3AEGB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aegB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aegB01
4IDIA 1GTEA 1VJKA 1ZOYB 3KWLA 1AYFA 3NRZA 1YQ4B 5GXGB 1OFFA 3P1MA 3AEEB 3AEBB 1CJEA 1T3QA 1N60A 1SF0A 1XLPA 1DOIA 4JWUC 4N58A 1YQ3B 5EE0A 1L6UA 3SR6A 1YJIA 3PO0A 1J7CA 4FXCA 1DGJA 2PVOD 4YT0B 2Y5CA 1XLNA 3AE4B 3LXFA 1V8CA 2N0SB 2JQRB 3FC4A 2W54A 1QOFA 1H7WA 2B76B 5EE3A 1E10A 3AEGB 1AWDA 1QF6A 3W9CB 4YTPB 2W3RA 3ETRA 2KAJA 3AMZA 3AECB 3HUIA 2BS3B 1JWBD 1WRIA 3AEAB 2KMMA 2EKIA 4HROA 2AX5A 2L52A 2MJDA 3FAHA 1TKGA 1PUTA 4C7ZA 1QOAA 1JROA 1OQRA 1WYGA 1R7SA 1NYRA 1L5PA 1J7BA 4HRSA 4YSXB 3CWIA 4US9A 3SFEB 1J7AA 2M56B 4N59A 2CJOA 3AE7B 3CF4A 1EWYC 3P4SB 3W5VB 1WWTA 1B9RA 1F0ZA 1IUEA 4YSZB 1FIQA 1KRHA 1DOYA 3NVZA 3ABVB 3VRAB 1ZXIA 1FRDA 1XLOA 4YXDB 3RPFC 4P6VF 1TKEA 2PKOA 3VRBB 2MJEA 3SFDB 1E0ZA 4JWSC 5AUIA 1ROEA 3NVWA 3L4PA 3AE2B 1NENB 1SB3C 2WDRB 5EE9A 1QOGA 2BS4B 1PDXA 4N6EB 2FBWB 3VR8B 1QLBB 3AN1A 2ACZB 2HTME 4JX1C 1FO4A 4YTMB 1RM6C 1L0VB 3LB8C 4ZHOA 3AE3B 3AV8A 1NI3A 3P4QB 3P4RB 2G1EA 3W5UB 1N61A 1TKYA 2OHFA 1OQQA 1N62A 3AE8B 2LEKA 2L83A 2W3SA 3HRDD 1XO3A 2E3TA 3AE9B 2WP9B 3B9JA 2WS3B 3DWGC 5MPOA 3ZYYX 1L6VA 1WGKA 1TYGB 2BT6A 1GTHA 3AE1B 1ZUD2 4C7YA 1DOXA 1KFYB 3NVVA 4ITKA 1ZP0B 1FFUA 5AUKA 5EE1A 1A70A 1KF6B 1UWMA 2K5PA 4YTNB 1CZPA 1JW9D 1JQ4A 1RWSA 1FMAD 3DWMA 2W55A 2PVGC 4C80A 2H89B 2PIAA 1YJJA 2JX5A 1WXQA 3VR9B 2MJ3A 1NVID 2WLBA 4ZHPA 1GT8A 1N63A 3AM9A 1QT9A 1QOBA 1VDVA 2QIEB 5C3JB 2CJNA 2DBYA 2K22A 2WU5B 4KX6B 1E9MA 2CU3A 1GAQB 2MH7A 3AB5A 5G5HA 4A9AA 1I7HA 3P4PB 3B2FA 4LTUA 3NS1A 4YSYB 4WQMA 3BIID 2DWQA 5C2TB 3B2GA 2H88B 1TJEA 2BS2B 3EUB2 1FXAA 3HVZA 3WCQA 1H7XA 1RFKA 3AEFB 1SIJA 1XLQA 2QJLA 1N5WA 5H92C 1JRPA 1V97A 1N5XA 3AEDB 1FXIA 1JALA 1GPXA 4WWMA 3CIRB 1JWAD 4US8A 3P63A 1VLBA 3AH7A 2WDVB 4ZOHC 1E7PB 1NEKB 1E6EB 3AE6B 2Q5WD 4USAA 1FRRA 1NYQA 5G5GA 5H8YE 2WU2B 2WQYB 2WDQB 1FFVA 1PFDA 1RYJA 2M19A 1FM0D 3NVYA 3AE5B 2K9XA
chains in the Genus database with same CATH superfamily
2CHXA 1ZOYB 1YMHE 3R3MA 3UGBB 2CHWA 3IVFA 3GZNB 1YJIA 1XQQA 1DGJA 2O6VD 3FC4A 3ZRCA 2RD0A 2JPHA 4W9LA 2ZVNA 2MBBB 2DZMA 1P3QU 4AS1A 1JWBD 3AEAB 3BYTB 2MJDA 3FAHA 1IP9A 1L5PA 4HRSA 3CWIA 4HPPA 4NNJB 4NPNA 3ML8A 2M56B 5J2RA 2WXKA 4GMVA 4W9EA 1P7EA 1EWYC 2C9WB 3W5VB 2QEJC 1L7YA 2KJ6A 3M3JA 2PW9A 2RDHA 4JWSC 1FNVA 4KIKA 1ROEA 1C1YB 4FJZA 3NOBA 4ZYNA 2LRUA 4HPMB 4WWNA 1ZPSA 2N4FA 3V6CB 2UWQA 3WA0A 2LEKA 3VUXA 1P0RA 2PTLA 4IG7B 1WGKA 2JSVX 3WAOA 4M0WB 1KFYB 3ZRFA 5EE1A 4PYZA 2C7MB 5BMGA 1G6JA 3MHSD 4RGTA 2UYZB 4AWJA 2LUMA 2GI9A 1PGAA 2NBWB 4J3OD 2WU5B 2KLCA 1GAQB 3AB5A 3N32A 3APDA 2KXJA 2GOWA 1F1HA 1HXYD 2AL6A 2GRIA 4DXGA 4FHJA 4IC7B 2X8XX 3ZKJC 4CO7A 1Z2MA 1OEYA 1JWAD 1V49A 4L1BA 1L4DB 1R4MI 3IT4B 4BKTA 3QIJA 2AEHA 4ZOHC 2NTTA 2WDQB 1E5WA 2K25A 2FIFA 2K9XA 1AYFA 4TMAB 3TCAA 2IO0B 1N60A 2JF5A 2N9KA 2BYTA 3HK0A 5EE0A 1L0XB 1C78A 2JWZA 1UWXA 2JZ3B 1H7WA 1HEZE 1RRBA 1KJTA 2LGDA 3HUIA 2RDGA 3SDLC 1JRUA 1PUTA 5LNK1 2DENB 1ZDVA 1V9JA 1BUIC 3Q14C 1C4CA 3X0WA 2Z0EB 4ASWC 1T5XD 1FIQA 2AYOB 4P16A 3GS2A 2WXJA 2QMTA 2V0GA 1ZE3D 3MJ5A 3N9YC 1WXVA 1KH0A 1NENB 1LFDA 2LXCA 2IJ0A 2AQ1B 3VUWA 3VXWA 2JYTA 3ZNZB 4S17A 2D11A 2D2QA 1V2YA 4EE2A 4RCOA 1UF0A 2NPTB 1I4RA 4WQOB 2JY6A 3AE9B 2BVCA 4G50A 1EUVB 1FFUA 2R2QA 4IWOA 3Q6BA 4FULA 1WXMA 2KKCA 2INCC 3KWVA 2BYVE 4G3XB 3PHXB 3AM9A 2FCSA 1UGMA 4M0WA 4EFOA 1IYFA 2Y3AA 1X1MA 3Q8CA 2TSSA 2O6VB 2V3PA 4LLGM 2R61A 3BY4B 3AEFB 3Q3OC 1V5OA 3LDZE 3VVWB 3V60A 4IM3A 4HCPB 4HXDA 2QILA 5D3DA 1HA5A 3WALA 1PFDA 2LI5A 1VJKA 1YQ4B 2IO1B 2I1KA 5GXGB 3AEBB 1T3QA 1XLPA 1DOIA 1ZW7A 5J17A 2AL3A 1GJZA 2E6XA 5DPTA 3RMKC 4ZDVA 2IGGA 1MFWA 4KGRA 4HLEA 2CS4A 4E71A 3A1QB 4AJYB 3AMZA 3QK0A 2AX5A 3AXCA 2J0MA 1WYGA 4MACA 5AZGA 1PGXA 2ZW1A 2KQ4X 3ZUNA 2HE7A 1B9RA 1J8CA 2PE6B 4XC2A 4JL9A 1FRDA 1XLOA 4YXDB 3VH3B 4B6WA 3ZXVA 3EFUA 3L54A 4AQ7A 4P1BC 4JIOU 4A8XC 2V3SA 4WJQA 1QLBB 4FN2A 3LB8C 1V6EA 3TEZA 2G1EA 2DX5B 1FEHA 2CR5A 3JYUA 2WS3B 1L6VA 2ICIA 2QHOA 2K5PA 4BZAA 2KACA 2EMSA 3OWEB 4PT5A 2NPTA 2L3ZA 2DZJA 4F1SA 4DHZE 4JGHB 1PQSA 4D2KA 4LTUA 2DWQA 3C8YA 1IPGA 2WXHA 3UI3A 2JRIB 4G0NB 4GDKB 2WDVB 1JWMD 1TT5B 1BXTA 3V6EB 1ISNA 4M00A 4M8NA 4B95A 3AEEB 3RYTA 2CHZA 3L0WB 1HTQA 2PVOD 3AE4B 2V4IB 4OZBA 4BKSD 2PPHA 5LXIB 2K3UA 1R4NI 2LVOA 1UUPA 2KWDA 3QHTA 4LNNA 2J42A 2QCZA 3X23A 1FCCC 4BKGA 1QILA 1D3ZA 4US9A 2I1JA 2LHDA 2MWSB 3MTNB 4GSWA 2DAJA 3NVZA 3A1QA 1DYQA 3HM6X 5FR3A 2G3QB 1SEBD 1H4RA 4IM2A 4HDOA 4LNOA 1K50A 4KZ0A 1MG4A 1EF5A 1WR6E 1QOGA 1YX5B 1UNSA 2LUEA 4JX1C 4LK0M 3RCZA 1J19A 1N61A 2OHFA 3C19A 3Q8FA 3SU8X 1N6ZA 4DWFA 4IKGA 3Q3NC 2V1YA 3PGEA 4NAMA 2Y5PA 2YEPB 2WXFA 4DBGA 2PEAA 1FMAD 4DXAB 2N1WA 5D2MB 1YN4A 4IUMB 1PGBA 2IPKD 3I5JC 1HE8A 2C7NB 3KYCD 4ACFA 3R66C 2KC1A 3Q3MC 5CHWA 5BYQA 2IBIB 4LJOB 1SE4A 2MRPA 3MJWA 2NTSA 5H92C 1UD7A 4C56C 3R7QA 4B9KA 3ZDTA 1GC7A 2BWES 3KUZA 1C77A 3DHGC 1WGYA 4ZRQA 4IDIA 5IN7A 4BOZB 2MBOA 3DOWA 2ZNVC 2LD9A 1F77A 2J0JA 1LXDA 3SHQA 4GDKA 4A3OA 3PVLA 2N0SB 1GB1A 3W9CB 1VRAB 2N9PC 4YWGG 2L52A 2IY1B 4TV3A 2XBBC 3M95A 1UGJA 2LJ5A 4N59A 1I42A 4FLHA 3PT2B 4R3DA 4W9CA 4BBNF 3ZJVA 1FNWA 4KDLB 3RFZB 2PKOA 4RF1A 4XDCA 4HJKA 4CHKA 2HD5B 3AE2B 3L4PA 4OVVA 2MBEA 5GMVA 1PDXA 3AN1A 1WI0A 4XYCA 1V81A 3AE3B 4HK2A 3UINB 1OQQA 2NS5A 4PS8A 2L83A 3IBEA 2MQJA 4CQNA 5AZFA 3VTVA 2D3BA 4XDDA 4ANUA 3DVGY 4KSLC 2ZCCA 4ANVA 1KLUD 4C80A 1AW7A 3V62A 2HDEA 3OG5A 4BBNC 3RULA 1VZ7A 2CU3A 2KC2A 1JCKB 2D3CA 3BWUD 4WQMA 4C4VA 4KGTA 2V3NA 1WR1A 2DHZA 5T8IA 3M63B 2BB6A 2JU6X 4EZLA 1XLQA 2BPSA 2MHJA 3RNCC 3LJ3A 3DVGX 3CIRB 1YNTE 1Q5WB 1E7PB 1NEKB 2L00B 1NYQA 2HJ1A 4AP4C 1ZKHA 1I4XA 1F2RC 3R7RA 3ZTDA 4LCDE 5IO9A 2SEBD 1SE2A 1TTNA 1CJEA 1ET9A 4BFRA 1J7CA 2D3GA 4Q2JA 1VCBA 3QA8A 4XGAB 4W9GA 4K81A 1TY2A 3ML9A 4HJGE 2W3RA 3U7DA 5E6JA 3IT6B 2BB5A 2J0KA 1SE9A 1WYWB 2KO3A 3K9PB 1J7AA 3Q3FA 3L16A 3CF4A 4TSSA 3U4EG 3MP9A 4YSZB 3DBRB 2WXNA 2GBMA 3UIPB 4MSQB 2L0FA 4FJYA 4HWIB 4BAXA 3N1ZC 4WJPA 1ACCA 3U2SC 2HTME 1L0VB 4ZHOA 1NI3A 3AU4A 3N30A 2MX2A 1TY0A 5AEKB 2KWVB 3IG3A 2D10A 4WWOA 3NHEB 1SIFA 3NVVA 4ITKA 3BVGA 1A70A 5I4DA 2GBJA 2NR2A 5JHBA 3DWMA 2DYBA 4OHJA 3BVZA 3GOEA 1J0GA 1H8CA 1HZ5A 3IAS1 1WJUA 3UQBA 1CQVA 2DBYA 2K22A 4RFBA 1TGZB 4ZRPA 3BIID 1T6BX 2WXIA 3QQ8B 3RN9C 3ECIA 4S0RA 1JRPA 1QZEA 3DBHB 1TS5A 2DZIA 3TEXA 1Q0WB 3JSVB 4NZLB 3L10B 2LJIA 2ZZPB 1CZPA 2QC8A 1P9DU 4BKSA 2WGSA 3ENEA 1L6UA 2LGIA 1XLNA 2RGFA 4L2YA 1WE6A 2AQ2B 4K3BA 5DCNA 4FA6A 2XEWA 2KAJA 1WX8A 5CHVC 2EKIA 2LVQA 3PZDA 5E6PA 3P2BA 2L32A 5JHAA 2KDIA 4WAAA 4II3B 3V05A 4XX5A 1MHXA 3A4RA 1MHHE 2N9LA 1WF9A 4P6VF 3Q8EA 3NUHB 2KLGA 2WXLA 4A3PA 3TEWA 1KM7A 1YOVB 4MGYE 2KNBA 2CU1A 3H7SA 1EU4A 2IDYA 4TQ1A 2XN9C 1L0YB 5AZHA 5BMIA 3WIMA 3Q8BA 4AJWA 1I4HA 1ZDXA 4K7WA 1WFYA 5DPSA 4DHJD 2MSED 4RGMA 5C1ZA 3T3OA 1SXTA 4M01A 1QOBA 2QIEB 5C3JB 2IZVB 1D5ZC 1E9MA 1I7HA 1WE7A 2OJWA 1Q10A 4GXBA 5BMHA 1E7UA 5FK9C 1FXAA 3PSEB 1I4QA 4J6IA 1N5XA 4A90A 3ONSA 5G5GA 2KQ7A 2WQYB 5G55A 1K53A 3KWLA 3NZUA 2KX3A 4A6QA 4ZYSA 1MVKA 2DNFA 3PO0A 4YT0B 1E8WA 4II2B 3JSVA 4GOCA 4KV2A 3AEGB 2N9XA 1CMXB 5LLIA 3AECB 3QWZB 3S2AA 4RGNA 1Q1OA 4WJNA 4HDQA 1J7BA 1AN8A 1NBFC 1WSPA 3I57A 2WXRA 3PLUA 1GB4A 5EDSA 2KJHB 2WXPA 1CK1A 3VRAB 1WGDA 2M0AA 3A9KB 2WDTB 4PYUA 1KTKA 1SGHA 2GB1A 2WDRB 1FO4A 2KDEB 5FKAC 3AV8A 2BW2A 2ZJDA 1LM8B 1KLVA 3B9JA 4HVBA 4K7SA 4FHKA 3U52E 4I6NB 3H7PB 1Z5SB 4HKZE 3ZDMC 3N1YC 2MJ3A 1SSNA 1S3SG 5G5HA 2GLSA 2MBQA 3B2FA 2INDC 3NS1A 2VH1A 4JE3B 4DXFA 3B2GA 1WRDB 3NS8A 1C76A 1P98A 1V97A 1GPXA 3FKYA 3PREA 3T8MA 1WJNA 2OEDA 4KVGB 5H8YE 1FFVA 1RYJA 5E6OA 3CSFA 2FE8A 3DBSA 3VHTC 3NRZA 1F9JA 1WY8A 2JWUA 4N58A 2ZCBA 1T0YA 4DDID 3PTFC 4K3CA 2KDBA 1AWDA 4MSMB 4UDUC 2IYDB 3IXSA 3ZIMA 3ETRA 4IW0A 3KQ4A 3CF6E 3U8ZA 1QOAA 3N3KB 3SFEB 1YD8U 2VH2A 3W2DA 3WAMA 1ZXIA 2J52A 4DHJB 1TBEA 3ZJTA 4W9FA 3E9SA 2G9HD 4M02A 4P1CC 3EA6A 3RNFC 4OVZA 4MJSB 3A9KA 4L23A 2W3SA 3L13A 3KYDD 2ZW0A 5MPOA 3DDCB 2DAFA 1WXAA 2WWZA 3QCAA 1P7FA 4DHZB 3CMMB 4YTNB 1JW9D 1RWSA 3FILB 2W55A 2H89B 2C5LC 2WXGA 3R8BA 2RPVA 1A5RA 3OLMD 2WYQA 4A20A 1VZ6A 3A9JB 4GIVA 1D4BA 3RNAC 4FJVB 5CHFA 2YLMA 5L95C 3KUDB 1EM7A 4YSYB 2KDMA 3H7PA 3EUB2 4MELA 4GU2A 4WWPA 3VDZA 3M62B 4C4VB 3W1YA 4JQWC 3PHWB 2DZKA 1C3TA 1V5TA 3PRZA 1TZ1A 2R2OA 1E6EB 3U30A 1OTRB 1FNUA 1R7SA 1ENFA 1JWSD 1V1PB 3TSSA 1SJED 1YQ3B 3Q8AA 3V61A 2N1VA 1MJDA 3K9OB 5D94A 2KWCA 1D5XC 2JQRB 1C4PA 1QOFA 1E10A 3I63C 1WZ0A 4RH6A 5BYRA 3HM3A 2KMMA 1I4GA 2KN4A 1TKGA 4O1NA 1IBXB 2JXTA 4W9HA 5DPWA 1SJHD 2LWPA 3CSTA 3GZNI 3UF8A 1WX9A 2ONQA 1GOZA 3DBRI 1UBQA 4LJPB 4XZ4A 3U7ZA 1DOYA 1B1ZA 2LGYA 1Y8RC 3KW5B 2N7JA 2WXQA 4RNAA 1E7VA 2ZPYA 4QAYA 2IO2B 5D3IB 4B0MA 5HFYA 1YJ1A 2BS4B 2BKRB 3H9DA 2ACZB 1BMLC 1F2RI 4YTMB 1PYWD 2MP2A 5IAAC 3W5UB 3AE8B 3IFWB 1YN3A 3HRDD 4ZRKA 5D6JB 1STEA 1ESFA 4GN1A 1RAXA 2ON8A 2WXMA 3MC0B 3TIXA 2BGFA 2BBCA 4GLSC 2EKEC 3VTWA 1WGGA 2PVGC 3KUCB 3O65B 3Q69A 4MJSA 4PS3A 1EF1A 1N63A 2KD0A 1NI2A 1VDVA 3MHZA 3RNBC 1L2NA 4A9AA 2MW5A 3P4PB 5D7GA 2ZNVB 3DHHC 3FILA 4E74A 3IHPC 1H7XA 3DBHI 4K7UA 1JALA 3A9JA 4US8A 2RMMA 3AH7A 2L0TA 4EKUA 2IY0B 1GUAB 4MM3B 2KJRA 4JWUC 4DDGD 1FPYA 1VZ8A 4KSKC 3P42A 1SE3A 1V8CA 4ZRJA 2W54A 2B76B 1QF6A 2FCMA 2WXOA 1AARA 1P1AA 1WRIA 1V1PA 4C7ZA 2L7RA 2KT7A 1XCTL 1YIWA 3TJPA 2DYOA 2JRHA 1WWTA 1KRHA 2K6QA 4C00A 2KQSA 1E0ZA 5AUIA 1IBXA 2FNJB 3D32A 3B08A 1OEYJ 4KGSA 4RF0A 4DQOC 1EO6A 1NDDA 1T0QC 4ARIA 1TS2A 3ZW3A 5HKHA 2INPE 5C23A 1VR9A 2BF8B 3R2IA 3N20C 3ZYYX 1JMLA 5AUKA 4M8MA 2UU7A 1UWMA 4LNFA 3KVFB 2LXAA 2JX5A 3VR9B 3PZ8A 3MC9A 3VH4B 1E90A 1XF5L 4H2AA 2JT4B 4XE0A 1T0SC 4GDLB 2KYWA 1EWCA 4HEA1 1U4AA 2LGXA 2AQ3B 3VQIA 2H88B 2M1MA 2FCQA 4W9KA 4HCNB 3AEDB 2CKHB 2WNMA 2Y5BB 5L83A 4IM0A 1FRRA 1VD2A 1XT9B 2QSDA 3DBLB 1RLFA 4I6LB 1K8RB 4FXCA 2ZEQA 2K39A 3LXFA 2PE9A 2SAKA 2KK8A 2M4NA 4NJCA 1EU3A 2BWFA 4MM3A 1NYRA 3P4SB 1WIAA 3HHMA 4EZJA 3VUYA 1E8YA 3IAM1 4G11A 2RSUA 3VFKA 3RZFA 3PS6A 2KX0A 3MFGA 2MJEA 1IGDA 4NAWB 3OJ4B 5JXVA 3APCA 2Z8LA 1M4VA 2PMVA 1GC6A 1K52A 2QDFA 2L76A 1TS3A 2JZPA 3E56A 1TKYA 1C79A 4MGKE 1WJ4A 3AULA 4F8CB 2FIDA 4NY0A 2BT6A 2LGSA 2BQQA 4KKIA 4JLCA 4LDTD 2PIAA 1WMHB 1HTOA 1QT9A 1YX6B 2CJNA 3Q2AC 4LNIA 2MH7A 2J53A 3PRPB 4KKJA 5C2TB 2D3AA 4ANXA 2KZRA 1N5WA 3P63A 3RT3B 4N9F4 3Q3JA 5IKCM 2EMTA 4GDLA 3WANA 3LYYA 3N1XC 2BTEA 3APFA 3GE3C 2GBKA 1OGWA 1XD3B 3OJ3A 3SR6A 1QQRA 2PJHA 3C0RB 3NZSA 4KZCA 4F7ZA 1TZOA 4MDKE 3HVDA 2MCNB 3TEYA 5J18A 1WGRA 3JW0X 2LVPA 1WM2A 5IA7A 3QC8B 3W1SC 2A4ZA 4PK1A 2K8HA 3I9V1 3AE7B 1UELA 4EOYA 3GE8C 1IUEA 3ABVB 2W82A 2DLBA 2MLBA 3VRBB 4AOFA 3PRMB 4MH0E 2JVCA 4WJOA 3BZDB 1FXTB 5EE9A 4N6EB 2KVRA 4B0EA 1RM6C 1UZXB 4FADA 2BYEA 3AI5A 3P4QB 2MEKA 2XK5B 3BK2A 4EZKA 2L1AA 2KFJA 4RM8A 3OAWA 1GNUA 1XO3A 2INNE 4NAWA 2O2VB 3DWGC 1ET6A 3T3NA 1GTHA 1I35A 4C7YA 4NJ7A 1DOXA 2WX0A 2VZKD 3ZTCA 2WX1A 3RI7C 4WIPA 5KHQA 2GBNA 3EFCA 1YJJA 1D6EC 1WZ3A 4MEMA 3T9LA 1NVID 2WLBA 3BINA 4XWWA 5LXHA 1KLGD 3DVNV 1ZXHA 3KLSX 2LFIA 5DPRA 5BYSA 2BS2B 4A55A 4TUUA 2FAZA 4OVUA 3UIOB 3HVZA 3RUIB 3WCQA 2QJLA 1WMHA 1FXIA 4ZRIA 1LQBA 4WH4A 4YL8A 1R4MB 2G45B 3J9CA 2KOXA 3AE5B 2KANA 2NMQA 3PZ7A 4W9JA 3ZNID 5CX3A 1SF0A 3NZ3A 1RFAA 2B3AA 2Z0DB 2JXXA 1MPEA 1KOTA 1TS4A 1WM3A 4EEWA 2K6DB 2Y5CA 4KDIC 2LASA 1E8XA 2I38A 1YQBA 2BS3B 2JYEA 4W9DA 2W9NA 4DK5A 3QX1A 1JROA 1OQRA 2GMIC 2K1FA 2RDBC 3NG0A 1XCQL 4HKQA 2LZ6A 5JZEB 3V3XA 1SBBB 5HI1A 3TMPB 4OZAA 4ICVA 3QAQA 1F0ZA 2VRRB 3JVZX 4NQLB 5TSSA 1L4ZB 1TIFA 1QKZA 3SFDB 2ZPNA 2MBHA 3ALBA 3NVWA 2KMCA 4LDTB 3DHIC 2YEPF 2J4XA 4E3CA 1N62A 4PS7A 1FCLA 5KHOA 2MP2B 1XXGA 3NJTA 2LHEA 3AE1B 1ZUD2 1JQ4A 2C7HA 3EGRA 2OOBB 3KH0A 2YVCA 3ZNGC 2C60A 2XK5A 3DVNU 2BKFA 4ZHPA 2O2VA 2KWUB 3QARA 2O6VA 4EUTA 3ZGZA 2G4SA 2I2YA 4IWQA 2A5UA 3DCGA 5HHDG 5JH5C 1WH3A 3RNEC 1V80A 2DYMA 3TUOA 4CYEA 1SIJA 3A4SC 4WWMA 3W1SA 3I3TB 2K0PA 1VLBA 2GBRA 2LRWA 4OZCA 2FUG1 4W9IA 3NVYA 2Z59B 2NVUI 1FM0D 2KVZA 1GTEA 1OFFA 4HPLB 3UQAA 2IO3B 4MT5A 2L8JA 4ANWA 4URKA 5EE3A 4ICUA 2FUHB 4RGOS 1LO5D 1BT0A 3RZWC 4HROA 2EELA 3R2TA 4REZA 4RMAA 1IGCA 3ZLZA 5E6NA 2CJOA 2WHIA 5CTRC 3RNGC 1WXSA 2M17A 3ZXRA 2VZKB 2HTHA 1UH6A 4WAFA 2KHWB 1V86A 2J7QB 1HQRD 2FBWB 3VR8B 1UBIA 1YN5A 4TKNA 4IWPA 3DPDA 4I6PA 2KFKB 1OQYA 3BYYB 3O13A 1K51A 5BO4B 5IP4D 2ASQA 2K8CA 1C9FA 2KTRB 4NQKE 3URYA 2M0XA 5FR6A 1KF6B 4MH8A 3EC8A 1WGHA 3QJZA 1D5MC 2REXA 1WXQA 3PPAA 4LNKA 1ZGUB 3EECA 1WX7A 1S1QB 4BVUC 3PLVA 3ZNHB 2XNAC 2ZVOA 3BVMA 2KN5A 2N7EA 1GG3A 2L05A 2KDFB 4GGQA 3HIZA 2G4DB 4ARCA 2D07B 1TJEA 4BOSC 1RFKA 4X57B 2OJRA 3A33B 2Q5WD 3AE6B 3H1UA 3PV1A 2WU2B 4IOIE 5HG2A 3DBLI 1XEEA 3L08A 3DQVA 3ZVVA 1E8ZA 3P1MA 2M8SA 1HZ6A 2MA9B 3NY5A 1Y56A 3RD2A 1WJ6A 3TBLD 2N7DA 3ZJUA 5TR5A 1C4AA 2PLPA 4YTPB 2HJ8A 2X38A 3TL5A 2JUOA 3H8HA 2RR9A 1R4NB 3EHVA 4KIKB 1M94A 4YSXB 1FD6A 4AUQC 3VAWA 2NBVB 3RPFC 2K8BA 4NJ6A 1TKEA 2V4LA 2BYFA 2LMCA 1SB3C 3VTUA 2FCNA 3B1LX 1I4PA 4K1RB 4JPSA 3MC8A 4TQ0A 3P4RB 4WURA 4MGIE 1MG8A 3H6NA 1MI0A 2E3TA 2WP9B 4XWTA 3SD5A 1TYGB 2IGDA 1ZP0B 3ZQ4A 2V9HA 2AWTA 3GP7A 1F52A 3SEBA 2KMAA 2NBUA 2N9EB 2KFKA 1GT8A 3WAPA 1JWUD 3AU5A 4KX6B 2D5GA 4P7IA 4RM9A 1V1OA 5G2NA 2IGHA 2KTRA 4GB9A 2JZZA 4FBJB 3BK1A 2NCNA 3ZO5B 3GB1A 2KTFA 2RPQA 3L17A 4OW0A 5IOIA 4MGZE 3B0AA 1T0RC 1LGRA 4USAA 2M19A
chains in the Genus database with same CATH topology
4IDIA 3LYYA 3NRZA 1ZOYB 1YMHE 2BTEA 2JWUA 4N58A 3SR6A 1QQRA 1F77A 1YJIA 1DGJA 2N0SB 1GB1A 3FC4A 1AWDA 4UDUC 3W9CB 1TZOA 1VRAB 3IXSA 3ETRA 3HVDA 3KQ4A 3TEYA 4YWGG 1JWBD 4AS1A 3AEAB 3BYTB 2L52A 2MJDA 3FAHA 1QOAA 1L5PA 4HRSA 1UGJA 3CWIA 3SFEB 2M56B 3I9V1 4N59A 3AE7B 2WXKA 1P7EA 1EWYC 3W2DA 3W5VB 2QEJC 1IUEA 4R3DA 3ABVB 1ZXIA 2W82A 3ZJVA 2DLBA 1FNWA 3RFZB 2PKOA 3VRBB 2J52A 4RF1A 2PW9A 2RDHA 4JWSC 4XDCA 1FNVA 1ROEA 3L4PA 3AE2B 3ZJTA 3BZDB 5EE9A 1PDXA 4N6EB 3E9SA 4B0EA 3AN1A 1ZPSA 1RM6C 2G9HD 3AE3B 3EA6A 3P4QB 2MEKA 3BK2A 2L1AA 1OQQA 4OVZA 4L23A 2LEKA 2L83A 2W3SA 1XO3A 2INNE 2PTLA 2ZW0A 3DWGC 5MPOA 1ET6A 1WGKA 3T3NA 4CQNA 2JSVX 1GTHA 4C7YA 1DOXA 1KFYB 4XDDA 1P7FA 2VZKD 5EE1A 4YTNB 1JW9D 1RWSA 5BMGA 3FILB 4WIPA 2W55A 4C80A 1KLUD 2H89B 1AW7A 2WXGA 1YJJA 1D6EC 3R8BA 2RPVA 2HDEA 4RGTA 2LUMA 1NVID 2GI9A 2WLBA 1VZ6A 1PGAA 1VZ7A 4J3OD 1D4BA 2WU5B 2CU3A 4XWWA 1GAQB 3AB5A 1JCKB 1KLGD 1EM7A 1ZXHA 3BWUD 4YSYB 4WQMA 2KDMA 3KLSX 2LFIA 1HXYD 4KGTA 5BYSA 2V3NA 2GRIA 2BS2B 3EUB2 4A55A 4DXGA 5T8IA 2BB6A 3HVZA 3WCQA 2JU6X 1XLQA 2QJLA 1FXIA 3CIRB 1JWAD 1YNTE 4L1BA 1L4DB 3IT4B 4WH4A 4ZOHC 1E7PB 1NEKB 1E6EB 1NYQA 2NTTA 3J9CA 1FNUA 2WDQB 1I4XA 1R7SA 1F2RC 3AE5B 2K9XA 1ENFA 2NMQA 1AYFA 3PZ7A 1JWSD 2SEBD 4TMAB 1SE2A 1CJEA 1V1PB 1N60A 1SF0A 2N9KA 1ET9A 3NZ3A 2BYTA 3TSSA 1SJED 1YQ3B 1MPEA 3Q8AA 5EE0A 1J7CA 1L0XB 1C78A 1TS4A 2Y5CA 4Q2JA 1UWXA 1D5XC 2JQRB 1C4PA 1QOFA 1H7WA 1HEZE 1E10A 1TY2A 4HJGE 2I38A 2W3RA 4RH6A 5BYRA 3HUIA 5E6JA 2BS3B 2JYEA 2BB5A 2KMMA 1I4GA 2RDGA 3IT6B 2KN4A 1TKGA 4O1NA 1PUTA 5LNK1 1IBXB 1JROA 1OQRA 1ZDVA 2JXTA 1XCQL 4HKQA 1J7AA 1SJHD 3V3XA 1BUIC 1SBBB 3CF4A 4TSSA 5HI1A 1C4CA 3U4EG 2ONQA 3MP9A 1GOZA 4OZAA 1F0ZA 4YSZB 1T5XD 1FIQA 3U7ZA 1DOYA 2WXNA 4P16A 5TSSA 1B1ZA 3GS2A 1L4ZB 2WXJA 2N7JA 2QMTA 1QKZA 1ZE3D 2V0GA 3SFDB 2WXQA 3MJ5A 3N9YC 4RNAA 1KH0A 3NVWA 1NENB 5D3IB 4B0MA 5HFYA 2IJ0A 2AQ1B 2BS4B 1ACCA 2JYTA 3U2SC 2ACZB 1BMLC 1F2RI 2HTME 4YTMB 1PYWD 1L0VB 2YEPF 4ZHOA 4EE2A 1NI3A 4RCOA 2J4XA 3W5UB 1TY0A 1I4RA 1N62A 3AE8B 1FCLA 1YN3A 3HRDD 3AE9B 1XXGA 1STEA 1ESFA 2LHEA 3AE1B 1ZUD2 2ON8A 2WXMA 3MC0B 3NVVA 4ITKA 1FFUA 3BVGA 1A70A 5I4DA 1JQ4A 2BBCA 3EGRA 4GLSC 3DWMA 4OHJA 3BVZA 3KWVA 2PVGC 3Q69A 1HZ5A 4ZHPA 1N63A 3AM9A 1VDVA 3IAS1 1CQVA 3MHZA 2DBYA 2K22A 4RFBA 3ZGZA 4A9AA 2I2YA 4M0WA 3P4PB 5D7GA 4ZRPA 2Y3AA 3BIID 3Q8CA 1T6BX 5HHDG 2TSSA 2V3PA 3FILA 2WXIA 4LLGM 2R61A 2DYMA 1H7XA 3TUOA 3AEFB 1SIJA 1JRPA 1JALA 1TS5A 4WWMA 3W1SA 2K0PA 4US8A 2RMMA 1VLBA 3AH7A 4OZCA 2FUG1 3TEXA 2QILA 5D3DA 1HA5A 4NZLB 3NVYA 2M19A 1PFDA 1FM0D 2LJIA 1CZPA 1GTEA 1VJKA 1YQ4B 5GXGB 1OFFA 3AEBB 1T3QA 1XLPA 4MM3B 1DOIA 4JWUC 2E6XA 1L6UA 4MT5A 2LGIA 2IGGA 1VZ8A 3P42A 1XLNA 4KGRA 1SE3A 1V8CA 2W54A 2B76B 5EE3A 4L2YA 2AQ2B 1QF6A 4RGOS 2KAJA 2WXOA 3AMZA 1LO5D 1WRIA 4HROA 2EKIA 2AX5A 2EELA 1V1PA 3R2TA 4REZA 4C7ZA 1WYGA 1XCTL 4MACA 1IGCA 2DYOA 2CJOA 1PGXA 2ZW1A 2KQ4X 2L32A 1WWTA 1B9RA 3V05A 1KRHA 1MHXA 1MHHE 2N9LA 1FRDA 1XLOA 4YXDB 4P6VF 2VZKB 3Q8EA 1E0ZA 3NUHB 5AUIA 1IBXA 2WXLA 3TEWA 4WAFA 4AQ7A 4KGSA 4A8XC 1HQRD 4RF0A 2FBWB 3VR8B 1QLBB 4DQOC 3LB8C 3TEZA 4ARIA 1EU4A 1TS2A 2IDYA 1YN5A 2G1EA 2INPE 4TQ1A 2XN9C 1VR9A 1L0YB 1FEHA 5BMIA 3R2IA 2WS3B 3BYYB 3O13A 3ZYYX 1JMLA 1K51A 1L6VA 2ICIA 1C9FA 3Q8BA 1I4HA 1ZDXA 5AUKA 3URYA 2K5PA 1KF6B 1UWMA 4MH8A 2KACA 3OWEB 4PT5A 1D5MC 2JX5A 1WXQA 4RGMA 3VR9B 3PZ8A 3T3OA 1SXTA 1QOBA 1XF5L 2QIEB 4H2AA 5C3JB 4D2KA 1D5ZC 1E9MA 4XE0A 2XNAC 3BVMA 1I7HA 4LTUA 4GDLB 1EWCA 4HEA1 2DWQA 4ARCA 3C8YA 1Q10A 2AQ3B 2WXHA 3VQIA 2H88B 1TJEA 3UI3A 5BMHA 5FK9C 1FXAA 1RFKA 1I4QA 1N5XA 3AEDB 4A90A 4GDKB 2WNMA 2WDVB 1JWMD 2Q5WD 3AE6B 5G5GA 1FRRA 4IOIE 2WU2B 2WQYB 5HG2A 2QSDA 1BXTA 1K53A 1XEEA 3KWLA 3P1MA 3AEEB 4A6QA 4ZYSA 1HZ6A 1MVKA 1Y56A 3PO0A 4FXCA 2PVOD 3ZJUA 4YT0B 1C4AA 3AE4B 3LXFA 2V4IB 4OZBA 2PLPA 2SAKA 3AEGB 2K3UA 4YTPB 2X38A 4NJCA 3AECB 1UUPA 3H8HA 2KWDA 1EU3A 2J42A 4RGNA 1FCCC 1NYRA 1J7BA 1QILA 4YSXB 1AN8A 4US9A 1FD6A 1WSPA 3I57A 2WXRA 3P4SB 2LHDA 1GB4A 2WXPA 3NVZA 3IAM1 1CK1A 3VRAB 1DYQA 5FR3A 3RPFC 1TKEA 2M0AA 1SEBD 3MFGA 2MJEA 1IGDA 4NAWB 1K50A 1KTKA 2LMCA 1SB3C 2GB1A 2WDRB 5JXVA 1QOGA 1UNSA 2Z8LA 1M4VA 2PMVA 1FO4A 1I4PA 4JX1C 4JPSA 1K52A 4LK0M 5FKAC 3AV8A 2BW2A 1TS3A 4TQ0A 2JZPA 3P4RB 4WURA 3E56A 1N61A 1TKYA 2OHFA 3Q8FA 1C79A 1MI0A 2E3TA 2WP9B 3B9JA 4XWTA 4IKGA 1TYGB 2BT6A 4NAMA 3U52E 2IGDA 2Y5PA 1ZP0B 2YEPB 3ZQ4A 2WXFA 3GP7A 4HKZE 1FMAD 4KKIA 3SEBA 2PIAA 1YN4A 2MJ3A 1PGBA 2IPKD 1SSNA 1GT8A 1QT9A 1JWUD 2CJNA 4KX6B 5G5HA 2D5GA 2MH7A 2J53A 1V1OA 5BYQA 2IGHA 3B2FA 1SE4A 3NS1A 4JE3B 4KKJA 4DXFA 2NTSA 5C2TB 3B2GA 3BK1A 1C76A 3GB1A 5H92C 1N5WA 4C56C 1V97A 1GPXA 4OW0A 3P63A 2OEDA 4USAA 5H8YE 1FFVA 1C77A 1RYJA 4ZRQA 2FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  1GTE A;  1VJK A;  1ZOY B;  3KWL A;  1AYF A;  3NRZ A;  1YQ4 B;  5GXG B;  1OFF A;  3P1M A;  3AEE B;  3AEB B;  1CJE A;  1T3Q A;  1N60 A;  1SF0 A;  1XLP A;  1DOI A;  4JWU C;  4N58 A;  1YQ3 B;  5EE0 A;  1L6U A;  3SR6 A;  1YJI A;  3PO0 A;  1J7C A;  4FXC A;  1DGJ A;  2PVO D;  4YT0 B;  2Y5C A;  1XLN A;  3AE4 B;  3LXF A;  1V8C A;  2N0S B;  2JQR B;  3FC4 A;  2W54 A;  1QOF A;  1H7W A;  2B76 B;  5EE3 A;  1E10 A;  3AEG B;  1AWD A;  1QF6 A;  3W9C B;  4YTP B;  2W3R A;  3ETR A;  2KAJ A;  3AMZ A;  3AEC B;  3HUI A;  2BS3 B;  1JWB D;  1WRI A;  3AEA B;  2KMM A;  2EKI A;  4HRO A;  2AX5 A;  2L52 A;  2MJD A;  3FAH A;  1TKG A;  1PUT A;  4C7Z A;  1QOA A;  1JRO A;  1OQR A;  1WYG A;  1R7S A;  1NYR A;  1L5P A;  1J7B A;  4HRS A;  4YSX B;  3CWI A;  4US9 A;  3SFE B;  1J7A A;  2M56 B;  4N59 A;  2CJO A;  3AE7 B;  3CF4 A;  1EWY C;  3P4S B;  3W5V B;  1WWT A;  1B9R A;  1F0Z A;  1IUE A;  4YSZ B;  1FIQ A;  1KRH A;  1DOY A;  3NVZ A;  3ABV B;  3VRA B;  1ZXI A;  1FRD A;  1XLO A;  4YXD B;  3RPF C;  4P6V F;  1TKE A;  2PKO A;  3VRB B;  2MJE A;  3SFD B;  1E0Z A;  4JWS C;  5AUI A;  1ROE A;  3NVW A;  3L4P A;  3AE2 B;  1NEN B;  1SB3 C;  2WDR B;  5EE9 A;  1QOG A;  2BS4 B;  1PDX A;  4N6E B;  2FBW B;  3VR8 B;  1QLB B;  3AN1 A;  2ACZ B;  2HTM E;  4JX1 C;  1FO4 A;  4YTM B;  1RM6 C;  1L0V B;  3LB8 C;  4ZHO A;  3AE3 B;  3AV8 A;  1NI3 A;  3P4Q B;  3P4R B;  2G1E A;  3W5U B;  1N61 A;  1TKY A;  2OHF A;  1OQQ A;  1N62 A;  3AE8 B;  2LEK A;  2L83 A;  2W3S A;  3HRD D;  1XO3 A;  2E3T A;  3AE9 B;  2WP9 B;  3B9J A;  2WS3 B;  3DWG C;  5MPO A;  3ZYY X;  1L6V A;  1WGK A;  1TYG B;  2BT6 A;  1GTH A;  3AE1 B;  1ZUD 2;  4C7Y A;  1DOX A;  1KFY B;  3NVV A;  4ITK A;  1ZP0 B;  1FFU A;  5AUK A;  5EE1 A;  1A70 A;  1KF6 B;  1UWM A;  2K5P A;  4YTN B;  1CZP A;  1JW9 D;  1JQ4 A;  1RWS A;  1FMA D;  3DWM A;  2W55 A;  2PVG C;  4C80 A;  2H89 B;  2PIA A;  1YJJ A;  2JX5 A;  1WXQ A;  3VR9 B;  2MJ3 A;  1NVI D;  2WLB A;  4ZHP A;  1GT8 A;  1N63 A;  3AM9 A;  1QT9 A;  1QOB A;  1VDV A;  2QIE B;  5C3J B;  2CJN A;  2DBY A;  2K22 A;  2WU5 B;  4KX6 B;  1E9M A;  2CU3 A;  1GAQ B;  2MH7 A;  3AB5 A;  5G5H A;  4A9A A;  1I7H A;  3P4P B;  3B2F A;  4LTU A;  3NS1 A;  4YSY B;  4WQM A;  3BII D;  2DWQ A;  5C2T B;  3B2G A;  2H88 B;  1TJE A;  2BS2 B;  3EUB 2;  1FXA A;  3HVZ A;  3WCQ A;  1H7X A;  1RFK A;  3AEF B;  1SIJ A;  1XLQ A;  2QJL A;  1N5W A;  5H92 C;  1JRP A;  1V97 A;  1N5X A;  3AED B;  1FXI A;  1JAL A;  1GPX A;  4WWM A;  3CIR B;  1JWA D;  4US8 A;  3P63 A;  1VLB A;  3AH7 A;  2WDV B;  4ZOH C;  1E7P B;  1NEK B;  1E6E B;  3AE6 B;  2Q5W D;  4USA A;  1FRR A;  1NYQ A;  5G5G A;  5H8Y E;  2WU2 B;  2WQY B;  2WDQ B;  1FFV A;  1PFD A;  1RYJ A;  2M19 A;  1FM0 D;  3NVY A;  3AE5 B;  2K9X A; 
#chains in the Genus database with same CATH topology
 2CHX A;  1ZOY B;  1YMH E;  3R3M A;  3UGB B;  2CHW A;  3IVF A;  3GZN B;  1YJI A;  1XQQ A;  1DGJ A;  2O6V D;  3FC4 A;  3ZRC A;  2RD0 A;  2JPH A;  4W9L A;  2ZVN A;  2MBB B;  2DZM A;  1P3Q U;  4AS1 A;  1JWB D;  3AEA B;  3BYT B;  2MJD A;  3FAH A;  1IP9 A;  1L5P A;  4HRS A;  3CWI A;  4HPP A;  4NNJ B;  4NPN A;  3ML8 A;  2M56 B;  5J2R A;  2WXK A;  4GMV A;  4W9E A;  1P7E A;  1EWY C;  2C9W B;  3W5V B;  2QEJ C;  1L7Y A;  2KJ6 A;  3M3J A;  2PW9 A;  2RDH A;  4JWS C;  1FNV A;  4KIK A;  1ROE A;  1C1Y B;  4FJZ A;  3NOB A;  4ZYN A;  2LRU A;  4HPM B;  4WWN A;  1ZPS A;  2N4F A;  3V6C B;  2UWQ A;  3WA0 A;  2LEK A;  3VUX A;  1P0R A;  2PTL A;  4IG7 B;  1WGK A;  2JSV X;  3WAO A;  4M0W B;  1KFY B;  3ZRF A;  5EE1 A;  4PYZ A;  2C7M B;  5BMG A;  1G6J A;  3MHS D;  4RGT A;  2UYZ B;  4AWJ A;  2LUM A;  2GI9 A;  1PGA A;  2NBW B;  4J3O D;  2WU5 B;  2KLC A;  1GAQ B;  3AB5 A;  3N32 A;  3APD A;  2KXJ A;  2GOW A;  1F1H A;  1HXY D;  2AL6 A;  2GRI A;  4DXG A;  4FHJ A;  4IC7 B;  2X8X X;  3ZKJ C;  4CO7 A;  1Z2M A;  1OEY A;  1JWA D;  1V49 A;  4L1B A;  1L4D B;  1R4M I;  3IT4 B;  4BKT A;  3QIJ A;  2AEH A;  4ZOH C;  2NTT A;  2WDQ B;  1E5W A;  2K25 A;  2FIF A;  2K9X A;  1AYF A;  4TMA B;  3TCA A;  2IO0 B;  1N60 A;  2JF5 A;  2N9K A;  2BYT A;  3HK0 A;  5EE0 A;  1L0X B;  1C78 A;  2JWZ A;  1UWX A;  2JZ3 B;  1H7W A;  1HEZ E;  1RRB A;  1KJT A;  2LGD A;  3HUI A;  2RDG A;  3SDL C;  1JRU A;  1PUT A;  5LNK 1;  2DEN B;  1ZDV A;  1V9J A;  1BUI C;  3Q14 C;  1C4C A;  3X0W A;  2Z0E B;  4ASW C;  1T5X D;  1FIQ A;  2AYO B;  4P16 A;  3GS2 A;  2WXJ A;  2QMT A;  2V0G A;  1ZE3 D;  3MJ5 A;  3N9Y C;  1WXV A;  1KH0 A;  1NEN B;  1LFD A;  2LXC A;  2IJ0 A;  2AQ1 B;  3VUW A;  3VXW A;  2JYT A;  3ZNZ B;  4S17 A;  2D11 A;  2D2Q A;  1V2Y A;  4EE2 A;  4RCO A;  1UF0 A;  2NPT B;  1I4R A;  4WQO B;  2JY6 A;  3AE9 B;  2BVC A;  4G50 A;  1EUV B;  1FFU A;  2R2Q A;  4IWO A;  3Q6B A;  4FUL A;  1WXM A;  2KKC A;  2INC C;  3KWV A;  2BYV E;  4G3X B;  3PHX B;  3AM9 A;  2FCS A;  1UGM A;  4M0W A;  4EFO A;  1IYF A;  2Y3A A;  1X1M A;  3Q8C A;  2TSS A;  2O6V B;  2V3P A;  4LLG M;  2R61 A;  3BY4 B;  3AEF B;  3Q3O C;  1V5O A;  3LDZ E;  3VVW B;  3V60 A;  4IM3 A;  4HCP B;  4HXD A;  2QIL A;  5D3D A;  1HA5 A;  3WAL A;  1PFD A;  2LI5 A;  1VJK A;  1YQ4 B;  2IO1 B;  2I1K A;  5GXG B;  3AEB B;  1T3Q A;  1XLP A;  1DOI A;  1ZW7 A;  5J17 A;  2AL3 A;  1GJZ A;  2E6X A;  5DPT A;  3RMK C;  4ZDV A;  2IGG A;  1MFW A;  4KGR A;  4HLE A;  2CS4 A;  4E71 A;  3A1Q B;  4AJY B;  3AMZ A;  3QK0 A;  2AX5 A;  3AXC A;  2J0M A;  1WYG A;  4MAC A;  5AZG A;  1PGX A;  2ZW1 A;  2KQ4 X;  3ZUN A;  2HE7 A;  1B9R A;  1J8C A;  2PE6 B;  4XC2 A;  4JL9 A;  1FRD A;  1XLO A;  4YXD B;  3VH3 B;  4B6W A;  3ZXV A;  3EFU A;  3L54 A;  4AQ7 A;  4P1B C;  4JIO U;  4A8X C;  2V3S A;  4WJQ A;  1QLB B;  4FN2 A;  3LB8 C;  1V6E A;  3TEZ A;  2G1E A;  2DX5 B;  1FEH A;  2CR5 A;  3JYU A;  2WS3 B;  1L6V A;  2ICI A;  2QHO A;  2K5P A;  4BZA A;  2KAC A;  2EMS A;  3OWE B;  4PT5 A;  2NPT A;  2L3Z A;  2DZJ A;  4F1S A;  4DHZ E;  4JGH B;  1PQS A;  4D2K A;  4LTU A;  2DWQ A;  3C8Y A;  1IPG A;  2WXH A;  3UI3 A;  2JRI B;  4G0N B;  4GDK B;  2WDV B;  1JWM D;  1TT5 B;  1BXT A;  3V6E B;  1ISN A;  4M00 A;  4M8N A;  4B95 A;  3AEE B;  3RYT A;  2CHZ A;  3L0W B;  1HTQ A;  2PVO D;  3AE4 B;  2V4I B;  4OZB A;  4BKS D;  2PPH A;  5LXI B;  2K3U A;  1R4N I;  2LVO A;  1UUP A;  2KWD A;  3QHT A;  4LNN A;  2J42 A;  2QCZ A;  3X23 A;  1FCC C;  4BKG A;  1QIL A;  1D3Z A;  4US9 A;  2I1J A;  2LHD A;  2MWS B;  3MTN B;  4GSW A;  2DAJ A;  3NVZ A;  3A1Q A;  1DYQ A;  3HM6 X;  5FR3 A;  2G3Q B;  1SEB D;  1H4R A;  4IM2 A;  4HDO A;  4LNO A;  1K50 A;  4KZ0 A;  1MG4 A;  1EF5 A;  1WR6 E;  1QOG A;  1YX5 B;  1UNS A;  2LUE A;  4JX1 C;  4LK0 M;  3RCZ A;  1J19 A;  1N61 A;  2OHF A;  3C19 A;  3Q8F A;  3SU8 X;  1N6Z A;  4DWF A;  4IKG A;  3Q3N C;  2V1Y A;  3PGE A;  4NAM A;  2Y5P A;  2YEP B;  2WXF A;  4DBG A;  2PEA A;  1FMA D;  4DXA B;  2N1W A;  5D2M B;  1YN4 A;  4IUM B;  1PGB A;  2IPK D;  3I5J C;  1HE8 A;  2C7N B;  3KYC D;  4ACF A;  3R66 C;  2KC1 A;  3Q3M C;  5CHW A;  5BYQ A;  2IBI B;  4LJO B;  1SE4 A;  2MRP A;  3MJW A;  2NTS A;  5H92 C;  1UD7 A;  4C56 C;  3R7Q A;  4B9K A;  3ZDT A;  1GC7 A;  2BWE S;  3KUZ A;  1C77 A;  3DHG C;  1WGY A;  4ZRQ A;  4IDI A;  5IN7 A;  4BOZ B;  2MBO A;  3DOW A;  2ZNV C;  2LD9 A;  1F77 A;  2J0J A;  1LXD A;  3SHQ A;  4GDK A;  4A3O A;  3PVL A;  2N0S B;  1GB1 A;  3W9C B;  1VRA B;  2N9P C;  4YWG G;  2L52 A;  2IY1 B;  4TV3 A;  2XBB C;  3M95 A;  1UGJ A;  2LJ5 A;  4N59 A;  1I42 A;  4FLH A;  3PT2 B;  4R3D A;  4W9C A;  4BBN F;  3ZJV A;  1FNW A;  4KDL B;  3RFZ B;  2PKO A;  4RF1 A;  4XDC A;  4HJK A;  4CHK A;  2HD5 B;  3AE2 B;  3L4P A;  4OVV A;  2MBE A;  5GMV A;  1PDX A;  3AN1 A;  1WI0 A;  4XYC A;  1V81 A;  3AE3 B;  4HK2 A;  3UIN B;  1OQQ A;  2NS5 A;  4PS8 A;  2L83 A;  3IBE A;  2MQJ A;  4CQN A;  5AZF A;  3VTV A;  2D3B A;  4XDD A;  4ANU A;  3DVG Y;  4KSL C;  2ZCC A;  4ANV A;  1KLU D;  4C80 A;  1AW7 A;  3V62 A;  2HDE A;  3OG5 A;  4BBN C;  3RUL A;  1VZ7 A;  2CU3 A;  2KC2 A;  1JCK B;  2D3C A;  3BWU D;  4WQM A;  4C4V A;  4KGT A;  2V3N A;  1WR1 A;  2DHZ A;  5T8I A;  3M63 B;  2BB6 A;  2JU6 X;  4EZL A;  1XLQ A;  2BPS A;  2MHJ A;  3RNC C;  3LJ3 A;  3DVG X;  3CIR B;  1YNT E;  1Q5W B;  1E7P B;  1NEK B;  2L00 B;  1NYQ A;  2HJ1 A;  4AP4 C;  1ZKH A;  1I4X A;  1F2R C;  3R7R A;  3ZTD A;  4LCD E;  5IO9 A;  2SEB D;  1SE2 A;  1TTN A;  1CJE A;  1ET9 A;  4BFR A;  1J7C A;  2D3G A;  4Q2J A;  1VCB A;  3QA8 A;  4XGA B;  4W9G A;  4K81 A;  1TY2 A;  3ML9 A;  4HJG E;  2W3R A;  3U7D A;  5E6J A;  3IT6 B;  2BB5 A;  2J0K A;  1SE9 A;  1WYW B;  2KO3 A;  3K9P B;  1J7A A;  3Q3F A;  3L16 A;  3CF4 A;  4TSS A;  3U4E G;  3MP9 A;  4YSZ B;  3DBR B;  2WXN A;  2GBM A;  3UIP B;  4MSQ B;  2L0F A;  4FJY A;  4HWI B;  4BAX A;  3N1Z C;  4WJP A;  1ACC A;  3U2S C;  2HTM E;  1L0V B;  4ZHO A;  1NI3 A;  3AU4 A;  3N30 A;  2MX2 A;  1TY0 A;  5AEK B;  2KWV B;  3IG3 A;  2D10 A;  4WWO A;  3NHE B;  1SIF A;  3NVV A;  4ITK A;  3BVG A;  1A70 A;  5I4D A;  2GBJ A;  2NR2 A;  5JHB A;  3DWM A;  2DYB A;  4OHJ A;  3BVZ A;  3GOE A;  1J0G A;  1H8C A;  1HZ5 A;  3IAS 1;  1WJU A;  3UQB A;  1CQV A;  2DBY A;  2K22 A;  4RFB A;  1TGZ B;  4ZRP A;  3BII D;  1T6B X;  2WXI A;  3QQ8 B;  3RN9 C;  3ECI A;  4S0R A;  1JRP A;  1QZE A;  3DBH B;  1TS5 A;  2DZI A;  3TEX A;  1Q0W B;  3JSV B;  4NZL B;  3L10 B;  2LJI A;  2ZZP B;  1CZP A;  2QC8 A;  1P9D U;  4BKS A;  2WGS A;  3ENE A;  1L6U A;  2LGI A;  1XLN A;  2RGF A;  4L2Y A;  1WE6 A;  2AQ2 B;  4K3B A;  5DCN A;  4FA6 A;  2XEW A;  2KAJ A;  1WX8 A;  5CHV C;  2EKI A;  2LVQ A;  3PZD A;  5E6P A;  3P2B A;  2L32 A;  5JHA A;  2KDI A;  4WAA A;  4II3 B;  3V05 A;  4XX5 A;  1MHX A;  3A4R A;  1MHH E;  2N9L A;  1WF9 A;  4P6V F;  3Q8E A;  3NUH B;  2KLG A;  2WXL A;  4A3P A;  3TEW A;  1KM7 A;  1YOV B;  4MGY E;  2KNB A;  2CU1 A;  3H7S A;  1EU4 A;  2IDY A;  4TQ1 A;  2XN9 C;  1L0Y B;  5AZH A;  5BMI A;  3WIM A;  3Q8B A;  4AJW A;  1I4H A;  1ZDX A;  4K7W A;  1WFY A;  5DPS A;  4DHJ D;  2MSE D;  4RGM A;  5C1Z A;  3T3O A;  1SXT A;  4M01 A;  1QOB A;  2QIE B;  5C3J B;  2IZV B;  1D5Z C;  1E9M A;  1I7H A;  1WE7 A;  2OJW A;  1Q10 A;  4GXB A;  5BMH A;  1E7U A;  5FK9 C;  1FXA A;  3PSE B;  1I4Q A;  4J6I A;  1N5X A;  4A90 A;  3ONS A;  5G5G A;  2KQ7 A;  2WQY B;  5G55 A;  1K53 A;  3KWL A;  3NZU A;  2KX3 A;  4A6Q A;  4ZYS A;  1MVK A;  2DNF A;  3PO0 A;  4YT0 B;  1E8W A;  4II2 B;  3JSV A;  4GOC A;  4KV2 A;  3AEG B;  2N9X A;  1CMX B;  5LLI A;  3AEC B;  3QWZ B;  3S2A A;  4RGN A;  1Q1O A;  4WJN A;  4HDQ A;  1J7B A;  1AN8 A;  1NBF C;  1WSP A;  3I57 A;  2WXR A;  3PLU A;  1GB4 A;  5EDS A;  2KJH B;  2WXP A;  1CK1 A;  3VRA B;  1WGD A;  2M0A A;  3A9K B;  2WDT B;  4PYU A;  1KTK A;  1SGH A;  2GB1 A;  2WDR B;  1FO4 A;  2KDE B;  5FKA C;  3AV8 A;  2BW2 A;  2ZJD A;  1LM8 B;  1KLV A;  3B9J A;  4HVB A;  4K7S A;  4FHK A;  3U52 E;  4I6N B;  3H7P B;  1Z5S B;  4HKZ E;  3ZDM C;  3N1Y C;  2MJ3 A;  1SSN A;  1S3S G;  5G5H A;  2GLS A;  2MBQ A;  3B2F A;  2IND C;  3NS1 A;  2VH1 A;  4JE3 B;  4DXF A;  3B2G A;  1WRD B;  3NS8 A;  1C76 A;  1P98 A;  1V97 A;  1GPX A;  3FKY A;  3PRE A;  3T8M A;  1WJN A;  2OED A;  4KVG B;  5H8Y E;  1FFV A;  1RYJ A;  5E6O A;  3CSF A;  2FE8 A;  3DBS A;  3VHT C;  3NRZ A;  1F9J A;  1WY8 A;  2JWU A;  4N58 A;  2ZCB A;  1T0Y A;  4DDI D;  3PTF C;  4K3C A;  2KDB A;  1AWD A;  4MSM B;  4UDU C;  2IYD B;  3IXS A;  3ZIM A;  3ETR A;  4IW0 A;  3KQ4 A;  3CF6 E;  3U8Z A;  1QOA A;  3N3K B;  3SFE B;  1YD8 U;  2VH2 A;  3W2D A;  3WAM A;  1ZXI A;  2J52 A;  4DHJ B;  1TBE A;  3ZJT A;  4W9F A;  3E9S A;  2G9H D;  4M02 A;  4P1C C;  3EA6 A;  3RNF C;  4OVZ A;  4MJS B;  3A9K A;  4L23 A;  2W3S A;  3L13 A;  3KYD D;  2ZW0 A;  5MPO A;  3DDC B;  2DAF A;  1WXA A;  2WWZ A;  3QCA A;  1P7F A;  4DHZ B;  3CMM B;  4YTN B;  1JW9 D;  1RWS A;  3FIL B;  2W55 A;  2H89 B;  2C5L C;  2WXG A;  3R8B A;  2RPV A;  1A5R A;  3OLM D;  2WYQ A;  4A20 A;  1VZ6 A;  3A9J B;  4GIV A;  1D4B A;  3RNA C;  4FJV B;  5CHF A;  2YLM A;  5L95 C;  3KUD B;  1EM7 A;  4YSY B;  2KDM A;  3H7P A;  3EUB 2;  4MEL A;  4GU2 A;  4WWP A;  3VDZ A;  3M62 B;  4C4V B;  3W1Y A;  4JQW C;  3PHW B;  2DZK A;  1C3T A;  1V5T A;  3PRZ A;  1TZ1 A;  2R2O A;  1E6E B;  3U30 A;  1OTR B;  1FNU A;  1R7S A;  1ENF A;  1JWS D;  1V1P B;  3TSS A;  1SJE D;  1YQ3 B;  3Q8A A;  3V61 A;  2N1V A;  1MJD A;  3K9O B;  5D94 A;  2KWC A;  1D5X C;  2JQR B;  1C4P A;  1QOF A;  1E10 A;  3I63 C;  1WZ0 A;  4RH6 A;  5BYR A;  3HM3 A;  2KMM A;  1I4G A;  2KN4 A;  1TKG A;  4O1N A;  1IBX B;  2JXT A;  4W9H A;  5DPW A;  1SJH D;  2LWP A;  3CST A;  3GZN I;  3UF8 A;  1WX9 A;  2ONQ A;  1GOZ A;  3DBR I;  1UBQ A;  4LJP B;  4XZ4 A;  3U7Z A;  1DOY A;  1B1Z A;  2LGY A;  1Y8R C;  3KW5 B;  2N7J A;  2WXQ A;  4RNA A;  1E7V A;  2ZPY A;  4QAY A;  2IO2 B;  5D3I B;  4B0M A;  5HFY A;  1YJ1 A;  2BS4 B;  2BKR B;  3H9D A;  2ACZ B;  1BML C;  1F2R I;  4YTM B;  1PYW D;  2MP2 A;  5IAA C;  3W5U B;  3AE8 B;  3IFW B;  1YN3 A;  3HRD D;  4ZRK A;  5D6J B;  1STE A;  1ESF A;  4GN1 A;  1RAX A;  2ON8 A;  2WXM A;  3MC0 B;  3TIX A;  2BGF A;  2BBC A;  4GLS C;  2EKE C;  3VTW A;  1WGG A;  2PVG C;  3KUC B;  3O65 B;  3Q69 A;  4MJS A;  4PS3 A;  1EF1 A;  1N63 A;  2KD0 A;  1NI2 A;  1VDV A;  3MHZ A;  3RNB C;  1L2N A;  4A9A A;  2MW5 A;  3P4P B;  5D7G A;  2ZNV B;  3DHH C;  3FIL A;  4E74 A;  3IHP C;  1H7X A;  3DBH I;  4K7U A;  1JAL A;  3A9J A;  4US8 A;  2RMM A;  3AH7 A;  2L0T A;  4EKU A;  2IY0 B;  1GUA B;  4MM3 B;  2KJR A;  4JWU C;  4DDG D;  1FPY A;  1VZ8 A;  4KSK C;  3P42 A;  1SE3 A;  1V8C A;  4ZRJ A;  2W54 A;  2B76 B;  1QF6 A;  2FCM A;  2WXO A;  1AAR A;  1P1A A;  1WRI A;  1V1P A;  4C7Z A;  2L7R A;  2KT7 A;  1XCT L;  1YIW A;  3TJP A;  2DYO A;  2JRH A;  1WWT A;  1KRH A;  2K6Q A;  4C00 A;  2KQS A;  1E0Z A;  5AUI A;  1IBX A;  2FNJ B;  3D32 A;  3B08 A;  1OEY J;  4KGS A;  4RF0 A;  4DQO C;  1EO6 A;  1NDD A;  1T0Q C;  4ARI A;  1TS2 A;  3ZW3 A;  5HKH A;  2INP E;  5C23 A;  1VR9 A;  2BF8 B;  3R2I A;  3N20 C;  3ZYY X;  1JML A;  5AUK A;  4M8M A;  2UU7 A;  1UWM A;  4LNF A;  3KVF B;  2LXA A;  2JX5 A;  3VR9 B;  3PZ8 A;  3MC9 A;  3VH4 B;  1E90 A;  1XF5 L;  4H2A A;  2JT4 B;  4XE0 A;  1T0S C;  4GDL B;  2KYW A;  1EWC A;  4HEA 1;  1U4A A;  2LGX A;  2AQ3 B;  3VQI A;  2H88 B;  2M1M A;  2FCQ A;  4W9K A;  4HCN B;  3AED B;  2CKH B;  2WNM A;  2Y5B B;  5L83 A;  4IM0 A;  1FRR A;  1VD2 A;  1XT9 B;  2QSD A;  3DBL B;  1RLF A;  4I6L B;  1K8R B;  4FXC A;  2ZEQ A;  2K39 A;  3LXF A;  2PE9 A;  2SAK A;  2KK8 A;  2M4N A;  4NJC A;  1EU3 A;  2BWF A;  4MM3 A;  1NYR A;  3P4S B;  1WIA A;  3HHM A;  4EZJ A;  3VUY A;  1E8Y A;  3IAM 1;  4G11 A;  2RSU A;  3VFK A;  3RZF A;  3PS6 A;  2KX0 A;  3MFG A;  2MJE A;  1IGD A;  4NAW B;  3OJ4 B;  5JXV A;  3APC A;  2Z8L A;  1M4V A;  2PMV A;  1GC6 A;  1K52 A;  2QDF A;  2L76 A;  1TS3 A;  2JZP A;  3E56 A;  1TKY A;  1C79 A;  4MGK E;  1WJ4 A;  3AUL A;  4F8C B;  2FID A;  4NY0 A;  2BT6 A;  2LGS A;  2BQQ A;  4KKI A;  4JLC A;  4LDT D;  2PIA A;  1WMH B;  1HTO A;  1QT9 A;  1YX6 B;  2CJN A;  3Q2A C;  4LNI A;  2MH7 A;  2J53 A;  3PRP B;  4KKJ A;  5C2T B;  2D3A A;  4ANX A;  2KZR A;  1N5W A;  3P63 A;  3RT3 B;  4N9F 4;  3Q3J A;  5IKC M;  2EMT A;  4GDL A;  3WAN A;  3LYY A;  3N1X C;  2BTE A;  3APF A;  3GE3 C;  2GBK A;  1OGW A;  1XD3 B;  3OJ3 A;  3SR6 A;  1QQR A;  2PJH A;  3C0R B;  3NZS A;  4KZC A;  4F7Z A;  1TZO A;  4MDK E;  3HVD A;  2MCN B;  3TEY A;  5J18 A;  1WGR A;  3JW0 X;  2LVP A;  1WM2 A;  5IA7 A;  3QC8 B;  3W1S C;  2A4Z A;  4PK1 A;  2K8H A;  3I9V 1;  3AE7 B;  1UEL A;  4EOY A;  3GE8 C;  1IUE A;  3ABV B;  2W82 A;  2DLB A;  2MLB A;  3VRB B;  4AOF A;  3PRM B;  4MH0 E;  2JVC A;  4WJO A;  3BZD B;  1FXT B;  5EE9 A;  4N6E B;  2KVR A;  4B0E A;  1RM6 C;  1UZX B;  4FAD A;  2BYE A;  3AI5 A;  3P4Q B;  2MEK A;  2XK5 B;  3BK2 A;  4EZK A;  2L1A A;  2KFJ A;  4RM8 A;  3OAW A;  1GNU A;  1XO3 A;  2INN E;  4NAW A;  2O2V B;  3DWG C;  1ET6 A;  3T3N A;  1GTH A;  1I35 A;  4C7Y A;  4NJ7 A;  1DOX A;  2WX0 A;  2VZK D;  3ZTC A;  2WX1 A;  3RI7 C;  4WIP A;  5KHQ A;  2GBN A;  3EFC A;  1YJJ A;  1D6E C;  1WZ3 A;  4MEM A;  3T9L A;  1NVI D;  2WLB A;  3BIN A;  4XWW A;  5LXH A;  1KLG D;  3DVN V;  1ZXH A;  3KLS X;  2LFI A;  5DPR A;  5BYS A;  2BS2 B;  4A55 A;  4TUU A;  2FAZ A;  4OVU A;  3UIO B;  3HVZ A;  3RUI B;  3WCQ A;  2QJL A;  1WMH A;  1FXI A;  4ZRI A;  1LQB A;  4WH4 A;  4YL8 A;  1R4M B;  2G45 B;  3J9C A;  2KOX A;  3AE5 B;  2KAN A;  2NMQ A;  3PZ7 A;  4W9J A;  3ZNI D;  5CX3 A;  1SF0 A;  3NZ3 A;  1RFA A;  2B3A A;  2Z0D B;  2JXX A;  1MPE A;  1KOT A;  1TS4 A;  1WM3 A;  4EEW A;  2K6D B;  2Y5C A;  4KDI C;  2LAS A;  1E8X A;  2I38 A;  1YQB A;  2BS3 B;  2JYE A;  4W9D A;  2W9N A;  4DK5 A;  3QX1 A;  1JRO A;  1OQR A;  2GMI C;  2K1F A;  2RDB C;  3NG0 A;  1XCQ L;  4HKQ A;  2LZ6 A;  5JZE B;  3V3X A;  1SBB B;  5HI1 A;  3TMP B;  4OZA A;  4ICV A;  3QAQ A;  1F0Z A;  2VRR B;  3JVZ X;  4NQL B;  5TSS A;  1L4Z B;  1TIF A;  1QKZ A;  3SFD B;  2ZPN A;  2MBH A;  3ALB A;  3NVW A;  2KMC A;  4LDT B;  3DHI C;  2YEP F;  2J4X A;  4E3C A;  1N62 A;  4PS7 A;  1FCL A;  5KHO A;  2MP2 B;  1XXG A;  3NJT A;  2LHE A;  3AE1 B;  1ZUD 2;  1JQ4 A;  2C7H A;  3EGR A;  2OOB B;  3KH0 A;  2YVC A;  3ZNG C;  2C60 A;  2XK5 A;  3DVN U;  2BKF A;  4ZHP A;  2O2V A;  2KWU B;  3QAR A;  2O6V A;  4EUT A;  3ZGZ A;  2G4S A;  2I2Y A;  4IWQ A;  2A5U A;  3DCG A;  5HHD G;  5JH5 C;  1WH3 A;  3RNE C;  1V80 A;  2DYM A;  3TUO A;  4CYE A;  1SIJ A;  3A4S C;  4WWM A;  3W1S A;  3I3T B;  2K0P A;  1VLB A;  2GBR A;  2LRW A;  4OZC A;  2FUG 1;  4W9I A;  3NVY A;  2Z59 B;  2NVU I;  1FM0 D;  2KVZ A;  1GTE A;  1OFF A;  4HPL B;  3UQA A;  2IO3 B;  4MT5 A;  2L8J A;  4ANW A;  4URK A;  5EE3 A;  4ICU A;  2FUH B;  4RGO S;  1LO5 D;  1BT0 A;  3RZW C;  4HRO A;  2EEL A;  3R2T A;  4REZ A;  4RMA A;  1IGC A;  3ZLZ A;  5E6N A;  2CJO A;  2WHI A;  5CTR C;  3RNG C;  1WXS A;  2M17 A;  3ZXR A;  2VZK B;  2HTH A;  1UH6 A;  4WAF A;  2KHW B;  1V86 A;  2J7Q B;  1HQR D;  2FBW B;  3VR8 B;  1UBI A;  1YN5 A;  4TKN A;  4IWP A;  3DPD A;  4I6P A;  2KFK B;  1OQY A;  3BYY B;  3O13 A;  1K51 A;  5BO4 B;  5IP4 D;  2ASQ A;  2K8C A;  1C9F A;  2KTR B;  4NQK E;  3URY A;  2M0X A;  5FR6 A;  1KF6 B;  4MH8 A;  3EC8 A;  1WGH A;  3QJZ A;  1D5M C;  2REX A;  1WXQ A;  3PPA A;  4LNK A;  1ZGU B;  3EEC A;  1WX7 A;  1S1Q B;  4BVU C;  3PLV A;  3ZNH B;  2XNA C;  2ZVO A;  3BVM A;  2KN5 A;  2N7E A;  1GG3 A;  2L05 A;  2KDF B;  4GGQ A;  3HIZ A;  2G4D B;  4ARC A;  2D07 B;  1TJE A;  4BOS C;  1RFK A;  4X57 B;  2OJR A;  3A33 B;  2Q5W D;  3AE6 B;  3H1U A;  3PV1 A;  2WU2 B;  4IOI E;  5HG2 A;  3DBL I;  1XEE A;  3L08 A;  3DQV A;  3ZVV A;  1E8Z A;  3P1M A;  2M8S A;  1HZ6 A;  2MA9 B;  3NY5 A;  1Y56 A;  3RD2 A;  1WJ6 A;  3TBL D;  2N7D A;  3ZJU A;  5TR5 A;  1C4A A;  2PLP A;  4YTP B;  2HJ8 A;  2X38 A;  3TL5 A;  2JUO A;  3H8H A;  2RR9 A;  1R4N B;  3EHV A;  4KIK B;  1M94 A;  4YSX B;  1FD6 A;  4AUQ C;  3VAW A;  2NBV B;  3RPF C;  2K8B A;  4NJ6 A;  1TKE A;  2V4L A;  2BYF A;  2LMC A;  1SB3 C;  3VTU A;  2FCN A;  3B1L X;  1I4P A;  4K1R B;  4JPS A;  3MC8 A;  4TQ0 A;  3P4R B;  4WUR A;  4MGI E;  1MG8 A;  3H6N A;  1MI0 A;  2E3T A;  2WP9 B;  4XWT A;  3SD5 A;  1TYG B;  2IGD A;  1ZP0 B;  3ZQ4 A;  2V9H A;  2AWT A;  3GP7 A;  1F52 A;  3SEB A;  2KMA A;  2NBU A;  2N9E B;  2KFK A;  1GT8 A;  3WAP A;  1JWU D;  3AU5 A;  4KX6 B;  2D5G A;  4P7I A;  4RM9 A;  1V1O A;  5G2N A;  2IGH A;  2KTR A;  4GB9 A;  2JZZ A;  4FBJ B;  3BK1 A;  2NCN A;  3ZO5 B;  3GB1 A;  2KTF A;  2RPQ A;  3L17 A;  4OW0 A;  5IOI A;  4MGZ E;  3B0A A;  1T0R C;  1LGR A;  4USA A;  2M19 A; 
#chains in the Genus database with same CATH homology
 4IDI A;  3LYY A;  3NRZ A;  1ZOY B;  1YMH E;  2BTE A;  2JWU A;  4N58 A;  3SR6 A;  1QQR A;  1F77 A;  1YJI A;  1DGJ A;  2N0S B;  1GB1 A;  3FC4 A;  1AWD A;  4UDU C;  3W9C B;  1TZO A;  1VRA B;  3IXS A;  3ETR A;  3HVD A;  3KQ4 A;  3TEY A;  4YWG G;  1JWB D;  4AS1 A;  3AEA B;  3BYT B;  2L52 A;  2MJD A;  3FAH A;  1QOA A;  1L5P A;  4HRS A;  1UGJ A;  3CWI A;  3SFE B;  2M56 B;  3I9V 1;  4N59 A;  3AE7 B;  2WXK A;  1P7E A;  1EWY C;  3W2D A;  3W5V B;  2QEJ C;  1IUE A;  4R3D A;  3ABV B;  1ZXI A;  2W82 A;  3ZJV A;  2DLB A;  1FNW A;  3RFZ B;  2PKO A;  3VRB B;  2J52 A;  4RF1 A;  2PW9 A;  2RDH A;  4JWS C;  4XDC A;  1FNV A;  1ROE A;  3L4P A;  3AE2 B;  3ZJT A;  3BZD B;  5EE9 A;  1PDX A;  4N6E B;  3E9S A;  4B0E A;  3AN1 A;  1ZPS A;  1RM6 C;  2G9H D;  3AE3 B;  3EA6 A;  3P4Q B;  2MEK A;  3BK2 A;  2L1A A;  1OQQ A;  4OVZ A;  4L23 A;  2LEK A;  2L83 A;  2W3S A;  1XO3 A;  2INN E;  2PTL A;  2ZW0 A;  3DWG C;  5MPO A;  1ET6 A;  1WGK A;  3T3N A;  4CQN A;  2JSV X;  1GTH A;  4C7Y A;  1DOX A;  1KFY B;  4XDD A;  1P7F A;  2VZK D;  5EE1 A;  4YTN B;  1JW9 D;  1RWS A;  5BMG A;  3FIL B;  4WIP A;  2W55 A;  4C80 A;  1KLU D;  2H89 B;  1AW7 A;  2WXG A;  1YJJ A;  1D6E C;  3R8B A;  2RPV A;  2HDE A;  4RGT A;  2LUM A;  1NVI D;  2GI9 A;  2WLB A;  1VZ6 A;  1PGA A;  1VZ7 A;  4J3O D;  1D4B A;  2WU5 B;  2CU3 A;  4XWW A;  1GAQ B;  3AB5 A;  1JCK B;  1KLG D;  1EM7 A;  1ZXH A;  3BWU D;  4YSY B;  4WQM A;  2KDM A;  3KLS X;  2LFI A;  1HXY D;  4KGT A;  5BYS A;  2V3N A;  2GRI A;  2BS2 B;  3EUB 2;  4A55 A;  4DXG A;  5T8I A;  2BB6 A;  3HVZ A;  3WCQ A;  2JU6 X;  1XLQ A;  2QJL A;  1FXI A;  3CIR B;  1JWA D;  1YNT E;  4L1B A;  1L4D B;  3IT4 B;  4WH4 A;  4ZOH C;  1E7P B;  1NEK B;  1E6E B;  1NYQ A;  2NTT A;  3J9C A;  1FNU A;  2WDQ B;  1I4X A;  1R7S A;  1F2R C;  3AE5 B;  2K9X A;  1ENF A;  2NMQ A;  1AYF A;  3PZ7 A;  1JWS D;  2SEB D;  4TMA B;  1SE2 A;  1CJE A;  1V1P B;  1N60 A;  1SF0 A;  2N9K A;  1ET9 A;  3NZ3 A;  2BYT A;  3TSS A;  1SJE D;  1YQ3 B;  1MPE A;  3Q8A A;  5EE0 A;  1J7C A;  1L0X B;  1C78 A;  1TS4 A;  2Y5C A;  4Q2J A;  1UWX A;  1D5X C;  2JQR B;  1C4P A;  1QOF A;  1H7W A;  1HEZ E;  1E10 A;  1TY2 A;  4HJG E;  2I38 A;  2W3R A;  4RH6 A;  5BYR A;  3HUI A;  5E6J A;  2BS3 B;  2JYE A;  2BB5 A;  2KMM A;  1I4G A;  2RDG A;  3IT6 B;  2KN4 A;  1TKG A;  4O1N A;  1PUT A;  5LNK 1;  1IBX B;  1JRO A;  1OQR A;  1ZDV A;  2JXT A;  1XCQ L;  4HKQ A;  1J7A A;  1SJH D;  3V3X A;  1BUI C;  1SBB B;  3CF4 A;  4TSS A;  5HI1 A;  1C4C A;  3U4E G;  2ONQ A;  3MP9 A;  1GOZ A;  4OZA A;  1F0Z A;  4YSZ B;  1T5X D;  1FIQ A;  3U7Z A;  1DOY A;  2WXN A;  4P16 A;  5TSS A;  1B1Z A;  3GS2 A;  1L4Z B;  2WXJ A;  2N7J A;  2QMT A;  1QKZ A;  1ZE3 D;  2V0G A;  3SFD B;  2WXQ A;  3MJ5 A;  3N9Y C;  4RNA A;  1KH0 A;  3NVW A;  1NEN B;  5D3I B;  4B0M A;  5HFY A;  2IJ0 A;  2AQ1 B;  2BS4 B;  1ACC A;  2JYT A;  3U2S C;  2ACZ B;  1BML C;  1F2R I;  2HTM E;  4YTM B;  1PYW D;  1L0V B;  2YEP F;  4ZHO A;  4EE2 A;  1NI3 A;  4RCO A;  2J4X A;  3W5U B;  1TY0 A;  1I4R A;  1N62 A;  3AE8 B;  1FCL A;  1YN3 A;  3HRD D;  3AE9 B;  1XXG A;  1STE A;  1ESF A;  2LHE A;  3AE1 B;  1ZUD 2;  2ON8 A;  2WXM A;  3MC0 B;  3NVV A;  4ITK A;  1FFU A;  3BVG A;  1A70 A;  5I4D A;  1JQ4 A;  2BBC A;  3EGR A;  4GLS C;  3DWM A;  4OHJ A;  3BVZ A;  3KWV A;  2PVG C;  3Q69 A;  1HZ5 A;  4ZHP A;  1N63 A;  3AM9 A;  1VDV A;  3IAS 1;  1CQV A;  3MHZ A;  2DBY A;  2K22 A;  4RFB A;  3ZGZ A;  4A9A A;  2I2Y A;  4M0W A;  3P4P B;  5D7G A;  4ZRP A;  2Y3A A;  3BII D;  3Q8C A;  1T6B X;  5HHD G;  2TSS A;  2V3P A;  3FIL A;  2WXI A;  4LLG M;  2R61 A;  2DYM A;  1H7X A;  3TUO A;  3AEF B;  1SIJ A;  1JRP A;  1JAL A;  1TS5 A;  4WWM A;  3W1S A;  2K0P A;  4US8 A;  2RMM A;  1VLB A;  3AH7 A;  4OZC A;  2FUG 1;  3TEX A;  2QIL A;  5D3D A;  1HA5 A;  4NZL B;  3NVY A;  2M19 A;  1PFD A;  1FM0 D;  2LJI A;  1CZP A;  1GTE A;  1VJK A;  1YQ4 B;  5GXG B;  1OFF A;  3AEB B;  1T3Q A;  1XLP A;  4MM3 B;  1DOI A;  4JWU C;  2E6X A;  1L6U A;  4MT5 A;  2LGI A;  2IGG A;  1VZ8 A;  3P42 A;  1XLN A;  4KGR A;  1SE3 A;  1V8C A;  2W54 A;  2B76 B;  5EE3 A;  4L2Y A;  2AQ2 B;  1QF6 A;  4RGO S;  2KAJ A;  2WXO A;  3AMZ A;  1LO5 D;  1WRI A;  4HRO A;  2EKI A;  2AX5 A;  2EEL A;  1V1P A;  3R2T A;  4REZ A;  4C7Z A;  1WYG A;  1XCT L;  4MAC A;  1IGC A;  2DYO A;  2CJO A;  1PGX A;  2ZW1 A;  2KQ4 X;  2L32 A;  1WWT A;  1B9R A;  3V05 A;  1KRH A;  1MHX A;  1MHH E;  2N9L A;  1FRD A;  1XLO A;  4YXD B;  4P6V F;  2VZK B;  3Q8E A;  1E0Z A;  3NUH B;  5AUI A;  1IBX A;  2WXL A;  3TEW A;  4WAF A;  4AQ7 A;  4KGS A;  4A8X C;  1HQR D;  4RF0 A;  2FBW B;  3VR8 B;  1QLB B;  4DQO C;  3LB8 C;  3TEZ A;  4ARI A;  1EU4 A;  1TS2 A;  2IDY A;  1YN5 A;  2G1E A;  2INP E;  4TQ1 A;  2XN9 C;  1VR9 A;  1L0Y B;  1FEH A;  5BMI A;  3R2I A;  2WS3 B;  3BYY B;  3O13 A;  3ZYY X;  1JML A;  1K51 A;  1L6V A;  2ICI A;  1C9F A;  3Q8B A;  1I4H A;  1ZDX A;  5AUK A;  3URY A;  2K5P A;  1KF6 B;  1UWM A;  4MH8 A;  2KAC A;  3OWE B;  4PT5 A;  1D5M C;  2JX5 A;  1WXQ A;  4RGM A;  3VR9 B;  3PZ8 A;  3T3O A;  1SXT A;  1QOB A;  1XF5 L;  2QIE B;  4H2A A;  5C3J B;  4D2K A;  1D5Z C;  1E9M A;  4XE0 A;  2XNA C;  3BVM A;  1I7H A;  4LTU A;  4GDL B;  1EWC A;  4HEA 1;  2DWQ A;  4ARC A;  3C8Y A;  1Q10 A;  2AQ3 B;  2WXH A;  3VQI A;  2H88 B;  1TJE A;  3UI3 A;  5BMH A;  5FK9 C;  1FXA A;  1RFK A;  1I4Q A;  1N5X A;  3AED B;  4A90 A;  4GDK B;  2WNM A;  2WDV B;  1JWM D;  2Q5W D;  3AE6 B;  5G5G A;  1FRR A;  4IOI E;  2WU2 B;  2WQY B;  5HG2 A;  2QSD A;  1BXT A;  1K53 A;  1XEE A;  3KWL A;  3P1M A;  3AEE B;  4A6Q A;  4ZYS A;  1HZ6 A;  1MVK A;  1Y56 A;  3PO0 A;  4FXC A;  2PVO D;  3ZJU A;  4YT0 B;  1C4A A;  3AE4 B;  3LXF A;  2V4I B;  4OZB A;  2PLP A;  2SAK A;  3AEG B;  2K3U A;  4YTP B;  2X38 A;  4NJC A;  3AEC B;  1UUP A;  3H8H A;  2KWD A;  1EU3 A;  2J42 A;  4RGN A;  1FCC C;  1NYR A;  1J7B A;  1QIL A;  4YSX B;  1AN8 A;  4US9 A;  1FD6 A;  1WSP A;  3I57 A;  2WXR A;  3P4S B;  2LHD A;  1GB4 A;  2WXP A;  3NVZ A;  3IAM 1;  1CK1 A;  3VRA B;  1DYQ A;  5FR3 A;  3RPF C;  1TKE A;  2M0A A;  1SEB D;  3MFG A;  2MJE A;  1IGD A;  4NAW B;  1K50 A;  1KTK A;  2LMC A;  1SB3 C;  2GB1 A;  2WDR B;  5JXV A;  1QOG A;  1UNS A;  2Z8L A;  1M4V A;  2PMV A;  1FO4 A;  1I4P A;  4JX1 C;  4JPS A;  1K52 A;  4LK0 M;  5FKA C;  3AV8 A;  2BW2 A;  1TS3 A;  4TQ0 A;  2JZP A;  3P4R B;  4WUR A;  3E56 A;  1N61 A;  1TKY A;  2OHF A;  3Q8F A;  1C79 A;  1MI0 A;  2E3T A;  2WP9 B;  3B9J A;  4XWT A;  4IKG A;  1TYG B;  2BT6 A;  4NAM A;  3U52 E;  2IGD A;  2Y5P A;  1ZP0 B;  2YEP B;  3ZQ4 A;  2WXF A;  3GP7 A;  4HKZ E;  1FMA D;  4KKI A;  3SEB A;  2PIA A;  1YN4 A;  2MJ3 A;  1PGB A;  2IPK D;  1SSN A;  1GT8 A;  1QT9 A;  1JWU D;  2CJN A;  4KX6 B;  5G5H A;  2D5G A;  2MH7 A;  2J53 A;  1V1O A;  5BYQ A;  2IGH A;  3B2F A;  1SE4 A;  3NS1 A;  4JE3 B;  4KKJ A;  4DXF A;  2NTS A;  5C2T B;  3B2G A;  3BK1 A;  1C76 A;  3GB1 A;  5H92 C;  1N5W A;  4C56 C;  1V97 A;  1GPX A;  4OW0 A;  3P63 A;  2OED A;  4USA A;  5H8Y E;  1FFV A;  1C77 A;  1RYJ A;  4ZRQ A;  2FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...