3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
b'THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
3L08A 1P1AA 4MDKE 2NCNA 4F7ZA 1VD2A 5C1ZA 1UZXB 2ZZPB 2W9NA 3VQIA 2D07B 2JVCA 4EUTA 2OOBB 2KWUB 1UELA 2Z0DB 2I1JA 3M62B 4IM2A 4W9GA 1WGHA 4FHKA 1P98A 4KIKA 3WAOA 3TMPB 3X0WA 3APFA 1E7VA 1I35A 1WH3A 2JUOA 4W9CA 4DDID 2J0MA 3ZRCA 3QK0A 4RM9A 2L3ZA 3ML8A 4WQOB 2KVRA 2BGFA 4GN1A 3RCZA 1R4MI 3RUIB 3TIXA 1E90A 3L17A 1C3TA 1EF1A 3EFUA 3ZDMC 1UD7A 2CHWA 2LJ5A 3HIZA 4KSKC 3Q3JA 2FCNA 4K7UA 3NOBA 2DHZA 1V2YA 2K39A 1V81A 2GBNA 4EOYA 4CYEA 2V3SA 2M8SA 1YX6B 4MSQB 4PYUA 3ZNID 2O2VB 2BF8B 2R2OA 3B0AA 2M1MA 5J2RA 2FAZA 3ZKJC 5JH5C 4WWNA 2A4ZA 2G3QB 3SU8X 5DPWA 4BKSD 1WJNA 4W9DA 2MQJA 3QAQA 1P9DU 4HLEA 3PRPB 1GC6A 5HKHA 3DVGY 3L0WB 1MG8A 1E8WA 3RZWC 2O2VA 2N1WA 5E6PA 3T9LA 3ZLZA 1LFDA 4ZDVA 3ENEA 1R4NI 1L7YA 2LD9A 3PT2B 3HM6X 3B08A 4I6PA 3TJPA 4TQ1A 4MM3A 4BOSC 2O6VD 3M95A 2BKRB 2KXJA 3ML9A 3EHVA 3HHMA 2ZCCA 3VUYA 1V5OA 1YX5B 5GMVA 4E71A 3UIOB 3PSEB 1XQQA 3RD2A 4BFRA 4TQ0A 3W1YA 4K7SA 1NBFC 1WYWB 3A1QB 1Z2MA 3DPDA 4JLCA 4G50A 1OTRB 2MWSB 2G4SA 3RZFA 5CHVC 2KOXA 4XX5A 5IAAC 2Z59B 2LASA 4MEMA 1WGYA 2FCSA 2D3GA 3L10B 4BBNF 2LGDA 2NS5A 5CHWA 4ICUA 1YD8U 2ZJDA 5D94A 4NQLB 2CHZA 3A1QA 3JYUA 2KC2A 3R66C 5DPSA 3AU4A 3ZO5B 2LVPA 3ZIMA 1TGZB 4HDOA 2DAFA 1U4AA 3RT3B 2LI5A 4B9KA 2Y5BB 4FJZA 1XD3B 2MBQA 1RAXA 2LZ6A 4E74A 3NY5A 1ISNA 4LJPB 5DPRA 3PTFC 4EZLA 4GDLB 3U7DA 3WANA 2BYVE 1L2NA 4A3PA 4NJ7A 3WAMA 3I3TB 5AEKB 4HPLB 2N9XA 4IWPA 4GIVA 3C0RB 3PLUA 1V80A 2C60A 1WXMA 2IO2B 2KJHB 2REXA 3NHEB 2PE6B 2EMTA 2LXCA 2ZNVB 3IBEA 4FJVB 1WE6A 4PS3A 2V4LA 1S1QB 2KO3A 3Q3FA 4GDLA 3U8ZA 3N3KB 2BYEA 3DDCB 1WRDB 2KNBA 1J0GA 2WX0A 4W9EA 1M94A 1H4RA 4TUUA 3V61A 1Z5SB 1P0RA 2IO0B 3VHTC 1WY8A 2UWQA 2KFJA 4B95A 2MLBA 4NJ6A 2NPTB 2JRIB 4IC7B 4B6WA 3CF6E 3PRMB 4FADA 4BOZB 4IWQA 5FR6A 3LDZE 3QQ8B 2K8HA 5DPTA 3W1SA 1IPGA 5L95C 1G6JA 1LQBA 3UF8A 4NPNA 4I6NB 2D10A 2NVUI 2BWES 4BBNC 4II3B 3VTUA 4ASWC 3QC8B 4BVUC 2AEHA 1WJ4A 2NPTA 4KDLB 4FA6A 2LXAA 1SE9A 4IG7B 2ASQA 2KHWB 2GOWA 3KUDB 2FUHB 3KYDD 2KD0A 5E6OA 4ANXA 3A9JB 4M0WB 3OJ4B 2KZRA 1E8ZA 4ZRJA 4II2B 3UINB 4W9FA 4ANWA 2NBWB 4WWPA 3UIPB 2DZJA 4PS7A 3PS6A 3DCGA 1S3SG 4GU2A 3KW5B 3SD5A 4AJYB 2R2QA 4J6IA 1KM7A 4FBJB 1WM3A 1WZ0A 3ZTDA 3A9JA 5L83A 2DYOA 3JVZX 1J19A 4IWOA 4KV2A 2KLCA 4NAWB 4G11A 4GXBA 1ZKHA 3T8MA 2IBIB 3ZUNA 1WFYA 3DOWA 2KN5A 3VFKA 1RFAA 4LCDE 2LRWA 3KVFB 2AL3A 4BKTA 2KK8A 4X57B 4ANUA 3SDLC 4NAWA 3ZRFA 4AP4C 4LDTD 4BKSA 2KTRB 1WX8A 2IZVB 2O6VB 1GC7A 1IP9A 3UQAA 2JRHA 2RR9A 3O65B 2GBJA 1EF5A 4LJOB 2M4NA 2K8BA 5AZFA 5D7GA 2XBBC 3PPAA 2JT4B 2KDIA 4OVUA 4NQKE 4DBGA 3MTNB 3NZUA 2KTRA 2MP2B 2O6VA 3B1LX 1WIAA 3IVFA 1LXDA 3PGEA 3HM3A 3N32A 1UH6A 3QA8A 3QARA 4GSWA 1TTNA 3A9KB 3UGBB 2NBVB 3VUXA 4MGYE 1EUVB 2DZKA 3ALBA 4KDIC 4W9KA 5CHFA 3V62A 2YLMA 5C23A 2PE9A 2ZVNA 4EKUA 1NI2A 3AU5A 1SIFA 4DHZE 3UQBA 2I1KA 4KSLC 2MRPA 2MA9B 2MP2A 2KMAA 3ONSA 4ZRKA 4OVVA 1Q5WB 3WALA 2ZEQA 2L0TA 2NR2A 1BT0A 3A9KA 3QX1A 4A3OA 4MSMB 2OJRA 1OGWA 2WWZA 3MJWA 4DHZB 4ZRIA 4W9HA 2KQ7A 2K25A 3CSFA 3QIJA 5LLIA 2PPHA 4HWIB 4MELA 2BKFA 1WI0A 4PYZA 1F9JA 2J0JA 4NY0A 3PLVA 3IFWB 2BWFA 3DBHI 2MW5A 3WAPA 4DWFA 1H8CA 2ZPNA 2CS4A 2EKEC 2FNJB 2MBBB 2N7EA 1E7UA 2DYMA 2MBEA 4M8MA 4URKA 2KKCA 2CR5A 1WM2A 3K9PB 2IY1B 1V9JA 4AJWA 1WR6E 2WYQA 3JW0X 3RULA 2FCMA 1A5RA 3L13A 1Q1OA 2M0XA 1WR1A 4EEWA 1GG3A 4HXDA 4K1RB 2V1YA 4K7WA 1T0YA 2K1FA 1Y8RC 2HE7A 2L00B 4FHJA 2LGXA 4HCNB 4W9LA 4ICVA 4DHJD 1WZ3A 3PHXB 4GDKB 1I42A 3QHTA 3R7QA 5EDSA 3H7PB 4I6LB 2KLGA 2N4FA 2L7RA 4K81A 4DK5A 2RD0A 3N30A 1P3QU 5D2MB 4N9F4 2EMSA 5LXIB 1E8YA 2AWTA 2KMCA 3VAWA 2N9EB 2CHXA 2C9WB 4FJYA 1UGMA 1WMHB 1AARA 2MBHA 4F1SA 1WGDA 3DBRI 4GDKA 2ZCBA 3S2AA 1SGHA 2KQSA 3H7PA 2LVQA 3EC8A 5JHBA 1Q0WB 2MBOA 1V6EA 3W1SC 2BYFA 2KTFA 2JF5A 3CSTA 4IM0A 3RYTA 5TR5A 3V6EB 3VXWA 4G0NB 4ZYNA 1WMHA 3DBSA 3PVLA 2ZVOA 2KWCA 4MJSB 1TZ1A 1E8XA 1UBQA 2KJRA 2KJ6A 4AWJA 3DVNU 2RSUA 2RGFA 4WJNA 1V86A 1WGRA 1WXSA 2B3AA 2KDFB 2L0FA 3QCAA 1RRBA 2NBUA 3VTWA 4RMAA 2GBKA 3GZNI 3BY4B 2HJ8A 4MJSA 3ZNGC 4KIKB 4LDTB 3ZNZB 3A4RA 3AI5A 4JGHB 4G3XB 3LJ3A 3KH0A 1C1YB 2DZMA 3KUZA 2G45B 4P7IA 5E6NA 5J18A 2C7HA 1WXAA 2KC1A 4MGZE 4WJPA 1CMXB 2KDEB 1E5WA 5CTRC 3VH3B 5IA7A 5J17A 2KWVB 2UYZB 3NZSA 5BO4B 3IHPC 4NNJB 3P2BA 4FLHA 1WGGA 3AXCA 2DENB 3JSVB 1ZW7A 3OLMD 4WJOA 4XC2A 2FCQA 1WE7A 2K8CA 1RLFA 3AULA 4JL9A 1FXTB 3IG3A 3D32A 2J7QB 3ZW3A 1OQYA 1WX7A 3U30A 2BPSA 4RM8A 4YL8A 3R7RA 3PV1A 3TBLD 4AUQC 4IW0A 3JSVA 3TL5A 1V5TA 4TKNA 1YJ1A 4HDQA 2DAJA 2GBRA 3OAWA 1GUAB 2C7NB 4GOCA 3VVWB 2DYBA 3PHWB 2N7DA 3DVGX 2JXXA 2J0KA 3ECIA 2IY0B 4FN2A 3M3JA 1YIWA 2JZZA 2KX3A 2KANA 1GJZA 2CU1A 3VDZA 1IYFA 3CMMB 3VUWA 4IUMB 3HK0A 4HCPB 4PS8A 4IM3A 2D11A 4MH0E 5CX3A 4XZ4A 4E3CA 2CKHB 2A5UA 3H6NA 3L16A 3V6CB 3SHQA 5JZEB 4F8CB 3A4SC 1K8RB 2KDBA 4GB9A 3PRZA 4GGQA 3NS8A 2LVOA 3K9OB 2Z0EB 2JY6A 1WX9A 2WDTB 4MGIE 3KYCD 1UBIA 3H9DA 3ZNHB 4HJKA 3A33B 1LM8B 3WA0A 1XT9B 3ZTCA 3H1UA 1TBEA 1NDDA 2IYDB 5AZGA 3APDA 3MHSD 4WAAA 3WIMA 4HPMB 4KZ0A 2LGYA 5DCNA 3X23A 4ANVA 2FIDA 2LRUA 2XEWA 4BKGA 1JRUA 4M8NA 4WWOA 3L54A 2IO1B 2M17A 3VH4B 4W9IA 4FULA 5KHQA 2L76A 1WJUA 2N1VA 5JHAA 2KX0A 4DHJB 2C7MB 2AL6A 4GMVA 2HD5B 5G55A 1EO6A 1KJTA 2GMIC 3VTVA 4AOFA 4CHKA 4DXAB 1X1MA 5D6JB 1WXVA 4WJQA 3M63B 2D2QA 1PQSA 2IO3B 3H7SA 1ZGUB 2GBMA 2MX2A 2C5LC 2RPQA 4DDGD 1KOTA 2FIFA 4EFOA 4HK2A 4HVBA 2K6DB 2N9PC 4MGKE 1WF9A 2XK5B 4A20A 5G2NA 4EZJA 3DVNV 3APCA 4W9JA 2WX1A 1VCBA 2AYOB 3R3MA 1J8CA 2LWPA 4EZKA 2ZNVC 5AZHA 3OJ3A 3V60A 1V49A 3ZVVA 3QWZB 3TCAA 3DBLI 2JWZA 2KFKB 3BINA 2XK5A 2PEAA 4JIOU 3ZDTA 3DQVA 4JQWC 1QZEA 3KUCB 1YQBA 3GOEA 2ZPYA 3PZDA 5LXHA 1KLVA 2L8JA 1GNUA 2HTHA 2JPHA 4KZCA 1HE8A 2VRRB 2DZIA 2KFKA 2PJHA 1D3ZA 3PREA 2QHOA 1WJ6A 2JZ3B 4KVGB 2K6QA 3QJZA 1OEYA 1OEYJ 2YVCA 2G4DB 2L05A 3EECA 4TV3A 5KHOA 2MCNB 4CO7A 2MSED 2DX5B 2LUEA
chains in the Genus database with same CATH superfamily
3L08A 5C1ZA 1FEHA 1UZXB 3DHGC 1BXTA 2W9NA 2JVCA 1I4HA 1F0ZA 1JWSD 1WGHA 3HVDA 2ZW1A 3WAOA 3W5VB 3TMPB 2JUOA 2W54A 4WH4A 2J0MA 3ML8A 1GPXA 4C80A 4GN1A 3RCZA 4AQ7A 1E90A 1C3TA 1E7PB 1XCQL 3MHZA 3DHIC 3Q3JA 2WXQA 2N9LA 2W3SA 2X38A 1V81A 2M8SA 1YX6B 2R2OA 3B0AA 5JH5C 2G3QB 1IGDA 1LGRA 1WJNA 3QAQA 1JCKB 1FCCC 1MG8A 1E8WA 1LFDA 3ENEA 1L7YA 1R4NI 3NVYA 1B1ZA 3TJPA 4TQ1A 1SF0A 3ML9A 3EHVA 3R8BA 2PIAA 1DOIA 3PSEB 1XQQA 2MH7A 1Z2MA 3DPDA 3RZFA 2WXMA 5CHVC 5IAAC 2L1AA 2D3GA 2KMMA 1YOVB 5BYSA 5D94A 3R66C 5DPSA 3ZO5B 2LVPA 2SAKA 1QKZA 4HDOA 3RMKC 2BB5A 2LZ6A 4E74A 1ISNA 4LJPB 3PTFC 2X8XX 3WANA 2BYVE 1M4VA 3ZJUA 2WXLA 4GIVA 2KJHB 2PW9A 2REXA 3CWIA 2LXCA 2ZNVB 1WE6A 2KO3A 3U4EG 2W82A 2WX0A 4W9EA 3ZXRA 1H4RA 1P0RA 1VZ8A 1D5MC 4Q2JA 2UWQA 3CF6E 4FADA 3IT4B 4BOZB 3LB8C 1ZDVA 3W1SA 1G6JA 1IPGA 3UF8A 4BBNC 2INDC 3VTUA 2DLBA 4KDLB 2PVGC 1MHHE 2ASQA 2KD0A 5E6OA 1I4PA 2KZRA 5GXGB 2WXFA 4ZRJA 4LTUA 2NBWB 1S3SG 4GU2A 4AJYB 1L0VB 1OQRA 3RNEC 2GB1A 3FILB 2KT7A 2QDFA 2KLCA 2KN5A 1Q10A 3KVFB 4QAYA 1PGBA 4J3OD 4NAWA 3ZRFA 1WX8A 1GC7A 2JRHA 2K8BA 3MC0B 3Q3NC 4DBGA 1QF6A 4GSWA 4K3BA 5AUIA 1TTNA 1E9MA 4YSZB 3VUXA 2DZKA 4W9KA 1SE2A 5C23A 2SEBD 3AU5A 2WGSA 1TKYA 3AE5B 2MRPA 2MP2A 1Q5WB 2ZEQA 2NR2A 3A9KA 4A3OA 2OJRA 1OGWA 4DHZB 4OW0A 2GLSA 4OZBA 4A9AA 1UUPA 2KQ7A 2K25A 3CSFA 2PPHA 4HWIB 4ZYSA 1YN5A 3EA6A 1A70A 2INNE 1V8CA 1L6VA 4WURA 2PLPA 1ZXIA 1TT5B 3WAPA 4DWFA 4ARIA 2CS4A 1MHXA 4M8MA 5BMGA 1E7UA 2DYMA 2MBEA 1RFKA 1WM2A 2IY1B 3MJ5A 3L13A 2M0XA 1WR1A 2XNAC 4IKGA 4L1BA 1NVID 2V1YA 2N7JA 4K7WA 2K1FA 2HE7A 4FHJA 2LGXA 1UNSA 1TZOA 3BVMA 4DK5A 4YWGG 3I5JC 1T5XD 2JQRB 4ARCA 1VJKA 2AWTA 2WLBA 3DBRB 1KRHA 1WMHB 1JW9D 2ZCBA 2L83A 2KQSA 3H7PA 2LVQA 5C3JB 2MBOA 2WNMA 1MG4A 2CU3A 3CSTA 3KWVA 4L23A 5TR5A 3V6EB 2INCC 1TZ1A 3SFEB 4REZA 4AWJA 3DVNU 1VR9A 1N61A 1V86A 3QCAA 4IOIE 4RMAA 3TEZA 1JWBD 3BY4B 2N0SB 3O13A 4MJSA 3AEBB 4LDTB 4JGHB 5E6NA 3KH0A 2DZMA 4P7IA 2QCZA 4MGZE 1L0YB 5CTRC 5JXVA 1CMXB 4C7YA 2HJ1A 2YEPB 3IHPC 3P2BA 4FLHA 2RDHA 3DWGC 4WJOA 1ZW7A 4XC2A 5H92C 3AE3B 3U30A 4RM8A 4YL8A 3Q3MC 3PV1A 3TBLD 3JSVA 1V5TA 2EELA 2E3TA 2GBRA 2WS3B 1GUAB 2C7NB 4GOCA 2JSVX 3PHWB 2BTEA 3DVGX 2JXXA 3M3JA 2KX3A 3BK2A 2K0PA 2BB6A 3VUWA 3HK0A 4HCPB 2PMVA 2A5UA 4F8CB 3A4SC 4GB9A 3ETRA 2LVOA 3K9OB 1TS3A 3KYCD 3H9DA 4MT5A 4NAMA 3H1UA 1NDDA 3N9YC 3AH7A 5AZGA 3APDA 3WIMA 3W9CB 4ANVA 1C77A 4OVZA 3AM9A 5BYQA 1WWTA 2N1VA 5JHAA 1SXTA 4DHJB 1NI3A 5G55A 1KJTA 2GMIC 4HPPA 3VTVA 3Q14C 2JXTA 3ZJTA 1V1PA 1SSNA 1PQSA 1T0SC 1ZGUB 2GBMA 2MX2A 2FBWB 4HVBA 1K53A 1OFFA 2N9PC 4MGKE 3DVNV 3APCA 1VCBA 1C79A 2ZNVC 3V60A 3QWZB 2WXIA 2K5PA 2J4XA 2KFKB 2XN9C 3GB1A 1MI0A 3SEBA 2AX5A 3U7ZA 4LLGM 2ICIA 4H2AA 1T6BX 4LNNA 1YQBA 3GOEA 1KLVA 4XYCA 2HTHA 1GNUA 2JPHA 2VRRB 4N6EB 2DZIA 1KTKA 2QHOA 1WJ6A 4YT0B 1C4PA 2YVCA 2L05A 4TV3A 2ONQA 1TY2A 4RGMA 1VD2A 1BMLC 2DWQA 2DNFA 3VQIA 3M62B 3IT6B 4W9GA 4IM2A 4WIPA 3APFA 3ZRCA 1T0QC 3AV8A 1R4MI 3TIXA 3L17A 3ZDMC 1UD7A 4K7UA 3NOBA 1V2YA 2MJEA 2V3SA 3ZNID 4PYUA 2O2VB 2BF8B 1I4GA 1FNWA 2M0AA 2MQJA 1N6ZA 3E56A 4HLEA 2L52A 5HKHA 3DVGY 3Q8EA 3RZWC 2N1WA 3T9LA 1R4NB 1MJDA 4YSXB 3Q8AA 1T3QA 3PT2B 3HM6X 1J7BA 4MM3A 2LGIA 3HHMA 2KACA 4BFRA 1P7FA 4K7SA 2IPKD 4JLCA 1OTRB 3TSSA 1JRPA 1ZE3D 2BYTA 1F1HA 2D3BA 4BBNF 2ACZB 2NS5A 4M02A 4RH6A 3A1QA 5H8YE 2DAFA 3RT3B 4B9KA 1IUEA 4ZRPA 3Q3OC 2MBQA 4XDDA 4IDIA 3IAS1 4NJ7A 3WAMA 4HPLB 2N9XA 4IWPA 2WDRB 3PLUA 3NHEB 2PE6B 4GDLA 2BYEA 3DDCB 1M94A 2TSSA 3V61A 5EE9A 3VHTC 1WY8A 2KFJA 1V97A 2NPTB 1PDXA 3PRMB 4IWQA 4P6VF 5FR6A 2K8HA 5L95C 2V0GA 4NPNA 2V9HA 2J52A 4L2YA 1WJ4A 3RNBC 2W3RA 3FAHA 1SE9A 2FUHB 4BZAA 4M0WB 3OJ4B 2V3NA 1E8ZA 4II2B 3UINB 3P1MA 4ANWA 3UIPB 4PS7A 2K9XA 1KM7A 2AQ1B 2Q5WD 1WM3A 1QLBB 3B9JA 3A9JA 3LYYA 5L83A 3JVZX 4JWUC 5EE1A 4YTMB 4G11A 3T8MA 1ZKHA 3VFKA 3HVZA 1RFAA 2LGSA 3NVVA 2AL3A 3P4RB 3SDLC 2KWDA 4AP4C 2WXKA 1KLGD 4BKSA 1DOYA 2RR9A 3Q69A 2GBJA 2BW2A 4LJOB 5AZFA 5D7GA 2XBBC 2JT4B 1HZ6A 2KDIA 3RNAC 3NZUA 1IBXA 2KTRA 2O6VA 3B1LX 1CJEA 2UU7A 3QARA 1D5XC 3ALBA 3V62A 4EKUA 1SIFA 2KMAA 4JE3B 1ESFA 1EU4A 4OVVA 2M19A 3C19A 3SR6A 4YSYB 1QILA 4BAXA 2L32A 1P7EA 3N1XC 3URYA 4MELA 3HUIA 2BKFA 4RCOA 3IFWB 2BWFA 2AQ2B 3DBHI 2MW5A 2WHIA 3MFGA 1NEKB 1V1PB 1XO3A 2N7EA 4URKA 1WYGA 3K9PB 4RF0A 1WR6E 2BBCA 3JW0X 1A5RA 1Q1OA 4PK1A 1GG3A 4HXDA 4TMAB 2KQ4X 4HRSA 1XLOA 1Y8RC 4HCNB 4W9LA 3E9SA 1I42A 4GDKB 3QHTA 5LNK1 1SBBB 3RNGC 5LXIB 2EMSA 1E8YA 4C4VB 2N9EB 2CHXA 4F1SA 4WWMA 1UGMA 1Y56A 3S2AA 5JHBA 1Q0WB 3W1SC 2I38A 3VXWA 4ZYNA 3PVLA 1E8XA 2KJRA 1MFWA 4DXFA 1WXSA 1KH0A 1F2RC 5D3DA 1ZOYB 1TY0A 2HJ8A 3ZNGC 2WDQB 5T8IA 3AI5A 2GRIA 4G3XB 5J18A 1C1YB 1SEBD 2NTTA 3U2SC 4WJPA 5J17A 5BO4B 1DOXA 1NYRA 3AXCA 2DENB 2QILA 1RLFA 2ON8A 3D32A 1EWCA 2RPVA 3ZW3A 2WXGA 3Q8FA 1WX7A 1N63A 2OEDA 3R7RA 1ZP0B 1HTOA 3ZGZA 1YJ1A 2DAJA 3OAWA 2DYBA 1C78A 1RM6C 3J9CA 2R61A 1UWXA 2CU1A 2ZW0A 4JPSA 4MH0E 2PTLA 3VR8B 4E3CA 3L16A 3V6CB 1RYJA 3SHQA 1FNUA 1XLPA 2WDTB 1UBIA 1WXQA 2WQYB 1XT9B 1L6UA 1STEA 1QOGA 3AECB 1FIQA 3ZTCA 1PUTA 4RF1A 3DWMA 2WDVB 4HPMB 4BKGA 1HTQA 2LRUA 2XEWA 4YXDB 4M8NA 3L54A 3Q8CA 5KHQA 3N20C 4GMVA 2HD5B 1EO6A 1LO5D 1X1MA 3VRAB 2DBYA 4A55A 1WXVA 1UGJA 3BVGA 2D2QA 3Q6BA 2IO3B 3H7SA 1MVKA 2C5LC 2RPQA 4DDGD 1KOTA 2FIFA 2KAJA 2GI9A 1NENB 4EFOA 1WF9A 4A20A 5G2NA 4YTPB 2G1EA 2E6XA 1CK1A 1VLBA 3NVZA 3PZ7A 5FK9C 2LJIA 2LWPA 1I7HA 2JU6X 1XEEA 3OJ3A 1V49A 3FC4A 2XK5A 2PEAA 4O1NA 4P1CC 4JQWC 3KUCB 5LXHA 2L8JA 4ZHOA 3PREA 2JZ3B 4RGNA 4ACFA 2VH2A 3GZNB 2G4DB 2MCNB 1VDVA 4CO7A 1D6EC 3N1YC 3T3NA 2LUEA 1FCLA 4MDKE 2NCNA 4WQMA 2ZZPB 4EUTA 2Z0DB 2I1JA 4C00A 1P98A 3U52E 1I35A 1WH3A 1N60A 4RM9A 2L3ZA 4WQOB 5HI1A 2BT6A 4RGOS 3EFUA 4KKIA 2LJ5A 3HIZA 2MJDA 3AEFB 2FCNA 2DHZA 2K39A 1R7SA 2RDGA 4KGRA 4MSQB 1MPEA 3P4QB 5J2RA 2FAZA 2D3AA 3BVZA 2RMMA 4WWNA 5DPWA 4BKSD 4FXCA 1I4XA 3L0WB 2JYTA 1I4QA 5E6PA 3ZLZA 1VRAB 3I57A 3B08A 4I6PA 2O6VD 3M95A 2BKRB 2ZCCA 3VUYA 4E71A 3UIOB 1YJJA 3W1YA 5FR3A 1NBFC 1WYWB 2KOXA 4XX5A 2Z59B 2FCSA 3L10B 3B2GA 5CHWA 4ICUA 2ZJDA 3R2TA 4NQLB 1D4BA 1K51A 2LEKA 1U4AA 4A6QA 4FJZA 1XD3B 1RAXA 3NY5A 5E6JA 3BYYB 4EZLA 2W55A 3U7DA 5AEKB 3IAM1 3C0RB 2JWUA 1V80A 2C60A 5HFYA 2EMTA 4PS3A 3KLSX 1S1QB 3U8ZA 2KNBA 1J0GA 4TUUA 1DGJA 4P16A 1B9RA 1ACCA 4LNIA 4B95A 2YEPF 3VRBB 4NJ6A 4B6WA 4IC7B 3QQ8B 2B76B 5DPTA 1LQBA 1AW7A 4I6NB 2D10A 2NVUI 2BWES 4II3B 3QC8B 4BVUC 3AEDB 4FA6A 2N9KA 2LXAA 3KUDB 3KYDD 2VZKD 2LMCA 1HEZE 2IGHA 4C56C 3PS6A 5C2TB 4FBJB 1WZ0A 2WP9B 2BS3B 2WXPA 2DYOA 3DHHC 4IWOA 2V4IB 4KV2A 4NAWB 2IBIB 1HXYD 1TS2A 1JWUD 1V1OA 2LRWA 3NJTA 2OJWA 3FILA 3KQ4A 2CJNA 4X57B 1EM7A 3O65B 1JMLA 3PPAA 2MEKA 3IVFA 2MP2B 3GE8C 2LHDA 3PGEA 1LXDA 4CQNA 3N32A 1UH6A 3QA8A 3A9KB 1ET9A 1EUVB 4KDIC 2K22A 2ZVNA 3UQBA 2I1KA 4KSLC 3BYTB 3ONSA 4ZRKA 2L0TA 5FKAC 1E6EB 3I63C 3GE3C 5G5GA 1ZXHA 3CIRB 3RPFC 2WWZA 2INPE 3AMZA 3BZDB 3GP7A 4TSSA 4W9HA 4ZRIA 1L5PA 4MH8A 1C9FA 2HTME 3OG5A 4A8XC 1TKGA 1FXIA 1WI0A 1F9JA 2J0JA 1SB3C 4NY0A 1RWSA 2ZPNA 2WU2B 3I9V1 4USAA 3NVWA 4HJGE 2CR5A 1V9JA 2QJLA 3T3OA 3P4SB 4AS1A 1ENFA 4K1RB 4R3DA 1T0YA 1JROA 1YN3A 1YQ4B 4NJCA 1QOFA 4OZAA 4ICVA 1WZ3A 3PHXB 3R7QA 5EDSA 3H7PB 1FM0D 1SIJA 4S17A 2L7RA 1PGAA 1L4DB 2KMCA 3VAWA 1SE3A 1C76A 2MBHA 1AARA 2I2YA 1WGDA 3EC8A 2D3CA 2Z8LA 2KDMA 1SE4A 5AUKA 2KTFA 2BVCA 3RYTA 5TSSA 3NRZA 1WMHA 3DBSA 2QSDA 4MJSB 1UBQA 2KJ6A 3AEAB 3MC8A 2RSUA 4XWTA 1F77A 4WJNA 2B3AA 2KDFB 2L0FA 1GAQB 1RRBA 2NBUA 3VTWA 3N1ZC 2GBKA 1F2RI 2IGDA 1NYQA 3A4RA 5I4DA 1HA5A 2C7HA 1WXAA 5IA7A 1E5WA 1FXAA 3VH3B 3FKYA 2UYZB 3NZSA 3L4PA 2KVZA 5BYRA 4NZLB 1JWAD 3JSVB 3OLMD 1WE7A 3AULA 1FXTB 2K3UA 2BPSA 2WXNA 3H8HA 4AUQC 4IW0A 1TYGB 4TKNA 4HDQA 3VVWB 2LFIA 2N7DA 2J0KA 2JZZA 1GJZA 1HQRD 1UWMA 2H88B 4PS8A 2D11A 2CKHB 3IXSA 1K8RB 4N58A 4GGQA 1UF0A 4M00A 2JY6A 1WX9A 4HJKA 3A33B 1LM8B 3WA0A 4P1BC 2FE8A 1AYFA 4KZ0A 1OQQA 2Y3AA 3TUOA 3VH4B 3AEGB 2JYEA 2L76A 2D5GA 2C7MB 3TEYA 4CHKA 1J7AA 4US9A 4WJQA 2BS2B 3M63B 4D2KA 2KN4A 2IJ0A 3BK1A 3Q2AC 3EUB2 4JX1C 3VR9B 4HK2A 4LNFA 1N5WA 3V05A 1T0RC 5D3IB 4XGAB 1TS5A 5AZHA 1XLNA 3TCAA 3DBLI 2JWZA 3BINA 3DQVA 1JALA 5IN7A 5G5HA 1QQRA 3PZDA 1E0ZA 4XDCA 1HE8A 2KFKA 1WGKA 2PJHA 1L4ZB 3ZYYX 4KVGB 1OEYA 2WU5B 1OEYJ 3RNCC 3EECA 3AE7B 5KHOA 1C4CA 2DX5B 4LNKA 1YMHE 1P1AA 4F7ZA 2D07B 4EZKA 2OOBB 2KWUB 1UELA 4FHKA 4KIKA 3X0WA 1E7VA 4B0EA 4W9CA 4DDID 3QK0A 1YNTE 2KVRA 2BGFA 3RUIB 1EF1A 1FO4A 2CHWA 3AEEB 4KSKC 4XWWA 2VH1A 1AWDA 3NZ3A 1FRRA 4RGTA 2GBNA 4EOYA 4CYEA 1TIFA 1TJEA 2MHJA 2M1MA 3ZKJC 2A4ZA 1C4AA 3SU8X 4MM3B 4W9DA 1P9DU 4MACA 3PRPB 1GC6A 4US8A 1XCTL 2O2VA 3MP9A 5EE0A 3P42A 4ZDVA 2LD9A 4DXGA 4BOSC 2KXJA 2WXHA 4WAFA 1V5OA 1YX5B 5GMVA 1PGXA 2LUMA 3RD2A 4TQ0A 4ZOHC 2BQQA 3W5UB 1XXGA 3A1QB 5IP4D 4G50A 2MWSB 1KLUD 2G4SA 3C8YA 5HG2A 2LASA 1WGYA 2FUG1 2LGDA 4PT5A 1YD8U 2CHZA 1K52A 3JYUA 2KC2A 3AU4A 3ZIMA 1TGZB 3NUHB 2LI5A 2Y5BB 1N5XA 4RFBA 3TEXA 5DPRA 4GDLB 1L2NA 4A3PA 1ZDXA 3I3TB 2IO2B 1WXMA 4KKJA 3Q8BA 4FJVB 1D5ZC 1IGCA 3IBEA 3OWEB 2V4LA 3Q3FA 3PO0A 3N3KB 1WRDB 1PFDA 1PYWD 3MC9A 2LHEA 4JWSC 1Z5SB 2IO0B 3ZQ4A 3HRDD 3PZ8A 2MLBA 4LNOA 2JRIB 3EGRA 2OHFA 3AE8B 3LDZE 1JQ4A 4ASWC 1HZ5A 2AEHA 3KWLA 2NPTA 2H89B 5BMHA 4N59A 4IG7B 2KHWB 2GOWA 4ANXA 3A9JB 3AB5A 4W9FA 3BIID 4WWPA 2DZJA 3DCGA 1QOBA 3KW5B 3SD5A 2R2QA 4J6IA 3ZTDA 1F52A 4M0WA 1R4MB 1J19A 3ZUNA 4GXBA 1WFYA 3DOWA 3RN9C 4ZHPA 4LCDE 4K3CA 4BKTA 2KK8A 2V3PA 4ANUA 3W2DA 4LDTD 1IBXB 1JWMD 2KTRB 2IZVB 2O6VB 1IP9A 3ZXVA 3UQAA 3AE6B 2G9HD 1EF5A 2EKIA 1CQVA 2M4NA 1BUIC 3TEWA 2NTSA 3ABVB 4OVUA 4NQKE 3MTNB 3NS1A 1WIAA 1ZPSA 3HM3A 3AN1A 3UGBB 2NBVB 3WCQA 4MGYE 5CHFA 1FFUA 2YLMA 3AE2B 2PE9A 1NI2A 5IOIA 4DHZE 2MA9B 3WALA 1GB4A 3RNFC 1BT0A 3QX1A 1AN8A 4MSMB 4HKQA 3MJWA 3BWUD 3GS2A 1FFVA 3QIJA 5LLIA 4S0RA 1N62A 4PYZA 3PLVA 2AQ3B 4GLSC 1XF5L 2QC8A 1QOAA 1ZUD2 1H8CA 2WXJA 2EKEC 3UI3A 4XE0A 2FNJB 3V3XA 1KFYB 2MBBB 4OHJA 4HROA 2KKCA 3RI7C 4AJWA 2WYQA 3RULA 2FCMA 4EEWA 2J53A 4HEA1 1YJIA 4ITKA 2QIEB 2L00B 1EU3A 2RDBC 4DHJD 1GB1A 1K50A 2WXRA 2KLGA 4I6LB 1I4RA 2N4FA 4KGTA 4K81A 3ZJVA 1E10A 4EE2A 2RD0A 3N30A 1P3QU 5D2MB 4N9F4 2VZKB 2C9WB 4FJYA 3DBRI 4GDKA 2M56B 5MPOA 1SGHA 1L0XB 2MJ3A 1V6EA 3EFCA 3LXFA 2BYFA 2JF5A 4IM0A 4C4VA 4G0NB 4YTNB 2Y5PA 2ZVOA 2KWCA 4KX6B 1VZ6A 2RGFA 1WGRA 1CZPA 1TKEA 3GZNI 3P63A 4KIKB 3ZNZB 1SJHD 3LJ3A 4B0MA 3KUZA 1J7CA 2G45B 2KC1A 2HDEA 2KDEB 1WRIA 3SFDB 1WSPA 2KWVB 4OZCA 4NNJB 1XLQA 1QT9A 1WGGA 2FCQA 2K8CA 4JL9A 3IG3A 2J7QB 2Y5CA 1OQYA 2JX5A 2J42A 5EE3A 3TL5A 2JZPA 3ECIA 4MEMA 4FN2A 1EWYC 1FNVA 2IY0B 1YIWA 2KANA 1GOZA 3VDZA 1IYFA 3CMMB 3R2IA 2CJOA 1DYQA 5BMIA 4IUMB 4IM3A 3P4PB 5CX3A 4UDUC 4XZ4A 3H6NA 2NMQA 5JZEB 2KDBA 3PRZA 3AE9B 3NS8A 2QMTA 2Z0EB 4MGIE 4HKZE 3ZNHB 2WXOA 1TBEA 2IYDB 5IKCM 3MHSD 4WAAA 3DBHB 1SJED 2LGYA 5DCNA 3X23A 2FIDA 1JRUA 4WWOA 2IO1B 2M17A 1FMAD 4W9IA 2QEJC 4FULA 1WJUA 4RNAA 2KX0A 1YQ3B 2AL6A 1YN4A 4AOFA 3AE1B 4DXAB 4KGSA 5D6JB 4A90A 1ROEA 2PVOD 3B2FA 2K6DB 4EZJA 2XK5B 1TS4A 4W9JA 2WX1A 2AYOB 3R3MA 2KYWA 4DQOC 1J8CA 3DBLB 4LK0M 3ZVVA 2BS4B 3RFZB 5HHDG 2IGGA 4JIOU 3ZDTA 1KF6B 1QZEA 1VZ7A 2ZPYA 4KZCA 1FRDA 1FD6A 1D3ZA 1ET6A 4ZRQA 3NG0A 5IO9A 4C7ZA 1FPYA 2IDYA 2K6QA 3QJZA 3AE4B 4M01A 2MSED 2PKOA
chains in the Genus database with same CATH topology
3L08A 1P1AA 4MDKE 2NCNA 4F7ZA 1VD2A 5C1ZA 1UZXB 2ZZPB 2W9NA 3VQIA 2D07B 2JVCA 4EUTA 2OOBB 2KWUB 1UELA 2Z0DB 2I1JA 3M62B 4IM2A 4W9GA 1WGHA 4FHKA 1P98A 4KIKA 3WAOA 3TMPB 3X0WA 3APFA 1E7VA 1I35A 1WH3A 2JUOA 4W9CA 4DDID 2J0MA 3ZRCA 3QK0A 4RM9A 2L3ZA 3ML8A 4WQOB 2KVRA 2BGFA 4GN1A 3RCZA 1R4MI 3RUIB 3TIXA 1E90A 3L17A 1C3TA 1EF1A 3EFUA 3ZDMC 1UD7A 2CHWA 2LJ5A 3HIZA 4KSKC 3Q3JA 2FCNA 4K7UA 3NOBA 2DHZA 1V2YA 2K39A 1V81A 2GBNA 4EOYA 4CYEA 2V3SA 2M8SA 1YX6B 4MSQB 4PYUA 3ZNID 2O2VB 2BF8B 2R2OA 3B0AA 2M1MA 5J2RA 2FAZA 3ZKJC 5JH5C 4WWNA 2A4ZA 2G3QB 3SU8X 5DPWA 4BKSD 1WJNA 4W9DA 2MQJA 3QAQA 1P9DU 4HLEA 3PRPB 1GC6A 5HKHA 3DVGY 3L0WB 1MG8A 1E8WA 3RZWC 2O2VA 2N1WA 5E6PA 3T9LA 3ZLZA 1LFDA 4ZDVA 3ENEA 1R4NI 1L7YA 2LD9A 3PT2B 3HM6X 3B08A 4I6PA 3TJPA 4TQ1A 4MM3A 4BOSC 2O6VD 3M95A 2BKRB 2KXJA 3ML9A 3EHVA 3HHMA 2ZCCA 3VUYA 1V5OA 1YX5B 5GMVA 4E71A 3UIOB 3PSEB 1XQQA 3RD2A 4BFRA 4TQ0A 3W1YA 4K7SA 1NBFC 1WYWB 3A1QB 1Z2MA 3DPDA 4JLCA 4G50A 1OTRB 2MWSB 2G4SA 3RZFA 5CHVC 2KOXA 4XX5A 5IAAC 2Z59B 2LASA 4MEMA 1WGYA 2FCSA 2D3GA 3L10B 4BBNF 2LGDA 2NS5A 5CHWA 4ICUA 1YD8U 2ZJDA 5D94A 4NQLB 2CHZA 3A1QA 3JYUA 2KC2A 3R66C 5DPSA 3AU4A 3ZO5B 2LVPA 3ZIMA 1TGZB 4HDOA 2DAFA 1U4AA 3RT3B 2LI5A 4B9KA 2Y5BB 4FJZA 1XD3B 2MBQA 1RAXA 2LZ6A 4E74A 3NY5A 1ISNA 4LJPB 5DPRA 3PTFC 4EZLA 4GDLB 3U7DA 3WANA 2BYVE 1L2NA 4A3PA 4NJ7A 3WAMA 3I3TB 5AEKB 4HPLB 2N9XA 4IWPA 4GIVA 3C0RB 3PLUA 1V80A 2C60A 1WXMA 2IO2B 2KJHB 2REXA 3NHEB 2PE6B 2EMTA 2LXCA 2ZNVB 3IBEA 4FJVB 1WE6A 4PS3A 2V4LA 1S1QB 2KO3A 3Q3FA 4GDLA 3U8ZA 3N3KB 2BYEA 3DDCB 1WRDB 2KNBA 1J0GA 2WX0A 4W9EA 1M94A 1H4RA 4TUUA 3V61A 1Z5SB 1P0RA 2IO0B 3VHTC 1WY8A 2UWQA 2KFJA 4B95A 2MLBA 4NJ6A 2NPTB 2JRIB 4IC7B 4B6WA 3CF6E 3PRMB 4FADA 4BOZB 4IWQA 5FR6A 3LDZE 3QQ8B 2K8HA 5DPTA 3W1SA 1IPGA 5L95C 1G6JA 1LQBA 3UF8A 4NPNA 4I6NB 2D10A 2NVUI 2BWES 4BBNC 4II3B 3VTUA 4ASWC 3QC8B 4BVUC 2AEHA 1WJ4A 2NPTA 4KDLB 4FA6A 2LXAA 1SE9A 4IG7B 2ASQA 2KHWB 2GOWA 3KUDB 2FUHB 3KYDD 2KD0A 5E6OA 4ANXA 3A9JB 4M0WB 3OJ4B 2KZRA 1E8ZA 4ZRJA 4II2B 3UINB 4W9FA 4ANWA 2NBWB 4WWPA 3UIPB 2DZJA 4PS7A 3PS6A 3DCGA 1S3SG 4GU2A 3KW5B 3SD5A 4AJYB 2R2QA 4J6IA 1KM7A 4FBJB 1WM3A 1WZ0A 3ZTDA 3A9JA 5L83A 2DYOA 3JVZX 1J19A 4IWOA 4KV2A 2KLCA 4NAWB 4G11A 4GXBA 1ZKHA 3T8MA 2IBIB 3ZUNA 1WFYA 3DOWA 2KN5A 3VFKA 1RFAA 4LCDE 2LRWA 3KVFB 2AL3A 4BKTA 2KK8A 4X57B 4ANUA 3SDLC 4NAWA 3ZRFA 4AP4C 4LDTD 4BKSA 2KTRB 1WX8A 2IZVB 2O6VB 1GC7A 1IP9A 3UQAA 2JRHA 2RR9A 3O65B 2GBJA 1EF5A 4LJOB 2M4NA 2K8BA 5AZFA 5D7GA 2XBBC 3PPAA 2JT4B 2KDIA 4OVUA 4NQKE 4DBGA 3MTNB 3NZUA 2KTRA 2MP2B 2O6VA 3B1LX 1WIAA 3IVFA 1LXDA 3PGEA 3HM3A 3N32A 1UH6A 3QA8A 3QARA 4GSWA 1TTNA 3A9KB 3UGBB 2NBVB 3VUXA 4MGYE 1EUVB 2DZKA 3ALBA 4KDIC 4W9KA 5CHFA 3V62A 2YLMA 5C23A 2PE9A 2ZVNA 4EKUA 1NI2A 3AU5A 1SIFA 4DHZE 3UQBA 2I1KA 4KSLC 2MRPA 2MA9B 2MP2A 2KMAA 3ONSA 4ZRKA 4OVVA 1Q5WB 3WALA 2ZEQA 2L0TA 2NR2A 1BT0A 3A9KA 3QX1A 4A3OA 4MSMB 2OJRA 1OGWA 2WWZA 3MJWA 4DHZB 4ZRIA 4W9HA 2KQ7A 2K25A 3CSFA 3QIJA 5LLIA 2PPHA 4HWIB 4MELA 2BKFA 1WI0A 4PYZA 1F9JA 2J0JA 4NY0A 3PLVA 3IFWB 2BWFA 3DBHI 2MW5A 3WAPA 4DWFA 1H8CA 2ZPNA 2CS4A 2EKEC 2FNJB 2MBBB 2N7EA 1E7UA 2DYMA 2MBEA 4M8MA 4URKA 2KKCA 2CR5A 1WM2A 3K9PB 2IY1B 1V9JA 4AJWA 1WR6E 2WYQA 3JW0X 3RULA 2FCMA 1A5RA 3L13A 1Q1OA 2M0XA 1WR1A 4EEWA 1GG3A 4HXDA 4K1RB 2V1YA 4K7WA 1T0YA 2K1FA 1Y8RC 2HE7A 2L00B 4FHJA 2LGXA 4HCNB 4W9LA 4ICVA 4DHJD 1WZ3A 3PHXB 4GDKB 1I42A 3QHTA 3R7QA 5EDSA 3H7PB 4I6LB 2KLGA 2N4FA 2L7RA 4K81A 4DK5A 2RD0A 3N30A 1P3QU 5D2MB 4N9F4 2EMSA 5LXIB 1E8YA 2AWTA 2KMCA 3VAWA 2N9EB 2CHXA 2C9WB 4FJYA 1UGMA 1WMHB 1AARA 2MBHA 4F1SA 1WGDA 3DBRI 4GDKA 2ZCBA 3S2AA 1SGHA 2KQSA 3H7PA 2LVQA 3EC8A 5JHBA 1Q0WB 2MBOA 1V6EA 3W1SC 2BYFA 2KTFA 2JF5A 3CSTA 4IM0A 3RYTA 5TR5A 3V6EB 3VXWA 4G0NB 4ZYNA 1WMHA 3DBSA 3PVLA 2ZVOA 2KWCA 4MJSB 1TZ1A 1E8XA 1UBQA 2KJRA 2KJ6A 4AWJA 3DVNU 2RSUA 2RGFA 4WJNA 1V86A 1WGRA 1WXSA 2B3AA 2KDFB 2L0FA 3QCAA 1RRBA 2NBUA 3VTWA 4RMAA 2GBKA 3GZNI 3BY4B 2HJ8A 4MJSA 3ZNGC 4KIKB 4LDTB 3ZNZB 3A4RA 3AI5A 4JGHB 4G3XB 3LJ3A 3KH0A 1C1YB 2DZMA 3KUZA 2G45B 4P7IA 5E6NA 5J18A 2C7HA 1WXAA 2KC1A 4MGZE 4WJPA 1CMXB 2KDEB 1E5WA 5CTRC 3VH3B 5IA7A 5J17A 2KWVB 2UYZB 3NZSA 5BO4B 3IHPC 4NNJB 3P2BA 4FLHA 1WGGA 3AXCA 2DENB 3JSVB 1ZW7A 3OLMD 4WJOA 4XC2A 2FCQA 1WE7A 2K8CA 1RLFA 3AULA 4JL9A 1FXTB 3IG3A 3D32A 2J7QB 3ZW3A 1OQYA 1WX7A 3U30A 2BPSA 4RM8A 4YL8A 3R7RA 3PV1A 3TBLD 4AUQC 4IW0A 3JSVA 3TL5A 1V5TA 4TKNA 1YJ1A 4HDQA 2DAJA 2GBRA 3OAWA 1GUAB 2C7NB 4GOCA 3VVWB 2DYBA 3PHWB 2N7DA 3DVGX 2JXXA 2J0KA 3ECIA 2IY0B 4FN2A 3M3JA 1YIWA 2JZZA 2KX3A 2KANA 1GJZA 2CU1A 3VDZA 1IYFA 3CMMB 3VUWA 4IUMB 3HK0A 4HCPB 4PS8A 4IM3A 2D11A 4MH0E 5CX3A 4XZ4A 4E3CA 2CKHB 2A5UA 3H6NA 3L16A 3V6CB 3SHQA 5JZEB 4F8CB 3A4SC 1K8RB 2KDBA 4GB9A 3PRZA 4GGQA 3NS8A 2LVOA 3K9OB 2Z0EB 2JY6A 1WX9A 2WDTB 4MGIE 3KYCD 1UBIA 3H9DA 3ZNHB 4HJKA 3A33B 1LM8B 3WA0A 1XT9B 3ZTCA 3H1UA 1TBEA 1NDDA 2IYDB 5AZGA 3APDA 3MHSD 4WAAA 3WIMA 4HPMB 4KZ0A 2LGYA 5DCNA 3X23A 4ANVA 2FIDA 2LRUA 2XEWA 4BKGA 1JRUA 4M8NA 4WWOA 3L54A 2IO1B 2M17A 3VH4B 4W9IA 4FULA 5KHQA 2L76A 1WJUA 2N1VA 5JHAA 2KX0A 4DHJB 2C7MB 2AL6A 4GMVA 2HD5B 5G55A 1EO6A 1KJTA 2GMIC 3VTVA 4AOFA 4CHKA 4DXAB 1X1MA 5D6JB 1WXVA 4WJQA 3M63B 2D2QA 1PQSA 2IO3B 3H7SA 1ZGUB 2GBMA 2MX2A 2C5LC 2RPQA 4DDGD 1KOTA 2FIFA 4EFOA 4HK2A 4HVBA 2K6DB 2N9PC 4MGKE 1WF9A 2XK5B 4A20A 5G2NA 4EZJA 3DVNV 3APCA 4W9JA 2WX1A 1VCBA 2AYOB 3R3MA 1J8CA 2LWPA 4EZKA 2ZNVC 5AZHA 3OJ3A 3V60A 1V49A 3ZVVA 3QWZB 3TCAA 3DBLI 2JWZA 2KFKB 3BINA 2XK5A 2PEAA 4JIOU 3ZDTA 3DQVA 4JQWC 1QZEA 3KUCB 1YQBA 3GOEA 2ZPYA 3PZDA 5LXHA 1KLVA 2L8JA 1GNUA 2HTHA 2JPHA 4KZCA 1HE8A 2VRRB 2DZIA 2KFKA 2PJHA 1D3ZA 3PREA 2QHOA 1WJ6A 2JZ3B 4KVGB 2K6QA 3QJZA 1OEYA 1OEYJ 2YVCA 2G4DB 2L05A 3EECA 4TV3A 5KHOA 2MCNB 4CO7A 2MSED 2DX5B 2LUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L08 A;  1P1A A;  4MDK E;  2NCN A;  4F7Z A;  1VD2 A;  5C1Z A;  1UZX B;  2ZZP B;  2W9N A;  3VQI A;  2D07 B;  2JVC A;  4EUT A;  2OOB B;  2KWU B;  1UEL A;  2Z0D B;  2I1J A;  3M62 B;  4IM2 A;  4W9G A;  1WGH A;  4FHK A;  1P98 A;  4KIK A;  3WAO A;  3TMP B;  3X0W A;  3APF A;  1E7V A;  1I35 A;  1WH3 A;  2JUO A;  4W9C A;  4DDI D;  2J0M A;  3ZRC A;  3QK0 A;  4RM9 A;  2L3Z A;  3ML8 A;  4WQO B;  2KVR A;  2BGF A;  4GN1 A;  3RCZ A;  1R4M I;  3RUI B;  3TIX A;  1E90 A;  3L17 A;  1C3T A;  1EF1 A;  3EFU A;  3ZDM C;  1UD7 A;  2CHW A;  2LJ5 A;  3HIZ A;  4KSK C;  3Q3J A;  2FCN A;  4K7U A;  3NOB A;  2DHZ A;  1V2Y A;  2K39 A;  1V81 A;  2GBN A;  4EOY A;  4CYE A;  2V3S A;  2M8S A;  1YX6 B;  4MSQ B;  4PYU A;  3ZNI D;  2O2V B;  2BF8 B;  2R2O A;  3B0A A;  2M1M A;  5J2R A;  2FAZ A;  3ZKJ C;  5JH5 C;  4WWN A;  2A4Z A;  2G3Q B;  3SU8 X;  5DPW A;  4BKS D;  1WJN A;  4W9D A;  2MQJ A;  3QAQ A;  1P9D U;  4HLE A;  3PRP B;  1GC6 A;  5HKH A;  3DVG Y;  3L0W B;  1MG8 A;  1E8W A;  3RZW C;  2O2V A;  2N1W A;  5E6P A;  3T9L A;  3ZLZ A;  1LFD A;  4ZDV A;  3ENE A;  1R4N I;  1L7Y A;  2LD9 A;  3PT2 B;  3HM6 X;  3B08 A;  4I6P A;  3TJP A;  4TQ1 A;  4MM3 A;  4BOS C;  2O6V D;  3M95 A;  2BKR B;  2KXJ A;  3ML9 A;  3EHV A;  3HHM A;  2ZCC A;  3VUY A;  1V5O A;  1YX5 B;  5GMV A;  4E71 A;  3UIO B;  3PSE B;  1XQQ A;  3RD2 A;  4BFR A;  4TQ0 A;  3W1Y A;  4K7S A;  1NBF C;  1WYW B;  3A1Q B;  1Z2M A;  3DPD A;  4JLC A;  4G50 A;  1OTR B;  2MWS B;  2G4S A;  3RZF A;  5CHV C;  2KOX A;  4XX5 A;  5IAA C;  2Z59 B;  2LAS A;  4MEM A;  1WGY A;  2FCS A;  2D3G A;  3L10 B;  4BBN F;  2LGD A;  2NS5 A;  5CHW A;  4ICU A;  1YD8 U;  2ZJD A;  5D94 A;  4NQL B;  2CHZ A;  3A1Q A;  3JYU A;  2KC2 A;  3R66 C;  5DPS A;  3AU4 A;  3ZO5 B;  2LVP A;  3ZIM A;  1TGZ B;  4HDO A;  2DAF A;  1U4A A;  3RT3 B;  2LI5 A;  4B9K A;  2Y5B B;  4FJZ A;  1XD3 B;  2MBQ A;  1RAX A;  2LZ6 A;  4E74 A;  3NY5 A;  1ISN A;  4LJP B;  5DPR A;  3PTF C;  4EZL A;  4GDL B;  3U7D A;  3WAN A;  2BYV E;  1L2N A;  4A3P A;  4NJ7 A;  3WAM A;  3I3T B;  5AEK B;  4HPL B;  2N9X A;  4IWP A;  4GIV A;  3C0R B;  3PLU A;  1V80 A;  2C60 A;  1WXM A;  2IO2 B;  2KJH B;  2REX A;  3NHE B;  2PE6 B;  2EMT A;  2LXC A;  2ZNV B;  3IBE A;  4FJV B;  1WE6 A;  4PS3 A;  2V4L A;  1S1Q B;  2KO3 A;  3Q3F A;  4GDL A;  3U8Z A;  3N3K B;  2BYE A;  3DDC B;  1WRD B;  2KNB A;  1J0G A;  2WX0 A;  4W9E A;  1M94 A;  1H4R A;  4TUU A;  3V61 A;  1Z5S B;  1P0R A;  2IO0 B;  3VHT C;  1WY8 A;  2UWQ A;  2KFJ A;  4B95 A;  2MLB A;  4NJ6 A;  2NPT B;  2JRI B;  4IC7 B;  4B6W A;  3CF6 E;  3PRM B;  4FAD A;  4BOZ B;  4IWQ A;  5FR6 A;  3LDZ E;  3QQ8 B;  2K8H A;  5DPT A;  3W1S A;  1IPG A;  5L95 C;  1G6J A;  1LQB A;  3UF8 A;  4NPN A;  4I6N B;  2D10 A;  2NVU I;  2BWE S;  4BBN C;  4II3 B;  3VTU A;  4ASW C;  3QC8 B;  4BVU C;  2AEH A;  1WJ4 A;  2NPT A;  4KDL B;  4FA6 A;  2LXA A;  1SE9 A;  4IG7 B;  2ASQ A;  2KHW B;  2GOW A;  3KUD B;  2FUH B;  3KYD D;  2KD0 A;  5E6O A;  4ANX A;  3A9J B;  4M0W B;  3OJ4 B;  2KZR A;  1E8Z A;  4ZRJ A;  4II2 B;  3UIN B;  4W9F A;  4ANW A;  2NBW B;  4WWP A;  3UIP B;  2DZJ A;  4PS7 A;  3PS6 A;  3DCG A;  1S3S G;  4GU2 A;  3KW5 B;  3SD5 A;  4AJY B;  2R2Q A;  4J6I A;  1KM7 A;  4FBJ B;  1WM3 A;  1WZ0 A;  3ZTD A;  3A9J A;  5L83 A;  2DYO A;  3JVZ X;  1J19 A;  4IWO A;  4KV2 A;  2KLC A;  4NAW B;  4G11 A;  4GXB A;  1ZKH A;  3T8M A;  2IBI B;  3ZUN A;  1WFY A;  3DOW A;  2KN5 A;  3VFK A;  1RFA A;  4LCD E;  2LRW A;  3KVF B;  2AL3 A;  4BKT A;  2KK8 A;  4X57 B;  4ANU A;  3SDL C;  4NAW A;  3ZRF A;  4AP4 C;  4LDT D;  4BKS A;  2KTR B;  1WX8 A;  2IZV B;  2O6V B;  1GC7 A;  1IP9 A;  3UQA A;  2JRH A;  2RR9 A;  3O65 B;  2GBJ A;  1EF5 A;  4LJO B;  2M4N A;  2K8B A;  5AZF A;  5D7G A;  2XBB C;  3PPA A;  2JT4 B;  2KDI A;  4OVU A;  4NQK E;  4DBG A;  3MTN B;  3NZU A;  2KTR A;  2MP2 B;  2O6V A;  3B1L X;  1WIA A;  3IVF A;  1LXD A;  3PGE A;  3HM3 A;  3N32 A;  1UH6 A;  3QA8 A;  3QAR A;  4GSW A;  1TTN A;  3A9K B;  3UGB B;  2NBV B;  3VUX A;  4MGY E;  1EUV B;  2DZK A;  3ALB A;  4KDI C;  4W9K A;  5CHF A;  3V62 A;  2YLM A;  5C23 A;  2PE9 A;  2ZVN A;  4EKU A;  1NI2 A;  3AU5 A;  1SIF A;  4DHZ E;  3UQB A;  2I1K A;  4KSL C;  2MRP A;  2MA9 B;  2MP2 A;  2KMA A;  3ONS A;  4ZRK A;  4OVV A;  1Q5W B;  3WAL A;  2ZEQ A;  2L0T A;  2NR2 A;  1BT0 A;  3A9K A;  3QX1 A;  4A3O A;  4MSM B;  2OJR A;  1OGW A;  2WWZ A;  3MJW A;  4DHZ B;  4ZRI A;  4W9H A;  2KQ7 A;  2K25 A;  3CSF A;  3QIJ A;  5LLI A;  2PPH A;  4HWI B;  4MEL A;  2BKF A;  1WI0 A;  4PYZ A;  1F9J A;  2J0J A;  4NY0 A;  3PLV A;  3IFW B;  2BWF A;  3DBH I;  2MW5 A;  3WAP A;  4DWF A;  1H8C A;  2ZPN A;  2CS4 A;  2EKE C;  2FNJ B;  2MBB B;  2N7E A;  1E7U A;  2DYM A;  2MBE A;  4M8M A;  4URK A;  2KKC A;  2CR5 A;  1WM2 A;  3K9P B;  2IY1 B;  1V9J A;  4AJW A;  1WR6 E;  2WYQ A;  3JW0 X;  3RUL A;  2FCM A;  1A5R A;  3L13 A;  1Q1O A;  2M0X A;  1WR1 A;  4EEW A;  1GG3 A;  4HXD A;  4K1R B;  2V1Y A;  4K7W A;  1T0Y A;  2K1F A;  1Y8R C;  2HE7 A;  2L00 B;  4FHJ A;  2LGX A;  4HCN B;  4W9L A;  4ICV A;  4DHJ D;  1WZ3 A;  3PHX B;  4GDK B;  1I42 A;  3QHT A;  3R7Q A;  5EDS A;  3H7P B;  4I6L B;  2KLG A;  2N4F A;  2L7R A;  4K81 A;  4DK5 A;  2RD0 A;  3N30 A;  1P3Q U;  5D2M B;  4N9F 4;  2EMS A;  5LXI B;  1E8Y A;  2AWT A;  2KMC A;  3VAW A;  2N9E B;  2CHX A;  2C9W B;  4FJY A;  1UGM A;  1WMH B;  1AAR A;  2MBH A;  4F1S A;  1WGD A;  3DBR I;  4GDK A;  2ZCB A;  3S2A A;  1SGH A;  2KQS A;  3H7P A;  2LVQ A;  3EC8 A;  5JHB A;  1Q0W B;  2MBO A;  1V6E A;  3W1S C;  2BYF A;  2KTF A;  2JF5 A;  3CST A;  4IM0 A;  3RYT A;  5TR5 A;  3V6E B;  3VXW A;  4G0N B;  4ZYN A;  1WMH A;  3DBS A;  3PVL A;  2ZVO A;  2KWC A;  4MJS B;  1TZ1 A;  1E8X A;  1UBQ A;  2KJR A;  2KJ6 A;  4AWJ A;  3DVN U;  2RSU A;  2RGF A;  4WJN A;  1V86 A;  1WGR A;  1WXS A;  2B3A A;  2KDF B;  2L0F A;  3QCA A;  1RRB A;  2NBU A;  3VTW A;  4RMA A;  2GBK A;  3GZN I;  3BY4 B;  2HJ8 A;  4MJS A;  3ZNG C;  4KIK B;  4LDT B;  3ZNZ B;  3A4R A;  3AI5 A;  4JGH B;  4G3X B;  3LJ3 A;  3KH0 A;  1C1Y B;  2DZM A;  3KUZ A;  2G45 B;  4P7I A;  5E6N A;  5J18 A;  2C7H A;  1WXA A;  2KC1 A;  4MGZ E;  4WJP A;  1CMX B;  2KDE B;  1E5W A;  5CTR C;  3VH3 B;  5IA7 A;  5J17 A;  2KWV B;  2UYZ B;  3NZS A;  5BO4 B;  3IHP C;  4NNJ B;  3P2B A;  4FLH A;  1WGG A;  3AXC A;  2DEN B;  3JSV B;  1ZW7 A;  3OLM D;  4WJO A;  4XC2 A;  2FCQ A;  1WE7 A;  2K8C A;  1RLF A;  3AUL A;  4JL9 A;  1FXT B;  3IG3 A;  3D32 A;  2J7Q B;  3ZW3 A;  1OQY A;  1WX7 A;  3U30 A;  2BPS A;  4RM8 A;  4YL8 A;  3R7R A;  3PV1 A;  3TBL D;  4AUQ C;  4IW0 A;  3JSV A;  3TL5 A;  1V5T A;  4TKN A;  1YJ1 A;  4HDQ A;  2DAJ A;  2GBR A;  3OAW A;  1GUA B;  2C7N B;  4GOC A;  3VVW B;  2DYB A;  3PHW B;  2N7D A;  3DVG X;  2JXX A;  2J0K A;  3ECI A;  2IY0 B;  4FN2 A;  3M3J A;  1YIW A;  2JZZ A;  2KX3 A;  2KAN A;  1GJZ A;  2CU1 A;  3VDZ A;  1IYF A;  3CMM B;  3VUW A;  4IUM B;  3HK0 A;  4HCP B;  4PS8 A;  4IM3 A;  2D11 A;  4MH0 E;  5CX3 A;  4XZ4 A;  4E3C A;  2CKH B;  2A5U A;  3H6N A;  3L16 A;  3V6C B;  3SHQ A;  5JZE B;  4F8C B;  3A4S C;  1K8R B;  2KDB A;  4GB9 A;  3PRZ A;  4GGQ A;  3NS8 A;  2LVO A;  3K9O B;  2Z0E B;  2JY6 A;  1WX9 A;  2WDT B;  4MGI E;  3KYC D;  1UBI A;  3H9D A;  3ZNH B;  4HJK A;  3A33 B;  1LM8 B;  3WA0 A;  1XT9 B;  3ZTC A;  3H1U A;  1TBE A;  1NDD A;  2IYD B;  5AZG A;  3APD A;  3MHS D;  4WAA A;  3WIM A;  4HPM B;  4KZ0 A;  2LGY A;  5DCN A;  3X23 A;  4ANV A;  2FID A;  2LRU A;  2XEW A;  4BKG A;  1JRU A;  4M8N A;  4WWO A;  3L54 A;  2IO1 B;  2M17 A;  3VH4 B;  4W9I A;  4FUL A;  5KHQ A;  2L76 A;  1WJU A;  2N1V A;  5JHA A;  2KX0 A;  4DHJ B;  2C7M B;  2AL6 A;  4GMV A;  2HD5 B;  5G55 A;  1EO6 A;  1KJT A;  2GMI C;  3VTV A;  4AOF A;  4CHK A;  4DXA B;  1X1M A;  5D6J B;  1WXV A;  4WJQ A;  3M63 B;  2D2Q A;  1PQS A;  2IO3 B;  3H7S A;  1ZGU B;  2GBM A;  2MX2 A;  2C5L C;  2RPQ A;  4DDG D;  1KOT A;  2FIF A;  4EFO A;  4HK2 A;  4HVB A;  2K6D B;  2N9P C;  4MGK E;  1WF9 A;  2XK5 B;  4A20 A;  5G2N A;  4EZJ A;  3DVN V;  3APC A;  4W9J A;  2WX1 A;  1VCB A;  2AYO B;  3R3M A;  1J8C A;  2LWP A;  4EZK A;  2ZNV C;  5AZH A;  3OJ3 A;  3V60 A;  1V49 A;  3ZVV A;  3QWZ B;  3TCA A;  3DBL I;  2JWZ A;  2KFK B;  3BIN A;  2XK5 A;  2PEA A;  4JIO U;  3ZDT A;  3DQV A;  4JQW C;  1QZE A;  3KUC B;  1YQB A;  3GOE A;  2ZPY A;  3PZD A;  5LXH A;  1KLV A;  2L8J A;  1GNU A;  2HTH A;  2JPH A;  4KZC A;  1HE8 A;  2VRR B;  2DZI A;  2KFK A;  2PJH A;  1D3Z A;  3PRE A;  2QHO A;  1WJ6 A;  2JZ3 B;  4KVG B;  2K6Q A;  3QJZ A;  1OEY A;  1OEY J;  2YVC A;  2G4D B;  2L05 A;  3EEC A;  4TV3 A;  5KHO A;  2MCN B;  4CO7 A;  2MSE D;  2DX5 B;  2LUE A; 
#chains in the Genus database with same CATH topology
 3L08 A;  5C1Z A;  1FEH A;  1UZX B;  3DHG C;  1BXT A;  2W9N A;  2JVC A;  1I4H A;  1F0Z A;  1JWS D;  1WGH A;  3HVD A;  2ZW1 A;  3WAO A;  3W5V B;  3TMP B;  2JUO A;  2W54 A;  4WH4 A;  2J0M A;  3ML8 A;  1GPX A;  4C80 A;  4GN1 A;  3RCZ A;  4AQ7 A;  1E90 A;  1C3T A;  1E7P B;  1XCQ L;  3MHZ A;  3DHI C;  3Q3J A;  2WXQ A;  2N9L A;  2W3S A;  2X38 A;  1V81 A;  2M8S A;  1YX6 B;  2R2O A;  3B0A A;  5JH5 C;  2G3Q B;  1IGD A;  1LGR A;  1WJN A;  3QAQ A;  1JCK B;  1FCC C;  1MG8 A;  1E8W A;  1LFD A;  3ENE A;  1L7Y A;  1R4N I;  3NVY A;  1B1Z A;  3TJP A;  4TQ1 A;  1SF0 A;  3ML9 A;  3EHV A;  3R8B A;  2PIA A;  1DOI A;  3PSE B;  1XQQ A;  2MH7 A;  1Z2M A;  3DPD A;  3RZF A;  2WXM A;  5CHV C;  5IAA C;  2L1A A;  2D3G A;  2KMM A;  1YOV B;  5BYS A;  5D94 A;  3R66 C;  5DPS A;  3ZO5 B;  2LVP A;  2SAK A;  1QKZ A;  4HDO A;  3RMK C;  2BB5 A;  2LZ6 A;  4E74 A;  1ISN A;  4LJP B;  3PTF C;  2X8X X;  3WAN A;  2BYV E;  1M4V A;  3ZJU A;  2WXL A;  4GIV A;  2KJH B;  2PW9 A;  2REX A;  3CWI A;  2LXC A;  2ZNV B;  1WE6 A;  2KO3 A;  3U4E G;  2W82 A;  2WX0 A;  4W9E A;  3ZXR A;  1H4R A;  1P0R A;  1VZ8 A;  1D5M C;  4Q2J A;  2UWQ A;  3CF6 E;  4FAD A;  3IT4 B;  4BOZ B;  3LB8 C;  1ZDV A;  3W1S A;  1G6J A;  1IPG A;  3UF8 A;  4BBN C;  2IND C;  3VTU A;  2DLB A;  4KDL B;  2PVG C;  1MHH E;  2ASQ A;  2KD0 A;  5E6O A;  1I4P A;  2KZR A;  5GXG B;  2WXF A;  4ZRJ A;  4LTU A;  2NBW B;  1S3S G;  4GU2 A;  4AJY B;  1L0V B;  1OQR A;  3RNE C;  2GB1 A;  3FIL B;  2KT7 A;  2QDF A;  2KLC A;  2KN5 A;  1Q10 A;  3KVF B;  4QAY A;  1PGB A;  4J3O D;  4NAW A;  3ZRF A;  1WX8 A;  1GC7 A;  2JRH A;  2K8B A;  3MC0 B;  3Q3N C;  4DBG A;  1QF6 A;  4GSW A;  4K3B A;  5AUI A;  1TTN A;  1E9M A;  4YSZ B;  3VUX A;  2DZK A;  4W9K A;  1SE2 A;  5C23 A;  2SEB D;  3AU5 A;  2WGS A;  1TKY A;  3AE5 B;  2MRP A;  2MP2 A;  1Q5W B;  2ZEQ A;  2NR2 A;  3A9K A;  4A3O A;  2OJR A;  1OGW A;  4DHZ B;  4OW0 A;  2GLS A;  4OZB A;  4A9A A;  1UUP A;  2KQ7 A;  2K25 A;  3CSF A;  2PPH A;  4HWI B;  4ZYS A;  1YN5 A;  3EA6 A;  1A70 A;  2INN E;  1V8C A;  1L6V A;  4WUR A;  2PLP A;  1ZXI A;  1TT5 B;  3WAP A;  4DWF A;  4ARI A;  2CS4 A;  1MHX A;  4M8M A;  5BMG A;  1E7U A;  2DYM A;  2MBE A;  1RFK A;  1WM2 A;  2IY1 B;  3MJ5 A;  3L13 A;  2M0X A;  1WR1 A;  2XNA C;  4IKG A;  4L1B A;  1NVI D;  2V1Y A;  2N7J A;  4K7W A;  2K1F A;  2HE7 A;  4FHJ A;  2LGX A;  1UNS A;  1TZO A;  3BVM A;  4DK5 A;  4YWG G;  3I5J C;  1T5X D;  2JQR B;  4ARC A;  1VJK A;  2AWT A;  2WLB A;  3DBR B;  1KRH A;  1WMH B;  1JW9 D;  2ZCB A;  2L83 A;  2KQS A;  3H7P A;  2LVQ A;  5C3J B;  2MBO A;  2WNM A;  1MG4 A;  2CU3 A;  3CST A;  3KWV A;  4L23 A;  5TR5 A;  3V6E B;  2INC C;  1TZ1 A;  3SFE B;  4REZ A;  4AWJ A;  3DVN U;  1VR9 A;  1N61 A;  1V86 A;  3QCA A;  4IOI E;  4RMA A;  3TEZ A;  1JWB D;  3BY4 B;  2N0S B;  3O13 A;  4MJS A;  3AEB B;  4LDT B;  4JGH B;  5E6N A;  3KH0 A;  2DZM A;  4P7I A;  2QCZ A;  4MGZ E;  1L0Y B;  5CTR C;  5JXV A;  1CMX B;  4C7Y A;  2HJ1 A;  2YEP B;  3IHP C;  3P2B A;  4FLH A;  2RDH A;  3DWG C;  4WJO A;  1ZW7 A;  4XC2 A;  5H92 C;  3AE3 B;  3U30 A;  4RM8 A;  4YL8 A;  3Q3M C;  3PV1 A;  3TBL D;  3JSV A;  1V5T A;  2EEL A;  2E3T A;  2GBR A;  2WS3 B;  1GUA B;  2C7N B;  4GOC A;  2JSV X;  3PHW B;  2BTE A;  3DVG X;  2JXX A;  3M3J A;  2KX3 A;  3BK2 A;  2K0P A;  2BB6 A;  3VUW A;  3HK0 A;  4HCP B;  2PMV A;  2A5U A;  4F8C B;  3A4S C;  4GB9 A;  3ETR A;  2LVO A;  3K9O B;  1TS3 A;  3KYC D;  3H9D A;  4MT5 A;  4NAM A;  3H1U A;  1NDD A;  3N9Y C;  3AH7 A;  5AZG A;  3APD A;  3WIM A;  3W9C B;  4ANV A;  1C77 A;  4OVZ A;  3AM9 A;  5BYQ A;  1WWT A;  2N1V A;  5JHA A;  1SXT A;  4DHJ B;  1NI3 A;  5G55 A;  1KJT A;  2GMI C;  4HPP A;  3VTV A;  3Q14 C;  2JXT A;  3ZJT A;  1V1P A;  1SSN A;  1PQS A;  1T0S C;  1ZGU B;  2GBM A;  2MX2 A;  2FBW B;  4HVB A;  1K53 A;  1OFF A;  2N9P C;  4MGK E;  3DVN V;  3APC A;  1VCB A;  1C79 A;  2ZNV C;  3V60 A;  3QWZ B;  2WXI A;  2K5P A;  2J4X A;  2KFK B;  2XN9 C;  3GB1 A;  1MI0 A;  3SEB A;  2AX5 A;  3U7Z A;  4LLG M;  2ICI A;  4H2A A;  1T6B X;  4LNN A;  1YQB A;  3GOE A;  1KLV A;  4XYC A;  2HTH A;  1GNU A;  2JPH A;  2VRR B;  4N6E B;  2DZI A;  1KTK A;  2QHO A;  1WJ6 A;  4YT0 B;  1C4P A;  2YVC A;  2L05 A;  4TV3 A;  2ONQ A;  1TY2 A;  4RGM A;  1VD2 A;  1BML C;  2DWQ A;  2DNF A;  3VQI A;  3M62 B;  3IT6 B;  4W9G A;  4IM2 A;  4WIP A;  3APF A;  3ZRC A;  1T0Q C;  3AV8 A;  1R4M I;  3TIX A;  3L17 A;  3ZDM C;  1UD7 A;  4K7U A;  3NOB A;  1V2Y A;  2MJE A;  2V3S A;  3ZNI D;  4PYU A;  2O2V B;  2BF8 B;  1I4G A;  1FNW A;  2M0A A;  2MQJ A;  1N6Z A;  3E56 A;  4HLE A;  2L52 A;  5HKH A;  3DVG Y;  3Q8E A;  3RZW C;  2N1W A;  3T9L A;  1R4N B;  1MJD A;  4YSX B;  3Q8A A;  1T3Q A;  3PT2 B;  3HM6 X;  1J7B A;  4MM3 A;  2LGI A;  3HHM A;  2KAC A;  4BFR A;  1P7F A;  4K7S A;  2IPK D;  4JLC A;  1OTR B;  3TSS A;  1JRP A;  1ZE3 D;  2BYT A;  1F1H A;  2D3B A;  4BBN F;  2ACZ B;  2NS5 A;  4M02 A;  4RH6 A;  3A1Q A;  5H8Y E;  2DAF A;  3RT3 B;  4B9K A;  1IUE A;  4ZRP A;  3Q3O C;  2MBQ A;  4XDD A;  4IDI A;  3IAS 1;  4NJ7 A;  3WAM A;  4HPL B;  2N9X A;  4IWP A;  2WDR B;  3PLU A;  3NHE B;  2PE6 B;  4GDL A;  2BYE A;  3DDC B;  1M94 A;  2TSS A;  3V61 A;  5EE9 A;  3VHT C;  1WY8 A;  2KFJ A;  1V97 A;  2NPT B;  1PDX A;  3PRM B;  4IWQ A;  4P6V F;  5FR6 A;  2K8H A;  5L95 C;  2V0G A;  4NPN A;  2V9H A;  2J52 A;  4L2Y A;  1WJ4 A;  3RNB C;  2W3R A;  3FAH A;  1SE9 A;  2FUH B;  4BZA A;  4M0W B;  3OJ4 B;  2V3N A;  1E8Z A;  4II2 B;  3UIN B;  3P1M A;  4ANW A;  3UIP B;  4PS7 A;  2K9X A;  1KM7 A;  2AQ1 B;  2Q5W D;  1WM3 A;  1QLB B;  3B9J A;  3A9J A;  3LYY A;  5L83 A;  3JVZ X;  4JWU C;  5EE1 A;  4YTM B;  4G11 A;  3T8M A;  1ZKH A;  3VFK A;  3HVZ A;  1RFA A;  2LGS A;  3NVV A;  2AL3 A;  3P4R B;  3SDL C;  2KWD A;  4AP4 C;  2WXK A;  1KLG D;  4BKS A;  1DOY A;  2RR9 A;  3Q69 A;  2GBJ A;  2BW2 A;  4LJO B;  5AZF A;  5D7G A;  2XBB C;  2JT4 B;  1HZ6 A;  2KDI A;  3RNA C;  3NZU A;  1IBX A;  2KTR A;  2O6V A;  3B1L X;  1CJE A;  2UU7 A;  3QAR A;  1D5X C;  3ALB A;  3V62 A;  4EKU A;  1SIF A;  2KMA A;  4JE3 B;  1ESF A;  1EU4 A;  4OVV A;  2M19 A;  3C19 A;  3SR6 A;  4YSY B;  1QIL A;  4BAX A;  2L32 A;  1P7E A;  3N1X C;  3URY A;  4MEL A;  3HUI A;  2BKF A;  4RCO A;  3IFW B;  2BWF A;  2AQ2 B;  3DBH I;  2MW5 A;  2WHI A;  3MFG A;  1NEK B;  1V1P B;  1XO3 A;  2N7E A;  4URK A;  1WYG A;  3K9P B;  4RF0 A;  1WR6 E;  2BBC A;  3JW0 X;  1A5R A;  1Q1O A;  4PK1 A;  1GG3 A;  4HXD A;  4TMA B;  2KQ4 X;  4HRS A;  1XLO A;  1Y8R C;  4HCN B;  4W9L A;  3E9S A;  1I42 A;  4GDK B;  3QHT A;  5LNK 1;  1SBB B;  3RNG C;  5LXI B;  2EMS A;  1E8Y A;  4C4V B;  2N9E B;  2CHX A;  4F1S A;  4WWM A;  1UGM A;  1Y56 A;  3S2A A;  5JHB A;  1Q0W B;  3W1S C;  2I38 A;  3VXW A;  4ZYN A;  3PVL A;  1E8X A;  2KJR A;  1MFW A;  4DXF A;  1WXS A;  1KH0 A;  1F2R C;  5D3D A;  1ZOY B;  1TY0 A;  2HJ8 A;  3ZNG C;  2WDQ B;  5T8I A;  3AI5 A;  2GRI A;  4G3X B;  5J18 A;  1C1Y B;  1SEB D;  2NTT A;  3U2S C;  4WJP A;  5J17 A;  5BO4 B;  1DOX A;  1NYR A;  3AXC A;  2DEN B;  2QIL A;  1RLF A;  2ON8 A;  3D32 A;  1EWC A;  2RPV A;  3ZW3 A;  2WXG A;  3Q8F A;  1WX7 A;  1N63 A;  2OED A;  3R7R A;  1ZP0 B;  1HTO A;  3ZGZ A;  1YJ1 A;  2DAJ A;  3OAW A;  2DYB A;  1C78 A;  1RM6 C;  3J9C A;  2R61 A;  1UWX A;  2CU1 A;  2ZW0 A;  4JPS A;  4MH0 E;  2PTL A;  3VR8 B;  4E3C A;  3L16 A;  3V6C B;  1RYJ A;  3SHQ A;  1FNU A;  1XLP A;  2WDT B;  1UBI A;  1WXQ A;  2WQY B;  1XT9 B;  1L6U A;  1STE A;  1QOG A;  3AEC B;  1FIQ A;  3ZTC A;  1PUT A;  4RF1 A;  3DWM A;  2WDV B;  4HPM B;  4BKG A;  1HTQ A;  2LRU A;  2XEW A;  4YXD B;  4M8N A;  3L54 A;  3Q8C A;  5KHQ A;  3N20 C;  4GMV A;  2HD5 B;  1EO6 A;  1LO5 D;  1X1M A;  3VRA B;  2DBY A;  4A55 A;  1WXV A;  1UGJ A;  3BVG A;  2D2Q A;  3Q6B A;  2IO3 B;  3H7S A;  1MVK A;  2C5L C;  2RPQ A;  4DDG D;  1KOT A;  2FIF A;  2KAJ A;  2GI9 A;  1NEN B;  4EFO A;  1WF9 A;  4A20 A;  5G2N A;  4YTP B;  2G1E A;  2E6X A;  1CK1 A;  1VLB A;  3NVZ A;  3PZ7 A;  5FK9 C;  2LJI A;  2LWP A;  1I7H A;  2JU6 X;  1XEE A;  3OJ3 A;  1V49 A;  3FC4 A;  2XK5 A;  2PEA A;  4O1N A;  4P1C C;  4JQW C;  3KUC B;  5LXH A;  2L8J A;  4ZHO A;  3PRE A;  2JZ3 B;  4RGN A;  4ACF A;  2VH2 A;  3GZN B;  2G4D B;  2MCN B;  1VDV A;  4CO7 A;  1D6E C;  3N1Y C;  3T3N A;  2LUE A;  1FCL A;  4MDK E;  2NCN A;  4WQM A;  2ZZP B;  4EUT A;  2Z0D B;  2I1J A;  4C00 A;  1P98 A;  3U52 E;  1I35 A;  1WH3 A;  1N60 A;  4RM9 A;  2L3Z A;  4WQO B;  5HI1 A;  2BT6 A;  4RGO S;  3EFU A;  4KKI A;  2LJ5 A;  3HIZ A;  2MJD A;  3AEF B;  2FCN A;  2DHZ A;  2K39 A;  1R7S A;  2RDG A;  4KGR A;  4MSQ B;  1MPE A;  3P4Q B;  5J2R A;  2FAZ A;  2D3A A;  3BVZ A;  2RMM A;  4WWN A;  5DPW A;  4BKS D;  4FXC A;  1I4X A;  3L0W B;  2JYT A;  1I4Q A;  5E6P A;  3ZLZ A;  1VRA B;  3I57 A;  3B08 A;  4I6P A;  2O6V D;  3M95 A;  2BKR B;  2ZCC A;  3VUY A;  4E71 A;  3UIO B;  1YJJ A;  3W1Y A;  5FR3 A;  1NBF C;  1WYW B;  2KOX A;  4XX5 A;  2Z59 B;  2FCS A;  3L10 B;  3B2G A;  5CHW A;  4ICU A;  2ZJD A;  3R2T A;  4NQL B;  1D4B A;  1K51 A;  2LEK A;  1U4A A;  4A6Q A;  4FJZ A;  1XD3 B;  1RAX A;  3NY5 A;  5E6J A;  3BYY B;  4EZL A;  2W55 A;  3U7D A;  5AEK B;  3IAM 1;  3C0R B;  2JWU A;  1V80 A;  2C60 A;  5HFY A;  2EMT A;  4PS3 A;  3KLS X;  1S1Q B;  3U8Z A;  2KNB A;  1J0G A;  4TUU A;  1DGJ A;  4P16 A;  1B9R A;  1ACC A;  4LNI A;  4B95 A;  2YEP F;  3VRB B;  4NJ6 A;  4B6W A;  4IC7 B;  3QQ8 B;  2B76 B;  5DPT A;  1LQB A;  1AW7 A;  4I6N B;  2D10 A;  2NVU I;  2BWE S;  4II3 B;  3QC8 B;  4BVU C;  3AED B;  4FA6 A;  2N9K A;  2LXA A;  3KUD B;  3KYD D;  2VZK D;  2LMC A;  1HEZ E;  2IGH A;  4C56 C;  3PS6 A;  5C2T B;  4FBJ B;  1WZ0 A;  2WP9 B;  2BS3 B;  2WXP A;  2DYO A;  3DHH C;  4IWO A;  2V4I B;  4KV2 A;  4NAW B;  2IBI B;  1HXY D;  1TS2 A;  1JWU D;  1V1O A;  2LRW A;  3NJT A;  2OJW A;  3FIL A;  3KQ4 A;  2CJN A;  4X57 B;  1EM7 A;  3O65 B;  1JML A;  3PPA A;  2MEK A;  3IVF A;  2MP2 B;  3GE8 C;  2LHD A;  3PGE A;  1LXD A;  4CQN A;  3N32 A;  1UH6 A;  3QA8 A;  3A9K B;  1ET9 A;  1EUV B;  4KDI C;  2K22 A;  2ZVN A;  3UQB A;  2I1K A;  4KSL C;  3BYT B;  3ONS A;  4ZRK A;  2L0T A;  5FKA C;  1E6E B;  3I63 C;  3GE3 C;  5G5G A;  1ZXH A;  3CIR B;  3RPF C;  2WWZ A;  2INP E;  3AMZ A;  3BZD B;  3GP7 A;  4TSS A;  4W9H A;  4ZRI A;  1L5P A;  4MH8 A;  1C9F A;  2HTM E;  3OG5 A;  4A8X C;  1TKG A;  1FXI A;  1WI0 A;  1F9J A;  2J0J A;  1SB3 C;  4NY0 A;  1RWS A;  2ZPN A;  2WU2 B;  3I9V 1;  4USA A;  3NVW A;  4HJG E;  2CR5 A;  1V9J A;  2QJL A;  3T3O A;  3P4S B;  4AS1 A;  1ENF A;  4K1R B;  4R3D A;  1T0Y A;  1JRO A;  1YN3 A;  1YQ4 B;  4NJC A;  1QOF A;  4OZA A;  4ICV A;  1WZ3 A;  3PHX B;  3R7Q A;  5EDS A;  3H7P B;  1FM0 D;  1SIJ A;  4S17 A;  2L7R A;  1PGA A;  1L4D B;  2KMC A;  3VAW A;  1SE3 A;  1C76 A;  2MBH A;  1AAR A;  2I2Y A;  1WGD A;  3EC8 A;  2D3C A;  2Z8L A;  2KDM A;  1SE4 A;  5AUK A;  2KTF A;  2BVC A;  3RYT A;  5TSS A;  3NRZ A;  1WMH A;  3DBS A;  2QSD A;  4MJS B;  1UBQ A;  2KJ6 A;  3AEA B;  3MC8 A;  2RSU A;  4XWT A;  1F77 A;  4WJN A;  2B3A A;  2KDF B;  2L0F A;  1GAQ B;  1RRB A;  2NBU A;  3VTW A;  3N1Z C;  2GBK A;  1F2R I;  2IGD A;  1NYQ A;  3A4R A;  5I4D A;  1HA5 A;  2C7H A;  1WXA A;  5IA7 A;  1E5W A;  1FXA A;  3VH3 B;  3FKY A;  2UYZ B;  3NZS A;  3L4P A;  2KVZ A;  5BYR A;  4NZL B;  1JWA D;  3JSV B;  3OLM D;  1WE7 A;  3AUL A;  1FXT B;  2K3U A;  2BPS A;  2WXN A;  3H8H A;  4AUQ C;  4IW0 A;  1TYG B;  4TKN A;  4HDQ A;  3VVW B;  2LFI A;  2N7D A;  2J0K A;  2JZZ A;  1GJZ A;  1HQR D;  1UWM A;  2H88 B;  4PS8 A;  2D11 A;  2CKH B;  3IXS A;  1K8R B;  4N58 A;  4GGQ A;  1UF0 A;  4M00 A;  2JY6 A;  1WX9 A;  4HJK A;  3A33 B;  1LM8 B;  3WA0 A;  4P1B C;  2FE8 A;  1AYF A;  4KZ0 A;  1OQQ A;  2Y3A A;  3TUO A;  3VH4 B;  3AEG B;  2JYE A;  2L76 A;  2D5G A;  2C7M B;  3TEY A;  4CHK A;  1J7A A;  4US9 A;  4WJQ A;  2BS2 B;  3M63 B;  4D2K A;  2KN4 A;  2IJ0 A;  3BK1 A;  3Q2A C;  3EUB 2;  4JX1 C;  3VR9 B;  4HK2 A;  4LNF A;  1N5W A;  3V05 A;  1T0R C;  5D3I B;  4XGA B;  1TS5 A;  5AZH A;  1XLN A;  3TCA A;  3DBL I;  2JWZ A;  3BIN A;  3DQV A;  1JAL A;  5IN7 A;  5G5H A;  1QQR A;  3PZD A;  1E0Z A;  4XDC A;  1HE8 A;  2KFK A;  1WGK A;  2PJH A;  1L4Z B;  3ZYY X;  4KVG B;  1OEY A;  2WU5 B;  1OEY J;  3RNC C;  3EEC A;  3AE7 B;  5KHO A;  1C4C A;  2DX5 B;  4LNK A;  1YMH E;  1P1A A;  4F7Z A;  2D07 B;  4EZK A;  2OOB B;  2KWU B;  1UEL A;  4FHK A;  4KIK A;  3X0W A;  1E7V A;  4B0E A;  4W9C A;  4DDI D;  3QK0 A;  1YNT E;  2KVR A;  2BGF A;  3RUI B;  1EF1 A;  1FO4 A;  2CHW A;  3AEE B;  4KSK C;  4XWW A;  2VH1 A;  1AWD A;  3NZ3 A;  1FRR A;  4RGT A;  2GBN A;  4EOY A;  4CYE A;  1TIF A;  1TJE A;  2MHJ A;  2M1M A;  3ZKJ C;  2A4Z A;  1C4A A;  3SU8 X;  4MM3 B;  4W9D A;  1P9D U;  4MAC A;  3PRP B;  1GC6 A;  4US8 A;  1XCT L;  2O2V A;  3MP9 A;  5EE0 A;  3P42 A;  4ZDV A;  2LD9 A;  4DXG A;  4BOS C;  2KXJ A;  2WXH A;  4WAF A;  1V5O A;  1YX5 B;  5GMV A;  1PGX A;  2LUM A;  3RD2 A;  4TQ0 A;  4ZOH C;  2BQQ A;  3W5U B;  1XXG A;  3A1Q B;  5IP4 D;  4G50 A;  2MWS B;  1KLU D;  2G4S A;  3C8Y A;  5HG2 A;  2LAS A;  1WGY A;  2FUG 1;  2LGD A;  4PT5 A;  1YD8 U;  2CHZ A;  1K52 A;  3JYU A;  2KC2 A;  3AU4 A;  3ZIM A;  1TGZ B;  3NUH B;  2LI5 A;  2Y5B B;  1N5X A;  4RFB A;  3TEX A;  5DPR A;  4GDL B;  1L2N A;  4A3P A;  1ZDX A;  3I3T B;  2IO2 B;  1WXM A;  4KKJ A;  3Q8B A;  4FJV B;  1D5Z C;  1IGC A;  3IBE A;  3OWE B;  2V4L A;  3Q3F A;  3PO0 A;  3N3K B;  1WRD B;  1PFD A;  1PYW D;  3MC9 A;  2LHE A;  4JWS C;  1Z5S B;  2IO0 B;  3ZQ4 A;  3HRD D;  3PZ8 A;  2MLB A;  4LNO A;  2JRI B;  3EGR A;  2OHF A;  3AE8 B;  3LDZ E;  1JQ4 A;  4ASW C;  1HZ5 A;  2AEH A;  3KWL A;  2NPT A;  2H89 B;  5BMH A;  4N59 A;  4IG7 B;  2KHW B;  2GOW A;  4ANX A;  3A9J B;  3AB5 A;  4W9F A;  3BII D;  4WWP A;  2DZJ A;  3DCG A;  1QOB A;  3KW5 B;  3SD5 A;  2R2Q A;  4J6I A;  3ZTD A;  1F52 A;  4M0W A;  1R4M B;  1J19 A;  3ZUN A;  4GXB A;  1WFY A;  3DOW A;  3RN9 C;  4ZHP A;  4LCD E;  4K3C A;  4BKT A;  2KK8 A;  2V3P A;  4ANU A;  3W2D A;  4LDT D;  1IBX B;  1JWM D;  2KTR B;  2IZV B;  2O6V B;  1IP9 A;  3ZXV A;  3UQA A;  3AE6 B;  2G9H D;  1EF5 A;  2EKI A;  1CQV A;  2M4N A;  1BUI C;  3TEW A;  2NTS A;  3ABV B;  4OVU A;  4NQK E;  3MTN B;  3NS1 A;  1WIA A;  1ZPS A;  3HM3 A;  3AN1 A;  3UGB B;  2NBV B;  3WCQ A;  4MGY E;  5CHF A;  1FFU A;  2YLM A;  3AE2 B;  2PE9 A;  1NI2 A;  5IOI A;  4DHZ E;  2MA9 B;  3WAL A;  1GB4 A;  3RNF C;  1BT0 A;  3QX1 A;  1AN8 A;  4MSM B;  4HKQ A;  3MJW A;  3BWU D;  3GS2 A;  1FFV A;  3QIJ A;  5LLI A;  4S0R A;  1N62 A;  4PYZ A;  3PLV A;  2AQ3 B;  4GLS C;  1XF5 L;  2QC8 A;  1QOA A;  1ZUD 2;  1H8C A;  2WXJ A;  2EKE C;  3UI3 A;  4XE0 A;  2FNJ B;  3V3X A;  1KFY B;  2MBB B;  4OHJ A;  4HRO A;  2KKC A;  3RI7 C;  4AJW A;  2WYQ A;  3RUL A;  2FCM A;  4EEW A;  2J53 A;  4HEA 1;  1YJI A;  4ITK A;  2QIE B;  2L00 B;  1EU3 A;  2RDB C;  4DHJ D;  1GB1 A;  1K50 A;  2WXR A;  2KLG A;  4I6L B;  1I4R A;  2N4F A;  4KGT A;  4K81 A;  3ZJV A;  1E10 A;  4EE2 A;  2RD0 A;  3N30 A;  1P3Q U;  5D2M B;  4N9F 4;  2VZK B;  2C9W B;  4FJY A;  3DBR I;  4GDK A;  2M56 B;  5MPO A;  1SGH A;  1L0X B;  2MJ3 A;  1V6E A;  3EFC A;  3LXF A;  2BYF A;  2JF5 A;  4IM0 A;  4C4V A;  4G0N B;  4YTN B;  2Y5P A;  2ZVO A;  2KWC A;  4KX6 B;  1VZ6 A;  2RGF A;  1WGR A;  1CZP A;  1TKE A;  3GZN I;  3P63 A;  4KIK B;  3ZNZ B;  1SJH D;  3LJ3 A;  4B0M A;  3KUZ A;  1J7C A;  2G45 B;  2KC1 A;  2HDE A;  2KDE B;  1WRI A;  3SFD B;  1WSP A;  2KWV B;  4OZC A;  4NNJ B;  1XLQ A;  1QT9 A;  1WGG A;  2FCQ A;  2K8C A;  4JL9 A;  3IG3 A;  2J7Q B;  2Y5C A;  1OQY A;  2JX5 A;  2J42 A;  5EE3 A;  3TL5 A;  2JZP A;  3ECI A;  4MEM A;  4FN2 A;  1EWY C;  1FNV A;  2IY0 B;  1YIW A;  2KAN A;  1GOZ A;  3VDZ A;  1IYF A;  3CMM B;  3R2I A;  2CJO A;  1DYQ A;  5BMI A;  4IUM B;  4IM3 A;  3P4P B;  5CX3 A;  4UDU C;  4XZ4 A;  3H6N A;  2NMQ A;  5JZE B;  2KDB A;  3PRZ A;  3AE9 B;  3NS8 A;  2QMT A;  2Z0E B;  4MGI E;  4HKZ E;  3ZNH B;  2WXO A;  1TBE A;  2IYD B;  5IKC M;  3MHS D;  4WAA A;  3DBH B;  1SJE D;  2LGY A;  5DCN A;  3X23 A;  2FID A;  1JRU A;  4WWO A;  2IO1 B;  2M17 A;  1FMA D;  4W9I A;  2QEJ C;  4FUL A;  1WJU A;  4RNA A;  2KX0 A;  1YQ3 B;  2AL6 A;  1YN4 A;  4AOF A;  3AE1 B;  4DXA B;  4KGS A;  5D6J B;  4A90 A;  1ROE A;  2PVO D;  3B2F A;  2K6D B;  4EZJ A;  2XK5 B;  1TS4 A;  4W9J A;  2WX1 A;  2AYO B;  3R3M A;  2KYW A;  4DQO C;  1J8C A;  3DBL B;  4LK0 M;  3ZVV A;  2BS4 B;  3RFZ B;  5HHD G;  2IGG A;  4JIO U;  3ZDT A;  1KF6 B;  1QZE A;  1VZ7 A;  2ZPY A;  4KZC A;  1FRD A;  1FD6 A;  1D3Z A;  1ET6 A;  4ZRQ A;  3NG0 A;  5IO9 A;  4C7Z A;  1FPY A;  2IDY A;  2K6Q A;  3QJZ A;  3AE4 B;  4M01 A;  2MSE D;  2PKO A; 
#chains in the Genus database with same CATH homology
 3L08 A;  1P1A A;  4MDK E;  2NCN A;  4F7Z A;  1VD2 A;  5C1Z A;  1UZX B;  2ZZP B;  2W9N A;  3VQI A;  2D07 B;  2JVC A;  4EUT A;  2OOB B;  2KWU B;  1UEL A;  2Z0D B;  2I1J A;  3M62 B;  4IM2 A;  4W9G A;  1WGH A;  4FHK A;  1P98 A;  4KIK A;  3WAO A;  3TMP B;  3X0W A;  3APF A;  1E7V A;  1I35 A;  1WH3 A;  2JUO A;  4W9C A;  4DDI D;  2J0M A;  3ZRC A;  3QK0 A;  4RM9 A;  2L3Z A;  3ML8 A;  4WQO B;  2KVR A;  2BGF A;  4GN1 A;  3RCZ A;  1R4M I;  3RUI B;  3TIX A;  1E90 A;  3L17 A;  1C3T A;  1EF1 A;  3EFU A;  3ZDM C;  1UD7 A;  2CHW A;  2LJ5 A;  3HIZ A;  4KSK C;  3Q3J A;  2FCN A;  4K7U A;  3NOB A;  2DHZ A;  1V2Y A;  2K39 A;  1V81 A;  2GBN A;  4EOY A;  4CYE A;  2V3S A;  2M8S A;  1YX6 B;  4MSQ B;  4PYU A;  3ZNI D;  2O2V B;  2BF8 B;  2R2O A;  3B0A A;  2M1M A;  5J2R A;  2FAZ A;  3ZKJ C;  5JH5 C;  4WWN A;  2A4Z A;  2G3Q B;  3SU8 X;  5DPW A;  4BKS D;  1WJN A;  4W9D A;  2MQJ A;  3QAQ A;  1P9D U;  4HLE A;  3PRP B;  1GC6 A;  5HKH A;  3DVG Y;  3L0W B;  1MG8 A;  1E8W A;  3RZW C;  2O2V A;  2N1W A;  5E6P A;  3T9L A;  3ZLZ A;  1LFD A;  4ZDV A;  3ENE A;  1R4N I;  1L7Y A;  2LD9 A;  3PT2 B;  3HM6 X;  3B08 A;  4I6P A;  3TJP A;  4TQ1 A;  4MM3 A;  4BOS C;  2O6V D;  3M95 A;  2BKR B;  2KXJ A;  3ML9 A;  3EHV A;  3HHM A;  2ZCC A;  3VUY A;  1V5O A;  1YX5 B;  5GMV A;  4E71 A;  3UIO B;  3PSE B;  1XQQ A;  3RD2 A;  4BFR A;  4TQ0 A;  3W1Y A;  4K7S A;  1NBF C;  1WYW B;  3A1Q B;  1Z2M A;  3DPD A;  4JLC A;  4G50 A;  1OTR B;  2MWS B;  2G4S A;  3RZF A;  5CHV C;  2KOX A;  4XX5 A;  5IAA C;  2Z59 B;  2LAS A;  4MEM A;  1WGY A;  2FCS A;  2D3G A;  3L10 B;  4BBN F;  2LGD A;  2NS5 A;  5CHW A;  4ICU A;  1YD8 U;  2ZJD A;  5D94 A;  4NQL B;  2CHZ A;  3A1Q A;  3JYU A;  2KC2 A;  3R66 C;  5DPS A;  3AU4 A;  3ZO5 B;  2LVP A;  3ZIM A;  1TGZ B;  4HDO A;  2DAF A;  1U4A A;  3RT3 B;  2LI5 A;  4B9K A;  2Y5B B;  4FJZ A;  1XD3 B;  2MBQ A;  1RAX A;  2LZ6 A;  4E74 A;  3NY5 A;  1ISN A;  4LJP B;  5DPR A;  3PTF C;  4EZL A;  4GDL B;  3U7D A;  3WAN A;  2BYV E;  1L2N A;  4A3P A;  4NJ7 A;  3WAM A;  3I3T B;  5AEK B;  4HPL B;  2N9X A;  4IWP A;  4GIV A;  3C0R B;  3PLU A;  1V80 A;  2C60 A;  1WXM A;  2IO2 B;  2KJH B;  2REX A;  3NHE B;  2PE6 B;  2EMT A;  2LXC A;  2ZNV B;  3IBE A;  4FJV B;  1WE6 A;  4PS3 A;  2V4L A;  1S1Q B;  2KO3 A;  3Q3F A;  4GDL A;  3U8Z A;  3N3K B;  2BYE A;  3DDC B;  1WRD B;  2KNB A;  1J0G A;  2WX0 A;  4W9E A;  1M94 A;  1H4R A;  4TUU A;  3V61 A;  1Z5S B;  1P0R A;  2IO0 B;  3VHT C;  1WY8 A;  2UWQ A;  2KFJ A;  4B95 A;  2MLB A;  4NJ6 A;  2NPT B;  2JRI B;  4IC7 B;  4B6W A;  3CF6 E;  3PRM B;  4FAD A;  4BOZ B;  4IWQ A;  5FR6 A;  3LDZ E;  3QQ8 B;  2K8H A;  5DPT A;  3W1S A;  1IPG A;  5L95 C;  1G6J A;  1LQB A;  3UF8 A;  4NPN A;  4I6N B;  2D10 A;  2NVU I;  2BWE S;  4BBN C;  4II3 B;  3VTU A;  4ASW C;  3QC8 B;  4BVU C;  2AEH A;  1WJ4 A;  2NPT A;  4KDL B;  4FA6 A;  2LXA A;  1SE9 A;  4IG7 B;  2ASQ A;  2KHW B;  2GOW A;  3KUD B;  2FUH B;  3KYD D;  2KD0 A;  5E6O A;  4ANX A;  3A9J B;  4M0W B;  3OJ4 B;  2KZR A;  1E8Z A;  4ZRJ A;  4II2 B;  3UIN B;  4W9F A;  4ANW A;  2NBW B;  4WWP A;  3UIP B;  2DZJ A;  4PS7 A;  3PS6 A;  3DCG A;  1S3S G;  4GU2 A;  3KW5 B;  3SD5 A;  4AJY B;  2R2Q A;  4J6I A;  1KM7 A;  4FBJ B;  1WM3 A;  1WZ0 A;  3ZTD A;  3A9J A;  5L83 A;  2DYO A;  3JVZ X;  1J19 A;  4IWO A;  4KV2 A;  2KLC A;  4NAW B;  4G11 A;  4GXB A;  1ZKH A;  3T8M A;  2IBI B;  3ZUN A;  1WFY A;  3DOW A;  2KN5 A;  3VFK A;  1RFA A;  4LCD E;  2LRW A;  3KVF B;  2AL3 A;  4BKT A;  2KK8 A;  4X57 B;  4ANU A;  3SDL C;  4NAW A;  3ZRF A;  4AP4 C;  4LDT D;  4BKS A;  2KTR B;  1WX8 A;  2IZV B;  2O6V B;  1GC7 A;  1IP9 A;  3UQA A;  2JRH A;  2RR9 A;  3O65 B;  2GBJ A;  1EF5 A;  4LJO B;  2M4N A;  2K8B A;  5AZF A;  5D7G A;  2XBB C;  3PPA A;  2JT4 B;  2KDI A;  4OVU A;  4NQK E;  4DBG A;  3MTN B;  3NZU A;  2KTR A;  2MP2 B;  2O6V A;  3B1L X;  1WIA A;  3IVF A;  1LXD A;  3PGE A;  3HM3 A;  3N32 A;  1UH6 A;  3QA8 A;  3QAR A;  4GSW A;  1TTN A;  3A9K B;  3UGB B;  2NBV B;  3VUX A;  4MGY E;  1EUV B;  2DZK A;  3ALB A;  4KDI C;  4W9K A;  5CHF A;  3V62 A;  2YLM A;  5C23 A;  2PE9 A;  2ZVN A;  4EKU A;  1NI2 A;  3AU5 A;  1SIF A;  4DHZ E;  3UQB A;  2I1K A;  4KSL C;  2MRP A;  2MA9 B;  2MP2 A;  2KMA A;  3ONS A;  4ZRK A;  4OVV A;  1Q5W B;  3WAL A;  2ZEQ A;  2L0T A;  2NR2 A;  1BT0 A;  3A9K A;  3QX1 A;  4A3O A;  4MSM B;  2OJR A;  1OGW A;  2WWZ A;  3MJW A;  4DHZ B;  4ZRI A;  4W9H A;  2KQ7 A;  2K25 A;  3CSF A;  3QIJ A;  5LLI A;  2PPH A;  4HWI B;  4MEL A;  2BKF A;  1WI0 A;  4PYZ A;  1F9J A;  2J0J A;  4NY0 A;  3PLV A;  3IFW B;  2BWF A;  3DBH I;  2MW5 A;  3WAP A;  4DWF A;  1H8C A;  2ZPN A;  2CS4 A;  2EKE C;  2FNJ B;  2MBB B;  2N7E A;  1E7U A;  2DYM A;  2MBE A;  4M8M A;  4URK A;  2KKC A;  2CR5 A;  1WM2 A;  3K9P B;  2IY1 B;  1V9J A;  4AJW A;  1WR6 E;  2WYQ A;  3JW0 X;  3RUL A;  2FCM A;  1A5R A;  3L13 A;  1Q1O A;  2M0X A;  1WR1 A;  4EEW A;  1GG3 A;  4HXD A;  4K1R B;  2V1Y A;  4K7W A;  1T0Y A;  2K1F A;  1Y8R C;  2HE7 A;  2L00 B;  4FHJ A;  2LGX A;  4HCN B;  4W9L A;  4ICV A;  4DHJ D;  1WZ3 A;  3PHX B;  4GDK B;  1I42 A;  3QHT A;  3R7Q A;  5EDS A;  3H7P B;  4I6L B;  2KLG A;  2N4F A;  2L7R A;  4K81 A;  4DK5 A;  2RD0 A;  3N30 A;  1P3Q U;  5D2M B;  4N9F 4;  2EMS A;  5LXI B;  1E8Y A;  2AWT A;  2KMC A;  3VAW A;  2N9E B;  2CHX A;  2C9W B;  4FJY A;  1UGM A;  1WMH B;  1AAR A;  2MBH A;  4F1S A;  1WGD A;  3DBR I;  4GDK A;  2ZCB A;  3S2A A;  1SGH A;  2KQS A;  3H7P A;  2LVQ A;  3EC8 A;  5JHB A;  1Q0W B;  2MBO A;  1V6E A;  3W1S C;  2BYF A;  2KTF A;  2JF5 A;  3CST A;  4IM0 A;  3RYT A;  5TR5 A;  3V6E B;  3VXW A;  4G0N B;  4ZYN A;  1WMH A;  3DBS A;  3PVL A;  2ZVO A;  2KWC A;  4MJS B;  1TZ1 A;  1E8X A;  1UBQ A;  2KJR A;  2KJ6 A;  4AWJ A;  3DVN U;  2RSU A;  2RGF A;  4WJN A;  1V86 A;  1WGR A;  1WXS A;  2B3A A;  2KDF B;  2L0F A;  3QCA A;  1RRB A;  2NBU A;  3VTW A;  4RMA A;  2GBK A;  3GZN I;  3BY4 B;  2HJ8 A;  4MJS A;  3ZNG C;  4KIK B;  4LDT B;  3ZNZ B;  3A4R A;  3AI5 A;  4JGH B;  4G3X B;  3LJ3 A;  3KH0 A;  1C1Y B;  2DZM A;  3KUZ A;  2G45 B;  4P7I A;  5E6N A;  5J18 A;  2C7H A;  1WXA A;  2KC1 A;  4MGZ E;  4WJP A;  1CMX B;  2KDE B;  1E5W A;  5CTR C;  3VH3 B;  5IA7 A;  5J17 A;  2KWV B;  2UYZ B;  3NZS A;  5BO4 B;  3IHP C;  4NNJ B;  3P2B A;  4FLH A;  1WGG A;  3AXC A;  2DEN B;  3JSV B;  1ZW7 A;  3OLM D;  4WJO A;  4XC2 A;  2FCQ A;  1WE7 A;  2K8C A;  1RLF A;  3AUL A;  4JL9 A;  1FXT B;  3IG3 A;  3D32 A;  2J7Q B;  3ZW3 A;  1OQY A;  1WX7 A;  3U30 A;  2BPS A;  4RM8 A;  4YL8 A;  3R7R A;  3PV1 A;  3TBL D;  4AUQ C;  4IW0 A;  3JSV A;  3TL5 A;  1V5T A;  4TKN A;  1YJ1 A;  4HDQ A;  2DAJ A;  2GBR A;  3OAW A;  1GUA B;  2C7N B;  4GOC A;  3VVW B;  2DYB A;  3PHW B;  2N7D A;  3DVG X;  2JXX A;  2J0K A;  3ECI A;  2IY0 B;  4FN2 A;  3M3J A;  1YIW A;  2JZZ A;  2KX3 A;  2KAN A;  1GJZ A;  2CU1 A;  3VDZ A;  1IYF A;  3CMM B;  3VUW A;  4IUM B;  3HK0 A;  4HCP B;  4PS8 A;  4IM3 A;  2D11 A;  4MH0 E;  5CX3 A;  4XZ4 A;  4E3C A;  2CKH B;  2A5U A;  3H6N A;  3L16 A;  3V6C B;  3SHQ A;  5JZE B;  4F8C B;  3A4S C;  1K8R B;  2KDB A;  4GB9 A;  3PRZ A;  4GGQ A;  3NS8 A;  2LVO A;  3K9O B;  2Z0E B;  2JY6 A;  1WX9 A;  2WDT B;  4MGI E;  3KYC D;  1UBI A;  3H9D A;  3ZNH B;  4HJK A;  3A33 B;  1LM8 B;  3WA0 A;  1XT9 B;  3ZTC A;  3H1U A;  1TBE A;  1NDD A;  2IYD B;  5AZG A;  3APD A;  3MHS D;  4WAA A;  3WIM A;  4HPM B;  4KZ0 A;  2LGY A;  5DCN A;  3X23 A;  4ANV A;  2FID A;  2LRU A;  2XEW A;  4BKG A;  1JRU A;  4M8N A;  4WWO A;  3L54 A;  2IO1 B;  2M17 A;  3VH4 B;  4W9I A;  4FUL A;  5KHQ A;  2L76 A;  1WJU A;  2N1V A;  5JHA A;  2KX0 A;  4DHJ B;  2C7M B;  2AL6 A;  4GMV A;  2HD5 B;  5G55 A;  1EO6 A;  1KJT A;  2GMI C;  3VTV A;  4AOF A;  4CHK A;  4DXA B;  1X1M A;  5D6J B;  1WXV A;  4WJQ A;  3M63 B;  2D2Q A;  1PQS A;  2IO3 B;  3H7S A;  1ZGU B;  2GBM A;  2MX2 A;  2C5L C;  2RPQ A;  4DDG D;  1KOT A;  2FIF A;  4EFO A;  4HK2 A;  4HVB A;  2K6D B;  2N9P C;  4MGK E;  1WF9 A;  2XK5 B;  4A20 A;  5G2N A;  4EZJ A;  3DVN V;  3APC A;  4W9J A;  2WX1 A;  1VCB A;  2AYO B;  3R3M A;  1J8C A;  2LWP A;  4EZK A;  2ZNV C;  5AZH A;  3OJ3 A;  3V60 A;  1V49 A;  3ZVV A;  3QWZ B;  3TCA A;  3DBL I;  2JWZ A;  2KFK B;  3BIN A;  2XK5 A;  2PEA A;  4JIO U;  3ZDT A;  3DQV A;  4JQW C;  1QZE A;  3KUC B;  1YQB A;  3GOE A;  2ZPY A;  3PZD A;  5LXH A;  1KLV A;  2L8J A;  1GNU A;  2HTH A;  2JPH A;  4KZC A;  1HE8 A;  2VRR B;  2DZI A;  2KFK A;  2PJH A;  1D3Z A;  3PRE A;  2QHO A;  1WJ6 A;  2JZ3 B;  4KVG B;  2K6Q A;  3QJZ A;  1OEY A;  1OEY J;  2YVC A;  2G4D B;  2L05 A;  3EEC A;  4TV3 A;  5KHO A;  2MCN B;  4CO7 A;  2MSE D;  2DX5 B;  2LUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...