5LXHA

Gabarap-l1 atg4b lir complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
total genus 35
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lxhA00
1WGDA 4II3B 4K7SA 2GBNA 2A4ZA 2LJ5A 3T8MA 2D3GA 1Z2MA 1WGYA 3ZRCA 3TBLD 1V86A 1WZ3A 1H8CA 4AJWA 2EMTA 5DPTA 3WANA 4FHJA 4IW0A 2BYVE 1P0RA 4BKSA 3DVGY 3QX1A 3V6CB 3DQVA 3GZNI 1KOTA 1UD7A 1E8XA 3ML8A 4DHJD 3M3JA 3QC8B 2YLMA 3U8ZA 3WAMA 4HDQA 3H7SA 4ZRJA 2NBVB 4OVUA 2KMCA 3VXWA 2CU1A 3PTFC 2AYOB 2L0TA 1V2YA 5D7GA 2Y5BB 3IHPC 1J8CA 4GDLB 4GB9A 2I1KA 3L08A 2CKHB 4DWFA 4E71A 4MM3A 4W9LA 3TCAA 2BKFA 3VQIA 4MGKE 1E7UA 3APDA 4ANWA 4GGQA 3ECIA 2KJ6A 3NHEB 2ZEQA 3L54A 1C1YB 1J19A 4FA6A 1V5OA 4IWQA 4IM3A 2RD0A 3SHQA 3OLMD 5AEKB 2GOWA 2KANA 3JYUA 4F1SA 3MJWA 3DVGX 3DCGA 1WGGA 2IYDB 1I35A 4GMVA 2NS5A 1WF9A 5AZGA 3EECA 3LDZE 2KC1A 2V3SA 4EZKA 2CHWA 3H1UA 1WJNA 4LDTD 4RM8A 3A9KA 2IZVB 3KUDB 2NR2A 3H7PB 3OAWA 3WAPA 1IP9A 2L3ZA 3C0RB 1Q5WB 3JSVA 3A4RA 3H6NA 2C7MB 4GDKB 4WAAA 3HK0A 1WX7A 5CHWA 3P2BA 1IPGA 4NAWB 3B1LX 1V81A 2MBOA 3KH0A 2C5LC 5IAAC 3R7QA 3H9DA 3ZO5B 1X1MA 4FLHA 2O2VB 4GN1A 2FCNA 3DPDA 2HD5B 2UYZB 3PLUA 4RMAA 3W1YA 2NPTA 1YJ1A 2AEHA 1WY8A 2ZCBA 1E5WA 4NY0A 4W9GA 3VAWA 2M17A 1UH6A 4GSWA 2L7RA 4FADA 1Z5SB 4FJVB 2KD0A 3AU4A 1KJTA 4AWJA 2O2VA 3ZKJC 1WR6E 1UELA 1WE6A 2LGYA 5BO4B 4N9F4 5L83A 1VCBA 2G3QB 2GBJA 3M63B 1WJ6A 4HVBA 2IO2B 1PQSA 3ZW3A 4GU2A 4BOSC 5LXHA 4NPNA 4MELA 5TR5A 3TIXA 2UWQA 3NZUA 3QAQA 5E6PA 4ANXA 1ZGUB 3GOEA 1V5TA 3RD2A 2MBBB 4IG7B 5JZEB 1NBFC 3B08A 1P9DU 4BKTA 3AULA 4FJZA 1WMHA 5CTRC 3CSFA 1WGHA 2JT4B 3PS6A 1WM2A 1L2NA 2NBWB 2IO3B 2JRIB 3PSEB 3PVLA 3V60A 2KTFA 2KJHB 3BINA 4E74A 1WZ0A 4BKSD 2OJRA 4EZJA 2DAFA 2KQSA 1WR1A 3N32A 4HPMB 1NI2A 3OJ4B 1EUVB 3MTNB 4MH0E 2KDEB 4LDTB 3SDLC 5EDSA 3QA8A 1D3ZA 1XT9B 4DDID 2J7QB 1E7VA 2PEAA 4JL9A 4TKNA 3K9PB 2MP2B 5HKHA 1F9JA 1SE9A 2L8JA 2WX1A 1ZKHA 4LJOB 3TMPB 2XK5A 2KFJA 2N7DA 1P98A 2GMIC 3VHTC 4W9HA 3KYCD 1UBQA 2MW5A 3HM6X 3A9JA 1TGZB 2LD9A 3PHWB 4JGHB 3ENEA 3L13A 4KZ0A 4BVUC 4JQWC 3MHSD 1TZ1A 2IY0B 2ZNVC 5KHOA 1OTRB 2OOBB 3JVZX 2JZ3B 2YVCA 2NCNA 4B95A 1YD8U 3EHVA 5J18A 3R3MA 3VTVA 2M1MA 1V9JA 4K81A 4W9JA 5CHFA 5D2MB 1SIFA 4A3OA 2HJ8A 2XBBC 2EMSA 2KO3A 1GC7A 2JY6A 3A1QA 3ZVVA 2AWTA 4NNJB 4KIKA 4FBJB 2R2OA 2KXJA 1E8YA 4G3XB 4HPLB 2K39A 1L7YA 3AXCA 3ZRFA 1ZW7A 4MDKE 3O65B 4IWOA 3V61A 2KTRA 1EO6A 3ALBA 3DBRI 3QIJA 1VD2A 3X23A 5LLIA 2JVCA 4KVGB 3PRZA 3RCZA 1WJ4A 2A5UA 2O6VA 3HHMA 2PE9A 3QK0A 3CMMB 4IM0A 3RZWC 3M62B 4B6WA 3IBEA 2LVOA 4MJSA 1OGWA 2XEWA 4A3PA 1GUAB 2KDBA 4ANUA 5KHQA 2DENB 3EFUA 3ZLZA 4NAWA 4J6IA 4CHKA 4B9KA 4LCDE 4ASWC 1WI0A 2KWCA 1WFYA 3ZNHB 4EOYA 2NVUI 1M94A 2LRUA 4PYUA 2KKCA 2KLCA 1V80A 1P1AA 4TQ0A 3QCAA 5DPRA 3RULA 1C3TA 4MGIE 1J0GA 4KDIC 2N9XA 2DHZA 2N1WA 4KZCA 3KW5B 2IBIB 2WDTB 3KYDD 2DYBA 4PS7A 3UQAA 1GJZA 1T0YA 2N9PC 2LVPA 2MP2A 4F7ZA 2J0MA 3IG3A 3NOBA 3VVWB 2Z0DB 4ZDVA 4A20A 2K6DB 5J17A 2Z0EB 2ZPYA 2DYOA 3L0WB 1WE7A 2JWZA 3QHTA 4DHJB 2LGDA 1RFAA 2KMAA 1EF1A 2LGXA 4I6NB 4EKUA 4MGYE 2RR9A 2RPQA 1K8RB 4WJNA 3NS8A 4HLEA 2LUEA 4M8MA 4JIOU 4NQLB 3U7DA 2AL3A 2BYFA 3V6EB 4AP4C 1I42A 4HJKA 2K8CA 3PRMB 4ZRIA 2IO0B 2DZIA 2WYQA 3TJPA 4II2B 3WIMA 4DBGA 4DHZE 5DPSA 2BGFA 4HWIB 2LI5A 2MBQA 5E6NA 5G2NA 5JHAA 5CX3A 3UINB 3VTUA 3W1SC 2GBMA 1WJUA 2K8HA 3W1SA 4AUQC 2NBUA 1WX9A 2JUOA 1H4RA 1KLVA 3A9JB 2CHZA 3A9KB 1ISNA 2PE6B 3IFWB 2KN5A 3N3KB 2BWES 4GIVA 1S3SG 4I6LB 2PPHA 3M95A 2LASA 4FULA 4TV3A 5C1ZA 2KWVB 1BT0A 2FCQA 2D07B 1MG8A 3L16A 3DBLI 2MBEA 4WQOB 2CHXA 3KVFB 3SD5A 5L95C 2XK5B 2DZMA 2IO1B 3Q3FA 4KIKB 3APFA 3R7RA 1E8ZA 3WA0A 4K7WA 2L05A 2KJRA 4W9FA 2JRHA 5FR6A 5GMVA 3H7PA 4IM2A 1Q0WB 1YIWA 3KUCB 2KFKA 3QARA 3DBSA 2ZNVB 1QZEA 5AZHA 2LWPA 2L00B 2VRRB 3RT3B 1WIAA 1UBIA 1Y8RC 4NJ7A 5C23A 4BBNF 2PJHA 3DVNV 5LXIB 5JHBA 2LZ6A 4MGZE 4IWPA 2GBKA 3X0WA 1WXMA 2BKRB 1WX8A 1YX5B 4I6PA 4HCNB 3S2AA 4PS3A 1E90A 2C7HA 3NZSA 2ZVNA 3PREA 2V1YA 1OQYA 3PRPB 4M8NA 4CYEA 5DPWA 4HK2A 3N30A 4MJSB 1R4NI 2RSUA 1E8WA 4WWNA 3KUZA 4KV2A 2K8BA 1G6JA 1RRBA 1RAXA 2BYEA 3A4SC 2BF8B 4FJYA 4HCPB 4K7UA 2M0XA 1RLFA 2KOXA 3PT2B 2J0KA 2DAJA 4GOCA 3QJZA 3CF6E 4OVVA 2HE7A 2D11A 3A33B 3UF8A 3DBHI 2D2QA 2KFKB 2LXAA 4E3CA 1JRUA 2MSED 4JLCA 2N9EB 1S1QB 2LXCA 3DOWA 2FIFA 1A5RA 2G4SA 3IVFA 1UZXB 3Q3JA 2G45B 4M0WB 2FIDA 3TL5A 4EEWA 1AARA 2KTRB 2GBRA 4MSMB 3ZTDA 3ML9A 4TUUA 3U30A 1WMHB 3I3TB 4TQ1A 5AZFA 4LJPB 3VH3B 1WRDB 4FN2A 1WM3A 2ASQA 2HTHA 3ZNGC 2J0JA 2O6VB 1LQBA 3BY4B 4G11A 4IC7B 4DXAB 4ICUA 4K1RB 2N7EA 5E6OA 1UGMA 1GC6A 2ZZPB 3UIPB 3VUWA 2G4DB 2KC2A 1GNUA 3PHXB 1HE8A 2ZPNA 4ICVA 2MBHA 3R66C 1GG3A 4WJQA 1WH3A 2DZKA 1R4MI 1YQBA 2C9WB 3WALA 3ZTCA 4AJYB 3K9OB 3VTWA 2M8SA 3D32A 3ONSA 1SGHA 1EF5A 3PPAA 3ZDTA 2KQ7A 4GDLA 3ZUNA 1NDDA 4DDGD 2KDIA 2MA9B 4KSLC 3PZDA 2KX0A 2ZCCA 1FXTB 2ZJDA 3UIOB 3AI5A 2ZVOA 3JW0X 4NJ6A 2O6VD 4F8CB 2LRWA 2FCMA 4BFRA 4MEMA 3CSTA 3UQBA 2C60A 3JSVB 3DDCB 4XC2A 2BWFA 2MX2A 4FHKA 2K6QA 1LM8B 2L0FA 3OJ3A 1OEYA 2D10A 1WXVA 3VH4B 1V49A 1LFDA 4W9EA 3ZIMA 2KWUB 3HIZA 1YX6B 4XZ4A 1Q1OA 3RZFA 3PV1A 4PS8A 4WJOA 2REXA 2WWZA 2L76A 4HXDA 2K25A 2MRPA 2DX5B 2QHOA 2K1FA 4HDOA 2JF5A 2MQJA 2W9NA 4X57B 4YL8A 2DYMA 5JH5C 2NPTB 4DHZB 3VDZA 2JZZA 2KHWB 1WXSA 2B3AA 2KK8A 1XQQA 5CHVC 1U4AA 1KM7A 2CR5A 4W9DA 3VUYA 4W9IA 3ZDMC 2JXXA 3L17A 2AL6A 2N1VA 3A1QB 4ZYNA 3ZNID 3T9LA 1CMXB 4PYZA 4NQKE 3PGEA 3RUIB 2KLGA 3WAOA 2IY1B 1WXAA 4ANVA 5DCNA 3V62A 4W9KA 3LJ3A 3PLVA 4BBNC 3SU8X 2KZRA 4KDLB 3UGBB 3VFKA 4GDKA 4EFOA 3NY5A 4BOZB 2JPHA 2N4FA 4RM9A 4G0NB 4WJPA 3AU5A 4WWPA 1WGRA 3APCA 5D94A 1P3QU 1IYFA 2EKEC 2KX3A 4GXBA 4WWOA 1V6EA 2MCNB 1WYWB 3DVNU 4KSKC 2FUHB 2KNBA 5J2RA 4MSQB 2C7NB 3B0AA 2KDFB 1LXDA 3VUXA 1OEYJ 3ZNZB 1TBEA 4DK5A 2FAZA 5IA7A 2MLBA 2FCSA 3HM3A 4XX5A 4CO7A 2V4LA 3RYTA 3QWZB 3QQ8B 1TTNA 4AOFA 2Z59B 4URKA 5D6JB 2I1JA 4G50A 2RGFA 4EZLA 2FNJB 4P7IA 2KVRA 2LVQA 2R2QA 4IUMB 2WX0A 1XD3B 2M4NA 4W9CA 4BKGA 3EC8A 4ZRKA 3L10B 2CS4A 4EUTA 5G55A 2MWSB 2BPSA 2DZJA
chains in the Genus database with same CATH superfamily
4II3B 2JX5A 2GBNA 2A4ZA 1N5WA 1Z2MA 3ZRCA 2WXNA 1WZ3A 1J7CA 4BZAA 3AE7B 4TMAB 5MPOA 5DPTA 4BKSA 3DVGY 3QX1A 2XNAC 3V6CB 1KOTA 4OZAA 1E8XA 3M3JA 2NMQA 1KLUD 2NBVB 2N0SB 3V05A 3PTFC 1VLBA 1V2YA 2N9KA 3NJTA 4MM3A 1Y56A 1JWBD 3ECIA 2KJ6A 4N59A 2ZEQA 3L54A 1I4GA 2K3UA 4IM3A 3SHQA 1FCLA 2WXIA 3RN9C 3JYUA 3DCGA 1DOXA 3RNFC 2NS5A 3EECA 3W9CB 4XWWA 1WJNA 2IZVB 3WAPA 1SSNA 4J3OD 3A4RA 3H6NA 2WU2B 3I9V1 3ZQ4A 1VZ6A 3P2BA 1IPGA 2KVZA 2MBOA 2BTEA 1ZE3D 3H9DA 1X1MA 4GN1A 3DPDA 2HD5B 1NYQA 3W1YA 2WXGA 2QCZA 2L7RA 2KD0A 3ZKJC 1UELA 2CJOA 4N9F4 1EU3A 1VCBA 2ZW1A 3GP7A 5BMIA 2J52A 3ZW3A 4GU2A 4BOSC 2KYWA 4WIPA 3NZUA 5E6PA 1ET9A 4WAFA 2MBBB 4IG7B 3RD2A 1P9DU 3AULA 5CTRC 3P4QB 2NBWB 3PSEB 1ZXHA 2KJHB 3BINA 4E74A 1CK1A 1D5XC 1NI2A 2DWQA 3OJ4B 3N9YC 2MJEA 1XO3A 3MTNB 3SDLC 1D3ZA 3BVGA 2V3PA 5HKHA 1C4CA 1IBXB 1ZKHA 3BIID 4LK0M 2MJDA 4HPPA 1DOIA 2R61A 4ZHOA 2MW5A 4USAA 3A9JA 2LD9A 3HVZA 4KZ0A 4DXGA 3MHSD 1TZ1A 2E3TA 1KH0A 2RMMA 2OOBB 2NCNA 1KLGD 4XWTA 1GOZA 3VTVA 2M1MA 2WXMA 3PZ7A 4A3OA 2XBBC 4LTUA 2JY6A 2AWTA 2JWUA 2R2OA 1E8YA 4HPLB 3AXCA 3ZRFA 3ZJTA 4C00A 4MDKE 3KQ4A 3O65B 2KTRA 2WXRA 3DBRI 3P1MA 1YN5A 2ICIA 1J7BA 1E10A 3TSSA 2HDEA 2A5UA 2O6VA 3QK0A 3U4EG 3BZDB 3Q8FA 2KDBA 5KHQA 1QOAA 1NYRA 4B9KA 2MH7A 1WFYA 4EOYA 4PYUA 2LRUA 1TIFA 2KLCA 3U52E 2J42A 3RULA 5FK9C 1V1OA 4KDIC 2N9XA 1GJZA 1T0YA 3RNAC 2LVPA 4F7ZA 3IG3A 1IBXA 2Z0EB 5EE3A 1WE7A 2JWZA 4DHJB 2LGDA 1RFAA 2KMAA 1EF1A 2Q5WD 2RPQA 3PO0A 2LUEA 5IN7A 4JIOU 4NQLB 1IGDA 3U7DA 1LO5D 2AL3A 2KWDA 4HKQA 1E0ZA 3PRMB 3TJPA 2WYQA 4DBGA 4DHZE 1SF0A 4HWIB 3AH7A 5JHAA 3UINB 3W1SC 4K3BA 4AUQC 1T0SC 1T3QA 2RDGA 3A9JB 3A9KB 2BQQA 2H89B 1VR9A 2PPHA 3M95A 2RDBC 2FCQA 1MG8A 4PK1A 4HJGE 1VZ7A 4WQOB 5L95C 3MJ5A 2DZMA 3Q3FA 2NTTA 1E8ZA 3R7RA 3WA0A 3NVZA 3P63A 1J7AA 1Q0WB 3KUCB 3QARA 2ZNVB 1QZEA 1K50A 1UBIA 4BBNF 4JWSC 2IGDA 1CQVA 2PJHA 3Q2AC 4O1NA 3X0WA 1WX8A 1ESFA 3AEAB 1YJJA 2ZVNA 4CYEA 3ZJUA 1UWXA 1HZ6A 4OW0A 1EWYC 2RSUA 1E8WA 1RRBA 1RAXA 2ACZB 2BYEA 4FJYA 4K7UA 2M0XA 2KOXA 1F77A 2J0KA 4S17A 4GOCA 3QJZA 2HE7A 2D2QA 2BVCA 2MSED 4JLCA 3J9CA 2G4SA 4L23A 3W2DA 1L4DB 2FIDA 3TL5A 4EEWA 1WGKA 4YSXB 3ML9A 1MJDA 3U30A 4MH8A 5AZFA 4P1CC 1WM3A 2Y3AA 2J0JA 3BY4B 1KRHA 4PT5A 1XEEA 3UIPB 1GNUA 3P4SB 2ZPNA 1HTOA 1GG3A 3VR8B 1FD6A 1C9FA 2ONQA 1ROEA 2C9WB 3WALA 3ZTCA 3BYTB 2KMMA 4A55A 3VTWA 3D32A 1SGHA 3ZDTA 2KQ7A 5AUIA 2KX0A 2ZCCA 1R7SA 3H8HA 3N1XC 3UIOB 2ZVOA 3JW0X 2O6VD 3FKYA 1FFUA 3ETRA 2LHEA 2INDC 1YN4A 2H88B 1I4PA 1WXVA 4W9EA 1YX6B 4XZ4A 3EGRA 2WWZA 2EKIA 1QOFA 2K25A 2MRPA 2DX5B 2QHOA 2JF5A 4DHZB 1QQRA 3C19A 3EFCA 3URYA 1FXAA 3L17A 2AL6A 3A1QB 3RUIB 2KLGA 3WAOA 4WQMA 4ANVA 5DCNA 3GE3C 1E9MA 2BB6A 2KZRA 1T0QC 3UGBB 4EFOA 3AEGB 3NY5A 4RM9A 3AU5A 3OWEB 1C77A 3APCA 5D94A 1IYFA 1T0RC 2INPE 1V97A 3DVNU 2KNBA 1TKEA 2KDFB 1BXTA 4A6QA 4ARIA 1FPYA 1RYJA 1TTNA 4AOFA 4URKA 2I1JA 5T8IA 2R2QA 3RPFC 5D3DA 4BKGA 1XD3B 2UU7A 4W9CA 3EC8A 4YTPB 4EUTA 2DZJA 1F2RC 4K7SA 2OEDA 2V3NA 1YJIA 1TY0A 2WU5B 5EE9A 3TBLD 2X38A 3NVWA 1WYGA 5IOIA 4IW0A 1P0RA 3BK1A 2AQ3B 3TUOA 2EELA 3H7SA 3R2TA 5HFYA 2KMCA 2CU1A 2AYOB 4TSSA 2Y5BB 3IHPC 4GDLB 3L08A 2HTME 4DWFA 1E7UA 4GGQA 1C1YB 2RD0A 2BW2A 4CQNA 1KFYB 2GOWA 4ZOHC 3DVGX 1YMHE 1WGGA 3AMZA 1I35A 1WF9A 1MI0A 3LDZE 4EZKA 2GB1A 3P4RB 1RWSA 3A9KA 3KUDB 2NR2A 4AS1A 5FR3A 5I4DA 1Q5WB 1ET6A 1MG4A 5CHWA 4NAWB 1V81A 2CJNA 3KH0A 5IAAC 3R7QA 2FCNA 1GAQB 3L4PA 1YJ1A 2AEHA 2L32A 2MHJA 2ZCBA 1PFDA 3TEXA 2M17A 1UH6A 3IXSA 4FADA 3Q3NC 1KJTA 2O2VA 2LGYA 2G3QB 1TT5B 1AYFA 1WJ6A 4HVBA 2IO2B 4RGMA 4MELA 5TR5A 2UWQA 1WRIA 1ZGUB 1V5TA 5JZEB 1DOYA 3B08A 1WMHA 3DWGC 2JT4B 2FUG1 3AE1B 1D6EC 3KWVA 4K3CA 4RNAA 1HQRD 3V60A 2KTFA 1WZ0A 4EZJA 2DAFA 2KQSA 2LHDA 2KDEB 5EDSA 3Q14C 2J7QB 1JALA 1IUEA 1F9JA 1SE9A 2WX1A 4L1BA 1YQ4B 2KFJA 2N7DA 1UBQA 1SJED 1TGZB 4A9AA 3PHWB 4JGHB 3ENEA 4JQWC 4MT5A 2ZNVC 5KHOA 1YOVB 3JVZX 3AECB 2JZ3B 2YVCA 4B95A 1YD8U 4K81A 4W9JA 5D2MB 4JPSA 2HJ8A 4L2YA 2LUMA 2KO3A 4A8XC 3ZVVA 4XE0A 4FBJB 4WURA 1N60A 2KXJA 2VH2A 1L7YA 4JE3B 1I4XA 2QC8A 4RGOS 3WCQA 1E7PB 3AM9A 3X23A 5LLIA 3ZXRA 1SBBB 2VH1A 4YSZB 2PE9A 3CMMB 1EU4A 4GLSC 1UWMA 3IBEA 1OGWA 4ANUA 3GZNB 1YNTE 4DQOC 1V1PB 3Q3OC 4B0MA 4LCDE 1C78A 1HTQA 3ZNHB 1M94A 4D2KA 2KKCA 1L6VA 1V80A 4TQ0A 1XLPA 2WXQA 3QCAA 1JWAD 1C3TA 1J0GA 2HJ1A 2N1WA 1SXTA 2IBIB 1UUPA 4ZDVA 3VVWB 2Z0DB 4A20A 1K53A 3L0WB 2V9HA 2LGXA 4MGYE 1BMLC 3IAM1 1K8RB 4WJNA 3AE4B 3MFGA 1KF6B 1I42A 2K8CA 4ZRIA 2NTSA 3WIMA 2WHIA 4WWMA 5DPSA 2M56B 2YEPF 2LI5A 2MBQA 5G2NA 5CX3A 3RMKC 1WJUA 2L52A 2IGGA 1KLVA 1H4RA 1ISNA 4M00A 1B1ZA 4XGAB 4FULA 2D07B 3L16A 2J4XA 3LYYA 2MBEA 1TS3A 3KVFB 1RFKA 2XK5B 3EUB2 2IO1B 3APFA 4K7WA 2L05A 4W9FA 2JRHA 2JYTA 3NS1A 3H7PA 4NZLB 1V1PA 1TS5A 3RT3B 1WIAA 5IKCM 5C23A 3DVNV 3Q69A 5LXIB 5JHBA 1JCKB 1N5XA 4IWPA 2BKRB 4HCNB 4PS3A 1E90A 5TSSA 3NZSA 1HXYD 1N63A 2D3CA 2W82A 3KUZA 4WWNA 2K8BA 1TYGB 2QEJC 2DAJA 1NEKB 3A33B 3DBHI 5IP4D 2KFKB 2RDHA 1FRRA 1S1QB 2N9EB 2XN9C 3DOWA 3Q3JA 4KKIA 3GB1A 3ZYYX 2BT6A 4RF0A 1F52A 4M0WB 2KTRB 2Y5PA 3ZTDA 5BYQA 1UF0A 4LJPB 1VJKA 2INCC 4FN2A 2O6VB 3ZJVA 2N7EA 5E6OA 1HE8A 1QOBA 3FILB 2DZKA 3IT6B 3AEDB 2JSVX 3PPAA 4ZHPA 2D3BA 3ZUNA 1QF6A 2KDIA 2MA9B 3C8YA 3E9SA 4NJ6A 3KLSX 2B76B 4BFRA 3B2GA 4MEMA 1MFWA 1V8CA 3JSVB 4XC2A 2W3RA 2K6QA 1LM8B 3E56A 1LFDA 1KTKA 2QSDA 3RZFA 4PS8A 2REXA 2WLBA 1TJEA 2W9NA 4X57B 5JH5C 2NPTB 2KT7A 5HG2A 5CHVC 4QAYA 2KAJA 1KM7A 4W9DA 1CJEA 1SJHD 4ZYNA 3ZNID 4NQKE 2G1EA 2N7JA 1WXAA 1DYQA 3V62A 4W9KA 2N9LA 3PLVA 3SU8X 4LNFA 4GDKA 5JXVA 2JPHA 4WJPA 2N4FA 4GXBA 1L0YB 3TEWA 4RGTA 4KSKC 1ZDXA 1JW9D 3ZNZB 3VUXA 1LXDA 1K52A 1OEYJ 4DK5A 1TBEA 4CO7A 3NZ3A 2TSSA 1WWTA 3RYTA 1MVKA 4JX1C 1R4NB 1CZPA 5C2TB 4G50A 2RGFA 2DNFA 4P7IA 2LVQA 3FILA 1E6EB 2M4NA 3RNCC 3L10B 2CS4A 5HI1A 5G55A 2BPSA 1I4QA 1WGDA 2E6XA 1JROA 2D3GA 4OZBA 1NVID 1V86A 4AJWA 5IO9A 2EMTA 2VZKB 1HA5A 2BYVE 1XLOA 4H2AA 5FKAC 3U8ZA 4LNOA 4ZRJA 1QOGA 3VXWA 2WXLA 2L0TA 2M0AA 5D7GA 1J8CA 4GB9A 3DHHC 3VQIA 3BK2A 3APDA 4S0RA 4ANWA 3NHEB 4EE2A 1J19A 3OLMD 1XLQA 2KANA 4F1SA 1MHXA 3MJWA 3BVMA 2PLPA 1PGXA 2KC1A 2V3SA 5BMHA 4LDTD 4RM8A 1ZPSA 2L3ZA 4AQ7A 4GDKB 3AB5A 4WAAA 2V4IB 1WX7A 4BAXA 1L0XB 1C4PA 3I57A 4C4VB 2O2VB 3PLUA 4RH6A 5H92C 3VAWA 1E5WA 4W9GA 2VZKD 3NUHB 1Z5SB 4FJVB 1TZOA 3AE6B 3AE2B 2Z8LA 1WE6A 3CIRB 4P6VF 3M63B 2GBJA 2LEKA 4WH4A 5LXHA 4NPNA 2M19A 1NBFC 3VRAB 4P16A 4BKTA 3MC0B 3PS6A 1P7EA 2FBWB 1WM2A 1FNVA 2IO3B 3R2IA 2WDQB 3GE8C 4C7ZA 4BKSD 2OJRA 3N32A 5G5GA 4HPMB 4M0WA 1EUVB 3AN1A 4LDTB 4DDID 2PEAA 3FC4A 2OJWA 4LJOB 3TMPB 2IDYA 3SFEB 1P98A 2GMIC 3VHTC 2IGHA 3DBRB 4W9HA 3KYCD 1EM7A 2FE8A 3L13A 4LNKA 4BVUC 1FNWA 2QMTA 4LLGM 1N61A 2WXJA 2BYTA 5J18A 2OHFA 1V9JA 5EE0A 1GC7A 1FO4A 4G3XB 2K39A 1TKGA 1PGBA 2I2YA 4HKZE 1EO6A 3ALBA 1OQQA 1VD2A 3QIJA 2JVCA 4KVGB 1TS2A 1WJ4A 4ITKA 4IM0A 4M02A 3M62B 3TEZA 1GUAB 2DENB 3ZLZA 3CWIA 4J6IA 4CHKA 4LNIA 4P1BC 2KWCA 2NVUI 3V3XA 2X8XX 3SEBA 1P1AA 3B2FA 1PYWD 2DHZA 3UQAA 3KYDD 2N9PC 2J0MA 3NOBA 3T3OA 5J17A 2K6DB 2SEBD 1SE3A 2K5PA 4I6NB 4EKUA 2RR9A 3NS8A 1GB4A 4HLEA 4M8MA 2PVOD 5LNK1 2IJ0A 4HJKA 2DZIA 1F1HA 4II2B 1SB3C 2GLSA 1YN3A 2CU3A 5E6NA 1GPXA 2GBMA 3O13A 4RCOA 2K9XA 2MEKA 4M01A 2NBUA 1WX9A 2WXPA 2JUOA 3NVVA 3IFWB 3N3KB 2BWES 1S3SG 1TS4A 1FRDA 2KN4A 1EWCA 1BT0A 3IT4B 3RFZB 5G5HA 2CHXA 1SEBD 5FR6A 1Q10A 3LXFA 1YIWA 2W55A 2G9HD 2KFKA 1XF5L 2L00B 4NJCA 2VRRB 1ZP0B 1XCTL 3PZ8A 2K22A 2KQ4X 2LZ6A 4MGZE 2GBKA 3AE9B 3S2AA 4ARCA 1VDVA 2C7HA 5DPWA 2V1YA 1OQYA 4HK2A 3N30A 1SE4A 4RGNA 4KV2A 3MC9A 2QIEB 1G6JA 3DBLB 3A4SC 1ZXIA 2BF8B 1FMAD 1RLFA 2W54A 1C76A 3U2SC 2BS4B 3CF6E 3UF8A 4E3CA 2WXFA 1I7HA 1D4BA 3IVFA 2ZW0A 1I4RA 3BWUD 1QILA 2GBRA 4TUUA 3I3TB 5BMGA 2BS3B 3ZNGC 4G11A 1MPEA 4ICUA 1UGMA 1GC6A 3Q8AA 3TEYA 3VUWA 2MBHA 3R8BA 3R66C 1R4MI 1YQBA 1NENB 1IGCA 3K9OB 2M8SA 5D3IB 1EF5A 4XDDA 4GDLA 4DDGD 1D5ZC 4KSLC 3PZDA 3DHGC 4REZA 1FXTB 2ZJDA 3AI5A 4F8CB 2LRWA 1UNSA 2FCMA 5HHDG 3VRBB 3CSTA 3UQBA 3EA6A 3NG0A 2WQYB 3DDCB 2BWFA 2MX2A 2L0FA 3OJ3A 1OEYA 2D10A 2LGSA 1V49A 3Q8EA 3HIZA 1Q1OA 3PV1A 2L76A 3BVZA 4HXDA 3HVDA 4YL8A 2MQJA 1LGRA 2DYMA 2WDRB 3VDZA 2JZZA 2KHWB 2KK8A 3AEEB 1WSPA 1XQQA 1P7FA 1U4AA 1RM6C 5H8YE 4YWGG 4PYZA 2IY1B 1VZ8A 3IAS1 3N1ZC 4KDLB 3DWMA 3U7ZA 3VFKA 3KWLA 4G0NB 4WWPA 1WGRA 4DXFA 4ZYSA 3VR9B 1V6EA 2MCNB 4HRSA 2FUHB 5J2RA 4MSQB 2C7NB 3BYYB 3B0AA 5IA7A 2FAZA 3HM3A 2V4LA 2WNMA 3QWZB 3QQ8B 5D6JB 3DBHB 3MC8A 3SR6A 4ZRKA 2MWSB 1UZXB 4IOIE 2LJ5A 3T8MA 4ZRQA 1WGYA 1F0ZA 4ZRPA 4FXCA 3DHIC 1H8CA 1XLNA 3WANA 1F2RI 3FAHA 4FHJA 3Q3MC 3DQVA 3P42A 3GZNI 1UD7A 3ML8A 4DHJD 3QC8B 4OZCA 2YLMA 3WAMA 4HDQA 1PGAA 2LGIA 5GXGB 4OVUA 1FNUA 1K51A 2WP9B 3AEFB 1JWUD 2I1KA 5BYRA 2CKHB 4E71A 4W9LA 3TCAA 2BKFA 2D5GA 3B9JA 3MP9A 4MGKE 4C56C 4FA6A 5BYSA 1V5OA 4IWQA 4KKJA 5AEKB 1AN8A 3ZXVA 1FFVA 1JQ4A 2IYDB 4GMVA 1FM0D 5AZGA 2CHWA 3H1UA 3HUIA 3H7PB 3OAWA 4RFBA 1IP9A 3C0RB 3N1YC 2INNE 2PVGC 3JSVA 2JYEA 4IDIA 1XXGA 2C7MB 2W3SA 3HK0A 2V0GA 4HEA1 3B1LX 1DGJA 3GS2A 2C5LC 4KGRA 3ZO5B 4FLHA 2WGSA 1ZUD2 2UYZB 4RMAA 1C4AA 2NPTA 1WY8A 4NY0A 4GSWA 4KX6B 3AU4A 4AWJA 1ENFA 1WR6E 5BO4B 3Q8CA 5L83A 3I5JC 1PDXA 1PUTA 1PQSA 2YEPB 3TIXA 2MJ3A 1QLBB 3QAQA 4ANXA 3GOEA 1BUIC 2BS2B 4FJZA 1N6ZA 4B0EA 3CSFA 1WGHA 1L2NA 3NVYA 4C7YA 2JRIB 1T6BX 3PVLA 1C79A 1T5XD 2L1AA 1WR1A 3AE8B 4YTMB 1OQRA 4MH0E 2LMCA 3QA8A 1XT9B 1E7VA 4JL9A 4TKNA 1ACCA 2MP2B 3K9PB 3NRZA 2L8JA 1I4HA 2WDVB 4N6EB 2XK5A 1D5MC 3HM6X 1TKYA 2K0PA 2PMVA 4XDCA 2IY0B 1OTRB 3RNGC 3EHVA 3R3MA 5CHFA 1SIFA 3SFDB 1L6UA 2EMSA 3A1QA 4OHJA 4NNJB 4KIKA 4RF1A 1HZ5A 2I38A 4KGSA 4C80A 1ZW7A 3V61A 4IWOA 5AUKA 1AWDA 3PRZA 3RCZA 3HHMA 3RZWC 4B6WA 2LVOA 1UGJA 4MJSA 2XEWA 4A3PA 3EFUA 3I63C 4NAWA 1GB1A 4ASWC 1WI0A 5DPRA 4MGIE 4XYCA 1R4MB 4R3DA 1AW7A 3KW5B 2WDTB 4KZCA 4PS7A 2DYBA 4UDUC 1FEHA 3ZGZA 2MP2A 2BB5A 2ZPYA 2DYOA 3QHTA 1QKZA 4C4VA 4MM3B 1M4VA 3HRDD 1VRAB 2JZPA 2DLBA 4IKGA 1NI3A 2BYFA 3V6EB 4AP4C 3W5UB 2IO0B 3RNBC 2BGFA 4KGTA 3VTUA 1XCQL 2GI9A 2K8HA 3W1SA 1TY2A 2CHZA 2PE6B 1ZOYB 2KN5A 4GIVA 2JXTA 4I6LB 4HROA 2LASA 4TV3A 5C1ZA 2KWVB 4N58A 3DBLI 2J53A 3OG5A 2WXKA 3SD5A 4A90A 3LB8C 1L0VB 4KIKB 2KJRA 2PTLA 4Q2JA 5GMVA 2AQ1B 4IM2A 3DBSA 5AZHA 2LWPA 4NJ7A 1Y8RC 5EE1A 1L5PA 5E6JA 4ACFA 2SAKA 1WXQA 1WXMA 1YX5B 4I6PA 3Q6BA 2PIAA 3Q8BA 3PREA 3PRPB 4M8NA 4MJSB 1R4NI 2LJIA 2DBYA 1STEA 4HCPB 3PT2B 1JWSD 4OVVA 2D11A 3N20C 2LXAA 1JRUA 2RPVA 2LXCA 4JWUC 2FIFA 1A5RA 1SE2A 2G45B 2ON8A 2AX5A 1AARA 2JU6X 4MSMB 1ZDVA 1WMHB 1JMLA 4TQ1A 3VH3B 1WRDB 2PKOA 4MACA 2ASQA 2HTHA 1OFFA 2GRIA 1LQBA 4IC7B 3AE5B 4DXAB 2KDMA 4K1RB 3P4PB 4YXDB 2ZZPB 1FCCC 2G4DB 2KC2A 2QILA 3W5VB 4ICVA 1JRPA 3PHXB 2IPKD 4OVZA 4WJQA 2QDFA 1WH3A 2WXOA 4AJYB 1MHHE 2WXHA 3ABVB 3AE3B 3ONSA 2WS3B 3T3NA 1NDDA 3RI7C 2C60A 2LFIA 4FHKA 1JWMD 1YQ3B 4YT0B 3VH4B 3ZIMA 2KWUB 4WJOA 2Y5CA 2QJLA 3RNEC 1HEZE 1L4ZB 4HDOA 2K1FA 1FXIA 4NAMA 1WXSA 2B3AA 4US9A 2BBCA 1FIQA 1SIJA 2L83A 2CR5A 3VUYA 4W9IA 3ZDMC 2JXXA 2KACA 2N1VA 4US8A 3T9LA 1CMXB 3PGEA 2AQ2B 3LJ3A 4BBNC 3UI3A 5C3JB 4LNNA 4BOZB 1QT9A 2D3AA 1P3QU 2EKEC 2KX3A 3MHZA 4WWOA 4YSYB 1WYWB 1B9RA 3AEBB 3AV8A 2JQRB 1N62A 1A70A 2PW9A 2MLBA 2FCSA 4XX5A 2Z59B 4EZLA 2FNJB 2KVRA 4IUMB 2WX0A 4YTNB
chains in the Genus database with same CATH topology
1WGDA 4II3B 4K7SA 2GBNA 2A4ZA 2LJ5A 3T8MA 2D3GA 1Z2MA 1WGYA 3ZRCA 3TBLD 1V86A 1WZ3A 1H8CA 4AJWA 2EMTA 5DPTA 3WANA 4FHJA 4IW0A 2BYVE 1P0RA 4BKSA 3DVGY 3QX1A 3V6CB 3DQVA 3GZNI 1KOTA 1UD7A 1E8XA 3ML8A 4DHJD 3M3JA 3QC8B 2YLMA 3U8ZA 3WAMA 4HDQA 3H7SA 4ZRJA 2NBVB 4OVUA 2KMCA 3VXWA 2CU1A 3PTFC 2AYOB 2L0TA 1V2YA 5D7GA 2Y5BB 3IHPC 1J8CA 4GDLB 4GB9A 2I1KA 3L08A 2CKHB 4DWFA 4E71A 4MM3A 4W9LA 3TCAA 2BKFA 3VQIA 4MGKE 1E7UA 3APDA 4ANWA 4GGQA 3ECIA 2KJ6A 3NHEB 2ZEQA 3L54A 1C1YB 1J19A 4FA6A 1V5OA 4IWQA 4IM3A 2RD0A 3SHQA 3OLMD 5AEKB 2GOWA 2KANA 3JYUA 4F1SA 3MJWA 3DVGX 3DCGA 1WGGA 2IYDB 1I35A 4GMVA 2NS5A 1WF9A 5AZGA 3EECA 3LDZE 2KC1A 2V3SA 4EZKA 2CHWA 3H1UA 1WJNA 4LDTD 4RM8A 3A9KA 2IZVB 3KUDB 2NR2A 3H7PB 3OAWA 3WAPA 1IP9A 2L3ZA 3C0RB 1Q5WB 3JSVA 3A4RA 3H6NA 2C7MB 4GDKB 4WAAA 3HK0A 1WX7A 5CHWA 3P2BA 1IPGA 4NAWB 3B1LX 1V81A 2MBOA 3KH0A 2C5LC 5IAAC 3R7QA 3H9DA 3ZO5B 1X1MA 4FLHA 2O2VB 4GN1A 2FCNA 3DPDA 2HD5B 2UYZB 3PLUA 4RMAA 3W1YA 2NPTA 1YJ1A 2AEHA 1WY8A 2ZCBA 1E5WA 4NY0A 4W9GA 3VAWA 2M17A 1UH6A 4GSWA 2L7RA 4FADA 1Z5SB 4FJVB 2KD0A 3AU4A 1KJTA 4AWJA 2O2VA 3ZKJC 1WR6E 1UELA 1WE6A 2LGYA 5BO4B 4N9F4 5L83A 1VCBA 2G3QB 2GBJA 3M63B 1WJ6A 4HVBA 2IO2B 1PQSA 3ZW3A 4GU2A 4BOSC 5LXHA 4NPNA 4MELA 5TR5A 3TIXA 2UWQA 3NZUA 3QAQA 5E6PA 4ANXA 1ZGUB 3GOEA 1V5TA 3RD2A 2MBBB 4IG7B 5JZEB 1NBFC 3B08A 1P9DU 4BKTA 3AULA 4FJZA 1WMHA 5CTRC 3CSFA 1WGHA 2JT4B 3PS6A 1WM2A 1L2NA 2NBWB 2IO3B 2JRIB 3PSEB 3PVLA 3V60A 2KTFA 2KJHB 3BINA 4E74A 1WZ0A 4BKSD 2OJRA 4EZJA 2DAFA 2KQSA 1WR1A 3N32A 4HPMB 1NI2A 3OJ4B 1EUVB 3MTNB 4MH0E 2KDEB 4LDTB 3SDLC 5EDSA 3QA8A 1D3ZA 1XT9B 4DDID 2J7QB 1E7VA 2PEAA 4JL9A 4TKNA 3K9PB 2MP2B 5HKHA 1F9JA 1SE9A 2L8JA 2WX1A 1ZKHA 4LJOB 3TMPB 2XK5A 2KFJA 2N7DA 1P98A 2GMIC 3VHTC 4W9HA 3KYCD 1UBQA 2MW5A 3HM6X 3A9JA 1TGZB 2LD9A 3PHWB 4JGHB 3ENEA 3L13A 4KZ0A 4BVUC 4JQWC 3MHSD 1TZ1A 2IY0B 2ZNVC 5KHOA 1OTRB 2OOBB 3JVZX 2JZ3B 2YVCA 2NCNA 4B95A 1YD8U 3EHVA 5J18A 3R3MA 3VTVA 2M1MA 1V9JA 4K81A 4W9JA 5CHFA 5D2MB 1SIFA 4A3OA 2HJ8A 2XBBC 2EMSA 2KO3A 1GC7A 2JY6A 3A1QA 3ZVVA 2AWTA 4NNJB 4KIKA 4FBJB 2R2OA 2KXJA 1E8YA 4G3XB 4HPLB 2K39A 1L7YA 3AXCA 3ZRFA 1ZW7A 4MDKE 3O65B 4IWOA 3V61A 2KTRA 1EO6A 3ALBA 3DBRI 3QIJA 1VD2A 3X23A 5LLIA 2JVCA 4KVGB 3PRZA 3RCZA 1WJ4A 2A5UA 2O6VA 3HHMA 2PE9A 3QK0A 3CMMB 4IM0A 3RZWC 3M62B 4B6WA 3IBEA 2LVOA 4MJSA 1OGWA 2XEWA 4A3PA 1GUAB 2KDBA 4ANUA 5KHQA 2DENB 3EFUA 3ZLZA 4NAWA 4J6IA 4CHKA 4B9KA 4LCDE 4ASWC 1WI0A 2KWCA 1WFYA 3ZNHB 4EOYA 2NVUI 1M94A 2LRUA 4PYUA 2KKCA 2KLCA 1V80A 1P1AA 4TQ0A 3QCAA 5DPRA 3RULA 1C3TA 4MGIE 1J0GA 4KDIC 2N9XA 2DHZA 2N1WA 4KZCA 3KW5B 2IBIB 2WDTB 3KYDD 2DYBA 4PS7A 3UQAA 1GJZA 1T0YA 2N9PC 2LVPA 2MP2A 4F7ZA 2J0MA 3IG3A 3NOBA 3VVWB 2Z0DB 4ZDVA 4A20A 2K6DB 5J17A 2Z0EB 2ZPYA 2DYOA 3L0WB 1WE7A 2JWZA 3QHTA 4DHJB 2LGDA 1RFAA 2KMAA 1EF1A 2LGXA 4I6NB 4EKUA 4MGYE 2RR9A 2RPQA 1K8RB 4WJNA 3NS8A 4HLEA 2LUEA 4M8MA 4JIOU 4NQLB 3U7DA 2AL3A 2BYFA 3V6EB 4AP4C 1I42A 4HJKA 2K8CA 3PRMB 4ZRIA 2IO0B 2DZIA 2WYQA 3TJPA 4II2B 3WIMA 4DBGA 4DHZE 5DPSA 2BGFA 4HWIB 2LI5A 2MBQA 5E6NA 5G2NA 5JHAA 5CX3A 3UINB 3VTUA 3W1SC 2GBMA 1WJUA 2K8HA 3W1SA 4AUQC 2NBUA 1WX9A 2JUOA 1H4RA 1KLVA 3A9JB 2CHZA 3A9KB 1ISNA 2PE6B 3IFWB 2KN5A 3N3KB 2BWES 4GIVA 1S3SG 4I6LB 2PPHA 3M95A 2LASA 4FULA 4TV3A 5C1ZA 2KWVB 1BT0A 2FCQA 2D07B 1MG8A 3L16A 3DBLI 2MBEA 4WQOB 2CHXA 3KVFB 3SD5A 5L95C 2XK5B 2DZMA 2IO1B 3Q3FA 4KIKB 3APFA 3R7RA 1E8ZA 3WA0A 4K7WA 2L05A 2KJRA 4W9FA 2JRHA 5FR6A 5GMVA 3H7PA 4IM2A 1Q0WB 1YIWA 3KUCB 2KFKA 3QARA 3DBSA 2ZNVB 1QZEA 5AZHA 2LWPA 2L00B 2VRRB 3RT3B 1WIAA 1UBIA 1Y8RC 4NJ7A 5C23A 4BBNF 2PJHA 3DVNV 5LXIB 5JHBA 2LZ6A 4MGZE 4IWPA 2GBKA 3X0WA 1WXMA 2BKRB 1WX8A 1YX5B 4I6PA 4HCNB 3S2AA 4PS3A 1E90A 2C7HA 3NZSA 2ZVNA 3PREA 2V1YA 1OQYA 3PRPB 4M8NA 4CYEA 5DPWA 4HK2A 3N30A 4MJSB 1R4NI 2RSUA 1E8WA 4WWNA 3KUZA 4KV2A 2K8BA 1G6JA 1RRBA 1RAXA 2BYEA 3A4SC 2BF8B 4FJYA 4HCPB 4K7UA 2M0XA 1RLFA 2KOXA 3PT2B 2J0KA 2DAJA 4GOCA 3QJZA 3CF6E 4OVVA 2HE7A 2D11A 3A33B 3UF8A 3DBHI 2D2QA 2KFKB 2LXAA 4E3CA 1JRUA 2MSED 4JLCA 2N9EB 1S1QB 2LXCA 3DOWA 2FIFA 1A5RA 2G4SA 3IVFA 1UZXB 3Q3JA 2G45B 4M0WB 2FIDA 3TL5A 4EEWA 1AARA 2KTRB 2GBRA 4MSMB 3ZTDA 3ML9A 4TUUA 3U30A 1WMHB 3I3TB 4TQ1A 5AZFA 4LJPB 3VH3B 1WRDB 4FN2A 1WM3A 2ASQA 2HTHA 3ZNGC 2J0JA 2O6VB 1LQBA 3BY4B 4G11A 4IC7B 4DXAB 4ICUA 4K1RB 2N7EA 5E6OA 1UGMA 1GC6A 2ZZPB 3UIPB 3VUWA 2G4DB 2KC2A 1GNUA 3PHXB 1HE8A 2ZPNA 4ICVA 2MBHA 3R66C 1GG3A 4WJQA 1WH3A 2DZKA 1R4MI 1YQBA 2C9WB 3WALA 3ZTCA 4AJYB 3K9OB 3VTWA 2M8SA 3D32A 3ONSA 1SGHA 1EF5A 3PPAA 3ZDTA 2KQ7A 4GDLA 3ZUNA 1NDDA 4DDGD 2KDIA 2MA9B 4KSLC 3PZDA 2KX0A 2ZCCA 1FXTB 2ZJDA 3UIOB 3AI5A 2ZVOA 3JW0X 4NJ6A 2O6VD 4F8CB 2LRWA 2FCMA 4BFRA 4MEMA 3CSTA 3UQBA 2C60A 3JSVB 3DDCB 4XC2A 2BWFA 2MX2A 4FHKA 2K6QA 1LM8B 2L0FA 3OJ3A 1OEYA 2D10A 1WXVA 3VH4B 1V49A 1LFDA 4W9EA 3ZIMA 2KWUB 3HIZA 1YX6B 4XZ4A 1Q1OA 3RZFA 3PV1A 4PS8A 4WJOA 2REXA 2WWZA 2L76A 4HXDA 2K25A 2MRPA 2DX5B 2QHOA 2K1FA 4HDOA 2JF5A 2MQJA 2W9NA 4X57B 4YL8A 2DYMA 5JH5C 2NPTB 4DHZB 3VDZA 2JZZA 2KHWB 1WXSA 2B3AA 2KK8A 1XQQA 5CHVC 1U4AA 1KM7A 2CR5A 4W9DA 3VUYA 4W9IA 3ZDMC 2JXXA 3L17A 2AL6A 2N1VA 3A1QB 4ZYNA 3ZNID 3T9LA 1CMXB 4PYZA 4NQKE 3PGEA 3RUIB 2KLGA 3WAOA 2IY1B 1WXAA 4ANVA 5DCNA 3V62A 4W9KA 3LJ3A 3PLVA 4BBNC 3SU8X 2KZRA 4KDLB 3UGBB 3VFKA 4GDKA 4EFOA 3NY5A 4BOZB 2JPHA 2N4FA 4RM9A 4G0NB 4WJPA 3AU5A 4WWPA 1WGRA 3APCA 5D94A 1P3QU 1IYFA 2EKEC 2KX3A 4GXBA 4WWOA 1V6EA 2MCNB 1WYWB 3DVNU 4KSKC 2FUHB 2KNBA 5J2RA 4MSQB 2C7NB 3B0AA 2KDFB 1LXDA 3VUXA 1OEYJ 3ZNZB 1TBEA 4DK5A 2FAZA 5IA7A 2MLBA 2FCSA 3HM3A 4XX5A 4CO7A 2V4LA 3RYTA 3QWZB 3QQ8B 1TTNA 4AOFA 2Z59B 4URKA 5D6JB 2I1JA 4G50A 2RGFA 4EZLA 2FNJB 4P7IA 2KVRA 2LVQA 2R2QA 4IUMB 2WX0A 1XD3B 2M4NA 4W9CA 4BKGA 3EC8A 4ZRKA 3L10B 2CS4A 4EUTA 5G55A 2MWSB 2BPSA 2DZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGD A;  4II3 B;  4K7S A;  2GBN A;  2A4Z A;  2LJ5 A;  3T8M A;  2D3G A;  1Z2M A;  1WGY A;  3ZRC A;  3TBL D;  1V86 A;  1WZ3 A;  1H8C A;  4AJW A;  2EMT A;  5DPT A;  3WAN A;  4FHJ A;  4IW0 A;  2BYV E;  1P0R A;  4BKS A;  3DVG Y;  3QX1 A;  3V6C B;  3DQV A;  3GZN I;  1KOT A;  1UD7 A;  1E8X A;  3ML8 A;  4DHJ D;  3M3J A;  3QC8 B;  2YLM A;  3U8Z A;  3WAM A;  4HDQ A;  3H7S A;  4ZRJ A;  2NBV B;  4OVU A;  2KMC A;  3VXW A;  2CU1 A;  3PTF C;  2AYO B;  2L0T A;  1V2Y A;  5D7G A;  2Y5B B;  3IHP C;  1J8C A;  4GDL B;  4GB9 A;  2I1K A;  3L08 A;  2CKH B;  4DWF A;  4E71 A;  4MM3 A;  4W9L A;  3TCA A;  2BKF A;  3VQI A;  4MGK E;  1E7U A;  3APD A;  4ANW A;  4GGQ A;  3ECI A;  2KJ6 A;  3NHE B;  2ZEQ A;  3L54 A;  1C1Y B;  1J19 A;  4FA6 A;  1V5O A;  4IWQ A;  4IM3 A;  2RD0 A;  3SHQ A;  3OLM D;  5AEK B;  2GOW A;  2KAN A;  3JYU A;  4F1S A;  3MJW A;  3DVG X;  3DCG A;  1WGG A;  2IYD B;  1I35 A;  4GMV A;  2NS5 A;  1WF9 A;  5AZG A;  3EEC A;  3LDZ E;  2KC1 A;  2V3S A;  4EZK A;  2CHW A;  3H1U A;  1WJN A;  4LDT D;  4RM8 A;  3A9K A;  2IZV B;  3KUD B;  2NR2 A;  3H7P B;  3OAW A;  3WAP A;  1IP9 A;  2L3Z A;  3C0R B;  1Q5W B;  3JSV A;  3A4R A;  3H6N A;  2C7M B;  4GDK B;  4WAA A;  3HK0 A;  1WX7 A;  5CHW A;  3P2B A;  1IPG A;  4NAW B;  3B1L X;  1V81 A;  2MBO A;  3KH0 A;  2C5L C;  5IAA C;  3R7Q A;  3H9D A;  3ZO5 B;  1X1M A;  4FLH A;  2O2V B;  4GN1 A;  2FCN A;  3DPD A;  2HD5 B;  2UYZ B;  3PLU A;  4RMA A;  3W1Y A;  2NPT A;  1YJ1 A;  2AEH A;  1WY8 A;  2ZCB A;  1E5W A;  4NY0 A;  4W9G A;  3VAW A;  2M17 A;  1UH6 A;  4GSW A;  2L7R A;  4FAD A;  1Z5S B;  4FJV B;  2KD0 A;  3AU4 A;  1KJT A;  4AWJ A;  2O2V A;  3ZKJ C;  1WR6 E;  1UEL A;  1WE6 A;  2LGY A;  5BO4 B;  4N9F 4;  5L83 A;  1VCB A;  2G3Q B;  2GBJ A;  3M63 B;  1WJ6 A;  4HVB A;  2IO2 B;  1PQS A;  3ZW3 A;  4GU2 A;  4BOS C;  5LXH A;  4NPN A;  4MEL A;  5TR5 A;  3TIX A;  2UWQ A;  3NZU A;  3QAQ A;  5E6P A;  4ANX A;  1ZGU B;  3GOE A;  1V5T A;  3RD2 A;  2MBB B;  4IG7 B;  5JZE B;  1NBF C;  3B08 A;  1P9D U;  4BKT A;  3AUL A;  4FJZ A;  1WMH A;  5CTR C;  3CSF A;  1WGH A;  2JT4 B;  3PS6 A;  1WM2 A;  1L2N A;  2NBW B;  2IO3 B;  2JRI B;  3PSE B;  3PVL A;  3V60 A;  2KTF A;  2KJH B;  3BIN A;  4E74 A;  1WZ0 A;  4BKS D;  2OJR A;  4EZJ A;  2DAF A;  2KQS A;  1WR1 A;  3N32 A;  4HPM B;  1NI2 A;  3OJ4 B;  1EUV B;  3MTN B;  4MH0 E;  2KDE B;  4LDT B;  3SDL C;  5EDS A;  3QA8 A;  1D3Z A;  1XT9 B;  4DDI D;  2J7Q B;  1E7V A;  2PEA A;  4JL9 A;  4TKN A;  3K9P B;  2MP2 B;  5HKH A;  1F9J A;  1SE9 A;  2L8J A;  2WX1 A;  1ZKH A;  4LJO B;  3TMP B;  2XK5 A;  2KFJ A;  2N7D A;  1P98 A;  2GMI C;  3VHT C;  4W9H A;  3KYC D;  1UBQ A;  2MW5 A;  3HM6 X;  3A9J A;  1TGZ B;  2LD9 A;  3PHW B;  4JGH B;  3ENE A;  3L13 A;  4KZ0 A;  4BVU C;  4JQW C;  3MHS D;  1TZ1 A;  2IY0 B;  2ZNV C;  5KHO A;  1OTR B;  2OOB B;  3JVZ X;  2JZ3 B;  2YVC A;  2NCN A;  4B95 A;  1YD8 U;  3EHV A;  5J18 A;  3R3M A;  3VTV A;  2M1M A;  1V9J A;  4K81 A;  4W9J A;  5CHF A;  5D2M B;  1SIF A;  4A3O A;  2HJ8 A;  2XBB C;  2EMS A;  2KO3 A;  1GC7 A;  2JY6 A;  3A1Q A;  3ZVV A;  2AWT A;  4NNJ B;  4KIK A;  4FBJ B;  2R2O A;  2KXJ A;  1E8Y A;  4G3X B;  4HPL B;  2K39 A;  1L7Y A;  3AXC A;  3ZRF A;  1ZW7 A;  4MDK E;  3O65 B;  4IWO A;  3V61 A;  2KTR A;  1EO6 A;  3ALB A;  3DBR I;  3QIJ A;  1VD2 A;  3X23 A;  5LLI A;  2JVC A;  4KVG B;  3PRZ A;  3RCZ A;  1WJ4 A;  2A5U A;  2O6V A;  3HHM A;  2PE9 A;  3QK0 A;  3CMM B;  4IM0 A;  3RZW C;  3M62 B;  4B6W A;  3IBE A;  2LVO A;  4MJS A;  1OGW A;  2XEW A;  4A3P A;  1GUA B;  2KDB A;  4ANU A;  5KHQ A;  2DEN B;  3EFU A;  3ZLZ A;  4NAW A;  4J6I A;  4CHK A;  4B9K A;  4LCD E;  4ASW C;  1WI0 A;  2KWC A;  1WFY A;  3ZNH B;  4EOY A;  2NVU I;  1M94 A;  2LRU A;  4PYU A;  2KKC A;  2KLC A;  1V80 A;  1P1A A;  4TQ0 A;  3QCA A;  5DPR A;  3RUL A;  1C3T A;  4MGI E;  1J0G A;  4KDI C;  2N9X A;  2DHZ A;  2N1W A;  4KZC A;  3KW5 B;  2IBI B;  2WDT B;  3KYD D;  2DYB A;  4PS7 A;  3UQA A;  1GJZ A;  1T0Y A;  2N9P C;  2LVP A;  2MP2 A;  4F7Z A;  2J0M A;  3IG3 A;  3NOB A;  3VVW B;  2Z0D B;  4ZDV A;  4A20 A;  2K6D B;  5J17 A;  2Z0E B;  2ZPY A;  2DYO A;  3L0W B;  1WE7 A;  2JWZ A;  3QHT A;  4DHJ B;  2LGD A;  1RFA A;  2KMA A;  1EF1 A;  2LGX A;  4I6N B;  4EKU A;  4MGY E;  2RR9 A;  2RPQ A;  1K8R B;  4WJN A;  3NS8 A;  4HLE A;  2LUE A;  4M8M A;  4JIO U;  4NQL B;  3U7D A;  2AL3 A;  2BYF A;  3V6E B;  4AP4 C;  1I42 A;  4HJK A;  2K8C A;  3PRM B;  4ZRI A;  2IO0 B;  2DZI A;  2WYQ A;  3TJP A;  4II2 B;  3WIM A;  4DBG A;  4DHZ E;  5DPS A;  2BGF A;  4HWI B;  2LI5 A;  2MBQ A;  5E6N A;  5G2N A;  5JHA A;  5CX3 A;  3UIN B;  3VTU A;  3W1S C;  2GBM A;  1WJU A;  2K8H A;  3W1S A;  4AUQ C;  2NBU A;  1WX9 A;  2JUO A;  1H4R A;  1KLV A;  3A9J B;  2CHZ A;  3A9K B;  1ISN A;  2PE6 B;  3IFW B;  2KN5 A;  3N3K B;  2BWE S;  4GIV A;  1S3S G;  4I6L B;  2PPH A;  3M95 A;  2LAS A;  4FUL A;  4TV3 A;  5C1Z A;  2KWV B;  1BT0 A;  2FCQ A;  2D07 B;  1MG8 A;  3L16 A;  3DBL I;  2MBE A;  4WQO B;  2CHX A;  3KVF B;  3SD5 A;  5L95 C;  2XK5 B;  2DZM A;  2IO1 B;  3Q3F A;  4KIK B;  3APF A;  3R7R A;  1E8Z A;  3WA0 A;  4K7W A;  2L05 A;  2KJR A;  4W9F A;  2JRH A;  5FR6 A;  5GMV A;  3H7P A;  4IM2 A;  1Q0W B;  1YIW A;  3KUC B;  2KFK A;  3QAR A;  3DBS A;  2ZNV B;  1QZE A;  5AZH A;  2LWP A;  2L00 B;  2VRR B;  3RT3 B;  1WIA A;  1UBI A;  1Y8R C;  4NJ7 A;  5C23 A;  4BBN F;  2PJH A;  3DVN V;  5LXI B;  5JHB A;  2LZ6 A;  4MGZ E;  4IWP A;  2GBK A;  3X0W A;  1WXM A;  2BKR B;  1WX8 A;  1YX5 B;  4I6P A;  4HCN B;  3S2A A;  4PS3 A;  1E90 A;  2C7H A;  3NZS A;  2ZVN A;  3PRE A;  2V1Y A;  1OQY A;  3PRP B;  4M8N A;  4CYE A;  5DPW A;  4HK2 A;  3N30 A;  4MJS B;  1R4N I;  2RSU A;  1E8W A;  4WWN A;  3KUZ A;  4KV2 A;  2K8B A;  1G6J A;  1RRB A;  1RAX A;  2BYE A;  3A4S C;  2BF8 B;  4FJY A;  4HCP B;  4K7U A;  2M0X A;  1RLF A;  2KOX A;  3PT2 B;  2J0K A;  2DAJ A;  4GOC A;  3QJZ A;  3CF6 E;  4OVV A;  2HE7 A;  2D11 A;  3A33 B;  3UF8 A;  3DBH I;  2D2Q A;  2KFK B;  2LXA A;  4E3C A;  1JRU A;  2MSE D;  4JLC A;  2N9E B;  1S1Q B;  2LXC A;  3DOW A;  2FIF A;  1A5R A;  2G4S A;  3IVF A;  1UZX B;  3Q3J A;  2G45 B;  4M0W B;  2FID A;  3TL5 A;  4EEW A;  1AAR A;  2KTR B;  2GBR A;  4MSM B;  3ZTD A;  3ML9 A;  4TUU A;  3U30 A;  1WMH B;  3I3T B;  4TQ1 A;  5AZF A;  4LJP B;  3VH3 B;  1WRD B;  4FN2 A;  1WM3 A;  2ASQ A;  2HTH A;  3ZNG C;  2J0J A;  2O6V B;  1LQB A;  3BY4 B;  4G11 A;  4IC7 B;  4DXA B;  4ICU A;  4K1R B;  2N7E A;  5E6O A;  1UGM A;  1GC6 A;  2ZZP B;  3UIP B;  3VUW A;  2G4D B;  2KC2 A;  1GNU A;  3PHX B;  1HE8 A;  2ZPN A;  4ICV A;  2MBH A;  3R66 C;  1GG3 A;  4WJQ A;  1WH3 A;  2DZK A;  1R4M I;  1YQB A;  2C9W B;  3WAL A;  3ZTC A;  4AJY B;  3K9O B;  3VTW A;  2M8S A;  3D32 A;  3ONS A;  1SGH A;  1EF5 A;  3PPA A;  3ZDT A;  2KQ7 A;  4GDL A;  3ZUN A;  1NDD A;  4DDG D;  2KDI A;  2MA9 B;  4KSL C;  3PZD A;  2KX0 A;  2ZCC A;  1FXT B;  2ZJD A;  3UIO B;  3AI5 A;  2ZVO A;  3JW0 X;  4NJ6 A;  2O6V D;  4F8C B;  2LRW A;  2FCM A;  4BFR A;  4MEM A;  3CST A;  3UQB A;  2C60 A;  3JSV B;  3DDC B;  4XC2 A;  2BWF A;  2MX2 A;  4FHK A;  2K6Q A;  1LM8 B;  2L0F A;  3OJ3 A;  1OEY A;  2D10 A;  1WXV A;  3VH4 B;  1V49 A;  1LFD A;  4W9E A;  3ZIM A;  2KWU B;  3HIZ A;  1YX6 B;  4XZ4 A;  1Q1O A;  3RZF A;  3PV1 A;  4PS8 A;  4WJO A;  2REX A;  2WWZ A;  2L76 A;  4HXD A;  2K25 A;  2MRP A;  2DX5 B;  2QHO A;  2K1F A;  4HDO A;  2JF5 A;  2MQJ A;  2W9N A;  4X57 B;  4YL8 A;  2DYM A;  5JH5 C;  2NPT B;  4DHZ B;  3VDZ A;  2JZZ A;  2KHW B;  1WXS A;  2B3A A;  2KK8 A;  1XQQ A;  5CHV C;  1U4A A;  1KM7 A;  2CR5 A;  4W9D A;  3VUY A;  4W9I A;  3ZDM C;  2JXX A;  3L17 A;  2AL6 A;  2N1V A;  3A1Q B;  4ZYN A;  3ZNI D;  3T9L A;  1CMX B;  4PYZ A;  4NQK E;  3PGE A;  3RUI B;  2KLG A;  3WAO A;  2IY1 B;  1WXA A;  4ANV A;  5DCN A;  3V62 A;  4W9K A;  3LJ3 A;  3PLV A;  4BBN C;  3SU8 X;  2KZR A;  4KDL B;  3UGB B;  3VFK A;  4GDK A;  4EFO A;  3NY5 A;  4BOZ B;  2JPH A;  2N4F A;  4RM9 A;  4G0N B;  4WJP A;  3AU5 A;  4WWP A;  1WGR A;  3APC A;  5D94 A;  1P3Q U;  1IYF A;  2EKE C;  2KX3 A;  4GXB A;  4WWO A;  1V6E A;  2MCN B;  1WYW B;  3DVN U;  4KSK C;  2FUH B;  2KNB A;  5J2R A;  4MSQ B;  2C7N B;  3B0A A;  2KDF B;  1LXD A;  3VUX A;  1OEY J;  3ZNZ B;  1TBE A;  4DK5 A;  2FAZ A;  5IA7 A;  2MLB A;  2FCS A;  3HM3 A;  4XX5 A;  4CO7 A;  2V4L A;  3RYT A;  3QWZ B;  3QQ8 B;  1TTN A;  4AOF A;  2Z59 B;  4URK A;  5D6J B;  2I1J A;  4G50 A;  2RGF A;  4EZL A;  2FNJ B;  4P7I A;  2KVR A;  2LVQ A;  2R2Q A;  4IUM B;  2WX0 A;  1XD3 B;  2M4N A;  4W9C A;  4BKG A;  3EC8 A;  4ZRK A;  3L10 B;  2CS4 A;  4EUT A;  5G55 A;  2MWS B;  2BPS A;  2DZJ A; 
#chains in the Genus database with same CATH topology
 4II3 B;  2JX5 A;  2GBN A;  2A4Z A;  1N5W A;  1Z2M A;  3ZRC A;  2WXN A;  1WZ3 A;  1J7C A;  4BZA A;  3AE7 B;  4TMA B;  5MPO A;  5DPT A;  4BKS A;  3DVG Y;  3QX1 A;  2XNA C;  3V6C B;  1KOT A;  4OZA A;  1E8X A;  3M3J A;  2NMQ A;  1KLU D;  2NBV B;  2N0S B;  3V05 A;  3PTF C;  1VLB A;  1V2Y A;  2N9K A;  3NJT A;  4MM3 A;  1Y56 A;  1JWB D;  3ECI A;  2KJ6 A;  4N59 A;  2ZEQ A;  3L54 A;  1I4G A;  2K3U A;  4IM3 A;  3SHQ A;  1FCL A;  2WXI A;  3RN9 C;  3JYU A;  3DCG A;  1DOX A;  3RNF C;  2NS5 A;  3EEC A;  3W9C B;  4XWW A;  1WJN A;  2IZV B;  3WAP A;  1SSN A;  4J3O D;  3A4R A;  3H6N A;  2WU2 B;  3I9V 1;  3ZQ4 A;  1VZ6 A;  3P2B A;  1IPG A;  2KVZ A;  2MBO A;  2BTE A;  1ZE3 D;  3H9D A;  1X1M A;  4GN1 A;  3DPD A;  2HD5 B;  1NYQ A;  3W1Y A;  2WXG A;  2QCZ A;  2L7R A;  2KD0 A;  3ZKJ C;  1UEL A;  2CJO A;  4N9F 4;  1EU3 A;  1VCB A;  2ZW1 A;  3GP7 A;  5BMI A;  2J52 A;  3ZW3 A;  4GU2 A;  4BOS C;  2KYW A;  4WIP A;  3NZU A;  5E6P A;  1ET9 A;  4WAF A;  2MBB B;  4IG7 B;  3RD2 A;  1P9D U;  3AUL A;  5CTR C;  3P4Q B;  2NBW B;  3PSE B;  1ZXH A;  2KJH B;  3BIN A;  4E74 A;  1CK1 A;  1D5X C;  1NI2 A;  2DWQ A;  3OJ4 B;  3N9Y C;  2MJE A;  1XO3 A;  3MTN B;  3SDL C;  1D3Z A;  3BVG A;  2V3P A;  5HKH A;  1C4C A;  1IBX B;  1ZKH A;  3BII D;  4LK0 M;  2MJD A;  4HPP A;  1DOI A;  2R61 A;  4ZHO A;  2MW5 A;  4USA A;  3A9J A;  2LD9 A;  3HVZ A;  4KZ0 A;  4DXG A;  3MHS D;  1TZ1 A;  2E3T A;  1KH0 A;  2RMM A;  2OOB B;  2NCN A;  1KLG D;  4XWT A;  1GOZ A;  3VTV A;  2M1M A;  2WXM A;  3PZ7 A;  4A3O A;  2XBB C;  4LTU A;  2JY6 A;  2AWT A;  2JWU A;  2R2O A;  1E8Y A;  4HPL B;  3AXC A;  3ZRF A;  3ZJT A;  4C00 A;  4MDK E;  3KQ4 A;  3O65 B;  2KTR A;  2WXR A;  3DBR I;  3P1M A;  1YN5 A;  2ICI A;  1J7B A;  1E10 A;  3TSS A;  2HDE A;  2A5U A;  2O6V A;  3QK0 A;  3U4E G;  3BZD B;  3Q8F A;  2KDB A;  5KHQ A;  1QOA A;  1NYR A;  4B9K A;  2MH7 A;  1WFY A;  4EOY A;  4PYU A;  2LRU A;  1TIF A;  2KLC A;  3U52 E;  2J42 A;  3RUL A;  5FK9 C;  1V1O A;  4KDI C;  2N9X A;  1GJZ A;  1T0Y A;  3RNA C;  2LVP A;  4F7Z A;  3IG3 A;  1IBX A;  2Z0E B;  5EE3 A;  1WE7 A;  2JWZ A;  4DHJ B;  2LGD A;  1RFA A;  2KMA A;  1EF1 A;  2Q5W D;  2RPQ A;  3PO0 A;  2LUE A;  5IN7 A;  4JIO U;  4NQL B;  1IGD A;  3U7D A;  1LO5 D;  2AL3 A;  2KWD A;  4HKQ A;  1E0Z A;  3PRM B;  3TJP A;  2WYQ A;  4DBG A;  4DHZ E;  1SF0 A;  4HWI B;  3AH7 A;  5JHA A;  3UIN B;  3W1S C;  4K3B A;  4AUQ C;  1T0S C;  1T3Q A;  2RDG A;  3A9J B;  3A9K B;  2BQQ A;  2H89 B;  1VR9 A;  2PPH A;  3M95 A;  2RDB C;  2FCQ A;  1MG8 A;  4PK1 A;  4HJG E;  1VZ7 A;  4WQO B;  5L95 C;  3MJ5 A;  2DZM A;  3Q3F A;  2NTT A;  1E8Z A;  3R7R A;  3WA0 A;  3NVZ A;  3P63 A;  1J7A A;  1Q0W B;  3KUC B;  3QAR A;  2ZNV B;  1QZE A;  1K50 A;  1UBI A;  4BBN F;  4JWS C;  2IGD A;  1CQV A;  2PJH A;  3Q2A C;  4O1N A;  3X0W A;  1WX8 A;  1ESF A;  3AEA B;  1YJJ A;  2ZVN A;  4CYE A;  3ZJU A;  1UWX A;  1HZ6 A;  4OW0 A;  1EWY C;  2RSU A;  1E8W A;  1RRB A;  1RAX A;  2ACZ B;  2BYE A;  4FJY A;  4K7U A;  2M0X A;  2KOX A;  1F77 A;  2J0K A;  4S17 A;  4GOC A;  3QJZ A;  2HE7 A;  2D2Q A;  2BVC A;  2MSE D;  4JLC A;  3J9C A;  2G4S A;  4L23 A;  3W2D A;  1L4D B;  2FID A;  3TL5 A;  4EEW A;  1WGK A;  4YSX B;  3ML9 A;  1MJD A;  3U30 A;  4MH8 A;  5AZF A;  4P1C C;  1WM3 A;  2Y3A A;  2J0J A;  3BY4 B;  1KRH A;  4PT5 A;  1XEE A;  3UIP B;  1GNU A;  3P4S B;  2ZPN A;  1HTO A;  1GG3 A;  3VR8 B;  1FD6 A;  1C9F A;  2ONQ A;  1ROE A;  2C9W B;  3WAL A;  3ZTC A;  3BYT B;  2KMM A;  4A55 A;  3VTW A;  3D32 A;  1SGH A;  3ZDT A;  2KQ7 A;  5AUI A;  2KX0 A;  2ZCC A;  1R7S A;  3H8H A;  3N1X C;  3UIO B;  2ZVO A;  3JW0 X;  2O6V D;  3FKY A;  1FFU A;  3ETR A;  2LHE A;  2IND C;  1YN4 A;  2H88 B;  1I4P A;  1WXV A;  4W9E A;  1YX6 B;  4XZ4 A;  3EGR A;  2WWZ A;  2EKI A;  1QOF A;  2K25 A;  2MRP A;  2DX5 B;  2QHO A;  2JF5 A;  4DHZ B;  1QQR A;  3C19 A;  3EFC A;  3URY A;  1FXA A;  3L17 A;  2AL6 A;  3A1Q B;  3RUI B;  2KLG A;  3WAO A;  4WQM A;  4ANV A;  5DCN A;  3GE3 C;  1E9M A;  2BB6 A;  2KZR A;  1T0Q C;  3UGB B;  4EFO A;  3AEG B;  3NY5 A;  4RM9 A;  3AU5 A;  3OWE B;  1C77 A;  3APC A;  5D94 A;  1IYF A;  1T0R C;  2INP E;  1V97 A;  3DVN U;  2KNB A;  1TKE A;  2KDF B;  1BXT A;  4A6Q A;  4ARI A;  1FPY A;  1RYJ A;  1TTN A;  4AOF A;  4URK A;  2I1J A;  5T8I A;  2R2Q A;  3RPF C;  5D3D A;  4BKG A;  1XD3 B;  2UU7 A;  4W9C A;  3EC8 A;  4YTP B;  4EUT A;  2DZJ A;  1F2R C;  4K7S A;  2OED A;  2V3N A;  1YJI A;  1TY0 A;  2WU5 B;  5EE9 A;  3TBL D;  2X38 A;  3NVW A;  1WYG A;  5IOI A;  4IW0 A;  1P0R A;  3BK1 A;  2AQ3 B;  3TUO A;  2EEL A;  3H7S A;  3R2T A;  5HFY A;  2KMC A;  2CU1 A;  2AYO B;  4TSS A;  2Y5B B;  3IHP C;  4GDL B;  3L08 A;  2HTM E;  4DWF A;  1E7U A;  4GGQ A;  1C1Y B;  2RD0 A;  2BW2 A;  4CQN A;  1KFY B;  2GOW A;  4ZOH C;  3DVG X;  1YMH E;  1WGG A;  3AMZ A;  1I35 A;  1WF9 A;  1MI0 A;  3LDZ E;  4EZK A;  2GB1 A;  3P4R B;  1RWS A;  3A9K A;  3KUD B;  2NR2 A;  4AS1 A;  5FR3 A;  5I4D A;  1Q5W B;  1ET6 A;  1MG4 A;  5CHW A;  4NAW B;  1V81 A;  2CJN A;  3KH0 A;  5IAA C;  3R7Q A;  2FCN A;  1GAQ B;  3L4P A;  1YJ1 A;  2AEH A;  2L32 A;  2MHJ A;  2ZCB A;  1PFD A;  3TEX A;  2M17 A;  1UH6 A;  3IXS A;  4FAD A;  3Q3N C;  1KJT A;  2O2V A;  2LGY A;  2G3Q B;  1TT5 B;  1AYF A;  1WJ6 A;  4HVB A;  2IO2 B;  4RGM A;  4MEL A;  5TR5 A;  2UWQ A;  1WRI A;  1ZGU B;  1V5T A;  5JZE B;  1DOY A;  3B08 A;  1WMH A;  3DWG C;  2JT4 B;  2FUG 1;  3AE1 B;  1D6E C;  3KWV A;  4K3C A;  4RNA A;  1HQR D;  3V60 A;  2KTF A;  1WZ0 A;  4EZJ A;  2DAF A;  2KQS A;  2LHD A;  2KDE B;  5EDS A;  3Q14 C;  2J7Q B;  1JAL A;  1IUE A;  1F9J A;  1SE9 A;  2WX1 A;  4L1B A;  1YQ4 B;  2KFJ A;  2N7D A;  1UBQ A;  1SJE D;  1TGZ B;  4A9A A;  3PHW B;  4JGH B;  3ENE A;  4JQW C;  4MT5 A;  2ZNV C;  5KHO A;  1YOV B;  3JVZ X;  3AEC B;  2JZ3 B;  2YVC A;  4B95 A;  1YD8 U;  4K81 A;  4W9J A;  5D2M B;  4JPS A;  2HJ8 A;  4L2Y A;  2LUM A;  2KO3 A;  4A8X C;  3ZVV A;  4XE0 A;  4FBJ B;  4WUR A;  1N60 A;  2KXJ A;  2VH2 A;  1L7Y A;  4JE3 B;  1I4X A;  2QC8 A;  4RGO S;  3WCQ A;  1E7P B;  3AM9 A;  3X23 A;  5LLI A;  3ZXR A;  1SBB B;  2VH1 A;  4YSZ B;  2PE9 A;  3CMM B;  1EU4 A;  4GLS C;  1UWM A;  3IBE A;  1OGW A;  4ANU A;  3GZN B;  1YNT E;  4DQO C;  1V1P B;  3Q3O C;  4B0M A;  4LCD E;  1C78 A;  1HTQ A;  3ZNH B;  1M94 A;  4D2K A;  2KKC A;  1L6V A;  1V80 A;  4TQ0 A;  1XLP A;  2WXQ A;  3QCA A;  1JWA D;  1C3T A;  1J0G A;  2HJ1 A;  2N1W A;  1SXT A;  2IBI B;  1UUP A;  4ZDV A;  3VVW B;  2Z0D B;  4A20 A;  1K53 A;  3L0W B;  2V9H A;  2LGX A;  4MGY E;  1BML C;  3IAM 1;  1K8R B;  4WJN A;  3AE4 B;  3MFG A;  1KF6 B;  1I42 A;  2K8C A;  4ZRI A;  2NTS A;  3WIM A;  2WHI A;  4WWM A;  5DPS A;  2M56 B;  2YEP F;  2LI5 A;  2MBQ A;  5G2N A;  5CX3 A;  3RMK C;  1WJU A;  2L52 A;  2IGG A;  1KLV A;  1H4R A;  1ISN A;  4M00 A;  1B1Z A;  4XGA B;  4FUL A;  2D07 B;  3L16 A;  2J4X A;  3LYY A;  2MBE A;  1TS3 A;  3KVF B;  1RFK A;  2XK5 B;  3EUB 2;  2IO1 B;  3APF A;  4K7W A;  2L05 A;  4W9F A;  2JRH A;  2JYT A;  3NS1 A;  3H7P A;  4NZL B;  1V1P A;  1TS5 A;  3RT3 B;  1WIA A;  5IKC M;  5C23 A;  3DVN V;  3Q69 A;  5LXI B;  5JHB A;  1JCK B;  1N5X A;  4IWP A;  2BKR B;  4HCN B;  4PS3 A;  1E90 A;  5TSS A;  3NZS A;  1HXY D;  1N63 A;  2D3C A;  2W82 A;  3KUZ A;  4WWN A;  2K8B A;  1TYG B;  2QEJ C;  2DAJ A;  1NEK B;  3A33 B;  3DBH I;  5IP4 D;  2KFK B;  2RDH A;  1FRR A;  1S1Q B;  2N9E B;  2XN9 C;  3DOW A;  3Q3J A;  4KKI A;  3GB1 A;  3ZYY X;  2BT6 A;  4RF0 A;  1F52 A;  4M0W B;  2KTR B;  2Y5P A;  3ZTD A;  5BYQ A;  1UF0 A;  4LJP B;  1VJK A;  2INC C;  4FN2 A;  2O6V B;  3ZJV A;  2N7E A;  5E6O A;  1HE8 A;  1QOB A;  3FIL B;  2DZK A;  3IT6 B;  3AED B;  2JSV X;  3PPA A;  4ZHP A;  2D3B A;  3ZUN A;  1QF6 A;  2KDI A;  2MA9 B;  3C8Y A;  3E9S A;  4NJ6 A;  3KLS X;  2B76 B;  4BFR A;  3B2G A;  4MEM A;  1MFW A;  1V8C A;  3JSV B;  4XC2 A;  2W3R A;  2K6Q A;  1LM8 B;  3E56 A;  1LFD A;  1KTK A;  2QSD A;  3RZF A;  4PS8 A;  2REX A;  2WLB A;  1TJE A;  2W9N A;  4X57 B;  5JH5 C;  2NPT B;  2KT7 A;  5HG2 A;  5CHV C;  4QAY A;  2KAJ A;  1KM7 A;  4W9D A;  1CJE A;  1SJH D;  4ZYN A;  3ZNI D;  4NQK E;  2G1E A;  2N7J A;  1WXA A;  1DYQ A;  3V62 A;  4W9K A;  2N9L A;  3PLV A;  3SU8 X;  4LNF A;  4GDK A;  5JXV A;  2JPH A;  4WJP A;  2N4F A;  4GXB A;  1L0Y B;  3TEW A;  4RGT A;  4KSK C;  1ZDX A;  1JW9 D;  3ZNZ B;  3VUX A;  1LXD A;  1K52 A;  1OEY J;  4DK5 A;  1TBE A;  4CO7 A;  3NZ3 A;  2TSS A;  1WWT A;  3RYT A;  1MVK A;  4JX1 C;  1R4N B;  1CZP A;  5C2T B;  4G50 A;  2RGF A;  2DNF A;  4P7I A;  2LVQ A;  3FIL A;  1E6E B;  2M4N A;  3RNC C;  3L10 B;  2CS4 A;  5HI1 A;  5G55 A;  2BPS A;  1I4Q A;  1WGD A;  2E6X A;  1JRO A;  2D3G A;  4OZB A;  1NVI D;  1V86 A;  4AJW A;  5IO9 A;  2EMT A;  2VZK B;  1HA5 A;  2BYV E;  1XLO A;  4H2A A;  5FKA C;  3U8Z A;  4LNO A;  4ZRJ A;  1QOG A;  3VXW A;  2WXL A;  2L0T A;  2M0A A;  5D7G A;  1J8C A;  4GB9 A;  3DHH C;  3VQI A;  3BK2 A;  3APD A;  4S0R A;  4ANW A;  3NHE B;  4EE2 A;  1J19 A;  3OLM D;  1XLQ A;  2KAN A;  4F1S A;  1MHX A;  3MJW A;  3BVM A;  2PLP A;  1PGX A;  2KC1 A;  2V3S A;  5BMH A;  4LDT D;  4RM8 A;  1ZPS A;  2L3Z A;  4AQ7 A;  4GDK B;  3AB5 A;  4WAA A;  2V4I B;  1WX7 A;  4BAX A;  1L0X B;  1C4P A;  3I57 A;  4C4V B;  2O2V B;  3PLU A;  4RH6 A;  5H92 C;  3VAW A;  1E5W A;  4W9G A;  2VZK D;  3NUH B;  1Z5S B;  4FJV B;  1TZO A;  3AE6 B;  3AE2 B;  2Z8L A;  1WE6 A;  3CIR B;  4P6V F;  3M63 B;  2GBJ A;  2LEK A;  4WH4 A;  5LXH A;  4NPN A;  2M19 A;  1NBF C;  3VRA B;  4P16 A;  4BKT A;  3MC0 B;  3PS6 A;  1P7E A;  2FBW B;  1WM2 A;  1FNV A;  2IO3 B;  3R2I A;  2WDQ B;  3GE8 C;  4C7Z A;  4BKS D;  2OJR A;  3N32 A;  5G5G A;  4HPM B;  4M0W A;  1EUV B;  3AN1 A;  4LDT B;  4DDI D;  2PEA A;  3FC4 A;  2OJW A;  4LJO B;  3TMP B;  2IDY A;  3SFE B;  1P98 A;  2GMI C;  3VHT C;  2IGH A;  3DBR B;  4W9H A;  3KYC D;  1EM7 A;  2FE8 A;  3L13 A;  4LNK A;  4BVU C;  1FNW A;  2QMT A;  4LLG M;  1N61 A;  2WXJ A;  2BYT A;  5J18 A;  2OHF A;  1V9J A;  5EE0 A;  1GC7 A;  1FO4 A;  4G3X B;  2K39 A;  1TKG A;  1PGB A;  2I2Y A;  4HKZ E;  1EO6 A;  3ALB A;  1OQQ A;  1VD2 A;  3QIJ A;  2JVC A;  4KVG B;  1TS2 A;  1WJ4 A;  4ITK A;  4IM0 A;  4M02 A;  3M62 B;  3TEZ A;  1GUA B;  2DEN B;  3ZLZ A;  3CWI A;  4J6I A;  4CHK A;  4LNI A;  4P1B C;  2KWC A;  2NVU I;  3V3X A;  2X8X X;  3SEB A;  1P1A A;  3B2F A;  1PYW D;  2DHZ A;  3UQA A;  3KYD D;  2N9P C;  2J0M A;  3NOB A;  3T3O A;  5J17 A;  2K6D B;  2SEB D;  1SE3 A;  2K5P A;  4I6N B;  4EKU A;  2RR9 A;  3NS8 A;  1GB4 A;  4HLE A;  4M8M A;  2PVO D;  5LNK 1;  2IJ0 A;  4HJK A;  2DZI A;  1F1H A;  4II2 B;  1SB3 C;  2GLS A;  1YN3 A;  2CU3 A;  5E6N A;  1GPX A;  2GBM A;  3O13 A;  4RCO A;  2K9X A;  2MEK A;  4M01 A;  2NBU A;  1WX9 A;  2WXP A;  2JUO A;  3NVV A;  3IFW B;  3N3K B;  2BWE S;  1S3S G;  1TS4 A;  1FRD A;  2KN4 A;  1EWC A;  1BT0 A;  3IT4 B;  3RFZ B;  5G5H A;  2CHX A;  1SEB D;  5FR6 A;  1Q10 A;  3LXF A;  1YIW A;  2W55 A;  2G9H D;  2KFK A;  1XF5 L;  2L00 B;  4NJC A;  2VRR B;  1ZP0 B;  1XCT L;  3PZ8 A;  2K22 A;  2KQ4 X;  2LZ6 A;  4MGZ E;  2GBK A;  3AE9 B;  3S2A A;  4ARC A;  1VDV A;  2C7H A;  5DPW A;  2V1Y A;  1OQY A;  4HK2 A;  3N30 A;  1SE4 A;  4RGN A;  4KV2 A;  3MC9 A;  2QIE B;  1G6J A;  3DBL B;  3A4S C;  1ZXI A;  2BF8 B;  1FMA D;  1RLF A;  2W54 A;  1C76 A;  3U2S C;  2BS4 B;  3CF6 E;  3UF8 A;  4E3C A;  2WXF A;  1I7H A;  1D4B A;  3IVF A;  2ZW0 A;  1I4R A;  3BWU D;  1QIL A;  2GBR A;  4TUU A;  3I3T B;  5BMG A;  2BS3 B;  3ZNG C;  4G11 A;  1MPE A;  4ICU A;  1UGM A;  1GC6 A;  3Q8A A;  3TEY A;  3VUW A;  2MBH A;  3R8B A;  3R66 C;  1R4M I;  1YQB A;  1NEN B;  1IGC A;  3K9O B;  2M8S A;  5D3I B;  1EF5 A;  4XDD A;  4GDL A;  4DDG D;  1D5Z C;  4KSL C;  3PZD A;  3DHG C;  4REZ A;  1FXT B;  2ZJD A;  3AI5 A;  4F8C B;  2LRW A;  1UNS A;  2FCM A;  5HHD G;  3VRB B;  3CST A;  3UQB A;  3EA6 A;  3NG0 A;  2WQY B;  3DDC B;  2BWF A;  2MX2 A;  2L0F A;  3OJ3 A;  1OEY A;  2D10 A;  2LGS A;  1V49 A;  3Q8E A;  3HIZ A;  1Q1O A;  3PV1 A;  2L76 A;  3BVZ A;  4HXD A;  3HVD A;  4YL8 A;  2MQJ A;  1LGR A;  2DYM A;  2WDR B;  3VDZ A;  2JZZ A;  2KHW B;  2KK8 A;  3AEE B;  1WSP A;  1XQQ A;  1P7F A;  1U4A A;  1RM6 C;  5H8Y E;  4YWG G;  4PYZ A;  2IY1 B;  1VZ8 A;  3IAS 1;  3N1Z C;  4KDL B;  3DWM A;  3U7Z A;  3VFK A;  3KWL A;  4G0N B;  4WWP A;  1WGR A;  4DXF A;  4ZYS A;  3VR9 B;  1V6E A;  2MCN B;  4HRS A;  2FUH B;  5J2R A;  4MSQ B;  2C7N B;  3BYY B;  3B0A A;  5IA7 A;  2FAZ A;  3HM3 A;  2V4L A;  2WNM A;  3QWZ B;  3QQ8 B;  5D6J B;  3DBH B;  3MC8 A;  3SR6 A;  4ZRK A;  2MWS B;  1UZX B;  4IOI E;  2LJ5 A;  3T8M A;  4ZRQ A;  1WGY A;  1F0Z A;  4ZRP A;  4FXC A;  3DHI C;  1H8C A;  1XLN A;  3WAN A;  1F2R I;  3FAH A;  4FHJ A;  3Q3M C;  3DQV A;  3P42 A;  3GZN I;  1UD7 A;  3ML8 A;  4DHJ D;  3QC8 B;  4OZC A;  2YLM A;  3WAM A;  4HDQ A;  1PGA A;  2LGI A;  5GXG B;  4OVU A;  1FNU A;  1K51 A;  2WP9 B;  3AEF B;  1JWU D;  2I1K A;  5BYR A;  2CKH B;  4E71 A;  4W9L A;  3TCA A;  2BKF A;  2D5G A;  3B9J A;  3MP9 A;  4MGK E;  4C56 C;  4FA6 A;  5BYS A;  1V5O A;  4IWQ A;  4KKJ A;  5AEK B;  1AN8 A;  3ZXV A;  1FFV A;  1JQ4 A;  2IYD B;  4GMV A;  1FM0 D;  5AZG A;  2CHW A;  3H1U A;  3HUI A;  3H7P B;  3OAW A;  4RFB A;  1IP9 A;  3C0R B;  3N1Y C;  2INN E;  2PVG C;  3JSV A;  2JYE A;  4IDI A;  1XXG A;  2C7M B;  2W3S A;  3HK0 A;  2V0G A;  4HEA 1;  3B1L X;  1DGJ A;  3GS2 A;  2C5L C;  4KGR A;  3ZO5 B;  4FLH A;  2WGS A;  1ZUD 2;  2UYZ B;  4RMA A;  1C4A A;  2NPT A;  1WY8 A;  4NY0 A;  4GSW A;  4KX6 B;  3AU4 A;  4AWJ A;  1ENF A;  1WR6 E;  5BO4 B;  3Q8C A;  5L83 A;  3I5J C;  1PDX A;  1PUT A;  1PQS A;  2YEP B;  3TIX A;  2MJ3 A;  1QLB B;  3QAQ A;  4ANX A;  3GOE A;  1BUI C;  2BS2 B;  4FJZ A;  1N6Z A;  4B0E A;  3CSF A;  1WGH A;  1L2N A;  3NVY A;  4C7Y A;  2JRI B;  1T6B X;  3PVL A;  1C79 A;  1T5X D;  2L1A A;  1WR1 A;  3AE8 B;  4YTM B;  1OQR A;  4MH0 E;  2LMC A;  3QA8 A;  1XT9 B;  1E7V A;  4JL9 A;  4TKN A;  1ACC A;  2MP2 B;  3K9P B;  3NRZ A;  2L8J A;  1I4H A;  2WDV B;  4N6E B;  2XK5 A;  1D5M C;  3HM6 X;  1TKY A;  2K0P A;  2PMV A;  4XDC A;  2IY0 B;  1OTR B;  3RNG C;  3EHV A;  3R3M A;  5CHF A;  1SIF A;  3SFD B;  1L6U A;  2EMS A;  3A1Q A;  4OHJ A;  4NNJ B;  4KIK A;  4RF1 A;  1HZ5 A;  2I38 A;  4KGS A;  4C80 A;  1ZW7 A;  3V61 A;  4IWO A;  5AUK A;  1AWD A;  3PRZ A;  3RCZ A;  3HHM A;  3RZW C;  4B6W A;  2LVO A;  1UGJ A;  4MJS A;  2XEW A;  4A3P A;  3EFU A;  3I63 C;  4NAW A;  1GB1 A;  4ASW C;  1WI0 A;  5DPR A;  4MGI E;  4XYC A;  1R4M B;  4R3D A;  1AW7 A;  3KW5 B;  2WDT B;  4KZC A;  4PS7 A;  2DYB A;  4UDU C;  1FEH A;  3ZGZ A;  2MP2 A;  2BB5 A;  2ZPY A;  2DYO A;  3QHT A;  1QKZ A;  4C4V A;  4MM3 B;  1M4V A;  3HRD D;  1VRA B;  2JZP A;  2DLB A;  4IKG A;  1NI3 A;  2BYF A;  3V6E B;  4AP4 C;  3W5U B;  2IO0 B;  3RNB C;  2BGF A;  4KGT A;  3VTU A;  1XCQ L;  2GI9 A;  2K8H A;  3W1S A;  1TY2 A;  2CHZ A;  2PE6 B;  1ZOY B;  2KN5 A;  4GIV A;  2JXT A;  4I6L B;  4HRO A;  2LAS A;  4TV3 A;  5C1Z A;  2KWV B;  4N58 A;  3DBL I;  2J53 A;  3OG5 A;  2WXK A;  3SD5 A;  4A90 A;  3LB8 C;  1L0V B;  4KIK B;  2KJR A;  2PTL A;  4Q2J A;  5GMV A;  2AQ1 B;  4IM2 A;  3DBS A;  5AZH A;  2LWP A;  4NJ7 A;  1Y8R C;  5EE1 A;  1L5P A;  5E6J A;  4ACF A;  2SAK A;  1WXQ A;  1WXM A;  1YX5 B;  4I6P A;  3Q6B A;  2PIA A;  3Q8B A;  3PRE A;  3PRP B;  4M8N A;  4MJS B;  1R4N I;  2LJI A;  2DBY A;  1STE A;  4HCP B;  3PT2 B;  1JWS D;  4OVV A;  2D11 A;  3N20 C;  2LXA A;  1JRU A;  2RPV A;  2LXC A;  4JWU C;  2FIF A;  1A5R A;  1SE2 A;  2G45 B;  2ON8 A;  2AX5 A;  1AAR A;  2JU6 X;  4MSM B;  1ZDV A;  1WMH B;  1JML A;  4TQ1 A;  3VH3 B;  1WRD B;  2PKO A;  4MAC A;  2ASQ A;  2HTH A;  1OFF A;  2GRI A;  1LQB A;  4IC7 B;  3AE5 B;  4DXA B;  2KDM A;  4K1R B;  3P4P B;  4YXD B;  2ZZP B;  1FCC C;  2G4D B;  2KC2 A;  2QIL A;  3W5V B;  4ICV A;  1JRP A;  3PHX B;  2IPK D;  4OVZ A;  4WJQ A;  2QDF A;  1WH3 A;  2WXO A;  4AJY B;  1MHH E;  2WXH A;  3ABV B;  3AE3 B;  3ONS A;  2WS3 B;  3T3N A;  1NDD A;  3RI7 C;  2C60 A;  2LFI A;  4FHK A;  1JWM D;  1YQ3 B;  4YT0 B;  3VH4 B;  3ZIM A;  2KWU B;  4WJO A;  2Y5C A;  2QJL A;  3RNE C;  1HEZ E;  1L4Z B;  4HDO A;  2K1F A;  1FXI A;  4NAM A;  1WXS A;  2B3A A;  4US9 A;  2BBC A;  1FIQ A;  1SIJ A;  2L83 A;  2CR5 A;  3VUY A;  4W9I A;  3ZDM C;  2JXX A;  2KAC A;  2N1V A;  4US8 A;  3T9L A;  1CMX B;  3PGE A;  2AQ2 B;  3LJ3 A;  4BBN C;  3UI3 A;  5C3J B;  4LNN A;  4BOZ B;  1QT9 A;  2D3A A;  1P3Q U;  2EKE C;  2KX3 A;  3MHZ A;  4WWO A;  4YSY B;  1WYW B;  1B9R A;  3AEB B;  3AV8 A;  2JQR B;  1N62 A;  1A70 A;  2PW9 A;  2MLB A;  2FCS A;  4XX5 A;  2Z59 B;  4EZL A;  2FNJ B;  2KVR A;  4IUM B;  2WX0 A;  4YTN B; 
#chains in the Genus database with same CATH homology
 1WGD A;  4II3 B;  4K7S A;  2GBN A;  2A4Z A;  2LJ5 A;  3T8M A;  2D3G A;  1Z2M A;  1WGY A;  3ZRC A;  3TBL D;  1V86 A;  1WZ3 A;  1H8C A;  4AJW A;  2EMT A;  5DPT A;  3WAN A;  4FHJ A;  4IW0 A;  2BYV E;  1P0R A;  4BKS A;  3DVG Y;  3QX1 A;  3V6C B;  3DQV A;  3GZN I;  1KOT A;  1UD7 A;  1E8X A;  3ML8 A;  4DHJ D;  3M3J A;  3QC8 B;  2YLM A;  3U8Z A;  3WAM A;  4HDQ A;  3H7S A;  4ZRJ A;  2NBV B;  4OVU A;  2KMC A;  3VXW A;  2CU1 A;  3PTF C;  2AYO B;  2L0T A;  1V2Y A;  5D7G A;  2Y5B B;  3IHP C;  1J8C A;  4GDL B;  4GB9 A;  2I1K A;  3L08 A;  2CKH B;  4DWF A;  4E71 A;  4MM3 A;  4W9L A;  3TCA A;  2BKF A;  3VQI A;  4MGK E;  1E7U A;  3APD A;  4ANW A;  4GGQ A;  3ECI A;  2KJ6 A;  3NHE B;  2ZEQ A;  3L54 A;  1C1Y B;  1J19 A;  4FA6 A;  1V5O A;  4IWQ A;  4IM3 A;  2RD0 A;  3SHQ A;  3OLM D;  5AEK B;  2GOW A;  2KAN A;  3JYU A;  4F1S A;  3MJW A;  3DVG X;  3DCG A;  1WGG A;  2IYD B;  1I35 A;  4GMV A;  2NS5 A;  1WF9 A;  5AZG A;  3EEC A;  3LDZ E;  2KC1 A;  2V3S A;  4EZK A;  2CHW A;  3H1U A;  1WJN A;  4LDT D;  4RM8 A;  3A9K A;  2IZV B;  3KUD B;  2NR2 A;  3H7P B;  3OAW A;  3WAP A;  1IP9 A;  2L3Z A;  3C0R B;  1Q5W B;  3JSV A;  3A4R A;  3H6N A;  2C7M B;  4GDK B;  4WAA A;  3HK0 A;  1WX7 A;  5CHW A;  3P2B A;  1IPG A;  4NAW B;  3B1L X;  1V81 A;  2MBO A;  3KH0 A;  2C5L C;  5IAA C;  3R7Q A;  3H9D A;  3ZO5 B;  1X1M A;  4FLH A;  2O2V B;  4GN1 A;  2FCN A;  3DPD A;  2HD5 B;  2UYZ B;  3PLU A;  4RMA A;  3W1Y A;  2NPT A;  1YJ1 A;  2AEH A;  1WY8 A;  2ZCB A;  1E5W A;  4NY0 A;  4W9G A;  3VAW A;  2M17 A;  1UH6 A;  4GSW A;  2L7R A;  4FAD A;  1Z5S B;  4FJV B;  2KD0 A;  3AU4 A;  1KJT A;  4AWJ A;  2O2V A;  3ZKJ C;  1WR6 E;  1UEL A;  1WE6 A;  2LGY A;  5BO4 B;  4N9F 4;  5L83 A;  1VCB A;  2G3Q B;  2GBJ A;  3M63 B;  1WJ6 A;  4HVB A;  2IO2 B;  1PQS A;  3ZW3 A;  4GU2 A;  4BOS C;  5LXH A;  4NPN A;  4MEL A;  5TR5 A;  3TIX A;  2UWQ A;  3NZU A;  3QAQ A;  5E6P A;  4ANX A;  1ZGU B;  3GOE A;  1V5T A;  3RD2 A;  2MBB B;  4IG7 B;  5JZE B;  1NBF C;  3B08 A;  1P9D U;  4BKT A;  3AUL A;  4FJZ A;  1WMH A;  5CTR C;  3CSF A;  1WGH A;  2JT4 B;  3PS6 A;  1WM2 A;  1L2N A;  2NBW B;  2IO3 B;  2JRI B;  3PSE B;  3PVL A;  3V60 A;  2KTF A;  2KJH B;  3BIN A;  4E74 A;  1WZ0 A;  4BKS D;  2OJR A;  4EZJ A;  2DAF A;  2KQS A;  1WR1 A;  3N32 A;  4HPM B;  1NI2 A;  3OJ4 B;  1EUV B;  3MTN B;  4MH0 E;  2KDE B;  4LDT B;  3SDL C;  5EDS A;  3QA8 A;  1D3Z A;  1XT9 B;  4DDI D;  2J7Q B;  1E7V A;  2PEA A;  4JL9 A;  4TKN A;  3K9P B;  2MP2 B;  5HKH A;  1F9J A;  1SE9 A;  2L8J A;  2WX1 A;  1ZKH A;  4LJO B;  3TMP B;  2XK5 A;  2KFJ A;  2N7D A;  1P98 A;  2GMI C;  3VHT C;  4W9H A;  3KYC D;  1UBQ A;  2MW5 A;  3HM6 X;  3A9J A;  1TGZ B;  2LD9 A;  3PHW B;  4JGH B;  3ENE A;  3L13 A;  4KZ0 A;  4BVU C;  4JQW C;  3MHS D;  1TZ1 A;  2IY0 B;  2ZNV C;  5KHO A;  1OTR B;  2OOB B;  3JVZ X;  2JZ3 B;  2YVC A;  2NCN A;  4B95 A;  1YD8 U;  3EHV A;  5J18 A;  3R3M A;  3VTV A;  2M1M A;  1V9J A;  4K81 A;  4W9J A;  5CHF A;  5D2M B;  1SIF A;  4A3O A;  2HJ8 A;  2XBB C;  2EMS A;  2KO3 A;  1GC7 A;  2JY6 A;  3A1Q A;  3ZVV A;  2AWT A;  4NNJ B;  4KIK A;  4FBJ B;  2R2O A;  2KXJ A;  1E8Y A;  4G3X B;  4HPL B;  2K39 A;  1L7Y A;  3AXC A;  3ZRF A;  1ZW7 A;  4MDK E;  3O65 B;  4IWO A;  3V61 A;  2KTR A;  1EO6 A;  3ALB A;  3DBR I;  3QIJ A;  1VD2 A;  3X23 A;  5LLI A;  2JVC A;  4KVG B;  3PRZ A;  3RCZ A;  1WJ4 A;  2A5U A;  2O6V A;  3HHM A;  2PE9 A;  3QK0 A;  3CMM B;  4IM0 A;  3RZW C;  3M62 B;  4B6W A;  3IBE A;  2LVO A;  4MJS A;  1OGW A;  2XEW A;  4A3P A;  1GUA B;  2KDB A;  4ANU A;  5KHQ A;  2DEN B;  3EFU A;  3ZLZ A;  4NAW A;  4J6I A;  4CHK A;  4B9K A;  4LCD E;  4ASW C;  1WI0 A;  2KWC A;  1WFY A;  3ZNH B;  4EOY A;  2NVU I;  1M94 A;  2LRU A;  4PYU A;  2KKC A;  2KLC A;  1V80 A;  1P1A A;  4TQ0 A;  3QCA A;  5DPR A;  3RUL A;  1C3T A;  4MGI E;  1J0G A;  4KDI C;  2N9X A;  2DHZ A;  2N1W A;  4KZC A;  3KW5 B;  2IBI B;  2WDT B;  3KYD D;  2DYB A;  4PS7 A;  3UQA A;  1GJZ A;  1T0Y A;  2N9P C;  2LVP A;  2MP2 A;  4F7Z A;  2J0M A;  3IG3 A;  3NOB A;  3VVW B;  2Z0D B;  4ZDV A;  4A20 A;  2K6D B;  5J17 A;  2Z0E B;  2ZPY A;  2DYO A;  3L0W B;  1WE7 A;  2JWZ A;  3QHT A;  4DHJ B;  2LGD A;  1RFA A;  2KMA A;  1EF1 A;  2LGX A;  4I6N B;  4EKU A;  4MGY E;  2RR9 A;  2RPQ A;  1K8R B;  4WJN A;  3NS8 A;  4HLE A;  2LUE A;  4M8M A;  4JIO U;  4NQL B;  3U7D A;  2AL3 A;  2BYF A;  3V6E B;  4AP4 C;  1I42 A;  4HJK A;  2K8C A;  3PRM B;  4ZRI A;  2IO0 B;  2DZI A;  2WYQ A;  3TJP A;  4II2 B;  3WIM A;  4DBG A;  4DHZ E;  5DPS A;  2BGF A;  4HWI B;  2LI5 A;  2MBQ A;  5E6N A;  5G2N A;  5JHA A;  5CX3 A;  3UIN B;  3VTU A;  3W1S C;  2GBM A;  1WJU A;  2K8H A;  3W1S A;  4AUQ C;  2NBU A;  1WX9 A;  2JUO A;  1H4R A;  1KLV A;  3A9J B;  2CHZ A;  3A9K B;  1ISN A;  2PE6 B;  3IFW B;  2KN5 A;  3N3K B;  2BWE S;  4GIV A;  1S3S G;  4I6L B;  2PPH A;  3M95 A;  2LAS A;  4FUL A;  4TV3 A;  5C1Z A;  2KWV B;  1BT0 A;  2FCQ A;  2D07 B;  1MG8 A;  3L16 A;  3DBL I;  2MBE A;  4WQO B;  2CHX A;  3KVF B;  3SD5 A;  5L95 C;  2XK5 B;  2DZM A;  2IO1 B;  3Q3F A;  4KIK B;  3APF A;  3R7R A;  1E8Z A;  3WA0 A;  4K7W A;  2L05 A;  2KJR A;  4W9F A;  2JRH A;  5FR6 A;  5GMV A;  3H7P A;  4IM2 A;  1Q0W B;  1YIW A;  3KUC B;  2KFK A;  3QAR A;  3DBS A;  2ZNV B;  1QZE A;  5AZH A;  2LWP A;  2L00 B;  2VRR B;  3RT3 B;  1WIA A;  1UBI A;  1Y8R C;  4NJ7 A;  5C23 A;  4BBN F;  2PJH A;  3DVN V;  5LXI B;  5JHB A;  2LZ6 A;  4MGZ E;  4IWP A;  2GBK A;  3X0W A;  1WXM A;  2BKR B;  1WX8 A;  1YX5 B;  4I6P A;  4HCN B;  3S2A A;  4PS3 A;  1E90 A;  2C7H A;  3NZS A;  2ZVN A;  3PRE A;  2V1Y A;  1OQY A;  3PRP B;  4M8N A;  4CYE A;  5DPW A;  4HK2 A;  3N30 A;  4MJS B;  1R4N I;  2RSU A;  1E8W A;  4WWN A;  3KUZ A;  4KV2 A;  2K8B A;  1G6J A;  1RRB A;  1RAX A;  2BYE A;  3A4S C;  2BF8 B;  4FJY A;  4HCP B;  4K7U A;  2M0X A;  1RLF A;  2KOX A;  3PT2 B;  2J0K A;  2DAJ A;  4GOC A;  3QJZ A;  3CF6 E;  4OVV A;  2HE7 A;  2D11 A;  3A33 B;  3UF8 A;  3DBH I;  2D2Q A;  2KFK B;  2LXA A;  4E3C A;  1JRU A;  2MSE D;  4JLC A;  2N9E B;  1S1Q B;  2LXC A;  3DOW A;  2FIF A;  1A5R A;  2G4S A;  3IVF A;  1UZX B;  3Q3J A;  2G45 B;  4M0W B;  2FID A;  3TL5 A;  4EEW A;  1AAR A;  2KTR B;  2GBR A;  4MSM B;  3ZTD A;  3ML9 A;  4TUU A;  3U30 A;  1WMH B;  3I3T B;  4TQ1 A;  5AZF A;  4LJP B;  3VH3 B;  1WRD B;  4FN2 A;  1WM3 A;  2ASQ A;  2HTH A;  3ZNG C;  2J0J A;  2O6V B;  1LQB A;  3BY4 B;  4G11 A;  4IC7 B;  4DXA B;  4ICU A;  4K1R B;  2N7E A;  5E6O A;  1UGM A;  1GC6 A;  2ZZP B;  3UIP B;  3VUW A;  2G4D B;  2KC2 A;  1GNU A;  3PHX B;  1HE8 A;  2ZPN A;  4ICV A;  2MBH A;  3R66 C;  1GG3 A;  4WJQ A;  1WH3 A;  2DZK A;  1R4M I;  1YQB A;  2C9W B;  3WAL A;  3ZTC A;  4AJY B;  3K9O B;  3VTW A;  2M8S A;  3D32 A;  3ONS A;  1SGH A;  1EF5 A;  3PPA A;  3ZDT A;  2KQ7 A;  4GDL A;  3ZUN A;  1NDD A;  4DDG D;  2KDI A;  2MA9 B;  4KSL C;  3PZD A;  2KX0 A;  2ZCC A;  1FXT B;  2ZJD A;  3UIO B;  3AI5 A;  2ZVO A;  3JW0 X;  4NJ6 A;  2O6V D;  4F8C B;  2LRW A;  2FCM A;  4BFR A;  4MEM A;  3CST A;  3UQB A;  2C60 A;  3JSV B;  3DDC B;  4XC2 A;  2BWF A;  2MX2 A;  4FHK A;  2K6Q A;  1LM8 B;  2L0F A;  3OJ3 A;  1OEY A;  2D10 A;  1WXV A;  3VH4 B;  1V49 A;  1LFD A;  4W9E A;  3ZIM A;  2KWU B;  3HIZ A;  1YX6 B;  4XZ4 A;  1Q1O A;  3RZF A;  3PV1 A;  4PS8 A;  4WJO A;  2REX A;  2WWZ A;  2L76 A;  4HXD A;  2K25 A;  2MRP A;  2DX5 B;  2QHO A;  2K1F A;  4HDO A;  2JF5 A;  2MQJ A;  2W9N A;  4X57 B;  4YL8 A;  2DYM A;  5JH5 C;  2NPT B;  4DHZ B;  3VDZ A;  2JZZ A;  2KHW B;  1WXS A;  2B3A A;  2KK8 A;  1XQQ A;  5CHV C;  1U4A A;  1KM7 A;  2CR5 A;  4W9D A;  3VUY A;  4W9I A;  3ZDM C;  2JXX A;  3L17 A;  2AL6 A;  2N1V A;  3A1Q B;  4ZYN A;  3ZNI D;  3T9L A;  1CMX B;  4PYZ A;  4NQK E;  3PGE A;  3RUI B;  2KLG A;  3WAO A;  2IY1 B;  1WXA A;  4ANV A;  5DCN A;  3V62 A;  4W9K A;  3LJ3 A;  3PLV A;  4BBN C;  3SU8 X;  2KZR A;  4KDL B;  3UGB B;  3VFK A;  4GDK A;  4EFO A;  3NY5 A;  4BOZ B;  2JPH A;  2N4F A;  4RM9 A;  4G0N B;  4WJP A;  3AU5 A;  4WWP A;  1WGR A;  3APC A;  5D94 A;  1P3Q U;  1IYF A;  2EKE C;  2KX3 A;  4GXB A;  4WWO A;  1V6E A;  2MCN B;  1WYW B;  3DVN U;  4KSK C;  2FUH B;  2KNB A;  5J2R A;  4MSQ B;  2C7N B;  3B0A A;  2KDF B;  1LXD A;  3VUX A;  1OEY J;  3ZNZ B;  1TBE A;  4DK5 A;  2FAZ A;  5IA7 A;  2MLB A;  2FCS A;  3HM3 A;  4XX5 A;  4CO7 A;  2V4L A;  3RYT A;  3QWZ B;  3QQ8 B;  1TTN A;  4AOF A;  2Z59 B;  4URK A;  5D6J B;  2I1J A;  4G50 A;  2RGF A;  4EZL A;  2FNJ B;  4P7I A;  2KVR A;  2LVQ A;  2R2Q A;  4IUM B;  2WX0 A;  1XD3 B;  2M4N A;  4W9C A;  4BKG A;  3EC8 A;  4ZRK A;  3L10 B;  2CS4 A;  4EUT A;  5G55 A;  2MWS B;  2BPS A;  2DZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...