3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
b'HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like Protein
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
1ET9A 4RGOS 1CQVA 1HTLD 1SE3A 1TY0A 2CHBD 4RCOA 1F77A 1S5ED 1TS4A 1MD2D 3BVMA 1EEFD 1FNWA 1PTOB 1PTOF 2AQ3B 1JCKB 1I4XA 3R8BA 2QEJC 1SBBB 4NZLB 1CT1D 1SE2A 1PZID 5I4DA 1JR0D 1AW7A 5ELCA 1ENFA 3BZDB 1TS2A 3W2DA 1SE4A 1EWCA 1FNVA 1D6EC 3DWAA 2RDGA 5ELEA 1CHPD 3DWQA 2IPKD 1DJRD 1DYQA 1SXTA 5ELBA 1D5XC 5FKAC 4RGNA 4RFBA 1SEBD 3BYYB 1I4HA 2TSSA 4RH6A 1UUPA 1V1PA 3BYTB 4RGTA 1S5BD 1RF2D 4ZYSA 2R61A 4L6TB 1XTCD 3R2TA 2NTSA 2XRSD 1LO5D 4RHRA 1LT6D 1S5DD 1JWSD 1PYWD 1S5FD 3URYA 3BVGA 1STEA 2G9HD 1B44D 1BCPD 1HA5A 1LLRD 1LT4D 1YN4A 2AQ2B 1M4VA 2SEBD 4OHJA 1ET6A 4BWGB 1I4RA 1ESFA 2O2LD 1UNSA 3R2IA 1BXTA 1BCPC 3GP7A 3BVZA 1LTBD 1PTOH 3MC0B 2J4XA 1TS5A 3KLSX 5D3DA 1LTTD 1FNUA 1HQRD 1S5CD 1JQYD 2XRQD 3DWPA 1XXGA 1QILA 1CHQD 1LT5D 1D5MC 1SJED 1KLUD 4TSSA 1I4QA 3SEBA 1PRTC 1TS3A 3OWEB 4RGMA 1EFID 4Z9CB 4UDUC 1HXYD 2RDHA 1LTRD 4L63B 1B1ZA 1RCVD 1CK1A 4DXGA 3O13A 1RD9D 1YN5A 1I4PA 1BCPB 1EU3A 1BCPF 1KLGD 1G8ZD 1L0YB 1AN8A 1EU4A 3EA6A 5FK9C 3CHBD 4C56C 5TSSA 2AQ1B 5D3IB 1LTID 1V1PB 1LTGD 4K6LA 1PTOD 1RDPD 1T5XD 1TY2A 2ICIA 1FD7D 1LTAD 1PRTD 2QILA 3V05A 1L0XB 1PRTB 1PRTF 1GOZA 2NTTA 4O1NA 3MFGA 1V1OA 1SJHD 1PTOC 1KTKA 2XNAC 1I4GA 4DXFA 1LT3D 2XN9C 1JWUD 5ELDA 1D5ZC 1FGBD 1EEID 4RHSA 2IJ0A 2Z8LA 5ELFA 2WV6D 1PZKD 3EFXD 1PZJD 1LTSD 1YN3A 3TSSA 1JWMD
chains in the Genus database with same CATH superfamily
1Q8KA 2CQAA 3QWNA 3VAWA 3HEJA 2JY6A 4FXCA 3DBHB 4A3FB 2AUKA 3B08A 4JI1Q 3RT3B 2IL8A 3OTOL 4LNFA 1NTGA 1PFNA 2B63G 1JOQA 2MP2A 4NJ7A 1MPEA 4QUCA 1V9PA 4DR1Q 1R7SA 1STBA 1CM9A 1EQVA 4QL5A 1WTPA 2E5LL 2K1BA 4A90A 4RM8A 2F0DA 2AL3A 3L9AX 1J7BA 1VQ4A 3GZNI 3DBLI 3KUDB 1R4PB 1STNA 2N9LA 2L0FA 4BOZB 5DAUA 2FBWB 4DK5A 4TMAB 5F2DA 1E7ZA 2N4FA 2MJEA 4YHHL 1H9SA 2JQOA 5KYLA 2L76A 3DQVA 3C1EA 1T6BX 1HTOA 4EZKA 3RLOA 1KH0A 3GS2A 3BYYB 5I2YA 4HIDA 4HWIB 2NN6H 2Q2HA 4A3FG 4W9LA 2A73B 1N34Q 3AE6B 4ZRKA 1EF1A 3AE8B 1KQSA 2R61A 3C3LA 2XRSD 4NJ6A 2F3VA 3URYA 3P4PB 4DHZB 1TWCB 3WIMA 1IP9A 1KFYB 2G9HD 1YHQA 2OTLA 1FCLA 2JZZA 1PH5A 4KY6A 2L4NA 1M4VA 1O78A 3DCGA 4IWPA 1QOGA 2HUGA 1JOOA 2K04A 3K59A 1FM0D 1YD8U 2BPSA 2NVYB 3H94A 1I4RA 1ESFA 1VQJA 3FPUB 4N8FA 4GNXC 2INNE 3AEDB 3VVWB 3VXWA 1QCBD 4Y52H 4GLVB 2XTIA 2EJGC 2WU5B 1SE8A 5J2RA 1IGDA 4CJ0B 2VUMH 1NENB 4BY1H 1HUNA 1KRHA 2A69C 1WYDA 5G55A 1S1QB 4NMZA 1OQYA 2K5NA 1N60A 4LDTB 1TZ1A 5JAVA 1ISNA 1LQBA 4B95A 1O80A 2KVZA 1XQQA 3EECA 5DCNA 1V80A 4ACFA 1PRTC 3CMAA 2RPQA 2BB5A 4LUZA 1EFID 1WGRA 1F2YA 2E3TA 3PO0A 1FJGQ 4DV6L 4PS7A 1AEXA 1UGMA 4EQ5A 4ZRPA 2LGYA 4DR5L 3JAML 2F0GA 4KN4C 1RLFA 3I56A 1KLGD 2FMCA 4BBSH 3N9YC 4AS1A 3CAMA 1SNDA 4K5VA 4JI1L 4DV4Q 2CHXA 1GUNA 4GSWA 4EQOA 4JBMA 3MFYA 4CDEC 3RFZB 4XWWA 2ZCCA 4GN4B 4N6EB 3AV8A 4TRDA 1JROA 4GS3A 4JI0L 1R4NI 1SF0A 2R93H 1ZGUB 4ASWC 3PF4A 4JOIA 2PYKA 1LTAD 4KKTA 1ILQA 3ZNID 3BU2A 4LLGM 1BUIC 3PV0A 3M4QA 3S14B 1WGKA 2PI2E 1JWBD 1L6VA 1WR6E 3TMEA 1ML0D 3W5UB 3J80E 4P6VF 4I65A 1QG7A 1VQKA 3CW2C 1XD3B 2IJ0A 5D94A 2K01A 3FEWX 1PH9A 2K5VA 1XT9B 2J0JA 3NZUA 4GN3B 2F0UA 2EE1A 2W82A 1VQAA 1TY0A 5DM63 2MSED 2ZEQA 3K58A 1VQ6A 1RTNA 1KABA 4FDBA 5KHOA 1F0ZA 3A5UA 3PO3G 1P98A 4P7IA 4PMBA 2A4ZA 2RR9A 4J6IA 3OLMD 2V1CC 3HP3A 4LF5Q 4WJWA 4KIKB 4BBRH 3AE4B 4AQYQ 2VZKB 3PHXB 3PIOA 1IYJB 3SD5A 2J0MA 3K9PB 2WDQB 4MSMB 3R3OA 4DV2L 3ULPA 4A9AA 2MP1A 5LL6X 2HD3A 2MQJA 3NS8A 3K7AH 2MJ3A 5CMDA 1P3QU 2INCC 1D5XC 2XWJB 4RMFA 4B3MQ 1E7UA 4YSXB 5BMIA 4RFBA 3J80i 1JRUA 3V61A 2MX2A 1F2LA 4DKAC 1WJ6A 1CZPA 3M4YA 3H0GB 5IGDA 3ALBA 2QCZA 2NN6I 2BB6A 2BS4B 3K80C 2PKOA 3TS0A 4A20A 4NQLB 1SRUA 1B44D 1HA5A 4ZYNA 1VQMA 5E4WC 1QVCA 1KRSA 4OHJA 2I1KA 4E74A 5I6WA 1WWTA 1Q3LA 2JT4B 3ZLZA 3GQBA 1J5EL 4X66L 2EYPA 4FF4A 3T56B 1SYBA 3QAQA 2MCNB 2B2UC 1ASZA 3GTOH 3G4SA 4GNXA 2LI5A 3IKJA 3X3NA 3NENA 1C4PA 4W9GA 4KJOA 3NBHB 1MHXA 1ENCA 3FAHA 2ZJDA 4A3GH 4R8NA 1TJEA 4JGHB 5IGBA 1NYQA 4N9PA 4QY7A 2LXKA 5DPRA 4ZRIA 4HIKA 2DN8A 4QAYA 2R7ZB 2N78A 2HIXA 1CK1A 3PMFA 3SFEB 2SNSA 2RBMA 1I4PA 3Q14C 4OIKA 2G5DA 4YCWA 2K7VA 4JI7L 1WX7A 3GTKB 1AN8A 1MSGA 3PV1A 1CZGA 5LXIB 2EYMA 3CHBD 2A6ED 5TSSA 3CF5A 1G91A 3Q3JA 2G4SA 1O7ZA 4HAEA 3RNBC 2JA6B 3I4NH 1AWDA 1CJEA 4KD3A 1VQDA 5K5PA 3STBC 5D2MB 4A8XC 1PRTF 4IPCA 4IOAA 2L3ZA 1RM6C 2QW7A 3MFGA 1NR2A 3QR8A 3PUXA 2UU9L 3O65B 3DOWA 3SK6A 3MXPA 2KN4A 2KZRA 1VLBA 4OONA 2A5UA 4V190 3CWIA 2EYOA 1JOKA 2K75A 4LJZC 2KT7A 4J1MA 4DBGA 2PZTA 2JU6X 4KGTA 1YNXA 4MH8A 3NTKA 2R7ZG 1FRRA 4TQ0A 4EVOA 1STAA 2KOLA 1YJJA 1QWYA 4LTUA 1IBXB 1Z2MA 1O7IA 2JZ3B 1HFNA 2LKVA 1FO4A 2CQOA 4YCVA 4IOIE 1UEAB 3I4MH 1DOIA 4A3IH 1Q1OA 3RNUA 1EEFD 2KECA 1PFDA 2DNCA 2JA6G 1VF5C 4M8AA 2N9XA 2MFIA 3RYTA 3ER0A 1EQTA 1N36L 1HNXQ 1SE2A 4CO7A 4DPGA 1JRPA 1WGGA 3OJ3A 4MGIE 4B08A 2F0WA 2IDYA 1SLJA 3ND8A 5ELNA 4HEA1 1V8CA 2DNFA 1ENFA 2L05A 1LXDA 3PRPB 1OXVA 3QARA 3T8MA 3VR8B 1MFWA 4ARCA 3T13A 1WD0A 2UXBQ 3HIZA 4UY8C 2KTRA 2FUG1 5HHDG 1KJTA 3BDCA 5ISRA 2JEAI 1DJRD 1HCZA 1Q1BA 4ITKA 3R66C 3J81j 1I94Q 1IBKL 1WZ0A 2PW9A 1J8CA 3K81C 2NVTH 1E2WA 3CU7A 3MZ5A 4DV7Q 1B70B 1TT5B 1HZ5A 3BYTB 1WM2A 3R2TA 4JWSC 2NTSA 5BYRA 3V6EB 3ZW3A 1QUQA 4OIJA 1IKLA 1B3AA 4HPPA 1JE4A 1H9SB 3ZDTA 2L0TA 5IGCA 1JJGA 5C4XB 5EKKA 1P8LA 5J1ZA 4LNKA 3S1MH 2PIAA 5IWAL 2CR5A 2QJLA 1UE5A 5CTRC 3U52E 1HJPA 1VQNA 3I5JC 2B2TC 1BUVT 4XYQA 2O2VA 4DUYL 2KCCA 1HH2P 2F4VQ 3RMHA 2A69D 3S1NH 2MHJA 2B3AA 1BXTA 2K14A 3GP7A 2L5TA 1PGAA 2AWOA 1ZXIA 4M01A 5IP9H 5AUIA 2J4XA 3L13A 1C78A 2B2UA 5D3DA 2BKFA 3AE1B 3EVQA 3P4RB 3FPPA 1E0ZA 4R4TA 2AYOB 2ZM6Q 1CHQD 3RR5A 5I2XA 1D5MC 4GKKL 3PIP3 3HOUB 2KHSA 4LUOA 4TQ1A 2RDBC 3DMUA 4PK1A 4K5XA 2KC2A 5G5HA 2IX0A 4JG2A 5KNBA 1AZPA 3GTPB 1SR3A 1NSNS 3OMGA 4RM9A 4ID6A 1LGRA 1G8ZD 3NXWA 2GBKA 4C7ZA 4JBWA 3LNNA 1BO0A 1ESRA 1WI5A 4D2KA 3QIJA 4EOYA 1E24A 2JJQA 3T1YQ 1XLNA 1MG8A 4DUZQ 1MVKA 1Z5SB 2D3CA 4DR3L 5EJWA 2HT1A 3A9JA 4PMWA 2L11A 4GDKA 3VUXA 3BS1A 3ZIMA 4LF6Q 4DK6C 1KDBA 2JYTA 4MN3A 2CCZA 2UUAL 3SU8X 2TMPA 3R3MA 2YTXA 4K2KA 3HOYG 1GOZA 1ZKHA 4PYUA 3VR4A 3S16H 2B8GA 1FRDA 1S40A 2KFJA 4NXML 3Q6SA 3HOUG 2ZVOA 2C9OA 3J81E 3RZOB 1HNZL 1XF5L 2CWPA 2FCMA 5I6YA 1E1OA 3HFZB 1W3SA 4OELB 4TKOB 1I6HB 4CKEA 1WGHA 2J0TD 3TBLD 4FXKC 2WV6D 2VH2A 1GPXA 1PYBA 3EFXD 3IFTA 4FF2A 1L5PA 2CJNA 1IL2A 4WH4A 5IT9E 4HROA 5JVH3 3GTGH 1VQ5A 3F2DA 5K36H 1C4QA 1IL8A 4ILWA 3ZNZB 1HTQA 4XQQA 4JI5L 2BBCA 1SYEA 1TS4A 2CU1A 1GUGA 1EZ8A 3NHHA 3Q8EA 2IO3B 1HQMC 3CQZH 1T0YA 2PEAA 3N1YC 2QDLA 3WAOA 3ZUNA 3LDZE 2M17A 4FJYA 2I5MX 5IGGA 3K5MA 3GTLB 4OO1G 5CC4A 3FKYA 3KOJA 4BY7H 5GXGB 4WAAA 4DQOC 2CH4W 4PT5A 5JVG3 2A74C 2O6VA 2KA7A 2BYVE 3EIVA 3M9BA 1VQFA 3KUZA 3M63B 5HFYA 3MWYW 1B8AA 3MC9A 4KVGB 3CC7A 1CHPD 4EQPA 3A4RA 1ZDVA 4I6LB 3M4OB 1WH3A 2M00A 3J81i 4L8JA 4BBNC 2AEHA 2KCMA 2BCOA 3GD7A 3DWGC 2YV5A 3C0RB 1GVPA 1XWEA 2KX0A 2NZHA 3FMCA 1TWFB 3K57A 5KIXA 4YY3Q 1BOSA 3Q6BA 1Z7TA 1LT6D 4CBVA 2WWZA 3S2AA 1KAWA 1UEBA 1V43A 3L0OA 4OVUA 4X65Q 4DDID 5E4XA 1GG3A 2Z4HA 4IUNA 1LLRD 1OO9B 2E75C 2AQ2B 4HR7B 4KN7C 4C3JH 1OTCA 2R92G 1PQSA 3AMZA 4A93B 3I70A 4IN3A 2EQSA 1PDXA 3B2FA 5M3FB 3QO2A 3GE3C 2IY0B 2B2TA 3GOEA 4MHEA 1EQQA 1V81A 1E6EB 3VTWA 5J22A 2CU3A 2G45B 4GKJL 2NB0A 4XYOA 2Z59B 1LTTD 2B29A 3ND9A 2CW0C 5LMNQ 1BMLC 1SNPA 3MC8A 1OXSC 3PRZA 2JWUA 3P42A 1TS3A 1EY7A 2HIVA 4JC0A 4P73A 5M3MH 1ACCA 2DY8A 4FO2A 4UDUC 5LL6S 4FNFA 4GNXB 3VR2A 4XDDA 1BKBA 4A3CH 4JI8L 2IGHA 5FLMG 3STBD 4GDLA 3HZXA 1M8AA 1NE3A 5KHQA 1I6VC 2F0EA 2IWHA 1Y69U 2VNUD 2WKCA 1HPCA 4A93G 1ZXHA 1NI3A 1H9JA 2BYEA 2D11A 2DYBA 1VDVA 3GB1A 3RI7C 1VF7A 3E9HA 3QOLA 2WAQE 2WKDA 2DBYA 4DHJD 1TWHH 1WR1A 4RKBA 4NY0A 1PRTB 4WFN3 5CBEE 2NTTA 4C2MH 5C3WA 3B9JA 5J18A 3HOXH 1Y1WG 1B53A 1SJHD 5FLXL 1O7LA 2JXMB 3K6OA 3I55A 1WMHA 4JV5Q 2FMMA 1J7CA 1HE8A 1P1AA 3PO2B 2WXHA 3BG3A 2LGDA 1YITA 1NAPA 1MBYA 3VRBB 3K9OB 2LXJA 1FIQA 2IZVB 5ELFA 2WXQA 4UP9A 3DBRB 3KDFA 4ULLA 4JI2Q 3J7ZC 1FNUA 1XTDA 4A3MB 1N33L 2KAJA 2KKCA 3HOVB 2VZAA 5D14A 1EM7A 4J8QA 4TVAB 2EDGA 5KYIA 2Q5WD 2Z0EB 3TN2A 2UUBL 5KNDA 2LGXA 2X8XX 2IW3A 2O6VD 1XEEA 3PZDA 4E3CA 2HQEA 5FOBB 5JH5C 2KDMA 3PCOB 3MHZA 3DVGY 1SBBB 2CWAA 3D3RA 1K83B 2NBVB 2VY3A 2PJHA 3Q8AA 3FKIB 2WACA 2E2HB 3K8AA 2DWQA 4ODGA 1UGJA 1MHHE 2LWPA 1HA6A 4HKZE 3KUPA 4KD4A 1IUEA 1K8RB 4KSLC 3PO2G 4WJOA 2B63H 4LJPB 5T8IA 4L5SA 1X55A 4N9F4 3U4EG 2VB2X 3DBSA 4N59A 5C23A 3U9SA 4IFDG 1L4ZB 2HQLA 2E2IH 4A3MG 1FGUA 4PQXA 3HOVG 1FCCC 5LMNL 2KXJA 2WAQB 4A3KB 4QUFA 4YTNB 2GLSA 2Y3AA 5EBCA 1K9MC 3PZ8A 2NPTA 5IYCG 1GNUA 3ULLA 4KSKC 1XTCD 2KTRB 4MT5A 1W2BA 1VD2A 1KL9A 2PVOD 3ZKJC 3G7LA 4IW0A 1PYWD 1S5FD 2C60A 5IYDG 1STEA 2ZXOA 2DLBA 2WDTB 3P1HA 2L52A 2ZZPB 1R9TB 3FKIG 2SEBD 5CR3A 4BWGB 1NVID 4KKIA 1KOTA 1W6KA 2PPHA 3ZNHB 1IW7C 4A3FH 1SNCA 3B1LX 3HHMA 4MIUA 2FCQA 4BBNF 3R2IA 3BVZA 2AL6A 4I6PA 2KEEA 2N9KA 1TS5A 1MSHA 1QUQB 1SYGA 4TV3A 2D5DA 2L00B 1YJWA 4BA2I 1NBFC 1HRJA 4W9CA 1PA6A 4F8MA 1HZ9A 2KX3A 1W6JA 3Q3FA 3CCEA 1C79A 4UAIA 3OTOQ 4BFRA 2WAQG 3H8HA 2O2VB 3UIOB 1KDAA 4Z9CB 3VTUA 1R4QB 1HXYD 4DXGA 4GLXA 2DAJA 4OX9L 2DYMA 5BR8L 4PS8A 4WJQA 2E5LQ 1JW9D 3EA6A 5GMVA 1KDCA 1AE2A 3S17B 3VRAB 3F2BA 1F9QA 1TWAH 3SK4A 2M9VA 3PUVA 4FLHA 4J3OD 1LTGD 1G6PA 2J52A 1OQQA 1WJUA 1O7YA 2H5XA 4J15A 4WAFA 3J7A5 2QILA 4YSYB 4YHHQ 3U8ZA 3VDZA 1GXDC 4C7YA 3CMEA 3T3OA 5NUCA 4DGZA 5FJ8G 3IVFA 1TWCH 1GUTA 1XLQA 3CIRB 2QDBA 4L23A 4P1BC 2A8VA 3WANA 1PFSA 3VYTA 3RUZA 1ZYRC 1V97A 3A4SC 4MSQB 4AOFA 4DFAA 5C4JB 3A9JB 2PQAA 4GDKB 3KK7A 3CCUA 4BKSA 4LF9L 1KRTA 1JT8A 3DWMA 2JRHA 2D07B 4IM2A 4IUTA 3TREA 2K25A 4W9FA 1LTSD 1QE6A 5A2QL 4DAYA 4LNQA 4OZCA 3HM3A 1C7YA 2CHBD 2JXXA 3UE1A 4KI0A 4RCOA 4ZQ3A 1WTXA 3GTMH 3KJPA 1N62A 2BWES 4W9IA 1FNWA 3AXCA 3IG3A 1TBEA 3BZCA 4DHJB 4WQOB 4W9HA 1QNKA 2QF7A 3OMCA 4PMCA 1GUAB 4HN7A 4R9WA 4LF7L 3QB3A 2QCPX 4C1NK 2JF5A 2VQFL 3L0WB 2H88B 1VQLA 4IALA 5D65A 1AW7A 1EYAA 1STYA 2LVPA 3GTQB 2JA5B 1L7YA 4X3SA 2DGYA 2CFMA 2EMTA 1A0IA 1EWCA 1K3RA 4XT3B 5DPWA 2F1MA 3DWAA 4FVMA 5GQOA 4DV6Q 3PO3H 1LUZA 4I7AA 2KMMA 3T53B 4DR5Q 3P4QB 5L83A 1DOKA 4X3TA 2LXCA 2JQRB 2RKSA 5JEAG 2KJHB 3ZNGC 4DR2L 2V3SA 2BYTA 1SFOB 2HJ1A 1R4MI 5FO8B 1F2MA 4NJCA 4Y7NB 2DX5B 2C5LC 4RH6A 3UDXA 2O6VB 2PE9A 4R8IA 4JI0Q 4BOSC 2H89B 3CSFA 1P7FA 5DPSA 4ZYSA 3RN5A 4YWKA 3HM6X 3RNGC 4RHRA 2NVQH 2KDEB 1JMLA 4CDDC 2F3IA 4YWGG 2NWGA 1GB4A 1F9SA 4XZ4A 3D4WA 1TKEA 3OYYA 1MIUA 3NK9A 1EUVB 5JJLA 5M5YB 2KWUB 4KDLB 4MTNA 3AECB 3ZDMC 4JI3L 2R3ZA 3KLWA 2Y0SE 3T16A 2WFWA 2JSOA 2JA5G 2RA4A 2WXIA 4ZLTF 1WJJA 2I2YA 2CW0D 2EPBA 4JCVE 3WWVA 2HTHA 3DBHI 4Q0FA 5HGTA 3W1GA 5IE8A 1HQRD 3R7QA 1E0BA 5HURA 4P16A 3TL5A 3AEAB 4GZYC 1KLVA 1A6XA 3PZ7A 2ZVNA 3U7ZA 2SNMA 2LVQA 2B2VC 1RWSA 4M02A 4DK3C 3R93A 4MELA 3SFDB 4R1JA 1BVSA 2QA4A 4L5QA 4DAVA 2HCIA 3JAME 4HIMA 2JA8H 2IYDB 2I07B 3NY5A 2K33A 3D8GA 4L63B 1X54A 2OHFA 5EDSA 2RF4A 2E76C 1EU3A 1NMFA 3VUYA 2ASBA 3EUB2 4GXBA 1HNWL 1L0YB 3DUZA 3A1QA 3SHQA 4C56C 5IOCA 1FVIA 1OXUA 1NNXA 1PFMA 2PMVA 3NE5B 2YYZA 3QC8B 4X6AH 2OJRA 1B2TA 2KWDA 3DHIC 1TY2A 4DV2Q 3ICEA 4G11A 2ICIA 3K5OA 2GBJA 4DV0Q 4IOCA 1C4CA 2L55A 3TUOA 5DM73 1XMQL 1F1HA 1K8GA 1U4AA 2X38A 1YHBA 4RA8A 1VQ7A 4GDLB 5A35A 2KEDA 1QVGA 4QQBX 3KQ4A 1GO3E 4R3DA 2BS3B 4NAWA 4ABNA 1FGBD 4G7OC 4B0EA 1CTMA 4A76A 3HOWB 3APFA 2Z8LA 4XT1B 2ENBA 2F0KA 1RL2A 1TKWB 4IDIA 2YU9B 3WOEA 4DV1L 1XLOA 1CA6A 4PNYA 2Y0SB 3Q22A 1R4NB 2K8CA 2RMMA 1L0VB 5D7GA 2N7DA 1UF0A 1WMHB 1VQBA 1KM7A 4WORA 1Y8NB 1I42A 3JAMi 1J5EQ 2N49A 3NSWA 1H9KA 4X66Q 3H15A 1GAQB 1FXIA 4IUMB 1LYLA 3OW2A 1V5TA 1I4XA 2RSNA 3PGEA 2R7ZH 2LEKA 3UF8A 2DNEA 1PLFA 4IKGA 3UGBB 2FXQA 4A3LG 1X3EA 2ZXPA 4LFBL 4WURA 3ZGZA 3MAQA 4NXNQ 1AE3A 1ASYA 3SE0A 3S1RH 3GTKH 1E9MA 2YEPF 4CJ1B 4LFAL 1UBQA 3KBGA 1C9FA 3NPPA 3PT2B 3K7UC 4KV2A 5C6AA 2JA6H 2Q2TA 1RTOA 4O42A 4P72A 4X62L 1TT2A 2A6HC 2D2CC 3HOWG 2HE7A 4H13C 2G3QB 2KDIA 4W9DA 3VHTC 4AP4C 4DWFA 3B6YA 3S15B 2WHIA 2FCSA 4JI7Q 3V3XA 3F1ZA 1XO3A 3M3YB 2LSSA 2Y0SG 3Q3OC 3AEVA 1WRIA 3ZVVA 1D1IA 1CKMA 1FL0A 3H3VH 4KHPL 5CHFA 5KEEA 1A63A 2KJXA 3NTHA 2NCNA 4A3OA 1IW7D 1NDDA 3J7AF 5E6PA 2RDFA 4IURA 3NTIA 3A7LA 1EYGA 3SHLA 2UU9Q 2K22A 1CSPA 2ZW1A 4ICVA 2C9WB 2F0FA 2KHWB 3Q8BA 4KDIC 1B9NA 5ELOA 2Y5CA 3EFUA 2VXWA 1BT0A 1WVLA 1U4MA 3S2HB 4JLCA 4BXXG 4DV0L 1YIWA 2NPTB 1VZ8A 1WX9A 2NR2A 3M62B 1YI2A 3A33B 3NVWA 1S5CD 3MHSD 1SSNA 5IODA 1Y8OB 4IC7B 2XK5A 5HI1A 4ZUIA 5CHVC 1UE1A 1PVOA 3KYCD 1EIFA 2LD9A 3NVVA 4F88A 3P7JA 3AQQA 3I7FA 4MTKA 1X9NA 3VTVA 4DXAB 1AYFA 4FADA 1WZ3A 2N9PC 4IUPA 3PGZA 2B2VA 1WYWB 5KNCA 2IO1B 2L9HA 1RCVD 2RHQB 1N36Q 3AN1A 4IWOA 1MJCA 2KVMA 4KGRA 2OCEA 4CYEA 4QIWE 3H7PA 1WF9A 4DR7L 2GA4B 4S3SA 4BS9A 2ZW0A 4XC2A 4HCSA 3Q0AA 5FO9B 3Q23A 5D3IB 4ZHPA 3ZRFA 5EGTA 1I3QH 3ULJA 3FRPB 4H44C 3ZYYX 2ATWA 2H4OA 4K81A 5T1IA 2A1AA 1VMCA 1YJNA 5M5XB 2KHIA 3NJTA 3VUWA 1F9PA 4N58A 4NXNL 3LGJA 4BY1B 2IY5B 4P74A 1IBKQ 3N32A 1L0WA 2E6XA 1Q10A 2DJGC 4CDFC 2JPHA 1I4GA 4X57B 1OTRB 3TP6A 1FPYA 1JALA 2GBNA 2HTME 3GE8C 1WXVA 2ZT9C 1DGJA 3H0GG 1H95A 3RZDB 4FHJA 3QJYA 4ZUJA 2WP9B 3TZUA 1OXTA 2K52A 4U68A 3OJ4B 1IHZA 2I0QA 3HOYH 3MA2B 4PZ7A 1HEZE 4BBSB 3DEOA 4HIOA 4HMIA 2FIDA 3KUCB 3TEYA 5IWAQ 1HUMA 1I50B 1VQ8A 4G50A 3HOUH 3D6CA 4TUUA 2Z6BA 3HKSA 1F77A 2F03A 4DUYQ 1HZBA 1V8QA 1IBLL 3CP0A 5EPLA 2IO2B 5AEKB 1J9OA 2GI9A 4AUQC 2LXAA 2AQ3B 2NS5A 1JCKB 4PZ6A 2UXDL 2PQAB 4JBKA 3TP5A 2LHDA 1BQQT 2VW9A 2OJWA 3TBIB 3GTPH 2N1WA 2XIWA 4QF4A 2IX3A 3I3TB 4GKKQ 3HS0C 4DAYB 2ALYB 1EO6A 4OVZA 1SNQA 3FC4A 1DM0B 3NS1A 4ZDVA 1F2ZA 5COYA 1Q0WB 1YQBA 1YJIA 1FNVA 2KMCA 3QG1A 4KV6A 1WTVA 2ES2A 1WGDA 1XLPA 4FF3A 3K5LA 1IXRA 3N1XC 4QIWB 2BVCA 4OO1H 2INDC 2F0QA 1GUSA 3QIAA 4LUVA 3OOCA 1E8YA 1F9RA 1TKYA 2DENB 1RAXA 4HCPB 4BBSG 4C3HB 5IP7G 4IFDJ 1WM3A 1B50A 4DR3Q 2KFKA 3PTFC 4A3BB 2LMCA 1YX6B 1UUPA 4TKNA 4YTPB 2WS3B 5C3EB 2F0NA 4L6TB 2UUAQ 2E2JB 2MBQA 1I6HH 5GAGC 2KVRA 5JJKA 3H3VI 2SAKA 2EKEC 4XX5A 2UXCQ 2Z6KA 3AFQA 4C3IB 1Y14B 4CDCC 4DAPA 4NXMQ 4IG7B 4XE0A 4GU2A 1HNZQ 1XCTL 1E22A 1J6QA 4EZLA 3I2ZA 2MP2B 5AJ3L 3VA5A 3DHQA 2IGGA 2Q2UA 1UAPA 3K7AB 4B3SL 3NBIA 4OWXB 1JORA 2BW2A 2KO3A 3AEFB 3GTLH 4M00A 2SDFA 3D31A 2LZ6A 2K39A 5EAYA 2OQKA 4RF0A 5C5LA 4BKGA 2EY5A 2R92H 1YQ4B 4OEMB 4JI5Q 4FJZA 4POFA 1YVCA 4J6HA 4C3HG 1WI0A 5D6JB 4H02A 4A3BG 1UELA 2M1MA 2DUDA 3H91A 1D7QA 3VYSA 3V62A 5C3EG 4G7HC 3CKIB 2EZVA 2MWSB 1S4ZA 4LWCA 3VA7A 4NPSA 5C0XG 4UHVA 3J81c 2BH2A 1UWVA 1F2RI 3MTNB 4WWNA 5JHBA 3KVFB 3D4DA 3M4OH 3QX1A 3NVZA 1XNRL 3OWFA 1NY4A 4C3IG 2EMSA 1WE7A 2O5JC 2WX0A 3AH7A 4F8CB 2OF1A 5IT9c 3GTOB 2RHSB 3J7YW 2CKHB 1PRTD 2WP8J 1TWFH 1Z9FA 2KQ4X 4H7BA 5C1ZA 4LFCL 1SDFA 1M1KC 5I9PA 5EKLA 5FLMH 1FFVA 5M5WH 2RCFA 2ZTDA 4JI6L 1PTOC 1HR0L 4A3GB 3A1QB 2CHZA 1C48A 3RUIB 3ECIA 3I3CA 3AE5B 3VR6A 4A93H 2GN5A 2OEDA 1Y8RC 1KF6B 4BAXA 4RAUC 2B8FA 2GVAA 4S17A 2EVBA 3LWEA 1JWMD 4US9A 3EN2A 2WXKA 4JL9A 5CV8A 5C4XG 1Y1WH 1PH7A 1SMXA 5H92C 5M9OA 5IYBG 3PREA 4B0MA 2LASA 3X3MA 1T0QC 2C7MB 1GD7A 4CHKA 3ML9A 1N9WA 3D4RA 1EUJA 4NAWB 5CV5A 3S1QH 1TR5A 4KHZA 1WE6A 2QC8A 4GKJQ 1KNEA 3R8BA 3F8TA 2UUCL 2NBWB 2N55A 2XVSA 2CJOA 2UXCL 3BJUA 4XQJA 3TEXA 2F0TA 3I72A 1QOFA 1GHJA 1K53A 2YEPB 2G1EA 2CHWA 3IAS1 2BQQA 3BZDB 3W2DA 4GOCA 3PIPA 2BGFA 4N8X1 3S2DB 1PH1A 2L8JA 2O4XA 3U58A 4WWPA 4DV5L 3M7GA 4K7WA 4EFOA 1SXTA 2N88A 4JI8Q 3TQYA 2KDFB 3D32A 3E56A 4LNNA 3X23A 3GO5A 3HRZC 1J0GA 3L7ZC 4LNOA 1C9OA 4OO1I 3NRZA 4XTCS 3UQBA 1YOVB 3PUWA 3NUHB 3U4VA 2IX1A 3A55A 2QGQA 2X69A 2B76B 1V1PA 5JEAJ 2K6AA 4HKQA 4A3JB 2OXPA 3I90A 2O5IC 3DEPA 3MHBA 3RLFA 1V1QA 1JWSD 2PNHA 2PVGC 4IFDH 1QLBB 3V2TA 1C77A 2D10A 4HCNB 4H2AA 1SN8A 2LGIA 3SR6A 4A3MH 3HOVH 1NI2A 2PQEA 4GOPC 1TWGB 1DD2A 3H6NA 3CC4A 5C4ZA 1YZ6A 4ANWA 2K5HA 5AFWA 1KIXA 1EL0A 3AB5A 3H9DA 1UNSA 3MTSA 2JA7B 1BCPC 4A3DB 1LTBD 5IYCH 2N0SB 2JVCA 1H9RA 4NB3A 5FO7B 1N33Q 1PH6A 5IYDH 1PFBA 1K83H 3R7RA 3NQTA 5LMUL 2LJ5A 4TSSA 2WXOA 3ZXVA 1D8LA 1LACA 3FKIH 2E2HH 3UINB 2UUBQ 4AJWA 3RD2A 3SEBA 2CVRA 2G9DA 2MPMA 4ME5A 3H6MA 2JX5A 2WXMA 4M8MA 3U7DA 5LNK1 4RGMA 5HGQA 2K6DB 1A5RA 2PZUA 2R7DA 1A3TA 4ZRQA 4A3JG 5JXVA 2E2DC 3AE9B 4XYCA 1VQCA 1FD6A 3VH4B 2XK5B 5C5MA 3ITPA 2L83A 3S1MB 2EYHA 1N32L 1XNQL 2OTJA 2KCNA 2IGDA 2BWFA 2QMTA 4HRSA 4JPSA 3FVQA 5H1SE 3SK5A 3WAPA 3BDOA 3FP9A 5CV6A 4WJ4A 1JICA 3BDLA 3MEFA 5C44B 2JA7G 4A3DG 2D0OA 3H09A 2NVXB 5FLXE 2M56B 3V60A 2D5GA 4U673 1V1OA 4KLKA 2EY6A 1E8ZA 1ZDXA 1U4LA 3H7PB 1K51A 1EY0A 3UIPB 4EUTA 4DXFA 2NBFA 3PUZA 3IT6B 1K73C 1BBWA 2JEBI 2JA9A 1NJIC 1VZ6A 3P20A 1Q90A 1T0RC 4N9TA 3QJZA 1DXMA 4URKA 1J8IA 4NW2A 1QVFA 3DPDA 3JC66 4KK7A 1K8OA 3LX0A 2LJIA 2EJFC 4B9WA 2K5PA 1CQVA 3QOJA 2EIFA 1S5ED 1PUTA 5IN7A 4O0AA 1CZWA 5M3FG 1PH8A 4W9JA 2FHTA 1PTOF 1JMCA 2A19A 2RCNA 3D6WA 4PZ8A 2VRRB 5MPOA 2INPE 4AH6A 1Z6HA 3N1ZC 5C44G 1VQOA 1QT9A 2L15A 3S16B 1EOTA 3T1HL 1STGA 2GOWA 2F0HA 2MNAA 1I5FA 1G51A 4F7XA 4FA6A 3S17H 3TEZA 1DCZA 1H9MA 2OWOA 2F0OA 5KRUA 2WXLA 3KYHC 3MEHA 3OSOA 5EPKA 2KUMA 4K2LA 1AP0A 1E2ZA 5CBAE 3A7AB 3A56A 1PHJA 1UWMA 4DV3L 1KD1C 5BR8Q 3DWQA 3E6ZX 4OX9Q 3TJPA 1VDZA 5EE0A 5FKAC 3G48A 3IXSA 5LMNW 4OZAA 4NAMA 1SEBD 4AWJA 3CPFA 3OW7A 4OXPA 1L2FA 2Z1CA 3BZKA 1KC8C 3PRMB 1OEYA 1VMPA 1ZE3D 4FULA 2KLGA 4LW1A 4DR6L 1WCMB 2D3AA 4F7ZA 3RN9C 2WNMA 1YMHE 2K0PA 3EFCA 1TXYA 1Y1VB 4NKLA 4IPDA 1JE5A 2DJFC 3Q3NC 4IFDI 2SOBA 3DBRI 3N20C 1EY5A 4IUQA 2R2OA 2A5HA 2KFKB 1J7AA 1TVXA 4GOPA 2LMCB 4KHVA 4YL8A 1VRAB 4LF9Q 4G0NB 3EGRA 1CFMA 3TDQA 4IM0A 5BMGA 4JI4Q 4CGYB 3WCQA 1EYDA 2PO4A 3JYUA 3HOZB 4KY7A 2K32A 3T4AC 2N9EB 3KLSA 1DOLA 1UBIA 3G71A 5JHAA 1L1OC 3C2PA 3GTQH 2JA5H 2JZPA 3RN2A 2ZNVC 4KGSA 1G2TA 2HDMA 2LS01 3T51B 4BA1I 3UQAA 3MP9A 4LF7Q 1VCBA 2ZCBA 5BN3A 2RPVA 3AULA 2VQFQ 1ICFB 1WCMG 1BCPF 1DONA 2I38A 4HJGE 4A75A 2WIIB 2Q8RE 4WWMA 1Y1VG 4IQZA 2WU2B 4R4OA 1TKGA 1LABA 2OEOA 1E8WA 4Y7NH 3TMPB 1PTOD 1U0LA 1ZUD2 1E7VA 1N5XA 4EGVA 4RG1A 2BDOA 1WY8A 1Q46A 2NVUI 1MI2A 4POGA 3MVVA 4OVVA 2PW5A 3RCZA 4E71A 1DOYA 4DR2Q 3U30A 1WJ4A 1VQHA 3DM1A 3HOZG 1WFYA 2K28A 4A3KG 5M5YH 3C1FA 4X3UA 1G6ZA 4FP5D 5KGUA 1VJKA 2KK8A 2XWBB 1WD1A 5I9OA 5A2QE 1EY4A 1LTLA 1X32A 5L95C 3A74A 4OGQC 1ZKOA 3MXUA 4P71A 2KACA 1WX8A 1A8VA 4RGOS 1PH3A 1C8CA 4IPHA 1SE3A 4KJNA 2AKWB 4IJHA 2ZJRA 2ZJQA 4LF4L 2M2LA 4JI3Q 1TIFA 3G6JB 3L08A 2BOSA 1WTWA 2V4LA 2VQEQ 1TWHB 1XMOL 3EC8A 2R7FA 2RQXA 3ONAB 4FXGC 4C2MB 2WXPA 4MACA 3HOXB 3I57A 3HRDD 3I63C 4YWMA 1JR0D 4X3KA 3AE7B 3B0AA 2KQ3A 4HJ9A 4OWWB 4K7UA 1TS2A 1WTRA 4Q5VA 4WIPA 2NVYH 3RMKC 1MHWC 4KZ0A 4JI4L 5J17A 1Q82C 3VR3A 2DZKA 3ZXRA 3P1MA 1IBML 1OFFA 1HNWQ 4FN2A 4A3LH 4RGNA 3E9IA 3P2BA 4LCDE 4AQ7A 4KMUC 1FXAA 2Q2IA 2VH1A 4MM3A 2XEWA 1U4PA 3RNFC 1B9MA 1Q1EA 1JJ2A 4B3TQ 4QCLA 2N1VA 1E8XA 2WX1A 4YTMB 1RF2D 2AUJD 2KWCA 3HOWH 2J42A 1MGSA 3A8JE 1XMQQ 2Q8TA 3VFKA 1RYJA 1CKOA 1MJDA 2K9XA 1BCPD 5GAEC 2YU9H 3SXHA 2WXGA 2Z9HA 2W9NA 2J0KA 2C35B 1ET6A 1X3GA 4R4IA 3JAMc 3NOBA 4TQUS 5JOBA 2OOBB 2MQHA 2H1EA 4LF8L 2O2LD 4JYAQ 1YQ3B 3U2SC 2HHHL 2EYJA 2L32A 1BBUA 2BE5C 3TEWA 1PXUA 2D2QA 4GN5A 4XIGS 4GIVA 3S14H 3PSIA 4DV1Q 2BA1A 4JVZA 1KLUD 5CORA 2REXA 4KTAA 1ZOYB 3KF6A 2Z0SA 1S3SG 4V0BA 3L3OC 4C1NI 4DAMA 3DVGX 1ROEA 4IM3A 3DVNU 3UI3A 2W3RA 4UP7A 4ANUA 4ANVA 2LFNA 1L1OA 2MBHA 3SGIA 3NELA 4HJ8A 3GZNB 2RDHA 4IO9A 2ICEC 3KF8A 2W54A 3DBLB 3JVZX 4NQKE 4PS3A 4ZK9B 2V4DA 2AWNA 1FFUA 3PSEB 4LFBQ 2WQYB 1JJCB 3AU5A 4KKUA 5CV4A 4LFAQ 3M3YH 5C0XJ 4HLEA 4YWLA 1FMAD 1X3FA 2VQEL 2DZIA 1A70A 4X62Q 5T1GA 1Q86C 3PPAA 1IYFA 3UE0A 1CKNA 2LRUA 2WXJA 1E1TA 4L5RC 4P75A 3VR5A 4HXDA 1P7EA 3QA8A 1WIAA 3TIXA 3ENEA 3A8KE 3D0FA 3JW0X 2D9UA 3JSVA 3T9LA 5E1FA 3X0WA 3J7AV 1UH6A 4ZOHC 1YNNC 3Q8DA 1BBXC 4KHPQ 1QNUA 2W3SA 4QJFA 2MBBB 2L12A 4A3EB 1EWYC 2F0PA 1KXLA 3S2HH 3AEBB 1PZKD 1K50A 2M8SA 1Q81C 3J80c 5E3FA 4ZAIA 3BIID 2JN4A 4REZA 3LWUA 3S9WA 2JYOA 2BYFA 4F1SA 5JJZA 1Q8IA 2K50A 2X6GA 1VS0A 2L0CA 2ZTEA 1AARA 1T9HA 3NWSA 2I5HA 3CRKC 3DLLA 4LNIA 1HTLD 1EF5A 2K5QA 1CQFA 1KAAA 1TWAB 4B3TL 5HG2A 5E6NA 4ZKCB 5AZHA 3KWVA 1MD2D 1X3PA 3BVMA 3H0GH 1PTOB 3E0EA 4CKCA 3KFUA 1GJZA 2JUOA 4DNRB 1SYCA 4BKSD 4MGZE 1TQOA 1ICWA 3TS2A 4MGYE 2OT2A 4G4KA 4JPBW 1N6ZA 2D62A 2K5WA 1GUOA 1EIGA 4OL7A 1A15A 1B3QA 1RFAA 4M0WA 3WDNA 2HDEA 2KYWA 4XGAB 1U5KA 1YNJC 2KCTA 4APVA 3SR1A 3CCQA 4JYAL 3BINA 4NPNA 1D6EC 4WJNA 4NNJB 3DM3A 4MJSA 5ELEA 4A3EG 4CKBA 3U50C 1DYQA 3OIQA 4DF7A 3GTJB 5M5XH 3HG9A 4C4VA 3W1BA 1S72A 3TRZA 4DR4L 4DR7Q 4FYDA 2PTLA 4A55A 2PNRC 5JPNC 2JXTA 2V3PA 2MJDA 4WWOA 4ARIA 4CQNA 3GTMB 5CV7A 4M1UB 3UDGA 2DZMA 3WAMA 4FXDA 4BZAA 2K8HA 4RGTA 2MBEA 3CCRA 3UI2A 3RZDH 5EBDA 2MGSA 3KDFB 1QB5D 1SMYC 1HZAA 2PE6B 3AB9A 4C80A 1B4OA 4HJAA 1NBWA 2GBRA 3WA0A 3K0XA 4PV1C 2HJ8A 5AUKA 4JX1C 2WINB 1EWIA 5IP7H 1I50H 2B2WC 3BK2A 2MBOA 4ZHOA 1JB3A 5JJIA 1YNTE 4K3CA 4DR1L 1G291 3M85A 3PO3B 1V6EA 2KQ7A 2V3NA 2JE6I 4LK1C 1QILA 4K7SA 4KX6B 1GC6A 4MDKE 2N7EA 3PIO3 2KNBA 1EYCA 1I4QA 1U9RA 2HDLA 4HSVA 3MXNA 3M3JA 1IBLQ 4ZKBB 1DOXA 2UXDQ 4GOPB 1VQGA 3KBXA 3N3KB 1NYRA 3OHXC 3Q24A 2Z6KC 1B1ZA 1EZ6A 3SDZA 2NVQB 2KD0A 2OQ0A 2UYZB 1K0SA 5G5GA 4A3PA 1BCPB 3K0YA 1A3UA 1PYSB 3I4OA 4EZJA 3ZTCA 3GV6A 1SB3C 1PH4A 2WGSA 3T3NA 3BWUD 2AWTA 4GGQA 5EE1A 4IZ8A 4C3HH 1N34L 4K6LA 4FF1A 3QHTA 4P1CC 4A3BH 4JW0A 3KWLA 3IL8A 2L1BA 1PMRA 2XBBC 4K1RB 1L0XB 4DNIA 5C3EH 2E2JH 5DNFA 2GBMA 1D3ZA 1GJXA 1ZPSA 3OIPA 5C0XH 4O1NA 4RKLA 2IY1B 3EHVA 1YEZA 5C3XA 2FNJB 4DN4M 4BKTA 1C0AA 2KQSA 2CS4A 1JWUD 4WRDA 5ELDA 2K4KA 4C3IH 3CXCA 3L17A 4K14A 3Q8FA 1DOMA 2DZJA 4JBJA 4XDXA 1MJEA 3NEMA 4GLAC 3J80L 2JA8B 1X6OA 3V96A 3TSSA 2WXFA 1Q12A 1CI3M 1EY6A 5JZEB 1GB1A 2EJMA 3J9CA 4B9XA 2ZTCA 3NG0A 1PGBA 4NDXA 2EELA 3FHWA 5AJ3Q 2IBIB 1L2NA 1GKHA 1ZYRD 5IAAC 1FJGL 1C3TA 2MEKA 4B3SQ 1NUCA 2VUMB 5C4XH 4IPGA 2WYQA 3ZQ4A 2M0AA 5IYBH 4DV4L 5ELCA 1RKNA 2NN6G 3P63A 4RNAA 1QZGA 1D1KA 1RODA 3FDTA 1K8MA 4O2DA 4QB4A 3TZDA 1L6UA 3RNEC 2CH4A 1N5WA 1WSPA 1STHA 2JA8G 2K5DA 1EOVA 5CHWA 5ELBA 3KLRA 1VQEA 3IT4B 2ASQA 2VB3X 3FILA 3ML8A 3I91A 1P16A 1V49A 2FIFA 1XNRQ 1I4HA 4ME3A 3N30A 4HCEA 2TSSA 5CYUA 2R93B 3EBEA 2ACZB 5EE9A 2F0JA 3I73A 2I46A 2IO0B 1BDOA 2E74C 2RD0A 4LFCQ 2VUMG 4BY1G 2ID0A 4W9EA 2RSUA 3AEEB 4MZ9A 2BE5D 4JI6Q 1BF4A 1HR0Q 3S1RB 4ALPA 2P5ZX 2JK8A 4XQNA 2N8NA 3HVDA 2FINB 3N52A 4MM3B 2I1JA 3A54A 3SVMA 3B2GA 2XGTA 3IAM1 4MH0E 2HD5B 3RD4A 4AYBE 1H4RA 2LY7A 1B7YB 2B2WA 3MC0B 2CKZB 5C4HA 1AZQA 1HZ6A 1Q5WB 3PLUA 3DWPA 1JWAD 3IFWB 5GADC 1XXGA 3OG5A 4A6QA 3ZJVA 2M19A 1LT5D 3K5NA 4G7ZC 4LF5L 3P75A 4AQYL 3RZOH 3W5OA 1CSQA 5J39A 1CMXB 2R93G 2JYEA 1E3PA 3OWEB 1YJ9A 3HUIA 1VQPA 2EYFA 1YX5B 2UUCQ 3S2DH 1LTRD 3VYRA 3O13A 4I7ZC 3LB8C 1TU2B 4GMVA 5LHY1 1TIID 1YJ1A 4BBRB 4B3ML 2Q8IB 1KHIA 3AI5A 4CHTB 1RIPA 5FK9C 4US8A 5IKCM 1K28A 1FXTB 3H1UA 1IPGA 5G3LF 3KF6B 2Y5BB 1T5EA 3V05A 4DV5Q 2D3BA 3WALA 1L1OB 2F0IA 4A3JH 1L4DB 2N7JA 1SROA 1YNND 2BH8A 2D0PA 3KF8B 3PQIA 3EROA 1XPRA 2WXRA 2ZNVB 4S0RA 1HR0W 1X1MA 1KTKA 3M4PA 4K8IA 3TP7A 2MRPA 2XN9C 4IUUA 2BT6A 5C0XI 1NEKB 1V2YA 1VZ7A 3A9KA 1TWGH 3E3XA 4DDGD 2Y5PA 1IYVA 3C46A 3NQIA 3ZRCA 2WDVB 3W3AA 2JA7H 5IY0A 4A3DH 1P9DU 2GVBA 1CKNB 3A8IE 2QSDA 2W55A 1JB7A 2M4NA 1A3VA 2E8GA 1ET9A 1PDQA 2F3WA 5DPTA 4EEWA 2F0VA 1DZ1A 1ZEQX 3APDA 2B2YC 3AFPA 4BBRG 4AYBB 3KJOA 4M8NA 3JSVB 1I3QB 4HK2A 3V6CB 4DK0A 3IAYA 2LRWA 5GROA 3EJIA 3I4LA 4LJOB 3GDEA 2X6LA 2QEJC 1YNJD 2MUYA 4JQWC 5IA7A 2N3SA 3DXJC 1CT1D 1II3A 2KOXA 4K0KQ 1LM0A 1PZID 1QF6A 5LMUQ 3VH3B 1XPUA 1PGXA 4USAA 1Z47A 4K3BA 2LFIA 2YLMA 5C2TB 2BA0A 5CV9A 2FCNA 5M3FH 4RF1A 1QOBA 3VDYA 4C00A 1Q7YC 1MI0A 2IPKD 3HOYB 5C44H 4HTHA 3GV3A 2NVXH 2FE8A 3SDLC 5BO4B 1SMYD 1N32Q 1XNQQ 4YIJA 3DDCB 3I4NB 4M0WB 3RPFC 1WXMA 3S24A 4AYBG 4YXDB 4HJ7A 1XJVA 4B3RQ 3BY4B 4PYZA 2YVCA 3IHPC 1S5BD 2UWQA 1SAPA 5LLIA 3KYDD 1NR4A 4MJSB 2KLCA 2AHOB 3BVGA 2A6HD 2V1YA 3WOFA 5H8YE 4C4VB 4A3GG 3TCAA 1A2UA 5LXHA 1ENAA 1CA5A 1D4BA 5BMHA 1QOAA 4RWSC 5G3LD 5C3JB 3VQIA 1D2BA 1ZP0B 3ABVB 5EPJA 3KLSX 3I9V1 1WYGA 2XRQD 1JQYD 4E6IA 1HNXL 5E6JA 1KNAA 3Q3MC 2JP1A 1K3BC 2MW5A 2RVLA 3I4MB 2C7HA 4A3IB 1NMGA 1WJNA 3PO2H 2EKIA 1EWHA 3W9CB 1QKZA 2GB1A 1OQRA 4EE2A 3HKZE 3I4NG 5FLXc 1QQRA 4JE3B 4BVUC 2BF8B 2MHVA 2UXBL 3M7NA 2KANA 4AJYB 4I6NB 2WXNA 3PS6A 3VYUA 1EFWA 4ZRJA 2LUMA 2FAZA 2KN5A 3SK8A 3T1HQ 1I94L 1VCIA 3C8YA 3CCLA 3ZJUA 1WFQA 1HTPA 2RSOA 4DA2A 2K03A 1GC7A 4L2YA 4DV7L 2BDNA 3MXNB 1LTID 1YHAA 2MJ8A 3PVLA 4X64Q 2XSCA 4DV3Q 3CF6E 3QK0A 2VS1A 2F52A 2PPBC 4K0KL 2YTVA 2JWZA 3ERQA 4IUVA 1WCMH 4FJVB 2NVTB 2R92B 3I8ZA 1LT3D 1Y1VH 3W5VB 3I4MG 4A3IG 1YIJA 1EEID 4R4CA 2F4VL 1QZEA 4GN1A 2J7ZA 3J81L 2AX5A 4QMGA 3G6EA 1N8RC 1PH2A 1JC7A 1WRDB 3NP8A 4DR6Q 4HDQA 4LMQD 1YN3A 1C1YB 3E5SA 1C76A 1E7PB 1X65A 2KDBA 1FEHA 1ZW7A 4EKUA 2ZM6L 4WJPA 3IFDA 3L2PA 3CSTA 2J53A 1M94A 2R2QA 1BR9A 3ETRA 1SNOA 5IT9L 3HOZH 3S1NB 1K52A 1IKMA 1IGCA 4B3RL 2K1FA 2B2YA 4A3KH 1UWXA 4JWUC 2KHJA 2A68C 4IJLA 1K8AC 3OPOA 3W1SC 3NWTA 5L37A 4CJ2C 3KH0A 2QEXA 2BKRB 4NZLB 1V5OA 4K8JA 4K5WA 3UDFA 5JPMC 5M5WB 3HKZB 1TTNA 1SNMA 1R9TH 3CMMB 3QWZB 5FR6A 3CCMA 1RHPA 3T1YL 2PMZE 1J19A 4DUZL 3QCAA 4HVBA 2KBNA 1GM5A 4LF6L 3CRLC 1VR9A 2KMAA 3N6RA 5CGKA 3M95A 1UZXB 5FJ8H 4GLSC 1Y1WB 1JQ4A 1WXSA 2KENA 2BS2B 3RNCC 1T3QA 5DLQE 5BN5A 3H7SA 3NZSA 5EE3A 3S1QB 1X56A 2GRIA 2K3UA 5IP9G 1M90C 1LO5D 3APCA 2NZOA 4YSZB 4XWTA 2M0XA 3RULA 4EX5A 2LHEA 4DNTB 3W1YA 4LAAA 1LT4D 4K6DA 1OGWA 3U4ZA 3FILB 4B9KA 2KWVB 3HKZG 1VQ9A 1SIJA 1BNZA 2DHZA 4X64L 1SE9A 4R4QA 2NZ1D 1E90A 1H8CA 4KY5A 3MJWA 1A62A 3ZJYC 1IZ6A 1GUWA 3GTGB 1U4RA 1EQRA 5EKIA 1I7HA 1WTOA 3ZJTA 1SJED 3A0JA 2EXDA 3ZO5B 3HVZA 1CUKA 1EY9A 2Z4IA 5IGFA 3CQZB 2ZJPA 4LF4Q 1TYGB 1E10A 2NMQA 4UP8A 2GMIC 2ZPYA 4Q2JA 2I5LX 5C4JH 1XCQL 3CPWA 2K8BA 2V9HA 3UDIA 1XMOQ 2J7QB 2L1AA 2F0MA 3NUCA 1TGZB 4BY7B 2QHOA 3Q2AC 2BTEA 5J3BA 1Y8PB 1RD9D 2MO0A 5JEAH 1N61A 1YN5A 2DYOA 5BYQA 2QDFA 2KJ6A 2PMZB 3H3VC 1EU4A 3PHWB 4KKJA 3C19A 2K6QA 4YCUA 3MXGA 3E0JA 2NYZD 2AQ1B 1RJTA 3AE2B 1IYUA 5IGEA 2NBUA 4A4IA 3AEGB 2LVOA 1RDPD 1T5XD 3TP8A 2FUHB 1F9JA 2IHFA 4YY3L 1FD7D 3DHHC 3ONSA 2F0LA 5AZFA 2D3GA 5G2NA 2ONQA 1RRBA 2RGFA 2FJ2A 1IBMQ 2C7NB 4ICUA 1VQIA 4X65L 2UU7A 5BYSA 2WB1E 1MKHA 2EYLA 4UPAA 5K36G 2G4DB 3L16A 4G3XB 1HZCA 1OEYJ 5AZGA 3PLVA 1S3OA 4DK1A 3CC2A 3IRBA 4RHSA 4L5TA 2V4IB 3LXFA 4WQMA 3RNAC 4F87A 4QGUA 4RCNA 3AU7A 3L10B 4OW0A 4MEMA 1MG4A 3RZWC 3KW5B 2PCFB 3DHGC 5E6OA 1QZHA 5E7NA 4BY7G 1B9RA 2R6GA 4C3JB 1F2RC 3QQ8B 4KIKA 4XXEA 2MA9B 1SFOH 1YBYA 5IOIA 2DY7A 5FR3A 4PG3A 3CCJA 4HMJA 4LF8Q 3Q69A 4KZCA 3DVNV 4ANXA 3A9KB 2MO1A 2HHHQ 1V86A 1LM8B 1LFDA 4OZBA 1NCVA 4FHKA 5CX3A 4DU9A 3W1SA 2ON8A 5I4DA 2MLBA 5EQ0A 3F2CA 2DAFA 4NP5A 3AMUA 2KTFA 1N63A 5M3MB 1SE4A 2JRIB 1PV4A 2B39A 2Z0DB 4L1BA 1E5WA 2PI2A 2MH7A 1UE6A 4P2CB 1C4AA 2RDGA 1G6JA 1XX8A 3IBEA 4HSPA 2KJRA 4H0LC 5HKHA 2EY1A 3AM9A 1SYFA 4WJ3M 4KKSA 3L4PA 3RLNA 2QKIC 5TR5A 4C3JG 4JV5L 1EIHA 1ILPA 1ONLA 1UD7A 1WGYA 4II3B 4LDTD 2LUEA 2ZXRA 3A5ZB 2LGSA 3AU4A 4B6WA 2HCCA 4YT0B 1P0RA 2WLBA 3MJ5A 4HJ5A 2WB1B 1E2VA 1S5DD 4EQNA 4A3EH 3NBHA 2YTYA 4JI2L 1HHVA 5IIFA 4IWQA 1FYCA 3PUYA 3OAWA 1UE7A 4MNOA 3NHEB 1YN4A 5HY6A 1LV9A 2AMCB 5DEHA 2V0GA 1AFPA 2L7RA 1RFKA 1WXAA 2PLPA 2IHEA 4AIMA 5M3MG 1X3QA 1EIYB 5IO9A 1QJOA 1PTOH 1XPOA 1EY8A 3HGBA 1OXXK 3ZTDA 3LJ3A 4JIOU 3RZFA 1AH9A 4A3CG 3L54A 3AE3B 1F52A 3LYYA 2C5CA 1FR3A 1DGSA 1I35A 3Q8CA 2K05A 4HPMB 1WOCA 1WTHA 2JSVX 1TZOA 4OWTB 4W9KA 2WB1G 5IP4D 2FFKB 3HOXG 3PF5A 1K0RA 3AYHB 3GTJH 1WXQA 3TEHB 1V9JA 4HDOA 4HPLB 2EXZA 4II2B 2NUCA 3F2UA 5GAHC 1G2SA 2B63B 2PZWA 1SSOA 5BN4A 3CCSA 4HJKA 4JOIC 1V1PB 1WTQA 4MGKE 2B3GA 2F4IA 3BK1A 2EOTA 1R4MB 1SYDA 1SIFA 3NZ3A 3EQLC 4GB9A 4RMAA 3E9SA 2A6EC 2F0SA 4HEDA 2E2IB 1A2TA 3CD6A 3U9OA 1IBXA 4G57A 2IT1A 2WDRB 3HK0A 3ERSX 3VR9B 4ZCKA 4DR4Q 1GHKA 4FBJB 3P4SB 4DHZE 2XNAC 3CCVA 1T0SC 4LK0M 1QOHA 2KC1A 2EY2A 3NVYA 1D5ZC 2PW7A 1XYIA 2VZKD 4XDCA 4BXXH 1Y56A 4JK1C 1SGHA 2VL6A 1ZXTA 1PZJD 2ZPNA 2QIEB 1HFGA 4ZRZA 3S15H 2A68D
chains in the Genus database with same CATH topology
2CQAA 3QWNA 3HEJA 4FXCA 4A3FB 2AUKA 2IL8A 1PFNA 1JOQA 1MPEA 4QUCA 1R7SA 1STBA 1CM9A 1EQVA 1WTPA 2K1BA 4A90A 2F0DA 3L9AX 1J7BA 1R4PB 1STNA 2N9LA 5DAUA 2FBWB 4TMAB 5F2DA 2MJEA 1H9SA 5KYLA 3C1EA 1T6BX 1KH0A 3GS2A 3BYYB 5I2YA 2NN6H 2A73B 3AE6B 3AE8B 2R61A 3C3LA 2XRSD 2F3VA 3URYA 3P4PB 1TWCB 1KFYB 2G9HD 1FCLA 4KY6A 2L4NA 1M4VA 1O78A 1QOGA 2HUGA 1JOOA 2K04A 3K59A 1FM0D 2WXKA 2NVYB 3H94A 1I4RA 1ESFA 3FPUB 2INNE 3AEDB 1QCBD 2WU5B 2EJGC 1IGDA 4CJ0B 1NENB 1HUNA 1KRHA 2A69C 4NMZA 1N60A 5JAVA 1O80A 1PRTC 2BB5A 1EFID 1F2YA 2E3TA 3PO0A 1AEXA 4ZRPA 3JAML 2F0GA 4KN4C 1KLGD 2FMCA 3N9YC 4AS1A 1SNDA 4K5VA 3RFZB 1GUNA 4XWWA 4EQOA 3MFYA 4N6EB 3AV8A 4TRDA 1JROA 1SF0A 2PYKA 1LTAD 4KKTA 1ILQA 4LLGM 1BUIC 3PV0A 3S14B 1WGKA 1JWBD 1L6VA 3TMEA 1ML0D 3W5UB 3J80E 4P6VF 4I65A 1QG7A 2IJ0A 2K01A 3FEWX 2F0UA 2EE1A 2W82A 1TY0A 5DM63 3K58A 1RTNA 1KABA 1F0ZA 4PMBA 3HP3A 4WJWA 3AE4B 2VZKB 2WDQB 3R3OA 4A9AA 2MP1A 5LL6X 2MJ3A 5CMDA 1D5XC 2XWJB 5BMIA 4RFBA 1F2LA 1CZPA 3M4YA 3H0GB 5IGDA 2NN6I 2BB6A 2BS4B 2PKOA 1B44D 1HA5A 5E4WC 4OHJA 5I6WA 1WWTA 1Q3LA 3GQBA 4FF4A 2EYPA 3T56B 1SYBA 2B2UC 3IKJA 3X3NA 1C4PA 4KJOA 1MHXA 1ENCA 3FAHA 4R8NA 1TJEA 5IGBA 1NYQA 4N9PA 2DN8A 2R7ZB 1CK1A 3PMFA 3SFEB 2SNSA 2RBMA 1I4PA 4OIKA 2K7VA 3GTKB 1AN8A 1MSGA 1CZGA 2EYMA 2A6ED 3CHBD 5TSSA 1G91A 1O7ZA 4HAEA 2JA6B 1AWDA 1CJEA 4KD3A 5K5PA 4A8XC 1PRTF 1RM6C 3MFGA 1NR2A 3PUXA 3SK6A 3MXPA 2KN4A 1VLBA 4V190 3CWIA 2EYOA 1JOKA 4LJZC 4J1MA 2PZTA 2JU6X 4KGTA 4MH8A 3NTKA 1FRRA 4TQ0A 4EVOA 1STAA 2KOLA 1YJJA 1QWYA 4LTUA 1IBXB 1HFNA 2LKVA 1FO4A 4IOIE 1UEAB 1DOIA 1EEFD 2KECA 1PFDA 2DNCA 1VF5C 4M8AA 1EQTA 1SE2A 1JRPA 4B08A 2F0WA 2IDYA 3ND8A 4HEA1 1V8CA 1ENFA 3VR8B 1OXVA 4ARCA 3T13A 1WD0A 2FUG1 5HHDG 3BDCA 5ISRA 2JEAI 1DJRD 1HCZA 1Q1BA 4ITKA 2PW9A 1E2WA 3CU7A 3MZ5A 1HZ5A 3BYTB 3R2TA 4JWSC 2NTSA 5BYRA 4OIJA 1IKLA 1B3AA 1JE4A 1H9SB 5IGCA 5C4XB 5EKKA 5J1ZA 2PIAA 2QJLA 3U52E 2B2TC 1BUVT 4XYQA 2KCCA 3RMHA 2A69D 1BXTA 3GP7A 1PGAA 2L5TA 2AWOA 1ZXIA 5AUIA 2J4XA 1C78A 2B2UA 5D3DA 3P4RB 3AE1B 3EVQA 3FPPA 1E0ZA 1CHQD 5I2XA 1D5MC 3PIP3 3HOUB 2KHSA 4TQ1A 3DMUA 4K5XA 5G5HA 2IX0A 1AZPA 5KNBA 3GTPB 1NSNS 3OMGA 4ID6A 1G8ZD 3NXWA 4C7ZA 4JBWA 3LNNA 1BO0A 1ESRA 4D2KA 1XLNA 1MVKA 5EJWA 4PMWA 2L11A 3BS1A 1KDBA 2JYTA 4MN3A 2TMPA 4K2KA 1GOZA 3VR4A 2B8GA 1FRDA 3Q6SA 2C9OA 3J81E 3RZOB 1XF5L 5I6YA 4TKOB 1I6HB 4CKEA 2J0TD 4FXKC 2WV6D 1GPXA 3EFXD 4FF2A 3IFTA 1L5PA 2CJNA 4WH4A 5IT9E 4HROA 5JVH3 5K36H 1C4QA 1IL8A 4ILWA 4XQQA 2BBCA 1SYEA 1TS4A 1GUGA 1EZ8A 3NHHA 3Q8EA 1HQMC 5IGGA 3GTLB 3K5MA 4OO1G 5CC4A 5GXGB 4DQOC 4PT5A 5JVG3 2A74C 2KA7A 5HFYA 3MWYW 1CHPD 4EQPA 1ZDVA 3M4OB 2M00A 4L8JA 2BCOA 3GD7A 3DWGC 1XWEA 3FMCA 1TWFB 3K57A 5KIXA 1BOSA 1Z7TA 1LT6D 4CBVA 1V43A 5E4XA 2Z4HA 4IUNA 1LLRD 1OO9B 2E75C 2AQ2B 4HR7B 4KN7C 3AMZA 4A93B 3I70A 4IN3A 1PDXA 3B2FA 5M3FB 3QO2A 2B2TA 4MHEA 1E6EB 5J22A 2CU3A 2NB0A 4XYOA 1LTTD 3ND9A 2CW0C 1BMLC 1SNPA 1OXSC 2JWUA 3P42A 1TS3A 1EY7A 1ACCA 2DY8A 4FO2A 4UDUC 5LL6S 4FNFA 3VR2A 4XDDA 2IGHA 3HZXA 1M8AA 1I6VC 2F0EA 2IWHA 1Y69U 2VNUD 2WKCA 1HPCA 1ZXHA 1NI3A 1H9JA 3GB1A 1VDVA 1VF7A 2WKDA 3QOLA 2DBYA 4RKBA 1PRTB 4WFN3 5CBEE 2NTTA 5C3WA 3B9JA 1B53A 1SJHD 5FLXL 1O7LA 2JXMB 3K6OA 2FMMA 1J7CA 3PO2B 2WXHA 3BG3A 1NAPA 1MBYA 3VRBB 1FIQA 5ELFA 2WXQA 4ULLA 1FNUA 4A3MB 2KAJA 3HOVB 5D14A 1EM7A 4J8QA 2EDGA 5KYIA 2Q5WD 3TN2A 5KNDA 2IW3A 1XEEA 2HQEA 5FOBB 2KDMA 3MHZA 1SBBB 3D3RA 1K83B 3Q8AA 3FKIB 2WACA 2E2HB 2DWQA 4ODGA 1UGJA 1MHHE 4HKZE 1HA6A 3KUPA 4KD4A 1IUEA 3U4EG 2VB2X 4N59A 3U9SA 4IFDG 1L4ZB 4PQXA 1FCCC 2WAQB 4A3KB 4QUFA 4YTNB 2Y3AA 5EBCA 3PZ8A 1XTCD 4MT5A 2PVOD 3G7LA 1PYWD 1S5FD 1STEA 2ZXOA 2DLBA 3P1HA 2L52A 1R9TB 2SEBD 5CR3A 4BWGB 1NVID 4KKIA 1W6KA 1IW7C 1SNCA 4MIUA 3R2IA 3BVZA 2KEEA 2N9KA 1TS5A 1MSHA 1SYGA 2D5DA 4BA2I 1HRJA 4F8MA 1W6JA 1C79A 4UAIA 3H8HA 1KDAA 4Z9CB 1R4QB 1HXYD 4DXGA 2DYMA 1JW9D 3EA6A 3VRAB 1KDCA 3S17B 1F9QA 3SK4A 2M9VA 3PUVA 4J3OD 1LTGD 2J52A 1OQQA 4WAFA 1O7YA 2QILA 4YSYB 1GXDC 4C7YA 3T3OA 5NUCA 4DGZA 1GUTA 1XLQA 3CIRB 2QDBA 4L23A 3VYTA 1V97A 3RUZA 1ZYRC 4DFAA 5C4JB 4GDKB 3KK7A 3DWMA 4IUTA 1LTSD 1QE6A 5A2QL 4DAYA 4OZCA 2CHBD 4KI0A 4RCOA 4ZQ3A 1WTXA 1N62A 1FNWA 1QNKA 2QF7A 3OMCA 4PMCA 4HN7A 4R9WA 3QB3A 2QCPX 4C1NK 2H88B 4IALA 5D65A 1AW7A 1EYAA 1STYA 3GTQB 2JA5B 4X3SA 1EWCA 4XT3B 2F1MA 3DWAA 4FVMA 2KMMA 3T53B 3P4QB 1DOKA 4X3TA 2JQRB 2RKSA 5JEAG 2BYTA 1SFOB 5FO8B 1F2MA 4NJCA 4Y7NB 4RH6A 4R8IA 2H89B 1P7FA 4ZYSA 4RHRA 1JMLA 4YWGG 2NWGA 1GB4A 1F9SA 3D4WA 1TKEA 3NK9A 5M5YB 3AECB 2R3ZA 3T16A 2JSOA 2RA4A 2WXIA 4ZLTF 2I2YA 2CW0D 2EPBA 4Q0FA 5HGTA 1HQRD 1E0BA 5HURA 4P16A 3AEAB 4GZYC 1A6XA 3PZ7A 3U7ZA 2SNMA 2B2VC 1RWSA 3R93A 4DAVA 2HCIA 3JAME 2I07B 2K33A 3D8GA 4L63B 2OHFA 2E76C 1EU3A 3EUB2 1L0YB 3DUZA 4C56C 5IOCA 1OXUA 1PFMA 2PMVA 3NE5B 2YYZA 1B2TA 2KWDA 1TY2A 2ICIA 3K5OA 1C4CA 2L55A 3TUOA 5DM73 2X38A 4RA8A 4GDLB 5A35A 2KEDA 3KQ4A 4R3DA 2BS3B 4ABNA 1FGBD 4G7OC 4B0EA 1CTMA 3HOWB 2Z8LA 4XT1B 2ENBA 2F0KA 1TKWB 4IDIA 2YU9B 3WOEA 1XLOA 1CA6A 4PNYA 2Y0SB 3Q22A 5D7GA 2RMMA 1L0VB 4WORA 1Y8NB 3NSWA 1H9KA 1GAQB 1FXIA 1I4XA 2RSNA 2LEKA 2DNEA 1PLFA 4IKGA 4WURA 3ZGZA 2ZXPA 3MAQA 3SE0A 1E9MA 2YEPF 4CJ1B 1C9FA 3KBGA 3NPPA 5C6AA 1RTOA 4O42A 4ZOHC 1TT2A 2A6HC 2D2CC 4H13C 3S15B 3V3XA 1XO3A 3M3YB 1WRIA 1D1IA 5KEEA 2KJXA 3NTHA 1IW7D 3J7AF 2RDFA 4IURA 3NTIA 3A7LA 3SHLA 2K22A 2ZW1A 2F0FA 3Q8BA 1B9NA 2Y5CA 2VXWA 1WVLA 1U4MA 3S2HB 1VZ8A 3NVWA 1S5CD 1SSNA 5IODA 1Y8OB 5HI1A 4ZUIA 3NVVA 4F88A 3P7JA 1AYFA 4IUPA 2B2VA 5KNCA 2L9HA 1RCVD 3AN1A 2KVMA 4KGRA 2GA4B 4BS9A 4S3SA 2ZW0A 4HCSA 3Q0AA 5FO9B 3Q23A 5D3IB 4ZHPA 5EGTA 3FRPB 4H44C 3ZYYX 2H4OA 5T1IA 1VMCA 5M5XB 1F9PA 4N58A 4BY1B 2E6XA 1Q10A 1I4GA 3TP6A 1JALA 2HTME 2ZT9C 1DGJA 3RZDB 3QJYA 4ZUJA 2WP9B 3TZUA 1OXTA 4U68A 1IHZA 3MA2B 1HEZE 4BBSB 3DEOA 3TEYA 4HMIA 1HUMA 1I50B 3D6CA 1F77A 2F03A 1V8QA 5EPLA 1J9OA 2GI9A 2AQ3B 1JCKB 3TP5A 2LHDA 1BQQT 3TBIB 2XIWA 4QF4A 2IX3A 3HS0C 4OVZA 1SNQA 3FC4A 1DM0B 3NS1A 1F2ZA 5COYA 1YJIA 1FNVA 3QG1A 4KV6A 1WTVA 1XLPA 4FF3A 3K5LA 4QIWB 4OO1H 2F0QA 1GUSA 3QIAA 3OOCA 1F9RA 1TKYA 4C3HB 4IFDJ 1B50A 4A3BB 2LMCA 1UUPA 4YTPB 2WS3B 5C3EB 2F0NA 4L6TB 2E2JB 2SAKA 4C3IB 4XE0A 4DAPA 1XCTL 3VA5A 3DHQA 2IGGA 1UAPA 3K7AB 2BW2A 3NBIA 1JORA 3AEFB 2SDFA 3D31A 4RF0A 5C5LA 2EY5A 1YQ4B 4J6HA 4C3HG 3H91A 3VYSA 4G7HC 3CKIB 2EZVA 1S4ZA 3VA7A 5C0XG 1F2RI 3D4DA 3NVZA 3OWFA 4C3IG 2O5JC 3AH7A 2OF1A 3GTOB 3J7YW 1PRTD 2WP8J 2KQ4X 4H7BA 1SDFA 5I9PA 5EKLA 1FFVA 4A3GB 1PTOC 1C48A 3I3CA 3AE5B 3VR6A 2OEDA 1KF6B 4RAUC 2B8FA 2EVBA 3LWEA 1JWMD 4US9A 5CV8A 5H92C 5M9OA 4B0MA 3X3MA 3D4RA 4NAWB 5CV5A 1TR5A 4KHZA 1KNEA 3R8BA 2N55A 2XVSA 2CJOA 4XQJA 3TEXA 2F0TA 3I72A 1QOFA 1GHJA 1K53A 2YEPB 2G1EA 3IAS1 3BZDB 3W2DA 3S2DB 2O4XA 3M7GA 1SXTA 2N88A 3E56A 3GO5A 3HRZC 3L7ZC 4OO1I 3NRZA 4XTCS 3PUWA 3NUHB 2IX1A 3A55A 2X69A 2B76B 1V1PA 5JEAJ 2K6AA 4HKQA 4A3JB 2OXPA 3I90A 2O5IC 3DEPA 3MHBA 3RLFA 1JWSD 2PVGC 4IFDH 1QLBB 3V2TA 1C77A 4H2AA 2LGIA 2PQEA 1DD2A 1TWGB 5C4ZA 5AFWA 1EL0A 3AB5A 1UNSA 3MTSA 2JA7B 1BCPC 4A3DB 1LTBD 2N0SB 1H9RA 5FO7B 1PFBA 3NQTA 4TSSA 2WXOA 1LACA 3SR6A 3SEBA 2CVRA 2G9DA 2MPMA 4ME5A 3H6MA 2JX5A 2WXMA 5LNK1 4RGMA 2PZUA 1A3TA 4ZRQA 5JXVA 2E2DC 3AE9B 1FD6A 5C5MA 3ITPA 2L83A 3S1MB 2EYHA 4JPSA 2QMTA 2KCNA 2IGDA 4HRSA 3FVQA 3SK5A 3BDOA 5CV6A 1JICA 3BDLA 5C44B 3H09A 2NVXB 5FLXE 2M56B 2D5GA 4U673 1V1OA 2EY6A 1ZDXA 1U4LA 1K51A 1EY0A 4DXFA 2NBFA 3PUZA 3IT6B 2JEBI 1VZ6A 3P20A 1Q90A 4N9TA 1DXMA 1J8IA 4NW2A 4KK7A 1K8OA 3LX0A 2LJIA 2EJFC 4B9WA 2K5PA 1CQVA 3QOJA 1S5ED 1PUTA 1CZWA 2FHTA 1PTOF 5MPOA 3D6WA 2INPE 1Z6HA 1QT9A 3S16B 1EOTA 1STGA 2F0HA 4F7XA 3TEZA 1DCZA 1H9MA 2WXLA 2F0OA 5KRUA 3MEHA 5EPKA 3OSOA 2KUMA 4K2LA 1AP0A 1E2ZA 5CBAE 3A7AB 3A56A 1UWMA 3DWQA 3E6ZX 1VDZA 5EE0A 5FKAC 3IXSA 4OZAA 4NAMA 1SEBD 3OW7A 2Z1CA 1VMPA 1ZE3D 1WCMB 2WNMA 1YMHE 2K0PA 1Y1VB 4NKLA 4IFDI 2SOBA 1EY5A 4IUQA 2A5HA 1J7AA 1TVXA 2LMCB 4KHVA 1VRAB 3EGRA 1CFMA 3TDQA 5BMGA 4CGYB 3WCQA 1EYDA 2PO4A 3HOZB 4KY7A 2K32A 3T4AC 3KLSA 1DOLA 3C2PA 2JZPA 4KGSA 1G2TA 2HDMA 2LS01 3T51B 4BA1I 3MP9A 5BN3A 2RPVA 2I38A 1BCPF 1DONA 4HJGE 2WIIB 2Q8RE 4WWMA 4IQZA 2WU2B 1TKGA 1LABA 2OEOA 1PTOD 1ZUD2 1N5XA 4EGVA 2BDOA 1MI2A 3MVVA 2PW5A 1DOYA 3DM1A 2K28A 3C1FA 4X3UA 1G6ZA 4FP5D 5KGUA 1VJKA 2XWBB 1WD1A 5I9OA 5A2QE 1EY4A 1X32A 4OGQC 1ZKOA 3MXUA 2KACA 4RGOS 1C8CA 4KJNA 1SE3A 2M2LA 3G6JB 2BOSA 1WTWA 1TWHB 2RQXA 3ONAB 4FXGC 4C2MB 2WXPA 4MACA 3HOXB 3I57A 3HRDD 1JR0D 4X3KA 3AE7B 2KQ3A 1TS2A 1WTRA 4Q5VA 4WIPA 3VR3A 3P1MA 1OFFA 4RGNA 4AQ7A 4KMUC 1FXAA 1U4PA 1B9MA 1Q1EA 4QCLA 4YTMB 1RF2D 2AUJD 2J42A 1MGSA 3A8JE 2Q8TA 1RYJA 2K9XA 1BCPD 3SXHA 2WXGA 1ET6A 4TQUS 5JOBA 2H1EA 2O2LD 1YQ3B 3U2SC 2L32A 2EYJA 3TEWA 2BE5C 1PXUA 4XIGS 2BA1A 1KLUD 5CORA 4KTAA 1ZOYB 4V0BA 3L3OC 4C1NI 3UI3A 1ROEA 2W3RA 2LFNA 5T8IA 2RDHA 2ICEC 3KF8A 2W54A 4ZK9B 2V4DA 2AWNA 1FFUA 2WQYB 4KKUA 5CV4A 5C0XJ 1FMAD 1A70A 5T1GA 2WXJA 3VR5A 1P7EA 3A8KE 2D9UA 5E1FA 3J7AV 1YNNC 1BBXC 2W3SA 1QNUA 2L12A 4A3EB 1EWYC 2F0PA 3AEBB 1PZKD 1K50A 3BIID 5E3FA 4ZAIA 4REZA 3LWUA 3S9WA 2JYOA 5JJZA 1Q8IA 2X6GA 2L0CA 3NWSA 3CRKC 1HTLD 2K5QA 1CQFA 1KAAA 1TWAB 5HG2A 4ZKCB 3KWVA 1MD2D 1X3PA 3BVMA 1PTOB 4CKCA 4DNRB 1SYCA 1TQOA 1ICWA 2OT2A 4G4KA 2D62A 2K5WA 1GUOA 1EIGA 4OL7A 1A15A 4M0WA 3WDNA 2HDEA 1YNJC 3SR1A 1D6EC 5ELEA 4CKBA 1DYQA 3OIQA 4DF7A 3GTJB 3HG9A 2PTLA 4FYDA 4A55A 2PNRC 5JPNC 2JXTA 2V3PA 2MJDA 4ARIA 4CQNA 3GTMB 5CV7A 4M1UB 4FXDA 4RGTA 3UI2A 5EBDA 2MGSA 1QB5D 1SMYC 4C80A 3AB9A 1B4OA 4PV1C 5AUKA 4JX1C 2WINB 2B2WC 3BK2A 4ZHOA 1JB3A 1YNTE 3PO3B 1G291 3M85A 2V3NA 2JE6I 4LK1C 1QILA 4KX6B 3PIO3 1EYCA 1I4QA 1U9RA 2HDLA 4HSVA 3MXNA 4ZKBB 1DOXA 3KBXA 1NYRA 3OHXC 3Q24A 4YSXB 1B1ZA 1EZ6A 3SDZA 2NVQB 5G5GA 1BCPB 3K0YA 1A3UA 3GV6A 1SB3C 3T3NA 3BWUD 5EE1A 4IZ8A 4K6LA 4FF1A 3KWLA 3IL8A 2L1BA 1PMRA 1L0XB 5DNFA 1GJXA 1ZPSA 3OIPA 5C0XH 4O1NA 4RKLA 5C3XA 4DN4M 1JWUD 4WRDA 5ELDA 3Q8FA 4K14A 1DOMA 4XDXA 3J80L 2JA8B 3V96A 3TSSA 2WXFA 1Q12A 1CI3M 1EY6A 1GB1A 2EJMA 3J9CA 4B9XA 1PGBA 4NDXA 2EELA 1ZYRD 2MEKA 1NUCA 2VUMB 3ZQ4A 2M0AA 5ELCA 1RKNA 2NN6G 3P63A 4RNAA 1D1KA 1RODA 3FDTA 1K8MA 4QB4A 3TZDA 1L6UA 1N5WA 1WSPA 1STHA 2K5DA 5ELBA 3KLRA 3IT4B 2VB3X 3FILA 3I91A 1I4HA 5EE9A 4HCEA 2TSSA 5CYUA 2R93B 2ACZB 2F0JA 3I73A 2I46A 1BDOA 2E74C 2ID0A 3SFDB 3AEEB 2BE5D 1BF4A 3HVDA 3S1RB 4XQNA 2FINB 3N52A 4MM3B 3A54A 3SVMA 3B2GA 3IAM1 3RD4A 2LY7A 2B2WA 3MC0B 5C4HA 1AZQA 1HZ6A 3DWPA 1JWAD 1XXGA 4A6QA 3ZJVA 2M19A 1LT5D 3K5NA 4G7ZC 3P75A 5J39A 2JYEA 3OWEB 3HUIA 2EYFA 1LTRD 3VYRA 3O13A 4I7ZC 3LB8C 1TU2B 5LHY1 1TIID 4BBRB 2Q8IB 4CHTB 5FK9C 4US8A 5G3LF 1T5EA 3V05A 2F0IA 1L4DB 2N7JA 1YNND 3EROA 2WXRA 1KTKA 4K8IA 3TP7A 2XN9C 4IUUA 2BT6A 5C0XI 1NEKB 1VZ7A 2Y5PA 1IYVA 3C46A 3NQIA 2WDVB 3W3AA 3A8IE 2QSDA 2W55A 1A3VA 1ET9A 1PDQA 2F3WA 2F0VA 1DZ1A 1ZEQX 2B2YC 4AYBB 1I3QB 4DK0A 3IAYA 3EJIA 3I4LA 2X6LA 2QEJC 1YNJD 2MUYA 3DXJC 1CT1D 1II3A 1QF6A 1PZID 1PGXA 4USAA 1Z47A 2LFIA 5C2TB 2BA0A 5CV9A 4RF1A 1QOBA 1MI0A 2IPKD 3HOYB 4HTHA 3GV3A 2FE8A 1SMYD 4YIJA 3I4NB 3RPFC 4YXDB 1S5BD 1SAPA 1NR4A 3BVGA 2A6HD 3WOFA 5H8YE 1A2UA 1ENAA 1CA5A 1D4BA 5BMHA 1QOAA 4RWSC 5G3LD 5C3JB 3VQIA 1D2BA 1ZP0B 3ABVB 5EPJA 3KLSX 3I9V1 1WYGA 2XRQD 1JQYD 4E6IA 5E6JA 1KNAA 2JP1A 2RVLA 3I4MB 4A3IB 2EKIA 1EWHA 3W9CB 1QKZA 2GB1A 1OQRA 4EE2A 4JE3B 1QQRA 2MHVA 3M7NA 2WXNA 3VYUA 2LUMA 3SK8A 1VCIA 3C8YA 3ZJUA 1HTPA 2RSOA 4DA2A 2K03A 4L2YA 2BDNA 1LTID 2MJ8A 2XSCA 2PPBC 3ERQA 4IUVA 2NVTB 2R92B 3I8ZA 1LT3D 3W5VB 1EEID 2J7ZA 3J81L 2AX5A 4QMGA 1JC7A 3NP8A 4LMQD 1YN3A 1E7PB 3E5SA 1C76A 1FEHA 3IFDA 2J53A 1BR9A 3ETRA 1SNOA 5IT9L 3S1NB 1K52A 1IKMA 1IGCA 2B2YA 1UWXA 4JWUC 2A68C 3OPOA 3NWTA 4CJ2C 4NZLB 4K8JA 4K5WA 5JPMC 5M5WB 3HKZB 1SNMA 1RHPA 3CRLC 1VR9A 3N6RA 5CGKA 4GLSC 1Y1WB 1JQ4A 2BS2B 1T3QA 5BN5A 5EE3A 3S1QB 2GRIA 2K3UA 1LO5D 4YSZB 4XWTA 2LHEA 4DNTB 4LAAA 1LT4D 4K6DA 3FILB 1SIJA 1BNZA 2NZ1D 4KY5A 1GUWA 3GTGB 1U4RA 5EKIA 1I7HA 1WTOA 3ZJTA 1SJED 3HVZA 1EY9A 2Z4IA 5IGFA 3CQZB 1TYGB 1E10A 2NMQA 4Q2JA 1XCQL 2L1AA 2F0MA 3NUCA 2BTEA 4BY7B 1Y8PB 1RD9D 1N61A 5JEAH 1YN5A 2DYOA 5BYQA 2PMZB 3H3VC 1EU4A 4KKJA 3MXGA 3E0JA 2NYZD 2AQ1B 1RJTA 3AE2B 1IYUA 5IGEA 3AEGB 1RDPD 1T5XD 3TP8A 1FD7D 2F0LA 2ONQA 2FJ2A 5BYSA 5K36G 2EYLA 4DK1A 2V4IB 4RHSA 3LXFA 4WQMA 4F87A 4RCNA 3AU7A 4OW0A 2PCFB 1B9RA 2R6GA 4C3JB 1F2RC 4XXEA 2DY7A 5FR3A 4HMJA 3Q69A 4OZBA 1NCVA 4DU9A 3W1SA 2ON8A 5I4DA 5EQ0A 4NP5A 3AMUA 4L1BA 1N63A 5M3MB 1SE4A 2B39A 2MH7A 1C4AA 4P2CB 2RDGA 1XX8A 4HSPA 4H0LC 2EY1A 3AM9A 1SYFA 3L4PA 4KKSA 2QKIC 4C3JG 1EIHA 1ILPA 1ONLA 2ZXRA 2HCCA 4YT0B 2WLBA 3MJ5A 2WB1B 1E2VA 1S5DD 4EQNA 3NBHA 1HHVA 5IIFA 1FYCA 3PUYA 1YN4A 1LV9A 2V0GA