5LXHA

Gabarap-l1 atg4b lir complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
total genus 35
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lxhA00
2ZCBA 4NNJB 4WWOA 5AZHA 2KKCA 4M8MA 4DXAB 4GDLA 4GSWA 2N7DA 4FJZA 4K7UA 2C60A 5CHWA 1P9DU 3HM6X 4NJ7A 1KM7A 1WMHB 4B9KA 1V2YA 3ZKJC 1TBEA 4KIKA 2AL3A 2NVUI 5AEKB 2BKFA 4AUQC 1IP9A 3SD5A 3UIOB 4TV3A 2EKEC 2K6DB 3ZTCA 1P0RA 2C9WB 2L76A 3AULA 4A3PA 1RLFA 5C1ZA 1WYWB 2O6VA 2KN5A 1V80A 3DBRI 3QC8B 1I35A 4RMAA 2D3GA 2PEAA 1X1MA 3C0RB 1Q1OA 2N7EA 2KMCA 1CMXB 2OOBB 4KDLB 3NZUA 2LWPA 1Q5WB 3A9JA 4W9LA 1XQQA 1XD3B 2KJHB 4NQKE 2RSUA 4W9GA 5DPSA 3DVNV 3SDLC 5J18A 2JPHA 1UZXB 4MELA 1V49A 2L05A 5G55A 3WIMA 3VTVA 2A5UA 2J0JA 2KMAA 2BYVE 2HD5B 2N9EB 2Z0DB 5CX3A 2K8BA 3BINA 4KDIC 4A20A 4FADA 2KWVB 2LXAA 3PVLA 4KVGB 4PS8A 4HDQA 1VD2A 2KQ7A 1E8WA 2KD0A 2JZ3B 4E71A 4ZDVA 4DWFA 4G50A 3GOEA 3APFA 4W9EA 2DHZA 4IM2A 1V81A 1GJZA 3DCGA 1KJTA 1PQSA 1WE6A 2GBKA 4RM8A 3A9KA 2IO0B 2C5LC 2L00B 2BKRB 2N9PC 4IC7B 3RCZA 4IM0A 4F7ZA 5CHVC 2AEHA 4ICUA 4MSMB 1WXSA 1ZW7A 2KC1A 5TR5A 3ZLZA 3ZDMC 3S2AA 1Z5SB 3HIZA 1UD7A 2VRRB 2BYFA 3NZSA 2L7RA 4HJKA 3PSEB 4GDKA 1V5OA 2B3AA 5DPRA 3WANA 4RM9A 3ZNID 4BKGA 2NBUA 5L83A 4ANXA 2M0XA 3T9LA 2WX1A 3AU4A 2IO1B 4GDLB 1EF5A 4E74A 2OJRA 2MW5A 2LXCA 2N1VA 3H6NA 3N30A 3VQIA 3X23A 3ZRFA 2RGFA 4B6WA 5JH5C 4GB9A 4KIKB 4WJPA 4MDKE 3D32A 3I3TB 2Z59B 4JIOU 2DZMA 2FCQA 3RZFA 2KVRA 3UIPB 4DHZE 4M8NA 4A3OA 2JWZA 1XT9B 3RZWC 3VUYA 4LCDE 2G45B 3QIJA 2NBWB 1S3SG 2EMSA 3V62A 3WA0A 3MJWA 4AP4C 4ANWA 2Y5BB 2MBHA 4HPMB 5D7GA 1WM2A 3ZVVA 2KWCA 2LRWA 3DBHI 4FJVB 4IW0A 4WQOB 2V1YA 2ZVOA 1ZKHA 4FULA 3RYTA 4HK2A 1LM8B 4E3CA 1AARA 1J8CA 3APDA 1JRUA 2RD0A 3B08A 1YQBA 2DAFA 1WXAA 2ZVNA 4GN1A 3QHTA 1WE7A 3PHXB 1A5RA 1LQBA 2C7HA 2FIFA 1EUVB 3EC8A 3IFWB 2XK5B 4I6LB 3U7DA 5GMVA 2C7NB 3UGBB 3PHWB 2MBOA 3V6CB 2JT4B 2KJRA 1E8ZA 3VTWA 2FCNA 4KZ0A 1UGMA 3U30A 4BOSC 3HHMA 4EOYA 2C7MB 2ZCCA 5DPWA 1UBIA 2CHZA 4WJNA 4CYEA 3RD2A 3UF8A 1IPGA 3SHQA 4TQ0A 3VDZA 4II3B 3M3JA 3P2BA 1EO6A 5JHBA 3A1QA 4AJYB 4X57B 3VHTC 1WH3A 3ALBA 1BT0A 1UH6A 2IO2B 4IWPA 2GOWA 3Q3FA 2REXA 3ZIMA 3PRZA 3A4RA 3VAWA 2HE7A 3CSFA 3UQBA 2KZRA 4DBGA 2FAZA 2HTHA 3R7QA 2NPTB 2KLCA 3ZRCA 2D11A 4GDKB 2JRIB 2LZ6A 2R2OA 3ZNZB 3IBEA 1E5WA 1VCBA 2WYQA 3EECA 5D6JB 4EZLA 2LGDA 3PS6A 4DHZB 1E7UA 3CSTA 3PRPB 3EFUA 3ENEA 4BKSA 2V4LA 4GGQA 2HJ8A 3DVNU 2MP2B 3QK0A 2NS5A 2O2VA 1V86A 4GU2A 2KDIA 4F8CB 4CHKA 3A4SC 3ECIA 2AL6A 3ZDTA 1WX8A 5EDSA 5IAAC 2GBNA 4IWQA 4HLEA 4HPLB 1MG8A 2LD9A 1YJ1A 3PLVA 3WAPA 1U4AA 4TUUA 1YIWA 2L8JA 1NI2A 4FN2A 3DPDA 3KYCD 4PS7A 3RUIB 4W9IA 3X0WA 3K9PB 1LXDA 4MM3A 3PRMB 5E6NA 3L17A 4JQWC 3PTFC 1WX7A 3R66C 2KX0A 3APCA 3W1YA 1WR1A 3W1SC 1WIAA 2KANA 2XBBC 3TBLD 4K7SA 3UQAA 4OVUA 3R3MA 3VFKA 5LXIB 4IG7B 3OJ4B 4IUMB 2AWTA 3T8MA 4FA6A 2M1MA 5D2MB 3IVFA 2PE9A 2KLGA 4MGKE 4DHJB 1E8XA 2LVPA 3PT2B 2MCNB 2JZZA 4PYZA 1C1YB 2BF8B 2WWZA 3TMPB 4MGYE 1SE9A 4KSKC 3DBSA 4WJOA 2K25A 3QWZB 3WAMA 4P7IA 2DX5B 2LVOA 2N4FA 1H4RA 1RFAA 1L7YA 2ASQA 1J19A 2BYEA 3NOBA 4W9KA 1WJ4A 2D07B 3QQ8B 2JRHA 3RT3B 2A4ZA 3DOWA 3TJPA 3VH4B 2KJ6A 4WAAA 3TIXA 1R4NI 2D10A 4AWJA 2N1WA 3JVZX 2G4DB 1L2NA 2M17A 5E6OA 3MHSD 2ZNVC 3QAQA 4PYUA 3B0AA 3DDCB 3N3KB 2DZIA 4ANUA 2KFKB 2KK8A 4KZCA 3MTNB 2M8SA 1RAXA 2ZZPB 2V3SA 1WX9A 3IHPC 2ZPNA 2GMIC 2YVCA 3NHEB 3DVGX 2FUHB 4ICVA 4B95A 2KFJA 2DZJA 1WFYA 2KDFB 2YLMA 4MGZE 4W9HA 4TKNA 2IY1B 1WXVA 1GC7A 2O6VB 4DK5A 3HK0A 2JUOA 2DZKA 2N9XA 4K7WA 2LASA 4DDGD 2PPHA 2IY0B 2FCMA 1WJUA 2CHWA 4AOFA 3QA8A 3VTUA 2UYZB 1RRBA 2LGYA 4HXDA 2KXJA 3R7RA 1UELA 3GZNI 4W9JA 5CTRC 4EZKA 1P98A 4FHJA 4GMVA 3AXCA 3EHVA 3ZNHB 4IWOA 2BGFA 1WXMA 3NS8A 2KDEB 2CS4A 3H9DA 4I6NB 2KC2A 2BWFA 2DYOA 5KHOA 3CF6E 2RR9A 2NBVB 3KUZA 4XZ4A 3VUWA 2IO3B 4FHKA 4KSLC 4BBNC 4NAWB 1V9JA 1FXTB 3LJ3A 1K8RB 4I6PA 4BVUC 1WGYA 4NPNA 3CMMB 5HKHA 1S1QB 2XEWA 4JL9A 4FLHA 4K1RB 3M63B 2KHWB 1OGWA 4LJPB 4NAWA 1E8YA 4ASWC 1KLVA 3ZTDA 4BKSD 4WWPA 2KDBA 2JVCA 2KOXA 4YL8A 3ZNGC 3ZO5B 1TZ1A 4HDOA 5LXHA 2LJ5A 4LDTB 1GC6A 1WGRA 4XX5A 2NR2A 1EF1A 1P1AA 3TCAA 1WGGA 2K6QA 1SGHA 2IYDB 2UWQA 3H1UA 1UBQA 2J0MA 2LGXA 2MBQA 1WF9A 2KQSA 4MH0E 2MX2A 3KH0A 1V6EA 1WMHA 3PREA 3PZDA 4WWNA 4MJSA 4EKUA 3L0WB 2AYOB 4N9F4 3KUCB 3DQVA 1F9JA 1QZEA 2KFKA 2KWUB 2LVQA 4MEMA 3VUXA 5KHQA 2BPSA 3OLMD 1WGDA 1YX5B 2MLBA 3QJZA 5JHAA 4BBNF 2DYBA 2MBEA 4G3XB 3PGEA 2K8CA 4DDID 3NY5A 3ML8A 1TGZB 3U8ZA 1H8CA 2I1JA 3PV1A 4HVBA 1WRDB 1WY8A 2ZEQA 3BY4B 3ONSA 2FNJB 1P3QU 1NBFC 3VXWA 1YD8U 2KX3A 1OEYA 2KTFA 4NJ6A 5DPTA 4BKTA 4GIVA 1G6JA 2K8HA 3DBLI 5J17A 5AZGA 2M4NA 2EMTA 2PE6B 4ZRKA 2WDTB 3PLUA 5CHFA 3K9OB 1Z2MA 4BFRA 3TL5A 4LJOB 3W1SA 1T0YA 3SU8X 2KNBA 1E7VA 1Q0WB 3L13A 2XK5A 2I1KA 1WJ6A 1WI0A 3A33B 3A1QB 2JF5A 1D3ZA 2O6VD 3KUDB 2K39A 2MWSB 1OTRB 2BWES 4J6IA 4W9CA 3OJ3A 3V6EB 3VH3B 2ZPYA 3H7PB 1YX6B 2K1FA 2CU1A 3H7SA 4OVVA 1NDDA 4W9FA 1KOTA 2DENB 3IG3A 4XC2A 4EUTA 3L08A 3AU5A 3H7PA 3KYDD 2KO3A 2MBBB 4HWIB 1ZGUB 4HCPB 1C3TA 4EFOA 4FBJB 2L3ZA 1Y8RC 4CO7A 3JW0X 2CHXA 3Q3JA 3ZUNA 3HM3A 2QHOA 3M62B 4MGIE 5D94A 4F1SA 4GXBA 4MSQB 2NPTA 4ANVA 2L0TA 3QCAA 3L54A 2WX0A 2MA9B 4NQLB 2CR5A 4EEWA 2D2QA 2O2VB 5C23A 3KVFB 1R4MI 1GUAB 1WZ3A 2JY6A 4MJSB 2R2QA 4GOCA 4LDTD 1WR6E 1TTNA 4JGHB 4NY0A 1GG3A 3DVGY 4IM3A 3V60A 2GBRA 2W9NA 2IZVB 4ZYNA 1WZ0A 5LLIA 3A9JB 4K81A 2GBMA 4PS3A 4WJQA 2LI5A 4DHJD 1M94A 2LRUA 2DAJA 2ZJDA 2G3QB 5L95C 2MP2A 3JYUA 4II2B 3JSVA 3N32A 2CKHB 1J0GA 3QX1A 2FCSA 3ML9A 2J7QB 4TQ1A 4ZRIA 3RULA 2MRPA 5BO4B 3VVWB 1SIFA 5JZEB 2KTRA 1LFDA 2J0KA 1HE8A 3JSVB 4HCNB 4M0WB 2RPQA 2LUEA 5J2RA 3PPAA 3KW5B 4G0NB 2IBIB 2KTRB 2MQJA 3AI5A 2DYMA 4AJWA 1WJNA 1WM3A 1ISNA 2NCNA 3A9KB 3WAOA 3L10B 3L16A 2Z0EB 4BOZB 2G4SA 4G11A 4KV2A 1I42A 1E90A 1V5TA 3O65B 5IA7A 1OQYA 3OAWA 4URKA 2MSED 2JXXA 2ZNVB 2PJHA 3M95A 5E6PA 3V61A 3WALA 3B1LX 4W9DA 1WGHA 2FIDA 4ZRJA 2GBJA 3ZW3A 1OEYJ 1IYFA 4JLCA 1GNUA 3LDZE 4EZJA 2L0FA 5DCNA 5G2NA 3UINB 3QARA 5AZFA 4FJYA 5FR6A
chains in the Genus database with same CATH superfamily
2ZCBA 4WWOA 4HEA1 1P9DU 4NJ7A 1WMHB 1L6VA 4B9KA 4KIKA 1RWSA 5HFYA 1IP9A 1FPYA 2WU2B 2C9WB 2K0PA 5C1ZA 1C76A 1V80A 3QC8B 4RMAA 3C0RB 3IAM1 2N7EA 1XD3B 2KJHB 3DVNV 5J18A 3CWIA 2JPHA 4MELA 2L05A 1FFVA 2BYVE 5CX3A 2Z0DB 1KTKA 4A20A 2K22A 4HDQA 4KKIA 1FNUA 1SBBB 1DYQA 1PFDA 2KD0A 4DWFA 2DHZA 1GJZA 4RM8A 2W82A 3OWEB 4IC7B 3RCZA 4F7ZA 2YEPB 4MSMB 3AEAB 3KWVA 3TUOA 3ZDMC 3S2AA 3CIRB 1B1ZA 2BYFA 3PSEB 3HRDD 4RM9A 3T9LA 3AU4A 4GDLB 1R4NB 2OJRA 2LXCA 3VQIA 3ZRFA 1QOGA 4XYCA 4MDKE 3D32A 4JIOU 3ZXVA 5E6JA 2QCZA 2KT7A 2WGSA 1SF0A 3QIJA 2NBWB 5BYSA 3WCQA 2Y5BB 4L2YA 2OJWA 5FR3A 4WQOB 3ZYYX 4YWGG 5EE1A 2DAFA 4GN1A 1LGRA 1BMLC 1LQBA 3IFWB 2XK5B 3DHIC 3Q2AC 3U7DA 1ACCA 2JT4B 3DWGC 1XF5L 2KWDA 2FCNA 1FXIA 4KKJA 3SR6A 2ZCCA 2QEJC 4WJNA 4A55A 3M3JA 3P2BA 3A1QA 2XNAC 1I4QA 3ALBA 2GOWA 3Q3FA 1ENFA 3VAWA 3A4RA 5BMIA 1I4HA 2AQ3B 3R7QA 2NPTB 4JWUC 4WQMA 1TS4A 1MJDA 2JRIB 2R2OA 3IBEA 1E5WA 4A6QA 4EZLA 1NI3A 1E7UA 2M56B 3PRPB 3P4QB 3B2GA 1FNWA 2V4LA 4RH6A 3DVNU 3QK0A 2O2VA 3C8YA 4IWQA 2Y5PA 2LD9A 2WXIA 1D5ZC 2D5GA 1NI2A 1XEEA 3Q3NC 3K9PB 4JQWC 4MH8A 3APCA 2XBBC 1E7PB 3UQAA 5LXIB 2BB6A 4MM3B 3OJ4B 3T8MA 1KRHA 2KACA 4FA6A 1XLQA 4ZHPA 3Q8BA 1ROEA 1E8XA 2LUMA 2N0SB 2MCNB 3LXFA 2WWZA 1SE9A 4KSKC 3QWZB 2FE8A 1E9MA 2DX5B 2N4FA 5D3IB 4S0RA 1STEA 1K52A 3W5UB 1WJ4A 2G9HD 2JRHA 2A4ZA 1QILA 2N1WA 1L2NA 2M17A 4WWMA 2ZNVC 4B0EA 2KN4A 2DZIA 3N3KB 4ANUA 2SAKA 1FD6A 4KZCA 1RAXA 1DOYA 4R3DA 1WX9A 3DBLB 3IHPC 2AQ1B 2ZPNA 2WXJA 3NHEB 3DVGX 2FUHB 4ICVA 2DZJA 4RF0A 2IY1B 2I2YA 2O6VB 4DK5A 3HK0A 3I5JC 3QA8A 3SFDB 2UYZB 1RRBA 3R7RA 3NVZA 3Q3MC 3OG5A 4FHJA 2J4XA 2PMVA 2BGFA 4I6NB 2RR9A 3KUZA 4NAWB 1K8RB 1S1QB 2E3TA 2BT6A 1E8YA 3P4PB 4ASWC 1KLVA 1KH0A 2KOXA 1OFFA 4YL8A 3AEDB 3AM9A 2NR2A 1GPXA 1WGGA 3H1UA 1UBQA 4KGSA 2KQSA 1WMHA 3T3NA 4YSXB 1F9JA 2KWUB 3VR8B 1T0SC 4LNKA 3L4PA 1WGDA 2MLBA 5JHAA 2MBEA 3GP7A 3NY5A 1UNSA 3BIID 1P3QU 1NBFC 4A8XC 3ZJUA 1YD8U 1OEYA 2KTFA 4NJ6A 4BKTA 2M4NA 3E56A 1JWBD 4IKGA 5CHFA 4YTNB 3K9OB 4BFRA 3Q8CA 1M4VA 4LJOB 1FO4A 1A70A 3SU8X 1JQ4A 2KNBA 1WI0A 3A33B 3Q3OC 3AEGB 3KUDB 2K39A 1EWYC 1OTRB 4W9CA 3W5VB 1SJHD 1E6EB 2JXTA 4LNFA 4W9FA 1KOTA 2DENB 3L08A 2ICIA 3NUHB 2QJLA 3RNCC 4FBJB 1I4RA 3SEBA 3Q3JA 4ZHOA 3ZUNA 2QHOA 2IGHA 4F1SA 2GLSA 4ANVA 2NPTA 2IPKD 1JWAD 2QMTA 2MA9B 1D5MC 1JW9D 2CR5A 4TMAB 2M0AA 2D2QA 5C23A 3KVFB 1BUIC 1XCTL 2NTTA 2XN9C 1WR6E 1TT5B 3HVZA 1GG3A 1L0YB 1MHXA 3DVGY 3V60A 2GBRA 2IZVB 4K81A 4WJQA 2ZJDA 2G3QB 1L0VB 2MP2A 3N32A 3RULA 3AE8B 2MRPA 4NAMA 2RPQA 2LUEA 1HEZE 3AI5A 4AS1A 1WJNA 1WM3A 2NCNA 4L1BA 1IUEA 3A9KB 3I9V1 3L16A 2Z0EB 3EGRA 3TEZA 3AE4B 4G11A 1I42A 4S17A 2MSED 2JXXA 2ZNVB 3V61A 3WALA 2FIDA 1IBXB 2GBJA 2OEDA 3ZW3A 1OEYJ 2L0FA 3J9CA 5G2NA 1V8CA 3QARA 3O13A 1XLNA 5FR6A 5L95C 2Z8LA 4DXAB 2KKCA 3N20C 4GDLA 1SB3C 1TKGA 4K7UA 2PIAA 3KQ4A 2W3SA 3HM6X 2K5PA 2MH7A 5AEKB 2NVUI 3SD5A 4TV3A 4REZA 2L76A 1JWMD 3AULA 1RLFA 3E9SA 1WYWB 2KN5A 1I35A 1YN5A 2D3GA 2PEAA 1X1MA 4RCOA 2OOBB 5BMHA 1Q5WB 3A9JA 4W9LA 1XQQA 2RSUA 4W9GA 5DPSA 3SDLC 1YQ3B 2CJOA 1V49A 5G55A 4FADA 1PDXA 2LXAA 1C4CA 3PVLA 4ARCA 2WXKA 2TSSA 4C4VB 3EA6A 2JZ3B 4ZDVA 2RMMA 4WH4A 1CJEA 3T3OA 1HZ6A 2DLBA 1KJTA 2IO0B 2X8XX 2C5LC 2GI9A 2L00B 2BKRB 4LNOA 4IM0A 4FXCA 2AEHA 2KC1A 1MPEA 1UD7A 3HIZA 1WYGA 1ZE3D 2VZKD 4GDKA 2B3AA 1MG4A 2CU3A 2WX1A 2WLBA 1IGDA 2MW5A 1CZPA 3X23A 4PK1A 2V3PA 3TSSA 5JH5C 2YEPF 3FKYA 3EUB2 2Z59B 3UIPB 1TZOA 3MFGA 3VUYA 4LCDE 2G45B 1SJED 3WA0A 1S3SG 4AP4C 1D5XC 1VZ8A 3NJTA 1F2RI 3EFCA 1MI0A 2KAJA 2W55A 2FUG1 4FULA 3RYTA 1YQBA 3AECB 1WE7A 1TS5A 4C7ZA 1EUVB 5GMVA 3UGBB 3PHWB 2MBOA 4GLSC 2LFIA 1BXTA 5I4DA 3HHMA 2C7MB 2ACZB 5DPWA 3B2FA 3RD2A 1IPGA 5G5HA 4TQ0A 3Q6BA 1JWSD 4AJYB 4X57B 2WP9B 2JU6X 1SXTA 1XLOA 2KZRA 2FAZA 2HTHA 3ZRCA 2D11A 3TEXA 4LK0M 4NJCA 4ZRQA 4EE2A 5IO9A 1VCBA 2WYQA 3EECA 5D6JB 4H2AA 1FFUA 4CQNA 3ENEA 4GGQA 2JYEA 3FC4A 3Q8AA 3N1ZC 3RI7C 3RMKC 3A4SC 1T6BX 5IAAC 2GBNA 4HLEA 2J53A 1VDVA 3WAPA 1YIWA 1EU4A 4HJGE 1C9FA 4RNAA 3DPDA 4PS7A 1QLBB 1LXDA 3N1XC 4MM3A 5E6NA 2RPVA 1WX7A 3R66C 3ZQ4A 3W1YA 2WXNA 1WIAA 1VR9A 4OVUA 3R3MA 5D2MB 2JZPA 2WU5B 1ZOYB 4DHJB 3PT2B 3KLSX 4PYZA 4XWWA 5IKCM 3BYTB 4MGYE 4P7IA 1YJJA 1L7YA 1RFAA 2D3AA 2WDVB 2RDBC 3LB8C 4XE0A 4YT0B 1LO5D 3NOBA 4W9KA 3QQ8B 3RT3B 1R4NI 2MJDA 2G4DB 5E6OA 1TIFA 1EM7A 3B0AA 3KWLA 2KK8A 2ZZPB 1J7CA 2D3BA 3URYA 1WFYA 4W9HA 4N6EB 5HHDG 1WXVA 1GC7A 1VZ6A 2JUOA 2N9XA 2LASA 3U4EG 1VRAB 2FCMA 3AV8A 3VTUA 1RYJA 2KXJA 4P1BC 3GZNI 4W9JA 1P98A 4P1CC 2KDEB 2CS4A 5KHOA 2NBVB 4FHKA 1K50A 4KSLC 4BBNC 1V9JA 3LJ3A 4ACFA 1FEHA 2EELA 5HKHA 2IGDA 4JL9A 2M19A 4FLHA 4K1RB 3M63B 2ZW1A 1KFYB 2WNMA 3AE1B 2UU7A 1I4PA 3ZNGC 3ZO5B 1TZ1A 4B0MA 4RGOS 4XGAB 5LNK1 2LJ5A 3TCAA 2K6QA 1FNVA 1ZPSA 4RFBA 2J0MA 2LGXA 2MBQA 2BW2A 5D3DA 2MX2A 3KH0A 1UGJA 1V6EA 3PREA 4HPPA 4WWNA 4MJSA 1E0ZA 3L0WB 2AYOB 3I57A 3DQVA 2LVQA 2KFKA 3VUXA 1FCCC 5BMGA 3QJZA 4G3XB 4OHJA 1V97A 3RPFC 1TKYA 3U8ZA 2I1JA 3PV1A 4HVBA 4US9A 2ZEQA 2KX3A 1QOFA 3VR9B 2EKIA 2VZKB 1Z2MA 3TL5A 2INDC 3L13A 1JROA 3BVGA 1WWTA 1FXAA 1XCQL 3Q8EA 1D3ZA 2GRIA 3N1YC 3OJ3A 1VZ7A 2ZPYA 2IGGA 3H7PB 1YX6B 1AYFA 2K1FA 3H7SA 1QOBA 4XC2A 4EUTA 3AU5A 3H7PA 3AEFB 2MBBB 1ZGUB 3IXSA 1C3TA 4EFOA 2L3ZA 3JW0X 2CHXA 2NTSA 3M62B 4YTPB 4GXBA 4MSQB 4EEWA 1GUAB 2JY6A 4NY0A 4OW0A 1F77A 1WZ0A 5LLIA 3A9JB 5HG2A 2V0GA 2DAJA 4RGTA 5TSSA 3JSVA 5FK9C 4P6VF 2FCSA 2J7QB 4ZRIA 5JZEB 2ONQA 2PTLA 2J0KA 4D2KA 4USAA 3Q69A 2KTRB 2DYMA 5GXGB 3GZNB 4A90A 3L10B 3MHZA 1L5PA 4BOZB 4ZRPA 2VH2A 1OQYA 3PZ7A 3OAWA 5E6PA 1HA5A 1TY2A 1F2RC 4K3BA 4EZJA 1JALA 2N9KA 4FJYA 1TY0A 4M8MA 4JX1C 2N7DA 4FJZA 1HZ5A 3RNAC 1V2YA 2AL3A 2KDMA 2BKFA 4AUQC 3GS2A 3RNFC 3UIOB 3ZTCA 1EU3A 1P0RA 2QILA 3DBRI 1Q1OA 2LMCA 2KMCA 3AE5B 3SFEB 1CMXB 1N61A 1FMAD 4KGTA 1MVKA 1C77A 2WXLA 4NQKE 1ZDXA 1C4AA 2IJ0A 2QIEB 3C19A 2J0JA 2K8BA 3BINA 4KDIC 2KWVB 5FKAC 4KVGB 4PS8A 1V1PB 1VD2A 3AEEB 1J7AA 1E8WA 3TEWA 2K9XA 4E71A 4G50A 3GOEA 3APFA 4W9EA 4OVZA 4IM2A 1V81A 1WE6A 1FM0D 3A9KA 2N9PC 5CHVC 1I7HA 1ZW7A 1PYWD 3NVVA 5C2TB 2VRRB 4HJKA 1E10A 1V5OA 3ZNID 5DPRA 4LTUA 5L83A 1NENB 2IO1B 3U7ZA 4E74A 1EF5A 4A9AA 2N1VA 3H6NA 3DHHC 2FBWB 2J42A 2L32A 2DZMA 2FCQA 2KVRA 4M8NA 2JWZA 1XT9B 4ZYSA 3RZWC 3RNBC 2EMSA 2RDHA 4YSYB 4ANWA 4XDCA 3MP9A 5D7GA 4HPMB 5BYRA 1TYGB 1FCLA 3ZVVA 2INPE 2KWCA 2LRWA 3DBHI 4IW0A 3U2SC 2V1YA 2ZVOA 1ZKHA 4HK2A 1J8CA 1AARA 3APDA 1JRUA 1C78A 2WXOA 3EC8A 4ITKA 1V1PA 3V6CB 2KJRA 3VTWA 4C56C 4KZ0A 5IN7A 4BOSC 4EOYA 3MC9A 1MFWA 1UBIA 4CYEA 1YOVB 3SHQA 2OHFA 4II3B 1EO6A 1BT0A 1C4PA 2BVCA 4HKZE 2IO2B 2REXA 3ZIMA 2HE7A 4QAYA 4DBGA 2KLCA 5AUIA 3VRAB 4GDKB 2H89B 1I4GA 1DOXA 3PS6A 1HQRD 3EFUA 3DWMA 2JYTA 2V4IB 5C3JB 2HJ8A 4DXGA 2NS5A 1QT9A 1V86A 4GU2A 4YSZB 4CHKA 1WX8A 5EDSA 3NVYA 1YJ1A 1U4AA 2ON8A 2L8JA 3DHGC 3KYCD 2B76B 1ZP0B 5T8IA 3RUIB 3PRMB 1FIQA 3BZDB 1JWUD 3PTFC 4M00A 1JCKB 5EE9A 1TKEA 2KANA 3TBLD 1GAQB 3VFKA 4IG7B 3ZXRA 4IUMB 2AWTA 1NYRA 2KYWA 1EWCA 4AQ7A 2PE9A 4MGKE 3AMZA 1PGAA 3R2TA 1C1YB 4WJOA 2JQRB 2WXHA 2LVOA 3FILB 2BS2B 2ASQA 1IBXA 2PVOD 2W54A 5AUKA 4LLGM 3DOWA 1SE4A 4WAAA 3TIXA 3AH7A 3MHSD 3QAQA 4PYUA 3DDCB 3Q8FA 1QF6A 2V3SA 2AQ2B 2YVCA 1NVID 4B95A 2KFJA 2Q5WD 2KDFB 3FAHA 4TKNA 3MC8A 1C79A 5IOIA 1PUTA 3AE6B 3N9YC 2IY0B 4AOFA 3V05A 4HXDA 5CTRC 5HI1A 2KMMA 4K3CA 3EHVA 3ZNHB 3ZGZA 4IWOA 4BZAA 1WXMA 4IOIE 3H9DA 4TSSA 3CF6E 2G1EA 4XZ4A 2IO3B 4I6PA 1FXTB 4BVUC 1RM6C 2I38A 1F1HA 1UF0A 4NPNA 3CMMB 2LGIA 2XEWA 1OQQA 1KF6B 2KHWB 4LJPB 4KGRA 4BKSD 4KX6B 1AWDA 1YNTE 1UUPA 5LXHA 2LHEA 4LDTB 4XX5A 1EF1A 1SGHA 2IYDB 4MT5A 2MJ3A 1Y56A 5EE0A 4MH0E 5H8YE 3GE3C 3PZDA 1FRDA 4N9F4 3KUCB 5EE3A 5H92C 1R7SA 2JSVX 1V1OA 1TGZB 2LHDA 1WY8A 2QDFA 3ZJTA 1SSNA 4GIVA 3DBLI 5AZGA 2EMTA 2PE6B 4ZRKA 3PLUA 4RGNA 1D6EC 1ESFA 1Q0WB 3ZJVA 1DOIA 2I1KA 2VH1A 1XO3A 2JF5A 2O6VD 2BWES 3PZ8A 4J6IA 2V9HA 3V6EB 3VH3B 3VRBB 5IP4D 4OVVA 4RF1A 3KYDD 4P16A 4HWIB 1N5XA 4HCPB 4CO7A 3HM3A 4O1NA 4MGIE 5D94A 4L23A 3QCAA 3L54A 3AE3B 2WX0A 3BVZA 2J52A 1WZ3A 4LDTD 1TTNA 1P7FA 1HXYD 4IM3A 2W9NA 2BB5A 3LYYA 4PS3A 4DHJD 1M94A 2LRUA 3PO0A 2H88B 2JWUA 2CKHB 2RDGA 1J0GA 2HTME 3W9CB 3ML9A 2WHIA 4TQ1A 3VVWB 1SIFA 1D4BA 4HCNB 1CQVA 5J2RA 3KW5B 4G0NB 2IBIB 2MQJA 4AJWA 3AEBB 3WAOA 4KV2A 1E90A 1V5TA 1YN4A 3O65B 5IA7A 5BYQA 1ET9A 4URKA 1AW7A 3M95A 4W9DA 1T3QA 2GB1A 2WXGA 1IYFA 2HDEA 1L4ZB 5DCNA 3UINB 2NMQA 2X38A 4NZLB 4NNJB 5AZHA 1J7BA 4GSWA 2C60A 5CHWA 3MJ5A 4JE3B 1KM7A 4HROA 3ZKJC 1TBEA 1UWMA 1XXGA 2MJEA 2EKEC 2K6DB 4A3PA 2O6VA 1JRPA 2MHJA 2WDQB 1SE3A 3NZUA 4KDLB 2LWPA 3RNEC 1F0ZA 1WXQA 1UWXA 2QC8A 1UZXB 3WIMA 3VTVA 2A5UA 2KMAA 2HD5B 2N9EB 1T0RC 3BK1A 2QSDA 4US8A 2E6XA 2KQ7A 2PKOA 3IT4B 1CK1A 1KLGD 3DCGA 1PQSA 2GBKA 4ARIA 1B9RA 4IDIA 4C7YA 2L1AA 2N9LA 4MACA 1NYQA 4ICUA 1WXSA 5TR5A 3ZLZA 1Z5SB 4Q2JA 3NZSA 4ZOHC 2L7RA 3WANA 4BKGA 1ZXHA 5G5GA 2NBUA 4ANXA 2M0XA 3N30A 2RGFA 4B6WA 1N60A 4GB9A 3UI3A 1N5WA 4KIKB 1K53A 2BS3B 4WJPA 4WAFA 3I3TB 3RZFA 4DHZE 4A3OA 1I4XA 1MHHE 3V62A 3MJWA 4N59A 3IT6B 3RN9C 2MBHA 1WM2A 4N58A 4FJVB 1N62A 1LM8B 4E3CA 2RD0A 3B08A 2WXFA 2LGSA 1WXAA 2PVGC 2KQ4X 2ZVNA 3QHTA 3PHXB 1A5RA 3W2DA 1PGXA 1SIJA 2C7HA 2FIFA 4I6LB 3P1MA 3P4RB 2Y5CA 2C7NB 1ZUD2 1L4DB 1ET6A 1E8ZA 1YMHE 1UGMA 3U30A 2CHZA 3UF8A 3VDZA 4OZCA 5JHBA 1VJKA 3VHTC 1GB4A 1WH3A 1UH6A 4IWPA 1WSPA 1XLPA 3PRZA 2SEBD 3CSFA 3UQBA 4LNIA 1IGCA 2HJ1A 2LZ6A 3ZNZB 4UDUC 3R2IA 2LGDA 2PW9A 3Q14C 3AE2B 3CSTA 4DHZB 2LEKA 3P42A 2V3NA 4BKSA 2DWQA 2MP2B 1TJEA 3AE7B 1TS2A 3BK2A 2KDIA 4F8CB 3ECIA 2AL6A 2L52A 3ZDTA 4C80A 1Q10A 4XDDA 4HPLB 1MG8A 3PLVA 2INNE 4TUUA 4FN2A 3DBHB 4W9IA 3X0WA 4LNNA 3L17A 1N63A 2KX0A 3GB1A 1KLUD 1P7EA 1WR1A 4XWTA 3W1SC 3ABVB 4K7SA 2M1MA 3IVFA 2KLGA 2LVPA 3FILA 2JZZA 3AE9B 4C00A 2JX5A 2DNFA 2BF8B 3TMPB 3IAS1 3DBSA 2K25A 3GE8C 3WAMA 2BBCA 3P4SB 1H4RA 2CJNA 1J19A 2BYEA 3RNGC 2IDYA 1RFKA 2D07B 1QOAA 3TJPA 3VH4B 2KJ6A 2D10A 4AWJA 3JVZX 4J3OD 1HTOA 4YTMB 4DXFA 2KFKB 3MTNB 2M8SA 3U52E 2GMIC 1NEKB 2YLMA 4MGZE 1JMLA 4DDGD 2DZKA 4K7WA 1PGBA 2PPHA 2Y3AA 1SEBD 3MC0B 1WJUA 2CHWA 4RGMA 3BVMA 2LGYA 1UELA 2MEKA 4PT5A 4EZKA 4GMVA 1T0QC 3AXCA 3NS8A 2KVZA 2KC2A 2BWFA 2BQQA 3HVDA 4M02A 2DYOA 2AX5A 1VLBA 2WXMA 3VUWA 1GOZA 3AB5A 2BTEA 1WGYA 1WGKA 1OGWA 4NAWA 3ZTDA 1L0XB 2WXQA 4WWPA 2KDBA 1DGJA 2JVCA 3BWUD 4HDOA 2WS3B 2WDRB 1GC6A 1WGRA 1P1AA 2UWQA 3P63A 3HUIA 3TEYA 1WF9A 5JXVA 4EKUA 4OZAA 1YQ4B 3BYYB 1QZEA 5KHQA 4MEMA 1K51A 2BPSA 3OLMD 1YX5B 3RFZB 4BBNF 2DYBA 3PGEA 2K8CA 4DDID 3ML8A 1WRIA 1H8CA 1WRDB 1YN3A 3BY4B 3ONSA 2FNJB 1FRRA 4DQOC 3VXWA 5DPTA 1G6JA 2K8HA 5J17A 1HTQA 2WDTB 1YJIA 3W1SA 1R4MB 1T0YA 4C4VA 1E7VA 2XK5A 1WJ6A 2INCC 3A1QB 1L6UA 2MWSB 3NS1A 1ZDVA 2CU1A 1T5XD 2LJIA 3R8BA 1NDDA 5MPOA 3IG3A 4WURA 3H8HA 2KO3A 2W3RA 1Y8RC 2WQYB 2D3CA 2L0TA 1AN8A 4M01A 3NZ3A 1QQRA 4NQLB 2DBYA 2N7JA 4BAXA 4YXDB 2O2VB 4MJSB 1R4MI 4OZBA 2R2QA 4GOCA 4JGHB 3DBRB 4ZYNA 2GBMA 2LI5A 3AN1A 1ZXIA 3JYUA 1TS3A 3NRZA 4II2B 4M0WA 3QX1A 2BYTA 5BO4B 2R61A 2KTRA 1LFDA 1F52A 2WXPA 1HE8A 3JSVB 3ETRA 4M0WB 3PPAA 2PLPA 4HRSA 1OQRA 1N6ZA 3NG0A 1ISNA 4HKQA 3I63C 4JWSC 4JPSA 2G4SA 3V3XA 3B9JA 1GB1A 3NVWA 1SE2A 2PJHA 3B1LX 4WIPA 1WGHA 4ZRJA 1QKZA 4JLCA 1GNUA 2L83A 3LDZE 2K3UA 5AZFA 2BS4B 2ZW0A 2WXRA
chains in the Genus database with same CATH topology
2ZCBA 4NNJB 4WWOA 5AZHA 2KKCA 4M8MA 4DXAB 4GDLA 4GSWA 2N7DA 4FJZA 4K7UA 2C60A 5CHWA 1P9DU 3HM6X 4NJ7A 1KM7A 1WMHB 4B9KA 1V2YA 3ZKJC 1TBEA 4KIKA 2AL3A 2NVUI 5AEKB 2BKFA 4AUQC 1IP9A 3SD5A 3UIOB 4TV3A 2EKEC 2K6DB 3ZTCA 1P0RA 2C9WB 2L76A 3AULA 4A3PA 1RLFA 5C1ZA 1WYWB 2O6VA 2KN5A 1V80A 3DBRI 3QC8B 1I35A 4RMAA 2D3GA 2PEAA 1X1MA 3C0RB 1Q1OA 2N7EA 2KMCA 1CMXB 2OOBB 4KDLB 3NZUA 2LWPA 1Q5WB 3A9JA 4W9LA 1XQQA 1XD3B 2KJHB 4NQKE 2RSUA 4W9GA 5DPSA 3DVNV 3SDLC 5J18A 2JPHA 1UZXB 4MELA 1V49A 2L05A 5G55A 3WIMA 3VTVA 2A5UA 2J0JA 2KMAA 2BYVE 2HD5B 2N9EB 2Z0DB 5CX3A 2K8BA 3BINA 4KDIC 4A20A 4FADA 2KWVB 2LXAA 3PVLA 4KVGB 4PS8A 4HDQA 1VD2A 2KQ7A 1E8WA 2KD0A 2JZ3B 4E71A 4ZDVA 4DWFA 4G50A 3GOEA 3APFA 4W9EA 2DHZA 4IM2A 1V81A 1GJZA 3DCGA 1KJTA 1PQSA 1WE6A 2GBKA 4RM8A 3A9KA 2IO0B 2C5LC 2L00B 2BKRB 2N9PC 4IC7B 3RCZA 4IM0A 4F7ZA 5CHVC 2AEHA 4ICUA 4MSMB 1WXSA 1ZW7A 2KC1A 5TR5A 3ZLZA 3ZDMC 3S2AA 1Z5SB 3HIZA 1UD7A 2VRRB 2BYFA 3NZSA 2L7RA 4HJKA 3PSEB 4GDKA 1V5OA 2B3AA 5DPRA 3WANA 4RM9A 3ZNID 4BKGA 2NBUA 5L83A 4ANXA 2M0XA 3T9LA 2WX1A 3AU4A 2IO1B 4GDLB 1EF5A 4E74A 2OJRA 2MW5A 2LXCA 2N1VA 3H6NA 3N30A 3VQIA 3X23A 3ZRFA 2RGFA 4B6WA 5JH5C 4GB9A 4KIKB 4WJPA 4MDKE 3D32A 3I3TB 2Z59B 4JIOU 2DZMA 2FCQA 3RZFA 2KVRA 3UIPB 4DHZE 4M8NA 4A3OA 2JWZA 1XT9B 3RZWC 3VUYA 4LCDE 2G45B 3QIJA 2NBWB 1S3SG 2EMSA 3V62A 3WA0A 3MJWA 4AP4C 4ANWA 2Y5BB 2MBHA 4HPMB 5D7GA 1WM2A 3ZVVA 2KWCA 2LRWA 3DBHI 4FJVB 4IW0A 4WQOB 2V1YA 2ZVOA 1ZKHA 4FULA 3RYTA 4HK2A 1LM8B 4E3CA 1AARA 1J8CA 3APDA 1JRUA 2RD0A 3B08A 1YQBA 2DAFA 1WXAA 2ZVNA 4GN1A 3QHTA 1WE7A 3PHXB 1A5RA 1LQBA 2C7HA 2FIFA 1EUVB 3EC8A 3IFWB 2XK5B 4I6LB 3U7DA 5GMVA 2C7NB 3UGBB 3PHWB 2MBOA 3V6CB 2JT4B 2KJRA 1E8ZA 3VTWA 2FCNA 4KZ0A 1UGMA 3U30A 4BOSC 3HHMA 4EOYA 2C7MB 2ZCCA 5DPWA 1UBIA 2CHZA 4WJNA 4CYEA 3RD2A 3UF8A 1IPGA 3SHQA 4TQ0A 3VDZA 4II3B 3M3JA 3P2BA 1EO6A 5JHBA 3A1QA 4AJYB 4X57B 3VHTC 1WH3A 3ALBA 1BT0A 1UH6A 2IO2B 4IWPA 2GOWA 3Q3FA 2REXA 3ZIMA 3PRZA 3A4RA 3VAWA 2HE7A 3CSFA 3UQBA 2KZRA 4DBGA 2FAZA 2HTHA 3R7QA 2NPTB 2KLCA 3ZRCA 2D11A 4GDKB 2JRIB 2LZ6A 2R2OA 3ZNZB 3IBEA 1E5WA 1VCBA 2WYQA 3EECA 5D6JB 4EZLA 2LGDA 3PS6A 4DHZB 1E7UA 3CSTA 3PRPB 3EFUA 3ENEA 4BKSA 2V4LA 4GGQA 2HJ8A 3DVNU 2MP2B 3QK0A 2NS5A 2O2VA 1V86A 4GU2A 2KDIA 4F8CB 4CHKA 3A4SC 3ECIA 2AL6A 3ZDTA 1WX8A 5EDSA 5IAAC 2GBNA 4IWQA 4HLEA 4HPLB 1MG8A 2LD9A 1YJ1A 3PLVA 3WAPA 1U4AA 4TUUA 1YIWA 2L8JA 1NI2A 4FN2A 3DPDA 3KYCD 4PS7A 3RUIB 4W9IA 3X0WA 3K9PB 1LXDA 4MM3A 3PRMB 5E6NA 3L17A 4JQWC 3PTFC 1WX7A 3R66C 2KX0A 3APCA 3W1YA 1WR1A 3W1SC 1WIAA 2KANA 2XBBC 3TBLD 4K7SA 3UQAA 4OVUA 3R3MA 3VFKA 5LXIB 4IG7B 3OJ4B 4IUMB 2AWTA 3T8MA 4FA6A 2M1MA 5D2MB 3IVFA 2PE9A 2KLGA 4MGKE 4DHJB 1E8XA 2LVPA 3PT2B 2MCNB 2JZZA 4PYZA 1C1YB 2BF8B 2WWZA 3TMPB 4MGYE 1SE9A 4KSKC 3DBSA 4WJOA 2K25A 3QWZB 3WAMA 4P7IA 2DX5B 2LVOA 2N4FA 1H4RA 1RFAA 1L7YA 2ASQA 1J19A 2BYEA 3NOBA 4W9KA 1WJ4A 2D07B 3QQ8B 2JRHA 3RT3B 2A4ZA 3DOWA 3TJPA 3VH4B 2KJ6A 4WAAA 3TIXA 1R4NI 2D10A 4AWJA 2N1WA 3JVZX 2G4DB 1L2NA 2M17A 5E6OA 3MHSD 2ZNVC 3QAQA 4PYUA 3B0AA 3DDCB 3N3KB 2DZIA 4ANUA 2KFKB 2KK8A 4KZCA 3MTNB 2M8SA 1RAXA 2ZZPB 2V3SA 1WX9A 3IHPC 2ZPNA 2GMIC 2YVCA 3NHEB 3DVGX 2FUHB 4ICVA 4B95A 2KFJA 2DZJA 1WFYA 2KDFB 2YLMA 4MGZE 4W9HA 4TKNA 2IY1B 1WXVA 1GC7A 2O6VB 4DK5A 3HK0A 2JUOA 2DZKA 2N9XA 4K7WA 2LASA 4DDGD 2PPHA 2IY0B 2FCMA 1WJUA 2CHWA 4AOFA 3QA8A 3VTUA 2UYZB 1RRBA 2LGYA 4HXDA 2KXJA 3R7RA 1UELA 3GZNI 4W9JA 5CTRC 4EZKA 1P98A 4FHJA 4GMVA 3AXCA 3EHVA 3ZNHB 4IWOA 2BGFA 1WXMA 3NS8A 2KDEB 2CS4A 3H9DA 4I6NB 2KC2A 2BWFA 2DYOA 5KHOA 3CF6E 2RR9A 2NBVB 3KUZA 4XZ4A 3VUWA 2IO3B 4FHKA 4KSLC 4BBNC 4NAWB 1V9JA 1FXTB 3LJ3A 1K8RB 4I6PA 4BVUC 1WGYA 4NPNA 3CMMB 5HKHA 1S1QB 2XEWA 4JL9A 4FLHA 4K1RB 3M63B 2KHWB 1OGWA 4LJPB 4NAWA 1E8YA 4ASWC 1KLVA 3ZTDA 4BKSD 4WWPA 2KDBA 2JVCA 2KOXA 4YL8A 3ZNGC 3ZO5B 1TZ1A 4HDOA 5LXHA 2LJ5A 4LDTB 1GC6A 1WGRA 4XX5A 2NR2A 1EF1A 1P1AA 3TCAA 1WGGA 2K6QA 1SGHA 2IYDB 2UWQA 3H1UA 1UBQA 2J0MA 2LGXA 2MBQA 1WF9A 2KQSA 4MH0E 2MX2A 3KH0A 1V6EA 1WMHA 3PREA 3PZDA 4WWNA 4MJSA 4EKUA 3L0WB 2AYOB 4N9F4 3KUCB 3DQVA 1F9JA 1QZEA 2KFKA 2KWUB 2LVQA 4MEMA 3VUXA 5KHQA 2BPSA 3OLMD 1WGDA 1YX5B 2MLBA 3QJZA 5JHAA 4BBNF 2DYBA 2MBEA 4G3XB 3PGEA 2K8CA 4DDID 3NY5A 3ML8A 1TGZB 3U8ZA 1H8CA 2I1JA 3PV1A 4HVBA 1WRDB 1WY8A 2ZEQA 3BY4B 3ONSA 2FNJB 1P3QU 1NBFC 3VXWA 1YD8U 2KX3A 1OEYA 2KTFA 4NJ6A 5DPTA 4BKTA 4GIVA 1G6JA 2K8HA 3DBLI 5J17A 5AZGA 2M4NA 2EMTA 2PE6B 4ZRKA 2WDTB 3PLUA 5CHFA 3K9OB 1Z2MA 4BFRA 3TL5A 4LJOB 3W1SA 1T0YA 3SU8X 2KNBA 1E7VA 1Q0WB 3L13A 2XK5A 2I1KA 1WJ6A 1WI0A 3A33B 3A1QB 2JF5A 1D3ZA 2O6VD 3KUDB 2K39A 2MWSB 1OTRB 2BWES 4J6IA 4W9CA 3OJ3A 3V6EB 3VH3B 2ZPYA 3H7PB 1YX6B 2K1FA 2CU1A 3H7SA 4OVVA 1NDDA 4W9FA 1KOTA 2DENB 3IG3A 4XC2A 4EUTA 3L08A 3AU5A 3H7PA 3KYDD 2KO3A 2MBBB 4HWIB 1ZGUB 4HCPB 1C3TA 4EFOA 4FBJB 2L3ZA 1Y8RC 4CO7A 3JW0X 2CHXA 3Q3JA 3ZUNA 3HM3A 2QHOA 3M62B 4MGIE 5D94A 4F1SA 4GXBA 4MSQB 2NPTA 4ANVA 2L0TA 3QCAA 3L54A 2WX0A 2MA9B 4NQLB 2CR5A 4EEWA 2D2QA 2O2VB 5C23A 3KVFB 1R4MI 1GUAB 1WZ3A 2JY6A 4MJSB 2R2QA 4GOCA 4LDTD 1WR6E 1TTNA 4JGHB 4NY0A 1GG3A 3DVGY 4IM3A 3V60A 2GBRA 2W9NA 2IZVB 4ZYNA 1WZ0A 5LLIA 3A9JB 4K81A 2GBMA 4PS3A 4WJQA 2LI5A 4DHJD 1M94A 2LRUA 2DAJA 2ZJDA 2G3QB 5L95C 2MP2A 3JYUA 4II2B 3JSVA 3N32A 2CKHB 1J0GA 3QX1A 2FCSA 3ML9A 2J7QB 4TQ1A 4ZRIA 3RULA 2MRPA 5BO4B 3VVWB 1SIFA 5JZEB 2KTRA 1LFDA 2J0KA 1HE8A 3JSVB 4HCNB 4M0WB 2RPQA 2LUEA 5J2RA 3PPAA 3KW5B 4G0NB 2IBIB 2KTRB 2MQJA 3AI5A 2DYMA 4AJWA 1WJNA 1WM3A 1ISNA 2NCNA 3A9KB 3WAOA 3L10B 3L16A 2Z0EB 4BOZB 2G4SA 4G11A 4KV2A 1I42A 1E90A 1V5TA 3O65B 5IA7A 1OQYA 3OAWA 4URKA 2MSED 2JXXA 2ZNVB 2PJHA 3M95A 5E6PA 3V61A 3WALA 3B1LX 4W9DA 1WGHA 2FIDA 4ZRJA 2GBJA 3ZW3A 1OEYJ 1IYFA 4JLCA 1GNUA 3LDZE 4EZJA 2L0FA 5DCNA 5G2NA 3UINB 3QARA 5AZFA 4FJYA 5FR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCB A;  4NNJ B;  4WWO A;  5AZH A;  2KKC A;  4M8M A;  4DXA B;  4GDL A;  4GSW A;  2N7D A;  4FJZ A;  4K7U A;  2C60 A;  5CHW A;  1P9D U;  3HM6 X;  4NJ7 A;  1KM7 A;  1WMH B;  4B9K A;  1V2Y A;  3ZKJ C;  1TBE A;  4KIK A;  2AL3 A;  2NVU I;  5AEK B;  2BKF A;  4AUQ C;  1IP9 A;  3SD5 A;  3UIO B;  4TV3 A;  2EKE C;  2K6D B;  3ZTC A;  1P0R A;  2C9W B;  2L76 A;  3AUL A;  4A3P A;  1RLF A;  5C1Z A;  1WYW B;  2O6V A;  2KN5 A;  1V80 A;  3DBR I;  3QC8 B;  1I35 A;  4RMA A;  2D3G A;  2PEA A;  1X1M A;  3C0R B;  1Q1O A;  2N7E A;  2KMC A;  1CMX B;  2OOB B;  4KDL B;  3NZU A;  2LWP A;  1Q5W B;  3A9J A;  4W9L A;  1XQQ A;  1XD3 B;  2KJH B;  4NQK E;  2RSU A;  4W9G A;  5DPS A;  3DVN V;  3SDL C;  5J18 A;  2JPH A;  1UZX B;  4MEL A;  1V49 A;  2L05 A;  5G55 A;  3WIM A;  3VTV A;  2A5U A;  2J0J A;  2KMA A;  2BYV E;  2HD5 B;  2N9E B;  2Z0D B;  5CX3 A;  2K8B A;  3BIN A;  4KDI C;  4A20 A;  4FAD A;  2KWV B;  2LXA A;  3PVL A;  4KVG B;  4PS8 A;  4HDQ A;  1VD2 A;  2KQ7 A;  1E8W A;  2KD0 A;  2JZ3 B;  4E71 A;  4ZDV A;  4DWF A;  4G50 A;  3GOE A;  3APF A;  4W9E A;  2DHZ A;  4IM2 A;  1V81 A;  1GJZ A;  3DCG A;  1KJT A;  1PQS A;  1WE6 A;  2GBK A;  4RM8 A;  3A9K A;  2IO0 B;  2C5L C;  2L00 B;  2BKR B;  2N9P C;  4IC7 B;  3RCZ A;  4IM0 A;  4F7Z A;  5CHV C;  2AEH A;  4ICU A;  4MSM B;  1WXS A;  1ZW7 A;  2KC1 A;  5TR5 A;  3ZLZ A;  3ZDM C;  3S2A A;  1Z5S B;  3HIZ A;  1UD7 A;  2VRR B;  2BYF A;  3NZS A;  2L7R A;  4HJK A;  3PSE B;  4GDK A;  1V5O A;  2B3A A;  5DPR A;  3WAN A;  4RM9 A;  3ZNI D;  4BKG A;  2NBU A;  5L83 A;  4ANX A;  2M0X A;  3T9L A;  2WX1 A;  3AU4 A;  2IO1 B;  4GDL B;  1EF5 A;  4E74 A;  2OJR A;  2MW5 A;  2LXC A;  2N1V A;  3H6N A;  3N30 A;  3VQI A;  3X23 A;  3ZRF A;  2RGF A;  4B6W A;  5JH5 C;  4GB9 A;  4KIK B;  4WJP A;  4MDK E;  3D32 A;  3I3T B;  2Z59 B;  4JIO U;  2DZM A;  2FCQ A;  3RZF A;  2KVR A;  3UIP B;  4DHZ E;  4M8N A;  4A3O A;  2JWZ A;  1XT9 B;  3RZW C;  3VUY A;  4LCD E;  2G45 B;  3QIJ A;  2NBW B;  1S3S G;  2EMS A;  3V62 A;  3WA0 A;  3MJW A;  4AP4 C;  4ANW A;  2Y5B B;  2MBH A;  4HPM B;  5D7G A;  1WM2 A;  3ZVV A;  2KWC A;  2LRW A;  3DBH I;  4FJV B;  4IW0 A;  4WQO B;  2V1Y A;  2ZVO A;  1ZKH A;  4FUL A;  3RYT A;  4HK2 A;  1LM8 B;  4E3C A;  1AAR A;  1J8C A;  3APD A;  1JRU A;  2RD0 A;  3B08 A;  1YQB A;  2DAF A;  1WXA A;  2ZVN A;  4GN1 A;  3QHT A;  1WE7 A;  3PHX B;  1A5R A;  1LQB A;  2C7H A;  2FIF A;  1EUV B;  3EC8 A;  3IFW B;  2XK5 B;  4I6L B;  3U7D A;  5GMV A;  2C7N B;  3UGB B;  3PHW B;  2MBO A;  3V6C B;  2JT4 B;  2KJR A;  1E8Z A;  3VTW A;  2FCN A;  4KZ0 A;  1UGM A;  3U30 A;  4BOS C;  3HHM A;  4EOY A;  2C7M B;  2ZCC A;  5DPW A;  1UBI A;  2CHZ A;  4WJN A;  4CYE A;  3RD2 A;  3UF8 A;  1IPG A;  3SHQ A;  4TQ0 A;  3VDZ A;  4II3 B;  3M3J A;  3P2B A;  1EO6 A;  5JHB A;  3A1Q A;  4AJY B;  4X57 B;  3VHT C;  1WH3 A;  3ALB A;  1BT0 A;  1UH6 A;  2IO2 B;  4IWP A;  2GOW A;  3Q3F A;  2REX A;  3ZIM A;  3PRZ A;  3A4R A;  3VAW A;  2HE7 A;  3CSF A;  3UQB A;  2KZR A;  4DBG A;  2FAZ A;  2HTH A;  3R7Q A;  2NPT B;  2KLC A;  3ZRC A;  2D11 A;  4GDK B;  2JRI B;  2LZ6 A;  2R2O A;  3ZNZ B;  3IBE A;  1E5W A;  1VCB A;  2WYQ A;  3EEC A;  5D6J B;  4EZL A;  2LGD A;  3PS6 A;  4DHZ B;  1E7U A;  3CST A;  3PRP B;  3EFU A;  3ENE A;  4BKS A;  2V4L A;  4GGQ A;  2HJ8 A;  3DVN U;  2MP2 B;  3QK0 A;  2NS5 A;  2O2V A;  1V86 A;  4GU2 A;  2KDI A;  4F8C B;  4CHK A;  3A4S C;  3ECI A;  2AL6 A;  3ZDT A;  1WX8 A;  5EDS A;  5IAA C;  2GBN A;  4IWQ A;  4HLE A;  4HPL B;  1MG8 A;  2LD9 A;  1YJ1 A;  3PLV A;  3WAP A;  1U4A A;  4TUU A;  1YIW A;  2L8J A;  1NI2 A;  4FN2 A;  3DPD A;  3KYC D;  4PS7 A;  3RUI B;  4W9I A;  3X0W A;  3K9P B;  1LXD A;  4MM3 A;  3PRM B;  5E6N A;  3L17 A;  4JQW C;  3PTF C;  1WX7 A;  3R66 C;  2KX0 A;  3APC A;  3W1Y A;  1WR1 A;  3W1S C;  1WIA A;  2KAN A;  2XBB C;  3TBL D;  4K7S A;  3UQA A;  4OVU A;  3R3M A;  3VFK A;  5LXI B;  4IG7 B;  3OJ4 B;  4IUM B;  2AWT A;  3T8M A;  4FA6 A;  2M1M A;  5D2M B;  3IVF A;  2PE9 A;  2KLG A;  4MGK E;  4DHJ B;  1E8X A;  2LVP A;  3PT2 B;  2MCN B;  2JZZ A;  4PYZ A;  1C1Y B;  2BF8 B;  2WWZ A;  3TMP B;  4MGY E;  1SE9 A;  4KSK C;  3DBS A;  4WJO A;  2K25 A;  3QWZ B;  3WAM A;  4P7I A;  2DX5 B;  2LVO A;  2N4F A;  1H4R A;  1RFA A;  1L7Y A;  2ASQ A;  1J19 A;  2BYE A;  3NOB A;  4W9K A;  1WJ4 A;  2D07 B;  3QQ8 B;  2JRH A;  3RT3 B;  2A4Z A;  3DOW A;  3TJP A;  3VH4 B;  2KJ6 A;  4WAA A;  3TIX A;  1R4N I;  2D10 A;  4AWJ A;  2N1W A;  3JVZ X;  2G4D B;  1L2N A;  2M17 A;  5E6O A;  3MHS D;  2ZNV C;  3QAQ A;  4PYU A;  3B0A A;  3DDC B;  3N3K B;  2DZI A;  4ANU A;  2KFK B;  2KK8 A;  4KZC A;  3MTN B;  2M8S A;  1RAX A;  2ZZP B;  2V3S A;  1WX9 A;  3IHP C;  2ZPN A;  2GMI C;  2YVC A;  3NHE B;  3DVG X;  2FUH B;  4ICV A;  4B95 A;  2KFJ A;  2DZJ A;  1WFY A;  2KDF B;  2YLM A;  4MGZ E;  4W9H A;  4TKN A;  2IY1 B;  1WXV A;  1GC7 A;  2O6V B;  4DK5 A;  3HK0 A;  2JUO A;  2DZK A;  2N9X A;  4K7W A;  2LAS A;  4DDG D;  2PPH A;  2IY0 B;  2FCM A;  1WJU A;  2CHW A;  4AOF A;  3QA8 A;  3VTU A;  2UYZ B;  1RRB A;  2LGY A;  4HXD A;  2KXJ A;  3R7R A;  1UEL A;  3GZN I;  4W9J A;  5CTR C;  4EZK A;  1P98 A;  4FHJ A;  4GMV A;  3AXC A;  3EHV A;  3ZNH B;  4IWO A;  2BGF A;  1WXM A;  3NS8 A;  2KDE B;  2CS4 A;  3H9D A;  4I6N B;  2KC2 A;  2BWF A;  2DYO A;  5KHO A;  3CF6 E;  2RR9 A;  2NBV B;  3KUZ A;  4XZ4 A;  3VUW A;  2IO3 B;  4FHK A;  4KSL C;  4BBN C;  4NAW B;  1V9J A;  1FXT B;  3LJ3 A;  1K8R B;  4I6P A;  4BVU C;  1WGY A;  4NPN A;  3CMM B;  5HKH A;  1S1Q B;  2XEW A;  4JL9 A;  4FLH A;  4K1R B;  3M63 B;  2KHW B;  1OGW A;  4LJP B;  4NAW A;  1E8Y A;  4ASW C;  1KLV A;  3ZTD A;  4BKS D;  4WWP A;  2KDB A;  2JVC A;  2KOX A;  4YL8 A;  3ZNG C;  3ZO5 B;  1TZ1 A;  4HDO A;  5LXH A;  2LJ5 A;  4LDT B;  1GC6 A;  1WGR A;  4XX5 A;  2NR2 A;  1EF1 A;  1P1A A;  3TCA A;  1WGG A;  2K6Q A;  1SGH A;  2IYD B;  2UWQ A;  3H1U A;  1UBQ A;  2J0M A;  2LGX A;  2MBQ A;  1WF9 A;  2KQS A;  4MH0 E;  2MX2 A;  3KH0 A;  1V6E A;  1WMH A;  3PRE A;  3PZD A;  4WWN A;  4MJS A;  4EKU A;  3L0W B;  2AYO B;  4N9F 4;  3KUC B;  3DQV A;  1F9J A;  1QZE A;  2KFK A;  2KWU B;  2LVQ A;  4MEM A;  3VUX A;  5KHQ A;  2BPS A;  3OLM D;  1WGD A;  1YX5 B;  2MLB A;  3QJZ A;  5JHA A;  4BBN F;  2DYB A;  2MBE A;  4G3X B;  3PGE A;  2K8C A;  4DDI D;  3NY5 A;  3ML8 A;  1TGZ B;  3U8Z A;  1H8C A;  2I1J A;  3PV1 A;  4HVB A;  1WRD B;  1WY8 A;  2ZEQ A;  3BY4 B;  3ONS A;  2FNJ B;  1P3Q U;  1NBF C;  3VXW A;  1YD8 U;  2KX3 A;  1OEY A;  2KTF A;  4NJ6 A;  5DPT A;  4BKT A;  4GIV A;  1G6J A;  2K8H A;  3DBL I;  5J17 A;  5AZG A;  2M4N A;  2EMT A;  2PE6 B;  4ZRK A;  2WDT B;  3PLU A;  5CHF A;  3K9O B;  1Z2M A;  4BFR A;  3TL5 A;  4LJO B;  3W1S A;  1T0Y A;  3SU8 X;  2KNB A;  1E7V A;  1Q0W B;  3L13 A;  2XK5 A;  2I1K A;  1WJ6 A;  1WI0 A;  3A33 B;  3A1Q B;  2JF5 A;  1D3Z A;  2O6V D;  3KUD B;  2K39 A;  2MWS B;  1OTR B;  2BWE S;  4J6I A;  4W9C A;  3OJ3 A;  3V6E B;  3VH3 B;  2ZPY A;  3H7P B;  1YX6 B;  2K1F A;  2CU1 A;  3H7S A;  4OVV A;  1NDD A;  4W9F A;  1KOT A;  2DEN B;  3IG3 A;  4XC2 A;  4EUT A;  3L08 A;  3AU5 A;  3H7P A;  3KYD D;  2KO3 A;  2MBB B;  4HWI B;  1ZGU B;  4HCP B;  1C3T A;  4EFO A;  4FBJ B;  2L3Z A;  1Y8R C;  4CO7 A;  3JW0 X;  2CHX A;  3Q3J A;  3ZUN A;  3HM3 A;  2QHO A;  3M62 B;  4MGI E;  5D94 A;  4F1S A;  4GXB A;  4MSQ B;  2NPT A;  4ANV A;  2L0T A;  3QCA A;  3L54 A;  2WX0 A;  2MA9 B;  4NQL B;  2CR5 A;  4EEW A;  2D2Q A;  2O2V B;  5C23 A;  3KVF B;  1R4M I;  1GUA B;  1WZ3 A;  2JY6 A;  4MJS B;  2R2Q A;  4GOC A;  4LDT D;  1WR6 E;  1TTN A;  4JGH B;  4NY0 A;  1GG3 A;  3DVG Y;  4IM3 A;  3V60 A;  2GBR A;  2W9N A;  2IZV B;  4ZYN A;  1WZ0 A;  5LLI A;  3A9J B;  4K81 A;  2GBM A;  4PS3 A;  4WJQ A;  2LI5 A;  4DHJ D;  1M94 A;  2LRU A;  2DAJ A;  2ZJD A;  2G3Q B;  5L95 C;  2MP2 A;  3JYU A;  4II2 B;  3JSV A;  3N32 A;  2CKH B;  1J0G A;  3QX1 A;  2FCS A;  3ML9 A;  2J7Q B;  4TQ1 A;  4ZRI A;  3RUL A;  2MRP A;  5BO4 B;  3VVW B;  1SIF A;  5JZE B;  2KTR A;  1LFD A;  2J0K A;  1HE8 A;  3JSV B;  4HCN B;  4M0W B;  2RPQ A;  2LUE A;  5J2R A;  3PPA A;  3KW5 B;  4G0N B;  2IBI B;  2KTR B;  2MQJ A;  3AI5 A;  2DYM A;  4AJW A;  1WJN A;  1WM3 A;  1ISN A;  2NCN A;  3A9K B;  3WAO A;  3L10 B;  3L16 A;  2Z0E B;  4BOZ B;  2G4S A;  4G11 A;  4KV2 A;  1I42 A;  1E90 A;  1V5T A;  3O65 B;  5IA7 A;  1OQY A;  3OAW A;  4URK A;  2MSE D;  2JXX A;  2ZNV B;  2PJH A;  3M95 A;  5E6P A;  3V61 A;  3WAL A;  3B1L X;  4W9D A;  1WGH A;  2FID A;  4ZRJ A;  2GBJ A;  3ZW3 A;  1OEY J;  1IYF A;  4JLC A;  1GNU A;  3LDZ E;  4EZJ A;  2L0F A;  5DCN A;  5G2N A;  3UIN B;  3QAR A;  5AZF A;  4FJY A;  5FR6 A; 
#chains in the Genus database with same CATH topology
 2ZCB A;  4WWO A;  4HEA 1;  1P9D U;  4NJ7 A;  1WMH B;  1L6V A;  4B9K A;  4KIK A;  1RWS A;  5HFY A;  1IP9 A;  1FPY A;  2WU2 B;  2C9W B;  2K0P A;  5C1Z A;  1C76 A;  1V80 A;  3QC8 B;  4RMA A;  3C0R B;  3IAM 1;  2N7E A;  1XD3 B;  2KJH B;  3DVN V;  5J18 A;  3CWI A;  2JPH A;  4MEL A;  2L05 A;  1FFV A;  2BYV E;  5CX3 A;  2Z0D B;  1KTK A;  4A20 A;  2K22 A;  4HDQ A;  4KKI A;  1FNU A;  1SBB B;  1DYQ A;  1PFD A;  2KD0 A;  4DWF A;  2DHZ A;  1GJZ A;  4RM8 A;  2W82 A;  3OWE B;  4IC7 B;  3RCZ A;  4F7Z A;  2YEP B;  4MSM B;  3AEA B;  3KWV A;  3TUO A;  3ZDM C;  3S2A A;  3CIR B;  1B1Z A;  2BYF A;  3PSE B;  3HRD D;  4RM9 A;  3T9L A;  3AU4 A;  4GDL B;  1R4N B;  2OJR A;  2LXC A;  3VQI A;  3ZRF A;  1QOG A;  4XYC A;  4MDK E;  3D32 A;  4JIO U;  3ZXV A;  5E6J A;  2QCZ A;  2KT7 A;  2WGS A;  1SF0 A;  3QIJ A;  2NBW B;  5BYS A;  3WCQ A;  2Y5B B;  4L2Y A;  2OJW A;  5FR3 A;  4WQO B;  3ZYY X;  4YWG G;  5EE1 A;  2DAF A;  4GN1 A;  1LGR A;  1BML C;  1LQB A;  3IFW B;  2XK5 B;  3DHI C;  3Q2A C;  3U7D A;  1ACC A;  2JT4 B;  3DWG C;  1XF5 L;  2KWD A;  2FCN A;  1FXI A;  4KKJ A;  3SR6 A;  2ZCC A;  2QEJ C;  4WJN A;  4A55 A;  3M3J A;  3P2B A;  3A1Q A;  2XNA C;  1I4Q A;  3ALB A;  2GOW A;  3Q3F A;  1ENF A;  3VAW A;  3A4R A;  5BMI A;  1I4H A;  2AQ3 B;  3R7Q A;  2NPT B;  4JWU C;  4WQM A;  1TS4 A;  1MJD A;  2JRI B;  2R2O A;  3IBE A;  1E5W A;  4A6Q A;  4EZL A;  1NI3 A;  1E7U A;  2M56 B;  3PRP B;  3P4Q B;  3B2G A;  1FNW A;  2V4L A;  4RH6 A;  3DVN U;  3QK0 A;  2O2V A;  3C8Y A;  4IWQ A;  2Y5P A;  2LD9 A;  2WXI A;  1D5Z C;  2D5G A;  1NI2 A;  1XEE A;  3Q3N C;  3K9P B;  4JQW C;  4MH8 A;  3APC A;  2XBB C;  1E7P B;  3UQA A;  5LXI B;  2BB6 A;  4MM3 B;  3OJ4 B;  3T8M A;  1KRH A;  2KAC A;  4FA6 A;  1XLQ A;  4ZHP A;  3Q8B A;  1ROE A;  1E8X A;  2LUM A;  2N0S B;  2MCN B;  3LXF A;  2WWZ A;  1SE9 A;  4KSK C;  3QWZ B;  2FE8 A;  1E9M A;  2DX5 B;  2N4F A;  5D3I B;  4S0R A;  1STE A;  1K52 A;  3W5U B;  1WJ4 A;  2G9H D;  2JRH A;  2A4Z A;  1QIL A;  2N1W A;  1L2N A;  2M17 A;  4WWM A;  2ZNV C;  4B0E A;  2KN4 A;  2DZI A;  3N3K B;  4ANU A;  2SAK A;  1FD6 A;  4KZC A;  1RAX A;  1DOY A;  4R3D A;  1WX9 A;  3DBL B;  3IHP C;  2AQ1 B;  2ZPN A;  2WXJ A;  3NHE B;  3DVG X;  2FUH B;  4ICV A;  2DZJ A;  4RF0 A;  2IY1 B;  2I2Y A;  2O6V B;  4DK5 A;  3HK0 A;  3I5J C;  3QA8 A;  3SFD B;  2UYZ B;  1RRB A;  3R7R A;  3NVZ A;  3Q3M C;  3OG5 A;  4FHJ A;  2J4X A;  2PMV A;  2BGF A;  4I6N B;  2RR9 A;  3KUZ A;  4NAW B;  1K8R B;  1S1Q B;  2E3T A;  2BT6 A;  1E8Y A;  3P4P B;  4ASW C;  1KLV A;  1KH0 A;  2KOX A;  1OFF A;  4YL8 A;  3AED B;  3AM9 A;  2NR2 A;  1GPX A;  1WGG A;  3H1U A;  1UBQ A;  4KGS A;  2KQS A;  1WMH A;  3T3N A;  4YSX B;  1F9J A;  2KWU B;  3VR8 B;  1T0S C;  4LNK A;  3L4P A;  1WGD A;  2MLB A;  5JHA A;  2MBE A;  3GP7 A;  3NY5 A;  1UNS A;  3BII D;  1P3Q U;  1NBF C;  4A8X C;  3ZJU A;  1YD8 U;  1OEY A;  2KTF A;  4NJ6 A;  4BKT A;  2M4N A;  3E56 A;  1JWB D;  4IKG A;  5CHF A;  4YTN B;  3K9O B;  4BFR A;  3Q8C A;  1M4V A;  4LJO B;  1FO4 A;  1A70 A;  3SU8 X;  1JQ4 A;  2KNB A;  1WI0 A;  3A33 B;  3Q3O C;  3AEG B;  3KUD B;  2K39 A;  1EWY C;  1OTR B;  4W9C A;  3W5V B;  1SJH D;  1E6E B;  2JXT A;  4LNF A;  4W9F A;  1KOT A;  2DEN B;  3L08 A;  2ICI A;  3NUH B;  2QJL A;  3RNC C;  4FBJ B;  1I4R A;  3SEB A;  3Q3J A;  4ZHO A;  3ZUN A;  2QHO A;  2IGH A;  4F1S A;  2GLS A;  4ANV A;  2NPT A;  2IPK D;  1JWA D;  2QMT A;  2MA9 B;  1D5M C;  1JW9 D;  2CR5 A;  4TMA B;  2M0A A;  2D2Q A;  5C23 A;  3KVF B;  1BUI C;  1XCT L;  2NTT A;  2XN9 C;  1WR6 E;  1TT5 B;  3HVZ A;  1GG3 A;  1L0Y B;  1MHX A;  3DVG Y;  3V60 A;  2GBR A;  2IZV B;  4K81 A;  4WJQ A;  2ZJD A;  2G3Q B;  1L0V B;  2MP2 A;  3N32 A;  3RUL A;  3AE8 B;  2MRP A;  4NAM A;  2RPQ A;  2LUE A;  1HEZ E;  3AI5 A;  4AS1 A;  1WJN A;  1WM3 A;  2NCN A;  4L1B A;  1IUE A;  3A9K B;  3I9V 1;  3L16 A;  2Z0E B;  3EGR A;  3TEZ A;  3AE4 B;  4G11 A;  1I42 A;  4S17 A;  2MSE D;  2JXX A;  2ZNV B;  3V61 A;  3WAL A;  2FID A;  1IBX B;  2GBJ A;  2OED A;  3ZW3 A;  1OEY J;  2L0F A;  3J9C A;  5G2N A;  1V8C A;  3QAR A;  3O13 A;  1XLN A;  5FR6 A;  5L95 C;  2Z8L A;  4DXA B;  2KKC A;  3N20 C;  4GDL A;  1SB3 C;  1TKG A;  4K7U A;  2PIA A;  3KQ4 A;  2W3S A;  3HM6 X;  2K5P A;  2MH7 A;  5AEK B;  2NVU I;  3SD5 A;  4TV3 A;  4REZ A;  2L76 A;  1JWM D;  3AUL A;  1RLF A;  3E9S A;  1WYW B;  2KN5 A;  1I35 A;  1YN5 A;  2D3G A;  2PEA A;  1X1M A;  4RCO A;  2OOB B;  5BMH A;  1Q5W B;  3A9J A;  4W9L A;  1XQQ A;  2RSU A;  4W9G A;  5DPS A;  3SDL C;  1YQ3 B;  2CJO A;  1V49 A;  5G55 A;  4FAD A;  1PDX A;  2LXA A;  1C4C A;  3PVL A;  4ARC A;  2WXK A;  2TSS A;  4C4V B;  3EA6 A;  2JZ3 B;  4ZDV A;  2RMM A;  4WH4 A;  1CJE A;  3T3O A;  1HZ6 A;  2DLB A;  1KJT A;  2IO0 B;  2X8X X;  2C5L C;  2GI9 A;  2L00 B;  2BKR B;  4LNO A;  4IM0 A;  4FXC A;  2AEH A;  2KC1 A;  1MPE A;  1UD7 A;  3HIZ A;  1WYG A;  1ZE3 D;  2VZK D;  4GDK A;  2B3A A;  1MG4 A;  2CU3 A;  2WX1 A;  2WLB A;  1IGD A;  2MW5 A;  1CZP A;  3X23 A;  4PK1 A;  2V3P A;  3TSS A;  5JH5 C;  2YEP F;  3FKY A;  3EUB 2;  2Z59 B;  3UIP B;  1TZO A;  3MFG A;  3VUY A;  4LCD E;  2G45 B;  1SJE D;  3WA0 A;  1S3S G;  4AP4 C;  1D5X C;  1VZ8 A;  3NJT A;  1F2R I;  3EFC A;  1MI0 A;  2KAJ A;  2W55 A;  2FUG 1;  4FUL A;  3RYT A;  1YQB A;  3AEC B;  1WE7 A;  1TS5 A;  4C7Z A;  1EUV B;  5GMV A;  3UGB B;  3PHW B;  2MBO A;  4GLS C;  2LFI A;  1BXT A;  5I4D A;  3HHM A;  2C7M B;  2ACZ B;  5DPW A;  3B2F A;  3RD2 A;  1IPG A;  5G5H A;  4TQ0 A;  3Q6B A;  1JWS D;  4AJY B;  4X57 B;  2WP9 B;  2JU6 X;  1SXT A;  1XLO A;  2KZR A;  2FAZ A;  2HTH A;  3ZRC A;  2D11 A;  3TEX A;  4LK0 M;  4NJC A;  4ZRQ A;  4EE2 A;  5IO9 A;  1VCB A;  2WYQ A;  3EEC A;  5D6J B;  4H2A A;  1FFU A;  4CQN A;  3ENE A;  4GGQ A;  2JYE A;  3FC4 A;  3Q8A A;  3N1Z C;  3RI7 C;  3RMK C;  3A4S C;  1T6B X;  5IAA C;  2GBN A;  4HLE A;  2J53 A;  1VDV A;  3WAP A;  1YIW A;  1EU4 A;  4HJG E;  1C9F A;  4RNA A;  3DPD A;  4PS7 A;  1QLB B;  1LXD A;  3N1X C;  4MM3 A;  5E6N A;  2RPV A;  1WX7 A;  3R66 C;  3ZQ4 A;  3W1Y A;  2WXN A;  1WIA A;  1VR9 A;  4OVU A;  3R3M A;  5D2M B;  2JZP A;  2WU5 B;  1ZOY B;  4DHJ B;  3PT2 B;  3KLS X;  4PYZ A;  4XWW A;  5IKC M;  3BYT B;  4MGY E;  4P7I A;  1YJJ A;  1L7Y A;  1RFA A;  2D3A A;  2WDV B;  2RDB C;  3LB8 C;  4XE0 A;  4YT0 B;  1LO5 D;  3NOB A;  4W9K A;  3QQ8 B;  3RT3 B;  1R4N I;  2MJD A;  2G4D B;  5E6O A;  1TIF A;  1EM7 A;  3B0A A;  3KWL A;  2KK8 A;  2ZZP B;  1J7C A;  2D3B A;  3URY A;  1WFY A;  4W9H A;  4N6E B;  5HHD G;  1WXV A;  1GC7 A;  1VZ6 A;  2JUO A;  2N9X A;  2LAS A;  3U4E G;  1VRA B;  2FCM A;  3AV8 A;  3VTU A;  1RYJ A;  2KXJ A;  4P1B C;  3GZN I;  4W9J A;  1P98 A;  4P1C C;  2KDE B;  2CS4 A;  5KHO A;  2NBV B;  4FHK A;  1K50 A;  4KSL C;  4BBN C;  1V9J A;  3LJ3 A;  4ACF A;  1FEH A;  2EEL A;  5HKH A;  2IGD A;  4JL9 A;  2M19 A;  4FLH A;  4K1R B;  3M63 B;  2ZW1 A;  1KFY B;  2WNM A;  3AE1 B;  2UU7 A;  1I4P A;  3ZNG C;  3ZO5 B;  1TZ1 A;  4B0M A;  4RGO S;  4XGA B;  5LNK 1;  2LJ5 A;  3TCA A;  2K6Q A;  1FNV A;  1ZPS A;  4RFB A;  2J0M A;  2LGX A;  2MBQ A;  2BW2 A;  5D3D A;  2MX2 A;  3KH0 A;  1UGJ A;  1V6E A;  3PRE A;  4HPP A;  4WWN A;  4MJS A;  1E0Z A;  3L0W B;  2AYO B;  3I57 A;  3DQV A;  2LVQ A;  2KFK A;  3VUX A;  1FCC C;  5BMG A;  3QJZ A;  4G3X B;  4OHJ A;  1V97 A;  3RPF C;  1TKY A;  3U8Z A;  2I1J A;  3PV1 A;  4HVB A;  4US9 A;  2ZEQ A;  2KX3 A;  1QOF A;  3VR9 B;  2EKI A;  2VZK B;  1Z2M A;  3TL5 A;  2IND C;  3L13 A;  1JRO A;  3BVG A;  1WWT A;  1FXA A;  1XCQ L;  3Q8E A;  1D3Z A;  2GRI A;  3N1Y C;  3OJ3 A;  1VZ7 A;  2ZPY A;  2IGG A;  3H7P B;  1YX6 B;  1AYF A;  2K1F A;  3H7S A;  1QOB A;  4XC2 A;  4EUT A;  3AU5 A;  3H7P A;  3AEF B;  2MBB B;  1ZGU B;  3IXS A;  1C3T A;  4EFO A;  2L3Z A;  3JW0 X;  2CHX A;  2NTS A;  3M62 B;  4YTP B;  4GXB A;  4MSQ B;  4EEW A;  1GUA B;  2JY6 A;  4NY0 A;  4OW0 A;  1F77 A;  1WZ0 A;  5LLI A;  3A9J B;  5HG2 A;  2V0G A;  2DAJ A;  4RGT A;  5TSS A;  3JSV A;  5FK9 C;  4P6V F;  2FCS A;  2J7Q B;  4ZRI A;  5JZE B;  2ONQ A;  2PTL A;  2J0K A;  4D2K A;  4USA A;  3Q69 A;  2KTR B;  2DYM A;  5GXG B;  3GZN B;  4A90 A;  3L10 B;  3MHZ A;  1L5P A;  4BOZ B;  4ZRP A;  2VH2 A;  1OQY A;  3PZ7 A;  3OAW A;  5E6P A;  1HA5 A;  1TY2 A;  1F2R C;  4K3B A;  4EZJ A;  1JAL A;  2N9K A;  4FJY A;  1TY0 A;  4M8M A;  4JX1 C;  2N7D A;  4FJZ A;  1HZ5 A;  3RNA C;  1V2Y A;  2AL3 A;  2KDM A;  2BKF A;  4AUQ C;  3GS2 A;  3RNF C;  3UIO B;  3ZTC A;  1EU3 A;  1P0R A;  2QIL A;  3DBR I;  1Q1O A;  2LMC A;  2KMC A;  3AE5 B;  3SFE B;  1CMX B;  1N61 A;  1FMA D;  4KGT A;  1MVK A;  1C77 A;  2WXL A;  4NQK E;  1ZDX A;  1C4A A;  2IJ0 A;  2QIE B;  3C19 A;  2J0J A;  2K8B A;  3BIN A;  4KDI C;  2KWV B;  5FKA C;  4KVG B;  4PS8 A;  1V1P B;  1VD2 A;  3AEE B;  1J7A A;  1E8W A;  3TEW A;  2K9X A;  4E71 A;  4G50 A;  3GOE A;  3APF A;  4W9E A;  4OVZ A;  4IM2 A;  1V81 A;  1WE6 A;  1FM0 D;  3A9K A;  2N9P C;  5CHV C;  1I7H A;  1ZW7 A;  1PYW D;  3NVV A;  5C2T B;  2VRR B;  4HJK A;  1E10 A;  1V5O A;  3ZNI D;  5DPR A;  4LTU A;  5L83 A;  1NEN B;  2IO1 B;  3U7Z A;  4E74 A;  1EF5 A;  4A9A A;  2N1V A;  3H6N A;  3DHH C;  2FBW B;  2J42 A;  2L32 A;  2DZM A;  2FCQ A;  2KVR A;  4M8N A;  2JWZ A;  1XT9 B;  4ZYS A;  3RZW C;  3RNB C;  2EMS A;  2RDH A;  4YSY B;  4ANW A;  4XDC A;  3MP9 A;  5D7G A;  4HPM B;  5BYR A;  1TYG B;  1FCL A;  3ZVV A;  2INP E;  2KWC A;  2LRW A;  3DBH I;  4IW0 A;  3U2S C;  2V1Y A;  2ZVO A;  1ZKH A;  4HK2 A;  1J8C A;  1AAR A;  3APD A;  1JRU A;  1C78 A;  2WXO A;  3EC8 A;  4ITK A;  1V1P A;  3V6C B;  2KJR A;  3VTW A;  4C56 C;  4KZ0 A;  5IN7 A;  4BOS C;  4EOY A;  3MC9 A;  1MFW A;  1UBI A;  4CYE A;  1YOV B;  3SHQ A;  2OHF A;  4II3 B;  1EO6 A;  1BT0 A;  1C4P A;  2BVC A;  4HKZ E;  2IO2 B;  2REX A;  3ZIM A;  2HE7 A;  4QAY A;  4DBG A;  2KLC A;  5AUI A;  3VRA B;  4GDK B;  2H89 B;  1I4G A;  1DOX A;  3PS6 A;  1HQR D;  3EFU A;  3DWM A;  2JYT A;  2V4I B;  5C3J B;  2HJ8 A;  4DXG A;  2NS5 A;  1QT9 A;  1V86 A;  4GU2 A;  4YSZ B;  4CHK A;  1WX8 A;  5EDS A;  3NVY A;  1YJ1 A;  1U4A A;  2ON8 A;  2L8J A;  3DHG C;  3KYC D;  2B76 B;  1ZP0 B;  5T8I A;  3RUI B;  3PRM B;  1FIQ A;  3BZD B;  1JWU D;  3PTF C;  4M00 A;  1JCK B;  5EE9 A;  1TKE A;  2KAN A;  3TBL D;  1GAQ B;  3VFK A;  4IG7 B;  3ZXR A;  4IUM B;  2AWT A;  1NYR A;  2KYW A;  1EWC A;  4AQ7 A;  2PE9 A;  4MGK E;  3AMZ A;  1PGA A;  3R2T A;  1C1Y B;  4WJO A;  2JQR B;  2WXH A;  2LVO A;  3FIL B;  2BS2 B;  2ASQ A;  1IBX A;  2PVO D;  2W54 A;  5AUK A;  4LLG M;  3DOW A;  1SE4 A;  4WAA A;  3TIX A;  3AH7 A;  3MHS D;  3QAQ A;  4PYU A;  3DDC B;  3Q8F A;  1QF6 A;  2V3S A;  2AQ2 B;  2YVC A;  1NVI D;  4B95 A;  2KFJ A;  2Q5W D;  2KDF B;  3FAH A;  4TKN A;  3MC8 A;  1C79 A;  5IOI A;  1PUT A;  3AE6 B;  3N9Y C;  2IY0 B;  4AOF A;  3V05 A;  4HXD A;  5CTR C;  5HI1 A;  2KMM A;  4K3C A;  3EHV A;  3ZNH B;  3ZGZ A;  4IWO A;  4BZA A;  1WXM A;  4IOI E;  3H9D A;  4TSS A;  3CF6 E;  2G1E A;  4XZ4 A;  2IO3 B;  4I6P A;  1FXT B;  4BVU C;  1RM6 C;  2I38 A;  1F1H A;  1UF0 A;  4NPN A;  3CMM B;  2LGI A;  2XEW A;  1OQQ A;  1KF6 B;  2KHW B;  4LJP B;  4KGR A;  4BKS D;  4KX6 B;  1AWD A;  1YNT E;  1UUP A;  5LXH A;  2LHE A;  4LDT B;  4XX5 A;  1EF1 A;  1SGH A;  2IYD B;  4MT5 A;  2MJ3 A;  1Y56 A;  5EE0 A;  4MH0 E;  5H8Y E;  3GE3 C;  3PZD A;  1FRD A;  4N9F 4;  3KUC B;  5EE3 A;  5H92 C;  1R7S A;  2JSV X;  1V1O A;  1TGZ B;  2LHD A;  1WY8 A;  2QDF A;  3ZJT A;  1SSN A;  4GIV A;  3DBL I;  5AZG A;  2EMT A;  2PE6 B;  4ZRK A;  3PLU A;  4RGN A;  1D6E C;  1ESF A;  1Q0W B;  3ZJV A;  1DOI A;  2I1K A;  2VH1 A;  1XO3 A;  2JF5 A;  2O6V D;  2BWE S;  3PZ8 A;  4J6I A;  2V9H A;  3V6E B;  3VH3 B;  3VRB B;  5IP4 D;  4OVV A;  4RF1 A;  3KYD D;  4P16 A;  4HWI B;  1N5X A;  4HCP B;  4CO7 A;  3HM3 A;  4O1N A;  4MGI E;  5D94 A;  4L23 A;  3QCA A;  3L54 A;  3AE3 B;  2WX0 A;  3BVZ A;  2J52 A;  1WZ3 A;  4LDT D;  1TTN A;  1P7F A;  1HXY D;  4IM3 A;  2W9N A;  2BB5 A;  3LYY A;  4PS3 A;  4DHJ D;  1M94 A;  2LRU A;  3PO0 A;  2H88 B;  2JWU A;  2CKH B;  2RDG A;  1J0G A;  2HTM E;  3W9C B;  3ML9 A;  2WHI A;  4TQ1 A;  3VVW B;  1SIF A;  1D4B A;  4HCN B;  1CQV A;  5J2R A;  3KW5 B;  4G0N B;  2IBI B;  2MQJ A;  4AJW A;  3AEB B;  3WAO A;  4KV2 A;  1E90 A;  1V5T A;  1YN4 A;  3O65 B;  5IA7 A;  5BYQ A;  1ET9 A;  4URK A;  1AW7 A;  3M95 A;  4W9D A;  1T3Q A;  2GB1 A;  2WXG A;  1IYF A;  2HDE A;  1L4Z B;  5DCN A;  3UIN B;  2NMQ A;  2X38 A;  4NZL B;  4NNJ B;  5AZH A;  1J7B A;  4GSW A;  2C60 A;  5CHW A;  3MJ5 A;  4JE3 B;  1KM7 A;  4HRO A;  3ZKJ C;  1TBE A;  1UWM A;  1XXG A;  2MJE A;  2EKE C;  2K6D B;  4A3P A;  2O6V A;  1JRP A;  2MHJ A;  2WDQ B;  1SE3 A;  3NZU A;  4KDL B;  2LWP A;  3RNE C;  1F0Z A;  1WXQ A;  1UWX A;  2QC8 A;  1UZX B;  3WIM A;  3VTV A;  2A5U A;  2KMA A;  2HD5 B;  2N9E B;  1T0R C;  3BK1 A;  2QSD A;  4US8 A;  2E6X A;  2KQ7 A;  2PKO A;  3IT4 B;  1CK1 A;  1KLG D;  3DCG A;  1PQS A;  2GBK A;  4ARI A;  1B9R A;  4IDI A;  4C7Y A;  2L1A A;  2N9L A;  4MAC A;  1NYQ A;  4ICU A;  1WXS A;  5TR5 A;  3ZLZ A;  1Z5S B;  4Q2J A;  3NZS A;  4ZOH C;  2L7R A;  3WAN A;  4BKG A;  1ZXH A;  5G5G A;  2NBU A;  4ANX A;  2M0X A;  3N30 A;  2RGF A;  4B6W A;  1N60 A;  4GB9 A;  3UI3 A;  1N5W A;  4KIK B;  1K53 A;  2BS3 B;  4WJP A;  4WAF A;  3I3T B;  3RZF A;  4DHZ E;  4A3O A;  1I4X A;  1MHH E;  3V62 A;  3MJW A;  4N59 A;  3IT6 B;  3RN9 C;  2MBH A;  1WM2 A;  4N58 A;  4FJV B;  1N62 A;  1LM8 B;  4E3C A;  2RD0 A;  3B08 A;  2WXF A;  2LGS A;  1WXA A;  2PVG C;  2KQ4 X;  2ZVN A;  3QHT A;  3PHX B;  1A5R A;  3W2D A;  1PGX A;  1SIJ A;  2C7H A;  2FIF A;  4I6L B;  3P1M A;  3P4R B;  2Y5C A;  2C7N B;  1ZUD 2;  1L4D B;  1ET6 A;  1E8Z A;  1YMH E;  1UGM A;  3U30 A;  2CHZ A;  3UF8 A;  3VDZ A;  4OZC A;  5JHB A;  1VJK A;  3VHT C;  1GB4 A;  1WH3 A;  1UH6 A;  4IWP A;  1WSP A;  1XLP A;  3PRZ A;  2SEB D;  3CSF A;  3UQB A;  4LNI A;  1IGC A;  2HJ1 A;  2LZ6 A;  3ZNZ B;  4UDU C;  3R2I A;  2LGD A;  2PW9 A;  3Q14 C;  3AE2 B;  3CST A;  4DHZ B;  2LEK A;  3P42 A;  2V3N A;  4BKS A;  2DWQ A;  2MP2 B;  1TJE A;  3AE7 B;  1TS2 A;  3BK2 A;  2KDI A;  4F8C B;  3ECI A;  2AL6 A;  2L52 A;  3ZDT A;  4C80 A;  1Q10 A;  4XDD A;  4HPL B;  1MG8 A;  3PLV A;  2INN E;  4TUU A;  4FN2 A;  3DBH B;  4W9I A;  3X0W A;  4LNN A;  3L17 A;  1N63 A;  2KX0 A;  3GB1 A;  1KLU D;  1P7E A;  1WR1 A;  4XWT A;  3W1S C;  3ABV B;  4K7S A;  2M1M A;  3IVF A;  2KLG A;  2LVP A;  3FIL A;  2JZZ A;  3AE9 B;  4C00 A;  2JX5 A;  2DNF A;  2BF8 B;  3TMP B;  3IAS 1;  3DBS A;  2K25 A;  3GE8 C;  3WAM A;  2BBC A;  3P4S B;  1H4R A;  2CJN A;  1J19 A;  2BYE A;  3RNG C;  2IDY A;  1RFK A;  2D07 B;  1QOA A;  3TJP A;  3VH4 B;  2KJ6 A;  2D10 A;  4AWJ A;  3JVZ X;  4J3O D;  1HTO A;  4YTM B;  4DXF A;  2KFK B;  3MTN B;  2M8S A;  3U52 E;  2GMI C;  1NEK B;  2YLM A;  4MGZ E;  1JML A;  4DDG D;  2DZK A;  4K7W A;  1PGB A;  2PPH A;  2Y3A A;  1SEB D;  3MC0 B;  1WJU A;  2CHW A;  4RGM A;  3BVM A;  2LGY A;  1UEL A;  2MEK A;  4PT5 A;  4EZK A;  4GMV A;  1T0Q C;  3AXC A;  3NS8 A;  2KVZ A;  2KC2 A;  2BWF A;  2BQQ A;  3HVD A;  4M02 A;  2DYO A;  2AX5 A;  1VLB A;  2WXM A;  3VUW A;  1GOZ A;  3AB5 A;  2BTE A;  1WGY A;  1WGK A;  1OGW A;  4NAW A;  3ZTD A;  1L0X B;  2WXQ A;  4WWP A;  2KDB A;  1DGJ A;  2JVC A;  3BWU D;  4HDO A;  2WS3 B;  2WDR B;  1GC6 A;  1WGR A;  1P1A A;  2UWQ A;  3P63 A;  3HUI A;  3TEY A;  1WF9 A;  5JXV A;  4EKU A;  4OZA A;  1YQ4 B;  3BYY B;  1QZE A;  5KHQ A;  4MEM A;  1K51 A;  2BPS A;  3OLM D;  1YX5 B;  3RFZ B;  4BBN F;  2DYB A;  3PGE A;  2K8C A;  4DDI D;  3ML8 A;  1WRI A;  1H8C A;  1WRD B;  1YN3 A;  3BY4 B;  3ONS A;  2FNJ B;  1FRR A;  4DQO C;  3VXW A;  5DPT A;  1G6J A;  2K8H A;  5J17 A;  1HTQ A;  2WDT B;  1YJI A;  3W1S A;  1R4M B;  1T0Y A;  4C4V A;  1E7V A;  2XK5 A;  1WJ6 A;  2INC C;  3A1Q B;  1L6U A;  2MWS B;  3NS1 A;  1ZDV A;  2CU1 A;  1T5X D;  2LJI A;  3R8B A;  1NDD A;  5MPO A;  3IG3 A;  4WUR A;  3H8H A;  2KO3 A;  2W3R A;  1Y8R C;  2WQY B;  2D3C A;  2L0T A;  1AN8 A;  4M01 A;  3NZ3 A;  1QQR A;  4NQL B;  2DBY A;  2N7J A;  4BAX A;  4YXD B;  2O2V B;  4MJS B;  1R4M I;  4OZB A;  2R2Q A;  4GOC A;  4JGH B;  3DBR B;  4ZYN A;  2GBM A;  2LI5 A;  3AN1 A;  1ZXI A;  3JYU A;  1TS3 A;  3NRZ A;  4II2 B;  4M0W A;  3QX1 A;  2BYT A;  5BO4 B;  2R61 A;  2KTR A;  1LFD A;  1F52 A;  2WXP A;  1HE8 A;  3JSV B;  3ETR A;  4M0W B;  3PPA A;  2PLP A;  4HRS A;  1OQR A;  1N6Z A;  3NG0 A;  1ISN A;  4HKQ A;  3I63 C;  4JWS C;  4JPS A;  2G4S A;  3V3X A;  3B9J A;  1GB1 A;  3NVW A;  1SE2 A;  2PJH A;  3B1L X;  4WIP A;  1WGH A;  4ZRJ A;  1QKZ A;  4JLC A;  1GNU A;  2L83 A;  3LDZ E;  2K3U A;  5AZF A;  2BS4 B;  2ZW0 A;  2WXR A; 
#chains in the Genus database with same CATH homology
 2ZCB A;  4NNJ B;  4WWO A;  5AZH A;  2KKC A;  4M8M A;  4DXA B;  4GDL A;  4GSW A;  2N7D A;  4FJZ A;  4K7U A;  2C60 A;  5CHW A;  1P9D U;  3HM6 X;  4NJ7 A;  1KM7 A;  1WMH B;  4B9K A;  1V2Y A;  3ZKJ C;  1TBE A;  4KIK A;  2AL3 A;  2NVU I;  5AEK B;  2BKF A;  4AUQ C;  1IP9 A;  3SD5 A;  3UIO B;  4TV3 A;  2EKE C;  2K6D B;  3ZTC A;  1P0R A;  2C9W B;  2L76 A;  3AUL A;  4A3P A;  1RLF A;  5C1Z A;  1WYW B;  2O6V A;  2KN5 A;  1V80 A;  3DBR I;  3QC8 B;  1I35 A;  4RMA A;  2D3G A;  2PEA A;  1X1M A;  3C0R B;  1Q1O A;  2N7E A;  2KMC A;  1CMX B;  2OOB B;  4KDL B;  3NZU A;  2LWP A;  1Q5W B;  3A9J A;  4W9L A;  1XQQ A;  1XD3 B;  2KJH B;  4NQK E;  2RSU A;  4W9G A;  5DPS A;  3DVN V;  3SDL C;  5J18 A;  2JPH A;  1UZX B;  4MEL A;  1V49 A;  2L05 A;  5G55 A;  3WIM A;  3VTV A;  2A5U A;  2J0J A;  2KMA A;  2BYV E;  2HD5 B;  2N9E B;  2Z0D B;  5CX3 A;  2K8B A;  3BIN A;  4KDI C;  4A20 A;  4FAD A;  2KWV B;  2LXA A;  3PVL A;  4KVG B;  4PS8 A;  4HDQ A;  1VD2 A;  2KQ7 A;  1E8W A;  2KD0 A;  2JZ3 B;  4E71 A;  4ZDV A;  4DWF A;  4G50 A;  3GOE A;  3APF A;  4W9E A;  2DHZ A;  4IM2 A;  1V81 A;  1GJZ A;  3DCG A;  1KJT A;  1PQS A;  1WE6 A;  2GBK A;  4RM8 A;  3A9K A;  2IO0 B;  2C5L C;  2L00 B;  2BKR B;  2N9P C;  4IC7 B;  3RCZ A;  4IM0 A;  4F7Z A;  5CHV C;  2AEH A;  4ICU A;  4MSM B;  1WXS A;  1ZW7 A;  2KC1 A;  5TR5 A;  3ZLZ A;  3ZDM C;  3S2A A;  1Z5S B;  3HIZ A;  1UD7 A;  2VRR B;  2BYF A;  3NZS A;  2L7R A;  4HJK A;  3PSE B;  4GDK A;  1V5O A;  2B3A A;  5DPR A;  3WAN A;  4RM9 A;  3ZNI D;  4BKG A;  2NBU A;  5L83 A;  4ANX A;  2M0X A;  3T9L A;  2WX1 A;  3AU4 A;  2IO1 B;  4GDL B;  1EF5 A;  4E74 A;  2OJR A;  2MW5 A;  2LXC A;  2N1V A;  3H6N A;  3N30 A;  3VQI A;  3X23 A;  3ZRF A;  2RGF A;  4B6W A;  5JH5 C;  4GB9 A;  4KIK B;  4WJP A;  4MDK E;  3D32 A;  3I3T B;  2Z59 B;  4JIO U;  2DZM A;  2FCQ A;  3RZF A;  2KVR A;  3UIP B;  4DHZ E;  4M8N A;  4A3O A;  2JWZ A;  1XT9 B;  3RZW C;  3VUY A;  4LCD E;  2G45 B;  3QIJ A;  2NBW B;  1S3S G;  2EMS A;  3V62 A;  3WA0 A;  3MJW A;  4AP4 C;  4ANW A;  2Y5B B;  2MBH A;  4HPM B;  5D7G A;  1WM2 A;  3ZVV A;  2KWC A;  2LRW A;  3DBH I;  4FJV B;  4IW0 A;  4WQO B;  2V1Y A;  2ZVO A;  1ZKH A;  4FUL A;  3RYT A;  4HK2 A;  1LM8 B;  4E3C A;  1AAR A;  1J8C A;  3APD A;  1JRU A;  2RD0 A;  3B08 A;  1YQB A;  2DAF A;  1WXA A;  2ZVN A;  4GN1 A;  3QHT A;  1WE7 A;  3PHX B;  1A5R A;  1LQB A;  2C7H A;  2FIF A;  1EUV B;  3EC8 A;  3IFW B;  2XK5 B;  4I6L B;  3U7D A;  5GMV A;  2C7N B;  3UGB B;  3PHW B;  2MBO A;  3V6C B;  2JT4 B;  2KJR A;  1E8Z A;  3VTW A;  2FCN A;  4KZ0 A;  1UGM A;  3U30 A;  4BOS C;  3HHM A;  4EOY A;  2C7M B;  2ZCC A;  5DPW A;  1UBI A;  2CHZ A;  4WJN A;  4CYE A;  3RD2 A;  3UF8 A;  1IPG A;  3SHQ A;  4TQ0 A;  3VDZ A;  4II3 B;  3M3J A;  3P2B A;  1EO6 A;  5JHB A;  3A1Q A;  4AJY B;  4X57 B;  3VHT C;  1WH3 A;  3ALB A;  1BT0 A;  1UH6 A;  2IO2 B;  4IWP A;  2GOW A;  3Q3F A;  2REX A;  3ZIM A;  3PRZ A;  3A4R A;  3VAW A;  2HE7 A;  3CSF A;  3UQB A;  2KZR A;  4DBG A;  2FAZ A;  2HTH A;  3R7Q A;  2NPT B;  2KLC A;  3ZRC A;  2D11 A;  4GDK B;  2JRI B;  2LZ6 A;  2R2O A;  3ZNZ B;  3IBE A;  1E5W A;  1VCB A;  2WYQ A;  3EEC A;  5D6J B;  4EZL A;  2LGD A;  3PS6 A;  4DHZ B;  1E7U A;  3CST A;  3PRP B;  3EFU A;  3ENE A;  4BKS A;  2V4L A;  4GGQ A;  2HJ8 A;  3DVN U;  2MP2 B;  3QK0 A;  2NS5 A;  2O2V A;  1V86 A;  4GU2 A;  2KDI A;  4F8C B;  4CHK A;  3A4S C;  3ECI A;  2AL6 A;  3ZDT A;  1WX8 A;  5EDS A;  5IAA C;  2GBN A;  4IWQ A;  4HLE A;  4HPL B;  1MG8 A;  2LD9 A;  1YJ1 A;  3PLV A;  3WAP A;  1U4A A;  4TUU A;  1YIW A;  2L8J A;  1NI2 A;  4FN2 A;  3DPD A;  3KYC D;  4PS7 A;  3RUI B;  4W9I A;  3X0W A;  3K9P B;  1LXD A;  4MM3 A;  3PRM B;  5E6N A;  3L17 A;  4JQW C;  3PTF C;  1WX7 A;  3R66 C;  2KX0 A;  3APC A;  3W1Y A;  1WR1 A;  3W1S C;  1WIA A;  2KAN A;  2XBB C;  3TBL D;  4K7S A;  3UQA A;  4OVU A;  3R3M A;  3VFK A;  5LXI B;  4IG7 B;  3OJ4 B;  4IUM B;  2AWT A;  3T8M A;  4FA6 A;  2M1M A;  5D2M B;  3IVF A;  2PE9 A;  2KLG A;  4MGK E;  4DHJ B;  1E8X A;  2LVP A;  3PT2 B;  2MCN B;  2JZZ A;  4PYZ A;  1C1Y B;  2BF8 B;  2WWZ A;  3TMP B;  4MGY E;  1SE9 A;  4KSK C;  3DBS A;  4WJO A;  2K25 A;  3QWZ B;  3WAM A;  4P7I A;  2DX5 B;  2LVO A;  2N4F A;  1H4R A;  1RFA A;  1L7Y A;  2ASQ A;  1J19 A;  2BYE A;  3NOB A;  4W9K A;  1WJ4 A;  2D07 B;  3QQ8 B;  2JRH A;  3RT3 B;  2A4Z A;  3DOW A;  3TJP A;  3VH4 B;  2KJ6 A;  4WAA A;  3TIX A;  1R4N I;  2D10 A;  4AWJ A;  2N1W A;  3JVZ X;  2G4D B;  1L2N A;  2M17 A;  5E6O A;  3MHS D;  2ZNV C;  3QAQ A;  4PYU A;  3B0A A;  3DDC B;  3N3K B;  2DZI A;  4ANU A;  2KFK B;  2KK8 A;  4KZC A;  3MTN B;  2M8S A;  1RAX A;  2ZZP B;  2V3S A;  1WX9 A;  3IHP C;  2ZPN A;  2GMI C;  2YVC A;  3NHE B;  3DVG X;  2FUH B;  4ICV A;  4B95 A;  2KFJ A;  2DZJ A;  1WFY A;  2KDF B;  2YLM A;  4MGZ E;  4W9H A;  4TKN A;  2IY1 B;  1WXV A;  1GC7 A;  2O6V B;  4DK5 A;  3HK0 A;  2JUO A;  2DZK A;  2N9X A;  4K7W A;  2LAS A;  4DDG D;  2PPH A;  2IY0 B;  2FCM A;  1WJU A;  2CHW A;  4AOF A;  3QA8 A;  3VTU A;  2UYZ B;  1RRB A;  2LGY A;  4HXD A;  2KXJ A;  3R7R A;  1UEL A;  3GZN I;  4W9J A;  5CTR C;  4EZK A;  1P98 A;  4FHJ A;  4GMV A;  3AXC A;  3EHV A;  3ZNH B;  4IWO A;  2BGF A;  1WXM A;  3NS8 A;  2KDE B;  2CS4 A;  3H9D A;  4I6N B;  2KC2 A;  2BWF A;  2DYO A;  5KHO A;  3CF6 E;  2RR9 A;  2NBV B;  3KUZ A;  4XZ4 A;  3VUW A;  2IO3 B;  4FHK A;  4KSL C;  4BBN C;  4NAW B;  1V9J A;  1FXT B;  3LJ3 A;  1K8R B;  4I6P A;  4BVU C;  1WGY A;  4NPN A;  3CMM B;  5HKH A;  1S1Q B;  2XEW A;  4JL9 A;  4FLH A;  4K1R B;  3M63 B;  2KHW B;  1OGW A;  4LJP B;  4NAW A;  1E8Y A;  4ASW C;  1KLV A;  3ZTD A;  4BKS D;  4WWP A;  2KDB A;  2JVC A;  2KOX A;  4YL8 A;  3ZNG C;  3ZO5 B;  1TZ1 A;  4HDO A;  5LXH A;  2LJ5 A;  4LDT B;  1GC6 A;  1WGR A;  4XX5 A;  2NR2 A;  1EF1 A;  1P1A A;  3TCA A;  1WGG A;  2K6Q A;  1SGH A;  2IYD B;  2UWQ A;  3H1U A;  1UBQ A;  2J0M A;  2LGX A;  2MBQ A;  1WF9 A;  2KQS A;  4MH0 E;  2MX2 A;  3KH0 A;  1V6E A;  1WMH A;  3PRE A;  3PZD A;  4WWN A;  4MJS A;  4EKU A;  3L0W B;  2AYO B;  4N9F 4;  3KUC B;  3DQV A;  1F9J A;  1QZE A;  2KFK A;  2KWU B;  2LVQ A;  4MEM A;  3VUX A;  5KHQ A;  2BPS A;  3OLM D;  1WGD A;  1YX5 B;  2MLB A;  3QJZ A;  5JHA A;  4BBN F;  2DYB A;  2MBE A;  4G3X B;  3PGE A;  2K8C A;  4DDI D;  3NY5 A;  3ML8 A;  1TGZ B;  3U8Z A;  1H8C A;  2I1J A;  3PV1 A;  4HVB A;  1WRD B;  1WY8 A;  2ZEQ A;  3BY4 B;  3ONS A;  2FNJ B;  1P3Q U;  1NBF C;  3VXW A;  1YD8 U;  2KX3 A;  1OEY A;  2KTF A;  4NJ6 A;  5DPT A;  4BKT A;  4GIV A;  1G6J A;  2K8H A;  3DBL I;  5J17 A;  5AZG A;  2M4N A;  2EMT A;  2PE6 B;  4ZRK A;  2WDT B;  3PLU A;  5CHF A;  3K9O B;  1Z2M A;  4BFR A;  3TL5 A;  4LJO B;  3W1S A;  1T0Y A;  3SU8 X;  2KNB A;  1E7V A;  1Q0W B;  3L13 A;  2XK5 A;  2I1K A;  1WJ6 A;  1WI0 A;  3A33 B;  3A1Q B;  2JF5 A;  1D3Z A;  2O6V D;  3KUD B;  2K39 A;  2MWS B;  1OTR B;  2BWE S;  4J6I A;  4W9C A;  3OJ3 A;  3V6E B;  3VH3 B;  2ZPY A;  3H7P B;  1YX6 B;  2K1F A;  2CU1 A;  3H7S A;  4OVV A;  1NDD A;  4W9F A;  1KOT A;  2DEN B;  3IG3 A;  4XC2 A;  4EUT A;  3L08 A;  3AU5 A;  3H7P A;  3KYD D;  2KO3 A;  2MBB B;  4HWI B;  1ZGU B;  4HCP B;  1C3T A;  4EFO A;  4FBJ B;  2L3Z A;  1Y8R C;  4CO7 A;  3JW0 X;  2CHX A;  3Q3J A;  3ZUN A;  3HM3 A;  2QHO A;  3M62 B;  4MGI E;  5D94 A;  4F1S A;  4GXB A;  4MSQ B;  2NPT A;  4ANV A;  2L0T A;  3QCA A;  3L54 A;  2WX0 A;  2MA9 B;  4NQL B;  2CR5 A;  4EEW A;  2D2Q A;  2O2V B;  5C23 A;  3KVF B;  1R4M I;  1GUA B;  1WZ3 A;  2JY6 A;  4MJS B;  2R2Q A;  4GOC A;  4LDT D;  1WR6 E;  1TTN A;  4JGH B;  4NY0 A;  1GG3 A;  3DVG Y;  4IM3 A;  3V60 A;  2GBR A;  2W9N A;  2IZV B;  4ZYN A;  1WZ0 A;  5LLI A;  3A9J B;  4K81 A;  2GBM A;  4PS3 A;  4WJQ A;  2LI5 A;  4DHJ D;  1M94 A;  2LRU A;  2DAJ A;  2ZJD A;  2G3Q B;  5L95 C;  2MP2 A;  3JYU A;  4II2 B;  3JSV A;  3N32 A;  2CKH B;  1J0G A;  3QX1 A;  2FCS A;  3ML9 A;  2J7Q B;  4TQ1 A;  4ZRI A;  3RUL A;  2MRP A;  5BO4 B;  3VVW B;  1SIF A;  5JZE B;  2KTR A;  1LFD A;  2J0K A;  1HE8 A;  3JSV B;  4HCN B;  4M0W B;  2RPQ A;  2LUE A;  5J2R A;  3PPA A;  3KW5 B;  4G0N B;  2IBI B;  2KTR B;  2MQJ A;  3AI5 A;  2DYM A;  4AJW A;  1WJN A;  1WM3 A;  1ISN A;  2NCN A;  3A9K B;  3WAO A;  3L10 B;  3L16 A;  2Z0E B;  4BOZ B;  2G4S A;  4G11 A;  4KV2 A;  1I42 A;  1E90 A;  1V5T A;  3O65 B;  5IA7 A;  1OQY A;  3OAW A;  4URK A;  2MSE D;  2JXX A;  2ZNV B;  2PJH A;  3M95 A;  5E6P A;  3V61 A;  3WAL A;  3B1L X;  4W9D A;  1WGH A;  2FID A;  4ZRJ A;  2GBJ A;  3ZW3 A;  1OEY J;  1IYF A;  4JLC A;  1GNU A;  3LDZ E;  4EZJ A;  2L0F A;  5DCN A;  5G2N A;  3UIN B;  3QAR A;  5AZF A;  4FJY A;  5FR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...