3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Superantigen-like Protein
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
3MC0B 1BCPF 2G9HD 4L6TB 1S5BD 2RDGA 1LO5D 3EFXD 1S5ED 1LTSD 1QILA 1I4RA 4Z9CB 3V05A 1YN3A 1RF2D 4RHSA 4RGOS 3BVZA 2IJ0A 2Z8LA 3SEBA 1EU3A 1HXYD 1RD9D 1YN5A 1KLGD 1YN4A 1TS2A 1JWSD 1LTID 1PRTD 2AQ3B 1DYQA 1SJHD 1SEBD 2XRSD 3KLSX 5FKAC 2R61A 1SBBB 2TSSA 3GP7A 5TSSA 4RGTA 3URYA 2NTTA 1CQVA 1FNVA 1PTOD 1XXGA 5D3DA 3BYYB 1FD7D 1FNWA 1SE2A 4C56C 1V1PB 3CHBD 1B1ZA 5ELCA 1TS5A 1D6EC 4O1NA 1PTOB 1D5XC 1EEID 1MD2D 1V1PA 1CHQD 1PZKD 1JQYD 2QEJC 1UNSA 1JR0D 1L0YB 1V1OA 1PRTF 3R8BA 4DXGA 3DWPA 3BVGA 1PTOF 2XNAC 1PRTC 3DWQA 1RCVD 5I4DA 1I4HA 1PYWD 3DWAA 1DJRD 1BCPC 1EWCA 1B44D 1S5DD 4OHJA 1LLRD 1TY0A 1CT1D 5ELBA 1LTAD 1SJED 3BYTB 1TY2A 4BWGB 4RH6A 1I4GA 1S5CD 1JWMD 4RCOA 4RGMA 1ET6A 1L0XB 1D5ZC 1BCPD 1KTKA 1EU4A 2J4XA 1GOZA 3EA6A 1LTGD 1I4XA 1G8ZD 2AQ1B 5ELEA 1LT4D 2CHBD 4NZLB 2AQ2B 1TS4A 2NTSA 1FGBD 1SXTA 3R2IA 1SE4A 1I4QA 4ZYSA 3W2DA 1LT3D 2IPKD 1CHPD 1LTRD 3O13A 2ICIA 2O2LD 1SE3A 1JWUD 5D3IB 3TSSA 1UUPA 1BCPB 4UDUC 1I4PA 2XN9C 3MFGA 1PTOH 4RHRA 1D5MC 1JCKB 1PRTB 1LTBD 4L63B 4RGNA 1EFID 5FK9C 1AN8A 1HA5A 1ET9A 1PTOC 2SEBD 1HQRD 1ESFA 1FNUA 2RDHA 1PZID 3BZDB 1EEFD 1LTTD 1M4VA 1HTLD 3R2TA 2QILA 1ENFA 1PZJD 1TS3A 2XRQD 3BVMA 5ELDA 1S5FD 1RDPD 1XTCD 1LT6D 1KLUD 3OWEB 4TSSA 1BXTA 5ELFA 4DXFA 1AW7A 1STEA 2WV6D 4K6LA 1T5XD 1LT5D 1CK1A 4RFBA 1F77A
chains in the Genus database with same CATH superfamily
3ND9A 1WCMG 1HZCA 3QO2A 2EYLA 4L6TB 3TCAA 2RDGA 3PF5A 3GDEA 3S2HH 1HNXQ 2PNRC 2BF8B 1QG7A 1R4QB 3BS1A 4FXGC 2K8HA 1YN3A 2WP9B 2IY1B 4XC2A 1MBYA 4ACFA 4QQBX 5IYDG 3IAM1 4BBNF 4HVBA 3CCQA 4ZUJA 1CQFA 1Y1VG 1YEZA 3ZNID 3H6MA 1IP9A 1KDBA 2HHHQ 3M85A 3Q3OC 5F2DA 2K5NA 1GO3E 2BOSA 2E75C 2JP1A 3A5ZB 3OIQA 2LGYA 3CSTA 4YSYB 5DPTA 2KVRA 1KLVA 1G291 1VF7A 2R7ZG 2Z1CA 4DV3L 2EYHA 1ICWA 4K5WA 1EY9A 4LNIA 3NG0A 4K8JA 1IKLA 3RMHA 3GTJB 2Z0DB 3NHEB 4JOIA 3U4EG 3EBEA 5M5XH 1NR2A 3ER0A 1E2WA 4E6IA 5FLXL 1N32L 1WTQA 3FDTA 2LMCA 2QC8A 4B95A 1WTWA 4GN4B 1N36Q 3RD2A 3VXWA 2RPVA 2ZCCA 1WGRA 5T1GA 4DR5L 3HVDA 1CZGA 4GGQA 4RM8A 3W1SA 4FVMA 3NWTA 2DYOA 4KV2A 4CJ2C 3U58A 1ET6A 2FIDA 4DV1L 1XEEA 3HOWH 2ZT9C 2ZXOA 2LJ5A 4OZAA 3RNEC 3HP3A 1GG3A 2ZJDA 3S2DB 4NPNA 1FFUA 2WXRA 3K7AB 1HNWL 1EF5A 2XVSA 3U52E 1KL9A 4OXPA 3UI3A 2JRIB 2H4OA 1AE3A 1WMHA 5K36G 2N0SB 3J81L 1VQFA 3RLNA 3S1QH 2XEWA 2FHTA 5CC4A 2ICEC 2WXMA 1SE3A 4AJWA 1JOOA 2KCNA 2IW3A 1WTVA 4BY1H 2GB1A 3BJUA 2V4DA 3TBIB 1NJIC 1K3RA 1VCBA 1WJNA 1GB4A 1V8CA 2R6GA 2K5DA 3EHVA 3VTWA 1AZQA 1ZPSA 3KLRA 4HR7B 5IYDH 2H1EA 1FXTB 3SFEB 1TR5A 1UWMA 5C0XG 3ZUNA 2PE6B 2KLCA 3AB5A 3RNCC 5L37A 3AE5B 3R2TA 4US9A 3PUVA 4FN2A 1K28A 4C7ZA 4ARCA 4JI3Q 4K8IA 5AZGA 3MWYW 3AMUA 2R2OA 4JBKA 2D07B 3NBIA 3KF6A 2E6XA 1EOTA 1Q86C 4A6QA 3AULA 1FJGQ 1ZOYB 2M1MA 2IWHA 4JGHB 4GDKA 1GJZA 1N62A 3ENEA 1F52A 1KDCA 2K04A 3IFTA 3HM6X 3OAWA 2NZ1D 5CV4A 2CW0D 4LF8Q 4G0NB 2OEDA 1S5ED 5E6JA 2V0GA 3ZLZA 1QILA 3L16A 3I8ZA 4XX5A 2I1JA 5M3FG 4K7SA 2LSSA 4RKLA 1NI3A 2N55A 1L4DB 3VTUA 1IBLL 4MH0E 1WI5A 4AYBE 1Q8KA 2WS3B 1O78A 3QB3A 3QJZA 4FYDA 2K7VA 1VQOA 4GOPB 1YN4A 2CJNA 1FGUA 3A7AB 1BKBA 1MGSA 2MO0A 1WH3A 1IBXA 1NBFC 5KNBA 2RVLA 2E2IB 3S1MB 2VH1A 5IP9G 3L3OC 3P4PB 4HCEA 1KM7A 3AFQA 2EE1A 1NI2A 4DK5A 1XXGA 2F52A 5EQ0A 4IM0A 2LRWA 3DMUA 1V1QA 5AJ3L 4IOAA 3L08A 5DAUA 1IYVA 2FCNA 3X3NA 5C5MA 2OF1A 2W82A 3AE3B 4XYQA 3ABVB 4MELA 4JPBW 1JQ4A 3W1SC 4FDBA 3RD4A 2CHXA 5IODA 1MJEA 3VUWA 1SIFA 4X3TA 4GMVA 2QHOA 2WXNA 3N3KB 3TJPA 3UGBB 4IZ8A 4IPHA 4LK0M 3NTKA 1JMCA 4H2AA 1YQ4B 2DLBA 4K6DA 3NTIA 3AE2B 1E2ZA 3PREA 4N8X1 3PF4A 2B2UC 1WYDA 2GOWA 5EE3A 3TL5A 5IOCA 4RGMA 2JXXA 3DHIC 1L0XB 4JI5Q 3W1YA 1BCPD 4FADA 4PYZA 5CBAE 4Y7NB 4YWKA 3KYCD 2B3AA 4WWOA 1DGSA 2QCZA 3ZDTA 1ONLA 2CHBD 2QIEB 2ASQA 3ONSA 4ZYNA 1HNZQ 2WXKA 5FR6A 3T8MA 1B70B 3W5UB 3Q14C 2JA7H 4OO1I 2XWBB 3S2HB 4JOIC 2HT1A 1D4BA 4FHKA 3TIXA 1FJGL 2OT2A 4LK1C 2DNFA 1K0SA 4IFDG 2L9HA 4LNQA 4KKIA 1XNRQ 4AP4C 1F9SA 3M95A 5AFWA 2JA7G 2Z6BA 3B2GA 3I4NH 3MHSD 2C7HA 2NVYB 4OVVA 3N32A 2N8NA 2BDNA 3NQIA 3JAML 1EUJA 4JYAQ 2LD9A 4KDIC 4XQJA 5FK9C 1EYGA 1NY4A 4W9CA 4PG3A 1IUEA 3L17A 2YVCA 2VZKB 4JI2Q 4BY7G 2PZWA 2IGDA 1STGA 5IYCG 1OFFA 3KF6B 4YTMB 3O65B 4MN3A 2D5GA 4L5RC 1KNAA 2PCFB 4DAYB 3FKYA 1LQBA 1TIFA 1QE6A 3EC8A 4BY7H 2M56B 4XDXA 2OWOA 1D1IA 1G51A 2PLPA 5J22A 3OWEB 2HHHL 2RPQA 2FFKB 4HRSA 3WCQA 2JA8G 2KEDA 1AW7A 4H02A 2PMVA 4RMFA 1WYGA 5LMUL 2WP8J 2ZZPB 1HR0W 2MBOA 4ME3A 2BGFA 1WXSA 3NVVA 4JLCA 3MXNB 4K0KQ 2PZUA 1PH8A 4BOZB 4XQQA 2MQJA 1T0YA 4DUYL 1UE5A 4RGOS 2XBBC 4ZAIA 2SNSA 1CM9A 3HOYG 2F0LA 1LM8B 4F87A 1BBXC 4LF7Q 1N32Q 2MJEA 3TBLD 4DK1A 4OWWB 2B2UA 4DUZL 2UXBL 4Q2JA 2A69C 1WXMA 3E56A 1KIXA 2I5MX 2XRSD 1JWBD 5E6PA 4BY1G 5BO4B 3IHPC 4JX1C 1BR9A 2W54A 4A3LH 1J5EQ 2YEPB 1STNA 1JJGA 1GM5A 2KT7A 4JW0A 3C46A 4HAEA 3HOXB 1SNPA 2R2QA 3GTOB 5C0XH 3S17H 3J80E 2EDGA 2R93H 3VR9B 2JA9A 2RA4A 4CHTB 2F0NA 2EQSA 3DWPA 1YNXA 2RHQB 3R3OA 4ZHOA 5HKHA 5LMNW 1BUIC 2RMMA 3WALA 2K01A 1MSGA 4LAAA 4KKSA 5IGDA 2ZJRA 4S3SA 2PJHA 4MIUA 3K8AA 1JICA 3A8IE 1SFOB 1RTOA 3I57A 4F8CB 1MKHA 2L4NA 4X62L 1K83B 4Q5VA 4JYAL 3EECA 2FE8A 3I4MG 4GSWA 1I4GA 4I6NB 1JWMD 2I5HA 3IT4B 4A3DB 2M2LA 1ZGUB 3AEDB 5JXVA 2LWPA 4BFRA 4IALA 3A1QB 2FNJB 3DXJC 2YTXA 2UXCL 4JI0L 1G6PA 1EO6A 1SB3C 1SE4A 2R3ZA 3F1ZA 5IE8A 2KDIA 4C2MH 3NVYA 2PI2E 4B3SL 1I50B 1A62A 1SNCA 3AE9B 3AU4A 4HJKA 1TT5B 1CFMA 3OOCA 1Y8PB 1VRAB 3HOUG 5C2TB 1I4PA 1QNUA 5ISRA 5C3EG 3MFGA 2KX3A 3D32A 3TZDA 3H3VH 3JSVA 4XE0A 4P71A 1IL8A 5J17A 4HROA 3SK5A 1SAPA 4CHKA 5DPSA 4GOPC 3GTPB 3WANA 4J1MA 1EFID 4A93H 2Q8RE 3DHHC 5GAHC 4FLHA 1Q5WB 2INPE 2G9DA 3WWVA 1DOMA 2CW0C 3LGJA 3IT6B 4HXDA 5IKCM 4KJOA 3H3VI 2V9HA 3EN2A 3I91A 1YI2A 3GTGB 4GKJQ 1FCCC 1FNUA 2L12A 4H44C 4N8FA 4DK3C 1VCIA 2L0CA 3F2UA 4HEA1 1WTHA 3M4OB 2RKSA 5EKKA 2JEBI 2DENB 4LNFA 1KRTA 2XSCA 4EUTA 4PZ6A 1TVXA 2MP2B 3I63C 3PLVA 4IPDA 4MM3B 3I3CA 2AWOA 2PVGC 1GHKA 3ZGZA 3FRPB 2HE7A 1WD1A 2F0JA 2YTYA 3H7PB 4XYCA 1V43A 4A3GG 5I9PA 2V4LA 1OXXK 1Z5SB 1VD2A 2K5VA 5IT9L 2EJMA 2RCNA 1Z7TA 3S1NH 3DWGC 3NK9A 1PXUA 3QIAA 1B3AA 2B8FA 2G3QB 5C44G 1B2TA 1K83H 1MIUA 2XK5A 5LNK1 1E6EB 1AFPA 3IAS1 1B9RA 3GOEA 1WX9A 4WURA 2N49A 3HKSA 2Z8LA 4EQ5A 4A3EG 3M4QA 3MXUA 1I6VC 2E76C 4NJ7A 5K36H 1RJTA 1IBML 1JB3A 2L1BA 4K14A 1N63A 2JZ3B 1Y56A 5FO8B 5IIFA 3VRBB 2R7DA 1JWSD 3MHBA 3PIP3 4JI4Q 1P98A 4QL5A 2AMCB 4XT1B 2MLBA 1XNQQ 3D4RA 2KHWB 2YLMA 4F8MA 1RFAA 2BW2A 3NTHA 4NXML 1PGBA 1NUCA 4QJFA 3NY5A 4KIKB 1VQ8A 4MH8A 1V8QA 1FNVA 1I50H 1I3QH 2FJ2A 4LF6L 1SYCA 3DM1A 3PO2H 3N9YC 1XCTL 3VR6A 3CCEA 2GMIC 2WX1A 3RT3B 3S17B 1WYWB 1FR3A 1DM0B 5KNCA 1U4RA 3VQIA 2OQ0A 5A35A 2EMSA 1EQVA 3GTKH 2Y5CA 3GZNI 2R7ZB 4A4IA 5LMNQ 1A15A 3DHQA 1G2SA 2KDFB 2E5LL 3L9AX 1F1HA 3TDQA 1YIJA 5GROA 1RCVD 4BBRH 1T5EA 4I7ZC 3G71A 4ZCKA 2BKFA 2V4IB 1SROA 5L83A 2JYOA 5CHFA 4PNYA 1EWCA 1JROA 1MHHE 5CBEE 2Z9HA 1LGRA 2F0EA 2FMCA 3CC7A 2OOBB 2B63G 2WAQB 1J8IA 1TY2A 3M4OH 2JA6G 1TBEA 1Y1WG 2F0UA 2K22A 1H4RA 2IO3B 1EOVA 5M9OA 1PDXA 1CKMA 1K52A 1R9TH 3K0XA 4R4TA 2LVOA 4EOYA 2JT4B 5KYIA 2A5UA 1R4MI 4YL8A 2B3GA 4FF1A 3AN1A 2VH2A 2UUBQ 1EUVB 4K5VA 1P1AA 3IL8A 3GTLH 1GAQB 3BIID 2KECA 2MA9B 3HOZG 3S1QB 1WZ3A 5IGFA 1GUOA 2K4KA 3I4OA 3J7A5 1QJOA 3GQBA 4UPAA 1QT9A 4DR4L 5JOBA 3TP5A 1WY8A 4NY0A 1VQAA 4WJPA 4OIJA 3LWEA 3T4AC 2K50A 3MVVA 5HHDG 4A3MH 1OQYA 2MUYA 2QDLA 2Y0SB 3CCUA 3T51B 3MJWA 4G7HC 1MG8A 2A6HD 1QB5D 3GTGH 2INCC 5IGCA 3B2FA 1VQDA 2OCEA 5EPJA 4LJPB 4KN4C 3V6CB 3Q3MC 4P73A 1PFDA 3J81i 2AL6A 3SFDB 4EKUA 4KHPQ 3DBLB 2NN6I 1YQ3B 1VQHA 4CJ0B 2IX3A 2F0DA 4X66L 3RMKC 2RDBC 4MSQB 2PO4A 2L05A 2DHZA 2Z6KA 3CMMB 5D6JB 1Q1BA 1U0LA 4AH6A 4JI4L 4ZKCB 1STEA 4RAUC 4G57A 1OTRB 1VJKA 4K5XA 3U7ZA 4R4QA 4RA8A 3H91A 4IUVA 2BYTA 2QF7A 1SFOH 2O2VB 2JUOA 2PNHA 1RAXA 1XPOA 3WOEA 4HPMB 3H1UA 4QIWE 3EGRA 2UYZB 4DHJB 4XYOA 3MC9A 2IJ0A 4L5QA 1FXAA 1HXYD 1Q82C 4P6VF 1YBYA 1TKWB 3A5UA 1W6KA 5LMNL 4PMWA 2W9NA 1LTID 4K2KA 3RZFA 4U673 4LMQD 5M3FB 5C4XB 2J0KA 1VQ7A 3AEBB 4DV6Q 1UWXA 2IDYA 1WIAA 2KVZA 1BBUA 1CQVA 3PV0A 1PTOD 3CCMA 4B9XA 1HPCA 1A6XA 2REXA 3J7AV 1NEKB 1NCVA 3D6WA 3OMCA 3CCRA 2WNMA 3DEOA 3P1HA 4X65Q 3A9KB 1YHBA 3DBHB 1EEID 3ML9A 2L5TA 2JY6A 1A70A 4C3JG 5CTRC 1VMPA 2H5XA 1VQPA 1YHQA 2K28A 3T9LA 3ETRA 3VH3B 4BKSA 2N88A 2B76B 4LJZC 5EGTA 1K8AC 1Q10A 2JJQA 5DM63 1CT1D 4V0BA 5H92C 4YHHL 2DZMA 1XMQQ 3U4VA 2IX1A 2O5IC 2LHEA 1EY4A 1F9JA 2Z0SA 4WAFA 1JRPA 1G91A 1LTGD 4I7AA 1ESRA 4XIGS 2KACA 3KOJA 1E3PA 1UWVA 3W1BA 1YNTE 2GVBA 2MGSA 4ME5A 4ZKBB 3H3VC 4NJ6A 3H0GB 3OSOA 1SXTA 2Y5BB 4DNIA 3Q8AA 4YWLA 1EIYB 3FC4A 2SAKA 4FXDA 5JEAJ 3A4SC 1V86A 5FO9B 4IO9A 1J7AA 3KH0A 1T0SC 3RUZA 1XPRA 3EUB2 2D3GA 1YNJC 2MFIA 2IO1B 5J18A 1X3GA 5CR3A 1KJTA 2LZ6A 1NBWA 2WX0A 4IG7B 4YTPB 4UDUC 5E4WC 1JB7A 5IT9c 4IWOA 1TWFB 3GE3C 4M00A 1QOHA 1D7QA 4B3TL 5CGKA 1B50A 1ACCA 1AZPA 1WRIA 1N9WA 3OW7A 2I1KA 3P42A 3A4RA 1PYBA 3KDFA 2NS5A 4K81A 1WGYA 1BOSA 2M9VA 4DF7A 1HRJA 1NVID 2AEHA 5JPNC 3HOVB 4W9LA 4YT0B 1QOBA 3R7QA 4ZQ3A 2DBYA 3BZDB 1MG4A 3BVMA 1OQQA 5IP9H 5A2QE 2F1MA 1Y69U 2IZVB 1CA5A 4BY7B 5CV7A 4HIOA 2WU2B 2ZVNA 5GMVA 1BXTA 4GB9A 2KVMA 3PSIA 4WFN3 1P0RA 3AB9A 1PA6A 3JAME 4P74A 3K7UC 1NNXA 2VQEQ 4LDTD 4LF6Q 2X6LA 5DPRA 1ASYA 3PV1A 4BBSH 3N1XC 2MHVA 4P7IA 4C3IG 3CRLC 4CDCC 1N34L 3TEHB 2L52A 5FLXc 1M1KC 2VB3X 3P20A 2O6VB 1RF2D 3ZW3A 3J9CA 3C8YA 4W9DA 4PV1C 4OZCA 2EKEC 4I6PA 4HIKA 4GXBA 2WQYB 3J80i 4W9GA 3NQTA 1R9TB 2Y5PA 4ILWA 1E7VA 4K2LA 4C3HG 4YHHQ 1PRTD 1GXDC 4KV6A 4MTNA 1E1TA 3K7AH 4APVA 5C44H 3AEEB 4A3BH 4HMIA 1QKZA 1JMLA 4XGAB 2N7JA 2NVQH 2BPSA 1P8LA 2GLSA 3RN9C 1J6QA 4TQ1A 1Q46A 4A3KG 2DJFC 3CF5A 2KNBA 1WFYA 4AOFA 5L95C 5C1ZA 4LLGM 4BXXH 5IP4D 1EY6A 3AYHB 4JBMA 1EIGA 5AEKB 4YIJA 5JJIA 3S1RH 4DXGA 4AJYB 3L0OA 2G4SA 4YCVA 2KCCA 1PRTC 1WGDA 2EXDA 1QVFA 2ZNVC 4LF7L 3HOXG 3PO3G 2GRIA 1NR4A 3CQZB 4B3ML 2VNUD 1L7YA 2A5HA 5CV8A 3GZNB 1JORA 4YWGG 4HJGE 3MTNB 4JI6L 1LTLA 1SYBA 2ZVOA 4LFCQ 4RCOA 1EY7A 1VQGA 2Z4HA 2Q2TA 1XF5L 1JOQA 4IUUA 2X6GA 3SGIA 1DOLA 1EU4A 4A3DH 4JQWC 1N5WA 3EA6A 4XWWA 3WDNA 2N4FA 3GTJH 2M0AA 4NQLB 1G8ZD 2VZAA 4DR3Q 1OXVA 2KLGA 5G3LD 1JALA 1XCQL 1H9RA 4XZ4A 4A3DG 4ZOHC 4GLXA 2D62A 2IPKD 1WRDB 3CF6E 4HKQA 1MJDA 4XTCS 3TEXA 3FEWX 3O13A 2JVCA 4CDFC 3TP6A 3UDFA 5BN3A 2HJ8A 4MM3A 3DPDA 5IA7A 1UUPA 4N9PA 1VF5C 1TWFH 4OELB 1N33Q 2E3TA 3ERSX 1SSNA 5IWAQ 2VUMG 3BDCA 3HRZC 4ZRZA 3PO2G 2PZTA 4RMAA 1BDOA 3CU7A 4IC7B 4J3OD 4PS3A 3AQQA 2NZHA 4N9TA 2JXMB 3IBEA 2K6QA 3SHQA 1CKNA 4L8JA 3F2CA 3SE0A 1PH2A 1PH4A 2XWJB 5C3EB 1DD2A 1MHWC 2A1AA 1XMOL 1Q7YC 3T16A 1DOXA 3EVQA 2NBFA 5C0XJ 2A73B 1JJCB 1Q8IA 4JVZA 3MJ5A 2CJOA 1WOCA 1B53A 4MHEA 3GTMB 1C77A 3PSEB 2KJRA 1R4NI 2DNEA 2Z4IA 3Q8CA 3IXSA 1Z47A 1GNUA 4DV4Q 1YZ6A 4DR7L 2JWUA 1F2ZA 2WKCA 3BDOA 5FLMH 4CO7A 1IYUA 5D7GA 1VQCA 2WV6D 3CP0A 2O5JC 1H9KA 4A3FB 4LFAQ 4KMUC 2BH2A 1YN5A 2EMTA 4NXNQ 4DV1Q 4QAYA 3MC0B 4JC0A 1CZPA 1C1YB 3BK2A 3VDZA 3CQZH 1MSHA 3P2BA 3B6YA 2XIWA 4B08A 1YJ1A 2Y3AA 4BKGA 1K8OA 3ND8A 3P75A 4GKJL 4KLKA 1L6VA 2ONQA 3K57A 4WWMA 2JQRB 3V60A 1PH7A 3CKIB 4MGKE 2ZCBA 1GUGA 4JG2A 3M4PA 3NEMA 2MO1A 1Q90A 3M3YB 1HZAA 5C44B 4WJ4A 3QHTA 1WMHB 3HG9A 4DV7L 1K0RA 1RL2A 3SDZA 5IT9E 2WWZA 5EJWA 2BE5D 2D3AA 2TSSA 2NVQB 1L1OA 2W55A 3PGZA 4A3EB 1FEHA 1I6HB 4A3CG 1EFWA 4PZ7A 3DVNU 5G3LF 4IUPA 1E2VA 1Y1VB 2A69D 4LUOA 4CKCA 5KNDA 1E1OA 3U50C 1R7SA 1WJ4A 2B2WA 4IPGA 4HKZE 1XLQA 2K5PA 2SOBA 1UEAB 3FP9A 2F3VA 3MXPA 1SMXA 2YEPF 1MI2A 2QA4A 4QMGA 1R4PB 3B9JA 1QUQA 2AWTA 3UDGA 2LUMA 1PFBA 4J8QA 1PTOF 3TP8A 3RYTA 4K3CA 1PLFA 3DM3A 1IBMQ 2V3NA 4IDIA 3LB8C 1I4HA 4R4IA 1X32A 2E2IH 3DWAA 1HQMC 3A74A 4F1SA 4DR2Q 1L4ZB 1CUKA 2K05A 4MDKE 4BKSD 1TTNA 5IP7H 2B2YA 4JI7Q 3OG5A 2PTLA 4DN4M 2QCPX 1U4LA 4BWGB 1S5CD 5KIXA 4KVGB 3AXCA 2RDFA 5IWAL 2Z0EB 2RBMA 1E7PB 2DX5B 2G5DA 2FINB 3E0EA 2CHZA 2WGSA 4P1BC 4TUUA 4CYEA 2NVXB 1NENB 2OJRA 5ELEA 1TKGA 2ACZB 2KWUB 4GKKL 1UGJA 2ENBA 4LFBL 3QIJA 5AUIA 2DYBA 5BYQA 1X54A 1CMXB 4LUVA 4W9HA 4W9FA 3HZXA 3H8HA 5H8YE 4NJCA 3C0RB 4KGRA 4C4VB 2F4IA 1LABA 2MJ3A 2ICIA 3CWIA 3KJOA 4BOSC 2VRRB 1JWUD 4IJHA 2F0SA 4ANVA 3TSSA 3E6ZX 1VLBA 4IKGA 1HCZA 1X3EA 1UE1A 4RF0A 1D5MC 3HGBA 5J3BA 4DAYA 1C4CA 1Z2MA 4M02A 3ZJTA 2E2DC 4O2DA 4DV0Q 2HTHA 1HZBA 2WU5B 4DKAC 1F9PA 2K6DB 3VUXA 2KC2A 3Q3NC 1D2BA 5M5YH 4CDEC 4OIKA 1L2FA 4MSMB 1T3QA 1YMHE 3PZDA 2D2QA 2NVTH 3JYUA 5E7NA 2CH4W 2NBUA 3P63A 3HUIA 1SNOA 5ELDA 1TJEA 5GADC 1QQRA 3PUYA 1L0VB 4K7UA 3CAMA 1XTCD 1IPGA 4POFA 4WQMA 1WX7A 3TEYA 4KN7C 2WXLA 2R92G 4IN3A 3RN5A 1IHZA 1Q81C 1ZKHA 2JYTA 3VYSA 2KC1A 2NPTB 4BKTA 3BG3A 2HCIA 2A8VA 4OGQC 5CV5A 1LO5D 3A7LA 1WJUA 3N20C 1PFMA 3FPUB 4F7ZA 3CC2A 2JRHA 3OLMD 1DGJA 1HUMA 3DBRI 5FO7B 4XDDA 4RHSA 4AS1A 3VUYA 4WRDA 3JC66 2HIXA 1RRBA 1AEXA 4LNNA 1SRUA 2IGGA 4LUZA 1FRRA 2ZXPA 2P5ZX 3K9OB 4L2YA 3DBSA 3RNFC 2LJIA 2K33A 1SEBD 3OYYA 2KN4A 2EY2A 1VS0A 2EYPA 3DOWA 4YTNB 4TMAB 3D8GA 2K5WA 2D9UA 5EBCA 2M0XA 1ZXHA 3G7LA 1FNWA 4HDQA 4LJOB 2VS1A 1JW9D 4C56C 4A3GH 4Q0FA 1FRDA 1EYAA 2I0QA 2UXDQ 2L15A 4A3BG 2KMAA 4IWPA 2C5LC 5EE0A 1GUSA 4JI2L 1WTXA 3M62B 5A2QL 2NVUI 5FR3A 1F2LA 3RNUA 4N9F4 4PYUA 1UNSA 2L55A 4IUQA 5IP7G 2N9KA 1V1OA 4S17A 3HOUH 1V80A 4EZJA 4A93B 3QOJA 3BVGA 1J0GA 3U8ZA 5BN4A 2EPBA 2X69A 3ITPA 3STBC 1IW7C 1VQNA 4DV2Q 4PK1A 3R66C 4FNFA 3S15H 1PMRA 4NW2A 3PGEA 1SNQA 1P3QU 1ZYRD 2NB0A 2RR9A 4RH6A 2B29A 2K5QA 3KF8A 1IBKL 1VMCA 4LF4L 1KTKA 5JJZA 1HH2P 2R7FA 1W2BA 2CWPA 4MJSA 1E8ZA 3UQBA 3RZWC 1QF6A 1EYDA 2L00B 4A76A 4A3OA 5AZHA 3KYDD 4LF8L 1TS4A 2OHFA 3C19A 4RWSC 1MFWA 1E0BA 1RIPA 4X3UA 2N7DA 4G4KA 3CC4A 2DAJA 2GBKA 3G4SA 1EYCA 3W2DA 2BYFA 2PE9A 1SYDA 2KTRB 4DFAA 2GA4B 2KJHB 2ZJPA 2K39A 4EFOA 4L1BA 3H0GG 1X3FA 4TRDA 1O7LA 1K50A 1SNMA 4QUCA 1F0ZA 1XMQL 3M3YH 1NE3A 4DPGA 4RGNA 3OW2A 2FXQA 2F0GA 3G48A 3TZUA 4LFAL 2I2YA 4S0RA 1TU2B 3CRKC 1VQKA 1XLOA 2ZW1A 2KAJA 1AN8A 2OXPA 1KFYB 3HM3A 1HA6A 1PTOC 3KDFB 1HZ6A 2SEBD 3F2DA 1C8CA 1V6EA 2CR5A 1OXSC 3HOVH 3MP9A 1LTTD 4PQXA 3D31A 1FMAD 1K3BC 3I3TB 4A90A 1TS3A 3LDZE 1S3OA 2LASA 3GTOH 1QOGA 2WXFA 2K32A 5LL6X 3G6EA 1C4QA 2JF5A 4B9KA 3T1HQ 2A4ZA 4FJZA 4II3B 4JWSC 1P16A 4P1CC 1HE8A 5E6NA 5C3JB 4FP5D 1PYSB 5D14A 1CSQA 2INDC 1BCPF 2EJGC 2K6AA 3C2PA 4OZBA 3ULLA 2XGTA 1HEZE 3A1QA 4FF2A 1QZHA 3APCA 3H9DA 4PS7A 2ZEQA 3SK4A 4Z9CB 4YY3Q 4WIPA 2KHJA 4DDID 3L0WB 1HNXL 3A0JA 1GC7A 4EGVA 4BBSG 2KOLA 2B2YC 3PT2B 2Q2UA 3T3OA 1XD3B 1LM0A 2LXKA 4C3IB 2PYKA 2J0JA 1VQIA 3NS1A 2F0FA 4W9KA 1VQBA 2A68C 4HN7A 4AYBG 3VYTA 4KD4A 3U7DA 3LXFA 2WINB 3AU7A 3E5SA 1J9OA 4IFDJ 4KY5A 2RSUA 5GXGB 5BMHA 4TKNA 1XLNA 2D10A 3DDCB 1XT9B 1N60A 1OEYA 5AJ3Q 2PQAB 3ULPA 4AQYL 1SYEA 1V1PB 2Z6KC 3FKIH 1XTDA 4HSPA 3QG1A 2DWQA 4TV3A 3VTVA 3GTQH 4QF4A 4HCSA 3QQ8B 4II2B 2QEJC 4GKKQ 1WGHA 4NKLA 2EJFC 1B7YB 1N36L 2WXOA 2NBVB 2KN5A 3M7GA 2FMMA 1L5PA 3GD7A 3DWQA 4K1RB 5IY0A 3KWLA 3R93A 5I4DA 2HDEA 4HPLB 1PYWD 1QUQB 5E4XA 1CSPA 3AV8A 5HI1A 4DV5L 3NHHA 4FF4A 3DEPA 1AWDA 2FAZA 4HLEA 4ULLA 1PHJA 3AEFB 5IGGA 2ASBA 2WB1E 4KGTA 2G4DB 1ZYRC 3N30A 4LW1A 3DLLA 4EVOA 4IURA 2BS3B 3VFKA 5DPWA 4MGZE 3IAYA 1RKNA 3HKZG 5J1ZA 4USAA 2J4XA 3A56A 1H9SA 4GN3B 3STBD 1WZ0A 4MNOA 2JA5G 2L8JA 1S4ZA 2LGXA 3QR8A 2QDFA 4ZK9B 3MAQA 2J7ZA 1DCZA 1II3A 1TQOA 2KEEA 4ZYSA 1S3SG 5JZEB 4OX9L 3G6JB 4PMBA 1HNWQ 1SMYC 5H1SE 1QWYA 1TZOA 2KFKA 2ON8A 4IUTA 4FHJA 4DHZE 2VXWA 3ZDMC 2XN9C 4A3IB 5JJLA 1C4PA 1PTOH 4DU9A 4KGSA 1WE6A 2KCMA 4R3DA 4XWTA 4EZLA 3ZQ4A 2KD0A 2EXZA 3I73A 4R8IA 1A2UA 1ZXIA 2LY7A 5D94A 2DY8A 3ZJUA 1TXYA 1GVPA 4LFCL 3ALBA 4C3IH 2OTLA 4EQPA 1IYFA 2LFNA 2O4XA 3BU2A 3KYHC 2F0VA 3PRZA 3SU8X 1EWYC 2RQXA 4WORA 2RDHA 3PO2B 1N6ZA 4OWXB 3RLOA 1C79A 3U9SA 2K8BA 2E5LQ 4R8NA 1AARA 4GN1A 1EWIA 1NDDA 2XRQD 2KWCA 2DN8A 1TIID 1WGGA 2UUCL 3FKIB 5KGUA 3AEGB 1YQBA 2BYVE 4GU2A 4IW0A 4E3CA 3MEHA 3JAMc 2KA7A 4LDTB 5DCNA 4LF5L 3PIOA 4A75A 3QARA 1YOVB 3I5JC 2LEKA 1KDAA 2J0TD 1KAWA 2KX0A 1SNDA 3HEJA 3AM9A 2K52A 4NPSA 2JA6H 2LFIA 3OJ4B 3PLUA 4X62Q 2DNCA 5EKIA 2G9HD 4DAVA 1XX8A 3W5OA 1S5BD 1RM6C 3Q6BA 2IT1A 5IO9A 4TQ0A 2KUMA 3K81C 4JI8Q 1IBLQ 4P72A 1LTSD 5CV6A 3E9HA 1UE6A 2AX5A 2C7NB 3V05A 4CKEA 1D3ZA 2JA5H 1LV9A 2ZW0A 3GB1A 1AP0A 3AMZA 3B0AA 3QC8B 3WAOA 1VQLA 2DJGC 1V5TA 3P1MA 5DLQE 1H9JA 1WM2A 4QY7A 1SE9A 2F0MA 2MBBB 4YXDB 2FCMA 3ZO5B 1DYQA 5CORA 5JHBA 2EY6A 3H0GH 2D2CC 3S16H 1BMLC 3PZ8A 5C3XA 4DV4L 4DR7Q 3RULA 2WXJA 4C1NI 3I7FA 2I5LX 1JRUA 3TS2A 1FD7D 1H9MA 1I6HH 4Y52H 3CXCA 4LF4Q 1V81A 2NUCA 2Z59B 4OWTB 2FIFA 4BAXA 1YNNC 2NWGA 1TS5A 4O1NA 1F2RC 2LGSA 5BN5A 2A6EC 2PW7A 2DZIA 2JXTA 1E8XA 3NUHB 1GJXA 3DCGA 2QDBA 4RCNA 3RZDB 1HFGA 1J19A 4JBJA 3R8BA 2F0WA 2BH8A 1F9RA 4KSKC 2G1EA 4ZRQA 5DEHA 1C78A 4NDXA 3UE1A 2IY0B 3Q23A 5JAVA 1FYCA 1ENCA 3E0JA 4IUNA 1HZ5A 2N1VA 3UQAA 1YJ9A 2NMQA 2B2VC 3C1FA 2GI9A 1TGZB 4C80A 1LTAD 2Y0SE 3MZ5A 1VZ6A 2V3SA 5M3MB 4KJNA 5C23A 2J7QB 3BK1A 2CHWA 2L7RA 1PH6A 2WB1B 3RPFC 1C76A 5G5GA 2C7MB 3MTSA 1KF6B 3GTPH 4B0MA 3Q8BA 3A8JE 2UU7A 1AE2A 2UXCQ 2BWES 4NZLB 2NPTA 4TKOB 2UUCQ 3Q3JA 5EPKA 3J7ZC 4GDLB 5E1FA 2JA6B 4OO1H 3I2ZA 1O7ZA 1Y1WB 1H95A 1PUTA 3IVFA 3ZTCA 2MPMA 1PVOA 4IPCA 2LGDA 1HNZL 2C5CA 1S40A 2LGIA 2VZKD 2O2LD 4O0AA 5IOIA 3HVZA 1UGMA 4C3HH 1BCPB 3J81j 1EM7A 3MEFA 1Y8RC 3NWSA 4HJ7A 1OO9B 1GUNA 1XNQL 3PUZA 2J42A 3PZ7A 3HOZB 4EQNA 2WXPA 5HGTA 2KANA 1SMYD 1UBIA 5C4XH 1YNJD 3I70A 1SDFA 1YITA 4MGIE 1MPEA 2N1WA 3H7PA 4CJ1B 5M5YB 1GD7A 2JWZA 5M5WH 3A54A 1KH0A 2M19A 4HK2A 1BVSA 2CWAA 2RHSB 4A3MG 4FF3A 1DZ1A 1HTLD 2Y0SG 5HGQA 3C1EA 3J80L 1UH6A 2JZPA 2WHIA 3AI5A 1S5FD 4BA2I 1UEBA 2BS2B 4GNXC 4NB3A 4G3XB 1ROEA 3N52A 3UF8A 1YJWA 1L0WA 3MHZA 4GZYC 4EEWA 5ELFA 4IFDH 1EY0A 1N8RC 3CCLA 2EYMA 1JJ2A 1TKYA 4PT5A 3RNAC 4K6LA 2LXAA 2YV5A 4JI1L 1F2RI 3H6NA 3KBXA 2D0PA 1F77A 2GN5A 1XYIA 4WAAA 3I4NG 5MPOA 3VVWB 4LF9L 3PRMB 2R92H 1RFKA 1YD8U 1O7YA 3H15A 3JSVB 1NYRA 3V62A 2MX2A 3ZRCA 1E90A 2J0MA 2QGQA 3BVZA 4LCDE 4NQKE 3DQVA 2K1BA 1RD9D 1KXLA 2Q8IB 2KFKB 3PVLA 3Q0AA 4KZ0A 4KHVA 4OO1G 2R7ZH 3ZXVA 1TS2A 4X6AH 2AQ3B 4MT5A 2KTFA 3KLSX 3P4SB 4HSVA 1KNEA 5TSSA 4DNTB 2LMCB 1G6ZA 2UXBQ 2DGYA 3SK6A 3BINA 2CVRA 1U5KA 4LNKA 3KQ4A 2EY5A 1D1KA 3BYYB 2KFJA 4AWJA 3KUDB 5JHAA 4KKTA 2MEKA 3CHBD 4A3IH 4DBGA 1M94A 2EYFA 5GAGC 3CCSA 2FUG1 3IG3A 5C4XG 4C1NK 1TWCH 2B63H 1JQYD 4XDCA 1U4PA 1PRTF 1LUZA 2IBIB 1QOFA 1WE7A 1YIWA 3M63B 3SD5A 5EE9A 1ASZA 4A3BB 3T56B 1ZP0B 1SN8A 4MZ9A 1J7BA 4OHJA 1IYJB 1B44D 1S5DD 2BKRB 3VHTC 5M3MH 2DZJA 1BT0A 5C4JB 1O7IA 2CQOA 3H7SA 3Q2AC 3A9KA 4BA1I 2OQKA 2WAQE 5DNFA 2BB6A 5EDSA 5G2NA 2ALYB 2K03A 2WDQB 1ENAA 1A0IA 4K7WA 2KBNA 5IYCH 3A9JB 3KBGA 3U9OA 3MXNA 2JZZA 3P4RB 4ICUA 3MFYA 4LWCA 2YU9B 2LXJA 2RCFA 1MHXA 3ONAB 2AQ2B 3Q6SA 1Y1WH 4OVUA 5KHOA 1GB1A 3HS0C 2F4VQ 3NUCA 1WTRA 1Q1OA 4IM3A 2A6ED 2HD3A 2WYQA 1V9PA 1DONA 4HIDA 2PKOA 4MGYE 4ZRPA 5BYRA 2I46A 2DYMA 1E9MA 1P7EA 3NENA 1EQRA 4TQUS 4BBRG 2WXGA 2ZXRA 1PH3A 4HEDA 5DM73 5C4HA 3FAHA 3ECIA 4DHZB 4M01A 2FCQA 3P4QB 2O2VA 1VDZA 3GO5A 2AHOB 3NBHB 1LXDA 4A3KH 4L23A 4KY7A 3K5LA 1UZXB 2N9LA 3ULJA 3H09A 3R3MA 4JI8L 2ES2A 3VRAB 2PW5A 5AZFA 4LF9Q 1HQRD 4DXAB 1EEFD 1DOYA 3FILA 1O80A 2QILA 4G50A 2ZNVB 2JA8H 5E6OA 3S2AA 1YHAA 1A3TA 1RDPD 2O6VD 3Q3FA 1JC7A 4X66Q 1TKEA 3BZKA 3NZUA 4JIOU 1WGKA 2M8SA 5T8IA 3PUWA 2WIIB 1K53A 4GDLA 4PS8A 2KWDA 5LMUQ 1WXVA 3RNGC 3V61A 1IZ6A 3BY4B 2KQSA 1DOIA 1FPYA 2NN6G 1WXAA 2BQQA 2PPHA 3VAWA 1YJIA 4WWNA 4YWMA 3GTMH 1AH9A 1X3PA 1V97A 3PHWB 5LL6S 1BF4A 4L5SA 2Q2IA 1XJVA 5COYA 4V190 1E22A 1E5WA 4NXMQ 3AU5A 3NELA 1M90C 2AWNA 2KHIA 2KDBA 2WDTB 3T13A 2PIAA 2RSNA 3SR1A 4GNXA 4O42A 1JE4A 1NSNS 1NTGA 4C3JH 3T53B 3URYA 1QVCA 5C4ZA 1YJJA 1YX6B 2EYOA 3GE8C 3NZSA 2MRPA 5IGBA 3LWUA 4MJSB 1J5EL 2LKVA 4C3HB 2L83A 3VYRA 5D65A 5LLIA 2W3SA 3LYYA 1D6EC 1EQQA 2ATWA 1T0QC 3RLFA 1P7FA 3U30A 1CI3M 3DHGC 1WCMH 1PFSA 1Q1EA 2SDFA 1PZKD 5IYBH 2D3BA 3U4ZA 4OVZA 3K0YA 1EQTA 3ERQA 1JR0D 4M8AA 1F2YA 2HIVA 3S2DH 3AE1B 1E0ZA 1Z9FA 1OGWA 3K5NA 2Q8TA 2BDOA 4A3KB 1WX8A 1D8LA 4KTAA 1SF0A 1BBWA 1QVGA 5C3EH 2B2WC 1E7UA 5EBDA 2JU6X 1NMGA 4F7XA 3WA0A 1BCPC 4A3EH 2BB5A 1FXIA 3D4WA 3DUZA 2F0PA 1YJNA 3Q8DA 3RUIB 3BYTB 1SJED 3TMPB 1G2TA 1Y1VH 4K0KL 2WDRB 1E24A 2QKIC 4ZHPA 3EQLC 2GVAA 1PH1A 3J7AF 4A3CH 4K3BA 1STHA 1F9QA 2K9XA 4ICVA 3UINB 1ICFB 3TS0A 2LVQA 3MC8A 1SYFA 3AH7A 4A3JG 4DGZA 2D5DA 3KK7A 5KRUA 3Q24A 4IFDI 2DZKA 3X0WA 1A8VA 5FJ8H 3TQYA 5I2YA 3R2IA 5CYUA 4DUZQ 2CQAA 1KC8C 1KOTA 1I4QA 3RR5A 3M4YA 2ID0A 2PQEA 4OONA 2A68D 1JWAD 2BWFA 3F8TA 2QJLA 2C9OA 4MACA 4DV7Q 3RN2A 4ABNA 5I9OA 4FJYA 4M0WA 1SR3A 1EZ8A 2A19A 4R9WA 2ZTDA 5JPMC 2I38A 4OW0A 1JCKB 1ZW7A 1OTCA 4ZRKA 3ZNZB 1LTBD 2VQFL 3S24A 1E8YA 3CMEA 2AUJD 2ZTCA 5M5XB 1WM3A 1WFQA 2ZTEA 1TYGB 1UBQA 3KVFB 2KDMA 2N3SA 5FOBB 5K5PA 2VL6A 3SXHA 1V9JA 1K9MC 1HA5A 4A3IG 3ZJYC 2JSVX 2KYWA 3NBHA 2JE6I 3V3XA 1VZ7A 3C3LA 2BYEA 2JA8B 5JJKA 1NAPA 4POGA 4UP9A 3I90A 5C6AA 2MBHA 4FBJB 1GUAB 3V96A 3DBHI 4WJNA 4WQOB 3X3MA 5LXIB 1A5RA 2KJXA 3E3XA 4HJAA 3N6RA 3PRPB 4B6WA 4KHPL 5HG2A 4I6LB 1OXUA 4DNRB 3UIOB 1W6JA 5LXHA 2IHEA 4UP7A 1T5XD 5D2MB 2WACA 2PI2A 1PFNA 1EIFA 1CK1A 2V1CC 1KRHA 4G7OC 2BVCA 4X57B 1V49A 2WXIA 1QZEA 4UY8C 4B3RL 2E8GA 3VR8B 4ASWC 2OTJA 2NVTB 4M1UB 3W1GA 1N61A 1I42A 4ZLTF 4QIWB 2M17A 3RFZB 4A20A 4A3FG 4MTKA 4P2CB 4IJLA 4REZA 3A55A 4ZRIA 1H8CA 2B8GA 4C4VA 3AECB 2NVXH 3TUOA 1YNND 4DV6L 4R4OA 1MI0A 4GS3A 4GLAC 1K73C 2RSOA 1I94Q 2L0TA 2SNMA 2R61A 3OPOA 2BT6A 3GP7A 2B2TA 1JE5A 4LF5Q 2R93G 3L10B 4G11A 3ZJVA 3F2BA 3S16B 1UELA 3CCVA 3V6EB 1G6JA 2AL3A 3A9JA 3IFWB 1TWGH 2EOTA 4X65L 3L2PA 5CMDA 1SE2A 2EY1A 2ZJQA 3APFA 4NAWA 1EF1A 3GV3A 5TR5A 4DR1Q 3DBLI 5IAAC 1T6BX 2PQAA 3TEZA 4NAWB 1FO4A 5KYLA 1P9DU 4R1JA 2NR2A 3QWNA 4HWIB 2K5HA 1PGAA 1ZKOA 1SIJA 3S9WA 2ZM6Q 1L1OB 4DDGD 2TMPA 4WJQA 3CD6A 4B3MQ 3X23A 5C0XI 4J6IA 2CKZB 3S14H 2NCNA 3AE8B 2MP1A 3WAPA 2AKWB 2E2HH 1ZE3D 1C9FA 2HUGA 2YYZA 3UDIA 3EROA 1V5OA 2EIFA 4ARIA 5E3FA 5GQOA 3D6CA 2M4NA 5G5HA 3Q22A 1STAA 2NVYH 2KJ6A 2RF4A 2HDMA 3HRDD 3FMCA 2HQEA 1I4XA 5JEAH 4E74A 2BTEA 2PW9A 3HOUB 3CPWA 1WD0A 3J81E 1QCBD 2NTSA 3KUPA 1TT2A 1T0RC 1KRSA 2N78A 4HMJA 3Q8FA 1F2MA 4PMCA 3OTOQ 3L13A 1LFDA 3CIRB 3HK0A 3NS8A 2HTME 4XT3B 1FCLA 2N7EA 3D3RA 2F0TA 4X64L 4DR4Q 1K8RB 5CV9A 4QB4A 3NPPA 2MH7A 2WXHA 3T3NA 1U4MA 1XWEA 3HFZB 1HZ9A 4B3RQ 3SDLC 1SSOA 4YSXB 2J52A 1B8AA 4L63B 5IN7A 3PMFA 1QNKA 4IQZA 1ML0D 3DVGX 2L11A 1E7ZA 4HJ9A 4A3FH 3HIZA 4H0LC 1FIQA 4HPPA 1GC6A 3NE5B 1XMOQ 1CKNB 3HOWG 5FLXE 2HQLA 2IGHA 4DQOC 2DAFA 3UI2A 4DR6Q 1PZID 4A3GB 3VDYA 2BE5C 4TVAB 2MSED 3PHXB 2KOXA 4DK0A 1CKOA 3DVGY 4M0WB 1BQQT 1WCMB 3GTQB 2VB2X 1HTOA 4Y7NH 2VQEL 2FBWB 4YCWA 2GBJA 4TSSA 2CU1A 4HIMA 4A3MB 1X65A 2F0KA 4OEMB 3JW0X 4A9AA 2KO3A 3VR2A 5BR8L 1KHIA 1I94L 1HR0Q 1RLFA 3SR6A 3PIO3 3V2TA 4NXNL 3NP8A 4QGUA 4W9EA 1CA6A 4JCVE 3TP7A 3S15B 1NYQA 3APDA 1C0AA 1IXRA 3NSWA 4FULA 2R92B 5GAEC 2ZM6L 4YCUA 2F3IA 3HOXH 4DR1L 1A63A 4BVUC 1I35A 1L1OC 1WWTA 1UE7A 1JT8A 4KHZA 3I4NB 4U68A 3VR3A 3QOLA 1WF9A 4AIMA 2PEAA 1KLGD 3KLWA 4L5TA 5C5LA 5I6YA 3LJ3A 3OMGA 4A55A 1SJHD 4DR5Q 2LRUA 1LYLA 4ITKA 2QSDA 3B08A 4LNOA 1V2YA 1TWGB 1RWSA 2V1YA 4AUQC 2PMZE 3AEAB 1X3QA 3ICEA 1VQ9A 1PDQA 2KCTA 2K25A 2KDEB 3AE7B 3K59A 1PTOB 2LXCA 2DY7A 4UAIA 1FVIA 2MBEA 3I72A 3IFDA 2B63B 1L0YB 1Q12A 2WAQG 1FL0A 2KMMA 2F0HA 1YVCA 2UU9Q 2F0QA 1L6UA 2Q2HA 4C2MB 2UUAL 3S14B 3S1NB 4ZDVA 3NXWA 1X55A 5JVG3 4GOPA 1RTNA 3ZNGC 4C7YA 5KHQA 4DAMA 1Y8OB 4A93G 1CZWA 5C3WA 3Q8EA 2B2TC 2EELA 5JVH3 2UWQA 4CDDC 1VQ6A 2CFMA 2IY5B 2XK5B 4DR6L 2YTVA 4UHVA 4JV5L 4CQNA 1SLJA 4A3LG 4XQNA 3ZKJC 3AE6B 1GUTA 4P16A 2ZPYA 2HJ1A 2L32A 2MW5A 1FGBD 2KXJA 4N59A 3CCJA 1Y14B 3I56A 3OWFA 2D0OA 3L4PA 4CKBA 4DWFA 4JI3L 1HUNA 4KX6B 2F03A 2VY3A 2XTIA 5BYSA 4RNAA 5HURA 2WDVB 3E9SA 3UDXA 3ZYYX 4ALPA 2IL8A 1HTPA 3KJPA 3K5MA 3EJIA 4CGYB 2JX5A 4HDOA 1T9HA 4B0EA 2HD5B 4FXKC 2BS4B 2IO0B 3J7YW 3VA5A 4EX5A 2WKDA 5BMIA 2MNAA 3MXGA 1YX5B 1WXQA 3GTKB 2A74C 3KWVA 1KAAA 3I4MH 3DWMA 5BR8Q 1HR0L 4US8A 2HCCA 1IGCA 4R4CA 3TMEA 4BBRB 3FPPA 3J80c 2JQOA 1KQSA 2NZOA 1C9OA 2H88B 2OJWA 2F4VL 1VZ8A 3PCOB 3QJYA 4P75A 3N1YC 3D4DA 3PPAA 4WWPA 1QLBB 4UP8A 3A8KE 2KENA 2KQ4X 3VYUA 2QMTA 2W3RA 1GKHA 4DV5Q 3RZDH 1KLUD 4JPSA 1EWHA 3RNBC 3LNNA 4HTHA 5I6WA 4F88A 4M8NA 2DUDA 2L1AA 4XXEA 4NAMA 1W3SA 2J53A 1C3TA 2EYJA 4BXXG 2VUMH 4IOIE 1I3QB 2WLBA 3JVZX 2F0IA 3EFXD 1IBKQ 1NMFA 3GTLB 2E2HB 1ZDXA 5FJ8G 1C4AA 1I4RA 2N9PC 1H9SB 5I2XA 3CPFA 4QUFA 3J81c 4A8XC 4A3JH 5EPLA 1LACA 3NVZA 2K14A 5CHWA 1EU3A 2UUAQ 1IKMA 3ZXRA 4HJ5A 4OX9Q 4M8MA 2UUBL 1TWHB 3WAMA 1J8CA 2EVBA 1E8WA 1RYJA 4ANXA 4KKUA 2PMZB 4B3TQ 3S1MH 2GBRA 2MJDA 3QX1A 1WTPA 1SBBB 4IOCA 4EQOA 4WJ3M 4RGTA 2K8CA 1FM0D 3QWZB 3ZNHB 3TEWA 3OJ3A 4KK7A 4BBSB 4RG1A 3UE0A 3K58A 3OHXC 2RD0A 1C7YA 4C3JB 4JI5L 4A3PA 4ANWA 1OEYJ 2K3UA 2IX0A 2EZVA 2MBQA 1HTQA 2CKHB 4AYBB 2BBCA 3NOBA 1XLPA 1MD2D 1V1PA 3ML8A 4KSLC 2IO2B 3PO3H 2E2JB 1KABA 3GV6A 4KKJA 1STBA 1PH9A 2F3WA 2CU3A 3QAQA 3W9CB 2XNAC 3OTOL 4PZ8A 3VR4A 1GPXA 3VA7A 4JI7L 4DK6C 3EFUA 3HOYH 5IYBG 5HFYA 4WJOA 1SGHA 1A3UA 1DJRD 5M5WB 2MHJA 2KKCA 2N9XA 1TY0A 3RZOB 2E74C 3H94A 5ELBA 1VQEA 1SYGA 3T1YL 4DR2L 1N34Q 3D0FA 1XPUA 4DV3Q 2D3CA 3LX0A 1D5ZC 2MWSB 1ISNA 1GOZA 2JN4A 3P7JA 2KK8A 4HCPB 2FUHB 1E10A 1RODA 2LVPA 1TWAH 1IL2A 4URKA 4J6HA 4B9WA 4N6EB 1LT4D 2NYZD 3S1RB 3DBRB 4ZRJA 4DR3L 5IGEA 2IYDB 3M3JA 3HKZE 4JBWA 2JA7B 1R4MB 3PTFC 4JWUC 3UIPB 1X9NA 2JK8A 5JH5C 1SE8A 3HKZB 1LT3D 5ELOA 1WR6E 4D2KA 4LFBQ 1VQ4A 5NUCA 2INNE 1WJJA 2MQHA 2JA5B 5D3IB 1EIHA 4A3JB 3AE4B 3U2SC 3ZTDA 1C48A 4YSZB 2QEXA 2KWVB 3HOVG 1ZXTA 4RHRA 2NN6H 3OIPA 3MA2B 3M7NA 2X8XX 3PO0A 3JAMi 3L7ZC 2B2VA 2WXQA 1BUVT 1K8GA 4NMZA 3RCZA 2H89B 2AUKA 4DV0L 4W9JA 4FXCA 2ZPNA 1ILPA 4HJ8A 5AUKA 4DUYQ 4KDLB 1EL0A 1WI0A 3PUXA 3FHWA 4GIVA 4C00A 4EE2A 4FA6A 3BWUD 2KQ3A 2BA0A 5FLMG 1VQMA 3AEVA 1RHPA 3PQIA 4JI6Q 4DAPA 1LT6D 4WJWA 4X3KA 1WSPA 2RGFA 3EIVA 3KUCB 3K9PB 2KTRA 4W9IA 3AFPA 1HJPA 1BNZA 1GUWA 4LTUA 3E9IA 5M3FH 4NNJB 3QCAA 2PPBC 4X3SA 2C9WB 2C35B 1I5FA 3FKIG 4RFBA 2VQFQ 3HOYB 1QOAA 2Q5WD 1PH5A 3KFUA 2JSOA 3QK0A 3WOFA 2FCSA 4MEMA 4KZCA 3W5VB 3WIMA 3HHMA 4YY3L 1A3VA 1VQ5A 3NJTA 5JEAG 4FO2A 4G7ZC 4WH4A 1Q0WB 4BY1B 3KW5B 3SEBA 3K80C 3SK8A 5EKLA 2HDLA 3ZVVA 1OQRA 3TRZA 3FVQA 2BCOA 2UU9L 2V3PA 1TWAB 4GLVB 4CBVA 1N33L 2F0OA 4OL7A 3A33B 4FJVB 2B39A 1FFVA 2OEOA 2YU9H 2CS4A 4ODGA 5HY6A 1HHVA 5FKAC 1FD6A 1U4AA 1U9RA 3I4LA 1TZ1A 2D11A 4HCNB 4KY6A 2NTTA 3ZIMA 1S72A 3SHLA 5D3DA 4AQ7A 1PQSA 3GS2A 2KHSA 2A6HC 3BDLA 4DA2A 4AQYQ 1KD1C 1STYA 1EY8A 1DXMA 1X56A 1B1ZA 5ELCA 3T1YQ 3EFCA 3KF8B 4GOCA 5J2RA 4QCLA 3PO3B 2PVOD 3KLSA 4KD3A 1D5XC 3K6OA 5T1IA 4JV5Q 3TN2A 2R93B 3QA8A 1CHQD 4JI0Q 1A2TA 3I55A 4ANUA 3DVNV 2K0PA 2UXDL 1Y8NB 3CMAA 1Q3LA 3HOZH 1JOKA 3TREA 3I4MB 1K51A 3CW2C 1B9NA 1WVLA 2KZRA 4B3SQ 2LI5A 2X38A 1X1MA 2CH4A 1XQQA 2K1FA 2MJ8A 1MVKA 4NP5A 4J15A 5EAYA 1ZEQX 3CSFA 1IBXB 3RZOH 3M9BA 1AYFA 1I7HA 1ZUD2 1BO0A 1X6OA 1B4OA 2L0FA 1B9MA 1LLRD 3Q69A 1ILQA 3KUZA 2G45B 3PS6A 1GHJA 5J39A 4JI1Q 4DV2L 4JL9A 3BZCA 1WTOA 5CHVC 3PIPA 1IW7D 2L3ZA 1PGXA 3VR5A 4BZAA 2JYEA 4KIKA 2AQ1B 2IHFA 2NBWB 5EE1A 1OXTA 2BA1A 5ELNA 5M3MG 4GNXB 2M00A 1IGDA 2VUMB 2LUEA 2WB1G 1M8AA 3W3AA 4ZUIA 4RF1A 4E71A 1L2NA 2N9EB 4GN5A 3RI7C 1B3QA 1CHPD 3VH4B 1LTRD 4DHJD 4IUMB 4I65A 4H13C 1K8MA 3L54A 5C4JH 1UD7A 4ID6A 1CJEA 4IM2A 4EZKA 1UAPA 1VQJA 2O6VA 3SVMA 2LS01 2L76A 2QW7A 1MJCA 1PRTB 3FILB 1CTMA 1TWHH 1J7CA 2EKIA 3I9V1 5G55A 4BS9A 1DOKA 4JE3B 1UF0A 3ZRFA 3IRBA 1QZGA 1HFNA 1WR1A 4H7BA 2K75A 2I07B 2AYOB 4GDKB 5CX3A 1ET9A 2WFWA 3NRZA 4BBNC 2LHDA 1ESFA 5KEEA 2MCNB 1M4VA 1EZ6A 5LHY1 1PV4A 1VDVA 2CCZA 1ENFA 1PZJD 2MP2A 2JPHA 3T1HL 4RKBA 1TWCB 3B1LX 1R4NB 1XO3A 4IWQA 3R7RA 1Z6HA 3N1ZC 1N5XA 3HOWB 2E2JH 3IKJA 1XNRL 2GBNA 4X64Q 2KQ7A 4RM9A 4KI0A 2VW9A 2KMCA 4N58A 1VR9A 1EY5A 4DXFA 2GBMA 4JK1C 3NZ3A 4GLSC 2C60A 3NVWA 2JEAI 5BMGA 3K5OA 1LT5D 1S1QB 1ZDVA 1WJ6A
chains in the Genus database with same CATH topology
3ND9A 3QO2A 4L6TB 2EYLA 2RDGA 2PNRC 1QG7A 1R4QB 3BS1A 4FXGC 2WP9B 1YN3A 1MBYA 3IAM1 4ZUJA 1CQFA 3H6MA 1KDBA 3M85A 5F2DA 3OIQA 2BOSA 2E75C 2JP1A 4YSYB 1G291 1VF7A 2Z1CA 2EYHA 1ICWA 4K5WA 1EY9A 4K8JA 1IKLA 3RMHA 3GTJB 3U4EG 1NR2A 4E6IA 1E2WA 5FLXL 1WTQA 3FDTA 2LMCA 1WTWA 2RPVA 5T1GA 3HVDA 1CZGA 3W1SA 4FVMA 3NWTA 2DYOA 4CJ2C 1ET6A 1XEEA 2ZT9C 2ZXOA 4OZAA 3HP3A 3S2DB 1FFUA 2WXRA 3K7AB 2XVSA 3U52E 3UI3A 2H4OA 5K36G 2N0SB 3J81L 2FHTA 5CC4A 2ICEC 2WXMA 1SE3A 1JOOA 2KCNA 2IW3A 1WTVA 2GB1A 2V4DA 3TBIB 1GB4A 1V8CA 2R6GA 2K5DA 1AZQA 1ZPSA 3KLRA 4HR7B 2H1EA 3SFEB 1TR5A 1UWMA 5C0XG 3AB5A 3AE5B 3R2TA 4US9A 3PUVA 4C7ZA 4ARCA 4K8IA 3MWYW 3AMUA 3NBIA 2E6XA 1EOTA 4A6QA 1ZOYB 2IWHA 1N62A 1KDCA 2K04A 3IFTA 2NZ1D 5CV4A 2CW0D 2OEDA 1S5ED 5E6JA 2V0GA 1QILA 3I8ZA 1NI3A 4RKLA 2N55A 1L4DB 2WS3B 1O78A 3QB3A 4FYDA 2K7VA 1YN4A 2CJNA 3A7AB 1MGSA 1IBXA 5KNBA 2RVLA 2E2IB 3S1MB 3L3OC 3P4PB 4HCEA 2EE1A 1XXGA 5EQ0A 3DMUA 5DAUA 1IYVA 3X3NA 5C5MA 2OF1A 2W82A 3AE3B 4XYQA 3ABVB 1JQ4A 3RD4A 5IODA 4X3TA 2WXNA 4IZ8A 4LK0M 3NTKA 4H2AA 1YQ4B 2DLBA 4K6DA 3NTIA 3AE2B 1E2ZA 2B2UC 5EE3A 5IOCA 4RGMA 1L0XB 1BCPD 5CBAE 4Y7NB 1ONLA 2CHBD 2QIEB 2WXKA 3W5UB 4OO1I 2XWBB 3S2HB 1D4BA 2OT2A 4LK1C 4IFDG 2L9HA 4KKIA 1F9SA 5AFWA 3B2GA 2NVYB 2BDNA 3NQIA 3JAML 4XQJA 5FK9C 1IUEA 2VZKB 2PZWA 2IGDA 1STGA 1OFFA 4YTMB 4MN3A 2D5GA 1KNAA 2PCFB 1QE6A 2M56B 4XDXA 1D1IA 2PLPA 5J22A 3OWEB 2FFKB 4HRSA 3WCQA 2KEDA 1AW7A 2PMVA 1WYGA 2WP8J 3NVVA 2PZUA 4XQQA 4RGOS 4ZAIA 2SNSA 1CM9A 2F0LA 4F87A 1BBXC 2MJEA 4DK1A 2B2UA 4Q2JA 2A69C 3E56A 2XRSD 1JWBD 4JX1C 1BR9A 2W54A 2YEPB 1STNA 3C46A 4HAEA 3HOXB 1SNPA 3GTOB 5C0XH 3J80E 2EDGA 3VR9B 2RA4A 4CHTB 2F0NA 3DWPA 3R3OA 4ZHOA 1BUIC 2RMMA 2K01A 1MSGA 4LAAA 4KKSA 5IGDA 4S3SA 4MIUA 1JICA 3A8IE 1SFOB 1RTOA 3I57A 2L4NA 1K83B 4Q5VA 2FE8A 1I4GA 1JWMD 3IT4B 4A3DB 2M2LA 3AEDB 5JXVA 4IALA 3DXJC 1SB3C 1SE4A 2R3ZA 3NVYA 1I50B 1SNCA 3AE9B 1CFMA 3OOCA 1Y8PB 1VRAB 5C2TB 1I4PA 1QNUA 5ISRA 3MFGA 3TZDA 4XE0A 1IL8A 4HROA 3SK5A 1SAPA 3GTPB 4J1MA 1EFID 2Q8RE 3IT6B 2INPE 2G9DA 1DOMA 2CW0C 4KJOA 3I91A 3GTGB 1FCCC 1FNUA 2L12A 4H44C 4HEA1 1VCIA 2L0CA 3F2UA 3M4OB 2RKSA 5EKKA 2JEBI 2XSCA 1TVXA 4MM3B 3I3CA 2AWOA 2PVGC 1GHKA 3ZGZA 3FRPB 1WD1A 2F0JA 1V43A 5I9PA 1OXXK 5IT9L 2EJMA 1Z7TA 3DWGC 3NK9A 1PXUA 3QIAA 1B3AA 2B8FA 1B2TA 5LNK1 1E6EB 1AFPA 3IAS1 1B9RA 4WURA 2Z8LA 3MXUA 1I6VC 2E76C 5K36H 1RJTA 1N63A 1JB3A 2L1BA 4K14A 1Y56A 5FO8B 5IIFA 3VRBB 1JWSD 3MHBA 3PIP3 4XT1B 3D4RA 4F8MA 2BW2A 3NTHA 1PGBA 1NUCA 4MH8A 1V8QA 1FNVA 2FJ2A 1SYCA 3DM1A 3N9YC 1XCTL 3VR6A 3S17B 1FR3A 1DM0B 5KNCA 1U4RA 3VQIA 5A35A 2Y5CA 1EQVA 2R7ZB 1A15A 3DHQA 1G2SA 3L9AX 3TDQA 1RCVD 1T5EA 4I7ZC 2V4IB 2JYOA 4PNYA 1EWCA 1JROA 1MHHE 5CBEE 2F0EA 2FMCA 2WAQB 1J8IA 1TY2A 2F0UA 2K22A 5M9OA 1PDXA 1K52A 5KYIA 4FF1A 3AN1A 4K5VA 3IL8A 1GAQB 3BIID 2KECA 3S1QB 5IGFA 1GUOA 1QJOA 3GQBA 1QT9A 5JOBA 3TP5A 4OIJA 3LWEA 3T4AC 3MVVA 5HHDG 2MUYA 2Y0SB 3T51B 4G7HC 2A6HD 1QB5D 5IGCA 3B2FA 5EPJA 4KN4C 1PFDA 3SFDB 2NN6I 1YQ3B 4CJ0B 2IX3A 2F0DA 2PO4A 1Q1BA 4ZKCB 1STEA 4RAUC 4G57A 1VJKA 4K5XA 3U7ZA 4RA8A 3H91A 4IUVA 2BYTA 2QF7A 3WOEA 3EGRA 4XYOA 2IJ0A 1FXAA 1HXYD 4P6VF 1TKWB 1W6KA 4PMWA 1LTID 4K2KA 4U673 4LMQD 5M3FB 5C4XB 3AEBB 1UWXA 2IDYA 1CQVA 3PV0A 1PTOD 4B9XA 1HPCA 1A6XA 3J7AV 1NEKB 1NCVA 3D6WA 3OMCA 2WNMA 3DEOA 3P1HA 1EEID 2L5TA 1A70A 4C3JG 1VMPA 2K28A 3ETRA 2N88A 2B76B 4LJZC 5EGTA 1Q10A 5DM63 1CT1D 4V0BA 5H92C 2IX1A 2O5IC 2LHEA 1EY4A 4WAFA 1JRPA 1G91A 1LTGD 1ESRA 4XIGS 2KACA 1YNTE 2MGSA 4ME5A 4ZKBB 3H3VC 3H0GB 3OSOA 1SXTA 3Q8AA 3FC4A 2SAKA 4FXDA 5JEAJ 5FO9B 1J7AA 3RUZA 3EUB2 1YNJC 5CR3A 4YTPB 4UDUC 5E4WC 1TWFB 1QOHA 5CGKA 1B50A 1ACCA 1AZPA 1WRIA 3OW7A 3P42A 1BOSA 2M9VA 4DF7A 1HRJA 1NVID 5JPNC 3HOVB 4YT0B 1QOBA 4ZQ3A 2DBYA 3BZDB 3BVMA 1OQQA 5A2QE 2F1MA 1Y69U 1CA5A 4BY7B 5CV7A 2WU2B 1BXTA 2KVMA 4WFN3 3AB9A 3JAME 2X6LA 2MHVA 4C3IG 3CRLC 2L52A 2VB3X 3P20A 1RF2D 3J9CA 3C8YA 4PV1C 4OZCA 2WQYB 3NQTA 1R9TB 2Y5PA 4ILWA 4K2LA 4C3HG 1PRTD 1GXDC 4KV6A 3AEEB 4HMIA 1QKZA 1JMLA 2N7JA 4TQ1A 4LLGM 1EY6A 1EIGA 4YIJA 4DXGA 2KCCA 1PRTC 2GRIA 1NR4A 3CQZB 2VNUD 2A5HA 5CV8A 1JORA 4YWGG 4HJGE 1SYBA 4RCOA 1EY7A 2Z4HA 1XF5L 1JOQA 4IUUA 2X6GA 1DOLA 1EU4A 1N5WA 3EA6A 4XWWA 3WDNA 2M0AA 1G8ZD 1OXVA 5G3LD 1JALA 1XCQL 1H9RA 4ZOHC 2D62A 2IPKD 4HKQA 4XTCS 3TEXA 3FEWX 3O13A 3TP6A 5BN3A 1UUPA 4N9PA 1VF5C 2E3TA 1SSNA 3BDCA 3HRZC 4ZRZA 2PZTA 1BDOA 3CU7A 4J3OD 4N9TA 2JXMB 4L8JA 3SE0A 2XWJB 5C3EB 1DD2A 3T16A 1DOXA 3EVQA 2NBFA 5C0XJ 2A73B 1Q8IA 3MJ5A 2CJOA 1B53A 4MHEA 3GTMB 1C77A 2DNEA 2Z4IA 3Q8CA 3IXSA 1Z47A 2JWUA 1F2ZA 2WKCA 3BDOA 1IYUA 5D7GA 2WV6D 2O5JC 1H9KA 4A3FB 1YN5A 4KMUC 3MC0B 1CZPA 3BK2A 1MSHA 2XIWA 4B08A 2Y3AA 1K8OA 3ND8A 3P75A 1L6VA 2ONQA 3K57A 4WWMA 2JQRB 3CKIB 1GUGA 3M3YB 1Q90A 5C44B 3HG9A 3SDZA 5IT9E 5EJWA 2BE5D 2TSSA 2NVQB 2W55A 1FEHA 4A3EB 1I6HB 5G3LF 4IUPA 1E2VA 1Y1VB 2A69D 4CKCA 5KNDA 1R7SA 2B2WA 4HKZE 1XLQA 2K5PA 2SOBA 1UEAB 2F3VA 3MXPA 2YEPF 1MI2A 4QMGA 1R4PB 3B9JA 2LUMA 1PFBA 4J8QA 1PTOF 3TP8A 1PLFA 4IDIA 2V3NA 3LB8C 1I4HA 1X32A 3DWAA 1HQMC 1L4ZB 2K05A 2B2YA 2PTLA 4DN4M 2QCPX 1U4LA 4BWGB 1S5CD 5KIXA 2RDFA 2RBMA 1E7PB 2FINB 2NVXB 1NENB 5ELEA 1TKGA 2ACZB 1UGJA 2ENBA 5AUIA 5BYQA 3HZXA 3H8HA 5H8YE 4NJCA 4KGRA 2F4IA 1LABA 2MJ3A 2ICIA 3CWIA 1JWUD 2F0SA 3TSSA 3E6ZX 1VLBA 4IKGA 1HCZA 4RF0A 1D5MC 3HGBA 4DAYA 1C4CA 3ZJTA 2E2DC 2WU5B 1F9PA 1D2BA 4OIKA 1T3QA 1YMHE 3P63A 3HUIA 1SNOA 5ELDA 1TJEA 1QQRA 3PUYA 1L0VB 1XTCD 4WQMA 3TEYA 4KN7C 2WXLA 4IN3A 1IHZA 2JYTA 3VYSA 3BG3A 2HCIA 4OGQC 5CV5A 1LO5D 3A7LA 1PFMA 3FPUB 1DGJA 1HUMA 5FO7B 4XDDA 4RHSA 4AS1A 4WRDA 1AEXA 2IGGA 1FRRA 2ZXPA 4L2YA 2LJIA 2K33A 1SEBD 2KN4A 2EY2A 2EYPA 4YTNB 4TMAB 3D8GA 2K5WA 2D9UA 5EBCA 1ZXHA 3G7LA 1FNWA 1JW9D 4C56C 4Q0FA 1FRDA 1EYAA 5EE0A 1GUSA 1WTXA 5A2QL 5FR3A 1F2LA 1UNSA 2L55A 4IUQA 2N9KA 1V1OA 4A93B 3QOJA 3BVGA 5BN4A 2EPBA 2X69A 3ITPA 1IW7C 4FNFA 1PMRA 4NW2A 1SNQA 1ZYRD 2NB0A 4RH6A 2K5QA 3KF8A 1VMCA 1KTKA 5JJZA 1QF6A 1EYDA 1TS4A 2OHFA 4RWSC 1E0BA 4X3UA 4G4KA 3W2DA 1EYCA 1SYDA 4DFAA 2GA4B 4L1BA 4TRDA 1O7LA 1K50A 1SNMA 4QUCA 1F0ZA 4RGNA 3TZUA 2F0GA 1TU2B 3CRKC 2ZW1A 1XLOA 2KAJA 1AN8A 2OXPA 1KFYB 1HA6A 1PTOC 1HZ6A 2SEBD 1C8CA 1OXSC 3MP9A 1LTTD 4PQXA 3D31A 1FMAD 4A90A 1TS3A 1QOGA 2WXFA 2K32A 5LL6X 1C4QA 4JWSC 5C3JB 4FP5D 5D14A 1BCPF 2EJGC 2K6AA 3C2PA 4OZBA 1HEZE 4FF2A 3SK4A 4Z9CB 4WIPA 4EGVA 2KOLA 2B2YC 3T3OA 4C3IB 2PYKA 3NS1A 2F0FA 2A68C 4HN7A 3VYTA 4KD4A 3LXFA 2WINB 3AU7A 3E5SA 1J9OA 4IFDJ 4KY5A 5GXGB 5BMHA 1XLNA 1N60A 1SYEA 1V1PB 4HSPA 3QG1A 2DWQA 4QF4A 4HCSA 2QEJC 4NKLA 2EJFC 2WXOA 3M7GA 2FMMA 1L5PA 3GD7A 3DWQA 3KWLA 3R93A 5I4DA 2HDEA 1PYWD 5E4XA 3AV8A 5HI1A 3NHHA 4FF4A 3DEPA 1AWDA 4ULLA 3AEFB 5IGGA 4KGTA 1ZYRC 4EVOA 4IURA 2BS3B 3IAYA 1RKNA 4USAA 5J1ZA 2J4XA 3A56A 1H9SA 1S4ZA 4ZK9B 3MAQA 2J7ZA 1DCZA 1II3A 1TQOA 2KEEA 4ZYSA 3G6JB 4PMBA 1SMYC 1TZOA 1QWYA 2ON8A 4IUTA 2VXWA 2XN9C 4A3IB 1C4PA 4KGSA 1PTOH 4DU9A 4R3DA 4XWTA 3ZQ4A 2EXZA 3I73A 4R8IA 1A2UA 1ZXIA 2LY7A 2DY8A 3ZJUA 4EQPA 2LFNA 2O4XA 2F0VA 1EWYC 2RQXA 4WORA 2RDHA 3PO2B 1C79A 3U9SA 4R8NA 2XRQD 2DN8A 1TIID 3FKIB 5KGUA 3AEGB 3MEHA 2KA7A 2LEKA 1KDAA 2J0TD 1SNDA 3HEJA 3AM9A 2LFIA 4DAVA 2DNCA 5EKIA 2G9HD 1RM6C 1XX8A 1S5BD 2IT1A 4TQ0A 2KUMA 1LTSD 5CV6A 2AX5A 3V05A 4CKEA 2ZW0A 1LV9A 3GB1A 1AP0A 3AMZA 3P1MA 1H9JA 2F0MA 4YXDB 1DYQA 5CORA 2EY6A 2D2CC 1BMLC 3PZ8A 5C3XA 2WXJA 4C1NI 1FD7D 1H9MA 2NUCA 1YNNC 2NWGA 1TS5A 4O1NA 1F2RC 5BN5A 2A6EC 2PW7A 2JXTA 3NUHB 1GJXA 2QDBA 4RCNA 3RZDB 1HFGA 3R8BA 2F0WA 1F9RA 2G1EA 4ZRQA 5DEHA 1C78A 4NDXA 3Q23A 5JAVA 1FYCA 1ENCA 3E0JA 4IUNA 1HZ5A 2NMQA 2B2VC 3C1FA 2GI9A 4C80A 1LTAD 1VZ6A 3MZ5A 5M3MB 4KJNA 3BK1A 3RPFC 2WB1B 1C76A 5G5GA 3MTSA 1KF6B 4B0MA 3Q8BA 3A8JE 4NZLB 4TKOB 5EPKA 4GDLB 5E1FA 2JA6B 4OO1H 1O7ZA 1Y1WB 1PUTA 2MPMA 2VZKD 2C5CA 2LGIA 2O2LD 3HVZA 1BCPB 1EM7A 3NWSA 1OO9B 1GUNA 3PUZA 2J42A 3PZ7A 3HOZB 4EQNA 2WXPA 5HGTA 1SMYD 1YNJD 3I70A 1SDFA 1MPEA 4CJ1B 5M5YB 3A54A 1KH0A 2M19A 1DZ1A 4FF3A 1HTLD 3J80L 2JZPA 3C1EA 1S5FD 4BA2I 2BS2B 1ROEA 3N52A 3MHZA 4GZYC 5ELFA 4IFDH 1EY0A 2EYMA 4PT5A 1TKYA 4K6LA 1F2RI 3KBXA 1F77A 1XYIA 5MPOA 1RFKA 1O7YA 1NYRA 3BVZA 2K1BA 1RD9D 2Q8IB 3Q0AA 4KHVA 4OO1G 1TS2A 2AQ3B 4MT5A 3KLSX 3P4SB 4HSVA 1KNEA 5TSSA 4DNTB 2LMCB 1G6ZA 3SK6A 2CVRA 3KQ4A 2EY5A 1D1KA 3BYYB 4KKTA 2MEKA 3CHBD 2EYFA 2FUG1 4C1NK 1JQYD 4XDCA 1U4PA 1PRTF 1QOFA 5EE9A 4A3BB 3T56B 1ZP0B 1J7BA 4OHJA 1S5DD 1B44D 5C4JB 4BA1I 5DNFA 2BB6A 2K03A 2WDQB 1ENAA 3KBGA 3U9OA 3MXNA 3P4RB 3MFYA 2YU9B 1MHXA 3ONAB 2AQ2B 3Q6SA 1GB1A 3HS0C 3NUCA 1WTRA 2A6ED 1DONA 2PKOA 4ZRPA 5BYRA 2I46A 2DYMA 1E9MA 1P7EA 4TQUS 2WXGA 2ZXRA 4HEDA 5DM73 5C4HA 3FAHA 3P4QB 1VDZA 3GO5A 4L23A 4KY7A 3K5LA 2N9LA 3H09A 3VRAB 2PW5A 1HQRD 1EEFD 1DOYA 3FILA 1O80A 2QILA 1A3TA 1RDPD 1JC7A 1TKEA 1WGKA 5T8IA 3PUWA 2WIIB 1K53A 2KWDA 1DOIA 2NN6G 1YJIA 1X3PA 1V97A 5LL6S 1BF4A 5COYA 4V190 2AWNA 3T13A 2PIAA 2RSNA 3SR1A 4O42A 1JE4A 1NSNS 3URYA 3T53B 5C4ZA 1YJJA 2EYOA 5IGBA 3LWUA 2LKVA 4C3HB 2L83A 3VYRA 5D65A 2W3SA 3LYYA 1D6EC 3RLFA 1P7FA 1CI3M 2SDFA 1Q1EA 1PZKD 4OVZA 3K0YA 1EQTA 3ERQA 1JR0D 4M8AA 1F2YA 3AE1B 1E0ZA 3K5NA 2Q8TA 2BDOA 4A3KB 1SF0A 4KTAA 2B2WC 5EBDA 2JU6X 4F7XA 1BCPC 2BB5A 1FXIA 3D4WA 3DUZA 2F0PA 3BYTB 1SJED 1G2TA 2WDRB 2QKIC 4ZHPA 3EQLC 3J7AF 1STHA 1F9QA 2K9XA 1SYFA 3AH7A 4DGZA 2D5DA 3KK7A 5KRUA 3Q24A 4IFDI 5I2YA 3R2IA 5CYUA 2CQAA 1I4QA 3M4YA 2ID0A 2PQEA 2A68D 1JWAD 2QJLA 2C9OA 4MACA 4ABNA 5I9OA 4M0WA 4OW0A 1EZ8A 4R9WA 5JPMC 2I38A 1JCKB 1LTBD 2AUJD 5M5XB 1TYGB 2I2YA 2KDMA 5FOBB 5K5PA 3SXHA 1HA5A 2JSVX 3NBHA 2JE6I 3V3XA 1VZ7A 3C3LA 2JA8B 1NAPA 3I90A 5C6AA 3V96A 3X3MA 2KJXA 3N6RA 5HG2A 1OXUA 4DNRB 1W6JA 1T5XD 2WACA 1PFNA 1CK1A 1KRHA 4G7OC 2WXIA 3VR8B 2NVTB 4M1UB 1N61A 4ZLTF 4QIWB 3RFZB 4P2CB 4REZA 3A55A 2B8GA 3AECB 3TUOA 1YNND 1MI0A 2RSOA 2SNMA 2R61A 3OPOA 2BT6A 3GP7A 2B2TA 3ZJVA 3S16B 2EOTA 5CMDA 1SE2A 2EY1A 3GV3A 1T6BX 3TEZA 4NAWB 1FO4A 5KYLA 3QWNA 1PGAA 1ZKOA 1SIJA 3S9WA 2TMPA 5C0XI 1C9FA 3AE8B 2MP1A 1ZE3D 2HUGA 2YYZA 3EROA 4ARIA 5E3FA 3D6CA 5G5HA 3Q22A 1STAA 2HDMA 3HRDD 3FMCA 2HQEA 1I4XA 5JEAH 2BTEA 2PW9A 3HOUB 1WD0A 3J81E 1QCBD 2NTSA 3KUPA 1TT2A 4HMJA 3Q8FA 1F2MA 4PMCA 3CIRB 2HTME 4XT3B 1FCLA 3D3RA 2F0TA 5CV9A 4QB4A 3NPPA 2MH7A 2WXHA 3T3NA 1U4MA 1XWEA 1SSOA 4YSXB 2J52A 4L63B 3PMFA 1QNKA 4IQZA 1ML0D 2L11A 4H0LC 1FIQA 3NE5B 5FLXE 2IGHA 4DQOC 3UI2A 1PZID 4A3GB 2BE5C 4DK0A 1BQQT 1WCMB 3GTQB 2VB2X 2FBWB 4TSSA 4A3MB 2F0KA 4A9AA 3VR2A 3SR6A 3PIO3 3V2TA 3NP8A 1CA6A 3TP7A 3S15B 1NYQA 3NSWA 2R92B 1WWTA 4KHZA 3I4NB 4U68A 3VR3A 3QOLA 1KLGD 5C5LA 5I6YA 3OMGA 4A55A 1SJHD 4ITKA 2QSDA 1TWGB 1RWSA 3AEAB 1X3QA 1PDQA 3AE7B 3K59A 1PTOB 2DY7A 4UAIA 3I72A 3IFDA 2B63B 1L0YB 1Q12A 2KMMA 2F0HA 2F0QA 1L6UA 4C2MB 3S14B 3S1NB 3NXWA 5JVG3 1RTNA 4C7YA 1Y8OB 1CZWA 5C3WA 3Q8EA 2B2TC 2EELA 5JVH3 4CQNA 4XQNA 3AE6B 1GUTA 4P16A 2L32A 1FGBD 4N59A 3OWFA 3L4PA 4CKBA 1HUNA 4KX6B 2F03A 5BYSA 4RNAA 5HURA 2WDVB 3E9SA 3ZYYX 2IL8A 1HTPA 3K5MA 3EJIA 4CGYB 2JX5A 4B0EA 4FXKC 2BS4B 3J7YW 3VA5A 2WKDA 5BMIA 3MXGA 1WXQA 3GTKB 2A74C 3KWVA 1KAAA 3DWMA 4US8A 2HCCA 1IGCA 3TMEA 4BBRB 3FPPA 2H88B 1VZ8A 3QJYA 3D4DA 1QLBB 3A8KE 2QMTA 2KQ4X 3VYUA 2W3RA 1KLUD 4JPSA 1EWHA 3LNNA 4HTHA 5I6WA 4F88A 2L1AA 4XXEA 4NAMA 2J53A 2EYJA 4IOIE 1I3QB 2WLBA 2F0IA 3EFXD 3GTLB 2E2HB 4D2KA 1ZDXA 1C4AA 1I4RA 1H9SB 5I2XA 4A8XC 4QUFA 5EPLA 1LACA 3NVZA 1EU3A 1IKMA 1TWHB 2EVBA 1RYJA 4KKUA 2PMZB 2MJDA 1WTPA 1SBBB 4EQOA 4RGTA 1FM0D 3TEWA 4KK7A 4BBSB 3K58A 3OHXC 4C3JB 2K3UA 2IX0A 2EZVA 4AYBB 2BBCA 1XLPA 1MD2D 1V1PA 2E2JB 1KABA 3GV6A 4KKJA 1STBA 2F3WA 2CU3A 3W9CB 2XNAC 3VR4A 1GPXA 3VA7A 5HFYA 1A3UA 1DJRD 5M5WB 1TY0A 3RZOB 2E74C 3H94A 5ELBA 1SYGA 3LX0A 1D5ZC 1GOZA 3P7JA 1E10A 1RODA 4J6HA 4B9WA 4N6EB 1LT4D 2NYZD 3S1RB 5IGEA 4JBWA 2JA7B 4JWUC 3HKZB 1LT3D 5NUCA 2INNE 1EIHA 3U2SC 2JA5B 5D3IB 4A3JB 3AE4B 1C48A 4YSZB 1ZXTA 4RHRA 2NN6H 3OIPA 3MA2B 3M7NA 3PO0A 3L7ZC 2B2VA 2WXQA 1BUVT 4NMZA 2H89B 2AUKA 4FXCA 1ILPA 5AUKA 1EL0A 3PUXA 4EE2A 3BWUD 2KQ3A 2BA0A 1RHPA 4DAPA 1LT6D 4WJWA 4X3KA 1WSPA 1GUWA 1BNZA 4LTUA 2PPBC 4X3SA 4RFBA 3HOYB 1QOAA 2Q5WD 2JSOA 3WOFA 3W5VB 1A3VA 5JEAG 4FO2A 4G7ZC 4WH4A 4BY1B 3SEBA 3SK8A 5EKLA 2HDLA 1OQRA 3FVQA 2BCOA 2V3PA 1TWAB 4CBVA 2F0OA 4OL7A 2B39A 1FFVA 2OEOA 4ODGA 1HHVA 5FKAC 1FD6A 1U9RA 3I4LA 4KY6A 2NTTA 3SHLA 5D3DA 4AQ7A 3GS2A 2KHSA 2A6HC 3BDLA 4DA2A 1STYA 1EY8A 1DXMA 1B1ZA 5ELCA 4QCLA 3PO3B 2PVOD 3KLSA 4KD3A 1D5XC 5T1IA 3K6OA 2R93B 3TN2A 1CHQD 1A2TA 2K0PA 1Y8NB 1Q3LA 1JOKA 3I4MB 2X38A 1K51A 1B9NA 1WVLA 2MJ8A 1MVKA 4NP5A 1ZEQX 1IBXB 1I7HA 1AYFA 1ZUD2 1BO0A 1B4OA 3Q69A 1B9MA 1LLRD 1ILQA 1GHJA 5J39A 1WTOA 1IW7D 1PGXA