3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
4II2B 2IO2B 3VH3B 3BINA 1WX9A 1Y8RC 3QC8B 3VTWA 2BKRB 4WWOA 1WH3A 2KTRA 2MX2A 1UBQA 4ICUA 4KZ0A 5J17A 3MHSD 3EC8A 4MDKE 3ZDMC 1J0GA 2O6VD 2DZKA 3VAWA 1WFYA 4MGIE 4DDID 1R4MI 4CYEA 3GOEA 5TR5A 2DZMA 3MTNB 4MSMB 1LQBA 4YL8A 5AZFA 4BOSC 4GMVA 5HKHA 5DPRA 1ZW7A 2KQ7A 2MA9B 1ZGUB 2KLCA 4ICVA 3PRPB 4RM9A 5D6JB 1E7VA 2DZIA 4ANVA 2JZ3B 3HM3A 3VDZA 1WY8A 4DBGA 4EZKA 4BOZB 2KFKB 5D7GA 2MBBB 3DVNU 3QA8A 4GSWA 1M94A 2KWVB 1GC7A 2K6QA 4KVGB 3HM6X 2KDBA 2G4SA 2KJHB 3A9JA 3PT2B 2LGXA 3QX1A 3TCAA 1S1QB 1YX6B 5LLIA 1P98A 3R3MA 4WJOA 4IUMB 1HE8A 1EF1A 3OLMD 3UINB 1YQBA 3AI5A 2Z59B 2JWZA 1WMHB 2NPTA 1YD8U 5DPTA 3RT3B 3QHTA 2N1WA 4ANWA 3PRMB 2NBVB 3SHQA 3V60A 1E8XA 1WR6E 3V6CB 2M1MA 2KDFB 2LXAA 2R2OA 3AXCA 3CMMB 4BFRA 2NCNA 2WDTB 2BYVE 2RPQA 3KVFB 3WAOA 2L8JA 4EEWA 4W9IA 4NNJB 4OVUA 3H7PB 1V81A 1WJ6A 3QAQA 2FUHB 4FHJA 2HJ8A 1YIWA 2UWQA 2LI5A 2D07B 3APCA 4MJSA 3VXWA 4J6IA 2RR9A 4FN2A 2KMCA 3ZNHB 1K8RB 1WXAA 2MW5A 4LJPB 5DPWA 2DX5B 3ALBA 3APDA 2MP2B 3VTVA 4JL9A 2ZJDA 2Z0DB 2FCQA 2KWCA 4IC7B 4FULA 3W1YA 3ZLZA 1L7YA 2PPHA 4HVBA 4DHJD 5C1ZA 2KQSA 4HCPB 5D94A 3TBLD 1UD7A 4W9EA 3L08A 2C9WB 4NY0A 1UGMA 4AUQC 2R2QA 1E5WA 2GOWA 2J0JA 2MBHA 4GIVA 2LVOA 2CU1A 3PPAA 2XEWA 2LGDA 1WGHA 4LDTD 3EECA 1WJUA 2LGYA 2NBUA 3UGBB 3C0RB 1NDDA 1RAXA 3PZDA 3U7DA 2KHWB 1EF5A 2JZZA 3ZDTA 4W9LA 1R4NI 2KDEB 3PGEA 2KXJA 2G3QB 2N7DA 3A9KA 4HWIB 4WQOB 1TTNA 4TKNA 2PE6B 1WMHA 2N7EA 2L7RA 1WM3A 3V6EB 4N9F4 2K6DB 3N32A 3WANA 4E71A 4BKTA 2FCSA 4HDOA 4RM8A 4DDGD 4M8MA 4MSQB 4TUUA 4ZRIA 2FCMA 3ZVVA 3ZNGC 2K39A 3NHEB 3ZRCA 1LFDA 1J19A 2G4DB 3ZNID 4HK2A 2M4NA 3HHMA 5J18A 3PHXB 4GDKA 4HCNB 4P7IA 4KIKB 2Z0EB 5E6PA 3HK0A 3RYTA 3UQBA 2BWFA 2FAZA 4W9DA 1TBEA 2KC1A 4MJSB 4HDQA 4AP4C 1TZ1A 4IWPA 2XK5B 1E8YA 2I1JA 2N4FA 2ZZPB 3H9DA 3DOWA 2OOBB 1JRUA 1YX5B 2LXCA 3ECIA 3CSTA 4NAWB 3TIXA 1H4RA 2L3ZA 3M95A 4ZDVA 4MEMA 3WALA 4B6WA 2LVQA 2GMIC 3W1SA 2LD9A 3L54A 2IO0B 2GBKA 1WXSA 1KOTA 2JPHA 3RULA 5AEKB 4AJWA 1V49A 3AULA 4BVUC 3U30A 4A3PA 3BY4B 2RSUA 3A4SC 2LVPA 2REXA 2D2QA 3PVLA 3Q3FA 1WIAA 3IFWB 2OJRA 2HD5B 4W9JA 2ZVNA 3LJ3A 3DBHI 3ZTCA 4CO7A 3ML9A 1P3QU 4IM2A 4A3OA 4LJOB 1U4AA 4A20A 5BO4B 4WAAA 2L05A 3ZO5B 1FXTB 2KKCA 4K81A 3VHTC 2WX0A 2K8HA 3IG3A 1L2NA 3ZUNA 1P1AA 1VD2A 4IWQA 2V3SA 1SGHA 2GBJA 1PQSA 4FJZA 3VVWB 2A5UA 5LXIB 3R7QA 4KSLC 1VCBA 3A1QB 4WWPA 4E74A 1WE6A 5IA7A 3GZNI 2AL6A 1CMXB 2JRHA 2KLGA 1WE7A 4G11A 2CR5A 2NS5A 2M0XA 2NBWB 2D3GA 2O2VA 2EMTA 2NR2A 1NI2A 4BKGA 1SE9A 1OQYA 3I3TB 3JSVA 2KJRA 4TV3A 4MM3A 4KIKA 1V6EA 2MQJA 3R66C 2D11A 2KN5A 2AYOB 4DHJB 2JT4B 3M63B 1V86A 5L95C 3L17A 4DHZE 1C1YB 1E8ZA 2JY6A 2K8CA 2DENB 1ISNA 3V61A 3RCZA 1WJ4A 5CTRC 4GDLA 4EFOA 3X23A 4E3CA 1WGRA 3PRZA 4KDIC 2LZ6A 2JVCA 1T0YA 2CHWA 3K9PB 3OJ3A 4IW0A 3WA0A 1WI0A 5JHBA 4BBNF 5AZHA 4NQKE 5IAAC 3DCGA 4PS8A 3QWZB 2FIDA 4G0NB 4GDKB 3N3KB 1Q1OA 2PJHA 4NJ7A 1WX8A 3IVFA 4PS7A 1WZ0A 4F7ZA 2MP2A 3JVZX 1OEYJ 2ZCCA 4EUTA 2IZVB 2EKEC 1G6JA 2K1FA 4ZRJA 5G2NA 4TQ0A 1XT9B 2K25A 2JRIB 3ZKJC 3NZUA 1WF9A 4I6NB 4B95A 4HLEA 4LDTB 3SU8X 1RLFA 2M8SA 1WXVA 2N1VA 1WR1A 3H7SA 1RFAA 4HJKA 3AU5A 2BYFA 3UQAA 1V2YA 5AZGA 4GXBA 3CF6E 3L16A 4M8NA 4RMAA 4KDLB 2JXXA 2KX0A 3VUWA 4DWFA 3Q3JA 4NPNA 2DHZA 1GJZA 5EDSA 4HPMB 4XC2A 2D10A 5CHWA 3UIPB 4F8CB 4AWJA 3QARA 3OAWA 4IWOA 2L0FA 2IYDB 3PV1A 4I6PA 4W9GA 3UF8A 5CHVC 1S3SG 1P0RA 3RUIB 2MSED 1OGWA 1I42A 2N9EB 3QCAA 3DVGX 2KC2A 2DYBA 3TJPA 3L10B 3ZIMA 2KFKA 2GBRA 3KW5B 2ZNVC 3TMPB 2FCNA 3QIJA 4ANUA 2KWUB 2C7MB 1E8WA 1OTRB 3H1UA 5CHFA 1WYWB 5DCNA 3X0WA 2ZCBA 1BT0A 2CHXA 1EUVB 3T9LA 1LXDA 5J2RA 2KTFA 3S2AA 2RD0A 4EKUA 3N30A 2KFJA 1C3TA 2AWTA 2IY0B 1XQQA 3VFKA 2IO3B 2MBQA 4II3B 2J0KA 4WWNA 5DPSA 2XK5A 5JH5C 1Q0WB 2KZRA 3H6NA 3NOBA 3IBEA 3L13A 2KK8A 4FJYA 3DBSA 4JGHB 4JQWC 3DBLI 4HPLB 1WGDA 2IO1B 2N9XA 4IM0A 1V5TA 3ENEA 2KVRA 3H7PA 2KX3A 2J7QB 2A4ZA 3JSVB 5FR6A 4DK5A 5L83A 2MCNB 2L00B 3DQVA 3EFUA 2BGFA 4F1SA 2O6VA 4EZJA 3QJZA 2L76A 3QQ8B 4FHKA 2KDIA 1ZKHA 2Y5BB 4AJYB 3L0WB 3DVGY 3PS6A 1I35A 2ZPYA 5C23A 2ZVOA 2DZJA 2WWZA 4GDLB 2LJ5A 3ML8A 2CKHB 4KSKC 2K8BA 2AEHA 4IG7B 4AOFA 1IYFA 1V5OA 3APFA 4GGQA 4DXAB 3ZNZB 3ZTDA 2V1YA 1WRDB 4MGKE 2N9PC 2O6VB 1WGYA 3MJWA 4BKSD 1WGGA 4KZCA 1LM8B 1J8CA 1YJ1A 3A9JB 5CX3A 4MELA 3PLVA 4ZYNA 2XBBC 4K1RB 5JZEB 3R7RA 4MGYE 4MGZE 3UIOB 4CHKA 2JF5A 3KYDD 2BWES 4BKSA 4FA6A 4URKA 4GU2A 2DYOA 3KUDB 4ANXA 4W9HA 3B08A 3HIZA 3M3JA 3IHPC 5G55A 3SDLC 1GUAB 3WIMA 4FBJB 1GC6A 2LASA 2LRUA 2LWPA 4WJPA 4LCDE 2CHZA 3DBRI 4K7SA 2DYMA 4PYUA 3V62A 3WAPA 3ZRFA 3OJ4B 3NZSA 4PYZA 2YLMA 5D2MB 3VUYA 1XD3B 3ZW3A 2ZNVB 2FIFA 2BF8B 2PE9A 2GBNA 4W9FA 4DHZB 1IP9A 1V80A 3PSEB 4X57B 2M17A 1SIFA 3VTUA 2GBMA 3KUZA 4EOYA 1Q5WB 3PREA 1UELA 2KANA 4FADA 2KNBA 3B0AA 4OVVA 2KJ6A 3ONSA 2PEAA 1EO6A 2QHOA 1H8CA 4WJQA 3P2BA 3SD5A 2MBOA 1WM2A 4JLCA 2C60A 2DAJA 4PS3A 4G50A 1WZ3A 1V9JA 4NQLB 2BYEA 1AARA 1IPGA 4FLHA 1TGZB 1E90A 5KHQA 3RZFA 2MBEA 2KTRB 3M62B 3DPDA 1WX7A 4JIOU 3NY5A 2IBIB 4W9CA 2AL3A 2KO3A 2ZEQA 1MG8A 2ZPNA 4TQ1A 2W9NA 4ASWC 2UYZB 3NS8A 4GB9A 4BBNC 4XX5A 2HE7A 3CSFA 3T8MA 1Z2MA 3K9OB 4GN1A 4M0WB 1KJTA 1Z5SB 4G3XB 1E7UA 2RGFA 3PTFC 2BKFA 3KUCB 3A33B 3VH4B 1P9DU 2FNJB 5LXHA 2DAFA 2CS4A 2B3AA 2LUEA 1QZEA 2KMAA 2MWSB 1KLVA 3KH0A 3VUXA 2C7HA 3O65B 4EZLA 2EMSA 3U8ZA 1RRBA 1WJNA 3RZWC 2V4LA 2G45B 3JW0X 4HXDA 3RD2A 2KD0A 2L0TA 2MLBA 3AU4A 3KYCD 1UZXB 5KHOA 2HTHA 2NPTB 2KOXA 4IM3A 3DVNV 3WAMA 3DDCB 3JYUA 3QK0A 4ZRKA 1WXMA 2C7NB 4I6LB 5GMVA 2YVCA 2I1KA 5JHAA 1UBIA 4W9KA 2JUOA 4NAWA 1A5RA 1OEYA 3W1SC 4MH0E 1F9JA 2IY1B 3A9KB 2NVUI 1X1MA 4NJ6A 3B1LX 3TL5A 2O2VB 3A1QA 2WYQA 3VQIA 1KM7A 1NBFC 4K7WA 4XZ4A 4GOCA 2MRPA 4B9KA 1GG3A 2ASQA 2LRWA 4FJVB 4K7UA 4KV2A 3PLUA 2BPSA 3EHVA 3LDZE 4WJNA 2C5LC 1D3ZA 2WX1A 5E6NA 5E6OA 2VRRB 3PHWB 3D32A 3A4RA 2J0MA 1UH6A 1GNUA
chains in the Genus database with same CATH superfamily
4II2B 3P4SB 2IO2B 3VH3B 1N6ZA 4J3OD 1WH3A 2DZKA 1WFYA 1T0SC 4DDID 4MH8A 1FFVA 2PW9A 3U4EG 4ICVA 2DZIA 4US9A 3HM3A 3VDZA 4BOZB 2KWVB 1DOYA 1GC7A 2BB5A 2J42A 3TCAA 2M56B 2WU2B 3UINB 2DNFA 1YD8U 3QHTA 3HVZA 2N1WA 1MHXA 3CIRB 1WR6E 2R2OA 2RPQA 1AWDA 4NNJB 1L4ZB 3APCA 3VXWA 4J6IA 3ZNHB 1T3QA 2MW5A 3ALBA 4LTUA 2MP2B 2NTTA 1A70A 2KWCA 4HVBA 1L7YA 1HXYD 1JWAD 2KQSA 3MHZA 2N0SB 1V1PB 3L08A 1I4RA 2QEJC 3MP9A 4AUQC 1E5WA 2MBHA 1F77A 3I63C 4RFBA 2CU1A 2LGDA 2FE8A 2ZW0A 4LDTD 2G9HD 1FXAA 2K9XA 4WAFA 1OQRA 3ZXRA 2WNMA 4W9LA 3A9KA 4HWIB 1J7CA 4XDCA 2N7EA 2L7RA 3RMKC 2WDVB 4E71A 1XO3A 3E9SA 4BKTA 2K3UA 2FCMA 4YSYB 1PUTA 4RF0A 3B2GA 4OHJA 3RYTA 3HK0A 1D5ZC 2BWFA 2PKOA 2M0AA 1E0ZA 4HROA 2MEKA 3RPFC 1E8YA 2ZZPB 3DOWA 4L2YA 1YX5B 4NAWB 3ECIA 4RF1A 3M95A 4B6WA 2LD9A 2V9HA 2IO0B 2GBKA 2WXRA 3L54A 4C80A 3RULA 1V49A 2QILA 3A4SC 3URYA 3PVLA 1WIAA 1L0VB 3IFWB 3U7ZA 4CO7A 1P3QU 4IM2A 5E6JA 4WAAA 2PVOD 1FXTB 2WX0A 1QKZA 2QSDA 2RMMA 3ZUNA 1P1AA 4NAMA 1SGHA 4FJZA 2MJEA 3R7QA 4KSLC 1VCBA 1EU3A 5T8IA 2JRHA 2D3GA 1UF0A 1ACCA 1L0YB 3TEYA 2WHIA 4TV3A 3NRZA 2D11A 1XLPA 2W3RA 3M63B 4ZRQA 4KGRA 5L95C 1NEKB 4DHZE 1C1YB 1E8ZA 2LUMA 1AW7A 2BQQA 3ZGZA 4HKZE 4E3CA 3K9PB 2CHWA 3OJ3A 3DWGC 3LXFA 3QWZB 2FIDA 2PJHA 2INPE 1WX8A 4F7ZA 4ZYSA 4EUTA 1GB1A 3KWVA 2IZVB 3IXSA 1G6JA 1VJKA 4TQ0A 2JRIB 3KQ4A 1MI0A 4HLEA 1WXVA 2N1VA 4HJKA 1HQRD 2BYFA 5AZGA 1FIQA 3CF6E 3L16A 2WXNA 3Q3JA 2LFIA 4A9AA 1GJZA 5IN7A 3UIPB 5CHWA 4F8CB 4IOIE 2L0FA 2LJIA 1F1HA 2BB6A 3AEFB 5TSSA 1NYRA 2GLSA 2DYBA 3L10B 3AE5B 1NVID 1YMHE 1WRIA 2GRIA 1FNWA 2KWUB 4WIPA 1JWSD 3H1UA 5CHFA 1MHHE 3X0WA 1BT0A 1EUVB 1LXDA 1FPYA 3AE2B 4KKIA 3S2AA 2KFJA 1XQQA 3VFKA 5DPSA 4LNFA 3H6NA 2D3CA 3NOBA 3L13A 2KK8A 4JGHB 1BXTA 1XCTL 2KX3A 2J7QB 2A4ZA 3AE3B 2Z8LA 3EFUA 2BGFA 4FHKA 2Y5BB 4AJYB 3TEWA 3DVGY 1I35A 5C23A 2WWZA 5C2TB 1YN4A 3OG5A 2AEHA 4IG7B 4AOFA 2I2YA 3APFA 2N9PC 4BKSD 2J53A 1K51A 1LM8B 3A9JB 1EWYC 4MELA 5JZEB 2VH2A 4MGZE 4CHKA 3T3NA 4W9HA 1KLUD 3HIZA 3M3JA 3IHPC 1FRDA 5G55A 3SDLC 3WIMA 4FBJB 2LASA 1E6EB 1PDXA 2JQRB 4LCDE 4PYZA 1KFYB 3BK1A 1XD3B 4C7ZA 2D3AA 2BF8B 2PE9A 3C8YA 1IP9A 3N1XC 3PSEB 2WXOA 1C79A 2WXGA 3KUZA 1UELA 4OVVA 1NENB 4KGTA 2QJLA 2QHOA 4C4VA 5BMHA 1QQRA 3P2BA 3SD5A 2C60A 2DAJA 5G5GA 4KKJA 1WZ3A 2K5PA 2X8XX 2HDEA 1V9JA 4NQLB 4FLHA 1E90A 1V8CA 5KHQA 1WSPA 3HRDD 1UGJA 5BYQA 3NY5A 3IT6B 2W9NA 3NS8A 4GB9A 2D5GA 3BVMA 2WU5B 2LHDA 4HJGE 2I38A 3KUCB 5HFYA 1P9DU 4NJCA 2CS4A 2B3AA 2MWSB 2C7HA 3O65B 2V0GA 3NVYA 1WJNA 2V4LA 1C77A 3AN1A 3R2IA 1UZXB 3N1YC 2NPTB 2KOXA 4IM3A 4ZRKA 4I6LB 5H92C 5GMVA 2AX5A 3EFCA 2PVGC 4NAWA 2RDHA 1OEYA 3W1SC 4MH0E 3A9KB 2O2VB 3A1QA 4RNAA 4GOCA 2ASQA 2LRWA 4FJVB 3PLUA 1PFDA 5E6OA 5D3DA 2BS3B 1TZOA 1B1ZA 4UDUC 1FXIA 5H8YE 4RGMA 4JWSC 3A1QB 2J0MA 4N6EB 1GNUA 1DOIA 3Q8EA 1Y8RC 2WXKA 4WWOA 2MX2A 4KZ0A 3ZDMC 1ZPSA 2O6VD 2QIEB 4MGIE 1JWBD 4CYEA 3GOEA 4B0EA 4MSMB 4YL8A 4GMVA 5DPRA 1ZW7A 2KQ7A 2BTEA 1ZGUB 1ZOYB 4ZRPA 3EGRA 4RM9A 2IGDA 3P4PB 2KFKB 3QA8A 4GSWA 4KVGB 2K6QA 4QAYA 3BK2A 3HM6X 3A9JA 2G4SA 2KJHB 3PT2B 1JWUD 5LLIA 4WH4A 4WJOA 2V3NA 1D4BA 4IUMB 1HE8A 1SJED 1YJJA 4D2KA 2DBYA 3RT3B 3RNEC 3PRMB 2BW2A 2WXQA 2NBVB 2M1MA 2KDFB 3AXCA 4OVUA 4BAXA 3QAQA 1XCQL 2HJ8A 1YIWA 1I4GA 1V1PA 4LJPB 2KACA 3APDA 4NZLB 1MVKA 1DYQA 4IC7B 3W1YA 2PPHA 1TY0A 5C1ZA 1I4XA 1JROA 5D94A 3RN9C 2R2QA 1WWTA 1TIFA 2W3SA 5IOIA 1D5XC 4L1BA 5EE9A 3UGBB 1RAXA 3PZDA 3U7DA 2KHWB 1EF5A 2JZZA 1PGBA 4YTNB 2XN9C 1TTNA 4OZBA 1WMHA 1WM3A 3V6EB 4ARCA 3N32A 1K52A 1ZXIA 2L83A 4HDOA 1RYJA 3BYYB 4TUUA 3ZVVA 3P4RB 1LFDA 1FNUA 1LGRA 1J19A 3ZNID 5J18A 4HK2A 3EA6A 3NVWA 2H89B 4KIKB 1VZ6A 2FAZA 4LNIA 2WDRB 4W9DA 1I4PA 2KC1A 4MJSB 4HDQA 4AP4C 1TZ1A 3H9DA 1L0XB 2N4FA 2N9LA 4YTMB 1H4RA 2L3ZA 1Q10A 1XLQA 1BMLC 4ZDVA 2GMIC 2KDMA 1KTKA 1KOTA 2JPHA 1VZ7A 4AJWA 1SSNA 2D2QA 2ZVNA 3AV8A 5G5HA 2X38A 4LJOB 1U4AA 4IKGA 5BO4B 4XWWA 3VHTC 2KYWA 2K8HA 2KWDA 1ENFA 4DQOC 4IWQA 5I4DA 1PQSA 3Q8FA 2A5UA 4E74A 2INCC 5IA7A 2AL6A 3GE3C 2KLGA 4G11A 2INNE 3BVZA 4PT5A 2NR2A 3NVVA 4BKGA 1SE9A 1I4HA 3JSVA 2KN5A 4DHJB 2K8CA 4K3CA 1WJ4A 1F0ZA 3X23A 1WGRA 1YOVB 3GE8C 4KDIC 3ABVB 2JVCA 1T0YA 2WP9B 1WI0A 5JHBA 4PS8A 4G0NB 3AEEB 3Q3NC 3B9JA 3IVFA 1J7BA 1WZ0A 2JU6X 4M00A 1OFFA 1T0QC 2EKEC 4US8A 3TSSA 2K25A 2V3PA 3NZUA 3SU8X 1N62A 1RLFA 4AQ7A 3H7SA 1RFAA 2BBCA 5AUKA 3UQAA 5LNK1 4M8NA 4RMAA 4KDLB 1CZPA 4DWFA 2L1AA 5IKCM 1MG4A 5EDSA 1M4VA 4XC2A 2B76B 3U52E 3QARA 3OAWA 4IWOA 2IYDB 4RGNA 3UF8A 2WGSA 3RUIB 3VRAB 3SR6A 2C7MB 3ZYYX 2ZCBA 2CHXA 2BT6A 2IPKD 2KTFA 1FEHA 2RD0A 2IY0B 1TS5A 2IO3B 5JH5C 2LEKA 2QC8A 1K53A 4HEA1 1QOBA 2IDYA 4FJYA 1FRRA 2GB1A 1SF0A 2PTLA 4IM0A 1PGAA 2KVRA 3H7PA 5L83A 2MCNB 2L00B 4F1SA 2O6VA 2KVZA 3QJZA 3PZ7A 5EE0A 3L0WB 3VRBB 2ZPYA 1E7PB 2DZJA 1JCKB 4KSKC 2K8BA 1IYFA 4GGQA 2DWQA 4MGKE 1WRDB 2O6VB 1I4QA 3LB8C 5CX3A 2LGIA 3PLVA 4ZYNA 4K1RB 3W5UB 3R7RA 4MGYE 1E10A 2BWES 4URKA 4MACA 4GU2A 1ESFA 4ANXA 1GUAB 1TT5B 1STEA 2LRUA 4ZOHC 3DBRI 4K7SA 2DYMA 4PYUA 3WAPA 3ZRFA 2E6XA 3OJ4B 2WXLA 1AYFA 2ZNVB 5EE3A 1OQQA 3DBRB 3AM9A 4X57B 3VTUA 4RGTA 3PREA 2YEPF 2KANA 4FADA 4C56C 2AQ2B 1EO6A 1WXQA 1IBXB 1H8CA 5HHDG 4WJQA 1HA5A 2MBOA 1WM2A 3Q14C 4PS3A 1SE4A 1AARA 2L32A 3AECB 3TEXA 2KTRB 3M62B 3DPDA 2WXPA 2IBIB 1ZP0B 1IUEA 2JYTA 1XLOA 3RNFC 4C00A 1KJTA 3DBHB 3TEZA 2RGFA 3PTFC 1T6BX 1LO5D 2BKFA 3ETRA 1YNTE 5LXHA 1KLVA 4EZLA 3P4QB 4P1CC 3ZJVA 4OVZA 4YT0B 3RZWC 2PMVA 1P7EA 5HI1A 4O1NA 2MLBA 3KYCD 1D5MC 1HTOA 1L6UA 3DVNV 3JYUA 1KLGD 1WXMA 2C7NB 2RDBC 1N5WA 2YVCA 4W9KA 1GAQB 1A5RA 1F9JA 5BYSA 3B1LX 1TKYA 2WYQA 4K7WA 4IDIA 4XZ4A 4B9KA 1GG3A 3ZXVA 3EHVA 1YN3A 4WJNA 1D3ZA 5E6NA 3D32A 5MPOA 2K0PA 1JALA 5BMGA 1WX9A 2BKRB 1R4MB 5J17A 1HEZE 3EC8A 3MHSD 3C19A 3P42A 1R4MI 2LHEA 5TR5A 2DZMA 3MTNB 5AZFA 2JSVX 4LNKA 4C4VB 1PYWD 3PRPB 3WCQA 1E7VA 4EZKA 2JZ3B 2MJ3A 1WY8A 5JXVA 3DVNU 3PO0A 1ROEA 2LGXA 1L6VA 1S1QB 1YX6B 1T5XD 1XEEA 3R3MA 3OLMD 1ET6A 3AI5A 2Z59B 4GLSC 2JWZA 1WMHB 1QLBB 5DPTA 2JWUA 1Y56A 3V60A 3SHQA 3MFGA 3AEDB 4K3BA 1E8XA 3V6CB 1GB4A 3CMMB 3DWMA 4BFRA 4P6VF 2BYVE 3KVFB 3WAOA 2L8JA 4EEWA 4DXGA 2FUHB 2UWQA 2LI5A 2D07B 3Q8AA 2KMCA 1K8RB 5DPWA 2DX5B 2OHFA 3VTVA 4JL9A 2Z0DB 1HZ6A 2IJ0A 3NG0A 4FULA 3ZLZA 3RNBC 1HTQA 3AB5A 4XDDA 2VH1A 1UD7A 2BS2B 2C9WB 4NY0A 2GOWA 2KQ4X 4GIVA 1C78A 3PPAA 1BUIC 4P1BC 3CWIA 4JWUC 3EECA 1NDDA 2Y5PA 4WURA 3PGEA 4WQOB 2N7DA 1YQ4B 4TKNA 2PE6B 3WANA 4YXDB 2FCSA 2Q5WD 3NJTA 2LGSA 1QOGA 1QOAA 3E56A 4MSQB 1N60A 3NHEB 3ZRCA 4ARIA 2G4DB 3N9YC 4GDKA 4HCNB 4P7IA 3UQBA 1L4DB 2WXIA 1JRUA 2LXCA 3CSTA 3WALA 2LVQA 3W1SA 3N20C 2J4XA 3FAHA 5AEKB 3AULA 4BVUC 3U30A 4A3PA 4JE3B 2RSUA 2REXA 3Q3FA 2OJRA 3FILB 4W9JA 3ZTCA 3ML9A 4A3OA 4A55A 4EE2A 2L05A 3AMZA 2KKCA 4K81A 3VR9B 3IG3A 1KH0A 3UI3A 3GP7A 2V3SA 4MT5A 1ZUD2 3GZNI 1TS3A 4DXFA 1SIJA 2NS5A 2M0XA 4LLGM 2O2VA 2EMTA 1GPXA 2KJRA 4MM3A 4PK1A 2AYOB 3I57A 2BVCA 2XNAC 3L17A 2JY6A 2DENB 1ISNA 3V61A 2NMQA 3RCZA 4GDLA 3IT4B 3PRZA 4IW0A 1JRPA 1VZ8A 4BBNF 4HPPA 1TS2A 5IAAC 3AEAB 3N3KB 1C4CA 4PS7A 1RM6C 1OEYJ 2ZCCA 2INDC 2K1FA 5G2NA 1XT9B 2MHJA 2M8SA 3BIID 1WR1A 3LYYA 3PZ8A 4FXCA 5IO9A 1V2YA 3RNAC 2WS3B 2JYEA 4GXBA 2UU7A 1TJEA 2KX0A 1JWMD 2DHZA 4HPMB 4XGAB 3N1ZC 1SBBB 4XWTA 4I6PA 4W9GA 5CHVC 1P0RA 2MSED 2AQ3B 2N9EB 3QCAA 3DVGX 2KC2A 1EWCA 5IP4D 3TJPA 1CJEA 4KGSA 2KFKA 2GBRA 1SE3A 3QIJA 2M19A 2VZKD 1E8WA 1WYWB 4BZAA 3T9LA 2HJ1A 3AE6B 4EKUA 2AWTA 3R2TA 3DBLB 3Q8BA 3VR8B 2KT7A 4WWNA 2XK5A 1Q0WB 4HRSA 3DBSA 3DBLI 4HPLB 2IO1B 3JSVB 4R3DA 1V5TA 1YN5A 5FR6A 4DK5A 4USAA 3DQVA 3NUHB 1PGXA 1SXTA 4EZJA 1QF6A 2L76A 3QQ8B 2KDIA 2RPVA 3PS6A 1N61A 2ZVOA 2LJ5A 3ML8A 3Q3MC 2CKHB 2JXTA 3AE7B 2V4IB 3AH7A 2V1YA 3ZNZB 1WGYA 2OEDA 4WWMA 4KZCA 1J8CA 1YJ1A 1IGDA 3HUIA 1FCCC 2XBBC 1SE2A 1UWXA 3UIOB 3KYDD 4BKSA 4FA6A 2DYOA 3NVZA 3B08A 3IAM1 3GB1A 1GC6A 2VZKB 4L23A 2WDQB 2CHZA 4XE0A 3V62A 4LNNA 5D2MB 4WQMA 3SEBA 1V80A 2M17A 1SIFA 2MJDA 1FNVA 3MC0B 1Q5WB 1FFUA 2QMTA 2KNBA 3B0AA 2KJ6A 3ONSA 3P63A 1EU4A 1KF6B 4G50A 1XF5L 2BYEA 1TGZB 3O13A 2MBEA 1WX7A 4JIOU 4W9CA 3BWUD 1TKGA 2KO3A 2ZEQA 4TQ1A 4ASWC 2R61A 4XX5A 3CSFA 3T8MA 1Z2MA 4M0WB 1QILA 3A33B 3AE8B 2DAFA 1E9MA 1QZEA 3U8ZA 3RNCC 2K22A 2G45B 4HXDA 5KHOA 4ZHPA 1FM0D 1V1OA 4M02A 2JUOA 3H8HA 3W2DA 2NVUI 1NYQA 4NJ6A 1TS4A 1SB3C 3Q3OC 3VQIA 2MRPA 4K7UA 3LDZE 1F52A 3PHWB 4YSXB 3A4RA 3SFEB 5BMIA 2W55A 4ITKA 2PIAA 3BINA 2DLBA 1ZDVA 3QC8B 3VTWA 1C4PA 2KTRA 2SAKA 1UBQA 2H88B 1K50A 4ICUA 4MDKE 1CK1A 4YTPB 1J0GA 3VAWA 5AUIA 3RNGC 3W5VB 2OJWA 1LQBA 4BOSC 5HKHA 2MA9B 2KLCA 5D6JB 4OZCA 4ANVA 4DBGA 5D7GA 2MBBB 4A8XC 2WXMA 5FKAC 1M94A 4OW0A 3QX1A 1MPEA 2KDBA 3SFDB 1ZDXA 2WXFA 1P98A 2G1EA 1EF1A 3ZJUA 1YQBA 3DHIC 1SJHD 2NPTA 4M01A 4ANWA 1B9RA 2LXAA 3B2FA 2NCNA 2WDTB 3V3XA 1D6EC 4W9IA 1ZE3D 3H7PB 1V81A 1WJ6A 4FHJA 1AN8A 4KX6B 1UUPA 2BYTA 4MJSA 2AQ1B 2RR9A 2WLBA 4FN2A 3I5JC 1WXAA 2ZJDA 2EELA 4TMAB 2FCQA 4DHJD 2KN4A 4ACFA 4HCPB 1JW9D 3TBLD 4W9EA 1UGMA 2KMMA 2J0JA 2LVOA 2XEWA 1QOFA 1WGHA 2YEPB 1WJUA 2LGYA 2NBUA 3C0RB 4YWGG 2N9KA 3ZDTA 1R4NI 2KDEB 4N58A 2KXJA 2G3QB 2NTSA 4ZHOA 4P16A 4N9F4 2K6DB 1VLBA 4RM8A 4DDGD 4M8MA 4ZRIA 1J7AA 3ZNGC 2K39A 1L5PA 2M4NA 3HHMA 3PHXB 5E6PA 1XLNA 2Z0EB 4N59A 1TBEA 4IWPA 4JPSA 2XK5B 2I1JA 2OOBB 2CU3A 3AE4B 1I7HA 3TIXA 2KAJA 3W9CB 3I9V1 4MEMA 2E3TA 1KRHA 2ICIA 3KWLA 1WXSA 2QCZA 3BY4B 2IGGA 1R7SA 2GI9A 2ZW1A 2Y3AA 2LVPA 4RGOS 2WXHA 2MH7A 2N7JA 2HD5B 3LJ3A 1C4AA 3DBHI 3TUOA 1FD6A 3R8BA 4A20A 3ZO5B 3ZQ4A 3KLSX 1EM7A 2CJOA 1L2NA 1VD2A 2GBJA 3AEGB 5LXIB 4S0RA 3VVWB 3MC9A 4WWPA 2QDFA 3GZNB 1WE6A 1ZXHA 1CMXB 3DHHC 4XYCA 1WE7A 2CR5A 1VRAB 3EUB2 2NBWB 2W54A 4AS1A 1NI2A 1TYGB 1P7FA 1OQYA 1TY2A 3I3TB 1RWSA 4KIKA 1CQVA 1V6EA 2MQJA 3R66C 2JT4B 1V86A 5C3JB 1UWMA 1VDVA 3U2SC 1DOXA 1FMAD 5CTRC 1UNSA 4EFOA 3DHGC 4LNOA 2LZ6A 3WA0A 3BYTB 5AZHA 4RCOA 4NQKE 3DCGA 4GDKB 4NJ7A 2WXJA 1Q1OA 2MP2A 3JVZX 2J52A 3FC4A 4ZRJA 3ZKJC 1WF9A 4A6QA 4I6NB 3FKYA 4B95A 4LDTB 4HKQA 1GOZA 3AU5A 2HTME 2BS4B 4M0WA 2CJNA 2RDGA 4H2AA 1WGKA 1T0RC 2JZPA 2JXXA 3VUWA 3BZDB 4NPNA 5BYRA 4YSZB 4CQNA 3T3OA 1VR9A 2D10A 3AEBB 1FO4A 3IAS1 4AWJA 3NS1A 5GXGB 1DGJA 1WYGA 3PV1A 2D3BA 2LMCA 1S3SG 1F2RI 1OGWA 1I42A 4C7YA 3ZIMA 3KW5B 4MM3B 2ZNVC 3TMPB 2FCNA 4ANUA 1OTRB 3MJ5A 5DCNA 5J2RA 3Q69A 4Q2JA 1C3TA 2L52A 3N30A 2MBQA 4II3B 2J0KA 1FCLA 2PLPA 3MC8A 2KZRA 3IBEA 5FK9C 4JQWC 3NZ3A 1WGDA 2N9XA 5EE1A 3ENEA 3ZJTA 3RFZB 1JMLA 3AE1B 1ZKHA 3FILA 1N63A 4GDLB 1SEBD 3AE9B 1HZ5A 1V5OA 4DXAB 3ZTDA 3MJWA 1WGGA 5FR3A 1QT9A 2JF5A 2JX5A 3KUDB 1F2RC 3Q2AC 1YQ3B 2LWPA 4WJPA 4TSSA 3NZSA 2ON8A 2YLMA 3Q6BA 3VUYA 1ET9A 2EKIA 3ZW3A 2FIFA 4DHZB 2GBNA 4W9FA 2FUG1 2TSSA 4A90A 2GBMA 2Y5CA 4EOYA 1C9FA 1TKEA 1MJDA 2PEAA 5D3IB 2SEBD 1R4NB 4JLCA 3V05A 1IPGA 3RZFA 4OZAA 1C76A 3Q8CA 1YJIA 4LK0M 2AL3A 1MG8A 2ZPNA 1NI3A 2FBWB 3RI7C 2UYZB 4BBNC 2HE7A 3K9OB 4GN1A 2ACZB 1Z5SB 4G3XB 1E7UA 1V97A 2IGHA 3VH4B 2FNJB 4RH6A 2LUEA 3OWEB 2KMAA 3KH0A 3VUXA 3GS2A 2EMSA 1RRBA 4REZA 3JW0X 2WQYB 3BVGA 2KD0A 2L0TA 3RD2A 2ONQA 4S17A 2W82A 3AU4A 1XXGA 2HTHA 3WAMA 3DDCB 3QK0A 2I1KA 5JHAA 1UBIA 2IY1B 3TL5A 1X1MA 4B0MA 1KM7A 4JX1C 1NBFC 3J9CA 3HVDA 3P1MA 1RFKA 1IBXA 4KV2A 1N5XA 2BPSA 2C5LC 5HG2A 2WX1A 1JQ4A 2VRRB 3L4PA 1MFWA 1IGCA 1UH6A
chains in the Genus database with same CATH topology
4II2B 2IO2B 3VH3B 3BINA 1WX9A 1Y8RC 3QC8B 3VTWA 2BKRB 4WWOA 1WH3A 2KTRA 2MX2A 1UBQA 4ICUA 4KZ0A 5J17A 3MHSD 3EC8A 4MDKE 3ZDMC 1J0GA 2O6VD 2DZKA 3VAWA 1WFYA 4MGIE 4DDID 1R4MI 4CYEA 3GOEA 5TR5A 2DZMA 3MTNB 4MSMB 1LQBA 4YL8A 5AZFA 4BOSC 4GMVA 5HKHA 5DPRA 1ZW7A 2KQ7A 2MA9B 1ZGUB 2KLCA 4ICVA 3PRPB 4RM9A 5D6JB 1E7VA 2DZIA 4ANVA 2JZ3B 3HM3A 3VDZA 1WY8A 4DBGA 4EZKA 4BOZB 2KFKB 5D7GA 2MBBB 3DVNU 3QA8A 4GSWA 1M94A 2KWVB 1GC7A 2K6QA 4KVGB 3HM6X 2KDBA 2G4SA 2KJHB 3A9JA 3PT2B 2LGXA 3QX1A 3TCAA 1S1QB 1YX6B 5LLIA 1P98A 3R3MA 4WJOA 4IUMB 1HE8A 1EF1A 3OLMD 3UINB 1YQBA 3AI5A 2Z59B 2JWZA 1WMHB 2NPTA 1YD8U 5DPTA 3RT3B 3QHTA 2N1WA 4ANWA 3PRMB 2NBVB 3SHQA 3V60A 1E8XA 1WR6E 3V6CB 2M1MA 2KDFB 2LXAA 2R2OA 3AXCA 3CMMB 4BFRA 2NCNA 2WDTB 2BYVE 2RPQA 3KVFB 3WAOA 2L8JA 4EEWA 4W9IA 4NNJB 4OVUA 3H7PB 1V81A 1WJ6A 3QAQA 2FUHB 4FHJA 2HJ8A 1YIWA 2UWQA 2LI5A 2D07B 3APCA 4MJSA 3VXWA 4J6IA 2RR9A 4FN2A 2KMCA 3ZNHB 1K8RB 1WXAA 2MW5A 4LJPB 5DPWA 2DX5B 3ALBA 3APDA 2MP2B 3VTVA 4JL9A 2ZJDA 2Z0DB 2FCQA 2KWCA 4IC7B 4FULA 3W1YA 3ZLZA 1L7YA 2PPHA 4HVBA 4DHJD 5C1ZA 2KQSA 4HCPB 5D94A 3TBLD 1UD7A 4W9EA 3L08A 2C9WB 4NY0A 1UGMA 4AUQC 2R2QA 1E5WA 2GOWA 2J0JA 2MBHA 4GIVA 2LVOA 2CU1A 3PPAA 2XEWA 2LGDA 1WGHA 4LDTD 3EECA 1WJUA 2LGYA 2NBUA 3UGBB 3C0RB 1NDDA 1RAXA 3PZDA 3U7DA 2KHWB 1EF5A 2JZZA 3ZDTA 4W9LA 1R4NI 2KDEB 3PGEA 2KXJA 2G3QB 2N7DA 3A9KA 4HWIB 4WQOB 1TTNA 4TKNA 2PE6B 1WMHA 2N7EA 2L7RA 1WM3A 3V6EB 4N9F4 2K6DB 3N32A 3WANA 4E71A 4BKTA 2FCSA 4HDOA 4RM8A 4DDGD 4M8MA 4MSQB 4TUUA 4ZRIA 2FCMA 3ZVVA 3ZNGC 2K39A 3NHEB 3ZRCA 1LFDA 1J19A 2G4DB 3ZNID 4HK2A 2M4NA 3HHMA 5J18A 3PHXB 4GDKA 4HCNB 4P7IA 4KIKB 2Z0EB 5E6PA 3HK0A 3RYTA 3UQBA 2BWFA 2FAZA 4W9DA 1TBEA 2KC1A 4MJSB 4HDQA 4AP4C 1TZ1A 4IWPA 2XK5B 1E8YA 2I1JA 2N4FA 2ZZPB 3H9DA 3DOWA 2OOBB 1JRUA 1YX5B 2LXCA 3ECIA 3CSTA 4NAWB 3TIXA 1H4RA 2L3ZA 3M95A 4ZDVA 4MEMA 3WALA 4B6WA 2LVQA 2GMIC 3W1SA 2LD9A 3L54A 2IO0B 2GBKA 1WXSA 1KOTA 2JPHA 3RULA 5AEKB 4AJWA 1V49A 3AULA 4BVUC 3U30A 4A3PA 3BY4B 2RSUA 3A4SC 2LVPA 2REXA 2D2QA 3PVLA 3Q3FA 1WIAA 3IFWB 2OJRA 2HD5B 4W9JA 2ZVNA 3LJ3A 3DBHI 3ZTCA 4CO7A 3ML9A 1P3QU 4IM2A 4A3OA 4LJOB 1U4AA 4A20A 5BO4B 4WAAA 2L05A 3ZO5B 1FXTB 2KKCA 4K81A 3VHTC 2WX0A 2K8HA 3IG3A 1L2NA 3ZUNA 1P1AA 1VD2A 4IWQA 2V3SA 1SGHA 2GBJA 1PQSA 4FJZA 3VVWB 2A5UA 5LXIB 3R7QA 4KSLC 1VCBA 3A1QB 4WWPA 4E74A 1WE6A 5IA7A 3GZNI 2AL6A 1CMXB 2JRHA 2KLGA 1WE7A 4G11A 2CR5A 2NS5A 2M0XA 2NBWB 2D3GA 2O2VA 2EMTA 2NR2A 1NI2A 4BKGA 1SE9A 1OQYA 3I3TB 3JSVA 2KJRA 4TV3A 4MM3A 4KIKA 1V6EA 2MQJA 3R66C 2D11A 2KN5A 2AYOB 4DHJB 2JT4B 3M63B 1V86A 5L95C 3L17A 4DHZE 1C1YB 1E8ZA 2JY6A 2K8CA 2DENB 1ISNA 3V61A 3RCZA 1WJ4A 5CTRC 4GDLA 4EFOA 3X23A 4E3CA 1WGRA 3PRZA 4KDIC 2LZ6A 2JVCA 1T0YA 2CHWA 3K9PB 3OJ3A 4IW0A 3WA0A 1WI0A 5JHBA 4BBNF 5AZHA 4NQKE 5IAAC 3DCGA 4PS8A 3QWZB 2FIDA 4G0NB 4GDKB 3N3KB 1Q1OA 2PJHA 4NJ7A 1WX8A 3IVFA 4PS7A 1WZ0A 4F7ZA 2MP2A 3JVZX 1OEYJ 2ZCCA 4EUTA 2IZVB 2EKEC 1G6JA 2K1FA 4ZRJA 5G2NA 4TQ0A 1XT9B 2K25A 2JRIB 3ZKJC 3NZUA 1WF9A 4I6NB 4B95A 4HLEA 4LDTB 3SU8X 1RLFA 2M8SA 1WXVA 2N1VA 1WR1A 3H7SA 1RFAA 4HJKA 3AU5A 2BYFA 3UQAA 1V2YA 5AZGA 4GXBA 3CF6E 3L16A 4M8NA 4RMAA 4KDLB 2JXXA 2KX0A 3VUWA 4DWFA 3Q3JA 4NPNA 2DHZA 1GJZA 5EDSA 4HPMB 4XC2A 2D10A 5CHWA 3UIPB 4F8CB 4AWJA 3QARA 3OAWA 4IWOA 2L0FA 2IYDB 3PV1A 4I6PA 4W9GA 3UF8A 5CHVC 1S3SG 1P0RA 3RUIB 2MSED 1OGWA 1I42A 2N9EB 3QCAA 3DVGX 2KC2A 2DYBA 3TJPA 3L10B 3ZIMA 2KFKA 2GBRA 3KW5B 2ZNVC 3TMPB 2FCNA 3QIJA 4ANUA 2KWUB 2C7MB 1E8WA 1OTRB 3H1UA 5CHFA 1WYWB 5DCNA 3X0WA 2ZCBA 1BT0A 2CHXA 1EUVB 3T9LA 1LXDA 5J2RA 2KTFA 3S2AA 2RD0A 4EKUA 3N30A 2KFJA 1C3TA 2AWTA 2IY0B 1XQQA 3VFKA 2IO3B 2MBQA 4II3B 2J0KA 4WWNA 5DPSA 2XK5A 5JH5C 1Q0WB 2KZRA 3H6NA 3NOBA 3IBEA 3L13A 2KK8A 4FJYA 3DBSA 4JGHB 4JQWC 3DBLI 4HPLB 1WGDA 2IO1B 2N9XA 4IM0A 1V5TA 3ENEA 2KVRA 3H7PA 2KX3A 2J7QB 2A4ZA 3JSVB 5FR6A 4DK5A 5L83A 2MCNB 2L00B 3DQVA 3EFUA 2BGFA 4F1SA 2O6VA 4EZJA 3QJZA 2L76A 3QQ8B 4FHKA 2KDIA 1ZKHA 2Y5BB 4AJYB 3L0WB 3DVGY 3PS6A 1I35A 2ZPYA 5C23A 2ZVOA 2DZJA 2WWZA 4GDLB 2LJ5A 3ML8A 2CKHB 4KSKC 2K8BA 2AEHA 4IG7B 4AOFA 1IYFA 1V5OA 3APFA 4GGQA 4DXAB 3ZNZB 3ZTDA 2V1YA 1WRDB 4MGKE 2N9PC 2O6VB 1WGYA 3MJWA 4BKSD 1WGGA 4KZCA 1LM8B 1J8CA 1YJ1A 3A9JB 5CX3A 4MELA 3PLVA 4ZYNA 2XBBC 4K1RB 5JZEB 3R7RA 4MGYE 4MGZE 3UIOB 4CHKA 2JF5A 3KYDD 2BWES 4BKSA 4FA6A 4URKA 4GU2A 2DYOA 3KUDB 4ANXA 4W9HA 3B08A 3HIZA 3M3JA 3IHPC 5G55A 3SDLC 1GUAB 3WIMA 4FBJB 1GC6A 2LASA 2LRUA 2LWPA 4WJPA 4LCDE 2CHZA 3DBRI 4K7SA 2DYMA 4PYUA 3V62A 3WAPA 3ZRFA 3OJ4B 3NZSA 4PYZA 2YLMA 5D2MB 3VUYA 1XD3B 3ZW3A 2ZNVB 2FIFA 2BF8B 2PE9A 2GBNA 4W9FA 4DHZB 1IP9A 1V80A 3PSEB 4X57B 2M17A 1SIFA 3VTUA 2GBMA 3KUZA 4EOYA 1Q5WB 3PREA 1UELA 2KANA 4FADA 2KNBA 3B0AA 4OVVA 2KJ6A 3ONSA 2PEAA 1EO6A 2QHOA 1H8CA 4WJQA 3P2BA 3SD5A 2MBOA 1WM2A 4JLCA 2C60A 2DAJA 4PS3A 4G50A 1WZ3A 1V9JA 4NQLB 2BYEA 1AARA 1IPGA 4FLHA 1TGZB 1E90A 5KHQA 3RZFA 2MBEA 2KTRB 3M62B 3DPDA 1WX7A 4JIOU 3NY5A 2IBIB 4W9CA 2AL3A 2KO3A 2ZEQA 1MG8A 2ZPNA 4TQ1A 2W9NA 4ASWC 2UYZB 3NS8A 4GB9A 4BBNC 4XX5A 2HE7A 3CSFA 3T8MA 1Z2MA 3K9OB 4GN1A 4M0WB 1KJTA 1Z5SB 4G3XB 1E7UA 2RGFA 3PTFC 2BKFA 3KUCB 3A33B 3VH4B 1P9DU 2FNJB 5LXHA 2DAFA 2CS4A 2B3AA 2LUEA 1QZEA 2KMAA 2MWSB 1KLVA 3KH0A 3VUXA 2C7HA 3O65B 4EZLA 2EMSA 3U8ZA 1RRBA 1WJNA 3RZWC 2V4LA 2G45B 3JW0X 4HXDA 3RD2A 2KD0A 2L0TA 2MLBA 3AU4A 3KYCD 1UZXB 5KHOA 2HTHA 2NPTB 2KOXA 4IM3A 3DVNV 3WAMA 3DDCB 3JYUA 3QK0A 4ZRKA 1WXMA 2C7NB 4I6LB 5GMVA 2YVCA 2I1KA 5JHAA 1UBIA 4W9KA 2JUOA 4NAWA 1A5RA 1OEYA 3W1SC 4MH0E 1F9JA 2IY1B 3A9KB 2NVUI 1X1MA 4NJ6A 3B1LX 3TL5A 2O2VB 3A1QA 2WYQA 3VQIA 1KM7A 1NBFC 4K7WA 4XZ4A 4GOCA 2MRPA 4B9KA 1GG3A 2ASQA 2LRWA 4FJVB 4K7UA 4KV2A 3PLUA 2BPSA 3EHVA 3LDZE 4WJNA 2C5LC 1D3ZA 2WX1A 5E6NA 5E6OA 2VRRB 3PHWB 3D32A 3A4RA 2J0MA 1UH6A 1GNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II2 B;  2IO2 B;  3VH3 B;  3BIN A;  1WX9 A;  1Y8R C;  3QC8 B;  3VTW A;  2BKR B;  4WWO A;  1WH3 A;  2KTR A;  2MX2 A;  1UBQ A;  4ICU A;  4KZ0 A;  5J17 A;  3MHS D;  3EC8 A;  4MDK E;  3ZDM C;  1J0G A;  2O6V D;  2DZK A;  3VAW A;  1WFY A;  4MGI E;  4DDI D;  1R4M I;  4CYE A;  3GOE A;  5TR5 A;  2DZM A;  3MTN B;  4MSM B;  1LQB A;  4YL8 A;  5AZF A;  4BOS C;  4GMV A;  5HKH A;  5DPR A;  1ZW7 A;  2KQ7 A;  2MA9 B;  1ZGU B;  2KLC A;  4ICV A;  3PRP B;  4RM9 A;  5D6J B;  1E7V A;  2DZI A;  4ANV A;  2JZ3 B;  3HM3 A;  3VDZ A;  1WY8 A;  4DBG A;  4EZK A;  4BOZ B;  2KFK B;  5D7G A;  2MBB B;  3DVN U;  3QA8 A;  4GSW A;  1M94 A;  2KWV B;  1GC7 A;  2K6Q A;  4KVG B;  3HM6 X;  2KDB A;  2G4S A;  2KJH B;  3A9J A;  3PT2 B;  2LGX A;  3QX1 A;  3TCA A;  1S1Q B;  1YX6 B;  5LLI A;  1P98 A;  3R3M A;  4WJO A;  4IUM B;  1HE8 A;  1EF1 A;  3OLM D;  3UIN B;  1YQB A;  3AI5 A;  2Z59 B;  2JWZ A;  1WMH B;  2NPT A;  1YD8 U;  5DPT A;  3RT3 B;  3QHT A;  2N1W A;  4ANW A;  3PRM B;  2NBV B;  3SHQ A;  3V60 A;  1E8X A;  1WR6 E;  3V6C B;  2M1M A;  2KDF B;  2LXA A;  2R2O A;  3AXC A;  3CMM B;  4BFR A;  2NCN A;  2WDT B;  2BYV E;  2RPQ A;  3KVF B;  3WAO A;  2L8J A;  4EEW A;  4W9I A;  4NNJ B;  4OVU A;  3H7P B;  1V81 A;  1WJ6 A;  3QAQ A;  2FUH B;  4FHJ A;  2HJ8 A;  1YIW A;  2UWQ A;  2LI5 A;  2D07 B;  3APC A;  4MJS A;  3VXW A;  4J6I A;  2RR9 A;  4FN2 A;  2KMC A;  3ZNH B;  1K8R B;  1WXA A;  2MW5 A;  4LJP B;  5DPW A;  2DX5 B;  3ALB A;  3APD A;  2MP2 B;  3VTV A;  4JL9 A;  2ZJD A;  2Z0D B;  2FCQ A;  2KWC A;  4IC7 B;  4FUL A;  3W1Y A;  3ZLZ A;  1L7Y A;  2PPH A;  4HVB A;  4DHJ D;  5C1Z A;  2KQS A;  4HCP B;  5D94 A;  3TBL D;  1UD7 A;  4W9E A;  3L08 A;  2C9W B;  4NY0 A;  1UGM A;  4AUQ C;  2R2Q A;  1E5W A;  2GOW A;  2J0J A;  2MBH A;  4GIV A;  2LVO A;  2CU1 A;  3PPA A;  2XEW A;  2LGD A;  1WGH A;  4LDT D;  3EEC A;  1WJU A;  2LGY A;  2NBU A;  3UGB B;  3C0R B;  1NDD A;  1RAX A;  3PZD A;  3U7D A;  2KHW B;  1EF5 A;  2JZZ A;  3ZDT A;  4W9L A;  1R4N I;  2KDE B;  3PGE A;  2KXJ A;  2G3Q B;  2N7D A;  3A9K A;  4HWI B;  4WQO B;  1TTN A;  4TKN A;  2PE6 B;  1WMH A;  2N7E A;  2L7R A;  1WM3 A;  3V6E B;  4N9F 4;  2K6D B;  3N32 A;  3WAN A;  4E71 A;  4BKT A;  2FCS A;  4HDO A;  4RM8 A;  4DDG D;  4M8M A;  4MSQ B;  4TUU A;  4ZRI A;  2FCM A;  3ZVV A;  3ZNG C;  2K39 A;  3NHE B;  3ZRC A;  1LFD A;  1J19 A;  2G4D B;  3ZNI D;  4HK2 A;  2M4N A;  3HHM A;  5J18 A;  3PHX B;  4GDK A;  4HCN B;  4P7I A;  4KIK B;  2Z0E B;  5E6P A;  3HK0 A;  3RYT A;  3UQB A;  2BWF A;  2FAZ A;  4W9D A;  1TBE A;  2KC1 A;  4MJS B;  4HDQ A;  4AP4 C;  1TZ1 A;  4IWP A;  2XK5 B;  1E8Y A;  2I1J A;  2N4F A;  2ZZP B;  3H9D A;  3DOW A;  2OOB B;  1JRU A;  1YX5 B;  2LXC A;  3ECI A;  3CST A;  4NAW B;  3TIX A;  1H4R A;  2L3Z A;  3M95 A;  4ZDV A;  4MEM A;  3WAL A;  4B6W A;  2LVQ A;  2GMI C;  3W1S A;  2LD9 A;  3L54 A;  2IO0 B;  2GBK A;  1WXS A;  1KOT A;  2JPH A;  3RUL A;  5AEK B;  4AJW A;  1V49 A;  3AUL A;  4BVU C;  3U30 A;  4A3P A;  3BY4 B;  2RSU A;  3A4S C;  2LVP A;  2REX A;  2D2Q A;  3PVL A;  3Q3F A;  1WIA A;  3IFW B;  2OJR A;  2HD5 B;  4W9J A;  2ZVN A;  3LJ3 A;  3DBH I;  3ZTC A;  4CO7 A;  3ML9 A;  1P3Q U;  4IM2 A;  4A3O A;  4LJO B;  1U4A A;  4A20 A;  5BO4 B;  4WAA A;  2L05 A;  3ZO5 B;  1FXT B;  2KKC A;  4K81 A;  3VHT C;  2WX0 A;  2K8H A;  3IG3 A;  1L2N A;  3ZUN A;  1P1A A;  1VD2 A;  4IWQ A;  2V3S A;  1SGH A;  2GBJ A;  1PQS A;  4FJZ A;  3VVW B;  2A5U A;  5LXI B;  3R7Q A;  4KSL C;  1VCB A;  3A1Q B;  4WWP A;  4E74 A;  1WE6 A;  5IA7 A;  3GZN I;  2AL6 A;  1CMX B;  2JRH A;  2KLG A;  1WE7 A;  4G11 A;  2CR5 A;  2NS5 A;  2M0X A;  2NBW B;  2D3G A;  2O2V A;  2EMT A;  2NR2 A;  1NI2 A;  4BKG A;  1SE9 A;  1OQY A;  3I3T B;  3JSV A;  2KJR A;  4TV3 A;  4MM3 A;  4KIK A;  1V6E A;  2MQJ A;  3R66 C;  2D11 A;  2KN5 A;  2AYO B;  4DHJ B;  2JT4 B;  3M63 B;  1V86 A;  5L95 C;  3L17 A;  4DHZ E;  1C1Y B;  1E8Z A;  2JY6 A;  2K8C A;  2DEN B;  1ISN A;  3V61 A;  3RCZ A;  1WJ4 A;  5CTR C;  4GDL A;  4EFO A;  3X23 A;  4E3C A;  1WGR A;  3PRZ A;  4KDI C;  2LZ6 A;  2JVC A;  1T0Y A;  2CHW A;  3K9P B;  3OJ3 A;  4IW0 A;  3WA0 A;  1WI0 A;  5JHB A;  4BBN F;  5AZH A;  4NQK E;  5IAA C;  3DCG A;  4PS8 A;  3QWZ B;  2FID A;  4G0N B;  4GDK B;  3N3K B;  1Q1O A;  2PJH A;  4NJ7 A;  1WX8 A;  3IVF A;  4PS7 A;  1WZ0 A;  4F7Z A;  2MP2 A;  3JVZ X;  1OEY J;  2ZCC A;  4EUT A;  2IZV B;  2EKE C;  1G6J A;  2K1F A;  4ZRJ A;  5G2N A;  4TQ0 A;  1XT9 B;  2K25 A;  2JRI B;  3ZKJ C;  3NZU A;  1WF9 A;  4I6N B;  4B95 A;  4HLE A;  4LDT B;  3SU8 X;  1RLF A;  2M8S A;  1WXV A;  2N1V A;  1WR1 A;  3H7S A;  1RFA A;  4HJK A;  3AU5 A;  2BYF A;  3UQA A;  1V2Y A;  5AZG A;  4GXB A;  3CF6 E;  3L16 A;  4M8N A;  4RMA A;  4KDL B;  2JXX A;  2KX0 A;  3VUW A;  4DWF A;  3Q3J A;  4NPN A;  2DHZ A;  1GJZ A;  5EDS A;  4HPM B;  4XC2 A;  2D10 A;  5CHW A;  3UIP B;  4F8C B;  4AWJ A;  3QAR A;  3OAW A;  4IWO A;  2L0F A;  2IYD B;  3PV1 A;  4I6P A;  4W9G A;  3UF8 A;  5CHV C;  1S3S G;  1P0R A;  3RUI B;  2MSE D;  1OGW A;  1I42 A;  2N9E B;  3QCA A;  3DVG X;  2KC2 A;  2DYB A;  3TJP A;  3L10 B;  3ZIM A;  2KFK A;  2GBR A;  3KW5 B;  2ZNV C;  3TMP B;  2FCN A;  3QIJ A;  4ANU A;  2KWU B;  2C7M B;  1E8W A;  1OTR B;  3H1U A;  5CHF A;  1WYW B;  5DCN A;  3X0W A;  2ZCB A;  1BT0 A;  2CHX A;  1EUV B;  3T9L A;  1LXD A;  5J2R A;  2KTF A;  3S2A A;  2RD0 A;  4EKU A;  3N30 A;  2KFJ A;  1C3T A;  2AWT A;  2IY0 B;  1XQQ A;  3VFK A;  2IO3 B;  2MBQ A;  4II3 B;  2J0K A;  4WWN A;  5DPS A;  2XK5 A;  5JH5 C;  1Q0W B;  2KZR A;  3H6N A;  3NOB A;  3IBE A;  3L13 A;  2KK8 A;  4FJY A;  3DBS A;  4JGH B;  4JQW C;  3DBL I;  4HPL B;  1WGD A;  2IO1 B;  2N9X A;  4IM0 A;  1V5T A;  3ENE A;  2KVR A;  3H7P A;  2KX3 A;  2J7Q B;  2A4Z A;  3JSV B;  5FR6 A;  4DK5 A;  5L83 A;  2MCN B;  2L00 B;  3DQV A;  3EFU A;  2BGF A;  4F1S A;  2O6V A;  4EZJ A;  3QJZ A;  2L76 A;  3QQ8 B;  4FHK A;  2KDI A;  1ZKH A;  2Y5B B;  4AJY B;  3L0W B;  3DVG Y;  3PS6 A;  1I35 A;  2ZPY A;  5C23 A;  2ZVO A;  2DZJ A;  2WWZ A;  4GDL B;  2LJ5 A;  3ML8 A;  2CKH B;  4KSK C;  2K8B A;  2AEH A;  4IG7 B;  4AOF A;  1IYF A;  1V5O A;  3APF A;  4GGQ A;  4DXA B;  3ZNZ B;  3ZTD A;  2V1Y A;  1WRD B;  4MGK E;  2N9P C;  2O6V B;  1WGY A;  3MJW A;  4BKS D;  1WGG A;  4KZC A;  1LM8 B;  1J8C A;  1YJ1 A;  3A9J B;  5CX3 A;  4MEL A;  3PLV A;  4ZYN A;  2XBB C;  4K1R B;  5JZE B;  3R7R A;  4MGY E;  4MGZ E;  3UIO B;  4CHK A;  2JF5 A;  3KYD D;  2BWE S;  4BKS A;  4FA6 A;  4URK A;  4GU2 A;  2DYO A;  3KUD B;  4ANX A;  4W9H A;  3B08 A;  3HIZ A;  3M3J A;  3IHP C;  5G55 A;  3SDL C;  1GUA B;  3WIM A;  4FBJ B;  1GC6 A;  2LAS A;  2LRU A;  2LWP A;  4WJP A;  4LCD E;  2CHZ A;  3DBR I;  4K7S A;  2DYM A;  4PYU A;  3V62 A;  3WAP A;  3ZRF A;  3OJ4 B;  3NZS A;  4PYZ A;  2YLM A;  5D2M B;  3VUY A;  1XD3 B;  3ZW3 A;  2ZNV B;  2FIF A;  2BF8 B;  2PE9 A;  2GBN A;  4W9F A;  4DHZ B;  1IP9 A;  1V80 A;  3PSE B;  4X57 B;  2M17 A;  1SIF A;  3VTU A;  2GBM A;  3KUZ A;  4EOY A;  1Q5W B;  3PRE A;  1UEL A;  2KAN A;  4FAD A;  2KNB A;  3B0A A;  4OVV A;  2KJ6 A;  3ONS A;  2PEA A;  1EO6 A;  2QHO A;  1H8C A;  4WJQ A;  3P2B A;  3SD5 A;  2MBO A;  1WM2 A;  4JLC A;  2C60 A;  2DAJ A;  4PS3 A;  4G50 A;  1WZ3 A;  1V9J A;  4NQL B;  2BYE A;  1AAR A;  1IPG A;  4FLH A;  1TGZ B;  1E90 A;  5KHQ A;  3RZF A;  2MBE A;  2KTR B;  3M62 B;  3DPD A;  1WX7 A;  4JIO U;  3NY5 A;  2IBI B;  4W9C A;  2AL3 A;  2KO3 A;  2ZEQ A;  1MG8 A;  2ZPN A;  4TQ1 A;  2W9N A;  4ASW C;  2UYZ B;  3NS8 A;  4GB9 A;  4BBN C;  4XX5 A;  2HE7 A;  3CSF A;  3T8M A;  1Z2M A;  3K9O B;  4GN1 A;  4M0W B;  1KJT A;  1Z5S B;  4G3X B;  1E7U A;  2RGF A;  3PTF C;  2BKF A;  3KUC B;  3A33 B;  3VH4 B;  1P9D U;  2FNJ B;  5LXH A;  2DAF A;  2CS4 A;  2B3A A;  2LUE A;  1QZE A;  2KMA A;  2MWS B;  1KLV A;  3KH0 A;  3VUX A;  2C7H A;  3O65 B;  4EZL A;  2EMS A;  3U8Z A;  1RRB A;  1WJN A;  3RZW C;  2V4L A;  2G45 B;  3JW0 X;  4HXD A;  3RD2 A;  2KD0 A;  2L0T A;  2MLB A;  3AU4 A;  3KYC D;  1UZX B;  5KHO A;  2HTH A;  2NPT B;  2KOX A;  4IM3 A;  3DVN V;  3WAM A;  3DDC B;  3JYU A;  3QK0 A;  4ZRK A;  1WXM A;  2C7N B;  4I6L B;  5GMV A;  2YVC A;  2I1K A;  5JHA A;  1UBI A;  4W9K A;  2JUO A;  4NAW A;  1A5R A;  1OEY A;  3W1S C;  4MH0 E;  1F9J A;  2IY1 B;  3A9K B;  2NVU I;  1X1M A;  4NJ6 A;  3B1L X;  3TL5 A;  2O2V B;  3A1Q A;  2WYQ A;  3VQI A;  1KM7 A;  1NBF C;  4K7W A;  4XZ4 A;  4GOC A;  2MRP A;  4B9K A;  1GG3 A;  2ASQ A;  2LRW A;  4FJV B;  4K7U A;  4KV2 A;  3PLU A;  2BPS A;  3EHV A;  3LDZ E;  4WJN A;  2C5L C;  1D3Z A;  2WX1 A;  5E6N A;  5E6O A;  2VRR B;  3PHW B;  3D32 A;  3A4R A;  2J0M A;  1UH6 A;  1GNU A; 
#chains in the Genus database with same CATH topology
 4II2 B;  3P4S B;  2IO2 B;  3VH3 B;  1N6Z A;  4J3O D;  1WH3 A;  2DZK A;  1WFY A;  1T0S C;  4DDI D;  4MH8 A;  1FFV A;  2PW9 A;  3U4E G;  4ICV A;  2DZI A;  4US9 A;  3HM3 A;  3VDZ A;  4BOZ B;  2KWV B;  1DOY A;  1GC7 A;  2BB5 A;  2J42 A;  3TCA A;  2M56 B;  2WU2 B;  3UIN B;  2DNF A;  1YD8 U;  3QHT A;  3HVZ A;  2N1W A;  1MHX A;  3CIR B;  1WR6 E;  2R2O A;  2RPQ A;  1AWD A;  4NNJ B;  1L4Z B;  3APC A;  3VXW A;  4J6I A;  3ZNH B;  1T3Q A;  2MW5 A;  3ALB A;  4LTU A;  2MP2 B;  2NTT A;  1A70 A;  2KWC A;  4HVB A;  1L7Y A;  1HXY D;  1JWA D;  2KQS A;  3MHZ A;  2N0S B;  1V1P B;  3L08 A;  1I4R A;  2QEJ C;  3MP9 A;  4AUQ C;  1E5W A;  2MBH A;  1F77 A;  3I63 C;  4RFB A;  2CU1 A;  2LGD A;  2FE8 A;  2ZW0 A;  4LDT D;  2G9H D;  1FXA A;  2K9X A;  4WAF A;  1OQR A;  3ZXR A;  2WNM A;  4W9L A;  3A9K A;  4HWI B;  1J7C A;  4XDC A;  2N7E A;  2L7R A;  3RMK C;  2WDV B;  4E71 A;  1XO3 A;  3E9S A;  4BKT A;  2K3U A;  2FCM A;  4YSY B;  1PUT A;  4RF0 A;  3B2G A;  4OHJ A;  3RYT A;  3HK0 A;  1D5Z C;  2BWF A;  2PKO A;  2M0A A;  1E0Z A;  4HRO A;  2MEK A;  3RPF C;  1E8Y A;  2ZZP B;  3DOW A;  4L2Y A;  1YX5 B;  4NAW B;  3ECI A;  4RF1 A;  3M95 A;  4B6W A;  2LD9 A;  2V9H A;  2IO0 B;  2GBK A;  2WXR A;  3L54 A;  4C80 A;  3RUL A;  1V49 A;  2QIL A;  3A4S C;  3URY A;  3PVL A;  1WIA A;  1L0V B;  3IFW B;  3U7Z A;  4CO7 A;  1P3Q U;  4IM2 A;  5E6J A;  4WAA A;  2PVO D;  1FXT B;  2WX0 A;  1QKZ A;  2QSD A;  2RMM A;  3ZUN A;  1P1A A;  4NAM A;  1SGH A;  4FJZ A;  2MJE A;  3R7Q A;  4KSL C;  1VCB A;  1EU3 A;  5T8I A;  2JRH A;  2D3G A;  1UF0 A;  1ACC A;  1L0Y B;  3TEY A;  2WHI A;  4TV3 A;  3NRZ A;  2D11 A;  1XLP A;  2W3R A;  3M63 B;  4ZRQ A;  4KGR A;  5L95 C;  1NEK B;  4DHZ E;  1C1Y B;  1E8Z A;  2LUM A;  1AW7 A;  2BQQ A;  3ZGZ A;  4HKZ E;  4E3C A;  3K9P B;  2CHW A;  3OJ3 A;  3DWG C;  3LXF A;  3QWZ B;  2FID A;  2PJH A;  2INP E;  1WX8 A;  4F7Z A;  4ZYS A;  4EUT A;  1GB1 A;  3KWV A;  2IZV B;  3IXS A;  1G6J A;  1VJK A;  4TQ0 A;  2JRI B;  3KQ4 A;  1MI0 A;  4HLE A;  1WXV A;  2N1V A;  4HJK A;  1HQR D;  2BYF A;  5AZG A;  1FIQ A;  3CF6 E;  3L16 A;  2WXN A;  3Q3J A;  2LFI A;  4A9A A;  1GJZ A;  5IN7 A;  3UIP B;  5CHW A;  4F8C B;  4IOI E;  2L0F A;  2LJI A;  1F1H A;  2BB6 A;  3AEF B;  5TSS A;  1NYR A;  2GLS A;  2DYB A;  3L10 B;  3AE5 B;  1NVI D;  1YMH E;  1WRI A;  2GRI A;  1FNW A;  2KWU B;  4WIP A;  1JWS D;  3H1U A;  5CHF A;  1MHH E;  3X0W A;  1BT0 A;  1EUV B;  1LXD A;  1FPY A;  3AE2 B;  4KKI A;  3S2A A;  2KFJ A;  1XQQ A;  3VFK A;  5DPS A;  4LNF A;  3H6N A;  2D3C A;  3NOB A;  3L13 A;  2KK8 A;  4JGH B;  1BXT A;  1XCT L;  2KX3 A;  2J7Q B;  2A4Z A;  3AE3 B;  2Z8L A;  3EFU A;  2BGF A;  4FHK A;  2Y5B B;  4AJY B;  3TEW A;  3DVG Y;  1I35 A;  5C23 A;  2WWZ A;  5C2T B;  1YN4 A;  3OG5 A;  2AEH A;  4IG7 B;  4AOF A;  2I2Y A;  3APF A;  2N9P C;  4BKS D;  2J53 A;  1K51 A;  1LM8 B;  3A9J B;  1EWY C;  4MEL A;  5JZE B;  2VH2 A;  4MGZ E;  4CHK A;  3T3N A;  4W9H A;  1KLU D;  3HIZ A;  3M3J A;  3IHP C;  1FRD A;  5G55 A;  3SDL C;  3WIM A;  4FBJ B;  2LAS A;  1E6E B;  1PDX A;  2JQR B;  4LCD E;  4PYZ A;  1KFY B;  3BK1 A;  1XD3 B;  4C7Z A;  2D3A A;  2BF8 B;  2PE9 A;  3C8Y A;  1IP9 A;  3N1X C;  3PSE B;  2WXO A;  1C79 A;  2WXG A;  3KUZ A;  1UEL A;  4OVV A;  1NEN B;  4KGT A;  2QJL A;  2QHO A;  4C4V A;  5BMH A;  1QQR A;  3P2B A;  3SD5 A;  2C60 A;  2DAJ A;  5G5G A;  4KKJ A;  1WZ3 A;  2K5P A;  2X8X X;  2HDE A;  1V9J A;  4NQL B;  4FLH A;  1E90 A;  1V8C A;  5KHQ A;  1WSP A;  3HRD D;  1UGJ A;  5BYQ A;  3NY5 A;  3IT6 B;  2W9N A;  3NS8 A;  4GB9 A;  2D5G A;  3BVM A;  2WU5 B;  2LHD A;  4HJG E;  2I38 A;  3KUC B;  5HFY A;  1P9D U;  4NJC A;  2CS4 A;  2B3A A;  2MWS B;  2C7H A;  3O65 B;  2V0G A;  3NVY A;  1WJN A;  2V4L A;  1C77 A;  3AN1 A;  3R2I A;  1UZX B;  3N1Y C;  2NPT B;  2KOX A;  4IM3 A;  4ZRK A;  4I6L B;  5H92 C;  5GMV A;  2AX5 A;  3EFC A;  2PVG C;  4NAW A;  2RDH A;  1OEY A;  3W1S C;  4MH0 E;  3A9K B;  2O2V B;  3A1Q A;  4RNA A;  4GOC A;  2ASQ A;  2LRW A;  4FJV B;  3PLU A;  1PFD A;  5E6O A;  5D3D A;  2BS3 B;  1TZO A;  1B1Z A;  4UDU C;  1FXI A;  5H8Y E;  4RGM A;  4JWS C;  3A1Q B;  2J0M A;  4N6E B;  1GNU A;  1DOI A;  3Q8E A;  1Y8R C;  2WXK A;  4WWO A;  2MX2 A;  4KZ0 A;  3ZDM C;  1ZPS A;  2O6V D;  2QIE B;  4MGI E;  1JWB D;  4CYE A;  3GOE A;  4B0E A;  4MSM B;  4YL8 A;  4GMV A;  5DPR A;  1ZW7 A;  2KQ7 A;  2BTE A;  1ZGU B;  1ZOY B;  4ZRP A;  3EGR A;  4RM9 A;  2IGD A;  3P4P B;  2KFK B;  3QA8 A;  4GSW A;  4KVG B;  2K6Q A;  4QAY A;  3BK2 A;  3HM6 X;  3A9J A;  2G4S A;  2KJH B;  3PT2 B;  1JWU D;  5LLI A;  4WH4 A;  4WJO A;  2V3N A;  1D4B A;  4IUM B;  1HE8 A;  1SJE D;  1YJJ A;  4D2K A;  2DBY A;  3RT3 B;  3RNE C;  3PRM B;  2BW2 A;  2WXQ A;  2NBV B;  2M1M A;  2KDF B;  3AXC A;  4OVU A;  4BAX A;  3QAQ A;  1XCQ L;  2HJ8 A;  1YIW A;  1I4G A;  1V1P A;  4LJP B;  2KAC A;  3APD A;  4NZL B;  1MVK A;  1DYQ A;  4IC7 B;  3W1Y A;  2PPH A;  1TY0 A;  5C1Z A;  1I4X A;  1JRO A;  5D94 A;  3RN9 C;  2R2Q A;  1WWT A;  1TIF A;  2W3S A;  5IOI A;  1D5X C;  4L1B A;  5EE9 A;  3UGB B;  1RAX A;  3PZD A;  3U7D A;  2KHW B;  1EF5 A;  2JZZ A;  1PGB A;  4YTN B;  2XN9 C;  1TTN A;  4OZB A;  1WMH A;  1WM3 A;  3V6E B;  4ARC A;  3N32 A;  1K52 A;  1ZXI A;  2L83 A;  4HDO A;  1RYJ A;  3BYY B;  4TUU A;  3ZVV A;  3P4R B;  1LFD A;  1FNU A;  1LGR A;  1J19 A;  3ZNI D;  5J18 A;  4HK2 A;  3EA6 A;  3NVW A;  2H89 B;  4KIK B;  1VZ6 A;  2FAZ A;  4LNI A;  2WDR B;  4W9D A;  1I4P A;  2KC1 A;  4MJS B;  4HDQ A;  4AP4 C;  1TZ1 A;  3H9D A;  1L0X B;  2N4F A;  2N9L A;  4YTM B;  1H4R A;  2L3Z A;  1Q10 A;  1XLQ A;  1BML C;  4ZDV A;  2GMI C;  2KDM A;  1KTK A;  1KOT A;  2JPH A;  1VZ7 A;  4AJW A;  1SSN A;  2D2Q A;  2ZVN A;  3AV8 A;  5G5H A;  2X38 A;  4LJO B;  1U4A A;  4IKG A;  5BO4 B;  4XWW A;  3VHT C;  2KYW A;  2K8H A;  2KWD A;  1ENF A;  4DQO C;  4IWQ A;  5I4D A;  1PQS A;  3Q8F A;  2A5U A;  4E74 A;  2INC C;  5IA7 A;  2AL6 A;  3GE3 C;  2KLG A;  4G11 A;  2INN E;  3BVZ A;  4PT5 A;  2NR2 A;  3NVV A;  4BKG A;  1SE9 A;  1I4H A;  3JSV A;  2KN5 A;  4DHJ B;  2K8C A;  4K3C A;  1WJ4 A;  1F0Z A;  3X23 A;  1WGR A;  1YOV B;  3GE8 C;  4KDI C;  3ABV B;  2JVC A;  1T0Y A;  2WP9 B;  1WI0 A;  5JHB A;  4PS8 A;  4G0N B;  3AEE B;  3Q3N C;  3B9J A;  3IVF A;  1J7B A;  1WZ0 A;  2JU6 X;  4M00 A;  1OFF A;  1T0Q C;  2EKE C;  4US8 A;  3TSS A;  2K25 A;  2V3P A;  3NZU A;  3SU8 X;  1N62 A;  1RLF A;  4AQ7 A;  3H7S A;  1RFA A;  2BBC A;  5AUK A;  3UQA A;  5LNK 1;  4M8N A;  4RMA A;  4KDL B;  1CZP A;  4DWF A;  2L1A A;  5IKC M;  1MG4 A;  5EDS A;  1M4V A;  4XC2 A;  2B76 B;  3U52 E;  3QAR A;  3OAW A;  4IWO A;  2IYD B;  4RGN A;  3UF8 A;  2WGS A;  3RUI B;  3VRA B;  3SR6 A;  2C7M B;  3ZYY X;  2ZCB A;  2CHX A;  2BT6 A;  2IPK D;  2KTF A;  1FEH A;  2RD0 A;  2IY0 B;  1TS5 A;  2IO3 B;  5JH5 C;  2LEK A;  2QC8 A;  1K53 A;  4HEA 1;  1QOB A;  2IDY A;  4FJY A;  1FRR A;  2GB1 A;  1SF0 A;  2PTL A;  4IM0 A;  1PGA A;  2KVR A;  3H7P A;  5L83 A;  2MCN B;  2L00 B;  4F1S A;  2O6V A;  2KVZ A;  3QJZ A;  3PZ7 A;  5EE0 A;  3L0W B;  3VRB B;  2ZPY A;  1E7P B;  2DZJ A;  1JCK B;  4KSK C;  2K8B A;  1IYF A;  4GGQ A;  2DWQ A;  4MGK E;  1WRD B;  2O6V B;  1I4Q A;  3LB8 C;  5CX3 A;  2LGI A;  3PLV A;  4ZYN A;  4K1R B;  3W5U B;  3R7R A;  4MGY E;  1E10 A;  2BWE S;  4URK A;  4MAC A;  4GU2 A;  1ESF A;  4ANX A;  1GUA B;  1TT5 B;  1STE A;  2LRU A;  4ZOH C;  3DBR I;  4K7S A;  2DYM A;  4PYU A;  3WAP A;  3ZRF A;  2E6X A;  3OJ4 B;  2WXL A;  1AYF A;  2ZNV B;  5EE3 A;  1OQQ A;  3DBR B;  3AM9 A;  4X57 B;  3VTU A;  4RGT A;  3PRE A;  2YEP F;  2KAN A;  4FAD A;  4C56 C;  2AQ2 B;  1EO6 A;  1WXQ A;  1IBX B;  1H8C A;  5HHD G;  4WJQ A;  1HA5 A;  2MBO A;  1WM2 A;  3Q14 C;  4PS3 A;  1SE4 A;  1AAR A;  2L32 A;  3AEC B;  3TEX A;  2KTR B;  3M62 B;  3DPD A;  2WXP A;  2IBI B;  1ZP0 B;  1IUE A;  2JYT A;  1XLO A;  3RNF C;  4C00 A;  1KJT A;  3DBH B;  3TEZ A;  2RGF A;  3PTF C;  1T6B X;  1LO5 D;  2BKF A;  3ETR A;  1YNT E;  5LXH A;  1KLV A;  4EZL A;  3P4Q B;  4P1C C;  3ZJV A;  4OVZ A;  4YT0 B;  3RZW C;  2PMV A;  1P7E A;  5HI1 A;  4O1N A;  2MLB A;  3KYC D;  1D5M C;  1HTO A;  1L6U A;  3DVN V;  3JYU A;  1KLG D;  1WXM A;  2C7N B;  2RDB C;  1N5W A;  2YVC A;  4W9K A;  1GAQ B;  1A5R A;  1F9J A;  5BYS A;  3B1L X;  1TKY A;  2WYQ A;  4K7W A;  4IDI A;  4XZ4 A;  4B9K A;  1GG3 A;  3ZXV A;  3EHV A;  1YN3 A;  4WJN A;  1D3Z A;  5E6N A;  3D32 A;  5MPO A;  2K0P A;  1JAL A;  5BMG A;  1WX9 A;  2BKR B;  1R4M B;  5J17 A;  1HEZ E;  3EC8 A;  3MHS D;  3C19 A;  3P42 A;  1R4M I;  2LHE A;  5TR5 A;  2DZM A;  3MTN B;  5AZF A;  2JSV X;  4LNK A;  4C4V B;  1PYW D;  3PRP B;  3WCQ A;  1E7V A;  4EZK A;  2JZ3 B;  2MJ3 A;  1WY8 A;  5JXV A;  3DVN U;  3PO0 A;  1ROE A;  2LGX A;  1L6V A;  1S1Q B;  1YX6 B;  1T5X D;  1XEE A;  3R3M A;  3OLM D;  1ET6 A;  3AI5 A;  2Z59 B;  4GLS C;  2JWZ A;  1WMH B;  1QLB B;  5DPT A;  2JWU A;  1Y56 A;  3V60 A;  3SHQ A;  3MFG A;  3AED B;  4K3B A;  1E8X A;  3V6C B;  1GB4 A;  3CMM B;  3DWM A;  4BFR A;  4P6V F;  2BYV E;  3KVF B;  3WAO A;  2L8J A;  4EEW A;  4DXG A;  2FUH B;  2UWQ A;  2LI5 A;  2D07 B;  3Q8A A;  2KMC A;  1K8R B;  5DPW A;  2DX5 B;  2OHF A;  3VTV A;  4JL9 A;  2Z0D B;  1HZ6 A;  2IJ0 A;  3NG0 A;  4FUL A;  3ZLZ A;  3RNB C;  1HTQ A;  3AB5 A;  4XDD A;  2VH1 A;  1UD7 A;  2BS2 B;  2C9W B;  4NY0 A;  2GOW A;  2KQ4 X;  4GIV A;  1C78 A;  3PPA A;  1BUI C;  4P1B C;  3CWI A;  4JWU C;  3EEC A;  1NDD A;  2Y5P A;  4WUR A;  3PGE A;  4WQO B;  2N7D A;  1YQ4 B;  4TKN A;  2PE6 B;  3WAN A;  4YXD B;  2FCS A;  2Q5W D;  3NJT A;  2LGS A;  1QOG A;  1QOA A;  3E56 A;  4MSQ B;  1N60 A;  3NHE B;  3ZRC A;  4ARI A;  2G4D B;  3N9Y C;  4GDK A;  4HCN B;  4P7I A;  3UQB A;  1L4D B;  2WXI A;  1JRU A;  2LXC A;  3CST A;  3WAL A;  2LVQ A;  3W1S A;  3N20 C;  2J4X A;  3FAH A;  5AEK B;  3AUL A;  4BVU C;  3U30 A;  4A3P A;  4JE3 B;  2RSU A;  2REX A;  3Q3F A;  2OJR A;  3FIL B;  4W9J A;  3ZTC A;  3ML9 A;  4A3O A;  4A55 A;  4EE2 A;  2L05 A;  3AMZ A;  2KKC A;  4K81 A;  3VR9 B;  3IG3 A;  1KH0 A;  3UI3 A;  3GP7 A;  2V3S A;  4MT5 A;  1ZUD 2;  3GZN I;  1TS3 A;  4DXF A;  1SIJ A;  2NS5 A;  2M0X A;  4LLG M;  2O2V A;  2EMT A;  1GPX A;  2KJR A;  4MM3 A;  4PK1 A;  2AYO B;  3I57 A;  2BVC A;  2XNA C;  3L17 A;  2JY6 A;  2DEN B;  1ISN A;  3V61 A;  2NMQ A;  3RCZ A;  4GDL A;  3IT4 B;  3PRZ A;  4IW0 A;  1JRP A;  1VZ8 A;  4BBN F;  4HPP A;  1TS2 A;  5IAA C;  3AEA B;  3N3K B;  1C4C A;  4PS7 A;  1RM6 C;  1OEY J;  2ZCC A;  2IND C;  2K1F A;  5G2N A;  1XT9 B;  2MHJ A;  2M8S A;  3BII D;  1WR1 A;  3LYY A;  3PZ8 A;  4FXC A;  5IO9 A;  1V2Y A;  3RNA C;  2WS3 B;  2JYE A;  4GXB A;  2UU7 A;  1TJE A;  2KX0 A;  1JWM D;  2DHZ A;  4HPM B;  4XGA B;  3N1Z C;  1SBB B;  4XWT A;  4I6P A;  4W9G A;  5CHV C;  1P0R A;  2MSE D;  2AQ3 B;  2N9E B;  3QCA A;  3DVG X;  2KC2 A;  1EWC A;  5IP4 D;  3TJP A;  1CJE A;  4KGS A;  2KFK A;  2GBR A;  1SE3 A;  3QIJ A;  2M19 A;  2VZK D;  1E8W A;  1WYW B;  4BZA A;  3T9L A;  2HJ1 A;  3AE6 B;  4EKU A;  2AWT A;  3R2T A;  3DBL B;  3Q8B A;  3VR8 B;  2KT7 A;  4WWN A;  2XK5 A;  1Q0W B;  4HRS A;  3DBS A;  3DBL I;  4HPL B;  2IO1 B;  3JSV B;  4R3D A;  1V5T A;  1YN5 A;  5FR6 A;  4DK5 A;  4USA A;  3DQV A;  3NUH B;  1PGX A;  1SXT A;  4EZJ A;  1QF6 A;  2L76 A;  3QQ8 B;  2KDI A;  2RPV A;  3PS6 A;  1N61 A;  2ZVO A;  2LJ5 A;  3ML8 A;  3Q3M C;  2CKH B;  2JXT A;  3AE7 B;  2V4I B;  3AH7 A;  2V1Y A;  3ZNZ B;  1WGY A;  2OED A;  4WWM A;  4KZC A;  1J8C A;  1YJ1 A;  1IGD A;  3HUI A;  1FCC C;  2XBB C;  1SE2 A;  1UWX A;  3UIO B;  3KYD D;  4BKS A;  4FA6 A;  2DYO A;  3NVZ A;  3B08 A;  3IAM 1;  3GB1 A;  1GC6 A;  2VZK B;  4L23 A;  2WDQ B;  2CHZ A;  4XE0 A;  3V62 A;  4LNN A;  5D2M B;  4WQM A;  3SEB A;  1V80 A;  2M17 A;  1SIF A;  2MJD A;  1FNV A;  3MC0 B;  1Q5W B;  1FFU A;  2QMT A;  2KNB A;  3B0A A;  2KJ6 A;  3ONS A;  3P63 A;  1EU4 A;  1KF6 B;  4G50 A;  1XF5 L;  2BYE A;  1TGZ B;  3O13 A;  2MBE A;  1WX7 A;  4JIO U;  4W9C A;  3BWU D;  1TKG A;  2KO3 A;  2ZEQ A;  4TQ1 A;  4ASW C;  2R61 A;  4XX5 A;  3CSF A;  3T8M A;  1Z2M A;  4M0W B;  1QIL A;  3A33 B;  3AE8 B;  2DAF A;  1E9M A;  1QZE A;  3U8Z A;  3RNC C;  2K22 A;  2G45 B;  4HXD A;  5KHO A;  4ZHP A;  1FM0 D;  1V1O A;  4M02 A;  2JUO A;  3H8H A;  3W2D A;  2NVU I;  1NYQ A;  4NJ6 A;  1TS4 A;  1SB3 C;  3Q3O C;  3VQI A;  2MRP A;  4K7U A;  3LDZ E;  1F52 A;  3PHW B;  4YSX B;  3A4R A;  3SFE B;  5BMI A;  2W55 A;  4ITK A;  2PIA A;  3BIN A;  2DLB A;  1ZDV A;  3QC8 B;  3VTW A;  1C4P A;  2KTR A;  2SAK A;  1UBQ A;  2H88 B;  1K50 A;  4ICU A;  4MDK E;  1CK1 A;  4YTP B;  1J0G A;  3VAW A;  5AUI A;  3RNG C;  3W5V B;  2OJW A;  1LQB A;  4BOS C;  5HKH A;  2MA9 B;  2KLC A;  5D6J B;  4OZC A;  4ANV A;  4DBG A;  5D7G A;  2MBB B;  4A8X C;  2WXM A;  5FKA C;  1M94 A;  4OW0 A;  3QX1 A;  1MPE A;  2KDB A;  3SFD B;  1ZDX A;  2WXF A;  1P98 A;  2G1E A;  1EF1 A;  3ZJU A;  1YQB A;  3DHI C;  1SJH D;  2NPT A;  4M01 A;  4ANW A;  1B9R A;  2LXA A;  3B2F A;  2NCN A;  2WDT B;  3V3X A;  1D6E C;  4W9I A;  1ZE3 D;  3H7P B;  1V81 A;  1WJ6 A;  4FHJ A;  1AN8 A;  4KX6 B;  1UUP A;  2BYT A;  4MJS A;  2AQ1 B;  2RR9 A;  2WLB A;  4FN2 A;  3I5J C;  1WXA A;  2ZJD A;  2EEL A;  4TMA B;  2FCQ A;  4DHJ D;  2KN4 A;  4ACF A;  4HCP B;  1JW9 D;  3TBL D;  4W9E A;  1UGM A;  2KMM A;  2J0J A;  2LVO A;  2XEW A;  1QOF A;  1WGH A;  2YEP B;  1WJU A;  2LGY A;  2NBU A;  3C0R B;  4YWG G;  2N9K A;  3ZDT A;  1R4N I;  2KDE B;  4N58 A;  2KXJ A;  2G3Q B;  2NTS A;  4ZHO A;  4P16 A;  4N9F 4;  2K6D B;  1VLB A;  4RM8 A;  4DDG D;  4M8M A;  4ZRI A;  1J7A A;  3ZNG C;  2K39 A;  1L5P A;  2M4N A;  3HHM A;  3PHX B;  5E6P A;  1XLN A;  2Z0E B;  4N59 A;  1TBE A;  4IWP A;  4JPS A;  2XK5 B;  2I1J A;  2OOB B;  2CU3 A;  3AE4 B;  1I7H A;  3TIX A;  2KAJ A;  3W9C B;  3I9V 1;  4MEM A;  2E3T A;  1KRH A;  2ICI A;  3KWL A;  1WXS A;  2QCZ A;  3BY4 B;  2IGG A;  1R7S A;  2GI9 A;  2ZW1 A;  2Y3A A;  2LVP A;  4RGO S;  2WXH A;  2MH7 A;  2N7J A;  2HD5 B;  3LJ3 A;  1C4A A;  3DBH I;  3TUO A;  1FD6 A;  3R8B A;  4A20 A;  3ZO5 B;  3ZQ4 A;  3KLS X;  1EM7 A;  2CJO A;  1L2N A;  1VD2 A;  2GBJ A;  3AEG B;  5LXI B;  4S0R A;  3VVW B;  3MC9 A;  4WWP A;  2QDF A;  3GZN B;  1WE6 A;  1ZXH A;  1CMX B;  3DHH C;  4XYC A;  1WE7 A;  2CR5 A;  1VRA B;  3EUB 2;  2NBW B;  2W54 A;  4AS1 A;  1NI2 A;  1TYG B;  1P7F A;  1OQY A;  1TY2 A;  3I3T B;  1RWS A;  4KIK A;  1CQV A;  1V6E A;  2MQJ A;  3R66 C;  2JT4 B;  1V86 A;  5C3J B;  1UWM A;  1VDV A;  3U2S C;  1DOX A;  1FMA D;  5CTR C;  1UNS A;  4EFO A;  3DHG C;  4LNO A;  2LZ6 A;  3WA0 A;  3BYT B;  5AZH A;  4RCO A;  4NQK E;  3DCG A;  4GDK B;  4NJ7 A;  2WXJ A;  1Q1O A;  2MP2 A;  3JVZ X;  2J52 A;  3FC4 A;  4ZRJ A;  3ZKJ C;  1WF9 A;  4A6Q A;  4I6N B;  3FKY A;  4B95 A;  4LDT B;  4HKQ A;  1GOZ A;  3AU5 A;  2HTM E;  2BS4 B;  4M0W A;  2CJN A;  2RDG A;  4H2A A;  1WGK A;  1T0R C;  2JZP A;  2JXX A;  3VUW A;  3BZD B;  4NPN A;  5BYR A;  4YSZ B;  4CQN A;  3T3O A;  1VR9 A;  2D10 A;  3AEB B;  1FO4 A;  3IAS 1;  4AWJ A;  3NS1 A;  5GXG B;  1DGJ A;  1WYG A;  3PV1 A;  2D3B A;  2LMC A;  1S3S G;  1F2R I;  1OGW A;  1I42 A;  4C7Y A;  3ZIM A;  3KW5 B;  4MM3 B;  2ZNV C;  3TMP B;  2FCN A;  4ANU A;  1OTR B;  3MJ5 A;  5DCN A;  5J2R A;  3Q69 A;  4Q2J A;  1C3T A;  2L52 A;  3N30 A;  2MBQ A;  4II3 B;  2J0K A;  1FCL A;  2PLP A;  3MC8 A;  2KZR A;  3IBE A;  5FK9 C;  4JQW C;  3NZ3 A;  1WGD A;  2N9X A;  5EE1 A;  3ENE A;  3ZJT A;  3RFZ B;  1JML A;  3AE1 B;  1ZKH A;  3FIL A;  1N63 A;  4GDL B;  1SEB D;  3AE9 B;  1HZ5 A;  1V5O A;  4DXA B;  3ZTD A;  3MJW A;  1WGG A;  5FR3 A;  1QT9 A;  2JF5 A;  2JX5 A;  3KUD B;  1F2R C;  3Q2A C;  1YQ3 B;  2LWP A;  4WJP A;  4TSS A;  3NZS A;  2ON8 A;  2YLM A;  3Q6B A;  3VUY A;  1ET9 A;  2EKI A;  3ZW3 A;  2FIF A;  4DHZ B;  2GBN A;  4W9F A;  2FUG 1;  2TSS A;  4A90 A;  2GBM A;  2Y5C A;  4EOY A;  1C9F A;  1TKE A;  1MJD A;  2PEA A;  5D3I B;  2SEB D;  1R4N B;  4JLC A;  3V05 A;  1IPG A;  3RZF A;  4OZA A;  1C76 A;  3Q8C A;  1YJI A;  4LK0 M;  2AL3 A;  1MG8 A;  2ZPN A;  1NI3 A;  2FBW B;  3RI7 C;  2UYZ B;  4BBN C;  2HE7 A;  3K9O B;  4GN1 A;  2ACZ B;  1Z5S B;  4G3X B;  1E7U A;  1V97 A;  2IGH A;  3VH4 B;  2FNJ B;  4RH6 A;  2LUE A;  3OWE B;  2KMA A;  3KH0 A;  3VUX A;  3GS2 A;  2EMS A;  1RRB A;  4REZ A;  3JW0 X;  2WQY B;  3BVG A;  2KD0 A;  2L0T A;  3RD2 A;  2ONQ A;  4S17 A;  2W82 A;  3AU4 A;  1XXG A;  2HTH A;  3WAM A;  3DDC B;  3QK0 A;  2I1K A;  5JHA A;  1UBI A;  2IY1 B;  3TL5 A;  1X1M A;  4B0M A;  1KM7 A;  4JX1 C;  1NBF C;  3J9C A;  3HVD A;  3P1M A;  1RFK A;  1IBX A;  4KV2 A;  1N5X A;  2BPS A;  2C5L C;  5HG2 A;  2WX1 A;  1JQ4 A;  2VRR B;  3L4P A;  1MFW A;  1IGC A;  1UH6 A; 
#chains in the Genus database with same CATH homology
 4II2 B;  2IO2 B;  3VH3 B;  3BIN A;  1WX9 A;  1Y8R C;  3QC8 B;  3VTW A;  2BKR B;  4WWO A;  1WH3 A;  2KTR A;  2MX2 A;  1UBQ A;  4ICU A;  4KZ0 A;  5J17 A;  3MHS D;  3EC8 A;  4MDK E;  3ZDM C;  1J0G A;  2O6V D;  2DZK A;  3VAW A;  1WFY A;  4MGI E;  4DDI D;  1R4M I;  4CYE A;  3GOE A;  5TR5 A;  2DZM A;  3MTN B;  4MSM B;  1LQB A;  4YL8 A;  5AZF A;  4BOS C;  4GMV A;  5HKH A;  5DPR A;  1ZW7 A;  2KQ7 A;  2MA9 B;  1ZGU B;  2KLC A;  4ICV A;  3PRP B;  4RM9 A;  5D6J B;  1E7V A;  2DZI A;  4ANV A;  2JZ3 B;  3HM3 A;  3VDZ A;  1WY8 A;  4DBG A;  4EZK A;  4BOZ B;  2KFK B;  5D7G A;  2MBB B;  3DVN U;  3QA8 A;  4GSW A;  1M94 A;  2KWV B;  1GC7 A;  2K6Q A;  4KVG B;  3HM6 X;  2KDB A;  2G4S A;  2KJH B;  3A9J A;  3PT2 B;  2LGX A;  3QX1 A;  3TCA A;  1S1Q B;  1YX6 B;  5LLI A;  1P98 A;  3R3M A;  4WJO A;  4IUM B;  1HE8 A;  1EF1 A;  3OLM D;  3UIN B;  1YQB A;  3AI5 A;  2Z59 B;  2JWZ A;  1WMH B;  2NPT A;  1YD8 U;  5DPT A;  3RT3 B;  3QHT A;  2N1W A;  4ANW A;  3PRM B;  2NBV B;  3SHQ A;  3V60 A;  1E8X A;  1WR6 E;  3V6C B;  2M1M A;  2KDF B;  2LXA A;  2R2O A;  3AXC A;  3CMM B;  4BFR A;  2NCN A;  2WDT B;  2BYV E;  2RPQ A;  3KVF B;  3WAO A;  2L8J A;  4EEW A;  4W9I A;  4NNJ B;  4OVU A;  3H7P B;  1V81 A;  1WJ6 A;  3QAQ A;  2FUH B;  4FHJ A;  2HJ8 A;  1YIW A;  2UWQ A;  2LI5 A;  2D07 B;  3APC A;  4MJS A;  3VXW A;  4J6I A;  2RR9 A;  4FN2 A;  2KMC A;  3ZNH B;  1K8R B;  1WXA A;  2MW5 A;  4LJP B;  5DPW A;  2DX5 B;  3ALB A;  3APD A;  2MP2 B;  3VTV A;  4JL9 A;  2ZJD A;  2Z0D B;  2FCQ A;  2KWC A;  4IC7 B;  4FUL A;  3W1Y A;  3ZLZ A;  1L7Y A;  2PPH A;  4HVB A;  4DHJ D;  5C1Z A;  2KQS A;  4HCP B;  5D94 A;  3TBL D;  1UD7 A;  4W9E A;  3L08 A;  2C9W B;  4NY0 A;  1UGM A;  4AUQ C;  2R2Q A;  1E5W A;  2GOW A;  2J0J A;  2MBH A;  4GIV A;  2LVO A;  2CU1 A;  3PPA A;  2XEW A;  2LGD A;  1WGH A;  4LDT D;  3EEC A;  1WJU A;  2LGY A;  2NBU A;  3UGB B;  3C0R B;  1NDD A;  1RAX A;  3PZD A;  3U7D A;  2KHW B;  1EF5 A;  2JZZ A;  3ZDT A;  4W9L A;  1R4N I;  2KDE B;  3PGE A;  2KXJ A;  2G3Q B;  2N7D A;  3A9K A;  4HWI B;  4WQO B;  1TTN A;  4TKN A;  2PE6 B;  1WMH A;  2N7E A;  2L7R A;  1WM3 A;  3V6E B;  4N9F 4;  2K6D B;  3N32 A;  3WAN A;  4E71 A;  4BKT A;  2FCS A;  4HDO A;  4RM8 A;  4DDG D;  4M8M A;  4MSQ B;  4TUU A;  4ZRI A;  2FCM A;  3ZVV A;  3ZNG C;  2K39 A;  3NHE B;  3ZRC A;  1LFD A;  1J19 A;  2G4D B;  3ZNI D;  4HK2 A;  2M4N A;  3HHM A;  5J18 A;  3PHX B;  4GDK A;  4HCN B;  4P7I A;  4KIK B;  2Z0E B;  5E6P A;  3HK0 A;  3RYT A;  3UQB A;  2BWF A;  2FAZ A;  4W9D A;  1TBE A;  2KC1 A;  4MJS B;  4HDQ A;  4AP4 C;  1TZ1 A;  4IWP A;  2XK5 B;  1E8Y A;  2I1J A;  2N4F A;  2ZZP B;  3H9D A;  3DOW A;  2OOB B;  1JRU A;  1YX5 B;  2LXC A;  3ECI A;  3CST A;  4NAW B;  3TIX A;  1H4R A;  2L3Z A;  3M95 A;  4ZDV A;  4MEM A;  3WAL A;  4B6W A;  2LVQ A;  2GMI C;  3W1S A;  2LD9 A;  3L54 A;  2IO0 B;  2GBK A;  1WXS A;  1KOT A;  2JPH A;  3RUL A;  5AEK B;  4AJW A;  1V49 A;  3AUL A;  4BVU C;  3U30 A;  4A3P A;  3BY4 B;  2RSU A;  3A4S C;  2LVP A;  2REX A;  2D2Q A;  3PVL A;  3Q3F A;  1WIA A;  3IFW B;  2OJR A;  2HD5 B;  4W9J A;  2ZVN A;  3LJ3 A;  3DBH I;  3ZTC A;  4CO7 A;  3ML9 A;  1P3Q U;  4IM2 A;  4A3O A;  4LJO B;  1U4A A;  4A20 A;  5BO4 B;  4WAA A;  2L05 A;  3ZO5 B;  1FXT B;  2KKC A;  4K81 A;  3VHT C;  2WX0 A;  2K8H A;  3IG3 A;  1L2N A;  3ZUN A;  1P1A A;  1VD2 A;  4IWQ A;  2V3S A;  1SGH A;  2GBJ A;  1PQS A;  4FJZ A;  3VVW B;  2A5U A;  5LXI B;  3R7Q A;  4KSL C;  1VCB A;  3A1Q B;  4WWP A;  4E74 A;  1WE6 A;  5IA7 A;  3GZN I;  2AL6 A;  1CMX B;  2JRH A;  2KLG A;  1WE7 A;  4G11 A;  2CR5 A;  2NS5 A;  2M0X A;  2NBW B;  2D3G A;  2O2V A;  2EMT A;  2NR2 A;  1NI2 A;  4BKG A;  1SE9 A;  1OQY A;  3I3T B;  3JSV A;  2KJR A;  4TV3 A;  4MM3 A;  4KIK A;  1V6E A;  2MQJ A;  3R66 C;  2D11 A;  2KN5 A;  2AYO B;  4DHJ B;  2JT4 B;  3M63 B;  1V86 A;  5L95 C;  3L17 A;  4DHZ E;  1C1Y B;  1E8Z A;  2JY6 A;  2K8C A;  2DEN B;  1ISN A;  3V61 A;  3RCZ A;  1WJ4 A;  5CTR C;  4GDL A;  4EFO A;  3X23 A;  4E3C A;  1WGR A;  3PRZ A;  4KDI C;  2LZ6 A;  2JVC A;  1T0Y A;  2CHW A;  3K9P B;  3OJ3 A;  4IW0 A;  3WA0 A;  1WI0 A;  5JHB A;  4BBN F;  5AZH A;  4NQK E;  5IAA C;  3DCG A;  4PS8 A;  3QWZ B;  2FID A;  4G0N B;  4GDK B;  3N3K B;  1Q1O A;  2PJH A;  4NJ7 A;  1WX8 A;  3IVF A;  4PS7 A;  1WZ0 A;  4F7Z A;  2MP2 A;  3JVZ X;  1OEY J;  2ZCC A;  4EUT A;  2IZV B;  2EKE C;  1G6J A;  2K1F A;  4ZRJ A;  5G2N A;  4TQ0 A;  1XT9 B;  2K25 A;  2JRI B;  3ZKJ C;  3NZU A;  1WF9 A;  4I6N B;  4B95 A;  4HLE A;  4LDT B;  3SU8 X;  1RLF A;  2M8S A;  1WXV A;  2N1V A;  1WR1 A;  3H7S A;  1RFA A;  4HJK A;  3AU5 A;  2BYF A;  3UQA A;  1V2Y A;  5AZG A;  4GXB A;  3CF6 E;  3L16 A;  4M8N A;  4RMA A;  4KDL B;  2JXX A;  2KX0 A;  3VUW A;  4DWF A;  3Q3J A;  4NPN A;  2DHZ A;  1GJZ A;  5EDS A;  4HPM B;  4XC2 A;  2D10 A;  5CHW A;  3UIP B;  4F8C B;  4AWJ A;  3QAR A;  3OAW A;  4IWO A;  2L0F A;  2IYD B;  3PV1 A;  4I6P A;  4W9G A;  3UF8 A;  5CHV C;  1S3S G;  1P0R A;  3RUI B;  2MSE D;  1OGW A;  1I42 A;  2N9E B;  3QCA A;  3DVG X;  2KC2 A;  2DYB A;  3TJP A;  3L10 B;  3ZIM A;  2KFK A;  2GBR A;  3KW5 B;  2ZNV C;  3TMP B;  2FCN A;  3QIJ A;  4ANU A;  2KWU B;  2C7M B;  1E8W A;  1OTR B;  3H1U A;  5CHF A;  1WYW B;  5DCN A;  3X0W A;  2ZCB A;  1BT0 A;  2CHX A;  1EUV B;  3T9L A;  1LXD A;  5J2R A;  2KTF A;  3S2A A;  2RD0 A;  4EKU A;  3N30 A;  2KFJ A;  1C3T A;  2AWT A;  2IY0 B;  1XQQ A;  3VFK A;  2IO3 B;  2MBQ A;  4II3 B;  2J0K A;  4WWN A;  5DPS A;  2XK5 A;  5JH5 C;  1Q0W B;  2KZR A;  3H6N A;  3NOB A;  3IBE A;  3L13 A;  2KK8 A;  4FJY A;  3DBS A;  4JGH B;  4JQW C;  3DBL I;  4HPL B;  1WGD A;  2IO1 B;  2N9X A;  4IM0 A;  1V5T A;  3ENE A;  2KVR A;  3H7P A;  2KX3 A;  2J7Q B;  2A4Z A;  3JSV B;  5FR6 A;  4DK5 A;  5L83 A;  2MCN B;  2L00 B;  3DQV A;  3EFU A;  2BGF A;  4F1S A;  2O6V A;  4EZJ A;  3QJZ A;  2L76 A;  3QQ8 B;  4FHK A;  2KDI A;  1ZKH A;  2Y5B B;  4AJY B;  3L0W B;  3DVG Y;  3PS6 A;  1I35 A;  2ZPY A;  5C23 A;  2ZVO A;  2DZJ A;  2WWZ A;  4GDL B;  2LJ5 A;  3ML8 A;  2CKH B;  4KSK C;  2K8B A;  2AEH A;  4IG7 B;  4AOF A;  1IYF A;  1V5O A;  3APF A;  4GGQ A;  4DXA B;  3ZNZ B;  3ZTD A;  2V1Y A;  1WRD B;  4MGK E;  2N9P C;  2O6V B;  1WGY A;  3MJW A;  4BKS D;  1WGG A;  4KZC A;  1LM8 B;  1J8C A;  1YJ1 A;  3A9J B;  5CX3 A;  4MEL A;  3PLV A;  4ZYN A;  2XBB C;  4K1R B;  5JZE B;  3R7R A;  4MGY E;  4MGZ E;  3UIO B;  4CHK A;  2JF5 A;  3KYD D;  2BWE S;  4BKS A;  4FA6 A;  4URK A;  4GU2 A;  2DYO A;  3KUD B;  4ANX A;  4W9H A;  3B08 A;  3HIZ A;  3M3J A;  3IHP C;  5G55 A;  3SDL C;  1GUA B;  3WIM A;  4FBJ B;  1GC6 A;  2LAS A;  2LRU A;  2LWP A;  4WJP A;  4LCD E;  2CHZ A;  3DBR I;  4K7S A;  2DYM A;  4PYU A;  3V62 A;  3WAP A;  3ZRF A;  3OJ4 B;  3NZS A;  4PYZ A;  2YLM A;  5D2M B;  3VUY A;  1XD3 B;  3ZW3 A;  2ZNV B;  2FIF A;  2BF8 B;  2PE9 A;  2GBN A;  4W9F A;  4DHZ B;  1IP9 A;  1V80 A;  3PSE B;  4X57 B;  2M17 A;  1SIF A;  3VTU A;  2GBM A;  3KUZ A;  4EOY A;  1Q5W B;  3PRE A;  1UEL A;  2KAN A;  4FAD A;  2KNB A;  3B0A A;  4OVV A;  2KJ6 A;  3ONS A;  2PEA A;  1EO6 A;  2QHO A;  1H8C A;  4WJQ A;  3P2B A;  3SD5 A;  2MBO A;  1WM2 A;  4JLC A;  2C60 A;  2DAJ A;  4PS3 A;  4G50 A;  1WZ3 A;  1V9J A;  4NQL B;  2BYE A;  1AAR A;  1IPG A;  4FLH A;  1TGZ B;  1E90 A;  5KHQ A;  3RZF A;  2MBE A;  2KTR B;  3M62 B;  3DPD A;  1WX7 A;  4JIO U;  3NY5 A;  2IBI B;  4W9C A;  2AL3 A;  2KO3 A;  2ZEQ A;  1MG8 A;  2ZPN A;  4TQ1 A;  2W9N A;  4ASW C;  2UYZ B;  3NS8 A;  4GB9 A;  4BBN C;  4XX5 A;  2HE7 A;  3CSF A;  3T8M A;  1Z2M A;  3K9O B;  4GN1 A;  4M0W B;  1KJT A;  1Z5S B;  4G3X B;  1E7U A;  2RGF A;  3PTF C;  2BKF A;  3KUC B;  3A33 B;  3VH4 B;  1P9D U;  2FNJ B;  5LXH A;  2DAF A;  2CS4 A;  2B3A A;  2LUE A;  1QZE A;  2KMA A;  2MWS B;  1KLV A;  3KH0 A;  3VUX A;  2C7H A;  3O65 B;  4EZL A;  2EMS A;  3U8Z A;  1RRB A;  1WJN A;  3RZW C;  2V4L A;  2G45 B;  3JW0 X;  4HXD A;  3RD2 A;  2KD0 A;  2L0T A;  2MLB A;  3AU4 A;  3KYC D;  1UZX B;  5KHO A;  2HTH A;  2NPT B;  2KOX A;  4IM3 A;  3DVN V;  3WAM A;  3DDC B;  3JYU A;  3QK0 A;  4ZRK A;  1WXM A;  2C7N B;  4I6L B;  5GMV A;  2YVC A;  2I1K A;  5JHA A;  1UBI A;  4W9K A;  2JUO A;  4NAW A;  1A5R A;  1OEY A;  3W1S C;  4MH0 E;  1F9J A;  2IY1 B;  3A9K B;  2NVU I;  1X1M A;  4NJ6 A;  3B1L X;  3TL5 A;  2O2V B;  3A1Q A;  2WYQ A;  3VQI A;  1KM7 A;  1NBF C;  4K7W A;  4XZ4 A;  4GOC A;  2MRP A;  4B9K A;  1GG3 A;  2ASQ A;  2LRW A;  4FJV B;  4K7U A;  4KV2 A;  3PLU A;  2BPS A;  3EHV A;  3LDZ E;  4WJN A;  2C5L C;  1D3Z A;  2WX1 A;  5E6N A;  5E6O A;  2VRR B;  3PHW B;  3D32 A;  3A4R A;  2J0M A;  1UH6 A;  1GNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...