2TSSA

Toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2tssA01
1LTAD 1BCPD 1CK1A 1AN8A 1LTGD 1LTTD 1SEBD 1CQVA 1PTOF 1XXGA 1HQRD 2XNAC 3BVGA 4O1NA 3DWQA 4DXGA 3MFGA 2AQ1B 1TY0A 3SEBA 5ELEA 1EEFD 1FD7D 4RCOA 3GP7A 1FNUA 5D3DA 1B44D 4RH6A 4RHRA 2NTSA 3MC0B 1ET6A 1LTID 2IJ0A 1FNWA 3R2TA 4L63B 1PZKD 1SXTA 1RCVD 1L0YB 5TSSA 1I4RA 1S5CD 4NZLB 1S5FD 1ESFA 1FNVA 1PTOB 5ELCA 2RDHA 1TS2A 1JQYD 1LO5D 3BVZA 1ET9A 3BVMA 3EFXD 1LT5D 3CHBD 1SE2A 5ELBA 1I4QA 4RHSA 2NTTA 1PTOC 5FKAC 1MD2D 1L0XB 1GOZA 1LLRD 1PRTF 1BCPF 1D5ZC 2RDGA 4OHJA 1STEA 1LTRD 1S5BD 3URYA 1PTOD 2R61A 1YN3A 1PZJD 3V05A 1CT1D 2O2LD 4TSSA 1JCKB 1YN5A 2CHBD 1EU3A 1I4XA 3R2IA 3R8BA 4K6LA 2QILA 1BXTA 1SJHD 2QEJC 1LTBD 1V1PB 1TS5A 4DXFA 1SBBB 2J4XA 1KTKA 1KLUD 1PRTB 1LT3D 2ICIA 4Z9CB 1QILA 2XN9C 1V1OA 1TY2A 4ZYSA 1DJRD 1PYWD 3BYYB 2XRQD 4RFBA 1LT4D 2AQ3B 3DWAA 1CHPD 4RGTA 1M4VA 1FGBD 2WV6D 1PRTC 1UUPA 1I4GA 1I4HA 3DWPA 1KLGD 4L6TB 1UNSA 3O13A 1I4PA 1PRTD 1EFID 3OWEB 2XRSD 3TSSA 1SE4A 2IPKD 1V1PA 1LT6D 3BZDB 1EEID 1HA5A 1JWMD 2G9HD 3EA6A 3W2DA 1EWCA 1LTSD 1D5MC 1F77A 5D3IB 1JWUD 1DYQA 1JR0D 1YN4A 1B1ZA 1EU4A 1HXYD 2Z8LA 1S5ED 1XTCD 4RGOS 3BYTB 1HTLD 1ENFA 2AQ2B 4UDUC 2TSSA 1BCPB 1D6EC 1G8ZD 1TS4A 3KLSX 1T5XD 5ELDA 4RGMA 4RGNA 4C56C 1S5DD 1PZID 1CHQD 1RDPD 5I4DA 1TS3A 1SE3A 1PTOH 1D5XC 2SEBD 1RF2D 1SJED 1JWSD 1BCPC 5ELFA 1RD9D 1AW7A 5FK9C 4BWGB
chains in the Genus database with same CATH superfamily
2K6QA 5M5WH 1IBKL 4ARIA 2A5UA 3NEMA 1LTTD 2IWHA 1MHXA 3VUWA 3Q23A 4DR1Q 2E2IH 2EYFA 2O2VB 2R2OA 2UU7A 1GUTA 2F0HA 4K7UA 2IY0B 2NB0A 3GDEA 3RLNA 4WJ4A 2WXLA 1SSNA 3W1YA 4R8IA 2B2YC 1PH3A 2BKFA 1HPCA 1VQ7A 2HCIA 2IDYA 5G5GA 2UXDL 1CTMA 2K5WA 2NN6H 1AZPA 1SE8A 1I6HH 2WP8J 1N60A 3HOWH 3S14H 3S1MB 1S5CD 4HCEA 4EGVA 3J81L 2AHOB 3A5UA 3DHQA 3DLLA 1VQPA 3M4YA 4OO1G 2R93G 2WXGA 3NG0A 4JWSC 2K8CA 1PFNA 2SNSA 2BQQA 4QL5A 3QCAA 1K8MA 1WXAA 2BYEA 4M02A 1K51A 4ITKA 4M8NA 1YNNC 5IGBA 2VS1A 5CV8A 1NVID 2BH2A 1A0IA 3RNAC 5T1GA 1ZKOA 2RCFA 4LUOA 3I2ZA 4A3IB 4FVMA 1X9NA 3OMCA 1PLFA 4G0NB 2YVCA 3M3YB 1PFSA 2EJMA 5JOBA 1UE1A 4OIKA 1PZJD 1TT2A 2ZM6L 2Q8IB 1HR0Q 3NTKA 1H9MA 3MVVA 1I4XA 1GD7A 4ZYNA 1FFUA 4AWJA 2CW0D 4QIWB 1GC6A 1F0ZA 2UXBL 1FCLA 2WFWA 2D9UA 3N6RA 4J6IA 3E56A 4LF9Q 4A3KG 3I72A 5H1SE 2B63G 3DCGA 3FKIB 5DNFA 3BIID 2EY1A 2MLBA 4YWKA 1TIID 2B2UA 5IYDG 2JWUA 1PRTB 3WCQA 3RFZB 2K8BA 2MQHA 1TR5A 2E2IB 1J19A 3J80i 4C2MB 4L5RC 3HOUH 2EMTA 2PW7A 4EEWA 1H9RA 4DR4Q 2IHFA 3DEPA 1YZ6A 3C46A 2DY8A 3BDLA 3WANA 2MW5A 4A3FH 5C4XH 5KIXA 4Y52H 4MHEA 3STBC 3K57A 4YSYB 1UUPA 4M8AA 3MXGA 2O6VA 2PMZB 2KWUB 1SIFA 3LGJA 1TU2B 3FEWX 1HJPA 2VB3X 2XVSA 4QB4A 5IGCA 4NXML 2Z6KC 4V0BA 4LF7Q 1IL8A 1UBIA 1V43A 2F0UA 5LMUL 4XGAB 1SSOA 2I5LX 1HTQA 1J5EL 2LVOA 4FJYA 2D11A 1HXYD 3KF6A 3FPUB 1Q86C 3I4NG 1TIFA 4LF8L 2I1JA 2CVRA 1TWAH 3QWNA 5H92C 3BYTB 2DAFA 5I9PA 1PH5A 2IX0A 1YNTE 1FXAA 5ELOA 2L8JA 1V81A 3ZTCA 3Q3MC 1XJVA 1QVGA 4JYAL 4WURA 5BMIA 1IXRA 2MHJA 2Z4HA 1AWDA 5I4DA 4BFRA 2PVOD 1CKNB 3UDIA 3NBIA 1SE3A 2WXQA 3ZO5B 1BOSA 1SFOB 1EY5A 2M17A 2RDBC 3OHXC 4EFOA 2LY7A 3RZDB 1LUZA 1IHZA 1AW7A 1A2TA 1BF4A 1BKBA 1PMRA 3G71A 4JI2L 1UGMA 4FF2A 2J0JA 4BY7B 5M3FG 2IYDB 3K5LA 4LMQD 3K5MA 5C0XH 4UP7A 4DXGA 1E3PA 3U50C 1P3QU 4HPPA 4KIKA 4B0EA 3SVMA 4FJVB 1YNND 4GKKL 4YWMA 3GP7A 4GLXA 1FRRA 3MC9A 2LVQA 2DZMA 1U9RA 2DUDA 2WB1G 4ARCA 4X6AH 4KTAA 4BZAA 4K7SA 4ZOHC 4QQBX 5IKCM 3QARA 2KMCA 4HDOA 1IYUA 2BT6A 4GDKA 2HQLA 3MXUA 1VCBA 5EPLA 4JV5L 1NDDA 1EY9A 2F0LA 2IBIB 2QEXA 3RPFC 2KUMA 5FLMH 2PE6B 3GTLH 1XMQQ 3AEVA 5J22A 5C4XB 3RNBC 3OAWA 5KYIA 4XQJA 3ZQ4A 4WJNA 2LXKA 1L1OB 1EY7A 3MP9A 1Y69U 2K04A 5DEHA 5C2TB 4LF6Q 4KD4A 1SE2A 2F0SA 1ZYRC 2MFIA 4C3HG 1GPXA 2N8NA 1N33L 4FXKC 5FKAC 1S72A 1WE6A 4M00A 1E7UA 1E24A 3DBLB 3A74A 1C4PA 1UZXB 3VR8B 1VCIA 3Q3OC 1IPGA 2DX5B 4BBNC 4FN2A 1WVLA 3GD7A 3ZNHB 4WAFA 4S3SA 4X3SA 2OTLA 1X3PA 1SYDA 1WF9A 4JWUC 2D3CA 4HIMA 2UUBL 1M94A 4L23A 3BG3A 2F0FA 1Z6HA 2EY2A 3A56A 2JU6X 4JBKA 2PYKA 1U4AA 1SBBB 5HGTA 4OVZA 4WJOA 1FMAD 2F0EA 3CMMB 3K81C 5IYCG 4GDLB 4GSWA 3VRBB 4EQPA 4U68A 2F0VA 4ID6A 4CDDC 2B2WC 2D5DA 3NUCA 2PQEA 4DK3C 2BCOA 2M8SA 4XIGS 3A33B 2KCCA 3P7JA 5IT9E 3U7DA 2VQEL 1T0YA 4A8XC 3HOVB 1M4VA 1OXSC 2L12A 1NY4A 4YSXB 2ON8A 5BN4A 2D62A 2F0TA 1HNXL 4IFDJ 4NPSA 3QK0A 1C4QA 1B53A 1UNSA 2D0PA 1ML0D 5BYSA 1C4CA 2V0GA 5AJ3L 4IQZA 4BA2I 3W2DA 4ASWC 5CBEE 1RTNA 2A74C 1D5MC 3CCLA 4GU2A 3CSFA 1PH1A 1HCZA 1WYWB 4XYCA 1SYFA 4CHTB 2HJ1A 2JA8H 1CSQA 4BXXH 4UP9A 3VR2A 5BO4B 4QUCA 2B8FA 2VY3A 2Q8TA 3RD4A 4MEMA 4DXAB 1QWYA 4JI3Q 3U7ZA 4WJPA 2ZJRA 4IFDI 3P63A 1NE3A 2BE5C 4PK1A 1DGSA 3TS2A 5C4ZA 2D10A 3GTOB 2Q2HA 1XLOA 4A3JB 4EOYA 4PS8A 4HCNB 1ZDVA 1JWSD 1JJGA 3CF6E 5HGQA 2VQFQ 3M4PA 3R3MA 4IUUA 1HR0W 2FUHB 3LNNA 4DV5Q 2NVXB 5GADC 2QDBA 2ZNVB 4MTNA 1SNPA 3ULLA 3BVGA 4KZ0A 1ZXHA 3EGRA 3P75A 4HMJA 1EL0A 3PO3B 1PGAA 2SAKA 3D6CA 5ELEA 4B3TL 1HRJA 2BDNA 3DBHB 4RH6A 2RSNA 1ZYRD 4WORA 4LFCQ 3C1FA 4ANVA 2XEWA 4DHZB 3OTOL 4IWPA 1LTID 5K36G 1OEYA 3VH4B 1S3SG 5GAGC 1PFBA 4YTPB 3U4EG 2QMTA 3L0OA 4YTNB 1UEAB 3ZGZA 1RJTA 1HTPA 2HE7A 1WR6E 3TN2A 2WKCA 4KK7A 2Z0EB 4KKTA 4IUQA 5D14A 4LF4Q 4YT0B 2RHQB 5IT9L 1E2VA 4TRDA 2L32A 2Z0DB 1IYJB 1T6BX 2LVPA 3A55A 2RDHA 5DCNA 5DM63 2F3IA 2BGFA 4C4VA 2NVTB 1VD2A 4DR2L 1WJJA 1L2NA 3VTUA 4GKJQ 1UELA 4ZKBB 2GBMA 3NVVA 1C3TA 1TWCH 2ZXOA 4HEDA 2J52A 1K83B 4QIWE 1CFMA 1FM0D 2KVRA 4BY1H 2KQSA 3F1ZA 5KHQA 3Q6SA 2GOWA 1IKMA 3Q8AA 1QZGA 1O7YA 1U4RA 5IY0A 2JA8B 3CRLC 3TDQA 1WTPA 3V2TA 2MJ3A 2KNBA 1UWMA 3SFEB 4BAXA 1YN5A 3GZNI 4X3UA 2KHWB 2PTLA 3A9KA 3HOZB 5E4XA 3W1SC 2LZ6A 1VF7A 1SROA 4I7ZC 2MRPA 2PI2E 4UPAA 1G6PA 3APFA 5AUIA 2UYZB 1M90C 3HP3A 3ER0A 2JZPA 2B2TC 5LL6S 3DBRB 4JI7Q 3H94A 4ULLA 1QZEA 3VTWA 2Q8RE 3HOXB 1WCMB 2AYOB 1TWFB 1C48A 3G48A 2PKOA 2PMZE 3MZ5A 3J80c 3PIP3 4IM2A 1I6VC 3M9BA 1TWGH 2LGIA 2RDFA 4Q5VA 4M0WB 3HRZC 2MPMA 5BR8L 4DUYQ 2MWSB 3NZUA 3V6CB 1IBXA 1GUOA 4LF5Q 1VZ7A 3I4MB 2VZAA 2BE5D 3DWAA 3NBHA 2H4OA 2NVUI 3VXWA 4I65A 2J0TD 3H3VC 5FOBB 3G7LA 5M3MB 4LNOA 3V96A 3ZYYX 2L0TA 5BYQA 1PH4A 1PHJA 3BK1A 5IIFA 2CH4W 1GNUA 5GROA 1WD0A 1PFMA 3UI2A 2H88B 1XPUA 3E0EA 1JWAD 2GVBA 4YIJA 3SK6A 1LTSD 1EM7A 4P1BC 1JC7A 1J8CA 1D8LA 4LW1A 2IX3A 4B3SQ 3U52E 3J7AV 2KX3A 4MH0E 4FLHA 3EUB2 2JX5A 2JQOA 2KANA 2IY5B 2MNAA 2B63H 4N6EB 4JPBW 5T1IA 2K1FA 3S15H 4DR6L 2KOXA 5JXVA 4A3GG 3OPOA 3KYDD 1WYDA 1F2ZA 3QJZA 1TWCB 1CHQD 2WQYB 1P98A 3Q2AC 2JJQA 2N49A 1EY6A 1X3EA 2ALYB 2N78A 4DV1Q 3NHHA 1LV9A 3QJYA 4C3IG 4NB3A 5ELFA 4HRSA 1XLPA 1MGSA 3K58A 4DV6Q 1J7BA 1HUNA 4IM0A 4XE0A 2LGSA 4XWTA 2M2LA 4N8X1 3QOLA 3LDZE 1STYA 3FDTA 5F2DA 4DHJB 2CWPA 2HDEA 4HIKA 2C7NB 3AEGB 1G6ZA 4DAMA 2EYOA 5EQ0A 2R93B 3OJ3A 2DYMA 2KYWA 4HPMB 1LACA 1R9TH 2M00A 1OGWA 4LUZA 1TT5B 5CV9A 3O65B 2D2QA 3NTIA 4X64L 4L63B 1MI2A 2EYLA 1TWGB 3DWMA 3RLFA 5A2QE 3M62B 1O7IA 2IHEA 1E8WA 3PLUA 1D1IA 4OZCA 2WXMA 2E2HB 1XT9B 4II3B 2O2VA 2GVAA 2LGDA 4YCVA 1ZKHA 4J3OD 1FJGL 1EOVA 3KBGA 4ZRJA 3PZDA 1QNUA 1IBLL 3K80C 3PZ8A 3CHBD 5M3FH 2WX0A 2K5DA 1MSGA 3A7LA 4DR1L 3ZJTA 1MD2D 1A70A 3VQIA 3DOWA 1YQBA 2OQKA 4OHJA 2ATWA 3VFKA 3AE4B 3QA8A 3MEHA 3PGEA 4A3KB 5LMNQ 2B63B 3WAOA 2NBFA 4TKNA 2OEDA 3PV0A 1L6UA 3IHPC 1OO9B 4I6PA 5IA7A 3LXFA 1WTRA 2HIXA 4DK0A 4HKQA 2QILA 1I94Q 3T1YQ 4MSMB 1LYLA 3BU2A 3MHSD 2KFJA 4DXFA 4P71A 4EX5A 2PZTA 3Q24A 2JSVX 4I6LB 4N9F4 1QG7A 3HVZA 1E7ZA 1AARA 1E0ZA 4NAMA 1Y8RC 2L9HA 4GNXC 1GHJA 1SYEA 3ICEA 4IFDG 1TQOA 1SB3C 1KHIA 1MFWA 4US8A 3TEWA 4C3HH 3P20A 2UUCQ 2DJGC 3C1EA 1N8RC 1JOKA 4NJ7A 1JE4A 4R4OA 4DNTB 1CA5A 2KVZA 3BS1A 3ZIMA 3I4NB 5CBAE 4IZ8A 2D3GA 1ZDXA 3W5OA 1HR0L 4JOIA 3DQVA 4NY0A 1I4PA 3AMZA 3EA6A 2IPKD 5CV6A 4FXCA 4X57B 2I38A 1WX7A 2ASBA 1LFDA 3CF5A 2EYPA 2RSUA 5A2QL 4K6DA 4LDTB 2I2YA 1EU4A 4N59A 1F1HA 2EELA 2Z8LA 4MGIE 3NJTA 4MSQB 2Y5CA 4LF9L 1ENFA 3JAMi 3D8GA 1ESRA 2NVQB 3K9PB 2PI2A 3K7AB 1E90A 2N1VA 3KLSX 4A3LG 2BOSA 4ANWA 2K5PA 5IYCH 3GTGB 2KDMA 3RN9C 1WTHA 3VYTA 3NHEB 5M5YB 1EQTA 3KUCB 1WX8A 2N9LA 3NVYA 4U673 3HM6X 2E3TA 1BUIC 1B3AA 3T3OA 2J0KA 4ZLTF 3CCJA 2JXTA 3VR9B 1AEXA 1V1QA 4DR4L 1WI0A 4RM8A 1SJED 5L83A 1VQ4A 1XLNA 1X3QA 1VQKA 2KJHB 3IVFA 3G6JB 3TS0A 2WB1B 3SXHA 1P7FA 3EHVA 3RMKC 2BH8A 4DHZE 4ZRZA 2OJWA 1CQVA 5JPMC 3HOVG 1EY0A 3MTNB 1WD1A 2K3UA 1WGRA 2ID0A 1SAPA 3K5NA 1X65A 4LF7L 3K5OA 3CXCA 2GRIA 4DQOC 3PVLA 2KJ6A 2AKWB 5D3DA 4OWXB 2N7EA 4DGZA 1IW7C 1N62A 1CKNA 3F2UA 4PZ8A 1TBEA 4NNJB 2EY6A 1MJCA 2ZJQA 3KWVA 2A19A 4HJ8A 4DR5Q 4URKA 1WMHB 2ZXRA 3ZJVA 4C3HB 2JSOA 3QQ8B 3FRPB 4IOIE 2BS3B 3I5JC 1VQNA 3CQZB 3G6EA 2RCNA 4LWCA 4NP5A 3S24A 3GTJH 2LUEA 1NI2A 1S4ZA 1FPYA 3BWUD 3AU7A 1KRHA 4XDXA 4HKZE 3SFDB 1CQFA 2QC8A 3CMAA 4MZ9A 3OSOA 2A69C 1NMFA 4B9XA 4A3JG 5CHVC 1Y1WH 5D65A 3DVGY 4HK2A 5KNDA 4IUVA 3DPDA 1B3QA 3EROA 1PH9A 3A7AB 5G3LD 1NTGA 2R61A 5ELNA 1L0WA 2KQ4X 5EJWA 4H7BA 4PYUA 1QF6A 2AL3A 4OZAA 2Q2IA 3BZKA 1Q10A 4A3DB 2Q2UA 2IT1A 5K36H 1WTVA 3GTKB 4ZRQA 2LFIA 5J18A 3AB9A 2DYOA 4CKEA 1L1OA 2RSOA 2F0GA 5FLXc 4RCNA 1XMOQ 1STHA 1C0AA 2K75A 2F0KA 3FP9A 4KI0A 2L83A 1L7YA 5IOIA 4HJ5A 4TQ0A 1IYFA 4JI4L 4JI8Q 2ICIA 4Z9CB 1QILA 1EYDA 1SMYC 1VQAA 2AWNA 4JBMA 1FXTB 3PO2G 1C78A 3PRMB 1BBWA 1VQGA 4LF6L 1NMGA 4O2DA 2WIIB 5I6YA 1LT4D 1EWHA 4K1RB 4DUZQ 2JA6G 4RGTA 3CC2A 4OW0A 1FGBD 5J39A 4ZRKA 3V62A 5I6WA 1KLGD 5KNBA 2K25A 1ILQA 3J81i 5HI1A 5EDSA 1VQ5A 4P7IA 4RKBA 3H7SA 5HKHA 2E2JB 2LGYA 4P2CB 1RIPA 4MELA 2ONQA 3GTQB 3R7RA 4PZ7A 1Y8NB 4C3JG 4GDLA 4AP4C 1V2YA 3M85A 2KLCA 1GUWA 4BBSG 3QO2A 2Z4IA 3DHHC 3HOZG 2VL6A 3GTMH 4A3BB 3Q3JA 4BBNF 1YIWA 2CJNA 3S1MH 3AN1A 3I70A 3SK4A 2VZKD 2BA1A 3EVQA 3SK5A 2QIEB 4G7HC 1IW7D 2MBHA 4E3CA 2K28A 3ZDTA 5J17A 1WOCA 4JI6Q 1M1KC 1S1QB 2J7QB 1SGHA 3NTHA 3HOXG 1WCMG 2G1EA 3Q3NC 1TKEA 4FO2A 4L1BA 2Q2TA 4A76A 4WFN3 1DGJA 2KACA 2REXA 5LMNW 1YHAA 2AX5A 1IKLA 5M9OA 3S9WA 3HK0A 4A3OA 4TQUS 4KMUC 1TY0A 4BKTA 2J0MA 1STNA 2JRHA 3W1BA 3M3YH 1N61A 1WFQA 4DKAC 3SDLC 2MGSA 4TMAB 1VQJA 2V9HA 4IPGA 2KCMA 2LUMA 4A6QA 1GO3E 2L4NA 3PUXA 2PJHA 2P5ZX 5EBCA 4LJZC 3CCVA 3NRZA 5DLQE 3GOEA 1Q3LA 1U4LA 2KCTA 1RFAA 4F7XA 1EYGA 1N9WA 4A3GH 3AU4A 4A3MG 2K22A 4NQKE 2YTYA 5E4WC 3KJPA 4POFA 4KV2A 2INDC 1QOHA 3FKIH 3SDZA 3N1YC 4DV4Q 3Q6BA 2BF8B 3LYYA 2A5HA 4FHJA 3K59A 2FXQA 2VQFL 3BVZA 3CRKC 4C2MH 2G45B 2KBNA 4WJWA 2CS4A 1N5XA 1NAPA 4ME3A 1VQFA 1A3VA 4M1UB 2EIFA 4X65L 1LXDA 5EE9A 3TP6A 2ZTDA 4P75A 3NVZA 4N58A 1I50B 1PTOD 2VNUD 2NYZD 1JROA 1WFYA 2PVGC 2HUGA 1K0RA 3GTMB 4AH6A 3DUZA 4PZ6A 4LFCL 3KJOA 4HJ9A 4B08A 2KTFA 5T8IA 1T9HA 2O4XA 5D94A 2YTXA 3NQIA 3PF5A 3AFQA 1T0QC 2BS2B 4YHHQ 1HEZE 5C3XA 2CHWA 2LMCB 3A4SC 3IG3A 3U30A 1K8AC 2MP2B 4JX1C 4LF4L 2UWQA 2OF1A 1S3OA 2Q5WD 3RNEC 3VH3B 3VA7A 1HH2P 2WACA 2BW2A 3ML8A 2CU1A 2WU2B 1PH8A 4LFAQ 1SFOH 4GKJL 1RTOA 3NUHB 1IBMQ 3AE9B 2FHTA 1VJKA 1EFWA 4JL9A 3RZDH 1E8ZA 4UAIA 4BVUC 1IP9A 4BY7H 2NS5A 1BBUA 1I4HA 1EIYB 1UAPA 2MSED 3I9V1 3OWEB 2UU9L 2XRSD 3L3OC 1FL0A 1ZP0B 1WM2A 2ZVNA 1N36Q 2N7JA 3P42A 4A3GB 1B9NA 2HJ8A 1N32Q 4A9AA 1JR0D 2VH2A 1LTLA 1E22A 2WHIA 1WJUA 1A15A 1X3FA 2R6GA 5CORA 3BINA 4P6VF 2CU3A 1X55A 2IY1B 4C3IB 3JAMc 3A8IE 4UDUC 1R4NI 4M0WA 5TR5A 2WWZA 1B9RA 2DGYA 2WB1E 4KHVA 4TKOB 4JI7L 1IZ6A 4P1CC 2R7DA 2KN5A 3BDOA 1KH0A 1ASYA 4IFDH 2IGDA 1WY8A 2SNMA 1YQ3B 5C5LA 4K2LA 2BS4B 1TVXA 2CJOA 2CKHB 1VS0A 2HDMA 4ICVA 1WGHA 1BCPC 2M0XA 3TP7A 3AE8B 3I8ZA 4NDXA 1MPEA 1XLQA 2LFNA 4LUVA 4GOPC 1AP0A 4PYZA 4XXEA 2R7FA 1WX9A 2NBUA 3ZKJC 2JYEA 3T51B 2VB2X 3A54A 2WGSA 4MJSB 3M7GA 3HRDD 2JE6I 2PLPA 3Q8CA 1B44D 3MEFA 4C1NI 1N34Q 2MJEA 4B3SL 3HVDA 4A3PA 4E74A 2QHOA 2YV5A 4YSZB 3HKSA 3T1HQ 2K32A 4BKSA 3PIO3 3ZRCA 1MSHA 3HOYG 2K14A 2C60A 4ODGA 4FULA 1ZE3D 4I7AA 4YY3Q 3M63B 3D4DA 3IFDA 1PDXA 1YJ1A 5AZHA 2ZW1A 4DV1L 2PPHA 2C35B 2YTVA 1YJ9A 4UHVA 3L17A 2FUG1 2L11A 4YWGG 4APVA 4DV6L 4DN4M 4ZRPA 3QX1A 1GUNA 3IL8A 4KLKA 1XTDA 2B2VC 3HOVH 2D2CC 4L5QA 3N32A 1L0XB 1G2SA 1PVOA 1ACCA 2W3RA 4GXBA 3TEYA 4OX9Q 1KL9A 2EOTA 1H4RA 4NQLB 2O2LD 4R9WA 2H89B 4TSSA 3P4PB 1MG4A 4R3DA 1QNKA 4HLEA 3ZJUA 1OXTA 4MIUA 4FJZA 1EIFA 3MTSA 1C1YB 3L10B 3W5UB 4DK1A 2F0OA 4IJHA 3OG5A 1B70B 1CKMA 1F9QA 3G4SA 2JXMB 1WIAA 2HQEA 3VYSA 3H6NA 1JICA 4RG1A 2B76B 5GMVA 4AQYQ 1XD3B 4NKLA 3GTOH 2INNE 1E2ZA 4A3JH 1RAXA 3JYUA 2JA5G 3N30A 2KMMA 1XPRA 1QOGA 4RF0A 2ZJPA 2JK8A 3T3NA 1PRTC 2NVXH 5GAEC 4ZAIA 2KDFB 5LMNL 4XTCS 3STBD 3PO3H 4XT1B 2JF5A 4DAYB 1SE4A 4XQNA 1JMLA 1NUCA 2XK5B 2FNJB 3ETRA 4NPNA 4WWOA 1T0RC 4GOCA 1F77A 2JYOA 4QMGA 1EO6A 4X62Q 2L1AA 3Q3FA 4W9HA 3RI7C 4BOSC 1XO3A 1AE3A 1I94L 3J80L 3W9CB 4Q2JA 4A3DG 1A3TA 2KHIA 2A8VA 1I5FA 4HCSA 2NN6I 4FYDA 1ZEQX 2PNRC 3RUZA 1HZ6A 3ZNZB 4GS3A 4JBJA 1U4MA 4I6NB 1S5DD 2CFMA 1GG3A 2KX0A 2VH1A 1RLFA 1Y14B 1TS3A 1P9DU 3E3XA 3GV3A 3T8MA 3EN2A 2F4VL 3C19A 3BDCA 2UUCL 5EBDA 3WAPA 2JA6H 5C4JB 2NVTH 3MXNB 3I3CA 5FK9C 1AFPA 1V86A 4JI0Q 3H9DA 4W9DA 1HE8A 4R1JA 1CK1A 5G3LF 3DHGC 4O1NA 1K83H 3CWIA 1QOAA 4IKGA 3MFGA 1A8VA 4FDBA 3S17B 3GZNB 1EEFD 1JOQA 1MHHE 1TZOA 4XZ4A 4HR7B 1YOVB 3AEBB 3J7AF 4B0MA 2BWFA 1HZCA 2JP1A 3S2DH 4AJYB 2KDEB 1XNRQ 4G7ZC 5E6JA 1NENB 2MQJA 3HOZH 4KGSA 2X38A 2N55A 2JT4B 2JRIB 1B7YB 4CJ1B 3CD6A 5AZGA 3AEDB 2DNEA 4US9A 4A75A 2L15A 2RGFA 3IT6B 5KNCA 4HJ7A 4BBRG 4JK1C 5IWAQ 1BQQT 4A3BG 1JORA 2K9XA 1EYCA 4H44C 1C77A 5ELCA 5JHAA 2G4DB 2I5MX 2WXKA 3HOXH 2LSSA 1WCMH 1TWFH 3VR4A 1LO5D 3FVQA 2OHFA 4H2AA 3KWLA 4BA1I 4FF1A 1MJDA 4ZUIA 2NCNA 4XDCA 2JEBI 2E5LQ 1J7CA 1I4QA 3UDFA 3PQIA 1TWHB 3I4MH 2KKCA 2M0AA 4XDDA 2UXCQ 3DVGX 5G55A 1RRBA 3LWUA 5M3MH 1XCTL 1YJJA 4DV2Q 3V05A 2WLBA 4DK5A 3DM3A 4MN3A 1PV4A 1CI3M 5IYBH 1IBKQ 1V80A 3I56A 4WJ3M 1Z9FA 1WMHA 2FE8A 5C23A 5IP9G 1CZWA 1MVKA 4LLGM 3K9OB 1UD7A 4HJAA 4P16A 1H9SB 1MHWC 2Y0SG 3H7PB 4EZLA 5ISRA 4R4QA 1XCQL 4PS7A 4IN3A 1SJHD 5HG2A 4DV3Q 3PO2B 4A3MH 4DR5L 3Q8FA 4K8JA 5IGDA 3APDA 2WXRA 2GBNA 3R66C 1WR1A 5DPWA 3ND8A 2JA6B 5EE1A 1B9MA 3UDXA 1C79A 4PMWA 3AE5B 4W9JA 3JSVB 4PMBA 4FP5D 1KD1C 2XN9C 4DPGA 4XQQA 1YIJA 1WXSA 1ZXIA 1V1OA 1V6EA 4ZYSA 3BYYB 1ENAA 5C3EG 4ZRIA 3SHQA 3VR6A 1SN8A 1JE5A 2W82A 3M7NA 3CIRB 4C3JB 3IAS1 3S2DB 1WZ3A 2PZWA 4G11A 2HD5B 2RF4A 4BBSB 1UWXA 4MT5A 4R8NA 4TUUA 4JCVE 2ASQA 1EEID 2A6EC 3L13A 2F0JA 1EWCA 4H02A 2R93H 1V5OA 3J7YW 2F1MA 4OO1H 2LXJA 3H09A 2PEAA 2PW9A 2WDTB 1HNWL 1S5ED 3ND9A 5CV5A 5EKIA 2V1YA 3GS2A 1HTLD 2G9DA 3JC66 5HY6A 3X3MA 4HPLB 4W9LA 1HNZQ 2QJLA 4KN4C 2CKZB 4RGMA 5ELDA 3KBXA 1XMOL 1Q1BA 1W2BA 3EQLC 1A62A 2IO3B 2B29A 4JI8L 2A6HC 1WTXA 4QCLA 2FCMA 4IG7B 4JBWA 5JVG3 2E2HH 2L05A 2SEBD 3H3VI 4KSKC 1ZXTA 4TQ1A 3OIPA 3QC8B 2B2YA 4DUZL 3B0AA 4B3MQ 3VR5A 1KOTA 1ZGUB 1V9PA 2DLBA 4DR7Q 1SEBD 1PTOF 2GN5A 3I7FA 1A2UA 4KX6B 5GXGB 2PNHA 1P7EA 3S1RH 1OTCA 3E9IA 3F8TA 3I4LA 4A3MB 3TRZA 2KO3A 3B1LX 3TMPB 5C1ZA 2E74C 4A3KH 3CC7A 2AWOA 2NTSA 4OWTB 5G5HA 4KN7C 4DV7Q 4LTUA 1A5RA 2ZNVC 3ULPA 2OXPA 4KDIC 5KRUA 5IYDH 4ICUA 2IX1A 3QAQA 1FNWA 4NXMQ 1PZKD 1LABA 3CMEA 5AEKB 1EIHA 5JHBA 1J5EQ 4PV1C 1S5FD 5CHWA 4GNXB 4NXNQ 4M01A 1F2LA 4HIOA 1IUEA 1Y56A 5JPNC 3B9JA 5HFYA 2RPQA 3KLWA 2WXJA 2A1AA 2DZJA 3AECB 1GUSA 2PO4A 4MTKA 4E71A 2ZXPA 2JVCA 4H0LC 2RQXA 2DHZA 4GN5A 1KRSA 2K1BA 4P74A 4G57A 1YJIA 3HM3A 4MGZE 4YL8A 1YD8U 4G3XB 1SNCA 1KFYB 3I4NH 2K33A 4RAUC 5DPTA 2ZJDA 2AMCB 1K3BC 3DVNV 2B3GA 5JAVA 3X0WA 1QUQB 3SU8X 1DOLA 3BZCA 1B2TA 1OXVA 5C3WA 2WXFA 4OL7A 4YTMB 4IWQA 4GLVB 4F87A 2F3VA 2KC1A 2D3AA 2CWAA 4WQMA 2NVQH 2KMAA 2A6ED 3K7AH 1NYRA 4RNAA 4GIVA 2CQAA 3KF8B 3GTGH 4B9WA 2JEAI 5M5YH 2DNCA 5CGKA 4S0RA 3HOWG 3MJ5A 2Z6KA 1HZ9A 1D2BA 3S1RB 2EXDA 4JV5Q 3U9SA 4Y7NB 1BMLC 4DNRB 3ZUNA 1HUMA 1N6ZA 1VQDA 4GLAC 1HHVA 4FA6A 2L55A 2A6HD 4KZCA 3F2DA 2FAZA 2B2UC 2V4DA 2VZKB 3MFYA 1K8RB 2GA4B 4AYBG 3AE2B 3VUXA 2K01A 1TYGB 5FLXL 2LMCA 1ISNA 2MP2A 1O7LA 2KECA 1BDOA 3NPPA 5JEAJ 1N33Q 5BN5A 1P8LA 4A90A 1G6JA 3K8AA 2QSDA 3QG1A 3J7ZC 1XX8A 2Y3AA 1X32A 2X6LA 4KVGB 5C44B 1STAA 3U4VA 2Z9HA 2NVYB 2RVLA 1YX6B 4CDFC 4LK0M 2AUKA 1WYGA 1D6EC 1RM6C 3RZFA 4KGRA 4RGNA 4FBJB 4GZYC 1JALA 1AYFA 4KKUA 2FINB 1V8QA 2UUBQ 3PHXB 2R92B 4X3KA 3ULJA 4LFAL 3J9CA 2K05A 3CQZH 3S1QH 3UQAA 1Q1OA 1IBML 1TKGA 1EQQA 2YEPF 3UGBB 1RD9D 1NBWA 3H0GB 2JPHA 3ITPA 2N9XA 4QGUA 2DAJA 4LNQA 1WXMA 1GUGA 1SNQA 3AYHB 1HQRD 1SNOA 3HOUG 4W9IA 2QKIC 1DZ1A 2LI5A 2RD0A 1CM9A 3HOYB 1GHKA 1NYQA 4EQNA 3GV6A 5FJ8G 1HA6A 1EIGA 1N36L 2YU9B 1ZW7A 2NR2A 4X3TA 4BS9A 5M5XB 4PS3A 3HS0C 3W5VB 1N32L 4K5WA 1WE7A 4RHRA 3QB3A 4DV0Q 1HNXQ 1VQBA 4A3DH 1GB4A 3I90A 3MC0B 3GTKH 1EF5A 3LJ3A 2LS01 1SXTA 1DD2A 1E6EB 1E5WA 3UE1A 1IGDA 2B39A 1SMXA 1XF5L 1II3A 2CHZA 4MNOA 2L76A 1J9OA 3CCEA 3AULA 2F0NA 2N0SB 3D31A 1FNVA 2VUMB 2CHXA 3H1UA 4G7OC 1PTOB 4JI5Q 2C7MB 2C9WB 2L7RA 2N1WA 3ALBA 3TEHB 1TS2A 1V8CA 4DAVA 4UY8C 4MJSA 3OYYA 3CCMA 1DOXA 3R3OA 4TV3A 1PGXA 3TEXA 4ZHOA 2HHHQ 3E9HA 4JI1Q 5ELBA 4RWSC 4AQ7A 2A73B 2WYQA 2YLMA 3WAMA 4XWWA 2HTHA 1BCPF 1D5ZC 3I3TB 3VR3A 1LTRD 1Z47A 3CP0A 2LHEA 4JQWC 3NE5B 2KHSA 4M8MA 5BYRA 1M8AA 2I1KA 1QLBB 1K73C 1N34L 1EU3A 1F9PA 2KTRB 3R2IA 3R8BA 1KF6B 2WAQG 3T1HL 2E2JH 1X1MA 2B2WA 1K8OA 2K6AA 4OELB 5EPKA 5FO7B 3GTQH 2EJGC 3SE0A 1KNEA 4EQOA 3S2HB 2ZT9C 3KVFB 1VQ6A 1BXTA 4AJWA 2SDFA 4KSLC 4YY3L 3RR5A 3S1QB 2JA5B 1IYVA 2D0OA 4PNYA 3PRPB 4RMAA 4CHKA 5KHOA 1XPOA 4A3BH 5IE8A 3SR1A 2JN4A 2K5VA 2RKSA 4EZKA 1FRDA 1LQBA 3TZUA 3KOJA 2WXOA 3FC4A 4BKGA 4DDID 1XWEA 4K7WA 3I4OA 2HD3A 2N9PC 3UIPB 3PO0A 1V9JA 1P0RA 3UI3A 4AIMA 3EFUA 1BO0A 3M3JA 1X54A 3KUZA 5FLMG 1KQSA 2O6VD 3RZWC 4OX9L 4EKUA 4DR2Q 3Q8EA 2O5JC 5JH5C 1UE6A 3PT2B 5IP9H 4IUNA 1AH9A 3PV1A 1J0GA 1RKNA 3TP8A 1MIUA 4ME5A 1YN4A 5D3IB 3KYHC 1K9MC 3PMFA 3PSEB 2VW9A 3RMHA 4P73A 1XMQL 3GB1A 2AQ2B 3T53B 1WJ4A 1B8AA 3HUIA 1TJEA 1NJIC 4K3BA 2F0MA 1T5XD 2MO1A 1PQSA 1Y1VB 3IXSA 2YYZA 2C5LC 3VDYA 4AQYL 3T4AC 1EWIA 2E75C 1BUVT 2F0PA 4L8JA 4DAYA 1WRDB 2XK5A 1IGCA 1PDQA 2FCQA 1C76A 2Z6BA 2QCPX 3EFCA 3SD5A 1AN8A 2M9VA 4E6IA 1KDAA 2F0IA 3M4OB 1EZ6A 3JAML 5FO8B 3OLMD 5IOCA 3L4PA 4KY6A 4NW2A 4FXDA 4F7ZA 2L1BA 1I50H 2EDGA 2ZTCA 2KWDA 1QE6A 4OGQC 4X62L 4BBRB 3AU5A 2ZEQA 4CYEA 2K52A 4DFAA 4FF3A 2K0PA 4XYOA 3QOJA 3F2BA 1VQHA 1HFNA 1PXUA 2KD0A 2IJ0A 2B3AA 4ANXA 1O78A 2YEPB 3DEOA 3CCRA 1RCVD 4POGA 1Q8KA 3N1ZC 1MBYA 4K14A 3AV8A 3MXNA 2CQOA 3MHBA 1QQRA 3R93A 3N1XC 2KZRA 1GJZA 2V3SA 5EPJA 2N7DA 5J2RA 1CMXB 3NOBA 3CPFA 4DR6Q 1QVCA 1FEHA 2KFKB 1E8XA 3APCA 3FILB 5IP4D 2W9NA 2CCZA 2V3PA 1RYJA 3ERQA 2ACZB 5A35A 4O0AA 5D2MB 3W1SA 2NTTA 3BJUA 3NXWA 4IM3A 2KA7A 2Y0SB 2A69D 4TVAB 4KGTA 2NZ1D 3TBLD 2RDGA 1C7YA 3PHWB 2B2TA 5E6OA 5LXHA 5COYA 2R7ZG 3BK2A 1NI3A 1GC7A 2L5TA 4JI3L 3VHTC 3NVWA 3PGZA 4D2KA 1XNRL 4LNNA 2CH4A 4W9KA 2O5IC 2EYJA 3UE0A 4R4CA 1R4NB 2PZUA 3KDFB 1B4OA 3J81j 2XGTA 2KAJA 2ZCCA 4DU9A 3F2CA 2QEJC 4L2YA 4C3IH 2E8GA 2K4KA 5C3EB 2KOLA 5IWAL 2KHJA 4OVUA 5JJLA 3I55A 3ZNGC 3P4RB 2EYHA 3GO5A 3N20C 5KGUA 4DV5L 4UP8A 4DA2A 1KIXA 1FCCC 1KLVA 2QGQA 5I2YA 1GM5A 2HCCA 2V1CC 3VYRA 5FR6A 3VDZA 4GOPB 2IGGA 4RFBA 2BTEA 2XRQD 3VVWB 2E5LL 1SMYD 1PH7A 1QVFA 2KLGA 5JEAG 1V97A 4ANUA 1CHPD 4X66Q 2UXCL 1Z7TA 3ONSA 1H9SA 2RPVA 4KKSA 2JXXA 4DV2L 2JY6A 1CKOA 4QUFA 2JUOA 2ICEC 3RZOB 1I4GA 2VRRB 4L6TB 1G51A 4JGHB 2M56B 2L00B 1DONA 4HEA1 3PUVA 1GVPA 3KK7A 1SE9A 3ZRFA 1HZAA 2LHDA 1DOKA 3TCAA 3U2SC 1P16A 4IURA 1JWMD 4IUTA 4WWNA 2NBWB 4BY1G 2BYVE 2DYBA 1YNJC 1WWTA 4HJKA 1TGZB 3JSVA 3AE6B 4RA8A 4FXGC 2G3QB 4DV3L 2L0FA 1EY4A 3HFZB 1L5PA 2EXZA 2MJ8A 1YJNA 2R3ZA 1H95A 2OTJA 4HJGE 3NZ3A 2F03A 3QWZB 4FADA 1VQ8A 3RUIB 3EIVA 2C5CA 4HTHA 1RL2A 1Z2MA 4USAA 5E1FA 1A63A 4NMZA 1Q12A 3GE8C 3P4QB 2QDLA 1KNAA 3D32A 1GUAB 3WIMA 4FNFA 1OQYA 1WI5A 1D7QA 2G4SA 2K7VA 2K6DB 1N5WA 2BBCA 1KDBA 2FIDA 3CSTA 5JVH3 2K03A 3MAQA 1VQCA 2EYMA 2NZOA 3KLRA 1T0SC 2NBVB 1KAAA 3AEEB 2MCNB 1FNUA 3UINB 5IGFA 3E0JA 1NSNS 2MO0A 1DM0B 3HG9A 3KUPA 2XTIA 1EWYC 4REZA 4S17A 2ZVOA 2MBOA 2WKDA 4Q0FA 4AS1A 2KQ7A 5TSSA 2I46A 4W9GA 1HNZL 1K28A 5C44G 2IO0B 2IO2B 4ZQ3A 2KK8A 4DUYL 1NCVA 4P72A 3Q22A 4LF5L 1XQQA 2HTME 1KM7A 3HKZB 3RN5A 5DM73 2LKVA 4DNIA 1MI0A 1PA6A 1R4MI 1V5TA 2MA9B 3L7ZC 1SLJA 2V4LA 2WXHA 1GKHA 3A9JB 4B3ML 4KHPQ 2KDIA 2NPTB 3VUYA 2R92G 5M5WB 4KKIA 1LT5D 3CCSA 3Q69A 4DR7L 4MGYE 5CV4A 1UF0A 3H0GG 5CYUA 4C7YA 2N4FA 1JB3A 3C0RB 5FJ8H 1EQVA 1S5BD 3LWEA 3W3AA 3URYA 2PIAA 1VQOA 3PZ7A 3P4SB 1JCKB 3PS6A 3P2BA 4DDGD 4DV7L 4A3LH 4AUQC 5JJZA 2X69A 1CA6A 3CCQA 4GNXA 1FXIA 1VZ8A 4WJQA 1IBLQ 2BKRB 2QDFA 4CJ2C 1I6HB 4A4IA 1CJEA 1R4PB 3J80E 3D3RA 3HOWB 3S14B 1G91A 2WP9B 1JQ4A 4XX5A 2EZVA 2PQAB 4IUMB 2ES2A 4CDEC 3AE3B 4OIJA 4OXPA 4WRDA 2Z59B 4NXNL 5EE0A 4HVBA 3LX0A 5LHY1 2NZHA 4LFBQ 1FGUA 1JRPA 1YNJD 2BB5A 3W1GA 5AUKA 1OXUA 2VUMG 3I73A 1C9OA 1G291 2UUAQ 4AYBB 1I35A 3H15A 5K5PA 1GJXA 4IUPA 1ROEA 1VQLA 1WSPA 3AH7A 4K2KA 1QUQA 4RKLA 5GAHC 3BY4B 1NEKB 5C4JH 4QJFA 5EE3A 2AQ3B 4GN1A 1WGDA 4JIOU 1OQQA 1OTRB 3AEAB 4MM3B 1R4QB 2J42A 4CQNA 2IGHA 3TP5A 1KAWA 1WGKA 3WWVA 2FMMA 3OWFA 1K50A 2KXJA 1YI2A 2KJRA 2ZW0A 4KJOA 4G4KA 4J15A 3S17H 5L37A 1Y8PB 3E6ZX 3ML9A 2G9HD 2R2QA 2FIFA 5LNK1 3KF8A 1HFGA 1Q7YC 3IFTA 3X23A 1E1OA 3ONAB 3C2PA 1WRIA 4RGOS 4F8MA 1B50A 3Q8DA 2BB6A 3DHIC 4HROA 3V3XA 3WDNA 3PUYA 2K39A 1PFDA 4JOIC 2N9EB 4DBGA 4C56C 4ABNA 1DOIA 1E8YA 3RN2A 3C8YA 4LK1C 1ZPSA 3HOUB 3RULA 1D5XC 3VRAB 3EC8A 1WGYA 4FHKA 2PCFB 5DAUA 1QOBA 1QOFA 4IO9A 3TQYA 1JW9D 3L2PA 4R4TA 3PUWA 4A3FB 3J81c 3H3VH 4QF4A 5IP7G 1BCPD 4JI4Q 1XXGA 2BVCA 2A68C 4YXDB 4K81A 2MBEA 4B3RQ 2M4NA 1Q82C 1TWHH 2JZZA 3KH0A 4RM9A 3K0XA 1MKHA 1SYCA 1E10A 4K0KQ 2INCC 1D1KA 3T1YL 4RCOA 3EECA 5AFWA 2E6XA 3A4RA 4EUTA 1QKZA 1ZOYB 3AQQA 2W3SA 4F8CB 1TWAB 3CC4A 1FIQA 3U58A 3CKIB 4GLSC 1YEZA 3QIJA 1A3UA 1UWVA 4L5TA 4A93G 1UBQA 2DZIA 3V61A 1DXMA 3PO2H 1I4RA 1F9JA 3AE7B 3DVNU 2QCZA 1QB5D 4CO7A 3RNCC 1ESFA 1YNXA 3A8JE 2Y0SE 5CR3A 3B2FA 3T56B 5E6NA 3HZXA 2AEHA 4LNFA 2DZKA 1Y1VG 2KWCA 2W54A 3NY5A 1CSPA 3ZJYC 3S1NH 1H9KA 3NELA 3EFXD 1VQMA 2C7HA 2FCNA 3ZXRA 2KCNA 2WX1A 2WAQB 3PSIA 3T16A 4DR3Q 4NAWB 1ZUD2 2MEKA 3R7QA 1K3RA 3KQ4A 4C3JH 1BT0A 3PLVA 1STEA 1JWBD 1L4DB 1FD6A 4BBSH 4GMVA 2J7ZA 1XNQQ 3RNUA 3P1HA 2W55A 2WINB 3QIAA 3KYCD 2CHBD 1DCZA 2K5QA 3IT4B 2C9OA 3CW2C 3L9AX 4DV0L 1WH3A 3N52A 1I42A 2B8GA 1F2YA 5EGTA 3ZVVA 1EZ8A 2WDQB 1SNDA 3A1QB 3PTFC 4K3CA 2E76C 3S16H 2J53A 1C9FA 1JOOA 4JC0A 1EUJA 1V1PB 1L4ZB 1TS5A 1BVSA 3UDGA 4WIPA 1CZPA 2EE1A 3VAWA 1KTKA 2LRWA 3NS8A 3GTLB 4JI5L 1WTWA 2MX2A 1W6KA 3VA5A 2JA7G 1J7AA 3X3NA 2KENA 4IALA 5CV7A 2WXIA 2BWES 2LEKA 2JQRB 2A4ZA 1W6JA 2HHHL 4JI1L 1YMHE 3MJWA 4CJ0B 2KTRA 1L1OC 5NUCA 5EKKA 3V60A 4N9PA 2I5HA 2WV6D 1F2RI 1F2RC 1WXQA 1SIJA 4HDQA 1VF5C 2CR5A 1AE2A 2GI9A 2RMMA 4CBVA 2R7ZH 2LGXA 2F3WA 1PRTD 3AFPA 2WDVB 2N3SA 3DBLI 1Y1WG 2MP1A 4ZK9B 3AXCA 1UE5A 3PREA 3VTVA 4DWFA 1CUKA 1TXYA 4X65Q 4HIDA 3KUDB 4MACA 1JWUD 3EJIA 3ZLZA 1SR3A 1B1ZA 2GBRA 2A68D 5G2NA 2IL8A 3GTPH 3IRBA 2BDOA 5I2XA 5C0XJ 2F0QA 2UXDQ 3LB8C 3M95A 1YHQA 1ONLA 2F0WA 4OWWB 1G8ZD 3OW2A 4C7ZA 1RHPA 3S1NB 3DMUA 1IL2A 1PZID 1WM3A 1O80A 4K8IA 2DENB 4W9EA 2KEDA 5BMHA 1STBA 3RNGC 3B6YA 3OIQA 1R7SA 5JEAH 1NR4A 3DWGC 5C0XI 4JVZA 5IGEA 2LJ5A 4A3EG 3OJ4B 1JJ2A 1EQRA 1KRTA 1Q5WB 5HURA 1JMCA 5C6AA 3JVZX 2XBBC 3CCUA 2LD9A 3S16B 2FMCA 2ZM6Q 4N8FA 3PF4A 2XIWA 1VDVA 4HMIA 4BOZB 3HKZE 1I3QH 2EMSA 3H91A 1ET6A 4IWOA 1EUVB 4ZCKA 3FMCA 2UU9Q 2UXBQ 1SNMA 4IOAA 3IKJA 1ICFB 3TIXA 2MBBB 5E3FA 1KDCA 4YWLA 3PIOA 3C3LA 2GLSA 1HQMC 1QJOA 3I91A 1U5KA 2WXPA 3ENEA 3IFWB 3HIZA 4C00A 2IO1B 1WXVA 2KN4A 3TREA 1G2TA 2LASA 4PQXA 1J6QA 1YHBA 4PT5A 3AI5A 1JQYD 2IW3A 2FJ2A 1WTOA 2R7ZB 1ET9A 1LM8B 3BVMA 1YJWA 4GGQA 2JZ3B 4Y7NH 3GE3C 1VR9A 4WWPA 1D3ZA 1XEEA 2K5NA 4C1NK 1JRUA 2KDBA 3U9OA 1LLRD 2OWOA 3IBEA 2GB1A 2NMQA 5IO9A 4A20A 3GTPB 4QAYA 4IOCA 4KDLB 4NJ6A 1CT1D 2RA4A 1CZGA 2JA9A 5FLXE 2FCSA 2DNFA 1J8IA 1U4PA 1DOYA 3CAMA 2EKEC 4A3IG 5LMUQ 3DBHI 2H5XA 4K6LA 1UH6A 4LJOB 3QR8A 4ZUJA 2F52A 4AYBE 4LF8Q 5C44H 3NQTA 2KFKA 2O6VB 3FILA 2AUJD 2NVYH 4JI6L 1FO4A 1VQEA 1O7ZA 2PE9A 4IW0A 4JYAQ 1BR9A 2QW7A 3KF6B 4JG2A 3TBIB 3T9LA 1UGJA 4J8QA 1KC8C 5IAAC 2R92H 3HKZG 2WXNA 5EAYA 1KXLA 2NUCA 4AOFA 3S2AA 1RFKA 2KT7A 5BMGA 3H0GH 4A3CG 3FKIG 2D5GA 3OW7A 4BY1B 1ICWA 2EY5A 4JI2Q 1GXDC 4MGKE 4WAAA 3KDFA 1I3QB 3DWPA 1Q0WB 3NWSA 5FR3A 3DDCB 1K52A 3FAHA 3NSWA 1JT8A 3HOYH 2WU5B 3I63C 3BZDB 2SOBA 1FVIA 2YU9H 1PYSB 1U0LA 2ZTEA 2H1EA 5J3BA 1F9SA 5M5XH 4GKKQ 1MG8A 1P1AA 2RR9A 3P1MA 5LLIA 4EE2A 3H7PA 2HDLA 3SGIA 4CKBA 3DBSA 2DWQA 1H8CA 1VZ6A 1KABA 1XTCD 1WJ6A 4DV4L 4KIKB 4LCDE 4EZJA 4GOPA 2NN6G 2MJDA 1TS4A 1PGBA 3A0JA 3ECIA 4J1MA 4HSPA 3PUZA 4IPHA 1C4AA 2VUMH 4C80A 3DBRI 1PTOH 3ZW3A 4F1SA 4PMCA 4A55A 2LJIA 1Q81C 1NR2A 1L0VB 3SR6A 3PPAA 4YCWA 4W9CA 4GDKB 3L0WB 2IZVB 4X66L 5CMDA 4HXDA 4II2B 1NNXA 3WALA 3K7UC 5L95C 2XNAC 5IT9c 2L0CA 1HZBA 3MHZA 3HEJA 1JB7A 3SEBA 2KJXA 4PG3A 1E9MA 2BA0A 1VMPA 1LGRA 1FD7D 2XWBB 3TUOA 4YHHL 2AL6A 2KVMA 4DF7A 2D3BA 4BY7G 2E2DC 3ZDMC 1PH6A 1PH2A 1X6OA 5IN7A 1K0SA 2OT2A 3MA2B 1SRUA 3T13A 1VQIA 4L5SA 3S15B 3S2HH 4WQOB 3UF8A 2LWPA 4IJLA 2B2VA 3OOCA 5KYLA 2JA5H 3H8HA 1E1TA 2WAQE 4YCUA 1FYCA 5D6JB 2OOBB 4ZHPA 2D07B 1W3SA 3Q0AA 1X3GA 4LNKA 4CDCC 1YVCA 2K5HA 3NP8A 1Y8OB 1Q8IA 1EY8A 4OONA 4W9FA 5IP7H 3ERSX 1YQ4B 2QA4A 4RHSA 3WOFA 2VQEQ 1TKYA 3FHWA 4GN4B 2F4VQ 4A3FG 1WGGA 4RF1A 5C4XG 5JZEB 5MPOA 1Q90A 2EJFC 1F9RA 4JLCA 3L54A 2I07B 2LRUA 1R9TB 2BYTA 4O42A 5AJ3Q 4BWGB 5FO9B 3NS1A 3WOEA 3AEFB 3AM9A 5CTRC 3I57A 2OQ0A 1SYGA 4OO1I 1PYBA 4A93H 2AWTA 2L3ZA 3FKYA 5C4HA 4LJPB 1YITA 3A9JA 1OQRA 2JWZA 2NPTA 1GAQB 3D4WA 1S40A 3TMEA 2FBWB 3OMGA 1E7VA 3DXJC 1EYAA 5E7NA 1FFVA 2INPE 3N3KB 1L2FA 2I0QA 1I7HA 2DY7A 4B9KA 3D0FA 1Y1VH 2EQSA 4ILWA 1LT3D 4DK6C 4V190 3AE1B 4KHPL 3RT3B 3AB5A 3TJPA 5M3FB 3L16A 3MC8A 2BYFA 2ZZPB 2KEEA 1SF0A 2GBKA 3QHTA 3SHLA 5DPSA 3TL5A 2GMIC 2KC2A 1SDFA 1E0BA 3B08A 3D6WA 2ENBA 4KKJA 5GQOA 1VLBA 2K8HA 2PW5A 2ZCBA 3M4OH 3JAME 2ZPNA 5C0XG 3V6EB 2PQAA 2OCEA 3GQBA 3O13A 2Y5BB 1EFID 4WWMA 2X8XX 4NZLB 1LT6D 4B3TQ 2WNMA 4H13C 2N9KA 3ZXVA 4J6HA 2NWGA 1DYQA 2KWVB 3RD2A 4BBRH 5BN3A 3SK8A 3OTOQ 1PUTA 1C8CA 3H6MA 2TSSA 4DAPA 4KY5A 3CPWA 3K6OA 1ENCA 4LFBL 1VDZA 1RWSA 2JA7H 2G5DA 4MM3A 3PIPA 1SYBA 2FFKB 1Z5SB 4N9TA 3ZNID 2XSCA 3MXPA 2DJFC 3HGBA 4B95A 2UUAL 1XYIA 3N9YC 1VMCA 2WS3B 4ZDVA 1K8GA 1YBYA 3TZDA 3U4ZA 5LXIB 1BBXC 4RMFA 1E2WA 4OEMB 4B6WA 1LTAD 2Z1CA 1K53A 1E7PB 3L08A 1GB1A 1LTGD 1RODA 4JPSA 3DWQA 3UQBA 4KV6A 3RYTA 2AQ1B 2HIVA 1NBFC 2PMVA 3JW0X 4C4VB 4A93B 3NK9A 4EQ5A 2KQ3A 3TEZA 4BKSD 1WTQA 3Q14C 5JJIA 1HTOA 1TZ1A 3B2GA 4WH4A 3RCZA 4IC7B 2TMPA 2V3NA 1UE7A 3R2TA 1BNZA 3PO3G 1A6XA 4XT3B 5LL6X 1L0YB 5CHFA 4IPDA 5H8YE 3UIOB 4HCPB 4EVOA 3WA0A 2M19A 3PCOB 2BPSA 5C3EH 4FF4A 4JE3B 4DHJD 2EPBA 3VYUA 1HNWQ 2L52A 1JJCB 3A9KB 4IPCA 1QCBD 5KEEA 1KJTA 1T3QA 1QZHA 2RBMA 1HZ5A 1UEBA 2GBJA 1QT9A 5BR8Q 2RHSB 1ASZA 4HSVA 4A3EH 4KJNA 1V49A 4IDIA 1D4BA 4B3RL 1PTOC 5IODA 5D7GA 4HN7A 1GOZA 1WJNA 1PRTF 1X56A 2X6GA 2MH7A 1H9JA 5EKLA 3E9SA 4MDKE 4K0KL 3DM1A 3ABVB 4ACFA 3MWYW 3RZOH 1YN3A 3KW5B 3CU7A 1OEYJ 4CGYB 1Q46A 1F52A 1IBXB 3KLSA 1VRAB 5CC4A 4KD3A 3KFUA 2LXCA 4JW0A 4GB9A 4KHZA 2N88A 3NBHB 4XC2A 3NZSA 3NENA 2JA7B 2V4IB 2MBQA 3RNFC 2LXAA 1TKWB 1AZQA 1VQ9A 5DPRA 2JA8G 2K50A 5HHDG 4BXXG 1LTBD 2Z0SA 4GN3B 3D4RA 2J4XA 2M1MA 4CKCA 3NWTA 1N63A 1KLUD 3IAYA 4ALPA 4K5XA 4JI0L 3GTJB 3IAM1 2VXWA 4G50A 4NAWA 4R4IA 2XWJB 1F2MA 1OFFA 3J81E 5C3JB 4NJCA 1TY2A 1TTNA 1DJRD 1ILPA 4K5VA 1PYWD 2PPBC 1Y1WB 2OEOA 1MJEA 4LNIA 1T5EA 5J1ZA 4MH8A 4XYQA 3FPPA 2EKIA 4DR3L 1YX5B 5E6PA 2CW0C 4KY7A 1EF1A 5AZFA 3AMUA 3U8ZA 2HT1A 2F4IA 3Q8BA 3A1QA 2WDRB 2JYTA 4QY7A 1XNQL 2DBYA 3TSSA 1V1PA 2EVBA 1HA5A 5JJKA 4A3IH 3I4MG 2ZPYA 5M3MG 5CX3A 4HAEA 5IGGA 1DOMA 4X64Q 1FR3A 5IYBG 3RLOA 1BCPB 3A5ZB 1STGA 2OJRA 3PRZA 3EBEA 2Y5PA 3HHMA 4F88A 2MHVA 1LM0A 4ZKCB 1R4MB 1Q1EA 1RDPD 4A3EB 2F0DA 2MUYA 3E5SA 1OXXK 4OZBA 2QF7A 2DN8A 4HWIB 4LDTD 1RF2D 4OVVA 3K0YA 1WZ0A 3A8KE 4A3CH 1FJGQ 3ZTDA 5C5MA 3J7A5 5I9OA 1L6VA 1EOTA 4LAAA 3M4QA
chains in the Genus database with same CATH topology
4ARIA 1LTTD 2IWHA 1MHXA 3Q23A 2EYFA 1GUTA 2F0HA 2NB0A 2WXLA 1SSNA 4R8IA 2B2YC 1HPCA 2HCIA 2IDYA 5G5GA 1CTMA 2K5WA 2NN6H 1AZPA 1N60A 2WP8J 3S1MB 1S5CD 4HCEA 4EGVA 3J81L 3DHQA 2WXGA 3M4YA 4OO1G 4JWSC 1PFNA 2SNSA 1K8MA 1K51A 4ITKA 1YNNC 5IGBA 1NVID 5CV8A 5T1GA 1ZKOA 4A3IB 4FVMA 3OMCA 1PLFA 3M3YB 2EJMA 5JOBA 4OIKA 1PZJD 1TT2A 2Q8IB 3NTKA 1H9MA 3MVVA 1I4XA 1FFUA 2CW0D 4QIWB 1F0ZA 1FCLA 2D9UA 3N6RA 3E56A 3I72A 3FKIB 5DNFA 3BIID 2EY1A 1TIID 2B2UA 2JWUA 1PRTB 3WCQA 3RFZB 1TR5A 2E2IB 4C2MB 2PW7A 1H9RA 3DEPA 3C46A 2DY8A 3BDLA 5KIXA 4MHEA 3K57A 4YSYB 1UUPA 4M8AA 3MXGA 2PMZB 4QB4A 1TU2B 3FEWX 2VB3X 2XVSA 5IGCA 4V0BA 1IL8A 1V43A 2F0UA 1SSOA 1HXYD 3FPUB 2CVRA 3QWNA 5H92C 3BYTB 5I9PA 2IX0A 1YNTE 1FXAA 4WURA 5BMIA 2Z4HA 1AWDA 5I4DA 2PVOD 3NBIA 1SE3A 2WXQA 1BOSA 1SFOB 1EY5A 3OHXC 2LY7A 3RZDB 1IHZA 1AW7A 1A2TA 1BF4A 1PMRA 4FF2A 4BY7B 3K5LA 4LMQD 3K5MA 5C0XH 4DXGA 4B0EA 3SVMA 1YNND 1FRRA 3GP7A 1U9RA 4ARCA 4KTAA 4ZOHC 1IYUA 2BT6A 3MXUA 5EPLA 1EY9A 2F0LA 3RPFC 2KUMA 5J22A 5C4XB 5KYIA 4XQJA 3ZQ4A 1EY7A 3MP9A 1Y69U 2K04A 5DEHA 5C2TB 4KD4A 1SE2A 2F0SA 1ZYRC 4C3HG 1GPXA 4FXKC 5FKAC 1C4PA 3VR8B 1VCIA 1WVLA 3GD7A 4WAFA 4S3SA 4X3SA 1X3PA 1SYDA 4JWUC 4L23A 3BG3A 2F0FA 1Z6HA 2EY2A 3A56A 2JU6X 2PYKA 1SBBB 5HGTA 4OVZA 1FMAD 2F0EA 4GDLB 3VRBB 4EQPA 4U68A 2F0VA 4ID6A 2B2WC 2D5DA 3NUCA 2PQEA 2BCOA 4XIGS 2KCCA 3P7JA 5IT9E 4A8XC 3HOVB 1M4VA 1OXSC 2L12A 4YSXB 2ON8A 5BN4A 2D62A 2F0TA 4IFDJ 1C4QA 1B53A 1UNSA 1ML0D 5BYSA 1C4CA 2V0GA 4IQZA 4BA2I 3W2DA 5CBEE 1RTNA 2A74C 1D5MC 1HCZA 1SYFA 4CHTB 3VR2A 4QUCA 2B8FA 2Q8TA 3RD4A 1QWYA 3U7ZA 4IFDI 3P63A 2BE5C 5C4ZA 3GTOB 1XLOA 4A3JB 1ZDVA 1JWSD 4IUUA 3LNNA 2NVXB 2QDBA 1SNPA 3BVGA 1ZXHA 3EGRA 3P75A 4HMJA 1EL0A 3PO3B 1PGAA 2SAKA 3D6CA 5ELEA 1HRJA 2BDNA 4RH6A 2RSNA 1ZYRD 4WORA 3C1FA 1LTID 5K36G 4YTPB 1PFBA 3U4EG 2QMTA 4YTNB 1UEAB 3ZGZA 1RJTA 1HTPA 3TN2A 2WKCA 4KK7A 4KKTA 4IUQA 5D14A 4YT0B 5IT9L 1E2VA 4TRDA 2L32A 1T6BX 3A55A 2RDHA 5DM63 2NVTB 4ZKBB 3NVVA 2J52A 2ZXOA 4HEDA 1K83B 1CFMA 1FM0D 3Q6SA 1IKMA 3Q8AA 1O7YA 1U4RA 2JA8B 3CRLC 3TDQA 1WTPA 3V2TA 2MJ3A 1UWMA 3SFEB 1YN5A 4X3UA 2PTLA 3HOZB 5E4XA 1VF7A 4I7ZC 5AUIA 3HP3A 2JZPA 2B2TC 5LL6S 3H94A 4ULLA 2Q8RE 3HOXB 1WCMB 1TWFB 1C48A 2PKOA 3MZ5A 3PIP3 1I6VC 2LGIA 2RDFA 4Q5VA 3HRZC 2MPMA 1IBXA 1GUOA 1VZ7A 3I4MB 3NBHA 2BE5D 3DWAA 2H4OA 4I65A 2J0TD 3H3VC 5FOBB 3G7LA 5M3MB 3V96A 3ZYYX 5BYQA 3BK1A 5IIFA 1WD0A 1PFMA 3UI2A 2H88B 1JWAD 4YIJA 3SK6A 1LTSD 1EM7A 1JC7A 3U52E 2IX3A 3J7AV 3EUB2 2JX5A 4N6EB 5T1IA 5JXVA 3OPOA 1F2ZA 1TWCB 1CHQD 2WQYB 1EY6A 3NHHA 1LV9A 3QJYA 4C3IG 5ELFA 4HRSA 1XLPA 1MGSA 3K58A 1J7BA 1HUNA 4XE0A 4XWTA 2M2LA 3QOLA 1STYA 3FDTA 5F2DA 2HDEA 3AEGB 1G6ZA 2R93B 2EYOA 5EQ0A 2DYMA 1LACA 2M00A 5CV9A 3NTIA 4L63B 1MI2A 2EYLA 1TWGB 3DWMA 3RLFA 5A2QE 1D1IA 4OZCA 2WXMA 2E2HB 4J3OD 3KBGA 1QNUA 3PZ8A 3CHBD 2K5DA 1MSGA 3A7LA 3ZJTA 1MD2D 1A70A 3VQIA 4OHJA 3AE4B 3MEHA 4A3KB 2B63B 2NBFA 2OEDA 3PV0A 1L6UA 1OO9B 3LXFA 1WTRA 4DK0A 4HKQA 2QILA 4DXFA 2PZTA 3Q24A 2JSVX 1QG7A 3HVZA 1E0ZA 4NAMA 2L9HA 1GHJA 1SYEA 4IFDG 1SB3C 1TQOA 4US8A 3TEWA 3P20A 3C1EA 1JOKA 1JE4A 4DNTB 1CA5A 3BS1A 3I4NB 5CBAE 4IZ8A 1ZDXA 1I4PA 3AMZA 3EA6A 5CV6A 2IPKD 4FXCA 2I38A 2EYPA 5A2QL 4K6DA 2I2YA 1EU4A 4N59A 2EELA 2Z8LA 2Y5CA 1ENFA 3D8GA 1ESRA 2NVQB 3K7AB 3KLSX 2BOSA 2K5PA 3GTGB 2KDMA 3VYTA 5M5YB 1EQTA 2N9LA 3NVYA 4U673 2E3TA 1BUIC 1B3AA 3T3OA 2JXTA 4ZLTF 3VR9B 1AEXA 1SJED 1XLNA 1X3QA 3G6JB 2WB1B 3SXHA 1P7FA 4ZRZA 1CQVA 5JPMC 1EY0A 1WD1A 2K3UA 2ID0A 1SAPA 3K5NA 3K5OA 4DQOC 2GRIA 5D3DA 4DGZA 1IW7C 1N62A 3F2UA 2EY6A 3KWVA 2ZXRA 3ZJVA 4C3HB 2JSOA 3FRPB 4IOIE 2BS3B 3CQZB 4NP5A 1S4ZA 3BWUD 3AU7A 1KRHA 4XDXA 4HKZE 3SFDB 1CQFA 4B9XA 3OSOA 2A69C 5D65A 5KNDA 4IUVA 3EROA 3A7AB 5G3LD 2R61A 2KQ4X 1QF6A 5EJWA 4H7BA 4OZAA 1Q10A 4A3DB 2IT1A 5K36H 1WTVA 3GTKB 4ZRQA 2LFIA 3AB9A 2DYOA 4CKEA 2RSOA 2F0GA 4RCNA 1STHA 2L83A 2F0KA 4KI0A 4TQ0A 2ICIA 4Z9CB 1QILA 1EYDA 1SMYC 2AWNA 1C78A 5I6YA 2WIIB 1LT4D 1EWHA 4RGTA 4OW0A 1FGBD 5J39A 5I6WA 1KLGD 5KNBA 1ILQA 5HI1A 4RKBA 2E2JB 4P2CB 2ONQA 3GTQB 1Y8NB 4C3JG 3M85A 1GUWA 3QO2A 2Z4IA 4A3BB 2CJNA 3AN1A 3I70A 3SK4A 2VZKD 2BA1A 3EVQA 3SK5A 2QIEB 4G7HC 1IW7D 2K28A 3NTHA 2G1EA 1TKEA 4FO2A 4L1BA 1DGJA 2KACA 4WFN3 2AX5A 1IKLA 5M9OA 3S9WA 4TQUS 4KMUC 1TY0A 1STNA 1N61A 2MGSA 4TMAB 2LUMA 4A6QA 2L4NA 3PUXA 5EBCA 3NRZA 4LJZC 1Q3LA 1U4LA 4F7XA 2K22A 5E4WC 1QOHA 3SDZA 3LYYA 2A5HA 3K59A 3BVZA 3CRKC 4WJWA 1N5XA 1NAPA 1A3VA 4M1UB 5EE9A 3TP6A 3NVZA 4N58A 1I50B 1PTOD 2VNUD 2NYZD 1JROA 2PVGC 2HUGA 3GTMB 3DUZA 4B08A 5T8IA 2O4XA 3NQIA 2BS2B 1HEZE 5C3XA 2LMCB 4JX1C 2OF1A 2Q5WD 3VA7A 2BW2A 2WACA 2WU2B 3NUHB 1RTOA 3AE9B 2FHTA 1VJKA 4UAIA 1I4HA 1UAPA 3I9V1 3OWEB 2XRSD 3L3OC 1ZP0B 2N7JA 3P42A 4A3GB 1B9NA 4A9AA 1JR0D 1A15A 2R6GA 5CORA 4P6VF 2CU3A 4C3IB 3A8IE 4UDUC 4M0WA 1B9RA 4KHVA 4TKOB 3BDOA 1KH0A 4IFDH 2IGDA 2SNMA 1YQ3B 5C5LA 4K2LA 2BS4B 1TVXA 2CJOA 2HDMA 1BCPC 3TP7A 3AE8B 3I8ZA 4NDXA 1MPEA 1XLQA 2LFNA 1AP0A 4XXEA 2JYEA 3T51B 2VB2X 3A54A 3M7GA 3HRDD 2JE6I 2PLPA 3Q8CA 1B44D 4C1NI 2MJEA 3HVDA 4YSZB 2K32A 3PIO3 1MSHA 4ODGA 1ZE3D 3D4DA 3IFDA 1PDXA 2ZW1A 2FUG1 2L11A 4YWGG 4DN4M 4ZRPA 1GUNA 3IL8A 2B2VC 2D2CC 1L0XB 1G2SA 1ACCA 2W3RA 3TEYA 2EOTA 2O2LD 4R9WA 2H89B 4TSSA 3P4PB 4R3DA 1QNKA 3ZJUA 1OXTA 4MIUA 3MTSA 3W5UB 4DK1A 2F0OA 1F9QA 2JXMB 2HQEA 3VYSA 1JICA 2B76B 4NKLA 2INNE 1E2ZA 2KMMA 1QOGA 4RF0A 3T3NA 1PRTC 4ZAIA 4XTCS 4C80A 4XT1B 1SE4A 4XQNA 1JMLA 1NUCA 3ETRA 1F77A 2JYOA 4QMGA 2L1AA 1XO3A 3J80L 3W9CB 4Q2JA 1A3TA 4HCSA 2NN6I 4FYDA 1ZEQX 2PNRC 3RUZA 1HZ6A 1U4MA 1S5DD 1TS3A 3GV3A 3BDCA 5EBDA 5C4JB 5FK9C 3I3CA 1AFPA 1CK1A 5G3LF 4O1NA 3CWIA 1QOAA 4IKGA 3MFGA 3S17B 1EEFD 1JOQA 1MHHE 1TZOA 4HR7B 3AEBB 3J7AF 4B0MA 2JP1A 4G7ZC 5E6JA 1NENB 4KGSA 2X38A 2N55A 4CJ1B 3AEDB 2DNEA 4US9A 3IT6B 5KNCA 4JK1C 1BQQT 1JORA 2K9XA 1EYCA 4H44C 1C77A 5ELCA 2WXKA 3VR4A 1LO5D 3FVQA 2OHFA 4H2AA 3KWLA 4BA1I 4FF1A 4ZUIA 4XDCA 2JEBI 1J7CA 1I4QA 1TWHB 2M0AA 4XDDA 3LWUA 1YJJA 1XCTL 3V05A 2WLBA 4MN3A 1CI3M 2FE8A 1EOTA 1CZWA 1MVKA 4LLGM 4P16A 1H9SB 5ISRA 1XCQL 4IN3A 1SJHD 5HG2A 3PO2B 3Q8FA 4K8JA 5IGDA 2WXRA 3ND8A 2JA6B 5EE1A 1B9MA 1C79A 3AE5B 4PMWA 4PMBA 4FP5D 2XN9C 1ZXIA 4XQQA 1V1OA 4ZYSA 3BYYB 1ENAA 3VR6A 2W82A 3M7NA 3CIRB 4C3JB 3IAS1 3S2DB 2PZWA 4MT5A 4BBSB 1UWXA 4R8NA 1EEID 2A6EC 2F0JA 1EWCA 3J7YW 2F1MA 4OO1H 3H09A 2PW9A 1S5ED 3ND9A 5CV5A 5EKIA 3GS2A 1HTLD 2G9DA 3X3MA 2QJLA 4KN4C 5ELDA 4RGMA 3KBXA 1Q1BA 3EQLC 4QCLA 2A6HC 1WTXA 4JBWA 5JVG3 2SEBD 1ZXTA 4TQ1A 3OIPA 2B2YA 3VR5A 2DLBA 1SEBD 1PTOF 4KX6B 1A2UA 5GXGB 1P7EA 3I4LA 4A3MB 2E74C 2AWOA 2NTSA 5G5HA 4KN7C 4LTUA 2OXPA 5KRUA 2IX1A 1FNWA 1PZKD 1LABA 1EIHA 4PV1C 1S5FD 1F2LA 1IUEA 1Y56A 5JPNC 3B9JA 5HFYA 2WXJA 3AECB 1GUSA 2PO4A 2ZXPA 4H0LC 2RQXA 2K1BA 4G57A 1YJIA 1SNCA 1KFYB 2K33A 4RAUC 5JAVA 1DOLA 1B2TA 1OXVA 5C3WA 2WXFA 4OL7A 4YTMB 4F87A 2F3VA 4WQMA 2A6ED 1NYRA 4RNAA 2CQAA 4B9WA 2JEAI 2DNCA 5CGKA 3MJ5A 1D2BA 3S1RB 3U9SA 4Y7NB 1BMLC 4DNRB 1HUMA 1HHVA 2L55A 2A6HD 2B2UC 2V4DA 2VZKB 3MFYA 3AE2B 2GA4B 2K01A 1TYGB 5FLXL 2LMCA 1O7LA 2KECA 1BDOA 3NPPA 5JEAJ 5BN5A 4A90A 2QSDA 3QG1A 1XX8A 2Y3AA 1X32A 2X6LA 5C44B 1STAA 2NVYB 2RVLA 4LK0M 2AUKA 1WYGA 1D6EC 1RM6C 4KGRA 4RGNA 4GZYC 1JALA 1AYFA 4KKUA 2FINB 1V8QA 2R92B 4X3KA 3J9CA 2K05A 1TKGA 2YEPF 1RD9D 3H0GB 3ITPA 1GUGA 1SNQA 1HQRD 1SNOA 2QKIC 1DZ1A 1CM9A 3HOYB 1GHKA 1NYQA 4EQNA 3GV6A 1HA6A 1EIGA 2YU9B 3W5VB 4X3TA 4BS9A 5M5XB 3HS0C 4K5WA 4RHRA 3QB3A 1GB4A 3I90A 3MC0B 2LS01 1SXTA 1DD2A 1E6EB 1XF5L 1IGDA 2B39A 1II3A 1J9OA 2F0NA 2N0SB 3D31A 1FNVA 2VUMB 4G7OC 1PTOB 1TS2A 1V8CA 4DAVA 1DOXA 3R3OA 3TEXA 1PGXA 4ZHOA 5ELBA 4RWSC 4AQ7A 2A73B 4XWWA 1BCPF 1D5ZC 3VR3A 1LTRD 1Z47A 2LHEA 3NE5B 2KHSA 5BYRA 1M8AA 1QLBB 1EU3A 1F9PA 3R2IA 3R8BA 1KF6B 2B2WA 1K8OA 2K6AA 5EPKA 5FO7B 2EJGC 3SE0A 1KNEA 4EQOA 3S2HB 2ZT9C 1BXTA 2SDFA 3S1QB 2JA5B 1IYVA 4PNYA 3SR1A 2RKSA 1FRDA 3TZUA 2WXOA 3FC4A 1XWEA 3PO0A 3UI3A 1BO0A 3Q8EA 2O5JC 4IUNA 1RKNA 3TP8A 4ME5A 1YN4A 5D3IB 3PMFA 3RMHA 3GB1A 2AQ2B 3T53B 3HUIA 1TJEA 2F0MA 1T5XD 1Y1VB 3IXSA 2YYZA 3T4AC 2E75C 1BUVT 2F0PA 4L8JA 4DAYA 1IGCA 1PDQA 1C76A 2QCPX 1AN8A 2M9VA 4E6IA 1KDAA 2F0IA 3M4OB 1EZ6A 3JAML 5FO8B 5IOCA 3L4PA 4KY6A 4NW2A 4FXDA 2L1BA 2EDGA 2KWDA 1QE6A 4OGQC 4BBRB 4DFAA 4FF3A 2K0PA 4XYOA 3QOJA 1HFNA 1PXUA 2IJ0A 1O78A 2YEPB 3DEOA 1RCVD 1MBYA 4K14A 3AV8A 3MXNA 3MHBA 1QQRA 3R93A 5EPJA 1FEHA 3FILB 2V3PA 1RYJA 3ERQA 2ACZB 5A35A 3W1SA 2NTTA 3NXWA 2KA7A 2Y0SB 2A69D 4KGTA 2NZ1D 2RDGA 2B2TA 5COYA 3BK2A 1NI3A 2L5TA 3NVWA 4D2KA 2O5IC 2EYJA 2PZUA 1B4OA 2KAJA 4DU9A 4L2YA 2QEJC 5C3EB 2KOLA 3P4RB 2EYHA 3GO5A 5KGUA 1FCCC 4DA2A 5I2YA 2HCCA 3VYRA 2IGGA 4RFBA 2BTEA 2XRQD 1SMYD 5JEAG 1V97A 1CHPD 1Z7TA 1H9SA 2RPVA 4KKSA 4QUFA 2ICEC 3RZOB 1I4GA 4L6TB 2M56B 1DONA 4HEA1 3PUVA 3KK7A 2LHDA 1DOKA 3U2SC 4IURA 1JWMD 4IUTA 1YNJC 1WWTA 3AE6B 4RA8A 4FXGC 1EY4A 1L5PA 4HJGE 2EXZA 2MJ8A 2R3ZA 3NZ3A 2F03A 2C5CA 4HTHA 4USAA 5E1FA 4NMZA 1Q12A 3P4QB 1KNAA 4FNFA 2K7VA 1N5WA 2BBCA 1KDBA 5JVH3 2K03A 3MAQA 2EYMA 3KLRA 3AEEB 1KAAA 1FNUA 5IGFA 3E0JA 1NSNS 1DM0B 3HG9A 3KUPA 4REZA 1EWYC 2WKDA 4Q0FA 4AS1A 5TSSA 2I46A 4ZQ3A 1NCVA 3Q22A 2HTME 3HKZB 5DM73 2LKVA 1MI0A 2WXHA 3L7ZC 5M5WB 4KKIA 1LT5D 3Q69A 5CV4A 5CYUA 4C7YA 1JB3A 1EQVA 1S5BD 3LWEA 3W3AA 3URYA 2PIAA 3PZ7A 3P4SB 1JCKB 5JJZA 2X69A 1CA6A 1FXIA 1VZ8A 4CJ2C 1I6HB 1CJEA 1JQ4A 1R4PB 3J80E 3D3RA 3HOWB 3S14B 1G91A 2WP9B 2EZVA 3AE3B 4OIJA 4WRDA 5EE0A 3LX0A 5LHY1 1JRPA 2BB5A 1YNJD 5AUKA 1OXUA 3I73A 1G291 4AYBB 5K5PA 1GJXA 4IUPA 1ROEA 1WSPA 3AH7A 4K2KA 4RKLA 1NEKB 5EE3A 2AQ3B 1OQQA 4MM3B 3AEAB 4CQNA 1R4QB 2J42A 2IGHA 3TP5A 1WGKA 2FMMA 3OWFA 1K50A 2ZW0A 4KJOA 4G4KA 1Y8PB 3E6ZX 2G9HD 5LNK1 3KF8A 1HFGA 3IFTA 3C2PA 3ONAB 1WRIA 4RGOS 4F8MA 1B50A 2BB6A 4HROA 3V3XA 3WDNA 3PUYA 1PFDA 4C56C 4ABNA 1DOIA 3C8YA 4LK1C 1ZPSA 3HOUB 1D5XC 3VRAB 2PCFB 5DAUA 1QOBA 1QOFA 1JW9D 3PUWA 4A3FB 4QF4A 1BCPD 1XXGA 4YXDB 2A68C 1SYCA 1E10A 1D1KA 4RCOA 5AFWA 2E6XA 1QKZA 1ZOYB 2W3SA 1TWAB 1FIQA 3CKIB 4GLSC 1A3UA 1DXMA 1I4RA 3AE7B 1QB5D 1ESFA 3A8JE 5CR3A 3B2FA 3T56B 3HZXA 2W54A 1H9KA 3EFXD 2KCNA 2WAQB 3T16A 4NAWB 1ZUD2 2MEKA 3KQ4A 1STEA 1JWBD 1L4DB 1FD6A 2J7ZA 2W55A 3P1HA 2WINB 3QIAA 2CHBD 1DCZA 2K5QA 3IT4B 2C9OA 3L9AX 3N52A 2B8GA 1F2YA 5EGTA 1EZ8A 2WDQB 1SNDA 2E76C 2J53A 1C9FA 1JOOA 1V1PB 1L4ZB 1TS5A 4WIPA 1CZPA 2EE1A 1KTKA 3GTLB 1WTWA 1W6KA 3VA5A 1J7AA 3X3NA 4IALA 5CV7A 2WXIA 2LEKA 2JQRB 1W6JA 1YMHE 4CJ0B 5NUCA 5EKKA 4N9PA 2WV6D 1F2RI 1F2RC 1WXQA 1SIJA 1VF5C 2GI9A 2RMMA 4CBVA 2F3WA 1PRTD 2WDVB 2MP1A 4ZK9B 4MACA 1JWUD 3EJIA 1B1ZA 2A68D 2IL8A 2BDOA 5I2XA 5C0XJ 2F0QA 3LB8C 1ONLA 2F0WA 1G8ZD 4C7ZA 1RHPA 3S1NB 3DMUA 1PZID 1O80A 4K8IA 2KEDA 5BMHA 1STBA 3OIQA 1R7SA 5JEAH 1NR4A 3DWGC 5C0XI 5IGEA 5HURA 5C6AA 3S16B 2FMCA 2XIWA 1VDVA 4HMIA 3H91A 1ET6A 3FMCA 1SNMA 3IKJA 5E3FA 1KDCA 3C3LA 1HQMC 1QJOA 3I91A 2WXPA 2KN4A 1G2TA 4PQXA 4PT5A 1JQYD 2IW3A 2FJ2A 1WTOA 2R7ZB 1ET9A 3BVMA 1VR9A 1XEEA 4C1NK 3U9OA 1LLRD 2GB1A 2NMQA 3GTPB 1CT1D 2RA4A 1CZGA 5FLXE 1J8IA 1U4PA 1DOYA 4K6LA 4ZUJA 3NQTA 3FILA 2AUJD 1FO4A 1O7ZA 1BR9A 3TBIB 1UGJA 4J8QA 2WXNA 2NUCA 1RFKA 5BMGA 2D5GA 3OW7A 4BY1B 1ICWA 2EY5A 1GXDC 1I3QB 3DWPA 3NWSA 5FR3A 1K52A 3FAHA 3NSWA 2WU5B 3BZDB 2SOBA 2H1EA 1F9SA 4EE2A 3P1MA 2HDLA 4CKBA 2DWQA 1VZ6A 1KABA 1XTCD 2NN6G 2MJDA 1TS4A 1PGBA 4J1MA 4HSPA 3PUZA 1C4AA 1PTOH 4PMCA 4A55A 2LJIA 1L0VB 1NR2A 3SR6A 4GDKB 5CMDA 2XNAC 2L0CA 3MHZA 3HEJA 3SEBA 2KJXA 1E9MA 2BA0A 1VMPA 1FD7D 2XWBB 3TUOA 2KVMA 4DF7A 2E2DC 2OT2A 3MA2B 3T13A 3S15B 2B2VA 3OOCA 5KYLA 3H8HA 1FYCA 4ZHPA 3Q0AA 3NP8A 1Y8OB 1Q8IA 1EY8A 1YQ4B 4RHSA 3WOFA 1TKYA 5MPOA 4RF1A 1Q90A 2EJFC 1F9RA 2I07B 1R9TB 2BYTA 4O42A 5FO9B 3NS1A 3WOEA 3AEFB 3AM9A 3I57A 1SYGA 4OO1I 5C4HA 1OQRA 1GAQB 3D4WA 3TMEA 2FBWB 3OMGA 3DXJC 1EYAA 1FFVA 2INPE 1I7HA 2DY7A 4ILWA 1LT3D 4V190 3AE1B 3AB5A 5M3FB 2KEEA 1SF0A 3SHLA 1SDFA 1E0BA 3D6WA 2ENBA 4KKJA 1VLBA 2PW5A 3JAME 5C0XG 3GQBA 3O13A 1EFID 4WWMA 4NZLB 1LT6D 2WNMA 4H13C 2N9KA 4J6HA 2NWGA 1DYQA 5BN3A 3SK8A 1PUTA 1C8CA 3H6MA 2TSSA 4DAPA 4KY5A 3K6OA 1ENCA 1VDZA 1RWSA 1SYBA 2FFKB 4N9TA 2XSCA 3HGBA 3MXPA 1XYIA 3N9YC 1VMCA 2WS3B 3TZDA 1BBXC 1E2WA 1LTAD 2Z1CA 1K53A 1E7PB 1GB1A 1LTGD 1RODA 4JPSA 3DWQA 4KV6A 2AQ1B 2PMVA 4A93B 3NK9A 2KQ3A 3TEZA 1WTQA 3B2GA 4WH4A 2TMPA 2V3NA 3R2TA 1BNZA 1A6XA 4XT3B 5LL6X 1L0YB 5H8YE 4EVOA 2M19A 4FF4A 4JE3B 2EPBA 3VYUA 2L52A 1QCBD 5KEEA 1T3QA 2RBMA 1HZ5A 1QT9A 4HSVA 4KJNA 4IDIA 1D4BA 1PTOC 5IODA 5D7GA 4HN7A 1GOZA 1PRTF 2X6GA 2MH7A 1H9JA 5EKLA 3E9SA 3ABVB 3DM1A 3MWYW 1YN3A 3CU7A 4CGYB 1IBXB 3KLSA 1VRAB 5CC4A 4KD3A 4KHZA 2N88A 2JA7B 2V4IB 1TKWB 1AZQA 5HHDG 1LTBD 3D4RA 2J4XA 4CKCA 3NWTA 1N63A 1KLUD 3IAYA</