2FCNA

X-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
total genus 21
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcnA00
3A9JB 4E3CA 4XZ4A 1LXDA 3DPDA 4FBJB 3ALBA 3NHEB 2FNJB 2KMCA 1U4AA 3VUYA 4PYUA 2V3SA 1MG8A 2LRUA 1UD7A 3ZW3A 1P9DU 3M3JA 5AZGA 3QC8B 3A1QA 4NAWA 5D6JB 3CSTA 3T8MA 4NJ6A 3ZDTA 3HHMA 1GUAB 4RMAA 5D7GA 4BBNF 2K6DB 3A9KB 1LQBA 1SE9A 2IY0B 4BVUC 2RD0A 4KVGB 4LDTB 4LJOB 1E90A 2OJRA 1WZ3A 4IWPA 1EUVB 4MSMB 3VUXA 2LXCA 4DXAB 4HJKA 1YX5B 4A3PA 2FAZA 2N9PC 4PYZA 2L0TA 2DYBA 1BT0A 2D3GA 4TQ0A 1WM2A 3WAPA 5D94A 2KX0A 1F9JA 2IO1B 3GOEA 4I6NB 3UINB 4IW0A 1S3SG 3I3TB 1E8WA 3ZKJC 3OAWA 3DBLI 2JZZA 3MJWA 3QCAA 4EFOA 2KTRB 2LGXA 3JVZX 2PEAA 4EKUA 3NZUA 4N9F4 1A5RA 3PT2B 4DHJB 2REXA 4JIOU 5KHQA 3GZNI 5GMVA 1ZGUB 4DHJD 2KDEB 1GG3A 1TTNA 2KFKB 3KYDD 2Z0EB 4J6IA 3VTWA 3V62A 1P98A 3H7PA 4GIVA 2N4FA 2KFJA 2EKEC 1WGYA 3SD5A 4AWJA 3JSVB 3WAMA 4ANVA 1V2YA 1P0RA 2AWTA 3VH3B 4GU2A 2MBBB 1R4MI 4W9CA 3U30A 5JZEB 2GBRA 5DPSA 3QA8A 3PHXB 1NDDA 4NJ7A 4KIKB 1GNUA 2C5LC 4X57B 2CS4A 3L08A 1J8CA 4MDKE 1WXSA 3ML9A 4E74A 1OGWA 1WI0A 3VTUA 3A9KA 1OTRB 4KSLC 2KOXA 4TV3A 2LGYA 2D2QA 2YVCA 2KC1A 1WYWB 3A4RA 2L00B 2WX1A 2CHWA 1OQYA 4NQLB 2JUOA 4W9IA 1XQQA 3QWZB 1R4NI 4W9LA 4DHZE 4K7SA 2FCQA 2J7QB 3VVWB 4WJNA 2CR5A 4NY0A 2KC2A 3U7DA 2DZIA 1I42A 1WZ0A 2K8BA 3QHTA 1WJNA 3VHTC 4IG7B 2N9EB 4BFRA 2DZMA 2FUHB 2LJ5A 1V49A 4ZYNA 5G55A 5J18A 1WXAA 3DBRI 2KTRA 3PTFC 4FN2A 2ZPNA 3ZTCA 1WX8A 2HJ8A 2RSUA 3KUZA 5JHBA 1Z2MA 4HPLB 4MJSB 2JY6A 2LGDA 2MSED 3JW0X 4I6LB 3IVFA 2HE7A 2KFKA 2DZKA 4ZRJA 2K6QA 5BO4B 3KUCB 1WXMA 2LASA 3IFWB 2IO3B 4TUUA 2BWES 4PS3A 4W9GA 1WMHB 1WJ4A 4K7UA 2KX3A 3LDZE 2NVUI 1TBEA 2I1JA 2LVPA 3BY4B 3JSVA 3L0WB 3WANA 2AYOB 3CF6E 5G2NA 1QZEA 3PPAA 3QAQA 2DYMA 2DAFA 3VDZA 3M62B 1WJ6A 2OOBB 2RGFA 5EDSA 4NQKE 1WR6E 4KIKA 4KZCA 4URKA 2AEHA 2FCSA 2LI5A 2WX0A 3RUIB 4GXBA 4AOFA 4BKGA 4KSKC 3DCGA 4WJOA 2LVQA 2XK5B 2JZ3B 2PPHA 2ZVNA 3W1SA 2AL6A 3EFUA 4IM3A 3VQIA 3DVNU 1Q0WB 2MW5A 3RZWC 1KOTA 4IWOA 3ZUNA 3VUWA 2JRHA 1V5TA 3R7RA 1P1AA 3ZIMA 4BKSA 4ANWA 1E5WA 3PSEB 2DZJA 2ZNVB 3PRPB 3T9LA 3RYTA 3R7QA 4HVBA 4LDTD 2BKRB 1WF9A 3AU4A 3HK0A 4MSQB 4DBGA 3NOBA 3QX1A 4A20A 2N9XA 2L3ZA 4FLHA 3H1UA 3KH0A 4MGIE 2Y5BB 3TJPA 2A4ZA 3APFA 4EZJA 2XBBC 3OLMD 2GMIC 3PGEA 1OEYJ 2DAJA 2RR9A 4II2B 2IY1B 3PS6A 1YQBA 3RZFA 1V5OA 4MGKE 1UELA 3UF8A 4DDGD 4G3XB 2N1VA 2J0KA 3V6EB 2K1FA 4WWPA 4GMVA 4HLEA 1NI2A 2MBOA 2KDFB 4A3OA 4FA6A 1J0GA 2KWUB 4M8MA 4ZDVA 3WALA 3DOWA 3QJZA 2KQSA 2ZVOA 3K9OB 4ANXA 4HDQA 1Q1OA 2FIFA 1G6JA 4WQOB 2GBNA 3PHWB 4IWQA 1T0YA 4K81A 3A33B 3V61A 2W9NA 4F8CB 3L10B 3PRMB 2BPSA 2C9WB 1WXVA 2UWQA 4K7WA 3TIXA 5J2RA 2ZZPB 3DBHI 4KDLB 1E7UA 3MHSD 4KZ0A 3QQ8B 3V60A 2MQJA 4WJQA 2PE9A 2PJHA 1M94A 2FCMA 3MTNB 4JGHB 4GB9A 1E8YA 4MELA 3PREA 4GDLB 4FULA 4AJYB 3A9JA 1LM8B 1X1MA 3JYUA 2A5UA 2JXXA 2NBWB 4W9DA 1I35A 1Y8RC 2D07B 3ECIA 3SU8X 2KJHB 4W9JA 4BOSC 4HCNB 5LXHA 2KJRA 2DHZA 4EZLA 2V4LA 3L54A 1PQSA 2ZNVC 2MWSB 3L16A 4B6WA 2C7MB 4GDKB 4EEWA 3TMPB 1RAXA 3ONSA 2HD5B 3DQVA 2LVOA 2LUEA 1RLFA 3UQAA 1EF1A 4IM2A 4BKSD 4ANUA 2NS5A 3ML8A 4MH0E 1RRBA 2GOWA 2NPTB 3DBSA 4OVUA 2I1KA 3O65B 2K8CA 3N30A 4XC2A 3H7SA 5CHVC 3D32A 2KO3A 1UBIA 2J0MA 2MCNB 1XT9B 4PS7A 3ZDMC 1WFYA 4YL8A 3APCA 3PRZA 4NAWB 4JQWC 4NPNA 2L76A 2ZPYA 4NNJB 2WWZA 4DK5A 3QK0A 2C7HA 4GN1A 4ASWC 4FJZA 2MA9B 3PLVA 2MBHA 2FCNA 2KDBA 1L2NA 2DENB 5E6OA 2L8JA 3QARA 4F7ZA 2KXJA 3NS8A 2N7EA 1CMXB 2B3AA 3K9PB 4ICUA 4HWIB 4W9KA 3H6NA 5DPWA 1YJ1A 1WX7A 2QHOA 4KV2A 4FADA 2K25A 2JPHA 3SHQA 4GDLA 3ZNGC 4GOCA 2IBIB 2AL3A 4B9KA 2FIDA 1NBFC 3UIOB 3QIJA 3M63B 4WWNA 3U8ZA 3ENEA 2NBVB 5L83A 2JVCA 1OEYA 2CHXA 4LCDE 4HCPB 2BKFA 2MLBA 3DVGY 3AI5A 5DCNA 1WGRA 5CX3A 2XEWA 3ZTDA 4BKTA 3CSFA 1WGHA 4FJVB 4G50A 1WX9A 3TL5A 1WM3A 3A4SC 1E7VA 3TBLD 3TCAA 2K8HA 3RT3B 4GDKA 5TR5A 2KANA 1KM7A 4WAAA 2D10A 3HM6X 4I6PA 3UIPB 5AEKB 2LXAA 5JHAA 4CO7A 4II3B 2JWZA 2MBQA 2G45B 2R2QA 1UBQA 2L7RA 4AJWA 2DX5B 3PZDA 1UH6A 2PE6B 2GBKA 2KQ7A 2MX2A 1TZ1A 5E6NA 4DHZB 2JF5A 4ICVA 3W1SC 3ZRCA 1KJTA 3WA0A 2RPQA 4EOYA 5JH5C 2ZCBA 4BBNC 3VTVA 2G4DB 4MEMA 3WAOA 1UGMA 3VH4B 2WYQA 2J0JA 3C0RB 3W1YA 5LLIA 3Q3FA 4M0WB 2NCNA 3CMMB 4MJSA 5FR6A 2BYVE 2KLGA 3AULA 4B95A 4W9FA 2BWFA 2LRWA 5DPTA 1WY8A 3RCZA 5C23A 2UYZB 3V6CB 2IO0B 1V6EA 1WMHA 2BYFA 1V80A 3ZNZB 2ASQA 1WGDA 2K39A 1YIWA 2G3QB 2L05A 2M0XA 3B08A 1WR1A 4ZRIA 3ZRFA 3ZVVA 4TQ1A 5DPRA 2KWCA 2KVRA 2R2OA 2KKCA 1L7YA 3UGBB 1AARA 4AUQC 1SGHA 2KWVB 3PLUA 1C3TA 1H4RA 1V86A 3L13A 2GBMA 3UQBA 1LFDA 2KTFA 2ZEQA 2EMSA 4HK2A 2KN5A 1ZKHA 3P2BA 4FHJA 5CTRC 1YX6B 4DDID 2XK5A 3R3MA 1JRUA 4GGQA 2NBUA 1D3ZA 3AU5A 3EC8A 2N1WA 2M8SA 2ZJDA 1EO6A 4W9EA 3EECA 3S2AA 4LJPB 1S1QB 2YLMA 3KVFB 2CU1A 1WE6A 2IO2B 2M1MA 4HXDA 1P3QU 1UZXB 4BOZB 3HIZA 4CYEA 3M95A 3ZO5B 5LXIB 4ZRKA 1K8RB 1E8XA 1Q5WB 3SDLC 1TGZB 3X23A 5CHWA 1EF5A 2MP2B 1FXTB 1C1YB 2Z59B 4G11A 4GSWA 2KLCA 4IM0A 2BYEA 4TKNA 4F1SA 4XX5A 2O6VB 2MBEA 2O2VB 3DDCB 3DVNV 4HPMB 4M8NA 4OVVA 3N32A 1WE7A 5L95C 2O6VD 1GC7A 5C1ZA 2GBJA 3DVGX 3ZNID 5HKHA 2LD9A 2WDTB 3VFKA 3APDA 2KHWB 1E8ZA 1ZW7A 2KZRA 3B0AA 1SIFA 2C7NB 3NY5A 2HTHA 2JRIB 4JLCA 4RM8A 2VRRB 4CHKA 1ISNA 2KDIA 3EHVA 1J19A 5D2MB 3KUDB 1GC6A 3A1QB 4WWOA 3RD2A 1H8CA 4AP4C 2G4SA 2M17A 4EUTA 1IPGA 3PV1A 1KLVA 2N7DA 1HE8A 3L17A 4P7IA 4IUMB 4WJPA 2C60A 4PS8A 3B1LX 3HM3A 3H9DA 3RULA 4EZKA 4MGYE 4E71A 5J17A 3ZNHB 2Z0DB 3KW5B 5CHFA 1VD2A 3ZLZA 2KNBA 4W9HA 2CKHB 3NZSA 1IP9A 3BINA 1V9JA 3PVLA 5AZHA 3IBEA 4RM9A 2IYDB 5E6PA 1WRDB 2L0FA 2LZ6A 1WJUA 3IG3A 2JT4B 3KYCD 4FHKA 4FJYA 4HDOA 3WIMA 2BGFA 4IC7B 5AZFA 2BF8B 2D11A 2M4NA 4MM3A 2EMTA 4DWFA 3OJ3A 1V81A 3LJ3A 1Z5SB 2DYOA 2CHZA 1IYFA 2NR2A 1GJZA 1WH3A 5KHOA 2LWPA 1VCBA 2V1YA 3OJ4B 5IAAC 3VAWA 2MRPA 3AXCA 2MP2A 1XD3B 2KJ6A 3H7PB 3IHPC 3N3KB 1WIAA 1YD8U 2KD0A 2O6VA 2O2VA 3Q3JA 4MGZE 3VXWA 2IZVB 2KK8A 4G0NB 4JL9A 1RFAA 1WGGA 3R66C 2NPTA 3X0WA 2KMAA 4KDIC 2ZCCA 4K1RB 5IA7A
chains in the Genus database with same CATH superfamily
4E3CA 1L5PA 1LXDA 2ICIA 3NHEB 3SFDB 4ACFA 1MG8A 3M3JA 3QC8B 5D6JB 3CSTA 3C8YA 4MT5A 4NJ6A 2MJ3A 2WNMA 1ZPSA 2K6DB 3A9KB 1LQBA 2IY0B 1IUEA 3GB1A 1WZ3A 2BQQA 1YX5B 1FEHA 1K51A 2FAZA 2N9PC 3BK1A 4PYZA 3I5JC 4TQ0A 3WAPA 1F9JA 5BYSA 3GOEA 2RDBC 2JZZA 3QCAA 1KTKA 2LGXA 1A5RA 4LTUA 2REXA 3GZNI 2KDEB 1TTNA 3KYDD 3NRZA 4J6IA 3AE9B 1P98A 1TJEA 2N4FA 2KFJA 1TY0A 2EKEC 1WGYA 3SD5A 2QIEB 3TSSA 4ANVA 3ABVB 4C4VB 4A9AA 3VH3B 4BAXA 3P1MA 1SE4A 1NDDA 2C5LC 4X57B 2CS4A 3L08A 4MDKE 3ML9A 1WI0A 2KVZA 3IT6B 4HROA 4KKIA 4REZA 4C7YA 1FFVA 2RMMA 1L4DB 2LGYA 3I63C 1P7EA 4LK0M 2N0SB 1XQQA 3QWZB 2WXKA 1R4NI 1RM6C 3U7DA 3VHTC 3QHTA 3DBLB 1SF0A 1V49A 3EUB2 4ZHOA 2KTRA 2W3RA 4FN2A 4RF0A 4KGRA 1V1PB 5JHBA 1SXTA 1Z2MA 3JW0X 2K6QA 3KUCB 3IAS1 3AEGB 4W9GA 1WMHB 2KX3A 2XNAC 1UGJA 2NVUI 3BY4B 1R4MB 2QMTA 3DHHC 2DYMA 3VDZA 3M62B 2OOBB 2RGFA 4DQOC 3RUIB 4GXBA 4AOFA 4KGTA 4KSKC 1XCTL 4WJOA 2NMQA 3W1SA 2BBCA 2MW5A 2PLPA 1KOTA 1PGAA 2JRHA 1V5TA 1AN8A 1P1AA 2DZJA 3PRPB 3RYTA 1N61A 3TEZA 4DBGA 3NOBA 3DWMA 3QX1A 1EU4A 3KH0A 2Y5BB 3TJPA 4EZJA 1NYRA 3RZFA 4DDGD 2J0KA 2K1FA 3AE2B 1NI2A 2MBOA 2KDFB 5C3JB 4ZDVA 3DOWA 3Q8BA 2KQSA 1Y56A 2FIFA 1G6JA 4K81A 1E0ZA 4F8CB 3L10B 3DBHI 1E7UA 3FC4A 2PE9A 1UUPA 1E8YA 3Q8CA 2N9LA 4OZBA 2NBWB 4W9DA 2D07B 3AV8A 2BB6A 4B6WA 3GE8C 2LHEA 3ONSA 3AECB 2HD5B 3DQVA 2LUEA 4IM2A 1VR9A 3O65B 2KO3A 1XT9B 2L52A 2FE8A 1WFYA 3LB8C 3NVZA 2L76A 2WXQA 4DK5A 2WWZA 3QK0A 4FJZA 3AEAB 2MBHA 2V4IB 3ZXRA 2V3NA 2DENB 2L8JA 2M19A 4F7ZA 2JXTA 2EELA 1UF0A 4W9KA 3H6NA 1YJ1A 2K25A 3ZNGC 4C4VA 4NAMA 2QC8A 2NTSA 3UIOB 3QIJA 5L83A 2BKFA 3HVZA 3DVGY 1QOAA 3CSFA 1WGHA 2IJ0A 1FMAD 1JMLA 1E7VA 3TCAA 4GDKA 4WAAA 1ESFA 1IBXB 4CQNA 2LUMA 3SR6A 2MBQA 1TS4A 1IGDA 1UBQA 2CJNA 2PE6B 3Q2AC 3N9YC 2K0PA 1TZ1A 4DHZB 1KJTA 3WA0A 2INNE 3WAOA 1UGMA 1V1PA 2J0JA 2NCNA 5GXGB 3IAM1 2KLGA 1CK1A 1XLOA 1WMHA 2BYFA 1V80A 2KYWA 1T5XD 1YIWA 2M0XA 2RPVA 3ZVVA 2V3PA 4TQ1A 5DPRA 1SJED 1SGHA 1F0ZA 3RNFC 3UQBA 1VDVA 5HI1A 1ZKHA 1L0VB 1WYGA 5HG2A 4GGQA 3EC8A 4LLGM 5IO9A 2ZJDA 4W9EA 3TEYA 1JCKB 1WE6A 2IO2B 3AEEB 3P4RB 3T3OA 4CYEA 3HIZA 4WURA 1JWBD 1PUTA 2MP2B 4M01A 2IGDA 1JQ4A 1ENFA 1C9FA 3UI3A 2O6VB 2O2VB 2BS4B 2KN4A 3N32A 3Q14C 2GBJA 2MEKA 1OQQA 3I57A 4G11A 3B0AA 4RM8A 3NY5A 2JRIB 4CHKA 2KDIA 1J19A 4WWOA 3RD2A 4EUTA 1D5ZC 4UDUC 3U52E 3EGRA 2WXGA 2WXHA 3EA6A 1NVID 1KH0A 1I4XA 1PFDA 3B1LX 1MFWA 3LYYA 2E3TA 3NVWA 3ZNHB 2CKHB 2BS2B 2WXFA 2KWDA 2LEKA 4KKJA 3PVLA 1SE3A 2VZKD 5E6PA 3KYCD 2JT4B 2BGFA 1F2RI 5AZFA 4DWFA 3LJ3A 3ZQ4A 1P7FA 2CHZA 3MC0B 4USAA 1WH3A 2LWPA 3MC9A 2V1YA 3N1ZC 2MRPA 5JXVA 4WWMA 5IP4D 1YD8U 1QQRA 2KD0A 3Q3JA 3VXWA 4WIPA 1VZ8A 3X0WA 2ZCCA 5IA7A 3A9JB 4XZ4A 4FBJB 1B9RA 2FNJB 3VUYA 4PYUA 4ZHPA 3ZW3A 2QSDA 1P9DU 2INDC 3FAHA 3A1QA 3U4EG 4FXCA 1Q10A 1WSPA 4RMAA 4BVUC 4LDTB 1FNUA 1SB3C 3SEBA 2WP9B 4LJOB 2OJRA 2WLBA 3MC8A 4LNNA 2LXCA 4P1CC 1K50A 2D3GA 1FO4A 4I6NB 4XYCA 3UINB 1M4VA 4IW0A 1S3SG 1MG4A 1RWSA 3DBLI 3OWEB 2KTRB 3JVZX 1XF5L 2PEAA 2KACA 4XWTA 5KHQA 1E7PB 1ZGUB 2M56B 1XLNA 2D3BA 1DYQA 3VTWA 1IBXA 5D3DA 5C2TB 3H7PA 4XGAB 3Q8FA 1P0RA 3W2DA 4GU2A 2MBBB 1R4MI 4W9CA 3U30A 4A8XC 4YSXB 2HDEA 3QA8A 4NJ7A 1F52A 1WXSA 1TKGA 4QAYA 3AE7B 2MJDA 4KSLC 3RPFC 1WYWB 2L00B 2WX1A 1I7HA 1QOBA 4W9IA 3AE3B 3P63A 3PZ7A 4W9LA 2J7QB 3VVWB 1N5WA 4R3DA 2Z8LA 2KC2A 4IG7B 2N9EB 3ZYYX 2DZMA 4XDDA 4ZYNA 5J18A 4HEA1 2ZPNA 4TSSA 2ONQA 5FKAC 4MJSB 2MSED 2H88B 3AB5A 2BT6A 5BO4B 1WXMA 2LASA 2IO3B 4TUUA 1WJ4A 3ZXVA 4K7UA 3LDZE 1TBEA 2I1JA 2WS3B 3JSVA 3L0WB 3PPAA 3BYYB 4AQ7A 3RNCC 4IOIE 4KZCA 2FCSA 2LI5A 1D5MC 5FK9C 3DCGA 2AL6A 1OFFA 3VQIA 4D2KA 2PMVA 1T6BX 2Y5PA 3VUWA 5I4DA 2BW2A 1R7SA 4C7ZA 3ZIMA 3MJ5A 2Y5CA 3AE1B 2RDGA 3DHGC 3T9LA 1MJDA 4HVBA 2BKRB 1WF9A 1HQRD 3OLMD 3PGEA 1OEYJ 2DAJA 4II2B 2SEBD 3U7ZA 3AMZA 1V5OA 4MGKE 1UELA 3UF8A 3V6EB 2B76B 3BVGA 4HLEA 3B2FA 2WDRB 5T8IA 4A3OA 1D5XC 2KWUB 4DXFA 2HJ1A 4FA6A 3WALA 3RN9C 3QJZA 1Q1OA 2GBNA 2ZW1A 1SEBD 2LHDA 2W54A 3A33B 3V61A 3PRMB 2BPSA 2UWQA 4KDLB 3MHSD 4KZ0A 3V60A 3AE4B 2MQJA 4WJQA 2FCMA 4JGHB 4MELA 3PREA 4FULA 3E9SA 3A9JA 4AJYB 1LM8B 3JYUA 1HEZE 2JXXA 4M02A 3SU8X 1YQ4B 3DWGC 4BOSC 4HCNB 3ZJVA 1FRDA 2KJRA 1V97A 3AE6B 2ZW0A 3L54A 1PQSA 2WXOA 2MWSB 3L16A 4GDKB 3HRDD 1EWYC 2L32A 2MHJA 2WXNA 1CJEA 2GOWA 3DBSA 1I4RA 3H7SA 1UBIA 2J0MA 2MCNB 4PS7A 1QOFA 3ZDMC 3W5UB 3AE8B 4NAWB 1DOXA 1T0QC 2SAKA 2MA9B 3W5VB 2PTLA 3HUIA 5TSSA 1FXIA 5E6OA 1HXYD 2KXJA 4FADA 4ZRPA 1QILA 4GDLA 4GOCA 3B2GA 2X8XX 3U8ZA 2NBVB 2CHXA 4HCPB 1HTOA 1E6EB 1WGRA 2XEWA 4FJVB 4G50A 3TBLD 5TR5A 1QKZA 2D10A 3HM6X 1E9MA 4I6PA 3BVMA 1PDXA 2LXAA 4CO7A 1JROA 1J7AA 2G45B 4AJWA 3PZDA 3T3NA 2IGHA 1HTQA 4AS1A 3RI7C 4ICVA 4EOYA 5JH5C 2ZCBA 2KAJA 3VTVA 2J52A 1C4CA 5LLIA 3Q3FA 4MJSA 5FR6A 2OJWA 2BYVE 3AULA 2YEPF 4W9FA 2LRWA 5DPTA 3V6CB 1JWUD 2IO0B 1V6EA 3V05A 3B08A 1WR1A 1I4GA 2KVRA 3UGBB 2KKCA 4K3CA 5HFYA 1H4RA 3L13A 1MI0A 2KTFA 2ZEQA 4HJGE 2EMSA 4P16A 2JSVX 4IKGA 2G9HD 3NG0A 4FHJA 4RGMA 3VR9B 4BZAA 1YX6B 4OVZA 1PGBA 2M8SA 1KLUD 4HRSA 1S1QB 2CU1A 4HXDA 1I4HA 1BXTA 1K8RB 1OQRA 1Q5WB 1TGZB 5CHWA 1RFKA 3P4QB 2BYEA 4A55A 5L95C 2O6VD 1N62A 2LD9A 4DXGA 2JWUA 2KZRA 4MACA 4M0WA 2VRRB 3KLSX 3A1QB 2BYTA 4AP4C 2G4SA 1XXGA 4IDIA 1HE8A 1GOZA 4IUMB 4WJPA 2C60A 4PS8A 3V3XA 1VRAB 4MGYE 4NJCA 4E71A 5J17A 2Z0DB 3KW5B 3R2TA 3ZLZA 1B1ZA 2KNBA 1UNSA 3NZSA 1XEEA 1IP9A 1NENB 2QILA 4PK1A 4HKQA 2IYDB 3SFEB 4Q2JA 1EWCA 2PVOD 2L0FA 2GLSA 4HPPA 4FHKA 4HDOA 3BWUD 1LO5D 1MHHE 4IC7B 2D11A 2M4NA 4MM3A 2OHFA 1L6VA 3OJ3A 1K53A 2HTME 1GJZA 5KHOA 3I9V1 1TS5A 3AXCA 3IHPC 3H7PB 1CZPA 4OZCA 4P6VF 4K1RB 1BUIC 4ARCA 3DPDA 2INCC 3ALBA 4M00A 2KMCA 1U4AA 2V3SA 1FCCC 5AZGA 4NAWA 5BMGA 2UU7A 3T8MA 3Q3MC 3HHMA 1GUAB 3R8BA 1ZDXA 5D7GA 1FM0D 1I4PA 1GAQB 3E56A 4KVGB 2WDQB 1JWSD 1EUVB 4MSMB 4A3PA 5BMIA 1SSNA 3MHZA 1FRRA 3CWIA 1WM2A 2KX0A 4L23A 2LJIA 2BTEA 3MJWA 4EFOA 3N1XC 4EKUA 3PT2B 4DHJB 4JIOU 4NZLB 5GMVA 1ACCA 3AEBB 1TIFA 5LNK1 1VZ6A 4AWJA 4XDCA 3JSVB 1A70A 2AWTA 5JZEB 2GBRA 3MFGA 3PHXB 1IGCA 1J8CA 4E74A 1OGWA 1YOVB 2KT7A 4A90A 2KOXA 2AX5A 1QLBB 1ET9A 4TV3A 2YVCA 3A4RA 1OQYA 4NQLB 1SIJA 4DHZE 1XLPA 2FCQA 4N59A 3AEFB 4RGOS 4WJNA 2CR5A 4NY0A 2DZIA 3RNGC 1I42A 2K8BA 1WJNA 1ROEA 2FUHB 2LJ5A 5G55A 1WXAA 3ZTCA 1WX8A 2HJ8A 2RSUA 1L6UA 3KUZA 4HKZE 1ZOYB 1EM7A 2JY6A 4WQMA 1KRHA 1FPYA 3IVFA 2KFKA 2DZKA 1DOIA 1XO3A 3IFWB 3B9JA 2BWES 4YT0B 2WQYB 4PS3A 4K3BA 1SBBB 1JWAD 2LVPA 2G1EA 4RH6A 3WANA 2AYOB 4OZAA 3CF6E 3KWLA 2KMMA 4B0MA 1GB1A 5EDSA 4LNFA 4NQKE 1C76A 4KIKA 4YTPB 2ACZB 1L0XB 3BZDB 2TSSA 2XK5B 2JZ3B 2ZVNA 3DVNU 1Q0WB 3ZUNA 4ANWA 1N6ZA 1V8CA 1E5WA 3PSEB 2ZNVB 1JALA 3ETRA 1MHXA 4A6QA 4JWSC 2WGSA 5EE1A 3PO0A 3HK0A 4MSQB 2N9XA 4FLHA 3IT4B 1JRPA 3DBRB 4MGIE 2A4ZA 3APFA 2KQ4X 2XBBC 4ZYSA 2IY1B 2QEJC 2M0AA 4G3XB 4GMVA 1J0GA 4M8MA 1YN5A 3KWVA 4ANXA 4HDQA 4PT5A 4WQOB 1E10A 4IWQA 3HVDA 2W9NA 3TIXA 5J2RA 2W3SA 3NVYA 4L2YA 4ARIA 3U2SC 1XLQA 2PJHA 3MTNB 4GDLB 3ECIA 5H92C 4JPSA 2MJEA 3AEDB 1ZUD2 5IKCM 5LXHA 2BVCA 2VH1A 1TY2A 2DHZA 2X38A 3DHIC 2GI9A 2ZNVC 2C7MB 2K9XA 3N1YC 3TMPB 1RAXA 2LVOA 2QJLA 3UQAA 4BKSD 2NS5A 3ML8A 4MH0E 1RRBA 2NPTB 4OVUA 2I1KA 3N30A 4XC2A 5CHVC 2DWQA 1TS3A 5G5GA 4ITKA 4YL8A 3APCA 2R61A 4JQWC 2ZPYA 1WXQA 2YEPB 2C7HA 4GN1A 4ASWC 2FCNA 4RNAA 2N7EA 5AUIA 1CMXB 3K9PB 2J42A 2FBWB 4HWIB 1C78A 1C4AA 3H8HA 3VRAB 5DPWA 1WX7A 2QDFA 2QHOA 3RFZB 5IN7A 2XN9C 2VZKB 2PKOA 3O13A 2AL3A 4KGSA 4B9KA 2FIDA 3M63B 3ENEA 2JVCA 2EKIA 4RGTA 4LCDE 5DCNA 3ZTDA 2JU6X 2JYTA 1WRIA 1NI3A 1WM3A 1D4BA 3A4SC 2OEDA 3RT3B 2KANA 4B0EA 3P42A 4II3B 2R2QA 2DX5B 5H8YE 1DOYA 4RFBA 2GBKA 3MP9A 2V9HA 3VRBB 5E6NA 1AYFA 1WGKA 2JF5A 1C4PA 3W1SC 1J7CA 1DGJA 4BBNC 2G4DB 2CJOA 2WYQA 3C0RB 4O1NA 2PIAA 4M0WB 2GRIA 4B95A 2BWFA 4TMAB 5C23A 4YSZB 4RF1A 2AQ3B 1AWDA 3Q3NC 2ASQA 2J53A 2G3QB 4RGNA 4ZRIA 1QT9A 3WCQA 3ZRFA 3BYTB 3TUOA 2KWCA 2R2OA 4AUQC 1C3TA 1AARA 3PLUA 2KWVB 2LFIA 1V86A 2GBMA 2FUG1 4HK2A 1PYWD 3P2BA 4US9A 2QCZA 4DDID 2XK5A 3R3MA 1ZXHA 5BYQA 2N1WA 1EO6A 2WXPA 4MM3B 3S2AA 4LJPB 4XWWA 3URYA 3N20C 3ZO5B 5LXIB 4ZRKA 1E8XA 5EE3A 3X23A 1FXTB 1C1YB 2WXJA 4IM0A 2Z59B 2KLCA 3RNAC 2V0GA 3DDCB 4M8NA 4HPMB 1WE7A 1GC7A 5C1ZA 3VFKA 4OW0A 4GLSC 1E8ZA 4YTMB 1SIFA 4JLCA 2HTHA 3EHVA 4YWGG 3KUDB 3GS2A 1H8CA 1FCLA 2M17A 3OG5A 1IPGA 3PV1A 1KLVA 2N7DA 3L17A 4P7IA 3HM3A 3RULA 3H9DA 1FFUA 5HHDG 1VD2A 1HA5A 1F2RC 1NEKB 2ON8A 1V9JA 4JE3B 4N58A 1WJUA 4LNKA 3WIMA 2Q5WD 2WXRA 2L83A 1V81A 2DYOA 3ZJTA 1IYFA 2NR2A 3OJ4B 5IAAC 3RMKC 1YN4A 3FILA 1XD3B 1BMLC 3BVZA 4MGZE 1YJJA 2KK8A 4G0NB 4JL9A 1RFAA 1WGGA 2NPTA 2KMAA 4KDIC 2WDVB 5D3IB 2LGIA 2LRUA 1UD7A 1XCQL 3ZDTA 4BBNF 1SE9A 3NZ3A 2RD0A 1N5XA 3TEXA 1E90A 4IWPA 1TZOA 3VUXA 4ZRQA 4DXAB 4HJKA 2L0TA 3AE5B 2DYBA 2KDMA 1BT0A 5D94A 2IO1B 3BK2A 1UWMA 3I3TB 5FR3A 1E8WA 3ZKJC 3OAWA 2WHIA 3NZUA 4N9F4 1YN3A 4C56C 1VLBA 3W9CB 1YJIA 4DHJD 1GG3A 2KFKB 3Q8EA 2Z0EB 3R2IA 2W82A 3V62A 4GIVA 1YNTE 3Q69A 2D3AA 2K5PA 3WAMA 1V2YA 2WU5B 1STEA 5DPSA 1AW7A 4KIKB 1GNUA 2JX5A 2JZPA 2LMCA 3VTUA 2DNFA 2WXLA 3A9KA 4J3OD 1OTRB 1TYGB 2D2QA 2KC1A 3PZ8A 2CHWA 2JUOA 2W55A 4K7SA 1YQ3B 4US8A 1WZ0A 4BFRA 4YXDB 3DBRI 3PTFC 1C77A 3GZNB 3C19A 1VZ7A 4HPLB 1QF6A 2LGDA 4I6LB 2HE7A 4ZRJA 3CIRB 3Q8AA 1N60A 5MPOA 5BYRA 3J9CA 3RNEC 4RCOA 1D6EC 5G2NA 1QZEA 3QAQA 2DAFA 1WJ6A 2BB5A 3NVVA 1WR6E 4URKA 2AEHA 2WX0A 4BKGA 3IXSA 2H89B 1QOGA 2LVQA 2PPHA 3GE3C 2E6XA 3EFUA 4IM3A 2K3UA 1FXAA 3RZWC 4IWOA 3NS1A 1R4NB 3R7RA 4BKSA 5G5HA 4P1BC 1LGRA 2WXIA 3R7QA 1FNVA 4LDTD 4C80A 3AU4A 1K52A 1VJKA 4A20A 3RNBC 2L3ZA 3H1UA 2GMIC 2RR9A 3PS6A 1YQBA 4XE0A 1PGXA 2AQ2B 2N1VA 4WWPA 2WXMA 2ZVOA 2JQRB 3K9OB 2NTTA 2BS3B 3PHWB 1T0YA 1TT5B 2DLBA 2D3CA 2C9WB 1KLGD 1WXVA 4K7WA 1SE2A 2ZZPB 2I38A 3QQ8B 1KFYB 1M94A 3BIID 4GB9A 1X1MA 2A5UA 3VR8B 1I35A 1Y8RC 2KJHB 4W9JA 3FKYA 5EE9A 4EZLA 2V4LA 4C00A 1RYJA 1JW9D 2RDHA 3NUHB 4EEWA 4LNIA 1FIQA 1RLFA 1EF1A 4ANUA 4YTNB 1TS2A 2JYEA 1HZ6A 3TEWA 2K8CA 3AN1A 2INPE 3D32A 1FNWA 4S17A 3PRZA 1J7BA 3L4PA 1T3QA 4WAFA 3GP7A 4NPNA 4NNJB 4WH4A 3PLVA 2KDBA 2DBYA 1ZE3D 1L2NA 3DBHB 3QARA 3NS8A 2B3AA 4JX1C 4ICUA 4KV2A 2JPHA 3SHQA 2IBIB 1NBFC 4WWNA 1ZP0B 1OEYA 4MH8A 2MLBA 3AI5A 5CX3A 1TKEA 4BKTA 1WX9A 3TL5A 5E6JA 2K8HA 1KM7A 1N63A 3NJTA 1T0RC 4ZOHC 3UIPB 3KQ4A 5AEKB 5JHAA 2JWZA 2L7RA 4H2AA 2L1AA 3ZGZA 1UH6A 2KQ7A 2MX2A 3ZRCA 2RPQA 3AH7A 2AQ1B 2Y3AA 1TKYA 4MEMA 4N6EB 4YSYB 3VH4B 3Q3OC 3W1YA 1UWXA 3CMMB 1WY8A 3RCZA 2IDYA 3ZJUA 2UYZB 1EU3A 4EE2A 3ZNZB 3P4PB 3EFCA 4L1BA 3LXFA 1WGDA 2K39A 2L05A 2IPKD 1ZXIA 1F1HA 2WU2B 1L7YA 1LFDA 5AUKA 5BMHA 2MH7A 2KN5A 5CTRC 5IOIA 2GB1A 1JRUA 1D3ZA 2N9KA 2NBUA 3AU5A 4JWUC 1GB4A 3EECA 2YLMA 3KVFB 2M1MA 1P3QU 1UZXB 4BOZB 3M95A 1YMHE 1MPEA 2VH2A 3SDLC 4GSWA 3FILB 1EF5A 2J4XA 4OHJA 4TKNA 4F1SA 2IGGA 4XX5A 2MBEA 3DVNV 4OVVA 3ZNID 3DVGX 5HKHA 1T0SC 2WDTB 3APDA 2KHWB 1ZW7A 2C7NB 1ET6A 1ISNA 1ZDVA 1L4ZB 5D2MB 2CU3A 1GC6A 3Q6BA 1GPXA 2PVGC 4EZKA 1F77A 1MVKA 1NYQA 5CHFA 4S0RA 2K22A 4W9HA 1L0YB 3BINA 1HZ5A 1C79A 5AZHA 1FD6A 3IBEA 5EE0A 2I2YA 4RM9A 1WRDB 2LZ6A 3IG3A 4FJYA 3P4SB 2D5GA 4LNOA 1I4QA 2BF8B 1CQVA 4KX6B 2EMTA 2N7JA 1Z5SB 3AM9A 1SJHD 2LGSA 1VCBA 3VAWA 2PW9A 1V1OA 2MP2A 1KF6B 2KJ6A 3N3KB 1WIAA 1JWMD 2O6VA 2O2VA 2IZVB 3R66C 1WWTA
chains in the Genus database with same CATH topology
3A9JB 4E3CA 4XZ4A 1LXDA 3DPDA 4FBJB 3ALBA 3NHEB 2FNJB 2KMCA 1U4AA 3VUYA 4PYUA 2V3SA 1MG8A 2LRUA 1UD7A 3ZW3A 1P9DU 3M3JA 5AZGA 3QC8B 3A1QA 4NAWA 5D6JB 3CSTA 3T8MA 4NJ6A 3ZDTA 3HHMA 1GUAB 4RMAA 5D7GA 4BBNF 2K6DB 3A9KB 1LQBA 1SE9A 2IY0B 4BVUC 2RD0A 4KVGB 4LDTB 4LJOB 1E90A 2OJRA 1WZ3A 4IWPA 1EUVB 4MSMB 3VUXA 2LXCA 4DXAB 4HJKA 1YX5B 4A3PA 2FAZA 2N9PC 4PYZA 2L0TA 2DYBA 1BT0A 2D3GA 4TQ0A 1WM2A 3WAPA 5D94A 2KX0A 1F9JA 2IO1B 3GOEA 4I6NB 3UINB 4IW0A 1S3SG 3I3TB 1E8WA 3ZKJC 3OAWA 3DBLI 2JZZA 3MJWA 3QCAA 4EFOA 2KTRB 2LGXA 3JVZX 2PEAA 4EKUA 3NZUA 4N9F4 1A5RA 3PT2B 4DHJB 2REXA 4JIOU 5KHQA 3GZNI 5GMVA 1ZGUB 4DHJD 2KDEB 1GG3A 1TTNA 2KFKB 3KYDD 2Z0EB 4J6IA 3VTWA 3V62A 1P98A 3H7PA 4GIVA 2N4FA 2KFJA 2EKEC 1WGYA 3SD5A 4AWJA 3JSVB 3WAMA 4ANVA 1V2YA 1P0RA 2AWTA 3VH3B 4GU2A 2MBBB 1R4MI 4W9CA 3U30A 5JZEB 2GBRA 5DPSA 3QA8A 3PHXB 1NDDA 4NJ7A 4KIKB 1GNUA 2C5LC 4X57B 2CS4A 3L08A 1J8CA 4MDKE 1WXSA 3ML9A 4E74A 1OGWA 1WI0A 3VTUA 3A9KA 1OTRB 4KSLC 2KOXA 4TV3A 2LGYA 2D2QA 2YVCA 2KC1A 1WYWB 3A4RA 2L00B 2WX1A 2CHWA 1OQYA 4NQLB 2JUOA 4W9IA 1XQQA 3QWZB 1R4NI 4W9LA 4DHZE 4K7SA 2FCQA 2J7QB 3VVWB 4WJNA 2CR5A 4NY0A 2KC2A 3U7DA 2DZIA 1I42A 1WZ0A 2K8BA 3QHTA 1WJNA 3VHTC 4IG7B 2N9EB 4BFRA 2DZMA 2FUHB 2LJ5A 1V49A 4ZYNA 5G55A 5J18A 1WXAA 3DBRI 2KTRA 3PTFC 4FN2A 2ZPNA 3ZTCA 1WX8A 2HJ8A 2RSUA 3KUZA 5JHBA 1Z2MA 4HPLB 4MJSB 2JY6A 2LGDA 2MSED 3JW0X 4I6LB 3IVFA 2HE7A 2KFKA 2DZKA 4ZRJA 2K6QA 5BO4B 3KUCB 1WXMA 2LASA 3IFWB 2IO3B 4TUUA 2BWES 4PS3A 4W9GA 1WMHB 1WJ4A 4K7UA 2KX3A 3LDZE 2NVUI 1TBEA 2I1JA 2LVPA 3BY4B 3JSVA 3L0WB 3WANA 2AYOB 3CF6E 5G2NA 1QZEA 3PPAA 3QAQA 2DYMA 2DAFA 3VDZA 3M62B 1WJ6A 2OOBB 2RGFA 5EDSA 4NQKE 1WR6E 4KIKA 4KZCA 4URKA 2AEHA 2FCSA 2LI5A 2WX0A 3RUIB 4GXBA 4AOFA 4BKGA 4KSKC 3DCGA 4WJOA 2LVQA 2XK5B 2JZ3B 2PPHA 2ZVNA 3W1SA 2AL6A 3EFUA 4IM3A 3VQIA 3DVNU 1Q0WB 2MW5A 3RZWC 1KOTA 4IWOA 3ZUNA 3VUWA 2JRHA 1V5TA 3R7RA 1P1AA 3ZIMA 4BKSA 4ANWA 1E5WA 3PSEB 2DZJA 2ZNVB 3PRPB 3T9LA 3RYTA 3R7QA 4HVBA 4LDTD 2BKRB 1WF9A 3AU4A 3HK0A 4MSQB 4DBGA 3NOBA 3QX1A 4A20A 2N9XA 2L3ZA 4FLHA 3H1UA 3KH0A 4MGIE 2Y5BB 3TJPA 2A4ZA 3APFA 4EZJA 2XBBC 3OLMD 2GMIC 3PGEA 1OEYJ 2DAJA 2RR9A 4II2B 2IY1B 3PS6A 1YQBA 3RZFA 1V5OA 4MGKE 1UELA 3UF8A 4DDGD 4G3XB 2N1VA 2J0KA 3V6EB 2K1FA 4WWPA 4GMVA 4HLEA 1NI2A 2MBOA 2KDFB 4A3OA 4FA6A 1J0GA 2KWUB 4M8MA 4ZDVA 3WALA 3DOWA 3QJZA 2KQSA 2ZVOA 3K9OB 4ANXA 4HDQA 1Q1OA 2FIFA 1G6JA 4WQOB 2GBNA 3PHWB 4IWQA 1T0YA 4K81A 3A33B 3V61A 2W9NA 4F8CB 3L10B 3PRMB 2BPSA 2C9WB 1WXVA 2UWQA 4K7WA 3TIXA 5J2RA 2ZZPB 3DBHI 4KDLB 1E7UA 3MHSD 4KZ0A 3QQ8B 3V60A 2MQJA 4WJQA 2PE9A 2PJHA 1M94A 2FCMA 3MTNB 4JGHB 4GB9A 1E8YA 4MELA 3PREA 4GDLB 4FULA 4AJYB 3A9JA 1LM8B 1X1MA 3JYUA 2A5UA 2JXXA 2NBWB 4W9DA 1I35A 1Y8RC 2D07B 3ECIA 3SU8X 2KJHB 4W9JA 4BOSC 4HCNB 5LXHA 2KJRA 2DHZA 4EZLA 2V4LA 3L54A 1PQSA 2ZNVC 2MWSB 3L16A 4B6WA 2C7MB 4GDKB 4EEWA 3TMPB 1RAXA 3ONSA 2HD5B 3DQVA 2LVOA 2LUEA 1RLFA 3UQAA 1EF1A 4IM2A 4BKSD 4ANUA 2NS5A 3ML8A 4MH0E 1RRBA 2GOWA 2NPTB 3DBSA 4OVUA 2I1KA 3O65B 2K8CA 3N30A 4XC2A 3H7SA 5CHVC 3D32A 2KO3A 1UBIA 2J0MA 2MCNB 1XT9B 4PS7A 3ZDMC 1WFYA 4YL8A 3APCA 3PRZA 4NAWB 4JQWC 4NPNA 2L76A 2ZPYA 4NNJB 2WWZA 4DK5A 3QK0A 2C7HA 4GN1A 4ASWC 4FJZA 2MA9B 3PLVA 2MBHA 2FCNA 2KDBA 1L2NA 2DENB 5E6OA 2L8JA 3QARA 4F7ZA 2KXJA 3NS8A 2N7EA 1CMXB 2B3AA 3K9PB 4ICUA 4HWIB 4W9KA 3H6NA 5DPWA 1YJ1A 1WX7A 2QHOA 4KV2A 4FADA 2K25A 2JPHA 3SHQA 4GDLA 3ZNGC 4GOCA 2IBIB 2AL3A 4B9KA 2FIDA 1NBFC 3UIOB 3QIJA 3M63B 4WWNA 3U8ZA 3ENEA 2NBVB 5L83A 2JVCA 1OEYA 2CHXA 4LCDE 4HCPB 2BKFA 2MLBA 3DVGY 3AI5A 5DCNA 1WGRA 5CX3A 2XEWA 3ZTDA 4BKTA 3CSFA 1WGHA 4FJVB 4G50A 1WX9A 3TL5A 1WM3A 3A4SC 1E7VA 3TBLD 3TCAA 2K8HA 3RT3B 4GDKA 5TR5A 2KANA 1KM7A 4WAAA 2D10A 3HM6X 4I6PA 3UIPB 5AEKB 2LXAA 5JHAA 4CO7A 4II3B 2JWZA 2MBQA 2G45B 2R2QA 1UBQA 2L7RA 4AJWA 2DX5B 3PZDA 1UH6A 2PE6B 2GBKA 2KQ7A 2MX2A 1TZ1A 5E6NA 4DHZB 2JF5A 4ICVA 3W1SC 3ZRCA 1KJTA 3WA0A 2RPQA 4EOYA 5JH5C 2ZCBA 4BBNC 3VTVA 2G4DB 4MEMA 3WAOA 1UGMA 3VH4B 2WYQA 2J0JA 3C0RB 3W1YA 5LLIA 3Q3FA 4M0WB 2NCNA 3CMMB 4MJSA 5FR6A 2BYVE 2KLGA 3AULA 4B95A 4W9FA 2BWFA 2LRWA 5DPTA 1WY8A 3RCZA 5C23A 2UYZB 3V6CB 2IO0B 1V6EA 1WMHA 2BYFA 1V80A 3ZNZB 2ASQA 1WGDA 2K39A 1YIWA 2G3QB 2L05A 2M0XA 3B08A 1WR1A 4ZRIA 3ZRFA 3ZVVA 4TQ1A 5DPRA 2KWCA 2KVRA 2R2OA 2KKCA 1L7YA 3UGBB 1AARA 4AUQC 1SGHA 2KWVB 3PLUA 1C3TA 1H4RA 1V86A 3L13A 2GBMA 3UQBA 1LFDA 2KTFA 2ZEQA 2EMSA 4HK2A 2KN5A 1ZKHA 3P2BA 4FHJA 5CTRC 1YX6B 4DDID 2XK5A 3R3MA 1JRUA 4GGQA 2NBUA 1D3ZA 3AU5A 3EC8A 2N1WA 2M8SA 2ZJDA 1EO6A 4W9EA 3EECA 3S2AA 4LJPB 1S1QB 2YLMA 3KVFB 2CU1A 1WE6A 2IO2B 2M1MA 4HXDA 1P3QU 1UZXB 4BOZB 3HIZA 4CYEA 3M95A 3ZO5B 5LXIB 4ZRKA 1K8RB 1E8XA 1Q5WB 3SDLC 1TGZB 3X23A 5CHWA 1EF5A 2MP2B 1FXTB 1C1YB 2Z59B 4G11A 4GSWA 2KLCA 4IM0A 2BYEA 4TKNA 4F1SA 4XX5A 2O6VB 2MBEA 2O2VB 3DDCB 3DVNV 4HPMB 4M8NA 4OVVA 3N32A 1WE7A 5L95C 2O6VD 1GC7A 5C1ZA 2GBJA 3DVGX 3ZNID 5HKHA 2LD9A 2WDTB 3VFKA 3APDA 2KHWB 1E8ZA 1ZW7A 2KZRA 3B0AA 1SIFA 2C7NB 3NY5A 2HTHA 2JRIB 4JLCA 4RM8A 2VRRB 4CHKA 1ISNA 2KDIA 3EHVA 1J19A 5D2MB 3KUDB 1GC6A 3A1QB 4WWOA 3RD2A 1H8CA 4AP4C 2G4SA 2M17A 4EUTA 1IPGA 3PV1A 1KLVA 2N7DA 1HE8A 3L17A 4P7IA 4IUMB 4WJPA 2C60A 4PS8A 3B1LX 3HM3A 3H9DA 3RULA 4EZKA 4MGYE 4E71A 5J17A 3ZNHB 2Z0DB 3KW5B 5CHFA 1VD2A 3ZLZA 2KNBA 4W9HA 2CKHB 3NZSA 1IP9A 3BINA 1V9JA 3PVLA 5AZHA 3IBEA 4RM9A 2IYDB 5E6PA 1WRDB 2L0FA 2LZ6A 1WJUA 3IG3A 2JT4B 3KYCD 4FHKA 4FJYA 4HDOA 3WIMA 2BGFA 4IC7B 5AZFA 2BF8B 2D11A 2M4NA 4MM3A 2EMTA 4DWFA 3OJ3A 1V81A 3LJ3A 1Z5SB 2DYOA 2CHZA 1IYFA 2NR2A 1GJZA 1WH3A 5KHOA 2LWPA 1VCBA 2V1YA 3OJ4B 5IAAC 3VAWA 2MRPA 3AXCA 2MP2A 1XD3B 2KJ6A 3H7PB 3IHPC 3N3KB 1WIAA 1YD8U 2KD0A 2O6VA 2O2VA 3Q3JA 4MGZE 3VXWA 2IZVB 2KK8A 4G0NB 4JL9A 1RFAA 1WGGA 3R66C 2NPTA 3X0WA 2KMAA 4KDIC 2ZCCA 4K1RB 5IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9J B;  4E3C A;  4XZ4 A;  1LXD A;  3DPD A;  4FBJ B;  3ALB A;  3NHE B;  2FNJ B;  2KMC A;  1U4A A;  3VUY A;  4PYU A;  2V3S A;  1MG8 A;  2LRU A;  1UD7 A;  3ZW3 A;  1P9D U;  3M3J A;  5AZG A;  3QC8 B;  3A1Q A;  4NAW A;  5D6J B;  3CST A;  3T8M A;  4NJ6 A;  3ZDT A;  3HHM A;  1GUA B;  4RMA A;  5D7G A;  4BBN F;  2K6D B;  3A9K B;  1LQB A;  1SE9 A;  2IY0 B;  4BVU C;  2RD0 A;  4KVG B;  4LDT B;  4LJO B;  1E90 A;  2OJR A;  1WZ3 A;  4IWP A;  1EUV B;  4MSM B;  3VUX A;  2LXC A;  4DXA B;  4HJK A;  1YX5 B;  4A3P A;  2FAZ A;  2N9P C;  4PYZ A;  2L0T A;  2DYB A;  1BT0 A;  2D3G A;  4TQ0 A;  1WM2 A;  3WAP A;  5D94 A;  2KX0 A;  1F9J A;  2IO1 B;  3GOE A;  4I6N B;  3UIN B;  4IW0 A;  1S3S G;  3I3T B;  1E8W A;  3ZKJ C;  3OAW A;  3DBL I;  2JZZ A;  3MJW A;  3QCA A;  4EFO A;  2KTR B;  2LGX A;  3JVZ X;  2PEA A;  4EKU A;  3NZU A;  4N9F 4;  1A5R A;  3PT2 B;  4DHJ B;  2REX A;  4JIO U;  5KHQ A;  3GZN I;  5GMV A;  1ZGU B;  4DHJ D;  2KDE B;  1GG3 A;  1TTN A;  2KFK B;  3KYD D;  2Z0E B;  4J6I A;  3VTW A;  3V62 A;  1P98 A;  3H7P A;  4GIV A;  2N4F A;  2KFJ A;  2EKE C;  1WGY A;  3SD5 A;  4AWJ A;  3JSV B;  3WAM A;  4ANV A;  1V2Y A;  1P0R A;  2AWT A;  3VH3 B;  4GU2 A;  2MBB B;  1R4M I;  4W9C A;  3U30 A;  5JZE B;  2GBR A;  5DPS A;  3QA8 A;  3PHX B;  1NDD A;  4NJ7 A;  4KIK B;  1GNU A;  2C5L C;  4X57 B;  2CS4 A;  3L08 A;  1J8C A;  4MDK E;  1WXS A;  3ML9 A;  4E74 A;  1OGW A;  1WI0 A;  3VTU A;  3A9K A;  1OTR B;  4KSL C;  2KOX A;  4TV3 A;  2LGY A;  2D2Q A;  2YVC A;  2KC1 A;  1WYW B;  3A4R A;  2L00 B;  2WX1 A;  2CHW A;  1OQY A;  4NQL B;  2JUO A;  4W9I A;  1XQQ A;  3QWZ B;  1R4N I;  4W9L A;  4DHZ E;  4K7S A;  2FCQ A;  2J7Q B;  3VVW B;  4WJN A;  2CR5 A;  4NY0 A;  2KC2 A;  3U7D A;  2DZI A;  1I42 A;  1WZ0 A;  2K8B A;  3QHT A;  1WJN A;  3VHT C;  4IG7 B;  2N9E B;  4BFR A;  2DZM A;  2FUH B;  2LJ5 A;  1V49 A;  4ZYN A;  5G55 A;  5J18 A;  1WXA A;  3DBR I;  2KTR A;  3PTF C;  4FN2 A;  2ZPN A;  3ZTC A;  1WX8 A;  2HJ8 A;  2RSU A;  3KUZ A;  5JHB A;  1Z2M A;  4HPL B;  4MJS B;  2JY6 A;  2LGD A;  2MSE D;  3JW0 X;  4I6L B;  3IVF A;  2HE7 A;  2KFK A;  2DZK A;  4ZRJ A;  2K6Q A;  5BO4 B;  3KUC B;  1WXM A;  2LAS A;  3IFW B;  2IO3 B;  4TUU A;  2BWE S;  4PS3 A;  4W9G A;  1WMH B;  1WJ4 A;  4K7U A;  2KX3 A;  3LDZ E;  2NVU I;  1TBE A;  2I1J A;  2LVP A;  3BY4 B;  3JSV A;  3L0W B;  3WAN A;  2AYO B;  3CF6 E;  5G2N A;  1QZE A;  3PPA A;  3QAQ A;  2DYM A;  2DAF A;  3VDZ A;  3M62 B;  1WJ6 A;  2OOB B;  2RGF A;  5EDS A;  4NQK E;  1WR6 E;  4KIK A;  4KZC A;  4URK A;  2AEH A;  2FCS A;  2LI5 A;  2WX0 A;  3RUI B;  4GXB A;  4AOF A;  4BKG A;  4KSK C;  3DCG A;  4WJO A;  2LVQ A;  2XK5 B;  2JZ3 B;  2PPH A;  2ZVN A;  3W1S A;  2AL6 A;  3EFU A;  4IM3 A;  3VQI A;  3DVN U;  1Q0W B;  2MW5 A;  3RZW C;  1KOT A;  4IWO A;  3ZUN A;  3VUW A;  2JRH A;  1V5T A;  3R7R A;  1P1A A;  3ZIM A;  4BKS A;  4ANW A;  1E5W A;  3PSE B;  2DZJ A;  2ZNV B;  3PRP B;  3T9L A;  3RYT A;  3R7Q A;  4HVB A;  4LDT D;  2BKR B;  1WF9 A;  3AU4 A;  3HK0 A;  4MSQ B;  4DBG A;  3NOB A;  3QX1 A;  4A20 A;  2N9X A;  2L3Z A;  4FLH A;  3H1U A;  3KH0 A;  4MGI E;  2Y5B B;  3TJP A;  2A4Z A;  3APF A;  4EZJ A;  2XBB C;  3OLM D;  2GMI C;  3PGE A;  1OEY J;  2DAJ A;  2RR9 A;  4II2 B;  2IY1 B;  3PS6 A;  1YQB A;  3RZF A;  1V5O A;  4MGK E;  1UEL A;  3UF8 A;  4DDG D;  4G3X B;  2N1V A;  2J0K A;  3V6E B;  2K1F A;  4WWP A;  4GMV A;  4HLE A;  1NI2 A;  2MBO A;  2KDF B;  4A3O A;  4FA6 A;  1J0G A;  2KWU B;  4M8M A;  4ZDV A;  3WAL A;  3DOW A;  3QJZ A;  2KQS A;  2ZVO A;  3K9O B;  4ANX A;  4HDQ A;  1Q1O A;  2FIF A;  1G6J A;  4WQO B;  2GBN A;  3PHW B;  4IWQ A;  1T0Y A;  4K81 A;  3A33 B;  3V61 A;  2W9N A;  4F8C B;  3L10 B;  3PRM B;  2BPS A;  2C9W B;  1WXV A;  2UWQ A;  4K7W A;  3TIX A;  5J2R A;  2ZZP B;  3DBH I;  4KDL B;  1E7U A;  3MHS D;  4KZ0 A;  3QQ8 B;  3V60 A;  2MQJ A;  4WJQ A;  2PE9 A;  2PJH A;  1M94 A;  2FCM A;  3MTN B;  4JGH B;  4GB9 A;  1E8Y A;  4MEL A;  3PRE A;  4GDL B;  4FUL A;  4AJY B;  3A9J A;  1LM8 B;  1X1M A;  3JYU A;  2A5U A;  2JXX A;  2NBW B;  4W9D A;  1I35 A;  1Y8R C;  2D07 B;  3ECI A;  3SU8 X;  2KJH B;  4W9J A;  4BOS C;  4HCN B;  5LXH A;  2KJR A;  2DHZ A;  4EZL A;  2V4L A;  3L54 A;  1PQS A;  2ZNV C;  2MWS B;  3L16 A;  4B6W A;  2C7M B;  4GDK B;  4EEW A;  3TMP B;  1RAX A;  3ONS A;  2HD5 B;  3DQV A;  2LVO A;  2LUE A;  1RLF A;  3UQA A;  1EF1 A;  4IM2 A;  4BKS D;  4ANU A;  2NS5 A;  3ML8 A;  4MH0 E;  1RRB A;  2GOW A;  2NPT B;  3DBS A;  4OVU A;  2I1K A;  3O65 B;  2K8C A;  3N30 A;  4XC2 A;  3H7S A;  5CHV C;  3D32 A;  2KO3 A;  1UBI A;  2J0M A;  2MCN B;  1XT9 B;  4PS7 A;  3ZDM C;  1WFY A;  4YL8 A;  3APC A;  3PRZ A;  4NAW B;  4JQW C;  4NPN A;  2L76 A;  2ZPY A;  4NNJ B;  2WWZ A;  4DK5 A;  3QK0 A;  2C7H A;  4GN1 A;  4ASW C;  4FJZ A;  2MA9 B;  3PLV A;  2MBH A;  2FCN A;  2KDB A;  1L2N A;  2DEN B;  5E6O A;  2L8J A;  3QAR A;  4F7Z A;  2KXJ A;  3NS8 A;  2N7E A;  1CMX B;  2B3A A;  3K9P B;  4ICU A;  4HWI B;  4W9K A;  3H6N A;  5DPW A;  1YJ1 A;  1WX7 A;  2QHO A;  4KV2 A;  4FAD A;  2K25 A;  2JPH A;  3SHQ A;  4GDL A;  3ZNG C;  4GOC A;  2IBI B;  2AL3 A;  4B9K A;  2FID A;  1NBF C;  3UIO B;  3QIJ A;  3M63 B;  4WWN A;  3U8Z A;  3ENE A;  2NBV B;  5L83 A;  2JVC A;  1OEY A;  2CHX A;  4LCD E;  4HCP B;  2BKF A;  2MLB A;  3DVG Y;  3AI5 A;  5DCN A;  1WGR A;  5CX3 A;  2XEW A;  3ZTD A;  4BKT A;  3CSF A;  1WGH A;  4FJV B;  4G50 A;  1WX9 A;  3TL5 A;  1WM3 A;  3A4S C;  1E7V A;  3TBL D;  3TCA A;  2K8H A;  3RT3 B;  4GDK A;  5TR5 A;  2KAN A;  1KM7 A;  4WAA A;  2D10 A;  3HM6 X;  4I6P A;  3UIP B;  5AEK B;  2LXA A;  5JHA A;  4CO7 A;  4II3 B;  2JWZ A;  2MBQ A;  2G45 B;  2R2Q A;  1UBQ A;  2L7R A;  4AJW A;  2DX5 B;  3PZD A;  1UH6 A;  2PE6 B;  2GBK A;  2KQ7 A;  2MX2 A;  1TZ1 A;  5E6N A;  4DHZ B;  2JF5 A;  4ICV A;  3W1S C;  3ZRC A;  1KJT A;  3WA0 A;  2RPQ A;  4EOY A;  5JH5 C;  2ZCB A;  4BBN C;  3VTV A;  2G4D B;  4MEM A;  3WAO A;  1UGM A;  3VH4 B;  2WYQ A;  2J0J A;  3C0R B;  3W1Y A;  5LLI A;  3Q3F A;  4M0W B;  2NCN A;  3CMM B;  4MJS A;  5FR6 A;  2BYV E;  2KLG A;  3AUL A;  4B95 A;  4W9F A;  2BWF A;  2LRW A;  5DPT A;  1WY8 A;  3RCZ A;  5C23 A;  2UYZ B;  3V6C B;  2IO0 B;  1V6E A;  1WMH A;  2BYF A;  1V80 A;  3ZNZ B;  2ASQ A;  1WGD A;  2K39 A;  1YIW A;  2G3Q B;  2L05 A;  2M0X A;  3B08 A;  1WR1 A;  4ZRI A;  3ZRF A;  3ZVV A;  4TQ1 A;  5DPR A;  2KWC A;  2KVR A;  2R2O A;  2KKC A;  1L7Y A;  3UGB B;  1AAR A;  4AUQ C;  1SGH A;  2KWV B;  3PLU A;  1C3T A;  1H4R A;  1V86 A;  3L13 A;  2GBM A;  3UQB A;  1LFD A;  2KTF A;  2ZEQ A;  2EMS A;  4HK2 A;  2KN5 A;  1ZKH A;  3P2B A;  4FHJ A;  5CTR C;  1YX6 B;  4DDI D;  2XK5 A;  3R3M A;  1JRU A;  4GGQ A;  2NBU A;  1D3Z A;  3AU5 A;  3EC8 A;  2N1W A;  2M8S A;  2ZJD A;  1EO6 A;  4W9E A;  3EEC A;  3S2A A;  4LJP B;  1S1Q B;  2YLM A;  3KVF B;  2CU1 A;  1WE6 A;  2IO2 B;  2M1M A;  4HXD A;  1P3Q U;  1UZX B;  4BOZ B;  3HIZ A;  4CYE A;  3M95 A;  3ZO5 B;  5LXI B;  4ZRK A;  1K8R B;  1E8X A;  1Q5W B;  3SDL C;  1TGZ B;  3X23 A;  5CHW A;  1EF5 A;  2MP2 B;  1FXT B;  1C1Y B;  2Z59 B;  4G11 A;  4GSW A;  2KLC A;  4IM0 A;  2BYE A;  4TKN A;  4F1S A;  4XX5 A;  2O6V B;  2MBE A;  2O2V B;  3DDC B;  3DVN V;  4HPM B;  4M8N A;  4OVV A;  3N32 A;  1WE7 A;  5L95 C;  2O6V D;  1GC7 A;  5C1Z A;  2GBJ A;  3DVG X;  3ZNI D;  5HKH A;  2LD9 A;  2WDT B;  3VFK A;  3APD A;  2KHW B;  1E8Z A;  1ZW7 A;  2KZR A;  3B0A A;  1SIF A;  2C7N B;  3NY5 A;  2HTH A;  2JRI B;  4JLC A;  4RM8 A;  2VRR B;  4CHK A;  1ISN A;  2KDI A;  3EHV A;  1J19 A;  5D2M B;  3KUD B;  1GC6 A;  3A1Q B;  4WWO A;  3RD2 A;  1H8C A;  4AP4 C;  2G4S A;  2M17 A;  4EUT A;  1IPG A;  3PV1 A;  1KLV A;  2N7D A;  1HE8 A;  3L17 A;  4P7I A;  4IUM B;  4WJP A;  2C60 A;  4PS8 A;  3B1L X;  3HM3 A;  3H9D A;  3RUL A;  4EZK A;  4MGY E;  4E71 A;  5J17 A;  3ZNH B;  2Z0D B;  3KW5 B;  5CHF A;  1VD2 A;  3ZLZ A;  2KNB A;  4W9H A;  2CKH B;  3NZS A;  1IP9 A;  3BIN A;  1V9J A;  3PVL A;  5AZH A;  3IBE A;  4RM9 A;  2IYD B;  5E6P A;  1WRD B;  2L0F A;  2LZ6 A;  1WJU A;  3IG3 A;  2JT4 B;  3KYC D;  4FHK A;  4FJY A;  4HDO A;  3WIM A;  2BGF A;  4IC7 B;  5AZF A;  2BF8 B;  2D11 A;  2M4N A;  4MM3 A;  2EMT A;  4DWF A;  3OJ3 A;  1V81 A;  3LJ3 A;  1Z5S B;  2DYO A;  2CHZ A;  1IYF A;  2NR2 A;  1GJZ A;  1WH3 A;  5KHO A;  2LWP A;  1VCB A;  2V1Y A;  3OJ4 B;  5IAA C;  3VAW A;  2MRP A;  3AXC A;  2MP2 A;  1XD3 B;  2KJ6 A;  3H7P B;  3IHP C;  3N3K B;  1WIA A;  1YD8 U;  2KD0 A;  2O6V A;  2O2V A;  3Q3J A;  4MGZ E;  3VXW A;  2IZV B;  2KK8 A;  4G0N B;  4JL9 A;  1RFA A;  1WGG A;  3R66 C;  2NPT A;  3X0W A;  2KMA A;  4KDI C;  2ZCC A;  4K1R B;  5IA7 A; 
#chains in the Genus database with same CATH topology
 4E3C A;  1L5P A;  1LXD A;  2ICI A;  3NHE B;  3SFD B;  4ACF A;  1MG8 A;  3M3J A;  3QC8 B;  5D6J B;  3CST A;  3C8Y A;  4MT5 A;  4NJ6 A;  2MJ3 A;  2WNM A;  1ZPS A;  2K6D B;  3A9K B;  1LQB A;  2IY0 B;  1IUE A;  3GB1 A;  1WZ3 A;  2BQQ A;  1YX5 B;  1FEH A;  1K51 A;  2FAZ A;  2N9P C;  3BK1 A;  4PYZ A;  3I5J C;  4TQ0 A;  3WAP A;  1F9J A;  5BYS A;  3GOE A;  2RDB C;  2JZZ A;  3QCA A;  1KTK A;  2LGX A;  1A5R A;  4LTU A;  2REX A;  3GZN I;  2KDE B;  1TTN A;  3KYD D;  3NRZ A;  4J6I A;  3AE9 B;  1P98 A;  1TJE A;  2N4F A;  2KFJ A;  1TY0 A;  2EKE C;  1WGY A;  3SD5 A;  2QIE B;  3TSS A;  4ANV A;  3ABV B;  4C4V B;  4A9A A;  3VH3 B;  4BAX A;  3P1M A;  1SE4 A;  1NDD A;  2C5L C;  4X57 B;  2CS4 A;  3L08 A;  4MDK E;  3ML9 A;  1WI0 A;  2KVZ A;  3IT6 B;  4HRO A;  4KKI A;  4REZ A;  4C7Y A;  1FFV A;  2RMM A;  1L4D B;  2LGY A;  3I63 C;  1P7E A;  4LK0 M;  2N0S B;  1XQQ A;  3QWZ B;  2WXK A;  1R4N I;  1RM6 C;  3U7D A;  3VHT C;  3QHT A;  3DBL B;  1SF0 A;  1V49 A;  3EUB 2;  4ZHO A;  2KTR A;  2W3R A;  4FN2 A;  4RF0 A;  4KGR A;  1V1P B;  5JHB A;  1SXT A;  1Z2M A;  3JW0 X;  2K6Q A;  3KUC B;  3IAS 1;  3AEG B;  4W9G A;  1WMH B;  2KX3 A;  2XNA C;  1UGJ A;  2NVU I;  3BY4 B;  1R4M B;  2QMT A;  3DHH C;  2DYM A;  3VDZ A;  3M62 B;  2OOB B;  2RGF A;  4DQO C;  3RUI B;  4GXB A;  4AOF A;  4KGT A;  4KSK C;  1XCT L;  4WJO A;  2NMQ A;  3W1S A;  2BBC A;  2MW5 A;  2PLP A;  1KOT A;  1PGA A;  2JRH A;  1V5T A;  1AN8 A;  1P1A A;  2DZJ A;  3PRP B;  3RYT A;  1N61 A;  3TEZ A;  4DBG A;  3NOB A;  3DWM A;  3QX1 A;  1EU4 A;  3KH0 A;  2Y5B B;  3TJP A;  4EZJ A;  1NYR A;  3RZF A;  4DDG D;  2J0K A;  2K1F A;  3AE2 B;  1NI2 A;  2MBO A;  2KDF B;  5C3J B;  4ZDV A;  3DOW A;  3Q8B A;  2KQS A;  1Y56 A;  2FIF A;  1G6J A;  4K81 A;  1E0Z A;  4F8C B;  3L10 B;  3DBH I;  1E7U A;  3FC4 A;  2PE9 A;  1UUP A;  1E8Y A;  3Q8C A;  2N9L A;  4OZB A;  2NBW B;  4W9D A;  2D07 B;  3AV8 A;  2BB6 A;  4B6W A;  3GE8 C;  2LHE A;  3ONS A;  3AEC B;  2HD5 B;  3DQV A;  2LUE A;  4IM2 A;  1VR9 A;  3O65 B;  2KO3 A;  1XT9 B;  2L52 A;  2FE8 A;  1WFY A;  3LB8 C;  3NVZ A;  2L76 A;  2WXQ A;  4DK5 A;  2WWZ A;  3QK0 A;  4FJZ A;  3AEA B;  2MBH A;  2V4I B;  3ZXR A;  2V3N A;  2DEN B;  2L8J A;  2M19 A;  4F7Z A;  2JXT A;  2EEL A;  1UF0 A;  4W9K A;  3H6N A;  1YJ1 A;  2K25 A;  3ZNG C;  4C4V A;  4NAM A;  2QC8 A;  2NTS A;  3UIO B;  3QIJ A;  5L83 A;  2BKF A;  3HVZ A;  3DVG Y;  1QOA A;  3CSF A;  1WGH A;  2IJ0 A;  1FMA D;  1JML A;  1E7V A;  3TCA A;  4GDK A;  4WAA A;  1ESF A;  1IBX B;  4CQN A;  2LUM A;  3SR6 A;  2MBQ A;  1TS4 A;  1IGD A;  1UBQ A;  2CJN A;  2PE6 B;  3Q2A C;  3N9Y C;  2K0P A;  1TZ1 A;  4DHZ B;  1KJT A;  3WA0 A;  2INN E;  3WAO A;  1UGM A;  1V1P A;  2J0J A;  2NCN A;  5GXG B;  3IAM 1;  2KLG A;  1CK1 A;  1XLO A;  1WMH A;  2BYF A;  1V80 A;  2KYW A;  1T5X D;  1YIW A;  2M0X A;  2RPV A;  3ZVV A;  2V3P A;  4TQ1 A;  5DPR A;  1SJE D;  1SGH A;  1F0Z A;  3RNF C;  3UQB A;  1VDV A;  5HI1 A;  1ZKH A;  1L0V B;  1WYG A;  5HG2 A;  4GGQ A;  3EC8 A;  4LLG M;  5IO9 A;  2ZJD A;  4W9E A;  3TEY A;  1JCK B;  1WE6 A;  2IO2 B;  3AEE B;  3P4R B;  3T3O A;  4CYE A;  3HIZ A;  4WUR A;  1JWB D;  1PUT A;  2MP2 B;  4M01 A;  2IGD A;  1JQ4 A;  1ENF A;  1C9F A;  3UI3 A;  2O6V B;  2O2V B;  2BS4 B;  2KN4 A;  3N32 A;  3Q14 C;  2GBJ A;  2MEK A;  1OQQ A;  3I57 A;  4G11 A;  3B0A A;  4RM8 A;  3NY5 A;  2JRI B;  4CHK A;  2KDI A;  1J19 A;  4WWO A;  3RD2 A;  4EUT A;  1D5Z C;  4UDU C;  3U52 E;  3EGR A;  2WXG A;  2WXH A;  3EA6 A;  1NVI D;  1KH0 A;  1I4X A;  1PFD A;  3B1L X;  1MFW A;  3LYY A;  2E3T A;  3NVW A;  3ZNH B;  2CKH B;  2BS2 B;  2WXF A;  2KWD A;  2LEK A;  4KKJ A;  3PVL A;  1SE3 A;  2VZK D;  5E6P A;  3KYC D;  2JT4 B;  2BGF A;  1F2R I;  5AZF A;  4DWF A;  3LJ3 A;  3ZQ4 A;  1P7F A;  2CHZ A;  3MC0 B;  4USA A;  1WH3 A;  2LWP A;  3MC9 A;  2V1Y A;  3N1Z C;  2MRP A;  5JXV A;  4WWM A;  5IP4 D;  1YD8 U;  1QQR A;  2KD0 A;  3Q3J A;  3VXW A;  4WIP A;  1VZ8 A;  3X0W A;  2ZCC A;  5IA7 A;  3A9J B;  4XZ4 A;  4FBJ B;  1B9R A;  2FNJ B;  3VUY A;  4PYU A;  4ZHP A;  3ZW3 A;  2QSD A;  1P9D U;  2IND C;  3FAH A;  3A1Q A;  3U4E G;  4FXC A;  1Q10 A;  1WSP A;  4RMA A;  4BVU C;  4LDT B;  1FNU A;  1SB3 C;  3SEB A;  2WP9 B;  4LJO B;  2OJR A;  2WLB A;  3MC8 A;  4LNN A;  2LXC A;  4P1C C;  1K50 A;  2D3G A;  1FO4 A;  4I6N B;  4XYC A;  3UIN B;  1M4V A;  4IW0 A;  1S3S G;  1MG4 A;  1RWS A;  3DBL I;  3OWE B;  2KTR B;  3JVZ X;  1XF5 L;  2PEA A;  2KAC A;  4XWT A;  5KHQ A;  1E7P B;  1ZGU B;  2M56 B;  1XLN A;  2D3B A;  1DYQ A;  3VTW A;  1IBX A;  5D3D A;  5C2T B;  3H7P A;  4XGA B;  3Q8F A;  1P0R A;  3W2D A;  4GU2 A;  2MBB B;  1R4M I;  4W9C A;  3U30 A;  4A8X C;  4YSX B;  2HDE A;  3QA8 A;  4NJ7 A;  1F52 A;  1WXS A;  1TKG A;  4QAY A;  3AE7 B;  2MJD A;  4KSL C;  3RPF C;  1WYW B;  2L00 B;  2WX1 A;  1I7H A;  1QOB A;  4W9I A;  3AE3 B;  3P63 A;  3PZ7 A;  4W9L A;  2J7Q B;  3VVW B;  1N5W A;  4R3D A;  2Z8L A;  2KC2 A;  4IG7 B;  2N9E B;  3ZYY X;  2DZM A;  4XDD A;  4ZYN A;  5J18 A;  4HEA 1;  2ZPN A;  4TSS A;  2ONQ A;  5FKA C;  4MJS B;  2MSE D;  2H88 B;  3AB5 A;  2BT6 A;  5BO4 B;  1WXM A;  2LAS A;  2IO3 B;  4TUU A;  1WJ4 A;  3ZXV A;  4K7U A;  3LDZ E;  1TBE A;  2I1J A;  2WS3 B;  3JSV A;  3L0W B;  3PPA A;  3BYY B;  4AQ7 A;  3RNC C;  4IOI E;  4KZC A;  2FCS A;  2LI5 A;  1D5M C;  5FK9 C;  3DCG A;  2AL6 A;  1OFF A;  3VQI A;  4D2K A;  2PMV A;  1T6B X;  2Y5P A;  3VUW A;  5I4D A;  2BW2 A;  1R7S A;  4C7Z A;  3ZIM A;  3MJ5 A;  2Y5C A;  3AE1 B;  2RDG A;  3DHG C;  3T9L A;  1MJD A;  4HVB A;  2BKR B;  1WF9 A;  1HQR D;  3OLM D;  3PGE A;  1OEY J;  2DAJ A;  4II2 B;  2SEB D;  3U7Z A;  3AMZ A;  1V5O A;  4MGK E;  1UEL A;  3UF8 A;  3V6E B;  2B76 B;  3BVG A;  4HLE A;  3B2F A;  2WDR B;  5T8I A;  4A3O A;  1D5X C;  2KWU B;  4DXF A;  2HJ1 A;  4FA6 A;  3WAL A;  3RN9 C;  3QJZ A;  1Q1O A;  2GBN A;  2ZW1 A;  1SEB D;  2LHD A;  2W54 A;  3A33 B;  3V61 A;  3PRM B;  2BPS A;  2UWQ A;  4KDL B;  3MHS D;  4KZ0 A;  3V60 A;  3AE4 B;  2MQJ A;  4WJQ A;  2FCM A;  4JGH B;  4MEL A;  3PRE A;  4FUL A;  3E9S A;  3A9J A;  4AJY B;  1LM8 B;  3JYU A;  1HEZ E;  2JXX A;  4M02 A;  3SU8 X;  1YQ4 B;  3DWG C;  4BOS C;  4HCN B;  3ZJV A;  1FRD A;  2KJR A;  1V97 A;  3AE6 B;  2ZW0 A;  3L54 A;  1PQS A;  2WXO A;  2MWS B;  3L16 A;  4GDK B;  3HRD D;  1EWY C;  2L32 A;  2MHJ A;  2WXN A;  1CJE A;  2GOW A;  3DBS A;  1I4R A;  3H7S A;  1UBI A;  2J0M A;  2MCN B;  4PS7 A;  1QOF A;  3ZDM C;  3W5U B;  3AE8 B;  4NAW B;  1DOX A;  1T0Q C;  2SAK A;  2MA9 B;  3W5V B;  2PTL A;  3HUI A;  5TSS A;  1FXI A;  5E6O A;  1HXY D;  2KXJ A;  4FAD A;  4ZRP A;  1QIL A;  4GDL A;  4GOC A;  3B2G A;  2X8X X;  3U8Z A;  2NBV B;  2CHX A;  4HCP B;  1HTO A;  1E6E B;  1WGR A;  2XEW A;  4FJV B;  4G50 A;  3TBL D;  5TR5 A;  1QKZ A;  2D10 A;  3HM6 X;  1E9M A;  4I6P A;  3BVM A;  1PDX A;  2LXA A;  4CO7 A;  1JRO A;  1J7A A;  2G45 B;  4AJW A;  3PZD A;  3T3N A;  2IGH A;  1HTQ A;  4AS1 A;  3RI7 C;  4ICV A;  4EOY A;  5JH5 C;  2ZCB A;  2KAJ A;  3VTV A;  2J52 A;  1C4C A;  5LLI A;  3Q3F A;  4MJS A;  5FR6 A;  2OJW A;  2BYV E;  3AUL A;  2YEP F;  4W9F A;  2LRW A;  5DPT A;  3V6C B;  1JWU D;  2IO0 B;  1V6E A;  3V05 A;  3B08 A;  1WR1 A;  1I4G A;  2KVR A;  3UGB B;  2KKC A;  4K3C A;  5HFY A;  1H4R A;  3L13 A;  1MI0 A;  2KTF A;  2ZEQ A;  4HJG E;  2EMS A;  4P16 A;  2JSV X;  4IKG A;  2G9H D;  3NG0 A;  4FHJ A;  4RGM A;  3VR9 B;  4BZA A;  1YX6 B;  4OVZ A;  1PGB A;  2M8S A;  1KLU D;  4HRS A;  1S1Q B;  2CU1 A;  4HXD A;  1I4H A;  1BXT A;  1K8R B;  1OQR A;  1Q5W B;  1TGZ B;  5CHW A;  1RFK A;  3P4Q B;  2BYE A;  4A55 A;  5L95 C;  2O6V D;  1N62 A;  2LD9 A;  4DXG A;  2JWU A;  2KZR A;  4MAC A;  4M0W A;  2VRR B;  3KLS X;  3A1Q B;  2BYT A;  4AP4 C;  2G4S A;  1XXG A;  4IDI A;  1HE8 A;  1GOZ A;  4IUM B;  4WJP A;  2C60 A;  4PS8 A;  3V3X A;  1VRA B;  4MGY E;  4NJC A;  4E71 A;  5J17 A;  2Z0D B;  3KW5 B;  3R2T A;  3ZLZ A;  1B1Z A;  2KNB A;  1UNS A;  3NZS A;  1XEE A;  1IP9 A;  1NEN B;  2QIL A;  4PK1 A;  4HKQ A;  2IYD B;  3SFE B;  4Q2J A;  1EWC A;  2PVO D;  2L0F A;  2GLS A;  4HPP A;  4FHK A;  4HDO A;  3BWU D;  1LO5 D;  1MHH E;  4IC7 B;  2D11 A;  2M4N A;  4MM3 A;  2OHF A;  1L6V A;  3OJ3 A;  1K53 A;  2HTM E;  1GJZ A;  5KHO A;  3I9V 1;  1TS5 A;  3AXC A;  3IHP C;  3H7P B;  1CZP A;  4OZC A;  4P6V F;  4K1R B;  1BUI C;  4ARC A;  3DPD A;  2INC C;  3ALB A;  4M00 A;  2KMC A;  1U4A A;  2V3S A;  1FCC C;  5AZG A;  4NAW A;  5BMG A;  2UU7 A;  3T8M A;  3Q3M C;  3HHM A;  1GUA B;  3R8B A;  1ZDX A;  5D7G A;  1FM0 D;  1I4P A;  1GAQ B;  3E56 A;  4KVG B;  2WDQ B;  1JWS D;  1EUV B;  4MSM B;  4A3P A;  5BMI A;  1SSN A;  3MHZ A;  1FRR A;  3CWI A;  1WM2 A;  2KX0 A;  4L23 A;  2LJI A;  2BTE A;  3MJW A;  4EFO A;  3N1X C;  4EKU A;  3PT2 B;  4DHJ B;  4JIO U;  4NZL B;  5GMV A;  1ACC A;  3AEB B;  1TIF A;  5LNK 1;  1VZ6 A;  4AWJ A;  4XDC A;  3JSV B;  1A70 A;  2AWT A;  5JZE B;  2GBR A;  3MFG A;  3PHX B;  1IGC A;  1J8C A;  4E74 A;  1OGW A;  1YOV B;  2KT7 A;  4A90 A;  2KOX A;  2AX5 A;  1QLB B;  1ET9 A;  4TV3 A;  2YVC A;  3A4R A;  1OQY A;  4NQL B;  1SIJ A;  4DHZ E;  1XLP A;  2FCQ A;  4N59 A;  3AEF B;  4RGO S;  4WJN A;  2CR5 A;  4NY0 A;  2DZI A;  3RNG C;  1I42 A;  2K8B A;  1WJN A;  1ROE A;  2FUH B;  2LJ5 A;  5G55 A;  1WXA A;  3ZTC A;  1WX8 A;  2HJ8 A;  2RSU A;  1L6U A;  3KUZ A;  4HKZ E;  1ZOY B;  1EM7 A;  2JY6 A;  4WQM A;  1KRH A;  1FPY A;  3IVF A;  2KFK A;  2DZK A;  1DOI A;  1XO3 A;  3IFW B;  3B9J A;  2BWE S;  4YT0 B;  2WQY B;  4PS3 A;  4K3B A;  1SBB B;  1JWA D;  2LVP A;  2G1E A;  4RH6 A;  3WAN A;  2AYO B;  4OZA A;  3CF6 E;  3KWL A;  2KMM A;  4B0M A;  1GB1 A;  5EDS A;  4LNF A;  4NQK E;  1C76 A;  4KIK A;  4YTP B;  2ACZ B;  1L0X B;  3BZD B;  2TSS A;  2XK5 B;  2JZ3 B;  2ZVN A;  3DVN U;  1Q0W B;  3ZUN A;  4ANW A;  1N6Z A;  1V8C A;  1E5W A;  3PSE B;  2ZNV B;  1JAL A;  3ETR A;  1MHX A;  4A6Q A;  4JWS C;  2WGS A;  5EE1 A;  3PO0 A;  3HK0 A;  4MSQ B;  2N9X A;  4FLH A;  3IT4 B;  1JRP A;  3DBR B;  4MGI E;  2A4Z A;  3APF A;  2KQ4 X;  2XBB C;  4ZYS A;  2IY1 B;  2QEJ C;  2M0A A;  4G3X B;  4GMV A;  1J0G A;  4M8M A;  1YN5 A;  3KWV A;  4ANX A;  4HDQ A;  4PT5 A;  4WQO B;  1E10 A;  4IWQ A;  3HVD A;  2W9N A;  3TIX A;  5J2R A;  2W3S A;  3NVY A;  4L2Y A;  4ARI A;  3U2S C;  1XLQ A;  2PJH A;  3MTN B;  4GDL B;  3ECI A;  5H92 C;  4JPS A;  2MJE A;  3AED B;  1ZUD 2;  5IKC M;  5LXH A;  2BVC A;  2VH1 A;  1TY2 A;  2DHZ A;  2X38 A;  3DHI C;  2GI9 A;  2ZNV C;  2C7M B;  2K9X A;  3N1Y C;  3TMP B;  1RAX A;  2LVO A;  2QJL A;  3UQA A;  4BKS D;  2NS5 A;  3ML8 A;  4MH0 E;  1RRB A;  2NPT B;  4OVU A;  2I1K A;  3N30 A;  4XC2 A;  5CHV C;  2DWQ A;  1TS3 A;  5G5G A;  4ITK A;  4YL8 A;  3APC A;  2R61 A;  4JQW C;  2ZPY A;  1WXQ A;  2YEP B;  2C7H A;  4GN1 A;  4ASW C;  2FCN A;  4RNA A;  2N7E A;  5AUI A;  1CMX B;  3K9P B;  2J42 A;  2FBW B;  4HWI B;  1C78 A;  1C4A A;  3H8H A;  3VRA B;  5DPW A;  1WX7 A;  2QDF A;  2QHO A;  3RFZ B;  5IN7 A;  2XN9 C;  2VZK B;  2PKO A;  3O13 A;  2AL3 A;  4KGS A;  4B9K A;  2FID A;  3M63 B;  3ENE A;  2JVC A;  2EKI A;  4RGT A;  4LCD E;  5DCN A;  3ZTD A;  2JU6 X;  2JYT A;  1WRI A;  1NI3 A;  1WM3 A;  1D4B A;  3A4S C;  2OED A;  3RT3 B;  2KAN A;  4B0E A;  3P42 A;  4II3 B;  2R2Q A;  2DX5 B;  5H8Y E;  1DOY A;  4RFB A;  2GBK A;  3MP9 A;  2V9H A;  3VRB B;  5E6N A;  1AYF A;  1WGK A;  2JF5 A;  1C4P A;  3W1S C;  1J7C A;  1DGJ A;  4BBN C;  2G4D B;  2CJO A;  2WYQ A;  3C0R B;  4O1N A;  2PIA A;  4M0W B;  2GRI A;  4B95 A;  2BWF A;  4TMA B;  5C23 A;  4YSZ B;  4RF1 A;  2AQ3 B;  1AWD A;  3Q3N C;  2ASQ A;  2J53 A;  2G3Q B;  4RGN A;  4ZRI A;  1QT9 A;  3WCQ A;  3ZRF A;  3BYT B;  3TUO A;  2KWC A;  2R2O A;  4AUQ C;  1C3T A;  1AAR A;  3PLU A;  2KWV B;  2LFI A;  1V86 A;  2GBM A;  2FUG 1;  4HK2 A;  1PYW D;  3P2B A;  4US9 A;  2QCZ A;  4DDI D;  2XK5 A;  3R3M A;  1ZXH A;  5BYQ A;  2N1W A;  1EO6 A;  2WXP A;  4MM3 B;  3S2A A;  4LJP B;  4XWW A;  3URY A;  3N20 C;  3ZO5 B;  5LXI B;  4ZRK A;  1E8X A;  5EE3 A;  3X23 A;  1FXT B;  1C1Y B;  2WXJ A;  4IM0 A;  2Z59 B;  2KLC A;  3RNA C;  2V0G A;  3DDC B;  4M8N A;  4HPM B;  1WE7 A;  1GC7 A;  5C1Z A;  3VFK A;  4OW0 A;  4GLS C;  1E8Z A;  4YTM B;  1SIF A;  4JLC A;  2HTH A;  3EHV A;  4YWG G;  3KUD B;  3GS2 A;  1H8C A;  1FCL A;  2M17 A;  3OG5 A;  1IPG A;  3PV1 A;  1KLV A;  2N7D A;  3L17 A;  4P7I A;  3HM3 A;  3RUL A;  3H9D A;  1FFU A;  5HHD G;  1VD2 A;  1HA5 A;  1F2R C;  1NEK B;  2ON8 A;  1V9J A;  4JE3 B;  4N58 A;  1WJU A;  4LNK A;  3WIM A;  2Q5W D;  2WXR A;  2L83 A;  1V81 A;  2DYO A;  3ZJT A;  1IYF A;  2NR2 A;  3OJ4 B;  5IAA C;  3RMK C;  1YN4 A;  3FIL A;  1XD3 B;  1BML C;  3BVZ A;  4MGZ E;  1YJJ A;  2KK8 A;  4G0N B;  4JL9 A;  1RFA A;  1WGG A;  2NPT A;  2KMA A;  4KDI C;  2WDV B;  5D3I B;  2LGI A;  2LRU A;  1UD7 A;  1XCQ L;  3ZDT A;  4BBN F;  1SE9 A;  3NZ3 A;  2RD0 A;  1N5X A;  3TEX A;  1E90 A;  4IWP A;  1TZO A;  3VUX A;  4ZRQ A;  4DXA B;  4HJK A;  2L0T A;  3AE5 B;  2DYB A;  2KDM A;  1BT0 A;  5D94 A;  2IO1 B;  3BK2 A;  1UWM A;  3I3T B;  5FR3 A;  1E8W A;  3ZKJ C;  3OAW A;  2WHI A;  3NZU A;  4N9F 4;  1YN3 A;  4C56 C;  1VLB A;  3W9C B;  1YJI A;  4DHJ D;  1GG3 A;  2KFK B;  3Q8E A;  2Z0E B;  3R2I A;  2W82 A;  3V62 A;  4GIV A;  1YNT E;  3Q69 A;  2D3A A;  2K5P A;  3WAM A;  1V2Y A;  2WU5 B;  1STE A;  5DPS A;  1AW7 A;  4KIK B;  1GNU A;  2JX5 A;  2JZP A;  2LMC A;  3VTU A;  2DNF A;  2WXL A;  3A9K A;  4J3O D;  1OTR B;  1TYG B;  2D2Q A;  2KC1 A;  3PZ8 A;  2CHW A;  2JUO A;  2W55 A;  4K7S A;  1YQ3 B;  4US8 A;  1WZ0 A;  4BFR A;  4YXD B;  3DBR I;  3PTF C;  1C77 A;  3GZN B;  3C19 A;  1VZ7 A;  4HPL B;  1QF6 A;  2LGD A;  4I6L B;  2HE7 A;  4ZRJ A;  3CIR B;  3Q8A A;  1N60 A;  5MPO A;  5BYR A;  3J9C A;  3RNE C;  4RCO A;  1D6E C;  5G2N A;  1QZE A;  3QAQ A;  2DAF A;  1WJ6 A;  2BB5 A;  3NVV A;  1WR6 E;  4URK A;  2AEH A;  2WX0 A;  4BKG A;  3IXS A;  2H89 B;  1QOG A;  2LVQ A;  2PPH A;  3GE3 C;  2E6X A;  3EFU A;  4IM3 A;  2K3U A;  1FXA A;  3RZW C;  4IWO A;  3NS1 A;  1R4N B;  3R7R A;  4BKS A;  5G5H A;  4P1B C;  1LGR A;  2WXI A;  3R7Q A;  1FNV A;  4LDT D;  4C80 A;  3AU4 A;  1K52 A;  1VJK A;  4A20 A;  3RNB C;  2L3Z A;  3H1U A;  2GMI C;  2RR9 A;  3PS6 A;  1YQB A;  4XE0 A;  1PGX A;  2AQ2 B;  2N1V A;  4WWP A;  2WXM A;  2ZVO A;  2JQR B;  3K9O B;  2NTT A;  2BS3 B;  3PHW B;  1T0Y A;  1TT5 B;  2DLB A;  2D3C A;  2C9W B;  1KLG D;  1WXV A;  4K7W A;  1SE2 A;  2ZZP B;  2I38 A;  3QQ8 B;  1KFY B;  1M94 A;  3BII D;  4GB9 A;  1X1M A;  2A5U A;  3VR8 B;  1I35 A;  1Y8R C;  2KJH B;  4W9J A;  3FKY A;  5EE9 A;  4EZL A;  2V4L A;  4C00 A;  1RYJ A;  1JW9 D;  2RDH A;  3NUH B;  4EEW A;  4LNI A;  1FIQ A;  1RLF A;  1EF1 A;  4ANU A;  4YTN B;  1TS2 A;  2JYE A;  1HZ6 A;  3TEW A;  2K8C A;  3AN1 A;  2INP E;  3D32 A;  1FNW A;  4S17 A;  3PRZ A;  1J7B A;  3L4P A;  1T3Q A;  4WAF A;  3GP7 A;  4NPN A;  4NNJ B;  4WH4 A;  3PLV A;  2KDB A;  2DBY A;  1ZE3 D;  1L2N A;  3DBH B;  3QAR A;  3NS8 A;  2B3A A;  4JX1 C;  4ICU A;  4KV2 A;  2JPH A;  3SHQ A;  2IBI B;  1NBF C;  4WWN A;  1ZP0 B;  1OEY A;  4MH8 A;  2MLB A;  3AI5 A;  5CX3 A;  1TKE A;  4BKT A;  1WX9 A;  3TL5 A;  5E6J A;  2K8H A;  1KM7 A;  1N63 A;  3NJT A;  1T0R C;  4ZOH C;  3UIP B;  3KQ4 A;  5AEK B;  5JHA A;  2JWZ A;  2L7R A;  4H2A A;  2L1A A;  3ZGZ A;  1UH6 A;  2KQ7 A;  2MX2 A;  3ZRC A;  2RPQ A;  3AH7 A;  2AQ1 B;  2Y3A A;  1TKY A;  4MEM A;  4N6E B;  4YSY B;  3VH4 B;  3Q3O C;  3W1Y A;  1UWX A;  3CMM B;  1WY8 A;  3RCZ A;  2IDY A;  3ZJU A;  2UYZ B;  1EU3 A;  4EE2 A;  3ZNZ B;  3P4P B;  3EFC A;  4L1B A;  3LXF A;  1WGD A;  2K39 A;  2L05 A;  2IPK D;  1ZXI A;  1F1H A;  2WU2 B;  1L7Y A;  1LFD A;  5AUK A;  5BMH A;  2MH7 A;  2KN5 A;  5CTR C;  5IOI A;  2GB1 A;  1JRU A;  1D3Z A;  2N9K A;  2NBU A;  3AU5 A;  4JWU C;  1GB4 A;  3EEC A;  2YLM A;  3KVF B;  2M1M A;  1P3Q U;  1UZX B;  4BOZ B;  3M95 A;  1YMH E;  1MPE A;  2VH2 A;  3SDL C;  4GSW A;  3FIL B;  1EF5 A;  2J4X A;  4OHJ A;  4TKN A;  4F1S A;  2IGG A;  4XX5 A;  2MBE A;  3DVN V;  4OVV A;  3ZNI D;  3DVG X;  5HKH A;  1T0S C;  2WDT B;  3APD A;  2KHW B;  1ZW7 A;  2C7N B;  1ET6 A;  1ISN A;  1ZDV A;  1L4Z B;  5D2M B;  2CU3 A;  1GC6 A;  3Q6B A;  1GPX A;  2PVG C;  4EZK A;  1F77 A;  1MVK A;  1NYQ A;  5CHF A;  4S0R A;  2K22 A;  4W9H A;  1L0Y B;  3BIN A;  1HZ5 A;  1C79 A;  5AZH A;  1FD6 A;  3IBE A;  5EE0 A;  2I2Y A;  4RM9 A;  1WRD B;  2LZ6 A;  3IG3 A;  4FJY A;  3P4S B;  2D5G A;  4LNO A;  1I4Q A;  2BF8 B;  1CQV A;  4KX6 B;  2EMT A;  2N7J A;  1Z5S B;  3AM9 A;  1SJH D;  2LGS A;  1VCB A;  3VAW A;  2PW9 A;  1V1O A;  2MP2 A;  1KF6 B;  2KJ6 A;  3N3K B;  1WIA A;  1JWM D;  2O6V A;  2O2V A;  2IZV B;  3R66 C;  1WWT A; 
#chains in the Genus database with same CATH homology
 3A9J B;  4E3C A;  4XZ4 A;  1LXD A;  3DPD A;  4FBJ B;  3ALB A;  3NHE B;  2FNJ B;  2KMC A;  1U4A A;  3VUY A;  4PYU A;  2V3S A;  1MG8 A;  2LRU A;  1UD7 A;  3ZW3 A;  1P9D U;  3M3J A;  5AZG A;  3QC8 B;  3A1Q A;  4NAW A;  5D6J B;  3CST A;  3T8M A;  4NJ6 A;  3ZDT A;  3HHM A;  1GUA B;  4RMA A;  5D7G A;  4BBN F;  2K6D B;  3A9K B;  1LQB A;  1SE9 A;  2IY0 B;  4BVU C;  2RD0 A;  4KVG B;  4LDT B;  4LJO B;  1E90 A;  2OJR A;  1WZ3 A;  4IWP A;  1EUV B;  4MSM B;  3VUX A;  2LXC A;  4DXA B;  4HJK A;  1YX5 B;  4A3P A;  2FAZ A;  2N9P C;  4PYZ A;  2L0T A;  2DYB A;  1BT0 A;  2D3G A;  4TQ0 A;  1WM2 A;  3WAP A;  5D94 A;  2KX0 A;  1F9J A;  2IO1 B;  3GOE A;  4I6N B;  3UIN B;  4IW0 A;  1S3S G;  3I3T B;  1E8W A;  3ZKJ C;  3OAW A;  3DBL I;  2JZZ A;  3MJW A;  3QCA A;  4EFO A;  2KTR B;  2LGX A;  3JVZ X;  2PEA A;  4EKU A;  3NZU A;  4N9F 4;  1A5R A;  3PT2 B;  4DHJ B;  2REX A;  4JIO U;  5KHQ A;  3GZN I;  5GMV A;  1ZGU B;  4DHJ D;  2KDE B;  1GG3 A;  1TTN A;  2KFK B;  3KYD D;  2Z0E B;  4J6I A;  3VTW A;  3V62 A;  1P98 A;  3H7P A;  4GIV A;  2N4F A;  2KFJ A;  2EKE C;  1WGY A;  3SD5 A;  4AWJ A;  3JSV B;  3WAM A;  4ANV A;  1V2Y A;  1P0R A;  2AWT A;  3VH3 B;  4GU2 A;  2MBB B;  1R4M I;  4W9C A;  3U30 A;  5JZE B;  2GBR A;  5DPS A;  3QA8 A;  3PHX B;  1NDD A;  4NJ7 A;  4KIK B;  1GNU A;  2C5L C;  4X57 B;  2CS4 A;  3L08 A;  1J8C A;  4MDK E;  1WXS A;  3ML9 A;  4E74 A;  1OGW A;  1WI0 A;  3VTU A;  3A9K A;  1OTR B;  4KSL C;  2KOX A;  4TV3 A;  2LGY A;  2D2Q A;  2YVC A;  2KC1 A;  1WYW B;  3A4R A;  2L00 B;  2WX1 A;  2CHW A;  1OQY A;  4NQL B;  2JUO A;  4W9I A;  1XQQ A;  3QWZ B;  1R4N I;  4W9L A;  4DHZ E;  4K7S A;  2FCQ A;  2J7Q B;  3VVW B;  4WJN A;  2CR5 A;  4NY0 A;  2KC2 A;  3U7D A;  2DZI A;  1I42 A;  1WZ0 A;  2K8B A;  3QHT A;  1WJN A;  3VHT C;  4IG7 B;  2N9E B;  4BFR A;  2DZM A;  2FUH B;  2LJ5 A;  1V49 A;  4ZYN A;  5G55 A;  5J18 A;  1WXA A;  3DBR I;  2KTR A;  3PTF C;  4FN2 A;  2ZPN A;  3ZTC A;  1WX8 A;  2HJ8 A;  2RSU A;  3KUZ A;  5JHB A;  1Z2M A;  4HPL B;  4MJS B;  2JY6 A;  2LGD A;  2MSE D;  3JW0 X;  4I6L B;  3IVF A;  2HE7 A;  2KFK A;  2DZK A;  4ZRJ A;  2K6Q A;  5BO4 B;  3KUC B;  1WXM A;  2LAS A;  3IFW B;  2IO3 B;  4TUU A;  2BWE S;  4PS3 A;  4W9G A;  1WMH B;  1WJ4 A;  4K7U A;  2KX3 A;  3LDZ E;  2NVU I;  1TBE A;  2I1J A;  2LVP A;  3BY4 B;  3JSV A;  3L0W B;  3WAN A;  2AYO B;  3CF6 E;  5G2N A;  1QZE A;  3PPA A;  3QAQ A;  2DYM A;  2DAF A;  3VDZ A;  3M62 B;  1WJ6 A;  2OOB B;  2RGF A;  5EDS A;  4NQK E;  1WR6 E;  4KIK A;  4KZC A;  4URK A;  2AEH A;  2FCS A;  2LI5 A;  2WX0 A;  3RUI B;  4GXB A;  4AOF A;  4BKG A;  4KSK C;  3DCG A;  4WJO A;  2LVQ A;  2XK5 B;  2JZ3 B;  2PPH A;  2ZVN A;  3W1S A;  2AL6 A;  3EFU A;  4IM3 A;  3VQI A;  3DVN U;  1Q0W B;  2MW5 A;  3RZW C;  1KOT A;  4IWO A;  3ZUN A;  3VUW A;  2JRH A;  1V5T A;  3R7R A;  1P1A A;  3ZIM A;  4BKS A;  4ANW A;  1E5W A;  3PSE B;  2DZJ A;  2ZNV B;  3PRP B;  3T9L A;  3RYT A;  3R7Q A;  4HVB A;  4LDT D;  2BKR B;  1WF9 A;  3AU4 A;  3HK0 A;  4MSQ B;  4DBG A;  3NOB A;  3QX1 A;  4A20 A;  2N9X A;  2L3Z A;  4FLH A;  3H1U A;  3KH0 A;  4MGI E;  2Y5B B;  3TJP A;  2A4Z A;  3APF A;  4EZJ A;  2XBB C;  3OLM D;  2GMI C;  3PGE A;  1OEY J;  2DAJ A;  2RR9 A;  4II2 B;  2IY1 B;  3PS6 A;  1YQB A;  3RZF A;  1V5O A;  4MGK E;  1UEL A;  3UF8 A;  4DDG D;  4G3X B;  2N1V A;  2J0K A;  3V6E B;  2K1F A;  4WWP A;  4GMV A;  4HLE A;  1NI2 A;  2MBO A;  2KDF B;  4A3O A;  4FA6 A;  1J0G A;  2KWU B;  4M8M A;  4ZDV A;  3WAL A;  3DOW A;  3QJZ A;  2KQS A;  2ZVO A;  3K9O B;  4ANX A;  4HDQ A;  1Q1O A;  2FIF A;  1G6J A;  4WQO B;  2GBN A;  3PHW B;  4IWQ A;  1T0Y A;  4K81 A;  3A33 B;  3V61 A;  2W9N A;  4F8C B;  3L10 B;  3PRM B;  2BPS A;  2C9W B;  1WXV A;  2UWQ A;  4K7W A;  3TIX A;  5J2R A;  2ZZP B;  3DBH I;  4KDL B;  1E7U A;  3MHS D;  4KZ0 A;  3QQ8 B;  3V60 A;  2MQJ A;  4WJQ A;  2PE9 A;  2PJH A;  1M94 A;  2FCM A;  3MTN B;  4JGH B;  4GB9 A;  1E8Y A;  4MEL A;  3PRE A;  4GDL B;  4FUL A;  4AJY B;  3A9J A;  1LM8 B;  1X1M A;  3JYU A;  2A5U A;  2JXX A;  2NBW B;  4W9D A;  1I35 A;  1Y8R C;  2D07 B;  3ECI A;  3SU8 X;  2KJH B;  4W9J A;  4BOS C;  4HCN B;  5LXH A;  2KJR A;  2DHZ A;  4EZL A;  2V4L A;  3L54 A;  1PQS A;  2ZNV C;  2MWS B;  3L16 A;  4B6W A;  2C7M B;  4GDK B;  4EEW A;  3TMP B;  1RAX A;  3ONS A;  2HD5 B;  3DQV A;  2LVO A;  2LUE A;  1RLF A;  3UQA A;  1EF1 A;  4IM2 A;  4BKS D;  4ANU A;  2NS5 A;  3ML8 A;  4MH0 E;  1RRB A;  2GOW A;  2NPT B;  3DBS A;  4OVU A;  2I1K A;  3O65 B;  2K8C A;  3N30 A;  4XC2 A;  3H7S A;  5CHV C;  3D32 A;  2KO3 A;  1UBI A;  2J0M A;  2MCN B;  1XT9 B;  4PS7 A;  3ZDM C;  1WFY A;  4YL8 A;  3APC A;  3PRZ A;  4NAW B;  4JQW C;  4NPN A;  2L76 A;  2ZPY A;  4NNJ B;  2WWZ A;  4DK5 A;  3QK0 A;  2C7H A;  4GN1 A;  4ASW C;  4FJZ A;  2MA9 B;  3PLV A;  2MBH A;  2FCN A;  2KDB A;  1L2N A;  2DEN B;  5E6O A;  2L8J A;  3QAR A;  4F7Z A;  2KXJ A;  3NS8 A;  2N7E A;  1CMX B;  2B3A A;  3K9P B;  4ICU A;  4HWI B;  4W9K A;  3H6N A;  5DPW A;  1YJ1 A;  1WX7 A;  2QHO A;  4KV2 A;  4FAD A;  2K25 A;  2JPH A;  3SHQ A;  4GDL A;  3ZNG C;  4GOC A;  2IBI B;  2AL3 A;  4B9K A;  2FID A;  1NBF C;  3UIO B;  3QIJ A;  3M63 B;  4WWN A;  3U8Z A;  3ENE A;  2NBV B;  5L83 A;  2JVC A;  1OEY A;  2CHX A;  4LCD E;  4HCP B;  2BKF A;  2MLB A;  3DVG Y;  3AI5 A;  5DCN A;  1WGR A;  5CX3 A;  2XEW A;  3ZTD A;  4BKT A;  3CSF A;  1WGH A;  4FJV B;  4G50 A;  1WX9 A;  3TL5 A;  1WM3 A;  3A4S C;  1E7V A;  3TBL D;  3TCA A;  2K8H A;  3RT3 B;  4GDK A;  5TR5 A;  2KAN A;  1KM7 A;  4WAA A;  2D10 A;  3HM6 X;  4I6P A;  3UIP B;  5AEK B;  2LXA A;  5JHA A;  4CO7 A;  4II3 B;  2JWZ A;  2MBQ A;  2G45 B;  2R2Q A;  1UBQ A;  2L7R A;  4AJW A;  2DX5 B;  3PZD A;  1UH6 A;  2PE6 B;  2GBK A;  2KQ7 A;  2MX2 A;  1TZ1 A;  5E6N A;  4DHZ B;  2JF5 A;  4ICV A;  3W1S C;  3ZRC A;  1KJT A;  3WA0 A;  2RPQ A;  4EOY A;  5JH5 C;  2ZCB A;  4BBN C;  3VTV A;  2G4D B;  4MEM A;  3WAO A;  1UGM A;  3VH4 B;  2WYQ A;  2J0J A;  3C0R B;  3W1Y A;  5LLI A;  3Q3F A;  4M0W B;  2NCN A;  3CMM B;  4MJS A;  5FR6 A;  2BYV E;  2KLG A;  3AUL A;  4B95 A;  4W9F A;  2BWF A;  2LRW A;  5DPT A;  1WY8 A;  3RCZ A;  5C23 A;  2UYZ B;  3V6C B;  2IO0 B;  1V6E A;  1WMH A;  2BYF A;  1V80 A;  3ZNZ B;  2ASQ A;  1WGD A;  2K39 A;  1YIW A;  2G3Q B;  2L05 A;  2M0X A;  3B08 A;  1WR1 A;  4ZRI A;  3ZRF A;  3ZVV A;  4TQ1 A;  5DPR A;  2KWC A;  2KVR A;  2R2O A;  2KKC A;  1L7Y A;  3UGB B;  1AAR A;  4AUQ C;  1SGH A;  2KWV B;  3PLU A;  1C3T A;  1H4R A;  1V86 A;  3L13 A;  2GBM A;  3UQB A;  1LFD A;  2KTF A;  2ZEQ A;  2EMS A;  4HK2 A;  2KN5 A;  1ZKH A;  3P2B A;  4FHJ A;  5CTR C;  1YX6 B;  4DDI D;  2XK5 A;  3R3M A;  1JRU A;  4GGQ A;  2NBU A;  1D3Z A;  3AU5 A;  3EC8 A;  2N1W A;  2M8S A;  2ZJD A;  1EO6 A;  4W9E A;  3EEC A;  3S2A A;  4LJP B;  1S1Q B;  2YLM A;  3KVF B;  2CU1 A;  1WE6 A;  2IO2 B;  2M1M A;  4HXD A;  1P3Q U;  1UZX B;  4BOZ B;  3HIZ A;  4CYE A;  3M95 A;  3ZO5 B;  5LXI B;  4ZRK A;  1K8R B;  1E8X A;  1Q5W B;  3SDL C;  1TGZ B;  3X23 A;  5CHW A;  1EF5 A;  2MP2 B;  1FXT B;  1C1Y B;  2Z59 B;  4G11 A;  4GSW A;  2KLC A;  4IM0 A;  2BYE A;  4TKN A;  4F1S A;  4XX5 A;  2O6V B;  2MBE A;  2O2V B;  3DDC B;  3DVN V;  4HPM B;  4M8N A;  4OVV A;  3N32 A;  1WE7 A;  5L95 C;  2O6V D;  1GC7 A;  5C1Z A;  2GBJ A;  3DVG X;  3ZNI D;  5HKH A;  2LD9 A;  2WDT B;  3VFK A;  3APD A;  2KHW B;  1E8Z A;  1ZW7 A;  2KZR A;  3B0A A;  1SIF A;  2C7N B;  3NY5 A;  2HTH A;  2JRI B;  4JLC A;  4RM8 A;  2VRR B;  4CHK A;  1ISN A;  2KDI A;  3EHV A;  1J19 A;  5D2M B;  3KUD B;  1GC6 A;  3A1Q B;  4WWO A;  3RD2 A;  1H8C A;  4AP4 C;  2G4S A;  2M17 A;  4EUT A;  1IPG A;  3PV1 A;  1KLV A;  2N7D A;  1HE8 A;  3L17 A;  4P7I A;  4IUM B;  4WJP A;  2C60 A;  4PS8 A;  3B1L X;  3HM3 A;  3H9D A;  3RUL A;  4EZK A;  4MGY E;  4E71 A;  5J17 A;  3ZNH B;  2Z0D B;  3KW5 B;  5CHF A;  1VD2 A;  3ZLZ A;  2KNB A;  4W9H A;  2CKH B;  3NZS A;  1IP9 A;  3BIN A;  1V9J A;  3PVL A;  5AZH A;  3IBE A;  4RM9 A;  2IYD B;  5E6P A;  1WRD B;  2L0F A;  2LZ6 A;  1WJU A;  3IG3 A;  2JT4 B;  3KYC D;  4FHK A;  4FJY A;  4HDO A;  3WIM A;  2BGF A;  4IC7 B;  5AZF A;  2BF8 B;  2D11 A;  2M4N A;  4MM3 A;  2EMT A;  4DWF A;  3OJ3 A;  1V81 A;  3LJ3 A;  1Z5S B;  2DYO A;  2CHZ A;  1IYF A;  2NR2 A;  1GJZ A;  1WH3 A;  5KHO A;  2LWP A;  1VCB A;  2V1Y A;  3OJ4 B;  5IAA C;  3VAW A;  2MRP A;  3AXC A;  2MP2 A;  1XD3 B;  2KJ6 A;  3H7P B;  3IHP C;  3N3K B;  1WIA A;  1YD8 U;  2KD0 A;  2O6V A;  2O2V A;  3Q3J A;  4MGZ E;  3VXW A;  2IZV B;  2KK8 A;  4G0N B;  4JL9 A;  1RFA A;  1WGG A;  3R66 C;  2NPT A;  3X0W A;  2KMA A;  4KDI C;  2ZCC A;  4K1R B;  5IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...