3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
b'HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like Protein
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
4UDUC 1TS3A 1LT3D 1LTBD 1LT5D 1PRTD 2AQ1B 5ELDA 1L0XB 5ELCA 1RF2D 1TY0A 4OHJA 3DWQA 3KLSX 1KLUD 1D5ZC 1V1PA 3MC0B 2TSSA 1KTKA 4NZLB 1V1OA 1UUPA 4DXFA 1T5XD 1I4HA 3URYA 4Z9CB 1JR0D 1PZKD 3OWEB 3BYYB 3W2DA 1V1PB 1LTAD 1I4XA 1D5XC 1PTOF 4RFBA 1EWCA 1S5CD 2IPKD 2QILA 1KLGD 2XRQD 1PTOC 1PTOB 2WV6D 4L6TB 1EFID 1DJRD 5FK9C 1CHPD 1EU4A 1PTOD 1SJED 4O1NA 1QILA 1PYWD 5TSSA 2O2LD 1RDPD 1LTTD 3GP7A 1JQYD 1CT1D 4RHRA 1I4PA 3CHBD 1CQVA 1SEBD 1MD2D 1JWUD 1SE2A 4RH6A 2AQ3B 2NTSA 5ELFA 1EU3A 1CHQD 1LO5D 2QEJC 1LTRD 1FNWA 5D3DA 1AN8A 1I4GA 1TS5A 3SEBA 2RDGA 1SBBB 1S5BD 1S5ED 1BXTA 2AQ2B 2RDHA 3EFXD 1LLRD 2IJ0A 1FD7D 1FNUA 1RD9D 1LT4D 4C56C 1S5FD 5I4DA 1HTLD 3MFGA 1SE4A 4RGTA 1JWMD 4ZYSA 1STEA 1S5DD 1FNVA 4RGMA 2NTTA 3O13A 2XN9C 3R2TA 1EEID 1TS4A 1YN4A 3BVGA 4K6LA 1YN3A 1L0YB 4DXGA 4RGOS 1JCKB 1B44D 1BCPF 1PTOH 1ENFA 2XNAC 3R8BA 1LTID 2Z8LA 1BCPC 1EEFD 1SE3A 1BCPB 1LTGD 1SXTA 1TY2A 1BCPD 4RGNA 3BVMA 1HA5A 1I4RA 4TSSA 1YN5A 3EA6A 2CHBD 1F77A 3BYTB 1UNSA 1DYQA 3DWAA 1GOZA 1I4QA 4RCOA 1G8ZD 1M4VA 1AW7A 1D5MC 3V05A 3BZDB 2XRSD 1CK1A 3DWPA 1B1ZA 1JWSD 1PZJD 2R61A 3R2IA 1HXYD 2SEBD 1FGBD 1TS2A 5ELBA 1ET6A 1SJHD 1HQRD 1XTCD 1LTSD 4L63B 1D6EC 1ET9A 1RCVD 1PZID 2J4XA 3TSSA 3BVZA 2ICIA 1ESFA 5ELEA 1PRTF 4BWGB 4RHSA 5D3IB 5FKAC 1LT6D 2G9HD 1XXGA 1PRTC 1PRTB
chains in the Genus database with same CATH superfamily
4E3CA 4K3CA 3UGBB 5IGDA 4DDID 1IHZA 1TWCB 1ENCA 2OWOA 2WU5B 2MW5A 4HJ8A 1XQQA 3IT4B 1PH9A 4PZ6A 1ZXHA 1KRSA 1CM9A 3Q8BA 3P4QB 1KLVA 3EQLC 3OPOA 4NZLB 2WXPA 4K8JA 1UGJA 2H1EA 1I4HA 2N78A 3H6NA 4X3TA 1JR0D 2Y0SG 3TEHB 3L0WB 4DAYB 4IJHA 3L16A 2F0HA 5EKLA 1J8CA 2FMMA 4C4VA 1EF1A 3I4NH 4XYOA 4BBRG 2LMCB 2E5LL 3ICEA 5CV5A 4OWXB 3KF8A 2L0TA 1AE2A 1CZWA 3WOEA 1E22A 4N59A 1RTNA 2RKSA 3CU7A 4KK7A 4FA6A 4O1NA 2IWHA 2ATWA 4HMJA 2JA5G 4JOIA 1RDPD 2KDIA 1T9HA 4KDLB 3KUZA 1STHA 2KECA 2K5WA 3RNAC 3SFDB 1CQVA 2BWES 4HWIB 2KFKB 3H91A 2X8XX 5E6JA 2L8JA 2PLPA 3JAMc 3NVZA 3AH7A 4H02A 3ND8A 4A3DB 2KEEA 2KD0A 1V43A 1TXYA 3KVFB 1NTGA 2R7DA 1ZP0B 1H9KA 3FP9A 1JWAD 3LB8C 4JI2L 2HUGA 2BH2A 2PPBC 4KKUA 3S1NH 1NBWA 2VS1A 2ZJPA 5CV6A 2NB0A 4KY5A 5HURA 4CO7A 5EDSA 3PS6A 2VQEL 4WRDA 1CFMA 1P98A 3VDYA 4AOFA 2ZM6L 4JI5Q 3I7FA 2F0WA 2J0TD 4DUZL 5AJ3Q 4A3EB 1E8YA 1KNAA 5L37A 3Q23A 1CKOA 4ZRPA 3T8MA 3TBIB 4A3LG 1K83B 1IP9A 3S24A 5FO7B 4IJLA 1QZGA 2SNMA 3U58A 4KD3A 4OVZA 1Q12A 1UWMA 1Q7YC 1L4ZB 2DNCA 2PO4A 4URKA 1B3QA 2LRUA 1G6JA 3D6WA 1TWAH 1QB5D 5T1IA 1FD6A 4HEA1 2QA4A 2B2TA 1JWBD 4RF1A 2B8FA 4X65L 2WQYB 1TT2A 3TEWA 4LFBQ 2EDGA 1KD1C 1ZUD2 5D6JB 1QE6A 3KLWA 3RR5A 4K7WA 3GDEA 4DV1Q 2FINB 2AHOB 2JA7H 3HOWG 4KZ0A 1ISNA 2BDNA 4KY7A 1ZDXA 3DWAA 2D07B 4F8CB 4EQ5A 3Q22A 3P7JA 3S1NB 1YI2A 1JOKA 1TWGH 4J8QA 2EOTA 3K8AA 3FPPA 3RD4A 4DNRB 1YOVB 2L9HA 4AIMA 3J7ZC 1XTDA 1PH7A 3PO2B 1UBQA 4B08A 1L2FA 4AP4C 2VQFQ 1AP0A 3OW7A 3QIAA 4DA2A 3RZDH 2RPQA 4F88A 3S2DH 3BVZA 1YHQA 3H8HA 3ZJYC 1Q1OA 1SYEA 2RSNA 1RJTA 2QMTA 4C00A 5AEKB 2LFIA 2G45B 1O7ZA 2VRRB 1LT6D 2VL6A 2MLBA 1PRTC 3N20C 1Q1EA 2FXQA 1YQ3B 3Q69A 3IFDA 3DCGA 4JBWA 2CHZA 3JSVB 1STBA 3NVYA 2BTEA 1FEHA 1MBYA 3OSOA 2JA7B 2M17A 3MC0B 1AWDA 1LABA 1HHVA 1SNMA 1VQLA 3AYHB 3FHWA 4DK1A 1IBKQ 2G1EA 3FILA 4FHJA 1IZ6A 3VXWA 4BZAA 2EJFC 2UUAL 1XLNA 5C4XH 4G50A 1TWGB 3S2AA 5HGTA 3T3OA 2LXAA 4A76A 1PTOB 3DVNV 3ZKJC 3LWUA 3RZDB 4BA2I 2KNBA 4WJPA 2B63G 2NBWB 5M5WH 1XF5L 3CC7A 4LNFA 4EGVA 3L9AX 3Q3JA 4LNNA 4LWCA 5AUKA 3ND9A 2R93H 1EIHA 1C4QA 4RHRA 1RL2A 4ZLTF 1VMPA 5CV8A 4LF6Q 1WCMB 1JWUD 4K5VA 2LY7A 1N32L 4HPMB 4RH6A 1QZHA 2LKVA 1H95A 1KDAA 4R4IA 5DNFA 3MAQA 2LZ6A 3ENEA 1A3UA 5D2MB 1LLRD 4FXKC 1TKYA 3AE3B 3T16A 2YVCA 3WWVA 3EN2A 4DR1L 4DDGD 1CQFA 4DV6L 2GMIC 3SK4A 4YHHL 1OO9B 5IWAL 1W2BA 4BAXA 4MGIE 2EY2A 4TKOB 4XDXA 5BMGA 3WA0A 3HGBA 3A5ZB 2LXKA 4YY3Q 1WYWB 2IO3B 5M3MG 3DHQA 3Q8EA 2F4VL 5AFWA 1PFSA 1UE5A 1PGBA 1EY6A 3PLVA 3I8ZA 2F0DA 3ULPA 2WFWA 4K7UA 2ZXOA 2EXDA 3SGIA 4AH6A 3GTPB 1JMLA 1WTPA 1FRRA 4PZ7A 5FJ8G 4KVGB 2KHWB 2WB1B 1JCKB 1N36Q 1IBMQ 4X66Q 3IBEA 4G4KA 2LWPA 2AYOB 5DPWA 1E1OA 2IY5B 2NN6I 3IRBA 1VQDA 2XWJB 2NPTA 3NTIA 3AXCA 2N55A 4HJGE 4DBGA 4JYAQ 2XSCA 1Z2MA 3JC66 1KF6B 1SE9A 1DGJA 2DZMA 2PCFB 5EGTA 1T0YA 2K6AA 1WTXA 3R7QA 2I5LX 3A4RA 4HSVA 1QJOA 1UH6A 4XX5A 3DWGC 1F9RA 4LNQA 1EO6A 5IGGA 1WM2A 3PO3H 1S3SG 2E2DC 1SNQA 2XRSD 1XCQL 2N9PC 4XGAB 4RM9A 3OTOQ 2EPBA 3DWPA 3T1YQ 4ME5A 1TS2A 3V6EB 3NBHB 1E9MA 4WQOB 2RGFA 3HKSA 2KENA 1VQKA 4BS9A 3RYTA 1PGXA 3BIID 1KABA 3EECA 1LTLA 2DENB 3P4PB 2AWNA 1ZKOA 5IT9c 3LWEA 5IGCA 1C1YB 1PGAA 4KHVA 3RULA 3ZTCA 3QA8A 3AMUA 1QQRA 1IUEA 5H8YE 1QKZA 2BPSA 1JW9D 1TS3A 2R6GA 3H3VI 2NZ1D 4QY7A 1V8CA 5ELOA 4W9DA 2GVBA 2DNEA 4P73A 4U68A 2UXBQ 1EFWA 2ZT9C 1XMQL 4KI0A 1E3PA 2NN6G 4OWTB 4C3HG 1H9SB 1B9NA 4Z9CB 1J7CA 2OCEA 1AFPA 3K7AH 3TP5A 3PO3B 4DFAA 1H4RA 2PIAA 3H7PA 3H9DA 2RSUA 1HZ6A 2KYWA 1J8IA 1T5EA 1SSOA 1YJWA 2B2VC 2I0QA 4FADA 4YWLA 3DBRB 3CCQA 4R4TA 1IL2A 4A3CH 1DJRD 1F9QA 1X1MA 4P1BC 2XTIA 3M7NA 1B70B 1SJED 3DUZA 1MFWA 1QILA 2RVLA 4JI4Q 1QOBA 3HRZC 1ZXIA 3P4SB 1LTTD 1DOMA 5G5HA 2BOSA 5C3XA 4HK2A 4N8FA 3TREA 2Z6KA 1R4NB 1BDOA 1VZ8A 3W3AA 4DV4Q 3AECB 1A3VA 1SGHA 1EU3A 1WX9A 1E2VA 3P1MA 3N9YC 5GMVA 3QARA 2MHVA 5C0XI 1Z5SB 1WXQA 2PMZE 2K33A 3OG5A 3R7RA 1ASYA 3T4AC 1W6JA 1WVLA 2WAQB 2JEAI 2KJHB 4FHKA 2L0CA 1I94L 3ABVB 4YSZB 4EKUA 3PVLA 1ZYRC 5IP7H 3LGJA 3K7AB 3U4EG 4JVZA 1BBWA 4DUYL 1KAAA 5HGQA 4HCSA 4FJVB 2HDEA 4AYBE 2ZTDA 4F7XA 3RT3B 1KRTA 4BY7G 4KKTA 1TBEA 1UF0A 2EJGC 1SYDA 2FCNA 4GLAC 3MHSD 4RGOS 1YJ1A 4MH0E 2VZKB 3C0RB 3CIRB 3TBLD 1SAPA 5I2YA 4WJQA 3PIP3 2CU3A 1GUGA 3EIVA 2Z4HA 1CSQA 2KQ7A 4HEDA 4MN3A 1Q3LA 1YQ4B 2OHFA 5IY0A 3TEXA 3WOFA 3JVZX 1VQAA 3VR8B 2DY7A 1YN5A 1TWHH 1WIAA 2EELA 3CWIA 1XT9B 3IAYA 4A4IA 1J9OA 1TIFA 2IX1A 3RLOA 1KAWA 1WD1A 1EIFA 1SNPA 1UEAB 4HJAA 3GTQH 4YIJA 1EYGA 1QLBB 5G2NA 4BFRA 4BBRH 4AUQC 2FCQA 2K03A 3M4QA 3V05A 1NEKB 3HRDD 3VR3A 3ER0A 4L5QA 4XZ4A 3TMEA 1E8WA 3W9CB 1DOIA 1F2RI 4KGRA 4AQ7A 2BH8A 1JWSD 2JA5H 2IZVB 4HROA 4YSYB 1WYDA 4JV5L 2KJXA 2B2UC 3DBSA 3SR6A 4YCUA 2FIDA 5KIXA 4N6EB 1VF5C 2K32A 1K51A 1XJVA 5DLQE 1ILQA 2WXIA 1PXUA 4GDLB 2JWZA 4CYEA 2O4XA 2A6ED 2QJLA 4EVOA 4IFDG 5J22A 4XT3B 4G11A 4ASWC 1XO3A 2MWSB 2D2CC 1FRDA 1EQVA 3NZUA 2E2HH 5BN3A 1UGMA 1VQIA 2EYLA 1HFNA 4HKZE 2FNJB 4OWWB 3PUYA 3HOUG 4JI1L 3B9JA 1JJ2A 1TWHB 3M4OB 5C4ZA 2EQSA 1XPOA 1N5WA 3E0EA 2MQJA 1SYGA 3M7GA 5EBDA 3DEPA 3GTQB 3U30A 4BBRB 2JQRB 3HOYB 2NCNA 3PZDA 4KZCA 1C48A 5JHBA 2PQAA 4OZBA 4A3LH 2MHJA 3PZ8A 1V1PB 1S4ZA 1SNDA 2A5HA 1PVOA 3IG3A 2C5CA 4KMUC 4OIJA 2IPKD 3QO2A 2ZVOA 3GE3C 3KQ4A 3TEZA 1Q46A 2N8NA 1YNNC 4C7YA 3TDQA 3FAHA 2FMCA 2J0JA 1XPRA 4WJNA 2CW0D 1PTOD 2HQLA 3OMGA 4P72A 4L8JA 2MP2A 2ZVNA 1PYWD 2E76C 2MH7A 4PYUA 3RPFC 1FFUA 3KW5B 4N58A 2EYPA 3DLLA 4KDIC 1TVXA 3P2BA 3SHLA 4DV2L 4C3IB 2JY6A 3HOWH 2QW7A 3A7AB 4KJNA 2E2HB 1J5EQ 3Q8DA 2UU9Q 1FXAA 3GV3A 3RNEC 1F0ZA 3FKIH 1FR3A 5CR3A 3PRZA 4LDTB 3HKZB 2LD9A 3ZJVA 2LXJA 4ZOHC 3PIPA 3MVVA 3ZTDA 2PW7A 4GNXA 3AB5A 4IKGA 3V62A 2L5TA 4S3SA 4GMVA 4DK5A 2KX3A 2HIVA 3J81i 1TQOA 5AZGA 4M8AA 4POGA 1GG3A 3A74A 4KV2A 1STEA 2JA6G 2PE6B 2KTRB 2DYMA 2J42A 2DZJA 3W1YA 1NNXA 5EKIA 2MPMA 3DEOA 3H0GG 4WAAA 3SU8X 2F0UA 4DXGA 1V8QA 2UUBL 1V2YA 4II3B 4TKNA 3VRAB 1E5WA 1TJEA 2BB6A 4ANWA 2J53A 1U4RA 3Q2AC 2AUKA 4ZRIA 1IBLL 1H9JA 2A6HC 3U4VA 5I9OA 2V4IB 2F52A 2F0SA 1WXMA 2KLCA 4AYBG 5CHWA 4GGQA 1I4RA 2PTLA 4DR7Q 1ONLA 3FKIB 3RN2A 4O0AA 4S17A 1DOYA 3AU7A 2MO0A 2GLSA 2NS5A 4YWGG 3I91A 4A3IB 4LF8Q 4YWKA 4Y7NB 1QNKA 1NVID 2PI2A 2JUOA 3RNCC 3CMAA 2B63H 2O6VB 2PPHA 2ID0A 4R4QA 4A3MG 2A5UA 3ETRA 4X64L 1WZ0A 4LNOA 4DR5L 5C6AA 4K0KL 1CKNA 1X3QA 3QWZB 4N9F4 4K5XA 4DV0L 4AQYQ 1NYQA 4C7ZA 1VQJA 4X3KA 2AEHA 3J80i 3CSTA 2ICIA 3RLNA 4CDDC 2XIWA 4WH4A 4GB9A 4W9KA 4HIOA 1L5PA 4A90A 1PH8A 1YN4A 3A56A 3QJYA 5FLXL 4IWQA 3ZDMC 4H13C 1V80A 1E8ZA 5ELDA 2K8CA 3N6RA 3WAPA 1YJ9A 3J81E 4A3PA 3P20A 1I6VC 1KQSA 2ZCBA 4NY0A 1WD0A 2BVCA 4K3BA 4GOPA 2I5MX 5M3MH 5CV4A 4A93G 4MH8A 4W9JA 3J7AV 1XLOA 3A7LA 1YBYA 4PMCA 4ARIA 4JWSC 2JK8A 2GBMA 2N9KA 4HJKA 4A3GG 1J19A 3N32A 1N34L 5FJ8H 4C3JG 1B9RA 1TWFH 4DV3Q 2ZJQA 3MJ5A 5JPMC 3TP7A 3QHTA 4XWTA 2WV6D 2GBRA 1O7LA 1EFID 3G48A 2LHEA 4CJ0B 1L6VA 2D2QA 4WJWA 2HE7A 4OGQC 3GTKH 1WE7A 4FYDA 3DBRI 1Y8NB 4P16A 2YU9H 4FJZA 3BJUA 1SE2A 2D0OA 4A6QA 1UWVA 1WXSA 2L83A 5EE1A 4N9TA 1MIUA 1KNEA 1R4NI 2G5DA 1SFOH 4C1NK 2Y3AA 5DEHA 5T8IA 3A1QA 2WXJA 2F0OA 3HOVG 4JK1C 1SE8A 1BF4A 2K50A 5M3FG 2NVXB 4IFDJ 2WX1A 5I6WA 3OLMD 3ZO5B 4GLXA 1HNZL 4ZRQA 4WWPA 5IOCA 3QJZA 2GA4B 3J80E 4W9EA 1WJNA 4JI3L 1CA5A 4ODGA 2F3IA 1TWFB 2C9WB 5BR8Q 3VDZA 4BKTA 1VQFA 1T0SC 2KANA 3F2UA 1OXTA 2HDMA 2PI2E 2WYQA 3PPAA 3KBXA 4UHVA 5ELNA 2N9XA 3QQ8B 2OEOA 3U8ZA 2F0GA 2F0VA 4JCVE 4K6LA 4DV7Q 1B50A 3VH4B 1GNUA 4KX6B 4HDQA 1B44D 2KQSA 3K0YA 5BN4A 2MRPA 4B3MQ 3S1MH 2KCMA 3APDA 1SYBA 1LTID 1FXIA 1I42A 4UP9A 2YU9B 1BCPC 2V4DA 1B7YB 3TP6A 2GN5A 5BN5A 3GTGB 5C3EH 1QUQB 2K3UA 4L5RC 2PW9A 4FDBA 4XWWA 3VFKA 1QNUA 2O2VB 4C3HH 1MHXA 2ZEQA 3MP9A 1IBXA 1GC7A 2M0XA 4XT1B 1L1OA 3E9HA 1ZW7A 1O7IA 1ACCA 2JXXA 3ML8A 2LUEA 2JSVX 4UPAA 4PMWA 1EZ6A 1IGDA 1NDDA 2CS4A 1EIYB 4DR3L 1V5TA 2E2JB 3C3LA 1AW7A 4JGHB 4X3SA 1S40A 1FCCC 3KUDB 1VQPA 1A5RA 2VZKD 4IPDA 1JE4A 2K14A 5LNK1 4NAWA 1A2TA 3QG1A 1XMOL 2UWQA 1WJUA 1XPUA 3UIPB 4BKSD 5E6PA 4QIWE 1F2ZA 3VUYA 2LFNA 1EM7A 1HNWQ 2F0LA 2C60A 4DV5L 4LF5L 2Q2TA 2KC1A 3ULJA 2X6LA 1MSHA 3AEDB 2E5LQ 5G3LD 3A0JA 2W3RA 1E7UA 3TL5A 1I35A 1WJ6A 4FF4A 5C3EB 2KDFB 3ZW3A 2V3SA 1Y1VG 2D5GA 1YEZA 1L0XB 2AUJD 2WDRB 4BBNC 1VQBA 2VZAA 1Q5WB 4KIKA 4ZDVA 3RZFA 3VR9B 1KLUD 1SDFA 1JOQA 1KXLA 1C9OA 1DOLA 2DZIA 2PJHA 1SMYD 1ASZA 2LSSA 3AE1B 3KLSA 1P16A 1V1OA 4QUCA 2WX0A 4BY7H 1IYFA 3M4PA 5LL6S 4QJFA 4KV6A 3IVFA 3PV0A 5IP9G 5D14A 3I2ZA 5CV9A 1G2TA 3Q8FA 1KLGD 4YCVA 2WXQA 5JXVA 4JI2Q 4A3JB 1DZ1A 5FK9C 1QOHA 2F0FA 3UF8A 1EWHA 1ZOYB 2H88B 1EF5A 5TSSA 2EZVA 2VQEQ 1VQGA 3U52E 3TS2A 3DWMA 3PHXB 5FR3A 4G3XB 4HKQA 3H1UA 5KNDA 2ZM6Q 3LXFA 2KJ6A 3VTWA 1KDCA 4DUZQ 1K8RB 1XWEA 4JOIC 1LO5D 1BBUA 5EE0A 3UINB 4EX5A 1MJDA 4RG1A 2A4ZA 4B3RL 3L17A 4BBSB 3M62B 2FCMA 1I4GA 2MBBB 2B39A 5GAHC 1VRAB 4LCDE 1S5ED 5J18A 2AQ2B 2R92B 3S16B 1AZPA 1F2YA 2YTVA 2L12A 2KXJA 2Z9HA 2SDFA 1HTLD 1T6BX 2G9DA 4IUTA 4RGTA 2PNRC 4X65Q 1K73C 1F52A 4PS3A 1NI2A 4ZYSA 2F0NA 1AZQA 3APCA 4OVUA 2K0PA 2I5HA 1Q90A 2BA1A 3JAML 3R3MA 2F0QA 3R2TA 4IFDH 3LX0A 3IHPC 4KTAA 2R2QA 2IGHA 4A3FG 1P8LA 2BKFA 1BVSA 4IUPA 3K6OA 2W3SA 3NOBA 4CKEA 1NCVA 4YT0B 3U9OA 3HOUH 1EQTA 2X6GA 4MNOA 1JORA 1JROA 2KQ4X 5DPTA 5GXGB 3KYCD 1EEFD 4TVAB 1TU2B 1XNQL 1XCTL 4MEMA 1YQBA 2IBIB 3NWTA 4IO9A 2IX3A 4K1RB 1GPXA 2KVMA 3G4SA 1E8XA 1TY2A 2UYZB 4K7SA 5HY6A 3NSWA 3CD6A 4F7ZA 1WTVA 5LHY1 2QSDA 1EY9A 1YZ6A 4B3TL 4KHPL 4X57B 3PIOA 5EPLA 1A63A 2LEKA 3UIOB 2B2TC 3M63B 4EQOA 1WTWA 2L4NA 3I4NB 3S1QH 4LFAL 2YYZA 4G0NB 1CZPA 2D0PA 3ERQA 2MUYA 4BY1G 3NK9A 2GBNA 1M8AA 2O6VD 2V3PA 1NMFA 2NZHA 4MJSB 1SR3A 4DK0A 1A15A 3AE6B 4JI8L 3CW2C 3C8YA 4FF1A 3KBGA 4LF4Q 2GOWA 3WAOA 2YLMA 4M01A 4BVUC 3PUZA 3H94A 3VYTA 1C77A 4GSWA 4F87A 3CMMB 1VQ5A 1MG8A 2G4SA 3HOUB 3HUIA 4XDCA 5IYBG 1UAPA 2Z6BA 1PRTB 3I63C 5C3JB 4IPGA 4LNKA 1U4LA 2SOBA 2RR9A 2WXRA 5COYA 1V9JA 3VA7A 2K5NA 1FYCA 2E8GA 3BG3A 2EIFA 2K5QA 4X6AH 2BS2B 1WOCA 4DAYA 5IE8A 4K2LA 2JA6H 2H89B 2KDEB 5KRUA 3MHBA 2V9HA 3DVGX 2BE5C 1VQ4A 1N32Q 2EE1A 1E0BA 3FVQA 2YEPB 4LK1C 1RWSA 2LMCA 2JRHA 2LGSA 1X3FA 2MGSA 3URYA 3IFWB 3H0GH 3EBEA 2UXCL 1SIFA 3W1GA 2ZJDA 1PTOF 4RFBA 3UDXA 3VR4A 3MEHA 1QZEA 2KO3A 4KSKC 2QILA 2KA7A 4HCPB 4GDKA 1M94A 3ONAB 3ZUNA 2N1WA 4DR1Q 4KKIA 1CHPD 1BBXC 3Q14C 4DV6Q 2Z59B 2KFKA 5IWAQ 3CCJA 2LGIA 3HP3A 4PYZA 5DPSA 5C44G 1TWAB 1TKEA 1CT1D 1RLFA 1DM0B 1I4PA 2D10A 4GN5A 2OQKA 5JEAG 3MFYA 2F4VQ 3BWUD 3FMCA 2OT2A 4IN3A 4XQQA 1BKBA 2CR5A 5JZEB 3KOJA 1TZ1A 1LTRD 1T0QC 2E2IH 4WFN3 3KF6B 2A69C 2LGYA 4BKGA 3H6MA 1WMHA 3Q0AA 1BUVT 1Z9FA 4A3MH 1MI0A 3ZLZA 3I4MG 4NKLA 1FMAD 4ZCKA 3D6CA 1IGCA 1PYBA 1K8OA 4PZ8A 1OQYA 2L1AA 2N9EB 3H0GB 3NJTA 3DXJC 2Q8RE 3S2DB 3I70A 2JYEA 1NY4A 3O13A 4ULLA 2XK5A 3T51B 2Y5PA 5JOBA 3ZVVA 3V61A 4B0EA 2DJFC 3BVGA 2INCC 5CBAE 3UQBA 3P75A 3TJPA 5K5PA 2D9UA 4ZRZA 3PGEA 1MVKA 3K57A 1GHJA 2K8BA 2BF8B 3I5JC 4KSLC 2Z8LA 4EZJA 2YTXA 2F0EA 3D31A 4NMZA 4LJOB 2N3SA 2JE6I 1EUJA 3ITPA 1M90C 1C79A 3VAWA 1V81A 4DV1L 2E2IB 5LMNL 3WANA 2A68D 4A3GH 4ZUJA 3GTLH 2Y5CA 4C3JH 3J7A5 2K05A 2KWDA 5C4XB 3NENA 4OL7A 2NBUA 5KHOA 3SK5A 4CDCC 2KK8A 3AV8A 2BBCA 2B3GA 1CK1A 4DR2L 3N1XC 3Q3NC 1CZGA 2OQ0A 1C76A 1S3OA 4OO1H 2SEBD 3HOZH 2BYFA 5M5WB 3E9SA 4A9AA 4ACFA 1LV9A 4NXML 2JN4A 1H9MA 4P75A 3CCVA 4EQPA 2D5DA 4LF9L 2KOXA 3DHHC 3KWLA 1XMQQ 2R93B 4IUQA 4MGYE 1R7SA 2UXDL 2Q8TA 1TKGA 4RAUC 1CKMA 3ALBA 3RNFC 4UAIA 1ILPA 2HCIA 1K52A 4JIOU 3H7PB 4JBKA 2EMTA 2RHSB 3G71A 4HCNB 1D7QA 1FL0A 2I1JA 3JSVA 3HHMA 2MFIA 3HOVH 4A3KG 2WDTB 5M3FH 3VQIA 4RNAA 5T1GA 3F2DA 2RBMA 2M4NA 1V1QA 2JXTA 3NVVA 2QDLA 4A3GB 4RCNA 4DHZE 3GTLB 1KM7A 3RN9C 3NRZA 2K25A 2CFMA 5GROA 4X62L 1XYIA 1C4CA 5IT9L 4PQXA 1OFFA 1ICFB 1MKHA 3VUWA 2JJQA 3GQBA 4L5TA 1V6EA 1E2WA 3S15H 2KWUB 3BYYB 3W2DA 3P4RB 2MEKA 2O5IC 2PVGC 3PRMB 1EOTA 1OQQA 2WNMA 2VUMG 3HOZB 1N33L 3MTNB 3I90A 1I94Q 2KMMA 2K4KA 3CXCA 1HR0L 4B0MA 2KBNA 2UUCL 5C1ZA 4MM3B 2WXLA 1G91A 4MIUA 1PLFA 3STBC 2RSOA 2DBYA 4GKJL 4GLSC 3A9JB 2I2YA 5GQOA 3A54A 2K22A 2M56B 4DUYQ 1HQMC 5KGUA 4QB4A 4G7HC 3CP0A 1LYLA 5MPOA 3TZDA 1WYGA 4OZAA 2L3ZA 1HJPA 2AQ3B 2ZJRA 5M3FB 3PSIA 4JI0L 2OJRA 4WQMA 2K5PA 1SSNA 2Z6KC 3MEFA 1T3QA 2IO0B 3AU5A 3UQAA 1E2ZA 1BXTA 4FXDA 1SN8A 3K58A 4W9LA 4LFCL 4JC0A 4GKKL 1SYCA 5IGBA 3AE9B 2WXGA 5CBEE 4QL5A 5CTRC 1Y1WH 1G291 4BXXG 4CJ1B 2RDBC 2CQAA 2XN9C 5C5MA 4HDOA 1FJGL 3MC9A 1EEID 4B6WA 1U5KA 2K5HA 1YIJA 4XXEA 3G7LA 3FC4A 2RPVA 3PT2B 2MJEA 3KDFB 4MTNA 3TQYA 4DR6L 2JA8G 5IYCG 3L4PA 1Y1VH 2M0AA 3T53B 1SRUA 1T0RC 3UDGA 4JV5Q 2JYOA 1VZ7A 5BMIA 1B8AA 1LTGD 1VDZA 2JEBI 3D32A 3BK1A 5BO4B 1WGGA 1RODA 5BYQA 3BVMA 1BUIC 1J7AA 1NYRA 1QOAA 4LTUA 5IN7A 1HZBA 2L05A 1EL0A 3AI5A 3L08A 5IP9H 5IGFA 1VR9A 1JB3A 3EUB2 4MSMB 2WP9B 1TR5A 5JEAJ 2JF5A 2K1FA 4ZHOA 3D0FA 3V3XA 3NBHA 4ZK9B 3U2SC 2CWAA 1IL8A 5FR6A 1TIID 3AEGB 1OTCA 1WFQA 5C2TB 2AWOA 3FDTA 4JI1Q 2R7ZG 4CKBA 1B1ZA 2HHHL 1WI0A 1Y1WB 1GD7A 1Q86C 3D4WA 2QC8A 3QAQA 2WP8J 2K04A 5ELBA 2L15A 4H44C 3N1YC 5HFYA 3KK7A 4LUVA 5IYDG 3SVMA 4I6LB 4CGYB 4L63B 1KIXA 1HEZE 5G3LF 3UE1A 4X3UA 1UWXA 2BYEA 3C19A 1JICA 2NWGA 4JBMA 1ESFA 1NR4A 4J6HA 1Y1VB 2EY1A 3AE5B 2BQQA 5G5GA 4XC2A 2WIIB 2BKRB 3AE8B 1PRTD 3PF5A 1WE6A 5EKKA 1I6HH 2K1BA 2INNE 3OYYA 4HSPA 1H9SA 3PUWA 3I4LA 2BYTA 2E6XA 2CCZA 1KHIA 4DV2Q 1P3QU 3C1EA 4DR4L 5CC4A 1JOOA 1Q0WB 4JE3B 2TSSA 2QHOA 5C0XG 1LGRA 2GVAA 1UUPA 4DXFA 1JB7A 1C8CA 1BNZA 4FF2A 2WU2B 2JT4B 3VHTC 2C9OA 4A3FH 3EVQA 3BDLA 3OWEB 4QMGA 1EWYC 2CJOA 2ZXRA 2Z0EB 4IM0A 4TMAB 3S14H 4LF7L 1D3ZA 2L00B 1XNRQ 4A3DG 4P74A 2M2LA 1HNXL 1DCZA 1EQRA 2L76A 2K39A 4IWPA 1F2LA 2ALYB 3GZNB 3PTFC 2EYFA 1N62A 3CCSA 4TQ1A 3WCQA 2CQOA 3AQQA 4A8XC 5A2QE 4B3SL 4CJ2C 2RD0A 4LMQD 2F0IA 4HR7B 1HA6A 2WKDA 2Y0SB 1CJEA 4DAVA 1V9PA 1VQ7A 4MZ9A 2DN8A 4J6IA 2L1BA 1AH9A 3QOLA 4JPBW 1PA6A 3W1BA 2R3ZA 3AFPA 2D11A 4A3EG 1YMHE 1FNWA 1I6HB 5JJLA 5DCNA 2UUBQ 1A70A 1LQBA 3HK0A 3UI3A 4BY1H 2MP1A 1PDQA 1QCBD 2RDGA 1B53A 2PZUA 3K0XA 3PUXA 1NJIC 4Y52H 1K53A 3RFZB 4LW1A 2JA5B 2VH1A 3CF6E 2ASBA 2EYJA 2V0GA 2OXPA 3NS8A 3ZNHB 1SE4A 1ML0D 1D1IA 4NXNL 4HIDA 2ZZPB 1K8MA 5C3WA 4W9FA 4R8NA 4GNXC 1S5DD 4K8IA 1TTNA 3S14B 4G57A 2B8GA 3Q3MC 1OEYA 3HEJA 4IUUA 2KCTA 5IYBH 2Q2HA 3R66C 3ONSA 2KC2A 1PFDA 1L6UA 2HQEA 1LFDA 2YTYA 4JLCA 3OMCA 3L2PA 2NVTH 1PFNA 3VR5A 4IC7B 3W5VB 1A6XA 1E6EB 4GN4B 3DVNU 3TEYA 4X64Q 2OTJA 4DR5Q 5IO9A 1YNJC 4K0KQ 2K6QA 5CMDA 4A3OA 1IXRA 2PZTA 4DV0Q 3PO2G 1UE7A 3TP8A 2QDBA 2JX5A 3ZJUA 1EZ8A 2MX2A 3DMUA 3PQIA 3SDZA 1UNSA 1KC8C 2HTME 2DHZA 3ZNID 1YD8U 3E3XA 1GOZA 1MJCA 4BKSA 1NMGA 3Q24A 1KL9A 3ZQ4A 3RMHA 2DNFA 2K6DB 2R61A 3R2IA 2N9LA 5C44H 2BCOA 2H5XA 4DU9A 4IG7B 1MJEA 2EKEC 1BMLC 4GDLA 1QWYA 1ET6A 3IKJA 1X6OA 5JEAH 3BS1A 4ICUA 1PZID 4RMAA 5DM63 4DWFA 3PCOB 4YSXB 1WGYA 1STYA 1HZCA 2ZTCA 5C4HA 3HOWB 4ICVA 1N34Q 2D3BA 3B0AA 2J52A 3ZDTA 1Q81C 4BWGB 1K0SA 2MA9B 3DHIC 4QIWB 4KD4A 1O80A 4JPSA 3NBIA 3I4MH 2IHEA 4NAMA 1PHJA 3JAME 2KWCA 2QGQA 5EJWA 2AQ1B 2KEDA 1L2NA 3B1LX 4FULA 1SB3C 2XVSA 1X3GA 1KFYB 3A55A 1JRPA 1WR1A 1V1PA 4R4OA 3AEBB 5IAAC 2JQOA 4KN7C 1TGZB 5KHQA 4HMIA 1WCMG 2JWUA 1C3TA 2AMCB 3ZGZA 1BQQT 4GOPC 4EOYA 1EWCA 3VR6A 1IYUA 1NR2A 3S17H 1X32A 3AFQA 2XRQD 2LASA 1B9MA 5JPNC 2OOBB 5H92C 4B9KA 1EQQA 1DONA 2MJ8A 1DXMA 3L3OC 5GAGC 4OO1I 1RFKA 1RM6C 2XWBB 1K0RA 4JI3Q 1I3QH 3S1RH 5E3FA 4JI6L 1KRHA 3PGZA 4RA8A 2WXNA 1C9FA 3M3YH 2KDMA 3CC4A 3QB3A 2Q2UA 3NY5A 1C7YA 3MXNB 2ACZB 2IGGA 3GTJH 3VTUA 2EYMA 4HIKA 3DBHB 1FVIA 1ESRA 3OIPA 4DXAB 4CDFC 2RDHA 2B63B 1FD7D 4DAPA 1FNUA 3NELA 1L0VB 4V190 2IO2B 2KTRA 1P0RA 1UEBA 1B4OA 3C1FA 4ALPA 4FVMA 3TCAA 2JVCA 5M5YH 3GTMH 2WKCA 1WFYA 3IFTA 3I4OA 2NTTA 3A5UA 1JT8A 3HOXG 4DR3Q 2ZW0A 2I38A 2BB5A 3AEFB 1NUCA 3NUCA 2LXCA 1E1TA 4A3KH 1U4MA 5C0XJ 2LUMA 3EJIA 2ASQA 4B95A 1RTOA 4DF7A 1NBFC 2W9NA 4GU2A 2C5LC 1F1HA 2MCNB 1RKNA 4J1MA 4HJ5A 3T3NA 3SK6A 1I3QB 1GJXA 1XMOQ 1BCPB 5KNBA 2SNSA 3E56A 1G6PA 2RCFA 2XGTA 3KWVA 4AWJA 2NVQH 1RHPA 5FOBB 5M3MB 2DX5B 1N8RC 1PH3A 4DV5Q 4XIGS 3GO5A 4K6DA 4L23A 1YVCA 2N49A 4U673 1GC6A 1WXAA 1YIWA 2O6VA 1V49A 2R2OA 4TUUA 1WWTA 2VUMH 4L5SA 1XLQA 3DVGY 1I4QA 2PZWA 1L1OC 1PH6A 1WTHA 1NAPA 4KJOA 2ZNVC 4MGKE 4US9A 3VTVA 1QVGA 3ZIMA 4IW0A 1O7YA 1ZXTA 1HTOA 1PZJD 3D4RA 3GTMB 1V5OA 2M19A 3CRKC 3J7YW 3AE7B 3RZWC 1ZEQX 5CX3A 1IKMA 4KIKB 3E0JA 1MSGA 3GTKB 3SFEB 3HM6X 2C35B 4YL8A 1ZKHA 1BT0A 5EPKA 2D3GA 3HVZA 4M02A 4KGTA 3K5LA 2MNAA 2DAJA 4P2CB 4K14A 2RF4A 1U9RA 2B2YA 2NN6H 2PYKA 5J1ZA 3T1HL 3PO3G 1DOXA 2X38A 2SAKA 4M0WB 2DGYA 2KOLA 1SFOB 5IA7A 3X3MA 5LMUL 2G3QB 2HD5B 4HIMA 3DPDA 1PH5A 1TKWB 4G7ZC 1VDVA 4US8A 4OIKA 5C4JH 1RIPA 4S0RA 4OHJA 2WDQB 3HKZE 3RNBC 3PUVA 4BXXH 3MXGA 5CORA 3KYDD 3CCUA 1YX6B 1VQCA 1WRIA 2LI5A 3B2GA 3ZJTA 1FXTB 1PYSB 3G6EA 1PZKD 1GUNA 4B3RQ 1A2UA 4CDEC 2JA8H 3CQZH 1LTAD 5IYCH 3HVDA 1SMXA 3P1HA 4OX9L 3VYUA 5LMNW 2ICEC 2AWTA 1PMRA 4USAA 4XE0A 4H7BA 1KJTA 1SNCA 1VLBA 1U0LA 3S1MB 4L6TB 3PHWB 3BZKA 4MHEA 1EU4A 2WAQG 3PIO3 5L95C 4C4VB 1YNXA 2LGXA 2RMMA 1EYAA 3KF8B 1JQYD 4ME3A 4DK6C 4C3HB 3GTOH 3VA5A 2NVYH 2AL3A 3GZNI 4LJPB 3PMFA 1GJZA 1MHHE 4EZLA 5TR5A 2I07B 4BA1I 2L0FA 2WDVB 2NTSA 3RCZA 3ZRCA 2QEJC 1IPGA 1J7BA 2KHSA 3CAMA 3H3VH 1K50A 5C4JB 3DOWA 3DM1A 1PV4A 4CHTB 2FE8A 2WXMA 3DDCB 3B6YA 2R7ZH 3PO0A 4MSQB 4IM3A 1XNQQ 3J9CA 1HUNA 1TWCH 5H1SE 1PH4A 1MG4A 4C56C 1S5FD 5FO8B 2B2WA 3OIQA 2KTFA 3MFGA 4ZUIA 3RNUA 2ON8A 3ECIA 4WIPA 1EY8A 1OQRA 4ARCA 3MHZA 2IL8A 4B3TQ 2RHQB 2AL6A 2BWFA 2LRWA 4KHPQ 2IDYA 2E75C 4V0BA 1XLPA 2HTHA 1G51A 4XQNA 1GHKA 3SXHA 2E3TA 3CPFA 3K7UC 5J39A 1QUQA 4LFAQ 5IT9E 3J7AF 1Q10A 4H2AA 5HHDG 4ANUA 3QC8B 2BW2A 4NB3A 1UE6A 1VCIA 2O2VA 2LHDA 2WINB 2Q8IB 1ZE3D 4JL9A 2QCZA 1SNOA 4ZKBB 3GV6A 2NUCA 2FFKB 1SF0A 4JI8Q 4YTNB 3UDIA 3GE8C 5C0XH 4LDTD 4JBJA 3H15A 1HA5A 2C7NB 5CHVC 3E5SA 1HR0W 2A6HD 5IOIA 4BY7B 2VB2X 4IPCA 2FCSA 2R7ZB 1X65A 2KQ3A 3ZRFA 3C46A 3HM3A 3MC8A 2K5DA 3SDLC 3AU4A 3L13A 2MJ3A 4RCOA 4A3DH 2B3AA 3R93A 4IUNA 1G2SA 5JJKA 1VQ8A 2Y5BB 2F0TA 2MQHA 3B08A 1CA6A 3EHVA 4FO2A 1D4BA 2WWZA 5E6NA 2K9XA 1RRBA 2LVPA 2Q5WD 1HNWL 3A9KA 3MJWA 2L11A 5EPJA 2HDLA 1D6EC 1ET9A 1RCVD 4JI7L 1WR6E 5HG2A 1OXSC 2UXCQ 2EXZA 4IOAA 2OF1A 3HOYG 2O5JC 4A3EH 2N7EA 1O78A 1PRTF 1GUTA 2KHJA 4DKAC 4I7AA 3H3VC 2WXFA 3EGRA 1K83H 1DD2A 3Q3OC 1XXGA 5BYRA 3NZSA 3VYSA 1WGHA 1Q82C 1HE8A 4RM8A 4GDKB 5G55A 3Q8AA 1BOSA 4YTMB 4WORA 4P1CC 1W3SA 4NW2A 4XTCS 1WY8A 2BS3B 2QF7A 2XBBC 3NUHB 4ZYNA 3A8IE 3RNGC 4LLGM 2YEPF 4JQWC 5JHAA 3D4DA 2KMCA 3DQVA 5KNCA 1WX8A 4CBVA 3RUZA 1GVPA 4W9IA 4DHZB 4C3IG 2W82A 1DOKA 4EQNA 4TRDA 2D3CA 5ISRA 2GI9A 1Z6HA 3KYHC 2RA4A 1N5XA 1IYJB 2NMQA 2UUAQ 1WMHB 2WXOA 2JRIB 3FILB 5IGEA 1WTRA 3N30A 3HKZG 3L0OA 3R3OA 2HIXA 2VXWA 4OXPA 3M9BA 4AJWA 1P7EA 2C7MB 3PO2H 2J7QB 3S9WA 2N0SB 2QDFA 3L10B 2ZW1A 3W1SC 3FRPB 4NPSA 4JWUC 2O2LD 1U4PA 1HZ5A 2DWQA 1N6ZA 4IUMB 2Q2IA 4IUVA 3J81L 2HT1A 2AX5A 3SD5A 1EY7A 5BMHA 2WXHA 1F2MA 5ELFA 2KZRA 2MSED 2XK5B 3PLUA 1Y8OB 1XEEA 1VD2A 5D3DA 1TS5A 1QOFA 3QIJA 3J81c 4N8X1 3AN1A 3S1QB 3NS1A 2WACA 3EFXD 1FM0D 1VCBA 1R4MB 1RD9D 1CTMA 2Z4IA 3W1SA 2MJDA 3DBHI 5I4DA 1YJJA 4MTKA 4PV1C 3DBLB 5LMNQ 3ZNGC 2X69A 4PK1A 2BA0A 4YHHQ 1X3PA 2NZOA 2CU1A 3SK8A 1A3TA 4RGMA 2KDBA 1MI2A 2J7ZA 3BDCA 4UY8C 4PT5A 3E9IA 3FKIG 4CHKA 3NG0A 3QK0A 3HZXA 1QG7A 1WM3A 2ENBA 3G6JB 4A3IG 3TN2A 1P7FA 4DR2Q 1PTOH 2F0KA 3AULA 4HPPA 2XNAC 3QOJA 2INPE 1HZ9A 1TT5B 2ZPNA 2IGDA 4GXBA 3OOCA 3UI2A 1D1KA 1SE3A 4NXMQ 5M9OA 3MWYW 3NHEB 5LL6X 4LF9Q 2CJNA 4P6VF 4XDDA 1IW7D 1WJ4A 4GN1A 1BCPD 2B29A 1CMXB 2JA6B 2PMVA 2UXDQ 1Q8KA 4Q0FA 1MGSA 4TSSA 1WCMH 3OW2A 2FHTA 2PMZB 2CHBD 1WSPA 1V97A 2F3WA 3U9SA 2NPTB 1P1AA 3MTSA 4YXDB 4NQLB 4JI5L 3J80L 2JU6X 2KCCA 1F2RC 3CCRA 3JYUA 4NJ6A 1UBIA 5AJ3L 3K59A 4A75A 1HTPA 3HG9A 5EBCA 4HXDA 2EMSA 4MJSA 2N88A 1A62A 3BZDB 2WGSA 4QCLA 1OXVA 3JW0X 4ZRKA 3J80c 1N9WA 4HCEA 2CHWA 1E7VA 4DNTB 4NJCA 4AYBB 4LF4L 4RF0A 4X62Q 4NP5A 3I56A 2DLBA 4AJYB 1HQRD 2K01A 3M3JA 5HI1A 2IO1B 1OEYJ 3TSSA 4DAMA 4GIVA 3RMKC 4NNJB 5DAUA 2MBEA 2A6EC 4A93H 2KUMA 4LFBL 3RLFA 5D3IB 3GTPH 5C23A 4ID6A 5A35A 1QF6A 1EY4A 3ERSX 4LUOA 2EY5A 5KYIA 1N33Q 1C4PA 4HTHA 1BO0A 3UE0A 2KLGA 1W6KA 2KN4A 4WJ4A 4A3MB 1HR0Q 1STGA 3F8TA 3H09A 4UDUC 1CI3M 4B9WA 2A19A 1LT3D 1LTBD 1WJJA 2UUCQ 3PF4A 2N1VA 2CKHB 4IURA 2IYDB 5ELCA 3KJPA 4TV3A 2J0KA 4GKJQ 4NQKE 1B3AA 1WGKA 1GXDC 3D8GA 1EIGA 3AE2B 3NHHA 3T56B 4O2DA 3M85A 2VQFL 1TYGB 2ZXPA 2DZKA 3B2FA 1ENAA 1II3A 1KTKA 5GADC 2ZPYA 3HOXH 1ROEA 4FBJB 3CKIB 2KCNA 4JI0Q 1HFGA 5EE9A 4XQJA 3CMEA 3CRLC 4ILWA 1JMCA 1HCZA 4ZAIA 2JZZA 1I4XA 3TMPB 1K8AC 4A3BG 1S5CD 1WTQA 2CW0C 1PTOC 4HJ7A 3VYRA 2JZPA 2ZCCA 5LXHA 4LFCQ 2IHFA 3AE4B 3N52A 3CF5A 4GKKQ 4RKBA 4DQOC 2MBOA 4L1BA 1SIJA 1E10A 4A93B 4R4CA 3GP7A 5EE3A 5E1FA 3KF6A 1E7ZA 2EVBA 1YITA 1X9NA 2I1KA 3RZOH 2BGFA 3PREA 1L7YA 1FJGQ 2JSOA 3K5OA 1YNTE 1IBKL 4C3JB 1C0AA 4OVVA 1CHQD 4DR6Q 3MXUA 4I65A 3KLRA 5JH5C 4OZCA 3SEBA 5IIFA 4J3OD 3W5UB 1RYJA 3SE0A 5I2XA 1LT4D 3T13A 2F0JA 3HOXB 4IWOA 1VQ9A 2DY8A 3NEMA 2KJRA 1Y56A 4W9CA 5CV7A 4IALA 2QIEB 1I50H 4N9PA 4LF6L 3RN5A 1AYFA 1TS4A 2Z0SA 1HPCA 3TIXA 4DHJB 1OGWA 2EKIA 3HOVB 2F4IA 4I7ZC 4MGZE 2HHHQ 1PDXA 3EFCA 3VVWB 1FO4A 1YJNA 1QT9A 2KKCA 5EQ0A 3WIMA 1OXXK 1SXTA 5C5LA 3RZOB 3VUXA 3KUCB 3SHQA 1VJKA 4OW0A 5FLMG 3NWSA 2NBVB 3GS2A 4EZKA 3TRZA 1GUOA 2M00A 1F77A 4WWMA 3BYTB 4YY3L 1A0IA 1FGUA 4C2MH 5FLXE 2DYBA 3S15B 5K36G 4XYQA 4FP5D 1DGSA 2A8VA 5C3EG 3WAMA 1N36L 1IBML 4X66L 3DHGC 2JYTA 2KHIA 1ZGUB 1HXYD 2KX0A 1FGBD 1X3EA 4DR4Q 1AARA 2VY3A 1I50B 3KJOA 3ZXRA 1XTCD 4JYAL 2FJ2A 3NVWA 2LJIA 4JX1C 4C80A 4LK0M 3VR2A 2J0MA 4UP7A 3N1ZC 1AE3A 2NVUI 2L55A 5ELEA 1STAA 1P9DU 2K8HA 3ML9A 3U7ZA 4PS8A 4LF7Q 1D2BA 2NBFA 3NTHA 4FNFA 1OXUA 2W54A 1HNXQ 3K9OB 2K7VA 2N7JA 2CH4A 1HTQA 4M8NA 1V86A 1R4QB 4A3JG 3OTOL 3T1YL 2K28A 4B3SQ 3DWQA 5DM73 1GUWA 3Q6BA 3AMZA 4C2MB 4RMFA 4QF4A 3T9LA 2B2VA 4KKJA 2REXA 4YCWA 2HCCA 1ICWA 2BE5D 2Z1CA 3I3CA 5IKCM 1KDBA 3WALA 1GUSA 4MM3A 1PUTA 3U7DA 4DGZA 4PG3A 3NPPA 4BBSG 3A9JA 2CHXA 4I6PA 2PQAB 5HKHA 3OAWA 1K3RA 4IFDI 5E4WC 3KFUA 4GOCA 2R92G 1VQEA 1FFVA 2V3NA 3IXSA 3CCMA 4E6IA 1YJIA 3O65B 1VQMA 5D94A 3GD7A 1K28A 4NXNQ 3LJ3A 1EUVB 2UXBL 2RCNA 3CHBD 3QR8A 3RD2A 2IY1B 4M8MA 2MP2B 5GAEC 3QX1A 4WWNA 2DAFA 2PVOD 3LYYA 3PZ7A 4EUTA 3CC2A 4ANVA 3X0WA 1WZ3A 1GB1A 3CCLA 2ZTEA 4P7IA 1FCLA 1KOTA 4PNYA 4OEMB 4KHZA 1QVFA 1UZXB 2A69D 4UP8A 2VB3X 2F3VA 3UDFA 2WXKA 3PV1A 4LNIA 4GN3B 3ULLA 4L2YA 4EFOA 4R9WA 3M4OH 2LGDA 2TMPA 2L7RA 4JI4L 2MBHA 1LUZA 1JWMD 3KDFA 1R4MI 1XD3B 3HOYH 4HRSA 4GNXB 4MELA 5LXIB 2MBQA 2WB1E 2KFJA 4OONA 3A8KE 5JJZA 3IL8A 1K3BC 3DBLI 4DV4L 3U4ZA 4WJ3M 5I6YA 1JJGA 1GAQB 3GOEA 3NTKA 1L0WA 2XEWA 4MT5A 3EFUA 3TS0A 1SROA 1X55A 1ENFA 3I4NG 4NPNA 3V60A 1VQNA 5J17A 3E6ZX 2EJMA 3I3TB 1X54A 4WWOA 1GB4A 4R1JA 3EC8A 4C3IH 2OEDA 1IBLQ 2F0PA 3JAMi 4FJYA 3M4YA 1F9JA 4APVA 2GBKA 5IP4D 4IOIE 4A3FB 4ZKCB 1DYQA 2FBWB 2CH4W 2INDC 4O42A 2A1AA 1VS0A 2A74C 1M4VA 3F2BA 1I7HA 3BK2A 4FXCA 2B2UA 2QCPX 4K2KA 4W9HA 1B2TA 2YV5A 1WI5A 2D62A 1WXVA 1QOGA 2M1MA 4HJ9A 2JA9A 2R7FA 2AKWB 4ZQ3A 2LJ5A 4GS3A 5I9PA 2Z0DB 5LLIA 2K5VA 1WX7A 4M1UB 2PE9A 3V2TA 1CKNB 4QAYA 2V1CC 3VH3B 3HIZA 1PQSA 3FEWX 4TQUS 3TUOA 5F2DA 3P42A 2BDOA 4A55A 4BY1B 2B76B 4POFA 1EWIA 3OJ3A 1XX8A 4II2B 1S1QB 4H0LC 1RF2D 4KGSA 1TY0A 5IODA 1A8VA 3KLSX 1GO3E 1SMYC 4JI6Q 2JP1A 3RUIB 4QQBX 3IT6B 3Q8CA 4ANXA 3K5NA 1T5XD 1EYDA 4NJ7A 3NE5B 2WS3B 5D65A 1YHAA 3F2CA 1HZAA 4GOPB 4A3IH 1XNRL 1CSPA 3BZCA 2C7HA 2JA7G 1Q1BA 1X56A 4Y7NH 1N61A 2NVTB 3BDOA 2PKOA 3DM3A 1JRUA 1QVCA 3QCAA 3AM9A 3NQTA 2RQXA 4F1SA 4Q2JA 2LVOA 4B9XA 1JJCB 1I5FA 3WDNA 1Z47A 2K52A 2KVRA 2HD3A 4PMBA 5EAYA 2ONQA 2IX0A 3STBD 1JE5A 2M9VA 1M1KC 1SEBD 1BR9A 1LM0A 1MD2D 2KN5A 3J81j 3FPUB 3S2HH 3ZXVA 1JQ4A 2EYOA 1HH2P 1H8CA 2WAQE 3M95A 5BYSA 1WF9A 1EY5A 2V4LA 4DNIA 1AN8A 4LJZC 5CHFA 5FO9B 2K75A 4NDXA 1LXDA 2KAJA 4W9GA 1ZDVA 1SBBB 5CYUA 1HRJA 1Y14B 3V6CB 1GUAB 3A4SC 4PS7A 4K5WA 1Y69U 5C44B 1IYVA 2F1MA 4OELB 1L4DB 2M8SA 4FF3A 4BOSC 2G4DB 3A1QB 1H9RA 1HNZQ 3D3RA 3C2PA 3AEVA 2W55A 3BY4B 1AEXA 5DPRA 4E71A 4E74A 1TZOA 1PFBA 3A33B 1UE1A 1J5EL 2GRIA 5C4XG 1YN3A 2UU9L 2WHIA 4XYCA 2KWVB 3X23A 3I4MB 3X3NA 4DHJD 2KACA 1BCPF 3W5OA 1E0ZA 3ZYYX 4P71A 1WGRA 1Z7TA 3LDZE 4QUFA 3VRBB 3S2HB 1CUKA 4DN4M 2NR2A 3IAM1 4FLHA 2WB1G 4KKSA 4RGNA 2D3AA 3OWFA 3EA6A 2R93G 2GBJA 4GLVB 1UELA 4KLKA 1D8LA 1SYFA 1VMCA 3T1HQ 4WURA 1PFMA 1Q8IA 4A3BH 4M00A 2JZ3B 3L7ZC 1IBXB 3K5MA 1ZYRD 5LMUQ 1WRDB 3RI7C 2UU7A 1VQ6A 1L1OB 3IAS1 2EY6A 4IQZA 3S17B 1FIQA 2ZNVB 4QGUA 4IDIA 2NVXH 2HJ1A 5FLXc 1C78A 2JPHA 5JAVA 2E74C 1GKHA 2KVZA 4LAAA 1LM8B 3Q3FA 4GZYC 2IW3A 1G6ZA 2KMAA 1RFAA 1K9MC 1LTSD 2EYHA 5J2RA 2J4XA 3S1RB 2IT1A 3FKYA 4HAEA 4K81A 2FUHB 3I9V1 4NAWB 4DR7L 3M3YB 4IOCA 2F0MA 3CPWA 1VZ6A 2PQEA 4OX9Q 1RAXA 3L54A 3PRPB 2JXMB 3GTJB 4LF5Q 2G9HD 2Y0SE 4R3DA 4LF8L 1YX5B 4BBNF 2NYZD 4OO1G 3HOZG 3OHXC 2B2YC 1LT5D 3TZUA 1C4AA 5E6OA 3GTGH 1MHWC 1NE3A 4YTPB 3PSEB 4HLEA 4DK3C 1D5ZC 3H7SA 4CQNA 1J6QA 4A3BB 5M5YB 5KEEA 5JVG3 4AQYL 4REZA 3Q6SA 4YWMA 2A73B 2PEAA 2VNUD 1EYCA 4FN2A 5AZFA 3MZ5A 3AEEB 3P63A 1D5XC 2E2JH 4J15A 3SR1A 4A3KB 1EOVA 4G7OC 2L52A 5AZHA 1R9TH 3AEAB 3QWNA 3I57A 1WTOA 3N3KB 3OJ4B 1WH3A 1NENB 1NSNS 3BU2A 4FXGC 2FAZA 2ES2A 3F1ZA 4HPLB 5FLMH 5E7NA 4Q5VA 4HN7A 5NUCA 1E24A 3MXNA 4JW0A 2QEXA 2NVQB 1JC7A 1EY0A 3AB9A 5M5XH 3BINA 1HUMA 2FIFA 3NXWA 2WLBA 5K36H 2CVRA 1E90A 1N63A 2V1YA 3APFA 4EEWA 3CCEA 1F9SA 1LACA 1PH1A 2VUMB 1IW7C 5JVH3 4MACA 2PNHA 1WGDA 1VF7A 4DV3L 4D2KA 4A20A 2MO1A 1S5BD 3HS0C 1KH0A 4BOZB 2OJWA 2IJ0A 2DUDA 3CSFA 2QKIC 5L83A 2CKZB 2N4FA 4RWSC 5AUIA 2CWPA 5CGKA 1Y8RC 3V96A 4EE2A 4R8IA 1U4AA 1J0GA 4HVBA 4AS1A 4KY6A 1FNVA 1YNND 3KUPA 2B2WC 2OTLA 1MPEA 2IY0B 5A2QL 1R9TB 3K80C 5JJIA 1UD7A 1JALA 2BT6A 4JG2A 2VW9A 1L0YB 4WJOA 1OTRB 3NQIA 4C1NI 3U50C 4A3JH 1GM5A 4IZ8A 3LNNA 3R8BA 4ABNA 4CKCA 1VQOA 4A3CG 5D7GA 5M5XB 4ITKA 4TQ0A 1Y1WG 1VQHA 1YNJD 2A68C 5KYLA 4JI7Q 2BYVE 2L32A 2N7DA 3A9KB 5E4XA 1K8GA 3EROA 4I6NB 5IYDH 1Y8PB 1FPYA 2PW5A 1PH2A 5BR8L 1R4PB 5J3BA 2RDFA 3GB1A 1S72A 4IM2A 2LVQA 4IPHA 1IKLA 2JA8B 3CQZB 4BBSH 3HFZB 1SLJA 4RKLA 1G8ZD 2H4OA 2DYOA 1D5MC 1NI3A 4DV7L 4ZRJA 2VH2A 2R92H 2HJ8A 3S16H 3NZ3A 3I73A 3I55A 2BS4B 4F8MA 4B3ML 2P5ZX 2F03A 3MA2B 4LUZA 1STNA 2I46A 4WAFA 4MDKE 1SJHD 3GTOB 2FUG1 4DPGA 3K9PB 5IP7G 4M0WA 2NVYB 3A8JE 4KN4C 1ZPSA 3K81C 2KT7A 3KH0A 4ZHPA 2DJGC 3ZNZB 1YHBA 3MXPA 3NP8A 4RHSA 1E7PB 1F9PA 2GB1A 5FKAC 2LS01 3I72A 1N60A
chains in the Genus database with same CATH topology
5IGDA 1IHZA 1TWCB 1ENCA 2WU5B 3IT4B 1ZXHA 1CM9A 3Q8BA 3P4QB 3EQLC 3OPOA 4NZLB 2WXPA 4K8JA 1UGJA 2H1EA 1I4HA 4X3TA 1JR0D 2F0HA 5EKLA 2FMMA 4XYOA 2LMCB 5CV5A 3KF8A 1CZWA 3WOEA 4N59A 1RTNA 2RKSA 3CU7A 4KK7A 4O1NA 2IWHA 4HMJA 1RDPD 3SFDB 1STHA 2KECA 2K5WA 1CQVA 3H91A 5E6JA 2PLPA 3NVZA 3AH7A 3ND8A 4A3DB 2KEEA 1V43A 1ZP0B 1H9KA 1JWAD 3LB8C 2HUGA 2PPBC 4KKUA 5CV6A 2NB0A 4KY5A 5HURA 4WRDA 1CFMA 2F0WA 2J0TD 4A3EB 1KNAA 3Q23A 4ZRPA 3TBIB 1K83B 5FO7B 2SNMA 4KD3A 4OVZA 1Q12A 1UWMA 1L4ZB 2DNCA 2PO4A 3D6WA 1QB5D 5T1IA 1FD6A 4HEA1 2B2TA 1JWBD 4RF1A 2B8FA 2WQYB 1TT2A 3TEWA 2EDGA 1ZUD2 1QE6A 2FINB 1ZDXA 2BDNA 4KY7A 3DWAA 3Q22A 3P7JA 3S1NB 1JOKA 4J8QA 2EOTA 3FPPA 3RD4A 4DNRB 2L9HA 3PO2B 4B08A 1AP0A 3OW7A 3QIAA 4DA2A 4F88A 3BVZA 3H8HA 1SYEA 2RSNA 1RJTA 2QMTA 2LFIA 1O7ZA 1LT6D 1PRTC 1Q1EA 1YQ3B 3Q69A 3IFDA 4JBWA 1STBA 2BTEA 1FEHA 1MBYA 3OSOA 2JA7B 3MC0B 1AWDA 1LABA 1HHVA 1SNMA 4DK1A 2G1EA 3FILA 2EJFC 1XLNA 1TWGB 5HGTA 3T3OA 1PTOB 3LWUA 3RZDB 4BA2I 1XF5L 4EGVA 3L9AX 5AUKA 3ND9A 1EIHA 1C4QA 4RHRA 4ZLTF 1VMPA 5CV8A 1WCMB 1JWUD 4K5VA 2LY7A 4RH6A 2LKVA 1KDAA 5DNFA 3MAQA 1A3UA 1LLRD 4FXKC 1TKYA 3AE3B 3T16A 1CQFA 3SK4A 1OO9B 2EY2A 4TKOB 4XDXA 5BMGA 3HGBA 3DHQA 3Q8EA 5AFWA 1PGBA 1EY6A 3I8ZA 2F0DA 2ZXOA 3GTPB 1JMLA 1WTPA 1FRRA 2WB1B 1JCKB 4G4KA 2NN6I 2XWJB 4HJGE 3NTIA 2N55A 2XSCA 1KF6B 1DGJA 2PCFB 5EGTA 2K6AA 1WTXA 4HSVA 1QJOA 3DWGC 1F9RA 5IGGA 1XCQL 2E2DC 1SNQA 2XRSD 2EPBA 3DWPA 4ME5A 1TS2A 1E9MA 4BS9A 1PGXA 3BIID 1KABA 3P4PB 2AWNA 1ZKOA 3LWEA 5IGCA 1PGAA 4KHVA 3AMUA 1QQRA 1IUEA 5H8YE 1QKZA 1JW9D 1TS3A 2R6GA 2NZ1D 1V8CA 2DNEA 4U68A 2ZT9C 4KI0A 4C3HG 2NN6G 1H9SB 1B9NA 4Z9CB 1J7CA 1AFPA 3PO3B 3TP5A 4DFAA 2PIAA 1HZ6A 1J8IA 1T5EA 1SSOA 2B2VC 1DJRD 1F9QA 3M7NA 1SJED 3DUZA 1ZXIA 1QILA 2RVLA 1QOBA 3HRZC 3P4SB 1LTTD 1DOMA 5G5HA 2BOSA 5C3XA 1BDOA 1VZ8A 3W3AA 3AECB 1A3VA 1EU3A 1E2VA 3P1MA 3N9YC 2MHVA 5C0XI 1WXQA 2K33A 3T4AC 1W6JA 1WVLA 2WAQB 2JEAI 2L0CA 3ABVB 4YSZB 1ZYRC 3K7AB 3U4EG 1KAAA 4HCSA 2HDEA 4F7XA 4KKTA 2EJGC 1SYDA 4RGOS 2VZKB 3CIRB 1SAPA 5I2YA 3PIP3 2CU3A 1GUGA 2Z4HA 4HEDA 4MN3A 1Q3LA 1YQ4B 2OHFA 3TEXA 3WOFA 3VR8B 2DY7A 1YN5A 2EELA 3IAYA 1J9OA 2IX1A 1WD1A 1SNPA 1UEAB 4YIJA 1QLBB 2K03A 3V05A 1NEKB 3HRDD 3VR3A 3W9CB 3TMEA 4AQ7A 1DOIA 1F2RI 4KGRA 1JWSD 4HROA 4YSYB 2KJXA 2B2UC 3SR6A 4N6EB 5KIXA 1VF5C 2K32A 1K51A 1ILQA 2WXIA 1PXUA 4GDLB 2O4XA 2A6ED 2QJLA 4EVOA 4IFDG 5J22A 4XT3B 1XO3A 2D2CC 1FRDA 1EQVA 5BN3A 2EYLA 1HFNA 4HKZE 3PUYA 3B9JA 1TWHB 3M4OB 5C4ZA 1N5WA 1SYGA 3M7GA 5EBDA 3DEPA 3GTQB 4BBRB 2JQRB 3HOYB 1C48A 4OZBA 3PZ8A 1V1PB 1S4ZA 1SNDA 2A5HA 2C5CA 4KMUC 4OIJA 2IPKD 3QO2A 3KQ4A 3TEZA 4C7YA 1YNNC 3TDQA 3FAHA 2FMCA 2CW0D 1PTOD 3OMGA 4L8JA 3RPFC 1PYWD 2E76C 2MH7A 1FFUA 4N58A 2EYPA 1TVXA 3SHLA 4C3IB 3A7AB 4KJNA 2E2HB 1FXAA 3GV3A 1F0ZA 1FR3A 5CR3A 3HKZB 3ZJVA 4ZOHC 3MVVA 2PW7A 4IKGA 3AB5A 2L5TA 4S3SA 1TQOA 4M8AA 1STEA 2DYMA 2J42A 5EKIA 2MPMA 3DEOA 2F0UA 4DXGA 1V8QA 3VRAB 1TJEA 2BB6A 2J53A 1U4RA 2AUKA 1H9JA 2A6HC 5I9OA 2V4IB 2F0SA 1I4RA 2PTLA 1ONLA 3FKIB 1DOYA 3AU7A 4YWGG 3I91A 4A3IB 4Y7NB 1QNKA 1NVID 2ID0A 3ETRA 5C6AA 1X3QA 4K5XA 1NYQA 4C7ZA 4X3KA 2ICIA 2XIWA 4WH4A 1L5PA 4A90A 1YN4A 3A56A 3QJYA 5FLXL 4H13C 5ELDA 3N6RA 3J81E 3P20A 1I6VC 1WD0A 4US8A 4MH8A 5CV4A 3J7AV 1XLOA 3A7LA 4PMCA 4ARIA 4JWSC 2N9KA 4C3JG 1B9RA 3MJ5A 5JPMC 3TP7A 4XWTA 2WV6D 1O7LA 1EFID 2LHEA 4CJ0B 1L6VA 4WJWA 4OGQC 4FYDA 1Y8NB 4P16A 1SE2A 4A6QA 2L83A 5EE1A 4N9TA 1KNEA 4C1NK 2Y3AA 5DEHA 5T8IA 2WXJA 2F0OA 4JK1C 2NVXB 1BF4A 4IFDJ 5I6WA 4ZRQA 5IOCA 2GA4B 3J80E 1CA5A 4ODGA 1TWFB 3F2UA 1OXTA 2HDMA 3KBXA 2OEOA 2F0GA 2F0VA 4K6LA 1B50A 4KX6B 1B44D 3K0YA 5BN4A 1SYBA 1LTID 1FXIA 3GTGB 2YU9B 1BCPC 2V4DA 3TP6A 5BN5A 2VZKD 4IDIA 2K3UA 2PW9A 4XWWA 1QNUA 1MHXA 3MP9A 1IBXA 4XT1B 1ACCA 2JSVX 4PMWA 1EZ6A 1IGDA 2E2JB 3C3LA 1AW7A 4X3SA 1FCCC 1JE4A 5LNK1 1A2TA 3QG1A 1F2ZA 2LFNA 1EM7A 2F0LA 2X6LA 1MSHA 3AEDB 5G3LD 2W3RA 4FF4A 5C3EB 2D5GA 2WDRB 1L0XB 2AUJD 3VR9B 1KLUD 1SDFA 1JOQA 1DOLA 5BMIA 1SMYD 3AE1B 3KLSA 1V1OA 4QUCA 5LL6S 4KV6A 3PV0A 5D14A 5CV9A 1G2TA 3Q8FA 1KLGD 2WXQA 5JXVA 4A3JB 1DZ1A 5FK9C 1QOHA 2F0FA 1EWHA 1ZOYB 2H88B 5TSSA 2EZVA 3U52E 3DWMA 4HKQA 5FR3A 5KNDA 3LXFA 1KDCA 1XWEA 1LO5D 5EE0A 4BBSB 1I4GA 2B39A 1VRAB 1S5ED 2AQ2B 2R92B 3S16B 1AZPA 1F2YA 2L12A 2SDFA 1HTLD 1T6BX 2G9DA 4IUTA 4RGTA 2PNRC 4ZYSA 2F0NA 1AZQA 2K0PA 1Q90A 2BA1A 3JAML 2F0QA 3R2TA 4IFDH 3LX0A 4KTAA 2IGHA 4IUPA 3K6OA 2W3SA 4CKEA 1NCVA 4YT0B 3U9OA 1EQTA 2X6GA 2KQ4X 1JORA 1JROA 5GXGB 1EEFD 1TU2B 1XCTL 3NWTA 2IX3A 1GPXA 2KVMA 1TY2A 3NSWA 1WTVA 5LHY1 2QSDA 1EY9A 5EPLA 2LEKA 2B2TC 4EQOA 1WTWA 2L4NA 3I4NB 2YYZA 1CZPA 3ERQA 2MUYA 3NK9A 1M8AA 2V3PA 4DK0A 1A15A 3AE6B 3C8YA 4FF1A 3KBGA 3PUZA 3H94A 3VYTA 1C77A 4F87A 3HOUB 3HUIA 4XDCA 1UAPA 1PRTB 5C3JB 1U4LA 2SOBA 2WXRA 5COYA 3VA7A 1FYCA 3BG3A 2K5QA 2BS2B 4DAYA 2H89B 4K2LA 5KRUA 3MHBA 2BE5C 2EE1A 1E0BA 3FVQA 2YEPB 4LK1C 1RWSA 2LMCA 2MGSA 3URYA 1PTOF 4RFBA 3VR4A 3MEHA 2QILA 2KA7A 3ONAB 4KKIA 1CHPD 1BBXC 2LGIA 3HP3A 1TWAB 1TKEA 1CT1D 1DM0B 1I4PA 5JEAG 3MFYA 3BWUD 3FMCA 2OT2A 4IN3A 4XQQA 1LTRD 4WFN3 2A69C 3H6MA 3Q0AA 1BUVT 1MI0A 4NKLA 1FMAD 3D6CA 1IGCA 1K8OA 2L1AA 3H0GB 3DXJC 2Q8RE 3S2DB 3I70A 2JYEA 3O13A 4ULLA 3T51B 2Y5PA 5JOBA 4B0EA 3BVGA 5CBAE 3P75A 5K5PA 2D9UA 4ZRZA 1MVKA 3K57A 1GHJA 2Z8LA 2F0EA 3D31A 4NMZA 2JE6I 3ITPA 1C79A 2E2IB 2A68D 4ZUJA 2Y5CA 2K05A 2KWDA 5C4XB 4OL7A 3SK5A 3AV8A 2BBCA 1CK1A 1CZGA 1C76A 4OO1H 2SEBD 5M5WB 3E9SA 4A9AA 1LV9A 1H9MA 3KWLA 4EQPA 2D5DA 2R93B 4IUQA 1R7SA 2Q8TA 1TKGA 4RAUC 4UAIA 1ILPA 2HCIA 1K52A 3VQIA 4RNAA 5T1GA 2RBMA 2JXTA 3NVVA 4A3GB 4RCNA 3GTLB 3NRZA 1XYIA 1C4CA 5IT9L 4PQXA 1OFFA 3GQBA 1E2WA 3BYYB 3W2DA 3P4RB 2MEKA 2O5IC 2PVGC 1EOTA 1OQQA 2WNMA 3HOZB 3I90A 2KMMA 4B0MA 4MM3B 2WXLA 1G91A 4MIUA 1PLFA 2RSOA 2DBYA 4GLSC 2I2YA 3A54A 2K22A 2M56B 1HQMC 5KGUA 4QB4A 4G7HC 5MPOA 3TZDA 1WYGA 4OZAA 2AQ3B 5M3FB 4WQMA 2K5PA 1SSNA 1T3QA 1E2ZA 1BXTA 4FXDA 3K58A 1SYCA 5IGBA 3AE9B 2WXGA 5CBEE 1G291 4CJ1B 2CQAA 2XN9C 5C5MA 1EEID 4XXEA 3G7LA 3FC4A 2RPVA 2MJEA 3L4PA 2M0AA 3T53B 2JYOA 1VZ7A 1LTGD 1VDZA 2JEBI 3BK1A 1RODA 5BYQA 3BVMA 1BUIC 1J7AA 1NYRA 1QOAA 4LTUA 1EL0A 5IGFA 1VR9A 1JB3A 3EUB2 2WP9B 1TR5A 5JEAJ 4ZHOA 3V3XA 3NBHA 4ZK9B 3U2SC 1IL8A 1TIID 3AEGB 5C2TB 2AWOA 3FDTA 4CKBA 1B1ZA 1Y1WB 3D4WA 2WP8J 2K04A 5ELBA 5HFYA 4H44C 3KK7A 3SVMA 4CGYB 4L63B 1HEZE 5G3LF 4X3UA 1UWXA 1JICA 2NWGA 1ESFA 1NR4A 4J6HA 1Y1VB 2EY1A 3AE5B 5G5GA 2WIIB 3AE8B 1PRTD 5EKKA 2K1BA 2INNE 4HSPA 1H9SA 3PUWA 3I4LA 2BYTA 2E6XA 3C1EA 5CC4A 1JOOA 4JE3B 2TSSA 5C0XG 1BNZA 1UUPA 4DXFA 4FF2A 1C8CA 2WU2B 2C9OA 3EVQA 3BDLA 3OWEB 4QMGA 1EWYC 2CJOA 2ZXRA 4TMAB 2M2LA 1DCZA 1F2LA 2EYFA 1N62A 4TQ1A 3WCQA 4A8XC 5A2QE 4CJ2C 4LMQD 2F0IA 4HR7B 1HA6A 2WKDA 2Y0SB 1CJEA 4DAVA 2DN8A 2L1BA 3QOLA 2R3ZA 1YMHE 1FNWA 1I6HB 1A70A 3UI3A 2MP1A 1PDQA 1QCBD 2RDGA 1B53A 2PZUA 3PUXA 1K53A 3RFZB 2JA5B 2V0GA 2EYJA 2OXPA 1SE4A 1ML0D 1D1IA 1K8MA 5C3WA 4R8NA 1S5DD 4K8IA 3S14B 4G57A 2B8GA 3HEJA 4IUUA 1PFDA 1L6UA 2HQEA 3OMCA 3W5VB 1PFNA 3VR5A 1A6XA 1E6EB 3TEYA 1YNJC 5CMDA 2PZTA 3TP8A 2QDBA 2JX5A 3ZJUA 1EZ8A 3DMUA 3SDZA 1UNSA 2HTME 1GOZA 3Q24A 3ZQ4A 3RMHA 2R61A 3R2IA 2N9LA 2BCOA 4DU9A 1BMLC 1QWYA 1ET6A 3IKJA 5JEAH 3BS1A 1PZID 5DM63 4YSXB 1STYA 5C4HA 3HOWB 2J52A 4BWGB 4QIWB 4KD4A 1O80A 4JPSA 3NBIA 4NAMA 3JAME 5EJWA 2AQ1B 2KEDA 1SB3C 2XVSA 1KFYB 3A55A 1JRPA 1V1PA 3AEBB 4KN7C 4HMIA 2JWUA 3ZGZA 1BQQT 1EWCA 3VR6A 1IYUA 1NR2A 1X32A 2XRQD 1B9MA 5JPNC 5H92C 1DONA 2MJ8A 1DXMA 3L3OC 4OO1I 1RFKA 1RM6C 2XWBB 5E3FA 1KRHA 2WXNA 4RA8A 1C9FA 2KDMA 3QB3A 2IGGA 2ACZB 2EYMA 1ESRA 3OIPA 2RDHA 2B63B 1FD7D 4DAPA 1FNUA 1L0VB 4V190 1B4OA 3C1FA 4FVMA 2WKCA 3IFTA 2NTTA 2ZW0A 2I38A 2BB5A 3AEFB 1NUCA 3NUCA 1U4MA 5C0XJ 2LUMA 3EJIA 1RTOA 4DF7A 1RKNA 4J1MA 3T3NA 3SK6A 1I3QB 1GJXA 1BCPB 5KNBA 2SNSA 3E56A 3KWVA 1RHPA 5FOBB 5M3MB 4XIGS 3GO5A 4K6DA 4L23A 4U673 1WWTA 1XLQA 1I4QA 2PZWA 4KJOA 1NAPA 4US9A 1O7YA 1ZXTA 1PZJD 3D4RA 3GTMB 2M19A 3CRKC 3J7YW 3AE7B 1ZEQX 1IKMA 3E0JA 1MSGA 3GTKB 3SFEB 3HVZA 5EPKA 4KGTA 3K5LA 4P2CB 4K14A 1U9RA 2B2YA 2NN6H 2PYKA 5J1ZA 1DOXA 2X38A 2SAKA 2KOLA 1SFOB 3X3MA 1TKWB 4G7ZC 1VDVA 4OIKA 4OHJA 2WDQB 3PUVA 3MXGA 5CORA 3B2GA 1WRIA 3ZJTA 1PZKD 1GUNA 1A2UA 3HVDA 1LTAD 3P1HA 3VYUA 2ICEC 4USAA 1PMRA 4XE0A 4H7BA 1VLBA 1SNCA 3S1MB 4L6TB 4MHEA 1EU4A 3PIO3 2RMMA 1EYAA 1JQYD 4C3HB 3VA5A 3PMFA 1MHHE 2I07B 4BA1I 2WDVB 2NTSA 2QEJC 1J7BA 2KHSA 1K50A 5C4JB 3DM1A 4CHTB 2WXMA 3PO0A 3J9CA 1HUNA 4C56C 1S5FD 5FO8B 2B2WA 3OIQA 2ON8A 3MFGA 4ZUIA 4WIPA 1EY8A 1OQRA 4ARCA 3MHZA 2IL8A 2IDYA 2E75C 4V0BA 1XLPA 4XQNA 1GHKA 3SXHA 2E3TA 5J39A 3J7AF 4H2AA 1Q10A 5IT9E 5HHDG 2BW2A 1VCIA 2LHDA 2WINB 2Q8IB 1ZE3D 1SNOA 4ZKBB 3GV6A 2NUCA 2FFKB 1SF0A 4YTNB 5C0XH 1HA5A 3E5SA 2A6HD 4BY7B 2VB2X 2R7ZB 2KQ3A 3C46A 2K5DA 2MJ3A 4RCOA 3R93A 4IUNA 1G2SA 2F0TA 1D4BA 1CA6A 4FO2A 2K9XA 2Q5WD 5EPJA 2L11A 2HDLA 1D6EC 1ET9A 1RCVD 5HG2A 1OXSC 2EXZA 2OF1A 2O5JC 1O78A 1PRTF 1GUTA 3EGRA 3H3VC 2WXFA 1DD2A 1XXGA 5BYRA 3VYSA 4GDKB 3Q8AA 1BOSA 4YTMB 4WORA 4NW2A 4XTCS 2BS3B 3NUHB 2QF7A 3A8IE 4LLGM 2YEPF 3D4DA 5KNCA 4CBVA 3RUZA 4C3IG 2W82A 1DOKA 4EQNA 4TRDA 5ISRA 2GI9A 1Z6HA 1N5XA 2RA4A 2NMQA 2WXOA 3FILB 5IGEA 1WTRA 3R3OA 2VXWA 1P7EA 2N0SB 3S9WA 2ZW1A 3FRPB 4JWUC 2O2LD 1U4PA 1HZ5A 2DWQA 4IUVA 3J81L 2AX5A 1EY7A 5BMHA 2WXHA 1F2MA 5ELFA 1Y8OB 1XEEA 5D3DA 1TS5A 1QOFA 3AN1A 3S1QB 3NS1A 2WACA 3EFXD 1FM0D 1RD9D 1CTMA 2Z4IA 3W1SA 2MJDA 5I4DA 1YJJA 4PV1C 2X69A 2BA0A 1X3PA 3SK8A 1A3TA 4RGMA 1MI2A 2J7ZA 3BDCA 4PT5A 3HZXA 1QG7A 2ENBA 3G6JB 3TN2A 1P7FA 1PTOH 2F0KA 2XNAC 3QOJA 2INPE 2IGDA 3OOCA 3UI2A 1D1KA 1SE3A 3NVYA 5M9OA 3MWYW 4XDDA 5LL6X 2CJNA 4P6VF 1IW7D 1BCPD 2PMVA 2JA6B 4Q0FA 1MGSA 4TSSA 2FHTA 2PMZB 2CHBD 1WSPA 1V97A 2F3WA 3U9SA 3MTSA 4YXDB 3J80L 2JU6X 2KCCA 1F2RC 3K59A 1HTPA 3HG9A 5EBCA 2N88A 3BZDB 4QCLA 1OXVA 4HCEA 4DNTB 4NJCA 4AYBB 4NP5A 2DLBA 1HQRD 2K01A 5HI1A 3TSSA 5DAUA 2A6EC 2KUMA 3RLFA 5D3IB 1QF6A 4ID6A 5A35A 1EY4A 1C4PA 5KYIA 2EY5A 4HTHA 1BO0A 2KN4A 1W6KA 4A3MB 2FE8A 1STGA 4UDUC 3H09A 4B9WA 1CI3M 4RF0A 1LT3D 1LTBD 4IURA 5ELCA 1B3AA 1WGKA 1GXDC 3D8GA 1EIGA 3AE2B 3NHHA 3T56B 3B2FA 3M85A 1TYGB 2ZXPA 1ENAA 1II3A 1KTKA 1ROEA 3CKIB 2KCNA 1HFGA 5EE9A 4XQJA 3CRLC 4ILWA 1HCZA 4ZAIA 1I4XA 1S5CD 1WTQA 2CW0C 1PTOC 3VYRA 2JZPA 3AE4B 3N52A 4RKBA 4DQOC 4L1BA 1SIJA 1E10A 4A93B 3GP7A 5EE3A 5E1FA 2EVBA 2JSOA 3K5OA 1YNTE 4C3JB 1CHQD 3MXUA 4I65A 3KLRA 4OZCA 3SEBA 5IIFA 4J3OD 3W5UB 1RYJA 3SE0A 5I2XA 1LT4D 3T13A 2F0JA 3HOXB 2DY8A 1Y56A 5CV7A 4IALA 2QIEB 4N9PA 1AYFA 1TS4A 1HPCA 2EKIA 3HOVB 2F4IA 4I7ZC 1PDXA 1FO4A 1QT9A 5EQ0A 1OXXK 1SXTA 5C5LA 3RZOB 1VJKA 4OW0A 3NWSA 3GS2A 1GUOA 2M00A 1F77A 4WWMA 3BYTB 5FLXE 3S15B 5K36G 4XYQA 4FP5D 2JYTA 1HXYD 1FGBD 1I50B 1XTCD 3NVWA 2FJ2A 2LJIA 4JX1C 4C80A 4LK0M 3VR2A 2L55A 5ELEA 1STAA 3U7ZA 1D2BA 2NBFA 3NTHA 4FNFA 1OXUA 2W54A 2K7VA 2N7JA 1R4QB 2K28A 3DWQA 5DM73 1GUWA 3AMZA 4C2MB 4QF4A 2B2VA 4KKJA 2HCCA 1ICWA 2BE5D 2Z1CA 3I3CA 1KDBA 1GUSA 1PUTA 4DGZA 3NPPA 4IFDI 5E4WC 1FFVA 2V3NA 3IXSA 1YJIA 4E6IA 3GD7A 3CHBD 3LYYA 2PVOD 3PZ7A 1GB1A 1FCLA 4PNYA 4KHZA 2A69D 2VB3X 2F3VA 2WXKA 4L2YA 4R9WA 2TMPA 1JWMD 4HRSA 3A8KE 5JJZA 3IL8A 1GAQB 5I6YA 3NTKA 4MT5A 1ENFA 3E6ZX 2EJMA 1GB4A 2OEDA 2F0PA 3M4YA 4IOIE 4A3FB 4ZKCB 1DYQA 2FBWB 4O42A 2A74C 4FXCA 1M4VA 1I7HA 3BK2A 2B2UA 2QCPX 4K2KA 1B2TA 2D62A 1QOGA 4ZQ3A 5I9PA 4M1UB 3V2TA 3FEWX 4TQUS 3TUOA 5F2DA 3P42A 2BDOA 4A55A 4BY1B 2B76B 1XX8A 4KGSA 4H0LC 1RF2D 1TY0A 5IODA 3KLSX 1SMYC 2JP1A 3IT6B 3Q8CA 3K5NA 1T5XD 1EYDA 3NE5B 2WS3B 5D65A 3CWIA 1Q1BA 1N61A 2NVTB 3BDOA 2PKOA 3AM9A 3NQTA 2RQXA 4Q2JA 4B9XA 3WDNA 1Z47A 4PMBA 2ONQA 2IX0A 2M9VA 1SEBD 1BR9A 1MD2D 1JQ4A 3FPUB 2EYOA 5BYSA 1EY5A 1AN8A 4LJZC 5FO9B 4NDXA 2KAJA 1ZDVA 1SBBB 5CYUA 1HRJA 4K5WA 1Y69U 5C44B 1IYVA 2F1MA 1L4DB 4FF3A 1H9RA 3D3RA 3C2PA 2W55A 1AEXA 1TZOA 1PFBA 2GRIA 1YN3A 3I4MB 3X3NA 2KACA 1BCPF 1E0ZA 3ZYYX 1Z7TA 4QUFA 3VRBB 3S2HB 4DN4M 3IAM1 4KKSA 4RGNA 3OWFA 3EA6A 1SYFA 1VMCA 4WURA 1PFMA 1Q8IA 3L7ZC 1IBXB 3K5MA 1ZYRD 3IAS1 2EY6A 4IQZA 3S17B 1FIQA 1C78A 5JAVA 2E74C 4LAAA 4GZYC 2IW3A 1G6ZA 1LTSD 2EYHA 2J4XA 3S1RB 2IT1A 4HAEA 3I9V1 4NAWB 3M3YB 2F0MA 1VZ6A 2PQEA 2JXMB 3GTJB 2G9HD 4R3DA 2NYZD 4OO1G 3OHXC 2B2YC 1LT5D 3TZUA 1C4AA 4YTPB 1D5ZC 4CQNA 4A3BB 5M5YB 5KEEA 5JVG3 4REZA 3Q6SA 2A73B 2VNUD 1EYCA 3MZ5A 3AEEB 3P63A 1D5XC 3SR1A 4A3KB 4G7OC 2L52A 3AEAB 3QWNA 3I57A 1WTOA 1NENB 1NSNS 4FXGC 4Q5VA 4HN7A 5NUCA 3MXNA 2NVQB 1JC7A 1EY0A 3AB9A 1HUMA 3NXWA 2WLBA 5K36H 2CVRA 1N63A 1F9SA 1LACA 2VUMB 1IW7C 5JVH3 4MACA 1VF7A 4D2KA 1S5BD 3HS0C 1KH0A 2IJ0A 2QKIC 5AUIA 4RWSC 5CGKA 3V96A 4EE2A 4R8IA 4AS1A 4KY6A 1FNVA