5LXHA

Gabarap-l1 atg4b lir complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 35
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lxhA00
4F1SA 3I3TB 2DAJA 4MH0E 2IBIB 4TQ1A 2G4SA 1Z2MA 4E3CA 3ECIA 3DVNV 3Q3JA 3TBLD 4B6WA 1GJZA 2V1YA 3APDA 3ZKJC 4GU2A 5E6NA 4LDTD 1Q1OA 3A4SC 3PLUA 2MP2B 4IWOA 1AARA 1CMXB 5E6PA 4F8CB 1J0GA 1P1AA 2D11A 1XT9B 2FIDA 3A1QB 2D10A 3A9JA 5IA7A 4PS3A 4HVBA 3KYCD 2M8SA 5D2MB 1WMHB 2LXAA 4BOSC 3OLMD 3X0WA 3MHSD 3DQVA 3VDZA 2KKCA 4EZLA 5G2NA 1X1MA 2OOBB 3PTFC 1LQBA 3N30A 4KSLC 5D7GA 1V81A 2D3GA 3JSVA 3VQIA 4FJYA 1WRDB 4WJQA 3VAWA 4HPMB 4W9HA 1WM3A 4TV3A 5TR5A 1QZEA 1YX6B 1T0YA 3DPDA 4M8MA 2KJHB 3AULA 3X23A 4WJNA 1KJTA 4K7SA 4AP4C 4DDGD 2Z59B 2DENB 2K6DB 4K81A 3UF8A 3PSEB 2FCMA 4DHJD 1E8ZA 3TMPB 2L0TA 2A4ZA 2FIFA 1J19A 2LRUA 5DPWA 2KLGA 2KHWB 3ZTCA 3MTNB 1OEYA 3AU4A 2CHZA 4W9JA 3UGBB 1WH3A 3B08A 2BWFA 3B0AA 3IBEA 4DWFA 1UBQA 2KJRA 4GB9A 1A5RA 3M3JA 3QK0A 1MG8A 2DZKA 2MLBA 2ZJDA 3QX1A 3ZRCA 2KXJA 4ICUA 2IO2B 3BY4B 4P7IA 1RFAA 1WE6A 4IM3A 4F7ZA 4URKA 1WGGA 2HTHA 3VTUA 5J2RA 5G55A 2KFJA 4HLEA 1UH6A 3NHEB 1E7UA 1WFYA 4G3XB 2HJ8A 4KZCA 2LASA 5KHOA 4EUTA 3B1LX 2KZRA 2CU1A 1JRUA 3QCAA 4EFOA 2NBUA 2XK5A 2ZVOA 4KVGB 2QHOA 3TJPA 3M62B 4GDLA 2MRPA 2ZZPB 4M0WB 2KFKA 2BKFA 3DVGY 3VTWA 2IYDB 3ML9A 3MJWA 3OAWA 4EZKA 5D6JB 1ZW7A 2DAFA 3R7QA 1NBFC 2MBBB 1SE9A 2L7RA 3H9DA 2IZVB 4FULA 5L95C 2K6QA 4JLCA 3W1SA 1P9DU 2ZVNA 4GOCA 2L3ZA 3NZSA 5CHFA 1LM8B 1WYWB 3S2AA 2NPTA 3OJ4B 2KVRA 2NS5A 3R66C 3QQ8B 4GDKA 4HDQA 1RLFA 3ZNID 4ZRIA 2MBEA 1S1QB 4JL9A 5JZEB 2BPSA 1M94A 4M8NA 3SDLC 5CTRC 2FAZA 2JVCA 3H6NA 3ZNZB 4MJSB 2BF8B 4XZ4A 1EF1A 3DCGA 4NJ7A 4KZ0A 1WIAA 2R2OA 5JHAA 1U4AA 4E71A 1KOTA 3VVWB 3ZLZA 2BGFA 3UINB 1OTRB 3VXWA 2C7HA 4BKSA 3OJ3A 3HM6X 3PRMB 4OVUA 2EMTA 4KDLB 1IYFA 2MBHA 2KDEB 3K9PB 3PT2B 4ANWA 2LGDA 3NOBA 2LXCA 3AI5A 2AL6A 4W9GA 2MBQA 4KV2A 2V3SA 3JYUA 2KNBA 4FBJB 2MWSB 3CMMB 4HCNB 2BKRB 3VH4B 5JH5C 4NAWA 4W9LA 5DPRA 3SD5A 2G4DB 2DHZA 3IG3A 1ZGUB 3AU5A 4B9KA 2CR5A 1UGMA 2JT4B 2LVOA 2CHXA 3RD2A 4W9KA 4NNJB 3PHWB 2JRIB 4GN1A 3PVLA 3WAMA 3HIZA 4XX5A 2CKHB 2LI5A 2KQSA 2UWQA 2EKEC 2JWZA 2LWPA 1WX7A 3ZTDA 1SIFA 4MSQB 3PREA 4CYEA 2N1WA 4HJKA 2RSUA 2GOWA 3L16A 5J18A 4ANXA 4MELA 2DZIA 4ZDVA 2N9PC 5JHBA 4TQ0A 4OVVA 2G3QB 3ALBA 3RUIB 1WY8A 2HE7A 4NQKE 1WJ6A 1YQBA 2MP2A 2W9NA 2MSED 3ENEA 2C5LC 4YL8A 2ZNVB 2BWES 1E8WA 2LZ6A 3WANA 1YX5B 3Q3FA 4LJOB 1WMHA 2DYBA 2M17A 3JSVB 3K9OB 4GIVA 1TZ1A 3V61A 3ZW3A 2MX2A 3WAOA 2GBRA 2I1KA 1WXAA 2FCSA 2IY1B 2ZPYA 1WGRA 3N3KB 3PHXB 1YJ1A 3PPAA 4ZRJA 1TTNA 2YVCA 2WWZA 1Z5SB 2D2QA 1YIWA 4IUMB 2FCNA 1E8YA 3A33B 5AZGA 4BBNF 2N9XA 2KDIA 4K1RB 2KWCA 1L7YA 3ML8A 2JF5A 3T9LA 1TGZB 1BT0A 2MBOA 4HWIB 2AEHA 2CHWA 4IM0A 3R3MA 2MQJA 2K8BA 2JY6A 2WDTB 1V9JA 2ZCCA 2KANA 3PS6A 4W9EA 4ASWC 4DDID 4EZJA 3P2BA 5C23A 3QA8A 3RYTA 2KQ7A 2K25A 4WAAA 1NI2A 2JPHA 3QARA 4DBGA 1WJUA 1WF9A 2O6VB 1WGDA 2IY0B 1WXVA 3R7RA 2GBJA 2KMCA 4DHZB 5D94A 1G6JA 1GG3A 1WJ4A 2WYQA 1UELA 4MSMB 1H8CA 4DHZE 1F9JA 1OQYA 3HHMA 2DZJA 2FCQA 1S3SG 4K7UA 4KSKC 5CHWA 4BKTA 3GZNI 3GOEA 4I6LB 3L08A 4MGIE 2KJ6A 4K7WA 4BVUC 2RGFA 3A9KB 2ZNVC 2GMIC 4LCDE 4PYUA 3V62A 2AWTA 4CHKA 3PLVA 2N1VA 2FUHB 1PQSA 2NVUI 2ZEQA 1H4RA 3H1UA 1Y8RC 4G0NB 2GBKA 2MCNB 3L0WB 3RT3B 3RCZA 1VCBA 2OJRA 3V60A 3DVNU 1V5TA 2KK8A 2WX1A 3EFUA 3DVGX 2IO0B 4NY0A 2NBWB 3WA0A 2HD5B 2N7DA 3RZWC 2L76A 4MDKE 1YD8U 3WIMA 2KDBA 3UQBA 3M63B 4I6NB 4MGZE 1J8CA 4G50A 3RULA 1KM7A 4AJYB 1WR6E 3HK0A 3O65B 5DPTA 4AOFA 3EECA 2KTRB 2N4FA 3QC8B 3U30A 3VH3B 3JW0X 2C9WB 3KUCB 2L8JA 3L10B 1E90A 2O6VD 3ZNGC 1WGHA 2RPQA 3CSTA 2J0KA 2PPHA 4MJSA 3VTVA 3ZDMC 3D32A 4HCPB 3A4RA 4KDIC 1UBIA 1NDDA 3DBRI 4WJPA 3H7PB 2C7NB 1R4MI 4FN2A 4HK2A 1E7VA 4FHKA 2DYOA 1WR1A 3AXCA 4BKGA 2MA9B 4HXDA 4WQOB 1GC7A 1UD7A 2K8CA 3CF6E 4FJVB 5AEKB 2WX0A 5EDSA 4W9CA 4KIKB 3L17A 2C7MB 2PEAA 4HPLB 3QJZA 1LXDA 3VHTC 4EKUA 3PRZA 3KUDB 3KUZA 1WZ0A 3HM3A 4NJ6A 1P3QU 3SU8X 3PZDA 4MGYE 3APCA 2AL3A 2O2VA 3W1SC 4EOYA 2B3AA 1C1YB 2ZPNA 1GUAB 3V6EB 3ZUNA 1RAXA 5CHVC 4BFRA 2NCNA 4WWOA 4A20A 2Y5BB 3DOWA 4IWQA 4W9DA 2EMSA 4BOZB 4JIOU 1V86A 4ZYNA 1D3ZA 4RMAA 2IO3B 4HDOA 2REXA 4GMVA 3A9JB 4MM3A 2UYZB 1I42A 3QAQA 3A1QA 1VD2A 3JVZX 3ZVVA 4E74A 3ZNHB 2RR9A 4PYZA 1Q5WB 2NR2A 1WJNA 3VUXA 4BKSD 5C1ZA 2KWUB 1EF5A 4NQLB 3U7DA 3WALA 4G11A 4DXAB 1IPGA 2KMAA 2MW5A 1P98A 4JQWC 1SGHA 5IAAC 4TUUA 4AWJA 1V6EA 2LJ5A 1WE7A 2I1JA 3NZUA 4ICVA 1XQQA 4GGQA 2IO1B 3IHPC 3PGEA 2R2QA 1RRBA 3UQAA 3LDZE 3DDCB 1WX8A 2LGXA 1EUVB 3ZO5B 4N9F4 2J7QB 1ISNA 1L2NA 3ONSA 4II3B 4ZRKA 3APFA 3QWZB 3NY5A 5DPSA 2K8HA 4A3PA 4IWPA 2BYEA 1XD3B 1IP9A 3VFKA 2JXXA 4WWNA 1OGWA 2L00B 2G45B 2BYFA 4WWPA 1C3TA 3VUWA 3KW5B 2N9EB 4X57B 2M1MA 3UIOB 3DBSA 2CS4A 3KVFB 2DYMA 5L83A 2DZMA 5E6OA 1UZXB 4IC7B 1P0RA 3RZFA 4A3OA 1FXTB 1HE8A 4IW0A 2LRWA 2K39A 1OEYJ 2O6VA 2DX5B 4IG7B 2JRHA 1K8RB 3TIXA 2XK5B 4B95A 2JUOA 5AZFA 4GXBA 1WXSA 3EC8A 2RD0A 2AYOB 3EHVA 3M95A 2KFKB 3IFWB 4FLHA 4GDLB 4NPNA 3V6CB 3ZDTA 4I6PA 2ZCBA 4II2B 5FR6A 2J0JA 2Z0EB 2XEWA 1V49A 2FNJB 2KN5A 4FA6A 2PE9A 2C60A 1I35A 4W9IA 2KDFB 1TBEA 3A9KA 5DCNA 4FJZA 2LGYA 3CSFA 4FADA 4PS8A 4PS7A 5J17A 4LJPB 4XC2A 2JZZA 2ASQA 1WXMA 3VUYA 2NPTB 4AJWA 1Q0WB 3TL5A 3LJ3A 4GDKB 2L0FA 3ZIMA 4ANVA 1GNUA 2LUEA 5HKHA 2PE6B 3KH0A 4J6IA 4ANUA 4IM2A 4RM8A 1ZKHA 3SHQA 1E5WA 1E8XA 2KD0A 2NBVB 2YLMA 4W9FA 2BYVE 5GMVA 1WI0A 2LVQA 2KWVB 4BBNC 2D07B 4LDTB 2KTRA 1WM2A 1R4NI 1WZ3A 2LVPA 4DK5A 3N32A 3IVFA 1KLVA 2K1FA 2KTFA 3PRPB 4WJOA 3TCAA 2KOXA 1V80A 3NS8A 5LXHA 3UIPB 2L05A 2KLCA 2LD9A 2Z0DB 1V2YA 2VRRB 3WAPA 1LFDA 2N7EA 2V4LA 1WGYA 3DBLI 3H7PA 3QIJA 2KX0A 4JGHB 3C0RB 4FHJA 2PJHA 2KC2A 2KC1A 4CO7A 4NAWB 4AUQC 3U8ZA 5BO4B 3KYDD 2M4NA 3W1YA 3BINA 3PV1A 4MGKE 4RM9A 2KX3A 2A5UA 2KO3A 3T8MA 3L54A 2GBMA 4TKNA 5LLIA 3DBHI 1WX9A 4EEWA 1V5OA 2XBBC 3QHTA 4GSWA 4KIKA 3H7SA 5AZHA 4DHJB 2J0MA 4MEMA 2JZ3B 1GC6A 3ZRFA 5LXIB 1EO6A 2GBNA 5CX3A 3L13A 2O2VB 5KHQA 2M0XA
chains in the Genus database with same CATH superfamily
3I3TB 4FXCA 4E3CA 2PIAA 3APDA 1K50A 1RM6C 4GU2A 3AE8B 3A4SC 1C4AA 3B2GA 1NI3A 1ACCA 5I4DA 4F8CB 2BQQA 2D11A 1XT9B 1TT5B 2D10A 5G5HA 1WMHB 3OLMD 1FO4A 1CK1A 3DQVA 3VDZA 2JXTA 2RDBC 2OOBB 4S0RA 4KSLC 2D3CA 1V81A 5EE3A 4FJYA 4WJQA 1RFKA 3Q8CA 1FFVA 2IPKD 2INPE 4K81A 2K6DB 2FCMA 4XWWA 4XE0A 2L0TA 2A4ZA 2FIFA 1WRIA 2LRUA 2ICIA 3ZTCA 1HTOA 3B08A 4H2AA 3IBEA 3VR8B 2V3PA 3QK0A 1MG8A 3KQ4A 1NEKB 3QX1A 2KXJA 4ICUA 3AEDB 1TYGB 4RGMA 2GI9A 3AEAB 2YEPF 2X38A 3FILA 4HLEA 1WFYA 2L52A 4G3XB 1HTQA 4TSSA 2NBUA 2ZVOA 4KVGB 2B76B 1OQRA 4M0WB 3DVGY 2IYDB 3ML9A 4ZHPA 1T6BX 3LB8C 2DAFA 2K6QA 4B0MA 1LM8B 2V3NA 1WYWB 3S2AA 2NPTA 3PZ7A 3AE5B 4HDQA 3ZNID 4ZRIA 1S1QB 1C9FA 4M8NA 1XLNA 4A55A 3R2IA 4N6EB 4KZ0A 1WIAA 2R2OA 3NZ3A 5JHAA 3HUIA 1XF5L 3P4SB 1I7HA 2BGFA 2PW9A 4BKSA 4OVUA 2EMTA 1IYFA 3W2DA 3AI5A 2AL6A 1FRRA 3TEZA 1UF0A 2KNBA 4FBJB 4HCNB 4JPSA 5JH5C 3SD5A 3IG3A 3AU5A 4B9KA 2Z8LA 2PVGC 2CHXA 3OG5A 4W9KA 4NNJB 3PVLA 3HIZA 1FFUA 2CKHB 1L4DB 3PREA 4CYEA 2ZW0A 2HDEA 2GOWA 1TJEA 3L16A 2AQ2B 4IDIA 2X8XX 2K5PA 3GZNB 3NG0A 3W5VB 1T5XD 4HRSA 3RUIB 2E6XA 3RFZB 4NQKE 1WJ6A 2W9NA 4USAA 2ZNVB 2BWES 1L5PA 1QF6A 1SXTA 4LJOB 3RNCC 1WMHA 3K9OB 4YXDB 4XWTA 3WAOA 3Q2AC 2I1KA 1WXAA 4ITKA 2IY1B 1MG4A 4HPPA 2WWZA 1Z5SB 2LHDA 1XEEA 1L0VB 5AZGA 4GLSC 2KDIA 4US9A 2WXNA 3ML8A 4Q2JA 1SSNA 1F0ZA 5BMHA 4HWIB 1VZ6A 4IM0A 2D5GA 2MQJA 4WQMA 1ESFA 5HG2A 2IGHA 1PDXA 2WDTB 1V9JA 3PS6A 4DDID 1HXYD 3QA8A 3RYTA 2RDHA 4AS1A 1NI2A 1JMLA 3QARA 4C7YA 1F2RI 2IY0B 1WXVA 2KMCA 1A70A 4K7UA 4MGIE 2PLPA 1TS3A 4BVUC 2N9KA 2K0PA 4LCDE 2ZNVC 4CHKA 2FUHB 1PQSA 2NVUI 4REZA 1H4RA 3H1UA 5G5GA 5BYSA 3BVZA 1L6VA 2GBKA 3L0WB 1PUTA 1TS4A 2OJRA 1C79A 3DVNU 4M0WA 1B9RA 5JXVA 2NTSA 3DVGX 3EFUA 1HA5A 1WYGA 5EE1A 2HD5B 1HEZE 1VDVA 3M63B 4G50A 3P4RB 2KDMA 3HK0A 4RCOA 3O65B 5IKCM 3EECA 1SJED 2KTRB 3GE8C 3U30A 3AEGB 2L8JA 1E90A 2O6VD 3ZDMC 2PPHA 2G1EA 4OVZA 3DBRI 3H7PB 1DOIA 4FHKA 2DYOA 2MA9B 1UD7A 3CF6E 1N5WA 2WU2B 1JWAD 4W9CA 1TY0A 3L17A 2C7MB 1T0SC 3KUDB 2ONQA 4NJ6A 4L2YA 1P3QU 2AL3A 5EE9A 1QOFA 1VLBA 1GUAB 3AEEB 1B1ZA 1GPXA 2BTEA 4A20A 3AE3B 4W9DA 2EMSA 5C2TB 1YNTE 2GRIA 3A9JB 1I42A 4C00A 3BYTB 2QDFA 1VD2A 2RR9A 1VJKA 1EM7A 2NR2A 1I4XA 1WJNA 3AB5A 3IT6B 5C1ZA 3B9JA 3NVYA 5IO9A 3WALA 4NAMA 4DXAB 1IPGA 4JWSC 1P98A 4AWJA 4ICVA 4GGQA 2WU5B 2LJIA 3LDZE 2QJLA 3BVMA 2LGXA 1EUVB 1PGXA 4N9F4 4II3B 4ZRKA 3APFA 4YTPB 4IWPA 3B2FA 4CQNA 1F2RC 1V1PB 3VFKA 1NENB 1OGWA 1C3TA 2CS4A 2RMMA 2WQYB 5IN7A 2PVOD 2V9HA 4TMAB 4D2KA 1MJDA 5E6OA 1UZXB 2LRWA 4GXBA 1R7SA 4NPNA 3MC8A 1FXAA 4I6PA 1IBXB 2W55A 3RNAC 2MJ3A 2KN5A 2KDFB 2LGYA 4HEA1 4PS8A 4PS7A 2JZZA 2ASQA 4BAXA 1Q0WB 1QT9A 2BS3B 3ZIMA 2LGSA 1OFFA 1XLQA 5GXGB 3SHQA 3L4PA 1E5WA 3W9CB 2YLMA 5GMVA 3KWVA 1UWXA 3I63C 1WI0A 4BBNC 2GLSA 1YJIA 2KTRA 2M19A 2Y5CA 3N32A 1JQ4A 1YN4A 2K1FA 2KQ4X 1M4VA 2VRRB 1YOVB 3DBLI 3H7PA 3IT4B 4NAWB 3U8ZA 5BO4B 3T8MA 4TKNA 1V5OA 1D5ZC 5AZHA 2J0MA 5BMGA 2JZ3B 1TS5A 4RF1A 5CX3A 3R8BA 2O2VB 1ROEA 5KHQA 3RI7C 1IUEA 4F1SA 1FNWA 3I9V1 2G4SA 3ECIA 3DVNV 3Q3JA 3ZJTA 1MHXA 3TBLD 4B6WA 5E6NA 4LDTD 1VZ8A 5D3DA 1AARA 1UWMA 4OHJA 2FIDA 3A9JA 5IA7A 2W54A 3V3XA 5D2MB 1QOAA 5G2NA 1X1MA 2BB6A 3RMKC 1LQBA 1AWDA 3VQIA 1JCKB 1WRDB 3C8YA 4WAFA 1KJTA 4AP4C 4DDGD 2DENB 3PSEB 1WGKA 4DHJD 3UI3A 3TMPB 4C56C 2WXIA 2BWFA 1UBQA 1V1PA 3DBLB 4OW0A 4P7IA 4IM3A 3VTUA 4XGAB 2CJOA 1UH6A 1E7UA 1FMAD 2WXKA 1KH0A 2LASA 3B1LX 4HROA 1JWSD 2MRPA 1I4QA 1AN8A 3VTWA 2INCC 1IBXA 3OAWA 3R7QA 2MBBB 2L1AA 3W1SA 5CHFA 2NS5A 1RLFA 5JZEB 3AMZA 3SDLC 2L32A 3TEWA 3GS2A 2BF8B 2DLBA 2H89B 3DCGA 4DQOC 4RF0A 3BWUD 1U4AA 2QCZA 1E7PB 3UINB 1OTRB 2C7HA 4XDDA 3P63A 2LXCA 4C7ZA 4W9GA 3C19A 3T3OA 2MBQA 4KV2A 2V3SA 3JYUA 2INNE 1IGCA 3CMMB 2JU6X 4NAWA 1YQ4B 1ZDXA 2DHZA 2JT4B 2LVOA 3ABVB 2JRIB 3WAMA 2N0SB 2KQSA 1GAQB 3ZTDA 1SIFA 2RSUA 3O13A 4MM3B 5J18A 4MELA 1EU4A 3HRDD 1J7AA 4JWUC 2MEKA 4TQ0A 3ALBA 4K3BA 1FM0D 2HE7A 3N9YC 3TEYA 4YL8A 3NS1A 1E8WA 2LZ6A 1YX5B 4KKIA 4WWMA 2DYBA 3JSVB 4N58A 1SF0A 1TZ1A 3EUB2 3N3KB 4ZRJA 1YN5A 1KLUD 1PYWD 1SB3C 1YIWA 2FCNA 1E8YA 3A33B 2N9XA 3AH7A 1L7YA 2JF5A 2BW2A 2CHWA 3R3MA 1VRAB 2KANA 2WXFA 3MHZA 4EZJA 1FPYA 2KQ7A 2I38A 3IAS1 1R4MB 5H8YE 4DBGA 1WF9A 1WGDA 1C76A 2GBJA 3R2TA 1GG3A 1WJ4A 4MSMB 4DHZE 3P4QB 2Y3AA 2DZJA 4BKTA 1S3SG 3ZXRA 3GZNI 2WXOA 2IGDA 2RGFA 2GMIC 3V62A 2AWTA 2I2YA 2WXQA 1I4PA 1Y8RC 3RT3B 3URYA 3RCZA 1VCBA 2BBCA 4YTNB 1V5TA 2KK8A 2FBWB 2Q5WD 2JYTA 2IO0B 4NY0A 1BXTA 3WA0A 2N7DA 3RZWC 1KRHA 2L76A 4MDKE 3FKYA 2KDBA 3UQBA 4MGZE 1KM7A 4AJYB 1WR6E 2PTLA 3N1XC 3U2SC 4AOFA 2LHEA 1QKZA 1C77A 2N4FA 2WS3B 2QEJC 3Q3MC 3KUCB 3L10B 4R3DA 2AQ3B 4HCPB 2KT7A 2VZKB 4YTMB 4HK2A 1E7VA 2AQ1B 2INDC 1KLGD 4FJVB 4ZRQA 5AEKB 3AE6B 2WX0A 4KIKB 2SAKA 1ZOYB 4HPLB 2WXRA 4EKUA 1DGJA 2JX5A 4L23A 1ZXIA 3Q69A 3KLSX 3HM3A 1YN3A 2KMMA 3APCA 4EOYA 2B3AA 2J53A 3V6EB 3CWIA 2Y5BB 4IWQA 2JYEA 4EE2A 4ZYNA 1D3ZA 2IO3B 4RH6A 2REXA 1WXQA 4GMVA 5EE0A 3NVWA 4MM3A 3Q8FA 4C4VB 1GOZA 3PZ8A 3AV8A 3VUXA 1C4CA 2KWUB 3U7DA 2MW5A 2WHIA 4QAYA 1WE7A 1XQQA 2QMTA 2IO1B 2WDQB 3UQAA 2K22A 1QLBB 3ZO5B 2WXJA 4YT0B 4P1CC 2FE8A 2K8HA 2BYEA 1GB1A 2N7JA 1SE3A 4WWNA 1R4NB 2PKOA 4NJCA 4RFBA 2N9EB 2LUMA 1T0QC 2W82A 3SFEB 3RZFA 1HE8A 4IW0A 1OEYJ 3Q6BA 2JRHA 1K8RB 2XK5B 2JUOA 3RNBC 4MH8A 4GDLB 2RD0A 2KFKB 3IFWB 4LNNA 4II2B 1MHHE 1TKGA 2J0JA 2Z0EB 2IDYA 2XEWA 1I35A 1Y56A 5DCNA 3CSFA 4K3CA 3VUYA 4AJWA 1QILA 1GNUA 1MVKA 4ANUA 4J6IA 1N60A 1XCTL 2BYTA 2XNAC 4W9FA 1LGRA 2FUG1 2LVPA 4DK5A 1BMLC 1TKEA 3PRPB 1V1OA 2WXPA 3AE7B 3VR9B 3TCAA 3NS8A 5LXHA 2L05A 2KLCA 3DWGC 3U52E 1P7FA 3WAPA 3QIJA 4JGHB 2KX0A 4CO7A 2K3UA 2KC1A 1FRDA 3RN9C 4AUQC 3BK2A 3KYDD 3W1YA 2A5UA 2GBMA 2XBBC 3Q8BA 4KIKA 5TSSA 1EU3A 5LXIB 3L13A 3AE1B 2M0XA 2QC8A 2IBIB 2SEBD 1GJZA 4KKJA 2V1YA 3ZKJC 3N1YC 1Q1OA 3PLUA 4IWOA 2RDGA 5E6PA 4PK1A 1P1AA 3SR6A 3A1QB 4PS3A 5C3JB 2LXAA 4BOSC 2WDRB 3X0WA 3MHSD 4EZLA 4JX1C 4C4VA 2LEKA 3N30A 2D3GA 4HPMB 1WM3A 4TV3A 1FXIA 1YX6B 1T0YA 1PGBA 2KJHB 2Z59B 4S17A 3UF8A 2WLBA 3AE4B 2OJWA 5HFYA 5BMIA 4RNAA 2KHWB 4ARIA 3AU4A 1AYFA 4YWGG 2E3TA 4DWFA 2KJRA 4GB9A 1A5RA 3M3JA 3BVGA 2DZKA 4XDCA 2ZJDA 3BY4B 4F7ZA 1WGGA 1JALA 3SEBA 1C78A 3NHEB 4A6QA 4HKQA 2HJ8A 4KZCA 5KHOA 1JRUA 1KF6B 3QCAA 4EFOA 2XK5A 3TJPA 2QHOA 1QOBA 4OZBA 3M62B 4GDLA 1K52A 2KFKA 2BKFA 3AE9B 3MJWA 4EZKA 5D6JB 1ZW7A 1NBFC 1SE9A 3H9DA 2IZVB 4FULA 5L95C 4JLCA 1P9DU 2ZVNA 4GOCA 3NZSA 3NUHB 3VRBB 4DXFA 4NZLB 3QQ8B 1D5MC 2BPSA 1SE4A 5CTRC 3H6NA 2JVCA 3ZNZB 4MJSB 2KWDA 3MJ5A 2K9XA 3MC9A 1EF1A 3U4EG 4YSZB 4E71A 3MC0B 3MFGA 2VH2A 3VVWB 3ZLZA 3OJ3A 3PRMB 2MBHA 3PT2B 3K9PB 4ANWA 2LGDA 3NOBA 2WNMA 2MWSB 2BB5A 4P1BC 3ZQ4A 1J7BA 2G4DB 1E9MA 1ZGUB 3RD2A 3PHWB 4GN1A 1HZ6A 4WIPA 4B0EA 1N63A 4XX5A 1E10A 2LI5A 2RPVA 2EKEC 2JWZA 4MSQB 2MJDA 4HJKA 4ANXA 2DZIA 4ZDVA 1J7CA 3BZDB 1ZXHA 4PT5A 2C5LC 5AUKA 3WANA 1WSPA 1P7EA 1EWCA 1VZ7A 5FKAC 4YSYB 2MX2A 2GBRA 2FCSA 1WGRA 1YJ1A 1RWSA 2D2QA 4IUMB 3NJTA 4BBNF 5D3IB 3TSSA 4K1RB 2KWCA 3T9LA 1BT0A 1JWBD 2AEHA 1OQQA 2D3AA 2OEDA 1KTKA 2K8BA 2JY6A 3P2BA 5C23A 2WGSA 4WAAA 1WJUA 4OZAA 4DHZB 1G6JA 5D94A 2M0AA 3OWEB 1WWTA 1H8CA 2CJNA 3HHMA 4KSKC 4LK0M 1ZE3D 2GB1A 3L08A 1T0RC 4I6LB 1D4BA 4K7WA 4LNKA 3A9KB 4PYUA 2N1VA 3NVVA 2YEPB 2UU7A 2ZEQA 4G0NB 2MCNB 4O1NA 1NYRA 1EWYC 4ZHOA 1N61A 4I6NB 5DPTA 1HQRD 2V0GA 3VH3B 1FIQA 3JW0X 2C9WB 4ZRPA 1YQ3B 4ZYSA 4ARCA 1WGHA 4A90A 3H8HA 2RPQA 3CSTA 2QSDA 4MJSA 2AX5A 3D32A 3A4RA 1UBIA 4WJPA 1E0ZA 2C7NB 1R4MI 3DHHC 4M01A 5AUIA 2NTTA 3AXCA 4WQOB 3EFCA 3LXFA 5E6JA 5EDSA 1FNVA 3QJZA 1LXDA 3E56A 1WZ0A 1F52A 5IP4D 3SU8X 1ET6A 3PZDA 4MGYE 2O2VA 4AQ7A 1DOYA 5T8IA 3P1MA 1C1YB 1MPEA 2ZPNA 3ZUNA 4WWOA 4M00A 3DOWA 2QILA 4RMAA 1C4PA 1JWUD 3JVZX 3ZVVA 2DWQA 3ZNHB 2VZKD 1Q5WB 4NQLB 2JWUA 3N1ZC 4JQWC 1SGHA 2BS2B 2LJ5A 2I1JA 2R2QA 1RRBA 3DDCB 2J7QB 1ISNA 1L2NA 3QWZB 3NY5A 5DPSA 4A3PA 1ENFA 1XD3B 2JXXA 3ZYYX 1VR9A 1XCQL 2L00B 4WWPA 3KW5B 4X57B 2M1MA 3DBSA 3KVFB 5IOIA 1L0YB 2JZPA 3N20C 1L6UA 4A3OA 2J42A 1FXTB 4IG7B 3CIRB 4B95A 3AE2B 3M95A 3DBHB 2ZCBA 1XLOA 3DHGC 1V49A 2FNJB 2PE9A 2C60A 4W9IA 3A9KA 4FJZA 1IGDA 4LJPB 2WXHA 3V05A 3TEXA 3J9CA 3TL5A 4GDKB 2KACA 2L0FA 2TSSA 2MH7A 2ON8A 2LUEA 2LMCA 1TS2A 4UDUC 5HKHA 2PE6B 3KH0A 3AN1A 4RM8A 3LYYA 2KD0A 2IGGA 1FEHA 1YJJA 2LVQA 3ZXVA 1R4NI 1WZ3A 1ZP0B 3IVFA 1KLVA 2OHFA 4WJOA 1V80A 3Q8EA 4LNIA 1LFDA 2N7EA 3ZGZA 3PO0A 2PJHA 2KC2A 2M4NA 3BINA 2BS4B 4MGKE 4RM9A 3L54A 5LLIA 3QHTA 1SBBB 3H7SA 1T3QA 1GC6A 2HTME 2J4XA 4XYCA 3DHIC 2DAJA 4MH0E 4TQ1A 3VRAB 1Z2MA 2WXMA 4BZAA 2MP2B 1CMXB 1TY2A 1J0GA 1F77A 4HVBA 3KYCD 2M8SA 1QOGA 2KKCA 1QQRA 3PTFC 5D7GA 3JSVA 2W3RA 1L4ZB 3VAWA 4L1BA 4W9HA 5TR5A 4M02A 1QZEA 2MHJA 3DPDA 3P42A 3AULA 4M8MA 1ZPSA 3X23A 4WJNA 4K7SA 1E8ZA 1J19A 5FK9C 5DPWA 2KLGA 3MTNB 1OEYA 3EA6A 1RYJA 2CHZA 2Y5PA 2JSVX 4W9JA 1WH3A 3UGBB 3B0AA 1CJEA 1XO3A 2MLBA 3ZRCA 2IO2B 1RFAA 1JROA 1WE6A 2H88B 4URKA 4MT5A 2HTHA 1N6ZA 5J2RA 5G55A 2KFJA 2EKIA 4C80A 4A9AA 4EUTA 2KZRA 2CU1A 3FAHA 4J3OD 1MFWA 3HVZA 1HZ5A 4IKGA 2ZZPB 4N59A 1LO5D 3AEFB 5HI1A 4KGRA 4KGSA 4WURA 3ZJVA 2L7RA 2NMQA 2L3ZA 3OJ4B 1DYQA 2BT6A 2KVRA 1JRPA 3R66C 2EELA 4GDKA 2MBEA 4JL9A 3WCQA 1M94A 2FAZA 3SFDB 2J52A 1YMHE 4HKZE 4XZ4A 4NJ7A 4ACFA 1KOTA 5MPOA 3AECB 3AM9A 3VXWA 3RNFC 3HM6X 3ZJUA 2JQRB 4KDLB 2KDEB 2R61A 1E6EB 4US8A 3BIID 2BVCA 1UNSA 3BK1A 2BKRB 3VH4B 4W9LA 5DPRA 4RGOS 2CR5A 1UGMA 1CQVA 3IXSA 3Q14C 1L0XB 2UWQA 2W3SA 1ZDVA 2LWPA 1WX7A 2LGIA 2N1WA 1ET9A 1ZUD2 2KYWA 2N9PC 5JHBA 4YSXB 4OVVA 2G3QB 1WY8A 2DBYA 5BYQA 1YQBA 2MP2A 2MSED 3ENEA 4KX6B 3Q3FA 4LLGM 2M17A 2KVZA 4GIVA 3V61A 3ZW3A 2M56B 3PHXB 3PPAA 1D5XC 2ZPYA 1TTNA 2YVCA 5LNK1 1TGZB 2MBOA 1K53A 1SEBD 3FC4A 1XXGA 3NVZA 4ASWC 2ZCCA 4W9EA 2K25A 3RPFC 3DBRB 2D3BA 2JPHA 2PMVA 1KFYB 2O6VB 3BYYB 3R7RA 2WYQA 1UELA 1SIJA 1TZOA 1F9JA 1OQYA 2FCQA 5CHWA 1STEA 2DNFA 3GOEA 2KJ6A 1XLPA 2WP9B 3PLVA 4MACA 5FR3A 4HJGE 3V60A 2WX1A 1K51A 2NBWB 4JE3B 4A8XC 1YD8U 3WIMA 1SE2A 1UUPA 1J8CA 3RULA 2IJ0A 1I4GA 1CZPA 1V8CA 3QC8B 3GB1A 4WH4A 3P4PB 1TKYA 3ZNGC 2J0KA 3Q8AA 3VTVA 4RGNA 4KDIC 1NDDA 4FN2A 4P16A 3DWMA 1WR1A 4BKGA 4HXDA 1GC7A 3HVDA 2K8CA 4RGTA 3T3NA 4P6VF 3NRZA 2PEAA 3VHTC 3PRZA 5H92C 3KUZA 5HHDG 3I5JC 1NYQA 3W1SC 3I57A 3Q3OC 4BFRA 1RAXA 2ACZB 5CHVC 2NCNA 1JW9D 4BOZB 3E9SA 4JIOU 1V86A 4LNFA 1GB4A 2ZW1A 1Q10A 4HDOA 2L83A 2UYZB 3QAQA 3A1QA 4E74A 1F1HA 4PYZA 4DXGA 2KN4A 4BKSD 1FD6A 1D6EC 1FNUA 1EF5A 2MJEA 2WDVB 4KGTA 4G11A 2KMAA 5IAAC 4TUUA 1V6EA 3NZUA 2VH1A 3IHPC 2KAJA 3PGEA 3W5UB 2CU3A 1WX8A 3ONSA 3EGRA 2LFIA 1IP9A 2V4IB 1N62A 1DOXA 2G45B 2BYFA 4LNOA 1N5XA 3VUWA 3UIOB 2WXLA 2DYMA 3RNGC 1I4HA 3FILB 2XN9C 5L83A 3RNEC 2DZMA 4OZCA 4IC7B 1P0RA 2K39A 2O6VA 2DX5B 3TIXA 5AZFA 1WXSA 1UGJA 3EC8A 3EHVA 2AYOB 3ZDTA 4FLHA 3V6CB 5FR6A 4FA6A 1FCCC 3IAM1 1TBEA 3ETRA 4FADA 5J17A 4XC2A 1WXMA 1JWMD 2NPTB 3LJ3A 4ANVA 2G9HD 2HJ1A 3KWLA 3GP7A 3AEBB 3Q3NC 4IOIE 4IM2A 1ZKHA 1BUIC 3TUOA 1E8XA 2NBVB 1I4RA 1V97A 2BYVE 1SJHD 1PGAA 2KWVB 2D07B 4LDTB 1WM2A 2KTFA 2KOXA 3UIPB 3GE3C 2LD9A 2Z0DB 1V2YA 1NVID 1FCLA 2V4LA 1WGYA 1PFDA 3MP9A 3C0RB 4FHJA 1MI0A 4LTUA 2N9LA 4ZOHC 3PV1A 1AW7A 2KX3A 2KO3A 4EEWA 3DBHI 1WX9A 4GSWA 4DHJB 2QIEB 4MEMA 3ZRFA 1TIFA 1EO6A 2GBNA 3U7ZA 5BYRA 2WXGA
chains in the Genus database with same CATH topology
4F1SA 3I3TB 2DAJA 4MH0E 2IBIB 4TQ1A 2G4SA 1Z2MA 4E3CA 3ECIA 3DVNV 3Q3JA 3TBLD 4B6WA 1GJZA 2V1YA 3APDA 3ZKJC 4GU2A 5E6NA 4LDTD 1Q1OA 3A4SC 3PLUA 2MP2B 4IWOA 1AARA 1CMXB 5E6PA 4F8CB 1J0GA 1P1AA 2D11A 1XT9B 2FIDA 3A1QB 2D10A 3A9JA 5IA7A 4PS3A 4HVBA 3KYCD 2M8SA 5D2MB 1WMHB 2LXAA 4BOSC 3OLMD 3X0WA 3MHSD 3DQVA 3VDZA 2KKCA 4EZLA 5G2NA 1X1MA 2OOBB 3PTFC 1LQBA 3N30A 4KSLC 5D7GA 1V81A 2D3GA 3JSVA 3VQIA 4FJYA 1WRDB 4WJQA 3VAWA 4HPMB 4W9HA 1WM3A 4TV3A 5TR5A 1QZEA 1YX6B 1T0YA 3DPDA 4M8MA 2KJHB 3AULA 3X23A 4WJNA 1KJTA 4K7SA 4AP4C 4DDGD 2Z59B 2DENB 2K6DB 4K81A 3UF8A 3PSEB 2FCMA 4DHJD 1E8ZA 3TMPB 2L0TA 2A4ZA 2FIFA 1J19A 2LRUA 5DPWA 2KLGA 2KHWB 3ZTCA 3MTNB 1OEYA 3AU4A 2CHZA 4W9JA 3UGBB 1WH3A 3B08A 2BWFA 3B0AA 3IBEA 4DWFA 1UBQA 2KJRA 4GB9A 1A5RA 3M3JA 3QK0A 1MG8A 2DZKA 2MLBA 2ZJDA 3QX1A 3ZRCA 2KXJA 4ICUA 2IO2B 3BY4B 4P7IA 1RFAA 1WE6A 4IM3A 4F7ZA 4URKA 1WGGA 2HTHA 3VTUA 5J2RA 5G55A 2KFJA 4HLEA 1UH6A 3NHEB 1E7UA 1WFYA 4G3XB 2HJ8A 4KZCA 2LASA 5KHOA 4EUTA 3B1LX 2KZRA 2CU1A 1JRUA 3QCAA 4EFOA 2NBUA 2XK5A 2ZVOA 4KVGB 2QHOA 3TJPA 3M62B 4GDLA 2MRPA 2ZZPB 4M0WB 2KFKA 2BKFA 3DVGY 3VTWA 2IYDB 3ML9A 3MJWA 3OAWA 4EZKA 5D6JB 1ZW7A 2DAFA 3R7QA 1NBFC 2MBBB 1SE9A 2L7RA 3H9DA 2IZVB 4FULA 5L95C 2K6QA 4JLCA 3W1SA 1P9DU 2ZVNA 4GOCA 2L3ZA 3NZSA 5CHFA 1LM8B 1WYWB 3S2AA 2NPTA 3OJ4B 2KVRA 2NS5A 3R66C 3QQ8B 4GDKA 4HDQA 1RLFA 3ZNID 4ZRIA 2MBEA 1S1QB 4JL9A 5JZEB 2BPSA 1M94A 4M8NA 3SDLC 5CTRC 2FAZA 2JVCA 3H6NA 3ZNZB 4MJSB 2BF8B 4XZ4A 1EF1A 3DCGA 4NJ7A 4KZ0A 1WIAA 2R2OA 5JHAA 1U4AA 4E71A 1KOTA 3VVWB 3ZLZA 2BGFA 3UINB 1OTRB 3VXWA 2C7HA 4BKSA 3OJ3A 3HM6X 3PRMB 4OVUA 2EMTA 4KDLB 1IYFA 2MBHA 2KDEB 3K9PB 3PT2B 4ANWA 2LGDA 3NOBA 2LXCA 3AI5A 2AL6A 4W9GA 2MBQA 4KV2A 2V3SA 3JYUA 2KNBA 4FBJB 2MWSB 3CMMB 4HCNB 2BKRB 3VH4B 5JH5C 4NAWA 4W9LA 5DPRA 3SD5A 2G4DB 2DHZA 3IG3A 1ZGUB 3AU5A 4B9KA 2CR5A 1UGMA 2JT4B 2LVOA 2CHXA 3RD2A 4W9KA 4NNJB 3PHWB 2JRIB 4GN1A 3PVLA 3WAMA 3HIZA 4XX5A 2CKHB 2LI5A 2KQSA 2UWQA 2EKEC 2JWZA 2LWPA 1WX7A 3ZTDA 1SIFA 4MSQB 3PREA 4CYEA 2N1WA 4HJKA 2RSUA 2GOWA 3L16A 5J18A 4ANXA 4MELA 2DZIA 4ZDVA 2N9PC 5JHBA 4TQ0A 4OVVA 2G3QB 3ALBA 3RUIB 1WY8A 2HE7A 4NQKE 1WJ6A 1YQBA 2MP2A 2W9NA 2MSED 3ENEA 2C5LC 4YL8A 2ZNVB 2BWES 1E8WA 2LZ6A 3WANA 1YX5B 3Q3FA 4LJOB 1WMHA 2DYBA 2M17A 3JSVB 3K9OB 4GIVA 1TZ1A 3V61A 3ZW3A 2MX2A 3WAOA 2GBRA 2I1KA 1WXAA 2FCSA 2IY1B 2ZPYA 1WGRA 3N3KB 3PHXB 1YJ1A 3PPAA 4ZRJA 1TTNA 2YVCA 2WWZA 1Z5SB 2D2QA 1YIWA 4IUMB 2FCNA 1E8YA 3A33B 5AZGA 4BBNF 2N9XA 2KDIA 4K1RB 2KWCA 1L7YA 3ML8A 2JF5A 3T9LA 1TGZB 1BT0A 2MBOA 4HWIB 2AEHA 2CHWA 4IM0A 3R3MA 2MQJA 2K8BA 2JY6A 2WDTB 1V9JA 2ZCCA 2KANA 3PS6A 4W9EA 4ASWC 4DDID 4EZJA 3P2BA 5C23A 3QA8A 3RYTA 2KQ7A 2K25A 4WAAA 1NI2A 2JPHA 3QARA 4DBGA 1WJUA 1WF9A 2O6VB 1WGDA 2IY0B 1WXVA 3R7RA 2GBJA 2KMCA 4DHZB 5D94A 1G6JA 1GG3A 1WJ4A 2WYQA 1UELA 4MSMB 1H8CA 4DHZE 1F9JA 1OQYA 3HHMA 2DZJA 2FCQA 1S3SG 4K7UA 4KSKC 5CHWA 4BKTA 3GZNI 3GOEA 4I6LB 3L08A 4MGIE 2KJ6A 4K7WA 4BVUC 2RGFA 3A9KB 2ZNVC 2GMIC 4LCDE 4PYUA 3V62A 2AWTA 4CHKA 3PLVA 2N1VA 2FUHB 1PQSA 2NVUI 2ZEQA 1H4RA 3H1UA 1Y8RC 4G0NB 2GBKA 2MCNB 3L0WB 3RT3B 3RCZA 1VCBA 2OJRA 3V60A 3DVNU 1V5TA 2KK8A 2WX1A 3EFUA 3DVGX 2IO0B 4NY0A 2NBWB 3WA0A 2HD5B 2N7DA 3RZWC 2L76A 4MDKE 1YD8U 3WIMA 2KDBA 3UQBA 3M63B 4I6NB 4MGZE 1J8CA 4G50A 3RULA 1KM7A 4AJYB 1WR6E 3HK0A 3O65B 5DPTA 4AOFA 3EECA 2KTRB 2N4FA 3QC8B 3U30A 3VH3B 3JW0X 2C9WB 3KUCB 2L8JA 3L10B 1E90A 2O6VD 3ZNGC 1WGHA 2RPQA 3CSTA 2J0KA 2PPHA 4MJSA 3VTVA 3ZDMC 3D32A 4HCPB 3A4RA 4KDIC 1UBIA 1NDDA 3DBRI 4WJPA 3H7PB 2C7NB 1R4MI 4FN2A 4HK2A 1E7VA 4FHKA 2DYOA 1WR1A 3AXCA 4BKGA 2MA9B 4HXDA 4WQOB 1GC7A 1UD7A 2K8CA 3CF6E 4FJVB 5AEKB 2WX0A 5EDSA 4W9CA 4KIKB 3L17A 2C7MB 2PEAA 4HPLB 3QJZA 1LXDA 3VHTC 4EKUA 3PRZA 3KUDB 3KUZA 1WZ0A 3HM3A 4NJ6A 1P3QU 3SU8X 3PZDA 4MGYE 3APCA 2AL3A 2O2VA 3W1SC 4EOYA 2B3AA 1C1YB 2ZPNA 1GUAB 3V6EB 3ZUNA 1RAXA 5CHVC 4BFRA 2NCNA 4WWOA 4A20A 2Y5BB 3DOWA 4IWQA 4W9DA 2EMSA 4BOZB 4JIOU 1V86A 4ZYNA 1D3ZA 4RMAA 2IO3B 4HDOA 2REXA 4GMVA 3A9JB 4MM3A 2UYZB 1I42A 3QAQA 3A1QA 1VD2A 3JVZX 3ZVVA 4E74A 3ZNHB 2RR9A 4PYZA 1Q5WB 2NR2A 1WJNA 3VUXA 4BKSD 5C1ZA 2KWUB 1EF5A 4NQLB 3U7DA 3WALA 4G11A 4DXAB 1IPGA 2KMAA 2MW5A 1P98A 4JQWC 1SGHA 5IAAC 4TUUA 4AWJA 1V6EA 2LJ5A 1WE7A 2I1JA 3NZUA 4ICVA 1XQQA 4GGQA 2IO1B 3IHPC 3PGEA 2R2QA 1RRBA 3UQAA 3LDZE 3DDCB 1WX8A 2LGXA 1EUVB 3ZO5B 4N9F4 2J7QB 1ISNA 1L2NA 3ONSA 4II3B 4ZRKA 3APFA 3QWZB 3NY5A 5DPSA 2K8HA 4A3PA 4IWPA 2BYEA 1XD3B 1IP9A 3VFKA 2JXXA 4WWNA 1OGWA 2L00B 2G45B 2BYFA 4WWPA 1C3TA 3VUWA 3KW5B 2N9EB 4X57B 2M1MA 3UIOB 3DBSA 2CS4A 3KVFB 2DYMA 5L83A 2DZMA 5E6OA 1UZXB 4IC7B 1P0RA 3RZFA 4A3OA 1FXTB 1HE8A 4IW0A 2LRWA 2K39A 1OEYJ 2O6VA 2DX5B 4IG7B 2JRHA 1K8RB 3TIXA 2XK5B 4B95A 2JUOA 5AZFA 4GXBA 1WXSA 3EC8A 2RD0A 2AYOB 3EHVA 3M95A 2KFKB 3IFWB 4FLHA 4GDLB 4NPNA 3V6CB 3ZDTA 4I6PA 2ZCBA 4II2B 5FR6A 2J0JA 2Z0EB 2XEWA 1V49A 2FNJB 2KN5A 4FA6A 2PE9A 2C60A 1I35A 4W9IA 2KDFB 1TBEA 3A9KA 5DCNA 4FJZA 2LGYA 3CSFA 4FADA 4PS8A 4PS7A 5J17A 4LJPB 4XC2A 2JZZA 2ASQA 1WXMA 3VUYA 2NPTB 4AJWA 1Q0WB 3TL5A 3LJ3A 4GDKB 2L0FA 3ZIMA 4ANVA 1GNUA 2LUEA 5HKHA 2PE6B 3KH0A 4J6IA 4ANUA 4IM2A 4RM8A 1ZKHA 3SHQA 1E5WA 1E8XA 2KD0A 2NBVB 2YLMA 4W9FA 2BYVE 5GMVA 1WI0A 2LVQA 2KWVB 4BBNC 2D07B 4LDTB 2KTRA 1WM2A 1R4NI 1WZ3A 2LVPA 4DK5A 3N32A 3IVFA 1KLVA 2K1FA 2KTFA 3PRPB 4WJOA 3TCAA 2KOXA 1V80A 3NS8A 5LXHA 3UIPB 2L05A 2KLCA 2LD9A 2Z0DB 1V2YA 2VRRB 3WAPA 1LFDA 2N7EA 2V4LA 1WGYA 3DBLI 3H7PA 3QIJA 2KX0A 4JGHB 3C0RB 4FHJA 2PJHA 2KC2A 2KC1A 4CO7A 4NAWB 4AUQC 3U8ZA 5BO4B 3KYDD 2M4NA 3W1YA 3BINA 3PV1A 4MGKE 4RM9A 2KX3A 2A5UA 2KO3A 3T8MA 3L54A 2GBMA 4TKNA 5LLIA 3DBHI 1WX9A 4EEWA 1V5OA 2XBBC 3QHTA 4GSWA 4KIKA 3H7SA 5AZHA 4DHJB 2J0MA 4MEMA 2JZ3B 1GC6A 3ZRFA 5LXIB 1EO6A 2GBNA 5CX3A 3L13A 2O2VB 5KHQA 2M0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1S A;  3I3T B;  2DAJ A;  4MH0 E;  2IBI B;  4TQ1 A;  2G4S A;  1Z2M A;  4E3C A;  3ECI A;  3DVN V;  3Q3J A;  3TBL D;  4B6W A;  1GJZ A;  2V1Y A;  3APD A;  3ZKJ C;  4GU2 A;  5E6N A;  4LDT D;  1Q1O A;  3A4S C;  3PLU A;  2MP2 B;  4IWO A;  1AAR A;  1CMX B;  5E6P A;  4F8C B;  1J0G A;  1P1A A;  2D11 A;  1XT9 B;  2FID A;  3A1Q B;  2D10 A;  3A9J A;  5IA7 A;  4PS3 A;  4HVB A;  3KYC D;  2M8S A;  5D2M B;  1WMH B;  2LXA A;  4BOS C;  3OLM D;  3X0W A;  3MHS D;  3DQV A;  3VDZ A;  2KKC A;  4EZL A;  5G2N A;  1X1M A;  2OOB B;  3PTF C;  1LQB A;  3N30 A;  4KSL C;  5D7G A;  1V81 A;  2D3G A;  3JSV A;  3VQI A;  4FJY A;  1WRD B;  4WJQ A;  3VAW A;  4HPM B;  4W9H A;  1WM3 A;  4TV3 A;  5TR5 A;  1QZE A;  1YX6 B;  1T0Y A;  3DPD A;  4M8M A;  2KJH B;  3AUL A;  3X23 A;  4WJN A;  1KJT A;  4K7S A;  4AP4 C;  4DDG D;  2Z59 B;  2DEN B;  2K6D B;  4K81 A;  3UF8 A;  3PSE B;  2FCM A;  4DHJ D;  1E8Z A;  3TMP B;  2L0T A;  2A4Z A;  2FIF A;  1J19 A;  2LRU A;  5DPW A;  2KLG A;  2KHW B;  3ZTC A;  3MTN B;  1OEY A;  3AU4 A;  2CHZ A;  4W9J A;  3UGB B;  1WH3 A;  3B08 A;  2BWF A;  3B0A A;  3IBE A;  4DWF A;  1UBQ A;  2KJR A;  4GB9 A;  1A5R A;  3M3J A;  3QK0 A;  1MG8 A;  2DZK A;  2MLB A;  2ZJD A;  3QX1 A;  3ZRC A;  2KXJ A;  4ICU A;  2IO2 B;  3BY4 B;  4P7I A;  1RFA A;  1WE6 A;  4IM3 A;  4F7Z A;  4URK A;  1WGG A;  2HTH A;  3VTU A;  5J2R A;  5G55 A;  2KFJ A;  4HLE A;  1UH6 A;  3NHE B;  1E7U A;  1WFY A;  4G3X B;  2HJ8 A;  4KZC A;  2LAS A;  5KHO A;  4EUT A;  3B1L X;  2KZR A;  2CU1 A;  1JRU A;  3QCA A;  4EFO A;  2NBU A;  2XK5 A;  2ZVO A;  4KVG B;  2QHO A;  3TJP A;  3M62 B;  4GDL A;  2MRP A;  2ZZP B;  4M0W B;  2KFK A;  2BKF A;  3DVG Y;  3VTW A;  2IYD B;  3ML9 A;  3MJW A;  3OAW A;  4EZK A;  5D6J B;  1ZW7 A;  2DAF A;  3R7Q A;  1NBF C;  2MBB B;  1SE9 A;  2L7R A;  3H9D A;  2IZV B;  4FUL A;  5L95 C;  2K6Q A;  4JLC A;  3W1S A;  1P9D U;  2ZVN A;  4GOC A;  2L3Z A;  3NZS A;  5CHF A;  1LM8 B;  1WYW B;  3S2A A;  2NPT A;  3OJ4 B;  2KVR A;  2NS5 A;  3R66 C;  3QQ8 B;  4GDK A;  4HDQ A;  1RLF A;  3ZNI D;  4ZRI A;  2MBE A;  1S1Q B;  4JL9 A;  5JZE B;  2BPS A;  1M94 A;  4M8N A;  3SDL C;  5CTR C;  2FAZ A;  2JVC A;  3H6N A;  3ZNZ B;  4MJS B;  2BF8 B;  4XZ4 A;  1EF1 A;  3DCG A;  4NJ7 A;  4KZ0 A;  1WIA A;  2R2O A;  5JHA A;  1U4A A;  4E71 A;  1KOT A;  3VVW B;  3ZLZ A;  2BGF A;  3UIN B;  1OTR B;  3VXW A;  2C7H A;  4BKS A;  3OJ3 A;  3HM6 X;  3PRM B;  4OVU A;  2EMT A;  4KDL B;  1IYF A;  2MBH A;  2KDE B;  3K9P B;  3PT2 B;  4ANW A;  2LGD A;  3NOB A;  2LXC A;  3AI5 A;  2AL6 A;  4W9G A;  2MBQ A;  4KV2 A;  2V3S A;  3JYU A;  2KNB A;  4FBJ B;  2MWS B;  3CMM B;  4HCN B;  2BKR B;  3VH4 B;  5JH5 C;  4NAW A;  4W9L A;  5DPR A;  3SD5 A;  2G4D B;  2DHZ A;  3IG3 A;  1ZGU B;  3AU5 A;  4B9K A;  2CR5 A;  1UGM A;  2JT4 B;  2LVO A;  2CHX A;  3RD2 A;  4W9K A;  4NNJ B;  3PHW B;  2JRI B;  4GN1 A;  3PVL A;  3WAM A;  3HIZ A;  4XX5 A;  2CKH B;  2LI5 A;  2KQS A;  2UWQ A;  2EKE C;  2JWZ A;  2LWP A;  1WX7 A;  3ZTD A;  1SIF A;  4MSQ B;  3PRE A;  4CYE A;  2N1W A;  4HJK A;  2RSU A;  2GOW A;  3L16 A;  5J18 A;  4ANX A;  4MEL A;  2DZI A;  4ZDV A;  2N9P C;  5JHB A;  4TQ0 A;  4OVV A;  2G3Q B;  3ALB A;  3RUI B;  1WY8 A;  2HE7 A;  4NQK E;  1WJ6 A;  1YQB A;  2MP2 A;  2W9N A;  2MSE D;  3ENE A;  2C5L C;  4YL8 A;  2ZNV B;  2BWE S;  1E8W A;  2LZ6 A;  3WAN A;  1YX5 B;  3Q3F A;  4LJO B;  1WMH A;  2DYB A;  2M17 A;  3JSV B;  3K9O B;  4GIV A;  1TZ1 A;  3V61 A;  3ZW3 A;  2MX2 A;  3WAO A;  2GBR A;  2I1K A;  1WXA A;  2FCS A;  2IY1 B;  2ZPY A;  1WGR A;  3N3K B;  3PHX B;  1YJ1 A;  3PPA A;  4ZRJ A;  1TTN A;  2YVC A;  2WWZ A;  1Z5S B;  2D2Q A;  1YIW A;  4IUM B;  2FCN A;  1E8Y A;  3A33 B;  5AZG A;  4BBN F;  2N9X A;  2KDI A;  4K1R B;  2KWC A;  1L7Y A;  3ML8 A;  2JF5 A;  3T9L A;  1TGZ B;  1BT0 A;  2MBO A;  4HWI B;  2AEH A;  2CHW A;  4IM0 A;  3R3M A;  2MQJ A;  2K8B A;  2JY6 A;  2WDT B;  1V9J A;  2ZCC A;  2KAN A;  3PS6 A;  4W9E A;  4ASW C;  4DDI D;  4EZJ A;  3P2B A;  5C23 A;  3QA8 A;  3RYT A;  2KQ7 A;  2K25 A;  4WAA A;  1NI2 A;  2JPH A;  3QAR A;  4DBG A;  1WJU A;  1WF9 A;  2O6V B;  1WGD A;  2IY0 B;  1WXV A;  3R7R A;  2GBJ A;  2KMC A;  4DHZ B;  5D94 A;  1G6J A;  1GG3 A;  1WJ4 A;  2WYQ A;  1UEL A;  4MSM B;  1H8C A;  4DHZ E;  1F9J A;  1OQY A;  3HHM A;  2DZJ A;  2FCQ A;  1S3S G;  4K7U A;  4KSK C;  5CHW A;  4BKT A;  3GZN I;  3GOE A;  4I6L B;  3L08 A;  4MGI E;  2KJ6 A;  4K7W A;  4BVU C;  2RGF A;  3A9K B;  2ZNV C;  2GMI C;  4LCD E;  4PYU A;  3V62 A;  2AWT A;  4CHK A;  3PLV A;  2N1V A;  2FUH B;  1PQS A;  2NVU I;  2ZEQ A;  1H4R A;  3H1U A;  1Y8R C;  4G0N B;  2GBK A;  2MCN B;  3L0W B;  3RT3 B;  3RCZ A;  1VCB A;  2OJR A;  3V60 A;  3DVN U;  1V5T A;  2KK8 A;  2WX1 A;  3EFU A;  3DVG X;  2IO0 B;  4NY0 A;  2NBW B;  3WA0 A;  2HD5 B;  2N7D A;  3RZW C;  2L76 A;  4MDK E;  1YD8 U;  3WIM A;  2KDB A;  3UQB A;  3M63 B;  4I6N B;  4MGZ E;  1J8C A;  4G50 A;  3RUL A;  1KM7 A;  4AJY B;  1WR6 E;  3HK0 A;  3O65 B;  5DPT A;  4AOF A;  3EEC A;  2KTR B;  2N4F A;  3QC8 B;  3U30 A;  3VH3 B;  3JW0 X;  2C9W B;  3KUC B;  2L8J A;  3L10 B;  1E90 A;  2O6V D;  3ZNG C;  1WGH A;  2RPQ A;  3CST A;  2J0K A;  2PPH A;  4MJS A;  3VTV A;  3ZDM C;  3D32 A;  4HCP B;  3A4R A;  4KDI C;  1UBI A;  1NDD A;  3DBR I;  4WJP A;  3H7P B;  2C7N B;  1R4M I;  4FN2 A;  4HK2 A;  1E7V A;  4FHK A;  2DYO A;  1WR1 A;  3AXC A;  4BKG A;  2MA9 B;  4HXD A;  4WQO B;  1GC7 A;  1UD7 A;  2K8C A;  3CF6 E;  4FJV B;  5AEK B;  2WX0 A;  5EDS A;  4W9C A;  4KIK B;  3L17 A;  2C7M B;  2PEA A;  4HPL B;  3QJZ A;  1LXD A;  3VHT C;  4EKU A;  3PRZ A;  3KUD B;  3KUZ A;  1WZ0 A;  3HM3 A;  4NJ6 A;  1P3Q U;  3SU8 X;  3PZD A;  4MGY E;  3APC A;  2AL3 A;  2O2V A;  3W1S C;  4EOY A;  2B3A A;  1C1Y B;  2ZPN A;  1GUA B;  3V6E B;  3ZUN A;  1RAX A;  5CHV C;  4BFR A;  2NCN A;  4WWO A;  4A20 A;  2Y5B B;  3DOW A;  4IWQ A;  4W9D A;  2EMS A;  4BOZ B;  4JIO U;  1V86 A;  4ZYN A;  1D3Z A;  4RMA A;  2IO3 B;  4HDO A;  2REX A;  4GMV A;  3A9J B;  4MM3 A;  2UYZ B;  1I42 A;  3QAQ A;  3A1Q A;  1VD2 A;  3JVZ X;  3ZVV A;  4E74 A;  3ZNH B;  2RR9 A;  4PYZ A;  1Q5W B;  2NR2 A;  1WJN A;  3VUX A;  4BKS D;  5C1Z A;  2KWU B;  1EF5 A;  4NQL B;  3U7D A;  3WAL A;  4G11 A;  4DXA B;  1IPG A;  2KMA A;  2MW5 A;  1P98 A;  4JQW C;  1SGH A;  5IAA C;  4TUU A;  4AWJ A;  1V6E A;  2LJ5 A;  1WE7 A;  2I1J A;  3NZU A;  4ICV A;  1XQQ A;  4GGQ A;  2IO1 B;  3IHP C;  3PGE A;  2R2Q A;  1RRB A;  3UQA A;  3LDZ E;  3DDC B;  1WX8 A;  2LGX A;  1EUV B;  3ZO5 B;  4N9F 4;  2J7Q B;  1ISN A;  1L2N A;  3ONS A;  4II3 B;  4ZRK A;  3APF A;  3QWZ B;  3NY5 A;  5DPS A;  2K8H A;  4A3P A;  4IWP A;  2BYE A;  1XD3 B;  1IP9 A;  3VFK A;  2JXX A;  4WWN A;  1OGW A;  2L00 B;  2G45 B;  2BYF A;  4WWP A;  1C3T A;  3VUW A;  3KW5 B;  2N9E B;  4X57 B;  2M1M A;  3UIO B;  3DBS A;  2CS4 A;  3KVF B;  2DYM A;  5L83 A;  2DZM A;  5E6O A;  1UZX B;  4IC7 B;  1P0R A;  3RZF A;  4A3O A;  1FXT B;  1HE8 A;  4IW0 A;  2LRW A;  2K39 A;  1OEY J;  2O6V A;  2DX5 B;  4IG7 B;  2JRH A;  1K8R B;  3TIX A;  2XK5 B;  4B95 A;  2JUO A;  5AZF A;  4GXB A;  1WXS A;  3EC8 A;  2RD0 A;  2AYO B;  3EHV A;  3M95 A;  2KFK B;  3IFW B;  4FLH A;  4GDL B;  4NPN A;  3V6C B;  3ZDT A;  4I6P A;  2ZCB A;  4II2 B;  5FR6 A;  2J0J A;  2Z0E B;  2XEW A;  1V49 A;  2FNJ B;  2KN5 A;  4FA6 A;  2PE9 A;  2C60 A;  1I35 A;  4W9I A;  2KDF B;  1TBE A;  3A9K A;  5DCN A;  4FJZ A;  2LGY A;  3CSF A;  4FAD A;  4PS8 A;  4PS7 A;  5J17 A;  4LJP B;  4XC2 A;  2JZZ A;  2ASQ A;  1WXM A;  3VUY A;  2NPT B;  4AJW A;  1Q0W B;  3TL5 A;  3LJ3 A;  4GDK B;  2L0F A;  3ZIM A;  4ANV A;  1GNU A;  2LUE A;  5HKH A;  2PE6 B;  3KH0 A;  4J6I A;  4ANU A;  4IM2 A;  4RM8 A;  1ZKH A;  3SHQ A;  1E5W A;  1E8X A;  2KD0 A;  2NBV B;  2YLM A;  4W9F A;  2BYV E;  5GMV A;  1WI0 A;  2LVQ A;  2KWV B;  4BBN C;  2D07 B;  4LDT B;  2KTR A;  1WM2 A;  1R4N I;  1WZ3 A;  2LVP A;  4DK5 A;  3N32 A;  3IVF A;  1KLV A;  2K1F A;  2KTF A;  3PRP B;  4WJO A;  3TCA A;  2KOX A;  1V80 A;  3NS8 A;  5LXH A;  3UIP B;  2L05 A;  2KLC A;  2LD9 A;  2Z0D B;  1V2Y A;  2VRR B;  3WAP A;  1LFD A;  2N7E A;  2V4L A;  1WGY A;  3DBL I;  3H7P A;  3QIJ A;  2KX0 A;  4JGH B;  3C0R B;  4FHJ A;  2PJH A;  2KC2 A;  2KC1 A;  4CO7 A;  4NAW B;  4AUQ C;  3U8Z A;  5BO4 B;  3KYD D;  2M4N A;  3W1Y A;  3BIN A;  3PV1 A;  4MGK E;  4RM9 A;  2KX3 A;  2A5U A;  2KO3 A;  3T8M A;  3L54 A;  2GBM A;  4TKN A;  5LLI A;  3DBH I;  1WX9 A;  4EEW A;  1V5O A;  2XBB C;  3QHT A;  4GSW A;  4KIK A;  3H7S A;  5AZH A;  4DHJ B;  2J0M A;  4MEM A;  2JZ3 B;  1GC6 A;  3ZRF A;  5LXI B;  1EO6 A;  2GBN A;  5CX3 A;  3L13 A;  2O2V B;  5KHQ A;  2M0X A; 
#chains in the Genus database with same CATH topology
 3I3T B;  4FXC A;  4E3C A;  2PIA A;  3APD A;  1K50 A;  1RM6 C;  4GU2 A;  3AE8 B;  3A4S C;  1C4A A;  3B2G A;  1NI3 A;  1ACC A;  5I4D A;  4F8C B;  2BQQ A;  2D11 A;  1XT9 B;  1TT5 B;  2D10 A;  5G5H A;  1WMH B;  3OLM D;  1FO4 A;  1CK1 A;  3DQV A;  3VDZ A;  2JXT A;  2RDB C;  2OOB B;  4S0R A;  4KSL C;  2D3C A;  1V81 A;  5EE3 A;  4FJY A;  4WJQ A;  1RFK A;  3Q8C A;  1FFV A;  2IPK D;  2INP E;  4K81 A;  2K6D B;  2FCM A;  4XWW A;  4XE0 A;  2L0T A;  2A4Z A;  2FIF A;  1WRI A;  2LRU A;  2ICI A;  3ZTC A;  1HTO A;  3B08 A;  4H2A A;  3IBE A;  3VR8 B;  2V3P A;  3QK0 A;  1MG8 A;  3KQ4 A;  1NEK B;  3QX1 A;  2KXJ A;  4ICU A;  3AED B;  1TYG B;  4RGM A;  2GI9 A;  3AEA B;  2YEP F;  2X38 A;  3FIL A;  4HLE A;  1WFY A;  2L52 A;  4G3X B;  1HTQ A;  4TSS A;  2NBU A;  2ZVO A;  4KVG B;  2B76 B;  1OQR A;  4M0W B;  3DVG Y;  2IYD B;  3ML9 A;  4ZHP A;  1T6B X;  3LB8 C;  2DAF A;  2K6Q A;  4B0M A;  1LM8 B;  2V3N A;  1WYW B;  3S2A A;  2NPT A;  3PZ7 A;  3AE5 B;  4HDQ A;  3ZNI D;  4ZRI A;  1S1Q B;  1C9F A;  4M8N A;  1XLN A;  4A55 A;  3R2I A;  4N6E B;  4KZ0 A;  1WIA A;  2R2O A;  3NZ3 A;  5JHA A;  3HUI A;  1XF5 L;  3P4S B;  1I7H A;  2BGF A;  2PW9 A;  4BKS A;  4OVU A;  2EMT A;  1IYF A;  3W2D A;  3AI5 A;  2AL6 A;  1FRR A;  3TEZ A;  1UF0 A;  2KNB A;  4FBJ B;  4HCN B;  4JPS A;  5JH5 C;  3SD5 A;  3IG3 A;  3AU5 A;  4B9K A;  2Z8L A;  2PVG C;  2CHX A;  3OG5 A;  4W9K A;  4NNJ B;  3PVL A;  3HIZ A;  1FFU A;  2CKH B;  1L4D B;  3PRE A;  4CYE A;  2ZW0 A;  2HDE A;  2GOW A;  1TJE A;  3L16 A;  2AQ2 B;  4IDI A;  2X8X X;  2K5P A;  3GZN B;  3NG0 A;  3W5V B;  1T5X D;  4HRS A;  3RUI B;  2E6X A;  3RFZ B;  4NQK E;  1WJ6 A;  2W9N A;  4USA A;  2ZNV B;  2BWE S;  1L5P A;  1QF6 A;  1SXT A;  4LJO B;  3RNC C;  1WMH A;  3K9O B;  4YXD B;  4XWT A;  3WAO A;  3Q2A C;  2I1K A;  1WXA A;  4ITK A;  2IY1 B;  1MG4 A;  4HPP A;  2WWZ A;  1Z5S B;  2LHD A;  1XEE A;  1L0V B;  5AZG A;  4GLS C;  2KDI A;  4US9 A;  2WXN A;  3ML8 A;  4Q2J A;  1SSN A;  1F0Z A;  5BMH A;  4HWI B;  1VZ6 A;  4IM0 A;  2D5G A;  2MQJ A;  4WQM A;  1ESF A;  5HG2 A;  2IGH A;  1PDX A;  2WDT B;  1V9J A;  3PS6 A;  4DDI D;  1HXY D;  3QA8 A;  3RYT A;  2RDH A;  4AS1 A;  1NI2 A;  1JML A;  3QAR A;  4C7Y A;  1F2R I;  2IY0 B;  1WXV A;  2KMC A;  1A70 A;  4K7U A;  4MGI E;  2PLP A;  1TS3 A;  4BVU C;  2N9K A;  2K0P A;  4LCD E;  2ZNV C;  4CHK A;  2FUH B;  1PQS A;  2NVU I;  4REZ A;  1H4R A;  3H1U A;  5G5G A;  5BYS A;  3BVZ A;  1L6V A;  2GBK A;  3L0W B;  1PUT A;  1TS4 A;  2OJR A;  1C79 A;  3DVN U;  4M0W A;  1B9R A;  5JXV A;  2NTS A;  3DVG X;  3EFU A;  1HA5 A;  1WYG A;  5EE1 A;  2HD5 B;  1HEZ E;  1VDV A;  3M63 B;  4G50 A;  3P4R B;  2KDM A;  3HK0 A;  4RCO A;  3O65 B;  5IKC M;  3EEC A;  1SJE D;  2KTR B;  3GE8 C;  3U30 A;  3AEG B;  2L8J A;  1E90 A;  2O6V D;  3ZDM C;  2PPH A;  2G1E A;  4OVZ A;  3DBR I;  3H7P B;  1DOI A;  4FHK A;  2DYO A;  2MA9 B;  1UD7 A;  3CF6 E;  1N5W A;  2WU2 B;  1JWA D;  4W9C A;  1TY0 A;  3L17 A;  2C7M B;  1T0S C;  3KUD B;  2ONQ A;  4NJ6 A;  4L2Y A;  1P3Q U;  2AL3 A;  5EE9 A;  1QOF A;  1VLB A;  1GUA B;  3AEE B;  1B1Z A;  1GPX A;  2BTE A;  4A20 A;  3AE3 B;  4W9D A;  2EMS A;  5C2T B;  1YNT E;  2GRI A;  3A9J B;  1I42 A;  4C00 A;  3BYT B;  2QDF A;  1VD2 A;  2RR9 A;  1VJK A;  1EM7 A;  2NR2 A;  1I4X A;  1WJN A;  3AB5 A;  3IT6 B;  5C1Z A;  3B9J A;  3NVY A;  5IO9 A;  3WAL A;  4NAM A;  4DXA B;  1IPG A;  4JWS C;  1P98 A;  4AWJ A;  4ICV A;  4GGQ A;  2WU5 B;  2LJI A;  3LDZ E;  2QJL A;  3BVM A;  2LGX A;  1EUV B;  1PGX A;  4N9F 4;  4II3 B;  4ZRK A;  3APF A;  4YTP B;  4IWP A;  3B2F A;  4CQN A;  1F2R C;  1V1P B;  3VFK A;  1NEN B;  1OGW A;  1C3T A;  2CS4 A;  2RMM A;  2WQY B;  5IN7 A;  2PVO D;  2V9H A;  4TMA B;  4D2K A;  1MJD A;  5E6O A;  1UZX B;  2LRW A;  4GXB A;  1R7S A;  4NPN A;  3MC8 A;  1FXA A;  4I6P A;  1IBX B;  2W55 A;  3RNA C;  2MJ3 A;  2KN5 A;  2KDF B;  2LGY A;  4HEA 1;  4PS8 A;  4PS7 A;  2JZZ A;  2ASQ A;  4BAX A;  1Q0W B;  1QT9 A;  2BS3 B;  3ZIM A;  2LGS A;  1OFF A;  1XLQ A;  5GXG B;  3SHQ A;  3L4P A;  1E5W A;  3W9C B;  2YLM A;  5GMV A;  3KWV A;  1UWX A;  3I63 C;  1WI0 A;  4BBN C;  2GLS A;  1YJI A;  2KTR A;  2M19 A;  2Y5C A;  3N32 A;  1JQ4 A;  1YN4 A;  2K1F A;  2KQ4 X;  1M4V A;  2VRR B;  1YOV B;  3DBL I;  3H7P A;  3IT4 B;  4NAW B;  3U8Z A;  5BO4 B;  3T8M A;  4TKN A;  1V5O A;  1D5Z C;  5AZH A;  2J0M A;  5BMG A;  2JZ3 B;  1TS5 A;  4RF1 A;  5CX3 A;  3R8B A;  2O2V B;  1ROE A;  5KHQ A;  3RI7 C;  1IUE A;  4F1S A;  1FNW A;  3I9V 1;  2G4S A;  3ECI A;  3DVN V;  3Q3J A;  3ZJT A;  1MHX A;  3TBL D;  4B6W A;  5E6N A;  4LDT D;  1VZ8 A;  5D3D A;  1AAR A;  1UWM A;  4OHJ A;  2FID A;  3A9J A;  5IA7 A;  2W54 A;  3V3X A;  5D2M B;  1QOA A;  5G2N A;  1X1M A;  2BB6 A;  3RMK C;  1LQB A;  1AWD A;  3VQI A;  1JCK B;  1WRD B;  3C8Y A;  4WAF A;  1KJT A;  4AP4 C;  4DDG D;  2DEN B;  3PSE B;  1WGK A;  4DHJ D;  3UI3 A;  3TMP B;  4C56 C;  2WXI A;  2BWF A;  1UBQ A;  1V1P A;  3DBL B;  4OW0 A;  4P7I A;  4IM3 A;  3VTU A;  4XGA B;  2CJO A;  1UH6 A;  1E7U A;  1FMA D;  2WXK A;  1KH0 A;  2LAS A;  3B1L X;  4HRO A;  1JWS D;  2MRP A;  1I4Q A;  1AN8 A;  3VTW A;  2INC C;  1IBX A;  3OAW A;  3R7Q A;  2MBB B;  2L1A A;  3W1S A;  5CHF A;  2NS5 A;  1RLF A;  5JZE B;  3AMZ A;  3SDL C;  2L32 A;  3TEW A;  3GS2 A;  2BF8 B;  2DLB A;  2H89 B;  3DCG A;  4DQO C;  4RF0 A;  3BWU D;  1U4A A;  2QCZ A;  1E7P B;  3UIN B;  1OTR B;  2C7H A;  4XDD A;  3P63 A;  2LXC A;  4C7Z A;  4W9G A;  3C19 A;  3T3O A;  2MBQ A;  4KV2 A;  2V3S A;  3JYU A;  2INN E;  1IGC A;  3CMM B;  2JU6 X;  4NAW A;  1YQ4 B;  1ZDX A;  2DHZ A;  2JT4 B;  2LVO A;  3ABV B;  2JRI B;  3WAM A;  2N0S B;  2KQS A;  1GAQ B;  3ZTD A;  1SIF A;  2RSU A;  3O13 A;  4MM3 B;  5J18 A;  4MEL A;  1EU4 A;  3HRD D;  1J7A A;  4JWU C;  2MEK A;  4TQ0 A;  3ALB A;  4K3B A;  1FM0 D;  2HE7 A;  3N9Y C;  3TEY A;  4YL8 A;  3NS1 A;  1E8W A;  2LZ6 A;  1YX5 B;  4KKI A;  4WWM A;  2DYB A;  3JSV B;  4N58 A;  1SF0 A;  1TZ1 A;  3EUB 2;  3N3K B;  4ZRJ A;  1YN5 A;  1KLU D;  1PYW D;  1SB3 C;  1YIW A;  2FCN A;  1E8Y A;  3A33 B;  2N9X A;  3AH7 A;  1L7Y A;  2JF5 A;  2BW2 A;  2CHW A;  3R3M A;  1VRA B;  2KAN A;  2WXF A;  3MHZ A;  4EZJ A;  1FPY A;  2KQ7 A;  2I38 A;  3IAS 1;  1R4M B;  5H8Y E;  4DBG A;  1WF9 A;  1WGD A;  1C76 A;  2GBJ A;  3R2T A;  1GG3 A;  1WJ4 A;  4MSM B;  4DHZ E;  3P4Q B;  2Y3A A;  2DZJ A;  4BKT A;  1S3S G;  3ZXR A;  3GZN I;  2WXO A;  2IGD A;  2RGF A;  2GMI C;  3V62 A;  2AWT A;  2I2Y A;  2WXQ A;  1I4P A;  1Y8R C;  3RT3 B;  3URY A;  3RCZ A;  1VCB A;  2BBC A;  4YTN B;  1V5T A;  2KK8 A;  2FBW B;  2Q5W D;  2JYT A;  2IO0 B;  4NY0 A;  1BXT A;  3WA0 A;  2N7D A;  3RZW C;  1KRH A;  2L76 A;  4MDK E;  3FKY A;  2KDB A;  3UQB A;  4MGZ E;  1KM7 A;  4AJY B;  1WR6 E;  2PTL A;  3N1X C;  3U2S C;  4AOF A;  2LHE A;  1QKZ A;  1C77 A;  2N4F A;  2WS3 B;  2QEJ C;  3Q3M C;  3KUC B;  3L10 B;  4R3D A;  2AQ3 B;  4HCP B;  2KT7 A;  2VZK B;  4YTM B;  4HK2 A;  1E7V A;  2AQ1 B;  2IND C;  1KLG D;  4FJV B;  4ZRQ A;  5AEK B;  3AE6 B;  2WX0 A;  4KIK B;  2SAK A;  1ZOY B;  4HPL B;  2WXR A;  4EKU A;  1DGJ A;  2JX5 A;  4L23 A;  1ZXI A;  3Q69 A;  3KLS X;  3HM3 A;  1YN3 A;  2KMM A;  3APC A;  4EOY A;  2B3A A;  2J53 A;  3V6E B;  3CWI A;  2Y5B B;  4IWQ A;  2JYE A;  4EE2 A;  4ZYN A;  1D3Z A;  2IO3 B;  4RH6 A;  2REX A;  1WXQ A;  4GMV A;  5EE0 A;  3NVW A;  4MM3 A;  3Q8F A;  4C4V B;  1GOZ A;  3PZ8 A;  3AV8 A;  3VUX A;  1C4C A;  2KWU B;  3U7D A;  2MW5 A;  2WHI A;  4QAY A;  1WE7 A;  1XQQ A;  2QMT A;  2IO1 B;  2WDQ B;  3UQA A;  2K22 A;  1QLB B;  3ZO5 B;  2WXJ A;  4YT0 B;  4P1C C;  2FE8 A;  2K8H A;  2BYE A;  1GB1 A;  2N7J A;  1SE3 A;  4WWN A;  1R4N B;  2PKO A;  4NJC A;  4RFB A;  2N9E B;  2LUM A;  1T0Q C;  2W82 A;  3SFE B;  3RZF A;  1HE8 A;  4IW0 A;  1OEY J;  3Q6B A;  2JRH A;  1K8R B;  2XK5 B;  2JUO A;  3RNB C;  4MH8 A;  4GDL B;  2RD0 A;  2KFK B;  3IFW B;  4LNN A;  4II2 B;  1MHH E;  1TKG A;  2J0J A;  2Z0E B;  2IDY A;  2XEW A;  1I35 A;  1Y56 A;  5DCN A;  3CSF A;  4K3C A;  3VUY A;  4AJW A;  1QIL A;  1GNU A;  1MVK A;  4ANU A;  4J6I A;  1N60 A;  1XCT L;  2BYT A;  2XNA C;  4W9F A;  1LGR A;  2FUG 1;  2LVP A;  4DK5 A;  1BML C;  1TKE A;  3PRP B;  1V1O A;  2WXP A;  3AE7 B;  3VR9 B;  3TCA A;  3NS8 A;  5LXH A;  2L05 A;  2KLC A;  3DWG C;  3U52 E;  1P7F A;  3WAP A;  3QIJ A;  4JGH B;  2KX0 A;  4CO7 A;  2K3U A;  2KC1 A;  1FRD A;  3RN9 C;  4AUQ C;  3BK2 A;  3KYD D;  3W1Y A;  2A5U A;  2GBM A;  2XBB C;  3Q8B A;  4KIK A;  5TSS A;  1EU3 A;  5LXI B;  3L13 A;  3AE1 B;  2M0X A;  2QC8 A;  2IBI B;  2SEB D;  1GJZ A;  4KKJ A;  2V1Y A;  3ZKJ C;  3N1Y C;  1Q1O A;  3PLU A;  4IWO A;  2RDG A;  5E6P A;  4PK1 A;  1P1A A;  3SR6 A;  3A1Q B;  4PS3 A;  5C3J B;  2LXA A;  4BOS C;  2WDR B;  3X0W A;  3MHS D;  4EZL A;  4JX1 C;  4C4V A;  2LEK A;  3N30 A;  2D3G A;  4HPM B;  1WM3 A;  4TV3 A;  1FXI A;  1YX6 B;  1T0Y A;  1PGB A;  2KJH B;  2Z59 B;  4S17 A;  3UF8 A;  2WLB A;  3AE4 B;  2OJW A;  5HFY A;  5BMI A;  4RNA A;  2KHW B;  4ARI A;  3AU4 A;  1AYF A;  4YWG G;  2E3T A;  4DWF A;  2KJR A;  4GB9 A;  1A5R A;  3M3J A;  3BVG A;  2DZK A;  4XDC A;  2ZJD A;  3BY4 B;  4F7Z A;  1WGG A;  1JAL A;  3SEB A;  1C78 A;  3NHE B;  4A6Q A;  4HKQ A;  2HJ8 A;  4KZC A;  5KHO A;  1JRU A;  1KF6 B;  3QCA A;  4EFO A;  2XK5 A;  3TJP A;  2QHO A;  1QOB A;  4OZB A;  3M62 B;  4GDL A;  1K52 A;  2KFK A;  2BKF A;  3AE9 B;  3MJW A;  4EZK A;  5D6J B;  1ZW7 A;  1NBF C;  1SE9 A;  3H9D A;  2IZV B;  4FUL A;  5L95 C;  4JLC A;  1P9D U;  2ZVN A;  4GOC A;  3NZS A;  3NUH B;  3VRB B;  4DXF A;  4NZL B;  3QQ8 B;  1D5M C;  2BPS A;  1SE4 A;  5CTR C;  3H6N A;  2JVC A;  3ZNZ B;  4MJS B;  2KWD A;  3MJ5 A;  2K9X A;  3MC9 A;  1EF1 A;  3U4E G;  4YSZ B;  4E71 A;  3MC0 B;  3MFG A;  2VH2 A;  3VVW B;  3ZLZ A;  3OJ3 A;  3PRM B;  2MBH A;  3PT2 B;  3K9P B;  4ANW A;  2LGD A;  3NOB A;  2WNM A;  2MWS B;  2BB5 A;  4P1B C;  3ZQ4 A;  1J7B A;  2G4D B;  1E9M A;  1ZGU B;  3RD2 A;  3PHW B;  4GN1 A;  1HZ6 A;  4WIP A;  4B0E A;  1N63 A;  4XX5 A;  1E10 A;  2LI5 A;  2RPV A;  2EKE C;  2JWZ A;  4MSQ B;  2MJD A;  4HJK A;  4ANX A;  2DZI A;  4ZDV A;  1J7C A;  3BZD B;  1ZXH A;  4PT5 A;  2C5L C;  5AUK A;  3WAN A;  1WSP A;  1P7E A;  1EWC A;  1VZ7 A;  5FKA C;  4YSY B;  2MX2 A;  2GBR A;  2FCS A;  1WGR A;  1YJ1 A;  1RWS A;  2D2Q A;  4IUM B;  3NJT A;  4BBN F;  5D3I B;  3TSS A;  4K1R B;  2KWC A;  3T9L A;  1BT0 A;  1JWB D;  2AEH A;  1OQQ A;  2D3A A;  2OED A;  1KTK A;  2K8B A;  2JY6 A;  3P2B A;  5C23 A;  2WGS A;  4WAA A;  1WJU A;  4OZA A;  4DHZ B;  1G6J A;  5D94 A;  2M0A A;  3OWE B;  1WWT A;  1H8C A;  2CJN A;  3HHM A;  4KSK C;  4LK0 M;  1ZE3 D;  2GB1 A;  3L08 A;  1T0R C;  4I6L B;  1D4B A;  4K7W A;  4LNK A;  3A9K B;  4PYU A;  2N1V A;  3NVV A;  2YEP B;  2UU7 A;  2ZEQ A;  4G0N B;  2MCN B;  4O1N A;  1NYR A;  1EWY C;  4ZHO A;  1N61 A;  4I6N B;  5DPT A;  1HQR D;  2V0G A;  3VH3 B;  1FIQ A;  3JW0 X;  2C9W B;  4ZRP A;  1YQ3 B;  4ZYS A;  4ARC A;  1WGH A;  4A90 A;  3H8H A;  2RPQ A;  3CST A;  2QSD A;  4MJS A;  2AX5 A;  3D32 A;  3A4R A;  1UBI A;  4WJP A;  1E0Z A;  2C7N B;  1R4M I;  3DHH C;  4M01 A;  5AUI A;  2NTT A;  3AXC A;  4WQO B;  3EFC A;  3LXF A;  5E6J A;  5EDS A;  1FNV A;  3QJZ A;  1LXD A;  3E56 A;  1WZ0 A;  1F52 A;  5IP4 D;  3SU8 X;  1ET6 A;  3PZD A;  4MGY E;  2O2V A;  4AQ7 A;  1DOY A;  5T8I A;  3P1M A;  1C1Y B;  1MPE A;  2ZPN A;  3ZUN A;  4WWO A;  4M00 A;  3DOW A;  2QIL A;  4RMA A;  1C4P A;  1JWU D;  3JVZ X;  3ZVV A;  2DWQ A;  3ZNH B;  2VZK D;  1Q5W B;  4NQL B;  2JWU A;  3N1Z C;  4JQW C;  1SGH A;  2BS2 B;  2LJ5 A;  2I1J A;  2R2Q A;  1RRB A;  3DDC B;  2J7Q B;  1ISN A;  1L2N A;  3QWZ B;  3NY5 A;  5DPS A;  4A3P A;  1ENF A;  1XD3 B;  2JXX A;  3ZYY X;  1VR9 A;  1XCQ L;  2L00 B;  4WWP A;  3KW5 B;  4X57 B;  2M1M A;  3DBS A;  3KVF B;  5IOI A;  1L0Y B;  2JZP A;  3N20 C;  1L6U A;  4A3O A;  2J42 A;  1FXT B;  4IG7 B;  3CIR B;  4B95 A;  3AE2 B;  3M95 A;  3DBH B;  2ZCB A;  1XLO A;  3DHG C;  1V49 A;  2FNJ B;  2PE9 A;  2C60 A;  4W9I A;  3A9K A;  4FJZ A;  1IGD A;  4LJP B;  2WXH A;  3V05 A;  3TEX A;  3J9C A;  3TL5 A;  4GDK B;  2KAC A;  2L0F A;  2TSS A;  2MH7 A;  2ON8 A;  2LUE A;  2LMC A;  1TS2 A;  4UDU C;  5HKH A;  2PE6 B;  3KH0 A;  3AN1 A;  4RM8 A;  3LYY A;  2KD0 A;  2IGG A;  1FEH A;  1YJJ A;  2LVQ A;  3ZXV A;  1R4N I;  1WZ3 A;  1ZP0 B;  3IVF A;  1KLV A;  2OHF A;  4WJO A;  1V80 A;  3Q8E A;  4LNI A;  1LFD A;  2N7E A;  3ZGZ A;  3PO0 A;  2PJH A;  2KC2 A;  2M4N A;  3BIN A;  2BS4 B;  4MGK E;  4RM9 A;  3L54 A;  5LLI A;  3QHT A;  1SBB B;  3H7S A;  1T3Q A;  1GC6 A;  2HTM E;  2J4X A;  4XYC A;  3DHI C;  2DAJ A;  4MH0 E;  4TQ1 A;  3VRA B;  1Z2M A;  2WXM A;  4BZA A;  2MP2 B;  1CMX B;  1TY2 A;  1J0G A;  1F77 A;  4HVB A;  3KYC D;  2M8S A;  1QOG A;  2KKC A;  1QQR A;  3PTF C;  5D7G A;  3JSV A;  2W3R A;  1L4Z B;  3VAW A;  4L1B A;  4W9H A;  5TR5 A;  4M02 A;  1QZE A;  2MHJ A;  3DPD A;  3P42 A;  3AUL A;  4M8M A;  1ZPS A;  3X23 A;  4WJN A;  4K7S A;  1E8Z A;  1J19 A;  5FK9 C;  5DPW A;  2KLG A;  3MTN B;  1OEY A;  3EA6 A;  1RYJ A;  2CHZ A;  2Y5P A;  2JSV X;  4W9J A;  1WH3 A;  3UGB B;  3B0A A;  1CJE A;  1XO3 A;  2MLB A;  3ZRC A;  2IO2 B;  1RFA A;  1JRO A;  1WE6 A;  2H88 B;  4URK A;  4MT5 A;  2HTH A;  1N6Z A;  5J2R A;  5G55 A;  2KFJ A;  2EKI A;  4C80 A;  4A9A A;  4EUT A;  2KZR A;  2CU1 A;  3FAH A;  4J3O D;  1MFW A;  3HVZ A;  1HZ5 A;  4IKG A;  2ZZP B;  4N59 A;  1LO5 D;  3AEF B;  5HI1 A;  4KGR A;  4KGS A;  4WUR A;  3ZJV A;  2L7R A;  2NMQ A;  2L3Z A;  3OJ4 B;  1DYQ A;  2BT6 A;  2KVR A;  1JRP A;  3R66 C;  2EEL A;  4GDK A;  2MBE A;  4JL9 A;  3WCQ A;  1M94 A;  2FAZ A;  3SFD B;  2J52 A;  1YMH E;  4HKZ E;  4XZ4 A;  4NJ7 A;  4ACF A;  1KOT A;  5MPO A;  3AEC B;  3AM9 A;  3VXW A;  3RNF C;  3HM6 X;  3ZJU A;  2JQR B;  4KDL B;  2KDE B;  2R61 A;  1E6E B;  4US8 A;  3BII D;  2BVC A;  1UNS A;  3BK1 A;  2BKR B;  3VH4 B;  4W9L A;  5DPR A;  4RGO S;  2CR5 A;  1UGM A;  1CQV A;  3IXS A;  3Q14 C;  1L0X B;  2UWQ A;  2W3S A;  1ZDV A;  2LWP A;  1WX7 A;  2LGI A;  2N1W A;  1ET9 A;  1ZUD 2;  2KYW A;  2N9P C;  5JHB A;  4YSX B;  4OVV A;  2G3Q B;  1WY8 A;  2DBY A;  5BYQ A;  1YQB A;  2MP2 A;  2MSE D;  3ENE A;  4KX6 B;  3Q3F A;  4LLG M;  2M17 A;  2KVZ A;  4GIV A;  3V61 A;  3ZW3 A;  2M56 B;  3PHX B;  3PPA A;  1D5X C;  2ZPY A;  1TTN A;  2YVC A;  5LNK 1;  1TGZ B;  2MBO A;  1K53 A;  1SEB D;  3FC4 A;  1XXG A;  3NVZ A;  4ASW C;  2ZCC A;  4W9E A;  2K25 A;  3RPF C;  3DBR B;  2D3B A;  2JPH A;  2PMV A;  1KFY B;  2O6V B;  3BYY B;  3R7R A;  2WYQ A;  1UEL A;  1SIJ A;  1TZO A;  1F9J A;  1OQY A;  2FCQ A;  5CHW A;  1STE A;  2DNF A;  3GOE A;  2KJ6 A;  1XLP A;  2WP9 B;  3PLV A;  4MAC A;  5FR3 A;  4HJG E;  3V60 A;  2WX1 A;  1K51 A;  2NBW B;  4JE3 B;  4A8X C;  1YD8 U;  3WIM A;  1SE2 A;  1UUP A;  1J8C A;  3RUL A;  2IJ0 A;  1I4G A;  1CZP A;  1V8C A;  3QC8 B;  3GB1 A;  4WH4 A;  3P4P B;  1TKY A;  3ZNG C;  2J0K A;  3Q8A A;  3VTV A;  4RGN A;  4KDI C;  1NDD A;  4FN2 A;  4P16 A;  3DWM A;  1WR1 A;  4BKG A;  4HXD A;  1GC7 A;  3HVD A;  2K8C A;  4RGT A;  3T3N A;  4P6V F;  3NRZ A;  2PEA A;  3VHT C;  3PRZ A;  5H92 C;  3KUZ A;  5HHD G;  3I5J C;  1NYQ A;  3W1S C;  3I57 A;  3Q3O C;  4BFR A;  1RAX A;  2ACZ B;  5CHV C;  2NCN A;  1JW9 D;  4BOZ B;  3E9S A;  4JIO U;  1V86 A;  4LNF A;  1GB4 A;  2ZW1 A;  1Q10 A;  4HDO A;  2L83 A;  2UYZ B;  3QAQ A;  3A1Q A;  4E74 A;  1F1H A;  4PYZ A;  4DXG A;  2KN4 A;  4BKS D;  1FD6 A;  1D6E C;  1FNU A;  1EF5 A;  2MJE A;  2WDV B;  4KGT A;  4G11 A;  2KMA A;  5IAA C;  4TUU A;  1V6E A;  3NZU A;  2VH1 A;  3IHP C;  2KAJ A;  3PGE A;  3W5U B;  2CU3 A;  1WX8 A;  3ONS A;  3EGR A;  2LFI A;  1IP9 A;  2V4I B;  1N62 A;  1DOX A;  2G45 B;  2BYF A;  4LNO A;  1N5X A;  3VUW A;  3UIO B;  2WXL A;  2DYM A;  3RNG C;  1I4H A;  3FIL B;  2XN9 C;  5L83 A;  3RNE C;  2DZM A;  4OZC A;  4IC7 B;  1P0R A;  2K39 A;  2O6V A;  2DX5 B;  3TIX A;  5AZF A;  1WXS A;  1UGJ A;  3EC8 A;  3EHV A;  2AYO B;  3ZDT A;  4FLH A;  3V6C B;  5FR6 A;  4FA6 A;  1FCC C;  3IAM 1;  1TBE A;  3ETR A;  4FAD A;  5J17 A;  4XC2 A;  1WXM A;  1JWM D;  2NPT B;  3LJ3 A;  4ANV A;  2G9H D;  2HJ1 A;  3KWL A;  3GP7 A;  3AEB B;  3Q3N C;  4IOI E;  4IM2 A;  1ZKH A;  1BUI C;  3TUO A;  1E8X A;  2NBV B;  1I4R A;  1V97 A;  2BYV E;  1SJH D;  1PGA A;  2KWV B;  2D07 B;  4LDT B;  1WM2 A;  2KTF A;  2KOX A;  3UIP B;  3GE3 C;  2LD9 A;  2Z0D B;  1V2Y A;  1NVI D;  1FCL A;  2V4L A;  1WGY A;  1PFD A;  3MP9 A;  3C0R B;  4FHJ A;  1MI0 A;  4LTU A;  2N9L A;  4ZOH C;  3PV1 A;  1AW7 A;  2KX3 A;  2KO3 A;  4EEW A;  3DBH I;  1WX9 A;  4GSW A;  4DHJ B;  2QIE B;  4MEM A;  3ZRF A;  1TIF A;  1EO6 A;  2GBN A;  3U7Z A;  5BYR A;  2WXG A; 
#chains in the Genus database with same CATH homology
 4F1S A;  3I3T B;  2DAJ A;  4MH0 E;  2IBI B;  4TQ1 A;  2G4S A;  1Z2M A;  4E3C A;  3ECI A;  3DVN V;  3Q3J A;  3TBL D;  4B6W A;  1GJZ A;  2V1Y A;  3APD A;  3ZKJ C;  4GU2 A;  5E6N A;  4LDT D;  1Q1O A;  3A4S C;  3PLU A;  2MP2 B;  4IWO A;  1AAR A;  1CMX B;  5E6P A;  4F8C B;  1J0G A;  1P1A A;  2D11 A;  1XT9 B;  2FID A;  3A1Q B;  2D10 A;  3A9J A;  5IA7 A;  4PS3 A;  4HVB A;  3KYC D;  2M8S A;  5D2M B;  1WMH B;  2LXA A;  4BOS C;  3OLM D;  3X0W A;  3MHS D;  3DQV A;  3VDZ A;  2KKC A;  4EZL A;  5G2N A;  1X1M A;  2OOB B;  3PTF C;  1LQB A;  3N30 A;  4KSL C;  5D7G A;  1V81 A;  2D3G A;  3JSV A;  3VQI A;  4FJY A;  1WRD B;  4WJQ A;  3VAW A;  4HPM B;  4W9H A;  1WM3 A;  4TV3 A;  5TR5 A;  1QZE A;  1YX6 B;  1T0Y A;  3DPD A;  4M8M A;  2KJH B;  3AUL A;  3X23 A;  4WJN A;  1KJT A;  4K7S A;  4AP4 C;  4DDG D;  2Z59 B;  2DEN B;  2K6D B;  4K81 A;  3UF8 A;  3PSE B;  2FCM A;  4DHJ D;  1E8Z A;  3TMP B;  2L0T A;  2A4Z A;  2FIF A;  1J19 A;  2LRU A;  5DPW A;  2KLG A;  2KHW B;  3ZTC A;  3MTN B;  1OEY A;  3AU4 A;  2CHZ A;  4W9J A;  3UGB B;  1WH3 A;  3B08 A;  2BWF A;  3B0A A;  3IBE A;  4DWF A;  1UBQ A;  2KJR A;  4GB9 A;  1A5R A;  3M3J A;  3QK0 A;  1MG8 A;  2DZK A;  2MLB A;  2ZJD A;  3QX1 A;  3ZRC A;  2KXJ A;  4ICU A;  2IO2 B;  3BY4 B;  4P7I A;  1RFA A;  1WE6 A;  4IM3 A;  4F7Z A;  4URK A;  1WGG A;  2HTH A;  3VTU A;  5J2R A;  5G55 A;  2KFJ A;  4HLE A;  1UH6 A;  3NHE B;  1E7U A;  1WFY A;  4G3X B;  2HJ8 A;  4KZC A;  2LAS A;  5KHO A;  4EUT A;  3B1L X;  2KZR A;  2CU1 A;  1JRU A;  3QCA A;  4EFO A;  2NBU A;  2XK5 A;  2ZVO A;  4KVG B;  2QHO A;  3TJP A;  3M62 B;  4GDL A;  2MRP A;  2ZZP B;  4M0W B;  2KFK A;  2BKF A;  3DVG Y;  3VTW A;  2IYD B;  3ML9 A;  3MJW A;  3OAW A;  4EZK A;  5D6J B;  1ZW7 A;  2DAF A;  3R7Q A;  1NBF C;  2MBB B;  1SE9 A;  2L7R A;  3H9D A;  2IZV B;  4FUL A;  5L95 C;  2K6Q A;  4JLC A;  3W1S A;  1P9D U;  2ZVN A;  4GOC A;  2L3Z A;  3NZS A;  5CHF A;  1LM8 B;  1WYW B;  3S2A A;  2NPT A;  3OJ4 B;  2KVR A;  2NS5 A;  3R66 C;  3QQ8 B;  4GDK A;  4HDQ A;  1RLF A;  3ZNI D;  4ZRI A;  2MBE A;  1S1Q B;  4JL9 A;  5JZE B;  2BPS A;  1M94 A;  4M8N A;  3SDL C;  5CTR C;  2FAZ A;  2JVC A;  3H6N A;  3ZNZ B;  4MJS B;  2BF8 B;  4XZ4 A;  1EF1 A;  3DCG A;  4NJ7 A;  4KZ0 A;  1WIA A;  2R2O A;  5JHA A;  1U4A A;  4E71 A;  1KOT A;  3VVW B;  3ZLZ A;  2BGF A;  3UIN B;  1OTR B;  3VXW A;  2C7H A;  4BKS A;  3OJ3 A;  3HM6 X;  3PRM B;  4OVU A;  2EMT A;  4KDL B;  1IYF A;  2MBH A;  2KDE B;  3K9P B;  3PT2 B;  4ANW A;  2LGD A;  3NOB A;  2LXC A;  3AI5 A;  2AL6 A;  4W9G A;  2MBQ A;  4KV2 A;  2V3S A;  3JYU A;  2KNB A;  4FBJ B;  2MWS B;  3CMM B;  4HCN B;  2BKR B;  3VH4 B;  5JH5 C;  4NAW A;  4W9L A;  5DPR A;  3SD5 A;  2G4D B;  2DHZ A;  3IG3 A;  1ZGU B;  3AU5 A;  4B9K A;  2CR5 A;  1UGM A;  2JT4 B;  2LVO A;  2CHX A;  3RD2 A;  4W9K A;  4NNJ B;  3PHW B;  2JRI B;  4GN1 A;  3PVL A;  3WAM A;  3HIZ A;  4XX5 A;  2CKH B;  2LI5 A;  2KQS A;  2UWQ A;  2EKE C;  2JWZ A;  2LWP A;  1WX7 A;  3ZTD A;  1SIF A;  4MSQ B;  3PRE A;  4CYE A;  2N1W A;  4HJK A;  2RSU A;  2GOW A;  3L16 A;  5J18 A;  4ANX A;  4MEL A;  2DZI A;  4ZDV A;  2N9P C;  5JHB A;  4TQ0 A;  4OVV A;  2G3Q B;  3ALB A;  3RUI B;  1WY8 A;  2HE7 A;  4NQK E;  1WJ6 A;  1YQB A;  2MP2 A;  2W9N A;  2MSE D;  3ENE A;  2C5L C;  4YL8 A;  2ZNV B;  2BWE S;  1E8W A;  2LZ6 A;  3WAN A;  1YX5 B;  3Q3F A;  4LJO B;  1WMH A;  2DYB A;  2M17 A;  3JSV B;  3K9O B;  4GIV A;  1TZ1 A;  3V61 A;  3ZW3 A;  2MX2 A;  3WAO A;  2GBR A;  2I1K A;  1WXA A;  2FCS A;  2IY1 B;  2ZPY A;  1WGR A;  3N3K B;  3PHX B;  1YJ1 A;  3PPA A;  4ZRJ A;  1TTN A;  2YVC A;  2WWZ A;  1Z5S B;  2D2Q A;  1YIW A;  4IUM B;  2FCN A;  1E8Y A;  3A33 B;  5AZG A;  4BBN F;  2N9X A;  2KDI A;  4K1R B;  2KWC A;  1L7Y A;  3ML8 A;  2JF5 A;  3T9L A;  1TGZ B;  1BT0 A;  2MBO A;  4HWI B;  2AEH A;  2CHW A;  4IM0 A;  3R3M A;  2MQJ A;  2K8B A;  2JY6 A;  2WDT B;  1V9J A;  2ZCC A;  2KAN A;  3PS6 A;  4W9E A;  4ASW C;  4DDI D;  4EZJ A;  3P2B A;  5C23 A;  3QA8 A;  3RYT A;  2KQ7 A;  2K25 A;  4WAA A;  1NI2 A;  2JPH A;  3QAR A;  4DBG A;  1WJU A;  1WF9 A;  2O6V B;  1WGD A;  2IY0 B;  1WXV A;  3R7R A;  2GBJ A;  2KMC A;  4DHZ B;  5D94 A;  1G6J A;  1GG3 A;  1WJ4 A;  2WYQ A;  1UEL A;  4MSM B;  1H8C A;  4DHZ E;  1F9J A;  1OQY A;  3HHM A;  2DZJ A;  2FCQ A;  1S3S G;  4K7U A;  4KSK C;  5CHW A;  4BKT A;  3GZN I;  3GOE A;  4I6L B;  3L08 A;  4MGI E;  2KJ6 A;  4K7W A;  4BVU C;  2RGF A;  3A9K B;  2ZNV C;  2GMI C;  4LCD E;  4PYU A;  3V62 A;  2AWT A;  4CHK A;  3PLV A;  2N1V A;  2FUH B;  1PQS A;  2NVU I;  2ZEQ A;  1H4R A;  3H1U A;  1Y8R C;  4G0N B;  2GBK A;  2MCN B;  3L0W B;  3RT3 B;  3RCZ A;  1VCB A;  2OJR A;  3V60 A;  3DVN U;  1V5T A;  2KK8 A;  2WX1 A;  3EFU A;  3DVG X;  2IO0 B;  4NY0 A;  2NBW B;  3WA0 A;  2HD5 B;  2N7D A;  3RZW C;  2L76 A;  4MDK E;  1YD8 U;  3WIM A;  2KDB A;  3UQB A;  3M63 B;  4I6N B;  4MGZ E;  1J8C A;  4G50 A;  3RUL A;  1KM7 A;  4AJY B;  1WR6 E;  3HK0 A;  3O65 B;  5DPT A;  4AOF A;  3EEC A;  2KTR B;  2N4F A;  3QC8 B;  3U30 A;  3VH3 B;  3JW0 X;  2C9W B;  3KUC B;  2L8J A;  3L10 B;  1E90 A;  2O6V D;  3ZNG C;  1WGH A;  2RPQ A;  3CST A;  2J0K A;  2PPH A;  4MJS A;  3VTV A;  3ZDM C;  3D32 A;  4HCP B;  3A4R A;  4KDI C;  1UBI A;  1NDD A;  3DBR I;  4WJP A;  3H7P B;  2C7N B;  1R4M I;  4FN2 A;  4HK2 A;  1E7V A;  4FHK A;  2DYO A;  1WR1 A;  3AXC A;  4BKG A;  2MA9 B;  4HXD A;  4WQO B;  1GC7 A;  1UD7 A;  2K8C A;  3CF6 E;  4FJV B;  5AEK B;  2WX0 A;  5EDS A;  4W9C A;  4KIK B;  3L17 A;  2C7M B;  2PEA A;  4HPL B;  3QJZ A;  1LXD A;  3VHT C;  4EKU A;  3PRZ A;  3KUD B;  3KUZ A;  1WZ0 A;  3HM3 A;  4NJ6 A;  1P3Q U;  3SU8 X;  3PZD A;  4MGY E;  3APC A;  2AL3 A;  2O2V A;  3W1S C;  4EOY A;  2B3A A;  1C1Y B;  2ZPN A;  1GUA B;  3V6E B;  3ZUN A;  1RAX A;  5CHV C;  4BFR A;  2NCN A;  4WWO A;  4A20 A;  2Y5B B;  3DOW A;  4IWQ A;  4W9D A;  2EMS A;  4BOZ B;  4JIO U;  1V86 A;  4ZYN A;  1D3Z A;  4RMA A;  2IO3 B;  4HDO A;  2REX A;  4GMV A;  3A9J B;  4MM3 A;  2UYZ B;  1I42 A;  3QAQ A;  3A1Q A;  1VD2 A;  3JVZ X;  3ZVV A;  4E74 A;  3ZNH B;  2RR9 A;  4PYZ A;  1Q5W B;  2NR2 A;  1WJN A;  3VUX A;  4BKS D;  5C1Z A;  2KWU B;  1EF5 A;  4NQL B;  3U7D A;  3WAL A;  4G11 A;  4DXA B;  1IPG A;  2KMA A;  2MW5 A;  1P98 A;  4JQW C;  1SGH A;  5IAA C;  4TUU A;  4AWJ A;  1V6E A;  2LJ5 A;  1WE7 A;  2I1J A;  3NZU A;  4ICV A;  1XQQ A;  4GGQ A;  2IO1 B;  3IHP C;  3PGE A;  2R2Q A;  1RRB A;  3UQA A;  3LDZ E;  3DDC B;  1WX8 A;  2LGX A;  1EUV B;  3ZO5 B;  4N9F 4;  2J7Q B;  1ISN A;  1L2N A;  3ONS A;  4II3 B;  4ZRK A;  3APF A;  3QWZ B;  3NY5 A;  5DPS A;  2K8H A;  4A3P A;  4IWP A;  2BYE A;  1XD3 B;  1IP9 A;  3VFK A;  2JXX A;  4WWN A;  1OGW A;  2L00 B;  2G45 B;  2BYF A;  4WWP A;  1C3T A;  3VUW A;  3KW5 B;  2N9E B;  4X57 B;  2M1M A;  3UIO B;  3DBS A;  2CS4 A;  3KVF B;  2DYM A;  5L83 A;  2DZM A;  5E6O A;  1UZX B;  4IC7 B;  1P0R A;  3RZF A;  4A3O A;  1FXT B;  1HE8 A;  4IW0 A;  2LRW A;  2K39 A;  1OEY J;  2O6V A;  2DX5 B;  4IG7 B;  2JRH A;  1K8R B;  3TIX A;  2XK5 B;  4B95 A;  2JUO A;  5AZF A;  4GXB A;  1WXS A;  3EC8 A;  2RD0 A;  2AYO B;  3EHV A;  3M95 A;  2KFK B;  3IFW B;  4FLH A;  4GDL B;  4NPN A;  3V6C B;  3ZDT A;  4I6P A;  2ZCB A;  4II2 B;  5FR6 A;  2J0J A;  2Z0E B;  2XEW A;  1V49 A;  2FNJ B;  2KN5 A;  4FA6 A;  2PE9 A;  2C60 A;  1I35 A;  4W9I A;  2KDF B;  1TBE A;  3A9K A;  5DCN A;  4FJZ A;  2LGY A;  3CSF A;  4FAD A;  4PS8 A;  4PS7 A;  5J17 A;  4LJP B;  4XC2 A;  2JZZ A;  2ASQ A;  1WXM A;  3VUY A;  2NPT B;  4AJW A;  1Q0W B;  3TL5 A;  3LJ3 A;  4GDK B;  2L0F A;  3ZIM A;  4ANV A;  1GNU A;  2LUE A;  5HKH A;  2PE6 B;  3KH0 A;  4J6I A;  4ANU A;  4IM2 A;  4RM8 A;  1ZKH A;  3SHQ A;  1E5W A;  1E8X A;  2KD0 A;  2NBV B;  2YLM A;  4W9F A;  2BYV E;  5GMV A;  1WI0 A;  2LVQ A;  2KWV B;  4BBN C;  2D07 B;  4LDT B;  2KTR A;  1WM2 A;  1R4N I;  1WZ3 A;  2LVP A;  4DK5 A;  3N32 A;  3IVF A;  1KLV A;  2K1F A;  2KTF A;  3PRP B;  4WJO A;  3TCA A;  2KOX A;  1V80 A;  3NS8 A;  5LXH A;  3UIP B;  2L05 A;  2KLC A;  2LD9 A;  2Z0D B;  1V2Y A;  2VRR B;  3WAP A;  1LFD A;  2N7E A;  2V4L A;  1WGY A;  3DBL I;  3H7P A;  3QIJ A;  2KX0 A;  4JGH B;  3C0R B;  4FHJ A;  2PJH A;  2KC2 A;  2KC1 A;  4CO7 A;  4NAW B;  4AUQ C;  3U8Z A;  5BO4 B;  3KYD D;  2M4N A;  3W1Y A;  3BIN A;  3PV1 A;  4MGK E;  4RM9 A;  2KX3 A;  2A5U A;  2KO3 A;  3T8M A;  3L54 A;  2GBM A;  4TKN A;  5LLI A;  3DBH I;  1WX9 A;  4EEW A;  1V5O A;  2XBB C;  3QHT A;  4GSW A;  4KIK A;  3H7S A;  5AZH A;  4DHJ B;  2J0M A;  4MEM A;  2JZ3 B;  1GC6 A;  3ZRF A;  5LXI B;  1EO6 A;  2GBN A;  5CX3 A;  3L13 A;  2O2V B;  5KHQ A;  2M0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...