2FCNA

X-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
total genus 21
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcnA00
1IYFA 2L05A 3NY5A 3DVNU 3ZRFA 4AOFA 2MP2A 4MH0E 2BPSA 2JF5A 4W9DA 2K8HA 2HD5B 4GDKB 4KZCA 2JZZA 4PYUA 2Z0EB 1G6JA 3GOEA 4HK2A 4HJKA 4B6WA 3Q3JA 4ZDVA 4KIKB 1P98A 2M1MA 3BY4B 4IM2A 1UZXB 3DCGA 4AP4C 2BGFA 3K9OB 2DAJA 2XK5B 4IG7B 1E8XA 2WYQA 3RT3B 1F9JA 2I1JA 3PV1A 3RZWC 1WZ0A 3AI5A 4ZRJA 5D7GA 2KJRA 4M0WB 2MA9B 2NBVB 4N9F4 2KD0A 5AZHA 3VDZA 4TUUA 2KNBA 4WWNA 4AJWA 3HK0A 1M94A 4MGIE 2PE9A 3H7SA 4WQOB 2HE7A 3R66C 3WAPA 3A4RA 2AL3A 3PLUA 4FLHA 2DZIA 4CHKA 4MDKE 4ICVA 2PEAA 3U8ZA 3ENEA 4JQWC 1H8CA 2JWZA 2BYVE 4ICUA 4NQKE 4HLEA 4XC2A 2J0KA 2AYOB 4A3PA 1RFAA 4HDOA 2FUHB 4EZKA 2GBRA 2C7HA 2LD9A 1EUVB 2LVPA 4HXDA 1OEYA 2DYMA 3CF6E 2CR5A 1BT0A 2NS5A 3ZIMA 1IP9A 2MBBB 1P9DU 1V80A 2G3QB 2KC2A 3ML9A 2KTRA 1L7YA 3L17A 2OOBB 3PRMB 3QCAA 5J17A 5JZEB 4KV2A 3TBLD 3VAWA 1YQBA 2K1FA 3PHXB 1H4RA 3A9JA 2FCSA 4PYZA 2LXAA 2MBEA 4B95A 2NCNA 3PREA 3TIXA 2LASA 4A20A 3CMMB 2C5LC 2W9NA 4DWFA 1D3ZA 2BF8B 2NBUA 5HKHA 5DPWA 2MRPA 1UBQA 5LXHA 3T8MA 2N9PC 3C0RB 4K7UA 3RZFA 2PJHA 2FCNA 4ANXA 2ZJDA 2D11A 3QJZA 4E71A 2KFKA 3KVFB 4GSWA 3AU4A 2KMCA 1Q0WB 4JL9A 5E6OA 3M62B 2BKRB 5GMVA 2KJ6A 3PT2B 1UH6A 3SHQA 3ZNHB 3ONSA 4FULA 1V5OA 3QC8B 2KFJA 2ZNVC 3U7DA 3HIZA 5G2NA 4TV3A 2N9XA 2KJHB 3X23A 3LDZE 3DDCB 3N3KB 3QX1A 2K25A 1Q1OA 2L00B 1YD8U 1C1YB 2DAFA 2IY1B 3DBSA 3ZNGC 2XEWA 2LGXA 2N4FA 4ANWA 4LJPB 4DK5A 3MHSD 1WX7A 4BOSC 4DHJD 2FCMA 2Z0DB 4HCPB 4GU2A 4W9FA 3PZDA 1I35A 3VVWB 3IFWB 1GC7A 3WALA 2PE6B 2ASQA 4M8NA 4MEMA 2RPQA 3JSVA 2R2QA 1MG8A 3ZNZB 4HVBA 1U4AA 3KUZA 2L7RA 3ZDMC 1T0YA 1ISNA 3D32A 3KW5B 2VRRB 3KYCD 4IM0A 3V6EB 4E74A 4FBJB 3PPAA 2EMTA 4DXAB 2FNJB 2YLMA 3PHWB 2B3AA 2M17A 2J0JA 1WJ4A 4HPLB 3ZRCA 2D10A 4LDTB 3DOWA 3PGEA 5CHVC 2DZMA 4GDLA 4AUQC 5D94A 1WH3A 3CSTA 4MJSA 2KDFB 2KTFA 4FJVB 2MW5A 3L13A 4OVUA 4MM3A 3ZNID 2KWUB 1FXTB 2ZCCA 3VTVA 4TQ0A 4EZJA 2ZPNA 2Z59B 3JSVB 4GB9A 4II2B 2CS4A 4G50A 2LI5A 2ZZPB 1WGRA 5BO4B 4W9IA 3ZTCA 4TQ1A 3ZW3A 2N9EB 2C7NB 4HCNB 2DZKA 4IW0A 2KC1A 2OJRA 3PVLA 3ZLZA 4GDLB 4F7ZA 2I1KA 4ANVA 2QHOA 2KDBA 2MX2A 2LRWA 4MJSB 2G4DB 2ZNVB 2BYFA 2L0TA 4K81A 2UWQA 2WDTB 3H6NA 5IA7A 3V62A 4BFRA 5C1ZA 4GGQA 2IO0B 4IWPA 3SD5A 3B08A 3UIPB 4BKSA 2JRIB 4NY0A 2EKEC 4W9GA 2RGFA 3A9KA 1WJNA 1XQQA 3VQIA 1CMXB 3NOBA 2MP2B 3ZVVA 4G0NB 3VUYA 3X0WA 3Q3FA 3RYTA 4EUTA 5L95C 1Y8RC 2NPTA 3DBLI 4ASWC 4EEWA 2K6DB 2O6VD 2M4NA 4ANUA 2KO3A 4KDLB 3TL5A 1IPGA 2UYZB 3DBRI 3SDLC 4FA6A 3AULA 3A33B 3M3JA 5J2RA 1GUAB 1S1QB 1WE6A 2L76A 1UELA 2C60A 3W1YA 3IVFA 2LUEA 3EECA 4WWPA 3KYDD 4FHJA 4W9HA 4GN1A 5CTRC 2KLCA 2IYDB 2CHXA 2GOWA 3BINA 4G11A 4IM3A 3WIMA 2GBKA 5D2MB 4RMAA 3VHTC 1V6EA 4BBNC 3JVZX 4NAWA 1TGZB 2GBJA 4NJ6A 3L0WB 2NPTB 2ZVOA 1WIAA 2LJ5A 2XBBC 1OQYA 1WYWB 1KLVA 2V1YA 1E8ZA 4DHZE 4F8CB 3WA0A 4TKNA 3ALBA 1E7VA 5KHOA 4FJYA 1SGHA 4FHKA 2KKCA 2RD0A 3NS8A 3PS6A 3GZNI 3H7PA 3ZTDA 1J19A 3UQAA 3NHEB 5D6JB 2CHZA 3DVGX 4JGHB 5G55A 4A3OA 3OLMD 2D2QA 1EO6A 3RD2A 4EKUA 1VD2A 3VUXA 2C9WB 3M63B 1RAXA 4DDGD 2KTRB 5EDSA 4NAWB 1UBIA 4EOYA 3RUIB 3PLVA 2GBMA 3M95A 3MJWA 3R3MA 5AEKB 1WGGA 4J6IA 3DBHI 3UGBB 4KSKC 2KOXA 3APDA 4F1SA 1WMHA 3IG3A 1I42A 1OTRB 3A9JB 2MBOA 2N1WA 2LWPA 4ZRIA 3VH3B 1WM3A 4WJQA 4PS7A 1Q5WB 1RLFA 2AWTA 3PRPB 2JXXA 1EF1A 3L08A 5IAAC 3RCZA 1AARA 2KLGA 4CO7A 5LXIB 1WI0A 4W9CA 4EFOA 1V9JA 1J8CA 4IC7B 1RRBA 4LDTD 5JH5C 2KFKB 1WGYA 1SIFA 2REXA 3QQ8B 2KDIA 4KZ0A 4WJOA 4BBNF 4FADA 1ZW7A 3OAWA 3A1QA 2DZJA 4HPMB 4AJYB 2G45B 2Y5BB 1WE7A 3DPDA 4CYEA 5CHFA 1J0GA 2NVUI 1R4NI 1XD3B 3QARA 1V81A 3VFKA 4DBGA 1WMHB 2L8JA 2DYBA 4WJNA 2K8BA 2ZEQA 3T9LA 3DVGY 5J18A 3L16A 1Z2MA 3EC8A 2KANA 4KVGB 1S3SG 2JZ3B 4HWIB 4W9JA 2LVQA 2RR9A 3UIOB 2L0FA 4FN2A 1WRDB 2JY6A 2BYEA 5JHBA 4KSLC 1YX5B 4K7WA 1PQSA 4WJPA 4GDKA 2WWZA 1X1MA 3TMPB 4DHJB 3HM3A 3A1QB 3SU8X 1WR6E 1NDDA 1WX8A 1WXMA 3V6CB 4KIKA 1EF5A 1YIWA 1Z5SB 2JUOA 2IZVB 3QAQA 2KXJA 4LJOB 1P3QU 3OJ3A 5TR5A 1V2YA 3UF8A 3APCA 2D3GA 2LGYA 4GXBA 2BKFA 2ZPYA 2K6QA 5E6NA 1WJ6A 2IO3B 3QA8A 4PS8A 4X57B 4AWJA 5LLIA 2KZRA 2HJ8A 4II3B 4MSQB 3WAOA 4YL8A 1L2NA 1E8YA 4MGYE 1ZGUB 4NJ7A 2MQJA 2IY0B 1SE9A 4K1RB 3QWZB 2FCQA 2IO1B 2D07B 3VH4B 2NR2A 3ZUNA 4W9LA 4E3CA 3H1UA 3MTNB 3JW0X 1KOTA 2A5UA 2V3SA 3R7QA 3QK0A 4RM8A 4P7IA 3VUWA 3TJPA 1P0RA 4BKGA 4BKSD 2AL6A 2NBWB 1LXDA 2KMAA 2A4ZA 1E90A 1VCBA 1OGWA 3N30A 4IWOA 4MSMB 5FR6A 1WXSA 3AU5A 3UQBA 1E8WA 2MBHA 1V49A 1WZ3A 4WAAA 2O6VA 2FAZA 2LRUA 2IO2B 3NZUA 4DDID 3CSFA 4JIOU 1WFYA 2KK8A 1YJ1A 2KX3A 4W9EA 2HTHA 2O2VA 3EFUA 3KUCB 3ECIA 3O65B 4W9KA 3VTUA 3JYUA 1R4MI 2EMSA 1KM7A 1WX9A 2YVCA 3A9KB 1WY8A 2FIDA 1K8RB 3B0AA 4LCDE 5AZGA 1XT9B 5CX3A 2JVCA 2KQ7A 4XX5A 5DPRA 2KVRA 2FIFA 5JHAA 2KHWB 3N32A 4IWQA 1LM8B 3RULA 3LJ3A 4NQLB 4HDQA 1GJZA 2N7DA 3HM6X 1V5TA 2MBQA 2K8CA 3A4SC 2O6VB 2IBIB 3NZSA 3PRZA 1WGDA 2C7MB 3APFA 4IUMB 3B1LX 3V60A 2DENB 2N7EA 2O2VB 1TTNA 4BKTA 5KHQA 2DX5B 2KWCA 3U30A 4BVUC 3S2AA 4RM9A 1QZEA 1LQBA 1JRUA 3IHPC 3L10B 3ZO5B 1GG3A 3VTWA 3QIJA 2JPHA 4MGKE 1TBEA 2M8SA 4ZYNA 2LXCA 3QHTA 1NI2A 4K7SA 4MELA 1E5WA 3OJ4B 5DPTA 2KQSA 2DYOA 3DVNV 1WF9A 2K39A 3KUDB 5DCNA 3PTFC 1KJTA 1YX6B 2KDEB 1WGHA 4XZ4A 3W1SC 1NBFC 3P2BA 3H7PB 2KN5A 1A5RA 1C3TA 2LVOA 4I6LB 4BOZB 3WAMA 2JRHA 2L3ZA 2ZCBA 3I3TB 4NPNA 3V61A 1UGMA 3EHVA 4NNJB 1WXAA 2GBNA 3PSEB 2M0XA 5AZFA 1P1AA 1WR1A 2CKHB 2R2OA 2MSED 4M8MA 2GMIC 2J0MA 1GC6A 3AXCA 4GMVA 1GNUA 2KX0A 2BWFA 5E6PA 5L83A 4G3XB 4OVVA 1UD7A 2N1VA 4I6NB 2DHZA 2G4SA 4JLCA 4FJZA 3UINB 2PPHA 1OEYJ 4EZLA 1ZKHA 1V86A 4KDIC 2BWES 3TCAA 3R7RA 2WX1A 2J7QB 1WXVA 2MWSB 1HE8A 3DQVA 3VXWA 2WX0A 5CHWA 4I6PA 2V4LA 1TZ1A 3L54A 4GIVA 4MGZE 3HHMA 2MLBA 3ZKJC 4GOCA 5C23A 4PS3A 2AEHA 3W1SA 3K9PB 3ML8A 1WM2A 2ZVNA 4B9KA 1E7UA 2CU1A 4URKA 3H9DA 4ZRKA 4WWOA 3KH0A 2CHWA 2JT4B 2RSUA 2XK5A 4DHZB 1LFDA 2LGDA 2KWVB 1WJUA 3ZDTA 5DPSA 3IBEA 2MCNB 3WANA 2LZ6A
chains in the Genus database with same CATH superfamily
2FBWB 5E6JA 1CK1A 2JZZA 3AMZA 2Z0EB 2BB5A 3Q3JA 4KIKB 1P98A 2M1MA 1SSNA 3N1YC 1JW9D 4RNAA 3K9OB 3RT3B 1E8XA 1ZDXA 2PLPA 4BAXA 3PV1A 2KJRA 2PW9A 2MA9B 1YN3A 1F77A 4MGIE 2HE7A 4CHKA 4HPPA 1H8CA 1B1ZA 1JWUD 2JWZA 4JPSA 1L0XB 4A3PA 1YOVB 1EUVB 3CF6E 3NVZA 5G5GA 1D5ZC 2VZKB 1L7YA 3NG0A 2OOBB 3QCAA 1YQBA 4HEA1 3A9JA 1FFUA 2LXAA 4B95A 2NCNA 3AE9B 1RM6C 2I38A 4GLSC 4OZAA 5BYQA 1JRPA 1T6BX 4ZHPA 1FMAD 5HKHA 5LXHA 1P7EA 3AM9A 1NI3A 5FK9C 2D11A 3QJZA 3KVFB 2QJLA 1UWXA 3GP7A 4FULA 5IN7A 4OZCA 3U7DA 5G2NA 4C7ZA 5BYRA 1PGBA 2AX5A 3DDCB 3N3KB 2K25A 1C1YB 2DAFA 3ZNGC 3AB5A 4LJPB 1T0SC 1XLNA 1T5XD 3MHSD 4BOSC 1D5XC 3R2IA 4W9FA 3VVWB 1AW7A 1VLBA 3WALA 1FFVA 2ASQA 1RWSA 3DHGC 3NS1A 4MEMA 1MG8A 2GLSA 3FILB 4DQOC 2J4XA 3ZQ4A 3KYCD 4HRSA 2KQ4X 2B3AA 2B76B 3PGEA 2DZMA 2JWUA 4AUQC 2BS3B 4KKIA 4MJSA 2KTFA 4RCOA 3ZNID 4P16A 2CS4A 2LI5A 1MG4A 3ZW3A 1ESFA 2LGIA 4IW0A 2X8XX 2KC1A 4H2AA 3ZLZA 3AE3B 2I1KA 3I5JC 2MX2A 2ZNVB 4LTUA 2L0TA 4EE2A 2WDTB 2WXFA 3V62A 4BFRA 5C1ZA 1XCTL 4IWPA 3B08A 5H92C 4NY0A 2RGFA 1GAQB 1CMXB 2MP2B 3BK2A 5FR3A 2CJNA 2VH2A 4AS1A 3TL5A 3SDLC 1I4PA 2UYZB 5J2RA 3ZJTA 1S1QB 3I9V1 2KT7A 2L76A 3SR6A 2KLCA 2CHXA 1I4RA 1L6VA 1JQ4A 1V6EA 3JVZX 4NAWA 4MACA 3L0WB 2ZVOA 2XBBC 1OQYA 1L0YB 4JE3B 1WYWB 1E8ZA 4F8CB 3ALBA 4L1BA 4FJYA 4YSZB 2KKCA 3PS6A 2MH7A 3UQAA 1N5WA 2EELA 4K3BA 2VH1A 4JGHB 5G55A 1VD2A 4DDGD 1C4PA 4EOYA 3RUIB 3PLVA 5AEKB 2EKIA 4MT5A 3AEEB 3DBHI 3DBHB 1ROEA 4REZA 4JWSC 3I57A 2MBOA 4USAA 2WXNA 2PTLA 4ZRIA 3VH3B 1WM3A 2LFIA 4WJQA 3U52E 1PDXA 3PRPB 2JXXA 3SFDB 3L08A 5IAAC 1AARA 3BVGA 4IC7B 4LDTD 1WGYA 2REXA 4KZ0A 3MC0B 4FADA 2IGDA 1F1HA 3DPDA 5AUIA 4FXCA 1J0GA 4DBGA 1V81A 5LNK1 2ZEQA 3DVGY 1E6EB 4LNOA 1Z2MA 2JU6X 2KANA 4KVGB 2JZ3B 2WXQA 4HROA 4HWIB 1HZ6A 1XLPA 2JY6A 1R7SA 5JHBA 1YX5B 4YWGG 4KGTA 1PQSA 3N20C 1N62A 1TKYA 3TMPB 1F0ZA 3A1QB 2V0GA 1Y56A 3V6CB 4KIKA 1EF5A 1Z5SB 3QAQA 2KXJA 2D3GA 2K6QA 1D6EC 1KTKA 3LB8C 3BVZA 3P1MA 2KZRA 2HJ8A 4BZAA 1MVKA 4MGYE 2MQJA 1SE9A 3QWZB 2FCQA 2NR2A 3U4EG 4P1BC 3MTNB 1KOTA 2A5UA 4RM8A 2WNMA 3TJPA 4ZYSA 5G5HA 1P0RA 2NBWB 2VZKD 5FR6A 4JIOU 3OG5A 1WFYA 4W9KA 1TS5A 4XDCA 3JYUA 2EMSA 4PK1A 1WY8A 2FIDA 4OZBA 2DLBA 3B0AA 5AZGA 3N9YC 4XX5A 2KVRA 2FIFA 5JHAA 2KHWB 4C80A 1FXIA 1GJZA 1V5TA 3PRZA 1WGDA 2C7MB 1ET9A 1B9RA 3MC9A 1UUPA 1SJHD 4BKTA 3LXFA 3ABVB 2TSSA 1FNWA 4BVUC 5AUKA 1ZE3D 1STEA 3BYYB 3IHPC 3L10B 3ZO5B 2WXJA 2JPHA 2LXCA 1TS3A 1VZ6A 1XXGA 4TMAB 1C3TA 1JWMD 1TT5B 3H7PB 2QDFA 2E3TA 4YSXB 4A9AA 3EHVA 3FILA 1WXAA 2M0XA 1WR1A 2CKHB 3MFGA 3AXCA 5E6PA 4OVZA 1L0VB 1OQQA 4G3XB 4I6NB 2G4SA 1E0ZA 3UINB 1LGRA 2WXGA 1V86A 4KDIC 1GOZA 1K50A 2WX1A 1SF0A 2GB1A 1WXVA 5CHWA 1QKZA 2NMQA 3L54A 3Q8CA 4PS3A 2PMVA 4B9KA 1TIFA 4URKA 2CHWA 1LFDA 2JSVX 3RNGC 2KVZA 1QF6A 2PKOA 5IP4D 2JX5A 2YEPB 1IUEA 2RDBC 1IBXB 2GI9A 2MP2A 3BWUD 2K8HA 4KZCA 4PYUA 4HJKA 4B6WA 3BY4B 3DCGA 2BGFA 2FE8A 4IG7B 2WYQA 3N1XC 5HI1A 3RNBC 4D2KA 4WQOB 3R66C 2AL3A 4MDKE 3RFZB 1QILA 2GRIA 1V1OA 4NQKE 4ICUA 2KACA 4XC2A 2AYOB 2K22A 4HDOA 4EZKA 2GBRA 2LVPA 4Q2JA 2BT6A 3LYYA 2CR5A 2NS5A 3EGRA 1P9DU 3ML9A 1N6ZA 5J17A 1WRIA 3TBLD 5GXGB 4ARCA 4WURA 1OFFA 1H4RA 2D3AA 3PREA 3CMMB 4DWFA 2BW2A 5DPWA 2MRPA 1UBQA 3PZ8A 3C0RB 3RZFA 3NJTA 3NVVA 2RDHA 3TEYA 1TYGB 5E6OA 3DHIC 2KJ6A 2LUMA 3SHQA 3ZNHB 2IGGA 3HIZA 4TV3A 3X23A 4XWTA 2IY1B 2XEWA 4LK0M 2N4FA 2K3UA 2IJ0A 4ANWA 1WX7A 2Z0DB 4HCPB 4KGSA 4M01A 1GC7A 2NTSA 3JSVA 2R2QA 1V1PA 1XLQA 4P1CC 2L7RA 4O1NA 3RNAC 2VRRB 4FBJB 4DXAB 3PHWB 3ZRCA 2D10A 4LDTB 3DOWA 2ONQA 4OW0A 4GDLA 3Q3NC 4M02A 5D94A 1WH3A 1XF5L 4LNKA 2KDFB 1YN5A 4FJVB 4C7YA 2MW5A 3L13A 1QLBB 1C79A 2KWUB 3RNCC 2MJEA 2Z59B 4II2B 4DXGA 1AYFA 2G9HD 1YJJA 3ZTCA 4TQ1A 2DWQA 1PGXA 3PVLA 2QMTA 4F7ZA 3NVWA 2QHOA 1DOXA 2G4DB 2CU3A 1EU4A 4K3CA 4GGQA 4BKSA 3VQIA 1AN8A 2OJWA 3VRAB 5HFYA 3RYTA 1Y8RC 2NPTA 1EWCA 2LMCA 4KDLB 1IPGA 1UNSA 1GUAB 2C60A 3RNEC 2LHDA 2LUEA 3EECA 4FHJA 3TEZA 4J3OD 2KAJA 2KN4A 2INCC 4YTMB 4BBNC 1TGZB 4NJ6A 2R61A 4AQ7A 1JWSD 5KHOA 3B2GA 2RD0A 2PIAA 4YTNB 3H7PA 1J19A 3NHEB 2CHZA 3DVGX 4A3OA 1FEHA 1EO6A 4EKUA 2WXLA 2C9WB 1KFYB 2KTRB 4C4VB 1ENFA 1UBIA 3VR8B 3M95A 1JCKB 3APDA 1WMHA 1I42A 2Z8LA 2N1WA 1SE2A 4HKQA 4PS7A 1Q5WB 2L83A 2WDVB 1RLFA 1MJDA 5LXIB 3PZ7A 1V9JA 1N63A 1RRBA 4BBNF 1ZW7A 2ZW0A 4AJYB 1WE7A 4CYEA 3W2DA 2NVUI 3QARA 4WJNA 2K8BA 2JYTA 3GE8C 3L16A 3EC8A 2ACZB 1S3SG 1VR9A 2L0FA 4FN2A 2BYEA 4K7WA 2WLBA 1FNUA 1X1MA 4ZRQA 3HM3A 2JXTA 1WR6E 2YEPF 4LJOB 1P3QU 1QOAA 3UF8A 1TZOA 1QQRA 4GXBA 2ZPYA 5E6NA 1TS2A 1WJ6A 2IO3B 4X57B 2JYEA 2BS4B 4II3B 4YL8A 1E8YA 1FRDA 1ZGUB 4NJ7A 3Q69A 4MM3B 3Q6BA 2IO1B 3ZUNA 3H1UA 3H8HA 1YN4A 2V3SA 1JALA 3NUHB 2LGSA 5IO9A 4IWOA 3KQ4A 1E8WA 2FAZA 1L4DB 4DDID 1HTQA 2W3SA 3CSFA 3DHHC 3DWGC 2KX3A 2O2VA 3KUCB 3ECIA 2KMMA 2YVCA 3A9KB 2IPKD 2WU5B 3AEDB 1K8RB 4LCDE 2JZPA 3T3NA 2N0SB 3RULA 3LJ3A 4NQLB 3AE4B 1FPYA 3PO0A 2MBQA 1JWBD 2O6VB 3R2TA 3V60A 1NYRA 2DENB 5KHQA 1TTNA 1NVID 2KWCA 3S2AA 2XNAC 4C00A 1GG3A 3AE5B 2MHJA 2M8SA 3QHTA 4K7SA 4MELA 2LJIA 1E5WA 1XCQL 3E56A 2V4IB 3DWMA 3DVNV 3W1SC 1KJTA 2KN5A 1K52A 1VRAB 2LVOA 2L3ZA 4NPNA 2GBNA 1IGCA 5AZFA 2ICIA 1GC6A 1GNUA 2BWFA 4WH4A 2DHZA 1Q10A 1IGDA 1ZKHA 3RI7C 1TY0A 3TCAA 3FAHA 1JWAD 4CQNA 2MWSB 1HE8A 3DQVA 2WXMA 2WX0A 2V4LA 4GIVA 2L52A 3ZKJC 3AEAB 2MJ3A 4B0MA 4L2YA 3W9CB 3W1SA 3ML8A 1WM2A 2HJ1A 1E7UA 3BIID 2RSUA 3Q3OC 2WU2B 3Q8BA 2MCNB 3WANA 2LZ6A 4XGAB 4YTPB 4AOFA 2BB6A 3ZXVA 1GB4A 2QC8A 1ZXIA 3GOEA 4HK2A 2M0AA 4ZDVA 4IM2A 1TY2A 2MEKA 2BYTA 2M19A 4AP4C 2DAJA 2XK5B 2I1JA 4MH8A 5D7GA 1EWYC 4M0WB 2NBVB 1OQRA 2E6XA 4WWNA 1FNVA 2L1AA 2PE9A 3H7SA 4US9A 1ZOYB 3O13A 3NVYA 4WIPA 2DZIA 2WDRB 4XE0A 1PGAA 2PEAA 3U8ZA 1YQ3B 4JQWC 2D5GA 4QAYA 1KRHA 5FKAC 3B2FA 1DGJA 1RFAA 2FUHB 1C78A 2LD9A 4HXDA 2DYMA 3MJ5A 1BT0A 3ZIMA 4ACFA 1IP9A 1XLOA 2MBBB 1V80A 2MJDA 3BZDB 1TKEA 2KTRA 3L17A 4PT5A 3VAWA 1YQ4B 4RGTA 4L23A 2LHEA 5BMGA 4PYZA 2MBEA 3TIXA 1XEEA 2LASA 4A20A 2W9NA 1D3ZA 2J53A 2N9PC 1WSPA 2WQYB 2WXPA 2Y5CA 4K7UA 1J7AA 2FCNA 2ZJDA 4E71A 2KWDA 2KMCA 1Q0WB 4JWUC 4JL9A 4RH6A 2ZW1A 1V5OA 2KFJA 2ZNVC 1YMHE 2KJHB 2RDGA 1WGKA 3GB1A 1YD8U 3DBSA 1EU3A 2QIEB 1TS4A 4DK5A 2BQQA 2FCMA 3IFWB 1TJEA 2PE6B 1A70A 3V3XA 1U4AA 3ZDMC 1T0YA 1ISNA 1I4GA 3V6EB 4E74A 3AEFB 3PPAA 2EMTA 3Q2AC 1VJKA 1GB1A 4HPLB 3AV8A 5CHVC 2RPVA 2W82A 1QOBA 4M00A 3AE7B 3CSTA 4OVUA 4MM3A 1FXTB 2ZCCA 3EA6A 3VTVA 1AWDA 4GB9A 3TEXA 4WQMA 1WGRA 3AE8B 4W9IA 5BO4B 2N9EB 2C7NB 2OJRA 2WXRA 1KH0A 1SBBB 4ANVA 2KDBA 1KLGD 2XN9C 2LRWA 3E9SA 3IT4B 4MJSB 1RYJA 4RGNA 4ZHOA 2UWQA 2IO0B 2EKEC 3A9KA 1WJNA 1XQQA 2Y5PA 2KDMA 4G0NB 3X0WA 3KWLA 3MHZA 3Q3FA 4N58A 1XO3A 3P63A 3DBLI 3DBLB 4ASWC 2K6DB 2O6VD 2M4NA 2KO3A 2V3PA 3DBRI 3DBRB 4YSYB 2J42A 4FA6A 4HKZE 3AULA 3A33B 3IVFA 4W9HA 2IYDB 4OHJA 3WIMA 3C8YA 2AQ3B 1WXQA 5D2MB 4RMAA 2RMMA 1FO4A 2GBJA 2Q5WD 2K0PA 2FUG1 1P7FA 4DHZE 2AQ2B 4TKNA 2BS2B 1SGHA 4FHKA 3GZNI 3GZNB 1V8CA 4A55A 3ZTDA 1GPXA 2WHIA 3WCQA 1QOGA 2HTME 2K5PA 1LO5D 3RD2A 1FCCC 4HJGE 4NAWB 2OHFA 1WGGA 3FKYA 1I4QA 3UGBB 4KSKC 2KOXA 3ZJVA 1VZ7A 3AEGB 3Q3MC 1C76A 1K51A 2LWPA 4KKJA 3HVZA 1T3QA 2AWTA 1EF1A 4ITKA 3RCZA 2WXIA 4CO7A 4W9CA 4EFOA 1C4CA 2KFKB 1SIFA 2KDIA 3ZGZA 2WXHA 4NZLB 3A1QA 2G45B 2Y5BB 3AECB 1HQRD 1R4NI 1R4NB 2V9HA 3VFKA 2DYBA 3Q14C 3T9LA 5IKCM 5D3IB 2LVQA 2RR9A 2SAKA 3AN1A 1WRDB 3EUB2 1UWMA 4WJPA 2WWZA 2D3CA 4DHJB 2M56B 1WX8A 5MPOA 5H8YE 1YIWA 2JUOA 1T0QC 2J52A 3OJ3A 5TR5A 1V2YA 3APCA 2BKFA 4KGRA 1C77A 4M0WA 4PS8A 4AWJA 4LLGM 3IAM1 5LLIA 1KF6B 2N9KA 2IY0B 4K1RB 3AH7A 2AQ1B 1FXAA 3R7QA 3QK0A 1NEKB 4P7IA 4N59A 3UI3A 1M4VA 4BKSD 2AL6A 1LXDA 2KMAA 1VCBA 3N30A 4MSMB 1F2RI 1WXSA 3AU5A 3UQBA 2MBHA 1V49A 1WZ3A 4WAAA 3RNFC 1VDVA 4W9EA 2HTHA 3EFUA 1J7CA 3O65B 3BYTB 2KYWA 4IKGA 3ZYYX 1C4AA 1MHHE 5CX3A 2WGSA 2DBYA 1C9FA 1L6UA 4IWQA 1LM8B 1E10A 5EE0A 2N7DA 3HM6X 2K8CA 3A4SC 3NZSA 3APFA 5EE9A 2INPE 2N7EA 2DX5B 4TSSA 3U30A 1QZEA 1JRUA 1UGJA 3RPFC 3VTWA 3QIJA 4MGKE 4ZYNA 3OJ4B 5DPTA 3P4PB 1WF9A 2BTEA 3KUDB 5DCNA 3PTFC 1YX6B 2KDEB 1WGHA 3P2BA 1A5RA 4I6LB 4BOZB 3V61A 1ZXHA 1UGMA 3GS2A 3PSEB 2R2OA 2J0MA 4GMVA 2KX0A 1L4ZB 4OVVA 2N1VA 1YJIA 3SFEB 4FJZA 3URYA 1OEYJ 2BWES 2G1EA 3R7RA 5EE3A 2J7QB 2PVOD 1IBXA 1I4XA 4I6PA 3Q8EA 1SJED 3HHMA 1DYQA 4GOCA 3K9PB 1WYGA 2CU1A 2W3RA 3H9DA 4ZRKA 1SIJA 3U7ZA 2JT4B 5D3DA 2LGDA 2JQRB 2KWVB 2INDC 5BMHA 3ZDTA 5HG2A 3IBEA 3LDZE 1NYQA 1T0RC 2L05A 3NY5A 1N60A 1YNTE 4LNFA 3DVNU 3ZRFA 1IYFA 4MH0E 3W5UB 2BPSA 2JF5A 4W9DA 2HD5B 4GDKB 1G6JA 3CWIA 1I4HA 2SEBD 4S0RA 4YXDB 4NAMA 3HRDD 1BXTA 1UZXB 3P4SB 2H88B 3P4QB 1F9JA 3RZWC 1WZ0A 3AI5A 4ZRJA 1I7HA 1KLUD 4N9F4 2KD0A 5AZHA 3VDZA 4TUUA 2KNBA 4AJWA 3HK0A 1M94A 3W5VB 2WS3B 3WAPA 3A4RA 3PLUA 4FLHA 2X38A 4ICVA 2WXKA 3ENEA 1PUTA 2LEKA 2PVGC 2UU7A 2BYVE 4HLEA 2J0KA 4RF1A 1WWTA 2C7HA 3R8BA 1OEYA 4YT0B 5EE1A 3RN9C 2G3QB 3IT6B 2KC2A 3PRMB 5JZEB 4KV2A 3B9JA 2K1FA 3MP9A 3NRZA 3PHXB 2FCSA 3HVDA 1VZ8A 2C5LC 3IXSA 2BF8B 2NBUA 3T8MA 4A8XC 4ANXA 2PJHA 2ON8A 2KFKA 4GSWA 3AU4A 3M62B 2QCZA 2BKRB 5GMVA 3PT2B 1UH6A 3ONSA 3QC8B 1QT9A 2OEDA 2N9XA 3QX1A 1Q1OA 2L00B 5C2TB 1DOIA 3U2SC 2LGXA 4C56C 1RFKA 5HHDG 1ZPSA 1ZUD2 4DHJD 2WP9B 4GU2A 3PZDA 2IDYA 1I35A 4M8NA 1EM7A 2WDQB 1F2RC 3AE6B 2RPQA 4HVBA 3ZNZB 3KUZA 3Q8AA 3D32A 3KW5B 4IM0A 1K53A 2FNJB 2YLMA 2M17A 2J0JA 1WJ4A 2K9XA 4A90A 2DNFA 5I4DA 1ACCA 1ET6A 1E9MA 3HUIA 4TQ0A 4EZJA 1PFDA 2ZPNA 3JSVB 1MI0A 1V1PB 4G50A 4WAFA 2ZZPB 4HCNB 2DZKA 1HZ5A 4GDLB 1ZP0B 3ETRA 2QILA 5IOIA 1HXYD 2BYFA 4K81A 3VRBB 5IA7A 3H6NA 1V97A 3SD5A 3UIPB 2JRIB 4W9GA 4ARIA 1E7PB 3NOBA 3ZVVA 4EUTA 3VUYA 5L95C 3V05A 1L5PA 1FIQA 4B0EA 4EEWA 4ANUA 4DXFA 2W55A 2QSDA 3TUOA 3CIRB 3M3JA 1WE6A 1UELA 3W1YA 2Y3AA 4WWPA 2INNE 3KYDD 4GN1A 5CTRC 2GOWA 3BINA 4G11A 4IM3A 2D3BA 2GBKA 4XYCA 3P4RB 3VHTC 4C4VA 2NPTB 3SEBA 1D5MC 1WIAA 2LJ5A 2BBCA 1KLVA 2V1YA 3BVMA 3WA0A 2V3NA 1E7VA 1MFWA 3NS8A 1TKGA 5D6JB 3AE1B 3OLMD 2D2QA 3BK1A 3VUXA 2HDEA 3M63B 3AE2B 1RAXA 5EDSA 2IGHA 2GBMA 3MJWA 3R3MA 4J6IA 4IDIA 4F1SA 3IG3A 1OTRB 3A9JB 3RMKC 5BYSA 3T3OA 5C3JB 3KWVA 2KLGA 1WI0A 3C19A 2CJOA 2I2YA 1J8CA 5JH5C 3VR9B 3TEWA 3QQ8B 4WJOA 3OAWA 2DZJA 4HPMB 5T8IA 5CHFA 1HTOA 1XD3B 1SE4A 1WMHB 2L8JA 5J18A 2WXOA 1BUIC 4W9JA 3UIOB 1QOFA 3TSSA 4KSLC 4GDKA 4RGMA 2H89B 1SXTA 3SU8X 1SB3C 1FRRA 1NDDA 1WXMA 3AEBB 2IZVB 3NZ3A 1PYWD 2LGYA 4WWMA 3QA8A 4S17A 1HEZE 4MSQB 3WAOA 3EFCA 4P6VF 1L2NA 5JXVA 1CZPA 5TSSA 4R3DA 4KX6B 2D07B 3VH4B 4E3CA 3GE3C 4W9LA 3JW0X 4N6EB 1N61A 4ZRPA 3VUWA 4BKGA 2A4ZA 1E90A 1OGWA 1MHXA 2O6VA 1N5XA 2LRUA 2IO2B 3NZUA 1J7BA 2KK8A 1YJ1A 4RFBA 3VTUA 1R4MI 1R4MB 1KM7A 1WX9A 4XDDA 3MC8A 4A6QA 1BMLC 1XT9B 4US8A 2JVCA 2KQ7A 5DPRA 3N32A 2W54A 4NJCA 3Q8FA 4LNNA 1FM0D 4HDQA 3FC4A 1HA5A 2IBIB 1CJEA 1MPEA 4IUMB 1CQVA 3B1LX 4RGOS 2L32A 1FD6A 2O2VB 1FCLA 3P42A 1NENB 4ZOHC 4RM9A 1F52A 1LQBA 1D4BA 4JX1C 5BMIA 1TBEA 3L4PA 1NI2A 4UDUC 2KQSA 2DYOA 2K39A 3OWEB 4XZ4A 1NBFC 3J9CA 3WAMA 2JRHA 2ZCBA 3I3TB 4NNJB 3ZJUA 1P1AA 4M8MA 2MSED 2GMIC 5L83A 1JMLA 1UD7A 3N1ZC 4JLCA 2PPHA 1SE3A 1JROA 3IAS1 4IOIE 4EZLA 2QEJC 1DOYA 2N9LA 4LNIA 1SEBD 3VXWA 1TZ1A 4XWWA 2BVCA 4MGZE 4RF0A 3KLSX 2MLBA 2N7JA 5C23A 1ZDVA 1UF0A 2AEHA 2NTTA 2ZVNA 3I63C 4WWOA 3KH0A 4DHZB 2XK5A 3ZXRA 1WJUA 5DPSA
chains in the Genus database with same CATH topology
1IYFA 2L05A 3NY5A 3DVNU 3ZRFA 4AOFA 2MP2A 4MH0E 2BPSA 2JF5A 4W9DA 2K8HA 2HD5B 4GDKB 4KZCA 2JZZA 4PYUA 2Z0EB 1G6JA 3GOEA 4HK2A 4HJKA 4B6WA 3Q3JA 4ZDVA 4KIKB 1P98A 2M1MA 3BY4B 4IM2A 1UZXB 3DCGA 4AP4C 2BGFA 3K9OB 2DAJA 2XK5B 4IG7B 1E8XA 2WYQA 3RT3B 1F9JA 2I1JA 3PV1A 3RZWC 1WZ0A 3AI5A 4ZRJA 5D7GA 2KJRA 4M0WB 2MA9B 2NBVB 4N9F4 2KD0A 5AZHA 3VDZA 4TUUA 2KNBA 4WWNA 4AJWA 3HK0A 1M94A 4MGIE 2PE9A 3H7SA 4WQOB 2HE7A 3R66C 3WAPA 3A4RA 2AL3A 3PLUA 4FLHA 2DZIA 4CHKA 4MDKE 4ICVA 2PEAA 3U8ZA 3ENEA 4JQWC 1H8CA 2JWZA 2BYVE 4ICUA 4NQKE 4HLEA 4XC2A 2J0KA 2AYOB 4A3PA 1RFAA 4HDOA 2FUHB 4EZKA 2GBRA 2C7HA 2LD9A 1EUVB 2LVPA 4HXDA 1OEYA 2DYMA 3CF6E 2CR5A 1BT0A 2NS5A 3ZIMA 1IP9A 2MBBB 1P9DU 1V80A 2G3QB 2KC2A 3ML9A 2KTRA 1L7YA 3L17A 2OOBB 3PRMB 3QCAA 5J17A 5JZEB 4KV2A 3TBLD 3VAWA 1YQBA 2K1FA 3PHXB 1H4RA 3A9JA 2FCSA 4PYZA 2LXAA 2MBEA 4B95A 2NCNA 3PREA 3TIXA 2LASA 4A20A 3CMMB 2C5LC 2W9NA 4DWFA 1D3ZA 2BF8B 2NBUA 5HKHA 5DPWA 2MRPA 1UBQA 5LXHA 3T8MA 2N9PC 3C0RB 4K7UA 3RZFA 2PJHA 2FCNA 4ANXA 2ZJDA 2D11A 3QJZA 4E71A 2KFKA 3KVFB 4GSWA 3AU4A 2KMCA 1Q0WB 4JL9A 5E6OA 3M62B 2BKRB 5GMVA 2KJ6A 3PT2B 1UH6A 3SHQA 3ZNHB 3ONSA 4FULA 1V5OA 3QC8B 2KFJA 2ZNVC 3U7DA 3HIZA 5G2NA 4TV3A 2N9XA 2KJHB 3X23A 3LDZE 3DDCB 3N3KB 3QX1A 2K25A 1Q1OA 2L00B 1YD8U 1C1YB 2DAFA 2IY1B 3DBSA 3ZNGC 2XEWA 2LGXA 2N4FA 4ANWA 4LJPB 4DK5A 3MHSD 1WX7A 4BOSC 4DHJD 2FCMA 2Z0DB 4HCPB 4GU2A 4W9FA 3PZDA 1I35A 3VVWB 3IFWB 1GC7A 3WALA 2PE6B 2ASQA 4M8NA 4MEMA 2RPQA 3JSVA 2R2QA 1MG8A 3ZNZB 4HVBA 1U4AA 3KUZA 2L7RA 3ZDMC 1T0YA 1ISNA 3D32A 3KW5B 2VRRB 3KYCD 4IM0A 3V6EB 4E74A 4FBJB 3PPAA 2EMTA 4DXAB 2FNJB 2YLMA 3PHWB 2B3AA 2M17A 2J0JA 1WJ4A 4HPLB 3ZRCA 2D10A 4LDTB 3DOWA 3PGEA 5CHVC 2DZMA 4GDLA 4AUQC 5D94A 1WH3A 3CSTA 4MJSA 2KDFB 2KTFA 4FJVB 2MW5A 3L13A 4OVUA 4MM3A 3ZNID 2KWUB 1FXTB 2ZCCA 3VTVA 4TQ0A 4EZJA 2ZPNA 2Z59B 3JSVB 4GB9A 4II2B 2CS4A 4G50A 2LI5A 2ZZPB 1WGRA 5BO4B 4W9IA 3ZTCA 4TQ1A 3ZW3A 2N9EB 2C7NB 4HCNB 2DZKA 4IW0A 2KC1A 2OJRA 3PVLA 3ZLZA 4GDLB 4F7ZA 2I1KA 4ANVA 2QHOA 2KDBA 2MX2A 2LRWA 4MJSB 2G4DB 2ZNVB 2BYFA 2L0TA 4K81A 2UWQA 2WDTB 3H6NA 5IA7A 3V62A 4BFRA 5C1ZA 4GGQA 2IO0B 4IWPA 3SD5A 3B08A 3UIPB 4BKSA 2JRIB 4NY0A 2EKEC 4W9GA 2RGFA 3A9KA 1WJNA 1XQQA 3VQIA 1CMXB 3NOBA 2MP2B 3ZVVA 4G0NB 3VUYA 3X0WA 3Q3FA 3RYTA 4EUTA 5L95C 1Y8RC 2NPTA 3DBLI 4ASWC 4EEWA 2K6DB 2O6VD 2M4NA 4ANUA 2KO3A 4KDLB 3TL5A 1IPGA 2UYZB 3DBRI 3SDLC 4FA6A 3AULA 3A33B 3M3JA 5J2RA 1GUAB 1S1QB 1WE6A 2L76A 1UELA 2C60A 3W1YA 3IVFA 2LUEA 3EECA 4WWPA 3KYDD 4FHJA 4W9HA 4GN1A 5CTRC 2KLCA 2IYDB 2CHXA 2GOWA 3BINA 4G11A 4IM3A 3WIMA 2GBKA 5D2MB 4RMAA 3VHTC 1V6EA 4BBNC 3JVZX 4NAWA 1TGZB 2GBJA 4NJ6A 3L0WB 2NPTB 2ZVOA 1WIAA 2LJ5A 2XBBC 1OQYA 1WYWB 1KLVA 2V1YA 1E8ZA 4DHZE 4F8CB 3WA0A 4TKNA 3ALBA 1E7VA 5KHOA 4FJYA 1SGHA 4FHKA 2KKCA 2RD0A 3NS8A 3PS6A 3GZNI 3H7PA 3ZTDA 1J19A 3UQAA 3NHEB 5D6JB 2CHZA 3DVGX 4JGHB 5G55A 4A3OA 3OLMD 2D2QA 1EO6A 3RD2A 4EKUA 1VD2A 3VUXA 2C9WB 3M63B 1RAXA 4DDGD 2KTRB 5EDSA 4NAWB 1UBIA 4EOYA 3RUIB 3PLVA 2GBMA 3M95A 3MJWA 3R3MA 5AEKB 1WGGA 4J6IA 3DBHI 3UGBB 4KSKC 2KOXA 3APDA 4F1SA 1WMHA 3IG3A 1I42A 1OTRB 3A9JB 2MBOA 2N1WA 2LWPA 4ZRIA 3VH3B 1WM3A 4WJQA 4PS7A 1Q5WB 1RLFA 2AWTA 3PRPB 2JXXA 1EF1A 3L08A 5IAAC 3RCZA 1AARA 2KLGA 4CO7A 5LXIB 1WI0A 4W9CA 4EFOA 1V9JA 1J8CA 4IC7B 1RRBA 4LDTD 5JH5C 2KFKB 1WGYA 1SIFA 2REXA 3QQ8B 2KDIA 4KZ0A 4WJOA 4BBNF 4FADA 1ZW7A 3OAWA 3A1QA 2DZJA 4HPMB 4AJYB 2G45B 2Y5BB 1WE7A 3DPDA 4CYEA 5CHFA 1J0GA 2NVUI 1R4NI 1XD3B 3QARA 1V81A 3VFKA 4DBGA 1WMHB 2L8JA 2DYBA 4WJNA 2K8BA 2ZEQA 3T9LA 3DVGY 5J18A 3L16A 1Z2MA 3EC8A 2KANA 4KVGB 1S3SG 2JZ3B 4HWIB 4W9JA 2LVQA 2RR9A 3UIOB 2L0FA 4FN2A 1WRDB 2JY6A 2BYEA 5JHBA 4KSLC 1YX5B 4K7WA 1PQSA 4WJPA 4GDKA 2WWZA 1X1MA 3TMPB 4DHJB 3HM3A 3A1QB 3SU8X 1WR6E 1NDDA 1WX8A 1WXMA 3V6CB 4KIKA 1EF5A 1YIWA 1Z5SB 2JUOA 2IZVB 3QAQA 2KXJA 4LJOB 1P3QU 3OJ3A 5TR5A 1V2YA 3UF8A 3APCA 2D3GA 2LGYA 4GXBA 2BKFA 2ZPYA 2K6QA 5E6NA 1WJ6A 2IO3B 3QA8A 4PS8A 4X57B 4AWJA 5LLIA 2KZRA 2HJ8A 4II3B 4MSQB 3WAOA 4YL8A 1L2NA 1E8YA 4MGYE 1ZGUB 4NJ7A 2MQJA 2IY0B 1SE9A 4K1RB 3QWZB 2FCQA 2IO1B 2D07B 3VH4B 2NR2A 3ZUNA 4W9LA 4E3CA 3H1UA 3MTNB 3JW0X 1KOTA 2A5UA 2V3SA 3R7QA 3QK0A 4RM8A 4P7IA 3VUWA 3TJPA 1P0RA 4BKGA 4BKSD 2AL6A 2NBWB 1LXDA 2KMAA 2A4ZA 1E90A 1VCBA 1OGWA 3N30A 4IWOA 4MSMB 5FR6A 1WXSA 3AU5A 3UQBA 1E8WA 2MBHA 1V49A 1WZ3A 4WAAA 2O6VA 2FAZA 2LRUA 2IO2B 3NZUA 4DDID 3CSFA 4JIOU 1WFYA 2KK8A 1YJ1A 2KX3A 4W9EA 2HTHA 2O2VA 3EFUA 3KUCB 3ECIA 3O65B 4W9KA 3VTUA 3JYUA 1R4MI 2EMSA 1KM7A 1WX9A 2YVCA 3A9KB 1WY8A 2FIDA 1K8RB 3B0AA 4LCDE 5AZGA 1XT9B 5CX3A 2JVCA 2KQ7A 4XX5A 5DPRA 2KVRA 2FIFA 5JHAA 2KHWB 3N32A 4IWQA 1LM8B 3RULA 3LJ3A 4NQLB 4HDQA 1GJZA 2N7DA 3HM6X 1V5TA 2MBQA 2K8CA 3A4SC 2O6VB 2IBIB 3NZSA 3PRZA 1WGDA 2C7MB 3APFA 4IUMB 3B1LX 3V60A 2DENB 2N7EA 2O2VB 1TTNA 4BKTA 5KHQA 2DX5B 2KWCA 3U30A 4BVUC 3S2AA 4RM9A 1QZEA 1LQBA 1JRUA 3IHPC 3L10B 3ZO5B 1GG3A 3VTWA 3QIJA 2JPHA 4MGKE 1TBEA 2M8SA 4ZYNA 2LXCA 3QHTA 1NI2A 4K7SA 4MELA 1E5WA 3OJ4B 5DPTA 2KQSA 2DYOA 3DVNV 1WF9A 2K39A 3KUDB 5DCNA 3PTFC 1KJTA 1YX6B 2KDEB 1WGHA 4XZ4A 3W1SC 1NBFC 3P2BA 3H7PB 2KN5A 1A5RA 1C3TA 2LVOA 4I6LB 4BOZB 3WAMA 2JRHA 2L3ZA 2ZCBA 3I3TB 4NPNA 3V61A 1UGMA 3EHVA 4NNJB 1WXAA 2GBNA 3PSEB 2M0XA 5AZFA 1P1AA 1WR1A 2CKHB 2R2OA 2MSED 4M8MA 2GMIC 2J0MA 1GC6A 3AXCA 4GMVA 1GNUA 2KX0A 2BWFA 5E6PA 5L83A 4G3XB 4OVVA 1UD7A 2N1VA 4I6NB 2DHZA 2G4SA 4JLCA 4FJZA 3UINB 2PPHA 1OEYJ 4EZLA 1ZKHA 1V86A 4KDIC 2BWES 3TCAA 3R7RA 2WX1A 2J7QB 1WXVA 2MWSB 1HE8A 3DQVA 3VXWA 2WX0A 5CHWA 4I6PA 2V4LA 1TZ1A 3L54A 4GIVA 4MGZE 3HHMA 2MLBA 3ZKJC 4GOCA 5C23A 4PS3A 2AEHA 3W1SA 3K9PB 3ML8A 1WM2A 2ZVNA 4B9KA 1E7UA 2CU1A 4URKA 3H9DA 4ZRKA 4WWOA 3KH0A 2CHWA 2JT4B 2RSUA 2XK5A 4DHZB 1LFDA 2LGDA 2KWVB 1WJUA 3ZDTA 5DPSA 3IBEA 2MCNB 3WANA 2LZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYF A;  2L05 A;  3NY5 A;  3DVN U;  3ZRF A;  4AOF A;  2MP2 A;  4MH0 E;  2BPS A;  2JF5 A;  4W9D A;  2K8H A;  2HD5 B;  4GDK B;  4KZC A;  2JZZ A;  4PYU A;  2Z0E B;  1G6J A;  3GOE A;  4HK2 A;  4HJK A;  4B6W A;  3Q3J A;  4ZDV A;  4KIK B;  1P98 A;  2M1M A;  3BY4 B;  4IM2 A;  1UZX B;  3DCG A;  4AP4 C;  2BGF A;  3K9O B;  2DAJ A;  2XK5 B;  4IG7 B;  1E8X A;  2WYQ A;  3RT3 B;  1F9J A;  2I1J A;  3PV1 A;  3RZW C;  1WZ0 A;  3AI5 A;  4ZRJ A;  5D7G A;  2KJR A;  4M0W B;  2MA9 B;  2NBV B;  4N9F 4;  2KD0 A;  5AZH A;  3VDZ A;  4TUU A;  2KNB A;  4WWN A;  4AJW A;  3HK0 A;  1M94 A;  4MGI E;  2PE9 A;  3H7S A;  4WQO B;  2HE7 A;  3R66 C;  3WAP A;  3A4R A;  2AL3 A;  3PLU A;  4FLH A;  2DZI A;  4CHK A;  4MDK E;  4ICV A;  2PEA A;  3U8Z A;  3ENE A;  4JQW C;  1H8C A;  2JWZ A;  2BYV E;  4ICU A;  4NQK E;  4HLE A;  4XC2 A;  2J0K A;  2AYO B;  4A3P A;  1RFA A;  4HDO A;  2FUH B;  4EZK A;  2GBR A;  2C7H A;  2LD9 A;  1EUV B;  2LVP A;  4HXD A;  1OEY A;  2DYM A;  3CF6 E;  2CR5 A;  1BT0 A;  2NS5 A;  3ZIM A;  1IP9 A;  2MBB B;  1P9D U;  1V80 A;  2G3Q B;  2KC2 A;  3ML9 A;  2KTR A;  1L7Y A;  3L17 A;  2OOB B;  3PRM B;  3QCA A;  5J17 A;  5JZE B;  4KV2 A;  3TBL D;  3VAW A;  1YQB A;  2K1F A;  3PHX B;  1H4R A;  3A9J A;  2FCS A;  4PYZ A;  2LXA A;  2MBE A;  4B95 A;  2NCN A;  3PRE A;  3TIX A;  2LAS A;  4A20 A;  3CMM B;  2C5L C;  2W9N A;  4DWF A;  1D3Z A;  2BF8 B;  2NBU A;  5HKH A;  5DPW A;  2MRP A;  1UBQ A;  5LXH A;  3T8M A;  2N9P C;  3C0R B;  4K7U A;  3RZF A;  2PJH A;  2FCN A;  4ANX A;  2ZJD A;  2D11 A;  3QJZ A;  4E71 A;  2KFK A;  3KVF B;  4GSW A;  3AU4 A;  2KMC A;  1Q0W B;  4JL9 A;  5E6O A;  3M62 B;  2BKR B;  5GMV A;  2KJ6 A;  3PT2 B;  1UH6 A;  3SHQ A;  3ZNH B;  3ONS A;  4FUL A;  1V5O A;  3QC8 B;  2KFJ A;  2ZNV C;  3U7D A;  3HIZ A;  5G2N A;  4TV3 A;  2N9X A;  2KJH B;  3X23 A;  3LDZ E;  3DDC B;  3N3K B;  3QX1 A;  2K25 A;  1Q1O A;  2L00 B;  1YD8 U;  1C1Y B;  2DAF A;  2IY1 B;  3DBS A;  3ZNG C;  2XEW A;  2LGX A;  2N4F A;  4ANW A;  4LJP B;  4DK5 A;  3MHS D;  1WX7 A;  4BOS C;  4DHJ D;  2FCM A;  2Z0D B;  4HCP B;  4GU2 A;  4W9F A;  3PZD A;  1I35 A;  3VVW B;  3IFW B;  1GC7 A;  3WAL A;  2PE6 B;  2ASQ A;  4M8N A;  4MEM A;  2RPQ A;  3JSV A;  2R2Q A;  1MG8 A;  3ZNZ B;  4HVB A;  1U4A A;  3KUZ A;  2L7R A;  3ZDM C;  1T0Y A;  1ISN A;  3D32 A;  3KW5 B;  2VRR B;  3KYC D;  4IM0 A;  3V6E B;  4E74 A;  4FBJ B;  3PPA A;  2EMT A;  4DXA B;  2FNJ B;  2YLM A;  3PHW B;  2B3A A;  2M17 A;  2J0J A;  1WJ4 A;  4HPL B;  3ZRC A;  2D10 A;  4LDT B;  3DOW A;  3PGE A;  5CHV C;  2DZM A;  4GDL A;  4AUQ C;  5D94 A;  1WH3 A;  3CST A;  4MJS A;  2KDF B;  2KTF A;  4FJV B;  2MW5 A;  3L13 A;  4OVU A;  4MM3 A;  3ZNI D;  2KWU B;  1FXT B;  2ZCC A;  3VTV A;  4TQ0 A;  4EZJ A;  2ZPN A;  2Z59 B;  3JSV B;  4GB9 A;  4II2 B;  2CS4 A;  4G50 A;  2LI5 A;  2ZZP B;  1WGR A;  5BO4 B;  4W9I A;  3ZTC A;  4TQ1 A;  3ZW3 A;  2N9E B;  2C7N B;  4HCN B;  2DZK A;  4IW0 A;  2KC1 A;  2OJR A;  3PVL A;  3ZLZ A;  4GDL B;  4F7Z A;  2I1K A;  4ANV A;  2QHO A;  2KDB A;  2MX2 A;  2LRW A;  4MJS B;  2G4D B;  2ZNV B;  2BYF A;  2L0T A;  4K81 A;  2UWQ A;  2WDT B;  3H6N A;  5IA7 A;  3V62 A;  4BFR A;  5C1Z A;  4GGQ A;  2IO0 B;  4IWP A;  3SD5 A;  3B08 A;  3UIP B;  4BKS A;  2JRI B;  4NY0 A;  2EKE C;  4W9G A;  2RGF A;  3A9K A;  1WJN A;  1XQQ A;  3VQI A;  1CMX B;  3NOB A;  2MP2 B;  3ZVV A;  4G0N B;  3VUY A;  3X0W A;  3Q3F A;  3RYT A;  4EUT A;  5L95 C;  1Y8R C;  2NPT A;  3DBL I;  4ASW C;  4EEW A;  2K6D B;  2O6V D;  2M4N A;  4ANU A;  2KO3 A;  4KDL B;  3TL5 A;  1IPG A;  2UYZ B;  3DBR I;  3SDL C;  4FA6 A;  3AUL A;  3A33 B;  3M3J A;  5J2R A;  1GUA B;  1S1Q B;  1WE6 A;  2L76 A;  1UEL A;  2C60 A;  3W1Y A;  3IVF A;  2LUE A;  3EEC A;  4WWP A;  3KYD D;  4FHJ A;  4W9H A;  4GN1 A;  5CTR C;  2KLC A;  2IYD B;  2CHX A;  2GOW A;  3BIN A;  4G11 A;  4IM3 A;  3WIM A;  2GBK A;  5D2M B;  4RMA A;  3VHT C;  1V6E A;  4BBN C;  3JVZ X;  4NAW A;  1TGZ B;  2GBJ A;  4NJ6 A;  3L0W B;  2NPT B;  2ZVO A;  1WIA A;  2LJ5 A;  2XBB C;  1OQY A;  1WYW B;  1KLV A;  2V1Y A;  1E8Z A;  4DHZ E;  4F8C B;  3WA0 A;  4TKN A;  3ALB A;  1E7V A;  5KHO A;  4FJY A;  1SGH A;  4FHK A;  2KKC A;  2RD0 A;  3NS8 A;  3PS6 A;  3GZN I;  3H7P A;  3ZTD A;  1J19 A;  3UQA A;  3NHE B;  5D6J B;  2CHZ A;  3DVG X;  4JGH B;  5G55 A;  4A3O A;  3OLM D;  2D2Q A;  1EO6 A;  3RD2 A;  4EKU A;  1VD2 A;  3VUX A;  2C9W B;  3M63 B;  1RAX A;  4DDG D;  2KTR B;  5EDS A;  4NAW B;  1UBI A;  4EOY A;  3RUI B;  3PLV A;  2GBM A;  3M95 A;  3MJW A;  3R3M A;  5AEK B;  1WGG A;  4J6I A;  3DBH I;  3UGB B;  4KSK C;  2KOX A;  3APD A;  4F1S A;  1WMH A;  3IG3 A;  1I42 A;  1OTR B;  3A9J B;  2MBO A;  2N1W A;  2LWP A;  4ZRI A;  3VH3 B;  1WM3 A;  4WJQ A;  4PS7 A;  1Q5W B;  1RLF A;  2AWT A;  3PRP B;  2JXX A;  1EF1 A;  3L08 A;  5IAA C;  3RCZ A;  1AAR A;  2KLG A;  4CO7 A;  5LXI B;  1WI0 A;  4W9C A;  4EFO A;  1V9J A;  1J8C A;  4IC7 B;  1RRB A;  4LDT D;  5JH5 C;  2KFK B;  1WGY A;  1SIF A;  2REX A;  3QQ8 B;  2KDI A;  4KZ0 A;  4WJO A;  4BBN F;  4FAD A;  1ZW7 A;  3OAW A;  3A1Q A;  2DZJ A;  4HPM B;  4AJY B;  2G45 B;  2Y5B B;  1WE7 A;  3DPD A;  4CYE A;  5CHF A;  1J0G A;  2NVU I;  1R4N I;  1XD3 B;  3QAR A;  1V81 A;  3VFK A;  4DBG A;  1WMH B;  2L8J A;  2DYB A;  4WJN A;  2K8B A;  2ZEQ A;  3T9L A;  3DVG Y;  5J18 A;  3L16 A;  1Z2M A;  3EC8 A;  2KAN A;  4KVG B;  1S3S G;  2JZ3 B;  4HWI B;  4W9J A;  2LVQ A;  2RR9 A;  3UIO B;  2L0F A;  4FN2 A;  1WRD B;  2JY6 A;  2BYE A;  5JHB A;  4KSL C;  1YX5 B;  4K7W A;  1PQS A;  4WJP A;  4GDK A;  2WWZ A;  1X1M A;  3TMP B;  4DHJ B;  3HM3 A;  3A1Q B;  3SU8 X;  1WR6 E;  1NDD A;  1WX8 A;  1WXM A;  3V6C B;  4KIK A;  1EF5 A;  1YIW A;  1Z5S B;  2JUO A;  2IZV B;  3QAQ A;  2KXJ A;  4LJO B;  1P3Q U;  3OJ3 A;  5TR5 A;  1V2Y A;  3UF8 A;  3APC A;  2D3G A;  2LGY A;  4GXB A;  2BKF A;  2ZPY A;  2K6Q A;  5E6N A;  1WJ6 A;  2IO3 B;  3QA8 A;  4PS8 A;  4X57 B;  4AWJ A;  5LLI A;  2KZR A;  2HJ8 A;  4II3 B;  4MSQ B;  3WAO A;  4YL8 A;  1L2N A;  1E8Y A;  4MGY E;  1ZGU B;  4NJ7 A;  2MQJ A;  2IY0 B;  1SE9 A;  4K1R B;  3QWZ B;  2FCQ A;  2IO1 B;  2D07 B;  3VH4 B;  2NR2 A;  3ZUN A;  4W9L A;  4E3C A;  3H1U A;  3MTN B;  3JW0 X;  1KOT A;  2A5U A;  2V3S A;  3R7Q A;  3QK0 A;  4RM8 A;  4P7I A;  3VUW A;  3TJP A;  1P0R A;  4BKG A;  4BKS D;  2AL6 A;  2NBW B;  1LXD A;  2KMA A;  2A4Z A;  1E90 A;  1VCB A;  1OGW A;  3N30 A;  4IWO A;  4MSM B;  5FR6 A;  1WXS A;  3AU5 A;  3UQB A;  1E8W A;  2MBH A;  1V49 A;  1WZ3 A;  4WAA A;  2O6V A;  2FAZ A;  2LRU A;  2IO2 B;  3NZU A;  4DDI D;  3CSF A;  4JIO U;  1WFY A;  2KK8 A;  1YJ1 A;  2KX3 A;  4W9E A;  2HTH A;  2O2V A;  3EFU A;  3KUC B;  3ECI A;  3O65 B;  4W9K A;  3VTU A;  3JYU A;  1R4M I;  2EMS A;  1KM7 A;  1WX9 A;  2YVC A;  3A9K B;  1WY8 A;  2FID A;  1K8R B;  3B0A A;  4LCD E;  5AZG A;  1XT9 B;  5CX3 A;  2JVC A;  2KQ7 A;  4XX5 A;  5DPR A;  2KVR A;  2FIF A;  5JHA A;  2KHW B;  3N32 A;  4IWQ A;  1LM8 B;  3RUL A;  3LJ3 A;  4NQL B;  4HDQ A;  1GJZ A;  2N7D A;  3HM6 X;  1V5T A;  2MBQ A;  2K8C A;  3A4S C;  2O6V B;  2IBI B;  3NZS A;  3PRZ A;  1WGD A;  2C7M B;  3APF A;  4IUM B;  3B1L X;  3V60 A;  2DEN B;  2N7E A;  2O2V B;  1TTN A;  4BKT A;  5KHQ A;  2DX5 B;  2KWC A;  3U30 A;  4BVU C;  3S2A A;  4RM9 A;  1QZE A;  1LQB A;  1JRU A;  3IHP C;  3L10 B;  3ZO5 B;  1GG3 A;  3VTW A;  3QIJ A;  2JPH A;  4MGK E;  1TBE A;  2M8S A;  4ZYN A;  2LXC A;  3QHT A;  1NI2 A;  4K7S A;  4MEL A;  1E5W A;  3OJ4 B;  5DPT A;  2KQS A;  2DYO A;  3DVN V;  1WF9 A;  2K39 A;  3KUD B;  5DCN A;  3PTF C;  1KJT A;  1YX6 B;  2KDE B;  1WGH A;  4XZ4 A;  3W1S C;  1NBF C;  3P2B A;  3H7P B;  2KN5 A;  1A5R A;  1C3T A;  2LVO A;  4I6L B;  4BOZ B;  3WAM A;  2JRH A;  2L3Z A;  2ZCB A;  3I3T B;  4NPN A;  3V61 A;  1UGM A;  3EHV A;  4NNJ B;  1WXA A;  2GBN A;  3PSE B;  2M0X A;  5AZF A;  1P1A A;  1WR1 A;  2CKH B;  2R2O A;  2MSE D;  4M8M A;  2GMI C;  2J0M A;  1GC6 A;  3AXC A;  4GMV A;  1GNU A;  2KX0 A;  2BWF A;  5E6P A;  5L83 A;  4G3X B;  4OVV A;  1UD7 A;  2N1V A;  4I6N B;  2DHZ A;  2G4S A;  4JLC A;  4FJZ A;  3UIN B;  2PPH A;  1OEY J;  4EZL A;  1ZKH A;  1V86 A;  4KDI C;  2BWE S;  3TCA A;  3R7R A;  2WX1 A;  2J7Q B;  1WXV A;  2MWS B;  1HE8 A;  3DQV A;  3VXW A;  2WX0 A;  5CHW A;  4I6P A;  2V4L A;  1TZ1 A;  3L54 A;  4GIV A;  4MGZ E;  3HHM A;  2MLB A;  3ZKJ C;  4GOC A;  5C23 A;  4PS3 A;  2AEH A;  3W1S A;  3K9P B;  3ML8 A;  1WM2 A;  2ZVN A;  4B9K A;  1E7U A;  2CU1 A;  4URK A;  3H9D A;  4ZRK A;  4WWO A;  3KH0 A;  2CHW A;  2JT4 B;  2RSU A;  2XK5 A;  4DHZ B;  1LFD A;  2LGD A;  2KWV B;  1WJU A;  3ZDT A;  5DPS A;  3IBE A;  2MCN B;  3WAN A;  2LZ6 A; 
#chains in the Genus database with same CATH topology
 2FBW B;  5E6J A;  1CK1 A;  2JZZ A;  3AMZ A;  2Z0E B;  2BB5 A;  3Q3J A;  4KIK B;  1P98 A;  2M1M A;  1SSN A;  3N1Y C;  1JW9 D;  4RNA A;  3K9O B;  3RT3 B;  1E8X A;  1ZDX A;  2PLP A;  4BAX A;  3PV1 A;  2KJR A;  2PW9 A;  2MA9 B;  1YN3 A;  1F77 A;  4MGI E;  2HE7 A;  4CHK A;  4HPP A;  1H8C A;  1B1Z A;  1JWU D;  2JWZ A;  4JPS A;  1L0X B;  4A3P A;  1YOV B;  1EUV B;  3CF6 E;  3NVZ A;  5G5G A;  1D5Z C;  2VZK B;  1L7Y A;  3NG0 A;  2OOB B;  3QCA A;  1YQB A;  4HEA 1;  3A9J A;  1FFU A;  2LXA A;  4B95 A;  2NCN A;  3AE9 B;  1RM6 C;  2I38 A;  4GLS C;  4OZA A;  5BYQ A;  1JRP A;  1T6B X;  4ZHP A;  1FMA D;  5HKH A;  5LXH A;  1P7E A;  3AM9 A;  1NI3 A;  5FK9 C;  2D11 A;  3QJZ A;  3KVF B;  2QJL A;  1UWX A;  3GP7 A;  4FUL A;  5IN7 A;  4OZC A;  3U7D A;  5G2N A;  4C7Z A;  5BYR A;  1PGB A;  2AX5 A;  3DDC B;  3N3K B;  2K25 A;  1C1Y B;  2DAF A;  3ZNG C;  3AB5 A;  4LJP B;  1T0S C;  1XLN A;  1T5X D;  3MHS D;  4BOS C;  1D5X C;  3R2I A;  4W9F A;  3VVW B;  1AW7 A;  1VLB A;  3WAL A;  1FFV A;  2ASQ A;  1RWS A;  3DHG C;  3NS1 A;  4MEM A;  1MG8 A;  2GLS A;  3FIL B;  4DQO C;  2J4X A;  3ZQ4 A;  3KYC D;  4HRS A;  2KQ4 X;  2B3A A;  2B76 B;  3PGE A;  2DZM A;  2JWU A;  4AUQ C;  2BS3 B;  4KKI A;  4MJS A;  2KTF A;  4RCO A;  3ZNI D;  4P16 A;  2CS4 A;  2LI5 A;  1MG4 A;  3ZW3 A;  1ESF A;  2LGI A;  4IW0 A;  2X8X X;  2KC1 A;  4H2A A;  3ZLZ A;  3AE3 B;  2I1K A;  3I5J C;  2MX2 A;  2ZNV B;  4LTU A;  2L0T A;  4EE2 A;  2WDT B;  2WXF A;  3V62 A;  4BFR A;  5C1Z A;  1XCT L;  4IWP A;  3B08 A;  5H92 C;  4NY0 A;  2RGF A;  1GAQ B;  1CMX B;  2MP2 B;  3BK2 A;  5FR3 A;  2CJN A;  2VH2 A;  4AS1 A;  3TL5 A;  3SDL C;  1I4P A;  2UYZ B;  5J2R A;  3ZJT A;  1S1Q B;  3I9V 1;  2KT7 A;  2L76 A;  3SR6 A;  2KLC A;  2CHX A;  1I4R A;  1L6V A;  1JQ4 A;  1V6E A;  3JVZ X;  4NAW A;  4MAC A;  3L0W B;  2ZVO A;  2XBB C;  1OQY A;  1L0Y B;  4JE3 B;  1WYW B;  1E8Z A;  4F8C B;  3ALB A;  4L1B A;  4FJY A;  4YSZ B;  2KKC A;  3PS6 A;  2MH7 A;  3UQA A;  1N5W A;  2EEL A;  4K3B A;  2VH1 A;  4JGH B;  5G55 A;  1VD2 A;  4DDG D;  1C4P A;  4EOY A;  3RUI B;  3PLV A;  5AEK B;  2EKI A;  4MT5 A;  3AEE B;  3DBH I;  3DBH B;  1ROE A;  4REZ A;  4JWS C;  3I57 A;  2MBO A;  4USA A;  2WXN A;  2PTL A;  4ZRI A;  3VH3 B;  1WM3 A;  2LFI A;  4WJQ A;  3U52 E;  1PDX A;  3PRP B;  2JXX A;  3SFD B;  3L08 A;  5IAA C;  1AAR A;  3BVG A;  4IC7 B;  4LDT D;  1WGY A;  2REX A;  4KZ0 A;  3MC0 B;  4FAD A;  2IGD A;  1F1H A;  3DPD A;  5AUI A;  4FXC A;  1J0G A;  4DBG A;  1V81 A;  5LNK 1;  2ZEQ A;  3DVG Y;  1E6E B;  4LNO A;  1Z2M A;  2JU6 X;  2KAN A;  4KVG B;  2JZ3 B;  2WXQ A;  4HRO A;  4HWI B;  1HZ6 A;  1XLP A;  2JY6 A;  1R7S A;  5JHB A;  1YX5 B;  4YWG G;  4KGT A;  1PQS A;  3N20 C;  1N62 A;  1TKY A;  3TMP B;  1F0Z A;  3A1Q B;  2V0G A;  1Y56 A;  3V6C B;  4KIK A;  1EF5 A;  1Z5S B;  3QAQ A;  2KXJ A;  2D3G A;  2K6Q A;  1D6E C;  1KTK A;  3LB8 C;  3BVZ A;  3P1M A;  2KZR A;  2HJ8 A;  4BZA A;  1MVK A;  4MGY E;  2MQJ A;  1SE9 A;  3QWZ B;  2FCQ A;  2NR2 A;  3U4E G;  4P1B C;  3MTN B;  1KOT A;  2A5U A;  4RM8 A;  2WNM A;  3TJP A;  4ZYS A;  5G5H A;  1P0R A;  2NBW B;  2VZK D;  5FR6 A;  4JIO U;  3OG5 A;  1WFY A;  4W9K A;  1TS5 A;  4XDC A;  3JYU A;  2EMS A;  4PK1 A;  1WY8 A;  2FID A;  4OZB A;  2DLB A;  3B0A A;  5AZG A;  3N9Y C;  4XX5 A;  2KVR A;  2FIF A;  5JHA A;  2KHW B;  4C80 A;  1FXI A;  1GJZ A;  1V5T A;  3PRZ A;  1WGD A;  2C7M B;  1ET9 A;  1B9R A;  3MC9 A;  1UUP A;  1SJH D;  4BKT A;  3LXF A;  3ABV B;  2TSS A;  1FNW A;  4BVU C;  5AUK A;  1ZE3 D;  1STE A;  3BYY B;  3IHP C;  3L10 B;  3ZO5 B;  2WXJ A;  2JPH A;  2LXC A;  1TS3 A;  1VZ6 A;  1XXG A;  4TMA B;  1C3T A;  1JWM D;  1TT5 B;  3H7P B;  2QDF A;  2E3T A;  4YSX B;  4A9A A;  3EHV A;  3FIL A;  1WXA A;  2M0X A;  1WR1 A;  2CKH B;  3MFG A;  3AXC A;  5E6P A;  4OVZ A;  1L0V B;  1OQQ A;  4G3X B;  4I6N B;  2G4S A;  1E0Z A;  3UIN B;  1LGR A;  2WXG A;  1V86 A;  4KDI C;  1GOZ A;  1K50 A;  2WX1 A;  1SF0 A;  2GB1 A;  1WXV A;  5CHW A;  1QKZ A;  2NMQ A;  3L54 A;  3Q8C A;  4PS3 A;  2PMV A;  4B9K A;  1TIF A;  4URK A;  2CHW A;  1LFD A;  2JSV X;  3RNG C;  2KVZ A;  1QF6 A;  2PKO A;  5IP4 D;  2JX5 A;  2YEP B;  1IUE A;  2RDB C;  1IBX B;  2GI9 A;  2MP2 A;  3BWU D;  2K8H A;  4KZC A;  4PYU A;  4HJK A;  4B6W A;  3BY4 B;  3DCG A;  2BGF A;  2FE8 A;  4IG7 B;  2WYQ A;  3N1X C;  5HI1 A;  3RNB C;  4D2K A;  4WQO B;  3R66 C;  2AL3 A;  4MDK E;  3RFZ B;  1QIL A;  2GRI A;  1V1O A;  4NQK E;  4ICU A;  2KAC A;  4XC2 A;  2AYO B;  2K22 A;  4HDO A;  4EZK A;  2GBR A;  2LVP A;  4Q2J A;  2BT6 A;  3LYY A;  2CR5 A;  2NS5 A;  3EGR A;  1P9D U;  3ML9 A;  1N6Z A;  5J17 A;  1WRI A;  3TBL D;  5GXG B;  4ARC A;  4WUR A;  1OFF A;  1H4R A;  2D3A A;  3PRE A;  3CMM B;  4DWF A;  2BW2 A;  5DPW A;  2MRP A;  1UBQ A;  3PZ8 A;  3C0R B;  3RZF A;  3NJT A;  3NVV A;  2RDH A;  3TEY A;  1TYG B;  5E6O A;  3DHI C;  2KJ6 A;  2LUM A;  3SHQ A;  3ZNH B;  2IGG A;  3HIZ A;  4TV3 A;  3X23 A;  4XWT A;  2IY1 B;  2XEW A;  4LK0 M;  2N4F A;  2K3U A;  2IJ0 A;  4ANW A;  1WX7 A;  2Z0D B;  4HCP B;  4KGS A;  4M01 A;  1GC7 A;  2NTS A;  3JSV A;  2R2Q A;  1V1P A;  1XLQ A;  4P1C C;  2L7R A;  4O1N A;  3RNA C;  2VRR B;  4FBJ B;  4DXA B;  3PHW B;  3ZRC A;  2D10 A;  4LDT B;  3DOW A;  2ONQ A;  4OW0 A;  4GDL A;  3Q3N C;  4M02 A;  5D94 A;  1WH3 A;  1XF5 L;  4LNK A;  2KDF B;  1YN5 A;  4FJV B;  4C7Y A;  2MW5 A;  3L13 A;  1QLB B;  1C79 A;  2KWU B;  3RNC C;  2MJE A;  2Z59 B;  4II2 B;  4DXG A;  1AYF A;  2G9H D;  1YJJ A;  3ZTC A;  4TQ1 A;  2DWQ A;  1PGX A;  3PVL A;  2QMT A;  4F7Z A;  3NVW A;  2QHO A;  1DOX A;  2G4D B;  2CU3 A;  1EU4 A;  4K3C A;  4GGQ A;  4BKS A;  3VQI A;  1AN8 A;  2OJW A;  3VRA B;  5HFY A;  3RYT A;  1Y8R C;  2NPT A;  1EWC A;  2LMC A;  4KDL B;  1IPG A;  1UNS A;  1GUA B;  2C60 A;  3RNE C;  2LHD A;  2LUE A;  3EEC A;  4FHJ A;  3TEZ A;  4J3O D;  2KAJ A;  2KN4 A;  2INC C;  4YTM B;  4BBN C;  1TGZ B;  4NJ6 A;  2R61 A;  4AQ7 A;  1JWS D;  5KHO A;  3B2G A;  2RD0 A;  2PIA A;  4YTN B;  3H7P A;  1J19 A;  3NHE B;  2CHZ A;  3DVG X;  4A3O A;  1FEH A;  1EO6 A;  4EKU A;  2WXL A;  2C9W B;  1KFY B;  2KTR B;  4C4V B;  1ENF A;  1UBI A;  3VR8 B;  3M95 A;  1JCK B;  3APD A;  1WMH A;  1I42 A;  2Z8L A;  2N1W A;  1SE2 A;  4HKQ A;  4PS7 A;  1Q5W B;  2L83 A;  2WDV B;  1RLF A;  1MJD A;  5LXI B;  3PZ7 A;  1V9J A;  1N63 A;  1RRB A;  4BBN F;  1ZW7 A;  2ZW0 A;  4AJY B;  1WE7 A;  4CYE A;  3W2D A;  2NVU I;  3QAR A;  4WJN A;  2K8B A;  2JYT A;  3GE8 C;  3L16 A;  3EC8 A;  2ACZ B;  1S3S G;  1VR9 A;  2L0F A;  4FN2 A;  2BYE A;  4K7W A;  2WLB A;  1FNU A;  1X1M A;  4ZRQ A;  3HM3 A;  2JXT A;  1WR6 E;  2YEP F;  4LJO B;  1P3Q U;  1QOA A;  3UF8 A;  1TZO A;  1QQR A;  4GXB A;  2ZPY A;  5E6N A;  1TS2 A;  1WJ6 A;  2IO3 B;  4X57 B;  2JYE A;  2BS4 B;  4II3 B;  4YL8 A;  1E8Y A;  1FRD A;  1ZGU B;  4NJ7 A;  3Q69 A;  4MM3 B;  3Q6B A;  2IO1 B;  3ZUN A;  3H1U A;  3H8H A;  1YN4 A;  2V3S A;  1JAL A;  3NUH B;  2LGS A;  5IO9 A;  4IWO A;  3KQ4 A;  1E8W A;  2FAZ A;  1L4D B;  4DDI D;  1HTQ A;  2W3S A;  3CSF A;  3DHH C;  3DWG C;  2KX3 A;  2O2V A;  3KUC B;  3ECI A;  2KMM A;  2YVC A;  3A9K B;  2IPK D;  2WU5 B;  3AED B;  1K8R B;  4LCD E;  2JZP A;  3T3N A;  2N0S B;  3RUL A;  3LJ3 A;  4NQL B;  3AE4 B;  1FPY A;  3PO0 A;  2MBQ A;  1JWB D;  2O6V B;  3R2T A;  3V60 A;  1NYR A;  2DEN B;  5KHQ A;  1TTN A;  1NVI D;  2KWC A;  3S2A A;  2XNA C;  4C00 A;  1GG3 A;  3AE5 B;  2MHJ A;  2M8S A;  3QHT A;  4K7S A;  4MEL A;  2LJI A;  1E5W A;  1XCQ L;  3E56 A;  2V4I B;  3DWM A;  3DVN V;  3W1S C;  1KJT A;  2KN5 A;  1K52 A;  1VRA B;  2LVO A;  2L3Z A;  4NPN A;  2GBN A;  1IGC A;  5AZF A;  2ICI A;  1GC6 A;  1GNU A;  2BWF A;  4WH4 A;  2DHZ A;  1Q10 A;  1IGD A;  1ZKH A;  3RI7 C;  1TY0 A;  3TCA A;  3FAH A;  1JWA D;  4CQN A;  2MWS B;  1HE8 A;  3DQV A;  2WXM A;  2WX0 A;  2V4L A;  4GIV A;  2L52 A;  3ZKJ C;  3AEA B;  2MJ3 A;  4B0M A;  4L2Y A;  3W9C B;  3W1S A;  3ML8 A;  1WM2 A;  2HJ1 A;  1E7U A;  3BII D;  2RSU A;  3Q3O C;  2WU2 B;  3Q8B A;  2MCN B;  3WAN A;  2LZ6 A;  4XGA B;  4YTP B;  4AOF A;  2BB6 A;  3ZXV A;  1GB4 A;  2QC8 A;  1ZXI A;  3GOE A;  4HK2 A;  2M0A A;  4ZDV A;  4IM2 A;  1TY2 A;  2MEK A;  2BYT A;  2M19 A;  4AP4 C;  2DAJ A;  2XK5 B;  2I1J A;  4MH8 A;  5D7G A;  1EWY C;  4M0W B;  2NBV B;  1OQR A;  2E6X A;  4WWN A;  1FNV A;  2L1A A;  2PE9 A;  3H7S A;  4US9 A;  1ZOY B;  3O13 A;  3NVY A;  4WIP A;  2DZI A;  2WDR B;  4XE0 A;  1PGA A;  2PEA A;  3U8Z A;  1YQ3 B;  4JQW C;  2D5G A;  4QAY A;  1KRH A;  5FKA C;  3B2F A;  1DGJ A;  1RFA A;  2FUH B;  1C78 A;  2LD9 A;  4HXD A;  2DYM A;  3MJ5 A;  1BT0 A;  3ZIM A;  4ACF A;  1IP9 A;  1XLO A;  2MBB B;  1V80 A;  2MJD A;  3BZD B;  1TKE A;  2KTR A;  3L17 A;  4PT5 A;  3VAW A;  1YQ4 B;  4RGT A;  4L23 A;  2LHE A;  5BMG A;  4PYZ A;  2MBE A;  3TIX A;  1XEE A;  2LAS A;  4A20 A;  2W9N A;  1D3Z A;  2J53 A;  2N9P C;  1WSP A;  2WQY B;  2WXP A;  2Y5C A;  4K7U A;  1J7A A;  2FCN A;  2ZJD A;  4E71 A;  2KWD A;  2KMC A;  1Q0W B;  4JWU C;  4JL9 A;  4RH6 A;  2ZW1 A;  1V5O A;  2KFJ A;  2ZNV C;  1YMH E;  2KJH B;  2RDG A;  1WGK A;  3GB1 A;  1YD8 U;  3DBS A;  1EU3 A;  2QIE B;  1TS4 A;  4DK5 A;  2BQQ A;  2FCM A;  3IFW B;  1TJE A;  2PE6 B;  1A70 A;  3V3X A;  1U4A A;  3ZDM C;  1T0Y A;  1ISN A;  1I4G A;  3V6E B;  4E74 A;  3AEF B;  3PPA A;  2EMT A;  3Q2A C;  1VJK A;  1GB1 A;  4HPL B;  3AV8 A;  5CHV C;  2RPV A;  2W82 A;  1QOB A;  4M00 A;  3AE7 B;  3CST A;  4OVU A;  4MM3 A;  1FXT B;  2ZCC A;  3EA6 A;  3VTV A;  1AWD A;  4GB9 A;  3TEX A;  4WQM A;  1WGR A;  3AE8 B;  4W9I A;  5BO4 B;  2N9E B;  2C7N B;  2OJR A;  2WXR A;  1KH0 A;  1SBB B;  4ANV A;  2KDB A;  1KLG D;  2XN9 C;  2LRW A;  3E9S A;  3IT4 B;  4MJS B;  1RYJ A;  4RGN A;  4ZHO A;  2UWQ A;  2IO0 B;  2EKE C;  3A9K A;  1WJN A;  1XQQ A;  2Y5P A;  2KDM A;  4G0N B;  3X0W A;  3KWL A;  3MHZ A;  3Q3F A;  4N58 A;  1XO3 A;  3P63 A;  3DBL I;  3DBL B;  4ASW C;  2K6D B;  2O6V D;  2M4N A;  2KO3 A;  2V3P A;  3DBR I;  3DBR B;  4YSY B;  2J42 A;  4FA6 A;  4HKZ E;  3AUL A;  3A33 B;  3IVF A;  4W9H A;  2IYD B;  4OHJ A;  3WIM A;  3C8Y A;  2AQ3 B;  1WXQ A;  5D2M B;  4RMA A;  2RMM A;  1FO4 A;  2GBJ A;  2Q5W D;  2K0P A;  2FUG 1;  1P7F A;  4DHZ E;  2AQ2 B;  4TKN A;  2BS2 B;  1SGH A;  4FHK A;  3GZN I;  3GZN B;  1V8C A;  4A55 A;  3ZTD A;  1GPX A;  2WHI A;  3WCQ A;  1QOG A;  2HTM E;  2K5P A;  1LO5 D;  3RD2 A;  1FCC C;  4HJG E;  4NAW B;  2OHF A;  1WGG A;  3FKY A;  1I4Q A;  3UGB B;  4KSK C;  2KOX A;  3ZJV A;  1VZ7 A;  3AEG B;  3Q3M C;  1C76 A;  1K51 A;  2LWP A;  4KKJ A;  3HVZ A;  1T3Q A;  2AWT A;  1EF1 A;  4ITK A;  3RCZ A;  2WXI A;  4CO7 A;  4W9C A;  4EFO A;  1C4C A;  2KFK B;  1SIF A;  2KDI A;  3ZGZ A;  2WXH A;  4NZL B;  3A1Q A;  2G45 B;  2Y5B B;  3AEC B;  1HQR D;  1R4N I;  1R4N B;  2V9H A;  3VFK A;  2DYB A;  3Q14 C;  3T9L A;  5IKC M;  5D3I B;  2LVQ A;  2RR9 A;  2SAK A;  3AN1 A;  1WRD B;  3EUB 2;  1UWM A;  4WJP A;  2WWZ A;  2D3C A;  4DHJ B;  2M56 B;  1WX8 A;  5MPO A;  5H8Y E;  1YIW A;  2JUO A;  1T0Q C;  2J52 A;  3OJ3 A;  5TR5 A;  1V2Y A;  3APC A;  2BKF A;  4KGR A;  1C77 A;  4M0W A;  4PS8 A;  4AWJ A;  4LLG M;  3IAM 1;  5LLI A;  1KF6 B;  2N9K A;  2IY0 B;  4K1R B;  3AH7 A;  2AQ1 B;  1FXA A;  3R7Q A;  3QK0 A;  1NEK B;  4P7I A;  4N59 A;  3UI3 A;  1M4V A;  4BKS D;  2AL6 A;  1LXD A;  2KMA A;  1VCB A;  3N30 A;  4MSM B;  1F2R I;  1WXS A;  3AU5 A;  3UQB A;  2MBH A;  1V49 A;  1WZ3 A;  4WAA A;  3RNF C;  1VDV A;  4W9E A;  2HTH A;  3EFU A;  1J7C A;  3O65 B;  3BYT B;  2KYW A;  4IKG A;  3ZYY X;  1C4A A;  1MHH E;  5CX3 A;  2WGS A;  2DBY A;  1C9F A;  1L6U A;  4IWQ A;  1LM8 B;  1E10 A;  5EE0 A;  2N7D A;  3HM6 X;  2K8C A;  3A4S C;  3NZS A;  3APF A;  5EE9 A;  2INP E;  2N7E A;  2DX5 B;  4TSS A;  3U30 A;  1QZE A;  1JRU A;  1UGJ A;  3RPF C;  3VTW A;  3QIJ A;  4MGK E;  4ZYN A;  3OJ4 B;  5DPT A;  3P4P B;  1WF9 A;  2BTE A;  3KUD B;  5DCN A;  3PTF C;  1YX6 B;  2KDE B;  1WGH A;  3P2B A;  1A5R A;  4I6L B;  4BOZ B;  3V61 A;  1ZXH A;  1UGM A;  3GS2 A;  3PSE B;  2R2O A;  2J0M A;  4GMV A;  2KX0 A;  1L4Z B;  4OVV A;  2N1V A;  1YJI A;  3SFE B;  4FJZ A;  3URY A;  1OEY J;  2BWE S;  2G1E A;  3R7R A;  5EE3 A;  2J7Q B;  2PVO D;  1IBX A;  1I4X A;  4I6P A;  3Q8E A;  1SJE D;  3HHM A;  1DYQ A;  4GOC A;  3K9P B;  1WYG A;  2CU1 A;  2W3R A;  3H9D A;  4ZRK A;  1SIJ A;  3U7Z A;  2JT4 B;  5D3D A;  2LGD A;  2JQR B;  2KWV B;  2IND C;  5BMH A;  3ZDT A;  5HG2 A;  3IBE A;  3LDZ E;  1NYQ A;  1T0R C;  2L05 A;  3NY5 A;  1N60 A;  1YNT E;  4LNF A;  3DVN U;  3ZRF A;  1IYF A;  4MH0 E;  3W5U B;  2BPS A;  2JF5 A;  4W9D A;  2HD5 B;  4GDK B;  1G6J A;  3CWI A;  1I4H A;  2SEB D;  4S0R A;  4YXD B;  4NAM A;  3HRD D;  1BXT A;  1UZX B;  3P4S B;  2H88 B;  3P4Q B;  1F9J A;  3RZW C;  1WZ0 A;  3AI5 A;  4ZRJ A;  1I7H A;  1KLU D;  4N9F 4;  2KD0 A;  5AZH A;  3VDZ A;  4TUU A;  2KNB A;  4AJW A;  3HK0 A;  1M94 A;  3W5V B;  2WS3 B;  3WAP A;  3A4R A;  3PLU A;  4FLH A;  2X38 A;  4ICV A;  2WXK A;  3ENE A;  1PUT A;  2LEK A;  2PVG C;  2UU7 A;  2BYV E;  4HLE A;  2J0K A;  4RF1 A;  1WWT A;  2C7H A;  3R8B A;  1OEY A;  4YT0 B;  5EE1 A;  3RN9 C;  2G3Q B;  3IT6 B;  2KC2 A;  3PRM B;  5JZE B;  4KV2 A;  3B9J A;  2K1F A;  3MP9 A;  3NRZ A;  3PHX B;  2FCS A;  3HVD A;  1VZ8 A;  2C5L C;  3IXS A;  2BF8 B;  2NBU A;  3T8M A;  4A8X C;  4ANX A;  2PJH A;  2ON8 A;  2KFK A;  4GSW A;  3AU4 A;  3M62 B;  2QCZ A;  2BKR B;  5GMV A;  3PT2 B;  1UH6 A;  3ONS A;  3QC8 B;  1QT9 A;  2OED A;  2N9X A;  3QX1 A;  1Q1O A;  2L00 B;  5C2T B;  1DOI A;  3U2S C;  2LGX A;  4C56 C;  1RFK A;  5HHD G;  1ZPS A;  1ZUD 2;  4DHJ D;  2WP9 B;  4GU2 A;  3PZD A;  2IDY A;  1I35 A;  4M8N A;  1EM7 A;  2WDQ B;  1F2R C;  3AE6 B;  2RPQ A;  4HVB A;  3ZNZ B;  3KUZ A;  3Q8A A;  3D32 A;  3KW5 B;  4IM0 A;  1K53 A;  2FNJ B;  2YLM A;  2M17 A;  2J0J A;  1WJ4 A;  2K9X A;  4A90 A;  2DNF A;  5I4D A;  1ACC A;  1ET6 A;  1E9M A;  3HUI A;  4TQ0 A;  4EZJ A;  1PFD A;  2ZPN A;  3JSV B;  1MI0 A;  1V1P B;  4G50 A;  4WAF A;  2ZZP B;  4HCN B;  2DZK A;  1HZ5 A;  4GDL B;  1ZP0 B;  3ETR A;  2QIL A;  5IOI A;  1HXY D;  2BYF A;  4K81 A;  3VRB B;  5IA7 A;  3H6N A;  1V97 A;  3SD5 A;  3UIP B;  2JRI B;  4W9G A;  4ARI A;  1E7P B;  3NOB A;  3ZVV A;  4EUT A;  3VUY A;  5L95 C;  3V05 A;  1L5P A;  1FIQ A;  4B0E A;  4EEW A;  4ANU A;  4DXF A;  2W55 A;  2QSD A;  3TUO A;  3CIR B;  3M3J A;  1WE6 A;  1UEL A;  3W1Y A;  2Y3A A;  4WWP A;  2INN E;  3KYD D;  4GN1 A;  5CTR C;  2GOW A;  3BIN A;  4G11 A;  4IM3 A;  2D3B A;  2GBK A;  4XYC A;  3P4R B;  3VHT C;  4C4V A;  2NPT B;  3SEB A;  1D5M C;  1WIA A;  2LJ5 A;  2BBC A;  1KLV A;  2V1Y A;  3BVM A;  3WA0 A;  2V3N A;  1E7V A;  1MFW A;  3NS8 A;  1TKG A;  5D6J B;  3AE1 B;  3OLM D;  2D2Q A;  3BK1 A;  3VUX A;  2HDE A;  3M63 B;  3AE2 B;  1RAX A;  5EDS A;  2IGH A;  2GBM A;  3MJW A;  3R3M A;  4J6I A;  4IDI A;  4F1S A;  3IG3 A;  1OTR B;  3A9J B;  3RMK C;  5BYS A;  3T3O A;  5C3J B;  3KWV A;  2KLG A;  1WI0 A;  3C19 A;  2CJO A;  2I2Y A;  1J8C A;  5JH5 C;  3VR9 B;  3TEW A;  3QQ8 B;  4WJO A;  3OAW A;  2DZJ A;  4HPM B;  5T8I A;  5CHF A;  1HTO A;  1XD3 B;  1SE4 A;  1WMH B;  2L8J A;  5J18 A;  2WXO A;  1BUI C;  4W9J A;  3UIO B;  1QOF A;  3TSS A;  4KSL C;  4GDK A;  4RGM A;  2H89 B;  1SXT A;  3SU8 X;  1SB3 C;  1FRR A;  1NDD A;  1WXM A;  3AEB B;  2IZV B;  3NZ3 A;  1PYW D;  2LGY A;  4WWM A;  3QA8 A;  4S17 A;  1HEZ E;  4MSQ B;  3WAO A;  3EFC A;  4P6V F;  1L2N A;  5JXV A;  1CZP A;  5TSS A;  4R3D A;  4KX6 B;  2D07 B;  3VH4 B;  4E3C A;  3GE3 C;  4W9L A;  3JW0 X;  4N6E B;  1N61 A;  4ZRP A;  3VUW A;  4BKG A;  2A4Z A;  1E90 A;  1OGW A;  1MHX A;  2O6V A;  1N5X A;  2LRU A;  2IO2 B;  3NZU A;  1J7B A;  2KK8 A;  1YJ1 A;  4RFB A;  3VTU A;  1R4M I;  1R4M B;  1KM7 A;  1WX9 A;  4XDD A;  3MC8 A;  4A6Q A;  1BML C;  1XT9 B;  4US8 A;  2JVC A;  2KQ7 A;  5DPR A;  3N32 A;  2W54 A;  4NJC A;  3Q8F A;  4LNN A;  1FM0 D;  4HDQ A;  3FC4 A;  1HA5 A;  2IBI B;  1CJE A;  1MPE A;  4IUM B;  1CQV A;  3B1L X;  4RGO S;  2L32 A;  1FD6 A;  2O2V B;  1FCL A;  3P42 A;  1NEN B;  4ZOH C;  4RM9 A;  1F52 A;  1LQB A;  1D4B A;  4JX1 C;  5BMI A;  1TBE A;  3L4P A;  1NI2 A;  4UDU C;  2KQS A;  2DYO A;  2K39 A;  3OWE B;  4XZ4 A;  1NBF C;  3J9C A;  3WAM A;  2JRH A;  2ZCB A;  3I3T B;  4NNJ B;  3ZJU A;  1P1A A;  4M8M A;  2MSE D;  2GMI C;  5L83 A;  1JML A;  1UD7 A;  3N1Z C;  4JLC A;  2PPH A;  1SE3 A;  1JRO A;  3IAS 1;  4IOI E;  4EZL A;  2QEJ C;  1DOY A;  2N9L A;  4LNI A;  1SEB D;  3VXW A;  1TZ1 A;  4XWW A;  2BVC A;  4MGZ E;  4RF0 A;  3KLS X;  2MLB A;  2N7J A;  5C23 A;  1ZDV A;  1UF0 A;  2AEH A;  2NTT A;  2ZVN A;  3I63 C;  4WWO A;  3KH0 A;  4DHZ B;  2XK5 A;  3ZXR A;  1WJU A;  5DPS A; 
#chains in the Genus database with same CATH homology
 1IYF A;  2L05 A;  3NY5 A;  3DVN U;  3ZRF A;  4AOF A;  2MP2 A;  4MH0 E;  2BPS A;  2JF5 A;  4W9D A;  2K8H A;  2HD5 B;  4GDK B;  4KZC A;  2JZZ A;  4PYU A;  2Z0E B;  1G6J A;  3GOE A;  4HK2 A;  4HJK A;  4B6W A;  3Q3J A;  4ZDV A;  4KIK B;  1P98 A;  2M1M A;  3BY4 B;  4IM2 A;  1UZX B;  3DCG A;  4AP4 C;  2BGF A;  3K9O B;  2DAJ A;  2XK5 B;  4IG7 B;  1E8X A;  2WYQ A;  3RT3 B;  1F9J A;  2I1J A;  3PV1 A;  3RZW C;  1WZ0 A;  3AI5 A;  4ZRJ A;  5D7G A;  2KJR A;  4M0W B;  2MA9 B;  2NBV B;  4N9F 4;  2KD0 A;  5AZH A;  3VDZ A;  4TUU A;  2KNB A;  4WWN A;  4AJW A;  3HK0 A;  1M94 A;  4MGI E;  2PE9 A;  3H7S A;  4WQO B;  2HE7 A;  3R66 C;  3WAP A;  3A4R A;  2AL3 A;  3PLU A;  4FLH A;  2DZI A;  4CHK A;  4MDK E;  4ICV A;  2PEA A;  3U8Z A;  3ENE A;  4JQW C;  1H8C A;  2JWZ A;  2BYV E;  4ICU A;  4NQK E;  4HLE A;  4XC2 A;  2J0K A;  2AYO B;  4A3P A;  1RFA A;  4HDO A;  2FUH B;  4EZK A;  2GBR A;  2C7H A;  2LD9 A;  1EUV B;  2LVP A;  4HXD A;  1OEY A;  2DYM A;  3CF6 E;  2CR5 A;  1BT0 A;  2NS5 A;  3ZIM A;  1IP9 A;  2MBB B;  1P9D U;  1V80 A;  2G3Q B;  2KC2 A;  3ML9 A;  2KTR A;  1L7Y A;  3L17 A;  2OOB B;  3PRM B;  3QCA A;  5J17 A;  5JZE B;  4KV2 A;  3TBL D;  3VAW A;  1YQB A;  2K1F A;  3PHX B;  1H4R A;  3A9J A;  2FCS A;  4PYZ A;  2LXA A;  2MBE A;  4B95 A;  2NCN A;  3PRE A;  3TIX A;  2LAS A;  4A20 A;  3CMM B;  2C5L C;  2W9N A;  4DWF A;  1D3Z A;  2BF8 B;  2NBU A;  5HKH A;  5DPW A;  2MRP A;  1UBQ A;  5LXH A;  3T8M A;  2N9P C;  3C0R B;  4K7U A;  3RZF A;  2PJH A;  2FCN A;  4ANX A;  2ZJD A;  2D11 A;  3QJZ A;  4E71 A;  2KFK A;  3KVF B;  4GSW A;  3AU4 A;  2KMC A;  1Q0W B;  4JL9 A;  5E6O A;  3M62 B;  2BKR B;  5GMV A;  2KJ6 A;  3PT2 B;  1UH6 A;  3SHQ A;  3ZNH B;  3ONS A;  4FUL A;  1V5O A;  3QC8 B;  2KFJ A;  2ZNV C;  3U7D A;  3HIZ A;  5G2N A;  4TV3 A;  2N9X A;  2KJH B;  3X23 A;  3LDZ E;  3DDC B;  3N3K B;  3QX1 A;  2K25 A;  1Q1O A;  2L00 B;  1YD8 U;  1C1Y B;  2DAF A;  2IY1 B;  3DBS A;  3ZNG C;  2XEW A;  2LGX A;  2N4F A;  4ANW A;  4LJP B;  4DK5 A;  3MHS D;  1WX7 A;  4BOS C;  4DHJ D;  2FCM A;  2Z0D B;  4HCP B;  4GU2 A;  4W9F A;  3PZD A;  1I35 A;  3VVW B;  3IFW B;  1GC7 A;  3WAL A;  2PE6 B;  2ASQ A;  4M8N A;  4MEM A;  2RPQ A;  3JSV A;  2R2Q A;  1MG8 A;  3ZNZ B;  4HVB A;  1U4A A;  3KUZ A;  2L7R A;  3ZDM C;  1T0Y A;  1ISN A;  3D32 A;  3KW5 B;  2VRR B;  3KYC D;  4IM0 A;  3V6E B;  4E74 A;  4FBJ B;  3PPA A;  2EMT A;  4DXA B;  2FNJ B;  2YLM A;  3PHW B;  2B3A A;  2M17 A;  2J0J A;  1WJ4 A;  4HPL B;  3ZRC A;  2D10 A;  4LDT B;  3DOW A;  3PGE A;  5CHV C;  2DZM A;  4GDL A;  4AUQ C;  5D94 A;  1WH3 A;  3CST A;  4MJS A;  2KDF B;  2KTF A;  4FJV B;  2MW5 A;  3L13 A;  4OVU A;  4MM3 A;  3ZNI D;  2KWU B;  1FXT B;  2ZCC A;  3VTV A;  4TQ0 A;  4EZJ A;  2ZPN A;  2Z59 B;  3JSV B;  4GB9 A;  4II2 B;  2CS4 A;  4G50 A;  2LI5 A;  2ZZP B;  1WGR A;  5BO4 B;  4W9I A;  3ZTC A;  4TQ1 A;  3ZW3 A;  2N9E B;  2C7N B;  4HCN B;  2DZK A;  4IW0 A;  2KC1 A;  2OJR A;  3PVL A;  3ZLZ A;  4GDL B;  4F7Z A;  2I1K A;  4ANV A;  2QHO A;  2KDB A;  2MX2 A;  2LRW A;  4MJS B;  2G4D B;  2ZNV B;  2BYF A;  2L0T A;  4K81 A;  2UWQ A;  2WDT B;  3H6N A;  5IA7 A;  3V62 A;  4BFR A;  5C1Z A;  4GGQ A;  2IO0 B;  4IWP A;  3SD5 A;  3B08 A;  3UIP B;  4BKS A;  2JRI B;  4NY0 A;  2EKE C;  4W9G A;  2RGF A;  3A9K A;  1WJN A;  1XQQ A;  3VQI A;  1CMX B;  3NOB A;  2MP2 B;  3ZVV A;  4G0N B;  3VUY A;  3X0W A;  3Q3F A;  3RYT A;  4EUT A;  5L95 C;  1Y8R C;  2NPT A;  3DBL I;  4ASW C;  4EEW A;  2K6D B;  2O6V D;  2M4N A;  4ANU A;  2KO3 A;  4KDL B;  3TL5 A;  1IPG A;  2UYZ B;  3DBR I;  3SDL C;  4FA6 A;  3AUL A;  3A33 B;  3M3J A;  5J2R A;  1GUA B;  1S1Q B;  1WE6 A;  2L76 A;  1UEL A;  2C60 A;  3W1Y A;  3IVF A;  2LUE A;  3EEC A;  4WWP A;  3KYD D;  4FHJ A;  4W9H A;  4GN1 A;  5CTR C;  2KLC A;  2IYD B;  2CHX A;  2GOW A;  3BIN A;  4G11 A;  4IM3 A;  3WIM A;  2GBK A;  5D2M B;  4RMA A;  3VHT C;  1V6E A;  4BBN C;  3JVZ X;  4NAW A;  1TGZ B;  2GBJ A;  4NJ6 A;  3L0W B;  2NPT B;  2ZVO A;  1WIA A;  2LJ5 A;  2XBB C;  1OQY A;  1WYW B;  1KLV A;  2V1Y A;  1E8Z A;  4DHZ E;  4F8C B;  3WA0 A;  4TKN A;  3ALB A;  1E7V A;  5KHO A;  4FJY A;  1SGH A;  4FHK A;  2KKC A;  2RD0 A;  3NS8 A;  3PS6 A;  3GZN I;  3H7P A;  3ZTD A;  1J19 A;  3UQA A;  3NHE B;  5D6J B;  2CHZ A;  3DVG X;  4JGH B;  5G55 A;  4A3O A;  3OLM D;  2D2Q A;  1EO6 A;  3RD2 A;  4EKU A;  1VD2 A;  3VUX A;  2C9W B;  3M63 B;  1RAX A;  4DDG D;  2KTR B;  5EDS A;  4NAW B;  1UBI A;  4EOY A;  3RUI B;  3PLV A;  2GBM A;  3M95 A;  3MJW A;  3R3M A;  5AEK B;  1WGG A;  4J6I A;  3DBH I;  3UGB B;  4KSK C;  2KOX A;  3APD A;  4F1S A;  1WMH A;  3IG3 A;  1I42 A;  1OTR B;  3A9J B;  2MBO A;  2N1W A;  2LWP A;  4ZRI A;  3VH3 B;  1WM3 A;  4WJQ A;  4PS7 A;  1Q5W B;  1RLF A;  2AWT A;  3PRP B;  2JXX A;  1EF1 A;  3L08 A;  5IAA C;  3RCZ A;  1AAR A;  2KLG A;  4CO7 A;  5LXI B;  1WI0 A;  4W9C A;  4EFO A;  1V9J A;  1J8C A;  4IC7 B;  1RRB A;  4LDT D;  5JH5 C;  2KFK B;  1WGY A;  1SIF A;  2REX A;  3QQ8 B;  2KDI A;  4KZ0 A;  4WJO A;  4BBN F;  4FAD A;  1ZW7 A;  3OAW A;  3A1Q A;  2DZJ A;  4HPM B;  4AJY B;  2G45 B;  2Y5B B;  1WE7 A;  3DPD A;  4CYE A;  5CHF A;  1J0G A;  2NVU I;  1R4N I;  1XD3 B;  3QAR A;  1V81 A;  3VFK A;  4DBG A;  1WMH B;  2L8J A;  2DYB A;  4WJN A;  2K8B A;  2ZEQ A;  3T9L A;  3DVG Y;  5J18 A;  3L16 A;  1Z2M A;  3EC8 A;  2KAN A;  4KVG B;  1S3S G;  2JZ3 B;  4HWI B;  4W9J A;  2LVQ A;  2RR9 A;  3UIO B;  2L0F A;  4FN2 A;  1WRD B;  2JY6 A;  2BYE A;  5JHB A;  4KSL C;  1YX5 B;  4K7W A;  1PQS A;  4WJP A;  4GDK A;  2WWZ A;  1X1M A;  3TMP B;  4DHJ B;  3HM3 A;  3A1Q B;  3SU8 X;  1WR6 E;  1NDD A;  1WX8 A;  1WXM A;  3V6C B;  4KIK A;  1EF5 A;  1YIW A;  1Z5S B;  2JUO A;  2IZV B;  3QAQ A;  2KXJ A;  4LJO B;  1P3Q U;  3OJ3 A;  5TR5 A;  1V2Y A;  3UF8 A;  3APC A;  2D3G A;  2LGY A;  4GXB A;  2BKF A;  2ZPY A;  2K6Q A;  5E6N A;  1WJ6 A;  2IO3 B;  3QA8 A;  4PS8 A;  4X57 B;  4AWJ A;  5LLI A;  2KZR A;  2HJ8 A;  4II3 B;  4MSQ B;  3WAO A;  4YL8 A;  1L2N A;  1E8Y A;  4MGY E;  1ZGU B;  4NJ7 A;  2MQJ A;  2IY0 B;  1SE9 A;  4K1R B;  3QWZ B;  2FCQ A;  2IO1 B;  2D07 B;  3VH4 B;  2NR2 A;  3ZUN A;  4W9L A;  4E3C A;  3H1U A;  3MTN B;  3JW0 X;  1KOT A;  2A5U A;  2V3S A;  3R7Q A;  3QK0 A;  4RM8 A;  4P7I A;  3VUW A;  3TJP A;  1P0R A;  4BKG A;  4BKS D;  2AL6 A;  2NBW B;  1LXD A;  2KMA A;  2A4Z A;  1E90 A;  1VCB A;  1OGW A;  3N30 A;  4IWO A;  4MSM B;  5FR6 A;  1WXS A;  3AU5 A;  3UQB A;  1E8W A;  2MBH A;  1V49 A;  1WZ3 A;  4WAA A;  2O6V A;  2FAZ A;  2LRU A;  2IO2 B;  3NZU A;  4DDI D;  3CSF A;  4JIO U;  1WFY A;  2KK8 A;  1YJ1 A;  2KX3 A;  4W9E A;  2HTH A;  2O2V A;  3EFU A;  3KUC B;  3ECI A;  3O65 B;  4W9K A;  3VTU A;  3JYU A;  1R4M I;  2EMS A;  1KM7 A;  1WX9 A;  2YVC A;  3A9K B;  1WY8 A;  2FID A;  1K8R B;  3B0A A;  4LCD E;  5AZG A;  1XT9 B;  5CX3 A;  2JVC A;  2KQ7 A;  4XX5 A;  5DPR A;  2KVR A;  2FIF A;  5JHA A;  2KHW B;  3N32 A;  4IWQ A;  1LM8 B;  3RUL A;  3LJ3 A;  4NQL B;  4HDQ A;  1GJZ A;  2N7D A;  3HM6 X;  1V5T A;  2MBQ A;  2K8C A;  3A4S C;  2O6V B;  2IBI B;  3NZS A;  3PRZ A;  1WGD A;  2C7M B;  3APF A;  4IUM B;  3B1L X;  3V60 A;  2DEN B;  2N7E A;  2O2V B;  1TTN A;  4BKT A;  5KHQ A;  2DX5 B;  2KWC A;  3U30 A;  4BVU C;  3S2A A;  4RM9 A;  1QZE A;  1LQB A;  1JRU A;  3IHP C;  3L10 B;  3ZO5 B;  1GG3 A;  3VTW A;  3QIJ A;  2JPH A;  4MGK E;  1TBE A;  2M8S A;  4ZYN A;  2LXC A;  3QHT A;  1NI2 A;  4K7S A;  4MEL A;  1E5W A;  3OJ4 B;  5DPT A;  2KQS A;  2DYO A;  3DVN V;  1WF9 A;  2K39 A;  3KUD B;  5DCN A;  3PTF C;  1KJT A;  1YX6 B;  2KDE B;  1WGH A;  4XZ4 A;  3W1S C;  1NBF C;  3P2B A;  3H7P B;  2KN5 A;  1A5R A;  1C3T A;  2LVO A;  4I6L B;  4BOZ B;  3WAM A;  2JRH A;  2L3Z A;  2ZCB A;  3I3T B;  4NPN A;  3V61 A;  1UGM A;  3EHV A;  4NNJ B;  1WXA A;  2GBN A;  3PSE B;  2M0X A;  5AZF A;  1P1A A;  1WR1 A;  2CKH B;  2R2O A;  2MSE D;  4M8M A;  2GMI C;  2J0M A;  1GC6 A;  3AXC A;  4GMV A;  1GNU A;  2KX0 A;  2BWF A;  5E6P A;  5L83 A;  4G3X B;  4OVV A;  1UD7 A;  2N1V A;  4I6N B;  2DHZ A;  2G4S A;  4JLC A;  4FJZ A;  3UIN B;  2PPH A;  1OEY J;  4EZL A;  1ZKH A;  1V86 A;  4KDI C;  2BWE S;  3TCA A;  3R7R A;  2WX1 A;  2J7Q B;  1WXV A;  2MWS B;  1HE8 A;  3DQV A;  3VXW A;  2WX0 A;  5CHW A;  4I6P A;  2V4L A;  1TZ1 A;  3L54 A;  4GIV A;  4MGZ E;  3HHM A;  2MLB A;  3ZKJ C;  4GOC A;  5C23 A;  4PS3 A;  2AEH A;  3W1S A;  3K9P B;  3ML8 A;  1WM2 A;  2ZVN A;  4B9K A;  1E7U A;  2CU1 A;  4URK A;  3H9D A;  4ZRK A;  4WWO A;  3KH0 A;  2CHW A;  2JT4 B;  2RSU A;  2XK5 A;  4DHZ B;  1LFD A;  2LGD A;  2KWV B;  1WJU A;  3ZDT A;  5DPS A;  3IBE A;  2MCN B;  3WAN A;  2LZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...