2FCNA

X-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
total genus 21
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcnA00
3QJZA 4AP4C 2Y5BB 4HCNB 2KLGA 4BKGA 2IO0B 1WX8A 4I6LB 3ZDMC 4W9KA 3RCZA 3WAMA 4HXDA 1UBIA 1EO6A 1WJNA 2MW5A 3B1LX 4MDKE 3PZDA 3V6EB 3VTUA 3R7RA 2KWUB 1E8WA 2BWFA 5L83A 2N9EB 1F9JA 4MEMA 3SU8X 3X23A 3CF6E 3SHQA 2MP2B 4W9EA 3DVGX 3SDLC 4MSQB 3IHPC 5KHQA 3ML8A 1OGWA 2L05A 3H6NA 3KH0A 4LCDE 3APCA 2XBBC 3I3TB 3L10B 3IG3A 2IO1B 2ZPYA 2BF8B 2PE9A 4K7WA 3IBEA 3VQIA 4GB9A 2DYBA 3AI5A 1RAXA 2MQJA 4LJPB 2FCMA 4AJWA 4JQWC 1YQBA 2L0TA 4NY0A 3NS8A 1WGHA 4GSWA 4BKSA 1J19A 1FXTB 2KC1A 2KTRB 2Z0DB 3UGBB 3V6CB 4NNJB 2FCSA 3VUYA 2KX0A 4FADA 2KFJA 1D3ZA 1P1AA 2LGDA 4IUMB 3QQ8B 3V61A 1SGHA 1RRBA 5TR5A 3PLVA 2HTHA 2N7DA 4CYEA 4W9FA 4RM8A 4ICUA 2ZJDA 3KUZA 3A9JB 3K9OB 5AZGA 5IAAC 2JWZA 2KN5A 4JLCA 1WXMA 4E74A 4AUQC 2ZNVC 4DHJB 3R7QA 2B3AA 3QC8B 1C1YB 4B95A 2PPHA 2JPHA 4NJ7A 4PS3A 2MP2A 2K8BA 2PJHA 1Z2MA 5HKHA 1H4RA 5D94A 5DPTA 3TBLD 2I1KA 4IC7B 3ZUNA 2N1VA 1IPGA 2N4FA 3PS6A 2K8CA 4XX5A 4GDKB 1WMHB 2KDFB 3PVLA 4GN1A 4BOZB 2NPTA 5LXHA 4M8MA 2NVUI 4KDIC 4MSMB 4DWFA 4W9HA 2FUHB 3A4RA 5DPWA 2KTRA 5D2MB 4BOSC 2JF5A 3TMPB 1H8CA 5CX3A 3BY4B 2JRIB 1XQQA 2MBQA 4M0WB 4X57B 2EMTA 3VDZA 3ZNZB 5BO4B 2LZ6A 4EOYA 2NBWB 1EF5A 2G4SA 4GIVA 3A9JA 4W9GA 2JRHA 1UGMA 3R3MA 4IWQA 2ZVOA 1E7UA 3EHVA 2AEHA 1P9DU 2KDIA 5CTRC 4HWIB 2J0JA 2O6VD 4KZ0A 4EKUA 4F8CB 4M8NA 4GGQA 4G0NB 5L95C 2GOWA 1YD8U 3AULA 3TL5A 2KQSA 2DAFA 4TV3A 3RZFA 1S1QB 3DVGY 3VTWA 2A4ZA 2M17A 3M3JA 2LRUA 1A5RA 2CHWA 1L2NA 3WALA 4BFRA 2OOBB 3ZO5B 1LM8B 3A1QB 4WQOB 3RZWC 1V5OA 2ZEQA 3HHMA 4HCPB 2RR9A 3HM3A 2RD0A 3JYUA 2L0FA 5E6NA 3UINB 3WIMA 5E6PA 2DZJA 1NDDA 4KIKA 2V3SA 1V9JA 4J6IA 1E5WA 2WYQA 2J0KA 4MH0E 2AWTA 1Q0WB 1KJTA 1GG3A 2KK8A 2KMAA 2MBBB 3L16A 2WX1A 3KYDD 1Q5WB 2ASQA 2DENB 3DBSA 3OJ4B 2K6DB 4FHJA 3NY5A 3A9KA 4IWPA 2WDTB 2FIFA 1OEYA 2LGYA 2MA9B 4W9IA 1LFDA 4W9CA 2KOXA 3ZNGC 4MGZE 2M4NA 4HVBA 4HLEA 4RM9A 5GMVA 2D11A 1LQBA 1WJUA 2GBRA 3H1UA 4HK2A 1WYWB 2BYFA 1OQYA 4ANUA 1GUAB 2KWVB 2MBOA 5JHAA 1AARA 3P2BA 4NAWA 5DPRA 1WGRA 3LDZE 3ECIA 4MGKE 2IO3B 3OAWA 3A1QA 3DVNV 3A4SC 4YL8A 5FR6A 4FULA 5CHVC 3APFA 3TCAA 2I1JA 1WY8A 2C7NB 4NPNA 1NI2A 3N30A 4IM0A 3DBLI 3ONSA 1EUVB 1YX6B 2AL3A 1SIFA 2KNBA 5C1ZA 2IY0B 3W1YA 1LXDA 4EEWA 2KWCA 2GBNA 2GMIC 3AU4A 4DXAB 1WZ0A 2M1MA 3QK0A 1GC7A 3T8MA 1E90A 4AWJA 2JT4B 3AXCA 3T9LA 1IYFA 3QCAA 2NPTB 3JW0X 2KMCA 3W1SC 1YX5B 1WGGA 3HIZA 2GBMA 3L17A 3TIXA 4E71A 1ISNA 2AL6A 3CSFA 3MJWA 2BWES 4KSKC 4KZCA 2EMSA 4A3OA 3ZLZA 3N32A 3VVWB 1K8RB 3DVNU 4WJPA 2N9PC 1V5TA 2O6VB 3PSEB 1T0YA 3L13A 1P3QU 1E8YA 2NBUA 3H7PB 3NOBA 5E6OA 3ALBA 3U7DA 4EZKA 3KUCB 4HPLB 3NZUA 2K25A 2MWSB 2A5UA 2BKRB 1HE8A 3VTVA 3UQBA 2K39A 5JH5C 1XD3B 2KTFA 1Q1OA 3DDCB 4IW0A 3RYTA 2C60A 1RLFA 1V6EA 2NS5A 3CSTA 4ZYNA 2KZRA 4HDQA 4TQ1A 3EFUA 1GC6A 4IWOA 1WE6A 2WWZA 1RFAA 2LUEA 2CU1A 2KJHB 3K9PB 3X0WA 4DDID 3PHXB 1YJ1A 2CKHB 2BKFA 2NCNA 2NR2A 1WRDB 2K6QA 2K8HA 1WX7A 2CR5A 2DZKA 2Z59B 2M0XA 4LJOB 4KIKB 4WJQA 4A20A 4ZDVA 5IA7A 2LI5A 2O6VA 4GOCA 5KHOA 2OJRA 3RUIB 2YLMA 1I35A 4AJYB 4G3XB 5CHWA 4CHKA 1WZ3A 3PLUA 2MCNB 1WE7A 3H7PA 3QARA 1TTNA 2RSUA 4PS8A 3U8ZA 3A9KB 2Z0EB 4GU2A 1MG8A 3KW5B 3ZRCA 4ANXA 4RMAA 3ZVVA 2MRPA 2BGFA 3B08A 3IFWB 2VRRB 4GMVA 2BYVE 2DX5B 4MGYE 2LXCA 5LXIB 1OEYJ 3PTFC 1WH3A 2FCQA 2N1WA 4ICVA 4NAWB 4ZRIA 4G11A 4KV2A 4F7ZA 3ZDTA 3R66C 4KDLB 3U30A 2KXJA 1L7YA 2V1YA 2ZPNA 1J8CA 1WI0A 4EUTA 1UELA 3ZRFA 2J0MA 1VD2A 5J17A 2YVCA 1PQSA 2AYOB 4MELA 4E3CA 3OJ3A 3ENEA 2JXXA 2LWPA 1J0GA 2LRWA 4K81A 3KUDB 3VH4B 2G4DB 2PE6B 2EKEC 2L7RA 2DYOA 2WX0A 1WJ4A 2W9NA 1ZGUB 4A3PA 3PHWB 2RGFA 2JZZA 4DHZE 4KVGB 3UIPB 2D07B 3D32A 4FJYA 3WAPA 2ZZPB 4MJSA 2DAJA 4URKA 5LLIA 2CHXA 4EZJA 1V86A 4EZLA 2L8JA 2GBJA 3H7SA 3UIOB 2ZNVB 2LJ5A 2LVOA 3ZTDA 4FJZA 3PT2B 2FIDA 2IZVB 2LD9A 3UF8A 2KDEB 2C9WB 4DBGA 2QHOA 3SD5A 1IP9A 2GBKA 2J7QB 1EF1A 1CMXB 3L0WB 4I6NB 2LGXA 3MHSD 1C3TA 1TBEA 2K1FA 4TKNA 2IYDB 3KYCD 3QIJA 1UBQA 1Z5SB 4FLHA 3PRZA 1WGDA 1OTRB 3V60A 3LJ3A 3A33B 1V80A 2KLCA 3H9DA 2LXAA 2O2VB 3VHTC 2BPSA 1U4AA 3WA0A 1WIAA 2CHZA 3L08A 4ZRKA 2L3ZA 2C5LC 2HD5B 2KDBA 2C7HA 1ZKHA 4NQKE 3WANA 4FBJB 1WR1A 2V4LA 3M95A 4DK5A 4WJOA 3DQVA 5CHFA 3VUWA 4B9KA 2MBEA 2FCNA 5JZEB 2R2QA 3GOEA 3JSVB 1SE9A 4KSLC 4ANVA 2XEWA 3CMMB 1BT0A 5D6JB 3RULA 1V49A 4F1SA 3KVFB 3VH3B 2FNJB 2REXA 3V62A 2DHZA 4HPMB 3RT3B 5JHBA 1Y8RC 1KOTA 1UH6A 1WM2A 3JVZX 3ZNID 5G55A 4BVUC 2MLBA 4W9DA 2ZCBA 3RD2A 4TQ0A 3ML9A 1P0RA 2D10A 4W9JA 2LASA 4FJVB 1TZ1A 3C0RB 4PYUA 1NBFC 4WAAA 3PRMB 3TJPA 3MTNB 4K1RB 1S3SG 2O2VA 4IM2A 3L54A 4GXBA 5J18A 2D3GA 4GDLB 4K7SA 4LDTD 3PGEA 2IO2B 3QWZB 4K7UA 4DDGD 2KC2A 3EECA 4XZ4A 3QA8A 3OLMD 3Q3JA 3PRPB 1P98A 4HJKA 4JGHB 4BKSD 5C23A 5J2RA 2FAZA 3VUXA 1KM7A 1V2YA 1WXSA 1WR6E 3S2AA 4TUUA 2RPQA 3JSVA 4HDOA 2IBIB 2KX3A 2LVQA 4ANWA 4JIOU 3ZTCA 2KFKB 3ZKJC 2HE7A 2L76A 2KVRA 1R4MI 2IY1B 3DPDA 1GJZA 4NJ6A 2MX2A 1QZEA 4WJNA 2D2QA 3M62B 1WM3A 4IM3A 3EC8A 3VAWA 1UZXB 3B0AA 4OVUA 1R4NI 2ZVNA 4NQLB 3QAQA 3VFKA 1WFYA 2KHWB 2KANA 3ZW3A 2MBHA 2KO3A 2N9XA 4PYZA 2ZCCA 4EFOA 3N3KB 4FA6A 1WXAA 2JUOA 2KJRA 4MJSB 1WX9A 3QHTA 4BBNF 3DBHI 2KKCA 5DCNA 3APDA 4GDLA 2C7MB 2JVCA 2UWQA 4WWPA 4WWOA 1WGYA 2G45B 1VCBA 2KQ7A 1G6JA 4B6WA 4ZRJA 4IG7B 3PREA 5AEKB 2XK5B 4N9F4 5D7GA 3M63B 4BKTA 3DBRI 5EDSA 1GNUA 1I42A 1YIWA 1WXVA 2JZ3B 2DZMA 4ASWC 3ZIMA 4AOFA 1E8ZA 4DHZB 4II2B 2KFKA 4WWNA 3ZNHB 2N7EA 3UQAA 1UD7A 2UYZB 3GZNI 1TGZB 2NBVB 4OVVA 5AZFA 4DHJD 4BBNC 4P7IA 2DYMA 2PEAA 3PPAA 1XT9B 2G3QB 4GDKA 1WMHA 1KLVA 4JL9A 2KD0A 4G50A 2M8SA 5DPSA 2CS4A 1ZW7A 4MGIE 2BYEA 4W9LA 4CO7A 2L00B 4II3B 3AU5A 1M94A 3VXWA 2LVPA 2HJ8A 3O65B 3HK0A 4XC2A 1E7VA 2JY6A 3NHEB 5AZHA 3WAOA 3IVFA 3HM6X 1X1MA 1WJ6A 5G2NA 2MSED 2XK5A 3PV1A 1WF9A 3BINA 4I6PA 4PS7A 4LDTB 2DZIA 3DCGA 1JRUA 3NZSA 1V81A 1E8XA 4FHKA 2KJ6A 3QX1A 2R2OA 3W1SA 3DOWA 3Q3FA 4FN2A 4MM3A
chains in the Genus database with same CATH superfamily
2KLGA 3NZ3A 3RCZA 3ZDMC 1JROA 1RFKA 3PZDA 3R7RA 2KWUB 5L83A 1F9JA 3CF6E 2MP2B 4W9EA 4MSQB 4LCDE 2L05A 3L10B 2BF8B 3IBEA 3AI5A 1RAXA 1VR9A 2FCMA 4JQWC 3NS8A 3AE9B 3OG5A 1J19A 1FXTB 2KTRB 3AE8B 4HPPA 4FADA 4IUMB 4RNAA 3PLVA 2HTHA 2WXKA 4ICUA 3KUZA 2RMMA 1VZ7A 1C4CA 1ESFA 1IGCA 1WXMA 1CQVA 2JPHA 2WNMA 5E6JA 1UUPA 1Z2MA 1H4RA 4EE2A 3TBLD 2N1VA 1SBBB 1IPGA 3PS6A 2K8CA 4GDKB 1WMHB 2H89B 3BYYB 2YEPB 2VH1A 5CX3A 2EMTA 3I9V1 5BO4B 4EOYA 2NBWB 1F52A 1VLBA 3A9JA 2JRHA 1D5XC 3EHVA 4P16A 1YN3A 4YWGG 1SIJA 2GRIA 2O6VD 4EKUA 4F8CB 3AM9A 3AEDB 2M56B 3TL5A 2DAFA 4TV3A 3RZFA 1FNVA 2WXOA 2BB6A 4A55A 1LM8B 2RR9A 3HM3A 1V8CA 2M0AA 3ZJVA 2DZJA 4M0WA 4R3DA 1I4PA 3Q8EA 1GG3A 3AEBB 2ICIA 1TY0A 2ASQA 1JW9D 2K6DB 3ZXVA 4IWPA 2M19A 4C4VB 3R2IA 2G1EA 1LQBA 3H1UA 3MHZA 1FXAA 2X8XX 2B76B 3P2BA 1V1OA 4OW0A 1M4VA 2IO3B 3A4SC 2LMCA 1NI3A 5FR6A 4NZLB 4OZBA 2I1JA 1PUTA 2XN9C 3FAHA 4NPNA 4DXGA 2QSDA 3KWVA 4EEWA 2KWCA 2GMIC 2J52A 3QK0A 1GC7A 1K53A 4NJCA 3IT6B 2NPTB 2KMCA 2GBMA 5BYSA 4E71A 2AL6A 3MJWA 3FC4A 3ZJUA 2WS3B 3N32A 1K8RB 4BZAA 4WJPA 3BIID 4LNFA 4NAMA 1T0YA 3L13A 3NOBA 3ALBA 1YOVB 4HKZE 2BKRB 2J42A 3UQBA 5JH5C 3NG0A 2KTFA 4HROA 2KZRA 4LTUA 3EFUA 1GC6A 2RDHA 1WE6A 3NVZA 2CU1A 4DDID 4MT5A 2CKHB 2CR5A 4WJQA 2LI5A 4RCOA 5CHWA 1C9FA 1WE7A 3H7PA 3QARA 4PS8A 3A9KB 1MJDA 3SFDB 5IN7A 2IDYA 3KW5B 2MRPA 1D4BA 1Q10A 4GMVA 2DX5B 1OEYJ 1N5WA 4ICVA 5MPOA 3Q8FA 4G11A 3ZDTA 3R66C 4KDLB 1I4GA 2L1AA 1L7YA 2ZPNA 1J8CA 1UELA 3ZRFA 1VD2A 2AYOB 3T3NA 2RPVA 1J0GA 1D6EC 2LRWA 4K81A 3VH4B 2G4DB 1SJHD 2PE6B 4O1NA 2L7RA 4S0RA 1ZGUB 4A3PA 3RNEC 4IDIA 1TJEA 2NTSA 5FKAC 3D32A 1FO4A 3WAPA 2D3BA 2ZZPB 4MJSA 1IBXA 2DAJA 4URKA 5LLIA 2V0GA 1MG4A 2IGGA 3PT2B 2FIDA 2LD9A 2KDEB 2C9WB 1IP9A 2GBKA 4I6NB 1E0ZA 1UWXA 1C3TA 2K1FA 3KYCD 3QIJA 4FLHA 2BS2B 1OTRB 3LJ3A 4BAXA 2Y5PA 2LXAA 1FIQA 4REZA 1LGRA 1F2RC 3VR9B 4ZRKA 2C7HA 1ZKHA 4LNIA 1WR1A 1ZDVA 1DOYA 4B9KA 3GOEA 3JSVB 3CMMB 4F1SA 2ONQA 5JHBA 1Y8RC 5BYQA 2VZKD 3ZNID 1GOZA 1FPYA 3LXFA 4BVUC 4K3CA 4XWTA 3N20C 4IOIE 3TEWA 4AS1A 4FJVB 2WP9B 4K1RB 1PDXA 2O2VA 2L32A 3QWZB 4YSXB 3Q3JA 1P98A 3Q2AC 1CJEA 4M00A 5G5HA 2RPQA 1GPXA 2D3CA 1SJED 3W9CB 1WRIA 2KX3A 1KF6B 1AW7A 3P42A 4ANWA 3EFCA 1UGJA 3ZTCA 3DBRB 2HE7A 3DPDA 2KVRA 4NJ6A 1FRRA 1QZEA 1WM3A 4KX6B 2PVGC 3FILB 4OVUA 4NQLB 3QAQA 3VFKA 3ZW3A 5D3DA 4EFOA 4FA6A 1F77A 2W82A 1WX9A 3QHTA 4RGMA 4XE0A 4GDLA 3C19A 4M02A 3I63C 3AE7B 3TEYA 3C8YA 3DBRI 5EDSA 1GNUA 1I42A 2JZ3B 3MP9A 1V97A 5T8IA 4II2B 1DOIA 2BT6A 2QMTA 2UYZB 1E9MA 1WXQA 4KKJA 5FR3A 4RGTA 1MHHE 2K3UA 5HFYA 2LJIA 2I2YA 2CS4A 1ZW7A 2SEBD 4MGIE 4W9LA 3NVVA 1I4RA 2L00B 4II3B 2LVPA 3NHEB 3WAOA 3IVFA 1ZXIA 2EKIA 3RNAC 1WJ6A 5G2NA 2MSED 2WXRA 1WF9A 2JZPA 3BINA 4I6PA 2WU2B 4PS7A 4LDTB 2DZIA 1GB1A 1XEEA 1JRUA 5LNK1 3NS1A 4AP4C 4BKGA 2IO0B 4HRSA 4N6EB 4W9KA 4US9A 3B1LX 2MW5A 4MDKE 2V9HA 3VTUA 2N9EB 4MEMA 3SU8X 3X23A 3SHQA 3SDLC 2PMVA 1OGWA 3KH0A 3P4PB 4ZYSA 2XBBC 1TS3A 4XGAB 1WYGA 2IO1B 2ZPYA 4K7WA 1KLGD 4LJPB 2AX5A 4NY0A 1YQBA 3V6CB 4NNJB 1P1AA 1FCLA 2LGDA 3QQ8B 5TR5A 3CWIA 3U2SC 2N7DA 4CYEA 4W9FA 4GLSC 4RM8A 5EE1A 2ZJDA 3A9JB 5AZGA 2QIEB 4AUQC 4DHJB 3R7QA 1VZ8A 3PZ7A 2KDMA 1C1YB 2PPHA 1STEA 2K8BA 2PJHA 5HKHA 4RGNA 1MVKA 2I1KA 2KN4A 2N4FA 1ENFA 3U52E 3SFEB 3BVGA 5HG2A 3A4RA 2KAJA 4DXFA 2Y5CA 4M0WB 2MBQA 1XQQA 3VDZA 2LZ6A 1EF5A 3AE6B 2AQ1B 2D3AA 1IGDA 1P9DU 2KDIA 2Z8LA 5CTRC 2NTTA 4M8NA 2MJDA 4GGQA 4D2KA 4UDUC 2HJ1A 2GOWA 3AULA 4MM3B 1TY2A 1QLBB 2KQ4X 1S1QB 3DVGY 3VTWA 2CHWA 2KYWA 3AH7A 3WALA 4WH4A 3NJTA 3RZWC 4WQOB 3HHMA 2FE8A 3JYUA 1AN8A 5E6NA 3UINB 2WHIA 4KIKA 2YEPF 5JXVA 1TS4A 2JQRB 2WYQA 2J0KA 4MH0E 2AWTA 2KK8A 2MJ3A 3IT4B 3OJ4B 1XLNA 2LGYA 4HVBA 4DQOC 1FEHA 5GMVA 1BUIC 1ET6A 1EWCA 4ANUA 2KWVB 1AARA 2IGHA 5DPRA 4NAWA 2QILA 4MGKE 3OAWA 2QCZA 3BYTB 5CHVC 3TCAA 2C7NB 3N30A 4IM0A 1EUVB 1SF0A 3W1YA 4FXCA 2GBNA 3AU4A 1MI0A 2M1MA 1IYFA 1E90A 3NVYA 3AXCA 3T9LA 4WQMA 3QCAA 3AMZA 3CSFA 3HVDA 2EMSA 2IJ0A 1VJKA 4A3OA 2WLBA 3RI7C 3DVNU 1SE3A 2BS3B 3O13A 5AUIA 3H7PB 3U7DA 3MFGA 3NZUA 4YTNB 3ZQ4A 4J3OD 2PTLA 1JMLA 1XD3B 1Q1OA 4IW0A 3RYTA 2C60A 4A6QA 3CSTA 4HDQA 1RFAA 2AQ3B 2WU5B 3K9PB 3PHXB 2NR2A 2BKFA 2Z59B 4ZDVA 5IA7A 2WXQA 4KGSA 3RUIB 5KHOA 1I35A 1N60A 2WDQB 4CHKA 2MCNB 1J7CA 1TTNA 3P4SB 3DHIC 2Z0EB 1XO3A 3ZRCA 1IBXB 1FFUA 3ZVVA 3B08A 2VRRB 4MGYE 2LXCA 4LNNA 3PTFC 1WH3A 2HTME 2KXJA 1FCCC 3FKYA 3VR8B 1OQQA 2G9HD 1JALA 1E7PB 1DGJA 2JXXA 2N0SB 3KUDB 3Q3OC 2DYOA 4DHZE 3W5UB 3UIPB 3N1YC 1HEZE 3AECB 2MHJA 2CJOA 4EZJA 2ACZB 1V86A 1WSPA 3H7SA 2IZVB 2BBCA 4H2AA 4DBGA 1EF1A 1C77A 1B1ZA 2LGXA 3N1XC 1MPEA 1IUEA 1TBEA 3ABVB 1WGDA 2J4XA 2O2VB 1TKEA 2BPSA 1QT9A 1U4AA 3WA0A 3L08A 2HD5B 2KDBA 4DK5A 3DQVA 2R2QA 1MHXA 4ANVA 1L5PA 2XEWA 1V49A 3W5VB 3KVFB 2WDRB 1KOTA 3P4QB 5H8YE 2MLBA 4W9DA 4OZAA 3RNFC 3HRDD 1C4AA 3BWUD 2D10A 1YJIA 4USAA 2LASA 2DWQA 3PRMB 3TJPA 4K7SA 4GDLB 1RM6C 4LDTD 3I57A 2IO2B 4DDGD 4XZ4A 2WDVB 3QA8A 3PRPB 4WWMA 4HJKA 4JGHB 5J2RA 3VUXA 1KM7A 1V2YA 1WR6E 4TUUA 1YN4A 3EUB2 4N58A 4HDOA 2IBIB 2LVQA 3RPFC 3ZKJC 4WJNA 2D2QA 3VAWA 3EC8A 3P1MA 1UZXB 4YT0B 3GZNB 3VRBB 2VH2A 2KO3A 3AE3B 2Q5WD 2IGDA 2JUOA 2KJRA 4BBNF 4MACA 5DCNA 3APDA 1WGYA 2KQ7A 1I4HA 1OQRA 3ETRA 1PGBA 1YIWA 1QQRA 2DZMA 3NRZA 1FRDA 3P63A 3GZNI 4A8XC 1TGZB 2JX5A 4OVVA 3AE2B 4DHJD 2DYMA 2PEAA 3PPAA 4GDKA 1KLVA 1WMHA 4JL9A 4G50A 4JWUC 1QOFA 3AE4B 1HQRD 3O65B 2JY6A 3HM6X 2XK5A 2BTEA 2N9LA 1V1PA 3DCGA 2KVZA 1E8XA 5GXGB 2K5PA 3Q3FA 3QJZA 4HCNB 1HA5A 1NYQA 3CIRB 3WAMA 4HXDA 1UBIA 1EO6A 2W54A 2LFIA 3V6EB 1QKZA 1VRAB 3DVGX 5KHQA 2WXPA 3H6NA 3BVMA 3I3TB 3IG3A 3VQIA 4GB9A 2DYBA 2MQJA 4AJWA 2L0TA 1WGHA 2W55A 4C56C 3Q3MC 4BKSA 2KC1A 3UGBB 1RYJA 3VUYA 2KX0A 2KFJA 1D3ZA 3V61A 1PYWD 3T3OA 1UF0A 3K9OB 2BQQA 2KN5A 2E6XA 4JLCA 4E74A 2ZNVC 5AUKA 3QC8B 4B95A 4NJ7A 4PS3A 4XDCA 1XCQL 5D94A 3GS2A 4IC7B 3SR6A 2KDFB 3PVLA 5BMGA 4BOZB 2NPTA 1EU3A 4ITKA 4M01A 1E6EB 1L4DB 2V3NA 4M8MA 2NVUI 4MSMB 4XYCA 2FUHB 3E9SA 5D2MB 4BOSC 3BY4B 2JRIB 3ZNZB 4OHJA 1NENB 2MH7A 2G4SA 4GIVA 3AEGB 3Q8BA 1UGMA 5IO9A 3R3MA 1E7UA 1UNSA 3Q3NC 4HWIB 4KZ0A 5L95C 3B2FA 1YD8U 1R7SA 2DLBA 2NMQA 3N1ZC 4OVZA 2INDC 4BFRA 2OOBB 1V5OA 4HCPB 2RD0A 3WIMA 1PFDA 1N63A 4J6IA 1E5WA 1MFWA 1Q0WB 1KJTA 2KMAA 3L16A 2WX1A 2XNAC 1QF6A 3NY5A 3A9KA 1SEBD 1LFDA 1B9RA 4MGZE 4N59A 1WJUA 1CZPA 2BYFA 1GUAB 5JHAA 3WCQA 3LDZE 3A1QA 3DVNV 1K51A 1VZ6A 1XLQA 3APFA 3W2DA 1BMLC 5C2TB 5EE3A 2AL3A 1FNWA 2IY0B 1LXDA 2EELA 1XXGA 3N9YC 1HXYD 3MC8A 4DXAB 1WZ0A 3R2TA 2WXMA 3T8MA 2D5GA 2JT4B 2BYTA 1WGGA 3HIZA 3PZ8A 1I4XA 4P1BC 1AYFA 1ISNA 3ZLZA 1BXTA 5FK9C 1HZ6A 3PSEB 4C00A 1E8YA 3LYYA 1VDVA 2NBUA 1JWMD 3B9JA 2WXFA 1GB4A 1JWBD 3DDCB 3KQ4A 2ZW1A 4TSSA 1FFVA 2FUG1 4IWOA 5G5GA 2V3PA 2WWZA 4CQNA 2LUEA 3B2GA 2PKOA 1DYQA 1YJ1A 2NCNA 1XLPA 1WRDB 1WX7A 1L4ZB 2M0XA 2O6VA 2OJRA 3EA6A 1KLUD 3AV8A 4G3XB 2WXNA 3U4EG 3PLUA 3U8ZA 2K0PA 4RGOS 1WGKA 3Q14C 4RF1A 4RMAA 4JX1C 4IKGA 2BGFA 3IFWB 3MJ5A 1FM0D 2OEDA 4KV2A 4F7ZA 3U30A 4YXDB 2V1YA 2INPE 5EE0A 1WI0A 2J0MA 1HTQA 5J17A 2YVCA 1PQSA 1SB3C 3OJ3A 2LWPA 5C3JB 2EKEC 1F2RI 3ZXRA 5BMIA 2W9NA 3FILA 2RGFA 2D07B 1YNTE 2CHXA 4WAFA 3TSSA 4HKQA 4EZLA 2GBJA 4L23A 1TKYA 2GI9A 1AWDA 3UIOB 1ZXHA 2LJ5A 2ZNVB 3BK1A 2QHOA 1C4PA 2J7QB 1TT5B 2IPKD 3MHSD 2CU3A 1F1HA 2IYDB 4XWWA 1Z5SB 3PRZA 2JYTA 3A33B 1V80A 4TMAB 1EU4A 2CJNA 3DWMA 2JWUA 1NYRA 3KWLA 2C5LC 4NQKE 3M95A 3MC9A 4WJOA 2LGSA 5CHFA 1ZOYB 2FCNA 3J9CA 4YTMB 1SE9A 1SE4A 5D6JB 1BT0A 3RULA 2RDBC 4L1BA 2REXA 2DHZA 3AE5B 1UH6A 4LNOA 1WM2A 2ZCBA 3RD2A 1R4NB 1D5ZC 1TZ1A 1NBFC 4WAAA 3MTNB 4IM2A 4KKIA 3L54A 2LHDA 3PGEA 4K7UA 3OWEB 2KC2A 3DBHB 3EECA 2I38A 3OLMD 2W3SA 2J53A 5C23A 1YQ4B 4B0MA 3S2AA 2RDGA 1K52A 2QJLA 3DWGC 3IAM1 4JIOU 1XF5L 2KMMA 2L76A 1GJZA 2Y3AA 2MX2A 1RWSA 4IM3A 3B0AA 1R4NI 2ZVNA 2MBHA 4PYZA 1EM7A 3N3KB 4MJSB 3DBHI 2C7MB 4WWPA 1XCTL 1JWUD 4WWOA 1NEKB 1VCBA 1G6JA 4ZRJA 1SSNA 2OJWA 3PREA 2XK5B 4N9F4 5D7GA 3M63B 3RMKC 1V1PB 1PGAA 1KTKA 1WXVA 4C7YA 4ASWC 1P7FA 3ZIMA 2K9XA 4DHZB 2R61A 2KFKA 3UQAA 2WXGA 1UD7A 2NBVB 4BBNC 1XT9B 4C80A 1N61A 4WURA 2BYEA 4OZCA 4CO7A 3AU5A 1M94A 2HJ8A 4XC2A 3DHGC 3HK0A 1E7VA 5AZHA 1X1MA 3Q69A 3U7ZA 2GLSA 3IAS1 1DOXA 1JQ4A 4P6VF 4FHKA 3QX1A 2R2OA 3TEXA 3W1SA 4FN2A 4MM3A 2L52A 2Y5BB 1ROEA 1WX8A 4I6LB 3ZYYX 2WXIA 1ET9A 3GP7A 1WJNA 3V05A 1E8WA 2BWFA 4YSYB 4XDDA 1YN5A 1ZUD2 1QOGA 3IHPC 1XLOA 3ML8A 3APCA 3BK2A 1JCKB 1L6VA 2PE9A 2MEKA 1EWYC 4GSWA 1GAQB 2Z0DB 5HHDG 2FCSA 3PO0A 1SGHA 1RRBA 3AN1A 3GE8C 1WWTA 5IAAC 2JWZA 3URYA 3AEAB 1JRPA 1TS2A 3EGRA 2B3AA 4JE3B 2MP2A 3UI3A 5DPTA 1C76A 3ZUNA 4XX5A 4GN1A 5LXHA 4KDIC 4DWFA 4W9HA 1ZP0B 5DPWA 1N5XA 3H8HA 2KTRA 2KWDA 2JF5A 3TMPB 1H8CA 4X57B 1L6UA 1T6BX 3RNCC 4W9GA 4IWQA 2ZVOA 2TSSA 2AEHA 3RNBC 2J0JA 4ZHPA 4JWSC 4G0NB 2KQSA 4WIPA 2JU6X 3P4RB 5IKCM 2A4ZA 2M17A 3M3JA 1KFYB 1T5XD 2LRUA 1A5RA 1L2NA 1I4QA 3R8BA 3ZO5B 3A1QB 1LO5D 2ZEQA 3SEBA 2L0FA 5E6PA 1NDDA 2BW2A 1C78A 2V3SA 1SXTA 1V9JA 4RFBA 4HEA1 2L83A 2PLPA 2BB5A 2MBBB 3V3XA 4KGTA 3DBLB 3KYDD 1Q5WB 2DENB 3DBSA 2QC8A 4FHJA 3NVWA 3Q8CA 2WDTB 2FIFA 1OEYA 1TS5A 2MA9B 4W9IA 4W9CA 2KOXA 3ZNGC 2M4NA 4HLEA 4RM9A 2D11A 2GBRA 4HK2A 1WYWB 2V4IB 1OQYA 2MBOA 5EE9A 3Q6BA 1WGRA 3ECIA 4MH8A 1ZE3D 4YL8A 4FULA 4YTPB 1WY8A 1NI2A 4P1CC 3DBLI 3ONSA 1YX6B 4HJGE 4PT5A 2OHFA 1SIFA 2KNBA 3LB8C 5C1ZA 1L0YB 2AQ2B 4AWJA 3JW0X 1JWAD 3W1SC 1SE2A 4C4VA 1YX5B 3L17A 1T0RC 3TIXA 3Q8AA 4LK0M 4KZCA 2HDEA 2BWES 4KSKC 3VVWB 5I4DA 2INNE 2N9PC 1V5TA 2O6VB 4S17A 3AEFB 2QEJC 3BZDB 1P3QU 5E6OA 5H92C 2WXJA 4EZKA 2H88B 2PW9A 3HVZA 3KUCB 4US8A 4HPLB 2K25A 2MWSB 2A5UA 1HE8A 3VTVA 1TZOA 1KH0A 1N62A 2K39A 1A70A 1RLFA 1V6EA 2NS5A 4ZYNA 4TQ1A 3HUIA 1J7BA 2KJHB 3X0WA 4PK1A 2K22A 5IP4D 2N9KA 2K6QA 2K8HA 2DZKA 3KLSX 1I7HA 4LJOB 4KIKB 4A20A 4GOCA 4A9AA 2YLMA 4AJYB 1Y56A 1NVID 1WZ3A 2RSUA 5TSSA 2JSVX 4GU2A 1MG8A 4ANXA 2LGIA 1FD6A 1K50A 2BYVE 3E56A 4A90A 5LXIB 2FCQA 2N1WA 1L0VB 1HZ5A 4NAWB 1OFFA 4L2YA 4ZRIA 5HI1A 1ZDXA 4EUTA 1P7EA 4C7ZA 2JYEA 3BVZA 4YSZB 4MELA 4E3CA 1FXIA 3ENEA 2JXTA 3TUOA 1T3QA 2WX0A 1WJ4A 2FBWB 3PHWB 2JZZA 4KVGB 2DNFA 4FJYA 1JWSD 2QDFA 1QOAA 1PGXA 2L8JA 3MC0B 1TKGA 3GE3C 2LVOA 3ZTDA 4FJZA 4RH6A 3RN9C 3UF8A 4LLGM 3SD5A 1CMXB 3L0WB 1QILA 1HTOA 2LEKA 3GB1A 4TKNA 1UBQA 1CK1A 3V60A 2KLCA 1UWMA 2X38A 3H9DA 1YQ3B 3VHTC 1FNUA 1WIAA 2CHZA 4FBJB 2L3ZA 3WANA 4B0EA 1T0SC 1E10A 3ZGZA 2V4LA 1YMHE 3VUWA 2MBEA 5JZEB 2WGSA 4KSLC 1ZPSA 4ZOHC 4QAYA 3VH3B 2FNJB 3V62A 2LHEA 4HPMB 3RT3B 2ON8A 3JVZX 5G55A 5BMHA 3DHHC 4ARIA 1R4MB 4TQ0A 2WQYB 1P0RA 3ML9A 2PIAA 4W9JA 3C0RB 2KT7A 4PYUA 2PVOD 1S3SG 5J18A 4GXBA 2GB1A 2D3GA 3AEEB 1KRHA 4BKSD 2FAZA 1WXSA 1ACCA 5D3IB 3RFZB 4LNKA 1TYGB 3JSVA 2UU7A 2MJEA 2LUMA 1L0XB 2E3TA 4ACFA 2KFKB 4K3BA 1R4MI 2IY1B 3TEZA 3M62B 4Q2JA 1WFYA 2KHWB 2KANA 3AB5A 4ZRPA 2N9XA 2ZCCA 1WXAA 2DBYA 1C79A 2KKCA 3ZJTA 2JVCA 2UWQA 2WXHA 1T0QC 4JPSA 3I5JC 2G45B 2WXLA 4B6WA 4IG7B 5AEKB 2N7JA 4BKTA 4AQ7A 4AOFA 1E8ZA 4WWNA 3ZNHB 2N7EA 3NUHB 5AZFA 1D5MC 1J7AA 4P7IA 2BVCA 2G3QB 2W3RA 2KD0A 4KGRA 4RF0A 3VRAB 1F0ZA 2M8SA 5DPSA 3IXSA 2VZKB 1TIFA 3VXWA 1N6ZA 1QOBA 2SAKA 1FMAD 3L4PA 4ZHOA 1YJJA 3PV1A 3RNGC 4ARCA 2ZW0A 3AE1B 4ZRQA 2KACA 5IOIA 5BYRA 2INCC 3NZSA 1V81A 2KJ6A 3DOWA 2BS4B
chains in the Genus database with same CATH topology
3QJZA 4AP4C 2Y5BB 4HCNB 2KLGA 4BKGA 2IO0B 1WX8A 4I6LB 3ZDMC 4W9KA 3RCZA 3WAMA 4HXDA 1UBIA 1EO6A 1WJNA 2MW5A 3B1LX 4MDKE 3PZDA 3V6EB 3VTUA 3R7RA 2KWUB 1E8WA 2BWFA 5L83A 2N9EB 1F9JA 4MEMA 3SU8X 3X23A 3CF6E 3SHQA 2MP2B 4W9EA 3DVGX 3SDLC 4MSQB 3IHPC 5KHQA 3ML8A 1OGWA 2L05A 3H6NA 3KH0A 4LCDE 3APCA 2XBBC 3I3TB 3L10B 3IG3A 2IO1B 2ZPYA 2BF8B 2PE9A 4K7WA 3IBEA 3VQIA 4GB9A 2DYBA 3AI5A 1RAXA 2MQJA 4LJPB 2FCMA 4AJWA 4JQWC 1YQBA 2L0TA 4NY0A 3NS8A 1WGHA 4GSWA 4BKSA 1J19A 1FXTB 2KC1A 2KTRB 2Z0DB 3UGBB 3V6CB 4NNJB 2FCSA 3VUYA 2KX0A 4FADA 2KFJA 1D3ZA 1P1AA 2LGDA 4IUMB 3QQ8B 3V61A 1SGHA 1RRBA 5TR5A 3PLVA 2HTHA 2N7DA 4CYEA 4W9FA 4RM8A 4ICUA 2ZJDA 3KUZA 3A9JB 3K9OB 5AZGA 5IAAC 2JWZA 2KN5A 4JLCA 1WXMA 4E74A 4AUQC 2ZNVC 4DHJB 3R7QA 2B3AA 3QC8B 1C1YB 4B95A 2PPHA 2JPHA 4NJ7A 4PS3A 2MP2A 2K8BA 2PJHA 1Z2MA 5HKHA 1H4RA 5D94A 5DPTA 3TBLD 2I1KA 4IC7B 3ZUNA 2N1VA 1IPGA 2N4FA 3PS6A 2K8CA 4XX5A 4GDKB 1WMHB 2KDFB 3PVLA 4GN1A 4BOZB 2NPTA 5LXHA 4M8MA 2NVUI 4KDIC 4MSMB 4DWFA 4W9HA 2FUHB 3A4RA 5DPWA 2KTRA 5D2MB 4BOSC 2JF5A 3TMPB 1H8CA 5CX3A 3BY4B 2JRIB 1XQQA 2MBQA 4M0WB 4X57B 2EMTA 3VDZA 3ZNZB 5BO4B 2LZ6A 4EOYA 2NBWB 1EF5A 2G4SA 4GIVA 3A9JA 4W9GA 2JRHA 1UGMA 3R3MA 4IWQA 2ZVOA 1E7UA 3EHVA 2AEHA 1P9DU 2KDIA 5CTRC 4HWIB 2J0JA 2O6VD 4KZ0A 4EKUA 4F8CB 4M8NA 4GGQA 4G0NB 5L95C 2GOWA 1YD8U 3AULA 3TL5A 2KQSA 2DAFA 4TV3A 3RZFA 1S1QB 3DVGY 3VTWA 2A4ZA 2M17A 3M3JA 2LRUA 1A5RA 2CHWA 1L2NA 3WALA 4BFRA 2OOBB 3ZO5B 1LM8B 3A1QB 4WQOB 3RZWC 1V5OA 2ZEQA 3HHMA 4HCPB 2RR9A 3HM3A 2RD0A 3JYUA 2L0FA 5E6NA 3UINB 3WIMA 5E6PA 2DZJA 1NDDA 4KIKA 2V3SA 1V9JA 4J6IA 1E5WA 2WYQA 2J0KA 4MH0E 2AWTA 1Q0WB 1KJTA 1GG3A 2KK8A 2KMAA 2MBBB 3L16A 2WX1A 3KYDD 1Q5WB 2ASQA 2DENB 3DBSA 3OJ4B 2K6DB 4FHJA 3NY5A 3A9KA 4IWPA 2WDTB 2FIFA 1OEYA 2LGYA 2MA9B 4W9IA 1LFDA 4W9CA 2KOXA 3ZNGC 4MGZE 2M4NA 4HVBA 4HLEA 4RM9A 5GMVA 2D11A 1LQBA 1WJUA 2GBRA 3H1UA 4HK2A 1WYWB 2BYFA 1OQYA 4ANUA 1GUAB 2KWVB 2MBOA 5JHAA 1AARA 3P2BA 4NAWA 5DPRA 1WGRA 3LDZE 3ECIA 4MGKE 2IO3B 3OAWA 3A1QA 3DVNV 3A4SC 4YL8A 5FR6A 4FULA 5CHVC 3APFA 3TCAA 2I1JA 1WY8A 2C7NB 4NPNA 1NI2A 3N30A 4IM0A 3DBLI 3ONSA 1EUVB 1YX6B 2AL3A 1SIFA 2KNBA 5C1ZA 2IY0B 3W1YA 1LXDA 4EEWA 2KWCA 2GBNA 2GMIC 3AU4A 4DXAB 1WZ0A 2M1MA 3QK0A 1GC7A 3T8MA 1E90A 4AWJA 2JT4B 3AXCA 3T9LA 1IYFA 3QCAA 2NPTB 3JW0X 2KMCA 3W1SC 1YX5B 1WGGA 3HIZA 2GBMA 3L17A 3TIXA 4E71A 1ISNA 2AL6A 3CSFA 3MJWA 2BWES 4KSKC 4KZCA 2EMSA 4A3OA 3ZLZA 3N32A 3VVWB 1K8RB 3DVNU 4WJPA 2N9PC 1V5TA 2O6VB 3PSEB 1T0YA 3L13A 1P3QU 1E8YA 2NBUA 3H7PB 3NOBA 5E6OA 3ALBA 3U7DA 4EZKA 3KUCB 4HPLB 3NZUA 2K25A 2MWSB 2A5UA 2BKRB 1HE8A 3VTVA 3UQBA 2K39A 5JH5C 1XD3B 2KTFA 1Q1OA 3DDCB 4IW0A 3RYTA 2C60A 1RLFA 1V6EA 2NS5A 3CSTA 4ZYNA 2KZRA 4HDQA 4TQ1A 3EFUA 1GC6A 4IWOA 1WE6A 2WWZA 1RFAA 2LUEA 2CU1A 2KJHB 3K9PB 3X0WA 4DDID 3PHXB 1YJ1A 2CKHB 2BKFA 2NCNA 2NR2A 1WRDB 2K6QA 2K8HA 1WX7A 2CR5A 2DZKA 2Z59B 2M0XA 4LJOB 4KIKB 4WJQA 4A20A 4ZDVA 5IA7A 2LI5A 2O6VA 4GOCA 5KHOA 2OJRA 3RUIB 2YLMA 1I35A 4AJYB 4G3XB 5CHWA 4CHKA 1WZ3A 3PLUA 2MCNB 1WE7A 3H7PA 3QARA 1TTNA 2RSUA 4PS8A 3U8ZA 3A9KB 2Z0EB 4GU2A 1MG8A 3KW5B 3ZRCA 4ANXA 4RMAA 3ZVVA 2MRPA 2BGFA 3B08A 3IFWB 2VRRB 4GMVA 2BYVE 2DX5B 4MGYE 2LXCA 5LXIB 1OEYJ 3PTFC 1WH3A 2FCQA 2N1WA 4ICVA 4NAWB 4ZRIA 4G11A 4KV2A 4F7ZA 3ZDTA 3R66C 4KDLB 3U30A 2KXJA 1L7YA 2V1YA 2ZPNA 1J8CA 1WI0A 4EUTA 1UELA 3ZRFA 2J0MA 1VD2A 5J17A 2YVCA 1PQSA 2AYOB 4MELA 4E3CA 3OJ3A 3ENEA 2JXXA 2LWPA 1J0GA 2LRWA 4K81A 3KUDB 3VH4B 2G4DB 2PE6B 2EKEC 2L7RA 2DYOA 2WX0A 1WJ4A 2W9NA 1ZGUB 4A3PA 3PHWB 2RGFA 2JZZA 4DHZE 4KVGB 3UIPB 2D07B 3D32A 4FJYA 3WAPA 2ZZPB 4MJSA 2DAJA 4URKA 5LLIA 2CHXA 4EZJA 1V86A 4EZLA 2L8JA 2GBJA 3H7SA 3UIOB 2ZNVB 2LJ5A 2LVOA 3ZTDA 4FJZA 3PT2B 2FIDA 2IZVB 2LD9A 3UF8A 2KDEB 2C9WB 4DBGA 2QHOA 3SD5A 1IP9A 2GBKA 2J7QB 1EF1A 1CMXB 3L0WB 4I6NB 2LGXA 3MHSD 1C3TA 1TBEA 2K1FA 4TKNA 2IYDB 3KYCD 3QIJA 1UBQA 1Z5SB 4FLHA 3PRZA 1WGDA 1OTRB 3V60A 3LJ3A 3A33B 1V80A 2KLCA 3H9DA 2LXAA 2O2VB 3VHTC 2BPSA 1U4AA 3WA0A 1WIAA 2CHZA 3L08A 4ZRKA 2L3ZA 2C5LC 2HD5B 2KDBA 2C7HA 1ZKHA 4NQKE 3WANA 4FBJB 1WR1A 2V4LA 3M95A 4DK5A 4WJOA 3DQVA 5CHFA 3VUWA 4B9KA 2MBEA 2FCNA 5JZEB 2R2QA 3GOEA 3JSVB 1SE9A 4KSLC 4ANVA 2XEWA 3CMMB 1BT0A 5D6JB 3RULA 1V49A 4F1SA 3KVFB 3VH3B 2FNJB 2REXA 3V62A 2DHZA 4HPMB 3RT3B 5JHBA 1Y8RC 1KOTA 1UH6A 1WM2A 3JVZX 3ZNID 5G55A 4BVUC 2MLBA 4W9DA 2ZCBA 3RD2A 4TQ0A 3ML9A 1P0RA 2D10A 4W9JA 2LASA 4FJVB 1TZ1A 3C0RB 4PYUA 1NBFC 4WAAA 3PRMB 3TJPA 3MTNB 4K1RB 1S3SG 2O2VA 4IM2A 3L54A 4GXBA 5J18A 2D3GA 4GDLB 4K7SA 4LDTD 3PGEA 2IO2B 3QWZB 4K7UA 4DDGD 2KC2A 3EECA 4XZ4A 3QA8A 3OLMD 3Q3JA 3PRPB 1P98A 4HJKA 4JGHB 4BKSD 5C23A 5J2RA 2FAZA 3VUXA 1KM7A 1V2YA 1WXSA 1WR6E 3S2AA 4TUUA 2RPQA 3JSVA 4HDOA 2IBIB 2KX3A 2LVQA 4ANWA 4JIOU 3ZTCA 2KFKB 3ZKJC 2HE7A 2L76A 2KVRA 1R4MI 2IY1B 3DPDA 1GJZA 4NJ6A 2MX2A 1QZEA 4WJNA 2D2QA 3M62B 1WM3A 4IM3A 3EC8A 3VAWA 1UZXB 3B0AA 4OVUA 1R4NI 2ZVNA 4NQLB 3QAQA 3VFKA 1WFYA 2KHWB 2KANA 3ZW3A 2MBHA 2KO3A 2N9XA 4PYZA 2ZCCA 4EFOA 3N3KB 4FA6A 1WXAA 2JUOA 2KJRA 4MJSB 1WX9A 3QHTA 4BBNF 3DBHI 2KKCA 5DCNA 3APDA 4GDLA 2C7MB 2JVCA 2UWQA 4WWPA 4WWOA 1WGYA 2G45B 1VCBA 2KQ7A 1G6JA 4B6WA 4ZRJA 4IG7B 3PREA 5AEKB 2XK5B 4N9F4 5D7GA 3M63B 4BKTA 3DBRI 5EDSA 1GNUA 1I42A 1YIWA 1WXVA 2JZ3B 2DZMA 4ASWC 3ZIMA 4AOFA 1E8ZA 4DHZB 4II2B 2KFKA 4WWNA 3ZNHB 2N7EA 3UQAA 1UD7A 2UYZB 3GZNI 1TGZB 2NBVB 4OVVA 5AZFA 4DHJD 4BBNC 4P7IA 2DYMA 2PEAA 3PPAA 1XT9B 2G3QB 4GDKA 1WMHA 1KLVA 4JL9A 2KD0A 4G50A 2M8SA 5DPSA 2CS4A 1ZW7A 4MGIE 2BYEA 4W9LA 4CO7A 2L00B 4II3B 3AU5A 1M94A 3VXWA 2LVPA 2HJ8A 3O65B 3HK0A 4XC2A 1E7VA 2JY6A 3NHEB 5AZHA 3WAOA 3IVFA 3HM6X 1X1MA 1WJ6A 5G2NA 2MSED 2XK5A 3PV1A 1WF9A 3BINA 4I6PA 4PS7A 4LDTB 2DZIA 3DCGA 1JRUA 3NZSA 1V81A 1E8XA 4FHKA 2KJ6A 3QX1A 2R2OA 3W1SA 3DOWA 3Q3FA 4FN2A 4MM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QJZ A;  4AP4 C;  2Y5B B;  4HCN B;  2KLG A;  4BKG A;  2IO0 B;  1WX8 A;  4I6L B;  3ZDM C;  4W9K A;  3RCZ A;  3WAM A;  4HXD A;  1UBI A;  1EO6 A;  1WJN A;  2MW5 A;  3B1L X;  4MDK E;  3PZD A;  3V6E B;  3VTU A;  3R7R A;  2KWU B;  1E8W A;  2BWF A;  5L83 A;  2N9E B;  1F9J A;  4MEM A;  3SU8 X;  3X23 A;  3CF6 E;  3SHQ A;  2MP2 B;  4W9E A;  3DVG X;  3SDL C;  4MSQ B;  3IHP C;  5KHQ A;  3ML8 A;  1OGW A;  2L05 A;  3H6N A;  3KH0 A;  4LCD E;  3APC A;  2XBB C;  3I3T B;  3L10 B;  3IG3 A;  2IO1 B;  2ZPY A;  2BF8 B;  2PE9 A;  4K7W A;  3IBE A;  3VQI A;  4GB9 A;  2DYB A;  3AI5 A;  1RAX A;  2MQJ A;  4LJP B;  2FCM A;  4AJW A;  4JQW C;  1YQB A;  2L0T A;  4NY0 A;  3NS8 A;  1WGH A;  4GSW A;  4BKS A;  1J19 A;  1FXT B;  2KC1 A;  2KTR B;  2Z0D B;  3UGB B;  3V6C B;  4NNJ B;  2FCS A;  3VUY A;  2KX0 A;  4FAD A;  2KFJ A;  1D3Z A;  1P1A A;  2LGD A;  4IUM B;  3QQ8 B;  3V61 A;  1SGH A;  1RRB A;  5TR5 A;  3PLV A;  2HTH A;  2N7D A;  4CYE A;  4W9F A;  4RM8 A;  4ICU A;  2ZJD A;  3KUZ A;  3A9J B;  3K9O B;  5AZG A;  5IAA C;  2JWZ A;  2KN5 A;  4JLC A;  1WXM A;  4E74 A;  4AUQ C;  2ZNV C;  4DHJ B;  3R7Q A;  2B3A A;  3QC8 B;  1C1Y B;  4B95 A;  2PPH A;  2JPH A;  4NJ7 A;  4PS3 A;  2MP2 A;  2K8B A;  2PJH A;  1Z2M A;  5HKH A;  1H4R A;  5D94 A;  5DPT A;  3TBL D;  2I1K A;  4IC7 B;  3ZUN A;  2N1V A;  1IPG A;  2N4F A;  3PS6 A;  2K8C A;  4XX5 A;  4GDK B;  1WMH B;  2KDF B;  3PVL A;  4GN1 A;  4BOZ B;  2NPT A;  5LXH A;  4M8M A;  2NVU I;  4KDI C;  4MSM B;  4DWF A;  4W9H A;  2FUH B;  3A4R A;  5DPW A;  2KTR A;  5D2M B;  4BOS C;  2JF5 A;  3TMP B;  1H8C A;  5CX3 A;  3BY4 B;  2JRI B;  1XQQ A;  2MBQ A;  4M0W B;  4X57 B;  2EMT A;  3VDZ A;  3ZNZ B;  5BO4 B;  2LZ6 A;  4EOY A;  2NBW B;  1EF5 A;  2G4S A;  4GIV A;  3A9J A;  4W9G A;  2JRH A;  1UGM A;  3R3M A;  4IWQ A;  2ZVO A;  1E7U A;  3EHV A;  2AEH A;  1P9D U;  2KDI A;  5CTR C;  4HWI B;  2J0J A;  2O6V D;  4KZ0 A;  4EKU A;  4F8C B;  4M8N A;  4GGQ A;  4G0N B;  5L95 C;  2GOW A;  1YD8 U;  3AUL A;  3TL5 A;  2KQS A;  2DAF A;  4TV3 A;  3RZF A;  1S1Q B;  3DVG Y;  3VTW A;  2A4Z A;  2M17 A;  3M3J A;  2LRU A;  1A5R A;  2CHW A;  1L2N A;  3WAL A;  4BFR A;  2OOB B;  3ZO5 B;  1LM8 B;  3A1Q B;  4WQO B;  3RZW C;  1V5O A;  2ZEQ A;  3HHM A;  4HCP B;  2RR9 A;  3HM3 A;  2RD0 A;  3JYU A;  2L0F A;  5E6N A;  3UIN B;  3WIM A;  5E6P A;  2DZJ A;  1NDD A;  4KIK A;  2V3S A;  1V9J A;  4J6I A;  1E5W A;  2WYQ A;  2J0K A;  4MH0 E;  2AWT A;  1Q0W B;  1KJT A;  1GG3 A;  2KK8 A;  2KMA A;  2MBB B;  3L16 A;  2WX1 A;  3KYD D;  1Q5W B;  2ASQ A;  2DEN B;  3DBS A;  3OJ4 B;  2K6D B;  4FHJ A;  3NY5 A;  3A9K A;  4IWP A;  2WDT B;  2FIF A;  1OEY A;  2LGY A;  2MA9 B;  4W9I A;  1LFD A;  4W9C A;  2KOX A;  3ZNG C;  4MGZ E;  2M4N A;  4HVB A;  4HLE A;  4RM9 A;  5GMV A;  2D11 A;  1LQB A;  1WJU A;  2GBR A;  3H1U A;  4HK2 A;  1WYW B;  2BYF A;  1OQY A;  4ANU A;  1GUA B;  2KWV B;  2MBO A;  5JHA A;  1AAR A;  3P2B A;  4NAW A;  5DPR A;  1WGR A;  3LDZ E;  3ECI A;  4MGK E;  2IO3 B;  3OAW A;  3A1Q A;  3DVN V;  3A4S C;  4YL8 A;  5FR6 A;  4FUL A;  5CHV C;  3APF A;  3TCA A;  2I1J A;  1WY8 A;  2C7N B;  4NPN A;  1NI2 A;  3N30 A;  4IM0 A;  3DBL I;  3ONS A;  1EUV B;  1YX6 B;  2AL3 A;  1SIF A;  2KNB A;  5C1Z A;  2IY0 B;  3W1Y A;  1LXD A;  4EEW A;  2KWC A;  2GBN A;  2GMI C;  3AU4 A;  4DXA B;  1WZ0 A;  2M1M A;  3QK0 A;  1GC7 A;  3T8M A;  1E90 A;  4AWJ A;  2JT4 B;  3AXC A;  3T9L A;  1IYF A;  3QCA A;  2NPT B;  3JW0 X;  2KMC A;  3W1S C;  1YX5 B;  1WGG A;  3HIZ A;  2GBM A;  3L17 A;  3TIX A;  4E71 A;  1ISN A;  2AL6 A;  3CSF A;  3MJW A;  2BWE S;  4KSK C;  4KZC A;  2EMS A;  4A3O A;  3ZLZ A;  3N32 A;  3VVW B;  1K8R B;  3DVN U;  4WJP A;  2N9P C;  1V5T A;  2O6V B;  3PSE B;  1T0Y A;  3L13 A;  1P3Q U;  1E8Y A;  2NBU A;  3H7P B;  3NOB A;  5E6O A;  3ALB A;  3U7D A;  4EZK A;  3KUC B;  4HPL B;  3NZU A;  2K25 A;  2MWS B;  2A5U A;  2BKR B;  1HE8 A;  3VTV A;  3UQB A;  2K39 A;  5JH5 C;  1XD3 B;  2KTF A;  1Q1O A;  3DDC B;  4IW0 A;  3RYT A;  2C60 A;  1RLF A;  1V6E A;  2NS5 A;  3CST A;  4ZYN A;  2KZR A;  4HDQ A;  4TQ1 A;  3EFU A;  1GC6 A;  4IWO A;  1WE6 A;  2WWZ A;  1RFA A;  2LUE A;  2CU1 A;  2KJH B;  3K9P B;  3X0W A;  4DDI D;  3PHX B;  1YJ1 A;  2CKH B;  2BKF A;  2NCN A;  2NR2 A;  1WRD B;  2K6Q A;  2K8H A;  1WX7 A;  2CR5 A;  2DZK A;  2Z59 B;  2M0X A;  4LJO B;  4KIK B;  4WJQ A;  4A20 A;  4ZDV A;  5IA7 A;  2LI5 A;  2O6V A;  4GOC A;  5KHO A;  2OJR A;  3RUI B;  2YLM A;  1I35 A;  4AJY B;  4G3X B;  5CHW A;  4CHK A;  1WZ3 A;  3PLU A;  2MCN B;  1WE7 A;  3H7P A;  3QAR A;  1TTN A;  2RSU A;  4PS8 A;  3U8Z A;  3A9K B;  2Z0E B;  4GU2 A;  1MG8 A;  3KW5 B;  3ZRC A;  4ANX A;  4RMA A;  3ZVV A;  2MRP A;  2BGF A;  3B08 A;  3IFW B;  2VRR B;  4GMV A;  2BYV E;  2DX5 B;  4MGY E;  2LXC A;  5LXI B;  1OEY J;  3PTF C;  1WH3 A;  2FCQ A;  2N1W A;  4ICV A;  4NAW B;  4ZRI A;  4G11 A;  4KV2 A;  4F7Z A;  3ZDT A;  3R66 C;  4KDL B;  3U30 A;  2KXJ A;  1L7Y A;  2V1Y A;  2ZPN A;  1J8C A;  1WI0 A;  4EUT A;  1UEL A;  3ZRF A;  2J0M A;  1VD2 A;  5J17 A;  2YVC A;  1PQS A;  2AYO B;  4MEL A;  4E3C A;  3OJ3 A;  3ENE A;  2JXX A;  2LWP A;  1J0G A;  2LRW A;  4K81 A;  3KUD B;  3VH4 B;  2G4D B;  2PE6 B;  2EKE C;  2L7R A;  2DYO A;  2WX0 A;  1WJ4 A;  2W9N A;  1ZGU B;  4A3P A;  3PHW B;  2RGF A;  2JZZ A;  4DHZ E;  4KVG B;  3UIP B;  2D07 B;  3D32 A;  4FJY A;  3WAP A;  2ZZP B;  4MJS A;  2DAJ A;  4URK A;  5LLI A;  2CHX A;  4EZJ A;  1V86 A;  4EZL A;  2L8J A;  2GBJ A;  3H7S A;  3UIO B;  2ZNV B;  2LJ5 A;  2LVO A;  3ZTD A;  4FJZ A;  3PT2 B;  2FID A;  2IZV B;  2LD9 A;  3UF8 A;  2KDE B;  2C9W B;  4DBG A;  2QHO A;  3SD5 A;  1IP9 A;  2GBK A;  2J7Q B;  1EF1 A;  1CMX B;  3L0W B;  4I6N B;  2LGX A;  3MHS D;  1C3T A;  1TBE A;  2K1F A;  4TKN A;  2IYD B;  3KYC D;  3QIJ A;  1UBQ A;  1Z5S B;  4FLH A;  3PRZ A;  1WGD A;  1OTR B;  3V60 A;  3LJ3 A;  3A33 B;  1V80 A;  2KLC A;  3H9D A;  2LXA A;  2O2V B;  3VHT C;  2BPS A;  1U4A A;  3WA0 A;  1WIA A;  2CHZ A;  3L08 A;  4ZRK A;  2L3Z A;  2C5L C;  2HD5 B;  2KDB A;  2C7H A;  1ZKH A;  4NQK E;  3WAN A;  4FBJ B;  1WR1 A;  2V4L A;  3M95 A;  4DK5 A;  4WJO A;  3DQV A;  5CHF A;  3VUW A;  4B9K A;  2MBE A;  2FCN A;  5JZE B;  2R2Q A;  3GOE A;  3JSV B;  1SE9 A;  4KSL C;  4ANV A;  2XEW A;  3CMM B;  1BT0 A;  5D6J B;  3RUL A;  1V49 A;  4F1S A;  3KVF B;  3VH3 B;  2FNJ B;  2REX A;  3V62 A;  2DHZ A;  4HPM B;  3RT3 B;  5JHB A;  1Y8R C;  1KOT A;  1UH6 A;  1WM2 A;  3JVZ X;  3ZNI D;  5G55 A;  4BVU C;  2MLB A;  4W9D A;  2ZCB A;  3RD2 A;  4TQ0 A;  3ML9 A;  1P0R A;  2D10 A;  4W9J A;  2LAS A;  4FJV B;  1TZ1 A;  3C0R B;  4PYU A;  1NBF C;  4WAA A;  3PRM B;  3TJP A;  3MTN B;  4K1R B;  1S3S G;  2O2V A;  4IM2 A;  3L54 A;  4GXB A;  5J18 A;  2D3G A;  4GDL B;  4K7S A;  4LDT D;  3PGE A;  2IO2 B;  3QWZ B;  4K7U A;  4DDG D;  2KC2 A;  3EEC A;  4XZ4 A;  3QA8 A;  3OLM D;  3Q3J A;  3PRP B;  1P98 A;  4HJK A;  4JGH B;  4BKS D;  5C23 A;  5J2R A;  2FAZ A;  3VUX A;  1KM7 A;  1V2Y A;  1WXS A;  1WR6 E;  3S2A A;  4TUU A;  2RPQ A;  3JSV A;  4HDO A;  2IBI B;  2KX3 A;  2LVQ A;  4ANW A;  4JIO U;  3ZTC A;  2KFK B;  3ZKJ C;  2HE7 A;  2L76 A;  2KVR A;  1R4M I;  2IY1 B;  3DPD A;  1GJZ A;  4NJ6 A;  2MX2 A;  1QZE A;  4WJN A;  2D2Q A;  3M62 B;  1WM3 A;  4IM3 A;  3EC8 A;  3VAW A;  1UZX B;  3B0A A;  4OVU A;  1R4N I;  2ZVN A;  4NQL B;  3QAQ A;  3VFK A;  1WFY A;  2KHW B;  2KAN A;  3ZW3 A;  2MBH A;  2KO3 A;  2N9X A;  4PYZ A;  2ZCC A;  4EFO A;  3N3K B;  4FA6 A;  1WXA A;  2JUO A;  2KJR A;  4MJS B;  1WX9 A;  3QHT A;  4BBN F;  3DBH I;  2KKC A;  5DCN A;  3APD A;  4GDL A;  2C7M B;  2JVC A;  2UWQ A;  4WWP A;  4WWO A;  1WGY A;  2G45 B;  1VCB A;  2KQ7 A;  1G6J A;  4B6W A;  4ZRJ A;  4IG7 B;  3PRE A;  5AEK B;  2XK5 B;  4N9F 4;  5D7G A;  3M63 B;  4BKT A;  3DBR I;  5EDS A;  1GNU A;  1I42 A;  1YIW A;  1WXV A;  2JZ3 B;  2DZM A;  4ASW C;  3ZIM A;  4AOF A;  1E8Z A;  4DHZ B;  4II2 B;  2KFK A;  4WWN A;  3ZNH B;  2N7E A;  3UQA A;  1UD7 A;  2UYZ B;  3GZN I;  1TGZ B;  2NBV B;  4OVV A;  5AZF A;  4DHJ D;  4BBN C;  4P7I A;  2DYM A;  2PEA A;  3PPA A;  1XT9 B;  2G3Q B;  4GDK A;  1WMH A;  1KLV A;  4JL9 A;  2KD0 A;  4G50 A;  2M8S A;  5DPS A;  2CS4 A;  1ZW7 A;  4MGI E;  2BYE A;  4W9L A;  4CO7 A;  2L00 B;  4II3 B;  3AU5 A;  1M94 A;  3VXW A;  2LVP A;  2HJ8 A;  3O65 B;  3HK0 A;  4XC2 A;  1E7V A;  2JY6 A;  3NHE B;  5AZH A;  3WAO A;  3IVF A;  3HM6 X;  1X1M A;  1WJ6 A;  5G2N A;  2MSE D;  2XK5 A;  3PV1 A;  1WF9 A;  3BIN A;  4I6P A;  4PS7 A;  4LDT B;  2DZI A;  3DCG A;  1JRU A;  3NZS A;  1V81 A;  1E8X A;  4FHK A;  2KJ6 A;  3QX1 A;  2R2O A;  3W1S A;  3DOW A;  3Q3F A;  4FN2 A;  4MM3 A; 
#chains in the Genus database with same CATH topology
 2KLG A;  3NZ3 A;  3RCZ A;  3ZDM C;  1JRO A;  1RFK A;  3PZD A;  3R7R A;  2KWU B;  5L83 A;  1F9J A;  3CF6 E;  2MP2 B;  4W9E A;  4MSQ B;  4LCD E;  2L05 A;  3L10 B;  2BF8 B;  3IBE A;  3AI5 A;  1RAX A;  1VR9 A;  2FCM A;  4JQW C;  3NS8 A;  3AE9 B;  3OG5 A;  1J19 A;  1FXT B;  2KTR B;  3AE8 B;  4HPP A;  4FAD A;  4IUM B;  4RNA A;  3PLV A;  2HTH A;  2WXK A;  4ICU A;  3KUZ A;  2RMM A;  1VZ7 A;  1C4C A;  1ESF A;  1IGC A;  1WXM A;  1CQV A;  2JPH A;  2WNM A;  5E6J A;  1UUP A;  1Z2M A;  1H4R A;  4EE2 A;  3TBL D;  2N1V A;  1SBB B;  1IPG A;  3PS6 A;  2K8C A;  4GDK B;  1WMH B;  2H89 B;  3BYY B;  2YEP B;  2VH1 A;  5CX3 A;  2EMT A;  3I9V 1;  5BO4 B;  4EOY A;  2NBW B;  1F52 A;  1VLB A;  3A9J A;  2JRH A;  1D5X C;  3EHV A;  4P16 A;  1YN3 A;  4YWG G;  1SIJ A;  2GRI A;  2O6V D;  4EKU A;  4F8C B;  3AM9 A;  3AED B;  2M56 B;  3TL5 A;  2DAF A;  4TV3 A;  3RZF A;  1FNV A;  2WXO A;  2BB6 A;  4A55 A;  1LM8 B;  2RR9 A;  3HM3 A;  1V8C A;  2M0A A;  3ZJV A;  2DZJ A;  4M0W A;  4R3D A;  1I4P A;  3Q8E A;  1GG3 A;  3AEB B;  2ICI A;  1TY0 A;  2ASQ A;  1JW9 D;  2K6D B;  3ZXV A;  4IWP A;  2M19 A;  4C4V B;  3R2I A;  2G1E A;  1LQB A;  3H1U A;  3MHZ A;  1FXA A;  2X8X X;  2B76 B;  3P2B A;  1V1O A;  4OW0 A;  1M4V A;  2IO3 B;  3A4S C;  2LMC A;  1NI3 A;  5FR6 A;  4NZL B;  4OZB A;  2I1J A;  1PUT A;  2XN9 C;  3FAH A;  4NPN A;  4DXG A;  2QSD A;  3KWV A;  4EEW A;  2KWC A;  2GMI C;  2J52 A;  3QK0 A;  1GC7 A;  1K53 A;  4NJC A;  3IT6 B;  2NPT B;  2KMC A;  2GBM A;  5BYS A;  4E71 A;  2AL6 A;  3MJW A;  3FC4 A;  3ZJU A;  2WS3 B;  3N32 A;  1K8R B;  4BZA A;  4WJP A;  3BII D;  4LNF A;  4NAM A;  1T0Y A;  3L13 A;  3NOB A;  3ALB A;  1YOV B;  4HKZ E;  2BKR B;  2J42 A;  3UQB A;  5JH5 C;  3NG0 A;  2KTF A;  4HRO A;  2KZR A;  4LTU A;  3EFU A;  1GC6 A;  2RDH A;  1WE6 A;  3NVZ A;  2CU1 A;  4DDI D;  4MT5 A;  2CKH B;  2CR5 A;  4WJQ A;  2LI5 A;  4RCO A;  5CHW A;  1C9F A;  1WE7 A;  3H7P A;  3QAR A;  4PS8 A;  3A9K B;  1MJD A;  3SFD B;  5IN7 A;  2IDY A;  3KW5 B;  2MRP A;  1D4B A;  1Q10 A;  4GMV A;  2DX5 B;  1OEY J;  1N5W A;  4ICV A;  5MPO A;  3Q8F A;  4G11 A;  3ZDT A;  3R66 C;  4KDL B;  1I4G A;  2L1A A;  1L7Y A;  2ZPN A;  1J8C A;  1UEL A;  3ZRF A;  1VD2 A;  2AYO B;  3T3N A;  2RPV A;  1J0G A;  1D6E C;  2LRW A;  4K81 A;  3VH4 B;  2G4D B;  1SJH D;  2PE6 B;  4O1N A;  2L7R A;  4S0R A;  1ZGU B;  4A3P A;  3RNE C;  4IDI A;  1TJE A;  2NTS A;  5FKA C;  3D32 A;  1FO4 A;  3WAP A;  2D3B A;  2ZZP B;  4MJS A;  1IBX A;  2DAJ A;  4URK A;  5LLI A;  2V0G A;  1MG4 A;  2IGG A;  3PT2 B;  2FID A;  2LD9 A;  2KDE B;  2C9W B;  1IP9 A;  2GBK A;  4I6N B;  1E0Z A;  1UWX A;  1C3T A;  2K1F A;  3KYC D;  3QIJ A;  4FLH A;  2BS2 B;  1OTR B;  3LJ3 A;  4BAX A;  2Y5P A;  2LXA A;  1FIQ A;  4REZ A;  1LGR A;  1F2R C;  3VR9 B;  4ZRK A;  2C7H A;  1ZKH A;  4LNI A;  1WR1 A;  1ZDV A;  1DOY A;  4B9K A;  3GOE A;  3JSV B;  3CMM B;  4F1S A;  2ONQ A;  5JHB A;  1Y8R C;  5BYQ A;  2VZK D;  3ZNI D;  1GOZ A;  1FPY A;  3LXF A;  4BVU C;  4K3C A;  4XWT A;  3N20 C;  4IOI E;  3TEW A;  4AS1 A;  4FJV B;  2WP9 B;  4K1R B;  1PDX A;  2O2V A;  2L32 A;  3QWZ B;  4YSX B;  3Q3J A;  1P98 A;  3Q2A C;  1CJE A;  4M00 A;  5G5H A;  2RPQ A;  1GPX A;  2D3C A;  1SJE D;  3W9C B;  1WRI A;  2KX3 A;  1KF6 B;  1AW7 A;  3P42 A;  4ANW A;  3EFC A;  1UGJ A;  3ZTC A;  3DBR B;  2HE7 A;  3DPD A;  2KVR A;  4NJ6 A;  1FRR A;  1QZE A;  1WM3 A;  4KX6 B;  2PVG C;  3FIL B;  4OVU A;  4NQL B;  3QAQ A;  3VFK A;  3ZW3 A;  5D3D A;  4EFO A;  4FA6 A;  1F77 A;  2W82 A;  1WX9 A;  3QHT A;  4RGM A;  4XE0 A;  4GDL A;  3C19 A;  4M02 A;  3I63 C;  3AE7 B;  3TEY A;  3C8Y A;  3DBR I;  5EDS A;  1GNU A;  1I42 A;  2JZ3 B;  3MP9 A;  1V97 A;  5T8I A;  4II2 B;  1DOI A;  2BT6 A;  2QMT A;  2UYZ B;  1E9M A;  1WXQ A;  4KKJ A;  5FR3 A;  4RGT A;  1MHH E;  2K3U A;  5HFY A;  2LJI A;  2I2Y A;  2CS4 A;  1ZW7 A;  2SEB D;  4MGI E;  4W9L A;  3NVV A;  1I4R A;  2L00 B;  4II3 B;  2LVP A;  3NHE B;  3WAO A;  3IVF A;  1ZXI A;  2EKI A;  3RNA C;  1WJ6 A;  5G2N A;  2MSE D;  2WXR A;  1WF9 A;  2JZP A;  3BIN A;  4I6P A;  2WU2 B;  4PS7 A;  4LDT B;  2DZI A;  1GB1 A;  1XEE A;  1JRU A;  5LNK 1;  3NS1 A;  4AP4 C;  4BKG A;  2IO0 B;  4HRS A;  4N6E B;  4W9K A;  4US9 A;  3B1L X;  2MW5 A;  4MDK E;  2V9H A;  3VTU A;  2N9E B;  4MEM A;  3SU8 X;  3X23 A;  3SHQ A;  3SDL C;  2PMV A;  1OGW A;  3KH0 A;  3P4P B;  4ZYS A;  2XBB C;  1TS3 A;  4XGA B;  1WYG A;  2IO1 B;  2ZPY A;  4K7W A;  1KLG D;  4LJP B;  2AX5 A;  4NY0 A;  1YQB A;  3V6C B;  4NNJ B;  1P1A A;  1FCL A;  2LGD A;  3QQ8 B;  5TR5 A;  3CWI A;  3U2S C;  2N7D A;  4CYE A;  4W9F A;  4GLS C;  4RM8 A;  5EE1 A;  2ZJD A;  3A9J B;  5AZG A;  2QIE B;  4AUQ C;  4DHJ B;  3R7Q A;  1VZ8 A;  3PZ7 A;  2KDM A;  1C1Y B;  2PPH A;  1STE A;  2K8B A;  2PJH A;  5HKH A;  4RGN A;  1MVK A;  2I1K A;  2KN4 A;  2N4F A;  1ENF A;  3U52 E;  3SFE B;  3BVG A;  5HG2 A;  3A4R A;  2KAJ A;  4DXF A;  2Y5C A;  4M0W B;  2MBQ A;  1XQQ A;  3VDZ A;  2LZ6 A;  1EF5 A;  3AE6 B;  2AQ1 B;  2D3A A;  1IGD A;  1P9D U;  2KDI A;  2Z8L A;  5CTR C;  2NTT A;  4M8N A;  2MJD A;  4GGQ A;  4D2K A;  4UDU C;  2HJ1 A;  2GOW A;  3AUL A;  4MM3 B;  1TY2 A;  1QLB B;  2KQ4 X;  1S1Q B;  3DVG Y;  3VTW A;  2CHW A;  2KYW A;  3AH7 A;  3WAL A;  4WH4 A;  3NJT A;  3RZW C;  4WQO B;  3HHM A;  2FE8 A;  3JYU A;  1AN8 A;  5E6N A;  3UIN B;  2WHI A;  4KIK A;  2YEP F;  5JXV A;  1TS4 A;  2JQR B;  2WYQ A;  2J0K A;  4MH0 E;  2AWT A;  2KK8 A;  2MJ3 A;  3IT4 B;  3OJ4 B;  1XLN A;  2LGY A;  4HVB A;  4DQO C;  1FEH A;  5GMV A;  1BUI C;  1ET6 A;  1EWC A;  4ANU A;  2KWV B;  1AAR A;  2IGH A;  5DPR A;  4NAW A;  2QIL A;  4MGK E;  3OAW A;  2QCZ A;  3BYT B;  5CHV C;  3TCA A;  2C7N B;  3N30 A;  4IM0 A;  1EUV B;  1SF0 A;  3W1Y A;  4FXC A;  2GBN A;  3AU4 A;  1MI0 A;  2M1M A;  1IYF A;  1E90 A;  3NVY A;  3AXC A;  3T9L A;  4WQM A;  3QCA A;  3AMZ A;  3CSF A;  3HVD A;  2EMS A;  2IJ0 A;  1VJK A;  4A3O A;  2WLB A;  3RI7 C;  3DVN U;  1SE3 A;  2BS3 B;  3O13 A;  5AUI A;  3H7P B;  3U7D A;  3MFG A;  3NZU A;  4YTN B;  3ZQ4 A;  4J3O D;  2PTL A;  1JML A;  1XD3 B;  1Q1O A;  4IW0 A;  3RYT A;  2C60 A;  4A6Q A;  3CST A;  4HDQ A;  1RFA A;  2AQ3 B;  2WU5 B;  3K9P B;  3PHX B;  2NR2 A;  2BKF A;  2Z59 B;  4ZDV A;  5IA7 A;  2WXQ A;  4KGS A;  3RUI B;  5KHO A;  1I35 A;  1N60 A;  2WDQ B;  4CHK A;  2MCN B;  1J7C A;  1TTN A;  3P4S B;  3DHI C;  2Z0E B;  1XO3 A;  3ZRC A;  1IBX B;  1FFU A;  3ZVV A;  3B08 A;  2VRR B;  4MGY E;  2LXC A;  4LNN A;  3PTF C;  1WH3 A;  2HTM E;  2KXJ A;  1FCC C;  3FKY A;  3VR8 B;  1OQQ A;  2G9H D;  1JAL A;  1E7P B;  1DGJ A;  2JXX A;  2N0S B;  3KUD B;  3Q3O C;  2DYO A;  4DHZ E;  3W5U B;  3UIP B;  3N1Y C;  1HEZ E;  3AEC B;  2MHJ A;  2CJO A;  4EZJ A;  2ACZ B;  1V86 A;  1WSP A;  3H7S A;  2IZV B;  2BBC A;  4H2A A;  4DBG A;  1EF1 A;  1C77 A;  1B1Z A;  2LGX A;  3N1X C;  1MPE A;  1IUE A;  1TBE A;  3ABV B;  1WGD A;  2J4X A;  2O2V B;  1TKE A;  2BPS A;  1QT9 A;  1U4A A;  3WA0 A;  3L08 A;  2HD5 B;  2KDB A;  4DK5 A;  3DQV A;  2R2Q A;  1MHX A;  4ANV A;  1L5P A;  2XEW A;  1V49 A;  3W5V B;  3KVF B;  2WDR B;  1KOT A;  3P4Q B;  5H8Y E;  2MLB A;  4W9D A;  4OZA A;  3RNF C;  3HRD D;  1C4A A;  3BWU D;  2D10 A;  1YJI A;  4USA A;  2LAS A;  2DWQ A;  3PRM B;  3TJP A;  4K7S A;  4GDL B;  1RM6 C;  4LDT D;  3I57 A;  2IO2 B;  4DDG D;  4XZ4 A;  2WDV B;  3QA8 A;  3PRP B;  4WWM A;  4HJK A;  4JGH B;  5J2R A;  3VUX A;  1KM7 A;  1V2Y A;  1WR6 E;  4TUU A;  1YN4 A;  3EUB 2;  4N58 A;  4HDO A;  2IBI B;  2LVQ A;  3RPF C;  3ZKJ C;  4WJN A;  2D2Q A;  3VAW A;  3EC8 A;  3P1M A;  1UZX B;  4YT0 B;  3GZN B;  3VRB B;  2VH2 A;  2KO3 A;  3AE3 B;  2Q5W D;  2IGD A;  2JUO A;  2KJR A;  4BBN F;  4MAC A;  5DCN A;  3APD A;  1WGY A;  2KQ7 A;  1I4H A;  1OQR A;  3ETR A;  1PGB A;  1YIW A;  1QQR A;  2DZM A;  3NRZ A;  1FRD A;  3P63 A;  3GZN I;  4A8X C;  1TGZ B;  2JX5 A;  4OVV A;  3AE2 B;  4DHJ D;  2DYM A;  2PEA A;  3PPA A;  4GDK A;  1KLV A;  1WMH A;  4JL9 A;  4G50 A;  4JWU C;  1QOF A;  3AE4 B;  1HQR D;  3O65 B;  2JY6 A;  3HM6 X;  2XK5 A;  2BTE A;  2N9L A;  1V1P A;  3DCG A;  2KVZ A;  1E8X A;  5GXG B;  2K5P A;  3Q3F A;  3QJZ A;  4HCN B;  1HA5 A;  1NYQ A;  3CIR B;  3WAM A;  4HXD A;  1UBI A;  1EO6 A;  2W54 A;  2LFI A;  3V6E B;  1QKZ A;  1VRA B;  3DVG X;  5KHQ A;  2WXP A;  3H6N A;  3BVM A;  3I3T B;  3IG3 A;  3VQI A;  4GB9 A;  2DYB A;  2MQJ A;  4AJW A;  2L0T A;  1WGH A;  2W55 A;  4C56 C;  3Q3M C;  4BKS A;  2KC1 A;  3UGB B;  1RYJ A;  3VUY A;  2KX0 A;  2KFJ A;  1D3Z A;  3V61 A;  1PYW D;  3T3O A;  1UF0 A;  3K9O B;  2BQQ A;  2KN5 A;  2E6X A;  4JLC A;  4E74 A;  2ZNV C;  5AUK A;  3QC8 B;  4B95 A;  4NJ7 A;  4PS3 A;  4XDC A;  1XCQ L;  5D94 A;  3GS2 A;  4IC7 B;  3SR6 A;  2KDF B;  3PVL A;  5BMG A;  4BOZ B;  2NPT A;  1EU3 A;  4ITK A;  4M01 A;  1E6E B;  1L4D B;  2V3N A;  4M8M A;  2NVU I;  4MSM B;  4XYC A;  2FUH B;  3E9S A;  5D2M B;  4BOS C;  3BY4 B;  2JRI B;  3ZNZ B;  4OHJ A;  1NEN B;  2MH7 A;  2G4S A;  4GIV A;  3AEG B;  3Q8B A;  1UGM A;  5IO9 A;  3R3M A;  1E7U A;  1UNS A;  3Q3N C;  4HWI B;  4KZ0 A;  5L95 C;  3B2F A;  1YD8 U;  1R7S A;  2DLB A;  2NMQ A;  3N1Z C;  4OVZ A;  2IND C;  4BFR A;  2OOB B;  1V5O A;  4HCP B;  2RD0 A;  3WIM A;  1PFD A;  1N63 A;  4J6I A;  1E5W A;  1MFW A;  1Q0W B;  1KJT A;  2KMA A;  3L16 A;  2WX1 A;  2XNA C;  1QF6 A;  3NY5 A;  3A9K A;  1SEB D;  1LFD A;  1B9R A;  4MGZ E;  4N59 A;  1WJU A;  1CZP A;  2BYF A;  1GUA B;  5JHA A;  3WCQ A;  3LDZ E;  3A1Q A;  3DVN V;  1K51 A;  1VZ6 A;  1XLQ A;  3APF A;  3W2D A;  1BML C;  5C2T B;  5EE3 A;  2AL3 A;  1FNW A;  2IY0 B;  1LXD A;  2EEL A;  1XXG A;  3N9Y C;  1HXY D;  3MC8 A;  4DXA B;  1WZ0 A;  3R2T A;  2WXM A;  3T8M A;  2D5G A;  2JT4 B;  2BYT A;  1WGG A;  3HIZ A;  3PZ8 A;  1I4X A;  4P1B C;  1AYF A;  1ISN A;  3ZLZ A;  1BXT A;  5FK9 C;  1HZ6 A;  3PSE B;  4C00 A;  1E8Y A;  3LYY A;  1VDV A;  2NBU A;  1JWM D;  3B9J A;  2WXF A;  1GB4 A;  1JWB D;  3DDC B;  3KQ4 A;  2ZW1 A;  4TSS A;  1FFV A;  2FUG 1;  4IWO A;  5G5G A;  2V3P A;  2WWZ A;  4CQN A;  2LUE A;  3B2G A;  2PKO A;  1DYQ A;  1YJ1 A;  2NCN A;  1XLP A;  1WRD B;  1WX7 A;  1L4Z B;  2M0X A;  2O6V A;  2OJR A;  3EA6 A;  1KLU D;  3AV8 A;  4G3X B;  2WXN A;  3U4E G;  3PLU A;  3U8Z A;  2K0P A;  4RGO S;  1WGK A;  3Q14 C;  4RF1 A;  4RMA A;  4JX1 C;  4IKG A;  2BGF A;  3IFW B;  3MJ5 A;  1FM0 D;  2OED A;  4KV2 A;  4F7Z A;  3U30 A;  4YXD B;  2V1Y A;  2INP E;  5EE0 A;  1WI0 A;  2J0M A;  1HTQ A;  5J17 A;  2YVC A;  1PQS A;  1SB3 C;  3OJ3 A;  2LWP A;  5C3J B;  2EKE C;  1F2R I;  3ZXR A;  5BMI A;  2W9N A;  3FIL A;  2RGF A;  2D07 B;  1YNT E;  2CHX A;  4WAF A;  3TSS A;  4HKQ A;  4EZL A;  2GBJ A;  4L23 A;  1TKY A;  2GI9 A;  1AWD A;  3UIO B;  1ZXH A;  2LJ5 A;  2ZNV B;  3BK1 A;  2QHO A;  1C4P A;  2J7Q B;  1TT5 B;  2IPK D;  3MHS D;  2CU3 A;  1F1H A;  2IYD B;  4XWW A;  1Z5S B;  3PRZ A;  2JYT A;  3A33 B;  1V80 A;  4TMA B;  1EU4 A;  2CJN A;  3DWM A;  2JWU A;  1NYR A;  3KWL A;  2C5L C;  4NQK E;  3M95 A;  3MC9 A;  4WJO A;  2LGS A;  5CHF A;  1ZOY B;  2FCN A;  3J9C A;  4YTM B;  1SE9 A;  1SE4 A;  5D6J B;  1BT0 A;  3RUL A;  2RDB C;  4L1B A;  2REX A;  2DHZ A;  3AE5 B;  1UH6 A;  4LNO A;  1WM2 A;  2ZCB A;  3RD2 A;  1R4N B;  1D5Z C;  1TZ1 A;  1NBF C;  4WAA A;  3MTN B;  4IM2 A;  4KKI A;  3L54 A;  2LHD A;  3PGE A;  4K7U A;  3OWE B;  2KC2 A;  3DBH B;  3EEC A;  2I38 A;  3OLM D;  2W3S A;  2J53 A;  5C23 A;  1YQ4 B;  4B0M A;  3S2A A;  2RDG A;  1K52 A;  2QJL A;  3DWG C;  3IAM 1;  4JIO U;  1XF5 L;  2KMM A;  2L76 A;  1GJZ A;  2Y3A A;  2MX2 A;  1RWS A;  4IM3 A;  3B0A A;  1R4N I;  2ZVN A;  2MBH A;  4PYZ A;  1EM7 A;  3N3K B;  4MJS B;  3DBH I;  2C7M B;  4WWP A;  1XCT L;  1JWU D;  4WWO A;  1NEK B;  1VCB A;  1G6J A;  4ZRJ A;  1SSN A;  2OJW A;  3PRE A;  2XK5 B;  4N9F 4;  5D7G A;  3M63 B;  3RMK C;  1V1P B;  1PGA A;  1KTK A;  1WXV A;  4C7Y A;  4ASW C;  1P7F A;  3ZIM A;  2K9X A;  4DHZ B;  2R61 A;  2KFK A;  3UQA A;  2WXG A;  1UD7 A;  2NBV B;  4BBN C;  1XT9 B;  4C80 A;  1N61 A;  4WUR A;  2BYE A;  4OZC A;  4CO7 A;  3AU5 A;  1M94 A;  2HJ8 A;  4XC2 A;  3DHG C;  3HK0 A;  1E7V A;  5AZH A;  1X1M A;  3Q69 A;  3U7Z A;  2GLS A;  3IAS 1;  1DOX A;  1JQ4 A;  4P6V F;  4FHK A;  3QX1 A;  2R2O A;  3TEX A;  3W1S A;  4FN2 A;  4MM3 A;  2L52 A;  2Y5B B;  1ROE A;  1WX8 A;  4I6L B;  3ZYY X;  2WXI A;  1ET9 A;  3GP7 A;  1WJN A;  3V05 A;  1E8W A;  2BWF A;  4YSY B;  4XDD A;  1YN5 A;  1ZUD 2;  1QOG A;  3IHP C;  1XLO A;  3ML8 A;  3APC A;  3BK2 A;  1JCK B;  1L6V A;  2PE9 A;  2MEK A;  1EWY C;  4GSW A;  1GAQ B;  2Z0D B;  5HHD G;  2FCS A;  3PO0 A;  1SGH A;  1RRB A;  3AN1 A;  3GE8 C;  1WWT A;  5IAA C;  2JWZ A;  3URY A;  3AEA B;  1JRP A;  1TS2 A;  3EGR A;  2B3A A;  4JE3 B;  2MP2 A;  3UI3 A;  5DPT A;  1C76 A;  3ZUN A;  4XX5 A;  4GN1 A;  5LXH A;  4KDI C;  4DWF A;  4W9H A;  1ZP0 B;  5DPW A;  1N5X A;  3H8H A;  2KTR A;  2KWD A;  2JF5 A;  3TMP B;  1H8C A;  4X57 B;  1L6U A;  1T6B X;  3RNC C;  4W9G A;  4IWQ A;  2ZVO A;  2TSS A;  2AEH A;  3RNB C;  2J0J A;  4ZHP A;  4JWS C;  4G0N B;  2KQS A;  4WIP A;  2JU6 X;  3P4R B;  5IKC M;  2A4Z A;  2M17 A;  3M3J A;  1KFY B;  1T5X D;  2LRU A;  1A5R A;  1L2N A;  1I4Q A;  3R8B A;  3ZO5 B;  3A1Q B;  1LO5 D;  2ZEQ A;  3SEB A;  2L0F A;  5E6P A;  1NDD A;  2BW2 A;  1C78 A;  2V3S A;  1SXT A;  1V9J A;  4RFB A;  4HEA 1;  2L83 A;  2PLP A;  2BB5 A;  2MBB B;  3V3X A;  4KGT A;  3DBL B;  3KYD D;  1Q5W B;  2DEN B;  3DBS A;  2QC8 A;  4FHJ A;  3NVW A;  3Q8C A;  2WDT B;  2FIF A;  1OEY A;  1TS5 A;  2MA9 B;  4W9I A;  4W9C A;  2KOX A;  3ZNG C;  2M4N A;  4HLE A;  4RM9 A;  2D11 A;  2GBR A;  4HK2 A;  1WYW B;  2V4I B;  1OQY A;  2MBO A;  5EE9 A;  3Q6B A;  1WGR A;  3ECI A;  4MH8 A;  1ZE3 D;  4YL8 A;  4FUL A;  4YTP B;  1WY8 A;  1NI2 A;  4P1C C;  3DBL I;  3ONS A;  1YX6 B;  4HJG E;  4PT5 A;  2OHF A;  1SIF A;  2KNB A;  3LB8 C;  5C1Z A;  1L0Y B;  2AQ2 B;  4AWJ A;  3JW0 X;  1JWA D;  3W1S C;  1SE2 A;  4C4V A;  1YX5 B;  3L17 A;  1T0R C;  3TIX A;  3Q8A A;  4LK0 M;  4KZC A;  2HDE A;  2BWE S;  4KSK C;  3VVW B;  5I4D A;  2INN E;  2N9P C;  1V5T A;  2O6V B;  4S17 A;  3AEF B;  2QEJ C;  3BZD B;  1P3Q U;  5E6O A;  5H92 C;  2WXJ A;  4EZK A;  2H88 B;  2PW9 A;  3HVZ A;  3KUC B;  4US8 A;  4HPL B;  2K25 A;  2MWS B;  2A5U A;  1HE8 A;  3VTV A;  1TZO A;  1KH0 A;  1N62 A;  2K39 A;  1A70 A;  1RLF A;  1V6E A;  2NS5 A;  4ZYN A;  4TQ1 A;  3HUI A;  1J7B A;  2KJH B;  3X0W A;  4PK1 A;  2K22 A;  5IP4 D;  2N9K A;  2K6Q A;  2K8H A;  2DZK A;  3KLS X;  1I7H A;  4LJO B;  4KIK B;  4A20 A;  4GOC A;  4A9A A;  2YLM A;  4AJY B;  1Y56 A;  1NVI D;  1WZ3 A;  2RSU A;  5TSS A;  2JSV X;  4GU2 A;  1MG8 A;  4ANX A;  2LGI A;  1FD6 A;  1K50 A;  2BYV E;  3E56 A;  4A90 A;  5LXI B;  2FCQ A;  2N1W A;  1L0V B;  1HZ5 A;  4NAW B;  1OFF A;  4L2Y A;  4ZRI A;  5HI1 A;  1ZDX A;  4EUT A;  1P7E A;  4C7Z A;  2JYE A;  3BVZ A;  4YSZ B;  4MEL A;  4E3C A;  1FXI A;  3ENE A;  2JXT A;  3TUO A;  1T3Q A;  2WX0 A;  1WJ4 A;  2FBW B;  3PHW B;  2JZZ A;  4KVG B;  2DNF A;  4FJY A;  1JWS D;  2QDF A;  1QOA A;  1PGX A;  2L8J A;  3MC0 B;  1TKG A;  3GE3 C;  2LVO A;  3ZTD A;  4FJZ A;  4RH6 A;  3RN9 C;  3UF8 A;  4LLG M;  3SD5 A;  1CMX B;  3L0W B;  1QIL A;  1HTO A;  2LEK A;  3GB1 A;  4TKN A;  1UBQ A;  1CK1 A;  3V60 A;  2KLC A;  1UWM A;  2X38 A;  3H9D A;  1YQ3 B;  3VHT C;  1FNU A;  1WIA A;  2CHZ A;  4FBJ B;  2L3Z A;  3WAN A;  4B0E A;  1T0S C;  1E10 A;  3ZGZ A;  2V4L A;  1YMH E;  3VUW A;  2MBE A;  5JZE B;  2WGS A;  4KSL C;  1ZPS A;  4ZOH C;  4QAY A;  3VH3 B;  2FNJ B;  3V62 A;  2LHE A;  4HPM B;  3RT3 B;  2ON8 A;  3JVZ X;  5G55 A;  5BMH A;  3DHH C;  4ARI A;  1R4M B;  4TQ0 A;  2WQY B;  1P0R A;  3ML9 A;  2PIA A;  4W9J A;  3C0R B;  2KT7 A;  4PYU A;  2PVO D;  1S3S G;  5J18 A;  4GXB A;  2GB1 A;  2D3G A;  3AEE B;  1KRH A;  4BKS D;  2FAZ A;  1WXS A;  1ACC A;  5D3I B;  3RFZ B;  4LNK A;  1TYG B;  3JSV A;  2UU7 A;  2MJE A;  2LUM A;  1L0X B;  2E3T A;  4ACF A;  2KFK B;  4K3B A;  1R4M I;  2IY1 B;  3TEZ A;  3M62 B;  4Q2J A;  1WFY A;  2KHW B;  2KAN A;  3AB5 A;  4ZRP A;  2N9X A;  2ZCC A;  1WXA A;  2DBY A;  1C79 A;  2KKC A;  3ZJT A;  2JVC A;  2UWQ A;  2WXH A;  1T0Q C;  4JPS A;  3I5J C;  2G45 B;  2WXL A;  4B6W A;  4IG7 B;  5AEK B;  2N7J A;  4BKT A;  4AQ7 A;  4AOF A;  1E8Z A;  4WWN A;  3ZNH B;  2N7E A;  3NUH B;  5AZF A;  1D5M C;  1J7A A;  4P7I A;  2BVC A;  2G3Q B;  2W3R A;  2KD0 A;  4KGR A;  4RF0 A;  3VRA B;  1F0Z A;  2M8S A;  5DPS A;  3IXS A;  2VZK B;  1TIF A;  3VXW A;  1N6Z A;  1QOB A;  2SAK A;  1FMA D;  3L4P A;  4ZHO A;  1YJJ A;  3PV1 A;  3RNG C;  4ARC A;  2ZW0 A;  3AE1 B;  4ZRQ A;  2KAC A;  5IOI A;  5BYR A;  2INC C;  3NZS A;  1V81 A;  2KJ6 A;  3DOW A;  2BS4 B; 
#chains in the Genus database with same CATH homology
 3QJZ A;  4AP4 C;  2Y5B B;  4HCN B;  2KLG A;  4BKG A;  2IO0 B;  1WX8 A;  4I6L B;  3ZDM C;  4W9K A;  3RCZ A;  3WAM A;  4HXD A;  1UBI A;  1EO6 A;  1WJN A;  2MW5 A;  3B1L X;  4MDK E;  3PZD A;  3V6E B;  3VTU A;  3R7R A;  2KWU B;  1E8W A;  2BWF A;  5L83 A;  2N9E B;  1F9J A;  4MEM A;  3SU8 X;  3X23 A;  3CF6 E;  3SHQ A;  2MP2 B;  4W9E A;  3DVG X;  3SDL C;  4MSQ B;  3IHP C;  5KHQ A;  3ML8 A;  1OGW A;  2L05 A;  3H6N A;  3KH0 A;  4LCD E;  3APC A;  2XBB C;  3I3T B;  3L10 B;  3IG3 A;  2IO1 B;  2ZPY A;  2BF8 B;  2PE9 A;  4K7W A;  3IBE A;  3VQI A;  4GB9 A;  2DYB A;  3AI5 A;  1RAX A;  2MQJ A;  4LJP B;  2FCM A;  4AJW A;  4JQW C;  1YQB A;  2L0T A;  4NY0 A;  3NS8 A;  1WGH A;  4GSW A;  4BKS A;  1J19 A;  1FXT B;  2KC1 A;  2KTR B;  2Z0D B;  3UGB B;  3V6C B;  4NNJ B;  2FCS A;  3VUY A;  2KX0 A;  4FAD A;  2KFJ A;  1D3Z A;  1P1A A;  2LGD A;  4IUM B;  3QQ8 B;  3V61 A;  1SGH A;  1RRB A;  5TR5 A;  3PLV A;  2HTH A;  2N7D A;  4CYE A;  4W9F A;  4RM8 A;  4ICU A;  2ZJD A;  3KUZ A;  3A9J B;  3K9O B;  5AZG A;  5IAA C;  2JWZ A;  2KN5 A;  4JLC A;  1WXM A;  4E74 A;  4AUQ C;  2ZNV C;  4DHJ B;  3R7Q A;  2B3A A;  3QC8 B;  1C1Y B;  4B95 A;  2PPH A;  2JPH A;  4NJ7 A;  4PS3 A;  2MP2 A;  2K8B A;  2PJH A;  1Z2M A;  5HKH A;  1H4R A;  5D94 A;  5DPT A;  3TBL D;  2I1K A;  4IC7 B;  3ZUN A;  2N1V A;  1IPG A;  2N4F A;  3PS6 A;  2K8C A;  4XX5 A;  4GDK B;  1WMH B;  2KDF B;  3PVL A;  4GN1 A;  4BOZ B;  2NPT A;  5LXH A;  4M8M A;  2NVU I;  4KDI C;  4MSM B;  4DWF A;  4W9H A;  2FUH B;  3A4R A;  5DPW A;  2KTR A;  5D2M B;  4BOS C;  2JF5 A;  3TMP B;  1H8C A;  5CX3 A;  3BY4 B;  2JRI B;  1XQQ A;  2MBQ A;  4M0W B;  4X57 B;  2EMT A;  3VDZ A;  3ZNZ B;  5BO4 B;  2LZ6 A;  4EOY A;  2NBW B;  1EF5 A;  2G4S A;  4GIV A;  3A9J A;  4W9G A;  2JRH A;  1UGM A;  3R3M A;  4IWQ A;  2ZVO A;  1E7U A;  3EHV A;  2AEH A;  1P9D U;  2KDI A;  5CTR C;  4HWI B;  2J0J A;  2O6V D;  4KZ0 A;  4EKU A;  4F8C B;  4M8N A;  4GGQ A;  4G0N B;  5L95 C;  2GOW A;  1YD8 U;  3AUL A;  3TL5 A;  2KQS A;  2DAF A;  4TV3 A;  3RZF A;  1S1Q B;  3DVG Y;  3VTW A;  2A4Z A;  2M17 A;  3M3J A;  2LRU A;  1A5R A;  2CHW A;  1L2N A;  3WAL A;  4BFR A;  2OOB B;  3ZO5 B;  1LM8 B;  3A1Q B;  4WQO B;  3RZW C;  1V5O A;  2ZEQ A;  3HHM A;  4HCP B;  2RR9 A;  3HM3 A;  2RD0 A;  3JYU A;  2L0F A;  5E6N A;  3UIN B;  3WIM A;  5E6P A;  2DZJ A;  1NDD A;  4KIK A;  2V3S A;  1V9J A;  4J6I A;  1E5W A;  2WYQ A;  2J0K A;  4MH0 E;  2AWT A;  1Q0W B;  1KJT A;  1GG3 A;  2KK8 A;  2KMA A;  2MBB B;  3L16 A;  2WX1 A;  3KYD D;  1Q5W B;  2ASQ A;  2DEN B;  3DBS A;  3OJ4 B;  2K6D B;  4FHJ A;  3NY5 A;  3A9K A;  4IWP A;  2WDT B;  2FIF A;  1OEY A;  2LGY A;  2MA9 B;  4W9I A;  1LFD A;  4W9C A;  2KOX A;  3ZNG C;  4MGZ E;  2M4N A;  4HVB A;  4HLE A;  4RM9 A;  5GMV A;  2D11 A;  1LQB A;  1WJU A;  2GBR A;  3H1U A;  4HK2 A;  1WYW B;  2BYF A;  1OQY A;  4ANU A;  1GUA B;  2KWV B;  2MBO A;  5JHA A;  1AAR A;  3P2B A;  4NAW A;  5DPR A;  1WGR A;  3LDZ E;  3ECI A;  4MGK E;  2IO3 B;  3OAW A;  3A1Q A;  3DVN V;  3A4S C;  4YL8 A;  5FR6 A;  4FUL A;  5CHV C;  3APF A;  3TCA A;  2I1J A;  1WY8 A;  2C7N B;  4NPN A;  1NI2 A;  3N30 A;  4IM0 A;  3DBL I;  3ONS A;  1EUV B;  1YX6 B;  2AL3 A;  1SIF A;  2KNB A;  5C1Z A;  2IY0 B;  3W1Y A;  1LXD A;  4EEW A;  2KWC A;  2GBN A;  2GMI C;  3AU4 A;  4DXA B;  1WZ0 A;  2M1M A;  3QK0 A;  1GC7 A;  3T8M A;  1E90 A;  4AWJ A;  2JT4 B;  3AXC A;  3T9L A;  1IYF A;  3QCA A;  2NPT B;  3JW0 X;  2KMC A;  3W1S C;  1YX5 B;  1WGG A;  3HIZ A;  2GBM A;  3L17 A;  3TIX A;  4E71 A;  1ISN A;  2AL6 A;  3CSF A;  3MJW A;  2BWE S;  4KSK C;  4KZC A;  2EMS A;  4A3O A;  3ZLZ A;  3N32 A;  3VVW B;  1K8R B;  3DVN U;  4WJP A;  2N9P C;  1V5T A;  2O6V B;  3PSE B;  1T0Y A;  3L13 A;  1P3Q U;  1E8Y A;  2NBU A;  3H7P B;  3NOB A;  5E6O A;  3ALB A;  3U7D A;  4EZK A;  3KUC B;  4HPL B;  3NZU A;  2K25 A;  2MWS B;  2A5U A;  2BKR B;  1HE8 A;  3VTV A;  3UQB A;  2K39 A;  5JH5 C;  1XD3 B;  2KTF A;  1Q1O A;  3DDC B;  4IW0 A;  3RYT A;  2C60 A;  1RLF A;  1V6E A;  2NS5 A;  3CST A;  4ZYN A;  2KZR A;  4HDQ A;  4TQ1 A;  3EFU A;  1GC6 A;  4IWO A;  1WE6 A;  2WWZ A;  1RFA A;  2LUE A;  2CU1 A;  2KJH B;  3K9P B;  3X0W A;  4DDI D;  3PHX B;  1YJ1 A;  2CKH B;  2BKF A;  2NCN A;  2NR2 A;  1WRD B;  2K6Q A;  2K8H A;  1WX7 A;  2CR5 A;  2DZK A;  2Z59 B;  2M0X A;  4LJO B;  4KIK B;  4WJQ A;  4A20 A;  4ZDV A;  5IA7 A;  2LI5 A;  2O6V A;  4GOC A;  5KHO A;  2OJR A;  3RUI B;  2YLM A;  1I35 A;  4AJY B;  4G3X B;  5CHW A;  4CHK A;  1WZ3 A;  3PLU A;  2MCN B;  1WE7 A;  3H7P A;  3QAR A;  1TTN A;  2RSU A;  4PS8 A;  3U8Z A;  3A9K B;  2Z0E B;  4GU2 A;  1MG8 A;  3KW5 B;  3ZRC A;  4ANX A;  4RMA A;  3ZVV A;  2MRP A;  2BGF A;  3B08 A;  3IFW B;  2VRR B;  4GMV A;  2BYV E;  2DX5 B;  4MGY E;  2LXC A;  5LXI B;  1OEY J;  3PTF C;  1WH3 A;  2FCQ A;  2N1W A;  4ICV A;  4NAW B;  4ZRI A;  4G11 A;  4KV2 A;  4F7Z A;  3ZDT A;  3R66 C;  4KDL B;  3U30 A;  2KXJ A;  1L7Y A;  2V1Y A;  2ZPN A;  1J8C A;  1WI0 A;  4EUT A;  1UEL A;  3ZRF A;  2J0M A;  1VD2 A;  5J17 A;  2YVC A;  1PQS A;  2AYO B;  4MEL A;  4E3C A;  3OJ3 A;  3ENE A;  2JXX A;  2LWP A;  1J0G A;  2LRW A;  4K81 A;  3KUD B;  3VH4 B;  2G4D B;  2PE6 B;  2EKE C;  2L7R A;  2DYO A;  2WX0 A;  1WJ4 A;  2W9N A;  1ZGU B;  4A3P A;  3PHW B;  2RGF A;  2JZZ A;  4DHZ E;  4KVG B;  3UIP B;  2D07 B;  3D32 A;  4FJY A;  3WAP A;  2ZZP B;  4MJS A;  2DAJ A;  4URK A;  5LLI A;  2CHX A;  4EZJ A;  1V86 A;  4EZL A;  2L8J A;  2GBJ A;  3H7S A;  3UIO B;  2ZNV B;  2LJ5 A;  2LVO A;  3ZTD A;  4FJZ A;  3PT2 B;  2FID A;  2IZV B;  2LD9 A;  3UF8 A;  2KDE B;  2C9W B;  4DBG A;  2QHO A;  3SD5 A;  1IP9 A;  2GBK A;  2J7Q B;  1EF1 A;  1CMX B;  3L0W B;  4I6N B;  2LGX A;  3MHS D;  1C3T A;  1TBE A;  2K1F A;  4TKN A;  2IYD B;  3KYC D;  3QIJ A;  1UBQ A;  1Z5S B;  4FLH A;  3PRZ A;  1WGD A;  1OTR B;  3V60 A;  3LJ3 A;  3A33 B;  1V80 A;  2KLC A;  3H9D A;  2LXA A;  2O2V B;  3VHT C;  2BPS A;  1U4A A;  3WA0 A;  1WIA A;  2CHZ A;  3L08 A;  4ZRK A;  2L3Z A;  2C5L C;  2HD5 B;  2KDB A;  2C7H A;  1ZKH A;  4NQK E;  3WAN A;  4FBJ B;  1WR1 A;  2V4L A;  3M95 A;  4DK5 A;  4WJO A;  3DQV A;  5CHF A;  3VUW A;  4B9K A;  2MBE A;  2FCN A;  5JZE B;  2R2Q A;  3GOE A;  3JSV B;  1SE9 A;  4KSL C;  4ANV A;  2XEW A;  3CMM B;  1BT0 A;  5D6J B;  3RUL A;  1V49 A;  4F1S A;  3KVF B;  3VH3 B;  2FNJ B;  2REX A;  3V62 A;  2DHZ A;  4HPM B;  3RT3 B;  5JHB A;  1Y8R C;  1KOT A;  1UH6 A;  1WM2 A;  3JVZ X;  3ZNI D;  5G55 A;  4BVU C;  2MLB A;  4W9D A;  2ZCB A;  3RD2 A;  4TQ0 A;  3ML9 A;  1P0R A;  2D10 A;  4W9J A;  2LAS A;  4FJV B;  1TZ1 A;  3C0R B;  4PYU A;  1NBF C;  4WAA A;  3PRM B;  3TJP A;  3MTN B;  4K1R B;  1S3S G;  2O2V A;  4IM2 A;  3L54 A;  4GXB A;  5J18 A;  2D3G A;  4GDL B;  4K7S A;  4LDT D;  3PGE A;  2IO2 B;  3QWZ B;  4K7U A;  4DDG D;  2KC2 A;  3EEC A;  4XZ4 A;  3QA8 A;  3OLM D;  3Q3J A;  3PRP B;  1P98 A;  4HJK A;  4JGH B;  4BKS D;  5C23 A;  5J2R A;  2FAZ A;  3VUX A;  1KM7 A;  1V2Y A;  1WXS A;  1WR6 E;  3S2A A;  4TUU A;  2RPQ A;  3JSV A;  4HDO A;  2IBI B;  2KX3 A;  2LVQ A;  4ANW A;  4JIO U;  3ZTC A;  2KFK B;  3ZKJ C;  2HE7 A;  2L76 A;  2KVR A;  1R4M I;  2IY1 B;  3DPD A;  1GJZ A;  4NJ6 A;  2MX2 A;  1QZE A;  4WJN A;  2D2Q A;  3M62 B;  1WM3 A;  4IM3 A;  3EC8 A;  3VAW A;  1UZX B;  3B0A A;  4OVU A;  1R4N I;  2ZVN A;  4NQL B;  3QAQ A;  3VFK A;  1WFY A;  2KHW B;  2KAN A;  3ZW3 A;  2MBH A;  2KO3 A;  2N9X A;  4PYZ A;  2ZCC A;  4EFO A;  3N3K B;  4FA6 A;  1WXA A;  2JUO A;  2KJR A;  4MJS B;  1WX9 A;  3QHT A;  4BBN F;  3DBH I;  2KKC A;  5DCN A;  3APD A;  4GDL A;  2C7M B;  2JVC A;  2UWQ A;  4WWP A;  4WWO A;  1WGY A;  2G45 B;  1VCB A;  2KQ7 A;  1G6J A;  4B6W A;  4ZRJ A;  4IG7 B;  3PRE A;  5AEK B;  2XK5 B;  4N9F 4;  5D7G A;  3M63 B;  4BKT A;  3DBR I;  5EDS A;  1GNU A;  1I42 A;  1YIW A;  1WXV A;  2JZ3 B;  2DZM A;  4ASW C;  3ZIM A;  4AOF A;  1E8Z A;  4DHZ B;  4II2 B;  2KFK A;  4WWN A;  3ZNH B;  2N7E A;  3UQA A;  1UD7 A;  2UYZ B;  3GZN I;  1TGZ B;  2NBV B;  4OVV A;  5AZF A;  4DHJ D;  4BBN C;  4P7I A;  2DYM A;  2PEA A;  3PPA A;  1XT9 B;  2G3Q B;  4GDK A;  1WMH A;  1KLV A;  4JL9 A;  2KD0 A;  4G50 A;  2M8S A;  5DPS A;  2CS4 A;  1ZW7 A;  4MGI E;  2BYE A;  4W9L A;  4CO7 A;  2L00 B;  4II3 B;  3AU5 A;  1M94 A;  3VXW A;  2LVP A;  2HJ8 A;  3O65 B;  3HK0 A;  4XC2 A;  1E7V A;  2JY6 A;  3NHE B;  5AZH A;  3WAO A;  3IVF A;  3HM6 X;  1X1M A;  1WJ6 A;  5G2N A;  2MSE D;  2XK5 A;  3PV1 A;  1WF9 A;  3BIN A;  4I6P A;  4PS7 A;  4LDT B;  2DZI A;  3DCG A;  1JRU A;  3NZS A;  1V81 A;  1E8X A;  4FHK A;  2KJ6 A;  3QX1 A;  2R2O A;  3W1S A;  3DOW A;  3Q3F A;  4FN2 A;  4MM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...