3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
2ZZPB 3DQVA 1RAXA 1WGDA 1WI0A 2IO2B 3L54A 3N30A 4OVUA 3QHTA 3VHTC 4DHZE 4PS7A 4WJOA 4MJSB 2FCNA 2J7QB 1PQSA 3EHVA 3PZDA 4LDTB 1A5RA 1WJ6A 2JXXA 3X23A 3QCAA 3QJZA 4KZ0A 3APDA 4TKNA 1OTRB 5LXHA 2ZJDA 1TZ1A 2G4SA 3ZDTA 3SU8X 3ZUNA 1GJZA 2B3AA 2DZJA 2G4DB 1WY8A 4B9KA 1WZ0A 5FR6A 3RZWC 4FHJA 4AJYB 4BKSA 3KVFB 3DVGX 2KO3A 4F1SA 4ANXA 2JPHA 4K7SA 4AWJA 5KHQA 4MSQB 3MTNB 4MJSA 2MWSB 3MHSD 2L8JA 3PV1A 2CS4A 2DZIA 2N4FA 2PE9A 2FCSA 3NHEB 3VVWB 2DZMA 2K8HA 3RCZA 1WXSA 3M95A 3H6NA 1HE8A 1LM8B 4ASWC 4MH0E 1J8CA 2BKRB 5CTRC 4IWOA 4BOZB 2VRRB 1T0YA 3B0AA 3PPAA 1I35A 2KLCA 1Q5WB 4FLHA 1GUAB 2Z0EB 1ZW7A 4WAAA 2GOWA 3S2AA 1H8CA 4EZLA 1X1MA 3TL5A 4XC2A 2D07B 5BO4B 2GBMA 2C60A 2JZZA 2D11A 3AI5A 2C7NB 2LUEA 4I6LB 1KOTA 3KUCB 2NBUA 1YJ1A 4RM8A 3RYTA 4W9JA 3PHXB 1ISNA 2MLBA 3CMMB 3U7DA 4IC7B 3ZVVA 2KLGA 2RSUA 3UF8A 4HWIB 3QQ8B 2KJ6A 3ALBA 4MGZE 2QHOA 1UH6A 3Q3JA 2KD0A 3TMPB 4E71A 2HE7A 2G3QB 4GB9A 4W9FA 2PE6B 4G3XB 2LRUA 1V5OA 2L0FA 3M62B 4DK5A 2KJRA 4B6WA 1GC6A 3QA8A 3T9LA 4MELA 4RMAA 5LLIA 1E90A 2ZCCA 3PREA 1M94A 2L76A 3DOWA 4CYEA 2D2QA 5E6OA 1V2YA 1LFDA 1ZKHA 5CHVC 4DWFA 3B1LX 1P1AA 1MG8A 4W9LA 2IBIB 2RR9A 2K8CA 1V86A 4TQ0A 1GG3A 2BKFA 1S1QB 4NJ7A 4BKGA 1LQBA 3LJ3A 3C0RB 3DVGY 4DBGA 4IM3A 3QARA 2IY1B 5C1ZA 2AL6A 4XX5A 2KDBA 2ZVNA 3ZDMC 2M17A 2NR2A 3JYUA 3RZFA 2KTRB 3OAWA 2R2QA 1YX6B 3H7PB 2KVRA 2CU1A 4JIOU 4GDLB 3W1SC 2IO0B 4W9KA 2BGFA 1FXTB 4ZDVA 2ZPNA 1WFYA 2DZKA 5GMVA 3QK0A 1JRUA 2JT4B 3HM6X 3QWZB 1Q1OA 2LJ5A 2MBEA 4DDGD 4MEMA 4GDKA 4HLEA 4FADA 1U4AA 2XK5B 3M3JA 4WWNA 3ZW3A 2NBWB 3H7SA 2CHZA 3V62A 4ANWA 2ZPYA 1WJUA 3AXCA 2BPSA 4IWPA 4BBNC 3L08A 3WIMA 3NY5A 4HDQA 3L10B 5IA7A 2AEHA 4P7IA 1UBIA 1P98A 2WYQA 2HD5B 3ZNHB 1I42A 1XD3B 4RM9A 3JSVA 3KH0A 4N9F4 4X57B 2V4LA 2JVCA 2PEAA 5DPWA 2MSED 2MRPA 4JL9A 2IO3B 5C23A 1NI2A 2DYMA 3ML8A 2C7MB 2K1FA 1YQBA 2OJRA 3VAWA 5JHAA 4NJ6A 4DDID 3B08A 1ZGUB 3VH4B 3CSFA 3TJPA 1EF5A 4BFRA 3L0WB 1XQQA 4ICUA 2KZRA 2JUOA 2GBJA 3UIOB 3VUWA 4WJPA 2KOXA 1YX5B 2KK8A 2ZVOA 3A1QA 4GOCA 4FJZA 2YLMA 1WRDB 3PSEB 1V6EA 2CHXA 4GIVA 1VCBA 3NOBA 1OEYJ 2N7EA 3A9KB 1WXAA 3H9DA 4IM2A 4NAWB 1L2NA 2JF5A 4W9DA 2KJHB 2GBRA 3M63B 4ICVA 3PRZA 2N1VA 4W9IA 3KUDB 3RT3B 3VUYA 2JWZA 3VTWA 2GBNA 1AARA 3X0WA 2K6DB 4LCDE 2KXJA 2LGYA 1E8XA 5AZGA 1YIWA 4KSKC 2CR5A 1EUVB 2C5LC 2DAJA 2ZEQA 4EFOA 4EZJA 3JW0X 1WJNA 2M1MA 2RD0A 4MGKE 2LGDA 2HTHA 4BBNF 4ZRJA 4FHKA 2KHWB 1L7YA 4IWQA 3SDLC 1Q0WB 3IVFA 3VQIA 1WGGA 2KC2A 2LD9A 3K9PB 1KM7A 2O6VA 3AU4A 1WF9A 2JZ3B 1WR1A 2W9NA 4J6IA 3ZTCA 3HK0A 1OQYA 2K8BA 2KKCA 4KDLB 4NY0A 2WX1A 4HJKA 2L3ZA 4KZCA 2LZ6A 1D3ZA 4K7UA 3PRMB 3LDZE 5L95C 2KFKA 4FJVB 3QC8B 3TIXA 4I6NB 2FIFA 1OEYA 2L7RA 5KHOA 5J18A 3JSVB 3A1QB 1RRBA 3V60A 2O2VB 4M0WB 2LVOA 2A5UA 4CO7A 2K39A 3AULA 3KYCD 4LJOB 3EECA 4GGQA 2KDIA 1WGRA 2MX2A 4LJPB 2J0MA 3A9KA 5AEKB 4TUUA 2K6QA 1UBQA 4URKA 1H4RA 5D94A 3ZKJC 2MP2A 5E6NA 4HCNB 3KUZA 4GSWA 3PTFC 3AU5A 2XEWA 2LWPA 3QIJA 5JZEB 2D3GA 3DBSA 2A4ZA 4IW0A 2GMIC 2M4NA 2NPTA 2WX0A 3A9JA 4FJYA 2AWTA 2FCMA 2RPQA 1TGZB 2KFJA 3L17A 2R2OA 3ZNID 3MJWA 1SGHA 4W9CA 3PS6A 1SIFA 2NBVB 2ZNVC 2J0KA 4XZ4A 2MBQA 3OJ3A 3T8MA 4JGHB 2G45B 2NVUI 2BYEA 3U8ZA 3NS8A 3DPDA 2LXCA 1V9JA 5D6JB 2KDFB 4I6PA 1TTNA 2O6VD 3K9OB 1TBEA 3DBLI 2C9WB 3VH3B 2LXAA 4LDTD 4DHZB 2EKEC 4DHJB 4NNJB 4W9GA 5JH5C 4NAWA 2PPHA 5D2MB 3TCAA 3PLUA 4BOSC 1Y8RC 4DXAB 5JHBA 3HIZA 1V80A 1WR6E 3NZSA 2ASQA 5HKHA 4W9HA 3KYDD 3ZTDA 3QAQA 2D10A 4HDOA 4PS8A 3ZLZA 3A33B 1XT9B 2NCNA 4A20A 2KTFA 2RGFA 3VUXA 3ZIMA 1V5TA 1UGMA 3DBRI 1WZ3A 2LI5A 2N9XA 4IM0A 2KANA 1E8WA 1WJ4A 2KWVB 4EUTA 2MA9B 3RULA 4HVBA 3UIPB 3R66C 4ZRKA 1EO6A 2CHWA 5AZFA 3H1UA 4MDKE 2DYBA 2L0TA 3WA0A 4BVUC 2WWZA 3DVNV 3Q3FA 3ZNZB 3NZUA 4F8CB 4II3B 4EEWA 3HM3A 4YL8A 3W1SA 2AL3A 2BYVE 2L05A 3IBEA 3A9JB 1KLVA 2JY6A 3QX1A 4MGIE 1C3TA 1UELA 4M8NA 2KWCA 1GC7A 2Y5BB 3H7PA 2Z59B 4M8MA 4GU2A 4GDLA 5E6PA 4PYUA 2O2VA 1GNUA 2IO1B 3JVZX 4IG7B 4WJQA 4AJWA 4OVVA 2BF8B 3BINA 3D32A 3V61A 2BWES 1E8YA 2KN5A 2KQSA 2LGXA 1WM3A 4FBJB 3ZRFA 4KVGB 4CHKA 4A3OA 4BKSD 2XK5A 2C7HA 2KWUB 3A4SC 3HHMA 3IG3A 2LRWA 2K25A 3P2BA 5DCNA 3UGBB 2KMCA 2REXA 3PGEA 1CMXB 4KIKB 4HXDA 1C1YB 1P0RA 5IAAC 5J2RA 2MBBB 3O65B 1WGHA 5CHWA 2BWFA 3GOEA 4HCPB 3APFA 1LXDA 1WGYA 1V49A 2J0JA 4DHJD 4AP4C 2UYZB 1VD2A 2IYDB 4EKUA 5D7GA 1WMHB 2FUHB 4FA6A 1NDDA 4G0NB 2KMAA 3RUIB 2KC1A 3R3MA 2I1JA 2V1YA 1P3QU 4K1RB 1G6JA 1RFAA 3PRPB 4TQ1A 3WAMA 1BT0A 4MGYE 4NPNA 1WM2A 1YD8U 4NQLB 3GZNI 3WAPA 2KX0A 3PVLA 1QZEA 3OJ4B 4II2B 2ZNVB 3R7QA 1R4MI 1Z2MA 4G50A 4KV2A 3VFKA 3L13A 5G2NA 4E74A 4E3CA 2MBOA 1E7UA 1KJTA 3UQBA 2O6VB 2I1KA 4HK2A 5DPSA 5DPRA 2KDEB 1S3SG 1WYWB 2JRHA 4BKTA 2KQ7A 2ZCBA 3EC8A 1F9JA 3L16A 4HPLB 1R4NI 3V6CB 4F7ZA 4GXBA 2N7DA 4HPMB 2KFKB 2LVQA 3I3TB 3UINB 4MSMB 3OLMD 4PYZA 5LXIB 2L00B 4ANUA 1WIAA 3ONSA 4W9EA 3VDZA 2PJHA 4K7WA 5CHFA 3V6EB 2Z0DB 3CF6E 4ZYNA 4WJNA 3N32A 2DX5B 4KSLC 2KTRA 3DVNU 1RLFA 1WXVA 3ECIA 2N1WA 3WALA 3BY4B 2AYOB 2DENB 2FAZA 1Z5SB 2LVPA 2OOBB 2JRIB 2KNBA 1IP9A 3CSTA 2MP2B 1V81A 2IZVB 2FCQA 5G55A 2V3SA 1EF1A 3EFUA 3ZO5B 3W1YA 3VTVA 3ZNGC 2GBKA 2NS5A 5L83A 1WX9A 1UD7A 2NPTB 1WX8A 3APCA 2DYOA 4ANVA 4A3PA 1IYFA 2FNJB 1NBFC 2CKHB 3ENEA 4WWOA 2BYFA 1J19A 2HJ8A 1OGWA 2M0XA 4GDKB 4NQKE 3TBLD 3U30A 5CX3A 3A4RA 2N9EB 4KIKA 4K81A 3ZRCA 4G11A 3IHPC 2EMTA 2MQJA 2EMSA 3PT2B 1E5WA 3VTUA 3WAOA 4ZRIA 2M8SA 3VXWA 4IUMB 4JLCA 3R7RA 2FIDA 2MBHA 4AOFA 5DPTA 2XBBC 3SHQA 1K8RB 3PHWB 1WXMA 4GN1A 5TR5A 1SE9A 3RD2A 4FN2A 2WDTB 2DHZA 3DCGA 3UQAA 1WMHA 1IPGA 4FULA 4PS3A 5AZHA 1E7VA 4WWPA 4EZKA 2IY0B 3ML9A 3PLVA 2DAFA 4JQWC 4KDIC 5J17A 3KW5B 3SD5A 4B95A 1WH3A 4WQOB 1UZXB 1WE6A 2YVCA 2KX3A 1P9DU 1WX7A 2MW5A 4EOYA 2MCNB 2UWQA 4TV3A 3WANA 4GMVA 2LASA 3DBHI 1J0GA 1E8ZA 4AUQC 3IFWB 1WE7A 5EDSA 3DDCB 2N9PC 3N3KB 4MM3A
chains in the Genus database with same CATH superfamily
1RAXA 3L4PA 4DHZE 1LGRA 3VHTC 3NZ3A 4PS7A 2KN4A 1XF5L 2FCNA 3PZDA 4LDTB 2JXXA 3X23A 3APDA 1OTRB 5LXHA 4A55A 2NTTA 1A70A 2B3AA 2ACZB 2DZJA 1JW9D 4AJYB 4BKSA 3DVGX 3NUHB 2JPHA 4AWJA 3PV1A 2IGHA 2CS4A 1JQ4A 2PE9A 3VVWB 3H6NA 2M19A 3KWVA 3PZ8A 3DHIC 2FE8A 2KLCA 2K0PA 1Q5WB 4FLHA 4EZLA 4XC2A 1UWMA 5BO4B 4LNNA 2PIAA 2LUEA 2NBUA 3RYTA 4W9JA 3PHXB 1PUTA 2UU7A 3P4QB 3ZVVA 2RSUA 1T6BX 2KJ6A 3ALBA 3QQ8B 4MGZE 1UH6A 4E71A 1KTKA 4GB9A 4W9FA 2PE6B 2QILA 2L0FA 4DK5A 1FFVA 4B6WA 1GC6A 3C8YA 1B1ZA 2ZCCA 4CYEA 1V2YA 1K53A 1LFDA 2WHIA 3ZQ4A 1P1AA 2QSDA 1MG8A 4RFBA 5HFYA 1S1QB 5I4DA 3GZNB 5C1ZA 4XX5A 2RMMA 1MPEA 2M17A 3Q8AA 1BMLC 2KTRB 1JALA 3NVYA 2CU1A 2KVRA 3VRAB 4W9KA 5BYSA 3P1MA 2ZPNA 1WFYA 1N5WA 1KFYB 3HM6X 1L4ZB 1SEBD 2LJ5A 4MEMA 4HLEA 2JQRB 2GLSA 2X8XX 3V62A 4IWPA 4KX6B 3WIMA 1TY0A 5MPOA 2HD5B 1I42A 4X57B 4KKJA 3NVZA 1NI2A 2BQQA 1WGKA 3TJPA 2KZRA 3VUWA 3MJ5A 4WJPA 2KOXA 4ACFA 3ZXVA 2PMVA 3DWGC 2X38A 2YLMA 1N63A 2IJ0A 1OEYJ 2N7EA 3A9KB 4W9DA 2KJHB 4ICVA 1XLQA 3VUYA 4J3OD 3RT3B 2WNMA 1SXTA 1YMHE 4OHJA 2C5LC 2DAJA 3JW0X 2M1MA 2HTHA 4RH6A 4BBNF 2RDHA 5IP4D 1UUPA 2KVZA 3SDLC 3EFCA 3O13A 1HA5A 3NS1A 3ZTCA 4JX1C 2KKCA 4KDLB 2PVGC 3MP9A 4UDUC 5IKCM 4REZA 3DHGC 3ZGZA 4FJVB 5KHOA 2BVCA 3JSVB 3A1QB 5J18A 2LVOA 3AULA 1FCCC 4TUUA 2K6QA 4URKA 3NVVA 5D94A 2MP2A 3ZKJC 4HCNB 3BYYB 3KUZA 3PTFC 1QT9A 2XEWA 3QIJA 1XLOA 2A4ZA 2IGGA 2WX0A 1J7BA 2NPTA 3A9JA 2AWTA 2KFJA 3IT4B 1SGHA 4W9CA 1FFUA 4B0MA 3PS6A 2J4XA 2ZNVC 2J0KA 1SSNA 1VZ7A 2O6VD 3I57A 4YSYB 1IGCA 4DHZB 2LXAA 3BVGA 2EKEC 4US9A 1FXIA 2PPHA 4M02A 3AEGB 5H8YE 1MI0A 1Y8RC 2MJEA 5JHBA 3NZSA 5HKHA 3KYDD 3ZTDA 4US8A 3A33B 1XT9B 2RGFA 1MHHE 4LNKA 4IM0A 1OQQA 2KWVB 2MA9B 3RNBC 3RULA 5EE9A 3UIPB 1I7HA 4USAA 3GB1A 1C77A 5AZFA 3DBHB 3WA0A 1FNWA 1FPYA 2BS4B 1SE3A 4RF0A 2BYVE 3IBEA 3A9JB 3QX1A 1N61A 2QIEB 1DOIA 2OHFA 1C3TA 2Z59B 3RNEC 4GU2A 1JWAD 3BVMA 2I2YA 4PT5A 3V61A 1C4PA 1E10A 2V4IB 4KVGB 4A3OA 1DYQA 2XK5A 2C7HA 1T0SC 1TY2A 3HHMA 3UGBB 5DCNA 4KIKB 4HXDA 1QOGA 5J2RA 2E3TA 1WSPA 4XDCA 2WGSA 1YN3A 1V8CA 2FUHB 3VRBB 2KMAA 2KC1A 1VRAB 1BT0A 3TEZA 3E56A 1YD8U 1YQ4B 3GZNI 1QZEA 3VFKA 3ZJUA 4E74A 1KJTA 3AEBB 4LNFA 3UQBA 1SF0A 4H2AA 4HK2A 1MJDA 1S3SG 2KACA 4F7ZA 4GXBA 2ICIA 3UINB 3I3TB 2L1AA 4PYZA 5CHFA 3V6EB 1L6VA 1QOFA 3HVDA 4A6QA 4GLSC 2WDVB 3ECIA 4KGRA 3BY4B 2AYOB 2DENB 1V1PB 4L2YA 1Z5SB 3FC4A 1YOVB 2KNBA 2MP2B 3TEYA 4LTUA 3W1YA 4A9AA 3P4RB 2BW2A 1NYRA 2JXTA 1TS2A 4WWOA 1J19A 2N9KA 2M0XA 3TBLD 5D3IB 3FAHA 2GB1A 2WXGA 1DGJA 1TKYA 4XE0A 3CWIA 3VTUA 4ZRIA 2WXQA 4D2KA 1KH0A 3VXWA 5DPTA 2XBBC 3RD2A 1SE9A 2WDTB 4PS3A 1E7VA 2WS3B 3RNGC 4WWPA 3PLVA 1WH3A 1P9DU 1WX7A 1T0RC 4EOYA 4TV3A 1I4PA 3WANA 2LASA 3DBHI 5G5GA 4AUQC 3IT6B 3IFWB 3AE5B 1F77A 3N3KB 4MM3A 2DWQA 1FCLA 3DQVA 1WI0A 3L54A 1KLGD 4MJSB 1GB4A 1A5RA 3QJZA 5AUIA 3T3NA 3AE7B 3ZDTA 3SU8X 4B9KA 1WZ0A 5FR6A 4FHJA 4XDDA 2KO3A 5HI1A 4C4VA 2N4FA 3Q8CA 4OZCA 2FCSA 3Q2AC 2DZMA 4ITKA 1WXSA 4YTNB 1HE8A 4MH0E 2BKRB 3AE8B 2VRRB 1I35A 2WXHA 1ZW7A 4WAAA 3RN9C 5G5HA 1X1MA 3TL5A 1AN8A 2D07B 2C60A 2JZZA 3AI5A 4I6LB 1YJ1A 4RM8A 1EM7A 1UWXA 3CMMB 4IC7B 3UF8A 3B2FA 2KD0A 2G3QB 4G3XB 2LRUA 3B2GA 1M4VA 1TKEA 2EKIA 2V0GA 1NENB 4RMAA 1NI3A 5LLIA 1SJHD 3PREA 1FRDA 1M94A 2D2QA 4M00A 4W9LA 2K5PA 4TQ0A 2B76B 2INCC 3DVGY 1Y56A 2IY1B 3KWLA 2K9XA 1T5XD 2ZVNA 3JYUA 2JX5A 2R2QA 1E7PB 3W1SC 2DZKA 5GMVA 3BIID 1YQ3B 2JT4B 2XN9C 3QWZB 1U4AA 2ZPYA 3P4SB 2BPSA 4M0WA 3NY5A 3L10B 4IOIE 2AEHA 4P7IA 1P98A 2V4LA 2QCZA 2MSED 1FO4A 4JL9A 2IO3B 2DYMA 3ML8A 1DOYA 2C7MB 1JCKB 5JHAA 1IUEA 1ZOYB 4YSZB 2WXRA 4WH4A 1F0ZA 1MVKA 1YX5B 2M0AA 2ZVOA 1QKZA 3Q3MC 2BT6A 4GOCA 2D3CA 1L6UA 1V6EA 2CHXA 2LUMA 4MACA 4HPPA 3H9DA 1L2NA 2JF5A 3N9YC 3M63B 4W9IA 3KUDB 3ZYYX 1AARA 3X0WA 1E8XA 5AZGA 2CR5A 1WJNA 2RD0A 4MGKE 2LGDA 2KHWB 1L7YA 4IWQA 2JYTA 2WLBA 1WGGA 4IKGA 2O6VA 4P1CC 2G9HD 3AU4A 1WF9A 4J6IA 2JZ3B 3I5JC 4NY0A 2L3ZA 1ZUD2 2XNAC 1XCTL 4K7UA 2WDQB 3LDZE 5L95C 4I6NB 3AH7A 1OEYA 4S17A 1RRBA 3UI3A 2NMQA 1ZXHA 3KYCD 3E9SA 4LJOB 1HTOA 2J0MA 5AEKB 1UBQA 1QILA 2WXMA 3GS2A 1ACCA 3WCQA 1VZ8A 3AU5A 2LWPA 5JZEB 1R7SA 2D3GA 1J7AA 3GE3C 1MG4A 5AUKA 3EUB2 3ZNID 3MJWA 4JGHB 2NVUI 2BYEA 3NS8A 5D6JB 2C9WB 2BS2B 2BB6A 1YJJA 4RF1A 4W9GA 4NAWA 3PLUA 1NEKB 1PDXA 4ARIA 3QAQA 2D10A 4HDOA 2WXKA 2KTFA 3VUXA 3ZIMA 3DBRI 1PGXA 1L0XB 2N9XA 4EUTA 3LB8C 3I63C 2LJIA 2BS3B 2DLBA 1ZPSA 4KGSA 1L0VB 2DYBA 2WWZA 3Q3FA 1HQRD 3NZUA 4KKIA 1WYGA 4II3B 2Q5WD 2E6XA 3HM3A 2AL3A 2L05A 1ET9A 1KLVA 2JY6A 1YNTE 2Y5BB 4RGNA 3Q8EA 3SFEB 2IO1B 1WXQA 3U2SC 2KQSA 4FBJB 1EU4A 5HHDG 2K25A 5GXGB 2KMCA 2REXA 1P0RA 1XEEA 1WGHA 2L83A 1LXDA 1WGYA 1V49A 2J0JA 1FIQA 1XLPA 1VD2A 4DQOC 1IBXA 1SB3C 1WMHB 1VLBA 4P6VF 5T8IA 3RUIB 2I1JA 2V1YA 1P3QU 1G6JA 3OWEB 2H89B 3BVZA 3R7QA 2ZNVB 1R4MI 1BUIC 2PLPA 2DBYA 3KQ4A 1N5XA 1NVID 4MM3B 1C4AA 2KQ7A 2WXJA 1XCQL 3V6CB 2N7DA 4HPMB 1B9RA 4MSMB 5LXIB 2L00B 4ANUA 1WIAA 4LLGM 3N32A 2DX5B 4KSLC 2KTRA 3W9CB 2FAZA 3P4PB 2JRIB 3PO0A 3CSTA 1V81A 2IZVB 3EFUA 1CZPA 1TS4A 1ZE3D 3NJTA 3ZNGC 1FXAA 3APCA 5JXVA 1E0ZA 1N60A 1DOXA 2FNJB 1OGWA 4NQKE 5CX3A 3P63A 3IHPC 2JZPA 4ZYSA 3WAOA 2LMCA 2M8SA 4LNIA 2FIDA 4AOFA 4KGTA 3SHQA 4GN1A 1WXMA 3UQAA 1WMHA 1IPGA 4FULA 2KMMA 1Q10A 1ROEA 4EE2A 1FM0D 4EZKA 1I4HA 2R61A 3SD5A 3HVZA 1UZXB 2HJ1A 2INDC 2YVCA 1JMLA 3OG5A 1YJIA 4N58A 1J0GA 1FNVA 1C9FA 3DDCB 1D6EC 1WGDA 4OVUA 3QHTA 2J7QB 5TSSA 3QCAA 4KZ0A 2EELA 4TKNA 1JROA 1TZ1A 1GJZA 3Q69A 2QJLA 2G4DB 1WY8A 3LXFA 1PGAA 2VH2A 3KVFB 2N9LA 4ANXA 1C4CA 1AW7A 1KRHA 1I4XA 3MC8A 1CK1A 4MJSA 2MWSB 2L8JA 3AE3B 2DZIA 2H88B 3AE6B 3RCZA 3M95A 3MHZA 4ASWC 4XWWA 2IGDA 3TEWA 1J8CA 5CTRC 2QDFA 4BOZB 1T0YA 3B0AA 1GOZA 1OQRA 3PPAA 1H8CA 2D3AA 2GOWA 4HEA1 1SIJA 2J53A 1HTQA 1SE4A 2L32A 1KOTA 1UNSA 3KUCB 5H92C 3KLSX 3U7DA 5BMHA 2KYWA 3Q3JA 3TMPB 2HE7A 4HRSA 2RDGA 1PYWD 3M62B 2Y3AA 4ZHOA 5IN7A 2KJRA 2PVOD 2WXNA 1HEZE 5IOIA 3QA8A 4C4VB 1ZDVA 2FBWB 1E90A 2L76A 1QOAA 1ZKHA 5CHVC 3B1LX 3V3XA 3RMKC 1AYFA 1TT5B 4K3BA 2IBIB 2RR9A 2K8CA 4YXDB 4LNOA 2BKFA 3AEFB 3LJ3A 4DBGA 5EE0A 4RGTA 2AL6A 2DNFA 1E6EB 1V97A 2KDBA 3RZFA 3OAWA 4JIOU 4GDLB 2IO0B 3QK0A 1FMAD 2W54A 1D5ZC 3TEXA 3N20C 2MBEA 1R4NB 1L4DB 4WWNA 3BZDB 3M3JA 3ETRA 3ZW3A 2NBWB 4ANWA 4ZHPA 1WJUA 3AXCA 3H8HA 4A90A 4BBNC 4HDQA 5IA7A 1UBIA 2OJWA 4NZLB 2MRPA 4BAXA 5C23A 1UGJA 4XGAB 3VAWA 2WQYB 5C2TB 3V05A 1ZGUB 2HDEA 3CSFA 4BFRA 3L0WB 4JWSC 2JUOA 2GBJA 1JWSD 5LNK1 4YSXB 3A1QA 4Q2JA 1ENFA 3W5VB 1KF6B 3PSEB 4GIVA 1E9MA 4NAWB 2JWZA 1V1OA 2L52A 4LCDE 2KXJA 2LGYA 3Q8FA 4KSKC 1EUVB 2ZEQA 4C80A 2WXIA 4EZJA 2HTME 4ZRJA 4FHKA 2GRIA 3IVFA 3VQIA 3K9PB 2LD9A 1KM7A 1STEA 2MHJA 3EGRA 3EA6A 2CJOA 3NVWA 3HK0A 2K8BA 2WX1A 3AE9B 2AX5A 1I4GA 1SJED 3TUOA 1I4RA 3QC8B 2TSSA 2WXOA 2FIFA 3FILB 2L7RA 3V60A 3N1ZC 1J7CA 3BK2A 4A8XC 3NG0A 4M0WB 4CO7A 2A5UA 3PZ7A 3EECA 1WGRA 2WXPA 1XO3A 3A9KA 1XLNA 3AM9A 2LHDA 1FEHA 3AE4B 2D5GA 5E6NA 1YN4A 4GSWA 2W3RA 3DBLB 3DBSA 4IW0A 1D5XC 2QEJC 2VZKD 1TZOA 2GMIC 4TMAB 2FCMA 1TGZB 3FILA 3L17A 2CJNA 1L5PA 2R2OA 4JE3B 1SIFA 4XZ4A 1TS3A 3T8MA 1GB1A 2G45B 3DPDA 1V9JA 2JSVX 2KDFB 4B0EA 3K9OB 1TBEA 3DBLI 4DHJB 4NNJB 5JH5C 4ZRQA 2JWUA 5D2MB 1PGBA 4BOSC 4DXAB 1UF0A 4W9HA 4PS8A 3AMZA 2INNE 2NCNA 4A20A 4R3DA 4YTMB 2LI5A 2KANA 4HVBA 1ZDXA 3R66C 1EO6A 2PW9A 2CHWA 3LYYA 3H1UA 2W55A 1YN5A 1OFFA 1K51A 4EEWA 3W1SA 4JPSA 3N1XC 1UELA 4M8NA 3H7PA 2KQ4X 5E6PA 3HUIA 2O2VA 2KT7A 3JVZX 4WJQA 4OZAA 4OVVA 4MT5A 2BF8B 3BINA 2MEKA 1LO5D 3D32A 4PK1A 1E8YA 2KN5A 3TSSA 2FUG1 1WM3A 2LFIA 4CHKA 4BKSD 4C7YA 2BBCA 3A4SC 3P2BA 1C76A 1HXYD 2G1EA 5IAAC 4ZOHC 3IAS1 2MBBB 3Q14C 4P16A 5CHWA 1C78A 3APFA 4DHJD 1WRIA 2JYEA 3ZJVA 2UYZB 2IYDB 4EKUA 2JU6X 2SAKA 3R3MA 3BYTB 5HG2A 1RFAA 2ZW1A 3PRPB 3ZJTA 4TQ1A 1CQVA 1WM2A 5BMGA 4NQLB 3WAPA 2KX0A 2WP9B 3OJ4B 1Z2MA 1JWUD 3L13A 4LK0M 4E3CA 3SFDB 1E7UA 3BK1A 2O6VB 3I9V1 2YEPF 2I1KA 1I4QA 5DPSA 5DPRA 1WYWB 2JRHA 4BKTA 4K3CA 1F9JA 1QOBA 3L16A 2KFKB 2WU2B 2RDBC 2SEBD 1TIFA 4OZBA 3ONSA 4W9EA 2PJHA 4K7WA 2WDRB 3CF6E 4L23A 2KWDA 1TKGA 1WXVA 1VR9A 3WALA 2OOBB 2LVPA 3Q8BA 5E6JA 3ZO5B 2OEDA 3VTVA 2GBKA 2NS5A 1VDVA 1WX9A 2NPTB 1WX8A 4ANVA 4A3PA 1NBFC 4C7ZA 4HKQA 2BYFA 1F1HA 3U30A 4WIPA 3A4RA 2N9EB 4KIKA 3RFZB 3RNFC 2AQ2B 1VJKA 1BXTA 4JLCA 2J52A 3PHWB 5TR5A 4C56C 4FN2A 3DCGA 1EWYC 2Y5PA 2IY0B 3ML9A 4JQWC 5J17A 3KW5B 3W2DA 4WQOB 3ABVB 3Q3NC 1WE6A 2PTLA 2GI9A 2IPKD 4FXCA 1K50A 2N9PC 2WU5B 2ZZPB 2K22A 2IO2B 3N30A 5BYQA 4WJOA 1F2RI 1PQSA 3EHVA 1JWBD 1WJ6A 4WWMA 2J42A 2ZJDA 3MFGA 2G4SA 3P42A 4M01A 3ZUNA 1P7FA 1HZ5A 4MH8A 3R2TA 4WURA 4C00A 4F1SA 1K52A 4K7SA 4RNAA 5KHQA 4MSQB 3MTNB 3MHSD 1T3QA 2AQ1B 3NHEB 2NTSA 2K8HA 1ET6A 2PKOA 1LM8B 3N1YC 4IWOA 5IO9A 1GUAB 2Z0EB 4DXGA 3S2AA 1FRRA 1FD6A 2GBMA 2D11A 4ARCA 5EE3A 2C7NB 2V3NA 1ISNA 2MLBA 1QQRA 2KLGA 4HWIB 2QHOA 1GAQB 3ZXRA 1V5OA 3AB5A 4S0RA 3T9LA 4MELA 4O1NA 4TSSA 3AV8A 2QC8A 1NYQA 1ZP0B 3DOWA 1ESFA 3R8BA 5E6OA 2ON8A 4DWFA 2KDMA 1GPXA 1V86A 1GG3A 2QMTA 5EE1A 4NJ7A 4BKGA 1JRPA 1LQBA 3C0RB 2VZKB 4IM3A 2BB5A 3QARA 2ZW0A 3ZDMC 2NR2A 1YX6B 2MH7A 3H7PB 3RNCC 1RFKA 2BGFA 1FXTB 4ZDVA 3CIRB 2ONQA 1JRUA 1Q1OA 1PFDA 4DDGD 2AQ3B 4GDKA 3AEDB 4FADA 3AEAB 2XK5B 3H7SA 2CHZA 4IDIA 5BMIA 4P1BC 3L08A 2LGSA 2BYTA 4BZAA 2WYQA 2V9HA 3ZNHB 1XD3B 4RM9A 3JSVA 1ZXIA 3KH0A 4HROA 4N9F4 4L1BA 2JVCA 4RGMA 2PEAA 5DPWA 2K1FA 1YQBA 2OJRA 5FKAC 4NJ6A 2IDYA 4DDID 3B08A 3VH4B 1EF5A 1XQQA 4ICUA 3R2IA 3UIOB 1CJEA 2KK8A 4HJGE 1D5MC 2MJDA 4FJZA 4N6EB 1WRDB 1IBXB 1VCBA 3NOBA 3SR6A 4YWGG 1WXAA 1T0QC 4IM2A 2GBRA 3PRZA 2N1VA 5FK9C 3VTWA 2GBNA 2K6DB 1YIWA 1KLUD 2YEPB 4EFOA 2Z8LA 3GE8C 2W82A 1Q0WB 2KC2A 2LHEA 1WR1A 2W9NA 1OQYA 2K3UA 4HJKA 4KZCA 2LZ6A 1D3ZA 5D3DA 3PRMB 4N59A 2N7JA 3AN1A 2KFKA 1V1PA 3B9JA 3FKYA 3TIXA 3IAM1 3NRZA 2WXFA 4OVZA 3MC9A 2O2VB 4WQMA 4RGOS 2K39A 1L0YB 2CU3A 3MC0B 1QF6A 4GGQA 2KDIA 2MX2A 4LJPB 1H4RA 1C79A 3RI7C 3AEEB 5BYRA 3VR9B 2M4NA 4FJYA 2RPQA 1SE2A 2NBVB 4AS1A 2MBQA 1VZ6A 3OJ3A 3URYA 3U8ZA 3U7ZA 2LXCA 1EU3A 4I6PA 1TTNA 3VH3B 4LDTD 1AWDA 3C19A 3TCAA 1TYGB 3AE1B 3HIZA 1V80A 1WR6E 2ASQA 1MFWA 3ZLZA 1WWTA 4RCOA 1HZ6A 1V5TA 1UGMA 1WZ3A 1QLBB 1E8WA 1WJ4A 2I38A 3RNAC 4NJCA 1R4MB 4ZRKA 1IGDA 4MDKE 3SEBA 2L0TA 4BVUC 3DVNV 3ZNZB 4F8CB 3J9CA 4YL8A 1D4BA 4MGIE 4YTPB 2KWCA 1GC7A 4M8MA 4GDLA 2VH1A 4PYUA 1GNUA 4IG7B 4AJWA 1P7EA 4WAFA 2BTEA 2BWES 3AECB 3VR8B 3Q6BA 2M56B 2WXLA 2LGXA 3ZRFA 2KWUB 1JWMD 4XWTA 3IG3A 2LRWA 2MJ3A 2Y5CA 3PGEA 1CMXB 3DBRB 1TS5A 1C1YB 2KAJA 2W3SA 3O65B 4HKZE 1F52A 2BWFA 3GOEA 4HCPB 4AP4C 5D7GA 4FA6A 1NDDA 4G0NB 4OW0A 4K1RB 5FR3A 3WAMA 4MGYE 4NPNA 2LGIA 3PVLA 1F2RC 4II2B 4G50A 4KV2A 5G2NA 2MBOA 2RPVA 2KDEB 3T3OA 2N0SB 2ZCBA 3EC8A 4NAMA 4HPLB 1R4NI 2LVQA 3OLMD 1TJEA 4AQ7A 3VDZA 4XYCA 2Z0DB 1FNUA 4ZYNA 4WJNA 3BWUD 5C3JB 3DVNU 1RLFA 2N1WA 1RWSA 3AE2B 4ZRPA 1EWCA 3GP7A 1IP9A 2FCQA 5G55A 2V3SA 1EF1A 3Q3OC 3HRDD 5L83A 3DWMA 1UD7A 2DYOA 1IYFA 2CKHB 3ENEA 4JWUC 2HJ8A 2INPE 4GDKB 1XXGA 3U4EG 4K81A 3ZRCA 4G11A 2EMTA 2MQJA 2EMSA 2V3PA 3PT2B 1E5WA 2D3BA 3W5UB 4IUMB 3IXSA 1N62A 3R7RA 3RPFC 1RM6C 2MBHA 1K8RB 3RZWC 3U52E 2DHZA 1SBBB 5AZHA 4QAYA 2LEKA 4KDIC 2DAFA 4YT0B 4B95A 1MHXA 2KX3A 2MW5A 2MCNB 2UWQA 4DXFA 1N6ZA 3DHHC 4GMVA 1E8ZA 1RYJA 1WE7A 5EDSA 4CQNA
chains in the Genus database with same CATH topology
2ZZPB 3DQVA 1RAXA 1WGDA 1WI0A 2IO2B 3L54A 3N30A 4OVUA 3QHTA 3VHTC 4DHZE 4PS7A 4WJOA 4MJSB 2FCNA 2J7QB 1PQSA 3EHVA 3PZDA 4LDTB 1A5RA 1WJ6A 2JXXA 3X23A 3QCAA 3QJZA 4KZ0A 3APDA 4TKNA 1OTRB 5LXHA 2ZJDA 1TZ1A 2G4SA 3ZDTA 3SU8X 3ZUNA 1GJZA 2B3AA 2DZJA 2G4DB 1WY8A 4B9KA 1WZ0A 5FR6A 3RZWC 4FHJA 4AJYB 4BKSA 3KVFB 3DVGX 2KO3A 4F1SA 4ANXA 2JPHA 4K7SA 4AWJA 5KHQA 4MSQB 3MTNB 4MJSA 2MWSB 3MHSD 2L8JA 3PV1A 2CS4A 2DZIA 2N4FA 2PE9A 2FCSA 3NHEB 3VVWB 2DZMA 2K8HA 3RCZA 1WXSA 3M95A 3H6NA 1HE8A 1LM8B 4ASWC 4MH0E 1J8CA 2BKRB 5CTRC 4IWOA 4BOZB 2VRRB 1T0YA 3B0AA 3PPAA 1I35A 2KLCA 1Q5WB 4FLHA 1GUAB 2Z0EB 1ZW7A 4WAAA 2GOWA 3S2AA 1H8CA 4EZLA 1X1MA 3TL5A 4XC2A 2D07B 5BO4B 2GBMA 2C60A 2JZZA 2D11A 3AI5A 2C7NB 2LUEA 4I6LB 1KOTA 3KUCB 2NBUA 1YJ1A 4RM8A 3RYTA 4W9JA 3PHXB 1ISNA 2MLBA 3CMMB 3U7DA 4IC7B 3ZVVA 2KLGA 2RSUA 3UF8A 4HWIB 3QQ8B 2KJ6A 3ALBA 4MGZE 2QHOA 1UH6A 3Q3JA 2KD0A 3TMPB 4E71A 2HE7A 2G3QB 4GB9A 4W9FA 2PE6B 4G3XB 2LRUA 1V5OA 2L0FA 3M62B 4DK5A 2KJRA 4B6WA 1GC6A 3QA8A 3T9LA 4MELA 4RMAA 5LLIA 1E90A 2ZCCA 3PREA 1M94A 2L76A 3DOWA 4CYEA 2D2QA 5E6OA 1V2YA 1LFDA 1ZKHA 5CHVC 4DWFA 3B1LX 1P1AA 1MG8A 4W9LA 2IBIB 2RR9A 2K8CA 1V86A 4TQ0A 1GG3A 2BKFA 1S1QB 4NJ7A 4BKGA 1LQBA 3LJ3A 3C0RB 3DVGY 4DBGA 4IM3A 3QARA 2IY1B 5C1ZA 2AL6A 4XX5A 2KDBA 2ZVNA 3ZDMC 2M17A 2NR2A 3JYUA 3RZFA 2KTRB 3OAWA 2R2QA 1YX6B 3H7PB 2KVRA 2CU1A 4JIOU 4GDLB 3W1SC 2IO0B 4W9KA 2BGFA 1FXTB 4ZDVA 2ZPNA 1WFYA 2DZKA 5GMVA 3QK0A 1JRUA 2JT4B 3HM6X 3QWZB 1Q1OA 2LJ5A 2MBEA 4DDGD 4MEMA 4GDKA 4HLEA 4FADA 1U4AA 2XK5B 3M3JA 4WWNA 3ZW3A 2NBWB 3H7SA 2CHZA 3V62A 4ANWA 2ZPYA 1WJUA 3AXCA 2BPSA 4IWPA 4BBNC 3L08A 3WIMA 3NY5A 4HDQA 3L10B 5IA7A 2AEHA 4P7IA 1UBIA 1P98A 2WYQA 2HD5B 3ZNHB 1I42A 1XD3B 4RM9A 3JSVA 3KH0A 4N9F4 4X57B 2V4LA 2JVCA 2PEAA 5DPWA 2MSED 2MRPA 4JL9A 2IO3B 5C23A 1NI2A 2DYMA 3ML8A 2C7MB 2K1FA 1YQBA 2OJRA 3VAWA 5JHAA 4NJ6A 4DDID 3B08A 1ZGUB 3VH4B 3CSFA 3TJPA 1EF5A 4BFRA 3L0WB 1XQQA 4ICUA 2KZRA 2JUOA 2GBJA 3UIOB 3VUWA 4WJPA 2KOXA 1YX5B 2KK8A 2ZVOA 3A1QA 4GOCA 4FJZA 2YLMA 1WRDB 3PSEB 1V6EA 2CHXA 4GIVA 1VCBA 3NOBA 1OEYJ 2N7EA 3A9KB 1WXAA 3H9DA 4IM2A 4NAWB 1L2NA 2JF5A 4W9DA 2KJHB 2GBRA 3M63B 4ICVA 3PRZA 2N1VA 4W9IA 3KUDB 3RT3B 3VUYA 2JWZA 3VTWA 2GBNA 1AARA 3X0WA 2K6DB 4LCDE 2KXJA 2LGYA 1E8XA 5AZGA 1YIWA 4KSKC 2CR5A 1EUVB 2C5LC 2DAJA 2ZEQA 4EFOA 4EZJA 3JW0X 1WJNA 2M1MA 2RD0A 4MGKE 2LGDA 2HTHA 4BBNF 4ZRJA 4FHKA 2KHWB 1L7YA 4IWQA 3SDLC 1Q0WB 3IVFA 3VQIA 1WGGA 2KC2A 2LD9A 3K9PB 1KM7A 2O6VA 3AU4A 1WF9A 2JZ3B 1WR1A 2W9NA 4J6IA 3ZTCA 3HK0A 1OQYA 2K8BA 2KKCA 4KDLB 4NY0A 2WX1A 4HJKA 2L3ZA 4KZCA 2LZ6A 1D3ZA 4K7UA 3PRMB 3LDZE 5L95C 2KFKA 4FJVB 3QC8B 3TIXA 4I6NB 2FIFA 1OEYA 2L7RA 5KHOA 5J18A 3JSVB 3A1QB 1RRBA 3V60A 2O2VB 4M0WB 2LVOA 2A5UA 4CO7A 2K39A 3AULA 3KYCD 4LJOB 3EECA 4GGQA 2KDIA 1WGRA 2MX2A 4LJPB 2J0MA 3A9KA 5AEKB 4TUUA 2K6QA 1UBQA 4URKA 1H4RA 5D94A 3ZKJC 2MP2A 5E6NA 4HCNB 3KUZA 4GSWA 3PTFC 3AU5A 2XEWA 2LWPA 3QIJA 5JZEB 2D3GA 3DBSA 2A4ZA 4IW0A 2GMIC 2M4NA 2NPTA 2WX0A 3A9JA 4FJYA 2AWTA 2FCMA 2RPQA 1TGZB 2KFJA 3L17A 2R2OA 3ZNID 3MJWA 1SGHA 4W9CA 3PS6A 1SIFA 2NBVB 2ZNVC 2J0KA 4XZ4A 2MBQA 3OJ3A 3T8MA 4JGHB 2G45B 2NVUI 2BYEA 3U8ZA 3NS8A 3DPDA 2LXCA 1V9JA 5D6JB 2KDFB 4I6PA 1TTNA 2O6VD 3K9OB 1TBEA 3DBLI 2C9WB 3VH3B 2LXAA 4LDTD 4DHZB 2EKEC 4DHJB 4NNJB 4W9GA 5JH5C 4NAWA 2PPHA 5D2MB 3TCAA 3PLUA 4BOSC 1Y8RC 4DXAB 5JHBA 3HIZA 1V80A 1WR6E 3NZSA 2ASQA 5HKHA 4W9HA 3KYDD 3ZTDA 3QAQA 2D10A 4HDOA 4PS8A 3ZLZA 3A33B 1XT9B 2NCNA 4A20A 2KTFA 2RGFA 3VUXA 3ZIMA 1V5TA 1UGMA 3DBRI 1WZ3A 2LI5A 2N9XA 4IM0A 2KANA 1E8WA 1WJ4A 2KWVB 4EUTA 2MA9B 3RULA 4HVBA 3UIPB 3R66C 4ZRKA 1EO6A 2CHWA 5AZFA 3H1UA 4MDKE 2DYBA 2L0TA 3WA0A 4BVUC 2WWZA 3DVNV 3Q3FA 3ZNZB 3NZUA 4F8CB 4II3B 4EEWA 3HM3A 4YL8A 3W1SA 2AL3A 2BYVE 2L05A 3IBEA 3A9JB 1KLVA 2JY6A 3QX1A 4MGIE 1C3TA 1UELA 4M8NA 2KWCA 1GC7A 2Y5BB 3H7PA 2Z59B 4M8MA 4GU2A 4GDLA 5E6PA 4PYUA 2O2VA 1GNUA 2IO1B 3JVZX 4IG7B 4WJQA 4AJWA 4OVVA 2BF8B 3BINA 3D32A 3V61A 2BWES 1E8YA 2KN5A 2KQSA 2LGXA 1WM3A 4FBJB 3ZRFA 4KVGB 4CHKA 4A3OA 4BKSD 2XK5A 2C7HA 2KWUB 3A4SC 3HHMA 3IG3A 2LRWA 2K25A 3P2BA 5DCNA 3UGBB 2KMCA 2REXA 3PGEA 1CMXB 4KIKB 4HXDA 1C1YB 1P0RA 5IAAC 5J2RA 2MBBB 3O65B 1WGHA 5CHWA 2BWFA 3GOEA 4HCPB 3APFA 1LXDA 1WGYA 1V49A 2J0JA 4DHJD 4AP4C 2UYZB 1VD2A 2IYDB 4EKUA 5D7GA 1WMHB 2FUHB 4FA6A 1NDDA 4G0NB 2KMAA 3RUIB 2KC1A 3R3MA 2I1JA 2V1YA 1P3QU 4K1RB 1G6JA 1RFAA 3PRPB 4TQ1A 3WAMA 1BT0A 4MGYE 4NPNA 1WM2A 1YD8U 4NQLB 3GZNI 3WAPA 2KX0A 3PVLA 1QZEA 3OJ4B 4II2B 2ZNVB 3R7QA 1R4MI 1Z2MA 4G50A 4KV2A 3VFKA 3L13A 5G2NA 4E74A 4E3CA 2MBOA 1E7UA 1KJTA 3UQBA 2O6VB 2I1KA 4HK2A 5DPSA 5DPRA 2KDEB 1S3SG 1WYWB 2JRHA 4BKTA 2KQ7A 2ZCBA 3EC8A 1F9JA 3L16A 4HPLB 1R4NI 3V6CB 4F7ZA 4GXBA 2N7DA 4HPMB 2KFKB 2LVQA 3I3TB 3UINB 4MSMB 3OLMD 4PYZA 5LXIB 2L00B 4ANUA 1WIAA 3ONSA 4W9EA 3VDZA 2PJHA 4K7WA 5CHFA 3V6EB 2Z0DB 3CF6E 4ZYNA 4WJNA 3N32A 2DX5B 4KSLC 2KTRA 3DVNU 1RLFA 1WXVA 3ECIA 2N1WA 3WALA 3BY4B 2AYOB 2DENB 2FAZA 1Z5SB 2LVPA 2OOBB 2JRIB 2KNBA 1IP9A 3CSTA 2MP2B 1V81A 2IZVB 2FCQA 5G55A 2V3SA 1EF1A 3EFUA 3ZO5B 3W1YA 3VTVA 3ZNGC 2GBKA 2NS5A 5L83A 1WX9A 1UD7A 2NPTB 1WX8A 3APCA 2DYOA 4ANVA 4A3PA 1IYFA 2FNJB 1NBFC 2CKHB 3ENEA 4WWOA 2BYFA 1J19A 2HJ8A 1OGWA 2M0XA 4GDKB 4NQKE 3TBLD 3U30A 5CX3A 3A4RA 2N9EB 4KIKA 4K81A 3ZRCA 4G11A 3IHPC 2EMTA 2MQJA 2EMSA 3PT2B 1E5WA 3VTUA 3WAOA 4ZRIA 2M8SA 3VXWA 4IUMB 4JLCA 3R7RA 2FIDA 2MBHA 4AOFA 5DPTA 2XBBC 3SHQA 1K8RB 3PHWB 1WXMA 4GN1A 5TR5A 1SE9A 3RD2A 4FN2A 2WDTB 2DHZA 3DCGA 3UQAA 1WMHA 1IPGA 4FULA 4PS3A 5AZHA 1E7VA 4WWPA 4EZKA 2IY0B 3ML9A 3PLVA 2DAFA 4JQWC 4KDIC 5J17A 3KW5B 3SD5A 4B95A 1WH3A 4WQOB 1UZXB 1WE6A 2YVCA 2KX3A 1P9DU 1WX7A 2MW5A 4EOYA 2MCNB 2UWQA 4TV3A 3WANA 4GMVA 2LASA 3DBHI 1J0GA 1E8ZA 4AUQC 3IFWB 1WE7A 5EDSA 3DDCB 2N9PC 3N3KB 4MM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZP B;  3DQV A;  1RAX A;  1WGD A;  1WI0 A;  2IO2 B;  3L54 A;  3N30 A;  4OVU A;  3QHT A;  3VHT C;  4DHZ E;  4PS7 A;  4WJO A;  4MJS B;  2FCN A;  2J7Q B;  1PQS A;  3EHV A;  3PZD A;  4LDT B;  1A5R A;  1WJ6 A;  2JXX A;  3X23 A;  3QCA A;  3QJZ A;  4KZ0 A;  3APD A;  4TKN A;  1OTR B;  5LXH A;  2ZJD A;  1TZ1 A;  2G4S A;  3ZDT A;  3SU8 X;  3ZUN A;  1GJZ A;  2B3A A;  2DZJ A;  2G4D B;  1WY8 A;  4B9K A;  1WZ0 A;  5FR6 A;  3RZW C;  4FHJ A;  4AJY B;  4BKS A;  3KVF B;  3DVG X;  2KO3 A;  4F1S A;  4ANX A;  2JPH A;  4K7S A;  4AWJ A;  5KHQ A;  4MSQ B;  3MTN B;  4MJS A;  2MWS B;  3MHS D;  2L8J A;  3PV1 A;  2CS4 A;  2DZI A;  2N4F A;  2PE9 A;  2FCS A;  3NHE B;  3VVW B;  2DZM A;  2K8H A;  3RCZ A;  1WXS A;  3M95 A;  3H6N A;  1HE8 A;  1LM8 B;  4ASW C;  4MH0 E;  1J8C A;  2BKR B;  5CTR C;  4IWO A;  4BOZ B;  2VRR B;  1T0Y A;  3B0A A;  3PPA A;  1I35 A;  2KLC A;  1Q5W B;  4FLH A;  1GUA B;  2Z0E B;  1ZW7 A;  4WAA A;  2GOW A;  3S2A A;  1H8C A;  4EZL A;  1X1M A;  3TL5 A;  4XC2 A;  2D07 B;  5BO4 B;  2GBM A;  2C60 A;  2JZZ A;  2D11 A;  3AI5 A;  2C7N B;  2LUE A;  4I6L B;  1KOT A;  3KUC B;  2NBU A;  1YJ1 A;  4RM8 A;  3RYT A;  4W9J A;  3PHX B;  1ISN A;  2MLB A;  3CMM B;  3U7D A;  4IC7 B;  3ZVV A;  2KLG A;  2RSU A;  3UF8 A;  4HWI B;  3QQ8 B;  2KJ6 A;  3ALB A;  4MGZ E;  2QHO A;  1UH6 A;  3Q3J A;  2KD0 A;  3TMP B;  4E71 A;  2HE7 A;  2G3Q B;  4GB9 A;  4W9F A;  2PE6 B;  4G3X B;  2LRU A;  1V5O A;  2L0F A;  3M62 B;  4DK5 A;  2KJR A;  4B6W A;  1GC6 A;  3QA8 A;  3T9L A;  4MEL A;  4RMA A;  5LLI A;  1E90 A;  2ZCC A;  3PRE A;  1M94 A;  2L76 A;  3DOW A;  4CYE A;  2D2Q A;  5E6O A;  1V2Y A;  1LFD A;  1ZKH A;  5CHV C;  4DWF A;  3B1L X;  1P1A A;  1MG8 A;  4W9L A;  2IBI B;  2RR9 A;  2K8C A;  1V86 A;  4TQ0 A;  1GG3 A;  2BKF A;  1S1Q B;  4NJ7 A;  4BKG A;  1LQB A;  3LJ3 A;  3C0R B;  3DVG Y;  4DBG A;  4IM3 A;  3QAR A;  2IY1 B;  5C1Z A;  2AL6 A;  4XX5 A;  2KDB A;  2ZVN A;  3ZDM C;  2M17 A;  2NR2 A;  3JYU A;  3RZF A;  2KTR B;  3OAW A;  2R2Q A;  1YX6 B;  3H7P B;  2KVR A;  2CU1 A;  4JIO U;  4GDL B;  3W1S C;  2IO0 B;  4W9K A;  2BGF A;  1FXT B;  4ZDV A;  2ZPN A;  1WFY A;  2DZK A;  5GMV A;  3QK0 A;  1JRU A;  2JT4 B;  3HM6 X;  3QWZ B;  1Q1O A;  2LJ5 A;  2MBE A;  4DDG D;  4MEM A;  4GDK A;  4HLE A;  4FAD A;  1U4A A;  2XK5 B;  3M3J A;  4WWN A;  3ZW3 A;  2NBW B;  3H7S A;  2CHZ A;  3V62 A;  4ANW A;  2ZPY A;  1WJU A;  3AXC A;  2BPS A;  4IWP A;  4BBN C;  3L08 A;  3WIM A;  3NY5 A;  4HDQ A;  3L10 B;  5IA7 A;  2AEH A;  4P7I A;  1UBI A;  1P98 A;  2WYQ A;  2HD5 B;  3ZNH B;  1I42 A;  1XD3 B;  4RM9 A;  3JSV A;  3KH0 A;  4N9F 4;  4X57 B;  2V4L A;  2JVC A;  2PEA A;  5DPW A;  2MSE D;  2MRP A;  4JL9 A;  2IO3 B;  5C23 A;  1NI2 A;  2DYM A;  3ML8 A;  2C7M B;  2K1F A;  1YQB A;  2OJR A;  3VAW A;  5JHA A;  4NJ6 A;  4DDI D;  3B08 A;  1ZGU B;  3VH4 B;  3CSF A;  3TJP A;  1EF5 A;  4BFR A;  3L0W B;  1XQQ A;  4ICU A;  2KZR A;  2JUO A;  2GBJ A;  3UIO B;  3VUW A;  4WJP A;  2KOX A;  1YX5 B;  2KK8 A;  2ZVO A;  3A1Q A;  4GOC A;  4FJZ A;  2YLM A;  1WRD B;  3PSE B;  1V6E A;  2CHX A;  4GIV A;  1VCB A;  3NOB A;  1OEY J;  2N7E A;  3A9K B;  1WXA A;  3H9D A;  4IM2 A;  4NAW B;  1L2N A;  2JF5 A;  4W9D A;  2KJH B;  2GBR A;  3M63 B;  4ICV A;  3PRZ A;  2N1V A;  4W9I A;  3KUD B;  3RT3 B;  3VUY A;  2JWZ A;  3VTW A;  2GBN A;  1AAR A;  3X0W A;  2K6D B;  4LCD E;  2KXJ A;  2LGY A;  1E8X A;  5AZG A;  1YIW A;  4KSK C;  2CR5 A;  1EUV B;  2C5L C;  2DAJ A;  2ZEQ A;  4EFO A;  4EZJ A;  3JW0 X;  1WJN A;  2M1M A;  2RD0 A;  4MGK E;  2LGD A;  2HTH A;  4BBN F;  4ZRJ A;  4FHK A;  2KHW B;  1L7Y A;  4IWQ A;  3SDL C;  1Q0W B;  3IVF A;  3VQI A;  1WGG A;  2KC2 A;  2LD9 A;  3K9P B;  1KM7 A;  2O6V A;  3AU4 A;  1WF9 A;  2JZ3 B;  1WR1 A;  2W9N A;  4J6I A;  3ZTC A;  3HK0 A;  1OQY A;  2K8B A;  2KKC A;  4KDL B;  4NY0 A;  2WX1 A;  4HJK A;  2L3Z A;  4KZC A;  2LZ6 A;  1D3Z A;  4K7U A;  3PRM B;  3LDZ E;  5L95 C;  2KFK A;  4FJV B;  3QC8 B;  3TIX A;  4I6N B;  2FIF A;  1OEY A;  2L7R A;  5KHO A;  5J18 A;  3JSV B;  3A1Q B;  1RRB A;  3V60 A;  2O2V B;  4M0W B;  2LVO A;  2A5U A;  4CO7 A;  2K39 A;  3AUL A;  3KYC D;  4LJO B;  3EEC A;  4GGQ A;  2KDI A;  1WGR A;  2MX2 A;  4LJP B;  2J0M A;  3A9K A;  5AEK B;  4TUU A;  2K6Q A;  1UBQ A;  4URK A;  1H4R A;  5D94 A;  3ZKJ C;  2MP2 A;  5E6N A;  4HCN B;  3KUZ A;  4GSW A;  3PTF C;  3AU5 A;  2XEW A;  2LWP A;  3QIJ A;  5JZE B;  2D3G A;  3DBS A;  2A4Z A;  4IW0 A;  2GMI C;  2M4N A;  2NPT A;  2WX0 A;  3A9J A;  4FJY A;  2AWT A;  2FCM A;  2RPQ A;  1TGZ B;  2KFJ A;  3L17 A;  2R2O A;  3ZNI D;  3MJW A;  1SGH A;  4W9C A;  3PS6 A;  1SIF A;  2NBV B;  2ZNV C;  2J0K A;  4XZ4 A;  2MBQ A;  3OJ3 A;  3T8M A;  4JGH B;  2G45 B;  2NVU I;  2BYE A;  3U8Z A;  3NS8 A;  3DPD A;  2LXC A;  1V9J A;  5D6J B;  2KDF B;  4I6P A;  1TTN A;  2O6V D;  3K9O B;  1TBE A;  3DBL I;  2C9W B;  3VH3 B;  2LXA A;  4LDT D;  4DHZ B;  2EKE C;  4DHJ B;  4NNJ B;  4W9G A;  5JH5 C;  4NAW A;  2PPH A;  5D2M B;  3TCA A;  3PLU A;  4BOS C;  1Y8R C;  4DXA B;  5JHB A;  3HIZ A;  1V80 A;  1WR6 E;  3NZS A;  2ASQ A;  5HKH A;  4W9H A;  3KYD D;  3ZTD A;  3QAQ A;  2D10 A;  4HDO A;  4PS8 A;  3ZLZ A;  3A33 B;  1XT9 B;  2NCN A;  4A20 A;  2KTF A;  2RGF A;  3VUX A;  3ZIM A;  1V5T A;  1UGM A;  3DBR I;  1WZ3 A;  2LI5 A;  2N9X A;  4IM0 A;  2KAN A;  1E8W A;  1WJ4 A;  2KWV B;  4EUT A;  2MA9 B;  3RUL A;  4HVB A;  3UIP B;  3R66 C;  4ZRK A;  1EO6 A;  2CHW A;  5AZF A;  3H1U A;  4MDK E;  2DYB A;  2L0T A;  3WA0 A;  4BVU C;  2WWZ A;  3DVN V;  3Q3F A;  3ZNZ B;  3NZU A;  4F8C B;  4II3 B;  4EEW A;  3HM3 A;  4YL8 A;  3W1S A;  2AL3 A;  2BYV E;  2L05 A;  3IBE A;  3A9J B;  1KLV A;  2JY6 A;  3QX1 A;  4MGI E;  1C3T A;  1UEL A;  4M8N A;  2KWC A;  1GC7 A;  2Y5B B;  3H7P A;  2Z59 B;  4M8M A;  4GU2 A;  4GDL A;  5E6P A;  4PYU A;  2O2V A;  1GNU A;  2IO1 B;  3JVZ X;  4IG7 B;  4WJQ A;  4AJW A;  4OVV A;  2BF8 B;  3BIN A;  3D32 A;  3V61 A;  2BWE S;  1E8Y A;  2KN5 A;  2KQS A;  2LGX A;  1WM3 A;  4FBJ B;  3ZRF A;  4KVG B;  4CHK A;  4A3O A;  4BKS D;  2XK5 A;  2C7H A;  2KWU B;  3A4S C;  3HHM A;  3IG3 A;  2LRW A;  2K25 A;  3P2B A;  5DCN A;  3UGB B;  2KMC A;  2REX A;  3PGE A;  1CMX B;  4KIK B;  4HXD A;  1C1Y B;  1P0R A;  5IAA C;  5J2R A;  2MBB B;  3O65 B;  1WGH A;  5CHW A;  2BWF A;  3GOE A;  4HCP B;  3APF A;  1LXD A;  1WGY A;  1V49 A;  2J0J A;  4DHJ D;  4AP4 C;  2UYZ B;  1VD2 A;  2IYD B;  4EKU A;  5D7G A;  1WMH B;  2FUH B;  4FA6 A;  1NDD A;  4G0N B;  2KMA A;  3RUI B;  2KC1 A;  3R3M A;  2I1J A;  2V1Y A;  1P3Q U;  4K1R B;  1G6J A;  1RFA A;  3PRP B;  4TQ1 A;  3WAM A;  1BT0 A;  4MGY E;  4NPN A;  1WM2 A;  1YD8 U;  4NQL B;  3GZN I;  3WAP A;  2KX0 A;  3PVL A;  1QZE A;  3OJ4 B;  4II2 B;  2ZNV B;  3R7Q A;  1R4M I;  1Z2M A;  4G50 A;  4KV2 A;  3VFK A;  3L13 A;  5G2N A;  4E74 A;  4E3C A;  2MBO A;  1E7U A;  1KJT A;  3UQB A;  2O6V B;  2I1K A;  4HK2 A;  5DPS A;  5DPR A;  2KDE B;  1S3S G;  1WYW B;  2JRH A;  4BKT A;  2KQ7 A;  2ZCB A;  3EC8 A;  1F9J A;  3L16 A;  4HPL B;  1R4N I;  3V6C B;  4F7Z A;  4GXB A;  2N7D A;  4HPM B;  2KFK B;  2LVQ A;  3I3T B;  3UIN B;  4MSM B;  3OLM D;  4PYZ A;  5LXI B;  2L00 B;  4ANU A;  1WIA A;  3ONS A;  4W9E A;  3VDZ A;  2PJH A;  4K7W A;  5CHF A;  3V6E B;  2Z0D B;  3CF6 E;  4ZYN A;  4WJN A;  3N32 A;  2DX5 B;  4KSL C;  2KTR A;  3DVN U;  1RLF A;  1WXV A;  3ECI A;  2N1W A;  3WAL A;  3BY4 B;  2AYO B;  2DEN B;  2FAZ A;  1Z5S B;  2LVP A;  2OOB B;  2JRI B;  2KNB A;  1IP9 A;  3CST A;  2MP2 B;  1V81 A;  2IZV B;  2FCQ A;  5G55 A;  2V3S A;  1EF1 A;  3EFU A;  3ZO5 B;  3W1Y A;  3VTV A;  3ZNG C;  2GBK A;  2NS5 A;  5L83 A;  1WX9 A;  1UD7 A;  2NPT B;  1WX8 A;  3APC A;  2DYO A;  4ANV A;  4A3P A;  1IYF A;  2FNJ B;  1NBF C;  2CKH B;  3ENE A;  4WWO A;  2BYF A;  1J19 A;  2HJ8 A;  1OGW A;  2M0X A;  4GDK B;  4NQK E;  3TBL D;  3U30 A;  5CX3 A;  3A4R A;  2N9E B;  4KIK A;  4K81 A;  3ZRC A;  4G11 A;  3IHP C;  2EMT A;  2MQJ A;  2EMS A;  3PT2 B;  1E5W A;  3VTU A;  3WAO A;  4ZRI A;  2M8S A;  3VXW A;  4IUM B;  4JLC A;  3R7R A;  2FID A;  2MBH A;  4AOF A;  5DPT A;  2XBB C;  3SHQ A;  1K8R B;  3PHW B;  1WXM A;  4GN1 A;  5TR5 A;  1SE9 A;  3RD2 A;  4FN2 A;  2WDT B;  2DHZ A;  3DCG A;  3UQA A;  1WMH A;  1IPG A;  4FUL A;  4PS3 A;  5AZH A;  1E7V A;  4WWP A;  4EZK A;  2IY0 B;  3ML9 A;  3PLV A;  2DAF A;  4JQW C;  4KDI C;  5J17 A;  3KW5 B;  3SD5 A;  4B95 A;  1WH3 A;  4WQO B;  1UZX B;  1WE6 A;  2YVC A;  2KX3 A;  1P9D U;  1WX7 A;  2MW5 A;  4EOY A;  2MCN B;  2UWQ A;  4TV3 A;  3WAN A;  4GMV A;  2LAS A;  3DBH I;  1J0G A;  1E8Z A;  4AUQ C;  3IFW B;  1WE7 A;  5EDS A;  3DDC B;  2N9P C;  3N3K B;  4MM3 A; 
#chains in the Genus database with same CATH topology
 1RAX A;  3L4P A;  4DHZ E;  1LGR A;  3VHT C;  3NZ3 A;  4PS7 A;  2KN4 A;  1XF5 L;  2FCN A;  3PZD A;  4LDT B;  2JXX A;  3X23 A;  3APD A;  1OTR B;  5LXH A;  4A55 A;  2NTT A;  1A70 A;  2B3A A;  2ACZ B;  2DZJ A;  1JW9 D;  4AJY B;  4BKS A;  3DVG X;  3NUH B;  2JPH A;  4AWJ A;  3PV1 A;  2IGH A;  2CS4 A;  1JQ4 A;  2PE9 A;  3VVW B;  3H6N A;  2M19 A;  3KWV A;  3PZ8 A;  3DHI C;  2FE8 A;  2KLC A;  2K0P A;  1Q5W B;  4FLH A;  4EZL A;  4XC2 A;  1UWM A;  5BO4 B;  4LNN A;  2PIA A;  2LUE A;  2NBU A;  3RYT A;  4W9J A;  3PHX B;  1PUT A;  2UU7 A;  3P4Q B;  3ZVV A;  2RSU A;  1T6B X;  2KJ6 A;  3ALB A;  3QQ8 B;  4MGZ E;  1UH6 A;  4E71 A;  1KTK A;  4GB9 A;  4W9F A;  2PE6 B;  2QIL A;  2L0F A;  4DK5 A;  1FFV A;  4B6W A;  1GC6 A;  3C8Y A;  1B1Z A;  2ZCC A;  4CYE A;  1V2Y A;  1K53 A;  1LFD A;  2WHI A;  3ZQ4 A;  1P1A A;  2QSD A;  1MG8 A;  4RFB A;  5HFY A;  1S1Q B;  5I4D A;  3GZN B;  5C1Z A;  4XX5 A;  2RMM A;  1MPE A;  2M17 A;  3Q8A A;  1BML C;  2KTR B;  1JAL A;  3NVY A;  2CU1 A;  2KVR A;  3VRA B;  4W9K A;  5BYS A;  3P1M A;  2ZPN A;  1WFY A;  1N5W A;  1KFY B;  3HM6 X;  1L4Z B;  1SEB D;  2LJ5 A;  4MEM A;  4HLE A;  2JQR B;  2GLS A;  2X8X X;  3V62 A;  4IWP A;  4KX6 B;  3WIM A;  1TY0 A;  5MPO A;  2HD5 B;  1I42 A;  4X57 B;  4KKJ A;  3NVZ A;  1NI2 A;  2BQQ A;  1WGK A;  3TJP A;  2KZR A;  3VUW A;  3MJ5 A;  4WJP A;  2KOX A;  4ACF A;  3ZXV A;  2PMV A;  3DWG C;  2X38 A;  2YLM A;  1N63 A;  2IJ0 A;  1OEY J;  2N7E A;  3A9K B;  4W9D A;  2KJH B;  4ICV A;  1XLQ A;  3VUY A;  4J3O D;  3RT3 B;  2WNM A;  1SXT A;  1YMH E;  4OHJ A;  2C5L C;  2DAJ A;  3JW0 X;  2M1M A;  2HTH A;  4RH6 A;  4BBN F;  2RDH A;  5IP4 D;  1UUP A;  2KVZ A;  3SDL C;  3EFC A;  3O13 A;  1HA5 A;  3NS1 A;  3ZTC A;  4JX1 C;  2KKC A;  4KDL B;  2PVG C;  3MP9 A;  4UDU C;  5IKC M;  4REZ A;  3DHG C;  3ZGZ A;  4FJV B;  5KHO A;  2BVC A;  3JSV B;  3A1Q B;  5J18 A;  2LVO A;  3AUL A;  1FCC C;  4TUU A;  2K6Q A;  4URK A;  3NVV A;  5D94 A;  2MP2 A;  3ZKJ C;  4HCN B;  3BYY B;  3KUZ A;  3PTF C;  1QT9 A;  2XEW A;  3QIJ A;  1XLO A;  2A4Z A;  2IGG A;  2WX0 A;  1J7B A;  2NPT A;  3A9J A;  2AWT A;  2KFJ A;  3IT4 B;  1SGH A;  4W9C A;  1FFU A;  4B0M A;  3PS6 A;  2J4X A;  2ZNV C;  2J0K A;  1SSN A;  1VZ7 A;  2O6V D;  3I57 A;  4YSY B;  1IGC A;  4DHZ B;  2LXA A;  3BVG A;  2EKE C;  4US9 A;  1FXI A;  2PPH A;  4M02 A;  3AEG B;  5H8Y E;  1MI0 A;  1Y8R C;  2MJE A;  5JHB A;  3NZS A;  5HKH A;  3KYD D;  3ZTD A;  4US8 A;  3A33 B;  1XT9 B;  2RGF A;  1MHH E;  4LNK A;  4IM0 A;  1OQQ A;  2KWV B;  2MA9 B;  3RNB C;  3RUL A;  5EE9 A;  3UIP B;  1I7H A;  4USA A;  3GB1 A;  1C77 A;  5AZF A;  3DBH B;  3WA0 A;  1FNW A;  1FPY A;  2BS4 B;  1SE3 A;  4RF0 A;  2BYV E;  3IBE A;  3A9J B;  3QX1 A;  1N61 A;  2QIE B;  1DOI A;  2OHF A;  1C3T A;  2Z59 B;  3RNE C;  4GU2 A;  1JWA D;  3BVM A;  2I2Y A;  4PT5 A;  3V61 A;  1C4P A;  1E10 A;  2V4I B;  4KVG B;  4A3O A;  1DYQ A;  2XK5 A;  2C7H A;  1T0S C;  1TY2 A;  3HHM A;  3UGB B;  5DCN A;  4KIK B;  4HXD A;  1QOG A;  5J2R A;  2E3T A;  1WSP A;  4XDC A;  2WGS A;  1YN3 A;  1V8C A;  2FUH B;  3VRB B;  2KMA A;  2KC1 A;  1VRA B;  1BT0 A;  3TEZ A;  3E56 A;  1YD8 U;  1YQ4 B;  3GZN I;  1QZE A;  3VFK A;  3ZJU A;  4E74 A;  1KJT A;  3AEB B;  4LNF A;  3UQB A;  1SF0 A;  4H2A A;  4HK2 A;  1MJD A;  1S3S G;  2KAC A;  4F7Z A;  4GXB A;  2ICI A;  3UIN B;  3I3T B;  2L1A A;  4PYZ A;  5CHF A;  3V6E B;  1L6V A;  1QOF A;  3HVD A;  4A6Q A;  4GLS C;  2WDV B;  3ECI A;  4KGR A;  3BY4 B;  2AYO B;  2DEN B;  1V1P B;  4L2Y A;  1Z5S B;  3FC4 A;  1YOV B;  2KNB A;  2MP2 B;  3TEY A;  4LTU A;  3W1Y A;  4A9A A;  3P4R B;  2BW2 A;  1NYR A;  2JXT A;  1TS2 A;  4WWO A;  1J19 A;  2N9K A;  2M0X A;  3TBL D;  5D3I B;  3FAH A;  2GB1 A;  2WXG A;  1DGJ A;  1TKY A;  4XE0 A;  3CWI A;  3VTU A;  4ZRI A;  2WXQ A;  4D2K A;  1KH0 A;  3VXW A;  5DPT A;  2XBB C;  3RD2 A;  1SE9 A;  2WDT B;  4PS3 A;  1E7V A;  2WS3 B;  3RNG C;  4WWP A;  3PLV A;  1WH3 A;  1P9D U;  1WX7 A;  1T0R C;  4EOY A;  4TV3 A;  1I4P A;  3WAN A;  2LAS A;  3DBH I;  5G5G A;  4AUQ C;  3IT6 B;  3IFW B;  3AE5 B;  1F77 A;  3N3K B;  4MM3 A;  2DWQ A;  1FCL A;  3DQV A;  1WI0 A;  3L54 A;  1KLG D;  4MJS B;  1GB4 A;  1A5R A;  3QJZ A;  5AUI A;  3T3N A;  3AE7 B;  3ZDT A;  3SU8 X;  4B9K A;  1WZ0 A;  5FR6 A;  4FHJ A;  4XDD A;  2KO3 A;  5HI1 A;  4C4V A;  2N4F A;  3Q8C A;  4OZC A;  2FCS A;  3Q2A C;  2DZM A;  4ITK A;  1WXS A;  4YTN B;  1HE8 A;  4MH0 E;  2BKR B;  3AE8 B;  2VRR B;  1I35 A;  2WXH A;  1ZW7 A;  4WAA A;  3RN9 C;  5G5H A;  1X1M A;  3TL5 A;  1AN8 A;  2D07 B;  2C60 A;  2JZZ A;  3AI5 A;  4I6L B;  1YJ1 A;  4RM8 A;  1EM7 A;  1UWX A;  3CMM B;  4IC7 B;  3UF8 A;  3B2F A;  2KD0 A;  2G3Q B;  4G3X B;  2LRU A;  3B2G A;  1M4V A;  1TKE A;  2EKI A;  2V0G A;  1NEN B;  4RMA A;  1NI3 A;  5LLI A;  1SJH D;  3PRE A;  1FRD A;  1M94 A;  2D2Q A;  4M00 A;  4W9L A;  2K5P A;  4TQ0 A;  2B76 B;  2INC C;  3DVG Y;  1Y56 A;  2IY1 B;  3KWL A;  2K9X A;  1T5X D;  2ZVN A;  3JYU A;  2JX5 A;  2R2Q A;  1E7P B;  3W1S C;  2DZK A;  5GMV A;  3BII D;  1YQ3 B;  2JT4 B;  2XN9 C;  3QWZ B;  1U4A A;  2ZPY A;  3P4S B;  2BPS A;  4M0W A;  3NY5 A;  3L10 B;  4IOI E;  2AEH A;  4P7I A;  1P98 A;  2V4L A;  2QCZ A;  2MSE D;  1FO4 A;  4JL9 A;  2IO3 B;  2DYM A;  3ML8 A;  1DOY A;  2C7M B;  1JCK B;  5JHA A;  1IUE A;  1ZOY B;  4YSZ B;  2WXR A;  4WH4 A;  1F0Z A;  1MVK A;  1YX5 B;  2M0A A;  2ZVO A;  1QKZ A;  3Q3M C;  2BT6 A;  4GOC A;  2D3C A;  1L6U A;  1V6E A;  2CHX A;  2LUM A;  4MAC A;  4HPP A;  3H9D A;  1L2N A;  2JF5 A;  3N9Y C;  3M63 B;  4W9I A;  3KUD B;  3ZYY X;  1AAR A;  3X0W A;  1E8X A;  5AZG A;  2CR5 A;  1WJN A;  2RD0 A;  4MGK E;  2LGD A;  2KHW B;  1L7Y A;  4IWQ A;  2JYT A;  2WLB A;  1WGG A;  4IKG A;  2O6V A;  4P1C C;  2G9H D;  3AU4 A;  1WF9 A;  4J6I A;  2JZ3 B;  3I5J C;  4NY0 A;  2L3Z A;  1ZUD 2;  2XNA C;  1XCT L;  4K7U A;  2WDQ B;  3LDZ E;  5L95 C;  4I6N B;  3AH7 A;  1OEY A;  4S17 A;  1RRB A;  3UI3 A;  2NMQ A;  1ZXH A;  3KYC D;  3E9S A;  4LJO B;  1HTO A;  2J0M A;  5AEK B;  1UBQ A;  1QIL A;  2WXM A;  3GS2 A;  1ACC A;  3WCQ A;  1VZ8 A;  3AU5 A;  2LWP A;  5JZE B;  1R7S A;  2D3G A;  1J7A A;  3GE3 C;  1MG4 A;  5AUK A;  3EUB 2;  3ZNI D;  3MJW A;  4JGH B;  2NVU I;  2BYE A;  3NS8 A;  5D6J B;  2C9W B;  2BS2 B;  2BB6 A;  1YJJ A;  4RF1 A;  4W9G A;  4NAW A;  3PLU A;  1NEK B;  1PDX A;  4ARI A;  3QAQ A;  2D10 A;  4HDO A;  2WXK A;  2KTF A;  3VUX A;  3ZIM A;  3DBR I;  1PGX A;  1L0X B;  2N9X A;  4EUT A;  3LB8 C;  3I63 C;  2LJI A;  2BS3 B;  2DLB A;  1ZPS A;  4KGS A;  1L0V B;  2DYB A;  2WWZ A;  3Q3F A;  1HQR D;  3NZU A;  4KKI A;  1WYG A;  4II3 B;  2Q5W D;  2E6X A;  3HM3 A;  2AL3 A;  2L05 A;  1ET9 A;  1KLV A;  2JY6 A;  1YNT E;  2Y5B B;  4RGN A;  3Q8E A;  3SFE B;  2IO1 B;  1WXQ A;  3U2S C;  2KQS A;  4FBJ B;  1EU4 A;  5HHD G;  2K25 A;  5GXG B;  2KMC A;  2REX A;  1P0R A;  1XEE A;  1WGH A;  2L83 A;  1LXD A;  1WGY A;  1V49 A;  2J0J A;  1FIQ A;  1XLP A;  1VD2 A;  4DQO C;  1IBX A;  1SB3 C;  1WMH B;  1VLB A;  4P6V F;  5T8I A;  3RUI B;  2I1J A;  2V1Y A;  1P3Q U;  1G6J A;  3OWE B;  2H89 B;  3BVZ A;  3R7Q A;  2ZNV B;  1R4M I;  1BUI C;  2PLP A;  2DBY A;  3KQ4 A;  1N5X A;  1NVI D;  4MM3 B;  1C4A A;  2KQ7 A;  2WXJ A;  1XCQ L;  3V6C B;  2N7D A;  4HPM B;  1B9R A;  4MSM B;  5LXI B;  2L00 B;  4ANU A;  1WIA A;  4LLG M;  3N32 A;  2DX5 B;  4KSL C;  2KTR A;  3W9C B;  2FAZ A;  3P4P B;  2JRI B;  3PO0 A;  3CST A;  1V81 A;  2IZV B;  3EFU A;  1CZP A;  1TS4 A;  1ZE3 D;  3NJT A;  3ZNG C;  1FXA A;  3APC A;  5JXV A;  1E0Z A;  1N60 A;  1DOX A;  2FNJ B;  1OGW A;  4NQK E;  5CX3 A;  3P63 A;  3IHP C;  2JZP A;  4ZYS A;  3WAO A;  2LMC A;  2M8S A;  4LNI A;  2FID A;  4AOF A;  4KGT A;  3SHQ A;  4GN1 A;  1WXM A;  3UQA A;  1WMH A;  1IPG A;  4FUL A;  2KMM A;  1Q10 A;  1ROE A;  4EE2 A;  1FM0 D;  4EZK A;  1I4H A;  2R61 A;  3SD5 A;  3HVZ A;  1UZX B;  2HJ1 A;  2IND C;  2YVC A;  1JML A;  3OG5 A;  1YJI A;  4N58 A;  1J0G A;  1FNV A;  1C9F A;  3DDC B;  1D6E C;  1WGD A;  4OVU A;  3QHT A;  2J7Q B;  5TSS A;  3QCA A;  4KZ0 A;  2EEL A;  4TKN A;  1JRO A;  1TZ1 A;  1GJZ A;  3Q69 A;  2QJL A;  2G4D B;  1WY8 A;  3LXF A;  1PGA A;  2VH2 A;  3KVF B;  2N9L A;  4ANX A;  1C4C A;  1AW7 A;  1KRH A;  1I4X A;  3MC8 A;  1CK1 A;  4MJS A;  2MWS B;  2L8J A;  3AE3 B;  2DZI A;  2H88 B;  3AE6 B;  3RCZ A;  3M95 A;  3MHZ A;  4ASW C;  4XWW A;  2IGD A;  3TEW A;  1J8C A;  5CTR C;  2QDF A;  4BOZ B;  1T0Y A;  3B0A A;  1GOZ A;  1OQR A;  3PPA A;  1H8C A;  2D3A A;  2GOW A;  4HEA 1;  1SIJ A;  2J53 A;  1HTQ A;  1SE4 A;  2L32 A;  1KOT A;  1UNS A;  3KUC B;  5H92 C;  3KLS X;  3U7D A;  5BMH A;  2KYW A;  3Q3J A;  3TMP B;  2HE7 A;  4HRS A;  2RDG A;  1PYW D;  3M62 B;  2Y3A A;  4ZHO A;  5IN7 A;  2KJR A;  2PVO D;  2WXN A;  1HEZ E;  5IOI A;  3QA8 A;  4C4V B;  1ZDV A;  2FBW B;  1E90 A;  2L76 A;  1QOA A;  1ZKH A;  5CHV C;  3B1L X;  3V3X A;  3RMK C;  1AYF A;  1TT5 B;  4K3B A;  2IBI B;  2RR9 A;  2K8C A;  4YXD B;  4LNO A;  2BKF A;  3AEF B;  3LJ3 A;  4DBG A;  5EE0 A;  4RGT A;  2AL6 A;  2DNF A;  1E6E B;  1V97 A;  2KDB A;  3RZF A;  3OAW A;  4JIO U;  4GDL B;  2IO0 B;  3QK0 A;  1FMA D;  2W54 A;  1D5Z C;  3TEX A;  3N20 C;  2MBE A;  1R4N B;  1L4D B;  4WWN A;  3BZD B;  3M3J A;  3ETR A;  3ZW3 A;  2NBW B;  4ANW A;  4ZHP A;  1WJU A;  3AXC A;  3H8H A;  4A90 A;  4BBN C;  4HDQ A;  5IA7 A;  1UBI A;  2OJW A;  4NZL B;  2MRP A;  4BAX A;  5C23 A;  1UGJ A;  4XGA B;  3VAW A;  2WQY B;  5C2T B;  3V05 A;  1ZGU B;  2HDE A;  3CSF A;  4BFR A;  3L0W B;  4JWS C;  2JUO A;  2GBJ A;  1JWS D;  5LNK 1;  4YSX B;  3A1Q A;  4Q2J A;  1ENF A;  3W5V B;  1KF6 B;  3PSE B;  4GIV A;  1E9M A;  4NAW B;  2JWZ A;  1V1O A;  2L52 A;  4LCD E;  2KXJ A;  2LGY A;  3Q8F A;  4KSK C;  1EUV B;  2ZEQ A;  4C80 A;  2WXI A;  4EZJ A;  2HTM E;  4ZRJ A;  4FHK A;  2GRI A;  3IVF A;  3VQI A;  3K9P B;  2LD9 A;  1KM7 A;  1STE A;  2MHJ A;  3EGR A;  3EA6 A;  2CJO A;  3NVW A;  3HK0 A;  2K8B A;  2WX1 A;  3AE9 B;  2AX5 A;  1I4G A;  1SJE D;  3TUO A;  1I4R A;  3QC8 B;  2TSS A;  2WXO A;  2FIF A;  3FIL B;  2L7R A;  3V60 A;  3N1Z C;  1J7C A;  3BK2 A;  4A8X C;  3NG0 A;  4M0W B;  4CO7 A;  2A5U A;  3PZ7 A;  3EEC A;  1WGR A;  2WXP A;  1XO3 A;  3A9K A;  1XLN A;  3AM9 A;  2LHD A;  1FEH A;  3AE4 B;  2D5G A;  5E6N A;  1YN4 A;  4GSW A;  2W3R A;  3DBL B;  3DBS A;  4IW0 A;  1D5X C;  2QEJ C;  2VZK D;  1TZO A;  2GMI C;  4TMA B;  2FCM A;  1TGZ B;  3FIL A;  3L17 A;  2CJN A;  1L5P A;  2R2O A;  4JE3 B;  1SIF A;  4XZ4 A;  1TS3 A;  3T8M A;  1GB1 A;  2G45 B;  3DPD A;  1V9J A;  2JSV X;  2KDF B;  4B0E A;  3K9O B;  1TBE A;  3DBL I;  4DHJ B;  4NNJ B;  5JH5 C;  4ZRQ A;  2JWU A;  5D2M B;  1PGB A;  4BOS C;  4DXA B;  1UF0 A;  4W9H A;  4PS8 A;  3AMZ A;  2INN E;  2NCN A;  4A20 A;  4R3D A;  4YTM B;  2LI5 A;  2KAN A;  4HVB A;  1ZDX A;  3R66 C;  1EO6 A;  2PW9 A;  2CHW A;  3LYY A;  3H1U A;  2W55 A;  1YN5 A;  1OFF A;  1K51 A;  4EEW A;  3W1S A;  4JPS A;  3N1X C;  1UEL A;  4M8N A;  3H7P A;  2KQ4 X;  5E6P A;  3HUI A;  2O2V A;  2KT7 A;  3JVZ X;  4WJQ A;  4OZA A;  4OVV A;  4MT5 A;  2BF8 B;  3BIN A;  2MEK A;  1LO5 D;  3D32 A;  4PK1 A;  1E8Y A;  2KN5 A;  3TSS A;  2FUG 1;  1WM3 A;  2LFI A;  4CHK A;  4BKS D;  4C7Y A;  2BBC A;  3A4S C;  3P2B A;  1C76 A;  1HXY D;  2G1E A;  5IAA C;  4ZOH C;  3IAS 1;  2MBB B;  3Q14 C;  4P16 A;  5CHW A;  1C78 A;  3APF A;  4DHJ D;  1WRI A;  2JYE A;  3ZJV A;  2UYZ B;  2IYD B;  4EKU A;  2JU6 X;  2SAK A;  3R3M A;  3BYT B;  5HG2 A;  1RFA A;  2ZW1 A;  3PRP B;  3ZJT A;  4TQ1 A;  1CQV A;  1WM2 A;  5BMG A;  4NQL B;  3WAP A;  2KX0 A;  2WP9 B;  3OJ4 B;  1Z2M A;  1JWU D;  3L13 A;  4LK0 M;  4E3C A;  3SFD B;  1E7U A;  3BK1 A;  2O6V B;  3I9V 1;  2YEP F;  2I1K A;  1I4Q A;  5DPS A;  5DPR A;  1WYW B;  2JRH A;  4BKT A;  4K3C A;  1F9J A;  1QOB A;  3L16 A;  2KFK B;  2WU2 B;  2RDB C;  2SEB D;  1TIF A;  4OZB A;  3ONS A;  4W9E A;  2PJH A;  4K7W A;  2WDR B;  3CF6 E;  4L23 A;  2KWD A;  1TKG A;  1WXV A;  1VR9 A;  3WAL A;  2OOB B;  2LVP A;  3Q8B A;  5E6J A;  3ZO5 B;  2OED A;  3VTV A;  2GBK A;  2NS5 A;  1VDV A;  1WX9 A;  2NPT B;  1WX8 A;  4ANV A;  4A3P A;  1NBF C;  4C7Z A;  4HKQ A;  2BYF A;  1F1H A;  3U30 A;  4WIP A;  3A4R A;  2N9E B;  4KIK A;  3RFZ B;  3RNF C;  2AQ2 B;  1VJK A;  1BXT A;  4JLC A;  2J52 A;  3PHW B;  5TR5 A;  4C56 C;  4FN2 A;  3DCG A;  1EWY C;  2Y5P A;  2IY0 B;  3ML9 A;  4JQW C;  5J17 A;  3KW5 B;  3W2D A;  4WQO B;  3ABV B;  3Q3N C;  1WE6 A;  2PTL A;  2GI9 A;  2IPK D;  4FXC A;  1K50 A;  2N9P C;  2WU5 B;  2ZZP B;  2K22 A;  2IO2 B;  3N30 A;  5BYQ A;  4WJO A;  1F2R I;  1PQS A;  3EHV A;  1JWB D;  1WJ6 A;  4WWM A;  2J42 A;  2ZJD A;  3MFG A;  2G4S A;  3P42 A;  4M01 A;  3ZUN A;  1P7F A;  1HZ5 A;  4MH8 A;  3R2T A;  4WUR A;  4C00 A;  4F1S A;  1K52 A;  4K7S A;  4RNA A;  5KHQ A;  4MSQ B;  3MTN B;  3MHS D;  1T3Q A;  2AQ1 B;  3NHE B;  2NTS A;  2K8H A;  1ET6 A;  2PKO A;  1LM8 B;  3N1Y C;  4IWO A;  5IO9 A;  1GUA B;  2Z0E B;  4DXG A;  3S2A A;  1FRR A;  1FD6 A;  2GBM A;  2D11 A;  4ARC A;  5EE3 A;  2C7N B;  2V3N A;  1ISN A;  2MLB A;  1QQR A;  2KLG A;  4HWI B;  2QHO A;  1GAQ B;  3ZXR A;  1V5O A;  3AB5 A;  4S0R A;  3T9L A;  4MEL A;  4O1N A;  4TSS A;  3AV8 A;  2QC8 A;  1NYQ A;  1ZP0 B;  3DOW A;  1ESF A;  3R8B A;  5E6O A;  2ON8 A;  4DWF A;  2KDM A;  1GPX A;  1V86 A;  1GG3 A;  2QMT A;  5EE1 A;  4NJ7 A;  4BKG A;  1JRP A;  1LQB A;  3C0R B;  2VZK B;  4IM3 A;  2BB5 A;  3QAR A;  2ZW0 A;  3ZDM C;  2NR2 A;  1YX6 B;  2MH7 A;  3H7P B;  3RNC C;  1RFK A;  2BGF A;  1FXT B;  4ZDV A;  3CIR B;  2ONQ A;  1JRU A;  1Q1O A;  1PFD A;  4DDG D;  2AQ3 B;  4GDK A;  3AED B;  4FAD A;  3AEA B;  2XK5 B;  3H7S A;  2CHZ A;  4IDI A;  5BMI A;  4P1B C;  3L08 A;  2LGS A;  2BYT A;  4BZA A;  2WYQ A;  2V9H A;  3ZNH B;  1XD3 B;  4RM9 A;  3JSV A;  1ZXI A;  3KH0 A;  4HRO A;  4N9F 4;  4L1B A;  2JVC A;  4RGM A;  2PEA A;  5DPW A;  2K1F A;  1YQB A;  2OJR A;  5FKA C;  4NJ6 A;  2IDY A;  4DDI D;  3B08 A;  3VH4 B;  1EF5 A;  1XQQ A;  4ICU A;  3R2I A;  3UIO B;  1CJE A;  2KK8 A;  4HJG E;  1D5M C;  2MJD A;  4FJZ A;  4N6E B;  1WRD B;  1IBX B;  1VCB A;  3NOB A;  3SR6 A;  4YWG G;  1WXA A;  1T0Q C;  4IM2 A;  2GBR A;  3PRZ A;  2N1V A;  5FK9 C;  3VTW A;  2GBN A;  2K6D B;  1YIW A;  1KLU D;  2YEP B;  4EFO A;  2Z8L A;  3GE8 C;  2W82 A;  1Q0W B;  2KC2 A;  2LHE A;  1WR1 A;  2W9N A;  1OQY A;  2K3U A;  4HJK A;  4KZC A;  2LZ6 A;  1D3Z A;  5D3D A;  3PRM B;  4N59 A;  2N7J A;  3AN1 A;  2KFK A;  1V1P A;  3B9J A;  3FKY A;  3TIX A;  3IAM 1;  3NRZ A;  2WXF A;  4OVZ A;  3MC9 A;  2O2V B;  4WQM A;  4RGO S;  2K39 A;  1L0Y B;  2CU3 A;  3MC0 B;  1QF6 A;  4GGQ A;  2KDI A;  2MX2 A;  4LJP B;  1H4R A;  1C79 A;  3RI7 C;  3AEE B;  5BYR A;  3VR9 B;  2M4N A;  4FJY A;  2RPQ A;  1SE2 A;  2NBV B;  4AS1 A;  2MBQ A;  1VZ6 A;  3OJ3 A;  3URY A;  3U8Z A;  3U7Z A;  2LXC A;  1EU3 A;  4I6P A;  1TTN A;  3VH3 B;  4LDT D;  1AWD A;  3C19 A;  3TCA A;  1TYG B;  3AE1 B;  3HIZ A;  1V80 A;  1WR6 E;  2ASQ A;  1MFW A;  3ZLZ A;  1WWT A;  4RCO A;  1HZ6 A;  1V5T A;  1UGM A;  1WZ3 A;  1QLB B;  1E8W A;  1WJ4 A;  2I38 A;  3RNA C;  4NJC A;  1R4M B;  4ZRK A;  1IGD A;  4MDK E;  3SEB A;  2L0T A;  4BVU C;  3DVN V;  3ZNZ B;  4F8C B;  3J9C A;  4YL8 A;  1D4B A;  4MGI E;  4YTP B;  2KWC A;  1GC7 A;  4M8M A;  4GDL A;  2VH1 A;  4PYU A;  1GNU A;  4IG7 B;  4AJW A;  1P7E A;  4WAF A;  2BTE A;  2BWE S;  3AEC B;  3VR8 B;  3Q6B A;  2M56 B;  2WXL A;  2LGX A;  3ZRF A;  2KWU B;  1JWM D;  4XWT A;  3IG3 A;  2LRW A;  2MJ3 A;  2Y5C A;  3PGE A;  1CMX B;  3DBR B;  1TS5 A;  1C1Y B;  2KAJ A;  2W3S A;  3O65 B;  4HKZ E;  1F52 A;  2BWF A;  3GOE A;  4HCP B;  4AP4 C;  5D7G A;  4FA6 A;  1NDD A;  4G0N B;  4OW0 A;  4K1R B;  5FR3 A;  3WAM A;  4MGY E;  4NPN A;  2LGI A;  3PVL A;  1F2R C;  4II2 B;  4G50 A;  4KV2 A;  5G2N A;  2MBO A;  2RPV A;  2KDE B;  3T3O A;  2N0S B;  2ZCB A;  3EC8 A;  4NAM A;  4HPL B;  1R4N I;  2LVQ A;  3OLM D;  1TJE A;  4AQ7 A;  3VDZ A;  4XYC A;  2Z0D B;  1FNU A;  4ZYN A;  4WJN A;  3BWU D;  5C3J B;  3DVN U;  1RLF A;  2N1W A;  1RWS A;  3AE2 B;  4ZRP A;  1EWC A;  3GP7 A;  1IP9 A;  2FCQ A;  5G55 A;  2V3S A;  1EF1 A;  3Q3O C;  3HRD D;  5L83 A;  3DWM A;  1UD7 A;  2DYO A;  1IYF A;  2CKH B;  3ENE A;  4JWU C;  2HJ8 A;  2INP E;  4GDK B;  1XXG A;  3U4E G;  4K81 A;  3ZRC A;  4G11 A;  2EMT A;  2MQJ A;  2EMS A;  2V3P A;  3PT2 B;  1E5W A;  2D3B A;  3W5U B;  4IUM B;  3IXS A;  1N62 A;  3R7R A;  3RPF C;  1RM6 C;  2MBH A;  1K8R B;  3RZW C;  3U52 E;  2DHZ A;  1SBB B;  5AZH A;  4QAY A;  2LEK A;  4KDI C;  2DAF A;  4YT0 B;  4B95 A;  1MHX A;  2KX3 A;  2MW5 A;  2MCN B;  2UWQ A;  4DXF A;  1N6Z A;  3DHH C;  4GMV A;  1E8Z A;  1RYJ A;  1WE7 A;  5EDS A;  4CQN A; 
#chains in the Genus database with same CATH homology
 2ZZP B;  3DQV A;  1RAX A;  1WGD A;  1WI0 A;  2IO2 B;  3L54 A;  3N30 A;  4OVU A;  3QHT A;  3VHT C;  4DHZ E;  4PS7 A;  4WJO A;  4MJS B;  2FCN A;  2J7Q B;  1PQS A;  3EHV A;  3PZD A;  4LDT B;  1A5R A;  1WJ6 A;  2JXX A;  3X23 A;  3QCA A;  3QJZ A;  4KZ0 A;  3APD A;  4TKN A;  1OTR B;  5LXH A;  2ZJD A;  1TZ1 A;  2G4S A;  3ZDT A;  3SU8 X;  3ZUN A;  1GJZ A;  2B3A A;  2DZJ A;  2G4D B;  1WY8 A;  4B9K A;  1WZ0 A;  5FR6 A;  3RZW C;  4FHJ A;  4AJY B;  4BKS A;  3KVF B;  3DVG X;  2KO3 A;  4F1S A;  4ANX A;  2JPH A;  4K7S A;  4AWJ A;  5KHQ A;  4MSQ B;  3MTN B;  4MJS A;  2MWS B;  3MHS D;  2L8J A;  3PV1 A;  2CS4 A;  2DZI A;  2N4F A;  2PE9 A;  2FCS A;  3NHE B;  3VVW B;  2DZM A;  2K8H A;  3RCZ A;  1WXS A;  3M95 A;  3H6N A;  1HE8 A;  1LM8 B;  4ASW C;  4MH0 E;  1J8C A;  2BKR B;  5CTR C;  4IWO A;  4BOZ B;  2VRR B;  1T0Y A;  3B0A A;  3PPA A;  1I35 A;  2KLC A;  1Q5W B;  4FLH A;  1GUA B;  2Z0E B;  1ZW7 A;  4WAA A;  2GOW A;  3S2A A;  1H8C A;  4EZL A;  1X1M A;  3TL5 A;  4XC2 A;  2D07 B;  5BO4 B;  2GBM A;  2C60 A;  2JZZ A;  2D11 A;  3AI5 A;  2C7N B;  2LUE A;  4I6L B;  1KOT A;  3KUC B;  2NBU A;  1YJ1 A;  4RM8 A;  3RYT A;  4W9J A;  3PHX B;  1ISN A;  2MLB A;  3CMM B;  3U7D A;  4IC7 B;  3ZVV A;  2KLG A;  2RSU A;  3UF8 A;  4HWI B;  3QQ8 B;  2KJ6 A;  3ALB A;  4MGZ E;  2QHO A;  1UH6 A;  3Q3J A;  2KD0 A;  3TMP B;  4E71 A;  2HE7 A;  2G3Q B;  4GB9 A;  4W9F A;  2PE6 B;  4G3X B;  2LRU A;  1V5O A;  2L0F A;  3M62 B;  4DK5 A;  2KJR A;  4B6W A;  1GC6 A;  3QA8 A;  3T9L A;  4MEL A;  4RMA A;  5LLI A;  1E90 A;  2ZCC A;  3PRE A;  1M94 A;  2L76 A;  3DOW A;  4CYE A;  2D2Q A;  5E6O A;  1V2Y A;  1LFD A;  1ZKH A;  5CHV C;  4DWF A;  3B1L X;  1P1A A;  1MG8 A;  4W9L A;  2IBI B;  2RR9 A;  2K8C A;  1V86 A;  4TQ0 A;  1GG3 A;  2BKF A;  1S1Q B;  4NJ7 A;  4BKG A;  1LQB A;  3LJ3 A;  3C0R B;  3DVG Y;  4DBG A;  4IM3 A;  3QAR A;  2IY1 B;  5C1Z A;  2AL6 A;  4XX5 A;  2KDB A;  2ZVN A;  3ZDM C;  2M17 A;  2NR2 A;  3JYU A;  3RZF A;  2KTR B;  3OAW A;  2R2Q A;  1YX6 B;  3H7P B;  2KVR A;  2CU1 A;  4JIO U;  4GDL B;  3W1S C;  2IO0 B;  4W9K A;  2BGF A;  1FXT B;  4ZDV A;  2ZPN A;  1WFY A;  2DZK A;  5GMV A;  3QK0 A;  1JRU A;  2JT4 B;  3HM6 X;  3QWZ B;  1Q1O A;  2LJ5 A;  2MBE A;  4DDG D;  4MEM A;  4GDK A;  4HLE A;  4FAD A;  1U4A A;  2XK5 B;  3M3J A;  4WWN A;  3ZW3 A;  2NBW B;  3H7S A;  2CHZ A;  3V62 A;  4ANW A;  2ZPY A;  1WJU A;  3AXC A;  2BPS A;  4IWP A;  4BBN C;  3L08 A;  3WIM A;  3NY5 A;  4HDQ A;  3L10 B;  5IA7 A;  2AEH A;  4P7I A;  1UBI A;  1P98 A;  2WYQ A;  2HD5 B;  3ZNH B;  1I42 A;  1XD3 B;  4RM9 A;  3JSV A;  3KH0 A;  4N9F 4;  4X57 B;  2V4L A;  2JVC A;  2PEA A;  5DPW A;  2MSE D;  2MRP A;  4JL9 A;  2IO3 B;  5C23 A;  1NI2 A;  2DYM A;  3ML8 A;  2C7M B;  2K1F A;  1YQB A;  2OJR A;  3VAW A;  5JHA A;  4NJ6 A;  4DDI D;  3B08 A;  1ZGU B;  3VH4 B;  3CSF A;  3TJP A;  1EF5 A;  4BFR A;  3L0W B;  1XQQ A;  4ICU A;  2KZR A;  2JUO A;  2GBJ A;  3UIO B;  3VUW A;  4WJP A;  2KOX A;  1YX5 B;  2KK8 A;  2ZVO A;  3A1Q A;  4GOC A;  4FJZ A;  2YLM A;  1WRD B;  3PSE B;  1V6E A;  2CHX A;  4GIV A;  1VCB A;  3NOB A;  1OEY J;  2N7E A;  3A9K B;  1WXA A;  3H9D A;  4IM2 A;  4NAW B;  1L2N A;  2JF5 A;  4W9D A;  2KJH B;  2GBR A;  3M63 B;  4ICV A;  3PRZ A;  2N1V A;  4W9I A;  3KUD B;  3RT3 B;  3VUY A;  2JWZ A;  3VTW A;  2GBN A;  1AAR A;  3X0W A;  2K6D B;  4LCD E;  2KXJ A;  2LGY A;  1E8X A;  5AZG A;  1YIW A;  4KSK C;  2CR5 A;  1EUV B;  2C5L C;  2DAJ A;  2ZEQ A;  4EFO A;  4EZJ A;  3JW0 X;  1WJN A;  2M1M A;  2RD0 A;  4MGK E;  2LGD A;  2HTH A;  4BBN F;  4ZRJ A;  4FHK A;  2KHW B;  1L7Y A;  4IWQ A;  3SDL C;  1Q0W B;  3IVF A;  3VQI A;  1WGG A;  2KC2 A;  2LD9 A;  3K9P B;  1KM7 A;  2O6V A;  3AU4 A;  1WF9 A;  2JZ3 B;  1WR1 A;  2W9N A;  4J6I A;  3ZTC A;  3HK0 A;  1OQY A;  2K8B A;  2KKC A;  4KDL B;  4NY0 A;  2WX1 A;  4HJK A;  2L3Z A;  4KZC A;  2LZ6 A;  1D3Z A;  4K7U A;  3PRM B;  3LDZ E;  5L95 C;  2KFK A;  4FJV B;  3QC8 B;  3TIX A;  4I6N B;  2FIF A;  1OEY A;  2L7R A;  5KHO A;  5J18 A;  3JSV B;  3A1Q B;  1RRB A;  3V60 A;  2O2V B;  4M0W B;  2LVO A;  2A5U A;  4CO7 A;  2K39 A;  3AUL A;  3KYC D;  4LJO B;  3EEC A;  4GGQ A;  2KDI A;  1WGR A;  2MX2 A;  4LJP B;  2J0M A;  3A9K A;  5AEK B;  4TUU A;  2K6Q A;  1UBQ A;  4URK A;  1H4R A;  5D94 A;  3ZKJ C;  2MP2 A;  5E6N A;  4HCN B;  3KUZ A;  4GSW A;  3PTF C;  3AU5 A;  2XEW A;  2LWP A;  3QIJ A;  5JZE B;  2D3G A;  3DBS A;  2A4Z A;  4IW0 A;  2GMI C;  2M4N A;  2NPT A;  2WX0 A;  3A9J A;  4FJY A;  2AWT A;  2FCM A;  2RPQ A;  1TGZ B;  2KFJ A;  3L17 A;  2R2O A;  3ZNI D;  3MJW A;  1SGH A;  4W9C A;  3PS6 A;  1SIF A;  2NBV B;  2ZNV C;  2J0K A;  4XZ4 A;  2MBQ A;  3OJ3 A;  3T8M A;  4JGH B;  2G45 B;  2NVU I;  2BYE A;  3U8Z A;  3NS8 A;  3DPD A;  2LXC A;  1V9J A;  5D6J B;  2KDF B;  4I6P A;  1TTN A;  2O6V D;  3K9O B;  1TBE A;  3DBL I;  2C9W B;  3VH3 B;  2LXA A;  4LDT D;  4DHZ B;  2EKE C;  4DHJ B;  4NNJ B;  4W9G A;  5JH5 C;  4NAW A;  2PPH A;  5D2M B;  3TCA A;  3PLU A;  4BOS C;  1Y8R C;  4DXA B;  5JHB A;  3HIZ A;  1V80 A;  1WR6 E;  3NZS A;  2ASQ A;  5HKH A;  4W9H A;  3KYD D;  3ZTD A;  3QAQ A;  2D10 A;  4HDO A;  4PS8 A;  3ZLZ A;  3A33 B;  1XT9 B;  2NCN A;  4A20 A;  2KTF A;  2RGF A;  3VUX A;  3ZIM A;  1V5T A;  1UGM A;  3DBR I;  1WZ3 A;  2LI5 A;  2N9X A;  4IM0 A;  2KAN A;  1E8W A;  1WJ4 A;  2KWV B;  4EUT A;  2MA9 B;  3RUL A;  4HVB A;  3UIP B;  3R66 C;  4ZRK A;  1EO6 A;  2CHW A;  5AZF A;  3H1U A;  4MDK E;  2DYB A;  2L0T A;  3WA0 A;  4BVU C;  2WWZ A;  3DVN V;  3Q3F A;  3ZNZ B;  3NZU A;  4F8C B;  4II3 B;  4EEW A;  3HM3 A;  4YL8 A;  3W1S A;  2AL3 A;  2BYV E;  2L05 A;  3IBE A;  3A9J B;  1KLV A;  2JY6 A;  3QX1 A;  4MGI E;  1C3T A;  1UEL A;  4M8N A;  2KWC A;  1GC7 A;  2Y5B B;  3H7P A;  2Z59 B;  4M8M A;  4GU2 A;  4GDL A;  5E6P A;  4PYU A;  2O2V A;  1GNU A;  2IO1 B;  3JVZ X;  4IG7 B;  4WJQ A;  4AJW A;  4OVV A;  2BF8 B;  3BIN A;  3D32 A;  3V61 A;  2BWE S;  1E8Y A;  2KN5 A;  2KQS A;  2LGX A;  1WM3 A;  4FBJ B;  3ZRF A;  4KVG B;  4CHK A;  4A3O A;  4BKS D;  2XK5 A;  2C7H A;  2KWU B;  3A4S C;  3HHM A;  3IG3 A;  2LRW A;  2K25 A;  3P2B A;  5DCN A;  3UGB B;  2KMC A;  2REX A;  3PGE A;  1CMX B;  4KIK B;  4HXD A;  1C1Y B;  1P0R A;  5IAA C;  5J2R A;  2MBB B;  3O65 B;  1WGH A;  5CHW A;  2BWF A;  3GOE A;  4HCP B;  3APF A;  1LXD A;  1WGY A;  1V49 A;  2J0J A;  4DHJ D;  4AP4 C;  2UYZ B;  1VD2 A;  2IYD B;  4EKU A;  5D7G A;  1WMH B;  2FUH B;  4FA6 A;  1NDD A;  4G0N B;  2KMA A;  3RUI B;  2KC1 A;  3R3M A;  2I1J A;  2V1Y A;  1P3Q U;  4K1R B;  1G6J A;  1RFA A;  3PRP B;  4TQ1 A;  3WAM A;  1BT0 A;  4MGY E;  4NPN A;  1WM2 A;  1YD8 U;  4NQL B;  3GZN I;  3WAP A;  2KX0 A;  3PVL A;  1QZE A;  3OJ4 B;  4II2 B;  2ZNV B;  3R7Q A;  1R4M I;  1Z2M A;  4G50 A;  4KV2 A;  3VFK A;  3L13 A;  5G2N A;  4E74 A;  4E3C A;  2MBO A;  1E7U A;  1KJT A;  3UQB A;  2O6V B;  2I1K A;  4HK2 A;  5DPS A;  5DPR A;  2KDE B;  1S3S G;  1WYW B;  2JRH A;  4BKT A;  2KQ7 A;  2ZCB A;  3EC8 A;  1F9J A;  3L16 A;  4HPL B;  1R4N I;  3V6C B;  4F7Z A;  4GXB A;  2N7D A;  4HPM B;  2KFK B;  2LVQ A;  3I3T B;  3UIN B;  4MSM B;  3OLM D;  4PYZ A;  5LXI B;  2L00 B;  4ANU A;  1WIA A;  3ONS A;  4W9E A;  3VDZ A;  2PJH A;  4K7W A;  5CHF A;  3V6E B;  2Z0D B;  3CF6 E;  4ZYN A;  4WJN A;  3N32 A;  2DX5 B;  4KSL C;  2KTR A;  3DVN U;  1RLF A;  1WXV A;  3ECI A;  2N1W A;  3WAL A;  3BY4 B;  2AYO B;  2DEN B;  2FAZ A;  1Z5S B;  2LVP A;  2OOB B;  2JRI B;  2KNB A;  1IP9 A;  3CST A;  2MP2 B;  1V81 A;  2IZV B;  2FCQ A;  5G55 A;  2V3S A;  1EF1 A;  3EFU A;  3ZO5 B;  3W1Y A;  3VTV A;  3ZNG C;  2GBK A;  2NS5 A;  5L83 A;  1WX9 A;  1UD7 A;  2NPT B;  1WX8 A;  3APC A;  2DYO A;  4ANV A;  4A3P A;  1IYF A;  2FNJ B;  1NBF C;  2CKH B;  3ENE A;  4WWO A;  2BYF A;  1J19 A;  2HJ8 A;  1OGW A;  2M0X A;  4GDK B;  4NQK E;  3TBL D;  3U30 A;  5CX3 A;  3A4R A;  2N9E B;  4KIK A;  4K81 A;  3ZRC A;  4G11 A;  3IHP C;  2EMT A;  2MQJ A;  2EMS A;  3PT2 B;  1E5W A;  3VTU A;  3WAO A;  4ZRI A;  2M8S A;  3VXW A;  4IUM B;  4JLC A;  3R7R A;  2FID A;  2MBH A;  4AOF A;  5DPT A;  2XBB C;  3SHQ A;  1K8R B;  3PHW B;  1WXM A;  4GN1 A;  5TR5 A;  1SE9 A;  3RD2 A;  4FN2 A;  2WDT B;  2DHZ A;  3DCG A;  3UQA A;  1WMH A;  1IPG A;  4FUL A;  4PS3 A;  5AZH A;  1E7V A;  4WWP A;  4EZK A;  2IY0 B;  3ML9 A;  3PLV A;  2DAF A;  4JQW C;  4KDI C;  5J17 A;  3KW5 B;  3SD5 A;  4B95 A;  1WH3 A;  4WQO B;  1UZX B;  1WE6 A;  2YVC A;  2KX3 A;  1P9D U;  1WX7 A;  2MW5 A;  4EOY A;  2MCN B;  2UWQ A;  4TV3 A;  3WAN A;  4GMV A;  2LAS A;  3DBH I;  1J0G A;  1E8Z A;  4AUQ C;  3IFW B;  1WE7 A;  5EDS A;  3DDC B;  2N9P C;  3N3K B;  4MM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...