3AEGB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aegB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aegB01
3NVWA 4C7YA 3P4SB 3DWGC 1N5XA 3SFEB 5EE3A 1WRIA 1SIJA 3B2FA 5C3JB 1VJKA 1E0ZA 1YJJA 3FC4A 1ZOYB 1N60A 3AEAB 5EE9A 2PVOD 1I7HA 1DOXA 1FFVA 2Y5CA 3LXFA 2MJDA 1CZPA 2KMMA 3P63A 3AEEB 1QT9A 4P6VF 1L5PA 2LEKA 4YXDB 1JRPA 1T3QA 1A70A 4HROA 1QLBB 3NVZA 1SF0A 3AB5A 1VLBA 1FXAA 1RM6C 1RWSA 1F0ZA 3CWIA 3BIID 1ZP0B 3VR8B 1TKYA 1YJIA 2CU3A 5AUIA 1E7PB 1QOAA 3HUIA 2N0SB 4LTUA 3AE6B 1TKGA 1N62A 3LB8C 3W5UB 1FIQA 3FAHA 3DWMA 3ZYYX 2K22A 2L52A 1V97A 4ITKA 1GAQB 5C2TB 1FFUA 3VR9B 1QOGA 3WCQA 1WWTA 1SB3C 1XLNA 1V8CA 1J7BA 3W9CB 3P4QB 1JALA 1KFYB 2M56B 3AM9A 4IDIA 1IUEA 2MJEA 1WGKA 4N6EB 1H7XA 4YSYB 1XLPA 2Q5WD 3NRZA 4US9A 2H88B 1OQRA 4N59A 3AH7A 2W3SA 1L6UA 2BS2B 5G5HA 1DOYA 1JQ4A 3P1MA 3AEDB 3AEFB 4C80A 1DGJA 5AUKA 1J7CA 2OHFA 2BS3B 4JWSC 5EE1A 3AE2B 2FBWB 1YQ3B 1JWBD 1OQQA 1TKEA 1XLQA 3HRDD 2WU5B 3NVYA 1WYGA 4US8A 3AE5B 3P4PB 3AE7B 1UWMA 2CJNA 4C7ZA 2WDVB 4FXCA 2DBYA 4WQMA 1OFFA 1YQ4B 1ZUD2 2EKIA 1GPXA 4ZHPA 3ABVB 1NI3A 3AV8A 3VRAB 1QOBA 4YT0B 1FRDA 1ROEA 2AX5A 1FMAD 1FRRA 2W54A 4YSZB 2K5PA 2JQRB 2WS3B 1E9MA 4USAA 3AE3B 2W55A 3P4RB 1E6EB 3VRBB 2K9XA 2QJLA 3CF4A 1N5WA 3ETRA 3SR6A 4A9AA 1N63A 3RPFC 4JX1C 3AE8B 3EUB2 4YTMB 1TJEA 2MH7A 1J7AA 1JWAD 1GTEA 1NVID 2PKOA 4JWUC 5G5GA 2BT6A 3AN1A 2WDRB 3B2GA 1DOIA 3AEGB 1JROA 2E3TA 5EE0A 2BS4B 2WDQB 3KWLA 1NENB 2CJOA 3B9JA 1L6VA 3AE1B 1XO3A 3NVVA 1PFDA 3AECB 3AE9B 1VDVA 1R7SA 2WQYB 2W3RA 3PO0A 3CIRB 2G1EA 1H7WA 4HRSA 5H8YE 4YTPB 2H89B 1NEKB 1KRHA 4WWMA 1RFKA 1FO4A 3AEBB 1PUTA 1QOFA 4YSXB 2HTME 1FM0D 1GT8A 1AWDA 4ZOHC 5MPOA 1WXQA 3W5VB 2DWQA 1XLOA 2L83A 1AYFA 1CJEA 2QIEB 2KAJA 3AE4B 3HVZA 2PIAA 4YTNB 1B9RA 2WLBA 3AMZA 4N58A 1PDXA 1N61A 1QF6A 1GTHA 4KX6B 1ZXIA 1KF6B 1JW9D 2B76B 1E10A 2ACZB 5H92C 1L0VB 1EWYC 2WP9B 1NYRA 3NS1A 2PVGC 2MJ3A 3L4PA 1TYGB 3SFDB 2WU2B 1FXIA 5GXGB 2M19A 2JX5A 1RYJA 4ZHOA 1NYQA
chains in the Genus database with same CATH superfamily
3RNEC 3PLVA 2KVZA 3NJTA 3PLUA 1HXYD 1L0XB 5FR6A 1JRPA 2WXQA 2WXLA 4ZDVA 1IPGA 1UBQA 4DWFA 1F2RC 4MT5A 3TBLD 5JH5C 4PYZA 2KQ7A 4TUUA 4L1BA 3UI3A 2MBEA 3P4QB 4L23A 3AM9A 3RI7C 2NVUI 4NQLB 5DPSA 3WAPA 3OAWA 2L05A 1E7UA 4GDLA 4P16A 3C0RB 3APDA 4GB9A 3BK2A 1WM2A 4WWPA 4IOIE 2BB5A 3GZNI 3IBEA 3Q8AA 2R2OA 4GDKB 3W2DA 4NJCA 3CSFA 3IG3A 4P7IA 3VHTC 3RMKC 1C1YB 1MHXA 2WDQB 3UINB 1XO3A 3ZRCA 3U7ZA 4MSQB 2WNMA 1WYWB 1TIFA 3QC8B 4WIPA 1UBIA 2K1FA 1C78A 1CJEA 5FK9C 1I4PA 1SBBB 5D6JB 3PVLA 1F77A 3Q69A 2N9PC 2AL3A 4MM3B 4FADA 3C8YA 2B3AA 4J3OD 1VRAB 3Q2AC 1ZDXA 1GC6A 3UQBA 3L4PA 1TT5B 4HKZE 1I4GA 3W1SC 5JZEB 4ARIA 1GOZA 2IGHA 2HE7A 2KFKA 1YJ1A 2WXRA 2DZIA 1FFVA 4EKUA 4E74A 1KM7A 2MRPA 3MP9A 5DPTA 4RF1A 1A70A 3NVZA 5BYQA 3PGEA 3DVNV 1UZXB 2MHJA 2CU3A 1ET6A 2N9KA 2N9LA 3Q3OC 3QWZB 2VH1A 4OVZA 4GOCA 5IO9A 3AULA 2MBHA 3V3XA 4K7SA 1ACCA 4ITKA 4LK0M 2WHIA 4DHZE 2X8XX 3EGRA 4FA6A 2LRUA 1YOVB 2KX3A 1XD3B 2EKEC 3QHTA 1WGKA 4HPPA 5C1ZA 2NTSA 3ZNGC 5AUKA 1TBEA 1WJUA 1XLQA 3H6NA 2DENB 3R66C 4WJPA 2Z0EB 3ZUNA 2SEBD 1DOXA 4YT0B 4IWOA 2DZMA 1WI0A 2WS3B 2JQRB 4DXGA 2K9XA 2LGSA 2VZKD 3A1QA 4REZA 1SJHD 2MH7A 4TQ1A 3DBRI 1F1HA 3QX1A 2WDRB 2ASQA 2RMMA 1JROA 5HFYA 1I35A 2K8CA 3TIXA 4HPMB 2M0XA 3QA8A 4EFOA 2CU1A 3VXWA 2K8BA 2W3RA 3CIRB 5GMVA 4A3PA 1KRHA 4W9JA 1AWDA 4BKSA 1GG3A 2ZW0A 4JIOU 1ET9A 1P98A 3PHWB 4YWGG 3QJZA 2PIAA 1E90A 1ZGUB 2BYEA 2RR9A 1QF6A 2K39A 2A4ZA 1TY2A 4GU2A 2B76B 2I38A 3HVDA 2JXTA 2LZ6A 3VFKA 4XC2A 2KMCA 3NS1A 4WJQA 4HJGE 5BMIA 2J7QB 2KYWA 3H7SA 3P4SB 3DBHI 1CQVA 2KTRB 2JSVX 3MFGA 2BYVE 2DYOA 2WYQA 3AEAB 2ZCCA 2LHEA 3I57A 2A5UA 2XN9C 1K53A 2L3ZA 1QLBB 4LNOA 4MH8A 2W82A 4WAFA 2V4IB 3OWEB 3KUDB 2INNE 2WXKA 1HZ6A 4K3CA 3LB8C 3VTVA 3U52E 5TSSA 4AS1A 1V97A 5C2TB 1J7BA 4M01A 1C79A 1KFYB 2LWPA 4YSYB 4US9A 1CMXB 2FCQA 3Q8EA 1DOYA 1KLUD 2X38A 5HKHA 1XCQL 2BKRB 1KLGD 2WU5B 4ZRPA 3NVYA 4DDID 1VCBA 4C7ZA 3PPAA 1JRUA 2GBKA 1YQ4B 3ZLZA 2C5LC 1IGDA 1IYFA 2W54A 2KWDA 2JF5A 4FULA 3DQVA 3N32A 1E9MA 1XF5L 2KXJA 1KH0A 3R2IA 3AE8B 1UNSA 1EU3A 1TJEA 4KZ0A 1DOIA 4ZRKA 2BF8B 3WALA 4HXDA 2O6VB 1WSPA 3TEWA 2WGSA 1E8XA 3AE9B 1VD2A 1GJZA 1MFWA 4ICUA 1D4BA 2XK5A 2D3GA 2DLBA 3PRPB 1WGYA 3Q8CA 2GB1A 2QIEB 4WQOB 4II3B 3N1XC 4A90A 1OEYJ 3MHSD 3Q8FA 3VTUA 2ZNVB 3DDCB 4MJSA 1MG8A 1TYGB 4HEA1 1LM8B 5IN7A 4NJ7A 3SFEB 4KGSA 2V3NA 2KVRA 2JZPA 5J17A 1N60A 2LD9A 3DVNU 2D5GA 1QT9A 3MHZA 4P6VF 5BMHA 2JPHA 2BPSA 4G50A 2JY6A 1G6JA 1V86A 1UWXA 5D2MB 4XGAB 1TKYA 3HUIA 4RGOS 1ESFA 4JE3B 5AZGA 2FIDA 2LXAA 4NAWB 1GB1A 3ECIA 1I4XA 4KGRA 1IUEA 3NRZA 1YX5B 3NZUA 3AI5A 4N59A 4AUQC 4ZYNA 1YN5A 3KQ4A 4A8XC 3V6CB 2JWZA 4LNKA 4EZKA 4MH0E 3N30A 4NAMA 3ENEA 2MP2A 2V4LA 4N9F4 2EKIA 4HVBA 1AW7A 1WRDB 1FMAD 2D11A 3QAQA 3CF6E 4USAA 1RRBA 2QJLA 1I42A 5C23A 3H8HA 1C77A 3EUB2 3Q6BA 4BAXA 4JWUC 2YEPF 2LJIA 3PS6A 1MG4A 3A9JB 1YN4A 3ZIMA 2KTFA 3WAMA 2XBBC 2JRIB 4YTPB 2WXFA 5LNK1 5BMGA 4QAYA 4ZOHC 1WXQA 2WX0A 3N3KB 2PE9A 3ZTDA 4RCOA 2Y5PA 1YD8U 3NG0A 3GE3C 2KC2A 3RNBC 2FUHB 1D5MC 2WDTB 3D32A 3M63B 2WU2B 2INDC 4OZBA 3EFUA 1D3ZA 2M8SA 5D3IB 4C7YA 3TSSA 3NHEB 1VZ6A 2J42A 2BGFA 3APFA 1J19A 1EUVB 4K7UA 3QK0A 5I4DA 2O2VA 2JRHA 4W9KA 3BZDB 2KO3A 1UGJA 3NZ3A 4IWPA 3ONSA 3EA6A 2J0MA 4RM9A 5BYSA 2LGIA 2QEJC 1C3TA 1TS4A 4RGNA 4NY0A 3L08A 3U2SC 4MELA 2MBOA 2K6QA 3LJ3A 4W9FA 4A6QA 5EDSA 1Y8RC 2LFIA 2BS2B 4LDTD 3AEDB 4ANVA 2LUMA 3GS2A 3FILB 4US8A 1UWMA 4AQ7A 2LASA 2KANA 1GPXA 1ZE3D 2K5PA 3IAS1 1IP9A 4K1RB 2ZPYA 1N63A 3WA0A 1GNUA 3DVGX 2MQJA 3A9KA 3RYTA 5E6JA 4MGYE 4JQWC 1L6VA 2KOXA 1E8ZA 3AECB 1R7SA 1QOFA 1P7FA 2C60A 1ZDVA 2L0FA 2Z0DB 3N9YC 1SE3A 2L7RA 2AEHA 5LLIA 1Q0WB 3ML8A 2N1VA 4BVUC 1Z5SB 2PVGC 4HCNB 3SFDB 2DAFA 3KVFB 4W9IA 4GDLB 2JX5A 1RYJA 5IA7A 3S2AA 4H2AA 4IC7B 3DBSA 1MJDA 2YEPB 3EHVA 2KK8A 2ZVOA 1BUIC 3V60A 3RUIB 5AZFA 2BYTA 1L5PA 2IY0B 1R4NB 4BZAA 1T3QA 4EZLA 4HROA 4PS3A 1SF0A 3ZO5B 4M0WA 4LTUA 3FAHA 3DWMA 2K22A 2BTEA 4WH4A 3I3TB 2KT7A 3PSEB 3SDLC 1V8CA 5KHOA 1F52A 4DDGD 5G2NA 2NPTA 1H7XA 4GSWA 3A4SC 3P1MA 2LVQA 4C80A 1GUAB 4D2KA 4JGHB 2BS3B 3O65B 2HD5B 1OEYA 4MGZE 5HI1A 3MC9A 4BBNF 1C4AA 3I9V1 1FNWA 2DBYA 3VQIA 1QOBA 1XXGA 3R2TA 1JMLA 2W9NA 4IWQA 3IT4B 2V3SA 2YLMA 3PTFC 5DPRA 2FCMA 4JX1C 4OHJA 5D94A 1NVID 1GTEA 2D3BA 3AEGB 2BS4B 1NENB 2RD0A 2Z59B 3EC8A 1HQRD 5H8YE 2WQYB 4TV3A 4NQKE 2JWUA 3RNAC 2PJHA 1L0YB 2KWCA 3V6EB 3SU8X 2DWQA 5FKAC 1D6EC 2LRWA 3NOBA 3SEBA 4NJ6A 3TEYA 3B1LX 2Y3AA 3R3MA 2WXOA 1WIAA 3PRZA 5DCNA 2WP9B 4ANUA 1QKZA 3V05A 4ZHOA 4RNAA 4RMAA 5G55A 1STEA 1PGXA 2FCNA 3IT6B 5IAAC 2KMAA 1TTNA 3LXFA 2KMMA 4LJPB 2WXNA 3HIZA 2MBQA 4E71A 2DAJA 2DHZA 3OLMD 3Q3FA 2HDEA 3TCAA 2RDGA 4GXBA 4AJYB 3A1QB 3T3NA 4RFBA 3ZYYX 1R4MB 5FR3A 3ALBA 3UIPB 1PYWD 2IJ0A 4URKA 1YQBA 4XE0A 1P7EA 2LVOA 4B0MA 1OQQA 1A5RA 3SD5A 1HZ5A 2QC8A 2IO0B 2BQQA 3BVZA 4L2YA 2G4SA 3DBLB 2LGXA 2AQ1B 3P2BA 2Y5BB 1EO6A 3PHXB 3ABVB 1ROEA 3LYYA 5J18A 1Q10A 5BYRA 3DOWA 2DZKA 3OJ4B 2KX0A 4RM8A 4ZRQA 2CHXA 4BKGA 4GDKA 1WJ4A 2L0TA 1FO4A 1B1ZA 2JYEA 4M8MA 4W9HA 4RH6A 1WJ6A 3DVGY 3AE4B 2IGDA 3U30A 2QDFA 4K3BA 4ZRJA 5E6NA 2J0KA 2GBJA 1FXIA 1KTKA 3IVFA 2R2QA 4GN1A 1WF9A 2QILA 1V49A 4HDOA 2AWTA 3O13A 1WRIA 1YJJA 1HTOA 5BO4B 4EEWA 1CZPA 4R3DA 1M4VA 4F7ZA 3WAOA 1FEHA 4IUMB 1RM6C 1QQRA 3WIMA 3CWIA 1YJIA 5AUIA 4XWTA 2FAZA 2QCZA 4LNNA 1LO5D 3AE6B 2ZNVC 5DPWA 2BWFA 3Q3JA 4C00A 4KV2A 3VAWA 2V1YA 1NDDA 4W9GA 1UUPA 1ZXHA 4A20A 2KKCA 2R61A 4IDIA 4TSSA 1FXTB 1YIWA 1EF5A 2AL6A 1E8WA 3BY4B 2OHFA 1YQ3B 2RPVA 2NTTA 2IY1B 2WXIA 2MLBA 1J8CA 2ON8A 1WMHA 1GC7A 4MJSB 1FRRA 1SGHA 4WWOA 3GE8C 5D7GA 2W55A 1JWMD 1WR1A 3VRBB 4P1CC 3ETRA 2HJ1A 5CX3A 3U4EG 3AN1A 5E6PA 4WJOA 4BFRA 1WJNA 1CK1A 1EF1A 2VH2A 1R4NI 2IBIB 2NCNA 3X23A 5JHBA 1HEZE 4CQNA 2CHWA 4W9EA 1IBXB 4TQ0A 1RFKA 3Q3NC 3KWVA 4DXAB 4KZCA 2FNJB 3ZW3A 3TL5A 3DHHC 1NBFC 3DPDA 4JLCA 3AMZA 1GTHA 3RD2A 1U4AA 4TKNA 3KLSX 3BK1A 1XCTL 1FNUA 2N1WA 5GXGB 1SJED 1D5ZC 2EMSA 4F8CB 4KSLC 2BWES 1V1PA 3DWGC 1N5XA 4DHJD 2MP2B 2N4FA 2IYDB 4EOYA 1ENFA 3FKYA 1SE2A 2JZ3B 1ISNA 1FCLA 1N62A 5IOIA 2G4DB 4I6PA 1WGDA 1V80A 2LVPA 3W9CB 3TJPA 3E9SA 2LI5A 2M4NA 2ZVNA 1JQ4A 3R7QA 4HLEA 4C4VA 1P0RA 1E5WA 1I4RA 2IGGA 3ZNID 3PRMB 2JT4B 1LQBA 4GIVA 3P4RB 3SR6A 4KKIA 2FUG1 2KN4A 2JYTA 4YTMB 4C56C 3QARA 4KIKA 3N1YC 1UF0A 2L1AA 3VTWA 3GZNB 3ZXRA 2O2VB 4HPLB 2ZZPB 1K8RB 2JVCA 2BKFA 1VR9A 1P3QU 4XWWA 4N58A 1K50A 3BYYB 2JXXA 1ZXIA 2MA9B 4ZRIA 2DYMA 2M19A 2EMTA 2M17A 1M94A 4PT5A 1SIJA 3ML9A 2WXHA 2PVOD 3DBLI 2VZKB 2MSED 3RFZB 3AB5A 4FJVB 1FXAA 3APCA 1UH6A 3VR8B 4IKGA 2HTHA 3A9KB 2MBBB 1TKGA 1FCCC 5JHAA 3UGBB 3KH0A 1JWSD 4IG7B 4ACFA 1V1OA 2OEDA 1MI0A 4FBJB 2FIFA 2PMVA 4M8NA 3AEFB 4G3XB 4JWSC 2GOWA 3ZRFA 5LXHA 1WZ3A 3HM6X 1OFFA 4XDCA 3VRAB 1FRDA 4NZLB 1X1MA 4YSZB 2MWSB 1ZW7A 1QILA 1YN3A 3BWUD 1BXTA 3LDZE 2BT6A 2BYFA 3B2GA 3A33B 5L95C 4OW0A 2LGYA 3KUCB 4W9LA 2LGDA 3PZ7A 2GBRA 1VDVA 4M0WB 1NEKB 2L00B 4HCPB 1FM0D 1GT8A 3OJ3A 2KC1A 3W5VB 3HVZA 4KDIC 2KLGA 1HTQA 4I6NB 3AU4A 3H7PA 2CKHB 2I1KA 2KWUB 3UQAA 1RFAA 3L13A 1WZ0A 1EM7A 2PLPA 4J6IA 4CO7A 3V62A 4WWNA 2LMCA 4BOSC 3PV1A 2XNAC 3NVWA 1GB4A 1VJKA 4EUTA 3M3JA 1WX7A 4KDLB 2LEKA 4MGIE 2J52A 1VLBA 2IDYA 3BVGA 1WXAA 1QOAA 4A55A 2L8JA 2RGFA 3W5UB 2G9HD 3BVMA 4LNIA 1QOGA 3WCQA 1WWTA 5HG2A 4MEMA 1JALA 2H88B 1T5XD 4IM3A 1TS3A 2K3UA 4P1BC 3ZJUA 1DGJA 1SXTA 3ZQ4A 2UYZB 4A3OA 2BW2A 1WX9A 2G3QB 1WYGA 1K52A 1T0RC 3P4PB 2CJNA 4AP4C 2KDFB 1Z2MA 2WXGA 5J2RA 4RF0A 3VH4B 4OVUA 1TZOA 2QHOA 2KACA 2AQ3B 1WFYA 1TZ1A 2LJ5A 3ZJVA 2CHZA 1J7AA 1JWAD 4OZCA 3L54A 3JW0X 2KJ6A 1OTRB 3BINA 4EZJA 3A4RA 4HRSA 1SSNA 2KZRA 1SEBD 3AEBB 2HTME 2KHWB 1I4HA 3I5JC 1K51A 1AYFA 3DCGA 2WXMA 4MGKE 1PDXA 2KFKB 2OOBB 3C19A 3ZJTA 4IW0A 1SB3C 2GMIC 4ANWA 1JCKB 3T3OA 4I6LB 4ANXA 5E6OA 3B2FA 1C9FA 2M0AA 1WGGA 3KW5B 1F9JA 1I7HA 3N20C 4LNFA 2Y5CA 4E3CA 4PS7A 2NBWB 4BBNC 5IKCM 5IP4D 1H4RA 1S1QB 1T0YA 3B08A 1ZP0B 4S17A 2E6XA 4HDQA 5CHWA 2IO3B 4XYCA 2O6VD 3H1UA 2CR5A 3B0AA 2NBUA 3W1YA 1OGWA 2Z8LA 3VVWB 1PGAA 1XLNA 2K8HA 2KQ4X 1OQRA 3Q8BA 1L4DB 3HHMA 2LXCA 2MW5A 3JSVA 2KWVB 5LXIB 1BMLC 3HRDD 4TMAB 3AE5B 3AE7B 4DQOC 1FPYA 2CS4A 4ZHPA 3N1ZC 2EELA 3V61A 1UELA 2GBMA 3HK0A 4LJOB 1D5XC 2ICIA 3RPFC 1Q1OA 3PZ8A 4B6WA 4GMVA 1VZ7A 2CJOA 3AE1B 4FLHA 2J0JA 3VUYA 4EE2A 4B95A 4WWMA 3L16A 2KN5A 2QSDA 4YSXB 2PTLA 2NR2A 1C76A 2L83A 4DHZB 1WX8A 2LUEA 3NUHB 2KAJA 3RNGC 3UIOB 3U8ZA 2AQ2B 2WLBA 4LDTB 3VH3B 4HKQA 1E10A 1KF6B 1WGRA 3TUOA 1V6EA 1WM3A 2RDBC 2KQSA 4FJZA 1KOTA 3VDZA 1ZPSA 3FC4A 5T8IA 5L83A 2YVCA 4PS8A 1WMHB 1BT0A 4YL8A 4FHJA 2K25A 1RWSA 4F1SA 2NMQA 1F0ZA 2WWZA 4FHKA 2C7HA 2N0SB 4MDKE 2M1MA 4PYUA 4MACA 4AWJA 1L4ZB 3ZDMC 2KNBA 2MEKA 4MM3A 2M56B 2MJEA 1WE7A 3L10B 4GGQA 2GRIA 1QZEA 3SHQA 1J0GA 1LXDA 5G5HA 4KSKC 1J7CA 3T8MA 3ZVVA 1TKEA 1JWBD 4PK1A 2VRRB 4XZ4A 4OZAA 3RNFC 1PQSA 4FXCA 2RDHA 4ICVA 3RCZA 3AV8A 2AX5A 2N9XA 5AEKB 3TEZA 4NPNA 1V1PB 3URYA 2D3CA 3EECA 2XK5B 4XX5A 4HJKA 3GOEA 1V81A 3NY5A 1AARA 2N7EA 3MJWA 3JYUA 2D10A 1I4QA 3PO0A 1H7WA 3ZNHB 5D3DA 2H89B 5CTRC 5JXVA 4FN2A 4X57B 2OJWA 1KLVA 1ZKHA 4DK5A 5MPOA 5HHDG 2DNFA 2ZCBA 3RZFA 3K9PB 2J53A 2BBCA 2DYBA 2SAKA 1N61A 1SE9A 1JWUD 4K7WA 1TS5A 2KFJA 3ZDTA 1EWYC 4WAAA 2MJ3A 1UGMA 4ARCA 2KDIA 4RGTA 4C4VB 1V9JA 1ZOYB 2RSUA 3Q3MC 5TR5A 2PEAA 5CHVC 2KDMA 2MJDA 4JL9A 3AEEB 1IGCA 2OJRA 1EU4A 2FCSA 4G11A 4JPSA 3BIID 3ZXVA 3IAM1 2KJHB 4KIKB 3GP7A 2L52A 3H9DA 1WE6A 2UU7A 1WR6E 1WXVA 3TEXA 2LHDA 3RULA 2C7MB 2WXPA 3MTNB 3AH7A 4NNJB 3W1SA 1XQQA 2ZW1A 2V3PA 3AXCA 3MC8A 1FD6A 5EE1A 3RZWC 2FBWB 2KTRA 3RN9C 2V0GA 3HM3A 2WDVB 3U7DA 4WQMA 2ONQA 1P9DU 3UF8A 3J9CA 2KLCA 1E6EB 3CF4A 1WXMA 4A9AA 2I2YA 5G5GA 1SE4A 2MX2A 4W9DA 2BB6A 1T6BX 3KWLA 3E56A 1SIFA 2G1EA 4W9CA 2RPQA 1PUTA 4DBGA 2KJRA 3MC0B 4GLSC 4YTNB 4M00A 3ZKJC 3QQ8B 1S3SG 1JW9D 3IXSA 4HK2A 1WXSA 1IBXA 3KUZA 1MVKA 5H92C 1L0VB 1NYRA 1RLFA 3R7RA 4OVVA 1HE8A 2TSSA 1T0QC 3T9LA 2JU6X 3WANA 1E0ZA 2JZZA 3NZSA 1Q5WB 3P63A 2D07B 1HA5A 4II2B 1R4MI 2O6VA 3JVZX 2GLSA 2IPKD 2KDBA 1KJTA 4ZYSA 1MPEA 1YNTE 4HWIB 4B0EA 3DHIC 1NI2A 1FFUA 3VR9B 2I1JA 4G0NB 5CHFA 4N6EB 4WJNA 2JUOA 2IO2B 3QCAA 1XLPA 4LLGM 2K0PA 2W3SA 3VUWA 3QIJA 4CYEA 2V9HA 4Q2JA 3AE2B 4AJWA 1V5TA 2MCNB 2XEWA 3H7PB 2REXA 4FJYA 3PZDA 1PGBA 4MSMB 1NI3A 2N9EB 1F2RI 3EFCA 4S0RA 2G45B 4RGMA 2PE6B 3PREA 2KDEB 3NS8A 3ZNZB 2PPHA 1T0SC 1YMHE 1EWCA 3IHPC 2E3TA 2WXJA 1MHHE 2D2QA 4NAWA 1Y56A 3P42A 1RAXA 1V5OA 4BKTA 3PT2B 3CSTA 3BYTB 4M02A 2DX5B 4O1NA 2NS5A 3IFWB 1E7VA 1LGRA 1L7YA 1B9RA 4BKSD 1V2YA 4UDUC 5AZHA 4KX6B 3KYDD 2ACZB 3CMMB 3TMPB 2K6DB 1OQYA 2J4XA 4BOZB 3VUXA 1WGHA 2INPE 1N6ZA 3KYCD 5EE3A 3DBRB 5C3JB 5EE9A 3AU5A 1C4PA 1DYQA 4YXDB 1H8CA 4IM2A 3A9JA 3OG5A 3I63C 1L2NA 2NPTB 1UD7A 2IO1B 2ZJDA 1E7PB 4AOFA 2GBNA 1FIQA 2L32A 5KHQA 1GAQB 1TS2A 4CHKA 2ZEQA 2UWQA 4IM0A 1VZ8A 3M62B 2FE8A 1TY0A 2GI9A 4KGTA 1XT9B 2Q5WD 3RT3B 1L6UA 3Q14C 4B9KA 2ZPNA 3DBHB 3K9OB 3L17A 2INCC 2N7DA 1ZUD2 3L0WB 3RNCC 3M95A 2N7JA 3X0WA 4DHJB 3ZTCA 1WY8A 2IZVB 3AE3B 1P1AA 3DHGC 1FNVA 4KVGB 1N5WA 3R8BA 2DZJA 4ASWC 1XEEA 2PKOA 1LFDA 2AYOB 5EE0A 1AN8A 3NVVA 2L76A 2QMTA 3B9JA 4LCDE 2KD0A 1PFDA 4XDDA 4DXFA 1TGZB 4WURA 3ZGZA 2PW9A 2C9WB 2D3AA 2WX1A 1XLOA 3GB1A 1E8YA 2NBVB 1YX6B 3FILA 4K81A 2BVCA 1WH3A 4KKJA 3MJ5A 1C4CA 2C7NB 3JSVB 2HJ8A 1NYQA
chains in the Genus database with same CATH topology
4C7YA 1ZPSA 3DWGC 1N5XA 3TSSA 3FC4A 5T8IA 1VZ6A 2J42A 1HXYD 1L0XB 1ENFA 1JRPA 2WXQA 1RWSA 5I4DA 2NMQA 2WXLA 1F0ZA 1SE2A 3BZDB 2N0SB 3NZ3A 1UGJA 1FCLA 1N62A 3EA6A 1F2RC 4MT5A 4MACA 5BYSA 2LGIA 4L1BA 1L4ZB 2QEJC 1TS4A 4RGNA 2MEKA 3UI3A 3U2SC 3W9CB 3P4QB 2M56B 4L23A 3AM9A 3E9SA 2MJEA 4A6QA 2GRIA 2LFIA 2BS2B 5G5HA 1JQ4A 3AEDB 4P16A 1J7CA 1TKEA 1JWBD 2LUMA 3GS2A 3FILB 4US8A 3BK2A 4OZAA 1UWMA 4AQ7A 4IOIE 4FXCA 1GPXA 2BB5A 2RDHA 1ZE3D 3AV8A 2AX5A 1I4RA 2K5PA 2IGGA 3TEZA 3IAS1 1V1PB 3P4RB 3URYA 3SR6A 3Q8AA 1N63A 4GDKB 2FUG1 4KKIA 3W2DA 4NJCA 2KN4A 2JYTA 4YTMB 4C56C 5E6JA 1MHXA 2WDQB 1L6VA 1XO3A 2L1AA 3U7ZA 1I4QA 3AECB 1R7SA 2WNMA 3PO0A 1H7WA 5D3DA 2H89B 5JXVA 1QOFA 4WIPA 1P7FA 1VR9A 5MPOA 5HHDG 1ZDVA 1C78A 1CJEA 2J53A 5FK9C 1I4PA 1SBBB 2BBCA 2SAKA 1F77A 4XWWA 3Q69A 3N9YC 4N58A 1K50A 3BYYB 1N61A 4MM3B 1SE3A 1JWUD 3C8YA 1ZXIA 1TS5A 4J3OD 1VRAB 1ZDXA 1EWYC 2PVGC 2MJ3A 3L4PA 3SFDB 2DYMA 4HKZE 1I4GA 2M19A 4ARCA 4ARIA 4GDLB 2JX5A 1RYJA 1GOZA 4H2AA 4RGTA 2IGHA 4PT5A 1SIJA 2YEPB 1ZOYB 2WXHA 2WXRA 2PVOD 1BUIC 1FFVA 2KDMA 2MJDA 2BYTA 3AEEB 1L5PA 1IGCA 3MP9A 4RF1A 1T3QA 1A70A 2VZKB 4HROA 1EU4A 3NVZA 3RFZB 1SF0A 3AB5A 1FXAA 5BYQA 4JPSA 3BIID 3VR8B 2CU3A 4IKGA 1ET6A 2N9KA 2N9LA 4M0WA 3IAM1 4LTUA 4OVZA 1TKGA 1FCCC 3DWMA 3GP7A 2K22A 3FAHA 3V3XA 2L52A 2BTEA 4WH4A 1ACCA 4ITKA 4LK0M 3EGRA 1JWSD 1V8CA 1V1OA 3TEXA 2OEDA 2LHDA 1WGKA 1H7XA 1MI0A 2WXPA 3AH7A 3W1SA 2PMVA 3P1MA 2ZW1A 3AEFB 2V3PA 4C80A 2NTSA 4D2KA 1FD6A 5AUKA 5EE1A 2BS3B 4JWSC 2FBWB 1XLQA 5HI1A 1C4AA 3I9V1 2V0GA 1FNWA 2WDVB 2DBYA 4WQMA 1OFFA 2ONQA 2SEBD 4XDCA 3VQIA 1DOXA 3VRAB 1QOBA 4YT0B 1FRDA 1XXGA 3R2TA 4NZLB 1JMLA 4YSZB 2JQRB 2WS3B 3J9CA 3IT4B 4DXGA 1E6EB 2K9XA 1QILA 3CF4A 1YN3A 4A9AA 2I2YA 2VZKD 4JX1C 4OHJA 4REZA 1SJHD 2MH7A 1NVID 1GTEA 1BXTA 3BWUD 4TQ1A 5G5GA 1SE4A 2BT6A 2WDRB 3B2GA 2BB6A 1JROA 3AEGB 2RMMA 5HFYA 2BS4B 1T6BX 4OW0A 3KWLA 1NENB 3E56A 3PZ7A 1HQRD 1VDVA 2W3RA 2WQYB 5H8YE 3CIRB 2G1EA 2JWUA 1NEKB 1KRHA 1L0YB 1PUTA 1FM0D 1GT8A 1AWDA 3W5VB 2ZW0A 2DWQA 5FKAC 1D6EC 3SEBA 1ET9A 4GLSC 3MC0B 3HVZA 4YWGG 2PIAA 4YTNB 3TEYA 2Y3AA 1QF6A 2WXOA 1TY2A 1JW9D 3IXSA 2B76B 2I38A 3HVDA 1IBXA 1EM7A 1MVKA 2JXTA 5H92C 1L0VB 2PLPA 2WP9B 1NYRA 3NS1A 1QKZA 4HJGE 5BMIA 2LMCA 3V05A 4ZHOA 4RNAA 2XNAC 3NVWA 3P4SB 2TSSA 1CQVA 2JU6X 1GB4A 1STEA 1VJKA 2JSVX 1PGXA 3MFGA 3IT6B 1E0ZA 2DYOA 3AEAB 2LHEA 3I57A 3LXFA 3P63A 2KMMA 1HA5A 1K53A 2WXNA 2XN9C 2LEKA 2J52A 1QLBB 1VLBA 4MH8A 2IPKD 2W82A 2V4IB 4WAFA 2IDYA 2HDEA 3OWEB 4ZYSA 1MPEA 1YNTE 2RDGA 3BVGA 2INNE 1QOAA 4A55A 4B0EA 2WXKA 1HZ6A 3T3NA 3LB8C 3W5UB 4RFBA 2G9HD 3U52E 3ZYYX 5TSSA 4AS1A 1V97A 5FR3A 3BVMA 5C2TB 1FFUA 3VR9B 1QOGA 3WCQA 1WWTA 5HG2A 1J7BA 1JALA 1C79A 1KFYB 4N6EB 1PYWD 2IJ0A 4YSYB 1XLPA 4LLGM 4US9A 2H88B 2K0PA 2W3SA 1T5XD 3Q8EA 1DOYA 1TS3A 2K3UA 4XE0A 1P7EA 1KLUD 3ZJUA 4B0MA 1DGJA 1SXTA 2X38A 4Q2JA 3ZQ4A 3AE2B 1XCQL 1OQQA 1KLGD 2BW2A 2WU5B 4ZRPA 3NVYA 1WYGA 1K52A 1HZ5A 3P4PB 2CJNA 3BVZA 4C7ZA 4L2YA 2AQ1B 2WXGA 1YQ4B 1PGBA 1IGDA 3ABVB 1NI3A 1ROEA 1F2RI 2W54A 2KWDA 3LYYA 4RF0A 1TZOA 4RGMA 1E9MA 2KACA 2AQ3B 1XF5L 1Q10A 1KH0A 5BYRA 3R2IA 3AE8B 3ZJVA 1UNSA 1EU3A 1TJEA 1J7AA 1JWAD 4OZCA 1YMHE 1EWCA 1DOIA 2E3TA 2WXJA 1MHHE 4ZRQA 1Y56A 1WSPA 3P42A 3TEWA 3AE9B 4HRSA 1D4BA 1SSNA 1SEBD 1FO4A 3BYTB 3AEBB 1B1ZA 2HTME 2JYEA 2DLBA 1I4HA 4O1NA 1K51A 3Q8CA 2GB1A 4RH6A 1AYFA 2QIEB 3AE4B 2WXMA 2IGDA 4A90A 1B9RA 4UDUC 1PDXA 3Q8FA 4KX6B 2ACZB 3ZJTA 1TYGB 1FXIA 1KTKA 4HEA1 2J4XA 1SB3C 2INPE 1JCKB 2QILA 3T3OA 3SFEB 4KGSA 3O13A 5EE3A 1WRIA 3B2FA 1C9FA 5C3JB 2V3NA 2M0AA 1YJJA 2JZPA 1N60A 5EE9A 1I7HA 2Y5CA 1C4PA 1CZPA 2D5GA 1M4VA 4R3DA 1QT9A 1DYQA 3MHZA 4P6VF 4YXDB 5BMHA 1FEHA 1RM6C 1QQRA 1UWXA 3CWIA 1ZP0B 1TKYA 1YJIA 2E6XA 4XWTA 5AUIA 1E7PB 3HUIA 1LO5D 4RGOS 3AE6B 1ESFA 1FIQA 4JE3B 2L32A 1GAQB 1TS2A 2Z8LA 4NAWB 1GB1A 1PGAA 1XLNA 1VZ8A 1UUPA 1ZXHA 2FE8A 1I4XA 1TY0A 4KGRA 2GI9A 2R61A 4KGTA 4IDIA 1IUEA 4TSSA 3NRZA 2KQ4X 2Q5WD 1OQRA 4N59A 1L6UA 3Q8BA 1YN5A 1L4DB 3KQ4A 4A8XC 2OHFA 1BMLC 3HRDD 1YQ3B 4TMAB 4NAMA 3AE5B 2RPVA 3AE7B 2NTTA 4DQOC 2WXIA 1ZUD2 2EKIA 2ON8A 1AW7A 4ZHPA 2N7JA 2EELA 1FMAD 1FRRA 5D7GA 4USAA 3AE3B 2W55A 1JWMD 2QJLA 3VRBB 1FNVA 3ETRA 1N5WA 3H8HA 1D5XC 2ICIA 3R8BA 3RPFC 1C77A 3EUB2 3PZ8A 1XEEA 2PKOA 4JWUC 3U4EG 3AN1A 2YEPF 1VZ7A 5EE0A 1AN8A 2LJIA 3NVVA 2CJOA 2QMTA 3B9JA 3AE1B 1PFDA 1CK1A 4XDDA 1YN4A 4DXFA 4WURA 1HEZE 3ZGZA 4CQNA 4EE2A 1IBXB 4YTPB 2PW9A 2WXFA 4WWMA 4TQ0A 1RFKA 5BMGA 5LNK1 2QSDA 3KWVA 4YSXB 2PTLA 4ZOHC 1WXQA 1C76A 1XLOA 2L83A 3NUHB 2KAJA 3GB1A 2AQ2B 2WLBA 3AMZA 3FILA 4RCOA 2Y5PA 1GTHA 4HKQA 1E10A 1KF6B 4KKJA 3TUOA 3MJ5A 3KLSX 1D5MC 1C4CA 3BK1A 1XCTL 2WU2B 1FNUA 4OZBA 5GXGB 1SJED 1D5ZC 5D3IB 1V1PA 1NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVW A;  4C7Y A;  3P4S B;  3DWG C;  1N5X A;  3SFE B;  5EE3 A;  1WRI A;  1SIJ A;  3B2F A;  5C3J B;  1VJK A;  1E0Z A;  1YJJ A;  3FC4 A;  1ZOY B;  1N60 A;  3AEA B;  5EE9 A;  2PVO D;  1I7H A;  1DOX A;  1FFV A;  2Y5C A;  3LXF A;  2MJD A;  1CZP A;  2KMM A;  3P63 A;  3AEE B;  1QT9 A;  4P6V F;  1L5P A;  2LEK A;  4YXD B;  1JRP A;  1T3Q A;  1A70 A;  4HRO A;  1QLB B;  3NVZ A;  1SF0 A;  3AB5 A;  1VLB A;  1FXA A;  1RM6 C;  1RWS A;  1F0Z A;  3CWI A;  3BII D;  1ZP0 B;  3VR8 B;  1TKY A;  1YJI A;  2CU3 A;  5AUI A;  1E7P B;  1QOA A;  3HUI A;  2N0S B;  4LTU A;  3AE6 B;  1TKG A;  1N62 A;  3LB8 C;  3W5U B;  1FIQ A;  3FAH A;  3DWM A;  3ZYY X;  2K22 A;  2L52 A;  1V97 A;  4ITK A;  1GAQ B;  5C2T B;  1FFU A;  3VR9 B;  1QOG A;  3WCQ A;  1WWT A;  1SB3 C;  1XLN A;  1V8C A;  1J7B A;  3W9C B;  3P4Q B;  1JAL A;  1KFY B;  2M56 B;  3AM9 A;  4IDI A;  1IUE A;  2MJE A;  1WGK A;  4N6E B;  1H7X A;  4YSY B;  1XLP A;  2Q5W D;  3NRZ A;  4US9 A;  2H88 B;  1OQR A;  4N59 A;  3AH7 A;  2W3S A;  1L6U A;  2BS2 B;  5G5H A;  1DOY A;  1JQ4 A;  3P1M A;  3AED B;  3AEF B;  4C80 A;  1DGJ A;  5AUK A;  1J7C A;  2OHF A;  2BS3 B;  4JWS C;  5EE1 A;  3AE2 B;  2FBW B;  1YQ3 B;  1JWB D;  1OQQ A;  1TKE A;  1XLQ A;  3HRD D;  2WU5 B;  3NVY A;  1WYG A;  4US8 A;  3AE5 B;  3P4P B;  3AE7 B;  1UWM A;  2CJN A;  4C7Z A;  2WDV B;  4FXC A;  2DBY A;  4WQM A;  1OFF A;  1YQ4 B;  1ZUD 2;  2EKI A;  1GPX A;  4ZHP A;  3ABV B;  1NI3 A;  3AV8 A;  3VRA B;  1QOB A;  4YT0 B;  1FRD A;  1ROE A;  2AX5 A;  1FMA D;  1FRR A;  2W54 A;  4YSZ B;  2K5P A;  2JQR B;  2WS3 B;  1E9M A;  4USA A;  3AE3 B;  2W55 A;  3P4R B;  1E6E B;  3VRB B;  2K9X A;  2QJL A;  3CF4 A;  1N5W A;  3ETR A;  3SR6 A;  4A9A A;  1N63 A;  3RPF C;  4JX1 C;  3AE8 B;  3EUB 2;  4YTM B;  1TJE A;  2MH7 A;  1J7A A;  1JWA D;  1GTE A;  1NVI D;  2PKO A;  4JWU C;  5G5G A;  2BT6 A;  3AN1 A;  2WDR B;  3B2G A;  1DOI A;  3AEG B;  1JRO A;  2E3T A;  5EE0 A;  2BS4 B;  2WDQ B;  3KWL A;  1NEN B;  2CJO A;  3B9J A;  1L6V A;  3AE1 B;  1XO3 A;  3NVV A;  1PFD A;  3AEC B;  3AE9 B;  1VDV A;  1R7S A;  2WQY B;  2W3R A;  3PO0 A;  3CIR B;  2G1E A;  1H7W A;  4HRS A;  5H8Y E;  4YTP B;  2H89 B;  1NEK B;  1KRH A;  4WWM A;  1RFK A;  1FO4 A;  3AEB B;  1PUT A;  1QOF A;  4YSX B;  2HTM E;  1FM0 D;  1GT8 A;  1AWD A;  4ZOH C;  5MPO A;  1WXQ A;  3W5V B;  2DWQ A;  1XLO A;  2L83 A;  1AYF A;  1CJE A;  2QIE B;  2KAJ A;  3AE4 B;  3HVZ A;  2PIA A;  4YTN B;  1B9R A;  2WLB A;  3AMZ A;  4N58 A;  1PDX A;  1N61 A;  1QF6 A;  1GTH A;  4KX6 B;  1ZXI A;  1KF6 B;  1JW9 D;  2B76 B;  1E10 A;  2ACZ B;  5H92 C;  1L0V B;  1EWY C;  2WP9 B;  1NYR A;  3NS1 A;  2PVG C;  2MJ3 A;  3L4P A;  1TYG B;  3SFD B;  2WU2 B;  1FXI A;  5GXG B;  2M19 A;  2JX5 A;  1RYJ A;  4ZHO A;  1NYQ A; 
#chains in the Genus database with same CATH topology
 3RNE C;  3PLV A;  2KVZ A;  3NJT A;  3PLU A;  1HXY D;  1L0X B;  5FR6 A;  1JRP A;  2WXQ A;  2WXL A;  4ZDV A;  1IPG A;  1UBQ A;  4DWF A;  1F2R C;  4MT5 A;  3TBL D;  5JH5 C;  4PYZ A;  2KQ7 A;  4TUU A;  4L1B A;  3UI3 A;  2MBE A;  3P4Q B;  4L23 A;  3AM9 A;  3RI7 C;  2NVU I;  4NQL B;  5DPS A;  3WAP A;  3OAW A;  2L05 A;  1E7U A;  4GDL A;  4P16 A;  3C0R B;  3APD A;  4GB9 A;  3BK2 A;  1WM2 A;  4WWP A;  4IOI E;  2BB5 A;  3GZN I;  3IBE A;  3Q8A A;  2R2O A;  4GDK B;  3W2D A;  4NJC A;  3CSF A;  3IG3 A;  4P7I A;  3VHT C;  3RMK C;  1C1Y B;  1MHX A;  2WDQ B;  3UIN B;  1XO3 A;  3ZRC A;  3U7Z A;  4MSQ B;  2WNM A;  1WYW B;  1TIF A;  3QC8 B;  4WIP A;  1UBI A;  2K1F A;  1C78 A;  1CJE A;  5FK9 C;  1I4P A;  1SBB B;  5D6J B;  3PVL A;  1F77 A;  3Q69 A;  2N9P C;  2AL3 A;  4MM3 B;  4FAD A;  3C8Y A;  2B3A A;  4J3O D;  1VRA B;  3Q2A C;  1ZDX A;  1GC6 A;  3UQB A;  3L4P A;  1TT5 B;  4HKZ E;  1I4G A;  3W1S C;  5JZE B;  4ARI A;  1GOZ A;  2IGH A;  2HE7 A;  2KFK A;  1YJ1 A;  2WXR A;  2DZI A;  1FFV A;  4EKU A;  4E74 A;  1KM7 A;  2MRP A;  3MP9 A;  5DPT A;  4RF1 A;  1A70 A;  3NVZ A;  5BYQ A;  3PGE A;  3DVN V;  1UZX B;  2MHJ A;  2CU3 A;  1ET6 A;  2N9K A;  2N9L A;  3Q3O C;  3QWZ B;  2VH1 A;  4OVZ A;  4GOC A;  5IO9 A;  3AUL A;  2MBH A;  3V3X A;  4K7S A;  1ACC A;  4ITK A;  4LK0 M;  2WHI A;  4DHZ E;  2X8X X;  3EGR A;  4FA6 A;  2LRU A;  1YOV B;  2KX3 A;  1XD3 B;  2EKE C;  3QHT A;  1WGK A;  4HPP A;  5C1Z A;  2NTS A;  3ZNG C;  5AUK A;  1TBE A;  1WJU A;  1XLQ A;  3H6N A;  2DEN B;  3R66 C;  4WJP A;  2Z0E B;  3ZUN A;  2SEB D;  1DOX A;  4YT0 B;  4IWO A;  2DZM A;  1WI0 A;  2WS3 B;  2JQR B;  4DXG A;  2K9X A;  2LGS A;  2VZK D;  3A1Q A;  4REZ A;  1SJH D;  2MH7 A;  4TQ1 A;  3DBR I;  1F1H A;  3QX1 A;  2WDR B;  2ASQ A;  2RMM A;  1JRO A;  5HFY A;  1I35 A;  2K8C A;  3TIX A;  4HPM B;  2M0X A;  3QA8 A;  4EFO A;  2CU1 A;  3VXW A;  2K8B A;  2W3R A;  3CIR B;  5GMV A;  4A3P A;  1KRH A;  4W9J A;  1AWD A;  4BKS A;  1GG3 A;  2ZW0 A;  4JIO U;  1ET9 A;  1P98 A;  3PHW B;  4YWG G;  3QJZ A;  2PIA A;  1E90 A;  1ZGU B;  2BYE A;  2RR9 A;  1QF6 A;  2K39 A;  2A4Z A;  1TY2 A;  4GU2 A;  2B76 B;  2I38 A;  3HVD A;  2JXT A;  2LZ6 A;  3VFK A;  4XC2 A;  2KMC A;  3NS1 A;  4WJQ A;  4HJG E;  5BMI A;  2J7Q B;  2KYW A;  3H7S A;  3P4S B;  3DBH I;  1CQV A;  2KTR B;  2JSV X;  3MFG A;  2BYV E;  2DYO A;  2WYQ A;  3AEA B;  2ZCC A;  2LHE A;  3I57 A;  2A5U A;  2XN9 C;  1K53 A;  2L3Z A;  1QLB B;  4LNO A;  4MH8 A;  2W82 A;  4WAF A;  2V4I B;  3OWE B;  3KUD B;  2INN E;  2WXK A;  1HZ6 A;  4K3C A;  3LB8 C;  3VTV A;  3U52 E;  5TSS A;  4AS1 A;  1V97 A;  5C2T B;  1J7B A;  4M01 A;  1C79 A;  1KFY B;  2LWP A;  4YSY B;  4US9 A;  1CMX B;  2FCQ A;  3Q8E A;  1DOY A;  1KLU D;  2X38 A;  5HKH A;  1XCQ L;  2BKR B;  1KLG D;  2WU5 B;  4ZRP A;  3NVY A;  4DDI D;  1VCB A;  4C7Z A;  3PPA A;  1JRU A;  2GBK A;  1YQ4 B;  3ZLZ A;  2C5L C;  1IGD A;  1IYF A;  2W54 A;  2KWD A;  2JF5 A;  4FUL A;  3DQV A;  3N32 A;  1E9M A;  1XF5 L;  2KXJ A;  1KH0 A;  3R2I A;  3AE8 B;  1UNS A;  1EU3 A;  1TJE A;  4KZ0 A;  1DOI A;  4ZRK A;  2BF8 B;  3WAL A;  4HXD A;  2O6V B;  1WSP A;  3TEW A;  2WGS A;  1E8X A;  3AE9 B;  1VD2 A;  1GJZ A;  1MFW A;  4ICU A;  1D4B A;  2XK5 A;  2D3G A;  2DLB A;  3PRP B;  1WGY A;  3Q8C A;  2GB1 A;  2QIE B;  4WQO B;  4II3 B;  3N1X C;  4A90 A;  1OEY J;  3MHS D;  3Q8F A;  3VTU A;  2ZNV B;  3DDC B;  4MJS A;  1MG8 A;  1TYG B;  4HEA 1;  1LM8 B;  5IN7 A;  4NJ7 A;  3SFE B;  4KGS A;  2V3N A;  2KVR A;  2JZP A;  5J17 A;  1N60 A;  2LD9 A;  3DVN U;  2D5G A;  1QT9 A;  3MHZ A;  4P6V F;  5BMH A;  2JPH A;  2BPS A;  4G50 A;  2JY6 A;  1G6J A;  1V86 A;  1UWX A;  5D2M B;  4XGA B;  1TKY A;  3HUI A;  4RGO S;  1ESF A;  4JE3 B;  5AZG A;  2FID A;  2LXA A;  4NAW B;  1GB1 A;  3ECI A;  1I4X A;  4KGR A;  1IUE A;  3NRZ A;  1YX5 B;  3NZU A;  3AI5 A;  4N59 A;  4AUQ C;  4ZYN A;  1YN5 A;  3KQ4 A;  4A8X C;  3V6C B;  2JWZ A;  4LNK A;  4EZK A;  4MH0 E;  3N30 A;  4NAM A;  3ENE A;  2MP2 A;  2V4L A;  4N9F 4;  2EKI A;  4HVB A;  1AW7 A;  1WRD B;  1FMA D;  2D11 A;  3QAQ A;  3CF6 E;  4USA A;  1RRB A;  2QJL A;  1I42 A;  5C23 A;  3H8H A;  1C77 A;  3EUB 2;  3Q6B A;  4BAX A;  4JWU C;  2YEP F;  2LJI A;  3PS6 A;  1MG4 A;  3A9J B;  1YN4 A;  3ZIM A;  2KTF A;  3WAM A;  2XBB C;  2JRI B;  4YTP B;  2WXF A;  5LNK 1;  5BMG A;  4QAY A;  4ZOH C;  1WXQ A;  2WX0 A;  3N3K B;  2PE9 A;  3ZTD A;  4RCO A;  2Y5P A;  1YD8 U;  3NG0 A;  3GE3 C;  2KC2 A;  3RNB C;  2FUH B;  1D5M C;  2WDT B;  3D32 A;  3M63 B;  2WU2 B;  2IND C;  4OZB A;  3EFU A;  1D3Z A;  2M8S A;  5D3I B;  4C7Y A;  3TSS A;  3NHE B;  1VZ6 A;  2J42 A;  2BGF A;  3APF A;  1J19 A;  1EUV B;  4K7U A;  3QK0 A;  5I4D A;  2O2V A;  2JRH A;  4W9K A;  3BZD B;  2KO3 A;  1UGJ A;  3NZ3 A;  4IWP A;  3ONS A;  3EA6 A;  2J0M A;  4RM9 A;  5BYS A;  2LGI A;  2QEJ C;  1C3T A;  1TS4 A;  4RGN A;  4NY0 A;  3L08 A;  3U2S C;  4MEL A;  2MBO A;  2K6Q A;  3LJ3 A;  4W9F A;  4A6Q A;  5EDS A;  1Y8R C;  2LFI A;  2BS2 B;  4LDT D;  3AED B;  4ANV A;  2LUM A;  3GS2 A;  3FIL B;  4US8 A;  1UWM A;  4AQ7 A;  2LAS A;  2KAN A;  1GPX A;  1ZE3 D;  2K5P A;  3IAS 1;  1IP9 A;  4K1R B;  2ZPY A;  1N63 A;  3WA0 A;  1GNU A;  3DVG X;  2MQJ A;  3A9K A;  3RYT A;  5E6J A;  4MGY E;  4JQW C;  1L6V A;  2KOX A;  1E8Z A;  3AEC B;  1R7S A;  1QOF A;  1P7F A;  2C60 A;  1ZDV A;  2L0F A;  2Z0D B;  3N9Y C;  1SE3 A;  2L7R A;  2AEH A;  5LLI A;  1Q0W B;  3ML8 A;  2N1V A;  4BVU C;  1Z5S B;  2PVG C;  4HCN B;  3SFD B;  2DAF A;  3KVF B;  4W9I A;  4GDL B;  2JX5 A;  1RYJ A;  5IA7 A;  3S2A A;  4H2A A;  4IC7 B;  3DBS A;  1MJD A;  2YEP B;  3EHV A;  2KK8 A;  2ZVO A;  1BUI C;  3V60 A;  3RUI B;  5AZF A;  2BYT A;  1L5P A;  2IY0 B;  1R4N B;  4BZA A;  1T3Q A;  4EZL A;  4HRO A;  4PS3 A;  1SF0 A;  3ZO5 B;  4M0W A;  4LTU A;  3FAH A;  3DWM A;  2K22 A;  2BTE A;  4WH4 A;  3I3T B;  2KT7 A;  3PSE B;  3SDL C;  1V8C A;  5KHO A;  1F52 A;  4DDG D;  5G2N A;  2NPT A;  1H7X A;  4GSW A;  3A4S C;  3P1M A;  2LVQ A;  4C80 A;  1GUA B;  4D2K A;  4JGH B;  2BS3 B;  3O65 B;  2HD5 B;  1OEY A;  4MGZ E;  5HI1 A;  3MC9 A;  4BBN F;  1C4A A;  3I9V 1;  1FNW A;  2DBY A;  3VQI A;  1QOB A;  1XXG A;  3R2T A;  1JML A;  2W9N A;  4IWQ A;  3IT4 B;  2V3S A;  2YLM A;  3PTF C;  5DPR A;  2FCM A;  4JX1 C;  4OHJ A;  5D94 A;  1NVI D;  1GTE A;  2D3B A;  3AEG B;  2BS4 B;  1NEN B;  2RD0 A;  2Z59 B;  3EC8 A;  1HQR D;  5H8Y E;  2WQY B;  4TV3 A;  4NQK E;  2JWU A;  3RNA C;  2PJH A;  1L0Y B;  2KWC A;  3V6E B;  3SU8 X;  2DWQ A;  5FKA C;  1D6E C;  2LRW A;  3NOB A;  3SEB A;  4NJ6 A;  3TEY A;  3B1L X;  2Y3A A;  3R3M A;  2WXO A;  1WIA A;  3PRZ A;  5DCN A;  2WP9 B;  4ANU A;  1QKZ A;  3V05 A;  4ZHO A;  4RNA A;  4RMA A;  5G55 A;  1STE A;  1PGX A;  2FCN A;  3IT6 B;  5IAA C;  2KMA A;  1TTN A;  3LXF A;  2KMM A;  4LJP B;  2WXN A;  3HIZ A;  2MBQ A;  4E71 A;  2DAJ A;  2DHZ A;  3OLM D;  3Q3F A;  2HDE A;  3TCA A;  2RDG A;  4GXB A;  4AJY B;  3A1Q B;  3T3N A;  4RFB A;  3ZYY X;  1R4M B;  5FR3 A;  3ALB A;  3UIP B;  1PYW D;  2IJ0 A;  4URK A;  1YQB A;  4XE0 A;  1P7E A;  2LVO A;  4B0M A;  1OQQ A;  1A5R A;  3SD5 A;  1HZ5 A;  2QC8 A;  2IO0 B;  2BQQ A;  3BVZ A;  4L2Y A;  2G4S A;  3DBL B;  2LGX A;  2AQ1 B;  3P2B A;  2Y5B B;  1EO6 A;  3PHX B;  3ABV B;  1ROE A;  3LYY A;  5J18 A;  1Q10 A;  5BYR A;  3DOW A;  2DZK A;  3OJ4 B;  2KX0 A;  4RM8 A;  4ZRQ A;  2CHX A;  4BKG A;  4GDK A;  1WJ4 A;  2L0T A;  1FO4 A;  1B1Z A;  2JYE A;  4M8M A;  4W9H A;  4RH6 A;  1WJ6 A;  3DVG Y;  3AE4 B;  2IGD A;  3U30 A;  2QDF A;  4K3B A;  4ZRJ A;  5E6N A;  2J0K A;  2GBJ A;  1FXI A;  1KTK A;  3IVF A;  2R2Q A;  4GN1 A;  1WF9 A;  2QIL A;  1V49 A;  4HDO A;  2AWT A;  3O13 A;  1WRI A;  1YJJ A;  1HTO A;  5BO4 B;  4EEW A;  1CZP A;  4R3D A;  1M4V A;  4F7Z A;  3WAO A;  1FEH A;  4IUM B;  1RM6 C;  1QQR A;  3WIM A;  3CWI A;  1YJI A;  5AUI A;  4XWT A;  2FAZ A;  2QCZ A;  4LNN A;  1LO5 D;  3AE6 B;  2ZNV C;  5DPW A;  2BWF A;  3Q3J A;  4C00 A;  4KV2 A;  3VAW A;  2V1Y A;  1NDD A;  4W9G A;  1UUP A;  1ZXH A;  4A20 A;  2KKC A;  2R61 A;  4IDI A;  4TSS A;  1FXT B;  1YIW A;  1EF5 A;  2AL6 A;  1E8W A;  3BY4 B;  2OHF A;  1YQ3 B;  2RPV A;  2NTT A;  2IY1 B;  2WXI A;  2MLB A;  1J8C A;  2ON8 A;  1WMH A;  1GC7 A;  4MJS B;  1FRR A;  1SGH A;  4WWO A;  3GE8 C;  5D7G A;  2W55 A;  1JWM D;  1WR1 A;  3VRB B;  4P1C C;  3ETR A;  2HJ1 A;  5CX3 A;  3U4E G;  3AN1 A;  5E6P A;  4WJO A;  4BFR A;  1WJN A;  1CK1 A;  1EF1 A;  2VH2 A;  1R4N I;  2IBI B;  2NCN A;  3X23 A;  5JHB A;  1HEZ E;  4CQN A;  2CHW A;  4W9E A;  1IBX B;  4TQ0 A;  1RFK A;  3Q3N C;  3KWV A;  4DXA B;  4KZC A;  2FNJ B;  3ZW3 A;  3TL5 A;  3DHH C;  1NBF C;  3DPD A;  4JLC A;  3AMZ A;  1GTH A;  3RD2 A;  1U4A A;  4TKN A;  3KLS X;  3BK1 A;  1XCT L;  1FNU A;  2N1W A;  5GXG B;  1SJE D;  1D5Z C;  2EMS A;  4F8C B;  4KSL C;  2BWE S;  1V1P A;  3DWG C;  1N5X A;  4DHJ D;  2MP2 B;  2N4F A;  2IYD B;  4EOY A;  1ENF A;  3FKY A;  1SE2 A;  2JZ3 B;  1ISN A;  1FCL A;  1N62 A;  5IOI A;  2G4D B;  4I6P A;  1WGD A;  1V80 A;  2LVP A;  3W9C B;  3TJP A;  3E9S A;  2LI5 A;  2M4N A;  2ZVN A;  1JQ4 A;  3R7Q A;  4HLE A;  4C4V A;  1P0R A;  1E5W A;  1I4R A;  2IGG A;  3ZNI D;  3PRM B;  2JT4 B;  1LQB A;  4GIV A;  3P4R B;  3SR6 A;  4KKI A;  2FUG 1;  2KN4 A;  2JYT A;  4YTM B;  4C56 C;  3QAR A;  4KIK A;  3N1Y C;  1UF0 A;  2L1A A;  3VTW A;  3GZN B;  3ZXR A;  2O2V B;  4HPL B;  2ZZP B;  1K8R B;  2JVC A;  2BKF A;  1VR9 A;  1P3Q U;  4XWW A;  4N58 A;  1K50 A;  3BYY B;  2JXX A;  1ZXI A;  2MA9 B;  4ZRI A;  2DYM A;  2M19 A;  2EMT A;  2M17 A;  1M94 A;  4PT5 A;  1SIJ A;  3ML9 A;  2WXH A;  2PVO D;  3DBL I;  2VZK B;  2MSE D;  3RFZ B;  3AB5 A;  4FJV B;  1FXA A;  3APC A;  1UH6 A;  3VR8 B;  4IKG A;  2HTH A;  3A9K B;  2MBB B;  1TKG A;  1FCC C;  5JHA A;  3UGB B;  3KH0 A;  1JWS D;  4IG7 B;  4ACF A;  1V1O A;  2OED A;  1MI0 A;  4FBJ B;  2FIF A;  2PMV A;  4M8N A;  3AEF B;  4G3X B;  4JWS C;  2GOW A;  3ZRF A;  5LXH A;  1WZ3 A;  3HM6 X;  1OFF A;  4XDC A;  3VRA B;  1FRD A;  4NZL B;  1X1M A;  4YSZ B;  2MWS B;  1ZW7 A;  1QIL A;  1YN3 A;  3BWU D;  1BXT A;  3LDZ E;  2BT6 A;  2BYF A;  3B2G A;  3A33 B;  5L95 C;  4OW0 A;  2LGY A;  3KUC B;  4W9L A;  2LGD A;  3PZ7 A;  2GBR A;  1VDV A;  4M0W B;  1NEK B;  2L00 B;  4HCP B;  1FM0 D;  1GT8 A;  3OJ3 A;  2KC1 A;  3W5V B;  3HVZ A;  4KDI C;  2KLG A;  1HTQ A;  4I6N B;  3AU4 A;  3H7P A;  2CKH B;  2I1K A;  2KWU B;  3UQA A;  1RFA A;  3L13 A;  1WZ0 A;  1EM7 A;  2PLP A;  4J6I A;  4CO7 A;  3V62 A;  4WWN A;  2LMC A;  4BOS C;  3PV1 A;  2XNA C;  3NVW A;  1GB4 A;  1VJK A;  4EUT A;  3M3J A;  1WX7 A;  4KDL B;  2LEK A;  4MGI E;  2J52 A;  1VLB A;  2IDY A;  3BVG A;  1WXA A;  1QOA A;  4A55 A;  2L8J A;  2RGF A;  3W5U B;  2G9H D;  3BVM A;  4LNI A;  1QOG A;  3WCQ A;  1WWT A;  5HG2 A;  4MEM A;  1JAL A;  2H88 B;  1T5X D;  4IM3 A;  1TS3 A;  2K3U A;  4P1B C;  3ZJU A;  1DGJ A;  1SXT A;  3ZQ4 A;  2UYZ B;  4A3O A;  2BW2 A;  1WX9 A;  2G3Q B;  1WYG A;  1K52 A;  1T0R C;  3P4P B;  2CJN A;  4AP4 C;  2KDF B;  1Z2M A;  2WXG A;  5J2R A;  4RF0 A;  3VH4 B;  4OVU A;  1TZO A;  2QHO A;  2KAC A;  2AQ3 B;  1WFY A;  1TZ1 A;  2LJ5 A;  3ZJV A;  2CHZ A;  1J7A A;  1JWA D;  4OZC A;  3L54 A;  3JW0 X;  2KJ6 A;  1OTR B;  3BIN A;  4EZJ A;  3A4R A;  4HRS A;  1SSN A;  2KZR A;  1SEB D;  3AEB B;  2HTM E;  2KHW B;  1I4H A;  3I5J C;  1K51 A;  1AYF A;  3DCG A;  2WXM A;  4MGK E;  1PDX A;  2KFK B;  2OOB B;  3C19 A;  3ZJT A;  4IW0 A;  1SB3 C;  2GMI C;  4ANW A;  1JCK B;  3T3O A;  4I6L B;  4ANX A;  5E6O A;  3B2F A;  1C9F A;  2M0A A;  1WGG A;  3KW5 B;  1F9J A;  1I7H A;  3N20 C;  4LNF A;  2Y5C A;  4E3C A;  4PS7 A;  2NBW B;  4BBN C;  5IKC M;  5IP4 D;  1H4R A;  1S1Q B;  1T0Y A;  3B08 A;  1ZP0 B;  4S17 A;  2E6X A;  4HDQ A;  5CHW A;  2IO3 B;  4XYC A;  2O6V D;  3H1U A;  2CR5 A;  3B0A A;  2NBU A;  3W1Y A;  1OGW A;  2Z8L A;  3VVW B;  1PGA A;  1XLN A;  2K8H A;  2KQ4 X;  1OQR A;  3Q8B A;  1L4D B;  3HHM A;  2LXC A;  2MW5 A;  3JSV A;  2KWV B;  5LXI B;  1BML C;  3HRD D;  4TMA B;  3AE5 B;  3AE7 B;  4DQO C;  1FPY A;  2CS4 A;  4ZHP A;  3N1Z C;  2EEL A;  3V61 A;  1UEL A;  2GBM A;  3HK0 A;  4LJO B;  1D5X C;  2ICI A;  3RPF C;  1Q1O A;  3PZ8 A;  4B6W A;  4GMV A;  1VZ7 A;  2CJO A;  3AE1 B;  4FLH A;  2J0J A;  3VUY A;  4EE2 A;  4B95 A;  4WWM A;  3L16 A;  2KN5 A;  2QSD A;  4YSX B;  2PTL A;  2NR2 A;  1C76 A;  2L83 A;  4DHZ B;  1WX8 A;  2LUE A;  3NUH B;  2KAJ A;  3RNG C;  3UIO B;  3U8Z A;  2AQ2 B;  2WLB A;  4LDT B;  3VH3 B;  4HKQ A;  1E10 A;  1KF6 B;  1WGR A;  3TUO A;  1V6E A;  1WM3 A;  2RDB C;  2KQS A;  4FJZ A;  1KOT A;  3VDZ A;  1ZPS A;  3FC4 A;  5T8I A;  5L83 A;  2YVC A;  4PS8 A;  1WMH B;  1BT0 A;  4YL8 A;  4FHJ A;  2K25 A;  1RWS A;  4F1S A;  2NMQ A;  1F0Z A;  2WWZ A;  4FHK A;  2C7H A;  2N0S B;  4MDK E;  2M1M A;  4PYU A;  4MAC A;  4AWJ A;  1L4Z B;  3ZDM C;  2KNB A;  2MEK A;  4MM3 A;  2M56 B;  2MJE A;  1WE7 A;  3L10 B;  4GGQ A;  2GRI A;  1QZE A;  3SHQ A;  1J0G A;  1LXD A;  5G5H A;  4KSK C;  1J7C A;  3T8M A;  3ZVV A;  1TKE A;  1JWB D;  4PK1 A;  2VRR B;  4XZ4 A;  4OZA A;  3RNF C;  1PQS A;  4FXC A;  2RDH A;  4ICV A;  3RCZ A;  3AV8 A;  2AX5 A;  2N9X A;  5AEK B;  3TEZ A;  4NPN A;  1V1P B;  3URY A;  2D3C A;  3EEC A;  2XK5 B;  4XX5 A;  4HJK A;  3GOE A;  1V81 A;  3NY5 A;  1AAR A;  2N7E A;  3MJW A;  3JYU A;  2D10 A;  1I4Q A;  3PO0 A;  1H7W A;  3ZNH B;  5D3D A;  2H89 B;  5CTR C;  5JXV A;  4FN2 A;  4X57 B;  2OJW A;  1KLV A;  1ZKH A;  4DK5 A;  5MPO A;  5HHD G;  2DNF A;  2ZCB A;  3RZF A;  3K9P B;  2J53 A;  2BBC A;  2DYB A;  2SAK A;  1N61 A;  1SE9 A;  1JWU D;  4K7W A;  1TS5 A;  2KFJ A;  3ZDT A;  1EWY C;  4WAA A;  2MJ3 A;  1UGM A;  4ARC A;  2KDI A;  4RGT A;  4C4V B;  1V9J A;  1ZOY B;  2RSU A;  3Q3M C;  5TR5 A;  2PEA A;  5CHV C;  2KDM A;  2MJD A;  4JL9 A;  3AEE B;  1IGC A;  2OJR A;  1EU4 A;  2FCS A;  4G11 A;  4JPS A;  3BII D;  3ZXV A;  3IAM 1;  2KJH B;  4KIK B;  3GP7 A;  2L52 A;  3H9D A;  1WE6 A;  2UU7 A;  1WR6 E;  1WXV A;  3TEX A;  2LHD A;  3RUL A;  2C7M B;  2WXP A;  3MTN B;  3AH7 A;  4NNJ B;  3W1S A;  1XQQ A;  2ZW1 A;  2V3P A;  3AXC A;  3MC8 A;  1FD6 A;  5EE1 A;  3RZW C;  2FBW B;  2KTR A;  3RN9 C;  2V0G A;  3HM3 A;  2WDV B;  3U7D A;  4WQM A;  2ONQ A;  1P9D U;  3UF8 A;  3J9C A;  2KLC A;  1E6E B;  3CF4 A;  1WXM A;  4A9A A;  2I2Y A;  5G5G A;  1SE4 A;  2MX2 A;  4W9D A;  2BB6 A;  1T6B X;  3KWL A;  3E56 A;  1SIF A;  2G1E A;  4W9C A;  2RPQ A;  1PUT A;  4DBG A;  2KJR A;  3MC0 B;  4GLS C;  4YTN B;  4M00 A;  3ZKJ C;  3QQ8 B;  1S3S G;  1JW9 D;  3IXS A;  4HK2 A;  1WXS A;  1IBX A;  3KUZ A;  1MVK A;  5H92 C;  1L0V B;  1NYR A;  1RLF A;  3R7R A;  4OVV A;  1HE8 A;  2TSS A;  1T0Q C;  3T9L A;  2JU6 X;  3WAN A;  1E0Z A;  2JZZ A;  3NZS A;  1Q5W B;  3P63 A;  2D07 B;  1HA5 A;  4II2 B;  1R4M I;  2O6V A;  3JVZ X;  2GLS A;  2IPK D;  2KDB A;  1KJT A;  4ZYS A;  1MPE A;  1YNT E;  4HWI B;  4B0E A;  3DHI C;  1NI2 A;  1FFU A;  3VR9 B;  2I1J A;  4G0N B;  5CHF A;  4N6E B;  4WJN A;  2JUO A;  2IO2 B;  3QCA A;  1XLP A;  4LLG M;  2K0P A;  2W3S A;  3VUW A;  3QIJ A;  4CYE A;  2V9H A;  4Q2J A;  3AE2 B;  4AJW A;  1V5T A;  2MCN B;  2XEW A;  3H7P B;  2REX A;  4FJY A;  3PZD A;  1PGB A;  4MSM B;  1NI3 A;  2N9E B;  1F2R I;  3EFC A;  4S0R A;  2G45 B;  4RGM A;  2PE6 B;  3PRE A;  2KDE B;  3NS8 A;  3ZNZ B;  2PPH A;  1T0S C;  1YMH E;  1EWC A;  3IHP C;  2E3T A;  2WXJ A;  1MHH E;  2D2Q A;  4NAW A;  1Y56 A;  3P42 A;  1RAX A;  1V5O A;  4BKT A;  3PT2 B;  3CST A;  3BYT B;  4M02 A;  2DX5 B;  4O1N A;  2NS5 A;  3IFW B;  1E7V A;  1LGR A;  1L7Y A;  1B9R A;  4BKS D;  1V2Y A;  4UDU C;  5AZH A;  4KX6 B;  3KYD D;  2ACZ B;  3CMM B;  3TMP B;  2K6D B;  1OQY A;  2J4X A;  4BOZ B;  3VUX A;  1WGH A;  2INP E;  1N6Z A;  3KYC D;  5EE3 A;  3DBR B;  5C3J B;  5EE9 A;  3AU5 A;  1C4P A;  1DYQ A;  4YXD B;  1H8C A;  4IM2 A;  3A9J A;  3OG5 A;  3I63 C;  1L2N A;  2NPT B;  1UD7 A;  2IO1 B;  2ZJD A;  1E7P B;  4AOF A;  2GBN A;  1FIQ A;  2L32 A;  5KHQ A;  1GAQ B;  1TS2 A;  4CHK A;  2ZEQ A;  2UWQ A;  4IM0 A;  1VZ8 A;  3M62 B;  2FE8 A;  1TY0 A;  2GI9 A;  4KGT A;  1XT9 B;  2Q5W D;  3RT3 B;  1L6U A;  3Q14 C;  4B9K A;  2ZPN A;  3DBH B;  3K9O B;  3L17 A;  2INC C;  2N7D A;  1ZUD 2;  3L0W B;  3RNC C;  3M95 A;  2N7J A;  3X0W A;  4DHJ B;  3ZTC A;  1WY8 A;  2IZV B;  3AE3 B;  1P1A A;  3DHG C;  1FNV A;  4KVG B;  1N5W A;  3R8B A;  2DZJ A;  4ASW C;  1XEE A;  2PKO A;  1LFD A;  2AYO B;  5EE0 A;  1AN8 A;  3NVV A;  2L76 A;  2QMT A;  3B9J A;  4LCD E;  2KD0 A;  1PFD A;  4XDD A;  4DXF A;  1TGZ B;  4WUR A;  3ZGZ A;  2PW9 A;  2C9W B;  2D3A A;  2WX1 A;  1XLO A;  3GB1 A;  1E8Y A;  2NBV B;  1YX6 B;  3FIL A;  4K81 A;  2BVC A;  1WH3 A;  4KKJ A;  3MJ5 A;  1C4C A;  2C7N B;  3JSV B;  2HJ8 A;  1NYQ A; 
#chains in the Genus database with same CATH homology
 4C7Y A;  1ZPS A;  3DWG C;  1N5X A;  3TSS A;  3FC4 A;  5T8I A;  1VZ6 A;  2J42 A;  1HXY D;  1L0X B;  1ENF A;  1JRP A;  2WXQ A;  1RWS A;  5I4D A;  2NMQ A;  2WXL A;  1F0Z A;  1SE2 A;  3BZD B;  2N0S B;  3NZ3 A;  1UGJ A;  1FCL A;  1N62 A;  3EA6 A;  1F2R C;  4MT5 A;  4MAC A;  5BYS A;  2LGI A;  4L1B A;  1L4Z B;  2QEJ C;  1TS4 A;  4RGN A;  2MEK A;  3UI3 A;  3U2S C;  3W9C B;  3P4Q B;  2M56 B;  4L23 A;  3AM9 A;  3E9S A;  2MJE A;  4A6Q A;  2GRI A;  2LFI A;  2BS2 B;  5G5H A;  1JQ4 A;  3AED B;  4P16 A;  1J7C A;  1TKE A;  1JWB D;  2LUM A;  3GS2 A;  3FIL B;  4US8 A;  3BK2 A;  4OZA A;  1UWM A;  4AQ7 A;  4IOI E;  4FXC A;  1GPX A;  2BB5 A;  2RDH A;  1ZE3 D;  3AV8 A;  2AX5 A;  1I4R A;  2K5P A;  2IGG A;  3TEZ A;  3IAS 1;  1V1P B;  3P4R B;  3URY A;  3SR6 A;  3Q8A A;  1N63 A;  4GDK B;  2FUG 1;  4KKI A;  3W2D A;  4NJC A;  2KN4 A;  2JYT A;  4YTM B;  4C56 C;  5E6J A;  1MHX A;  2WDQ B;  1L6V A;  1XO3 A;  2L1A A;  3U7Z A;  1I4Q A;  3AEC B;  1R7S A;  2WNM A;  3PO0 A;  1H7W A;  5D3D A;  2H89 B;  5JXV A;  1QOF A;  4WIP A;  1P7F A;  1VR9 A;  5MPO A;  5HHD G;  1ZDV A;  1C78 A;  1CJE A;  2J53 A;  5FK9 C;  1I4P A;  1SBB B;  2BBC A;  2SAK A;  1F77 A;  4XWW A;  3Q69 A;  3N9Y C;  4N58 A;  1K50 A;  3BYY B;  1N61 A;  4MM3 B;  1SE3 A;  1JWU D;  3C8Y A;  1ZXI A;  1TS5 A;  4J3O D;  1VRA B;  1ZDX A;  1EWY C;  2PVG C;  2MJ3 A;  3L4P A;  3SFD B;  2DYM A;  4HKZ E;  1I4G A;  2M19 A;  4ARC A;  4ARI A;  4GDL B;  2JX5 A;  1RYJ A;  1GOZ A;  4H2A A;  4RGT A;  2IGH A;  4PT5 A;  1SIJ A;  2YEP B;  1ZOY B;  2WXH A;  2WXR A;  2PVO D;  1BUI C;  1FFV A;  2KDM A;  2MJD A;  2BYT A;  3AEE B;  1L5P A;  1IGC A;  3MP9 A;  4RF1 A;  1T3Q A;  1A70 A;  2VZK B;  4HRO A;  1EU4 A;  3NVZ A;  3RFZ B;  1SF0 A;  3AB5 A;  1FXA A;  5BYQ A;  4JPS A;  3BII D;  3VR8 B;  2CU3 A;  4IKG A;  1ET6 A;  2N9K A;  2N9L A;  4M0W A;  3IAM 1;  4LTU A;  4OVZ A;  1TKG A;  1FCC C;  3DWM A;  3GP7 A;  2K22 A;  3FAH A;  3V3X A;  2L52 A;  2BTE A;  4WH4 A;  1ACC A;  4ITK A;  4LK0 M;  3EGR A;  1JWS D;  1V8C A;  1V1O A;  3TEX A;  2OED A;  2LHD A;  1WGK A;  1H7X A;  1MI0 A;  2WXP A;  3AH7 A;  3W1S A;  2PMV A;  3P1M A;  2ZW1 A;  3AEF B;  2V3P A;  4C80 A;  2NTS A;  4D2K A;  1FD6 A;  5AUK A;  5EE1 A;  2BS3 B;  4JWS C;  2FBW B;  1XLQ A;  5HI1 A;  1C4A A;  3I9V 1;  2V0G A;  1FNW A;  2WDV B;  2DBY A;  4WQM A;  1OFF A;  2ONQ A;  2SEB D;  4XDC A;  3VQI A;  1DOX A;  3VRA B;  1QOB A;  4YT0 B;  1FRD A;  1XXG A;  3R2T A;  4NZL B;  1JML A;  4YSZ B;  2JQR B;  2WS3 B;  3J9C A;  3IT4 B;  4DXG A;  1E6E B;  2K9X A;  1QIL A;  3CF4 A;  1YN3 A;  4A9A A;  2I2Y A;  2VZK D;  4JX1 C;  4OHJ A;  4REZ A;  1SJH D;  2MH7 A;  1NVI D;  1GTE A;  1BXT A;  3BWU D;  4TQ1 A;  5G5G A;  1SE4 A;  2BT6 A;  2WDR B;  3B2G A;  2BB6 A;  1JRO A;  3AEG B;  2RMM A;  5HFY A;  2BS4 B;  1T6B X;  4OW0 A;  3KWL A;  1NEN B;  3E56 A;  3PZ7 A;  1HQR D;  1VDV A;  2W3R A;  2WQY B;  5H8Y E;  3CIR B;  2G1E A;  2JWU A;  1NEK B;  1KRH A;  1L0Y B;  1PUT A;  1FM0 D;  1GT8 A;  1AWD A;  3W5V B;  2ZW0 A;  2DWQ A;  5FKA C;  1D6E C;  3SEB A;  1ET9 A;  4GLS C;  3MC0 B;  3HVZ A;  4YWG G;  2PIA A;  4YTN B;  3TEY A;  2Y3A A;  1QF6 A;  2WXO A;  1TY2 A;  1JW9 D;  3IXS A;  2B76 B;  2I38 A;  3HVD A;  1IBX A;  1EM7 A;  1MVK A;  2JXT A;  5H92 C;  1L0V B;  2PLP A;  2WP9 B;  1NYR A;  3NS1 A;  1QKZ A;  4HJG E;  5BMI A;  2LMC A;  3V05 A;  4ZHO A;  4RNA A;  2XNA C;  3NVW A;  3P4S B;  2TSS A;  1CQV A;  2JU6 X;  1GB4 A;  1STE A;  1VJK A;  2JSV X;  1PGX A;  3MFG A;  3IT6 B;  1E0Z A;  2DYO A;  3AEA B;  2LHE A;  3I57 A;  3LXF A;  3P63 A;  2KMM A;  1HA5 A;  1K53 A;  2WXN A;  2XN9 C;  2LEK A;  2J52 A;  1QLB B;  1VLB A;  4MH8 A;  2IPK D;  2W82 A;  2V4I B;  4WAF A;  2IDY A;  2HDE A;  3OWE B;  4ZYS A;  1MPE A;  1YNT E;  2RDG A;  3BVG A;  2INN E;  1QOA A;  4A55 A;  4B0E A;  2WXK A;  1HZ6 A;  3T3N A;  3LB8 C;  3W5U B;  4RFB A;  2G9H D;  3U52 E;  3ZYY X;  5TSS A;  4AS1 A;  1V97 A;  5FR3 A;  3BVM A;  5C2T B;  1FFU A;  3VR9 B;  1QOG A;  3WCQ A;  1WWT A;  5HG2 A;  1J7B A;  1JAL A;  1C79 A;  1KFY B;  4N6E B;  1PYW D;  2IJ0 A;  4YSY B;  1XLP A;  4LLG M;  4US9 A;  2H88 B;  2K0P A;  2W3S A;  1T5X D;  3Q8E A;  1DOY A;  1TS3 A;  2K3U A;  4XE0 A;  1P7E A;  1KLU D;  3ZJU A;  4B0M A;  1DGJ A;  1SXT A;  2X38 A;  4Q2J A;  3ZQ4 A;  3AE2 B;  1XCQ L;  1OQQ A;  1KLG D;  2BW2 A;  2WU5 B;  4ZRP A;  3NVY A;  1WYG A;  1K52 A;  1HZ5 A;  3P4P B;  2CJN A;  3BVZ A;  4C7Z A;  4L2Y A;  2AQ1 B;  2WXG A;  1YQ4 B;  1PGB A;  1IGD A;  3ABV B;  1NI3 A;  1ROE A;  1F2R I;  2W54 A;  2KWD A;  3LYY A;  4RF0 A;  1TZO A;  4RGM A;  1E9M A;  2KAC A;  2AQ3 B;  1XF5 L;  1Q10 A;  1KH0 A;  5BYR A;  3R2I A;  3AE8 B;  3ZJV A;  1UNS A;  1EU3 A;  1TJE A;  1J7A A;  1JWA D;  4OZC A;  1YMH E;  1EWC A;  1DOI A;  2E3T A;  2WXJ A;  1MHH E;  4ZRQ A;  1Y56 A;  1WSP A;  3P42 A;  3TEW A;  3AE9 B;  4HRS A;  1D4B A;  1SSN A;  1SEB D;  1FO4 A;  3BYT B;  3AEB B;  1B1Z A;  2HTM E;  2JYE A;  2DLB A;  1I4H A;  4O1N A;  1K51 A;  3Q8C A;  2GB1 A;  4RH6 A;  1AYF A;  2QIE B;  3AE4 B;  2WXM A;  2IGD A;  4A90 A;  1B9R A;  4UDU C;  1PDX A;  3Q8F A;  4KX6 B;  2ACZ B;  3ZJT A;  1TYG B;  1FXI A;  1KTK A;  4HEA 1;  2J4X A;  1SB3 C;  2INP E;  1JCK B;  2QIL A;  3T3O A;  3SFE B;  4KGS A;  3O13 A;  5EE3 A;  1WRI A;  3B2F A;  1C9F A;  5C3J B;  2V3N A;  2M0A A;  1YJJ A;  2JZP A;  1N60 A;  5EE9 A;  1I7H A;  2Y5C A;  1C4P A;  1CZP A;  2D5G A;  1M4V A;  4R3D A;  1QT9 A;  1DYQ A;  3MHZ A;  4P6V F;  4YXD B;  5BMH A;  1FEH A;  1RM6 C;  1QQR A;  1UWX A;  3CWI A;  1ZP0 B;  1TKY A;  1YJI A;  2E6X A;  4XWT A;  5AUI A;  1E7P B;  3HUI A;  1LO5 D;  4RGO S;  3AE6 B;  1ESF A;  1FIQ A;  4JE3 B;  2L32 A;  1GAQ B;  1TS2 A;  2Z8L A;  4NAW B;  1GB1 A;  1PGA A;  1XLN A;  1VZ8 A;  1UUP A;  1ZXH A;  2FE8 A;  1I4X A;  1TY0 A;  4KGR A;  2GI9 A;  2R61 A;  4KGT A;  4IDI A;  1IUE A;  4TSS A;  3NRZ A;  2KQ4 X;  2Q5W D;  1OQR A;  4N59 A;  1L6U A;  3Q8B A;  1YN5 A;  1L4D B;  3KQ4 A;  4A8X C;  2OHF A;  1BML C;  3HRD D;  1YQ3 B;  4TMA B;  4NAM A;  3AE5 B;  2RPV A;  3AE7 B;  2NTT A;  4DQO C;  2WXI A;  1ZUD 2;  2EKI A;  2ON8 A;  1AW7 A;  4ZHP A;  2N7J A;  2EEL A;  1FMA D;  1FRR A;  5D7G A;  4USA A;  3AE3 B;  2W55 A;  1JWM D;  2QJL A;  3VRB B;  1FNV A;  3ETR A;  1N5W A;  3H8H A;  1D5X C;  2ICI A;  3R8B A;  3RPF C;  1C77 A;  3EUB 2;  3PZ8 A;  1XEE A;  2PKO A;  4JWU C;  3U4E G;  3AN1 A;  2YEP F;  1VZ7 A;  5EE0 A;  1AN8 A;  2LJI A;  3NVV A;  2CJO A;  2QMT A;  3B9J A;  3AE1 B;  1PFD A;  1CK1 A;  4XDD A;  1YN4 A;  4DXF A;  4WUR A;  1HEZ E;  3ZGZ A;  4CQN A;  4EE2 A;  1IBX B;  4YTP B;  2PW9 A;  2WXF A;  4WWM A;  4TQ0 A;  1RFK A;  5BMG A;  5LNK 1;  2QSD A;  3KWV A;  4YSX B;  2PTL A;  4ZOH C;  1WXQ A;  1C76 A;  1XLO A;  2L83 A;  3NUH B;  2KAJ A;  3GB1 A;  2AQ2 B;  2WLB A;  3AMZ A;  3FIL A;  4RCO A;  2Y5P A;  1GTH A;  4HKQ A;  1E10 A;  1KF6 B;  4KKJ A;  3TUO A;  3MJ5 A;  3KLS X;  1D5M C;  1C4C A;  3BK1 A;  1XCT L;  2WU2 B;  1FNU A;  4OZB A;  5GXG B;  1SJE D;  1D5Z C;  5D3I B;  1V1P A;  1NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...