2JQRB

Solution model of crosslinked complex of cytochrome c and adrenodoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDCAYGLTDRSRLGCQISLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamics in a pure encounter complex of two proteins studied by solution scattering and paramagnetic NMR spectroscopy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
molecule keywords Cytochrome c iso-1
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jqrB00
4IDIA 1KFYB 3CWIA 1YQ3B 5EE9A 2W54A 2M19A 1NENB 1NEKB 1EWYC 3NVYA 3SFDB 2MH7A 1WGKA 1L6VA 3AEAB 3AN1A 3AB5A 1N62A 1XLPA 1L0VB 1PDXA 2W3SA 1FM0D 2KMMA 1FRDA 3AE7B 3LXFA 1GPXA 1F0ZA 3HUIA 1E7PB 2W55A 3VR9B 1OFFA 4ITKA 2H89B 2JQRB 4YTMB 4C7ZA 2K22A 2WU5B 3SR6A 3ABVB 3AE5B 2OHFA 1JWAD 3HVZA 1PFDA 1ZXIA 1ZP0B 2EKIA 1RWSA 2FBWB 2QJLA 2DWQA 1QOFA 3AM9A 2JX5A 2Q5WD 4US9A 5H92C 3P63A 2WDQB 2HTME 3AMZA 4WWMA 3HRDD 4YSXB 2K5PA 1DOIA 1NVID 1VJKA 1UWMA 1JW9D 3NS1A 4P6VF 4A9AA 4YSZB 5EE3A 1N63A 2WDVB 1NYRA 2N0SB 5H8YE 1TKGA 3AE6B 1QT9A 4YSYB 3NRZA 5AUIA 5EE0A 1E10A 1KF6B 1YJJA 1E0ZA 1TJEA 3AE3B 4ZOHC 1RFKA 2QIEB 3AEDB 3AE9B 1XLNA 4HRSA 1GAQB 2PIAA 3AEBB 4YXDB 2BS2B 5G5GA 5EE1A 1N5WA 1FFVA 1B9RA 1OQQA 2Y5CA 3VRBB 1WXQA 1T3QA 2PKOA 3AEGB 1R7SA 1N60A 3FC4A 3P4QB 5C3JB 3AEFB 1E6EB 3AE4B 1E9MA 3B2FA 5AUKA 4C80A 2KAJA 3W9CB 5MPOA 1VDVA 2ACZB 3B2GA 1DOYA 1SB3C 3PO0A 1NI3A 3CIRB 4KX6B 1OQRA 1IUEA 3P4RB 3VR8B 2MJ3A 1DOXA 1J7BA 1YQ4B 1FMAD 3ZYYX 4HROA 1WRIA 1L5PA 4JX1C 1A70A 3LB8C 2LEKA 3ETRA 3P4SB 1QOBA 1FXIA 1JRPA 3AE2B 4YT0B 1JALA 1V8CA 4ZHOA 1NYQA 4WQMA 1ZOYB 2AX5A 1WWTA 5GXGB 3P4PB 4LTUA 4C7YA 1QF6A 2WQYB 3AECB 1FFUA 2G1EA 5G5HA 1QLBB 1J7CA 1KRHA 2CJNA 3NVZA 1L6UA 1JROA 4JWSC 4YTPB 1TYGB 2WU2B 3BIID 4JWUC 1RYJA 4N58A 2CU3A 2WP9B 1RM6C 2M56B 1FRRA 1QOGA 2BT6A 1WYGA 2MJDA 2H88B 2WLBA 3NVVA 3SFEB 1N61A 4US8A 1AYFA 1QOAA 2B76B 3AH7A 4FXCA 2WDRB 1PUTA 2WS3B 1FXAA 1TKEA 4YTNB 3VRAB 4ZHPA 3FAHA 2BS4B 3AV8A 3RPFC 3W5UB 1FO4A 4USAA 3WCQA 4N6EB 3EUB2 1J7AA 3AEEB 1SIJA 1ZUD2 3AE1B 5C2TB 1JWBD 2K9XA 2CJOA 3DWMA 1DGJA 2E3TA 2MJEA 2W3RA 2DBYA 1ROEA 1SF0A 1CZPA 2PVGC 3AE8B 3DWGC 1N5XA 1YJIA 1VLBA 2BS3B 1V97A 3L4PA 1CJEA 1AWDA 2PVOD 1FIQA 1XLOA 3B9JA 3W5VB 1JQ4A 3P1MA 1TKYA 2L52A 4N59A 2L83A 1XO3A 3NVWA 3KWLA 1I7HA 1XLQA
chains in the Genus database with same CATH superfamily
3QQ8B 5LNK1 4II3B 2I1KA 1NENB 1EWYC 2MH7A 1WGKA 2W82A 3OAWA 4RGOS 4XC2A 2GRIA 4WQOB 2DYMA 3KUDB 3AE5B 1JWAD 4XX5A 4YSZB 1OEYA 4HVBA 4GN1A 3PHWB 3Q3OC 2HTME 3AMZA 2DX5B 3QCAA 1IGCA 5JHAA 2WXIA 1CQVA 2FAZA 4KZ0A 2LRWA 2DNFA 2LVOA 4O1NA 3PTFC 2M0AA 4J6IA 2JRIB 3NZSA 2C9WB 1WGYA 1SSNA 2VRRB 2G4DB 4BOZB 4K7WA 1FCLA 1Q10A 4ANWA 3PRMB 1LXDA 2RPQA 1SE9A 3P4SB 5CHVC 2N9PC 1JRPA 3EHVA 1SBBB 3M62B 4PS3A 1WWTA 2IBIB 2CS4A 4LJPB 2CHXA 3NZUA 2CJNA 1I4HA 3GZNB 1TYGB 2WXMA 1L4ZB 4XZ4A 1AARA 2ONQA 5DPRA 5AEKB 3BYTB 1IGDA 3BVZA 3MC0B 2NVUI 4I6LB 2C7HA 3DCGA 2BS4B 3HHMA 2BYVE 1ZUD2 4AP4C 3UI3A 1V9JA 1SF0A 3AE8B 4RH6A 4TKNA 2D5GA 2KT7A 3VUXA 2M8SA 3RNEC 1TZOA 1Q1OA 4DDGD 1K52A 5DPSA 3FILB 1I4RA 1D5XC 1WM3A 2J0JA 1WRDB 1JWMD 4URKA 4GB9A 3UQAA 2NMQA 2Z0EB 3KYCD 3VR9B 4HK2A 3ALBA 3GE3C 2DAFA 4TSSA 2O6VD 1H8CA 2BYEA 1GG3A 3UF8A 4W9HA 2RPVA 5IP4D 1C4CA 1P3QU 2DWQA 4AS1A 4HPMB 3H7PB 3PRPB 2KDFB 1U4AA 4FJVB 1UWMA 4WAFA 2XBBC 3QC8B 3X0WA 3R2TA 1GOZA 3BINA 4P7IA 4XWTA 5EE1A 2UYZB 1B9RA 2KK8A 3QJZA 4EZJA 2LI5A 1PQSA 1UH6A 2RR9A 3AE4B 3VTWA 2JF5A 2FE8A 1YQ4B 1FMAD 4UDUC 2LGIA 1FEHA 2G4SA 5D2MB 1C9FA 2JWUA 2N9XA 2JXTA 1E8WA 2IDYA 1WJUA 1WX9A 5JHBA 2DZJA 3SFEB 2WLBA 2D11A 2N1WA 5KHQA 2ZCCA 2D10A 4TQ0A 1GNUA 5J18A 4KDIC 3W5UB 2IO3B 2KTFA 1FCCC 2CJOA 2WX1A 1UF0A 2AL6A 2LRUA 2DZKA 3BVGA 1WH3A 3H1UA 2QC8A 5AZGA 3JYUA 1EO6A 1CK1A 3NVWA 5BO4B 5E6JA 2KC2A 2KXJA 3SDLC 5EE9A 2IY1B 3Q3JA 4E3CA 1SJHD 3GS2A 3IT4B 3L16A 4I6NB 1FNUA 3JW0X 3RULA 3V3XA 1HZ6A 1VZ8A 1MVKA 2R2QA 4JL9A 2I2YA 3L54A 1MHHE 4DQOC 2KACA 2WDQB 3HRDD 4MGKE 3VHTC 1JW9D 1HTOA 5FKAC 3PRZA 2RGFA 2N0SB 2IY0B 3AE6B 2KVZA 3BK2A 1YIWA 4C4VA 4HPLB 3ZW3A 1P1AA 3O13A 2Y5CA 3VQIA 2LVQA 5C3JB 2GBNA 4ICUA 4ZRKA 4IC7B 1WE6A 1Z5SB 4JX1C 4RFBA 2AQ2B 2L0TA 2AL3A 2C60A 2KDIA 1WY8A 2MBQA 3U4EG 2JXXA 5GXGB 2AX5A 1UWXA 4JWSC 5FR6A 2K6DB 3RYTA 4DBGA 2WXPA 4H2AA 3U52E 2IZVB 1WYGA 3NVVA 4REZA 3W2DA 4US8A 1P7FA 4LNKA 4NY0A 1TKEA 2QHOA 3A33B 2D2QA 4W9CA 4N6EB 4WJOA 1SIJA 4KIKB 5C2TB 3SHQA 4B6WA 1JMLA 1ET9A 2FUHB 1N5XA 3NHEB 3U7DA 3ZLZA 4NAWA 2M19A 2KTRB 1UD7A 4HKQA 2C7NB 4RGTA 2KLCA 3DBHI 3AULA 3OJ3A 4BBNF 1R4NI 2FIFA 2KJ6A 3ZDMC 4ZRQA 2GBJA 4NPNA 3U8ZA 1AW7A 2KTRA 2BKRB 1R4MI 1TY2A 3OG5A 4AWJA 3E9SA 3R7RA 1VJKA 1UBIA 1E8XA 1TKGA 1V6EA 5EE0A 1E0ZA 3Q3NC 1WMHB 1RFKA 1L4DB 1GJZA 2BS2B 5G5GA 4NZLB 3PGEA 1HA5A 4NNJB 2LVPA 4RMAA 1WXMA 4CO7A 1NBFC 2B3AA 5DCNA 5EDSA 1LM8B 3UGBB 2M0XA 4M01A 1KOTA 1C77A 2JZPA 3ZTDA 1FPYA 1OQRA 2J53A 1J19A 3PZ7A 2WXFA 1XT9B 4C56C 4JQWC 4P1CC 1FXIA 2BVCA 2OOBB 2M1MA 2BWES 2ASQA 2WXNA 1QOGA 2H88B 2K8BA 2PEAA 2QEJC 3L17A 3V61A 1VRAB 1E8YA 4ANVA 4MM3B 4EEWA 4USAA 4HDQA 4WURA 1YD8U 2RSUA 2WXLA 4WH4A 3DWMA 4EZLA 3DWGC 1VLBA 4A3PA 4DDID 1CJEA 1FIQA 1XLOA 4C00A 4KKJA 1GPXA 3VUYA 1OQYA 4BFRA 3N20C 3AEAB 3DBLB 1BT0A 2RDGA 3EGRA 3RNGC 4LNOA 4WJPA 5HG2A 4HDOA 3LDZE 5FR3A 4IW0A 2V3NA 4KIKA 4MH8A 2L32A 2V4LA 4HCNB 3WIMA 1GB1A 2GBRA 4G3XB 2NBWB 3QWZB 1IYFA 1YN4A 1ZKHA 5AUIA 2E6XA 1YJJA 3AE3B 5JH5C 1ET6A 2KFJA 4OZAA 4K1RB 4MACA 3L0WB 4DWFA 3AEGB 1HQRD 1ZDVA 1PGBA 5AUKA 1WIAA 2NTSA 4NJ6A 2CKHB 3C19A 2N1VA 2BWFA 4HROA 1L5PA 2MRPA 2V3PA 3SEBA 1D3ZA 1V80A 2N7EA 3AECB 2V0GA 2GI9A 3MFGA 2O2VB 3M63B 2WHIA 4MGIE 1SE4A 2WU2B 3B08A 5HFYA 5BYQA 5C23A 3O65B 1E10A 1V1PB 3IG3A 5J17A 2KDMA 1PYWD 1TIFA 1KM7A 2Y5BB 5E6OA 2VZKB 4G0NB 3V60A 3TEYA 4FULA 1NI2A 1KLVA 1AWDA 1V1PA 3UIOB 1OTRB 3NG0A 1YQ3B 3ZRCA 4B0MA 1NEKB 1UELA 2LHDA 1WI0A 2BPSA 3SD5A 1XXGA 1N62A 1TS5A 3T8MA 4FJZA 1L7YA 1EWCA 3M95A 2DZMA 2KO3A 3JVZX 3WANA 2K8HA 3MHSD 2K22A 3U30A 3RT3B 2BKFA 1M4VA 2R2OA 1UUPA 2JX5A 2IO2B 1SE3A 5I4DA 3NS1A 1J0GA 2MBHA 1VCBA 3V62A 4MSQB 1Q5WB 3IHPC 2WYQA 1WXQA 3IAS1 3DVGX 1R7SA 1YX6B 2VH1A 2KKCA 5AZHA 3RNBC 1WXAA 1WX8A 4IWQA 3E56A 1E9MA 1P7EA 4RF1A 4HLEA 2PE6B 3RNAC 2LWPA 3A4SC 1C78A 1UNSA 2FCQA 1NYQA 4DHJB 3P4PB 2BF8B 2L1AA 4L1BA 2FUG1 2EMSA 4LCDE 4A55A 4BVUC 2B76B 1ZPSA 3ML8A 3PPAA 3KYDD 2KHWB 1DGJA 2WXOA 2NR2A 3ZTCA 3ZIMA 1V1OA 1V5OA 1V97A 5AZFA 2LGSA 4WJNA 4B0EA 2KYWA 3JSVA 1QKZA 1K53A 1XO3A 4L23A 3T3NA 2DENB 4BBNC 4S0RA 3NVYA 4IWPA 4KKIA 4G11A 5L95C 1XLPA 1M94A 4PS8A 1Y8RC 2GB1A 3QHTA 4RGNA 4IM2A 2KZRA 3EC8A 2MQJA 3GP7A 4IG7B 2LFIA 2WU5B 5CHWA 3HVZA 5LXHA 2W9NA 1F9JA 2EKIA 3AM9A 4KSKC 3RCZA 2INNE 3ZUNA 1FNVA 1L0YB 5LXIB 3NRZA 2QDFA 1F52A 1E7UA 4DHZB 1TS2A 3WA0A 1EUVB 3VRBB 3QK0A 3N1ZC 2MBBB 4DHZE 2LJIA 2XNAC 2KAJA 1V81A 3P4RB 2ZW1A 2X38A 1J7BA 3ZYYX 1ZDXA 1F2RC 2YVCA 3ETRA 2QSDA 1C79A 1WXSA 4AJWA 4WQMA 1L0XB 1MI0A 2KWVB 3HIZA 2IJ0A 1I4QA 4FBJB 4OHJA 2AWTA 1VR9A 2L05A 2C5LC 5HKHA 3D32A 5HHDG 3BWUD 1AYFA 1WFYA 3Q8BA 2WDRB 1PUTA 2BGFA 3BZDB 2JSVX 2MBEA 4K7UA 4RCOA 1PGAA 1SJED 2DBYA 1QILA 2HTHA 3RMKC 4RM8A 2MEKA 5TR5A 3SU8X 3ECIA 3Q14C 2WDTB 4XDCA 1FRDA 1P9DU 1T0QC 2IGHA 1F0ZA 3ZJUA 4AUQC 4ASWC 3Q8EA 4IUMB 3ABVB 2LD9A 4TQ1A 3DDCB 2LUEA 3MTNB 4KGRA 3U7ZA 2QJLA 1RWSA 3V6CB 5H92C 2JYEA 3TSSA 2K5PA 1DOIA 1YMHE 3BY4B 4AOFA 1T5XD 3WALA 4MGZE 4HPPA 1JWUD 1K50A 1S1QB 4ZOHC 1P0RA 3AEBB 2GBMA 4YXDB 2FIDA 1F2RI 2I38A 4LK0M 4N9F4 2X8XX 3P4QB 5E6PA 3AEFB 3DBLI 2Z8LA 4C80A 1VZ7A 4LDTB 3MJ5A 2MJ3A 2FCNA 1ISNA 4W9EA 2D07B 1I42A 3M3JA 4DXAB 3N9YC 5IAAC 2G45B 4X57B 1SE2A 5IKCM 1D6EC 2EKEC 3JSVB 3TEZA 4NAWB 4K3BA 1J7CA 4AJYB 2LXCA 1WZ0A 3KLSX 1XCQL 1LGRA 2V4IB 3BIID 2WP9B 3GZNI 2MJDA 1QOAA 4W9FA 3OWEB 1J8CA 4EFOA 5LLIA 2LGYA 1JCKB 4KDLB 1FO4A 3TEWA 3VAWA 3DPDA 3R3MA 2ZEQA 3AE1B 4M8MA 1WJNA 2PVGC 1JRUA 2O6VA 2D3GA 2BS3B 1XF5L 1HZ5A 1UZXB 3L13A 1XLQA 4KGTA 3VH4B 1C4AA 4BAXA 2EMTA 2JZ3B 3SFDB 4K7SA 1WGHA 4RNAA 1L0VB 1PDXA 1FM0D 1F1HA 1RAXA 2LUMA 4FA6A 5HI1A 2FCMA 2H89B 2DAJA 1WGGA 2R61A 3AN1A 2FBWB 4JLCA 1QOFA 1YJ1A 4US9A 4MH0E 2I1JA 2KANA 4RGMA 3LJ3A 1NYRA 3APFA 1QQRA 4XYCA 3IBEA 2MWSB 2QIEB 4GDKB 4TUUA 1K51A 2XEWA 5C1ZA 2HJ8A 1IBXA 2V1YA 4M02A 3T3OA 2KQ7A 3S2AA 1VDVA 3OLMD 1IUEA 3PT2B 3N30A 3OJ4B 3K9PB 4NQKE 3LB8C 2LEKA 1UGMA 3AE2B 4C4VB 4YT0B 4GLSC 4IM0A 3I3TB 3ZNID 1QLBB 1JROA 3HM6X 2RDBC 3ONSA 2CR5A 1FRRA 3QA8A 3H7SA 2YEPF 4ICVA 4HCPB 1S3SG 3TBLD 4FXCA 2G3QB 3P2BA 2J7QB 3FAHA 1LO5D 1WSPA 3EUB2 2G9HD 3PLVA 2K9XA 1MFWA 3ZVVA 2MJEA 2W3RA 1FNWA 1CZPA 1Z2MA 1BMLC 2QCZA 1R4NB 2Y3AA 5CX3A 1WR6E 1SXTA 2AQ3B 2PVOD 3TIXA 3W5VB 3CF6E 3A4RA 2J52A 3H7PA 2AQ1B 3ML9A 1STEA 1ZGUB 2GLSA 4GOCA 4IWOA 1WGDA 1E7VA 3A1QB 3LXFA 4R3DA 2MBOA 2JRHA 3PZDA 2REXA 3TMPB 2LGDA 4W9DA 2JU6X 4II2B 4YTMB 3CSFA 1I4XA 2OHFA 2LZ6A 4XWWA 2VH2A 4IOIE 1ZP0B 1KLUD 3IT6B 2M4NA 2UWQA 4WIPA 2KQSA 3PHXB 3T9LA 3A1QA 1UGJA 4ZYNA 3WAMA 5BYRA 5EE3A 1WXVA 3BVMA 1DYQA 1I4PA 3B0AA 1TJEA 5CHFA 1WR1A 3A9JA 1FFVA 5G55A 3H6NA 4MGYE 2LGXA 1T6BX 4EOYA 1N60A 4BKSD 2RMMA 2HJ1A 3VFKA 4KX6B 4W9LA 1C4PA 2ZVOA 4HWIB 4XE0A 1LQBA 3UQBA 4J3OD 4TV3A 2JPHA 1TY0A 2J42A 2TSSA 1QZEA 2J0MA 1XEEA 1RYJA 2M56B 1ZXHA 2BT6A 1NDDA 4GSWA 2HDEA 1IBXB 2HE7A 3I5JC 1FXTB 3NJTA 3I9V1 1ENFA 3ZJTA 3V6EB 2ZCBA 4ARCA 4WWPA 2L0FA 3HVDA 2A5UA 2JUOA 3MJWA 4XGAB 1XCTL 3BK1A 4FHJA 4PT5A 5IN7A 2NS5A 4WWNA 3U2SC 2UU7A 1L2NA 3FKYA 2Z0DB 2WXGA 2N9EB 1FD6A 3PVLA 4GIVA 4JIOU 4HJKA 4MT5A 2D3AA 1KTKA 2W3SA 1C76A 1WF9A 4GDKA 2INDC 4OVZA 1BUIC 4QAYA 2JQRB 2K6QA 4TMAB 2FCSA 4C7ZA 3EA6A 2NPTB 3A9KB 4ANXA 1ZXIA 1MPEA 4EUTA 1ZE3D 3DQVA 3C0RB 3ZRFA 4KSLC 2KMCA 4FLHA 2WDVB 2KLGA 3GB1A 2N9LA 3K9OB 1I35A 1ESFA 2KC1A 3AE9B 4HRSA 3TEXA 4BKGA 1EF5A 4NJ7A 5D7GA 2KMAA 1EU4A 4RM9A 3ZXVA 2J4XA 3N1XC 3FC4A 3ENEA 3MP9A 3RFZB 3VR8B 2ZVNA 1OEYJ 1WRIA 2MA9B 3RNFC 1GC7A 2KN4A 3X23A 1QOBA 2L8JA 4CHKA 3KW5B 4ZRPA 2BB5A 4JGHB 5JZEB 4L2YA 4S17A 1MJDA 4JWUC 1RM6C 4EKUA 2KN5A 3PLUA 3VTVA 5DPWA 4JPSA 3TUOA 3WCQA 3KVFB 2K25A 3GOEA 3VDZA 5CTRC 1ROEA 2GBKA 3L4PA 2BW2A 4K81A 3J9CA 4GGQA 2MCNB 4MELA 2NBUA 4JE3B 2L83A 1I7HA 3Q3MC 3RUIB 3IXSA 3UIPB 4OVUA 4MEMA 2LJ5A 2XK5A 2KMMA 3AU5A 2WNMA 2KDBA 3PZ8A 4RF0A 2ZNVC 3H9DA 1X1MA 4GMVA 2SEBD 4IKGA 1WJ4A 3IAM1 4I6PA 4CYEA 4OZBA 5BMGA 4LTUA 3UINB 3GE8C 4KV2A 2DLBA 1D5ZC 4A8XC 4KGSA 4MJSA 1G6JA 3RNCC 4F7ZA 3DBHB 2KX0A 2KFKA 1WJ6A 5BYSA 1XLNA 2IPKD 1N5WA 1HXYD 3W1SA 1IPGA 2MW5A 1YOVB 2PW9A 1V86A 2QMTA 1R4MB 1OGWA 1MG4A 2NPTA 3P42A 5MPOA 3ZGZA 2NTTA 2GMIC 1NI3A 3CIRB 3WAPA 1KLGD 2KFKB 4K3CA 4LNIA 3PS6A 1WE7A 2K8CA 4OZCA 2KJHB 2KX3A 4LNFA 3ZNZB 4BKTA 2NCNA 5G5HA 1WGRA 1YN5A 3NVZA 2JYTA 2N7DA 1T0YA 4DXFA 2CU1A 2CHWA 3DVGY 1KH0A 1N6ZA 3AEEB 4PS7A 3HK0A 4YL8A 3DVNU 3N1YC 1IP9A 3DBRI 3Q6BA 2PLPA 2AYOB 3A9KA 1JQ4A 2HD5B 4GU2A 2K3UA 3ZNHB 3KWLA 2DYOA 4IDIA 2V3SA 1GC6A 1SIFA 3AE7B 4FJYA 3KUZA 2RD0A 2MSED 3VH3B 1LFDA 4DK5A 3KUCB 4WJQA 4G50A 2KQ4X 4A20A 2ZW0A 3DVNV 3LYYA 4NAMA 2NBVB 3P63A 2J0KA 4A9AA 4KVGB 4B95A 4FN2A 4YSYB 3VTUA 1KF6B 2L7RA 2O2VA 1WYWB 3AEDB 2Y5PA 2N4FA 3MHZA 1E8ZA 3RZFA 4ZRJA 2IGGA 4M8NA 4F8CB 2ZPYA 1V5TA 4LDTD 3IFWB 3NY5A 1DOXA 1TS3A 3VXWA 4FHKA 2IGDA 4HKZE 3APCA 3A9JB 4W9KA 4BOSC 2INCC 2A4ZA 2SAKA 2WQYB 2G1EA 1WX7A 4XDDA 2KWDA 5IA7A 2L76A 4OW0A 3R7QA 4DHJD 3QIJA 2DHZA 1VD2A 4N58A 4BZAA 1V49A 1TT5B 2JWZA 3W1YA 1N61A 1GB4A 2BYFA 1B1ZA 3Q2AC 1SEBD 2OJWA 1HE8A 2KDEB 4CQNA 4F1SA 3R66C 2Z59B 3V05A 3HM3A 3MC9A 4ZRIA 3KWVA 1KFYB 2K39A 4P16A 4PYZA 2KJRA 1D5MC 1D4BA 5FK9C 3W1SC 4WAAA 4ACFA 3HUIA 2WXJA 1H4RA 3NS8A 5G2NA 3I57A 4D2KA 2DYBA 4GDLB 1Y56A 1TBEA 3Q8CA 2Q5WD 1MG8A 4P6VF 1GUAB 3DHGC 3BYYB 1VZ6A 5D3IB 2WXRA 2PIAA 4GDLA 1OQQA 1T3QA 2PKOA 5JXVA 2WXKA 2LXAA 2ACZB 3B2GA 1DOYA 4PK1A 5KHOA 2PPHA 2PJHA 4W9JA 2LMCA 3CSTA 1A70A 2BBCA 1E5WA 2ZNVB 2BQQA 4ZHOA 4M00A 2N7JA 1QF6A 3APDA 3N32A 1FFUA 3VVWB 2ZJDA 3IVFA 1KRHA 1XQQA 4YTPB 2WGSA 5GMVA 3DHHC 1WM2A 4NJCA 3ZNGC 2BB6A 2AEHA 1PGXA 4ZHPA 3ZKJC 3NUHB 3RPFC 2OEDA 3QAQA 1J7AA 3H8HA 3MC8A 1JWBD 2PMVA 1YQBA 2E3TA 4Q2JA 2KD0A 1RLFA 1YJIA 3QARA 2MP2B 2INPE 3P1MA 2L52A 3KQ4A 5BMIA 1I4GA 2RDHA 5D6JB 3CMMB 2DZIA 2W54A 3PSEB 1YNTE 5D94A 2BTEA 2KWCA 2L00B 5BMHA 3R2IA 1TS4A 4ZYSA 1WZ3A 2D3BA 2PTLA 1E7PB 1OFFA 1SGHA 2MP2A 2WXHA 1C1YB 3SR6A 3RD2A 2JZZA 3ZDTA 4ARIA 1PFDA 4KZCA 1T0RC 2IO0B 1TGZB 2MX2A 3DBSA 2WWZA 3R8BA 2V9HA 5IOIA 2KWUB 4YSXB 2C7MB 1N63A 2XN9C 1E90A 2EELA 3ZQ4A 4WWOA 1UBQA 3RN9C 2YEPB 5D3DA 3KH0A 1T0SC 2L3ZA 3PV1A 3ZJVA 1E6EB 2N9KA 4LNNA 1MHXA 4MJSB 3W9CB 1SB3C 3Q8AA 3PO0A 1EF1A 4B9KA 4W9IA 4NQLB 1V2YA 3EFCA 1YX5B 1JALA 1V8CA 3ZO5B 1P98A 1ZOYB 4ANUA 3DBRB 5E6NA 1WMHA 1EM7A 4DXGA 1L6UA 1ZW7A 4IM3A 2ON8A 2CU3A 3DOWA 1YN3A 4YWGG 3ZXRA 3AH7A 3VUWA 1FXAA 4OVVA 1BXTA 4YTNB 4HEA1 3AV8A 3L10B 4HJGE 1TTNA 3QX1A 3PREA 2JY6A 2QILA 4A90A 4LLGM 1XD3B 4FADA 3TJPA 1ACCA 4A3OA 2D3CA 4N59A 4ZDVA 2KNBA 2FNJB 3CWIA 4LJOB 2WXQA 5J2RA 4E74A 1CMXB 3Q69A 1KJTA 1L6VA 2M17A 3AB5A 1AN8A 2K0PA 4MM3A 3AI5A 3EECA 3NOBA 5L83A 2W55A 2JVCA 4BKSA 4ITKA 4E71A 1K8RB 2BYTA 4P1BC 4MDKE 2JT4B 1RFAA 3DHIC 2OJRA 2MHJA 1RRBA 3Q8FA 5IO9A 1F77A 5T8IA 3L08A 2KVRA 5TSSA 3RZWC 3NZ3A 4WWMA 1NVID 1TZ1A 2MLBA 3RI7C 2PE9A 4AQ7A 5H8YE 1C3TA 1QT9A 4EZKA 1GAQB 1JWSD 2ZZPB 3AU4A 4A6QA 4HXDA 2LHEA 3Q3FA 3B2FA 3I63C 4M0WB 2ICIA 4EE2A 1Q0WB 1A5RA 5DPTA 2KOXA 2O6VB 2CHZA 2K1FA 3TCAA 3EFUA 4C7YA 4PYUA 2ZPNA 1EU3A 3FILA 3WAOA 4M0WA 1HEZE 2YLMA 4MSMB 2IO1B 2XK5B 4W9GA 3N3KB 2WS3B 2IYDB 3VRAB 3TL5A 3C8YA 3AXCA 1HTQA 2LASA 2WX0A 3URYA 2VZKD 3B9JA 2GOWA 3B1LX 1TKYA 4GXBA
chains in the Genus database with same CATH topology
4KGTA 4IDIA 5LNK1 1C4AA 1NENB 1EWYC 3SFDB 2MH7A 1WGKA 3AEAB 4RNAA 1L0VB 1PDXA 2RDGA 1FM0D 3EGRA 3AE7B 2W82A 5HG2A 4RGOS 2LUMA 5FR3A 5HI1A 2H89B 2V3NA 4MH8A 2GRIA 2DYMA 2L32A 2KQ4X 3AE5B 2R61A 1JWAD 2ZW0A 3LYYA 3AN1A 2FBWB 4YSZB 1QOFA 4NAMA 4US9A 3P63A 2HTME 3AMZA 1GB1A 1IGCA 4A9AA 1YN4A 4RGMA 2WXIA 1NYRA 1CQVA 5AUIA 4YSYB 2E6XA 1KF6B 1QQRA 1YJJA 3AE3B 2QIEB 3AEDB 2Y5PA 4O1NA 4GDKB 1ET6A 2M0AA 3MHZA 1K51A 4OZAA 2IGGA 4MACA 3AEGB 1HQRD 1ZDVA 1IBXA 1SSNA 1PGBA 5AUKA 3T3OA 2NTSA 1VDVA 1FCLA 1Q10A 1IUEA 1DOXA 1TS3A 4HROA 1L5PA 2V3PA 3SEBA 3LB8C 2LEKA 2IGDA 3P4SB 3AE2B 1JRPA 4HKZE 4YT0B 4GLSC 1SBBB 1WWTA 2SAKA 2WQYB 3AECB 2V0GA 2GI9A 2G1EA 3MFGA 4XDDA 1QLBB 2KWDA 2CJNA 1JROA 4OW0A 1I4HA 1SE4A 1TYGB 2WU2B 2WXMA 5HFYA 1L4ZB 4N58A 5BYQA 1E10A 1V1PB 1FRRA 2ONQA 3BYTB 1IGDA 2YEPF 1N61A 3BVZA 2KDMA 3MC0B 1GB4A 1PYWD 4FXCA 1B1ZA 3FAHA 2BS4B 1LO5D 1WSPA 3EUB2 1SEBD 2G9HD 1ZUD2 2K9XA 2VZKB 2MJEA 2W3RA 3UI3A 1FNWA 1SF0A 1CZPA 4CQNA 3AE8B 4RH6A 1BMLC 3TEYA 2D5GA 2Y3AA 1AWDA 1SXTA 1V1PA 2AQ3B 2PVOD 3W5VB 2J52A 3V05A 1TZOA 2AQ1B 3KWVA 1K52A 1KFYB 1STEA 3FILB 1YQ3B 1I4RA 4P16A 1D5XC 4B0MA 1NEKB 2LHDA 1D5MC 1XXGA 1JWMD 1N62A 1D4BA 5FK9C 1TS5A 2NMQA 3LXFA 4R3DA 3HUIA 2WXJA 3VR9B 1EWCA 4TSSA 3I57A 4YTMB 2JU6X 2K22A 4D2KA 1I4XA 2OHFA 4GDLB 4XWWA 1Y56A 2RPVA 4IOIE 1M4VA 3Q8CA 1ZP0B 1KLUD 1C4CA 2DWQA 1UUPA 4AS1A 2JX5A 2Q5WD 1SE3A 3IT6B 4WIPA 5I4DA 4P6VF 1UGJA 3NS1A 1UWMA 5BYRA 5EE3A 3BVMA 4WAFA 1DYQA 1I4PA 3BYYB 3R2TA 1VZ6A 5D3IB 1GOZA 2WXRA 1TJEA 2PIAA 4XWTA 5EE1A 1FFVA 1B9RA 1OQQA 1WXQA 1T3QA 3IAS1 2PKOA 1R7SA 1T6BX 1N60A 2RMMA 5JXVA 3E56A 2WXKA 3AE4B 1E9MA 1P7EA 4RF1A 2ACZB 2FE8A 3B2GA 1DOYA 4KX6B 1YQ4B 1C4PA 1FMAD 2LMCA 2LGIA 1FEHA 4UDUC 4XE0A 1C78A 1A70A 1UNSA 2BBCA 1C9FA 2JWUA 4J3OD 4ZHOA 2JXTA 1NYQA 2N7JA 1QF6A 3P4PB 2IDYA 1TY0A 2J42A 1FFUA 2TSSA 2L1AA 1KRHA 4L1BA 4YTPB 2FUG1 1XEEA 1RYJA 4A55A 2M56B 4NJCA 1ZXHA 2BT6A 2WLBA 3SFEB 2HDEA 2B76B 1IBXB 2BB6A 4TQ0A 1ZPSA 1PGXA 4ZHPA 3I9V1 3NUHB 1ENFA 3ZJTA 3RPFC 3W5UB 4ARCA 2OEDA 1J7AA 3H8HA 3HVDA 1FCCC 1JWBD 2PMVA 2CJOA 1DGJA 2E3TA 2WXOA 4Q2JA 1XCTL 1V1OA 1YJIA 1V97A 3BK1A 3BVGA 4PT5A 2INPE 3P1MA 4B0EA 3U2SC 2L52A 1CK1A 1XO3A 1QKZA 1K53A 2WXGA 3KQ4A 3NVWA 1I4GA 2RDHA 4L23A 5E6JA 5BMIA 3T3NA 5EE9A 2W54A 1YNTE 2BTEA 1FD6A 3NVYA 5BMHA 3R2IA 1TS4A 4KKIA 4MT5A 4ZYSA 1XLPA 1KTKA 1SJHD 2W3SA 1C76A 3GS2A 3IT4B 2GB1A 1E7PB 2PTLA 1FNUA 4OVZA 1OFFA 4RGNA 1BUIC 2WXHA 2JQRB 3V3XA 1HZ6A 3GP7A 4TMAB 4C7ZA 1VZ8A 2LFIA 2WU5B 3EA6A 3SR6A 1MVKA 3HVZA 4ARIA 1PFDA 2I2YA 1ZXIA 1MHHE 4DQOC 2KACA 2EKIA 1MPEA 3AM9A 3R8BA 2WDQB 1ZE3D 3HRDD 2INNE 4YSXB 1FNVA 1L0YB 1JW9D 5FKAC 1N63A 2WDVB 2XN9C 2N0SB 3AE6B 2EELA 3ZQ4A 3NRZA 3GB1A 2N9LA 1TS2A 3BK2A 1ESFA 3AE9B 4HRSA 2YEPB 5D3DA 3TEXA 5D7GA 3O13A 2Y5CA 3VRBB 1EU4A 3VQIA 2J4XA 3FC4A 5C3JB 3ZJVA 1E6EB 2LJIA 2N9KA 2XNAC 1MHXA 2KAJA 3MP9A 3W9CB 3RFZB 1SB3C 3Q8AA 3PO0A 3P4RB 3VR8B 2ZW1A 2X38A 1J7BA 3ZYYX 1ZDXA 1WRIA 4JX1C 1F2RC 4RFBA 2KN4A 2AQ2B 3ETRA 1QOBA 2QSDA 3U4EG 1C79A 1JALA 1V8CA 4WQMA 5GXGB 1L0XB 1MI0A 1ZOYB 2AX5A 4ZRPA 2BB5A 2IJ0A 1I4QA 4OHJA 1UWXA 1VR9A 4L2YA 1EM7A 4DXGA 1L6UA 4JWSC 2ON8A 4JWUC 2WXPA 4H2AA 3U52E 2CU3A 1RM6C 1WYGA 3NVVA 5HHDG 4REZA 3BWUD 3W2DA 1YN3A 4US8A 1AYFA 1P7FA 4YWGG 3Q8BA 4JPSA 3AH7A 2WDRB 1PUTA 3TUOA 3BZDB 1FXAA 1TKEA 1BXTA 4YTNB 4HEA1 3AV8A 2JSVX 3WCQA 4N6EB 4RCOA 4HJGE 1PGAA 1SIJA 5C2TB 1SJED 2DBYA 1JMLA 1ROEA 1ET9A 2QILA 1N5XA 1QILA 3L4PA 2BW2A 4A90A 4LLGM 3J9CA 1ACCA 4JE3B 4N59A 2L83A 1I7HA 3CWIA 2WXQA 2M19A 3IXSA 3Q69A 2MEKA 1L6VA 4HKQA 3AB5A 1AN8A 4RGTA 2K0PA 2KMMA 4XDCA 1FRDA 2IGHA 1GPXA 1F0ZA 2W55A 3ZJUA 2WNMA 4ITKA 2BYTA 3PZ8A 4RF0A 3Q8EA 3ABVB 4ZRQA 2SEBD 4TQ1A 4IKGA 3Q8FA 3IAM1 1F77A 1AW7A 5T8IA 4OZBA 4KGRA 5BMGA 3U7ZA 4LTUA 2QJLA 1RWSA 1TY2A 5H92C 2DLBA 2JYEA 5TSSA 1D5ZC 3NZ3A 4WWMA 4A8XC 3TSSA 3E9SA 4KGSA 2K5PA 1DOIA 1NVID 1VJKA 1YMHE 4AQ7A 1T5XD 1TKGA 5H8YE 1QT9A 5EE0A 1JWUD 1E0ZA 1K50A 4ZOHC 1RFKA 5BYSA 1L4DB 1XLNA 1GAQB 1JWSD 3AEBB 4YXDB 2BS2B 5G5GA 2IPKD 1N5WA 4NZLB 1F2RI 1HXYD 1HA5A 2I38A 3W1SA 4LK0M 2PW9A 4A6QA 2LHEA 3P4QB 2QMTA 3AEFB 3P42A 3B2FA 2Z8LA 4C80A 5MPOA 3ZGZA 1C77A 2ICIA 2JZPA 2NTTA 4EE2A 1NI3A 1VZ7A 2J53A 1OQRA 3CIRB 3MJ5A 1KLGD 2MJ3A 3PZ7A 2WXFA 4C56C 1FXIA 3N9YC 4OZCA 4C7YA 1SE2A 1D6EC 3TEZA 5G5HA 4NAWB 1J7CA 1YN5A 2WXNA 1EU3A 3NVZA 2JYTA 3FILA 3KLSX 1XCQL 2V4IB 3BIID 4M0WA 2WP9B 1HEZE 1QOGA 2MJDA 2H88B 4DXFA 2QEJC 1VRAB 1QOAA 3OWEB 4MM3B 2WS3B 3VRAB 1JCKB 1KH0A 1FO4A 3TEWA 4USAA 3AEEB 4WURA 2WXLA 3AE1B 4WH4A 3DWMA 3C8YA 3DWGC 2PVGC 1VLBA 2BS3B 2PLPA 3URYA 1CJEA 2VZKD 1FIQA 1XLOA 3B9JA 1JQ4A 2K3UA 1XF5L 1TKYA 1HZ5A 3KWLA 4KKJA 2DYOA 1XLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  1KFY B;  3CWI A;  1YQ3 B;  5EE9 A;  2W54 A;  2M19 A;  1NEN B;  1NEK B;  1EWY C;  3NVY A;  3SFD B;  2MH7 A;  1WGK A;  1L6V A;  3AEA B;  3AN1 A;  3AB5 A;  1N62 A;  1XLP A;  1L0V B;  1PDX A;  2W3S A;  1FM0 D;  2KMM A;  1FRD A;  3AE7 B;  3LXF A;  1GPX A;  1F0Z A;  3HUI A;  1E7P B;  2W55 A;  3VR9 B;  1OFF A;  4ITK A;  2H89 B;  2JQR B;  4YTM B;  4C7Z A;  2K22 A;  2WU5 B;  3SR6 A;  3ABV B;  3AE5 B;  2OHF A;  1JWA D;  3HVZ A;  1PFD A;  1ZXI A;  1ZP0 B;  2EKI A;  1RWS A;  2FBW B;  2QJL A;  2DWQ A;  1QOF A;  3AM9 A;  2JX5 A;  2Q5W D;  4US9 A;  5H92 C;  3P63 A;  2WDQ B;  2HTM E;  3AMZ A;  4WWM A;  3HRD D;  4YSX B;  2K5P A;  1DOI A;  1NVI D;  1VJK A;  1UWM A;  1JW9 D;  3NS1 A;  4P6V F;  4A9A A;  4YSZ B;  5EE3 A;  1N63 A;  2WDV B;  1NYR A;  2N0S B;  5H8Y E;  1TKG A;  3AE6 B;  1QT9 A;  4YSY B;  3NRZ A;  5AUI A;  5EE0 A;  1E10 A;  1KF6 B;  1YJJ A;  1E0Z A;  1TJE A;  3AE3 B;  4ZOH C;  1RFK A;  2QIE B;  3AED B;  3AE9 B;  1XLN A;  4HRS A;  1GAQ B;  2PIA A;  3AEB B;  4YXD B;  2BS2 B;  5G5G A;  5EE1 A;  1N5W A;  1FFV A;  1B9R A;  1OQQ A;  2Y5C A;  3VRB B;  1WXQ A;  1T3Q A;  2PKO A;  3AEG B;  1R7S A;  1N60 A;  3FC4 A;  3P4Q B;  5C3J B;  3AEF B;  1E6E B;  3AE4 B;  1E9M A;  3B2F A;  5AUK A;  4C80 A;  2KAJ A;  3W9C B;  5MPO A;  1VDV A;  2ACZ B;  3B2G A;  1DOY A;  1SB3 C;  3PO0 A;  1NI3 A;  3CIR B;  4KX6 B;  1OQR A;  1IUE A;  3P4R B;  3VR8 B;  2MJ3 A;  1DOX A;  1J7B A;  1YQ4 B;  1FMA D;  3ZYY X;  4HRO A;  1WRI A;  1L5P A;  4JX1 C;  1A70 A;  3LB8 C;  2LEK A;  3ETR A;  3P4S B;  1QOB A;  1FXI A;  1JRP A;  3AE2 B;  4YT0 B;  1JAL A;  1V8C A;  4ZHO A;  1NYQ A;  4WQM A;  1ZOY B;  2AX5 A;  1WWT A;  5GXG B;  3P4P B;  4LTU A;  4C7Y A;  1QF6 A;  2WQY B;  3AEC B;  1FFU A;  2G1E A;  5G5H A;  1QLB B;  1J7C A;  1KRH A;  2CJN A;  3NVZ A;  1L6U A;  1JRO A;  4JWS C;  4YTP B;  1TYG B;  2WU2 B;  3BII D;  4JWU C;  1RYJ A;  4N58 A;  2CU3 A;  2WP9 B;  1RM6 C;  2M56 B;  1FRR A;  1QOG A;  2BT6 A;  1WYG A;  2MJD A;  2H88 B;  2WLB A;  3NVV A;  3SFE B;  1N61 A;  4US8 A;  1AYF A;  1QOA A;  2B76 B;  3AH7 A;  4FXC A;  2WDR B;  1PUT A;  2WS3 B;  1FXA A;  1TKE A;  4YTN B;  3VRA B;  4ZHP A;  3FAH A;  2BS4 B;  3AV8 A;  3RPF C;  3W5U B;  1FO4 A;  4USA A;  3WCQ A;  4N6E B;  3EUB 2;  1J7A A;  3AEE B;  1SIJ A;  1ZUD 2;  3AE1 B;  5C2T B;  1JWB D;  2K9X A;  2CJO A;  3DWM A;  1DGJ A;  2E3T A;  2MJE A;  2W3R A;  2DBY A;  1ROE A;  1SF0 A;  1CZP A;  2PVG C;  3AE8 B;  3DWG C;  1N5X A;  1YJI A;  1VLB A;  2BS3 B;  1V97 A;  3L4P A;  1CJE A;  1AWD A;  2PVO D;  1FIQ A;  1XLO A;  3B9J A;  3W5V B;  1JQ4 A;  3P1M A;  1TKY A;  2L52 A;  4N59 A;  2L83 A;  1XO3 A;  3NVW A;  3KWL A;  1I7H A;  1XLQ A; 
#chains in the Genus database with same CATH topology
 3QQ8 B;  5LNK 1;  4II3 B;  2I1K A;  1NEN B;  1EWY C;  2MH7 A;  1WGK A;  2W82 A;  3OAW A;  4RGO S;  4XC2 A;  2GRI A;  4WQO B;  2DYM A;  3KUD B;  3AE5 B;  1JWA D;  4XX5 A;  4YSZ B;  1OEY A;  4HVB A;  4GN1 A;  3PHW B;  3Q3O C;  2HTM E;  3AMZ A;  2DX5 B;  3QCA A;  1IGC A;  5JHA A;  2WXI A;  1CQV A;  2FAZ A;  4KZ0 A;  2LRW A;  2DNF A;  2LVO A;  4O1N A;  3PTF C;  2M0A A;  4J6I A;  2JRI B;  3NZS A;  2C9W B;  1WGY A;  1SSN A;  2VRR B;  2G4D B;  4BOZ B;  4K7W A;  1FCL A;  1Q10 A;  4ANW A;  3PRM B;  1LXD A;  2RPQ A;  1SE9 A;  3P4S B;  5CHV C;  2N9P C;  1JRP A;  3EHV A;  1SBB B;  3M62 B;  4PS3 A;  1WWT A;  2IBI B;  2CS4 A;  4LJP B;  2CHX A;  3NZU A;  2CJN A;  1I4H A;  3GZN B;  1TYG B;  2WXM A;  1L4Z B;  4XZ4 A;  1AAR A;  2ONQ A;  5DPR A;  5AEK B;  3BYT B;  1IGD A;  3BVZ A;  3MC0 B;  2NVU I;  4I6L B;  2C7H A;  3DCG A;  2BS4 B;  3HHM A;  2BYV E;  1ZUD 2;  4AP4 C;  3UI3 A;  1V9J A;  1SF0 A;  3AE8 B;  4RH6 A;  4TKN A;  2D5G A;  2KT7 A;  3VUX A;  2M8S A;  3RNE C;  1TZO A;  1Q1O A;  4DDG D;  1K52 A;  5DPS A;  3FIL B;  1I4R A;  1D5X C;  1WM3 A;  2J0J A;  1WRD B;  1JWM D;  4URK A;  4GB9 A;  3UQA A;  2NMQ A;  2Z0E B;  3KYC D;  3VR9 B;  4HK2 A;  3ALB A;  3GE3 C;  2DAF A;  4TSS A;  2O6V D;  1H8C A;  2BYE A;  1GG3 A;  3UF8 A;  4W9H A;  2RPV A;  5IP4 D;  1C4C A;  1P3Q U;  2DWQ A;  4AS1 A;  4HPM B;  3H7P B;  3PRP B;  2KDF B;  1U4A A;  4FJV B;  1UWM A;  4WAF A;  2XBB C;  3QC8 B;  3X0W A;  3R2T A;  1GOZ A;  3BIN A;  4P7I A;  4XWT A;  5EE1 A;  2UYZ B;  1B9R A;  2KK8 A;  3QJZ A;  4EZJ A;  2LI5 A;  1PQS A;  1UH6 A;  2RR9 A;  3AE4 B;  3VTW A;  2JF5 A;  2FE8 A;  1YQ4 B;  1FMA D;  4UDU C;  2LGI A;  1FEH A;  2G4S A;  5D2M B;  1C9F A;  2JWU A;  2N9X A;  2JXT A;  1E8W A;  2IDY A;  1WJU A;  1WX9 A;  5JHB A;  2DZJ A;  3SFE B;  2WLB A;  2D11 A;  2N1W A;  5KHQ A;  2ZCC A;  2D10 A;  4TQ0 A;  1GNU A;  5J18 A;  4KDI C;  3W5U B;  2IO3 B;  2KTF A;  1FCC C;  2CJO A;  2WX1 A;  1UF0 A;  2AL6 A;  2LRU A;  2DZK A;  3BVG A;  1WH3 A;  3H1U A;  2QC8 A;  5AZG A;  3JYU A;  1EO6 A;  1CK1 A;  3NVW A;  5BO4 B;  5E6J A;  2KC2 A;  2KXJ A;  3SDL C;  5EE9 A;  2IY1 B;  3Q3J A;  4E3C A;  1SJH D;  3GS2 A;  3IT4 B;  3L16 A;  4I6N B;  1FNU A;  3JW0 X;  3RUL A;  3V3X A;  1HZ6 A;  1VZ8 A;  1MVK A;  2R2Q A;  4JL9 A;  2I2Y A;  3L54 A;  1MHH E;  4DQO C;  2KAC A;  2WDQ B;  3HRD D;  4MGK E;  3VHT C;  1JW9 D;  1HTO A;  5FKA C;  3PRZ A;  2RGF A;  2N0S B;  2IY0 B;  3AE6 B;  2KVZ A;  3BK2 A;  1YIW A;  4C4V A;  4HPL B;  3ZW3 A;  1P1A A;  3O13 A;  2Y5C A;  3VQI A;  2LVQ A;  5C3J B;  2GBN A;  4ICU A;  4ZRK A;  4IC7 B;  1WE6 A;  1Z5S B;  4JX1 C;  4RFB A;  2AQ2 B;  2L0T A;  2AL3 A;  2C60 A;  2KDI A;  1WY8 A;  2MBQ A;  3U4E G;  2JXX A;  5GXG B;  2AX5 A;  1UWX A;  4JWS C;  5FR6 A;  2K6D B;  3RYT A;  4DBG A;  2WXP A;  4H2A A;  3U52 E;  2IZV B;  1WYG A;  3NVV A;  4REZ A;  3W2D A;  4US8 A;  1P7F A;  4LNK A;  4NY0 A;  1TKE A;  2QHO A;  3A33 B;  2D2Q A;  4W9C A;  4N6E B;  4WJO A;  1SIJ A;  4KIK B;  5C2T B;  3SHQ A;  4B6W A;  1JML A;  1ET9 A;  2FUH B;  1N5X A;  3NHE B;  3U7D A;  3ZLZ A;  4NAW A;  2M19 A;  2KTR B;  1UD7 A;  4HKQ A;  2C7N B;  4RGT A;  2KLC A;  3DBH I;  3AUL A;  3OJ3 A;  4BBN F;  1R4N I;  2FIF A;  2KJ6 A;  3ZDM C;  4ZRQ A;  2GBJ A;  4NPN A;  3U8Z A;  1AW7 A;  2KTR A;  2BKR B;  1R4M I;  1TY2 A;  3OG5 A;  4AWJ A;  3E9S A;  3R7R A;  1VJK A;  1UBI A;  1E8X A;  1TKG A;  1V6E A;  5EE0 A;  1E0Z A;  3Q3N C;  1WMH B;  1RFK A;  1L4D B;  1GJZ A;  2BS2 B;  5G5G A;  4NZL B;  3PGE A;  1HA5 A;  4NNJ B;  2LVP A;  4RMA A;  1WXM A;  4CO7 A;  1NBF C;  2B3A A;  5DCN A;  5EDS A;  1LM8 B;  3UGB B;  2M0X A;  4M01 A;  1KOT A;  1C77 A;  2JZP A;  3ZTD A;  1FPY A;  1OQR A;  2J53 A;  1J19 A;  3PZ7 A;  2WXF A;  1XT9 B;  4C56 C;  4JQW C;  4P1C C;  1FXI A;  2BVC A;  2OOB B;  2M1M A;  2BWE S;  2ASQ A;  2WXN A;  1QOG A;  2H88 B;  2K8B A;  2PEA A;  2QEJ C;  3L17 A;  3V61 A;  1VRA B;  1E8Y A;  4ANV A;  4MM3 B;  4EEW A;  4USA A;  4HDQ A;  4WUR A;  1YD8 U;  2RSU A;  2WXL A;  4WH4 A;  3DWM A;  4EZL A;  3DWG C;  1VLB A;  4A3P A;  4DDI D;  1CJE A;  1FIQ A;  1XLO A;  4C00 A;  4KKJ A;  1GPX A;  3VUY A;  1OQY A;  4BFR A;  3N20 C;  3AEA B;  3DBL B;  1BT0 A;  2RDG A;  3EGR A;  3RNG C;  4LNO A;  4WJP A;  5HG2 A;  4HDO A;  3LDZ E;  5FR3 A;  4IW0 A;  2V3N A;  4KIK A;  4MH8 A;  2L32 A;  2V4L A;  4HCN B;  3WIM A;  1GB1 A;  2GBR A;  4G3X B;  2NBW B;  3QWZ B;  1IYF A;  1YN4 A;  1ZKH A;  5AUI A;  2E6X A;  1YJJ A;  3AE3 B;  5JH5 C;  1ET6 A;  2KFJ A;  4OZA A;  4K1R B;  4MAC A;  3L0W B;  4DWF A;  3AEG B;  1HQR D;  1ZDV A;  1PGB A;  5AUK A;  1WIA A;  2NTS A;  4NJ6 A;  2CKH B;  3C19 A;  2N1V A;  2BWF A;  4HRO A;  1L5P A;  2MRP A;  2V3P A;  3SEB A;  1D3Z A;  1V80 A;  2N7E A;  3AEC B;  2V0G A;  2GI9 A;  3MFG A;  2O2V B;  3M63 B;  2WHI A;  4MGI E;  1SE4 A;  2WU2 B;  3B08 A;  5HFY A;  5BYQ A;  5C23 A;  3O65 B;  1E10 A;  1V1P B;  3IG3 A;  5J17 A;  2KDM A;  1PYW D;  1TIF A;  1KM7 A;  2Y5B B;  5E6O A;  2VZK B;  4G0N B;  3V60 A;  3TEY A;  4FUL A;  1NI2 A;  1KLV A;  1AWD A;  1V1P A;  3UIO B;  1OTR B;  3NG0 A;  1YQ3 B;  3ZRC A;  4B0M A;  1NEK B;  1UEL A;  2LHD A;  1WI0 A;  2BPS A;  3SD5 A;  1XXG A;  1N62 A;  1TS5 A;  3T8M A;  4FJZ A;  1L7Y A;  1EWC A;  3M95 A;  2DZM A;  2KO3 A;  3JVZ X;  3WAN A;  2K8H A;  3MHS D;  2K22 A;  3U30 A;  3RT3 B;  2BKF A;  1M4V A;  2R2O A;  1UUP A;  2JX5 A;  2IO2 B;  1SE3 A;  5I4D A;  3NS1 A;  1J0G A;  2MBH A;  1VCB A;  3V62 A;  4MSQ B;  1Q5W B;  3IHP C;  2WYQ A;  1WXQ A;  3IAS 1;  3DVG X;  1R7S A;  1YX6 B;  2VH1 A;  2KKC A;  5AZH A;  3RNB C;  1WXA A;  1WX8 A;  4IWQ A;  3E56 A;  1E9M A;  1P7E A;  4RF1 A;  4HLE A;  2PE6 B;  3RNA C;  2LWP A;  3A4S C;  1C78 A;  1UNS A;  2FCQ A;  1NYQ A;  4DHJ B;  3P4P B;  2BF8 B;  2L1A A;  4L1B A;  2FUG 1;  2EMS A;  4LCD E;  4A55 A;  4BVU C;  2B76 B;  1ZPS A;  3ML8 A;  3PPA A;  3KYD D;  2KHW B;  1DGJ A;  2WXO A;  2NR2 A;  3ZTC A;  3ZIM A;  1V1O A;  1V5O A;  1V97 A;  5AZF A;  2LGS A;  4WJN A;  4B0E A;  2KYW A;  3JSV A;  1QKZ A;  1K53 A;  1XO3 A;  4L23 A;  3T3N A;  2DEN B;  4BBN C;  4S0R A;  3NVY A;  4IWP A;  4KKI A;  4G11 A;  5L95 C;  1XLP A;  1M94 A;  4PS8 A;  1Y8R C;  2GB1 A;  3QHT A;  4RGN A;  4IM2 A;  2KZR A;  3EC8 A;  2MQJ A;  3GP7 A;  4IG7 B;  2LFI A;  2WU5 B;  5CHW A;  3HVZ A;  5LXH A;  2W9N A;  1F9J A;  2EKI A;  3AM9 A;  4KSK C;  3RCZ A;  2INN E;  3ZUN A;  1FNV A;  1L0Y B;  5LXI B;  3NRZ A;  2QDF A;  1F52 A;  1E7U A;  4DHZ B;  1TS2 A;  3WA0 A;  1EUV B;  3VRB B;  3QK0 A;  3N1Z C;  2MBB B;  4DHZ E;  2LJI A;  2XNA C;  2KAJ A;  1V81 A;  3P4R B;  2ZW1 A;  2X38 A;  1J7B A;  3ZYY X;  1ZDX A;  1F2R C;  2YVC A;  3ETR A;  2QSD A;  1C79 A;  1WXS A;  4AJW A;  4WQM A;  1L0X B;  1MI0 A;  2KWV B;  3HIZ A;  2IJ0 A;  1I4Q A;  4FBJ B;  4OHJ A;  2AWT A;  1VR9 A;  2L05 A;  2C5L C;  5HKH A;  3D32 A;  5HHD G;  3BWU D;  1AYF A;  1WFY A;  3Q8B A;  2WDR B;  1PUT A;  2BGF A;  3BZD B;  2JSV X;  2MBE A;  4K7U A;  4RCO A;  1PGA A;  1SJE D;  2DBY A;  1QIL A;  2HTH A;  3RMK C;  4RM8 A;  2MEK A;  5TR5 A;  3SU8 X;  3ECI A;  3Q14 C;  2WDT B;  4XDC A;  1FRD A;  1P9D U;  1T0Q C;  2IGH A;  1F0Z A;  3ZJU A;  4AUQ C;  4ASW C;  3Q8E A;  4IUM B;  3ABV B;  2LD9 A;  4TQ1 A;  3DDC B;  2LUE A;  3MTN B;  4KGR A;  3U7Z A;  2QJL A;  1RWS A;  3V6C B;  5H92 C;  2JYE A;  3TSS A;  2K5P A;  1DOI A;  1YMH E;  3BY4 B;  4AOF A;  1T5X D;  3WAL A;  4MGZ E;  4HPP A;  1JWU D;  1K50 A;  1S1Q B;  4ZOH C;  1P0R A;  3AEB B;  2GBM A;  4YXD B;  2FID A;  1F2R I;  2I38 A;  4LK0 M;  4N9F 4;  2X8X X;  3P4Q B;  5E6P A;  3AEF B;  3DBL I;  2Z8L A;  4C80 A;  1VZ7 A;  4LDT B;  3MJ5 A;  2MJ3 A;  2FCN A;  1ISN A;  4W9E A;  2D07 B;  1I42 A;  3M3J A;  4DXA B;  3N9Y C;  5IAA C;  2G45 B;  4X57 B;  1SE2 A;  5IKC M;  1D6E C;  2EKE C;  3JSV B;  3TEZ A;  4NAW B;  4K3B A;  1J7C A;  4AJY B;  2LXC A;  1WZ0 A;  3KLS X;  1XCQ L;  1LGR A;  2V4I B;  3BII D;  2WP9 B;  3GZN I;  2MJD A;  1QOA A;  4W9F A;  3OWE B;  1J8C A;  4EFO A;  5LLI A;  2LGY A;  1JCK B;  4KDL B;  1FO4 A;  3TEW A;  3VAW A;  3DPD A;  3R3M A;  2ZEQ A;  3AE1 B;  4M8M A;  1WJN A;  2PVG C;  1JRU A;  2O6V A;  2D3G A;  2BS3 B;  1XF5 L;  1HZ5 A;  1UZX B;  3L13 A;  1XLQ A;  4KGT A;  3VH4 B;  1C4A A;  4BAX A;  2EMT A;  2JZ3 B;  3SFD B;  4K7S A;  1WGH A;  4RNA A;  1L0V B;  1PDX A;  1FM0 D;  1F1H A;  1RAX A;  2LUM A;  4FA6 A;  5HI1 A;  2FCM A;  2H89 B;  2DAJ A;  1WGG A;  2R61 A;  3AN1 A;  2FBW B;  4JLC A;  1QOF A;  1YJ1 A;  4US9 A;  4MH0 E;  2I1J A;  2KAN A;  4RGM A;  3LJ3 A;  1NYR A;  3APF A;  1QQR A;  4XYC A;  3IBE A;  2MWS B;  2QIE B;  4GDK B;  4TUU A;  1K51 A;  2XEW A;  5C1Z A;  2HJ8 A;  1IBX A;  2V1Y A;  4M02 A;  3T3O A;  2KQ7 A;  3S2A A;  1VDV A;  3OLM D;  1IUE A;  3PT2 B;  3N30 A;  3OJ4 B;  3K9P B;  4NQK E;  3LB8 C;  2LEK A;  1UGM A;  3AE2 B;  4C4V B;  4YT0 B;  4GLS C;  4IM0 A;  3I3T B;  3ZNI D;  1QLB B;  1JRO A;  3HM6 X;  2RDB C;  3ONS A;  2CR5 A;  1FRR A;  3QA8 A;  3H7S A;  2YEP F;  4ICV A;  4HCP B;  1S3S G;  3TBL D;  4FXC A;  2G3Q B;  3P2B A;  2J7Q B;  3FAH A;  1LO5 D;  1WSP A;  3EUB 2;  2G9H D;  3PLV A;  2K9X A;  1MFW A;  3ZVV A;  2MJE A;  2W3R A;  1FNW A;  1CZP A;  1Z2M A;  1BML C;  2QCZ A;  1R4N B;  2Y3A A;  5CX3 A;  1WR6 E;  1SXT A;  2AQ3 B;  2PVO D;  3TIX A;  3W5V B;  3CF6 E;  3A4R A;  2J52 A;  3H7P A;  2AQ1 B;  3ML9 A;  1STE A;  1ZGU B;  2GLS A;  4GOC A;  4IWO A;  1WGD A;  1E7V A;  3A1Q B;  3LXF A;  4R3D A;  2MBO A;  2JRH A;  3PZD A;  2REX A;  3TMP B;  2LGD A;  4W9D A;  2JU6 X;  4II2 B;  4YTM B;  3CSF A;  1I4X A;  2OHF A;  2LZ6 A;  4XWW A;  2VH2 A;  4IOI E;  1ZP0 B;  1KLU D;  3IT6 B;  2M4N A;  2UWQ A;  4WIP A;  2KQS A;  3PHX B;  3T9L A;  3A1Q A;  1UGJ A;  4ZYN A;  3WAM A;  5BYR A;  5EE3 A;  1WXV A;  3BVM A;  1DYQ A;  1I4P A;  3B0A A;  1TJE A;  5CHF A;  1WR1 A;  3A9J A;  1FFV A;  5G55 A;  3H6N A;  4MGY E;  2LGX A;  1T6B X;  4EOY A;  1N60 A;  4BKS D;  2RMM A;  2HJ1 A;  3VFK A;  4KX6 B;  4W9L A;  1C4P A;  2ZVO A;  4HWI B;  4XE0 A;  1LQB A;  3UQB A;  4J3O D;  4TV3 A;  2JPH A;  1TY0 A;  2J42 A;  2TSS A;  1QZE A;  2J0M A;  1XEE A;  1RYJ A;  2M56 B;  1ZXH A;  2BT6 A;  1NDD A;  4GSW A;  2HDE A;  1IBX B;  2HE7 A;  3I5J C;  1FXT B;  3NJT A;  3I9V 1;  1ENF A;  3ZJT A;  3V6E B;  2ZCB A;  4ARC A;  4WWP A;  2L0F A;  3HVD A;  2A5U A;  2JUO A;  3MJW A;  4XGA B;  1XCT L;  3BK1 A;  4FHJ A;  4PT5 A;  5IN7 A;  2NS5 A;  4WWN A;  3U2S C;  2UU7 A;  1L2N A;  3FKY A;  2Z0D B;  2WXG A;  2N9E B;  1FD6 A;  3PVL A;  4GIV A;  4JIO U;  4HJK A;  4MT5 A;  2D3A A;  1KTK A;  2W3S A;  1C76 A;  1WF9 A;  4GDK A;  2IND C;  4OVZ A;  1BUI C;  4QAY A;  2JQR B;  2K6Q A;  4TMA B;  2FCS A;  4C7Z A;  3EA6 A;  2NPT B;  3A9K B;  4ANX A;  1ZXI A;  1MPE A;  4EUT A;  1ZE3 D;  3DQV A;  3C0R B;  3ZRF A;  4KSL C;  2KMC A;  4FLH A;  2WDV B;  2KLG A;  3GB1 A;  2N9L A;  3K9O B;  1I35 A;  1ESF A;  2KC1 A;  3AE9 B;  4HRS A;  3TEX A;  4BKG A;  1EF5 A;  4NJ7 A;  5D7G A;  2KMA A;  1EU4 A;  4RM9 A;  3ZXV A;  2J4X A;  3N1X C;  3FC4 A;  3ENE A;  3MP9 A;  3RFZ B;  3VR8 B;  2ZVN A;  1OEY J;  1WRI A;  2MA9 B;  3RNF C;  1GC7 A;  2KN4 A;  3X23 A;  1QOB A;  2L8J A;  4CHK A;  3KW5 B;  4ZRP A;  2BB5 A;  4JGH B;  5JZE B;  4L2Y A;  4S17 A;  1MJD A;  4JWU C;  1RM6 C;  4EKU A;  2KN5 A;  3PLU A;  3VTV A;  5DPW A;  4JPS A;  3TUO A;  3WCQ A;  3KVF B;  2K25 A;  3GOE A;  3VDZ A;  5CTR C;  1ROE A;  2GBK A;  3L4P A;  2BW2 A;  4K81 A;  3J9C A;  4GGQ A;  2MCN B;  4MEL A;  2NBU A;  4JE3 B;  2L83 A;  1I7H A;  3Q3M C;  3RUI B;  3IXS A;  3UIP B;  4OVU A;  4MEM A;  2LJ5 A;  2XK5 A;  2KMM A;  3AU5 A;  2WNM A;  2KDB A;  3PZ8 A;  4RF0 A;  2ZNV C;  3H9D A;  1X1M A;  4GMV A;  2SEB D;  4IKG A;  1WJ4 A;  3IAM 1;  4I6P A;  4CYE A;  4OZB A;  5BMG A;  4LTU A;  3UIN B;  3GE8 C;  4KV2 A;  2DLB A;  1D5Z C;  4A8X C;  4KGS A;  4MJS A;  1G6J A;  3RNC C;  4F7Z A;  3DBH B;  2KX0 A;  2KFK A;  1WJ6 A;  5BYS A;  1XLN A;  2IPK D;  1N5W A;  1HXY D;  3W1S A;  1IPG A;  2MW5 A;  1YOV B;  2PW9 A;  1V86 A;  2QMT A;  1R4M B;  1OGW A;  1MG4 A;  2NPT A;  3P42 A;  5MPO A;  3ZGZ A;  2NTT A;  2GMI C;  1NI3 A;  3CIR B;  3WAP A;  1KLG D;  2KFK B;  4K3C A;  4LNI A;  3PS6 A;  1WE7 A;  2K8C A;  4OZC A;  2KJH B;  2KX3 A;  4LNF A;  3ZNZ B;  4BKT A;  2NCN A;  5G5H A;  1WGR A;  1YN5 A;  3NVZ A;  2JYT A;  2N7D A;  1T0Y A;  4DXF A;  2CU1 A;  2CHW A;  3DVG Y;  1KH0 A;  1N6Z A;  3AEE B;  4PS7 A;  3HK0 A;  4YL8 A;  3DVN U;  3N1Y C;  1IP9 A;  3DBR I;  3Q6B A;  2PLP A;  2AYO B;  3A9K A;  1JQ4 A;  2HD5 B;  4GU2 A;  2K3U A;  3ZNH B;  3KWL A;  2DYO A;  4IDI A;  2V3S A;  1GC6 A;  1SIF A;  3AE7 B;  4FJY A;  3KUZ A;  2RD0 A;  2MSE D;  3VH3 B;  1LFD A;  4DK5 A;  3KUC B;  4WJQ A;  4G50 A;  2KQ4 X;  4A20 A;  2ZW0 A;  3DVN V;  3LYY A;  4NAM A;  2NBV B;  3P63 A;  2J0K A;  4A9A A;  4KVG B;  4B95 A;  4FN2 A;  4YSY B;  3VTU A;  1KF6 B;  2L7R A;  2O2V A;  1WYW B;  3AED B;  2Y5P A;  2N4F A;  3MHZ A;  1E8Z A;  3RZF A;  4ZRJ A;  2IGG A;  4M8N A;  4F8C B;  2ZPY A;  1V5T A;  4LDT D;  3IFW B;  3NY5 A;  1DOX A;  1TS3 A;  3VXW A;  4FHK A;  2IGD A;  4HKZ E;  3APC A;  3A9J B;  4W9K A;  4BOS C;  2INC C;  2A4Z A;  2SAK A;  2WQY B;  2G1E A;  1WX7 A;  4XDD A;  2KWD A;  5IA7 A;  2L76 A;  4OW0 A;  3R7Q A;  4DHJ D;  3QIJ A;  2DHZ A;  1VD2 A;  4N58 A;  4BZA A;  1V49 A;  1TT5 B;  2JWZ A;  3W1Y A;  1N61 A;  1GB4 A;  2BYF A;  1B1Z A;  3Q2A C;  1SEB D;  2OJW A;  1HE8 A;  2KDE B;  4CQN A;  4F1S A;  3R66 C;  2Z59 B;  3V05 A;  3HM3 A;  3MC9 A;  4ZRI A;  3KWV A;  1KFY B;  2K39 A;  4P16 A;  4PYZ A;  2KJR A;  1D5M C;  1D4B A;  5FK9 C;  3W1S C;  4WAA A;  4ACF A;  3HUI A;  2WXJ A;  1H4R A;  3NS8 A;  5G2N A;  3I57 A;  4D2K A;  2DYB A;  4GDL B;  1Y56 A;  1TBE A;  3Q8C A;  2Q5W D;  1MG8 A;  4P6V F;  1GUA B;  3DHG C;  3BYY B;  1VZ6 A;  5D3I B;  2WXR A;  2PIA A;  4GDL A;  1OQQ A;  1T3Q A;  2PKO A;  5JXV A;  2WXK A;  2LXA A;  2ACZ B;  3B2G A;  1DOY A;  4PK1 A;  5KHO A;  2PPH A;  2PJH A;  4W9J A;  2LMC A;  3CST A;  1A70 A;  2BBC A;  1E5W A;  2ZNV B;  2BQQ A;  4ZHO A;  4M00 A;  2N7J A;  1QF6 A;  3APD A;  3N32 A;  1FFU A;  3VVW B;  2ZJD A;  3IVF A;  1KRH A;  1XQQ A;  4YTP B;  2WGS A;  5GMV A;  3DHH C;  1WM2 A;  4NJC A;  3ZNG C;  2BB6 A;  2AEH A;  1PGX A;  4ZHP A;  3ZKJ C;  3NUH B;  3RPF C;  2OED A;  3QAQ A;  1J7A A;  3H8H A;  3MC8 A;  1JWB D;  2PMV A;  1YQB A;  2E3T A;  4Q2J A;  2KD0 A;  1RLF A;  1YJI A;  3QAR A;  2MP2 B;  2INP E;  3P1M A;  2L52 A;  3KQ4 A;  5BMI A;  1I4G A;  2RDH A;  5D6J B;  3CMM B;  2DZI A;  2W54 A;  3PSE B;  1YNT E;  5D94 A;  2BTE A;  2KWC A;  2L00 B;  5BMH A;  3R2I A;  1TS4 A;  4ZYS A;  1WZ3 A;  2D3B A;  2PTL A;  1E7P B;  1OFF A;  1SGH A;  2MP2 A;  2WXH A;  1C1Y B;  3SR6 A;  3RD2 A;  2JZZ A;  3ZDT A;  4ARI A;  1PFD A;  4KZC A;  1T0R C;  2IO0 B;  1TGZ B;  2MX2 A;  3DBS A;  2WWZ A;  3R8B A;  2V9H A;  5IOI A;  2KWU B;  4YSX B;  2C7M B;  1N63 A;  2XN9 C;  1E90 A;  2EEL A;  3ZQ4 A;  4WWO A;  1UBQ A;  3RN9 C;  2YEP B;  5D3D A;  3KH0 A;  1T0S C;  2L3Z A;  3PV1 A;  3ZJV A;  1E6E B;  2N9K A;  4LNN A;  1MHX A;  4MJS B;  3W9C B;  1SB3 C;  3Q8A A;  3PO0 A;  1EF1 A;  4B9K A;  4W9I A;  4NQL B;  1V2Y A;  3EFC A;  1YX5 B;  1JAL A;  1V8C A;  3ZO5 B;  1P98 A;  1ZOY B;  4ANU A;  3DBR B;  5E6N A;  1WMH A;  1EM7 A;  4DXG A;  1L6U A;  1ZW7 A;  4IM3 A;  2ON8 A;  2CU3 A;  3DOW A;  1YN3 A;  4YWG G;  3ZXR A;  3AH7 A;  3VUW A;  1FXA A;  4OVV A;  1BXT A;  4YTN B;  4HEA 1;  3AV8 A;  3L10 B;  4HJG E;  1TTN A;  3QX1 A;  3PRE A;  2JY6 A;  2QIL A;  4A90 A;  4LLG M;  1XD3 B;  4FAD A;  3TJP A;  1ACC A;  4A3O A;  2D3C A;  4N59 A;  4ZDV A;  2KNB A;  2FNJ B;  3CWI A;  4LJO B;  2WXQ A;  5J2R A;  4E74 A;  1CMX B;  3Q69 A;  1KJT A;  1L6V A;  2M17 A;  3AB5 A;  1AN8 A;  2K0P A;  4MM3 A;  3AI5 A;  3EEC A;  3NOB A;  5L83 A;  2W55 A;  2JVC A;  4BKS A;  4ITK A;  4E71 A;  1K8R B;  2BYT A;  4P1B C;  4MDK E;  2JT4 B;  1RFA A;  3DHI C;  2OJR A;  2MHJ A;  1RRB A;  3Q8F A;  5IO9 A;  1F77 A;  5T8I A;  3L08 A;  2KVR A;  5TSS A;  3RZW C;  3NZ3 A;  4WWM A;  1NVI D;  1TZ1 A;  2MLB A;  3RI7 C;  2PE9 A;  4AQ7 A;  5H8Y E;  1C3T A;  1QT9 A;  4EZK A;  1GAQ B;  1JWS D;  2ZZP B;  3AU4 A;  4A6Q A;  4HXD A;  2LHE A;  3Q3F A;  3B2F A;  3I63 C;  4M0W B;  2ICI A;  4EE2 A;  1Q0W B;  1A5R A;  5DPT A;  2KOX A;  2O6V B;  2CHZ A;  2K1F A;  3TCA A;  3EFU A;  4C7Y A;  4PYU A;  2ZPN A;  1EU3 A;  3FIL A;  3WAO A;  4M0W A;  1HEZ E;  2YLM A;  4MSM B;  2IO1 B;  2XK5 B;  4W9G A;  3N3K B;  2WS3 B;  2IYD B;  3VRA B;  3TL5 A;  3C8Y A;  3AXC A;  1HTQ A;  2LAS A;  2WX0 A;  3URY A;  2VZK D;  3B9J A;  2GOW A;  3B1L X;  1TKY A;  4GXB A; 
#chains in the Genus database with same CATH homology
 4KGT A;  4IDI A;  5LNK 1;  1C4A A;  1NEN B;  1EWY C;  3SFD B;  2MH7 A;  1WGK A;  3AEA B;  4RNA A;  1L0V B;  1PDX A;  2RDG A;  1FM0 D;  3EGR A;  3AE7 B;  2W82 A;  5HG2 A;  4RGO S;  2LUM A;  5FR3 A;  5HI1 A;  2H89 B;  2V3N A;  4MH8 A;  2GRI A;  2DYM A;  2L32 A;  2KQ4 X;  3AE5 B;  2R61 A;  1JWA D;  2ZW0 A;  3LYY A;  3AN1 A;  2FBW B;  4YSZ B;  1QOF A;  4NAM A;  4US9 A;  3P63 A;  2HTM E;  3AMZ A;  1GB1 A;  1IGC A;  4A9A A;  1YN4 A;  4RGM A;  2WXI A;  1NYR A;  1CQV A;  5AUI A;  4YSY B;  2E6X A;  1KF6 B;  1QQR A;  1YJJ A;  3AE3 B;  2QIE B;  3AED B;  2Y5P A;  4O1N A;  4GDK B;  1ET6 A;  2M0A A;  3MHZ A;  1K51 A;  4OZA A;  2IGG A;  4MAC A;  3AEG B;  1HQR D;  1ZDV A;  1IBX A;  1SSN A;  1PGB A;  5AUK A;  3T3O A;  2NTS A;  1VDV A;  1FCL A;  1Q10 A;  1IUE A;  1DOX A;  1TS3 A;  4HRO A;  1L5P A;  2V3P A;  3SEB A;  3LB8 C;  2LEK A;  2IGD A;  3P4S B;  3AE2 B;  1JRP A;  4HKZ E;  4YT0 B;  4GLS C;  1SBB B;  1WWT A;  2SAK A;  2WQY B;  3AEC B;  2V0G A;  2GI9 A;  2G1E A;  3MFG A;  4XDD A;  1QLB B;  2KWD A;  2CJN A;  1JRO A;  4OW0 A;  1I4H A;  1SE4 A;  1TYG B;  2WU2 B;  2WXM A;  5HFY A;  1L4Z B;  4N58 A;  5BYQ A;  1E10 A;  1V1P B;  1FRR A;  2ONQ A;  3BYT B;  1IGD A;  2YEP F;  1N61 A;  3BVZ A;  2KDM A;  3MC0 B;  1GB4 A;  1PYW D;  4FXC A;  1B1Z A;  3FAH A;  2BS4 B;  1LO5 D;  1WSP A;  3EUB 2;  1SEB D;  2G9H D;  1ZUD 2;  2K9X A;  2VZK B;  2MJE A;  2W3R A;  3UI3 A;  1FNW A;  1SF0 A;  1CZP A;  4CQN A;  3AE8 B;  4RH6 A;  1BML C;  3TEY A;  2D5G A;  2Y3A A;  1AWD A;  1SXT A;  1V1P A;  2AQ3 B;  2PVO D;  3W5V B;  2J52 A;  3V05 A;  1TZO A;  2AQ1 B;  3KWV A;  1K52 A;  1KFY B;  1STE A;  3FIL B;  1YQ3 B;  1I4R A;  4P16 A;  1D5X C;  4B0M A;  1NEK B;  2LHD A;  1D5M C;  1XXG A;  1JWM D;  1N62 A;  1D4B A;  5FK9 C;  1TS5 A;  2NMQ A;  3LXF A;  4R3D A;  3HUI A;  2WXJ A;  3VR9 B;  1EWC A;  4TSS A;  3I57 A;  4YTM B;  2JU6 X;  2K22 A;  4D2K A;  1I4X A;  2OHF A;  4GDL B;  4XWW A;  1Y56 A;  2RPV A;  4IOI E;  1M4V A;  3Q8C A;  1ZP0 B;  1KLU D;  1C4C A;  2DWQ A;  1UUP A;  4AS1 A;  2JX5 A;  2Q5W D;  1SE3 A;  3IT6 B;  4WIP A;  5I4D A;  4P6V F;  1UGJ A;  3NS1 A;  1UWM A;  5BYR A;  5EE3 A;  3BVM A;  4WAF A;  1DYQ A;  1I4P A;  3BYY B;  3R2T A;  1VZ6 A;  5D3I B;  1GOZ A;  2WXR A;  1TJE A;  2PIA A;  4XWT A;  5EE1 A;  1FFV A;  1B9R A;  1OQQ A;  1WXQ A;  1T3Q A;  3IAS 1;  2PKO A;  1R7S A;  1T6B X;  1N60 A;  2RMM A;  5JXV A;  3E56 A;  2WXK A;  3AE4 B;  1E9M A;  1P7E A;  4RF1 A;  2ACZ B;  2FE8 A;  3B2G A;  1DOY A;  4KX6 B;  1YQ4 B;  1C4P A;  1FMA D;  2LMC A;  2LGI A;  1FEH A;  4UDU C;  4XE0 A;  1C78 A;  1A70 A;  1UNS A;  2BBC A;  1C9F A;  2JWU A;  4J3O D;  4ZHO A;  2JXT A;  1NYQ A;  2N7J A;  1QF6 A;  3P4P B;  2IDY A;  1TY0 A;  2J42 A;  1FFU A;  2TSS A;  2L1A A;  1KRH A;  4L1B A;  4YTP B;  2FUG 1;  1XEE A;  1RYJ A;  4A55 A;  2M56 B;  4NJC A;  1ZXH A;  2BT6 A;  2WLB A;  3SFE B;  2HDE A;  2B76 B;  1IBX B;  2BB6 A;  4TQ0 A;  1ZPS A;  1PGX A;  4ZHP A;  3I9V 1;  3NUH B;  1ENF A;  3ZJT A;  3RPF C;  3W5U B;  4ARC A;  2OED A;  1J7A A;  3H8H A;  3HVD A;  1FCC C;  1JWB D;  2PMV A;  2CJO A;  1DGJ A;  2E3T A;  2WXO A;  4Q2J A;  1XCT L;  1V1O A;  1YJI A;  1V97 A;  3BK1 A;  3BVG A;  4PT5 A;  2INP E;  3P1M A;  4B0E A;  3U2S C;  2L52 A;  1CK1 A;  1XO3 A;  1QKZ A;  1K53 A;  2WXG A;  3KQ4 A;  3NVW A;  1I4G A;  2RDH A;  4L23 A;  5E6J A;  5BMI A;  3T3N A;  5EE9 A;  2W54 A;  1YNT E;  2BTE A;  1FD6 A;  3NVY A;  5BMH A;  3R2I A;  1TS4 A;  4KKI A;  4MT5 A;  4ZYS A;  1XLP A;  1KTK A;  1SJH D;  2W3S A;  1C76 A;  3GS2 A;  3IT4 B;  2GB1 A;  1E7P B;  2PTL A;  1FNU A;  4OVZ A;  1OFF A;  4RGN A;  1BUI C;  2WXH A;  2JQR B;  3V3X A;  1HZ6 A;  3GP7 A;  4TMA B;  4C7Z A;  1VZ8 A;  2LFI A;  2WU5 B;  3EA6 A;  3SR6 A;  1MVK A;  3HVZ A;  4ARI A;  1PFD A;  2I2Y A;  1ZXI A;  1MHH E;  4DQO C;  2KAC A;  2EKI A;  1MPE A;  3AM9 A;  3R8B A;  2WDQ B;  1ZE3 D;  3HRD D;  2INN E;  4YSX B;  1FNV A;  1L0Y B;  1JW9 D;  5FKA C;  1N63 A;  2WDV B;  2XN9 C;  2N0S B;  3AE6 B;  2EEL A;  3ZQ4 A;  3NRZ A;  3GB1 A;  2N9L A;  1TS2 A;  3BK2 A;  1ESF A;  3AE9 B;  4HRS A;  2YEP B;  5D3D A;  3TEX A;  5D7G A;  3O13 A;  2Y5C A;  3VRB B;  1EU4 A;  3VQI A;  2J4X A;  3FC4 A;  5C3J B;  3ZJV A;  1E6E B;  2LJI A;  2N9K A;  2XNA C;  1MHX A;  2KAJ A;  3MP9 A;  3W9C B;  3RFZ B;  1SB3 C;  3Q8A A;  3PO0 A;  3P4R B;  3VR8 B;  2ZW1 A;  2X38 A;  1J7B A;  3ZYY X;  1ZDX A;  1WRI A;  4JX1 C;  1F2R C;  4RFB A;  2KN4 A;  2AQ2 B;  3ETR A;  1QOB A;  2QSD A;  3U4E G;  1C79 A;  1JAL A;  1V8C A;  4WQM A;  5GXG B;  1L0X B;  1MI0 A;  1ZOY B;  2AX5 A;  4ZRP A;  2BB5 A;  2IJ0 A;  1I4Q A;  4OHJ A;  1UWX A;  1VR9 A;  4L2Y A;  1EM7 A;  4DXG A;  1L6U A;  4JWS C;  2ON8 A;  4JWU C;  2WXP A;  4H2A A;  3U52 E;  2CU3 A;  1RM6 C;  1WYG A;  3NVV A;  5HHD G;  4REZ A;  3BWU D;  3W2D A;  1YN3 A;  4US8 A;  1AYF A;  1P7F A;  4YWG G;  3Q8B A;  4JPS A;  3AH7 A;  2WDR B;  1PUT A;  3TUO A;  3BZD B;  1FXA A;  1TKE A;  1BXT A;  4YTN B;  4HEA 1;  3AV8 A;  2JSV X;  3WCQ A;  4N6E B;  4RCO A;  4HJG E;  1PGA A;  1SIJ A;  5C2T B;  1SJE D;  2DBY A;  1JML A;  1ROE A;  1ET9 A;  2QIL A;  1N5X A;  1QIL A;  3L4P A;  2BW2 A;  4A90 A;  4LLG M;  3J9C A;  1ACC A;  4JE3 B;  4N59 A;  2L83 A;  1I7H A;  3CWI A;  2WXQ A;  2M19 A;  3IXS A;  3Q69 A;  2MEK A;  1L6V A;  4HKQ A;  3AB5 A;  1AN8 A;  4RGT A;  2K0P A;  2KMM A;  4XDC A;  1FRD A;  2IGH A;  1GPX A;  1F0Z A;  2W55 A;  3ZJU A;  2WNM A;  4ITK A;  2BYT A;  3PZ8 A;  4RF0 A;  3Q8E A;  3ABV B;  4ZRQ A;  2SEB D;  4TQ1 A;  4IKG A;  3Q8F A;  3IAM 1;  1F77 A;  1AW7 A;  5T8I A;  4OZB A;  4KGR A;  5BMG A;  3U7Z A;  4LTU A;  2QJL A;  1RWS A;  1TY2 A;  5H92 C;  2DLB A;  2JYE A;  5TSS A;  1D5Z C;  3NZ3 A;  4WWM A;  4A8X C;  3TSS A;  3E9S A;  4KGS A;  2K5P A;  1DOI A;  1NVI D;  1VJK A;  1YMH E;  4AQ7 A;  1T5X D;  1TKG A;  5H8Y E;  1QT9 A;  5EE0 A;  1JWU D;  1E0Z A;  1K50 A;  4ZOH C;  1RFK A;  5BYS A;  1L4D B;  1XLN A;  1GAQ B;  1JWS D;  3AEB B;  4YXD B;  2BS2 B;  5G5G A;  2IPK D;  1N5W A;  4NZL B;  1F2R I;  1HXY D;  1HA5 A;  2I38 A;  3W1S A;  4LK0 M;  2PW9 A;  4A6Q A;  2LHE A;  3P4Q B;  2QMT A;  3AEF B;  3P42 A;  3B2F A;  2Z8L A;  4C80 A;  5MPO A;  3ZGZ A;  1C77 A;  2ICI A;  2JZP A;  2NTT A;  4EE2 A;  1NI3 A;  1VZ7 A;  2J53 A;  1OQR A;  3CIR B;  3MJ5 A;  1KLG D;  2MJ3 A;  3PZ7 A;  2WXF A;  4C56 C;  1FXI A;  3N9Y C;  4OZC A;  4C7Y A;  1SE2 A;  1D6E C;  3TEZ A;  5G5H A;  4NAW B;  1J7C A;  1YN5 A;  2WXN A;  1EU3 A;  3NVZ A;  2JYT A;  3FIL A;  3KLS X;  1XCQ L;  2V4I B;  3BII D;  4M0W A;  2WP9 B;  1HEZ E;  1QOG A;  2MJD A;  2H88 B;  4DXF A;  2QEJ C;  1VRA B;  1QOA A;  3OWE B;  4MM3 B;  2WS3 B;  3VRA B;  1JCK B;  1KH0 A;  1FO4 A;  3TEW A;  4USA A;  3AEE B;  4WUR A;  2WXL A;  3AE1 B;  4WH4 A;  3DWM A;  3C8Y A;  3DWG C;  2PVG C;  1VLB A;  2BS3 B;  2PLP A;  3URY A;  1CJE A;  2VZK D;  1FIQ A;  1XLO A;  3B9J A;  1JQ4 A;  2K3U A;  1XF5 L;  1TKY A;  1HZ5 A;  3KWL A;  4KKJ A;  2DYO A;  1XLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...