3AEGB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aegB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aegB01
1L5PA 1FXIA 2MH7A 1YJJA 2WU2B 2DBYA 1QF6A 3AEGB 1YQ3B 3VR8B 1NI3A 1OQRA 1T3QA 3AE3B 2MJ3A 3AMZA 1F0ZA 2WP9B 1KF6B 5C2TB 5EE1A 2CJNA 5MPOA 2B76B 5C3JB 4LTUA 2JX5A 1PUTA 1FXAA 1OFFA 1DOYA 4N58A 1H7WA 3CF4A 1PFDA 1VJKA 2E3TA 3VRAB 1E6EB 1ZP0B 3AE6B 2WDRB 1QOFA 3HRDD 2W3RA 4YTPB 3EUB2 1JQ4A 2N0SB 1JALA 1PDXA 3AE4B 4US9A 2WDQB 3AE7B 1YJIA 5G5HA 4N59A 2PVOD 5H8YE 3W5UB 2LEKA 4USAA 3AEBB 4YSZB 2HTME 2L52A 3ZYYX 1A70A 2EKIA 1FFUA 3P4PB 1RWSA 3CWIA 3DWGC 3FC4A 1NEKB 3NRZA 3W5VB 1JRPA 1R7SA 1XLOA 2OHFA 1JWAD 1XLPA 2WLBA 5AUIA 1SIJA 2JQRB 3AV8A 1WYGA 5EE0A 5H92C 1NVID 2KAJA 1JROA 1VLBA 4HRSA 1QOAA 2W55A 3B2FA 2W3SA 3AH7A 3AM9A 3NVYA 4US8A 3SFDB 1QOGA 1RM6C 3AB5A 4C80A 4YXDB 1DOIA 1FRRA 1FIQA 3P4SB 2W54A 4YT0B 2L83A 1IUEA 1GAQB 1WRIA 1FM0D 4JX1C 3AE9B 1TYGB 4A9AA 1B9RA 4ITKA 1N5WA 1GPXA 2QJLA 4HROA 2K22A 3HUIA 3NVVA 4IDIA 2PIAA 4C7ZA 1TKEA 2BT6A 3W9CB 1NENB 4P6VF 1CZPA 3AEFB 1DGJA 1E9MA 3HVZA 3CIRB 1WGKA 1TKYA 2MJEA 1TJEA 2Q5WD 4ZHPA 1QLBB 1E7PB 1EWYC 1OQQA 3KWLA 4ZOHC 3ETRA 1VDVA 2K5PA 1DOXA 3ABVB 4N6EB 4C7YA 1UWMA 4WWMA 2Y5CA 1SF0A 1NYQA 1FO4A 1V97A 3FAHA 4JWSC 3AEAB 3AEDB 1NYRA 2PKOA 2ACZB 3NVWA 1J7CA 1N63A 3B9JA 4JWUC 3P1MA 2BS2B 5AUKA 1ZXIA 2PVGC 3DWMA 4FXCA 1XLQA 3AE1B 1AWDA 2CU3A 1GTEA 3AE2B 1N60A 3RPFC 1L0VB 1V8CA 3P63A 1YQ4B 1N5XA 3AEEB 1WXQA 2M56B 2G1EA 3AE5B 2FBWB 3VRBB 1JW9D 1TKGA 2H88B 1RYJA 1ZUD2 4YTNB 2CJOA 1SB3C 5G5GA 5EE3A 4ZHOA 3SR6A 2WQYB 1L6UA 2DWQA 1ZOYB 3P4QB 4KX6B 1E10A 1JWBD 1XO3A 5GXGB 1KRHA 3LXFA 1AYFA 1J7AA 2KMMA 2QIEB 2WS3B 1CJEA 3P4RB 4YSYB 1E0ZA 3VR9B 1N62A 1GTHA 4YTMB 3B2GA 1H7XA 3L4PA 2H89B 2WDVB 1FMAD 3AN1A 3WCQA 1RFKA 1I7HA 2K9XA 3NVZA 4WQMA 1QOBA 1WWTA 1GT8A 1FFVA 2WU5B 1L6VA 1N61A 3LB8C 3AECB 5EE9A 2M19A 1KFYB 2AX5A 3SFEB 3NS1A 1ROEA 2MJDA 1FRDA 4YSXB 3BIID 2BS4B 1J7BA 1XLNA 3AE8B 2BS3B 3PO0A 1QT9A
chains in the Genus database with same CATH superfamily
2ASQA 4FADA 3WAOA 5JZEB 5C2TB 5EE1A 3IAM1 1HXYD 1XQQA 2KLCA 1FXAA 1PFDA 3RCZA 2WXKA 3U7ZA 3V6CB 1ZP0B 1WGDA 5FK9C 1TTNA 4FBJB 3UIPB 1QZEA 4P1CC 2L0TA 4IM2A 1BT0A 2CS4A 2LVPA 3NJTA 3NG0A 4NNJB 3VHTC 2JSVX 3BK1A 1JWAD 4II2B 3O65B 3ONSA 4DHZB 2JQRB 2FUHB 3JVZX 5D3IB 3MHSD 3DOWA 4OVZA 2W3SA 1QOGA 1XCTL 1SJHD 2WNMA 3PZDA 2FCQA 3R66C 2IGDA 3DVNV 4RFBA 2MSED 4W9GA 3ZDMC 1IUEA 3ALBA 3HHMA 1IPGA 2AQ3B 2C7MB 1C4CA 4YL8A 2GBKA 3H7PB 5AZFA 2YEPB 4JPSA 2AL6A 3WANA 4RF1A 4BKTA 2AQ1B 4ZHPA 1E7PB 2WDTB 2FCNA 5D7GA 4NJ6A 1GC6A 4G0NB 2MP2A 3PREA 3UQBA 1WM3A 4KSLC 1F1HA 4HXDA 2ZNVC 1GTEA 4ANVA 3TEWA 1I4PA 4HVBA 5G5GA 1ZUD2 1ET6A 3NZSA 3VUXA 5BMIA 4BZAA 1BUIC 2NPTB 4DK5A 2W9NA 2RSUA 2IO0B 1JWBD 4QAYA 2N1VA 5C1ZA 4KDIC 1P98A 1YNTE 2WXOA 4MH0E 3W1SC 2LGDA 4UDUC 2DZJA 3NVZA 1WFYA 2C5LC 4GXBA 4ANWA 4BFRA 1K52A 2BWFA 2IO3B 3N30A 1TGZB 1WH3A 1GB4A 2BYEA 2NBUA 3KUDB 2LHEA 1HQRD 3CF4A 2V0GA 4OHJA 4YTPB 4K1RB 2O2VA 3L13A 1PDXA 5E6JA 2WDQB 2LFIA 3EHVA 2CKHB 2KDIA 1UF0A 1SXTA 2K8CA 2KC1A 4E71A 3W5VB 3A9JA 1QQRA 1SE2A 4TMAB 2WXMA 3RZWC 2Z59B 5IAAC 1H4RA 2A4ZA 2KMCA 4B6WA 4W9IA 2W55A 4HKZE 3NVYA 3SFDB 1WR6E 1UUPA 2O6VD 1TS5A 2LGXA 2BB6A 4BBNC 3JW0X 1FCLA 3GP7A 2N9XA 4M8NA 1E8XA 4C7ZA 4RH6A 3MC9A 1JWUD 4PS3A 1YX5B 3AULA 1YD8U 4H2AA 2Q5WD 1PGBA 2M8SA 4FJZA 2XN9C 2K5PA 3VVWB 1STEA 2ZW0A 2V3PA 5D6JB 1YOVB 5JXVA 4KGRA 2CHZA 3QCAA 3H8HA 2O6VB 4S0RA 2I38A 5FR3A 4XYCA 3KQ4A 2ACZB 3QK0A 2AWTA 2WXHA 3DWMA 4EKUA 5D94A 1YQ4B 1RRBA 1YIWA 3DVGY 3RFZB 1C78A 2CJOA 4IWPA 3L0WB 2E6XA 2PW9A 2JVCA 5GXGB 3GZNB 2J7QB 1ISNA 3A33B 2KMMA 2D10A 4LNOA 3BZDB 1HZ6A 2LGIA 2PMVA 3AI5A 3GZNI 3TCAA 3RNFC 2G4DB 2AYOB 1PGAA 2FNJB 4L2YA 3SD5A 4GOCA 1FXIA 2MH7A 1FNUA 2IY0B 2ONQA 2KOXA 3BVGA 3Q69A 1HTOA 4R3DA 4D2KA 1PUTA 1TS3A 3RULA 1QOFA 2LXCA 2C7NB 4JL9A 4XZ4A 3O13A 3DHHC 3PPAA 2M0XA 4USAA 4WAFA 5TSSA 4HPPA 2HTHA 4K3CA 3P4PB 2KQ4X 1IP9A 1WM2A 1R7SA 2WLBA 2IDYA 1YN4A 3DDCB 3RNEC 4C00A 3N3KB 1ET9A 4HRSA 1E7UA 3PGEA 1DOIA 1FIQA 1MVKA 4IC7B 1WMHA 3KYCD 3WA0A 5BYQA 3ZNGC 2KWUB 4WWNA 1UZXB 1N5WA 2JT4B 1XCQL 3UI3A 4MGZE 3GE8C 4DDGD 2PE9A 4P6VF 1C77A 1WGKA 5DCNA 5BMGA 2Z8LA 2N4FA 3ML9A 4KIKB 2KDFB 2BTEA 1S1QB 1Q10A 1V97A 3FAHA 3KW5B 2A5UA 4W9HA 3ZNHB 3CMMB 5GMVA 5DPRA 4ZRJA 2K6QA 4BBNF 1B1ZA 3TSSA 3IG3A 4RF0A 3P4QB 1V1OA 4RGOS 1Q0WB 3TEXA 3LXFA 3T8MA 1N62A 2V4IB 3L4PA 5C23A 4K3BA 3VAWA 2K9XA 3X0WA 1J0GA 3Q2AC 4WJQA 3IAS1 4YSXB 2KVZA 2BS4B 2DBYA 4CYEA 4TV3A 1L5PA 1YJJA 3OJ4B 3L17A 2DX5B 5BYRA 3U2SC 4N58A 1FCCC 1H7WA 1YN3A 2Y5BB 1D6EC 4A20A 3CSTA 2NBWB 1JALA 2LGSA 2XEWA 4GMVA 2LEKA 1C3TA 1P0RA 2BKRB 4M00A 3FC4A 2YVCA 2TSSA 3DBSA 3DBRB 2IGGA 4XWWA 2J0MA 1WJ4A 2V1YA 2JF5A 1RM6C 3R2IA 1IGCA 2UWQA 2NMQA 1MHXA 1LFDA 2RDBC 3BY4B 3ZGZA 2QCZA 2PIAA 1TKEA 2LASA 1C79A 3EECA 2KWDA 3KUZA 4FHJA 2JWUA 5J18A 3PSEB 4W9DA 1V1PA 2NR2A 2Y5CA 1SF0A 1KM7A 1FO4A 4MGKE 4JWSC 3RMKC 3AEDB 2PKOA 4HJGE 3EGRA 4L23A 2LMCA 2BKFA 2MCNB 3PHWB 2M17A 5JH5C 1JW9D 2XBBC 2FE8A 2NCNA 4P16A 2DWQA 2V3NA 3HVDA 2BWES 3LJ3A 4TQ0A 3VH4B 3SU8X 1K53A 1KLGD 4WIPA 2LXAA 3W2DA 1JWMD 2INNE 4I6NB 1C4AA 1GT8A 2BYFA 2WXFA 2KKCA 1VZ6A 3Q3OC 2C60A 2SAKA 1R4MB 3QWZB 2HE7A 1XLNA 1H8CA 1QT9A 2WYQA 2DENB 4IKGA 1YQ3B 2EKEC 2BGFA 3ML8A 4W9CA 1XEEA 5C3JB 4AJWA 2KWVB 1UELA 3DHIC 3HRDD 4WJPA 2G45B 2M1MA 4GN1A 4EFOA 4RCOA 4RGNA 2LVOA 2KDBA 1U4AA 4OVVA 1JCKB 2DAJA 2FAZA 3JSVB 2CU1A 3RNAC 4EZKA 1YQBA 1UD7A 3A9KA 1JWSD 3PT2B 3MJ5A 3APCA 3ZKJC 3QIJA 1KLUD 3TUOA 2KQ7A 3ZIMA 1ZDVA 4ITKA 1MFWA 2KXJA 4IDIA 1T0YA 4HPMB 1TT5B 4ZRQA 4CHKA 4WAAA 1EWYC 3ZTDA 2KANA 3A4RA 4FN2A 4M0WB 2JRHA 1E8ZA 4NAMA 4OZCA 2MBBB 3QC8B 5CHFA 1I4RA 2K25A 3RPFC 1N60A 1V8CA 3H7PA 1YJ1A 3AE5B 2RD0A 1TKGA 3S2AA 3RYTA 4I6LB 4DBGA 3AXCA 3N9YC 1WGYA 1EF5A 4BKSD 2IGHA 2RGFA 1H7XA 4OW0A 3C19A 3N20C 1QOBA 4LK0M 1WJUA 3NS1A 3AE8B 2Y5PA 2N7EA 2MWSB 2WXGA 3AMZA 2K6DB 2NPTA 2CJNA 3VRAB 5L83A 4PYUA 3AE6B 1EF1A 3EUB2 1WIAA 3R7RA 1YJIA 4IM3A 5HFYA 1OEYJ 4WQOB 3AEBB 1Z2MA 1FFUA 1BMLC 1UBIA 1JRPA 1X1MA 1XLPA 4EOYA 1M4VA 2YLMA 1LQBA 2QSDA 3CSFA 2Z0EB 3U4EG 2ZZPB 3DPDA 1L0XB 4ASWC 5HG2A 2D5GA 1WRIA 1FM0D 1OTRB 1FNWA 2CHXA 2KACA 4WH4A 2L32A 5I4DA 2N9LA 3SEBA 3PHXB 2GBNA 1E9MA 3I57A 2RPVA 5JHAA 2DHZA 1VZ7A 2KX0A 2BW2A 2IO1B 1TY2A 2L1AA 4DHZE 1F2RI 2J4XA 1SE4A 2LZ6A 1C9FA 2MBQA 3VTWA 3P63A 2J42A 1WXQA 2M56B 2G1EA 1XT9B 2ZPNA 1D5XC 1SB3C 1ZOYB 2IY1B 2LD9A 4LNNA 4M8MA 4XDDA 5J17A 2O6VA 1I7HA 3V60A 2MLBA 1HEZE 4MM3B 5EE9A 2DAFA 2M19A 1OGWA 4G11A 3SFEB 2D2QA 3BIID 1PYWD 1E6EB 3GB1A 3I5JC 4RM9A 3M62B 1K50A 2KO3A 3RT3B 3RNCC 5IKCM 3ZDTA 2KTRB 2MQJA 1V81A 1F9JA 2BF8B 4K81A 1FXTB 2KFKB 2N0SB 4PYZA 1UNSA 2PVOD 5E6NA 3PS6A 2L52A 4C4VB 2LRUA 3CWIA 2PJHA 4NJCA 2C9WB 2BYTA 5AZHA 1XXGA 4WWOA 1IGDA 1IBXB 4AJYB 5FKAC 2D11A 1ZKHA 1E90A 1WE7A 1ZPSA 4M01A 4KGSA 3MFGA 4OVUA 1B9RA 5IO9A 2UYZB 1A5RA 3W1YA 3NUHB 3CIRB 2QILA 1NDDA 4C7YA 4MJSB 1UWMA 3PRPB 1NYRA 1N63A 1WX9A 4JGHB 2MBHA 1P1AA 2AL3A 3AEEB 2ZPYA 4ARCA 3SDLC 3N1ZC 4IW0A 1L6UA 2MBEA 3HK0A 4F1SA 4KX6B 1V49A 3TEYA 3R2TA 4KIKA 5LXHA 3UINB 3VR9B 1GTHA 3C8YA 1KJTA 4GDLB 4Q2JA 2JZPA 2H89B 4ARIA 1WGGA 2L76A 1XD3B 3ZTCA 3AECB 1TS4A 2KHWB 2NS5A 1FRDA 1J7BA 3EA6A 2KD0A 1QF6A 1OQRA 2MJ3A 2HD5B 3P2BA 1E5WA 3P42A 4AUQC 1YMHE 2VZKD 1WGHA 4LNIA 5G5HA 4N59A 1VD2A 2KN4A 4YSZB 2KX3A 1WJ6A 4PS7A 3UIOB 4FJYA 3NRZA 1HZ5A 1GJZA 4KKJA 2LHDA 1HE8A 5CX3A 4JE3B 3ZW3A 4NAWB 4DHJD 4DQOC 4FLHA 4US8A 2VZKB 1AN8A 1K8RB 1WGRA 2DZKA 3RNBC 2GBMA 5BMHA 2C7HA 2KJRA 3N32A 2SEBD 2JZZA 4IWQA 1M94A 4ANXA 3ZUNA 2AEHA 3KVFB 3DBHB 2MEKA 4DHJB 2JYTA 1I35A 3PV1A 3W1SA 3APDA 4AOFA 5E6OA 3QHTA 2BS2B 3V05A 5AUKA 1UBQA 3PLVA 1AWDA 3AE2B 3Q3FA 2MBOA 1N5XA 1V9JA 3TJPA 4DXGA 1R4NB 5JHBA 2N7JA 1E10A 1KTKA 2ZW1A 2QHOA 3DVNU 1E0ZA 3B2GA 3LDZE 3AN1A 4MT5A 4JQWC 5LLIA 4HCNB 1T0SC 1FFVA 1T5XD 4CO7A 4EUTA 3Q8AA 1ROEA 5BYSA 1SGHA 2K1FA 1WZ0A 2QDFA 2R2OA 2WX0A 3ZJTA 3ZJVA 2N9PC 1ZGUB 2ZEQA 4P7IA 2W3RA 2L8JA 3M63B 4S17A 5HI1A 2ZVOA 2EKIA 1RWSA 4HJKA 1NEKB 2L0FA 3UF8A 2OHFA 2KVRA 2KAJA 4GU2A 1JMLA 4F7ZA 4DWFA 3M3JA 4AP4C 4MSMB 1TYGB 2ZNVB 4FHKA 3D32A 3ENEA 3TL5A 3NVVA 5AZGA 1LM8B 2JY6A 1NENB 4XX5A 2BQQA 3PLUA 3EFCA 4B0EA 1T0QC 3PTFC 3TMPB 4E74A 2JPHA 2JU6X 1BXTA 4P1BC 3DBRI 4GLSC 2CHWA 2V3SA 1TBEA 2FCMA 4GB9A 3AEAB 2BVCA 2LUMA 1WE6A 2L7RA 1OEYA 2KNBA 2WXRA 2FBWB 3RZFA 1AW7A 3PRMB 2KYWA 2WXIA 4IG7B 1SSNA 2JYEA 3U8ZA 4PT5A 1WXSA 2KJHB 2GBJA 1AYFA 1WRDB 3WIMA 3OJ3A 2HDEA 2DZMA 4HDQA 1RFKA 1P9DU 4MSQB 3A1QB 1V80A 4TQ1A 1D3ZA 4JLCA 1SE9A 5CTRC 2WXLA 2G4SA 2IJ0A 2WP9B 1KF6B 3UGBB 1E8YA 3KH0A 3QQ8B 2JX5A 4KDLB 1ENFA 3FILB 3DQVA 4A8XC 3GS2A 2WDRB 1SIFA 2PEAA 3T9LA 1EU3A 1PQSA 1I4QA 4EE2A 3MP9A 5J2RA 3K9OB 2IZVB 1LGRA 1KLVA 1L0YB 2DYBA 2VH2A 1TS2A 2WGSA 4E3CA 4J6IA 1LXDA 2QC8A 4ZYNA 1PGXA 1HA5A 1WYGA 5HHDG 1JROA 1Q5WB 1R4MI 3DHGC 3H1UA 1MG8A 3B2FA 5FR6A 3VXWA 3V62A 4C80A 2J52A 2BPSA 4BKSA 3ZNZB 4RGTA 2LJIA 3HUIA 3ECIA 3VUWA 2WXPA 3KYDD 2KWCA 2GB1A 2W82A 3KWLA 2MHJA 1E7VA 2KDMA 3WALA 2J53A 1V5TA 3SHQA 5T8IA 3VRBB 2L05A 4YTNB 1WF9A 1I42A 2XK5B 1J7AA 2KZRA 4OZBA 2XNAC 1FMAD 5D2MB 1WWTA 2WWZA 1QKZA 3LB8C 4BKGA 1V86A 1TIFA 3V3XA 2R61A 4KGTA 5AEKB 3VH3B 1L4ZB 2MJDA 2EELA 1RLFA 2LJ5A 2N1WA 3AE3B 1D4BA 2B76B 1V1PB 2YEPF 1OFFA 5IOIA 3Q6BA 2KMAA 4W9JA 2N9EB 3QJZA 3V61A 4MM3A 1V2YA 3WAPA 2NTTA 3ZNID 4II3B 3BYYB 5H92C 5EE0A 2QEJC 2KTRA 1VLBA 1D5MC 2KLGA 2WXJA 2KN5A 3AB5A 2GLSA 1ZW7A 2LWPA 2WXQA 3U52E 2PE6B 3BVZA 4AQ7A 3NHEB 1VRAB 3N1YC 3UQAA 2I2YA 4O1NA 1GUAB 1WY8A 4NZLB 3ZXVA 2GBRA 3N1XC 4C4VA 3QX1A 2QJLA 2K22A 3NOBA 1CQVA 4MDKE 3RUIB 2MJEA 1QLBB 2RR9A 2RMMA 3Q8EA 3U30A 2GI9A 2OOBB 3ETRA 3IFWB 1IBXA 4WWMA 1MJDA 5BO4B 2OJRA 2G3QB 4ICVA 1FNVA 3Q14C 2N9KA 3OWEB 3HIZA 4A3PA 2INCC 1MHHE 3B1LX 3A9KB 2INDC 5D3DA 3L16A 1CJEA 1P3QU 4MJSA 3OAWA 3QA8A 1WX7A 3EFUA 1ZDXA 1Y56A 2IYDB 3KWVA 2IBIB 4HCPB 2AX5A 1YX6B 2KDEB 4B9KA 3PO0A 1DYQA 2D07B 2L00B 1NI3A 1GOZA 3K9PB 5MPOA 2X8XX 4FA6A 2E3TA 4MGYE 4GDLA 4ZRIA 4GDKB 2EMTA 4TSSA 2HTME 2J0KA 3ZYYX 1A70A 4FJVB 4RNAA 2J0JA 5KHOA 1XLOA 4ANUA 1F77A 1SIJA 3ZLZA 1VCBA 4NQLB 4TKNA 1RFAA 1NVID 4FULA 2G9HD 2JZ3B 3H9DA 1QOAA 2ICIA 3T3OA 3PZ8A 2W54A 3Q3MC 3URYA 2KFJA 3IBEA 4XGAB 2OEDA 2UU7A 4B0MA 1ZXHA 3Q8CA 4HROA 3IT4B 1WR1A 3HVZA 3IVFA 4NAWA 1WX8A 2ON8A 4ZOHC 1DOXA 2PPHA 5CHWA 4URKA 2JXXA 1NYQA 3RI7C 3EC8A 3VDZA 3GOEA 1I4GA 3B9JA 4MGIE 1TZOA 1P7FA 4XC2A 3AE1B 4HKQA 3NY5A 4N9F4 5TR5A 2JRIB 1WXAA 4ZHOA 1QILA 4HPLB 3RNGC 3I3TB 4JIOU 2BBCA 2CR5A 3P4RB 4BOZB 2WDVB 1I4XA 2KT7A 3KLSX 2WU5B 1YN5A 5IP4D 2LGYA 4PS8A 2OJWA 1GB1A 2V4LA 3L08A 2DLBA 1EWCA 3HM6X 3Q3NC 1F0ZA 3U7DA 3Q8FA 3OLMD 4NQKE 3GE3C 1VJKA 4IOIE 4MELA 5H8YE 5IN7A 4LJOB 2ZJDA 2RPQA 1FPYA 5AUIA 4ZYSA 3BYTB 2KJ6A 3MJWA 1EO6A 2NVUI 3KUCB 2D3AA 2V9HA 2RDHA 2EMSA 3DCGA 2I1JA 2I1KA 2WHIA 3P4SB 2MP2B 3BK2A 1L4DB 4YT0B 4IUMB 1CK1A 4HLEA 3ZJUA 3VQIA 3PVLA 2FIDA 1GPXA 1F52A 2RDGA 4NJ7A 3AEFB 1ZE3D 1DGJA 3TBLD 3ZO5B 4EEWA 1NI2A 3IXSA 1OQQA 3WAMA 2JXTA 4LDTD 3I63C 3ZXRA 3MC8A 4WJNA 2PVGC 1MPEA 1UGJA 1WXMA 4DXAB 2H88B 3TIXA 1HTQA 4MH8A 3SR6A 2WQYB 1LO5D 4LJPB 2BB5A 2D3BA 1FD6A 2O2VB 3Q3JA 3BWUD 1G6JA 4LDTB 1Y8RC 4WQMA 3DBHI 3H6NA 4GIVA 4M02A 1L6VA 1T6BX 3PZ7A 3A9JB 3NZUA 1XF5L 1Q1OA 1EM7A 1GNUA 2K39A 4A55A 1DOYA 1TY0A 1UWXA 1R4NI 3VUYA 1KH0A 2FIFA 4US9A 3AE7B 3B08A 2DZIA 2D3CA 4K7UA 3A1QA 1VR9A 4LCDE 4XWTA 1GG3A 3BINA 1C76A 3C0RB 3VTUA 1IYFA 4WJOA 2M4NA 3FILA 3J9CA 1WSPA 2L83A 3R3MA 1GAQB 2JUOA 5HKHA 4ZRKA 4HK2A 4K7SA 1TZ1A 3IT6B 4WWPA 5LXIB 3MC0B 2REXA 2ZCBA 4GSWA 3Q8BA 4C56C 4N6EB 5DPWA 3NZ3A 2INPE 2MA9B 3VFKA 4MACA 4HEA1 4A90A 4MEMA 1L0VB 2Y3AA 1WXVA 1SJED 3JSVA 4IM0A 1F2RC 2KK8A 1EU4A 4LLGM 1KRHA 5IA7A 1UH6A 4YSYB 2LI5A 3I9V1 5DPTA 4BAXA 4A3OA 3VTVA 4BVUC 3HM3A 2GOWA 3QARA 4NPNA 2LRWA 5LNK1 2R2QA 4ZDVA 3IHPC 2DNFA 3AEGB 3VR8B 1J19A 1T3QA 1KOTA 3RN9C 3ZVVA 4BOSC 4PK1A 4G50A 1ACCA 4LTUA 2K3UA 4A6QA 2XK5A 4IWOA 2AQ2B 1S3SG 2D3GA 4M0WA 1WMHB 1Z5SB 4OZAA 3AE4B 2ZCCA 2MRPA 2NTSA 4W9FA 3E56A 4W9EA 4KV2A 4B95A 4KVGB 1VZ8A 4DDID 1K51A 3MHZA 3TEZA 3AV8A 2KC2A 1WJNA 5DPSA 4GGQA 1L7YA 2GRIA 1L2NA 2IPKD 3AH7A 4REZA 1FRRA 2IO2B 1MG4A 3BVMA 4XDCA 4JX1C 1ESFA 3M95A 3AE9B 3CF6E 1UGMA 4A9AA 2K0PA 4KKIA 2KQSA 3W9CB 3AU5A 1CZPA 4ZRPA 1CMXB 1SBBB 2HJ1A 4J3OD 5CHVC 1NBFC 4L1BA 4TUUA 4K7WA 3OG5A 3PRZA 1AARA 1MI0A 4W9KA 3A4SC 1J7CA 4JWUC 2DYOA 3FKYA 1N6ZA 2KTFA 2CU3A 1V5OA 3DBLB 4G3XB 1WI0A 5G55A 5KHQA 1RYJA 2PLPA 2MX2A 4AS1A 3DBLI 3R7QA 4RGMA 1SEBD 3V6EB 5L95C 2VRRB 3ZQ4A 2QIEB 4YWGG 2B3AA 3X23A 2M0AA 1GC7A 3L10B 2FCSA 4HDOA 3NS8A 3DVGX 2WU2B 2JWZA 2WXNA 3LYYA 4ICUA 2VH1A 4HWIB 3E9SA 3T3NA 4CQNA 3MTNB 4KZCA 4XE0A 4AWJA 1SE3A 1JQ4A 2BYVE 2GMIC 4X57B 3W5UB 4DXFA 4RMAA 4ACFA 1RAXA 4EZLA 3DWGC 4NY0A 5E6PA 1OQYA 2WX1A 4F8CB 1C1YB 2Z0DB 4EZJA 3H7SA 3AM9A 2NBVB 4YXDB 1C4PA 4KSKC 4GDKA 1V6EA 2K8HA 3R8BA 5EDSA 2BT6A 1FEHA 2QMTA 1J8CA 1JRUA 3L54A 1TKYA 3B0AA 1TJEA 2N7DA 2ZVNA 3APFA 1WZ3A 4W9LA 2LVQA 1VDVA 3ABVB 1D5ZC 5G2NA 4LNFA 3QAQA 3NVWA 2KFKA 2L3ZA 3P1MA 4WURA 2PTLA 1ZXIA 4FXCA 1XLQA 2LUEA 1I4HA 2DYMA 2HJ8A 3ZRFA 5EE3A 1EUVB 2X38A 1XO3A 1P7EA 2WS3B 1T0RC 4RM8A 4KZ0A 4YTMB 2K8BA 3WCQA 2FUG1 4LNKA 3JYUA 1N61A 3AU4A 1WYWB 3RD2A 1KFYB 1E8WA 2MW5A 4I6PA 2BS3B 3ZRCA
chains in the Genus database with same CATH topology
1GB1A 4IKGA 2DLBA 1YQ3B 1EWCA 1F0ZA 5C2TB 3Q8FA 5EE1A 3IAM1 1HXYD 1XEEA 5C3JB 3ZJTA 1FXAA 3ZJVA 1PFDA 1VJKA 2WXKA 3U7ZA 1ZP0B 5FK9C 3HRDD 2W3RA 4IOIE 4RCOA 5H8YE 4RGNA 5HI1A 2EKIA 1RWSA 1NEKB 1JCKB 2OHFA 2JSVX 3BK1A 1JWAD 5AUIA 4ZYSA 2JQRB 3BYTB 2KAJA 5D3IB 1JWSD 1JMLA 4OVZA 3MJ5A 2W3SA 2RDHA 1QOGA 1XCTL 1SJHD 2WNMA 3P4SB 3BK2A 1L4DB 4YT0B 1KLUD 2IGDA 3TUOA 4RFBA 1IUEA 1CK1A 1TYGB 2AQ3B 3ZJUA 1C4CA 3VQIA 1ZDVA 4ITKA 1GPXA 4IDIA 3NVVA 1NENB 2RDGA 2YEPB 4ZRQA 3AEFB 1ZE3D 1DGJA 4JPSA 4RF1A 2AQ1B 4B0EA 4ZHPA 3IXSA 1E7PB 1EWYC 1OQQA 2JU6X 5D7GA 1BXTA 4GLSC 2JXTA 3AEAB 4NAMA 4OZCA 2LUMA 1I4RA 2PVGC 1MPEA 3RPFC 1GTEA 1N60A 1V8CA 3TEWA 1UGJA 1I4PA 2WXRA 3AE5B 2FBWB 1TKGA 5G5GA 2H88B 1AW7A 1ET6A 1ZUD2 4MH8A 3SR6A 2WQYB 1LO5D 5BMIA 2WXIA 1BUIC 3N9YC 1SSNA 2JYEA 2BB5A 1JWBD 4PT5A 1AYFA 1FD6A 1YNTE 2WXOA 2IGHA 1H7XA 2HDEA 3BWUD 4UDUC 4OW0A 1RFKA 3NVZA 4WQMA 1QOBA 4LK0M 1L6VA 1T6BX 3PZ7A 1K52A 3NS1A 1XF5L 3AE8B 2Y5PA 4TQ1A 1EM7A 1GB4A 2WXLA 2WXGA 3AMZA 2IJ0A 2WP9B 1KF6B 2LHEA 2CJNA 1HQRD 4A55A 2JX5A 1DOYA 1TY0A 1UWXA 3CF4A 1ENFA 3VRAB 2V0GA 4OHJA 3FILB 3AE6B 4A8XC 3GS2A 2WDRB 1KH0A 4YTPB 3EUB2 1EU3A 1PDXA 4US9A 5E6JA 2WDQB 3AE7B 1YJIA 5HFYA 2LFIA 3AEBB 1I4QA 4EE2A 3MP9A 1FFUA 1SXTA 1BMLC 1VR9A 1L0YB 3W5VB 1JRPA 1TS2A 4XWTA 1QQRA 1SE2A 4TMAB 1XLPA 1PGXA 2WXMA 1M4VA 1HA5A 1WYGA 5HHDG 1JROA 1C76A 2QSDA 2W55A 4HKZE 3B2FA 3U4EG 3NVYA 3SFDB 4C80A 2J52A 1UUPA 3FILA 1TS5A 3J9CA 1L0XB 2BB6A 1FCLA 1WSPA 5HG2A 2D5GA 2L83A 1GAQB 1WRIA 1FM0D 3GP7A 1FNWA 2KACA 4WH4A 4RGTA 2L32A 2LJIA 3HUIA 4RH6A 4C7ZA 5I4DA 2N9LA 3SEBA 3IT6B 1JWUD 1E9MA 2WXPA 2RPVA 3I57A 4H2AA 2Q5WD 2GB1A 2W82A 1VZ7A 3MC0B 1PGBA 2BW2A 3KWLA 2XN9C 2K5PA 1TY2A 3Q8BA 1STEA 2ZW0A 2V3PA 4N6EB 4C56C 5JXVA 2KDMA 4KGRA 3NZ3A 2J53A 2L1AA 3H8HA 1F2RI 2INPE 2I38A 5FR3A 2J4XA 3KQ4A 2ACZB 2WXHA 1SE4A 4MACA 4HEA1 3DWMA 4A90A 1C9FA 1L0VB 3P63A 2J42A 1YQ4B 1WXQA 2M56B 2Y3AA 5T8IA 3RFZB 2G1EA 3VRBB 1C78A 2CJOA 1SJED 4YTNB 1D5XC 1SB3C 1F2RC 2E6XA 2PW9A 1ZOYB 1EU4A 5GXGB 4LLGM 1KRHA 1J7AA 2KMMA 4OZBA 2XNAC 4XDDA 4YSYB 3I9V1 3BZDB 1HZ6A 2LGIA 2PMVA 1FMAD 1I7HA 1WWTA 1HEZE 4MM3B 1QKZA 3LB8C 5LNK1 3V3XA 5EE9A 2M19A 2R61A 4KGTA 3SFEB 1L4ZB 1PGAA 2MJDA 3BIID 3GB1A 1PYWD 1E6EB 4L2YA 2EELA 1FXIA 1K50A 2MH7A 1FNUA 2ONQA 3AEGB 3VR8B 1T3QA 3AE3B 3BVGA 1D4BA 3Q69A 4R3DA 4D2KA 2B76B 1V1PB 2YEPF 1ACCA 4LTUA 1PUTA 1OFFA 2K3UA 4A6QA 1TS3A 2AQ2B 4M0WA 1QOFA 4OZAA 2N0SB 3AE4B 1UNSA 3O13A 2NTSA 2PVOD 4USAA 4WAFA 5TSSA 2L52A 3E56A 3P4PB 2KQ4X 2NTTA 3CWIA 1R7SA 4NJCA 1VZ8A 1K51A 2WLBA 2IDYA 3BYYB 3MHZA 3TEZA 3AV8A 2BYTA 5H92C 5EE0A 1YN4A 1XXGA 2QEJC 2GRIA 1VLBA 1ET9A 1IGDA 4HRSA 1D5MC 2IPKD 1IBXB 3AH7A 2WXJA 3AB5A 4REZA 2WXQA 1DOIA 5FKAC 1FRRA 1FIQA 1MVKA 3U52E 3BVMA 4XDCA 3BVZA 4AQ7A 5BYQA 4JX1C 1VRAB 1ESFA 2I2YA 3AE9B 4O1NA 1ZPSA 4NZLB 4KGSA 3MFGA 4A9AA 1B9RA 1N5WA 2QJLA 2K22A 2K0PA 4KKIA 1XCQL 3UI3A 3W9CB 1CQVA 4P6VF 1CZPA 4ZRPA 1SBBB 1C77A 3NUHB 3CIRB 2QILA 4J3OD 1WGKA 2MJEA 1QLBB 5BMGA 2RMMA 2Z8LA 3Q8EA 2GI9A 3ETRA 4L1BA 4C7YA 1IBXA 1UWMA 4WWMA 2BTEA 1MI0A 1Q10A 1V97A 3FAHA 1NYRA 1J7CA 1N63A 4JWUC 1FNVA 2DYOA 2N9KA 2CU3A 3OWEB 3AEEB 1RYJA 4ARCA 1B1ZA 2PLPA 3TSSA 1MHHE 4RF0A 1L6UA 4AS1A 3P4QB 1V1OA 4KX6B 5D3DA 4RGMA 1SEBD 4RGOS 3TEYA 3R2TA 3TEXA 3LXFA 3ZQ4A 2QIEB 1CJEA 3VR9B 1N62A 4YWGG 1GTHA 3C8YA 4Q2JA 4GDLB 2V4IB 2JZPA 3L4PA 2H89B 1ZDXA 2K9XA 1Y56A 2M0AA 4ARIA 3KWVA 3AECB 1TS4A 2AX5A 1FRDA 4YSXB 3IAS1 2BS4B 1J7BA 2DBYA 3PO0A 1DYQA 1L5PA 3EA6A 1YJJA 2WU2B 2WXNA 3LYYA 1QF6A 1NI3A 1OQRA 2MJ3A 1GOZA 5MPOA 3P42A 1YMHE 3E9SA 3T3NA 5BYRA 3U2SC 4CQNA 4N58A 1FCCC 2VZKD 1H7WA 1YN3A 2E3TA 1D6EC 4XE0A 1SE3A 1JQ4A 5G5HA 1JALA 4GDKB 4N59A 2KN4A 3W5UB 2LEKA 4DXFA 4TSSA 4YSZB 2HTME 3ZYYX 1A70A 3DWGC 3FC4A 4RNAA 3NRZA 1HZ5A 1XLOA 4KKJA 2LHDA 2TSSA 2IGGA 4JE3B 1F77A 1SIJA 4NAWB 4XWWA 1NVID 2G9HD 4DQOC 1QOAA 3AM9A 2ICIA 4US8A 2VZKB 1RM6C 3T3OA 3R2IA 1IGCA 4YXDB 1AN8A 1C4PA 3PZ8A 2W54A 2NMQA 1MHXA 5BMHA 3URYA 3R8BA 2OEDA 3ZGZA 4B0MA 1ZXHA 3Q8CA 4HROA 3IT4B 2SEBD 2PIAA 1TKEA 2BT6A 1C79A 2KWDA 2JWUA 1FEHA 2QMTA 3HVZA 1TKYA 1TJEA 2ON8A 4ZOHC 2MEKA 1VDVA 1DOXA 3ABVB 2JYTA 1V1PA 1D5ZC 2Y5CA 1SF0A 3W1SA 1NYQA 1FO4A 4JWSC 3AEDB 2PKOA 3NVWA 4HJGE 1I4GA 3B9JA 1TZOA 3P1MA 2BS2B 3V05A 4WURA 2PTLA 3EGRA 5AUKA 1P7FA 1ZXIA 4FXCA 1XLQA 3AE1B 1AWDA 4L23A 3AE2B 1I4HA 2LMCA 4HKQA 2DYMA 1N5XA 4DXGA 1JW9D 2FE8A 5EE3A 4ZHOA 4P16A 1QILA 2DWQA 2V3NA 3HVDA 2N7JA 2X38A 1E10A 1XO3A 1KTKA 2ZW1A 4TQ0A 1P7EA 2BBCA 2WS3B 3P4RB 1E0ZA 1K53A 1KLGD 4YTMB 4WIPA 3B2GA 2WDVB 3AN1A 3W2DA 3WCQA 4MT5A 1JWMD 2FUG1 2INNE 1I4XA 3KLSX 1C4AA 1GT8A 1FFVA 2WU5B 1N61A 1T5XD 2WXFA 1VZ6A 2SAKA 1YN5A 1KFYB 3Q8AA 1ROEA 5BYSA 1XLNA 2BS3B 1QT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5P A;  1FXI A;  2MH7 A;  1YJJ A;  2WU2 B;  2DBY A;  1QF6 A;  3AEG B;  1YQ3 B;  3VR8 B;  1NI3 A;  1OQR A;  1T3Q A;  3AE3 B;  2MJ3 A;  3AMZ A;  1F0Z A;  2WP9 B;  1KF6 B;  5C2T B;  5EE1 A;  2CJN A;  5MPO A;  2B76 B;  5C3J B;  4LTU A;  2JX5 A;  1PUT A;  1FXA A;  1OFF A;  1DOY A;  4N58 A;  1H7W A;  3CF4 A;  1PFD A;  1VJK A;  2E3T A;  3VRA B;  1E6E B;  1ZP0 B;  3AE6 B;  2WDR B;  1QOF A;  3HRD D;  2W3R A;  4YTP B;  3EUB 2;  1JQ4 A;  2N0S B;  1JAL A;  1PDX A;  3AE4 B;  4US9 A;  2WDQ B;  3AE7 B;  1YJI A;  5G5H A;  4N59 A;  2PVO D;  5H8Y E;  3W5U B;  2LEK A;  4USA A;  3AEB B;  4YSZ B;  2HTM E;  2L52 A;  3ZYY X;  1A70 A;  2EKI A;  1FFU A;  3P4P B;  1RWS A;  3CWI A;  3DWG C;  3FC4 A;  1NEK B;  3NRZ A;  3W5V B;  1JRP A;  1R7S A;  1XLO A;  2OHF A;  1JWA D;  1XLP A;  2WLB A;  5AUI A;  1SIJ A;  2JQR B;  3AV8 A;  1WYG A;  5EE0 A;  5H92 C;  1NVI D;  2KAJ A;  1JRO A;  1VLB A;  4HRS A;  1QOA A;  2W55 A;  3B2F A;  2W3S A;  3AH7 A;  3AM9 A;  3NVY A;  4US8 A;  3SFD B;  1QOG A;  1RM6 C;  3AB5 A;  4C80 A;  4YXD B;  1DOI A;  1FRR A;  1FIQ A;  3P4S B;  2W54 A;  4YT0 B;  2L83 A;  1IUE A;  1GAQ B;  1WRI A;  1FM0 D;  4JX1 C;  3AE9 B;  1TYG B;  4A9A A;  1B9R A;  4ITK A;  1N5W A;  1GPX A;  2QJL A;  4HRO A;  2K22 A;  3HUI A;  3NVV A;  4IDI A;  2PIA A;  4C7Z A;  1TKE A;  2BT6 A;  3W9C B;  1NEN B;  4P6V F;  1CZP A;  3AEF B;  1DGJ A;  1E9M A;  3HVZ A;  3CIR B;  1WGK A;  1TKY A;  2MJE A;  1TJE A;  2Q5W D;  4ZHP A;  1QLB B;  1E7P B;  1EWY C;  1OQQ A;  3KWL A;  4ZOH C;  3ETR A;  1VDV A;  2K5P A;  1DOX A;  3ABV B;  4N6E B;  4C7Y A;  1UWM A;  4WWM A;  2Y5C A;  1SF0 A;  1NYQ A;  1FO4 A;  1V97 A;  3FAH A;  4JWS C;  3AEA B;  3AED B;  1NYR A;  2PKO A;  2ACZ B;  3NVW A;  1J7C A;  1N63 A;  3B9J A;  4JWU C;  3P1M A;  2BS2 B;  5AUK A;  1ZXI A;  2PVG C;  3DWM A;  4FXC A;  1XLQ A;  3AE1 B;  1AWD A;  2CU3 A;  1GTE A;  3AE2 B;  1N60 A;  3RPF C;  1L0V B;  1V8C A;  3P63 A;  1YQ4 B;  1N5X A;  3AEE B;  1WXQ A;  2M56 B;  2G1E A;  3AE5 B;  2FBW B;  3VRB B;  1JW9 D;  1TKG A;  2H88 B;  1RYJ A;  1ZUD 2;  4YTN B;  2CJO A;  1SB3 C;  5G5G A;  5EE3 A;  4ZHO A;  3SR6 A;  2WQY B;  1L6U A;  2DWQ A;  1ZOY B;  3P4Q B;  4KX6 B;  1E10 A;  1JWB D;  1XO3 A;  5GXG B;  1KRH A;  3LXF A;  1AYF A;  1J7A A;  2KMM A;  2QIE B;  2WS3 B;  1CJE A;  3P4R B;  4YSY B;  1E0Z A;  3VR9 B;  1N62 A;  1GTH A;  4YTM B;  3B2G A;  1H7X A;  3L4P A;  2H89 B;  2WDV B;  1FMA D;  3AN1 A;  3WCQ A;  1RFK A;  1I7H A;  2K9X A;  3NVZ A;  4WQM A;  1QOB A;  1WWT A;  1GT8 A;  1FFV A;  2WU5 B;  1L6V A;  1N61 A;  3LB8 C;  3AEC B;  5EE9 A;  2M19 A;  1KFY B;  2AX5 A;  3SFE B;  3NS1 A;  1ROE A;  2MJD A;  1FRD A;  4YSX B;  3BII D;  2BS4 B;  1J7B A;  1XLN A;  3AE8 B;  2BS3 B;  3PO0 A;  1QT9 A; 
#chains in the Genus database with same CATH topology
 2ASQ A;  4FAD A;  3WAO A;  5JZE B;  5C2T B;  5EE1 A;  3IAM 1;  1HXY D;  1XQQ A;  2KLC A;  1FXA A;  1PFD A;  3RCZ A;  2WXK A;  3U7Z A;  3V6C B;  1ZP0 B;  1WGD A;  5FK9 C;  1TTN A;  4FBJ B;  3UIP B;  1QZE A;  4P1C C;  2L0T A;  4IM2 A;  1BT0 A;  2CS4 A;  2LVP A;  3NJT A;  3NG0 A;  4NNJ B;  3VHT C;  2JSV X;  3BK1 A;  1JWA D;  4II2 B;  3O65 B;  3ONS A;  4DHZ B;  2JQR B;  2FUH B;  3JVZ X;  5D3I B;  3MHS D;  3DOW A;  4OVZ A;  2W3S A;  1QOG A;  1XCT L;  1SJH D;  2WNM A;  3PZD A;  2FCQ A;  3R66 C;  2IGD A;  3DVN V;  4RFB A;  2MSE D;  4W9G A;  3ZDM C;  1IUE A;  3ALB A;  3HHM A;  1IPG A;  2AQ3 B;  2C7M B;  1C4C A;  4YL8 A;  2GBK A;  3H7P B;  5AZF A;  2YEP B;  4JPS A;  2AL6 A;  3WAN A;  4RF1 A;  4BKT A;  2AQ1 B;  4ZHP A;  1E7P B;  2WDT B;  2FCN A;  5D7G A;  4NJ6 A;  1GC6 A;  4G0N B;  2MP2 A;  3PRE A;  3UQB A;  1WM3 A;  4KSL C;  1F1H A;  4HXD A;  2ZNV C;  1GTE A;  4ANV A;  3TEW A;  1I4P A;  4HVB A;  5G5G A;  1ZUD 2;  1ET6 A;  3NZS A;  3VUX A;  5BMI A;  4BZA A;  1BUI C;  2NPT B;  4DK5 A;  2W9N A;  2RSU A;  2IO0 B;  1JWB D;  4QAY A;  2N1V A;  5C1Z A;  4KDI C;  1P98 A;  1YNT E;  2WXO A;  4MH0 E;  3W1S C;  2LGD A;  4UDU C;  2DZJ A;  3NVZ A;  1WFY A;  2C5L C;  4GXB A;  4ANW A;  4BFR A;  1K52 A;  2BWF A;  2IO3 B;  3N30 A;  1TGZ B;  1WH3 A;  1GB4 A;  2BYE A;  2NBU A;  3KUD B;  2LHE A;  1HQR D;  3CF4 A;  2V0G A;  4OHJ A;  4YTP B;  4K1R B;  2O2V A;  3L13 A;  1PDX A;  5E6J A;  2WDQ B;  2LFI A;  3EHV A;  2CKH B;  2KDI A;  1UF0 A;  1SXT A;  2K8C A;  2KC1 A;  4E71 A;  3W5V B;  3A9J A;  1QQR A;  1SE2 A;  4TMA B;  2WXM A;  3RZW C;  2Z59 B;  5IAA C;  1H4R A;  2A4Z A;  2KMC A;  4B6W A;  4W9I A;  2W55 A;  4HKZ E;  3NVY A;  3SFD B;  1WR6 E;  1UUP A;  2O6V D;  1TS5 A;  2LGX A;  2BB6 A;  4BBN C;  3JW0 X;  1FCL A;  3GP7 A;  2N9X A;  4M8N A;  1E8X A;  4C7Z A;  4RH6 A;  3MC9 A;  1JWU D;  4PS3 A;  1YX5 B;  3AUL A;  1YD8 U;  4H2A A;  2Q5W D;  1PGB A;  2M8S A;  4FJZ A;  2XN9 C;  2K5P A;  3VVW B;  1STE A;  2ZW0 A;  2V3P A;  5D6J B;  1YOV B;  5JXV A;  4KGR A;  2CHZ A;  3QCA A;  3H8H A;  2O6V B;  4S0R A;  2I38 A;  5FR3 A;  4XYC A;  3KQ4 A;  2ACZ B;  3QK0 A;  2AWT A;  2WXH A;  3DWM A;  4EKU A;  5D94 A;  1YQ4 B;  1RRB A;  1YIW A;  3DVG Y;  3RFZ B;  1C78 A;  2CJO A;  4IWP A;  3L0W B;  2E6X A;  2PW9 A;  2JVC A;  5GXG B;  3GZN B;  2J7Q B;  1ISN A;  3A33 B;  2KMM A;  2D10 A;  4LNO A;  3BZD B;  1HZ6 A;  2LGI A;  2PMV A;  3AI5 A;  3GZN I;  3TCA A;  3RNF C;  2G4D B;  2AYO B;  1PGA A;  2FNJ B;  4L2Y A;  3SD5 A;  4GOC A;  1FXI A;  2MH7 A;  1FNU A;  2IY0 B;  2ONQ A;  2KOX A;  3BVG A;  3Q69 A;  1HTO A;  4R3D A;  4D2K A;  1PUT A;  1TS3 A;  3RUL A;  1QOF A;  2LXC A;  2C7N B;  4JL9 A;  4XZ4 A;  3O13 A;  3DHH C;  3PPA A;  2M0X A;  4USA A;  4WAF A;  5TSS A;  4HPP A;  2HTH A;  4K3C A;  3P4P B;  2KQ4 X;  1IP9 A;  1WM2 A;  1R7S A;  2WLB A;  2IDY A;  1YN4 A;  3DDC B;  3RNE C;  4C00 A;  3N3K B;  1ET9 A;  4HRS A;  1E7U A;  3PGE A;  1DOI A;  1FIQ A;  1MVK A;  4IC7 B;  1WMH A;  3KYC D;  3WA0 A;  5BYQ A;  3ZNG C;  2KWU B;  4WWN A;  1UZX B;  1N5W A;  2JT4 B;  1XCQ L;  3UI3 A;  4MGZ E;  3GE8 C;  4DDG D;  2PE9 A;  4P6V F;  1C77 A;  1WGK A;  5DCN A;  5BMG A;  2Z8L A;  2N4F A;  3ML9 A;  4KIK B;  2KDF B;  2BTE A;  1S1Q B;  1Q10 A;  1V97 A;  3FAH A;  3KW5 B;  2A5U A;  4W9H A;  3ZNH B;  3CMM B;  5GMV A;  5DPR A;  4ZRJ A;  2K6Q A;  4BBN F;  1B1Z A;  3TSS A;  3IG3 A;  4RF0 A;  3P4Q B;  1V1O A;  4RGO S;  1Q0W B;  3TEX A;  3LXF A;  3T8M A;  1N62 A;  2V4I B;  3L4P A;  5C23 A;  4K3B A;  3VAW A;  2K9X A;  3X0W A;  1J0G A;  3Q2A C;  4WJQ A;  3IAS 1;  4YSX B;  2KVZ A;  2BS4 B;  2DBY A;  4CYE A;  4TV3 A;  1L5P A;  1YJJ A;  3OJ4 B;  3L17 A;  2DX5 B;  5BYR A;  3U2S C;  4N58 A;  1FCC C;  1H7W A;  1YN3 A;  2Y5B B;  1D6E C;  4A20 A;  3CST A;  2NBW B;  1JAL A;  2LGS A;  2XEW A;  4GMV A;  2LEK A;  1C3T A;  1P0R A;  2BKR B;  4M00 A;  3FC4 A;  2YVC A;  2TSS A;  3DBS A;  3DBR B;  2IGG A;  4XWW A;  2J0M A;  1WJ4 A;  2V1Y A;  2JF5 A;  1RM6 C;  3R2I A;  1IGC A;  2UWQ A;  2NMQ A;  1MHX A;  1LFD A;  2RDB C;  3BY4 B;  3ZGZ A;  2QCZ A;  2PIA A;  1TKE A;  2LAS A;  1C79 A;  3EEC A;  2KWD A;  3KUZ A;  4FHJ A;  2JWU A;  5J18 A;  3PSE B;  4W9D A;  1V1P A;  2NR2 A;  2Y5C A;  1SF0 A;  1KM7 A;  1FO4 A;  4MGK E;  4JWS C;  3RMK C;  3AED B;  2PKO A;  4HJG E;  3EGR A;  4L23 A;  2LMC A;  2BKF A;  2MCN B;  3PHW B;  2M17 A;  5JH5 C;  1JW9 D;  2XBB C;  2FE8 A;  2NCN A;  4P16 A;  2DWQ A;  2V3N A;  3HVD A;  2BWE S;  3LJ3 A;  4TQ0 A;  3VH4 B;  3SU8 X;  1K53 A;  1KLG D;  4WIP A;  2LXA A;  3W2D A;  1JWM D;  2INN E;  4I6N B;  1C4A A;  1GT8 A;  2BYF A;  2WXF A;  2KKC A;  1VZ6 A;  3Q3O C;  2C60 A;  2SAK A;  1R4M B;  3QWZ B;  2HE7 A;  1XLN A;  1H8C A;  1QT9 A;  2WYQ A;  2DEN B;  4IKG A;  1YQ3 B;  2EKE C;  2BGF A;  3ML8 A;  4W9C A;  1XEE A;  5C3J B;  4AJW A;  2KWV B;  1UEL A;  3DHI C;  3HRD D;  4WJP A;  2G45 B;  2M1M A;  4GN1 A;  4EFO A;  4RCO A;  4RGN A;  2LVO A;  2KDB A;  1U4A A;  4OVV A;  1JCK B;  2DAJ A;  2FAZ A;  3JSV B;  2CU1 A;  3RNA C;  4EZK A;  1YQB A;  1UD7 A;  3A9K A;  1JWS D;  3PT2 B;  3MJ5 A;  3APC A;  3ZKJ C;  3QIJ A;  1KLU D;  3TUO A;  2KQ7 A;  3ZIM A;  1ZDV A;  4ITK A;  1MFW A;  2KXJ A;  4IDI A;  1T0Y A;  4HPM B;  1TT5 B;  4ZRQ A;  4CHK A;  4WAA A;  1EWY C;  3ZTD A;  2KAN A;  3A4R A;  4FN2 A;  4M0W B;  2JRH A;  1E8Z A;  4NAM A;  4OZC A;  2MBB B;  3QC8 B;  5CHF A;  1I4R A;  2K25 A;  3RPF C;  1N60 A;  1V8C A;  3H7P A;  1YJ1 A;  3AE5 B;  2RD0 A;  1TKG A;  3S2A A;  3RYT A;  4I6L B;  4DBG A;  3AXC A;  3N9Y C;  1WGY A;  1EF5 A;  4BKS D;  2IGH A;  2RGF A;  1H7X A;  4OW0 A;  3C19 A;  3N20 C;  1QOB A;  4LK0 M;  1WJU A;  3NS1 A;  3AE8 B;  2Y5P A;  2N7E A;  2MWS B;  2WXG A;  3AMZ A;  2K6D B;  2NPT A;  2CJN A;  3VRA B;  5L83 A;  4PYU A;  3AE6 B;  1EF1 A;  3EUB 2;  1WIA A;  3R7R A;  1YJI A;  4IM3 A;  5HFY A;  1OEY J;  4WQO B;  3AEB B;  1Z2M A;  1FFU A;  1BML C;  1UBI A;  1JRP A;  1X1M A;  1XLP A;  4EOY A;  1M4V A;  2YLM A;  1LQB A;  2QSD A;  3CSF A;  2Z0E B;  3U4E G;  2ZZP B;  3DPD A;  1L0X B;  4ASW C;  5HG2 A;  2D5G A;  1WRI A;  1FM0 D;  1OTR B;  1FNW A;  2CHX A;  2KAC A;  4WH4 A;  2L32 A;  5I4D A;  2N9L A;  3SEB A;  3PHX B;  2GBN A;  1E9M A;  3I57 A;  2RPV A;  5JHA A;  2DHZ A;  1VZ7 A;  2KX0 A;  2BW2 A;  2IO1 B;  1TY2 A;  2L1A A;  4DHZ E;  1F2R I;  2J4X A;  1SE4 A;  2LZ6 A;  1C9F A;  2MBQ A;  3VTW A;  3P63 A;  2J42 A;  1WXQ A;  2M56 B;  2G1E A;  1XT9 B;  2ZPN A;  1D5X C;  1SB3 C;  1ZOY B;  2IY1 B;  2LD9 A;  4LNN A;  4M8M A;  4XDD A;  5J17 A;  2O6V A;  1I7H A;  3V60 A;  2MLB A;  1HEZ E;  4MM3 B;  5EE9 A;  2DAF A;  2M19 A;  1OGW A;  4G11 A;  3SFE B;  2D2Q A;  3BII D;  1PYW D;  1E6E B;  3GB1 A;  3I5J C;  4RM9 A;  3M62 B;  1K50 A;  2KO3 A;  3RT3 B;  3RNC C;  5IKC M;  3ZDT A;  2KTR B;  2MQJ A;  1V81 A;  1F9J A;  2BF8 B;  4K81 A;  1FXT B;  2KFK B;  2N0S B;  4PYZ A;  1UNS A;  2PVO D;  5E6N A;  3PS6 A;  2L52 A;  4C4V B;  2LRU A;  3CWI A;  2PJH A;  4NJC A;  2C9W B;  2BYT A;  5AZH A;  1XXG A;  4WWO A;  1IGD A;  1IBX B;  4AJY B;  5FKA C;  2D11 A;  1ZKH A;  1E90 A;  1WE7 A;  1ZPS A;  4M01 A;  4KGS A;  3MFG A;  4OVU A;  1B9R A;  5IO9 A;  2UYZ B;  1A5R A;  3W1Y A;  3NUH B;  3CIR B;  2QIL A;  1NDD A;  4C7Y A;  4MJS B;  1UWM A;  3PRP B;  1NYR A;  1N63 A;  1WX9 A;  4JGH B;  2MBH A;  1P1A A;  2AL3 A;  3AEE B;  2ZPY A;  4ARC A;  3SDL C;  3N1Z C;  4IW0 A;  1L6U A;  2MBE A;  3HK0 A;  4F1S A;  4KX6 B;  1V49 A;  3TEY A;  3R2T A;  4KIK A;  5LXH A;  3UIN B;  3VR9 B;  1GTH A;  3C8Y A;  1KJT A;  4GDL B;  4Q2J A;  2JZP A;  2H89 B;  4ARI A;  1WGG A;  2L76 A;  1XD3 B;  3ZTC A;  3AEC B;  1TS4 A;  2KHW B;  2NS5 A;  1FRD A;  1J7B A;  3EA6 A;  2KD0 A;  1QF6 A;  1OQR A;  2MJ3 A;  2HD5 B;  3P2B A;  1E5W A;  3P42 A;  4AUQ C;  1YMH E;  2VZK D;  1WGH A;  4LNI A;  5G5H A;  4N59 A;  1VD2 A;  2KN4 A;  4YSZ B;  2KX3 A;  1WJ6 A;  4PS7 A;  3UIO B;  4FJY A;  3NRZ A;  1HZ5 A;  1GJZ A;  4KKJ A;  2LHD A;  1HE8 A;  5CX3 A;  4JE3 B;  3ZW3 A;  4NAW B;  4DHJ D;  4DQO C;  4FLH A;  4US8 A;  2VZK B;  1AN8 A;  1K8R B;  1WGR A;  2DZK A;  3RNB C;  2GBM A;  5BMH A;  2C7H A;  2KJR A;  3N32 A;  2SEB D;  2JZZ A;  4IWQ A;  1M94 A;  4ANX A;  3ZUN A;  2AEH A;  3KVF B;  3DBH B;  2MEK A;  4DHJ B;  2JYT A;  1I35 A;  3PV1 A;  3W1S A;  3APD A;  4AOF A;  5E6O A;  3QHT A;  2BS2 B;  3V05 A;  5AUK A;  1UBQ A;  3PLV A;  1AWD A;  3AE2 B;  3Q3F A;  2MBO A;  1N5X A;  1V9J A;  3TJP A;  4DXG A;  1R4N B;  5JHB A;  2N7J A;  1E10 A;  1KTK A;  2ZW1 A;  2QHO A;  3DVN U;  1E0Z A;  3B2G A;  3LDZ E;  3AN1 A;  4MT5 A;  4JQW C;  5LLI A;  4HCN B;  1T0S C;  1FFV A;  1T5X D;  4CO7 A;  4EUT A;  3Q8A A;  1ROE A;  5BYS A;  1SGH A;  2K1F A;  1WZ0 A;  2QDF A;  2R2O A;  2WX0 A;  3ZJT A;  3ZJV A;  2N9P C;  1ZGU B;  2ZEQ A;  4P7I A;  2W3R A;  2L8J A;  3M63 B;  4S17 A;  5HI1 A;  2ZVO A;  2EKI A;  1RWS A;  4HJK A;  1NEK B;  2L0F A;  3UF8 A;  2OHF A;  2KVR A;  2KAJ A;  4GU2 A;  1JML A;  4F7Z A;  4DWF A;  3M3J A;  4AP4 C;  4MSM B;  1TYG B;  2ZNV B;  4FHK A;  3D32 A;  3ENE A;  3TL5 A;  3NVV A;  5AZG A;  1LM8 B;  2JY6 A;  1NEN B;  4XX5 A;  2BQQ A;  3PLU A;  3EFC A;  4B0E A;  1T0Q C;  3PTF C;  3TMP B;  4E74 A;  2JPH A;  2JU6 X;  1BXT A;  4P1B C;  3DBR I;  4GLS C;  2CHW A;  2V3S A;  1TBE A;  2FCM A;  4GB9 A;  3AEA B;  2BVC A;  2LUM A;  1WE6 A;  2L7R A;  1OEY A;  2KNB A;  2WXR A;  2FBW B;  3RZF A;  1AW7 A;  3PRM B;  2KYW A;  2WXI A;  4IG7 B;  1SSN A;  2JYE A;  3U8Z A;  4PT5 A;  1WXS A;  2KJH B;  2GBJ A;  1AYF A;  1WRD B;  3WIM A;  3OJ3 A;  2HDE A;  2DZM A;  4HDQ A;  1RFK A;  1P9D U;  4MSQ B;  3A1Q B;  1V80 A;  4TQ1 A;  1D3Z A;  4JLC A;  1SE9 A;  5CTR C;  2WXL A;  2G4S A;  2IJ0 A;  2WP9 B;  1KF6 B;  3UGB B;  1E8Y A;  3KH0 A;  3QQ8 B;  2JX5 A;  4KDL B;  1ENF A;  3FIL B;  3DQV A;  4A8X C;  3GS2 A;  2WDR B;  1SIF A;  2PEA A;  3T9L A;  1EU3 A;  1PQS A;  1I4Q A;  4EE2 A;  3MP9 A;  5J2R A;  3K9O B;  2IZV B;  1LGR A;  1KLV A;  1L0Y B;  2DYB A;  2VH2 A;  1TS2 A;  2WGS A;  4E3C A;  4J6I A;  1LXD A;  2QC8 A;  4ZYN A;  1PGX A;  1HA5 A;  1WYG A;  5HHD G;  1JRO A;  1Q5W B;  1R4M I;  3DHG C;  3H1U A;  1MG8 A;  3B2F A;  5FR6 A;  3VXW A;  3V62 A;  4C80 A;  2J52 A;  2BPS A;  4BKS A;  3ZNZ B;  4RGT A;  2LJI A;  3HUI A;  3ECI A;  3VUW A;  2WXP A;  3KYD D;  2KWC A;  2GB1 A;  2W82 A;  3KWL A;  2MHJ A;  1E7V A;  2KDM A;  3WAL A;  2J53 A;  1V5T A;  3SHQ A;  5T8I A;  3VRB B;  2L05 A;  4YTN B;  1WF9 A;  1I42 A;  2XK5 B;  1J7A A;  2KZR A;  4OZB A;  2XNA C;  1FMA D;  5D2M B;  1WWT A;  2WWZ A;  1QKZ A;  3LB8 C;  4BKG A;  1V86 A;  1TIF A;  3V3X A;  2R61 A;  4KGT A;  5AEK B;  3VH3 B;  1L4Z B;  2MJD A;  2EEL A;  1RLF A;  2LJ5 A;  2N1W A;  3AE3 B;  1D4B A;  2B76 B;  1V1P B;  2YEP F;  1OFF A;  5IOI A;  3Q6B A;  2KMA A;  4W9J A;  2N9E B;  3QJZ A;  3V61 A;  4MM3 A;  1V2Y A;  3WAP A;  2NTT A;  3ZNI D;  4II3 B;  3BYY B;  5H92 C;  5EE0 A;  2QEJ C;  2KTR A;  1VLB A;  1D5M C;  2KLG A;  2WXJ A;  2KN5 A;  3AB5 A;  2GLS A;  1ZW7 A;  2LWP A;  2WXQ A;  3U52 E;  2PE6 B;  3BVZ A;  4AQ7 A;  3NHE B;  1VRA B;  3N1Y C;  3UQA A;  2I2Y A;  4O1N A;  1GUA B;  1WY8 A;  4NZL B;  3ZXV A;  2GBR A;  3N1X C;  4C4V A;  3QX1 A;  2QJL A;  2K22 A;  3NOB A;  1CQV A;  4MDK E;  3RUI B;  2MJE A;  1QLB B;  2RR9 A;  2RMM A;  3Q8E A;  3U30 A;  2GI9 A;  2OOB B;  3ETR A;  3IFW B;  1IBX A;  4WWM A;  1MJD A;  5BO4 B;  2OJR A;  2G3Q B;  4ICV A;  1FNV A;  3Q14 C;  2N9K A;  3OWE B;  3HIZ A;  4A3P A;  2INC C;  1MHH E;  3B1L X;  3A9K B;  2IND C;  5D3D A;  3L16 A;  1CJE A;  1P3Q U;  4MJS A;  3OAW A;  3QA8 A;  1WX7 A;  3EFU A;  1ZDX A;  1Y56 A;  2IYD B;  3KWV A;  2IBI B;  4HCP B;  2AX5 A;  1YX6 B;  2KDE B;  4B9K A;  3PO0 A;  1DYQ A;  2D07 B;  2L00 B;  1NI3 A;  1GOZ A;  3K9P B;  5MPO A;  2X8X X;  4FA6 A;  2E3T A;  4MGY E;  4GDL A;  4ZRI A;  4GDK B;  2EMT A;  4TSS A;  2HTM E;  2J0K A;  3ZYY X;  1A70 A;  4FJV B;  4RNA A;  2J0J A;  5KHO A;  1XLO A;  4ANU A;  1F77 A;  1SIJ A;  3ZLZ A;  1VCB A;  4NQL B;  4TKN A;  1RFA A;  1NVI D;  4FUL A;  2G9H D;  2JZ3 B;  3H9D A;  1QOA A;  2ICI A;  3T3O A;  3PZ8 A;  2W54 A;  3Q3M C;  3URY A;  2KFJ A;  3IBE A;  4XGA B;  2OED A;  2UU7 A;  4B0M A;  1ZXH A;  3Q8C A;  4HRO A;  3IT4 B;  1WR1 A;  3HVZ A;  3IVF A;  4NAW A;  1WX8 A;  2ON8 A;  4ZOH C;  1DOX A;  2PPH A;  5CHW A;  4URK A;  2JXX A;  1NYQ A;  3RI7 C;  3EC8 A;  3VDZ A;  3GOE A;  1I4G A;  3B9J A;  4MGI E;  1TZO A;  1P7F A;  4XC2 A;  3AE1 B;  4HKQ A;  3NY5 A;  4N9F 4;  5TR5 A;  2JRI B;  1WXA A;  4ZHO A;  1QIL A;  4HPL B;  3RNG C;  3I3T B;  4JIO U;  2BBC A;  2CR5 A;  3P4R B;  4BOZ B;  2WDV B;  1I4X A;  2KT7 A;  3KLS X;  2WU5 B;  1YN5 A;  5IP4 D;  2LGY A;  4PS8 A;  2OJW A;  1GB1 A;  2V4L A;  3L08 A;  2DLB A;  1EWC A;  3HM6 X;  3Q3N C;  1F0Z A;  3U7D A;  3Q8F A;  3OLM D;  4NQK E;  3GE3 C;  1VJK A;  4IOI E;  4MEL A;  5H8Y E;  5IN7 A;  4LJO B;  2ZJD A;  2RPQ A;  1FPY A;  5AUI A;  4ZYS A;  3BYT B;  2KJ6 A;  3MJW A;  1EO6 A;  2NVU I;  3KUC B;  2D3A A;  2V9H A;  2RDH A;  2EMS A;  3DCG A;  2I1J A;  2I1K A;  2WHI A;  3P4S B;  2MP2 B;  3BK2 A;  1L4D B;  4YT0 B;  4IUM B;  1CK1 A;  4HLE A;  3ZJU A;  3VQI A;  3PVL A;  2FID A;  1GPX A;  1F52 A;  2RDG A;  4NJ7 A;  3AEF B;  1ZE3 D;  1DGJ A;  3TBL D;  3ZO5 B;  4EEW A;  1NI2 A;  3IXS A;  1OQQ A;  3WAM A;  2JXT A;  4LDT D;  3I63 C;  3ZXR A;  3MC8 A;  4WJN A;  2PVG C;  1MPE A;  1UGJ A;  1WXM A;  4DXA B;  2H88 B;  3TIX A;  1HTQ A;  4MH8 A;  3SR6 A;  2WQY B;  1LO5 D;  4LJP B;  2BB5 A;  2D3B A;  1FD6 A;  2O2V B;  3Q3J A;  3BWU D;  1G6J A;  4LDT B;  1Y8R C;  4WQM A;  3DBH I;  3H6N A;  4GIV A;  4M02 A;  1L6V A;  1T6B X;  3PZ7 A;  3A9J B;  3NZU A;  1XF5 L;  1Q1O A;  1EM7 A;  1GNU A;  2K39 A;  4A55 A;  1DOY A;  1TY0 A;  1UWX A;  1R4N I;  3VUY A;  1KH0 A;  2FIF A;  4US9 A;  3AE7 B;  3B08 A;  2DZI A;  2D3C A;  4K7U A;  3A1Q A;  1VR9 A;  4LCD E;  4XWT A;  1GG3 A;  3BIN A;  1C76 A;  3C0R B;  3VTU A;  1IYF A;  4WJO A;  2M4N A;  3FIL A;  3J9C A;  1WSP A;  2L83 A;  3R3M A;  1GAQ B;  2JUO A;  5HKH A;  4ZRK A;  4HK2 A;  4K7S A;  1TZ1 A;  3IT6 B;  4WWP A;  5LXI B;  3MC0 B;  2REX A;  2ZCB A;  4GSW A;  3Q8B A;  4C56 C;  4N6E B;  5DPW A;  3NZ3 A;  2INP E;  2MA9 B;  3VFK A;  4MAC A;  4HEA 1;  4A90 A;  4MEM A;  1L0V B;  2Y3A A;  1WXV A;  1SJE D;  3JSV A;  4IM0 A;  1F2R C;  2KK8 A;  1EU4 A;  4LLG M;  1KRH A;  5IA7 A;  1UH6 A;  4YSY B;  2LI5 A;  3I9V 1;  5DPT A;  4BAX A;  4A3O A;  3VTV A;  4BVU C;  3HM3 A;  2GOW A;  3QAR A;  4NPN A;  2LRW A;  5LNK 1;  2R2Q A;  4ZDV A;  3IHP C;  2DNF A;  3AEG B;  3VR8 B;  1J19 A;  1T3Q A;  1KOT A;  3RN9 C;  3ZVV A;  4BOS C;  4PK1 A;  4G50 A;  1ACC A;  4LTU A;  2K3U A;  4A6Q A;  2XK5 A;  4IWO A;  2AQ2 B;  1S3S G;  2D3G A;  4M0W A;  1WMH B;  1Z5S B;  4OZA A;  3AE4 B;  2ZCC A;  2MRP A;  2NTS A;  4W9F A;  3E56 A;  4W9E A;  4KV2 A;  4B95 A;  4KVG B;  1VZ8 A;  4DDI D;  1K51 A;  3MHZ A;  3TEZ A;  3AV8 A;  2KC2 A;  1WJN A;  5DPS A;  4GGQ A;  1L7Y A;  2GRI A;  1L2N A;  2IPK D;  3AH7 A;  4REZ A;  1FRR A;  2IO2 B;  1MG4 A;  3BVM A;  4XDC A;  4JX1 C;  1ESF A;  3M95 A;  3AE9 B;  3CF6 E;  1UGM A;  4A9A A;  2K0P A;  4KKI A;  2KQS A;  3W9C B;  3AU5 A;  1CZP A;  4ZRP A;  1CMX B;  1SBB B;  2HJ1 A;  4J3O D;  5CHV C;  1NBF C;  4L1B A;  4TUU A;  4K7W A;  3OG5 A;  3PRZ A;  1AAR A;  1MI0 A;  4W9K A;  3A4S C;  1J7C A;  4JWU C;  2DYO A;  3FKY A;  1N6Z A;  2KTF A;  2CU3 A;  1V5O A;  3DBL B;  4G3X B;  1WI0 A;  5G55 A;  5KHQ A;  1RYJ A;  2PLP A;  2MX2 A;  4AS1 A;  3DBL I;  3R7Q A;  4RGM A;  1SEB D;  3V6E B;  5L95 C;  2VRR B;  3ZQ4 A;  2QIE B;  4YWG G;  2B3A A;  3X23 A;  2M0A A;  1GC7 A;  3L10 B;  2FCS A;  4HDO A;  3NS8 A;  3DVG X;  2WU2 B;  2JWZ A;  2WXN A;  3LYY A;  4ICU A;  2VH1 A;  4HWI B;  3E9S A;  3T3N A;  4CQN A;  3MTN B;  4KZC A;  4XE0 A;  4AWJ A;  1SE3 A;  1JQ4 A;  2BYV E;  2GMI C;  4X57 B;  3W5U B;  4DXF A;  4RMA A;  4ACF A;  1RAX A;  4EZL A;  3DWG C;  4NY0 A;  5E6P A;  1OQY A;  2WX1 A;  4F8C B;  1C1Y B;  2Z0D B;  4EZJ A;  3H7S A;  3AM9 A;  2NBV B;  4YXD B;  1C4P A;  4KSK C;  4GDK A;  1V6E A;  2K8H A;  3R8B A;  5EDS A;  2BT6 A;  1FEH A;  2QMT A;  1J8C A;  1JRU A;  3L54 A;  1TKY A;  3B0A A;  1TJE A;  2N7D A;  2ZVN A;  3APF A;  1WZ3 A;  4W9L A;  2LVQ A;  1VDV A;  3ABV B;  1D5Z C;  5G2N A;  4LNF A;  3QAQ A;  3NVW A;  2KFK A;  2L3Z A;  3P1M A;  4WUR A;  2PTL A;  1ZXI A;  4FXC A;  1XLQ A;  2LUE A;  1I4H A;  2DYM A;  2HJ8 A;  3ZRF A;  5EE3 A;  1EUV B;  2X38 A;  1XO3 A;  1P7E A;  2WS3 B;  1T0R C;  4RM8 A;  4KZ0 A;  4YTM B;  2K8B A;  3WCQ A;  2FUG 1;  4LNK A;  3JYU A;  1N61 A;  3AU4 A;  1WYW B;  3RD2 A;  1KFY B;  1E8W A;  2MW5 A;  4I6P A;  2BS3 B;  3ZRC A; 
#chains in the Genus database with same CATH homology
 1GB1 A;  4IKG A;  2DLB A;  1YQ3 B;  1EWC A;  1F0Z A;  5C2T B;  3Q8F A;  5EE1 A;  3IAM 1;  1HXY D;  1XEE A;  5C3J B;  3ZJT A;  1FXA A;  3ZJV A;  1PFD A;  1VJK A;  2WXK A;  3U7Z A;  1ZP0 B;  5FK9 C;  3HRD D;  2W3R A;  4IOI E;  4RCO A;  5H8Y E;  4RGN A;  5HI1 A;  2EKI A;  1RWS A;  1NEK B;  1JCK B;  2OHF A;  2JSV X;  3BK1 A;  1JWA D;  5AUI A;  4ZYS A;  2JQR B;  3BYT B;  2KAJ A;  5D3I B;  1JWS D;  1JML A;  4OVZ A;  3MJ5 A;  2W3S A;  2RDH A;  1QOG A;  1XCT L;  1SJH D;  2WNM A;  3P4S B;  3BK2 A;  1L4D B;  4YT0 B;  1KLU D;  2IGD A;  3TUO A;  4RFB A;  1IUE A;  1CK1 A;  1TYG B;  2AQ3 B;  3ZJU A;  1C4C A;  3VQI A;  1ZDV A;  4ITK A;  1GPX A;  4IDI A;  3NVV A;  1NEN B;  2RDG A;  2YEP B;  4ZRQ A;  3AEF B;  1ZE3 D;  1DGJ A;  4JPS A;  4RF1 A;  2AQ1 B;  4B0E A;  4ZHP A;  3IXS A;  1E7P B;  1EWY C;  1OQQ A;  2JU6 X;  5D7G A;  1BXT A;  4GLS C;  2JXT A;  3AEA B;  4NAM A;  4OZC A;  2LUM A;  1I4R A;  2PVG C;  1MPE A;  3RPF C;  1GTE A;  1N60 A;  1V8C A;  3TEW A;  1UGJ A;  1I4P A;  2WXR A;  3AE5 B;  2FBW B;  1TKG A;  5G5G A;  2H88 B;  1AW7 A;  1ET6 A;  1ZUD 2;  4MH8 A;  3SR6 A;  2WQY B;  1LO5 D;  5BMI A;  2WXI A;  1BUI C;  3N9Y C;  1SSN A;  2JYE A;  2BB5 A;  1JWB D;  4PT5 A;  1AYF A;  1FD6 A;  1YNT E;  2WXO A;  2IGH A;  1H7X A;  2HDE A;  3BWU D;  4UDU C;  4OW0 A;  1RFK A;  3NVZ A;  4WQM A;  1QOB A;  4LK0 M;  1L6V A;  1T6B X;  3PZ7 A;  1K52 A;  3NS1 A;  1XF5 L;  3AE8 B;  2Y5P A;  4TQ1 A;  1EM7 A;  1GB4 A;  2WXL A;  2WXG A;  3AMZ A;  2IJ0 A;  2WP9 B;  1KF6 B;  2LHE A;  2CJN A;  1HQR D;  4A55 A;  2JX5 A;  1DOY A;  1TY0 A;  1UWX A;  3CF4 A;  1ENF A;  3VRA B;  2V0G A;  4OHJ A;  3FIL B;  3AE6 B;  4A8X C;  3GS2 A;  2WDR B;  1KH0 A;  4YTP B;  3EUB 2;  1EU3 A;  1PDX A;  4US9 A;  5E6J A;  2WDQ B;  3AE7 B;  1YJI A;  5HFY A;  2LFI A;  3AEB B;  1I4Q A;  4EE2 A;  3MP9 A;  1FFU A;  1SXT A;  1BML C;  1VR9 A;  1L0Y B;  3W5V B;  1JRP A;  1TS2 A;  4XWT A;  1QQR A;  1SE2 A;  4TMA B;  1XLP A;  1PGX A;  2WXM A;  1M4V A;  1HA5 A;  1WYG A;  5HHD G;  1JRO A;  1C76 A;  2QSD A;  2W55 A;  4HKZ E;  3B2F A;  3U4E G;  3NVY A;  3SFD B;  4C80 A;  2J52 A;  1UUP A;  3FIL A;  1TS5 A;  3J9C A;  1L0X B;  2BB6 A;  1FCL A;  1WSP A;  5HG2 A;  2D5G A;  2L83 A;  1GAQ B;  1WRI A;  1FM0 D;  3GP7 A;  1FNW A;  2KAC A;  4WH4 A;  4RGT A;  2L32 A;  2LJI A;  3HUI A;  4RH6 A;  4C7Z A;  5I4D A;  2N9L A;  3SEB A;  3IT6 B;  1JWU D;  1E9M A;  2WXP A;  2RPV A;  3I57 A;  4H2A A;  2Q5W D;  2GB1 A;  2W82 A;  1VZ7 A;  3MC0 B;  1PGB A;  2BW2 A;  3KWL A;  2XN9 C;  2K5P A;  1TY2 A;  3Q8B A;  1STE A;  2ZW0 A;  2V3P A;  4N6E B;  4C56 C;  5JXV A;  2KDM A;  4KGR A;  3NZ3 A;  2J53 A;  2L1A A;  3H8H A;  1F2R I;  2INP E;  2I38 A;  5FR3 A;  2J4X A;  3KQ4 A;  2ACZ B;  2WXH A;  1SE4 A;  4MAC A;  4HEA 1;  3DWM A;  4A90 A;  1C9F A;  1L0V B;  3P63 A;  2J42 A;  1YQ4 B;  1WXQ A;  2M56 B;  2Y3A A;  5T8I A;  3RFZ B;  2G1E A;  3VRB B;  1C78 A;  2CJO A;  1SJE D;  4YTN B;  1D5X C;  1SB3 C;  1F2R C;  2E6X A;  2PW9 A;  1ZOY B;  1EU4 A;  5GXG B;  4LLG M;  1KRH A;  1J7A A;  2KMM A;  4OZB A;  2XNA C;  4XDD A;  4YSY B;  3I9V 1;  3BZD B;  1HZ6 A;  2LGI A;  2PMV A;  1FMA D;  1I7H A;  1WWT A;  1HEZ E;  4MM3 B;  1QKZ A;  3LB8 C;  5LNK 1;  3V3X A;  5EE9 A;  2M19 A;  2R61 A;  4KGT A;  3SFE B;  1L4Z B;  1PGA A;  2MJD A;  3BII D;  3GB1 A;  1PYW D;  1E6E B;  4L2Y A;  2EEL A;  1FXI A;  1K50 A;  2MH7 A;  1FNU A;  2ONQ A;  3AEG B;  3VR8 B;  1T3Q A;  3AE3 B;  3BVG A;  1D4B A;  3Q69 A;  4R3D A;  4D2K A;  2B76 B;  1V1P B;  2YEP F;  1ACC A;  4LTU A;  1PUT A;  1OFF A;  2K3U A;  4A6Q A;  1TS3 A;  2AQ2 B;  4M0W A;  1QOF A;  4OZA A;  2N0S B;  3AE4 B;  1UNS A;  3O13 A;  2NTS A;  2PVO D;  4USA A;  4WAF A;  5TSS A;  2L52 A;  3E56 A;  3P4P B;  2KQ4 X;  2NTT A;  3CWI A;  1R7S A;  4NJC A;  1VZ8 A;  1K51 A;  2WLB A;  2IDY A;  3BYY B;  3MHZ A;  3TEZ A;  3AV8 A;  2BYT A;  5H92 C;  5EE0 A;  1YN4 A;  1XXG A;  2QEJ C;  2GRI A;  1VLB A;  1ET9 A;  1IGD A;  4HRS A;  1D5M C;  2IPK D;  1IBX B;  3AH7 A;  2WXJ A;  3AB5 A;  4REZ A;  2WXQ A;  1DOI A;  5FKA C;  1FRR A;  1FIQ A;  1MVK A;  3U52 E;  3BVM A;  4XDC A;  3BVZ A;  4AQ7 A;  5BYQ A;  4JX1 C;  1VRA B;  1ESF A;  2I2Y A;  3AE9 B;  4O1N A;  1ZPS A;  4NZL B;  4KGS A;  3MFG A;  4A9A A;  1B9R A;  1N5W A;  2QJL A;  2K22 A;  2K0P A;  4KKI A;  1XCQ L;  3UI3 A;  3W9C B;  1CQV A;  4P6V F;  1CZP A;  4ZRP A;  1SBB B;  1C77 A;  3NUH B;  3CIR B;  2QIL A;  4J3O D;  1WGK A;  2MJE A;  1QLB B;  5BMG A;  2RMM A;  2Z8L A;  3Q8E A;  2GI9 A;  3ETR A;  4L1B A;  4C7Y A;  1IBX A;  1UWM A;  4WWM A;  2BTE A;  1MI0 A;  1Q10 A;  1V97 A;  3FAH A;  1NYR A;  1J7C A;  1N63 A;  4JWU C;  1FNV A;  2DYO A;  2N9K A;  2CU3 A;  3OWE B;  3AEE B;  1RYJ A;  4ARC A;  1B1Z A;  2PLP A;  3TSS A;  1MHH E;  4RF0 A;  1L6U A;  4AS1 A;  3P4Q B;  1V1O A;  4KX6 B;  5D3D A;  4RGM A;  1SEB D;  4RGO S;  3TEY A;  3R2T A;  3TEX A;  3LXF A;  3ZQ4 A;  2QIE B;  1CJE A;  3VR9 B;  1N62 A;  4YWG G;  1GTH A;  3C8Y A;  4Q2J A;  4GDL B;  2V4I B;  2JZP A;  3L4P A;  2H89 B;  1ZDX A;  2K9X A;  1Y56 A;  2M0A A;  4ARI A;  3KWV A;  3AEC B;  1TS4 A;  2AX5 A;  1FRD A;  4YSX B;  3IAS 1;  2BS4 B;  1J7B A;  2DBY A;  3PO0 A;  1DYQ A;  1L5P A;  3EA6 A;  1YJJ A;  2WU2 B;  2WXN A;  3LYY A;  1QF6 A;  1NI3 A;  1OQR A;  2MJ3 A;  1GOZ A;  5MPO A;  3P42 A;  1YMH E;  3E9S A;  3T3N A;  5BYR A;  3U2S C;  4CQN A;  4N58 A;  1FCC C;  2VZK D;  1H7W A;  1YN3 A;  2E3T A;  1D6E C;  4XE0 A;  1SE3 A;  1JQ4 A;  5G5H A;  1JAL A;  4GDK B;  4N59 A;  2KN4 A;  3W5U B;  2LEK A;  4DXF A;  4TSS A;  4YSZ B;  2HTM E;  3ZYY X;  1A70 A;  3DWG C;  3FC4 A;  4RNA A;  3NRZ A;  1HZ5 A;  1XLO A;  4KKJ A;  2LHD A;  2TSS A;  2IGG A;  4JE3 B;  1F77 A;  1SIJ A;  4NAW B;  4XWW A;  1NVI D;  2G9H D;  4DQO C;  1QOA A;  3AM9 A;  2ICI A;  4US8 A;  2VZK B;  1RM6 C;  3T3O A;  3R2I A;  1IGC A;  4YXD B;  1AN8 A;  1C4P A;  3PZ8 A;  2W54 A;  2NMQ A;  1MHX A;  5BMH A;  3URY A;  3R8B A;  2OED A;  3ZGZ A;  4B0M A;  1ZXH A;  3Q8C A;  4HRO A;  3IT4 B;  2SEB D;  2PIA A;  1TKE A;  2BT6 A;  1C79 A;  2KWD A;  2JWU A;  1FEH A;  2QMT A;  3HVZ A;  1TKY A;  1TJE A;  2ON8 A;  4ZOH C;  2MEK A;  1VDV A;  1DOX A;  3ABV B;  2JYT A;  1V1P A;  1D5Z C;  2Y5C A;  1SF0 A;  3W1S A;  1NYQ A;  1FO4 A;  4JWS C;  3AED B;  2PKO A;  3NVW A;  4HJG E;  1I4G A;  3B9J A;  1TZO A;  3P1M A;  2BS2 B;  3V05 A;  4WUR A;  2PTL A;  3EGR A;  5AUK A;  1P7F A;  1ZXI A;  4FXC A;  1XLQ A;  3AE1 B;  1AWD A;  4L23 A;  3AE2 B;  1I4H A;  2LMC A;  4HKQ A;  2DYM A;  1N5X A;  4DXG A;  1JW9 D;  2FE8 A;  5EE3 A;  4ZHO A;  4P16 A;  1QIL A;  2DWQ A;  2V3N A;  3HVD A;  2N7J A;  2X38 A;  1E10 A;  1XO3 A;  1KTK A;  2ZW1 A;  4TQ0 A;  1P7E A;  2BBC A;  2WS3 B;  3P4R B;  1E0Z A;  1K53 A;  1KLG D;  4YTM B;  4WIP A;  3B2G A;  2WDV B;  3AN1 A;  3W2D A;  3WCQ A;  4MT5 A;  1JWM D;  2FUG 1;  2INN E;  1I4X A;  3KLS X;  1C4A A;  1GT8 A;  1FFV A;  2WU5 B;  1N61 A;  1T5X D;  2WXF A;  1VZ6 A;  2SAK A;  1YN5 A;  1KFY B;  3Q8A A;  1ROE A;  5BYS A;  1XLN A;  2BS3 B;  1QT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...