3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
b'THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
molecule tags Protein binding/dna binding protein
source organism Saccharomyces cerevisiae
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
3QQ8B 3AI5A 3H7SA 4PS8A 1V5TA 2N4FA 2FUHB 4FJYA 3ZNHB 4HPLB 4F7ZA 3KYCD 2V3SA 1IYFA 1Q1OA 4JGHB 4WWNA 5JHBA 2NPTB 4HPMB 4W9FA 2G3QB 4TQ0A 3S2AA 4NNJB 1R4MI 3N3KB 3PPAA 2BWFA 2LZ6A 4IWQA 4AWJA 3A33B 2CHWA 2KLGA 4PYZA 3K9PB 1WH3A 3RULA 4KZ0A 4OVUA 4F8CB 1T0YA 1WGYA 2NVUI 3PTFC 1VD2A 3A1QB 2FNJB 2LXAA 3KVFB 2ZPNA 1ISNA 2NS5A 3QCAA 1WX8A 4MGZE 3UIOB 5FR6A 3PS6A 2JUOA 1RAXA 4IG7B 3H7PA 4BOZB 4W9IA 1V80A 1UH6A 4BKTA 5JHAA 4GDKB 1VCBA 3H1UA 1IPGA 2KDIA 5GMVA 3ZNGC 2RSUA 2KD0A 4IM2A 3UQBA 3ONSA 3PRZA 4G50A 4G0NB 2MLBA 2M8SA 4K7SA 1WJUA 1YX6B 4ZRJA 3RT3B 2D07B 3EHVA 1E5WA 2RR9A 2GBKA 2LRWA 4FJVB 3U7DA 1WGHA 4AJYB 4MEMA 3HIZA 5KHOA 5AEKB 2RGFA 4TUUA 2KQSA 1K8RB 3D32A 5DPTA 3QAQA 4I6NB 2YVCA 3VVWB 1AARA 4TQ1A 2O2VA 3TCAA 4CO7A 1XT9B 2LASA 1YD8U 2XK5A 1XQQA 3B0AA 3VTWA 4DK5A 1X1MA 4GGQA 1C3TA 5E6OA 4DDGD 3MJWA 2N7EA 3BY4B 2BF8B 2N7DA 3WALA 3VXWA 3V61A 2FCMA 3IVFA 3WIMA 2IY0B 2KFKB 4GIVA 2KKCA 2MX2A 3ALBA 4GN1A 1WMHA 2MBOA 4EZKA 3BINA 3APCA 2D3GA 1YJ1A 1Q5WB 2OJRA 3X23A 2KTRA 2KWUB 1XD3B 2BPSA 1WRDB 2BKRB 1YX5B 4ZRKA 1E7UA 2KDFB 2CHZA 2KLCA 4MDKE 4MJSB 2KTRB 3R66C 2DZJA 2CHXA 2JXXA 2J0MA 3PSEB 1WMHB 2L0FA 2GBMA 4B95A 4CHKA 1EUVB 3QA8A 3VFKA 4EFOA 1WGGA 1WR1A 4NQKE 2O6VA 3EECA 1WZ3A 3VQIA 4EOYA 2KN5A 4FHJA 3UQAA 2K6QA 1H4RA 2ZNVC 2A4ZA 1KLVA 2KVRA 4GSWA 2LVPA 2DZIA 4DBGA 4ANUA 2WDTB 3RZFA 3TBLD 1P98A 2FIFA 4WJOA 1L7YA 3JYUA 1LQBA 3VUWA 3DVNU 4FULA 3VUYA 4BKGA 4K81A 1UELA 3ENEA 4ANVA 3L08A 4FHKA 1TZ1A 3VAWA 3ZLZA 5L83A 2KC1A 2D2QA 4FN2A 2KXJA 3WAOA 4GMVA 3V60A 3UINB 5LXHA 3DBSA 4KDIC 2N9PC 2UWQA 5D7GA 4AP4C 2O6VD 2AYOB 4KVGB 2HJ8A 3HK0A 4E71A 3DOWA 2K8CA 3WANA 2IO0B 2KWVB 1EF5A 3TMPB 5JH5C 2O2VB 1Q0WB 3AULA 3NY5A 2IO2B 4P7IA 2K8BA 3IFWB 2LWPA 2DENB 2MQJA 5L95C 3M62B 2L05A 1WE6A 4ZRIA 5LLIA 3W1SC 2FCNA 2DAFA 4NPNA 4GB9A 4ICUA 4HXDA 5DPRA 3QIJA 3PLVA 4WQOB 3ML8A 3C0RB 4WJNA 4JQWC 5IA7A 1WJNA 1WX9A 2ASQA 1GC6A 2D11A 3L16A 5D2MB 5CX3A 2BYEA 2C7MB 2V4LA 2G4DB 2JY6A 2NPTA 1NBFC 1GUAB 3GZNI 1I35A 3ZO5B 2JVCA 3TL5A 3OLMD 4W9LA 4FBJB 3MTNB 1FXTB 5IAAC 5CHWA 1E8ZA 4HCNB 4URKA 1E90A 1V2YA 1V86A 3VH3B 4TV3A 5EDSA 1YQBA 4F1SA 1OQYA 2PPHA 2DYOA 1NI2A 2MBQA 3HM6X 4KSLC 1PQSA 3SU8X 4HVBA 3ZVVA 1E8YA 2MBBB 2O6VB 4BOSC 4WJQA 4II3B 1IP9A 2DZMA 2ZCCA 3PHWB 4W9KA 4FLHA 4YL8A 4NQLB 3H6NA 3R7RA 2J7QB 1A5RA 5C23A 1J8CA 1GG3A 4I6LB 3UF8A 3JW0X 2OOBB 1WYWB 2XEWA 3ECIA 4GOCA 4XC2A 2BYVE 4IWOA 1OTRB 3L54A 3NZUA 4ICVA 4IM3A 4PYUA 1L2NA 1GNUA 2KJHB 2Y5BB 4A20A 4MSMB 2BYFA 3KUDB 2J0JA 2JT4B 2PE6B 3KYDD 3M95A 2KFKA 4HJKA 3L10B 1WFYA 2JZZA 2KK8A 2D10A 3M3JA 2MW5A 4E3CA 3ZRFA 3ML9A 1F9JA 4NAWB 2L00B 3CF6E 3VDZA 1UZXB 4ZYNA 4ANWA 2JPHA 2NBWB 4B9KA 3QX1A 2MP2B 1NDDA 2I1JA 3AXCA 4AOFA 3QWZB 3QK0A 3LDZE 4GU2A 4LJOB 4KZCA 1P0RA 3PREA 3HHMA 1R4NI 2DX5B 3VH4B 1TTNA 3V6EB 3PZDA 3CSTA 1WGRA 2JRIB 3LJ3A 4TKNA 2HD5B 3RCZA 4DHZE 1C1YB 4FADA 2KJRA 2B3AA 2FCSA 2FCQA 4NJ6A 3A9JB 1P3QU 2JWZA 1V9JA 2R2QA 3HM3A 2C9WB 1WZ0A 2M17A 2CU1A 5DPSA 2LUEA 4HWIB 2WX0A 2IZVB 4GDLB 3KUCB 3DVGX 2N9EB 4IW0A 2CR5A 4LCDE 1Z2MA 4MH0E 2DYBA 4WWOA 3QC8B 3H7PB 3ZRCA 3W1YA 2Z59B 4WAAA 4M8MA 4DXAB 1OGWA 3PV1A 2DAJA 3DVGY 2RPQA 5J18A 3PRPB 1EF1A 3DCGA 3OJ3A 4EZJA 3H9DA 1GC7A 3RUIB 3ZDMC 4BKSA 1ZKHA 1WXAA 2DZKA 2M0XA 2PE9A 3UIPB 2XBBC 1TGZB 1RFAA 3GOEA 1CMXB 2KMCA 5D6JB 2GBJA 2MP2A 4BBNF 2MRPA 2IY1B 1KJTA 2K8HA 1WI0A 2BKFA 1UBQA 3K9OB 1QZEA 4W9HA 1OEYJ 4HDOA 3TIXA 2DYMA 3NZSA 3Q3FA 2MSED 4FJZA 2NR2A 3KW5B 3JSVA 2R2OA 3APDA 2JZ3B 5J2RA 1WE7A 2LI5A 2PEAA 4RMAA 3N30A 3V62A 3RYTA 1E8XA 3WAPA 1H8CA 1WF9A 3DBRI 3QJZA 1WM3A 2LGYA 4N9F4 2GMIC 3A9KA 3X0WA 5CTRC 5BO4B 2L0TA 4EUTA 1J0GA 4K7UA 2YLMA 3OJ4B 2AWTA 4HDQA 4WJPA 4JL9A 1MG8A 2LD9A 1E7VA 2G45B 3DBLI 4MELA 3ZDTA 2KX0A 4FA6A 3L0WB 3ZTCA 3IHPC 2Z0DB 3PHXB 1EO6A 1ZW7A 4G3XB 4DHJD 3IBEA 2RD0A 5KHQA 5LXIB 3I3TB 2IO1B 3UGBB 2KFJA 2I1KA 2PJHA 4XZ4A 4E74A 2G4SA 3PT2B 2FIDA 2BGFA 2CKHB 3B1LX 4JIOU 3VHTC 2C7HA 2ZZPB 1WXVA 4KV2A 4DHZB 4EKUA 2IO3B 2IYDB 2MBHA 3CSFA 1J19A 2ZVOA 4I6PA 4K1RB 2K25A 2LGDA 2V1YA 2ZNVB 2GBRA 1E8WA 2KC2A 1BT0A 3KUZA 3P2BA 4IUMB 1SGHA 2Z0EB 2HE7A 3DPDA 3O65B 2AL3A 2ZPYA 4W9GA 2WWZA 3PRMB 1G6JA 4MJSA 1WR6E 3L17A 2WYQA 3DVNV 2NBVB 3A9KB 2LGXA 3ZNID 4A3OA 1WX7A 2LXCA 2MA9B 1RLFA 2KANA 2KZRA 3NS8A 4BBNC 4RM8A 4J6IA 3APFA 3VUXA 2KWCA 3NOBA 4DHJB 5CHVC 1KM7A 3SHQA 1UD7A 4CYEA 1Z5SB 2NCNA 3ZIMA 2KJ6A 3QARA 2XK5B 2L76A 3A9JA 5AZGA 2LRUA 3QHTA 2C7NB 3T8MA 2L8JA 2A5UA 3NHEB 1UBIA 4HK2A 4MSQB 1WXSA 3T9LA 4IM0A 3RD2A 4IWPA 1V49A 1WGDA 4PS3A 1S1QB 2VRRB 3DQVA 4II2B 1UGMA 5AZHA 1WIAA 1V6EA 2ZVNA 4DWFA 1KOTA 2ZJDA 2LJ5A 2EMSA 2KO3A 4HCPB 5HKHA 1U4AA 2KDBA 2IBIB 3EFUA 2LVQA 4MGKE 4MM3A 3JSVB 2REXA 4IC7B 5G2NA 3SD5A 4NAWA 3VTUA 1SE9A 1P1AA 3N32A 3CMMB 4G11A 1OEYA 5G55A 3KH0A 3PGEA 4GDLA 4W9DA 4K7WA 3WAMA 4KSKC 2K1FA 2KNBA 4EZLA 3W1SA 4BFRA 2BWES 1YIWA 5CHFA 1I42A 2CS4A 1Y8RC 2NBUA 4XX5A 2KHWB 4M0WB 1LXDA 5DPWA 2ZEQA 4LDTB 1S3SG 2N9XA 3A1QA 1RRBA 1V5OA 4M8NA 4PS7A 3AU5A 3WA0A 3DBHI 3RZWC 4KDLB 4NJ7A 2LVOA 2KTFA 2JF5A 3SDLC 2K6DB 2KX3A 4JLCA 4EEWA 4ASWC 4MGIE 5DCNA 3PVLA 5C1ZA 3ZTDA 1WY8A 2W9NA 2KDEB 2N1VA 2C60A 2GBNA 3VTVA 3MHSD 2EMTA 5E6NA 1WJ4A 4AJWA 2KMAA 3ZKJC 4OVVA 2DHZA 3EC8A 3A4SC 3B08A 2L7RA 3PLUA 1WM2A 2KOXA 3IG3A 4ANXA 3ZW3A 5J17A 4AUQC 2GOWA 2MBEA 4W9EA 1SIFA 3U8ZA 5JZEB 3R3MA 1V81A 2AL6A 3A4RA 2HTHA 4LJPB 3ZNZB 3Q3JA 1WJ6A 3OAWA 4KIKB 1HE8A 1P9DU 1ZGUB 2AEHA 2K39A 3R7QA 1D3ZA 1GJZA 2MCNB 2M4NA 4DDID 4BKSD 2QHOA 2M1MA 5TR5A 3JVZX 4RM9A 4BVUC 4W9CA 3AU4A 3DDCB 4WWPA 1LFDA 4LDTD 2KQ7A 5E6PA 2EKEC 1JRUA 2L3ZA 1TBEA 4X57B 4B6WA 2FAZA 3V6CB 3U30A 2C5LC 4A3PA 4MGYE 3TJPA 3ZUNA 1WXMA 4W9JA 1M94A 1LM8B 5D94A 3M63B 3L13A 2MWSB 4KIKA 5AZFA 4GXBA 4GDKA 4ZDVA 2ZCBA 4HLEA 2UYZB 2WX1A 4NY0A 2JRHA 2J0KA 2N1WA
chains in the Genus database with same CATH superfamily
3QQ8B 1HTOA 3AI5A 3H7SA 2N4FA 2V3SA 4JGHB 4TQ0A 3AE6B 4AWJA 3A33B 3C8YA 4F8CB 4OVUA 2NVUI 1VD2A 1ISNA 2NS5A 2PVOD 1WX8A 3MJ5A 5FR6A 3PS6A 4IG7B 4BOZB 2KWDA 1V80A 1UH6A 2KDIA 4MACA 3V3XA 4YTNB 4G50A 2WXPA 2MLBA 2M8SA 1WJUA 1K50A 3RT3B 1C79A 4OZAA 3EHVA 4ZHPA 4FJVB 2GBKA 2LRWA 3U7DA 1WGHA 2HTME 1FCLA 1N61A 1D5MC 5DPTA 3QAQA 4I6NB 3WCQA 2O2VA 1XT9B 3RMKC 1YD8U 1XQQA 3VTWA 4DK5A 4GGQA 4MH8A 3IVFA 2FBWB 2MX2A 3KWLA 2MBOA 1YJ1A 1GB1A 2KTRA 1XD3B 2PMVA 1T5XD 1WRDB 4LTUA 4MJSB 5IN7A 2KTRB 2QILA 3R66C 2CHXA 2JXXA 1IBXB 1L4DB 2K9XA 3VFKA 4DQOC 2CJOA 2SEBD 1C78A 1WR1A 4NQKE 3VQIA 1KLUD 2BBCA 4EOYA 2NTTA 1SXTA 3UQAA 2K6QA 2A4ZA 1XXGA 2VH2A 2WDTB 5BMHA 3TBLD 1L7YA 1LQBA 4OZCA 5AUIA 1UELA 4ANVA 1TZ1A 2W3SA 4GMVA 3V60A 3UINB 2JXTA 3NVZA 2Q5WD 2N9PC 5D7GA 1IUEA 4AP4C 2O6VD 3PZ7A 3DOWA 2K8CA 4RFBA 2KWVB 2RDHA 3TMPB 3DBLB 3DWGC 3TSSA 1SIJA 2CU3A 5MPOA 1I4QA 4ZRIA 1WE6A 1XCTL 1PYWD 1RYJA 2K22A 3QIJA 2ONQA 1WJNA 1WX9A 3L16A 2ASQA 2D11A 2G4DB 3IXSA 2NPTA 1I35A 1CK1A 2QIEB 3OLMD 1XF5L 2WDRB 4ZRPA 2IGGA 1KLGD 1FXTB 5CHWA 3L4PA 1UF0A 1E8ZA 1F52A 1V2YA 1V86A 2DYOA 2MBQA 1PQSA 2MBBB 1TY2A 2WHIA 4WJQA 4ZRQA 5HI1A 2K3UA 4FLHA 1V8CA 2J7QB 4P6VF 4AS1A 2D5GA 1AWDA 3HVZA 2OOBB 1T6BX 4GOCA 3TUOA 4IWOA 4ICVA 1L6UA 1L2NA 1WGKA 3P4QB 4MSMB 2BYFA 2J0JA 2PE6B 3KYDD 2KFKA 5AUKA 3L10B 2D10A 2LJIA 1HEZE 2BS4B 2L00B 4RGMA 1A70A 2MJDA 4K3BA 4KGTA 1XLOA 4ZYNA 1TIFA 2WXRA 1SJED 2MP2B 5LXHA 2Y5CA 4GU2A 2INNE 4LJOB 2JRIB 1C1YB 3I63C 3A9JB 5EE3A 2OJWA 5EE9A 2R2QA 3HM3A 1XLPA 2M17A 2KYWA 2WX0A 4GDLB 3DVGX 2N9EB 2CR5A 3KLSX 4YXDB 4M8MA 1OGWA 2ACZB 3Q3NC 3PV1A 3U52E 1ZOYB 3PRPB 1PGXA 1XCQL 1GC7A 1ZKHA 1YQ4B 4OHJA 3EA6A 3GOEA 1ENFA 1CMXB 1TKYA 1ZXHA 1T0QC 3Q69A 1ACCA 4YSZB 2BKFA 1UBQA 3AE7B 1GB4A 1FMAD 2DYMA 3Q3FA 4FJZA 3JSVA 3TEWA 2ZW0A 1N62A 1PUTA 3WAPA 4N9F4 1VJKA 1MFWA 1L5PA 4EUTA 4HDQA 4A9AA 2NMQA 4AQ7A 1I4HA 3ZDTA 4RGOS 3L0WB 3ZTCA 2LHEA 2EKIA 1ZW7A 1NYRA 2KFJA 4E74A 4OVZA 4JIOU 2KACA 4NAMA 4DHZB 3P4PB 3ZYYX 4I6PA 3RNFC 2LGDA 2ZNVB 2DBYA 2Z0EB 2WWZA 3TEYA 2WYQA 3ABVB 1I4GA 4A90A 2LGXA 3Q2AC 3ZNID 4A3OA 3IAS1 1WX7A 1RLFA 2KANA 4BBNC 4J6IA 1FIQA 3APFA 3DBHB 1TS2A 4C80A 3U2SC 1Z5SB 2KJ6A 5BMGA 2V9HA 4YT0B 2L8JA 2A5UA 3NHEB 4IM0A 4PS3A 3AE2B 4EE2A 5IKCM 4DWFA 4HCPB 3IT6B 1U4AA 2JU6X 4MGKE 4IC7B 1FNVA 3PGEA 4GDLA 4K7WA 3MP9A 1GOZA 2N9LA 2BWES 1YIWA 3I9V1 3Q3MC 5CHFA 2NBUA 1Y8RC 3ZXRA 2D3AA 4XX5A 4JX1C 4M0WB 5TSSA 5DPWA 3A1QA 1RRBA 4M8NA 3AU5A 4KDLB 2V3NA 2JF5A 3ETRA 4MGIE 1C9FA 3SFDB 5C1ZA 1WY8A 2QSDA 2LUMA 3MC9A 3AE9B 2KMAA 3EC8A 3A4SC 3B08A 1WM2A 1AN8A 3IG3A 5J17A 3R3MA 3RN9C 4LJPB 3ZNZB 1WXQA 3OAWA 3NS1A 4KIKB 1ZGUB 2MCNB 2M4NA 4BKSD 1VZ8A 3I57A 3ZQ4A 4USAA 3AU4A 1TBEA 4ZHOA 2GRIA 2FAZA 4A3PA 3TJPA 3MC0B 4W9JA 1PGAA 4KIKA 2ZCBA 1MVKA 2WX1A 4W9KA 3AMZA 4RGNA 2YEPB 1Q1OA 4WWNA 1ZPSA 2NPTB 4P1CC 4NNJB 2L32A 3AB5A 2W82A 5HFYA 2KLGA 3NZ3A 4KZ0A 1T0YA 3A1QB 1QOAA 1L0YB 3EUB2 3BWUD 2ZPNA 3QCAA 1E10A 4L2YA 2JWUA 3UIOB 4WH4A 1RAXA 3H7PA 4W9IA 4BKTA 1HZ6A 5JHAA 1IPGA 1P7EA 5GMVA 2MEKA 3UQBA 3ONSA 3KQ4A 3PRZA 3AE1B 4XWWA 2WQYB 3AE8B 4K7SA 3KWVA 2RR9A 3HIZA 2HDEA 1N63A 4TUUA 2KQSA 1JWUD 5T8IA 3VRAB 1NENB 3B0AA 1X1MA 3T3NA 2WXMA 3LB8C 2N7DA 3VXWA 2FCMA 3WIMA 1XLNA 3U4EG 4ARIA 2OJRA 1C77A 2V0GA 2BKRB 3BK2A 1Q10A 2KLCA 2WXFA 3TEZA 2L0FA 4CHKA 1EUVB 3QA8A 3EECA 2KDMA 1FNWA 2KN5A 1H4RA 3VRBB 2LVPA 4ANUA 1DOXA 3JYUA 3VUWA 3DVNU 1D5ZC 3VUYA 4BKGA 3ENEA 3ZJUA 3ZLZA 2KXJA 4HKZE 2UWQA 1V1PA 1I4RA 4KGRA 1STEA 3NUHB 4KVGB 1ZDVA 3WANA 2G9HD 3VR8B 4P7IA 5EE1A 3IFWB 2DENB 2MH7A 1YJIA 1HXYD 5JXVA 4ICUA 1MHHE 2EELA 3ML8A 4WJNA 4JQWC 2QMTA 1GC6A 1GUAB 3CIRB 4W9LA 4FBJB 4URKA 1E90A 3VH3B 1YQBA 4F1SA 2JX5A 1OQYA 2PPHA 1R7SA 4KSLC 4HVBA 2O6VB 3Q8FA 3PHWB 3DWMA 1DYQA 4NQLB 3H6NA 1GG3A 1TJEA 3UF8A 3HUIA 1JALA 1OTRB 3L54A 2BS2B 1IGCA 2Y5BB 4A20A 3RPFC 5C3JB 1LO5D 1VR9A 1D5XC 2BB5A 2QEJC 3M3JA 1F9JA 1TKGA 3GE3C 4NAWB 3CF6E 1UZXB 1SE2A 1F1HA 4C4VA 1RWSA 3AE3B 3QWZB 3LDZE 1P0RA 2DX5B 3VH4B 3V6EB 3CSTA 3LJ3A 1FM0D 2L52A 1C4PA 2B3AA 2MJEA 2FCSA 1IGDA 4NJ6A 2JWZA 3AE4B 4QAYA 3B2FA 1MPEA 1Z2MA 5G5GA 3QC8B 3BIID 4WWMA 3W1YA 2Z59B 4DXAB 1T0SC 1JROA 2RPQA 4EZJA 3RUIB 4A55A 2DZKA 1WXAA 2M0XA 3UIPB 3RNCC 4ACFA 3UI3A 2Y5PA 2X38A 1RFAA 3ZGZA 2KMCA 2MP2A 2MRPA 1YN5A 2IY1B 1DGJA 3R2TA 3K9OB 5IO9A 2JQRB 3AEGB 2D3BA 2PVGC 4KX6B 2R2OA 1F2RI 2DLBA 4RMAA 3RYTA 3QJZA 1WF9A 2GMIC 3GB1A 1ET9A 3A9KA 4JPSA 2L0TA 1MJDA 2G45B 2YEPF 4FA6A 2BYTA 2Z0DB 3PHXB 4XGAB 1EO6A 5KHQA 1VZ6A 3UGBB 1N6ZA 3BVZA 2GI9A 2FIDA 2C7HA 2IO3B 2IYDB 3CSFA 2V1YA 2KC2A 1E8WA 2W55A 4IUMB 3DPDA 2HE7A 2AL3A 2ZPYA 1FRRA 2WLBA 2WXOA 1G6JA 4MJSA 1RM6C 1WR6E 3L17A 3DVNV 5GXGB 2MA9B 2KZRA 1MG4A 3NS8A 1T0RC 3DHGC 1FXAA 3NOBA 4DHJB 2INPE 4J3OD 1KM7A 2NCNA 3ZIMA 1K52A 2DNFA 3A9JA 3LYYA 4RNAA 1FPYA 5IP4D 4HK2A 4MSQB 3T9LA 1VRAB 1D6EC 1S1QB 1SE4A 3DQVA 4II2B 2ZVNA 1OQRA 2KO3A 1Y56A 5HKHA 2IBIB 3JSVB 4NAWA 1SSNA 4RGTA 1P1AA 3N32A 1I7HA 3CMMB 5G55A 2V3PA 2KNBA 4EZLA 4YTPB 3W1SA 4BFRA 2L1AA 2ICIA 3RNBC 4B0MA 2CS4A 4YWGG 1IBXA 2ZEQA 3WA0A 3U7ZA 4FXCA 3AEBB 1ZDXA 2WU2B 4N6EB 1YOVB 3IAM1 2W9NA 2N1VA 1JRPA 2GBNA 3MHSD 5E6NA 4AJWA 3ZKJC 3E56A 4P16A 5D3DA 4ANXA 3ZW3A 4W9EA 5JZEB 2AL6A 3A4RA 3Q3JA 2VZKB 1P9DU 3FKYA 2K39A 1JMLA 3R7QA 2WXNA 2W3RA 4BVUC 1SE3A 1NYQA 4WWPA 4LDTD 1JRUA 1SEBD 4LNNA 4X57B 4B6WA 3V6CB 4IKGA 3ZUNA 5C2TB 1BUIC 1WXMA 1XLQA 1T3QA 4HLEA 2JRHA 2N1WA 4PS8A 1V5TA 3ZNHB 4F7ZA 3P1MA 1IYFA 5JHBA 4HPMB 4W9FA 3SEBA 2G3QB 1K51A 3S2AA 1FFVA 1R4MI 3PPAA 4C00A 3K9PB 1WH3A 1WGYA 2LXAA 3KVFB 4B0EA 4A8XC 4RF1A 1ZP0B 3B2GA 2AQ2B 1VCBA 3ZNGC 2RSUA 1QQRA 1B9RA 1PFDA 2MJ3A 2WU5B 2ON8A 4M02A 4ZRJA 1YX6B 2D07B 4XYCA 4AJYB 4PK1A 5KHOA 1EWCA 5AEKB 2RGFA 4KKIA 3BK1A 2MHJA 3D32A 4JWSC 1AW7A 4C4VB 1AARA 2N7JA 4TQ1A 3TCAA 4CO7A 2WGSA 1YNTE 1C3TA 3GP7A 1WYGA 2BF8B 3WALA 4RCOA 4DXGA 3V61A 1XEEA 4GIVA 3ALBA 4GN1A 1WMHA 3BINA 3PZ8A 2BVCA 2V4IB 1Q5WB 3X23A 2WXJA 2KWUB 2NTSA 2BPSA 1TS3A 4O1NA 1FO4A 1E7UA 4XDDA 2KDFB 2CHZA 4MDKE 2I2YA 2DZJA 1HA5A 4IDIA 4B95A 5FK9C 2PTLA 2AX5A 2H88B 2J4XA 2O6VA 2GB1A 2IGDA 4S0RA 4REZA 1L0VB 1C4AA 2KVRA 2DZIA 4DBGA 3EFCA 1P98A 4WJOA 2LFIA 4US8A 3MHZA 5IOIA 4K81A 4FHKA 5L83A 3RI7C 4ARCA 4FN2A 4N58A 3WAOA 4MT5A 4US9A 2LMCA 1TS4A 2HJ8A 1J7CA 2KMMA 3HK0A 3J9CA 1EF5A 2O2VB 3NY5A 2K8BA 5BYSA 2LWPA 2MQJA 3M62B 2L05A 3P4SB 5LLIA 3W1SC 2L83A 4HJGE 2FCNA 4NPNA 4GB9A 1F2RC 3PLVA 4WQOB 3C0RB 1DOIA 5IA7A 1VDVA 2JYTA 3BZDB 3GZNI 1NBFC 3TL5A 3NVVA 2JZPA 3AM9A 5IAAC 3AEEB 1FD6A 5LNK1 5EDSA 1C76A 3ZVVA 1E8YA 3NRZA 4KKJA 3ZXVA 2WDQB 2DZMA 2PIAA 2FE8A 2QDFA 4YL8A 1AYFA 1A5RA 5C23A 1J8CA 3Q8CA 3JW0X 2M56B 3BVGA 1WYWB 2Y3AA 3O13A 2XEWA 3ECIA 1FRDA 2BYVE 4PYUA 4IM3A 4JE3B 1CJEA 2PLPA 5G5HA 5FKAC 4C7ZA 2JYEA 4HJKA 1WFYA 2JZZA 2MW5A 4E3CA 1P7FA 3ZRFA 4YTMB 1GAQB 3GZNB 4ANWA 1SF0A 4D2KA 3C19A 1TT5B 1NDDA 2I1JA 3HHMA 2J42A 1TTNA 3PZDA 2AQ1B 4FADA 1FCCC 1P3QU 1TZOA 4S17A 1V9JA 1TS5A 2C9WB 4LLGM 2CU1A 2LUEA 1TKEA 2K0PA 4MH0E 3N1YC 1EM7A 4WAAA 5H8YE 2DAJA 3DVGY 5J18A 1KH0A 3H9DA 3ZDMC 4BKSA 2XBBC 1TGZB 4BAXA 1DOYA 1J7BA 5D6JB 2GBJA 4BBNF 1KJTA 2K8HA 1WI0A 3FILB 2BB6A 4W9HA 2G1EA 1OEYJ 3NZSA 2MSED 4HPPA 3BYYB 2WXGA 3KW5B 4XE0A 3APDA 2WP9B 2JZ3B 1J7AA 2PEAA 1QF6A 1C4CA 1E8XA 1EU3A 2IGHA 1E0ZA 1H8CA 2LGYA 1EU4A 4K7UA 2INDC 3OJ4B 4JL9A 1MG8A 2LD9A 1E7VA 4MELA 3Q8EA 2WXHA 4PT5A 4WURA 3IHPC 5D3IB 4G3XB 1HTQA 2RD0A 5LXIB 3I3TB 1FXIA 2IO1B 2PJHA 3PT2B 1EWYC 3AEDB 2BGFA 3B1LX 3VHTC 2WXLA 4RF0A 2ZVOA 3VR9B 4K1RB 2K25A 3MFGA 2LGSA 1BT0A 3O65B 2B76B 4LNKA 3W2DA 2M19A 4HROA 1OFFA 4RM8A 1D4BA 2RPVA 4TMAB 2UU7A 5CHVC 4GLSC 3SHQA 1R4NB 3R8BA 3FILA 2W54A 2XK5B 2KQ4X 2L76A 2LRUA 4CQNA 3T8MA 2BW2A 3BYTB 1WXSA 2J53A 2WXKA 3N1ZC 1MI0A 1V49A 5HG2A 1FEHA 1UGMA 1WIAA 4R3DA 2ZJDA 1JQ4A 2KDBA 3ZJTA 1B1ZA 2LVQA 3SD5A 1SE9A 2TSSA 3AEFB 4KSKC 2K1FA 2AQ3B 1KRHA 3V05A 1LXDA 1SB3C 1HZ5A 1S3SG 1D3ZA 2R61A 4PS7A 3DBHI 3RZWC 2LVOA 2N9KA 2KTFA 3SDLC 2K6DB 2KX3A 4JLCA 5DCNA 3PVLA 2WS3B 2KDEB 4HEA1 2WDVB 3FAHA 4UDUC 4AUQC 2GOWA 1SIFA 2HTHA 2N0SB 1WJ6A 2QCZA 1HE8A 4LNFA 4DDID 2VZKD 2QHOA 2M1MA 5TR5A 1F0ZA 4RM9A 3DDCB 3P42A 1JWMD 2KQ7A 5E6PA 2L3ZA 3U30A 4L1BA 4MGYE 1JW9D 2I38A 1M94A 1LM8B 2SAKA 3M63B 3L13A 2MWSB 2PKOA 1YQ3B 3RNAC 4GDKA 4ZDVA 2UYZB 4NY0A 3OG5A 1K53A 3SFEB 3TEXA 2RDBC 1UWMA 1N5WA 4FJYA 2FUHB 4HPLB 3KYCD 3N9YC 3AEAB 2M0AA 3N3KB 3MC8A 2BWFA 5I4DA 2LZ6A 4IWQA 4LNIA 2CHWA 4PYZA 3RULA 3PTFC 2FNJB 3RFZB 4JWUC 4MGZE 1KF6B 2JUOA 4GDKB 1TYGB 3H1UA 2KD0A 4IM2A 4G0NB 4MM3B 2D3CA 1E5WA 2K5PA 3BVMA 3P63A 3DHIC 4TSSA 4MEMA 2LHDA 1K8RB 1I4XA 2YVCA 1OQQA 3VVWB 3AECB 4OZBA 2LASA 4KGSA 2XK5A 5E6OA 4DDGD 3MJWA 2N7EA 3BY4B 1ESFA 1R4MB 1JWSD 1VLBA 3PO0A 2IY0B 2KFKB 1YMHE 1UWXA 2KKCA 4EZKA 3APCA 1UGJA 2D3GA 5BYRA 2HJ1A 1YX5B 4ZRKA 1UUPA 2RMMA 2J0MA 3PSEB 1WMHB 2GBMA 1E9MA 4EFOA 1WGGA 3SR6A 4XDCA 1WZ3A 4FHJA 1QOBA 1BXTA 2BQQA 1KLVA 2ZNVC 1FNUA 4GSWA 3RZFA 2IPKD 3Q3OC 1CZPA 2FIFA 1F77A 4FULA 3AV8A 3L08A 4LNOA 3VAWA 4ZYSA 3NJTA 4NJCA 2KC1A 2D2QA 3RNEC 1ZE3D 3DBSA 4KDIC 3FC4A 2AYOB 4E71A 1QILA 3W5VB 2IO0B 3H8HA 2BT6A 5JH5C 1Q0WB 3AULA 2IO2B 3OWEB 1LGRA 5L95C 4WIPA 1MHXA 3RNGC 1YJJA 1E7PB 2DAFA 4HXDA 5DPRA 1WSPA 3AH7A 3W5UB 4ZOHC 2X8XX 5D2MB 3GE8C 2BYEA 2C7MB 2V4LA 5CX3A 2JY6A 3ZO5B 2JVCA 3AE5B 3DBRB 2J52A 3MTNB 1YN3A 1QOFA 4HCNB 4TV3A 4M01A 1XO3A 1QOGA 1NI2A 3HM6X 1VZ7A 3SU8X 1RFKA 2E3TA 2KVZA 4BOSC 1QT9A 4II3B 1IP9A 1CQVA 2ZCCA 3DHHC 3R7RA 4BZAA 4I6LB 3I5JC 2BS3B 1YN4A 4XC2A 2ZW1A 3NZUA 2PW9A 1I4PA 4YSXB 1GNUA 2KJHB 2E6XA 3KUDB 2Z8LA 1L6VA 2JT4B 3M95A 2IJ0A 2KK8A 4NZLB 2QC8A 3ML9A 2KN4A 1ET6A 1ZXIA 3VDZA 2JPHA 1NI3A 4ITKA 5BMIA 2NBWB 4K3CA 4B9KA 3QX1A 2LEKA 3AXCA 4AOFA 3QK0A 4KZCA 4C56C 3PREA 1R4NI 4IOIE 3HRDD 1HQRD 3RCZA 1WGRA 1JWBD 4TKNA 2HD5B 4DHZE 3CWIA 2KJRA 4HRSA 2FCQA 5EE0A 5FR3A 1KFYB 1L4ZB 1V1OA 4A6QA 1WZ0A 5DPSA 2WNMA 4HWIB 2IZVB 5BYQA 3KUCB 3EGRA 2IDYA 4IW0A 3R2IA 4H2AA 4LCDE 2DYBA 4WWOA 3H7PB 3ZRCA 3P4RB 1EF1A 3DCGA 1M4VA 3NVYA 3OJ3A 2PE9A 2OEDA 1UNSA 3NG0A 4XWTA 2GLSA 2DWQA 1QZEA 1WRIA 4HDOA 3TIXA 2NR2A 2QJLA 4N59A 5J2RA 3HVDA 1WE7A 2LI5A 1WWTA 3N30A 3V62A 2XNAC 3N20C 1JWAD 1TY0A 3DBRI 1WM3A 1QKZA 3X0WA 3IT4B 5CTRC 5BO4B 1J0GA 2YLMA 2AWTA 4WJPA 5E6JA 1SJHD 5HHDG 3N1XC 3DBLI 2KX0A 2OHFA 4DHJD 3IBEA 1E6EB 1NVID 2I1KA 4XZ4A 2G4SA 3T3OA 4YSYB 2CKHB 2ZZPB 1WXVA 4KV2A 4EKUA 2JSVX 1V1PB 2MBHA 1J19A 1N5XA 4Q2JA 3KUZA 2GBRA 3E9SA 3P2BA 1SGHA 2INCC 4W9GA 3PRMB 1PGBA 1NEKB 1KTKA 2NBVB 1FFUA 3A9KB 2LXCA 4HKQA 2XN9C 1GPXA 4RH6A 1PDXA 3VUXA 2KWCA 1BMLC 1UD7A 4CYEA 3QARA 1L0XB 1ROEA 5AZGA 4C7YA 3GS2A 3QHTA 2C7NB 1UBIA 3RD2A 4IWPA 1WGDA 3LXFA 4M00A 2VRRB 3ZJVA 2WXIA 3URYA 5AZHA 1V6EA 1KOTA 2LJ5A 2EMSA 2KAJA 4LK0M 3EFUA 2H89B 4MM3A 2REXA 5G2NA 3VTUA 2WXQA 4G11A 1OEYA 3KH0A 4W9DA 3WAMA 4P1BC 1I42A 2KT7A 2KHWB 4WAFA 4LDTB 2N9XA 1V5OA 4NJ7A 1SBBB 4M0WA 4EEWA 4ASWC 4WQMA 2CJNA 1V97A 3ZTDA 3NVWA 3Q6BA 2C60A 3VTVA 2EMTA 2VH1A 1WJ4A 1JCKB 4OVVA 1ZUD2 2DHZA 4DXFA 2L7RA 3PLUA 2KOXA 3B9JA 3U8ZA 2MBEA 5H92C 3Q14C 1V81A 3AN1A 3Q8AA 2AEHA 1GJZA 3Q8BA 3JVZX 4W9CA 1LFDA 2EKEC 2FUG1 2BTEA 2C5LC 2LGIA 1N60A 3W9CB 4OW0A 4L23A 1QLBB 2RDGA 5D94A 5AZFA 4GXBA 2J0KA
chains in the Genus database with same CATH topology
3QQ8B 3AI5A 3H7SA 4PS8A 1V5TA 2N4FA 2FUHB 4FJYA 3ZNHB 4HPLB 4F7ZA 3KYCD 2V3SA 1IYFA 1Q1OA 4JGHB 4WWNA 5JHBA 2NPTB 4HPMB 4W9FA 2G3QB 4TQ0A 3S2AA 4NNJB 1R4MI 3N3KB 3PPAA 2BWFA 2LZ6A 4IWQA 4AWJA 3A33B 2CHWA 2KLGA 4PYZA 3K9PB 1WH3A 3RULA 4KZ0A 4OVUA 4F8CB 1T0YA 1WGYA 2NVUI 3PTFC 1VD2A 3A1QB 2FNJB 2LXAA 3KVFB 2ZPNA 1ISNA 2NS5A 3QCAA 1WX8A 4MGZE 3UIOB 5FR6A 3PS6A 2JUOA 1RAXA 4IG7B 3H7PA 4BOZB 4W9IA 1V80A 1UH6A 4BKTA 5JHAA 4GDKB 1VCBA 3H1UA 1IPGA 2KDIA 5GMVA 3ZNGC 2RSUA 2KD0A 4IM2A 3UQBA 3ONSA 3PRZA 4G50A 4G0NB 2MLBA 2M8SA 4K7SA 1WJUA 1YX6B 4ZRJA 3RT3B 2D07B 3EHVA 1E5WA 2RR9A 2GBKA 2LRWA 4FJVB 3U7DA 1WGHA 4AJYB 4MEMA 3HIZA 5KHOA 5AEKB 2RGFA 4TUUA 2KQSA 1K8RB 3D32A 5DPTA 3QAQA 4I6NB 2YVCA 3VVWB 1AARA 4TQ1A 2O2VA 3TCAA 4CO7A 1XT9B 2LASA 1YD8U 2XK5A 1XQQA 3B0AA 3VTWA 4DK5A 1X1MA 4GGQA 1C3TA 5E6OA 4DDGD 3MJWA 2N7EA 3BY4B 2BF8B 2N7DA 3WALA 3VXWA 3V61A 2FCMA 3IVFA 3WIMA 2IY0B 2KFKB 4GIVA 2KKCA 2MX2A 3ALBA 4GN1A 1WMHA 2MBOA 4EZKA 3BINA 3APCA 2D3GA 1YJ1A 1Q5WB 2OJRA 3X23A 2KTRA 2KWUB 1XD3B 2BPSA 1WRDB 2BKRB 1YX5B 4ZRKA 1E7UA 2KDFB 2CHZA 2KLCA 4MDKE 4MJSB 2KTRB 3R66C 2DZJA 2CHXA 2JXXA 2J0MA 3PSEB 1WMHB 2L0FA 2GBMA 4B95A 4CHKA 1EUVB 3QA8A 3VFKA 4EFOA 1WGGA 1WR1A 4NQKE 2O6VA 3EECA 1WZ3A 3VQIA 4EOYA 2KN5A 4FHJA 3UQAA 2K6QA 1H4RA 2ZNVC 2A4ZA 1KLVA 2KVRA 4GSWA 2LVPA 2DZIA 4DBGA 4ANUA 2WDTB 3RZFA 3TBLD 1P98A 2FIFA 4WJOA 1L7YA 3JYUA 1LQBA 3VUWA 3DVNU 4FULA 3VUYA 4BKGA 4K81A 1UELA 3ENEA 4ANVA 3L08A 4FHKA 1TZ1A 3VAWA 3ZLZA 5L83A 2KC1A 2D2QA 4FN2A 2KXJA 3WAOA 4GMVA 3V60A 3UINB 5LXHA 3DBSA 4KDIC 2N9PC 2UWQA 5D7GA 4AP4C 2O6VD 2AYOB 4KVGB 2HJ8A 3HK0A 4E71A 3DOWA 2K8CA 3WANA 2IO0B 2KWVB 1EF5A 3TMPB 5JH5C 2O2VB 1Q0WB 3AULA 3NY5A 2IO2B 4P7IA 2K8BA 3IFWB 2LWPA 2DENB 2MQJA 5L95C 3M62B 2L05A 1WE6A 4ZRIA 5LLIA 3W1SC 2FCNA 2DAFA 4NPNA 4GB9A 4ICUA 4HXDA 5DPRA 3QIJA 3PLVA 4WQOB 3ML8A 3C0RB 4WJNA 4JQWC 5IA7A 1WJNA 1WX9A 2ASQA 1GC6A 2D11A 3L16A 5D2MB 5CX3A 2BYEA 2C7MB 2V4LA 2G4DB 2JY6A 2NPTA 1NBFC 1GUAB 3GZNI 1I35A 3ZO5B 2JVCA 3TL5A 3OLMD 4W9LA 4FBJB 3MTNB 1FXTB 5IAAC 5CHWA 1E8ZA 4HCNB 4URKA 1E90A 1V2YA 1V86A 3VH3B 4TV3A 5EDSA 1YQBA 4F1SA 1OQYA 2PPHA 2DYOA 1NI2A 2MBQA 3HM6X 4KSLC 1PQSA 3SU8X 4HVBA 3ZVVA 1E8YA 2MBBB 2O6VB 4BOSC 4WJQA 4II3B 1IP9A 2DZMA 2ZCCA 3PHWB 4W9KA 4FLHA 4YL8A 4NQLB 3H6NA 3R7RA 2J7QB 1A5RA 5C23A 1J8CA 1GG3A 4I6LB 3UF8A 3JW0X 2OOBB 1WYWB 2XEWA 3ECIA 4GOCA 4XC2A 2BYVE 4IWOA 1OTRB 3L54A 3NZUA 4ICVA 4IM3A 4PYUA 1L2NA 1GNUA 2KJHB 2Y5BB 4A20A 4MSMB 2BYFA 3KUDB 2J0JA 2JT4B 2PE6B 3KYDD 3M95A 2KFKA 4HJKA 3L10B 1WFYA 2JZZA 2KK8A 2D10A 3M3JA 2MW5A 4E3CA 3ZRFA 3ML9A 1F9JA 4NAWB 2L00B 3CF6E 3VDZA 1UZXB 4ZYNA 4ANWA 2JPHA 2NBWB 4B9KA 3QX1A 2MP2B 1NDDA 2I1JA 3AXCA 4AOFA 3QWZB 3QK0A 3LDZE 4GU2A 4LJOB 4KZCA 1P0RA 3PREA 3HHMA 1R4NI 2DX5B 3VH4B 1TTNA 3V6EB 3PZDA 3CSTA 1WGRA 2JRIB 3LJ3A 4TKNA 2HD5B 3RCZA 4DHZE 1C1YB 4FADA 2KJRA 2B3AA 2FCSA 2FCQA 4NJ6A 3A9JB 1P3QU 2JWZA 1V9JA 2R2QA 3HM3A 2C9WB 1WZ0A 2M17A 2CU1A 5DPSA 2LUEA 4HWIB 2WX0A 2IZVB 4GDLB 3KUCB 3DVGX 2N9EB 4IW0A 2CR5A 4LCDE 1Z2MA 4MH0E 2DYBA 4WWOA 3QC8B 3H7PB 3ZRCA 3W1YA 2Z59B 4WAAA 4M8MA 4DXAB 1OGWA 3PV1A 2DAJA 3DVGY 2RPQA 5J18A 3PRPB 1EF1A 3DCGA 3OJ3A 4EZJA 3H9DA 1GC7A 3RUIB 3ZDMC 4BKSA 1ZKHA 1WXAA 2DZKA 2M0XA 2PE9A 3UIPB 2XBBC 1TGZB 1RFAA 3GOEA 1CMXB 2KMCA 5D6JB 2GBJA 2MP2A 4BBNF 2MRPA 2IY1B 1KJTA 2K8HA 1WI0A 2BKFA 1UBQA 3K9OB 1QZEA 4W9HA 1OEYJ 4HDOA 3TIXA 2DYMA 3NZSA 3Q3FA 2MSED 4FJZA 2NR2A 3KW5B 3JSVA 2R2OA 3APDA 2JZ3B 5J2RA 1WE7A 2LI5A 2PEAA 4RMAA 3N30A 3V62A 3RYTA 1E8XA 3WAPA 1H8CA 1WF9A 3DBRI 3QJZA 1WM3A 2LGYA 4N9F4 2GMIC 3A9KA 3X0WA 5CTRC 5BO4B 2L0TA 4EUTA 1J0GA 4K7UA 2YLMA 3OJ4B 2AWTA 4HDQA 4WJPA 4JL9A 1MG8A 2LD9A 1E7VA 2G45B 3DBLI 4MELA 3ZDTA 2KX0A 4FA6A 3L0WB 3ZTCA 3IHPC 2Z0DB 3PHXB 1EO6A 1ZW7A 4G3XB 4DHJD 3IBEA 2RD0A 5KHQA 5LXIB 3I3TB 2IO1B 3UGBB 2KFJA 2I1KA 2PJHA 4XZ4A 4E74A 2G4SA 3PT2B 2FIDA 2BGFA 2CKHB 3B1LX 4JIOU 3VHTC 2C7HA 2ZZPB 1WXVA 4KV2A 4DHZB 4EKUA 2IO3B 2IYDB 2MBHA 3CSFA 1J19A 2ZVOA 4I6PA 4K1RB 2K25A 2LGDA 2V1YA 2ZNVB 2GBRA 1E8WA 2KC2A 1BT0A 3KUZA 3P2BA 4IUMB 1SGHA 2Z0EB 2HE7A 3DPDA 3O65B 2AL3A 2ZPYA 4W9GA 2WWZA 3PRMB 1G6JA 4MJSA 1WR6E 3L17A 2WYQA 3DVNV 2NBVB 3A9KB 2LGXA 3ZNID 4A3OA 1WX7A 2LXCA 2MA9B 1RLFA 2KANA 2KZRA 3NS8A 4BBNC 4RM8A 4J6IA 3APFA 3VUXA 2KWCA 3NOBA 4DHJB 5CHVC 1KM7A 3SHQA 1UD7A 4CYEA 1Z5SB 2NCNA 3ZIMA 2KJ6A 3QARA 2XK5B 2L76A 3A9JA 5AZGA 2LRUA 3QHTA 2C7NB 3T8MA 2L8JA 2A5UA 3NHEB 1UBIA 4HK2A 4MSQB 1WXSA 3T9LA 4IM0A 3RD2A 4IWPA 1V49A 1WGDA 4PS3A 1S1QB 2VRRB 3DQVA 4II2B 1UGMA 5AZHA 1WIAA 1V6EA 2ZVNA 4DWFA 1KOTA 2ZJDA 2LJ5A 2EMSA 2KO3A 4HCPB 5HKHA 1U4AA 2KDBA 2IBIB 3EFUA 2LVQA 4MGKE 4MM3A 3JSVB 2REXA 4IC7B 5G2NA 3SD5A 4NAWA 3VTUA 1SE9A 1P1AA 3N32A 3CMMB 4G11A 1OEYA 5G55A 3KH0A 3PGEA 4GDLA 4W9DA 4K7WA 3WAMA 4KSKC 2K1FA 2KNBA 4EZLA 3W1SA 4BFRA 2BWES 1YIWA 5CHFA 1I42A 2CS4A 1Y8RC 2NBUA 4XX5A 2KHWB 4M0WB 1LXDA 5DPWA 2ZEQA 4LDTB 1S3SG 2N9XA 3A1QA 1RRBA 1V5OA 4M8NA 4PS7A 3AU5A 3WA0A 3DBHI 3RZWC 4KDLB 4NJ7A 2LVOA 2KTFA 2JF5A 3SDLC 2K6DB 2KX3A 4JLCA 4EEWA 4ASWC 4MGIE 5DCNA 3PVLA 5C1ZA 3ZTDA 1WY8A 2W9NA 2KDEB 2N1VA 2C60A 2GBNA 3VTVA 3MHSD 2EMTA 5E6NA 1WJ4A 4AJWA 2KMAA 3ZKJC 4OVVA 2DHZA 3EC8A 3A4SC 3B08A 2L7RA 3PLUA 1WM2A 2KOXA 3IG3A 4ANXA 3ZW3A 5J17A 4AUQC 2GOWA 2MBEA 4W9EA 1SIFA 3U8ZA 5JZEB 3R3MA 1V81A 2AL6A 3A4RA 2HTHA 4LJPB 3ZNZB 3Q3JA 1WJ6A 3OAWA 4KIKB 1HE8A 1P9DU 1ZGUB 2AEHA 2K39A 3R7QA 1D3ZA 1GJZA 2MCNB 2M4NA 4DDID 4BKSD 2QHOA 2M1MA 5TR5A 3JVZX 4RM9A 4BVUC 4W9CA 3AU4A 3DDCB 4WWPA 1LFDA 4LDTD 2KQ7A 5E6PA 2EKEC 1JRUA 2L3ZA 1TBEA 4X57B 4B6WA 2FAZA 3V6CB 3U30A 2C5LC 4A3PA 4MGYE 3TJPA 3ZUNA 1WXMA 4W9JA 1M94A 1LM8B 5D94A 3M63B 3L13A 2MWSB 4KIKA 5AZFA 4GXBA 4GDKA 4ZDVA 2ZCBA 4HLEA 2UYZB 2WX1A 4NY0A 2JRHA 2J0KA 2N1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  3AI5 A;  3H7S A;  4PS8 A;  1V5T A;  2N4F A;  2FUH B;  4FJY A;  3ZNH B;  4HPL B;  4F7Z A;  3KYC D;  2V3S A;  1IYF A;  1Q1O A;  4JGH B;  4WWN A;  5JHB A;  2NPT B;  4HPM B;  4W9F A;  2G3Q B;  4TQ0 A;  3S2A A;  4NNJ B;  1R4M I;  3N3K B;  3PPA A;  2BWF A;  2LZ6 A;  4IWQ A;  4AWJ A;  3A33 B;  2CHW A;  2KLG A;  4PYZ A;  3K9P B;  1WH3 A;  3RUL A;  4KZ0 A;  4OVU A;  4F8C B;  1T0Y A;  1WGY A;  2NVU I;  3PTF C;  1VD2 A;  3A1Q B;  2FNJ B;  2LXA A;  3KVF B;  2ZPN A;  1ISN A;  2NS5 A;  3QCA A;  1WX8 A;  4MGZ E;  3UIO B;  5FR6 A;  3PS6 A;  2JUO A;  1RAX A;  4IG7 B;  3H7P A;  4BOZ B;  4W9I A;  1V80 A;  1UH6 A;  4BKT A;  5JHA A;  4GDK B;  1VCB A;  3H1U A;  1IPG A;  2KDI A;  5GMV A;  3ZNG C;  2RSU A;  2KD0 A;  4IM2 A;  3UQB A;  3ONS A;  3PRZ A;  4G50 A;  4G0N B;  2MLB A;  2M8S A;  4K7S A;  1WJU A;  1YX6 B;  4ZRJ A;  3RT3 B;  2D07 B;  3EHV A;  1E5W A;  2RR9 A;  2GBK A;  2LRW A;  4FJV B;  3U7D A;  1WGH A;  4AJY B;  4MEM A;  3HIZ A;  5KHO A;  5AEK B;  2RGF A;  4TUU A;  2KQS A;  1K8R B;  3D32 A;  5DPT A;  3QAQ A;  4I6N B;  2YVC A;  3VVW B;  1AAR A;  4TQ1 A;  2O2V A;  3TCA A;  4CO7 A;  1XT9 B;  2LAS A;  1YD8 U;  2XK5 A;  1XQQ A;  3B0A A;  3VTW A;  4DK5 A;  1X1M A;  4GGQ A;  1C3T A;  5E6O A;  4DDG D;  3MJW A;  2N7E A;  3BY4 B;  2BF8 B;  2N7D A;  3WAL A;  3VXW A;  3V61 A;  2FCM A;  3IVF A;  3WIM A;  2IY0 B;  2KFK B;  4GIV A;  2KKC A;  2MX2 A;  3ALB A;  4GN1 A;  1WMH A;  2MBO A;  4EZK A;  3BIN A;  3APC A;  2D3G A;  1YJ1 A;  1Q5W B;  2OJR A;  3X23 A;  2KTR A;  2KWU B;  1XD3 B;  2BPS A;  1WRD B;  2BKR B;  1YX5 B;  4ZRK A;  1E7U A;  2KDF B;  2CHZ A;  2KLC A;  4MDK E;  4MJS B;  2KTR B;  3R66 C;  2DZJ A;  2CHX A;  2JXX A;  2J0M A;  3PSE B;  1WMH B;  2L0F A;  2GBM A;  4B95 A;  4CHK A;  1EUV B;  3QA8 A;  3VFK A;  4EFO A;  1WGG A;  1WR1 A;  4NQK E;  2O6V A;  3EEC A;  1WZ3 A;  3VQI A;  4EOY A;  2KN5 A;  4FHJ A;  3UQA A;  2K6Q A;  1H4R A;  2ZNV C;  2A4Z A;  1KLV A;  2KVR A;  4GSW A;  2LVP A;  2DZI A;  4DBG A;  4ANU A;  2WDT B;  3RZF A;  3TBL D;  1P98 A;  2FIF A;  4WJO A;  1L7Y A;  3JYU A;  1LQB A;  3VUW A;  3DVN U;  4FUL A;  3VUY A;  4BKG A;  4K81 A;  1UEL A;  3ENE A;  4ANV A;  3L08 A;  4FHK A;  1TZ1 A;  3VAW A;  3ZLZ A;  5L83 A;  2KC1 A;  2D2Q A;  4FN2 A;  2KXJ A;  3WAO A;  4GMV A;  3V60 A;  3UIN B;  5LXH A;  3DBS A;  4KDI C;  2N9P C;  2UWQ A;  5D7G A;  4AP4 C;  2O6V D;  2AYO B;  4KVG B;  2HJ8 A;  3HK0 A;  4E71 A;  3DOW A;  2K8C A;  3WAN A;  2IO0 B;  2KWV B;  1EF5 A;  3TMP B;  5JH5 C;  2O2V B;  1Q0W B;  3AUL A;  3NY5 A;  2IO2 B;  4P7I A;  2K8B A;  3IFW B;  2LWP A;  2DEN B;  2MQJ A;  5L95 C;  3M62 B;  2L05 A;  1WE6 A;  4ZRI A;  5LLI A;  3W1S C;  2FCN A;  2DAF A;  4NPN A;  4GB9 A;  4ICU A;  4HXD A;  5DPR A;  3QIJ A;  3PLV A;  4WQO B;  3ML8 A;  3C0R B;  4WJN A;  4JQW C;  5IA7 A;  1WJN A;  1WX9 A;  2ASQ A;  1GC6 A;  2D11 A;  3L16 A;  5D2M B;  5CX3 A;  2BYE A;  2C7M B;  2V4L A;  2G4D B;  2JY6 A;  2NPT A;  1NBF C;  1GUA B;  3GZN I;  1I35 A;  3ZO5 B;  2JVC A;  3TL5 A;  3OLM D;  4W9L A;  4FBJ B;  3MTN B;  1FXT B;  5IAA C;  5CHW A;  1E8Z A;  4HCN B;  4URK A;  1E90 A;  1V2Y A;  1V86 A;  3VH3 B;  4TV3 A;  5EDS A;  1YQB A;  4F1S A;  1OQY A;  2PPH A;  2DYO A;  1NI2 A;  2MBQ A;  3HM6 X;  4KSL C;  1PQS A;  3SU8 X;  4HVB A;  3ZVV A;  1E8Y A;  2MBB B;  2O6V B;  4BOS C;  4WJQ A;  4II3 B;  1IP9 A;  2DZM A;  2ZCC A;  3PHW B;  4W9K A;  4FLH A;  4YL8 A;  4NQL B;  3H6N A;  3R7R A;  2J7Q B;  1A5R A;  5C23 A;  1J8C A;  1GG3 A;  4I6L B;  3UF8 A;  3JW0 X;  2OOB B;  1WYW B;  2XEW A;  3ECI A;  4GOC A;  4XC2 A;  2BYV E;  4IWO A;  1OTR B;  3L54 A;  3NZU A;  4ICV A;  4IM3 A;  4PYU A;  1L2N A;  1GNU A;  2KJH B;  2Y5B B;  4A20 A;  4MSM B;  2BYF A;  3KUD B;  2J0J A;  2JT4 B;  2PE6 B;  3KYD D;  3M95 A;  2KFK A;  4HJK A;  3L10 B;  1WFY A;  2JZZ A;  2KK8 A;  2D10 A;  3M3J A;  2MW5 A;  4E3C A;  3ZRF A;  3ML9 A;  1F9J A;  4NAW B;  2L00 B;  3CF6 E;  3VDZ A;  1UZX B;  4ZYN A;  4ANW A;  2JPH A;  2NBW B;  4B9K A;  3QX1 A;  2MP2 B;  1NDD A;  2I1J A;  3AXC A;  4AOF A;  3QWZ B;  3QK0 A;  3LDZ E;  4GU2 A;  4LJO B;  4KZC A;  1P0R A;  3PRE A;  3HHM A;  1R4N I;  2DX5 B;  3VH4 B;  1TTN A;  3V6E B;  3PZD A;  3CST A;  1WGR A;  2JRI B;  3LJ3 A;  4TKN A;  2HD5 B;  3RCZ A;  4DHZ E;  1C1Y B;  4FAD A;  2KJR A;  2B3A A;  2FCS A;  2FCQ A;  4NJ6 A;  3A9J B;  1P3Q U;  2JWZ A;  1V9J A;  2R2Q A;  3HM3 A;  2C9W B;  1WZ0 A;  2M17 A;  2CU1 A;  5DPS A;  2LUE A;  4HWI B;  2WX0 A;  2IZV B;  4GDL B;  3KUC B;  3DVG X;  2N9E B;  4IW0 A;  2CR5 A;  4LCD E;  1Z2M A;  4MH0 E;  2DYB A;  4WWO A;  3QC8 B;  3H7P B;  3ZRC A;  3W1Y A;  2Z59 B;  4WAA A;  4M8M A;  4DXA B;  1OGW A;  3PV1 A;  2DAJ A;  3DVG Y;  2RPQ A;  5J18 A;  3PRP B;  1EF1 A;  3DCG A;  3OJ3 A;  4EZJ A;  3H9D A;  1GC7 A;  3RUI B;  3ZDM C;  4BKS A;  1ZKH A;  1WXA A;  2DZK A;  2M0X A;  2PE9 A;  3UIP B;  2XBB C;  1TGZ B;  1RFA A;  3GOE A;  1CMX B;  2KMC A;  5D6J B;  2GBJ A;  2MP2 A;  4BBN F;  2MRP A;  2IY1 B;  1KJT A;  2K8H A;  1WI0 A;  2BKF A;  1UBQ A;  3K9O B;  1QZE A;  4W9H A;  1OEY J;  4HDO A;  3TIX A;  2DYM A;  3NZS A;  3Q3F A;  2MSE D;  4FJZ A;  2NR2 A;  3KW5 B;  3JSV A;  2R2O A;  3APD A;  2JZ3 B;  5J2R A;  1WE7 A;  2LI5 A;  2PEA A;  4RMA A;  3N30 A;  3V62 A;  3RYT A;  1E8X A;  3WAP A;  1H8C A;  1WF9 A;  3DBR I;  3QJZ A;  1WM3 A;  2LGY A;  4N9F 4;  2GMI C;  3A9K A;  3X0W A;  5CTR C;  5BO4 B;  2L0T A;  4EUT A;  1J0G A;  4K7U A;  2YLM A;  3OJ4 B;  2AWT A;  4HDQ A;  4WJP A;  4JL9 A;  1MG8 A;  2LD9 A;  1E7V A;  2G45 B;  3DBL I;  4MEL A;  3ZDT A;  2KX0 A;  4FA6 A;  3L0W B;  3ZTC A;  3IHP C;  2Z0D B;  3PHX B;  1EO6 A;  1ZW7 A;  4G3X B;  4DHJ D;  3IBE A;  2RD0 A;  5KHQ A;  5LXI B;  3I3T B;  2IO1 B;  3UGB B;  2KFJ A;  2I1K A;  2PJH A;  4XZ4 A;  4E74 A;  2G4S A;  3PT2 B;  2FID A;  2BGF A;  2CKH B;  3B1L X;  4JIO U;  3VHT C;  2C7H A;  2ZZP B;  1WXV A;  4KV2 A;  4DHZ B;  4EKU A;  2IO3 B;  2IYD B;  2MBH A;  3CSF A;  1J19 A;  2ZVO A;  4I6P A;  4K1R B;  2K25 A;  2LGD A;  2V1Y A;  2ZNV B;  2GBR A;  1E8W A;  2KC2 A;  1BT0 A;  3KUZ A;  3P2B A;  4IUM B;  1SGH A;  2Z0E B;  2HE7 A;  3DPD A;  3O65 B;  2AL3 A;  2ZPY A;  4W9G A;  2WWZ A;  3PRM B;  1G6J A;  4MJS A;  1WR6 E;  3L17 A;  2WYQ A;  3DVN V;  2NBV B;  3A9K B;  2LGX A;  3ZNI D;  4A3O A;  1WX7 A;  2LXC A;  2MA9 B;  1RLF A;  2KAN A;  2KZR A;  3NS8 A;  4BBN C;  4RM8 A;  4J6I A;  3APF A;  3VUX A;  2KWC A;  3NOB A;  4DHJ B;  5CHV C;  1KM7 A;  3SHQ A;  1UD7 A;  4CYE A;  1Z5S B;  2NCN A;  3ZIM A;  2KJ6 A;  3QAR A;  2XK5 B;  2L76 A;  3A9J A;  5AZG A;  2LRU A;  3QHT A;  2C7N B;  3T8M A;  2L8J A;  2A5U A;  3NHE B;  1UBI A;  4HK2 A;  4MSQ B;  1WXS A;  3T9L A;  4IM0 A;  3RD2 A;  4IWP A;  1V49 A;  1WGD A;  4PS3 A;  1S1Q B;  2VRR B;  3DQV A;  4II2 B;  1UGM A;  5AZH A;  1WIA A;  1V6E A;  2ZVN A;  4DWF A;  1KOT A;  2ZJD A;  2LJ5 A;  2EMS A;  2KO3 A;  4HCP B;  5HKH A;  1U4A A;  2KDB A;  2IBI B;  3EFU A;  2LVQ A;  4MGK E;  4MM3 A;  3JSV B;  2REX A;  4IC7 B;  5G2N A;  3SD5 A;  4NAW A;  3VTU A;  1SE9 A;  1P1A A;  3N32 A;  3CMM B;  4G11 A;  1OEY A;  5G55 A;  3KH0 A;  3PGE A;  4GDL A;  4W9D A;  4K7W A;  3WAM A;  4KSK C;  2K1F A;  2KNB A;  4EZL A;  3W1S A;  4BFR A;  2BWE S;  1YIW A;  5CHF A;  1I42 A;  2CS4 A;  1Y8R C;  2NBU A;  4XX5 A;  2KHW B;  4M0W B;  1LXD A;  5DPW A;  2ZEQ A;  4LDT B;  1S3S G;  2N9X A;  3A1Q A;  1RRB A;  1V5O A;  4M8N A;  4PS7 A;  3AU5 A;  3WA0 A;  3DBH I;  3RZW C;  4KDL B;  4NJ7 A;  2LVO A;  2KTF A;  2JF5 A;  3SDL C;  2K6D B;  2KX3 A;  4JLC A;  4EEW A;  4ASW C;  4MGI E;  5DCN A;  3PVL A;  5C1Z A;  3ZTD A;  1WY8 A;  2W9N A;  2KDE B;  2N1V A;  2C60 A;  2GBN A;  3VTV A;  3MHS D;  2EMT A;  5E6N A;  1WJ4 A;  4AJW A;  2KMA A;  3ZKJ C;  4OVV A;  2DHZ A;  3EC8 A;  3A4S C;  3B08 A;  2L7R A;  3PLU A;  1WM2 A;  2KOX A;  3IG3 A;  4ANX A;  3ZW3 A;  5J17 A;  4AUQ C;  2GOW A;  2MBE A;  4W9E A;  1SIF A;  3U8Z A;  5JZE B;  3R3M A;  1V81 A;  2AL6 A;  3A4R A;  2HTH A;  4LJP B;  3ZNZ B;  3Q3J A;  1WJ6 A;  3OAW A;  4KIK B;  1HE8 A;  1P9D U;  1ZGU B;  2AEH A;  2K39 A;  3R7Q A;  1D3Z A;  1GJZ A;  2MCN B;  2M4N A;  4DDI D;  4BKS D;  2QHO A;  2M1M A;  5TR5 A;  3JVZ X;  4RM9 A;  4BVU C;  4W9C A;  3AU4 A;  3DDC B;  4WWP A;  1LFD A;  4LDT D;  2KQ7 A;  5E6P A;  2EKE C;  1JRU A;  2L3Z A;  1TBE A;  4X57 B;  4B6W A;  2FAZ A;  3V6C B;  3U30 A;  2C5L C;  4A3P A;  4MGY E;  3TJP A;  3ZUN A;  1WXM A;  4W9J A;  1M94 A;  1LM8 B;  5D94 A;  3M63 B;  3L13 A;  2MWS B;  4KIK A;  5AZF A;  4GXB A;  4GDK A;  4ZDV A;  2ZCB A;  4HLE A;  2UYZ B;  2WX1 A;  4NY0 A;  2JRH A;  2J0K A;  2N1W A; 
#chains in the Genus database with same CATH topology
 3QQ8 B;  1HTO A;  3AI5 A;  3H7S A;  2N4F A;  2V3S A;  4JGH B;  4TQ0 A;  3AE6 B;  4AWJ A;  3A33 B;  3C8Y A;  4F8C B;  4OVU A;  2NVU I;  1VD2 A;  1ISN A;  2NS5 A;  2PVO D;  1WX8 A;  3MJ5 A;  5FR6 A;  3PS6 A;  4IG7 B;  4BOZ B;  2KWD A;  1V80 A;  1UH6 A;  2KDI A;  4MAC A;  3V3X A;  4YTN B;  4G50 A;  2WXP A;  2MLB A;  2M8S A;  1WJU A;  1K50 A;  3RT3 B;  1C79 A;  4OZA A;  3EHV A;  4ZHP A;  4FJV B;  2GBK A;  2LRW A;  3U7D A;  1WGH A;  2HTM E;  1FCL A;  1N61 A;  1D5M C;  5DPT A;  3QAQ A;  4I6N B;  3WCQ A;  2O2V A;  1XT9 B;  3RMK C;  1YD8 U;  1XQQ A;  3VTW A;  4DK5 A;  4GGQ A;  4MH8 A;  3IVF A;  2FBW B;  2MX2 A;  3KWL A;  2MBO A;  1YJ1 A;  1GB1 A;  2KTR A;  1XD3 B;  2PMV A;  1T5X D;  1WRD B;  4LTU A;  4MJS B;  5IN7 A;  2KTR B;  2QIL A;  3R66 C;  2CHX A;  2JXX A;  1IBX B;  1L4D B;  2K9X A;  3VFK A;  4DQO C;  2CJO A;  2SEB D;  1C78 A;  1WR1 A;  4NQK E;  3VQI A;  1KLU D;  2BBC A;  4EOY A;  2NTT A;  1SXT A;  3UQA A;  2K6Q A;  2A4Z A;  1XXG A;  2VH2 A;  2WDT B;  5BMH A;  3TBL D;  1L7Y A;  1LQB A;  4OZC A;  5AUI A;  1UEL A;  4ANV A;  1TZ1 A;  2W3S A;  4GMV A;  3V60 A;  3UIN B;  2JXT A;  3NVZ A;  2Q5W D;  2N9P C;  5D7G A;  1IUE A;  4AP4 C;  2O6V D;  3PZ7 A;  3DOW A;  2K8C A;  4RFB A;  2KWV B;  2RDH A;  3TMP B;  3DBL B;  3DWG C;  3TSS A;  1SIJ A;  2CU3 A;  5MPO A;  1I4Q A;  4ZRI A;  1WE6 A;  1XCT L;  1PYW D;  1RYJ A;  2K22 A;  3QIJ A;  2ONQ A;  1WJN A;  1WX9 A;  3L16 A;  2ASQ A;  2D11 A;  2G4D B;  3IXS A;  2NPT A;  1I35 A;  1CK1 A;  2QIE B;  3OLM D;  1XF5 L;  2WDR B;  4ZRP A;  2IGG A;  1KLG D;  1FXT B;  5CHW A;  3L4P A;  1UF0 A;  1E8Z A;  1F52 A;  1V2Y A;  1V86 A;  2DYO A;  2MBQ A;  1PQS A;  2MBB B;  1TY2 A;  2WHI A;  4WJQ A;  4ZRQ A;  5HI1 A;  2K3U A;  4FLH A;  1V8C A;  2J7Q B;  4P6V F;  4AS1 A;  2D5G A;  1AWD A;  3HVZ A;  2OOB B;  1T6B X;  4GOC A;  3TUO A;  4IWO A;  4ICV A;  1L6U A;  1L2N A;  1WGK A;  3P4Q B;  4MSM B;  2BYF A;  2J0J A;  2PE6 B;  3KYD D;  2KFK A;  5AUK A;  3L10 B;  2D10 A;  2LJI A;  1HEZ E;  2BS4 B;  2L00 B;  4RGM A;  1A70 A;  2MJD A;  4K3B A;  4KGT A;  1XLO A;  4ZYN A;  1TIF A;  2WXR A;  1SJE D;  2MP2 B;  5LXH A;  2Y5C A;  4GU2 A;  2INN E;  4LJO B;  2JRI B;  1C1Y B;  3I63 C;  3A9J B;  5EE3 A;  2OJW A;  5EE9 A;  2R2Q A;  3HM3 A;  1XLP A;  2M17 A;  2KYW A;  2WX0 A;  4GDL B;  3DVG X;  2N9E B;  2CR5 A;  3KLS X;  4YXD B;  4M8M A;  1OGW A;  2ACZ B;  3Q3N C;  3PV1 A;  3U52 E;  1ZOY B;  3PRP B;  1PGX A;  1XCQ L;  1GC7 A;  1ZKH A;  1YQ4 B;  4OHJ A;  3EA6 A;  3GOE A;  1ENF A;  1CMX B;  1TKY A;  1ZXH A;  1T0Q C;  3Q69 A;  1ACC A;  4YSZ B;  2BKF A;  1UBQ A;  3AE7 B;  1GB4 A;  1FMA D;  2DYM A;  3Q3F A;  4FJZ A;  3JSV A;  3TEW A;  2ZW0 A;  1N62 A;  1PUT A;  3WAP A;  4N9F 4;  1VJK A;  1MFW A;  1L5P A;  4EUT A;  4HDQ A;  4A9A A;  2NMQ A;  4AQ7 A;  1I4H A;  3ZDT A;  4RGO S;  3L0W B;  3ZTC A;  2LHE A;  2EKI A;  1ZW7 A;  1NYR A;  2KFJ A;  4E74 A;  4OVZ A;  4JIO U;  2KAC A;  4NAM A;  4DHZ B;  3P4P B;  3ZYY X;  4I6P A;  3RNF C;  2LGD A;  2ZNV B;  2DBY A;  2Z0E B;  2WWZ A;  3TEY A;  2WYQ A;  3ABV B;  1I4G A;  4A90 A;  2LGX A;  3Q2A C;  3ZNI D;  4A3O A;  3IAS 1;  1WX7 A;  1RLF A;  2KAN A;  4BBN C;  4J6I A;  1FIQ A;  3APF A;  3DBH B;  1TS2 A;  4C80 A;  3U2S C;  1Z5S B;  2KJ6 A;  5BMG A;  2V9H A;  4YT0 B;  2L8J A;  2A5U A;  3NHE B;  4IM0 A;  4PS3 A;  3AE2 B;  4EE2 A;  5IKC M;  4DWF A;  4HCP B;  3IT6 B;  1U4A A;  2JU6 X;  4MGK E;  4IC7 B;  1FNV A;  3PGE A;  4GDL A;  4K7W A;  3MP9 A;  1GOZ A;  2N9L A;  2BWE S;  1YIW A;  3I9V 1;  3Q3M C;  5CHF A;  2NBU A;  1Y8R C;  3ZXR A;  2D3A A;  4XX5 A;  4JX1 C;  4M0W B;  5TSS A;  5DPW A;  3A1Q A;  1RRB A;  4M8N A;  3AU5 A;  4KDL B;  2V3N A;  2JF5 A;  3ETR A;  4MGI E;  1C9F A;  3SFD B;  5C1Z A;  1WY8 A;  2QSD A;  2LUM A;  3MC9 A;  3AE9 B;  2KMA A;  3EC8 A;  3A4S C;  3B08 A;  1WM2 A;  1AN8 A;  3IG3 A;  5J17 A;  3R3M A;  3RN9 C;  4LJP B;  3ZNZ B;  1WXQ A;  3OAW A;  3NS1 A;  4KIK B;  1ZGU B;  2MCN B;  2M4N A;  4BKS D;  1VZ8 A;  3I57 A;  3ZQ4 A;  4USA A;  3AU4 A;  1TBE A;  4ZHO A;  2GRI A;  2FAZ A;  4A3P A;  3TJP A;  3MC0 B;  4W9J A;  1PGA A;  4KIK A;  2ZCB A;  1MVK A;  2WX1 A;  4W9K A;  3AMZ A;  4RGN A;  2YEP B;  1Q1O A;  4WWN A;  1ZPS A;  2NPT B;  4P1C C;  4NNJ B;  2L32 A;  3AB5 A;  2W82 A;  5HFY A;  2KLG A;  3NZ3 A;  4KZ0 A;  1T0Y A;  3A1Q B;  1QOA A;  1L0Y B;  3EUB 2;  3BWU D;  2ZPN A;  3QCA A;  1E10 A;  4L2Y A;  2JWU A;  3UIO B;  4WH4 A;  1RAX A;  3H7P A;  4W9I A;  4BKT A;  1HZ6 A;  5JHA A;  1IPG A;  1P7E A;  5GMV A;  2MEK A;  3UQB A;  3ONS A;  3KQ4 A;  3PRZ A;  3AE1 B;  4XWW A;  2WQY B;  3AE8 B;  4K7S A;  3KWV A;  2RR9 A;  3HIZ A;  2HDE A;  1N63 A;  4TUU A;  2KQS A;  1JWU D;  5T8I A;  3VRA B;  1NEN B;  3B0A A;  1X1M A;  3T3N A;  2WXM A;  3LB8 C;  2N7D A;  3VXW A;  2FCM A;  3WIM A;  1XLN A;  3U4E G;  4ARI A;  2OJR A;  1C77 A;  2V0G A;  2BKR B;  3BK2 A;  1Q10 A;  2KLC A;  2WXF A;  3TEZ A;  2L0F A;  4CHK A;  1EUV B;  3QA8 A;  3EEC A;  2KDM A;  1FNW A;  2KN5 A;  1H4R A;  3VRB B;  2LVP A;  4ANU A;  1DOX A;  3JYU A;  3VUW A;  3DVN U;  1D5Z C;  3VUY A;  4BKG A;  3ENE A;  3ZJU A;  3ZLZ A;  2KXJ A;  4HKZ E;  2UWQ A;  1V1P A;  1I4R A;  4KGR A;  1STE A;  3NUH B;  4KVG B;  1ZDV A;  3WAN A;  2G9H D;  3VR8 B;  4P7I A;  5EE1 A;  3IFW B;  2DEN B;  2MH7 A;  1YJI A;  1HXY D;  5JXV A;  4ICU A;  1MHH E;  2EEL A;  3ML8 A;  4WJN A;  4JQW C;  2QMT A;  1GC6 A;  1GUA B;  3CIR B;  4W9L A;  4FBJ B;  4URK A;  1E90 A;  3VH3 B;  1YQB A;  4F1S A;  2JX5 A;  1OQY A;  2PPH A;  1R7S A;  4KSL C;  4HVB A;  2O6V B;  3Q8F A;  3PHW B;  3DWM A;  1DYQ A;  4NQL B;  3H6N A;  1GG3 A;  1TJE A;  3UF8 A;  3HUI A;  1JAL A;  1OTR B;  3L54 A;  2BS2 B;  1IGC A;  2Y5B B;  4A20 A;  3RPF C;  5C3J B;  1LO5 D;  1VR9 A;  1D5X C;  2BB5 A;  2QEJ C;  3M3J A;  1F9J A;  1TKG A;  3GE3 C;  4NAW B;  3CF6 E;  1UZX B;  1SE2 A;  1F1H A;  4C4V A;  1RWS A;  3AE3 B;  3QWZ B;  3LDZ E;  1P0R A;  2DX5 B;  3VH4 B;  3V6E B;  3CST A;  3LJ3 A;  1FM0 D;  2L52 A;  1C4P A;  2B3A A;  2MJE A;  2FCS A;  1IGD A;  4NJ6 A;  2JWZ A;  3AE4 B;  4QAY A;  3B2F A;  1MPE A;  1Z2M A;  5G5G A;  3QC8 B;  3BII D;  4WWM A;  3W1Y A;  2Z59 B;  4DXA B;  1T0S C;  1JRO A;  2RPQ A;  4EZJ A;  3RUI B;  4A55 A;  2DZK A;  1WXA A;  2M0X A;  3UIP B;  3RNC C;  4ACF A;  3UI3 A;  2Y5P A;  2X38 A;  1RFA A;  3ZGZ A;  2KMC A;  2MP2 A;  2MRP A;  1YN5 A;  2IY1 B;  1DGJ A;  3R2T A;  3K9O B;  5IO9 A;  2JQR B;  3AEG B;  2D3B A;  2PVG C;  4KX6 B;  2R2O A;  1F2R I;  2DLB A;  4RMA A;  3RYT A;  3QJZ A;  1WF9 A;  2GMI C;  3GB1 A;  1ET9 A;  3A9K A;  4JPS A;  2L0T A;  1MJD A;  2G45 B;  2YEP F;  4FA6 A;  2BYT A;  2Z0D B;  3PHX B;  4XGA B;  1EO6 A;  5KHQ A;  1VZ6 A;  3UGB B;  1N6Z A;  3BVZ A;  2GI9 A;  2FID A;  2C7H A;  2IO3 B;  2IYD B;  3CSF A;  2V1Y A;  2KC2 A;  1E8W A;  2W55 A;  4IUM B;  3DPD A;  2HE7 A;  2AL3 A;  2ZPY A;  1FRR A;  2WLB A;  2WXO A;  1G6J A;  4MJS A;  1RM6 C;  1WR6 E;  3L17 A;  3DVN V;  5GXG B;  2MA9 B;  2KZR A;  1MG4 A;  3NS8 A;  1T0R C;  3DHG C;  1FXA A;  3NOB A;  4DHJ B;  2INP E;  4J3O D;  1KM7 A;  2NCN A;  3ZIM A;  1K52 A;  2DNF A;  3A9J A;  3LYY A;  4RNA A;  1FPY A;  5IP4 D;  4HK2 A;  4MSQ B;  3T9L A;  1VRA B;  1D6E C;  1S1Q B;  1SE4 A;  3DQV A;  4II2 B;  2ZVN A;  1OQR A;  2KO3 A;  1Y56 A;  5HKH A;  2IBI B;  3JSV B;  4NAW A;  1SSN A;  4RGT A;  1P1A A;  3N32 A;  1I7H A;  3CMM B;  5G55 A;  2V3P A;  2KNB A;  4EZL A;  4YTP B;  3W1S A;  4BFR A;  2L1A A;  2ICI A;  3RNB C;  4B0M A;  2CS4 A;  4YWG G;  1IBX A;  2ZEQ A;  3WA0 A;  3U7Z A;  4FXC A;  3AEB B;  1ZDX A;  2WU2 B;  4N6E B;  1YOV B;  3IAM 1;  2W9N A;  2N1V A;  1JRP A;  2GBN A;  3MHS D;  5E6N A;  4AJW A;  3ZKJ C;  3E56 A;  4P16 A;  5D3D A;  4ANX A;  3ZW3 A;  4W9E A;  5JZE B;  2AL6 A;  3A4R A;  3Q3J A;  2VZK B;  1P9D U;  3FKY A;  2K39 A;  1JML A;  3R7Q A;  2WXN A;  2W3R A;  4BVU C;  1SE3 A;  1NYQ A;  4WWP A;  4LDT D;  1JRU A;  1SEB D;  4LNN A;  4X57 B;  4B6W A;  3V6C B;  4IKG A;  3ZUN A;  5C2T B;  1BUI C;  1WXM A;  1XLQ A;  1T3Q A;  4HLE A;  2JRH A;  2N1W A;  4PS8 A;  1V5T A;  3ZNH B;  4F7Z A;  3P1M A;  1IYF A;  5JHB A;  4HPM B;  4W9F A;  3SEB A;  2G3Q B;  1K51 A;  3S2A A;  1FFV A;  1R4M I;  3PPA A;  4C00 A;  3K9P B;  1WH3 A;  1WGY A;  2LXA A;  3KVF B;  4B0E A;  4A8X C;  4RF1 A;  1ZP0 B;  3B2G A;  2AQ2 B;  1VCB A;  3ZNG C;  2RSU A;  1QQR A;  1B9R A;  1PFD A;  2MJ3 A;  2WU5 B;  2ON8 A;  4M02 A;  4ZRJ A;  1YX6 B;  2D07 B;  4XYC A;  4AJY B;  4PK1 A;  5KHO A;  1EWC A;  5AEK B;  2RGF A;  4KKI A;  3BK1 A;  2MHJ A;  3D32 A;  4JWS C;  1AW7 A;  4C4V B;  1AAR A;  2N7J A;  4TQ1 A;  3TCA A;  4CO7 A;  2WGS A;  1YNT E;  1C3T A;  3GP7 A;  1WYG A;  2BF8 B;  3WAL A;  4RCO A;  4DXG A;  3V61 A;  1XEE A;  4GIV A;  3ALB A;  4GN1 A;  1WMH A;  3BIN A;  3PZ8 A;  2BVC A;  2V4I B;  1Q5W B;  3X23 A;  2WXJ A;  2KWU B;  2NTS A;  2BPS A;  1TS3 A;  4O1N A;  1FO4 A;  1E7U A;  4XDD A;  2KDF B;  2CHZ A;  4MDK E;  2I2Y A;  2DZJ A;  1HA5 A;  4IDI A;  4B95 A;  5FK9 C;  2PTL A;  2AX5 A;  2H88 B;  2J4X A;  2O6V A;  2GB1 A;  2IGD A;  4S0R A;  4REZ A;  1L0V B;  1C4A A;  2KVR A;  2DZI A;  4DBG A;  3EFC A;  1P98 A;  4WJO A;  2LFI A;  4US8 A;  3MHZ A;  5IOI A;  4K81 A;  4FHK A;  5L83 A;  3RI7 C;  4ARC A;  4FN2 A;  4N58 A;  3WAO A;  4MT5 A;  4US9 A;  2LMC A;  1TS4 A;  2HJ8 A;  1J7C A;  2KMM A;  3HK0 A;  3J9C A;  1EF5 A;  2O2V B;  3NY5 A;  2K8B A;  5BYS A;  2LWP A;  2MQJ A;  3M62 B;  2L05 A;  3P4S B;  5LLI A;  3W1S C;  2L83 A;  4HJG E;  2FCN A;  4NPN A;  4GB9 A;  1F2R C;  3PLV A;  4WQO B;  3C0R B;  1DOI A;  5IA7 A;  1VDV A;  2JYT A;  3BZD B;  3GZN I;  1NBF C;  3TL5 A;  3NVV A;  2JZP A;  3AM9 A;  5IAA C;  3AEE B;  1FD6 A;  5LNK 1;  5EDS A;  1C76 A;  3ZVV A;  1E8Y A;  3NRZ A;  4KKJ A;  3ZXV A;  2WDQ B;  2DZM A;  2PIA A;  2FE8 A;  2QDF A;  4YL8 A;  1AYF A;  1A5R A;  5C23 A;  1J8C A;  3Q8C A;  3JW0 X;  2M56 B;  3BVG A;  1WYW B;  2Y3A A;  3O13 A;  2XEW A;  3ECI A;  1FRD A;  2BYV E;  4PYU A;  4IM3 A;  4JE3 B;  1CJE A;  2PLP A;  5G5H A;  5FKA C;  4C7Z A;  2JYE A;  4HJK A;  1WFY A;  2JZZ A;  2MW5 A;  4E3C A;  1P7F A;  3ZRF A;  4YTM B;  1GAQ B;  3GZN B;  4ANW A;  1SF0 A;  4D2K A;  3C19 A;  1TT5 B;  1NDD A;  2I1J A;  3HHM A;  2J42 A;  1TTN A;  3PZD A;  2AQ1 B;  4FAD A;  1FCC C;  1P3Q U;  1TZO A;  4S17 A;  1V9J A;  1TS5 A;  2C9W B;  4LLG M;  2CU1 A;  2LUE A;  1TKE A;  2K0P A;  4MH0 E;  3N1Y C;  1EM7 A;  4WAA A;  5H8Y E;  2DAJ A;  3DVG Y;  5J18 A;  1KH0 A;  3H9D A;  3ZDM C;  4BKS A;  2XBB C;  1TGZ B;  4BAX A;  1DOY A;  1J7B A;  5D6J B;  2GBJ A;  4BBN F;  1KJT A;  2K8H A;  1WI0 A;  3FIL B;  2BB6 A;  4W9H A;  2G1E A;  1OEY J;  3NZS A;  2MSE D;  4HPP A;  3BYY B;  2WXG A;  3KW5 B;  4XE0 A;  3APD A;  2WP9 B;  2JZ3 B;  1J7A A;  2PEA A;  1QF6 A;  1C4C A;  1E8X A;  1EU3 A;  2IGH A;  1E0Z A;  1H8C A;  2LGY A;  1EU4 A;  4K7U A;  2IND C;  3OJ4 B;  4JL9 A;  1MG8 A;  2LD9 A;  1E7V A;  4MEL A;  3Q8E A;  2WXH A;  4PT5 A;  4WUR A;  3IHP C;  5D3I B;  4G3X B;  1HTQ A;  2RD0 A;  5LXI B;  3I3T B;  1FXI A;  2IO1 B;  2PJH A;  3PT2 B;  1EWY C;  3AED B;  2BGF A;  3B1L X;  3VHT C;  2WXL A;  4RF0 A;  2ZVO A;  3VR9 B;  4K1R B;  2K25 A;  3MFG A;  2LGS A;  1BT0 A;  3O65 B;  2B76 B;  4LNK A;  3W2D A;  2M19 A;  4HRO A;  1OFF A;  4RM8 A;  1D4B A;  2RPV A;  4TMA B;  2UU7 A;  5CHV C;  4GLS C;  3SHQ A;  1R4N B;  3R8B A;  3FIL A;  2W54 A;  2XK5 B;  2KQ4 X;  2L76 A;  2LRU A;  4CQN A;  3T8M A;  2BW2 A;  3BYT B;  1WXS A;  2J53 A;  2WXK A;  3N1Z C;  1MI0 A;  1V49 A;  5HG2 A;  1FEH A;  1UGM A;  1WIA A;  4R3D A;  2ZJD A;  1JQ4 A;  2KDB A;  3ZJT A;  1B1Z A;  2LVQ A;  3SD5 A;  1SE9 A;  2TSS A;  3AEF B;  4KSK C;  2K1F A;  2AQ3 B;  1KRH A;  3V05 A;  1LXD A;  1SB3 C;  1HZ5 A;  1S3S G;  1D3Z A;  2R61 A;  4PS7 A;  3DBH I;  3RZW C;  2LVO A;  2N9K A;  2KTF A;  3SDL C;  2K6D B;  2KX3 A;  4JLC A;  5DCN A;  3PVL A;  2WS3 B;  2KDE B;  4HEA 1;  2WDV B;  3FAH A;  4UDU C;  4AUQ C;  2GOW A;  1SIF A;  2HTH A;  2N0S B;  1WJ6 A;  2QCZ A;  1HE8 A;  4LNF A;  4DDI D;  2VZK D;  2QHO A;  2M1M A;  5TR5 A;  1F0Z A;  4RM9 A;  3DDC B;  3P42 A;  1JWM D;  2KQ7 A;  5E6P A;  2L3Z A;  3U30 A;  4L1B A;  4MGY E;  1JW9 D;  2I38 A;  1M94 A;  1LM8 B;  2SAK A;  3M63 B;  3L13 A;  2MWS B;  2PKO A;  1YQ3 B;  3RNA C;  4GDK A;  4ZDV A;  2UYZ B;  4NY0 A;  3OG5 A;  1K53 A;  3SFE B;  3TEX A;  2RDB C;  1UWM A;  1N5W A;  4FJY A;  2FUH B;  4HPL B;  3KYC D;  3N9Y C;  3AEA B;  2M0A A;  3N3K B;  3MC8 A;  2BWF A;  5I4D A;  2LZ6 A;  4IWQ A;  4LNI A;  2CHW A;  4PYZ A;  3RUL A;  3PTF C;  2FNJ B;  3RFZ B;  4JWU C;  4MGZ E;  1KF6 B;  2JUO A;  4GDK B;  1TYG B;  3H1U A;  2KD0 A;  4IM2 A;  4G0N B;  4MM3 B;  2D3C A;  1E5W A;  2K5P A;  3BVM A;  3P63 A;  3DHI C;  4TSS A;  4MEM A;  2LHD A;  1K8R B;  1I4X A;  2YVC A;  1OQQ A;  3VVW B;  3AEC B;  4OZB A;  2LAS A;  4KGS A;  2XK5 A;  5E6O A;  4DDG D;  3MJW A;  2N7E A;  3BY4 B;  1ESF A;  1R4M B;  1JWS D;  1VLB A;  3PO0 A;  2IY0 B;  2KFK B;  1YMH E;  1UWX A;  2KKC A;  4EZK A;  3APC A;  1UGJ A;  2D3G A;  5BYR A;  2HJ1 A;  1YX5 B;  4ZRK A;  1UUP A;  2RMM A;  2J0M A;  3PSE B;  1WMH B;  2GBM A;  1E9M A;  4EFO A;  1WGG A;  3SR6 A;  4XDC A;  1WZ3 A;  4FHJ A;  1QOB A;  1BXT A;  2BQQ A;  1KLV A;  2ZNV C;  1FNU A;  4GSW A;  3RZF A;  2IPK D;  3Q3O C;  1CZP A;  2FIF A;  1F77 A;  4FUL A;  3AV8 A;  3L08 A;  4LNO A;  3VAW A;  4ZYS A;  3NJT A;  4NJC A;  2KC1 A;  2D2Q A;  3RNE C;  1ZE3 D;  3DBS A;  4KDI C;  3FC4 A;  2AYO B;  4E71 A;  1QIL A;  3W5V B;  2IO0 B;  3H8H A;  2BT6 A;  5JH5 C;  1Q0W B;  3AUL A;  2IO2 B;  3OWE B;  1LGR A;  5L95 C;  4WIP A;  1MHX A;  3RNG C;  1YJJ A;  1E7P B;  2DAF A;  4HXD A;  5DPR A;  1WSP A;  3AH7 A;  3W5U B;  4ZOH C;  2X8X X;  5D2M B;  3GE8 C;  2BYE A;  2C7M B;  2V4L A;  5CX3 A;  2JY6 A;  3ZO5 B;  2JVC A;  3AE5 B;  3DBR B;  2J52 A;  3MTN B;  1YN3 A;  1QOF A;  4HCN B;  4TV3 A;  4M01 A;  1XO3 A;  1QOG A;  1NI2 A;  3HM6 X;  1VZ7 A;  3SU8 X;  1RFK A;  2E3T A;  2KVZ A;  4BOS C;  1QT9 A;  4II3 B;  1IP9 A;  1CQV A;  2ZCC A;  3DHH C;  3R7R A;  4BZA A;  4I6L B;  3I5J C;  2BS3 B;  1YN4 A;  4XC2 A;  2ZW1 A;  3NZU A;  2PW9 A;  1I4P A;  4YSX B;  1GNU A;  2KJH B;  2E6X A;  3KUD B;  2Z8L A;  1L6V A;  2JT4 B;  3M95 A;  2IJ0 A;  2KK8 A;  4NZL B;  2QC8 A;  3ML9 A;  2KN4 A;  1ET6 A;  1ZXI A;  3VDZ A;  2JPH A;  1NI3 A;  4ITK A;  5BMI A;  2NBW B;  4K3C A;  4B9K A;  3QX1 A;  2LEK A;  3AXC A;  4AOF A;  3QK0 A;  4KZC A;  4C56 C;  3PRE A;  1R4N I;  4IOI E;  3HRD D;  1HQR D;  3RCZ A;  1WGR A;  1JWB D;  4TKN A;  2HD5 B;  4DHZ E;  3CWI A;  2KJR A;  4HRS A;  2FCQ A;  5EE0 A;  5FR3 A;  1KFY B;  1L4Z B;  1V1O A;  4A6Q A;  1WZ0 A;  5DPS A;  2WNM A;  4HWI B;  2IZV B;  5BYQ A;  3KUC B;  3EGR A;  2IDY A;  4IW0 A;  3R2I A;  4H2A A;  4LCD E;  2DYB A;  4WWO A;  3H7P B;  3ZRC A;  3P4R B;  1EF1 A;  3DCG A;  1M4V A;  3NVY A;  3OJ3 A;  2PE9 A;  2OED A;  1UNS A;  3NG0 A;  4XWT A;  2GLS A;  2DWQ A;  1QZE A;  1WRI A;  4HDO A;  3TIX A;  2NR2 A;  2QJL A;  4N59 A;  5J2R A;  3HVD A;  1WE7 A;  2LI5 A;  1WWT A;  3N30 A;  3V62 A;  2XNA C;  3N20 C;  1JWA D;  1TY0 A;  3DBR I;  1WM3 A;  1QKZ A;  3X0W A;  3IT4 B;  5CTR C;  5BO4 B;  1J0G A;  2YLM A;  2AWT A;  4WJP A;  5E6J A;  1SJH D;  5HHD G;  3N1X C;  3DBL I;  2KX0 A;  2OHF A;  4DHJ D;  3IBE A;  1E6E B;  1NVI D;  2I1K A;  4XZ4 A;  2G4S A;  3T3O A;  4YSY B;  2CKH B;  2ZZP B;  1WXV A;  4KV2 A;  4EKU A;  2JSV X;  1V1P B;  2MBH A;  1J19 A;  1N5X A;  4Q2J A;  3KUZ A;  2GBR A;  3E9S A;  3P2B A;  1SGH A;  2INC C;  4W9G A;  3PRM B;  1PGB A;  1NEK B;  1KTK A;  2NBV B;  1FFU A;  3A9K B;  2LXC A;  4HKQ A;  2XN9 C;  1GPX A;  4RH6 A;  1PDX A;  3VUX A;  2KWC A;  1BML C;  1UD7 A;  4CYE A;  3QAR A;  1L0X B;  1ROE A;  5AZG A;  4C7Y A;  3GS2 A;  3QHT A;  2C7N B;  1UBI A;  3RD2 A;  4IWP A;  1WGD A;  3LXF A;  4M00 A;  2VRR B;  3ZJV A;  2WXI A;  3URY A;  5AZH A;  1V6E A;  1KOT A;  2LJ5 A;  2EMS A;  2KAJ A;  4LK0 M;  3EFU A;  2H89 B;  4MM3 A;  2REX A;  5G2N A;  3VTU A;  2WXQ A;  4G11 A;  1OEY A;  3KH0 A;  4W9D A;  3WAM A;  4P1B C;  1I42 A;  2KT7 A;  2KHW B;  4WAF A;  4LDT B;  2N9X A;  1V5O A;  4NJ7 A;  1SBB B;  4M0W A;  4EEW A;  4ASW C;  4WQM A;  2CJN A;  1V97 A;  3ZTD A;  3NVW A;  3Q6B A;  2C60 A;  3VTV A;  2EMT A;  2VH1 A;  1WJ4 A;  1JCK B;  4OVV A;  1ZUD 2;  2DHZ A;  4DXF A;  2L7R A;  3PLU A;  2KOX A;  3B9J A;  3U8Z A;  2MBE A;  5H92 C;  3Q14 C;  1V81 A;  3AN1 A;  3Q8A A;  2AEH A;  1GJZ A;  3Q8B A;  3JVZ X;  4W9C A;  1LFD A;  2EKE C;  2FUG 1;  2BTE A;  2C5L C;  2LGI A;  1N60 A;  3W9C B;  4OW0 A;  4L23 A;  1QLB B;  2RDG A;  5D94 A;  5AZF A;  4GXB A;  2J0K A; 
#chains in the Genus database with same CATH homology
 3QQ8 B;  3AI5 A;  3H7S A;  4PS8 A;  1V5T A;  2N4F A;  2FUH B;  4FJY A;  3ZNH B;  4HPL B;  4F7Z A;  3KYC D;  2V3S A;  1IYF A;  1Q1O A;  4JGH B;  4WWN A;  5JHB A;  2NPT B;  4HPM B;  4W9F A;  2G3Q B;  4TQ0 A;  3S2A A;  4NNJ B;  1R4M I;  3N3K B;  3PPA A;  2BWF A;  2LZ6 A;  4IWQ A;  4AWJ A;  3A33 B;  2CHW A;  2KLG A;  4PYZ A;  3K9P B;  1WH3 A;  3RUL A;  4KZ0 A;  4OVU A;  4F8C B;  1T0Y A;  1WGY A;  2NVU I;  3PTF C;  1VD2 A;  3A1Q B;  2FNJ B;  2LXA A;  3KVF B;  2ZPN A;  1ISN A;  2NS5 A;  3QCA A;  1WX8 A;  4MGZ E;  3UIO B;  5FR6 A;  3PS6 A;  2JUO A;  1RAX A;  4IG7 B;  3H7P A;  4BOZ B;  4W9I A;  1V80 A;  1UH6 A;  4BKT A;  5JHA A;  4GDK B;  1VCB A;  3H1U A;  1IPG A;  2KDI A;  5GMV A;  3ZNG C;  2RSU A;  2KD0 A;  4IM2 A;  3UQB A;  3ONS A;  3PRZ A;  4G50 A;  4G0N B;  2MLB A;  2M8S A;  4K7S A;  1WJU A;  1YX6 B;  4ZRJ A;  3RT3 B;  2D07 B;  3EHV A;  1E5W A;  2RR9 A;  2GBK A;  2LRW A;  4FJV B;  3U7D A;  1WGH A;  4AJY B;  4MEM A;  3HIZ A;  5KHO A;  5AEK B;  2RGF A;  4TUU A;  2KQS A;  1K8R B;  3D32 A;  5DPT A;  3QAQ A;  4I6N B;  2YVC A;  3VVW B;  1AAR A;  4TQ1 A;  2O2V A;  3TCA A;  4CO7 A;  1XT9 B;  2LAS A;  1YD8 U;  2XK5 A;  1XQQ A;  3B0A A;  3VTW A;  4DK5 A;  1X1M A;  4GGQ A;  1C3T A;  5E6O A;  4DDG D;  3MJW A;  2N7E A;  3BY4 B;  2BF8 B;  2N7D A;  3WAL A;  3VXW A;  3V61 A;  2FCM A;  3IVF A;  3WIM A;  2IY0 B;  2KFK B;  4GIV A;  2KKC A;  2MX2 A;  3ALB A;  4GN1 A;  1WMH A;  2MBO A;  4EZK A;  3BIN A;  3APC A;  2D3G A;  1YJ1 A;  1Q5W B;  2OJR A;  3X23 A;  2KTR A;  2KWU B;  1XD3 B;  2BPS A;  1WRD B;  2BKR B;  1YX5 B;  4ZRK A;  1E7U A;  2KDF B;  2CHZ A;  2KLC A;  4MDK E;  4MJS B;  2KTR B;  3R66 C;  2DZJ A;  2CHX A;  2JXX A;  2J0M A;  3PSE B;  1WMH B;  2L0F A;  2GBM A;  4B95 A;  4CHK A;  1EUV B;  3QA8 A;  3VFK A;  4EFO A;  1WGG A;  1WR1 A;  4NQK E;  2O6V A;  3EEC A;  1WZ3 A;  3VQI A;  4EOY A;  2KN5 A;  4FHJ A;  3UQA A;  2K6Q A;  1H4R A;  2ZNV C;  2A4Z A;  1KLV A;  2KVR A;  4GSW A;  2LVP A;  2DZI A;  4DBG A;  4ANU A;  2WDT B;  3RZF A;  3TBL D;  1P98 A;  2FIF A;  4WJO A;  1L7Y A;  3JYU A;  1LQB A;  3VUW A;  3DVN U;  4FUL A;  3VUY A;  4BKG A;  4K81 A;  1UEL A;  3ENE A;  4ANV A;  3L08 A;  4FHK A;  1TZ1 A;  3VAW A;  3ZLZ A;  5L83 A;  2KC1 A;  2D2Q A;  4FN2 A;  2KXJ A;  3WAO A;  4GMV A;  3V60 A;  3UIN B;  5LXH A;  3DBS A;  4KDI C;  2N9P C;  2UWQ A;  5D7G A;  4AP4 C;  2O6V D;  2AYO B;  4KVG B;  2HJ8 A;  3HK0 A;  4E71 A;  3DOW A;  2K8C A;  3WAN A;  2IO0 B;  2KWV B;  1EF5 A;  3TMP B;  5JH5 C;  2O2V B;  1Q0W B;  3AUL A;  3NY5 A;  2IO2 B;  4P7I A;  2K8B A;  3IFW B;  2LWP A;  2DEN B;  2MQJ A;  5L95 C;  3M62 B;  2L05 A;  1WE6 A;  4ZRI A;  5LLI A;  3W1S C;  2FCN A;  2DAF A;  4NPN A;  4GB9 A;  4ICU A;  4HXD A;  5DPR A;  3QIJ A;  3PLV A;  4WQO B;  3ML8 A;  3C0R B;  4WJN A;  4JQW C;  5IA7 A;  1WJN A;  1WX9 A;  2ASQ A;  1GC6 A;  2D11 A;  3L16 A;  5D2M B;  5CX3 A;  2BYE A;  2C7M B;  2V4L A;  2G4D B;  2JY6 A;  2NPT A;  1NBF C;  1GUA B;  3GZN I;  1I35 A;  3ZO5 B;  2JVC A;  3TL5 A;  3OLM D;  4W9L A;  4FBJ B;  3MTN B;  1FXT B;  5IAA C;  5CHW A;  1E8Z A;  4HCN B;  4URK A;  1E90 A;  1V2Y A;  1V86 A;  3VH3 B;  4TV3 A;  5EDS A;  1YQB A;  4F1S A;  1OQY A;  2PPH A;  2DYO A;  1NI2 A;  2MBQ A;  3HM6 X;  4KSL C;  1PQS A;  3SU8 X;  4HVB A;  3ZVV A;  1E8Y A;  2MBB B;  2O6V B;  4BOS C;  4WJQ A;  4II3 B;  1IP9 A;  2DZM A;  2ZCC A;  3PHW B;  4W9K A;  4FLH A;  4YL8 A;  4NQL B;  3H6N A;  3R7R A;  2J7Q B;  1A5R A;  5C23 A;  1J8C A;  1GG3 A;  4I6L B;  3UF8 A;  3JW0 X;  2OOB B;  1WYW B;  2XEW A;  3ECI A;  4GOC A;  4XC2 A;  2BYV E;  4IWO A;  1OTR B;  3L54 A;  3NZU A;  4ICV A;  4IM3 A;  4PYU A;  1L2N A;  1GNU A;  2KJH B;  2Y5B B;  4A20 A;  4MSM B;  2BYF A;  3KUD B;  2J0J A;  2JT4 B;  2PE6 B;  3KYD D;  3M95 A;  2KFK A;  4HJK A;  3L10 B;  1WFY A;  2JZZ A;  2KK8 A;  2D10 A;  3M3J A;  2MW5 A;  4E3C A;  3ZRF A;  3ML9 A;  1F9J A;  4NAW B;  2L00 B;  3CF6 E;  3VDZ A;  1UZX B;  4ZYN A;  4ANW A;  2JPH A;  2NBW B;  4B9K A;  3QX1 A;  2MP2 B;  1NDD A;  2I1J A;  3AXC A;  4AOF A;  3QWZ B;  3QK0 A;  3LDZ E;  4GU2 A;  4LJO B;  4KZC A;  1P0R A;  3PRE A;  3HHM A;  1R4N I;  2DX5 B;  3VH4 B;  1TTN A;  3V6E B;  3PZD A;  3CST A;  1WGR A;  2JRI B;  3LJ3 A;  4TKN A;  2HD5 B;  3RCZ A;  4DHZ E;  1C1Y B;  4FAD A;  2KJR A;  2B3A A;  2FCS A;  2FCQ A;  4NJ6 A;  3A9J B;  1P3Q U;  2JWZ A;  1V9J A;  2R2Q A;  3HM3 A;  2C9W B;  1WZ0 A;  2M17 A;  2CU1 A;  5DPS A;  2LUE A;  4HWI B;  2WX0 A;  2IZV B;  4GDL B;  3KUC B;  3DVG X;  2N9E B;  4IW0 A;  2CR5 A;  4LCD E;  1Z2M A;  4MH0 E;  2DYB A;  4WWO A;  3QC8 B;  3H7P B;  3ZRC A;  3W1Y A;  2Z59 B;  4WAA A;  4M8M A;  4DXA B;  1OGW A;  3PV1 A;  2DAJ A;  3DVG Y;  2RPQ A;  5J18 A;  3PRP B;  1EF1 A;  3DCG A;  3OJ3 A;  4EZJ A;  3H9D A;  1GC7 A;  3RUI B;  3ZDM C;  4BKS A;  1ZKH A;  1WXA A;  2DZK A;  2M0X A;  2PE9 A;  3UIP B;  2XBB C;  1TGZ B;  1RFA A;  3GOE A;  1CMX B;  2KMC A;  5D6J B;  2GBJ A;  2MP2 A;  4BBN F;  2MRP A;  2IY1 B;  1KJT A;  2K8H A;  1WI0 A;  2BKF A;  1UBQ A;  3K9O B;  1QZE A;  4W9H A;  1OEY J;  4HDO A;  3TIX A;  2DYM A;  3NZS A;  3Q3F A;  2MSE D;  4FJZ A;  2NR2 A;  3KW5 B;  3JSV A;  2R2O A;  3APD A;  2JZ3 B;  5J2R A;  1WE7 A;  2LI5 A;  2PEA A;  4RMA A;  3N30 A;  3V62 A;  3RYT A;  1E8X A;  3WAP A;  1H8C A;  1WF9 A;  3DBR I;  3QJZ A;  1WM3 A;  2LGY A;  4N9F 4;  2GMI C;  3A9K A;  3X0W A;  5CTR C;  5BO4 B;  2L0T A;  4EUT A;  1J0G A;  4K7U A;  2YLM A;  3OJ4 B;  2AWT A;  4HDQ A;  4WJP A;  4JL9 A;  1MG8 A;  2LD9 A;  1E7V A;  2G45 B;  3DBL I;  4MEL A;  3ZDT A;  2KX0 A;  4FA6 A;  3L0W B;  3ZTC A;  3IHP C;  2Z0D B;  3PHX B;  1EO6 A;  1ZW7 A;  4G3X B;  4DHJ D;  3IBE A;  2RD0 A;  5KHQ A;  5LXI B;  3I3T B;  2IO1 B;  3UGB B;  2KFJ A;  2I1K A;  2PJH A;  4XZ4 A;  4E74 A;  2G4S A;  3PT2 B;  2FID A;  2BGF A;  2CKH B;  3B1L X;  4JIO U;  3VHT C;  2C7H A;  2ZZP B;  1WXV A;  4KV2 A;  4DHZ B;  4EKU A;  2IO3 B;  2IYD B;  2MBH A;  3CSF A;  1J19 A;  2ZVO A;  4I6P A;  4K1R B;  2K25 A;  2LGD A;  2V1Y A;  2ZNV B;  2GBR A;  1E8W A;  2KC2 A;  1BT0 A;  3KUZ A;  3P2B A;  4IUM B;  1SGH A;  2Z0E B;  2HE7 A;  3DPD A;  3O65 B;  2AL3 A;  2ZPY A;  4W9G A;  2WWZ A;  3PRM B;  1G6J A;  4MJS A;  1WR6 E;  3L17 A;  2WYQ A;  3DVN V;  2NBV B;  3A9K B;  2LGX A;  3ZNI D;  4A3O A;  1WX7 A;  2LXC A;  2MA9 B;  1RLF A;  2KAN A;  2KZR A;  3NS8 A;  4BBN C;  4RM8 A;  4J6I A;  3APF A;  3VUX A;  2KWC A;  3NOB A;  4DHJ B;  5CHV C;  1KM7 A;  3SHQ A;  1UD7 A;  4CYE A;  1Z5S B;  2NCN A;  3ZIM A;  2KJ6 A;  3QAR A;  2XK5 B;  2L76 A;  3A9J A;  5AZG A;  2LRU A;  3QHT A;  2C7N B;  3T8M A;  2L8J A;  2A5U A;  3NHE B;  1UBI A;  4HK2 A;  4MSQ B;  1WXS A;  3T9L A;  4IM0 A;  3RD2 A;  4IWP A;  1V49 A;  1WGD A;  4PS3 A;  1S1Q B;  2VRR B;  3DQV A;  4II2 B;  1UGM A;  5AZH A;  1WIA A;  1V6E A;  2ZVN A;  4DWF A;  1KOT A;  2ZJD A;  2LJ5 A;  2EMS A;  2KO3 A;  4HCP B;  5HKH A;  1U4A A;  2KDB A;  2IBI B;  3EFU A;  2LVQ A;  4MGK E;  4MM3 A;  3JSV B;  2REX A;  4IC7 B;  5G2N A;  3SD5 A;  4NAW A;  3VTU A;  1SE9 A;  1P1A A;  3N32 A;  3CMM B;  4G11 A;  1OEY A;  5G55 A;  3KH0 A;  3PGE A;  4GDL A;  4W9D A;  4K7W A;  3WAM A;  4KSK C;  2K1F A;  2KNB A;  4EZL A;  3W1S A;  4BFR A;  2BWE S;  1YIW A;  5CHF A;  1I42 A;  2CS4 A;  1Y8R C;  2NBU A;  4XX5 A;  2KHW B;  4M0W B;  1LXD A;  5DPW A;  2ZEQ A;  4LDT B;  1S3S G;  2N9X A;  3A1Q A;  1RRB A;  1V5O A;  4M8N A;  4PS7 A;  3AU5 A;  3WA0 A;  3DBH I;  3RZW C;  4KDL B;  4NJ7 A;  2LVO A;  2KTF A;  2JF5 A;  3SDL C;  2K6D B;  2KX3 A;  4JLC A;  4EEW A;  4ASW C;  4MGI E;  5DCN A;  3PVL A;  5C1Z A;  3ZTD A;  1WY8 A;  2W9N A;  2KDE B;  2N1V A;  2C60 A;  2GBN A;  3VTV A;  3MHS D;  2EMT A;  5E6N A;  1WJ4 A;  4AJW A;  2KMA A;  3ZKJ C;  4OVV A;  2DHZ A;  3EC8 A;  3A4S C;  3B08 A;  2L7R A;  3PLU A;  1WM2 A;  2KOX A;  3IG3 A;  4ANX A;  3ZW3 A;  5J17 A;  4AUQ C;  2GOW A;  2MBE A;  4W9E A;  1SIF A;  3U8Z A;  5JZE B;  3R3M A;  1V81 A;  2AL6 A;  3A4R A;  2HTH A;  4LJP B;  3ZNZ B;  3Q3J A;  1WJ6 A;  3OAW A;  4KIK B;  1HE8 A;  1P9D U;  1ZGU B;  2AEH A;  2K39 A;  3R7Q A;  1D3Z A;  1GJZ A;  2MCN B;  2M4N A;  4DDI D;  4BKS D;  2QHO A;  2M1M A;  5TR5 A;  3JVZ X;  4RM9 A;  4BVU C;  4W9C A;  3AU4 A;  3DDC B;  4WWP A;  1LFD A;  4LDT D;  2KQ7 A;  5E6P A;  2EKE C;  1JRU A;  2L3Z A;  1TBE A;  4X57 B;  4B6W A;  2FAZ A;  3V6C B;  3U30 A;  2C5L C;  4A3P A;  4MGY E;  3TJP A;  3ZUN A;  1WXM A;  4W9J A;  1M94 A;  1LM8 B;  5D94 A;  3M63 B;  3L13 A;  2MWS B;  4KIK A;  5AZF A;  4GXB A;  4GDK A;  4ZDV A;  2ZCB A;  4HLE A;  2UYZ B;  2WX1 A;  4NY0 A;  2JRH A;  2J0K A;  2N1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...