3AEGB

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aegB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aegB01
4LTUA 3B9JA 4N58A 3AMZA 2WLBA 1YJJA 2MH7A 3W5VB 3AE9B 1KRHA 2WDRB 2DBYA 4YTPB 1GAQB 3DWMA 2E3TA 4KX6B 1N63A 2PKOA 4USAA 2K9XA 1FO4A 2WU5B 3HUIA 4C7YA 1XO3A 3NVWA 5C3JB 1J7AA 1QOGA 5GXGB 1WYGA 1JQ4A 2CJNA 5EE9A 1TJEA 1AYFA 3BIID 1NENB 3AE1B 1OQRA 3AM9A 3W9CB 1FRRA 3P4PB 5C2TB 5H92C 1OQQA 1XLQA 2WP9B 3P4QB 3NVZA 2Q5WD 2PVGC 1AWDA 1J7BA 3NS1A 1XLPA 1B9RA 2H89B 1L5PA 1E7PB 3AEEB 3CWIA 3L4PA 3SFEB 2LEKA 2B76B 3AEDB 2H88B 1NYQA 4ZHOA 3AEGB 4ZOHC 1FFUA 1E9MA 2DWQA 1XLOA 2PIAA 3CIRB 1UWMA 3AE3B 2QJLA 3KWLA 4IDIA 2QIEB 4JX1C 5EE3A 4A9AA 2K22A 3AV8A 3LB8C 3AECB 1V8CA 1JROA 1SF0A 3SFDB 2MJEA 1ZP0B 1DOXA 3AE6B 1OFFA 1FFVA 4HRSA 4JWSC 3PO0A 1RM6C 4YSZB 1VDVA 3VR9B 1N62A 2HTME 1QT9A 2AX5A 3FC4A 1TKEA 3AE2B 3HRDD 1ZXIA 1SIJA 2BS2B 3P63A 1N5WA 4WQMA 1E6EB 3AE8B 3EUB2 3WCQA 1WGKA 2W55A 3AH7A 5EE1A 1TYGB 2L83A 1J7CA 2KAJA 2L52A 3CF4A 1WRIA 2G1EA 2K5PA 1E0ZA 2N0SB 1L6UA 3ETRA 2W54A 1JW9D 2W3RA 3LXFA 1RYJA 3P4RB 1SB3C 1V97A 1PFDA 1PUTA 1H7XA 3B2FA 1L0VB 3VRAB 1ZUD2 1PDXA 2CU3A 3AEAB 1WWTA 1QF6A 1YQ3B 2BT6A 4WWMA 3ZYYX 3ABVB 3AE5B 1N61A 1QOAA 3P1MA 1XLNA 5AUKA 1QLBB 1QOFA 2M19A 4FXCA 1GT8A 1IUEA 2WDQB 1R7SA 5MPOA 2MJDA 1DGJA 2Y5CA 1EWYC 1CZPA 4C80A 2JQRB 3VR8B 3AEFB 2CJOA 3NVYA 1DOYA 1YQ4B 1TKGA 4US9A 5EE0A 5G5HA 3AE7B 1JWBD 3NRZA 1F0ZA 4C7ZA 1JRPA 2OHFA 1FM0D 4N59A 1TKYA 1WXQA 1NEKB 2WU2B 3AN1A 3AE4B 1ROEA 1T3QA 1I7HA 1GTEA 2BS3B 3AEBB 1N60A 3W5UB 1FXAA 1NVID 5H8YE 5AUIA 3RPFC 4YT0B 2M56B 4ITKA 2WDVB 4P6VF 4ZHPA 1VJKA 1VLBA 1A70A 1N5XA 1H7WA 1KFYB 2WQYB 4YXDB 2MJ3A 1GPXA 1FRDA 1CJEA 2WS3B 1FMAD 2FBWB 4YTNB 1L6VA 2PVOD 4YTMB 2W3SA 1FIQA 1RFKA 3FAHA 1FXIA 1JALA 2JX5A 3VRBB 1E10A 4YSYB 2ACZB 4HROA 3AB5A 3DWGC 4JWUC 2EKIA 1GTHA 1JWAD 1QOBA 1RWSA 1DOIA 1YJIA 2KMMA 3B2GA 4N6EB 1NI3A 2BS4B 3HVZA 3NVVA 1KF6B 4US8A 3SR6A 1ZOYB 3P4SB 5G5GA 1NYRA 4YSXB
chains in the Genus database with same CATH superfamily
1VZ6A 4C4VB 2RMMA 3DWMA 4QAYA 4WURA 3N1YC 2EKEC 4ZRPA 2DYBA 3Q14C 4GIVA 4OW0A 2ZEQA 3RFZB 2K6DB 3ZQ4A 1D3ZA 3OJ3A 3GE3C 1UF0A 4IOIE 1STEA 1L5PA 1E7PB 4RGTA 1GC6A 1OTRB 2H88B 3ZXVA 1E9MA 4W9CA 3N3KB 2BB5A 2KDFB 2BGFA 4NJ6A 3IBEA 2JUOA 1Q0WB 4CYEA 3VR9B 4GDKA 1WGGA 5CX3A 1V80A 1ZKHA 2ZW1A 3DBHB 3AE8B 3IAS1 5JHBA 2WXPA 3LYYA 1WRIA 2JRHA 3IXSA 1MHXA 1NBFC 2BYFA 3HM6X 2N7EA 5KHOA 4GSWA 3X0WA 1PDXA 1N61A 2G4DB 2AL3A 1SIFA 3Q3JA 2ZPYA 1WJ4A 3N1XC 4HCNB 1LQBA 1Q1OA 1WZ3A 3ZNGC 3BVGA 2DZKA 3IFWB 4PYUA 2MBQA 4XZ4A 1JRPA 2IJ0A 2FE8A 1GTEA 2L1AA 3O65B 3BYTB 1V49A 2KMAA 4K3CA 4YTNB 1FIQA 1WI0A 2BTEA 4HDQA 3U2SC 1E10A 1DYQA 2IO1B 4NJCA 1JWAD 4KIKB 4LNNA 2FUG1 3T3OA 2DHZA 3DVGX 1TBEA 2KHWB 3I57A 1C1YB 3VXWA 3ZRFA 3B9JA 1WX9A 2NTTA 5HKHA 3DBRI 1TS2A 2WDRB 4YTPB 5HFYA 2CHXA 1FO4A 4USAA 1LGRA 2LI5A 4P16A 1J7AA 5L83A 2M17A 4WAFA 3NHEB 2IGGA 1CK1A 2OOBB 3L17A 4BOSC 4II2B 2WX1A 1XLPA 4OZAA 4XE0A 2WXJA 2O6VB 1I4HA 4MDKE 2DX5B 3ZW3A 3AEGB 2KQSA 2K22A 1FD6A 4HXDA 3TEYA 4C56C 1WE7A 2KWDA 2DYMA 3DBRB 1RM6C 4YSZB 2G9HD 2IO3B 3SEBA 2HTME 2L3ZA 1WXAA 4M02A 3Q69A 3KUCB 5CHWA 2KAJA 2PE6B 1BT0A 2G1EA 2FCSA 3T9LA 1F77A 5AEKB 2JZ3B 3ZYYX 3AE5B 4DHZB 4W9FA 1QLBB 2KXJA 1YIWA 3K9PB 4C80A 3URYA 4NAMA 3PGEA 4EUTA 4HKZE 1TKYA 3ZO5B 3VTUA 3C0RB 2EELA 5D94A 2QDFA 3WIMA 2KK8A 3OWEB 3Q3MC 5E6PA 1L4ZB 4NPNA 2LJ5A 2IDYA 3Q8BA 4LLGM 4M8MA 4KGSA 2JPHA 4BOZB 3DWGC 1E7UA 2EKIA 1P0RA 1YQBA 3VUXA 3B1LX 3AI5A 1H8CA 3SR6A 3NZUA 2V0GA 2WNMA 4N58A 5L95C 4RM8A 3MJ5A 3KYDD 2ZNVB 4JLCA 2WU5B 3HUIA 1WR6E 4MH8A 1JQ4A 2K8HA 1NENB 2NPTB 2BQQA 2M8SA 3NVZA 2HE7A 3NZSA 3VTWA 1I4RA 2GRIA 3EFUA 4HCPB 2J0MA 2WXMA 4JX1C 2KX3A 3TL5A 4ANVA 3WAOA 2LWPA 2V3SA 1XD3B 2KTRB 2LHEA 1SBBB 1SIJA 2NBUA 4DXAB 3Q8FA 5HHDG 2L52A 3E9SA 1RLFA 3CF6E 1JW9D 2N9LA 2W3RA 2INPE 3IT4B 4G50A 4FADA 1OEYJ 2IY1B 1WWTA 1MI0A 1FPYA 1QOFA 2K39A 1GT8A 1WMHA 3EC8A 2CJOA 2FIDA 1PQSA 3PLVA 3VH3B 2G45B 2A4ZA 4NNJB 3NRZA 4GMVA 1KH0A 1F2RI 1Z5SB 1A5RA 4P6VF 2XEWA 2AYOB 4HKQA 2DZIA 2W3SA 4GDKB 4MM3A 4KGRA 3ZIMA 1V5TA 4PS8A 2LFIA 4XX5A 1KLUD 4MH0E 1Z2MA 2KT7A 1WJUA 2VZKB 1XEEA 2NS5A 4DWFA 4DDID 3L08A 1D5ZC 5EDSA 3CMMB 4CQNA 1OQQA 4RGNA 3GZNB 2PVGC 1TT5B 1HQRD 3C19A 4MT5A 1XCTL 2C9WB 2D3CA 2DYOA 3WAPA 4EE2A 2MBEA 4TV3A 1WFYA 2LEKA 2KWCA 3AEDB 3WANA 2NBWB 2PIAA 1D6EC 2MWSB 3R8BA 4AUQC 2R61A 4TSSA 2N1VA 1V8CA 3BYYB 2WXLA 1HA5A 1YX5B 2AX5A 1GJZA 2BKFA 3MC8A 4B9KA 1FCLA 3TBLD 2KQ7A 1V9JA 1XF5L 4ZYSA 1YOVB 3VFKA 3B2FA 4BKSA 4JL9A 1J0GA 2G3QB 1WXSA 2Z8LA 2RPVA 3NUHB 3T3NA 4URKA 2ZW0A 3AEFB 1TZ1A 1YQ4B 1H4RA 1UBIA 5LNK1 4PT5A 4XWWA 3EHVA 3RNCC 1NEKB 2VH2A 1T3QA 2LMCA 4ANUA 3DHHC 3VUYA 4YT0B 1JCKB 4IC7B 2N9XA 1PGXA 3A1QA 2ON8A 3FC4A 1FNWA 1RFKA 2K6QA 3RZFA 2BYVE 3U7ZA 4JWUC 1C3TA 4MJSA 4IM2A 1ZOYB 4LTUA 3UQAA 4B95A 1MG8A 3HM3A 4KX6B 4F7ZA 4C7YA 3HVDA 4ACFA 2JXXA 1WYGA 1FRRA 1E7VA 1MVKA 3Q3NC 5T8IA 1YN5A 2V1YA 4MSMB 3IHPC 4I6LB 2CU1A 5BMIA 5EE3A 5BYSA 1TY0A 1OQYA 1ZGUB 4G3XB 1OFFA 4IWQA 3VUWA 3PO0A 4PS7A 1AARA 1K51A 4TMAB 2WXKA 5FR6A 2BS2B 4O1NA 2MBHA 3ZDMC 3GE8C 5FK9C 2LASA 1WX7A 1GOZA 3GP7A 5BYQA 2OEDA 1SB3C 2J0JA 2GLSA 4LJPB 3ALBA 2LHDA 4FBJB 1YQ3B 4HPPA 2Y3AA 2WDTB 1OEYA 3BINA 2JQRB 2V3NA 2WGSA 1R4MI 2N9KA 4JGHB 3A9KA 4RGMA 2I2YA 4GOCA 3Q2AC 1XQQA 1UELA 1E5WA 3ZJVA 3R3MA 4K7SA 3PHWB 4YXDB 1P9DU 2RPQA 2FBWB 1VRAB 3BWUD 3MTNB 1C78A 3U8ZA 2OJRA 4MACA 2BS4B 4TKNA 2CKHB 2IYDB 1WSPA 2INDC 3APFA 3TIXA 3RT3B 1V1PA 2MH7A 2MSED 1KRHA 2J52A 2BBCA 1UD7A 3KUZA 1LXDA 2IGDA 1XXGA 3A33B 4G0NB 1BXTA 1WGHA 3QK0A 3Q3FA 4EEWA 2FAZA 1AYFA 1WMHB 3S2AA 2GI9A 5DPTA 2GBNA 2BW2A 2GOWA 1B9RA 4LK0M 5BMHA 4W9LA 1MFWA 3B08A 1NYQA 2DWQA 4GU2A 4OVZA 4ARCA 3JSVB 4AQ7A 2BWES 4BKTA 3DBHI 5IP4D 4MM3B 5JZEB 1ISNA 3ZTDA 1WXVA 3HRDD 3WAMA 3KYCD 1WGKA 4NQLB 2E6XA 1ESFA 3LJ3A 4MGZE 3ETRA 1WGDA 3MP9A 1PFDA 4BVUC 2AQ3B 4HK2A 2G4SA 3RNFC 2CU3A 5BO4B 1DGJA 3VDZA 2BYEA 1CZPA 5G55A 2LUEA 3NVYA 2LVQA 3ONSA 2LXAA 5EE0A 2NMQA 3U30A 5IN7A 2GBMA 1MJDA 1N60A 1IGCA 5H8YE 2PEAA 3DOWA 1EWCA 4ITKA 2LGXA 1SE9A 4JIOU 1FMAD 2JY6A 4YTMB 2KC1A 4H2AA 4DBGA 3RZWC 1Q5WB 1DOIA 3B2GA 3KWVA 3MC9A 1MG4A 4ZRQA 4HVBA 4REZA 4LDTD 3V60A 4TUUA 5LXHA 2IBIB 2PKOA 4ZYNA 3UINB 3SDLC 4FJVB 4GDLB 4DXGA 2RR9A 1Y8RC 1GG3A 2KN4A 3NZ3A 4A90A 3DHIC 2L0FA 4A3OA 3UIPB 3L4PA 4FLHA 2JU6X 3PRPB 1XLOA 1R4NI 4BZAA 4CO7A 2QIEB 2KJRA 3A1QB 1TS5A 4HDOA 1T0YA 4ARIA 4L2YA 2JZZA 2KNBA 1EF5A 1TTNA 2HJ1A 3AE6B 3CSTA 4K81A 4MJSB 2EMSA 3N20C 5FR3A 1D5MC 2ZVNA 2BVCA 1E6EB 4J3OD 1I35A 3W1SC 3JVZX 2W54A 4UDUC 4N9F4 3PS6A 1PUTA 4XDDA 4A3PA 2WXFA 1L0VB 1QZEA 3R2TA 3AEAB 1SSNA 2UYZB 5DCNA 1V6EA 4W9HA 1R4NB 2KX0A 1SJHD 1G6JA 2N1WA 4IUMB 4KDLB 2LXCA 4JPSA 2PMVA 4XGAB 4C7ZA 1VZ8A 2CS4A 3L54A 2WU2B 1SXTA 1ROEA 1ET9A 5LLIA 1NVID 1E8WA 4FJYA 5JHAA 4A8XC 1H7WA 4GGQA 2KZRA 3ZVVA 2J42A 1FXIA 2O2VB 4HPLB 2KLGA 3RUIB 3Q6BA 1RFAA 4CHKA 2KMMA 2JXTA 3IT6B 4GB9A 1YD8U 4LNOA 3UQBA 1MPEA 1N63A 4MSQB 1SEBD 3PZ7A 5C3JB 3CSFA 1TJEA 2A5UA 2WXNA 2MQJA 2JSVX 5J17A 2B3AA 3A9KB 3QHTA 1QKZA 1L4DB 1HZ6A 2VZKD 1J19A 1EUVB 1K8RB 2WWZA 3KLSX 1FEHA 4G11A 3V6CB 2MA9B 3DPDA 1JROA 3RNGC 1HZ5A 2MJEA 3EFCA 4K1RB 2IO0B 4W9JA 2AEHA 3H7PA 2MHJA 2X8XX 2IZVB 4RCOA 3EA6A 4W9EA 1V1PB 1Y56A 5J18A 1RYJA 1J8CA 2M1MA 1BUIC 3H1UA 4KVGB 2WHIA 2YEPF 1V86A 3ABVB 4JQWC 3GS2A 1R7SA 3QIJA 1I4QA 2V3PA 4FHKA 4ASWC 2GBRA 1P1AA 3AU5A 3R7QA 3TUOA 1FM0D 3AEBB 3W1YA 1SJED 2WDVB 3HK0A 3ZJUA 3PRMB 1GPXA 4W9GA 1WE6A 4BBNF 1FRDA 2WS3B 4BFRA 5IA7A 2KACA 4YSYB 2ACZB 3AB5A 1YJIA 3EECA 3NVVA 3Q8EA 2C7MB 1EWYC 3UGBB 3AMZA 3A9JA 2JRIB 4A6QA 4ICVA 1GC7A 3SHQA 4XDCA 2R2OA 3GZNI 1PYWD 1T0SC 3SD5A 3TJPA 3AM9A 2FCQA 1S1QB 5C2TB 4NJ7A 2JYEA 2JVCA 2N9EB 1AWDA 5IO9A 2KWUB 2IPKD 3W1SA 4E74A 4WJPA 4DHJD 1VR9A 3ML8A 4L23A 2Z0DB 3ZRCA 2KDEB 1T0RC 3U4EG 2BYTA 2XNAC 1TS3A 4RGOS 3GB1A 1ZP0B 4M01A 1TKEA 4LNIA 1JMLA 1UNSA 1P3QU 4GXBA 1EU4A 2REXA 1XT9B 2KFKA 2K5PA 2TSSA 3BK2A 1WY8A 1N6ZA 1V97A 2KVRA 4EFOA 1JWUD 2JYTA 3TMPB 1AW7A 2N7DA 2UWQA 2ZNVC 1IBXA 2KDIA 1E8YA 2MJDA 4NAWA 3VR8B 2LVPA 1D5XC 4US9A 4F8CB 3QWZB 4MGIE 4FHJA 3LDZE 2K1FA 3DDCB 2BS3B 2K25A 4KZCA 2DENB 2MLBA 1RAXA 3V62A 2LRUA 1KTKA 4WH4A 1YMHE 4BKGA 2MJ3A 4LJOB 2LVOA 2PVOD 3NVWA 2KVZA 5CHVC 2KWVB 4DDGD 3N9YC 4N6EB 1L0YB 2ICIA 1LM8B 1WZ0A 5G5GA 1NYRA 1K52A 3I3TB 1C4AA 1E8XA 3QJZA 1WYWB 5AZGA 2M0XA 3VH4B 4IM0A 2GBKA 5J2RA 2AL6A 1UUPA 1RRBA 2NBVB 5EE9A 3WALA 3IVFA 1S3SG 2M4NA 4ZRIA 3L0WB 3OLMD 4FA6A 1UH6A 3NS8A 3R66C 3CWIA 1NI2A 4AWJA 3APCA 3DCGA 3QC8B 3PRZA 3RI7C 3JW0X 1SF0A 2L32A 3ZUNA 1DOXA 1VZ7A 1ET6A 2LGDA 3MHZA 1VCBA 2LRWA 1N62A 4DQOC 2NR2A 4OZCA 1FNUA 3PT2B 4K7WA 3EUB2 3WA0A 2CHZA 1TIFA 3H9DA 3GOEA 2QILA 1HTOA 4P1BC 1YNTE 3BVZA 4RF0A 3FKYA 1WIAA 4RF1A 3ENEA 1ZE3D 2MP2A 2KDMA 2HJ8A 1IGDA 4LNKA 3I63C 2WDQB 4DK5A 4MELA 1F2RC 3VTVA 1FXTB 4NY0A 1TZOA 1F0ZA 3OG5A 4RFBA 2JWZA 1WF9A 2KJHB 3W5UB 5D6JB 2IGHA 2D5GA 1VJKA 4E3CA 2FCMA 1KFYB 4BAXA 2ASQA 3M62B 4BBNC 5TSSA 5I4DA 1X1MA 3H7PB 2RDGA 5D3IB 3BZDB 4MGKE 3V05A 3BK1A 2KOXA 1WM2A 4WAAA 3MJWA 3UF8A 1WJ6A 3PVLA 2WLBA 4AJYB 1XCQL 4KDIC 4WJQA 3KQ4A 3W5VB 2W9NA 3PSEB 4HPMB 1GAQB 2Y5PA 3U7DA 2K9XA 1EF1A 2CR5A 1WRDB 1I4GA 1JWSD 5GXGB 1ZPSA 2CJNA 2RGFA 2KO3A 4I6NB 3NY5A 3DVGY 3RNAC 5IKCM 1I42A 2C7HA 2Q5WD 2IO2B 2H89B 4W9DA 3AEEB 4XC2A 2DZJA 2D10A 2ZVOA 4ZDVA 2V4IB 1FFUA 3QX1A 2L76A 1UWMA 1YX6B 1LFDA 1U4AA 2YVCA 3LB8C 3L16A 4NZLB 2NPTA 4JWSC 2BB6A 5LXIB 1FCCC 3AXCA 2K8CA 4TQ0A 4M0WA 3WCQA 2DAFA 2LD9A 2L83A 4K3BA 3UI3A 1UWXA 2C7NB 4RNAA 3A9JB 1L6UA 3DVNU 4RM9A 1K53A 1UBQA 4HWIB 3RN9C 2D3BA 3L13A 1SGHA 4WWMA 2WXHA 5AZHA 2J7QB 4AOFA 1XLNA 4IWPA 5MPOA 4B0EA 1KLVA 2O6VD 3ZGZA 1TKGA 2FIFA 2ONQA 5E6OA 3ZLZA 1M94A 3A4SC 2GMIC 3NOBA 1Q10A 1A70A 2D3AA 2J53A 4PYZA 3VRBB 4KKIA 3RNBC 1EM7A 1CQVA 4P1CC 2Z0EB 1NI3A 5D3DA 1WR1A 1F1HA 2KFKB 4YSXB 4A20A 1YJJA 2ZZPB 5FKAC 1L0XB 5C1ZA 5BYRA 3KVFB 1QOGA 4ICUA 2INNE 1IBXB 4NAWB 4I6PA 2GB1A 3TCAA 2BPSA 3VAWA 1C77A 4KSKC 2J0KA 3O13A 3NS1A 1GB1A 1HTQA 3FILA 5DPRA 3R2IA 2RDHA 3RMKC 2ZCCA 2PE9A 3NG0A 3L10B 1IPGA 3AE3B 3BY4B 2JZPA 3PPAA 1JWMD 4R3DA 2LUMA 2GBJA 3AECB 1WM3A 1GB4A 3SFDB 4OVVA 1FFVA 2HDEA 2WXOA 4IWOA 3NJTA 4B0MA 3AE2B 1N5WA 4M00A 1WJNA 4YL8A 5EE1A 1TYGB 3VVWB 4EZKA 3CF4A 1E0ZA 3SU8X 3TEWA 3LXFA 3T8MA 1V5OA 1H7XA 3VRAB 2I1JA 1D4BA 1B1ZA 4ANWA 3VHTC 4FXCA 1IUEA 2KJ6A 3H7SA 3ZTCA 2CHWA 1WGRA 1C4CA 1FXAA 4XWTA 2MCNB 1QILA 3ECIA 2KKCA 3DQVA 1I4PA 3V3XA 3FAHA 1JALA 4MGYE 2LGSA 3RULA 4AJWA 4IM3A 3HIZA 2WXIA 2N9PC 5D7GA 2JWUA 2AWTA 2HD5B 1MHHE 4PK1A 2Y5BB 4WIPA 2BWFA 4JE3B 1XO3A 2MP2B 5TR5A 1YN3A 2SEBD 3BIID 4P7IA 1GUAB 2XBBC 4LNFA 3B0AA 2RSUA 5H92C 2DNFA 4ANXA 3N30A 1F52A 4FJZA 4EZLA 4WJNA 2D2QA 3AV8A 1ACCA 2NVUI 2I1KA 3QCAA 2L0TA 3X23A 2FUHB 4D2KA 4HRSA 1WXMA 3V6EB 2AQ2B 1E90A 5E6NA 1F9JA 3H8HA 3AH7A 5E6JA 3AULA 2K8BA 4LDTB 1BMLC 4IG7B 4EKUA 1QF6A 2BT6A 3ML9A 3OJ4B 1T6BX 2KFJA 2D11A 1QOAA 1EO6A 1CMXB 2IY0B 2OJWA 2QC8A 2Z59B 2RDBC 2W82A 3RCZA 5G5HA 2QMTA 1M4VA 4N59A 1ZXHA 4B6WA 3AN1A 2INCC 1ZW7A 3TSSA 1WGYA 1K50A 1VLBA 2LGIA 2JT4B 3PHXB 1C9FA 3OAWA 2JX5A 2K3UA 3J9CA 1GTHA 1JRUA 4M0WB 2RD0A 4II3B 5KHQA 1KJTA 2SAKA 1KF6B 3KW5B 2WYQA 2NCNA 4HLEA 5DPWA 1WH3A 1T0QC 1HXYD 1YJ1A 2DBYA 3BVMA 4HJKA 5D2MB 3W9CB 2BF8B 1UGMA 4W9IA 3K9OB 2WP9B 2MRPA 1NDDA 2WXGA 1TS4A 1AN8A 2KD0A 3APDA 4DXFA 4IDIA 4OHJA 2XK5A 4A9AA 1PGBA 3E56A 1LO5D 3QQ8B 5CHFA 2DZMA 5IOIA 2D3GA 1IYFA 4WWNA 1IP9A 3P63A 4X57B 2W55A 5HI1A 2JF5A 4EOYA 2C5LC 2N0SB 5G2NA 1HE8A 3P42A 4C4VA 2L8JA 1ZUD2 3JSVA 2L00B 1SE3A 3P1MA 5AUKA 2NTSA 2M19A 4KGTA 3JYUA 4OZBA 4WQOB 4Q2JA 5CTRC 2KDBA 3FILB 4IKGA 3AE7B 1JWBD 4WWOA 5BMGA 1PGAA 1C76A 2ZJDA 3AE4B 3M95A 5IAAC 3ZNID 1V2YA 2YEPB 5AUIA 4TQ1A 4ZHPA 2LGYA 4HEA1 4AP4C 1CJEA 2D07B 4KZ0A 2MEKA 2PW9A 1ZDVA 1T5XD 3HVZA 1UGJA 4US8A 3RNEC 3ZNZB 3TEZA 3DBSA 2KYWA 4FULA 4GN1A 1KM7A 1TY2A 3VQIA 2FCNA 1ZDXA 2I38A 4OVUA 4C00A 3AE1B 1OQRA 3C8YA 2FNJB 3P4PB 2KN5A 2QEJC 3P4QB 4YWGG 1J7BA 1UZXB 2R2QA 1SE4A 3D32A 3PV1A 3SFEB 4A55A 4PS3A 4J6IA 4ZOHC 2XN9C 2N4FA 3KWLA 1P7EA 4EZJA 4GDLA 5DPSA 4GLSC 3H6NA 1VDVA 1QT9A 2V9HA 3U52E 1ZXIA 3TEXA 2WXQA 4KIKA 4IW0A 1TGZB 3RYTA 1J7CA 3DHGC 1C79A 3KH0A 1C4PA 3PLUA 2ZPNA 3ZJTA 2WX0A 3Q3OC 1L2NA 2QSDA 1V1OA 2Y5CA 3KUDB 3N32A 2DLBA 2KANA 2HTHA 4MEMA 3EGRA 1E8ZA 4LCDE 3DVNV 3M3JA 5GMVA 1P98A 2O6VA 4DHJB 4E71A 2X38A 4M8NA 3IAM1 2PLPA 3QARA 2KMCA 2WQYB 1L6VA 5C23A 3ZNHB 1VD2A 1V81A 2V4LA 4HROA 3DBLI 1HEZE 1RWSA 1QOBA 3MFGA 2ZCBA 1OGWA 2L05A 3Q8CA 4K7UA 2KTFA 3AE9B 3PZDA 3A4RA 2K0PA 2VH1A 2E3TA 2WXRA 4KSLC 2PPHA 3Q8AA 4HJGE 1GNUA 5AZFA 3ZKJC 2O2VA 1SE2A 4S0RA 1XLQA 2KC2A 3PTFC 4L1BA 1KOTA 4S17A 3ZDTA 2C60A 3IG3A 3PREA 2B76B 3I5JC 4ZHOA 3DBLB 4RH6A 2DAJA 3MC0B 3CIRB 2QJLA 4XYCA 3N1ZC 4KV2A 4RMAA 5HG2A 3RD2A 2M0AA 5JXVA 4WJOA 2KQ4X 2QCZA 4ZRKA 4ZRJA 4WQMA 2KLCA 2VRRB 1ENFA 3I9V1 2AQ1B 4BKSD 1P7FA 2BKRB 5JH5C 3MHSD 4F1SA 2MBOA 3P4RB 1QQRA 3W2DA 1FNVA 3ZXRA 4AS1A 4KKJA 3M63B 2PJHA 1YN4A 2MBBB 4FN2A 4WWPA 1DOYA 1L7YA 2N7JA 2MW5A 2OHFA 1WXQA 1I4XA 2LJIA 1KLGD 2PTLA 3V61A 1EU3A 1I7HA 2YLMA 3AU4A 2MX2A 2XK5B 3QA8A 1R4MB 2M56B 4W9KA 3R7RA 3RPFC 4DHZE 3UIOB 3HHMA 1N5XA 2EMTA 2J4XA 4NQKE 3PZ8A 2UU7A 2LZ6A 1WX8A 2KTRA 2QHOA 3QAQA 2L7RA 3P2BA 3P4SB
chains in the Genus database with same CATH topology
4LTUA 1MHHE 3AMZA 1VZ6A 4WIPA 4A6QA 2RMMA 3DWMA 4WURA 4KX6B 4XDCA 4C7YA 4JE3B 1XO3A 1PYWD 1YN3A 3HVDA 4ZRPA 1WYGA 2SEBD 3BIID 3AM9A 4OW0A 3RFZB 1FRRA 5C2TB 3ZQ4A 5H92C 1MVKA 2JYEA 1AWDA 4IOIE 5T8IA 2IPKD 1STEA 3W1SA 1YN5A 1L5PA 1E7PB 4RGTA 1VR9A 4L23A 2H88B 1E9MA 3U4EG 2BYTA 5BMIA 2XNAC 5EE3A 2BB5A 1TS3A 1TY0A 5BYSA 3AV8A 4RGOS 1ACCA 3GB1A 1ZP0B 4D2KA 1OFFA 4HRSA 3PO0A 3VR9B 1K51A 4TMAB 2WXKA 1TKEA 2BS2B 4O1NA 2AQ2B 2ZW1A 3AE8B 3IAS1 1JMLA 1UNSA 2WXPA 3H8HA 3AH7A 1EU4A 5FK9C 5E6JA 3LYYA 1WRIA 3IXSA 2TSSA 1MHXA 2K5PA 3BK2A 1GOZA 3GP7A 5BYQA 2OEDA 1SB3C 1V97A 1BMLC 1JWUD 1PDXA 2LHDA 2JYTA 1QF6A 1YQ3B 2BT6A 1T6BX 1AW7A 1N61A 1QOAA 1IBXA 2Y3AA 2MJDA 2JQRB 3VR8B 2W82A 2V3NA 1D5XC 3BVGA 4US9A 2N9KA 5G5HA 2QMTA 4RGMA 1JRPA 2IJ0A 1M4VA 4N59A 1ZXHA 2I2YA 2FE8A 3AN1A 1GTEA 2BS3B 3TSSA 2L1AA 3ZJVA 1K50A 1KTKA 3BYTB 1VLBA 1YMHE 2LGIA 4WH4A 2MJ3A 4YXDB 1C9FA 2PVOD 3NVWA 2FBWB 4YTNB 1VRAB 3BWUD 1FIQA 2JX5A 2K3UA 2BTEA 3U2SC 1E10A 1DYQA 4NJCA 1C78A 3J9CA 3N9YC 1GTHA 1JWAD 4N6EB 1L0YB 2FUG1 3T3OA 2ICIA 4MACA 2BS4B 2SAKA 1KF6B 3I57A 5G5GA 1NYRA 1K52A 1WSPA 1C4AA 3B9JA 1HXYD 2NTTA 1V1PA 2MH7A 1TS2A 1KRHA 2WDRB 2DBYA 4YTPB 2BBCA 2J52A 5HFYA 3BVMA 2IGDA 1XXGA 1FO4A 4USAA 1BXTA 1UUPA 4P16A 1J7AA 5EE9A 1AYFA 3W9CB 4WAFA 2GI9A 2IGGA 1CK1A 2BW2A 2WP9B 1XLPA 2WXGA 1B9RA 4OZAA 1TS4A 4XE0A 2WXJA 4LK0M 1I4HA 3CWIA 5BMHA 1AN8A 4DXFA 1NYQA 3AEGB 2DWQA 4IDIA 4OHJA 4A9AA 2K22A 1FD6A 1PGBA 4OVZA 4ARCA 3TEYA 3E56A 4AQ7A 1LO5D 4C56C 2KWDA 1SF0A 2L32A 2DYMA 4MM3B 1DOXA 1VZ7A 1ET6A 3MHZA 1RM6C 4YSZB 2G9HD 1N62A 3SEBA 2HTME 4DQOC 3HRDD 4OZCA 3P63A 1FNUA 3Q69A 3EUB2 1WGKA 2W55A 5HI1A 2E6XA 2KAJA 2G1EA 1ESFA 2N0SB 3ETRA 1ZOYB 2QILA 3MP9A 1PFDA 1YNTE 3BVZA 2AQ3B 3P42A 4RF0A 1F77A 1ZUD2 4RF1A 2CU3A 1ZE3D 2KDMA 1SE3A 3AE5B 3ZYYX 3P1MA 5AUKA 1IGDA 2NTSA 1QLBB 2M19A 2WDQB 4KGTA 1DGJA 1CZPA 4C80A 3URYA 3NVYA 4OZBA 4NAMA 1F2RC 4Q2JA 5EE0A 2NMQA 3FILB 1TZOA 3AE7B 1JWBD 4HKZE 4IKGA 5BMGA 1F0ZA 1PGAA 1C76A 4RFBA 1TKYA 3AE4B 3W5UB 1N60A 2IGHA 1IGCA 2EELA 2D5GA 2YEPB 5AUIA 5H8YE 1EWCA 4ITKA 4TQ1A 4ZHPA 1VJKA 4HEA1 1KFYB 3OWEB 1CJEA 1FMAD 1L4ZB 4YTMB 5TSSA 5I4DA 4H2AA 2IDYA 2MEKA 2RDGA 2PW9A 3Q8BA 4LLGM 5D3IB 3BZDB 4KGSA 1ZDVA 3DWGC 2EKIA 3V05A 1DOIA 3B2GA 3KWVA 1T5XD 4ZRQA 3HVZA 1UGJA 3BK1A 4US8A 3SR6A 2V0GA 2WNMA 3TEZA 4REZA 4N58A 2WLBA 1XCQL 3MJ5A 3W5VB 3KQ4A 1GAQB 2Y5PA 1TY2A 3VQIA 2PKOA 2K9XA 2WU5B 3HUIA 1I4GA 4GDLB 4MH8A 1JWSD 5GXGB 1ZDXA 1ZPSA 4DXGA 1JQ4A 2CJNA 2I38A 1NENB 3AE1B 1OQRA 2KN4A 3C8YA 3NZ3A 3P4PB 4A90A 2QEJC 3P4QB 4YWGG 3NVZA 2Q5WD 1J7BA 2H89B 1SE4A 3AEEB 1I4RA 3L4PA 3SFEB 4A55A 2V4IB 2JU6X 2GRIA 4ZOHC 1FFUA 1XLOA 2XN9C 1UWMA 1P7EA 2WXMA 3KWLA 2QIEB 4JX1C 1TS5A 4ARIA 4L2YA 3LB8C 4NZLB 4GLSC 3AE6B 4JWSC 2BB6A 1VDVA 2LHEA 1QT9A 1SBBB 3U52E 1ZXIA 1SIJA 1FCCC 4TQ0A 5FR3A 1D5MC 3TEXA 2WXQA 4M0WA 1E6EB 3WCQA 3Q8FA 4J3OD 2L83A 1J7CA 5HHDG 2L52A 3UI3A 1UWXA 1C79A 3E9SA 1C4PA 4RNAA 1L6UA 2W54A 4UDUC 1JW9D 2N9LA 2W3RA 2INPE 3IT4B 3ZJTA 1K53A 1PUTA 4XDDA 2WXFA 1L0VB 3R2TA 3AEAB 1WWTA 2QSDA 4WWMA 1SSNA 2WXHA 1MI0A 1V1OA 1XLNA 1QOFA 5MPOA 1GT8A 1SJHD 4B0EA 2Y5CA 2DLBA 2CJOA 3ZGZA 1TKGA 3EGRA 2ONQA 4JPSA 2PMVA 3NRZA 4C7ZA 1VZ8A 2WU2B 1SXTA 1ROEA 1ET9A 1NVID 1KH0A 1F2RI 2X38A 3IAM1 4P6VF 2PLPA 1Q10A 4HKQA 1A70A 4A8XC 1H7WA 2WQYB 2J53A 1L6VA 2W3SA 2J42A 1FXIA 4GDKB 3VRBB 4KGRA 4KKIA 1EM7A 1CQVA 4HROA 1HEZE 1RWSA 1QOBA 2KMMA 3MFGA 1NI3A 5D3DA 2LFIA 2JXTA 1KLUD 3IT6B 4YSXB 3Q8CA 1YJJA 5FKAC 3AE9B 1L0XB 2K0PA 2E3TA 1MPEA 1N63A 2WXRA 1SEBD 2VZKB 3PZ7A 3Q8AA 5BYRA 1XEEA 4HJGE 5C3JB 1QOGA 1D5ZC 2INNE 1IBXB 1TJEA 4NAWB 2WXNA 1SE2A 2GB1A 4CQNA 1OQQA 1XLQA 4RGNA 1C77A 2JSVX 4L1BA 3O13A 2PVGC 1HQRD 4MT5A 3NS1A 1GB1A 1XCTL 2DYOA 4EE2A 3FILA 1QKZA 3R2IA 1L4DB 2RDHA 1HZ6A 2B76B 2LEKA 3AEDB 4ZHOA 2VZKD 4RH6A 2PIAA 3MC0B 3CIRB 1D6EC 5D7GA 3AE3B 2QJLA 1FEHA 3KLSX 2JZPA 3R8BA 1JWMD 2R61A 4R3DA 2LUMA 4TSSA 3AECB 1V8CA 1JROA 3BYYB 1HZ5A 2WXLA 3SFDB 2MJEA 1HA5A 5HG2A 1GB4A 2M0AA 1FFVA 2HDEA 2WXOA 5JXVA 2AX5A 4B0MA 3AE2B 2KQ4X 4RCOA 3EA6A 1N5WA 4WQMA 1FCLA 1ENFA 3I9V1 5EE1A 1TYGB 2AQ1B 3CF4A 1XF5L 4ZYSA 1P7FA 1E0ZA 1V1PB 3TEWA 1Y56A 3LXFA 1RYJA 3P4RB 3B2FA 1H7XA 1BUIC 3VRAB 1QQRA 3W2DA 1FNVA 2Z8LA 4AS1A 1D4BA 2YEPF 1B1ZA 4KKJA 3ABVB 2RPVA 3NUHB 3GS2A 4FXCA 3T3NA 1IUEA 1YN4A 1R7SA 1I4QA 2ZW0A 2V3PA 3AEFB 1DOYA 1YQ4B 2N7JA 5LNK1 4PT5A 4XWWA 3TUOA 2OHFA 1FM0D 1WXQA 1I4XA 1NEKB 1KLGD 2LJIA 2PTLA 1T3QA 1EU3A 1I7HA 1C4CA 2LMCA 3AEBB 1FXAA 1SJED 4XWTA 3RPFC 4YT0B 1JCKB 1QILA 2M56B 2WDVB 3ZJUA 1PGXA 1N5XA 2J4XA 1GPXA 2ON8A 1FRDA 3FC4A 2WS3B 3PZ8A 1I4PA 3V3XA 1FNWA 1RFKA 3FAHA 1JALA 2KACA 4YSYB 3U7ZA 2ACZB 3AB5A 4JWUC 1YJIA 3NVVA 3Q8EA 2WXIA 1EWYC 3P4SB 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LTU A;  3B9J A;  4N58 A;  3AMZ A;  2WLB A;  1YJJ A;  2MH7 A;  3W5V B;  3AE9 B;  1KRH A;  2WDR B;  2DBY A;  4YTP B;  1GAQ B;  3DWM A;  2E3T A;  4KX6 B;  1N63 A;  2PKO A;  4USA A;  2K9X A;  1FO4 A;  2WU5 B;  3HUI A;  4C7Y A;  1XO3 A;  3NVW A;  5C3J B;  1J7A A;  1QOG A;  5GXG B;  1WYG A;  1JQ4 A;  2CJN A;  5EE9 A;  1TJE A;  1AYF A;  3BII D;  1NEN B;  3AE1 B;  1OQR A;  3AM9 A;  3W9C B;  1FRR A;  3P4P B;  5C2T B;  5H92 C;  1OQQ A;  1XLQ A;  2WP9 B;  3P4Q B;  3NVZ A;  2Q5W D;  2PVG C;  1AWD A;  1J7B A;  3NS1 A;  1XLP A;  1B9R A;  2H89 B;  1L5P A;  1E7P B;  3AEE B;  3CWI A;  3L4P A;  3SFE B;  2LEK A;  2B76 B;  3AED B;  2H88 B;  1NYQ A;  4ZHO A;  3AEG B;  4ZOH C;  1FFU A;  1E9M A;  2DWQ A;  1XLO A;  2PIA A;  3CIR B;  1UWM A;  3AE3 B;  2QJL A;  3KWL A;  4IDI A;  2QIE B;  4JX1 C;  5EE3 A;  4A9A A;  2K22 A;  3AV8 A;  3LB8 C;  3AEC B;  1V8C A;  1JRO A;  1SF0 A;  3SFD B;  2MJE A;  1ZP0 B;  1DOX A;  3AE6 B;  1OFF A;  1FFV A;  4HRS A;  4JWS C;  3PO0 A;  1RM6 C;  4YSZ B;  1VDV A;  3VR9 B;  1N62 A;  2HTM E;  1QT9 A;  2AX5 A;  3FC4 A;  1TKE A;  3AE2 B;  3HRD D;  1ZXI A;  1SIJ A;  2BS2 B;  3P63 A;  1N5W A;  4WQM A;  1E6E B;  3AE8 B;  3EUB 2;  3WCQ A;  1WGK A;  2W55 A;  3AH7 A;  5EE1 A;  1TYG B;  2L83 A;  1J7C A;  2KAJ A;  2L52 A;  3CF4 A;  1WRI A;  2G1E A;  2K5P A;  1E0Z A;  2N0S B;  1L6U A;  3ETR A;  2W54 A;  1JW9 D;  2W3R A;  3LXF A;  1RYJ A;  3P4R B;  1SB3 C;  1V97 A;  1PFD A;  1PUT A;  1H7X A;  3B2F A;  1L0V B;  3VRA B;  1ZUD 2;  1PDX A;  2CU3 A;  3AEA B;  1WWT A;  1QF6 A;  1YQ3 B;  2BT6 A;  4WWM A;  3ZYY X;  3ABV B;  3AE5 B;  1N61 A;  1QOA A;  3P1M A;  1XLN A;  5AUK A;  1QLB B;  1QOF A;  2M19 A;  4FXC A;  1GT8 A;  1IUE A;  2WDQ B;  1R7S A;  5MPO A;  2MJD A;  1DGJ A;  2Y5C A;  1EWY C;  1CZP A;  4C80 A;  2JQR B;  3VR8 B;  3AEF B;  2CJO A;  3NVY A;  1DOY A;  1YQ4 B;  1TKG A;  4US9 A;  5EE0 A;  5G5H A;  3AE7 B;  1JWB D;  3NRZ A;  1F0Z A;  4C7Z A;  1JRP A;  2OHF A;  1FM0 D;  4N59 A;  1TKY A;  1WXQ A;  1NEK B;  2WU2 B;  3AN1 A;  3AE4 B;  1ROE A;  1T3Q A;  1I7H A;  1GTE A;  2BS3 B;  3AEB B;  1N60 A;  3W5U B;  1FXA A;  1NVI D;  5H8Y E;  5AUI A;  3RPF C;  4YT0 B;  2M56 B;  4ITK A;  2WDV B;  4P6V F;  4ZHP A;  1VJK A;  1VLB A;  1A70 A;  1N5X A;  1H7W A;  1KFY B;  2WQY B;  4YXD B;  2MJ3 A;  1GPX A;  1FRD A;  1CJE A;  2WS3 B;  1FMA D;  2FBW B;  4YTN B;  1L6V A;  2PVO D;  4YTM B;  2W3S A;  1FIQ A;  1RFK A;  3FAH A;  1FXI A;  1JAL A;  2JX5 A;  3VRB B;  1E10 A;  4YSY B;  2ACZ B;  4HRO A;  3AB5 A;  3DWG C;  4JWU C;  2EKI A;  1GTH A;  1JWA D;  1QOB A;  1RWS A;  1DOI A;  1YJI A;  2KMM A;  3B2G A;  4N6E B;  1NI3 A;  2BS4 B;  3HVZ A;  3NVV A;  1KF6 B;  4US8 A;  3SR6 A;  1ZOY B;  3P4S B;  5G5G A;  1NYR A;  4YSX B; 
#chains in the Genus database with same CATH topology
 1VZ6 A;  4C4V B;  2RMM A;  3DWM A;  4QAY A;  4WUR A;  3N1Y C;  2EKE C;  4ZRP A;  2DYB A;  3Q14 C;  4GIV A;  4OW0 A;  2ZEQ A;  3RFZ B;  2K6D B;  3ZQ4 A;  1D3Z A;  3OJ3 A;  3GE3 C;  1UF0 A;  4IOI E;  1STE A;  1L5P A;  1E7P B;  4RGT A;  1GC6 A;  1OTR B;  2H88 B;  3ZXV A;  1E9M A;  4W9C A;  3N3K B;  2BB5 A;  2KDF B;  2BGF A;  4NJ6 A;  3IBE A;  2JUO A;  1Q0W B;  4CYE A;  3VR9 B;  4GDK A;  1WGG A;  5CX3 A;  1V80 A;  1ZKH A;  2ZW1 A;  3DBH B;  3AE8 B;  3IAS 1;  5JHB A;  2WXP A;  3LYY A;  1WRI A;  2JRH A;  3IXS A;  1MHX A;  1NBF C;  2BYF A;  3HM6 X;  2N7E A;  5KHO A;  4GSW A;  3X0W A;  1PDX A;  1N61 A;  2G4D B;  2AL3 A;  1SIF A;  3Q3J A;  2ZPY A;  1WJ4 A;  3N1X C;  4HCN B;  1LQB A;  1Q1O A;  1WZ3 A;  3ZNG C;  3BVG A;  2DZK A;  3IFW B;  4PYU A;  2MBQ A;  4XZ4 A;  1JRP A;  2IJ0 A;  2FE8 A;  1GTE A;  2L1A A;  3O65 B;  3BYT B;  1V49 A;  2KMA A;  4K3C A;  4YTN B;  1FIQ A;  1WI0 A;  2BTE A;  4HDQ A;  3U2S C;  1E10 A;  1DYQ A;  2IO1 B;  4NJC A;  1JWA D;  4KIK B;  4LNN A;  2FUG 1;  3T3O A;  2DHZ A;  3DVG X;  1TBE A;  2KHW B;  3I57 A;  1C1Y B;  3VXW A;  3ZRF A;  3B9J A;  1WX9 A;  2NTT A;  5HKH A;  3DBR I;  1TS2 A;  2WDR B;  4YTP B;  5HFY A;  2CHX A;  1FO4 A;  4USA A;  1LGR A;  2LI5 A;  4P16 A;  1J7A A;  5L83 A;  2M17 A;  4WAF A;  3NHE B;  2IGG A;  1CK1 A;  2OOB B;  3L17 A;  4BOS C;  4II2 B;  2WX1 A;  1XLP A;  4OZA A;  4XE0 A;  2WXJ A;  2O6V B;  1I4H A;  4MDK E;  2DX5 B;  3ZW3 A;  3AEG B;  2KQS A;  2K22 A;  1FD6 A;  4HXD A;  3TEY A;  4C56 C;  1WE7 A;  2KWD A;  2DYM A;  3DBR B;  1RM6 C;  4YSZ B;  2G9H D;  2IO3 B;  3SEB A;  2HTM E;  2L3Z A;  1WXA A;  4M02 A;  3Q69 A;  3KUC B;  5CHW A;  2KAJ A;  2PE6 B;  1BT0 A;  2G1E A;  2FCS A;  3T9L A;  1F77 A;  5AEK B;  2JZ3 B;  3ZYY X;  3AE5 B;  4DHZ B;  4W9F A;  1QLB B;  2KXJ A;  1YIW A;  3K9P B;  4C80 A;  3URY A;  4NAM A;  3PGE A;  4EUT A;  4HKZ E;  1TKY A;  3ZO5 B;  3VTU A;  3C0R B;  2EEL A;  5D94 A;  2QDF A;  3WIM A;  2KK8 A;  3OWE B;  3Q3M C;  5E6P A;  1L4Z B;  4NPN A;  2LJ5 A;  2IDY A;  3Q8B A;  4LLG M;  4M8M A;  4KGS A;  2JPH A;  4BOZ B;  3DWG C;  1E7U A;  2EKI A;  1P0R A;  1YQB A;  3VUX A;  3B1L X;  3AI5 A;  1H8C A;  3SR6 A;  3NZU A;  2V0G A;  2WNM A;  4N58 A;  5L95 C;  4RM8 A;  3MJ5 A;  3KYD D;  2ZNV B;  4JLC A;  2WU5 B;  3HUI A;  1WR6 E;  4MH8 A;  1JQ4 A;  2K8H A;  1NEN B;  2NPT B;  2BQQ A;  2M8S A;  3NVZ A;  2HE7 A;  3NZS A;  3VTW A;  1I4R A;  2GRI A;  3EFU A;  4HCP B;  2J0M A;  2WXM A;  4JX1 C;  2KX3 A;  3TL5 A;  4ANV A;  3WAO A;  2LWP A;  2V3S A;  1XD3 B;  2KTR B;  2LHE A;  1SBB B;  1SIJ A;  2NBU A;  4DXA B;  3Q8F A;  5HHD G;  2L52 A;  3E9S A;  1RLF A;  3CF6 E;  1JW9 D;  2N9L A;  2W3R A;  2INP E;  3IT4 B;  4G50 A;  4FAD A;  1OEY J;  2IY1 B;  1WWT A;  1MI0 A;  1FPY A;  1QOF A;  2K39 A;  1GT8 A;  1WMH A;  3EC8 A;  2CJO A;  2FID A;  1PQS A;  3PLV A;  3VH3 B;  2G45 B;  2A4Z A;  4NNJ B;  3NRZ A;  4GMV A;  1KH0 A;  1F2R I;  1Z5S B;  1A5R A;  4P6V F;  2XEW A;  2AYO B;  4HKQ A;  2DZI A;  2W3S A;  4GDK B;  4MM3 A;  4KGR A;  3ZIM A;  1V5T A;  4PS8 A;  2LFI A;  4XX5 A;  1KLU D;  4MH0 E;  1Z2M A;  2KT7 A;  1WJU A;  2VZK B;  1XEE A;  2NS5 A;  4DWF A;  4DDI D;  3L08 A;  1D5Z C;  5EDS A;  3CMM B;  4CQN A;  1OQQ A;  4RGN A;  3GZN B;  2PVG C;  1TT5 B;  1HQR D;  3C19 A;  4MT5 A;  1XCT L;  2C9W B;  2D3C A;  2DYO A;  3WAP A;  4EE2 A;  2MBE A;  4TV3 A;  1WFY A;  2LEK A;  2KWC A;  3AED B;  3WAN A;  2NBW B;  2PIA A;  1D6E C;  2MWS B;  3R8B A;  4AUQ C;  2R61 A;  4TSS A;  2N1V A;  1V8C A;  3BYY B;  2WXL A;  1HA5 A;  1YX5 B;  2AX5 A;  1GJZ A;  2BKF A;  3MC8 A;  4B9K A;  1FCL A;  3TBL D;  2KQ7 A;  1V9J A;  1XF5 L;  4ZYS A;  1YOV B;  3VFK A;  3B2F A;  4BKS A;  4JL9 A;  1J0G A;  2G3Q B;  1WXS A;  2Z8L A;  2RPV A;  3NUH B;  3T3N A;  4URK A;  2ZW0 A;  3AEF B;  1TZ1 A;  1YQ4 B;  1H4R A;  1UBI A;  5LNK 1;  4PT5 A;  4XWW A;  3EHV A;  3RNC C;  1NEK B;  2VH2 A;  1T3Q A;  2LMC A;  4ANU A;  3DHH C;  3VUY A;  4YT0 B;  1JCK B;  4IC7 B;  2N9X A;  1PGX A;  3A1Q A;  2ON8 A;  3FC4 A;  1FNW A;  1RFK A;  2K6Q A;  3RZF A;  2BYV E;  3U7Z A;  4JWU C;  1C3T A;  4MJS A;  4IM2 A;  1ZOY B;  4LTU A;  3UQA A;  4B95 A;  1MG8 A;  3HM3 A;  4KX6 B;  4F7Z A;  4C7Y A;  3HVD A;  4ACF A;  2JXX A;  1WYG A;  1FRR A;  1E7V A;  1MVK A;  3Q3N C;  5T8I A;  1YN5 A;  2V1Y A;  4MSM B;  3IHP C;  4I6L B;  2CU1 A;  5BMI A;  5EE3 A;  5BYS A;  1TY0 A;  1OQY A;  1ZGU B;  4G3X B;  1OFF A;  4IWQ A;  3VUW A;  3PO0 A;  4PS7 A;  1AAR A;  1K51 A;  4TMA B;  2WXK A;  5FR6 A;  2BS2 B;  4O1N A;  2MBH A;  3ZDM C;  3GE8 C;  5FK9 C;  2LAS A;  1WX7 A;  1GOZ A;  3GP7 A;  5BYQ A;  2OED A;  1SB3 C;  2J0J A;  2GLS A;  4LJP B;  3ALB A;  2LHD A;  4FBJ B;  1YQ3 B;  4HPP A;  2Y3A A;  2WDT B;  1OEY A;  3BIN A;  2JQR B;  2V3N A;  2WGS A;  1R4M I;  2N9K A;  4JGH B;  3A9K A;  4RGM A;  2I2Y A;  4GOC A;  3Q2A C;  1XQQ A;  1UEL A;  1E5W A;  3ZJV A;  3R3M A;  4K7S A;  3PHW B;  4YXD B;  1P9D U;  2RPQ A;  2FBW B;  1VRA B;  3BWU D;  3MTN B;  1C78 A;  3U8Z A;  2OJR A;  4MAC A;  2BS4 B;  4TKN A;  2CKH B;  2IYD B;  1WSP A;  2IND C;  3APF A;  3TIX A;  3RT3 B;  1V1P A;  2MH7 A;  2MSE D;  1KRH A;  2J52 A;  2BBC A;  1UD7 A;  3KUZ A;  1LXD A;  2IGD A;  1XXG A;  3A33 B;  4G0N B;  1BXT A;  1WGH A;  3QK0 A;  3Q3F A;  4EEW A;  2FAZ A;  1AYF A;  1WMH B;  3S2A A;  2GI9 A;  5DPT A;  2GBN A;  2BW2 A;  2GOW A;  1B9R A;  4LK0 M;  5BMH A;  4W9L A;  1MFW A;  3B08 A;  1NYQ A;  2DWQ A;  4GU2 A;  4OVZ A;  4ARC A;  3JSV B;  4AQ7 A;  2BWE S;  4BKT A;  3DBH I;  5IP4 D;  4MM3 B;  5JZE B;  1ISN A;  3ZTD A;  1WXV A;  3HRD D;  3WAM A;  3KYC D;  1WGK A;  4NQL B;  2E6X A;  1ESF A;  3LJ3 A;  4MGZ E;  3ETR A;  1WGD A;  3MP9 A;  1PFD A;  4BVU C;  2AQ3 B;  4HK2 A;  2G4S A;  3RNF C;  2CU3 A;  5BO4 B;  1DGJ A;  3VDZ A;  2BYE A;  1CZP A;  5G55 A;  2LUE A;  3NVY A;  2LVQ A;  3ONS A;  2LXA A;  5EE0 A;  2NMQ A;  3U30 A;  5IN7 A;  2GBM A;  1MJD A;  1N60 A;  1IGC A;  5H8Y E;  2PEA A;  3DOW A;  1EWC A;  4ITK A;  2LGX A;  1SE9 A;  4JIO U;  1FMA D;  2JY6 A;  4YTM B;  2KC1 A;  4H2A A;  4DBG A;  3RZW C;  1Q5W B;  1DOI A;  3B2G A;  3KWV A;  3MC9 A;  1MG4 A;  4ZRQ A;  4HVB A;  4REZ A;  4LDT D;  3V60 A;  4TUU A;  5LXH A;  2IBI B;  2PKO A;  4ZYN A;  3UIN B;  3SDL C;  4FJV B;  4GDL B;  4DXG A;  2RR9 A;  1Y8R C;  1GG3 A;  2KN4 A;  3NZ3 A;  4A90 A;  3DHI C;  2L0F A;  4A3O A;  3UIP B;  3L4P A;  4FLH A;  2JU6 X;  3PRP B;  1XLO A;  1R4N I;  4BZA A;  4CO7 A;  2QIE B;  2KJR A;  3A1Q B;  1TS5 A;  4HDO A;  1T0Y A;  4ARI A;  4L2Y A;  2JZZ A;  2KNB A;  1EF5 A;  1TTN A;  2HJ1 A;  3AE6 B;  3CST A;  4K81 A;  4MJS B;  2EMS A;  3N20 C;  5FR3 A;  1D5M C;  2ZVN A;  2BVC A;  1E6E B;  4J3O D;  1I35 A;  3W1S C;  3JVZ X;  2W54 A;  4UDU C;  4N9F 4;  3PS6 A;  1PUT A;  4XDD A;  4A3P A;  2WXF A;  1L0V B;  1QZE A;  3R2T A;  3AEA B;  1SSN A;  2UYZ B;  5DCN A;  1V6E A;  4W9H A;  1R4N B;  2KX0 A;  1SJH D;  1G6J A;  2N1W A;  4IUM B;  4KDL B;  2LXC A;  4JPS A;  2PMV A;  4XGA B;  4C7Z A;  1VZ8 A;  2CS4 A;  3L54 A;  2WU2 B;  1SXT A;  1ROE A;  1ET9 A;  5LLI A;  1NVI D;  1E8W A;  4FJY A;  5JHA A;  4A8X C;  1H7W A;  4GGQ A;  2KZR A;  3ZVV A;  2J42 A;  1FXI A;  2O2V B;  4HPL B;  2KLG A;  3RUI B;  3Q6B A;  1RFA A;  4CHK A;  2KMM A;  2JXT A;  3IT6 B;  4GB9 A;  1YD8 U;  4LNO A;  3UQB A;  1MPE A;  1N63 A;  4MSQ B;  1SEB D;  3PZ7 A;  5C3J B;  3CSF A;  1TJE A;  2A5U A;  2WXN A;  2MQJ A;  2JSV X;  5J17 A;  2B3A A;  3A9K B;  3QHT A;  1QKZ A;  1L4D B;  1HZ6 A;  2VZK D;  1J19 A;  1EUV B;  1K8R B;  2WWZ A;  3KLS X;  1FEH A;  4G11 A;  3V6C B;  2MA9 B;  3DPD A;  1JRO A;  3RNG C;  1HZ5 A;  2MJE A;  3EFC A;  4K1R B;  2IO0 B;  4W9J A;  2AEH A;  3H7P A;  2MHJ A;  2X8X X;  2IZV B;  4RCO A;  3EA6 A;  4W9E A;  1V1P B;  1Y56 A;  5J18 A;  1RYJ A;  1J8C A;  2M1M A;  1BUI C;  3H1U A;  4KVG B;  2WHI A;  2YEP F;  1V86 A;  3ABV B;  4JQW C;  3GS2 A;  1R7S A;  3QIJ A;  1I4Q A;  2V3P A;  4FHK A;  4ASW C;  2GBR A;  1P1A A;  3AU5 A;  3R7Q A;  3TUO A;  1FM0 D;  3AEB B;  3W1Y A;  1SJE D;  2WDV B;  3HK0 A;  3ZJU A;  3PRM B;  1GPX A;  4W9G A;  1WE6 A;  4BBN F;  1FRD A;  2WS3 B;  4BFR A;  5IA7 A;  2KAC A;  4YSY B;  2ACZ B;  3AB5 A;  1YJI A;  3EEC A;  3NVV A;  3Q8E A;  2C7M B;  1EWY C;  3UGB B;  3AMZ A;  3A9J A;  2JRI B;  4A6Q A;  4ICV A;  1GC7 A;  3SHQ A;  4XDC A;  2R2O A;  3GZN I;  1PYW D;  1T0S C;  3SD5 A;  3TJP A;  3AM9 A;  2FCQ A;  1S1Q B;  5C2T B;  4NJ7 A;  2JYE A;  2JVC A;  2N9E B;  1AWD A;  5IO9 A;  2KWU B;  2IPK D;  3W1S A;  4E74 A;  4WJP A;  4DHJ D;  1VR9 A;  3ML8 A;  4L23 A;  2Z0D B;  3ZRC A;  2KDE B;  1T0R C;  3U4E G;  2BYT A;  2XNA C;  1TS3 A;  4RGO S;  3GB1 A;  1ZP0 B;  4M01 A;  1TKE A;  4LNI A;  1JML A;  1UNS A;  1P3Q U;  4GXB A;  1EU4 A;  2REX A;  1XT9 B;  2KFK A;  2K5P A;  2TSS A;  3BK2 A;  1WY8 A;  1N6Z A;  1V97 A;  2KVR A;  4EFO A;  1JWU D;  2JYT A;  3TMP B;  1AW7 A;  2N7D A;  2UWQ A;  2ZNV C;  1IBX A;  2KDI A;  1E8Y A;  2MJD A;  4NAW A;  3VR8 B;  2LVP A;  1D5X C;  4US9 A;  4F8C B;  3QWZ B;  4MGI E;  4FHJ A;  3LDZ E;  2K1F A;  3DDC B;  2BS3 B;  2K25 A;  4KZC A;  2DEN B;  2MLB A;  1RAX A;  3V62 A;  2LRU A;  1KTK A;  4WH4 A;  1YMH E;  4BKG A;  2MJ3 A;  4LJO B;  2LVO A;  2PVO D;  3NVW A;  2KVZ A;  5CHV C;  2KWV B;  4DDG D;  3N9Y C;  4N6E B;  1L0Y B;  2ICI A;  1LM8 B;  1WZ0 A;  5G5G A;  1NYR A;  1K52 A;  3I3T B;  1C4A A;  1E8X A;  3QJZ A;  1WYW B;  5AZG A;  2M0X A;  3VH4 B;  4IM0 A;  2GBK A;  5J2R A;  2AL6 A;  1UUP A;  1RRB A;  2NBV B;  5EE9 A;  3WAL A;  3IVF A;  1S3S G;  2M4N A;  4ZRI A;  3L0W B;  3OLM D;  4FA6 A;  1UH6 A;  3NS8 A;  3R66 C;  3CWI A;  1NI2 A;  4AWJ A;  3APC A;  3DCG A;  3QC8 B;  3PRZ A;  3RI7 C;  3JW0 X;  1SF0 A;  2L32 A;  3ZUN A;  1DOX A;  1VZ7 A;  1ET6 A;  2LGD A;  3MHZ A;  1VCB A;  2LRW A;  1N62 A;  4DQO C;  2NR2 A;  4OZC A;  1FNU A;  3PT2 B;  4K7W A;  3EUB 2;  3WA0 A;  2CHZ A;  1TIF A;  3H9D A;  3GOE A;  2QIL A;  1HTO A;  4P1B C;  1YNT E;  3BVZ A;  4RF0 A;  3FKY A;  1WIA A;  4RF1 A;  3ENE A;  1ZE3 D;  2MP2 A;  2KDM A;  2HJ8 A;  1IGD A;  4LNK A;  3I63 C;  2WDQ B;  4DK5 A;  4MEL A;  1F2R C;  3VTV A;  1FXT B;  4NY0 A;  1TZO A;  1F0Z A;  3OG5 A;  4RFB A;  2JWZ A;  1WF9 A;  2KJH B;  3W5U B;  5D6J B;  2IGH A;  2D5G A;  1VJK A;  4E3C A;  2FCM A;  1KFY B;  4BAX A;  2ASQ A;  3M62 B;  4BBN C;  5TSS A;  5I4D A;  1X1M A;  3H7P B;  2RDG A;  5D3I B;  3BZD B;  4MGK E;  3V05 A;  3BK1 A;  2KOX A;  1WM2 A;  4WAA A;  3MJW A;  3UF8 A;  1WJ6 A;  3PVL A;  2WLB A;  4AJY B;  1XCQ L;  4KDI C;  4WJQ A;  3KQ4 A;  3W5V B;  2W9N A;  3PSE B;  4HPM B;  1GAQ B;  2Y5P A;  3U7D A;  2K9X A;  1EF1 A;  2CR5 A;  1WRD B;  1I4G A;  1JWS D;  5GXG B;  1ZPS A;  2CJN A;  2RGF A;  2KO3 A;  4I6N B;  3NY5 A;  3DVG Y;  3RNA C;  5IKC M;  1I42 A;  2C7H A;  2Q5W D;  2IO2 B;  2H89 B;  4W9D A;  3AEE B;  4XC2 A;  2DZJ A;  2D10 A;  2ZVO A;  4ZDV A;  2V4I B;  1FFU A;  3QX1 A;  2L76 A;  1UWM A;  1YX6 B;  1LFD A;  1U4A A;  2YVC A;  3LB8 C;  3L16 A;  4NZL B;  2NPT A;  4JWS C;  2BB6 A;  5LXI B;  1FCC C;  3AXC A;  2K8C A;  4TQ0 A;  4M0W A;  3WCQ A;  2DAF A;  2LD9 A;  2L83 A;  4K3B A;  3UI3 A;  1UWX A;  2C7N B;  4RNA A;  3A9J B;  1L6U A;  3DVN U;  4RM9 A;  1K53 A;  1UBQ A;  4HWI B;  3RN9 C;  2D3B A;  3L13 A;  1SGH A;  4WWM A;  2WXH A;  5AZH A;  2J7Q B;  4AOF A;  1XLN A;  4IWP A;  5MPO A;  4B0E A;  1KLV A;  2O6V D;  3ZGZ A;  1TKG A;  2FIF A;  2ONQ A;  5E6O A;  3ZLZ A;  1M94 A;  3A4S C;  2GMI C;  3NOB A;  1Q10 A;  1A70 A;  2D3A A;  2J53 A;  4PYZ A;  3VRB B;  4KKI A;  3RNB C;  1EM7 A;  1CQV A;  4P1C C;  2Z0E B;  1NI3 A;  5D3D A;  1WR1 A;  1F1H A;  2KFK B;  4YSX B;  4A20 A;  1YJJ A;  2ZZP B;  5FKA C;  1L0X B;  5C1Z A;  5BYR A;  3KVF B;  1QOG A;  4ICU A;  2INN E;  1IBX B;  4NAW B;  4I6P A;  2GB1 A;  3TCA A;  2BPS A;  3VAW A;  1C77 A;  4KSK C;  2J0K A;  3O13 A;  3NS1 A;  1GB1 A;  1HTQ A;  3FIL A;  5DPR A;  3R2I A;  2RDH A;  3RMK C;  2ZCC A;  2PE9 A;  3NG0 A;  3L10 B;  1IPG A;  3AE3 B;  3BY4 B;  2JZP A;  3PPA A;  1JWM D;  4R3D A;  2LUM A;  2GBJ A;  3AEC B;  1WM3 A;  1GB4 A;  3SFD B;  4OVV A;  1FFV A;  2HDE A;  2WXO A;  4IWO A;  3NJT A;  4B0M A;  3AE2 B;  1N5W A;  4M00 A;  1WJN A;  4YL8 A;  5EE1 A;  1TYG B;  3VVW B;  4EZK A;  3CF4 A;  1E0Z A;  3SU8 X;  3TEW A;  3LXF A;  3T8M A;  1V5O A;  1H7X A;  3VRA B;  2I1J A;  1D4B A;  1B1Z A;  4ANW A;  3VHT C;  4FXC A;  1IUE A;  2KJ6 A;  3H7S A;  3ZTC A;  2CHW A;  1WGR A;  1C4C A;  1FXA A;  4XWT A;  2MCN B;  1QIL A;  3ECI A;  2KKC A;  3DQV A;  1I4P A;  3V3X A;  3FAH A;  1JAL A;  4MGY E;  2LGS A;  3RUL A;  4AJW A;  4IM3 A;  3HIZ A;  2WXI A;  2N9P C;  5D7G A;  2JWU A;  2AWT A;  2HD5 B;  1MHH E;  4PK1 A;  2Y5B B;  4WIP A;  2BWF A;  4JE3 B;  1XO3 A;  2MP2 B;  5TR5 A;  1YN3 A;  2SEB D;  3BII D;  4P7I A;  1GUA B;  2XBB C;  4LNF A;  3B0A A;  2RSU A;  5H92 C;  2DNF A;  4ANX A;  3N30 A;  1F52 A;  4FJZ A;  4EZL A;  4WJN A;  2D2Q A;  3AV8 A;  1ACC A;  2NVU I;  2I1K A;  3QCA A;  2L0T A;  3X23 A;  2FUH B;  4D2K A;  4HRS A;  1WXM A;  3V6E B;  2AQ2 B;  1E90 A;  5E6N A;  1F9J A;  3H8H A;  3AH7 A;  5E6J A;  3AUL A;  2K8B A;  4LDT B;  1BML C;  4IG7 B;  4EKU A;  1QF6 A;  2BT6 A;  3ML9 A;  3OJ4 B;  1T6B X;  2KFJ A;  2D11 A;  1QOA A;  1EO6 A;  1CMX B;  2IY0 B;  2OJW A;  2QC8 A;  2Z59 B;  2RDB C;  2W82 A;  3RCZ A;  5G5H A;  2QMT A;  1M4V A;  4N59 A;  1ZXH A;  4B6W A;  3AN1 A;  2INC C;  1ZW7 A;  3TSS A;  1WGY A;  1K50 A;  1VLB A;  2LGI A;  2JT4 B;  3PHX B;  1C9F A;  3OAW A;  2JX5 A;  2K3U A;  3J9C A;  1GTH A;  1JRU A;  4M0W B;  2RD0 A;  4II3 B;  5KHQ A;  1KJT A;  2SAK A;  1KF6 B;  3KW5 B;  2WYQ A;  2NCN A;  4HLE A;  5DPW A;  1WH3 A;  1T0Q C;  1HXY D;  1YJ1 A;  2DBY A;  3BVM A;  4HJK A;  5D2M B;  3W9C B;  2BF8 B;  1UGM A;  4W9I A;  3K9O B;  2WP9 B;  2MRP A;  1NDD A;  2WXG A;  1TS4 A;  1AN8 A;  2KD0 A;  3APD A;  4DXF A;  4IDI A;  4OHJ A;  2XK5 A;  4A9A A;  1PGB A;  3E56 A;  1LO5 D;  3QQ8 B;  5CHF A;  2DZM A;  5IOI A;  2D3G A;  1IYF A;  4WWN A;  1IP9 A;  3P63 A;  4X57 B;  2W55 A;  5HI1 A;  2JF5 A;  4EOY A;  2C5L C;  2N0S B;  5G2N A;  1HE8 A;  3P42 A;  4C4V A;  2L8J A;  1ZUD 2;  3JSV A;  2L00 B;  1SE3 A;  3P1M A;  5AUK A;  2NTS A;  2M19 A;  4KGT A;  3JYU A;  4OZB A;  4WQO B;  4Q2J A;  5CTR C;  2KDB A;  3FIL B;  4IKG A;  3AE7 B;  1JWB D;  4WWO A;  5BMG A;  1PGA A;  1C76 A;  2ZJD A;  3AE4 B;  3M95 A;  5IAA C;  3ZNI D;  1V2Y A;  2YEP B;  5AUI A;  4TQ1 A;  4ZHP A;  2LGY A;  4HEA 1;  4AP4 C;  1CJE A;  2D07 B;  4KZ0 A;  2MEK A;  2PW9 A;  1ZDV A;  1T5X D;  3HVZ A;  1UGJ A;  4US8 A;  3RNE C;  3ZNZ B;  3TEZ A;  3DBS A;  2KYW A;  4FUL A;  4GN1 A;  1KM7 A;  1TY2 A;  3VQI A;  2FCN A;  1ZDX A;  2I38 A;  4OVU A;  4C00 A;  3AE1 B;  1OQR A;  3C8Y A;  2FNJ B;  3P4P B;  2KN5 A;  2QEJ C;  3P4Q B;  4YWG G;  1J7B A;  1UZX B;  2R2Q A;  1SE4 A;  3D32 A;  3PV1 A;  3SFE B;  4A55 A;  4PS3 A;  4J6I A;  4ZOH C;  2XN9 C;  2N4F A;  3KWL A;  1P7E A;  4EZJ A;  4GDL A;  5DPS A;  4GLS C;  3H6N A;  1VDV A;  1QT9 A;  2V9H A;  3U52 E;  1ZXI A;  3TEX A;  2WXQ A;  4KIK A;  4IW0 A;  1TGZ B;  3RYT A;  1J7C A;  3DHG C;  1C79 A;  3KH0 A;  1C4P A;  3PLU A;  2ZPN A;  3ZJT A;  2WX0 A;  3Q3O C;  1L2N A;  2QSD A;  1V1O A;  2Y5C A;  3KUD B;  3N32 A;  2DLB A;  2KAN A;  2HTH A;  4MEM A;  3EGR A;  1E8Z A;  4LCD E;  3DVN V;  3M3J A;  5GMV A;  1P98 A;  2O6V A;  4DHJ B;  4E71 A;  2X38 A;  4M8N A;  3IAM 1;  2PLP A;  3QAR A;  2KMC A;  2WQY B;  1L6V A;  5C23 A;  3ZNH B;  1VD2 A;  1V81 A;  2V4L A;  4HRO A;  3DBL I;  1HEZ E;  1RWS A;  1QOB A;  3MFG A;  2ZCB A;  1OGW A;  2L05 A;  3Q8C A;  4K7U A;  2KTF A;  3AE9 B;  3PZD A;  3A4R A;  2K0P A;  2VH1 A;  2E3T A;  2WXR A;  4KSL C;  2PPH A;  3Q8A A;  4HJG E;  1GNU A;  5AZF A;  3ZKJ C;  2O2V A;  1SE2 A;  4S0R A;  1XLQ A;  2KC2 A;  3PTF C;  4L1B A;  1KOT A;  4S17 A;  3ZDT A;  2C60 A;  3IG3 A;  3PRE A;  2B76 B;  3I5J C;  4ZHO A;  3DBL B;  4RH6 A;  2DAJ A;  3MC0 B;  3CIR B;  2QJL A;  4XYC A;  3N1Z C;  4KV2 A;  4RMA A;  5HG2 A;  3RD2 A;  2M0A A;  5JXV A;  4WJO A;  2KQ4 X;  2QCZ A;  4ZRK A;  4ZRJ A;  4WQM A;  2KLC A;  2VRR B;  1ENF A;  3I9V 1;  2AQ1 B;  4BKS D;  1P7F A;  2BKR B;  5JH5 C;  3MHS D;  4F1S A;  2MBO A;  3P4R B;  1QQR A;  3W2D A;  1FNV A;  3ZXR A;  4AS1 A;  4KKJ A;  3M63 B;  2PJH A;  1YN4 A;  2MBB B;  4FN2 A;  4WWP A;  1DOY A;  1L7Y A;  2N7J A;  2MW5 A;  2OHF A;  1WXQ A;  1I4X A;  2LJI A;  1KLG D;  2PTL A;  3V61 A;  1EU3 A;  1I7H A;  2YLM A;  3AU4 A;  2MX2 A;  2XK5 B;  3QA8 A;  1R4M B;  2M56 B;  4W9K A;  3R7R A;  3RPF C;  4DHZ E;  3UIO B;  3HHM A;  1N5X A;  2EMT A;  2J4X A;  4NQK E;  3PZ8 A;  2UU7 A;  2LZ6 A;  1WX8 A;  2KTR A;  2QHO A;  3QAQ A;  2L7R A;  3P2B A;  3P4S B; 
#chains in the Genus database with same CATH homology
 4LTU A;  1MHH E;  3AMZ A;  1VZ6 A;  4WIP A;  4A6Q A;  2RMM A;  3DWM A;  4WUR A;  4KX6 B;  4XDC A;  4C7Y A;  4JE3 B;  1XO3 A;  1PYW D;  1YN3 A;  3HVD A;  4ZRP A;  1WYG A;  2SEB D;  3BII D;  3AM9 A;  4OW0 A;  3RFZ B;  1FRR A;  5C2T B;  3ZQ4 A;  5H92 C;  1MVK A;  2JYE A;  1AWD A;  4IOI E;  5T8I A;  2IPK D;  1STE A;  3W1S A;  1YN5 A;  1L5P A;  1E7P B;  4RGT A;  1VR9 A;  4L23 A;  2H88 B;  1E9M A;  3U4E G;  2BYT A;  5BMI A;  2XNA C;  5EE3 A;  2BB5 A;  1TS3 A;  1TY0 A;  5BYS A;  3AV8 A;  4RGO S;  1ACC A;  3GB1 A;  1ZP0 B;  4D2K A;  1OFF A;  4HRS A;  3PO0 A;  3VR9 B;  1K51 A;  4TMA B;  2WXK A;  1TKE A;  2BS2 B;  4O1N A;  2AQ2 B;  2ZW1 A;  3AE8 B;  3IAS 1;  1JML A;  1UNS A;  2WXP A;  3H8H A;  3AH7 A;  1EU4 A;  5FK9 C;  5E6J A;  3LYY A;  1WRI A;  3IXS A;  2TSS A;  1MHX A;  2K5P A;  3BK2 A;  1GOZ A;  3GP7 A;  5BYQ A;  2OED A;  1SB3 C;  1V97 A;  1BML C;  1JWU D;  1PDX A;  2LHD A;  2JYT A;  1QF6 A;  1YQ3 B;  2BT6 A;  1T6B X;  1AW7 A;  1N61 A;  1QOA A;  1IBX A;  2Y3A A;  2MJD A;  2JQR B;  3VR8 B;  2W82 A;  2V3N A;  1D5X C;  3BVG A;  4US9 A;  2N9K A;  5G5H A;  2QMT A;  4RGM A;  1JRP A;  2IJ0 A;  1M4V A;  4N59 A;  1ZXH A;  2I2Y A;  2FE8 A;  3AN1 A;  1GTE A;  2BS3 B;  3TSS A;  2L1A A;  3ZJV A;  1K50 A;  1KTK A;  3BYT B;  1VLB A;  1YMH E;  2LGI A;  4WH4 A;  2MJ3 A;  4YXD B;  1C9F A;  2PVO D;  3NVW A;  2FBW B;  4YTN B;  1VRA B;  3BWU D;  1FIQ A;  2JX5 A;  2K3U A;  2BTE A;  3U2S C;  1E10 A;  1DYQ A;  4NJC A;  1C78 A;  3J9C A;  3N9Y C;  1GTH A;  1JWA D;  4N6E B;  1L0Y B;  2FUG 1;  3T3O A;  2ICI A;  4MAC A;  2BS4 B;  2SAK A;  1KF6 B;  3I57 A;  5G5G A;  1NYR A;  1K52 A;  1WSP A;  1C4A A;  3B9J A;  1HXY D;  2NTT A;  1V1P A;  2MH7 A;  1TS2 A;  1KRH A;  2WDR B;  2DBY A;  4YTP B;  2BBC A;  2J52 A;  5HFY A;  3BVM A;  2IGD A;  1XXG A;  1FO4 A;  4USA A;  1BXT A;  1UUP A;  4P16 A;  1J7A A;  5EE9 A;  1AYF A;  3W9C B;  4WAF A;  2GI9 A;  2IGG A;  1CK1 A;  2BW2 A;  2WP9 B;  1XLP A;  2WXG A;  1B9R A;  4OZA A;  1TS4 A;  4XE0 A;  2WXJ A;  4LK0 M;  1I4H A;  3CWI A;  5BMH A;  1AN8 A;  4DXF A;  1NYQ A;  3AEG B;  2DWQ A;  4IDI A;  4OHJ A;  4A9A A;  2K22 A;  1FD6 A;  1PGB A;  4OVZ A;  4ARC A;  3TEY A;  3E56 A;  4AQ7 A;  1LO5 D;  4C56 C;  2KWD A;  1SF0 A;  2L32 A;  2DYM A;  4MM3 B;  1DOX A;  1VZ7 A;  1ET6 A;  3MHZ A;  1RM6 C;  4YSZ B;  2G9H D;  1N62 A;  3SEB A;  2HTM E;  4DQO C;  3HRD D;  4OZC A;  3P63 A;  1FNU A;  3Q69 A;  3EUB 2;  1WGK A;  2W55 A;  5HI1 A;  2E6X A;  2KAJ A;  2G1E A;  1ESF A;  2N0S B;  3ETR A;  1ZOY B;  2QIL A;  3MP9 A;  1PFD A;  1YNT E;  3BVZ A;  2AQ3 B;  3P42 A;  4RF0 A;  1F77 A;  1ZUD 2;  4RF1 A;  2CU3 A;  1ZE3 D;  2KDM A;  1SE3 A;  3AE5 B;  3ZYY X;  3P1M A;  5AUK A;  1IGD A;  2NTS A;  1QLB B;  2M19 A;  2WDQ B;  4KGT A;  1DGJ A;  1CZP A;  4C80 A;  3URY A;  3NVY A;  4OZB A;  4NAM A;  1F2R C;  4Q2J A;  5EE0 A;  2NMQ A;  3FIL B;  1TZO A;  3AE7 B;  1JWB D;  4HKZ E;  4IKG A;  5BMG A;  1F0Z A;  1PGA A;  1C76 A;  4RFB A;  1TKY A;  3AE4 B;  3W5U B;  1N60 A;  2IGH A;  1IGC A;  2EEL A;  2D5G A;  2YEP B;  5AUI A;  5H8Y E;  1EWC A;  4ITK A;  4TQ1 A;  4ZHP A;  1VJK A;  4HEA 1;  1KFY B;  3OWE B;  1CJE A;  1FMA D;  1L4Z B;  4YTM B;  5TSS A;  5I4D A;  4H2A A;  2IDY A;  2MEK A;  2RDG A;  2PW9 A;  3Q8B A;  4LLG M;  5D3I B;  3BZD B;  4KGS A;  1ZDV A;  3DWG C;  2EKI A;  3V05 A;  1DOI A;  3B2G A;  3KWV A;  1T5X D;  4ZRQ A;  3HVZ A;  1UGJ A;  3BK1 A;  4US8 A;  3SR6 A;  2V0G A;  2WNM A;  3TEZ A;  4REZ A;  4N58 A;  2WLB A;  1XCQ L;  3MJ5 A;  3W5V B;  3KQ4 A;  1GAQ B;  2Y5P A;  1TY2 A;  3VQI A;  2PKO A;  2K9X A;  2WU5 B;  3HUI A;  1I4G A;  4GDL B;  4MH8 A;  1JWS D;  5GXG B;  1ZDX A;  1ZPS A;  4DXG A;  1JQ4 A;  2CJN A;  2I38 A;  1NEN B;  3AE1 B;  1OQR A;  2KN4 A;  3C8Y A;  3NZ3 A;  3P4P B;  4A90 A;  2QEJ C;  3P4Q B;  4YWG G;  3NVZ A;  2Q5W D;  1J7B A;  2H89 B;  1SE4 A;  3AEE B;  1I4R A;  3L4P A;  3SFE B;  4A55 A;  2V4I B;  2JU6 X;  2GRI A;  4ZOH C;  1FFU A;  1XLO A;  2XN9 C;  1UWM A;  1P7E A;  2WXM A;  3KWL A;  2QIE B;  4JX1 C;  1TS5 A;  4ARI A;  4L2Y A;  3LB8 C;  4NZL B;  4GLS C;  3AE6 B;  4JWS C;  2BB6 A;  1VDV A;  2LHE A;  1QT9 A;  1SBB B;  3U52 E;  1ZXI A;  1SIJ A;  1FCC C;  4TQ0 A;  5FR3 A;  1D5M C;  3TEX A;  2WXQ A;  4M0W A;  1E6E B;  3WCQ A;  3Q8F A;  4J3O D;  2L83 A;  1J7C A;  5HHD G;  2L52 A;  3UI3 A;  1UWX A;  1C79 A;  3E9S A;  1C4P A;  4RNA A;  1L6U A;  2W54 A;  4UDU C;  1JW9 D;  2N9L A;  2W3R A;  2INP E;  3IT4 B;  3ZJT A;  1K53 A;  1PUT A;  4XDD A;  2WXF A;  1L0V B;  3R2T A;  3AEA B;  1WWT A;  2QSD A;  4WWM A;  1SSN A;  2WXH A;  1MI0 A;  1V1O A;  1XLN A;  1QOF A;  5MPO A;  1GT8 A;  1SJH D;  4B0E A;  2Y5C A;  2DLB A;  2CJO A;  3ZGZ A;  1TKG A;  3EGR A;  2ONQ A;  4JPS A;  2PMV A;  3NRZ A;  4C7Z A;  1VZ8 A;  2WU2 B;  1SXT A;  1ROE A;  1ET9 A;  1NVI D;  1KH0 A;  1F2R I;  2X38 A;  3IAM 1;  4P6V F;  2PLP A;  1Q10 A;  4HKQ A;  1A70 A;  4A8X C;  1H7W A;  2WQY B;  2J53 A;  1L6V A;  2W3S A;  2J42 A;  1FXI A;  4GDK B;  3VRB B;  4KGR A;  4KKI A;  1EM7 A;  1CQV A;  4HRO A;  1HEZ E;  1RWS A;  1QOB A;  2KMM A;  3MFG A;  1NI3 A;  5D3D A;  2LFI A;  2JXT A;  1KLU D;  3IT6 B;  4YSX B;  3Q8C A;  1YJJ A;  5FKA C;  3AE9 B;  1L0X B;  2K0P A;  2E3T A;  1MPE A;  1N63 A;  2WXR A;  1SEB D;  2VZK B;  3PZ7 A;  3Q8A A;  5BYR A;  1XEE A;  4HJG E;  5C3J B;  1QOG A;  1D5Z C;  2INN E;  1IBX B;  1TJE A;  4NAW B;  2WXN A;  1SE2 A;  2GB1 A;  4CQN A;  1OQQ A;  1XLQ A;  4RGN A;  1C77 A;  2JSV X;  4L1B A;  3O13 A;  2PVG C;  1HQR D;  4MT5 A;  3NS1 A;  1GB1 A;  1XCT L;  2DYO A;  4EE2 A;  3FIL A;  1QKZ A;  3R2I A;  1L4D B;  2RDH A;  1HZ6 A;  2B76 B;  2LEK A;  3AED B;  4ZHO A;  2VZK D;  4RH6 A;  2PIA A;  3MC0 B;  3CIR B;  1D6E C;  5D7G A;  3AE3 B;  2QJL A;  1FEH A;  3KLS X;  2JZP A;  3R8B A;  1JWM D;  2R61 A;  4R3D A;  2LUM A;  4TSS A;  3AEC B;  1V8C A;  1JRO A;  3BYY B;  1HZ5 A;  2WXL A;  3SFD B;  2MJE A;  1HA5 A;  5HG2 A;  1GB4 A;  2M0A A;  1FFV A;  2HDE A;  2WXO A;  5JXV A;  2AX5 A;  4B0M A;  3AE2 B;  2KQ4 X;  4RCO A;  3EA6 A;  1N5W A;  4WQM A;  1FCL A;  1ENF A;  3I9V 1;  5EE1 A;  1TYG B;  2AQ1 B;  3CF4 A;  1XF5 L;  4ZYS A;  1P7F A;  1E0Z A;  1V1P B;  3TEW A;  1Y56 A;  3LXF A;  1RYJ A;  3P4R B;  3B2F A;  1H7X A;  1BUI C;  3VRA B;  1QQR A;  3W2D A;  1FNV A;  2Z8L A;  4AS1 A;  1D4B A;  2YEP F;  1B1Z A;  4KKJ A;  3ABV B;  2RPV A;  3NUH B;  3GS2 A;  4FXC A;  3T3N A;  1IUE A;  1YN4 A;  1R7S A;  1I4Q A;  2ZW0 A;  2V3P A;  3AEF B;  1DOY A;  1YQ4 B;  2N7J A;  5LNK 1;  4PT5 A;  4XWW A;  3TUO A;  2OHF A;  1FM0 D;  1WXQ A;  1I4X A;  1NEK B;  1KLG D;  2LJI A;  2PTL A;  1T3Q A;  1EU3 A;  1I7H A;  1C4C A;  2LMC A;  3AEB B;  1FXA A;  1SJE D;  4XWT A;  3RPF C;  4YT0 B;  1JCK B;  1QIL A;  2M56 B;  2WDV B;  3ZJU A;  1PGX A;  1N5X A;  2J4X A;  1GPX A;  2ON8 A;  1FRD A;  3FC4 A;  2WS3 B;  3PZ8 A;  1I4P A;  3V3X A;  1FNW A;  1RFK A;  3FAH A;  1JAL A;  2KAC A;  4YSY B;  3U7Z A;  2ACZ B;  3AB5 A;  4JWU C;  1YJI A;  3NVV A;  3Q8E A;  2WXI A;  1EWY C;  3P4S B;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...