1FNUA 2K5QA 2F0WA 1D1KA 1SNOA 3V05A 1MI2A 3KBGA 5ELEA 2BS2B 5EE0A 4HMIA 3D4WA 1GB4A 1GUNA 4E6IA 1C4QA 3I4LA 3BYTB 4WURA 2MHVA 5C3WA 5IT9E 1U4PA 1C77A 3IT6B 4A55A 2LMCA 3RUZA 3TP8A 3F2UA 1J7CA 3ZJUA 1M8AA 3PZ7A 3NS1A 2CHBD 1F77A 1O7LA 2R61A 2RKSA 1QWYA 2KVMA 1L4DB 5M3FB 3WOFA 1CK1A 4L2YA 4QIWB 1D5ZC 5LNK1 4KJNA 4RHRA 3P75A 1Z47A 2K01A 5IGFA 2NVQB 3NQTA 3AEEB 3V3XA 2EJFC 5FO8B 2VUMB 1SFOB 4WAFA 3WOEA 1EIHA 2F0FA 4OHJA 5K36H 1U4MA 3M4OB 1WTOA 1IKLA 1PZKD 4I65A 3L3OC 3DHQA 1ZXIA 1SYDA 2F0MA 1E2VA 2EY5A 4CKCA 3VA5A 3SFDB 3A8IE 2K3UA 1K8OA 1MI0A 4YSZB 4HEDA 1S5ED 1D5XC 2L9HA 2VB3X 2FUG1 3HOZB 2DNEA 2ZW0A 2L4NA 3J81L 1EM7A 2QSDA 1V8CA 1EY6A 2JE6I 5D14A 1ZYRD 3TMEA 3E5SA 2D5GA 2F1MA 1Q1EA 2V0GA 3N9YC 2WXMA 2L12A 1K52A 2MJEA 3EVQA 2A6ED 1FGBD 2JSVX 2L55A 3R3OA 3NVZA 2ENBA 1KAAA 1NEKB 4C3HB 1LT5D 2E74C 1SYCA 2HDLA 5AUKA 2I38A 2K32A 1ZEQX 3DMUA 2QKIC 3HZXA 3M3YB 4GZYC 1FNVA 3PV0A 1VF5C 3DWMA 4OZAA 2JX5A 1EWCA 2OEOA 4ZOHC 2E76C 3A7AB 4IFDI 2J53A 5FOBB 2ON8A 1SF0A 3KLSA 4F7XA 1ROEA 1S4ZA 3AE7B 5C4ZA 3HOUB 2G1EA 1PRTF 1LACA 1XLPA 1ILPA 4YWGG 1F2RC 2B39A 2LY7A 1G2SA 4C7YA 3D4RA 5FO9B 4YSYB 4N6EB 4JPSA 2INPE 1T5XD 3DM1A 1N61A 1FCLA 4XDXA 1DONA 2EYJA 4MT5A 3M7NA 3TEXA 1STYA 3X3MA 3A55A 1ACCA 2ICEC 4DNRB 2D9UA 1JRPA 1CHPD 4QB4A 1LT6D 2IWHA 4NAWB 2A73B 2PZWA 1EU3A 4RGMA 4DK0A 3AV8A 2L32A 4ODGA 2NTSA 5BN5A 3U9OA 4FP5D 1QOHA 2IDYA 1X32A 4WH4A 1HFGA 4DA2A 4PQXA 4KGRA 3H3VC 4K8JA 3ETRA 1PFDA 2RVLA 1PMRA 4F88A 3PO0A 4ZUJA 1D5MC 1IYUA 2V3NA 2KAJA 2BDNA 4B9XA 1FR3A 1I6VC 5C6AA 1IGCA 1WTPA 4RNAA 2F0GA 2PTLA 1HEZE 1Y1WB 4P6VF 1Q3LA 2B2VC 5I9OA 2L83A 3U52E 1TY0A 2IX3A 1SJHD 4DU9A 2KQ4X 5I2XA 3IAYA 1E0ZA 3DEPA 5KRUA 3H0GB 5BMIA 4KJOA 1SNPA 4ZQ3A 2SDFA 1UWXA 5EPLA 1HA5A 5IIFA 2JU6X 3BVZA 4XXEA 2WDRB 4C1NK 2B2TC 5C4HA 4IUPA 4JK1C 3ONAB 3L4PA 1IL8A 3U2SC 3K7AB 1VLBA 2KECA 4QF4A 4NJCA 1NR2A 1UUPA 1YJIA 1JROA 2WKDA 2EY2A 5K36G 1H9SB 1YNTE 1JC7A 3C1EA 2V4DA 5EE3A 2XWBB 1ZDXA 1A3VA 1HXYD 2F3WA 4WJWA 4FNFA 1TWAB 2KQ3A 1EFID 1I4GA 1EY7A 5JAVA 5BMGA 3LX0A 4OL7A 4HSPA 4G7OC 1JICA 1CQVA 1N63A 1PTOF 1Y1VB 2PMVA 5JPNC 3QOLA 3GTOB 4DN4M 3VR6A 2WDVB 2WXIA 3B2FA 2F0SA 1JW9D 3ZJVA 2B2VA 2JA7B 3P7JA 1G8ZD 4BY1B 2BE5C 3HGBA 2Y5PA 4K14A 2ID0A 5BMHA 3VR9B 3GV3A 3DXJC 1QNUA 2PLPA 5AFWA 3T3OA 2B2WC 1STEA 1J9OA 1BOSA 1JOOA 1FXAA 2W54A 4KD4A 3EQLC 1WSPA 2Q8TA 4BBRB 1I4QA 1UEAB 1TS3A 1B9NA 2HCCA 1WTXA 1Y56A 1T5EA 5T1GA 3KWVA 3HOWB 3ERQA 2WP9B 1CHQD 1YNND 4LJZC 4A3JB 2DY8A 2PIAA 4HJGE 3HP3A 4EQPA 5C2TB 1SMYD 2YYZA 5IGDA 3DWPA 2LHDA 1PDXA 3PUYA 3MEHA 2JEAI 1VZ7A 3MVVA 2QMTA 4GLSC 3MJ5A 3Q24A 4IURA 2WS3B 3AECB 5E4WC 3NBHA 5LHY1 1YJJA 1R7SA 3TZDA 2K03A 2CW0C 1J8IA 1EU4A 3NHHA 1SNCA 5LL6X 4WFN3 2PMZB 1LV9A 1ZOYB 5C44B 1ENCA 2L0CA 4IUTA 2QF7A 2JSOA 2WKCA 4KKJA 4K5VA 2FBWB 3VR2A 3MA2B 3A56A 4DAVA 1QG7A 1EY8A 3IT4B 3OOCA 4K5WA 4YTNB 2E6XA 4ZRQA 4A3FB 1KLGD 4H7BA 1JWAD 1IGDA 2KN4A 3R2IA 3QO2A 1BDOA 1G291 1VR9A 1LTRD 2EKIA 1I50B 4OIKA 2F0NA 2BE5D 3ZQ4A 2LGIA 1SE3A 2K7VA 1RYJA 4B08A 3P1HA 1C9FA 1VDVA 1JOQA 1JB3A 4RF0A 2L11A 5JEAG 3LNNA 1ZP0B 3D4DA 3FDTA 5CMDA 3AE4B 1JE4A 2WV6D 1E10A 1YNJC 1J7BA 1UGJA 2C9OA 3NUCA 1PTOD 5JVG3 1RD9D 1BBXC 2N9KA 1YMHE 5CV6A 4IOIE 4FVMA 2KEEA 3CIRB 1LT3D 3SK8A 3GO5A 3NTKA 3U7ZA 4C3JG 1SBBB 3S1QB 4CKBA 2W3RA 5EPJA 3KF8A 2JEBI 1PRTC 1L0YB 1XEEA 3SK6A 1PFMA 3SVMA 1S5FD 1XXGA 1F2MA 4ZK9B 3EJIA 1PTOB 4M1UB 2K5WA 1AWDA 1I4XA 3Q8CA 4KHVA 1HZ6A 1EY0A 3MFYA 4UAIA 1BCPC 1O80A 2H4OA 3EUB2 3NTHA 2EYPA 3GD7A 1S5DD 4B9WA 1YN3A 4HCSA 1LTTD 2RDHA 3JAME 2KA7A 1PGXA 1IKMA 1FFVA 1QB5D 5HI1A 5C0XG 2K33A 3AE2B 2WXOA 1A3TA 1CT1D 4H13C 4IFDH 2A74C 3BDOA 3P20A 2KOLA 2DNCA 4J3OD 4FO2A 1P7FA 3NBIA 1IBXA 1D2BA 1GXDC 3D6CA 2HCIA 3DWAA 3LYYA 1BNZA 2J4XA 4JBWA 1ENAA 3NVVA 1TJEA 2LUMA 3M85A 2A69C 2F0PA 1RM6C 5H8YE 3SK4A 3I91A 2D5DA 1XCTL 1BCPF 2GB1A 3P42A 1VZ6A 2IGGA 3AEBB 3BZDB 4OZBA 4XIGS 5HG2A 1T3QA 1TU2B 1A70A 3MXPA 5I4DA 4WRDA 4A3BB 4TRDA 1DOKA 2OF1A 1TVXA 3MFGA 5FKAC 2W55A 4DAPA 2X38A 4X3TA 1L4ZB 1DCZA 1IUEA 5A2QE 1AZQA 4YSXB 3JAML 2IPKD 3MZ5A 2WB1B 2M9VA 3BG3A 1R4PB 2X69A 2PW7A 3AB9A 4XYQA 3K5MA 3NPPA 5J22A 2WNMA 2LFIA 5TSSA 2X6GA 1WVLA 4A6QA 4PMWA 4G57A 2RPVA 3G6JB 4YT0B 4HMJA 1Q1BA 4S3SA 1M4VA 5CBEE 2PKOA 3P4RB 3TP6A 4WIPA 3K58A 1TYGB 3GB1A 3UI3A 3GTMB 4ZHPA 1NR4A 5DAUA 3L7ZC 3HVZA 3J7YW 1Q12A 1WXQA 2X6LA 1TWHB 3RMHA 3SDZA 4HTHA 3Q8EA 4DF7A 2EZVA 2E2HB 5I6WA 4AS1A 2KDMA 1KDCA 1IYVA 5KEEA 3QJYA 3KK7A 3I4NB 5M5WB 1KNEA 4FXCA 2WIIB 1EL0A 3Q0AA 3KUPA 3PUVA 1EIGA 1KFYB 4MIUA 1NENB 2HDEA 3OHXC 4M0WA 4RCNA 1YN4A 3FAHA 3NQIA 2WXRA 1C4AA 4IALA 4K6DA 2K0PA 5CORA 1D1IA 1B9RA 3TBIB 4N59A 3I4MB 1OXXK 1KF6B 1RTNA 1Y8NB 2GRIA 4US8A 1SSNA 1KTKA 4N58A 2SNSA 4OO1I 2HTME 1FRRA 1SNMA 2EOTA 3VR8B 4BA1I 5C4JB 1EZ6A 1Y8OB 2Y5CA 3W5VB 4XYOA 4TQ0A 2F0JA 1CA5A 3PO3B 3J81E 1XLOA 2CQAA 2RA4A 1JQ4A 2VZKB 2BA1A 5J1ZA 3QIAA 5M3MB 5KYLA 4YIJA 5EQ0A 4B0MA 1HTLD 3BK1A 5CV4A 4Q2JA 2K1BA 2EVBA 4JX1C 2A69D 3TZUA 2QEJC 4C56C 3IFDA 1AYFA 3E9SA 5H92C 1FD7D 1LTID 5ISRA 1E7PB 3RLFA 3T53B 3Q6SA 3RZDB 4DAYA 2MJ3A 2Q5WD 5KNDA 4BS9A 1NYRA 3EGRA 4N9PA 4G4KA 1E2WA 1FCCC 1R9TB 1QF6A 3VRBB 4US9A 1KDAA 1G91A 5IGCA 2A5HA 1TS2A 1B53A 3C1FA 2WAQB 3AE8B 5G5GA 5G3LD 2JWUA 5BYRA 1W6JA 5NUCA 3TP5A 3BS1A 1B4OA 2R93B 2A6HC 1MHHE 3Q22A 1ZPSA 1O78A 4EVOA 2B63B 4K5XA 1NCVA 5DM63 3QWNA 4K2LA 4A93B 5IT9L 4XQQA 2B8FA 2YU9B