3EGRA

Crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
QKEWPLWEVFVRSKQGLEHKHCGSLHATDAQQALHMARDVYTRRQEGVSIWVVPSTAITASAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phenylacetate-CoA oxygenase subunit PaaB
publication title Crystal structure of phenylacetate-CoA oxygenase subunit PaaB (YP_297411.1) from RALSTONIA EUTROPHA JMP134 at 2.65 A resolution
rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
total genus 12
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06243 PaaB Phenylacetic acid degradation B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.520 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3egrA00
3EGRA
chains in the Genus database with same CATH superfamily
2WDVB 4C7ZA 1Q5WB 1UBIA 2PMVA 3LDZE 3RMKC 1WGGA 1PYWD 3DWMA 1HE8A 2LI5A 2IYDB 1XLOA 2KKCA 3DWGC 1PUTA 4BOSC 4N59A 1V80A 4A55A 1E7UA 3PREA 1SGHA 2V9HA 4JPSA 1L4DB 3RUIB 2BPSA 3KVFB 3T9LA 4HCPB 3Q3OC 3RZWC 3AEDB 2KMAA 1XLNA 3NZUA 3BIID 1WI0A 4FHKA 3NRZA 2WWZA 2JZ3B 4A6QA 3L17A 4CQNA 3IG3A 4C00A 3ZRCA 2L05A 4HVBA 2KT7A 2LGSA 2CS4A 4WWOA 3BY4B 2C7HA 2FCQA 2IY0B 4LDTD 2MBQA 2LGYA 3P4PB 2ZW1A 2JRHA 3FILA 2DHZA 3ONSA 1Q0WB 1RYJA 4FN2A 2NTTA 4W9CA 1TYGB 3MC8A 3Q3MC 3PVLA 1SJED 2WX1A 2ZVNA 1RFKA 4PS3A 1XXGA 2BQQA 2LMCA 1D3ZA 3TEXA 1C4PA 1E7PB 3RN9C 2XK5A 4B95A 2SEBD 3GP7A 2IO0B 1ESFA 5BYRA 3MHZA 4ZHPA 2CJNA 3CF6E 2CU3A 2J0JA 1ROEA 2V1YA 1M94A 5L95C 3ZUNA 2K9XA 2FUHB 4JGHB 3EHVA 3SEBA 1N61A 1JW9D 2YVCA 2ZNVB 5EE0A 3EECA 3VRBB 2V3NA 2HDEA 2NS5A 1WYGA 2K8BA 1UH6A 4LJPB 2L0TA 5KHQA 4HK2A 2M8SA 4W9DA 3ZJTA 4WJOA 1UUPA 3S2AA 2KQ4X 3H1UA 3JW0X 1RLFA 3ML8A 4FLHA 5CHFA 1DYQA 3B2FA 1T0SC 3RNFC 4AOFA 1I7HA 1UELA 2LHDA 4AJWA 2GOWA 1WF9A 5LNK1 4BBNF 1XEEA 1D5MC 4OZAA 5C2TB 4D2KA 3AE9B 4G11A 3ZQ4A 1UGMA 2M4NA 1P3QU 2N7JA 2ZZPB 4DDID 4HROA 1N63A 3PRMB 1TS5A 4BBNC 2PVOD 3ZLZA 3D32A 2O6VD 3ZRFA 4MT5A 3AM9A 3W1SC 5E6PA 3P63A 1WXSA 4LNOA 1WXMA 1CZPA 4GGQA 2GB1A 5D6JB 2DENB 1IPGA 1E9MA 3AMZA 3L4PA 4OHJA 3U7ZA 1UZXB 3FKYA 2D3CA 1WGKA 2MQJA 3ECIA 1QOFA 1E8ZA 2OJWA 4WQMA 2ACZB 1KLVA 2QSDA 4IOIE 2BGFA 2JU6X 3ALBA 4MH8A 3R7RA 4WJQA 3VTUA 3U52E 3KUCB 2L00B 2YEPB 2KWVB 1YQ4B 2RMMA 1QOAA 2D07B 3NOBA 2JF5A 2IO2B 2WDRB 1QILA 3VR9B 2N1WA 1TS3A 4KKIA 5IN7A 2J52A 5IOIA 1JCKB 2V3PA 3RT3B 1Y56A 1WMHA 4A9AA 4DK5A 5TR5A 4NZLB 2G9HD 3QCAA 1XO3A 1PGXA 1VCBA 1ZKHA 3IAM1 3P42A 2J42A 2ZPNA 3H9DA 2DLBA 1WGHA 3KUZA 4W9EA 2OJRA 5BMIA 3IT4B 3X23A 3Q3FA 3W1YA 1I4QA 1V49A 3QARA 4HRSA 3C19A 4GB9A 3T3NA 4TMAB 3KWLA 4J3OD 1PFDA 3ZYYX 2ZJDA 1QF6A 4IUMB 3NZ3A 5I4DA 2AL6A 5G5GA 3NVWA 4RGOS 3JYUA 1WJ6A 2IO1B 1ZDVA 5T8IA 3DBLB 1FRRA 4AUQC 1VJKA 2KQSA 3Q8CA 3Q2AC 2L0FA 2OHFA 4WWPA 4HWIB 3L16A 1A5RA 5J2RA 2DZJA 1VDVA 4EZKA 1YQ3B 1YQBA 2WXOA 2LFIA 1L6UA 1YN3A 3GE8C 1C4AA 4JWUC 2GBKA 4GMVA 4OW0A 1XCTL 3ABVB 2LEKA 2O6VA 2BYTA 3I63C 3AEGB 2WYQA 2AWTA 1MJDA 3GZNB 2G4SA 1LO5D 1R4MB 2OOBB 1WYWB 1AW7A 1ZUD2 2L3ZA 3V05A 3IVFA 2WNMA 1F2RI 5AUKA 2BKRB 3H7PA 5DPTA 2K6QA 4W9JA 1FXTB 1OGWA 1YJ1A 4ZDVA 3ETRA 3UI3A 2INPE 2KX3A 3AEAB 3BVZA 3L54A 2I1JA 1WMHB 3PZDA 2GBMA 5AZFA 3IXSA 3MJ5A 4LK0M 1E8WA 3A9KA 4FBJB 4EZJA 2Z59B 2SAKA 2HJ1A 4ARCA 2KTRA 2WXKA 4K7UA 4FXCA 2MH7A 4H2AA 5DPRA 1WXVA 1ZE3D 1JALA 1GPXA 2FIDA 4MSQB 3I5JC 1IUEA 4B6WA 3Q69A 1V81A 2KO3A 2IY1B 2W55A 4K7SA 3AEBB 2LZ6A 3ZNZB 2NPTA 1SE9A 1U4AA 2MBBB 3PO0A 4LNIA 3H6NA 1AARA 2IBIB 3WAMA 1F2RC 1HTOA 1V1OA 2M56B 2KK8A 4PK1A 2BF8B 4BKSD 4FHJA 3L10B 2HTME 1V97A 1AYFA 3Q8BA 4XYCA 1L0VB 3BYTB 2PE9A 3ZO5B 3AU5A 3MFGA 4UDUC 1ZPSA 1V86A 2WXJA 3EFCA 4NY0A 4W9KA 3U2SC 1KM7A 2O6VB 5CTRC 3V60A 4XC2A 2KD0A 3DQVA 2MEKA 1R4NI 4PT5A 3AN1A 4C7YA 2GLSA 3EC8A 4JL9A 2KTFA 4RF1A 2PIAA 4EZLA 2KDBA 4MM3A 1YNTE 2O2VA 2AQ2B 2WXHA 4IDIA 4M0WA 2ZNVC 3PGEA 2WU5B 3AI5A 2MJDA 3HHMA 2V0GA 3AU4A 1F77A 3SD5A 1EUVB 4WAAA 1QQRA 1CK1A 1L0YB 5JXVA 2WXQA 1QOBA 4CYEA 4E74A 1ET9A 1QKZA 5JH5C 2KTRB 2AQ1B 3FC4A 4ZYSA 5JHAA 3ZTCA 1FO4A 2LRUA 3TEYA 1RFAA 3TCAA 3M3JA 2MP2A 2VH1A 2GI9A 1MI0A 1WX9A 4IW0A 4ZRQA 2FCMA 2JWZA 3DBRI 1P9DU 2MHJA 1EWCA 1MG4A 5IO9A 5IAAC 3Q8EA 1OEYJ 3P1MA 1YOVB 2HTHA 5FR6A 2NPTB 3ZDMC 4S17A 1FD6A 1N62A 1WX8A 4HJKA 3HIZA 4OVVA 1AWDA 1C77A 3N1ZC 4N58A 2M19A 1UBQA 1WXQA 2GRIA 1FNVA 2K6DB 1F0ZA 1XF5L 1SIFA 5D3IB 2CHZA 4FULA 3ZGZA 2LXCA 3L0WB 1XT9B 1HZ5A 4OZCA 4PS8A 1NEKB 2WQYB 5FK9C 3VH3B 1KTKA 3AULA 5BYQA 3ZNGC 4DDGD 4HLEA 4HJGE 3ZKJC 2BS2B 1K8RB 3DBLI 1DOYA 4LNFA 1YX6B 2N1VA 4B9KA 4TKNA 4N6EB 1GAQB 3R8BA 1MG8A 3U8ZA 1D6EC 4G50A 2O2VB 3K9PB 3U7DA 4M0WB 2LASA 4I6NB 3SFDB 2BWES 4YTNB 3BVMA 3VTWA 1JWBD 2L76A 4MGZE 4FA6A 2LRWA 2INNE 3W5VB 2JVCA 1UWXA 4NJ7A 5CX3A 3WCQA 2KLGA 3QX1A 2JQRB 1YJIA 4GSWA 3ZTDA 2LVOA 4MGYE 1FXIA 5CHVC 1EM7A 3QJZA 4X57B 2DZKA 4K3CA 4LNNA 2MP2B 3ZXRA 2N9EB 2R2OA 3VFKA 4WWMA 2IGGA 4KKJA 1Q1OA 2W3RA 2BT6A 2KMMA 4ZHOA 4W9IA 3NS1A 2INDC 3L13A 5EDSA 4P1CC 1S3SG 3RYTA 2RDGA 1WWTA 2B76B 2LXAA 2K8HA 4I6PA 1MVKA 5H92C 1DOXA 1TZ1A 1L6VA 3PV1A 3TBLD 3BVGA 3MC9A 3VVWB 3QWZB 1X1MA 4GOCA 4DHZB 1MPEA 1P7FA 4A8XC 1SE4A 2IGHA 3N3KB 3GOEA 4F7ZA 3NVVA 3RULA 4EFOA 3CSTA 1JWAD 4XE0A 1E7VA 4IM2A 4DBGA 2D3GA 4KDLB 2D3AA 2KWDA 2L1AA 1JRPA 3ZJVA 4HXDA 2PJHA 3RNCC 1KJTA 3VH4B 1L7YA 2PE6B 2W9NA 2JRIB 4M8MA 2EKIA 4RF0A 4NPNA 3BZDB 1FCCC 3V61A 3TL5A 1QT9A 2H89B 5C23A 2KLCA 1Z2MA 4AS1A 2CKHB 4K7WA 2DWQA 2FUG1 1JQ4A 1GC6A 3PHWB 2D2QA 1VR9A 3MP9A 2DYOA 1OQQA 3AE2B 1V5OA 3Q3JA 3TEWA 2LVQA 1I4PA 3VR8B 2RPVA 3UQAA 2LGXA 4B0MA 5L83A 3ZXVA 3ZW3A 1M4VA 1ENFA 4GU2A 2MJ3A 3FILB 2NTSA 1TKEA 3Q6BA 3UIOB 2PKOA 2WDQB 2I1KA 2REXA 1J0GA 1GOZA 1ZXHA 2KN5A 1EF1A 3LYYA 1E5WA 2KDFB 3KQ4A 4E71A 2Y5BB 4GLSC 4Q2JA 2CHWA 1TY2A 4AQ7A 2J0MA 4HEA1 4N9F4 1VLBA 3KYCD 3B0AA 2XK5B 2KFKA 1N60A 3RPFC 1E6EB 1E8XA 4DXGA 3OG5A 1TKYA 2BB5A 1K52A 3KW5B 2N9PC 1UD7A 1HZ6A 1WJ4A 2D10A 2INCC 3EGRA 1OEYA 3BK1A 2WXMA 3KWVA 1G6JA 3EUB2 2NBVB 4P16A 1FEHA 3DOWA 2M1MA 5J18A 2LJIA 4MEMA 1FRDA 4HPMB 3TIXA 3TUOA 1XCQL 3KUDB 4MACA 2L7RA 2JYEA 3MTNB 2NBWB 2N9XA 5EE3A 4NQLB 1FFVA 3N32A 4WIPA 2B3AA 2W3SA 3DCGA 1I4XA 1WRDB 3R2TA 2WXIA 3BINA 4W9GA 4S0RA 1H4RA 4JLCA 3TMPB 3AH7A 2I2YA 1WR6E 2AEHA 2BYVE 1QZEA 3W1SA 2R2QA 1EU4A 2JX5A 3ZIMA 1RAXA 1L0XB 1I42A 1PGAA 2BW2A 3UGBB 3JSVA 3PZ8A 4XWTA 4GIVA 2KQ7A 1WY8A 2JZPA 2NCNA 5IP4D 2MA9B 2D5GA 2M0AA 4PYZA 1SF0A 5MPOA 4KV2A 3TSSA 1NDDA 2LJ5A 1YD8U 2QDFA 3AE7B 1GUAB 3N1XC 1SJHD 3KYDD 5BMHA 4EKUA 2C7MB 5AZGA 2RDHA 3URYA 1E90A 5D3DA 4YSZB 1SIJA 2IJ0A 2CU1A 1V1PA 1FMAD 4ZRKA 4EOYA 2KFKB 2WP9B 3ML9A 4YTMB 4NNJB 4ZOHC 2L8JA 4BAXA 3CSFA 1IGCA 4NAMA 4RGMA 4XDCA 4P6VF 5GXGB 4ICVA 1B9RA 1YX5B 3HK0A 1UF0A 2KX0A 4DHJD 4ZYNA 4XX5A 2D11A 3R7QA 1CMXB 4YWGG 3UQBA 1F9JA 2C5LC 4USAA 2QHOA 2XBBC 3WANA 4KSKC 4JE3B 4DXAB 3QA8A 1YN4A 1GJZA 1ZW7A 2WXFA 1KLUD 3NVZA 2KACA 5H8YE 1KLGD 1CJEA 4TV3A 2V4IB 5C3JB 1NBFC 2Z0DB 1IP9A 1OFFA 4HKQA 4QAYA 1K51A 1F52A 3IFWB 1EO6A 4WJNA 2I38A 2A4ZA 1S1QB 1TTNA 3E9SA 3GB1A 3AV8A 3OJ3A 1NENB 2JSVX 3APCA 3RI7C 1WSPA 1WRIA 2MJEA 1KOTA 1WGDA 2KJHB 5EE9A 1JWSD 1K53A 4YSYB 2DYBA 1C1YB 3JSVB 2FAZA 4XGAB 5AEKB 3Q14C 3V3XA 4ICUA 2PVGC 2KDIA 2FCNA 3PTFC 1F1HA 1HXYD 3C8YA 4HCNB 4KZ0A 2IDYA 4TSSA 2PW9A 1CQVA 4IC7B 2ZCBA 1GC7A 1SBBB 2DNFA 1I4RA 4OVZA 3B08A 2IZVB 3APFA 1LFDA 4J6IA 3WA0A 3RD2A 1T0QC 1SE2A 1V1PB 2G45B 4RGTA 3HVDA 5LXIB 5JHBA 3I57A 3ZDTA 5D2MB 3QQ8B 1TT5B 3QIJA 1WJNA 2K39A 2FCSA 1TJEA 4MDKE 5BO4B 3R3MA 1ZP0B 3A9JA 1NYRA 4P1BC 2K1FA 4LCDE 2MBHA 2AYOB 3H7PB 2WDTB 1P0RA 3VXWA 3RCZA 2DBYA 2Y5PA 4US9A 2ONQA 1H8CA 1P7EA 1R7SA 2JZZA 3IBEA 2C60A 3DBHB 2JXXA 3T3OA 1TIFA 3R2IA 3ENEA 1N5XA 4MJSA 3A9KB 3NZSA 1KRHA 1IBXA 2KOXA 5DPWA 3NY5A 2GBRA 4RGNA 5FR3A 4OZBA 2X38A 2XN9C 4KZCA 5G2NA 2AQ3B 3P2BA 2QMTA 5E6JA 4M01A 1TZOA 1E8YA 1LGRA 1TS2A 3O13A 3H8HA 2EKEC 1BMLC 3AE6B 3VQIA 4YXDB 1YMHE 1FIQA 2UYZB 2QJLA 4NJCA 4K3BA 3W9CB 2W82A 2RGFA 1T0YA 1GNUA 5BYSA 3Q3NC 4IM0A 4HDQA 1D5XC 2H88B 4RNAA 3CIRB 4AP4C 2D3BA 2PPHA 2MX2A 3RFZB 1Y8RC 1YJJA 3BYYB 2WHIA 1T3QA 1QLBB 4C56C 1J7CA 4BVUC 3EA6A 1HQRD 5D94A 3B9JA 2ZEQA 3Q8FA 2YEPF 3VUXA 3GS2A 1EWYC 2M17A 3DVNV 4EE2A 3B1LX 1VRAB 4WWNA 1NI2A 1HEZE 2NVUI 4M00A 2RSUA 2FNJB 3A9JB 2KN4A 2DZMA 2IO3B 1TKGA 3AE8B 1T6BX 3M62B 1RRBA 4L23A 4YTPB 2K3UA 4B0EA 4MM3B 4WH4A 4URKA 2WXRA 4W9LA 4JIOU 2QIEB 1OTRB 4BKGA 3QC8B 3HVZA 1NYQA 1OQRA 2AL3A 1YIWA 1HTQA 2KC2A 2RPQA 2NMQA 3VDZA 3AEEB 4MJSB 3MHSD 3H7SA 1KH0A 2DAJA 3GZNI 1R4MI 1QOGA 1IBXB 4DHJB 5CHWA 2J4XA 3NVYA 1NI3A 4K1RB 1Q10A 4OVUA 3L08A 4C4VA 2BYFA 4HPLB 3N20C 3P4SB 2KDMA 4LLGM 1ZXIA 4RM8A 5G55A 2QILA 1PGBA 3UINB 4ANWA 1TY0A 4HPPA 2AX5A 1WM2A 1J7AA 2VRRB 1EU3A 4FJVB 2BTEA 3KLSX 3NG0A 4CHKA 1I4GA 2PLPA 3ZNID 3P4RB 1ACCA 3RNBC 4MELA 1WE6A 1BUIC 2QCZA 4ITKA 2JPHA 2ON8A 2Q5WD 5HG2A 3GE3C 1V5TA 1LQBA 1N6ZA 3LXFA 3NHEB 1KFYB 4MSMB 2WU2B 2HJ8A 4II2B 3V6CB 3U30A 3ZVVA 2QC8A 2BB6A 3Q8AA 3KH0A 1JRUA 3J9CA 4P7IA 3AXCA 1V8CA 1ET6A 3W5UB 3FAHA 1VZ6A 3VUYA 3WAOA 1VZ8A 3ZJUA 1JMLA 2VH2A 2NR2A 4US8A 2ZVOA 1Z5SB 3A4SC 2DX5B 4AWJA 1HA5A 2Z8LA 4XWWA 4GXBA 1NVID 5C1ZA 2JUOA 2JXTA 4ARIA 2EMSA 5BMGA 2BVCA 5E6NA 2MCNB 3HRDD 4NQKE 2W54A 2JWUA 3OAWA 2DYMA 4YSXB 1OQYA 4JWSC 3SFEB 2GMIC 1L4ZB 5DPSA 3QHTA 4MGKE 2FIFA 2GBJA 3AE1B 1KF6B 2YLMA 3NJTA 3AE5B 1R4NB 3IAS1 1WFYA 2TSSA 2K25A 4C4VB 5AUIA 2FE8A 3B2GA 3PRPB 4LJOB 1WR1A 2XNAC 1JWUD 3DBHI 5TSSA 1VZ7A 4KGSA 3V62A 1P98A 4XZ4A 2KVZA 4FJYA 2J53A 4R3DA 2PTLA 2LHEA 3LB8C 2Z0EB 5LXHA 4KSLC 1B1ZA 3U4EG 1WZ3A 5LLIA 4ACFA 1V2YA 2L52A 2ZCCA 2WXLA 2JYTA 5JZEB 3DVNU 5J17A 2CJOA 2WXGA 1JWMD 2Y3AA 4ZRIA 3MJWA 2A5UA 2PEAA 3RNEC 2R61A 1WJUA 2WS3B 2OEDA 3AECB 2KDEB 2RR9A 1GB1A 1T0RC 5HFYA 1FM0D 1L2NA 3DBRB 3I9V1 3MC0B 2BKFA 1YN5A 2VZKD 5HI1A 2N7EA 4FADA 5G5HA 3SR6A 1BT0A 1MHHE 1AN8A 2KANA 1V9JA 4MH0E 1XLPA 3M95A 1D5ZC 3WALA 2KVRA 3EFUA 1V6EA 1WM3A 1TBEA 2LWPA 1XLQA 1FNUA 4YT0B 2BS4B 4RM9A 1I4HA 1K50A 4F8CB 3CMMB 2KAJA 4AJYB 4WJPA 3TJPA 3OJ4B 3ZNHB 1FNWA 4YL8A 2LGDA 3PHXB 4LTUA 4PYUA 2DZIA 2JT4B 3CWIA 1FXAA 1ZDXA 4KGRA 2MBEA 3SDLC 1GG3A 2KFJA 5FKAC 4KIKA 2K8CA 5DCNA 4HDOA 2JY6A 5HHDG 1A70A 2KYWA 4M02A 1BXTA 4K81A 4NAWA 1T5XD 1UGJA 2GBNA 1E0ZA 2LVPA 3IT6B 3DBSA 4DWFA 3A1QA 1I35A 2L83A 3WIMA 1PDXA 2KZRA 3AE3B 3UIPB 1WX7A 2KWUB 3IHPC 1LXDA 2N9LA 1C79A 2J7QB 3PRZA 3AEFB 5IKCM 1WH3A 1SE3A 1WGYA 5KHOA 1FCLA 1RWSA 1STEA 4LDTB 3VAWA 3APDA 2MW5A 2EMTA 4WURA 2QEJC 3VRAB 1J19A 4IWPA 1FPYA 2WXPA 2ASQA 1IGDA 3TEZA 2LD9A 3AB5A 4W9HA 2IGDA 4MGIE 4G0NB 2HE7A 1VD2A 3PPAA 5HKHA 3PS6A 4F1SA 3W2DA 1WZ0A 3BWUD 2MSED 2BWFA 3C0RB 2KJ6A 2WGSA 2DAFA 3K9OB 4REZA 4KVGB 1P1AA 3BK2A 2WX0A 3A33B 1ZGUB 4ZRJA 4WAFA 4KX6B 4BZAA 2K5PA 5D7GA 4DQOC 2UWQA 2MBOA 3V6EB 1WIAA 2N0SB 3N1YC 3VTVA 3N9YC 1SXTA 2IPKD 1IYFA 4W9FA 3QAQA 3DHIC 3PT2B 4IKGA 3RZFA 3SHQA 4IWQA 5IA7A 4GDKA 4ASWC 4IM3A 2C9WB 3PZ7A 2ICIA 4E3CA 3DDCB 4GDLA 2MLBA 1N5WA 4KIKB 2KWCA 4ANVA 3OWEB 2EELA 1C4CA 1XD3B 4BOZB 4II3B 2KHWB 3VUWA 2ZW0A 4XDDA 4RMAA 1PQSA 3DHGC 1TGZB 2BBCA 1L5PA 2Y5CA 3PSEB 4NAWB 4WQOB 3PLVA 2N4FA 2X8XX 1J8CA 3A1QB 4JQWC 4JX1C 1EF5A 3P4QB 3RNAC 4FJZA 2LUEA 1DGJA 4TQ1A 2C7NB 2RD0A 1XQQA 2ZPYA 1E10A 4L2YA 3UF8A 1WXAA 4BFRA 4M8NA 3DHHC 1WE7A 3N30A 4C80A 3NUHB 2KJRA 2V4LA 4A20A 1C9FA 5EE1A 1UWMA 1MHXA 2KC1A 1J7BA 4LNKA 1TS4A 1WGRA 2CHXA 3DVGY 2L32A 3X0WA 1JROA 2G4DB 2MRPA 2M0XA 3WAPA 5AZHA 3PLUA 1ZOYB 2V3SA 5GMVA 1SEBD 1RM6C 4IG7B 2WLBA 4A3OA 5E6OA 3LJ3A 2K22A 3T8MA 3RNGC 3OLMD 4BKTA 1MFWA 3HM3A 1ISNA 3HUIA 4KGTA 1SB3C 4L1BA 3AE4B 1GB4A 3O65B 3DPDA 4EUTA 2VZKB 1D4BA 2XEWA 1UNSA 3I3TB 4RH6A 4ANUA 4IWOA 4A90A 3DVGX 2HD5B 4TQ0A 4GDKB 4A3PA 2K0PA 2G3QB 4GDLB 3A4RA 4ZRPA 3VHTC 4RCOA 3HM6X 2E3TA 2N9KA 4GN1A 3JVZX 2LUMA 2BYEA 4RFBA 2MWSB 2WXNA 4EEWA 4TUUA 1C76A 2RDBC 2J0KA 2G1EA 4CO7A 1C3TA 4KDIC 4I6LB 2KMCA 4G3XB 1DOIA 4DXFA 4ANXA 2CR5A 1LM8B 3E56A 4PS7A 3NS8A 2KNBA 3R66C 2FBWB 3SU8X 3QK0A 2UU7A 2E6XA 4O1NA 2N7DA 4HKZE 1FFUA 4BKSA 3M63B 1C78A 4DHZE 2BS3B 2KXJA 2LGIA 4NJ6A 1SSNA 2NBUA
chains in the Genus database with same CATH topology
2DYMA 2WDVB 4C7ZA 3AE7B 4YSXB 1SJHD 4JWSC 3SFEB 2PMVA 2MEKA 1L4ZB 1PYWD 3DWMA 5BMHA 1XLOA 3DWGC 4PT5A 1PUTA 1KF6B 3AE1B 3AN1A 2RDHA 4N59A 3URYA 5D3DA 3AE5B 4A55A 4YSZB 4C7YA 1SIJA 3IAS1 1L4DB 4JPSA 2TSSA 2IJ0A 1V1PA 5AUIA 2FE8A 3B2GA 3AEDB 1FMAD 1XLNA 2WP9B 3BIID 3NRZA 4YTMB 4RF1A 2PIAA 4ZOHC 4A6QA 1YNTE 2AQ2B 2WXHA 4IDIA 4NAMA 1IGCA 4M0WA 4RGMA 4XDCA 4CQNA 2WU5B 2MJDA 2XNAC 1JWUD 2V0GA 4P6VF 5GXGB 5TSSA 1VZ7A 4KGSA 1B9RA 1F77A 2J53A 1QQRA 4R3DA 2PTLA 2LHEA 3LB8C 1CK1A 3P4PB 1L0YB 2ZW1A 1B1ZA 3U4EG 4YWGG 5JXVA 3FILA 4USAA 2WXQA 1QOBA 2L52A 1ET9A 1QKZA 4JE3B 1RYJA 2WXLA 2JYTA 2NTTA 2AQ1B 1YN4A 3FC4A 4ZYSA 2WXFA 1KLUD 3NVZA 2KACA 5H8YE 2CJOA 1KLGD 1CJEA 1TYGB 1FO4A 3TEYA 2WXGA 2V4IB 1JWMD 5C3JB 2Y3AA 1SJED 2GI9A 1MI0A 1RFKA 2R61A 4ZRQA 2WS3B 1OFFA 4HKQA 1XXGA 2OEDA 3AECB 1EWCA 2LMCA 1K51A 3TEXA 1C4PA 1E7PB 1GB1A 3Q8EA 5HFYA 1FM0D 3P1MA 3I9V1 3MC0B 2SEBD 2VZKD 1YN5A 3GP7A 5HI1A 2I38A 5G5HA 1ESFA 5BYRA 3SR6A 3MHZA 4ZHPA 3E9SA 1MHHE 2CJNA 1AN8A 1N62A 2CU3A 1FD6A 3GB1A 1ROEA 3AV8A 1XLPA 1D5ZC 2K9XA 1NENB 2JSVX 1AWDA 1XLQA 3SEBA 1C77A 1WSPA 1FNUA 1N61A 1JW9D 2BS4B 4YT0B 1I4HA 1WRIA 2MJEA 1K50A 4N58A 5EE0A 2M19A 3VRBB 2V3NA 2HDEA 5EE9A 1WXQA 2GRIA 1FNVA 1WYGA 1JWSD 2KAJA 1K53A 4YSYB 3ZJTA 1UUPA 1F0ZA 1FNWA 3V3XA 2KQ4X 2PVGC 1XF5L 5D3IB 1HXYD 3C8YA 3ZGZA 1DYQA 3B2FA 4LTUA 2IDYA 4TSSA 1I7HA 2PW9A 1HZ5A 1CQVA 3CWIA 2LHDA 4OZCA 1NEKB 2WQYB 1FXAA 5LNK1 5FK9C 1SBBB 1ZDXA 4KGRA 1KTKA 5BYQA 1I4RA 4OVZA 5FKAC 1XEEA 4HJGE 1D5MC 4OZAA 5C2TB 1SE2A 2BS2B 4D2KA 3AE9B 1DOYA 1V1PB 5HHDG 3ZQ4A 1A70A 4RGTA 3HVDA 3I57A 1BXTA 4N6EB 1GAQB 3R8BA 2N7JA 1T5XD 1UGJA 1D6EC 1TJEA 3SFDB 4HROA 1N63A 1ZP0B 1E0ZA 1NYRA 3IT6B 4YTNB 1TS5A 3BVMA 2L83A 2PVOD 1JWBD 1PDXA 3AE3B 2INNE 3AM9A 4MT5A 3W5VB 2N9LA 2DBYA 2Y5PA 4US9A 1UWXA 1C79A 2ONQA 3WCQA 3AEFB 1P7EA 2JQRB 1R7SA 1YJIA 3P63A 1SE3A 1FCLA 1FXIA 1RWSA 1STEA 4WURA 2QEJC 3VRAB 1CZPA 1EM7A 2GB1A 3T3OA 3R2IA 1E9MA 2WXPA 3AMZA 3L4PA 4OHJA 3U7ZA 1IGDA 3TEZA 1N5XA 1WGKA 3AB5A 4WWMA 2IGDA 1KRHA 2IGGA 4KKJA 1QOFA 2W3RA 1IBXA 2BT6A 2KMMA 4WQMA 2ACZB 3W2DA 2QSDA 4IOIE 4ZHOA 2JU6X 4RGNA 3NS1A 5FR3A 3BWUD 4OZBA 4MH8A 2X38A 2XN9C 2AQ3B 2QMTA 5E6JA 2RDGA 1WWTA 1TZOA 4REZA 2B76B 3U52E 1TS2A 1MVKA 2YEPB 3O13A 1YQ4B 2RMMA 3BK2A 1QOAA 3H8HA 1BMLC 3AE6B 5H92C 3VQIA 4YXDB 1YMHE 1DOXA 4WAFA 4KX6B 1L6VA 3BVGA 2K5PA 5D7GA 1FIQA 4DQOC 2WDRB 1QILA 3VR9B 1TS3A 1MPEA 1P7FA 2N0SB 4A8XC 4KKIA 2QJLA 2J52A 4NJCA 1JCKB 1SE4A 2IGHA 2V3PA 3W9CB 2W82A 1Y56A 3N9YC 1SXTA 2IPKD 5BYSA 3NVVA 4A9AA 4NZLB 1D5XC 2G9HD 1XO3A 2H88B 1PGXA 1JWAD 3IAM1 4RNAA 4XE0A 3P42A 3CIRB 4IKGA 2J42A 3RFZB 1YJJA 2DLBA 2KWDA 2L1AA 1JRPA 3BYYB 1T3QA 1QLBB 5BMIA 3IT4B 3ZJVA 4C56C 1J7CA 3PZ7A 3EA6A 1HQRD 2ICIA 3B9JA 3Q8FA 1N5WA 2YEPF 1I4QA 3GS2A 1EWYC 3OWEB 2EELA 1C4CA 2EKIA 4HRSA 2ZW0A 4RF0A 3BZDB 4EE2A 4XDDA 3T3NA 1FCCC 1VRAB 4TMAB 2BBCA 1L5PA 2Y5CA 3KWLA 4J3OD 1PFDA 1QT9A 4NAWB 3ZYYX 1QF6A 2H89B 1HEZE 3NZ3A 4AS1A 5I4DA 2KN4A 2DWQA 2FUG1 3NVWA 5G5GA 1JQ4A 1TKGA 3AE8B 1T6BX 4RGOS 4JX1C 1VR9A 3MP9A 4L23A 1ZDVA 5T8IA 3P4QB 2DYOA 1FRRA 4YTPB 1OQQA 3AE2B 1VJKA 2K3UA 4B0EA 4MM3B 3TEWA 3Q8CA 1DGJA 4WH4A 2WXRA 2QIEB 2OHFA 4TQ1A 1I4PA 3VR8B 1VDVA 2RPVA 1E10A 1YQ3B 4B0MA 4L2YA 2WXOA 3HVZA 1NYQA 1L6UA 1OQRA 2LFIA 1YN3A 1M4VA 1ENFA 1C4AA 2MJ3A 2NMQA 4JWUC 3FILB 4OW0A 3AEEB 2NTSA 1TKEA 4C80A 3NUHB 2PKOA 1XCTL 2WDQB 3ABVB 1KH0A 2LEKA 2BYTA 1C9FA 1GOZA 1QOGA 1ZXHA 3AEGB 5EE1A 1IBXB 1UWMA 1MHXA 3LYYA 2J4XA 1LO5D 1AW7A 1NI3A 3KQ4A 3NVYA 1J7BA 1ZUD2 4GLSC 1TS4A 3V05A 2L32A 4Q2JA 2WNMA 1F2RI 5AUKA 1JROA 1TY2A 1Q10A 4AQ7A 4HEA1 1ZOYB 1VLBA 1SEBD 1RM6C 3P4SB 2WLBA 3ETRA 1N60A 3RPFC 2KDMA 2K22A 1ZXIA 4LLGM 1E6EB 3UI3A 2QILA 4DXGA 1PGBA 1TKYA 2BB5A 1K52A 3HUIA 4KGTA 1SB3C 2INPE 4L1BA 3AE4B 1GB4A 1TY0A 1HZ6A 2AX5A 1J7AA 3AEAB 3BVZA 2VZKB 3EGRA 1EU3A 1D4BA 2BTEA 3KLSX 1UNSA 3BK1A 2WXMA 4RH6A 4A90A 1I4GA 2PLPA 3KWVA 3EUB2 3IXSA 4P16A 1FEHA 3MJ5A 3P4RB 4TQ0A 1ACCA 4LK0M 2LJIA 4GDKB 1BUIC 4ITKA 2ON8A 1FRDA 2Q5WD 2SAKA 5HG2A 3TUOA 4ARCA 1XCQL 2WXKA 4FXCA 2MH7A 3LXFA 4MACA 4H2AA 1KFYB 2K0PA 4GDLB 1ZE3D 1JALA 4ZRPA 1GPXA 4RCOA 2JYEA 2WU2B 2E3TA 1IUEA 2N9KA 5EE3A 1FFVA 3Q69A 2LUMA 2BB6A 3Q8AA 4WIPA 4RFBA 2W3SA 3J9CA 2W55A 2WXNA 1I4XA 3R2TA 1C76A 2WXIA 1V8CA 1ET6A 3AEBB 2G1EA 3W5UB 3FAHA 1VZ6A 3PO0A 3AH7A 2I2YA 1DOIA 4DXFA 1VZ8A 3ZJUA 1JMLA 1F2RC 3E56A 1V1OA 2M56B 4US8A 3W1SA 1EU4A 2JX5A 2HTME 2FBWB 1V97A 2E6XA 1AYFA 3Q8BA 1L0VB 1L0XB 1PGAA 4O1NA 2BW2A 3BYTB 3PZ8A 1HA5A 4HKZE 1FFUA 4XWTA 2Z8LA 3MFGA 1C78A 4XWWA 4UDUC 1ZPSA 1NVID 2WXJA 2JZPA 2JXTA 4ARIA 5BMGA 2BS3B 2D5GA 3U2SC 2M0AA 3HRDD 1SF0A 5MPOA 2LGIA 3TSSA 1SSNA 2W54A 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGR A; 
#chains in the Genus database with same CATH topology
 2WDV B;  4C7Z A;  1Q5W B;  1UBI A;  2PMV A;  3LDZ E;  3RMK C;  1WGG A;  1PYW D;  3DWM A;  1HE8 A;  2LI5 A;  2IYD B;  1XLO A;  2KKC A;  3DWG C;  1PUT A;  4BOS C;  4N59 A;  1V80 A;  4A55 A;  1E7U A;  3PRE A;  1SGH A;  2V9H A;  4JPS A;  1L4D B;  3RUI B;  2BPS A;  3KVF B;  3T9L A;  4HCP B;  3Q3O C;  3RZW C;  3AED B;  2KMA A;  1XLN A;  3NZU A;  3BII D;  1WI0 A;  4FHK A;  3NRZ A;  2WWZ A;  2JZ3 B;  4A6Q A;  3L17 A;  4CQN A;  3IG3 A;  4C00 A;  3ZRC A;  2L05 A;  4HVB A;  2KT7 A;  2LGS A;  2CS4 A;  4WWO A;  3BY4 B;  2C7H A;  2FCQ A;  2IY0 B;  4LDT D;  2MBQ A;  2LGY A;  3P4P B;  2ZW1 A;  2JRH A;  3FIL A;  2DHZ A;  3ONS A;  1Q0W B;  1RYJ A;  4FN2 A;  2NTT A;  4W9C A;  1TYG B;  3MC8 A;  3Q3M C;  3PVL A;  1SJE D;  2WX1 A;  2ZVN A;  1RFK A;  4PS3 A;  1XXG A;  2BQQ A;  2LMC A;  1D3Z A;  3TEX A;  1C4P A;  1E7P B;  3RN9 C;  2XK5 A;  4B95 A;  2SEB D;  3GP7 A;  2IO0 B;  1ESF A;  5BYR A;  3MHZ A;  4ZHP A;  2CJN A;  3CF6 E;  2CU3 A;  2J0J A;  1ROE A;  2V1Y A;  1M94 A;  5L95 C;  3ZUN A;  2K9X A;  2FUH B;  4JGH B;  3EHV A;  3SEB A;  1N61 A;  1JW9 D;  2YVC A;  2ZNV B;  5EE0 A;  3EEC A;  3VRB B;  2V3N A;  2HDE A;  2NS5 A;  1WYG A;  2K8B A;  1UH6 A;  4LJP B;  2L0T A;  5KHQ A;  4HK2 A;  2M8S A;  4W9D A;  3ZJT A;  4WJO A;  1UUP A;  3S2A A;  2KQ4 X;  3H1U A;  3JW0 X;  1RLF A;  3ML8 A;  4FLH A;  5CHF A;  1DYQ A;  3B2F A;  1T0S C;  3RNF C;  4AOF A;  1I7H A;  1UEL A;  2LHD A;  4AJW A;  2GOW A;  1WF9 A;  5LNK 1;  4BBN F;  1XEE A;  1D5M C;  4OZA A;  5C2T B;  4D2K A;  3AE9 B;  4G11 A;  3ZQ4 A;  1UGM A;  2M4N A;  1P3Q U;  2N7J A;  2ZZP B;  4DDI D;  4HRO A;  1N63 A;  3PRM B;  1TS5 A;  4BBN C;  2PVO D;  3ZLZ A;  3D32 A;  2O6V D;  3ZRF A;  4MT5 A;  3AM9 A;  3W1S C;  5E6P A;  3P63 A;  1WXS A;  4LNO A;  1WXM A;  1CZP A;  4GGQ A;  2GB1 A;  5D6J B;  2DEN B;  1IPG A;  1E9M A;  3AMZ A;  3L4P A;  4OHJ A;  3U7Z A;  1UZX B;  3FKY A;  2D3C A;  1WGK A;  2MQJ A;  3ECI A;  1QOF A;  1E8Z A;  2OJW A;  4WQM A;  2ACZ B;  1KLV A;  2QSD A;  4IOI E;  2BGF A;  2JU6 X;  3ALB A;  4MH8 A;  3R7R A;  4WJQ A;  3VTU A;  3U52 E;  3KUC B;  2L00 B;  2YEP B;  2KWV B;  1YQ4 B;  2RMM A;  1QOA A;  2D07 B;  3NOB A;  2JF5 A;  2IO2 B;  2WDR B;  1QIL A;  3VR9 B;  2N1W A;  1TS3 A;  4KKI A;  5IN7 A;  2J52 A;  5IOI A;  1JCK B;  2V3P A;  3RT3 B;  1Y56 A;  1WMH A;  4A9A A;  4DK5 A;  5TR5 A;  4NZL B;  2G9H D;  3QCA A;  1XO3 A;  1PGX A;  1VCB A;  1ZKH A;  3IAM 1;  3P42 A;  2J42 A;  2ZPN A;  3H9D A;  2DLB A;  1WGH A;  3KUZ A;  4W9E A;  2OJR A;  5BMI A;  3IT4 B;  3X23 A;  3Q3F A;  3W1Y A;  1I4Q A;  1V49 A;  3QAR A;  4HRS A;  3C19 A;  4GB9 A;  3T3N A;  4TMA B;  3KWL A;  4J3O D;  1PFD A;  3ZYY X;  2ZJD A;  1QF6 A;  4IUM B;  3NZ3 A;  5I4D A;  2AL6 A;  5G5G A;  3NVW A;  4RGO S;  3JYU A;  1WJ6 A;  2IO1 B;  1ZDV A;  5T8I A;  3DBL B;  1FRR A;  4AUQ C;  1VJK A;  2KQS A;  3Q8C A;  3Q2A C;  2L0F A;  2OHF A;  4WWP A;  4HWI B;  3L16 A;  1A5R A;  5J2R A;  2DZJ A;  1VDV A;  4EZK A;  1YQ3 B;  1YQB A;  2WXO A;  2LFI A;  1L6U A;  1YN3 A;  3GE8 C;  1C4A A;  4JWU C;  2GBK A;  4GMV A;  4OW0 A;  1XCT L;  3ABV B;  2LEK A;  2O6V A;  2BYT A;  3I63 C;  3AEG B;  2WYQ A;  2AWT A;  1MJD A;  3GZN B;  2G4S A;  1LO5 D;  1R4M B;  2OOB B;  1WYW B;  1AW7 A;  1ZUD 2;  2L3Z A;  3V05 A;  3IVF A;  2WNM A;  1F2R I;  5AUK A;  2BKR B;  3H7P A;  5DPT A;  2K6Q A;  4W9J A;  1FXT B;  1OGW A;  1YJ1 A;  4ZDV A;  3ETR A;  3UI3 A;  2INP E;  2KX3 A;  3AEA B;  3BVZ A;  3L54 A;  2I1J A;  1WMH B;  3PZD A;  2GBM A;  5AZF A;  3IXS A;  3MJ5 A;  4LK0 M;  1E8W A;  3A9K A;  4FBJ B;  4EZJ A;  2Z59 B;  2SAK A;  2HJ1 A;  4ARC A;  2KTR A;  2WXK A;  4K7U A;  4FXC A;  2MH7 A;  4H2A A;  5DPR A;  1WXV A;  1ZE3 D;  1JAL A;  1GPX A;  2FID A;  4MSQ B;  3I5J C;  1IUE A;  4B6W A;  3Q69 A;  1V81 A;  2KO3 A;  2IY1 B;  2W55 A;  4K7S A;  3AEB B;  2LZ6 A;  3ZNZ B;  2NPT A;  1SE9 A;  1U4A A;  2MBB B;  3PO0 A;  4LNI A;  3H6N A;  1AAR A;  2IBI B;  3WAM A;  1F2R C;  1HTO A;  1V1O A;  2M56 B;  2KK8 A;  4PK1 A;  2BF8 B;  4BKS D;  4FHJ A;  3L10 B;  2HTM E;  1V97 A;  1AYF A;  3Q8B A;  4XYC A;  1L0V B;  3BYT B;  2PE9 A;  3ZO5 B;  3AU5 A;  3MFG A;  4UDU C;  1ZPS A;  1V86 A;  2WXJ A;  3EFC A;  4NY0 A;  4W9K A;  3U2S C;  1KM7 A;  2O6V B;  5CTR C;  3V60 A;  4XC2 A;  2KD0 A;  3DQV A;  2MEK A;  1R4N I;  4PT5 A;  3AN1 A;  4C7Y A;  2GLS A;  3EC8 A;  4JL9 A;  2KTF A;  4RF1 A;  2PIA A;  4EZL A;  2KDB A;  4MM3 A;  1YNT E;  2O2V A;  2AQ2 B;  2WXH A;  4IDI A;  4M0W A;  2ZNV C;  3PGE A;  2WU5 B;  3AI5 A;  2MJD A;  3HHM A;  2V0G A;  3AU4 A;  1F77 A;  3SD5 A;  1EUV B;  4WAA A;  1QQR A;  1CK1 A;  1L0Y B;  5JXV A;  2WXQ A;  1QOB A;  4CYE A;  4E74 A;  1ET9 A;  1QKZ A;  5JH5 C;  2KTR B;  2AQ1 B;  3FC4 A;  4ZYS A;  5JHA A;  3ZTC A;  1FO4 A;  2LRU A;  3TEY A;  1RFA A;  3TCA A;  3M3J A;  2MP2 A;  2VH1 A;  2GI9 A;  1MI0 A;  1WX9 A;  4IW0 A;  4ZRQ A;  2FCM A;  2JWZ A;  3DBR I;  1P9D U;  2MHJ A;  1EWC A;  1MG4 A;  5IO9 A;  5IAA C;  3Q8E A;  1OEY J;  3P1M A;  1YOV B;  2HTH A;  5FR6 A;  2NPT B;  3ZDM C;  4S17 A;  1FD6 A;  1N62 A;  1WX8 A;  4HJK A;  3HIZ A;  4OVV A;  1AWD A;  1C77 A;  3N1Z C;  4N58 A;  2M19 A;  1UBQ A;  1WXQ A;  2GRI A;  1FNV A;  2K6D B;  1F0Z A;  1XF5 L;  1SIF A;  5D3I B;  2CHZ A;  4FUL A;  3ZGZ A;  2LXC A;  3L0W B;  1XT9 B;  1HZ5 A;  4OZC A;  4PS8 A;  1NEK B;  2WQY B;  5FK9 C;  3VH3 B;  1KTK A;  3AUL A;  5BYQ A;  3ZNG C;  4DDG D;  4HLE A;  4HJG E;  3ZKJ C;  2BS2 B;  1K8R B;  3DBL I;  1DOY A;  4LNF A;  1YX6 B;  2N1V A;  4B9K A;  4TKN A;  4N6E B;  1GAQ B;  3R8B A;  1MG8 A;  3U8Z A;  1D6E C;  4G50 A;  2O2V B;  3K9P B;  3U7D A;  4M0W B;  2LAS A;  4I6N B;  3SFD B;  2BWE S;  4YTN B;  3BVM A;  3VTW A;  1JWB D;  2L76 A;  4MGZ E;  4FA6 A;  2LRW A;  2INN E;  3W5V B;  2JVC A;  1UWX A;  4NJ7 A;  5CX3 A;  3WCQ A;  2KLG A;  3QX1 A;  2JQR B;  1YJI A;  4GSW A;  3ZTD A;  2LVO A;  4MGY E;  1FXI A;  5CHV C;  1EM7 A;  3QJZ A;  4X57 B;  2DZK A;  4K3C A;  4LNN A;  2MP2 B;  3ZXR A;  2N9E B;  2R2O A;  3VFK A;  4WWM A;  2IGG A;  4KKJ A;  1Q1O A;  2W3R A;  2BT6 A;  2KMM A;  4ZHO A;  4W9I A;  3NS1 A;  2IND C;  3L13 A;  5EDS A;  4P1C C;  1S3S G;  3RYT A;  2RDG A;  1WWT A;  2B76 B;  2LXA A;  2K8H A;  4I6P A;  1MVK A;  5H92 C;  1DOX A;  1TZ1 A;  1L6V A;  3PV1 A;  3TBL D;  3BVG A;  3MC9 A;  3VVW B;  3QWZ B;  1X1M A;  4GOC A;  4DHZ B;  1MPE A;  1P7F A;  4A8X C;  1SE4 A;  2IGH A;  3N3K B;  3GOE A;  4F7Z A;  3NVV A;  3RUL A;  4EFO A;  3CST A;  1JWA D;  4XE0 A;  1E7V A;  4IM2 A;  4DBG A;  2D3G A;  4KDL B;  2D3A A;  2KWD A;  2L1A A;  1JRP A;  3ZJV A;  4HXD A;  2PJH A;  3RNC C;  1KJT A;  3VH4 B;  1L7Y A;  2PE6 B;  2W9N A;  2JRI B;  4M8M A;  2EKI A;  4RF0 A;  4NPN A;  3BZD B;  1FCC C;  3V61 A;  3TL5 A;  1QT9 A;  2H89 B;  5C23 A;  2KLC A;  1Z2M A;  4AS1 A;  2CKH B;  4K7W A;  2DWQ A;  2FUG 1;  1JQ4 A;  1GC6 A;  3PHW B;  2D2Q A;  1VR9 A;  3MP9 A;  2DYO A;  1OQQ A;  3AE2 B;  1V5O A;  3Q3J A;  3TEW A;  2LVQ A;  1I4P A;  3VR8 B;  2RPV A;  3UQA A;  2LGX A;  4B0M A;  5L83 A;  3ZXV A;  3ZW3 A;  1M4V A;  1ENF A;  4GU2 A;  2MJ3 A;  3FIL B;  2NTS A;  1TKE A;  3Q6B A;  3UIO B;  2PKO A;  2WDQ B;  2I1K A;  2REX A;  1J0G A;  1GOZ A;  1ZXH A;  2KN5 A;  1EF1 A;  3LYY A;  1E5W A;  2KDF B;  3KQ4 A;  4E71 A;  2Y5B B;  4GLS C;  4Q2J A;  2CHW A;  1TY2 A;  4AQ7 A;  2J0M A;  4HEA 1;  4N9F 4;  1VLB A;  3KYC D;  3B0A A;  2XK5 B;  2KFK A;  1N60 A;  3RPF C;  1E6E B;  1E8X A;  4DXG A;  3OG5 A;  1TKY A;  2BB5 A;  1K52 A;  3KW5 B;  2N9P C;  1UD7 A;  1HZ6 A;  1WJ4 A;  2D10 A;  2INC C;  3EGR A;  1OEY A;  3BK1 A;  2WXM A;  3KWV A;  1G6J A;  3EUB 2;  2NBV B;  4P16 A;  1FEH A;  3DOW A;  2M1M A;  5J18 A;  2LJI A;  4MEM A;  1FRD A;  4HPM B;  3TIX A;  3TUO A;  1XCQ L;  3KUD B;  4MAC A;  2L7R A;  2JYE A;  3MTN B;  2NBW B;  2N9X A;  5EE3 A;  4NQL B;  1FFV A;  3N32 A;  4WIP A;  2B3A A;  2W3S A;  3DCG A;  1I4X A;  1WRD B;  3R2T A;  2WXI A;  3BIN A;  4W9G A;  4S0R A;  1H4R A;  4JLC A;  3TMP B;  3AH7 A;  2I2Y A;  1WR6 E;  2AEH A;  2BYV E;  1QZE A;  3W1S A;  2R2Q A;  1EU4 A;  2JX5 A;  3ZIM A;  1RAX A;  1L0X B;  1I42 A;  1PGA A;  2BW2 A;  3UGB B;  3JSV A;  3PZ8 A;  4XWT A;  4GIV A;  2KQ7 A;  1WY8 A;  2JZP A;  2NCN A;  5IP4 D;  2MA9 B;  2D5G A;  2M0A A;  4PYZ A;  1SF0 A;  5MPO A;  4KV2 A;  3TSS A;  1NDD A;  2LJ5 A;  1YD8 U;  2QDF A;  3AE7 B;  1GUA B;  3N1X C;  1SJH D;  3KYD D;  5BMH A;  4EKU A;  2C7M B;  5AZG A;  2RDH A;  3URY A;  1E90 A;  5D3D A;  4YSZ B;  1SIJ A;  2IJ0 A;  2CU1 A;  1V1P A;  1FMA D;  4ZRK A;  4EOY A;  2KFK B;  2WP9 B;  3ML9 A;  4YTM B;  4NNJ B;  4ZOH C;  2L8J A;  4BAX A;  3CSF A;  1IGC A;  4NAM A;  4RGM A;  4XDC A;  4P6V F;  5GXG B;  4ICV A;  1B9R A;  1YX5 B;  3HK0 A;  1UF0 A;  2KX0 A;  4DHJ D;  4ZYN A;  4XX5 A;  2D11 A;  3R7Q A;  1CMX B;  4YWG G;  3UQB A;  1F9J A;  2C5L C;  4USA A;  2QHO A;  2XBB C;  3WAN A;  4KSK C;  4JE3 B;  4DXA B;  3QA8 A;  1YN4 A;  1GJZ A;  1ZW7 A;  2WXF A;  1KLU D;  3NVZ A;  2KAC A;  5H8Y E;  1KLG D;  1CJE A;  4TV3 A;  2V4I B;  5C3J B;  1NBF C;  2Z0D B;  1IP9 A;  1OFF A;  4HKQ A;  4QAY A;  1K51 A;  1F52 A;  3IFW B;  1EO6 A;  4WJN A;  2I38 A;  2A4Z A;  1S1Q B;  1TTN A;  3E9S A;  3GB1 A;  3AV8 A;  3OJ3 A;  1NEN B;  2JSV X;  3APC A;  3RI7 C;  1WSP A;  1WRI A;  2MJE A;  1KOT A;  1WGD A;  2KJH B;  5EE9 A;  1JWS D;  1K53 A;  4YSY B;  2DYB A;  1C1Y B;  3JSV B;  2FAZ A;  4XGA B;  5AEK B;  3Q14 C;  3V3X A;  4ICU A;  2PVG C;  2KDI A;  2FCN A;  3PTF C;  1F1H A;  1HXY D;  3C8Y A;  4HCN B;  4KZ0 A;  2IDY A;  4TSS A;  2PW9 A;  1CQV A;  4IC7 B;  2ZCB A;  1GC7 A;  1SBB B;  2DNF A;  1I4R A;  4OVZ A;  3B08 A;  2IZV B;  3APF A;  1LFD A;  4J6I A;  3WA0 A;  3RD2 A;  1T0Q C;  1SE2 A;  1V1P B;  2G45 B;  4RGT A;  3HVD A;  5LXI B;  5JHB A;  3I57 A;  3ZDT A;  5D2M B;  3QQ8 B;  1TT5 B;  3QIJ A;  1WJN A;  2K39 A;  2FCS A;  1TJE A;  4MDK E;  5BO4 B;  3R3M A;  1ZP0 B;  3A9J A;  1NYR A;  4P1B C;  2K1F A;  4LCD E;  2MBH A;  2AYO B;  3H7P B;  2WDT B;  1P0R A;  3VXW A;  3RCZ A;  2DBY A;  2Y5P A;  4US9 A;  2ONQ A;  1H8C A;  1P7E A;  1R7S A;  2JZZ A;  3IBE A;  2C60 A;  3DBH B;  2JXX A;  3T3O A;  1TIF A;  3R2I A;  3ENE A;  1N5X A;  4MJS A;  3A9K B;  3NZS A;  1KRH A;  1IBX A;  2KOX A;  5DPW A;  3NY5 A;  2GBR A;  4RGN A;  5FR3 A;  4OZB A;  2X38 A;  2XN9 C;  4KZC A;  5G2N A;  2AQ3 B;  3P2B A;  2QMT A;  5E6J A;  4M01 A;  1TZO A;  1E8Y A;  1LGR A;  1TS2 A;  3O13 A;  3H8H A;  2EKE C;  1BML C;  3AE6 B;  3VQI A;  4YXD B;  1YMH E;  1FIQ A;  2UYZ B;  2QJL A;  4NJC A;  4K3B A;  3W9C B;  2W82 A;  2RGF A;  1T0Y A;  1GNU A;  5BYS A;  3Q3N C;  4IM0 A;  4HDQ A;  1D5X C;  2H88 B;  4RNA A;  3CIR B;  4AP4 C;  2D3B A;  2PPH A;  2MX2 A;  3RFZ B;  1Y8R C;  1YJJ A;  3BYY B;  2WHI A;  1T3Q A;  1QLB B;  4C56 C;  1J7C A;  4BVU C;  3EA6 A;  1HQR D;  5D94 A;  3B9J A;  2ZEQ A;  3Q8F A;  2YEP F;  3VUX A;  3GS2 A;  1EWY C;  2M17 A;  3DVN V;  4EE2 A;  3B1L X;  1VRA B;  4WWN A;  1NI2 A;  1HEZ E;  2NVU I;  4M00 A;  2RSU A;  2FNJ B;  3A9J B;  2KN4 A;  2DZM A;  2IO3 B;  1TKG A;  3AE8 B;  1T6B X;  3M62 B;  1RRB A;  4L23 A;  4YTP B;  2K3U A;  4B0E A;  4MM3 B;  4WH4 A;  4URK A;  2WXR A;  4W9L A;  4JIO U;  2QIE B;  1OTR B;  4BKG A;  3QC8 B;  3HVZ A;  1NYQ A;  1OQR A;  2AL3 A;  1YIW A;  1HTQ A;  2KC2 A;  2RPQ A;  2NMQ A;  3VDZ A;  3AEE B;  4MJS B;  3MHS D;  3H7S A;  1KH0 A;  2DAJ A;  3GZN I;  1R4M I;  1QOG A;  1IBX B;  4DHJ B;  5CHW A;  2J4X A;  3NVY A;  1NI3 A;  4K1R B;  1Q10 A;  4OVU A;  3L08 A;  4C4V A;  2BYF A;  4HPL B;  3N20 C;  3P4S B;  2KDM A;  4LLG M;  1ZXI A;  4RM8 A;  5G55 A;  2QIL A;  1PGB A;  3UIN B;  4ANW A;  1TY0 A;  4HPP A;  2AX5 A;  1WM2 A;  1J7A A;  2VRR B;  1EU3 A;  4FJV B;  2BTE A;  3KLS X;  3NG0 A;  4CHK A;  1I4G A;  2PLP A;  3ZNI D;  3P4R B;  1ACC A;  3RNB C;  4MEL A;  1WE6 A;  1BUI C;  2QCZ A;  4ITK A;  2JPH A;  2ON8 A;  2Q5W D;  5HG2 A;  3GE3 C;  1V5T A;  1LQB A;  1N6Z A;  3LXF A;  3NHE B;  1KFY B;  4MSM B;  2WU2 B;  2HJ8 A;  4II2 B;  3V6C B;  3U30 A;  3ZVV A;  2QC8 A;  2BB6 A;  3Q8A A;  3KH0 A;  1JRU A;  3J9C A;  4P7I A;  3AXC A;  1V8C A;  1ET6 A;  3W5U B;  3FAH A;  1VZ6 A;  3VUY A;  3WAO A;  1VZ8 A;  3ZJU A;  1JML A;  2VH2 A;  2NR2 A;  4US8 A;  2ZVO A;  1Z5S B;  3A4S C;  2DX5 B;  4AWJ A;  1HA5 A;  2Z8L A;  4XWW A;  4GXB A;  1NVI D;  5C1Z A;  2JUO A;  2JXT A;  4ARI A;  2EMS A;  5BMG A;  2BVC A;  5E6N A;  2MCN B;  3HRD D;  4NQK E;  2W54 A;  2JWU A;  3OAW A;  2DYM A;  4YSX B;  1OQY A;  4JWS C;  3SFE B;  2GMI C;  1L4Z B;  5DPS A;  3QHT A;  4MGK E;  2FIF A;  2GBJ A;  3AE1 B;  1KF6 B;  2YLM A;  3NJT A;  3AE5 B;  1R4N B;  3IAS 1;  1WFY A;  2TSS A;  2K25 A;  4C4V B;  5AUI A;  2FE8 A;  3B2G A;  3PRP B;  4LJO B;  1WR1 A;  2XNA C;  1JWU D;  3DBH I;  5TSS A;  1VZ7 A;  4KGS A;  3V62 A;  1P98 A;  4XZ4 A;  2KVZ A;  4FJY A;  2J53 A;  4R3D A;  2PTL A;  2LHE A;  3LB8 C;  2Z0E B;  5LXH A;  4KSL C;  1B1Z A;  3U4E G;  1WZ3 A;  5LLI A;  4ACF A;  1V2Y A;  2L52 A;  2ZCC A;  2WXL A;  2JYT A;  5JZE B;  3DVN U;  5J17 A;  2CJO A;  2WXG A;  1JWM D;  2Y3A A;  4ZRI A;  3MJW A;  2A5U A;  2PEA A;  3RNE C;  2R61 A;  1WJU A;  2WS3 B;  2OED A;  3AEC B;  2KDE B;  2RR9 A;  1GB1 A;  1T0R C;  5HFY A;  1FM0 D;  1L2N A;  3DBR B;  3I9V 1;  3MC0 B;  2BKF A;  1YN5 A;  2VZK D;  5HI1 A;  2N7E A;  4FAD A;  5G5H A;  3SR6 A;  1BT0 A;  1MHH E;  1AN8 A;  2KAN A;  1V9J A;  4MH0 E;  1XLP A;  3M95 A;  1D5Z C;  3WAL A;  2KVR A;  3EFU A;  1V6E A;  1WM3 A;  1TBE A;  2LWP A;  1XLQ A;  1FNU A;  4YT0 B;  2BS4 B;  4RM9 A;  1I4H A;  1K50 A;  4F8C B;  3CMM B;  2KAJ A;  4AJY B;  4WJP A;  3TJP A;  3OJ4 B;  3ZNH B;  1FNW A;  4YL8 A;  2LGD A;  3PHX B;  4LTU A;  4PYU A;  2DZI A;  2JT4 B;  3CWI A;  1FXA A;  1ZDX A;  4KGR A;  2MBE A;  3SDL C;  1GG3 A;  2KFJ A;  5FKA C;  4KIK A;  2K8C A;  5DCN A;  4HDO A;  2JY6 A;  5HHD G;  1A70 A;  2KYW A;  4M02 A;  1BXT A;  4K81 A;  4NAW A;  1T5X D;  1UGJ A;  2GBN A;  1E0Z A;  2LVP A;  3IT6 B;  3DBS A;  4DWF A;  3A1Q A;  1I35 A;  2L83 A;  3WIM A;  1PDX A;  2KZR A;  3AE3 B;  3UIP B;  1WX7 A;  2KWU B;  3IHP C;  1LXD A;  2N9L A;  1C79 A;  2J7Q B;  3PRZ A;  3AEF B;  5IKC M;  1WH3 A;  1SE3 A;  1WGY A;  5KHO A;  1FCL A;  1RWS A;  1STE A;  4LDT B;  3VAW A;  3APD A;  2MW5 A;  2EMT A;  4WUR A;  2QEJ C;  3VRA B;  1J19 A;  4IWP A;  1FPY A;  2WXP A;  2ASQ A;  1IGD A;  3TEZ A;  2LD9 A;  3AB5 A;  4W9H A;  2IGD A;  4MGI E;  4G0N B;  2HE7 A;  1VD2 A;  3PPA A;  5HKH A;  3PS6 A;  4F1S A;  3W2D A;  1WZ0 A;  3BWU D;  2MSE D;  2BWF A;  3C0R B;  2KJ6 A;  2WGS A;  2DAF A;  3K9O B;  4REZ A;  4KVG B;  1P1A A;  3BK2 A;  2WX0 A;  3A33 B;  1ZGU B;  4ZRJ A;  4WAF A;  4KX6 B;  4BZA A;  2K5P A;  5D7G A;  4DQO C;  2UWQ A;  2MBO A;  3V6E B;  1WIA A;  2N0S B;  3N1Y C;  3VTV A;  3N9Y C;  1SXT A;  2IPK D;  1IYF A;  4W9F A;  3QAQ A;  3DHI C;  3PT2 B;  4IKG A;  3RZF A;  3SHQ A;  4IWQ A;  5IA7 A;  4GDK A;  4ASW C;  4IM3 A;  2C9W B;  3PZ7 A;  2ICI A;  4E3C A;  3DDC B;  4GDL A;  2MLB A;  1N5W A;  4KIK B;  2KWC A;  4ANV A;  3OWE B;  2EEL A;  1C4C A;  1XD3 B;  4BOZ B;  4II3 B;  2KHW B;  3VUW A;  2ZW0 A;  4XDD A;  4RMA A;  1PQS A;  3DHG C;  1TGZ B;  2BBC A;  1L5P A;  2Y5C A;  3PSE B;  4NAW B;  4WQO B;  3PLV A;  2N4F A;  2X8X X;  1J8C A;  3A1Q B;  4JQW C;  4JX1 C;  1EF5 A;  3P4Q B;  3RNA C;  4FJZ A;  2LUE A;  1DGJ A;  4TQ1 A;  2C7N B;  2RD0 A;  1XQQ A;  2ZPY A;  1E10 A;  4L2Y A;  3UF8 A;  1WXA A;  4BFR A;  4M8N A;  3DHH C;  1WE7 A;  3N30 A;  4C80 A;  3NUH B;  2KJR A;  2V4L A;  4A20 A;  1C9F A;  5EE1 A;  1UWM A;  1MHX A;  2KC1 A;  1J7B A;  4LNK A;  1TS4 A;  1WGR A;  2CHX A;  3DVG Y;  2L32 A;  3X0W A;  1JRO A;  2G4D B;  2MRP A;  2M0X A;  3WAP A;  5AZH A;  3PLU A;  1ZOY B;  2V3S A;  5GMV A;  1SEB D;  1RM6 C;  4IG7 B;  2WLB A;  4A3O A;  5E6O A;  3LJ3 A;  2K22 A;  3T8M A;  3RNG C;  3OLM D;  4BKT A;  1MFW A;  3HM3 A;  1ISN A;  3HUI A;  4KGT A;  1SB3 C;  4L1B A;  3AE4 B;  1GB4 A;  3O65 B;  3DPD A;  4EUT A;  2VZK B;  1D4B A;  2XEW A;  1UNS A;  3I3T B;  4RH6 A;  4ANU A;  4IWO A;  4A90 A;  3DVG X;  2HD5 B;  4TQ0 A;  4GDK B;  4A3P A;  2K0P A;  2G3Q B;  4GDL B;  3A4R A;  4ZRP A;  3VHT C;  4RCO A;  3HM6 X;  2E3T A;  2N9K A;  4GN1 A;  3JVZ X;  2LUM A;  2BYE A;  4RFB A;  2MWS B;  2WXN A;  4EEW A;  4TUU A;  1C76 A;  2RDB C;  2J0K A;  2G1E A;  4CO7 A;  1C3T A;  4KDI C;  4I6L B;  2KMC A;  4G3X B;  1DOI A;  4DXF A;  4ANX A;  2CR5 A;  1LM8 B;  3E56 A;  4PS7 A;  3NS8 A;  2KNB A;  3R66 C;  2FBW B;  3SU8 X;  3QK0 A;  2UU7 A;  2E6X A;  4O1N A;  2N7D A;  4HKZ E;  1FFU A;  4BKS A;  3M63 B;  1C78 A;  4DHZ E;  2BS3 B;  2KXJ A;  2LGI A;  4NJ6 A;  1SSN A;  2NBU A; 
#chains in the Genus database with same CATH homology
 2DYM A;  2WDV B;  4C7Z A;  3AE7 B;  4YSX B;  1SJH D;  4JWS C;  3SFE B;  2PMV A;  2MEK A;  1L4Z B;  1PYW D;  3DWM A;  5BMH A;  1XLO A;  3DWG C;  4PT5 A;  1PUT A;  1KF6 B;  3AE1 B;  3AN1 A;  2RDH A;  4N59 A;  3URY A;  5D3D A;  3AE5 B;  4A55 A;  4YSZ B;  4C7Y A;  1SIJ A;  3IAS 1;  1L4D B;  4JPS A;  2TSS A;  2IJ0 A;  1V1P A;  5AUI A;  2FE8 A;  3B2G A;  3AED B;  1FMA D;  1XLN A;  2WP9 B;  3BII D;  3NRZ A;  4YTM B;  4RF1 A;  2PIA A;  4ZOH C;  4A6Q A;  1YNT E;  2AQ2 B;  2WXH A;  4IDI A;  4NAM A;  1IGC A;  4M0W A;  4RGM A;  4XDC A;  4CQN A;  2WU5 B;  2MJD A;  2XNA C;  1JWU D;  2V0G A;  4P6V F;  5GXG B;  5TSS A;  1VZ7 A;  4KGS A;  1B9R A;  1F77 A;  2J53 A;  1QQR A;  4R3D A;  2PTL A;  2LHE A;  3LB8 C;  1CK1 A;  3P4P B;  1L0Y B;  2ZW1 A;  1B1Z A;  3U4E G;  4YWG G;  5JXV A;  3FIL A;  4USA A;  2WXQ A;  1QOB A;  2L52 A;  1ET9 A;  1QKZ A;  4JE3 B;  1RYJ A;  2WXL A;  2JYT A;  2NTT A;  2AQ1 B;  1YN4 A;  3FC4 A;  4ZYS A;  2WXF A;  1KLU D;  3NVZ A;  2KAC A;  5H8Y E;  2CJO A;  1KLG D;  1CJE A;  1TYG B;  1FO4 A;  3TEY A;  2WXG A;  2V4I B;  1JWM D;  5C3J B;  2Y3A A;  1SJE D;  2GI9 A;  1MI0 A;  1RFK A;  2R61 A;  4ZRQ A;  2WS3 B;  1OFF A;  4HKQ A;  1XXG A;  2OED A;  3AEC B;  1EWC A;  2LMC A;  1K51 A;  3TEX A;  1C4P A;  1E7P B;  1GB1 A;  3Q8E A;  5HFY A;  1FM0 D;  3P1M A;  3I9V 1;  3MC0 B;  2SEB D;  2VZK D;  1YN5 A;  3GP7 A;  5HI1 A;  2I38 A;  5G5H A;  1ESF A;  5BYR A;  3SR6 A;  3MHZ A;  4ZHP A;  3E9S A;  1MHH E;  2CJN A;  1AN8 A;  1N62 A;  2CU3 A;  1FD6 A;  3GB1 A;  1ROE A;  3AV8 A;  1XLP A;  1D5Z C;  2K9X A;  1NEN B;  2JSV X;  1AWD A;  1XLQ A;  3SEB A;  1C77 A;  1WSP A;  1FNU A;  1N61 A;  1JW9 D;  2BS4 B;  4YT0 B;  1I4H A;  1WRI A;  2MJE A;  1K50 A;  4N58 A;  5EE0 A;  2M19 A;  3VRB B;  2V3N A;  2HDE A;  5EE9 A;  1WXQ A;  2GRI A;  1FNV A;  1WYG A;  1JWS D;  2KAJ A;  1K53 A;  4YSY B;  3ZJT A;  1UUP A;  1F0Z A;  1FNW A;  3V3X A;  2KQ4 X;  2PVG C;  1XF5 L;  5D3I B;  1HXY D;  3C8Y A;  3ZGZ A;  1DYQ A;  3B2F A;  4LTU A;  2IDY A;  4TSS A;  1I7H A;  2PW9 A;  1HZ5 A;  1CQV A;  3CWI A;  2LHD A;  4OZC A;  1NEK B;  2WQY B;  1FXA A;  5LNK 1;  5FK9 C;  1SBB B;  1ZDX A;  4KGR A;  1KTK A;  5BYQ A;  1I4R A;  4OVZ A;  5FKA C;  1XEE A;  4HJG E;  1D5M C;  4OZA A;  5C2T B;  1SE2 A;  2BS2 B;  4D2K A;  3AE9 B;  1DOY A;  1V1P B;  5HHD G;  3ZQ4 A;  1A70 A;  4RGT A;  3HVD A;  3I57 A;  1BXT A;  4N6E B;  1GAQ B;  3R8B A;  2N7J A;  1T5X D;  1UGJ A;  1D6E C;  1TJE A;  3SFD B;  4HRO A;  1N63 A;  1ZP0 B;  1E0Z A;  1NYR A;  3IT6 B;  4YTN B;  1TS5 A;  3BVM A;  2L83 A;  2PVO D;  1JWB D;  1PDX A;  3AE3 B;  2INN E;  3AM9 A;  4MT5 A;  3W5V B;  2N9L A;  2DBY A;  2Y5P A;  4US9 A;  1UWX A;  1C79 A;  2ONQ A;  3WCQ A;  3AEF B;  1P7E A;  2JQR B;  1R7S A;  1YJI A;  3P63 A;  1SE3 A;  1FCL A;  1FXI A;  1RWS A;  1STE A;  4WUR A;  2QEJ C;  3VRA B;  1CZP A;  1EM7 A;  2GB1 A;  3T3O A;  3R2I A;  1E9M A;  2WXP A;  3AMZ A;  3L4P A;  4OHJ A;  3U7Z A;  1IGD A;  3TEZ A;  1N5X A;  1WGK A;  3AB5 A;  4WWM A;  2IGD A;  1KRH A;  2IGG A;  4KKJ A;  1QOF A;  2W3R A;  1IBX A;  2BT6 A;  2KMM A;  4WQM A;  2ACZ B;  3W2D A;  2QSD A;  4IOI E;  4ZHO A;  2JU6 X;  4RGN A;  3NS1 A;  5FR3 A;  3BWU D;  4OZB A;  4MH8 A;  2X38 A;  2XN9 C;  2AQ3 B;  2QMT A;  5E6J A;  2RDG A;  1WWT A;  1TZO A;  4REZ A;  2B76 B;  3U52 E;  1TS2 A;  1MVK A;  2YEP B;  3O13 A;  1YQ4 B;  2RMM A;  3BK2 A;  1QOA A;  3H8H A;  1BML C;  3AE6 B;  5H92 C;  3VQI A;  4YXD B;  1YMH E;  1DOX A;  4WAF A;  4KX6 B;  1L6V A;  3BVG A;  2K5P A;  5D7G A;  1FIQ A;  4DQO C;  2WDR B;  1QIL A;  3VR9 B;  1TS3 A;  1MPE A;  1P7F A;  2N0S B;  4A8X C;  4KKI A;  2QJL A;  2J52 A;  4NJC A;  1JCK B;  1SE4 A;  2IGH A;  2V3P A;  3W9C B;  2W82 A;  1Y56 A;  3N9Y C;  1SXT A;  2IPK D;  5BYS A;  3NVV A;  4A9A A;  4NZL B;  1D5X C;  2G9H D;  1XO3 A;  2H88 B;  1PGX A;  1JWA D;  3IAM 1;  4RNA A;  4XE0 A;  3P42 A;  3CIR B;  4IKG A;  2J42 A;  3RFZ B;  1YJJ A;  2DLB A;  2KWD A;  2L1A A;  1JRP A;  3BYY B;  1T3Q A;  1QLB B;  5BMI A;  3IT4 B;  3ZJV A;  4C56 C;  1J7C A;  3PZ7 A;  3EA6 A;  1HQR D;  2ICI A;  3B9J A;  3Q8F A;  1N5W A;  2YEP F;  1I4Q A;  3GS2 A;  1EWY C;  3OWE B;  2EEL A;  1C4C A;  2EKI A;  4HRS A;  2ZW0 A;  4RF0 A;  3BZD B;  4EE2 A;  4XDD A;  3T3N A;  1FCC C;  1VRA B;  4TMA B;  2BBC A;  1L5P A;  2Y5C A;  3KWL A;  4J3O D;  1PFD A;  1QT9 A;  4NAW B;  3ZYY X;  1QF6 A;  2H89 B;  1HEZ E;  3NZ3 A;  4AS1 A;  5I4D A;  2KN4 A;  2DWQ A;  2FUG 1;  3NVW A;  5G5G A;  1JQ4 A;  1TKG A;  3AE8 B;  1T6B X;  4RGO S;  4JX1 C;  1VR9 A;  3MP9 A;  4L23 A;  1ZDV A;  5T8I A;  3P4Q B;  2DYO A;  1FRR A;  4YTP B;  1OQQ A;  3AE2 B;  1VJK A;  2K3U A;  4B0E A;  4MM3 B;  3TEW A;  3Q8C A;  1DGJ A;  4WH4 A;  2WXR A;  2QIE B;  2OHF A;  4TQ1 A;  1I4P A;  3VR8 B;  1VDV A;  2RPV A;  1E10 A;  1YQ3 B;  4B0M A;  4L2Y A;  2WXO A;  3HVZ A;  1NYQ A;  1L6U A;  1OQR A;  2LFI A;  1YN3 A;  1M4V A;  1ENF A;  1C4A A;  2MJ3 A;  2NMQ A;  4JWU C;  3FIL B;  4OW0 A;  3AEE B;  2NTS A;  1TKE A;  4C80 A;  3NUH B;  2PKO A;  1XCT L;  2WDQ B;  3ABV B;  1KH0 A;  2LEK A;  2BYT A;  1C9F A;  1GOZ A;  1QOG A;  1ZXH A;  3AEG B;  5EE1 A;  1IBX B;  1UWM A;  1MHX A;  3LYY A;  2J4X A;  1LO5 D;  1AW7 A;  1NI3 A;  3KQ4 A;  3NVY A;  1J7B A;  1ZUD 2;  4GLS C;  1TS4 A;  3V05 A;  2L32 A;  4Q2J A;  2WNM A;  1F2R I;  5AUK A;  1JRO A;  1TY2 A;  1Q10 A;  4AQ7 A;  4HEA 1;  1ZOY B;  1VLB A;  1SEB D;  1RM6 C;  3P4S B;  2WLB A;  3ETR A;  1N60 A;  3RPF C;  2KDM A;  2K22 A;  1ZXI A;  4LLG M;  1E6E B;  3UI3 A;  2QIL A;  4DXG A;  1PGB A;  1TKY A;  2BB5 A;  1K52 A;  3HUI A;  4KGT A;  1SB3 C;  2INP E;  4L1B A;  3AE4 B;  1GB4 A;  1TY0 A;  1HZ6 A;  2AX5 A;  1J7A A;  3AEA B;  3BVZ A;  2VZK B;  3EGR A;  1EU3 A;  1D4B A;  2BTE A;  3KLS X;  1UNS A;  3BK1 A;  2WXM A;  4RH6 A;  4A90 A;  1I4G A;  2PLP A;  3KWV A;  3EUB 2;  3IXS A;  4P16 A;  1FEH A;  3MJ5 A;  3P4R B;  4TQ0 A;  1ACC A;  4LK0 M;  2LJI A;  4GDK B;  1BUI C;  4ITK A;  2ON8 A;  1FRD A;  2Q5W D;  2SAK A;  5HG2 A;  3TUO A;  4ARC A;  1XCQ L;  2WXK A;  4FXC A;  2MH7 A;  3LXF A;  4MAC A;  4H2A A;  1KFY B;  2K0P A;  4GDL B;  1ZE3 D;  1JAL A;  4ZRP A;  1GPX A;  4RCO A;  2JYE A;  2WU2 B;  2E3T A;  1IUE A;  2N9K A;  5EE3 A;  1FFV A;  3Q69 A;  2LUM A;  2BB6 A;  3Q8A A;  4WIP A;  4RFB A;  2W3S A;  3J9C A;  2W55 A;  2WXN A;  1I4X A;  3R2T A;  1C76 A;  2WXI A;  1V8C A;  1ET6 A;  3AEB B;  2G1E A;  3W5U B;  3FAH A;  1VZ6 A;  3PO0 A;  3AH7 A;  2I2Y A;  1DOI A;  4DXF A;  1VZ8 A;  3ZJU A;  1JML A;  1F2R C;  3E56 A;  1V1O A;  2M56 B;  4US8 A;  3W1S A;  1EU4 A;  2JX5 A;  2HTM E;  2FBW B;  1V97 A;  2E6X A;  1AYF A;  3Q8B A;  1L0V B;  1L0X B;  1PGA A;  4O1N A;  2BW2 A;  3BYT B;  3PZ8 A;  1HA5 A;  4HKZ E;  1FFU A;  4XWT A;  2Z8L A;  3MFG A;  1C78 A;  4XWW A;  4UDU C;  1ZPS A;  1NVI D;  2WXJ A;  2JZP A;  2JXT A;  4ARI A;  5BMG A;  2BS3 B;  2D5G A;  3U2S C;  2M0A A;  3HRD D;  1SF0 A;  5MPO A;  2LGI A;  3TSS A;  1SSN A;  2W54 A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...