3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
4A3OA 4BOZB 4DHJB 3K9PB 4IC7B 3SHQA 2V4LA 5J2RA 1TTNA 2L0FA 3ZDTA 3VTVA 4JL9A 2GMIC 2DENB 2RSUA 4MSMB 3WIMA 2KWCA 3UIPB 4JLCA 4XX5A 3AU4A 1UD7A 4IUMB 5CHFA 2HE7A 1GJZA 2AYOB 4PS7A 3HHMA 4KSLC 4MH0E 2IO0B 3A9KA 3H6NA 1IP9A 4DHJD 3EC8A 2ZCCA 4ANVA 4IWQA 3ZTDA 4YL8A 1I42A 2BYEA 2LZ6A 5E6NA 5LLIA 2KZRA 2MW5A 2JY6A 3ZRFA 3A1QA 3PV1A 3UQBA 1VD2A 1WJUA 2MSED 2AL3A 3I3TB 4K1RB 3A9JB 3SDLC 3QQ8B 2J0KA 1WE7A 1YJ1A 3QAQA 2K39A 1H8CA 1C3TA 2LVQA 2N7DA 4W9JA 3Q3JA 2J0MA 4FJYA 4AJWA 3ZIMA 2MBEA 3NOBA 2JUOA 4HCNB 4FJZA 4LDTB 1V49A 5JH5C 4II2B 1PQSA 2VRRB 2M4NA 4W9EA 2JPHA 4KV2A 2KQSA 2KN5A 4CYEA 3MHSD 4M8MA 4W9HA 1U4AA 3ML8A 5AEKB 3PZDA 1YIWA 2HTHA 5GMVA 3ZKJC 3B0AA 2WWZA 4BVUC 3B1LX 1WMHA 1F9JA 3ML9A 1UBQA 4FBJB 2BYVE 2G4SA 2LGXA 4WJQA 4LDTD 2KLGA 3U30A 1Z5SB 1WFYA 2MWSB 2NBUA 2NS5A 2UWQA 1TBEA 3QK0A 3VH3B 2L3ZA 4BKGA 3PVLA 2REXA 2RPQA 2L0TA 3A9JA 2KKCA 5CHVC 4EFOA 2EMSA 2O2VB 4W9KA 1WXAA 3HM6X 1RLFA 3NY5A 1BT0A 2OOBB 4NNJB 3QJZA 2YVCA 4WJOA 4W9GA 5DPRA 1UBIA 2BPSA 2C7NB 1OGWA 2ZEQA 3N32A 3QWZB 1WJNA 2I1JA 4K7UA 4KSKC 3ZRCA 1GC7A 4FADA 3CSTA 5DPTA 1P1AA 4FULA 1GC6A 3GZNI 3IBEA 3ECIA 2RR9A 3VVWB 3VUWA 1RRBA 2DAJA 4M0WB 1D3ZA 4W9DA 2GOWA 5G2NA 1M94A 4GMVA 1V2YA 2JT4B 3KH0A 4BKSD 2BWFA 5IA7A 3KUZA 3S2AA 3RZWC 1E8ZA 1VCBA 2KNBA 3PSEB 1S1QB 5AZFA 1P0RA 1GNUA 1RFAA 2V3SA 3JYUA 1H4RA 4HJKA 4B6WA 2CS4A 3L0WB 3T9LA 1WR1A 2O2VA 2RGFA 1R4NI 4KZ0A 2Y5BB 1Q0WB 2IO3B 4NAWB 2N1WA 4BKSA 4EZJA 3OJ4B 3UF8A 1R4MI 2JXXA 4BKTA 1EUVB 2C7HA 4RM9A 1EF1A 4MGKE 4WQOB 2PPHA 2PE9A 3TL5A 1WY8A 3QIJA 2ZVOA 1LQBA 1WGRA 2FNJB 2ZPYA 1WGGA 2M8SA 3MJWA 2MBHA 3QARA 4K7SA 1KLVA 2FCMA 2Z0EB 3TJPA 4E71A 3DBSA 4TKNA 2DYOA 4AP4C 1TZ1A 2LVPA 4AOFA 3WAMA 3UINB 4PYZA 4FHKA 2XBBC 3ZUNA 1J8CA 4J6IA 5D94A 3AXCA 3ALBA 2KDBA 4XZ4A 1L2NA 4P7IA 2KFKA 2N9PC 3H9DA 2G45B 2JWZA 3DQVA 4FN2A 3NHEB 3VXWA 1ISNA 1UZXB 2FAZA 4GGQA 2K8CA 4ZDVA 1WZ3A 3RD2A 4ANUA 3SU8X 1T0YA 4NJ6A 5C1ZA 2DX5B 2JVCA 3VTWA 5AZGA 4AUQC 4ASWC 2KXJA 2KDIA 2ZZPB 4GDLB 1S3SG 2M17A 2N4FA 1QZEA 3VTUA 4URKA 2KD0A 3IVFA 3EFUA 1WE6A 2KDEB 2KMCA 3LDZE 4ANXA 4M8NA 4MJSB 4GXBA 5JHBA 3DBHI 2LVOA 4A3PA 4ICUA 2V1YA 3AU5A 4MGIE 5JHAA 4HLEA 1YQBA 5DCNA 4ICVA 3QCAA 4KDLB 4MM3A 2KDFB 2K8HA 1HE8A 3M62B 4F8CB 3RCZA 2DAFA 1E5WA 2ZCBA 3H7PB 2JZ3B 1WX8A 5JZEB 4W9CA 3DVNV 3ZNGC 2D07B 3DBRI 2J0JA 5DPWA 4GDLA 3KVFB 3DVGX 2N1VA 3PREA 4LJPB 3ZW3A 4IG7B 2N9XA 3DVNU 2RD0A 3K9OB 1J0GA 4E3CA 3L54A 4HWIB 4FJVB 2GBJA 4LJOB 4WJPA 5EDSA 1RAXA 1EF5A 3CF6E 2GBRA 3L08A 1XD3B 4TQ0A 4MJSA 1OEYJ 2G4DB 1WI0A 1TGZB 3C0RB 1SE9A 2CR5A 2W9NA 4DXAB 3PGEA 1V80A 3VDZA 2C5LC 2A4ZA 2LGYA 2LASA 3KYCD 2AWTA 4HDOA 3M95A 1L7YA 4KZCA 3V60A 3H7PA 2CHXA 2KLCA 1WJ6A 2ZVNA 4GIVA 2KFJA 3RYTA 4HVBA 3HM3A 1WX7A 4ZRKA 3V6EB 1P3QU 4MGYE 3U8ZA 2LD9A 1FXTB 2A5UA 5CHWA 2CU1A 4GOCA 3HIZA 4W9IA 4G11A 2IO1B 2D10A 3PT2B 3V62A 1UH6A 1WGHA 2JRHA 4DDID 3PRPB 2K8BA 3IHPC 2BF8B 1K8RB 2J7QB 2DYMA 1V5OA 3H1UA 3TIXA 1OTRB 2ZNVB 2WDTB 2OJRA 2MBQA 5CTRC 1JRUA 3IG3A 2UYZB 4WWOA 2O6VB 4F1SA 2LRWA 3ZVVA 4DHZE 1YD8U 2DHZA 4II3B 1NDDA 1Q1OA 4JIOU 2NBVB 3APDA 3WA0A 2D2QA 2KJ6A 3DVGY 3AULA 1WRDB 2DZKA 1SGHA 3QX1A 2ZNVC 2O6VD 3DDCB 1E8XA 4CHKA 2BKRB 3R7RA 2CKHB 4NPNA 1WYWB 3HK0A 3PHWB 4E74A 2IZVB 3ZNHB 3R66C 4I6PA 3PRMB 2L7RA 4RM8A 3KUDB 3LJ3A 4HK2A 5KHQA 3UQAA 5E6PA 3QHTA 3X23A 4DBGA 1XQQA 4DK5A 2O6VA 2HJ8A 3KW5B 4EKUA 3O65B 3N3KB 2FCSA 3CMMB 3SD5A 4G50A 3IFWB 3OJ3A 2L05A 2L8JA 1X1MA 3NZUA 2IBIB 2KO3A 4LCDE 5FR6A 4W9LA 2LXAA 3BY4B 3PHXB 4EOYA 5LXIB 4NAWA 3U7DA 4GSWA 2KX3A 2JF5A 2G3QB 3PTFC 3APCA 3W1SC 4GU2A 3A33B 1I35A 2IY0B 2K25A 4JQWC 3L13A 3NZSA 3EECA 3T8MA 1V6EA 1V9JA 2KK8A 5DPSA 5D7GA 1E8YA 1WH3A 3W1SA 3DCGA 3Q3FA 4TUUA 2L00B 4X57B 2C60A 2CHWA 2MX2A 4DDGD 3PLVA 2D11A 3RULA 2XK5B 4B95A 2NCNA 3PRZA 4BBNC 4EUTA 2MQJA 3NS8A 1CMXB 1P98A 4HXDA 5CX3A 2D3GA 3VAWA 4EZKA 2FCQA 2KC1A 1KJTA 4FLHA 4K7WA 2Z59B 3APFA 4BOSC 5L83A 2BGFA 4MEMA 3OAWA 5IAAC 3ZNZB 3CSFA 4NQLB 2KC2A 1WZ0A 3RT3B 2AEHA 1WR6E 2B3AA 3VFKA 4IWOA 1AARA 1YX6B 4GB9A 3VQIA 2LXCA 1IPGA 3DPDA 3WALA 2C7MB 2K6DB 2M1MA 2PJHA 2XK5A 1WF9A 3A4SC 1WMHB 4MELA 2YLMA 4W9FA 2HD5B 1NBFC 4KIKB 4WAAA 4FA6A 4MSQB 2C9WB 3R3MA 1ZW7A 3L17A 1OEYA 2BWES 2ZPNA 4PS3A 1WJ4A 3VUYA 2GBMA 3JSVB 3L10B 3B08A 1P9DU 1UELA 2DZJA 1V81A 1J19A 1SIFA 2KWVB 2IO2B 1V5TA 3WAOA 4I6LB 4NJ7A 2R2QA 2KTRB 4KDIC 4OVVA 2MA9B 1KOTA 2N7EA 1E8WA 2FIFA 2LJ5A 3EHVA 4GDKB 4I6NB 4IM3A 2QHOA 4XC2A 3ZTCA 4AWJA 2KANA 2PE6B 4PYUA 4WWPA 5KHOA 2I1KA 5D2MB 4A20A 2FUHB 2IYDB 4G0NB 3X0WA 2KMAA 1ZKHA 1LFDA 5D6JB 3VH4B 3TMPB 3ZNID 1WGDA 3R7QA 4WWNA 4KIKA 2KWUB 4FHJA 4EZLA 3RUIB 4HCPB 5TR5A 1Y8RC 1WM2A 3GOEA 4K81A 1UGMA 3ZDMC 1WIAA 4BFRA 3TBLD 2WX1A 3KUCB 1XT9B 5G55A 1WM3A 3JSVA 3PLUA 2KVRA 3MTNB 4TV3A 2KHWB 2MRPA 3VHTC 2DYBA 2FCNA 4ZYNA 2KJHB 2KTRA 2GBKA 3QC8B 3JVZX 4B9KA 3V6CB 2MBOA 1WXVA 2MBBB 4MDKE 4EEWA 1IYFA 4NY0A 2PEAA 1Z2MA 4GDKA 4CO7A 3DOWA 4DHZB 3V61A 3TCAA 3ZO5B 2AL6A 3JW0X 3M63B 4HDQA 2LGDA 3PPAA 4HPMB 1WXMA 1WGYA 1GG3A 3KYDD 4JGHB 1E7UA 2EKEC 3DBLI 3N30A 4IWPA 3RZFA 3BINA 5L95C 2ASQA 2WYQA 4TQ1A 2NVUI 4ZRJA 2FIDA 4BBNF 2JRIB 2BYFA 4HPLB 4OVUA 4IM2A 2NPTB 4IM0A 3ONSA 4ZRIA 1NI2A 1YX5B 2KTFA 2KX0A 4DWFA 2CHZA 2DZMA 1EO6A 4GN1A 2M0XA 2GBNA 1V86A 2JZZA 4RMAA 3UIOB 2MP2B 3ENEA 2K1FA 2KFKB 1E90A 2R2OA 2ZJDA 3W1YA 2BKFA 4NQKE 3VUXA 1E7VA 4IW0A 2NR2A 3H7SA 3WAPA 4AJYB 5J18A 1C1YB 2XEWA 2LRUA 3ZLZA 1A5RA 2Z0DB 2EMTA 2N9EB 1LM8B 3M3JA 2L76A 3AI5A 2WX0A 2MCNB 1Q5WB 3A4RA 1LXDA 2NPTA 1ZGUB 5J17A 5HKHA 3A9KB 2DZIA 3D32A 2LWPA 3PS6A 4WJNA 4MGZE 1WX9A 3WANA 4G3XB 4PS8A 2LUEA 2KOXA 3P2BA 5LXHA 2KQ7A 3QA8A 1GUAB 2LI5A 2IY1B 2MP2A 1OQYA 1WXSA 1KM7A 2K6QA 2KJRA 5BO4B 3OLMD 5E6OA 2NBWB 3A1QB 4KVGB 4N9F4 4F7ZA 1G6JA 4ANWA 5AZHA 3UGBB 3L16A 1MG8A 5C23A 2MLBA
chains in the Genus database with same CATH superfamily
3K9PB 1L6UA 4QAYA 2L0FA 3ZDTA 4JL9A 3WIMA 3UIPB 1P7FA 1QOGA 1IP9A 3H6NA 1GOZA 5EE1A 1T0RC 3NG0A 4IWQA 4JPSA 1I42A 2LZ6A 2MW5A 2WDQB 3UQBA 1WJUA 2MSED 3Q2AC 4K1RB 3SDLC 4BAXA 4RNAA 1C3TA 2LVQA 2N9KA 3DHIC 3ZIMA 1WWTA 4HCNB 1P7EA 2JZPA 4YXDB 2M4NA 4W9EA 2JPHA 4KV2A 3MP9A 4CYEA 2NTTA 1DOYA 1U4AA 3RNEC 2WHIA 1YIWA 2HTHA 4KX6B 2JQRB 2INNE 1UGJA 2G4SA 2LGXA 4WJQA 2K0PA 1TBEA 3QK0A 1KLGD 2KACA 2V0GA 3PVLA 2KKCA 4EFOA 2O2VB 1T3QA 1WXAA 3HM6X 1XLQA 3SEBA 3QJZA 2YVCA 4WJOA 5DPRA 3QWZB 1OGWA 3N32A 1CZPA 2I1JA 1C9FA 4KSKC 1T0QC 2BTEA 5IO9A 5DPTA 2BB6A 1P1AA 5BYRA 3GZNI 3VUWA 1E9MA 1D3ZA 2NMQA 1M94A 2JT4B 3P63A 1KRHA 3KH0A 4D2KA 4N6EB 4JX1C 2LGIA 1S1QB 3LXFA 4XDDA 5AZFA 2V3SA 3DBRB 1H4RA 2CS4A 3L0WB 2O2VA 1R4NI 3AMZA 5AUIA 1VDVA 1EUVB 3TUOA 2C7HA 4RM9A 4OHJA 5BMGA 2PPHA 3H8HA 3IAS1 3DHGC 2ZVOA 4TSSA 2FNJB 5EE0A 2MBHA 2FCMA 1M4VA 1R7SA 2V3PA 4AOFA 2XBBC 1L2NA 1EWYC 4PT5A 2G45B 3VXWA 2K8CA 4MM3B 3RD2A 2ZW0A 4OW0A 2PW9A 4NJ6A 3SU8X 5C1ZA 2DX5B 1VR9A 4RGMA 2DLBA 2NTSA 4JWSC 4ASWC 1KF6B 1S3SG 2M17A 2WDRB 3AE9B 3EFUA 4C4VB 1FM0D 1NENB 1FFUA 4M8NA 3DBHI 3Q3OC 4A3PA 1V8CA 2PKOA 3AU5A 4M01A 4REZA 1B9RA 1K50A 1YQBA 5DCNA 4ZHOA 3NZ3A 4MM3A 3R2IA 2M19A 3M62B 3RCZA 2DAFA 1WX8A 5JZEB 3DVGX 2N1VA 4LJPB 3K9OB 1J7BA 3L54A 4FJVB 4LJOB 4WJPA 4C4VA 2KDMA 2X38A 2GBRA 1XD3B 3B2FA 1WI0A 1TGZB 2D5GA 2LGYA 2A4ZA 5IOIA 3O13A 5T8IA 4YT0B 4P16A 4JWUC 4KZCA 2KLCA 2KFJA 4MGYE 2LD9A 3R2TA 4GOCA 2D10A 4XWWA 2JYTA 3PT2B 3V62A 1WGHA 2JRHA 3PRPB 4YWGG 2BF8B 2DYMA 1V5OA 4OZCA 1OTRB 1SE4A 2MBQA 5CTRC 4WWOA 2O6VB 2LRWA 1J7CA 3ZVVA 3BIID 1YD8U 2DHZA 4KGRA 2CJNA 3APDA 2INPE 5H92C 1SGHA 3LB8C 1WYWB 2W54A 4E74A 1TIFA 3NVWA 4B0MA 3LJ3A 5KHQA 3UQAA 4USAA 2O6VA 3KW5B 3N1XC 5BMIA 3NZUA 1C78A 4LCDE 2PTLA 5LXIB 3U7DA 1F2RC 3PTFC 1MFWA 1NVID 3W1SC 4A55A 3A33B 3L13A 1D5XC 1T6BX 2KK8A 2M0AA 1NEKB 2RDHA 5D7GA 1E8YA 1OQQA 3DCGA 3HUIA 3Q3FA 2WLBA 4DDGD 4O1NA 2D11A 3ZJTA 1SBBB 4BBNC 2L52A 1RFKA 1MPEA 2ICIA 4YTPB 3BYTB 3VRBB 5HG2A 2BGFA 2HTME 3ZNZB 3WALA 1ZP0B 2C7MB 2YLMA 3W5VB 4N59A 4M02A 1D4BA 1MHHE 3L10B 4EE2A 1SIFA 2KWVB 3BK1A 3AEDB 1LO5D 3GS2A 4AQ7A 4DXGA 2MA9B 1KOTA 2N7EA 1E8WA 2LJ5A 4XC2A 2KANA 5KHOA 4A20A 2XNAC 2FUHB 4G0NB 2PMVA 2IDYA 3AE5B 4OVZA 3TMPB 1VZ6A 2KWUB 4FHJA 1AN8A 1TT5B 4K81A 1UGMA 1VRAB 1YOVB 4BFRA 2WX1A 1XT9B 5G55A 2FUG1 4R3DA 3MFGA 2GBKA 3JVZX 2MBOA 1WXVA 4MDKE 2Y5PA 3DOWA 1XLNA 4DHZB 1WXMA 1WGYA 2MEKA 1GG3A 3KYDD 2EKEC 3DBLI 5L95C 1ZXHA 2NVUI 1FFVA 2FIDA 4BBNF 3AV8A 2BYFA 4HPLB 4RF0A 2LMCA 4ZRIA 2GB1A 2K5PA 2KFKB 1E90A 1ZDXA 2R2OA 3W1YA 2BKFA 1IBXB 3VR9B 4P6VF 3ZYYX 4C80A 2N9EB 1LM8B 1LXDA 1FMAD 4XWTA 4G3XB 2KOXA 5LXHA 2KQ7A 1TY2A 1V1PB 1WXSA 5BO4B 4ZHPA 3RNAC 2NBWB 4ANWA 1MG8A 1IBXA 2MLBA 3C8YA 3SHQA 1TTNA 3VTVA 2DENB 4MSMB 4RH6A 2QJLA 4IUMB 5CHFA 2HE7A 4PS7A 4MH0E 2WP9B 3N1YC 1TKEA 3EC8A 1NYRA 3AE6B 2BYEA 1V1PA 2BT6A 2JY6A 3N1ZC 4LNFA 3BYYB 3Q3NC 1VD2A 1CK1A 3U2SC 3QQ8B 2K39A 1H8CA 4IOIE 3NOBA 2JUOA 3W2DA 4LDTB 3KWLA 5JH5C 1PQSA 1YJIA 2WQYB 3AEGB 5HHDG 5H8YE 2KN5A 1RWSA 4M8MA 5AEKB 3RPFC 1WMHA 1F9JA 3ML9A 2B76B 3NUHB 3U30A 1Z5SB 2UWQA 3B9JA 2RPQA 4W9KA 1BT0A 2C7NB 2BPSA 2ZEQA 5E6JA 3ZRCA 1GC7A 3EA6A 3CSTA 3NS1A 1GC6A 1RRBA 2DAJA 4W9DA 5IA7A 3KUZA 3S2AA 3BK2A 1E8ZA 1VCBA 3PSEB 1P0RA 1GNUA 1OFFA 3T9LA 1WR1A 4KZ0A 2J53A 1Q0WB 4NAWB 4BKSA 3OJ4B 3UF8A 1CQVA 2JXXA 4BKTA 5BYSA 2WXIA 1YN5A 2PE9A 3TL5A 1N61A 4ZRPA 2ONQA 4LNIA 2WXLA 1WGRA 2ZPYA 3IAM1 4E71A 1QOAA 1TZ1A 4MACA 3UINB 5D94A 2KDBA 1TYGB 1ZXIA 3I63C 2OEDA 2JXTA 4ZDVA 1GAQB 2FAZA 4GGQA 2VH2A 1WZ3A 2JU6X 1T0YA 5AZGA 2OJWA 2KXJA 4L23A 1QZEA 4URKA 1F1HA 1SF0A 4A90A 4US8A 2KDEB 1NI3A 2KMCA 4ANXA 2EKIA 4MGIE 1V1OA 2M56B 4HLEA 1FCCC 3QCAA 1T5XD 2L32A 2TSSA 5IP4D 4F8CB 2ZCBA 2JZ3B 5LNK1 1EU3A 4XYCA 3KVFB 2N9XA 3DVNU 4HPPA 1K53A 4HWIB 2GBJA 1CJEA 1EF5A 3CF6E 4TQ0A 1OEYJ 2G4DB 1F77A 2KMMA 3C0RB 1BXTA 2CR5A 4IDIA 3P1MA 3UI3A 2QDFA 3VDZA 2C5LC 4HDOA 1TS4A 3GE8C 2ZVNA 4GIVA 3GB1A 4HVBA 4ZRKA 4A8XC 2WDVB 3KWVA 2A5UA 1QT9A 1PGAA 2LGSA 2IO1B 1UH6A 3W5UB 2K3UA 2Q5WD 2JX5A 4XDCA 3IHPC 3E9SA 1K8RB 3H1UA 2IJ0A 2SAKA 4ITKA 1ZDVA 4RF1A 1JRUA 2G9HD 4DHZE 3PZ8A 4II3B 1NDDA 3NJTA 3DHHC 2KJ6A 3QX1A 2ZNVC 2O6VD 4UDUC 3VR8B 2CKHB 2KT7A 4I6PA 1ET6A 3X23A 1XQQA 2W3RA 3SFEB 4EKUA 4L2YA 3SD5A 1VZ7A 2KWDA 3IFWB 3OJ3A 2L05A 1XXGA 2L8JA 3NVVA 2IBIB 2KO3A 4WIPA 3EGRA 2KX3A 4RCOA 2N0SB 1I35A 1HZ6A 4DXFA 3NZSA 2J52A 2D3AA 3Q6BA 1L4DB 3ZJUA 5DPSA 3EUB2 3OWEB 3W1SA 3AECB 5JXVA 2MX2A 4MH8A 3PLVA 3RULA 1C79A 2D3GA 3NVZA 4FLHA 4K7WA 3AE7B 1D6EC 4MEMA 1YQ3B 3E56A 3RN9C 5IAAC 3CSFA 4NQLB 2KC2A 1WZ0A 2WXGA 2B3AA 4IWOA 4DQOC 3VQIA 2LXCA 1IPGA 2M1MA 1ZE3D 4MELA 4W9FA 2HD5B 1NBFC 3R3MA 4YSYB 3VUYA 3CIRB 2GBMA 3JSVB 3B08A 1J19A 4WWMA 2I38A 2IO2B 1V5TA 4I6LB 3V3XA 2KTRB 1MJDA 1XLOA 4IM3A 4WWPA 2QCZA 2QMTA 2IYDB 3X0WA 4PK1A 2KMAA 3HRDD 1WGDA 3W9CB 4WWNA 4CQNA 4HCPB 2MH7A 1Y8RC 1KTKA 1WIAA 3JSVA 4LNKA 3MTNB 3OG5A 4ZYNA 2KTRA 4B9KA 2MBBB 4NY0A 4BZAA 1Z2MA 3V05A 1C77A 3V61A 3TCAA 3IT4B 3Q69A 1I4QA 2CJOA 1QF6A 1YNTE 4J3OD 2MHJA 2WYQA 2JSVX 2JWUA 3T3NA 2NPTB 5HI1A 3I5JC 4YSXB 4DWFA 4GN1A 1V86A 2JZZA 4ZYSA 2Y5CA 2K1FA 3TEXA 3RI7C 1L0VB 2IPKD 4NQKE 3VUXA 4IW0A 2NR2A 3WAPA 4AJYB 4WURA 3ZLZA 2INCC 2EMTA 2L76A 3RNBC 2MCNB 1ACCA 2NPTA 2DZIA 3PS6A 2VH1A 1WX9A 3WANA 4PS8A 3RMKC 3P2BA 1OQYA 3A1QB 4LK0M 5AZHA 5GXGB 3N9YC 1BMLC 4BOZB 4DHJB 4IC7B 3R8BA 2L1AA 1E0ZA 1UWXA 1JWSD 2K22A 2WXOA 2GMIC 2RSUA 4JLCA 4XX5A 1Q10A 1DGJA 3AU4A 4HROA 1GJZA 3HHMA 2BS3B 1TKGA 1LGRA 2WXKA 2UU7A 5E6NA 5LLIA 1UUPA 3ZRFA 1RYJA 4P1CC 3A1QA 3PV1A 2MJDA 3MC0B 2PVOD 3KLSX 5G5GA 2AL3A 3I3TB 2J0KA 1WE7A 4ARCA 1FEHA 3QAQA 4AS1A 1JWBD 3AEBB 3Q3JA 4AJWA 2MBEA 3P4RB 4FJZA 4LNNA 2VRRB 3AB5A 1JRPA 1JWMD 2KQSA 3FKYA 4W9HA 3PZDA 5GMVA 3B0AA 4BVUC 1UBQA 3VRAB 2BYVE 3N20C 1E10A 4LDTD 2KLGA 1WFYA 2MWSB 2NS5A 3VH3B 2L3ZA 3IXSA 1N60A 1C4AA 2REXA 2L0TA 5CHVC 1L0XB 2BYTA 4C00A 4W9GA 1A70A 2WXRA 1WJNA 4RGNA 2GRIA 3ECIA 3SFDB 3ZJVA 5G2NA 3P42A 1V2YA 1K52A 4BKSD 3J9CA 1I4GA 3RZWC 4XE0A 2FBWB 2KNBA 2XN9C 1RFAA 1XLPA 1F0ZA 4H2AA 1E7PB 4EZJA 1ZPSA 1NYQA 2FE8A 3NVYA 4MT5A 3AE1B 3QIJA 4C56C 1WGGA 3MJWA 2Z8LA 3QARA 4S0RA 1KLVA 2LEKA 2Z0EB 3AEEB 3IT6B 2AX5A 3TJPA 4C7ZA 3DBSA 4TKNA 1AYFA 2LVPA 1PGXA 2WXJA 4P1BC 4PYZA 4FHKA 4LLGM 2QEJC 3ZUNA 3AXCA 3Q8BA 4XZ4A 1SSNA 2KFKA 2PLPA 1VJKA 2WXPA 4FN2A 2J4XA 3AE3B 1AW7A 4ANUA 2JVCA 3VTWA 3RNCC 2OHFA 4KKIA 2KDIA 3VTUA 1XF5L 2KD0A 1R4MB 3IVFA 3LDZE 5JHBA 3MJ5A 4GXBA 2LVOA 1EM7A 4HEA1 1ENFA 2VZKB 1MI0A 4ICVA 4KDLB 5EE3A 1B1ZA 2BBCA 2KDFB 2K8HA 4A9AA 5TSSA 1E5WA 3C19A 3H7PB 2IGGA 4W9CA 2D07B 3DBRI 2J0JA 3PREA 4A6QA 2KN4A 2RD0A 4M00A 3L08A 1SXTA 1SE9A 4DXAB 1JMLA 1ROEA 3FILB 2AWTA 3FC4A 3ZQ4A 3M95A 1L7YA 3V60A 3H7PA 2CHXA 4HJGE 1K51A 1SJHD 1WX7A 3HM3A 3Q3MC 3V6EB 5CHWA 2CU1A 2N9LA 3HIZA 4G11A 2BQQA 3HVDA 4DDID 1KLUD 4NZLB 2K8BA 1JWUD 1DOIA 2ZNVB 2WDTB 2UYZB 2PVGC 3FILA 4JIOU 2QC8A 1N6ZA 1DYQA 4KGTA 3WA0A 2QILA 3DVGY 3AULA 1JCKB 1WRDB 2KQ4X 2V3NA 1E8XA 3DDCB 2BKRB 4LNOA 2V9HA 3R7RA 3PHWB 1WGKA 3R66C 1YQ4B 1FRRA 1L0YB 1EWCA 3PRMB 2L7RA 4RM8A 3BWUD 2HJ8A 3DWMA 3O65B 4RGOS 3CMMB 2LHEA 4NAMA 1X1MA 2LXAA 3BY4B 3PHXB 4NAWA 3AE2B 5C3JB 2G3QB 3APCA 4XGAB 4GU2A 2ON8A 2DNFA 2IY0B 2K25A 1SE3A 1N5WA 3T8MA 2BS4B 1V6EA 1V97A 3TEZA 2LJIA 1WH3A 4TUUA 2C60A 1FNUA 2AQ1B 2XK5B 2SEBD 2ZW1A 3PRZA 3DBLB 1P98A 4IKGA 3CWIA 5CX3A 4EZKA 2INDC 2KC1A 2N7JA 3APFA 4WAFA 4BOSC 2W82A 3OAWA 2DBYA 1WR6E 2GLSA 1YX6B 4GB9A 2YEPF 2AQ2B 3DPDA 2XK5A 1WF9A 2WXMA 3A4SC 2JYEA 1J7AA 5G5HA 4KIKB 4WAAA 1PUTA 4OZBA 1OEYA 2ZPNA 4PS3A 1P9DU 1UELA 1V81A 3WAOA 2R2QA 1GPXA 1I4PA 4GDKB 1TJEA 2QHOA 3ZTCA 2PE6B 2I1KA 1FD6A 1ZKHA 1LFDA 5D6JB 3VH4B 3U4EG 1IUEA 3HVZA 4KIKA 4EZLA 1STEA 1WM2A 3U52E 1AWDA 4RFBA 3KUCB 2G1EA 1I7HA 1I4HA 4TV3A 3VHTC 2MRPA 2FCNA 2KJHB 3V6CB 1IYFA 4ARIA 1HA5A 2PEAA 4GDKA 4CO7A 1I4RA 1ZOYB 1TKYA 3JW0X 4HDQA 3PPAA 4HPMB 1WXQA 4JGHB 3RZFA 1E7UA 4IWPA 3N30A 3BINA 4TQ1A 5D3IB 1JROA 4IM0A 4OZAA 1NI2A 1YX5B 2KX0A 2E6XA 2L83A 4RMAA 3UIOB 2MP2B 1HTOA 1N63A 2ZJDA 3U7ZA 3H7SA 5J18A 1A5RA 2LRUA 1L6VA 2GI9A 2WX0A 3PZ7A 5D3DA 1Q5WB 1BUIC 3A4RA 3A9KB 2PIAA 1VLBA 1FNWA 2LUEA 1GB4A 3QA8A 2LI5A 2IY1B 2MP2A 2K6QA 2KJRA 5E6OA 4N9F4 3ZXVA 3ABVB 5C23A 4A3OA 2V4LA 5J2RA 2KWCA 1UD7A 1I4XA 2AYOB 4KSLC 2IO0B 3A9KA 4DHJD 2ZCCA 4ANVA 3ZTDA 4YL8A 2HDEA 4HKQA 2RDGA 2KZRA 1FXAA 1XO3A 4Q2JA 3A9JB 3MC9A 3BVMA 1YJ1A 3P4QB 2N7DA 4W9JA 2J0MA 4FJYA 5FK9C 1V49A 4II2B 1HZ5A 4RGTA 1FXIA 1PYWD 3MHSD 3ML8A 3ZKJC 2WWZA 3B1LX 2WS3B 1WYGA 4FBJB 3B2GA 4K3BA 2NBUA 4GLSC 4BKGA 1FIQA 2KAJA 3A9JA 2DWQA 3AE8B 3WCQA 2EMSA 3NY5A 4NNJB 1RLFA 4ACFA 2OOBB 1UBIA 2D3CA 4K7UA 3I9V1 1FNVA 4FADA 5MPOA 4FULA 3IBEA 2IGDA 4N58A 2RR9A 3VVWB 1GB1A 3I57A 4M0WB 2GOWA 4GMVA 1TS2A 1ZUD2 1UF0A 1SE2A 1TS3A 3PO0A 2BWFA 3TEWA 4KKJA 1FPYA 3AEAB 2RDBC 3JYUA 2CU3A 1QOFA 1YN3A 4HJKA 1ESFA 1XCTL 4B6WA 3Q8EA 2RGFA 2Y5BB 3Q8FA 2IO3B 2N1WA 3BVZA 1R4MI 1YMHE 5I4DA 1MG4A 2QSDA 1E6EB 1EF1A 4M0WA 3AN1A 4MGKE 4WQOB 1HXYD 1WY8A 3L4PA 1LQBA 3ZXRA 2M8SA 2RMMA 2KYWA 4K7SA 1C4CA 1TZOA 1L4ZB 2DYOA 4AP4C 3GZNB 3WAMA 2IGHA 2WXFA 4S17A 4YTNB 1J8CA 4J6IA 3ALBA 2BB5A 1JALA 4P7IA 2N9PC 1ET9A 3GP7A 3H9DA 2JWZA 3DQVA 3NHEB 1ISNA 1UZXB 5BMHA 1KH0A 2EELA 4AUQC 2E3TA 2ZZPB 1R4NB 4GDLB 2N4FA 4WH4A 3AE4B 1WE6A 4FXCA 1N5XA 4MJSB 4ICUA 2V1YA 1SJED 5JHAA 4JE3B 1FRDA 1MVKA 1HE8A 3GE3C 3DVNV 5HFYA 3ZNGC 1OQRA 5DPWA 2W55A 4GDLA 2AQ3B 2VZKD 3ZW3A 4IG7B 1J0GA 4E3CA 5EDSA 3FAHA 4WQMA 1RAXA 1QKZA 4MJSA 3AEFB 1IGCA 2I2YA 2W9NA 1HTQA 3Q8CA 1SB3C 1XEEA 3MHZA 3PGEA 1V80A 2LASA 3KYCD 1PFDA 2YEPB 1PDXA 4C7YA 1WJ6A 3RYTA 1P3QU 2WNMA 1C76A 2HJ1A 3U8ZA 1FXTB 4W9IA 3DBHB 3T3OA 3ETRA 1WRIA 4YSZB 1QQRA 1Y56A 2J7QB 3TIXA 2MJEA 2OJRA 3IG3A 4F1SA 5IKCM 2WU5B 1Q1OA 3P4PB 2NBVB 2D3BA 2D2QA 5EE9A 3TEYA 1D5ZC 3NRZA 2Y3AA 2DZKA 4CHKA 1C4PA 4US9A 1TY0A 4NPNA 3HK0A 2K9XA 4L1BA 2IZVB 3ZNHB 1KFYB 3KUDB 4HK2A 2X8XX 5E6PA 3QHTA 4DBGA 4DK5A 3MC8A 3N3KB 2FCSA 4G50A 1PGBA 1QILA 2V4IB 5FR6A 1D5MC 4W9LA 4EOYA 4GSWA 2JF5A 4LTUA 2LHDA 4JQWC 1L5PA 1QOBA 3RNFC 5AUKA 3EECA 1V9JA 2BVCA 3RFZB 2L00B 4X57B 2CHWA 4YTMB 3DWGC 4B95A 3LYYA 4ZOHC 2ACZB 2NCNA 1UNSA 4B0EA 4EUTA 2MQJA 3NS8A 1CMXB 4HXDA 3VAWA 2H88B 4KGSA 1QLBB 2FCQA 1KJTA 1YJJA 2Z59B 5L83A 1VZ8A 5IN7A 3RT3B 2AEHA 3AH7A 3VFKA 1AARA 1SEBD 2K6DB 1F52A 1HEZE 1JQ4A 2PJHA 2BS2B 1WMHB 2LFIA 4FA6A 4MSQB 2C9WB 1ZW7A 3L17A 1JWAD 2BWES 1WJ4A 1IGDA 3ZGZA 2WXQA 4HRSA 2DZJA 2RPVA 5FR3A 1F2RI 1SIJA 4NJ7A 4KDIC 2R61A 4OVVA 1TS5A 1YN4A 1JW9D 2FIFA 3EHVA 4I6NB 1N62A 4AWJA 1HQRD 4PYUA 3P4SB 5D2MB 4TMAB 3ZNID 3R7QA 1UWMA 3RUIB 5TR5A 5BYQA 3GOEA 3ZDMC 3TBLD 2KVZA 1WM3A 3PLUA 2KVRA 2KHWB 2QIEB 2DYBA 3QC8B 3SR6A 4EEWA 2BW2A 3Q8AA 3ZO5B 2WXNA 2AL6A 3URYA 3BVGA 3M63B 2WU2B 1MHXA 2LGDA 2LUMA 1WSPA 2ASQA 5FKAC 2WXHA 1EU4A 4ZRJA 3RNGC 4NJCA 2JRIB 2MJ3A 4OVUA 4IM2A 3Q14C 3ONSA 1FCLA 4HKZE 2WGSA 2KTFA 2CHZA 2DZMA 1EO6A 2M0XA 2GBNA 3ENEA 1DOXA 1E7VA 2H89B 1C1YB 2XEWA 2J42A 5C2TB 2Z0DB 3M3JA 3AI5A 4ZRQA 3BZDB 3KQ4A 3TSSA 1RM6C 1FO4A 1XCQL 2W3SA 1ZGUB 5J17A 5HKHA 3D32A 2LWPA 4WJNA 4MGZE 1GUAB 1KM7A 3OLMD 4KVGB 4K3CA 4F7ZA 3AM9A 1G6JA 3L16A 3EFCA 1T0SC 3UGBB
chains in the Genus database with same CATH topology
4A3OA 4BOZB 4DHJB 3K9PB 4IC7B 3SHQA 2V4LA 5J2RA 1TTNA 2L0FA 3ZDTA 3VTVA 4JL9A 2GMIC 2DENB 2RSUA 4MSMB 3WIMA 2KWCA 3UIPB 4JLCA 4XX5A 3AU4A 1UD7A 4IUMB 5CHFA 2HE7A 1GJZA 2AYOB 4PS7A 3HHMA 4KSLC 4MH0E 2IO0B 3A9KA 3H6NA 1IP9A 4DHJD 3EC8A 2ZCCA 4ANVA 4IWQA 3ZTDA 4YL8A 1I42A 2BYEA 2LZ6A 5E6NA 5LLIA 2KZRA 2MW5A 2JY6A 3ZRFA 3A1QA 3PV1A 3UQBA 1VD2A 1WJUA 2MSED 2AL3A 3I3TB 4K1RB 3A9JB 3SDLC 3QQ8B 2J0KA 1WE7A 1YJ1A 3QAQA 2K39A 1H8CA 1C3TA 2LVQA 2N7DA 4W9JA 3Q3JA 2J0MA 4FJYA 4AJWA 3ZIMA 2MBEA 3NOBA 2JUOA 4HCNB 4FJZA 4LDTB 1V49A 5JH5C 4II2B 1PQSA 2VRRB 2M4NA 4W9EA 2JPHA 4KV2A 2KQSA 2KN5A 4CYEA 3MHSD 4M8MA 4W9HA 1U4AA 3ML8A 5AEKB 3PZDA 1YIWA 2HTHA 5GMVA 3ZKJC 3B0AA 2WWZA 4BVUC 3B1LX 1WMHA 1F9JA 3ML9A 1UBQA 4FBJB 2BYVE 2G4SA 2LGXA 4WJQA 4LDTD 2KLGA 3U30A 1Z5SB 1WFYA 2MWSB 2NBUA 2NS5A 2UWQA 1TBEA 3QK0A 3VH3B 2L3ZA 4BKGA 3PVLA 2REXA 2RPQA 2L0TA 3A9JA 2KKCA 5CHVC 4EFOA 2EMSA 2O2VB 4W9KA 1WXAA 3HM6X 1RLFA 3NY5A 1BT0A 2OOBB 4NNJB 3QJZA 2YVCA 4WJOA 4W9GA 5DPRA 1UBIA 2BPSA 2C7NB 1OGWA 2ZEQA 3N32A 3QWZB 1WJNA 2I1JA 4K7UA 4KSKC 3ZRCA 1GC7A 4FADA 3CSTA 5DPTA 1P1AA 4FULA 1GC6A 3GZNI 3IBEA 3ECIA 2RR9A 3VVWB 3VUWA 1RRBA 2DAJA 4M0WB 1D3ZA 4W9DA 2GOWA 5G2NA 1M94A 4GMVA 1V2YA 2JT4B 3KH0A 4BKSD 2BWFA 5IA7A 3KUZA 3S2AA 3RZWC 1E8ZA 1VCBA 2KNBA 3PSEB 1S1QB 5AZFA 1P0RA 1GNUA 1RFAA 2V3SA 3JYUA 1H4RA 4HJKA 4B6WA 2CS4A 3L0WB 3T9LA 1WR1A 2O2VA 2RGFA 1R4NI 4KZ0A 2Y5BB 1Q0WB 2IO3B 4NAWB 2N1WA 4BKSA 4EZJA 3OJ4B 3UF8A 1R4MI 2JXXA 4BKTA 1EUVB 2C7HA 4RM9A 1EF1A 4MGKE 4WQOB 2PPHA 2PE9A 3TL5A 1WY8A 3QIJA 2ZVOA 1LQBA 1WGRA 2FNJB 2ZPYA 1WGGA 2M8SA 3MJWA 2MBHA 3QARA 4K7SA 1KLVA 2FCMA 2Z0EB 3TJPA 4E71A 3DBSA 4TKNA 2DYOA 4AP4C 1TZ1A 2LVPA 4AOFA 3WAMA 3UINB 4PYZA 4FHKA 2XBBC 3ZUNA 1J8CA 4J6IA 5D94A 3AXCA 3ALBA 2KDBA 4XZ4A 1L2NA 4P7IA 2KFKA 2N9PC 3H9DA 2G45B 2JWZA 3DQVA 4FN2A 3NHEB 3VXWA 1ISNA 1UZXB 2FAZA 4GGQA 2K8CA 4ZDVA 1WZ3A 3RD2A 4ANUA 3SU8X 1T0YA 4NJ6A 5C1ZA 2DX5B 2JVCA 3VTWA 5AZGA 4AUQC 4ASWC 2KXJA 2KDIA 2ZZPB 4GDLB 1S3SG 2M17A 2N4FA 1QZEA 3VTUA 4URKA 2KD0A 3IVFA 3EFUA 1WE6A 2KDEB 2KMCA 3LDZE 4ANXA 4M8NA 4MJSB 4GXBA 5JHBA 3DBHI 2LVOA 4A3PA 4ICUA 2V1YA 3AU5A 4MGIE 5JHAA 4HLEA 1YQBA 5DCNA 4ICVA 3QCAA 4KDLB 4MM3A 2KDFB 2K8HA 1HE8A 3M62B 4F8CB 3RCZA 2DAFA 1E5WA 2ZCBA 3H7PB 2JZ3B 1WX8A 5JZEB 4W9CA 3DVNV 3ZNGC 2D07B 3DBRI 2J0JA 5DPWA 4GDLA 3KVFB 3DVGX 2N1VA 3PREA 4LJPB 3ZW3A 4IG7B 2N9XA 3DVNU 2RD0A 3K9OB 1J0GA 4E3CA 3L54A 4HWIB 4FJVB 2GBJA 4LJOB 4WJPA 5EDSA 1RAXA 1EF5A 3CF6E 2GBRA 3L08A 1XD3B 4TQ0A 4MJSA 1OEYJ 2G4DB 1WI0A 1TGZB 3C0RB 1SE9A 2CR5A 2W9NA 4DXAB 3PGEA 1V80A 3VDZA 2C5LC 2A4ZA 2LGYA 2LASA 3KYCD 2AWTA 4HDOA 3M95A 1L7YA 4KZCA 3V60A 3H7PA 2CHXA 2KLCA 1WJ6A 2ZVNA 4GIVA 2KFJA 3RYTA 4HVBA 3HM3A 1WX7A 4ZRKA 3V6EB 1P3QU 4MGYE 3U8ZA 2LD9A 1FXTB 2A5UA 5CHWA 2CU1A 4GOCA 3HIZA 4W9IA 4G11A 2IO1B 2D10A 3PT2B 3V62A 1UH6A 1WGHA 2JRHA 4DDID 3PRPB 2K8BA 3IHPC 2BF8B 1K8RB 2J7QB 2DYMA 1V5OA 3H1UA 3TIXA 1OTRB 2ZNVB 2WDTB 2OJRA 2MBQA 5CTRC 1JRUA 3IG3A 2UYZB 4WWOA 2O6VB 4F1SA 2LRWA 3ZVVA 4DHZE 1YD8U 2DHZA 4II3B 1NDDA 1Q1OA 4JIOU 2NBVB 3APDA 3WA0A 2D2QA 2KJ6A 3DVGY 3AULA 1WRDB 2DZKA 1SGHA 3QX1A 2ZNVC 2O6VD 3DDCB 1E8XA 4CHKA 2BKRB 3R7RA 2CKHB 4NPNA 1WYWB 3HK0A 3PHWB 4E74A 2IZVB 3ZNHB 3R66C 4I6PA 3PRMB 2L7RA 4RM8A 3KUDB 3LJ3A 4HK2A 5KHQA 3UQAA 5E6PA 3QHTA 3X23A 4DBGA 1XQQA 4DK5A 2O6VA 2HJ8A 3KW5B 4EKUA 3O65B 3N3KB 2FCSA 3CMMB 3SD5A 4G50A 3IFWB 3OJ3A 2L05A 2L8JA 1X1MA 3NZUA 2IBIB 2KO3A 4LCDE 5FR6A 4W9LA 2LXAA 3BY4B 3PHXB 4EOYA 5LXIB 4NAWA 3U7DA 4GSWA 2KX3A 2JF5A 2G3QB 3PTFC 3APCA 3W1SC 4GU2A 3A33B 1I35A 2IY0B 2K25A 4JQWC 3L13A 3NZSA 3EECA 3T8MA 1V6EA 1V9JA 2KK8A 5DPSA 5D7GA 1E8YA 1WH3A 3W1SA 3DCGA 3Q3FA 4TUUA 2L00B 4X57B 2C60A 2CHWA 2MX2A 4DDGD 3PLVA 2D11A 3RULA 2XK5B 4B95A 2NCNA 3PRZA 4BBNC 4EUTA 2MQJA 3NS8A 1CMXB 1P98A 4HXDA 5CX3A 2D3GA 3VAWA 4EZKA 2FCQA 2KC1A 1KJTA 4FLHA 4K7WA 2Z59B 3APFA 4BOSC 5L83A 2BGFA 4MEMA 3OAWA 5IAAC 3ZNZB 3CSFA 4NQLB 2KC2A 1WZ0A 3RT3B 2AEHA 1WR6E 2B3AA 3VFKA 4IWOA 1AARA 1YX6B 4GB9A 3VQIA 2LXCA 1IPGA 3DPDA 3WALA 2C7MB 2K6DB 2M1MA 2PJHA 2XK5A 1WF9A 3A4SC 1WMHB 4MELA 2YLMA 4W9FA 2HD5B 1NBFC 4KIKB 4WAAA 4FA6A 4MSQB 2C9WB 3R3MA 1ZW7A 3L17A 1OEYA 2BWES 2ZPNA 4PS3A 1WJ4A 3VUYA 2GBMA 3JSVB 3L10B 3B08A 1P9DU 1UELA 2DZJA 1V81A 1J19A 1SIFA 2KWVB 2IO2B 1V5TA 3WAOA 4I6LB 4NJ7A 2R2QA 2KTRB 4KDIC 4OVVA 2MA9B 1KOTA 2N7EA 1E8WA 2FIFA 2LJ5A 3EHVA 4GDKB 4I6NB 4IM3A 2QHOA 4XC2A 3ZTCA 4AWJA 2KANA 2PE6B 4PYUA 4WWPA 5KHOA 2I1KA 5D2MB 4A20A 2FUHB 2IYDB 4G0NB 3X0WA 2KMAA 1ZKHA 1LFDA 5D6JB 3VH4B 3TMPB 3ZNID 1WGDA 3R7QA 4WWNA 4KIKA 2KWUB 4FHJA 4EZLA 3RUIB 4HCPB 5TR5A 1Y8RC 1WM2A 3GOEA 4K81A 1UGMA 3ZDMC 1WIAA 4BFRA 3TBLD 2WX1A 3KUCB 1XT9B 5G55A 1WM3A 3JSVA 3PLUA 2KVRA 3MTNB 4TV3A 2KHWB 2MRPA 3VHTC 2DYBA 2FCNA 4ZYNA 2KJHB 2KTRA 2GBKA 3QC8B 3JVZX 4B9KA 3V6CB 2MBOA 1WXVA 2MBBB 4MDKE 4EEWA 1IYFA 4NY0A 2PEAA 1Z2MA 4GDKA 4CO7A 3DOWA 4DHZB 3V61A 3TCAA 3ZO5B 2AL6A 3JW0X 3M63B 4HDQA 2LGDA 3PPAA 4HPMB 1WXMA 1WGYA 1GG3A 3KYDD 4JGHB 1E7UA 2EKEC 3DBLI 3N30A 4IWPA 3RZFA 3BINA 5L95C 2ASQA 2WYQA 4TQ1A 2NVUI 4ZRJA 2FIDA 4BBNF 2JRIB 2BYFA 4HPLB 4OVUA 4IM2A 2NPTB 4IM0A 3ONSA 4ZRIA 1NI2A 1YX5B 2KTFA 2KX0A 4DWFA 2CHZA 2DZMA 1EO6A 4GN1A 2M0XA 2GBNA 1V86A 2JZZA 4RMAA 3UIOB 2MP2B 3ENEA 2K1FA 2KFKB 1E90A 2R2OA 2ZJDA 3W1YA 2BKFA 4NQKE 3VUXA 1E7VA 4IW0A 2NR2A 3H7SA 3WAPA 4AJYB 5J18A 1C1YB 2XEWA 2LRUA 3ZLZA 1A5RA 2Z0DB 2EMTA 2N9EB 1LM8B 3M3JA 2L76A 3AI5A 2WX0A 2MCNB 1Q5WB 3A4RA 1LXDA 2NPTA 1ZGUB 5J17A 5HKHA 3A9KB 2DZIA 3D32A 2LWPA 3PS6A 4WJNA 4MGZE 1WX9A 3WANA 4G3XB 4PS8A 2LUEA 2KOXA 3P2BA 5LXHA 2KQ7A 3QA8A 1GUAB 2LI5A 2IY1B 2MP2A 1OQYA 1WXSA 1KM7A 2K6QA 2KJRA 5BO4B 3OLMD 5E6OA 2NBWB 3A1QB 4KVGB 4N9F4 4F7ZA 1G6JA 4ANWA 5AZHA 3UGBB 3L16A 1MG8A 5C23A 2MLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3O A;  4BOZ B;  4DHJ B;  3K9P B;  4IC7 B;  3SHQ A;  2V4L A;  5J2R A;  1TTN A;  2L0F A;  3ZDT A;  3VTV A;  4JL9 A;  2GMI C;  2DEN B;  2RSU A;  4MSM B;  3WIM A;  2KWC A;  3UIP B;  4JLC A;  4XX5 A;  3AU4 A;  1UD7 A;  4IUM B;  5CHF A;  2HE7 A;  1GJZ A;  2AYO B;  4PS7 A;  3HHM A;  4KSL C;  4MH0 E;  2IO0 B;  3A9K A;  3H6N A;  1IP9 A;  4DHJ D;  3EC8 A;  2ZCC A;  4ANV A;  4IWQ A;  3ZTD A;  4YL8 A;  1I42 A;  2BYE A;  2LZ6 A;  5E6N A;  5LLI A;  2KZR A;  2MW5 A;  2JY6 A;  3ZRF A;  3A1Q A;  3PV1 A;  3UQB A;  1VD2 A;  1WJU A;  2MSE D;  2AL3 A;  3I3T B;  4K1R B;  3A9J B;  3SDL C;  3QQ8 B;  2J0K A;  1WE7 A;  1YJ1 A;  3QAQ A;  2K39 A;  1H8C A;  1C3T A;  2LVQ A;  2N7D A;  4W9J A;  3Q3J A;  2J0M A;  4FJY A;  4AJW A;  3ZIM A;  2MBE A;  3NOB A;  2JUO A;  4HCN B;  4FJZ A;  4LDT B;  1V49 A;  5JH5 C;  4II2 B;  1PQS A;  2VRR B;  2M4N A;  4W9E A;  2JPH A;  4KV2 A;  2KQS A;  2KN5 A;  4CYE A;  3MHS D;  4M8M A;  4W9H A;  1U4A A;  3ML8 A;  5AEK B;  3PZD A;  1YIW A;  2HTH A;  5GMV A;  3ZKJ C;  3B0A A;  2WWZ A;  4BVU C;  3B1L X;  1WMH A;  1F9J A;  3ML9 A;  1UBQ A;  4FBJ B;  2BYV E;  2G4S A;  2LGX A;  4WJQ A;  4LDT D;  2KLG A;  3U30 A;  1Z5S B;  1WFY A;  2MWS B;  2NBU A;  2NS5 A;  2UWQ A;  1TBE A;  3QK0 A;  3VH3 B;  2L3Z A;  4BKG A;  3PVL A;  2REX A;  2RPQ A;  2L0T A;  3A9J A;  2KKC A;  5CHV C;  4EFO A;  2EMS A;  2O2V B;  4W9K A;  1WXA A;  3HM6 X;  1RLF A;  3NY5 A;  1BT0 A;  2OOB B;  4NNJ B;  3QJZ A;  2YVC A;  4WJO A;  4W9G A;  5DPR A;  1UBI A;  2BPS A;  2C7N B;  1OGW A;  2ZEQ A;  3N32 A;  3QWZ B;  1WJN A;  2I1J A;  4K7U A;  4KSK C;  3ZRC A;  1GC7 A;  4FAD A;  3CST A;  5DPT A;  1P1A A;  4FUL A;  1GC6 A;  3GZN I;  3IBE A;  3ECI A;  2RR9 A;  3VVW B;  3VUW A;  1RRB A;  2DAJ A;  4M0W B;  1D3Z A;  4W9D A;  2GOW A;  5G2N A;  1M94 A;  4GMV A;  1V2Y A;  2JT4 B;  3KH0 A;  4BKS D;  2BWF A;  5IA7 A;  3KUZ A;  3S2A A;  3RZW C;  1E8Z A;  1VCB A;  2KNB A;  3PSE B;  1S1Q B;  5AZF A;  1P0R A;  1GNU A;  1RFA A;  2V3S A;  3JYU A;  1H4R A;  4HJK A;  4B6W A;  2CS4 A;  3L0W B;  3T9L A;  1WR1 A;  2O2V A;  2RGF A;  1R4N I;  4KZ0 A;  2Y5B B;  1Q0W B;  2IO3 B;  4NAW B;  2N1W A;  4BKS A;  4EZJ A;  3OJ4 B;  3UF8 A;  1R4M I;  2JXX A;  4BKT A;  1EUV B;  2C7H A;  4RM9 A;  1EF1 A;  4MGK E;  4WQO B;  2PPH A;  2PE9 A;  3TL5 A;  1WY8 A;  3QIJ A;  2ZVO A;  1LQB A;  1WGR A;  2FNJ B;  2ZPY A;  1WGG A;  2M8S A;  3MJW A;  2MBH A;  3QAR A;  4K7S A;  1KLV A;  2FCM A;  2Z0E B;  3TJP A;  4E71 A;  3DBS A;  4TKN A;  2DYO A;  4AP4 C;  1TZ1 A;  2LVP A;  4AOF A;  3WAM A;  3UIN B;  4PYZ A;  4FHK A;  2XBB C;  3ZUN A;  1J8C A;  4J6I A;  5D94 A;  3AXC A;  3ALB A;  2KDB A;  4XZ4 A;  1L2N A;  4P7I A;  2KFK A;  2N9P C;  3H9D A;  2G45 B;  2JWZ A;  3DQV A;  4FN2 A;  3NHE B;  3VXW A;  1ISN A;  1UZX B;  2FAZ A;  4GGQ A;  2K8C A;  4ZDV A;  1WZ3 A;  3RD2 A;  4ANU A;  3SU8 X;  1T0Y A;  4NJ6 A;  5C1Z A;  2DX5 B;  2JVC A;  3VTW A;  5AZG A;  4AUQ C;  4ASW C;  2KXJ A;  2KDI A;  2ZZP B;  4GDL B;  1S3S G;  2M17 A;  2N4F A;  1QZE A;  3VTU A;  4URK A;  2KD0 A;  3IVF A;  3EFU A;  1WE6 A;  2KDE B;  2KMC A;  3LDZ E;  4ANX A;  4M8N A;  4MJS B;  4GXB A;  5JHB A;  3DBH I;  2LVO A;  4A3P A;  4ICU A;  2V1Y A;  3AU5 A;  4MGI E;  5JHA A;  4HLE A;  1YQB A;  5DCN A;  4ICV A;  3QCA A;  4KDL B;  4MM3 A;  2KDF B;  2K8H A;  1HE8 A;  3M62 B;  4F8C B;  3RCZ A;  2DAF A;  1E5W A;  2ZCB A;  3H7P B;  2JZ3 B;  1WX8 A;  5JZE B;  4W9C A;  3DVN V;  3ZNG C;  2D07 B;  3DBR I;  2J0J A;  5DPW A;  4GDL A;  3KVF B;  3DVG X;  2N1V A;  3PRE A;  4LJP B;  3ZW3 A;  4IG7 B;  2N9X A;  3DVN U;  2RD0 A;  3K9O B;  1J0G A;  4E3C A;  3L54 A;  4HWI B;  4FJV B;  2GBJ A;  4LJO B;  4WJP A;  5EDS A;  1RAX A;  1EF5 A;  3CF6 E;  2GBR A;  3L08 A;  1XD3 B;  4TQ0 A;  4MJS A;  1OEY J;  2G4D B;  1WI0 A;  1TGZ B;  3C0R B;  1SE9 A;  2CR5 A;  2W9N A;  4DXA B;  3PGE A;  1V80 A;  3VDZ A;  2C5L C;  2A4Z A;  2LGY A;  2LAS A;  3KYC D;  2AWT A;  4HDO A;  3M95 A;  1L7Y A;  4KZC A;  3V60 A;  3H7P A;  2CHX A;  2KLC A;  1WJ6 A;  2ZVN A;  4GIV A;  2KFJ A;  3RYT A;  4HVB A;  3HM3 A;  1WX7 A;  4ZRK A;  3V6E B;  1P3Q U;  4MGY E;  3U8Z A;  2LD9 A;  1FXT B;  2A5U A;  5CHW A;  2CU1 A;  4GOC A;  3HIZ A;  4W9I A;  4G11 A;  2IO1 B;  2D10 A;  3PT2 B;  3V62 A;  1UH6 A;  1WGH A;  2JRH A;  4DDI D;  3PRP B;  2K8B A;  3IHP C;  2BF8 B;  1K8R B;  2J7Q B;  2DYM A;  1V5O A;  3H1U A;  3TIX A;  1OTR B;  2ZNV B;  2WDT B;  2OJR A;  2MBQ A;  5CTR C;  1JRU A;  3IG3 A;  2UYZ B;  4WWO A;  2O6V B;  4F1S A;  2LRW A;  3ZVV A;  4DHZ E;  1YD8 U;  2DHZ A;  4II3 B;  1NDD A;  1Q1O A;  4JIO U;  2NBV B;  3APD A;  3WA0 A;  2D2Q A;  2KJ6 A;  3DVG Y;  3AUL A;  1WRD B;  2DZK A;  1SGH A;  3QX1 A;  2ZNV C;  2O6V D;  3DDC B;  1E8X A;  4CHK A;  2BKR B;  3R7R A;  2CKH B;  4NPN A;  1WYW B;  3HK0 A;  3PHW B;  4E74 A;  2IZV B;  3ZNH B;  3R66 C;  4I6P A;  3PRM B;  2L7R A;  4RM8 A;  3KUD B;  3LJ3 A;  4HK2 A;  5KHQ A;  3UQA A;  5E6P A;  3QHT A;  3X23 A;  4DBG A;  1XQQ A;  4DK5 A;  2O6V A;  2HJ8 A;  3KW5 B;  4EKU A;  3O65 B;  3N3K B;  2FCS A;  3CMM B;  3SD5 A;  4G50 A;  3IFW B;  3OJ3 A;  2L05 A;  2L8J A;  1X1M A;  3NZU A;  2IBI B;  2KO3 A;  4LCD E;  5FR6 A;  4W9L A;  2LXA A;  3BY4 B;  3PHX B;  4EOY A;  5LXI B;  4NAW A;  3U7D A;  4GSW A;  2KX3 A;  2JF5 A;  2G3Q B;  3PTF C;  3APC A;  3W1S C;  4GU2 A;  3A33 B;  1I35 A;  2IY0 B;  2K25 A;  4JQW C;  3L13 A;  3NZS A;  3EEC A;  3T8M A;  1V6E A;  1V9J A;  2KK8 A;  5DPS A;  5D7G A;  1E8Y A;  1WH3 A;  3W1S A;  3DCG A;  3Q3F A;  4TUU A;  2L00 B;  4X57 B;  2C60 A;  2CHW A;  2MX2 A;  4DDG D;  3PLV A;  2D11 A;  3RUL A;  2XK5 B;  4B95 A;  2NCN A;  3PRZ A;  4BBN C;  4EUT A;  2MQJ A;  3NS8 A;  1CMX B;  1P98 A;  4HXD A;  5CX3 A;  2D3G A;  3VAW A;  4EZK A;  2FCQ A;  2KC1 A;  1KJT A;  4FLH A;  4K7W A;  2Z59 B;  3APF A;  4BOS C;  5L83 A;  2BGF A;  4MEM A;  3OAW A;  5IAA C;  3ZNZ B;  3CSF A;  4NQL B;  2KC2 A;  1WZ0 A;  3RT3 B;  2AEH A;  1WR6 E;  2B3A A;  3VFK A;  4IWO A;  1AAR A;  1YX6 B;  4GB9 A;  3VQI A;  2LXC A;  1IPG A;  3DPD A;  3WAL A;  2C7M B;  2K6D B;  2M1M A;  2PJH A;  2XK5 A;  1WF9 A;  3A4S C;  1WMH B;  4MEL A;  2YLM A;  4W9F A;  2HD5 B;  1NBF C;  4KIK B;  4WAA A;  4FA6 A;  4MSQ B;  2C9W B;  3R3M A;  1ZW7 A;  3L17 A;  1OEY A;  2BWE S;  2ZPN A;  4PS3 A;  1WJ4 A;  3VUY A;  2GBM A;  3JSV B;  3L10 B;  3B08 A;  1P9D U;  1UEL A;  2DZJ A;  1V81 A;  1J19 A;  1SIF A;  2KWV B;  2IO2 B;  1V5T A;  3WAO A;  4I6L B;  4NJ7 A;  2R2Q A;  2KTR B;  4KDI C;  4OVV A;  2MA9 B;  1KOT A;  2N7E A;  1E8W A;  2FIF A;  2LJ5 A;  3EHV A;  4GDK B;  4I6N B;  4IM3 A;  2QHO A;  4XC2 A;  3ZTC A;  4AWJ A;  2KAN A;  2PE6 B;  4PYU A;  4WWP A;  5KHO A;  2I1K A;  5D2M B;  4A20 A;  2FUH B;  2IYD B;  4G0N B;  3X0W A;  2KMA A;  1ZKH A;  1LFD A;  5D6J B;  3VH4 B;  3TMP B;  3ZNI D;  1WGD A;  3R7Q A;  4WWN A;  4KIK A;  2KWU B;  4FHJ A;  4EZL A;  3RUI B;  4HCP B;  5TR5 A;  1Y8R C;  1WM2 A;  3GOE A;  4K81 A;  1UGM A;  3ZDM C;  1WIA A;  4BFR A;  3TBL D;  2WX1 A;  3KUC B;  1XT9 B;  5G55 A;  1WM3 A;  3JSV A;  3PLU A;  2KVR A;  3MTN B;  4TV3 A;  2KHW B;  2MRP A;  3VHT C;  2DYB A;  2FCN A;  4ZYN A;  2KJH B;  2KTR A;  2GBK A;  3QC8 B;  3JVZ X;  4B9K A;  3V6C B;  2MBO A;  1WXV A;  2MBB B;  4MDK E;  4EEW A;  1IYF A;  4NY0 A;  2PEA A;  1Z2M A;  4GDK A;  4CO7 A;  3DOW A;  4DHZ B;  3V61 A;  3TCA A;  3ZO5 B;  2AL6 A;  3JW0 X;  3M63 B;  4HDQ A;  2LGD A;  3PPA A;  4HPM B;  1WXM A;  1WGY A;  1GG3 A;  3KYD D;  4JGH B;  1E7U A;  2EKE C;  3DBL I;  3N30 A;  4IWP A;  3RZF A;  3BIN A;  5L95 C;  2ASQ A;  2WYQ A;  4TQ1 A;  2NVU I;  4ZRJ A;  2FID A;  4BBN F;  2JRI B;  2BYF A;  4HPL B;  4OVU A;  4IM2 A;  2NPT B;  4IM0 A;  3ONS A;  4ZRI A;  1NI2 A;  1YX5 B;  2KTF A;  2KX0 A;  4DWF A;  2CHZ A;  2DZM A;  1EO6 A;  4GN1 A;  2M0X A;  2GBN A;  1V86 A;  2JZZ A;  4RMA A;  3UIO B;  2MP2 B;  3ENE A;  2K1F A;  2KFK B;  1E90 A;  2R2O A;  2ZJD A;  3W1Y A;  2BKF A;  4NQK E;  3VUX A;  1E7V A;  4IW0 A;  2NR2 A;  3H7S A;  3WAP A;  4AJY B;  5J18 A;  1C1Y B;  2XEW A;  2LRU A;  3ZLZ A;  1A5R A;  2Z0D B;  2EMT A;  2N9E B;  1LM8 B;  3M3J A;  2L76 A;  3AI5 A;  2WX0 A;  2MCN B;  1Q5W B;  3A4R A;  1LXD A;  2NPT A;  1ZGU B;  5J17 A;  5HKH A;  3A9K B;  2DZI A;  3D32 A;  2LWP A;  3PS6 A;  4WJN A;  4MGZ E;  1WX9 A;  3WAN A;  4G3X B;  4PS8 A;  2LUE A;  2KOX A;  3P2B A;  5LXH A;  2KQ7 A;  3QA8 A;  1GUA B;  2LI5 A;  2IY1 B;  2MP2 A;  1OQY A;  1WXS A;  1KM7 A;  2K6Q A;  2KJR A;  5BO4 B;  3OLM D;  5E6O A;  2NBW B;  3A1Q B;  4KVG B;  4N9F 4;  4F7Z A;  1G6J A;  4ANW A;  5AZH A;  3UGB B;  3L16 A;  1MG8 A;  5C23 A;  2MLB A; 
#chains in the Genus database with same CATH topology
 3K9P B;  1L6U A;  4QAY A;  2L0F A;  3ZDT A;  4JL9 A;  3WIM A;  3UIP B;  1P7F A;  1QOG A;  1IP9 A;  3H6N A;  1GOZ A;  5EE1 A;  1T0R C;  3NG0 A;  4IWQ A;  4JPS A;  1I42 A;  2LZ6 A;  2MW5 A;  2WDQ B;  3UQB A;  1WJU A;  2MSE D;  3Q2A C;  4K1R B;  3SDL C;  4BAX A;  4RNA A;  1C3T A;  2LVQ A;  2N9K A;  3DHI C;  3ZIM A;  1WWT A;  4HCN B;  1P7E A;  2JZP A;  4YXD B;  2M4N A;  4W9E A;  2JPH A;  4KV2 A;  3MP9 A;  4CYE A;  2NTT A;  1DOY A;  1U4A A;  3RNE C;  2WHI A;  1YIW A;  2HTH A;  4KX6 B;  2JQR B;  2INN E;  1UGJ A;  2G4S A;  2LGX A;  4WJQ A;  2K0P A;  1TBE A;  3QK0 A;  1KLG D;  2KAC A;  2V0G A;  3PVL A;  2KKC A;  4EFO A;  2O2V B;  1T3Q A;  1WXA A;  3HM6 X;  1XLQ A;  3SEB A;  3QJZ A;  2YVC A;  4WJO A;  5DPR A;  3QWZ B;  1OGW A;  3N32 A;  1CZP A;  2I1J A;  1C9F A;  4KSK C;  1T0Q C;  2BTE A;  5IO9 A;  5DPT A;  2BB6 A;  1P1A A;  5BYR A;  3GZN I;  3VUW A;  1E9M A;  1D3Z A;  2NMQ A;  1M94 A;  2JT4 B;  3P63 A;  1KRH A;  3KH0 A;  4D2K A;  4N6E B;  4JX1 C;  2LGI A;  1S1Q B;  3LXF A;  4XDD A;  5AZF A;  2V3S A;  3DBR B;  1H4R A;  2CS4 A;  3L0W B;  2O2V A;  1R4N I;  3AMZ A;  5AUI A;  1VDV A;  1EUV B;  3TUO A;  2C7H A;  4RM9 A;  4OHJ A;  5BMG A;  2PPH A;  3H8H A;  3IAS 1;  3DHG C;  2ZVO A;  4TSS A;  2FNJ B;  5EE0 A;  2MBH A;  2FCM A;  1M4V A;  1R7S A;  2V3P A;  4AOF A;  2XBB C;  1L2N A;  1EWY C;  4PT5 A;  2G45 B;  3VXW A;  2K8C A;  4MM3 B;  3RD2 A;  2ZW0 A;  4OW0 A;  2PW9 A;  4NJ6 A;  3SU8 X;  5C1Z A;  2DX5 B;  1VR9 A;  4RGM A;  2DLB A;  2NTS A;  4JWS C;  4ASW C;  1KF6 B;  1S3S G;  2M17 A;  2WDR B;  3AE9 B;  3EFU A;  4C4V B;  1FM0 D;  1NEN B;  1FFU A;  4M8N A;  3DBH I;  3Q3O C;  4A3P A;  1V8C A;  2PKO A;  3AU5 A;  4M01 A;  4REZ A;  1B9R A;  1K50 A;  1YQB A;  5DCN A;  4ZHO A;  3NZ3 A;  4MM3 A;  3R2I A;  2M19 A;  3M62 B;  3RCZ A;  2DAF A;  1WX8 A;  5JZE B;  3DVG X;  2N1V A;  4LJP B;  3K9O B;  1J7B A;  3L54 A;  4FJV B;  4LJO B;  4WJP A;  4C4V A;  2KDM A;  2X38 A;  2GBR A;  1XD3 B;  3B2F A;  1WI0 A;  1TGZ B;  2D5G A;  2LGY A;  2A4Z A;  5IOI A;  3O13 A;  5T8I A;  4YT0 B;  4P16 A;  4JWU C;  4KZC A;  2KLC A;  2KFJ A;  4MGY E;  2LD9 A;  3R2T A;  4GOC A;  2D10 A;  4XWW A;  2JYT A;  3PT2 B;  3V62 A;  1WGH A;  2JRH A;  3PRP B;  4YWG G;  2BF8 B;  2DYM A;  1V5O A;  4OZC A;  1OTR B;  1SE4 A;  2MBQ A;  5CTR C;  4WWO A;  2O6V B;  2LRW A;  1J7C A;  3ZVV A;  3BII D;  1YD8 U;  2DHZ A;  4KGR A;  2CJN A;  3APD A;  2INP E;  5H92 C;  1SGH A;  3LB8 C;  1WYW B;  2W54 A;  4E74 A;  1TIF A;  3NVW A;  4B0M A;  3LJ3 A;  5KHQ A;  3UQA A;  4USA A;  2O6V A;  3KW5 B;  3N1X C;  5BMI A;  3NZU A;  1C78 A;  4LCD E;  2PTL A;  5LXI B;  3U7D A;  1F2R C;  3PTF C;  1MFW A;  1NVI D;  3W1S C;  4A55 A;  3A33 B;  3L13 A;  1D5X C;  1T6B X;  2KK8 A;  2M0A A;  1NEK B;  2RDH A;  5D7G A;  1E8Y A;  1OQQ A;  3DCG A;  3HUI A;  3Q3F A;  2WLB A;  4DDG D;  4O1N A;  2D11 A;  3ZJT A;  1SBB B;  4BBN C;  2L52 A;  1RFK A;  1MPE A;  2ICI A;  4YTP B;  3BYT B;  3VRB B;  5HG2 A;  2BGF A;  2HTM E;  3ZNZ B;  3WAL A;  1ZP0 B;  2C7M B;  2YLM A;  3W5V B;  4N59 A;  4M02 A;  1D4B A;  1MHH E;  3L10 B;  4EE2 A;  1SIF A;  2KWV B;  3BK1 A;  3AED B;  1LO5 D;  3GS2 A;  4AQ7 A;  4DXG A;  2MA9 B;  1KOT A;  2N7E A;  1E8W A;  2LJ5 A;  4XC2 A;  2KAN A;  5KHO A;  4A20 A;  2XNA C;  2FUH B;  4G0N B;  2PMV A;  2IDY A;  3AE5 B;  4OVZ A;  3TMP B;  1VZ6 A;  2KWU B;  4FHJ A;  1AN8 A;  1TT5 B;  4K81 A;  1UGM A;  1VRA B;  1YOV B;  4BFR A;  2WX1 A;  1XT9 B;  5G55 A;  2FUG 1;  4R3D A;  3MFG A;  2GBK A;  3JVZ X;  2MBO A;  1WXV A;  4MDK E;  2Y5P A;  3DOW A;  1XLN A;  4DHZ B;  1WXM A;  1WGY A;  2MEK A;  1GG3 A;  3KYD D;  2EKE C;  3DBL I;  5L95 C;  1ZXH A;  2NVU I;  1FFV A;  2FID A;  4BBN F;  3AV8 A;  2BYF A;  4HPL B;  4RF0 A;  2LMC A;  4ZRI A;  2GB1 A;  2K5P A;  2KFK B;  1E90 A;  1ZDX A;  2R2O A;  3W1Y A;  2BKF A;  1IBX B;  3VR9 B;  4P6V F;  3ZYY X;  4C80 A;  2N9E B;  1LM8 B;  1LXD A;  1FMA D;  4XWT A;  4G3X B;  2KOX A;  5LXH A;  2KQ7 A;  1TY2 A;  1V1P B;  1WXS A;  5BO4 B;  4ZHP A;  3RNA C;  2NBW B;  4ANW A;  1MG8 A;  1IBX A;  2MLB A;  3C8Y A;  3SHQ A;  1TTN A;  3VTV A;  2DEN B;  4MSM B;  4RH6 A;  2QJL A;  4IUM B;  5CHF A;  2HE7 A;  4PS7 A;  4MH0 E;  2WP9 B;  3N1Y C;  1TKE A;  3EC8 A;  1NYR A;  3AE6 B;  2BYE A;  1V1P A;  2BT6 A;  2JY6 A;  3N1Z C;  4LNF A;  3BYY B;  3Q3N C;  1VD2 A;  1CK1 A;  3U2S C;  3QQ8 B;  2K39 A;  1H8C A;  4IOI E;  3NOB A;  2JUO A;  3W2D A;  4LDT B;  3KWL A;  5JH5 C;  1PQS A;  1YJI A;  2WQY B;  3AEG B;  5HHD G;  5H8Y E;  2KN5 A;  1RWS A;  4M8M A;  5AEK B;  3RPF C;  1WMH A;  1F9J A;  3ML9 A;  2B76 B;  3NUH B;  3U30 A;  1Z5S B;  2UWQ A;  3B9J A;  2RPQ A;  4W9K A;  1BT0 A;  2C7N B;  2BPS A;  2ZEQ A;  5E6J A;  3ZRC A;  1GC7 A;  3EA6 A;  3CST A;  3NS1 A;  1GC6 A;  1RRB A;  2DAJ A;  4W9D A;  5IA7 A;  3KUZ A;  3S2A A;  3BK2 A;  1E8Z A;  1VCB A;  3PSE B;  1P0R A;  1GNU A;  1OFF A;  3T9L A;  1WR1 A;  4KZ0 A;  2J53 A;  1Q0W B;  4NAW B;  4BKS A;  3OJ4 B;  3UF8 A;  1CQV A;  2JXX A;  4BKT A;  5BYS A;  2WXI A;  1YN5 A;  2PE9 A;  3TL5 A;  1N61 A;  4ZRP A;  2ONQ A;  4LNI A;  2WXL A;  1WGR A;  2ZPY A;  3IAM 1;  4E71 A;  1QOA A;  1TZ1 A;  4MAC A;  3UIN B;  5D94 A;  2KDB A;  1TYG B;  1ZXI A;  3I63 C;  2OED A;  2JXT A;  4ZDV A;  1GAQ B;  2FAZ A;  4GGQ A;  2VH2 A;  1WZ3 A;  2JU6 X;  1T0Y A;  5AZG A;  2OJW A;  2KXJ A;  4L23 A;  1QZE A;  4URK A;  1F1H A;  1SF0 A;  4A90 A;  4US8 A;  2KDE B;  1NI3 A;  2KMC A;  4ANX A;  2EKI A;  4MGI E;  1V1O A;  2M56 B;  4HLE A;  1FCC C;  3QCA A;  1T5X D;  2L32 A;  2TSS A;  5IP4 D;  4F8C B;  2ZCB A;  2JZ3 B;  5LNK 1;  1EU3 A;  4XYC A;  3KVF B;  2N9X A;  3DVN U;  4HPP A;  1K53 A;  4HWI B;  2GBJ A;  1CJE A;  1EF5 A;  3CF6 E;  4TQ0 A;  1OEY J;  2G4D B;  1F77 A;  2KMM A;  3C0R B;  1BXT A;  2CR5 A;  4IDI A;  3P1M A;  3UI3 A;  2QDF A;  3VDZ A;  2C5L C;  4HDO A;  1TS4 A;  3GE8 C;  2ZVN A;  4GIV A;  3GB1 A;  4HVB A;  4ZRK A;  4A8X C;  2WDV B;  3KWV A;  2A5U A;  1QT9 A;  1PGA A;  2LGS A;  2IO1 B;  1UH6 A;  3W5U B;  2K3U A;  2Q5W D;  2JX5 A;  4XDC A;  3IHP C;  3E9S A;  1K8R B;  3H1U A;  2IJ0 A;  2SAK A;  4ITK A;  1ZDV A;  4RF1 A;  1JRU A;  2G9H D;  4DHZ E;  3PZ8 A;  4II3 B;  1NDD A;  3NJT A;  3DHH C;  2KJ6 A;  3QX1 A;  2ZNV C;  2O6V D;  4UDU C;  3VR8 B;  2CKH B;  2KT7 A;  4I6P A;  1ET6 A;  3X23 A;  1XQQ A;  2W3R A;  3SFE B;  4EKU A;  4L2Y A;  3SD5 A;  1VZ7 A;  2KWD A;  3IFW B;  3OJ3 A;  2L05 A;  1XXG A;  2L8J A;  3NVV A;  2IBI B;  2KO3 A;  4WIP A;  3EGR A;  2KX3 A;  4RCO A;  2N0S B;  1I35 A;  1HZ6 A;  4DXF A;  3NZS A;  2J52 A;  2D3A A;  3Q6B A;  1L4D B;  3ZJU A;  5DPS A;  3EUB 2;  3OWE B;  3W1S A;  3AEC B;  5JXV A;  2MX2 A;  4MH8 A;  3PLV A;  3RUL A;  1C79 A;  2D3G A;  3NVZ A;  4FLH A;  4K7W A;  3AE7 B;  1D6E C;  4MEM A;  1YQ3 B;  3E56 A;  3RN9 C;  5IAA C;  3CSF A;  4NQL B;  2KC2 A;  1WZ0 A;  2WXG A;  2B3A A;  4IWO A;  4DQO C;  3VQI A;  2LXC A;  1IPG A;  2M1M A;  1ZE3 D;  4MEL A;  4W9F A;  2HD5 B;  1NBF C;  3R3M A;  4YSY B;  3VUY A;  3CIR B;  2GBM A;  3JSV B;  3B08 A;  1J19 A;  4WWM A;  2I38 A;  2IO2 B;  1V5T A;  4I6L B;  3V3X A;  2KTR B;  1MJD A;  1XLO A;  4IM3 A;  4WWP A;  2QCZ A;  2QMT A;  2IYD B;  3X0W A;  4PK1 A;  2KMA A;  3HRD D;  1WGD A;  3W9C B;  4WWN A;  4CQN A;  4HCP B;  2MH7 A;  1Y8R C;  1KTK A;  1WIA A;  3JSV A;  4LNK A;  3MTN B;  3OG5 A;  4ZYN A;  2KTR A;  4B9K A;  2MBB B;  4NY0 A;  4BZA A;  1Z2M A;  3V05 A;  1C77 A;  3V61 A;  3TCA A;  3IT4 B;  3Q69 A;  1I4Q A;  2CJO A;  1QF6 A;  1YNT E;  4J3O D;  2MHJ A;  2WYQ A;  2JSV X;  2JWU A;  3T3N A;  2NPT B;  5HI1 A;  3I5J C;  4YSX B;  4DWF A;  4GN1 A;  1V86 A;  2JZZ A;  4ZYS A;  2Y5C A;  2K1F A;  3TEX A;  3RI7 C;  1L0V B;  2IPK D;  4NQK E;  3VUX A;  4IW0 A;  2NR2 A;  3WAP A;  4AJY B;  4WUR A;  3ZLZ A;  2INC C;  2EMT A;  2L76 A;  3RNB C;  2MCN B;  1ACC A;  2NPT A;  2DZI A;  3PS6 A;  2VH1 A;  1WX9 A;  3WAN A;  4PS8 A;  3RMK C;  3P2B A;  1OQY A;  3A1Q B;  4LK0 M;  5AZH A;  5GXG B;  3N9Y C;  1BML C;  4BOZ B;  4DHJ B;  4IC7 B;  3R8B A;  2L1A A;  1E0Z A;  1UWX A;  1JWS D;  2K22 A;  2WXO A;  2GMI C;  2RSU A;  4JLC A;  4XX5 A;  1Q10 A;  1DGJ A;  3AU4 A;  4HRO A;  1GJZ A;  3HHM A;  2BS3 B;  1TKG A;  1LGR A;  2WXK A;  2UU7 A;  5E6N A;  5LLI A;  1UUP A;  3ZRF A;  1RYJ A;  4P1C C;  3A1Q A;  3PV1 A;  2MJD A;  3MC0 B;  2PVO D;  3KLS X;  5G5G A;  2AL3 A;  3I3T B;  2J0K A;  1WE7 A;  4ARC A;  1FEH A;  3QAQ A;  4AS1 A;  1JWB D;  3AEB B;  3Q3J A;  4AJW A;  2MBE A;  3P4R B;  4FJZ A;  4LNN A;  2VRR B;  3AB5 A;  1JRP A;  1JWM D;  2KQS A;  3FKY A;  4W9H A;  3PZD A;  5GMV A;  3B0A A;  4BVU C;  1UBQ A;  3VRA B;  2BYV E;  3N20 C;  1E10 A;  4LDT D;  2KLG A;  1WFY A;  2MWS B;  2NS5 A;  3VH3 B;  2L3Z A;  3IXS A;  1N60 A;  1C4A A;  2REX A;  2L0T A;  5CHV C;  1L0X B;  2BYT A;  4C00 A;  4W9G A;  1A70 A;  2WXR A;  1WJN A;  4RGN A;  2GRI A;  3ECI A;  3SFD B;  3ZJV A;  5G2N A;  3P42 A;  1V2Y A;  1K52 A;  4BKS D;  3J9C A;  1I4G A;  3RZW C;  4XE0 A;  2FBW B;  2KNB A;  2XN9 C;  1RFA A;  1XLP A;  1F0Z A;  4H2A A;  1E7P B;  4EZJ A;  1ZPS A;  1NYQ A;  2FE8 A;  3NVY A;  4MT5 A;  3AE1 B;  3QIJ A;  4C56 C;  1WGG A;  3MJW A;  2Z8L A;  3QAR A;  4S0R A;  1KLV A;  2LEK A;  2Z0E B;  3AEE B;  3IT6 B;  2AX5 A;  3TJP A;  4C7Z A;  3DBS A;  4TKN A;  1AYF A;  2LVP A;  1PGX A;  2WXJ A;  4P1B C;  4PYZ A;  4FHK A;  4LLG M;  2QEJ C;  3ZUN A;  3AXC A;  3Q8B A;  4XZ4 A;  1SSN A;  2KFK A;  2PLP A;  1VJK A;  2WXP A;  4FN2 A;  2J4X A;  3AE3 B;  1AW7 A;  4ANU A;  2JVC A;  3VTW A;  3RNC C;  2OHF A;  4KKI A;  2KDI A;  3VTU A;  1XF5 L;  2KD0 A;  1R4M B;  3IVF A;  3LDZ E;  5JHB A;  3MJ5 A;  4GXB A;  2LVO A;  1EM7 A;  4HEA 1;  1ENF A;  2VZK B;  1MI0 A;  4ICV A;  4KDL B;  5EE3 A;  1B1Z A;  2BBC A;  2KDF B;  2K8H A;  4A9A A;  5TSS A;  1E5W A;  3C19 A;  3H7P B;  2IGG A;  4W9C A;  2D07 B;  3DBR I;  2J0J A;  3PRE A;  4A6Q A;  2KN4 A;  2RD0 A;  4M00 A;  3L08 A;  1SXT A;  1SE9 A;  4DXA B;  1JML A;  1ROE A;  3FIL B;  2AWT A;  3FC4 A;  3ZQ4 A;  3M95 A;  1L7Y A;  3V60 A;  3H7P A;  2CHX A;  4HJG E;  1K51 A;  1SJH D;  1WX7 A;  3HM3 A;  3Q3M C;  3V6E B;  5CHW A;  2CU1 A;  2N9L A;  3HIZ A;  4G11 A;  2BQQ A;  3HVD A;  4DDI D;  1KLU D;  4NZL B;  2K8B A;  1JWU D;  1DOI A;  2ZNV B;  2WDT B;  2UYZ B;  2PVG C;  3FIL A;  4JIO U;  2QC8 A;  1N6Z A;  1DYQ A;  4KGT A;  3WA0 A;  2QIL A;  3DVG Y;  3AUL A;  1JCK B;  1WRD B;  2KQ4 X;  2V3N A;  1E8X A;  3DDC B;  2BKR B;  4LNO A;  2V9H A;  3R7R A;  3PHW B;  1WGK A;  3R66 C;  1YQ4 B;  1FRR A;  1L0Y B;  1EWC A;  3PRM B;  2L7R A;  4RM8 A;  3BWU D;  2HJ8 A;  3DWM A;  3O65 B;  4RGO S;  3CMM B;  2LHE A;  4NAM A;  1X1M A;  2LXA A;  3BY4 B;  3PHX B;  4NAW A;  3AE2 B;  5C3J B;  2G3Q B;  3APC A;  4XGA B;  4GU2 A;  2ON8 A;  2DNF A;  2IY0 B;  2K25 A;  1SE3 A;  1N5W A;  3T8M A;  2BS4 B;  1V6E A;  1V97 A;  3TEZ A;  2LJI A;  1WH3 A;  4TUU A;  2C60 A;  1FNU A;  2AQ1 B;  2XK5 B;  2SEB D;  2ZW1 A;  3PRZ A;  3DBL B;  1P98 A;  4IKG A;  3CWI A;  5CX3 A;  4EZK A;  2IND C;  2KC1 A;  2N7J A;  3APF A;  4WAF A;  4BOS C;  2W82 A;  3OAW A;  2DBY A;  1WR6 E;  2GLS A;  1YX6 B;  4GB9 A;  2YEP F;  2AQ2 B;  3DPD A;  2XK5 A;  1WF9 A;  2WXM A;  3A4S C;  2JYE A;  1J7A A;  5G5H A;  4KIK B;  4WAA A;  1PUT A;  4OZB A;  1OEY A;  2ZPN A;  4PS3 A;  1P9D U;  1UEL A;  1V81 A;  3WAO A;  2R2Q A;  1GPX A;  1I4P A;  4GDK B;  1TJE A;  2QHO A;  3ZTC A;  2PE6 B;  2I1K A;  1FD6 A;  1ZKH A;  1LFD A;  5D6J B;  3VH4 B;  3U4E G;  1IUE A;  3HVZ A;  4KIK A;  4EZL A;  1STE A;  1WM2 A;  3U52 E;  1AWD A;  4RFB A;  3KUC B;  2G1E A;  1I7H A;  1I4H A;  4TV3 A;  3VHT C;  2MRP A;  2FCN A;  2KJH B;  3V6C B;  1IYF A;  4ARI A;  1HA5 A;  2PEA A;  4GDK A;  4CO7 A;  1I4R A;  1ZOY B;  1TKY A;  3JW0 X;  4HDQ A;  3PPA A;  4HPM B;  1WXQ A;  4JGH B;  3RZF A;  1E7U A;  4IWP A;  3N30 A;  3BIN A;  4TQ1 A;  5D3I B;  1JRO A;  4IM0 A;  4OZA A;  1NI2 A;  1YX5 B;  2KX0 A;  2E6X A;  2L83 A;  4RMA A;  3UIO B;  2MP2 B;  1HTO A;  1N63 A;  2ZJD A;  3U7Z A;  3H7S A;  5J18 A;  1A5R A;  2LRU A;  1L6V A;  2GI9 A;  2WX0 A;  3PZ7 A;  5D3D A;  1Q5W B;  1BUI C;  3A4R A;  3A9K B;  2PIA A;  1VLB A;  1FNW A;  2LUE A;  1GB4 A;  3QA8 A;  2LI5 A;  2IY1 B;  2MP2 A;  2K6Q A;  2KJR A;  5E6O A;  4N9F 4;  3ZXV A;  3ABV B;  5C23 A;  4A3O A;  2V4L A;  5J2R A;  2KWC A;  1UD7 A;  1I4X A;  2AYO B;  4KSL C;  2IO0 B;  3A9K A;  4DHJ D;  2ZCC A;  4ANV A;  3ZTD A;  4YL8 A;  2HDE A;  4HKQ A;  2RDG A;  2KZR A;  1FXA A;  1XO3 A;  4Q2J A;  3A9J B;  3MC9 A;  3BVM A;  1YJ1 A;  3P4Q B;  2N7D A;  4W9J A;  2J0M A;  4FJY A;  5FK9 C;  1V49 A;  4II2 B;  1HZ5 A;  4RGT A;  1FXI A;  1PYW D;  3MHS D;  3ML8 A;  3ZKJ C;  2WWZ A;  3B1L X;  2WS3 B;  1WYG A;  4FBJ B;  3B2G A;  4K3B A;  2NBU A;  4GLS C;  4BKG A;  1FIQ A;  2KAJ A;  3A9J A;  2DWQ A;  3AE8 B;  3WCQ A;  2EMS A;  3NY5 A;  4NNJ B;  1RLF A;  4ACF A;  2OOB B;  1UBI A;  2D3C A;  4K7U A;  3I9V 1;  1FNV A;  4FAD A;  5MPO A;  4FUL A;  3IBE A;  2IGD A;  4N58 A;  2RR9 A;  3VVW B;  1GB1 A;  3I57 A;  4M0W B;  2GOW A;  4GMV A;  1TS2 A;  1ZUD 2;  1UF0 A;  1SE2 A;  1TS3 A;  3PO0 A;  2BWF A;  3TEW A;  4KKJ A;  1FPY A;  3AEA B;  2RDB C;  3JYU A;  2CU3 A;  1QOF A;  1YN3 A;  4HJK A;  1ESF A;  1XCT L;  4B6W A;  3Q8E A;  2RGF A;  2Y5B B;  3Q8F A;  2IO3 B;  2N1W A;  3BVZ A;  1R4M I;  1YMH E;  5I4D A;  1MG4 A;  2QSD A;  1E6E B;  1EF1 A;  4M0W A;  3AN1 A;  4MGK E;  4WQO B;  1HXY D;  1WY8 A;  3L4P A;  1LQB A;  3ZXR A;  2M8S A;  2RMM A;  2KYW A;  4K7S A;  1C4C A;  1TZO A;  1L4Z B;  2DYO A;  4AP4 C;  3GZN B;  3WAM A;  2IGH A;  2WXF A;  4S17 A;  4YTN B;  1J8C A;  4J6I A;  3ALB A;  2BB5 A;  1JAL A;  4P7I A;  2N9P C;  1ET9 A;  3GP7 A;  3H9D A;  2JWZ A;  3DQV A;  3NHE B;  1ISN A;  1UZX B;  5BMH A;  1KH0 A;  2EEL A;  4AUQ C;  2E3T A;  2ZZP B;  1R4N B;  4GDL B;  2N4F A;  4WH4 A;  3AE4 B;  1WE6 A;  4FXC A;  1N5X A;  4MJS B;  4ICU A;  2V1Y A;  1SJE D;  5JHA A;  4JE3 B;  1FRD A;  1MVK A;  1HE8 A;  3GE3 C;  3DVN V;  5HFY A;  3ZNG C;  1OQR A;  5DPW A;  2W55 A;  4GDL A;  2AQ3 B;  2VZK D;  3ZW3 A;  4IG7 B;  1J0G A;  4E3C A;  5EDS A;  3FAH A;  4WQM A;  1RAX A;  1QKZ A;  4MJS A;  3AEF B;  1IGC A;  2I2Y A;  2W9N A;  1HTQ A;  3Q8C A;  1SB3 C;  1XEE A;  3MHZ A;  3PGE A;  1V80 A;  2LAS A;  3KYC D;  1PFD A;  2YEP B;  1PDX A;  4C7Y A;  1WJ6 A;  3RYT A;  1P3Q U;  2WNM A;  1C76 A;  2HJ1 A;  3U8Z A;  1FXT B;  4W9I A;  3DBH B;  3T3O A;  3ETR A;  1WRI A;  4YSZ B;  1QQR A;  1Y56 A;  2J7Q B;  3TIX A;  2MJE A;  2OJR A;  3IG3 A;  4F1S A;  5IKC M;  2WU5 B;  1Q1O A;  3P4P B;  2NBV B;  2D3B A;  2D2Q A;  5EE9 A;  3TEY A;  1D5Z C;  3NRZ A;  2Y3A A;  2DZK A;  4CHK A;  1C4P A;  4US9 A;  1TY0 A;  4NPN A;  3HK0 A;  2K9X A;  4L1B A;  2IZV B;  3ZNH B;  1KFY B;  3KUD B;  4HK2 A;  2X8X X;  5E6P A;  3QHT A;  4DBG A;  4DK5 A;  3MC8 A;  3N3K B;  2FCS A;  4G50 A;  1PGB A;  1QIL A;  2V4I B;  5FR6 A;  1D5M C;  4W9L A;  4EOY A;  4GSW A;  2JF5 A;  4LTU A;  2LHD A;  4JQW C;  1L5P A;  1QOB A;  3RNF C;  5AUK A;  3EEC A;  1V9J A;  2BVC A;  3RFZ B;  2L00 B;  4X57 B;  2CHW A;  4YTM B;  3DWG C;  4B95 A;  3LYY A;  4ZOH C;  2ACZ B;  2NCN A;  1UNS A;  4B0E A;  4EUT A;  2MQJ A;  3NS8 A;  1CMX B;  4HXD A;  3VAW A;  2H88 B;  4KGS A;  1QLB B;  2FCQ A;  1KJT A;  1YJJ A;  2Z59 B;  5L83 A;  1VZ8 A;  5IN7 A;  3RT3 B;  2AEH A;  3AH7 A;  3VFK A;  1AAR A;  1SEB D;  2K6D B;  1F52 A;  1HEZ E;  1JQ4 A;  2PJH A;  2BS2 B;  1WMH B;  2LFI A;  4FA6 A;  4MSQ B;  2C9W B;  1ZW7 A;  3L17 A;  1JWA D;  2BWE S;  1WJ4 A;  1IGD A;  3ZGZ A;  2WXQ A;  4HRS A;  2DZJ A;  2RPV A;  5FR3 A;  1F2R I;  1SIJ A;  4NJ7 A;  4KDI C;  2R61 A;  4OVV A;  1TS5 A;  1YN4 A;  1JW9 D;  2FIF A;  3EHV A;  4I6N B;  1N62 A;  4AWJ A;  1HQR D;  4PYU A;  3P4S B;  5D2M B;  4TMA B;  3ZNI D;  3R7Q A;  1UWM A;  3RUI B;  5TR5 A;  5BYQ A;  3GOE A;  3ZDM C;  3TBL D;  2KVZ A;  1WM3 A;  3PLU A;  2KVR A;  2KHW B;  2QIE B;  2DYB A;  3QC8 B;  3SR6 A;  4EEW A;  2BW2 A;  3Q8A A;  3ZO5 B;  2WXN A;  2AL6 A;  3URY A;  3BVG A;  3M63 B;  2WU2 B;  1MHX A;  2LGD A;  2LUM A;  1WSP A;  2ASQ A;  5FKA C;  2WXH A;  1EU4 A;  4ZRJ A;  3RNG C;  4NJC A;  2JRI B;  2MJ3 A;  4OVU A;  4IM2 A;  3Q14 C;  3ONS A;  1FCL A;  4HKZ E;  2WGS A;  2KTF A;  2CHZ A;  2DZM A;  1EO6 A;  2M0X A;  2GBN A;  3ENE A;  1DOX A;  1E7V A;  2H89 B;  1C1Y B;  2XEW A;  2J42 A;  5C2T B;  2Z0D B;  3M3J A;  3AI5 A;  4ZRQ A;  3BZD B;  3KQ4 A;  3TSS A;  1RM6 C;  1FO4 A;  1XCQ L;  2W3S A;  1ZGU B;  5J17 A;  5HKH A;  3D32 A;  2LWP A;  4WJN A;  4MGZ E;  1GUA B;  1KM7 A;  3OLM D;  4KVG B;  4K3C A;  4F7Z A;  3AM9 A;  1G6J A;  3L16 A;  3EFC A;  1T0S C;  3UGB B; 
#chains in the Genus database with same CATH homology
 4A3O A;  4BOZ B;  4DHJ B;  3K9P B;  4IC7 B;  3SHQ A;  2V4L A;  5J2R A;  1TTN A;  2L0F A;  3ZDT A;  3VTV A;  4JL9 A;  2GMI C;  2DEN B;  2RSU A;  4MSM B;  3WIM A;  2KWC A;  3UIP B;  4JLC A;  4XX5 A;  3AU4 A;  1UD7 A;  4IUM B;  5CHF A;  2HE7 A;  1GJZ A;  2AYO B;  4PS7 A;  3HHM A;  4KSL C;  4MH0 E;  2IO0 B;  3A9K A;  3H6N A;  1IP9 A;  4DHJ D;  3EC8 A;  2ZCC A;  4ANV A;  4IWQ A;  3ZTD A;  4YL8 A;  1I42 A;  2BYE A;  2LZ6 A;  5E6N A;  5LLI A;  2KZR A;  2MW5 A;  2JY6 A;  3ZRF A;  3A1Q A;  3PV1 A;  3UQB A;  1VD2 A;  1WJU A;  2MSE D;  2AL3 A;  3I3T B;  4K1R B;  3A9J B;  3SDL C;  3QQ8 B;  2J0K A;  1WE7 A;  1YJ1 A;  3QAQ A;  2K39 A;  1H8C A;  1C3T A;  2LVQ A;  2N7D A;  4W9J A;  3Q3J A;  2J0M A;  4FJY A;  4AJW A;  3ZIM A;  2MBE A;  3NOB A;  2JUO A;  4HCN B;  4FJZ A;  4LDT B;  1V49 A;  5JH5 C;  4II2 B;  1PQS A;  2VRR B;  2M4N A;  4W9E A;  2JPH A;  4KV2 A;  2KQS A;  2KN5 A;  4CYE A;  3MHS D;  4M8M A;  4W9H A;  1U4A A;  3ML8 A;  5AEK B;  3PZD A;  1YIW A;  2HTH A;  5GMV A;  3ZKJ C;  3B0A A;  2WWZ A;  4BVU C;  3B1L X;  1WMH A;  1F9J A;  3ML9 A;  1UBQ A;  4FBJ B;  2BYV E;  2G4S A;  2LGX A;  4WJQ A;  4LDT D;  2KLG A;  3U30 A;  1Z5S B;  1WFY A;  2MWS B;  2NBU A;  2NS5 A;  2UWQ A;  1TBE A;  3QK0 A;  3VH3 B;  2L3Z A;  4BKG A;  3PVL A;  2REX A;  2RPQ A;  2L0T A;  3A9J A;  2KKC A;  5CHV C;  4EFO A;  2EMS A;  2O2V B;  4W9K A;  1WXA A;  3HM6 X;  1RLF A;  3NY5 A;  1BT0 A;  2OOB B;  4NNJ B;  3QJZ A;  2YVC A;  4WJO A;  4W9G A;  5DPR A;  1UBI A;  2BPS A;  2C7N B;  1OGW A;  2ZEQ A;  3N32 A;  3QWZ B;  1WJN A;  2I1J A;  4K7U A;  4KSK C;  3ZRC A;  1GC7 A;  4FAD A;  3CST A;  5DPT A;  1P1A A;  4FUL A;  1GC6 A;  3GZN I;  3IBE A;  3ECI A;  2RR9 A;  3VVW B;  3VUW A;  1RRB A;  2DAJ A;  4M0W B;  1D3Z A;  4W9D A;  2GOW A;  5G2N A;  1M94 A;  4GMV A;  1V2Y A;  2JT4 B;  3KH0 A;  4BKS D;  2BWF A;  5IA7 A;  3KUZ A;  3S2A A;  3RZW C;  1E8Z A;  1VCB A;  2KNB A;  3PSE B;  1S1Q B;  5AZF A;  1P0R A;  1GNU A;  1RFA A;  2V3S A;  3JYU A;  1H4R A;  4HJK A;  4B6W A;  2CS4 A;  3L0W B;  3T9L A;  1WR1 A;  2O2V A;  2RGF A;  1R4N I;  4KZ0 A;  2Y5B B;  1Q0W B;  2IO3 B;  4NAW B;  2N1W A;  4BKS A;  4EZJ A;  3OJ4 B;  3UF8 A;  1R4M I;  2JXX A;  4BKT A;  1EUV B;  2C7H A;  4RM9 A;  1EF1 A;  4MGK E;  4WQO B;  2PPH A;  2PE9 A;  3TL5 A;  1WY8 A;  3QIJ A;  2ZVO A;  1LQB A;  1WGR A;  2FNJ B;  2ZPY A;  1WGG A;  2M8S A;  3MJW A;  2MBH A;  3QAR A;  4K7S A;  1KLV A;  2FCM A;  2Z0E B;  3TJP A;  4E71 A;  3DBS A;  4TKN A;  2DYO A;  4AP4 C;  1TZ1 A;  2LVP A;  4AOF A;  3WAM A;  3UIN B;  4PYZ A;  4FHK A;  2XBB C;  3ZUN A;  1J8C A;  4J6I A;  5D94 A;  3AXC A;  3ALB A;  2KDB A;  4XZ4 A;  1L2N A;  4P7I A;  2KFK A;  2N9P C;  3H9D A;  2G45 B;  2JWZ A;  3DQV A;  4FN2 A;  3NHE B;  3VXW A;  1ISN A;  1UZX B;  2FAZ A;  4GGQ A;  2K8C A;  4ZDV A;  1WZ3 A;  3RD2 A;  4ANU A;  3SU8 X;  1T0Y A;  4NJ6 A;  5C1Z A;  2DX5 B;  2JVC A;  3VTW A;  5AZG A;  4AUQ C;  4ASW C;  2KXJ A;  2KDI A;  2ZZP B;  4GDL B;  1S3S G;  2M17 A;  2N4F A;  1QZE A;  3VTU A;  4URK A;  2KD0 A;  3IVF A;  3EFU A;  1WE6 A;  2KDE B;  2KMC A;  3LDZ E;  4ANX A;  4M8N A;  4MJS B;  4GXB A;  5JHB A;  3DBH I;  2LVO A;  4A3P A;  4ICU A;  2V1Y A;  3AU5 A;  4MGI E;  5JHA A;  4HLE A;  1YQB A;  5DCN A;  4ICV A;  3QCA A;  4KDL B;  4MM3 A;  2KDF B;  2K8H A;  1HE8 A;  3M62 B;  4F8C B;  3RCZ A;  2DAF A;  1E5W A;  2ZCB A;  3H7P B;  2JZ3 B;  1WX8 A;  5JZE B;  4W9C A;  3DVN V;  3ZNG C;  2D07 B;  3DBR I;  2J0J A;  5DPW A;  4GDL A;  3KVF B;  3DVG X;  2N1V A;  3PRE A;  4LJP B;  3ZW3 A;  4IG7 B;  2N9X A;  3DVN U;  2RD0 A;  3K9O B;  1J0G A;  4E3C A;  3L54 A;  4HWI B;  4FJV B;  2GBJ A;  4LJO B;  4WJP A;  5EDS A;  1RAX A;  1EF5 A;  3CF6 E;  2GBR A;  3L08 A;  1XD3 B;  4TQ0 A;  4MJS A;  1OEY J;  2G4D B;  1WI0 A;  1TGZ B;  3C0R B;  1SE9 A;  2CR5 A;  2W9N A;  4DXA B;  3PGE A;  1V80 A;  3VDZ A;  2C5L C;  2A4Z A;  2LGY A;  2LAS A;  3KYC D;  2AWT A;  4HDO A;  3M95 A;  1L7Y A;  4KZC A;  3V60 A;  3H7P A;  2CHX A;  2KLC A;  1WJ6 A;  2ZVN A;  4GIV A;  2KFJ A;  3RYT A;  4HVB A;  3HM3 A;  1WX7 A;  4ZRK A;  3V6E B;  1P3Q U;  4MGY E;  3U8Z A;  2LD9 A;  1FXT B;  2A5U A;  5CHW A;  2CU1 A;  4GOC A;  3HIZ A;  4W9I A;  4G11 A;  2IO1 B;  2D10 A;  3PT2 B;  3V62 A;  1UH6 A;  1WGH A;  2JRH A;  4DDI D;  3PRP B;  2K8B A;  3IHP C;  2BF8 B;  1K8R B;  2J7Q B;  2DYM A;  1V5O A;  3H1U A;  3TIX A;  1OTR B;  2ZNV B;  2WDT B;  2OJR A;  2MBQ A;  5CTR C;  1JRU A;  3IG3 A;  2UYZ B;  4WWO A;  2O6V B;  4F1S A;  2LRW A;  3ZVV A;  4DHZ E;  1YD8 U;  2DHZ A;  4II3 B;  1NDD A;  1Q1O A;  4JIO U;  2NBV B;  3APD A;  3WA0 A;  2D2Q A;  2KJ6 A;  3DVG Y;  3AUL A;  1WRD B;  2DZK A;  1SGH A;  3QX1 A;  2ZNV C;  2O6V D;  3DDC B;  1E8X A;  4CHK A;  2BKR B;  3R7R A;  2CKH B;  4NPN A;  1WYW B;  3HK0 A;  3PHW B;  4E74 A;  2IZV B;  3ZNH B;  3R66 C;  4I6P A;  3PRM B;  2L7R A;  4RM8 A;  3KUD B;  3LJ3 A;  4HK2 A;  5KHQ A;  3UQA A;  5E6P A;  3QHT A;  3X23 A;  4DBG A;  1XQQ A;  4DK5 A;  2O6V A;  2HJ8 A;  3KW5 B;  4EKU A;  3O65 B;  3N3K B;  2FCS A;  3CMM B;  3SD5 A;  4G50 A;  3IFW B;  3OJ3 A;  2L05 A;  2L8J A;  1X1M A;  3NZU A;  2IBI B;  2KO3 A;  4LCD E;  5FR6 A;  4W9L A;  2LXA A;  3BY4 B;  3PHX B;  4EOY A;  5LXI B;  4NAW A;  3U7D A;  4GSW A;  2KX3 A;  2JF5 A;  2G3Q B;  3PTF C;  3APC A;  3W1S C;  4GU2 A;  3A33 B;  1I35 A;  2IY0 B;  2K25 A;  4JQW C;  3L13 A;  3NZS A;  3EEC A;  3T8M A;  1V6E A;  1V9J A;  2KK8 A;  5DPS A;  5D7G A;  1E8Y A;  1WH3 A;  3W1S A;  3DCG A;  3Q3F A;  4TUU A;  2L00 B;  4X57 B;  2C60 A;  2CHW A;  2MX2 A;  4DDG D;  3PLV A;  2D11 A;  3RUL A;  2XK5 B;  4B95 A;  2NCN A;  3PRZ A;  4BBN C;  4EUT A;  2MQJ A;  3NS8 A;  1CMX B;  1P98 A;  4HXD A;  5CX3 A;  2D3G A;  3VAW A;  4EZK A;  2FCQ A;  2KC1 A;  1KJT A;  4FLH A;  4K7W A;  2Z59 B;  3APF A;  4BOS C;  5L83 A;  2BGF A;  4MEM A;  3OAW A;  5IAA C;  3ZNZ B;  3CSF A;  4NQL B;  2KC2 A;  1WZ0 A;  3RT3 B;  2AEH A;  1WR6 E;  2B3A A;  3VFK A;  4IWO A;  1AAR A;  1YX6 B;  4GB9 A;  3VQI A;  2LXC A;  1IPG A;  3DPD A;  3WAL A;  2C7M B;  2K6D B;  2M1M A;  2PJH A;  2XK5 A;  1WF9 A;  3A4S C;  1WMH B;  4MEL A;  2YLM A;  4W9F A;  2HD5 B;  1NBF C;  4KIK B;  4WAA A;  4FA6 A;  4MSQ B;  2C9W B;  3R3M A;  1ZW7 A;  3L17 A;  1OEY A;  2BWE S;  2ZPN A;  4PS3 A;  1WJ4 A;  3VUY A;  2GBM A;  3JSV B;  3L10 B;  3B08 A;  1P9D U;  1UEL A;  2DZJ A;  1V81 A;  1J19 A;  1SIF A;  2KWV B;  2IO2 B;  1V5T A;  3WAO A;  4I6L B;  4NJ7 A;  2R2Q A;  2KTR B;  4KDI C;  4OVV A;  2MA9 B;  1KOT A;  2N7E A;  1E8W A;  2FIF A;  2LJ5 A;  3EHV A;  4GDK B;  4I6N B;  4IM3 A;  2QHO A;  4XC2 A;  3ZTC A;  4AWJ A;  2KAN A;  2PE6 B;  4PYU A;  4WWP A;  5KHO A;  2I1K A;  5D2M B;  4A20 A;  2FUH B;  2IYD B;  4G0N B;  3X0W A;  2KMA A;  1ZKH A;  1LFD A;  5D6J B;  3VH4 B;  3TMP B;  3ZNI D;  1WGD A;  3R7Q A;  4WWN A;  4KIK A;  2KWU B;  4FHJ A;  4EZL A;  3RUI B;  4HCP B;  5TR5 A;  1Y8R C;  1WM2 A;  3GOE A;  4K81 A;  1UGM A;  3ZDM C;  1WIA A;  4BFR A;  3TBL D;  2WX1 A;  3KUC B;  1XT9 B;  5G55 A;  1WM3 A;  3JSV A;  3PLU A;  2KVR A;  3MTN B;  4TV3 A;  2KHW B;  2MRP A;  3VHT C;  2DYB A;  2FCN A;  4ZYN A;  2KJH B;  2KTR A;  2GBK A;  3QC8 B;  3JVZ X;  4B9K A;  3V6C B;  2MBO A;  1WXV A;  2MBB B;  4MDK E;  4EEW A;  1IYF A;  4NY0 A;  2PEA A;  1Z2M A;  4GDK A;  4CO7 A;  3DOW A;  4DHZ B;  3V61 A;  3TCA A;  3ZO5 B;  2AL6 A;  3JW0 X;  3M63 B;  4HDQ A;  2LGD A;  3PPA A;  4HPM B;  1WXM A;  1WGY A;  1GG3 A;  3KYD D;  4JGH B;  1E7U A;  2EKE C;  3DBL I;  3N30 A;  4IWP A;  3RZF A;  3BIN A;  5L95 C;  2ASQ A;  2WYQ A;  4TQ1 A;  2NVU I;  4ZRJ A;  2FID A;  4BBN F;  2JRI B;  2BYF A;  4HPL B;  4OVU A;  4IM2 A;  2NPT B;  4IM0 A;  3ONS A;  4ZRI A;  1NI2 A;  1YX5 B;  2KTF A;  2KX0 A;  4DWF A;  2CHZ A;  2DZM A;  1EO6 A;  4GN1 A;  2M0X A;  2GBN A;  1V86 A;  2JZZ A;  4RMA A;  3UIO B;  2MP2 B;  3ENE A;  2K1F A;  2KFK B;  1E90 A;  2R2O A;  2ZJD A;  3W1Y A;  2BKF A;  4NQK E;  3VUX A;  1E7V A;  4IW0 A;  2NR2 A;  3H7S A;  3WAP A;  4AJY B;  5J18 A;  1C1Y B;  2XEW A;  2LRU A;  3ZLZ A;  1A5R A;  2Z0D B;  2EMT A;  2N9E B;  1LM8 B;  3M3J A;  2L76 A;  3AI5 A;  2WX0 A;  2MCN B;  1Q5W B;  3A4R A;  1LXD A;  2NPT A;  1ZGU B;  5J17 A;  5HKH A;  3A9K B;  2DZI A;  3D32 A;  2LWP A;  3PS6 A;  4WJN A;  4MGZ E;  1WX9 A;  3WAN A;  4G3X B;  4PS8 A;  2LUE A;  2KOX A;  3P2B A;  5LXH A;  2KQ7 A;  3QA8 A;  1GUA B;  2LI5 A;  2IY1 B;  2MP2 A;  1OQY A;  1WXS A;  1KM7 A;  2K6Q A;  2KJR A;  5BO4 B;  3OLM D;  5E6O A;  2NBW B;  3A1Q B;  4KVG B;  4N9F 4;  4F7Z A;  1G6J A;  4ANW A;  5AZH A;  3UGB B;  3L16 A;  1MG8 A;  5C23 A;  2MLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...