3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like Protein
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
1SE3A 1T5XD 3BZDB 1L0XB 1UUPA 3V05A 2J4XA 1PTOF 1LT6D 3URYA 3BVMA 5D3IB 1CT1D 4RCOA 1RD9D 2R61A 1PRTD 1D5MC 1GOZA 3R8BA 1JWMD 2RDGA 4L63B 1ESFA 1KLUD 1SE4A 1JR0D 3KLSX 1EEFD 2G9HD 1ET9A 1EFID 2CHBD 1ENFA 1LT4D 1PRTB 4BWGB 1STEA 5FKAC 1UNSA 5ELEA 1RF2D 1BCPD 4RHRA 1LTID 3DWAA 5D3DA 1FGBD 2WV6D 4K6LA 1TY2A 1CHQD 1LTBD 3OWEB 4L6TB 1LO5D 2ICIA 2SEBD 1XTCD 1LTGD 4DXFA 1S5ED 1D6EC 1L0YB 1S5CD 1I4GA 1BCPB 3EFXD 4OHJA 1LTSD 1PTOH 1V1OA 1FNUA 3W2DA 1YN3A 1FNWA 1RCVD 4NZLB 1RDPD 2IJ0A 4RHSA 1S5FD 1TS5A 1CQVA 3CHBD 1I4RA 3BYTB 1SEBD 1YN4A 4ZYSA 1SJED 1EEID 1PTOD 4Z9CB 1G8ZD 1AN8A 1V1PB 1PRTC 3O13A 1TS3A 1FD7D 1DJRD 1SXTA 3TSSA 4RGNA 5I4DA 2QEJC 1F77A 1BCPF 1I4QA 1B1ZA 1HXYD 1JQYD 2AQ2B 2AQ1B 1EWCA 4RGOS 1TY0A 5ELBA 1S5BD 1PTOB 1KLGD 2NTTA 1PZKD 1PZJD 3GP7A 5ELDA 1S5DD 4O1NA 1HTLD 2XNAC 1BCPC 4RH6A 4DXGA 1SBBB 3R2IA 4C56C 1I4HA 1PZID 1I4PA 3SEBA 1PRTF 2NTSA 1YN5A 4TSSA 1D5ZC 4RGTA 3EA6A 1LTTD 1LTAD 1KTKA 3BVZA 5TSSA 3MC0B 1ET6A 1BXTA 1D5XC 2Z8LA 1LT5D 2IPKD 1MD2D 1DYQA 1I4XA 1CK1A 1CHPD 2QILA 1AW7A 2O2LD 3MFGA 1EU4A 1JWUD 5FK9C 2RDHA 1TS2A 2XN9C 5ELFA 1TS4A 5ELCA 3BYYB 3R2TA 2XRSD 1EU3A 3DWQA 1PTOC 1JCKB 1HA5A 1SE2A 1SJHD 4RGMA 1B44D 1JWSD 1LTRD 4RFBA 1LT3D 3DWPA 1XXGA 4UDUC 1QILA 1LLRD 1V1PA 1PYWD 2AQ3B 2TSSA 2XRQD 3BVGA 1M4VA 1HQRD 1FNVA
chains in the Genus database with same CATH superfamily
1C1YB 4GSWA 2FINB 1JB7A 3HOWH 4X65Q 1L0XB 1SE8A 2EY1A 2EYMA 1MSHA 4LFAQ 4A3JG 1WX8A 2N1WA 3RD4A 3URYA 1NAPA 2R92G 2LVOA 3ZNZB 2RSNA 4ASWC 4E3CA 1WTVA 4FHJA 5BMGA 4NPNA 4P6VF 5IYBG 3DQVA 3V96A 1BO0A 5MPOA 3CCJA 2OXPA 2BYEA 2MJEA 3TRZA 1WYGA 3MHZA 5IT9c 1EEFD 4OIKA 5GAHC 4A3CG 3D8GA 1NMFA 3A1QB 1LT4D 4AH6A 2K39A 1DOIA 4ULLA 1P9DU 3K81C 3I3TB 2D3CA 1VQAA 2PJHA 4QL5A 2MBOA 3VUYA 3Q3JA 5HKHA 1TY2A 1Y1VH 3H0GB 1GJXA 5JZEB 3NBIA 5LMUQ 2OTLA 2RD0A 1WMHB 1OTCA 4B3TQ 4K2LA 2IO1B 4XWTA 2BS4B 4FF3A 1ISNA 1WTOA 5LMNL 3CQZH 4US8A 2HUGA 1X3QA 2IJ0A 5M3FB 3IG3A 1CMXB 4R1JA 1WYDA 4DV5L 5L95C 3AE8B 1ENAA 3T1HQ 2B63G 1HZBA 3SK4A 1ML0D 1MHWC 4FF1A 1Y56A 2JSVX 4OWTB 3RN9C 2CJOA 2LHDA 1XPUA 1PDXA 3DEOA 4JVZA 1DJRD 3OTOQ 3NVVA 1TZOA 1X32A 1FCCC 2HIVA 4CYEA 2UUBL 1CQFA 1LTLA 4H44C 2ON8A 4XGAB 5JXVA 3S24A 2NUCA 5ELDA 1PZJD 1MPEA 2GN5A 4A3DB 3T1YQ 3RYTA 4YIJA 4DKAC 1S40A 2JY6A 1K51A 2JA9A 4J1MA 4KZ0A 3APCA 4NNJB 2L76A 3HRZC 2MO0A 5T1IA 2KANA 2JA5G 4RF1A 2GOWA 3Q8FA 2ZM6Q 3MP9A 2L1AA 2N9KA 1N9WA 4RGTA 2HE7A 1CKNA 3MXNB 5LXHA 2FJ2A 1YQ3B 3TCAA 4DR2L 2J0MA 4TKNA 5M9OA 3RUIB 3S1NB 2F0KA 3AYHB 1NDDA 3HZXA 2K9XA 5FO9B 4KHVA 5BYRA 4MM3B 4K8IA 4YWLA 3SGIA 1VQ9A 2VB3X 3PMFA 2PMZB 1S72A 2DY7A 1H9RA 3SK6A 1JQ4A 3FVQA 4ODGA 3M4YA 3L16A 2YYZA 2XRSD 3HEJA 4JI3L 5C23A 4HKQA 4DR4L 4ANUA 3FAHA 4EVOA 3HP3A 4KKIA 3MEFA 5M3FH 4DR6Q 4UDUC 2LXCA 3GOEA 1O7IA 1V9JA 2F0OA 2MEKA 2R2OA 3TJPA 5EKLA 2K6AA 3I91A 2GLSA 5CHWA 2QHOA 2EDGA 2Q2IA 3RLOA 1YOVB 4B3SL 2NVYB 3BZDB 4QUFA 3CCUA 4NJCA 3VTUA 4IG7B 4LDTB 1PH1A 1LM0A 4FXKC 4YCVA 1PTOF 4DU9A 3A5UA 1LGRA 4B08A 5C4XG 4CDEC 3HOUB 3TP7A 3AB9A 5IP7G 1LV9A 3ZXRA 1K8OA 3SHQA 5HY6A 5BR8Q 1IW7D 4LF4Q 4A3DH 2ZJRA 2R92B 1NI2A 3PQIA 2ZEQA 1UEBA 5H92C 1F2YA 3N20C 4JI4Q 3AN1A 4OIJA 3L08A 1XPOA 1EYGA 2CFMA 3FRPB 3J81L 4DV0L 1BBWA 1HPCA 4YWGG 3V6CB 2MP2B 4P72A 4N9PA 4HEA1 4PG3A 2VQFQ 3MVVA 1BBXC 3S1NH 4XDCA 4M02A 1CHQD 4RKLA 4JW0A 4CDCC 2IYDB 2BE5D 3RLFA 1VRAB 1VMCA 2RHQB 4NJ7A 2GVBA 2NVQB 1LM8B 4WWPA 1VQ4A 3QHTA 1YEZA 4EEWA 3H7PA 1EY5A 4BOZB 3C46A 4ZKCB 2Y5CA 3I2ZA 3PHXB 2Q2HA 2GRIA 2KCTA 1LTSD 3Q6BA 4WJPA 2EYFA 1JJ2A 1NMGA 5JJIA 2L83A 4MGKE 2MBBB 2J0JA 4JI1L 3RULA 1RDPD 1UEAB 1QOBA 2LVQA 1EWYC 4HPMB 1P7EA 5C2TB 4KN4C 1V86A 1VQMA 3WAPA 4N6EB 4XTCS 4A6QA 3TZDA 5EJWA 4A3IG 1IBMQ 1WD0A 2V1CC 1HTOA 4Z9CB 3A4SC 3I5JC 3WAOA 1SXTA 5F2DA 2PI2E 3UI2A 1Q81C 4BY1B 2B63B 5K36H 4R4OA 1JMLA 4EFOA 1MGSA 3NQTA 4CKCA 1OXSC 2L0TA 2XIWA 4ACFA 1WYWB 3N1YC 2Z4IA 4LFBQ 3SVMA 2B3GA 1SSNA 3D3RA 3HOUH 3OW7A 2BBCA 1U5KA 2IGDA 3A54A 1K9MC 1K83B 4KY5A 2NYZD 2ZT9C 4RH6A 2R2QA 2EVBA 1PZID 3J80c 4Q0FA 5FOBB 4USAA 4DHJD 3NVZA 5HFYA 2NTSA 2WDRB 3G4SA 4PYUA 4R9WA 1ILQA 1E5WA 5IGGA 3DHGC 3K5LA 3Q8AA 4IM2A 1D5XC 3KUZA 4FA6A 2KENA 1STNA 1J7BA 2ZTDA 3U4EG 2BH2A 3KFUA 1H9KA 2K50A 4IFDH 2JXTA 2CH4W 2PMVA 2M8SA 1HFNA 2NVQH 1PH6A 2GI9A 2NCNA 2P5ZX 5FK9C 1TS2A 4E74A 1Z47A 4IFDI 3KYCD 4BKSD 3AU5A 2X69A 1QVGA 4LTUA 1RJTA 2PPHA 2K5VA 2WACA 2EXZA 4A3EG 1R7SA 1SLJA 3KW5B 4GN5A 4BXXG 4W9GA 5E6OA 1AE3A 4MGIE 5EGTA 1M4VA 3QQ8B 4W9CA 1B3AA 4CJ1B 1UH6A 3DVNU 2JJQA 1E10A 2KXJA 4AOFA 1CZWA 3OWFA 2WXNA 4JI5Q 2O6VB 1EO6A 2LXKA 3PLVA 1NE3A 2KX3A 3SFEB 2KOLA 1PQSA 2L7RA 4JI8L 1JWBD 1M1KC 1ZGUB 2WB1B 2WXOA 3ZRFA 2WIIB 3E9SA 1K83H 2B2VA 2OT2A 3HKSA 4KD4A 1MI2A 1B2TA 1B9RA 3G7LA 2EE1A 3TEXA 1FIQA 4ZKBB 3ZLZA 2QDLA 4Q2JA 4WJNA 4H02A 4YCWA 5ELEA 1X55A 1KXLA 4IKGA 2XK5A 3LJ3A 3PZDA 2C5LC 3PREA 4OVUA 3ITPA 3E0EA 4B9XA 5IGDA 2WXPA 1U4MA 4AJYB 1LO5D 2ICIA 3PLUA 1N61A 5IN7A 1XTCD 4JK1C 4N9TA 1JB3A 3PUXA 1WXVA 3UE1A 1A5RA 4B9WA 5HURA 3A9JB 1A3UA 1VD2A 2WXQA 5HI1A 3TMPB 4C3HG 1NYQA 2K6DB 4ZOHC 3A7LA 2M00A 2C7MB 1ZOYB 1Y8OB 2C60A 3HKZB 2EMSA 4P2CB 3S14B 1KHIA 1WVLA 1BNZA 3M95A 4BZAA 2CW0C 2VW9A 4YXDB 1WI5A 4P75A 2KJRA 3EBEA 1RAXA 2JVCA 5C44B 2FCMA 1GVPA 1SJED 1PH9A 3UINB 4CQNA 4EUTA 2NZOA 3AECB 4KDLB 3O13A 5L83A 3M3JA 3GTPB 4CJ0B 3OLMD 5I4DA 4OZBA 4JCVE 4GDLB 4R8IA 3U50C 2C7NB 2XBBC 5LMUL 2AQ1B 1D8LA 4JIOU 4II3B 2BCOA 2MCNB 2K1BA 1HZ5A 1EUVB 4AUQC 1EZ8A 2M9VA 3A1QA 5CV6A 4GOCA 4G50A 3B9JA 1C7YA 4CHKA 2N4FA 4KDIC 3TEWA 2M56B 2NS5A 1PV4A 2UYZB 2V4IB 1KTKA 1HZ9A 2K32A 1W3SA 4HROA 4OGQC 3KYHC 4DV7Q 1BUIC 2V4DA 2VNUD 1J19A 5DNFA 2IPKD 2WXRA 3AE4B 1IZ6A 1VMPA 2K33A 2UU9Q 1MG8A 2CW0D 1WMHA 3JAML 1KRSA 2WAQE 3SK8A 1HCZA 3AE2B 2JU6X 4A3BG 2QMTA 2B2YC 2H89B 2N3SA 2XEWA 2XTIA 3KBXA 1A62A 3S15B 1JCKB 2LVPA 1XCQL 1FCLA 1PH3A 1XNQQ 2OJWA 1X3GA 4J6IA 2VZKB 3GTJB 1NY4A 1LLRD 2WKDA 3VDYA 3RD2A 4YSYB 1E7PB 1XF5L 2N55A 4G7HC 5C44H 2KUMA 4A3EB 4X3SA 3S16B 1KC8C 4C1NI 4KVGB 4MSMB 4P74A 4B95A 2N7DA 4X66Q 3S9WA 3I4NG 1LT6D 4XYOA 2ID0A 2LXJA 4IFDJ 2D11A 1OXUA 2KLCA 3VQIA 3WDNA 4DXAB 2JA6G 1WTXA 4Y52H 2GBNA 1XCTL 4A8XC 1FXAA 2IGHA 4CGYB 2UXDL 2E2JB 1L5PA 2R93G 1ACCA 1STGA 3MXNA 4DAMA 3H3VI 4HCEA 3KUDB 5IYDH 2E2IH 3TQYA 1MKHA 1S3OA 5CV7A 3QK0A 4A3PA 1IGCA 1A8VA 1WJJA 5C4HA 3BU2A 3GE3C 2DZMA 2JZPA 3L54A 3BDCA 4MM3A 1Y1WH 1EOVA 3I3CA 4F88A 1WE7A 3D4WA 2EMTA 2LGYA 1BDOA 4PV1C 2K6QA 1PH8A 4NXNQ 1LTGD 4HJ8A 4KSKC 2N8NA 1A70A 5DEHA 3ZQ4A 1D1IA 3W3AA 1EFWA 3A8IE 1JALA 4LWCA 2DNCA 4KHPQ 1T0YA 3VYUA 2NR2A 1ZYRC 3CSFA 4KK7A 4DK1A 4JV5Q 2WXJA 3ZUNA 5EAYA 1TS5A 4OW0A 1UWMA 2N9LA 3CHBD 1I4RA 5D6JB 2W3SA 4S0RA 1OXVA 2OCEA 3OHXC 1DOMA 4QIWB 1DOXA 3K9PB 3ERSX 4IZ8A 1AZPA 3I73A 4P1CC 2F0GA 3S16H 3QG1A 2L4NA 1CKNB 4RGNA 1JICA 1FYCA 4KY6A 1BCPF 4DHZB 1VR9A 2K28A 2JRHA 3ZDMC 3AU7A 1RWSA 3LWEA 2QIEB 1RLFA 4JE3B 2K1FA 5A2QE 1ZKHA 4PS7A 3CCEA 4K81A 1STAA 4XYQA 3JSVA 3D6WA 2NN6H 4LAAA 5EKIA 4HR7B 1U4LA 5C3EB 2QEXA 4IOAA 2MP2A 2QDBA 4R4TA 2LMCB 3KDFB 1VQDA 3MTNB 1DOKA 3WOEA 1WJUA 2NN6I 1WGGA 1IP9A 1SFOH 2A6EC 1N63A 1VQCA 4HSVA 4A3KG 4LF7L 3U52E 3W1SA 3KJOA 4QF4A 1ZYRD 1XYIA 1LUZA 3H9DA 1N33Q 3AMZA 4KGTA 3V60A 3S2DB 1RIPA 2K7VA 1IXRA 4DR5L 2A68D 4YY3Q 3V62A 2NVXH 4LFBL 4HDOA 1VQGA 1SSOA 1R4PB 3KLRA 4N59A 2A6HD 1QZEA 3H91A 1SJHD 2KN5A 1B44D 1LTRD 3S2AA 4C2MB 2CQAA 3C19A 3G71A 2JSOA 3Q2AC 4US9A 1PGAA 3QR8A 2EYLA 4ZRIA 3RNAC 1PYWD 5CX3A 3OIQA 5LMNW 4CBVA 2JA8B 3DBHB 2V3SA 5LHY1 1HFGA 3VR6A 1PYSB 3NVYA 1L1OA 1STHA 2PTLA 3KH0A 3K7AH 5JJZA 2QDFA 4O2DA 4KJOA 1PH5A 4JI2L 2VL6A 3NEMA 1WTQA 4YT0B 2CKHB 1QVCA 3OW2A 3HG9A 4OL7A 3T3OA 3HOZB 2A6ED 1UE1A 3CC7A 4WQOB 1CT1D 4X64Q 1FO4A 1A3TA 1RYJA 1M94A 5G3LD 3Q3OC 1GOZA 1ZXHA 3PGZA 3KUCB 4C7ZA 4DV4L 1IGDA 1NYRA 2MUYA 2IY1B 2NWGA 2LUEA 4BBNF 4X62L 5C3EH 3BINA 3Q3FA 4FXGC 4HRSA 1PUTA 5C1ZA 1FRDA 3UQBA 5M5XB 2BS2B 1V8QA 2LASA 2R93B 1XJVA 1HHVA 5LXIB 2FNJB 3S1QH 4HIOA 5IYCG 1WJ4A 1KLVA 1BCPD 1CKMA 1F52A 1YHBA 3AV8A 4GN1A 4A3FG 1LXDA 3NY5A 3RNGC 2OQ0A 3GZNB 1SYBA 1FJGQ 5M3MB 3PIP3 3S2DH 4DV2L 1HA6A 3MHSD 3DBRI 1QNKA 4DXFA 2LJ5A 2LGSA 4JWSC 4JI5L 3VYSA 1HR0Q 2BDOA 2CWPA 4A3LH 5KRUA 1GJZA 2MJ3A 1SE9A 2NVTB 1X3FA 1TBEA 3DHHC 3IAYA 3HRDD 3UI3A 2UXCQ 3WALA 3MHBA 2Q2TA 3PUZA 4BY7H 5FR6A 2BGFA 2N9XA 3ERQA 1B7YB 5JEAH 4LFCQ 1ZPSA 1D1KA 2K25A 4DWFA 3PO3H 1CZGA 3UDFA 2JA8H 4A3MG 2INCC 2QA4A 4HCNB 1Q8KA 4TQ0A 5C4JH 1DCZA 3HIZA 2WXGA 1K28A 3CF6E 2E5LL 3SXHA 1F77A 2JZZA 1VQBA 5H1SE 5IP9H 1UGJA 4PYZA 4JQWC 2Q8RE 1NR4A 1VQ5A 3HOZH 3QAQA 1JQYD 2EYPA 4DFAA 3WAMA 1MI0A 1UGMA 3A56A 4KLKA 2AL3A 4POFA 4HIKA 4Y7NB 2IT1A 3F2CA 2R7ZG 1NVID 4GU2A 1NR2A 3I70A 4LW1A 3H6MA 2PQEA 5CV5A 5FLMH 5E4WC 1CZPA 2ZW1A 4X57B 4U68A 1K52A 4C56C 1YBYA 2ZXPA 4PMCA 1C79A 2JPHA 2KFKB 3GTQB 3SK5A 1I94L 3T13A 1KM7A 1YN5A 4DV1L 2K5DA 1D5ZC 5M5XH 2D5DA 1F2RC 2IO0B 3QC8B 4MACA 1WY8A 1ZEQX 3RUZA 2EY5A 2GBKA 2HQLA 3KOJA 3PHWB 3M9BA 3LX0A 3AE7B 2IX0A 3A9JA 4NKLA 1D7QA 5M3MH 2ASQA 4J3OD 1WCMB 1GM5A 2KMMA 1PFNA 1KABA 4JI7L 3G48A 4K7WA 1JOOA 1Q8IA 1AARA 2YU9B 5IWAQ 4A93G 2V1YA 2NVTH 4NW2A 1JWSD 2K01A 3N6RA 2N9PC 3IAS1 2UXBQ 4II2B 3B2FA 1V97A 2WFWA 4L23A 4TUUA 2X6GA 3SR6A 1QOFA 4EZJA 1ZXIA 4DN4M 5CGKA 1R9TB 2LRUA 4IWPA 4NQLB 1E0BA 1DXMA 5D7GA 4GDKA 4FHKA 2LS01 2B2YA 1F2RI 4DV7L 3ONAB 1E7ZA 4K2KA 2E6XA 3DVGY 4W9EA 5BYSA 1WGDA 4C1NK 4HDQA 2IWHA 1ZUD2 3K5NA 3H8HA 2B2WA 5FR3A 3ZGZA 4JG2A 2XK5B 3ZDTA 3NTIA 4K3BA 2ONQA 2OEOA 1PRTD 3RR5A 1EY6A 1OO9B 1KRHA 4NXMQ 1WRDB 5CTRC 4AWJA 4C4VB 2MO1A 1LYLA 1EQVA 3HHMA 4YWKA 2EJMA 1ASYA 1XLQA 2RPQA 2BQQA 1JR0D 2FE8A 3MFYA 5CBEE 4LF9L 3GTQH 3P20A 2GBJA 2HDLA 2KCNA 4WJOA 4ANXA 4C3IB 1WTRA 4GZYC 1RL2A 1STEA 4AS1A 1F9RA 2B2VC 4KI0A 1GAQB 3P7JA 1K8RB 2YTXA 1DGJA 1H9MA 3ETRA 4UP7A 2MLBA 2NZ1D 3H94A 4MNOA 1WCMH 2VUMG 3QB3A 4R8NA 1K53A 1S5CD 1B4OA 2UUAQ 1TYGB 2N7EA 3C8YA 2HT1A 4A3GB 1B70B 1FNUA 5D65A 1MHXA 2PMZE 2BTEA 5EPLA 1SMYC 5GAEC 4DK5A 2L32A 4LNFA 4B3MQ 2K5HA 3A7AB 1S5FD 4BKTA 3MAQA 4B3RL 3H15A 2O4XA 3PF5A 3J81i 3S17B 1R9TH 1EOTA 1UBQA 3AXCA 4B9KA 1EYCA 4QUCA 4XWWA 2KZRA 3ICEA 4DR3L 4N9F4 4M01A 4WWOA 3CRKC 2MFIA 1ZDVA 4F8CB 2WXFA 2EY6A 1B9MA 2UUCL 3AI5A 2QEJC 5IGEA 1EY0A 4XDXA 4OZCA 2F0IA 2WXLA 4CKEA 4UP9A 1V49A 4JI0Q 2G4DB 4AQYL 1S5BD 4EQ5A 2IX1A 1A2UA 2R7FA 2NTTA 1SIJA 2CQOA 5DAUA 2JQOA 4WWNA 1KOTA 1NSNS 1EIFA 2HD3A 1SRUA 2HDEA 4UAIA 4GN4B 1V1QA 1VQ7A 2KDFB 4WAAA 2F0TA 4TSSA 4EOYA 1E1OA 5JEAJ 2RMMA 4C3IH 3K5OA 1F9JA 1Q5WB 3AEDB 3WCQA 3DVNV 3PZ8A 1WTHA 1SMYD 4LF8Q 1TT5B 1ET6A 1NTGA 2D0OA 2K04A 2PQAB 4IUPA 1TKYA 1EYAA 1MD2D 2I5LX 4PMBA 1KH0A 2JX5A 2BH8A 2E76C 4LK0M 5CV4A 3CC4A 2Y0SB 3D6CA 4AYBB 3I4MB 1WXQA 2FIFA 3I56A 1YIWA 3PCOB 1BVSA 1QQRA 5C0XH 1LACA 2AHOB 1Y69U 3PGEA 3STBC 3BS1A 4JPSA 2C5CA 4IUNA 3NXWA 1FM0D 5ELCA 1KRTA 4IN3A 3DWMA 4NAMA 3SR1A 5C0XI 5NUCA 5DLQE 4A3GH 1EIHA 2C35B 3I72A 3HOYB 5I6YA 1E7UA 3RFZB 1AWDA 1PFBA 2I5HA 3NWSA 1E8YA 1YJIA 2KQSA 2MBEA 1JT8A 4XYCA 4ARCA 2B8GA 5IE8A 4KKTA 1C76A 1VZ8A 3AEEB 2AX5A 3S17H 2LFIA 3FP9A 2BT6A 4OVVA 4DBGA 2BDNA 4H0LC 1DGSA 1WJ6A 2FUHB 2F0VA 4BA2I 4MELA 3UQAA 1WXMA 1BUVT 1I50B 3U4ZA 3NTHA 3BDLA 1FPYA 1YX6B 2VXWA 1N33L 4FXDA 4CDDC 3H0GH 2BB6A 3TS0A 3QOLA 5EE0A 2QW7A 2F0PA 1L6VA 3TEYA 1HNZQ 2B2UA 2MBHA 4OZAA 4ZLTF 4ARIA 3U9SA 3HFZB 3R8BA 2VQEL 2EQSA 3KDFA 2LMCA 2WXKA 3CAMA 5JOBA 3WA0A 5M5YB 2G4SA 1VQFA 2N78A 2HCIA 2K14A 3BWUD 3Q3MC 1RKNA 4DV3Q 2WP9B 1FXIA 1SNOA 4W9FA 2M1MA 5JVG3 3T4AC 4RMFA 5FLXL 1FGBD 1P98A 2BVCA 5IT9E 3H09A 1QOHA 1SN8A 2HTHA 3QX1A 3I4MH 4ANVA 3MXPA 4MZ9A 1DONA 4H2AA 3W5OA 1K8MA 2X6LA 3M62B 1NBWA 3QOJA 2KEDA 4A3JB 1O7YA 1LFDA 3V6EB 1FL0A 2L0FA 2NPTA 2F4IA 3L0WB 1N36Q 2LEKA 4A9AA 1GUOA 3HOYH 2W82A 4A4IA 4RM8A 1ZW7A 4DR1L 3CCRA 3M3YB 2DZIA 2K8HA 4K7SA 4XDDA 2BA0A 1ILPA 2M19A 3JSVB 4BBNC 2REXA 3IAM1 1SR3A 1T0QC 2K22A 2BYVE 2ICEC 4HJ5A 3DDCB 4ZHOA 1T0RC 2ZCBA 4LCDE 2XVSA 1VCIA 3NHEB 2SDFA 1L4ZB 1H4RA 1G6PA 3B6YA 4L2YA 2KMAA 4NAWA 4LF6Q 3CXCA 4RGOS 1EWCA 3EJIA 1H9SB 4W9JA 4WJ4A 1PTOB 1KLGD 5CMDA 3QCAA 5E6PA 3LGJA 4B0MA 3OYYA 4DR7L 1DD2A 2KA7A 2CR5A 4XQQA 3ZJTA 4OO1H 2JXMB 4LUZA 1HNXL 3N32A 2J0TD 2BOSA 2QGQA 3PUWA 1RHPA 1I6HB 4Q5VA 1VQKA 1FEHA 1MG4A 3K0XA 4RKBA 4OWWB 1IHZA 2MJ8A 1NI3A 1P7FA 3HUIA 4KKJA 4EE2A 4URKA 4OO1I 1EF1A 5CYUA 2K52A 2JWZA 5EPKA 3E5SA 5TSSA 2JYEA 3GE8C 1B3QA 4FLHA 4GKKQ 2JT4B 1TJEA 3Q23A 3FPPA 2PLPA 5FJ8H 2NVYH 1HTQA 5I6WA 3GTLB 4EGVA 2FMCA 1GUNA 1L1OB 5EBCA 3PO2G 1RFAA 4MGZE 1VZ7A 1GNUA 2FXQA 3NHHA 3W1SC 1F9QA 2JEBI 2RDHA 2F0UA 5JJKA 2W55A 4A3JH 4REZA 4LNOA 4YTPB 3FMCA 5E7NA 4OXPA 1QT9A 1PTOC 2PE9A 1Q0WB 3RNFC 2I2YA 2R92H 5BMIA 1WIAA 4LDTD 4LMQD 3ENEA 3DXJC 2ZTEA 1KAAA 1VDVA 1XMQL 1YNJC 2EYJA 3OMGA 5IYBH 4GKJQ 2ZVOA 3BY4B 3NVWA 2WLBA 1XX8A 2OJRA 3PIPA 3BVGA 1HQRD 2JA5B 3VHTC 3HKZE 3NJTA 3HOVG 4AP4C 1WTWA 2KJ6A 4HPPA 1YITA 3EIVA 4A3CH 3UF8A 4JC0A 3V05A 4LF5L 4POGA 4DNRB 3VAWA 1VCBA 4MSQB 3JAMi 3NG0A 2PO4A 5C0XJ 4K0KL 2IL8A 2QCPX 2WHIA 1UE7A 3KF8A 3IFTA 3CKIB 2N49A 5E4XA 2TMPA 1A0IA 3F2DA 3P63A 1N5WA 1L1OC 2KFKA 2PZWA 2PZTA 1XMOL 1G291 1SYEA 5AJ3L 2LI5A 2O2VA 3EFUA 4RAUC 2K3UA 4LJOB 1SYFA 4A90A 1XT9B 4ICUA 3KLSX 3ULLA 2X8XX 2B3AA 4JLCA 4DV6Q 1IBKQ 1I6HH 3CMEA 1N32L 1KQSA 2D3GA 1CKOA 1KNEA 1D3ZA 4IOIE 4WRDA 3U9OA 5GADC 2KACA 2BF8B 3RZFA 4ME3A 5BN3A 1E8XA 3FILB 4W9KA 3VVWB 1D4BA 4RNAA 3EC8A 4FVMA 1XNRQ 1BR9A 1J5EL 2OOBB 4ID6A 2C7HA 4BY1H 4RF0A 2B63H 3OAWA 4LNNA 4KY7A 2D3BA 2RPVA 4OX9Q 1NNXA 2KNBA 3J9CA 3CCLA 4ITKA 1L0YB 3GB1A 1G6JA 3CC2A 3APDA 4NB3A 5C4XB 3C1FA 4HVBA 1QUQA 3R3MA 2F3WA 1H8CA 3J7AV 3EUB2 1VQ8A 3EHVA 3N30A 5IO9A 3PSIA 3S1RB 2N0SB 3RNUA 4GOPB 1Y8RC 3E9HA 2MRPA 2RDFA 1QF6A 1EEID 2DZKA 2F4VL 4K14A 1GXDC 1SB3C 3D32A 2JA5H 3ZNHB 4JI6Q 2RF4A 1SIFA 5E1FA 5CV8A 2AEHA 1S1QB 4IURA 4IUVA 3RNCC 3VDZA 4X65L 2ACZB 2HD5B 4FYDA 1NCVA 3VA5A 4LFAL 2F1MA 5G55A 3K7UC 1VQPA 4C4VA 2DJGC 4QJFA 1OQYA 5IIFA 2ZNVB 1V2YA 2KHSA 1B8AA 1EY7A 2UUAL 2LSSA 2MQHA 1HTLD 3NBHA 2M4NA 1IYJB 2ZJQA 3ML8A 3P4QB 3OIPA 2D62A 4GLAC 3ND9A 3NOBA 3ZTCA 3RT3B 3BJUA 1EUJA 2A69C 4UPAA 3DUZA 2EZVA 2RVLA 3CIRB 4I7AA 1EF5A 4GOPC 3QJYA 1H9JA 3L0OA 3BK2A 3J80E 4A3IB 2F0HA 4GDKB 3JYUA 5KYLA 2D3AA 4N8X1 2Y5PA 1SDFA 1IBLQ 1D2BA 1V80A 2KKCA 1TWFB 2AWNA 3ZO5B 3MXUA 3EN2A 2O5IC 1C0AA 1E0ZA 1V8CA 2L8JA 3N1XC 3B1LX 1FGUA 1VQJA 1C4CA 3DOWA 3PO2B 3NPPA 4B3TL 4M1UB 5JJLA 5C4XH 1SE2A 3F2BA 3J7YW 2ZNVC 2IGGA 2YLMA 5IP7H 1SNQA 5FLXc 1PH7A 3DWPA 2WAQG 4GIVA 2KYWA 1WD1A 3R93A 2O6VD 1C48A 5KEEA 3VFKA 3DHQA 3NP8A 1GD7A 3T1HL 4UHVA 4C3JG 4XT3B 1YHQA 4LF8L 2HTME 3FEWX 2W54A 2KX0A 4XZ4A 1OEYA 3VRAB 4K5VA 4M8AA 4FN2A 4QIWE 4YHHQ 3OTOL 1X3PA 1F2MA 3I9V1 3Q8DA 3GO5A 2V9HA 4PT5A 1TWCB 3M4QA 3J81c 4DUYQ 1OFFA 2JA7G 3T1YL 2Z6KA 2B2WC 2M0AA 1Y14B 1ET9A 5J18A 2XWBB 3AE3B 3QJZA 2OF1A 4FF2A 4M00A 3DM3A 2PQAA 1YJ1A 2ENBA 3S14H 4LLGM 4CO7A 3KUPA 2ZM6L 2VY3A 3Q8BA 4IWOA 1RF2D 2DYMA 2Z59B 1HNWQ 2SAKA 3TDQA 2FMMA 4PNYA 1K3BC 2Z0EB 3IT6B 4KGRA 2KCCA 2PCFB 4LJZC 1IYUA 1Q90A 1Z6HA 2JP1A 4L6TB 4WJWA 3RN5A 1VQLA 4JYAQ 4GS3A 3GTPH 4A3IH 3O65B 2DHZA 3CD6A 2D0PA 4DAYA 1G6ZA 1TWFH 1YZ6A 2HHHQ 4ZRQA 2JXXA 1Q1BA 1Q46A 1BF4A 4MT5A 3TBIB 1HNZL 3DHIC 3ZNID 3DPDA 4ZCKA 4NZLB 2ZPYA 2L0CA 3LB8C 4HKZE 2D2QA 3MZ5A 2L9HA 2N88A 2WDTB 4CDFC 3QA8A 4FBJB 2AL6A 2WP8J 2LGXA 4YSZB 4FJVB 5J17A 3PIO3 5IOCA 2PZUA 2H5XA 4I7ZC 2UU7A 1L2FA 4ZYSA 4DR6L 1F2ZA 3I8ZA 1WM3A 1YN4A 2PVOD 3P1MA 1CTMA 1BT0A 1V1PB 3K59A 1HEZE 1PHJA 2ES2A 1P8LA 2A74C 2KTFA 3NSWA 4KKUA 4IPHA 3L10B 3MJWA 2KFJA 2LUMA 3ZKJC 1YNXA 2QC8A 2VZAA 4X3KA 5AUIA 3AE5B 2MA9B 2RQXA 4KJNA 3E0JA 1V81A 1EYDA 2LD9A 4KKSA 4JBKA 2UWQA 5BR8L 1GUTA 4DXGA 2KCMA 4MTNA 1KAWA 3HOXG 4LF4L 2INDC 3S15H 2BKFA 4HAEA 3SEBA 5IKCM 3LDZE 5G3LF 1SYDA 4C3HB 3PS6A 2D07B 4M0WB 4JI4L 1OGWA 1WX9A 4ZUJA 1TWGB 3GTJH 3UDXA 1SGHA 1FFVA 2KVMA 4PQXA 5T8IA 4KMUC 4XXEA 4A3EH 1A63A 4YCUA 3PRMB 4CHTB 3DLLA 1I4XA 2F52A 1STBA 2K05A 3VR4A 2VQFL 2CHXA 2IY0B 3DBSA 1PFMA 4DNIA 2Q5WD 4ZRPA 5ISRA 2VZKD 2G3QB 1J7CA 2XWJB 4BBRG 1C78A 4LF6L 3RZWC 5KGUA 4GXBA 4A75A 5KNBA 1G91A 5LMNQ 1N8RC 1YI2A 4NP5A 1EU3A 3TL5A 1YNNC 4GNXA 2WU5B 4DV5Q 4S3SA 1IUEA 1Q82C 2E2JH 3N9YC 2KQ7A 1QILA 2WWZA 3IHPC 2VH2A 1XLPA 4OONA 2EPBA 1AH9A 1U0LA 2WAQB 2Q8TA 2J7ZA 3J81E 1CA5A 1WE6A 2HJ8A 1L2NA 5C4ZA 3LXFA 1IBML 2ZTCA 1E2ZA 5DPSA 1I6VC 1H9SA 2E75C 2UUBQ 2J4XA 2RGFA 2RSUA 2KT7A 4WORA 1EZ6A 3AFPA 2IX3A 1WZ3A 2VRRB 5EE1A 1HZCA 2KDEB 1E8WA 2A5HA 1J7AA 3IXSA 1JWAD 4BBSG 2E74C 3D4DA 4L63B 4A55A 3FKIG 3SFDB 1QOGA 3A55A 2YTVA 4V190 2A8VA 4A3BB 2CHZA 3X23A 3H7SA 4BKSA 3VH4B 3F1ZA 1L4DB 4CKBA 3HOWG 2NPTB 2LKVA 4IALA 2B2UC 4DR2Q 1M8AA 4C3HH 2JA7B 1SAPA 3EVQA 4H13C 4TKOB 1EY9A 3OJ4B 1TWGH 1V9PA 2WINB 1VQOA 5DPRA 1N34Q 2DAJA 3U30A 1WI0A 3MC8A 3N1ZC 1LTID 1YHAA 3CW2C 5T1GA 2R6GA 1PYBA 5L37A 2Z0SA 3D0FA 3IRBA 2Z0DB 2D2CC 1E7VA 4F1SA 2G9DA 3AB5A 1JORA 1JOKA 1YIJA 1DOYA 5TR5A 2WKCA 4JI3Q 1GC7A 2KWVB 3FHWA 4DR4Q 2N9EB 4JBMA 3J81j 3I4NB 2KTRB 1II3A 4OHJA 1V1OA 1Y8PB 3T56B 5E6NA 2WDVB 4NAWB 3T9LA 5JVH3 3GS2A 2D5GA 1MHHE 3L9AX 2JA6B 4IUMB 4XC2A 1T0SC 1ZP0B 1Y1VG 5CBAE 4RM9A 1XD3B 1YQBA 3L13A 4AIMA 2PIAA 4QAYA 3I4OA 5GAGC 1BQQT 1WZ0A 2RDBC 2VB2X 5M5WB 2EKEC 5BN4A 4QB4A 1FXTB 1FD7D 3P4SB 4JBJA 1PA6A 2GVAA 1C4AA 1L7YA 1E22A 1CSQA 2MQJA 1QB5D 2F0FA 1KDAA 4IPCA 4P16A 5KNDA 2E2DC 1IPGA 1XEEA 3ZIMA 2KC2A 4OX9L 2WX1A 1Z2MA 2MX2A 5J1ZA 1PZKD 1G51A 1KDCA 2J53A 4HMIA 3VUXA 3B08A 1KF6B 1I35A 1ESRA 1SBBB 3R2IA 1I4PA 1K8GA 4DV0Q 4A3BH 1PRTF 1Q10A 2JF5A 4KIKA 5IODA 4ZYNA 3FILA 4C2MH 2I1KA 3VUWA 4B0EA 2F3VA 1X9NA 5BO4B 3JAMc 1GUAB 1Q12A 2MWSB 4W9LA 1KFYB 3KLSA 4A20A 1VJKA 1IL2A 3RLNA 4FF4A 2DX5B 2PYKA 2RR9A 3FKYA 2QILA 2O2LD 3DBHI 1HH2P 2BPSA 5C3XA 1GC6A 1ENCA 1PVOA 4RA8A 3NUCA 1SF0A 3PUYA 5EDSA 4G57A 4HIDA 4JI1Q 1GO3E 4L5QA 3MTSA 3DWQA 3I90A 1DZ1A 4BBRB 1TVXA 2G45B 4JWUC 3ND8A 5D2MB 3KF8B 4GOPA 1XO3A 4JGHB 2JA6H 4IO9A 1XPRA 4WIPA 5C3JB 2O2VB 1N5XA 4TVAB 1G2SA 3ZYYX 3HM6X 2R93H 4K7UA 3NUHB 4HJGE 1VQIA 1T5XD 4NDXA 1E3PA 2EYOA 2Z6BA 5J39A 1FRRA 4HXDA 3APFA 4I6LB 3PUVA 1ICWA 5E6JA 1B9NA 4A3KB 3HGBA 5CV9A 1VZ6A 1X65A 1RD9D 1IBLL 1E24A 5M3FG 1MVKA 2KMCA 3GZNI 3RNEC 2YEPF 5IA7A 2K0PA 2PI2A 2A5UA 3H1UA 3L7ZC 2V3PA 1EQRA 1KLUD 4IW0A 1R4QB 1OXTA 3K80C 2AUKA 5C5MA 4YTNB 2G9HD 4EZKA 1ONLA 4L1BA 3WIMA 4PZ7A 3A0JA 5LNK1 1QUQB 4LK1C 1F1HA 5GROA 4DPGA 2I5MX 1UNSA 4XX5A 3AEVA 4PZ6A 2NVUI 4IOCA 1YX5B 5DPTA 2V4LA 1FFUA 3QO2A 3E6ZX 2K5WA 3OWEB 4I6NB 1TKEA 2BWES 4A3DG 3F2UA 2CCZA 3IBEA 2PW9A 2UU9L 3DWGC 1IBXB 3NZUA 2DY8A 2KVRA 4LNQA 3MJ5A 2SOBA 1QWYA 3EFXD 1NENB 4AYBE 4GLXA 1PFSA 1KNAA 5DM73 2DYBA 3OOCA 3VR2A 2IDYA 2OEDA 1RCVD 2HQEA 4Y7NH 4IDIA 4FJYA 2RCFA 5IGBA 2WU2B 3VXWA 2F0JA 2ZCCA 1CJEA 1E9MA 2KDMA 2EYHA 2IO3B 4CJ2C 3NBHB 3J7AF 1SEBD 2WDQB 1OXXK 4J8QA 1XNQL 1WWTA 5CHVC 4ZDVA 4K6DA 1M90C 1ZXTA 4HJAA 3AEGB 2CHWA 3QWZB 2B39A 1TS3A 2WXIA 4I6PA 2JZ3B 4A3KH 5JHAA 3VH3B 1SNPA 1I4QA 4X66L 4LNKA 3NE5B 4A3FB 4JI8Q 1TY0A 3JAME 4FDBA 1J6QA 4L5SA 1A15A 4O1NA 5GXGB 2YU9H 3FDTA 3GQBA 4D2KA 3A5ZB 3W5UB 1VQNA 5K36G 1GB4A 3PRZA 3KK7A 3AEBB 3NZ3A 3VTWA 2KJXA 5J22A 3T8MA 3BVZA 3DMUA 2O5JC 3HOUG 1GUWA 3QWNA 4PS3A 3JW0X 4W9DA 4KGSA 4LJPB 2L1BA 5C3WA 4MN3A 1UWVA 4TQUS 4A3MB 1NUCA 1RM6C 2NMQA 4RCNA 2WGSA 3C3LA 3EQLC 2LJIA 1JWUD 5G5GA 2KO3A 1MSGA 4NXNL 1HUMA 4IC7B 2EELA 3L2PA 3BYYB 3J7A5 1P3QU 4HWIB 5DM63 5IP4D 1QE6A 3P4RB 1HA5A 4RGMA 3GTGB 5HGTA 2F03A 1IYFA 4TMAB 3ZTDA 4R4QA 4KHPL 2EJGC 1XXGA 4GLSC 2R7ZB 5KHOA 4DDGD 1AE2A 1V1PA 2MSED 3M7NA 4JV5L 3VYRA 1PXUA 3JVZX 4IPGA 1WGKA 4HN7A 4IFDG 3L17A 3NELA 4ZUIA 2J0KA 1FNVA 2IY5B 3ABVB 2IHEA 4HJ9A 4GGQA 4LNIA 2H88B 3BVMA 5IYCH 3S1MB 2LXAA 2Z4HA 4XT1B 3B0AA 4BOSC 2KECA 4KTAA 4G4KA 4A3FH 3SU8X 1EQQA 4G11A 1SNDA 1U4PA 2JYOA 3W1BA 5IGFA 3UDIA 1ESFA 3PIOA 1S3SG 2F0SA 2Q2UA 4M0WA 4MIUA 4DAYB 4HCSA 3ALBA 4DK3C 1PH2A 2EY2A 2ZXOA 3TS2A 3Q14C 3G6JB 4BY1G 4O0AA 4A93B 3Q8EA 5G5HA 1UAPA 1GPXA 1I3QB 4BWGB 5FKAC 4H7BA 2L3ZA 1A2TA 1VF5C 4TRDA 4F87A 2LHEA 3W9CB 1CFMA 5D3DA 1OQRA 2Z6KC 4APVA 2IW3A 4DAPA 2BB5A 4A3MH 2WX0A 2DENB 3Q69A 2B2TA 4GB9A 5J2RA 4YY3L 2CVRA 3A8JE 3V2TA 1V5TA 2K75A 1FNWA 1XTDA 4DA2A 3M4OB 1KDBA 4DUZQ 3AQQA 3GTGH 1MJDA 5C5LA 2L15A 1AYFA 1WSPA 1YJNA 3PO0A 3STBD 3MA2B 5EE3A 1J0GA 2R7ZH 2YVCA 2XSCA 1UELA 4WQMA 4F7ZA 4ZK9B 2W9NA 1EWIA 5IY0A 1G8ZD 5D94A 5LL6X 1YMHE 4DAVA 1N34L 3HM3A 3TSSA 1IW7C 1WGYA 3TREA 2WS3B 3KYDD 3UGBB 3T16A 3VRBB 1SNCA 1L0WA 4KZCA 1TIFA 2DAFA 3C1EA 3CSTA 3S1MH 3LWUA 2KQ3A 2UXDQ 3GP7A 4DK6C 4IM3A 5FO8B 4X64L 2C9WB 2F0DA 3PPAA 1K73C 4EQPA 3OG5A 4BKGA 1O80A 5ELOA 4R4IA 2Q8IB 1VQ6A 2VUMB 1N60A 1I4HA 2MPMA 2PVGC 1GKHA 1V6EA 2GBRA 2MJDA 2L00B 3Q24A 1YJWA 1TKWB 3PF4A 5JAVA 2BE5C 4GNXB 1LTTD 2GB1A 3L4PA 3RN2A 4A93H 3AE6B 1I3QH 4YWMA 3FPUB 4ZQ3A 4PMWA 4ILWA 2KN4A 1Z9FA 1JMCA 1LT5D 3KWLA 2LY7A 1CM9A 2LFNA 2H1EA 5JH5C 2RA4A 2OTJA 1ZKOA 5IOIA 4DHJB 1I50H 3U7DA 3GV3A 4J15A 1SROA 3KF6B 2WB1G 1WM2A 1XLOA 2KTRA 3U7ZA 2L12A 5A2QL 3NQIA 1FJGL 2JQRB 1EU4A 1JJCB 4BS9A 4IUUA 5I2XA 3UIOB 3TIXA 1T9HA 2GA4B 2I0QA 2WNMA 1KIXA 3CMAA 1EWHA 5FO7B 1WTPA 4K5WA 1HR0L 5AZHA 3M4OH 4E6IA 1LQBA 3BIID 1ZDXA 5M5YH 5KHQA 2UXCL 2AQ3B 4MJSA 4HSPA 3H6NA 2WB1E 2HIXA 3PV0A 4K3CA 4LFCL 1T3QA 2ZPNA 4L5TA 4GNXC 1K8AC 1F2LA 1EM7A 2G1EA 4GN3B 5EQ0A 3CCMA 2ZJDA 3EECA 1E8ZA 2IBIB 1SYCA 2E3TA 2MGSA 2NBFA 3A9KA 5AUKA 2L11A 2MW5A 3PT2B 3TZUA 1F9SA 1U9RA 1EY4A 3I7FA 2K5QA 1QVFA 3FC4A 1J8CA 4PZ8A 3HKZG 3KWVA 1C77A 2KVZA 1P16A 1JWMD 2RDGA 1ROEA 2FAZA 1K3RA 4EX5A 4NJ6A 4QY7A 5C44G 2VUMH 1WRIA 5CHFA 3GTKB 5AFWA 2KHIA 2SNSA 3LNNA 3Q22A 3K5MA 2CHBD 2NBWB 4LF7Q 3M3YH 4EQOA 1QCBD 2FUG1 1WF9A 4RHRA 3DWAA 2F0EA 4BA1I 4DR5Q 1PH4A 1R4MB 4G3XB 1TTNA 2EIFA 1TWAB 3JC66 1YQ4B 3M63B 3RZDB 1TGZB 2EJFC 3R7RA 3KLWA 2JRIB 1J8IA 3ZJVA 3E56A 1I4GA 5IYDG 1WXAA 3OPOA 1QZHA 4C80A 1JOQA 3MXGA 1PTOH 4FADA 1AEXA 3W2DA 4DNTB 5JPNC 2DZJA 4YTMB 1UE5A 1FMAD 3A4RA 3TUOA 2X38A 4WWMA 4HK2A 4IWQA 5IWAL 4WFN3 1Y1WG 2DNFA 4ZRJA 2UXBL 3K58A 4BAXA 1X6OA 1CI3M 2AKWB 1EIYB 2KWCA 1PTOD 4JI2Q 1JRPA 2NBVB 1AN8A 4KIKB 3SDZA 2DUDA 1SNMA 2PW7A 1VDZA 2Y3AA 3X0WA 2C9OA 1YNJD 1MJEA 4R3DA 3MC9A 3GTLH 1HXYD 1TU2B 5ELBA 2L05A 1B53A 3P1HA 4DV4Q 1OEYJ 3NRZA 4OWXB 4KHZA 4X62Q 2XNAC 3GTOB 1L0VB 3ZW3A 2PE6B 4NXML 1XLNA 3RI7C 3GTKH 2KDIA 3J7ZC 2KC1A 2J52A 1JW9D 1UD7A 1W6JA 1WFYA 1IL8A 3U4VA 3MC0B 2DWQA 3AH7A 3P4PB 3A8KE 2ZVNA 2QJLA 2F0NA 4DV2Q 4RG1A 1IBXA 1JC7A 3KBGA 1I5FA 2INNE 4JOIA 1X1MA 1TWAH 1A3VA 4HLEA 3RZDH 1IYVA 2NN6G 3MFGA 1R4MI 4WAFA 2INPE 2XN9C 5ELFA 2M0XA 3WWVA 4V0BA 3A74A 1Q1EA 3CCVA 1E1TA 3PRPB 1MIUA 3R66C 4RMAA 3RNBC 2F3IA 3ZXVA 2DBYA 1B50A 2ATWA 1Z7TA 3T53B 2QCZA 4K5XA 4P71A 4IJLA 3ZVVA 2XGTA 1HUNA 4B3ML 2BW2A 1PMRA 3IL8A 1KJTA 2BS3B 1OTRB 4WJ3M 2E5LQ 1HQMC 2FCQA 4FJZA 1VQHA 1OQQA 5H8YE 4DDID 3D4RA 2HJ1A 5D3IB 3W1GA 1V5OA 2KEEA 2ASBA 1UE6A 2BKRB 1C4QA 1LABA 3GDEA 4JI0L 3ZNGC 1WH3A 4IQZA 2JN4A 2QF7A 2K8CA 4MH8A 1I94Q 3GTOH 1C9FA 4DV1Q 3CMMB 3I55A 1K50A 4WURA 4XE0A 3E3XA 5JPMC 5DCNA 1EFID 3S1RH 2YTYA 3LYYA 5GMVA 3RZOB 3QIJA 3VR8B 1AFPA 4ALPA 3PTFC 4EKUA 3ONSA 3W1YA 2M2LA 2JEAI 2EXDA 2MBQA 2V3NA 2H4OA 4FULA 2WV6D 3X3NA 4AJWA 1LTBD 1X3EA 4K8JA 2LRWA 3HVDA 4C00A 4N8FA 1E90A 2A69D 5AZGA 4JI7Q 4I65A 3HOVB 5I9OA 3K6OA 5C3EG 3C2PA 2I46A 2FCSA 3CWIA 4F7XA 1Z5SB 2OQKA 4DHZE 1E6EB 2J42A 2F0MA 2AUJD 1TIID 2E2IB 1QJOA 1AP0A 1QKZA 2ZW0A 1NBFC 3VYTA 2B76B 3AE9B 1RTOA 4HIMA 1QZGA 2SNMA 4J6HA 2KAJA 5AEKB 4NMZA 3NS8A 1YVCA 3K9OB 1Y1WB 5D14A 5KNCA 2MHJA 5EPJA 1RRBA 1HTPA 4JX1C 1STYA 4HJKA 3P42A 3R7QA 3TP8A 3IT4B 4A3LG 1WR1A 1PGXA 1Y8NB 5E3FA 2KHWB 4IUQA 5DPWA 4DF7A 2ZXRA 3S2HB 4G7OC 3K57A 4BY7G 1WJNA 3BDOA 1S5DD 4W9IA 1E2VA 2A73B 2DYOA 5JEAG 3H3VC 2DGYA 2NZHA 2CU1A 2KDBA 2Z9HA 1C3TA 4LF9Q 1E2WA 3K8AA 3Q6SA 4O42A 2JA8G 3PO3G 3PO2H 4AQ7A 4MTKA 5ELNA 2ZJPA 4DUZL 3RMHA 2IHFA 3BZCA 2PNRC 1YJJA 3PV1A 1ZE3D 3RZOH 5IP9G 1C4PA 4M8MA 4N58A 3HOZG 4KV6A 4DV3L 2I38A 3AFQA 1Q86C 3T3NA 5HGQA 2Z8LA 2M17A 2WYQA 3F8TA 3Q8CA 1CK1A 2PKOA 4P73A 1FR3A 3BZKA 5FLMG 4MEMA 5EKKA 1QG7A 4LUOA 3VR5A 1CA6A 2L5TA 2R3ZA 3HOVH 2KHJA 3CPFA 2D9UA 3NTKA 1T5EA 2DN8A 3H3VH 1QNUA 3CF5A 4ZHPA 4X6AH 3HK0A 3DBLB 1TWCH 1UZXB 4B6WA 2DJFC 4DK0A 4B3RQ 1Q1OA 1YJ9A 1N36L 4F8MA 4ABNA 4W9HA 1MBYA 1TWHB 5A35A 1IKMA 5K5PA 1SFOB 1F0ZA 4MGYE 2L55A 2XRQD 4DR3Q 1HZAA 2K4KA 5M3MG 1VLBA 4JL9A 4A76A 1KD1C 2DLBA 3CU7A 2MNAA 2UUCQ 2KWDA 4C7YA 1JROA 1GHJA 2K5NA 1K0RA 1BOSA 4XQJA 1PFDA 5FLXE 2PPBC 4BXXH 4AQYQ 2NVXB 2RKSA 3I57A 4OELB 3K0YA 5KIXA 2E2HB 4K1RB 1TXYA 1I42A 2GMIC 5I2YA 2N1VA 1D5MC 3S2HH 4NQKE 4FP5D 5J3BA 1ASZA 1JRUA 4BVUC 2L52A 2FFKB 4NPSA 2A68C 1S4ZA 3ER0A 4NY0A 5BMHA 1V43A 3SDLC 1TZ1A 3K7AB 3EROA 1UWXA 3CCSA 1WFQA 3KF6A 4QQBX 1WR6E 3EFCA 1T6BX 1K0SA 1BBUA 1G2TA 5KYIA 4GKKL 2A6HC 3UE0A 1XQQA 4TQ1A 3RCZA 2SEBD 4HCPB 3IFDA 3MWYW 2F0QA 2FHTA 3CP0A 3N3KB 1S5ED 4C3JB 1D6EC 3U8ZA 2AWOA 1BCPB 2Y5BB 3ULPA 4P1BC 5JHBA 1EY8A 2CKZB 2PW5A 1YN3A 1Q7YC 3PVLA 3UIPB 2A1AA 1TQOA 4HTHA 2K5PA 3Q0AA 3VA7A 4X3TA 2B2TC 3WOFA 3V61A 3I4LA 1H95A 1CQVA 4IJHA 1TWHH 3S1QB 2QSDA 3DBLI 4XQNA 4IUTA 3G6EA 4ICVA 3VR9B 4GKJL 3DBRB 1YNND 3OSOA 5BN5A 3KQ4A 1WCMG 5IT9L 3CCQA 4KN7C 4DQOC 1FD6A 1PDQA 4HEDA 1GB1A 4HMJA 2WXMA 1Q3LA 1XWEA 3MEHA 2I07B 2AQ2B 3R3OA 4FO2A 3HS0C 2VQEQ 1KL9A 2FBWB 3AEFB 3GD7A 1F9PA 2E2HH 4HPLB 2KOXA 2OHFA 4PS8A 3TMEA 1I7HA 4E71A 2G5DA 1BCPC 2CH4A 4DGZA 5LLIA 1U4AA 4BY7B 4S17A 1O7LA 2JUOA 1J9OA 3SHLA 3PO3B 2MP1A 1UF0A 3EA6A 2GBMA 4DV6L 1IBKL 1A6XA 2ALYB 3TP5A 4GMVA 5C4JB 3SE0A 4B3SQ 2KK8A 4G0NB 4YL8A 2VH1A 1O78A 1GUGA 4MJSB 2B29A 4RWSC 2D10A 1BMLC 1DYQA 3P2BA 4WJQA 3VR3A 3C0RB 4ZRZA 1CHPD 1XNRL 1NEKB 1WXSA 2LWPA 1N6ZA 4LUVA 1NJIC 1L6UA 3AULA 2JE6I 4C3JH 2K03A 3DEPA 3NENA 2JK8A 3A9KB 2FCNA 2IZVB 1TS4A 5AZFA 1TR5A 1WGHA 2NBUA 3AMUA 5GQOA 4C3IG 3H7PB 3RMKC 4DR1Q 3AU4A 2QKIC 4RFBA 4PK1A 3U58A 4OEMB 3KVFB 4MH0E 1C9OA 2CWAA 3PSEB 2TSSA 3UDGA 1BKBA 2VS1A 4JBWA 3HOXB 2JA7H 3TP6A 2OWOA 3I63C 2JWUA 3QIAA 4UP8A 5C0XG 4EZLA 3J80i 5LL6S 5HHDG 1SE3A 3BK1A 1TKGA 4QMGA 4U673 1UUPA 3TBLD 2E8GA 2NB0A 1N62A 2BA1A 2KWUB 4JI6L 2MHVA 4X3UA 4A3GG 2LGDA 1SYGA 2YV5A 2KBNA 2ZZPB 3M4PA 2EOTA 2F0WA 1RFKA 4RCOA 1VQEA 4DR7Q 3DVGX 3BG3A 2R61A 2PEAA 3B2GA 1WGRA 4OVZA 1HNXQ 2W3RA 1CUKA 4MDKE 5I9PA 3I4NH 2AMCB 1SE4A 3M7GA 1ICFB 2EKIA 2KD0A 1GG3A 1AZQA 1IKLA 2R7DA 3M85A 4BFRA 2KQ4X 3X3MA 1HE8A 3Q3NC 2RHSB 4ZRKA 3RPFC 1ENFA 3OMCA 3ZJUA 1PRTB 3H0GG 5EE9A 2CS4A 1X54A 2F0LA 3A33B 1VF7A 2O6VA 3QARA 3SD5A 4QGUA 3HVZA 1HRJA 5M5WH 2RSOA 4K6LA 3W5VB 1C8CA 1WOCA 5CR3A 3NK9A 1X56A 1U4RA 2RCNA 4R4CA 1GHKA 1FVIA 1QOAA 3NWTA 4FNFA 3L3OC 3N52A 1P0RA 4M8NA 3TEZA 5BYQA 3AE1B 2HDMA 4ME5A 3CPWA 2I1JA 2K8BA 3IVFA 5IAAC 1R4NB 1P1AA 2N7JA 1O7ZA 1EQTA 4FXCA 3CRLC 1XMQQ 5HG2A 4RHSA 1SMXA 5CC4A 4GLVB 4IPDA 3V3XA 3U2SC 4BBSB 3BYTB 3DCGA 2J7QB 3FKIB 3GTMB 2IO2B 2WXHA 2PNHA 2Y0SG 4AYBG 1HR0W 3HOXH 3I4MG 3ML9A 3NZSA 4LF5Q 1PRTC 5EBDA 3HOWB 2CU3A 2JYTA 2A19A 4K0KQ 3P75A 3HOYG 2AYOB 1B1ZA 1YNTE 4XIGS 4YHHL 1W6KA 3TEHB 1XMOQ 3E9IA 3NS1A 1PLFA 3D31A 5AJ3Q 2RBMA 4KD3A 2Y0SE 3T51B 2KLGA 2V0GA 1JE5A 2BYTA 1VS0A 3AEAB 4L5RC 2YEPB 4DUYL 4BBRH 1N32Q 1PGBA 2BYFA 1HJPA 1RTNA 2A4ZA 2Z1CA 3TN2A 4KSLC 1EIGA 4G7ZC 1WX7A 1LTAD 5C6AA 1DOLA 4L8JA 4P7IA 4KX6B 1J5EQ 4GDLA 4WH4A 3IKJA 3ZRCA 1BXTA 3EGRA 4KV2A 5G2NA 1JE4A 1Y1VB 3VTVA 1HNWL 2B8FA 1JJGA 4ANWA 1TT2A 3WANA 1AW7A 3GV6A 4MHEA 3ULJA 3ZJYC 4JYAL 4OO1G 2KJHB 2LGIA 1MJCA 2DNEA 3AM9A 4TV3A 2BWFA 2FIDA 5COYA 3KJPA 3IFWB 3R2TA 2HHHL 3ECIA 1DM0B 4UY8C 1YD8U 3CQZB 3OJ3A 4JOIC 4EQNA 1QLBB 2AWTA 4YSXB 2MH7A 3DM1A 1MFWA 2CJNA 2WQYB 1W2BA 4HJ7A 1LT3D 2LZ6A 2HCCA 4IM0A 4A3OA 1EL0A 4QCLA 1R4NI 5IGCA 1CSPA 4BBSH 5FJ8G 1GUSA 2F4VQ 3FKIH 1HZ6A 3PZ7A 5CORA 3GTMH 1RODA 1UBIA 3J80L 4JPBW 4ZAIA
chains in the Genus database with same CATH topology
2FINB 1L0XB 2EY1A 2EYMA 1MSHA 3RD4A 3URYA 1NAPA 2RSNA 1WTVA 5BMGA 4P6VF 3V96A 1BO0A 5MPOA 2OXPA 2MJEA 1WYGA 3MHZA 1EEFD 4OIKA 3D8GA 1LT4D 1DOIA 4ULLA 1TY2A 3H0GB 1GJXA 3NBIA 4K2LA 4XWTA 2BS4B 4FF3A 1WTOA 4US8A 2HUGA 1X3QA 2IJ0A 5M3FB 3AE8B 1ENAA 1Y56A 3SK4A 1ML0D 4FF1A 2JSVX 2CJOA 2LHDA 1PDXA 3DEOA 3NVVA 1DJRD 1TZOA 1X32A 1FCCC 1CQFA 4H44C 2ON8A 5JXVA 2NUCA 5ELDA 1PZJD 1MPEA 4A3DB 4YIJA 1K51A 4J1MA 3HRZC 5T1IA 4RF1A 3Q8FA 3MP9A 2L1AA 2N9KA 4RGTA 2FJ2A 1YQ3B 5M9OA 3S1NB 2F0KA 3HZXA 2K9XA 5FO9B 4KHVA 5BYRA 4MM3B 4K8IA 2VB3X 3PMFA 2PMZB 2DY7A 1H9RA 3SK6A 1JQ4A 3FVQA 4ODGA 3M4YA 2YYZA 2XRSD 3HEJA 4HKQA 3FAHA 4EVOA 3HP3A 4KKIA 4UDUC 2MEKA 2F0OA 5EKLA 2K6AA 3I91A 2EDGA 2NVYB 3BZDB 4QUFA 4NJCA 4FXKC 1PTOF 4DU9A 4B08A 3HOUB 3TP7A 3AB9A 1LV9A 1K8OA 1IW7D 2R92B 5H92C 1F2YA 3AN1A 4OIJA 3J81L 3FRPB 1HPCA 4YWGG 4N9PA 4HEA1 3MVVA 1BBXC 4XDCA 1CHQD 4RKLA 2BE5D 3RLFA 1VRAB 1VMCA 2NVQB 1EY5A 3C46A 4ZKCB 2Y5CA 2GRIA 1LTSD 2EYFA 2L83A 1RDPD 1UEAB 1QOBA 5C2TB 1EWYC 1P7EA 4KN4C 4N6EB 4XTCS 4A6QA 3TZDA 5EJWA 1WD0A 4Z9CB 1SXTA 5F2DA 3UI2A 4BY1B 2B63B 5K36H 1JMLA 1MGSA 3NQTA 4CKCA 1OXSC 2XIWA 2Z4IA 3SVMA 1SSNA 3D3RA 3OW7A 2BBCA 2IGDA 3A54A 1K83B 4KY5A 2NYZD 2ZT9C 4RH6A 2EVBA 1PZID 4Q0FA 5FOBB 4USAA 5HFYA 3NVZA 2NTSA 2WDRB 4R9WA 1ILQA 5IGGA 3K5LA 3Q8AA 1D5XC 1STNA 1J7BA 1H9KA 4IFDH 2JXTA 2PMVA 1HFNA 2GI9A 5FK9C 1TS2A 1Z47A 4IFDI 2X69A 4LTUA 1RJTA 2WACA 2EXZA 1R7SA 5EGTA 1M4VA 1B3AA 4CJ1B 1E10A 1CZWA 3OWFA 2WXNA 3SFEB 2KOLA 1JWBD 2WB1B 2WXOA 2WIIB 3E9SA 2B2VA 2OT2A 4KD4A 1MI2A 1B2TA 1B9RA 3G7LA 2EE1A 3TEXA 1FIQA 4ZKBB 4Q2JA 5ELEA 4IKGA 3ITPA 4B9XA 5IGDA 2WXPA 1U4MA 1LO5D 2ICIA 1N61A 1XTCD 4JK1C 4N9TA 1JB3A 3PUXA 4B9WA 5HURA 1A3UA 2WXQA 5HI1A 4C3HG 1NYQA 4ZOHC 3A7LA 2M00A 1ZOYB 1Y8OB 3HKZB 4P2CB 3S14B 1WVLA 1BNZA 2CW0C 4YXDB 5C44B 1SJED 3AECB 3O13A 3GTPB 4CJ0B 5I4DA 4OZBA 4GDLB 4R8IA 2AQ1B 2BCOA 2K1BA 1HZ5A 1EZ8A 2M9VA 5CV6A 3B9JA 3TEWA 2M56B 2V4IB 4HROA 1KTKA 2K32A 4OGQC 1BUIC 2V4DA 2VNUD 5DNFA 2IPKD 2WXRA 3AE4B 1VMPA 2K33A 2CW0D 3JAML 3SK8A 1HCZA 3AE2B 2JU6X 2QMTA 2B2YC 2H89B 3KBXA 3S15B 1JCKB 1XCQL 1FCLA 2VZKB 3GTJB 1LLRD 2WKDA 4YSYB 1E7PB 1XF5L 2N55A 4G7HC 4A3EB 2KUMA 4X3SA 3S16B 4C1NI 3S9WA 1LT6D 4XYOA 2ID0A 4IFDJ 1OXUA 3VQIA 3WDNA 1WTXA 1XCTL 4A8XC 1FXAA 2IGHA 4CGYB 2E2JB 1L5PA 1ACCA 1STGA 3MXNA 4HCEA 5CV7A 1IGCA 5C4HA 2JZPA 3BDCA 3I3CA 4F88A 3D4WA 1BDOA 4PV1C 1LTGD 1A70A 5DEHA 3ZQ4A 1D1IA 3W3AA 3A8IE 1JALA 2DNCA 3VYUA 1ZYRC 4KK7A 4DK1A 2WXJA 1TS5A 4OW0A 1UWMA 2N9LA 3CHBD 1I4RA 2W3SA 1OXVA 3OHXC 1DOMA 4QIWB 1DOXA 4IZ8A 1AZPA 3I73A 2F0GA 3QG1A 2L4NA 4RGNA 1JICA 1FYCA 4KY6A 1BCPF 1VR9A 2K28A 3AU7A 1RWSA 3LWEA 2QIEB 4JE3B 5A2QE 1STAA 4XYQA 3D6WA 2NN6H 4LAAA 5EKIA 4HR7B 1U4LA 5C3EB 2QDBA 2LMCB 1DOKA 3WOEA 2NN6I 1N63A 2A6EC 4HSVA 3U52E 3W1SA 4QF4A 1ZYRD 1XYIA 3AMZA 4KGTA 3S2DB 2K7VA 2A68D 1SSOA 1R4PB 3KLRA 4N59A 2A6HD 3H91A 1SJHD 1B44D 1LTRD 4C2MB 2CQAA 2JSOA 4US9A 1PGAA 2EYLA 1PYWD 3OIQA 2JA8B 4CBVA 5LHY1 3VR6A 1HFGA 3NVYA 1STHA 2PTLA 5JJZA 4KJOA 1WTQA 4YT0B 3HG9A 4OL7A 3T3OA 3HOZB 2A6ED 1CT1D 1FO4A 1A3TA 1RYJA 5G3LD 1GOZA 1ZXHA 4C7ZA 1NYRA 1IGDA 2MUYA 2NWGA 4HRSA 4FXGC 1PUTA 1FRDA 5M5XB 2BS2B 1V8QA 2R93B 1HHVA 1BCPD 3AV8A 1SYBA 5M3MB 3PIP3 1HA6A 1QNKA 4DXFA 4JWSC 3VYSA 2BDOA 5KRUA 2MJ3A 2NVTB 3IAYA 3HRDD 3UI3A 3MHBA 3PUZA 3ERQA 5JEAH 1ZPSA 1D1KA 1CZGA 4TQ0A 1DCZA 2WXGA 3SXHA 1F77A 1UGJA 2Q8RE 1NR4A 1JQYD 2EYPA 4DFAA 1MI0A 3A56A 4Y7NB 2IT1A 1NVID 1NR2A 3I70A 3H6MA 2PQEA 5CV5A 2ZW1A 5E4WC 1CZPA 4U68A 1K52A 4C56C 2ZXPA 4PMCA 1C79A 3GTQB 3SK5A 3T13A 1YN5A 2K5DA 1D5ZC 2D5DA 1F2RC 4MACA 1ZEQX 3RUZA 2EY5A 3LX0A 3AE7B 2IX0A 4NKLA 4J3OD 1WCMB 2KMMA 1PFNA 1KABA 1JOOA 1Q8IA 2YU9B 4NW2A 1JWSD 2K01A 3N6RA 3IAS1 3B2FA 1V97A 3SR6A 4L23A 2X6GA 1QOFA 1ZXIA 4DN4M 5CGKA 1R9TB 1E0BA 1DXMA 5D7GA 2LS01 2B2YA 1F2RI 3ONAB 4K2KA 2E6XA 5BYSA 4C1NK 2IWHA 1ZUD2 3K5NA 3H8HA 2B2WA 5FR3A 3ZGZA 3NTIA 2ONQA 2OEOA 1PRTD 1KRHA 1EY6A 1OO9B 1EQVA 2EJMA 1XLQA 1JR0D 2FE8A 3MFYA 5CBEE 3P20A 2HDLA 2KCNA 4C3IB 1WTRA 4GZYC 1STEA 4AS1A 1F9RA 2B2VC 4KI0A 1GAQB 3P7JA 1DGJA 1H9MA 3ETRA 2NZ1D 3H94A 3QB3A 4R8NA 1K53A 1S5CD 1B4OA 1TYGB 3C8YA 4A3GB 1FNUA 5D65A 1MHXA 2BTEA 5EPLA 1SMYC 2L32A 3A7AB 1S5FD 3MAQA 2O4XA 3S17B 1EOTA 1EYCA 4QUCA 4XWWA 3CRKC 1ZDVA 2WXFA 2EY6A 1B9MA 5IGEA 2QEJC 1EY0A 4XDXA 4OZCA 2F0IA 2WXLA 4CKEA 1S5BD 2IX1A 1A2UA 2NTTA 1SIJA 5DAUA 1NSNS 2HDEA 4UAIA 2F0TA 4TSSA 5JEAJ 2RMMA 3K5OA 3AEDB 3WCQA 3PZ8A 1SMYD 1ET6A 2K04A 4IUPA 1TKYA 1EYAA 1MD2D 4PMBA 1KH0A 2JX5A 4LK0M 2E76C 5CV4A 1WXQA 2Y0SB 3D6CA 4AYBB 3I4MB 1QQRA 5C0XH 1LACA 1Y69U 4JPSA 3BS1A 2C5CA 4IUNA 3NXWA 1FM0D 5ELCA 3DWMA 4IN3A 4NAMA 3SR1A 5C0XI 5NUCA 1EIHA 3RFZB 3I72A 3HOYB 5I6YA 1AWDA 1PFBA 1YJIA 3NWSA 4ARCA 2B8GA 4KKTA 1C76A 1VZ8A 3AEEB 2AX5A 2LFIA 2BT6A 2BDNA 4H0LC 2F0VA 4BA2I 1BUVT 1I50B 3NTHA 3BDLA 2VXWA 4FXDA 2BB6A 3QOLA 5EE0A 2F0PA 1L6VA 3TEYA 2B2UA 4OZAA 4ZLTF 4ARIA 3U9SA 3R8BA 2WXKA 2LMCA 5JOBA 5M5YB 2HCIA 3BWUD 1RKNA 2WP9B 1FXIA 1SNOA 5JVG3 3T4AC 5FLXL 1FGBD 5IT9E 3H09A 1QOHA 3MXPA 1DONA 4H2AA 1K8MA 2X6LA 3QOJA 2KEDA 4A3JB 1O7YA 2F4IA 2LEKA 4A9AA 1GUOA 2W82A 3M3YB 4XDDA 2BA0A 1ILPA 2M19A 3IAM1 2K22A 2ICEC 4ZHOA 2XVSA 1VCIA 2SDFA 1L4ZB 4L2YA 4RGOS 1EWCA 3EJIA 1H9SB 1PTOB 1KLGD 5CMDA 4B0MA 1DD2A 2KA7A 4XQQA 3ZJTA 4OO1H 2JXMB 2J0TD 2BOSA 3PUWA 1RHPA 1I6HB 4Q5VA 1FEHA 4KKJA 4RKBA 3HUIA 1IHZA 2MJ8A 1NI3A 1P7FA 4EE2A 4OO1I 5CYUA 5EPKA 3E5SA 5TSSA 2JYEA 1TJEA 3Q23A 3FPPA 2PLPA 5I6WA 3GTLB 4EGVA 2FMCA 1GUNA 5EBCA 1VZ7A 3NHHA 1F9QA 2JEBI 2RDHA 2F0UA 2W55A 4REZA 4YTPB 3FMCA 1QT9A 1PTOC 2I2YA 5BMIA 4LMQD 3DXJC 1KAAA 1VDVA 1YNJC 2EYJA 3OMGA 3NVWA 2WLBA 1XX8A 3BVGA 1HQRD 2JA5B 1WTWA 3V05A 4DNRB 2PO4A 5C0XJ 2IL8A 2QCPX 3KF8A 5E4XA 3IFTA 3CKIB 2TMPA 3P63A 1N5WA 2PZWA 2PZTA 1G291 1SYEA 4RAUC 2K3UA 1SYFA 4A90A 3KLSX 1KNEA 4IOIE 4WRDA 3U9OA 2KACA 5BN3A 3FILB 1D4BA 4RNAA 4FVMA 1BR9A 4ID6A 4RF0A 4KY7A 2RPVA 3J9CA 4ITKA 1L0YB 3GB1A 5C4XB 3C1FA 2F3WA 3J7AV 3EUB2 3S1RB 2N0SB 2RDFA 1QF6A 1EEID 4K14A 1GXDC 1SB3C 5E1FA 5CV8A 4IURA 4IUVA 2ACZB 4FYDA 1NCVA 3VA5A 2F1MA 5IIFA 2KHSA 1EY7A 1HTLD 3NBHA 3P4QB 3OIPA 2D62A 3ND9A 2A69C 3DUZA 2EZVA 2RVLA 3CIRB 3QJYA 1H9JA 3BK2A 3J80E 4A3IB 2F0HA 4GDKB 5KYLA 2Y5PA 1SDFA 1D2BA 1TWFB 2AWNA 3MXUA 2O5IC 1E0ZA 1V8CA 1C4CA 3PO2B 3NPPA 4M1UB 1SE2A 3J7YW 2IGGA 1SNQA 3DWPA 1WD1A 3R93A 1C48A 5KEEA 3DHQA 3NP8A 4C3JG 2HTME 4XT3B 3U4EG 3VRAB 3FEWX 2W54A 4K5VA 4M8AA 1X3PA 1F2MA 3I9V1 3GO5A 4PT5A 1TWCB 1OFFA 2B2WC 2M0AA 1ET9A 2XWBB 3AE3B 2OF1A 4FF2A 2ENBA 4LLGM 3KUPA 3Q8BA 1RF2D 2DYMA 2SAKA 4KGRA 3TDQA 2FMMA 4PNYA 3IT6B 2KCCA 2PCFB 4LJZC 1IYUA 1Q90A 1Z6HA 2JP1A 4L6TB 4WJWA 2J53A 4DAYA 1G6ZA 4ZRQA 1Q1BA 1BF4A 4MT5A 3TBIB 4NZLB 4HKZE 2L0CA 3LB8C 3MZ5A 2L9HA 2N88A 2WP8J 4YSZB 3PIO3 5IOCA 2PZUA 4I7ZC 1YN4A 4ZYSA 1F2ZA 3I8ZA 2PVOD 3P1MA 1CTMA 1V1PB 3K59A 1HEZE 2A74C 3NSWA 4KKUA 2LUMA 4X3KA 5AUIA 3AE5B 2RQXA 4KJNA 3E0JA 1EYDA 4KKSA 1GUTA 4DXGA 4HAEA 3SEBA 5G3LF 1SYDA 4C3HB 4ZUJA 1TWGB 1FFVA 2KVMA 4PQXA 5T8IA 4KMUC 4XXEA 4CHTB 1I4XA 2K05A 1STBA 3VR4A 1PFMA 2Q5WD 4ZRPA 5ISRA 2VZKD 1J7CA 2XWJB 1C78A 5KGUA 5KNBA 1G91A 4NP5A 1EU3A 1YNNC 2WU5B 4S3SA 1IUEA 3N9YC 1QILA 1XLPA 2EPBA 3J81E 2WAQB 2Q8TA 2J7ZA 1CA5A 5C4ZA 3LXFA 1E2ZA 1I6VC 1H9SA 2E75C 2J4XA 4WORA 1EZ6A 2IX3A 5EE1A 2A5HA 1J7AA 3IXSA 1JWAD 2E74C 3D4DA 4L63B 4A55A 3SFDB 1QOGA 3A55A 4A3BB 4V190 1L4DB 4CKBA 2LKVA 4IALA 2B2UC 2JA7B 1M8AA 1SAPA 3EVQA 4H13C 4TKOB 1EY9A 4WAFA 2WINB 1LTID 5T1GA 2R6GA 2D2CC 2G9DA 3AB5A 1JORA 1JOKA 1DOYA 2WKCA 3I4NB 1II3A 4OHJA 1V1OA 1Y8PB 3T56B 2WDVB 4NAWB 5JVH3 3GS2A 2D5GA 1MHHE 3L9AX 2JA6B 1ZP0B 5CBAE 2PIAA 1BQQT 2VB2X 5M5WB 5BN4A 4QB4A 1FD7D 3P4SB 1C4AA 1QB5D 2F0FA 1KDAA 4P16A 5KNDA 2E2DC 1XEEA 5J1ZA 1PZKD 1KDCA 4HMIA 1KF6B 1ESRA 1SBBB 3R2IA 1I4PA 1Q10A 1PRTF 5IODA 3FILA 4B0EA 2F3VA 1Q12A 1KFYB 3KLSA 1VJKA 4FF4A 2PYKA 2QILA 2O2LD 5C3XA 1ENCA 4RA8A 3NUCA 1SF0A 3PUYA 4G57A 3MTSA 3DWQA 3I90A 1DZ1A 4BBRB 1TVXA 4JWUC 3ND8A 1XO3A 4WIPA 5C3JB 1N5XA 1G2SA 3ZYYX 3NUHB 4HJGE 1T5XD 4NDXA 2EYOA 5J39A 1FRRA 3PUVA 1ICWA 5E6JA 1B9NA 4A3KB 3HGBA 5CV9A 1VZ6A 1RD9D 1MVKA 2YEPF 2K0PA 3L7ZC 2V3PA 1KLUD 1R4QB 1OXTA 5C5MA 2AUKA 4YTNB 2G9HD 1ONLA 4L1BA 5LNK1 4LK1C 1UNSA 1FFUA 3QO2A 3E6ZX 2K5WA 3OWEB 1TKEA 3F2UA 2PW9A 3DWGC 1IBXB 2DY8A 3MJ5A 2SOBA 1QWYA 3EFXD 1NENB 2IDYA 5DM73 1KNAA 2OEDA 3OOCA 3VR2A 1RCVD 2HQEA 4IDIA 5IGBA 2WU2B 2F0JA 1CJEA 1E9MA 2KDMA 2EYHA 4CJ2C 3J7AF 1SEBD 2WDQB 1OXXK 4J8QA 1WWTA 4K6DA 1ZXTA 3AEGB 2B39A 1TS3A 2WXIA 1SNPA 1I4QA 3NE5B 4A3FB 1TY0A 3JAME 1A15A 4O1NA 5GXGB 3FDTA 3GQBA 4D2KA 3W5UB 5K36G 1GB4A 3KK7A 3AEBB 3NZ3A 2KJXA 5J22A 3BVZA 3DMUA 2O5JC 1GUWA 3QWNA 4KGSA 2L1BA 5C3WA 4MN3A 4TQUS 4A3MB 1NUCA 1RM6C 2NMQA 4RCNA 3C3LA 3EQLC 2LJIA 1JWUD 5G5GA 1MSGA 1HUMA 2EELA 3BYYB 5DM63 1QE6A 3P4RB 1HA5A 4RGMA 3GTGB 5HGTA 2F03A 4TMAB 2EJGC 1XXGA 4GLSC 2R7ZB 1V1PA 3M7NA 3VYRA 1PXUA 1WGKA 4HN7A 4IFDG 4ZUIA 1FNVA 3ABVB 2H88B 3BVMA 3S1MB 2Z4HA 4XT1B 2KECA 4KTAA 4G4KA 1SNDA 1U4PA 2JYOA 5IGFA 1ESFA 4M0WA 2F0SA 4MIUA 4HCSA 2EY2A 2ZXOA 3G6JB 4A93B 3Q8EA 5G5HA 1UAPA 1GPXA 1I3QB 4BWGB 5FKAC 4H7BA 1A2TA 1VF5C 4TRDA 4F87A 2LHEA 3W9CB 1CFMA 5D3DA 1OQRA 2IW3A 4DAPA 2BB5A 3Q69A 2B2TA 2CVRA 3A8JE 3V2TA 1FNWA 4DA2A 3M4OB 1KDBA 1WSPA 5C5LA 1AYFA 3PO0A 5EE3A 3MA2B 4WQMA 2XSCA 4ZK9B 1G8ZD 5LL6X 1YMHE 4DAVA 3TSSA 1IW7C 2WS3B 3T16A 3VRBB 1SNCA 3C1EA 3LWUA 2KQ3A 3GP7A 5FO8B 2F0DA 4EQPA 1O80A 2Q8IB 2VUMB 1N60A 1I4HA 2MPMA 2PVGC 2MJDA 3Q24A 1TKWB 5JAVA 2BE5C 1LTTD 2GB1A 3L4PA 3AE6B 3FPUB 4ZQ3A 4PMWA 4ILWA 2KN4A 1LT5D 3KWLA 2LY7A 1CM9A 2LFNA 2H1EA 2RA4A 1ZKOA 3GV3A 3U7ZA 1XLOA 2L12A 5A2QL 3NQIA 2JQRB 1EU4A 4BS9A 4IUUA 5I2XA 2GA4B 2WNMA 1EWHA 5FO7B 1WTPA 4K5WA 4E6IA 3BIID 1ZDXA 2AQ3B 4HSPA 3PV0A 1T3QA 1EM7A 2G1EA 1F2LA 5EQ0A 1SYCA 2E3TA 2MGSA 2NBFA 5AUKA 2L11A 3TZUA 1F9SA 1U9RA 1EY4A 3FC4A 2K5QA 3KWVA 1C77A 1JWMD 2RDGA 1ROEA 1WRIA 3GTKB 5AFWA 2SNSA 3LNNA 3Q22A 3K5MA 2CHBD 4EQOA 1QCBD 2FUG1 4RHRA 3DWAA 2F0EA 4BA1I 1TWAB 1YQ4B 3RZDB 2EJFC 1J8IA 3ZJVA 3E56A 1I4GA 3OPOA 4C80A 1JOQA 3MXGA 1PTOH 1AEXA 3W2DA 4DNTB 5JPNC 4YTMB 1FMAD 3TUOA 2X38A 4WWMA 4WFN3 3K58A 1CI3M 1PTOD 1JRPA 1AN8A 3SDZA 1SNMA 2PW7A 1VDZA 2Y3AA 2C9OA 1YNJD 4R3DA 1HXYD 1TU2B 5ELBA 1B53A 3P1HA 3NRZA 4KHZA 2XNAC 3GTOB 1L0VB 1XLNA 2J52A 1JW9D 1W6JA 1IL8A 3MC0B 2DWQA 3AH7A 3P4PB 3A8KE 2QJLA 2F0NA 1IBXA 1JC7A 3KBGA 2INNE 1A3VA 1IYVA 2NN6G 3MFGA 2INPE 2XN9C 5ELFA 4V0BA 1Q1EA 2DBYA 1B50A 1Z7TA 3T53B 4K5XA 1HUNA 2BW2A 1PMRA 3IL8A 2BS3B 1HQMC 1OQQA 5H8YE 3D4RA 5D3IB 2KEEA 1C4QA 1LABA 4IQZA 2QF7A 4MH8A 1C9FA 4WURA 1K50A 4XE0A 5JPMC 1EFID 3LYYA 3RZOB 3VR8B 1AFPA 2M2LA 2JEAI 2V3NA 2H4OA 2WV6D 3X3NA 1LTBD 4K8JA 3HVDA 2A69D 4I65A 3HOVB 5I9OA 3K6OA 3C2PA 2I46A 3CWIA 4F7XA 1E6EB 2J42A 2F0MA 2AUJD 1TIID 2E2IB 1QJOA 1AP0A 1QKZA 2ZW0A 3VYTA 2B76B 3AE9B 1RTOA 2SNMA 4J6HA 2KAJA 4NMZA 1Y1WB 5D14A 5KNCA 5EPJA 1HTPA 4JX1C 1STYA 3P42A 3TP8A 3IT4B 1PGXA 1Y8NB 5E3FA 4IUQA 4DF7A 2ZXRA 3S2HB 4G7OC 3K57A 3BDOA 1S5DD 1E2VA 2A73B 2DYOA 5JEAG 3H3VC 1E2WA 3Q6SA 4O42A 4AQ7A 3RMHA 2PNRC 1YJJA 1ZE3D 1C4PA 4N58A 4KV6A 2I38A 3T3NA 2Z8LA 3Q8CA 1CK1A 2PKOA 1FR3A 5EKKA 1QG7A 1CA6A 3VR5A 2L5TA 2R3ZA 3NTKA 2D9UA 1T5EA 2DN8A 1QNUA 4ZHPA 4DK0A 4F8MA 4ABNA 1MBYA 1TWHB 5A35A 1IKMA 5K5PA 1SFOB 1F0ZA 2L55A 2XRQD 1VLBA 2DLBA 3CU7A 2KWDA 4C7YA 1JROA 1GHJA 1BOSA 4XQJA 1PFDA 5FLXE 2PPBC 3I57A 2NVXB 2RKSA 3K0YA 5KIXA 2E2HB 5I2YA 1D5MC 4FP5D 2L52A 2FFKB 2A68C 1S4ZA 5BMHA 1V43A 3K7AB 3EROA 1UWXA 1T6BX 1G2TA 5KYIA 4TQ1A 2A6HC 2SEBD 3IFDA 3MWYW 2F0QA 2FHTA 1S5ED 4C3JB 1D6EC 2AWOA 1BCPB 1EY8A 2PW5A 1YN3A 1TQOA 4HTHA 2K5PA 3Q0AA 3VA7A 4X3TA 2B2TC 3WOFA 3I4LA 1CQVA 3S1QB 2QSDA 4XQNA 4IUTA 3VR9B 1YNND 3OSOA 5BN5A 3KQ4A 5IT9L 4KN7C 4DQOC 1FD6A 1PDQA 4HEDA 1GB1A 4HMJA 2WXMA 1Q3LA 1XWEA 3MEHA 2I07B 2AQ2B 3R3OA 4FO2A 3HS0C 2FBWB 3AEFB 3GD7A 1F9PA 2OHFA 3TMEA 1I7HA 1BCPC 4DGZA 4BY7B 1O7LA 1J9OA 3SHLA 3PO3B 2MP1A 3EA6A 1A6XA 3TP5A 5C4JB 3SE0A 1O78A 1GUGA 4RWSC 1BMLC 1DYQA 3VR3A 4ZRZA 1CHPD 1NEKB 1L6UA 2JE6I 2K03A 3DEPA 1TS4A 1TR5A 3AMUA 4C3IG 2QKIC 4RFBA 2TSSA 4JBWA 3HOXB 3TP6A 2JWUA 3QIAA 5C0XG 5LL6S 5HHDG 1SE3A 3BK1A 1TKGA 4QMGA 4U673 1UUPA 2NB0A 1N62A 2BA1A 2MHVA 4X3UA 1SYGA 2EOTA 2F0WA 1RFKA 4RCOA 3BG3A 2R61A 3B2GA 4OVZA 2W3RA 5I9PA 3M7GA 1SE4A 2EKIA 1AZQA 1IKLA 3M85A 2KQ4X 3X3MA 3RPFC 1ENFA 3OMCA 3ZJUA 1PRTB 5EE9A 2F0LA 1VF7A 3HVZA 1HRJA 2RSOA 4K6LA 3W5VB 1C8CA 5CR3A 3NK9A 1U4RA 1GHKA 1QOAA 3NWTA 4FNFA 3L3OC 3N52A 3TEZA 5BYQA 3AE1B 2HDMA 4ME5A 2N7JA 1O7ZA 1EQTA 4FXCA 3CRLC 5HG2A 4RHSA 5CC4A 3V3XA 3U2SC 4BBSB 3BYTB 3FKIB 3GTMB 2WXHA 1PRTC 5EBDA