3EGRA

Crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
QKEWPLWEVFVRSKQGLEHKHCGSLHATDAQQALHMARDVYTRRQEGVSIWVVPSTAITASAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords phenylacetate-CoA oxygenase subunit PaaB
publication title Crystal structure of phenylacetate-CoA oxygenase subunit PaaB (YP_297411.1) from RALSTONIA EUTROPHA JMP134 at 2.65 A resolution
rcsb
source organism Ralstonia eutropha jmp134
total genus 12
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06243 PaaB Phenylacetic acid degradation B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.520 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3egrA00
3EGRA
chains in the Genus database with same CATH superfamily
1I4GA 4NAWA 4BKSA 2V4IB 5E6PA 3PHWB 2RMMA 4DK5A 4ZDVA 3RT3B 1VLBA 3TEXA 1R7SA 2MHJA 2XBBC 4S17A 1LXDA 1YN5A 3RMKC 2GBNA 2KN5A 2KQSA 3N1XC 5G55A 1NDDA 1E90A 4YL8A 1WJNA 1WXMA 2RDGA 3K9OB 1OGWA 4KSKC 3ETRA 4G11A 4KZCA 5JHAA 1E7PB 3UQAA 2DLBA 3DCGA 2JZZA 4HEA1 2R2QA 4TMAB 2LZ6A 1QKZA 3Q3JA 4M0WB 4O1NA 4W9CA 1WZ0A 4IM2A 2OEDA 4W9GA 1L0XB 3IAM1 2N7JA 4UDUC 3AE9B 4YSYB 3ECIA 4YSZB 1QQRA 2I1JA 4MELA 4XGAB 1YD8U 1N61A 4A55A 1GB4A 1MPEA 2UWQA 1R4NB 4MH8A 2LGIA 3CWIA 4JX1C 1TS4A 2RDHA 2RD0A 2LHEA 2K8HA 2D07B 1BXTA 4BKSD 2QDFA 4OZAA 2PPHA 4A9AA 1V2YA 1PFDA 3H7PA 4MM3A 4IWOA 3QQ8B 2WXKA 1M4VA 2K6DB 3A1QA 3VUXA 3ZVVA 2ZEQA 1EUVB 1XCQL 3AULA 1DOXA 3JYUA 2PW9A 2KOXA 2KKCA 1WGRA 2FNJB 1PGAA 1V9JA 4OW0A 2ZPYA 3N32A 4HWIB 3NJTA 2FIDA 2CS4A 1NI2A 2CU3A 4FA6A 2WX0A 3H1UA 1TT5B 1RFAA 3TEYA 5IKCM 2KC1A 1GAQB 2KDFB 2KVZA 4WWPA 3KYDD 3KLSX 2BQQA 4IM3A 2EMSA 1SE2A 4F7ZA 2CJNA 2DZIA 1BUIC 1T5XD 2D2QA 1HZ5A 2BS2B 3ZXRA 4W9FA 2LMCA 3KYCD 5D7GA 3RNEC 2G4SA 1XCTL 1I7HA 4AUQC 4MM3B 5IN7A 3DWMA 2JVCA 1B9RA 2AQ1B 1CJEA 3A1QB 4FHKA 3RN9C 1SXTA 1CMXB 1ZXIA 1WE7A 2KAJA 4RF1A 1E8ZA 2WU2B 1ISNA 1C3TA 3QC8B 5I4DA 2XEWA 3KVFB 1YJIA 1E8YA 3SU8X 3A9JA 1SSNA 3H8HA 3P1MA 3RUIB 1L4ZB 3OLMD 1GOZA 3ALBA 4OVUA 1AW7A 3VRBB 2BS4B 3B9JA 4US9A 1FCLA 5AUKA 4RCOA 3U7DA 1TGZB 2O2VA 5AEKB 2ZVOA 3RZWC 1YN3A 4C4VA 3W5UB 2K0PA 2D3GA 2J7QB 2KACA 1XLPA 3GOEA 5IOIA 2I1KA 2BYVE 4YTPB 4DWFA 2AQ3B 1QOBA 1D5ZC 1UWMA 3VAWA 2V1YA 3OJ3A 4ZRKA 4XZ4A 3AE7B 1F0ZA 3AM9A 4ZOHC 1ENFA 1J8CA 3EUB2 5E6JA 4NPNA 4W9IA 1N63A 1XD3B 2KX0A 2M8SA 3B1LX 2FUG1 1PGBA 2IDYA 4WAAA 4JIOU 3A9JB 2N9XA 4S0RA 2QJLA 5L83A 3PZDA 4YXDB 1SE4A 4C80A 1T0YA 2N9KA 3NUHB 2MW5A 2O2VB 3DBRB 3AMZA 1C4CA 4II3B 4GLSC 1HXYD 2KJHB 1WXQA 3N1ZC 1L0YB 3RD2A 1GC6A 1ZGUB 2UU7A 4E3CA 2JY6A 2PLPA 4GMVA 2JPHA 3R8BA 2CKHB 3ZW3A 3RNCC 3V05A 2KLGA 1AN8A 2ON8A 1Q0WB 2L76A 3O65B 4KKJA 3V3XA 2LD9A 4KIKB 2M1MA 3QIJA 2WDVB 2J0JA 3Q6BA 3IT6B 3WCQA 2MJDA 1JW9D 2AX5A 3MTNB 1C4AA 2PEAA 3KWLA 3RYTA 3ZYYX 2WS3B 5HI1A 1RRBA 3DBRI 1T6BX 5JHBA 1SJED 3OJ4B 4N59A 3DBSA 1OEYJ 1H4RA 4RF0A 1I42A 3BVZA 1MVKA 3AE3B 2N9LA 1JWMD 1C76A 4TSSA 1J19A 2AYOB 2WXPA 2L0TA 5CHFA 4ZRJA 1OEYA 1VZ6A 1FFUA 4ZYNA 3L17A 4EZLA 1F1HA 1N5WA 1TY0A 3NVYA 4QAYA 1BT0A 2ZCCA 2IGGA 2KDBA 3P4QB 1OFFA 2DHZA 3SHQA 5TR5A 2NBVB 2BB5A 4LJPB 3DVNV 2IO3B 4AOFA 4N58A 3NZUA 3HRDD 1KTKA 3AEAB 1WE6A 3PZ7A 1AYFA 1EM7A 1S3SG 4KX6B 4P16A 1VDVA 3IG3A 2ZVNA 1VRAB 4BBNF 4C7YA 1L0VB 3P63A 2GOWA 4C7ZA 4KKIA 1KF6B 2V3NA 1V97A 1KLGD 1SIJA 3TMPB 1F9JA 1WM3A 3BINA 5C3JB 4PYZA 3CIRB 2NS5A 5JH5C 3Q8CA 2DZKA 1L6UA 1L4DB 4B6WA 2J4XA 5G5HA 3P4PB 1KH0A 3HVDA 4DHJB 3NZSA 2N1VA 1OQRA 3APFA 2Z59B 3WAOA 2R61A 1YQBA 4M01A 5D94A 3ZIMA 3AV8A 5J2RA 3KWVA 3RNBC 3AE6B 3AXCA 2X8XX 1M94A 1FCCC 4D2KA 1TS3A 5AZHA 2NBWB 4J3OD 3ZNHB 1SEBD 3N30A 1FRDA 1JWUD 2KQ4X 4LNNA 3V62A 4DHJD 2Z8LA 4XDDA 2ACZB 2M17A 4HJGE 5T8IA 1JQ4A 1ROEA 2L0FA 2ICIA 3MHZA 2REXA 3NVVA 2KD0A 4MGYE 2MP2A 1JRPA 2QC8A 4RH6A 4DHZE 4K1RB 4WWOA 3DOWA 3VR9B 5AUIA 2Y3AA 2J53A 2XN9C 3RZFA 2N4FA 5CHWA 3ZTDA 3VHTC 2KTFA 3N3KB 4MSMB 1YJ1A 2L3ZA 1TY2A 4DXGA 4FADA 4K7UA 2K3UA 4BKGA 2WXQA 4JWSC 3FC4A 2GMIC 5FK9C 4OZBA 4FULA 4HDOA 4ITKA 4RGTA 1YX6B 3T3OA 3R2IA 2M0AA 4R3DA 4RM8A 1E10A 3RI7C 2WXHA 2BBCA 4M02A 4PYUA 4ZRPA 4MGKE 2MP2B 2N7DA 4NZLB 1K53A 4EFOA 1XLNA 2PE6B 1T0SC 1Z5SB 1IYFA 2MBQA 2KK8A 1I4QA 2J52A 4L2YA 2LRUA 2W54A 3U52E 3AH7A 4HKQA 2PVOD 1Y8RC 3C19A 2IY1B 3KW5B 5G5GA 1WRIA 4A3PA 3ZXVA 4LK0M 2Y5PA 2LVQA 3AU4A 3W9CB 2DZMA 3TJPA 1AARA 1ZDXA 1TS5A 2PMVA 3GS2A 1RWSA 4FJZA 1NEKB 4I6PA 2WXIA 2W55A 1JWAD 1KJTA 3VFKA 1V5TA 3Q8FA 1XO3A 2BB6A 3IXSA 2ONQA 4C56C 2DENB 2L32A 5EE9A 2RR9A 4A8XC 4GDKA 1WGHA 2PTLA 3BYYB 1D4BA 1JWSD 1GC7A 2IBIB 1V8CA 3BYTB 4MACA 1ACCA 3BVGA 3H6NA 4LTUA 1QLBB 4A3OA 2B76B 4MGIE 2WDQB 2HJ1A 2V3SA 1Z2MA 1I4HA 4EUTA 3QA8A 1K51A 5BO4B 4OVVA 1SGHA 2NTTA 1ESFA 1SB3C 3HM3A 3P4RB 1YNTE 2WXLA 2KMAA 2BT6A 1V1OA 3OAWA 1FEHA 3EFUA 4HVBA 3GB1A 2JYTA 4LJOB 2KMCA 1V1PB 2OHFA 1C4PA 4PS8A 1F52A 2DAJA 1CK1A 3NS1A 5DPSA 4GDLB 5AZFA 5CX3A 1V6EA 4GDKB 4TV3A 2WLBA 2FUHB 2JSVX 5J17A 4BZAA 1C9FA 3UI3A 2KFKB 5HFYA 1T0QC 2CJOA 5BMHA 2V3PA 2IY0B 2NCNA 5TSSA 4OHJA 3PZ8A 2GBMA 3PV1A 2ZZPB 2JYEA 4RGOS 4B0MA 1FNWA 2FCSA 3X23A 5H8YE 5LLIA 1E5WA 1UELA 2NPTA 2EELA 1TYGB 4LNOA 1RM6C 4ACFA 2KWCA 2LGSA 2RDBC 2IYDB 3DHGC 4EKUA 3APDA 4ICUA 1P1AA 3TEZA 4ZRIA 3C8YA 3V60A 2IZVB 3SR6A 2OOBB 4P6VF 2H89B 4NY0A 1KLUD 1V5OA 1FPYA 1HTOA 3RPFC 3GP7A 4KDIC 4W9HA 1N62A 1TIFA 1H8CA 2IO1B 2RPQA 2HJ8A 3IFWB 3ZLZA 3HK0A 2WQYB 3SEBA 3HM6X 5AZGA 3ZUNA 3BIID 3O13A 1TKEA 1IPGA 2L8JA 1VJKA 2NPTB 1ZDVA 2KMMA 3C0RB 4ZYSA 4URKA 2J0MA 3HIZA 4DDGD 2W3RA 4KV2A 2K9XA 3MJ5A 4PT5A 1K50A 3DVGY 2G9HD 2KHWB 3VR8B 2N7EA 4AJWA 1HE8A 3DDCB 3KQ4A 4FJVB 1TBEA 3SDLC 3PSEB 4EZJA 5IO9A 2NR2A 1WMHB 3W1YA 3DBLI 4A6QA 2JT4B 1QF6A 2KO3A 1FXAA 4A20A 1E0ZA 4X57B 2VH1A 3IBEA 2GB1A 1MFWA 1D6EC 3JSVA 1SF0A 1XF5L 3QX1A 2LGDA 1WSPA 2DNFA 1VR9A 3TL5A 2Q5WD 5G2NA 3U2SC 4HPMB 2KXJA 2KT7A 3E9SA 3B08A 3S2AA 3RCZA 2KWUB 4IWQA 3L0WB 1WYGA 1NI3A 1PDXA 4N6EB 3KUDB 4KIKA 1DYQA 2MWSB 2JQRB 3Q3FA 4EE2A 4W9EA 2WXFA 3I9V1 1QILA 1N60A 4MDKE 1XQQA 2LVPA 2V4LA 2HTME 2MX2A 4XC2A 3JSVB 3Q8EA 1STEA 2KANA 1P0RA 2BWFA 3AEEB 4GGQA 1TKGA 1WGKA 1WX8A 4P1CC 1JRUA 4MH0E 2KDEB 4NJ6A 2MBHA 1JCKB 3N9YC 1CZPA 4KDLB 3IT4B 3W5VB 1P3QU 1XEEA 3T3NA 5JXVA 3ONSA 2IPKD 4JWUC 2A4ZA 4KGTA 1LO5D 3LXFA 3PS6A 2KWDA 3H9DA 2MA9B 2HD5B 4MEMA 4W9DA 2KTRA 3I57A 1VD2A 2LXCA 2JXTA 1V80A 2QILA 2FCQA 3QWZB 2SEBD 1EO6A 3A4RA 3QCAA 1QT9A 2VZKB 4C00A 5J18A 4YTNB 3R3MA 3MHSD 3PTFC 2RGFA 2WHIA 5D2MB 2INPE 3GZNI 3ZNGC 1RFKA 4IWPA 1RLFA 1N6ZA 1WXVA 1L2NA 2O6VA 2J0KA 3W2DA 3PT2B 3WALA 4JE3B 1TTNA 4NAMA 1ZE3D 1WFYA 2VZKD 5DPWA 4GOCA 4G0NB 2L00B 2C60A 4FBJB 2BGFA 4P7IA 2PE9A 4JGHB 3KUZA 2KTRB 3HHMA 4WJPA 3NG0A 5JZEB 2LI5A 2KQ7A 1MJDA 3B0AA 3ZTCA 3PHXB 2ZW0A 3CMMB 2Y5CA 3PVLA 2BKFA 2WWZA 3AE8B 1FFVA 2K39A 3U7ZA 4E71A 5E6NA 1FXTB 4IG7B 4KSLC 4DBGA 1SE3A 2PVGC 2C9WB 2MSED 5MPOA 2O6VB 3CSFA 3QJZA 4MGZE 2LGYA 1JALA 3U4EG 4HJKA 4BOSC 2D5GA 4W9LA 1BMLC 4PK1A 1WRDB 3QAQA 2INDC 4IKGA 1I35A 3ZO5B 4BVUC 2QSDA 4WJOA 1WM2A 2TSSA 1SIFA 1KM7A 3UF8A 3QARA 2RPVA 4FHJA 2NVUI 4IW0A 4WQMA 1KOTA 4IOIE 4CHKA 2QHOA 2O6VD 2JX5A 3WAPA 1J7AA 1WGGA 3L08A 1EWCA 3VVWB 3Q69A 3WA0A 5D3DA 5C23A 4ANVA 3RNAC 4IM0A 3DBHB 4H2AA 3VRAB 2MQJA 3AU5A 2AQ2B 2G1EA 1NYRA 2KDMA 3RNGC 2LJ5A 1WR6E 3ZDMC 4DXAB 1EU3A 1L7YA 3NOBA 4ARCA 2GBJA 2PIAA 4TQ0A 4L1BA 5DCNA 2JXXA 1XT9B 2SAKA 3B2GA 3MP9A 3OWEB 3L13A 1LQBA 3J9CA 3QHTA 4Q2JA 3DBHI 2IGDA 1EWYC 3ZJTA 1OQYA 3CF6E 4JQWC 4B0EA 4CO7A 4ANXA 3TUOA 3VQIA 4LNKA 1FRRA 2BKRB 3GE3C 4BBNC 1TZOA 1YOVB 4K3BA 3MFGA 2IO2B 2K25A 1E6EB 4AP4C 1A70A 4AS1A 1PQSA 3ZQ4A 1UZXB 5E6OA 2INNE 1WY8A 2WP9B 4TUUA 2EKIA 1V81A 2N9PC 4XWTA 3ZDTA 1NVID 1L6VA 4MSQB 3UIOB 2AWTA 1WXAA 4WURA 2M19A 2GBKA 3ML9A 2KN4A 4RNAA 2WXOA 2L7RA 3ZNID 1Q10A 1F2RI 2K1FA 4FJYA 4FN2A 3AE1B 3AECB 3LYYA 1NYQA 3Q3MC 1B1ZA 4LNIA 3I5JC 3PLVA 1FXIA 2C7NB 1GUAB 1EF1A 1YN4A 4RM9A 5IA7A 1P7FA 2MCNB 1E8XA 4WJQA 2BYFA 2X38A 1I4XA 4XX5A 3AN1A 1ZOYB 3VUYA 1V1PA 5BYQA 1ZUD2 1C78A 4WQOB 4K81A 4GDLA 1T0RC 3EECA 1QOFA 2VRRB 2WU5B 5C2TB 2DWQA 3BVMA 4DHZB 2KC2A 5HHDG 1YJJA 2KYWA 4P1BC 2KFKA 1D5XC 5GMVA 3NVWA 1EF5A 1TZ1A 3M62B 5EE0A 3RULA 4B95A 5EE1A 1JMLA 2XK5A 3DVNU 2PKOA 3FILA 5D6JB 3FKYA 3BK1A 1UGMA 4GIVA 2FCMA 2D3CA 4HXDA 4EOYA 2Z0DB 4EZKA 2MRPA 3TSSA 2EKEC 3P4SB 2YEPF 1IP9A 2XNAC 2JZ3B 4W9JA 3R7RA 2DX5B 1FD6A 5LXIB 2LASA 3PRPB 1R4MI 2V9HA 2D11A 4PS7A 2C7MB 4USAA 3W1SC 4XWWA 2KJ6A 2RSUA 2HTHA 1XLOA 1YIWA 2KVRA 3Q3NC 2FAZA 2BPSA 2C5LC 2MJ3A 2G4DB 1PGXA 3TCAA 3U30A 2E3TA 2GLSA 5FKAC 1E8WA 4RGNA 4IC7B 4HCNB 2XK5B 2OJRA 1WR1A 2K5PA 3AEBB 4M8NA 1VZ7A 4NJCA 5L95C 3FILB 3HVZA 1WJ6A 2OJWA 3ZJUA 2LWPA 1OTRB 1UBIA 1ZKHA 4NAWB 2WXJA 2ZW1A 4XE0A 2FCNA 1NBFC 3T8MA 4AWJA 3MC0B 1E9MA 3UGBB 2IGHA 1QOAA 3A4SC 4J6IA 2M0XA 4KGSA 3PO0A 4WWNA 3VTWA 3R2TA 1YX5B 2INCC 1WH3A 1ZPSA 1FO4A 4W9KA 4WWMA 1WWTA 2CHXA 3EA6A 3NRZA 1WMHA 1IBXA 2I2YA 3BK2A 1TS2A 4MT5A 4KGRA 2IJ0A 3N20C 1MG8A 2Y5BB 2JF5A 3NZ3A 1UH6A 3R7QA 2KNBA 2GBRA 1R4NI 3DBLB 1CQVA 2NMQA 1I4RA 3ZJVA 2W3SA 3DWGC 3EGRA 3DHIC 3I63C 3Q8BA 1SE9A 1QZEA 3V61A 1LM8B 3PREA 4HLEA 1D3ZA 3GE8C 4OVZA 4GU2A 1C79A 4JL9A 4K7WA 1Q5WB 2QCZA 3FAHA 5IP4D 4AJYB 1DGJA 1HTQA 1YQ4B 4MJSA 4L23A 1ZP0B 3H7PB 1HQRD 1IBXB 5CHVC 5IAAC 5KHOA 4K3CA 3P42A 1K52A 3SD5A 2N1WA 2ZNVC 4RMAA 3ML8A 1F77A 1WGDA 3DPDA 1MHXA 2EMTA 2KZRA 4XDCA 2LHDA 3MC9A 2CHWA 4HRSA 3W1SA 4II2B 1DOIA 1A5RA 2D3AA 4BKTA 2LFIA 4YSXB 1KRHA 2LRWA 5BMIA 3L54A 2W82A 3T9LA 2L52A 2V0GA 1WX7A 3Q8AA 2GRIA 1XXGA 1E7VA 5D3IB 3X0WA 1GJZA 2LXAA 1LGRA 1S1QB 4MJSB 1J7BA 3AEFB 1YQ3B 1RAXA 2MJEA 3V6CB 2GI9A 3K9PB 2ZCBA 4OZCA 5HG2A 3PRMB 4XYCA 1D5MC 2DZJA 3ABVB 2QIEB 5CTRC 2N9EB 3UINB 2NTSA 2WDRB 4GB9A 4I6NB 4YTMB 3AE4B 2ZPNA 3WAMA 4FLHA 4ARIA 2NBUA 1UD7A 2AEHA 4I6LB 4WH4A 3VH3B 1F2RC 4ANUA 1SBBB 5LXHA 3VH4B 5DPTA 2BF8B 4ASWC 4K7SA 1WXSA 1YMHE 3ZKJC 2DYMA 3AEGB 3EC8A 3V6EB 1TKYA 4C4VB 1ZW7A 3GZNB 2L05A 1Q1OA 2BWES 5BYRA 2G3QB 1XLQA 2K22A 2JU6X 2LUMA 4IUMB 4HPPA 3AE2B 3LDZE 4BOZB 3UQBA 2KX3A 3A33B 4HPLB 4RGMA 1UWXA 2N0SB 2BS3B 2BVCA 2K8BA 3ZGZA 2CHZA 2LEKA 3DQVA 3IVFA 1HA5A 4RFBA 2C7HA 5C1ZA 1FM0D 3TBLD 2MBBB 3UIPB 2JRHA 1WGYA 4DXFA 2PJHA 1UGJA 5EDSA 1HEZE 3JVZX 3IHPC 3EFCA 4M8MA 3DVGX 4B9KA 1P9DU 4F8CB 2R2OA 4GXBA 2WXGA 1RYJA 4IDIA 4LDTB 1WF9A 1DOYA 3VXWA 4JPSA 2WX1A 1QOGA 3PRZA 2L83A 1C1YB 3D32A 1IGDA 5HKHA 2YEPB 1WX9A 2WXMA 2BYEA 3A9KA 3B2FA 1WI0A 3Q14C 1E7UA 2K8CA 4AQ7A 4NNJB 2DYBA 5H92C 1WJUA 1AWDA 1FNUA 2KJRA 4HKZE 2JWZA 3URYA 2MLBA 1EU4A 1NENB 5LNK1 4LDTD 4BFRA 1LFDA 1JWBD 1WZ3A 2Z0EB 2BYTA 3H7SA 3WIMA 4A90A 3RFZB 2J42A 3MC8A 1GNUA 2E6XA 3VTUA 2W9NA 4DDID 3ZRCA 2K6QA 2KLCA 2M56B 3JW0X 3AB5A 4M00A 2D10A 3M3JA 2L1AA 3VTVA 2G45B 2JUOA 2LUEA 5FR6A 5KHQA 2HDEA 3KH0A 1GG3A 3N1YC 4KVGB 2MBEA 1KFYB 2LJIA 4LLGM 1V86A 2ZNVB 2QMTA 3A9KB 1IGCA 1WJ4A 3TIXA 1P98A 3EHVA 2AL6A 3P2BA 3PPAA 4ANWA 4ZHPA 4N9F4 3VDZA 2MBOA 3NY5A 1VCBA 4HCPB 3RNFC 2YVCA 3MJWA 5DPRA 4DQOC 2JZPA 1J7CA 3OG5A 4FXCA 2KDIA 5BMGA 3LB8C 3AEDB 2ZJDA 3I3TB 1PYWD 1I4PA 1L5PA 5EE3A 3APCA 3PGEA 3KUCB 3LJ3A 1X1MA 3IAS1 1Y56A 2BW2A 2UYZB 3SFEB 4G3XB 3R66C 4CYEA 2HE7A 1GB1A 2WNMA 1TJEA 3ENEA 1FMAD 4CQNA 3L10B 3QK0A 1ET6A 1MG4A 1WYWB 4US8A 1K8RB 2YLMA 3Q2AC 2CR5A 1UF0A 2KFJA 2B3AA 4GSWA 2H88B 1FNVA 3SFDB 4WJNA 3E56A 4BAXA 3AI5A 4WIPA 1U4AA 4KZ0A 3VUWA 3PLUA 2AL3A 4TQ1A 4NQLB 2WGSA 3ZRFA 1FIQA 2DBYA 1WIAA 3M63B 3HUIA 4ZRQA 2ASQA 4YWGG 1ZXHA 4YT0B 1MHHE 2WDTB 1MI0A 5FR3A 2FE8A 2CU1A 2WXNA 1PUTA 4ZHOA 3CSTA 4NQKE 2WXRA 1VZ8A 3AE5B 1J0GA 2FIFA 4HROA 3BZDB 4G50A 3ZNZB 2MH7A 1T3QA 1UUPA 4GN1A 2A5UA 4TKNA 3BY4B 4LCDE 3NHEB 2MEKA 1G6JA 1N5XA 3DHHC 3WANA 3BWUD 1JROA 3M95A 2M4NA 2IO0B 4ICVA 2D3BA 4HK2A 3L4PA 4REZA 1IUEA 2LVOA 1V49A 4WAFA 2DYOA 2FBWB 2JWUA 2BTEA 3Q3OC 4E74A 2JRIB 4JLCA 4EEWA 3U8ZA 4LNFA 2LGXA 4PS3A 1UNSA 1R4MB 1KLVA 2DAFA 1ET9A 5BYSA 1P7EA 5GXGB 1SJHD 3L16A 3NS8A 4F1SA 2I38A 3NVZA 3TEWA 2WYQA 1C77A 1UBQA 4NJ7A 4HDQA 4M0WA 2VH2A 1HZ6A 2KWVB 2QEJC 1GPXA 1OQQA
chains in the Genus database with same CATH topology
2ICIA 1I4GA 3MHZA 2V4IB 1C79A 2SEBD 3NVVA 1QT9A 2VZKB 3FAHA 1JRPA 4RH6A 1DGJA 2RMMA 1YQ4B 4YTNB 1VLBA 4L23A 1R7SA 1ZP0B 3TEXA 3VR9B 1HQRD 1IBXB 5AUIA 2Y3AA 2J53A 2XN9C 2INPE 1YN5A 1RFKA 3P42A 1K52A 1TY2A 4DXGA 3W2DA 2K3UA 1F77A 2WXQA 1MHXA 4JE3B 4JWSC 3FC4A 2RDGA 4XDCA 2LHDA 4HRSA 4NAMA 1ZE3D 3W1SA 2VZKD 3ETRA 5FK9C 1DOIA 1E7PB 4OZBA 2DLBA 4ITKA 4RGTA 2LFIA 4HEA1 4YSXB 4TMAB 3T3OA 1KRHA 1QKZA 5BMIA 4O1NA 3R2IA 2W82A 2M0AA 4R3DA 2L52A 1E10A 2ZW0A 2V0GA 2OEDA 2WXHA 1L0XB 2BBCA 2Y5CA 3Q8AA 2GRIA 3IAM1 1XXGA 2N7JA 4UDUC 3AE9B 4ZRPA 3AE8B 4YSYB 5D3IB 4NZLB 1K53A 1XLNA 4YSZB 1QQRA 1I4QA 2J52A 1FFVA 3U7ZA 4L2YA 1J7BA 3AEFB 2W54A 1N61A 4A55A 1YQ3B 1GB4A 1MPEA 2MJEA 3U52E 4MH8A 2LGIA 3AH7A 1SE3A 2PVGC 3CWIA 4JX1C 1TS4A 2RDHA 2GI9A 2PVOD 4HKQA 5MPOA 4OZCA 2LHEA 5HG2A 1JALA 5G5GA 1D5MC 1BXTA 1WRIA 4OZAA 3U4EG 4LK0M 2Y5PA 2D5GA 3ABVB 1BMLC 2QIEB 3W9CB 2NTSA 4A9AA 2WDRB 1PFDA 4IKGA 2QSDA 2TSSA 4YTMB 1ZDXA 1TS5A 2PMVA 3AE4B 2WXKA 1M4VA 4ARIA 3GS2A 4WH4A 2RPVA 1RWSA 1F2RC 1XCQL 4WQMA 1DOXA 1NEKB 1SBBB 2PW9A 2WXIA 4IOIE 2W55A 1JWAD 2JX5A 1J7AA 3Q8FA 1YMHE 1XO3A 1PGAA 2BB6A 3IXSA 2ONQA 1EWCA 4C56C 4OW0A 3Q69A 2DYMA 2L32A 3AEGB 1TKYA 5D3DA 5EE9A 2CU3A 4A8XC 2PTLA 1D4BA 3BYYB 4H2AA 3VRAB 1JWSD 3TEYA 2AQ2B 2G1EA 1NYRA 2KDMA 5BYRA 1GAQB 1V8CA 3BYTB 4MACA 1XLQA 2K22A 1ACCA 3BVGA 2JU6X 2LUMA 1EU3A 3AE2B 4ARCA 3KLSX 2PIAA 1SE2A 4TQ0A 4LTUA 2CJNA 4L1BA 1QLBB 1BUIC 1T5XD 4RGMA 1UWXA 2N0SB 2BS3B 2B76B 1HZ5A 2BS2B 2SAKA 3ZGZA 3B2GA 3MP9A 2WDQB 2LEKA 2LMCA 5D7GA 3OWEB 1HA5A 4RFBA 1I4HA 1FM0D 1XCTL 1I7HA 1K51A 4MM3B 3J9CA 3DWMA 2NTTA 4DXFA 1ESFA 4Q2JA 1B9RA 1UGJA 1CJEA 1SB3C 2AQ1B 3P4RB 1YNTE 2IGDA 1EWYC 3ZJTA 2WXLA 1SXTA 1HEZE 2BT6A 1V1OA 4B0EA 1FEHA 1ZXIA 3GB1A 2JYTA 1V1PB 2KAJA 2OHFA 4RF1A 2WU2B 1C4PA 3TUOA 4N6EB 5I4DA 3VQIA 3NS1A 1CK1A 1FRRA 2WXGA 1RYJA 4GDLB 4IDIA 1DOYA 1YJIA 1TZOA 4GDKB 4JPSA 1SSNA 3H8HA 3P1MA 1QOGA 2WLBA 2L83A 3MFGA 1L4ZB 1IGDA 2JSVX 2YEPB 1GOZA 1C9FA 1E6EB 2WXMA 3B2FA 3UI3A 1AW7A 1A70A 4AQ7A 4AS1A 3VRBB 5HFYA 3ZQ4A 5H92C 1AWDA 1FNUA 2BS4B 3B9JA 4US9A 4HKZE 1FCLA 2INNE 2CJOA 5AUKA 2V3PA 5BMHA 4RCOA 2WP9B 3URYA 5TSSA 1EU4A 4OHJA 1NENB 2EKIA 3PZ8A 5LNK1 4XWTA 1YN3A 3W5UB 1NVID 1JWBD 2K0PA 1L6VA 2KACA 1XLPA 2BYTA 4YTPB 4WURA 2JYEA 4RGOS 2M19A 4B0MA 4A90A 3RFZB 2AQ3B 1QOBA 4RNAA 2KN4A 2J42A 1D5ZC 1UWMA 1FNWA 2WXOA 5H8YE 2E6XA 1Q10A 1F2RI 3AE7B 1F0ZA 2EELA 2M56B 1TYGB 3AM9A 3AE1B 3AECB 4ZOHC 3AB5A 1ENFA 3LYYA 1RM6C 1NYQA 3EUB2 5E6JA 1B1ZA 1N63A 2L1AA 2FUG1 1PGBA 2HDEA 1FXIA 1YN4A 2IDYA 1KFYB 2LJIA 3TEZA 1P7FA 2QJLA 4LLGM 3C8YA 2QMTA 4YXDB 1IGCA 2X38A 3SR6A 1I4XA 1SE4A 3AN1A 4C80A 1ZOYB 1V1PA 4P6VF 2N9KA 2H89B 5BYQA 1ZUD2 1C78A 1KLUD 3NUHB 3AMZA 1C4CA 4ZHPA 3RPFC 1QOFA 4GLSC 1HXYD 2WU5B 1WXQA 3GP7A 5C2TB 2DWQA 3BVMA 1L0YB 1N62A 4DQOC 5HHDG 1YJJA 2PLPA 2JZPA 2WQYB 3SEBA 1J7CA 4FXCA 1D5XC 3R8BA 3NVWA 5BMGA 3BIID 3O13A 3V05A 3LB8C 1TKEA 3AEDB 1AN8A 2ON8A 1VJKA 5EE0A 1PYWD 1I4PA 1L5PA 1ZDVA 4KKJA 5EE3A 3V3XA 2KMMA 5EE1A 1JMLA 4ZYSA 2WDVB 3IT6B 3WCQA 2MJDA 1JW9D 2AX5A 1C4AA 3KWLA 2PKOA 2W3RA 3FILA 3ZYYX 2WS3B 3IAS1 3BK1A 2K9XA 5HI1A 1Y56A 3MJ5A 2BW2A 4PT5A 1K50A 3SFEB 1T6BX 1GB1A 2WNMA 1TJEA 1SJED 1FMAD 2G9HD 4CQNA 3VR8B 4N59A 3TSSA 3P4SB 2YEPF 1ET6A 4RF0A 2XNAC 3KQ4A 3BVZA 4US8A 1FD6A 1MVKA 3AE3B 2N9LA 4A6QA 1QF6A 1JWMD 4USAA 4XWWA 2H88B 1FNVA 3SFDB 1FXAA 3E56A 1C76A 4TSSA 1XLOA 1E0ZA 4WIPA 2WXPA 2MJ3A 1VZ6A 1FFUA 4TQ1A 2GB1A 1PGXA 1FIQA 2E3TA 2DBYA 1D6EC 1SF0A 1XF5L 1N5WA 1TY0A 3NVYA 5FKAC 3HUIA 4RGNA 4ZRQA 1WSPA 4YWGG 1VR9A 2IGGA 1ZXHA 4YT0B 3P4QB 2Q5WD 1OFFA 1MHHE 4NJCA 2K5PA 3AEBB 3U2SC 1VZ7A 1MI0A 3FILB 2BB5A 3E9SA 3HVZA 5FR3A 2FE8A 3ZJUA 2WXNA 1PUTA 4ZHOA 1WYGA 4N58A 2WXRA 3HRDD 1KTKA 1NI3A 1PDXA 1VZ8A 1AYFA 3AE5B 3AEAB 3PZ7A 2WXJA 2ZW1A 1EM7A 4KX6B 4NAWB 4XE0A 1DYQA 4HROA 4P16A 3MC0B 1VDVA 3BZDB 2MH7A 1E9MA 1T3QA 1UUPA 2IGHA 1QOAA 2JQRB 4EE2A 4KGSA 1VRAB 3PO0A 2WXFA 4C7YA 1L0VB 1QILA 3I9V1 3R2TA 2MEKA 3P63A 1N60A 4C7ZA 4KKIA 1N5XA 1KF6B 2V3NA 1ZPSA 1V97A 1FO4A 4WWMA 1KLGD 1SIJA 1WWTA 2HTME 3BWUD 3Q8EA 3EA6A 1JROA 1STEA 5C3JB 3AEEB 3NRZA 3CIRB 1TKGA 1WGKA 3Q8CA 1L6UA 1L4DB 1IBXA 2J4XA 3L4PA 4REZA 1IUEA 5G5HA 3P4PB 1KH0A 3HVDA 1JCKB 2I2YA 3BK2A 1TS2A 4MT5A 4KGRA 3N9YC 2IJ0A 2DYOA 4WAFA 1OQRA 2FBWB 2JWUA 2BTEA 1CZPA 3IT4B 3W5VB 2R61A 1XEEA 3NZ3A 1UNSA 3T3NA 5JXVA 3AV8A 2IPKD 4JWUC 1CQVA 2NMQA 1ET9A 1I4RA 3KWVA 4KGTA 5BYSA 3ZJVA 2W3SA 1LO5D 1P7EA 3AE6B 3LXFA 1SJHD 5GXGB 2KWDA 3DWGC 1FCCC 4D2KA 3EGRA 1TS3A 4J3OD 3Q8BA 2I38A 3NVZA 3TEWA 1SEBD 1C77A 1FRDA 1JWUD 2KQ4X 2Z8LA 4M0WA 4XDDA 2ACZB 3I57A 4HJGE 1HZ6A 2JXTA 2QILA 5T8IA 1JQ4A 2QEJC 4OVZA 1ROEA 1GPXA 1OQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGR A; 
#chains in the Genus database with same CATH topology
 1I4G A;  4NAW A;  4BKS A;  2V4I B;  5E6P A;  3PHW B;  2RMM A;  4DK5 A;  4ZDV A;  3RT3 B;  1VLB A;  3TEX A;  1R7S A;  2MHJ A;  2XBB C;  4S17 A;  1LXD A;  1YN5 A;  3RMK C;  2GBN A;  2KN5 A;  2KQS A;  3N1X C;  5G55 A;  1NDD A;  1E90 A;  4YL8 A;  1WJN A;  1WXM A;  2RDG A;  3K9O B;  1OGW A;  4KSK C;  3ETR A;  4G11 A;  4KZC A;  5JHA A;  1E7P B;  3UQA A;  2DLB A;  3DCG A;  2JZZ A;  4HEA 1;  2R2Q A;  4TMA B;  2LZ6 A;  1QKZ A;  3Q3J A;  4M0W B;  4O1N A;  4W9C A;  1WZ0 A;  4IM2 A;  2OED A;  4W9G A;  1L0X B;  3IAM 1;  2N7J A;  4UDU C;  3AE9 B;  4YSY B;  3ECI A;  4YSZ B;  1QQR A;  2I1J A;  4MEL A;  4XGA B;  1YD8 U;  1N61 A;  4A55 A;  1GB4 A;  1MPE A;  2UWQ A;  1R4N B;  4MH8 A;  2LGI A;  3CWI A;  4JX1 C;  1TS4 A;  2RDH A;  2RD0 A;  2LHE A;  2K8H A;  2D07 B;  1BXT A;  4BKS D;  2QDF A;  4OZA A;  2PPH A;  4A9A A;  1V2Y A;  1PFD A;  3H7P A;  4MM3 A;  4IWO A;  3QQ8 B;  2WXK A;  1M4V A;  2K6D B;  3A1Q A;  3VUX A;  3ZVV A;  2ZEQ A;  1EUV B;  1XCQ L;  3AUL A;  1DOX A;  3JYU A;  2PW9 A;  2KOX A;  2KKC A;  1WGR A;  2FNJ B;  1PGA A;  1V9J A;  4OW0 A;  2ZPY A;  3N32 A;  4HWI B;  3NJT A;  2FID A;  2CS4 A;  1NI2 A;  2CU3 A;  4FA6 A;  2WX0 A;  3H1U A;  1TT5 B;  1RFA A;  3TEY A;  5IKC M;  2KC1 A;  1GAQ B;  2KDF B;  2KVZ A;  4WWP A;  3KYD D;  3KLS X;  2BQQ A;  4IM3 A;  2EMS A;  1SE2 A;  4F7Z A;  2CJN A;  2DZI A;  1BUI C;  1T5X D;  2D2Q A;  1HZ5 A;  2BS2 B;  3ZXR A;  4W9F A;  2LMC A;  3KYC D;  5D7G A;  3RNE C;  2G4S A;  1XCT L;  1I7H A;  4AUQ C;  4MM3 B;  5IN7 A;  3DWM A;  2JVC A;  1B9R A;  2AQ1 B;  1CJE A;  3A1Q B;  4FHK A;  3RN9 C;  1SXT A;  1CMX B;  1ZXI A;  1WE7 A;  2KAJ A;  4RF1 A;  1E8Z A;  2WU2 B;  1ISN A;  1C3T A;  3QC8 B;  5I4D A;  2XEW A;  3KVF B;  1YJI A;  1E8Y A;  3SU8 X;  3A9J A;  1SSN A;  3H8H A;  3P1M A;  3RUI B;  1L4Z B;  3OLM D;  1GOZ A;  3ALB A;  4OVU A;  1AW7 A;  3VRB B;  2BS4 B;  3B9J A;  4US9 A;  1FCL A;  5AUK A;  4RCO A;  3U7D A;  1TGZ B;  2O2V A;  5AEK B;  2ZVO A;  3RZW C;  1YN3 A;  4C4V A;  3W5U B;  2K0P A;  2D3G A;  2J7Q B;  2KAC A;  1XLP A;  3GOE A;  5IOI A;  2I1K A;  2BYV E;  4YTP B;  4DWF A;  2AQ3 B;  1QOB A;  1D5Z C;  1UWM A;  3VAW A;  2V1Y A;  3OJ3 A;  4ZRK A;  4XZ4 A;  3AE7 B;  1F0Z A;  3AM9 A;  4ZOH C;  1ENF A;  1J8C A;  3EUB 2;  5E6J A;  4NPN A;  4W9I A;  1N63 A;  1XD3 B;  2KX0 A;  2M8S A;  3B1L X;  2FUG 1;  1PGB A;  2IDY A;  4WAA A;  4JIO U;  3A9J B;  2N9X A;  4S0R A;  2QJL A;  5L83 A;  3PZD A;  4YXD B;  1SE4 A;  4C80 A;  1T0Y A;  2N9K A;  3NUH B;  2MW5 A;  2O2V B;  3DBR B;  3AMZ A;  1C4C A;  4II3 B;  4GLS C;  1HXY D;  2KJH B;  1WXQ A;  3N1Z C;  1L0Y B;  3RD2 A;  1GC6 A;  1ZGU B;  2UU7 A;  4E3C A;  2JY6 A;  2PLP A;  4GMV A;  2JPH A;  3R8B A;  2CKH B;  3ZW3 A;  3RNC C;  3V05 A;  2KLG A;  1AN8 A;  2ON8 A;  1Q0W B;  2L76 A;  3O65 B;  4KKJ A;  3V3X A;  2LD9 A;  4KIK B;  2M1M A;  3QIJ A;  2WDV B;  2J0J A;  3Q6B A;  3IT6 B;  3WCQ A;  2MJD A;  1JW9 D;  2AX5 A;  3MTN B;  1C4A A;  2PEA A;  3KWL A;  3RYT A;  3ZYY X;  2WS3 B;  5HI1 A;  1RRB A;  3DBR I;  1T6B X;  5JHB A;  1SJE D;  3OJ4 B;  4N59 A;  3DBS A;  1OEY J;  1H4R A;  4RF0 A;  1I42 A;  3BVZ A;  1MVK A;  3AE3 B;  2N9L A;  1JWM D;  1C76 A;  4TSS A;  1J19 A;  2AYO B;  2WXP A;  2L0T A;  5CHF A;  4ZRJ A;  1OEY A;  1VZ6 A;  1FFU A;  4ZYN A;  3L17 A;  4EZL A;  1F1H A;  1N5W A;  1TY0 A;  3NVY A;  4QAY A;  1BT0 A;  2ZCC A;  2IGG A;  2KDB A;  3P4Q B;  1OFF A;  2DHZ A;  3SHQ A;  5TR5 A;  2NBV B;  2BB5 A;  4LJP B;  3DVN V;  2IO3 B;  4AOF A;  4N58 A;  3NZU A;  3HRD D;  1KTK A;  3AEA B;  1WE6 A;  3PZ7 A;  1AYF A;  1EM7 A;  1S3S G;  4KX6 B;  4P16 A;  1VDV A;  3IG3 A;  2ZVN A;  1VRA B;  4BBN F;  4C7Y A;  1L0V B;  3P63 A;  2GOW A;  4C7Z A;  4KKI A;  1KF6 B;  2V3N A;  1V97 A;  1KLG D;  1SIJ A;  3TMP B;  1F9J A;  1WM3 A;  3BIN A;  5C3J B;  4PYZ A;  3CIR B;  2NS5 A;  5JH5 C;  3Q8C A;  2DZK A;  1L6U A;  1L4D B;  4B6W A;  2J4X A;  5G5H A;  3P4P B;  1KH0 A;  3HVD A;  4DHJ B;  3NZS A;  2N1V A;  1OQR A;  3APF A;  2Z59 B;  3WAO A;  2R61 A;  1YQB A;  4M01 A;  5D94 A;  3ZIM A;  3AV8 A;  5J2R A;  3KWV A;  3RNB C;  3AE6 B;  3AXC A;  2X8X X;  1M94 A;  1FCC C;  4D2K A;  1TS3 A;  5AZH A;  2NBW B;  4J3O D;  3ZNH B;  1SEB D;  3N30 A;  1FRD A;  1JWU D;  2KQ4 X;  4LNN A;  3V62 A;  4DHJ D;  2Z8L A;  4XDD A;  2ACZ B;  2M17 A;  4HJG E;  5T8I A;  1JQ4 A;  1ROE A;  2L0F A;  2ICI A;  3MHZ A;  2REX A;  3NVV A;  2KD0 A;  4MGY E;  2MP2 A;  1JRP A;  2QC8 A;  4RH6 A;  4DHZ E;  4K1R B;  4WWO A;  3DOW A;  3VR9 B;  5AUI A;  2Y3A A;  2J53 A;  2XN9 C;  3RZF A;  2N4F A;  5CHW A;  3ZTD A;  3VHT C;  2KTF A;  3N3K B;  4MSM B;  1YJ1 A;  2L3Z A;  1TY2 A;  4DXG A;  4FAD A;  4K7U A;  2K3U A;  4BKG A;  2WXQ A;  4JWS C;  3FC4 A;  2GMI C;  5FK9 C;  4OZB A;  4FUL A;  4HDO A;  4ITK A;  4RGT A;  1YX6 B;  3T3O A;  3R2I A;  2M0A A;  4R3D A;  4RM8 A;  1E10 A;  3RI7 C;  2WXH A;  2BBC A;  4M02 A;  4PYU A;  4ZRP A;  4MGK E;  2MP2 B;  2N7D A;  4NZL B;  1K53 A;  4EFO A;  1XLN A;  2PE6 B;  1T0S C;  1Z5S B;  1IYF A;  2MBQ A;  2KK8 A;  1I4Q A;  2J52 A;  4L2Y A;  2LRU A;  2W54 A;  3U52 E;  3AH7 A;  4HKQ A;  2PVO D;  1Y8R C;  3C19 A;  2IY1 B;  3KW5 B;  5G5G A;  1WRI A;  4A3P A;  3ZXV A;  4LK0 M;  2Y5P A;  2LVQ A;  3AU4 A;  3W9C B;  2DZM A;  3TJP A;  1AAR A;  1ZDX A;  1TS5 A;  2PMV A;  3GS2 A;  1RWS A;  4FJZ A;  1NEK B;  4I6P A;  2WXI A;  2W55 A;  1JWA D;  1KJT A;  3VFK A;  1V5T A;  3Q8F A;  1XO3 A;  2BB6 A;  3IXS A;  2ONQ A;  4C56 C;  2DEN B;  2L32 A;  5EE9 A;  2RR9 A;  4A8X C;  4GDK A;  1WGH A;  2PTL A;  3BYY B;  1D4B A;  1JWS D;  1GC7 A;  2IBI B;  1V8C A;  3BYT B;  4MAC A;  1ACC A;  3BVG A;  3H6N A;  4LTU A;  1QLB B;  4A3O A;  2B76 B;  4MGI E;  2WDQ B;  2HJ1 A;  2V3S A;  1Z2M A;  1I4H A;  4EUT A;  3QA8 A;  1K51 A;  5BO4 B;  4OVV A;  1SGH A;  2NTT A;  1ESF A;  1SB3 C;  3HM3 A;  3P4R B;  1YNT E;  2WXL A;  2KMA A;  2BT6 A;  1V1O A;  3OAW A;  1FEH A;  3EFU A;  4HVB A;  3GB1 A;  2JYT A;  4LJO B;  2KMC A;  1V1P B;  2OHF A;  1C4P A;  4PS8 A;  1F52 A;  2DAJ A;  1CK1 A;  3NS1 A;  5DPS A;  4GDL B;  5AZF A;  5CX3 A;  1V6E A;  4GDK B;  4TV3 A;  2WLB A;  2FUH B;  2JSV X;  5J17 A;  4BZA A;  1C9F A;  3UI3 A;  2KFK B;  5HFY A;  1T0Q C;  2CJO A;  5BMH A;  2V3P A;  2IY0 B;  2NCN A;  5TSS A;  4OHJ A;  3PZ8 A;  2GBM A;  3PV1 A;  2ZZP B;  2JYE A;  4RGO S;  4B0M A;  1FNW A;  2FCS A;  3X23 A;  5H8Y E;  5LLI A;  1E5W A;  1UEL A;  2NPT A;  2EEL A;  1TYG B;  4LNO A;  1RM6 C;  4ACF A;  2KWC A;  2LGS A;  2RDB C;  2IYD B;  3DHG C;  4EKU A;  3APD A;  4ICU A;  1P1A A;  3TEZ A;  4ZRI A;  3C8Y A;  3V60 A;  2IZV B;  3SR6 A;  2OOB B;  4P6V F;  2H89 B;  4NY0 A;  1KLU D;  1V5O A;  1FPY A;  1HTO A;  3RPF C;  3GP7 A;  4KDI C;  4W9H A;  1N62 A;  1TIF A;  1H8C A;  2IO1 B;  2RPQ A;  2HJ8 A;  3IFW B;  3ZLZ A;  3HK0 A;  2WQY B;  3SEB A;  3HM6 X;  5AZG A;  3ZUN A;  3BII D;  3O13 A;  1TKE A;  1IPG A;  2L8J A;  1VJK A;  2NPT B;  1ZDV A;  2KMM A;  3C0R B;  4ZYS A;  4URK A;  2J0M A;  3HIZ A;  4DDG D;  2W3R A;  4KV2 A;  2K9X A;  3MJ5 A;  4PT5 A;  1K50 A;  3DVG Y;  2G9H D;  2KHW B;  3VR8 B;  2N7E A;  4AJW A;  1HE8 A;  3DDC B;  3KQ4 A;  4FJV B;  1TBE A;  3SDL C;  3PSE B;  4EZJ A;  5IO9 A;  2NR2 A;  1WMH B;  3W1Y A;  3DBL I;  4A6Q A;  2JT4 B;  1QF6 A;  2KO3 A;  1FXA A;  4A20 A;  1E0Z A;  4X57 B;  2VH1 A;  3IBE A;  2GB1 A;  1MFW A;  1D6E C;  3JSV A;  1SF0 A;  1XF5 L;  3QX1 A;  2LGD A;  1WSP A;  2DNF A;  1VR9 A;  3TL5 A;  2Q5W D;  5G2N A;  3U2S C;  4HPM B;  2KXJ A;  2KT7 A;  3E9S A;  3B08 A;  3S2A A;  3RCZ A;  2KWU B;  4IWQ A;  3L0W B;  1WYG A;  1NI3 A;  1PDX A;  4N6E B;  3KUD B;  4KIK A;  1DYQ A;  2MWS B;  2JQR B;  3Q3F A;  4EE2 A;  4W9E A;  2WXF A;  3I9V 1;  1QIL A;  1N60 A;  4MDK E;  1XQQ A;  2LVP A;  2V4L A;  2HTM E;  2MX2 A;  4XC2 A;  3JSV B;  3Q8E A;  1STE A;  2KAN A;  1P0R A;  2BWF A;  3AEE B;  4GGQ A;  1TKG A;  1WGK A;  1WX8 A;  4P1C C;  1JRU A;  4MH0 E;  2KDE B;  4NJ6 A;  2MBH A;  1JCK B;  3N9Y C;  1CZP A;  4KDL B;  3IT4 B;  3W5V B;  1P3Q U;  1XEE A;  3T3N A;  5JXV A;  3ONS A;  2IPK D;  4JWU C;  2A4Z A;  4KGT A;  1LO5 D;  3LXF A;  3PS6 A;  2KWD A;  3H9D A;  2MA9 B;  2HD5 B;  4MEM A;  4W9D A;  2KTR A;  3I57 A;  1VD2 A;  2LXC A;  2JXT A;  1V80 A;  2QIL A;  2FCQ A;  3QWZ B;  2SEB D;  1EO6 A;  3A4R A;  3QCA A;  1QT9 A;  2VZK B;  4C00 A;  5J18 A;  4YTN B;  3R3M A;  3MHS D;  3PTF C;  2RGF A;  2WHI A;  5D2M B;  2INP E;  3GZN I;  3ZNG C;  1RFK A;  4IWP A;  1RLF A;  1N6Z A;  1WXV A;  1L2N A;  2O6V A;  2J0K A;  3W2D A;  3PT2 B;  3WAL A;  4JE3 B;  1TTN A;  4NAM A;  1ZE3 D;  1WFY A;  2VZK D;  5DPW A;  4GOC A;  4G0N B;  2L00 B;  2C60 A;  4FBJ B;  2BGF A;  4P7I A;  2PE9 A;  4JGH B;  3KUZ A;  2KTR B;  3HHM A;  4WJP A;  3NG0 A;  5JZE B;  2LI5 A;  2KQ7 A;  1MJD A;  3B0A A;  3ZTC A;  3PHX B;  2ZW0 A;  3CMM B;  2Y5C A;  3PVL A;  2BKF A;  2WWZ A;  3AE8 B;  1FFV A;  2K39 A;  3U7Z A;  4E71 A;  5E6N A;  1FXT B;  4IG7 B;  4KSL C;  4DBG A;  1SE3 A;  2PVG C;  2C9W B;  2MSE D;  5MPO A;  2O6V B;  3CSF A;  3QJZ A;  4MGZ E;  2LGY A;  1JAL A;  3U4E G;  4HJK A;  4BOS C;  2D5G A;  4W9L A;  1BML C;  4PK1 A;  1WRD B;  3QAQ A;  2IND C;  4IKG A;  1I35 A;  3ZO5 B;  4BVU C;  2QSD A;  4WJO A;  1WM2 A;  2TSS A;  1SIF A;  1KM7 A;  3UF8 A;  3QAR A;  2RPV A;  4FHJ A;  2NVU I;  4IW0 A;  4WQM A;  1KOT A;  4IOI E;  4CHK A;  2QHO A;  2O6V D;  2JX5 A;  3WAP A;  1J7A A;  1WGG A;  3L08 A;  1EWC A;  3VVW B;  3Q69 A;  3WA0 A;  5D3D A;  5C23 A;  4ANV A;  3RNA C;  4IM0 A;  3DBH B;  4H2A A;  3VRA B;  2MQJ A;  3AU5 A;  2AQ2 B;  2G1E A;  1NYR A;  2KDM A;  3RNG C;  2LJ5 A;  1WR6 E;  3ZDM C;  4DXA B;  1EU3 A;  1L7Y A;  3NOB A;  4ARC A;  2GBJ A;  2PIA A;  4TQ0 A;  4L1B A;  5DCN A;  2JXX A;  1XT9 B;  2SAK A;  3B2G A;  3MP9 A;  3OWE B;  3L13 A;  1LQB A;  3J9C A;  3QHT A;  4Q2J A;  3DBH I;  2IGD A;  1EWY C;  3ZJT A;  1OQY A;  3CF6 E;  4JQW C;  4B0E A;  4CO7 A;  4ANX A;  3TUO A;  3VQI A;  4LNK A;  1FRR A;  2BKR B;  3GE3 C;  4BBN C;  1TZO A;  1YOV B;  4K3B A;  3MFG A;  2IO2 B;  2K25 A;  1E6E B;  4AP4 C;  1A70 A;  4AS1 A;  1PQS A;  3ZQ4 A;  1UZX B;  5E6O A;  2INN E;  1WY8 A;  2WP9 B;  4TUU A;  2EKI A;  1V81 A;  2N9P C;  4XWT A;  3ZDT A;  1NVI D;  1L6V A;  4MSQ B;  3UIO B;  2AWT A;  1WXA A;  4WUR A;  2M19 A;  2GBK A;  3ML9 A;  2KN4 A;  4RNA A;  2WXO A;  2L7R A;  3ZNI D;  1Q10 A;  1F2R I;  2K1F A;  4FJY A;  4FN2 A;  3AE1 B;  3AEC B;  3LYY A;  1NYQ A;  3Q3M C;  1B1Z A;  4LNI A;  3I5J C;  3PLV A;  1FXI A;  2C7N B;  1GUA B;  1EF1 A;  1YN4 A;  4RM9 A;  5IA7 A;  1P7F A;  2MCN B;  1E8X A;  4WJQ A;  2BYF A;  2X38 A;  1I4X A;  4XX5 A;  3AN1 A;  1ZOY B;  3VUY A;  1V1P A;  5BYQ A;  1ZUD 2;  1C78 A;  4WQO B;  4K81 A;  4GDL A;  1T0R C;  3EEC A;  1QOF A;  2VRR B;  2WU5 B;  5C2T B;  2DWQ A;  3BVM A;  4DHZ B;  2KC2 A;  5HHD G;  1YJJ A;  2KYW A;  4P1B C;  2KFK A;  1D5X C;  5GMV A;  3NVW A;  1EF5 A;  1TZ1 A;  3M62 B;  5EE0 A;  3RUL A;  4B95 A;  5EE1 A;  1JML A;  2XK5 A;  3DVN U;  2PKO A;  3FIL A;  5D6J B;  3FKY A;  3BK1 A;  1UGM A;  4GIV A;  2FCM A;  2D3C A;  4HXD A;  4EOY A;  2Z0D B;  4EZK A;  2MRP A;  3TSS A;  2EKE C;  3P4S B;  2YEP F;  1IP9 A;  2XNA C;  2JZ3 B;  4W9J A;  3R7R A;  2DX5 B;  1FD6 A;  5LXI B;  2LAS A;  3PRP B;  1R4M I;  2V9H A;  2D11 A;  4PS7 A;  2C7M B;  4USA A;  3W1S C;  4XWW A;  2KJ6 A;  2RSU A;  2HTH A;  1XLO A;  1YIW A;  2KVR A;  3Q3N C;  2FAZ A;  2BPS A;  2C5L C;  2MJ3 A;  2G4D B;  1PGX A;  3TCA A;  3U30 A;  2E3T A;  2GLS A;  5FKA C;  1E8W A;  4RGN A;  4IC7 B;  4HCN B;  2XK5 B;  2OJR A;  1WR1 A;  2K5P A;  3AEB B;  4M8N A;  1VZ7 A;  4NJC A;  5L95 C;  3FIL B;  3HVZ A;  1WJ6 A;  2OJW A;  3ZJU A;  2LWP A;  1OTR B;  1UBI A;  1ZKH A;  4NAW B;  2WXJ A;  2ZW1 A;  4XE0 A;  2FCN A;  1NBF C;  3T8M A;  4AWJ A;  3MC0 B;  1E9M A;  3UGB B;  2IGH A;  1QOA A;  3A4S C;  4J6I A;  2M0X A;  4KGS A;  3PO0 A;  4WWN A;  3VTW A;  3R2T A;  1YX5 B;  2INC C;  1WH3 A;  1ZPS A;  1FO4 A;  4W9K A;  4WWM A;  1WWT A;  2CHX A;  3EA6 A;  3NRZ A;  1WMH A;  1IBX A;  2I2Y A;  3BK2 A;  1TS2 A;  4MT5 A;  4KGR A;  2IJ0 A;  3N20 C;  1MG8 A;  2Y5B B;  2JF5 A;  3NZ3 A;  1UH6 A;  3R7Q A;  2KNB A;  2GBR A;  1R4N I;  3DBL B;  1CQV A;  2NMQ A;  1I4R A;  3ZJV A;  2W3S A;  3DWG C;  3EGR A;  3DHI C;  3I63 C;  3Q8B A;  1SE9 A;  1QZE A;  3V61 A;  1LM8 B;  3PRE A;  4HLE A;  1D3Z A;  3GE8 C;  4OVZ A;  4GU2 A;  1C79 A;  4JL9 A;  4K7W A;  1Q5W B;  2QCZ A;  3FAH A;  5IP4 D;  4AJY B;  1DGJ A;  1HTQ A;  1YQ4 B;  4MJS A;  4L23 A;  1ZP0 B;  3H7P B;  1HQR D;  1IBX B;  5CHV C;  5IAA C;  5KHO A;  4K3C A;  3P42 A;  1K52 A;  3SD5 A;  2N1W A;  2ZNV C;  4RMA A;  3ML8 A;  1F77 A;  1WGD A;  3DPD A;  1MHX A;  2EMT A;  2KZR A;  4XDC A;  2LHD A;  3MC9 A;  2CHW A;  4HRS A;  3W1S A;  4II2 B;  1DOI A;  1A5R A;  2D3A A;  4BKT A;  2LFI A;  4YSX B;  1KRH A;  2LRW A;  5BMI A;  3L54 A;  2W82 A;  3T9L A;  2L52 A;  2V0G A;  1WX7 A;  3Q8A A;  2GRI A;  1XXG A;  1E7V A;  5D3I B;  3X0W A;  1GJZ A;  2LXA A;  1LGR A;  1S1Q B;  4MJS B;  1J7B A;  3AEF B;  1YQ3 B;  1RAX A;  2MJE A;  3V6C B;  2GI9 A;  3K9P B;  2ZCB A;  4OZC A;  5HG2 A;  3PRM B;  4XYC A;  1D5M C;  2DZJ A;  3ABV B;  2QIE B;  5CTR C;  2N9E B;  3UIN B;  2NTS A;  2WDR B;  4GB9 A;  4I6N B;  4YTM B;  3AE4 B;  2ZPN A;  3WAM A;  4FLH A;  4ARI A;  2NBU A;  1UD7 A;  2AEH A;  4I6L B;  4WH4 A;  3VH3 B;  1F2R C;  4ANU A;  1SBB B;  5LXH A;  3VH4 B;  5DPT A;  2BF8 B;  4ASW C;  4K7S A;  1WXS A;  1YMH E;  3ZKJ C;  2DYM A;  3AEG B;  3EC8 A;  3V6E B;  1TKY A;  4C4V B;  1ZW7 A;  3GZN B;  2L05 A;  1Q1O A;  2BWE S;  5BYR A;  2G3Q B;  1XLQ A;  2K22 A;  2JU6 X;  2LUM A;  4IUM B;  4HPP A;  3AE2 B;  3LDZ E;  4BOZ B;  3UQB A;  2KX3 A;  3A33 B;  4HPL B;  4RGM A;  1UWX A;  2N0S B;  2BS3 B;  2BVC A;  2K8B A;  3ZGZ A;  2CHZ A;  2LEK A;  3DQV A;  3IVF A;  1HA5 A;  4RFB A;  2C7H A;  5C1Z A;  1FM0 D;  3TBL D;  2MBB B;  3UIP B;  2JRH A;  1WGY A;  4DXF A;  2PJH A;  1UGJ A;  5EDS A;  1HEZ E;  3JVZ X;  3IHP C;  3EFC A;  4M8M A;  3DVG X;  4B9K A;  1P9D U;  4F8C B;  2R2O A;  4GXB A;  2WXG A;  1RYJ A;  4IDI A;  4LDT B;  1WF9 A;  1DOY A;  3VXW A;  4JPS A;  2WX1 A;  1QOG A;  3PRZ A;  2L83 A;  1C1Y B;  3D32 A;  1IGD A;  5HKH A;  2YEP B;  1WX9 A;  2WXM A;  2BYE A;  3A9K A;  3B2F A;  1WI0 A;  3Q14 C;  1E7U A;  2K8C A;  4AQ7 A;  4NNJ B;  2DYB A;  5H92 C;  1WJU A;  1AWD A;  1FNU A;  2KJR A;  4HKZ E;  2JWZ A;  3URY A;  2MLB A;  1EU4 A;  1NEN B;  5LNK 1;  4LDT D;  4BFR A;  1LFD A;  1JWB D;  1WZ3 A;  2Z0E B;  2BYT A;  3H7S A;  3WIM A;  4A90 A;  3RFZ B;  2J42 A;  3MC8 A;  1GNU A;  2E6X A;  3VTU A;  2W9N A;  4DDI D;  3ZRC A;  2K6Q A;  2KLC A;  2M56 B;  3JW0 X;  3AB5 A;  4M00 A;  2D10 A;  3M3J A;  2L1A A;  3VTV A;  2G45 B;  2JUO A;  2LUE A;  5FR6 A;  5KHQ A;  2HDE A;  3KH0 A;  1GG3 A;  3N1Y C;  4KVG B;  2MBE A;  1KFY B;  2LJI A;  4LLG M;  1V86 A;  2ZNV B;  2QMT A;  3A9K B;  1IGC A;  1WJ4 A;  3TIX A;  1P98 A;  3EHV A;  2AL6 A;  3P2B A;  3PPA A;  4ANW A;  4ZHP A;  4N9F 4;  3VDZ A;  2MBO A;  3NY5 A;  1VCB A;  4HCP B;  3RNF C;  2YVC A;  3MJW A;  5DPR A;  4DQO C;  2JZP A;  1J7C A;  3OG5 A;  4FXC A;  2KDI A;  5BMG A;  3LB8 C;  3AED B;  2ZJD A;  3I3T B;  1PYW D;  1I4P A;  1L5P A;  5EE3 A;  3APC A;  3PGE A;  3KUC B;  3LJ3 A;  1X1M A;  3IAS 1;  1Y56 A;  2BW2 A;  2UYZ B;  3SFE B;  4G3X B;  3R66 C;  4CYE A;  2HE7 A;  1GB1 A;  2WNM A;  1TJE A;  3ENE A;  1FMA D;  4CQN A;  3L10 B;  3QK0 A;  1ET6 A;  1MG4 A;  1WYW B;  4US8 A;  1K8R B;  2YLM A;  3Q2A C;  2CR5 A;  1UF0 A;  2KFJ A;  2B3A A;  4GSW A;  2H88 B;  1FNV A;  3SFD B;  4WJN A;  3E56 A;  4BAX A;  3AI5 A;  4WIP A;  1U4A A;  4KZ0 A;  3VUW A;  3PLU A;  2AL3 A;  4TQ1 A;  4NQL B;  2WGS A;  3ZRF A;  1FIQ A;  2DBY A;  1WIA A;  3M63 B;  3HUI A;  4ZRQ A;  2ASQ A;  4YWG G;  1ZXH A;  4YT0 B;  1MHH E;  2WDT B;  1MI0 A;  5FR3 A;  2FE8 A;  2CU1 A;  2WXN A;  1PUT A;  4ZHO A;  3CST A;  4NQK E;  2WXR A;  1VZ8 A;  3AE5 B;  1J0G A;  2FIF A;  4HRO A;  3BZD B;  4G50 A;  3ZNZ B;  2MH7 A;  1T3Q A;  1UUP A;  4GN1 A;  2A5U A;  4TKN A;  3BY4 B;  4LCD E;  3NHE B;  2MEK A;  1G6J A;  1N5X A;  3DHH C;  3WAN A;  3BWU D;  1JRO A;  3M95 A;  2M4N A;  2IO0 B;  4ICV A;  2D3B A;  4HK2 A;  3L4P A;  4REZ A;  1IUE A;  2LVO A;  1V49 A;  4WAF A;  2DYO A;  2FBW B;  2JWU A;  2BTE A;  3Q3O C;  4E74 A;  2JRI B;  4JLC A;  4EEW A;  3U8Z A;  4LNF A;  2LGX A;  4PS3 A;  1UNS A;  1R4M B;  1KLV A;  2DAF A;  1ET9 A;  5BYS A;  1P7E A;  5GXG B;  1SJH D;  3L16 A;  3NS8 A;  4F1S A;  2I38 A;  3NVZ A;  3TEW A;  2WYQ A;  1C77 A;  1UBQ A;  4NJ7 A;  4HDQ A;  4M0W A;  2VH2 A;  1HZ6 A;  2KWV B;  2QEJ C;  1GPX A;  1OQQ A; 
#chains in the Genus database with same CATH homology
 2ICI A;  1I4G A;  3MHZ A;  2V4I B;  1C79 A;  2SEB D;  3NVV A;  1QT9 A;  2VZK B;  3FAH A;  1JRP A;  4RH6 A;  1DGJ A;  2RMM A;  1YQ4 B;  4YTN B;  1VLB A;  4L23 A;  1R7S A;  1ZP0 B;  3TEX A;  3VR9 B;  1HQR D;  1IBX B;  5AUI A;  2Y3A A;  2J53 A;  2XN9 C;  2INP E;  1YN5 A;  1RFK A;  3P42 A;  1K52 A;  1TY2 A;  4DXG A;  3W2D A;  2K3U A;  1F77 A;  2WXQ A;  1MHX A;  4JE3 B;  4JWS C;  3FC4 A;  2RDG A;  4XDC A;  2LHD A;  4HRS A;  4NAM A;  1ZE3 D;  3W1S A;  2VZK D;  3ETR A;  5FK9 C;  1DOI A;  1E7P B;  4OZB A;  2DLB A;  4ITK A;  4RGT A;  2LFI A;  4HEA 1;  4YSX B;  4TMA B;  3T3O A;  1KRH A;  1QKZ A;  5BMI A;  4O1N A;  3R2I A;  2W82 A;  2M0A A;  4R3D A;  2L52 A;  1E10 A;  2ZW0 A;  2V0G A;  2OED A;  2WXH A;  1L0X B;  2BBC A;  2Y5C A;  3Q8A A;  2GRI A;  3IAM 1;  1XXG A;  2N7J A;  4UDU C;  3AE9 B;  4ZRP A;  3AE8 B;  4YSY B;  5D3I B;  4NZL B;  1K53 A;  1XLN A;  4YSZ B;  1QQR A;  1I4Q A;  2J52 A;  1FFV A;  3U7Z A;  4L2Y A;  1J7B A;  3AEF B;  2W54 A;  1N61 A;  4A55 A;  1YQ3 B;  1GB4 A;  1MPE A;  2MJE A;  3U52 E;  4MH8 A;  2LGI A;  3AH7 A;  1SE3 A;  2PVG C;  3CWI A;  4JX1 C;  1TS4 A;  2RDH A;  2GI9 A;  2PVO D;  4HKQ A;  5MPO A;  4OZC A;  2LHE A;  5HG2 A;  1JAL A;  5G5G A;  1D5M C;  1BXT A;  1WRI A;  4OZA A;  3U4E G;  4LK0 M;  2Y5P A;  2D5G A;  3ABV B;  1BML C;  2QIE B;  3W9C B;  2NTS A;  4A9A A;  2WDR B;  1PFD A;  4IKG A;  2QSD A;  2TSS A;  4YTM B;  1ZDX A;  1TS5 A;  2PMV A;  3AE4 B;  2WXK A;  1M4V A;  4ARI A;  3GS2 A;  4WH4 A;  2RPV A;  1RWS A;  1F2R C;  1XCQ L;  4WQM A;  1DOX A;  1NEK B;  1SBB B;  2PW9 A;  2WXI A;  4IOI E;  2W55 A;  1JWA D;  2JX5 A;  1J7A A;  3Q8F A;  1YMH E;  1XO3 A;  1PGA A;  2BB6 A;  3IXS A;  2ONQ A;  1EWC A;  4C56 C;  4OW0 A;  3Q69 A;  2DYM A;  2L32 A;  3AEG B;  1TKY A;  5D3D A;  5EE9 A;  2CU3 A;  4A8X C;  2PTL A;  1D4B A;  3BYY B;  4H2A A;  3VRA B;  1JWS D;  3TEY A;  2AQ2 B;  2G1E A;  1NYR A;  2KDM A;  5BYR A;  1GAQ B;  1V8C A;  3BYT B;  4MAC A;  1XLQ A;  2K22 A;  1ACC A;  3BVG A;  2JU6 X;  2LUM A;  1EU3 A;  3AE2 B;  4ARC A;  3KLS X;  2PIA A;  1SE2 A;  4TQ0 A;  4LTU A;  2CJN A;  4L1B A;  1QLB B;  1BUI C;  1T5X D;  4RGM A;  1UWX A;  2N0S B;  2BS3 B;  2B76 B;  1HZ5 A;  2BS2 B;  2SAK A;  3ZGZ A;  3B2G A;  3MP9 A;  2WDQ B;  2LEK A;  2LMC A;  5D7G A;  3OWE B;  1HA5 A;  4RFB A;  1I4H A;  1FM0 D;  1XCT L;  1I7H A;  1K51 A;  4MM3 B;  3J9C A;  3DWM A;  2NTT A;  4DXF A;  1ESF A;  4Q2J A;  1B9R A;  1UGJ A;  1CJE A;  1SB3 C;  2AQ1 B;  3P4R B;  1YNT E;  2IGD A;  1EWY C;  3ZJT A;  2WXL A;  1SXT A;  1HEZ E;  2BT6 A;  1V1O A;  4B0E A;  1FEH A;  1ZXI A;  3GB1 A;  2JYT A;  1V1P B;  2KAJ A;  2OHF A;  4RF1 A;  2WU2 B;  1C4P A;  3TUO A;  4N6E B;  5I4D A;  3VQI A;  3NS1 A;  1CK1 A;  1FRR A;  2WXG A;  1RYJ A;  4GDL B;  4IDI A;  1DOY A;  1YJI A;  1TZO A;  4GDK B;  4JPS A;  1SSN A;  3H8H A;  3P1M A;  1QOG A;  2WLB A;  2L83 A;  3MFG A;  1L4Z B;  1IGD A;  2JSV X;  2YEP B;  1GOZ A;  1C9F A;  1E6E B;  2WXM A;  3B2F A;  3UI3 A;  1AW7 A;  1A70 A;  4AQ7 A;  4AS1 A;  3VRB B;  5HFY A;  3ZQ4 A;  5H92 C;  1AWD A;  1FNU A;  2BS4 B;  3B9J A;  4US9 A;  4HKZ E;  1FCL A;  2INN E;  2CJO A;  5AUK A;  2V3P A;  5BMH A;  4RCO A;  2WP9 B;  3URY A;  5TSS A;  1EU4 A;  4OHJ A;  1NEN B;  2EKI A;  3PZ8 A;  5LNK 1;  4XWT A;  1YN3 A;  3W5U B;  1NVI D;  1JWB D;  2K0P A;  1L6V A;  2KAC A;  1XLP A;  2BYT A;  4YTP B;  4WUR A;  2JYE A;  4RGO S;  2M19 A;  4B0M A;  4A90 A;  3RFZ B;  2AQ3 B;  1QOB A;  4RNA A;  2KN4 A;  2J42 A;  1D5Z C;  1UWM A;  1FNW A;  2WXO A;  5H8Y E;  2E6X A;  1Q10 A;  1F2R I;  3AE7 B;  1F0Z A;  2EEL A;  2M56 B;  1TYG B;  3AM9 A;  3AE1 B;  3AEC B;  4ZOH C;  3AB5 A;  1ENF A;  3LYY A;  1RM6 C;  1NYQ A;  3EUB 2;  5E6J A;  1B1Z A;  1N63 A;  2L1A A;  2FUG 1;  1PGB A;  2HDE A;  1FXI A;  1YN4 A;  2IDY A;  1KFY B;  2LJI A;  3TEZ A;  1P7F A;  2QJL A;  4LLG M;  3C8Y A;  2QMT A;  4YXD B;  1IGC A;  2X38 A;  3SR6 A;  1I4X A;  1SE4 A;  3AN1 A;  4C80 A;  1ZOY B;  1V1P A;  4P6V F;  2N9K A;  2H89 B;  5BYQ A;  1ZUD 2;  1C78 A;  1KLU D;  3NUH B;  3AMZ A;  1C4C A;  4ZHP A;  3RPF C;  1QOF A;  4GLS C;  1HXY D;  2WU5 B;  1WXQ A;  3GP7 A;  5C2T B;  2DWQ A;  3BVM A;  1L0Y B;  1N62 A;  4DQO C;  5HHD G;  1YJJ A;  2PLP A;  2JZP A;  2WQY B;  3SEB A;  1J7C A;  4FXC A;  1D5X C;  3R8B A;  3NVW A;  5BMG A;  3BII D;  3O13 A;  3V05 A;  3LB8 C;  1TKE A;  3AED B;  1AN8 A;  2ON8 A;  1VJK A;  5EE0 A;  1PYW D;  1I4P A;  1L5P A;  1ZDV A;  4KKJ A;  5EE3 A;  3V3X A;  2KMM A;  5EE1 A;  1JML A;  4ZYS A;  2WDV B;  3IT6 B;  3WCQ A;  2MJD A;  1JW9 D;  2AX5 A;  1C4A A;  3KWL A;  2PKO A;  2W3R A;  3FIL A;  3ZYY X;  2WS3 B;  3IAS 1;  3BK1 A;  2K9X A;  5HI1 A;  1Y56 A;  3MJ5 A;  2BW2 A;  4PT5 A;  1K50 A;  3SFE B;  1T6B X;  1GB1 A;  2WNM A;  1TJE A;  1SJE D;  1FMA D;  2G9H D;  4CQN A;  3VR8 B;  4N59 A;  3TSS A;  3P4S B;  2YEP F;  1ET6 A;  4RF0 A;  2XNA C;  3KQ4 A;  3BVZ A;  4US8 A;  1FD6 A;  1MVK A;  3AE3 B;  2N9L A;  4A6Q A;  1QF6 A;  1JWM D;  4USA A;  4XWW A;  2H88 B;  1FNV A;  3SFD B;  1FXA A;  3E56 A;  1C76 A;  4TSS A;  1XLO A;  1E0Z A;  4WIP A;  2WXP A;  2MJ3 A;  1VZ6 A;  1FFU A;  4TQ1 A;  2GB1 A;  1PGX A;  1FIQ A;  2E3T A;  2DBY A;  1D6E C;  1SF0 A;  1XF5 L;  1N5W A;  1TY0 A;  3NVY A;  5FKA C;  3HUI A;  4RGN A;  4ZRQ A;  1WSP A;  4YWG G;  1VR9 A;  2IGG A;  1ZXH A;  4YT0 B;  3P4Q B;  2Q5W D;  1OFF A;  1MHH E;  4NJC A;  2K5P A;  3AEB B;  3U2S C;  1VZ7 A;  1MI0 A;  3FIL B;  2BB5 A;  3E9S A;  3HVZ A;  5FR3 A;  2FE8 A;  3ZJU A;  2WXN A;  1PUT A;  4ZHO A;  1WYG A;  4N58 A;  2WXR A;  3HRD D;  1KTK A;  1NI3 A;  1PDX A;  1VZ8 A;  1AYF A;  3AE5 B;  3AEA B;  3PZ7 A;  2WXJ A;  2ZW1 A;  1EM7 A;  4KX6 B;  4NAW B;  4XE0 A;  1DYQ A;  4HRO A;  4P16 A;  3MC0 B;  1VDV A;  3BZD B;  2MH7 A;  1E9M A;  1T3Q A;  1UUP A;  2IGH A;  1QOA A;  2JQR B;  4EE2 A;  4KGS A;  1VRA B;  3PO0 A;  2WXF A;  4C7Y A;  1L0V B;  1QIL A;  3I9V 1;  3R2T A;  2MEK A;  3P63 A;  1N60 A;  4C7Z A;  4KKI A;  1N5X A;  1KF6 B;  2V3N A;  1ZPS A;  1V97 A;  1FO4 A;  4WWM A;  1KLG D;  1SIJ A;  1WWT A;  2HTM E;  3BWU D;  3Q8E A;  3EA6 A;  1JRO A;  1STE A;  5C3J B;  3AEE B;  3NRZ A;  3CIR B;  1TKG A;  1WGK A;  3Q8C A;  1L6U A;  1L4D B;  1IBX A;  2J4X A;  3L4P A;  4REZ A;  1IUE A;  5G5H A;  3P4P B;  1KH0 A;  3HVD A;  1JCK B;  2I2Y A;  3BK2 A;  1TS2 A;  4MT5 A;  4KGR A;  3N9Y C;  2IJ0 A;  2DYO A;  4WAF A;  1OQR A;  2FBW B;  2JWU A;  2BTE A;  1CZP A;  3IT4 B;  3W5V B;  2R61 A;  1XEE A;  3NZ3 A;  1UNS A;  3T3N A;  5JXV A;  3AV8 A;  2IPK D;  4JWU C;  1CQV A;  2NMQ A;  1ET9 A;  1I4R A;  3KWV A;  4KGT A;  5BYS A;  3ZJV A;  2W3S A;  1LO5 D;  1P7E A;  3AE6 B;  3LXF A;  1SJH D;  5GXG B;  2KWD A;  3DWG C;  1FCC C;  4D2K A;  3EGR A;  1TS3 A;  4J3O D;  3Q8B A;  2I38 A;  3NVZ A;  3TEW A;  1SEB D;  1C77 A;  1FRD A;  1JWU D;  2KQ4 X;  2Z8L A;  4M0W A;  4XDD A;  2ACZ B;  3I57 A;  4HJG E;  1HZ6 A;  2JXT A;  2QIL A;  5T8I A;  1JQ4 A;  2QEJ C;  4OVZ A;  1ROE A;  1GPX A;  1OQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...