1YJIA

Rdc-refined solution nmr structure of reduced putidaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putidaredoxin
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 15
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjiA00
4IDIA 5EE3A 2N0SB 2H89B 3AEFB 4FXCA 3AM9A 3LB8C 1NEKB 2QIEB 1NVID 1UWMA 5G5HA 2BT6A 1ZP0B 1WRIA 3ETRA 1XLQA 1RWSA 2WU2B 2L83A 2DBYA 4US8A 2E3TA 2JQRB 4WWMA 4N58A 1L6VA 5C3JB 1N62A 1TYGB 4YT0B 1FXIA 5AUIA 5MPOA 1FO4A 1XLPA 2MH7A 2WDQB 2Y5CA 3AEEB 1L6UA 4YTNB 1QOGA 1QT9A 2WDRB 1JWBD 4YSXB 1N5XA 3AE4B 2G1EA 3DWGC 3AE5B 1OFFA 3B2FA 1CJEA 3KWLA 2Q5WD 1ZUD2 1QOFA 1TKEA 1NYRA 1JALA 1VDVA 1TKGA 1YQ4B 3NS1A 2B76B 1V8CA 1WYGA 1QOAA 5G5GA 3FAHA 3RPFC 1DOYA 3CIRB 3W9CB 2CJNA 1I7HA 4C7YA 4LTUA 1GAQB 5EE1A 3AE7B 2ACZB 3AV8A 4YTPB 4ZHOA 1YJJA 1DOIA 2WS3B 1N63A 2JX5A 3AE1B 3AN1A 3NVWA 2OHFA 1RFKA 4P6VF 1FRDA 4KX6B 4HRSA 3CWIA 1FMAD 2CJOA 4ZOHC 1EWYC 1XLNA 4N59A 3ABVB 3VR9B 2MJ3A 2L52A 2CU3A 3AE9B 2W54A 3P1MA 1CZPA 3ZYYX 4JX1C 2PKOA 1KF6B 1VLBA 4JWUC 5EE0A 3WCQA 1KFYB 3NVVA 1XO3A 1T3QA 1TJEA 4ITKA 4YTMB 5AUKA 2FBWB 4C80A 3HUIA 1E6EB 1FFUA 3NVYA 3W5VB 4HROA 2WU5B 1E7PB 2KAJA 5H8YE 1JRPA 3VR8B 5H92C 3SR6A 1F0ZA 1AWDA 2W3RA 2PVGC 1JWAD 1NYQA 1JROA 2HTME 2WQYB 3DWMA 5EE9A 1DOXA 1QOBA 1V97A 3PO0A 3AB5A 2DWQA 1SF0A 2PIAA 1FXAA 1WXQA 1N5WA 1NENB 2BS2B 2H88B 2WP9B 1IUEA 1L5PA 1ROEA 1FIQA 3AEDB 1RYJA 3AEGB 4YSZB 2K9XA 3AMZA 4YXDB 2M19A 1GPXA 2BS4B 2W3SA 1DGJA 3P4QB 4N6EB 3AEBB 1J7CA 2LEKA 3NRZA 1VJKA 1PUTA 2WDVB 1FRRA 2K22A 1WWTA 4A9AA 1JW9D 1KRHA 3EUB2 4JWSC 2K5PA 4ZHPA 3AE3B 3AECB 3HRDD 1QF6A 3HVZA 1XLOA 2M56B 2BS3B 2MJEA 3AE2B 1R7SA 4WQMA 1B9RA 1NI3A 1SB3C 1ZXIA 4US9A 3FC4A 1PFDA 1E9MA 3P63A 1OQRA 3B9JA 2KMMA 3VRBB 2PVOD 3L4PA 1J7BA 3P4RB 3BIID 1PDXA 3SFDB 4USAA 1YQ3B 3AEAB 2EKIA 1A70A 1TKYA 2QJLA 2WLBA 3B2GA 3P4SB 1AYFA 3NVZA 4C7ZA 3AH7A 3SFEB 1ZOYB 1FFVA 2AX5A 1SIJA 3AE6B 1WGKA 3W5UB 3LXFA 1E10A 1E0ZA 1OQQA 2MJDA 1L0VB 5GXGB 4YSYB 1YJIA 3AE8B 1JQ4A 3VRAB 1J7AA 1N60A 1N61A 1RM6C 5C2TB 3P4PB 1QLBB 2W55A 1FM0D
chains in the Genus database with same CATH superfamily
2KX3A 2NPTA 3Q8EA 3ENEA 5DPWA 1FEHA 4US8A 4LDTD 2JYTA 2J0JA 4BBNC 4KV2A 2VH2A 1OQYA 3UIOB 2GB1A 2WDRB 4NJCA 3RT3B 5FR3A 3IXSA 2DYBA 1WR6E 1NYRA 1WYGA 2IY0B 3IFWB 2MQJA 5IAAC 1ENFA 5EE1A 2KQ4X 4OW0A 4ZYNA 2KDFB 3UIPB 4ZHOA 3BY4B 2KWUB 1Q1OA 5BYSA 3CWIA 2V4IB 3RNAC 3K9PB 4ZOHC 2KFKB 2YEPF 2RPVA 1VZ7A 2LGIA 1MG8A 5E6PA 3UI3A 4KSLC 1LM8B 1TJEA 1LQBA 3KUZA 1D5ZC 2RGFA 2GOWA 2D3CA 3DBSA 3BVZA 2C7NB 4LNNA 1QOBA 4DHJD 2DWQA 1MHXA 2J0KA 1GPXA 2LXAA 1M4VA 2FIDA 2LEKA 5TR5A 5JH5C 2D3BA 2KJHB 3H1UA 3AECB 4HLEA 2KFKA 4B0EA 1E9MA 2BWES 1G6JA 3PV1A 4LK0M 4IKGA 3GZNI 2WX0A 1PDXA 3KH0A 2QSDA 1WMHB 4WJPA 2BTEA 2KTFA 2K6QA 3B1LX 4IM3A 5LXHA 5HI1A 1HEZE 2WYQA 1ZKHA 1V2YA 2KFJA 5EE3A 3KYDD 3AM9A 1PGXA 1NEKB 4K3BA 2EMSA 3Q69A 3TBLD 2VRRB 3ZDMC 5EDSA 4I6NB 1STEA 1V9JA 1L6VA 3OJ4B 4KKIA 4YT0B 2ZCBA 4BOZB 3KLSX 3X23A 4BOSC 3WAPA 2KDIA 4FJZA 5HKHA 4YSXB 1WMHA 4RMAA 5JZEB 1QILA 1SJHD 4RM8A 4K7WA 2Z59B 3OJ3A 2I1JA 4I6PA 3QARA 2BB6A 2GI9A 2FE8A 3A9KB 5DPSA 3OG5A 2D5GA 3ZYYX 4JWUC 1XF5L 2BBCA 3OLMD 4ITKA 4EZJA 3PHWB 4HROA 4HKQA 1FNWA 3AU5A 3M95A 3ZLZA 4ASWC 2IO1B 1IGDA 2B3AA 1JWUD 2LRWA 2W3SA 3GP7A 4GU2A 3NS8A 2JVCA 1BMLC 2JRIB 1WM2A 1WGRA 1XD3B 3A9KA 1UELA 4WQMA 3HHMA 4EZKA 3APCA 2UU7A 4JPSA 4YWGG 4MJSB 1OQRA 2J52A 2IO2B 3BIID 3AI5A 1A70A 4N9F4 2DYMA 2JF5A 3W1YA 1FFVA 1ZDVA 2LJIA 3W5UB 3T3OA 2BB5A 2MJDA 1A5RA 3CMMB 1RM6C 4DDGD 3P4PB 1XQQA 2AL6A 2Y3AA 4HDQA 1RWSA 4CYEA 1T0QC 4N58A 2YVCA 4MJSA 3A9JB 3QIJA 3AEEB 2GBKA 3PZ8A 4XX5A 2HD5B 5CHVC 3LJ3A 3Q8AA 2MLBA 4GB9A 4BKTA 1WJ6A 4QAYA 4MSQB 3UQAA 1GC6A 2QC8A 2RR9A 2K25A 4F1SA 5E6NA 2KX0A 1SEBD 4A6QA 1RFKA 2LXCA 4NZLB 3OAWA 3ZRFA 1LFDA 1E8XA 1EWYC 1WR1A 4M02A 1F9JA 3A9JA 1E6EB 3NVYA 4HPLB 4JLCA 2ZEQA 3V05A 2HTME 2WQYB 2IGGA 2PIAA 1WXQA 2G45B 2H88B 2IPKD 2QCZA 1GOZA 3P4QB 3AULA 3TUOA 4AOFA 5E6OA 3EUB2 1I35A 2M56B 4CO7A 4XYCA 1NI3A 1ZXIA 3FC4A 4FBJB 4FADA 2INDC 3B9JA 2QDFA 1WGDA 2PVOD 4ICUA 3AH7A 4WWNA 3EFCA 1H8CA 3RNGC 1ZW7A 3UINB 1ZXHA 1P98A 1J7AA 2H89B 3VUWA 2LFIA 1UWMA 5LLIA 1GJZA 1KLGD 4TQ1A 1MPEA 1P7FA 3CF6E 1TYGB 2PPHA 5MPOA 2M0XA 5J2RA 2MH7A 4YTNB 5T8IA 4KIKB 1FPYA 4R3DA 5IKCM 1MG4A 3AE4B 2BQQA 4TUUA 1QOFA 2LUEA 2WXHA 1LGRA 2FNJB 4K7UA 4BZAA 3W9CB 2CJNA 4C7YA 1GAQB 3TSSA 2FIFA 3ZKJC 4L1BA 1UUPA 2LGYA 1BUIC 1FRDA 1RLFA 2KXJA 2IO0B 2NCNA 3VAWA 4W9FA 2BYTA 1V5TA 1TTNA 2QILA 3TEZA 2MJ3A 2DLBA 2PKOA 2L00B 4A8XC 2EKEC 2G4SA 3JYUA 2NVUI 2WU5B 5DPTA 4KIKA 5H92C 3FILB 1JROA 2GBMA 3RN9C 4CHKA 3Q8BA 1YD8U 2KJ6A 1L5PA 4DXGA 2REXA 2BS4B 4XGAB 3AEBB 2WDVB 1P7EA 1R4MB 1EM7A 1C3TA 1QF6A 3AE2B 5HG2A 2RPQA 3FKYA 2KMMA 1UWXA 1OEYA 3MHZA 3DBRB 1D4BA 4NQKE 1IPGA 4LNFA 2LHDA 3A4RA 1SSNA 1I4QA 1E8ZA 3PHXB 2I1KA 1WGKA 2ZZPB 3FILA 4NY0A 2O2VB 1TZOA 2DZIA 4ANWA 4YSYB 3L08A 3I63C 3A33B 1ZPSA 2MBOA 4FXCA 1NVID 5CHFA 4ACFA 1ZP0B 3VUXA 3BYTB 3DVNU 4WWMA 3E56A 3GS2A 3PZ7A 2DZMA 3ZTDA 4LDTB 3IHPC 3OWEB 4XZ4A 2LVQA 3PVLA 1ZUD2 5FKAC 2NBVB 2E6XA 3MC0B 3ZTCA 2LJ5A 2O2VA 2ZVNA 3AV8A 3ONSA 2LD9A 3ML8A 3NUHB 4A3PA 2WX1A 1P3QU 1P9DU 4MGKE 2CJOA 2A4ZA 3TJPA 2N9XA 2FAZA 3J9CA 3P1MA 4JX1C 1KF6B 2D2QA 4YTMB 1TIFA 4PS8A 2HE7A 2MBBB 2W3RA 1V97A 1JWMD 1NENB 1WF9A 3ZNHB 1C4PA 4WURA 2PE9A 4DQOC 2SEBD 4GSWA 1PUTA 3R7QA 1TS4A 2K22A 4HWIB 1JW9D 3DOWA 3KUDB 4JWSC 1UGJA 4WIPA 1EWCA 1TT5B 2W9NA 4US9A 3I3TB 3RNEC 3X0WA 2JWZA 1V1PB 3B0AA 3RI7C 3BZDB 4USAA 1KJTA 2N1VA 2QJLA 1ET9A 2NMQA 1E8YA 3I5JC 2IZVB 4S17A 5BMIA 2K39A 5C1ZA 3C0RB 1WGGA 2M1MA 3N1XC 5BYRA 2XEWA 2ZW0A 3E9SA 4LNKA 2MA9B 3Q3MC 4OVUA 3TMPB 4PK1A 2OEDA 4OZCA 2N1WA 4B95A 2L83A 4KSKC 3RYTA 1S3SG 2ON8A 4RGNA 5KHQA 2KMAA 2Y5CA 1V1PA 2MRPA 3QK0A 3ZJTA 4ZRQA 4W9EA 1VDVA 4XE0A 2B76B 3MTNB 1UGMA 2JRHA 3R66C 4NAMA 4HPMB 2V0GA 2WS3B 1T0RC 1T0YA 4K3CA 1E8WA 3DHGC 3VR9B 1R4MI 1T6BX 1TS5A 2HTHA 5JHBA 4W9LA 4X57B 4HPPA 4HJGE 2FBWB 1WGYA 1E7PB 3DBRI 1JRPA 1K53A 3KVFB 1AWDA 3U7ZA 1BXTA 5D3IB 4PS7A 2Y5BB 1LXDA 3JW0X 2J42A 3AEGB 1SE2A 1J7CA 2L3ZA 3N3KB 5TSSA 2CU1A 2J0MA 2JY6A 3KYCD 2WXMA 1I4RA 5AEKB 2DAJA 2C7MB 1C76A 1PFDA 1HXYD 2BKFA 3P4RB 1H4RA 2EKIA 1TKYA 2KO3A 2N9PC 3QC8B 4IOIE 4II3B 4AQ7A 4FN2A 2GBNA 1HZ6A 1N60A 1YMHE 4BKGA 4B0MA 1FM0D 1NDDA 2KANA 3AEFB 3Q8FA 3ETRA 4ZDVA 2WU2B 1ET6A 1F77A 4DXFA 4FA6A 5AZFA 4E71A 2BVCA 2ZPNA 2WXRA 1V86A 2RDGA 1CMXB 1XLPA 2FCQA 1RFAA 2QMTA 2WGSA 3SDLC 1YQ4B 2WXFA 3R2IA 1Y56A 3ML9A 2BYEA 1DOYA 4XWWA 4OZBA 1ESFA 3QQ8B 1Z2MA 2WXIA 1J19A 4KDLB 2L8JA 4GGQA 4KX6B 3O13A 3VQIA 4L2YA 4NPNA 4P7IA 4DBGA 4MSMB 1WX9A 2GBRA 2INNE 2ZCCA 3VDZA 2PTLA 3U8ZA 1F0ZA 2L32A 1T0SC 2M4NA 3WANA 1YN3A 5JHAA 1HTOA 2M17A 1N5WA 1IUEA 3U4EG 4A55A 2IO3B 3Q2AC 4JE3B 4LNIA 1NI2A 2FCNA 4MH8A 1V81A 3GE3C 4J6IA 2GMIC 1VJKA 1J8CA 4C56C 2MW5A 3B08A 1OTRB 1L0XB 3GOEA 5LXIB 3RNCC 2M8SA 3V60A 3QJZA 1SIFA 5DPRA 3Q3NC 2J4XA 3CSFA 2KN4A 1TGZB 2X8XX 2WHIA 5J18A 2UWQA 4TV3A 1KOTA 4HJKA 4MH0E 1OQQA 5BMHA 1OGWA 3PRPB 3ZNGC 3SD5A 3S2AA 1HE8A 2JXTA 5GMVA 4C4VB 1PGAA 3ZXRA 2KJRA 2AYOB 2G9HD 4P1BC 3A4SC 2IGDA 1L6UA 1QOGA 4CQNA 3IBEA 2G3QB 3NG0A 2Z0DB 1K8RB 2ZVOA 2NR2A 2LWPA 4KKJA 4RNAA 1F2RI 1I7HA 3L10B 4LTUA 4XDDA 2IDYA 2KT7A 1YIWA 3IT4B 2BGFA 3AN1A 2OHFA 1WJNA 3V62A 1FXTB 1NBFC 1D5XC 5AZGA 4C4VA 1SBBB 1XLNA 3P42A 4LCDE 2CU3A 2WXKA 4IM2A 5HFYA 1VLBA 3DDCB 4RGMA 3HUIA 4WJOA 4XC2A 1F1HA 2IY1B 3SR6A 3W2DA 2FUG1 3KUCB 2IJ0A 2JYEA 2L76A 2WP9B 2BS2B 2WDTB 3AEDB 1RYJA 3Q14C 4ARCA 3RCZA 1D6EC 4MM3B 3W1SA 3MFGA 2ONQA 1WH3A 4ICVA 4B6WA 3N32A 1IGCA 2UYZB 3Q8CA 2D10A 2WXJA 3N30A 1YQBA 2VZKB 2KK8A 5DCNA 1ISNA 2NTTA 5IP4D 3VTVA 4GDLB 4RCOA 4EE2A 3BK1A 4PT5A 2I38A 4OVVA 2DHZA 1YJIA 3AE8B 4Q2JA 4KZ0A 4WAFA 3ZJVA 4GDKB 1GUAB 5G5HA 3GE8C 4AWJA 2ASQA 1XLQA 4MM3A 3MJWA 2K6DB 3T3NA 2RDBC 3WIMA 1YN5A 3QA8A 2JXXA 5C3JB 1SXTA 2Z8LA 3APFA 1TY0A 2M0AA 1OFFA 4I6LB 3PRZA 3N20C 2CR5A 4GDLA 1JALA 2KC2A 4EKUA 4MT5A 1EF1A 1Q10A 1GC7A 4J3OD 4P1CC 3HM6X 3AE7B 1YX5B 4GDKA 4RH6A 4P6VF 2JPHA 3IAM1 3I57A 4GOCA 2Y5PA 3TIXA 1FMAD 3AXCA 5L95C 3H8HA 3ABVB 2DNFA 4W9DA 3AE9B 2A5UA 3L17A 1WIAA 2K8HA 5AUKA 1MI0A 4C80A 4JQWC 1WE7A 1XCQL 3DVNV 1UZXB 2V4LA 1DOXA 1WI0A 1TZ1A 2N7DA 5I4DA 2TSSA 1WXSA 1FXAA 4YSZB 1ROEA 2K9XA 3AMZA 1WX8A 2VH1A 3TEWA 1WWTA 4NJ7A 2MJEA 1SB3C 1PYWD 4GN1A 3DQVA 2HJ1A 4IG7B 1Y8RC 4IWQA 4C7ZA 2O6VD 3EECA 1UBIA 5IN7A 3UQBA 1D3ZA 3MJ5A 3PRMB 2VZKD 2KZRA 1XCTL 4AS1A 3SU8X 3T9LA 1XEEA 2E3TA 1WXMA 2WXPA 3NY5A 3EA6A 2KDBA 1N62A 2MSED 3ZUNA 2KLCA 2YEPB 1FXIA 2SAKA 1OEYJ 4H2AA 1GNUA 1SGHA 4GIVA 3QCAA 3NS1A 1V80A 4ANUA 1WX7A 3R3MA 4MEMA 3HIZA 3KQ4A 4FLHA 2W82A 5IO9A 2ZNVB 2GRIA 4XWTA 2D3AA 4LNOA 3U30A 1V1OA 3ZQ4A 2KMCA 3W5VB 2BPSA 3V6EB 2KAJA 3URYA 3VVWB 4MDKE 1NYQA 4YL8A 1MJDA 3H6NA 2FCSA 1SE4A 2IGHA 1FCLA 2N4FA 4GXBA 4HXDA 1WZ0A 3RMKC 5HHDG 1KLUD 1HA5A 2BS3B 2RD0A 2KWCA 1IYFA 5FR6A 3UGBB 4BKSA 4K81A 1F2RC 4M8NA 3SFEB 2AX5A 2XN9C 3BK2A 1SIJA 1AN8A 2JZPA 2BKRB 4DHZB 4F8CB 5GXGB 1PQSA 2I2YA 1I4HA 1N61A 5C2TB 3MC8A 3ZNZB 3DHIC 2PMVA 4OZAA 4IDIA 3L0WB 3NZSA 2QHOA 3KWVA 1VZ8A 1VZ6A 2N9KA 1MFWA 3LB8C 1E5WA 3U52E 1N6ZA 4G50A 4W9GA 2KTRB 3VH4B 1Z5SB 4WJQA 4K7SA 5AZHA 3VXWA 1FO4A 1F52A 4URKA 2R61A 2KWVB 3RD2A 3APDA 1VD2A 3B2FA 3Q3FA 2BF8B 4AP4C 3PS6A 2Z0EB 1K52A 4HK2A 2BWFA 1GB1A 4DDID 2ICIA 4A90A 3ZRCA 4B9KA 2PEAA 3ZJUA 3NOBA 2J7QB 1UF0A 1FNVA 3NVWA 4G0NB 4E74A 2K8BA 2AQ1B 3NZUA 1UBQA 3ZW3A 2KTRA 1C78A 1XXGA 1KFYB 4LJPB 3HK0A 1Q0WB 2V1YA 2JU6X 2V3NA 4W9JA 1YOVB 4IWPA 3VR8B 4ANXA 2AEHA 3DPDA 3PO0A 4LJOB 3ZIMA 4EZLA 3RFZB 1IP9A 2CHXA 4YXDB 2NBWB 4A3OA 3BVGA 4BKSD 2MBHA 4A9AA 1KRHA 4ZHPA 3AE3B 1C1YB 2IBIB 3IG3A 2KYWA 2LGXA 2ZPYA 1T5XD 2XK5B 1MHHE 1KM7A 4NQLB 3L4PA 4HVBA 3PT2B 2DX5B 4RM9A 1UH6A 1P1AA 4RGTA 2INCC 4JL9A 1WJUA 1WE6A 4JGHB 5CTRC 1Q5WB 1TBEA 4PYZA 4L23A 2L1AA 4KGTA 1K50A 3D32A 2KLGA 5BMGA 3L13A 4EEWA 3N1YC 3EC8A 1L4DB 3QX1A 2OJWA 3N1ZC 2JQRB 2L7RA 2BYVE 2V3SA 4IWOA 5D94A 4W9IA 2WWZA 2XK5A 5AUIA 3V3XA 2KDEB 1EO6A 3DBLB 1C4CA 1D5MC 3DWGC 3WAOA 1WJ4A 3C19A 4NAWB 1B1ZA 4M8MA 3LDZE 3FAHA 3VH3B 1V6EA 1GB4A 3DVGY 3EFUA 4YTPB 2OOBB 2MCNB 4F7ZA 1MVKA 1I4PA 2LGDA 3NJTA 3Q3OC 3Q3JA 3MP9A 4IUMB 1E90A 4REZA 2ZJDA 4FULA 1WRDB 2DAFA 4GMVA 3RZWC 4PYUA 2RSUA 4EUTA 2CS4A 4KVGB 4NAWA 2K8CA 2NTSA 5J17A 2M19A 3WAMA 3V6CB 3W1SC 3M3JA 3H7PB 2K5PA 2PJHA 1XLOA 2FCMA 2BYFA 1R7SA 2GBJA 1ACCA 3SFDB 2K0PA 2IYDB 1WSPA 3RZFA 2WXNA 5CX3A 3ECIA 2R2QA 2N9LA 1CQVA 1QKZA 3TEXA 3ZGZA 4WWPA 2L05A 1FCCC 1BT0A 1VCBA 1L2NA 5CHWA 4G3XB 4DK5A 3RUIB 3H7PA 2JWUA 3U7DA 2AQ2B 1V5OA 2BW2A 2WDQB 2NBUA 1J0GA 5D7GA 1QT9A 3KWLA 2WXOA 2C9WB 3HVDA 2LRUA 5G5GA 2MBQA 3RPFC 2KD0A 2KC1A 3MC9A 4DHZE 3WALA 4TKNA 2RMMA 3QHTA 4P16A 3V61A 2EELA 1FNUA 3VTUA 3SEBA 2KVRA 3VHTC 2LHEA 2D07B 2WXQA 3MHSD 1YNTE 1SJED 3WCQA 1T3QA 3JSVB 3ZDTA 2C60A 4TQ0A 2R2OA 1L4ZB 1FFUA 1EUVB 2LVOA 1YX6B 4G11A 1C79A 2WXLA 4RFBA 1IBXB 2K1FA 3GB1A 4DWFA 2ZW1A 4OVZA 3SHQA 1HTQA 2XBBC 4N6EB 5IOIA 2LGSA 1HZ5A 4C00A 1I42A 1JCKB 3HRDD 4M00A 2KQSA 3HVZA 4MGYE 3VTWA 2KACA 4ZRPA 3P63A 2FUHB 1P0RA 2D11A 3ZO5B 2L0FA 3JSVA 3B2GA 1VRAB 3BINA 3NVZA 4RF1A 3DBLI 5IA7A 4JIOU 4D2KA 2PE6B 1IBXA 4BAXA 2O6VB 2W55A 2HJ8A 5BO4B 1EU4A 1WXAA 2KNBA 4RF0A 4RGOS 4DXAB 5L83A 2QIEB 2KQ7A 2V3PA 3TEYA 3O65B 3R7RA 3RNFC 3ZNID 1U4AA 2X38A 5FK9C 4UDUC 5D6JB 1PGBA 5BYQA 1JWBD 2G1EA 3AE5B 3VFKA 2CHZA 2Q5WD 1KLVA 2XNAC 3KW5B 1V8CA 1JWSD 2LZ6A 3QAQA 2PLPA 3Q6BA 1WYWB 4XDCA 2O6VA 1YJJA 1DOIA 3IT6B 1X1MA 3U2SC 5D2MB 1S1QB 4AJWA 2W54A 1C77A 1R4NB 1JRUA 2LASA 2WNMA 2NS5A 2C5LC 5H8YE 3PGEA 4ZRJA 2PW9A 3DWMA 4KZCA 2DENB 1HQRD 4WH4A 2MWSB 3NRZA 4AJYB 2OJRA 2ZNVC 4HKZE 2DYOA 1B9RA 5LNK1 2MHJA 3VRBB 2KVZA 1V49A 1M94A 4BBNF 1RRBA 3AEAB 1AYFA 4BVUC 3ALBA 1CK1A 2CKHB 2KDMA 1C9FA 3LXFA 1E10A 1E0ZA 2MBEA 3BVMA 2LMCA 1ZGUB 4TSSA 1DYQA 4K1RB 4E3CA 2KKCA 3H7SA 2DZKA 3DCGA 3R2TA 4W9CA 4MELA 4EFOA 5G55A 4HCNB 3C8YA 4AUQC 4OHJA 4WQOB 1QOAA 3L54A 3DBHB 1I4XA 3PLVA 2ACZB 1AW7A 1N63A 2JUOA 3AE1B 4HRSA 3LYYA 5D3DA 1WY8A 5JXVA 2C7HA 4KDIC 4LLGM 1K51A 3VUYA 3NVVA 3IAS1 4WAAA 1YJ1A 2JZ3B 4IW0A 3NZ3A 1KH0A 1L7YA 2WXGA 1ZDXA 4IM0A 2PVGC 1JWAD 5C23A 1XT9B 2V9HA 3AB5A 3DHHC 3BYYB 2GLSA 1FRRA 1AARA 2KHWB 5E6JA 3T8MA 2MP2B 4ZRKA 1TY2A 3P2BA 4KGRA 4PS3A 1KTKA 1L0YB 1YQ3B 2AL3A 1SE3A 3CSTA 4MGZE 3AU4A 2N7EA 1RAXA 1WXVA 2L0TA 1ZOYB 3PSEB 3AE6B 1E7VA 2MEKA 2D3GA 3HM3A 3I9V1 4ANVA 3VRAB 4EOYA 1JMLA 1QLBB 1WM3A 4MACA 2JT4B 2N9EB 2N0SB 1QZEA 2RDHA 1ZE3D 3JVZX 3NHEB 3EGRA 4FJVB 2BT6A 3UF8A 1VR9A 1WRIA 3RULA 3A1QB 2DBYA 2AWTA 2CHWA 2MP2A 3ZXVA 1EU3A 4M0WB 3GZNB 3PTFC 2DZJA 4HEA1 4WWOA 4FJYA 2JSVX 2KN5A 4FHJA 2YLMA 4ZRIA 1N5XA 1R4NI 3DVGX 1YN4A 2INPE 4TMAB 1CJEA 4BFRA 3R8BA 1UNSA 3BWUD 1TKEA 4HDOA 1E7UA 1TKGA 4NNJB 3L16A 4ZYSA 1WZ3A 3ZVVA 4ARIA 1I4GA 3CIRB 2LUMA 1C4AA 1LO5D 2JX5A 2N7JA 3PZDA 4N59A 3A1QA 4DHJB 1EF5A 5G2NA 2L52A 4M0WA 4IC7B 1CZPA 1SE9A 5EE0A 3PLUA 4A20A 1XO3A 3RNBC 2G4DB 2AQ3B 4NJ6A 2KWDA 4W9HA 5EE9A 1WFYA 4MGIE 4KGSA 4S0RA 3TL5A 1SF0A 1QQRA 3TCAA 3EHVA 1FIQA 4GLSC 2NPTB 1DGJA 2KOXA 4II2B 4WJNA 5KHOA 3M63B 3K9OB 3PREA 2QEJC 4FHKA 3IVFA 3QWZB 1UD7A 3H9DA 2JZZA 1J7BA 2K3UA 1FD6A 4O1NA 2J53A 4M01A 2EMTA 3WA0A 2LVPA 3P4SB 2WLBA 1WGHA 1GG3A 3PPAA 1L0VB 1TS3A 3M62B 2MX2A 4W9KA 1JQ4A 2LI5A 4HCPB 1TS2A 3DBHI 2HDEA 3N9YC
chains in the Genus database with same CATH topology
4GDKB 1ZPSA 1FCCC 3Q8EA 4FXCA 5G5HA 1NVID 1ZP0B 1FEHA 1XLQA 4US8A 2JWUA 3T3NA 3BYTB 1YN5A 2JYTA 4WWMA 3E56A 5C3JB 2AQ2B 3GS2A 1SXTA 2BW2A 3PZ7A 2WDQB 2Z8LA 5D7GA 1TY0A 1QT9A 2GB1A 2WDRB 4NJCA 2M0AA 3OWEB 1OFFA 3KWLA 2WXOA 3IXSA 5FR3A 3HVDA 1ZUD2 1NYRA 5FKAC 1JALA 2E6XA 1WYGA 4MT5A 3MC0B 5G5GA 3RPFC 1ENFA 1Q10A 4J3OD 5EE1A 3AE7B 2KQ4X 3AV8A 4OW0A 3ZGZA 2RMMA 3NUHB 4ZHOA 4P16A 4RH6A 4P6VF 3IAM1 3I57A 2EELA 1FNUA 2Y5PA 3CWIA 1FMAD 2V4IB 2CJOA 5BYSA 3H8HA 4ZOHC 2YEPF 3SEBA 2RPVA 1VZ7A 2LGIA 2LHEA 3ABVB 3J9CA 3AE9B 2WXQA 3P1MA 3UI3A 4JX1C 1YNTE 1KF6B 1SJED 3WCQA 1T3QA 1TJEA 4TQ0A 4YTMB 5AUKA 1MI0A 1D5ZC 4C80A 1L4ZB 1FFUA 1XCQL 3BVZA 1C79A 2W3RA 1DOXA 5I4DA 2WXLA 1QOBA 1V97A 1JWMD 2TSSA 2DWQA 4RFBA 1IBXB 1FXAA 1MHXA 1NENB 4YSZB 3GB1A 1ROEA 1C4PA 4WURA 2K9XA 3AMZA 1GPXA 2ZW1A 4OVZA 1M4VA 4DQOC 4N6EB 2SEBD 2LEKA 1PUTA 3TEWA 1HZ5A 1TS4A 2K22A 1WWTA 1JCKB 1JW9D 4JWSC 1UGJA 4WIPA 1EWCA 3AECB 3HRDD 3HVZA 2MJEA 2KACA 1SB3C 1PYWD 4US9A 4ZRPA 1E9MA 3P63A 4B0EA 4LK0M 4IKGA 1V1PB 1PDXA 3BZDB 4USAA 2QSDA 2BTEA 2QJLA 1ET9A 2NMQA 1VRAB 3B2GA 3NVZA 4C7ZA 4RF1A 5BMIA 5HI1A 5BYRA 4D2KA 2ZW0A 1IBXA 3E9SA 3MJ5A 1HEZE 2W55A 1EU4A 5EE3A 2VZKD 4RF0A 4RGOS 3AM9A 1PGXA 1NEKB 2QIEB 3Q69A 1XCTL 2OEDA 4OZCA 4AS1A 2V3PA 1XEEA 2L83A 3TEYA 2E3TA 2WXPA 1STEA 2ON8A 4RGNA 1L6VA 3EA6A 1N62A 4KKIA 4YT0B 3KLSX 2X38A 2YEPB 1FXIA 5FK9C 4UDUC 2SAKA 2Y5CA 1V1PA 1PGBA 4H2AA 5BYQA 3ZJTA 1JWBD 4YSXB 4ZRQA 2G1EA 3AE5B 1QILA 1SJHD 2Q5WD 1VDVA 4XE0A 3NS1A 2XNAC 2B76B 1V8CA 1JWSD 4NAMA 2PLPA 2BB6A 4XDCA 3KQ4A 2V0GA 2GI9A 1YJJA 1DOIA 2WS3B 3IT6B 2FE8A 2W82A 3U2SC 2GRIA 4XWTA 3VR9B 2D5GA 1T6BX 2W54A 3ZYYX 1C77A 1TS5A 4JWUC 1XF5L 1V1OA 2BBCA 4ITKA 3ZQ4A 4HJGE 2FBWB 2WNMA 3W5VB 4HROA 4HKQA 1E7PB 2KAJA 5H8YE 1JRPA 1K53A 1FNWA 3URYA 1AWDA 2PW9A 1BXTA 3DWMA 1NYQA 5D3IB 3U7ZA 1HQRD 2J42A 1IGDA 1SE4A 4WH4A 2IGHA 1FCLA 3AEGB 1SE2A 1JWUD 2W3SA 3GP7A 3NRZA 1J7CA 5TSSA 1BMLC 5HHDG 1KLUD 2WXMA 1I4RA 1HA5A 4HKZE 2DYOA 1B9RA 2BS3B 4WQMA 5LNK1 1C76A 1PFDA 4JPSA 4YWGG 1OQRA 3VRBB 2J52A 1HXYD 3P4RB 3BIID 3AEAB 2EKIA 1A70A 1TKYA 2DYMA 1AYFA 1CK1A 1F2RC 4IOIE 3SFEB 1FFVA 2AX5A 2KDMA 2XN9C 1C9FA 3BK2A 1SIJA 1ZDVA 2LJIA 1AN8A 2JZPA 3W5UB 4AQ7A 2BB5A 3LXFA 3T3OA 1E10A 2MJDA 1E0ZA 5GXGB 3BVMA 2I2YA 1I4HA 1HZ6A 1N60A 1N61A 1RM6C 1YMHE 2LMCA 3P4PB 5C2TB 4OZAA 2PMVA 4TSSA 1DYQA 1FM0D 4B0MA 4IDIA 3AEFB 3KWVA 1VZ8A 1VZ6A 2N9KA 3LB8C 2Y3AA 3Q8FA 3U52E 3ETRA 1RWSA 2WU2B 1ET6A 1F77A 4DXFA 4N58A 2WXRA 2RDGA 1FO4A 3R2TA 1XLPA 3AEEB 3PZ8A 2R61A 3Q8AA 3C8YA 3B2FA 4OHJA 2QMTA 1YQ4B 2WXFA 3R2IA 1Y56A 1K52A 1QOAA 1I4XA 1GB1A 1DOYA 4XWWA 4OZBA 2ICIA 4A90A 1ESFA 2ACZB 3ZJUA 2WXIA 1AW7A 1N63A 3AE1B 1FNVA 1SEBD 3NVWA 1RFKA 4A6QA 4KX6B 4HRSA 3O13A 3LYYA 4L2YA 4NZLB 5D3DA 3VQIA 5JXVA 2AQ1B 4LLGM 1EWYC 1K51A 1C78A 1XXGA 1KFYB 2INNE 3NVVA 3IAS1 1E6EB 3NVYA 2PTLA 1KH0A 2JU6X 2V3NA 3NZ3A 2WXGA 3VR8B 1ZDXA 1F0ZA 2L32A 2PVGC 1JWAD 2HTME 2WQYB 3V05A 1YN3A 2IGGA 3PO0A 3AB5A 2PIAA 1WXQA 1N5WA 3RFZB 2H88B 1IUEA 2IPKD 4YXDB 3U4EG 4A55A 1GOZA 4JE3B 3BYYB 3P4QB 4MH8A 3TUOA 3BVGA 1VJKA 1FRRA 5E6JA 4A9AA 3EUB2 1KRHA 4C56C 4ZHPA 3AE3B 2M56B 1L0XB 1NI3A 1ZXIA 3FC4A 1TY2A 1T5XD 3B9JA 1MHHE 2PVOD 4KGRA 3L4PA 2J4XA 2KN4A 1KTKA 1L0YB 1YQ3B 1SE3A 3AH7A 4RGTA 1ZOYB 3AE6B 2MEKA 1ZXHA 1OQQA 3I9V1 5BMHA 3VRAB 1J7AA 1JMLA 1QLBB 4MACA 4L23A 2L1AA 4KGTA 1K50A 2JXTA 2N0SB 2H89B 5BMGA 2RDHA 1ZE3D 2LFIA 1UWMA 1KLGD 3EGRA 2BT6A 1VR9A 1WRIA 1L4DB 4TQ1A 1PGAA 1MPEA 2DBYA 1EU3A 1P7FA 2JQRB 1TYGB 2G9HD 4HEA1 5AUIA 5MPOA 3V3XA 2MH7A 2IGDA 4YTNB 5T8IA 1L6UA 2JSVX 1QOGA 4CQNA 1C4CA 1D5MC 4R3DA 1N5XA 3AE4B 3DWGC 1YN4A 2INPE 4TMAB 1CJEA 3R8BA 1UNSA 3BWUD 1QOFA 1TKEA 1TKGA 4ZYSA 2WXHA 4NAWB 1B1ZA 4ARIA 4KKJA 3FAHA 1I4GA 3CIRB 4RNAA 2CJNA 1F2RI 3W9CB 1GB4A 1I7HA 4C7YA 4LTUA 1GAQB 4XDDA 4YTPB 2IDYA 3IT4B 3TSSA 2LUMA 1C4AA 1MVKA 1LO5D 1I4PA 4L1BA 2JX5A 3AN1A 1UUPA 2OHFA 1BUIC 1FRDA 2N7JA 3MP9A 1D5XC 2BYTA 1SBBB 1XLNA 2QILA 4N59A 3TEZA 4REZA 3P42A 2MJ3A 2L52A 2CU3A 2WXKA 4M0WA 2DLBA 1CZPA 5HFYA 2PKOA 1VLBA 5EE0A 1XO3A 4A8XC 4RGMA 2AQ3B 3HUIA 2WU5B 2KWDA 5H92C 3SR6A 3W2DA 3FILB 1JROA 2FUG1 5EE9A 2IJ0A 2JYEA 3Q8BA 4KGSA 1SF0A 1QQRA 2WP9B 2BS2B 3AEDB 2NTSA 1L5PA 1FIQA 4GLSC 1RYJA 4DXGA 2M19A 2BS4B 1DGJA 3AEBB 4ARCA 2WDVB 1D6EC 4MM3B 1P7EA 3W1SA 3MFGA 2K5PA 1EM7A 2ONQA 1QF6A 1XLOA 3AE2B 1R7SA 2QEJC 5HG2A 1IGCA 2KMMA 1UWXA 1J7BA 3MHZA 3Q8CA 2K3UA 1FD6A 1ACCA 2WXJA 2J53A 2K0PA 4O1NA 1WSPA 3SFDB 1D4BA 3P4SB 2WLBA 2VZKB 2LHDA 2NTTA 2WXNA 4GDLB 1SSNA 4RCOA 1I4QA 4EE2A 3BK1A 1WGKA 3FILA 4PT5A 1TZOA 1L0VB 2I38A 1TS3A 4YSYB 1YJIA 3AE8B 2N9LA 1JQ4A 1CQVA 1QKZA 1TS2A 4Q2JA 3TEXA 2HDEA 4WAFA 3ZJVA 3N9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  5EE3 A;  2N0S B;  2H89 B;  3AEF B;  4FXC A;  3AM9 A;  3LB8 C;  1NEK B;  2QIE B;  1NVI D;  1UWM A;  5G5H A;  2BT6 A;  1ZP0 B;  1WRI A;  3ETR A;  1XLQ A;  1RWS A;  2WU2 B;  2L83 A;  2DBY A;  4US8 A;  2E3T A;  2JQR B;  4WWM A;  4N58 A;  1L6V A;  5C3J B;  1N62 A;  1TYG B;  4YT0 B;  1FXI A;  5AUI A;  5MPO A;  1FO4 A;  1XLP A;  2MH7 A;  2WDQ B;  2Y5C A;  3AEE B;  1L6U A;  4YTN B;  1QOG A;  1QT9 A;  2WDR B;  1JWB D;  4YSX B;  1N5X A;  3AE4 B;  2G1E A;  3DWG C;  3AE5 B;  1OFF A;  3B2F A;  1CJE A;  3KWL A;  2Q5W D;  1ZUD 2;  1QOF A;  1TKE A;  1NYR A;  1JAL A;  1VDV A;  1TKG A;  1YQ4 B;  3NS1 A;  2B76 B;  1V8C A;  1WYG A;  1QOA A;  5G5G A;  3FAH A;  3RPF C;  1DOY A;  3CIR B;  3W9C B;  2CJN A;  1I7H A;  4C7Y A;  4LTU A;  1GAQ B;  5EE1 A;  3AE7 B;  2ACZ B;  3AV8 A;  4YTP B;  4ZHO A;  1YJJ A;  1DOI A;  2WS3 B;  1N63 A;  2JX5 A;  3AE1 B;  3AN1 A;  3NVW A;  2OHF A;  1RFK A;  4P6V F;  1FRD A;  4KX6 B;  4HRS A;  3CWI A;  1FMA D;  2CJO A;  4ZOH C;  1EWY C;  1XLN A;  4N59 A;  3ABV B;  3VR9 B;  2MJ3 A;  2L52 A;  2CU3 A;  3AE9 B;  2W54 A;  3P1M A;  1CZP A;  3ZYY X;  4JX1 C;  2PKO A;  1KF6 B;  1VLB A;  4JWU C;  5EE0 A;  3WCQ A;  1KFY B;  3NVV A;  1XO3 A;  1T3Q A;  1TJE A;  4ITK A;  4YTM B;  5AUK A;  2FBW B;  4C80 A;  3HUI A;  1E6E B;  1FFU A;  3NVY A;  3W5V B;  4HRO A;  2WU5 B;  1E7P B;  2KAJ A;  5H8Y E;  1JRP A;  3VR8 B;  5H92 C;  3SR6 A;  1F0Z A;  1AWD A;  2W3R A;  2PVG C;  1JWA D;  1NYQ A;  1JRO A;  2HTM E;  2WQY B;  3DWM A;  5EE9 A;  1DOX A;  1QOB A;  1V97 A;  3PO0 A;  3AB5 A;  2DWQ A;  1SF0 A;  2PIA A;  1FXA A;  1WXQ A;  1N5W A;  1NEN B;  2BS2 B;  2H88 B;  2WP9 B;  1IUE A;  1L5P A;  1ROE A;  1FIQ A;  3AED B;  1RYJ A;  3AEG B;  4YSZ B;  2K9X A;  3AMZ A;  4YXD B;  2M19 A;  1GPX A;  2BS4 B;  2W3S A;  1DGJ A;  3P4Q B;  4N6E B;  3AEB B;  1J7C A;  2LEK A;  3NRZ A;  1VJK A;  1PUT A;  2WDV B;  1FRR A;  2K22 A;  1WWT A;  4A9A A;  1JW9 D;  1KRH A;  3EUB 2;  4JWS C;  2K5P A;  4ZHP A;  3AE3 B;  3AEC B;  3HRD D;  1QF6 A;  3HVZ A;  1XLO A;  2M56 B;  2BS3 B;  2MJE A;  3AE2 B;  1R7S A;  4WQM A;  1B9R A;  1NI3 A;  1SB3 C;  1ZXI A;  4US9 A;  3FC4 A;  1PFD A;  1E9M A;  3P63 A;  1OQR A;  3B9J A;  2KMM A;  3VRB B;  2PVO D;  3L4P A;  1J7B A;  3P4R B;  3BII D;  1PDX A;  3SFD B;  4USA A;  1YQ3 B;  3AEA B;  2EKI A;  1A70 A;  1TKY A;  2QJL A;  2WLB A;  3B2G A;  3P4S B;  1AYF A;  3NVZ A;  4C7Z A;  3AH7 A;  3SFE B;  1ZOY B;  1FFV A;  2AX5 A;  1SIJ A;  3AE6 B;  1WGK A;  3W5U B;  3LXF A;  1E10 A;  1E0Z A;  1OQQ A;  2MJD A;  1L0V B;  5GXG B;  4YSY B;  1YJI A;  3AE8 B;  1JQ4 A;  3VRA B;  1J7A A;  1N60 A;  1N61 A;  1RM6 C;  5C2T B;  3P4P B;  1QLB B;  2W55 A;  1FM0 D; 
#chains in the Genus database with same CATH topology
 2KX3 A;  2NPT A;  3Q8E A;  3ENE A;  5DPW A;  1FEH A;  4US8 A;  4LDT D;  2JYT A;  2J0J A;  4BBN C;  4KV2 A;  2VH2 A;  1OQY A;  3UIO B;  2GB1 A;  2WDR B;  4NJC A;  3RT3 B;  5FR3 A;  3IXS A;  2DYB A;  1WR6 E;  1NYR A;  1WYG A;  2IY0 B;  3IFW B;  2MQJ A;  5IAA C;  1ENF A;  5EE1 A;  2KQ4 X;  4OW0 A;  4ZYN A;  2KDF B;  3UIP B;  4ZHO A;  3BY4 B;  2KWU B;  1Q1O A;  5BYS A;  3CWI A;  2V4I B;  3RNA C;  3K9P B;  4ZOH C;  2KFK B;  2YEP F;  2RPV A;  1VZ7 A;  2LGI A;  1MG8 A;  5E6P A;  3UI3 A;  4KSL C;  1LM8 B;  1TJE A;  1LQB A;  3KUZ A;  1D5Z C;  2RGF A;  2GOW A;  2D3C A;  3DBS A;  3BVZ A;  2C7N B;  4LNN A;  1QOB A;  4DHJ D;  2DWQ A;  1MHX A;  2J0K A;  1GPX A;  2LXA A;  1M4V A;  2FID A;  2LEK A;  5TR5 A;  5JH5 C;  2D3B A;  2KJH B;  3H1U A;  3AEC B;  4HLE A;  2KFK A;  4B0E A;  1E9M A;  2BWE S;  1G6J A;  3PV1 A;  4LK0 M;  4IKG A;  3GZN I;  2WX0 A;  1PDX A;  3KH0 A;  2QSD A;  1WMH B;  4WJP A;  2BTE A;  2KTF A;  2K6Q A;  3B1L X;  4IM3 A;  5LXH A;  5HI1 A;  1HEZ E;  2WYQ A;  1ZKH A;  1V2Y A;  2KFJ A;  5EE3 A;  3KYD D;  3AM9 A;  1PGX A;  1NEK B;  4K3B A;  2EMS A;  3Q69 A;  3TBL D;  2VRR B;  3ZDM C;  5EDS A;  4I6N B;  1STE A;  1V9J A;  1L6V A;  3OJ4 B;  4KKI A;  4YT0 B;  2ZCB A;  4BOZ B;  3KLS X;  3X23 A;  4BOS C;  3WAP A;  2KDI A;  4FJZ A;  5HKH A;  4YSX B;  1WMH A;  4RMA A;  5JZE B;  1QIL A;  1SJH D;  4RM8 A;  4K7W A;  2Z59 B;  3OJ3 A;  2I1J A;  4I6P A;  3QAR A;  2BB6 A;  2GI9 A;  2FE8 A;  3A9K B;  5DPS A;  3OG5 A;  2D5G A;  3ZYY X;  4JWU C;  1XF5 L;  2BBC A;  3OLM D;  4ITK A;  4EZJ A;  3PHW B;  4HRO A;  4HKQ A;  1FNW A;  3AU5 A;  3M95 A;  3ZLZ A;  4ASW C;  2IO1 B;  1IGD A;  2B3A A;  1JWU D;  2LRW A;  2W3S A;  3GP7 A;  4GU2 A;  3NS8 A;  2JVC A;  1BML C;  2JRI B;  1WM2 A;  1WGR A;  1XD3 B;  3A9K A;  1UEL A;  4WQM A;  3HHM A;  4EZK A;  3APC A;  2UU7 A;  4JPS A;  4YWG G;  4MJS B;  1OQR A;  2J52 A;  2IO2 B;  3BII D;  3AI5 A;  1A70 A;  4N9F 4;  2DYM A;  2JF5 A;  3W1Y A;  1FFV A;  1ZDV A;  2LJI A;  3W5U B;  3T3O A;  2BB5 A;  2MJD A;  1A5R A;  3CMM B;  1RM6 C;  4DDG D;  3P4P B;  1XQQ A;  2AL6 A;  2Y3A A;  4HDQ A;  1RWS A;  4CYE A;  1T0Q C;  4N58 A;  2YVC A;  4MJS A;  3A9J B;  3QIJ A;  3AEE B;  2GBK A;  3PZ8 A;  4XX5 A;  2HD5 B;  5CHV C;  3LJ3 A;  3Q8A A;  2MLB A;  4GB9 A;  4BKT A;  1WJ6 A;  4QAY A;  4MSQ B;  3UQA A;  1GC6 A;  2QC8 A;  2RR9 A;  2K25 A;  4F1S A;  5E6N A;  2KX0 A;  1SEB D;  4A6Q A;  1RFK A;  2LXC A;  4NZL B;  3OAW A;  3ZRF A;  1LFD A;  1E8X A;  1EWY C;  1WR1 A;  4M02 A;  1F9J A;  3A9J A;  1E6E B;  3NVY A;  4HPL B;  4JLC A;  2ZEQ A;  3V05 A;  2HTM E;  2WQY B;  2IGG A;  2PIA A;  1WXQ A;  2G45 B;  2H88 B;  2IPK D;  2QCZ A;  1GOZ A;  3P4Q B;  3AUL A;  3TUO A;  4AOF A;  5E6O A;  3EUB 2;  1I35 A;  2M56 B;  4CO7 A;  4XYC A;  1NI3 A;  1ZXI A;  3FC4 A;  4FBJ B;  4FAD A;  2IND C;  3B9J A;  2QDF A;  1WGD A;  2PVO D;  4ICU A;  3AH7 A;  4WWN A;  3EFC A;  1H8C A;  3RNG C;  1ZW7 A;  3UIN B;  1ZXH A;  1P98 A;  1J7A A;  2H89 B;  3VUW A;  2LFI A;  1UWM A;  5LLI A;  1GJZ A;  1KLG D;  4TQ1 A;  1MPE A;  1P7F A;  3CF6 E;  1TYG B;  2PPH A;  5MPO A;  2M0X A;  5J2R A;  2MH7 A;  4YTN B;  5T8I A;  4KIK B;  1FPY A;  4R3D A;  5IKC M;  1MG4 A;  3AE4 B;  2BQQ A;  4TUU A;  1QOF A;  2LUE A;  2WXH A;  1LGR A;  2FNJ B;  4K7U A;  4BZA A;  3W9C B;  2CJN A;  4C7Y A;  1GAQ B;  3TSS A;  2FIF A;  3ZKJ C;  4L1B A;  1UUP A;  2LGY A;  1BUI C;  1FRD A;  1RLF A;  2KXJ A;  2IO0 B;  2NCN A;  3VAW A;  4W9F A;  2BYT A;  1V5T A;  1TTN A;  2QIL A;  3TEZ A;  2MJ3 A;  2DLB A;  2PKO A;  2L00 B;  4A8X C;  2EKE C;  2G4S A;  3JYU A;  2NVU I;  2WU5 B;  5DPT A;  4KIK A;  5H92 C;  3FIL B;  1JRO A;  2GBM A;  3RN9 C;  4CHK A;  3Q8B A;  1YD8 U;  2KJ6 A;  1L5P A;  4DXG A;  2REX A;  2BS4 B;  4XGA B;  3AEB B;  2WDV B;  1P7E A;  1R4M B;  1EM7 A;  1C3T A;  1QF6 A;  3AE2 B;  5HG2 A;  2RPQ A;  3FKY A;  2KMM A;  1UWX A;  1OEY A;  3MHZ A;  3DBR B;  1D4B A;  4NQK E;  1IPG A;  4LNF A;  2LHD A;  3A4R A;  1SSN A;  1I4Q A;  1E8Z A;  3PHX B;  2I1K A;  1WGK A;  2ZZP B;  3FIL A;  4NY0 A;  2O2V B;  1TZO A;  2DZI A;  4ANW A;  4YSY B;  3L08 A;  3I63 C;  3A33 B;  1ZPS A;  2MBO A;  4FXC A;  1NVI D;  5CHF A;  4ACF A;  1ZP0 B;  3VUX A;  3BYT B;  3DVN U;  4WWM A;  3E56 A;  3GS2 A;  3PZ7 A;  2DZM A;  3ZTD A;  4LDT B;  3IHP C;  3OWE B;  4XZ4 A;  2LVQ A;  3PVL A;  1ZUD 2;  5FKA C;  2NBV B;  2E6X A;  3MC0 B;  3ZTC A;  2LJ5 A;  2O2V A;  2ZVN A;  3AV8 A;  3ONS A;  2LD9 A;  3ML8 A;  3NUH B;  4A3P A;  2WX1 A;  1P3Q U;  1P9D U;  4MGK E;  2CJO A;  2A4Z A;  3TJP A;  2N9X A;  2FAZ A;  3J9C A;  3P1M A;  4JX1 C;  1KF6 B;  2D2Q A;  4YTM B;  1TIF A;  4PS8 A;  2HE7 A;  2MBB B;  2W3R A;  1V97 A;  1JWM D;  1NEN B;  1WF9 A;  3ZNH B;  1C4P A;  4WUR A;  2PE9 A;  4DQO C;  2SEB D;  4GSW A;  1PUT A;  3R7Q A;  1TS4 A;  2K22 A;  4HWI B;  1JW9 D;  3DOW A;  3KUD B;  4JWS C;  1UGJ A;  4WIP A;  1EWC A;  1TT5 B;  2W9N A;  4US9 A;  3I3T B;  3RNE C;  3X0W A;  2JWZ A;  1V1P B;  3B0A A;  3RI7 C;  3BZD B;  4USA A;  1KJT A;  2N1V A;  2QJL A;  1ET9 A;  2NMQ A;  1E8Y A;  3I5J C;  2IZV B;  4S17 A;  5BMI A;  2K39 A;  5C1Z A;  3C0R B;  1WGG A;  2M1M A;  3N1X C;  5BYR A;  2XEW A;  2ZW0 A;  3E9S A;  4LNK A;  2MA9 B;  3Q3M C;  4OVU A;  3TMP B;  4PK1 A;  2OED A;  4OZC A;  2N1W A;  4B95 A;  2L83 A;  4KSK C;  3RYT A;  1S3S G;  2ON8 A;  4RGN A;  5KHQ A;  2KMA A;  2Y5C A;  1V1P A;  2MRP A;  3QK0 A;  3ZJT A;  4ZRQ A;  4W9E A;  1VDV A;  4XE0 A;  2B76 B;  3MTN B;  1UGM A;  2JRH A;  3R66 C;  4NAM A;  4HPM B;  2V0G A;  2WS3 B;  1T0R C;  1T0Y A;  4K3C A;  1E8W A;  3DHG C;  3VR9 B;  1R4M I;  1T6B X;  1TS5 A;  2HTH A;  5JHB A;  4W9L A;  4X57 B;  4HPP A;  4HJG E;  2FBW B;  1WGY A;  1E7P B;  3DBR I;  1JRP A;  1K53 A;  3KVF B;  1AWD A;  3U7Z A;  1BXT A;  5D3I B;  4PS7 A;  2Y5B B;  1LXD A;  3JW0 X;  2J42 A;  3AEG B;  1SE2 A;  1J7C A;  2L3Z A;  3N3K B;  5TSS A;  2CU1 A;  2J0M A;  2JY6 A;  3KYC D;  2WXM A;  1I4R A;  5AEK B;  2DAJ A;  2C7M B;  1C76 A;  1PFD A;  1HXY D;  2BKF A;  3P4R B;  1H4R A;  2EKI A;  1TKY A;  2KO3 A;  2N9P C;  3QC8 B;  4IOI E;  4II3 B;  4AQ7 A;  4FN2 A;  2GBN A;  1HZ6 A;  1N60 A;  1YMH E;  4BKG A;  4B0M A;  1FM0 D;  1NDD A;  2KAN A;  3AEF B;  3Q8F A;  3ETR A;  4ZDV A;  2WU2 B;  1ET6 A;  1F77 A;  4DXF A;  4FA6 A;  5AZF A;  4E71 A;  2BVC A;  2ZPN A;  2WXR A;  1V86 A;  2RDG A;  1CMX B;  1XLP A;  2FCQ A;  1RFA A;  2QMT A;  2WGS A;  3SDL C;  1YQ4 B;  2WXF A;  3R2I A;  1Y56 A;  3ML9 A;  2BYE A;  1DOY A;  4XWW A;  4OZB A;  1ESF A;  3QQ8 B;  1Z2M A;  2WXI A;  1J19 A;  4KDL B;  2L8J A;  4GGQ A;  4KX6 B;  3O13 A;  3VQI A;  4L2Y A;  4NPN A;  4P7I A;  4DBG A;  4MSM B;  1WX9 A;  2GBR A;  2INN E;  2ZCC A;  3VDZ A;  2PTL A;  3U8Z A;  1F0Z A;  2L32 A;  1T0S C;  2M4N A;  3WAN A;  1YN3 A;  5JHA A;  1HTO A;  2M17 A;  1N5W A;  1IUE A;  3U4E G;  4A55 A;  2IO3 B;  3Q2A C;  4JE3 B;  4LNI A;  1NI2 A;  2FCN A;  4MH8 A;  1V81 A;  3GE3 C;  4J6I A;  2GMI C;  1VJK A;  1J8C A;  4C56 C;  2MW5 A;  3B08 A;  1OTR B;  1L0X B;  3GOE A;  5LXI B;  3RNC C;  2M8S A;  3V60 A;  3QJZ A;  1SIF A;  5DPR A;  3Q3N C;  2J4X A;  3CSF A;  2KN4 A;  1TGZ B;  2X8X X;  2WHI A;  5J18 A;  2UWQ A;  4TV3 A;  1KOT A;  4HJK A;  4MH0 E;  1OQQ A;  5BMH A;  1OGW A;  3PRP B;  3ZNG C;  3SD5 A;  3S2A A;  1HE8 A;  2JXT A;  5GMV A;  4C4V B;  1PGA A;  3ZXR A;  2KJR A;  2AYO B;  2G9H D;  4P1B C;  3A4S C;  2IGD A;  1L6U A;  1QOG A;  4CQN A;  3IBE A;  2G3Q B;  3NG0 A;  2Z0D B;  1K8R B;  2ZVO A;  2NR2 A;  2LWP A;  4KKJ A;  4RNA A;  1F2R I;  1I7H A;  3L10 B;  4LTU A;  4XDD A;  2IDY A;  2KT7 A;  1YIW A;  3IT4 B;  2BGF A;  3AN1 A;  2OHF A;  1WJN A;  3V62 A;  1FXT B;  1NBF C;  1D5X C;  5AZG A;  4C4V A;  1SBB B;  1XLN A;  3P42 A;  4LCD E;  2CU3 A;  2WXK A;  4IM2 A;  5HFY A;  1VLB A;  3DDC B;  4RGM A;  3HUI A;  4WJO A;  4XC2 A;  1F1H A;  2IY1 B;  3SR6 A;  3W2D A;  2FUG 1;  3KUC B;  2IJ0 A;  2JYE A;  2L76 A;  2WP9 B;  2BS2 B;  2WDT B;  3AED B;  1RYJ A;  3Q14 C;  4ARC A;  3RCZ A;  1D6E C;  4MM3 B;  3W1S A;  3MFG A;  2ONQ A;  1WH3 A;  4ICV A;  4B6W A;  3N32 A;  1IGC A;  2UYZ B;  3Q8C A;  2D10 A;  2WXJ A;  3N30 A;  1YQB A;  2VZK B;  2KK8 A;  5DCN A;  1ISN A;  2NTT A;  5IP4 D;  3VTV A;  4GDL B;  4RCO A;  4EE2 A;  3BK1 A;  4PT5 A;  2I38 A;  4OVV A;  2DHZ A;  1YJI A;  3AE8 B;  4Q2J A;  4KZ0 A;  4WAF A;  3ZJV A;  4GDK B;  1GUA B;  5G5H A;  3GE8 C;  4AWJ A;  2ASQ A;  1XLQ A;  4MM3 A;  3MJW A;  2K6D B;  3T3N A;  2RDB C;  3WIM A;  1YN5 A;  3QA8 A;  2JXX A;  5C3J B;  1SXT A;  2Z8L A;  3APF A;  1TY0 A;  2M0A A;  1OFF A;  4I6L B;  3PRZ A;  3N20 C;  2CR5 A;  4GDL A;  1JAL A;  2KC2 A;  4EKU A;  4MT5 A;  1EF1 A;  1Q10 A;  1GC7 A;  4J3O D;  4P1C C;  3HM6 X;  3AE7 B;  1YX5 B;  4GDK A;  4RH6 A;  4P6V F;  2JPH A;  3IAM 1;  3I57 A;  4GOC A;  2Y5P A;  3TIX A;  1FMA D;  3AXC A;  5L95 C;  3H8H A;  3ABV B;  2DNF A;  4W9D A;  3AE9 B;  2A5U A;  3L17 A;  1WIA A;  2K8H A;  5AUK A;  1MI0 A;  4C80 A;  4JQW C;  1WE7 A;  1XCQ L;  3DVN V;  1UZX B;  2V4L A;  1DOX A;  1WI0 A;  1TZ1 A;  2N7D A;  5I4D A;  2TSS A;  1WXS A;  1FXA A;  4YSZ B;  1ROE A;  2K9X A;  3AMZ A;  1WX8 A;  2VH1 A;  3TEW A;  1WWT A;  4NJ7 A;  2MJE A;  1SB3 C;  1PYW D;  4GN1 A;  3DQV A;  2HJ1 A;  4IG7 B;  1Y8R C;  4IWQ A;  4C7Z A;  2O6V D;  3EEC A;  1UBI A;  5IN7 A;  3UQB A;  1D3Z A;  3MJ5 A;  3PRM B;  2VZK D;  2KZR A;  1XCT L;  4AS1 A;  3SU8 X;  3T9L A;  1XEE A;  2E3T A;  1WXM A;  2WXP A;  3NY5 A;  3EA6 A;  2KDB A;  1N62 A;  2MSE D;  3ZUN A;  2KLC A;  2YEP B;  1FXI A;  2SAK A;  1OEY J;  4H2A A;  1GNU A;  1SGH A;  4GIV A;  3QCA A;  3NS1 A;  1V80 A;  4ANU A;  1WX7 A;  3R3M A;  4MEM A;  3HIZ A;  3KQ4 A;  4FLH A;  2W82 A;  5IO9 A;  2ZNV B;  2GRI A;  4XWT A;  2D3A A;  4LNO A;  3U30 A;  1V1O A;  3ZQ4 A;  2KMC A;  3W5V B;  2BPS A;  3V6E B;  2KAJ A;  3URY A;  3VVW B;  4MDK E;  1NYQ A;  4YL8 A;  1MJD A;  3H6N A;  2FCS A;  1SE4 A;  2IGH A;  1FCL A;  2N4F A;  4GXB A;  4HXD A;  1WZ0 A;  3RMK C;  5HHD G;  1KLU D;  1HA5 A;  2BS3 B;  2RD0 A;  2KWC A;  1IYF A;  5FR6 A;  3UGB B;  4BKS A;  4K81 A;  1F2R C;  4M8N A;  3SFE B;  2AX5 A;  2XN9 C;  3BK2 A;  1SIJ A;  1AN8 A;  2JZP A;  2BKR B;  4DHZ B;  4F8C B;  5GXG B;  1PQS A;  2I2Y A;  1I4H A;  1N61 A;  5C2T B;  3MC8 A;  3ZNZ B;  3DHI C;  2PMV A;  4OZA A;  4IDI A;  3L0W B;  3NZS A;  2QHO A;  3KWV A;  1VZ8 A;  1VZ6 A;  2N9K A;  1MFW A;  3LB8 C;  1E5W A;  3U52 E;  1N6Z A;  4G50 A;  4W9G A;  2KTR B;  3VH4 B;  1Z5S B;  4WJQ A;  4K7S A;  5AZH A;  3VXW A;  1FO4 A;  1F52 A;  4URK A;  2R61 A;  2KWV B;  3RD2 A;  3APD A;  1VD2 A;  3B2F A;  3Q3F A;  2BF8 B;  4AP4 C;  3PS6 A;  2Z0E B;  1K52 A;  4HK2 A;  2BWF A;  1GB1 A;  4DDI D;  2ICI A;  4A90 A;  3ZRC A;  4B9K A;  2PEA A;  3ZJU A;  3NOB A;  2J7Q B;  1UF0 A;  1FNV A;  3NVW A;  4G0N B;  4E74 A;  2K8B A;  2AQ1 B;  3NZU A;  1UBQ A;  3ZW3 A;  2KTR A;  1C78 A;  1XXG A;  1KFY B;  4LJP B;  3HK0 A;  1Q0W B;  2V1Y A;  2JU6 X;  2V3N A;  4W9J A;  1YOV B;  4IWP A;  3VR8 B;  4ANX A;  2AEH A;  3DPD A;  3PO0 A;  4LJO B;  3ZIM A;  4EZL A;  3RFZ B;  1IP9 A;  2CHX A;  4YXD B;  2NBW B;  4A3O A;  3BVG A;  4BKS D;  2MBH A;  4A9A A;  1KRH A;  4ZHP A;  3AE3 B;  1C1Y B;  2IBI B;  3IG3 A;  2KYW A;  2LGX A;  2ZPY A;  1T5X D;  2XK5 B;  1MHH E;  1KM7 A;  4NQL B;  3L4P A;  4HVB A;  3PT2 B;  2DX5 B;  4RM9 A;  1UH6 A;  1P1A A;  4RGT A;  2INC C;  4JL9 A;  1WJU A;  1WE6 A;  4JGH B;  5CTR C;  1Q5W B;  1TBE A;  4PYZ A;  4L23 A;  2L1A A;  4KGT A;  1K50 A;  3D32 A;  2KLG A;  5BMG A;  3L13 A;  4EEW A;  3N1Y C;  3EC8 A;  1L4D B;  3QX1 A;  2OJW A;  3N1Z C;  2JQR B;  2L7R A;  2BYV E;  2V3S A;  4IWO A;  5D94 A;  4W9I A;  2WWZ A;  2XK5 A;  5AUI A;  3V3X A;  2KDE B;  1EO6 A;  3DBL B;  1C4C A;  1D5M C;  3DWG C;  3WAO A;  1WJ4 A;  3C19 A;  4NAW B;  1B1Z A;  4M8M A;  3LDZ E;  3FAH A;  3VH3 B;  1V6E A;  1GB4 A;  3DVG Y;  3EFU A;  4YTP B;  2OOB B;  2MCN B;  4F7Z A;  1MVK A;  1I4P A;  2LGD A;  3NJT A;  3Q3O C;  3Q3J A;  3MP9 A;  4IUM B;  1E90 A;  4REZ A;  2ZJD A;  4FUL A;  1WRD B;  2DAF A;  4GMV A;  3RZW C;  4PYU A;  2RSU A;  4EUT A;  2CS4 A;  4KVG B;  4NAW A;  2K8C A;  2NTS A;  5J17 A;  2M19 A;  3WAM A;  3V6C B;  3W1S C;  3M3J A;  3H7P B;  2K5P A;  2PJH A;  1XLO A;  2FCM A;  2BYF A;  1R7S A;  2GBJ A;  1ACC A;  3SFD B;  2K0P A;  2IYD B;  1WSP A;  3RZF A;  2WXN A;  5CX3 A;  3ECI A;  2R2Q A;  2N9L A;  1CQV A;  1QKZ A;  3TEX A;  3ZGZ A;  4WWP A;  2L05 A;  1FCC C;  1BT0 A;  1VCB A;  1L2N A;  5CHW A;  4G3X B;  4DK5 A;  3RUI B;  3H7P A;  2JWU A;  3U7D A;  2AQ2 B;  1V5O A;  2BW2 A;  2WDQ B;  2NBU A;  1J0G A;  5D7G A;  1QT9 A;  3KWL A;  2WXO A;  2C9W B;  3HVD A;  2LRU A;  5G5G A;  2MBQ A;  3RPF C;  2KD0 A;  2KC1 A;  3MC9 A;  4DHZ E;  3WAL A;  4TKN A;  2RMM A;  3QHT A;  4P16 A;  3V61 A;  2EEL A;  1FNU A;  3VTU A;  3SEB A;  2KVR A;  3VHT C;  2LHE A;  2D07 B;  2WXQ A;  3MHS D;  1YNT E;  1SJE D;  3WCQ A;  1T3Q A;  3JSV B;  3ZDT A;  2C60 A;  4TQ0 A;  2R2O A;  1L4Z B;  1FFU A;  1EUV B;  2LVO A;  1YX6 B;  4G11 A;  1C79 A;  2WXL A;  4RFB A;  1IBX B;  2K1F A;  3GB1 A;  4DWF A;  2ZW1 A;  4OVZ A;  3SHQ A;  1HTQ A;  2XBB C;  4N6E B;  5IOI A;  2LGS A;  1HZ5 A;  4C00 A;  1I42 A;  1JCK B;  3HRD D;  4M00 A;  2KQS A;  3HVZ A;  4MGY E;  3VTW A;  2KAC A;  4ZRP A;  3P63 A;  2FUH B;  1P0R A;  2D11 A;  3ZO5 B;  2L0F A;  3JSV A;  3B2G A;  1VRA B;  3BIN A;  3NVZ A;  4RF1 A;  3DBL I;  5IA7 A;  4JIO U;  4D2K A;  2PE6 B;  1IBX A;  4BAX A;  2O6V B;  2W55 A;  2HJ8 A;  5BO4 B;  1EU4 A;  1WXA A;  2KNB A;  4RF0 A;  4RGO S;  4DXA B;  5L83 A;  2QIE B;  2KQ7 A;  2V3P A;  3TEY A;  3O65 B;  3R7R A;  3RNF C;  3ZNI D;  1U4A A;  2X38 A;  5FK9 C;  4UDU C;  5D6J B;  1PGB A;  5BYQ A;  1JWB D;  2G1E A;  3AE5 B;  3VFK A;  2CHZ A;  2Q5W D;  1KLV A;  2XNA C;  3KW5 B;  1V8C A;  1JWS D;  2LZ6 A;  3QAQ A;  2PLP A;  3Q6B A;  1WYW B;  4XDC A;  2O6V A;  1YJJ A;  1DOI A;  3IT6 B;  1X1M A;  3U2S C;  5D2M B;  1S1Q B;  4AJW A;  2W54 A;  1C77 A;  1R4N B;  1JRU A;  2LAS A;  2WNM A;  2NS5 A;  2C5L C;  5H8Y E;  3PGE A;  4ZRJ A;  2PW9 A;  3DWM A;  4KZC A;  2DEN B;  1HQR D;  4WH4 A;  2MWS B;  3NRZ A;  4AJY B;  2OJR A;  2ZNV C;  4HKZ E;  2DYO A;  1B9R A;  5LNK 1;  2MHJ A;  3VRB B;  2KVZ A;  1V49 A;  1M94 A;  4BBN F;  1RRB A;  3AEA B;  1AYF A;  4BVU C;  3ALB A;  1CK1 A;  2CKH B;  2KDM A;  1C9F A;  3LXF A;  1E10 A;  1E0Z A;  2MBE A;  3BVM A;  2LMC A;  1ZGU B;  4TSS A;  1DYQ A;  4K1R B;  4E3C A;  2KKC A;  3H7S A;  2DZK A;  3DCG A;  3R2T A;  4W9C A;  4MEL A;  4EFO A;  5G55 A;  4HCN B;  3C8Y A;  4AUQ C;  4OHJ A;  4WQO B;  1QOA A;  3L54 A;  3DBH B;  1I4X A;  3PLV A;  2ACZ B;  1AW7 A;  1N63 A;  2JUO A;  3AE1 B;  4HRS A;  3LYY A;  5D3D A;  1WY8 A;  5JXV A;  2C7H A;  4KDI C;  4LLG M;  1K51 A;  3VUY A;  3NVV A;  3IAS 1;  4WAA A;  1YJ1 A;  2JZ3 B;  4IW0 A;  3NZ3 A;  1KH0 A;  1L7Y A;  2WXG A;  1ZDX A;  4IM0 A;  2PVG C;  1JWA D;  5C23 A;  1XT9 B;  2V9H A;  3AB5 A;  3DHH C;  3BYY B;  2GLS A;  1FRR A;  1AAR A;  2KHW B;  5E6J A;  3T8M A;  2MP2 B;  4ZRK A;  1TY2 A;  3P2B A;  4KGR A;  4PS3 A;  1KTK A;  1L0Y B;  1YQ3 B;  2AL3 A;  1SE3 A;  3CST A;  4MGZ E;  3AU4 A;  2N7E A;  1RAX A;  1WXV A;  2L0T A;  1ZOY B;  3PSE B;  3AE6 B;  1E7V A;  2MEK A;  2D3G A;  3HM3 A;  3I9V 1;  4ANV A;  3VRA B;  4EOY A;  1JML A;  1QLB B;  1WM3 A;  4MAC A;  2JT4 B;  2N9E B;  2N0S B;  1QZE A;  2RDH A;  1ZE3 D;  3JVZ X;  3NHE B;  3EGR A;  4FJV B;  2BT6 A;  3UF8 A;  1VR9 A;  1WRI A;  3RUL A;  3A1Q B;  2DBY A;  2AWT A;  2CHW A;  2MP2 A;  3ZXV A;  1EU3 A;  4M0W B;  3GZN B;  3PTF C;  2DZJ A;  4HEA 1;  4WWO A;  4FJY A;  2JSV X;  2KN5 A;  4FHJ A;  2YLM A;  4ZRI A;  1N5X A;  1R4N I;  3DVG X;  1YN4 A;  2INP E;  4TMA B;  1CJE A;  4BFR A;  3R8B A;  1UNS A;  3BWU D;  1TKE A;  4HDO A;  1E7U A;  1TKG A;  4NNJ B;  3L16 A;  4ZYS A;  1WZ3 A;  3ZVV A;  4ARI A;  1I4G A;  3CIR B;  2LUM A;  1C4A A;  1LO5 D;  2JX5 A;  2N7J A;  3PZD A;  4N59 A;  3A1Q A;  4DHJ B;  1EF5 A;  5G2N A;  2L52 A;  4M0W A;  4IC7 B;  1CZP A;  1SE9 A;  5EE0 A;  3PLU A;  4A20 A;  1XO3 A;  3RNB C;  2G4D B;  2AQ3 B;  4NJ6 A;  2KWD A;  4W9H A;  5EE9 A;  1WFY A;  4MGI E;  4KGS A;  4S0R A;  3TL5 A;  1SF0 A;  1QQR A;  3TCA A;  3EHV A;  1FIQ A;  4GLS C;  2NPT B;  1DGJ A;  2KOX A;  4II2 B;  4WJN A;  5KHO A;  3M63 B;  3K9O B;  3PRE A;  2QEJ C;  4FHK A;  3IVF A;  3QWZ B;  1UD7 A;  3H9D A;  2JZZ A;  1J7B A;  2K3U A;  1FD6 A;  4O1N A;  2J53 A;  4M01 A;  2EMT A;  3WA0 A;  2LVP A;  3P4S B;  2WLB A;  1WGH A;  1GG3 A;  3PPA A;  1L0V B;  1TS3 A;  3M62 B;  2MX2 A;  4W9K A;  1JQ4 A;  2LI5 A;  4HCP B;  1TS2 A;  3DBH I;  2HDE A;  3N9Y C; 
#chains in the Genus database with same CATH homology
 4GDK B;  1ZPS A;  1FCC C;  3Q8E A;  4FXC A;  5G5H A;  1NVI D;  1ZP0 B;  1FEH A;  1XLQ A;  4US8 A;  2JWU A;  3T3N A;  3BYT B;  1YN5 A;  2JYT A;  4WWM A;  3E56 A;  5C3J B;  2AQ2 B;  3GS2 A;  1SXT A;  2BW2 A;  3PZ7 A;  2WDQ B;  2Z8L A;  5D7G A;  1TY0 A;  1QT9 A;  2GB1 A;  2WDR B;  4NJC A;  2M0A A;  3OWE B;  1OFF A;  3KWL A;  2WXO A;  3IXS A;  5FR3 A;  3HVD A;  1ZUD 2;  1NYR A;  5FKA C;  1JAL A;  2E6X A;  1WYG A;  4MT5 A;  3MC0 B;  5G5G A;  3RPF C;  1ENF A;  1Q10 A;  4J3O D;  5EE1 A;  3AE7 B;  2KQ4 X;  3AV8 A;  4OW0 A;  3ZGZ A;  2RMM A;  3NUH B;  4ZHO A;  4P16 A;  4RH6 A;  4P6V F;  3IAM 1;  3I57 A;  2EEL A;  1FNU A;  2Y5P A;  3CWI A;  1FMA D;  2V4I B;  2CJO A;  5BYS A;  3H8H A;  4ZOH C;  2YEP F;  3SEB A;  2RPV A;  1VZ7 A;  2LGI A;  2LHE A;  3ABV B;  3J9C A;  3AE9 B;  2WXQ A;  3P1M A;  3UI3 A;  4JX1 C;  1YNT E;  1KF6 B;  1SJE D;  3WCQ A;  1T3Q A;  1TJE A;  4TQ0 A;  4YTM B;  5AUK A;  1MI0 A;  1D5Z C;  4C80 A;  1L4Z B;  1FFU A;  1XCQ L;  3BVZ A;  1C79 A;  2W3R A;  1DOX A;  5I4D A;  2WXL A;  1QOB A;  1V97 A;  1JWM D;  2TSS A;  2DWQ A;  4RFB A;  1IBX B;  1FXA A;  1MHX A;  1NEN B;  4YSZ B;  3GB1 A;  1ROE A;  1C4P A;  4WUR A;  2K9X A;  3AMZ A;  1GPX A;  2ZW1 A;  4OVZ A;  1M4V A;  4DQO C;  4N6E B;  2SEB D;  2LEK A;  1PUT A;  3TEW A;  1HZ5 A;  1TS4 A;  2K22 A;  1WWT A;  1JCK B;  1JW9 D;  4JWS C;  1UGJ A;  4WIP A;  1EWC A;  3AEC B;  3HRD D;  3HVZ A;  2MJE A;  2KAC A;  1SB3 C;  1PYW D;  4US9 A;  4ZRP A;  1E9M A;  3P63 A;  4B0E A;  4LK0 M;  4IKG A;  1V1P B;  1PDX A;  3BZD B;  4USA A;  2QSD A;  2BTE A;  2QJL A;  1ET9 A;  2NMQ A;  1VRA B;  3B2G A;  3NVZ A;  4C7Z A;  4RF1 A;  5BMI A;  5HI1 A;  5BYR A;  4D2K A;  2ZW0 A;  1IBX A;  3E9S A;  3MJ5 A;  1HEZ E;  2W55 A;  1EU4 A;  5EE3 A;  2VZK D;  4RF0 A;  4RGO S;  3AM9 A;  1PGX A;  1NEK B;  2QIE B;  3Q69 A;  1XCT L;  2OED A;  4OZC A;  4AS1 A;  2V3P A;  1XEE A;  2L83 A;  3TEY A;  2E3T A;  2WXP A;  1STE A;  2ON8 A;  4RGN A;  1L6V A;  3EA6 A;  1N62 A;  4KKI A;  4YT0 B;  3KLS X;  2X38 A;  2YEP B;  1FXI A;  5FK9 C;  4UDU C;  2SAK A;  2Y5C A;  1V1P A;  1PGB A;  4H2A A;  5BYQ A;  3ZJT A;  1JWB D;  4YSX B;  4ZRQ A;  2G1E A;  3AE5 B;  1QIL A;  1SJH D;  2Q5W D;  1VDV A;  4XE0 A;  3NS1 A;  2XNA C;  2B76 B;  1V8C A;  1JWS D;  4NAM A;  2PLP A;  2BB6 A;  4XDC A;  3KQ4 A;  2V0G A;  2GI9 A;  1YJJ A;  1DOI A;  2WS3 B;  3IT6 B;  2FE8 A;  2W82 A;  3U2S C;  2GRI A;  4XWT A;  3VR9 B;  2D5G A;  1T6B X;  2W54 A;  3ZYY X;  1C77 A;  1TS5 A;  4JWU C;  1XF5 L;  1V1O A;  2BBC A;  4ITK A;  3ZQ4 A;  4HJG E;  2FBW B;  2WNM A;  3W5V B;  4HRO A;  4HKQ A;  1E7P B;  2KAJ A;  5H8Y E;  1JRP A;  1K53 A;  1FNW A;  3URY A;  1AWD A;  2PW9 A;  1BXT A;  3DWM A;  1NYQ A;  5D3I B;  3U7Z A;  1HQR D;  2J42 A;  1IGD A;  1SE4 A;  4WH4 A;  2IGH A;  1FCL A;  3AEG B;  1SE2 A;  1JWU D;  2W3S A;  3GP7 A;  3NRZ A;  1J7C A;  5TSS A;  1BML C;  5HHD G;  1KLU D;  2WXM A;  1I4R A;  1HA5 A;  4HKZ E;  2DYO A;  1B9R A;  2BS3 B;  4WQM A;  5LNK 1;  1C76 A;  1PFD A;  4JPS A;  4YWG G;  1OQR A;  3VRB B;  2J52 A;  1HXY D;  3P4R B;  3BII D;  3AEA B;  2EKI A;  1A70 A;  1TKY A;  2DYM A;  1AYF A;  1CK1 A;  1F2R C;  4IOI E;  3SFE B;  1FFV A;  2AX5 A;  2KDM A;  2XN9 C;  1C9F A;  3BK2 A;  1SIJ A;  1ZDV A;  2LJI A;  1AN8 A;  2JZP A;  3W5U B;  4AQ7 A;  2BB5 A;  3LXF A;  3T3O A;  1E10 A;  2MJD A;  1E0Z A;  5GXG B;  3BVM A;  2I2Y A;  1I4H A;  1HZ6 A;  1N60 A;  1N61 A;  1RM6 C;  1YMH E;  2LMC A;  3P4P B;  5C2T B;  4OZA A;  2PMV A;  4TSS A;  1DYQ A;  1FM0 D;  4B0M A;  4IDI A;  3AEF B;  3KWV A;  1VZ8 A;  1VZ6 A;  2N9K A;  3LB8 C;  2Y3A A;  3Q8F A;  3U52 E;  3ETR A;  1RWS A;  2WU2 B;  1ET6 A;  1F77 A;  4DXF A;  4N58 A;  2WXR A;  2RDG A;  1FO4 A;  3R2T A;  1XLP A;  3AEE B;  3PZ8 A;  2R61 A;  3Q8A A;  3C8Y A;  3B2F A;  4OHJ A;  2QMT A;  1YQ4 B;  2WXF A;  3R2I A;  1Y56 A;  1K52 A;  1QOA A;  1I4X A;  1GB1 A;  1DOY A;  4XWW A;  4OZB A;  2ICI A;  4A90 A;  1ESF A;  2ACZ B;  3ZJU A;  2WXI A;  1AW7 A;  1N63 A;  3AE1 B;  1FNV A;  1SEB D;  3NVW A;  1RFK A;  4A6Q A;  4KX6 B;  4HRS A;  3O13 A;  3LYY A;  4L2Y A;  4NZL B;  5D3D A;  3VQI A;  5JXV A;  2AQ1 B;  4LLG M;  1EWY C;  1K51 A;  1C78 A;  1XXG A;  1KFY B;  2INN E;  3NVV A;  3IAS 1;  1E6E B;  3NVY A;  2PTL A;  1KH0 A;  2JU6 X;  2V3N A;  3NZ3 A;  2WXG A;  3VR8 B;  1ZDX A;  1F0Z A;  2L32 A;  2PVG C;  1JWA D;  2HTM E;  2WQY B;  3V05 A;  1YN3 A;  2IGG A;  3PO0 A;  3AB5 A;  2PIA A;  1WXQ A;  1N5W A;  3RFZ B;  2H88 B;  1IUE A;  2IPK D;  4YXD B;  3U4E G;  4A55 A;  1GOZ A;  4JE3 B;  3BYY B;  3P4Q B;  4MH8 A;  3TUO A;  3BVG A;  1VJK A;  1FRR A;  5E6J A;  4A9A A;  3EUB 2;  1KRH A;  4C56 C;  4ZHP A;  3AE3 B;  2M56 B;  1L0X B;  1NI3 A;  1ZXI A;  3FC4 A;  1TY2 A;  1T5X D;  3B9J A;  1MHH E;  2PVO D;  4KGR A;  3L4P A;  2J4X A;  2KN4 A;  1KTK A;  1L0Y B;  1YQ3 B;  1SE3 A;  3AH7 A;  4RGT A;  1ZOY B;  3AE6 B;  2MEK A;  1ZXH A;  1OQQ A;  3I9V 1;  5BMH A;  3VRA B;  1J7A A;  1JML A;  1QLB B;  4MAC A;  4L23 A;  2L1A A;  4KGT A;  1K50 A;  2JXT A;  2N0S B;  2H89 B;  5BMG A;  2RDH A;  1ZE3 D;  2LFI A;  1UWM A;  1KLG D;  3EGR A;  2BT6 A;  1VR9 A;  1WRI A;  1L4D B;  4TQ1 A;  1PGA A;  1MPE A;  2DBY A;  1EU3 A;  1P7F A;  2JQR B;  1TYG B;  2G9H D;  4HEA 1;  5AUI A;  5MPO A;  3V3X A;  2MH7 A;  2IGD A;  4YTN B;  5T8I A;  1L6U A;  2JSV X;  1QOG A;  4CQN A;  1C4C A;  1D5M C;  4R3D A;  1N5X A;  3AE4 B;  3DWG C;  1YN4 A;  2INP E;  4TMA B;  1CJE A;  3R8B A;  1UNS A;  3BWU D;  1QOF A;  1TKE A;  1TKG A;  4ZYS A;  2WXH A;  4NAW B;  1B1Z A;  4ARI A;  4KKJ A;  3FAH A;  1I4G A;  3CIR B;  4RNA A;  2CJN A;  1F2R I;  3W9C B;  1GB4 A;  1I7H A;  4C7Y A;  4LTU A;  1GAQ B;  4XDD A;  4YTP B;  2IDY A;  3IT4 B;  3TSS A;  2LUM A;  1C4A A;  1MVK A;  1LO5 D;  1I4P A;  4L1B A;  2JX5 A;  3AN1 A;  1UUP A;  2OHF A;  1BUI C;  1FRD A;  2N7J A;  3MP9 A;  1D5X C;  2BYT A;  1SBB B;  1XLN A;  2QIL A;  4N59 A;  3TEZ A;  4REZ A;  3P42 A;  2MJ3 A;  2L52 A;  2CU3 A;  2WXK A;  4M0W A;  2DLB A;  1CZP A;  5HFY A;  2PKO A;  1VLB A;  5EE0 A;  1XO3 A;  4A8X C;  4RGM A;  2AQ3 B;  3HUI A;  2WU5 B;  2KWD A;  5H92 C;  3SR6 A;  3W2D A;  3FIL B;  1JRO A;  2FUG 1;  5EE9 A;  2IJ0 A;  2JYE A;  3Q8B A;  4KGS A;  1SF0 A;  1QQR A;  2WP9 B;  2BS2 B;  3AED B;  2NTS A;  1L5P A;  1FIQ A;  4GLS C;  1RYJ A;  4DXG A;  2M19 A;  2BS4 B;  1DGJ A;  3AEB B;  4ARC A;  2WDV B;  1D6E C;  4MM3 B;  1P7E A;  3W1S A;  3MFG A;  2K5P A;  1EM7 A;  2ONQ A;  1QF6 A;  1XLO A;  3AE2 B;  1R7S A;  2QEJ C;  5HG2 A;  1IGC A;  2KMM A;  1UWX A;  1J7B A;  3MHZ A;  3Q8C A;  2K3U A;  1FD6 A;  1ACC A;  2WXJ A;  2J53 A;  2K0P A;  4O1N A;  1WSP A;  3SFD B;  1D4B A;  3P4S B;  2WLB A;  2VZK B;  2LHD A;  2NTT A;  2WXN A;  4GDL B;  1SSN A;  4RCO A;  1I4Q A;  4EE2 A;  3BK1 A;  1WGK A;  3FIL A;  4PT5 A;  1TZO A;  1L0V B;  2I38 A;  1TS3 A;  4YSY B;  1YJI A;  3AE8 B;  2N9L A;  1JQ4 A;  1CQV A;  1QKZ A;  1TS2 A;  4Q2J A;  3TEX A;  2HDE A;  4WAF A;  3ZJV A;  3N9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...