1YJIA

Rdc-refined solution nmr structure of reduced putidaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 15
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjiA00
3NVWA 4IDIA 3AECB 1FFVA 3HRDD 1DOXA 2ACZB 5EE9A 2K22A 4YSXB 1WRIA 1DGJA 3W5UB 3VR9B 2WU5B 1A70A 1FXAA 1TYGB 1UWMA 5MPOA 1E10A 1KRHA 3B2GA 1ZXIA 1N5WA 4P6VF 3NVZA 1XLOA 2BS3B 4YSYB 5C2TB 2W3RA 3AE1B 5AUIA 1E0ZA 1RYJA 3NVYA 1FM0D 1WYGA 2K5PA 3SFEB 5AUKA 2AX5A 2WDRB 1RWSA 3HUIA 1FO4A 1SB3C 2JX5A 1ZP0B 1T3QA 1PDXA 2PVOD 3AV8A 1AWDA 2WS3B 4N59A 5C3JB 1FIQA 2KAJA 2K9XA 1QOBA 1XO3A 3NVVA 2N0SB 2KMMA 1JROA 2MJ3A 3ETRA 1EWYC 1TJEA 2B76B 3AEEB 4FXCA 1QOAA 1L5PA 1CZPA 1ROEA 3LXFA 1TKEA 2EKIA 1J7CA 1KF6B 3AEDB 1CJEA 1SIJA 1L6UA 1RM6C 3P63A 1PUTA 1JRPA 4US9A 5G5HA 4C7YA 2CJNA 1I7HA 1VLBA 1XLNA 3AE5B 1N63A 4ITKA 5GXGB 3VR8B 1JQ4A 4WWMA 1YQ4B 3WCQA 2BS2B 1JALA 1GAQB 2JQRB 1AYFA 1DOYA 4USAA 4JX1C 2Q5WD 3EUB2 1QF6A 3PO0A 1JW9D 1L0VB 1FRRA 1OQRA 3ZYYX 1RFKA 4C7ZA 3DWMA 5EE3A 1XLQA 4US8A 1N62A 3BIID 1J7AA 4JWUC 1GPXA 2W3SA 4YT0B 4N58A 2W55A 1FMAD 2WDQB 1QT9A 1R7SA 1NENB 3AEAB 1TKGA 4N6EB 1OQQA 2PKOA 1NYRA 1PFDA 3FC4A 5EE1A 5H8YE 3CIRB 4YTMB 3KWLA 3L4PA 1YJJA 1VDVA 4ZHPA 1NI3A 2BT6A 1QLBB 3P4RB 1DOIA 3CWIA 1F0ZA 3RPFC 3NRZA 3AE4B 2MH7A 2DBYA 5H92C 3SFDB 2H89B 2WU2B 1XLPA 5G5GA 2L52A 4LTUA 1VJKA 1FXIA 2Y5CA 1NYQA 3AH7A 2W54A 1ZUD2 2E3TA 2CU3A 3AE7B 4A9AA 3DWGC 3AB5A 1KFYB 1N5XA 2WDVB 2CJOA 2DWQA 3AE8B 3AEBB 2WLBA 4ZHOA 3ABVB 3P4SB 1JWAD 2M19A 1WXQA 2MJDA 1WGKA 3AEFB 1ZOYB 1SF0A 2BS4B 3AEGB 3B9JA 1YJIA 1NEKB 2MJEA 3W9CB 1QOGA 1IUEA 1OFFA 4WQMA 1YQ3B 4YSZB 3AE9B 1QOFA 2FBWB 1N61A 3LB8C 3W5VB 1NVID 3AE6B 2HTME 2OHFA 3FAHA 2QJLA 2L83A 3AE2B 1FRDA 1N60A 2G1EA 2PIAA 3AM9A 3P4QB 1V8CA 4HRSA 2WP9B 2LEKA 4YXDB 3AE3B 2QIEB 4HROA 3SR6A 1E7PB 3P4PB 2M56B 3AMZA 2WQYB 4YTNB 4JWSC 1E9MA 3B2FA 1E6EB 1JWBD 3HVZA 4ZOHC 2H88B 1FFUA 4YTPB 3AN1A 1B9RA 1WWTA 3VRAB 3NS1A 1V97A 3P1MA 5EE0A 3VRBB 4C80A 1L6VA 2PVGC 4KX6B 1J7BA 1TKYA
chains in the Genus database with same CATH superfamily
4IDIA 3AECB 2GRIA 2C60A 3DBHB 4EZKA 4A3PA 1WX8A 2JXXA 4I6NB 4MEMA 5AZFA 4BAXA 2PJHA 1TS5A 2JSVX 3CSFA 2K6QA 5J2RA 3VVWB 4L1BA 1F1HA 2G4DB 2KO3A 1TGZB 1SJHD 3BYYB 3T8MA 4LCDE 4A55A 4MJSB 1V1PA 2N0SB 1YN3A 1D4BA 1PGBA 1CZPA 3C8YA 5KHOA 1TKEA 2EKIA 3SDLC 1L4DB 1CJEA 1LFDA 2GBRA 2LD9A 5IOIA 5G5HA 3IT6B 4NNJB 3FILA 3EUB2 4MDKE 1RFKA 3PLUA 4B9KA 1WGYA 4G3XB 5HHDG 3Q8BA 1C77A 2PKOA 4RH6A 4DDID 3UIOB 2BYTA 2KWCA 4M0WA 1FNUA 1KOTA 1HTOA 3H9DA 2L52A 3TUOA 5DPWA 4I6PA 1Q10A 2WXOA 3AE7B 2EELA 1WM3A 1N5XA 2LWPA 4BFRA 1RLFA 1YN5A 1QQRA 1ET9A 4DHZE 2CHZA 1SF0A 3SEBA 4ICVA 1NEKB 3N20C 4JL9A 2PW9A 1YQ3B 4FHKA 1GJZA 3VUXA 3HHMA 3UIPB 3LB8C 3FAHA 2Y3AA 2DZMA 3T9LA 2BF8B 2K8CA 5L83A 2QC8A 2K3UA 3ZGZA 3RNBC 1A5RA 3Q2AC 2JRIB 1WWTA 1I4RA 4URKA 2ZPYA 2KHWB 4K7WA 3DHHC 1UD7A 4DDGD 3BZDB 2V1YA 3QX1A 3A33B 3AE1B 4AS1A 4GXBA 5D7GA 3WANA 2NBWB 2Z8LA 1FCLA 4JIOU 4ASWC 2ZZPB 3WAOA 4A90A 3AV8A 1TS2A 2RDGA 5HG2A 2GB1A 3DVGY 5IAAC 4HLEA 1KTKA 2L0TA 2WYQA 2J53A 1VLBA 4KGTA 1WGGA 4OVZA 2Z0DB 3JVZX 1PGAA 3VTUA 1IYFA 2KANA 4GGQA 2QSDA 3BVGA 5TSSA 3CIRB 2KWVB 1NI3A 4HJGE 3ZIMA 2BYFA 3SHQA 3ZJTA 1E7UA 4X57B 2KJRA 4L2YA 5DCNA 3UI3A 1EM7A 4GDKB 2DAFA 4DXFA 3UQBA 5D3IB 1IGCA 3NS8A 3DBLI 2M19A 3CMMB 5FR3A 2FAZA 3AEFB 1IBXA 3B9JA 3U7ZA 2GBNA 3PV1A 4XDDA 2PIAA 2LJIA 3N3KB 4C56C 1L0YB 4WJQA 3IVFA 3ZRCA 2M4NA 4MSQB 1C4PA 2FUG1 1EF5A 4TMAB 2REXA 1V5TA 1OGWA 3VR9B 2WU5B 4P7IA 1KRHA 4HJKA 2QHOA 5FKAC 2KDEB 5LNK1 2D10A 4J6IA 1XLOA 2DHZA 3OLMD 3JSVA 2FNJB 3RYTA 3J9CA 4ZRIA 2IGHA 2WX0A 4LNOA 4KIKB 2IY0B 1ZP0B 1KH0A 3MC8A 4W9LA 4XX5A 3PVLA 1XO3A 3Q14C 1F77A 1EWYC 4FXCA 4W9KA 4DXGA 1F9JA 2L1AA 2OOBB 3X0WA 1P98A 3P63A 1YMHE 3TCAA 5CHVC 1N63A 3WCQA 4MGIE 5CTRC 4IC7B 1PQSA 2BYEA 4NAWA 1BUIC 5EE3A 4HVBA 1XLQA 2PPHA 1D3ZA 3GP7A 4RFBA 2MBEA 1V80A 2MLBA 3FC4A 3LJ3A 1U4AA 3SFDB 2K8HA 4S0RA 2BWFA 1VD2A 4LTUA 1VJKA 2Y5CA 3R3MA 2KTRA 2XK5B 2FCNA 5LLIA 2HD5B 1UGJA 4OZBA 4EUTA 4BKSD 1E8WA 1SE2A 4OZAA 4FADA 4E71A 3OJ3A 4HPMB 1SEBD 1RFAA 2JZZA 3KUCB 1VRAB 2MHJA 1MHHE 4G0NB 2ZPNA 2LEKA 2INDC 2NTSA 4MSMB 5D6JB 3BWUD 5HKHA 2K39A 4ZOHC 3M3JA 3PHXB 3ZQ4A 4WAFA 4YL8A 3DCGA 3H8HA 1E8ZA 3HM3A 3EFUA 4AJYB 1TIFA 3W5UB 3VDZA 3GZNB 2MRPA 3AI5A 1MHXA 2LGDA 3A9KA 2BB6A 2N9KA 5C2TB 4C4VB 1JRUA 3ZVVA 1HQRD 1EO6A 3IFWB 3M62B 1PGXA 4B6WA 2O6VD 3V3XA 2LGSA 2JZPA 3Q3NC 2G45B 1TTNA 2I2YA 1P0RA 4WJOA 2NMQA 1M94A 1S3SG 3AE5B 4ZYNA 4GDLB 2SAKA 1ZKHA 2ONQA 2DZJA 2HJ1A 3ZYYX 1KLGD 4C7ZA 3BIID 5AZHA 2RMMA 2V3SA 3UGBB 3L4PA 3MJWA 2IJ0A 5LXIB 2K1FA 2MBHA 2VZKB 5H92C 2QEJC 5BMHA 1I4PA 1WIAA 2LJ5A 2CU3A 1V2YA 2GI9A 2I1KA 3AE8B 3VH3B 2J0KA 4BOZB 4ZYSA 4XGAB 3OWEB 1ZOYB 1I4QA 3DBSA 3B0AA 3R7QA 3U52E 4MGZE 4YSZB 2MBBB 1PYWD 3ZJUA 2D3BA 3QA8A 4HK2A 2QJLA 3AM9A 4YXDB 2PE9A 5AEKB 3VFKA 3QK0A 2OJWA 2QIEB 2WQYB 4KGRA 4FJZA 2YLMA 3R66C 4KZCA 1RAXA 5G5GA 3VUWA 3HRDD 2GOWA 2K6DB 1HXYD 1A70A 1ZDXA 2JRHA 2VH2A 2JT4B 4NJCA 4EKUA 4MT5A 1MVKA 4TUUA 4MM3A 3Q3MC 3EA6A 1JWMD 2ZW1A 2KC1A 1V86A 2WXGA 4IUMB 4J3OD 4TQ1A 4WJNA 1H4RA 2IY1B 2N7EA 4LLGM 2NPTA 2KC2A 3ZO5B 4HXDA 2D3AA 1RM6C 1PUTA 4FULA 1RRBA 2N7JA 3MC9A 3Q8FA 3N1ZC 3L54A 2R61A 2UU7A 4ZRKA 1J8CA 1I4GA 1OQQA 4RMAA 2AEHA 2C7HA 5H8YE 4M00A 4LJPB 2A4ZA 1WXSA 1VDVA 4DWFA 4ZHPA 2XN9C 4P1CC 3ZNHB 2WGSA 5JHAA 3OG5A 3M95A 1FEHA 2MP2A 2J4XA 3N30A 3PS6A 1Y56A 4IW0A 3EC8A 4EZJA 3B1LX 2UWQA 4OVUA 4WWNA 2ON8A 4G11A 3ENEA 1C4CA 3W9CB 3HK0A 3QHTA 1VCBA 2IO0B 2QMTA 4M8MA 4F7ZA 2MW5A 1NVID 4BBNF 3I63C 3TL5A 3DPDA 1FRDA 4LNKA 1ZGUB 1VZ8A 1I4XA 1WI0A 5E6JA 4PYZA 2GBKA 3GB1A 3RNCC 1WXAA 1I4HA 2FIDA 2L3ZA 1MFWA 3NVWA 3Q8CA 4JPSA 4EEWA 1FXAA 2BKFA 2WXPA 2W3RA 3KUDB 2BBCA 4EOYA 1HZ5A 1SE4A 1V49A 1T3QA 1MG8A 2NTTA 1F2RI 2PVOD 4N59A 2O2VA 5E6NA 1C76A 4HPPA 1Y8RC 1QOBA 2N9LA 2XEWA 4FJYA 3MJ5A 1Q0WB 4WQOB 4F1SA 1I42A 3RNEC 1KF6B 2DZIA 2KQ7A 3AEDB 3R2IA 1ESFA 4MELA 4WWMA 1SBBB 3KYDD 1UBIA 2KNBA 1JCKB 1OQRA 5FR6A 4IM3A 4FA6A 3MHZA 1J7AA 2XBBC 3N9YC 3PPAA 4QAYA 3AEAB 1NBFC 2N9XA 1CK1A 3L17A 3GZNI 3ZTDA 2KVRA 2B3AA 5FK9C 2KQSA 3NRZA 2N1VA 1SJED 2LUMA 4II3B 2I38A 1FXIA 4A9AA 4BKGA 3TMPB 2ZCBA 3A1QB 1XEEA 5KHQA 4JLCA 4M02A 3WA0A 2BB5A 1UNSA 3U2SC 1WGKA 3ECIA 4IOIE 1WRDB 2C7MB 1XD3B 3WALA 3IAM1 2RSUA 1V6EA 4K81A 3T3OA 2HTME 2C9WB 2Z59B 2R2QA 3PRMB 4HKZE 4CYEA 5IN7A 2JU6X 2LHDA 1E6EB 1TS4A 4BBNC 1LM8B 2LGIA 2WXNA 1FFVA 3DVNV 3DDCB 3C0RB 4AOFA 2GBJA 1DYQA 3TEXA 2G9HD 2NBVB 1V81A 1ZXIA 2KXJA 2ZW0A 1E0ZA 4PS7A 3NJTA 1RYJA 3NVYA 3PRPB 4FLHA 5IP4D 2WS3B 3H7PB 2LFIA 3V6CB 1WZ0A 2KAJA 5DPRA 1WF9A 3NY5A 3U7DA 1JRPA 4GN1A 3TSSA 4AQ7A 3PTFC 2BS2B 4IKGA 4LJOB 3FKYA 4KSKC 4USAA 1XT9B 3PO0A 4RM9A 2C7NB 2V3NA 2D3CA 4BVUC 1YNTE 3A9JB 2INCC 2ZEQA 3DHIC 2HDEA 3IBEA 3SU8X 5AZGA 2KKCA 3KWLA 3MC0B 2RD0A 1DOIA 4TV3A 2M1MA 2OJRA 3ZTCA 3Q8AA 2NS5A 3VAWA 1GB4A 2FUHB 3KH0A 2ASQA 2WLBA 4HCPB 3EGRA 1IPGA 3A4RA 2KMCA 4IWOA 2KD0A 2MJDA 3KUZA 5IKCM 4GU2A 4NQKE 1TZOA 1OFFA 3ZDMC 1B1ZA 4FJVB 2JYEA 2VZKD 2WP9B 3PHWB 3L0WB 3B2FA 1MPEA 1NI2A 4ZRJA 3NZ3A 4KGSA 2PLPA 1X1MA 4AP4C 4RF1A 4GB9A 2KDFB 1LQBA 4IG7B 1TYGB 1WZ3A 2MBQA 3UINB 2D11A 1N6ZA 3HIZA 4E3CA 4GSWA 2BWES 2NBUA 2L8JA 2WXRA 2DYBA 1CQVA 3NVVA 2D5GA 4BOSC 1T0QC 3AEEB 3DHGC 1ROEA 2UYZB 3PGEA 5JZEB 1L6UA 4LDTB 1I7HA 1XLNA 2MSED 2PE6B 4II2B 1V9JA 4JX1C 2Q5WD 1HZ6A 1FRRA 3DWMA 2W3SA 3IG3A 1QT9A 5JXVA 4YTMB 2X8XX 1XF5L 1FD6A 4ZDVA 1QLBB 1V1PB 3CWIA 3IAS1 2LGXA 5DPSA 2MCNB 3RFZB 2MX2A 3ZKJC 2DBYA 1XCTL 1K53A 1STEA 2IYDB 1ZE3D 4DHZB 3PZDA 4OW0A 1WMHA 1NDDA 4WWOA 3ABVB 2DLBA 3FILB 1FNVA 3V60A 3AEGB 3DBHI 3RZFA 4FHJA 3K9PB 3AE9B 1E8YA 2QILA 3OJ4B 4RGTA 2HJ8A 2L83A 1V8CA 4M0WB 3AE3B 3EFCA 5IA7A 4ANVA 4WH4A 4YTPB 3VRAB 3N1YC 4IM2A 1JWSD 1Z2MA 2NCNA 2ACZB 3DBRB 3ZW3A 3B2GA 4XDCA 4P6VF 3MFGA 2BS3B 3ZXRA 4BKSA 4NQLB 1C3TA 2D2QA 1WYGA 2PTLA 1P7EA 1FO4A 3VTWA 2JX5A 2QDFA 3QJZA 1V1OA 3JW0X 1VZ6A 4NZLB 3ONSA 1QOAA 1YN4A 4IM0A 1BMLC 3E56A 2CJNA 3ZNZB 2WHIA 1ZPSA 5G2NA 2VH1A 1JW9D 2DZKA 2V4IB 2KLCA 4JWUC 2YEPF 3GE3C 4N58A 2WDQB 1NENB 2LXAA 3PZ8A 3V62A 1SGHA 4MGYE 5CHFA 3Q69A 3RD2A 1Q5WB 1HA5A 4M01A 2O6VA 1UUPA 3KVFB 1GC6A 4GIVA 2LI5A 3GOEA 3BK2A 2KTFA 4CHKA 1GC7A 4GMVA 1HE8A 3KW5B 2JVCA 1H8CA 4ZHOA 4K1RB 1SE9A 2JXTA 4WWPA 2XNAC 2CR5A 4W9JA 1WJNA 3P2BA 2DYMA 1C78A 2RDBC 4EZLA 4W9DA 1P9DU 1WY8A 2IPKD 1WFYA 2IGDA 3P4QB 1N60A 2G4SA 4HRSA 4N6EB 1WX7A 5BMIA 4HROA 3TEZA 2IO1B 1YOVB 1UH6A 4MJSA 1E5WA 1YJ1A 2H88B 3TIXA 4DHJB 2V9HA 2DAJA 3NS1A 2N9EB 1L6VA 2PVGC 5JH5C 4PT5A 2K22A 1D5MC 4C00A 1IBXB 4WAAA 2JF5A 1VZ7A 2V4LA 3QCAA 4YSYB 3QWZB 4W9FA 1L2NA 2GMIC 1FM0D 5AUKA 3P42A 2KK8A 2MQJA 5E6OA 4B0MA 3MHSD 2Y5PA 3L10B 4GOCA 4HDOA 4A6QA 1J19A 3BK1A 4ANUA 2KN5A 4K3CA 2AQ1B 5CHWA 1J7CA 1Z5SB 3Q6BA 1EU4A 3WAPA 3VR8B 4NY0A 3U8ZA 2BQQA 3JSVB 4US8A 3ALBA 1L0XB 2MA9B 2L00B 1FMAD 1L7YA 2EKEC 4OZCA 1NYRA 5EE1A 5BYRA 1K52A 3VH4B 4LK0M 1CMXB 5J17A 5JHBA 4ZRPA 1YQBA 1JQ4A 1C4AA 3QQ8B 3IHPC 2CHXA 1T0SC 3C19A 3AXCA 2LXCA 5HFYA 4RNAA 1QILA 2MBOA 2E6XA 2LGYA 2KVZA 2BW2A 1R4NB 2BS4B 4NAWB 3CF6E 2LMCA 1EU3A 2W9NA 2IO2B 1AW7A 2KX0A 1XXGA 3AE6B 3NUHB 5AUIA 3QAQA 3B08A 5I4DA 2ZVNA 4BZAA 2GLSA 3Q8EA 3AMZA 4YTNB 1AN8A 1P7FA 2ZNVB 2JPHA 1JWBD 2WXQA 1FFUA 2DX5B 4ZRQA 1V97A 4UDUC 2AL6A 2RPQA 4YSXB 5MPOA 4RCOA 1E10A 2LVQA 5BYSA 2WNMA 4LNFA 2N7DA 2WWZA 1OEYA 2KZRA 2AX5A 2CKHB 3RT3B 1EF1A 3VUYA 2IZVB 5C1ZA 4DBGA 2PEAA 3APFA 4RGOS 4AJWA 1JROA 2BKRB 3VTVA 2INNE 4FN2A 1FPYA 3NZSA 3URYA 3LYYA 3D32A 2L7RA 1YX5B 4IWQA 4K3BA 4GDKA 1GAQB 2MEKA 1G6JA 2GBMA 2CS4A 2KDBA 3A9KB 3KLSX 4W9IA 1L0VB 2FCQA 1K8RB 2KWDA 1N62A 2R2OA 2J42A 1SE3A 3NOBA 1R7SA 5D94A 3DBRI 2K25A 2INPE 2BVCA 2JWUA 1GB1A 4EFOA 1YD8U 4YWGG 1WH3A 1SXTA 3RPFC 5D2MB 3UQAA 1IGDA 2H89B 1T6BX 3BYTB 4LDTD 4W9HA 2DNFA 3Q3JA 3IT4B 1ZUD2 3AB5A 2KQ4X 1E7VA 4CQNA 2WXLA 3R8BA 4MH8A 1E90A 3P4SB 1WXQA 2AWTA 3TEYA 5HI1A 1WR1A 4KIKA 3TEWA 2KFKB 4RF0A 3P4PB 3I3TB 2M56B 3T3NA 3V6EB 1GG3A 3I57A 4KSLC 2CU1A 4I6LB 4JQWC 4REZA 3RNFC 5EE9A 1DGJA 3LDZE 3RNGC 4FBJB 4WIPA 4G50A 4HWIB 3AU4A 3ZJVA 2M17A 3SFEB 2K5PA 3PREA 1KLVA 3VXWA 4E74A 3DOWA 1WJUA 1WR6E 3RCZA 1D5XC 1OQYA 1P1AA 1WGHA 1AWDA 3ZDTA 2FE8A 2K9XA 4O1NA 2MJ3A 4KDIC 1L5PA 2MWSB 2JY6A 3KQ4A 4BKTA 4OHJA 2LZ6A 4ACFA 2DYOA 2XK5A 3MTNB 4S17A 4C7YA 1L4ZB 1F52A 4JGHB 3W2DA 4IWPA 2JQRB 4HEA1 1QKZA 4DQOC 3BVZA 3O13A 1ACCA 2ZCCA 4MM3B 1MJDA 1MI0A 1FXTB 1ZW7A 1BT0A 1ISNA 4B95A 3AU5A 2YVCA 1MG4A 4P16A 4KKJA 3K9OB 1UF0A 2NPTB 4JE3B 4KDLB 3V05A 1LGRA 4HPLB 4L23A 1TBEA 4KV2A 1OEYJ 3L16A 2JUOA 3TJPA 2TSSA 4PK1A 4A3OA 1OTRB 1QOGA 2BGFA 2KMAA 4C4VA 1QOFA 4D2KA 4TSSA 3SR6A 2X38A 1V5OA 2K8BA 4JWSC 2A5UA 3HM6X 2RPVA 2MP2B 3HVZA 1B9RA 2N1WA 1YIWA 3H1UA 3P1MA 2ZVOA 1TKYA 3RI7C 2FCSA 1WRIA 5EDSA 4GDLA 1R4MB 1UWMA 3OAWA 2KLGA 4XC2A 5IO9A 3APDA 5CX3A 2WXFA 2D3GA 2WDRB 2LVOA 2IO3B 3BINA 1PDXA 1R4NI 3GS2A 2LASA 4DHJD 3QIJA 1BXTA 2RGFA 1UBQA 1D6EC 3LXFA 2WX1A 2KYWA 2KOXA 1S1QB 1WJ6A 2L0FA 2NVUI 1XCQL 2M0XA 5C23A 4W9EA 4YT0B 4XZ4A 3NZUA 1GUAB 2LRWA 2BTEA 4K7SA 1WGDA 2WDTB 1ENFA 2O2VB 2WXIA 3P4RB 1F0ZA 3ZUNA 2WXHA 2I1JA 2W54A 3RMKC 3QC8B 5T8IA 3MP9A 3W1SA 1TS3A 4XE0A 5LXHA 3UF8A 4HDQA 2OEDA 1KJTA 4F8CB 3TBLD 3I5JC 2FBWB 4TQ0A 1ET6A 1ZXHA 2BPSA 1UZXB 2LRUA 5G55A 3Q3FA 1JMLA 2LUEA 3APCA 1UELA 4A8XC 3N1XC 3VRBB 5EE0A 4OVVA 1DOXA 2J0JA 4PS3A 1WGRA 3ZRFA 1F2RC 3NVZA 4HCNB 3ZLZA 3GE8C 2V3PA 1RWSA 2KDIA 2VRRB 2FCMA 4KZ0A 2KX3A 2KJ6A 1FIQA 3WIMA 3RN9C 2KFJA 3H7SA 2DENB 2JWZA 2C5LC 1TJEA 4MGKE 1D5ZC 1M4VA 4TKNA 1SIJA 4ARCA 5D3DA 1LO5D 5GXGB 1EUVB 1AYFA 1DOYA 2WXMA 2V0GA 1QF6A 4PS8A 2WXJA 3X23A 1LXDA 1GPXA 3DVGX 1T0RC 4HKQA 2KWUB 2G3QB 3ZNID 3Q3OC 4NAMA 1GOZA 4H2AA 3R2TA 2WXKA 3AE4B 1QZEA 1K51A 1VR9A 2E3TA 4XWWA 3AEBB 2CJOA 3EECA 1C79A 4MH0E 2AL3A 2L76A 1JWAD 1WSPA 3DVNU 1TT5B 1IUEA 3ML8A 4ICUA 1N61A 5GMVA 5BYQA 4EE2A 2HTHA 4RGNA 2JYTA 1WXMA 4N9F4 4RM8A 1EWCA 2KACA 1E9MA 2KJHB 5E6PA 3O65B 1ZDVA 4XYCA 4C80A 4KX6B 1J7BA 4M8NA 1FNWA 3KYCD 2K0PA 5DPTA 3BY4B 3L13A 1N5WA 4B0EA 5TR5A 2JZ3B 3HUIA 1J0GA 4ANXA 2NR2A 4R3DA 2M8SA 4GLSC 1WX9A 2KMMA 4P1BC 2EMSA 3ETRA 2W82A 2IDYA 2KFKA 3A1QA 3W1SC 4W9GA 1YX6B 2AQ3B 3A4SC 1SIFA 5L95C 3PT2B 4ITKA 2BYVE 4A20A 4CO7A 1YQ4B 1JALA 3ML9A 2PMVA 2W55A 4DXAB 1PFDA 1SSNA 4MACA 4DK5A 1R4MI 2AQ2B 3RULA 1YJJA 3VHTC 1IP9A 3SD5A 2WU2B 1XLPA 4WURA 5BO4B 3EHVA 1E8XA 1KFYB 4PYUA 2DWQA 2Z0EB 3KWVA 3VQIA 2L32A 4XWTA 1WYWB 5BMGA 3RZWC 1K50A 1P3QU 2RR9A 3I9V1 4RGMA 3H6NA 2OHFA 2IGGA 3AE2B 2G1EA 3JYUA 2CHWA 4WJPA 4AWJA 1C1YB 3S2AA 1E7PB 3H7PA 4NJ7A 1JWUD 1T5XD 3V61A 1WMHB 3U4EG 2KT7A 2ZNVC 1HTQA 2AYOB 3QARA 1TZ1A 4ARIA 3RUIB 3ZNGC 2KN4A 3HVDA 3DQVA 2RDHA 4KVGB 4K7UA 3NHEB 4AUQC 3A9JA 1WE6A 3R7RA 2ZJDA 1SB3C 2M0AA 5C3JB 3U30A 2L05A 2KTRB 3WAMA 2YEPB 3DBLB 1KLUD 2B76B 4LNIA 3NG0A 2Y5BB 1TY0A 1UGMA 3PSEB 2FIFA 4US9A 2EMTA 4KKIA 1HEZE 1I35A 4W9CA 3M63B 4Q2JA 2LHEA 2KDMA 4NPNA 1T0YA 1WM2A 3RNAC 1TKGA 2IBIB 2QCZA 1KM7A 3PZ7A 2BT6A 2HE7A 2J52A 3PLVA 2N4FA 1WE7A 2MH7A 3L08A 1WXVA 3PRZA 1NYQA 3AH7A 3BVMA 3DWGC 1WJ4A 2WDVB 1UWXA 1TY2A 3ZXVA 4ANWA 2J7QB 3E9SA 4NJ6A 2J0MA 1YJIA 2MJEA 1AARA 4WQMA 2ICIA 2D07B 3AULA 3W5VB 1FCCC 3CSTA 1GNUA 3N32A 1XQQA 1Q1OA 2O6VB 5J18A 4LNNA 3IXSA 3W1YA 2SEBD 3AN1A 1C9FA 2LVPA 2N9PC
chains in the Genus database with same CATH topology
4IDIA 3AECB 2GRIA 3HRDD 2ACZB 1HXYD 1WRIA 1A70A 1UWMA 1ZDXA 3B2GA 4XDCA 4P6VF 3MFGA 1TS5A 2JSVX 4NJCA 2BS3B 2WXFA 4L1BA 1WYGA 4MT5A 1MVKA 2PTLA 2WDRB 3EA6A 1P7EA 1JWMD 1SJHD 1FO4A 2JX5A 2ZW1A 3BYYB 1PDXA 3GS2A 1V1OA 4J3OD 2WXGA 4TQ1A 4A55A 1BXTA 1VZ6A 4NZLB 1V1PA 2N0SB 1YN3A 1D6EC 1D4BA 1QOAA 1PGBA 1CZPA 3C8YA 3LXFA 4LLGM 1TKEA 2EKIA 1YN4A 1L4DB 1BMLC 3E56A 1CJEA 1RM6C 1PUTA 5G5HA 2CJNA 3IT6B 1ZPSA 2N7JA 3FILA 1XCQL 3EUB2 3Q8FA 1JW9D 1RFKA 2V4IB 4JWUC 2YEPF 4YT0B 2R61A 4N58A 5HHDG 2WDQB 3Q8BA 1NENB 1I4GA 1C77A 1OQQA 2PKOA 4RH6A 2BTEA 3PZ8A 5H8YE 2BYTA 1VDVA 4ZHPA 2XN9C 1ENFA 4M0WA 2WXIA 1FNUA 3Q69A 3P4RB 1HA5A 1F0ZA 1UUPA 2WXHA 2L52A 1FEHA 3TUOA 3BK2A 2W54A 1Q10A 2WXOA 2J4XA 2EELA 3AE7B 1Y56A 1N5XA 5T8IA 3MP9A 3W1SA 1TS3A 4XE0A 4ZHOA 1YN5A 1QQRA 2JXTA 1ET9A 2XNAC 1SF0A 2ON8A 3SEBA 2DYMA 2OEDA 1C78A 1C4CA 1NEKB 3W9CB 2PW9A 1YQ3B 2FBWB 2QMTA 4TQ0A 3LB8C 1NVID 2IPKD 3FAHA 2IGDA 3P4QB 1FRDA 1N60A 2Y3AA 4HRSA 4N6EB 5BMIA 1ET6A 4HROA 1ZXHA 1VZ8A 3TEZA 1I4XA 5E6JA 2K3UA 3GB1A 3ZGZA 1JMLA 2H88B 4A8XC 1WWTA 1I4RA 1I4HA 3NS1A 3VRBB 5EE0A 1L6VA 2PVGC 3NVWA 1DOXA 3Q8CA 4PT5A 4JPSA 2K22A 1D5MC 1FXAA 1IBXB 3BZDB 1F2RC 1VZ7A 3NVZA 2WXPA 4YSYB 2W3RA 3AE1B 4AS1A 1FM0D 5D7GA 2BBCA 5AUKA 1HZ5A 2V3PA 1SE4A 1RWSA 2Z8LA 1FCLA 3P42A 1T3QA 2NTTA 4A90A 1F2RI 2PVOD 3AV8A 1TS2A 4N59A 4B0MA 2RDGA 1FIQA 1C76A 2Y5PA 1QOBA 2N9LA 5HG2A 3MJ5A 4A6QA 1TJEA 3BK1A 2GB1A 1D5ZC 1M4VA 2AQ1B 1J7CA 1KF6B 3AEDB 1SIJA 1KTKA 1EU4A 3R2IA 4ARCA 1ESFA 2J53A 5D3DA 1VLBA 3VR8B 1LO5D 5GXGB 4WWMA 1SBBB 4KGTA 1AYFA 1DOYA 2WXMA 2V0GA 1QF6A 1JCKB 1OQRA 2WXJA 4OVZA 4US8A 3MHZA 1J7AA 1GPXA 1L0XB 1PGAA 3N9YC 1FMAD 3AEAB 4OZCA 1CK1A 1NYRA 2QSDA 3BVGA 5EE1A 5TSSA 3CIRB 4HKQA 5BYRA 1K52A 4NAMA 1NI3A 1GOZA 4LK0M 4H2AA 3R2TA 5FK9C 4HJGE 3NRZA 2WXKA 3ZJTA 3AE4B 1SJED 2LUMA 4ZRPA 2I38A 1FXIA 4A9AA 1C4AA 1JQ4A 1K51A 1VR9A 2E3TA 4XWWA 4L2YA 1XEEA 3UI3A 3AEBB 2CJOA 5HFYA 1EM7A 4GDKB 4RNAA 4DXFA 1C79A 2BB5A 5D3IB 1QILA 1IGCA 1UNSA 2E6XA 3U2SC 1JWAD 2M19A 1WSPA 2BW2A 5FR3A 1WGKA 3AEFB 1IBXA 2BS4B 3B9JA 4NAWB 2LMCA 4IOIE 3U7ZA 1IUEA 1EU3A 3IAM1 1AW7A 3T3OA 1N61A 1XXGA 3AE6B 5BYQA 2HTME 4EE2A 3NUHB 5AUIA 4XDDA 2PIAA 2LJIA 4RGNA 4C56C 1L0YB 5I4DA 2JYTA 4HKZE 1EWCA 2KACA 3Q8EA 3AMZA 2JU6X 4YTNB 1E9MA 1AN8A 1P7FA 1E6EB 1C4PA 2LHDA 1JWBD 1ZDVA 1TS4A 1FFUA 2WXQA 2FUG1 4ZRQA 1V97A 2LGIA 2WXNA 4C80A 4KX6B 1J7BA 1FFVA 1FNWA 2K0PA 4TMAB 4UDUC 4YSXB 1DYQA 3VR9B 2WU5B 5MPOA 4RCOA 1E10A 1KRHA 3TEXA 2G9HD 5BYSA 5FKAC 2WNMA 1ZXIA 1N5WA 5LNK1 1XLOA 4B0EA 2ZW0A 1E0ZA 1RYJA 3NVYA 3J9CA 2AX5A 2IGHA 3HUIA 1ZP0B 1KH0A 4R3DA 2WS3B 2LFIA 4RGOS 2KAJA 4GLSC 1XO3A 1JWSD 1F77A 2KMMA 1JROA 3ETRA 2W82A 1EWYC 2INNE 4FXCA 2IDYA 4DXGA 3URYA 3LYYA 2L1AA 3P63A 2AQ3B 1JRPA 1YMHE 3TSSA 4ITKA 1N63A 4AQ7A 3WCQA 1YQ4B 2BS2B 1JALA 1GAQB 4IKGA 2MEKA 2PMVA 4USAA 3KLSX 3PO0A 1L0VB 1BUIC 5EE3A 1XLQA 2KWDA 1N62A 2J42A 2V3NA 1SE3A 1YNTE 2W55A 3GP7A 4RFBA 1R7SA 1PFDA 1SSNA 2HDEA 3FC4A 4MACA 2AQ2B 2INPE 3KWLA 1YJJA 3MC0B 2JWUA 1GB1A 4YWGG 1DOIA 1SXTA 3RPFC 3SFDB 1IGDA 2H89B 1T6BX 2WU2B 3BYTB 1XLPA 3Q8AA 4LTUA 1VJKA 2Y5CA 4WURA 3IT4B 1ZUD2 3AB5A 1GB4A 1KFYB 2KQ4X 2DWQA 1UGJA 4OZBA 4CQNA 2WXLA 3R8BA 2WLBA 3EGRA 3KWVA 3VQIA 2L32A 4MH8A 3P4SB 1WXQA 2MJDA 1SE2A 4OZAA 4XWTA 1TZOA 5BMGA 3TEYA 1OFFA 5HI1A 1K50A 1B1ZA 1SEBD 3I9V1 2JYEA 4RGMA 1VRAB 2OHFA 1MHHE 2VZKD 2IGGA 3AE2B 2G1EA 2WP9B 2LEKA 3TEWA 4RF0A 2NTSA 1E7PB 3P4PB 3T3NA 2M56B 1JWUD 3B2FA 3BWUD 1T5XD 4ZOHC 1MPEA 3ZQ4A 4WAFA 3NZ3A 3I57A 4KGSA 3U4EG 2PLPA 3H8HA 4RF1A 4REZA 5EE9A 4ARIA 1DGJA 3W5UB 1TYGB 2KN4A 3HVDA 4WIPA 1MHXA 2RDHA 2BB6A 2N9KA 5C2TB 3ZJVA 3SFEB 1HQRD 2K5PA 1PGXA 3V3XA 1SB3C 2WXRA 1D5XC 2JZPA 2M0AA 5C3JB 1AWDA 2FE8A 1CQVA 2K9XA 3NVVA 2YEPB 2D5GA 2I2YA 4O1NA 2MJ3A 1KLUD 2B76B 3AEEB 1L5PA 1ROEA 2NMQA 3KQ4A 4OHJA 1TY0A 1L6UA 2DYOA 4US9A 4C7YA 1L4ZB 1I7HA 1XLNA 3AE5B 3W2DA 4GDLB 2SAKA 4KKIA 2JQRB 4HEA1 1HEZE 2ONQA 1QKZA 4JX1C 2Q5WD 4Q2JA 1HZ6A 2LHEA 3ZYYX 1FRRA 2KDMA 1KLGD 3BVZA 4DQOC 3DWMA 4C7ZA 3O13A 3BIID 2RMMA 2W3SA 1ACCA 4MM3B 1QT9A 1TKGA 5JXVA 4YTMB 1MI0A 1XF5L 3L4PA 1FD6A 2IJ0A 3PZ7A 2BT6A 1QLBB 2J52A 1V1PB 3CWIA 3IAS1 2VZKB 3RFZB 5H92C 2MH7A 2DBYA 1XCTL 4P16A 2QEJC 4KKJA 1K53A 5BMHA 1I4PA 1STEA 1NYQA 1ZE3D 3AH7A 4JE3B 2CU3A 3BVMA 3DWGC 2GI9A 4OW0A 3V05A 2WDVB 3AE8B 1UWXA 1TY2A 4L23A 3ABVB 2DLBA 4ZYSA 3FILB 1FNVA 3E9SA 3OWEB 2TSSA 1ZOYB 1I4QA 3AEGB 1YJIA 2MJEA 1QOGA 4WQMA 3U52E 2ICIA 4YSZB 1PYWD 3AE9B 1QOFA 2QILA 3ZJUA 4RGTA 3W5VB 2QJLA 2L83A 1FCCC 4D2KA 3AM9A 4TSSA 4YXDB 1V8CA 3AE3B 2QIEB 3SR6A 2X38A 2WQYB 4JWSC 3IXSA 2RPVA 3HVZA 4KGRA 4WH4A 2SEBD 4YTPB 3AN1A 1B9RA 1C9FA 3VRAB 3P1MA 5G5GA 1TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVW A;  4IDI A;  3AEC B;  1FFV A;  3HRD D;  1DOX A;  2ACZ B;  5EE9 A;  2K22 A;  4YSX B;  1WRI A;  1DGJ A;  3W5U B;  3VR9 B;  2WU5 B;  1A70 A;  1FXA A;  1TYG B;  1UWM A;  5MPO A;  1E10 A;  1KRH A;  3B2G A;  1ZXI A;  1N5W A;  4P6V F;  3NVZ A;  1XLO A;  2BS3 B;  4YSY B;  5C2T B;  2W3R A;  3AE1 B;  5AUI A;  1E0Z A;  1RYJ A;  3NVY A;  1FM0 D;  1WYG A;  2K5P A;  3SFE B;  5AUK A;  2AX5 A;  2WDR B;  1RWS A;  3HUI A;  1FO4 A;  1SB3 C;  2JX5 A;  1ZP0 B;  1T3Q A;  1PDX A;  2PVO D;  3AV8 A;  1AWD A;  2WS3 B;  4N59 A;  5C3J B;  1FIQ A;  2KAJ A;  2K9X A;  1QOB A;  1XO3 A;  3NVV A;  2N0S B;  2KMM A;  1JRO A;  2MJ3 A;  3ETR A;  1EWY C;  1TJE A;  2B76 B;  3AEE B;  4FXC A;  1QOA A;  1L5P A;  1CZP A;  1ROE A;  3LXF A;  1TKE A;  2EKI A;  1J7C A;  1KF6 B;  3AED B;  1CJE A;  1SIJ A;  1L6U A;  1RM6 C;  3P63 A;  1PUT A;  1JRP A;  4US9 A;  5G5H A;  4C7Y A;  2CJN A;  1I7H A;  1VLB A;  1XLN A;  3AE5 B;  1N63 A;  4ITK A;  5GXG B;  3VR8 B;  1JQ4 A;  4WWM A;  1YQ4 B;  3WCQ A;  2BS2 B;  1JAL A;  1GAQ B;  2JQR B;  1AYF A;  1DOY A;  4USA A;  4JX1 C;  2Q5W D;  3EUB 2;  1QF6 A;  3PO0 A;  1JW9 D;  1L0V B;  1FRR A;  1OQR A;  3ZYY X;  1RFK A;  4C7Z A;  3DWM A;  5EE3 A;  1XLQ A;  4US8 A;  1N62 A;  3BII D;  1J7A A;  4JWU C;  1GPX A;  2W3S A;  4YT0 B;  4N58 A;  2W55 A;  1FMA D;  2WDQ B;  1QT9 A;  1R7S A;  1NEN B;  3AEA B;  1TKG A;  4N6E B;  1OQQ A;  2PKO A;  1NYR A;  1PFD A;  3FC4 A;  5EE1 A;  5H8Y E;  3CIR B;  4YTM B;  3KWL A;  3L4P A;  1YJJ A;  1VDV A;  4ZHP A;  1NI3 A;  2BT6 A;  1QLB B;  3P4R B;  1DOI A;  3CWI A;  1F0Z A;  3RPF C;  3NRZ A;  3AE4 B;  2MH7 A;  2DBY A;  5H92 C;  3SFD B;  2H89 B;  2WU2 B;  1XLP A;  5G5G A;  2L52 A;  4LTU A;  1VJK A;  1FXI A;  2Y5C A;  1NYQ A;  3AH7 A;  2W54 A;  1ZUD 2;  2E3T A;  2CU3 A;  3AE7 B;  4A9A A;  3DWG C;  3AB5 A;  1KFY B;  1N5X A;  2WDV B;  2CJO A;  2DWQ A;  3AE8 B;  3AEB B;  2WLB A;  4ZHO A;  3ABV B;  3P4S B;  1JWA D;  2M19 A;  1WXQ A;  2MJD A;  1WGK A;  3AEF B;  1ZOY B;  1SF0 A;  2BS4 B;  3AEG B;  3B9J A;  1YJI A;  1NEK B;  2MJE A;  3W9C B;  1QOG A;  1IUE A;  1OFF A;  4WQM A;  1YQ3 B;  4YSZ B;  3AE9 B;  1QOF A;  2FBW B;  1N61 A;  3LB8 C;  3W5V B;  1NVI D;  3AE6 B;  2HTM E;  2OHF A;  3FAH A;  2QJL A;  2L83 A;  3AE2 B;  1FRD A;  1N60 A;  2G1E A;  2PIA A;  3AM9 A;  3P4Q B;  1V8C A;  4HRS A;  2WP9 B;  2LEK A;  4YXD B;  3AE3 B;  2QIE B;  4HRO A;  3SR6 A;  1E7P B;  3P4P B;  2M56 B;  3AMZ A;  2WQY B;  4YTN B;  4JWS C;  1E9M A;  3B2F A;  1E6E B;  1JWB D;  3HVZ A;  4ZOH C;  2H88 B;  1FFU A;  4YTP B;  3AN1 A;  1B9R A;  1WWT A;  3VRA B;  3NS1 A;  1V97 A;  3P1M A;  5EE0 A;  3VRB B;  4C80 A;  1L6V A;  2PVG C;  4KX6 B;  1J7B A;  1TKY A; 
#chains in the Genus database with same CATH topology
 4IDI A;  3AEC B;  2GRI A;  2C60 A;  3DBH B;  4EZK A;  4A3P A;  1WX8 A;  2JXX A;  4I6N B;  4MEM A;  5AZF A;  4BAX A;  2PJH A;  1TS5 A;  2JSV X;  3CSF A;  2K6Q A;  5J2R A;  3VVW B;  4L1B A;  1F1H A;  2G4D B;  2KO3 A;  1TGZ B;  1SJH D;  3BYY B;  3T8M A;  4LCD E;  4A55 A;  4MJS B;  1V1P A;  2N0S B;  1YN3 A;  1D4B A;  1PGB A;  1CZP A;  3C8Y A;  5KHO A;  1TKE A;  2EKI A;  3SDL C;  1L4D B;  1CJE A;  1LFD A;  2GBR A;  2LD9 A;  5IOI A;  5G5H A;  3IT6 B;  4NNJ B;  3FIL A;  3EUB 2;  4MDK E;  1RFK A;  3PLU A;  4B9K A;  1WGY A;  4G3X B;  5HHD G;  3Q8B A;  1C77 A;  2PKO A;  4RH6 A;  4DDI D;  3UIO B;  2BYT A;  2KWC A;  4M0W A;  1FNU A;  1KOT A;  1HTO A;  3H9D A;  2L52 A;  3TUO A;  5DPW A;  4I6P A;  1Q10 A;  2WXO A;  3AE7 B;  2EEL A;  1WM3 A;  1N5X A;  2LWP A;  4BFR A;  1RLF A;  1YN5 A;  1QQR A;  1ET9 A;  4DHZ E;  2CHZ A;  1SF0 A;  3SEB A;  4ICV A;  1NEK B;  3N20 C;  4JL9 A;  2PW9 A;  1YQ3 B;  4FHK A;  1GJZ A;  3VUX A;  3HHM A;  3UIP B;  3LB8 C;  3FAH A;  2Y3A A;  2DZM A;  3T9L A;  2BF8 B;  2K8C A;  5L83 A;  2QC8 A;  2K3U A;  3ZGZ A;  3RNB C;  1A5R A;  3Q2A C;  2JRI B;  1WWT A;  1I4R A;  4URK A;  2ZPY A;  2KHW B;  4K7W A;  3DHH C;  1UD7 A;  4DDG D;  3BZD B;  2V1Y A;  3QX1 A;  3A33 B;  3AE1 B;  4AS1 A;  4GXB A;  5D7G A;  3WAN A;  2NBW B;  2Z8L A;  1FCL A;  4JIO U;  4ASW C;  2ZZP B;  3WAO A;  4A90 A;  3AV8 A;  1TS2 A;  2RDG A;  5HG2 A;  2GB1 A;  3DVG Y;  5IAA C;  4HLE A;  1KTK A;  2L0T A;  2WYQ A;  2J53 A;  1VLB A;  4KGT A;  1WGG A;  4OVZ A;  2Z0D B;  3JVZ X;  1PGA A;  3VTU A;  1IYF A;  2KAN A;  4GGQ A;  2QSD A;  3BVG A;  5TSS A;  3CIR B;  2KWV B;  1NI3 A;  4HJG E;  3ZIM A;  2BYF A;  3SHQ A;  3ZJT A;  1E7U A;  4X57 B;  2KJR A;  4L2Y A;  5DCN A;  3UI3 A;  1EM7 A;  4GDK B;  2DAF A;  4DXF A;  3UQB A;  5D3I B;  1IGC A;  3NS8 A;  3DBL I;  2M19 A;  3CMM B;  5FR3 A;  2FAZ A;  3AEF B;  1IBX A;  3B9J A;  3U7Z A;  2GBN A;  3PV1 A;  4XDD A;  2PIA A;  2LJI A;  3N3K B;  4C56 C;  1L0Y B;  4WJQ A;  3IVF A;  3ZRC A;  2M4N A;  4MSQ B;  1C4P A;  2FUG 1;  1EF5 A;  4TMA B;  2REX A;  1V5T A;  1OGW A;  3VR9 B;  2WU5 B;  4P7I A;  1KRH A;  4HJK A;  2QHO A;  5FKA C;  2KDE B;  5LNK 1;  2D10 A;  4J6I A;  1XLO A;  2DHZ A;  3OLM D;  3JSV A;  2FNJ B;  3RYT A;  3J9C A;  4ZRI A;  2IGH A;  2WX0 A;  4LNO A;  4KIK B;  2IY0 B;  1ZP0 B;  1KH0 A;  3MC8 A;  4W9L A;  4XX5 A;  3PVL A;  1XO3 A;  3Q14 C;  1F77 A;  1EWY C;  4FXC A;  4W9K A;  4DXG A;  1F9J A;  2L1A A;  2OOB B;  3X0W A;  1P98 A;  3P63 A;  1YMH E;  3TCA A;  5CHV C;  1N63 A;  3WCQ A;  4MGI E;  5CTR C;  4IC7 B;  1PQS A;  2BYE A;  4NAW A;  1BUI C;  5EE3 A;  4HVB A;  1XLQ A;  2PPH A;  1D3Z A;  3GP7 A;  4RFB A;  2MBE A;  1V80 A;  2MLB A;  3FC4 A;  3LJ3 A;  1U4A A;  3SFD B;  2K8H A;  4S0R A;  2BWF A;  1VD2 A;  4LTU A;  1VJK A;  2Y5C A;  3R3M A;  2KTR A;  2XK5 B;  2FCN A;  5LLI A;  2HD5 B;  1UGJ A;  4OZB A;  4EUT A;  4BKS D;  1E8W A;  1SE2 A;  4OZA A;  4FAD A;  4E71 A;  3OJ3 A;  4HPM B;  1SEB D;  1RFA A;  2JZZ A;  3KUC B;  1VRA B;  2MHJ A;  1MHH E;  4G0N B;  2ZPN A;  2LEK A;  2IND C;  2NTS A;  4MSM B;  5D6J B;  3BWU D;  5HKH A;  2K39 A;  4ZOH C;  3M3J A;  3PHX B;  3ZQ4 A;  4WAF A;  4YL8 A;  3DCG A;  3H8H A;  1E8Z A;  3HM3 A;  3EFU A;  4AJY B;  1TIF A;  3W5U B;  3VDZ A;  3GZN B;  2MRP A;  3AI5 A;  1MHX A;  2LGD A;  3A9K A;  2BB6 A;  2N9K A;  5C2T B;  4C4V B;  1JRU A;  3ZVV A;  1HQR D;  1EO6 A;  3IFW B;  3M62 B;  1PGX A;  4B6W A;  2O6V D;  3V3X A;  2LGS A;  2JZP A;  3Q3N C;  2G45 B;  1TTN A;  2I2Y A;  1P0R A;  4WJO A;  2NMQ A;  1M94 A;  1S3S G;  3AE5 B;  4ZYN A;  4GDL B;  2SAK A;  1ZKH A;  2ONQ A;  2DZJ A;  2HJ1 A;  3ZYY X;  1KLG D;  4C7Z A;  3BII D;  5AZH A;  2RMM A;  2V3S A;  3UGB B;  3L4P A;  3MJW A;  2IJ0 A;  5LXI B;  2K1F A;  2MBH A;  2VZK B;  5H92 C;  2QEJ C;  5BMH A;  1I4P A;  1WIA A;  2LJ5 A;  2CU3 A;  1V2Y A;  2GI9 A;  2I1K A;  3AE8 B;  3VH3 B;  2J0K A;  4BOZ B;  4ZYS A;  4XGA B;  3OWE B;  1ZOY B;  1I4Q A;  3DBS A;  3B0A A;  3R7Q A;  3U52 E;  4MGZ E;  4YSZ B;  2MBB B;  1PYW D;  3ZJU A;  2D3B A;  3QA8 A;  4HK2 A;  2QJL A;  3AM9 A;  4YXD B;  2PE9 A;  5AEK B;  3VFK A;  3QK0 A;  2OJW A;  2QIE B;  2WQY B;  4KGR A;  4FJZ A;  2YLM A;  3R66 C;  4KZC A;  1RAX A;  5G5G A;  3VUW A;  3HRD D;  2GOW A;  2K6D B;  1HXY D;  1A70 A;  1ZDX A;  2JRH A;  2VH2 A;  2JT4 B;  4NJC A;  4EKU A;  4MT5 A;  1MVK A;  4TUU A;  4MM3 A;  3Q3M C;  3EA6 A;  1JWM D;  2ZW1 A;  2KC1 A;  1V86 A;  2WXG A;  4IUM B;  4J3O D;  4TQ1 A;  4WJN A;  1H4R A;  2IY1 B;  2N7E A;  4LLG M;  2NPT A;  2KC2 A;  3ZO5 B;  4HXD A;  2D3A A;  1RM6 C;  1PUT A;  4FUL A;  1RRB A;  2N7J A;  3MC9 A;  3Q8F A;  3N1Z C;  3L54 A;  2R61 A;  2UU7 A;  4ZRK A;  1J8C A;  1I4G A;  1OQQ A;  4RMA A;  2AEH A;  2C7H A;  5H8Y E;  4M00 A;  4LJP B;  2A4Z A;  1WXS A;  1VDV A;  4DWF A;  4ZHP A;  2XN9 C;  4P1C C;  3ZNH B;  2WGS A;  5JHA A;  3OG5 A;  3M95 A;  1FEH A;  2MP2 A;  2J4X A;  3N30 A;  3PS6 A;  1Y56 A;  4IW0 A;  3EC8 A;  4EZJ A;  3B1L X;  2UWQ A;  4OVU A;  4WWN A;  2ON8 A;  4G11 A;  3ENE A;  1C4C A;  3W9C B;  3HK0 A;  3QHT A;  1VCB A;  2IO0 B;  2QMT A;  4M8M A;  4F7Z A;  2MW5 A;  1NVI D;  4BBN F;  3I63 C;  3TL5 A;  3DPD A;  1FRD A;  4LNK A;  1ZGU B;  1VZ8 A;  1I4X A;  1WI0 A;  5E6J A;  4PYZ A;  2GBK A;  3GB1 A;  3RNC C;  1WXA A;  1I4H A;  2FID A;  2L3Z A;  1MFW A;  3NVW A;  3Q8C A;  4JPS A;  4EEW A;  1FXA A;  2BKF A;  2WXP A;  2W3R A;  3KUD B;  2BBC A;  4EOY A;  1HZ5 A;  1SE4 A;  1V49 A;  1T3Q A;  1MG8 A;  2NTT A;  1F2R I;  2PVO D;  4N59 A;  2O2V A;  5E6N A;  1C76 A;  4HPP A;  1Y8R C;  1QOB A;  2N9L A;  2XEW A;  4FJY A;  3MJ5 A;  1Q0W B;  4WQO B;  4F1S A;  1I42 A;  3RNE C;  1KF6 B;  2DZI A;  2KQ7 A;  3AED B;  3R2I A;  1ESF A;  4MEL A;  4WWM A;  1SBB B;  3KYD D;  1UBI A;  2KNB A;  1JCK B;  1OQR A;  5FR6 A;  4IM3 A;  4FA6 A;  3MHZ A;  1J7A A;  2XBB C;  3N9Y C;  3PPA A;  4QAY A;  3AEA B;  1NBF C;  2N9X A;  1CK1 A;  3L17 A;  3GZN I;  3ZTD A;  2KVR A;  2B3A A;  5FK9 C;  2KQS A;  3NRZ A;  2N1V A;  1SJE D;  2LUM A;  4II3 B;  2I38 A;  1FXI A;  4A9A A;  4BKG A;  3TMP B;  2ZCB A;  3A1Q B;  1XEE A;  5KHQ A;  4JLC A;  4M02 A;  3WA0 A;  2BB5 A;  1UNS A;  3U2S C;  1WGK A;  3ECI A;  4IOI E;  1WRD B;  2C7M B;  1XD3 B;  3WAL A;  3IAM 1;  2RSU A;  1V6E A;  4K81 A;  3T3O A;  2HTM E;  2C9W B;  2Z59 B;  2R2Q A;  3PRM B;  4HKZ E;  4CYE A;  5IN7 A;  2JU6 X;  2LHD A;  1E6E B;  1TS4 A;  4BBN C;  1LM8 B;  2LGI A;  2WXN A;  1FFV A;  3DVN V;  3DDC B;  3C0R B;  4AOF A;  2GBJ A;  1DYQ A;  3TEX A;  2G9H D;  2NBV B;  1V81 A;  1ZXI A;  2KXJ A;  2ZW0 A;  1E0Z A;  4PS7 A;  3NJT A;  1RYJ A;  3NVY A;  3PRP B;  4FLH A;  5IP4 D;  2WS3 B;  3H7P B;  2LFI A;  3V6C B;  1WZ0 A;  2KAJ A;  5DPR A;  1WF9 A;  3NY5 A;  3U7D A;  1JRP A;  4GN1 A;  3TSS A;  4AQ7 A;  3PTF C;  2BS2 B;  4IKG A;  4LJO B;  3FKY A;  4KSK C;  4USA A;  1XT9 B;  3PO0 A;  4RM9 A;  2C7N B;  2V3N A;  2D3C A;  4BVU C;  1YNT E;  3A9J B;  2INC C;  2ZEQ A;  3DHI C;  2HDE A;  3IBE A;  3SU8 X;  5AZG A;  2KKC A;  3KWL A;  3MC0 B;  2RD0 A;  1DOI A;  4TV3 A;  2M1M A;  2OJR A;  3ZTC A;  3Q8A A;  2NS5 A;  3VAW A;  1GB4 A;  2FUH B;  3KH0 A;  2ASQ A;  2WLB A;  4HCP B;  3EGR A;  1IPG A;  3A4R A;  2KMC A;  4IWO A;  2KD0 A;  2MJD A;  3KUZ A;  5IKC M;  4GU2 A;  4NQK E;  1TZO A;  1OFF A;  3ZDM C;  1B1Z A;  4FJV B;  2JYE A;  2VZK D;  2WP9 B;  3PHW B;  3L0W B;  3B2F A;  1MPE A;  1NI2 A;  4ZRJ A;  3NZ3 A;  4KGS A;  2PLP A;  1X1M A;  4AP4 C;  4RF1 A;  4GB9 A;  2KDF B;  1LQB A;  4IG7 B;  1TYG B;  1WZ3 A;  2MBQ A;  3UIN B;  2D11 A;  1N6Z A;  3HIZ A;  4E3C A;  4GSW A;  2BWE S;  2NBU A;  2L8J A;  2WXR A;  2DYB A;  1CQV A;  3NVV A;  2D5G A;  4BOS C;  1T0Q C;  3AEE B;  3DHG C;  1ROE A;  2UYZ B;  3PGE A;  5JZE B;  1L6U A;  4LDT B;  1I7H A;  1XLN A;  2MSE D;  2PE6 B;  4II2 B;  1V9J A;  4JX1 C;  2Q5W D;  1HZ6 A;  1FRR A;  3DWM A;  2W3S A;  3IG3 A;  1QT9 A;  5JXV A;  4YTM B;  2X8X X;  1XF5 L;  1FD6 A;  4ZDV A;  1QLB B;  1V1P B;  3CWI A;  3IAS 1;  2LGX A;  5DPS A;  2MCN B;  3RFZ B;  2MX2 A;  3ZKJ C;  2DBY A;  1XCT L;  1K53 A;  1STE A;  2IYD B;  1ZE3 D;  4DHZ B;  3PZD A;  4OW0 A;  1WMH A;  1NDD A;  4WWO A;  3ABV B;  2DLB A;  3FIL B;  1FNV A;  3V60 A;  3AEG B;  3DBH I;  3RZF A;  4FHJ A;  3K9P B;  3AE9 B;  1E8Y A;  2QIL A;  3OJ4 B;  4RGT A;  2HJ8 A;  2L83 A;  1V8C A;  4M0W B;  3AE3 B;  3EFC A;  5IA7 A;  4ANV A;  4WH4 A;  4YTP B;  3VRA B;  3N1Y C;  4IM2 A;  1JWS D;  1Z2M A;  2NCN A;  2ACZ B;  3DBR B;  3ZW3 A;  3B2G A;  4XDC A;  4P6V F;  3MFG A;  2BS3 B;  3ZXR A;  4BKS A;  4NQL B;  1C3T A;  2D2Q A;  1WYG A;  2PTL A;  1P7E A;  1FO4 A;  3VTW A;  2JX5 A;  2QDF A;  3QJZ A;  1V1O A;  3JW0 X;  1VZ6 A;  4NZL B;  3ONS A;  1QOA A;  1YN4 A;  4IM0 A;  1BML C;  3E56 A;  2CJN A;  3ZNZ B;  2WHI A;  1ZPS A;  5G2N A;  2VH1 A;  1JW9 D;  2DZK A;  2V4I B;  2KLC A;  4JWU C;  2YEP F;  3GE3 C;  4N58 A;  2WDQ B;  1NEN B;  2LXA A;  3PZ8 A;  3V62 A;  1SGH A;  4MGY E;  5CHF A;  3Q69 A;  3RD2 A;  1Q5W B;  1HA5 A;  4M01 A;  2O6V A;  1UUP A;  3KVF B;  1GC6 A;  4GIV A;  2LI5 A;  3GOE A;  3BK2 A;  2KTF A;  4CHK A;  1GC7 A;  4GMV A;  1HE8 A;  3KW5 B;  2JVC A;  1H8C A;  4ZHO A;  4K1R B;  1SE9 A;  2JXT A;  4WWP A;  2XNA C;  2CR5 A;  4W9J A;  1WJN A;  3P2B A;  2DYM A;  1C78 A;  2RDB C;  4EZL A;  4W9D A;  1P9D U;  1WY8 A;  2IPK D;  1WFY A;  2IGD A;  3P4Q B;  1N60 A;  2G4S A;  4HRS A;  4N6E B;  1WX7 A;  5BMI A;  4HRO A;  3TEZ A;  2IO1 B;  1YOV B;  1UH6 A;  4MJS A;  1E5W A;  1YJ1 A;  2H88 B;  3TIX A;  4DHJ B;  2V9H A;  2DAJ A;  3NS1 A;  2N9E B;  1L6V A;  2PVG C;  5JH5 C;  4PT5 A;  2K22 A;  1D5M C;  4C00 A;  1IBX B;  4WAA A;  2JF5 A;  1VZ7 A;  2V4L A;  3QCA A;  4YSY B;  3QWZ B;  4W9F A;  1L2N A;  2GMI C;  1FM0 D;  5AUK A;  3P42 A;  2KK8 A;  2MQJ A;  5E6O A;  4B0M A;  3MHS D;  2Y5P A;  3L10 B;  4GOC A;  4HDO A;  4A6Q A;  1J19 A;  3BK1 A;  4ANU A;  2KN5 A;  4K3C A;  2AQ1 B;  5CHW A;  1J7C A;  1Z5S B;  3Q6B A;  1EU4 A;  3WAP A;  3VR8 B;  4NY0 A;  3U8Z A;  2BQQ A;  3JSV B;  4US8 A;  3ALB A;  1L0X B;  2MA9 B;  2L00 B;  1FMA D;  1L7Y A;  2EKE C;  4OZC A;  1NYR A;  5EE1 A;  5BYR A;  1K52 A;  3VH4 B;  4LK0 M;  1CMX B;  5J17 A;  5JHB A;  4ZRP A;  1YQB A;  1JQ4 A;  1C4A A;  3QQ8 B;  3IHP C;  2CHX A;  1T0S C;  3C19 A;  3AXC A;  2LXC A;  5HFY A;  4RNA A;  1QIL A;  2MBO A;  2E6X A;  2LGY A;  2KVZ A;  2BW2 A;  1R4N B;  2BS4 B;  4NAW B;  3CF6 E;  2LMC A;  1EU3 A;  2W9N A;  2IO2 B;  1AW7 A;  2KX0 A;  1XXG A;  3AE6 B;  3NUH B;  5AUI A;  3QAQ A;  3B08 A;  5I4D A;  2ZVN A;  4BZA A;  2GLS A;  3Q8E A;  3AMZ A;  4YTN B;  1AN8 A;  1P7F A;  2ZNV B;  2JPH A;  1JWB D;  2WXQ A;  1FFU A;  2DX5 B;  4ZRQ A;  1V97 A;  4UDU C;  2AL6 A;  2RPQ A;  4YSX B;  5MPO A;  4RCO A;  1E10 A;  2LVQ A;  5BYS A;  2WNM A;  4LNF A;  2N7D A;  2WWZ A;  1OEY A;  2KZR A;  2AX5 A;  2CKH B;  3RT3 B;  1EF1 A;  3VUY A;  2IZV B;  5C1Z A;  4DBG A;  2PEA A;  3APF A;  4RGO S;  4AJW A;  1JRO A;  2BKR B;  3VTV A;  2INN E;  4FN2 A;  1FPY A;  3NZS A;  3URY A;  3LYY A;  3D32 A;  2L7R A;  1YX5 B;  4IWQ A;  4K3B A;  4GDK A;  1GAQ B;  2MEK A;  1G6J A;  2GBM A;  2CS4 A;  2KDB A;  3A9K B;  3KLS X;  4W9I A;  1L0V B;  2FCQ A;  1K8R B;  2KWD A;  1N62 A;  2R2O A;  2J42 A;  1SE3 A;  3NOB A;  1R7S A;  5D94 A;  3DBR I;  2K25 A;  2INP E;  2BVC A;  2JWU A;  1GB1 A;  4EFO A;  1YD8 U;  4YWG G;  1WH3 A;  1SXT A;  3RPF C;  5D2M B;  3UQA A;  1IGD A;  2H89 B;  1T6B X;  3BYT B;  4LDT D;  4W9H A;  2DNF A;  3Q3J A;  3IT4 B;  1ZUD 2;  3AB5 A;  2KQ4 X;  1E7V A;  4CQN A;  2WXL A;  3R8B A;  4MH8 A;  1E90 A;  3P4S B;  1WXQ A;  2AWT A;  3TEY A;  5HI1 A;  1WR1 A;  4KIK A;  3TEW A;  2KFK B;  4RF0 A;  3P4P B;  3I3T B;  2M56 B;  3T3N A;  3V6E B;  1GG3 A;  3I57 A;  4KSL C;  2CU1 A;  4I6L B;  4JQW C;  4REZ A;  3RNF C;  5EE9 A;  1DGJ A;  3LDZ E;  3RNG C;  4FBJ B;  4WIP A;  4G50 A;  4HWI B;  3AU4 A;  3ZJV A;  2M17 A;  3SFE B;  2K5P A;  3PRE A;  1KLV A;  3VXW A;  4E74 A;  3DOW A;  1WJU A;  1WR6 E;  3RCZ A;  1D5X C;  1OQY A;  1P1A A;  1WGH A;  1AWD A;  3ZDT A;  2FE8 A;  2K9X A;  4O1N A;  2MJ3 A;  4KDI C;  1L5P A;  2MWS B;  2JY6 A;  3KQ4 A;  4BKT A;  4OHJ A;  2LZ6 A;  4ACF A;  2DYO A;  2XK5 A;  3MTN B;  4S17 A;  4C7Y A;  1L4Z B;  1F52 A;  4JGH B;  3W2D A;  4IWP A;  2JQR B;  4HEA 1;  1QKZ A;  4DQO C;  3BVZ A;  3O13 A;  1ACC A;  2ZCC A;  4MM3 B;  1MJD A;  1MI0 A;  1FXT B;  1ZW7 A;  1BT0 A;  1ISN A;  4B95 A;  3AU5 A;  2YVC A;  1MG4 A;  4P16 A;  4KKJ A;  3K9O B;  1UF0 A;  2NPT B;  4JE3 B;  4KDL B;  3V05 A;  1LGR A;  4HPL B;  4L23 A;  1TBE A;  4KV2 A;  1OEY J;  3L16 A;  2JUO A;  3TJP A;  2TSS A;  4PK1 A;  4A3O A;  1OTR B;  1QOG A;  2BGF A;  2KMA A;  4C4V A;  1QOF A;  4D2K A;  4TSS A;  3SR6 A;  2X38 A;  1V5O A;  2K8B A;  4JWS C;  2A5U A;  3HM6 X;  2RPV A;  2MP2 B;  3HVZ A;  1B9R A;  2N1W A;  1YIW A;  3H1U A;  3P1M A;  2ZVO A;  1TKY A;  3RI7 C;  2FCS A;  1WRI A;  5EDS A;  4GDL A;  1R4M B;  1UWM A;  3OAW A;  2KLG A;  4XC2 A;  5IO9 A;  3APD A;  5CX3 A;  2WXF A;  2D3G A;  2WDR B;  2LVO A;  2IO3 B;  3BIN A;  1PDX A;  1R4N I;  3GS2 A;  2LAS A;  4DHJ D;  3QIJ A;  1BXT A;  2RGF A;  1UBQ A;  1D6E C;  3LXF A;  2WX1 A;  2KYW A;  2KOX A;  1S1Q B;  1WJ6 A;  2L0F A;  2NVU I;  1XCQ L;  2M0X A;  5C23 A;  4W9E A;  4YT0 B;  4XZ4 A;  3NZU A;  1GUA B;  2LRW A;  2BTE A;  4K7S A;  1WGD A;  2WDT B;  1ENF A;  2O2V B;  2WXI A;  3P4R B;  1F0Z A;  3ZUN A;  2WXH A;  2I1J A;  2W54 A;  3RMK C;  3QC8 B;  5T8I A;  3MP9 A;  3W1S A;  1TS3 A;  4XE0 A;  5LXH A;  3UF8 A;  4HDQ A;  2OED A;  1KJT A;  4F8C B;  3TBL D;  3I5J C;  2FBW B;  4TQ0 A;  1ET6 A;  1ZXH A;  2BPS A;  1UZX B;  2LRU A;  5G55 A;  3Q3F A;  1JML A;  2LUE A;  3APC A;  1UEL A;  4A8X C;  3N1X C;  3VRB B;  5EE0 A;  4OVV A;  1DOX A;  2J0J A;  4PS3 A;  1WGR A;  3ZRF A;  1F2R C;  3NVZ A;  4HCN B;  3ZLZ A;  3GE8 C;  2V3P A;  1RWS A;  2KDI A;  2VRR B;  2FCM A;  4KZ0 A;  2KX3 A;  2KJ6 A;  1FIQ A;  3WIM A;  3RN9 C;  2KFJ A;  3H7S A;  2DEN B;  2JWZ A;  2C5L C;  1TJE A;  4MGK E;  1D5Z C;  1M4V A;  4TKN A;  1SIJ A;  4ARC A;  5D3D A;  1LO5 D;  5GXG B;  1EUV B;  1AYF A;  1DOY A;  2WXM A;  2V0G A;  1QF6 A;  4PS8 A;  2WXJ A;  3X23 A;  1LXD A;  1GPX A;  3DVG X;  1T0R C;  4HKQ A;  2KWU B;  2G3Q B;  3ZNI D;  3Q3O C;  4NAM A;  1GOZ A;  4H2A A;  3R2T A;  2WXK A;  3AE4 B;  1QZE A;  1K51 A;  1VR9 A;  2E3T A;  4XWW A;  3AEB B;  2CJO A;  3EEC A;  1C79 A;  4MH0 E;  2AL3 A;  2L76 A;  1JWA D;  1WSP A;  3DVN U;  1TT5 B;  1IUE A;  3ML8 A;  4ICU A;  1N61 A;  5GMV A;  5BYQ A;  4EE2 A;  2HTH A;  4RGN A;  2JYT A;  1WXM A;  4N9F 4;  4RM8 A;  1EWC A;  2KAC A;  1E9M A;  2KJH B;  5E6P A;  3O65 B;  1ZDV A;  4XYC A;  4C80 A;  4KX6 B;  1J7B A;  4M8N A;  1FNW A;  3KYC D;  2K0P A;  5DPT A;  3BY4 B;  3L13 A;  1N5W A;  4B0E A;  5TR5 A;  2JZ3 B;  3HUI A;  1J0G A;  4ANX A;  2NR2 A;  4R3D A;  2M8S A;  4GLS C;  1WX9 A;  2KMM A;  4P1B C;  2EMS A;  3ETR A;  2W82 A;  2IDY A;  2KFK A;  3A1Q A;  3W1S C;  4W9G A;  1YX6 B;  2AQ3 B;  3A4S C;  1SIF A;  5L95 C;  3PT2 B;  4ITK A;  2BYV E;  4A20 A;  4CO7 A;  1YQ4 B;  1JAL A;  3ML9 A;  2PMV A;  2W55 A;  4DXA B;  1PFD A;  1SSN A;  4MAC A;  4DK5 A;  1R4M I;  2AQ2 B;  3RUL A;  1YJJ A;  3VHT C;  1IP9 A;  3SD5 A;  2WU2 B;  1XLP A;  4WUR A;  5BO4 B;  3EHV A;  1E8X A;  1KFY B;  4PYU A;  2DWQ A;  2Z0E B;  3KWV A;  3VQI A;  2L32 A;  4XWT A;  1WYW B;  5BMG A;  3RZW C;  1K50 A;  1P3Q U;  2RR9 A;  3I9V 1;  4RGM A;  3H6N A;  2OHF A;  2IGG A;  3AE2 B;  2G1E A;  3JYU A;  2CHW A;  4WJP A;  4AWJ A;  1C1Y B;  3S2A A;  1E7P B;  3H7P A;  4NJ7 A;  1JWU D;  1T5X D;  3V61 A;  1WMH B;  3U4E G;  2KT7 A;  2ZNV C;  1HTQ A;  2AYO B;  3QAR A;  1TZ1 A;  4ARI A;  3RUI B;  3ZNG C;  2KN4 A;  3HVD A;  3DQV A;  2RDH A;  4KVG B;  4K7U A;  3NHE B;  4AUQ C;  3A9J A;  1WE6 A;  3R7R A;  2ZJD A;  1SB3 C;  2M0A A;  5C3J B;  3U30 A;  2L05 A;  2KTR B;  3WAM A;  2YEP B;  3DBL B;  1KLU D;  2B76 B;  4LNI A;  3NG0 A;  2Y5B B;  1TY0 A;  1UGM A;  3PSE B;  2FIF A;  4US9 A;  2EMT A;  4KKI A;  1HEZ E;  1I35 A;  4W9C A;  3M63 B;  4Q2J A;  2LHE A;  2KDM A;  4NPN A;  1T0Y A;  1WM2 A;  3RNA C;  1TKG A;  2IBI B;  2QCZ A;  1KM7 A;  3PZ7 A;  2BT6 A;  2HE7 A;  2J52 A;  3PLV A;  2N4F A;  1WE7 A;  2MH7 A;  3L08 A;  1WXV A;  3PRZ A;  1NYQ A;  3AH7 A;  3BVM A;  3DWG C;  1WJ4 A;  2WDV B;  1UWX A;  1TY2 A;  3ZXV A;  4ANW A;  2J7Q B;  3E9S A;  4NJ6 A;  2J0M A;  1YJI A;  2MJE A;  1AAR A;  4WQM A;  2ICI A;  2D07 B;  3AUL A;  3W5V B;  1FCC C;  3CST A;  1GNU A;  3N32 A;  1XQQ A;  1Q1O A;  2O6V B;  5J18 A;  4LNN A;  3IXS A;  3W1Y A;  2SEB D;  3AN1 A;  1C9F A;  2LVP A;  2N9P C; 
#chains in the Genus database with same CATH homology
 4IDI A;  3AEC B;  2GRI A;  3HRD D;  2ACZ B;  1HXY D;  1WRI A;  1A70 A;  1UWM A;  1ZDX A;  3B2G A;  4XDC A;  4P6V F;  3MFG A;  1TS5 A;  2JSV X;  4NJC A;  2BS3 B;  2WXF A;  4L1B A;  1WYG A;  4MT5 A;  1MVK A;  2PTL A;  2WDR B;  3EA6 A;  1P7E A;  1JWM D;  1SJH D;  1FO4 A;  2JX5 A;  2ZW1 A;  3BYY B;  1PDX A;  3GS2 A;  1V1O A;  4J3O D;  2WXG A;  4TQ1 A;  4A55 A;  1BXT A;  1VZ6 A;  4NZL B;  1V1P A;  2N0S B;  1YN3 A;  1D6E C;  1D4B A;  1QOA A;  1PGB A;  1CZP A;  3C8Y A;  3LXF A;  4LLG M;  1TKE A;  2EKI A;  1YN4 A;  1L4D B;  1BML C;  3E56 A;  1CJE A;  1RM6 C;  1PUT A;  5G5H A;  2CJN A;  3IT6 B;  1ZPS A;  2N7J A;  3FIL A;  1XCQ L;  3EUB 2;  3Q8F A;  1JW9 D;  1RFK A;  2V4I B;  4JWU C;  2YEP F;  4YT0 B;  2R61 A;  4N58 A;  5HHD G;  2WDQ B;  3Q8B A;  1NEN B;  1I4G A;  1C77 A;  1OQQ A;  2PKO A;  4RH6 A;  2BTE A;  3PZ8 A;  5H8Y E;  2BYT A;  1VDV A;  4ZHP A;  2XN9 C;  1ENF A;  4M0W A;  2WXI A;  1FNU A;  3Q69 A;  3P4R B;  1HA5 A;  1F0Z A;  1UUP A;  2WXH A;  2L52 A;  1FEH A;  3TUO A;  3BK2 A;  2W54 A;  1Q10 A;  2WXO A;  2J4X A;  2EEL A;  3AE7 B;  1Y56 A;  1N5X A;  5T8I A;  3MP9 A;  3W1S A;  1TS3 A;  4XE0 A;  4ZHO A;  1YN5 A;  1QQR A;  2JXT A;  1ET9 A;  2XNA C;  1SF0 A;  2ON8 A;  3SEB A;  2DYM A;  2OED A;  1C78 A;  1C4C A;  1NEK B;  3W9C B;  2PW9 A;  1YQ3 B;  2FBW B;  2QMT A;  4TQ0 A;  3LB8 C;  1NVI D;  2IPK D;  3FAH A;  2IGD A;  3P4Q B;  1FRD A;  1N60 A;  2Y3A A;  4HRS A;  4N6E B;  5BMI A;  1ET6 A;  4HRO A;  1ZXH A;  1VZ8 A;  3TEZ A;  1I4X A;  5E6J A;  2K3U A;  3GB1 A;  3ZGZ A;  1JML A;  2H88 B;  4A8X C;  1WWT A;  1I4R A;  1I4H A;  3NS1 A;  3VRB B;  5EE0 A;  1L6V A;  2PVG C;  3NVW A;  1DOX A;  3Q8C A;  4PT5 A;  4JPS A;  2K22 A;  1D5M C;  1FXA A;  1IBX B;  3BZD B;  1F2R C;  1VZ7 A;  3NVZ A;  2WXP A;  4YSY B;  2W3R A;  3AE1 B;  4AS1 A;  1FM0 D;  5D7G A;  2BBC A;  5AUK A;  1HZ5 A;  2V3P A;  1SE4 A;  1RWS A;  2Z8L A;  1FCL A;  3P42 A;  1T3Q A;  2NTT A;  4A90 A;  1F2R I;  2PVO D;  3AV8 A;  1TS2 A;  4N59 A;  4B0M A;  2RDG A;  1FIQ A;  1C76 A;  2Y5P A;  1QOB A;  2N9L A;  5HG2 A;  3MJ5 A;  4A6Q A;  1TJE A;  3BK1 A;  2GB1 A;  1D5Z C;  1M4V A;  2AQ1 B;  1J7C A;  1KF6 B;  3AED B;  1SIJ A;  1KTK A;  1EU4 A;  3R2I A;  4ARC A;  1ESF A;  2J53 A;  5D3D A;  1VLB A;  3VR8 B;  1LO5 D;  5GXG B;  4WWM A;  1SBB B;  4KGT A;  1AYF A;  1DOY A;  2WXM A;  2V0G A;  1QF6 A;  1JCK B;  1OQR A;  2WXJ A;  4OVZ A;  4US8 A;  3MHZ A;  1J7A A;  1GPX A;  1L0X B;  1PGA A;  3N9Y C;  1FMA D;  3AEA B;  4OZC A;  1CK1 A;  1NYR A;  2QSD A;  3BVG A;  5EE1 A;  5TSS A;  3CIR B;  4HKQ A;  5BYR A;  1K52 A;  4NAM A;  1NI3 A;  1GOZ A;  4LK0 M;  4H2A A;  3R2T A;  5FK9 C;  4HJG E;  3NRZ A;  2WXK A;  3ZJT A;  3AE4 B;  1SJE D;  2LUM A;  4ZRP A;  2I38 A;  1FXI A;  4A9A A;  1C4A A;  1JQ4 A;  1K51 A;  1VR9 A;  2E3T A;  4XWW A;  4L2Y A;  1XEE A;  3UI3 A;  3AEB B;  2CJO A;  5HFY A;  1EM7 A;  4GDK B;  4RNA A;  4DXF A;  1C79 A;  2BB5 A;  5D3I B;  1QIL A;  1IGC A;  1UNS A;  2E6X A;  3U2S C;  1JWA D;  2M19 A;  1WSP A;  2BW2 A;  5FR3 A;  1WGK A;  3AEF B;  1IBX A;  2BS4 B;  3B9J A;  4NAW B;  2LMC A;  4IOI E;  3U7Z A;  1IUE A;  1EU3 A;  3IAM 1;  1AW7 A;  3T3O A;  1N61 A;  1XXG A;  3AE6 B;  5BYQ A;  2HTM E;  4EE2 A;  3NUH B;  5AUI A;  4XDD A;  2PIA A;  2LJI A;  4RGN A;  4C56 C;  1L0Y B;  5I4D A;  2JYT A;  4HKZ E;  1EWC A;  2KAC A;  3Q8E A;  3AMZ A;  2JU6 X;  4YTN B;  1E9M A;  1AN8 A;  1P7F A;  1E6E B;  1C4P A;  2LHD A;  1JWB D;  1ZDV A;  1TS4 A;  1FFU A;  2WXQ A;  2FUG 1;  4ZRQ A;  1V97 A;  2LGI A;  2WXN A;  4C80 A;  4KX6 B;  1J7B A;  1FFV A;  1FNW A;  2K0P A;  4TMA B;  4UDU C;  4YSX B;  1DYQ A;  3VR9 B;  2WU5 B;  5MPO A;  4RCO A;  1E10 A;  1KRH A;  3TEX A;  2G9H D;  5BYS A;  5FKA C;  2WNM A;  1ZXI A;  1N5W A;  5LNK 1;  1XLO A;  4B0E A;  2ZW0 A;  1E0Z A;  1RYJ A;  3NVY A;  3J9C A;  2AX5 A;  2IGH A;  3HUI A;  1ZP0 B;  1KH0 A;  4R3D A;  2WS3 B;  2LFI A;  4RGO S;  2KAJ A;  4GLS C;  1XO3 A;  1JWS D;  1F77 A;  2KMM A;  1JRO A;  3ETR A;  2W82 A;  1EWY C;  2INN E;  4FXC A;  2IDY A;  4DXG A;  3URY A;  3LYY A;  2L1A A;  3P63 A;  2AQ3 B;  1JRP A;  1YMH E;  3TSS A;  4ITK A;  1N63 A;  4AQ7 A;  3WCQ A;  1YQ4 B;  2BS2 B;  1JAL A;  1GAQ B;  4IKG A;  2MEK A;  2PMV A;  4USA A;  3KLS X;  3PO0 A;  1L0V B;  1BUI C;  5EE3 A;  1XLQ A;  2KWD A;  1N62 A;  2J42 A;  2V3N A;  1SE3 A;  1YNT E;  2W55 A;  3GP7 A;  4RFB A;  1R7S A;  1PFD A;  1SSN A;  2HDE A;  3FC4 A;  4MAC A;  2AQ2 B;  2INP E;  3KWL A;  1YJJ A;  3MC0 B;  2JWU A;  1GB1 A;  4YWG G;  1DOI A;  1SXT A;  3RPF C;  3SFD B;  1IGD A;  2H89 B;  1T6B X;  2WU2 B;  3BYT B;  1XLP A;  3Q8A A;  4LTU A;  1VJK A;  2Y5C A;  4WUR A;  3IT4 B;  1ZUD 2;  3AB5 A;  1GB4 A;  1KFY B;  2KQ4 X;  2DWQ A;  1UGJ A;  4OZB A;  4CQN A;  2WXL A;  3R8B A;  2WLB A;  3EGR A;  3KWV A;  3VQI A;  2L32 A;  4MH8 A;  3P4S B;  1WXQ A;  2MJD A;  1SE2 A;  4OZA A;  4XWT A;  1TZO A;  5BMG A;  3TEY A;  1OFF A;  5HI1 A;  1K50 A;  1B1Z A;  1SEB D;  3I9V 1;  2JYE A;  4RGM A;  1VRA B;  2OHF A;  1MHH E;  2VZK D;  2IGG A;  3AE2 B;  2G1E A;  2WP9 B;  2LEK A;  3TEW A;  4RF0 A;  2NTS A;  1E7P B;  3P4P B;  3T3N A;  2M56 B;  1JWU D;  3B2F A;  3BWU D;  1T5X D;  4ZOH C;  1MPE A;  3ZQ4 A;  4WAF A;  3NZ3 A;  3I57 A;  4KGS A;  3U4E G;  2PLP A;  3H8H A;  4RF1 A;  4REZ A;  5EE9 A;  4ARI A;  1DGJ A;  3W5U B;  1TYG B;  2KN4 A;  3HVD A;  4WIP A;  1MHX A;  2RDH A;  2BB6 A;  2N9K A;  5C2T B;  3ZJV A;  3SFE B;  1HQR D;  2K5P A;  1PGX A;  3V3X A;  1SB3 C;  2WXR A;  1D5X C;  2JZP A;  2M0A A;  5C3J B;  1AWD A;  2FE8 A;  1CQV A;  2K9X A;  3NVV A;  2YEP B;  2D5G A;  2I2Y A;  4O1N A;  2MJ3 A;  1KLU D;  2B76 B;  3AEE B;  1L5P A;  1ROE A;  2NMQ A;  3KQ4 A;  4OHJ A;  1TY0 A;  1L6U A;  2DYO A;  4US9 A;  4C7Y A;  1L4Z B;  1I7H A;  1XLN A;  3AE5 B;  3W2D A;  4GDL B;  2SAK A;  4KKI A;  2JQR B;  4HEA 1;  1HEZ E;  2ONQ A;  1QKZ A;  4JX1 C;  2Q5W D;  4Q2J A;  1HZ6 A;  2LHE A;  3ZYY X;  1FRR A;  2KDM A;  1KLG D;  3BVZ A;  4DQO C;  3DWM A;  4C7Z A;  3O13 A;  3BII D;  2RMM A;  2W3S A;  1ACC A;  4MM3 B;  1QT9 A;  1TKG A;  5JXV A;  4YTM B;  1MI0 A;  1XF5 L;  3L4P A;  1FD6 A;  2IJ0 A;  3PZ7 A;  2BT6 A;  1QLB B;  2J52 A;  1V1P B;  3CWI A;  3IAS 1;  2VZK B;  3RFZ B;  5H92 C;  2MH7 A;  2DBY A;  1XCT L;  4P16 A;  2QEJ C;  4KKJ A;  1K53 A;  5BMH A;  1I4P A;  1STE A;  1NYQ A;  1ZE3 D;  3AH7 A;  4JE3 B;  2CU3 A;  3BVM A;  3DWG C;  2GI9 A;  4OW0 A;  3V05 A;  2WDV B;  3AE8 B;  1UWX A;  1TY2 A;  4L23 A;  3ABV B;  2DLB A;  4ZYS A;  3FIL B;  1FNV A;  3E9S A;  3OWE B;  2TSS A;  1ZOY B;  1I4Q A;  3AEG B;  1YJI A;  2MJE A;  1QOG A;  4WQM A;  3U52 E;  2ICI A;  4YSZ B;  1PYW D;  3AE9 B;  1QOF A;  2QIL A;  3ZJU A;  4RGT A;  3W5V B;  2QJL A;  2L83 A;  1FCC C;  4D2K A;  3AM9 A;  4TSS A;  4YXD B;  1V8C A;  3AE3 B;  2QIE B;  3SR6 A;  2X38 A;  2WQY B;  4JWS C;  3IXS A;  2RPV A;  3HVZ A;  4KGR A;  4WH4 A;  2SEB D;  4YTP B;  3AN1 A;  1B9R A;  1C9F A;  3VRA B;  3P1M A;  5G5G A;  1TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...