3WAOA

Crystal structure of atg13 lir-fused human lc3b_2-119
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 32
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3waoA00
3VTUA 4DWFA 2KMCA 1J8CA 3PVLA 4W9IA 3VUXA 3ZW3A 2KFJA 2UWQA 1E7UA 2KJ6A 3ZVVA 3BY4B 4TQ1A 2KWVB 2LGDA 4A20A 2WWZA 3PZDA 3P2BA 3CSFA 2MA9B 4FBJB 4EEWA 3A33B 2MBBB 4EZLA 2PE6B 1WR1A 2C7MB 1H4RA 3ALBA 4EFOA 1C1YB 1EUVB 3NHEB 2AEHA 3C0RB 1LQBA 4KVGB 1NI2A 4HLEA 2IO1B 4FJYA 3R7RA 1YX5B 3DDCB 1BT0A 4BVUC 2GOWA 1UZXB 2MQJA 2BPSA 4OVUA 4GDLA 1Z2MA 3UQAA 1P98A 4K1RB 3DBRI 1P3QU 3AXCA 1R4NI 2CS4A 5G2NA 4ZRKA 4DDID 2L7RA 3DVGY 1UBIA 5LXHA 1FXTB 2JZ3B 2KQSA 4TV3A 2MBQA 2FCMA 1RFAA 4FN2A 3RYTA 3PPAA 4KIKB 1S1QB 1HE8A 3L16A 3JSVB 2CHZA 2KWUB 2L8JA 2K25A 4RM8A 4ZYNA 3OJ3A 2JY6A 2LUEA 3W1SA 1VCBA 4TKNA 3U7DA 2KKCA 2K8CA 3TJPA 4EKUA 1GUAB 1D3ZA 2PJHA 2EKEC 2RGFA 3A1QA 1UELA 5TR5A 2D07B 5L83A 2KFKA 3NOBA 1V9JA 2DAFA 3WIMA 3ZLZA 4GDKA 4WJQA 4HDOA 4IW0A 2L0FA 2KDFB 3M95A 2J0JA 4IM2A 4BOSC 1WJUA 4MJSA 2FCQA 2IY0B 3UF8A 2MWSB 2CU1A 2KC1A 2WX1A 3APCA 4BKSD 5HKHA 1WGGA 4HXDA 4EUTA 3KUCB 2NBWB 4NQLB 1SGHA 4AP4C 3NZUA 4GSWA 2CR5A 4HPMB 4WAAA 4NAWA 3PGEA 1JRUA 2N7DA 2KDBA 2IBIB 3QX1A 1E8YA 2O6VB 1E8WA 4II2B 3DVNU 2DYMA 2ZPNA 4MH0E 3PHXB 4N9F4 4BKTA 3ENEA 5KHQA 2G3QB 4MGKE 2NPTB 3A9KB 3Q3FA 3T9LA 3A4SC 3U30A 2JZZA 1RAXA 2KANA 1UD7A 1UH6A 1WJ6A 4G0NB 4NQKE 3ZO5B 1KOTA 2JVCA 1OEYJ 3KH0A 5L95C 1E7VA 3L08A 4XZ4A 3N32A 3QJZA 1V2YA 3R7QA 2BKFA 2JRHA 2XK5A 3JW0X 4IWQA 4I6LB 2J0KA 4WJPA 3MHSD 3SHQA 2O2VA 3IHPC 3ZRFA 2KLCA 2J7QB 5E6OA 3BINA 4K7UA 4EZKA 5EDSA 2KWCA 2JXXA 3K9OB 2CHWA 2KDEB 2FCNA 1XD3B 2DZIA 1MG8A 3WAMA 1WM2A 2LASA 3VH3B 1J19A 2DYBA 1Q1OA 2ZNVB 1M94A 4JQWC 4PS7A 2ZNVC 4W9CA 4DHJD 3CF6E 4P7IA 2Z0DB 4G11A 1KJTA 4PYZA 1P1AA 1L7YA 2M4NA 2MRPA 1YQBA 3ZNID 2IO0B 2LD9A 4HCPB 1LM8B 1E8XA 2I1KA 3M62B 1WXAA 3VFKA 5E6PA 2N9XA 1WX8A 1OGWA 2OOBB 3ZNHB 2KN5A 1TBEA 3LJ3A 4ASWC 5JHAA 1ZW7A 2K8HA 4HPLB 4IG7B 4WQOB 2KLGA 4WWNA 2FAZA 3PS6A 2BGFA 4XX5A 2MX2A 2NS5A 3VQIA 3ZNGC 1WX9A 2N9PC 1E90A 4M0WB 1YIWA 2QHOA 1PQSA 4IC7B 4A3OA 2G4DB 4LJPB 1V6EA 4BBNC 2ZCBA 1OQYA 1IP9A 2L76A 2KXJA 4LCDE 4W9JA 2M8SA 2W9NA 2DAJA 3RD2A 2BWES 4CHKA 2BWFA 3IFWB 1ZGUB 2NVUI 2PE9A 1RRBA 1WIAA 2IO2B 3HM3A 3RZFA 4HVBA 2HE7A 2C60A 3AU4A 2D10A 3ZKJC 2RPQA 4JGHB 4A3PA 2DENB 2RD0A 3GOEA 2L05A 3PTFC 4W9HA 3M63B 2LJ5A 4MGZE 2OJRA 5AZHA 4NY0A 3KYDD 2MSED 4AJWA 1A5RA 1OTRB 3O65B 3VDZA 5J18A 4I6NB 2D11A 3H9DA 4ZRIA 3AI5A 4KDLB 4K7SA 4YL8A 4KSLC 4F1SA 3PSEB 1GJZA 2R2QA 4B9KA 2L00B 4NJ6A 4GMVA 4FHKA 3ZIMA 2XBBC 1KM7A 4AOFA 1WY8A 3W1YA 3IVFA 2O6VD 3TIXA 4BFRA 2NR2A 3VXWA 5AZGA 2C9WB 3PHWB 4W9EA 3SDLC 4GGQA 1LXDA 2ZZPB 1UBQA 1LFDA 3B1LX 1GNUA 2BYFA 1RLFA 1EO6A 3EFUA 3PRMB 2KOXA 3NZSA 3R3MA 2MP2A 4GIVA 1V86A 3SD5A 2FCSA 2BKRB 2DX5B 3B0AA 2M1MA 2GBRA 5JHBA 1Z5SB 1G6JA 1WRDB 3V6EB 5D6JB 2LVOA 4DHZE 3V61A 3L17A 2KTRA 3NY5A 1WGDA 2V4LA 4GU2A 1SIFA 5IAAC 5J2RA 4GDLB 2JUOA 3DBSA 3HHMA 4AUQC 1F9JA 2GBNA 1VD2A 3QWZB 3L13A 4MGYE 4MSMB 4F7ZA 5DPWA 2A5UA 2ZVNA 3KW5B 1S3SG 2EMSA 2KZRA 2GBKA 3EC8A 3ECIA 3KUZA 3V6CB 4KV2A 3H7PA 3VVWB 1NDDA 3T8MA 4WJOA 1WZ3A 3UQBA 3QQ8B 4BKSA 4J6IA 3OLMD 3JVZX 3VH4B 2CKHB 4FJVB 4G3XB 2DZMA 3L10B 2N9EB 5D7GA 2HD5B 2GBJA 2LRUA 3OJ4B 4NPNA 1E8ZA 1K8RB 2KFKB 1Y8RC 4F8CB 1WZ0A 4FA6A 4GDKB 1SE9A 5CTRC 4TUUA 2GMIC 2NCNA 3X0WA 2HJ8A 1ISNA 2NBVB 4BBNF 4E3CA 2JWZA 3A9JA 3ML8A 4OVVA 4MJSB 3N30A 1WMHA 2ASQA 2B3AA 2HTHA 4DBGA 2FNJB 2KD0A 1WF9A 4RM9A 4B95A 2RSUA 3KVFB 3PLVA 4MM3A 2JT4B 2M0XA 2DYOA 4MEMA 4NAWB 2YVCA 4PYUA 2IY1B 2VRRB 3NS8A 3UINB 5AZFA 3UGBB 2MBOA 4KDIC 2WYQA 2MW5A 2Z59B 5DCNA 2K1FA 3SU8X 3QC8B 3TMPB 2PEAA 1WYWB 4HK2A 4W9DA 2LI5A 1R4MI 1AARA 3UIPB 2AYOB 4DDGD 2WDTB 5LLIA 3GZNI 4IWOA 1WX7A 2A4ZA 1Q5WB 1WE6A 2MCNB 1WXMA 3RZWC 1I35A 1P9DU 4GXBA 5G55A 3CSTA 5FR6A 3L0WB 3DPDA 1XT9B 2G4SA 2ZVOA 3DVGX 2FIDA 2N1WA 4FJZA 2LGYA 4WWOA 1QZEA 2KTFA 3A4RA 3VAWA 3ZDTA 3CMMB 3IBEA 4M8NA 2V1YA 3ZNZB 2XK5B 2REXA 5DPSA 2O2VB 4K7WA 2KJHB 4W9KA 4ANWA 4LDTB 4HJKA 3RCZA 2LWPA 3VUWA 3U8ZA 5D94A 5DPTA 4W9FA 2D2QA 2JRIB 2M17A 5CHVC 4FADA 1Q0WB 1GC7A 2DHZA 2KQ7A 3RT3B 3DOWA 5BO4B 1EF5A 2MBEA 2KNBA 4IM0A 4KZ0A 3V62A 1TTNA 2R2OA 3WALA 3PRPB 3QCAA 4KIKA 4HWIB 5CHWA 2G45B 1V5TA 4ICVA 1IYFA 3JSVA 5KHOA 2J0MA 3Q3JA 2C5LC 2DZKA 3I3TB 3S2AA 1WGHA 3V60A 1WM3A 4BOZB 4FLHA 1I42A 4GB9A 4EOYA 3QHTA 4EZJA 3AU5A 2KX0A 1KLVA 5D2MB 5DPRA 4GN1A 2C7NB 1WE7A 3LDZE 4DHJB 1L2NA 3QARA 3H1UA 3H7SA 3HM6X 5E6NA 4AWJA 1WR6E 2DZJA 3QK0A 3RULA 3APDA 3N3KB 4MGIE 4HDQA 4ANUA 3TL5A 4ANXA 3KUDB 2JF5A 1H8CA 3PT2B 4AJYB 4URKA 3PRZA 5CX3A 4JL9A 1UGMA 4ZDVA 3OAWA 5C1ZA 3ZUNA 4TQ0A 2LVPA 2K6QA 4B6WA 4II3B 2LXCA 4E74A 1T0YA 2JPHA 2BF8B 2ZJDA 1J0GA 3R66C 3H6NA 2LRWA 1V5OA 2D3GA 3PV1A 2AL6A 2O6VA 1U4AA 2IYDB 3HK0A 4M8MA 3WAPA 2IZVB 2PPHA 3DBLI 3DQVA 3EHVA 3HIZA 3PREA 2LGXA 2AL3A 4KSKC 3TCAA 4K81A 2NPTA 2WX0A 3DBHI 4W9LA 4E71A 3EECA 1CMXB 1WFYA 3A9KA 3ZRCA 3K9PB 4PS3A 4W9GA 3VHTC 4DK5A 4KZCA 2N1VA 2ZCCA 4WJNA 3DVNV 1ZKHA 1WXSA 3APFA 1C3TA 2GBMA 4CYEA 4RMAA 3W1SC 4MDKE 1XQQA 2KK8A 1E5WA 2KC2A 3A1QB 3UIOB 3QAQA 3VTVA 3QA8A 3WANA 4ANVA 1YD8U 2MP2B 1V49A 2K8BA 3KYCD 2LZ6A 1WGYA 2NBUA 3D32A 3JYUA 3DCGA 2MLBA 4HCNB 5JH5C 3ML9A 3QIJA 2KTRB 4DXAB 2L3ZA 4X57B 3VTWA 2AWTA 1EF1A 2KX3A 2KVRA 2UYZB 3WA0A 3X23A 2FUHB 4JLCA 2IO3B 2L0TA 5GMVA 2N7EA 2K6DB 2RR9A 1WGRA 2ZEQA 4PS8A 3ONSA 2Y5BB 4G50A 3IG3A 4MSQB 2XEWA 1X1MA 2KHWB 4LDTD 5AEKB 2YLMA 2Z0EB 3MTNB 2KO3A 3M3JA 3PLUA 4LJOB 3ZTCA 1GG3A 4DHZB 3H7PB 2KJRA 1TZ1A 1WJ4A 4CO7A 3MJWA 1WI0A 2C7HA 2V3SA 3B08A 2BYEA 5CHFA 4XC2A 4ZRJA 2BYVE 4GOCA 1TGZB 2FIFA 3L54A 4IUMB 1V80A 4BKGA 2MBHA 1WJNA 1OEYA 4I6PA 2KMAA 2CHXA 3RUIB 3TBLD 2K39A 1NBFC 3AULA 4FHJA 5LXIB 4MELA 2I1JA 3ZDMC 2N4FA 1YX6B 1YJ1A 3A9JB 4IWPA 4JIOU 1WH3A 4WWPA 3ZTDA 2LXAA 4FULA 1IPGA 5C23A 1WMHB 3WAOA 3VUYA 1V81A 1P0RA 2LVQA 1GC6A 2ZPYA 2EMTA 2KDIA 4NNJB 1WXVA 5JZEB 4IM3A 5J17A 4NJ7A 4ICUA 5IA7A
chains in the Genus database with same CATH superfamily
4ARIA 3PVLA 3VUXA 2UWQA 4ACFA 2BYTA 4OZBA 3BY4B 4TQ1A 3GE3C 1JROA 2LGDA 1B9RA 4CQNA 1SJED 3A33B 1WR1A 1C1YB 3NHEB 1YJJA 1LQBA 4QAYA 4FJYA 1VJKA 4D2KA 5IOIA 3NG0A 2V0GA 2INNE 3AXCA 1R4NI 2CS4A 3AE2B 3PZ7A 3Q3OC 2MBQA 4PK1A 4LNIA 2K25A 2G1EA 3FILB 1NEKB 2JY6A 1KFYB 3U7DA 2K8CA 2PJHA 4RGOS 5L83A 1RYJA 3AE1B 3NOBA 3BK1A 4GDKA 1JWAD 2KDFB 4LNFA 4HRSA 5HG2A 1C4CA 2CU1A 2WXIA 4BKSD 4ZHPA 4HXDA 4EUTA 1SGHA 4A8XC 2JU6X 3C8YA 2BB5A 3PGEA 1SB3C 2EKIA 1YJIA 2HTME 4H2AA 3QX1A 1E8YA 4RFBA 1E8WA 4YWGG 4MH0E 2BBCA 4BKTA 3VR9B 2BB6A 3U30A 2N7JA 1UD7A 4G0NB 2JVCA 1K51A 3I9V1 5L95C 3ZJUA 2KVZA 2WLBA 1PDXA 2RDGA 3SHQA 2O2VA 3ZRFA 2KLCA 4EZKA 3TEZA 3Q8CA 2KWCA 2JXXA 2KDEB 2ZW1A 2FCNA 1K52A 3VH3B 2D5GA 4XWWA 4JQWC 4DHJD 1RM6C 1P1AA 2MJDA 2JQRB 1YQBA 4C00A 1LM8B 1E8XA 2J52A 1WXAA 3VFKA 1WX8A 1OGWA 2ACZB 1TBEA 4IOIE 2QSDA 1D5MC 1ZW7A 4HPLB 2KLGA 2FAZA 3PS6A 2BGFA 4XX5A 2NS5A 3TEWA 1WX9A 2D3AA 2QHOA 1PQSA 4HROA 5EE9A 4BBNC 2ZCBA 1IP9A 3ZXRA 5EE3A 4K3BA 2M8SA 4CHKA 1YN4A 3RZFA 3HM3A 2N9KA 2RPQA 3GOEA 4W9HA 2LJ5A 3N1YC 3EGRA 2MSED 4AJWA 2DLBA 3SR6A 3O65B 1FIQA 3H9DA 4ZRIA 3AI5A 1GJZA 1FO4A 4US8A 2L00B 2W54A 1WY8A 3AEAB 2OHFA 4BFRA 4W9EA 5HFYA 1LFDA 1A5RA 2BYFA 3R3MA 4OVZA 4XYCA 2MP2A 3SD5A 2FCSA 5E6JA 2M1MA 1Z5SB 1G6JA 1DGJA 1WRDB 3V6EB 3V61A 3L17A 4ZYSA 2KTRA 5J2RA 5IAAC 3QWZB 1TT5B 5DPWA 2R61A 2EMSA 3EC8A 4HJGE 3P63A 1WRIA 3H7PA 4KV2A 1NDDA 1L6VA 3I63C 3VH4B 2I38A 2PMVA 2DZMA 2GBJA 2LRUA 3OJ4B 2I2YA 4ARCA 1Y8RC 4FA6A 1WZ0A 4GDKB 2GI9A 2WXFA 4TUUA 1GB4A 3X0WA 1ISNA 3A9JA 3ML8A 1J7CA 2ASQA 4DBGA 2RSUA 5HI1A 2BS4B 2JT4B 3Q8BA 3ETRA 2YVCA 2JZPA 4PYUA 3NS8A 3UINB 1JALA 1I4XA 3QC8B 3TMPB 3N1XC 1WYWB 2LI5A 3UIPB 1YN3A 5LLIA 1WE6A 1WXMA 1E9MA 1IGCA 1QILA 2AQ1B 2W3RA 3E56A 4GXBA 3DVGX 2FIDA 4FJZA 4WWOA 3ZDTA 3IBEA 3ZGZA 1KF6B 2PTLA 4M02A 2O2VB 3AEGB 2Q5WD 4HJKA 2LWPA 5DPTA 5D3IB 2M17A 5CHVC 2WU2B 4JE3B 1EF5A 3ZYYX 2KNBA 4IM0A 2R2OA 3QCAA 4KIKA 4LK0M 5KHOA 1YOVB 2E6XA 2J0MA 2IJ0A 2C5LC 2DZKA 4FLHA 3AU5A 2D3BA 5D2MB 2G9HD 2C7NB 1WE7A 3QARA 4AWJA 3URYA 3BZDB 3QK0A 3U4EG 3KUDB 3I57A 1C77A 4AJYB 4URKA 5BMHA 3OAWA 2W55A 1NYQA 2IGDA 3BYTB 2WXKA 1J0GA 2LRWA 2IYDB 1PFDA 1TS2A 4KSKC 2AL3A 1V1PA 1PGBA 4KGRA 2MHJA 4A9AA 3NVVA 2WX0A 2KWDA 1CMXB 1WFYA 3K9PB 4PS3A 4W9GA 3VHTC 3SFEB 4KZCA 4DK5A 2ZCCA 3DVNV 1ZKHA 3BIID 4CYEA 4L23A 4HKZE 1XQQA 2V4IB 3A1QB 4ANVA 3QA8A 2MP2B 1WGYA 1HA5A 3GE8C 2KTRB 1EF1A 2FUHB 2FBWB 2IO3B 3B2GA 3N1ZC 4JLCA 1L0VB 1WGRA 2RR9A 5H8YE 4MSQB 1FNUA 5AEKB 2YLMA 1ZE3D 3H7PB 3IAM1 4CO7A 2H89B 2BW2A 2BYEA 3B08A 3MC9A 4GOCA 1T0RC 2FIFA 3L54A 4MT5A 1E0ZA 3AECB 2MBHA 2KMAA 3TBLD 2K39A 1NBFC 2WDRB 4MELA 2N4FA 1YJ1A 3KWVA 3A9JB 2Y5CA 4JIOU 4AQ7A 2LXAA 3R2IA 1K50A 1VDVA 1P0RA 2KDIA 1WXVA 2V3NA 1TS4A 5J17A 4NJ7A 4ICUA 2UU7A 5IA7A 4W9IA 3Q8FA 2KJ6A 1N60A 3CWIA 3E9SA 2WXNA 3CSFA 4S0RA 5IN7A 2XNAC 1ZP0B 1H4RA 3ALBA 2AEHA 1BMLC 4XDDA 3C0RB 1YX5B 2EELA 4BVUC 3HUIA 1UWXA 2MQJA 2BPSA 4Q2JA 3UI3A 3C19A 1Z2MA 4GDLA 3UQAA 1HQRD 4B0EA 1P3QU 1ZPSA 2WXQA 4JPSA 4DDID 1UBIA 3W2DA 3PPAA 4KIKB 1S1QB 1HE8A 3L16A 1XLPA 2KWUB 4DQOC 2L8JA 1XEEA 4RM8A 1CQVA 3OJ3A 3IAS1 1D5XC 1YQ3B 2SAKA 2EKEC 2RGFA 1UELA 2IGHA 1F2RC 2D07B 3AE8B 1HTQA 2L0FA 4IM2A 4BOSC 4P6VF 2WGSA 1WJUA 2MWSB 2KC1A 4YSXB 4NQLB 3ZQ4A 5EE0A 1K53A 2WNMA 3ZXVA 1JRUA 1XLOA 2KDBA 2IBIB 3DVNU 2ZPNA 3MC0B 3PHXB 1V1PB 3Q14C 4MGKE 1Q10A 3B2FA 1HTOA 3A4SC 1FXAA 2JZZA 1BUIC 1UH6A 1OEYJ 1NI3A 1E7VA 2MEKA 1IGDA 3N32A 1SIJA 5AUIA 3NJTA 2BKFA 1SSNA 4I6LB 2J53A 1FXIA 2WHIA 3BINA 4K7UA 3AE4B 2TSSA 2DZIA 3DHIC 2ZNVB 1T3QA 3RNCC 4W9CA 4EE2A 2K3UA 2MRPA 3LXFA 2IO0B 2LD9A 2I1KA 4KGSA 5E6PA 2N9XA 3L4PA 2FUG1 4ASWC 5JHAA 1SE3A 2L83A 2K8HA 1N62A 4IG7B 4WQOB 2JSVX 1CK1A 2N9PC 1E90A 4N58A 4IC7B 2G4DB 4KKJA 4LJPB 1I4HA 2L76A 4W9JA 1R4MB 1UUPA 2DAJA 3RD2A 3IFWB 3GZNB 1RRBA 4HVBA 1LGRA 1F1HA 1PGXA 3AU4A 2D10A 4JGHB 1MPEA 2RD0A 4B0MA 1YN5A 2OJRA 5AZHA 2L1AA 4FXCA 3VDZA 2J42A 4K7SA 3PSEB 4NJ6A 1D6EC 2K9XA 2NR2A 3VXWA 4GGQA 2ZZPB 2FE8A 3SDLC 3EFUA 3NZSA 2KOXA 2AQ3B 2DX5B 3MHZA 3P4SB 5I4DA 1QQRA 5D6JB 2ONQA 2V4LA 4GU2A 1SIFA 4LNKA 3T3NA 4GDLB 1CZPA 1TJEA 2GBNA 1D5ZC 3L13A 3KW5B 2KZRA 3KUZA 3VR8B 1N61A 1EWCA 1JWMD 1WZ3A 2VH1A 3W5VB 4LLGM 4J6IA 2VZKB 1E10A 2CKHB 3L10B 3DWGC 5JXVA 3RNFC 1YNTE 3J9CA 3NVWA 1K8RB 1SE9A 5CTRC 1L0YB 2ICIA 3SFDB 4LTUA 4OVVA 4A90A 3N30A 2KD0A 4B95A 2INCC 2QEJC 4MM3A 2M0XA 3DWMA 2M56B 3HRDD 3W9CB 5GXGB 3UGBB 1C78A 2MBOA 2WYQA 2MW5A 2Z59B 2K1FA 1GPXA 1GOZA 4M01A 4HK2A 1R4MI 2QILA 1L5PA 3GZNI 4IWOA 4N6EB 2A4ZA 1Q5WB 1I35A 5FR6A 1IBXA 3RN9C 2G4SA 2LGYA 2KTFA 2KAJA 2V1YA 3ZNZB 1BXTA 2NTSA 2WDVB 2KJHB 5FKAC 2JWUA 4N59A 2KQ4X 4W9FA 3Q6BA 3TUOA 1Q0WB 1GC7A 1ACCA 4KZ0A 1TTNA 3PRPB 3AE9B 3NZ3A 1P7EA 4EZJA 4RNAA 3FKYA 1F0ZA 3Q2AC 3IT6B 4DHJB 3H1UA 2RPVA 1ZXHA 3RULA 4MGIE 5BYQA 4HDQA 4ANXA 1I4QA 2LGIA 3PRZA 4ZDVA 3MC8A 3ZUNA 4DXGA 1QOFA 2K6QA 2LXCA 2JPHA 2BF8B 3BVGA 3H6NA 1V5OA 2D3GA 2AL6A 2O6VA 5AUKA 3WAPA 2PPHA 3BYYB 3TCAA 2LGXA 3AE3B 2BQQA 4K81A 4E71A 2V3PA 1I7HA 3U52E 3RMKC 5BMGA 4S17A 1MHXA 4BZAA 5BYSA 2RDHA 3W1SC 2KK8A 1E5WA 2KC2A 4ITKA 1GAQB 1EU4A 1MI0A 2NBUA 3DCGA 2MLBA 5JH5C 1SJHD 3QIJA 4MACA 2AQ2B 3VTWA 2AWTA 2KX3A 2UYZB 2L0TA 2WXHA 5GMVA 2K6DB 4PS8A 3ONSA 2Y5BB 2WXRA 3IG3A 4OZCA 1X1MA 2Z0EB 3IT4B 1WI0A 5CHFA 4TSSA 1TGZB 1WJNA 4MH8A 3P1MA 2CHXA 1OQQA 1YMHE 2B76B 3T3OA 3AULA 5LXIB 2QMTA 4YTMB 1JWSD 2I1JA 3AH7A 3GB1A 1UNSA 1YX6B 4REZA 2X8XX 1IPGA 5C23A 4NNJB 3EUB2 4IM3A 4MM3B 3VTUA 1WXQA 2KFJA 4HPPA 1ZUD2 2KWVB 2CU3A 4NAMA 2MA9B 1C76A 4LNNA 2MBBB 1KH0A 1IBXB 1EUVB 1XCQL 3BK2A 4ZRQA 4RGTA 4OVUA 2LHDA 4A55A 2IPKD 4UDUC 4RGMA 2KQSA 4TV3A 3RYTA 4USAA 1MHHE 1V97A 1VLBA 1VRAB 1QT9A 4ZYNA 2IGGA 2QC8A 1VCBA 4TKNA 2KKCA 3TJPA 1PYWD 5TR5A 5LNK1 2KFKA 1V9JA 3ZLZA 4HDOA 1AYFA 2M19A 3M95A 5G5HA 4M00A 4MJSA 2FCQA 2IY0B 1HZ6A 3UF8A 4L1BA 3APCA 3KUCB 2NBWB 3VRBB 1ZDVA 3NZUA 4GSWA 2CR5A 2DBYA 4HPMB 4NAWA 3BVZA 4BAXA 2Y3AA 2O6VB 2DYMA 4N9F4 4KGTA 1OQRA 2G3QB 3Q3FA 3T9LA 2WXGA 3NVYA 1RAXA 2KANA 1KOTA 4AS1A 1TKGA 3AE5B 3KH0A 3L08A 4XZ4A 2GLSA 2PKOA 2BT6A 1FD6A 1XO3A 3NUHB 5EE1A 1OFFA 2BTEA 4WJPA 2Y5PA 2J7QB 2NTTA 5G5GA 2CHWA 3BWUD 1XD3B 1MG8A 3WAMA 1Q1OA 4PS7A 2ZNVC 4YTPB 2Z0DB 4G11A 2DWQA 1L7YA 2M4NA 1V8CA 1KLGD 2NMQA 3M62B 2OOBB 3LJ3A 2INPE 1PGAA 1QKZA 1TS5A 2JXTA 2N0SB 1JWBD 3NS1A 2CJNA 3ZNGC 3VQIA 3Q3MC 1ET6A 4A3OA 1YIWA 4KX6B 3EFCA 2KXJA 2MJEA 3O13A 4RCOA 2W9NA 3N9YC 2BWFA 3AMZA 1NENB 2NVUI 1ENFA 1XXGA 2C60A 3P4RB 3ZKJC 1FFVA 4A3PA 3PTFC 4MGZE 4NY0A 2ZW0A 1OTRB 5J18A 4I6NB 2D11A 4KDLB 4YL8A 2R2QA 4B9KA 2JYTA 4GMVA 4FHKA 3ZIMA 1KM7A 4AOFA 4K3CA 3W1YA 1SEBD 1UF0A 3TIXA 3PHWB 4HKQA 1UBQA 1GNUA 1EU3A 4GIVA 1EO6A 2OEDA 2MJ3A 5JHBA 3NY5A 3DBSA 3HHMA 4XDCA 1F9JA 2Z8LA 3TEYA 4F7ZA 2A5UA 2ZVNA 3CIRB 2YEPB 2ON8A 1FCLA 3T8MA 3UQBA 1B1ZA 3QQ8B 4P16A 4BKSA 4C7YA 5IKCM 5HHDG 4FJVB 1P7FA 2QDFA 3AE6B 1QOGA 2N9EB 5D7GA 4NPNA 1E8ZA 2KFKB 4F8CB 2WXMA 2GMIC 1JCKB 2HJ8A 1L4DB 4BBNF 4C80A 1JW9D 4MJSB 1M4VA 1WMHA 2B3AA 1N63A 3NRZA 1WF9A 3RFZB 4P1CC 1AWDA 5FR3A 2LJIA 4NAWB 2VRRB 3BVMA 4KDIC 3SU8X 1AARA 4OHJA 3Q69A 4DDGD 2WDTB 1WX7A 1C79A 2QIEB 2VH2A 1TZOA 5G55A 1ZOYB 3CSTA 1FRDA 3L0WB 3DPDA 1XT9B 2ZVOA 3DHGC 2QCZA 2N1WA 3VAWA 4M8NA 5DPSA 4ANWA 4LDTB 3RCZA 3VUWA 3U8ZA 3H8HA 3LYYA 2D2QA 2KACA 4FADA 1HZ5A 3PZ8A 2DHZA 2KQ7A 3RT3B 4HWIB 5CHWA 2G45B 1RWSA 1IYFA 3JSVA 1DYQA 3AM9A 3V60A 1WM3A 4BOZB 1I42A 5DPRA 3P4QB 4TMAB 1L2NA 3HM6X 5E6NA 3RPFC 1WR6E 2DZJA 1FPYA 2JX5A 2KT7A 2PW9A 4RH6A 3APDA 4IKGA 3N3KB 1WGKA 3PT2B 1EM7A 2VZKD 4JL9A 1RFKA 5C1ZA 4TQ0A 1I4RA 2LVPA 3FAHA 3AEFB 4II3B 1T0YA 4E74A 3PV1A 1CJEA 1VR9A 4M8MA 3DQVA 2KMMA 2NPTA 4W9LA 3A9KA 3ZRCA 1ROEA 3OWEB 4RGNA 1T0SC 4WJNA 2N9LA 3APFA 1C3TA 3DBRB 1EWYC 4RMAA 4MDKE 3QAQA 4WIPA 1YD8U 4PT5A 2K0PA 2K8BA 1FM0D 4YSZB 3ML9A 3HVZA 2W82A 4DXAB 2L3ZA 4X57B 1I4PA 2KVRA 3WA0A 2OJWA 2N7EA 4G50A 1DOIA 2DNFA 3NVZA 2KHWB 4LJOB 3ZTCA 1GG3A 2WU5B 3SEBA 3VRAB 2KJRA 1TZ1A 1WJ4A 3EA6A 2C7HA 2V3SA 1FCCC 4C56C 3KQ4A 1QF6A 3AEDB 1V80A 4I6PA 2QJLA 4M0WA 1Y56A 3R8BA 2CJOA 1T6BX 4J3OD 3U7ZA 3ZDMC 1MJDA 4IWPA 1WH3A 4WWPA 3ZTDA 1HXYD 1WMHB 5D3DA 3WAOA 2LVQA 2EMTA 3AEBB 4OW0A 5JZEB 2V9HA 4DWFA 2K5PA 2KMCA 3I5JC 1J8CA 3ZW3A 1AN8A 1E7UA 1MFWA 3ZVVA 1SE2A 4A20A 2YEPF 2WWZA 3PZDA 3KWLA 3P2BA 2LEKA 1C4AA 1NYRA 2J4XA 4FBJB 4EEWA 4EZLA 2PE6B 1STEA 2C7MB 1JMLA 1F52A 4EFOA 4ZOHC 4KVGB 1NI2A 1F2RI 4HLEA 2IO1B 3R7RA 3DDCB 1BT0A 2GOWA 1UZXB 3ABVB 3WCQA 1SXTA 1P98A 4K1RB 3DBRI 4JX1C 5G2NA 4ZRKA 1MG4A 2L7RA 3DVGY 2K22A 2WXPA 5LXHA 1FXTB 3ZJVA 2JZ3B 2FCMA 1RFAA 4FN2A 1T5XD 1QOBA 1SE4A 3JSVB 2CHZA 3TEXA 2INDC 1TY2A 2LUEA 4R3DA 1KTKA 3W1SA 4EKUA 1D3ZA 1GUAB 1KRHA 3A1QA 1MVKA 2DAFA 3WIMA 4WJQA 2D3CA 4IW0A 1VZ8A 3P42A 2X38A 2J0JA 5IO9A 2WX1A 2WXOA 5HKHA 1WGGA 3V3XA 4HEA1 4AP4C 2LUMA 4WAAA 4L2YA 2N7DA 4ZRPA 4II2B 2PVGC 1E7PB 3ENEA 5KHQA 4YXDB 2NPTB 3A9KB 3RI7C 4DXFA 4NQKE 1WJ6A 3ZO5B 1SF0A 1C9FA 3QJZA 1V2YA 3R7QA 2JRHA 1WSPA 1I4GA 2XK5A 3JW0X 4IWQA 2J0KA 3MHSD 4C4VA 3IHPC 2LFIA 5E6OA 5EDSA 1N5XA 3K9OB 4WAFA 3Q3NC 1WM2A 1WWTA 2LASA 1J19A 2DYBA 1M94A 3CF6E 4P7IA 1KJTA 1C4PA 4PYZA 4YTNB 1TKYA 3ZNID 4HCPB 3Q8EA 3ZNHB 2KN5A 1J7AA 2H88B 2JYEA 4WWNA 1TYGB 2MX2A 3AEEB 4M0WB 1L6UA 1L4ZB 1V6EA 1OQYA 4O1NA 4LCDE 1J7BA 2PIAA 1JRPA 2BWES 1ZGUB 3AE7B 2PE9A 2IO2B 1WIAA 5TSSA 2HE7A 1TKEA 3LB8C 2DENB 2L05A 3M63B 3FC4A 3KYDD 4KSLC 4F1SA 3MP9A 5BMIA 2XBBC 3R2TA 2LHEA 1XCTL 2GB1A 3IVFA 1NVID 2O6VD 5AZGA 2C9WB 1JQ4A 1LXDA 3B9JA 3PRMB 3B1LX 1RLFA 1VZ6A 1V86A 3W5UB 2KYWA 2BKRB 3B0AA 2GBRA 4DHZE 2LVOA 4XGAB 5T8IA 1WGDA 2JUOA 4KKIA 4AUQC 2AX5A 1A70A 2XN9C 2SEBD 1VD2A 1FMAD 5IP4D 4MGYE 4MSMB 4RF0A 2KDMA 3Q8AA 1S3SG 2W3SA 2GBKA 3V6CB 3ECIA 2IDYA 3VVWB 4WJOA 1R7SA 1E6EB 5FK9C 3OLMD 3JVZX 3V05A 1XLNA 4G3XB 2HD5B 2WDQB 1TIFA 3N20C 1QOAA 3P4PB 2NCNA 4US9A 2NBVB 4E3CA 2JWZA 3DBLB 3RNBC 4RF1A 2RDBC 2HTHA 3DHHC 1T0QC 2FNJB 3DBHB 2WXLA 4RM9A 3KVFB 3PLVA 3PO0A 2DYOA 1ZXIA 2E3TA 4MEMA 5C3JB 1HEZE 2IY1B 4YSYB 1ET9A 5AZFA 2GRIA 5DCNA 3ZJTA 4ZHOA 2PEAA 1FEHA 4W9DA 3AB5A 4JWUC 2AYOB 2M0AA 2PVOD 2MCNB 3RZWC 1KLUD 1P9DU 2LGSA 3IXSA 2MH7A 2RMMA 2HJ1A 1QZEA 3A4RA 3CMMB 1LO5D 4WQMA 4GLSC 2XK5B 2REXA 4OZAA 4K7WA 3MFGA 4W9KA 1PUTA 4C4VB 5D94A 2JRIB 3AV8A 2LMCA 1DOYA 3DOWA 2WQYB 5BO4B 2MBEA 3V62A 4NJCA 3WALA 1GB1A 1V5TA 4ICVA 2L32A 4A6QA 3Q3JA 1FRRA 3I3TB 1SBBB 1WGHA 3S2AA 3FILA 2PLPA 3HVDA 1TS3A 4GB9A 4EOYA 3QHTA 3RNGC 2KX0A 1KLVA 4GN1A 3LDZE 3H7SA 1DOXA 4ANUA 3TL5A 4WH4A 1N6ZA 2BS2B 2JF5A 1H8CA 3GP7A 5CX3A 1UGMA 1FFUA 3U2SC 1AW7A 1UGJA 4B6WA 1F77A 2ZJDA 4C7ZA 3R66C 1XF5L 1U4AA 4WWMA 3HK0A 3PREA 2IZVB 1VZ7A 3DBLI 3EHVA 3HIZA 3TSSA 4XWTA 4P1BC 1L0XB 3DBHI 4WURA 3EECA 2L52A 1N5WA 1JWUD 2N1VA 3RNEC 4LNOA 1V1OA 1UWMA 1WXSA 1WYGA 2HDEA 2GBMA 1R4NB 3UIOB 1ZDXA 3VTVA 2BS3B 3WANA 1TY0A 1V49A 3KYCD 2LZ6A 3OG5A 1QLBB 3D32A 3JYUA 4HCNB 4NZLB 1YQ4B 3AN1A 3X23A 2ZEQA 2WXJA 5MPOA 1FNVA 2XEWA 1D4BA 4XE0A 4LDTD 5H92C 3MTNB 2KO3A 3M3JA 3PLUA 4DHZB 4JWSC 3MJWA 3GS2A 2WS3B 4ZRJA 4XC2A 4IUMB 2BYVE 3MJ5A 2KN4A 4BKGA 1OEYA 3RUIB 1FNWA 3RNAC 2WP9B 4FHJA 3KLSX 4IDIA 5BYRA 4YT0B 4FULA 1ESFA 2BVCA 3VUYA 1V81A 1XLQA 1GC6A 2ZPYA 5C2TB 1IUEA
chains in the Genus database with same CATH topology
3VTUA 4DWFA 2KMCA 1J8CA 3PVLA 4W9IA 3VUXA 3ZW3A 2KFJA 2UWQA 1E7UA 2KJ6A 3ZVVA 3BY4B 4TQ1A 2KWVB 2LGDA 4A20A 2WWZA 3PZDA 3P2BA 3CSFA 2MA9B 4FBJB 4EEWA 3A33B 2MBBB 4EZLA 2PE6B 1WR1A 2C7MB 1H4RA 3ALBA 4EFOA 1C1YB 1EUVB 3NHEB 2AEHA 3C0RB 1LQBA 4KVGB 1NI2A 4HLEA 2IO1B 4FJYA 3R7RA 1YX5B 3DDCB 1BT0A 4BVUC 2GOWA 1UZXB 2MQJA 2BPSA 4OVUA 4GDLA 1Z2MA 3UQAA 1P98A 4K1RB 3DBRI 1P3QU 3AXCA 1R4NI 2CS4A 5G2NA 4ZRKA 4DDID 2L7RA 3DVGY 1UBIA 5LXHA 1FXTB 2JZ3B 2KQSA 4TV3A 2MBQA 2FCMA 1RFAA 4FN2A 3RYTA 3PPAA 4KIKB 1S1QB 1HE8A 3L16A 3JSVB 2CHZA 2KWUB 2L8JA 2K25A 4RM8A 4ZYNA 3OJ3A 2JY6A 2LUEA 3W1SA 1VCBA 4TKNA 3U7DA 2KKCA 2K8CA 3TJPA 4EKUA 1GUAB 1D3ZA 2PJHA 2EKEC 2RGFA 3A1QA 1UELA 5TR5A 2D07B 5L83A 2KFKA 3NOBA 1V9JA 2DAFA 3WIMA 3ZLZA 4GDKA 4WJQA 4HDOA 4IW0A 2L0FA 2KDFB 3M95A 2J0JA 4IM2A 4BOSC 1WJUA 4MJSA 2FCQA 2IY0B 3UF8A 2MWSB 2CU1A 2KC1A 2WX1A 3APCA 4BKSD 5HKHA 1WGGA 4HXDA 4EUTA 3KUCB 2NBWB 4NQLB 1SGHA 4AP4C 3NZUA 4GSWA 2CR5A 4HPMB 4WAAA 4NAWA 3PGEA 1JRUA 2N7DA 2KDBA 2IBIB 3QX1A 1E8YA 2O6VB 1E8WA 4II2B 3DVNU 2DYMA 2ZPNA 4MH0E 3PHXB 4N9F4 4BKTA 3ENEA 5KHQA 2G3QB 4MGKE 2NPTB 3A9KB 3Q3FA 3T9LA 3A4SC 3U30A 2JZZA 1RAXA 2KANA 1UD7A 1UH6A 1WJ6A 4G0NB 4NQKE 3ZO5B 1KOTA 2JVCA 1OEYJ 3KH0A 5L95C 1E7VA 3L08A 4XZ4A 3N32A 3QJZA 1V2YA 3R7QA 2BKFA 2JRHA 2XK5A 3JW0X 4IWQA 4I6LB 2J0KA 4WJPA 3MHSD 3SHQA 2O2VA 3IHPC 3ZRFA 2KLCA 2J7QB 5E6OA 3BINA 4K7UA 4EZKA 5EDSA 2KWCA 2JXXA 3K9OB 2CHWA 2KDEB 2FCNA 1XD3B 2DZIA 1MG8A 3WAMA 1WM2A 2LASA 3VH3B 1J19A 2DYBA 1Q1OA 2ZNVB 1M94A 4JQWC 4PS7A 2ZNVC 4W9CA 4DHJD 3CF6E 4P7IA 2Z0DB 4G11A 1KJTA 4PYZA 1P1AA 1L7YA 2M4NA 2MRPA 1YQBA 3ZNID 2IO0B 2LD9A 4HCPB 1LM8B 1E8XA 2I1KA 3M62B 1WXAA 3VFKA 5E6PA 2N9XA 1WX8A 1OGWA 2OOBB 3ZNHB 2KN5A 1TBEA 3LJ3A 4ASWC 5JHAA 1ZW7A 2K8HA 4HPLB 4IG7B 4WQOB 2KLGA 4WWNA 2FAZA 3PS6A 2BGFA 4XX5A 2MX2A 2NS5A 3VQIA 3ZNGC 1WX9A 2N9PC 1E90A 4M0WB 1YIWA 2QHOA 1PQSA 4IC7B 4A3OA 2G4DB 4LJPB 1V6EA 4BBNC 2ZCBA 1OQYA 1IP9A 2L76A 2KXJA 4LCDE 4W9JA 2M8SA 2W9NA 2DAJA 3RD2A 2BWES 4CHKA 2BWFA 3IFWB 1ZGUB 2NVUI 2PE9A 1RRBA 1WIAA 2IO2B 3HM3A 3RZFA 4HVBA 2HE7A 2C60A 3AU4A 2D10A 3ZKJC 2RPQA 4JGHB 4A3PA 2DENB 2RD0A 3GOEA 2L05A 3PTFC 4W9HA 3M63B 2LJ5A 4MGZE 2OJRA 5AZHA 4NY0A 3KYDD 2MSED 4AJWA 1A5RA 1OTRB 3O65B 3VDZA 5J18A 4I6NB 2D11A 3H9DA 4ZRIA 3AI5A 4KDLB 4K7SA 4YL8A 4KSLC 4F1SA 3PSEB 1GJZA 2R2QA 4B9KA 2L00B 4NJ6A 4GMVA 4FHKA 3ZIMA 2XBBC 1KM7A 4AOFA 1WY8A 3W1YA 3IVFA 2O6VD 3TIXA 4BFRA 2NR2A 3VXWA 5AZGA 2C9WB 3PHWB 4W9EA 3SDLC 4GGQA 1LXDA 2ZZPB 1UBQA 1LFDA 3B1LX 1GNUA 2BYFA 1RLFA 1EO6A 3EFUA 3PRMB 2KOXA 3NZSA 3R3MA 2MP2A 4GIVA 1V86A 3SD5A 2FCSA 2BKRB 2DX5B 3B0AA 2M1MA 2GBRA 5JHBA 1Z5SB 1G6JA 1WRDB 3V6EB 5D6JB 2LVOA 4DHZE 3V61A 3L17A 2KTRA 3NY5A 1WGDA 2V4LA 4GU2A 1SIFA 5IAAC 5J2RA 4GDLB 2JUOA 3DBSA 3HHMA 4AUQC 1F9JA 2GBNA 1VD2A 3QWZB 3L13A 4MGYE 4MSMB 4F7ZA 5DPWA 2A5UA 2ZVNA 3KW5B 1S3SG 2EMSA 2KZRA 2GBKA 3EC8A 3ECIA 3KUZA 3V6CB 4KV2A 3H7PA 3VVWB 1NDDA 3T8MA 4WJOA 1WZ3A 3UQBA 3QQ8B 4BKSA 4J6IA 3OLMD 3JVZX 3VH4B 2CKHB 4FJVB 4G3XB 2DZMA 3L10B 2N9EB 5D7GA 2HD5B 2GBJA 2LRUA 3OJ4B 4NPNA 1E8ZA 1K8RB 2KFKB 1Y8RC 4F8CB 1WZ0A 4FA6A 4GDKB 1SE9A 5CTRC 4TUUA 2GMIC 2NCNA 3X0WA 2HJ8A 1ISNA 2NBVB 4BBNF 4E3CA 2JWZA 3A9JA 3ML8A 4OVVA 4MJSB 3N30A 1WMHA 2ASQA 2B3AA 2HTHA 4DBGA 2FNJB 2KD0A 1WF9A 4RM9A 4B95A 2RSUA 3KVFB 3PLVA 4MM3A 2JT4B 2M0XA 2DYOA 4MEMA 4NAWB 2YVCA 4PYUA 2IY1B 2VRRB 3NS8A 3UINB 5AZFA 3UGBB 2MBOA 4KDIC 2WYQA 2MW5A 2Z59B 5DCNA 2K1FA 3SU8X 3QC8B 3TMPB 2PEAA 1WYWB 4HK2A 4W9DA 2LI5A 1R4MI 1AARA 3UIPB 2AYOB 4DDGD 2WDTB 5LLIA 3GZNI 4IWOA 1WX7A 2A4ZA 1Q5WB 1WE6A 2MCNB 1WXMA 3RZWC 1I35A 1P9DU 4GXBA 5G55A 3CSTA 5FR6A 3L0WB 3DPDA 1XT9B 2G4SA 2ZVOA 3DVGX 2FIDA 2N1WA 4FJZA 2LGYA 4WWOA 1QZEA 2KTFA 3A4RA 3VAWA 3ZDTA 3CMMB 3IBEA 4M8NA 2V1YA 3ZNZB 2XK5B 2REXA 5DPSA 2O2VB 4K7WA 2KJHB 4W9KA 4ANWA 4LDTB 4HJKA 3RCZA 2LWPA 3VUWA 3U8ZA 5D94A 5DPTA 4W9FA 2D2QA 2JRIB 2M17A 5CHVC 4FADA 1Q0WB 1GC7A 2DHZA 2KQ7A 3RT3B 3DOWA 5BO4B 1EF5A 2MBEA 2KNBA 4IM0A 4KZ0A 3V62A 1TTNA 2R2OA 3WALA 3PRPB 3QCAA 4KIKA 4HWIB 5CHWA 2G45B 1V5TA 4ICVA 1IYFA 3JSVA 5KHOA 2J0MA 3Q3JA 2C5LC 2DZKA 3I3TB 3S2AA 1WGHA 3V60A 1WM3A 4BOZB 4FLHA 1I42A 4GB9A 4EOYA 3QHTA 4EZJA 3AU5A 2KX0A 1KLVA 5D2MB 5DPRA 4GN1A 2C7NB 1WE7A 3LDZE 4DHJB 1L2NA 3QARA 3H1UA 3H7SA 3HM6X 5E6NA 4AWJA 1WR6E 2DZJA 3QK0A 3RULA 3APDA 3N3KB 4MGIE 4HDQA 4ANUA 3TL5A 4ANXA 3KUDB 2JF5A 1H8CA 3PT2B 4AJYB 4URKA 3PRZA 5CX3A 4JL9A 1UGMA 4ZDVA 3OAWA 5C1ZA 3ZUNA 4TQ0A 2LVPA 2K6QA 4B6WA 4II3B 2LXCA 4E74A 1T0YA 2JPHA 2BF8B 2ZJDA 1J0GA 3R66C 3H6NA 2LRWA 1V5OA 2D3GA 3PV1A 2AL6A 2O6VA 1U4AA 2IYDB 3HK0A 4M8MA 3WAPA 2IZVB 2PPHA 3DBLI 3DQVA 3EHVA 3HIZA 3PREA 2LGXA 2AL3A 4KSKC 3TCAA 4K81A 2NPTA 2WX0A 3DBHI 4W9LA 4E71A 3EECA 1CMXB 1WFYA 3A9KA 3ZRCA 3K9PB 4PS3A 4W9GA 3VHTC 4DK5A 4KZCA 2N1VA 2ZCCA 4WJNA 3DVNV 1ZKHA 1WXSA 3APFA 1C3TA 2GBMA 4CYEA 4RMAA 3W1SC 4MDKE 1XQQA 2KK8A 1E5WA 2KC2A 3A1QB 3UIOB 3QAQA 3VTVA 3QA8A 3WANA 4ANVA 1YD8U 2MP2B 1V49A 2K8BA 3KYCD 2LZ6A 1WGYA 2NBUA 3D32A 3JYUA 3DCGA 2MLBA 4HCNB 5JH5C 3ML9A 3QIJA 2KTRB 4DXAB 2L3ZA 4X57B 3VTWA 2AWTA 1EF1A 2KX3A 2KVRA 2UYZB 3WA0A 3X23A 2FUHB 4JLCA 2IO3B 2L0TA 5GMVA 2N7EA 2K6DB 2RR9A 1WGRA 2ZEQA 4PS8A 3ONSA 2Y5BB 4G50A 3IG3A 4MSQB 2XEWA 1X1MA 2KHWB 4LDTD 5AEKB 2YLMA 2Z0EB 3MTNB 2KO3A 3M3JA 3PLUA 4LJOB 3ZTCA 1GG3A 4DHZB 3H7PB 2KJRA 1TZ1A 1WJ4A 4CO7A 3MJWA 1WI0A 2C7HA 2V3SA 3B08A 2BYEA 5CHFA 4XC2A 4ZRJA 2BYVE 4GOCA 1TGZB 2FIFA 3L54A 4IUMB 1V80A 4BKGA 2MBHA 1WJNA 1OEYA 4I6PA 2KMAA 2CHXA 3RUIB 3TBLD 2K39A 1NBFC 3AULA 4FHJA 5LXIB 4MELA 2I1JA 3ZDMC 2N4FA 1YX6B 1YJ1A 3A9JB 4IWPA 4JIOU 1WH3A 4WWPA 3ZTDA 2LXAA 4FULA 1IPGA 5C23A 1WMHB 3WAOA 3VUYA 1V81A 1P0RA 2LVQA 1GC6A 2ZPYA 2EMTA 2KDIA 4NNJB 1WXVA 5JZEB 4IM3A 5J17A 4NJ7A 4ICUA 5IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTU A;  4DWF A;  2KMC A;  1J8C A;  3PVL A;  4W9I A;  3VUX A;  3ZW3 A;  2KFJ A;  2UWQ A;  1E7U A;  2KJ6 A;  3ZVV A;  3BY4 B;  4TQ1 A;  2KWV B;  2LGD A;  4A20 A;  2WWZ A;  3PZD A;  3P2B A;  3CSF A;  2MA9 B;  4FBJ B;  4EEW A;  3A33 B;  2MBB B;  4EZL A;  2PE6 B;  1WR1 A;  2C7M B;  1H4R A;  3ALB A;  4EFO A;  1C1Y B;  1EUV B;  3NHE B;  2AEH A;  3C0R B;  1LQB A;  4KVG B;  1NI2 A;  4HLE A;  2IO1 B;  4FJY A;  3R7R A;  1YX5 B;  3DDC B;  1BT0 A;  4BVU C;  2GOW A;  1UZX B;  2MQJ A;  2BPS A;  4OVU A;  4GDL A;  1Z2M A;  3UQA A;  1P98 A;  4K1R B;  3DBR I;  1P3Q U;  3AXC A;  1R4N I;  2CS4 A;  5G2N A;  4ZRK A;  4DDI D;  2L7R A;  3DVG Y;  1UBI A;  5LXH A;  1FXT B;  2JZ3 B;  2KQS A;  4TV3 A;  2MBQ A;  2FCM A;  1RFA A;  4FN2 A;  3RYT A;  3PPA A;  4KIK B;  1S1Q B;  1HE8 A;  3L16 A;  3JSV B;  2CHZ A;  2KWU B;  2L8J A;  2K25 A;  4RM8 A;  4ZYN A;  3OJ3 A;  2JY6 A;  2LUE A;  3W1S A;  1VCB A;  4TKN A;  3U7D A;  2KKC A;  2K8C A;  3TJP A;  4EKU A;  1GUA B;  1D3Z A;  2PJH A;  2EKE C;  2RGF A;  3A1Q A;  1UEL A;  5TR5 A;  2D07 B;  5L83 A;  2KFK A;  3NOB A;  1V9J A;  2DAF A;  3WIM A;  3ZLZ A;  4GDK A;  4WJQ A;  4HDO A;  4IW0 A;  2L0F A;  2KDF B;  3M95 A;  2J0J A;  4IM2 A;  4BOS C;  1WJU A;  4MJS A;  2FCQ A;  2IY0 B;  3UF8 A;  2MWS B;  2CU1 A;  2KC1 A;  2WX1 A;  3APC A;  4BKS D;  5HKH A;  1WGG A;  4HXD A;  4EUT A;  3KUC B;  2NBW B;  4NQL B;  1SGH A;  4AP4 C;  3NZU A;  4GSW A;  2CR5 A;  4HPM B;  4WAA A;  4NAW A;  3PGE A;  1JRU A;  2N7D A;  2KDB A;  2IBI B;  3QX1 A;  1E8Y A;  2O6V B;  1E8W A;  4II2 B;  3DVN U;  2DYM A;  2ZPN A;  4MH0 E;  3PHX B;  4N9F 4;  4BKT A;  3ENE A;  5KHQ A;  2G3Q B;  4MGK E;  2NPT B;  3A9K B;  3Q3F A;  3T9L A;  3A4S C;  3U30 A;  2JZZ A;  1RAX A;  2KAN A;  1UD7 A;  1UH6 A;  1WJ6 A;  4G0N B;  4NQK E;  3ZO5 B;  1KOT A;  2JVC A;  1OEY J;  3KH0 A;  5L95 C;  1E7V A;  3L08 A;  4XZ4 A;  3N32 A;  3QJZ A;  1V2Y A;  3R7Q A;  2BKF A;  2JRH A;  2XK5 A;  3JW0 X;  4IWQ A;  4I6L B;  2J0K A;  4WJP A;  3MHS D;  3SHQ A;  2O2V A;  3IHP C;  3ZRF A;  2KLC A;  2J7Q B;  5E6O A;  3BIN A;  4K7U A;  4EZK A;  5EDS A;  2KWC A;  2JXX A;  3K9O B;  2CHW A;  2KDE B;  2FCN A;  1XD3 B;  2DZI A;  1MG8 A;  3WAM A;  1WM2 A;  2LAS A;  3VH3 B;  1J19 A;  2DYB A;  1Q1O A;  2ZNV B;  1M94 A;  4JQW C;  4PS7 A;  2ZNV C;  4W9C A;  4DHJ D;  3CF6 E;  4P7I A;  2Z0D B;  4G11 A;  1KJT A;  4PYZ A;  1P1A A;  1L7Y A;  2M4N A;  2MRP A;  1YQB A;  3ZNI D;  2IO0 B;  2LD9 A;  4HCP B;  1LM8 B;  1E8X A;  2I1K A;  3M62 B;  1WXA A;  3VFK A;  5E6P A;  2N9X A;  1WX8 A;  1OGW A;  2OOB B;  3ZNH B;  2KN5 A;  1TBE A;  3LJ3 A;  4ASW C;  5JHA A;  1ZW7 A;  2K8H A;  4HPL B;  4IG7 B;  4WQO B;  2KLG A;  4WWN A;  2FAZ A;  3PS6 A;  2BGF A;  4XX5 A;  2MX2 A;  2NS5 A;  3VQI A;  3ZNG C;  1WX9 A;  2N9P C;  1E90 A;  4M0W B;  1YIW A;  2QHO A;  1PQS A;  4IC7 B;  4A3O A;  2G4D B;  4LJP B;  1V6E A;  4BBN C;  2ZCB A;  1OQY A;  1IP9 A;  2L76 A;  2KXJ A;  4LCD E;  4W9J A;  2M8S A;  2W9N A;  2DAJ A;  3RD2 A;  2BWE S;  4CHK A;  2BWF A;  3IFW B;  1ZGU B;  2NVU I;  2PE9 A;  1RRB A;  1WIA A;  2IO2 B;  3HM3 A;  3RZF A;  4HVB A;  2HE7 A;  2C60 A;  3AU4 A;  2D10 A;  3ZKJ C;  2RPQ A;  4JGH B;  4A3P A;  2DEN B;  2RD0 A;  3GOE A;  2L05 A;  3PTF C;  4W9H A;  3M63 B;  2LJ5 A;  4MGZ E;  2OJR A;  5AZH A;  4NY0 A;  3KYD D;  2MSE D;  4AJW A;  1A5R A;  1OTR B;  3O65 B;  3VDZ A;  5J18 A;  4I6N B;  2D11 A;  3H9D A;  4ZRI A;  3AI5 A;  4KDL B;  4K7S A;  4YL8 A;  4KSL C;  4F1S A;  3PSE B;  1GJZ A;  2R2Q A;  4B9K A;  2L00 B;  4NJ6 A;  4GMV A;  4FHK A;  3ZIM A;  2XBB C;  1KM7 A;  4AOF A;  1WY8 A;  3W1Y A;  3IVF A;  2O6V D;  3TIX A;  4BFR A;  2NR2 A;  3VXW A;  5AZG A;  2C9W B;  3PHW B;  4W9E A;  3SDL C;  4GGQ A;  1LXD A;  2ZZP B;  1UBQ A;  1LFD A;  3B1L X;  1GNU A;  2BYF A;  1RLF A;  1EO6 A;  3EFU A;  3PRM B;  2KOX A;  3NZS A;  3R3M A;  2MP2 A;  4GIV A;  1V86 A;  3SD5 A;  2FCS A;  2BKR B;  2DX5 B;  3B0A A;  2M1M A;  2GBR A;  5JHB A;  1Z5S B;  1G6J A;  1WRD B;  3V6E B;  5D6J B;  2LVO A;  4DHZ E;  3V61 A;  3L17 A;  2KTR A;  3NY5 A;  1WGD A;  2V4L A;  4GU2 A;  1SIF A;  5IAA C;  5J2R A;  4GDL B;  2JUO A;  3DBS A;  3HHM A;  4AUQ C;  1F9J A;  2GBN A;  1VD2 A;  3QWZ B;  3L13 A;  4MGY E;  4MSM B;  4F7Z A;  5DPW A;  2A5U A;  2ZVN A;  3KW5 B;  1S3S G;  2EMS A;  2KZR A;  2GBK A;  3EC8 A;  3ECI A;  3KUZ A;  3V6C B;  4KV2 A;  3H7P A;  3VVW B;  1NDD A;  3T8M A;  4WJO A;  1WZ3 A;  3UQB A;  3QQ8 B;  4BKS A;  4J6I A;  3OLM D;  3JVZ X;  3VH4 B;  2CKH B;  4FJV B;  4G3X B;  2DZM A;  3L10 B;  2N9E B;  5D7G A;  2HD5 B;  2GBJ A;  2LRU A;  3OJ4 B;  4NPN A;  1E8Z A;  1K8R B;  2KFK B;  1Y8R C;  4F8C B;  1WZ0 A;  4FA6 A;  4GDK B;  1SE9 A;  5CTR C;  4TUU A;  2GMI C;  2NCN A;  3X0W A;  2HJ8 A;  1ISN A;  2NBV B;  4BBN F;  4E3C A;  2JWZ A;  3A9J A;  3ML8 A;  4OVV A;  4MJS B;  3N30 A;  1WMH A;  2ASQ A;  2B3A A;  2HTH A;  4DBG A;  2FNJ B;  2KD0 A;  1WF9 A;  4RM9 A;  4B95 A;  2RSU A;  3KVF B;  3PLV A;  4MM3 A;  2JT4 B;  2M0X A;  2DYO A;  4MEM A;  4NAW B;  2YVC A;  4PYU A;  2IY1 B;  2VRR B;  3NS8 A;  3UIN B;  5AZF A;  3UGB B;  2MBO A;  4KDI C;  2WYQ A;  2MW5 A;  2Z59 B;  5DCN A;  2K1F A;  3SU8 X;  3QC8 B;  3TMP B;  2PEA A;  1WYW B;  4HK2 A;  4W9D A;  2LI5 A;  1R4M I;  1AAR A;  3UIP B;  2AYO B;  4DDG D;  2WDT B;  5LLI A;  3GZN I;  4IWO A;  1WX7 A;  2A4Z A;  1Q5W B;  1WE6 A;  2MCN B;  1WXM A;  3RZW C;  1I35 A;  1P9D U;  4GXB A;  5G55 A;  3CST A;  5FR6 A;  3L0W B;  3DPD A;  1XT9 B;  2G4S A;  2ZVO A;  3DVG X;  2FID A;  2N1W A;  4FJZ A;  2LGY A;  4WWO A;  1QZE A;  2KTF A;  3A4R A;  3VAW A;  3ZDT A;  3CMM B;  3IBE A;  4M8N A;  2V1Y A;  3ZNZ B;  2XK5 B;  2REX A;  5DPS A;  2O2V B;  4K7W A;  2KJH B;  4W9K A;  4ANW A;  4LDT B;  4HJK A;  3RCZ A;  2LWP A;  3VUW A;  3U8Z A;  5D94 A;  5DPT A;  4W9F A;  2D2Q A;  2JRI B;  2M17 A;  5CHV C;  4FAD A;  1Q0W B;  1GC7 A;  2DHZ A;  2KQ7 A;  3RT3 B;  3DOW A;  5BO4 B;  1EF5 A;  2MBE A;  2KNB A;  4IM0 A;  4KZ0 A;  3V62 A;  1TTN A;  2R2O A;  3WAL A;  3PRP B;  3QCA A;  4KIK A;  4HWI B;  5CHW A;  2G45 B;  1V5T A;  4ICV A;  1IYF A;  3JSV A;  5KHO A;  2J0M A;  3Q3J A;  2C5L C;  2DZK A;  3I3T B;  3S2A A;  1WGH A;  3V60 A;  1WM3 A;  4BOZ B;  4FLH A;  1I42 A;  4GB9 A;  4EOY A;  3QHT A;  4EZJ A;  3AU5 A;  2KX0 A;  1KLV A;  5D2M B;  5DPR A;  4GN1 A;  2C7N B;  1WE7 A;  3LDZ E;  4DHJ B;  1L2N A;  3QAR A;  3H1U A;  3H7S A;  3HM6 X;  5E6N A;  4AWJ A;  1WR6 E;  2DZJ A;  3QK0 A;  3RUL A;  3APD A;  3N3K B;  4MGI E;  4HDQ A;  4ANU A;  3TL5 A;  4ANX A;  3KUD B;  2JF5 A;  1H8C A;  3PT2 B;  4AJY B;  4URK A;  3PRZ A;  5CX3 A;  4JL9 A;  1UGM A;  4ZDV A;  3OAW A;  5C1Z A;  3ZUN A;  4TQ0 A;  2LVP A;  2K6Q A;  4B6W A;  4II3 B;  2LXC A;  4E74 A;  1T0Y A;  2JPH A;  2BF8 B;  2ZJD A;  1J0G A;  3R66 C;  3H6N A;  2LRW A;  1V5O A;  2D3G A;  3PV1 A;  2AL6 A;  2O6V A;  1U4A A;  2IYD B;  3HK0 A;  4M8M A;  3WAP A;  2IZV B;  2PPH A;  3DBL I;  3DQV A;  3EHV A;  3HIZ A;  3PRE A;  2LGX A;  2AL3 A;  4KSK C;  3TCA A;  4K81 A;  2NPT A;  2WX0 A;  3DBH I;  4W9L A;  4E71 A;  3EEC A;  1CMX B;  1WFY A;  3A9K A;  3ZRC A;  3K9P B;  4PS3 A;  4W9G A;  3VHT C;  4DK5 A;  4KZC A;  2N1V A;  2ZCC A;  4WJN A;  3DVN V;  1ZKH A;  1WXS A;  3APF A;  1C3T A;  2GBM A;  4CYE A;  4RMA A;  3W1S C;  4MDK E;  1XQQ A;  2KK8 A;  1E5W A;  2KC2 A;  3A1Q B;  3UIO B;  3QAQ A;  3VTV A;  3QA8 A;  3WAN A;  4ANV A;  1YD8 U;  2MP2 B;  1V49 A;  2K8B A;  3KYC D;  2LZ6 A;  1WGY A;  2NBU A;  3D32 A;  3JYU A;  3DCG A;  2MLB A;  4HCN B;  5JH5 C;  3ML9 A;  3QIJ A;  2KTR B;  4DXA B;  2L3Z A;  4X57 B;  3VTW A;  2AWT A;  1EF1 A;  2KX3 A;  2KVR A;  2UYZ B;  3WA0 A;  3X23 A;  2FUH B;  4JLC A;  2IO3 B;  2L0T A;  5GMV A;  2N7E A;  2K6D B;  2RR9 A;  1WGR A;  2ZEQ A;  4PS8 A;  3ONS A;  2Y5B B;  4G50 A;  3IG3 A;  4MSQ B;  2XEW A;  1X1M A;  2KHW B;  4LDT D;  5AEK B;  2YLM A;  2Z0E B;  3MTN B;  2KO3 A;  3M3J A;  3PLU A;  4LJO B;  3ZTC A;  1GG3 A;  4DHZ B;  3H7P B;  2KJR A;  1TZ1 A;  1WJ4 A;  4CO7 A;  3MJW A;  1WI0 A;  2C7H A;  2V3S A;  3B08 A;  2BYE A;  5CHF A;  4XC2 A;  4ZRJ A;  2BYV E;  4GOC A;  1TGZ B;  2FIF A;  3L54 A;  4IUM B;  1V80 A;  4BKG A;  2MBH A;  1WJN A;  1OEY A;  4I6P A;  2KMA A;  2CHX A;  3RUI B;  3TBL D;  2K39 A;  1NBF C;  3AUL A;  4FHJ A;  5LXI B;  4MEL A;  2I1J A;  3ZDM C;  2N4F A;  1YX6 B;  1YJ1 A;  3A9J B;  4IWP A;  4JIO U;  1WH3 A;  4WWP A;  3ZTD A;  2LXA A;  4FUL A;  1IPG A;  5C23 A;  1WMH B;  3WAO A;  3VUY A;  1V81 A;  1P0R A;  2LVQ A;  1GC6 A;  2ZPY A;  2EMT A;  2KDI A;  4NNJ B;  1WXV A;  5JZE B;  4IM3 A;  5J17 A;  4NJ7 A;  4ICU A;  5IA7 A; 
#chains in the Genus database with same CATH topology
 4ARI A;  3PVL A;  3VUX A;  2UWQ A;  4ACF A;  2BYT A;  4OZB A;  3BY4 B;  4TQ1 A;  3GE3 C;  1JRO A;  2LGD A;  1B9R A;  4CQN A;  1SJE D;  3A33 B;  1WR1 A;  1C1Y B;  3NHE B;  1YJJ A;  1LQB A;  4QAY A;  4FJY A;  1VJK A;  4D2K A;  5IOI A;  3NG0 A;  2V0G A;  2INN E;  3AXC A;  1R4N I;  2CS4 A;  3AE2 B;  3PZ7 A;  3Q3O C;  2MBQ A;  4PK1 A;  4LNI A;  2K25 A;  2G1E A;  3FIL B;  1NEK B;  2JY6 A;  1KFY B;  3U7D A;  2K8C A;  2PJH A;  4RGO S;  5L83 A;  1RYJ A;  3AE1 B;  3NOB A;  3BK1 A;  4GDK A;  1JWA D;  2KDF B;  4LNF A;  4HRS A;  5HG2 A;  1C4C A;  2CU1 A;  2WXI A;  4BKS D;  4ZHP A;  4HXD A;  4EUT A;  1SGH A;  4A8X C;  2JU6 X;  3C8Y A;  2BB5 A;  3PGE A;  1SB3 C;  2EKI A;  1YJI A;  2HTM E;  4H2A A;  3QX1 A;  1E8Y A;  4RFB A;  1E8W A;  4YWG G;  4MH0 E;  2BBC A;  4BKT A;  3VR9 B;  2BB6 A;  3U30 A;  2N7J A;  1UD7 A;  4G0N B;  2JVC A;  1K51 A;  3I9V 1;  5L95 C;  3ZJU A;  2KVZ A;  2WLB A;  1PDX A;  2RDG A;  3SHQ A;  2O2V A;  3ZRF A;  2KLC A;  4EZK A;  3TEZ A;  3Q8C A;  2KWC A;  2JXX A;  2KDE B;  2ZW1 A;  2FCN A;  1K52 A;  3VH3 B;  2D5G A;  4XWW A;  4JQW C;  4DHJ D;  1RM6 C;  1P1A A;  2MJD A;  2JQR B;  1YQB A;  4C00 A;  1LM8 B;  1E8X A;  2J52 A;  1WXA A;  3VFK A;  1WX8 A;  1OGW A;  2ACZ B;  1TBE A;  4IOI E;  2QSD A;  1D5M C;  1ZW7 A;  4HPL B;  2KLG A;  2FAZ A;  3PS6 A;  2BGF A;  4XX5 A;  2NS5 A;  3TEW A;  1WX9 A;  2D3A A;  2QHO A;  1PQS A;  4HRO A;  5EE9 A;  4BBN C;  2ZCB A;  1IP9 A;  3ZXR A;  5EE3 A;  4K3B A;  2M8S A;  4CHK A;  1YN4 A;  3RZF A;  3HM3 A;  2N9K A;  2RPQ A;  3GOE A;  4W9H A;  2LJ5 A;  3N1Y C;  3EGR A;  2MSE D;  4AJW A;  2DLB A;  3SR6 A;  3O65 B;  1FIQ A;  3H9D A;  4ZRI A;  3AI5 A;  1GJZ A;  1FO4 A;  4US8 A;  2L00 B;  2W54 A;  1WY8 A;  3AEA B;  2OHF A;  4BFR A;  4W9E A;  5HFY A;  1LFD A;  1A5R A;  2BYF A;  3R3M A;  4OVZ A;  4XYC A;  2MP2 A;  3SD5 A;  2FCS A;  5E6J A;  2M1M A;  1Z5S B;  1G6J A;  1DGJ A;  1WRD B;  3V6E B;  3V61 A;  3L17 A;  4ZYS A;  2KTR A;  5J2R A;  5IAA C;  3QWZ B;  1TT5 B;  5DPW A;  2R61 A;  2EMS A;  3EC8 A;  4HJG E;  3P63 A;  1WRI A;  3H7P A;  4KV2 A;  1NDD A;  1L6V A;  3I63 C;  3VH4 B;  2I38 A;  2PMV A;  2DZM A;  2GBJ A;  2LRU A;  3OJ4 B;  2I2Y A;  4ARC A;  1Y8R C;  4FA6 A;  1WZ0 A;  4GDK B;  2GI9 A;  2WXF A;  4TUU A;  1GB4 A;  3X0W A;  1ISN A;  3A9J A;  3ML8 A;  1J7C A;  2ASQ A;  4DBG A;  2RSU A;  5HI1 A;  2BS4 B;  2JT4 B;  3Q8B A;  3ETR A;  2YVC A;  2JZP A;  4PYU A;  3NS8 A;  3UIN B;  1JAL A;  1I4X A;  3QC8 B;  3TMP B;  3N1X C;  1WYW B;  2LI5 A;  3UIP B;  1YN3 A;  5LLI A;  1WE6 A;  1WXM A;  1E9M A;  1IGC A;  1QIL A;  2AQ1 B;  2W3R A;  3E56 A;  4GXB A;  3DVG X;  2FID A;  4FJZ A;  4WWO A;  3ZDT A;  3IBE A;  3ZGZ A;  1KF6 B;  2PTL A;  4M02 A;  2O2V B;  3AEG B;  2Q5W D;  4HJK A;  2LWP A;  5DPT A;  5D3I B;  2M17 A;  5CHV C;  2WU2 B;  4JE3 B;  1EF5 A;  3ZYY X;  2KNB A;  4IM0 A;  2R2O A;  3QCA A;  4KIK A;  4LK0 M;  5KHO A;  1YOV B;  2E6X A;  2J0M A;  2IJ0 A;  2C5L C;  2DZK A;  4FLH A;  3AU5 A;  2D3B A;  5D2M B;  2G9H D;  2C7N B;  1WE7 A;  3QAR A;  4AWJ A;  3URY A;  3BZD B;  3QK0 A;  3U4E G;  3KUD B;  3I57 A;  1C77 A;  4AJY B;  4URK A;  5BMH A;  3OAW A;  2W55 A;  1NYQ A;  2IGD A;  3BYT B;  2WXK A;  1J0G A;  2LRW A;  2IYD B;  1PFD A;  1TS2 A;  4KSK C;  2AL3 A;  1V1P A;  1PGB A;  4KGR A;  2MHJ A;  4A9A A;  3NVV A;  2WX0 A;  2KWD A;  1CMX B;  1WFY A;  3K9P B;  4PS3 A;  4W9G A;  3VHT C;  3SFE B;  4KZC A;  4DK5 A;  2ZCC A;  3DVN V;  1ZKH A;  3BII D;  4CYE A;  4L23 A;  4HKZ E;  1XQQ A;  2V4I B;  3A1Q B;  4ANV A;  3QA8 A;  2MP2 B;  1WGY A;  1HA5 A;  3GE8 C;  2KTR B;  1EF1 A;  2FUH B;  2FBW B;  2IO3 B;  3B2G A;  3N1Z C;  4JLC A;  1L0V B;  1WGR A;  2RR9 A;  5H8Y E;  4MSQ B;  1FNU A;  5AEK B;  2YLM A;  1ZE3 D;  3H7P B;  3IAM 1;  4CO7 A;  2H89 B;  2BW2 A;  2BYE A;  3B08 A;  3MC9 A;  4GOC A;  1T0R C;  2FIF A;  3L54 A;  4MT5 A;  1E0Z A;  3AEC B;  2MBH A;  2KMA A;  3TBL D;  2K39 A;  1NBF C;  2WDR B;  4MEL A;  2N4F A;  1YJ1 A;  3KWV A;  3A9J B;  2Y5C A;  4JIO U;  4AQ7 A;  2LXA A;  3R2I A;  1K50 A;  1VDV A;  1P0R A;  2KDI A;  1WXV A;  2V3N A;  1TS4 A;  5J17 A;  4NJ7 A;  4ICU A;  2UU7 A;  5IA7 A;  4W9I A;  3Q8F A;  2KJ6 A;  1N60 A;  3CWI A;  3E9S A;  2WXN A;  3CSF A;  4S0R A;  5IN7 A;  2XNA C;  1ZP0 B;  1H4R A;  3ALB A;  2AEH A;  1BML C;  4XDD A;  3C0R B;  1YX5 B;  2EEL A;  4BVU C;  3HUI A;  1UWX A;  2MQJ A;  2BPS A;  4Q2J A;  3UI3 A;  3C19 A;  1Z2M A;  4GDL A;  3UQA A;  1HQR D;  4B0E A;  1P3Q U;  1ZPS A;  2WXQ A;  4JPS A;  4DDI D;  1UBI A;  3W2D A;  3PPA A;  4KIK B;  1S1Q B;  1HE8 A;  3L16 A;  1XLP A;  2KWU B;  4DQO C;  2L8J A;  1XEE A;  4RM8 A;  1CQV A;  3OJ3 A;  3IAS 1;  1D5X C;  1YQ3 B;  2SAK A;  2EKE C;  2RGF A;  1UEL A;  2IGH A;  1F2R C;  2D07 B;  3AE8 B;  1HTQ A;  2L0F A;  4IM2 A;  4BOS C;  4P6V F;  2WGS A;  1WJU A;  2MWS B;  2KC1 A;  4YSX B;  4NQL B;  3ZQ4 A;  5EE0 A;  1K53 A;  2WNM A;  3ZXV A;  1JRU A;  1XLO A;  2KDB A;  2IBI B;  3DVN U;  2ZPN A;  3MC0 B;  3PHX B;  1V1P B;  3Q14 C;  4MGK E;  1Q10 A;  3B2F A;  1HTO A;  3A4S C;  1FXA A;  2JZZ A;  1BUI C;  1UH6 A;  1OEY J;  1NI3 A;  1E7V A;  2MEK A;  1IGD A;  3N32 A;  1SIJ A;  5AUI A;  3NJT A;  2BKF A;  1SSN A;  4I6L B;  2J53 A;  1FXI A;  2WHI A;  3BIN A;  4K7U A;  3AE4 B;  2TSS A;  2DZI A;  3DHI C;  2ZNV B;  1T3Q A;  3RNC C;  4W9C A;  4EE2 A;  2K3U A;  2MRP A;  3LXF A;  2IO0 B;  2LD9 A;  2I1K A;  4KGS A;  5E6P A;  2N9X A;  3L4P A;  2FUG 1;  4ASW C;  5JHA A;  1SE3 A;  2L83 A;  2K8H A;  1N62 A;  4IG7 B;  4WQO B;  2JSV X;  1CK1 A;  2N9P C;  1E90 A;  4N58 A;  4IC7 B;  2G4D B;  4KKJ A;  4LJP B;  1I4H A;  2L76 A;  4W9J A;  1R4M B;  1UUP A;  2DAJ A;  3RD2 A;  3IFW B;  3GZN B;  1RRB A;  4HVB A;  1LGR A;  1F1H A;  1PGX A;  3AU4 A;  2D10 A;  4JGH B;  1MPE A;  2RD0 A;  4B0M A;  1YN5 A;  2OJR A;  5AZH A;  2L1A A;  4FXC A;  3VDZ A;  2J42 A;  4K7S A;  3PSE B;  4NJ6 A;  1D6E C;  2K9X A;  2NR2 A;  3VXW A;  4GGQ A;  2ZZP B;  2FE8 A;  3SDL C;  3EFU A;  3NZS A;  2KOX A;  2AQ3 B;  2DX5 B;  3MHZ A;  3P4S B;  5I4D A;  1QQR A;  5D6J B;  2ONQ A;  2V4L A;  4GU2 A;  1SIF A;  4LNK A;  3T3N A;  4GDL B;  1CZP A;  1TJE A;  2GBN A;  1D5Z C;  3L13 A;  3KW5 B;  2KZR A;  3KUZ A;  3VR8 B;  1N61 A;  1EWC A;  1JWM D;  1WZ3 A;  2VH1 A;  3W5V B;  4LLG M;  4J6I A;  2VZK B;  1E10 A;  2CKH B;  3L10 B;  3DWG C;  5JXV A;  3RNF C;  1YNT E;  3J9C A;  3NVW A;  1K8R B;  1SE9 A;  5CTR C;  1L0Y B;  2ICI A;  3SFD B;  4LTU A;  4OVV A;  4A90 A;  3N30 A;  2KD0 A;  4B95 A;  2INC C;  2QEJ C;  4MM3 A;  2M0X A;  3DWM A;  2M56 B;  3HRD D;  3W9C B;  5GXG B;  3UGB B;  1C78 A;  2MBO A;  2WYQ A;  2MW5 A;  2Z59 B;  2K1F A;  1GPX A;  1GOZ A;  4M01 A;  4HK2 A;  1R4M I;  2QIL A;  1L5P A;  3GZN I;  4IWO A;  4N6E B;  2A4Z A;  1Q5W B;  1I35 A;  5FR6 A;  1IBX A;  3RN9 C;  2G4S A;  2LGY A;  2KTF A;  2KAJ A;  2V1Y A;  3ZNZ B;  1BXT A;  2NTS A;  2WDV B;  2KJH B;  5FKA C;  2JWU A;  4N59 A;  2KQ4 X;  4W9F A;  3Q6B A;  3TUO A;  1Q0W B;  1GC7 A;  1ACC A;  4KZ0 A;  1TTN A;  3PRP B;  3AE9 B;  3NZ3 A;  1P7E A;  4EZJ A;  4RNA A;  3FKY A;  1F0Z A;  3Q2A C;  3IT6 B;  4DHJ B;  3H1U A;  2RPV A;  1ZXH A;  3RUL A;  4MGI E;  5BYQ A;  4HDQ A;  4ANX A;  1I4Q A;  2LGI A;  3PRZ A;  4ZDV A;  3MC8 A;  3ZUN A;  4DXG A;  1QOF A;  2K6Q A;  2LXC A;  2JPH A;  2BF8 B;  3BVG A;  3H6N A;  1V5O A;  2D3G A;  2AL6 A;  2O6V A;  5AUK A;  3WAP A;  2PPH A;  3BYY B;  3TCA A;  2LGX A;  3AE3 B;  2BQQ A;  4K81 A;  4E71 A;  2V3P A;  1I7H A;  3U52 E;  3RMK C;  5BMG A;  4S17 A;  1MHX A;  4BZA A;  5BYS A;  2RDH A;  3W1S C;  2KK8 A;  1E5W A;  2KC2 A;  4ITK A;  1GAQ B;  1EU4 A;  1MI0 A;  2NBU A;  3DCG A;  2MLB A;  5JH5 C;  1SJH D;  3QIJ A;  4MAC A;  2AQ2 B;  3VTW A;  2AWT A;  2KX3 A;  2UYZ B;  2L0T A;  2WXH A;  5GMV A;  2K6D B;  4PS8 A;  3ONS A;  2Y5B B;  2WXR A;  3IG3 A;  4OZC A;  1X1M A;  2Z0E B;  3IT4 B;  1WI0 A;  5CHF A;  4TSS A;  1TGZ B;  1WJN A;  4MH8 A;  3P1M A;  2CHX A;  1OQQ A;  1YMH E;  2B76 B;  3T3O A;  3AUL A;  5LXI B;  2QMT A;  4YTM B;  1JWS D;  2I1J A;  3AH7 A;  3GB1 A;  1UNS A;  1YX6 B;  4REZ A;  2X8X X;  1IPG A;  5C23 A;  4NNJ B;  3EUB 2;  4IM3 A;  4MM3 B;  3VTU A;  1WXQ A;  2KFJ A;  4HPP A;  1ZUD 2;  2KWV B;  2CU3 A;  4NAM A;  2MA9 B;  1C76 A;  4LNN A;  2MBB B;  1KH0 A;  1IBX B;  1EUV B;  1XCQ L;  3BK2 A;  4ZRQ A;  4RGT A;  4OVU A;  2LHD A;  4A55 A;  2IPK D;  4UDU C;  4RGM A;  2KQS A;  4TV3 A;  3RYT A;  4USA A;  1MHH E;  1V97 A;  1VLB A;  1VRA B;  1QT9 A;  4ZYN A;  2IGG A;  2QC8 A;  1VCB A;  4TKN A;  2KKC A;  3TJP A;  1PYW D;  5TR5 A;  5LNK 1;  2KFK A;  1V9J A;  3ZLZ A;  4HDO A;  1AYF A;  2M19 A;  3M95 A;  5G5H A;  4M00 A;  4MJS A;  2FCQ A;  2IY0 B;  1HZ6 A;  3UF8 A;  4L1B A;  3APC A;  3KUC B;  2NBW B;  3VRB B;  1ZDV A;  3NZU A;  4GSW A;  2CR5 A;  2DBY A;  4HPM B;  4NAW A;  3BVZ A;  4BAX A;  2Y3A A;  2O6V B;  2DYM A;  4N9F 4;  4KGT A;  1OQR A;  2G3Q B;  3Q3F A;  3T9L A;  2WXG A;  3NVY A;  1RAX A;  2KAN A;  1KOT A;  4AS1 A;  1TKG A;  3AE5 B;  3KH0 A;  3L08 A;  4XZ4 A;  2GLS A;  2PKO A;  2BT6 A;  1FD6 A;  1XO3 A;  3NUH B;  5EE1 A;  1OFF A;  2BTE A;  4WJP A;  2Y5P A;  2J7Q B;  2NTT A;  5G5G A;  2CHW A;  3BWU D;  1XD3 B;  1MG8 A;  3WAM A;  1Q1O A;  4PS7 A;  2ZNV C;  4YTP B;  2Z0D B;  4G11 A;  2DWQ A;  1L7Y A;  2M4N A;  1V8C A;  1KLG D;  2NMQ A;  3M62 B;  2OOB B;  3LJ3 A;  2INP E;  1PGA A;  1QKZ A;  1TS5 A;  2JXT A;  2N0S B;  1JWB D;  3NS1 A;  2CJN A;  3ZNG C;  3VQI A;  3Q3M C;  1ET6 A;  4A3O A;  1YIW A;  4KX6 B;  3EFC A;  2KXJ A;  2MJE A;  3O13 A;  4RCO A;  2W9N A;  3N9Y C;  2BWF A;  3AMZ A;  1NEN B;  2NVU I;  1ENF A;  1XXG A;  2C60 A;  3P4R B;  3ZKJ C;  1FFV A;  4A3P A;  3PTF C;  4MGZ E;  4NY0 A;  2ZW0 A;  1OTR B;  5J18 A;  4I6N B;  2D11 A;  4KDL B;  4YL8 A;  2R2Q A;  4B9K A;  2JYT A;  4GMV A;  4FHK A;  3ZIM A;  1KM7 A;  4AOF A;  4K3C A;  3W1Y A;  1SEB D;  1UF0 A;  3TIX A;  3PHW B;  4HKQ A;  1UBQ A;  1GNU A;  1EU3 A;  4GIV A;  1EO6 A;  2OED A;  2MJ3 A;  5JHB A;  3NY5 A;  3DBS A;  3HHM A;  4XDC A;  1F9J A;  2Z8L A;  3TEY A;  4F7Z A;  2A5U A;  2ZVN A;  3CIR B;  2YEP B;  2ON8 A;  1FCL A;  3T8M A;  3UQB A;  1B1Z A;  3QQ8 B;  4P16 A;  4BKS A;  4C7Y A;  5IKC M;  5HHD G;  4FJV B;  1P7F A;  2QDF A;  3AE6 B;  1QOG A;  2N9E B;  5D7G A;  4NPN A;  1E8Z A;  2KFK B;  4F8C B;  2WXM A;  2GMI C;  1JCK B;  2HJ8 A;  1L4D B;  4BBN F;  4C80 A;  1JW9 D;  4MJS B;  1M4V A;  1WMH A;  2B3A A;  1N63 A;  3NRZ A;  1WF9 A;  3RFZ B;  4P1C C;  1AWD A;  5FR3 A;  2LJI A;  4NAW B;  2VRR B;  3BVM A;  4KDI C;  3SU8 X;  1AAR A;  4OHJ A;  3Q69 A;  4DDG D;  2WDT B;  1WX7 A;  1C79 A;  2QIE B;  2VH2 A;  1TZO A;  5G55 A;  1ZOY B;  3CST A;  1FRD A;  3L0W B;  3DPD A;  1XT9 B;  2ZVO A;  3DHG C;  2QCZ A;  2N1W A;  3VAW A;  4M8N A;  5DPS A;  4ANW A;  4LDT B;  3RCZ A;  3VUW A;  3U8Z A;  3H8H A;  3LYY A;  2D2Q A;  2KAC A;  4FAD A;  1HZ5 A;  3PZ8 A;  2DHZ A;  2KQ7 A;  3RT3 B;  4HWI B;  5CHW A;  2G45 B;  1RWS A;  1IYF A;  3JSV A;  1DYQ A;  3AM9 A;  3V60 A;  1WM3 A;  4BOZ B;  1I42 A;  5DPR A;  3P4Q B;  4TMA B;  1L2N A;  3HM6 X;  5E6N A;  3RPF C;  1WR6 E;  2DZJ A;  1FPY A;  2JX5 A;  2KT7 A;  2PW9 A;  4RH6 A;  3APD A;  4IKG A;  3N3K B;  1WGK A;  3PT2 B;  1EM7 A;  2VZK D;  4JL9 A;  1RFK A;  5C1Z A;  4TQ0 A;  1I4R A;  2LVP A;  3FAH A;  3AEF B;  4II3 B;  1T0Y A;  4E74 A;  3PV1 A;  1CJE A;  1VR9 A;  4M8M A;  3DQV A;  2KMM A;  2NPT A;  4W9L A;  3A9K A;  3ZRC A;  1ROE A;  3OWE B;  4RGN A;  1T0S C;  4WJN A;  2N9L A;  3APF A;  1C3T A;  3DBR B;  1EWY C;  4RMA A;  4MDK E;  3QAQ A;  4WIP A;  1YD8 U;  4PT5 A;  2K0P A;  2K8B A;  1FM0 D;  4YSZ B;  3ML9 A;  3HVZ A;  2W82 A;  4DXA B;  2L3Z A;  4X57 B;  1I4P A;  2KVR A;  3WA0 A;  2OJW A;  2N7E A;  4G50 A;  1DOI A;  2DNF A;  3NVZ A;  2KHW B;  4LJO B;  3ZTC A;  1GG3 A;  2WU5 B;  3SEB A;  3VRA B;  2KJR A;  1TZ1 A;  1WJ4 A;  3EA6 A;  2C7H A;  2V3S A;  1FCC C;  4C56 C;  3KQ4 A;  1QF6 A;  3AED B;  1V80 A;  4I6P A;  2QJL A;  4M0W A;  1Y56 A;  3R8B A;  2CJO A;  1T6B X;  4J3O D;  3U7Z A;  3ZDM C;  1MJD A;  4IWP A;  1WH3 A;  4WWP A;  3ZTD A;  1HXY D;  1WMH B;  5D3D A;  3WAO A;  2LVQ A;  2EMT A;  3AEB B;  4OW0 A;  5JZE B;  2V9H A;  4DWF A;  2K5P A;  2KMC A;  3I5J C;  1J8C A;  3ZW3 A;  1AN8 A;  1E7U A;  1MFW A;  3ZVV A;  1SE2 A;  4A20 A;  2YEP F;  2WWZ A;  3PZD A;  3KWL A;  3P2B A;  2LEK A;  1C4A A;  1NYR A;  2J4X A;  4FBJ B;  4EEW A;  4EZL A;  2PE6 B;  1STE A;  2C7M B;  1JML A;  1F52 A;  4EFO A;  4ZOH C;  4KVG B;  1NI2 A;  1F2R I;  4HLE A;  2IO1 B;  3R7R A;  3DDC B;  1BT0 A;  2GOW A;  1UZX B;  3ABV B;  3WCQ A;  1SXT A;  1P98 A;  4K1R B;  3DBR I;  4JX1 C;  5G2N A;  4ZRK A;  1MG4 A;  2L7R A;  3DVG Y;  2K22 A;  2WXP A;  5LXH A;  1FXT B;  3ZJV A;  2JZ3 B;  2FCM A;  1RFA A;  4FN2 A;  1T5X D;  1QOB A;  1SE4 A;  3JSV B;  2CHZ A;  3TEX A;  2IND C;  1TY2 A;  2LUE A;  4R3D A;  1KTK A;  3W1S A;  4EKU A;  1D3Z A;  1GUA B;  1KRH A;  3A1Q A;  1MVK A;  2DAF A;  3WIM A;  4WJQ A;  2D3C A;  4IW0 A;  1VZ8 A;  3P42 A;  2X38 A;  2J0J A;  5IO9 A;  2WX1 A;  2WXO A;  5HKH A;  1WGG A;  3V3X A;  4HEA 1;  4AP4 C;  2LUM A;  4WAA A;  4L2Y A;  2N7D A;  4ZRP A;  4II2 B;  2PVG C;  1E7P B;  3ENE A;  5KHQ A;  4YXD B;  2NPT B;  3A9K B;  3RI7 C;  4DXF A;  4NQK E;  1WJ6 A;  3ZO5 B;  1SF0 A;  1C9F A;  3QJZ A;  1V2Y A;  3R7Q A;  2JRH A;  1WSP A;  1I4G A;  2XK5 A;  3JW0 X;  4IWQ A;  2J0K A;  3MHS D;  4C4V A;  3IHP C;  2LFI A;  5E6O A;  5EDS A;  1N5X A;  3K9O B;  4WAF A;  3Q3N C;  1WM2 A;  1WWT A;  2LAS A;  1J19 A;  2DYB A;  1M94 A;  3CF6 E;  4P7I A;  1KJT A;  1C4P A;  4PYZ A;  4YTN B;  1TKY A;  3ZNI D;  4HCP B;  3Q8E A;  3ZNH B;  2KN5 A;  1J7A A;  2H88 B;  2JYE A;  4WWN A;  1TYG B;  2MX2 A;  3AEE B;  4M0W B;  1L6U A;  1L4Z B;  1V6E A;  1OQY A;  4O1N A;  4LCD E;  1J7B A;  2PIA A;  1JRP A;  2BWE S;  1ZGU B;  3AE7 B;  2PE9 A;  2IO2 B;  1WIA A;  5TSS A;  2HE7 A;  1TKE A;  3LB8 C;  2DEN B;  2L05 A;  3M63 B;  3FC4 A;  3KYD D;  4KSL C;  4F1S A;  3MP9 A;  5BMI A;  2XBB C;  3R2T A;  2LHE A;  1XCT L;  2GB1 A;  3IVF A;  1NVI D;  2O6V D;  5AZG A;  2C9W B;  1JQ4 A;  1LXD A;  3B9J A;  3PRM B;  3B1L X;  1RLF A;  1VZ6 A;  1V86 A;  3W5U B;  2KYW A;  2BKR B;  3B0A A;  2GBR A;  4DHZ E;  2LVO A;  4XGA B;  5T8I A;  1WGD A;  2JUO A;  4KKI A;  4AUQ C;  2AX5 A;  1A70 A;  2XN9 C;  2SEB D;  1VD2 A;  1FMA D;  5IP4 D;  4MGY E;  4MSM B;  4RF0 A;  2KDM A;  3Q8A A;  1S3S G;  2W3S A;  2GBK A;  3V6C B;  3ECI A;  2IDY A;  3VVW B;  4WJO A;  1R7S A;  1E6E B;  5FK9 C;  3OLM D;  3JVZ X;  3V05 A;  1XLN A;  4G3X B;  2HD5 B;  2WDQ B;  1TIF A;  3N20 C;  1QOA A;  3P4P B;  2NCN A;  4US9 A;  2NBV B;  4E3C A;  2JWZ A;  3DBL B;  3RNB C;  4RF1 A;  2RDB C;  2HTH A;  3DHH C;  1T0Q C;  2FNJ B;  3DBH B;  2WXL A;  4RM9 A;  3KVF B;  3PLV A;  3PO0 A;  2DYO A;  1ZXI A;  2E3T A;  4MEM A;  5C3J B;  1HEZ E;  2IY1 B;  4YSY B;  1ET9 A;  5AZF A;  2GRI A;  5DCN A;  3ZJT A;  4ZHO A;  2PEA A;  1FEH A;  4W9D A;  3AB5 A;  4JWU C;  2AYO B;  2M0A A;  2PVO D;  2MCN B;  3RZW C;  1KLU D;  1P9D U;  2LGS A;  3IXS A;  2MH7 A;  2RMM A;  2HJ1 A;  1QZE A;  3A4R A;  3CMM B;  1LO5 D;  4WQM A;  4GLS C;  2XK5 B;  2REX A;  4OZA A;  4K7W A;  3MFG A;  4W9K A;  1PUT A;  4C4V B;  5D94 A;  2JRI B;  3AV8 A;  2LMC A;  1DOY A;  3DOW A;  2WQY B;  5BO4 B;  2MBE A;  3V62 A;  4NJC A;  3WAL A;  1GB1 A;  1V5T A;  4ICV A;  2L32 A;  4A6Q A;  3Q3J A;  1FRR A;  3I3T B;  1SBB B;  1WGH A;  3S2A A;  3FIL A;  2PLP A;  3HVD A;  1TS3 A;  4GB9 A;  4EOY A;  3QHT A;  3RNG C;  2KX0 A;  1KLV A;  4GN1 A;  3LDZ E;  3H7S A;  1DOX A;  4ANU A;  3TL5 A;  4WH4 A;  1N6Z A;  2BS2 B;  2JF5 A;  1H8C A;  3GP7 A;  5CX3 A;  1UGM A;  1FFU A;  3U2S C;  1AW7 A;  1UGJ A;  4B6W A;  1F77 A;  2ZJD A;  4C7Z A;  3R66 C;  1XF5 L;  1U4A A;  4WWM A;  3HK0 A;  3PRE A;  2IZV B;  1VZ7 A;  3DBL I;  3EHV A;  3HIZ A;  3TSS A;  4XWT A;  4P1B C;  1L0X B;  3DBH I;  4WUR A;  3EEC A;  2L52 A;  1N5W A;  1JWU D;  2N1V A;  3RNE C;  4LNO A;  1V1O A;  1UWM A;  1WXS A;  1WYG A;  2HDE A;  2GBM A;  1R4N B;  3UIO B;  1ZDX A;  3VTV A;  2BS3 B;  3WAN A;  1TY0 A;  1V49 A;  3KYC D;  2LZ6 A;  3OG5 A;  1QLB B;  3D32 A;  3JYU A;  4HCN B;  4NZL B;  1YQ4 B;  3AN1 A;  3X23 A;  2ZEQ A;  2WXJ A;  5MPO A;  1FNV A;  2XEW A;  1D4B A;  4XE0 A;  4LDT D;  5H92 C;  3MTN B;  2KO3 A;  3M3J A;  3PLU A;  4DHZ B;  4JWS C;  3MJW A;  3GS2 A;  2WS3 B;  4ZRJ A;  4XC2 A;  4IUM B;  2BYV E;  3MJ5 A;  2KN4 A;  4BKG A;  1OEY A;  3RUI B;  1FNW A;  3RNA C;  2WP9 B;  4FHJ A;  3KLS X;  4IDI A;  5BYR A;  4YT0 B;  4FUL A;  1ESF A;  2BVC A;  3VUY A;  1V81 A;  1XLQ A;  1GC6 A;  2ZPY A;  5C2T B;  1IUE A; 
#chains in the Genus database with same CATH homology
 3VTU A;  4DWF A;  2KMC A;  1J8C A;  3PVL A;  4W9I A;  3VUX A;  3ZW3 A;  2KFJ A;  2UWQ A;  1E7U A;  2KJ6 A;  3ZVV A;  3BY4 B;  4TQ1 A;  2KWV B;  2LGD A;  4A20 A;  2WWZ A;  3PZD A;  3P2B A;  3CSF A;  2MA9 B;  4FBJ B;  4EEW A;  3A33 B;  2MBB B;  4EZL A;  2PE6 B;  1WR1 A;  2C7M B;  1H4R A;  3ALB A;  4EFO A;  1C1Y B;  1EUV B;  3NHE B;  2AEH A;  3C0R B;  1LQB A;  4KVG B;  1NI2 A;  4HLE A;  2IO1 B;  4FJY A;  3R7R A;  1YX5 B;  3DDC B;  1BT0 A;  4BVU C;  2GOW A;  1UZX B;  2MQJ A;  2BPS A;  4OVU A;  4GDL A;  1Z2M A;  3UQA A;  1P98 A;  4K1R B;  3DBR I;  1P3Q U;  3AXC A;  1R4N I;  2CS4 A;  5G2N A;  4ZRK A;  4DDI D;  2L7R A;  3DVG Y;  1UBI A;  5LXH A;  1FXT B;  2JZ3 B;  2KQS A;  4TV3 A;  2MBQ A;  2FCM A;  1RFA A;  4FN2 A;  3RYT A;  3PPA A;  4KIK B;  1S1Q B;  1HE8 A;  3L16 A;  3JSV B;  2CHZ A;  2KWU B;  2L8J A;  2K25 A;  4RM8 A;  4ZYN A;  3OJ3 A;  2JY6 A;  2LUE A;  3W1S A;  1VCB A;  4TKN A;  3U7D A;  2KKC A;  2K8C A;  3TJP A;  4EKU A;  1GUA B;  1D3Z A;  2PJH A;  2EKE C;  2RGF A;  3A1Q A;  1UEL A;  5TR5 A;  2D07 B;  5L83 A;  2KFK A;  3NOB A;  1V9J A;  2DAF A;  3WIM A;  3ZLZ A;  4GDK A;  4WJQ A;  4HDO A;  4IW0 A;  2L0F A;  2KDF B;  3M95 A;  2J0J A;  4IM2 A;  4BOS C;  1WJU A;  4MJS A;  2FCQ A;  2IY0 B;  3UF8 A;  2MWS B;  2CU1 A;  2KC1 A;  2WX1 A;  3APC A;  4BKS D;  5HKH A;  1WGG A;  4HXD A;  4EUT A;  3KUC B;  2NBW B;  4NQL B;  1SGH A;  4AP4 C;  3NZU A;  4GSW A;  2CR5 A;  4HPM B;  4WAA A;  4NAW A;  3PGE A;  1JRU A;  2N7D A;  2KDB A;  2IBI B;  3QX1 A;  1E8Y A;  2O6V B;  1E8W A;  4II2 B;  3DVN U;  2DYM A;  2ZPN A;  4MH0 E;  3PHX B;  4N9F 4;  4BKT A;  3ENE A;  5KHQ A;  2G3Q B;  4MGK E;  2NPT B;  3A9K B;  3Q3F A;  3T9L A;  3A4S C;  3U30 A;  2JZZ A;  1RAX A;  2KAN A;  1UD7 A;  1UH6 A;  1WJ6 A;  4G0N B;  4NQK E;  3ZO5 B;  1KOT A;  2JVC A;  1OEY J;  3KH0 A;  5L95 C;  1E7V A;  3L08 A;  4XZ4 A;  3N32 A;  3QJZ A;  1V2Y A;  3R7Q A;  2BKF A;  2JRH A;  2XK5 A;  3JW0 X;  4IWQ A;  4I6L B;  2J0K A;  4WJP A;  3MHS D;  3SHQ A;  2O2V A;  3IHP C;  3ZRF A;  2KLC A;  2J7Q B;  5E6O A;  3BIN A;  4K7U A;  4EZK A;  5EDS A;  2KWC A;  2JXX A;  3K9O B;  2CHW A;  2KDE B;  2FCN A;  1XD3 B;  2DZI A;  1MG8 A;  3WAM A;  1WM2 A;  2LAS A;  3VH3 B;  1J19 A;  2DYB A;  1Q1O A;  2ZNV B;  1M94 A;  4JQW C;  4PS7 A;  2ZNV C;  4W9C A;  4DHJ D;  3CF6 E;  4P7I A;  2Z0D B;  4G11 A;  1KJT A;  4PYZ A;  1P1A A;  1L7Y A;  2M4N A;  2MRP A;  1YQB A;  3ZNI D;  2IO0 B;  2LD9 A;  4HCP B;  1LM8 B;  1E8X A;  2I1K A;  3M62 B;  1WXA A;  3VFK A;  5E6P A;  2N9X A;  1WX8 A;  1OGW A;  2OOB B;  3ZNH B;  2KN5 A;  1TBE A;  3LJ3 A;  4ASW C;  5JHA A;  1ZW7 A;  2K8H A;  4HPL B;  4IG7 B;  4WQO B;  2KLG A;  4WWN A;  2FAZ A;  3PS6 A;  2BGF A;  4XX5 A;  2MX2 A;  2NS5 A;  3VQI A;  3ZNG C;  1WX9 A;  2N9P C;  1E90 A;  4M0W B;  1YIW A;  2QHO A;  1PQS A;  4IC7 B;  4A3O A;  2G4D B;  4LJP B;  1V6E A;  4BBN C;  2ZCB A;  1OQY A;  1IP9 A;  2L76 A;  2KXJ A;  4LCD E;  4W9J A;  2M8S A;  2W9N A;  2DAJ A;  3RD2 A;  2BWE S;  4CHK A;  2BWF A;  3IFW B;  1ZGU B;  2NVU I;  2PE9 A;  1RRB A;  1WIA A;  2IO2 B;  3HM3 A;  3RZF A;  4HVB A;  2HE7 A;  2C60 A;  3AU4 A;  2D10 A;  3ZKJ C;  2RPQ A;  4JGH B;  4A3P A;  2DEN B;  2RD0 A;  3GOE A;  2L05 A;  3PTF C;  4W9H A;  3M63 B;  2LJ5 A;  4MGZ E;  2OJR A;  5AZH A;  4NY0 A;  3KYD D;  2MSE D;  4AJW A;  1A5R A;  1OTR B;  3O65 B;  3VDZ A;  5J18 A;  4I6N B;  2D11 A;  3H9D A;  4ZRI A;  3AI5 A;  4KDL B;  4K7S A;  4YL8 A;  4KSL C;  4F1S A;  3PSE B;  1GJZ A;  2R2Q A;  4B9K A;  2L00 B;  4NJ6 A;  4GMV A;  4FHK A;  3ZIM A;  2XBB C;  1KM7 A;  4AOF A;  1WY8 A;  3W1Y A;  3IVF A;  2O6V D;  3TIX A;  4BFR A;  2NR2 A;  3VXW A;  5AZG A;  2C9W B;  3PHW B;  4W9E A;  3SDL C;  4GGQ A;  1LXD A;  2ZZP B;  1UBQ A;  1LFD A;  3B1L X;  1GNU A;  2BYF A;  1RLF A;  1EO6 A;  3EFU A;  3PRM B;  2KOX A;  3NZS A;  3R3M A;  2MP2 A;  4GIV A;  1V86 A;  3SD5 A;  2FCS A;  2BKR B;  2DX5 B;  3B0A A;  2M1M A;  2GBR A;  5JHB A;  1Z5S B;  1G6J A;  1WRD B;  3V6E B;  5D6J B;  2LVO A;  4DHZ E;  3V61 A;  3L17 A;  2KTR A;  3NY5 A;  1WGD A;  2V4L A;  4GU2 A;  1SIF A;  5IAA C;  5J2R A;  4GDL B;  2JUO A;  3DBS A;  3HHM A;  4AUQ C;  1F9J A;  2GBN A;  1VD2 A;  3QWZ B;  3L13 A;  4MGY E;  4MSM B;  4F7Z A;  5DPW A;  2A5U A;  2ZVN A;  3KW5 B;  1S3S G;  2EMS A;  2KZR A;  2GBK A;  3EC8 A;  3ECI A;  3KUZ A;  3V6C B;  4KV2 A;  3H7P A;  3VVW B;  1NDD A;  3T8M A;  4WJO A;  1WZ3 A;  3UQB A;  3QQ8 B;  4BKS A;  4J6I A;  3OLM D;  3JVZ X;  3VH4 B;  2CKH B;  4FJV B;  4G3X B;  2DZM A;  3L10 B;  2N9E B;  5D7G A;  2HD5 B;  2GBJ A;  2LRU A;  3OJ4 B;  4NPN A;  1E8Z A;  1K8R B;  2KFK B;  1Y8R C;  4F8C B;  1WZ0 A;  4FA6 A;  4GDK B;  1SE9 A;  5CTR C;  4TUU A;  2GMI C;  2NCN A;  3X0W A;  2HJ8 A;  1ISN A;  2NBV B;  4BBN F;  4E3C A;  2JWZ A;  3A9J A;  3ML8 A;  4OVV A;  4MJS B;  3N30 A;  1WMH A;  2ASQ A;  2B3A A;  2HTH A;  4DBG A;  2FNJ B;  2KD0 A;  1WF9 A;  4RM9 A;  4B95 A;  2RSU A;  3KVF B;  3PLV A;  4MM3 A;  2JT4 B;  2M0X A;  2DYO A;  4MEM A;  4NAW B;  2YVC A;  4PYU A;  2IY1 B;  2VRR B;  3NS8 A;  3UIN B;  5AZF A;  3UGB B;  2MBO A;  4KDI C;  2WYQ A;  2MW5 A;  2Z59 B;  5DCN A;  2K1F A;  3SU8 X;  3QC8 B;  3TMP B;  2PEA A;  1WYW B;  4HK2 A;  4W9D A;  2LI5 A;  1R4M I;  1AAR A;  3UIP B;  2AYO B;  4DDG D;  2WDT B;  5LLI A;  3GZN I;  4IWO A;  1WX7 A;  2A4Z A;  1Q5W B;  1WE6 A;  2MCN B;  1WXM A;  3RZW C;  1I35 A;  1P9D U;  4GXB A;  5G55 A;  3CST A;  5FR6 A;  3L0W B;  3DPD A;  1XT9 B;  2G4S A;  2ZVO A;  3DVG X;  2FID A;  2N1W A;  4FJZ A;  2LGY A;  4WWO A;  1QZE A;  2KTF A;  3A4R A;  3VAW A;  3ZDT A;  3CMM B;  3IBE A;  4M8N A;  2V1Y A;  3ZNZ B;  2XK5 B;  2REX A;  5DPS A;  2O2V B;  4K7W A;  2KJH B;  4W9K A;  4ANW A;  4LDT B;  4HJK A;  3RCZ A;  2LWP A;  3VUW A;  3U8Z A;  5D94 A;  5DPT A;  4W9F A;  2D2Q A;  2JRI B;  2M17 A;  5CHV C;  4FAD A;  1Q0W B;  1GC7 A;  2DHZ A;  2KQ7 A;  3RT3 B;  3DOW A;  5BO4 B;  1EF5 A;  2MBE A;  2KNB A;  4IM0 A;  4KZ0 A;  3V62 A;  1TTN A;  2R2O A;  3WAL A;  3PRP B;  3QCA A;  4KIK A;  4HWI B;  5CHW A;  2G45 B;  1V5T A;  4ICV A;  1IYF A;  3JSV A;  5KHO A;  2J0M A;  3Q3J A;  2C5L C;  2DZK A;  3I3T B;  3S2A A;  1WGH A;  3V60 A;  1WM3 A;  4BOZ B;  4FLH A;  1I42 A;  4GB9 A;  4EOY A;  3QHT A;  4EZJ A;  3AU5 A;  2KX0 A;  1KLV A;  5D2M B;  5DPR A;  4GN1 A;  2C7N B;  1WE7 A;  3LDZ E;  4DHJ B;  1L2N A;  3QAR A;  3H1U A;  3H7S A;  3HM6 X;  5E6N A;  4AWJ A;  1WR6 E;  2DZJ A;  3QK0 A;  3RUL A;  3APD A;  3N3K B;  4MGI E;  4HDQ A;  4ANU A;  3TL5 A;  4ANX A;  3KUD B;  2JF5 A;  1H8C A;  3PT2 B;  4AJY B;  4URK A;  3PRZ A;  5CX3 A;  4JL9 A;  1UGM A;  4ZDV A;  3OAW A;  5C1Z A;  3ZUN A;  4TQ0 A;  2LVP A;  2K6Q A;  4B6W A;  4II3 B;  2LXC A;  4E74 A;  1T0Y A;  2JPH A;  2BF8 B;  2ZJD A;  1J0G A;  3R66 C;  3H6N A;  2LRW A;  1V5O A;  2D3G A;  3PV1 A;  2AL6 A;  2O6V A;  1U4A A;  2IYD B;  3HK0 A;  4M8M A;  3WAP A;  2IZV B;  2PPH A;  3DBL I;  3DQV A;  3EHV A;  3HIZ A;  3PRE A;  2LGX A;  2AL3 A;  4KSK C;  3TCA A;  4K81 A;  2NPT A;  2WX0 A;  3DBH I;  4W9L A;  4E71 A;  3EEC A;  1CMX B;  1WFY A;  3A9K A;  3ZRC A;  3K9P B;  4PS3 A;  4W9G A;  3VHT C;  4DK5 A;  4KZC A;  2N1V A;  2ZCC A;  4WJN A;  3DVN V;  1ZKH A;  1WXS A;  3APF A;  1C3T A;  2GBM A;  4CYE A;  4RMA A;  3W1S C;  4MDK E;  1XQQ A;  2KK8 A;  1E5W A;  2KC2 A;  3A1Q B;  3UIO B;  3QAQ A;  3VTV A;  3QA8 A;  3WAN A;  4ANV A;  1YD8 U;  2MP2 B;  1V49 A;  2K8B A;  3KYC D;  2LZ6 A;  1WGY A;  2NBU A;  3D32 A;  3JYU A;  3DCG A;  2MLB A;  4HCN B;  5JH5 C;  3ML9 A;  3QIJ A;  2KTR B;  4DXA B;  2L3Z A;  4X57 B;  3VTW A;  2AWT A;  1EF1 A;  2KX3 A;  2KVR A;  2UYZ B;  3WA0 A;  3X23 A;  2FUH B;  4JLC A;  2IO3 B;  2L0T A;  5GMV A;  2N7E A;  2K6D B;  2RR9 A;  1WGR A;  2ZEQ A;  4PS8 A;  3ONS A;  2Y5B B;  4G50 A;  3IG3 A;  4MSQ B;  2XEW A;  1X1M A;  2KHW B;  4LDT D;  5AEK B;  2YLM A;  2Z0E B;  3MTN B;  2KO3 A;  3M3J A;  3PLU A;  4LJO B;  3ZTC A;  1GG3 A;  4DHZ B;  3H7P B;  2KJR A;  1TZ1 A;  1WJ4 A;  4CO7 A;  3MJW A;  1WI0 A;  2C7H A;  2V3S A;  3B08 A;  2BYE A;  5CHF A;  4XC2 A;  4ZRJ A;  2BYV E;  4GOC A;  1TGZ B;  2FIF A;  3L54 A;  4IUM B;  1V80 A;  4BKG A;  2MBH A;  1WJN A;  1OEY A;  4I6P A;  2KMA A;  2CHX A;  3RUI B;  3TBL D;  2K39 A;  1NBF C;  3AUL A;  4FHJ A;  5LXI B;  4MEL A;  2I1J A;  3ZDM C;  2N4F A;  1YX6 B;  1YJ1 A;  3A9J B;  4IWP A;  4JIO U;  1WH3 A;  4WWP A;  3ZTD A;  2LXA A;  4FUL A;  1IPG A;  5C23 A;  1WMH B;  3WAO A;  3VUY A;  1V81 A;  1P0R A;  2LVQ A;  1GC6 A;  2ZPY A;  2EMT A;  2KDI A;  4NNJ B;  1WXV A;  5JZE B;  4IM3 A;  5J17 A;  4NJ7 A;  4ICU A;  5IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...