3V05A

2.4 angstrom crystal structure of superantigen-like protein from staphylococcus aureus.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
193
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Superantigen-like Protein
publication title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 60
structure length 193
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v05A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v05A01
2XRQD 3MC0B 4RGOS 2AQ2B 3BYYB 1EWCA 4RCOA 2O2LD 1JWMD 1SEBD 2RDHA 3SEBA 2AQ3B 2XRSD 5ELDA 1JR0D 1RF2D 1LTID 1PZKD 2XNAC 1AN8A 3TSSA 1HA5A 5FK9C 1EU3A 1FNVA 1I4RA 5ELCA 1UUPA 1PZID 1S5CD 1V1OA 4DXFA 1L0YB 4NZLB 2WV6D 2Z8LA 1V1PA 1CHPD 1AW7A 1V1PB 2IJ0A 1I4GA 3DWQA 1TY0A 4L63B 1ESFA 1BCPB 1JCKB 1STEA 1S5DD 2RDGA 2R61A 1MD2D 3DWPA 5I4DA 1D6EC 4OHJA 1KTKA 4BWGB 1B44D 1L0XB 1BCPD 2CHBD 2NTTA 2SEBD 1TS3A 1EU4A 1DJRD 3O13A 1PRTC 1D5MC 2ICIA 4RGTA 1PRTF 1S5BD 5ELBA 3BZDB 1FGBD 1LLRD 1RDPD 4K6LA 1S5ED 1FNUA 1CT1D 1LTRD 3DWAA 1FNWA 2QEJC 1SJHD 3BVGA 1LT5D 1HTLD 1LO5D 1SE4A 1YN3A 1S5FD 1GOZA 1B1ZA 1BXTA 1SE2A 3GP7A 1YN4A 1PTOC 4RGMA 1PTOF 1D5ZC 5ELFA 1CQVA 1XXGA 1I4HA 1PYWD 1KLUD 2G9HD 1TS2A 1EEID 2J4XA 1EEFD 1CK1A 3EFXD 5ELEA 1SBBB 1HQRD 5FKAC 4TSSA 1HXYD 1BCPF 1SJED 1TY2A 1LTTD 4ZYSA 1XTCD 1RD9D 1LT6D 3KLSX 1EFID 4O1NA 4RGNA 1PRTB 1LT3D 1PTOH 1LTSD 4Z9CB 3R2TA 2QILA 4RHSA 1ET6A 1G8ZD 1KLGD 1I4XA 1PRTD 1SXTA 1LT4D 1M4VA 3V05A 4C56C 5D3DA 2IPKD 1JWSD 3CHBD 4RFBA 1YN5A 2NTSA 1ENFA 1LTAD 1SE3A 4L6TB 1PTOB 1T5XD 1PZJD 1UNSA 5D3IB 1CHQD 1LTGD 1TS4A 2XN9C 3OWEB 1JWUD 1LTBD 1I4PA 2TSSA 3BVMA 4RHRA 2AQ1B 3R8BA 1BCPC 1D5XC 3MFGA 1I4QA 3BVZA 3URYA 4DXGA 1PTOD 3W2DA 1F77A 1QILA 4RH6A 1TS5A 1ET9A 1FD7D 3R2IA 3BYTB 1RCVD 4UDUC 1DYQA 1JQYD 5TSSA 3EA6A
chains in the Genus database with same CATH superfamily
3FAHA 1VQ6A 4JBWA 5C4HA 3CCSA 2VUMB 4HEA1 4RM8A 5KRUA 2LMCA 1ILQA 4MNOA 4OX9L 2LVQA 3NRZA 3GTKH 1IZ6A 4BXXG 5FJ8H 1WOCA 3OOCA 4MSMB 2DX5B 2K5HA 2R92B 4HRSA 2EQSA 3SK8A 3AU7A 4HK2A 1XNRL 1S5CD 1KXLA 4KX6B 2OT2A 5J2RA 5CX3A 4JCVE 1ZGUB 3ZYYX 1P7FA 4GNXA 3MXUA 2CHXA 1FGUA 1J9OA 3W1BA 2R92G 2W54A 5C0XH 3QIAA 3WA0A 3AE3B 2R2OA 1Q1EA 3MZ5A 5ISRA 1QVGA 3GTPH 3N1XC 3DWGC 1N8RC 1STEA 1SYEA 1NUCA 2K14A 3QJYA 4Q2JA 3UDXA 1S72A 2CHWA 2JYEA 4GKJQ 2KCMA 3L3OC 3GTQB 1AARA 4DPGA 4P75A 5J1ZA 3CPFA 1I6HH 1D5MC 3UDGA 1UGMA 4WQMA 4ASWC 4EZKA 2EYOA 1MG4A 2BE5D 2G4DB 1DCZA 2GI9A 4KY6A 3EGRA 1SRUA 3DUZA 4DAYB 2OHFA 3ZQ4A 4EZJA 1SF0A 2Q2TA 2Y5CA 1IL2A 1HRJA 2XK5B 1AWDA 3B2FA 3VRAB 2BOSA 4CKCA 1F9PA 2UXBQ 1ACCA 1EM7A 1S40A 2RCFA 2RA4A 2EJGC 2NVQH 3IFWB 1I35A 3PV1A 4WJWA 1OXTA 2VQFQ 1JJCB 2K4KA 2IX3A 5IT9L 3R66C 3R7RA 1I42A 1ZE3D 4DGZA 3S9WA 2DAFA 2D9UA 4KV6A 3WOEA 2B2TA 4YIJA 3P1HA 2QIEB 4AJYB 4EQPA 2VZKB 3RCZA 3I72A 1E0BA 2I5MX 3I4LA 1EIHA 1T0RC 4MTNA 5EE9A 5M5XB 1O7LA 4B3SQ 5CV7A 4BBRH 4CBVA 4AH6A 5LMUL 3DBLB 2BS3B 3SXHA 3HS0C 4KV2A 1YEZA 5KYIA 2PMZB 2Y5PA 1PGBA 3H7PA 2VW9A 3J7AV 4P6VF 3CF5A 4IZ8A 5CHVC 3VYUA 3RLOA 2BDNA 2K25A 4US8A 1CQFA 4HDOA 1MPEA 2Q5WD 2RDBC 2IO2B 1ZKHA 3RZWC 2Z4IA 2J52A 3Q8DA 3BK2A 3ZJUA 2WS3B 4OWXB 1Y69U 4TVAB 1JWUD 3K0XA 1LTBD 3LNNA 3ML9A 3Q2AC 2KX3A 1A8VA 3OWFA 4B08A 5HI1A 4XE0A 2EZVA 4NPSA 4C2MB 4JI0L 2L83A 1TT5B 3NVYA 1JRPA 2VZKD 3PRPB 1XTDA 2WLBA 4UPAA 5E7NA 2N7DA 1PFMA 5JJLA 3HVDA 1PYBA 1QILA 1WY8A 4HCEA 3RMKC 2B2TC 1IHZA 2KK8A 1CM9A 4LNKA 4MM3A 3M4OH 1NSNS 3KQ4A 4IM3A 1JORA 1YQBA 2XRQD 4HCNB 2EY5A 2F0IA 4CJ0B 2E5LQ 1VRAB 5F2DA 2KENA 4FVMA 3GO5A 2N49A 2R3ZA 4PZ7A 2JUOA 4DQOC 2E8GA 3F2CA 3H9DA 2MHVA 1QUQB 2K3UA 4BS9A 2LFIA 3WAMA 1HNZQ 4WJOA 3BS1A 3MHBA 2NBVB 1IBKL 4HJGE 2KAJA 3DBSA 5KNBA 3RNGC 1RFAA 1WZ3A 4GGQA 4MSQB 4UP8A 4DXFA 1AZQA 1E8WA 2BVCA 2K5VA 1V1PA 3RNFC 3B9JA 1J7CA 1IW7C 4TQ1A 2O6VD 3K5NA 3GOEA 4L63B 3BY4B 5E4WC 5JXVA 3AEVA 2GBJA 4YTMB 3M4PA 3NTIA 3W1SA 3H0GH 5G3LD 3S1MH 2RDGA 2JA9A 2RSUA 4II3B 4FF4A 5CHFA 1DGJA 3S14H 4ANUA 3NBHB 1K52A 3WDNA 3KBGA 3PO2H 5AEKB 4HIDA 1WMHA 2UXDL 4B9WA 2KACA 2IO3B 3UGBB 3P4PB 3VR6A 4M8AA 5IAAC 1QVCA 1FGBD 2PYKA 5T1GA 1I7HA 3U58A 4TQUS 4CO7A 4A8XC 4KHPQ 4ZCKA 4CKEA 2DYBA 4N59A 4JL9A 4HXDA 3U9OA 3MC8A 3NHEB 2XEWA 4QAYA 1GOZA 3HEJA 2KHWB 1BXTA 2OTJA 1X3GA 1E9MA 1QLBB 1EUJA 1HHVA 2UU9Q 3DHGC 2ALYB 3QHTA 1WJ4A 4ZYNA 5L95C 2FXQA 3LWEA 2DUDA 5LMNL 2FIDA 1YVCA 5JAVA 3R3MA 1SNPA 1EY0A 1WTPA 2D3BA 2KTRB 4B9KA 3LXFA 5ELOA 1SBBB 5A2QE 1HQRD 4IQZA 2QF7A 5IYBG 3AFQA 1WTVA 4LF4Q 4K0KL 3E9HA 4NDXA 5GAGC 2KWCA 2OJWA 2A19A 3IXSA 4IKGA 1XTCD 1RD9D 4W9IA 5EKIA 3W1SC 3M7GA 3GTMB 2BQQA 4NPNA 4B3RQ 4REZA 4B6WA 1A3TA 4X57B 4ODGA 4Z9CB 4MEMA 3K7AH 4ZDVA 3U4EG 5DNFA 1WI5A 4JK1C 1G8ZD 2DJFC 3RLFA 4BBSB 2BYVE 2WXPA 4P16A 4CDDC 1C9FA 3BZCA 4WJQA 2Z9HA 4KDIC 3EC8A 1XJVA 5EBCA 1GVPA 1YHAA 4X66L 2NTSA 4BBSG 4ZOHC 4OZCA 2Z6KC 1TS4A 4L5QA 1J8IA 1MHWC 5EBDA 3MA2B 3FHWA 3KYDD 2WXRA 3HIZA 5IYDG 1PLFA 3R8BA 1C1YB 1D5XC 3T13A 1G6PA 3AE2B 3A8IE 1S3SG 1SYGA 2KFJA 3PUWA 1QQRA 2AWTA 5TR5A 1F2ZA 3DQVA 4AIMA 1G6JA 1EF1A 2HD5B 1FD7D 1TWFB 1Y1WB 1PH8A 1P16A 2J7QB 2HDLA 1I5FA 3IRBA 3PGZA 1MI0A 2INPE 3DHHC 3AE9B 2H5XA 2RCNA 1B3QA 3PQIA 1N34L 1XNQL 2F0DA 2HQEA 1XEEA 3MWYW 1YNNC 1Y1WG 1SE9A 1Q8IA 3J80L 5IYCG 4GOPA 2PI2E 2AQ3B 2XRSD 2K50A 2L15A 2H88B 3IAM1 4DDID 1F2RC 2PLPA 4K5VA 1EYDA 3EQLC 1E2VA 5C4XH 1UBQA 4RF0A 3A7AB 3P20A 3NY5A 3OW7A 4IPCA 4FXDA 2LGSA 3KF6B 1GD7A 3GTLH 2KT7A 2MBEA 5H92C 2OXPA 1UGJA 4IOAA 5KHOA 4DKAC 4L1BA 2K03A 2Z4HA 4U673 3PO3B 2FBWB 2GMIC 3V60A 3D8GA 1ESFA 3DM3A 3NTHA 2EY1A 1YJ9A 3LYYA 4JE3B 1IKLA 1BO0A 2JQOA 4K7UA 3OIPA 1QOAA 1A3UA 1A70A 1NYQA 2L12A 1WGRA 3RZDH 1DOKA 1TVXA 3TEHB 4EGVA 3S1RH 3GTOB 1JW9D 1LV9A 1DJRD 1EY9A 2VXWA 5C0XJ 1WRIA 3CWIA 3DBRI 3JVZX 3TS0A 3GB1A 3JW0X 5ELBA 1R7SA 4TQ0A 2A4ZA 1SNMA 2UUCL 3NP8A 4W9JA 4DHZB 2HCIA 4MH8A 2F0UA 4NNJB 3CCEA 3AMUA 3KBXA 4JI8L 2UUBL 4JLCA 4DK5A 4A3DH 3I57A 4IJHA 2R6GA 4N9PA 3J7YW 2J0KA 2L32A 3S1QH 1YN3A 4X6AH 3L08A 5AZFA 4I7AA 1EZ8A 3PRZA 1B1ZA 2CKZB 3I7FA 4DNRB 1WYDA 1AYFA 3GS2A 4JI3L 2FUG1 4XZ4A 5C4JH 3H91A 5IP7G 3IAYA 5JZEB 1WFYA 2D10A 2PVOD 2TMPA 1XXGA 2NPTA 1I50B 4YY3L 1HE8A 2L05A 3X23A 2J4XA 3VUYA 3HK0A 4CHKA 2K22A 2JA8B 2EPBA 4K1RB 1VQLA 2WHIA 4DV2L 4ZLTF 3U52E 2Y0SE 1HXYD 2FMCA 5LL6X 4ICUA 1KM7A 4A76A 5EJWA 4G57A 3BZKA 4WORA 1D7QA 1IYJB 1I94Q 5G55A 3W5UB 4JI5L 2JA8G 2EYLA 3T3NA 2W9NA 3AEFB 1QOHA 2J0MA 4FF3A 3R7QA 5C2TB 4ZQ3A 4DR6Q 4B3MQ 4ARCA 1YJIA 2F0HA 2FHTA 5L83A 3L4PA 1K3BC 4DK6C 1X56A 2ZJRA 2LMCB 3CSTA 5G5GA 2ENBA 5A35A 1E8ZA 4WIPA 2H4OA 3PVLA 5GROA 4NXML 2NVXB 1V5OA 1UNSA 2KANA 5CV5A 2N1VA 1KDCA 4A3LG 1FIQA 2Q8TA 1Z5SB 4HJKA 2K39A 1ZKOA 4S0RA 3X3NA 4IFDJ 1QOFA 4FXGC 4IWQA 3IAS1 4ULLA 1YJJA 4IPGA 2MWSB 2CWAA 2MSED 1BVSA 3I8ZA 1NCVA 4LK0M 3RN2A 4K2KA 4A3IB 1F9RA 4M8MA 3VXWA 4NAWB 2KDEB 1WSPA 1TWAB 1Z7TA 2BE5C 2AKWB 2NR2A 4PT5A 5M3MG 1TKGA 2VQEL 2A69D 1SB3C 4RAUC 4A3IG 2IGHA 3AE5B 4HROA 4MZ9A 2F0MA 3TEYA 1EQVA 3JAML 4KKJA 4QIWE 2WXFA 2VH2A 2OCEA 4JYAQ 3ENEA 3MHZA 4H44C 5K36G 4CGYB 3Q22A 4FJYA 3VDZA 1U9RA 3K8AA 3NHHA 2GBNA 3HRZC 2D0PA 3SHLA 4QJFA 4I65A 2JWZA 1OQQA 4AS1A 2LVOA 2WFWA 2F0FA 1AW7A 3RR5A 4ILWA 3KLWA 3Q8AA 1VQ9A 4IWPA 3TS2A 3GTKB 1JT8A 2DZKA 4HMJA 3VDYA 3KVFB 5C3JB 1JCKB 4NMZA 2WAQE 1KF6B 5EDSA 3APFA 2KUMA 1VCBA 2ONQA 1KTKA 4BWGB 4XC2A 2F0NA 1C48A 5FJ8G 4B3TQ 1D2BA 3SK4A 1L2FA 4FYDA 1TS3A 4XTCS 1KQSA 5BR8Q 2KVRA 1YITA 3DM1A 3ONSA 4HN7A 4JOIA 2OJRA 1RDPD 3G48A 5AJ3Q 2O6VA 3T51B 3QC8B 4DV6Q 2CH4W 4XT3B 2BPSA 3KH0A 2DJGC 3C0RB 5C0XG 1XMQQ 3VR4A 3J81j 2QHOA 1SE4A 3V6CB 2RPVA 3MXNA 5C44G 1RM6C 4GZYC 3I90A 2FNJB 4A3PA 1I6HB 1UE1A 3VTWA 2D5DA 3PSIA 2PNRC 5JHBA 1V8CA 1RIPA 5EPJA 2NWGA 2VH1A 4KGTA 2RR9A 4PS3A 1FYCA 2WQYB 1YJNA 1E3PA 1T0QC 3VA5A 2L76A 3ICEA 4CKBA 2NVQB 4LF9L 5C0XI 5DPWA 4GKKQ 1CKMA 3CIRB 1B9RA 4ARIA 2BW2A 2UUAQ 4RGNA 2ZM6Q 4LF5L 4DR7L 1PGAA 2ZW1A 5C5MA 1JB7A 1ZP0B 3LJ3A 4BFRA 1JROA 3K9OB 4NJ6A 4QB4A 4FULA 3EBEA 3J81L 2FCSA 4BA2I 3ZNHB 4AYBB 4RHSA 1FRDA 3BDOA 3IKJA 2I1JA 3QX1A 2F0SA 4JC0A 1MJEA 1PRTD 4GDKA 3KLRA 1H4RA 1IYFA 3NTKA 3CCMA 4BBRB 1U4AA 4JOIC 2KDBA 3C2PA 2AX5A 5D3DA 4AYBG 4HJAA 4FDBA 3CU7A 3Q6BA 2UXCL 4DWFA 1CHQD 4HJ5A 5IO9A 4BBRG 2CJNA 3N32A 2K32A 3IFTA 1YI2A 2QC8A 2K52A 1DOIA 2DNEA 1H95A 1L6UA 4LFAQ 2CR5A 4K81A 4K8IA 1GUAB 2C7HA 3SFEB 4IFDG 1RWSA 3M63B 4N6EB 1RCVD 3AFPA 2BYFA 4WWPA 4DR5L 3ULPA 1T5EA 1KABA 2F0EA 3EA6A 2JYTA 1HTPA 2G1EA 3M3YH 3HVZA 1SGHA 2BWES 2MO1A 4WURA 4DUYL 1EYGA 3OJ4B 2K33A 1V8QA 1JWMD 3Q0AA 1K8MA 4BKGA 5NUCA 2L1AA 1KH0A 3OAWA 4KD3A 5AFWA 1Y1WH 1WD1A 2WX1A 1AN8A 3M4OB 1EU3A 5IYCH 4FA6A 4EEWA 3N1ZC 2IX0A 2AUKA 3T1YQ 2LJ5A 3C3LA 1JC7A 4MTKA 4IFDI 1L0YB 2WV6D 3HOWB 2BKRB 5E1FA 1SFOH 2HHHL 3A1QA 3ZNID 1I4GA 1P0RA 2CVRA 2N7JA 3ERSX 1UWMA 3PS6A 1VQ4A 2ZTCA 3FEWX 3U4ZA 2O5IC 3HOWG 1WVLA 5I4DA 2ES2A 1D6EC 4GDLA 4OHJA 2LRUA 2GBMA 2A5UA 2F0QA 3MEFA 3NS8A 3O13A 2QEXA 3J9CA 1GUTA 1YNXA 1E7ZA 3E0JA 4POFA 4WWOA 3RZFA 2JX5A 3PRMB 1FVIA 3FP9A 2DENB 2Z0DB 3EN2A 4A55A 5CORA 3H0GB 3S1MB 3ALBA 1WGYA 2B63G 2DYMA 3S16H 1STNA 1TWCH 1UE7A 1PFBA 4WQOB 4ZRZA 1C4PA 1XD3B 4UP9A 3S14B 1ZW7A 4LJZC 2H1EA 3J7A5 3PO2B 4ZRPA 2ZJDA 3KF8A 1A15A 1E8YA 3RN9C 4X3SA 1WXQA 4ME5A 4BVUC 2KJXA 4A3KG 4EZLA 3T16A 1KIXA 2L11A 1FD6A 3PO2G 1Y1VG 4XQJA 2KMMA 3W9CB 2F52A 2INDC 3PO0A 2QA4A 1K8OA 3L0WB 4NJ7A 1N5WA 5KGUA 1ILPA 1WTRA 4LF7Q 2AHOB 3M4QA 1GB1A 2KQ3A 1X3FA 2NVUI 2MO0A 1K8RB 2CJOA 2PKOA 1V81A 1WYGA 3AXCA 3SD5A 1BQQT 1EY6A 3P42A 1X32A 1OEYA 2KWVB 3A33B 4UAIA 1UE5A 2PMZE 2FCQA 2MBBB 3U7DA 3MAQA 4USAA 1QNKA 1KFYB 4TV3A 2AWNA 3ZLZA 4KDLB 2Q2UA 2I2YA 4WJNA 3A9KB 1TGZB 4WJ4A 4XQNA 2JN4A 4IUTA 1I4XA 1XPRA 1QKZA 4JPBW 1O7YA 3ZO5B 1Q5WB 4KD4A 2C35B 3Q69A 4YT0B 4JQWC 1FJGQ 2M19A 4KI0A 4JPSA 4DV7Q 5IE8A 2KZRA 1PH5A 1PZJD 1STAA 2RDFA 1CA6A 1ASZA 1ML0D 4LFCQ 2EY2A 2TSSA 3BVMA 2JPHA 3APCA 3A8JE 3SDLC 4RHRA 3OLMD 1N36Q 4GKJL 1BT0A 4A3LH 5IN7A 3CXCA 1PH9A 4DXGA 4LMQD 1JQ4A 3CC4A 2RHSB 2W3SA 2NZOA 3DVNU 4GXBA 4YXDB 2KCTA 2C9OA 1SYBA 4ANXA 1PH3A 2N1WA 1TZOA 2HJ8A 3TEXA 5C6AA 4N9F4 2WGSA 5JJKA 5T8IA 5IGEA 5M3MH 1MBYA 1L4DB 5GMVA 3C46A 5BN4A 2AQ2B 2UXBL 2A73B 1GG3A 2IBIB 1VZ6A 2B8GA 1XT9B 3SDZA 2MBOA 5LNK1 2FIFA 3AE8B 2F3IA 5H8YE 2RDHA 1AZPA 3S17H 1HNWQ 4MT5A 2V1CC 2VQFL 1OQYA 2PQAB 2A6ED 5IT9E 1NDDA 4E71A 1U4MA 4OGQC 3AE6B 2KJHB 4EUTA 1DZ1A 3NEMA 4Y7NH 2YTXA 5K36H 2RMMA 1WCMH 4OZBA 2IJ0A 3Q3MC 4B3SL 2GBKA 4E74A 5ELNA 5G2NA 3U50C 2DHZA 1VQBA 2KLGA 1KC8C 1F1HA 4RMFA 5JH5C 5C4XB 2B8FA 1S5DD 2M4NA 1OTRB 2Q2HA 3DWPA 2QMTA 1CSPA 1L1OA 3Q24A 3GTLB 5HGTA 3WAOA 2OOBB 3HFZB 5CHWA 3E5SA 3NZ3A 2QGQA 3AEGB 5C23A 5C4XG 2K04A 2ICIA 2LI5A 5GQOA 4LUZA 1STGA 5FOBB 1UBIA 3T56B 2V3NA 4OW0A 1HNXL 3V6EB 4K6LA 1Q81C 3MFYA 5KIXA 3VR3A 4OVUA 4DHJD 1K0RA 3CMEA 4JVZA 2VL6A 1N63A 1PDXA 1YX6B 1JOOA 3RZDB 3H94A 3H1UA 2IT1A 3K5LA 3RUIB 1XX8A 1S5FD 3NWTA 4DV4Q 3S1RB 1VS0A 1VQOA 1PH6A 2CS4A 1YN4A 3MJ5A 2N9KA 4LCDE 4W9EA 4G11A 3D4WA 4GB9A 5C44H 1D5ZC 1RTOA 4GLXA 1PHJA 1NJIC 3KJPA 3C8YA 4MJSA 3VUWA 4QY7A 3PZ8A 4DAVA 1I4HA 2IDYA 1K50A 3RNCC 1E22A 1B7YB 2A69C 3FKIH 3BDLA 4DV1Q 4A3DB 1G91A 4I6NB 2JSOA 1EEFD 5LHY1 3S1QB 4KLKA 4K7SA 1MKHA 1PQSA 3V2TA 2E5LL 3VYRA 1NE3A 3ZNGC 1FEHA 2EMTA 5E6PA 5J39A 4A3DG 4LLGM 4W9HA 1EIGA 5C4JB 2ACZB 1V9PA 3G4SA 1LT6D 3VHTC 4IPDA 1HNZL 2G4SA 4M0WA 4DV5Q 3NVZA 3A9JA 1SAPA 3Q8CA 2JY6A 3PMFA 2WXGA 4FF2A 3P4RB 4LNFA 1RFKA 1SMXA 1U5KA 4F7ZA 4X62Q 4DR4Q 5DPRA 4WWNA 3LWUA 4LFBQ 1VQAA 1EL0A 4R4QA 1AE3A 3NVWA 1IGCA 2WB1B 1WE7A 2F3VA 1VMPA 1J6QA 4L2YA 2MP1A 4IG7B 1M8AA 1W6JA 2K6AA 3OSOA 5CGKA 2I0QA 1N62A 1SSNA 3K59A 4GNXC 1H8CA 2WB1G 3E56A 2ZTDA 3CCVA 1I4QA 2E74C 2BS2B 3W2DA 1SDFA 5FLXL 4XYOA 1OQRA 1C4CA 3VVWB 2IX1A 2JEBI 2JE6I 3GD7A 5DPTA 4N8FA 1DOMA 1GUGA 1XLQA 2QSDA 3DHQA 3EUB2 4P71A 1JQYD 4KHPL 1VLBA 3AV8A 3M7NA 3QARA 4IUVA 4IFDH 4K2LA 3PF5A 2NMQA 4YWLA 1UF0A 4IW0A 1TU2B 3L16A 3BYYB 3A5ZB 3MTNB 1VDZA 3CW2C 1Y8OB 3L9AX 3NWSA 3ETRA 3UIPB 1ZDXA 3DVGX 1VQDA 2CQOA 2PI2A 4HCSA 4K5WA 3SEBA 2RD0A 2MBHA 2UU9L 2D11A 1X55A 5KHQA 1BOSA 2NZ1D 2XNAC 2BGFA 3D31A 4EKUA 1B3AA 4GN4B 2KXJA 4QUFA 2O6VB 5ELCA 5T1IA 1QT9A 1HH2P 1GUNA 1H9SA 4DUZQ 3E0EA 1GJXA 4HIOA 2V3SA 1HPCA 5HY6A 1EO6A 1MHXA 1VZ7A 2MEKA 3IT4B 4HTHA 2Z59B 2SAKA 3UDIA 1YQ3B 1WYWB 2Z0EB 4LF4L 4PMWA 2B2WA 4HLEA 2M2LA 1TIID 3JSVA 4WH4A 2JJQA 4HJ7A 1PYSB 2MFIA 3A0JA 3U4VA 4B3RL 1XNRQ 3F2DA 1VQ5A 1XCQL 1L0XB 3TL5A 3HOWH 2LASA 1HUMA 3CC2A 1IL8A 3NZUA 4S17A 3KUCB 4O0AA 1PRTC 2F0JA 5BN5A 4LUOA 1FRRA 4DHZE 2NBUA 1KNEA 1LTRD 2C7MB 2KD0A 4DNIA 5EPLA 4A3BG 2E6XA 2PVGC 4IUNA 1SIJA 4A6QA 1OEYJ 2HDMA 3KUPA 1CMXB 4KIKA 3MXPA 3NBIA 3TQYA 2EYPA 1WX9A 1YIWA 3I4NG 1KHIA 2L1BA 1ZOYB 1E5WA 3EECA 1BBUA 4HKZE 3L0OA 3UE0A 2B63H 2J53A 2M8SA 1CA5A 2WP9B 3F1ZA 4XWTA 5FR6A 3ZRCA 1SYCA 2A74C 1SN8A 2EYMA 1WZ0A 3N52A 2KMCA 4EQ5A 1WE6A 2F0KA 4JV5Q 1V5TA 2ZJQA 2LXAA 5HHDG 2BTEA 4A3KH 2E2DC 3OW2A 4I6LB 1SNCA 3ERQA 1Y1VH 4LF8Q 3G6JB 5ELEA 4JI7Q 3MEHA 2K6DB 5EQ0A 1B50A 4TSSA 3F2BA 4HIMA 2KDMA 1P8LA 1QCBD 4MGKE 3OG5A 3ZGZA 4A20A 1P98A 4HWIB 3J80E 4RNAA 2HIVA 5HGQA 3QOJA 1GPXA 1LUZA 4PZ8A 4C3IH 5C3EH 3K57A 4DF7A 1EQTA 2B3AA 2DYOA 2WXHA 4D2KA 1MGSA 2RF4A 3A56A 4KZCA 5D7GA 1IYUA 4K6DA 1KLGD 2KMAA 1ISNA 3AE7B 2YYZA 1WIAA 3S24A 4MH0E 2MP2A 2GLSA 3S2AA 2CH4A 2IY1B 2Z6BA 1C78A 4AQYQ 1TWGH 2E3TA 3WALA 4PMBA 2WXKA 3QK0A 1YN5A 1C4QA 3ZJYC 3ZKJC 1E90A 4DR2Q 3E6ZX 2PW5A 4K14A 4JI1Q 5D3IB 4W9KA 1DOXA 5IT9c 3H15A 5G3LF 3H3VH 2O5JC 4YSZB 1WRDB 3PUVA 4KKUA 2EYFA 3BVZA 1Q46A 3URYA 2O4XA 4G7OC 1FXIA 2XWBB 2L8JA 3TEZA 1MHHE 4C4VB 4GN5A 4QF4A 3TP8A 3ZDMC 1TQOA 4LDTD 4A3GB 2K28A 4DV0Q 3AN1A 3R2IA 2IO0B 2YEPB 4XYQA 3HOZG 1UZXB 1X54A 3T4AC 3HKZB 2LHEA 5IWAQ 5HFYA 1ZYRD 3DLLA 1HR0W 4A3GG 1L7YA 2N9LA 4URKA 1KAWA 5IODA 2PMVA 2OF1A 1T9HA 3L7ZC 1WGHA 3HKZG 5D2MB 1WXVA 1RF2D 3PZ7A 4K3BA 1IBXB 3TSSA 3J7ZC 3AEEB 2EIFA 2KYWA 4DV3Q 1XMOQ 1P3QU 3PPAA 3P2BA 1STYA 2IGGA 2BWFA 2KVZA 5J3BA 3LGJA 3RFZB 1VR9A 3M3YB 5IGDA 1DXMA 2NBWB 3PF4A 2LKVA 2DY7A 4ABNA 3D3RA 2EE1A 5KNDA 4C1NI 4IN3A 3PLVA 1PV4A 1A2TA 2XSCA 1WWTA 2D3CA 2KX0A 1WGKA 4NKLA 3RD2A 4A9AA 3OIQA 1I94L 4A3JH 4OIJA 3KW5B 2JK8A 2LXKA 3KDFB 3RNUA 2KDFB 3DBRB 4DR6L 2VRRB 4B3ML 3HGBA 4BY1H 4J6IA 1SFOB 1R9TH 4OEMB 4YWGG 2XVSA 3QB3A 2LUMA 1CKNA 1GC7A 4KHVA 5KYLA 2KTFA 3FKYA 4YCVA 4HPMB 3BK1A 1OXUA 2YTYA 4A75A 2WXNA 3FILB 4F1SA 1MVKA 3P4SB 3PSEB 1HTQA 4DR1Q 1BUVT 2MJDA 3B6YA 3DXJC 4IURA 2KEDA 4ZRJA 4X65Q 1HQMC 3PT2B 2ZZPB 1LTLA 1XO3A 2PPBC 1BNZA 3S16B 2QDFA 1TWCB 3RLNA 4A3CH 1B8AA 3RUZA 1Q10A 4G3XB 2RSOA 2L5TA 3MXGA 1QZGA 2DGYA 2B2VA 2NBFA 3EFXD 2IWHA 2Y5BB 3APDA 2K05A 1P1AA 1PFDA 4I6PA 2BS4B 1I3QB 2JF5A 5GXGB 4NJCA 2YEPF 3JAME 3H3VC 2ZTEA 3JYUA 1SYFA 2KFKB 1H9KA 2R7FA 3KLSX 3TBLD 2DBYA 4W9LA 3MJWA 4M1UB 4JYAL 2D2QA 2A6EC 4QL5A 2EMSA 4G7HC 3BINA 4GIVA 2ID0A 4BOZB 1E6EB 4X64Q 5CV6A 4AYBE 2KLCA 3HUIA 1QWYA 3E9SA 3EVQA 1E2WA 3QWNA 5A2QL 2IO1B 4GOPC 1C77A 3U2SC 1SIFA 3V05A 2HD3A 2V1YA 3K81C 1IYVA 3TEWA 1VMCA 1HTOA 2WKCA 4L6TB 1RAXA 1SE3A 4CJ2C 4H2AA 1E10A 4FLHA 1LTGD 3KYHC 5FLMG 1BBXC 5JHAA 2F0TA 4B3TL 2B76B 3MFGA 1IBLQ 1RYJA 3X0WA 5BR8L 2M17A 4MGYE 1Q12A 1D1IA 3I56A 5AJ3L 1NYRA 1UELA 3KYCD 3AB9A 3BYTB 2KQ4X 4UDUC 1HR0Q 4W9FA 2J42A 3A7LA 4DV6L 4LNIA 4DFAA 1C4AA 2B2VC 1O7ZA 3AQQA 2AEHA 1HFNA 1XMQL 3MC0B 1YJ1A 2ZCBA 4IM0A 4ZK9B 1K8AC 2NCNA 4IWOA 2LGYA 1OFFA 1EY7A 2JA6H 5IP4D 1HZ9A 2D62A 5IKCM 1VQKA 1LTID 1ZUD2 4P74A 1GHJA 3OTOQ 2OQ0A 3VYTA 2E2IH 3TRZA 1PZID 4JI2Q 4UHVA 5M3MB 4RM9A 3NOBA 4OVZA 4BOSC 2K75A 3HZXA 1MSGA 5JJIA 3FC4A 4GNXB 3N30A 4EFOA 5DEHA 2CCZA 1K73C 3S17B 3ZTCA 4A90A 2QKIC 2DY8A 3HP3A 1TZ1A 4OWWB 1D1KA 2L00B 2YLMA 3G6EA 4GKKL 2J0JA 2R93G 3A4SC 2UUAL 2ZM6L 2PO4A 2KJRA 1MG8A 4IUQA 3KWVA 4MJSB 4N9TA 1N60A 1X3PA 4S3SA 4Y7NB 3LDZE 5FR3A 2LJIA 1WJUA 3J81E 1EU4A 1WCMB 3CCJA 3HOUG 2WNMA 2ZVOA 1L4ZB 3AEAB 5AUKA 4FBJB 3ZVVA 3GV6A 4DAYA 1FNWA 1AE2A 2L0CA 3J80c 3DMUA 5IP9H 1SJHD 3T1HQ 4JI4Q 1PGXA 1WCMG 1W2BA 1GUWA 2JVCA 1LT5D 1K8GA 2CFMA 4XDDA 2OEOA 2BF8B 2MLBA 2WXLA 4A3BH 2ZT9C 4ZUJA 1IBMQ 4J15A 1JJ2A 4DU9A 4LJOB 3PIO3 1GUOA 3GP7A 1M1KC 1FXAA 4FJZA 1YMHE 3FVQA 3I4NH 3VR2A 1LFDA 1J5EQ 1CKOA 4IJLA 3A4RA 1VQEA 1A0IA 1VF5C 2GVBA 4LFAL 3AMZA 3J7AF 1FCLA 4X3KA 3UE1A 1YJWA 2UUBQ 1GC6A 4R4OA 3VH4B 4C7ZA 1Y14B 1S1QB 3DOWA 2B2UA 1GKHA 3TJPA 3KJOA 2YVCA 4OONA 3TP5A 3MC9A 4A3FH 2K7VA 1ZXIA 2VB3X 4A3MH 1F52A 2LUEA 5C44B 1Q0WB 5E6NA 3ZJTA 2ZPNA 1X3EA 3PCOB 4CQNA 1PRTB 2FCMA 4YHHQ 1X65A 2K5QA 3FKIB 2KJ6A 3H7PB 1G51A 1RLFA 4ZKBB 2GBRA 3HRDD 3T1YL 4LK1C 1MFWA 1FO4A 1ET6A 4HKQA 4UP7A 4DK3C 2PZUA 4EQNA 3P1MA 2F1MA 1VDVA 1V1QA 3FKIG 4MGZE 4QMGA 2IPKD 4RFBA 3AEDB 4KSKC 4ZRIA 3SK6A 5IGCA 2GVAA 1NVID 5HG2A 1U4RA 2XN9C 3JC66 3OWEB 4DR3Q 1A3VA 2DWQA 1XQQA 3I4MG 5CBAE 3CRKC 2QDLA 4HSPA 3W1YA 2WDVB 2D3GA 1PTOD 1H9RA 1H9SB 1M94A 2QCZA 3VRBB 4EOYA 2KEEA 3SVMA 1UH6A 1WI0A 2MJ8A 2YTVA 2ASQA 4GMVA 5IGGA 4C3JG 1QE6A 2A68D 1V97A 3P75A 1KDAA 3EFUA 1SE8A 4MM3B 5TSSA 2F4VQ 2EYJA 3WANA 1Q1OA 2VZAA 3IBEA 1Q90A 1VQCA 3ULLA 1WTWA 3HOZH 4FJVB 1IP9A 2HJ1A 4LTUA 2PQEA 4A3GH 1EUVB 1LABA 4NXNQ 2LXCA 1V9JA 1CFMA 3NE5B 1NAPA 2NZHA 4E6IA 1I4RA 2P5ZX 3SGIA 3CCQA 1FPYA 2GB1A 4JWSC 4R8NA 2NVYH 3NZSA 1UD7A 2FMMA 2NB0A 4HEDA 5I6YA 2IY5B 1E7VA 3PGEA 4OZAA 4LF7L 5KNCA 2V4DA 2Z8LA 3GV3A 4IOCA 3QAQA 2E75C 1HZAA 2R7DA 2M9VA 4C3HG 1V1PB 3DWMA 1J7BA 4P73A 4OVVA 4AWJA 3ZW3A 5AUIA 1QF6A 3K58A 4FXCA 3A5UA 4KK7A 1NENB 2WXJA 2INNE 1ZDVA 1SNQA 4LWCA 2BT6A 3L13A 2KOXA 2CW0D 4C00A 5C1ZA 1B44D 3HM3A 3M62B 1NR2A 5HKHA 1G2SA 1BCPD 4DK0A 1FM0D 2DAJA 1TKYA 2EXZA 3BG3A 3AYHB 4BKSA 1WMHB 4R1JA 1SSOA 1PRTF 2OTLA 3UI3A 1QG7A 3BZDB 2N55A 3JAMc 4I7ZC 2DZIA 2QEJC 4FO2A 1FJGL 2HT1A 1Q86C 4DV7L 3IG3A 5GAEC 3ZIMA 1M90C 4JBJA 3EROA 4IALA 4LFCL 4BY7B 4LAAA 2K5NA 2Y0SG 5IOCA 4KTAA 2L4NA 1UAPA 3K5OA 1N36L 4K5XA 3PUYA 4RGMA 2KO3A 1F2YA 1VCIA 2V0GA 4EQOA 4BY7G 2MP2B 2X38A 1KAAA 4W9CA 2LEKA 3A74A 2JZPA 2KTRA 1TJEA 1CK1A 1ASYA 2MA9B 1ZYRC 2B63B 2ASBA 4P1BC 3GDEA 3L54A 1YOVB 1VD2A 3OMCA 2C7NB 3IT6B 1BCPF 1E1OA 4AP4C 1HNWL 1LTTD 2F4IA 2K6QA 1K83H 3Q3OC 4C1NK 4HJ9A 2WDRB 1PUTA 2XWJB 4IC7B 1II3A 2EJMA 4A3KB 4NAMA 4MHEA 2KECA 4K7WA 1Y1VB 5EKLA 2ATWA 1GJZA 4BBNF 1I3QH 4DN4M 1SXTA 1VQ7A 2FINB 3K9PB 4QCLA 2WB1E 2B29A 1IUEA 2K8BA 2L55A 1E7UA 2IY0B 1S3OA 5CR3A 1ENFA 1JOKA 2LSSA 4C3IB 3GQBA 5C3EB 5L37A 3VUXA 1RODA 3WAPA 3U8ZA 1WXAA 4ITKA 4AQ7A 1JMCA 5FLMH 5LXIB 3CQZH 3MTSA 4C3IG 3RN5A 5C3EG 2ZXOA 1ZPSA 2EKEC 2JSVX 3AB5A 1TWGB 4B9XA 2GA4B 3M3JA 3ZUNA 3M95A 1GNUA 4NQLB 3HOVH 2G3QB 4G50A 1A63A 3W3AA 3S2HH 1WXMA 3ML8A 2C5LC 3D4RA 4RGOS 2KDIA 3CCRA 3Q8EA 3J81c 4PYZA 2K01A 4RCOA 4DV4L 3I9V1 4LNNA 2WAQG 2SNSA 2K5PA 4L8JA 3ABVB 2MUYA 2VB2X 3SHQA 1PZKD 5CYUA 4F88A 4GOPB 2YU9H 2F3WA 1B9NA 3FDTA 1K0SA 3A54A 5BMHA 1CKNB 4N8X1 5JPNC 3KF6A 4WJPA 3VTUA 4DV1L 2WU2B 3RT3B 4PK1A 2N8NA 1EWIA 3EHVA 1A2UA 4F8MA 3GTGH 2JA7H 2ZEQA 3QOLA 2E2HH 2KWUB 4RA8A 5I9PA 1FMAD 1GB4A 4C7YA 1TY0A 1Z6HA 4ZHOA 4OELB 1SR3A 1N33Q 2JP1A 4KZ0A 4XYCA 4RWSC 3O65B 1R4QB 2NYZD 4DV5L 3H3VI 2LGXA 4HPPA 4DBGA 2R93H 1K51A 4JI6Q 2QJLA 3ZXVA 4DHJB 1R4NI 3ZXRA 4X62L 4JBKA 3PREA 4DR4L 4RGTA 1FL0A 4J1MA 4LFBL 3BWUD 2L7RA 1DONA 1N32Q 3UQAA 1HFGA 3HOYG 4W9GA 3U30A 3HOUH 1S5ED 1ENAA 1CT1D 1NNXA 2ICEC 3F2UA 1D8LA 1XYIA 4A3JB 4X3TA 3QIJA 2CKHB 1BBWA 2ZXPA 5EE0A 4R9WA 2D0OA 5DAUA 5D14A 4ZAIA 3NVVA 5EE1A 2R7ZG 3J80i 4BY1B 5C3WA 4A3JG 1R9TB 3RYTA 2FE8A 2I38A 1EQRA 1WM2A 4GLSC 2FUHB 1D3ZA 2G9DA 1EFWA 2QW7A 2M00A 2I1KA 1Y56A 4BY1G 2NPTB 1CSQA 2KKCA 2ZJPA 2F0GA 1EEID 2XBBC 3CAMA 1TR5A 5BO4B 1X6OA 1LM0A 3AULA 1NMGA 3I4OA 1OGWA 1SMYD 2UWQA 3D32A 3D0FA 1RJTA 4G7ZC 1SJED 3Q6SA 1TKWB 2M0AA 3K0YA 4O1NA 3RNBC 4QUCA 2N9XA 1PTOH 2NN6G 1YIJA 1XPOA 4YL8A 5JEAH 1P9DU 3WIMA 1HUNA 4DUZL 1QNUA 1CTMA 2WX0A 2MHJA 2WINB 3ZJVA 4YWMA 3NENA 2F0VA 4YWKA 4A3CG 1C76A 2N9EB 4LF6Q 3F8TA 1K9MC 1AP0A 3PIOA 5J17A 4M01A 3ZNZB 1VQMA 2VUMG 3RI7C 2Q2IA 3UF8A 2LXJA 1FR3A 2Q8RE 3KLSA 1YHBA 3L17A 3VR5A 1QVFA 2WXIA 4L5TA 1YD8U 2I46A 2NN6I 2DLBA 1WTHA 3I4MH 2KOLA 2L9HA 3K7UC 4J6HA 4NAWA 3SE0A 3KWLA 3DBHB 4GN3B 4DAMA 1L1OC 2A5HA 3QO2A 4MDKE 1YX5B 3HKZE 3CRLC 4C3JH 1VQNA 2SOBA 1RTNA 4A93H 1C9OA 1V6EA 3G71A 1HJPA 3ZRFA 2DN8A 4O2DA 2MCNB 1SEBD 2MJ3A 1U4PA 2A8VA 1HZ6A 1DOYA 4DK1A 1L2NA 5C3XA 2JZZA 1EOTA 4KMUC 1QZHA 4JV5L 3Q3FA 3V61A 1FNVA 5CV8A 4NP5A 1N61A 1ZEQX 1EWHA 2E2JH 3AU4A 2B39A 4M00A 1OO9B 4XDCA 3T9LA 2ZXRA 2RGFA 4OIKA 3NK9A 1Q7YC 2PTLA 4B0MA 4LF8L 2MW5A 4XXEA 3VR8B 4YCWA 2WIIB 2PZTA 1KRSA 4JI7L 3CD6A 3S2DH 3STBD 2JA6B 3KOJA 2K8HA 3DBHI 4DAPA 5M5YH 4QQBX 2MX2A 4C3HH 4AUQC 4PZ6A 4GLVB 2E2IB 3L2PA 1K53A 3CKIB 1MD2D 4FNFA 3NUHB 2JA6G 3PUXA 3V3XA 1OXXK 4CDFC 1JWBD 2WACA 3C1FA 1EF5A 4YCUA 5G5HA 4BAXA 4YTNB 2BYTA 1S5BD 3IVFA 3N9YC 1LLRD 2PCFB 4AQYL 4J3OD 2C9WB 1VJKA 3K6OA 1YHQA 1VQFA 5CC4A 4DR2L 1GXDC 4JI1L 2HTHA 2IHEA 3DVNV 1EWYC 2X6GA 4IPHA 2C60A 3NG0A 5CTRC 3JAMi 1PH1A 4OX9Q 2W3RA 1SE2A 2A6HD 2L0FA 3MXNB 4ZRKA 1PTOC 3GZNB 5BMGA 1VZ8A 1HNXQ 1PVOA 3P7JA 3QR8A 2JU6X 1VQHA 4DV0L 5J18A 2A68C 3DEPA 4JWUC 5M5WH 4JG2A 3N20C 3T53B 3HOXH 1O80A 1TS2A 4BY7H 3AU5A 1WM3A 2N3SA 4A3EH 1Y8NB 4A3BB 5BYQA 5IWAL 4K3CA 5IP9G 3I4NB 3I55A 2G45B 5I6WA 3UINB 3DBLI 2HIXA 1EFID 1WXSA 1XLOA 3OYYA 2JRHA 2JT4B 4DV3L 2JXMB 2RQXA 1XMOL 2ON8A 1MIUA 1NR4A 4BA1I 2B2YA 1FFUA 1NI3A 1H9MA 5DPSA 4A3FB 3RPFC 4R4CA 1LT4D 4A3MB 2AL3A 4GDKB 3GZNI 4C56C 2N0SB 3WOFA 4JX1C 1LTAD 5IGFA 1WJJA 1O78A 3E9IA 4A3FG 4CYEA 1JICA 4A3MG 2EKIA 2CW0C 1I4PA 3RD4A 2JA5H 1TYGB 2RPQA 4LDTB 1HEZE 1VQ8A 3CP0A 1BCPC 2FAZA 2B2WC 4PQXA 4H02A 1PA6A 2IZVB 2J7ZA 3Q23A 4POGA 2IHFA 1PH2A 1B9MA 3ULJA 2BB5A 4R8IA 4RH6A 1XLPA 2BH2A 3N1YC 4IM2A 3BIID 3IL8A 4PMCA 1U4LA 1R4MB 1DYQA 5FO7B 1CZPA 4KHZA 2RSNA 2L0TA 4BBNC 4HDQA 5LMNW 1XLNA 3LB8C 2ZW0A 5C4ZA 1KLVA 4MELA 4EX5A 2EVBA 1A6XA 3RZOH 5LMUQ 4DR1L 4MACA 4UY8C 1E1TA 2KWDA 2EYHA 3MVVA 3CF6E 5ELDA 5E4XA 1ONLA 4X65L 4ID6A 2JQRB 2Z1CA 2BB6A 2EELA 3L10B 3J81i 4C80A 2V3PA 3AE4B 3AI5A 3GE8C 4OO1H 4HR7B 2B2YC 1EQQA 1E8XA 2L52A 1STHA 2Z6KA 2WDQB 2X8XX 3HOZB 2NVTH 3TBIB 3S1NH 3X3MA 4KSLC 1WR6E 4DDGD 2PEAA 2KCNA 4WJ3M 5COYA 2JZ3B 1PMRA 1KD1C 2EDGA 1WTOA 3DDCB 3A1QB 4KVGB 1GUSA 2WYQA 5FLXc 2WXMA 1IXRA 3TCAA 1Y8RC 5IIFA 3MP9A 2HTME 1KL9A 3HG9A 3NJTA 1R4MI 4CDEC 5DLQE 2KC1A 4YSYB 4LNQA 2NVYB 4N58A 1OTCA 4GDLB 4IUPA 4X64L 1WX7A 2KBNA 1YNTE 4JI0Q 4PS8A 1NTGA 2CHBD 2NTTA 4HMIA 4ZUIA 5GADC 2BBCA 3PHXB 3RNAC 2W55A 3SR6A 4BZAA 4LUVA 1K28A 2WXOA 4ZKCB 1L6VA 5DM73 1EYCA 2INCC 3OJ3A 5I2XA 4XGAB 3CPWA 3PIP3 3N6RA 3HOYH 4BKSD 1WJNA 3Q3JA 3QG1A 4G0NB 3C1EA 5EE3A 4TKOB 2IYDB 4US9A 4HJ8A 1MSHA 5M3FH 3KF8B 1IBLL 4GN1A 1ICWA 4JBMA 1WGGA 1VQPA 2R7ZH 4ANWA 2XIWA 4XDXA 1IBKQ 3RMHA 1PYWD 4HIKA 1JRUA 1KLUD 3CC7A 1HR0L 3S15H 4JW0A 1JJGA 1WGDA 3D6WA 1WTQA 3B08A 2AMCB 1QB5D 2SDFA 1HZ5A 4XX5A 2EY6A 3H6NA 2EJFC 3M85A 2LY7A 5K5PA 3GE3C 2MQJA 5CV4A 3W5OA 1KRTA 1LT3D 5H1SE 3C19A 1AH9A 2XTIA 4RCNA 3OTOL 3A9KA 4KKIA 4KJOA 1XF5L 2LS01 3TN2A 2QILA 4PG3A 4JI2L 1TWHH 1VQIA 2UXDQ 2NN6H 5E6JA 1O7IA 3K5MA 1PXUA 4FXKC 2WP8J 5JPMC 3Q14C 4XIGS 2IL8A 4CDCC 1K83B 4JGHB 1JWSD 3IHPC 4ANVA 2DZMA 4GU2A 3Q3NC 3OHXC 5D6JB 3M9BA 3BU2A 3AM9A 5JEAJ 1E24A 4BXXH 3KK7A 3SK5A 4EVOA 1HCZA 2JRIB 1ICFB 2AQ1B 1RL2A 2GN5A 2VUMH 5EGTA 1S4ZA 2RBMA 5I2YA 3DHIC 1VQJA 3TMEA 3PLUA 3VH3B 3BDCA 4HCPB 4B95A 2SNMA 2FCNA 4WWMA 4GOCA 1G6ZA 3WCQA 2JWUA 2JXTA 5LXHA 2D07B 1KOTA 1TS5A 5LMNQ 3IFDA 4XQQA 3BJUA 4RKLA 3T1HL 2R92H 4JI4L 2WWZA 3B0AA 1QJOA 4TRDA 3DPDA 1WJ6A 3I2ZA 1PDQA 2FFKB 4ZHPA 4CJ1B 5D65A 3PO3G 1ROEA 1TKEA 4FADA 1J8CA 1IBML 5LL6S 1BMLC 3I3TB 3MHSD 3CQZB 4K0KQ 3QWZB 4NB3A 1KJTA 2K1FA 2KQ7A 1J5EL 4KKSA 4OWTB 2KNBA 2PQAA 3HKSA 3I91A 1OXSC 1Z9FA 4M02A 1RHPA 3GTJB 3H09A 3HOVB 2MPMA 3CCUA 1V2YA 3P63A 1SNOA 2N7EA 1CJEA 5CBEE 3S2HB 1X3QA 3FPUB 2JEAI 2V9HA 2HQLA 1V1OA 3W5VB 3I5JC 3GTQH 2LWPA 1NY4A 4J8QA 3HOVG 1HA6A 1SMYC 4HVBA 2LFNA 4HAEA 3NUCA 4X66Q 3TZDA 2YU9B 3U9SA 2O2VA 2YV5A 3VYSA 3ITPA 2R61A 1CI3M 3NELA 1VF7A 4YHHL 1JMLA 3QCAA 1MI2A 1G2TA 1L1OB 3I3CA 4IO9A 5AZHA 3GTGB 1QOGA 1HZBA 2JA7B 1XCTL 1UWXA 2E2HB 1NEKB 2PE6B 1IPGA 2NS5A 1YNJD 2K9XA 3DWAA 3CCLA 2D2CC 3TDQA 1GM5A 2JA7G 4ZRQA 3BVGA 5HURA 4PNYA 2I5LX 4DR3L 3TUOA 4YSXB 2R93B 1N34Q 3TIXA 3SR1A 1XNQQ 2K1BA 2MQHA 1B4OA 4E3CA 2CHZA 2WXQA 4RMAA 5M5XH 2O2VB 1KNAA 1YZ6A 1FFVA 3QJZA 5ELFA 3HOUB 1E7PB 4ACFA 2J0TD 2OQKA 1BF4A 4MIUA 2OWOA 3UIOB 2ZNVC 4A3OA 1ZXTA 4PV1C 2DNFA 2HDEA 1JE5A 1T3QA 3N3KB 2AYOB 1C3TA 4QGUA 2F4VL 2VNUD 1B53A 2N9PC 3ZTDA 3TP7A 2IW3A 3VAWA 3ZDTA 5FKAC 1JOQA 2K5WA 3A55A 2R2QA 4NY0A 4DXAB 2DNCA 3G7LA 3FMCA 3NPPA 4NXNL 2XK5A 2UU7A 3EJIA 2N78A 4X3UA 5IA7A 2FJ2A 4APVA 2RVLA 4WRDA 5IY0A 1T6BX 1WH3A 4M0WB 2Z0SA 1JWAD 2HE7A 3A9JB 3R2TA 4O42A 1N9WA 1AEXA 1F2LA 4V190 4L23A 4C2MH 1UE6A 2BCOA 3STBC 2UUCQ 3R3OA 3TP6A 4ICVA 1KDBA 4KKTA 1PTOB 4JI8Q 2LZ6A 1SLJA 3P4QB 1ZXHA 3NQTA 3VFKA 2K5DA 5C5LA 2MRPA 3A8KE 1TT2A 5BN3A 4Q5VA 3KUZA 4JI3Q 2REXA 4YTPB 4LJPB 1NBFC 3KUDB 1WX8A 5JEAG 1LXDA 4EE2A 2X6LA 5EPKA 3EIVA 1EYAA 2A1AA 2MJEA 1IKMA 2V4IB 3EFCA 4YY3Q 3UQBA 1A5RA 1SYDA 1TIFA 4II2B 1J0GA 4P72A 2PJHA 2PPHA 3B1LX 1I6VC 2UYZB 2AUJD 3VQIA 1T0YA 3PZDA 4DV2Q 4K8JA 4KN7C 1P7EA 1X1MA 4WAAA 2A6HC 2O2LD 3I4MB 2D5GA 2PNHA 1CZWA 4JI5Q 1JR0D 4IUUA 2Q8IB 3UDFA 4FHKA 4MGIE 5LLIA 1HA5A 3NQIA 1Q1BA 2F0PA 3WWVA 3GTPB 2RKSA 2VY3A 4G4KA 1UUPA 4C3JB 2HCCA 3ND8A 5AZGA 4A93B 1T0SC 2M1MA 1N5XA 4RG1A 5EAYA 1C7YA 3QQ8B 1LM8B 1H9JA 4HPLB 5E6OA 3DWQA 3NXWA 2F03A 2F0WA 2AWOA 4OXPA 1BCPB 2F0LA 3PUZA 4A93G 2VS1A 4NXMQ 1PFSA 1BR9A 3T3OA 1STBA 3H7SA 2B2UC 1F9JA 3JSVB 4FF1A 2E2JB 5BYRA 3Q8BA 4M8NA 5JJZA 1NMFA 1QUQA 5CMDA 2PW7A 5JOBA 3S2DB 3V62A 1JB3A 3D4DA 4R4IA 1XPUA 2D3AA 1R4PB 1BDOA 3T8MA 5BMIA 3R93A 5M5YB 1FNUA 1EIYB 2C5CA 2L3ZA 4C3HB 2VQEQ 3AE1B 5IYBH 1EZ6A 2MH7A 1HTLD 5JVG3 3LX0A 4KIKB 1GHKA 1V80A 2LD9A 1EOVA 1EY4A 4IOIE 2I5HA 1DM0B 1EY5A 1Q82C 4AJWA 1JALA 1PTOF 4P1CC 3TMPB 2MGSA 2KHJA 5M9OA 2XGTA 2QCPX 2LHDA 2ZVNA 3NBHA 4Q0FA 3GTMH 2V4LA 1VQGA 1EIFA 1UEAB 1IGDA 1WF9A 1CUKA 1UWVA 2KA7A 3DVGY 4BBSH 3UI2A 2BKFA 1IW7D 1KRHA 2G5DA 1TY2A 2Y0SB 2DZJA 3I63C 1CZGA 5IYDH 4W9DA 2F0OA 4H7BA 1GAQB 2CU1A 1TTNA 1LTSD 5M5WB 2LRWA 4KGRA 3HOXB 4NQKE 2LGIA 4R3DA 4A3EB 3FPPA 3CSFA 3V96A 1L0VB 4NW2A 3PIPA 1YBYA 2LVPA 1FXTB 1WR1A 3ONAB 4LNOA 1PH4A 3AEBB 1M4VA 3HOXG 1F9QA 4FN2A 1BUIC 4A3EG 1V86A 1K3RA 3CHBD 4OL7A 4V0BA 1F0ZA 1TWFH 1N33L 2IGDA 4MN3A 3ECIA 4GLAC 3Q8FA 4HSVA 2KQSA 3B2GA 4JI6L 1ESRA 3VA7A 2I07B 2EOTA 4C4VA 4RKBA 4DA2A 2N4FA 1PFNA 5E3FA 1SNDA 3M4YA 1U0LA 3CMAA 3I73A 2X69A 1N32L 1C8CA 1ET9A 1A62A 3AH7A 1F2MA 2CWPA 1E0ZA 3SU8X 4KN4C 2JA5B 1EY8A 1WFQA 2AL6A 5IOIA 1L0WA 2W82A 2KHSA 2M0XA 1NI2A 5D94A 4LF9Q 1EWCA 4XWWA 1Z47A 5EKKA 1C0AA 4RF1A 5BYSA 3PO3H 1J19A 1N6ZA 2JA5G 4WFN3 2MNAA 1IBXA 1B70B 4LF5Q 2EXDA 1TXYA 5I9OA 4QIWB 4DR7Q 5FK9C 2KHIA 1SROA 4XT1B 4F7XA 2KCCA 2H89B 3E3XA 1QZEA 4R4TA 1FCCC 1YQ4B 5FO8B 3PHWB 2BYEA 4F8CB 4FHJA 4NZLB 3GTOH 1CHPD 3RZOB 4ME3A 2BA0A 4LW1A 3H0GG 3RNEC 2KN4A 3NSWA 3OMGA 3GTJH 1GO3E 3D6CA 5MPOA 2WAQB 3H6MA 2N88A 2UXCQ 2PE9A 2E76C 3KDFA 1F9SA 3RULA 2BA1A 1AFPA 5IP7H 1R4NB 2NVTB 2RHQB 2SEBD 2LGDA 3S1NB 3QA8A 2M56B 2WU5B 3TZUA 1HZCA 2JYOA 3K80C 1LQBA 2B3GA 3PV0A 4OO1G 3CMMB 2Y3AA 1DGSA 3W1GA 1WTXA 4LF6L 4A4IA 1OXVA 4ALPA 4DR5Q 1Q3LA 5IGBA 1I50H 1V49A 2MBQA 4KJNA 2OEDA 3FILA 3FRPB 2KC2A 1WD0A 2PW9A 1XWEA 1LO5D 5DM63 4KY7A 1LGRA 2K8CA 3PTFC 2HUGA 1TBEA 1W6KA 1Z2MA 1BKBA 4DUYQ 2JA8H 1YNND 1F2RI 1E2ZA 2KVMA 4L5RC 3I70A 1JE4A 4PYUA 1CQVA 4WAFA 1V43A 4FP5D 1C79A 1X9NA 1QOBA 5J22A 2G9HD 3HOYB 4OO1I 2PIAA 1MJCA 3ER0A 4CHTB 1J7AA 4Y52H 2JXXA 2KN5A 3AECB 3K7AB 5M3FB 5CV9A 2HHHQ 3DCGA 3H8HA 4TUUA 4DNTB 2GRIA 2KFKA 2R7ZB 1NBWA 4ZYSA 3ND9A 4IUMB 2PZWA 4BKTA 4GSWA 5M3FG 1PH7A 2NVXH 1L5PA 5GAHC 2ZPYA 1W3SA 4H0LC 3S15B 3NS1A 4U68A 1LACA 5JVH3 4F87A 4JIOU 3DEOA 3HHMA 4P7IA 3OPOA 2CQAA 4GS3A 1DOLA 2ZCCA 2WKDA 5FLXE 2BDOA 4TMAB 5FO9B 4A3IH 4KY5A 4B0EA 3TREA 1TWAH 1G291 2QDBA 1T5XD 1UEBA 3VR9B 1RKNA 1MJDA 4L5SA 2CU3A 4H13C 1Q8KA 2GOWA 1TWHB 1ENCA 2ZNVB 4KGSA 3SFDB 1RRBA 4IDIA 1LYLA 1B2TA 4P2CB 2K0PA 1YNJC 1F77A 4TKNA 4AOFA 5DCNA 3KFUA 4PS7A 1Y8PB 2NUCA 1DD2A 3HM6X 3VTVA 2WDTB 5KEEA 3U7ZA 2BH8A 1D4BA
chains in the Genus database with same CATH topology
3FAHA 4JBWA 5C4HA 4HEA1 2VUMB 5KRUA 2LMCA 1ILQA 3NRZA 3OOCA 2R92B 4HRSA 3SK8A 3AU7A 1S5CD 4KX6B 2OT2A 3ZYYX 1P7FA 3MXUA 1J9OA 2W54A 5C0XH 3QIAA 3AE3B 1Q1EA 3MZ5A 5ISRA 3DWGC 1STEA 1SYEA 1NUCA 3QJYA 4Q2JA 2JYEA 3L3OC 3GTQB 5J1ZA 4WQMA 1D5MC 2EYOA 2BE5D 1DCZA 2GI9A 4KY6A 3EGRA 3DUZA 2OHFA 3ZQ4A 1SF0A 2Y5CA 3B2FA 1HRJA 1AWDA 3VRAB 2BOSA 4CKCA 1F9PA 1ACCA 1EM7A 2RA4A 2EJGC 4WJWA 1OXTA 2IX3A 5IT9L 1ZE3D 4DGZA 3S9WA 2D9UA 4KV6A 3WOEA 2B2TA 4YIJA 3P1HA 2QIEB 4EQPA 2VZKB 3I72A 1E0BA 3I4LA 1EIHA 5EE9A 5M5XB 1O7LA 5CV7A 4CBVA 2BS3B 3SXHA 3HS0C 5KYIA 2PMZB 2Y5PA 1PGBA 3J7AV 4P6VF 4IZ8A 3VYUA 2BDNA 4US8A 1CQFA 1MPEA 2Q5WD 2Z4IA 2J52A 3BK2A 3ZJUA 2WS3B 1Y69U 1JWUD 1LTBD 3LNNA 3OWFA 4B08A 5HI1A 4XE0A 2EZVA 4C2MB 2L83A 3NVYA 1JRPA 2VZKD 2WLBA 1PFMA 3HVDA 1QILA 4HCEA 2B2TC 1IHZA 1CM9A 1NSNS 3KQ4A 1JORA 2XRQD 2EY5A 2F0IA 4CJ0B 1VRAB 5F2DA 4DQOC 4FVMA 3GO5A 2R3ZA 2MHVA 2K3UA 4BS9A 2LFIA 3BS1A 3MHBA 4HJGE 2KAJA 5KNBA 4DXFA 1AZQA 1V1PA 3B9JA 1J7CA 1IW7C 4TQ1A 3K5NA 4L63B 5JXVA 5E4WC 4YTMB 3NTIA 3W1SA 5G3LD 2RDGA 4FF4A 1DGJA 1K52A 3WDNA 3KBGA 4B9WA 2KACA 3P4PB 3VR6A 4M8AA 1FGBD 2PYKA 5T1GA 1I7HA 4TQUS 4A8XC 4CKEA 4N59A 3U9OA 1GOZA 3HEJA 1BXTA 1E9MA 1QLBB 1HHVA 3LWEA 5JAVA 1SNPA 1EY0A 1WTPA 3LXFA 1SBBB 5A2QE 1HQRD 4IQZA 2QF7A 1WTVA 4NDXA 3IXSA 1XTCD 1RD9D 5EKIA 3M7GA 3GTMB 4REZA 1A3TA 4ODGA 4Z9CB 3U4EG 5DNFA 4JK1C 4BBSB 1G8ZD 3RLFA 4P16A 2WXPA 1C9FA 5EBCA 2NTSA 4ZOHC 4OZCA 1TS4A 1J8IA 5EBDA 3MA2B 2WXRA 1PLFA 3R8BA 1D5XC 3T13A 3AE2B 3A8IE 1SYGA 3PUWA 1QQRA 1F2ZA 1FD7D 1TWFB 1Y1WB 2HDLA 2INPE 1MI0A 3AE9B 4IKGA 1XEEA 2F0DA 2HQEA 3MWYW 1YNNC 1Q8IA 3J80L 2H88B 2AQ3B 2XRSD 3IAM1 1F2RC 2PLPA 4K5VA 1EYDA 3EQLC 1E2VA 4RF0A 3A7AB 3P20A 3OW7A 4FXDA 5H92C 2OXPA 1UGJA 4L1BA 2K03A 2Z4HA 4U673 3PO3B 2FBWB 3D8GA 1ESFA 3NTHA 2EY1A 3LYYA 4JE3B 1IKLA 1BO0A 3OIPA 1QOAA 1A3UA 1A70A 1NYQA 2L12A 1DOKA 1TVXA 4EGVA 3GTOB 1JW9D 1LV9A 1DJRD 1EY9A 2VXWA 5C0XJ 1WRIA 3CWIA 3GB1A 5ELBA 1R7SA 4TQ0A 1SNMA 3NP8A 2HCIA 4MH8A 2F0UA 3AMUA 3KBXA 3I57A 2R6GA 4N9PA 3J7YW 2L32A 1YN3A 1EZ8A 1B1ZA 4DNRB 1AYFA 3GS2A 2FUG1 3IAYA 3H91A 2PVOD 2TMPA 1XXGA 1I50B 2J4XA 2K22A 2JA8B 2EPBA 4ZLTF 3U52E 1HXYD 2FMCA 5LL6X 5EJWA 4G57A 4WORA 3W5UB 2EYLA 3T3NA 3AEFB 1QOHA 4FF3A 5C2TB 4ZQ3A 4ARCA 1YJIA 2F0HA 2FHTA 3L4PA 2LMCB 5G5GA 2ENBA 5A35A 4WIPA 2H4OA 2NVXB 1UNSA 5CV5A 1KDCA 1FIQA 2Q8TA 1ZKOA 3X3NA 4IFDJ 1QOFA 4FXGC 3IAS1 4ULLA 1YJJA 1NCVA 3I8ZA 4LK0M 4K2KA 4A3IB 1F9RA 4NAWB 1WSPA 1TWAB 1Z7TA 2BE5C 4PT5A 1TKGA 2A69D 1SB3C 4RAUC 2IGHA 3AE5B 4HROA 2F0MA 3TEYA 1EQVA 3JAML 4KKJA 2WXFA 3MHZA 4H44C 5K36G 4CGYB 3Q22A 1U9RA 3NHHA 3HRZC 3SHLA 4I65A 4AS1A 1OQQA 2F0FA 1AW7A 4ILWA 3Q8AA 3GTKB 4HMJA 5C3JB 1JCKB 4NMZA 1KF6B 2KUMA 2ONQA 1KTKA 4BWGB 2F0NA 1C48A 1D2BA 3SK4A 4FYDA 1TS3A 4XTCS 3DM1A 4HN7A 1RDPD 3T51B 4XT3B 5C0XG 3VR4A 1SE4A 2RPVA 3MXNA 1RM6C 4GZYC 3I90A 1I6HB 2D5DA 2PNRC 1V8CA 5EPJA 2NWGA 4KGTA 1FYCA 2WQYB 3VA5A 4CKBA 2NVQB 5C0XI 3CIRB 1B9RA 4ARIA 2BW2A 4RGNA 1PGAA 2ZW1A 5C5MA 1ZP0B 1JROA 4QB4A 3J81L 4BA2I 4AYBB 4RHSA 1FRDA 3BDOA 3IKJA 2F0SA 1PRTD 3KLRA 3NTKA 4BBRB 3C2PA 2AX5A 5D3DA 3CU7A 1CHQD 2CJNA 2K32A 3IFTA 1DOIA 2DNEA 1L6UA 4K8IA 3SFEB 4IFDG 1RWSA 4N6EB 1RCVD 1T5EA 1KABA 2F0EA 3EA6A 2JYTA 1HTPA 2G1EA 3HVZA 4WURA 2K33A 1V8QA 1JWMD 3Q0AA 1K8MA 5NUCA 2L1AA 1KH0A 4KD3A 5AFWA 1WD1A 1AN8A 3M4OB 1EU3A 2IX0A 2AUKA 3C3LA 1JC7A 4IFDI 1L0YB 2WV6D 3HOWB 5E1FA 1I4GA 2CVRA 2N7JA 1UWMA 3FEWX 2O5IC 1WVLA 5I4DA 1D6EC 4OHJA 2F0QA 3O13A 3J9CA 1GUTA 3E0JA 2JX5A 4A55A 5CORA 3H0GB 3S1MB 2DYMA 1STNA 1PFBA 4ZRZA 1C4PA 3S14B 4LJZC 2H1EA 3PO2B 4ZRPA 3KF8A 1A15A 4X3SA 1WXQA 4ME5A 2KJXA 3T16A 2L11A 1FD6A 4XQJA 2KMMA 3W9CB 3PO0A 1K8OA 1N5WA 5KGUA 1ILPA 1WTRA 1GB1A 2KQ3A 2CJOA 2PKOA 1WYGA 1BQQT 1EY6A 3P42A 1X32A 4UAIA 3MAQA 4USAA 1QNKA 1KFYB 2I2YA 2AWNA 4XQNA 4IUTA 1I4XA 1QKZA 1O7YA 4KD4A 3Q69A 4YT0B 2M19A 4KI0A 4JPSA 1PZJD 1STAA 2RDFA 1CA6A 1ML0D 2EY2A 2TSSA 3BVMA 3A8JE 4RHRA 4DXGA 4LMQD 1JQ4A 2W3SA 4YXDB 2C9OA 1SYBA 1TZOA 3TEXA 5C6AA 5T8IA 5IGEA 1L4DB 1MBYA 3C46A 5BN4A 2AQ2B 2A73B 5LNK1 1VZ6A 2B8GA 3SDZA 3AE8B 5H8YE 2RDHA 1AZPA 4MT5A 2A6ED 5IT9E 1U4MA 4OGQC 3AE6B 1DZ1A 5K36H 2RMMA 4OZBA 2IJ0A 5C4XB 2B8FA 1S5DD 3DWPA 2QMTA 3Q24A 3GTLB 5HGTA 3E5SA 3NZ3A 3AEGB 2K04A 2ICIA 1STGA 5FOBB 3T56B 2V3NA 4OW0A 4K6LA 3MFYA 5KIXA 3VR3A 1N63A 1PDXA 1JOOA 3RZDB 3H94A 2IT1A 3K5LA 1XX8A 1S5FD 3NWTA 3S1RB 1YN4A 3MJ5A 2N9KA 3D4WA 1D5ZC 1RTOA 3C8YA 3PZ8A 4DAVA 1I4HA 2IDYA 1K50A 2A69C 4A3DB 3BDLA 1G91A 2JSOA 1EEFD 5LHY1 3S1QB 3V2TA 3VYRA 1FEHA 5J39A 4LLGM 1EIGA 5C4JB 2ACZB 1LT6D 4M0WA 3NVZA 1SAPA 3Q8CA 3PMFA 2WXGA 4FF2A 3P4RB 1RFKA 3LWUA 1EL0A 3NVWA 1IGCA 2WB1B 2F3VA 1VMPA 4L2YA 2MP1A 1M8AA 1W6JA 2K6AA 3OSOA 5CGKA 1N62A 1SSNA 3K59A 3E56A 1I4QA 2E74C 2BS2B 3W2DA 1SDFA 5FLXL 4XYOA 1OQRA 1C4CA 2IX1A 2JEBI 2JE6I 3GD7A 1DOMA 1GUGA 1XLQA 2QSDA 3DHQA 3EUB2 1JQYD 1VLBA 3AV8A 3M7NA 4IUVA 4IFDH 4K2LA 2NMQA 1TU2B 3BYYB 1VDZA 3L9AX 1Y8OB 3NWSA 3ETRA 1ZDXA 4HCSA 4K5WA 3SEBA 1BOSA 2NZ1D 2XNAC 3D31A 1B3AA 4QUFA 5ELCA 5T1IA 1QT9A 1GUNA 1H9SA 4WWMA 1GJXA 1HPCA 2MEKA 1MHXA 3IT4B 1VZ7A 4HTHA 2SAKA 1YQ3B 4PMWA 2B2WA 2M2LA 1TIID 4WH4A 1XCQL 1L0XB 1HUMA 1IL8A 1PRTC 2F0JA 5BN5A 1FRRA 1KNEA 1LTRD 2E6XA 5EPLA 4A6QA 2PVGC 4IUNA 1SIJA 2HDMA 3KUPA 3MXPA 3NBIA 2EYPA 2L1BA 1ZOYB 4HKZE 2J53A 2WP9B 1CA5A 4XWTA 1SYCA 2A74C 2EYMA 3N52A 2F0KA 5HHDG 2BTEA 2E2DC 1SNCA 3ERQA 3G6JB 5ELEA 3MEHA 5EQ0A 1B50A 4TSSA 2KDMA 1QCBD 3ZGZA 3J80E 4RNAA 3QOJA 1GPXA 3K57A 4DF7A 1EQTA 2DYOA 2WXHA 4D2KA 1MGSA 3A56A 5D7GA 1IYUA 4K6DA 1KLGD 3AE7B 2YYZA 1C78A 2E3TA 4PMBA 2WXKA 1YN5A 1C4QA 3E6ZX 2PW5A 4K14A 5D3IB 1DOXA 5G3LF 2O5JC 4YSZB 3PUVA 4KKUA 2EYFA 3BVZA 3URYA 4G7OC 2O4XA 1FXIA 2XWBB 3TEZA 1MHHE 4QF4A 3TP8A 1TQOA 4A3GB 2K28A 3AN1A 3R2IA 2YEPB 4XYQA 3T4AC 3HKZB 2LHEA 5HFYA 1ZYRD 2N9LA 5IODA 2PMVA 2OF1A 3L7ZC 1RF2D 3PZ7A 1IBXB 3TSSA 3AEEB 1STYA 2IGGA 3RFZB 1VR9A 3M3YB 5IGDA 1DXMA 2LKVA 2DY7A 4ABNA 3D3RA 2EE1A 5KNDA 4C1NI 4IN3A 1A2TA 2XSCA 1WWTA 1WGKA 4NKLA 4A9AA 3OIQA 4OIJA 3HGBA 1SFOB 4YWGG 2XVSA 3QB3A 2LUMA 4KHVA 5KYLA 3BK1A 1OXUA 2WXNA 3FILB 1MVKA 3P4SB 1BUVT 2MJDA 3DXJC 4IURA 2KEDA 1HQMC 1XO3A 2PPBC 1BNZA 3S16B 1TWCB 1Q10A 3RUZA 2RSOA 2L5TA 3MXGA 3EFXD 2B2VA 2NBFA 2IWHA 2K05A 1PFDA 2BS4B 1I3QB 5GXGB 4NJCA 2YEPF 3JAME 3H3VC 1SYFA 1H9KA 3KLSX 2DBYA 4M1UB 2A6EC 4G7HC 2ID0A 1E6EB 5CV6A 3HUIA 1QWYA 3E9SA 3EVQA 1E2WA 3QWNA 5A2QL 3U2SC 1C77A 3V05A 1IYVA 3TEWA 1VMCA 2WKCA 4L6TB 1SE3A 4CJ2C 4H2AA 1E10A 1LTGD 1BBXC 2F0TA 2B76B 3MFGA 1RYJA 1Q12A 1D1IA 1NYRA 3AB9A 3BYTB 2KQ4X 4UDUC 2J42A 3A7LA 4DFAA 1C4AA 2B2VC 1O7ZA 1HFNA 3MC0B 4ZK9B 1OFFA 1EY7A 2D62A 1LTID 1ZUD2 1GHJA 3VYTA 1PZID 5M3MB 4OVZA 3HZXA 1MSGA 3FC4A 5DEHA 3S17B 4A90A 2QKIC 2DY8A 3HP3A 1D1KA 2PO4A 4IUQA 3KWVA 4N9TA 1N60A 1X3PA 4S3SA 4Y7NB 5FR3A 2LJIA 3J81E 1EU4A 1WCMB 2WNMA 5AUKA 3AEAB 1L4ZB 3GV6A 4DAYA 1FNWA 2L0CA 1PGXA 3DMUA 1SJHD 1GUWA 1LT5D 4XDDA 2OEOA 2WXLA 2ZT9C 4ZUJA 4DU9A 3PIO3 1GUOA 3GP7A 1FXAA 1YMHE 3FVQA 3VR2A 1VF5C 3AMZA 3J7AF 1FCLA 4X3KA 4C7ZA 2B2UA 3TP5A 2K7VA 1ZXIA 2VB3X 5C44B 3ZJTA 4CQNA 1PRTB 2K5QA 3FKIB 4ZKBB 3HRDD 4LK1C 1FO4A 1ET6A 4HKQA 3P1MA 2PZUA 4EQNA 2F1MA 1VDVA 4QMGA 2IPKD 4RFBA 3AEDB 3SK6A 5IGCA 1NVID 5HG2A 1U4RA 2XN9C 3OWEB 2DWQA 1A3VA 5CBAE 3CRKC 4HSPA 2WDVB 1PTOD 1H9RA 1H9SB 3VRBB 2KEEA 3SVMA 2MJ8A 5IGGA 4C3JG 1QE6A 2A68D 1V97A 3P75A 1KDAA 4MM3B 5TSSA 2EYJA 1Q90A 1WTWA 4LTUA 2PQEA 1LABA 1CFMA 3NE5B 1NAPA 4E6IA 1I4RA 4JWSC 2GB1A 4R8NA 2FMMA 2NB0A 4HEDA 5I6YA 4OZAA 5KNCA 2V4DA 2Z8LA 3GV3A 2E75C 2M9VA 4C3HG 1V1PB 3DWMA 1J7BA 5AUIA 1QF6A 3K58A 4FXCA 4KK7A 1NENB 2WXJA 2INNE 1ZDVA 1SNQA 2BT6A 2CW0D 1B44D 1NR2A 1G2SA 1BCPD 4DK0A 1FM0D 1TKYA 2EXZA 3BG3A 1SSOA 1PRTF 3UI3A 1QG7A 3BZDB 2N55A 4I7ZC 2QEJC 4FO2A 3EROA 4IALA 4BY7B 4LAAA 5IOCA 4KTAA 2L4NA 1UAPA 3K5OA 4K5XA 3PUYA 4RGMA 1F2YA 1VCIA 2V0GA 4EQOA 2X38A 1KAAA 2LEKA 2JZPA 1TJEA 1CK1A 1ZYRC 2B63B 3OMCA 3IT6B 1BCPF 1LTTD 2F4IA 4C1NK 2WDRB 1PUTA 2XWJB 1II3A 2EJMA 4A3KB 4NAMA 4MHEA 2KECA 1Y1VB 5EKLA 4DN4M 1SXTA 2FINB 4QCLA 1IUEA 2L55A 5CR3A 1ENFA 1JOKA 4C3IB 3GQBA 5C3EB 1RODA 4ITKA 4AQ7A 1ZPSA 3MTSA 4C3IG 2ZXOA 2JSVX 3AB5A 1TWGB 4B9XA 2GA4B 3W3AA 3D4RA 4RGOS 3Q8EA 2K01A 4RCOA 3I9V1 2K5PA 2SNSA 4L8JA 3ABVB 2MUYA 2VB2X 5CYUA 1PZKD 4F88A 2F3WA 1B9NA 3FDTA 3A54A 5BMHA 5JPNC 2WU2B 1A2UA 4F8MA 3QOLA 4RA8A 5I9PA 1FMAD 1GB4A 4C7YA 1TY0A 1Z6HA 4ZHOA 2JP1A 4RWSC 1R4QB 2NYZD 1K51A 2QJLA 4RGTA 4J1MA 3BWUD 1DONA 1HFGA 1S5ED 1ENAA 1CT1D 2ICEC 3F2UA 1XYIA 4A3JB 4X3TA 5EE0A 2ZXPA 4R9WA 5DAUA 5D14A 4ZAIA 3NVVA 5EE1A 4BY1B 5C3WA 1R9TB 2FE8A 2I38A 4GLSC 2G9DA 2M00A 1Y56A 2F0GA 1EEID 1TR5A 1SMYD 1RJTA 4G7ZC 1SJED 3Q6SA 1TKWB 2M0AA 3K0YA 4O1NA 4QUCA 1PTOH 2NN6G 5JEAH 1HUNA 1QNUA 1CTMA 2WINB 3ZJVA 2F0VA 1C76A 1AP0A 2Q8RE 1FR3A 3KLSA 3VR5A 2WXIA 2DLBA 2I46A 2NN6I 2KOLA 2L9HA 4J6HA 3SE0A 3KWLA 2A5HA 3QO2A 3CRLC 2SOBA 1RTNA 2DN8A 1SEBD 2MJ3A 1U4PA 1HZ6A 1DOYA 4DK1A 5C3XA 1EOTA 4KMUC 1FNVA 5CV8A 4NP5A 1N61A 1ZEQX 1EWHA 2B39A 1OO9B 4XDCA 2ZXRA 4B0MA 4OIKA 3NK9A 2PTLA 4XXEA 3VR8B 2WIIB 2PZTA 2JA6B 4DAPA 2E2IB 1K53A 3CKIB 1MD2D 4FNFA 3NUHB 3PUXA 3V3XA 1OXXK 1JWBD 2WACA 3C1FA 5G5HA 4YTNB 2BYTA 1S5BD 3N9YC 1LLRD 2PCFB 4J3OD 1VJKA 3K6OA 5CC4A 1GXDC 1EWYC 2X6GA 2W3RA 1SE2A 2A6HD 1PTOC 5BMGA 1VZ8A 3P7JA 2JU6X 2A68C 3DEPA 4JWUC 3T53B 1O80A 1TS2A 4A3BB 1Y8NB 5BYQA 3I4NB 5I6WA 1EFID 1XLOA 2JXMB 2RQXA 2ON8A 1NR4A 4BA1I 2B2YA 1FFUA 1NI3A 1H9MA 4A3FB 3RPFC 1LT4D 4A3MB 4GDKB 4C56C 2N0SB 3WOFA 4JX1C 1LTAD 5IGFA 1O78A 1JICA 2EKIA 2CW0C 1I4PA 3RD4A 1TYGB 1HEZE 1BCPC 2B2WC 4PQXA 2J7ZA 3Q23A 1B9MA 2BB5A 4R8IA 4RH6A 1XLPA 3BIID 3IL8A 4PMCA 1U4LA 1DYQA 5FO7B 1CZPA 4KHZA 2RSNA 3LB8C 1XLNA 2ZW0A 5C4ZA 2EVBA 1A6XA 4MACA 2KWDA 2EYHA 3MVVA 5ELDA 5E4XA 1ONLA 4ID6A 2JQRB 2Z1CA 2BB6A 2EELA 4C80A 2V3PA 3AE4B 4OO1H 4HR7B 2B2YC 2L52A 1STHA 2WDQB 3HOZB 3TBIB 3X3MA 2KCNA 5COYA 1PMRA 2EDGA 1WTOA 1GUSA 2WXMA 5IIFA 3MP9A 2HTME 3HG9A 4YSYB 2NVYB 4N58A 4GDLB 4IUPA 1YNTE 4HMIA 2CHBD 2NTTA 4ZUIA 2BBCA 2W55A 3SR6A 2WXOA 4ZKCB 1L6VA 5DM73 1EYCA 5I2XA 3PIP3 3N6RA 3QG1A 3C1EA 5EE3A 4TKOB 4US9A 1MSHA 1ICWA 2XIWA 4XDXA 3RMHA 1PYWD 1KLUD 3D6WA 1WTQA 1QB5D 2SDFA 1HZ5A 2EY6A 2EJFC 3M85A 2LY7A 5K5PA 5CV4A 1LT3D 4RCNA 4KKIA 4KJOA 1XF5L 2LS01 3TN2A 2QILA 2NN6H 5E6JA 3K5MA 1PXUA 4FXKC 2WP8J 5JPMC 4XIGS 2IL8A 1K83B 1JWSD 3OHXC 3AM9A 5JEAJ 3KK7A 3SK5A 4EVOA 1HCZA 2AQ1B 5EGTA 1S4ZA 2RBMA 5I2YA 3TMEA 3BDCA 2SNMA 3WCQA 1G6ZA 2JWUA 2JXTA 1TS5A 3IFDA 4XQQA 4RKLA 1QJOA 4TRDA 4ZHPA 1PDQA 2FFKB 4CJ1B 5D65A 1ROEA 1TKEA 5LL6S 1BMLC 3CQZB 4KKSA 3I91A 1OXSC 1RHPA 3GTJB 3H09A 3HOVB 2MPMA 3P63A 1SNOA 1CJEA 5CBEE 3S2HB 1X3QA 3FPUB 2JEAI 1V1OA 3W5VB 4J8QA 1HA6A 1SMYC 2LFNA 4HAEA 3NUCA 3TZDA 2YU9B 3U9SA 3VYSA 3ITPA 2R61A 1CI3M 1JMLA 1VF7A 1MI2A 1G2TA 3I3CA 3GTGB 1QOGA 2JA7B 1XCTL 1UWXA 2E2HB 1NEKB 1YNJD 2K9XA 3DWAA 2D2CC 3TDQA 4ZRQA 3BVGA 5HURA 4PNYA 3TUOA 4YSXB 2R93B 3SR1A 2K1BA 1B4OA 2WXQA 1KNAA 1FFVA 5ELFA 3HOUB 1E7PB 2J0TD 1BF4A 4MIUA 1ZXTA 4PV1C 2HDEA 1T3QA 2VNUD 1B53A 3TP7A 2IW3A 5FKAC 1JOQA 2K5WA 3A55A 2DNCA 3G7LA 3FMCA 3NPPA 3EJIA 4X3UA 2FJ2A 2RVLA 4WRDA 1T6BX 1JWAD 3R2TA 4O42A 1AEXA 1F2LA 4V190 4L23A 2BCOA 3R3OA 3TP6A 1KDBA 4KKTA 1PTOB 3P4QB 1ZXHA 3NQTA 2K5DA 5C5LA 3A8KE 1TT2A 5BN3A 4Q5VA 4YTPB 5JEAG 4EE2A 2X6LA 5EPKA 1EYAA 2V4IB 2MJEA 1IKMA 1SYDA 1I6VC 2AUJD 3VQIA 4K8JA 4KN7C 1P7EA 2A6HC 2O2LD 3I4MB 2D5GA 1CZWA 1JR0D 4IUUA 2Q8IB 1HA5A 3NQIA 1Q1BA 2F0PA 3GTPB 2RKSA 4G4KA 4C3JB 1UUPA 2HCCA 3ND8A 4A93B 1N5XA 1H9JA 3DWQA 3NXWA 2F03A 2F0WA 2AWOA 1BCPB 2F0LA 3PUZA 1BR9A 3T3OA 1STBA 2B2UC 5BYRA 4FF1A 2E2JB 3Q8BA 5JJZA 5CMDA 2PW7A 5JOBA 3S2DB 1JB3A 3D4DA 1R4PB 1BDOA 5BMIA 3R93A 5M5YB 1FNUA 2C5CA 3AE1B 4C3HB 2MH7A 1EZ6A 1HTLD 5JVG3 3LX0A 1GHKA 1EY4A 4IOIE 1DM0B 1EY5A 1JALA 1PTOF 2MGSA 5M9OA 2QCPX 2LHDA 3NBHA 4Q0FA 1UEAB 1IGDA 2KA7A 3UI2A 1IW7D 1KRHA 1TY2A 2Y0SB 1CZGA 2F0OA 4H7BA 1GAQB 1LTSD 5M5WB 4KGRA 3HOXB 2LGIA 4R3DA 4A3EB 3FPPA 3V96A 1L0VB 4NW2A 3ONAB 3AEBB 1M4VA 1F9QA 1BUIC 4OL7A 3CHBD 4V0BA 1F0ZA 2IGDA 4MN3A 3Q8FA 4HSVA 3B2GA 1ESRA 3VA7A 2I07B 2EOTA 4RKBA 4DA2A 1PFNA 5E3FA 1SNDA 3M4YA 3I73A 2X69A 1C8CA 1ET9A 3AH7A 1F2MA 1E0ZA 4KN4C 2JA5B 1EY8A 2W82A 2KHSA 1EWCA 4XWWA 1Z47A 5EKKA 5BYSA 4RF1A 1IBXA 4WFN3 5I9OA 4QIWB 5FK9C 4XT1B 2H89B 4F7XA 2KCCA 1FCCC 1YQ4B 5FO8B 4NZLB 1CHPD 3RZOB 2BA0A 2KN4A 3NSWA 3OMGA 3D6CA 5MPOA 2WAQB 3H6MA 2N88A 2E76C 1F9SA 2BA1A 1AFPA 2NVTB 2SEBD 3S1NB 2M56B 2WU5B 3TZUA 2JYOA 3PV0A 4OO1G 2Y3AA 1WTXA 1OXVA 1Q3LA 5IGBA 2OEDA 4KJNA 3FILA 3FRPB 1WD0A 2PW9A 1XWEA 1LO5D 5DM63 4KY7A 2HUGA 1W6KA 1YNND 1F2RI 1E2ZA 2KVMA