3V61A

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
THINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v61A00
2JRHA 3WAMA 3MJWA 4LDTD 4E74A 1WRDB 2RPQA 3EECA 1P98A 2OOBB 2JF5A 2K25A 3AULA 3ZNID 2L00B 1R4NI 3L13A 4GDLA 3QAQA 4DXAB 3JYUA 4MGZE 3QJZA 2AYOB 1ISNA 2KDEB 3A9JA 4HCPB 3RT3B 3UIOB 3RZFA 2M4NA 2M8SA 2OJRA 4WWNA 4BKTA 3KYCD 2M17A 3V6CB 4II2B 4RMAA 2D10A 4FBJB 4MGKE 4XC2A 1WGRA 1UELA 1WM2A 2IY0B 4PYZA 3U7DA 3ZRFA 4A3OA 1WX8A 2K39A 4NQLB 3W1SC 2KMCA 4HDQA 1A5RA 2KC1A 1TGZB 5D2MB 1LM8B 1VCBA 2IYDB 5BO4B 4ZRIA 1KM7A 2BWFA 3QHTA 2LXCA 1J0GA 1E5WA 1E8YA 4TUUA 1WFYA 2NBVB 5JZEB 1XD3B 4RM9A 3UQBA 1V81A 4W9FA 1PQSA 1UD7A 1WXSA 2J0JA 3L08A 1KJTA 2ZZPB 4NPNA 2FAZA 3AU4A 3L0WB 3RUIB 2WX1A 4DWFA 2N7EA 1WM3A 3ALBA 5G55A 5JHAA 2M0XA 2JWZA 3VQIA 1KOTA 5KHOA 5C1ZA 2ZVOA 2B3AA 2JVCA 2K1FA 1UGMA 4F7ZA 2LGYA 2FCQA 2PE6B 4RM8A 4NQKE 4DHJB 3DVNV 3H1UA 4W9HA 3VUWA 3A9KB 3R7QA 4FJVB 3APCA 2MCNB 3ZNHB 3C0RB 4DDID 3T9LA 4EZJA 1S1QB 3A33B 3VFKA 4BOZB 4LJPB 2BYEA 1E8ZA 2KZRA 3ZRCA 3V62A 1MG8A 1RLFA 3PT2B 2AEHA 4I6PA 4K7UA 5LXHA 4KVGB 2ZJDA 2PE9A 2K8HA 1P3QU 4BKGA 3NZUA 2MBQA 2MBOA 4KSKC 3P2BA 3LDZE 2FCMA 3W1YA 3HM3A 3DBRI 1NBFC 4HXDA 3PPAA 1WE7A 1P1AA 1S3SG 4HPMB 4JL9A 4M0WB 4WAAA 2G45B 2Y5BB 2NPTB 2LVOA 2KOXA 2ZPYA 3DBHI 4W9IA 1WJ4A 2AWTA 4BFRA 2CHXA 2CHWA 1YX6B 3CF6E 3RZWC 2R2OA 5DCNA 2BKFA 4TV3A 1C3TA 1V9JA 2BPSA 1V86A 1WJNA 4AJYB 5L95C 2KFJA 3VH4B 3IFWB 2N9XA 4W9JA 1OQYA 4JLCA 4MJSB 4ANUA 3EHVA 2JZ3B 2L3ZA 4GSWA 3WAOA 4B95A 1WXAA 2C7NB 3NY5A 2HTHA 5AEKB 1GUAB 2N9PC 2J7QB 2KTRB 5D6JB 2GBJA 2KMAA 3B1LX 3K9OB 3PRPB 1VD2A 3JSVB 3OLMD 3N3KB 2O6VB 2Z59B 3KUZA 1H8CA 4HCNB 2WX0A 3A4RA 3PGEA 3APFA 3D32A 2REXA 5J17A 4G0NB 2C60A 5E6PA 1V49A 2AL6A 3TIXA 1JRUA 2D3GA 3ZLZA 2J0MA 4KDIC 4K1RB 3A1QB 2BKRB 3V61A 3VDZA 4BBNC 3ENEA 1U4AA 4W9KA 1SGHA 4MH0E 5HKHA 2GBNA 5KHQA 3AI5A 2GBRA 2W9NA 3KW5B 4GIVA 2ZNVB 3M63B 2C7MB 1TTNA 2NR2A 3MTNB 4HJKA 1WMHB 2C7HA 1H4RA 3UINB 4GB9A 2N9EB 1IPGA 3QWZB 2MQJA 3QCAA 3PRMB 4MGYE 2JUOA 4DK5A 3ZIMA 2KDIA 3L17A 4ICUA 3R66C 2MBEA 2BWES 4ZYNA 4K7WA 2KX0A 2KWCA 2LVQA 3O65B 1SE9A 1Q5WB 4FJZA 5DPRA 2XK5A 4A20A 2KLGA 1ZGUB 1L2NA 4P7IA 3DQVA 5DPWA 3ZTCA 3M95A 4WWPA 2JRIB 4J6IA 4F1SA 4FULA 3VH3B 4KZCA 5CX3A 3PLVA 4HWIB 3U30A 2KANA 4AP4C 4IM0A 2GOWA 2JT4B 2NCNA 2ZCBA 3ZO5B 1EUVB 2RGFA 1C1YB 2DHZA 2GBMA 3QA8A 5EDSA 4GN1A 1Z2MA 2L0TA 4MSQB 2ZNVC 1HE8A 2DZJA 1GJZA 3M3JA 2PJHA 4PS3A 4ANXA 1WGYA 2RD0A 3QARA 4KV2A 1RAXA 4K7SA 4M8MA 5TR5A 1GC7A 1EF1A 2LGDA 3RCZA 3WALA 2PPHA 4GGQA 3HIZA 2CHZA 3VXWA 5AZGA 2V1YA 2DAJA 3EC8A 3ZTDA 3Q3JA 3TBLD 4LCDE 3APDA 3R7RA 1YD8U 2L7RA 3L16A 3OJ4B 1P9DU 4JQWC 2Z0DB 3B0AA 3I3TB 4HK2A 3NOBA 3AU5A 3PHXB 1G6JA 2EMSA 1WX9A 3DVGX 4NAWB 3IVFA 1P0RA 3LJ3A 2IO0B 2FIDA 1F9JA 4GDKA 1OGWA 1UBQA 2KTFA 2CR5A 2K6DB 2VRRB 4DHZE 4FHJA 2DZKA 5J18A 3TL5A 2KTRA 3RULA 1E7UA 3VTUA 4CYEA 2FCSA 4I6NB 2WDTB 2XBBC 4BOSC 5L83A 3PVLA 2CS4A 3B08A 3HHMA 2CU1A 3HM6X 4W9GA 1WJ6A 3ONSA 4KIKA 1K8RB 5JHBA 2LGXA 3H7PA 1RFAA 2I1KA 4GDLB 2WWZA 1EF5A 2K8BA 5CTRC 1WI0A 3WAPA 2IY1B 3V6EB 1I42A 3A9JB 4WJOA 1UH6A 1FXTB 2MP2B 2NS5A 3IBEA 3W1SA 4DBGA 3DCGA 3OAWA 4AUQC 2DZIA 2J0KA 2LRUA 4WJQA 4F8CB 1WXVA 4G50A 1WJUA 4B9KA 4ANVA 3UQAA 4BBNF 2KFKA 1WMHA 2G3QB 5D7GA 2K6QA 2G4SA 3GOEA 1CMXB 2LI5A 1TBEA 2IO3B 4W9EA 5CHFA 3NHEB 2NBWB 3X0WA 3A4SC 2KWVB 1GNUA 4FN2A 2LXAA 4IG7B 4MELA 1RRBA 2BGFA 5E6OA 3VVWB 2NVUI 4B6WA 4DHJD 2MBHA 2KHWB 4IM2A 5AZFA 1SIFA 5GMVA 2FCNA 1YIWA 1GC6A 3SU8X 3N30A 3ML9A 4NJ6A 4G3XB 3ZUNA 2MSED 2JXXA 2GBKA 2K8CA 4DDGD 2C9WB 2MWSB 3DOWA 4LDTB 3SHQA 4FA6A 1R4MI 4I6LB 1UZXB 2I1JA 3PV1A 1ZKHA 3QK0A 4IM3A 4WJPA 2MW5A 1J19A 1WIAA 2EKEC 4OVUA 4HVBA 2DENB 4EKUA 1OEYA 3DPDA 4MGIE 3EFUA 3VTWA 2L8JA 2L0FA 3ZVVA 4ANWA 2MA9B 3AXCA 3T8MA 2BYVE 3TCAA 3JVZX 2DX5B 3QX1A 3V60A 3L10B 2LJ5A 3VAWA 3ZW3A 2JPHA 3HK0A 4ICVA 3RD2A 4LJOB 2KC2A 2IO2B 2KDBA 3KYDD 2BYFA 1XQQA 1IYFA 1WX7A 1YJ1A 3WANA 4E3CA 2DYBA 2PEAA 1YX5B 3WIMA 2JY6A 3ZKJC 4JGHB 2IZVB 2C5LC 3R3MA 4X57B 4ZRJA 4JIOU 3A9KA 4W9CA 3Q3FA 1WZ0A 1EO6A 2KVRA 4BKSD 3K9PB 2O2VB 4BVUC 4XZ4A 3ZNZB 2A5UA 5CHVC 2RSUA 3VUXA 5D94A 1T0YA 2UWQA 3PTFC 3CSFA 3UIPB 1LFDA 1OTRB 2FIFA 3S2AA 1WGDA 3U8ZA 3PRZA 3M62B 4EOYA 1V5TA 3NS8A 3GZNI 4AOFA 2DYOA 3SD5A 2WYQA 3UF8A 2KXJA 1E90A 4EFOA 4XX5A 1GG3A 2JZZA 2V3SA 3NZSA 3PREA 2HE7A 1L7YA 1NI2A 1XT9B 2KJHB 2D11A 2NPTA 3RYTA 1KLVA 2MRPA 2MP2A 2N4FA 5LLIA 4ASWC 4MEMA 1TZ1A 2G4DB 2LZ6A 3BINA 4N9F4 1WR6E 4PS7A 3ZDTA 4IW0A 2KX3A 4YL8A 2LD9A 2LASA 4KZ0A 4AWJA 3SDLC 4NNJB 3JW0X 4AJWA 3QQ8B 4PS8A 2KJ6A 4MJSA 2YLMA 2ZPNA 2DAFA 5G2NA 2N7DA 5LXIB 3TJPA 1NDDA 2LVPA 3PSEB 4FLHA 4TQ1A 2ZCCA 2ZVNA 4GMVA 2MLBA 4BKSA 3TMPB 1WGHA 2MX2A 3DBLI 3JSVA 4II3B 3PS6A 2O6VA 3ECIA 3OJ3A 4ZRKA 1E8XA 4MSMB 2FUHB 3PLUA 2IO1B 2HJ8A 2R2QA 4FJYA 3ZNGC 1V2YA 4EZLA 2KNBA 3CMMB 1Z5SB 4FHKA 1X1MA 1LXDA 2MBBB 2XK5B 3DVNU 2KN5A 3KH0A 4EZKA 4KSLC 2A4ZA 1I35A 1WZ3A 3A1QA 2KKCA 5AZHA 2KLCA 2LWPA 1WXMA 4WJNA 1Q0WB 2KQ7A 2LUEA 3KUCB 3H6NA 4E71A 2EMTA 2KO3A 2RR9A 4HLEA 4URKA 1Y8RC 3DVGY 3IHPC 1AARA 1WYWB 4A3PA 3ZDMC 2YVCA 1Q1OA 2KJRA 5C23A 1QZEA 2KD0A 2KWUB 2L05A 3UGBB 2QHOA 2D07B 2ASQA 1WGGA 2D2QA 4TKNA 4FADA 1D3ZA 4CHKA 4WQOB 2KK8A 2HD5B 4EUTA 1BT0A 2UYZB 4M8NA 3PHWB 2CKHB 3H9DA 2O2VA 3X23A 2DYMA 1WY8A 1E8WA 2LRWA 2DZMA 5J2RA 3VTVA 1E7VA 2NBUA 4MM3A 4GDKB 4WWOA 2L76A 4DHZB 1WF9A 2M1MA 1V5OA 2FNJB 4IWQA 1J8CA 2Z0EB 4HPLB 1ZW7A 2IBIB 4NY0A 1V6EA 2KQSA 2N1VA 3H7SA 4W9LA 5JH5C 3DBSA 1M94A 3KVFB 4TQ0A 2KDFB 4IWOA 4NJ7A 5CHWA 4EEWA 1WR1A 4GOCA 5IAAC 2XEWA 3QIJA 3L54A 5E6NA 4KIKB 4GU2A 1YQBA 3H7PB 5DPTA 4GXBA 1IP9A 4G11A 4ZDVA 3DDCB 4HDOA 3KUDB 3ML8A 4NAWA 1LQBA 3MHSD 3N32A 4W9DA 3QC8B 4IWPA 4IC7B 4K81A 4PYUA 2ZEQA 1WE6A 3VHTC 5IA7A 1V80A 5DPSA 3VUYA 2V4LA 4MDKE 2BF8B 1WH3A 5FR6A 2KFKB 2AL3A 2N1WA 3BY4B 2GMIC 4OVVA 3CSTA 2O6VD 4KDLB 3IG3A 3WA0A 4CO7A 1UBIA 3PZDA 1OEYJ 4IUMB
chains in the Genus database with same CATH superfamily
2JRHA 4XDDA 2B76B 1NENB 3EECA 2L00B 1R4NI 3L13A 3PO0A 4MGZE 1YJIA 3HVZA 2DNFA 1ISNA 2KDEB 4HCPB 4USAA 3RZFA 2PW9A 2OJRA 1E6EB 2M17A 4GLSC 4WIPA 3AN1A 1WM2A 2IY0B 3U7DA 3ZGZA 4HDQA 2KC1A 4RGNA 2RPVA 2QSDA 4KGRA 3TSSA 2AQ3B 4RM9A 3RNFC 4N59A 4W9FA 1ZPSA 5AUKA 1FEHA 1UD7A 1D5MC 3Q8BA 4NPNA 2D3CA 3RUIB 3ALBA 1KOTA 2JWZA 1CK1A 3Q14C 1K52A 2B3AA 2K1FA 3LB8C 1UGMA 2FCQA 4RM8A 3DVNV 2OJWA 3H1UA 3APCA 4WWMA 4N6EB 2BYEA 1E8ZA 3V62A 3ZJTA 1RLFA 2ZW0A 2AEHA 4KVGB 3GE3C 2BB6A 2PE9A 4BKGA 3NZUA 4YXDB 4KSKC 3W1YA 1TS4A 1FRDA 1S3SG 3T3NA 2NPTB 2XN9C 2PMVA 1WJ4A 5DCNA 2BPSA 1JWBD 4REZA 2TSSA 4W9JA 1OQYA 2NTTA 4B95A 2C7NB 1F1HA 1GUAB 1IGDA 1N5WA 2W3SA 1KH0A 1VD2A 3OLMD 2DBYA 1QT9A 1ET9A 3LYYA 1H8CA 4HCNB 2WX0A 4BAXA 3PGEA 3APFA 1QOGA 5HHDG 2REXA 5J17A 1CQVA 1FO4A 1JRPA 3Q6BA 4OZBA 4KDIC 3A1QB 3V61A 4BBNC 2V3NA 1SGHA 4W9KA 2GBNA 5KHQA 3AI5A 2GBRA 2W9NA 3M63B 1TTNA 2QMTA 1QLBB 2NR2A 2PTLA 1C4PA 1H4RA 2N9LA 4GB9A 1YMHE 3QWZB 1IPGA 3R66C 3EUB2 2MBEA 4LNIA 4ZYNA 4J3OD 4K7WA 2LVQA 3O65B 1SE9A 4A20A 3R8BA 3DBLB 2K9XA 5C2TB 4P7IA 2JRIB 4J6IA 1FFUA 4FULA 3VH3B 1GB1A 3NVZA 2VH1A 2NCNA 5EDSA 2L0TA 1L6VA 4PS3A 1WGYA 4HPPA 4K7SA 1EF1A 3RCZA 3NVVA 2CHZA 4XWWA 1T3QA 3ZTDA 3R7RA 3DBRB 4L23A 2DWQA 4HK2A 3NOBA 3PHXB 4O1NA 1P0RA 1FNWA 2IO0B 3DBHB 1MHHE 3BVZA 2H88B 4R3DA 1IBXA 2VRRB 3VRBB 1EU4A 4M02A 1JCKB 3B08A 1WGKA 3HM6X 1K8RB 5JHBA 2I1KA 4GDLB 2IY1B 4RF0A 3A9JB 4ITKA 1FXTB 4DBGA 4K3BA 3CWIA 2J53A 4WJQA 1V1PA 1ZXIA 2KFKA 2G3QB 3DHIC 2K6QA 3RNCC 3GOEA 4W9EA 2KWVB 1GNUA 2GLSA 4MELA 1EU3A 3BZDB 3VVWB 2MBHA 5TSSA 2KHWB 2CJNA 2FCNA 3B2FA 3N30A 3ML9A 3ZUNA 2GBKA 2RDBC 2BS4B 5HI1A 1HZ6A 3SHQA 4FA6A 3AE9B 1UZXB 3PV1A 4PK1A 1ZXHA 4OVUA 1JROA 3HRDD 3DPDA 3EFUA 2L8JA 2RDHA 3ZVVA 2MA9B 3AXCA 2BYVE 3VAWA 1UF0A 3RD2A 2BYFA 1TY2A 3WANA 2K3UA 3IT4B 3MC9A 2IZVB 3R3MA 1TS5A 2QILA 4X57B 4ZRJA 4W9CA 1SB3C 4BKSD 3K9PB 2PLPA 4XZ4A 2INPE 2A5UA 2RSUA 3V05A 3PTFC 3CSFA 3UIPB 1LFDA 2QCZA 3U8ZA 3NS8A 4AOFA 4C7ZA 2JZZA 1N61A 3BWUD 2WXQA 4Q2JA 2NPTA 1AN8A 4ZYSA 4P1CC 3EA6A 4IW0A 2KX3A 2M0AA 2LASA 3SDLC 1HTQA 3BYYB 2ACZB 3RPFC 2YLMA 2ZPNA 1F0ZA 4FLHA 4TQ1A 2ZCCA 1J7CA 4BKSA 1QOFA 2EKIA 4II3B 3ECIA 2IO1B 2R2QA 3ZNGC 1V2YA 2L83A 3CMMB 1XLQA 4FHKA 3DVNU 4ACFA 4KSLC 3U52E 2WU2B 1I35A 5IN7A 3A1QA 2IJ0A 2KLCA 1MPEA 1WXMA 4E71A 3KUCB 1TJEA 1DGJA 3H6NA 2RR9A 1Y8RC 1C76A 3IHPC 2WXMA 2YVCA 3ZDMC 4DXFA 1Q1OA 2KD0A 2KWUB 2L05A 4MH8A 3UGBB 3UI3A 1WGGA 2D2QA 3AM9A 3RNBC 1LO5D 2KK8A 4EUTA 1BT0A 4RH6A 1E8WA 2LRWA 3KWVA 3IT6B 1NYRA 5J2RA 3FILB 2WXGA 4MM3A 4GDKB 1D4BA 4LK0M 4ZRQA 1YN4A 4PT5A 1J8CA 4HPLB 4NY0A 2KQSA 3W9CB 5JH5C 4D2KA 4TQ0A 4NJ7A 4WURA 4EEWA 4GOCA 2LHDA 4KIKB 4GU2A 3BK1A 5DPTA 3MFGA 1IP9A 2V3PA 4C7YA 3MHSD 2INDC 4IWPA 4K81A 2ZEQA 1WE6A 4RFBA 2SEBD 2V4LA 1UGJA 2AL3A 2N1WA 3CSTA 1GOZA 2QEJC 4KDLB 3WA0A 1UBIA 1ENFA 3PZDA 4IUMB 3WAMA 1PDXA 2V0GA 1WRDB 2RPQA 2OOBB 2K25A 3AULA 1Y56A 4GDLA 1I4HA 3A9JA 3RT3B 2M4NA 3ZQ4A 2L1AA 2NMQA 4BKTA 3V6CB 4LNNA 4II2B 4FBJB 2WXRA 4A3OA 4PYZA 1A5RA 1VCBA 4H2AA 1TIFA 2IYDB 1KM7A 1J0GA 2LXCA 1B9RA 1E5WA 4TUUA 3TEZA 4HEA1 1WRIA 2JXTA 3UQBA 4EE2A 2WLBA 3L08A 1KJTA 2ZZPB 3AU4A 2Y5CA 2WX1A 4DWFA 5JHAA 1L4DB 5KHOA 5C1ZA 1NVID 2ZVOA 4HKQA 1AWDA 4W9HA 3R7QA 4FJVB 4DDID 3T9LA 4ZOHC 1S1QB 3A33B 1YN3A 1MG8A 3PT2B 5LXHA 2ZJDA 2K8HA 3KLSX 3P1MA 2MBOA 3Q8FA 4C4VB 1NEKB 4FXCA 2FCMA 4RGTA 3PPAA 4WAAA 1SE3A 4JL9A 4M0WB 2G45B 2JWUA 2KACA 2ZPYA 1JWSD 2CHWA 1MFWA 2FE8A 2MEKA 4DXGA 2X38A 3BIID 1Q10A 1WJNA 4AJYB 5L95C 4NJCA 1PFDA 3E9SA 2N9XA 1F77A 4MJSB 2QIEB 2JZ3B 2L3ZA 3WAOA 1WXAA 2HTHA 1LGRA 2VZKB 2N9PC 1FD6A 2J7QB 3K9OB 4XDCA 3PRPB 4XWTA 3RN9C 3JSVB 2G1EA 3N3KB 2O6VB 3RMKC 4CQNA 4QAYA 3P4QB 3A4RA 3D32A 1MHXA 2HDEA 1R4NB 4G0NB 5H92C 3TIXA 3MHZA 1JRUA 2D3GA 2KDMA 3RNAC 2J0MA 2BKRB 3VDZA 3C8YA 1P7EA 3Q3NC 1TKEA 1V1PB 2WDVB 4MH0E 5HKHA 1C9FA 2I38A 3KW5B 1PGBA 4GIVA 3MTNB 2I2YA 1YQ3B 2C7HA 3UINB 5IP4D 1YN5A 2N9EB 4MGYE 2JUOA 3L17A 3L4PA 4XE0A 2BWES 3MC0B 1D5ZC 2GRIA 4MT5A 3DQVA 3M95A 4WWPA 4AQ7A 4XYCA 3LXFA 4KZCA 3NVWA 4IM0A 1YNTE 2ZCBA 1C1YB 2DHZA 2GBMA 1Z2MA 4IOIE 1GJZA 3M3JA 1SBBB 2MJDA 1RAXA 1SJED 5E6JA 4GGQA 1KLUD 1FNUA 5AZGA 3Q3JA 3OJ4B 1P9DU 3B0AA 1G6JA 4JE3B 2EMSA 1WX9A 4NAWB 3FILA 2FIDA 4GDKA 1OGWA 2KTFA 1EM7A 2BS2B 1KLGD 2CR5A 4AS1A 4DHZE 5J18A 2Y3AA 2KTRA 4TSSA 3RULA 3VTUA 4CYEA 2FCSA 3PZ7A 2WDTB 2WXJA 2XBBC 4B0MA 4ARIA 2CU1A 1WJ6A 4KIKA 2WWZA 2K8BA 3GP7A 1XF5L 1YJJA 3W5UB 3W1SA 3KQ4A 2DZIA 2J0KA 2LRUA 4F8CB 5BYRA 1I4QA 3UQAA 1WMHA 3NUHB 3AE8B 5D7GA 2G4SA 4LNKA 5BMIA 1E0ZA 1TBEA 1FPYA 2NBWB 3NHEB 3X0WA 2J52A 2LXAA 3NS1A 2JQRB 3RNGC 5E6OA 2NVUI 4IKGA 1ZDVA 5AZFA 4A6QA 1A70A 2MSED 1QILA 2JXXA 2K8CA 1N6ZA 2MWSB 3DOWA 1TT5B 1TKGA 2MW5A 4WJPA 1J19A 3U7ZA 2EKEC 3I9V1 2DENB 3N1XC 4EKUA 1L5PA 2R61A 3Q8CA 3T8MA 1AW7A 2UU7A 3JVZX 4YTMB 2FUG1 3V60A 3ZW3A 2LJ5A 4ICVA 2KDBA 3KYDD 3R2IA 1N63A 3KWLA 1IYFA 1YJ1A 1GAQB 2DLBA 2DYBA 2PEAA 2JY6A 3ZKJC 4JGHB 2E3TA 1FMAD 1WZ0A 1EO6A 2KVRA 4BVUC 1PYWD 2PKOA 1SF0A 3SFEB 1T0YA 4MM3B 1KF6B 3S2AA 4YWGG 3P4RB 3PRZA 3M62B 3V3XA 4C4VA 2WYQA 3AE1B 4EFOA 2LEKA 2V3SA 3AMZA 4WH4A 2HE7A 1L7YA 4M0WA 4ARCA 2WU5B 2MRPA 5HFYA 1E9MA 2MP2A 2GI9A 2LMCA 3AE6B 5LLIA 4MEMA 1WR6E 1HXYD 3OWEB 4C80A 4HJGE 1DOYA 2RMMA 4NNJB 1XLPA 2AQ2B 3JW0X 4AJWA 1VDVA 2KJ6A 4MJSA 2DAFA 5LXIB 3TJPA 3PSEB 4GMVA 2MLBA 3MP9A 2JYTA 3DBLI 3JSVA 2K22A 3BK2A 3PS6A 2O6VA 3ZXRA 3PLUA 2HJ8A 4FJYA 4EZLA 1MG4A 2KQ4X 1X1MA 2XK5B 2MBBB 1XCTL 4LNFA 3I63C 5AZHA 4YTPB 2AX5A 4WJNA 5GXGB 1WYGA 5IOIA 3DVGY 4A3PA 2OHFA 2KJRA 3BVGA 3RNEC 2ASQA 2KVZA 4TKNA 1I4RA 3TEWA 1STEA 4LLGM 3I5JC 1N5XA 1ROEA 2CKHB 2O2VA 3X23A 1WY8A 1BMLC 2M19A 4WWOA 2L76A 4DHZB 1WF9A 2D3AA 1TS3A 1V5OA 2IBIB 3H7SA 3DBSA 1C4CA 2LUMA 1PGXA 2GB1A 2BS3B 1VLBA 1OQQA 5IAAC 5E6NA 4M01A 1SE2A 3H7PB 4G11A 3U4EG 3DDCB 4HDOA 3KUDB 2PVOD 4NAWA 1LQBA 3N32A 5FR3A 1WWTA 3OG5A 5BMHA 4IC7B 4PYUA 2PIAA 3VHTC 5DPSA 4MDKE 2BF8B 1WH3A 5FR6A 3BY4B 5MPOA 3ZYYX 5G5GA 4CO7A 3IG3A 3MJWA 3IAM1 4E74A 4ZHPA 1V1OA 1QF6A 1P98A 3AE5B 2WDRB 3ZNID 4DXAB 3QAQA 2ON8A 1JWUD 5T8IA 3UIOB 2M8SA 1VZ8A 2BT6A 4WWNA 2IDYA 1ZE3D 3KYCD 2D10A 3W2DA 4XC2A 1WGRA 1C78A 4NQLB 4TMAB 3W1SC 3E56A 3NJTA 2YEPB 5D2MB 3P42A 4ZRIA 3QHTA 2WP9B 1E8YA 5G5HA 1WFYA 1JW9D 2NBVB 1XD3B 5JZEB 2OEDA 1V81A 4YT0B 1C77A 1DOIA 1PQSA 2BTEA 2J0JA 2FAZA 3U2SC 5G55A 2M0XA 3VR9B 3ZJVA 2HTME 2PE6B 4DHJB 2MJ3A 3A9KB 3VUWA 3C0RB 1DYQA 4A55A 3VFKA 1PGAA 4LJPB 2L52A 4I6PA 1P3QU 2ICIA 5JXVA 1ZUD2 3LDZE 1T0QC 1GPXA 3NVYA 3HM3A 2RDGA 2N9KA 1NBFC 1JWAD 3URYA 4HXDA 3TEYA 4HPMB 4OZCA 2KOXA 4W9IA 2AWTA 1TYGB 2BBCA 2CHXA 1YX6B 1NI3A 2R2OA 2E6XA 4NAMA 2BKFA 4TV3A 1V86A 2KFJA 4JLCA 5AEKB 4ZRPA 2KTRB 2GBJA 2KMAA 1FCLA 3ZJUA 5LNK1 2WS3B 1L0YB 3KUZA 3GZNB 3Q3MC 3AEFB 3TUOA 5E6PA 1V49A 3ZLZA 3P4PB 4YSYB 2INCC 1F52A 3ENEA 1TKYA 1R7SA 1E7PB 2ZNVB 4RGOS 1WMHB 2WXFA 1FCCC 3QCAA 3ZIMA 1CJEA 1FXAA 1Q5WB 4FJZA 2XK5A 5DPWA 4KGTA 4F1SA 1I7HA 1XXGA 5CX3A 3PLVA 3U30A 1N60A 3GB1A 2KANA 1D5XC 2GOWA 1EUVB 2RGFA 1HE8A 2PJHA 4KV2A 4WQMA 4M8MA 2LGDA 3IXSA 1UWXA 2PPHA 3VXWA 3N20C 2V1YA 2CU3A 3APDA 3I3TB 3AU5A 2QJLA 3DVGX 3IVFA 3LJ3A 1F9JA 1VJKA 4FHJA 3TL5A 4L1BA 2J4XA 4HRSA 2WXKA 4YSXB 1E7UA 1T0RC 4I6NB 3FKYA 2WXLA 5L83A 2CS4A 4XGAB 3HHMA 5HG2A 4W9GA 3BVMA 3ONSA 3H7PA 4HKZE 1EF5A 1WI0A 1I42A 1YOVB 2BYTA 2MP2B 3IBEA 2IGDA 3DCGA 4AUQC 3Q8AA 4G50A 4B9KA 3DWGC 2BB5A 4ANVA 4BBNF 2LI5A 2IO3B 3A4SC 3DHHC 4FN2A 2Q5WD 4DHJD 3B9JA 4IM2A 1RYJA 1SIFA 1OFFA 3GE8C 1FNVA 2C9WB 2V4IB 2IGHA 4LDTB 1R4MI 2I1JA 1ZKHA 1T5XD 2H89B 1XO3A 4HVBA 5IKCM 1OEYA 1ZP0B 4MGIE 2BVCA 3VTWA 2G9HD 4ANWA 3R2TA 2WXPA 3TCAA 2DX5B 4LTUA 1I4XA 3HK0A 1RFKA 2FBWB 2IO2B 1K50A 4A90A 4RGMA 1YX5B 3WIMA 4ZHOA 3CIRB 3C19A 4KX6B 2C5LC 1XCQL 3A9KA 3Q3FA 1DOXA 2O2VB 3W5VB 1VRAB 1K51A 3ZNZB 4B0EA 5CHVC 3VUXA 5D94A 1L6UA 1HTOA 1OTRB 5D3IB 1WGDA 4EOYA 1HA5A 2YEPF 3P63A 2WXNA 1E90A 1GG3A 2LGSA 3PREA 1NI2A 1QOAA 2KJHB 2D11A 3RYTA 1KLVA 1TS2A 4ASWC 1J7BA 1TZ1A 2G4DB 4N9F4 5BYSA 4NZLB 4YL8A 2LD9A 4KZ0A 4AWJA 3TEXA 1QOBA 5G2NA 2N7DA 1VZ7A 1EWYC 3TMPB 2MX2A 4S17A 1HEZE 4ZRKA 1E8XA 2FUHB 1UWMA 1Z5SB 1FFVA 2WXHA 4EZKA 3KH0A 3B2GA 3GS2A 2A4ZA 1WZ3A 2KKCA 2K0PA 2EELA 5EE0A 5EE3A 1Q0WB 2LUEA 2EMTA 2MHJA 3AEDB 4HLEA 4URKA 3ETRA 5C23A 1QZEA 5C3JB 2QHOA 2D07B 3IAS1 3AECB 4P6VF 4CHKA 4WQOB 2UYZB 4M8NA 1V8CA 3H9DA 1UUPA 3VTVA 1E7VA 2NBUA 3I57A 1M4VA 2FNJB 2Z0EB 1ZW7A 2HJ1A 1FM0D 1SIJA 2KDFB 4IWOA 2KWDA 3QIJA 3L54A 1YQBA 4K3CA 4ZDVA 3EGRA 3ML8A 1KTKA 2VH2A 3QC8B 5IA7A 2VZKD 3VUYA 2GMIC 1BUIC 2O6VD 4HROA 5FKAC 1J7AA 1OEYJ 5DPRA 4LDTD 4L2YA 2WXOA 2BW2A 2JF5A 2JX5A 3T3OA 3JYUA 3QJZA 2AYOB 1WSPA 1F2RC 1FRRA 1ZDXA 4RMAA 3NZ3A 4MGKE 1UELA 3ZRFA 4YSZB 1WX8A 2K39A 2KMCA 1TGZB 1LM8B 5AUIA 2JYEA 5BO4B 2BWFA 3Q3OC 4IDIA 3AB5A 2W54A 1WXSA 4S0RA 4C56C 5EE9A 1XEEA 3ABVB 3L0WB 2N7EA 1WM3A 5BYQA 3VQIA 2M56B 2JVCA 4F7ZA 2LGYA 1ET6A 4NQKE 1N62A 1JWMD 2N0SB 2MCNB 3BYTB 3ZNHB 4EZJA 1KRHA 4BOZB 3AE7B 2KZRA 3ZRCA 1RWSA 4K7UA 1ESFA 2CJOA 1SE4A 2BQQA 2MBQA 3P2BA 3DBRI 1L0XB 4JWSC 1C4AA 1WE7A 1P1AA 3SFDB 2Y5BB 2W3RA 2LVOA 1JALA 3DBHI 1JQ4A 4BFRA 3CF6E 3RZWC 3NRZA 1NYQA 2N7JA 1C3TA 1V9JA 4C00A 1I4GA 3Q8EA 3VH4B 3IFWB 3VRAB 1SJHD 2SAKA 4ANUA 3EHVA 2KYWA 4GSWA 4OHJA 3NY5A 3H8HA 2WHIA 5D6JB 3B1LX 4JPSA 2Z59B 3AEBB 5IO9A 2LJIA 2C60A 3P4SB 1MJDA 2AL6A 4K1RB 2JZPA 4RCOA 3SEBA 1U4AA 2C7MB 4HJKA 2MQJA 3PRMB 1TY0A 4DK5A 2KDIA 4ICUA 1SXTA 2MJEA 2KX0A 2KWCA 4DQOC 1VZ6A 2MH7A 1WXQA 3MJ5A 5BMGA 2KLGA 1VR9A 3WCQA 1EWCA 1ZGUB 1L2NA 1KFYB 3AE4B 1P7FA 3ZTCA 5EE1A 2JSVX 1BXTA 3AH7A 4HWIB 4JX1C 4AP4C 2JT4B 3ZO5B 3RI7C 3QA8A 2INNE 4GN1A 1F2RI 4MSQB 2ZNVC 2DZJA 4ANXA 2RD0A 3QARA 1D6EC 2Y5PA 5TR5A 1GC7A 2WDQB 3WALA 4US9A 3HIZA 2DAJA 3EC8A 4A8XC 3TBLD 4LCDE 1YD8U 2L7RA 3L16A 1RM6C 4JQWC 2Z0DB 4OVZA 1L4ZB 3AEEB 1QKZA 1UBQA 3N1ZC 1GB4A 4LNOA 4WAFA 2K6DB 3PZ8A 2DZKA 2JU6X 2KN4A 3Q2AC 1PUTA 4BOSC 3PVLA 1HZ5A 1MI0A 1FXIA 4KKJA 3Q69A 2LGXA 3FAHA 1RFAA 2AQ1B 2WQYB 5CTRC 4US8A 3WAPA 3V6EB 4WJOA 1UH6A 2QC8A 1SSNA 2NS5A 2QDFA 3ZXVA 3OAWA 1AYFA 1WXVA 1WJUA 2WGSA 4P16A 4KGSA 1CMXB 5CHFA 1XLOA 3AEAB 4IG7B 1RRBA 2BGFA 1L0VB 1TZOA 4B6WA 1T0SC 5GMVA 1YIWA 1GC6A 3SU8X 4NJ6A 4G3XB 4DDGD 4P1BC 2K5PA 4I6LB 2W82A 2L32A 2XNAC 3QK0A 4IM3A 3VR8B 1JMLA 1IUEA 3MC8A 1WIAA 3DHGC 4A9AA 2L0FA 1HQRD 2LHEA 3QX1A 3L10B 4OW0A 2JPHA 3N9YC 4LJOB 2KC2A 3HUIA 2NTSA 2V9HA 3AV8A 1XQQA 1WX7A 1UNSA 4E3CA 5H8YE 4JIOU 5FK9C 4MACA 1CZPA 2UWQA 2D5GA 2FIFA 2LFIA 3RFZB 1K53A 1I4PA 1V97A 1V5TA 3GZNI 2DYOA 3SD5A 3UF8A 2KXJA 4XX5A 2Z8LA 3NZSA 1XT9B 3N1YC 2X8XX 2N4FA 3SR6A 3NG0A 2LZ6A 3BINA 1YQ4B 4PS7A 3ZDTA 1C79A 4RNAA 3QQ8B 4PS8A 1NDDA 1XLNA 2LVPA 4N58A 2W55A 2ZVNA 1WGHA 1ACCA 3DWMA 3OJ3A 4MSMB 2KNBA 3AE3B 1E10A 2KAJA 3J9CA 4UDUC 1LXDA 4OZAA 2KN5A 2KT7A 2LWPA 4YTNB 1B1ZA 2KQ7A 1R4MB 2KO3A 1MVKA 2ZW1A 5I4DA 1AARA 1WYWB 2IGGA 2WXIA 2ONQA 1SEBD 4BZAA 3AE2B 4FADA 2J42A 1D3ZA 2HD5B 1OQRA 3PHWB 2LGIA 1T6BX 2DYMA 2DZMA 2M1MA 1IBXB 2IPKD 4IWQA 2PVGC 4W9LA 1V6EA 2N1VA 1M94A 3FC4A 3KVFB 5CHWA 1FIQA 1WR1A 4M00A 3AEGB 2XEWA 1IGCA 3EFCA 3HVDA 4GXBA 2D3BA 4KKIA 2KMMA 1QQRA 3O13A 4W9DA 4RF1A 1V80A 2KFKB 4JWUC 4OVVA 2WNMA 5D3DA 1ZOYB
chains in the Genus database with same CATH topology
2JRHA 3WAMA 3MJWA 4LDTD 4E74A 1WRDB 2RPQA 3EECA 1P98A 2OOBB 2JF5A 2K25A 3AULA 3ZNID 2L00B 1R4NI 3L13A 4GDLA 3QAQA 4DXAB 3JYUA 4MGZE 3QJZA 2AYOB 1ISNA 2KDEB 3A9JA 4HCPB 3RT3B 3UIOB 3RZFA 2M4NA 2M8SA 2OJRA 4WWNA 4BKTA 3KYCD 2M17A 3V6CB 4II2B 4RMAA 2D10A 4FBJB 4MGKE 4XC2A 1WGRA 1UELA 1WM2A 2IY0B 4PYZA 3U7DA 3ZRFA 4A3OA 1WX8A 2K39A 4NQLB 3W1SC 2KMCA 4HDQA 1A5RA 2KC1A 1TGZB 5D2MB 1LM8B 1VCBA 2IYDB 5BO4B 4ZRIA 1KM7A 2BWFA 3QHTA 2LXCA 1J0GA 1E5WA 1E8YA 4TUUA 1WFYA 2NBVB 5JZEB 1XD3B 4RM9A 3UQBA 1V81A 4W9FA 1PQSA 1UD7A 1WXSA 2J0JA 3L08A 1KJTA 2ZZPB 4NPNA 2FAZA 3AU4A 3L0WB 3RUIB 2WX1A 4DWFA 2N7EA 1WM3A 3ALBA 5G55A 5JHAA 2M0XA 2JWZA 3VQIA 1KOTA 5KHOA 5C1ZA 2ZVOA 2B3AA 2JVCA 2K1FA 1UGMA 4F7ZA 2LGYA 2FCQA 2PE6B 4RM8A 4NQKE 4DHJB 3DVNV 3H1UA 4W9HA 3VUWA 3A9KB 3R7QA 4FJVB 3APCA 2MCNB 3ZNHB 3C0RB 4DDID 3T9LA 4EZJA 1S1QB 3A33B 3VFKA 4BOZB 4LJPB 2BYEA 1E8ZA 2KZRA 3ZRCA 3V62A 1MG8A 1RLFA 3PT2B 2AEHA 4I6PA 4K7UA 5LXHA 4KVGB 2ZJDA 2PE9A 2K8HA 1P3QU 4BKGA 3NZUA 2MBQA 2MBOA 4KSKC 3P2BA 3LDZE 2FCMA 3W1YA 3HM3A 3DBRI 1NBFC 4HXDA 3PPAA 1WE7A 1P1AA 1S3SG 4HPMB 4JL9A 4M0WB 4WAAA 2G45B 2Y5BB 2NPTB 2LVOA 2KOXA 2ZPYA 3DBHI 4W9IA 1WJ4A 2AWTA 4BFRA 2CHXA 2CHWA 1YX6B 3CF6E 3RZWC 2R2OA 5DCNA 2BKFA 4TV3A 1C3TA 1V9JA 2BPSA 1V86A 1WJNA 4AJYB 5L95C 2KFJA 3VH4B 3IFWB 2N9XA 4W9JA 1OQYA 4JLCA 4MJSB 4ANUA 3EHVA 2JZ3B 2L3ZA 4GSWA 3WAOA 4B95A 1WXAA 2C7NB 3NY5A 2HTHA 5AEKB 1GUAB 2N9PC 2J7QB 2KTRB 5D6JB 2GBJA 2KMAA 3B1LX 3K9OB 3PRPB 1VD2A 3JSVB 3OLMD 3N3KB 2O6VB 2Z59B 3KUZA 1H8CA 4HCNB 2WX0A 3A4RA 3PGEA 3APFA 3D32A 2REXA 5J17A 4G0NB 2C60A 5E6PA 1V49A 2AL6A 3TIXA 1JRUA 2D3GA 3ZLZA 2J0MA 4KDIC 4K1RB 3A1QB 2BKRB 3V61A 3VDZA 4BBNC 3ENEA 1U4AA 4W9KA 1SGHA 4MH0E 5HKHA 2GBNA 5KHQA 3AI5A 2GBRA 2W9NA 3KW5B 4GIVA 2ZNVB 3M63B 2C7MB 1TTNA 2NR2A 3MTNB 4HJKA 1WMHB 2C7HA 1H4RA 3UINB 4GB9A 2N9EB 1IPGA 3QWZB 2MQJA 3QCAA 3PRMB 4MGYE 2JUOA 4DK5A 3ZIMA 2KDIA 3L17A 4ICUA 3R66C 2MBEA 2BWES 4ZYNA 4K7WA 2KX0A 2KWCA 2LVQA 3O65B 1SE9A 1Q5WB 4FJZA 5DPRA 2XK5A 4A20A 2KLGA 1ZGUB 1L2NA 4P7IA 3DQVA 5DPWA 3ZTCA 3M95A 4WWPA 2JRIB 4J6IA 4F1SA 4FULA 3VH3B 4KZCA 5CX3A 3PLVA 4HWIB 3U30A 2KANA 4AP4C 4IM0A 2GOWA 2JT4B 2NCNA 2ZCBA 3ZO5B 1EUVB 2RGFA 1C1YB 2DHZA 2GBMA 3QA8A 5EDSA 4GN1A 1Z2MA 2L0TA 4MSQB 2ZNVC 1HE8A 2DZJA 1GJZA 3M3JA 2PJHA 4PS3A 4ANXA 1WGYA 2RD0A 3QARA 4KV2A 1RAXA 4K7SA 4M8MA 5TR5A 1GC7A 1EF1A 2LGDA 3RCZA 3WALA 2PPHA 4GGQA 3HIZA 2CHZA 3VXWA 5AZGA 2V1YA 2DAJA 3EC8A 3ZTDA 3Q3JA 3TBLD 4LCDE 3APDA 3R7RA 1YD8U 2L7RA 3L16A 3OJ4B 1P9DU 4JQWC 2Z0DB 3B0AA 3I3TB 4HK2A 3NOBA 3AU5A 3PHXB 1G6JA 2EMSA 1WX9A 3DVGX 4NAWB 3IVFA 1P0RA 3LJ3A 2IO0B 2FIDA 1F9JA 4GDKA 1OGWA 1UBQA 2KTFA 2CR5A 2K6DB 2VRRB 4DHZE 4FHJA 2DZKA 5J18A 3TL5A 2KTRA 3RULA 1E7UA 3VTUA 4CYEA 2FCSA 4I6NB 2WDTB 2XBBC 4BOSC 5L83A 3PVLA 2CS4A 3B08A 3HHMA 2CU1A 3HM6X 4W9GA 1WJ6A 3ONSA 4KIKA 1K8RB 5JHBA 2LGXA 3H7PA 1RFAA 2I1KA 4GDLB 2WWZA 1EF5A 2K8BA 5CTRC 1WI0A 3WAPA 2IY1B 3V6EB 1I42A 3A9JB 4WJOA 1UH6A 1FXTB 2MP2B 2NS5A 3IBEA 3W1SA 4DBGA 3DCGA 3OAWA 4AUQC 2DZIA 2J0KA 2LRUA 4WJQA 4F8CB 1WXVA 4G50A 1WJUA 4B9KA 4ANVA 3UQAA 4BBNF 2KFKA 1WMHA 2G3QB 5D7GA 2K6QA 2G4SA 3GOEA 1CMXB 2LI5A 1TBEA 2IO3B 4W9EA 5CHFA 3NHEB 2NBWB 3X0WA 3A4SC 2KWVB 1GNUA 4FN2A 2LXAA 4IG7B 4MELA 1RRBA 2BGFA 5E6OA 3VVWB 2NVUI 4B6WA 4DHJD 2MBHA 2KHWB 4IM2A 5AZFA 1SIFA 5GMVA 2FCNA 1YIWA 1GC6A 3SU8X 3N30A 3ML9A 4NJ6A 4G3XB 3ZUNA 2MSED 2JXXA 2GBKA 2K8CA 4DDGD 2C9WB 2MWSB 3DOWA 4LDTB 3SHQA 4FA6A 1R4MI 4I6LB 1UZXB 2I1JA 3PV1A 1ZKHA 3QK0A 4IM3A 4WJPA 2MW5A 1J19A 1WIAA 2EKEC 4OVUA 4HVBA 2DENB 4EKUA 1OEYA 3DPDA 4MGIE 3EFUA 3VTWA 2L8JA 2L0FA 3ZVVA 4ANWA 2MA9B 3AXCA 3T8MA 2BYVE 3TCAA 3JVZX 2DX5B 3QX1A 3V60A 3L10B 2LJ5A 3VAWA 3ZW3A 2JPHA 3HK0A 4ICVA 3RD2A 4LJOB 2KC2A 2IO2B 2KDBA 3KYDD 2BYFA 1XQQA 1IYFA 1WX7A 1YJ1A 3WANA 4E3CA 2DYBA 2PEAA 1YX5B 3WIMA 2JY6A 3ZKJC 4JGHB 2IZVB 2C5LC 3R3MA 4X57B 4ZRJA 4JIOU 3A9KA 4W9CA 3Q3FA 1WZ0A 1EO6A 2KVRA 4BKSD 3K9PB 2O2VB 4BVUC 4XZ4A 3ZNZB 2A5UA 5CHVC 2RSUA 3VUXA 5D94A 1T0YA 2UWQA 3PTFC 3CSFA 3UIPB 1LFDA 1OTRB 2FIFA 3S2AA 1WGDA 3U8ZA 3PRZA 3M62B 4EOYA 1V5TA 3NS8A 3GZNI 4AOFA 2DYOA 3SD5A 2WYQA 3UF8A 2KXJA 1E90A 4EFOA 4XX5A 1GG3A 2JZZA 2V3SA 3NZSA 3PREA 2HE7A 1L7YA 1NI2A 1XT9B 2KJHB 2D11A 2NPTA 3RYTA 1KLVA 2MRPA 2MP2A 2N4FA 5LLIA 4ASWC 4MEMA 1TZ1A 2G4DB 2LZ6A 3BINA 4N9F4 1WR6E 4PS7A 3ZDTA 4IW0A 2KX3A 4YL8A 2LD9A 2LASA 4KZ0A 4AWJA 3SDLC 4NNJB 3JW0X 4AJWA 3QQ8B 4PS8A 2KJ6A 4MJSA 2YLMA 2ZPNA 2DAFA 5G2NA 2N7DA 5LXIB 3TJPA 1NDDA 2LVPA 3PSEB 4FLHA 4TQ1A 2ZCCA 2ZVNA 4GMVA 2MLBA 4BKSA 3TMPB 1WGHA 2MX2A 3DBLI 3JSVA 4II3B 3PS6A 2O6VA 3ECIA 3OJ3A 4ZRKA 1E8XA 4MSMB 2FUHB 3PLUA 2IO1B 2HJ8A 2R2QA 4FJYA 3ZNGC 1V2YA 4EZLA 2KNBA 3CMMB 1Z5SB 4FHKA 1X1MA 1LXDA 2MBBB 2XK5B 3DVNU 2KN5A 3KH0A 4EZKA 4KSLC 2A4ZA 1I35A 1WZ3A 3A1QA 2KKCA 5AZHA 2KLCA 2LWPA 1WXMA 4WJNA 1Q0WB 2KQ7A 2LUEA 3KUCB 3H6NA 4E71A 2EMTA 2KO3A 2RR9A 4HLEA 4URKA 1Y8RC 3DVGY 3IHPC 1AARA 1WYWB 4A3PA 3ZDMC 2YVCA 1Q1OA 2KJRA 5C23A 1QZEA 2KD0A 2KWUB 2L05A 3UGBB 2QHOA 2D07B 2ASQA 1WGGA 2D2QA 4TKNA 4FADA 1D3ZA 4CHKA 4WQOB 2KK8A 2HD5B 4EUTA 1BT0A 2UYZB 4M8NA 3PHWB 2CKHB 3H9DA 2O2VA 3X23A 2DYMA 1WY8A 1E8WA 2LRWA 2DZMA 5J2RA 3VTVA 1E7VA 2NBUA 4MM3A 4GDKB 4WWOA 2L76A 4DHZB 1WF9A 2M1MA 1V5OA 2FNJB 4IWQA 1J8CA 2Z0EB 4HPLB 1ZW7A 2IBIB 4NY0A 1V6EA 2KQSA 2N1VA 3H7SA 4W9LA 5JH5C 3DBSA 1M94A 3KVFB 4TQ0A 2KDFB 4IWOA 4NJ7A 5CHWA 4EEWA 1WR1A 4GOCA 5IAAC 2XEWA 3QIJA 3L54A 5E6NA 4KIKB 4GU2A 1YQBA 3H7PB 5DPTA 4GXBA 1IP9A 4G11A 4ZDVA 3DDCB 4HDOA 3KUDB 3ML8A 4NAWA 1LQBA 3MHSD 3N32A 4W9DA 3QC8B 4IWPA 4IC7B 4K81A 4PYUA 2ZEQA 1WE6A 3VHTC 5IA7A 1V80A 5DPSA 3VUYA 2V4LA 4MDKE 2BF8B 1WH3A 5FR6A 2KFKB 2AL3A 2N1WA 3BY4B 2GMIC 4OVVA 3CSTA 2O6VD 4KDLB 3IG3A 3WA0A 4CO7A 1UBIA 3PZDA 1OEYJ 4IUMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRH A;  3WAM A;  3MJW A;  4LDT D;  4E74 A;  1WRD B;  2RPQ A;  3EEC A;  1P98 A;  2OOB B;  2JF5 A;  2K25 A;  3AUL A;  3ZNI D;  2L00 B;  1R4N I;  3L13 A;  4GDL A;  3QAQ A;  4DXA B;  3JYU A;  4MGZ E;  3QJZ A;  2AYO B;  1ISN A;  2KDE B;  3A9J A;  4HCP B;  3RT3 B;  3UIO B;  3RZF A;  2M4N A;  2M8S A;  2OJR A;  4WWN A;  4BKT A;  3KYC D;  2M17 A;  3V6C B;  4II2 B;  4RMA A;  2D10 A;  4FBJ B;  4MGK E;  4XC2 A;  1WGR A;  1UEL A;  1WM2 A;  2IY0 B;  4PYZ A;  3U7D A;  3ZRF A;  4A3O A;  1WX8 A;  2K39 A;  4NQL B;  3W1S C;  2KMC A;  4HDQ A;  1A5R A;  2KC1 A;  1TGZ B;  5D2M B;  1LM8 B;  1VCB A;  2IYD B;  5BO4 B;  4ZRI A;  1KM7 A;  2BWF A;  3QHT A;  2LXC A;  1J0G A;  1E5W A;  1E8Y A;  4TUU A;  1WFY A;  2NBV B;  5JZE B;  1XD3 B;  4RM9 A;  3UQB A;  1V81 A;  4W9F A;  1PQS A;  1UD7 A;  1WXS A;  2J0J A;  3L08 A;  1KJT A;  2ZZP B;  4NPN A;  2FAZ A;  3AU4 A;  3L0W B;  3RUI B;  2WX1 A;  4DWF A;  2N7E A;  1WM3 A;  3ALB A;  5G55 A;  5JHA A;  2M0X A;  2JWZ A;  3VQI A;  1KOT A;  5KHO A;  5C1Z A;  2ZVO A;  2B3A A;  2JVC A;  2K1F A;  1UGM A;  4F7Z A;  2LGY A;  2FCQ A;  2PE6 B;  4RM8 A;  4NQK E;  4DHJ B;  3DVN V;  3H1U A;  4W9H A;  3VUW A;  3A9K B;  3R7Q A;  4FJV B;  3APC A;  2MCN B;  3ZNH B;  3C0R B;  4DDI D;  3T9L A;  4EZJ A;  1S1Q B;  3A33 B;  3VFK A;  4BOZ B;  4LJP B;  2BYE A;  1E8Z A;  2KZR A;  3ZRC A;  3V62 A;  1MG8 A;  1RLF A;  3PT2 B;  2AEH A;  4I6P A;  4K7U A;  5LXH A;  4KVG B;  2ZJD A;  2PE9 A;  2K8H A;  1P3Q U;  4BKG A;  3NZU A;  2MBQ A;  2MBO A;  4KSK C;  3P2B A;  3LDZ E;  2FCM A;  3W1Y A;  3HM3 A;  3DBR I;  1NBF C;  4HXD A;  3PPA A;  1WE7 A;  1P1A A;  1S3S G;  4HPM B;  4JL9 A;  4M0W B;  4WAA A;  2G45 B;  2Y5B B;  2NPT B;  2LVO A;  2KOX A;  2ZPY A;  3DBH I;  4W9I A;  1WJ4 A;  2AWT A;  4BFR A;  2CHX A;  2CHW A;  1YX6 B;  3CF6 E;  3RZW C;  2R2O A;  5DCN A;  2BKF A;  4TV3 A;  1C3T A;  1V9J A;  2BPS A;  1V86 A;  1WJN A;  4AJY B;  5L95 C;  2KFJ A;  3VH4 B;  3IFW B;  2N9X A;  4W9J A;  1OQY A;  4JLC A;  4MJS B;  4ANU A;  3EHV A;  2JZ3 B;  2L3Z A;  4GSW A;  3WAO A;  4B95 A;  1WXA A;  2C7N B;  3NY5 A;  2HTH A;  5AEK B;  1GUA B;  2N9P C;  2J7Q B;  2KTR B;  5D6J B;  2GBJ A;  2KMA A;  3B1L X;  3K9O B;  3PRP B;  1VD2 A;  3JSV B;  3OLM D;  3N3K B;  2O6V B;  2Z59 B;  3KUZ A;  1H8C A;  4HCN B;  2WX0 A;  3A4R A;  3PGE A;  3APF A;  3D32 A;  2REX A;  5J17 A;  4G0N B;  2C60 A;  5E6P A;  1V49 A;  2AL6 A;  3TIX A;  1JRU A;  2D3G A;  3ZLZ A;  2J0M A;  4KDI C;  4K1R B;  3A1Q B;  2BKR B;  3V61 A;  3VDZ A;  4BBN C;  3ENE A;  1U4A A;  4W9K A;  1SGH A;  4MH0 E;  5HKH A;  2GBN A;  5KHQ A;  3AI5 A;  2GBR A;  2W9N A;  3KW5 B;  4GIV A;  2ZNV B;  3M63 B;  2C7M B;  1TTN A;  2NR2 A;  3MTN B;  4HJK A;  1WMH B;  2C7H A;  1H4R A;  3UIN B;  4GB9 A;  2N9E B;  1IPG A;  3QWZ B;  2MQJ A;  3QCA A;  3PRM B;  4MGY E;  2JUO A;  4DK5 A;  3ZIM A;  2KDI A;  3L17 A;  4ICU A;  3R66 C;  2MBE A;  2BWE S;  4ZYN A;  4K7W A;  2KX0 A;  2KWC A;  2LVQ A;  3O65 B;  1SE9 A;  1Q5W B;  4FJZ A;  5DPR A;  2XK5 A;  4A20 A;  2KLG A;  1ZGU B;  1L2N A;  4P7I A;  3DQV A;  5DPW A;  3ZTC A;  3M95 A;  4WWP A;  2JRI B;  4J6I A;  4F1S A;  4FUL A;  3VH3 B;  4KZC A;  5CX3 A;  3PLV A;  4HWI B;  3U30 A;  2KAN A;  4AP4 C;  4IM0 A;  2GOW A;  2JT4 B;  2NCN A;  2ZCB A;  3ZO5 B;  1EUV B;  2RGF A;  1C1Y B;  2DHZ A;  2GBM A;  3QA8 A;  5EDS A;  4GN1 A;  1Z2M A;  2L0T A;  4MSQ B;  2ZNV C;  1HE8 A;  2DZJ A;  1GJZ A;  3M3J A;  2PJH A;  4PS3 A;  4ANX A;  1WGY A;  2RD0 A;  3QAR A;  4KV2 A;  1RAX A;  4K7S A;  4M8M A;  5TR5 A;  1GC7 A;  1EF1 A;  2LGD A;  3RCZ A;  3WAL A;  2PPH A;  4GGQ A;  3HIZ A;  2CHZ A;  3VXW A;  5AZG A;  2V1Y A;  2DAJ A;  3EC8 A;  3ZTD A;  3Q3J A;  3TBL D;  4LCD E;  3APD A;  3R7R A;  1YD8 U;  2L7R A;  3L16 A;  3OJ4 B;  1P9D U;  4JQW C;  2Z0D B;  3B0A A;  3I3T B;  4HK2 A;  3NOB A;  3AU5 A;  3PHX B;  1G6J A;  2EMS A;  1WX9 A;  3DVG X;  4NAW B;  3IVF A;  1P0R A;  3LJ3 A;  2IO0 B;  2FID A;  1F9J A;  4GDK A;  1OGW A;  1UBQ A;  2KTF A;  2CR5 A;  2K6D B;  2VRR B;  4DHZ E;  4FHJ A;  2DZK A;  5J18 A;  3TL5 A;  2KTR A;  3RUL A;  1E7U A;  3VTU A;  4CYE A;  2FCS A;  4I6N B;  2WDT B;  2XBB C;  4BOS C;  5L83 A;  3PVL A;  2CS4 A;  3B08 A;  3HHM A;  2CU1 A;  3HM6 X;  4W9G A;  1WJ6 A;  3ONS A;  4KIK A;  1K8R B;  5JHB A;  2LGX A;  3H7P A;  1RFA A;  2I1K A;  4GDL B;  2WWZ A;  1EF5 A;  2K8B A;  5CTR C;  1WI0 A;  3WAP A;  2IY1 B;  3V6E B;  1I42 A;  3A9J B;  4WJO A;  1UH6 A;  1FXT B;  2MP2 B;  2NS5 A;  3IBE A;  3W1S A;  4DBG A;  3DCG A;  3OAW A;  4AUQ C;  2DZI A;  2J0K A;  2LRU A;  4WJQ A;  4F8C B;  1WXV A;  4G50 A;  1WJU A;  4B9K A;  4ANV A;  3UQA A;  4BBN F;  2KFK A;  1WMH A;  2G3Q B;  5D7G A;  2K6Q A;  2G4S A;  3GOE A;  1CMX B;  2LI5 A;  1TBE A;  2IO3 B;  4W9E A;  5CHF A;  3NHE B;  2NBW B;  3X0W A;  3A4S C;  2KWV B;  1GNU A;  4FN2 A;  2LXA A;  4IG7 B;  4MEL A;  1RRB A;  2BGF A;  5E6O A;  3VVW B;  2NVU I;  4B6W A;  4DHJ D;  2MBH A;  2KHW B;  4IM2 A;  5AZF A;  1SIF A;  5GMV A;  2FCN A;  1YIW A;  1GC6 A;  3SU8 X;  3N30 A;  3ML9 A;  4NJ6 A;  4G3X B;  3ZUN A;  2MSE D;  2JXX A;  2GBK A;  2K8C A;  4DDG D;  2C9W B;  2MWS B;  3DOW A;  4LDT B;  3SHQ A;  4FA6 A;  1R4M I;  4I6L B;  1UZX B;  2I1J A;  3PV1 A;  1ZKH A;  3QK0 A;  4IM3 A;  4WJP A;  2MW5 A;  1J19 A;  1WIA A;  2EKE C;  4OVU A;  4HVB A;  2DEN B;  4EKU A;  1OEY A;  3DPD A;  4MGI E;  3EFU A;  3VTW A;  2L8J A;  2L0F A;  3ZVV A;  4ANW A;  2MA9 B;  3AXC A;  3T8M A;  2BYV E;  3TCA A;  3JVZ X;  2DX5 B;  3QX1 A;  3V60 A;  3L10 B;  2LJ5 A;  3VAW A;  3ZW3 A;  2JPH A;  3HK0 A;  4ICV A;  3RD2 A;  4LJO B;  2KC2 A;  2IO2 B;  2KDB A;  3KYD D;  2BYF A;  1XQQ A;  1IYF A;  1WX7 A;  1YJ1 A;  3WAN A;  4E3C A;  2DYB A;  2PEA A;  1YX5 B;  3WIM A;  2JY6 A;  3ZKJ C;  4JGH B;  2IZV B;  2C5L C;  3R3M A;  4X57 B;  4ZRJ A;  4JIO U;  3A9K A;  4W9C A;  3Q3F A;  1WZ0 A;  1EO6 A;  2KVR A;  4BKS D;  3K9P B;  2O2V B;  4BVU C;  4XZ4 A;  3ZNZ B;  2A5U A;  5CHV C;  2RSU A;  3VUX A;  5D94 A;  1T0Y A;  2UWQ A;  3PTF C;  3CSF A;  3UIP B;  1LFD A;  1OTR B;  2FIF A;  3S2A A;  1WGD A;  3U8Z A;  3PRZ A;  3M62 B;  4EOY A;  1V5T A;  3NS8 A;  3GZN I;  4AOF A;  2DYO A;  3SD5 A;  2WYQ A;  3UF8 A;  2KXJ A;  1E90 A;  4EFO A;  4XX5 A;  1GG3 A;  2JZZ A;  2V3S A;  3NZS A;  3PRE A;  2HE7 A;  1L7Y A;  1NI2 A;  1XT9 B;  2KJH B;  2D11 A;  2NPT A;  3RYT A;  1KLV A;  2MRP A;  2MP2 A;  2N4F A;  5LLI A;  4ASW C;  4MEM A;  1TZ1 A;  2G4D B;  2LZ6 A;  3BIN A;  4N9F 4;  1WR6 E;  4PS7 A;  3ZDT A;  4IW0 A;  2KX3 A;  4YL8 A;  2LD9 A;  2LAS A;  4KZ0 A;  4AWJ A;  3SDL C;  4NNJ B;  3JW0 X;  4AJW A;  3QQ8 B;  4PS8 A;  2KJ6 A;  4MJS A;  2YLM A;  2ZPN A;  2DAF A;  5G2N A;  2N7D A;  5LXI B;  3TJP A;  1NDD A;  2LVP A;  3PSE B;  4FLH A;  4TQ1 A;  2ZCC A;  2ZVN A;  4GMV A;  2MLB A;  4BKS A;  3TMP B;  1WGH A;  2MX2 A;  3DBL I;  3JSV A;  4II3 B;  3PS6 A;  2O6V A;  3ECI A;  3OJ3 A;  4ZRK A;  1E8X A;  4MSM B;  2FUH B;  3PLU A;  2IO1 B;  2HJ8 A;  2R2Q A;  4FJY A;  3ZNG C;  1V2Y A;  4EZL A;  2KNB A;  3CMM B;  1Z5S B;  4FHK A;  1X1M A;  1LXD A;  2MBB B;  2XK5 B;  3DVN U;  2KN5 A;  3KH0 A;  4EZK A;  4KSL C;  2A4Z A;  1I35 A;  1WZ3 A;  3A1Q A;  2KKC A;  5AZH A;  2KLC A;  2LWP A;  1WXM A;  4WJN A;  1Q0W B;  2KQ7 A;  2LUE A;  3KUC B;  3H6N A;  4E71 A;  2EMT A;  2KO3 A;  2RR9 A;  4HLE A;  4URK A;  1Y8R C;  3DVG Y;  3IHP C;  1AAR A;  1WYW B;  4A3P A;  3ZDM C;  2YVC A;  1Q1O A;  2KJR A;  5C23 A;  1QZE A;  2KD0 A;  2KWU B;  2L05 A;  3UGB B;  2QHO A;  2D07 B;  2ASQ A;  1WGG A;  2D2Q A;  4TKN A;  4FAD A;  1D3Z A;  4CHK A;  4WQO B;  2KK8 A;  2HD5 B;  4EUT A;  1BT0 A;  2UYZ B;  4M8N A;  3PHW B;  2CKH B;  3H9D A;  2O2V A;  3X23 A;  2DYM A;  1WY8 A;  1E8W A;  2LRW A;  2DZM A;  5J2R A;  3VTV A;  1E7V A;  2NBU A;  4MM3 A;  4GDK B;  4WWO A;  2L76 A;  4DHZ B;  1WF9 A;  2M1M A;  1V5O A;  2FNJ B;  4IWQ A;  1J8C A;  2Z0E B;  4HPL B;  1ZW7 A;  2IBI B;  4NY0 A;  1V6E A;  2KQS A;  2N1V A;  3H7S A;  4W9L A;  5JH5 C;  3DBS A;  1M94 A;  3KVF B;  4TQ0 A;  2KDF B;  4IWO A;  4NJ7 A;  5CHW A;  4EEW A;  1WR1 A;  4GOC A;  5IAA C;  2XEW A;  3QIJ A;  3L54 A;  5E6N A;  4KIK B;  4GU2 A;  1YQB A;  3H7P B;  5DPT A;  4GXB A;  1IP9 A;  4G11 A;  4ZDV A;  3DDC B;  4HDO A;  3KUD B;  3ML8 A;  4NAW A;  1LQB A;  3MHS D;  3N32 A;  4W9D A;  3QC8 B;  4IWP A;  4IC7 B;  4K81 A;  4PYU A;  2ZEQ A;  1WE6 A;  3VHT C;  5IA7 A;  1V80 A;  5DPS A;  3VUY A;  2V4L A;  4MDK E;  2BF8 B;  1WH3 A;  5FR6 A;  2KFK B;  2AL3 A;  2N1W A;  3BY4 B;  2GMI C;  4OVV A;  3CST A;  2O6V D;  4KDL B;  3IG3 A;  3WA0 A;  4CO7 A;  1UBI A;  3PZD A;  1OEY J;  4IUM B; 
#chains in the Genus database with same CATH topology
 2JRH A;  4XDD A;  2B76 B;  1NEN B;  3EEC A;  2L00 B;  1R4N I;  3L13 A;  3PO0 A;  4MGZ E;  1YJI A;  3HVZ A;  2DNF A;  1ISN A;  2KDE B;  4HCP B;  4USA A;  3RZF A;  2PW9 A;  2OJR A;  1E6E B;  2M17 A;  4GLS C;  4WIP A;  3AN1 A;  1WM2 A;  2IY0 B;  3U7D A;  3ZGZ A;  4HDQ A;  2KC1 A;  4RGN A;  2RPV A;  2QSD A;  4KGR A;  3TSS A;  2AQ3 B;  4RM9 A;  3RNF C;  4N59 A;  4W9F A;  1ZPS A;  5AUK A;  1FEH A;  1UD7 A;  1D5M C;  3Q8B A;  4NPN A;  2D3C A;  3RUI B;  3ALB A;  1KOT A;  2JWZ A;  1CK1 A;  3Q14 C;  1K52 A;  2B3A A;  2K1F A;  3LB8 C;  1UGM A;  2FCQ A;  4RM8 A;  3DVN V;  2OJW A;  3H1U A;  3APC A;  4WWM A;  4N6E B;  2BYE A;  1E8Z A;  3V62 A;  3ZJT A;  1RLF A;  2ZW0 A;  2AEH A;  4KVG B;  3GE3 C;  2BB6 A;  2PE9 A;  4BKG A;  3NZU A;  4YXD B;  4KSK C;  3W1Y A;  1TS4 A;  1FRD A;  1S3S G;  3T3N A;  2NPT B;  2XN9 C;  2PMV A;  1WJ4 A;  5DCN A;  2BPS A;  1JWB D;  4REZ A;  2TSS A;  4W9J A;  1OQY A;  2NTT A;  4B95 A;  2C7N B;  1F1H A;  1GUA B;  1IGD A;  1N5W A;  2W3S A;  1KH0 A;  1VD2 A;  3OLM D;  2DBY A;  1QT9 A;  1ET9 A;  3LYY A;  1H8C A;  4HCN B;  2WX0 A;  4BAX A;  3PGE A;  3APF A;  1QOG A;  5HHD G;  2REX A;  5J17 A;  1CQV A;  1FO4 A;  1JRP A;  3Q6B A;  4OZB A;  4KDI C;  3A1Q B;  3V61 A;  4BBN C;  2V3N A;  1SGH A;  4W9K A;  2GBN A;  5KHQ A;  3AI5 A;  2GBR A;  2W9N A;  3M63 B;  1TTN A;  2QMT A;  1QLB B;  2NR2 A;  2PTL A;  1C4P A;  1H4R A;  2N9L A;  4GB9 A;  1YMH E;  3QWZ B;  1IPG A;  3R66 C;  3EUB 2;  2MBE A;  4LNI A;  4ZYN A;  4J3O D;  4K7W A;  2LVQ A;  3O65 B;  1SE9 A;  4A20 A;  3R8B A;  3DBL B;  2K9X A;  5C2T B;  4P7I A;  2JRI B;  4J6I A;  1FFU A;  4FUL A;  3VH3 B;  1GB1 A;  3NVZ A;  2VH1 A;  2NCN A;  5EDS A;  2L0T A;  1L6V A;  4PS3 A;  1WGY A;  4HPP A;  4K7S A;  1EF1 A;  3RCZ A;  3NVV A;  2CHZ A;  4XWW A;  1T3Q A;  3ZTD A;  3R7R A;  3DBR B;  4L23 A;  2DWQ A;  4HK2 A;  3NOB A;  3PHX B;  4O1N A;  1P0R A;  1FNW A;  2IO0 B;  3DBH B;  1MHH E;  3BVZ A;  2H88 B;  4R3D A;  1IBX A;  2VRR B;  3VRB B;  1EU4 A;  4M02 A;  1JCK B;  3B08 A;  1WGK A;  3HM6 X;  1K8R B;  5JHB A;  2I1K A;  4GDL B;  2IY1 B;  4RF0 A;  3A9J B;  4ITK A;  1FXT B;  4DBG A;  4K3B A;  3CWI A;  2J53 A;  4WJQ A;  1V1P A;  1ZXI A;  2KFK A;  2G3Q B;  3DHI C;  2K6Q A;  3RNC C;  3GOE A;  4W9E A;  2KWV B;  1GNU A;  2GLS A;  4MEL A;  1EU3 A;  3BZD B;  3VVW B;  2MBH A;  5TSS A;  2KHW B;  2CJN A;  2FCN A;  3B2F A;  3N30 A;  3ML9 A;  3ZUN A;  2GBK A;  2RDB C;  2BS4 B;  5HI1 A;  1HZ6 A;  3SHQ A;  4FA6 A;  3AE9 B;  1UZX B;  3PV1 A;  4PK1 A;  1ZXH A;  4OVU A;  1JRO A;  3HRD D;  3DPD A;  3EFU A;  2L8J A;  2RDH A;  3ZVV A;  2MA9 B;  3AXC A;  2BYV E;  3VAW A;  1UF0 A;  3RD2 A;  2BYF A;  1TY2 A;  3WAN A;  2K3U A;  3IT4 B;  3MC9 A;  2IZV B;  3R3M A;  1TS5 A;  2QIL A;  4X57 B;  4ZRJ A;  4W9C A;  1SB3 C;  4BKS D;  3K9P B;  2PLP A;  4XZ4 A;  2INP E;  2A5U A;  2RSU A;  3V05 A;  3PTF C;  3CSF A;  3UIP B;  1LFD A;  2QCZ A;  3U8Z A;  3NS8 A;  4AOF A;  4C7Z A;  2JZZ A;  1N61 A;  3BWU D;  2WXQ A;  4Q2J A;  2NPT A;  1AN8 A;  4ZYS A;  4P1C C;  3EA6 A;  4IW0 A;  2KX3 A;  2M0A A;  2LAS A;  3SDL C;  1HTQ A;  3BYY B;  2ACZ B;  3RPF C;  2YLM A;  2ZPN A;  1F0Z A;  4FLH A;  4TQ1 A;  2ZCC A;  1J7C A;  4BKS A;  1QOF A;  2EKI A;  4II3 B;  3ECI A;  2IO1 B;  2R2Q A;  3ZNG C;  1V2Y A;  2L83 A;  3CMM B;  1XLQ A;  4FHK A;  3DVN U;  4ACF A;  4KSL C;  3U52 E;  2WU2 B;  1I35 A;  5IN7 A;  3A1Q A;  2IJ0 A;  2KLC A;  1MPE A;  1WXM A;  4E71 A;  3KUC B;  1TJE A;  1DGJ A;  3H6N A;  2RR9 A;  1Y8R C;  1C76 A;  3IHP C;  2WXM A;  2YVC A;  3ZDM C;  4DXF A;  1Q1O A;  2KD0 A;  2KWU B;  2L05 A;  4MH8 A;  3UGB B;  3UI3 A;  1WGG A;  2D2Q A;  3AM9 A;  3RNB C;  1LO5 D;  2KK8 A;  4EUT A;  1BT0 A;  4RH6 A;  1E8W A;  2LRW A;  3KWV A;  3IT6 B;  1NYR A;  5J2R A;  3FIL B;  2WXG A;  4MM3 A;  4GDK B;  1D4B A;  4LK0 M;  4ZRQ A;  1YN4 A;  4PT5 A;  1J8C A;  4HPL B;  4NY0 A;  2KQS A;  3W9C B;  5JH5 C;  4D2K A;  4TQ0 A;  4NJ7 A;  4WUR A;  4EEW A;  4GOC A;  2LHD A;  4KIK B;  4GU2 A;  3BK1 A;  5DPT A;  3MFG A;  1IP9 A;  2V3P A;  4C7Y A;  3MHS D;  2IND C;  4IWP A;  4K81 A;  2ZEQ A;  1WE6 A;  4RFB A;  2SEB D;  2V4L A;  1UGJ A;  2AL3 A;  2N1W A;  3CST A;  1GOZ A;  2QEJ C;  4KDL B;  3WA0 A;  1UBI A;  1ENF A;  3PZD A;  4IUM B;  3WAM A;  1PDX A;  2V0G A;  1WRD B;  2RPQ A;  2OOB B;  2K25 A;  3AUL A;  1Y56 A;  4GDL A;  1I4H A;  3A9J A;  3RT3 B;  2M4N A;  3ZQ4 A;  2L1A A;  2NMQ A;  4BKT A;  3V6C B;  4LNN A;  4II2 B;  4FBJ B;  2WXR A;  4A3O A;  4PYZ A;  1A5R A;  1VCB A;  4H2A A;  1TIF A;  2IYD B;  1KM7 A;  1J0G A;  2LXC A;  1B9R A;  1E5W A;  4TUU A;  3TEZ A;  4HEA 1;  1WRI A;  2JXT A;  3UQB A;  4EE2 A;  2WLB A;  3L08 A;  1KJT A;  2ZZP B;  3AU4 A;  2Y5C A;  2WX1 A;  4DWF A;  5JHA A;  1L4D B;  5KHO A;  5C1Z A;  1NVI D;  2ZVO A;  4HKQ A;  1AWD A;  4W9H A;  3R7Q A;  4FJV B;  4DDI D;  3T9L A;  4ZOH C;  1S1Q B;  3A33 B;  1YN3 A;  1MG8 A;  3PT2 B;  5LXH A;  2ZJD A;  2K8H A;  3KLS X;  3P1M A;  2MBO A;  3Q8F A;  4C4V B;  1NEK B;  4FXC A;  2FCM A;  4RGT A;  3PPA A;  4WAA A;  1SE3 A;  4JL9 A;  4M0W B;  2G45 B;  2JWU A;  2KAC A;  2ZPY A;  1JWS D;  2CHW A;  1MFW A;  2FE8 A;  2MEK A;  4DXG A;  2X38 A;  3BII D;  1Q10 A;  1WJN A;  4AJY B;  5L95 C;  4NJC A;  1PFD A;  3E9S A;  2N9X A;  1F77 A;  4MJS B;  2QIE B;  2JZ3 B;  2L3Z A;  3WAO A;  1WXA A;  2HTH A;  1LGR A;  2VZK B;  2N9P C;  1FD6 A;  2J7Q B;  3K9O B;  4XDC A;  3PRP B;  4XWT A;  3RN9 C;  3JSV B;  2G1E A;  3N3K B;  2O6V B;  3RMK C;  4CQN A;  4QAY A;  3P4Q B;  3A4R A;  3D32 A;  1MHX A;  2HDE A;  1R4N B;  4G0N B;  5H92 C;  3TIX A;  3MHZ A;  1JRU A;  2D3G A;  2KDM A;  3RNA C;  2J0M A;  2BKR B;  3VDZ A;  3C8Y A;  1P7E A;  3Q3N C;  1TKE A;  1V1P B;  2WDV B;  4MH0 E;  5HKH A;  1C9F A;  2I38 A;  3KW5 B;  1PGB A;  4GIV A;  3MTN B;  2I2Y A;  1YQ3 B;  2C7H A;  3UIN B;  5IP4 D;  1YN5 A;  2N9E B;  4MGY E;  2JUO A;  3L17 A;  3L4P A;  4XE0 A;  2BWE S;  3MC0 B;  1D5Z C;  2GRI A;  4MT5 A;  3DQV A;  3M95 A;  4WWP A;  4AQ7 A;  4XYC A;  3LXF A;  4KZC A;  3NVW A;  4IM0 A;  1YNT E;  2ZCB A;  1C1Y B;  2DHZ A;  2GBM A;  1Z2M A;  4IOI E;  1GJZ A;  3M3J A;  1SBB B;  2MJD A;  1RAX A;  1SJE D;  5E6J A;  4GGQ A;  1KLU D;  1FNU A;  5AZG A;  3Q3J A;  3OJ4 B;  1P9D U;  3B0A A;  1G6J A;  4JE3 B;  2EMS A;  1WX9 A;  4NAW B;  3FIL A;  2FID A;  4GDK A;  1OGW A;  2KTF A;  1EM7 A;  2BS2 B;  1KLG D;  2CR5 A;  4AS1 A;  4DHZ E;  5J18 A;  2Y3A A;  2KTR A;  4TSS A;  3RUL A;  3VTU A;  4CYE A;  2FCS A;  3PZ7 A;  2WDT B;  2WXJ A;  2XBB C;  4B0M A;  4ARI A;  2CU1 A;  1WJ6 A;  4KIK A;  2WWZ A;  2K8B A;  3GP7 A;  1XF5 L;  1YJJ A;  3W5U B;  3W1S A;  3KQ4 A;  2DZI A;  2J0K A;  2LRU A;  4F8C B;  5BYR A;  1I4Q A;  3UQA A;  1WMH A;  3NUH B;  3AE8 B;  5D7G A;  2G4S A;  4LNK A;  5BMI A;  1E0Z A;  1TBE A;  1FPY A;  2NBW B;  3NHE B;  3X0W A;  2J52 A;  2LXA A;  3NS1 A;  2JQR B;  3RNG C;  5E6O A;  2NVU I;  4IKG A;  1ZDV A;  5AZF A;  4A6Q A;  1A70 A;  2MSE D;  1QIL A;  2JXX A;  2K8C A;  1N6Z A;  2MWS B;  3DOW A;  1TT5 B;  1TKG A;  2MW5 A;  4WJP A;  1J19 A;  3U7Z A;  2EKE C;  3I9V 1;  2DEN B;  3N1X C;  4EKU A;  1L5P A;  2R61 A;  3Q8C A;  3T8M A;  1AW7 A;  2UU7 A;  3JVZ X;  4YTM B;  2FUG 1;  3V60 A;  3ZW3 A;  2LJ5 A;  4ICV A;  2KDB A;  3KYD D;  3R2I A;  1N63 A;  3KWL A;  1IYF A;  1YJ1 A;  1GAQ B;  2DLB A;  2DYB A;  2PEA A;  2JY6 A;  3ZKJ C;  4JGH B;  2E3T A;  1FMA D;  1WZ0 A;  1EO6 A;  2KVR A;  4BVU C;  1PYW D;  2PKO A;  1SF0 A;  3SFE B;  1T0Y A;  4MM3 B;  1KF6 B;  3S2A A;  4YWG G;  3P4R B;  3PRZ A;  3M62 B;  3V3X A;  4C4V A;  2WYQ A;  3AE1 B;  4EFO A;  2LEK A;  2V3S A;  3AMZ A;  4WH4 A;  2HE7 A;  1L7Y A;  4M0W A;  4ARC A;  2WU5 B;  2MRP A;  5HFY A;  1E9M A;  2MP2 A;  2GI9 A;  2LMC A;  3AE6 B;  5LLI A;  4MEM A;  1WR6 E;  1HXY D;  3OWE B;  4C80 A;  4HJG E;  1DOY A;  2RMM A;  4NNJ B;  1XLP A;  2AQ2 B;  3JW0 X;  4AJW A;  1VDV A;  2KJ6 A;  4MJS A;  2DAF A;  5LXI B;  3TJP A;  3PSE B;  4GMV A;  2MLB A;  3MP9 A;  2JYT A;  3DBL I;  3JSV A;  2K22 A;  3BK2 A;  3PS6 A;  2O6V A;  3ZXR A;  3PLU A;  2HJ8 A;  4FJY A;  4EZL A;  1MG4 A;  2KQ4 X;  1X1M A;  2XK5 B;  2MBB B;  1XCT L;  4LNF A;  3I63 C;  5AZH A;  4YTP B;  2AX5 A;  4WJN A;  5GXG B;  1WYG A;  5IOI A;  3DVG Y;  4A3P A;  2OHF A;  2KJR A;  3BVG A;  3RNE C;  2ASQ A;  2KVZ A;  4TKN A;  1I4R A;  3TEW A;  1STE A;  4LLG M;  3I5J C;  1N5X A;  1ROE A;  2CKH B;  2O2V A;  3X23 A;  1WY8 A;  1BML C;  2M19 A;  4WWO A;  2L76 A;  4DHZ B;  1WF9 A;  2D3A A;  1TS3 A;  1V5O A;  2IBI B;  3H7S A;  3DBS A;  1C4C A;  2LUM A;  1PGX A;  2GB1 A;  2BS3 B;  1VLB A;  1OQQ A;  5IAA C;  5E6N A;  4M01 A;  1SE2 A;  3H7P B;  4G11 A;  3U4E G;  3DDC B;  4HDO A;  3KUD B;  2PVO D;  4NAW A;  1LQB A;  3N32 A;  5FR3 A;  1WWT A;  3OG5 A;  5BMH A;  4IC7 B;  4PYU A;  2PIA A;  3VHT C;  5DPS A;  4MDK E;  2BF8 B;  1WH3 A;  5FR6 A;  3BY4 B;  5MPO A;  3ZYY X;  5G5G A;  4CO7 A;  3IG3 A;  3MJW A;  3IAM 1;  4E74 A;  4ZHP A;  1V1O A;  1QF6 A;  1P98 A;  3AE5 B;  2WDR B;  3ZNI D;  4DXA B;  3QAQ A;  2ON8 A;  1JWU D;  5T8I A;  3UIO B;  2M8S A;  1VZ8 A;  2BT6 A;  4WWN A;  2IDY A;  1ZE3 D;  3KYC D;  2D10 A;  3W2D A;  4XC2 A;  1WGR A;  1C78 A;  4NQL B;  4TMA B;  3W1S C;  3E56 A;  3NJT A;  2YEP B;  5D2M B;  3P42 A;  4ZRI A;  3QHT A;  2WP9 B;  1E8Y A;  5G5H A;  1WFY A;  1JW9 D;  2NBV B;  1XD3 B;  5JZE B;  2OED A;  1V81 A;  4YT0 B;  1C77 A;  1DOI A;  1PQS A;  2BTE A;  2J0J A;  2FAZ A;  3U2S C;  5G55 A;  2M0X A;  3VR9 B;  3ZJV A;  2HTM E;  2PE6 B;  4DHJ B;  2MJ3 A;  3A9K B;  3VUW A;  3C0R B;  1DYQ A;  4A55 A;  3VFK A;  1PGA A;  4LJP B;  2L52 A;  4I6P A;  1P3Q U;  2ICI A;  5JXV A;  1ZUD 2;  3LDZ E;  1T0Q C;  1GPX A;  3NVY A;  3HM3 A;  2RDG A;  2N9K A;  1NBF C;  1JWA D;  3URY A;  4HXD A;  3TEY A;  4HPM B;  4OZC A;  2KOX A;  4W9I A;  2AWT A;  1TYG B;  2BBC A;  2CHX A;  1YX6 B;  1NI3 A;  2R2O A;  2E6X A;  4NAM A;  2BKF A;  4TV3 A;  1V86 A;  2KFJ A;  4JLC A;  5AEK B;  4ZRP A;  2KTR B;  2GBJ A;  2KMA A;  1FCL A;  3ZJU A;  5LNK 1;  2WS3 B;  1L0Y B;  3KUZ A;  3GZN B;  3Q3M C;  3AEF B;  3TUO A;  5E6P A;  1V49 A;  3ZLZ A;  3P4P B;  4YSY B;  2INC C;  1F52 A;  3ENE A;  1TKY A;  1R7S A;  1E7P B;  2ZNV B;  4RGO S;  1WMH B;  2WXF A;  1FCC C;  3QCA A;  3ZIM A;  1CJE A;  1FXA A;  1Q5W B;  4FJZ A;  2XK5 A;  5DPW A;  4KGT A;  4F1S A;  1I7H A;  1XXG A;  5CX3 A;  3PLV A;  3U30 A;  1N60 A;  3GB1 A;  2KAN A;  1D5X C;  2GOW A;  1EUV B;  2RGF A;  1HE8 A;  2PJH A;  4KV2 A;  4WQM A;  4M8M A;  2LGD A;  3IXS A;  1UWX A;  2PPH A;  3VXW A;  3N20 C;  2V1Y A;  2CU3 A;  3APD A;  3I3T B;  3AU5 A;  2QJL A;  3DVG X;  3IVF A;  3LJ3 A;  1F9J A;  1VJK A;  4FHJ A;  3TL5 A;  4L1B A;  2J4X A;  4HRS A;  2WXK A;  4YSX B;  1E7U A;  1T0R C;  4I6N B;  3FKY A;  2WXL A;  5L83 A;  2CS4 A;  4XGA B;  3HHM A;  5HG2 A;  4W9G A;  3BVM A;  3ONS A;  3H7P A;  4HKZ E;  1EF5 A;  1WI0 A;  1I42 A;  1YOV B;  2BYT A;  2MP2 B;  3IBE A;  2IGD A;  3DCG A;  4AUQ C;  3Q8A A;  4G50 A;  4B9K A;  3DWG C;  2BB5 A;  4ANV A;  4BBN F;  2LI5 A;  2IO3 B;  3A4S C;  3DHH C;  4FN2 A;  2Q5W D;  4DHJ D;  3B9J A;  4IM2 A;  1RYJ A;  1SIF A;  1OFF A;  3GE8 C;  1FNV A;  2C9W B;  2V4I B;  2IGH A;  4LDT B;  1R4M I;  2I1J A;  1ZKH A;  1T5X D;  2H89 B;  1XO3 A;  4HVB A;  5IKC M;  1OEY A;  1ZP0 B;  4MGI E;  2BVC A;  3VTW A;  2G9H D;  4ANW A;  3R2T A;  2WXP A;  3TCA A;  2DX5 B;  4LTU A;  1I4X A;  3HK0 A;  1RFK A;  2FBW B;  2IO2 B;  1K50 A;  4A90 A;  4RGM A;  1YX5 B;  3WIM A;  4ZHO A;  3CIR B;  3C19 A;  4KX6 B;  2C5L C;  1XCQ L;  3A9K A;  3Q3F A;  1DOX A;  2O2V B;  3W5V B;  1VRA B;  1K51 A;  3ZNZ B;  4B0E A;  5CHV C;  3VUX A;  5D94 A;  1L6U A;  1HTO A;  1OTR B;  5D3I B;  1WGD A;  4EOY A;  1HA5 A;  2YEP F;  3P63 A;  2WXN A;  1E90 A;  1GG3 A;  2LGS A;  3PRE A;  1NI2 A;  1QOA A;  2KJH B;  2D11 A;  3RYT A;  1KLV A;  1TS2 A;  4ASW C;  1J7B A;  1TZ1 A;  2G4D B;  4N9F 4;  5BYS A;  4NZL B;  4YL8 A;  2LD9 A;  4KZ0 A;  4AWJ A;  3TEX A;  1QOB A;  5G2N A;  2N7D A;  1VZ7 A;  1EWY C;  3TMP B;  2MX2 A;  4S17 A;  1HEZ E;  4ZRK A;  1E8X A;  2FUH B;  1UWM A;  1Z5S B;  1FFV A;  2WXH A;  4EZK A;  3KH0 A;  3B2G A;  3GS2 A;  2A4Z A;  1WZ3 A;  2KKC A;  2K0P A;  2EEL A;  5EE0 A;  5EE3 A;  1Q0W B;  2LUE A;  2EMT A;  2MHJ A;  3AED B;  4HLE A;  4URK A;  3ETR A;  5C23 A;  1QZE A;  5C3J B;  2QHO A;  2D07 B;  3IAS 1;  3AEC B;  4P6V F;  4CHK A;  4WQO B;  2UYZ B;  4M8N A;  1V8C A;  3H9D A;  1UUP A;  3VTV A;  1E7V A;  2NBU A;  3I57 A;  1M4V A;  2FNJ B;  2Z0E B;  1ZW7 A;  2HJ1 A;  1FM0 D;  1SIJ A;  2KDF B;  4IWO A;  2KWD A;  3QIJ A;  3L54 A;  1YQB A;  4K3C A;  4ZDV A;  3EGR A;  3ML8 A;  1KTK A;  2VH2 A;  3QC8 B;  5IA7 A;  2VZK D;  3VUY A;  2GMI C;  1BUI C;  2O6V D;  4HRO A;  5FKA C;  1J7A A;  1OEY J;  5DPR A;  4LDT D;  4L2Y A;  2WXO A;  2BW2 A;  2JF5 A;  2JX5 A;  3T3O A;  3JYU A;  3QJZ A;  2AYO B;  1WSP A;  1F2R C;  1FRR A;  1ZDX A;  4RMA A;  3NZ3 A;  4MGK E;  1UEL A;  3ZRF A;  4YSZ B;  1WX8 A;  2K39 A;  2KMC A;  1TGZ B;  1LM8 B;  5AUI A;  2JYE A;  5BO4 B;  2BWF A;  3Q3O C;  4IDI A;  3AB5 A;  2W54 A;  1WXS A;  4S0R A;  4C56 C;  5EE9 A;  1XEE A;  3ABV B;  3L0W B;  2N7E A;  1WM3 A;  5BYQ A;  3VQI A;  2M56 B;  2JVC A;  4F7Z A;  2LGY A;  1ET6 A;  4NQK E;  1N62 A;  1JWM D;  2N0S B;  2MCN B;  3BYT B;  3ZNH B;  4EZJ A;  1KRH A;  4BOZ B;  3AE7 B;  2KZR A;  3ZRC A;  1RWS A;  4K7U A;  1ESF A;  2CJO A;  1SE4 A;  2BQQ A;  2MBQ A;  3P2B A;  3DBR I;  1L0X B;  4JWS C;  1C4A A;  1WE7 A;  1P1A A;  3SFD B;  2Y5B B;  2W3R A;  2LVO A;  1JAL A;  3DBH I;  1JQ4 A;  4BFR A;  3CF6 E;  3RZW C;  3NRZ A;  1NYQ A;  2N7J A;  1C3T A;  1V9J A;  4C00 A;  1I4G A;  3Q8E A;  3VH4 B;  3IFW B;  3VRA B;  1SJH D;  2SAK A;  4ANU A;  3EHV A;  2KYW A;  4GSW A;  4OHJ A;  3NY5 A;  3H8H A;  2WHI A;  5D6J B;  3B1L X;  4JPS A;  2Z59 B;  3AEB B;  5IO9 A;  2LJI A;  2C60 A;  3P4S B;  1MJD A;  2AL6 A;  4K1R B;  2JZP A;  4RCO A;  3SEB A;  1U4A A;  2C7M B;  4HJK A;  2MQJ A;  3PRM B;  1TY0 A;  4DK5 A;  2KDI A;  4ICU A;  1SXT A;  2MJE A;  2KX0 A;  2KWC A;  4DQO C;  1VZ6 A;  2MH7 A;  1WXQ A;  3MJ5 A;  5BMG A;  2KLG A;  1VR9 A;  3WCQ A;  1EWC A;  1ZGU B;  1L2N A;  1KFY B;  3AE4 B;  1P7F A;  3ZTC A;  5EE1 A;  2JSV X;  1BXT A;  3AH7 A;  4HWI B;  4JX1 C;  4AP4 C;  2JT4 B;  3ZO5 B;  3RI7 C;  3QA8 A;  2INN E;  4GN1 A;  1F2R I;  4MSQ B;  2ZNV C;  2DZJ A;  4ANX A;  2RD0 A;  3QAR A;  1D6E C;  2Y5P A;  5TR5 A;  1GC7 A;  2WDQ B;  3WAL A;  4US9 A;  3HIZ A;  2DAJ A;  3EC8 A;  4A8X C;  3TBL D;  4LCD E;  1YD8 U;  2L7R A;  3L16 A;  1RM6 C;  4JQW C;  2Z0D B;  4OVZ A;  1L4Z B;  3AEE B;  1QKZ A;  1UBQ A;  3N1Z C;  1GB4 A;  4LNO A;  4WAF A;  2K6D B;  3PZ8 A;  2DZK A;  2JU6 X;  2KN4 A;  3Q2A C;  1PUT A;  4BOS C;  3PVL A;  1HZ5 A;  1MI0 A;  1FXI A;  4KKJ A;  3Q69 A;  2LGX A;  3FAH A;  1RFA A;  2AQ1 B;  2WQY B;  5CTR C;  4US8 A;  3WAP A;  3V6E B;  4WJO A;  1UH6 A;  2QC8 A;  1SSN A;  2NS5 A;  2QDF A;  3ZXV A;  3OAW A;  1AYF A;  1WXV A;  1WJU A;  2WGS A;  4P16 A;  4KGS A;  1CMX B;  5CHF A;  1XLO A;  3AEA B;  4IG7 B;  1RRB A;  2BGF A;  1L0V B;  1TZO A;  4B6W A;  1T0S C;  5GMV A;  1YIW A;  1GC6 A;  3SU8 X;  4NJ6 A;  4G3X B;  4DDG D;  4P1B C;  2K5P A;  4I6L B;  2W82 A;  2L32 A;  2XNA C;  3QK0 A;  4IM3 A;  3VR8 B;  1JML A;  1IUE A;  3MC8 A;  1WIA A;  3DHG C;  4A9A A;  2L0F A;  1HQR D;  2LHE A;  3QX1 A;  3L10 B;  4OW0 A;  2JPH A;  3N9Y C;  4LJO B;  2KC2 A;  3HUI A;  2NTS A;  2V9H A;  3AV8 A;  1XQQ A;  1WX7 A;  1UNS A;  4E3C A;  5H8Y E;  4JIO U;  5FK9 C;  4MAC A;  1CZP A;  2UWQ A;  2D5G A;  2FIF A;  2LFI A;  3RFZ B;  1K53 A;  1I4P A;  1V97 A;  1V5T A;  3GZN I;  2DYO A;  3SD5 A;  3UF8 A;  2KXJ A;  4XX5 A;  2Z8L A;  3NZS A;  1XT9 B;  3N1Y C;  2X8X X;  2N4F A;  3SR6 A;  3NG0 A;  2LZ6 A;  3BIN A;  1YQ4 B;  4PS7 A;  3ZDT A;  1C79 A;  4RNA A;  3QQ8 B;  4PS8 A;  1NDD A;  1XLN A;  2LVP A;  4N58 A;  2W55 A;  2ZVN A;  1WGH A;  1ACC A;  3DWM A;  3OJ3 A;  4MSM B;  2KNB A;  3AE3 B;  1E10 A;  2KAJ A;  3J9C A;  4UDU C;  1LXD A;  4OZA A;  2KN5 A;  2KT7 A;  2LWP A;  4YTN B;  1B1Z A;  2KQ7 A;  1R4M B;  2KO3 A;  1MVK A;  2ZW1 A;  5I4D A;  1AAR A;  1WYW B;  2IGG A;  2WXI A;  2ONQ A;  1SEB D;  4BZA A;  3AE2 B;  4FAD A;  2J42 A;  1D3Z A;  2HD5 B;  1OQR A;  3PHW B;  2LGI A;  1T6B X;  2DYM A;  2DZM A;  2M1M A;  1IBX B;  2IPK D;  4IWQ A;  2PVG C;  4W9L A;  1V6E A;  2N1V A;  1M94 A;  3FC4 A;  3KVF B;  5CHW A;  1FIQ A;  1WR1 A;  4M00 A;  3AEG B;  2XEW A;  1IGC A;  3EFC A;  3HVD A;  4GXB A;  2D3B A;  4KKI A;  2KMM A;  1QQR A;  3O13 A;  4W9D A;  4RF1 A;  1V80 A;  2KFK B;  4JWU C;  4OVV A;  2WNM A;  5D3D A;  1ZOY B; 
#chains in the Genus database with same CATH homology
 2JRH A;  3WAM A;  3MJW A;  4LDT D;  4E74 A;  1WRD B;  2RPQ A;  3EEC A;  1P98 A;  2OOB B;  2JF5 A;  2K25 A;  3AUL A;  3ZNI D;  2L00 B;  1R4N I;  3L13 A;  4GDL A;  3QAQ A;  4DXA B;  3JYU A;  4MGZ E;  3QJZ A;  2AYO B;  1ISN A;  2KDE B;  3A9J A;  4HCP B;  3RT3 B;  3UIO B;  3RZF A;  2M4N A;  2M8S A;  2OJR A;  4WWN A;  4BKT A;  3KYC D;  2M17 A;  3V6C B;  4II2 B;  4RMA A;  2D10 A;  4FBJ B;  4MGK E;  4XC2 A;  1WGR A;  1UEL A;  1WM2 A;  2IY0 B;  4PYZ A;  3U7D A;  3ZRF A;  4A3O A;  1WX8 A;  2K39 A;  4NQL B;  3W1S C;  2KMC A;  4HDQ A;  1A5R A;  2KC1 A;  1TGZ B;  5D2M B;  1LM8 B;  1VCB A;  2IYD B;  5BO4 B;  4ZRI A;  1KM7 A;  2BWF A;  3QHT A;  2LXC A;  1J0G A;  1E5W A;  1E8Y A;  4TUU A;  1WFY A;  2NBV B;  5JZE B;  1XD3 B;  4RM9 A;  3UQB A;  1V81 A;  4W9F A;  1PQS A;  1UD7 A;  1WXS A;  2J0J A;  3L08 A;  1KJT A;  2ZZP B;  4NPN A;  2FAZ A;  3AU4 A;  3L0W B;  3RUI B;  2WX1 A;  4DWF A;  2N7E A;  1WM3 A;  3ALB A;  5G55 A;  5JHA A;  2M0X A;  2JWZ A;  3VQI A;  1KOT A;  5KHO A;  5C1Z A;  2ZVO A;  2B3A A;  2JVC A;  2K1F A;  1UGM A;  4F7Z A;  2LGY A;  2FCQ A;  2PE6 B;  4RM8 A;  4NQK E;  4DHJ B;  3DVN V;  3H1U A;  4W9H A;  3VUW A;  3A9K B;  3R7Q A;  4FJV B;  3APC A;  2MCN B;  3ZNH B;  3C0R B;  4DDI D;  3T9L A;  4EZJ A;  1S1Q B;  3A33 B;  3VFK A;  4BOZ B;  4LJP B;  2BYE A;  1E8Z A;  2KZR A;  3ZRC A;  3V62 A;  1MG8 A;  1RLF A;  3PT2 B;  2AEH A;  4I6P A;  4K7U A;  5LXH A;  4KVG B;  2ZJD A;  2PE9 A;  2K8H A;  1P3Q U;  4BKG A;  3NZU A;  2MBQ A;  2MBO A;  4KSK C;  3P2B A;  3LDZ E;  2FCM A;  3W1Y A;  3HM3 A;  3DBR I;  1NBF C;  4HXD A;  3PPA A;  1WE7 A;  1P1A A;  1S3S G;  4HPM B;  4JL9 A;  4M0W B;  4WAA A;  2G45 B;  2Y5B B;  2NPT B;  2LVO A;  2KOX A;  2ZPY A;  3DBH I;  4W9I A;  1WJ4 A;  2AWT A;  4BFR A;  2CHX A;  2CHW A;  1YX6 B;  3CF6 E;  3RZW C;  2R2O A;  5DCN A;  2BKF A;  4TV3 A;  1C3T A;  1V9J A;  2BPS A;  1V86 A;  1WJN A;  4AJY B;  5L95 C;  2KFJ A;  3VH4 B;  3IFW B;  2N9X A;  4W9J A;  1OQY A;  4JLC A;  4MJS B;  4ANU A;  3EHV A;  2JZ3 B;  2L3Z A;  4GSW A;  3WAO A;  4B95 A;  1WXA A;  2C7N B;  3NY5 A;  2HTH A;  5AEK B;  1GUA B;  2N9P C;  2J7Q B;  2KTR B;  5D6J B;  2GBJ A;  2KMA A;  3B1L X;  3K9O B;  3PRP B;  1VD2 A;  3JSV B;  3OLM D;  3N3K B;  2O6V B;  2Z59 B;  3KUZ A;  1H8C A;  4HCN B;  2WX0 A;  3A4R A;  3PGE A;  3APF A;  3D32 A;  2REX A;  5J17 A;  4G0N B;  2C60 A;  5E6P A;  1V49 A;  2AL6 A;  3TIX A;  1JRU A;  2D3G A;  3ZLZ A;  2J0M A;  4KDI C;  4K1R B;  3A1Q B;  2BKR B;  3V61 A;  3VDZ A;  4BBN C;  3ENE A;  1U4A A;  4W9K A;  1SGH A;  4MH0 E;  5HKH A;  2GBN A;  5KHQ A;  3AI5 A;  2GBR A;  2W9N A;  3KW5 B;  4GIV A;  2ZNV B;  3M63 B;  2C7M B;  1TTN A;  2NR2 A;  3MTN B;  4HJK A;  1WMH B;  2C7H A;  1H4R A;  3UIN B;  4GB9 A;  2N9E B;  1IPG A;  3QWZ B;  2MQJ A;  3QCA A;  3PRM B;  4MGY E;  2JUO A;  4DK5 A;  3ZIM A;  2KDI A;  3L17 A;  4ICU A;  3R66 C;  2MBE A;  2BWE S;  4ZYN A;  4K7W A;  2KX0 A;  2KWC A;  2LVQ A;  3O65 B;  1SE9 A;  1Q5W B;  4FJZ A;  5DPR A;  2XK5 A;  4A20 A;  2KLG A;  1ZGU B;  1L2N A;  4P7I A;  3DQV A;  5DPW A;  3ZTC A;  3M95 A;  4WWP A;  2JRI B;  4J6I A;  4F1S A;  4FUL A;  3VH3 B;  4KZC A;  5CX3 A;  3PLV A;  4HWI B;  3U30 A;  2KAN A;  4AP4 C;  4IM0 A;  2GOW A;  2JT4 B;  2NCN A;  2ZCB A;  3ZO5 B;  1EUV B;  2RGF A;  1C1Y B;  2DHZ A;  2GBM A;  3QA8 A;  5EDS A;  4GN1 A;  1Z2M A;  2L0T A;  4MSQ B;  2ZNV C;  1HE8 A;  2DZJ A;  1GJZ A;  3M3J A;  2PJH A;  4PS3 A;  4ANX A;  1WGY A;  2RD0 A;  3QAR A;  4KV2 A;  1RAX A;  4K7S A;  4M8M A;  5TR5 A;  1GC7 A;  1EF1 A;  2LGD A;  3RCZ A;  3WAL A;  2PPH A;  4GGQ A;  3HIZ A;  2CHZ A;  3VXW A;  5AZG A;  2V1Y A;  2DAJ A;  3EC8 A;  3ZTD A;  3Q3J A;  3TBL D;  4LCD E;  3APD A;  3R7R A;  1YD8 U;  2L7R A;  3L16 A;  3OJ4 B;  1P9D U;  4JQW C;  2Z0D B;  3B0A A;  3I3T B;  4HK2 A;  3NOB A;  3AU5 A;  3PHX B;  1G6J A;  2EMS A;  1WX9 A;  3DVG X;  4NAW B;  3IVF A;  1P0R A;  3LJ3 A;  2IO0 B;  2FID A;  1F9J A;  4GDK A;  1OGW A;  1UBQ A;  2KTF A;  2CR5 A;  2K6D B;  2VRR B;  4DHZ E;  4FHJ A;  2DZK A;  5J18 A;  3TL5 A;  2KTR A;  3RUL A;  1E7U A;  3VTU A;  4CYE A;  2FCS A;  4I6N B;  2WDT B;  2XBB C;  4BOS C;  5L83 A;  3PVL A;  2CS4 A;  3B08 A;  3HHM A;  2CU1 A;  3HM6 X;  4W9G A;  1WJ6 A;  3ONS A;  4KIK A;  1K8R B;  5JHB A;  2LGX A;  3H7P A;  1RFA A;  2I1K A;  4GDL B;  2WWZ A;  1EF5 A;  2K8B A;  5CTR C;  1WI0 A;  3WAP A;  2IY1 B;  3V6E B;  1I42 A;  3A9J B;  4WJO A;  1UH6 A;  1FXT B;  2MP2 B;  2NS5 A;  3IBE A;  3W1S A;  4DBG A;  3DCG A;  3OAW A;  4AUQ C;  2DZI A;  2J0K A;  2LRU A;  4WJQ A;  4F8C B;  1WXV A;  4G50 A;  1WJU A;  4B9K A;  4ANV A;  3UQA A;  4BBN F;  2KFK A;  1WMH A;  2G3Q B;  5D7G A;  2K6Q A;  2G4S A;  3GOE A;  1CMX B;  2LI5 A;  1TBE A;  2IO3 B;  4W9E A;  5CHF A;  3NHE B;  2NBW B;  3X0W A;  3A4S C;  2KWV B;  1GNU A;  4FN2 A;  2LXA A;  4IG7 B;  4MEL A;  1RRB A;  2BGF A;  5E6O A;  3VVW B;  2NVU I;  4B6W A;  4DHJ D;  2MBH A;  2KHW B;  4IM2 A;  5AZF A;  1SIF A;  5GMV A;  2FCN A;  1YIW A;  1GC6 A;  3SU8 X;  3N30 A;  3ML9 A;  4NJ6 A;  4G3X B;  3ZUN A;  2MSE D;  2JXX A;  2GBK A;  2K8C A;  4DDG D;  2C9W B;  2MWS B;  3DOW A;  4LDT B;  3SHQ A;  4FA6 A;  1R4M I;  4I6L B;  1UZX B;  2I1J A;  3PV1 A;  1ZKH A;  3QK0 A;  4IM3 A;  4WJP A;  2MW5 A;  1J19 A;  1WIA A;  2EKE C;  4OVU A;  4HVB A;  2DEN B;  4EKU A;  1OEY A;  3DPD A;  4MGI E;  3EFU A;  3VTW A;  2L8J A;  2L0F A;  3ZVV A;  4ANW A;  2MA9 B;  3AXC A;  3T8M A;  2BYV E;  3TCA A;  3JVZ X;  2DX5 B;  3QX1 A;  3V60 A;  3L10 B;  2LJ5 A;  3VAW A;  3ZW3 A;  2JPH A;  3HK0 A;  4ICV A;  3RD2 A;  4LJO B;  2KC2 A;  2IO2 B;  2KDB A;  3KYD D;  2BYF A;  1XQQ A;  1IYF A;  1WX7 A;  1YJ1 A;  3WAN A;  4E3C A;  2DYB A;  2PEA A;  1YX5 B;  3WIM A;  2JY6 A;  3ZKJ C;  4JGH B;  2IZV B;  2C5L C;  3R3M A;  4X57 B;  4ZRJ A;  4JIO U;  3A9K A;  4W9C A;  3Q3F A;  1WZ0 A;  1EO6 A;  2KVR A;  4BKS D;  3K9P B;  2O2V B;  4BVU C;  4XZ4 A;  3ZNZ B;  2A5U A;  5CHV C;  2RSU A;  3VUX A;  5D94 A;  1T0Y A;  2UWQ A;  3PTF C;  3CSF A;  3UIP B;  1LFD A;  1OTR B;  2FIF A;  3S2A A;  1WGD A;  3U8Z A;  3PRZ A;  3M62 B;  4EOY A;  1V5T A;  3NS8 A;  3GZN I;  4AOF A;  2DYO A;  3SD5 A;  2WYQ A;  3UF8 A;  2KXJ A;  1E90 A;  4EFO A;  4XX5 A;  1GG3 A;  2JZZ A;  2V3S A;  3NZS A;  3PRE A;  2HE7 A;  1L7Y A;  1NI2 A;  1XT9 B;  2KJH B;  2D11 A;  2NPT A;  3RYT A;  1KLV A;  2MRP A;  2MP2 A;  2N4F A;  5LLI A;  4ASW C;  4MEM A;  1TZ1 A;  2G4D B;  2LZ6 A;  3BIN A;  4N9F 4;  1WR6 E;  4PS7 A;  3ZDT A;  4IW0 A;  2KX3 A;  4YL8 A;  2LD9 A;  2LAS A;  4KZ0 A;  4AWJ A;  3SDL C;  4NNJ B;  3JW0 X;  4AJW A;  3QQ8 B;  4PS8 A;  2KJ6 A;  4MJS A;  2YLM A;  2ZPN A;  2DAF A;  5G2N A;  2N7D A;  5LXI B;  3TJP A;  1NDD A;  2LVP A;  3PSE B;  4FLH A;  4TQ1 A;  2ZCC A;  2ZVN A;  4GMV A;  2MLB A;  4BKS A;  3TMP B;  1WGH A;  2MX2 A;  3DBL I;  3JSV A;  4II3 B;  3PS6 A;  2O6V A;  3ECI A;  3OJ3 A;  4ZRK A;  1E8X A;  4MSM B;  2FUH B;  3PLU A;  2IO1 B;  2HJ8 A;  2R2Q A;  4FJY A;  3ZNG C;  1V2Y A;  4EZL A;  2KNB A;  3CMM B;  1Z5S B;  4FHK A;  1X1M A;  1LXD A;  2MBB B;  2XK5 B;  3DVN U;  2KN5 A;  3KH0 A;  4EZK A;  4KSL C;  2A4Z A;  1I35 A;  1WZ3 A;  3A1Q A;  2KKC A;  5AZH A;  2KLC A;  2LWP A;  1WXM A;  4WJN A;  1Q0W B;  2KQ7 A;  2LUE A;  3KUC B;  3H6N A;  4E71 A;  2EMT A;  2KO3 A;  2RR9 A;  4HLE A;  4URK A;  1Y8R C;  3DVG Y;  3IHP C;  1AAR A;  1WYW B;  4A3P A;  3ZDM C;  2YVC A;  1Q1O A;  2KJR A;  5C23 A;  1QZE A;  2KD0 A;  2KWU B;  2L05 A;  3UGB B;  2QHO A;  2D07 B;  2ASQ A;  1WGG A;  2D2Q A;  4TKN A;  4FAD A;  1D3Z A;  4CHK A;  4WQO B;  2KK8 A;  2HD5 B;  4EUT A;  1BT0 A;  2UYZ B;  4M8N A;  3PHW B;  2CKH B;  3H9D A;  2O2V A;  3X23 A;  2DYM A;  1WY8 A;  1E8W A;  2LRW A;  2DZM A;  5J2R A;  3VTV A;  1E7V A;  2NBU A;  4MM3 A;  4GDK B;  4WWO A;  2L76 A;  4DHZ B;  1WF9 A;  2M1M A;  1V5O A;  2FNJ B;  4IWQ A;  1J8C A;  2Z0E B;  4HPL B;  1ZW7 A;  2IBI B;  4NY0 A;  1V6E A;  2KQS A;  2N1V A;  3H7S A;  4W9L A;  5JH5 C;  3DBS A;  1M94 A;  3KVF B;  4TQ0 A;  2KDF B;  4IWO A;  4NJ7 A;  5CHW A;  4EEW A;  1WR1 A;  4GOC A;  5IAA C;  2XEW A;  3QIJ A;  3L54 A;  5E6N A;  4KIK B;  4GU2 A;  1YQB A;  3H7P B;  5DPT A;  4GXB A;  1IP9 A;  4G11 A;  4ZDV A;  3DDC B;  4HDO A;  3KUD B;  3ML8 A;  4NAW A;  1LQB A;  3MHS D;  3N32 A;  4W9D A;  3QC8 B;  4IWP A;  4IC7 B;  4K81 A;  4PYU A;  2ZEQ A;  1WE6 A;  3VHT C;  5IA7 A;  1V80 A;  5DPS A;  3VUY A;  2V4L A;  4MDK E;  2BF8 B;  1WH3 A;  5FR6 A;  2KFK B;  2AL3 A;  2N1W A;  3BY4 B;  2GMI C;  4OVV A;  3CST A;  2O6V D;  4KDL B;  3IG3 A;  3WA0 A;  4CO7 A;  1UBI A;  3PZD A;  1OEY J;  4IUM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...