2JQRB

Solution model of crosslinked complex of cytochrome c and adrenodoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDCAYGLTDRSRLGCQISLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c iso-1
publication title Dynamics in a pure encounter complex of two proteins studied by solution scattering and paramagnetic NMR spectroscopy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jqrB00
2EKIA 5MPOA 1NYQA 3WCQA 1NYRA 2KAJA 3NVZA 3HVZA 3AV8A 3VR8B 3P63A 3P1MA 1XO3A 1PUTA 3P4SB 1JRPA 4N6EB 4P6VF 4A9AA 1OFFA 1JWAD 1XLQA 3AE4B 2CU3A 4USAA 3LB8C 1FM0D 5EE9A 2ACZB 1AYFA 2H88B 5EE1A 2M56B 1UWMA 1VLBA 1CJEA 4N58A 3NVWA 2H89B 2WDQB 1QOAA 1V8CA 3AEGB 3W5UB 1DOYA 1WYGA 2WDVB 1B9RA 1KRHA 1ZOYB 1PFDA 2W55A 2MJEA 1FMAD 1RYJA 4C7YA 1FRDA 3ZYYX 3AE3B 1JW9D 1YJIA 3B9JA 3ABVB 1NENB 3AE7B 1L6VA 1FXAA 3AE1B 1YJJA 1VJKA 2WU2B 3NRZA 3SR6A 3P4QB 4JX1C 4ZHOA 1A70A 2W54A 3FC4A 1IUEA 3CIRB 3CWIA 2QJLA 3NS1A 4US9A 4IDIA 1J7CA 1L5PA 1QT9A 2AX5A 4US8A 4ZOHC 2DWQA 3RPFC 3SFDB 5EE0A 1OQRA 1N60A 1FRRA 1NI3A 1XLPA 1SIJA 2PVOD 3HUIA 1SF0A 1RWSA 4HRSA 2HTME 1N62A 1ZP0B 1QLBB 1XLNA 3AB5A 4ITKA 4YTNB 1RFKA 4WWMA 1JALA 2WS3B 3VR9B 3BIID 1N5XA 4ZHPA 3ETRA 3AMZA 1WXQA 4C7ZA 1L0VB 2W3RA 3AEAB 1N5WA 4YT0B 5H8YE 1OQQA 4C80A 1V97A 1DGJA 2G1EA 1WGKA 4N59A 1JROA 1ROEA 1L6UA 1GPXA 1J7BA 1VDVA 3DWMA 2K22A 4YSXB 3AEEB 2LEKA 4FXCA 4YSYB 2BS3B 1J7AA 1TKYA 4HROA 3FAHA 4WQMA 5C3JB 1QF6A 1E7PB 1I7HA 3AECB 1T3QA 3DWGC 5AUIA 1AWDA 2W3SA 2KMMA 1RM6C 1E6EB 3NVYA 3P4PB 1YQ4B 3AE5B 3AE9B 1N63A 3AEBB 2JQRB 4KX6B 2OHFA 1KFYB 1FXIA 3AE2B 1DOXA 1E10A 5GXGB 4YXDB 2CJNA 4YTMB 2E3TA 2QIEB 4YTPB 1ZXIA 4LTUA 2L83A 1FFVA 2WDRB 2K5PA 2PKOA 3P4RB 2BS2B 3HRDD 5G5GA 3VRAB 2BS4B 3NVVA 5G5HA 3W9CB 1R7SA 2MJ3A 1TJEA 2L52A 2N0SB 1ZUD2 3AM9A 2PVGC 1GAQB 3PO0A 1EWYC 1YQ3B 2M19A 5C2TB 2Q5WD 1TKGA 2Y5CA 2PIAA 4JWSC 1TKEA 2WP9B 1WWTA 2MH7A 1QOFA 2BT6A 1E9MA 3AEDB 1NVID 3L4PA 2WLBA 2CJOA 3W5VB 3AEFB 1CZPA 1KF6B 3LXFA 1QOGA 3B2GA 1SB3C 2K9XA 2WQYB 2FBWB 1JWBD 1PDXA 5H92C 3AN1A 1FIQA 1E0ZA 1NEKB 2MJDA 2B76B 3AE6B 3AH7A 1F0ZA 1N61A 5AUKA 5EE3A 2WU5B 3SFEB 3VRBB 1WRIA 4YSZB 1XLOA 1TYGB 3AE8B 2DBYA 1JQ4A 1FO4A 1FFUA 3EUB2 1QOBA 1DOIA 3KWLA 4JWUC 3B2FA 2JX5A
chains in the Genus database with same CATH superfamily
4ZDVA 1MHHE 2BWES 2KAJA 1V5OA 1WJNA 2BKRB 1WMHA 3BY4B 3LB8C 3UIOB 3U2SC 5JHBA 4MH8A 4RH6A 4C7YA 5IOIA 2AYOB 3T3OA 3IAM1 1YJJA 4FHKA 2CU1A 3L16A 4ZHOA 4P1BC 2NS5A 1YN4A 4RMAA 1J7CA 4HPLB 3U7ZA 4A90A 4BZAA 4ZRKA 1XLPA 4PYZA 3TEXA 3PV1A 1GOZA 2OOBB 2K8HA 4NZLB 1S3SG 1GG3A 3N1YC 3PRZA 2IDYA 3VR9B 2BYVE 3I3TB 1PGAA 4PK1A 2HJ8A 1T6BX 2G1EA 2JXXA 3OJ4B 2KK8A 3QHTA 2MQJA 3EC8A 4YSYB 4WQMA 1V49A 2K6QA 3W2DA 3BK2A 2FCMA 2XN9C 4REZA 3H9DA 3DHGC 4KVGB 3OWEB 2BS2B 2NPTB 3U4EG 1VZ6A 1C76A 2HD5B 1UGJA 2K6DB 4MM3B 2J0JA 5E6JA 3AEDB 3Q3OC 2RPVA 2WX0A 2KJ6A 3ZNGC 3QIJA 2QEJC 4N9F4 2WQYB 2KT7A 2O6VA 4TQ0A 1WRDB 3BINA 3KYCD 2MBBB 2LASA 3RNFC 4BBNF 4NY0A 5MPOA 1NYQA 1SEBD 2WXMA 1WJ6A 5G2NA 2L76A 3ZNZB 1MJDA 1WGDA 4USAA 1R4NI 1XCQL 5LNK1 2H89B 2WDQB 5E6PA 4MJSB 2KFJA 2MP2A 3RT3B 2MJEA 4IM2A 2LHDA 1L0XB 2BVCA 1NENB 2A4ZA 2J0KA 4AJYB 3DHIC 4JX1C 1OTRB 2PE9A 2WXRA 3SU8X 1HQRD 5DPTA 3NZ3A 1WIAA 2DWQA 2N9LA 2OEDA 3V6EB 2IO2B 4F7ZA 2X8XX 3MC9A 2GBRA 1I4GA 1TS2A 4TSSA 3ETRA 1HA5A 2WXJA 3VTUA 2DENB 1L0VB 3IAS1 2L7RA 3DHHC 2QILA 1L4ZB 4IWPA 4R3DA 3AEEB 1WZ3A 2M0AA 1Q10A 1E7PB 2BGFA 1TT5B 4MGYE 4HK2A 2KDBA 1D5MC 4HLEA 1SE9A 3RULA 2LGSA 4EKUA 2CHZA 4K3CA 4EZKA 1BXTA 2QIEB 4RF0A 2L83A 1ZXHA 5CHFA 3NVVA 1YJ1A 3K9OB 1IP9A 4AUQC 3VUYA 3Q14C 1D5XC 1EWYC 3T9LA 2KWCA 3DQVA 1C1YB 1ZDXA 3L4PA 3Q3JA 2DX5B 2JYTA 3ZTCA 1OEYA 4BBNC 3ZGZA 4JL9A 3AN1A 2I1KA 2MJDA 3TEYA 2WU5B 3VRBB 3DPDA 5H8YE 1IYFA 4P16A 2WDTB 3BK1A 1WM2A 4ZYSA 2MBHA 1VRAB 1V1PB 2CU3A 4GDKB 3Q3FA 3KVFB 1YN3A 2RD0A 2C9WB 1MG4A 1VZ7A 4G3XB 4GOCA 1STEA 4JPSA 2D3AA 1C9FA 2AQ3B 4CYEA 3OJ3A 3VXWA 2BB6A 2FAZA 2ONQA 4LJPB 1A70A 3Q8FA 1IUEA 2DYBA 3H7PB 2EMSA 4MM3A 4KZCA 2IGDA 3BWUD 4FBJB 4KDLB 1I4XA 1L7YA 3TJPA 1F52A 2WX1A 4FULA 2MRPA 4OVUA 3AEAB 4DBGA 1SBBB 2JZZA 2NVUI 5JHAA 4E3CA 3V61A 5T8IA 3NOBA 2LJ5A 1V86A 2LD9A 3ALBA 1ET6A 4MDKE 3AE5B 4MJSA 2KJRA 3HVDA 1ZXIA 1UH6A 2L0FA 1R7SA 3U30A 3SHQA 3BVZA 4TUUA 2JF5A 1TKGA 3PREA 1M94A 2V0GA 3GS2A 1QOGA 4GSWA 1RFAA 5E6NA 1GB4A 2G4DB 1QKZA 2L1AA 5IP4D 4IM3A 4XZ4A 2N9PC 4YSZB 2D2QA 1KTKA 3RNCC 2INNE 2GOWA 3JW0X 1K53A 1AYFA 1A5RA 2DAFA 2ON8A 4ANXA 1V8CA 1DOYA 5C1ZA 4W9JA 1ZOYB 4W9EA 2BB5A 5JXVA 4XWTA 2FIFA 2CS4A 4IWOA 3A9JB 1R4MB 4LDTD 1XF5L 2MBEA 4BKSA 3VUXA 1WXAA 1GUAB 3RPFC 1C78A 2G4SA 3U8ZA 4B6WA 4ASWC 1SIJA 3WAPA 2ZVOA 1WH3A 4WWMA 1BMLC 2GBNA 1KH0A 1V6EA 3AU5A 1N5WA 1OQQA 2KWVB 1EU3A 3EGRA 1F2RI 3W1SC 4GIVA 2L0TA 1RAXA 4KV2A 4DXFA 1V1PA 4GDKA 1AWDA 1E6EB 3MFGA 3SDLC 2ZCBA 2LGXA 1N63A 3UQBA 3APFA 5GXGB 2DZMA 2AEHA 3N9YC 1I4HA 1TTNA 3B1LX 3HRDD 5IAAC 3H7PA 4O1NA 4WWPA 2C7MB 4WH4A 3GZNI 1SXTA 3FILB 1HE8A 3UQAA 1TIFA 5BO4B 4EZLA 2V3PA 3L0WB 1IPGA 2G45B 1FO4A 2QC8A 3SD5A 4ZRIA 3Q8CA 2O6VD 2WXGA 3P63A 2L3ZA 4FJZA 4P6VF 1JRPA 4HDQA 3TCAA 2KNBA 1JWAD 3TUOA 5AEKB 1SIFA 2FUG1 2ZEQA 3D32A 3B0AA 2BKFA 2J52A 4J3OD 1KRHA 1GNUA 1P9DU 4DXAB 1WXVA 4BKGA 4NJ6A 2WXKA 3BYYB 3B9JA 2Z0EB 4BAXA 2NMQA 2M8SA 2BYTA 2KQ4X 4GGQA 4A6QA 3Q8AA 3R2TA 5TSSA 4US9A 2JZ3B 4IDIA 3L54A 3OAWA 1UD7A 3AB5A 4ITKA 2WS3B 3HK0A 1KJTA 4GXBA 1K51A 4LNOA 1FNVA 1UBIA 1JROA 1L6UA 2ICIA 2DHZA 2LRWA 3LJ3A 2BS3B 1J7AA 1AARA 3PZDA 1WSPA 3NJTA 1I7HA 4K81A 3DWGC 2IYDB 1XT9B 2LGDA 3ML9A 4EEWA 3ZNHB 3H7SA 1FXIA 3NUHB 4ARIA 3ZLZA 5IA7A 5FK9C 2K5PA 4KDIC 1E7VA 2LI5A 5AZHA 1ZW7A 3A9KB 5CHWA 2KFKB 2LUEA 5L83A 1J19A 2NBUA 1UGMA 2WP9B 1E5WA 2FCQA 4L2YA 4HKZE 1WGHA 3LXFA 3UINB 4XX5A 2FBWB 4C4VB 4LJOB 1HTQA 2NTSA 4S17A 2I1JA 2Z0DB 3R2IA 1WRIA 3VVWB 1SE2A 1TZOA 2BF8B 4OZBA 4LNFA 2BW2A 3MP9A 1XO3A 3RNGC 1UUPA 5CHVC 4LNIA 3IG3A 1KLGD 2J53A 1WXMA 3AU4A 1WE6A 2EELA 1QOAA 3URYA 5FKAC 2NCNA 4NAMA 5IN7A 3ZJUA 3GE3C 3KH0A 1VJKA 4W9GA 3P4QB 4M00A 4KKJA 2LRUA 2JUOA 4CQNA 1NBFC 2X38A 3VAWA 1NI3A 2FIDA 3L08A 4DWFA 3FILA 2GRIA 2GBMA 1JWSD 4XGAB 1Q5WB 4K3BA 1N5XA 3VQIA 1WXQA 1KLUD 2XEWA 2V3SA 1P1AA 4A3PA 3HM3A 1EWCA 2IO1B 3QA8A 2AWTA 4J6IA 3M3JA 2KC2A 4X57B 3QJZA 2JWZA 2JWUA 4RGNA 4JQWC 5TR5A 4FJYA 4YTPB 1E7UA 3P4RB 2KVZA 3KWVA 2KWUB 2IZVB 2KOXA 2J4XA 1FCLA 4WJNA 3EA6A 1EF5A 1YQ3B 4W9CA 3TSSA 5HKHA 5JH5C 2CJOA 3MHSD 3W5VB 1CZPA 2DAJA 4FA6A 2V1YA 4F1SA 1F1HA 3AE6B 4AWJA 5KHOA 2LXAA 3GB1A 2OJWA 3EUB2 4JE3B 4BKTA 2WXOA 3A4SC 1YX5B 5HG2A 4L1BA 1HXYD 4XDCA 4FLHA 2C5LC 1KLVA 4A9AA 2YEPF 1QILA 2M56B 1UWMA 2ZPNA 1OQYA 3NY5A 2WDVB 3W5UB 4AQ7A 2JVCA 1EM7A 2W55A 3EFCA 4MGIE 2KX3A 2KDIA 4XWWA 2XK5B 3KUDB 2A5UA 4RGMA 1C4PA 3AE1B 2W54A 3A9KA 2KFKA 2J0MA 2K0PA 2AX5A 3CSFA 1H8CA 2MX2A 2L32A 1N60A 3ZQ4A 4RGTA 4KSKC 4I6LB 2VH1A 5CTRC 4BKSD 2PPHA 2INPE 4LNKA 5GMVA 4C4VA 3I9V1 1JALA 5DPRA 2V4LA 1TY0A 1JMLA 2ZW1A 4DHJB 1LGRA 1PQSA 2KTFA 1WGKA 2UYZB 2ZNVC 4YWGG 3VUWA 3GP7A 3RNBC 2L8JA 3IT6B 2KZRA 3FKYA 1E10A 4A20A 1FCCC 1K8RB 2JU6X 4PT5A 2FCSA 3DBLB 2KD0A 3DBRI 5LXHA 2SAKA 4IOIE 3Q3NC 1XEEA 1XQQA 2MA9B 2M19A 3N32A 2M17A 2DLBA 3OG5A 3B2GA 4RF1A 1T0QC 1JWBD 4FADA 2N1WA 1C79A 2QMTA 1TYGB 4K1RB 2LJIA 1FPYA 3P4PB 4LCDE 1WE7A 2GBKA 2RDHA 4K7SA 2IY1B 4W9LA 3NVZA 1L0YB 2BPSA 2ACZB 1WI0A 1VLBA 1CJEA 2KDMA 3NVWA 2LUMA 3V6CB 3PS6A 2HE7A 4WWOA 3IVFA 3ML8A 1BT0A 2WXLA 4WAFA 1QQRA 1JW9D 3C0RB 2ZZPB 2DYMA 3ABVB 2EKEC 2Z8LA 3MC8A 4A8XC 3A33B 5C23A 1H4RA 1QZEA 4WIPA 1WFYA 4PS8A 1GJZA 4OHJA 3DDCB 4W9DA 3WANA 5LLIA 1SF0A 3ZJTA 1RWSA 3B08A 1T0YA 2RPQA 2IO0B 2MCNB 4TKNA 2PTLA 1D4BA 2LMCA 4DXGA 2BBCA 4M02A 1YNTE 4A3OA 1HZ5A 1C77A 1VDVA 4WURA 2WYQA 3PHXB 4IW0A 4HROA 3CF6E 1P7EA 1ZDVA 2DZIA 4RNAA 3TL5A 1E8YA 1YQ4B 3Q3MC 1EF1A 1RRBA 4E71A 1J8CA 2E3TA 1TZ1A 4OVZA 2XK5A 1ACCA 2M1MA 2KC1A 3GZNB 4LTUA 4CO7A 3RYTA 1CK1A 2FCNA 2Z59B 3Q8EA 3JVZX 3U52E 2LVPA 2B3AA 2CKHB 2PIAA 1E9MA 1KF6B 2AQ1B 1DYQA 2D11A 1LQBA 3IT4B 3L10B 1N61A 4M0WB 4B9KA 3WCQA 3RI7C 4B0EA 4WJQA 3VR8B 1I4PA 1OFFA 3AE4B 4XDDA 4AS1A 4W9IA 3ONSA 4I6PA 1I4QA 3NHEB 2D3BA 1MG8A 1YX6B 1I4RA 3ZKJC 1FXAA 4WJOA 2R2QA 4W9FA 3CWIA 2D3GA 2M4NA 3CMMB 3QK0A 1OQRA 4RM9A 1WR6E 5D3DA 1L2NA 1VD2A 2NBWB 4DK5A 1RFKA 3ENEA 3NG0A 1C3TA 2N7DA 4N59A 4P1CC 1SGHA 1MVKA 1NDDA 1YOVB 3DWMA 4B0MA 2JYEA 1QF6A 2KMAA 1EUVB 3QWZB 2GLSA 4BFRA 2SEBD 2J42A 1KFYB 1YD8U 1DOXA 4XE0A 1LM8B 2WDRB 2KTRB 2WXPA 3APDA 1TJEA 1ZUD2 2LHEA 3R7QA 2W9NA 2PE6B 4NPNA 5CX3A 4Q2JA 2Q5WD 1TKEA 3MHZA 1WWTA 1VR9A 5D6JB 3ZO5B 4KKIA 1ZGUB 1SB3C 3UGBB 5H92C 3PTFC 5D7GA 2K8CA 2B76B 3E56A 3ZTDA 1YQBA 2I2YA 1FNUA 3CSTA 3TEWA 2EMTA 2KX0A 2EKIA 3NZSA 3WA0A 1NYRA 1XLQA 1MI0A 1TY2A 2UWQA 3V3XA 1WX9A 3WALA 4MEMA 1D5ZC 3AE3B 4IG7B 1NI2A 2JSVX 4KGSA 3AE7B 2IGGA 3QAQA 2N9KA 2RDGA 4EUTA 3NS1A 1D3ZA 2MSED 1TS3A 4GDLB 3IHPC 1SSNA 4W9KA 5J18A 2JRIB 2MEKA 2HTME 1F77A 1D6EC 1JRUA 3ZIMA 2BYEA 4JGHB 1XD3B 4MGZE 4M0WA 4NQLB 2KANA 2MBOA 4RCOA 4C80A 1Z2MA 2N4FA 3X23A 3O65B 1GPXA 4LK0M 4KIKA 1TKYA 4AJWA 4C56C 2LVQA 4WWNA 1GB1A 5KHQA 2KMMA 4W9HA 3PVLA 3V62A 4KSLC 4K7UA 2JQRB 3AE2B 4OW0A 2G9HD 2RSUA 1V2YA 1FFVA 3VRAB 2ASQA 3KW5B 2D07B 4NNJB 4BOZB 3AM9A 3VTVA 1NVID 4MSQB 3RZFA 3A4RA 2LGYA 2IGHA 2IO3B 2QHOA 5AUKA 3SFEB 2IBIB 5BMHA 3IFWB 1TS4A 3B2FA 4HWIB 3HVZA 2BYFA 1S1QB 3APCA 3M95A 1EO6A 4G50A 4URKA 1WGYA 4P7IA 1IBXB 5EE1A 1JWUD 2RGFA 3Q69A 4LLGM 3AEGB 2RMMA 1B9RA 1WJUA 3PPAA 1FRDA 1C4AA 3TMPB 3VDZA 4MACA 4BOSC 1R4NB 4HPPA 3V05A 1FXTB 2KTRA 3RN9C 1SJED 3FC4A 4G0NB 2HTHA 1K52A 2WGSA 3U7DA 1L5PA 1MHXA 4KZ0A 2LXCA 3LDZE 1P3QU 2PEAA 2KDFB 4YTNB 3MC0B 5FR3A 3KYDD 2J7QB 4ANVA 4YT0B 1ISNA 1V97A 3W1YA 1ROEA 5D2MB 4GMVA 4FN2A 2HJ1A 2K22A 2LEKA 2KLGA 3KUCB 3AECB 3DBRB 3HHMA 1LO5D 4M8NA 1RM6C 3PLUA 3DBHI 2KJHB 1Z5SB 4D2KA 3VH4B 4DDID 5BYRA 2INCC 3W9CB 2MJ3A 3JSVA 3PRPB 1JCKB 4TQ1A 1U4AA 2KKCA 3MJWA 3ZDMC 2WLBA 3ECIA 5J2RA 4DDGD 3RFZB 4GDLA 3AEFB 4NJ7A 1ET9A 1E0ZA 3V60A 1PGXA 1F0ZA 3MJ5A 1F9JA 3H6NA 3AULA 3KUZA 1JQ4A 3NS8A 4DHZB 5J17A 1N6ZA 3WAOA 2C60A 3H1UA 2AQ2B 3P4SB 2WNMA 3AI5A 3ZRFA 5JZEB 3M63B 2IJ0A 1T0SC 1WM3A 5LXIB 4DHJD 3RNEC 2Y5BB 3H8HA 3MTNB 3ZDTA 5D3IB 1IGCA 3GOEA 3QQ8B 1PFDA 2PMVA 5HI1A 1RYJA 3RNAC 3ZW3A 2NBVB 1BUIC 3WAMA 3CIRB 1V80A 3I5JC 1V5TA 2CR5A 3JYUA 3UF8A 2Y3AA 4GU2A 2AL6A 4BVUC 2BWFA 1I35A 3K9PB 2MLBA 2JRHA 1XCTL 4II3B 4ZHPA 4ANWA 4C7ZA 4HKQA 5DCNA 3R8BA 1J7BA 2FNJB 4JIOU 1IBXA 4DHZE 1WX7A 2W3SA 2WXFA 3N1ZC 3DVNU 4WAAA 3AEBB 2WXIA 4YTMB 2M0XA 2WXNA 1V1OA 3ZVVA 3AXCA 5D94A 2W82A 2PKOA 1WF9A 4AOFA 3QCAA 2C7HA 4IWQA 3DVNV 1IGDA 3SEBA 4ICVA 4HCNB 5E6OA 1V9JA 1C4CA 2LZ6A 1PDXA 1FIQA 1NEKB 1OGWA 4C00A 1GC7A 1HEZE 4WQOB 3TIXA 3VFKA 3O13A 2KQ7A 3ZXVA 1ZKHA 3PZ7A 1X1MA 4M01A 1QOBA 3PGEA 4JWUC 2MHJA 3OLMD 2JX5A 1WJ4A 3VTWA 1SE4A 1HTOA 3P1MA 5AZFA 1UF0A 2VZKD 3QC8B 4CHKA 2KN5A 2QCZA 1P0RA 2CHWA 1ZPSA 3RD2A 1B1ZA 2WU2B 1E90A 3NRZA 2N9XA 2KACA 4HVBA 4LNNA 2K8BA 5L95C 3SFDB 3P42A 2LFIA 4PS3A 4OZAA 4HRSA 1CMXB 2N9EB 1LXDA 2JPHA 1Q0WB 3BIID 4GLSC 3C8YA 1J0GA 2FE8A 3QX1A 2ZVNA 4TMAB 2YVCA 4B95A 4FXCA 5DPSA 3ZUNA 1WGGA 1YMHE 5C3JB 3X0WA 2KLCA 4A55A 2GBJA 4HJGE 4ANUA 1TGZB 2OHFA 5BMIA 2QDFA 2VZKB 2K25A 2XNAC 3PRMB 3I63C 4MT5A 5G5HA 3RMKC 3C19A 2PVGC 1GAQB 4MELA 4QAYA 2QSDA 1CQVA 3W1SA 2E6XA 5C2TB 4F8CB 2L05A 2FUHB 2WHIA 1QOFA 3PHWB 2DZJA 1MPEA 3VHTC 2DZKA 2BQQA 3J9CA 1FFUA 2NPTA 2N7EA 1KOTA 2ZW0A 2CHXA 2UU7A 4HDOA 2D3CA 3EECA 4N58A 4UDUC 4HPMB 2KVRA 3HM6X 4S0RA 2KXJA 1HZ6A 3UI3A 1XXGA 4L23A 2K3UA 3Q8BA 1AN8A 1SJHD 1QT9A 4PYUA 4US8A 4ZOHC 2KO3A 4I6NB 4KIKB 2I38A 2XBBC 3R3MA 3TEZA 3HUIA 4HCPB 1YIWA 1ZP0B 4NJCA 3S2AA 4FHJA 3R7RA 4HEA1 4M8MA 1GC6A 4KGTA 4NQKE 3AMZA 2O2VB 2W3RA 2NR2A 1LFDA 2MW5A 3N3KB 1FNWA 4OVVA 3M62B 2MBQA 3Q6BA 3FAHA 3DBLI 3PLVA 3WIMA 1T3QA 3NVYA 3ZXRA 4KX6B 1Q1OA 3KLSX 2LVOA 3BVGA 4ARCA 1UBQA 1E8WA 3N1XC 3PT2B 3EHVA 5G5GA 5I4DA 2BTEA 2N0SB 2YLMA 4JLCA 3QARA 1TS5A 2TSSA 2Y5CA 3IBEA 1UWXA 2BT6A 4RGOS 3R66C 3DCGA 4HJKA 5G55A 4EOYA 3LYYA 1RLFA 1M4VA 1XLOA 1L4DB 3AE8B 3VH3B 2LGIA 1Y8RC 1E8ZA 2ZCCA 4TV3A 3PSEB 5EDSA 1MFWA 1ESFA 2INDC 2KMCA 3AV8A 2KQSA 4N6EB 3Q2AC 2VRRB 3ZJVA 4FJVB 5EE9A 4G11A 3TBLD 1WYGA 1V81A 4HXDA 4ZRJA 1FMAD 2D10A 1UZXB 1ZE3D 3HIZA 2DNFA 2VH2A 1YN5A 2ZNVB 2GMIC 2GI9A 2QJLA 4XC2A 4EE2A 3A1QB 3GE8C 1T5XD 5DPWA 4NAWB 1FRRA 2L00B 1N62A 2MWSB 3E9SA 2KYWA 4MGKE 4H2AA 2PW9A 3PZ8A 2V9HA 3BZDB 2K1FA 1PGBA 5AZGA 5BYQA 2D5GA 4OZCA 1I42A 2JY6A 3DBHB 1DGJA 2ZJDA 3UIPB 1WR1A 3JSVB 4MH0E 1FD6A 1WMHB 1WYWB 4LDTB 3P2BA 1TBEA 3BVMA 4IKGA 3AE9B 1ENFA 4YL8A 1PYWD 2YEPB 2N7JA 2BS4B 2L52A 2HDEA 3L17A 2IPKD 3IXSA 3PO0A 1E8XA 1VZ8A 4PS7A 1VCBA 1WXSA 4GB9A 2MH7A 3EFUA 5FR6A 4E74A 1FEHA 4ZRQA 2KDEB 4II2B 2K9XA 1WY8A 5BMGA 3NZUA 3AH7A 4EFOA 2JT4B 2PJHA 3KWLA 2AL3A 1DOIA 4ZRPA 2V4IB 2O2VA 4ZYNA 4RM8A 1G6JA 1T0RC 3N30A 2KN4A 1P98A 1PUTA 2ZPYA 4ACFA 1FM0D 2H88B 2G3QB 2DYOA 1WGRA 1JWMD 2R61A 5IKCM 3T3NA 4RFBA 3ZYYX 3RZWC 1YJIA 1UELA 1L6VA 1K50A 1Y56A 3SR6A 4EZJA 4IC7B 2OJRA 1WZ0A 1EU4A 3L13A 5BYSA 5EE0A 5IO9A 4KGRA 4AP4C 2PVOD 4MSMB 1R4MI 2K39A 2O6VB 1QLBB 2C7NB 1XLNA 2WWZA 2WXQA 2N1VA 2Y5PA 3A9JA 1UNSA 3KQ4A 2RDBC 4IUMB 2IY0B 4YSXB 2KWDA 4DQOC 2RR9A 4IM0A 3T8MA 3N20C 5AUIA 3RCZA 2PLPA 3I57A 1P7FA 2MP2B 3DBSA 1F2RC 4YXDB 2CJNA 2NTTA 4GN1A 2REXA 2R2OA 1SE3A 2WXHA 3BYTB 3ZRCA 4JWSC 4WJPA 3DVGX 2JXTA 3A1QA 2GB1A 2LWPA 4NAWA 1AW7A 1KM7A 3DVGY 5HFYA 2V3NA 1WX8A 5HHDG 3ZNID 4ICUA 1OEYJ 3RUIB 3DOWA 4XYCA 5EE3A 4K7WA 2DBYA 2JZPA 2KHWB
chains in the Genus database with same CATH topology
1SE4A 3Q8CA 3WCQA 2WXGA 1MHHE 4B0EA 2KAJA 3VR8B 3P63A 3P1MA 1I4PA 2VZKD 4P6VF 1JRPA 1OFFA 1JWAD 3AE4B 4XDDA 3TUOA 4AS1A 3LB8C 2FUG1 3U2SC 4MH8A 4RH6A 1I4QA 2J52A 4J3OD 1KRHA 1ZPSA 4C7YA 1I4RA 2WXKA 3BYYB 1B1ZA 3B9JA 3T3OA 2NMQA 2BYTA 3IAM1 1FXAA 1YJJA 2KQ4X 2WU2B 3NRZA 2KACA 4ZHOA 4A6QA 3Q8AA 3R2TA 5TSSA 3CWIA 1YN4A 4US9A 4IDIA 1J7CA 3U7ZA 4A90A 3SFDB 3P42A 2LFIA 1OQRA 4OZAA 1XLPA 3TEXA 5D3DA 4HRSA 1GOZA 4NZLB 3AB5A 4ITKA 1RFKA 2IDYA 2WS3B 3VR9B 3BIID 4GLSC 3C8YA 1K51A 1FNVA 1PGAA 1T6BX 2G1EA 2FE8A 4N59A 1JROA 1L6UA 2ICIA 1MVKA 4TMAB 3DWMA 4FXCA 4YSYB 4B0MA 2BS3B 2JYEA 1J7AA 1YMHE 5C3JB 4WQMA 1QF6A 1WSPA 1I7HA 3W2DA 3BK2A 4A55A 3DWGC 4HJGE 2XN9C 4REZA 2SEBD 2J42A 1KFYB 1FXIA 2OHFA 5BMIA 3NUHB 1DOXA 4ARIA 4XE0A 2VZKB 2XNAC 5FK9C 3OWEB 2WDRB 2K5PA 2BS2B 4MT5A 5G5HA 1VZ6A 2WXPA 3U4EG 1C76A 1TJEA 1ZUD2 2LHEA 2PVGC 1GAQB 1UGJA 2QSDA 1CQVA 3W1SA 2E6XA 4Q2JA 2Q5WD 4MM3B 5C2TB 1TKEA 2WP9B 3MHZA 1WWTA 5E6JA 1QOFA 1VR9A 3AEDB 4L2YA 2RPVA 4HKZE 3LXFA 2QEJC 4KKIA 1SB3C 2WQYB 1MPEA 2FBWB 4TQ0A 5H92C 5D7GA 2B76B 3J9CA 3E56A 2NTSA 3R2IA 2I2YA 1WRIA 1FNUA 1FFUA 1SE2A 1TZOA 3TEWA 5MPOA 2EKIA 4OZBA 1NYQA 1SEBD 2WXMA 1NYRA 2BW2A 3MP9A 2ZW0A 1XO3A 1UUPA 1XLQA 1MI0A 1TY2A 4USAA 1XCQL 1KLGD 3V3XA 2J53A 5LNK1 4N58A 4UDUC 2H89B 2WDQB 2EELA 1QOAA 3URYA 5FKAC 2MJEA 1D5ZC 3AE3B 4NAMA 2LHDA 1L0XB 2JSVX 3ZJUA 4KGSA 1HZ6A 1NENB 2IGGA 3AE7B 3UI3A 1XXGA 1VJKA 3P4QB 2N9KA 4JX1C 4L23A 2K3UA 2WXRA 2RDGA 3Q8BA 4KKJA 3NS1A 1HQRD 4CQNA 1AN8A 1SJHD 1QT9A 3NZ3A 4US8A 4ZOHC 2X38A 2DWQA 2N9LA 2I38A 1TS3A 1NI3A 2OEDA 4GDLB 3TEZA 1SSNA 3HUIA 2MEKA 2HTME 1F77A 3FILA 1ZP0B 1D6EC 4NJCA 2GRIA 1JWSD 4HEA1 1I4GA 1TS2A 1N5XA 4TSSA 3ETRA 1HA5A 2WXJA 3AMZA 4KGTA 4M0WA 3VQIA 1WXQA 1L0VB 2W3RA 4RCOA 3IAS1 1KLUD 4C80A 2QILA 1FNWA 1GPXA 1L4ZB 4R3DA 4LK0M 1EWCA 3AEEB 2M0AA 1TKYA 3FAHA 1Q10A 1E7PB 4C56C 1T3QA 1GB1A 2KMMA 3NVYA 1D5MC 2JQRB 2JWUA 3AE2B 4KX6B 4RGNA 3KLSX 1BXTA 2G9HD 2QIEB 4OW0A 4RF0A 3BVGA 4YTPB 4ARCA 2L83A 1FFVA 3P4RB 1ZXHA 5G5GA 3VRAB 3KWVA 3NVVA 5I4DA 2BTEA 1FCLA 2J4XA 2N0SB 3AM9A 3EA6A 1TS5A 1D5XC 1EWYC 1YQ3B 2TSSA 2Y5CA 3TSSA 1UWXA 2BT6A 1ZDXA 4RGOS 3L4PA 1NVID 2CJOA 3W5VB 2JYTA 1CZPA 3ZGZA 2IGHA 3LYYA 3AN1A 2MJDA 3AE6B 5AUKA 1M4VA 2WU5B 3SFEB 5BMHA 3VRBB 3TEYA 1XLOA 3GB1A 1L4DB 3AE8B 3EUB2 4JE3B 5H8YE 1TS4A 2LGIA 3B2FA 2WXOA 4P16A 5HG2A 4L1BA 1HXYD 3HVZA 4XDCA 1ESFA 3AV8A 3BK1A 4ZYSA 4N6EB 4A9AA 1VRAB 3ZJVA 1V1PB 2CU3A 4GDKB 2YEPF 1IBXB 5EE9A 5EE1A 1QILA 1JWUD 1YN3A 2M56B 1UWMA 3Q69A 4LLGM 3AEGB 3W5UB 1WYGA 2RMMA 2WDVB 1B9RA 4AQ7A 1EM7A 2W55A 1VZ7A 1FMAD 1FRDA 1C4AA 1STEA 4JPSA 4XWWA 1C9FA 2AQ3B 4MACA 1ZE3D 4RGMA 1C4PA 3AE1B 2BB6A 3V05A 1YN5A 2ONQA 1SJED 1A70A 2W54A 3FC4A 2GI9A 1IUEA 3Q8FA 2QJLA 2K0PA 1K52A 1L5PA 2AX5A 1MHXA 4EE2A 1T5XD 4NAWB 2L32A 1N60A 1FRRA 3ZQ4A 2IGDA 4RGTA 3BWUD 2INPE 1N62A 3E9SA 4H2AA 1I4XA 2PW9A 3PZ8A 3I9V1 1JALA 4YTNB 3MC0B 3BZDB 5FR3A 1PGBA 5BYQA 1TY0A 2D5GA 4OZCA 1JMLA 2ZW1A 3AEAB 4YT0B 1SBBB 1V97A 1DGJA 1WGKA 1ROEA 4YWGG 1FD6A 5T8IA 2K22A 2LEKA 3GP7A 3AECB 1LO5D 3IT6B 1ET6A 1RM6C 3BVMA 3AE5B 4IKGA 3AE9B 4D2KA 1ENFA 1PYWD 1E10A 3HVDA 1FCCC 5BYRA 2JU6X 2YEPB 4PT5A 1ZXIA 2N7JA 2BS4B 3W9CB 1R7SA 2SAKA 2MJ3A 2L52A 2HDEA 4IOIE 3BVZA 2IPKD 3IXSA 3PO0A 1XEEA 2M19A 1VZ8A 1TKGA 1JCKB 4TQ1A 2V0GA 2MH7A 2DLBA 3GS2A 2WLBA 1FEHA 3RFZB 3AEFB 4ZRQA 1QOGA 3B2GA 4RF1A 2K9XA 1ET9A 1JWBD 1E0ZA 5BMGA 1GB4A 1PGXA 1QKZA 2L1AA 3AH7A 1F0ZA 3MJ5A 2QMTA 1C79A 4YSZB 1TYGB 1JQ4A 3KWLA 1DOIA 2LJIA 2V4IB 3P4PB 4ZRPA 2RDHA 3NVZA 1L0YB 1KTKA 2KN4A 2AQ2B 2INNE 3P4SB 2WNMA 1PUTA 2IJ0A 1K53A 1FM0D 2ACZB 1AYFA 2H88B 2ON8A 1VLBA 1CJEA 2KDMA 3NVWA 2DYOA 2LUMA 3H8HA 1V8CA 1DOYA 1JWMD 1ZOYB 5D3IB 1IGCA 2BB5A 5JXVA 1PFDA 2R61A 2PMVA 5HI1A 3T3NA 1RYJA 2WXLA 4RFBA 1QQRA 4XWTA 4WAFA 3ZYYX 1JW9D 1YJIA 2DYMA 3ABVB 1BUIC 2Z8LA 4A8XC 1L6VA 1XF5L 1K50A 1Y56A 3SR6A 3CIRB 1EU4A 4WIPA 5BYSA 4OHJA 3RPFC 1C78A 5EE0A 4KGRA 1SIJA 2PVOD 2Y3AA 1SF0A 3ZJTA 1RWSA 1QLBB 1XLNA 2PTLA 1D4BA 2LMCA 4WWMA 1XCTL 2WXQA 1BMLC 4ZHPA 1KH0A 2Y5PA 4C7ZA 4DXGA 1N5WA 4HKQA 1OQQA 1UNSA 2BBCA 3KQ4A 1EU3A 1YNTE 1HZ5A 1C77A 3R8BA 1J7BA 3EGRA 1VDVA 1F2RI 4WURA 4YSXB 2KWDA 4HROA 4DQOC 1P7EA 4DXFA 1V1PA 1ZDVA 1IBXA 4RNAA 2WXFA 1AWDA 2W3SA 2PLPA 3I57A 5AUIA 1E6EB 3MFGA 1YQ4B 1P7FA 1N63A 3AEBB 5GXGB 1F2RC 2WXIA 4YXDB 2CJNA 4YTMB 2E3TA 2WXNA 4OVZA 2NTTA 1V1OA 1I4HA 3N9YC 1ACCA 4LTUA 2W82A 2PKOA 3HRDD 1CK1A 1SE3A 2WXHA 3BYTB 3Q8EA 4O1NA 1IGDA 3U52E 4JWSC 2PIAA 2JXTA 3SEBA 2GB1A 1AW7A 4WH4A 1E9MA 1SXTA 1KF6B 3FILB 5HFYA 2V3NA 2AQ1B 1DYQA 1C4CA 5HHDG 3IT4B 1PDXA 1FIQA 1NEKB 1HEZE 1N61A 2V3PA 5EE3A 3O13A 2DBYA 3PZ7A 2JZPA 1FO4A 1QOBA 4JWUC 2JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKI A;  5MPO A;  1NYQ A;  3WCQ A;  1NYR A;  2KAJ A;  3NVZ A;  3HVZ A;  3AV8 A;  3VR8 B;  3P63 A;  3P1M A;  1XO3 A;  1PUT A;  3P4S B;  1JRP A;  4N6E B;  4P6V F;  4A9A A;  1OFF A;  1JWA D;  1XLQ A;  3AE4 B;  2CU3 A;  4USA A;  3LB8 C;  1FM0 D;  5EE9 A;  2ACZ B;  1AYF A;  2H88 B;  5EE1 A;  2M56 B;  1UWM A;  1VLB A;  1CJE A;  4N58 A;  3NVW A;  2H89 B;  2WDQ B;  1QOA A;  1V8C A;  3AEG B;  3W5U B;  1DOY A;  1WYG A;  2WDV B;  1B9R A;  1KRH A;  1ZOY B;  1PFD A;  2W55 A;  2MJE A;  1FMA D;  1RYJ A;  4C7Y A;  1FRD A;  3ZYY X;  3AE3 B;  1JW9 D;  1YJI A;  3B9J A;  3ABV B;  1NEN B;  3AE7 B;  1L6V A;  1FXA A;  3AE1 B;  1YJJ A;  1VJK A;  2WU2 B;  3NRZ A;  3SR6 A;  3P4Q B;  4JX1 C;  4ZHO A;  1A70 A;  2W54 A;  3FC4 A;  1IUE A;  3CIR B;  3CWI A;  2QJL A;  3NS1 A;  4US9 A;  4IDI A;  1J7C A;  1L5P A;  1QT9 A;  2AX5 A;  4US8 A;  4ZOH C;  2DWQ A;  3RPF C;  3SFD B;  5EE0 A;  1OQR A;  1N60 A;  1FRR A;  1NI3 A;  1XLP A;  1SIJ A;  2PVO D;  3HUI A;  1SF0 A;  1RWS A;  4HRS A;  2HTM E;  1N62 A;  1ZP0 B;  1QLB B;  1XLN A;  3AB5 A;  4ITK A;  4YTN B;  1RFK A;  4WWM A;  1JAL A;  2WS3 B;  3VR9 B;  3BII D;  1N5X A;  4ZHP A;  3ETR A;  3AMZ A;  1WXQ A;  4C7Z A;  1L0V B;  2W3R A;  3AEA B;  1N5W A;  4YT0 B;  5H8Y E;  1OQQ A;  4C80 A;  1V97 A;  1DGJ A;  2G1E A;  1WGK A;  4N59 A;  1JRO A;  1ROE A;  1L6U A;  1GPX A;  1J7B A;  1VDV A;  3DWM A;  2K22 A;  4YSX B;  3AEE B;  2LEK A;  4FXC A;  4YSY B;  2BS3 B;  1J7A A;  1TKY A;  4HRO A;  3FAH A;  4WQM A;  5C3J B;  1QF6 A;  1E7P B;  1I7H A;  3AEC B;  1T3Q A;  3DWG C;  5AUI A;  1AWD A;  2W3S A;  2KMM A;  1RM6 C;  1E6E B;  3NVY A;  3P4P B;  1YQ4 B;  3AE5 B;  3AE9 B;  1N63 A;  3AEB B;  2JQR B;  4KX6 B;  2OHF A;  1KFY B;  1FXI A;  3AE2 B;  1DOX A;  1E10 A;  5GXG B;  4YXD B;  2CJN A;  4YTM B;  2E3T A;  2QIE B;  4YTP B;  1ZXI A;  4LTU A;  2L83 A;  1FFV A;  2WDR B;  2K5P A;  2PKO A;  3P4R B;  2BS2 B;  3HRD D;  5G5G A;  3VRA B;  2BS4 B;  3NVV A;  5G5H A;  3W9C B;  1R7S A;  2MJ3 A;  1TJE A;  2L52 A;  2N0S B;  1ZUD 2;  3AM9 A;  2PVG C;  1GAQ B;  3PO0 A;  1EWY C;  1YQ3 B;  2M19 A;  5C2T B;  2Q5W D;  1TKG A;  2Y5C A;  2PIA A;  4JWS C;  1TKE A;  2WP9 B;  1WWT A;  2MH7 A;  1QOF A;  2BT6 A;  1E9M A;  3AED B;  1NVI D;  3L4P A;  2WLB A;  2CJO A;  3W5V B;  3AEF B;  1CZP A;  1KF6 B;  3LXF A;  1QOG A;  3B2G A;  1SB3 C;  2K9X A;  2WQY B;  2FBW B;  1JWB D;  1PDX A;  5H92 C;  3AN1 A;  1FIQ A;  1E0Z A;  1NEK B;  2MJD A;  2B76 B;  3AE6 B;  3AH7 A;  1F0Z A;  1N61 A;  5AUK A;  5EE3 A;  2WU5 B;  3SFE B;  3VRB B;  1WRI A;  4YSZ B;  1XLO A;  1TYG B;  3AE8 B;  2DBY A;  1JQ4 A;  1FO4 A;  1FFU A;  3EUB 2;  1QOB A;  1DOI A;  3KWL A;  4JWU C;  3B2F A;  2JX5 A; 
#chains in the Genus database with same CATH topology
 4ZDV A;  1MHH E;  2BWE S;  2KAJ A;  1V5O A;  1WJN A;  2BKR B;  1WMH A;  3BY4 B;  3LB8 C;  3UIO B;  3U2S C;  5JHB A;  4MH8 A;  4RH6 A;  4C7Y A;  5IOI A;  2AYO B;  3T3O A;  3IAM 1;  1YJJ A;  4FHK A;  2CU1 A;  3L16 A;  4ZHO A;  4P1B C;  2NS5 A;  1YN4 A;  4RMA A;  1J7C A;  4HPL B;  3U7Z A;  4A90 A;  4BZA A;  4ZRK A;  1XLP A;  4PYZ A;  3TEX A;  3PV1 A;  1GOZ A;  2OOB B;  2K8H A;  4NZL B;  1S3S G;  1GG3 A;  3N1Y C;  3PRZ A;  2IDY A;  3VR9 B;  2BYV E;  3I3T B;  1PGA A;  4PK1 A;  2HJ8 A;  1T6B X;  2G1E A;  2JXX A;  3OJ4 B;  2KK8 A;  3QHT A;  2MQJ A;  3EC8 A;  4YSY B;  4WQM A;  1V49 A;  2K6Q A;  3W2D A;  3BK2 A;  2FCM A;  2XN9 C;  4REZ A;  3H9D A;  3DHG C;  4KVG B;  3OWE B;  2BS2 B;  2NPT B;  3U4E G;  1VZ6 A;  1C76 A;  2HD5 B;  1UGJ A;  2K6D B;  4MM3 B;  2J0J A;  5E6J A;  3AED B;  3Q3O C;  2RPV A;  2WX0 A;  2KJ6 A;  3ZNG C;  3QIJ A;  2QEJ C;  4N9F 4;  2WQY B;  2KT7 A;  2O6V A;  4TQ0 A;  1WRD B;  3BIN A;  3KYC D;  2MBB B;  2LAS A;  3RNF C;  4BBN F;  4NY0 A;  5MPO A;  1NYQ A;  1SEB D;  2WXM A;  1WJ6 A;  5G2N A;  2L76 A;  3ZNZ B;  1MJD A;  1WGD A;  4USA A;  1R4N I;  1XCQ L;  5LNK 1;  2H89 B;  2WDQ B;  5E6P A;  4MJS B;  2KFJ A;  2MP2 A;  3RT3 B;  2MJE A;  4IM2 A;  2LHD A;  1L0X B;  2BVC A;  1NEN B;  2A4Z A;  2J0K A;  4AJY B;  3DHI C;  4JX1 C;  1OTR B;  2PE9 A;  2WXR A;  3SU8 X;  1HQR D;  5DPT A;  3NZ3 A;  1WIA A;  2DWQ A;  2N9L A;  2OED A;  3V6E B;  2IO2 B;  4F7Z A;  2X8X X;  3MC9 A;  2GBR A;  1I4G A;  1TS2 A;  4TSS A;  3ETR A;  1HA5 A;  2WXJ A;  3VTU A;  2DEN B;  1L0V B;  3IAS 1;  2L7R A;  3DHH C;  2QIL A;  1L4Z B;  4IWP A;  4R3D A;  3AEE B;  1WZ3 A;  2M0A A;  1Q10 A;  1E7P B;  2BGF A;  1TT5 B;  4MGY E;  4HK2 A;  2KDB A;  1D5M C;  4HLE A;  1SE9 A;  3RUL A;  2LGS A;  4EKU A;  2CHZ A;  4K3C A;  4EZK A;  1BXT A;  2QIE B;  4RF0 A;  2L83 A;  1ZXH A;  5CHF A;  3NVV A;  1YJ1 A;  3K9O B;  1IP9 A;  4AUQ C;  3VUY A;  3Q14 C;  1D5X C;  1EWY C;  3T9L A;  2KWC A;  3DQV A;  1C1Y B;  1ZDX A;  3L4P A;  3Q3J A;  2DX5 B;  2JYT A;  3ZTC A;  1OEY A;  4BBN C;  3ZGZ A;  4JL9 A;  3AN1 A;  2I1K A;  2MJD A;  3TEY A;  2WU5 B;  3VRB B;  3DPD A;  5H8Y E;  1IYF A;  4P16 A;  2WDT B;  3BK1 A;  1WM2 A;  4ZYS A;  2MBH A;  1VRA B;  1V1P B;  2CU3 A;  4GDK B;  3Q3F A;  3KVF B;  1YN3 A;  2RD0 A;  2C9W B;  1MG4 A;  1VZ7 A;  4G3X B;  4GOC A;  1STE A;  4JPS A;  2D3A A;  1C9F A;  2AQ3 B;  4CYE A;  3OJ3 A;  3VXW A;  2BB6 A;  2FAZ A;  2ONQ A;  4LJP B;  1A70 A;  3Q8F A;  1IUE A;  2DYB A;  3H7P B;  2EMS A;  4MM3 A;  4KZC A;  2IGD A;  3BWU D;  4FBJ B;  4KDL B;  1I4X A;  1L7Y A;  3TJP A;  1F52 A;  2WX1 A;  4FUL A;  2MRP A;  4OVU A;  3AEA B;  4DBG A;  1SBB B;  2JZZ A;  2NVU I;  5JHA A;  4E3C A;  3V61 A;  5T8I A;  3NOB A;  2LJ5 A;  1V86 A;  2LD9 A;  3ALB A;  1ET6 A;  4MDK E;  3AE5 B;  4MJS A;  2KJR A;  3HVD A;  1ZXI A;  1UH6 A;  2L0F A;  1R7S A;  3U30 A;  3SHQ A;  3BVZ A;  4TUU A;  2JF5 A;  1TKG A;  3PRE A;  1M94 A;  2V0G A;  3GS2 A;  1QOG A;  4GSW A;  1RFA A;  5E6N A;  1GB4 A;  2G4D B;  1QKZ A;  2L1A A;  5IP4 D;  4IM3 A;  4XZ4 A;  2N9P C;  4YSZ B;  2D2Q A;  1KTK A;  3RNC C;  2INN E;  2GOW A;  3JW0 X;  1K53 A;  1AYF A;  1A5R A;  2DAF A;  2ON8 A;  4ANX A;  1V8C A;  1DOY A;  5C1Z A;  4W9J A;  1ZOY B;  4W9E A;  2BB5 A;  5JXV A;  4XWT A;  2FIF A;  2CS4 A;  4IWO A;  3A9J B;  1R4M B;  4LDT D;  1XF5 L;  2MBE A;  4BKS A;  3VUX A;  1WXA A;  1GUA B;  3RPF C;  1C78 A;  2G4S A;  3U8Z A;  4B6W A;  4ASW C;  1SIJ A;  3WAP A;  2ZVO A;  1WH3 A;  4WWM A;  1BML C;  2GBN A;  1KH0 A;  1V6E A;  3AU5 A;  1N5W A;  1OQQ A;  2KWV B;  1EU3 A;  3EGR A;  1F2R I;  3W1S C;  4GIV A;  2L0T A;  1RAX A;  4KV2 A;  4DXF A;  1V1P A;  4GDK A;  1AWD A;  1E6E B;  3MFG A;  3SDL C;  2ZCB A;  2LGX A;  1N63 A;  3UQB A;  3APF A;  5GXG B;  2DZM A;  2AEH A;  3N9Y C;  1I4H A;  1TTN A;  3B1L X;  3HRD D;  5IAA C;  3H7P A;  4O1N A;  4WWP A;  2C7M B;  4WH4 A;  3GZN I;  1SXT A;  3FIL B;  1HE8 A;  3UQA A;  1TIF A;  5BO4 B;  4EZL A;  2V3P A;  3L0W B;  1IPG A;  2G45 B;  1FO4 A;  2QC8 A;  3SD5 A;  4ZRI A;  3Q8C A;  2O6V D;  2WXG A;  3P63 A;  2L3Z A;  4FJZ A;  4P6V F;  1JRP A;  4HDQ A;  3TCA A;  2KNB A;  1JWA D;  3TUO A;  5AEK B;  1SIF A;  2FUG 1;  2ZEQ A;  3D32 A;  3B0A A;  2BKF A;  2J52 A;  4J3O D;  1KRH A;  1GNU A;  1P9D U;  4DXA B;  1WXV A;  4BKG A;  4NJ6 A;  2WXK A;  3BYY B;  3B9J A;  2Z0E B;  4BAX A;  2NMQ A;  2M8S A;  2BYT A;  2KQ4 X;  4GGQ A;  4A6Q A;  3Q8A A;  3R2T A;  5TSS A;  4US9 A;  2JZ3 B;  4IDI A;  3L54 A;  3OAW A;  1UD7 A;  3AB5 A;  4ITK A;  2WS3 B;  3HK0 A;  1KJT A;  4GXB A;  1K51 A;  4LNO A;  1FNV A;  1UBI A;  1JRO A;  1L6U A;  2ICI A;  2DHZ A;  2LRW A;  3LJ3 A;  2BS3 B;  1J7A A;  1AAR A;  3PZD A;  1WSP A;  3NJT A;  1I7H A;  4K81 A;  3DWG C;  2IYD B;  1XT9 B;  2LGD A;  3ML9 A;  4EEW A;  3ZNH B;  3H7S A;  1FXI A;  3NUH B;  4ARI A;  3ZLZ A;  5IA7 A;  5FK9 C;  2K5P A;  4KDI C;  1E7V A;  2LI5 A;  5AZH A;  1ZW7 A;  3A9K B;  5CHW A;  2KFK B;  2LUE A;  5L83 A;  1J19 A;  2NBU A;  1UGM A;  2WP9 B;  1E5W A;  2FCQ A;  4L2Y A;  4HKZ E;  1WGH A;  3LXF A;  3UIN B;  4XX5 A;  2FBW B;  4C4V B;  4LJO B;  1HTQ A;  2NTS A;  4S17 A;  2I1J A;  2Z0D B;  3R2I A;  1WRI A;  3VVW B;  1SE2 A;  1TZO A;  2BF8 B;  4OZB A;  4LNF A;  2BW2 A;  3MP9 A;  1XO3 A;  3RNG C;  1UUP A;  5CHV C;  4LNI A;  3IG3 A;  1KLG D;  2J53 A;  1WXM A;  3AU4 A;  1WE6 A;  2EEL A;  1QOA A;  3URY A;  5FKA C;  2NCN A;  4NAM A;  5IN7 A;  3ZJU A;  3GE3 C;  3KH0 A;  1VJK A;  4W9G A;  3P4Q B;  4M00 A;  4KKJ A;  2LRU A;  2JUO A;  4CQN A;  1NBF C;  2X38 A;  3VAW A;  1NI3 A;  2FID A;  3L08 A;  4DWF A;  3FIL A;  2GRI A;  2GBM A;  1JWS D;  4XGA B;  1Q5W B;  4K3B A;  1N5X A;  3VQI A;  1WXQ A;  1KLU D;  2XEW A;  2V3S A;  1P1A A;  4A3P A;  3HM3 A;  1EWC A;  2IO1 B;  3QA8 A;  2AWT A;  4J6I A;  3M3J A;  2KC2 A;  4X57 B;  3QJZ A;  2JWZ A;  2JWU A;  4RGN A;  4JQW C;  5TR5 A;  4FJY A;  4YTP B;  1E7U A;  3P4R B;  2KVZ A;  3KWV A;  2KWU B;  2IZV B;  2KOX A;  2J4X A;  1FCL A;  4WJN A;  3EA6 A;  1EF5 A;  1YQ3 B;  4W9C A;  3TSS A;  5HKH A;  5JH5 C;  2CJO A;  3MHS D;  3W5V B;  1CZP A;  2DAJ A;  4FA6 A;  2V1Y A;  4F1S A;  1F1H A;  3AE6 B;  4AWJ A;  5KHO A;  2LXA A;  3GB1 A;  2OJW A;  3EUB 2;  4JE3 B;  4BKT A;  2WXO A;  3A4S C;  1YX5 B;  5HG2 A;  4L1B A;  1HXY D;  4XDC A;  4FLH A;  2C5L C;  1KLV A;  4A9A A;  2YEP F;  1QIL A;  2M56 B;  1UWM A;  2ZPN A;  1OQY A;  3NY5 A;  2WDV B;  3W5U B;  4AQ7 A;  2JVC A;  1EM7 A;  2W55 A;  3EFC A;  4MGI E;  2KX3 A;  2KDI A;  4XWW A;  2XK5 B;  3KUD B;  2A5U A;  4RGM A;  1C4P A;  3AE1 B;  2W54 A;  3A9K A;  2KFK A;  2J0M A;  2K0P A;  2AX5 A;  3CSF A;  1H8C A;  2MX2 A;  2L32 A;  1N60 A;  3ZQ4 A;  4RGT A;  4KSK C;  4I6L B;  2VH1 A;  5CTR C;  4BKS D;  2PPH A;  2INP E;  4LNK A;  5GMV A;  4C4V A;  3I9V 1;  1JAL A;  5DPR A;  2V4L A;  1TY0 A;  1JML A;  2ZW1 A;  4DHJ B;  1LGR A;  1PQS A;  2KTF A;  1WGK A;  2UYZ B;  2ZNV C;  4YWG G;  3VUW A;  3GP7 A;  3RNB C;  2L8J A;  3IT6 B;  2KZR A;  3FKY A;  1E10 A;  4A20 A;  1FCC C;  1K8R B;  2JU6 X;  4PT5 A;  2FCS A;  3DBL B;  2KD0 A;  3DBR I;  5LXH A;  2SAK A;  4IOI E;  3Q3N C;  1XEE A;  1XQQ A;  2MA9 B;  2M19 A;  3N32 A;  2M17 A;  2DLB A;  3OG5 A;  3B2G A;  4RF1 A;  1T0Q C;  1JWB D;  4FAD A;  2N1W A;  1C79 A;  2QMT A;  1TYG B;  4K1R B;  2LJI A;  1FPY A;  3P4P B;  4LCD E;  1WE7 A;  2GBK A;  2RDH A;  4K7S A;  2IY1 B;  4W9L A;  3NVZ A;  1L0Y B;  2BPS A;  2ACZ B;  1WI0 A;  1VLB A;  1CJE A;  2KDM A;  3NVW A;  2LUM A;  3V6C B;  3PS6 A;  2HE7 A;  4WWO A;  3IVF A;  3ML8 A;  1BT0 A;  2WXL A;  4WAF A;  1QQR A;  1JW9 D;  3C0R B;  2ZZP B;  2DYM A;  3ABV B;  2EKE C;  2Z8L A;  3MC8 A;  4A8X C;  3A33 B;  5C23 A;  1H4R A;  1QZE A;  4WIP A;  1WFY A;  4PS8 A;  1GJZ A;  4OHJ A;  3DDC B;  4W9D A;  3WAN A;  5LLI A;  1SF0 A;  3ZJT A;  1RWS A;  3B08 A;  1T0Y A;  2RPQ A;  2IO0 B;  2MCN B;  4TKN A;  2PTL A;  1D4B A;  2LMC A;  4DXG A;  2BBC A;  4M02 A;  1YNT E;  4A3O A;  1HZ5 A;  1C77 A;  1VDV A;  4WUR A;  2WYQ A;  3PHX B;  4IW0 A;  4HRO A;  3CF6 E;  1P7E A;  1ZDV A;  2DZI A;  4RNA A;  3TL5 A;  1E8Y A;  1YQ4 B;  3Q3M C;  1EF1 A;  1RRB A;  4E71 A;  1J8C A;  2E3T A;  1TZ1 A;  4OVZ A;  2XK5 A;  1ACC A;  2M1M A;  2KC1 A;  3GZN B;  4LTU A;  4CO7 A;  3RYT A;  1CK1 A;  2FCN A;  2Z59 B;  3Q8E A;  3JVZ X;  3U52 E;  2LVP A;  2B3A A;  2CKH B;  2PIA A;  1E9M A;  1KF6 B;  2AQ1 B;  1DYQ A;  2D11 A;  1LQB A;  3IT4 B;  3L10 B;  1N61 A;  4M0W B;  4B9K A;  3WCQ A;  3RI7 C;  4B0E A;  4WJQ A;  3VR8 B;  1I4P A;  1OFF A;  3AE4 B;  4XDD A;  4AS1 A;  4W9I A;  3ONS A;  4I6P A;  1I4Q A;  3NHE B;  2D3B A;  1MG8 A;  1YX6 B;  1I4R A;  3ZKJ C;  1FXA A;  4WJO A;  2R2Q A;  4W9F A;  3CWI A;  2D3G A;  2M4N A;  3CMM B;  3QK0 A;  1OQR A;  4RM9 A;  1WR6 E;  5D3D A;  1L2N A;  1VD2 A;  2NBW B;  4DK5 A;  1RFK A;  3ENE A;  3NG0 A;  1C3T A;  2N7D A;  4N59 A;  4P1C C;  1SGH A;  1MVK A;  1NDD A;  1YOV B;  3DWM A;  4B0M A;  2JYE A;  1QF6 A;  2KMA A;  1EUV B;  3QWZ B;  2GLS A;  4BFR A;  2SEB D;  2J42 A;  1KFY B;  1YD8 U;  1DOX A;  4XE0 A;  1LM8 B;  2WDR B;  2KTR B;  2WXP A;  3APD A;  1TJE A;  1ZUD 2;  2LHE A;  3R7Q A;  2W9N A;  2PE6 B;  4NPN A;  5CX3 A;  4Q2J A;  2Q5W D;  1TKE A;  3MHZ A;  1WWT A;  1VR9 A;  5D6J B;  3ZO5 B;  4KKI A;  1ZGU B;  1SB3 C;  3UGB B;  5H92 C;  3PTF C;  5D7G A;  2K8C A;  2B76 B;  3E56 A;  3ZTD A;  1YQB A;  2I2Y A;  1FNU A;  3CST A;  3TEW A;  2EMT A;  2KX0 A;  2EKI A;  3NZS A;  3WA0 A;  1NYR A;  1XLQ A;  1MI0 A;  1TY2 A;  2UWQ A;  3V3X A;  1WX9 A;  3WAL A;  4MEM A;  1D5Z C;  3AE3 B;  4IG7 B;  1NI2 A;  2JSV X;  4KGS A;  3AE7 B;  2IGG A;  3QAQ A;  2N9K A;  2RDG A;  4EUT A;  3NS1 A;  1D3Z A;  2MSE D;  1TS3 A;  4GDL B;  3IHP C;  1SSN A;  4W9K A;  5J18 A;  2JRI B;  2MEK A;  2HTM E;  1F77 A;  1D6E C;  1JRU A;  3ZIM A;  2BYE A;  4JGH B;  1XD3 B;  4MGZ E;  4M0W A;  4NQL B;  2KAN A;  2MBO A;  4RCO A;  4C80 A;  1Z2M A;  2N4F A;  3X23 A;  3O65 B;  1GPX A;  4LK0 M;  4KIK A;  1TKY A;  4AJW A;  4C56 C;  2LVQ A;  4WWN A;  1GB1 A;  5KHQ A;  2KMM A;  4W9H A;  3PVL A;  3V62 A;  4KSL C;  4K7U A;  2JQR B;  3AE2 B;  4OW0 A;  2G9H D;  2RSU A;  1V2Y A;  1FFV A;  3VRA B;  2ASQ A;  3KW5 B;  2D07 B;  4NNJ B;  4BOZ B;  3AM9 A;  3VTV A;  1NVI D;  4MSQ B;  3RZF A;  3A4R A;  2LGY A;  2IGH A;  2IO3 B;  2QHO A;  5AUK A;  3SFE B;  2IBI B;  5BMH A;  3IFW B;  1TS4 A;  3B2F A;  4HWI B;  3HVZ A;  2BYF A;  1S1Q B;  3APC A;  3M95 A;  1EO6 A;  4G50 A;  4URK A;  1WGY A;  4P7I A;  1IBX B;  5EE1 A;  1JWU D;  2RGF A;  3Q69 A;  4LLG M;  3AEG B;  2RMM A;  1B9R A;  1WJU A;  3PPA A;  1FRD A;  1C4A A;  3TMP B;  3VDZ A;  4MAC A;  4BOS C;  1R4N B;  4HPP A;  3V05 A;  1FXT B;  2KTR A;  3RN9 C;  1SJE D;  3FC4 A;  4G0N B;  2HTH A;  1K52 A;  2WGS A;  3U7D A;  1L5P A;  1MHX A;  4KZ0 A;  2LXC A;  3LDZ E;  1P3Q U;  2PEA A;  2KDF B;  4YTN B;  3MC0 B;  5FR3 A;  3KYD D;  2J7Q B;  4ANV A;  4YT0 B;  1ISN A;  1V97 A;  3W1Y A;  1ROE A;  5D2M B;  4GMV A;  4FN2 A;  2HJ1 A;  2K22 A;  2LEK A;  2KLG A;  3KUC B;  3AEC B;  3DBR B;  3HHM A;  1LO5 D;  4M8N A;  1RM6 C;  3PLU A;  3DBH I;  2KJH B;  1Z5S B;  4D2K A;  3VH4 B;  4DDI D;  5BYR A;  2INC C;  3W9C B;  2MJ3 A;  3JSV A;  3PRP B;  1JCK B;  4TQ1 A;  1U4A A;  2KKC A;  3MJW A;  3ZDM C;  2WLB A;  3ECI A;  5J2R A;  4DDG D;  3RFZ B;  4GDL A;  3AEF B;  4NJ7 A;  1ET9 A;  1E0Z A;  3V60 A;  1PGX A;  1F0Z A;  3MJ5 A;  1F9J A;  3H6N A;  3AUL A;  3KUZ A;  1JQ4 A;  3NS8 A;  4DHZ B;  5J17 A;  1N6Z A;  3WAO A;  2C60 A;  3H1U A;  2AQ2 B;  3P4S B;  2WNM A;  3AI5 A;  3ZRF A;  5JZE B;  3M63 B;  2IJ0 A;  1T0S C;  1WM3 A;  5LXI B;  4DHJ D;  3RNE C;  2Y5B B;  3H8H A;  3MTN B;  3ZDT A;  5D3I B;  1IGC A;  3GOE A;  3QQ8 B;  1PFD A;  2PMV A;  5HI1 A;  1RYJ A;  3RNA C;  3ZW3 A;  2NBV B;  1BUI C;  3WAM A;  3CIR B;  1V80 A;  3I5J C;  1V5T A;  2CR5 A;  3JYU A;  3UF8 A;  2Y3A A;  4GU2 A;  2AL6 A;  4BVU C;  2BWF A;  1I35 A;  3K9P B;  2MLB A;  2JRH A;  1XCT L;  4II3 B;  4ZHP A;  4ANW A;  4C7Z A;  4HKQ A;  5DCN A;  3R8B A;  1J7B A;  2FNJ B;  4JIO U;  1IBX A;  4DHZ E;  1WX7 A;  2W3S A;  2WXF A;  3N1Z C;  3DVN U;  4WAA A;  3AEB B;  2WXI A;  4YTM B;  2M0X A;  2WXN A;  1V1O A;  3ZVV A;  3AXC A;  5D94 A;  2W82 A;  2PKO A;  1WF9 A;  4AOF A;  3QCA A;  2C7H A;  4IWQ A;  3DVN V;  1IGD A;  3SEB A;  4ICV A;  4HCN B;  5E6O A;  1V9J A;  1C4C A;  2LZ6 A;  1PDX A;  1FIQ A;  1NEK B;  1OGW A;  4C00 A;  1GC7 A;  1HEZ E;  4WQO B;  3TIX A;  3VFK A;  3O13 A;  2KQ7 A;  3ZXV A;  1ZKH A;  3PZ7 A;  1X1M A;  4M01 A;  1QOB A;  3PGE A;  4JWU C;  2MHJ A;  3OLM D;  2JX5 A;  1WJ4 A;  3VTW A;  1SE4 A;  1HTO A;  3P1M A;  5AZF A;  1UF0 A;  2VZK D;  3QC8 B;  4CHK A;  2KN5 A;  2QCZ A;  1P0R A;  2CHW A;  1ZPS A;  3RD2 A;  1B1Z A;  2WU2 B;  1E90 A;  3NRZ A;  2N9X A;  2KAC A;  4HVB A;  4LNN A;  2K8B A;  5L95 C;  3SFD B;  3P42 A;  2LFI A;  4PS3 A;  4OZA A;  4HRS A;  1CMX B;  2N9E B;  1LXD A;  2JPH A;  1Q0W B;  3BII D;  4GLS C;  3C8Y A;  1J0G A;  2FE8 A;  3QX1 A;  2ZVN A;  4TMA B;  2YVC A;  4B95 A;  4FXC A;  5DPS A;  3ZUN A;  1WGG A;  1YMH E;  5C3J B;  3X0W A;  2KLC A;  4A55 A;  2GBJ A;  4HJG E;  4ANU A;  1TGZ B;  2OHF A;  5BMI A;  2QDF A;  2VZK B;  2K25 A;  2XNA C;  3PRM B;  3I63 C;  4MT5 A;  5G5H A;  3RMK C;  3C19 A;  2PVG C;  1GAQ B;  4MEL A;  4QAY A;  2QSD A;  1CQV A;  3W1S A;  2E6X A;  5C2T B;  4F8C B;  2L05 A;  2FUH B;  2WHI A;  1QOF A;  3PHW B;  2DZJ A;  1MPE A;  3VHT C;  2DZK A;  2BQQ A;  3J9C A;  1FFU A;  2NPT A;  2N7E A;  1KOT A;  2ZW0 A;  2CHX A;  2UU7 A;  4HDO A;  2D3C A;  3EEC A;  4N58 A;  4UDU C;  4HPM B;  2KVR A;  3HM6 X;  4S0R A;  2KXJ A;  1HZ6 A;  3UI3 A;  1XXG A;  4L23 A;  2K3U A;  3Q8B A;  1AN8 A;  1SJH D;  1QT9 A;  4PYU A;  4US8 A;  4ZOH C;  2KO3 A;  4I6N B;  4KIK B;  2I38 A;  2XBB C;  3R3M A;  3TEZ A;  3HUI A;  4HCP B;  1YIW A;  1ZP0 B;  4NJC A;  3S2A A;  4FHJ A;  3R7R A;  4HEA 1;  4M8M A;  1GC6 A;  4KGT A;  4NQK E;  3AMZ A;  2O2V B;  2W3R A;  2NR2 A;  1LFD A;  2MW5 A;  3N3K B;  1FNW A;  4OVV A;  3M62 B;  2MBQ A;  3Q6B A;  3FAH A;  3DBL I;  3PLV A;  3WIM A;  1T3Q A;  3NVY A;  3ZXR A;  4KX6 B;  1Q1O A;  3KLS X;  2LVO A;  3BVG A;  4ARC A;  1UBQ A;  1E8W A;  3N1X C;  3PT2 B;  3EHV A;  5G5G A;  5I4D A;  2BTE A;  2N0S B;  2YLM A;  4JLC A;  3QAR A;  1TS5 A;  2TSS A;  2Y5C A;  3IBE A;  1UWX A;  2BT6 A;  4RGO S;  3R66 C;  3DCG A;  4HJK A;  5G55 A;  4EOY A;  3LYY A;  1RLF A;  1M4V A;  1XLO A;  1L4D B;  3AE8 B;  3VH3 B;  2LGI A;  1Y8R C;  1E8Z A;  2ZCC A;  4TV3 A;  3PSE B;  5EDS A;  1MFW A;  1ESF A;  2IND C;  2KMC A;  3AV8 A;  2KQS A;  4N6E B;  3Q2A C;  2VRR B;  3ZJV A;  4FJV B;  5EE9 A;  4G11 A;  3TBL D;  1WYG A;  1V81 A;  4HXD A;  4ZRJ A;  1FMA D;  2D10 A;  1UZX B;  1ZE3 D;  3HIZ A;  2DNF A;  2VH2 A;  1YN5 A;  2ZNV B;  2GMI C;  2GI9 A;  2QJL A;  4XC2 A;  4EE2 A;  3A1Q B;  3GE8 C;  1T5X D;  5DPW A;  4NAW B;  1FRR A;  2L00 B;  1N62 A;  2MWS B;  3E9S A;  2KYW A;  4MGK E;  4H2A A;  2PW9 A;  3PZ8 A;  2V9H A;  3BZD B;  2K1F A;  1PGB A;  5AZG A;  5BYQ A;  2D5G A;  4OZC A;  1I42 A;  2JY6 A;  3DBH B;  1DGJ A;  2ZJD A;  3UIP B;  1WR1 A;  3JSV B;  4MH0 E;  1FD6 A;  1WMH B;  1WYW B;  4LDT B;  3P2B A;  1TBE A;  3BVM A;  4IKG A;  3AE9 B;  1ENF A;  4YL8 A;  1PYW D;  2YEP B;  2N7J A;  2BS4 B;  2L52 A;  2HDE A;  3L17 A;  2IPK D;  3IXS A;  3PO0 A;  1E8X A;  1VZ8 A;  4PS7 A;  1VCB A;  1WXS A;  4GB9 A;  2MH7 A;  3EFU A;  5FR6 A;  4E74 A;  1FEH A;  4ZRQ A;  2KDE B;  4II2 B;  2K9X A;  1WY8 A;  5BMG A;  3NZU A;  3AH7 A;  4EFO A;  2JT4 B;  2PJH A;  3KWL A;  2AL3 A;  1DOI A;  4ZRP A;  2V4I B;  2O2V A;  4ZYN A;  4RM8 A;  1G6J A;  1T0R C;  3N30 A;  2KN4 A;  1P98 A;  1PUT A;  2ZPY A;  4ACF A;  1FM0 D;  2H88 B;  2G3Q B;  2DYO A;  1WGR A;  1JWM D;  2R61 A;  5IKC M;  3T3N A;  4RFB A;  3ZYY X;  3RZW C;  1YJI A;  1UEL A;  1L6V A;  1K50 A;  1Y56 A;  3SR6 A;  4EZJ A;  4IC7 B;  2OJR A;  1WZ0 A;  1EU4 A;  3L13 A;  5BYS A;  5EE0 A;  5IO9 A;  4KGR A;  4AP4 C;  2PVO D;  4MSM B;  1R4M I;  2K39 A;  2O6V B;  1QLB B;  2C7N B;  1XLN A;  2WWZ A;  2WXQ A;  2N1V A;  2Y5P A;  3A9J A;  1UNS A;  3KQ4 A;  2RDB C;  4IUM B;  2IY0 B;  4YSX B;  2KWD A;  4DQO C;  2RR9 A;  4IM0 A;  3T8M A;  3N20 C;  5AUI A;  3RCZ A;  2PLP A;  3I57 A;  1P7F A;  2MP2 B;  3DBS A;  1F2R C;  4YXD B;  2CJN A;  2NTT A;  4GN1 A;  2REX A;  2R2O A;  1SE3 A;  2WXH A;  3BYT B;  3ZRC A;  4JWS C;  4WJP A;  3DVG X;  2JXT A;  3A1Q A;  2GB1 A;  2LWP A;  4NAW A;  1AW7 A;  1KM7 A;  3DVG Y;  5HFY A;  2V3N A;  1WX8 A;  5HHD G;  3ZNI D;  4ICU A;  1OEY J;  3RUI B;  3DOW A;  4XYC A;  5EE3 A;  4K7W A;  2DBY A;  2JZP A;  2KHW B; 
#chains in the Genus database with same CATH homology
 1SE4 A;  3Q8C A;  3WCQ A;  2WXG A;  1MHH E;  4B0E A;  2KAJ A;  3VR8 B;  3P63 A;  3P1M A;  1I4P A;  2VZK D;  4P6V F;  1JRP A;  1OFF A;  1JWA D;  3AE4 B;  4XDD A;  3TUO A;  4AS1 A;  3LB8 C;  2FUG 1;  3U2S C;  4MH8 A;  4RH6 A;  1I4Q A;  2J52 A;  4J3O D;  1KRH A;  1ZPS A;  4C7Y A;  1I4R A;  2WXK A;  3BYY B;  1B1Z A;  3B9J A;  3T3O A;  2NMQ A;  2BYT A;  3IAM 1;  1FXA A;  1YJJ A;  2KQ4 X;  2WU2 B;  3NRZ A;  2KAC A;  4ZHO A;  4A6Q A;  3Q8A A;  3R2T A;  5TSS A;  3CWI A;  1YN4 A;  4US9 A;  4IDI A;  1J7C A;  3U7Z A;  4A90 A;  3SFD B;  3P42 A;  2LFI A;  1OQR A;  4OZA A;  1XLP A;  3TEX A;  5D3D A;  4HRS A;  1GOZ A;  4NZL B;  3AB5 A;  4ITK A;  1RFK A;  2IDY A;  2WS3 B;  3VR9 B;  3BII D;  4GLS C;  3C8Y A;  1K51 A;  1FNV A;  1PGA A;  1T6B X;  2G1E A;  2FE8 A;  4N59 A;  1JRO A;  1L6U A;  2ICI A;  1MVK A;  4TMA B;  3DWM A;  4FXC A;  4YSY B;  4B0M A;  2BS3 B;  2JYE A;  1J7A A;  1YMH E;  5C3J B;  4WQM A;  1QF6 A;  1WSP A;  1I7H A;  3W2D A;  3BK2 A;  4A55 A;  3DWG C;  4HJG E;  2XN9 C;  4REZ A;  2SEB D;  2J42 A;  1KFY B;  1FXI A;  2OHF A;  5BMI A;  3NUH B;  1DOX A;  4ARI A;  4XE0 A;  2VZK B;  2XNA C;  5FK9 C;  3OWE B;  2WDR B;  2K5P A;  2BS2 B;  4MT5 A;  5G5H A;  1VZ6 A;  2WXP A;  3U4E G;  1C76 A;  1TJE A;  1ZUD 2;  2LHE A;  2PVG C;  1GAQ B;  1UGJ A;  2QSD A;  1CQV A;  3W1S A;  2E6X A;  4Q2J A;  2Q5W D;  4MM3 B;  5C2T B;  1TKE A;  2WP9 B;  3MHZ A;  1WWT A;  5E6J A;  1QOF A;  1VR9 A;  3AED B;  4L2Y A;  2RPV A;  4HKZ E;  3LXF A;  2QEJ C;  4KKI A;  1SB3 C;  2WQY B;  1MPE A;  2FBW B;  4TQ0 A;  5H92 C;  5D7G A;  2B76 B;  3J9C A;  3E56 A;  2NTS A;  3R2I A;  2I2Y A;  1WRI A;  1FNU A;  1FFU A;  1SE2 A;  1TZO A;  3TEW A;  5MPO A;  2EKI A;  4OZB A;  1NYQ A;  1SEB D;  2WXM A;  1NYR A;  2BW2 A;  3MP9 A;  2ZW0 A;  1XO3 A;  1UUP A;  1XLQ A;  1MI0 A;  1TY2 A;  4USA A;  1XCQ L;  1KLG D;  3V3X A;  2J53 A;  5LNK 1;  4N58 A;  4UDU C;  2H89 B;  2WDQ B;  2EEL A;  1QOA A;  3URY A;  5FKA C;  2MJE A;  1D5Z C;  3AE3 B;  4NAM A;  2LHD A;  1L0X B;  2JSV X;  3ZJU A;  4KGS A;  1HZ6 A;  1NEN B;  2IGG A;  3AE7 B;  3UI3 A;  1XXG A;  1VJK A;  3P4Q B;  2N9K A;  4JX1 C;  4L23 A;  2K3U A;  2WXR A;  2RDG A;  3Q8B A;  4KKJ A;  3NS1 A;  1HQR D;  4CQN A;  1AN8 A;  1SJH D;  1QT9 A;  3NZ3 A;  4US8 A;  4ZOH C;  2X38 A;  2DWQ A;  2N9L A;  2I38 A;  1TS3 A;  1NI3 A;  2OED A;  4GDL B;  3TEZ A;  1SSN A;  3HUI A;  2MEK A;  2HTM E;  1F77 A;  3FIL A;  1ZP0 B;  1D6E C;  4NJC A;  2GRI A;  1JWS D;  4HEA 1;  1I4G A;  1TS2 A;  1N5X A;  4TSS A;  3ETR A;  1HA5 A;  2WXJ A;  3AMZ A;  4KGT A;  4M0W A;  3VQI A;  1WXQ A;  1L0V B;  2W3R A;  4RCO A;  3IAS 1;  1KLU D;  4C80 A;  2QIL A;  1FNW A;  1GPX A;  1L4Z B;  4R3D A;  4LK0 M;  1EWC A;  3AEE B;  2M0A A;  1TKY A;  3FAH A;  1Q10 A;  1E7P B;  4C56 C;  1T3Q A;  1GB1 A;  2KMM A;  3NVY A;  1D5M C;  2JQR B;  2JWU A;  3AE2 B;  4KX6 B;  4RGN A;  3KLS X;  1BXT A;  2G9H D;  2QIE B;  4OW0 A;  4RF0 A;  3BVG A;  4YTP B;  4ARC A;  2L83 A;  1FFV A;  3P4R B;  1ZXH A;  5G5G A;  3VRA B;  3KWV A;  3NVV A;  5I4D A;  2BTE A;  1FCL A;  2J4X A;  2N0S B;  3AM9 A;  3EA6 A;  1TS5 A;  1D5X C;  1EWY C;  1YQ3 B;  2TSS A;  2Y5C A;  3TSS A;  1UWX A;  2BT6 A;  1ZDX A;  4RGO S;  3L4P A;  1NVI D;  2CJO A;  3W5V B;  2JYT A;  1CZP A;  3ZGZ A;  2IGH A;  3LYY A;  3AN1 A;  2MJD A;  3AE6 B;  5AUK A;  1M4V A;  2WU5 B;  3SFE B;  5BMH A;  3VRB B;  3TEY A;  1XLO A;  3GB1 A;  1L4D B;  3AE8 B;  3EUB 2;  4JE3 B;  5H8Y E;  1TS4 A;  2LGI A;  3B2F A;  2WXO A;  4P16 A;  5HG2 A;  4L1B A;  1HXY D;  3HVZ A;  4XDC A;  1ESF A;  3AV8 A;  3BK1 A;  4ZYS A;  4N6E B;  4A9A A;  1VRA B;  3ZJV A;  1V1P B;  2CU3 A;  4GDK B;  2YEP F;  1IBX B;  5EE9 A;  5EE1 A;  1QIL A;  1JWU D;  1YN3 A;  2M56 B;  1UWM A;  3Q69 A;  4LLG M;  3AEG B;  3W5U B;  1WYG A;  2RMM A;  2WDV B;  1B9R A;  4AQ7 A;  1EM7 A;  2W55 A;  1VZ7 A;  1FMA D;  1FRD A;  1C4A A;  1STE A;  4JPS A;  4XWW A;  1C9F A;  2AQ3 B;  4MAC A;  1ZE3 D;  4RGM A;  1C4P A;  3AE1 B;  2BB6 A;  3V05 A;  1YN5 A;  2ONQ A;  1SJE D;  1A70 A;  2W54 A;  3FC4 A;  2GI9 A;  1IUE A;  3Q8F A;  2QJL A;  2K0P A;  1K52 A;  1L5P A;  2AX5 A;  1MHX A;  4EE2 A;  1T5X D;  4NAW B;  2L32 A;  1N60 A;  1FRR A;  3ZQ4 A;  2IGD A;  4RGT A;  3BWU D;  2INP E;  1N62 A;  3E9S A;  4H2A A;  1I4X A;  2PW9 A;  3PZ8 A;  3I9V 1;  1JAL A;  4YTN B;  3MC0 B;  3BZD B;  5FR3 A;  1PGB A;  5BYQ A;  1TY0 A;  2D5G A;  4OZC A;  1JML A;  2ZW1 A;  3AEA B;  4YT0 B;  1SBB B;  1V97 A;  1DGJ A;  1WGK A;  1ROE A;  4YWG G;  1FD6 A;  5T8I A;  2K22 A;  2LEK A;  3GP7 A;  3AEC B;  1LO5 D;  3IT6 B;  1ET6 A;  1RM6 C;  3BVM A;  3AE5 B;  4IKG A;  3AE9 B;  4D2K A;  1ENF A;  1PYW D;  1E10 A;  3HVD A;  1FCC C;  5BYR A;  2JU6 X;  2YEP B;  4PT5 A;  1ZXI A;  2N7J A;  2BS4 B;  3W9C B;  1R7S A;  2SAK A;  2MJ3 A;  2L52 A;  2HDE A;  4IOI E;  3BVZ A;  2IPK D;  3IXS A;  3PO0 A;  1XEE A;  2M19 A;  1VZ8 A;  1TKG A;  1JCK B;  4TQ1 A;  2V0G A;  2MH7 A;  2DLB A;  3GS2 A;  2WLB A;  1FEH A;  3RFZ B;  3AEF B;  4ZRQ A;  1QOG A;  3B2G A;  4RF1 A;  2K9X A;  1ET9 A;  1JWB D;  1E0Z A;  5BMG A;  1GB4 A;  1PGX A;  1QKZ A;  2L1A A;  3AH7 A;  1F0Z A;  3MJ5 A;  2QMT A;  1C79 A;  4YSZ B;  1TYG B;  1JQ4 A;  3KWL A;  1DOI A;  2LJI A;  2V4I B;  3P4P B;  4ZRP A;  2RDH A;  3NVZ A;  1L0Y B;  1KTK A;  2KN4 A;  2AQ2 B;  2INN E;  3P4S B;  2WNM A;  1PUT A;  2IJ0 A;  1K53 A;  1FM0 D;  2ACZ B;  1AYF A;  2H88 B;  2ON8 A;  1VLB A;  1CJE A;  2KDM A;  3NVW A;  2DYO A;  2LUM A;  3H8H A;  1V8C A;  1DOY A;  1JWM D;  1ZOY B;  5D3I B;  1IGC A;  2BB5 A;  5JXV A;  1PFD A;  2R61 A;  2PMV A;  5HI1 A;  3T3N A;  1RYJ A;  2WXL A;  4RFB A;  1QQR A;  4XWT A;  4WAF A;  3ZYY X;  1JW9 D;  1YJI A;  2DYM A;  3ABV B;  1BUI C;  2Z8L A;  4A8X C;  1L6V A;  1XF5 L;  1K50 A;  1Y56 A;  3SR6 A;  3CIR B;  1EU4 A;  4WIP A;  5BYS A;  4OHJ A;  3RPF C;  1C78 A;  5EE0 A;  4KGR A;  1SIJ A;  2PVO D;  2Y3A A;  1SF0 A;  3ZJT A;  1RWS A;  1QLB B;  1XLN A;  2PTL A;  1D4B A;  2LMC A;  4WWM A;  1XCT L;  2WXQ A;  1BML C;  4ZHP A;  1KH0 A;  2Y5P A;  4C7Z A;  4DXG A;  1N5W A;  4HKQ A;  1OQQ A;  1UNS A;  2BBC A;  3KQ4 A;  1EU3 A;  1YNT E;  1HZ5 A;  1C77 A;  3R8B A;  1J7B A;  3EGR A;  1VDV A;  1F2R I;  4WUR A;  4YSX B;  2KWD A;  4HRO A;  4DQO C;  1P7E A;  4DXF A;  1V1P A;  1ZDV A;  1IBX A;  4RNA A;  2WXF A;  1AWD A;  2W3S A;  2PLP A;  3I57 A;  5AUI A;  1E6E B;  3MFG A;  1YQ4 B;  1P7F A;  1N63 A;  3AEB B;  5GXG B;  1F2R C;  2WXI A;  4YXD B;  2CJN A;  4YTM B;  2E3T A;  2WXN A;  4OVZ A;  2NTT A;  1V1O A;  1I4H A;  3N9Y C;  1ACC A;  4LTU A;  2W82 A;  2PKO A;  3HRD D;  1CK1 A;  1SE3 A;  2WXH A;  3BYT B;  3Q8E A;  4O1N A;  1IGD A;  3U52 E;  4JWS C;  2PIA A;  2JXT A;  3SEB A;  2GB1 A;  1AW7 A;  4WH4 A;  1E9M A;  1SXT A;  1KF6 B;  3FIL B;  5HFY A;  2V3N A;  2AQ1 B;  1DYQ A;  1C4C A;  5HHD G;  3IT4 B;  1PDX A;  1FIQ A;  1NEK B;  1HEZ E;  1N61 A;  2V3P A;  5EE3 A;  3O13 A;  2DBY A;  3PZ7 A;  2JZP A;  1FO4 A;  1QOB A;  4JWU C;  2JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...