3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Superantigen-like Protein
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
1B1ZA 3EA6A 4TSSA 1HA5A 4RGNA 1SEBD 1CHQD 2IPKD 2R61A 4OHJA 1CK1A 4DXGA 1FNWA 2TSSA 1FD7D 1LT4D 5D3DA 5ELBA 1CHPD 1LTRD 3BYYB 4RGMA 1HTLD 2AQ3B 4L6TB 3CHBD 4RH6A 1LTGD 4K6LA 5ELEA 1SXTA 2J4XA 1STEA 1DJRD 1HXYD 1XXGA 1M4VA 1PRTC 2G9HD 4RFBA 1RDPD 1BCPD 1D6EC 1G8ZD 1KLGD 1KLUD 1SE2A 1KTKA 1LO5D 2QEJC 1LTBD 4Z9CB 1XTCD 1PTOH 1S5ED 1EEFD 1TS4A 2RDGA 2AQ1B 3DWQA 1YN4A 4ZYSA 4DXFA 2ICIA 4RGOS 1EU3A 4RCOA 1AW7A 1PYWD 1JWSD 3W2DA 2QILA 1FNVA 1MD2D 1S5CD 1UNSA 1SBBB 2O2LD 1D5ZC 1I4RA 1L0XB 3BZDB 2IJ0A 1PTOB 1EFID 1LTAD 1L0YB 1QILA 1ET6A 1SE4A 1RF2D 1I4XA 1HQRD 5ELDA 3DWAA 5ELCA 1I4QA 1EWCA 4NZLB 1UUPA 1YN5A 3DWPA 2RDHA 1ESFA 3SEBA 3R2TA 2XRSD 1BCPB 1PZKD 1TS3A 4RGTA 3TSSA 1LT5D 1LTID 1TS5A 3URYA 1S5BD 1T5XD 2Z8LA 1TY0A 1FNUA 1S5DD 2SEBD 2CHBD 4RHRA 1PZID 3V05A 3MFGA 4L63B 1FGBD 3OWEB 1PTOF 1AN8A 1I4GA 1PTOD 1PTOC 1TY2A 5TSSA 1V1PA 4BWGB 1SJED 1PRTF 3O13A 1YN3A 1EU4A 1S5FD 1LLRD 1V1PB 3EFXD 1SJHD 1PRTD 1LT3D 1BCPC 3BVGA 1JCKB 1JQYD 2XRQD 5FKAC 4UDUC 1LTSD 3BYTB 1BCPF 4O1NA 1JR0D 1ET9A 1ENFA 1I4PA 2XNAC 5ELFA 1GOZA 3BVMA 3KLSX 1JWUD 1BXTA 1D5XC 2WV6D 4RHSA 3GP7A 1V1OA 1RCVD 4C56C 1CQVA 1PZJD 1LTTD 1D5MC 1LT6D 2XN9C 5D3IB 3R8BA 1I4HA 3R2IA 1TS2A 2NTSA 1PRTB 2NTTA 1DYQA 1JWMD 1EEID 2AQ2B 1RD9D 1CT1D 5I4DA 3MC0B 1B44D 1F77A 5FK9C 3BVZA 1SE3A
chains in the Genus database with same CATH superfamily
5C4JB 2FAZA 1M1KC 4HDQA 5F2DA 2JZZA 3I55A 2R61A 2M9VA 3Q3MC 2JVCA 5D3DA 2KTRB 3PMFA 4RMAA 1CHPD 5E4WC 1CUKA 1PLFA 2KNBA 3VR2A 5JVG3 2G3QB 1RHPA 5M5WH 4DR4L 1F2MA 2MRPA 2NWGA 4GLSC 5C6AA 1UE6A 1LTGD 1Q7YC 1N9WA 4RG1A 5M5WB 4JI2Q 1EM7A 3WOFA 1STGA 3K58A 4GLAC 2UXBL 3LYYA 3AB5A 1I5FA 2PQEA 5GAEC 1F0ZA 4HWIB 1KH0A 1WXSA 1RODA 1AP0A 3U50C 3ERSX 1SE2A 3UE1A 3NZ3A 2G4SA 1FCLA 3MXPA 2RHQB 2D0OA 2RDGA 3A9KB 3PLUA 1TKWB 3KLSA 1D8LA 1G51A 3T53B 1MHWC 3HKZE 2BYTA 1SNOA 4NNJB 3IAYA 5D14A 1NMGA 1PYWD 3M4QA 3FC4A 1X65A 3G4SA 4GOPB 2EJMA 2UUBQ 1D5ZC 1R7SA 1QB5D 2OHFA 4K5WA 5KIXA 2C60A 4ZHPA 2H5XA 1FO4A 2BYVE 3VA5A 1RF2D 3H09A 2WXKA 1JJCB 1C48A 1K8RB 2MQHA 2PI2A 4WWOA 1ENAA 5FR6A 1WR6E 2XEWA 1ILQA 1D1KA 4H13C 4HJ8A 4X66Q 1VQ5A 1NVID 2DZJA 3TIXA 5IIFA 1FFUA 3DHHC 1UGMA 1IXRA 1PZKD 3HOWB 2KANA 2LASA 3NTHA 2VW9A 1GG3A 2B2WC 3SDLC 4EQ5A 4KD3A 1FRDA 1CJEA 2JN4A 2FCSA 1J7CA 2B29A 4QGUA 5CV6A 4DUZQ 3PUWA 3KF6B 4A3MB 3RNFC 4PS8A 5HURA 3AQQA 1EOVA 3WDNA 1WX9A 2BVCA 2LRWA 4DAVA 1Q81C 3E56A 1E24A 3TZDA 4G4KA 3NHHA 3RN2A 5JEAG 5BMGA 3P1MA 1PXUA 2NN6I 4A3GB 4C3IG 3S2HH 2D11A 4DV7L 2H1EA 2LGYA 1IBKQ 2KZRA 2PJHA 1LTSD 1GXDC 1W6KA 1MKHA 1GVPA 1QNUA 2KHIA 1J5EQ 1SGHA 3LJ3A 4K2LA 3EECA 3EROA 3QHTA 2B3AA 3NUCA 1MGSA 3HK0A 2CQAA 3NWSA 4HCSA 1VF7A 5IP9H 2QCPX 1JB3A 4HTHA 1B4OA 4US8A 3WCQA 1FD6A 4RHSA 3GP7A 4C56C 2D9UA 1PH2A 4Y7NH 4IFDH 4ZRIA 4N8X1 3GTKH 3NS8A 3L0OA 4G11A 4XC2A 2MFIA 1JWMD 1IW7D 1HZ6A 4L5TA 5J3BA 2PCFB 3W3AA 4AIMA 4DR3L 5JJKA 3MXUA 4IURA 4E6IA 1VQ9A 2HHHL 1VRAB 5H8YE 2EYLA 3ZW3A 2DAJA 3OJ4B 1MG4A 4IPCA 4JI5Q 4KHVA 3BZCA 1LT4D 1KNEA 3BDCA 3KUDB 3IBEA 1KD1C 1L1OA 5JZEB 2JA5G 3NP8A 3PIPA 2Q2UA 2V4LA 5KHQA 4U68A 2VZAA 2ZW0A 2AKWB 4NAMA 1TWFB 1TYGB 3AEGB 2FMMA 4MTNA 1SXTA 2WDVB 3BIID 4OVUA 2VUMG 1HUMA 1JMCA 3TQYA 3G6JB 4URKA 2V1CC 2C5LC 1KLGD 1G8ZD 1E8ZA 4OVVA 3HZXA 4KDIC 3EC8A 2NVYB 3AV8A 2EJGC 1RKNA 3J81j 3DWQA 1X3QA 3I9V1 4WJPA 5FO7B 2IO0B 3Q23A 4KHPQ 5CHFA 1L6UA 2KDFB 1EL0A 4IUMB 3A1QA 3VUYA 2L55A 3S9WA 2MPMA 2JE6I 2MBOA 2KFKA 4PYZA 1WJ6A 2K39A 2GA4B 4PK1A 2A74C 4X3UA 3MXGA 1WI5A 4W9CA 2O5JC 4JWSC 1F52A 2KQ7A 3WANA 1OEYJ 3J80E 5IAAC 4A3IB 3CF6E 4DV6Q 4NW2A 4NXMQ 1PUTA 5E7NA 3AULA 5ELCA 4DR6L 5E6PA 3ALBA 1PFSA 2QCZA 2CJNA 1X56A 4J1MA 3SEBA 3GTQB 1N62A 1I6HH 4RCNA 2QKIC 3M4PA 5DM63 1AZPA 2QIEB 3AN1A 5DCNA 3ZTCA 1S3OA 4XT3B 3HOYH 1IGCA 4FVMA 2F4VQ 1FYCA 3BJUA 1RM6C 5LXIB 1A3VA 2CHBD 3K7AH 3QOLA 2MW5A 3N1ZC 1FL0A 3QX1A 1ZUD2 1XNRL 4XDXA 5BO4B 2PZUA 3L2PA 1WTRA 1PTOF 1VDZA 3NUHB 1NMFA 1EYCA 1I4GA 3DBLI 3CPWA 1TY2A 4A3DB 3V6EB 4K5XA 3L3OC 2RSUA 3F8TA 2D07B 4ACFA 5L95C 3QOJA 4A93H 1HZ9A 2J52A 1YOVB 1PH8A 4OGQC 1EYGA 4C7ZA 2INPE 1SB3C 2CW0C 1YEZA 1P3QU 2Z6KA 3PF5A 3VA7A 2NVTB 4BS9A 5KNCA 3KWLA 1SIJA 4R8IA 4IOIE 2KN4A 2F0UA 4K8IA 4X62Q 4DN4M 2XSCA 5C3EH 1PH4A 2GN5A 1YJ1A 4HIKA 3GTKB 2K3UA 4HROA 2DYMA 3PREA 4DAYB 1W6JA 5TR5A 5IYBG 3SR1A 1VD2A 4HIMA 4A76A 3C1EA 2I0QA 2BQQA 1OXXK 5EE3A 1QZGA 4JE3B 4FDBA 5LMNL 2I5MX 4NKLA 4ZLTF 2ZNVB 1YVCA 2YEPB 2R7ZH 2MX2A 2VNUD 3OMGA 2WQYB 1LM0A 4QL5A 1LXDA 1VQEA 2NZOA 2PVOD 5KGUA 2O4XA 5FK9C 4R1JA 4BZAA 4HJGE 4YXDB 2Q5WD 1S40A 1L4DB 4YCUA 4QUFA 2C9OA 2XGTA 2LXCA 4A3BH 4WORA 3CD6A 2DZMA 3MHSD 5C4XH 2KOXA 4HLEA 3B1LX 5JHAA 3CMAA 2BTEA 1RFKA 3Q3NC 2HJ8A 1TWGH 1FD7D 5EKLA 3G7LA 4LNFA 1QUQB 4ALPA 4YTNB 1PFDA 1Q1OA 1WSPA 2N7EA 1R4MB 3QIJA 2DX5B 4IDIA 4KZCA 1C3TA 1UWVA 4O42A 4JI3Q 1LFDA 4GGQA 4E74A 2J4XA 3TEYA 3MTSA 4GS3A 1TWGB 2CU3A 4B6WA 1U0LA 1HZ5A 3TEWA 1BUIC 1ROEA 2KO3A 4H44C 4KLKA 4A93G 2NZHA 3Q2AC 4I6NB 2WXGA 3PV1A 1XLOA 2L9HA 1YN4A 3NQIA 3D4RA 3DHGC 4K7SA 1VQAA 1C78A 3HUIA 2B8FA 4KKTA 2F0GA 5JVH3 1NYQA 3IXSA 3VTWA 4RKLA 1K53A 2WXRA 2MQJA 3JC66 3S24A 4XQQA 4CKEA 1UNSA 2QEXA 2VQFL 3J81i 5KYIA 3STBD 1JB7A 1O7IA 2MP1A 3BZDB 3L9AX 4Y52H 2NS5A 3KQ4A 3RFZB 1H8CA 1YIWA 1V1QA 2EMSA 1VR9A 3AECB 2M1MA 1YQ3B 4KKUA 2K5DA 3S1MB 3QCAA 5IWAL 2VUMB 5JAVA 3NJTA 3VDZA 1IBMQ 2BE5D 1EY8A 2HUGA 1PGBA 1ZPSA 1ESFA 1U4MA 4BY1H 3PIO3 3N9YC 1BCPB 4I65A 3WALA 2MSED 4A6QA 2IYDB 2V4DA 4JW0A 3C19A 2K9XA 2E2HB 1DOXA 5D6JB 1TY0A 4TKOB 1S5DD 4RHRA 1VQ8A 2GLSA 4HMJA 2M4NA 4NJ6A 3V05A 1EF1A 4WIPA 1T0RC 3STBC 1SYBA 1VMCA 3B2FA 1JRPA 2MP2A 4PNYA 5HG2A 5IGCA 2WXNA 5LHY1 4R4IA 3Q22A 1PGXA 5TSSA 2JA7B 2B3GA 1XYIA 4A9AA 1YHAA 3O13A 1PYBA 1S5FD 1P98A 1V1PB 1TWAB 3B9JA 4RNAA 2F4IA 4X62L 2RVLA 4JPBW 1BBUA 5EQ0A 3D32A 5JPMC 3KYHC 3QK0A 3ZIMA 1JQYD 2AWTA 1Y1VB 4LUOA 2R2OA 3HM3A 3IFWB 4KSKC 2IBIB 1QNKA 2K22A 4JGHB 2FJ2A 3GD7A 3PO0A 3I91A 4OWXB 1A62A 3S1QH 3RI7C 2GBJA 2LKVA 1BUVT 4YT0B 3RNAC 2WB1G 1Q8KA 4DV3L 2KDMA 1EF5A 2J7ZA 1CKNB 3GTPB 2LWPA 5DPRA 1RYJA 3W5VB 2WV6D 4BA1I 2K5HA 1BO0A 2B8GA 3WAPA 3CCEA 3FMCA 2FUHB 2PYKA 1KNAA 2L0TA 1NUCA 1AFPA 3L10B 3QO2A 2NBWB 3P42A 4CBVA 3F2DA 2N88A 3BK2A 3VYUA 2KVMA 2WXMA 2B2TA 1L6VA 2KT7A 2K1BA 2VY3A 1VMPA 3H91A 4XT1B 3DM3A 2ALYB 1OO9B 4C3JH 2J53A 4W9HA 5C44G 4UY8C 2N7DA 3TS2A 4HXDA 3FVQA 4K5VA 3VFKA 2NVQH 1HNXQ 1IKLA 5IY0A 4FNFA 5IWAQ 2I2YA 3PVLA 2HIVA 5C44H 1E7VA 4B08A 5M3MH 2M19A 2OEOA 4S3SA 5IP7H 3Q24A 3U8ZA 2Z1CA 4DFAA 2MHJA 1R9TB 1LTRD 2IHEA 2E5LQ 4JI6Q 4AJWA 1P16A 3JAMc 5IT9E 1I94L 3CHBD 1HQMC 4L8JA 3JYUA 1CI3M 3A0JA 3HOWG 1QKZA 3KJOA 4C1NI 2MBHA 4W9DA 4DV1L 5ELEA 1U4AA 4JVZA 3QJZA 2QHOA 2SAKA 3HM6X 3NELA 1DJRD 2SOBA 3CRKC 2DJFC 2EYJA 4ANXA 2L5TA 2BB6A 1XCQL 3OSOA 5EKKA 1SSNA 1UD7A 1LTBD 3VTUA 2RCNA 3ND8A 4ZUJA 2ATWA 2Z0EB 4DK0A 3GTLH 3DVGX 4F1SA 2V3PA 3AE3B 3A1QB 1OGWA 1YX6B 1STNA 4IUVA 4RCOA 1T6BX 4POGA 2KVZA 4DQOC 1JWSD 3CCQA 1WGRA 2UUAL 1A63A 3I4OA 1VLBA 2JQOA 3TBIB 1SNCA 3X23A 2R2QA 2JXXA 3OJ3A 1GUGA 4IM0A 1NYRA 3S2AA 2BCOA 2X38A 2QW7A 3A4RA 1ZYRC 1N34L 1D1IA 1ILPA 2C35B 5IYBH 3GZNB 3H0GB 2YVCA 3DWAA 2XWJB 2BWES 1QG7A 1MBYA 3K6OA 1YN5A 2J0MA 2RDHA 2K6DB 3S14H 3P2BA 1E10A 4GNXB 5IN7A 3N52A 4A3JH 1JOQA 2W3SA 1JORA 4LK0M 1TS3A 3SDZA 2WXHA 3TSSA 4LNOA 4MACA 3RPFC 2JXMB 4OXPA 5EDSA 5FO9B 1V81A 1YZ6A 2K6QA 2PPBC 1WF9A 3HOXG 1MSGA 2ENBA 1DCZA 1DOIA 1JALA 1TWAH 2O2VA 3AEBB 4ASWC 3GDEA 2LXKA 4YWGG 1RJTA 4OWWB 4JI4Q 3U7ZA 3RZOH 1CA6A 3FKIG 3HKSA 3CCJA 4LF7L 3M4OH 3F2UA 1SJED 3A5ZB 1PRTF 1ZYRD 2F0DA 1KDAA 1W3SA 1KAWA 3HOVB 4NQKE 1SROA 3HOXB 1JCKB 1S4ZA 1WX7A 2KJRA 4ZHOA 4X65L 4B3TQ 2FBWB 2WDQB 2HIXA 4FJZA 3C2PA 2K04A 4ZRZA 2HTHA 4LF6Q 3RNBC 2W3RA 3L54A 1UF0A 3CWIA 4E3CA 4FA6A 2HDLA 2L12A 1GJXA 1JWUD 3CKIB 3NTKA 1BXTA 4FXDA 2ASQA 2YEPF 2CJOA 2E2IB 2K33A 1KL9A 4MH8A 4DHJD 2XBBC 2DYBA 4H0LC 3UF8A 1GUTA 2VH1A 3I73A 3R8BA 4IW0A 2GVBA 4DR1L 2ZTEA 4C80A 3PUXA 1H9SA 2EE1A 3H0GH 1XT9B 3MC0B 1B44D 5CV5A 4A55A 2NB0A 4B9KA 2NR2A 3PQIA 2DY8A 4K14A 3K0YA 4L5RC 4CHKA 3D6WA 2I1KA 1N32L 4OHJA 2JA5B 2K50A 1XJVA 1C0AA 1BDOA 2KLCA 2YTYA 2WYQA 2I07B 4LUVA 3ZJUA 3VR8B 4A93B 5AZHA 2JA5H 2RCFA 4W9JA 4MZ9A 2CHWA 3TCAA 1HNZL 1ZP0B 4DR5Q 3A7AB 5I9OA 1R4QB 1WJ4A 2H4OA 3GTLB 2LS01 1VQLA 1LYLA 1A2UA 4JLCA 2F0EA 3EFCA 4II3B 2KTRA 4BBRG 4DV4L 3DEPA 1XO3A 4NMZA 3ULJA 1UBQA 5BN5A 2R93B 3VYRA 4DHZE 3SFEB 3VYSA 4Q0FA 3Q69A 4EZJA 2I46A 2CHZA 1CFMA 2D0PA 1KF6B 4C3HB 1TWCH 3NTIA 3LB8C 4JI7Q 4R4OA 1HZAA 1WYDA 1E8YA 3PGEA 4X65Q 3A4SC 2Y0SB 1O7ZA 2UUAQ 2J42A 2UXDL 3AE2B 4A3FG 2KTFA 5IGDA 1KAAA 1Y69U 3SU8X 4LNNA 4QJFA 3BY4B 2JSOA 1MD2D 1L1OB 4L1BA 1KABA 4LF5L 2LSSA 1A70A 2A5UA 1FPYA 4MELA 4TV3A 1N5XA 2GBRA 4GKJQ 1TT5B 5JOBA 5E6NA 3KH0A 1E7PB 2UU9L 1FXIA 5ELDA 3J7YW 2BWFA 5H1SE 2C7HA 1IYVA 1NEKB 1XMQQ 3PF4A 2JT4B 1C79A 5EPKA 2DBYA 2YU9B 4YWLA 4B3ML 2J0KA 5CV8A 2KAJA 3P4RB 2YV5A 2NYZD 4LF9Q 2ZVNA 2QDBA 2MBEA 2VZKB 4HRSA 4CKCA 4UP8A 1WXMA 2B2VA 3DBHB 4IALA 3RN9C 1D2BA 2RSNA 1KRHA 2JA7G 3Q8EA 2M8SA 4CJ2C 1VQNA 4CDCC 3FKIH 4CHTB 4IUNA 1V1PA 1YI2A 2IT1A 4PV1C 3PSIA 2B63G 4DR5L 1A5RA 3WAOA 4JYAL 1V97A 1WVLA 3HEJA 4NJ7A 4N58A 3HKZB 4WJNA 1ZXTA 2L8JA 2N9KA 4IWQA 2XRQD 2A68D 3GE8C 3EBEA 3RMKC 4WH4A 4FF2A 3H94A 3N20C 5E4XA 3RMHA 4G50A 3L13A 4II2B 1CKNA 2L52A 1K28A 4NDXA 4POFA 2KMAA 1L2NA 4R4CA 2UXCQ 2ZPNA 5G2NA 2R7DA 2D62A 1ZGUB 1DOMA 1JWAD 3R7RA 4HJ7A 4KI0A 2JQRB 3OIPA 5IYDH 1U4PA 2B2WA 2ZXOA 2JZ3B 1I4HA 3PUZA 1P1AA 2M0AA 2PIAA 1JRUA 4DXAB 2KHSA 4A3EH 4CQNA 3DEOA 4B9XA 1PMRA 1ACCA 2E6XA 3NOBA 4A3DH 2RPQA 2R3ZA 3J81E 2KCMA 1HA5A 5HGQA 3ABVB 2PQAA 1WTWA 2IGDA 3DMUA 3AI5A 3RUIB 1C76A 2MGSA 3OPOA 4B3MQ 3CMEA 2JYTA 1ML0D 3C1FA 2N1VA 3T3OA 2PZTA 3QG1A 4JV5Q 4A3FH 3HOUB 3JSVB 4FJYA 3IHPC 4HCEA 4GNXA 4OZBA 4JBKA 1UE7A 4QUCA 2WWZA 3P4QB 1SMYC 4WAFA 3NZUA 2YLMA 2ZJRA 1ZKHA 4BBSB 3ZO5B 5C0XH 2B39A 4OIKA 4LJPB 1AWDA 3TBLD 3P7JA 2CU1A 3K5OA 1PTOH 3RD2A 4N9PA 4OIJA 4IN3A 3NY5A 1F9RA 1XWEA 2ICIA 2OWOA 3X0WA 5IKCM 1IBKL 1BVSA 1EU3A 2E2JB 2LUEA 5BMHA 1V2YA 3TEZA 4YL8A 2BA0A 4CDEC 3ICEA 4MGYE 4JI1L 2KK8A 1DD2A 4EUTA 3VR4A 3PPAA 1YJJA 3IAS1 3DHIC 1I4RA 5C4XB 3EGRA 2K6AA 2LHEA 2WX0A 5D7GA 1UE5A 4MEMA 1Q12A 3KJPA 2KX0A 1SE8A 3KF6A 2VQFQ 5E6JA 3KOJA 5FLXE 4A3KH 2FFKB 3DQVA 1QZEA 1HR0Q 1BNZA 1K83B 2N3SA 3SVMA 2IY5B 1L1OC 4GOPA 3T51B 4GKKL 2WXQA 3VR3A 4ME5A 4XDCA 3Q8BA 4WWNA 4PYUA 1B9RA 1B9NA 3P75A 4HJ9A 5HI1A 2F0WA 5LNK1 2XIWA 4JG2A 4A3GH 1KFYB 2I1JA 2WKDA 3ZLZA 1K83H 4G7OC 1QOGA 2C5CA 1XPOA 3AE7B 3H3VI 2E76C 1IKMA 1RAXA 1PTOD 4BY1B 2KACA 3E6ZX 1F9QA 1Q0WB 4DV7Q 2KMMA 1NAPA 3K59A 1B3AA 2KQ3A 3DPDA 1YHQA 3BDOA 2O6VB 2PTLA 4QB4A 3DBRB 2F0QA 4BBSH 1BCPC 2RBMA 1BF4A 2V1YA 3HVDA 3PO3H 3LXFA 3P4SB 1FJGL 2MNAA 1N8RC 2LHDA 4K3BA 5I2XA 2WAQE 4P6VF 4XQNA 1HTPA 3HFZB 4P72A 3TN2A 1L7YA 3K5LA 4DKAC 3RZDB 1WE7A 4AQYQ 5C5MA 3JAML 1XF5L 2VH2A 5IGEA 4YSXB 1GC6A 2K05A 2Q8RE 4IM3A 3RYTA 1TZOA 4YSZB 3S2DB 3ZUNA 4AYBE 1NENB 3ZJTA 5IP4D 3FEWX 3NBIA 1XPRA 4JI1Q 5AJ3L 4JIOU 3D8GA 3J80L 4ZK9B 4HJ5A 2L76A 2LUMA 4C3JB 2NCNA 2IL8A 1CKMA 1L0VB 4X3TA 3CQZB 2RD0A 2ZXPA 3SE0A 1U4LA 4XTCS 3GTPH 3KYCD 1GHJA 2JK8A 3KBGA 4A90A 3I3CA 4KD4A 3I4NG 1B1ZA 3EA6A 1RWSA 2JEAI 4JQWC 3DWMA 2HJ1A 1SYCA 4GKKQ 3SK5A 4ICUA 1JWBD 1RLFA 5DAUA 1Y1VH 1GM5A 2RR9A 2EZVA 4A3CH 2Z6KC 1JC7A 3ONSA 4ZDVA 2HT1A 4HDOA 1LACA 4IFDJ 4UPAA 2EQSA 2JA6B 1XNRQ 5IO9A 3MTNB 3KF8B 3Q8AA 1STEA 3RNCC 2M2LA 1E90A 4FLHA 3S15H 2G9HD 1K8AC 3A54A 1UELA 5EE1A 1JOOA 4UAIA 3ULLA 1YJNA 3PGZA 2ZNVC 2RF4A 5EE9A 4DV3Q 3ZNHB 2R7ZG 3RNUA 1TKGA 4ZYSA 3SD5A 4MSMB 5J17A 2Q2IA 4PG3A 2OTJA 1FJGQ 4JPSA 3HOWH 4IUQA 5C0XJ 1V9JA 3RD4A 3S15B 5BYSA 4IC7B 2EVBA 1TR5A 3R3MA 2M56B 3DUZA 2VUMH 1WE6A 1SBBB 4XZ4A 1WMHA 1SYGA 4PZ7A 2K5NA 3ZRCA 3BZKA 4I6LB 3I56A 5C3JB 2NZ1D 2F0MA 1SLJA 1MHXA 2GMIC 4KDLB 2ICEC 4HAEA 1K0SA 3ONAB 4WJWA 2N9EB 2E2IH 2D5GA 1TBEA 3C0RB 3U52E 5IODA 4UP7A 5GMVA 2A69D 2RDBC 4LAAA 4ID6A 1OXUA 4KN4C 3AFQA 1ONLA 2WKCA 5JEAJ 5M3FG 1N34Q 3EUB2 1Q86C 4D2KA 4TQ1A 4IFDG 1WZ3A 2A19A 5C3EB 2MWSB 3UDFA 1OXVA 2Z8LA 3LGJA 1MIUA 5GAHC 3PZ7A 2Y5PA 3J7ZC 3N6RA 2W55A 3CCSA 4DR2Q 4L63B 1XQQA 2KCCA 1Z47A 2L83A 3I7FA 3SGIA 1KIXA 1A2TA 2KWDA 1SAPA 3SR6A 1E7UA 2JA6H 1X54A 4DV5Q 3AMZA 4MIUA 4DF7A 4QQBX 3EFXD 5CV9A 1PRTD 1STAA 2N55A 1LT3D 4OWTB 5BR8Q 3KVFB 3K57A 4CO7A 1SN8A 3NWTA 2LD9A 2KENA 4NY0A 3MA2B 4KHZA 5GADC 2DYOA 3Q8CA 1FM0D 5FKAC 2INDC 4LK1C 1VZ6A 4O0AA 4R4QA 1C1YB 1PQSA 2DJGC 4HIOA 2SNSA 4RAUC 1QF6A 1Q1BA 4MJSB 3PIOA 2V9HA 5GAGC 2PE9A 5ISRA 2QC8A 2UUCQ 5AJ3Q 1IPGA 1D5XC 5JPNC 1Q1EA 1WCMH 2MUYA 2OTLA 4GMVA 4A3BB 1CQVA 2GBKA 3IFTA 4E71A 1D5MC 1EY0A 2F3WA 1IYUA 2AUKA 2F0IA 5D3IB 2HCIA 5IYCH 2Q8TA 2MBQA 4LFCL 4XXEA 2JP1A 2DNEA 3H3VH 3AH7A 4X64L 2MHVA 4OW0A 4KKSA 2KVRA 1F77A 1YMHE 3BVZA 1N60A 4XGAB 2V4IB 4IWOA 3I4LA 1FRRA 1XX8A 1DOYA 1SEBD 2IPKD 4JI4L 1PDXA 1GUAB 2IO3B 3I2ZA 1FNWA 4BKGA 1HJPA 1C9OA 4PZ8A 2ZVOA 4M8NA 4MGKE 3QQ8B 5DM73 4P2CB 4EVOA 2N9LA 3V61A 1TTNA 2JEBI 5E3FA 3NS1A 3IT6B 3TP7A 1V86A 3HOYG 3OW7A 5CGKA 4DDGD 2A6ED 3EIVA 3B2GA 3RN5A 4FN2A 2QSDA 1YNND 2E2DC 1CZWA 1E3PA 5C4JH 4LF6L 1B2TA 2DENB 5I2YA 5LLIA 1XCTL 1LO5D 4R9WA 1HH2P 4IUUA 2DY7A 1B7YB 2F0HA 3GV3A 1EEFD 5M5YB 4OO1H 2A8VA 1VCIA 1WTVA 1XLQA 4YWMA 2IX3A 4X57B 3PSEB 1IBXB 2B2TC 1N36Q 2KEEA 3MEFA 1Q8IA 3HOZH 4DR7Q 3AEFB 5CTRC 4A3IG 1N61A 1Q3LA 3NQTA 5CBAE 5KEEA 4JBJA 2IO2B 1SRUA 2CKZB 4RWSC 4MGZE 1F2YA 3GV6A 2D3GA 4W9GA 1EY9A 4IJHA 1CSQA 1ASYA 3ZTDA 3L7ZC 1IUEA 1L0YB 1FIQA 1XD3B 2G45B 2PLPA 1GD7A 2ZTCA 4YWKA 1WTXA 3TMPB 1AZQA 4MN3A 1YNNC 3RZDH 1F2RC 5BYRA 3ENEA 4A8XC 1CZGA 1K8MA 1EO6A 2JSVX 1YJWA 3LWEA 1II3A 2XRSD 4LFCQ 2QGQA 4OX9L 5CV7A 2E2JH 2W82A 1FCCC 2LGSA 3AEVA 2LFIA 1QWYA 4EZLA 1PH5A 4DR4Q 3N30A 4NQLB 5J18A 2YTVA 1V5TA 2DN8A 4IZ8A 2A73B 3I3TB 1PZID 4A20A 2WDRB 3PO2H 2LGDA 4MTKA 3OWEB 2F0JA 1ZEQX 1EQQA 1EIYB 1WJJA 3RULA 2Z4IA 2K4KA 4XQJA 1F9SA 5FLMG 1Z2MA 4X6AH 3S1QB 2D2QA 1WCMB 2A6HC 4ICVA 3OIQA 3CC7A 4DWFA 1R4MI 5BN4A 2JU6X 2EY2A 2SNMA 4U673 4JI7L 3BVGA 1CSPA 5HKHA 2VXWA 2FCMA 2VS1A 3HP3A 2MJ8A 3BYTB 1BQQT 2N8NA 3UQBA 1ICWA 2ZW1A 3GE3C 4AJYB 2CWAA 3S2HB 1FFVA 1SMXA 3PZ8A 2B76B 4IKGA 1VQMA 4YSYB 4NXNQ 3K80C 2FXQA 4FYDA 1GHKA 3HOYB 2LXAA 1HR0W 4X64Q 5FLMH 2UU9Q 5C2TB 3UE0A 4AYBG 4LF4Q 1PFMA 4O2DA 2PMVA 1O80A 4ZQ3A 3TS0A 3L0WB 4CKBA 1CT1D 2E75C 3E5SA 2K32A 2UWQA 4LJOB 4P1CC 1NBWA 1HTOA 4GDKA 1KDBA 2Z9HA 5LL6S 2K0PA 1Y8RC 1Y56A 3HVZA 4DXGA 3KLWA 3AEEB 4OX9Q 2I5HA 4EQOA 3TP6A 4XDDA 2FUG1 3NSWA 2W54A 1TKYA 3L16A 3Q0AA 4RH6A 2EXZA 3ZXVA 1X55A 4C7YA 1VQ7A 4LNKA 4ARCA 1EFWA 3GO5A 5AZFA 5L83A 2ZZPB 3UI2A 1QOAA 3E0EA 3PIP3 4LF8Q 2KDEB 1JQ4A 3ECIA 1CM9A 4OELB 4BOZB 4K2KA 3JAME 2F0PA 3PO3B 2A69C 4HSVA 2X6LA 4MSQB 5EPLA 3P1HA 2F0VA 1TWFH 2L1BA 2PO4A 2KQSA 5EKIA 4A3FB 2WHIA 3K81C 3VXWA 2HDMA 4IO9A 3V96A 4WWPA 5C3XA 1X6OA 2K01A 2R93H 2MEKA 3IAM1 2AMCB 3PT2B 3WIMA 2PW7A 2R6GA 2N9XA 1V80A 4KHPL 2E2HH 4AOFA 3D0FA 1O78A 3V3XA 1TWCB 5CORA 5IGGA 3JVZX 4C00A 1HZCA 1QILA 1N33Q 4YY3L 4RKBA 5AEKB 3MXNB 5HHDG 2B2UC 3S16B 4K0KQ 4BY1G 3T1HQ 3Q8FA 3OW2A 3H7PB 1YBYA 2K5QA 5A2QL 4MJSA 2KC2A 1EZ6A 1UE1A 1UUPA 3DWPA 4WQOB 3CSTA 2EXDA 4HJAA 3A8IE 4LCDE 1JJGA 3GTJH 1LTID 2Z0SA 4WJ3M 1S5BD 3AU7A 3DHQA 3W1GA 2LGXA 5C3WA 3K9PB 3CQZH 1V6EA 4JV5L 3T16A 4JOIA 1C4PA 2JY6A 3ZNID 2MP2B 2NBUA 3NG0A 1N32Q 3FHWA 3M3YH 2OJRA 2L0CA 3SHQA 5FR3A 3QB3A 1HHVA 1F2RI 2BBCA 2K75A 4OL7A 5J22A 4XWTA 1E5WA 2BGFA 2L3ZA 1C7YA 1STHA 1KRTA 3MZ5A 5M9OA 2KWUB 1CQFA 1GUOA 3K7AB 3TDQA 3DVNV 1Q46A 3F2BA 1RL2A 1EUVB 2Y0SE 2F52A 3BK1A 4FHJA 3HRZC 2CW0D 1K51A 2JA8G 2IZVB 3T1YL 1QQRA 1H9SB 1WJUA 5ELOA 4RA8A 1NNXA 3X3MA 4BY7G 1T0YA 2WAQB 4KN7C 3I4MB 3NENA 4NXNL 1M90C 1PDQA 5ELFA 1N63A 4GDKB 3G6EA 2MJEA 4RF0A 2KFJA 1MJDA 4CYEA 1NCVA 3T8MA 2VB3X 3DBHI 3JAMi 4M8MA 4J6IA 2K52A 4C2MH 2JA6G 3CMMB 2K25A 1GKHA 1PZJD 4DR6Q 1GPXA 2XN9C 4DNIA 3MJ5A 4LMQD 1EOTA 2ZTDA 3R2IA 1TS2A 1ICFB 2NTSA 2P5ZX 4AQ7A 3HOUG 1Y14B 5A35A 1EEID 2AQ2B 2B2VC 4YY3Q 3AE1B 2LVQA 5LL6X 2C7NB 4GKJL 4N8FA 2ZEQA 3RT3B 1BR9A 1VCBA 2I5LX 3ZXRA 1ZDXA 1JE5A 4ULLA 1GUNA 1EIFA 1KRSA 1SNMA 4HR7B 5C0XI 2NN6G 4MHEA 1O7LA 3W1SA 2BKRB 1LM8B 2DNFA 3H8HA 3VR9B 2WINB 4F88A 3QARA 4GZYC 1STYA 1ZW7A 3FILB 4ZUIA 3NVWA 5AFWA 3OTOL 3HIZA 4HCNB 3ZJVA 1XMOL 4HKQA 4QAYA 5IYCG 4HEA1 2LMCB 2EJFC 2PQAB 5I6YA 4TMAB 4KKJA 1XLNA 1PH1A 2OQ0A 2NVYH 3RZOB 3KLRA 1EQTA 4IFDI 2G5DA 1BMLC 3RCZA 3TJPA 5DNFA 3PO2G 4AQYL 3CCRA 4MGIE 1XNQQ 4Z9CB 1S5ED 3SK4A 3PS6A 2VQEL 1B50A 1JROA 4FXKC 2RPVA 3AE8B 4P71A 2INCC 2PNRC 1SYDA 1FXTB 4ZRKA 1S1QB 2Q2TA 5JHBA 3S16H 2K7VA 1N33L 1IHZA 2WX1A 4TVAB 3VUXA 1E6EB 1NY4A 2DZKA 1WD0A 1WGDA 4DBGA 3DOWA 2O2LD 1WGKA 1SFOB 4PQXA 3KWVA 1TQOA 4H02A 1YHBA 3T1HL 1YIJA 1BBXC 2R7FA 4TUUA 3KK7A 3RLNA 3GTMB 4X66L 3WA0A 2J0JA 4L2YA 4AWJA 1I4XA 2LGIA 1C4QA 4JWUC 1SSOA 3M7GA 1BBWA 1I4QA 3AE9B 4NZLB 2CKHB 3VUWA 4M01A 1S3SG 4G3XB 4QY7A 2BE5C 1F1HA 3HOXH 2DWQA 4GNXC 4B3RL 1WY8A 1IBML 4K81A 4XYCA 4ZOHC 2EY5A 4A3JG 1Q82C 3E9SA 3RNEC 2KDBA 2M0XA 1P7EA 4FXGC 4BA2I 3RZWC 3DXJC 3BU2A 1F2LA 5I9PA 4PMBA 2LZ6A 2SDFA 5C4HA 4JI5L 3GQBA 4MNOA 3RLOA 4L5SA 1V49A 2W9NA 3U9OA 2K8CA 3LNNA 3D31A 5C4XG 3WOEA 1UWMA 1V8CA 1YN3A 4KY6A 5MPOA 3VR5A 4J3OD 4DK3C 3ZNZB 2PW9A 4K7UA 1C9FA 4JBMA 3GTOH 3ZGZA 1F9PA 3H7SA 1HPCA 4KGTA 4C2MB 3N3KB 3SHLA 3ZNGC 1BCPF 2QDFA 3HGBA 3TEHB 3CW2C 3X3NA 2KWVB 3CCUA 1LUZA 4G7ZC 5FJ8H 4GU2A 3BVMA 1E8XA 3V60A 3EJIA 1U9RA 4GOPC 1Z5SB 3M62B 2WU2B 2F1MA 2PNHA 5FJ8G 1T0SC 1V1OA 3UDGA 1X3GA 1WGGA 4JI8Q 4FADA 1LT6D 4YIJA 3BS1A 4UHVA 2WAQG 2MJ3A 3U58A 2GRIA 3APDA 1KOTA 4M1UB 1SYEA 1SNDA 2O6VD 3J9CA 1IW7C 2LMCA 1K73C 4HK2A 1YNXA 3C3LA 2WXOA 3ZKJC 1WTOA 3S17B 1EWIA 4A3KG 4IPGA 1GB4A 1SE3A 4N9TA 2EYFA 3G48A 1BT0A 4CDFC 4H2AA 2NPTB 2ZJPA 5JH5C 3ITPA 1DOLA 1LQBA 1WCMG 3OTOQ 1ZOYB 4M0WB 2LJ5A 4M8AA 2AHOB 2FINB 4B3SL 1IZ6A 1WXVA 2ZCBA 5D2MB 1J7AA 4B3RQ 5E1FA 3KFUA 4PMWA 1T9HA 3BWUD 3ZDMC 3CF5A 2F0KA 3M63B 3W1YA 3MEHA 3FAHA 2X6GA 2AL3A 2IX1A 2IW3A 2EKEC 4G57A 1PFNA 5M3MB 2JYOA 5FOBB 4FF4A 1XNQL 1I94Q 1MI0A 3L4PA 4NJCA 4F7ZA 3GTJB 3S1MH 1HTQA 4R4TA 4GLVB 1RDPD 2DNCA 2IHFA 1KLUD 3AEDB 4LFBQ 4HPPA 2QEJC 5E6OA 1GJZA 3J7AV 3AM9A 1M8AA 4A3MH 2IDYA 4OO1G 1EYDA 1JMLA 4DDID 2R92B 1K0RA 4A3IH 4BKTA 1WWTA 4GB9A 3CC4A 3HOZG 3E3XA 2JRHA 3RNGC 4ANWA 4Q5VA 1QVCA 4FHKA 1L0XB 3FPUB 3G71A 4NXML 3Q6BA 4B0MA 4ZCKA 1SE4A 4K1RB 5CMDA 1VQHA 5M5XH 3OOCA 3S1RB 2RMMA 2GB1A 2LVOA 3T3NA 3KDFB 2PKOA 3CC2A 1VQDA 2PE6B 3BG3A 3IT4B 3FKIB 2LRUA 3W1BA 2KXJA 2G1EA 3AE4B 2K03A 2KECA 4WJ4A 3R2TA 3TP8A 1PH3A 4FXCA 4ZYNA 4UP9A 1SDFA 4JCVE 3VH3B 3FDTA 1LT5D 3KDFA 4ARIA 4R3DA 4ZKCB 2J7QB 3OWFA 3CIRB 4GN1A 1I42A 3NVYA 3FP9A 3NEMA 5ELNA 4RM9A 2PMZE 2EIFA 2K5VA 3MFGA 1TJEA 3GTOB 1FGBD 4LNQA 1UAPA 3Q8DA 3CCVA 2BDOA 1DZ1A 1RRBA 2FMCA 1LTLA 2F3IA 2QDLA 4KIKA 3TP5A 1LLRD 2CCZA 2I38A 2E74C 4KY5A 1VQFA 4OVZA 4B95A 1IBLQ 2CR5A 2L0FA 1NJIC 1K3BC 4I6PA 3SK8A 1NSNS 4IM2A 4IUTA 3U9SA 3KUCB 1N36L 4AYBB 1P8LA 4KJOA 1QJOA 2LVPA 1RTNA 3OLMD 4LNIA 2WACA 1JR0D 1TWHB 4F87A 4XYQA 4B3TL 3AU5A 3M3YB 3Q3FA 2QJLA 3DWGC 4GN3B 4AUQC 3UDIA 4TQ0A 1GOZA 4JI8L 4A3KB 1WTPA 2HQLA 4XWWA 1QUQA 3P20A 3I4MG 3AEAB 4M0WA 5BMIA 1NR2A 2CFMA 4C4VA 3T13A 2OJWA 4BY7B 3NHEB 4ILWA 1KXLA 5LMUL 1N5WA 2B2YC 1XEEA 4P74A 4PS3A 1I35A 2JA8B 5GROA 4XE0A 3I8ZA 1OFFA 1PRTB 1IYJB 3PO2B 3C8YA 4LWCA 2BYFA 1DYQA 2EMTA 3A9JB 4KGSA 1E9MA 3TL5A 2WB1E 2AX5A 2MA9B 4S0RA 5T8IA 4DHZB 3KF8A 1PH7A 2WDTB 1WTQA 4BFRA 1IP9A 1P9DU 2IWHA 2EYMA 2FHTA 4EX5A 1YJIA 1NDDA 1D3ZA 1H9RA 4RGNA 1K9MC 1ASZA 1AH9A 4ANVA 1YNTE 4ME3A 1H9JA 1B3QA 1Z9FA 4KZ0A 3PCOB 2WNMA 5M3FH 3FILA 4M00A 1CA5A 4AS1A 4C3IH 4LF7Q 1FVIA 4KMUC 5C44B 2KCNA 1MHHE 4PT5A 1HTLD 2AQ3B 4L6TB 3PRPB 4MM3B 1E8WA 4EQNA 4MT5A 1K52A 2E8GA 4K6LA 1VZ7A 3APCA 1X3FA 3D4WA 4DR2L 1VQPA 1HNZQ 3NBHA 3MAQA 1HXYD 4QF4A 1M4VA 1K8GA 3HS0C 4A3EG 1B70B 1XTDA 1C77A 1VJKA 2JF5A 1WZ0A 4KSLC 4YTMB 3A55A 4IPHA 1R9TH 1B9MA 5JEAH 5T1IA 3S14B 3VYTA 3S2DH 3MP9A 4BKSA 2JA9A 2BA1A 5C1ZA 2AQ1B 2A4ZA 1TGZB 3GZNI 4DXFA 4DV0Q 3K5MA 1IGDA 4BVUC 1E0BA 4P16A 3V6CB 1MSHA 4LDTD 1H4RA 1EY6A 4BBSG 3GOEA 3IG3A 4C4VB 2BW2A 2QILA 4V190 1S5CD 2PVGC 3NVZA 1SYFA 1VQBA 3TREA 2GI9A 3M95A 4IWPA 1I50B 2PW5A 2JWZA 2Y3AA 2NUCA 2KHWB 3J7A5 3Q3JA 4KGRA 2EKIA 4BBNC 4WURA 1J19A 3PRZA 1R4NI 1I50H 2CS4A 3A56A 3PRMB 1OQQA 4CDDC 4EZKA 4DPGA 1H9MA 1I6VC 3GTGB 5T1GA 1EWYC 1Q5WB 2JRIB 3I57A 1JJ2A 2V0GA 2NVXH 3E9IA 2N78A 2F0TA 4A3LG 3RUZA 2KHJA 3FRPB 3FKYA 3J81L 1C4AA 4JK1C 4DAMA 1QT9A 2J0TD 2IO1B 3KW5B 3Q6SA 4M02A 3H0GG 4EEWA 5FO8B 1Y8NB 5I6WA 1HCZA 5JJZA 1QZHA 1OTRB 3MJWA 5IOIA 4AP4C 1AARA 1VQKA 4W9FA 2F0SA 4DHJB 2ZT9C 4BWGB 1IBLL 1P7FA 1ZXHA 3EFUA 4HEDA 1MVKA 4FULA 3AMUA 1X1MA 5G5GA 4I7AA 1TT2A 2BH2A 1YJ9A 2JA8H 2D10A 1LGRA 1EQVA 1CKOA 4X3SA 3ERQA 2UXDQ 1AYFA 2BDNA 3Q3OC 4BY7H 1XLPA 2UUCL 1G6ZA 2ZJQA 3OMCA 4GLXA 4LUZA 1PHJA 3DBLB 3HKZG 3KLSX 1HEZE 4GIVA 3A5UA 2ZJDA 3ZQ4A 1EIGA 2G9DA 3B08A 4N9F4 4DAYA 2BB5A 4EOYA 5EBCA 1UBIA 1E2VA 1EZ8A 2NVQB 5DPTA 1STBA 5IYDG 3PUVA 1Y1WB 2ID0A 3PO3G 3LDZE 2NTTA 4HVBA 3VR6A 4ZRQA 3W5UB 3PHXB 4BBRH 3NBHB 2WXLA 3QC8B 2UYZB 3QAQA 2RHSB 5KNBA 4XX5A 1OTCA 4N59A 1TKEA 2JWUA 2XWBB 3DBRI 1EY5A 1SR3A 1G6PA 2ZXRA 4KJNA 4DR3Q 3KUPA 4A3EB 1A8VA 2MBBB 2VRRB 3M3JA 4CJ0B 3I90A 1I6HB 3R66C 2RSOA 3NPPA 4RGMA 2BS2B 1C8CA 1PVOA 5M5YH 4HKZE 4LLGM 2F03A 1C4CA 1WYGA 1Z7TA 5C3EG 5CHVC 3M4YA 1SMYD 2BS3B 1XXGA 1X32A 4LFAQ 1UGJA 2M17A 4LDTB 1IYFA 1D6EC 4QMGA 1V43A 1IL8A 1XTCD 5GQOA 1WFYA 3I5JC 5C4ZA 1TS4A 4WWMA 4DR7L 4YTPB 3W5OA 3VHTC 1L2FA 2N4FA 4V0BA 2A5HA 1JICA 2UXCL 1I3QB 4FF3A 1A6XA 4KIKB 5D65A 1ISNA 1EYAA 2O2VB 1WMHB 4K7WA 1GAQB 2QMTA 2EYOA 2RA4A 1FXAA 5IGFA 1VQCA 1NR4A 4W9KA 3ZYYX 1ZE3D 2CH4W 3H6NA 1B53A 2Q8IB 2FCQA 1HA6A 1ET6A 4WJOA 1FR3A 4OEMB 2RKSA 1I3QH 4TKNA 2MCNB 2HHHQ 1HRJA 3GTQH 5KHOA 3MHZA 4DA2A 2KLGA 5J39A 4CJ1B 2AWOA 4K6DA 1HR0L 4DV6L 1J7BA 2Z59B 4DGZA 1K50A 3DLLA 3MXNA 3L08A 3QIAA 4KK7A 5IA7A 1HE8A 1TS5A 4PZ6A 1OEYA 3PV0A 2LI5A 2X8XX 1G291 3H7PA 1QOFA 1DXMA 2M00A 4JBWA 2O6VA 1GO3E 4WQMA 1J0GA 2D5DA 4WAAA 1G2SA 1EWHA 1E0ZA 4CGYB 3KUZA 4GXBA 3H1UA 2KA7A 1PTOC 3K5NA 4BOSC 2NVUI 1NTGA 2HQEA 1AE2A 2OQKA 1MFWA 1D4BA 1EU4A 3BDLA 2N0SB 4IUPA 1SJHD 1OQYA 2L05A 5AUIA 2KQ4X 2ZCCA 4LW1A 2VQEQ 3ML8A 4F8MA 1HNWL 3ZJYC 3CPFA 4S17A 4I7ZC 1PV4A 3U4ZA 1VZ8A 4DUYQ 3VAWA 1PH6A 4USAA 2NN6H 3I70A 1Y1WH 4L23A 2B2UA 2WLBA 2XNAC 4J6HA 4A3OA 1ENCA 5JJLA 2ZPYA 4KTAA 4LF4L 1Y1WG 2EELA 3SXHA 3IKJA 1VQ4A 1RCVD 2OEDA 4DAPA 3I72A 3GS2A 3NE5B 4APVA 1IL2A 3J81c 4IG7B 3WAMA 3AE5B 2DZIA 3MC8A 2MH7A 2Y5BB 1DM0B 2UUBL 2F0FA 4L5QA 4JOIC 2ASBA 3IRBA 4W9IA 5DLQE 1NI2A 2PPHA 1SNQA 3DBSA 3TZUA 4XIGS 1QCBD 3PUYA 2NVTH 2O5IC 2F4VL 2JXTA 4FBJB 1K3RA 3HOUH 3A9KA 4WFN3 2BOSA 3SFDB 1VDVA 4RM8A 4REZA 1UEBA 3U4VA 4QIWB 4DK6C 2NBVB 4YHHL 1XMQL 4AH6A 1A3TA 2TSSA 2F0OA 4GN5A 5C23A 4NAWB 1LV9A 1NE3A 2F3VA 1MJCA 4EKUA 4WJQA 5M3MG 1R4NB 2UXBQ 2DLBA 2XK5B 4P1BC 4LF8L 2WP8J 4HPMB 3VQIA 4B3SQ 2EDGA 2L15A 1YX5B 5DPSA 4A3LH 2FCNA 2Q2HA 1X3PA 3CCMA 1SF0A 2WXFA 2K14A 4NAWA 3NRZA 2DAFA 4GN4B 2LXJA 2KX3A 3NK9A 2KC1A 5G55A 1MJEA 1S72A 3EHVA 3CRLC 2KCTA 2BYEA 2Z4HA 3BINA 1IBXA 3LX0A 5D94A 4LF5Q 5NUCA 2JYEA 4J8QA 1KDCA 4RGOS 3IL8A 3T1YQ 3HHMA 4IJLA 3EVQA 1DONA 3QWZB 1VQIA 2K1FA 2OOBB 1J8IA 2XTIA 3D6CA 1PTOB 4P75A 1EFID 2EOTA 1OQRA 3M85A 4ITKA 3W1SC 2N49A 2JX5A 1GNUA 3VTVA 1R4PB 4J15A 3S1NH 1DGJA 2KDIA 3T4AC 4HCPB 4C3HG 2R92H 4KV2A 1L0WA 3RR5A 3UIPB 3RZFA 5IT9L 4ZKBB 3H15A 3OHXC 2K5WA 4FP5D 2CWPA 4IOCA 1QOBA 2INNE 2R93G 3PHWB 2ES2A 3HOVG 1YD8U 3P4PB 2BS4B 2QF7A 2L32A 5HFYA 4DUZL 4EGVA 3URYA 3J80c 4HIDA 5M5XB 1WOCA 2KEDA 4ZRJA 1QOHA 3VRBB 5EPJA 1FNUA 2WP9B 2KJHB 1NBFC 1UH6A 4YHHQ 2WS3B 4JX1C 4JYAQ 1AN8A 5KYLA 4JI0L 4Y7NB 3C46A 2K8BA 1HNWQ 2N7JA 2N9PC 5M3FB 4GDLA 3B6YA 2WXIA 4ANUA 2DUDA 3H3VC 2KJXA 1J8CA 2JJQA 4A3JB 4IOAA 3ML9A 2A68C 1KC8C 4HN7A 3T56B 3APFA 3EN2A 2WXPA 2E3TA 4GDLB 2KD0A 3V62A 3T9LA 2OCEA 4UDUC 4NPNA 4QIWE 2KOLA 1O7YA 1V9PA 2JA7H 4Q2JA 1OXSC 1ENFA 4K3CA 3ER0A 4OZCA 2VZKD 3VH4B 5BN3A 2F0NA 5EBDA 3R3OA 1EY7A 1X3EA 3I4MH 2VL6A 1N6ZA 3KYDD 1T5EA 4A75A 1JW9D 2HTME 4KKIA 3UIOB 3F1ZA 1KM7A 1AEXA 1GUWA 3CSFA 1TVXA 1EIHA 3MHBA 4F7XA 3D4DA 1WIAA 2D2CC 2L11A 2REXA 1WRIA 1TU2B 3PLVA 2MO0A 3OYYA 2KKCA 1L5PA 3EQLC 1YQBA 5I4DA 4QCLA 3K8AA 3MVVA 1ZDVA 3M7NA 5BYQA 4BXXG 5IT9c 3UI3A 1RTOA 3M9BA 3N1YC 1HZBA 1PH9A 1QVFA 5IGBA 2BT6A 2C7MB 4TSSA 1VQ6A 5JJIA 4IPDA 1SFOH 1ESRA 3DDCB 1HFGA 1YITA 3Q14C 2IGHA 5K5PA 5AZGA 5K36G 1WFQA 2YTXA 1XMOQ 1WM2A 2N1WA 1BOSA 4HMIA 5ELBA 2C9WB 1E2WA 2EPBA 5KNDA 1KQSA 5CV4A 2IX0A 3BYYB 3MFYA 2LJIA 2BPSA 1Y8PB 1KLVA 2D3CA 3H9DA 1A0IA 2KWCA 1RIPA 3A8KE 4JI6L 3J7AF 1WH3A 2K8HA 1M94A 1E22A 3RLFA 4R8NA 1WXAA 1BKBA 1TXYA 3E0JA 5IE8A 2YU9H 3ND9A 1GC7A 2A6EC 2AWNA 4JI0Q 3D3RA 2A1AA 2JZPA 3A9JA 1Y8OB 4G0NB 4DV1Q 1BCPD 2Y5CA 4FO2A 5LXHA 1VS0A 1WXQA 3NVVA 3CXCA 2LFNA 3A33B 4A3BG 3JSVA 4N6EB 1XPUA 3TMEA 4A3PA 5CC4A 3K9OB 1UZXB 2EYHA 1AW7A 5G3LF 4C3IB 3K7UC 3ZVVA 3W2DA 2HD5B 1FNVA 4WRDA 3AFPA 2OXPA 3CCLA 2PZWA 2IJ0A 3NXWA 1F9JA 4MM3A 1LTAD 5HGTA 3A74A 2K5PA 1E1OA 2V3SA 1TIID 2ON8A 4EQPA 4OZAA 3HOZB 2IY1B 1GUSA 1Y1VG 1HNXL 4NP5A 1EWCA 4C3HH 2R92G 3VRAB 4BBRB 4DV2L 3B0AA 2FNJB 3E9HA 2G4DB 1WM3A 5IP7G 5LMNW 5EAYA 1QLBB 3ULPA 3PZDA 2AUJD 4RGTA 3HRDD 5FLXc 4YCWA 2AL6A 4BXXH 5EE0A 2R7ZB 2L4NA 1JE4A 2ACZB 2OF1A 4KX6B 2D3AA 1FMAD 5K36H 1T0QC 2Z0DB 1L4ZB 1MI2A 5CHWA 5EGTA 3DCGA 3OAWA 3OG5A 4FJVB 3U30A 2WIIB 5G5HA 3ZDTA 4IQZA 2V3NA 5KRUA 1PA6A 3NZSA 1TIFA 2KUMA 5C5LA 4KV6A 5DEHA 3AYHB 4JI3L 1W2BA 1EUJA 2KMCA 1OXTA 2EYPA 4TRDA 5H92C 5CX3A 2FIDA 1ZXIA 4X3KA 2BKFA 4DU9A 3UINB 3VVWB 1Q10A 1X9NA 4LFBL 1ET9A 5IOCA 1MPEA 1D7QA 5AUKA 1I4PA 2YYZA 2F0LA 3A7LA 5LMNQ 2NPTA 3QA8A 1YNJC 1V8QA 2NVXB 1DGSA 2RQXA 4ABNA 2QA4A 3S17H 1U4RA 1VF5C 4HJKA 3ZRFA 1E1TA 5GXGB 1WJNA 2KN5A 1G2TA 5EJWA 2JPHA 1DOKA 1LABA 1VQJA 1K8OA 4JC0A 4LTUA 4RF1A 3GTMH 2L00B 4OONA 3AB9A 1EQRA 1PFBA 2CH4A 1H9KA 3HOVH 1UEAB 2LY7A 3V2TA 2TMPA 4DNRB 2IY0B 2NMQA 4OO1I 1RD9D 2JUOA 1F2ZA 4EE2A 4YCVA 2GVAA 3TEXA 1NI3A 2KFKB 2MJDA 3HG9A 2L1AA 3R93A 1WI0A 1FGUA 3IVFA 1ZKOA 3LWUA 5G3LD 3H6MA 1CHQD 5COYA 4F8CB 1CK1A 2Z6BA 4KVGB 1JOKA 1G91A 2HDEA 1YNJD 3CU7A 4H7BA 2BH8A 3DVGY 3P63A 4NB3A 2ZM6Q 4BBNF 3UQAA 4A3CG 4K8JA 2AYOB 3S1NB 2GBMA 1RFAA 1G6JA 1WRDB 4LJZC 1WR1A 3N32A 1VQGA 4RMFA 3TRZA 3I4NB 1CTMA 4G7HC 4DK1A 3JW0X 4BAXA 2A6HD 3WWVA 2RGFA 4PMCA 2PI2E 3J80i 1YQ4B 2XVSA 3I4NH 2OT2A 5J1ZA 4B9WA 5L37A 1PRTC 1JT8A 4RFBA 4C3JG 5J2RA 5CR3A 1KTKA 2B63H 3QR8A 1Q90A 3MC9A 2HCCA 1WGYA 5CBEE 2B2YA 3CAMA 3TUOA 1J9OA 2GBNA 3KBXA 4KY7A 1V5OA 2Y0SG 1QE6A 5FLXL 1CZPA 3A8JE 4TQUS 5A2QE 4DR1Q 1HUNA 2MLBA 3AXCA 4P7IA 2K28A 4A4IA 1WD1A 2FE8A 2GOWA 3AU4A 1MG8A 4GOCA 4BKSD 2CHXA 2WXJA 4DV2Q 4US9A 1Z6HA 2H89B 4JL9A 4W9EA 1GB1A 4XYOA 4B0EA 1HQRD 3DVNU 1HFNA 5C0XG 4NPSA 1A15A 1E7ZA 1H95A 1SE9A 5LMUQ 3U7DA 3SK6A 2XK5A 1KHIA 1SNPA 4FF1A 1CMXB 2B63B 2FIFA 3MWYW 4A3GG 4K0KL 1KJTA 3PTFC 3R7QA 1A3UA 1EY4A 3VDYA 3QJYA 4A3DG 1T5XD 3U4EG 4ODGA 2SEBD 3IFDA 3GTGH 4P73A 2LEKA 2UU7A 2PMZB 1WX8A 3N1XC 4EFOA 4JI2L 3F2CA 4HSPA 3ETRA 4DV5L 1P0RA 2WU5B 2EY1A 3L17A 4LF9L 1T3QA 4DV4Q 2BF8B 4MDKE 4LFAL 5BR8L 3K0XA 5CYUA 2ZM6L 1TWHH 2E5LL 2VB2X 4W9LA 1J6QA 1PYSB 1WGHA 3UDXA 4DK5A 1QVGA 2HE7A 2WFWA 3DM1A 4ZRPA 3FPPA 1AE3A 1E2ZA 2DGYA 2L7RA 4PS7A 2IGGA 3M4OB 5HY6A 4O1NA 1I7HA 2KBNA 2RDFA 1B8AA 4C1NK 2MO1A 4DNTB 1U5KA 1FEHA 1TZ1A 2ONQA 4MH0E 1WTHA 4DUYL 2CVRA 2HD3A 3O65B 2H88B 5IP9G 2WB1B 4DV0L 2EY6A 4ZAIA 3CP0A 1J5EL 3GB1A 3AE6B 3I63C 3QWNA 4HPLB 2AEHA 3W9CB 2NBFA 1UWXA 1LTTD 2X69A 5JXVA 3U2SC 4A3MG 2CQOA 3S1RH 2DHZA 2D3BA 1WYWB 2KJ6A 3UGBB 2WGSA 1SIFA 2KYWA 5DPWA 1VQOA 2PEAA 1PGAA 4GSWA
chains in the Genus database with same CATH topology
5C4JB 5F2DA 2R61A 2M9VA 5D3DA 3PMFA 1CHPD 5E4WC 1PLFA 3VR2A 5JVG3 1RHPA 1F2MA 2NWGA 4GLSC 5C6AA 1LTGD 5M5WB 1EM7A 3WOFA 1STGA 3K58A 3LYYA 3AB5A 2PQEA 1F0ZA 1KH0A 1RODA 1AP0A 1SE2A 3NZ3A 1FCLA 3MXPA 2RDGA 1TKWB 3KLSA 3T53B 2BYTA 1SNOA 3IAYA 5D14A 1PYWD 3FC4A 2EJMA 1D5ZC 1R7SA 1QB5D 2OHFA 4K5WA 5KIXA 1FO4A 4ZHPA 3VA5A 1RF2D 3H09A 2WXKA 1C48A 1ENAA 1ILQA 1D1KA 4H13C 1NVID 5IIFA 1FFUA 1PZKD 3HOWB 3NTHA 2B2WC 4KD3A 1FRDA 1CJEA 1J7CA 5CV6A 3PUWA 4A3MB 5HURA 3WDNA 4DAVA 3E56A 3TZDA 4G4KA 3NHHA 5JEAG 5BMGA 3P1MA 1PXUA 2NN6I 4A3GB 4C3IG 2H1EA 1LTSD 1GXDC 1W6KA 1QNUA 4K2LA 3EROA 3NUCA 1MGSA 2CQAA 3NWSA 4HCSA 1VF7A 2QCPX 1JB3A 4HTHA 1B4OA 4US8A 3WCQA 1FD6A 4RHSA 3GP7A 4C56C 2D9UA 4IFDH 1JWMD 1IW7D 1HZ6A 2PCFB 3W3AA 3MXUA 4IURA 4E6IA 1VRAB 5H8YE 2EYLA 4KHVA 1LT4D 1KNEA 3BDCA 3NP8A 4U68A 2ZW0A 4NAMA 1TWFB 1TYGB 3AEGB 2FMMA 1SXTA 2WDVB 3BIID 1HUMA 3G6JB 1KLGD 1G8ZD 3HZXA 2NVYB 3AV8A 2EJGC 1RKNA 3I9V1 3DWQA 1X3QA 5FO7B 3Q23A 1L6UA 1EL0A 2L55A 3S9WA 2MPMA 2JE6I 2GA4B 2A74C 4X3UA 3MXGA 2O5JC 4JWSC 3J80E 4A3IB 4NW2A 1PUTA 5ELCA 2CJNA 4J1MA 3SEBA 3GTQB 1N62A 4RCNA 2QKIC 5DM63 1AZPA 2QIEB 3AN1A 4XT3B 1IGCA 4FVMA 1FYCA 1RM6C 1A3VA 2CHBD 3QOLA 1ZUD2 4XDXA 2PZUA 1WTRA 1PTOF 1VDZA 3NUHB 1EYCA 1I4GA 1TY2A 4A3DB 4K5XA 3L3OC 3QOJA 2J52A 4OGQC 4C7ZA 2INPE 1SB3C 2CW0C 3VA7A 2NVTB 4BS9A 5KNCA 3KWLA 1SIJA 4R8IA 4IOIE 2KN4A 2F0UA 4K8IA 4DN4M 2XSCA 3GTKB 2K3UA 4HROA 2DYMA 1W6JA 3SR1A 3C1EA 5EE3A 1OXXK 4JE3B 4ZLTF 4NKLA 2YEPB 2VNUD 3OMGA 2WQYB 2PVOD 5KGUA 2O4XA 5FK9C 4HJGE 4YXDB 2Q5WD 1L4DB 4QUFA 2C9OA 4WORA 2BTEA 1RFKA 1FD7D 5EKLA 3G7LA 4YTNB 1PFDA 1WSPA 4IDIA 4O42A 2J4XA 3TEYA 3MTSA 1TWGB 2CU3A 3TEWA 1HZ5A 1BUIC 1ROEA 4H44C 2WXGA 1XLOA 2L9HA 1YN4A 3NQIA 3D4RA 1C78A 3HUIA 2B8FA 4KKTA 2F0GA 5JVH3 1NYQA 3IXSA 4RKLA 1K53A 2WXRA 4XQQA 4CKEA 1UNSA 5KYIA 3RFZB 3BZDB 2MP1A 3L9AX 3KQ4A 1VR9A 3AECB 1YQ3B 4KKUA 2K5DA 3S1MB 2VUMB 5JAVA 2BE5D 1EY8A 2HUGA 1PGBA 1ZPSA 1ESFA 1U4MA 3PIO3 3N9YC 1BCPB 4I65A 4A6QA 2V4DA 2K9XA 2E2HB 1DOXA 1TY0A 4TKOB 1S5DD 4RHRA 4HMJA 3V05A 4WIPA 1SYBA 1VMCA 3B2FA 1JRPA 4PNYA 5HG2A 5IGCA 2WXNA 5LHY1 3Q22A 1PGXA 5TSSA 2JA7B 1XYIA 4A9AA 3O13A 1S5FD 1V1PB 1TWAB 3B9JA 4RNAA 2F4IA 2RVLA 5EQ0A 5JPMC 1JQYD 1Y1VB 2K22A 1QNKA 2FJ2A 3GD7A 3PO0A 3I91A 2LKVA 1BUVT 4YT0B 2KDMA 2J7ZA 3GTPB 1RYJA 3W5VB 2WV6D 4BA1I 1BO0A 2B8GA 3FMCA 5BYQA 2PYKA 1KNAA 3P42A 1NUCA 1AFPA 3QO2A 4CBVA 2N88A 3BK2A 3VYUA 2KVMA 2WXMA 2B2TA 1L6VA 2K1BA 1VMPA 3H91A 4XT1B 2J53A 1OO9B 3FVQA 4K5VA 1IKLA 4FNFA 2I2YA 4B08A 2M19A 2OEOA 4S3SA 3Q24A 2Z1CA 4DFAA 1R9TB 1LTRD 5IT9E 3CHBD 1HQMC 4L8JA 1CI3M 1QKZA 4C1NI 5ELEA 2SAKA 1DJRD 2SOBA 3CRKC 2EYJA 2L5TA 2BB6A 1XCQL 3OSOA 5EKKA 1SSNA 1LTBD 3ND8A 4ZUJA 4DK0A 2V3PA 3AE3B 1STNA 4IUVA 4RCOA 1T6BX 4DQOC 1JWSD 1VLBA 3TBIB 1SNCA 1GUGA 1NYRA 2BCOA 2X38A 1ZYRC 1D1IA 1ILPA 3H0GB 3DWAA 2XWJB 1QG7A 1MBYA 3K6OA 1YN5A 2RDHA 1E10A 3N52A 1JOQA 2W3SA 4LK0M 1JORA 4MACA 1TS3A 3SDZA 2WXHA 3TSSA 3RPFC 2JXMB 5FO9B 2PPBC 1MSGA 2ENBA 1DCZA 1DOIA 1JALA 3AEBB 4YWGG 1RJTA 3U7ZA 1CA6A 3F2UA 1SJED 1PRTF 1ZYRD 2F0DA 1KDAA 3HOVB 3HOXB 1JCKB 1S4ZA 4ZHOA 2FBWB 2WDQB 3C2PA 2K04A 4ZRZA 2W3RA 3CWIA 2HDLA 2L12A 1GJXA 1JWUD 3CKIB 3NTKA 1BXTA 4FXDA 2YEPF 2CJOA 2E2IB 2K33A 4MH8A 4H0LC 1GUTA 3I73A 3R8BA 4C80A 3PUXA 1H9SA 2EE1A 3MC0B 1B44D 5CV5A 4A55A 2NB0A 2DY8A 4K14A 3K0YA 3D6WA 4OHJA 2JA5B 1BDOA 3ZJUA 2I07B 3VR8B 4A93B 1ZP0B 3A7AB 5I9OA 1R4QB 2H4OA 3GTLB 2LS01 1A2UA 2F0EA 1XO3A 3DEPA 4NMZA 5BN5A 2R93B 3VYRA 3SFEB 3VYSA 4Q0FA 3Q69A 2I46A 1CFMA 1KF6B 4C3HB 3NTIA 3LB8C 2Y0SB 1O7ZA 2J42A 3AE2B 5IGDA 1KAAA 1Y69U 4L1BA 2JSOA 1MD2D 1KABA 1A70A 1N5XA 5JOBA 1E7PB 1FXIA 5ELDA 3J7YW 1IYVA 1NEKB 1C79A 5EPKA 2DBYA 2YU9B 2KAJA 5CV8A 3P4RB 2NYZD 2QDBA 2VZKB 4HRSA 4CKCA 2B2VA 4IALA 1D2BA 2RSNA 1KRHA 3Q8EA 4CJ2C 4CHTB 4IUNA 1V1PA 2IT1A 4PV1C 1V97A 1WVLA 3HEJA 4N58A 3HKZB 1ZXTA 2N9KA 2XRQD 2A68D 4WH4A 4FF2A 3H94A 5E4XA 3RMHA 2L52A 4NDXA 2D62A 1DOMA 1JWAD 4KI0A 2JQRB 3OIPA 1U4PA 2B2WA 2ZXOA 1I4HA 3PUZA 2M0AA 2PIAA 2KHSA 4CQNA 3DEOA 4B9XA 1PMRA 1ACCA 2E6XA 2R3ZA 3J81E 1HA5A 3ABVB 1WTWA 2IGDA 3DMUA 1C76A 2MGSA 3OPOA 2JYTA 1ML0D 3C1FA 3T3OA 2PZTA 3QG1A 3HOUB 4HCEA 4OZBA 4QUCA 3P4QB 1SMYC 4WAFA 4BBSB 5C0XH 2B39A 4OIKA 1AWDA 3P7JA 3K5OA 1PTOH 4N9PA 4OIJA 4IN3A 1F9RA 1XWEA 2ICIA 1EU3A 2E2JB 5BMHA 3TEZA 2BA0A 1DD2A 3VR4A 1YJJA 3IAS1 3EGRA 1I4RA 5C4XB 2K6AA 2LHEA 5D7GA 1Q12A 5E6JA 5FLXE 2FFKB 1BNZA 1K83B 3SVMA 3T51B 2WXQA 3VR3A 4ME5A 4XDCA 3Q8BA 1B9RA 1B9NA 3P75A 5HI1A 2F0WA 5LNK1 2XIWA 1KFYB 2WKDA 4G7OC 1QOGA 2C5CA 3AE7B 2E76C 1IKMA 1PTOD 4BY1B 2KACA 3E6ZX 1F9QA 2KMMA 1NAPA 3K59A 1B3AA 2KQ3A 3BDOA 2PTLA 4QB4A 2F0QA 1BCPC 2RBMA 1BF4A 3HVDA 3LXFA 3P4SB 2LHDA 5I2XA 4P6VF 4XQNA 1HTPA 3TN2A 3K5LA 3RZDB 5C5MA 3JAML 1XF5L 4YSXB 5IGEA 2K05A 2Q8RE 1TZOA 4YSZB 3S2DB 1NENB 3ZJTA 3FEWX 3NBIA 3D8GA 3J80L 4ZK9B 2LUMA 4C3JB 2IL8A 1L0VB 4X3TA 3CQZB 2ZXPA 3SE0A 1U4LA 4XTCS 1GHJA 3KBGA 4A90A 3I3CA 4KD4A 1RWSA 1B1ZA 3EA6A 2JEAI 3DWMA 1SYCA 3SK5A 1JWBD 5DAUA 2EZVA 1JC7A 1LACA 4IFDJ 2JA6B 3Q8AA 1STEA 2M2LA 2G9HD 3A54A 5EE1A 1JOOA 4UAIA 5EE9A 1TKGA 4ZYSA 4JPSA 4IUQA 5C0XJ 3RD4A 3S15B 5BYSA 2EVBA 1TR5A 2M56B 3DUZA 1SBBB 1SYGA 5C3JB 2NZ1D 2F0MA 1MHXA 2ICEC 4HAEA 3ONAB 4WJWA 2D5GA 3U52E 5IODA 2A69D 5JEAJ 1OXUA 4ID6A 4LAAA 4KN4C 1ONLA 2WKCA 3EUB2 1D4BA 4TQ1A 4IFDG 5C3EB 1OXVA 2Z8LA 3PZ7A 2Y5PA 3N6RA 2W55A 4L63B 2KCCA 1Z47A 2L83A 1A2TA 2KWDA 1SAPA 3SR6A 3AMZA 4MIUA 4DF7A 3EFXD 5CV9A 1PRTD 1STAA 2N55A 1LT3D 3K57A 3NWTA 3MA2B 4KHZA 2DYOA 3Q8CA 1FM0D 5FKAC 4LK1C 1VZ6A 2SNSA 4RAUC 1QF6A 1Q1BA 5ISRA 1D5XC 5JPNC 1Q1EA 2MUYA 4A3BB 1CQVA 3IFTA 1D5MC 1EY0A 2F3WA 1IYUA 2AUKA 2F0IA 5D3IB 2HCIA 2Q8TA 4XXEA 2JP1A 2DNEA 3AH7A 2MHVA 4OW0A 4KKSA 1F77A 1YMHE 3BVZA 1N60A 2V4IB 3I4LA 1FRRA 1XX8A 1DOYA 1SEBD 2IPKD 1PDXA 1FNWA 5DM73 4P2CB 4EVOA 2N9LA 2JEBI 5E3FA 3NS1A 3IT6B 3TP7A 3OW7A 5CGKA 2A6ED 3B2GA 2QSDA 1YNND 2E2DC 1CZWA 1B2TA 5I2YA 1XCTL 1LO5D 4R9WA 2DY7A 4IUUA 2F0HA 3GV3A 1EEFD 5M5YB 4OO1H 1VCIA 1WTVA 1XLQA 2IX3A 1IBXB 2B2TC 2KEEA 1Q8IA 3AEFB 1N61A 1Q3LA 3NQTA 5CBAE 5KEEA 4RWSC 1F2YA 3GV6A 1EY9A 3L7ZC 1IUEA 1L0YB 1FIQA 2PLPA 1WTXA 1AZQA 4MN3A 1YNNC 1F2RC 5BYRA 4A8XC 1CZGA 1K8MA 2JSVX 3LWEA 1II3A 2XRSD 5CV7A 2W82A 1FCCC 2LFIA 1QWYA 2DN8A 4IZ8A 2A73B 1PZID 2WDRB 3OWEB 2F0JA 1ZEQX 2Z4IA 4XQJA 1F9SA 3S1QB 1WCMB 2A6HC 3OIQA 5BN4A 2JU6X 2EY2A 2SNMA 4U673 3BVGA 2VXWA 3HP3A 2MJ8A 3BYTB 1BQQT 1ICWA 2ZW1A 3S2HB 1FFVA 3PZ8A 2B76B 4IKGA 4YSYB 4FYDA 1GHKA 3HOYB 5C2TB 1PFMA 2PMVA 1O80A 4ZQ3A 4CKBA 1CT1D 2E75C 3E5SA 2K32A 1KDBA 5LL6S 2K0PA 1Y56A 3HVZA 4DXGA 3AEEB 4EQOA 3TP6A 4XDDA 2FUG1 3NSWA 2W54A 1TKYA 3Q0AA 4RH6A 2EXZA 4C7YA 4ARCA 3GO5A 3UI2A 1QOAA 3PIP3 1JQ4A 1CM9A 4K2KA 3JAME 2F0PA 3PO3B 2A69C 4HSVA 2X6LA 5EPLA 3P1HA 2F0VA 2L1BA 2PO4A 5EKIA 4A3FB 2HDMA 3V96A 5C3XA 2MEKA 2K01A 3IAM1 2PW7A 2R6GA 1O78A 3V3XA 1TWCB 5CORA 5IGGA 1QILA 4RKBA 5HHDG 2B2UC 3S16B 3Q8FA 2K5QA 5A2QL 1EZ6A 1UUPA 3DWPA 3A8IE 1LTID 1S5BD 3AU7A 3DHQA 5C3WA 3T16A 1C4PA 5FR3A 2L0CA 3QB3A 1HHVA 1F2RI 2BBCA 4OL7A 5J22A 4XWTA 1STHA 5M9OA 3MZ5A 1CQFA 1GUOA 3K7AB 3TDQA 3BK1A 3HRZC 2CW0D 1K51A 1QQRA 1H9SB 4RA8A 3X3MA 2WAQB 4KN7C 3I4MB 1N63A 1PDQA 5ELFA 4GDKB 2MJEA 1NCVA 2VB3X 1PZJD 1GPXA 2XN9C 3MJ5A 4LMQD 1EOTA 3R2IA 1TS2A 2NTSA 4AQ7A 5A35A 1EEID 2AQ2B 2B2VC 3AE1B 5LL6X 1BR9A 1ZDXA 4ULLA 1GUNA 1SNMA 4HR7B 5C0XI 2NN6G 4MHEA 1O7LA 3W1SA 3H8HA 3VR9B 2WINB 4F88A 4GZYC 1STYA 3FILB 4ZUIA 3NVWA 5AFWA 3ZJVA 4HKQA 4HEA1 2LMCB 2EJFC 5I6YA 4TMAB 4KKJA 1XLNA 3RZOB 3KLRA 1EQTA 4IFDI 1BMLC 5DNFA 4Z9CB 1S5ED 3SK4A 1B50A 1JROA 4FXKC 2RPVA 3AE8B 2PNRC 1SYDA 2K7VA 1IHZA 1E6EB 1WD0A 2O2LD 1WGKA 1SFOB 4PQXA 3KWVA 1TQOA 1BBXC 3KK7A 3GTMB 4L2YA 1I4XA 2LGIA 1C4QA 4JWUC 1SSOA 3M7GA 1I4QA 3AE9B 4NZLB 2BE5C 2DWQA 4ZOHC 2EY5A 3E9SA 1P7EA 4FXGC 4BA2I 3DXJC 1F2LA 5I9PA 4PMBA 2SDFA 5C4HA 3GQBA 3U9OA 3LNNA 3D31A 1V8CA 3WOEA 1UWMA 1YN3A 4KY6A 5MPOA 3VR5A 4J3OD 2PW9A 1C9FA 3ZGZA 1F9PA 1HPCA 4KGTA 4C2MB 3SHLA 1BCPF 3HGBA 3X3NA 4G7ZC 3BVMA 3EJIA 1U9RA 2WU2B 2F1MA 1V1OA 1LT6D 4YIJA 3BS1A 2MJ3A 2GRIA 4M1UB 1SYEA 1SNDA 3J9CA 1IW7C 2LMCA 3C3LA 2WXOA 1WTOA 3S17B 1GB4A 1SE3A 4N9TA 2EYFA 4H2AA 3ITPA 1DOLA 1ZOYB 4M8AA 2FINB 1J7AA 5E1FA 3BWUD 4PMWA 2F0KA 3MEHA 3FAHA 2X6GA 2IX1A 2IW3A 4G57A 1PFNA 5M3MB 4FF4A 2JYOA 5FOBB 1MI0A 3L4PA 4NJCA 3GTJB 3AEDB 1RDPD 2DNCA 1KLUD 2QEJC 3J7AV 3AM9A 1M8AA 2IDYA 4OO1G 1EYDA 1JMLA 2R92B 1WWTA 4Q5VA 1L0XB 3FPUB 4B0MA 1SE4A 5CMDA 3OOCA 3S1RB 2RMMA 2GB1A 3T3NA 2PKOA 3BG3A 3IT4B 3FKIB 2G1EA 3AE4B 2K03A 2KECA 3R2TA 3TP8A 4FXCA 1SDFA 4ARIA 3FDTA 1LT5D 4R3DA 4ZKCB 3OWFA 3CIRB 3NVYA 3MFGA 1TJEA 3GTOB 1FGBD 1UAPA 2BDOA 1DZ1A 2FMCA 3TP5A 1LLRD 2I38A 2E74C 4KY5A 4OVZA 3SK8A 1NSNS 4IUTA 3U9SA 4AYBB 4KJOA 1QJOA 1RTNA 2WACA 1JR0D 1TWHB 4F87A 4XYQA 3M3YB 2QJLA 3DWGC 4TQ0A 1GOZA 4A3KB 1WTPA 4XWWA 3P20A 3AEAB 4M0WA 5BMIA 1NR2A 3T13A 4BY7B 4ILWA 1N5WA 2B2YC 1XEEA 2JA8B 4XE0A 3I8ZA 1OFFA 1PRTB 3PO2B 3C8YA 4D2KA 4KGSA 1DYQA 1E9MA 2AX5A 5T8IA 3KF8A 1WTQA 2IWHA 2EYMA 2FHTA 1YJIA 1H9RA 4RGNA 1YNTE 1H9JA 2WNMA 3FILA 4AS1A 1CA5A 4PT5A 4KMUC 5C44B 2KCNA 1MHHE 1HTLD 2AQ3B 4L6TB 4MM3B 4EQNA 4MT5A 1K52A 4K6LA 1VZ7A 3D4WA 3NBHA 3MAQA 1HXYD 4QF4A 1M4VA 3HS0C 1C77A 1VJKA 4YTMB 3A55A 5JEAH 1B9MA 5T1IA 3S14B 3VYTA 3MP9A 2BA1A 2AQ1B 4DXFA 3K5MA 1IGDA 1E0BA 4P16A 1MSHA 1EY6A 2BW2A 2QILA 4V190 1S5CD 2PVGC 3NVZA 1SYFA 2GI9A 1I50B 2PW5A 2Y3AA 2NUCA 4KGRA 2EKIA 4WURA 3A56A 1OQQA 1EWYC 1H9MA 3GTGB 1I6VC 5T1GA 3I57A 2V0GA 2F0TA 3RUZA 3FRPB 3J81L 1C4AA 4JK1C 1QT9A 2J0TD 3Q6SA 5FO8B 1Y8NB 5I6WA 1HCZA 5JJZA 2F0SA 2ZT9C 4BWGB 1P7FA 1ZXHA 4HEDA 1MVKA 3AMUA 5G5GA 1TT2A 1EQVA 4X3SA 3ERQA 1AYFA 2BDNA 1XLPA 1G6ZA 3OMCA 3KLSX 1HEZE 3ZQ4A 1EIGA 2G9DA 4DAYA 2BB5A 5EBCA 1E2VA 1EZ8A 2NVQB 1STBA 1Y1WB 3PUVA 2ID0A 2NTTA 3VR6A 4ZRQA 3W5UB 2WXLA 5KNBA 4N59A 1TKEA 2JWUA 2XWBB 1EY5A 2ZXRA 4KJNA 3KUPA 4A3EB 4CJ0B 3I90A 1I6HB 2RSOA 3NPPA 4RGMA 2BS2B 1C8CA 4HKZE 4LLGM 2F03A 1C4CA 1WYGA 1Z7TA 3M4YA 1SMYD 2BS3B 1XXGA 1X32A 1UGJA 1D6EC 4QMGA 1V43A 1IL8A 1XTCD 5C4ZA 1TS4A 4WWMA 4YTPB 4V0BA 2A5HA 1JICA 1I3QB 4FF3A 1A6XA 5D65A 1EYAA 1GAQB 2QMTA 2EYOA 2RA4A 1FXAA 5IGFA 1NR4A 3ZYYX 1ZE3D 1B53A 2Q8IB 1HA6A 1ET6A 1FR3A 2RKSA 1HRJA 3MHZA 4DA2A 5J39A 4CJ1B 2AWOA 4K6DA 1J7BA 4DGZA 1K50A 3MXNA 3QIAA 4KK7A 1TS5A 3PV0A 1G291 1QOFA 1DXMA 2M00A 4JBWA 4WQMA 2D5DA 1G2SA 1EWHA 1E0ZA 4CGYB 2KA7A 1PTOC 3K5NA 2HQEA 1EU4A 3BDLA 2N0SB 4IUPA 1SJHD 5AUIA 2KQ4X 4F8MA 4I7ZC 1VZ8A 4USAA 2NN6H 3I70A 4L23A 2B2UA 2WLBA 2XNAC 4J6HA 1ENCA 4KTAA 2EELA 3SXHA 3IKJA 1RCVD 2OEDA 4DAPA 3I72A 3GS2A 3NE5B 3AE5B 2MH7A 1DM0B 2F0FA 1SNQA 3TZUA 4XIGS 1QCBD 3PUYA 2JXTA 2O5IC 3SFDB 4WFN3 2BOSA 1VDVA 4REZA 4QIWB 1A3TA 2TSSA 2F0OA 4NAWB 1LV9A 2F3VA 2DLBA 2WP8J 3VQIA 2EDGA 1X3PA 1SF0A 2WXFA 3NRZA 3NK9A 3CRLC 1IBXA 2Z4HA 3LX0A 5NUCA 2JYEA 4J8QA 1KDCA 4RGOS 3IL8A 3EVQA 1DONA 1J8IA 3D6CA 1PTOB 1EFID 2EOTA 1OQRA 3M85A 4ITKA 2JX5A 1R4PB 1DGJA 3T4AC 4C3HG 5IT9L 4ZKBB 3OHXC 2K5WA 4FP5D 2INNE 1QOBA 3P4PB 2BS4B 2QF7A 2L32A 5HFYA 4EGVA 3URYA 5M5XB 2KEDA 1QOHA 3VRBB 5EPJA 1FNUA 2WP9B 2WS3B 4JX1C 1AN8A 5KYLA 4Y7NB 3C46A 2N7JA 5M3FB 2WXIA 3H3VC 2KJXA 4A3JB 2A68C 4HN7A 3T56B 2WXPA 2E3TA 4GDLB 4UDUC 2KOLA 1O7YA 4Q2JA 1OXSC 1ENFA 4OZCA 2VZKD 5BN3A 2F0NA 5EBDA 3R3OA 1EY7A 1T5EA 2HTME 1JW9D 4KKIA 1AEXA 1GUWA 1TVXA 1EIHA 3MHBA 4F7XA 3D4DA 2D2CC 2L11A 1WRIA 1TU2B 1L5PA 3EQLC 5I4DA 4QCLA 3MVVA 1ZDVA 3M7NA 3UI3A 1RTOA 5IGBA 2BT6A 4TSSA 1ESRA 1HFGA 2IGHA 5K5PA 5K36G 1BOSA 4HMIA 5ELBA 1E2WA 2EPBA 5KNDA 5CV4A 2IX0A 3BYYB 3MFYA 2LJIA 1Y8PB 3A8KE 3J7AF 3RLFA 4R8NA 4RF0A 3E0JA 3ND9A 2A6EC 2AWNA 3D3RA 2JZPA 1Y8OB 1BCPD 2Y5CA 4FO2A 1WXQA 3NVVA 2LFNA 4N6EB 3TMEA 5CC4A 2EYHA 1AW7A 5G3LF 4C3IB 3W2DA 1FNVA 4WRDA 2OXPA 2PZWA 2IJ0A 3NXWA 1LTAD 5HGTA 2K5PA 1TIID 2ON8A 4EQPA 4OZAA 3HOZB 1GUSA 4NP5A 1EWCA 3VRAB 4BBRB 1QLBB 2AUJD 4RGTA 3HRDD 5EE0A 2R7ZB 2L4NA 1JE4A 2ACZB 2OF1A 4KX6B 1FMAD 5K36H 1L4ZB 1MI2A 5EGTA 2WIIB 5G5HA 4IQZA 2V3NA 5KRUA 2KUMA 5C5LA 4KV6A 5DEHA 1OXTA 2EYPA 4TRDA 5H92C 1ZXIA 4X3KA 4DU9A 1Q10A 1MPEA 1ET9A 5IOCA 5AUKA 1I4PA 2YYZA 2F0LA 3A7LA 1YNJC 1V8QA 2NVXB 2RQXA 4ABNA 1U4RA 1VF5C 5GXGB 1G2TA 5EJWA 1DOKA 1LABA 1K8OA 4LTUA 4RF1A 3AB9A 1PFBA 1H9KA 1UEAB 2LY7A 3V2TA 2TMPA 4DNRB 2NMQA 4EE2A 4OO1I 1RD9D 1F2ZA 3TEXA 1NI3A 2MJDA 3HG9A 2L1AA 3R93A 1ZKOA 3LWUA 5G3LD 3H6MA 1CHQD 5COYA 1CK1A 1JOKA 1G91A 2HDEA 1YNJD 3CU7A 4H7BA 3P63A 4K8JA 3S1NB 4LJZC 3I4NB 1CTMA 4G7HC 4DK1A 2A6HD 4PMCA 1YQ4B 2XVSA 2OT2A 4B9WA 5J1ZA 1PRTC 4RFBA 4C3JG 5CR3A 1KTKA 1Q90A 2HCCA 5CBEE 2B2YA 3TUOA 1J9OA 3KBXA 4KY7A 1QE6A 5FLXL 1CZPA 3A8JE