3WAOA

Crystal structure of atg13 lir-fused human lc3b_2-119
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3waoA00
2LXAA 4FJVB 4WJOA 1YJ1A 5D7GA 2BPSA 5TR5A 3M3JA 3VDZA 3ZNID 1WGYA 2KNBA 4HCPB 2JRHA 4XC2A 1WYWB 3WAPA 4FBJB 2KK8A 1V86A 3QQ8B 5D6JB 2QHOA 5AEKB 1WGDA 2DYMA 2D3GA 3A9KB 4IUMB 1WJUA 2ZPNA 3KUCB 3L0WB 3QWZB 3EC8A 4GXBA 3IFWB 4FA6A 1F9JA 1R4MI 2B3AA 2DYBA 4BKSD 2KXJA 1WZ3A 4GB9A 4K7WA 3W1SA 5L83A 3DVNV 3ENEA 2PPHA 2I1KA 3W1YA 2KO3A 1ZKHA 1S1QB 4XX5A 2MW5A 2KC1A 1YX5B 3BY4B 1RFAA 3QIJA 2LVPA 2BYVE 1TGZB 2IO1B 4AJWA 2MA9B 5JZEB 4I6NB 2KC2A 2N7DA 4KZCA 3ZDMC 3JW0X 3DVGX 1UZXB 3PLVA 3PRZA 1OTRB 3ZKJC 2K39A 3ZNZB 2RD0A 2KDFB 4HPLB 3V60A 2GBKA 5AZGA 2L76A 1D3ZA 4TUUA 4KV2A 3DOWA 2REXA 2LGYA 3R3MA 1WY8A 2MWSB 4MGKE 2J0KA 3DPDA 2G4DB 2O2VB 4HLEA 1GG3A 2LWPA 5DPRA 2KANA 2RR9A 3PTFC 4MH0E 4NY0A 4W9IA 3RZFA 4F1SA 4JL9A 2JZ3B 4FULA 3ZDTA 1VCBA 3UGBB 2GBJA 1V81A 3AU4A 4JQWC 2C60A 2M8SA 3UINB 2N9XA 3LDZE 1C3TA 3PRPB 4KZ0A 2A5UA 2KFKB 3L10B 2FNJB 4BKTA 1FXTB 1XT9B 2KTFA 3ZRCA 3VH4B 2LXCA 2LASA 2FUHB 1E7VA 1E8XA 3CF6E 2BGFA 4GIVA 4W9CA 2KFJA 1Q1OA 2KJHB 3PSEB 4WWNA 2FCSA 1UBIA 4LJPB 2NCNA 5EDSA 3L17A 1UELA 4RM9A 5IA7A 3KH0A 3MJWA 3R7RA 3N3KB 1WMHA 3QX1A 1Z5SB 4MSMB 2MCNB 2XK5A 4II2B 4OVVA 1TZ1A 1IYFA 3KUDB 3OJ4B 2N1VA 2MLBA 4BKGA 1J0GA 2KMAA 5AZHA 1V5OA 3SD5A 4WWOA 2N1WA 5LLIA 1MG8A 1Z2MA 2VRRB 3VUXA 3ONSA 1P9DU 3AU5A 3DBRI 3O65B 3VVWB 4PYZA 1EUVB 2V3SA 1Y8RC 2FIFA 4GMVA 4MJSA 3M95A 5CHFA 4F7ZA 1KOTA 3OJ3A 2ZZPB 4WJQA 5CX3A 4PS7A 2NBWB 3GZNI 2K8BA 2KWUB 3HM6X 4DDID 4EUTA 3NZUA 2KJRA 3WAMA 5J18A 3HM3A 3PLUA 4KIKA 4KSLC 2MBOA 2DZKA 1CMXB 3VTWA 4BKSA 2LGXA 3ECIA 3JYUA 5AZFA 5DPTA 4K1RB 1E8ZA 2WWZA 3N32A 2G3QB 4TQ0A 4MEMA 4F8CB 4LCDE 3PHXB 4K7SA 4BOZB 3WALA 2KOXA 3IHPC 5JHBA 1XD3B 4EOYA 2LJ5A 4ANWA 2K6QA 2BWFA 2YVCA 3ZRFA 4JIOU 3IG3A 3QHTA 4J6IA 1GNUA 3K9OB 2MBEA 1WFYA 3HHMA 3NS8A 4A3PA 4BVUC 4EZJA 2NPTA 2MQJA 2KDEB 2FAZA 1NI2A 4HVBA 2D07B 4GGQA 5DPSA 4IWOA 3Q3JA 3DBSA 3B1LX 1SGHA 5FR6A 2CKHB 3ALBA 4W9HA 1LQBA 2GBMA 4OVUA 3L16A 3BINA 1P0RA 2L8JA 3PV1A 2Y5BB 2BKRB 4MGZE 2JRIB 4KDLB 1WXAA 2KZRA 1KJTA 3L08A 2CHXA 3AXCA 3VH3B 3M62B 2PE6B 3V6EB 3PHWB 2AEHA 1V80A 1WE7A 2D10A 4EZKA 3CSFA 1H4RA 1ZW7A 2O6VD 3H9DA 3JVZX 4YL8A 5LXHA 2DZMA 3H7PA 1P3QU 3ZNGC 1OGWA 2LD9A 3OAWA 4HDQA 3QC8B 1WZ0A 3SHQA 3IVFA 4P7IA 2NR2A 4X57B 5J2RA 2JXXA 5JH5C 1GJZA 1WM2A 4XZ4A 4PS8A 3UIOB 2WYQA 4GDLA 2XBBC 2BYEA 3RYTA 4DHZE 2DYOA 4ICVA 3VXWA 2HTHA 3RUIB 4ZDVA 2DZJA 4MM3A 2Z0EB 2CS4A 4KSKC 2DAFA 1V49A 3DVGY 4W9JA 1WJ6A 5E6OA 5IAAC 2C7HA 4FLHA 1BT0A 2BYFA 2FCMA 2V1YA 1WMHB 1R4NI 2M4NA 5J17A 2LI5A 4PS3A 4DHJD 4WJPA 4II3B 1UH6A 1WH3A 2XK5B 1WXMA 1LFDA 2DX5B 3ML9A 4LDTB 3LJ3A 4DWFA 3EFUA 2BWES 2IO2B 4DDGD 1WXSA 3I3TB 3NZSA 4EKUA 1EF5A 1NBFC 2K25A 2DHZA 3ML8A 3UF8A 4G11A 2JT4B 2CR5A 3H1UA 1NDDA 2W9NA 1S3SG 3QARA 3Q3FA 5KHOA 1AARA 4JGHB 4CHKA 4G3XB 1X1MA 4B9KA 3PPAA 2KWCA 2IY1B 3H6NA 4MJSB 4BOSC 1RRBA 2LRWA 2KDIA 3S2AA 2EKEC 3EECA 3QCAA 3T8MA 2NS5A 2MX2A 3A1QA 3P2BA 4KIKB 1WX7A 4CYEA 2FIDA 2ZJDA 2ZNVB 4W9EA 2KD0A 3MHSD 2K6DB 2ZCBA 2C7MB 4RM8A 5G55A 1GC6A 4AP4C 1GUAB 4AOFA 3U30A 3VUYA 4E74A 2OOBB 4FN2A 1LXDA 1L2NA 1H8CA 2EMSA 4FJYA 2MBQA 1J8CA 4B6WA 2ZVNA 2RSUA 1TBEA 2YLMA 4IW0A 2G4SA 3APCA 2K8CA 4ICUA 3KVFB 4M8MA 2XEWA 3B0AA 3PS6A 3UQAA 2IY0B 2PEAA 2UWQA 2JF5A 4RMAA 4MELA 4DXAB 4ANUA 1RAXA 2GOWA 1A5RA 4CO7A 3W1SC 2KDBA 4GN1A 2NPTB 2KJ6A 2ASQA 2Z0DB 1T0YA 4MSQB 2N4FA 1E5WA 3OLMD 1WRDB 4A20A 1WR6E 2CU1A 4AWJA 4HXDA 2LGDA 3DCGA 4E71A 2ZPYA 1K8RB 3V61A 1KM7A 4A3OA 4HWIB 2KWVB 3TL5A 1P98A 2BF8B 1I35A 3DVNU 3MTNB 3L54A 1WJ4A 2MP2A 4ZRJA 2MRPA 2O6VA 1JRUA 2KKCA 1E7UA 2L05A 4EZLA 1P1AA 5C23A 4WQOB 2BKFA 1IP9A 1WGRA 4W9LA 4NPNA 2NBUA 3ZNHB 2L7RA 2V4LA 2MBBB 2DENB 2GMIC 3V62A 4G0NB 1XQQA 2LVQA 2IYDB 2N9PC 3NOBA 4HJKA 5LXIB 2RPQA 2KQSA 4KDIC 2M17A 2L3ZA 4GSWA 3VUWA 3H7PB 4HPMB 1RLFA 1KLVA 2GBNA 1EO6A 3WA0A 4BFRA 3AI5A 1SIFA 2MSED 3A33B 4AUQC 1QZEA 1IPGA 4NAWA 5E6NA 1WX9A 2HE7A 2DZIA 1E8WA 3JSVA 3PGEA 2HJ8A 4GDLB 3VHTC 2IO3B 3N30A 3R66C 1WIAA 2KTRA 1OEYA 3H7SA 3CSTA 3DBLI 4GDKA 3TBLD 2KN5A 4HK2A 4I6LB 3TMPB 1WM3A 1UBQA 1I42A 1WE6A 4KVGB 3T9LA 3QAQA 4FADA 1YQBA 3A9JA 2J0JA 3ZW3A 2AL3A 3IBEA 2C5LC 2JWZA 2AL6A 1OEYJ 3WIMA 3RT3B 2PE9A 3DQVA 3RZWC 4HDOA 1J19A 1GC7A 3RCZA 4IC7B 1WR1A 4NJ7A 4WAAA 3M63B 4EFOA 1HE8A 3ZUNA 3KUZA 4IWQA 1WXVA 3PREA 1UGMA 3HIZA 3B08A 4B95A 3TIXA 2LVOA 1C1YB 1WF9A 5CHWA 4DHZB 1G6JA 3VFKA 2FCQA 4M8NA 2K1FA 1ISNA 1L7YA 5G2NA 4MGYE 2J7QB 4ZYNA 1WGHA 3ZIMA 1WJNA 3AULA 3TCAA 2D11A 4W9KA 4FHJA 3D32A 4TV3A 1V6EA 3A1QB 2G45B 2MBHA 4K7UA 4NQLB 4NNJB 3SDLC 4ASWC 4URKA 2ZVOA 4K81A 2OJRA 4W9DA 3CMMB 3HK0A 2ZNVC 3KYDD 4FHKA 1UD7A 4IM2A 4MGIE 4IWPA 3A9KA 4ANXA 4ZRIA 2JUOA 3DDCB 1V5TA 1Q0WB 2JPHA 3NY5A 2KHWB 4TKNA 3ZLZA 2IZVB 4IM0A 4EEWA 5HKHA 3QA8A 3PT2B 2WDTB 4BBNC 2UYZB 5L95C 2K8HA 1E90A 5DCNA 1U4AA 1YIWA 3QK0A 3V6CB 4DBGA 2WX0A 1Q5WB 2J0MA 5KHQA 1WX8A 2L0TA 5CTRC 3L13A 4PYUA 2NBVB 3A4RA 5JHAA 2Z59B 2IO0B 2MP2B 4JLCA 2O6VB 3EHVA 1WGGA 5D2MB 3VAWA 2EMTA 4NQKE 4GOCA 4AJYB 4ZRKA 2CHWA 3UIPB 4G50A 4IM3A 1YX6B 3QJZA 4WWPA 2JZZA 2L0FA 3VTVA 3GOEA 3PRMB 5C1ZA 2O2VA 1LM8B 2ZEQA 3ZTDA 4ANVA 1PQSA 3RD2A 4FJZA 3NHEB 2N7EA 3C0RB 3RULA 1TTNA 2KVRA 4HCNB 4NAWB 2RGFA 2LUEA 4M0WB 3X23A 3JSVB 4W9FA 5DPWA 3VTUA 2KX0A 3ZVVA 2KFKA 2KLCA 2A4ZA 2KMCA 2C9WB 2KTRB 3ZO5B 2KLGA 2ZCCA 3UQBA 1M94A 4E3CA 2NVUI 4GDKB 4DHJB 2LRUA 4DK5A 4W9GA 2GBRA 5GMVA 3KYCD 3A9JB 2N9EB 4GU2A 2KX3A 4I6PA 3KW5B 3TJPA 2FCNA 4N9F4 2HD5B 3R7QA 3U7DA 2M1MA 2D2QA 4WJNA 3VQIA 2JY6A 1YD8U 2M0XA 2C7NB 3A4SC 1V2YA 4MDKE 3PZDA 4NJ6A 2JVCA 3DBHI 4LJOB 5E6PA 4BBNF 5BO4B 2DAJA 1EF1A 5D94A 3APDA 3WAOA 1SE9A 1VD2A 2CHZA 3K9PB 1V9JA 1E8YA 3PVLA 5CHVC 3APFA 1WI0A 2AWTA 2IBIB 2LZ6A 3X0WA 2L00B 3ZTCA 1ZGUB 1OQYA 2I1JA 2KQ7A 4LDTD 4TQ1A 3SU8X 3WANA 2R2QA 2AYOB 2PJHA 2R2OA 3U8ZA 2WX1A 4IG7B
chains in the Genus database with same CATH superfamily
3P63A 2LXAA 1YJ1A 2BPSA 1TY2A 5TSSA 4HCPB 4WWMA 3NVYA 2JRHA 4XC2A 1WYWB 3WAPA 2KK8A 3E56A 4IUMB 1WJUA 2ZPNA 2EKIA 3KUCB 4S17A 4FA6A 2WXIA 1F9JA 2B3AA 2W82A 1IGDA 2KO3A 1T5XD 4RNAA 1BMLC 3QIJA 2LMCA 1TGZB 5JZEB 1SJHD 3PRZA 1PGXA 2D5GA 2N9LA 2QDFA 3R3MA 1WY8A 3ABVB 4M01A 2ZW0A 1VR9A 1GG3A 2RR9A 4JL9A 1YQ4B 1V81A 2L83A 4JQWC 4REZA 2LHEA 1FO4A 2FNJB 2X38A 1ZOYB 2KTFA 1AYFA 1E7VA 1E8XA 4GIVA 3PSEB 2FCSA 3C19A 1UELA 5IA7A 1UF0A 1ZP0B 5E6JA 1BUIC 2CU3A 1Z5SB 3Q8BA 1QLBB 4MSMB 4AS1A 3KUDB 2IGHA 3C8YA 4ZRQA 1UNSA 1ROEA 2N1VA 4BKGA 2KMAA 3TSSA 2YEPB 1ZDXA 4WWOA 5HFYA 2PW9A 1DOIA 2H89B 3AU5A 3U52E 4C7ZA 4MJSA 4F7ZA 2ZZPB 3GZNI 2W54A 3NZUA 2WDVB 3VTWA 4BKSA 3AECB 5AZFA 2W3RA 5C2TB 4K7SA 1F77A 2KOXA 2J53A 2LJ5A 4ANWA 1RYJA 2LHDA 3NS8A 2N7JA 2KDEB 1NI2A 4HVBA 2WGSA 1NI3A 2Y5PA 4IWOA 3B1LX 4W9HA 1LQBA 2GBMA 4D2KA 3PV1A 1WYGA 2Y5BB 2BKRB 3OG5A 4KDLB 2KZRA 3L08A 3VH3B 3M62B 1NENB 2D10A 4EZKA 3CSFA 1H4RA 1ZW7A 2O6VD 3NVVA 4YL8A 1PGAA 1OGWA 2LD9A 1R4NB 2D3BA 2NR2A 4X57B 5J2RA 1IBXA 1YN4A 4XZ4A 2WYQA 3RYTA 4DHZE 5LNK1 2JX5A 1WSPA 3RUIB 2DZJA 2JU6X 3E9SA 1C4AA 2CS4A 2ON8A 4KSKC 1D5MC 5E6OA 3Q3OC 2V1YA 4K3BA 1KFYB 1DGJA 4DWFA 3EFUA 3I3TB 4EKUA 5GXGB 4P1CC 4G11A 4LNOA 2W9NA 3RNCC 1AARA 4G3XB 2KWCA 2XN9C 2IY1B 2KDIA 3GB1A 3S2AA 2BVCA 2EKEC 2V3PA 2NS5A 2MX2A 4AQ7A 3OWEB 2BBCA 4KIKB 2FIDA 1KLGD 3MHSD 2KD0A 4AOFA 1JWAD 2QMTA 4E74A 2OOBB 4FJYA 4OZBA 1J8CA 1FEHA 2RSUA 4WH4A 4RGNA 2XEWA 3B0AA 3PS6A 2JF5A 4MELA 1XEEA 2PIAA 3W1SC 4GN1A 2NPTB 2KJ6A 2N4FA 1WRDB 1I4GA 4E71A 1K8RB 3V61A 1D5XC 2VZKD 1P98A 2BF8B 1I35A 3MTNB 2MP2A 1JRUA 1E7UA 5C23A 4RGOS 3HRDD 1IP9A 4NPNA 2L7RA 2MBBB 2DENB 2LVQA 4YTPB 1SSNA 2RPQA 4UDUC 2KQSA 1L5PA 1KLVA 4P16A 3WA0A 1EO6A 1I4PA 1SIFA 2J42A 4AUQC 4NAWA 2HE7A 3JSVA 1E8WA 1R7SA 3PGEA 3R66C 1WIAA 3H7SA 3DBLI 4GDKA 2KN5A 4MM3B 2HJ1A 2LGSA 1YMHE 4ZYSA 3ZW3A 2AL3A 2KDMA 3WIMA 1CZPA 3KLSX 3B9JA 3MJ5A 4IC7B 1MHHE 2JYTA 3GE3C 1SE3A 2JXTA 1C1YB 4DHZB 1GB1A 4M8NA 4ZYNA 3AULA 1J7AA 4W9KA 2JYEA 4C80A 4L23A 1QOGA 3MC9A 4TV3A 4EE2A 3I57A 4NNJB 1YOVB 4URKA 2OJRA 3CMMB 3HK0A 2ZNVC 1UD7A 2WU5B 4IWPA 3AEEB 1WXQA 4XDCA 2INDC 2JUOA 1Q0WB 2JPHA 2KHWB 1VZ6A 4C7YA 1SE4A 3ZLZA 2IZVB 4IM0A 2WDTB 5L95C 3P4QB 5DCNA 1T0RC 1YIWA 3V6CB 3VRBB 2V4IB 4IKGA 5KHQA 1WX8A 4J3OD 2O6VB 3LYYA 3VAWA 1ZDVA 2EMTA 4NQKE 4AJYB 2CHWA 1ACCA 2L0FA 1VJKA 2O2VA 1LM8B 2ZEQA 4L1BA 4RCOA 1TTNA 3X23A 3AE6B 1QOFA 5DPWA 2PVGC 3VTUA 2KX0A 3ZVVA 3KWLA 2KMCA 2KTRB 2WXFA 1M94A 4E3CA 3AEAB 2GLSA 2RDBC 3KYCD 2WHIA 3A9JB 4GU2A 4NJCA 4I6PA 3DWMA 3GP7A 3SR6A 2HD5B 2W3SA 3R7QA 1FRDA 2D2QA 2JY6A 2JWUA 3RNFC 3W5VB 1VD2A 3SFDB 3P4RB 3PVLA 1WI0A 2AWTA 1FFUA 3BYYB 1FNUA 3U8ZA 3AI5A 2KMMA 4PS8A 4JE3B 4WJOA 1SE2A 3VDZA 3ZNID 4ZOHC 2KNBA 4MH8A 3QQ8B 2QHOA 3MC0B 1WGDA 3RNBC 2D3GA 3IAM1 3A9KB 4JWSC 4XYCA 4K3CA 2BYTA 1C76A 3L0WB 3QWZB 3EC8A 3LXFA 3IFWB 4BKSD 2KXJA 1WZ3A 4GB9A 3W1SA 2VZKB 3W5UB 3DVNV 3ENEA 2I1KA 5FK9C 3AE3B 4PK1A 4WAFA 2MA9B 3BIID 4JX1C 2KC2A 1I4XA 2N7DA 4KZCA 3DVGX 1UZXB 3PLVA 3AMZA 2GRIA 2LGIA 4HPLB 1V1PA 4KV2A 3RPFC 2MWSB 1EM7A 4C4VA 2LWPA 4F1SA 3RZFA 4FULA 1VCBA 3UGBB 2J4XA 1HZ5A 2C60A 2M8SA 2MHJA 2N9XA 4N58A 4KZ0A 2A5UA 2KFKB 3MP9A 1FXTB 1YJIA 3VH4B 2LJIA 4W9CA 1J7CA 4WWNA 1UBIA 3ZXRA 5EDSA 2QSDA 3DBRB 3QX1A 3P1MA 2PKOA 3O13A 1TZ1A 1IYFA 1I4HA 3EGRA 2B76B 3O65B 3SFEB 1Y8RC 4GMVA 5CHFA 4WJQA 2NBWB 2K8BA 2KWUB 3HM6X 4EUTA 5J18A 3PLUA 1WRIA 2LGXA 5DPTA 3N32A 3Q8AA 1KLUD 4LCDE 4BOZB 1JWSD 3WALA 5JHBA 1M4VA 3ZRFA 2BWFA 3EA6A 4JIOU 5IKCM 1GNUA 1WFYA 4A3PA 1XCQL 2G1EA 2LUMA 5DPSA 2V0GA 5T8IA 2ONQA 5IN7A 5FR6A 3GS2A 1UGJA 2CKHB 4OVUA 3L16A 3IT4B 3ZJVA 1C78A 3AXCA 4KKIA 3PHWB 2AEHA 1FCCC 1XO3A 5LXHA 1K51A 4A9AA 2MEKA 3ZNGC 3OAWA 1JALA 1WZ0A 3IVFA 4P7IA 1C9FA 1GJZA 1XLNA 1TS3A 3P4PB 1K53A 2Q5WD 3MC8A 2Z0EB 4ARIA 3ZJUA 1JWUD 3U7ZA 3AE5B 2X8XX 4XGAB 2BYFA 2LI5A 4DHJD 1UH6A 2J52A 1F2RI 2PLPA 2DX5B 3ML9A 4GLSC 2IO2B 4DDGD 3UF8A 1JWMD 2JT4B 2CR5A 3H1UA 1I4QA 1NDDA 3WCQA 1AN8A 4B9KA 5D3IB 4MJSB 3H6NA 4BOSC 1SB3C 3QCAA 3T8MA 3NS1A 4PT5A 5C3JB 4CYEA 3TEWA 1KOTA 1LO5D 4H2AA 1L2NA 1JMLA 1H8CA 1TBEA 2G4SA 2WDQB 2BB6A 2OJWA 3DWGC 4M8MA 1N5WA 3UQAA 2PEAA 2UWQA 3R2TA 3AE7B 1A5RA 2GOWA 1N60A 2KDBA 2Z0DB 2ICIA 3MHZA 4MSQB 3J9CA 3OLMD 1E6EB 1AWDA 1KTKA 2CU1A 4HXDA 4AWJA 4RGTA 2KWVB 4YTMB 1TKGA 3DVNU 1FRRA 3L54A 1WJ4A 4TSSA 4ZRJA 1P1AA 2W55A 5IOIA 1MHXA 4W9LA 3DHIC 3ZNHB 3V62A 5LXIB 2IYDB 2N9PC 4HJKA 2K5PA 2QIEB 2L3ZA 4GSWA 3VUWA 3N1XC 4HPMB 1RLFA 2GBNA 1E9MA 1RM6C 1IBXB 1QZEA 1IPGA 1NYRA 1WX9A 4M0WA 3VHTC 1DOYA 4LNNA 1L0YB 1P7FA 4DXFA 2ACZB 4JWUC 1F2RC 1OEYA 2M19A 3CWIA 3CSTA 3BZDB 4Q2JA 3TMPB 1RWSA 2H88B 1F52A 3RI7C 3IBEA 2C5LC 2JWZA 2AL6A 3RT3B 2PMVA 4NJ7A 3M63B 2WXHA 2WXGA 4ZRPA 1UGMA 3B08A 4KGTA 2PVOD 2FCQA 4US8A 1L7YA 2J7QB 1WGHA 3ZIMA 2KVZA 1ZE3D 3D32A 3BYTB 4HEA1 1YJJA 2G45B 2L52A 4ZHOA 4ACFA 4W9DA 1B9RA 1SBBB 4FHKA 3W2DA 2ZW1A 4ZRIA 1VDVA 1K50A 3AE2B 1J7BA 4TKNA 1QILA 4BBNC 1E90A 5IP4D 3QK0A 4DBGA 2BB5A 2J0MA 2L0TA 1QKZA 2QEJC 3L13A 3N20C 4PYUA 3A4RA 5CTRC 1GOZA 1T0QC 1JW9D 2MP2B 1YNTE 2QILA 1HTQA 3ZYYX 2DWQA 1UWXA 4GOCA 3VRAB 3UIPB 1HZ6A 1OFFA 3AE1B 2WQYB 3VTVA 3GOEA 5C1ZA 3ZTDA 4ANVA 3BVZA 3NHEB 2N7EA 4FXCA 1JWBD 1ZPSA 4NAWB 3JSVB 2C9WB 3N1YC 5BYRA 4GDKB 4DHJB 1N61A 4DK5A 2GBRA 1D4BA 2N9EB 2KX3A 4LNFA 1PUTA 2R61A 1QOBA 3U7DA 2M1MA 3URYA 4MDKE 1V2YA 2JVCA 3DBHI 4LJOB 5E6PA 2NMQA 1SE9A 3K9PB 2WXPA 3ZXVA 3APFA 2IBIB 2LZ6A 2L00B 1OQYA 2WXMA 2OHFA 4LDTD 3SU8X 2R2QA 1Y56A 2AYOB 3NUHB 2R2OA 1ET9A 3Q2AC 4IG7B 4OVZA 4FJVB 5D7GA 3M3JA 1WGYA 4BAXA 3AN1A 4FBJB 1PGBA 1FMAD 3PO0A 1F1HA 5AEKB 1ET6A 1IUEA 1EWYC 3TEZA 1R4MI 2AQ3B 1P7EA 5L83A 3W1YA 1ZKHA 1S1QB 2KC1A 3KWVA 3BY4B 1RFAA 1ZUD2 2LVPA 2BYVE 2IO1B 2PTLA 3JW0X 3ZNZB 2KDFB 4OW0A 1DOXA 5AZGA 2REXA 1E7PB 1V1OA 4O1NA 4M02A 2J0KA 2G4DB 2O2VB 3L4PA 4HLEA 2QCZA 3PTFC 4NY0A 4MH0E 4W9IA 2KWDA 1C77A 4NZLB 3RN9C 3LDZE 3PRPB 3P4SB 4HJGE 1XT9B 2LXCA 2FUHB 4YXDB 3CF6E 2KFJA 1Q1OA 2KJHB 1FD6A 2NCNA 3L17A 4RM9A 4USAA 5D3DA 5HHDG 3MJWA 3R7RA 1WMHA 1C4PA 4TMAB 2MCNB 2XK5A 4OVVA 3GZNB 3OJ4B 3TUOA 4LTUA 3BK2A 3Q3NC 2MLBA 5IO9A 5AZHA 3SD5A 2N1WA 1MG8A 1Z2MA 1V97A 3GE8C 1P9DU 1RFKA 2FIFA 1D5ZC 1OQRA 1FM0D 4DDID 2KJRA 3WAMA 3HVZA 2K0PA 2KACA 4KSLC 2DZKA 1N62A 1OQQA 2OEDA 3ECIA 3IXSA 2RDGA 1L0XB 1E8ZA 4K1RB 2G3QB 3DHHC 4HKQA 4MEMA 4F8CB 3RNAC 3PHXB 3IHPC 3NZ3A 1XD3B 4EOYA 1ZXHA 2YEPF 4EZJA 2MQJA 4M00A 4R3DA 2D07B 4GGQA 3Q3JA 5HI1A 1SGHA 1V1PB 1P0RA 3V3XA 3BWUD 4MGZE 2WXNA 2JRIB 1HEZE 1WXAA 1KJTA 2CHXA 2D3AA 4C4VB 2PE6B 3H9DA 2EELA 3JVZX 2DZMA 3T3NA 3RMKC 3H7PA 4HDQA 2XNAC 4YWGG 2JXXA 5JH5C 3AEGB 1ESFA 1VLBA 4GDLA 2XBBC 2BYEA 4ICVA 2WLBA 3FKYA 2KQ4X 3DVGY 1V49A 5BYQA 4W9JA 1WJ6A 5IAAC 2C7HA 3B2FA 1BT0A 2FCMA 4KGRA 1R4NI 4WQMA 2M4NA 5J17A 4PS3A 4WJPA 1LFDA 3U2SC 1Q10A 2AQ1B 1B1ZA 4WIPA 1QOAA 4LDTB 3LJ3A 5H92C 1L0VB 5AUIA 2BWES 5EE9A 3NZSA 1HTOA 1SXTA 1SEBD 1L4DB 3QARA 3Q3FA 5KHOA 4JGHB 4CHKA 1X1MA 4LLGM 2V3NA 5BMHA 3EECA 3A1QA 2ZJDA 2ZNVB 1TZOA 2ZCBA 4RM8A 2C7MB 5G55A 4AP4C 1GC6A 3U30A 4FN2A 2UU7A 2EMSA 2MBQA 2DLBA 2YLMA 4IW0A 4ICUA 3PZ8A 2K8CA 2WXOA 3KVFB 1TJEA 1WGKA 2DBYA 4N6EB 2IY0B 4RMAA 4DXAB 1RAXA 1FXAA 4CO7A 1EU3A 1AW7A 3Q8CA 4YSYB 1E5WA 4LNKA 1WR6E 2LGDA 3DCGA 2KAJA 1KM7A 3ZJTA 4L2YA 4YSZB 2MRPA 4EZLA 2L05A 1LGRA 1UWMA 2K3UA 2BKFA 1WGRA 3DBLB 2NBUA 1KRHA 5MPOA 2V4LA 2NTSA 1CJEA 3NOBA 2M17A 4BFRA 3A33B 1HQRD 5E6NA 2DZIA 2SAKA 5EE0A 2IO3B 3IAS1 4B0MA 4YTNB 3TBLD 4HK2A 1WM3A 3R2IA 1I42A 5I4DA 2CJOA 3QAQA 1YQBA 2J0JA 1OEYJ 3RZWC 1J19A 1GC7A 4EFOA 1YN5A 1TT5B 1HE8A 3KUZA 4IWQA 1QT9A 5EE3A 3TIXA 3AH7A 1TY0A 3AE8B 1WF9A 1UUPA 3FILA 3AEDB 4XE0A 2K1FA 5G2NA 4MGYE 3Q14C 1WJNA 1L4ZB 3TCAA 2D11A 4FHJA 1FNVA 1V6EA 2INPE 2VH1A 1XCTL 3SDLC 4ASWC 1MFWA 2M0AA 3FC4A 1JQ4A 4IM2A 4MGIE 1STEA 4ANXA 1V5TA 4YSXB 1ENFA 3QA8A 3PT2B 2K8HA 3Q69A 2KT7A 1U4AA 3HUIA 4KKJA 3AB5A 2NBVB 5JHAA 2IO0B 3EHVA 3Q6BA 2IDYA 2I2YA 4P1BC 4ZRKA 4IM3A 1ZXIA 4WWPA 1E0ZA 2K22A 2FBWB 3RD2A 1TS5A 3VR8B 1XXGA 2KVRA 2RGFA 2LUEA 4M0WB 1A70A 4W9FA 3AE4B 3ZO5B 2NVUI 1E10A 2LRUA 3KW5B 2MJDA 3TJPA 2FCNA 4DXGA 4N9F4 4RF1A 4A90A 4WJNA 3A4SC 3PZDA 4NJ6A 4BBNF 2JSVX 4RH6A 5G5GA 3EFCA 1E8YA 3ZGZA 5CHVC 1K52A 1YN3A 2RMMA 1XLOA 3ZTCA 1ZGUB 1YQ3B 2I1JA 4WURA 2KQ7A 2FUG1 4ARCA 1FFVA 3ETRA 5TR5A 3NG0A 1V86A 5D6JB 2FE8A 2WDRB 2DYMA 2QJLA 4GXBA 2GI9A 4OZAA 5BMIA 1T0SC 2DYBA 4K7WA 2PPHA 2D3CA 5H8YE 4XX5A 2MW5A 2LFIA 1YX5B 4LNIA 4AJWA 1FNWA 4I6NB 1KF6B 3ZDMC 1FIQA 3BVMA 1OTRB 3ZKJC 2K39A 2RD0A 3V60A 3B2GA 2GBKA 2L76A 1D3ZA 1TKEA 4TUUA 3DOWA 3SEBA 1VZ7A 2LGYA 4MGKE 3DPDA 4C56C 2DNFA 1FXIA 2L32A 5DPRA 2KANA 5AUKA 3RNEC 3I63C 2JZ3B 3ZDTA 2Z8LA 2GBJA 3AU4A 1XLQA 3UINB 1C3TA 3L10B 2L1AA 4BKTA 3ZRCA 2LASA 1GAQB 2AX5A 1FPYA 2BGFA 4JPSA 4RFBA 5BYSA 1N63A 1PYWD 4ZHPA 2K9XA 4LJPB 5FR3A 4A6QA 3KH0A 3N3KB 1D6EC 2WS3B 3NRZA 1MPEA 2KYWA 4II2B 4HRSA 1SIJA 1EU4A 1J0GA 2Y3AA 1V5OA 3V05A 5LLIA 3VUXA 2VRRB 1SJED 3ONSA 3DBRI 3VVWB 4PYZA 1NVID 1EUVB 2V3SA 3N1ZC 3M95A 3OJ3A 5CX3A 4PS7A 3HM3A 4KIKA 2MBOA 4A8XC 1CMXB 2IGDA 3AEBB 3JYUA 2WWZA 2WXQA 4TQ0A 3KQ4A 1TYGB 3N9YC 2K6QA 2YVCA 4YT0B 3IG3A 3QHTA 1L6UA 4J6IA 2IPKD 3K9OB 2MBEA 3HHMA 4B0EA 4BVUC 2NPTA 2FAZA 3ZQ4A 3R8BA 2WXKA 1DYQA 3DBSA 4HPPA 1C79A 1C4CA 3ALBA 1MI0A 3BINA 2L8JA 4LK0M 2IJ0A 3V6EB 1I4RA 1V80A 1WE7A 1N5XA 3NVWA 1BXTA 1P3QU 1N6ZA 3QC8B 3SHQA 3I5JC 1WM2A 2MH7A 3UIOB 3Q8FA 1VRAB 3LB8C 2DYOA 3P42A 3VXWA 2HTHA 2TSSA 4ZDVA 4MM3A 2DAFA 3VR9B 5EE1A 4FLHA 2E3TA 1WMHB 2VH2A 3NVZA 4II3B 4XWWA 3TEXA 1WH3A 2XK5B 1SF0A 1WXMA 2BQQA 3UI3A 1FCLA 2KN4A 4P6VF 1WXSA 1EF5A 2BS2B 2INCC 1NBFC 2K25A 2DHZA 4MT5A 3ML8A 1S3SG 2WXJA 3PZ7A 2JQRB 1NYQA 3PPAA 1PDXA 3MFGA 1RRBA 2LRWA 2RPVA 5G5HA 3P2BA 1KH0A 2M56B 1WX7A 2QC8A 4W9EA 5HG2A 4ANUA 2K6DB 1XLPA 1GUAB 3VUYA 1LXDA 4HROA 4B6WA 2ZVNA 1V8CA 3APCA 1JRPA 4OHJA 4N59A 4BZAA 4OZCA 2AQ2B 1TKYA 2ASQA 1T0YA 2E6XA 1MJDA 1QQRA 4A20A 4ITKA 2ZPYA 4A3OA 4HWIB 3TL5A 1IGCA 2O6VA 2KKCA 1EWCA 4WQOB 4MACA 4US9A 1QF6A 2MJ3A 2GMIC 1PFDA 4G0NB 1XQQA 4DQOC 2HTME 4KDIC 5JXVA 3H7PB 4A55A 2MSED 4GDLB 2HJ8A 2I38A 1VZ8A 3N30A 4IDIA 2KTRA 1MG4A 4I6LB 3H8HA 1UBQA 1GPXA 1WE6A 4KVGB 3T9LA 4FADA 3A9JA 2RDHA 2N9KA 2BT6A 4RF0A 2PE9A 1CQVA 3DQVA 1T6BX 3AV8A 4HDOA 2MJEA 2WXLA 3RCZA 4WAAA 1JROA 1L6VA 1WR1A 4XWTA 4CQNA 2JZPA 3AE9B 1CK1A 3ZUNA 3EUB2 3FAHA 3BK1A 2BW2A 1WXVA 3PREA 3HIZA 4B95A 2LVOA 3I9V1 5CHWA 3U4EG 1G6JA 2N0SB 3VFKA 4IOIE 1ISNA 1MVKA 3T3OA 1HXYD 2BS4B 1XF5L 4KX6B 3A1QB 2LEKA 2MBHA 4K7UA 4NQLB 2ZVOA 4K81A 3KYDD 1TS4A 4C00A 4HKZE 3A9KA 3DDCB 3NY5A 3RNGC 4EEWA 2GB1A 2WU2B 5HKHA 2UYZB 1TIFA 2BS3B 1GB4A 4NAMA 2HDEA 1Q5WB 2WX0A 1T3QA 3Q8EA 2Z59B 4JLCA 3Q3MC 1NEKB 1WGGA 2WXRA 5FKAC 5D2MB 3W9CB 1WWTA 4G50A 2Y5CA 1YX6B 3QJZA 4XDDA 2JZZA 2V9HA 3PRMB 3BVGA 1PQSA 5BMGA 4FJZA 3C0RB 1I7HA 3RULA 3HVDA 4RGMA 2INNE 4HCNB 4S0RA 1JCKB 2WNMA 3DBHB 3RFZB 2KFKA 2KLCA 2A4ZA 3TEYA 2G9HD 2KLGA 2ZCCA 3UQBA 2IGGA 2BTEA 1HA5A 4W9GA 5GMVA 3DHGC 2NTTA 2CJNA 3AM9A 3VQIA 1YD8U 2M0XA 2C7NB 3CIRB 4QAYA 5BO4B 2DAJA 1EF1A 5D94A 3APDA 2SEBD 3WAOA 2CHZA 3AEFB 1V9JA 3FILB 1F0ZA 3NJTA 3X0WA 3IT6B 1TS2A 4TQ1A 3WANA 4KGSA 2PJHA 1R4MB 2WX1A 2WP9B
chains in the Genus database with same CATH topology
2LXAA 4FJVB 4WJOA 1YJ1A 5D7GA 2BPSA 5TR5A 3M3JA 3VDZA 3ZNID 1WGYA 2KNBA 4HCPB 2JRHA 4XC2A 1WYWB 3WAPA 4FBJB 2KK8A 1V86A 3QQ8B 5D6JB 2QHOA 5AEKB 1WGDA 2DYMA 2D3GA 3A9KB 4IUMB 1WJUA 2ZPNA 3KUCB 3L0WB 3QWZB 3EC8A 4GXBA 3IFWB 4FA6A 1F9JA 1R4MI 2B3AA 2DYBA 4BKSD 2KXJA 1WZ3A 4GB9A 4K7WA 3W1SA 5L83A 3DVNV 3ENEA 2PPHA 2I1KA 3W1YA 2KO3A 1ZKHA 1S1QB 4XX5A 2MW5A 2KC1A 1YX5B 3BY4B 1RFAA 3QIJA 2LVPA 2BYVE 1TGZB 2IO1B 4AJWA 2MA9B 5JZEB 4I6NB 2KC2A 2N7DA 4KZCA 3ZDMC 3JW0X 3DVGX 1UZXB 3PLVA 3PRZA 1OTRB 3ZKJC 2K39A 3ZNZB 2RD0A 2KDFB 4HPLB 3V60A 2GBKA 5AZGA 2L76A 1D3ZA 4TUUA 4KV2A 3DOWA 2REXA 2LGYA 3R3MA 1WY8A 2MWSB 4MGKE 2J0KA 3DPDA 2G4DB 2O2VB 4HLEA 1GG3A 2LWPA 5DPRA 2KANA 2RR9A 3PTFC 4MH0E 4NY0A 4W9IA 3RZFA 4F1SA 4JL9A 2JZ3B 4FULA 3ZDTA 1VCBA 3UGBB 2GBJA 1V81A 3AU4A 4JQWC 2C60A 2M8SA 3UINB 2N9XA 3LDZE 1C3TA 3PRPB 4KZ0A 2A5UA 2KFKB 3L10B 2FNJB 4BKTA 1FXTB 1XT9B 2KTFA 3ZRCA 3VH4B 2LXCA 2LASA 2FUHB 1E7VA 1E8XA 3CF6E 2BGFA 4GIVA 4W9CA 2KFJA 1Q1OA 2KJHB 3PSEB 4WWNA 2FCSA 1UBIA 4LJPB 2NCNA 5EDSA 3L17A 1UELA 4RM9A 5IA7A 3KH0A 3MJWA 3R7RA 3N3KB 1WMHA 3QX1A 1Z5SB 4MSMB 2MCNB 2XK5A 4II2B 4OVVA 1TZ1A 1IYFA 3KUDB 3OJ4B 2N1VA 2MLBA 4BKGA 1J0GA 2KMAA 5AZHA 1V5OA 3SD5A 4WWOA 2N1WA 5LLIA 1MG8A 1Z2MA 2VRRB 3VUXA 3ONSA 1P9DU 3AU5A 3DBRI 3O65B 3VVWB 4PYZA 1EUVB 2V3SA 1Y8RC 2FIFA 4GMVA 4MJSA 3M95A 5CHFA 4F7ZA 1KOTA 3OJ3A 2ZZPB 4WJQA 5CX3A 4PS7A 2NBWB 3GZNI 2K8BA 2KWUB 3HM6X 4DDID 4EUTA 3NZUA 2KJRA 3WAMA 5J18A 3HM3A 3PLUA 4KIKA 4KSLC 2MBOA 2DZKA 1CMXB 3VTWA 4BKSA 2LGXA 3ECIA 3JYUA 5AZFA 5DPTA 4K1RB 1E8ZA 2WWZA 3N32A 2G3QB 4TQ0A 4MEMA 4F8CB 4LCDE 3PHXB 4K7SA 4BOZB 3WALA 2KOXA 3IHPC 5JHBA 1XD3B 4EOYA 2LJ5A 4ANWA 2K6QA 2BWFA 2YVCA 3ZRFA 4JIOU 3IG3A 3QHTA 4J6IA 1GNUA 3K9OB 2MBEA 1WFYA 3HHMA 3NS8A 4A3PA 4BVUC 4EZJA 2NPTA 2MQJA 2KDEB 2FAZA 1NI2A 4HVBA 2D07B 4GGQA 5DPSA 4IWOA 3Q3JA 3DBSA 3B1LX 1SGHA 5FR6A 2CKHB 3ALBA 4W9HA 1LQBA 2GBMA 4OVUA 3L16A 3BINA 1P0RA 2L8JA 3PV1A 2Y5BB 2BKRB 4MGZE 2JRIB 4KDLB 1WXAA 2KZRA 1KJTA 3L08A 2CHXA 3AXCA 3VH3B 3M62B 2PE6B 3V6EB 3PHWB 2AEHA 1V80A 1WE7A 2D10A 4EZKA 3CSFA 1H4RA 1ZW7A 2O6VD 3H9DA 3JVZX 4YL8A 5LXHA 2DZMA 3H7PA 1P3QU 3ZNGC 1OGWA 2LD9A 3OAWA 4HDQA 3QC8B 1WZ0A 3SHQA 3IVFA 4P7IA 2NR2A 4X57B 5J2RA 2JXXA 5JH5C 1GJZA 1WM2A 4XZ4A 4PS8A 3UIOB 2WYQA 4GDLA 2XBBC 2BYEA 3RYTA 4DHZE 2DYOA 4ICVA 3VXWA 2HTHA 3RUIB 4ZDVA 2DZJA 4MM3A 2Z0EB 2CS4A 4KSKC 2DAFA 1V49A 3DVGY 4W9JA 1WJ6A 5E6OA 5IAAC 2C7HA 4FLHA 1BT0A 2BYFA 2FCMA 2V1YA 1WMHB 1R4NI 2M4NA 5J17A 2LI5A 4PS3A 4DHJD 4WJPA 4II3B 1UH6A 1WH3A 2XK5B 1WXMA 1LFDA 2DX5B 3ML9A 4LDTB 3LJ3A 4DWFA 3EFUA 2BWES 2IO2B 4DDGD 1WXSA 3I3TB 3NZSA 4EKUA 1EF5A 1NBFC 2K25A 2DHZA 3ML8A 3UF8A 4G11A 2JT4B 2CR5A 3H1UA 1NDDA 2W9NA 1S3SG 3QARA 3Q3FA 5KHOA 1AARA 4JGHB 4CHKA 4G3XB 1X1MA 4B9KA 3PPAA 2KWCA 2IY1B 3H6NA 4MJSB 4BOSC 1RRBA 2LRWA 2KDIA 3S2AA 2EKEC 3EECA 3QCAA 3T8MA 2NS5A 2MX2A 3A1QA 3P2BA 4KIKB 1WX7A 4CYEA 2FIDA 2ZJDA 2ZNVB 4W9EA 2KD0A 3MHSD 2K6DB 2ZCBA 2C7MB 4RM8A 5G55A 1GC6A 4AP4C 1GUAB 4AOFA 3U30A 3VUYA 4E74A 2OOBB 4FN2A 1LXDA 1L2NA 1H8CA 2EMSA 4FJYA 2MBQA 1J8CA 4B6WA 2ZVNA 2RSUA 1TBEA 2YLMA 4IW0A 2G4SA 3APCA 2K8CA 4ICUA 3KVFB 4M8MA 2XEWA 3B0AA 3PS6A 3UQAA 2IY0B 2PEAA 2UWQA 2JF5A 4RMAA 4MELA 4DXAB 4ANUA 1RAXA 2GOWA 1A5RA 4CO7A 3W1SC 2KDBA 4GN1A 2NPTB 2KJ6A 2ASQA 2Z0DB 1T0YA 4MSQB 2N4FA 1E5WA 3OLMD 1WRDB 4A20A 1WR6E 2CU1A 4AWJA 4HXDA 2LGDA 3DCGA 4E71A 2ZPYA 1K8RB 3V61A 1KM7A 4A3OA 4HWIB 2KWVB 3TL5A 1P98A 2BF8B 1I35A 3DVNU 3MTNB 3L54A 1WJ4A 2MP2A 4ZRJA 2MRPA 2O6VA 1JRUA 2KKCA 1E7UA 2L05A 4EZLA 1P1AA 5C23A 4WQOB 2BKFA 1IP9A 1WGRA 4W9LA 4NPNA 2NBUA 3ZNHB 2L7RA 2V4LA 2MBBB 2DENB 2GMIC 3V62A 4G0NB 1XQQA 2LVQA 2IYDB 2N9PC 3NOBA 4HJKA 5LXIB 2RPQA 2KQSA 4KDIC 2M17A 2L3ZA 4GSWA 3VUWA 3H7PB 4HPMB 1RLFA 1KLVA 2GBNA 1EO6A 3WA0A 4BFRA 3AI5A 1SIFA 2MSED 3A33B 4AUQC 1QZEA 1IPGA 4NAWA 5E6NA 1WX9A 2HE7A 2DZIA 1E8WA 3JSVA 3PGEA 2HJ8A 4GDLB 3VHTC 2IO3B 3N30A 3R66C 1WIAA 2KTRA 1OEYA 3H7SA 3CSTA 3DBLI 4GDKA 3TBLD 2KN5A 4HK2A 4I6LB 3TMPB 1WM3A 1UBQA 1I42A 1WE6A 4KVGB 3T9LA 3QAQA 4FADA 1YQBA 3A9JA 2J0JA 3ZW3A 2AL3A 3IBEA 2C5LC 2JWZA 2AL6A 1OEYJ 3WIMA 3RT3B 2PE9A 3DQVA 3RZWC 4HDOA 1J19A 1GC7A 3RCZA 4IC7B 1WR1A 4NJ7A 4WAAA 3M63B 4EFOA 1HE8A 3ZUNA 3KUZA 4IWQA 1WXVA 3PREA 1UGMA 3HIZA 3B08A 4B95A 3TIXA 2LVOA 1C1YB 1WF9A 5CHWA 4DHZB 1G6JA 3VFKA 2FCQA 4M8NA 2K1FA 1ISNA 1L7YA 5G2NA 4MGYE 2J7QB 4ZYNA 1WGHA 3ZIMA 1WJNA 3AULA 3TCAA 2D11A 4W9KA 4FHJA 3D32A 4TV3A 1V6EA 3A1QB 2G45B 2MBHA 4K7UA 4NQLB 4NNJB 3SDLC 4ASWC 4URKA 2ZVOA 4K81A 2OJRA 4W9DA 3CMMB 3HK0A 2ZNVC 3KYDD 4FHKA 1UD7A 4IM2A 4MGIE 4IWPA 3A9KA 4ANXA 4ZRIA 2JUOA 3DDCB 1V5TA 1Q0WB 2JPHA 3NY5A 2KHWB 4TKNA 3ZLZA 2IZVB 4IM0A 4EEWA 5HKHA 3QA8A 3PT2B 2WDTB 4BBNC 2UYZB 5L95C 2K8HA 1E90A 5DCNA 1U4AA 1YIWA 3QK0A 3V6CB 4DBGA 2WX0A 1Q5WB 2J0MA 5KHQA 1WX8A 2L0TA 5CTRC 3L13A 4PYUA 2NBVB 3A4RA 5JHAA 2Z59B 2IO0B 2MP2B 4JLCA 2O6VB 3EHVA 1WGGA 5D2MB 3VAWA 2EMTA 4NQKE 4GOCA 4AJYB 4ZRKA 2CHWA 3UIPB 4G50A 4IM3A 1YX6B 3QJZA 4WWPA 2JZZA 2L0FA 3VTVA 3GOEA 3PRMB 5C1ZA 2O2VA 1LM8B 2ZEQA 3ZTDA 4ANVA 1PQSA 3RD2A 4FJZA 3NHEB 2N7EA 3C0RB 3RULA 1TTNA 2KVRA 4HCNB 4NAWB 2RGFA 2LUEA 4M0WB 3X23A 3JSVB 4W9FA 5DPWA 3VTUA 2KX0A 3ZVVA 2KFKA 2KLCA 2A4ZA 2KMCA 2C9WB 2KTRB 3ZO5B 2KLGA 2ZCCA 3UQBA 1M94A 4E3CA 2NVUI 4GDKB 4DHJB 2LRUA 4DK5A 4W9GA 2GBRA 5GMVA 3KYCD 3A9JB 2N9EB 4GU2A 2KX3A 4I6PA 3KW5B 3TJPA 2FCNA 4N9F4 2HD5B 3R7QA 3U7DA 2M1MA 2D2QA 4WJNA 3VQIA 2JY6A 1YD8U 2M0XA 2C7NB 3A4SC 1V2YA 4MDKE 3PZDA 4NJ6A 2JVCA 3DBHI 4LJOB 5E6PA 4BBNF 5BO4B 2DAJA 1EF1A 5D94A 3APDA 3WAOA 1SE9A 1VD2A 2CHZA 3K9PB 1V9JA 1E8YA 3PVLA 5CHVC 3APFA 1WI0A 2AWTA 2IBIB 2LZ6A 3X0WA 2L00B 3ZTCA 1ZGUB 1OQYA 2I1JA 2KQ7A 4LDTD 4TQ1A 3SU8X 3WANA 2R2QA 2AYOB 2PJHA 2R2OA 3U8ZA 2WX1A 4IG7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXA A;  4FJV B;  4WJO A;  1YJ1 A;  5D7G A;  2BPS A;  5TR5 A;  3M3J A;  3VDZ A;  3ZNI D;  1WGY A;  2KNB A;  4HCP B;  2JRH A;  4XC2 A;  1WYW B;  3WAP A;  4FBJ B;  2KK8 A;  1V86 A;  3QQ8 B;  5D6J B;  2QHO A;  5AEK B;  1WGD A;  2DYM A;  2D3G A;  3A9K B;  4IUM B;  1WJU A;  2ZPN A;  3KUC B;  3L0W B;  3QWZ B;  3EC8 A;  4GXB A;  3IFW B;  4FA6 A;  1F9J A;  1R4M I;  2B3A A;  2DYB A;  4BKS D;  2KXJ A;  1WZ3 A;  4GB9 A;  4K7W A;  3W1S A;  5L83 A;  3DVN V;  3ENE A;  2PPH A;  2I1K A;  3W1Y A;  2KO3 A;  1ZKH A;  1S1Q B;  4XX5 A;  2MW5 A;  2KC1 A;  1YX5 B;  3BY4 B;  1RFA A;  3QIJ A;  2LVP A;  2BYV E;  1TGZ B;  2IO1 B;  4AJW A;  2MA9 B;  5JZE B;  4I6N B;  2KC2 A;  2N7D A;  4KZC A;  3ZDM C;  3JW0 X;  3DVG X;  1UZX B;  3PLV A;  3PRZ A;  1OTR B;  3ZKJ C;  2K39 A;  3ZNZ B;  2RD0 A;  2KDF B;  4HPL B;  3V60 A;  2GBK A;  5AZG A;  2L76 A;  1D3Z A;  4TUU A;  4KV2 A;  3DOW A;  2REX A;  2LGY A;  3R3M A;  1WY8 A;  2MWS B;  4MGK E;  2J0K A;  3DPD A;  2G4D B;  2O2V B;  4HLE A;  1GG3 A;  2LWP A;  5DPR A;  2KAN A;  2RR9 A;  3PTF C;  4MH0 E;  4NY0 A;  4W9I A;  3RZF A;  4F1S A;  4JL9 A;  2JZ3 B;  4FUL A;  3ZDT A;  1VCB A;  3UGB B;  2GBJ A;  1V81 A;  3AU4 A;  4JQW C;  2C60 A;  2M8S A;  3UIN B;  2N9X A;  3LDZ E;  1C3T A;  3PRP B;  4KZ0 A;  2A5U A;  2KFK B;  3L10 B;  2FNJ B;  4BKT A;  1FXT B;  1XT9 B;  2KTF A;  3ZRC A;  3VH4 B;  2LXC A;  2LAS A;  2FUH B;  1E7V A;  1E8X A;  3CF6 E;  2BGF A;  4GIV A;  4W9C A;  2KFJ A;  1Q1O A;  2KJH B;  3PSE B;  4WWN A;  2FCS A;  1UBI A;  4LJP B;  2NCN A;  5EDS A;  3L17 A;  1UEL A;  4RM9 A;  5IA7 A;  3KH0 A;  3MJW A;  3R7R A;  3N3K B;  1WMH A;  3QX1 A;  1Z5S B;  4MSM B;  2MCN B;  2XK5 A;  4II2 B;  4OVV A;  1TZ1 A;  1IYF A;  3KUD B;  3OJ4 B;  2N1V A;  2MLB A;  4BKG A;  1J0G A;  2KMA A;  5AZH A;  1V5O A;  3SD5 A;  4WWO A;  2N1W A;  5LLI A;  1MG8 A;  1Z2M A;  2VRR B;  3VUX A;  3ONS A;  1P9D U;  3AU5 A;  3DBR I;  3O65 B;  3VVW B;  4PYZ A;  1EUV B;  2V3S A;  1Y8R C;  2FIF A;  4GMV A;  4MJS A;  3M95 A;  5CHF A;  4F7Z A;  1KOT A;  3OJ3 A;  2ZZP B;  4WJQ A;  5CX3 A;  4PS7 A;  2NBW B;  3GZN I;  2K8B A;  2KWU B;  3HM6 X;  4DDI D;  4EUT A;  3NZU A;  2KJR A;  3WAM A;  5J18 A;  3HM3 A;  3PLU A;  4KIK A;  4KSL C;  2MBO A;  2DZK A;  1CMX B;  3VTW A;  4BKS A;  2LGX A;  3ECI A;  3JYU A;  5AZF A;  5DPT A;  4K1R B;  1E8Z A;  2WWZ A;  3N32 A;  2G3Q B;  4TQ0 A;  4MEM A;  4F8C B;  4LCD E;  3PHX B;  4K7S A;  4BOZ B;  3WAL A;  2KOX A;  3IHP C;  5JHB A;  1XD3 B;  4EOY A;  2LJ5 A;  4ANW A;  2K6Q A;  2BWF A;  2YVC A;  3ZRF A;  4JIO U;  3IG3 A;  3QHT A;  4J6I A;  1GNU A;  3K9O B;  2MBE A;  1WFY A;  3HHM A;  3NS8 A;  4A3P A;  4BVU C;  4EZJ A;  2NPT A;  2MQJ A;  2KDE B;  2FAZ A;  1NI2 A;  4HVB A;  2D07 B;  4GGQ A;  5DPS A;  4IWO A;  3Q3J A;  3DBS A;  3B1L X;  1SGH A;  5FR6 A;  2CKH B;  3ALB A;  4W9H A;  1LQB A;  2GBM A;  4OVU A;  3L16 A;  3BIN A;  1P0R A;  2L8J A;  3PV1 A;  2Y5B B;  2BKR B;  4MGZ E;  2JRI B;  4KDL B;  1WXA A;  2KZR A;  1KJT A;  3L08 A;  2CHX A;  3AXC A;  3VH3 B;  3M62 B;  2PE6 B;  3V6E B;  3PHW B;  2AEH A;  1V80 A;  1WE7 A;  2D10 A;  4EZK A;  3CSF A;  1H4R A;  1ZW7 A;  2O6V D;  3H9D A;  3JVZ X;  4YL8 A;  5LXH A;  2DZM A;  3H7P A;  1P3Q U;  3ZNG C;  1OGW A;  2LD9 A;  3OAW A;  4HDQ A;  3QC8 B;  1WZ0 A;  3SHQ A;  3IVF A;  4P7I A;  2NR2 A;  4X57 B;  5J2R A;  2JXX A;  5JH5 C;  1GJZ A;  1WM2 A;  4XZ4 A;  4PS8 A;  3UIO B;  2WYQ A;  4GDL A;  2XBB C;  2BYE A;  3RYT A;  4DHZ E;  2DYO A;  4ICV A;  3VXW A;  2HTH A;  3RUI B;  4ZDV A;  2DZJ A;  4MM3 A;  2Z0E B;  2CS4 A;  4KSK C;  2DAF A;  1V49 A;  3DVG Y;  4W9J A;  1WJ6 A;  5E6O A;  5IAA C;  2C7H A;  4FLH A;  1BT0 A;  2BYF A;  2FCM A;  2V1Y A;  1WMH B;  1R4N I;  2M4N A;  5J17 A;  2LI5 A;  4PS3 A;  4DHJ D;  4WJP A;  4II3 B;  1UH6 A;  1WH3 A;  2XK5 B;  1WXM A;  1LFD A;  2DX5 B;  3ML9 A;  4LDT B;  3LJ3 A;  4DWF A;  3EFU A;  2BWE S;  2IO2 B;  4DDG D;  1WXS A;  3I3T B;  3NZS A;  4EKU A;  1EF5 A;  1NBF C;  2K25 A;  2DHZ A;  3ML8 A;  3UF8 A;  4G11 A;  2JT4 B;  2CR5 A;  3H1U A;  1NDD A;  2W9N A;  1S3S G;  3QAR A;  3Q3F A;  5KHO A;  1AAR A;  4JGH B;  4CHK A;  4G3X B;  1X1M A;  4B9K A;  3PPA A;  2KWC A;  2IY1 B;  3H6N A;  4MJS B;  4BOS C;  1RRB A;  2LRW A;  2KDI A;  3S2A A;  2EKE C;  3EEC A;  3QCA A;  3T8M A;  2NS5 A;  2MX2 A;  3A1Q A;  3P2B A;  4KIK B;  1WX7 A;  4CYE A;  2FID A;  2ZJD A;  2ZNV B;  4W9E A;  2KD0 A;  3MHS D;  2K6D B;  2ZCB A;  2C7M B;  4RM8 A;  5G55 A;  1GC6 A;  4AP4 C;  1GUA B;  4AOF A;  3U30 A;  3VUY A;  4E74 A;  2OOB B;  4FN2 A;  1LXD A;  1L2N A;  1H8C A;  2EMS A;  4FJY A;  2MBQ A;  1J8C A;  4B6W A;  2ZVN A;  2RSU A;  1TBE A;  2YLM A;  4IW0 A;  2G4S A;  3APC A;  2K8C A;  4ICU A;  3KVF B;  4M8M A;  2XEW A;  3B0A A;  3PS6 A;  3UQA A;  2IY0 B;  2PEA A;  2UWQ A;  2JF5 A;  4RMA A;  4MEL A;  4DXA B;  4ANU A;  1RAX A;  2GOW A;  1A5R A;  4CO7 A;  3W1S C;  2KDB A;  4GN1 A;  2NPT B;  2KJ6 A;  2ASQ A;  2Z0D B;  1T0Y A;  4MSQ B;  2N4F A;  1E5W A;  3OLM D;  1WRD B;  4A20 A;  1WR6 E;  2CU1 A;  4AWJ A;  4HXD A;  2LGD A;  3DCG A;  4E71 A;  2ZPY A;  1K8R B;  3V61 A;  1KM7 A;  4A3O A;  4HWI B;  2KWV B;  3TL5 A;  1P98 A;  2BF8 B;  1I35 A;  3DVN U;  3MTN B;  3L54 A;  1WJ4 A;  2MP2 A;  4ZRJ A;  2MRP A;  2O6V A;  1JRU A;  2KKC A;  1E7U A;  2L05 A;  4EZL A;  1P1A A;  5C23 A;  4WQO B;  2BKF A;  1IP9 A;  1WGR A;  4W9L A;  4NPN A;  2NBU A;  3ZNH B;  2L7R A;  2V4L A;  2MBB B;  2DEN B;  2GMI C;  3V62 A;  4G0N B;  1XQQ A;  2LVQ A;  2IYD B;  2N9P C;  3NOB A;  4HJK A;  5LXI B;  2RPQ A;  2KQS A;  4KDI C;  2M17 A;  2L3Z A;  4GSW A;  3VUW A;  3H7P B;  4HPM B;  1RLF A;  1KLV A;  2GBN A;  1EO6 A;  3WA0 A;  4BFR A;  3AI5 A;  1SIF A;  2MSE D;  3A33 B;  4AUQ C;  1QZE A;  1IPG A;  4NAW A;  5E6N A;  1WX9 A;  2HE7 A;  2DZI A;  1E8W A;  3JSV A;  3PGE A;  2HJ8 A;  4GDL B;  3VHT C;  2IO3 B;  3N30 A;  3R66 C;  1WIA A;  2KTR A;  1OEY A;  3H7S A;  3CST A;  3DBL I;  4GDK A;  3TBL D;  2KN5 A;  4HK2 A;  4I6L B;  3TMP B;  1WM3 A;  1UBQ A;  1I42 A;  1WE6 A;  4KVG B;  3T9L A;  3QAQ A;  4FAD A;  1YQB A;  3A9J A;  2J0J A;  3ZW3 A;  2AL3 A;  3IBE A;  2C5L C;  2JWZ A;  2AL6 A;  1OEY J;  3WIM A;  3RT3 B;  2PE9 A;  3DQV A;  3RZW C;  4HDO A;  1J19 A;  1GC7 A;  3RCZ A;  4IC7 B;  1WR1 A;  4NJ7 A;  4WAA A;  3M63 B;  4EFO A;  1HE8 A;  3ZUN A;  3KUZ A;  4IWQ A;  1WXV A;  3PRE A;  1UGM A;  3HIZ A;  3B08 A;  4B95 A;  3TIX A;  2LVO A;  1C1Y B;  1WF9 A;  5CHW A;  4DHZ B;  1G6J A;  3VFK A;  2FCQ A;  4M8N A;  2K1F A;  1ISN A;  1L7Y A;  5G2N A;  4MGY E;  2J7Q B;  4ZYN A;  1WGH A;  3ZIM A;  1WJN A;  3AUL A;  3TCA A;  2D11 A;  4W9K A;  4FHJ A;  3D32 A;  4TV3 A;  1V6E A;  3A1Q B;  2G45 B;  2MBH A;  4K7U A;  4NQL B;  4NNJ B;  3SDL C;  4ASW C;  4URK A;  2ZVO A;  4K81 A;  2OJR A;  4W9D A;  3CMM B;  3HK0 A;  2ZNV C;  3KYD D;  4FHK A;  1UD7 A;  4IM2 A;  4MGI E;  4IWP A;  3A9K A;  4ANX A;  4ZRI A;  2JUO A;  3DDC B;  1V5T A;  1Q0W B;  2JPH A;  3NY5 A;  2KHW B;  4TKN A;  3ZLZ A;  2IZV B;  4IM0 A;  4EEW A;  5HKH A;  3QA8 A;  3PT2 B;  2WDT B;  4BBN C;  2UYZ B;  5L95 C;  2K8H A;  1E90 A;  5DCN A;  1U4A A;  1YIW A;  3QK0 A;  3V6C B;  4DBG A;  2WX0 A;  1Q5W B;  2J0M A;  5KHQ A;  1WX8 A;  2L0T A;  5CTR C;  3L13 A;  4PYU A;  2NBV B;  3A4R A;  5JHA A;  2Z59 B;  2IO0 B;  2MP2 B;  4JLC A;  2O6V B;  3EHV A;  1WGG A;  5D2M B;  3VAW A;  2EMT A;  4NQK E;  4GOC A;  4AJY B;  4ZRK A;  2CHW A;  3UIP B;  4G50 A;  4IM3 A;  1YX6 B;  3QJZ A;  4WWP A;  2JZZ A;  2L0F A;  3VTV A;  3GOE A;  3PRM B;  5C1Z A;  2O2V A;  1LM8 B;  2ZEQ A;  3ZTD A;  4ANV A;  1PQS A;  3RD2 A;  4FJZ A;  3NHE B;  2N7E A;  3C0R B;  3RUL A;  1TTN A;  2KVR A;  4HCN B;  4NAW B;  2RGF A;  2LUE A;  4M0W B;  3X23 A;  3JSV B;  4W9F A;  5DPW A;  3VTU A;  2KX0 A;  3ZVV A;  2KFK A;  2KLC A;  2A4Z A;  2KMC A;  2C9W B;  2KTR B;  3ZO5 B;  2KLG A;  2ZCC A;  3UQB A;  1M94 A;  4E3C A;  2NVU I;  4GDK B;  4DHJ B;  2LRU A;  4DK5 A;  4W9G A;  2GBR A;  5GMV A;  3KYC D;  3A9J B;  2N9E B;  4GU2 A;  2KX3 A;  4I6P A;  3KW5 B;  3TJP A;  2FCN A;  4N9F 4;  2HD5 B;  3R7Q A;  3U7D A;  2M1M A;  2D2Q A;  4WJN A;  3VQI A;  2JY6 A;  1YD8 U;  2M0X A;  2C7N B;  3A4S C;  1V2Y A;  4MDK E;  3PZD A;  4NJ6 A;  2JVC A;  3DBH I;  4LJO B;  5E6P A;  4BBN F;  5BO4 B;  2DAJ A;  1EF1 A;  5D94 A;  3APD A;  3WAO A;  1SE9 A;  1VD2 A;  2CHZ A;  3K9P B;  1V9J A;  1E8Y A;  3PVL A;  5CHV C;  3APF A;  1WI0 A;  2AWT A;  2IBI B;  2LZ6 A;  3X0W A;  2L00 B;  3ZTC A;  1ZGU B;  1OQY A;  2I1J A;  2KQ7 A;  4LDT D;  4TQ1 A;  3SU8 X;  3WAN A;  2R2Q A;  2AYO B;  2PJH A;  2R2O A;  3U8Z A;  2WX1 A;  4IG7 B; 
#chains in the Genus database with same CATH topology
 3P63 A;  2LXA A;  1YJ1 A;  2BPS A;  1TY2 A;  5TSS A;  4HCP B;  4WWM A;  3NVY A;  2JRH A;  4XC2 A;  1WYW B;  3WAP A;  2KK8 A;  3E56 A;  4IUM B;  1WJU A;  2ZPN A;  2EKI A;  3KUC B;  4S17 A;  4FA6 A;  2WXI A;  1F9J A;  2B3A A;  2W82 A;  1IGD A;  2KO3 A;  1T5X D;  4RNA A;  1BML C;  3QIJ A;  2LMC A;  1TGZ B;  5JZE B;  1SJH D;  3PRZ A;  1PGX A;  2D5G A;  2N9L A;  2QDF A;  3R3M A;  1WY8 A;  3ABV B;  4M01 A;  2ZW0 A;  1VR9 A;  1GG3 A;  2RR9 A;  4JL9 A;  1YQ4 B;  1V81 A;  2L83 A;  4JQW C;  4REZ A;  2LHE A;  1FO4 A;  2FNJ B;  2X38 A;  1ZOY B;  2KTF A;  1AYF A;  1E7V A;  1E8X A;  4GIV A;  3PSE B;  2FCS A;  3C19 A;  1UEL A;  5IA7 A;  1UF0 A;  1ZP0 B;  5E6J A;  1BUI C;  2CU3 A;  1Z5S B;  3Q8B A;  1QLB B;  4MSM B;  4AS1 A;  3KUD B;  2IGH A;  3C8Y A;  4ZRQ A;  1UNS A;  1ROE A;  2N1V A;  4BKG A;  2KMA A;  3TSS A;  2YEP B;  1ZDX A;  4WWO A;  5HFY A;  2PW9 A;  1DOI A;  2H89 B;  3AU5 A;  3U52 E;  4C7Z A;  4MJS A;  4F7Z A;  2ZZP B;  3GZN I;  2W54 A;  3NZU A;  2WDV B;  3VTW A;  4BKS A;  3AEC B;  5AZF A;  2W3R A;  5C2T B;  4K7S A;  1F77 A;  2KOX A;  2J53 A;  2LJ5 A;  4ANW A;  1RYJ A;  2LHD A;  3NS8 A;  2N7J A;  2KDE B;  1NI2 A;  4HVB A;  2WGS A;  1NI3 A;  2Y5P A;  4IWO A;  3B1L X;  4W9H A;  1LQB A;  2GBM A;  4D2K A;  3PV1 A;  1WYG A;  2Y5B B;  2BKR B;  3OG5 A;  4KDL B;  2KZR A;  3L08 A;  3VH3 B;  3M62 B;  1NEN B;  2D10 A;  4EZK A;  3CSF A;  1H4R A;  1ZW7 A;  2O6V D;  3NVV A;  4YL8 A;  1PGA A;  1OGW A;  2LD9 A;  1R4N B;  2D3B A;  2NR2 A;  4X57 B;  5J2R A;  1IBX A;  1YN4 A;  4XZ4 A;  2WYQ A;  3RYT A;  4DHZ E;  5LNK 1;  2JX5 A;  1WSP A;  3RUI B;  2DZJ A;  2JU6 X;  3E9S A;  1C4A A;  2CS4 A;  2ON8 A;  4KSK C;  1D5M C;  5E6O A;  3Q3O C;  2V1Y A;  4K3B A;  1KFY B;  1DGJ A;  4DWF A;  3EFU A;  3I3T B;  4EKU A;  5GXG B;  4P1C C;  4G11 A;  4LNO A;  2W9N A;  3RNC C;  1AAR A;  4G3X B;  2KWC A;  2XN9 C;  2IY1 B;  2KDI A;  3GB1 A;  3S2A A;  2BVC A;  2EKE C;  2V3P A;  2NS5 A;  2MX2 A;  4AQ7 A;  3OWE B;  2BBC A;  4KIK B;  2FID A;  1KLG D;  3MHS D;  2KD0 A;  4AOF A;  1JWA D;  2QMT A;  4E74 A;  2OOB B;  4FJY A;  4OZB A;  1J8C A;  1FEH A;  2RSU A;  4WH4 A;  4RGN A;  2XEW A;  3B0A A;  3PS6 A;  2JF5 A;  4MEL A;  1XEE A;  2PIA A;  3W1S C;  4GN1 A;  2NPT B;  2KJ6 A;  2N4F A;  1WRD B;  1I4G A;  4E71 A;  1K8R B;  3V61 A;  1D5X C;  2VZK D;  1P98 A;  2BF8 B;  1I35 A;  3MTN B;  2MP2 A;  1JRU A;  1E7U A;  5C23 A;  4RGO S;  3HRD D;  1IP9 A;  4NPN A;  2L7R A;  2MBB B;  2DEN B;  2LVQ A;  4YTP B;  1SSN A;  2RPQ A;  4UDU C;  2KQS A;  1L5P A;  1KLV A;  4P16 A;  3WA0 A;  1EO6 A;  1I4P A;  1SIF A;  2J42 A;  4AUQ C;  4NAW A;  2HE7 A;  3JSV A;  1E8W A;  1R7S A;  3PGE A;  3R66 C;  1WIA A;  3H7S A;  3DBL I;  4GDK A;  2KN5 A;  4MM3 B;  2HJ1 A;  2LGS A;  1YMH E;  4ZYS A;  3ZW3 A;  2AL3 A;  2KDM A;  3WIM A;  1CZP A;  3KLS X;  3B9J A;  3MJ5 A;  4IC7 B;  1MHH E;  2JYT A;  3GE3 C;  1SE3 A;  2JXT A;  1C1Y B;  4DHZ B;  1GB1 A;  4M8N A;  4ZYN A;  3AUL A;  1J7A A;  4W9K A;  2JYE A;  4C80 A;  4L23 A;  1QOG A;  3MC9 A;  4TV3 A;  4EE2 A;  3I57 A;  4NNJ B;  1YOV B;  4URK A;  2OJR A;  3CMM B;  3HK0 A;  2ZNV C;  1UD7 A;  2WU5 B;  4IWP A;  3AEE B;  1WXQ A;  4XDC A;  2IND C;  2JUO A;  1Q0W B;  2JPH A;  2KHW B;  1VZ6 A;  4C7Y A;  1SE4 A;  3ZLZ A;  2IZV B;  4IM0 A;  2WDT B;  5L95 C;  3P4Q B;  5DCN A;  1T0R C;  1YIW A;  3V6C B;  3VRB B;  2V4I B;  4IKG A;  5KHQ A;  1WX8 A;  4J3O D;  2O6V B;  3LYY A;  3VAW A;  1ZDV A;  2EMT A;  4NQK E;  4AJY B;  2CHW A;  1ACC A;  2L0F A;  1VJK A;  2O2V A;  1LM8 B;  2ZEQ A;  4L1B A;  4RCO A;  1TTN A;  3X23 A;  3AE6 B;  1QOF A;  5DPW A;  2PVG C;  3VTU A;  2KX0 A;  3ZVV A;  3KWL A;  2KMC A;  2KTR B;  2WXF A;  1M94 A;  4E3C A;  3AEA B;  2GLS A;  2RDB C;  3KYC D;  2WHI A;  3A9J B;  4GU2 A;  4NJC A;  4I6P A;  3DWM A;  3GP7 A;  3SR6 A;  2HD5 B;  2W3S A;  3R7Q A;  1FRD A;  2D2Q A;  2JY6 A;  2JWU A;  3RNF C;  3W5V B;  1VD2 A;  3SFD B;  3P4R B;  3PVL A;  1WI0 A;  2AWT A;  1FFU A;  3BYY B;  1FNU A;  3U8Z A;  3AI5 A;  2KMM A;  4PS8 A;  4JE3 B;  4WJO A;  1SE2 A;  3VDZ A;  3ZNI D;  4ZOH C;  2KNB A;  4MH8 A;  3QQ8 B;  2QHO A;  3MC0 B;  1WGD A;  3RNB C;  2D3G A;  3IAM 1;  3A9K B;  4JWS C;  4XYC A;  4K3C A;  2BYT A;  1C76 A;  3L0W B;  3QWZ B;  3EC8 A;  3LXF A;  3IFW B;  4BKS D;  2KXJ A;  1WZ3 A;  4GB9 A;  3W1S A;  2VZK B;  3W5U B;  3DVN V;  3ENE A;  2I1K A;  5FK9 C;  3AE3 B;  4PK1 A;  4WAF A;  2MA9 B;  3BII D;  4JX1 C;  2KC2 A;  1I4X A;  2N7D A;  4KZC A;  3DVG X;  1UZX B;  3PLV A;  3AMZ A;  2GRI A;  2LGI A;  4HPL B;  1V1P A;  4KV2 A;  3RPF C;  2MWS B;  1EM7 A;  4C4V A;  2LWP A;  4F1S A;  3RZF A;  4FUL A;  1VCB A;  3UGB B;  2J4X A;  1HZ5 A;  2C60 A;  2M8S A;  2MHJ A;  2N9X A;  4N58 A;  4KZ0 A;  2A5U A;  2KFK B;  3MP9 A;  1FXT B;  1YJI A;  3VH4 B;  2LJI A;  4W9C A;  1J7C A;  4WWN A;  1UBI A;  3ZXR A;  5EDS A;  2QSD A;  3DBR B;  3QX1 A;  3P1M A;  2PKO A;  3O13 A;  1TZ1 A;  1IYF A;  1I4H A;  3EGR A;  2B76 B;  3O65 B;  3SFE B;  1Y8R C;  4GMV A;  5CHF A;  4WJQ A;  2NBW B;  2K8B A;  2KWU B;  3HM6 X;  4EUT A;  5J18 A;  3PLU A;  1WRI A;  2LGX A;  5DPT A;  3N32 A;  3Q8A A;  1KLU D;  4LCD E;  4BOZ B;  1JWS D;  3WAL A;  5JHB A;  1M4V A;  3ZRF A;  2BWF A;  3EA6 A;  4JIO U;  5IKC M;  1GNU A;  1WFY A;  4A3P A;  1XCQ L;  2G1E A;  2LUM A;  5DPS A;  2V0G A;  5T8I A;  2ONQ A;  5IN7 A;  5FR6 A;  3GS2 A;  1UGJ A;  2CKH B;  4OVU A;  3L16 A;  3IT4 B;  3ZJV A;  1C78 A;  3AXC A;  4KKI A;  3PHW B;  2AEH A;  1FCC C;  1XO3 A;  5LXH A;  1K51 A;  4A9A A;  2MEK A;  3ZNG C;  3OAW A;  1JAL A;  1WZ0 A;  3IVF A;  4P7I A;  1C9F A;  1GJZ A;  1XLN A;  1TS3 A;  3P4P B;  1K53 A;  2Q5W D;  3MC8 A;  2Z0E B;  4ARI A;  3ZJU A;  1JWU D;  3U7Z A;  3AE5 B;  2X8X X;  4XGA B;  2BYF A;  2LI5 A;  4DHJ D;  1UH6 A;  2J52 A;  1F2R I;  2PLP A;  2DX5 B;  3ML9 A;  4GLS C;  2IO2 B;  4DDG D;  3UF8 A;  1JWM D;  2JT4 B;  2CR5 A;  3H1U A;  1I4Q A;  1NDD A;  3WCQ A;  1AN8 A;  4B9K A;  5D3I B;  4MJS B;  3H6N A;  4BOS C;  1SB3 C;  3QCA A;  3T8M A;  3NS1 A;  4PT5 A;  5C3J B;  4CYE A;  3TEW A;  1KOT A;  1LO5 D;  4H2A A;  1L2N A;  1JML A;  1H8C A;  1TBE A;  2G4S A;  2WDQ B;  2BB6 A;  2OJW A;  3DWG C;  4M8M A;  1N5W A;  3UQA A;  2PEA A;  2UWQ A;  3R2T A;  3AE7 B;  1A5R A;  2GOW A;  1N60 A;  2KDB A;  2Z0D B;  2ICI A;  3MHZ A;  4MSQ B;  3J9C A;  3OLM D;  1E6E B;  1AWD A;  1KTK A;  2CU1 A;  4HXD A;  4AWJ A;  4RGT A;  2KWV B;  4YTM B;  1TKG A;  3DVN U;  1FRR A;  3L54 A;  1WJ4 A;  4TSS A;  4ZRJ A;  1P1A A;  2W55 A;  5IOI A;  1MHX A;  4W9L A;  3DHI C;  3ZNH B;  3V62 A;  5LXI B;  2IYD B;  2N9P C;  4HJK A;  2K5P A;  2QIE B;  2L3Z A;  4GSW A;  3VUW A;  3N1X C;  4HPM B;  1RLF A;  2GBN A;  1E9M A;  1RM6 C;  1IBX B;  1QZE A;  1IPG A;  1NYR A;  1WX9 A;  4M0W A;  3VHT C;  1DOY A;  4LNN A;  1L0Y B;  1P7F A;  4DXF A;  2ACZ B;  4JWU C;  1F2R C;  1OEY A;  2M19 A;  3CWI A;  3CST A;  3BZD B;  4Q2J A;  3TMP B;  1RWS A;  2H88 B;  1F52 A;  3RI7 C;  3IBE A;  2C5L C;  2JWZ A;  2AL6 A;  3RT3 B;  2PMV A;  4NJ7 A;  3M63 B;  2WXH A;  2WXG A;  4ZRP A;  1UGM A;  3B08 A;  4KGT A;  2PVO D;  2FCQ A;  4US8 A;  1L7Y A;  2J7Q B;  1WGH A;  3ZIM A;  2KVZ A;  1ZE3 D;  3D32 A;  3BYT B;  4HEA 1;  1YJJ A;  2G45 B;  2L52 A;  4ZHO A;  4ACF A;  4W9D A;  1B9R A;  1SBB B;  4FHK A;  3W2D A;  2ZW1 A;  4ZRI A;  1VDV A;  1K50 A;  3AE2 B;  1J7B A;  4TKN A;  1QIL A;  4BBN C;  1E90 A;  5IP4 D;  3QK0 A;  4DBG A;  2BB5 A;  2J0M A;  2L0T A;  1QKZ A;  2QEJ C;  3L13 A;  3N20 C;  4PYU A;  3A4R A;  5CTR C;  1GOZ A;  1T0Q C;  1JW9 D;  2MP2 B;  1YNT E;  2QIL A;  1HTQ A;  3ZYY X;  2DWQ A;  1UWX A;  4GOC A;  3VRA B;  3UIP B;  1HZ6 A;  1OFF A;  3AE1 B;  2WQY B;  3VTV A;  3GOE A;  5C1Z A;  3ZTD A;  4ANV A;  3BVZ A;  3NHE B;  2N7E A;  4FXC A;  1JWB D;  1ZPS A;  4NAW B;  3JSV B;  2C9W B;  3N1Y C;  5BYR A;  4GDK B;  4DHJ B;  1N61 A;  4DK5 A;  2GBR A;  1D4B A;  2N9E B;  2KX3 A;  4LNF A;  1PUT A;  2R61 A;  1QOB A;  3U7D A;  2M1M A;  3URY A;  4MDK E;  1V2Y A;  2JVC A;  3DBH I;  4LJO B;  5E6P A;  2NMQ A;  1SE9 A;  3K9P B;  2WXP A;  3ZXV A;  3APF A;  2IBI B;  2LZ6 A;  2L00 B;  1OQY A;  2WXM A;  2OHF A;  4LDT D;  3SU8 X;  2R2Q A;  1Y56 A;  2AYO B;  3NUH B;  2R2O A;  1ET9 A;  3Q2A C;  4IG7 B;  4OVZ A;  4FJV B;  5D7G A;  3M3J A;  1WGY A;  4BAX A;  3AN1 A;  4FBJ B;  1PGB A;  1FMA D;  3PO0 A;  1F1H A;  5AEK B;  1ET6 A;  1IUE A;  1EWY C;  3TEZ A;  1R4M I;  2AQ3 B;  1P7E A;  5L83 A;  3W1Y A;  1ZKH A;  1S1Q B;  2KC1 A;  3KWV A;  3BY4 B;  1RFA A;  1ZUD 2;  2LVP A;  2BYV E;  2IO1 B;  2PTL A;  3JW0 X;  3ZNZ B;  2KDF B;  4OW0 A;  1DOX A;  5AZG A;  2REX A;  1E7P B;  1V1O A;  4O1N A;  4M02 A;  2J0K A;  2G4D B;  2O2V B;  3L4P A;  4HLE A;  2QCZ A;  3PTF C;  4NY0 A;  4MH0 E;  4W9I A;  2KWD A;  1C77 A;  4NZL B;  3RN9 C;  3LDZ E;  3PRP B;  3P4S B;  4HJG E;  1XT9 B;  2LXC A;  2FUH B;  4YXD B;  3CF6 E;  2KFJ A;  1Q1O A;  2KJH B;  1FD6 A;  2NCN A;  3L17 A;  4RM9 A;  4USA A;  5D3D A;  5HHD G;  3MJW A;  3R7R A;  1WMH A;  1C4P A;  4TMA B;  2MCN B;  2XK5 A;  4OVV A;  3GZN B;  3OJ4 B;  3TUO A;  4LTU A;  3BK2 A;  3Q3N C;  2MLB A;  5IO9 A;  5AZH A;  3SD5 A;  2N1W A;  1MG8 A;  1Z2M A;  1V97 A;  3GE8 C;  1P9D U;  1RFK A;  2FIF A;  1D5Z C;  1OQR A;  1FM0 D;  4DDI D;  2KJR A;  3WAM A;  3HVZ A;  2K0P A;  2KAC A;  4KSL C;  2DZK A;  1N62 A;  1OQQ A;  2OED A;  3ECI A;  3IXS A;  2RDG A;  1L0X B;  1E8Z A;  4K1R B;  2G3Q B;  3DHH C;  4HKQ A;  4MEM A;  4F8C B;  3RNA C;  3PHX B;  3IHP C;  3NZ3 A;  1XD3 B;  4EOY A;  1ZXH A;  2YEP F;  4EZJ A;  2MQJ A;  4M00 A;  4R3D A;  2D07 B;  4GGQ A;  3Q3J A;  5HI1 A;  1SGH A;  1V1P B;  1P0R A;  3V3X A;  3BWU D;  4MGZ E;  2WXN A;  2JRI B;  1HEZ E;  1WXA A;  1KJT A;  2CHX A;  2D3A A;  4C4V B;  2PE6 B;  3H9D A;  2EEL A;  3JVZ X;  2DZM A;  3T3N A;  3RMK C;  3H7P A;  4HDQ A;  2XNA C;  4YWG G;  2JXX A;  5JH5 C;  3AEG B;  1ESF A;  1VLB A;  4GDL A;  2XBB C;  2BYE A;  4ICV A;  2WLB A;  3FKY A;  2KQ4 X;  3DVG Y;  1V49 A;  5BYQ A;  4W9J A;  1WJ6 A;  5IAA C;  2C7H A;  3B2F A;  1BT0 A;  2FCM A;  4KGR A;  1R4N I;  4WQM A;  2M4N A;  5J17 A;  4PS3 A;  4WJP A;  1LFD A;  3U2S C;  1Q10 A;  2AQ1 B;  1B1Z A;  4WIP A;  1QOA A;  4LDT B;  3LJ3 A;  5H92 C;  1L0V B;  5AUI A;  2BWE S;  5EE9 A;  3NZS A;  1HTO A;  1SXT A;  1SEB D;  1L4D B;  3QAR A;  3Q3F A;  5KHO A;  4JGH B;  4CHK A;  1X1M A;  4LLG M;  2V3N A;  5BMH A;  3EEC A;  3A1Q A;  2ZJD A;  2ZNV B;  1TZO A;  2ZCB A;  4RM8 A;  2C7M B;  5G55 A;  4AP4 C;  1GC6 A;  3U30 A;  4FN2 A;  2UU7 A;  2EMS A;  2MBQ A;  2DLB A;  2YLM A;  4IW0 A;  4ICU A;  3PZ8 A;  2K8C A;  2WXO A;  3KVF B;  1TJE A;  1WGK A;  2DBY A;  4N6E B;  2IY0 B;  4RMA A;  4DXA B;  1RAX A;  1FXA A;  4CO7 A;  1EU3 A;  1AW7 A;  3Q8C A;  4YSY B;  1E5W A;  4LNK A;  1WR6 E;  2LGD A;  3DCG A;  2KAJ A;  1KM7 A;  3ZJT A;  4L2Y A;  4YSZ B;  2MRP A;  4EZL A;  2L05 A;  1LGR A;  1UWM A;  2K3U A;  2BKF A;  1WGR A;  3DBL B;  2NBU A;  1KRH A;  5MPO A;  2V4L A;  2NTS A;  1CJE A;  3NOB A;  2M17 A;  4BFR A;  3A33 B;  1HQR D;  5E6N A;  2DZI A;  2SAK A;  5EE0 A;  2IO3 B;  3IAS 1;  4B0M A;  4YTN B;  3TBL D;  4HK2 A;  1WM3 A;  3R2I A;  1I42 A;  5I4D A;  2CJO A;  3QAQ A;  1YQB A;  2J0J A;  1OEY J;  3RZW C;  1J19 A;  1GC7 A;  4EFO A;  1YN5 A;  1TT5 B;  1HE8 A;  3KUZ A;  4IWQ A;  1QT9 A;  5EE3 A;  3TIX A;  3AH7 A;  1TY0 A;  3AE8 B;  1WF9 A;  1UUP A;  3FIL A;  3AED B;  4XE0 A;  2K1F A;  5G2N A;  4MGY E;  3Q14 C;  1WJN A;  1L4Z B;  3TCA A;  2D11 A;  4FHJ A;  1FNV A;  1V6E A;  2INP E;  2VH1 A;  1XCT L;  3SDL C;  4ASW C;  1MFW A;  2M0A A;  3FC4 A;  1JQ4 A;  4IM2 A;  4MGI E;  1STE A;  4ANX A;  1V5T A;  4YSX B;  1ENF A;  3QA8 A;  3PT2 B;  2K8H A;  3Q69 A;  2KT7 A;  1U4A A;  3HUI A;  4KKJ A;  3AB5 A;  2NBV B;  5JHA A;  2IO0 B;  3EHV A;  3Q6B A;  2IDY A;  2I2Y A;  4P1B C;  4ZRK A;  4IM3 A;  1ZXI A;  4WWP A;  1E0Z A;  2K22 A;  2FBW B;  3RD2 A;  1TS5 A;  3VR8 B;  1XXG A;  2KVR A;  2RGF A;  2LUE A;  4M0W B;  1A70 A;  4W9F A;  3AE4 B;  3ZO5 B;  2NVU I;  1E10 A;  2LRU A;  3KW5 B;  2MJD A;  3TJP A;  2FCN A;  4DXG A;  4N9F 4;  4RF1 A;  4A90 A;  4WJN A;  3A4S C;  3PZD A;  4NJ6 A;  4BBN F;  2JSV X;  4RH6 A;  5G5G A;  3EFC A;  1E8Y A;  3ZGZ A;  5CHV C;  1K52 A;  1YN3 A;  2RMM A;  1XLO A;  3ZTC A;  1ZGU B;  1YQ3 B;  2I1J A;  4WUR A;  2KQ7 A;  2FUG 1;  4ARC A;  1FFV A;  3ETR A;  5TR5 A;  3NG0 A;  1V86 A;  5D6J B;  2FE8 A;  2WDR B;  2DYM A;  2QJL A;  4GXB A;  2GI9 A;  4OZA A;  5BMI A;  1T0S C;  2DYB A;  4K7W A;  2PPH A;  2D3C A;  5H8Y E;  4XX5 A;  2MW5 A;  2LFI A;  1YX5 B;  4LNI A;  4AJW A;  1FNW A;  4I6N B;  1KF6 B;  3ZDM C;  1FIQ A;  3BVM A;  1OTR B;  3ZKJ C;  2K39 A;  2RD0 A;  3V60 A;  3B2G A;  2GBK A;  2L76 A;  1D3Z A;  1TKE A;  4TUU A;  3DOW A;  3SEB A;  1VZ7 A;  2LGY A;  4MGK E;  3DPD A;  4C56 C;  2DNF A;  1FXI A;  2L32 A;  5DPR A;  2KAN A;  5AUK A;  3RNE C;  3I63 C;  2JZ3 B;  3ZDT A;  2Z8L A;  2GBJ A;  3AU4 A;  1XLQ A;  3UIN B;  1C3T A;  3L10 B;  2L1A A;  4BKT A;  3ZRC A;  2LAS A;  1GAQ B;  2AX5 A;  1FPY A;  2BGF A;  4JPS A;  4RFB A;  5BYS A;  1N63 A;  1PYW D;  4ZHP A;  2K9X A;  4LJP B;  5FR3 A;  4A6Q A;  3KH0 A;  3N3K B;  1D6E C;  2WS3 B;  3NRZ A;  1MPE A;  2KYW A;  4II2 B;  4HRS A;  1SIJ A;  1EU4 A;  1J0G A;  2Y3A A;  1V5O A;  3V05 A;  5LLI A;  3VUX A;  2VRR B;  1SJE D;  3ONS A;  3DBR I;  3VVW B;  4PYZ A;  1NVI D;  1EUV B;  2V3S A;  3N1Z C;  3M95 A;  3OJ3 A;  5CX3 A;  4PS7 A;  3HM3 A;  4KIK A;  2MBO A;  4A8X C;  1CMX B;  2IGD A;  3AEB B;  3JYU A;  2WWZ A;  2WXQ A;  4TQ0 A;  3KQ4 A;  1TYG B;  3N9Y C;  2K6Q A;  2YVC A;  4YT0 B;  3IG3 A;  3QHT A;  1L6U A;  4J6I A;  2IPK D;  3K9O B;  2MBE A;  3HHM A;  4B0E A;  4BVU C;  2NPT A;  2FAZ A;  3ZQ4 A;  3R8B A;  2WXK A;  1DYQ A;  3DBS A;  4HPP A;  1C79 A;  1C4C A;  3ALB A;  1MI0 A;  3BIN A;  2L8J A;  4LK0 M;  2IJ0 A;  3V6E B;  1I4R A;  1V80 A;  1WE7 A;  1N5X A;  3NVW A;  1BXT A;  1P3Q U;  1N6Z A;  3QC8 B;  3SHQ A;  3I5J C;  1WM2 A;  2MH7 A;  3UIO B;  3Q8F A;  1VRA B;  3LB8 C;  2DYO A;  3P42 A;  3VXW A;  2HTH A;  2TSS A;  4ZDV A;  4MM3 A;  2DAF A;  3VR9 B;  5EE1 A;  4FLH A;  2E3T A;  1WMH B;  2VH2 A;  3NVZ A;  4II3 B;  4XWW A;  3TEX A;  1WH3 A;  2XK5 B;  1SF0 A;  1WXM A;  2BQQ A;  3UI3 A;  1FCL A;  2KN4 A;  4P6V F;  1WXS A;  1EF5 A;  2BS2 B;  2INC C;  1NBF C;  2K25 A;  2DHZ A;  4MT5 A;  3ML8 A;  1S3S G;  2WXJ A;  3PZ7 A;  2JQR B;  1NYQ A;  3PPA A;  1PDX A;  3MFG A;  1RRB A;  2LRW A;  2RPV A;  5G5H A;  3P2B A;  1KH0 A;  2M56 B;  1WX7 A;  2QC8 A;  4W9E A;  5HG2 A;  4ANU A;  2K6D B;  1XLP A;  1GUA B;  3VUY A;  1LXD A;  4HRO A;  4B6W A;  2ZVN A;  1V8C A;  3APC A;  1JRP A;  4OHJ A;  4N59 A;  4BZA A;  4OZC A;  2AQ2 B;  1TKY A;  2ASQ A;  1T0Y A;  2E6X A;  1MJD A;  1QQR A;  4A20 A;  4ITK A;  2ZPY A;  4A3O A;  4HWI B;  3TL5 A;  1IGC A;  2O6V A;  2KKC A;  1EWC A;  4WQO B;  4MAC A;  4US9 A;  1QF6 A;  2MJ3 A;  2GMI C;  1PFD A;  4G0N B;  1XQQ A;  4DQO C;  2HTM E;  4KDI C;  5JXV A;  3H7P B;  4A55 A;  2MSE D;  4GDL B;  2HJ8 A;  2I38 A;  1VZ8 A;  3N30 A;  4IDI A;  2KTR A;  1MG4 A;  4I6L B;  3H8H A;  1UBQ A;  1GPX A;  1WE6 A;  4KVG B;  3T9L A;  4FAD A;  3A9J A;  2RDH A;  2N9K A;  2BT6 A;  4RF0 A;  2PE9 A;  1CQV A;  3DQV A;  1T6B X;  3AV8 A;  4HDO A;  2MJE A;  2WXL A;  3RCZ A;  4WAA A;  1JRO A;  1L6V A;  1WR1 A;  4XWT A;  4CQN A;  2JZP A;  3AE9 B;  1CK1 A;  3ZUN A;  3EUB 2;  3FAH A;  3BK1 A;  2BW2 A;  1WXV A;  3PRE A;  3HIZ A;  4B95 A;  2LVO A;  3I9V 1;  5CHW A;  3U4E G;  1G6J A;  2N0S B;  3VFK A;  4IOI E;  1ISN A;  1MVK A;  3T3O A;  1HXY D;  2BS4 B;  1XF5 L;  4KX6 B;  3A1Q B;  2LEK A;  2MBH A;  4K7U A;  4NQL B;  2ZVO A;  4K81 A;  3KYD D;  1TS4 A;  4C00 A;  4HKZ E;  3A9K A;  3DDC B;  3NY5 A;  3RNG C;  4EEW A;  2GB1 A;  2WU2 B;  5HKH A;  2UYZ B;  1TIF A;  2BS3 B;  1GB4 A;  4NAM A;  2HDE A;  1Q5W B;  2WX0 A;  1T3Q A;  3Q8E A;  2Z59 B;  4JLC A;  3Q3M C;  1NEK B;  1WGG A;  2WXR A;  5FKA C;  5D2M B;  3W9C B;  1WWT A;  4G50 A;  2Y5C A;  1YX6 B;  3QJZ A;  4XDD A;  2JZZ A;  2V9H A;  3PRM B;  3BVG A;  1PQS A;  5BMG A;  4FJZ A;  3C0R B;  1I7H A;  3RUL A;  3HVD A;  4RGM A;  2INN E;  4HCN B;  4S0R A;  1JCK B;  2WNM A;  3DBH B;  3RFZ B;  2KFK A;  2KLC A;  2A4Z A;  3TEY A;  2G9H D;  2KLG A;  2ZCC A;  3UQB A;  2IGG A;  2BTE A;  1HA5 A;  4W9G A;  5GMV A;  3DHG C;  2NTT A;  2CJN A;  3AM9 A;  3VQI A;  1YD8 U;  2M0X A;  2C7N B;  3CIR B;  4QAY A;  5BO4 B;  2DAJ A;  1EF1 A;  5D94 A;  3APD A;  2SEB D;  3WAO A;  2CHZ A;  3AEF B;  1V9J A;  3FIL B;  1F0Z A;  3NJT A;  3X0W A;  3IT6 B;  1TS2 A;  4TQ1 A;  3WAN A;  4KGS A;  2PJH A;  1R4M B;  2WX1 A;  2WP9 B; 
#chains in the Genus database with same CATH homology
 2LXA A;  4FJV B;  4WJO A;  1YJ1 A;  5D7G A;  2BPS A;  5TR5 A;  3M3J A;  3VDZ A;  3ZNI D;  1WGY A;  2KNB A;  4HCP B;  2JRH A;  4XC2 A;  1WYW B;  3WAP A;  4FBJ B;  2KK8 A;  1V86 A;  3QQ8 B;  5D6J B;  2QHO A;  5AEK B;  1WGD A;  2DYM A;  2D3G A;  3A9K B;  4IUM B;  1WJU A;  2ZPN A;  3KUC B;  3L0W B;  3QWZ B;  3EC8 A;  4GXB A;  3IFW B;  4FA6 A;  1F9J A;  1R4M I;  2B3A A;  2DYB A;  4BKS D;  2KXJ A;  1WZ3 A;  4GB9 A;  4K7W A;  3W1S A;  5L83 A;  3DVN V;  3ENE A;  2PPH A;  2I1K A;  3W1Y A;  2KO3 A;  1ZKH A;  1S1Q B;  4XX5 A;  2MW5 A;  2KC1 A;  1YX5 B;  3BY4 B;  1RFA A;  3QIJ A;  2LVP A;  2BYV E;  1TGZ B;  2IO1 B;  4AJW A;  2MA9 B;  5JZE B;  4I6N B;  2KC2 A;  2N7D A;  4KZC A;  3ZDM C;  3JW0 X;  3DVG X;  1UZX B;  3PLV A;  3PRZ A;  1OTR B;  3ZKJ C;  2K39 A;  3ZNZ B;  2RD0 A;  2KDF B;  4HPL B;  3V60 A;  2GBK A;  5AZG A;  2L76 A;  1D3Z A;  4TUU A;  4KV2 A;  3DOW A;  2REX A;  2LGY A;  3R3M A;  1WY8 A;  2MWS B;  4MGK E;  2J0K A;  3DPD A;  2G4D B;  2O2V B;  4HLE A;  1GG3 A;  2LWP A;  5DPR A;  2KAN A;  2RR9 A;  3PTF C;  4MH0 E;  4NY0 A;  4W9I A;  3RZF A;  4F1S A;  4JL9 A;  2JZ3 B;  4FUL A;  3ZDT A;  1VCB A;  3UGB B;  2GBJ A;  1V81 A;  3AU4 A;  4JQW C;  2C60 A;  2M8S A;  3UIN B;  2N9X A;  3LDZ E;  1C3T A;  3PRP B;  4KZ0 A;  2A5U A;  2KFK B;  3L10 B;  2FNJ B;  4BKT A;  1FXT B;  1XT9 B;  2KTF A;  3ZRC A;  3VH4 B;  2LXC A;  2LAS A;  2FUH B;  1E7V A;  1E8X A;  3CF6 E;  2BGF A;  4GIV A;  4W9C A;  2KFJ A;  1Q1O A;  2KJH B;  3PSE B;  4WWN A;  2FCS A;  1UBI A;  4LJP B;  2NCN A;  5EDS A;  3L17 A;  1UEL A;  4RM9 A;  5IA7 A;  3KH0 A;  3MJW A;  3R7R A;  3N3K B;  1WMH A;  3QX1 A;  1Z5S B;  4MSM B;  2MCN B;  2XK5 A;  4II2 B;  4OVV A;  1TZ1 A;  1IYF A;  3KUD B;  3OJ4 B;  2N1V A;  2MLB A;  4BKG A;  1J0G A;  2KMA A;  5AZH A;  1V5O A;  3SD5 A;  4WWO A;  2N1W A;  5LLI A;  1MG8 A;  1Z2M A;  2VRR B;  3VUX A;  3ONS A;  1P9D U;  3AU5 A;  3DBR I;  3O65 B;  3VVW B;  4PYZ A;  1EUV B;  2V3S A;  1Y8R C;  2FIF A;  4GMV A;  4MJS A;  3M95 A;  5CHF A;  4F7Z A;  1KOT A;  3OJ3 A;  2ZZP B;  4WJQ A;  5CX3 A;  4PS7 A;  2NBW B;  3GZN I;  2K8B A;  2KWU B;  3HM6 X;  4DDI D;  4EUT A;  3NZU A;  2KJR A;  3WAM A;  5J18 A;  3HM3 A;  3PLU A;  4KIK A;  4KSL C;  2MBO A;  2DZK A;  1CMX B;  3VTW A;  4BKS A;  2LGX A;  3ECI A;  3JYU A;  5AZF A;  5DPT A;  4K1R B;  1E8Z A;  2WWZ A;  3N32 A;  2G3Q B;  4TQ0 A;  4MEM A;  4F8C B;  4LCD E;  3PHX B;  4K7S A;  4BOZ B;  3WAL A;  2KOX A;  3IHP C;  5JHB A;  1XD3 B;  4EOY A;  2LJ5 A;  4ANW A;  2K6Q A;  2BWF A;  2YVC A;  3ZRF A;  4JIO U;  3IG3 A;  3QHT A;  4J6I A;  1GNU A;  3K9O B;  2MBE A;  1WFY A;  3HHM A;  3NS8 A;  4A3P A;  4BVU C;  4EZJ A;  2NPT A;  2MQJ A;  2KDE B;  2FAZ A;  1NI2 A;  4HVB A;  2D07 B;  4GGQ A;  5DPS A;  4IWO A;  3Q3J A;  3DBS A;  3B1L X;  1SGH A;  5FR6 A;  2CKH B;  3ALB A;  4W9H A;  1LQB A;  2GBM A;  4OVU A;  3L16 A;  3BIN A;  1P0R A;  2L8J A;  3PV1 A;  2Y5B B;  2BKR B;  4MGZ E;  2JRI B;  4KDL B;  1WXA A;  2KZR A;  1KJT A;  3L08 A;  2CHX A;  3AXC A;  3VH3 B;  3M62 B;  2PE6 B;  3V6E B;  3PHW B;  2AEH A;  1V80 A;  1WE7 A;  2D10 A;  4EZK A;  3CSF A;  1H4R A;  1ZW7 A;  2O6V D;  3H9D A;  3JVZ X;  4YL8 A;  5LXH A;  2DZM A;  3H7P A;  1P3Q U;  3ZNG C;  1OGW A;  2LD9 A;  3OAW A;  4HDQ A;  3QC8 B;  1WZ0 A;  3SHQ A;  3IVF A;  4P7I A;  2NR2 A;  4X57 B;  5J2R A;  2JXX A;  5JH5 C;  1GJZ A;  1WM2 A;  4XZ4 A;  4PS8 A;  3UIO B;  2WYQ A;  4GDL A;  2XBB C;  2BYE A;  3RYT A;  4DHZ E;  2DYO A;  4ICV A;  3VXW A;  2HTH A;  3RUI B;  4ZDV A;  2DZJ A;  4MM3 A;  2Z0E B;  2CS4 A;  4KSK C;  2DAF A;  1V49 A;  3DVG Y;  4W9J A;  1WJ6 A;  5E6O A;  5IAA C;  2C7H A;  4FLH A;  1BT0 A;  2BYF A;  2FCM A;  2V1Y A;  1WMH B;  1R4N I;  2M4N A;  5J17 A;  2LI5 A;  4PS3 A;  4DHJ D;  4WJP A;  4II3 B;  1UH6 A;  1WH3 A;  2XK5 B;  1WXM A;  1LFD A;  2DX5 B;  3ML9 A;  4LDT B;  3LJ3 A;  4DWF A;  3EFU A;  2BWE S;  2IO2 B;  4DDG D;  1WXS A;  3I3T B;  3NZS A;  4EKU A;  1EF5 A;  1NBF C;  2K25 A;  2DHZ A;  3ML8 A;  3UF8 A;  4G11 A;  2JT4 B;  2CR5 A;  3H1U A;  1NDD A;  2W9N A;  1S3S G;  3QAR A;  3Q3F A;  5KHO A;  1AAR A;  4JGH B;  4CHK A;  4G3X B;  1X1M A;  4B9K A;  3PPA A;  2KWC A;  2IY1 B;  3H6N A;  4MJS B;  4BOS C;  1RRB A;  2LRW A;  2KDI A;  3S2A A;  2EKE C;  3EEC A;  3QCA A;  3T8M A;  2NS5 A;  2MX2 A;  3A1Q A;  3P2B A;  4KIK B;  1WX7 A;  4CYE A;  2FID A;  2ZJD A;  2ZNV B;  4W9E A;  2KD0 A;  3MHS D;  2K6D B;  2ZCB A;  2C7M B;  4RM8 A;  5G55 A;  1GC6 A;  4AP4 C;  1GUA B;  4AOF A;  3U30 A;  3VUY A;  4E74 A;  2OOB B;  4FN2 A;  1LXD A;  1L2N A;  1H8C A;  2EMS A;  4FJY A;  2MBQ A;  1J8C A;  4B6W A;  2ZVN A;  2RSU A;  1TBE A;  2YLM A;  4IW0 A;  2G4S A;  3APC A;  2K8C A;  4ICU A;  3KVF B;  4M8M A;  2XEW A;  3B0A A;  3PS6 A;  3UQA A;  2IY0 B;  2PEA A;  2UWQ A;  2JF5 A;  4RMA A;  4MEL A;  4DXA B;  4ANU A;  1RAX A;  2GOW A;  1A5R A;  4CO7 A;  3W1S C;  2KDB A;  4GN1 A;  2NPT B;  2KJ6 A;  2ASQ A;  2Z0D B;  1T0Y A;  4MSQ B;  2N4F A;  1E5W A;  3OLM D;  1WRD B;  4A20 A;  1WR6 E;  2CU1 A;  4AWJ A;  4HXD A;  2LGD A;  3DCG A;  4E71 A;  2ZPY A;  1K8R B;  3V61 A;  1KM7 A;  4A3O A;  4HWI B;  2KWV B;  3TL5 A;  1P98 A;  2BF8 B;  1I35 A;  3DVN U;  3MTN B;  3L54 A;  1WJ4 A;  2MP2 A;  4ZRJ A;  2MRP A;  2O6V A;  1JRU A;  2KKC A;  1E7U A;  2L05 A;  4EZL A;  1P1A A;  5C23 A;  4WQO B;  2BKF A;  1IP9 A;  1WGR A;  4W9L A;  4NPN A;  2NBU A;  3ZNH B;  2L7R A;  2V4L A;  2MBB B;  2DEN B;  2GMI C;  3V62 A;  4G0N B;  1XQQ A;  2LVQ A;  2IYD B;  2N9P C;  3NOB A;  4HJK A;  5LXI B;  2RPQ A;  2KQS A;  4KDI C;  2M17 A;  2L3Z A;  4GSW A;  3VUW A;  3H7P B;  4HPM B;  1RLF A;  1KLV A;  2GBN A;  1EO6 A;  3WA0 A;  4BFR A;  3AI5 A;  1SIF A;  2MSE D;  3A33 B;  4AUQ C;  1QZE A;  1IPG A;  4NAW A;  5E6N A;  1WX9 A;  2HE7 A;  2DZI A;  1E8W A;  3JSV A;  3PGE A;  2HJ8 A;  4GDL B;  3VHT C;  2IO3 B;  3N30 A;  3R66 C;  1WIA A;  2KTR A;  1OEY A;  3H7S A;  3CST A;  3DBL I;  4GDK A;  3TBL D;  2KN5 A;  4HK2 A;  4I6L B;  3TMP B;  1WM3 A;  1UBQ A;  1I42 A;  1WE6 A;  4KVG B;  3T9L A;  3QAQ A;  4FAD A;  1YQB A;  3A9J A;  2J0J A;  3ZW3 A;  2AL3 A;  3IBE A;  2C5L C;  2JWZ A;  2AL6 A;  1OEY J;  3WIM A;  3RT3 B;  2PE9 A;  3DQV A;  3RZW C;  4HDO A;  1J19 A;  1GC7 A;  3RCZ A;  4IC7 B;  1WR1 A;  4NJ7 A;  4WAA A;  3M63 B;  4EFO A;  1HE8 A;  3ZUN A;  3KUZ A;  4IWQ A;  1WXV A;  3PRE A;  1UGM A;  3HIZ A;  3B08 A;  4B95 A;  3TIX A;  2LVO A;  1C1Y B;  1WF9 A;  5CHW A;  4DHZ B;  1G6J A;  3VFK A;  2FCQ A;  4M8N A;  2K1F A;  1ISN A;  1L7Y A;  5G2N A;  4MGY E;  2J7Q B;  4ZYN A;  1WGH A;  3ZIM A;  1WJN A;  3AUL A;  3TCA A;  2D11 A;  4W9K A;  4FHJ A;  3D32 A;  4TV3 A;  1V6E A;  3A1Q B;  2G45 B;  2MBH A;  4K7U A;  4NQL B;  4NNJ B;  3SDL C;  4ASW C;  4URK A;  2ZVO A;  4K81 A;  2OJR A;  4W9D A;  3CMM B;  3HK0 A;  2ZNV C;  3KYD D;  4FHK A;  1UD7 A;  4IM2 A;  4MGI E;  4IWP A;  3A9K A;  4ANX A;  4ZRI A;  2JUO A;  3DDC B;  1V5T A;  1Q0W B;  2JPH A;  3NY5 A;  2KHW B;  4TKN A;  3ZLZ A;  2IZV B;  4IM0 A;  4EEW A;  5HKH A;  3QA8 A;  3PT2 B;  2WDT B;  4BBN C;  2UYZ B;  5L95 C;  2K8H A;  1E90 A;  5DCN A;  1U4A A;  1YIW A;  3QK0 A;  3V6C B;  4DBG A;  2WX0 A;  1Q5W B;  2J0M A;  5KHQ A;  1WX8 A;  2L0T A;  5CTR C;  3L13 A;  4PYU A;  2NBV B;  3A4R A;  5JHA A;  2Z59 B;  2IO0 B;  2MP2 B;  4JLC A;  2O6V B;  3EHV A;  1WGG A;  5D2M B;  3VAW A;  2EMT A;  4NQK E;  4GOC A;  4AJY B;  4ZRK A;  2CHW A;  3UIP B;  4G50 A;  4IM3 A;  1YX6 B;  3QJZ A;  4WWP A;  2JZZ A;  2L0F A;  3VTV A;  3GOE A;  3PRM B;  5C1Z A;  2O2V A;  1LM8 B;  2ZEQ A;  3ZTD A;  4ANV A;  1PQS A;  3RD2 A;  4FJZ A;  3NHE B;  2N7E A;  3C0R B;  3RUL A;  1TTN A;  2KVR A;  4HCN B;  4NAW B;  2RGF A;  2LUE A;  4M0W B;  3X23 A;  3JSV B;  4W9F A;  5DPW A;  3VTU A;  2KX0 A;  3ZVV A;  2KFK A;  2KLC A;  2A4Z A;  2KMC A;  2C9W B;  2KTR B;  3ZO5 B;  2KLG A;  2ZCC A;  3UQB A;  1M94 A;  4E3C A;  2NVU I;  4GDK B;  4DHJ B;  2LRU A;  4DK5 A;  4W9G A;  2GBR A;  5GMV A;  3KYC D;  3A9J B;  2N9E B;  4GU2 A;  2KX3 A;  4I6P A;  3KW5 B;  3TJP A;  2FCN A;  4N9F 4;  2HD5 B;  3R7Q A;  3U7D A;  2M1M A;  2D2Q A;  4WJN A;  3VQI A;  2JY6 A;  1YD8 U;  2M0X A;  2C7N B;  3A4S C;  1V2Y A;  4MDK E;  3PZD A;  4NJ6 A;  2JVC A;  3DBH I;  4LJO B;  5E6P A;  4BBN F;  5BO4 B;  2DAJ A;  1EF1 A;  5D94 A;  3APD A;  3WAO A;  1SE9 A;  1VD2 A;  2CHZ A;  3K9P B;  1V9J A;  1E8Y A;  3PVL A;  5CHV C;  3APF A;  1WI0 A;  2AWT A;  2IBI B;  2LZ6 A;  3X0W A;  2L00 B;  3ZTC A;  1ZGU B;  1OQY A;  2I1J A;  2KQ7 A;  4LDT D;  4TQ1 A;  3SU8 X;  3WAN A;  2R2Q A;  2AYO B;  2PJH A;  2R2O A;  3U8Z A;  2WX1 A;  4IG7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...