5LXHA

Gabarap-l1 atg4b lir complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lxhA00
1LXDA 2BF8B 3R7QA 2CHXA 1YJ1A 4II3B 4IM2A 2MBBB 3ZDMC 2KVRA 3AU4A 4K81A 3V6CB 2DAJA 4FBJB 1WXVA 2LXCA 4M8NA 3WAPA 3ZVVA 1WIAA 3NZSA 1WFYA 2PJHA 1CMXB 2PE6B 5AZFA 3VUYA 4AJWA 1WX7A 2MX2A 4MJSB 4FA6A 1YIWA 3EC8A 4X57B 4PS8A 4B6WA 4NPNA 2PPHA 4URKA 4RM9A 1Y8RC 3SU8X 2L0TA 2LXAA 1P98A 2KDEB 3PRPB 4ZRIA 2BYEA 4DHZB 3EFUA 3UIPB 4GSWA 4IW0A 5BO4B 4FHJA 2K25A 3T8MA 2KX0A 5LLIA 3PLVA 2FAZA 2JPHA 1UH6A 2KJHB 2M1MA 3BINA 3HM6X 4KZ0A 4KIKA 2K8HA 2KANA 2MLBA 5LXHA 2JY6A 4M0WB 2ZNVB 3ZUNA 1E90A 3PZDA 4G3XB 4K7UA 2LGXA 2MW5A 1IYFA 3U30A 2ZZPB 4GMVA 2LI5A 2Z0DB 3ML9A 4DBGA 2MP2A 2HJ8A 3KUDB 3PT2B 1TBEA 2D07B 1UZXB 3D32A 3TBLD 2C7MB 2BWES 1P3QU 2FIFA 1J19A 5DPSA 4WJPA 2L0FA 1GC6A 5EDSA 2C60A 4BBNF 3DQVA 4MEMA 3DVNV 2IY0B 2N7EA 3A1QA 3QAQA 5L95C 4W9IA 3PREA 2FCNA 2D2QA 4AOFA 1G6JA 3OAWA 3WANA 2A5UA 4XZ4A 4TKNA 3VUWA 1IP9A 2O6VB 3L0WB 2IYDB 3L13A 2N1VA 1WH3A 2V4LA 3SHQA 4EFOA 1IPGA 1R4NI 4HLEA 3W1SC 2EMTA 2J0MA 3LJ3A 3VHTC 2KTRA 2IO3B 2MBOA 3JSVB 3NHEB 2CHZA 1GNUA 3OLMD 2M17A 3L10B 3OJ3A 4WJNA 1KLVA 2ZNVC 4GN1A 3TJPA 4JQWC 3VH4B 5E6NA 1WM3A 2DZKA 2HTHA 3SDLC 3ZW3A 4BKSA 1P1AA 1TGZB 3WAOA 2FIDA 1OEYJ 2J0JA 3W1YA 3KW5B 3NS8A 5CTRC 1SGHA 4NY0A 4IUMB 3DCGA 2RGFA 2CHWA 2HE7A 2KFJA 3Q3JA 3WALA 3IHPC 5CHWA 2Y5BB 3KYDD 2LVPA 4ZYNA 3L17A 4OVVA 3QIJA 1UBIA 4EUTA 1UGMA 4ICUA 3R66C 2AEHA 1E8YA 4KSKC 4FLHA 2Z0EB 3X0WA 2YVCA 3S2AA 4NJ7A 4JIOU 2N1WA 3AXCA 3PPAA 3ZIMA 1J0GA 1J8CA 5L83A 3APFA 1E8ZA 1KJTA 4HK2A 1WJ6A 2LWPA 2MP2B 1NI2A 3PGEA 2G4DB 3RYTA 2KFKA 4II2B 4NQLB 1WGGA 1LFDA 2KN5A 2K8BA 2KQ7A 2KJRA 3EECA 2B3AA 2LUEA 1Q1OA 2WX1A 4FJVB 4W9DA 2M4NA 2DYMA 2VRRB 4KDLB 1U4AA 2NBUA 3M95A 3L16A 2BWFA 3ALBA 1K8RB 3ZLZA 1XQQA 3UF8A 4B95A 3Q3FA 3UIOB 4BKTA 2V1YA 1V5TA 2N7DA 2M8SA 2L05A 1X1MA 4BOZB 3V6EB 2XBBC 1WJNA 2OJRA 3JSVA 3WIMA 4FADA 3RZFA 2CS4A 3H7SA 3QJZA 4W9FA 5GMVA 2KTRB 2GBKA 1PQSA 1EF5A 2AL6A 2IZVB 2K39A 2UYZB 4F7ZA 2AL3A 3H6NA 1VD2A 5D7GA 3ZTCA 2I1KA 3RD2A 1Q5WB 4J6IA 1XT9B 2MWSB 1GC7A 2MBHA 2GBMA 4IM3A 2KWVB 5E6OA 2DYOA 3TMPB 3TIXA 2L3ZA 5AZHA 3HM3A 2ZVOA 5IAAC 3APDA 3UINB 3VXWA 1I42A 2N9XA 3UQBA 2DENB 3UGBB 4HWIB 3EHVA 1WE6A 4GGQA 3A4RA 3MHSD 3N32A 1WX9A 4HPLB 3AI5A 4DDGD 2NBVB 3ZNHB 3ZNID 1EUVB 2Z59B 3U8ZA 2G45B 3DDCB 4ANVA 1EO6A 5JH5C 1I35A 1P0RA 4W9JA 1RLFA 3CMMB 3ZRCA 1H8CA 1WMHB 2D10A 4FHKA 2HD5B 4I6PA 4WWNA 3JW0X 4AWJA 2LZ6A 1WGDA 3NY5A 4WAAA 1YX5B 2IO2B 2IY1B 1C3TA 2ASQA 2KDBA 3PRMB 1KOTA 5KHQA 1WM2A 4KVGB 3M63B 3I3TB 2RPQA 4CHKA 4BKSD 2KFKB 2O2VA 3N3KB 3B0AA 3PS6A 2JRHA 3IBEA 3ONSA 3VH3B 2GBRA 3KH0A 4FN2A 4IM0A 3JYUA 2G3QB 4W9KA 4I6LB 4DHJB 2XEWA 1WGHA 1T0YA 1V49A 4IWOA 2KXJA 3ZNZB 4HPMB 1WJUA 2MQJA 2RSUA 4HCPB 1TZ1A 3KVFB 1WE7A 4GIVA 4EEWA 1GJZA 2KMAA 3PHWB 4BKGA 4K7SA 3QX1A 4B9KA 1BT0A 1GG3A 1WJ4A 4BBNC 5D6JB 4PYZA 2IBIB 3UQAA 2LRUA 1OGWA 4TQ0A 2AWTA 2C5LC 1OTRB 4G0NB 5JZEB 3V62A 2PEAA 4MGYE 5CHVC 3QCAA 2MCNB 3ZTDA 1Z5SB 1R4MI 2K6QA 2WDTB 2LD9A 4JGHB 2RR9A 3RT3B 3A9KA 3W1SA 2XK5B 3VVWB 3V60A 3N30A 3PTFC 5DPWA 3DBHI 4E3CA 4DHJD 3JVZX 4W9HA 2CKHB 2J0KA 2QHOA 3HHMA 3WAMA 4NQKE 3CSFA 3MJWA 4A20A 1A5RA 1ISNA 3DVGX 1FXTB 2FNJB 5FR6A 2AYOB 5JHBA 1MG8A 2JF5A 4AJYB 4PS7A 1WMHA 3C0RB 5G2NA 2MSED 4KZCA 1V86A 2CU1A 1S3SG 2EMSA 1F9JA 1WF9A 3ZRFA 1VCBA 3DBSA 3DOWA 4TQ1A 1TTNA 3L54A 1HE8A 4WJOA 2DHZA 1WR1A 5CX3A 5LXIB 2IO0B 4A3PA 4LJPB 3BY4B 4MGIE 2O2VB 3ZNGC 4CO7A 5J17A 4CYEA 4JL9A 4FJYA 4W9GA 4WWOA 2ZJDA 1V2YA 4MGKE 3H1UA 2BYFA 1WXSA 5J18A 3VDZA 3A4SC 4HVBA 5AZGA 3CSTA 2NCNA 2UWQA 1V9JA 3HIZA 4ZDVA 3A33B 2KOXA 4MSQB 1SIFA 2LRWA 2DYBA 4LDTB 2WWZA 4P7IA 3VQIA 4MELA 3TL5A 1NBFC 4ANUA 1D3ZA 4MGZE 1LQBA 3VTUA 2IO1B 4WJQA 2EKEC 4DK5A 1S1QB 2R2OA 3MTNB 2XK5A 4HDOA 2NVUI 1WZ3A 4BOSC 1L2NA 2BKFA 4NJ6A 5D2MB 3R7RA 4F8CB 3DVNU 3A9KB 4MH0E 3GZNI 3ECIA 4PS3A 4TUUA 3VTVA 2LASA 4ANXA 2GBJA 2V3SA 3VUXA 3AULA 5JHAA 3HK0A 2KDFB 2ZEQA 4KV2A 1UELA 1ZKHA 2JUOA 2KHWB 3CF6E 1WR6E 4W9CA 1V5OA 3ZO5B 3PLUA 3P2BA 4KSLC 2L8JA 4MM3A 2KTFA 5DPTA 4LDTD 1E8XA 3QWZB 2NPTA 2A4ZA 4GDKA 4TV3A 4GDLB 2DAFA 2KK8A 3M62B 4YL8A 4K7WA 1E5WA 4JLCA 2MRPA 2KWUB 4NAWB 3IG3A 2DZIA 1QZEA 2KX3A 3RUIB 3KUCB 4ICVA 4IG7B 3NZUA 3PV1A 4E71A 4DWFA 2C7HA 2ZCBA 3PRZA 2GOWA 2LGDA 4GB9A 1JRUA 1YD8U 3U7DA 1Q0WB 3RULA 4DXAB 2MBEA 5E6PA 2D11A 3K9OB 2J7QB 4ANWA 2FUHB 1OQYA 2JVCA 2ZPYA 2KMCA 2KO3A 1C1YB 3M3JA 2N9EB 2L7RA 3DVGY 4IC7B 5AEKB 1KM7A 2MBQA 1OEYA 3WA0A 2LVQA 2FCQA 1H4RA 2JZ3B 4HCNB 5CHFA 3DBRI 3ZDTA 4NNJB 1RRBA 1YQBA 2BGFA 5IA7A 2N9PC 1EF1A 2JXXA 5G55A 2KC2A 2KWCA 4ASWC 1RFAA 1ZGUB 2FCMA 2WX0A 4HJKA 5TR5A 5KHOA 1WXAA 1Z2MA 2JZZA 3AU5A 3H7PB 2LJ5A 2I1JA 4PYUA 3NOBA 2REXA 3K9PB 1WI0A 2GBNA 2RD0A 4WQOB 1RAXA 1UBQA 1V6EA 3VFKA 5DCNA 3A9JA 2KQSA 5C1ZA 2OOBB 2W9NA 2KJ6A 3OJ4B 3QA8A 3O65B 1WRDB 3LDZE 4N9F4 3RCZA 4XX5A 2DX5B 2GMIC 3KUZA 1SE9A 2KNBA 1LM8B 2KLCA 4LJOB 2C7NB 4MJSA 1P9DU 1E7UA 4RMAA 3L08A 4GDLA 3IFWB 4GOCA 1E7VA 2BYVE 2NPTB 2D3GA 4GDKB 4EKUA 4ZRKA 2N4FA 2KLGA 1WGYA 4NAWA 3V61A 2K1FA 3H9DA 4RM8A 3ENEA 4GU2A 4I6NB 3SD5A 1GUAB 3X23A 1UD7A 2NBWB 3IVFA 4K1RB 4ZRJA 4WWPA 4AUQC 1L7YA 5J2RA 1AARA 1M94A 1XD3B 2C9WB 2KKCA 3DBLI 3KYCD 4GXBA 4KDIC 4OVUA 5DPRA 3VTWA 4EOYA 3B08A 2LVOA 4A3OA 4EZJA 2KDIA 2JT4B 2JWZA 2O6VD 4IWQA 1ZW7A 2NS5A 4KIKB 4MDKE 2L00B 2ZPNA 2KZRA 2LGYA 2K8CA 4BVUC 4M8MA 2FCSA 1WZ0A 3QQ8B 5HKHA 2CR5A 4F1SA 1WXMA 3QK0A 2R2QA 3VAWA 4DDID 3PHXB 2YLMA 2WYQA 2PE9A 4DHZE 3QARA 3QC8B 1WX8A 2DZMA 1V81A 1WYWB 3T9LA 3ZKJC 2KC1A 3APCA 3ML8A 1WGRA 2MA9B 1YX6B 2DZJA 4W9LA 1V80A 4G11A 4XC2A 3RZWC 3B1LX 3TCAA 2BPSA 3H7PA 1E8WA 2NR2A 5D94A 4FJZA 1NDDA 4LCDE 2ZCCA 3A1QB 2G4SA 3PSEB 4BFRA 2L76A 4IWPA 2BKRB 4EZKA 4HDQA 3R3MA 2KD0A 3DPDA 3GOEA 4MSMB 2O6VA 2ZVNA 4G50A 4HXDA 4W9EA 4E74A 2K6DB 4EZLA 3A9JB 1WY8A 2JRIB 3PVLA 5C23A 2M0XA 4FULA 3QHTA 4AP4C
chains in the Genus database with same CATH superfamily
5D3IB 5GXGB 3NVVA 2KVRA 4K81A 1WXVA 1FRRA 1FFVA 1WIAA 2DWQA 3NZSA 2PE6B 4GLSC 1YQ3B 4XGAB 1Y8RC 3Q69A 4KKIA 3UIPB 4GSWA 2BB5A 3T8MA 2JPHA 3HM6X 4YT0B 3CWIA 2KANA 2MHJA 2NTSA 2MLBA 2QDFA 3IT6B 4M0WB 2ZNVB 3TEZA 1IYFA 1SBBB 4C7YA 1TT5B 2MEKA 1TY2A 2HJ8A 1FMAD 2M56B 1YQ4B 4WJPA 4RH6A 2C60A 4LNKA 4BBNF 4MEMA 1G6JA 1ET6A 2INDC 3BK1A 3I63C 4XZ4A 1VZ8A 1IGDA 3L0WB 3VRBB 3URYA 4HLEA 1IPGA 1HTQA 3VHTC 2KT7A 3NHEB 2CHZA 2W82A 3L10B 2BW2A 2UU7A 1KLVA 4GN1A 3VH4B 1WSPA 1WM3A 3ZW3A 1I4GA 1TGZB 3WAOA 2ONQA 2PIAA 3NS8A 5BMGA 4ACFA 1SGHA 4M01A 2RGFA 2CHWA 2HE7A 2KFJA 2V3PA 3WALA 3OG5A 5HHDG 2E6XA 2AEHA 1STEA 2Z0EB 3X0WA 3S2AA 2JQRB 3PPAA 3PZ8A 4P16A 2KN4A 4HK2A 1NI2A 4NQLB 2KN5A 2KQ7A 1C79A 1IBXB 3EECA 1XLOA 1Q1OA 2LUEA 2WX1A 1HZ6A 4KDLB 1U4AA 4RF0A 2NBUA 1K8RB 3ZLZA 3IT4B 3UF8A 1FCCC 2JYTA 3RZFA 2CS4A 4W9FA 3IAS1 2HJ1A 5I4DA 2WXHA 4J6IA 1XT9B 2MBHA 1SE4A 2GBMA 2KWVB 1KTKA 2DYOA 3TMPB 1MPEA 3HM3A 1MHXA 4OZCA 3TUOA 4NZLB 4GGQA 3A4RA 4DDGD 3AI5A 2INNE 3ZNHB 1QF6A 1EUVB 1K50A 2KWDA 1YOVB 1I35A 1YJIA 4N58A 2D10A 4WWNA 3JW0X 1WGDA 2I2YA 4WAAA 2ASQA 2KDBA 3W9CB 5KHQA 1C76A 3M63B 2RPQA 3B0AA 4NAMA 4DHJB 1WGHA 2AQ1B 3KLSX 4HPMB 2MQJA 4HCPB 1WE7A 4GIVA 1V8CA 4EEWA 1YN5A 1D5ZC 2GB1A 1WJ4A 1TKYA 1WXQA 5D6JB 3UQAA 4TQ0A 1EM7A 2AWTA 3V62A 5HFYA 2KMMA 2K6QA 2WDTB 2LD9A 4JGHB 2RR9A 3VVWB 3EA6A 4WWMA 3N30A 3PTFC 2WXFA 5DPWA 1NENB 3JVZX 1DGJA 3AE2B 3HHMA 3CSFA 3N20C 1XCQL 1AW7A 1J7AA 4HPPA 1WMHA 3Q3NC 5G2NA 3KWVA 3KQ4A 1SJHD 2SAKA 3DOWA 4WJOA 1TS5A 5CX3A 2IO0B 4ZRPA 4LJPB 2O2VB 4YSXB 3OWEB 1V2YA 4HVBA 2NCNA 3N1ZC 2K3UA 1V9JA 3AM9A 4LDTB 2WWZA 4P7IA 3VQIA 4MELA 5BYRA 1QOGA 1FFUA 1FXAA 2EKEC 2WXLA 3U4EG 4BOSC 1L2NA 5D2MB 3A9KB 4MH0E 2WU5B 4CQNA 3ECIA 4PS3A 2LASA 5JHAA 3AULA 3HK0A 1WGKA 2KHWB 4W9CA 4O1NA 1FNUA 3PLUA 3FILB 3ZGZA 4YTPB 3QWZB 1SEBD 3IAM1 4P1BC 3UI3A 4GDLB 4YL8A 1E5WA 2MRPA 4NAWB 2DZIA 2G1EA 3U7ZA 4IG7B 3MC8A 2B76B 2GOWA 1JRUA 4DXGA 2X38A 1YD8U 3U7DA 1Q0WB 3BK2A 2MBEA 4IKGA 1FNVA 3K9OB 1V1OA 4OZAA 1FRDA 3DHHC 1C1YB 2N9EB 3FKYA 1UWMA 2WXMA 1OEYA 1H4RA 3DBRI 2EKIA 1RRBA 1P7FA 2BGFA 5G55A 2KC2A 2KWCA 1RFAA 2FCMA 4HJKA 2J52A 1Z2MA 1HQRD 2I1JA 4PYUA 3NOBA 1KLUD 2GBNA 1V6EA 1ZP0B 2INPE 2OOBB 2QC8A 1ET9A 3O65B 3LDZE 3SFEB 1UGJA 4XX5A 1SE9A 1P9DU 4MM3B 4RCOA 1XEEA 3L08A 3ZJVA 3IFWB 1K52A 1E7VA 1KF6B 1SF0A 2BB6A 2KLGA 1TIFA 1JRPA 1JWMD 1UD7A 3RNGC 1AARA 3W1SA 1XD3B 2XNAC 4KDIC 2LVOA 4XDCA 2JWZA 2O6VD 4IWQA 4MDKE 4M0WA 2KAJA 2K8CA 4BVUC 2FCSA 3QK0A 2R2QA 4DDID 2WYQA 3NJTA 2WXKA 4QAYA 2MA9B 3RZWC 4G11A 3ZXRA 3H7PA 1E8WA 2NR2A 4FJZA 2WP9B 2BKRB 3Q8BA 1QOFA 3GOEA 2DNFA 3P4PB 1TS4A 4E74A 1IGCA 4LK0M 1L4ZB 2M0XA 1D5MC 3R2TA 3AE8B 1LXDA 4IM2A 2MBBB 3ZDMC 3AU4A 3V6CB 2DAJA 4HJGE 4LNOA 1WFYA 1CMXB 1RWSA 2MX2A 1YIWA 4LNNA 1E6EB 1TY0A 3ABVB 1T3QA 2PPHA 5EE1A 1JMLA 2L0TA 3DBRB 2KDEB 2BYEA 2K25A 2KX0A 2WDQB 3PLVA 2FAZA 4KZ0A 5C3JB 4KIKA 4OHJA 3C19A 5LXHA 2JY6A 3Q8AA 2V9HA 1E90A 4G3XB 1JALA 3NVWA 3ZJTA 4GMVA 2LI5A 2AQ2B 1ESFA 3ML9A 4DBGA 2RDBC 3BVMA 1TBEA 1UUPA 3TBLD 3SR6A 3D32A 3AEDB 1TKEA 2BWES 2FIFA 1J19A 2OJWA 5EDSA 3DQVA 2N7EA 3A1QA 2LMCA 3QAQA 3BVGA 2D2QA 1JWAD 1JCKB 2VH2A 3Q8EA 1JQ4A 4TKNA 3VUWA 1IP9A 2O6VB 4ZRQA 1MJDA 1PDXA 4YTMB 3AE5B 2MBOA 2W55A 1VZ7A 3HVDA 3OLMD 2M17A 3OJ3A 1Y56A 4JQWC 2WXIA 2DZKA 4BKSA 3W1YA 1OFFA 5CTRC 2AQ3B 4OVZA 3IHPC 2Y5BB 3NG0A 2WXPA 4ZYNA 4OVVA 4LNIA 4RNAA 3SEBA 3H8HA 1UBIA 1ENFA 3RMKC 4ICUA 4XE0A 3U2SC 3R66C 4KSKC 4FLHA 2IGHA 4JIOU 2OEDA 3ZXVA 5L83A 3APFA 1SB3C 2G4DB 4M02A 1WGGA 3I9V1 5EE3A 1EU4A 3SFDB 2VRRB 3M95A 3L16A 2BWFA 3ALBA 3N1YC 4ARCA 3Q3FA 3UIOB 2V1YA 1NEKB 1V5TA 2M8SA 2L05A 2OJRA 3JSVA 4ZYSA 2BQQA 3WIMA 3H7SA 3QJZA 2Q5WD 4YTNB 1EF5A 2AL3A 5IKCM 1JROA 3VR9B 1YJJA 2ZVOA 3APDA 2N9XA 2DENB 3UGBB 1UWXA 1WX9A 4HPLB 1V97A 3Q14C 2NBVB 4B0MA 4L23A 1YN4A 2HTME 3W5UB 1TKGA 2JU6X 4FHKA 4I6PA 1PGXA 2Y5PA 2IY1B 1EWYC 1C3TA 1KOTA 2J4XA 1T6BX 3I3TB 2K9XA 2WXOA 4CHKA 4BKSD 2KFKB 2O2VA 3GP7A 1NYQA 3GS2A 3VH3B 3KH0A 4W9KA 3AECB 4IWOA 1T0YA 1WJUA 2RSUA 1TZ1A 1V1PA 1F1HA 3KVFB 3PO0A 1QLBB 2FBWB 3QX1A 4BBNC 1CK1A 2IBIB 5T8IA 2C5LC 1OTRB 5CHVC 3QCAA 3AEFB 3ZJUA 3A9KA 4ZHPA 2XK5B 3V60A 1VRAB 4A9AA 4E3CA 4DHJD 3P4QB 2CKHB 5IP4D 1QT9A 1ZDVA 1A5RA 2X8XX 3DVGX 5FR6A 5JHBA 1MG8A 2JF5A 3BIID 1SJED 3C0RB 4P1CC 2MSED 3Q3OC 2VZKB 1V86A 2CU1A 4MH8A 4US9A 3DBSA 1TTNA 1HE8A 2DHZA 5LXIB 4MGIE 3BY4B 4CO7A 5J17A 4JL9A 4FJYA 1PGBA 2ZJDA 3L4PA 2BYFA 1WXSA 1FO4A 4REZA 2IDYA 4JE3B 1HEZE 3CSTA 2QILA 3C8YA 3A33B 1SIFA 3I5JC 2MH7A 1NBFC 4WIPA 1D3ZA 1I7HA 3VTUA 4DQOC 1TZOA 1VR9A 1PGAA 1GPXA 4DK5A 1S1QB 2NVUI 3AEEB 2BKFA 4KX6B 4NJ6A 4F8CB 4YSZB 3DVNU 3GZNI 1K53A 3VTVA 5IOIA 4BAXA 3VRAB 2BS3B 2GBJA 3VUXA 1HZ5A 4A6QA 1ZKHA 2WXGA 1V5OA 3ZO5B 3P2BA 1R7SA 1E10A 2L8JA 4MM3A 3BZDB 4LDTD 1E8XA 4RGOS 2A4ZA 3Q8CA 1LGRA 2DAFA 2L83A 2QIEB 2EELA 2KWUB 3TSSA 3RUIB 3PV1A 4HRSA 3PRZA 4DXAB 1SE2A 1M4VA 2KO3A 3CIRB 2GI9A 3DVGY 1KM7A 2MBQA 2LVQA 4S0RA 2FCQA 5TSSA 2PMVA 4R3DA 5CHFA 3ZDTA 1IUEA 4NNJB 1YQBA 5JXVA 2WLBA 3GB1A 4NJCA 3ZYYX 2CJNA 2JX5A 5TR5A 3AU5A 2D3CA 1WI0A 3BYYB 2KQSA 2W9NA 4B0EA 3LB8C 2WXQA 3RCZA 2KNBA 4LJOB 2C7NB 1DOIA 2W3SA 1MVKA 2QCZA 4GOCA 3RNAC 5LNK1 2NPTB 2D3GA 1MG4A 3HVZA 4ZRKA 1WWTA 2BBCA 2I38A 3V61A 1TS2A 4RM8A 3SD5A 1ZPSA 4ZRJA 5D3DA 1T0RC 4YXDB 2C9WB 4OVUA 2D3BA 1L5PA 2PKOA 2KDIA 3AMZA 2JT4B 3AV8A 2L00B 2ZPNA 1KRHA 4ARIA 3GZNB 4C80A 5HKHA 4D2KA 4F1SA 1WXMA 4IDIA 2YLMA 1KFYB 3NUHB 3QARA 4BZAA 2DZMA 1V81A 1WYWB 2KC1A 4XC2A 3DWMA 4W9LA 2QJLA 3B1LX 4OZBA 3TCAA 3AE4B 4N59A 1MHHE 4LCDE 2ZCCA 2G4SA 2H88B 4BFRA 4IWPA 5AUIA 3R3MA 2KD0A 4MSMB 2O6VA 4G50A 1DYQA 3A9JB 2JRIB 2PVGC 4WH4A 5IA7A 2L32A 1JW9D 3AE7B 1ZE3D 1XF5L 4FBJB 2LXCA 3WAPA 5G5GA 2Z8LA 3ZVVA 4KGRA 2PJHA 5AZFA 3VUYA 1WX7A 3EC8A 4X57B 4PS8A 4XDDA 4URKA 2K22A 4HEA1 5BYSA 3RNCC 1N61A 3SU8X 3PRPB 1P98A 4ZRIA 1VZ6A 4DHZB 5BO4B 2W3RA 2KJHB 1UH6A 1I4HA 1C9FA 2Y3AA 1XO3A 3T3NA 4K7UA 2MW5A 2LGIA 3U30A 2J42A 4JWUC 2Z0DB 2WXJA 3PT2B 2D07B 1UZXB 2WXRA 2C7MB 1P3QU 5DPSA 2L0FA 4C7ZA 2LHDA 1FM0D 3DVNV 2IY0B 4YSYB 5L95C 4W9IA 3PREA 4N6EB 2FCNA 4WURA 1WYGA 1I4XA 2N1VA 4EFOA 1R4NI 2FE8A 3MFGA 3W1SC 1NI3A 3WCQA 1GNUA 5IN7A 3DHIC 4WJNA 3N9YC 1ROEA 2ZNVC 1P7EA 5E6NA 3NVZA 3VR8B 2G9HD 1OEYJ 4AQ7A 3KW5B 4IUMB 3Q3JA 4USAA 5CHWA 3GE8C 3P4SB 3KYDD 5FKAC 2LVPA 3L17A 1PFDA 1UGMA 4AS1A 1E8YA 2K5PA 2QSDA 2N1WA 3AXCA 1J0GA 1E8ZA 2PW9A 3RI7C 2MP2B 5C2TB 3RYTA 2KFKA 3ZQ4A 1UF0A 1LFDA 1GOZA 2ACZB 1AWDA 2KJRA 4W9DA 4FJVB 1WRIA 3R8BA 4BKTA 4B95A 3AEBB 3W5VB 1E9MA 3TEWA 2XBBC 1WJNA 3TEYA 1SE3A 2QMTA 4J3OD 2KTRB 2GBKA 2K39A 4F7ZA 2IZVB 2UYZB 2IGDA 3HUIA 1CJEA 5D7GA 3ZTCA 2I1KA 3RD2A 2DLBA 3V05A 3P1MA 2VH1A 2BVCA 2M19A 2L3ZA 5AZHA 5IAAC 3VXWA 3B9JA 4HWIB 2GRIA 2JWUA 1N5XA 3ZNID 2Z59B 4KGSA 4ANVA 3E9SA 1ZXIA 1P0RA 4W9JA 1RLFA 3CMMB 1H8CA 1WMHB 4L1BA 2LZ6A 1R4NB 1YX5B 1VDVA 2IO2B 3PRMB 4KVGB 4TSSA 1IBXA 1F2RI 3N3KB 2ZW1A 2BS2B 1R4MB 2JXTA 3ONSA 2GBRA 1T5XD 4IM0A 2G3QB 2XEWA 1V49A 2H89B 2KXJA 3LYYA 1TYGB 1GJZA 2CU3A 2NTTA 3P63A 4B9KA 1PYWD 4K3CA 2MJEA 4G0NB 5JZEB 4MGYE 2MCNB 4ZOHC 1Z5SB 1QOAA 5FR3A 3RT3B 1N60A 1RYJA 3DBHI 4C4VB 2WNMA 2LEKA 4W9HA 1OQRA 4NQKE 4A20A 1QKZA 1ISNA 1SIJA 4AJYB 2KDMA 1K51A 3Q8FA 4KZCA 1S3SG 2D3AA 3ZRFA 4TQ1A 2JZPA 1F77A 4A3PA 1FPYA 3ZNGC 3RPFC 4CYEA 4WWOA 4MGKE 5E6JA 3VDZA 3A4SC 5AZGA 4K3BA 4ZDVA 1QILA 2KOXA 4MSQB 1SSNA 1HA5A 4JX1C 4ANUA 3AEAB 2VZKD 2IO1B 4WJQA 4Q2JA 2R2OA 3MTNB 3P42A 3I57A 1WZ3A 3R7RA 5BMHA 3DHGC 3AB5A 4TUUA 2WGSA 4JWSC 5MPOA 4LTUA 1Q10A 1B1ZA 2V3SA 2KDFB 2ZEQA 2JUOA 3AE3B 3CF6E 1ZOYB 4LNFA 4KSLC 2KTFA 5BYQA 2NPTA 2KK8A 1BXTA 4K7WA 1GB4A 4DXFA 3IG3A 2KX3A 2BS4B 3KUCB 2N9KA 4ICVA 3NZUA 4S17A 4E71A 4DWFA 2LGDA 1A70A 3AE1B 2ZW0A 3R2IA 3BWUD 1JWBD 2JVCA 1LO5D 4TMAB 3DBHB 2L7RA 4IC7B 2XN9C 1L6VA 4ASWC 1ZGUB 2WX0A 2WQYB 2IGGA 1HXYD 3H7PB 1T0SC 1WXAA 1TS3A 5KHOA 1D6EC 3K9PB 2RD0A 2RDGA 2IPKD 1C4AA 1F0ZA 4C00A 3A9JA 1SXTA 3OJ4B 3RN9C 3DBLB 4P6VF 4N9F4 1I4RA 2DX5B 3KUZA 1N5WA 3FILA 1LM8B 2PVOD 2V3NA 4RMAA 4GDLA 4RF1A 2BYVE 4GDKB 4EKUA 1XXGA 1WGYA 4NAWA 2K1FA 3ENEA 4I6NB 3X23A 2NMQA 4WWPA 1L7YA 1J7CA 3KYCD 4GXBA 2KKCA 3Q2AC 2WXNA 4RFBA 3V3XA 3VTWA 4PK1A 3B08A 3RNFC 4C56C 4US8A 4MT5A 1L0VB 1ZW7A 4KIKB 2KZRA 1KH0A 1UNSA 4M8MA 1WZ0A 3QQ8B 3PHXB 4DHZE 2DBYA 2PE9A 3BYTB 1CZPA 4KKJA 2GLSA 3T9LA 1WGRA 1YX6B 2DZJA 1FNWA 2BPSA 5FK9C 3LXFA 3A1QB 2YEPB 2L76A 1EWCA 1HTOA 4EZKA 4HDQA 2AX5A 3DPDA 2V0GA 4HXDA 2K6DB 4FULA 3QHTA 1YNTE 2BF8B 3R7QA 2CHXA 1YJ1A 4II3B 1T0QC 4M8NA 1E0ZA 4AJWA 4FADA 4MJSB 4FA6A 2KACA 2QEJC 2M0AA 4NPNA 4B6WA 2MJ3A 1D5XC 4RM9A 2LXAA 1N6ZA 3EFUA 2Y5CA 4IW0A 4FHJA 1F52A 4RGNA 5LLIA 2M1MA 3BINA 1E7PB 4ITKA 5EE9A 2K8HA 1NYRA 3ZUNA 3PZDA 2KYWA 2LGXA 4FXCA 2ZZPB 2MP2A 3KUDB 4M00A 1JWSD 5HG2A 1BUIC 4EE2A 3NZ3A 1GC6A 3AH7A 3U52E 4A90A 3N1XC 4AOFA 4UDUC 2WS3B 3OAWA 3WANA 2A5UA 1D4BA 1I4PA 2IYDB 3L13A 2V4LA 1WH3A 3SHQA 2EMTA 2J0MA 3LJ3A 2KTRA 2IO3B 3JSVB 3TJPA 3E56A 2BT6A 2RPVA 3AE9B 2HTHA 3SDLC 1P1AA 1MFWA 2FIDA 2J0JA 5BMIA 2R61A 4NY0A 3DCGA 1KLGD 3FAHA 1YMHE 3QIJA 1L0XB 4EUTA 1DOYA 3B2GA 2LGSA 2YVCA 3ZIMA 4NJ7A 1J8CA 3EUB2 1N63A 1KJTA 1WJ6A 2LWPA 3PGEA 4II2B 2SEBD 2K8BA 2W54A 2B3AA 2M4NA 2DYMA 1I4QA 1XLNA 2WDRB 1XQQA 4OW0A 2CJOA 1V1PB 2N7DA 1X1MA 4BOZB 3V6EB 3DWGC 3RFZB 5GMVA 4YWGG 1CQVA 1PQSA 2AL6A 3KWLA 3H6NA 1VD2A 1L0YB 1Q5WB 2MWSB 1GC7A 4IM3A 5E6OA 2L52A 3TIXA 2RMMA 3UINB 2J53A 4C4VA 1I42A 3BVZA 2LHEA 3Q3MC 4HKQA 3EHVA 1WE6A 3MHSD 3N32A 5H8YE 2ON8A 5AUKA 1RFKA 3U8ZA 2G45B 2LUMA 3DDCB 1EO6A 5JH5C 2HDEA 1XLQA 3ZRCA 2HD5B 4ZHOA 3TEXA 4AWJA 4RGMA 3NY5A 1WM2A 3RNBC 2K0PA 3P4RB 3W2DA 3PS6A 2JRHA 3IBEA 4FN2A 3AEGB 3JYUA 4I6LB 1ZDXA 3ETRA 3ZNZB 1TJEA 2KMAA 3PHWB 1F2RC 4BKGA 4K7SA 1L4DB 2OHFA 1BT0A 1GG3A 1RM6C 4PYZA 1GB1A 2LRUA 1OGWA 2IJ0A 2PEAA 3ZTDA 1R4MI 2RDHA 2KQ4X 2WHIA 1NVID 3AE6B 4MACA 2J0KA 2QHOA 3WAMA 3MJWA 2E3TA 1FXTB 2FNJB 2AYOB 3MC9A 1VLBA 2V4IB 4PS7A 4XWTA 3MHZA 3HRDD 3J9CA 3RNEC 2EMSA 1F9JA 1WF9A 1VCBA 1C77A 1N62A 1ZUD2 3L54A 4HKZE 1WR1A 4WQMA 2JSVX 4W9GA 1DOXA 3H1UA 5J18A 2UWQA 3HIZA 5H92C 1FEHA 1GAQB 3GE3C 3Q6BA 1JWUD 2DYBA 2LRWA 3PZ7A 1XCTL 1QOBA 3TL5A 4A55A 4MGZE 1LQBA 2N9LA 4XYCA 2XK5A 4HDOA 5IO9A 1C4PA 5EE0A 3EFCA 4ANXA 3EGRA 4KV2A 2WU2B 1UELA 1WR6E 4PT5A 1FXIA 5DPTA 4GDKA 4TV3A 5G5HA 3M62B 4JLCA 2YEPF 1QZEA 1AN8A 2L1AA 2FUG1 1FIQA 2C7HA 2ZCBA 4GB9A 2BYTA 3RULA 5E6PA 2D11A 1VJKA 4L2YA 2J7QB 4ANWA 2FUHB 2LFIA 1OQYA 2ZPYA 1ZXHA 3MC0B 2PLPA 2KMCA 3M3JA 3NRZA 1C78A 5AEKB 3WA0A 4HCNB 2JZ3B 2BTEA 2N9PC 1EF1A 1L6UA 4HROA 2JXXA 4A8XC 1YN3A 2JYEA 2JZZA 2LJ5A 2REXA 2PTLA 4WQOB 1RAXA 1UBQA 1OQQA 1B9RA 4JPSA 3T3OA 3VFKA 5DCNA 4H2AA 5C1ZA 2KJ6A 3QA8A 3B2FA 1WRDB 2INCC 3NVYA 2GMIC 4LLGM 1FCLA 2TSSA 3NS1A 3O13A 2KLCA 4WAFA 4MJSA 2LJIA 1E7UA 4KGTA 2N7JA 1J7BA 2N4FA 2MJDA 3H9DA 4GU2A 4IOIE 1GUAB 2NBWB 1PUTA 3IVFA 4K1RB 4AUQC 3FC4A 5J2RA 2ICIA 1M94A 1QQRA 2WDVB 3DBLI 4EOYA 3UQBA 5DPRA 4EZJA 3MJ5A 4XWWA 4A3OA 2NS5A 1MI0A 2LGYA 2KVZA 2CR5A 1FD6A 3VAWA 1BMLC 1ACCA 3IXSA 3QC8B 1WX8A 3ZKJC 3ML8A 3APCA 1V80A 1AYFA 5D94A 1NDDA 2D5GA 1C4CA 3PSEB 1EU3A 2ZVNA 4W9EA 1XLPA 2N0SB 5HI1A 4EZLA 3AN1A 1WY8A 5C23A 3MP9A 3PVLA 4AP4C 4RGTA
chains in the Genus database with same CATH topology
1LXDA 2BF8B 3R7QA 2CHXA 1YJ1A 4II3B 4IM2A 2MBBB 3ZDMC 2KVRA 3AU4A 4K81A 3V6CB 2DAJA 4FBJB 1WXVA 2LXCA 4M8NA 3WAPA 3ZVVA 1WIAA 3NZSA 1WFYA 2PJHA 1CMXB 2PE6B 5AZFA 3VUYA 4AJWA 1WX7A 2MX2A 4MJSB 4FA6A 1YIWA 3EC8A 4X57B 4PS8A 4B6WA 4NPNA 2PPHA 4URKA 4RM9A 1Y8RC 3SU8X 2L0TA 2LXAA 1P98A 2KDEB 3PRPB 4ZRIA 2BYEA 4DHZB 3EFUA 3UIPB 4GSWA 4IW0A 5BO4B 4FHJA 2K25A 3T8MA 2KX0A 5LLIA 3PLVA 2FAZA 2JPHA 1UH6A 2KJHB 2M1MA 3BINA 3HM6X 4KZ0A 4KIKA 2K8HA 2KANA 2MLBA 5LXHA 2JY6A 4M0WB 2ZNVB 3ZUNA 1E90A 3PZDA 4G3XB 4K7UA 2LGXA 2MW5A 1IYFA 3U30A 2ZZPB 4GMVA 2LI5A 2Z0DB 3ML9A 4DBGA 2MP2A 2HJ8A 3KUDB 3PT2B 1TBEA 2D07B 1UZXB 3D32A 3TBLD 2C7MB 2BWES 1P3QU 2FIFA 1J19A 5DPSA 4WJPA 2L0FA 1GC6A 5EDSA 2C60A 4BBNF 3DQVA 4MEMA 3DVNV 2IY0B 2N7EA 3A1QA 3QAQA 5L95C 4W9IA 3PREA 2FCNA 2D2QA 4AOFA 1G6JA 3OAWA 3WANA 2A5UA 4XZ4A 4TKNA 3VUWA 1IP9A 2O6VB 3L0WB 2IYDB 3L13A 2N1VA 1WH3A 2V4LA 3SHQA 4EFOA 1IPGA 1R4NI 4HLEA 3W1SC 2EMTA 2J0MA 3LJ3A 3VHTC 2KTRA 2IO3B 2MBOA 3JSVB 3NHEB 2CHZA 1GNUA 3OLMD 2M17A 3L10B 3OJ3A 4WJNA 1KLVA 2ZNVC 4GN1A 3TJPA 4JQWC 3VH4B 5E6NA 1WM3A 2DZKA 2HTHA 3SDLC 3ZW3A 4BKSA 1P1AA 1TGZB 3WAOA 2FIDA 1OEYJ 2J0JA 3W1YA 3KW5B 3NS8A 5CTRC 1SGHA 4NY0A 4IUMB 3DCGA 2RGFA 2CHWA 2HE7A 2KFJA 3Q3JA 3WALA 3IHPC 5CHWA 2Y5BB 3KYDD 2LVPA 4ZYNA 3L17A 4OVVA 3QIJA 1UBIA 4EUTA 1UGMA 4ICUA 3R66C 2AEHA 1E8YA 4KSKC 4FLHA 2Z0EB 3X0WA 2YVCA 3S2AA 4NJ7A 4JIOU 2N1WA 3AXCA 3PPAA 3ZIMA 1J0GA 1J8CA 5L83A 3APFA 1E8ZA 1KJTA 4HK2A 1WJ6A 2LWPA 2MP2B 1NI2A 3PGEA 2G4DB 3RYTA 2KFKA 4II2B 4NQLB 1WGGA 1LFDA 2KN5A 2K8BA 2KQ7A 2KJRA 3EECA 2B3AA 2LUEA 1Q1OA 2WX1A 4FJVB 4W9DA 2M4NA 2DYMA 2VRRB 4KDLB 1U4AA 2NBUA 3M95A 3L16A 2BWFA 3ALBA 1K8RB 3ZLZA 1XQQA 3UF8A 4B95A 3Q3FA 3UIOB 4BKTA 2V1YA 1V5TA 2N7DA 2M8SA 2L05A 1X1MA 4BOZB 3V6EB 2XBBC 1WJNA 2OJRA 3JSVA 3WIMA 4FADA 3RZFA 2CS4A 3H7SA 3QJZA 4W9FA 5GMVA 2KTRB 2GBKA 1PQSA 1EF5A 2AL6A 2IZVB 2K39A 2UYZB 4F7ZA 2AL3A 3H6NA 1VD2A 5D7GA 3ZTCA 2I1KA 3RD2A 1Q5WB 4J6IA 1XT9B 2MWSB 1GC7A 2MBHA 2GBMA 4IM3A 2KWVB 5E6OA 2DYOA 3TMPB 3TIXA 2L3ZA 5AZHA 3HM3A 2ZVOA 5IAAC 3APDA 3UINB 3VXWA 1I42A 2N9XA 3UQBA 2DENB 3UGBB 4HWIB 3EHVA 1WE6A 4GGQA 3A4RA 3MHSD 3N32A 1WX9A 4HPLB 3AI5A 4DDGD 2NBVB 3ZNHB 3ZNID 1EUVB 2Z59B 3U8ZA 2G45B 3DDCB 4ANVA 1EO6A 5JH5C 1I35A 1P0RA 4W9JA 1RLFA 3CMMB 3ZRCA 1H8CA 1WMHB 2D10A 4FHKA 2HD5B 4I6PA 4WWNA 3JW0X 4AWJA 2LZ6A 1WGDA 3NY5A 4WAAA 1YX5B 2IO2B 2IY1B 1C3TA 2ASQA 2KDBA 3PRMB 1KOTA 5KHQA 1WM2A 4KVGB 3M63B 3I3TB 2RPQA 4CHKA 4BKSD 2KFKB 2O2VA 3N3KB 3B0AA 3PS6A 2JRHA 3IBEA 3ONSA 3VH3B 2GBRA 3KH0A 4FN2A 4IM0A 3JYUA 2G3QB 4W9KA 4I6LB 4DHJB 2XEWA 1WGHA 1T0YA 1V49A 4IWOA 2KXJA 3ZNZB 4HPMB 1WJUA 2MQJA 2RSUA 4HCPB 1TZ1A 3KVFB 1WE7A 4GIVA 4EEWA 1GJZA 2KMAA 3PHWB 4BKGA 4K7SA 3QX1A 4B9KA 1BT0A 1GG3A 1WJ4A 4BBNC 5D6JB 4PYZA 2IBIB 3UQAA 2LRUA 1OGWA 4TQ0A 2AWTA 2C5LC 1OTRB 4G0NB 5JZEB 3V62A 2PEAA 4MGYE 5CHVC 3QCAA 2MCNB 3ZTDA 1Z5SB 1R4MI 2K6QA 2WDTB 2LD9A 4JGHB 2RR9A 3RT3B 3A9KA 3W1SA 2XK5B 3VVWB 3V60A 3N30A 3PTFC 5DPWA 3DBHI 4E3CA 4DHJD 3JVZX 4W9HA 2CKHB 2J0KA 2QHOA 3HHMA 3WAMA 4NQKE 3CSFA 3MJWA 4A20A 1A5RA 1ISNA 3DVGX 1FXTB 2FNJB 5FR6A 2AYOB 5JHBA 1MG8A 2JF5A 4AJYB 4PS7A 1WMHA 3C0RB 5G2NA 2MSED 4KZCA 1V86A 2CU1A 1S3SG 2EMSA 1F9JA 1WF9A 3ZRFA 1VCBA 3DBSA 3DOWA 4TQ1A 1TTNA 3L54A 1HE8A 4WJOA 2DHZA 1WR1A 5CX3A 5LXIB 2IO0B 4A3PA 4LJPB 3BY4B 4MGIE 2O2VB 3ZNGC 4CO7A 5J17A 4CYEA 4JL9A 4FJYA 4W9GA 4WWOA 2ZJDA 1V2YA 4MGKE 3H1UA 2BYFA 1WXSA 5J18A 3VDZA 3A4SC 4HVBA 5AZGA 3CSTA 2NCNA 2UWQA 1V9JA 3HIZA 4ZDVA 3A33B 2KOXA 4MSQB 1SIFA 2LRWA 2DYBA 4LDTB 2WWZA 4P7IA 3VQIA 4MELA 3TL5A 1NBFC 4ANUA 1D3ZA 4MGZE 1LQBA 3VTUA 2IO1B 4WJQA 2EKEC 4DK5A 1S1QB 2R2OA 3MTNB 2XK5A 4HDOA 2NVUI 1WZ3A 4BOSC 1L2NA 2BKFA 4NJ6A 5D2MB 3R7RA 4F8CB 3DVNU 3A9KB 4MH0E 3GZNI 3ECIA 4PS3A 4TUUA 3VTVA 2LASA 4ANXA 2GBJA 2V3SA 3VUXA 3AULA 5JHAA 3HK0A 2KDFB 2ZEQA 4KV2A 1UELA 1ZKHA 2JUOA 2KHWB 3CF6E 1WR6E 4W9CA 1V5OA 3ZO5B 3PLUA 3P2BA 4KSLC 2L8JA 4MM3A 2KTFA 5DPTA 4LDTD 1E8XA 3QWZB 2NPTA 2A4ZA 4GDKA 4TV3A 4GDLB 2DAFA 2KK8A 3M62B 4YL8A 4K7WA 1E5WA 4JLCA 2MRPA 2KWUB 4NAWB 3IG3A 2DZIA 1QZEA 2KX3A 3RUIB 3KUCB 4ICVA 4IG7B 3NZUA 3PV1A 4E71A 4DWFA 2C7HA 2ZCBA 3PRZA 2GOWA 2LGDA 4GB9A 1JRUA 1YD8U 3U7DA 1Q0WB 3RULA 4DXAB 2MBEA 5E6PA 2D11A 3K9OB 2J7QB 4ANWA 2FUHB 1OQYA 2JVCA 2ZPYA 2KMCA 2KO3A 1C1YB 3M3JA 2N9EB 2L7RA 3DVGY 4IC7B 5AEKB 1KM7A 2MBQA 1OEYA 3WA0A 2LVQA 2FCQA 1H4RA 2JZ3B 4HCNB 5CHFA 3DBRI 3ZDTA 4NNJB 1RRBA 1YQBA 2BGFA 5IA7A 2N9PC 1EF1A 2JXXA 5G55A 2KC2A 2KWCA 4ASWC 1RFAA 1ZGUB 2FCMA 2WX0A 4HJKA 5TR5A 5KHOA 1WXAA 1Z2MA 2JZZA 3AU5A 3H7PB 2LJ5A 2I1JA 4PYUA 3NOBA 2REXA 3K9PB 1WI0A 2GBNA 2RD0A 4WQOB 1RAXA 1UBQA 1V6EA 3VFKA 5DCNA 3A9JA 2KQSA 5C1ZA 2OOBB 2W9NA 2KJ6A 3OJ4B 3QA8A 3O65B 1WRDB 3LDZE 4N9F4 3RCZA 4XX5A 2DX5B 2GMIC 3KUZA 1SE9A 2KNBA 1LM8B 2KLCA 4LJOB 2C7NB 4MJSA 1P9DU 1E7UA 4RMAA 3L08A 4GDLA 3IFWB 4GOCA 1E7VA 2BYVE 2NPTB 2D3GA 4GDKB 4EKUA 4ZRKA 2N4FA 2KLGA 1WGYA 4NAWA 3V61A 2K1FA 3H9DA 4RM8A 3ENEA 4GU2A 4I6NB 3SD5A 1GUAB 3X23A 1UD7A 2NBWB 3IVFA 4K1RB 4ZRJA 4WWPA 4AUQC 1L7YA 5J2RA 1AARA 1M94A 1XD3B 2C9WB 2KKCA 3DBLI 3KYCD 4GXBA 4KDIC 4OVUA 5DPRA 3VTWA 4EOYA 3B08A 2LVOA 4A3OA 4EZJA 2KDIA 2JT4B 2JWZA 2O6VD 4IWQA 1ZW7A 2NS5A 4KIKB 4MDKE 2L00B 2ZPNA 2KZRA 2LGYA 2K8CA 4BVUC 4M8MA 2FCSA 1WZ0A 3QQ8B 5HKHA 2CR5A 4F1SA 1WXMA 3QK0A 2R2QA 3VAWA 4DDID 3PHXB 2YLMA 2WYQA 2PE9A 4DHZE 3QARA 3QC8B 1WX8A 2DZMA 1V81A 1WYWB 3T9LA 3ZKJC 2KC1A 3APCA 3ML8A 1WGRA 2MA9B 1YX6B 2DZJA 4W9LA 1V80A 4G11A 4XC2A 3RZWC 3B1LX 3TCAA 2BPSA 3H7PA 1E8WA 2NR2A 5D94A 4FJZA 1NDDA 4LCDE 2ZCCA 3A1QB 2G4SA 3PSEB 4BFRA 2L76A 4IWPA 2BKRB 4EZKA 4HDQA 3R3MA 2KD0A 3DPDA 3GOEA 4MSMB 2O6VA 2ZVNA 4G50A 4HXDA 4W9EA 4E74A 2K6DB 4EZLA 3A9JB 1WY8A 2JRIB 3PVLA 5C23A 2M0XA 4FULA 3QHTA 4AP4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXD A;  2BF8 B;  3R7Q A;  2CHX A;  1YJ1 A;  4II3 B;  4IM2 A;  2MBB B;  3ZDM C;  2KVR A;  3AU4 A;  4K81 A;  3V6C B;  2DAJ A;  4FBJ B;  1WXV A;  2LXC A;  4M8N A;  3WAP A;  3ZVV A;  1WIA A;  3NZS A;  1WFY A;  2PJH A;  1CMX B;  2PE6 B;  5AZF A;  3VUY A;  4AJW A;  1WX7 A;  2MX2 A;  4MJS B;  4FA6 A;  1YIW A;  3EC8 A;  4X57 B;  4PS8 A;  4B6W A;  4NPN A;  2PPH A;  4URK A;  4RM9 A;  1Y8R C;  3SU8 X;  2L0T A;  2LXA A;  1P98 A;  2KDE B;  3PRP B;  4ZRI A;  2BYE A;  4DHZ B;  3EFU A;  3UIP B;  4GSW A;  4IW0 A;  5BO4 B;  4FHJ A;  2K25 A;  3T8M A;  2KX0 A;  5LLI A;  3PLV A;  2FAZ A;  2JPH A;  1UH6 A;  2KJH B;  2M1M A;  3BIN A;  3HM6 X;  4KZ0 A;  4KIK A;  2K8H A;  2KAN A;  2MLB A;  5LXH A;  2JY6 A;  4M0W B;  2ZNV B;  3ZUN A;  1E90 A;  3PZD A;  4G3X B;  4K7U A;  2LGX A;  2MW5 A;  1IYF A;  3U30 A;  2ZZP B;  4GMV A;  2LI5 A;  2Z0D B;  3ML9 A;  4DBG A;  2MP2 A;  2HJ8 A;  3KUD B;  3PT2 B;  1TBE A;  2D07 B;  1UZX B;  3D32 A;  3TBL D;  2C7M B;  2BWE S;  1P3Q U;  2FIF A;  1J19 A;  5DPS A;  4WJP A;  2L0F A;  1GC6 A;  5EDS A;  2C60 A;  4BBN F;  3DQV A;  4MEM A;  3DVN V;  2IY0 B;  2N7E A;  3A1Q A;  3QAQ A;  5L95 C;  4W9I A;  3PRE A;  2FCN A;  2D2Q A;  4AOF A;  1G6J A;  3OAW A;  3WAN A;  2A5U A;  4XZ4 A;  4TKN A;  3VUW A;  1IP9 A;  2O6V B;  3L0W B;  2IYD B;  3L13 A;  2N1V A;  1WH3 A;  2V4L A;  3SHQ A;  4EFO A;  1IPG A;  1R4N I;  4HLE A;  3W1S C;  2EMT A;  2J0M A;  3LJ3 A;  3VHT C;  2KTR A;  2IO3 B;  2MBO A;  3JSV B;  3NHE B;  2CHZ A;  1GNU A;  3OLM D;  2M17 A;  3L10 B;  3OJ3 A;  4WJN A;  1KLV A;  2ZNV C;  4GN1 A;  3TJP A;  4JQW C;  3VH4 B;  5E6N A;  1WM3 A;  2DZK A;  2HTH A;  3SDL C;  3ZW3 A;  4BKS A;  1P1A A;  1TGZ B;  3WAO A;  2FID A;  1OEY J;  2J0J A;  3W1Y A;  3KW5 B;  3NS8 A;  5CTR C;  1SGH A;  4NY0 A;  4IUM B;  3DCG A;  2RGF A;  2CHW A;  2HE7 A;  2KFJ A;  3Q3J A;  3WAL A;  3IHP C;  5CHW A;  2Y5B B;  3KYD D;  2LVP A;  4ZYN A;  3L17 A;  4OVV A;  3QIJ A;  1UBI A;  4EUT A;  1UGM A;  4ICU A;  3R66 C;  2AEH A;  1E8Y A;  4KSK C;  4FLH A;  2Z0E B;  3X0W A;  2YVC A;  3S2A A;  4NJ7 A;  4JIO U;  2N1W A;  3AXC A;  3PPA A;  3ZIM A;  1J0G A;  1J8C A;  5L83 A;  3APF A;  1E8Z A;  1KJT A;  4HK2 A;  1WJ6 A;  2LWP A;  2MP2 B;  1NI2 A;  3PGE A;  2G4D B;  3RYT A;  2KFK A;  4II2 B;  4NQL B;  1WGG A;  1LFD A;  2KN5 A;  2K8B A;  2KQ7 A;  2KJR A;  3EEC A;  2B3A A;  2LUE A;  1Q1O A;  2WX1 A;  4FJV B;  4W9D A;  2M4N A;  2DYM A;  2VRR B;  4KDL B;  1U4A A;  2NBU A;  3M95 A;  3L16 A;  2BWF A;  3ALB A;  1K8R B;  3ZLZ A;  1XQQ A;  3UF8 A;  4B95 A;  3Q3F A;  3UIO B;  4BKT A;  2V1Y A;  1V5T A;  2N7D A;  2M8S A;  2L05 A;  1X1M A;  4BOZ B;  3V6E B;  2XBB C;  1WJN A;  2OJR A;  3JSV A;  3WIM A;  4FAD A;  3RZF A;  2CS4 A;  3H7S A;  3QJZ A;  4W9F A;  5GMV A;  2KTR B;  2GBK A;  1PQS A;  1EF5 A;  2AL6 A;  2IZV B;  2K39 A;  2UYZ B;  4F7Z A;  2AL3 A;  3H6N A;  1VD2 A;  5D7G A;  3ZTC A;  2I1K A;  3RD2 A;  1Q5W B;  4J6I A;  1XT9 B;  2MWS B;  1GC7 A;  2MBH A;  2GBM A;  4IM3 A;  2KWV B;  5E6O A;  2DYO A;  3TMP B;  3TIX A;  2L3Z A;  5AZH A;  3HM3 A;  2ZVO A;  5IAA C;  3APD A;  3UIN B;  3VXW A;  1I42 A;  2N9X A;  3UQB A;  2DEN B;  3UGB B;  4HWI B;  3EHV A;  1WE6 A;  4GGQ A;  3A4R A;  3MHS D;  3N32 A;  1WX9 A;  4HPL B;  3AI5 A;  4DDG D;  2NBV B;  3ZNH B;  3ZNI D;  1EUV B;  2Z59 B;  3U8Z A;  2G45 B;  3DDC B;  4ANV A;  1EO6 A;  5JH5 C;  1I35 A;  1P0R A;  4W9J A;  1RLF A;  3CMM B;  3ZRC A;  1H8C A;  1WMH B;  2D10 A;  4FHK A;  2HD5 B;  4I6P A;  4WWN A;  3JW0 X;  4AWJ A;  2LZ6 A;  1WGD A;  3NY5 A;  4WAA A;  1YX5 B;  2IO2 B;  2IY1 B;  1C3T A;  2ASQ A;  2KDB A;  3PRM B;  1KOT A;  5KHQ A;  1WM2 A;  4KVG B;  3M63 B;  3I3T B;  2RPQ A;  4CHK A;  4BKS D;  2KFK B;  2O2V A;  3N3K B;  3B0A A;  3PS6 A;  2JRH A;  3IBE A;  3ONS A;  3VH3 B;  2GBR A;  3KH0 A;  4FN2 A;  4IM0 A;  3JYU A;  2G3Q B;  4W9K A;  4I6L B;  4DHJ B;  2XEW A;  1WGH A;  1T0Y A;  1V49 A;  4IWO A;  2KXJ A;  3ZNZ B;  4HPM B;  1WJU A;  2MQJ A;  2RSU A;  4HCP B;  1TZ1 A;  3KVF B;  1WE7 A;  4GIV A;  4EEW A;  1GJZ A;  2KMA A;  3PHW B;  4BKG A;  4K7S A;  3QX1 A;  4B9K A;  1BT0 A;  1GG3 A;  1WJ4 A;  4BBN C;  5D6J B;  4PYZ A;  2IBI B;  3UQA A;  2LRU A;  1OGW A;  4TQ0 A;  2AWT A;  2C5L C;  1OTR B;  4G0N B;  5JZE B;  3V62 A;  2PEA A;  4MGY E;  5CHV C;  3QCA A;  2MCN B;  3ZTD A;  1Z5S B;  1R4M I;  2K6Q A;  2WDT B;  2LD9 A;  4JGH B;  2RR9 A;  3RT3 B;  3A9K A;  3W1S A;  2XK5 B;  3VVW B;  3V60 A;  3N30 A;  3PTF C;  5DPW A;  3DBH I;  4E3C A;  4DHJ D;  3JVZ X;  4W9H A;  2CKH B;  2J0K A;  2QHO A;  3HHM A;  3WAM A;  4NQK E;  3CSF A;  3MJW A;  4A20 A;  1A5R A;  1ISN A;  3DVG X;  1FXT B;  2FNJ B;  5FR6 A;  2AYO B;  5JHB A;  1MG8 A;  2JF5 A;  4AJY B;  4PS7 A;  1WMH A;  3C0R B;  5G2N A;  2MSE D;  4KZC A;  1V86 A;  2CU1 A;  1S3S G;  2EMS A;  1F9J A;  1WF9 A;  3ZRF A;  1VCB A;  3DBS A;  3DOW A;  4TQ1 A;  1TTN A;  3L54 A;  1HE8 A;  4WJO A;  2DHZ A;  1WR1 A;  5CX3 A;  5LXI B;  2IO0 B;  4A3P A;  4LJP B;  3BY4 B;  4MGI E;  2O2V B;  3ZNG C;  4CO7 A;  5J17 A;  4CYE A;  4JL9 A;  4FJY A;  4W9G A;  4WWO A;  2ZJD A;  1V2Y A;  4MGK E;  3H1U A;  2BYF A;  1WXS A;  5J18 A;  3VDZ A;  3A4S C;  4HVB A;  5AZG A;  3CST A;  2NCN A;  2UWQ A;  1V9J A;  3HIZ A;  4ZDV A;  3A33 B;  2KOX A;  4MSQ B;  1SIF A;  2LRW A;  2DYB A;  4LDT B;  2WWZ A;  4P7I A;  3VQI A;  4MEL A;  3TL5 A;  1NBF C;  4ANU A;  1D3Z A;  4MGZ E;  1LQB A;  3VTU A;  2IO1 B;  4WJQ A;  2EKE C;  4DK5 A;  1S1Q B;  2R2O A;  3MTN B;  2XK5 A;  4HDO A;  2NVU I;  1WZ3 A;  4BOS C;  1L2N A;  2BKF A;  4NJ6 A;  5D2M B;  3R7R A;  4F8C B;  3DVN U;  3A9K B;  4MH0 E;  3GZN I;  3ECI A;  4PS3 A;  4TUU A;  3VTV A;  2LAS A;  4ANX A;  2GBJ A;  2V3S A;  3VUX A;  3AUL A;  5JHA A;  3HK0 A;  2KDF B;  2ZEQ A;  4KV2 A;  1UEL A;  1ZKH A;  2JUO A;  2KHW B;  3CF6 E;  1WR6 E;  4W9C A;  1V5O A;  3ZO5 B;  3PLU A;  3P2B A;  4KSL C;  2L8J A;  4MM3 A;  2KTF A;  5DPT A;  4LDT D;  1E8X A;  3QWZ B;  2NPT A;  2A4Z A;  4GDK A;  4TV3 A;  4GDL B;  2DAF A;  2KK8 A;  3M62 B;  4YL8 A;  4K7W A;  1E5W A;  4JLC A;  2MRP A;  2KWU B;  4NAW B;  3IG3 A;  2DZI A;  1QZE A;  2KX3 A;  3RUI B;  3KUC B;  4ICV A;  4IG7 B;  3NZU A;  3PV1 A;  4E71 A;  4DWF A;  2C7H A;  2ZCB A;  3PRZ A;  2GOW A;  2LGD A;  4GB9 A;  1JRU A;  1YD8 U;  3U7D A;  1Q0W B;  3RUL A;  4DXA B;  2MBE A;  5E6P A;  2D11 A;  3K9O B;  2J7Q B;  4ANW A;  2FUH B;  1OQY A;  2JVC A;  2ZPY A;  2KMC A;  2KO3 A;  1C1Y B;  3M3J A;  2N9E B;  2L7R A;  3DVG Y;  4IC7 B;  5AEK B;  1KM7 A;  2MBQ A;  1OEY A;  3WA0 A;  2LVQ A;  2FCQ A;  1H4R A;  2JZ3 B;  4HCN B;  5CHF A;  3DBR I;  3ZDT A;  4NNJ B;  1RRB A;  1YQB A;  2BGF A;  5IA7 A;  2N9P C;  1EF1 A;  2JXX A;  5G55 A;  2KC2 A;  2KWC A;  4ASW C;  1RFA A;  1ZGU B;  2FCM A;  2WX0 A;  4HJK A;  5TR5 A;  5KHO A;  1WXA A;  1Z2M A;  2JZZ A;  3AU5 A;  3H7P B;  2LJ5 A;  2I1J A;  4PYU A;  3NOB A;  2REX A;  3K9P B;  1WI0 A;  2GBN A;  2RD0 A;  4WQO B;  1RAX A;  1UBQ A;  1V6E A;  3VFK A;  5DCN A;  3A9J A;  2KQS A;  5C1Z A;  2OOB B;  2W9N A;  2KJ6 A;  3OJ4 B;  3QA8 A;  3O65 B;  1WRD B;  3LDZ E;  4N9F 4;  3RCZ A;  4XX5 A;  2DX5 B;  2GMI C;  3KUZ A;  1SE9 A;  2KNB A;  1LM8 B;  2KLC A;  4LJO B;  2C7N B;  4MJS A;  1P9D U;  1E7U A;  4RMA A;  3L08 A;  4GDL A;  3IFW B;  4GOC A;  1E7V A;  2BYV E;  2NPT B;  2D3G A;  4GDK B;  4EKU A;  4ZRK A;  2N4F A;  2KLG A;  1WGY A;  4NAW A;  3V61 A;  2K1F A;  3H9D A;  4RM8 A;  3ENE A;  4GU2 A;  4I6N B;  3SD5 A;  1GUA B;  3X23 A;  1UD7 A;  2NBW B;  3IVF A;  4K1R B;  4ZRJ A;  4WWP A;  4AUQ C;  1L7Y A;  5J2R A;  1AAR A;  1M94 A;  1XD3 B;  2C9W B;  2KKC A;  3DBL I;  3KYC D;  4GXB A;  4KDI C;  4OVU A;  5DPR A;  3VTW A;  4EOY A;  3B08 A;  2LVO A;  4A3O A;  4EZJ A;  2KDI A;  2JT4 B;  2JWZ A;  2O6V D;  4IWQ A;  1ZW7 A;  2NS5 A;  4KIK B;  4MDK E;  2L00 B;  2ZPN A;  2KZR A;  2LGY A;  2K8C A;  4BVU C;  4M8M A;  2FCS A;  1WZ0 A;  3QQ8 B;  5HKH A;  2CR5 A;  4F1S A;  1WXM A;  3QK0 A;  2R2Q A;  3VAW A;  4DDI D;  3PHX B;  2YLM A;  2WYQ A;  2PE9 A;  4DHZ E;  3QAR A;  3QC8 B;  1WX8 A;  2DZM A;  1V81 A;  1WYW B;  3T9L A;  3ZKJ C;  2KC1 A;  3APC A;  3ML8 A;  1WGR A;  2MA9 B;  1YX6 B;  2DZJ A;  4W9L A;  1V80 A;  4G11 A;  4XC2 A;  3RZW C;  3B1L X;  3TCA A;  2BPS A;  3H7P A;  1E8W A;  2NR2 A;  5D94 A;  4FJZ A;  1NDD A;  4LCD E;  2ZCC A;  3A1Q B;  2G4S A;  3PSE B;  4BFR A;  2L76 A;  4IWP A;  2BKR B;  4EZK A;  4HDQ A;  3R3M A;  2KD0 A;  3DPD A;  3GOE A;  4MSM B;  2O6V A;  2ZVN A;  4G50 A;  4HXD A;  4W9E A;  4E74 A;  2K6D B;  4EZL A;  3A9J B;  1WY8 A;  2JRI B;  3PVL A;  5C23 A;  2M0X A;  4FUL A;  3QHT A;  4AP4 C; 
#chains in the Genus database with same CATH topology
 5D3I B;  5GXG B;  3NVV A;  2KVR A;  4K81 A;  1WXV A;  1FRR A;  1FFV A;  1WIA A;  2DWQ A;  3NZS A;  2PE6 B;  4GLS C;  1YQ3 B;  4XGA B;  1Y8R C;  3Q69 A;  4KKI A;  3UIP B;  4GSW A;  2BB5 A;  3T8M A;  2JPH A;  3HM6 X;  4YT0 B;  3CWI A;  2KAN A;  2MHJ A;  2NTS A;  2MLB A;  2QDF A;  3IT6 B;  4M0W B;  2ZNV B;  3TEZ A;  1IYF A;  1SBB B;  4C7Y A;  1TT5 B;  2MEK A;  1TY2 A;  2HJ8 A;  1FMA D;  2M56 B;  1YQ4 B;  4WJP A;  4RH6 A;  2C60 A;  4LNK A;  4BBN F;  4MEM A;  1G6J A;  1ET6 A;  2IND C;  3BK1 A;  3I63 C;  4XZ4 A;  1VZ8 A;  1IGD A;  3L0W B;  3VRB B;  3URY A;  4HLE A;  1IPG A;  1HTQ A;  3VHT C;  2KT7 A;  3NHE B;  2CHZ A;  2W82 A;  3L10 B;  2BW2 A;  2UU7 A;  1KLV A;  4GN1 A;  3VH4 B;  1WSP A;  1WM3 A;  3ZW3 A;  1I4G A;  1TGZ B;  3WAO A;  2ONQ A;  2PIA A;  3NS8 A;  5BMG A;  4ACF A;  1SGH A;  4M01 A;  2RGF A;  2CHW A;  2HE7 A;  2KFJ A;  2V3P A;  3WAL A;  3OG5 A;  5HHD G;  2E6X A;  2AEH A;  1STE A;  2Z0E B;  3X0W A;  3S2A A;  2JQR B;  3PPA A;  3PZ8 A;  4P16 A;  2KN4 A;  4HK2 A;  1NI2 A;  4NQL B;  2KN5 A;  2KQ7 A;  1C79 A;  1IBX B;  3EEC A;  1XLO A;  1Q1O A;  2LUE A;  2WX1 A;  1HZ6 A;  4KDL B;  1U4A A;  4RF0 A;  2NBU A;  1K8R B;  3ZLZ A;  3IT4 B;  3UF8 A;  1FCC C;  2JYT A;  3RZF A;  2CS4 A;  4W9F A;  3IAS 1;  2HJ1 A;  5I4D A;  2WXH A;  4J6I A;  1XT9 B;  2MBH A;  1SE4 A;  2GBM A;  2KWV B;  1KTK A;  2DYO A;  3TMP B;  1MPE A;  3HM3 A;  1MHX A;  4OZC A;  3TUO A;  4NZL B;  4GGQ A;  3A4R A;  4DDG D;  3AI5 A;  2INN E;  3ZNH B;  1QF6 A;  1EUV B;  1K50 A;  2KWD A;  1YOV B;  1I35 A;  1YJI A;  4N58 A;  2D10 A;  4WWN A;  3JW0 X;  1WGD A;  2I2Y A;  4WAA A;  2ASQ A;  2KDB A;  3W9C B;  5KHQ A;  1C76 A;  3M63 B;  2RPQ A;  3B0A A;  4NAM A;  4DHJ B;  1WGH A;  2AQ1 B;  3KLS X;  4HPM B;  2MQJ A;  4HCP B;  1WE7 A;  4GIV A;  1V8C A;  4EEW A;  1YN5 A;  1D5Z C;  2GB1 A;  1WJ4 A;  1TKY A;  1WXQ A;  5D6J B;  3UQA A;  4TQ0 A;  1EM7 A;  2AWT A;  3V62 A;  5HFY A;  2KMM A;  2K6Q A;  2WDT B;  2LD9 A;  4JGH B;  2RR9 A;  3VVW B;  3EA6 A;  4WWM A;  3N30 A;  3PTF C;  2WXF A;  5DPW A;  1NEN B;  3JVZ X;  1DGJ A;  3AE2 B;  3HHM A;  3CSF A;  3N20 C;  1XCQ L;  1AW7 A;  1J7A A;  4HPP A;  1WMH A;  3Q3N C;  5G2N A;  3KWV A;  3KQ4 A;  1SJH D;  2SAK A;  3DOW A;  4WJO A;  1TS5 A;  5CX3 A;  2IO0 B;  4ZRP A;  4LJP B;  2O2V B;  4YSX B;  3OWE B;  1V2Y A;  4HVB A;  2NCN A;  3N1Z C;  2K3U A;  1V9J A;  3AM9 A;  4LDT B;  2WWZ A;  4P7I A;  3VQI A;  4MEL A;  5BYR A;  1QOG A;  1FFU A;  1FXA A;  2EKE C;  2WXL A;  3U4E G;  4BOS C;  1L2N A;  5D2M B;  3A9K B;  4MH0 E;  2WU5 B;  4CQN A;  3ECI A;  4PS3 A;  2LAS A;  5JHA A;  3AUL A;  3HK0 A;  1WGK A;  2KHW B;  4W9C A;  4O1N A;  1FNU A;  3PLU A;  3FIL B;  3ZGZ A;  4YTP B;  3QWZ B;  1SEB D;  3IAM 1;  4P1B C;  3UI3 A;  4GDL B;  4YL8 A;  1E5W A;  2MRP A;  4NAW B;  2DZI A;  2G1E A;  3U7Z A;  4IG7 B;  3MC8 A;  2B76 B;  2GOW A;  1JRU A;  4DXG A;  2X38 A;  1YD8 U;  3U7D A;  1Q0W B;  3BK2 A;  2MBE A;  4IKG A;  1FNV A;  3K9O B;  1V1O A;  4OZA A;  1FRD A;  3DHH C;  1C1Y B;  2N9E B;  3FKY A;  1UWM A;  2WXM A;  1OEY A;  1H4R A;  3DBR I;  2EKI A;  1RRB A;  1P7F A;  2BGF A;  5G55 A;  2KC2 A;  2KWC A;  1RFA A;  2FCM A;  4HJK A;  2J52 A;  1Z2M A;  1HQR D;  2I1J A;  4PYU A;  3NOB A;  1KLU D;  2GBN A;  1V6E A;  1ZP0 B;  2INP E;  2OOB B;  2QC8 A;  1ET9 A;  3O65 B;  3LDZ E;  3SFE B;  1UGJ A;  4XX5 A;  1SE9 A;  1P9D U;  4MM3 B;  4RCO A;  1XEE A;  3L08 A;  3ZJV A;  3IFW B;  1K52 A;  1E7V A;  1KF6 B;  1SF0 A;  2BB6 A;  2KLG A;  1TIF A;  1JRP A;  1JWM D;  1UD7 A;  3RNG C;  1AAR A;  3W1S A;  1XD3 B;  2XNA C;  4KDI C;  2LVO A;  4XDC A;  2JWZ A;  2O6V D;  4IWQ A;  4MDK E;  4M0W A;  2KAJ A;  2K8C A;  4BVU C;  2FCS A;  3QK0 A;  2R2Q A;  4DDI D;  2WYQ A;  3NJT A;  2WXK A;  4QAY A;  2MA9 B;  3RZW C;  4G11 A;  3ZXR A;  3H7P A;  1E8W A;  2NR2 A;  4FJZ A;  2WP9 B;  2BKR B;  3Q8B A;  1QOF A;  3GOE A;  2DNF A;  3P4P B;  1TS4 A;  4E74 A;  1IGC A;  4LK0 M;  1L4Z B;  2M0X A;  1D5M C;  3R2T A;  3AE8 B;  1LXD A;  4IM2 A;  2MBB B;  3ZDM C;  3AU4 A;  3V6C B;  2DAJ A;  4HJG E;  4LNO A;  1WFY A;  1CMX B;  1RWS A;  2MX2 A;  1YIW A;  4LNN A;  1E6E B;  1TY0 A;  3ABV B;  1T3Q A;  2PPH A;  5EE1 A;  1JML A;  2L0T A;  3DBR B;  2KDE B;  2BYE A;  2K25 A;  2KX0 A;  2WDQ B;  3PLV A;  2FAZ A;  4KZ0 A;  5C3J B;  4KIK A;  4OHJ A;  3C19 A;  5LXH A;  2JY6 A;  3Q8A A;  2V9H A;  1E90 A;  4G3X B;  1JAL A;  3NVW A;  3ZJT A;  4GMV A;  2LI5 A;  2AQ2 B;  1ESF A;  3ML9 A;  4DBG A;  2RDB C;  3BVM A;  1TBE A;  1UUP A;  3TBL D;  3SR6 A;  3D32 A;  3AED B;  1TKE A;  2BWE S;  2FIF A;  1J19 A;  2OJW A;  5EDS A;  3DQV A;  2N7E A;  3A1Q A;  2LMC A;  3QAQ A;  3BVG A;  2D2Q A;  1JWA D;  1JCK B;  2VH2 A;  3Q8E A;  1JQ4 A;  4TKN A;  3VUW A;  1IP9 A;  2O6V B;  4ZRQ A;  1MJD A;  1PDX A;  4YTM B;  3AE5 B;  2MBO A;  2W55 A;  1VZ7 A;  3HVD A;  3OLM D;  2M17 A;  3OJ3 A;  1Y56 A;  4JQW C;  2WXI A;  2DZK A;  4BKS A;  3W1Y A;  1OFF A;  5CTR C;  2AQ3 B;  4OVZ A;  3IHP C;  2Y5B B;  3NG0 A;  2WXP A;  4ZYN A;  4OVV A;  4LNI A;  4RNA A;  3SEB A;  3H8H A;  1UBI A;  1ENF A;  3RMK C;  4ICU A;  4XE0 A;  3U2S C;  3R66 C;  4KSK C;  4FLH A;  2IGH A;  4JIO U;  2OED A;  3ZXV A;  5L83 A;  3APF A;  1SB3 C;  2G4D B;  4M02 A;  1WGG A;  3I9V 1;  5EE3 A;  1EU4 A;  3SFD B;  2VRR B;  3M95 A;  3L16 A;  2BWF A;  3ALB A;  3N1Y C;  4ARC A;  3Q3F A;  3UIO B;  2V1Y A;  1NEK B;  1V5T A;  2M8S A;  2L05 A;  2OJR A;  3JSV A;  4ZYS A;  2BQQ A;  3WIM A;  3H7S A;  3QJZ A;  2Q5W D;  4YTN B;  1EF5 A;  2AL3 A;  5IKC M;  1JRO A;  3VR9 B;  1YJJ A;  2ZVO A;  3APD A;  2N9X A;  2DEN B;  3UGB B;  1UWX A;  1WX9 A;  4HPL B;  1V97 A;  3Q14 C;  2NBV B;  4B0M A;  4L23 A;  1YN4 A;  2HTM E;  3W5U B;  1TKG A;  2JU6 X;  4FHK A;  4I6P A;  1PGX A;  2Y5P A;  2IY1 B;  1EWY C;  1C3T A;  1KOT A;  2J4X A;  1T6B X;  3I3T B;  2K9X A;  2WXO A;  4CHK A;  4BKS D;  2KFK B;  2O2V A;  3GP7 A;  1NYQ A;  3GS2 A;  3VH3 B;  3KH0 A;  4W9K A;  3AEC B;  4IWO A;  1T0Y A;  1WJU A;  2RSU A;  1TZ1 A;  1V1P A;  1F1H A;  3KVF B;  3PO0 A;  1QLB B;  2FBW B;  3QX1 A;  4BBN C;  1CK1 A;  2IBI B;  5T8I A;  2C5L C;  1OTR B;  5CHV C;  3QCA A;  3AEF B;  3ZJU A;  3A9K A;  4ZHP A;  2XK5 B;  3V60 A;  1VRA B;  4A9A A;  4E3C A;  4DHJ D;  3P4Q B;  2CKH B;  5IP4 D;  1QT9 A;  1ZDV A;  1A5R A;  2X8X X;  3DVG X;  5FR6 A;  5JHB A;  1MG8 A;  2JF5 A;  3BII D;  1SJE D;  3C0R B;  4P1C C;  2MSE D;  3Q3O C;  2VZK B;  1V86 A;  2CU1 A;  4MH8 A;  4US9 A;  3DBS A;  1TTN A;  1HE8 A;  2DHZ A;  5LXI B;  4MGI E;  3BY4 B;  4CO7 A;  5J17 A;  4JL9 A;  4FJY A;  1PGB A;  2ZJD A;  3L4P A;  2BYF A;  1WXS A;  1FO4 A;  4REZ A;  2IDY A;  4JE3 B;  1HEZ E;  3CST A;  2QIL A;  3C8Y A;  3A33 B;  1SIF A;  3I5J C;  2MH7 A;  1NBF C;  4WIP A;  1D3Z A;  1I7H A;  3VTU A;  4DQO C;  1TZO A;  1VR9 A;  1PGA A;  1GPX A;  4DK5 A;  1S1Q B;  2NVU I;  3AEE B;  2BKF A;  4KX6 B;  4NJ6 A;  4F8C B;  4YSZ B;  3DVN U;  3GZN I;  1K53 A;  3VTV A;  5IOI A;  4BAX A;  3VRA B;  2BS3 B;  2GBJ A;  3VUX A;  1HZ5 A;  4A6Q A;  1ZKH A;  2WXG A;  1V5O A;  3ZO5 B;  3P2B A;  1R7S A;  1E10 A;  2L8J A;  4MM3 A;  3BZD B;  4LDT D;  1E8X A;  4RGO S;  2A4Z A;  3Q8C A;  1LGR A;  2DAF A;  2L83 A;  2QIE B;  2EEL A;  2KWU B;  3TSS A;  3RUI B;  3PV1 A;  4HRS A;  3PRZ A;  4DXA B;  1SE2 A;  1M4V A;  2KO3 A;  3CIR B;  2GI9 A;  3DVG Y;  1KM7 A;  2MBQ A;  2LVQ A;  4S0R A;  2FCQ A;  5TSS A;  2PMV A;  4R3D A;  5CHF A;  3ZDT A;  1IUE A;  4NNJ B;  1YQB A;  5JXV A;  2WLB A;  3GB1 A;  4NJC A;  3ZYY X;  2CJN A;  2JX5 A;  5TR5 A;  3AU5 A;  2D3C A;  1WI0 A;  3BYY B;  2KQS A;  2W9N A;  4B0E A;  3LB8 C;  2WXQ A;  3RCZ A;  2KNB A;  4LJO B;  2C7N B;  1DOI A;  2W3S A;  1MVK A;  2QCZ A;  4GOC A;  3RNA C;  5LNK 1;  2NPT B;  2D3G A;  1MG4 A;  3HVZ A;  4ZRK A;  1WWT A;  2BBC A;  2I38 A;  3V61 A;  1TS2 A;  4RM8 A;  3SD5 A;  1ZPS A;  4ZRJ A;  5D3D A;  1T0R C;  4YXD B;  2C9W B;  4OVU A;  2D3B A;  1L5P A;  2PKO A;  2KDI A;  3AMZ A;  2JT4 B;  3AV8 A;  2L00 B;  2ZPN A;  1KRH A;  4ARI A;  3GZN B;  4C80 A;  5HKH A;  4D2K A;  4F1S A;  1WXM A;  4IDI A;  2YLM A;  1KFY B;  3NUH B;  3QAR A;  4BZA A;  2DZM A;  1V81 A;  1WYW B;  2KC1 A;  4XC2 A;  3DWM A;  4W9L A;  2QJL A;  3B1L X;  4OZB A;  3TCA A;  3AE4 B;  4N59 A;  1MHH E;  4LCD E;  2ZCC A;  2G4S A;  2H88 B;  4BFR A;  4IWP A;  5AUI A;  3R3M A;  2KD0 A;  4MSM B;  2O6V A;  4G50 A;  1DYQ A;  3A9J B;  2JRI B;  2PVG C;  4WH4 A;  5IA7 A;  2L32 A;  1JW9 D;  3AE7 B;  1ZE3 D;  1XF5 L;  4FBJ B;  2LXC A;  3WAP A;  5G5G A;  2Z8L A;  3ZVV A;  4KGR A;  2PJH A;  5AZF A;  3VUY A;  1WX7 A;  3EC8 A;  4X57 B;  4PS8 A;  4XDD A;  4URK A;  2K22 A;  4HEA 1;  5BYS A;  3RNC C;  1N61 A;  3SU8 X;  3PRP B;  1P98 A;  4ZRI A;  1VZ6 A;  4DHZ B;  5BO4 B;  2W3R A;  2KJH B;  1UH6 A;  1I4H A;  1C9F A;  2Y3A A;  1XO3 A;  3T3N A;  4K7U A;  2MW5 A;  2LGI A;  3U30 A;  2J42 A;  4JWU C;  2Z0D B;  2WXJ A;  3PT2 B;  2D07 B;  1UZX B;  2WXR A;  2C7M B;  1P3Q U;  5DPS A;  2L0F A;  4C7Z A;  2LHD A;  1FM0 D;  3DVN V;  2IY0 B;  4YSY B;  5L95 C;  4W9I A;  3PRE A;  4N6E B;  2FCN A;  4WUR A;  1WYG A;  1I4X A;  2N1V A;  4EFO A;  1R4N I;  2FE8 A;  3MFG A;  3W1S C;  1NI3 A;  3WCQ A;  1GNU A;  5IN7 A;  3DHI C;  4WJN A;  3N9Y C;  1ROE A;  2ZNV C;  1P7E A;  5E6N A;  3NVZ A;  3VR8 B;  2G9H D;  1OEY J;  4AQ7 A;  3KW5 B;  4IUM B;  3Q3J A;  4USA A;  5CHW A;  3GE8 C;  3P4S B;  3KYD D;  5FKA C;  2LVP A;  3L17 A;  1PFD A;  1UGM A;  4AS1 A;  1E8Y A;  2K5P A;  2QSD A;  2N1W A;  3AXC A;  1J0G A;  1E8Z A;  2PW9 A;  3RI7 C;  2MP2 B;  5C2T B;  3RYT A;  2KFK A;  3ZQ4 A;  1UF0 A;  1LFD A;  1GOZ A;  2ACZ B;  1AWD A;  2KJR A;  4W9D A;  4FJV B;  1WRI A;  3R8B A;  4BKT A;  4B95 A;  3AEB B;  3W5V B;  1E9M A;  3TEW A;  2XBB C;  1WJN A;  3TEY A;  1SE3 A;  2QMT A;  4J3O D;  2KTR B;  2GBK A;  2K39 A;  4F7Z A;  2IZV B;  2UYZ B;  2IGD A;  3HUI A;  1CJE A;  5D7G A;  3ZTC A;  2I1K A;  3RD2 A;  2DLB A;  3V05 A;  3P1M A;  2VH1 A;  2BVC A;  2M19 A;  2L3Z A;  5AZH A;  5IAA C;  3VXW A;  3B9J A;  4HWI B;  2GRI A;  2JWU A;  1N5X A;  3ZNI D;  2Z59 B;  4KGS A;  4ANV A;  3E9S A;  1ZXI A;  1P0R A;  4W9J A;  1RLF A;  3CMM B;  1H8C A;  1WMH B;  4L1B A;  2LZ6 A;  1R4N B;  1YX5 B;  1VDV A;  2IO2 B;  3PRM B;  4KVG B;  4TSS A;  1IBX A;  1F2R I;  3N3K B;  2ZW1 A;  2BS2 B;  1R4M B;  2JXT A;  3ONS A;  2GBR A;  1T5X D;  4IM0 A;  2G3Q B;  2XEW A;  1V49 A;  2H89 B;  2KXJ A;  3LYY A;  1TYG B;  1GJZ A;  2CU3 A;  2NTT A;  3P63 A;  4B9K A;  1PYW D;  4K3C A;  2MJE A;  4G0N B;  5JZE B;  4MGY E;  2MCN B;  4ZOH C;  1Z5S B;  1QOA A;  5FR3 A;  3RT3 B;  1N60 A;  1RYJ A;  3DBH I;  4C4V B;  2WNM A;  2LEK A;  4W9H A;  1OQR A;  4NQK E;  4A20 A;  1QKZ A;  1ISN A;  1SIJ A;  4AJY B;  2KDM A;  1K51 A;  3Q8F A;  4KZC A;  1S3S G;  2D3A A;  3ZRF A;  4TQ1 A;  2JZP A;  1F77 A;  4A3P A;  1FPY A;  3ZNG C;  3RPF C;  4CYE A;  4WWO A;  4MGK E;  5E6J A;  3VDZ A;  3A4S C;  5AZG A;  4K3B A;  4ZDV A;  1QIL A;  2KOX A;  4MSQ B;  1SSN A;  1HA5 A;  4JX1 C;  4ANU A;  3AEA B;  2VZK D;  2IO1 B;  4WJQ A;  4Q2J A;  2R2O A;  3MTN B;  3P42 A;  3I57 A;  1WZ3 A;  3R7R A;  5BMH A;  3DHG C;  3AB5 A;  4TUU A;  2WGS A;  4JWS C;  5MPO A;  4LTU A;  1Q10 A;  1B1Z A;  2V3S A;  2KDF B;  2ZEQ A;  2JUO A;  3AE3 B;  3CF6 E;  1ZOY B;  4LNF A;  4KSL C;  2KTF A;  5BYQ A;  2NPT A;  2KK8 A;  1BXT A;  4K7W A;  1GB4 A;  4DXF A;  3IG3 A;  2KX3 A;  2BS4 B;  3KUC B;  2N9K A;  4ICV A;  3NZU A;  4S17 A;  4E71 A;  4DWF A;  2LGD A;  1A70 A;  3AE1 B;  2ZW0 A;  3R2I A;  3BWU D;  1JWB D;  2JVC A;  1LO5 D;  4TMA B;  3DBH B;  2L7R A;  4IC7 B;  2XN9 C;  1L6V A;  4ASW C;  1ZGU B;  2WX0 A;  2WQY B;  2IGG A;  1HXY D;  3H7P B;  1T0S C;  1WXA A;  1TS3 A;  5KHO A;  1D6E C;  3K9P B;  2RD0 A;  2RDG A;  2IPK D;  1C4A A;  1F0Z A;  4C00 A;  3A9J A;  1SXT A;  3OJ4 B;  3RN9 C;  3DBL B;  4P6V F;  4N9F 4;  1I4R A;  2DX5 B;  3KUZ A;  1N5W A;  3FIL A;  1LM8 B;  2PVO D;  2V3N A;  4RMA A;  4GDL A;  4RF1 A;  2BYV E;  4GDK B;  4EKU A;  1XXG A;  1WGY A;  4NAW A;  2K1F A;  3ENE A;  4I6N B;  3X23 A;  2NMQ A;  4WWP A;  1L7Y A;  1J7C A;  3KYC D;  4GXB A;  2KKC A;  3Q2A C;  2WXN A;  4RFB A;  3V3X A;  3VTW A;  4PK1 A;  3B08 A;  3RNF C;  4C56 C;  4US8 A;  4MT5 A;  1L0V B;  1ZW7 A;  4KIK B;  2KZR A;  1KH0 A;  1UNS A;  4M8M A;  1WZ0 A;  3QQ8 B;  3PHX B;  4DHZ E;  2DBY A;  2PE9 A;  3BYT B;  1CZP A;  4KKJ A;  2GLS A;  3T9L A;  1WGR A;  1YX6 B;  2DZJ A;  1FNW A;  2BPS A;  5FK9 C;  3LXF A;  3A1Q B;  2YEP B;  2L76 A;  1EWC A;  1HTO A;  4EZK A;  4HDQ A;  2AX5 A;  3DPD A;  2V0G A;  4HXD A;  2K6D B;  4FUL A;  3QHT A;  1YNT E;  2BF8 B;  3R7Q A;  2CHX A;  1YJ1 A;  4II3 B;  1T0Q C;  4M8N A;  1E0Z A;  4AJW A;  4FAD A;  4MJS B;  4FA6 A;  2KAC A;  2QEJ C;  2M0A A;  4NPN A;  4B6W A;  2MJ3 A;  1D5X C;  4RM9 A;  2LXA A;  1N6Z A;  3EFU A;  2Y5C A;  4IW0 A;  4FHJ A;  1F52 A;  4RGN A;  5LLI A;  2M1M A;  3BIN A;  1E7P B;  4ITK A;  5EE9 A;  2K8H A;  1NYR A;  3ZUN A;  3PZD A;  2KYW A;  2LGX A;  4FXC A;  2ZZP B;  2MP2 A;  3KUD B;  4M00 A;  1JWS D;  5HG2 A;  1BUI C;  4EE2 A;  3NZ3 A;  1GC6 A;  3AH7 A;  3U52 E;  4A90 A;  3N1X C;  4AOF A;  4UDU C;  2WS3 B;  3OAW A;  3WAN A;  2A5U A;  1D4B A;  1I4P A;  2IYD B;  3L13 A;  2V4L A;  1WH3 A;  3SHQ A;  2EMT A;  2J0M A;  3LJ3 A;  2KTR A;  2IO3 B;  3JSV B;  3TJP A;  3E56 A;  2BT6 A;  2RPV A;  3AE9 B;  2HTH A;  3SDL C;  1P1A A;  1MFW A;  2FID A;  2J0J A;  5BMI A;  2R61 A;  4NY0 A;  3DCG A;  1KLG D;  3FAH A;  1YMH E;  3QIJ A;  1L0X B;  4EUT A;  1DOY A;  3B2G A;  2LGS A;  2YVC A;  3ZIM A;  4NJ7 A;  1J8C A;  3EUB 2;  1N63 A;  1KJT A;  1WJ6 A;  2LWP A;  3PGE A;  4II2 B;  2SEB D;  2K8B A;  2W54 A;  2B3A A;  2M4N A;  2DYM A;  1I4Q A;  1XLN A;  2WDR B;  1XQQ A;  4OW0 A;  2CJO A;  1V1P B;  2N7D A;  1X1M A;  4BOZ B;  3V6E B;  3DWG C;  3RFZ B;  5GMV A;  4YWG G;  1CQV A;  1PQS A;  2AL6 A;  3KWL A;  3H6N A;  1VD2 A;  1L0Y B;  1Q5W B;  2MWS B;  1GC7 A;  4IM3 A;  5E6O A;  2L52 A;  3TIX A;  2RMM A;  3UIN B;  2J53 A;  4C4V A;  1I42 A;  3BVZ A;  2LHE A;  3Q3M C;  4HKQ A;  3EHV A;  1WE6 A;  3MHS D;  3N32 A;  5H8Y E;  2ON8 A;  5AUK A;  1RFK A;  3U8Z A;  2G45 B;  2LUM A;  3DDC B;  1EO6 A;  5JH5 C;  2HDE A;  1XLQ A;  3ZRC A;  2HD5 B;  4ZHO A;  3TEX A;  4AWJ A;  4RGM A;  3NY5 A;  1WM2 A;  3RNB C;  2K0P A;  3P4R B;  3W2D A;  3PS6 A;  2JRH A;  3IBE A;  4FN2 A;  3AEG B;  3JYU A;  4I6L B;  1ZDX A;  3ETR A;  3ZNZ B;  1TJE A;  2KMA A;  3PHW B;  1F2R C;  4BKG A;  4K7S A;  1L4D B;  2OHF A;  1BT0 A;  1GG3 A;  1RM6 C;  4PYZ A;  1GB1 A;  2LRU A;  1OGW A;  2IJ0 A;  2PEA A;  3ZTD A;  1R4M I;  2RDH A;  2KQ4 X;  2WHI A;  1NVI D;  3AE6 B;  4MAC A;  2J0K A;  2QHO A;  3WAM A;  3MJW A;  2E3T A;  1FXT B;  2FNJ B;  2AYO B;  3MC9 A;  1VLB A;  2V4I B;  4PS7 A;  4XWT A;  3MHZ A;  3HRD D;  3J9C A;  3RNE C;  2EMS A;  1F9J A;  1WF9 A;  1VCB A;  1C77 A;  1N62 A;  1ZUD 2;  3L54 A;  4HKZ E;  1WR1 A;  4WQM A;  2JSV X;  4W9G A;  1DOX A;  3H1U A;  5J18 A;  2UWQ A;  3HIZ A;  5H92 C;  1FEH A;  1GAQ B;  3GE3 C;  3Q6B A;  1JWU D;  2DYB A;  2LRW A;  3PZ7 A;  1XCT L;  1QOB A;  3TL5 A;  4A55 A;  4MGZ E;  1LQB A;  2N9L A;  4XYC A;  2XK5 A;  4HDO A;  5IO9 A;  1C4P A;  5EE0 A;  3EFC A;  4ANX A;  3EGR A;  4KV2 A;  2WU2 B;  1UEL A;  1WR6 E;  4PT5 A;  1FXI A;  5DPT A;  4GDK A;  4TV3 A;  5G5H A;  3M62 B;  4JLC A;  2YEP F;  1QZE A;  1AN8 A;  2L1A A;  2FUG 1;  1FIQ A;  2C7H A;  2ZCB A;  4GB9 A;  2BYT A;  3RUL A;  5E6P A;  2D11 A;  1VJK A;  4L2Y A;  2J7Q B;  4ANW A;  2FUH B;  2LFI A;  1OQY A;  2ZPY A;  1ZXH A;  3MC0 B;  2PLP A;  2KMC A;  3M3J A;  3NRZ A;  1C78 A;  5AEK B;  3WA0 A;  4HCN B;  2JZ3 B;  2BTE A;  2N9P C;  1EF1 A;  1L6U A;  4HRO A;  2JXX A;  4A8X C;  1YN3 A;  2JYE A;  2JZZ A;  2LJ5 A;  2REX A;  2PTL A;  4WQO B;  1RAX A;  1UBQ A;  1OQQ A;  1B9R A;  4JPS A;  3T3O A;  3VFK A;  5DCN A;  4H2A A;  5C1Z A;  2KJ6 A;  3QA8 A;  3B2F A;  1WRD B;  2INC C;  3NVY A;  2GMI C;  4LLG M;  1FCL A;  2TSS A;  3NS1 A;  3O13 A;  2KLC A;  4WAF A;  4MJS A;  2LJI A;  1E7U A;  4KGT A;  2N7J A;  1J7B A;  2N4F A;  2MJD A;  3H9D A;  4GU2 A;  4IOI E;  1GUA B;  2NBW B;  1PUT A;  3IVF A;  4K1R B;  4AUQ C;  3FC4 A;  5J2R A;  2ICI A;  1M94 A;  1QQR A;  2WDV B;  3DBL I;  4EOY A;  3UQB A;  5DPR A;  4EZJ A;  3MJ5 A;  4XWW A;  4A3O A;  2NS5 A;  1MI0 A;  2LGY A;  2KVZ A;  2CR5 A;  1FD6 A;  3VAW A;  1BML C;  1ACC A;  3IXS A;  3QC8 B;  1WX8 A;  3ZKJ C;  3ML8 A;  3APC A;  1V80 A;  1AYF A;  5D94 A;  1NDD A;  2D5G A;  1C4C A;  3PSE B;  1EU3 A;  2ZVN A;  4W9E A;  1XLP A;  2N0S B;  5HI1 A;  4EZL A;  3AN1 A;  1WY8 A;  5C23 A;  3MP9 A;  3PVL A;  4AP4 C;  4RGT A; 
#chains in the Genus database with same CATH homology
 1LXD A;  2BF8 B;  3R7Q A;  2CHX A;  1YJ1 A;  4II3 B;  4IM2 A;  2MBB B;  3ZDM C;  2KVR A;  3AU4 A;  4K81 A;  3V6C B;  2DAJ A;  4FBJ B;  1WXV A;  2LXC A;  4M8N A;  3WAP A;  3ZVV A;  1WIA A;  3NZS A;  1WFY A;  2PJH A;  1CMX B;  2PE6 B;  5AZF A;  3VUY A;  4AJW A;  1WX7 A;  2MX2 A;  4MJS B;  4FA6 A;  1YIW A;  3EC8 A;  4X57 B;  4PS8 A;  4B6W A;  4NPN A;  2PPH A;  4URK A;  4RM9 A;  1Y8R C;  3SU8 X;  2L0T A;  2LXA A;  1P98 A;  2KDE B;  3PRP B;  4ZRI A;  2BYE A;  4DHZ B;  3EFU A;  3UIP B;  4GSW A;  4IW0 A;  5BO4 B;  4FHJ A;  2K25 A;  3T8M A;  2KX0 A;  5LLI A;  3PLV A;  2FAZ A;  2JPH A;  1UH6 A;  2KJH B;  2M1M A;  3BIN A;  3HM6 X;  4KZ0 A;  4KIK A;  2K8H A;  2KAN A;  2MLB A;  5LXH A;  2JY6 A;  4M0W B;  2ZNV B;  3ZUN A;  1E90 A;  3PZD A;  4G3X B;  4K7U A;  2LGX A;  2MW5 A;  1IYF A;  3U30 A;  2ZZP B;  4GMV A;  2LI5 A;  2Z0D B;  3ML9 A;  4DBG A;  2MP2 A;  2HJ8 A;  3KUD B;  3PT2 B;  1TBE A;  2D07 B;  1UZX B;  3D32 A;  3TBL D;  2C7M B;  2BWE S;  1P3Q U;  2FIF A;  1J19 A;  5DPS A;  4WJP A;  2L0F A;  1GC6 A;  5EDS A;  2C60 A;  4BBN F;  3DQV A;  4MEM A;  3DVN V;  2IY0 B;  2N7E A;  3A1Q A;  3QAQ A;  5L95 C;  4W9I A;  3PRE A;  2FCN A;  2D2Q A;  4AOF A;  1G6J A;  3OAW A;  3WAN A;  2A5U A;  4XZ4 A;  4TKN A;  3VUW A;  1IP9 A;  2O6V B;  3L0W B;  2IYD B;  3L13 A;  2N1V A;  1WH3 A;  2V4L A;  3SHQ A;  4EFO A;  1IPG A;  1R4N I;  4HLE A;  3W1S C;  2EMT A;  2J0M A;  3LJ3 A;  3VHT C;  2KTR A;  2IO3 B;  2MBO A;  3JSV B;  3NHE B;  2CHZ A;  1GNU A;  3OLM D;  2M17 A;  3L10 B;  3OJ3 A;  4WJN A;  1KLV A;  2ZNV C;  4GN1 A;  3TJP A;  4JQW C;  3VH4 B;  5E6N A;  1WM3 A;  2DZK A;  2HTH A;  3SDL C;  3ZW3 A;  4BKS A;  1P1A A;  1TGZ B;  3WAO A;  2FID A;  1OEY J;  2J0J A;  3W1Y A;  3KW5 B;  3NS8 A;  5CTR C;  1SGH A;  4NY0 A;  4IUM B;  3DCG A;  2RGF A;  2CHW A;  2HE7 A;  2KFJ A;  3Q3J A;  3WAL A;  3IHP C;  5CHW A;  2Y5B B;  3KYD D;  2LVP A;  4ZYN A;  3L17 A;  4OVV A;  3QIJ A;  1UBI A;  4EUT A;  1UGM A;  4ICU A;  3R66 C;  2AEH A;  1E8Y A;  4KSK C;  4FLH A;  2Z0E B;  3X0W A;  2YVC A;  3S2A A;  4NJ7 A;  4JIO U;  2N1W A;  3AXC A;  3PPA A;  3ZIM A;  1J0G A;  1J8C A;  5L83 A;  3APF A;  1E8Z A;  1KJT A;  4HK2 A;  1WJ6 A;  2LWP A;  2MP2 B;  1NI2 A;  3PGE A;  2G4D B;  3RYT A;  2KFK A;  4II2 B;  4NQL B;  1WGG A;  1LFD A;  2KN5 A;  2K8B A;  2KQ7 A;  2KJR A;  3EEC A;  2B3A A;  2LUE A;  1Q1O A;  2WX1 A;  4FJV B;  4W9D A;  2M4N A;  2DYM A;  2VRR B;  4KDL B;  1U4A A;  2NBU A;  3M95 A;  3L16 A;  2BWF A;  3ALB A;  1K8R B;  3ZLZ A;  1XQQ A;  3UF8 A;  4B95 A;  3Q3F A;  3UIO B;  4BKT A;  2V1Y A;  1V5T A;  2N7D A;  2M8S A;  2L05 A;  1X1M A;  4BOZ B;  3V6E B;  2XBB C;  1WJN A;  2OJR A;  3JSV A;  3WIM A;  4FAD A;  3RZF A;  2CS4 A;  3H7S A;  3QJZ A;  4W9F A;  5GMV A;  2KTR B;  2GBK A;  1PQS A;  1EF5 A;  2AL6 A;  2IZV B;  2K39 A;  2UYZ B;  4F7Z A;  2AL3 A;  3H6N A;  1VD2 A;  5D7G A;  3ZTC A;  2I1K A;  3RD2 A;  1Q5W B;  4J6I A;  1XT9 B;  2MWS B;  1GC7 A;  2MBH A;  2GBM A;  4IM3 A;  2KWV B;  5E6O A;  2DYO A;  3TMP B;  3TIX A;  2L3Z A;  5AZH A;  3HM3 A;  2ZVO A;  5IAA C;  3APD A;  3UIN B;  3VXW A;  1I42 A;  2N9X A;  3UQB A;  2DEN B;  3UGB B;  4HWI B;  3EHV A;  1WE6 A;  4GGQ A;  3A4R A;  3MHS D;  3N32 A;  1WX9 A;  4HPL B;  3AI5 A;  4DDG D;  2NBV B;  3ZNH B;  3ZNI D;  1EUV B;  2Z59 B;  3U8Z A;  2G45 B;  3DDC B;  4ANV A;  1EO6 A;  5JH5 C;  1I35 A;  1P0R A;  4W9J A;  1RLF A;  3CMM B;  3ZRC A;  1H8C A;  1WMH B;  2D10 A;  4FHK A;  2HD5 B;  4I6P A;  4WWN A;  3JW0 X;  4AWJ A;  2LZ6 A;  1WGD A;  3NY5 A;  4WAA A;  1YX5 B;  2IO2 B;  2IY1 B;  1C3T A;  2ASQ A;  2KDB A;  3PRM B;  1KOT A;  5KHQ A;  1WM2 A;  4KVG B;  3M63 B;  3I3T B;  2RPQ A;  4CHK A;  4BKS D;  2KFK B;  2O2V A;  3N3K B;  3B0A A;  3PS6 A;  2JRH A;  3IBE A;  3ONS A;  3VH3 B;  2GBR A;  3KH0 A;  4FN2 A;  4IM0 A;  3JYU A;  2G3Q B;  4W9K A;  4I6L B;  4DHJ B;  2XEW A;  1WGH A;  1T0Y A;  1V49 A;  4IWO A;  2KXJ A;  3ZNZ B;  4HPM B;  1WJU A;  2MQJ A;  2RSU A;  4HCP B;  1TZ1 A;  3KVF B;  1WE7 A;  4GIV A;  4EEW A;  1GJZ A;  2KMA A;  3PHW B;  4BKG A;  4K7S A;  3QX1 A;  4B9K A;  1BT0 A;  1GG3 A;  1WJ4 A;  4BBN C;  5D6J B;  4PYZ A;  2IBI B;  3UQA A;  2LRU A;  1OGW A;  4TQ0 A;  2AWT A;  2C5L C;  1OTR B;  4G0N B;  5JZE B;  3V62 A;  2PEA A;  4MGY E;  5CHV C;  3QCA A;  2MCN B;  3ZTD A;  1Z5S B;  1R4M I;  2K6Q A;  2WDT B;  2LD9 A;  4JGH B;  2RR9 A;  3RT3 B;  3A9K A;  3W1S A;  2XK5 B;  3VVW B;  3V60 A;  3N30 A;  3PTF C;  5DPW A;  3DBH I;  4E3C A;  4DHJ D;  3JVZ X;  4W9H A;  2CKH B;  2J0K A;  2QHO A;  3HHM A;  3WAM A;  4NQK E;  3CSF A;  3MJW A;  4A20 A;  1A5R A;  1ISN A;  3DVG X;  1FXT B;  2FNJ B;  5FR6 A;  2AYO B;  5JHB A;  1MG8 A;  2JF5 A;  4AJY B;  4PS7 A;  1WMH A;  3C0R B;  5G2N A;  2MSE D;  4KZC A;  1V86 A;  2CU1 A;  1S3S G;  2EMS A;  1F9J A;  1WF9 A;  3ZRF A;  1VCB A;  3DBS A;  3DOW A;  4TQ1 A;  1TTN A;  3L54 A;  1HE8 A;  4WJO A;  2DHZ A;  1WR1 A;  5CX3 A;  5LXI B;  2IO0 B;  4A3P A;  4LJP B;  3BY4 B;  4MGI E;  2O2V B;  3ZNG C;  4CO7 A;  5J17 A;  4CYE A;  4JL9 A;  4FJY A;  4W9G A;  4WWO A;  2ZJD A;  1V2Y A;  4MGK E;  3H1U A;  2BYF A;  1WXS A;  5J18 A;  3VDZ A;  3A4S C;  4HVB A;  5AZG A;  3CST A;  2NCN A;  2UWQ A;  1V9J A;  3HIZ A;  4ZDV A;  3A33 B;  2KOX A;  4MSQ B;  1SIF A;  2LRW A;  2DYB A;  4LDT B;  2WWZ A;  4P7I A;  3VQI A;  4MEL A;  3TL5 A;  1NBF C;  4ANU A;  1D3Z A;  4MGZ E;  1LQB A;  3VTU A;  2IO1 B;  4WJQ A;  2EKE C;  4DK5 A;  1S1Q B;  2R2O A;  3MTN B;  2XK5 A;  4HDO A;  2NVU I;  1WZ3 A;  4BOS C;  1L2N A;  2BKF A;  4NJ6 A;  5D2M B;  3R7R A;  4F8C B;  3DVN U;  3A9K B;  4MH0 E;  3GZN I;  3ECI A;  4PS3 A;  4TUU A;  3VTV A;  2LAS A;  4ANX A;  2GBJ A;  2V3S A;  3VUX A;  3AUL A;  5JHA A;  3HK0 A;  2KDF B;  2ZEQ A;  4KV2 A;  1UEL A;  1ZKH A;  2JUO A;  2KHW B;  3CF6 E;  1WR6 E;  4W9C A;  1V5O A;  3ZO5 B;  3PLU A;  3P2B A;  4KSL C;  2L8J A;  4MM3 A;  2KTF A;  5DPT A;  4LDT D;  1E8X A;  3QWZ B;  2NPT A;  2A4Z A;  4GDK A;  4TV3 A;  4GDL B;  2DAF A;  2KK8 A;  3M62 B;  4YL8 A;  4K7W A;  1E5W A;  4JLC A;  2MRP A;  2KWU B;  4NAW B;  3IG3 A;  2DZI A;  1QZE A;  2KX3 A;  3RUI B;  3KUC B;  4ICV A;  4IG7 B;  3NZU A;  3PV1 A;  4E71 A;  4DWF A;  2C7H A;  2ZCB A;  3PRZ A;  2GOW A;  2LGD A;  4GB9 A;  1JRU A;  1YD8 U;  3U7D A;  1Q0W B;  3RUL A;  4DXA B;  2MBE A;  5E6P A;  2D11 A;  3K9O B;  2J7Q B;  4ANW A;  2FUH B;  1OQY A;  2JVC A;  2ZPY A;  2KMC A;  2KO3 A;  1C1Y B;  3M3J A;  2N9E B;  2L7R A;  3DVG Y;  4IC7 B;  5AEK B;  1KM7 A;  2MBQ A;  1OEY A;  3WA0 A;  2LVQ A;  2FCQ A;  1H4R A;  2JZ3 B;  4HCN B;  5CHF A;  3DBR I;  3ZDT A;  4NNJ B;  1RRB A;  1YQB A;  2BGF A;  5IA7 A;  2N9P C;  1EF1 A;  2JXX A;  5G55 A;  2KC2 A;  2KWC A;  4ASW C;  1RFA A;  1ZGU B;  2FCM A;  2WX0 A;  4HJK A;  5TR5 A;  5KHO A;  1WXA A;  1Z2M A;  2JZZ A;  3AU5 A;  3H7P B;  2LJ5 A;  2I1J A;  4PYU A;  3NOB A;  2REX A;  3K9P B;  1WI0 A;  2GBN A;  2RD0 A;  4WQO B;  1RAX A;  1UBQ A;  1V6E A;  3VFK A;  5DCN A;  3A9J A;  2KQS A;  5C1Z A;  2OOB B;  2W9N A;  2KJ6 A;  3OJ4 B;  3QA8 A;  3O65 B;  1WRD B;  3LDZ E;  4N9F 4;  3RCZ A;  4XX5 A;  2DX5 B;  2GMI C;  3KUZ A;  1SE9 A;  2KNB A;  1LM8 B;  2KLC A;  4LJO B;  2C7N B;  4MJS A;  1P9D U;  1E7U A;  4RMA A;  3L08 A;  4GDL A;  3IFW B;  4GOC A;  1E7V A;  2BYV E;  2NPT B;  2D3G A;  4GDK B;  4EKU A;  4ZRK A;  2N4F A;  2KLG A;  1WGY A;  4NAW A;  3V61 A;  2K1F A;  3H9D A;  4RM8 A;  3ENE A;  4GU2 A;  4I6N B;  3SD5 A;  1GUA B;  3X23 A;  1UD7 A;  2NBW B;  3IVF A;  4K1R B;  4ZRJ A;  4WWP A;  4AUQ C;  1L7Y A;  5J2R A;  1AAR A;  1M94 A;  1XD3 B;  2C9W B;  2KKC A;  3DBL I;  3KYC D;  4GXB A;  4KDI C;  4OVU A;  5DPR A;  3VTW A;  4EOY A;  3B08 A;  2LVO A;  4A3O A;  4EZJ A;  2KDI A;  2JT4 B;  2JWZ A;  2O6V D;  4IWQ A;  1ZW7 A;  2NS5 A;  4KIK B;  4MDK E;  2L00 B;  2ZPN A;  2KZR A;  2LGY A;  2K8C A;  4BVU C;  4M8M A;  2FCS A;  1WZ0 A;  3QQ8 B;  5HKH A;  2CR5 A;  4F1S A;  1WXM A;  3QK0 A;  2R2Q A;  3VAW A;  4DDI D;  3PHX B;  2YLM A;  2WYQ A;  2PE9 A;  4DHZ E;  3QAR A;  3QC8 B;  1WX8 A;  2DZM A;  1V81 A;  1WYW B;  3T9L A;  3ZKJ C;  2KC1 A;  3APC A;  3ML8 A;  1WGR A;  2MA9 B;  1YX6 B;  2DZJ A;  4W9L A;  1V80 A;  4G11 A;  4XC2 A;  3RZW C;  3B1L X;  3TCA A;  2BPS A;  3H7P A;  1E8W A;  2NR2 A;  5D94 A;  4FJZ A;  1NDD A;  4LCD E;  2ZCC A;  3A1Q B;  2G4S A;  3PSE B;  4BFR A;  2L76 A;  4IWP A;  2BKR B;  4EZK A;  4HDQ A;  3R3M A;  2KD0 A;  3DPD A;  3GOE A;  4MSM B;  2O6V A;  2ZVN A;  4G50 A;  4HXD A;  4W9E A;  4E74 A;  2K6D B;  4EZL A;  3A9J B;  1WY8 A;  2JRI B;  3PVL A;  5C23 A;  2M0X A;  4FUL A;  3QHT A;  4AP4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...