3BVZA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type C-3
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvzA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvzA01
2IPKD 1LT3D 1JWSD 1SXTA 1JCKB 1PRTF 2RDGA 1FNUA 1ET9A 1HA5A 4K6LA 1PTOD 4TSSA 1FD7D 1RF2D 1AN8A 4RGOS 1SJED 4NZLB 4RGMA 1YN4A 1GOZA 1JWMD 3EA6A 1PZJD 1S5FD 3URYA 1I4QA 2R61A 1SBBB 3GP7A 1ENFA 5ELCA 1S5BD 4ZYSA 1EU3A 1STEA 1SE2A 3CHBD 4UDUC 1BCPB 1HXYD 1PRTC 3BYYB 1KLGD 1XXGA 1D5MC 5ELFA 3MFGA 3EFXD 1TS4A 2NTSA 2CHBD 1CQVA 1M4VA 1PZKD 1V1PB 1BCPD 1ESFA 1TS3A 4L6TB 1LTRD 1D5ZC 1LT5D 1T5XD 1V1PA 4RH6A 1I4HA 1QILA 3DWPA 1PTOB 1JWUD 1LLRD 1D6EC 2AQ1B 3V05A 4RHSA 1PYWD 5TSSA 1LO5D 2WV6D 2XNAC 3BZDB 3W2DA 5FK9C 3R8BA 1TY2A 4OHJA 4DXFA 1BXTA 1S5DD 2IJ0A 2Z8LA 4C56C 3KLSX 1YN5A 1RDPD 1HQRD 1I4RA 2NTTA 1LTSD 1CT1D 1LT4D 2AQ3B 2ICIA 1XTCD 1UUPA 4RGNA 4DXGA 1CHQD 1PRTB 1RCVD 1LTBD 4L63B 4RCOA 1MD2D 2AQ2B 1FNVA 1EU4A 1I4GA 1V1OA 1PRTD 3BVMA 3DWAA 5ELEA 1HTLD 2XRQD 1EEID 1TS5A 2XN9C 4O1NA 1S5ED 4RHRA 1EEFD 1EFID 1SE3A 1CK1A 3BVZA 1JR0D 1DYQA 3BYTB 1B1ZA 2G9HD 1LTAD 5D3IB 4Z9CB 2J4XA 1ET6A 2O2LD 3MC0B 1AW7A 1BCPF 1G8ZD 1RD9D 5FKAC 5D3DA 1DJRD 3R2TA 1I4XA 1UNSA 1SE4A 1FGBD 5ELDA 1YN3A 3BVGA 3R2IA 1CHPD 1KTKA 1L0YB 1I4PA 1PTOF 1S5CD 3OWEB 3SEBA 4RFBA 1FNWA 2XRSD 1L0XB 1SEBD 2QEJC 1TS2A 1KLUD 1LT6D 1LTTD 3TSSA 3O13A 4BWGB 1F77A 2TSSA 1BCPC 2RDHA 1LTID 5ELBA 5I4DA 2QILA 1JQYD 1PZID 1SJHD 4RGTA 2SEBD 1EWCA 1PTOH 1TY0A 3DWQA 1PTOC 1B44D 1LTGD 1D5XC
chains in the Genus database with same CATH superfamily
2KCNA 3FC4A 1W6KA 1SIFA 1Q5WB 3HP3A 4G7ZC 2Z6BA 4L5SA 2B2UA 3OOCA 3NPPA 5IGGA 1LQBA 1VJKA 3N1ZC 4IZ8A 3IKJA 2YLMA 4RGOS 4OELB 2GBKA 1YJ9A 1EY0A 1W6JA 4HKQA 3S15H 2FMCA 2OEDA 1STYA 3GV6A 3GP7A 3Q22A 2MJ3A 1X32A 3OTOQ 1CJEA 1WXSA 3EFUA 1STEA 2LZ6A 4IO9A 3CCSA 4M8NA 2AUKA 5IGFA 3IFTA 2HDLA 3HZXA 3F2CA 4GKKQ 4A9AA 4MJSB 5GQOA 5KNCA 3L13A 3QWZB 1I42A 3GTOH 1LLRD 3A1QB 2LASA 3VH3B 5IP9G 2AKWB 2DNEA 1PGXA 1TBEA 2LRUA 3BZDB 3GO5A 3P4SB 1VQKA 1TTNA 2FCMA 5FOBB 2F0MA 4AYBE 1F2MA 1TWGH 4ZRIA 4OHJA 2PZWA 2A68C 3E9IA 4QUFA 3GTKH 4NQKE 4ANVA 1EQTA 4V190 2RD0A 5H1SE 3TUOA 3G71A 4WQMA 2KAJA 1PFMA 3AMZA 5EJWA 2WDTB 1D4BA 2B76B 5KNDA 4LJOB 3MXNB 3HOZH 1C76A 2M19A 2A69D 1K83H 3K5NA 2KJ6A 3T3NA 4DXGA 1LXDA 2VZKB 4W9EA 3OG5A 2WNMA 1VQNA 2HIXA 4ZUIA 1JMCA 4I6LB 1N60A 1WYDA 3IFDA 3H7PB 1RRBA 3D4DA 1XNRQ 2KK8A 1XPOA 2WX0A 1MG4A 3I91A 2KNBA 4GOPC 1R4PB 3FKYA 5FR6A 1EEID 1YNXA 3CC7A 1E2WA 4PG3A 1K3BC 1II3A 4XTCS 1TWCH 4YWKA 4IN3A 1KM7A 3P4QB 4TVAB 2Y0SB 5J18A 2LEKA 2VZAA 4RHRA 2ZVNA 1VQFA 1RFKA 1JW9D 1C79A 4BOZB 1VQOA 1U4PA 2WXOA 4FJVB 4JL9A 3HIZA 2FCNA 4MTKA 1QUQB 3TP8A 1YBYA 1ET6A 1T0SC 1WTVA 5C1ZA 1MKHA 5AUKA 3SVMA 3APFA 2K14A 3EJIA 5IT9c 3Q8CA 4DR2Q 1T0RC 1IYVA 5KGUA 5D7GA 3HFZB 3P63A 3UIOB 2MWSB 1I4PA 2ZT9C 3H9DA 4KX6B 1I94L 2C60A 2KDIA 2F0NA 1ILPA 1QOAA 5T1IA 3KVFB 3V6EB 3KDFA 2E75C 4RM9A 2AWOA 3UE1A 4EE2A 5E1FA 4DV3Q 2BH2A 1E8ZA 4OIKA 3D31A 5M3MB 1WI0A 1AFPA 1H8CA 1T5EA 3RULA 4ARCA 2N9KA 4MDKE 1IBKL 2N78A 5KYIA 5E6JA 1SAPA 2PMZB 4ZLTF 3FMCA 2PO4A 4DK0A 4Q0FA 3NY5A 3WAMA 3RMHA 2WLBA 2KQ3A 3L3OC 3SXHA 3SK6A 1GUTA 4LK1C 1WX7A 1E8XA 3HOXB 4BZAA 1FVIA 4X3TA 1AARA 4WJQA 1K8MA 3Q23A 1WCMB 2BBCA 1DM0B 1S4ZA 3F2BA 4GIVA 2PIAA 1C8CA 5IA7A 2KANA 1S5FD 1PH3A 1WYGA 3BIID 3N30A 3KBGA 3UGBB 2NBVB 5JPNC 3DM1A 2VUMH 2I38A 3NS1A 4C00A 1C9OA 3ZJUA 3J7ZC 3PHXB 2V4DA 4JWUC 4XDCA 4ZHOA 1GB1A 4DNIA 1PRTC 2ZXOA 3K0YA 1RL2A 1GG3A 3DBHB 2A8VA 1YX5B 2KMCA 2L1AA 5G5HA 3NHEB 1KC8C 2B3GA 3RLOA 1DCZA 3NK9A 4ZDVA 2K1BA 1JICA 1NUCA 2R7ZG 2D3GA 4ANUA 2F3IA 1DXMA 2P5ZX 3T4AC 1IPGA 2KLGA 4JBWA 1EYCA 4HJ5A 1K28A 2B63B 1W3SA 3ONAB 2CWPA 1IL2A 3SGIA 2JA7H 4B3ML 1HTOA 2MQHA 4DXAB 1EY4A 3J80i 4C3HG 1RJTA 1GC6A 4N9PA 5JEAH 2JPHA 2L9HA 3F2DA 3CCUA 4GN3B 3TMPB 1B53A 2JXXA 1WD0A 1CMXB 4WRDA 1NBWA 1VF7A 4DV2Q 1JJ2A 3VHTC 1U0LA 1SFOB 3PUXA 4I65A 1JE5A 3DDCB 4FXDA 1NBFC 2V3SA 1NDDA 1V1OA 1GUWA 4C7YA 3D8GA 3DWAA 2VQEL 4B3TQ 2JA6G 1E10A 4IM2A 4JE3B 2K9XA 4LFCQ 1NYRA 2M2LA 4IWPA 2F0SA 4HR7B 3E0JA 4O2DA 3PSIA 5EKIA 4GOPA 1Y8RC 2KTRA 5EKLA 3A8IE 4BFRA 4BY7H 4A6QA 1FFVA 2PW7A 2YU9H 3MAQA 1FGUA 2FHTA 1G2SA 3CAMA 4ZAIA 2A68D 2A4ZA 2X6LA 4KVGB 3MC8A 4CKCA 4DR1Q 4L5RC 1UE7A 4HEA1 1VDZA 3AFQA 2H5XA 2WAQG 2HTME 1Y1VH 4Y52H 4J15A 1N34Q 2ZPNA 3CW2C 1ROEA 4IUQA 2A6HD 1X9NA 4HSVA 4IOAA 1KDCA 3QOLA 2N55A 1D3ZA 5EAYA 4IUPA 4PMCA 4YXDB 2RMMA 4DWFA 5J17A 3NE5B 1PDXA 1N33L 4JI3L 4A3JG 5M5YB 2GB1A 1V6EA 3A55A 1UBIA 3GS2A 2KWUB 1N36Q 3CWIA 2DJGC 2EMTA 3I72A 1G51A 1PTOH 3NRZA 1TY0A 4O0AA 2N9XA 3RN2A 2W9NA 3AE3B 4HMJA 4KKIA 3RLNA 1PQSA 1EZ8A 1GHJA 1YX6B 2K01A 1SXTA 1JCKB 3SR1A 3GTQB 1QE6A 2K7VA 3M7NA 2BB6A 3AE8B 3I4NG 1OXVA 5M5XH 2JZZA 4WJWA 2N8NA 3AE7B 1CKOA 4GU2A 4RMAA 4TSSA 2EIFA 4R4TA 3SU8X 1RF2D 4A3MH 2NPTB 3C19A 2PPHA 4H2AA 4A3EG 3PO2G 4LCDE 2RVLA 1SNMA 2F0PA 3OMGA 4ZYSA 3ZRCA 1PYSB 2F0DA 4AQYQ 3VDYA 3K8AA 4KTAA 4A3FB 3EN2A 2Z4IA 1XNQL 1PVOA 1ZXIA 1D1KA 3J81E 5AZHA 1WTQA 1HE8A 3EHVA 1WGRA 3AE2B 2JA8G 2K28A 3M4OB 3GOEA 1VS0A 1TYGB 4J3OD 4MGKE 1CI3M 1FL0A 1WOCA 4XC2A 3VTUA 3GTJH 3M3JA 4IPDA 4OXPA 2JYEA 2Z59B 3N1XC 3VTWA 1P3QU 2D5GA 2C7NB 4YY3L 1ONLA 1QB5D 1YNND 3ITPA 2LVPA 2HD3A 3HKZE 4GN4B 3NP8A 2ENBA 1PFDA 4XQJA 1I6HB 5KYLA 2I1KA 4PZ6A 1PDQA 5EDSA 1ZP0B 1HZ6A 2Z6KC 1E22A 1NMFA 2JK8A 1U4LA 1O7YA 3RPFC 4A3IB 1F2YA 1UWVA 1T3QA 2KHSA 2O2VA 2DZJA 3CMEA 2FJ2A 3AFPA 3B0AA 4KDIC 4WJOA 2WP9B 1LTSD 4ILWA 3S1RB 4LW1A 4DNTB 3S16H 4UP8A 2MRPA 3VXWA 1WX9A 2MBOA 5GAHC 1F2RC 3OLMD 3QHTA 1M1KC 4KK7A 3ZJYC 3B1LX 4C2MB 3VFKA 1YD8U 1PRTD 1PH7A 2IGHA 5ELEA 2WXJA 5E4XA 1WMHA 2QF7A 1YQBA 2LXAA 4OVVA 3T1HL 5EE0A 1C48A 1EIFA 1SYDA 2DZMA 4N8X1 4OW0A 3ONSA 2ASQA 4A4IA 4QJFA 2F0WA 1ASYA 5C44H 2UU9L 4GN1A 1MJEA 5FJ8H 1KFYB 1R7SA 2F0UA 2AMCB 1SNOA 1TT2A 4LF8Q 1B1ZA 3HOVG 3Q2AC 4ANWA 5AJ3Q 1HR0W 5D3IB 1CSQA 3U8ZA 2J7ZA 1J6QA 3PF5A 2BKFA 1IBLQ 3IT6B 1S40A 4DAYB 3CSTA 1WI5A 2OXPA 1SYEA 2WGSA 3A9JB 4E6IA 3A4RA 3CCEA 2GA4B 5C3EG 4DV5L 2F4VQ 3QIJA 4LAAA 4N9F4 5CR3A 1X56A 2PW5A 4A3OA 3AH7A 1I6VC 3JVZX 2WXFA 1IXRA 4O42A 2MNAA 1VQDA 3DHGC 3I3TB 2RDHA 2N9LA 1HA6A 3Q8DA 4ZQ3A 3A9KA 4MM3B 2K8HA 1IHZA 2RKSA 3S14H 1IBML 3H0GB 4YL8A 3AM9A 2KQSA 2HQLA 1JALA 3KF8B 3HOWG 2DAJA 3IXSA 3PO3G 2VW9A 3LB8C 3WAOA 3RD2A 2W55A 2K1FA 2B29A 2PQAA 4PMWA 2K52A 3FPPA 1FNUA 2L00B 4K6LA 2H89B 5G55A 1D2BA 3A5ZB 3GQBA 2GBRA 2IBIB 3GTMB 2CFMA 5IODA 4MGZE 3VR8B 3QC8B 2C5CA 2NZOA 2M1MA 3LGJA 5IN7A 1UAPA 5DLQE 1J5EQ 1MVKA 5CHFA 2IDYA 2INCC 1PMRA 2JA5G 2NR2A 4LNNA 3DVGX 1BCPB 4C1NK 3U4VA 4X64L 3CIRB 5E6NA 5JEAJ 5IYBH 4KIKA 1M4VA 2L4NA 3ZDMC 3CKIB 2G9DA 4RA8A 2UWQA 1V1PA 2EYJA 4BS9A 4X62Q 3NENA 5C3WA 1VZ6A 3QG1A 4Q2JA 1S72A 4IOCA 2DUDA 4A3JB 3W1SA 1PYWD 3S24A 4HJKA 4AS1A 3KUPA 1VQJA 4LWCA 1K8RB 5JAVA 2E76C 1ZOYB 1XMQQ 3DMUA 5NUCA 4CJ2C 5AZGA 2LY7A 4BAXA 1JQ4A 2L7RA 2WB1E 1UH6A 3PT2B 4HXDA 4A3KG 1EUJA 2AWTA 3KLSX 2W3RA 1PH1A 2WXGA 4HCSA 4KHVA 1RDPD 1HQRD 3W3AA 4N6EB 4FBJB 4TQ0A 2Z6KA 1U4RA 2F52A 4GNXB 4HJ9A 1V80A 4YCWA 3RZDH 1QOHA 3NBHB 3B6YA 1HZ5A 2WXRA 4A3BH 1EZ6A 3S2HH 2V3NA 2R7FA 4DV0Q 2HHHL 4N9TA 3PO2B 5A2QE 2LJ5A 3B2GA 3WAPA 2R92G 2UXDL 3C0RB 2MP2B 2AQ2B 1H9SB 1L2NA 3I4MH 4F88A 2MX2A 4LTUA 5FO9B 4BY1G 3GTGB 3H3VI 1IW7D 5J3BA 1IYJB 3SK8A 4RG1A 2IW3A 1QT9A 5EQ0A 4NAMA 3RD4A 3BZCA 1WFYA 1K52A 4ANXA 2JWZA 4DV6Q 1CUKA 2YYZA 4QQBX 2I0QA 2X69A 1RWSA 4FJZA 4IDIA 3KOJA 1OEYA 1A8VA 4CJ1B 1L4ZB 1S1QB 1C77A 1LUZA 1PYBA 5C0XI 2PZTA 1XPRA 2G9HD 2Q2HA 2WU2B 4B9KA 2K5NA 2ICEC 3NVVA 2JWUA 5C4XH 4G7HC 2DYOA 2GN5A 4BOSC 1BT0A 4X66L 2LKVA 4BBSG 5GADC 1O7IA 4NPSA 1DJRD 4FVMA 4GDLA 1F9JA 1RHPA 5AEKB 1CHPD 5HGQA 5M3FG 5IOCA 1EM7A 2KDMA 3IT4B 5CORA 1O7LA 2KCCA 5HY6A 1FRDA 4B6WA 5C4ZA 5J22A 1SEBD 3KDFB 3LYYA 1YIWA 4HJAA 1WE6A 1VQ7A 1SR3A 1FMAD 3AEBB 2Z0DB 4K8IA 1EUVB 2DAFA 1LABA 3U30A 2LMCB 2Q8RE 1IGDA 2MO1A 4QL5A 4RGTA 2SEBD 1Q1BA 2O5IC 1GKHA 3W1GA 4FXKC 1O78A 4CBVA 1NI2A 3NVWA 3RI7C 1KLVA 1LTGD 4IURA 5C0XG 3T1YQ 2WWZA 2N9PC 3PTFC 1UD7A 3VYSA 1G6PA 1C3TA 1KL9A 1LM0A 2KXJA 4FHKA 3TDQA 2K5DA 2YTYA 4IQZA 3CCLA 3BG3A 4IFDI 4EQOA 5IGBA 3ZIMA 1SJED 2BE5C 4S3SA 4CGYB 1GOZA 1FYCA 2E8GA 4R8NA 3TEHB 3P75A 1WVLA 2BQQA 1HRJA 3PGEA 5FO7B 1KDBA 2ZXPA 1J8CA 3EROA 1KOTA 3AEAB 3CHBD 4FP5D 5CC4A 4TRDA 1C9FA 4DHJB 1R4NI 1C1YB 3AMUA 1OXTA 4DR4L 3VR5A 3D3RA 3VYUA 1B8AA 1BR9A 1SNCA 5J2RA 3C1EA 1T5XD 2IY5B 3EQLC 1PH9A 4KSLC 2N0SB 4A3LH 4JPSA 2E2JH 1V81A 3MXUA 1NEKB 2FMMA 4BKGA 1JMLA 1S3SG 2WKCA 3J81c 4OO1H 1VCBA 2MQJA 1HR0L 2QMTA 5L83A 1XEEA 3NUCA 4X3KA 2QCPX 3HOWB 1B2TA 3OW7A 5CHWA 1Y8NB 3SFEB 3P1HA 3B2FA 4IFDG 3V3XA 5C5LA 4POGA 2FCQA 4DN4M 1QZEA 3DUZA 5FLMG 3FAHA 2ICIA 1V8QA 2BYFA 4WJNA 4ODGA 1WY8A 4DUYL 2LFNA 4JBMA 2BYEA 2NBWB 2K8CA 2F3WA 1BNZA 5LHY1 4L23A 2ZNVB 4KJNA 1WTRA 3A5UA 1RAXA 4JPBW 4DA2A 5KIXA 3Q8AA 2O6VA 2Z9HA 1HTLD 2JA5B 1PH6A 2BS3B 4KD3A 1YI2A 4DKAC 3ZQ4A 4K2KA 4GOPB 2UUBQ 2JQRB 2J52A 4O1NA 3NWSA 3W1YA 2LHEA 4LNFA 2M0AA 2KD0A 2PLPA 3DEPA 2VNUD 2IO3B 2BWES 2KO3A 2Q2UA 1C78A 1RTNA 2L05A 1N32L 5GXGB 2WIIB 4QGUA 4P75A 3F1ZA 4LDTB 1I35A 2EY6A 1TKGA 1Q82C 2FUG1 3ZNHB 4HIDA 4XIGS 4NXNL 3U9SA 3JAMi 4KI0A 5D3DA 1GAQB 3DBHI 2E3TA 2MCNB 3CC4A 4XYCA 3M3YH 2ZJQA 4MEMA 4YTPB 1P8LA 1A15A 3OIQA 1I94Q 1QVGA 1L2FA 5M3MG 4XT3B 1WXMA 3AB5A 2INPE 1HTPA 5EGTA 5J1ZA 2JYTA 2JZPA 2XRSD 4AP4C 2CQOA 1LT6D 2DY7A 5IYDH 3O13A 5LMUL 4JBJA 4ITKA 1IBKQ 4B3SL 2KJHB 3HK0A 4BVUC 1HTQA 3RLFA 4FF4A 2W82A 1WGDA 1ZKHA 4B9WA 3H91A 3WIMA 5F2DA 2E2IH 4FJYA 2MBEA 3CU7A 1EWCA 4DBGA 2PI2A 1ZKOA 1H9MA 3DWQA 1I50H 4K3BA 3HM3A 4DR6L 3ERQA 1VQAA 4W9GA 1Z9FA 2FFKB 1TZ1A 1WD1A 2A19A 1XCTL 3NSWA 3UE0A 1GNUA 2KVZA 3ALBA 2QIEB 4POFA 2EY1A 2EJMA 3ZJTA 3VUXA 1IZ6A 3K7UC 2YEPB 4KN7C 4OEMB 3URYA 4LF4L 1A3UA 2KX3A 2CVRA 2CHZA 3I70A 2EYOA 1M8AA 4MTNA 4A93B 2GMIC 2F0OA 4N58A 4FULA 2WXPA 1W2BA 4BKTA 1V1QA 2CH4W 5ELFA 2CS4A 3NVYA 1L1OC 4XX5A 2MJDA 2NVTH 3KLWA 1A3VA 2XSCA 2B63G 5CV9A 2I5MX 3KWLA 5IYCG 1PV4A 4A3CH 5BO4B 1XLOA 1QILA 2K5WA 1GUAB 2WXIA 3DQVA 2AQ1B 2EYPA 2B8GA 3PVLA 3GTLB 5CV5A 3JSVA 3G6EA 4BA2I 2KFJA 1RTOA 1MSHA 5JEAG 4LK0M 4B3MQ 1HHVA 1BXTA 3L9AX 3CCRA 5IIFA 4ZRQA 2O2VB 4US8A 3F2UA 4BBRH 2EY2A 4CHKA 3N20C 5FR3A 4JI8L 2KJXA 3PV0A 4JX1C 3S15B 3Q8BA 2KACA 1IBXB 4W9IA 1XLNA 4UHVA 2BE5D 2YTXA 3K5LA 5E4WC 2MJ8A 1OTCA 3AYHB 4RM8A 1AWDA 1FRRA 1HCZA 5CV7A 4KY7A 1K8AC 1P9DU 2EDGA 2J53A 2VQEQ 4RF1A 4LF6L 2JYOA 1WMHB 3ULLA 2IO1B 4W9KA 3BINA 1Q8IA 3SK4A 1NAPA 2XRQD 2E2HH 2Z0EB 4UP7A 3GTOB 1XT9B 2MA9B 2ZXRA 1WRIA 4JOIC 4GS3A 4N8FA 4KDLB 1CK1A 1E2ZA 2UUAL 1TWGB 4QIWE 3GTKB 1NCVA 1VDVA 2V0GA 4Z9CB 1XF5L 1Y1VG 2J4XA 1FEHA 1YJWA 4UAIA 3DLLA 1VQ4A 4WIPA 1AW7A 4W9DA 1PGBA 2R93H 4HJGE 1F9RA 4A55A 2A6HC 3HOZB 2EXZA 3L16A 3F8TA 1YZ6A 1K83B 5K36G 1UELA 2LGSA 4P7IA 2MJEA 4J1MA 1XLPA 1HNWL 5GAGC 2RDFA 2DZKA 3O65B 4HMIA 1VQGA 4C4VA 2RCFA 2QEJC 3IL8A 4KGRA 3FVQA 4RF0A 4JI3Q 2R6GA 3R7RA 1TWCB 2NYZD 1LTID 4JI1L 2WAQE 1R4NB 1E9MA 4JLCA 4XYOA 4U673 3NEMA 4ZCKA 5JVH3 1T6BX 3ZKJC 4EEWA 1E2VA 4EZJA 2QEXA 1WE7A 3BDCA 1B44D 4JI5L 2PQAB 4A3PA 1GPXA 3CCJA 4IPHA 5IY0A 3PQIA 5DM73 2K3UA 4RWSC 2FE8A 1KJTA 2JY6A 5IKCM 3WCQA 1G291 2NN6I 2C9WB 1HA5A 3J7AF 4IG7B 5J39A 4U68A 4A3FG 3D6WA 2KA7A 3KFUA 4I6PA 3RNAC 3X23A 2VL6A 3KBXA 1QOGA 2KDBA 2CH4A 3I73A 3GE8C 1X55A 2NCNA 2R61A 3PHWB 4PZ7A 4IUTA 4NJ7A 5DPRA 2VY3A 2JP1A 4WJPA 1EU3A 4K8JA 1XNQQ 4GN5A 2Q2IA 1FCLA 2XWBB 3QR8A 3BK2A 3BYYB 3CSFA 1TVXA 2O4XA 4KIKB 1YNNC 2L5TA 1L6UA 1V1PB 3JW0X 2G4SA 4YY3Q 1XMOL 2A5UA 4HDOA 3ZO5B 3DOWA 2F0FA 1I3QH 4N59A 4A3IG 3NHHA 2AYOB 2NVXH 2FIDA 4XQQA 3UI2A 2X8XX 1TU2B 3VUWA 4M1UB 1LV9A 3MXPA 4MIUA 2MBBB 1BUIC 5JHAA 5FK9C 5EE9A 2LI5A 4FNFA 3DBLI 3GZNI 5LNK1 3L0WB 4UPAA 2BOSA 1C4PA 4WFN3 2V9HA 3MJ5A 1NJIC 1EWIA 1JOKA 2NN6G 1PFNA 2XIWA 5D65A 1DOIA 1GXDC 1EWYC 1KH0A 1WJNA 2LRWA 2BS4B 3A7AB 3DEOA 2VUMB 3L10B 2UXBL 1XTCD 3NBIA 4RCOA 4AQ7A 2WXMA 1MSGA 1ZDVA 3JYUA 3T1HQ 4HPMB 3MZ5A 5IP7H 2N7DA 1TWAH 5C44G 2L83A 1CM9A 4NP5A 1YIJA 2UU9Q 4NMZA 3WOEA 2VXWA 1WTWA 3Q0AA 4TKOB 1WTXA 3HVDA 1Q12A 4A3GH 1VQPA 2K4KA 1TIFA 2KVRA 4HJ8A 2UYZB 2V4IB 4ZKBB 3ZLZA 4EZLA 1U9RA 2ZW0A 2G3QB 4XWTA 1ESRA 4JI0Q 5G2NA 2JA7B 1BBWA 1DOKA 4JI2L 1SROA 2O5JC 2KLCA 3IG3A 2WINB 3TL5A 3MC0B 3H15A 4C7ZA 3I55A 1BCPF 1G6ZA 1P98A 4TKNA 4DV5Q 2K22A 3W1SC 3BVGA 5EE1A 2N3SA 4IUUA 2IYDB 2L52A 2KX0A 3FKIH 2KVMA 3H0GG 4DF7A 1TT5B 5D94A 4DUZL 2V4LA 3N3KB 5BYQA 1XTDA 3ND8A 2HD5B 1NY4A 3TEWA 1TS2A 1TKYA 4L5TA 1ZYRC 1UE6A 4KKJA 2LFIA 1F2LA 4MN3A 3K7AH 4B3RL 4BWGB 2L0FA 3DCGA 4DK5A 2LXCA 3L08A 2NVYH 3NOBA 1SYCA 3T9LA 1XLQA 2K25A 3W5UB 5HKHA 4K1RB 4BY7B 1N5WA 1PZID 4DR7L 4W9CA 2WXQA 2E2DC 1PFBA 2YU9B 3KF6A 5DPWA 4LF5L 4DHJD 1AZPA 2K6QA 4KSKC 4M8AA 2WX1A 3QCAA 4NDXA 4WWPA 1AYFA 2IZVB 2KBNA 3X0WA 4S0RA 1D8LA 1CTMA 4ULLA 1SDFA 2UXCL 3K5OA 1XX8A 4IW0A 1WZ0A 3U52E 2Z1CA 4B08A 1Y69U 4X65L 2XTIA 1Y1VB 2R3ZA 1R9TH 4PMBA 3VR6A 1YN4A 4G4KA 3MTNB 4HK2A 5H92C 5IP9H 4JV5L 5KEEA 4WJ4A 2YV5A 5LXHA 2IO2B 4DV4L 5IYBG 3GZNB 2K03A 3I57A 3VR4A 3KH0A 1Q7YC 2NZ1D 2M56B 4X64Q 1SE9A 1YHAA 4W9FA 4YSYB 2NB0A 1DD2A 3PLVA 2KUMA 3STBD 3VYTA 5EE3A 3CP0A 3EFXD 1STNA 2NTSA 2A5HA 2LSSA 4LMQD 4OL7A 1Y1WH 2DLBA 3PUVA 1XYIA 3C8YA 3RT3B 2JXMB 1ESFA 1LTRD 2EVBA 4YIJA 1VQMA 3Q6SA 1PTOB 2KN4A 3AE6B 1X3GA 5BYSA 4XDXA 2BW2A 2Y5PA 4IPCA 2LS01 3GTPH 1K8OA 1WWTA 1BDOA 1UEBA 3PUZA 1CZPA 2D07B 5M5XB 2MPMA 1ZXHA 2ZEQA 2IJ0A 3GDEA 4MACA 1YJ1A 4A3MB 2KECA 4KY6A 4JI4L 2A73B 4A3BG 1XJVA 1AE2A 4HIMA 4EVOA 1I4RA 4GDKA 3RNUA 1EY5A 2PEAA 3T13A 1FO4A 4ZRKA 1VQEA 1LT4D 3I4MG 2HHHQ 3ERSX 1C4AA 3ZUNA 2KENA 2UXDQ 4LDTD 5C6AA 5FLXc 3V60A 1IW7C 4CJ0B 1Q10A 4XWWA 1TQOA 4L63B 1VQIA 1VQBA 4OIJA 4C3IG 3I56A 3QARA 2QDBA 4ZK9B 3IAM1 3L54A 1KRSA 4M02A 3RUIB 3GTJB 1C0AA 1TS5A 1K51A 1V97A 3IFWB 2KTFA 1D1IA 1EWHA 3NTIA 4DQOC 3S1NB 1STBA 2IO0B 5DPSA 2L3ZA 2HDEA 1K0RA 3EECA 4KJOA 4JI6L 3NQTA 4Q5VA 4REZA 1GHKA 2YVCA 3MXGA 3M4OH 1T9HA 4ZYNA 3WWVA 4C3JH 4X66Q 3NS8A 3RFZB 3KJOA 3KLSA 5CYUA 2RR9A 4NPNA 2MO0A 3NG0A 5BMGA 3SD5A 4GSWA 2QCZA 4V0BA 1G8ZD 2EYLA 1P7EA 4F8CB 1V9PA 1YNJD 2RF4A 2RQXA 5FKAC 3AE1B 3T51B 4II2B 1UNSA 2M9VA 1X1MA 3S16B 4K2LA 5CX3A 1GUOA 3U9OA 2KHJA 3MHZA 1KTKA 5G3LF 5BN4A 3H94A 3MEHA 4B0EA 5C4JH 1O7ZA 3CPFA 4C80A 2MLBA 5E6OA 3U50C 1YHBA 1VLBA 3B9JA 4XDDA 5KRUA 2JEAI 3IAS1 1OQYA 1WX8A 3ZDTA 2QILA 3OW2A 5C44B 2BGFA 5DM63 2JT4B 2K8BA 4K5XA 3R66C 5EBCA 4G7OC 2RDBC 1Q1EA 3J81L 4IJHA 4YSXB 5IP4D 1VD2A 3NTHA 4YCVA 4ME3A 4WJ3M 2V1YA 4MJSA 1YJIA 4DAVA 3ZVVA 2KMAA 3AB9A 5LMNW 2JEBI 3T8MA 5BR8L 3A1QA 1OQRA 1HZAA 1K50A 4NB3A 2MEKA 2E74C 4LJPB 3E3XA 1SRUA 1HPCA 3BJUA 3D0FA 1EYDA 3G48A 3I4LA 1EF1A 1RLFA 3DBLB 1A62A 3A33B 1KAWA 4DAMA 1WGYA 5LXIB 4MZ9A 2QKIC 2EJFC 3U2SC 1UEAB 1C7YA 2R7ZH 5EKKA 4ARIA 1Y14B 1T0YA 5AFWA 4DR4Q 1E5WA 1HZ9A 2ZCCA 1V5TA 3N6RA 2LGDA 3QX1A 4GMVA 4NAWA 4C3HH 1IL8A 1B9NA 1SYBA 1ZYRD 3MXNA 1ILQA 1TS4A 4A3LG 1ZGUB 3S14B 4I7ZC 2OJRA 2W54A 2DWQA 1EL0A 2J42A 2ZM6L 1J7AA 3AE9B 1C4CA 3DWPA 3VRBB 3DXJC 4ZHPA 4BBNF 3X3MA 4LFAL 1CZWA 3HOUH 2IHEA 4AYBB 1HR0Q 2RHSB 4CDFC 5I2YA 3CD6A 1QOBA 2QSDA 3TEZA 1TY2A 4J6HA 1DOXA 4TQUS 2JA6H 1B7YB 2ONQA 3ZYYX 4KKSA 1E8WA 1RIPA 1K9MC 1OEYJ 1BVSA 5CBAE 3Q3JA 4WWNA 2OF1A 3E0EA 1HFNA 4LF9L 2EOTA 1EYGA 1AH9A 3A8JE 4QY7A 4DUYQ 2EKIA 1OGWA 5A35A 3PZDA 4JVZA 1QUQA 5IE8A 3I9V1 2ZTCA 2WDVB 3SHLA 1HFGA 2EZVA 2VZKD 3CCQA 3BVMA 1HNZL 2D2QA 2KEEA 2XN9C 1MI2A 3BU2A 4HCNB 1HH2P 3QQ8B 3QK0A 3R7QA 4B95A 1N32Q 4WH4A 3Q24A 4GZYC 2Y0SE 3OMCA 1XO3A 3BVZA 4LNKA 2XK5A 1QOFA 1Z2MA 3DBSA 3HHMA 2YEPF 4HIOA 2NVQH 1CKNA 5L37A 4HEDA 3VAWA 4NXNQ 1FD6A 3FRPB 3DBRB 4DU9A 2G45B 3I5JC 1ZDXA 1RD9D 2C7MB 3EC8A 1KAAA 2NMQA 2L0TA 2VRRB 3RZDB 4HKZE 5JHBA 2JX5A 4EFOA 2Q8IB 3EIVA 4A3BB 3T56B 3S2HB 5IYDG 1GC7A 3A56A 4ABNA 3ABVB 3I4MB 1IUEA 4RNAA 5LMUQ 1EY9A 1L0XB 3J9CA 1Q8KA 4PV1C 3I4NH 1NSNS 2OEOA 2CHWA 3N9YC 4CO7A 1FR3A 2LXKA 4B3SQ 2GRIA 2LJIA 2H4OA 4C3IB 3PIP3 1WM3A 4CDEC 4URKA 4PQXA 2OQKA 3DPDA 4R3DA 4A3EH 4R4IA 2BDOA 2H88B 4QMGA 2Q2TA 3PSEB 3UDXA 4BXXH 2MSED 1LACA 1UGJA 4DR6Q 1MGSA 5M5WH 2PMZE 5C4XB 4X6AH 4GB9A 2PVGC 1OO9B 3OJ4B 4A93G 4GLVB 1XCQL 1ET9A 2JA8H 3PIPA 3TS0A 2KWVB 4EQNA 3KYCD 2F0GA 4LF4Q 3S1QH 1DGSA 1QZGA 1JWMD 1SLJA 4A3DH 4DHZB 1H9RA 3DVNV 3X3NA 5ISRA 3ML8A 2WACA 1ENFA 4LLGM 3I4OA 1H95A 3MJWA 4LF7L 4OWWB 2JRIB 1V8CA 4A3CG 2MUYA 1TJEA 2B2YC 3GB1A 3EGRA 3UI3A 3HOYH 2CHBD 1QF6A 1CQVA 3DWGC 3HRDD 3TCAA 4XYQA 1OQQA 1P0RA 1TWFH 5EPJA 1TS3A 2QHOA 2QDLA 1LT5D 3E6ZX 1M90C 2N7EA 3LXFA 4W9JA 3RCZA 4EUTA 5A2QL 1K3RA 2XBBC 2C9OA 1VZ8A 1MI0A 3TQYA 1WTPA 1PH2A 2LWPA 2CW0D 2WS3B 4WQOB 4KV2A 2ZPYA 4BBRG 2XWJB 4GKJL 4KGSA 4ME5A 2IHFA 4KKTA 1NENB 1G91A 3S2AA 3VDZA 3C3LA 1IKLA 2KOLA 2K32A 5M9OA 1RODA 4JI8Q 4HCEA 4RKLA 3D6CA 3RUZA 1RFAA 2M4NA 3DVGY 3EBEA 3LDZE 2GI9A 4H7BA 1JRPA 1P1AA 2KT7A 4DNRB 3RZOH 1X54A 4Y7NH 1VRAB 4HDQA 1F2ZA 2MP1A 5JH5C 2HIVA 2WXKA 3E56A 5AJ3L 2K05A 5CV8A 4LFBL 1QVCA 3NZUA 3AXCA 1ZPSA 4LF6Q 1YOVB 3HOVH 4CYEA 4AJYB 2G1EA 4DK3C 5TR5A 3PS6A 3AEVA 1MJDA 2BKRB 1PH8A 2HTHA 3AULA 4PYZA 5I9PA 4HTHA 2KC2A 4DV1L 4H0LC 2RSNA 5KNBA 2BVCA 1STHA 3VQIA 2UUAQ 1VQ6A 2MHVA 5C3EH 2D9UA 2E2JB 1E6EB 4FDBA 2OTLA 4JI7L 3TIXA 3K9OB 1ACCA 2UU7A 4JYAL 1JR0D 1B70B 4H02A 3HOZG 1FXTB 5DEHA 3GD7A 1V43A 4ICUA 2L15A 3G4SA 2OHFA 2V3PA 3U4EG 4YTMB 3CQZH 2J0KA 3N1YC 2UUCL 4FADA 3W9CB 4NW2A 4R4CA 3AEGB 1QLBB 4PS8A 2EJGC 4OX9L 4DDID 5LMNL 1CA5A 2B2WC 2BB5A 4B0MA 4FF3A 2B2UC 4CDDC 2PE6B 4FLHA 5CHVC 4CKEA 1K73C 1AP0A 4JC0A 2JE6I 1HNWQ 4MH8A 3J80E 3DVNU 4YHHL 3ULJA 4DGZA 4C1NI 3PO3H 2BCOA 1B50A 2M00A 4UY8C 2KTRB 3ZJVA 1VMCA 1LTTD 4JI1Q 1EOVA 3S1MH 3HS0C 3P7JA 1JE4A 1V9JA 2Y3AA 1F77A 4HN7A 1BCPC 2EY5A 1DOLA 4AWJA 3CF5A 2IY0B 4APVA 3CRKC 1A3TA 3CCVA 3R3OA 3KUDB 3KF6B 4JI5Q 3S2DH 1X6OA 2AHOB 2ZCBA 4FN2A 3KYHC 5KHOA 4YWLA 1GVPA 1SE8A 4AIMA 3VA5A 1BOSA 5HURA 4DV7L 3C46A 2BTEA 4G3XB 2X38A 5IGEA 1J9OA 4YCUA 4ZUJA 3JAMc 2INNE 4BKSD 1JWSD 2IT1A 2B2VC 2IX3A 4HIKA 2OT2A 4MNOA 3K80C 1PTOD 3Q69A 1FD7D 3M3YB 1YQ4B 2KFKA 4ACFA 4R1JA 1XD3B 4IWOA 2MBHA 4NZLB 5HFYA 4DR3L 1FJGL 4WORA 2AL3A 4H13C 4GNXC 1UE5A 4PYUA 1NNXA 2F0JA 4FF1A 1SE2A 4UDUC 2XEWA 1AE3A 4A3KH 3KUCB 2PJHA 1D5MC 1XMOQ 4TQ1A 2VB3X 3VR3A 1HZBA 3TN2A 4R9WA 1AZQA 1F52A 2C7HA 1V5OA 2E2IB 2LHDA 2MW5A 1E24A 3HKZB 4OONA 4XQNA 3IAYA 1KRTA 1I50B 5HGTA 3J80L 2IY1B 1TKEA 4E3CA 3RYTA 2F4IA 2R92H 2VUMG 2W3SA 3EFCA 2BDNA 3OPOA 4IUVA 1LTLA 3ENEA 5IO9A 2CR5A 3L2PA 4BY1H 4FO2A 4NJ6A 5I9OA 1BQQT 3S17H 1Q1OA 2HJ1A 4GDKB 4WAFA 3VH4B 1PH5A 5JJIA 4OGQC 2UXBQ 2PE9A 3PUWA 2K6AA 2NTTA 1XQQA 2TMPA 3M62B 3H6NA 1VR9A 1KNEA 5IP7G 3DHIC 4X3UA 1Q86C 4JWSC 1EQVA 2PKOA 1YQ3B 1PRTB 1RCVD 4A75A 1HNXL 3MWYW 1E7ZA 4DAYA 4KHPL 4M8MA 2L12A 3G6JB 3UDIA 2AX5A 1TWHH 3RN5A 2C5LC 5C2TB 2NVTB 3A9JA 4BBSH 4IPGA 4ALPA 4F87A 4A3GG 2JA7G 4QB4A 4A8XC 2PYKA 2IX1A 3M85A 4GLXA 5FLXE 5M3FH 2DENB 1A6XA 2L8JA 1L6VA 2DNCA 3R3MA 3K57A 3V62A 4K0KL 4MM3A 4JGHB 2CJOA 4H44C 4WWMA 4IUNA 3PUYA 4BBRB 4YT0B 1Q81C 3FKIG 4HAEA 4EQ5A 1A63A 1WH3A 3RNCC 3KF8A 3C2PA 1L0WA 1QCBD 1WGHA 1K53A 1A2TA 4IJLA 1SE4A 2B2WA 4US9A 1KDAA 1FGBD 1Z6HA 3E9SA 3ZXVA 3T1YL 4DUZQ 2BWFA 2ES2A 3APCA 3DHQA 2QA4A 4IWQA 5GAEC 2EKEC 2BH8A 4BY7G 1PTOF 5C0XH 1TGZB 5LL6S 3P1MA 1FNWA 2DYMA 4B3RQ 3V2TA 2ATWA 3HUIA 2R7DA 2E2HB 4JK1C 4HLEA 1H9KA 1OTRB 1RM6C 3M4QA 1XPUA 1NMGA 1WGKA 2JJQA 4DR7Q 2GLSA 1ASZA 2NWGA 2N4FA 2AWNA 2FINB 1B9MA 4XT1B 3SK5A 3FHWA 1YJNA 1SJHD 4LF5Q 2CJNA 1SGHA 3QIAA 3MVVA 1JC7A 1JJGA 3TS2A 2UXCQ 2GOWA 4RCNA 5BMIA 3TZUA 2ZTDA 3PMFA 4MHEA 1DGJA 1E7UA 2JVCA 4LNOA 2R93B 4X65Q 2PW9A 2K33A 5JJKA 1Q90A 3BDOA 4DDGD 2B2VA 4JV5Q 1AN8A 2EXDA 5BN5A 4P71A 2K04A 4DV4Q 1N61A 1QJOA 2B2TC 2JRHA 4ZOHC 3EA6A 1GUNA 5FLXL 1J8IA 4LUOA 3STBC 1N33Q 2GVBA 2GBJA 3NVZA 1ICWA 3K0XA 4KD4A 3K58A 2NUCA 1O80A 1Y1WG 3A9KB 4NXML 1SYFA 4NAWB 3AE4B 1EQRA 3ETRA 3UIPB 4GNXA 1KQSA 3AV8A 5IAAC 1XXGA 3TZDA 3ZTCA 4IFDH 3MFGA 3ND9A 3L0OA 2K5PA 3NBHA 2RHQB 3C1FA 2ZNVC 2E5LL 1BCPD 1DZ1A 3A8KE 1VZ7A 1WJUA 2ID0A 3K9PB 4L6TB 2B8FA 5FLMH 4RH6A 4CDCC 2WFWA 4ID6A 4A3MG 1I5FA 1WRDB 1P16A 4IUMB 2MP2A 3J7A5 1H9SA 1JWUD 1D6EC 1VQLA 1WIAA 3V05A 1B3AA 2N1WA 3SFDB 1N62A 3ZNZB 2M0XA 3AN1A 5D2MB 2J0MA 4KZCA 2KWCA 1PXUA 2I5HA 3UDGA 2ZW1A 2ZVOA 2WB1B 4JI4Q 2UUBL 2N49A 3V96A 1Q3LA 3A54A 4M0WA 1PUTA 3ML9A 4B9XA 1BKBA 5C4HA 1YN5A 4FF2A 1V2YA 4GXBA 4L2YA 4DK6C 3JC66 3Q6BA 1Y8OB 4TMAB 4K14A 4QAYA 4BBNC 2PCFB 1JWAD 1WR6E 1WXVA 1LFDA 2MHJA 2L1BA 4USAA 4ZRPA 2K6DB 1LGRA 4A20A 4PZ8A 2ZTEA 1LTBD 4FXGC 3ER0A 1U4MA 3HGBA 1KD1C 3LWUA 3M4YA 1L1OA 5C5MA 1IGCA 2BPSA 2KKCA 5BYRA 3K59A 1I3QB 3ZRFA 2NVXB 4JI6Q 4C3JG 1S5ED 2F1MA 2JSOA 1WXAA 2XK5B 1EFID 5M3MH 4MSQB 3M7GA 4KLKA 2EELA 1CKNB 1YNJC 2L32A 3CF6E 1N9WA 2J0TD 2F0TA 2VQFL 4K7WA 1RKNA 1FFUA 3GV3A 2LMCA 3SHQA 3QWNA 2DY8A 3MFYA 4R4OA 2CCZA 5BMHA 3KQ4A 1H9JA 3HOXH 2REXA 1HEZE 3R2TA 4XGAB 1PFSA 2KHWB 4DR5L 4IKGA 1WCMH 3KW5B 3SDZA 1LM8B 4ASWC 3I2ZA 5IWAL 2X6GA 1L0YB 3OWEB 5FJ8G 1G2TA 2VH2A 3H8HA 3ZGZA 2HCCA 4DAPA 1TWAB 1MJCA 4ZRZA 1EY8A 3W5OA 5IOIA 5JOBA 1FPYA 4EX5A 1GUSA 2DX5B 4DHZE 1PH4A 4OVUA 3BZKA 2K50A 4EKUA 1KHIA 1MFWA 2OCEA 2F0HA 2A6ED 1EY7A 4JOIA 3TEXA 3U7DA 3J80c 1UWMA 5T8IA 1CKMA 4A3GB 3UDFA 1SSNA 2HE7A 2CKHB 3FILA 1STGA 3AI5A 4OZBA 1DOMA 1DONA 2WXNA 5ELOA 1N6ZA 3CMMB 3H3VC 5BR8Q 4GDLB 4PS7A 1EYAA 2D11A 4GLSC 4F8MA 4XE0A 1WJ4A 3A74A 3RZWC 1QKZA 5GMVA 4K7UA 2B63H 1NR2A 3WDNA 1PLFA 5IYCH 2YTVA 1E90A 2L0CA 4RGMA 5CV4A 3MP9A 4FXCA 3FKIB 1SBBB 2NS5A 3TEYA 3P20A 5ELCA 1S5BD 2B2TA 1SN8A 3AU7A 1Z7TA 3HRZC 4HJ7A 1IBMQ 4QCLA 2CWAA 3P4RB 5CTRC 4LJZC 1ZEQX 3OTOL 1WGGA 3K7AB 4AYBG 2KC1A 1EF5A 1SFOH 4HPLB 2NVYB 2ZM6Q 3NUHB 3CPWA 1ISNA 2I07B 2EQSA 3HOUG 2GBMA 4L1BA 4YSZB 1A70A 3DBRI 2FNJB 2KCMA 2F0LA 2JN4A 5ELNA 4LFAQ 1E7PB 4TV3A 3NZSA 4GKKL 3IVFA 2WDRB 3L4PA 3PRPB 2BYVE 1VF5C 1WJ6A 2ZJPA 1D7QA 4ZKCB 1YHQA 3WANA 2NBUA 1HJPA 1ENCA 2PQEA 5G3LD 4YWMA 4EQPA 1SNDA 2BA0A 2FUHB 3IBEA 2ZJDA 3UINB 1E8YA 2ON8A 1WSPA 1J7BA 2DJFC 1E1TA 4LF9Q 3Q8FA 3NZ3A 4P73A 3CMAA 1R9TB 4LUVA 3T53B 2D62A 2KMMA 3KYDD 1R4MI 4PNYA 5JPMC 1TXYA 2AQ3B 4A90A 3VR2A 1VQ8A 3N32A 4DFAA 1GB4A 2QJLA 4X57B 2OWOA 1TZOA 1EO6A 2KJRA 5KHQA 1CSPA 2A74C 3TBLD 3EVQA 1UGMA 1ZUD2 2ACZB 1HNZQ 4MH0E 1T0QC 1MD2D 1FIQA 2GVAA 1FCCC 4M01A 1F9QA 2D0OA 3CXCA 3K6OA 1Y1WB 1GJXA 2JF5A 3T16A 1KF6B 2V1CC 4II3B 1E7VA 1XNRL 5I2XA 4M00A 2H1EA 2SDFA 5K36H 2BT6A 1QQRA 4G11A 3SDLC 3H6MA 5M5YH 2HT1A 3GTPB 5C0XJ 1S3OA 2B3AA 3A7LA 1SYGA 4OWXB 3Q3OC 4P72A 1TR5A 2L11A 1LTAD 3L17A 2N7JA 2WYQA 1IKMA 4FYDA 2DZIA 3GTQH 1JT8A 3BDLA 5JJZA 1ICFB 1WZ3A 3ZNGC 1I4XA 1JRUA 4IALA 1KNAA 1F1HA 2SNMA 1YN3A 2O6VB 2FAZA 3I63C 4DR2L 2VB2X 2JQOA 3W1BA 1GUGA 1S5CD 1I7HA 4RFBA 4JG2A 1BMLC 1AEXA 4QF4A 4R8IA 4EZKA 1QNUA 4XXEA 1HUMA 2FXQA 5I6WA 5IGDA 2D0PA 1K0SA 4BXXG 3AEFB 2NZHA 4KMUC 5DNFA 3J7AV 2K5HA 5C4XG 4A3FH 2JA9A 3I3CA 3VTVA 1E0BA 4P1CC 2PZUA 2KEDA 1V49A 4JQWC 4F1SA 3AECB 3WOFA 4DV3L 3D4RA 2EYFA 4G57A 4C3JB 3UF8A 1CFMA 3TRZA 1C4QA 2NBFA 3A0JA 3QB3A 4IFDJ 1I6HH 2SNSA 3S1NH 4A3DG 1J19A 1MBYA 2RDGA 4LNQA 2KFKB 1EFWA 1EOTA 5EBDA 4K6DA 3UQBA 4A3IH 1IYUA 1IYFA 1K8GA 1PZJD 1OXSC 4LF7Q 4KGTA 1STAA 4DPGA 1I4QA 3M9BA 3ZTDA 1PGAA 3JAME 3S1RH 2KDFB 2LGYA 5HHDG 3HOYG 5C4JB 4GOCA 3ZW3A 4HSPA 2MGSA 1IBXA 3HVZA 4P16A 2K5QA 4OO1I 3VUYA 1HZCA 3V61A 2F0QA 3BWUD 2NN6H 2CW0C 1R4QB 1Y8PB 4C2MH 1VQ5A 1HQMC 2PTLA 2LGIA 2DNFA 3APDA 3IRBA 4KV6A 1D5ZC 3J81j 3J7YW 3Q14C 1X3QA 4GKJQ 1UZXB 5JJLA 4P1BC 3NJTA 2N88A 5TSSA 2RPQA 5G5GA 3R8BA 5CV6A 2HJ8A 2QGQA 2SAKA 4HVBA 3QAQA 2Z8LA 1Z5SB 1FXAA 1A2UA 1WYWB 3AQQA 2PPBC 1EIHA 3IHPC 2G4DB 4HRSA 4EGVA 4WAAA 2K5VA 4NY0A 2BS2B 4MT5A 2Q5WD 1E0ZA 2AUJD 4LFBQ 1PHJA 2K0PA 2BYTA 2Z0SA 3H1UA 3VYRA 4JI0L 2R7ZB 4OZCA 2F0VA 3NQIA 5IGCA 3VRAB 3PGZA 2JUOA 3OHXC 3KLRA 3TREA 2ZJRA 4C3HB 3BK1A 2WKDA 5EPLA 1EU4A 4DV2L 4OO1G 4DV1Q 2RSUA 4HCPB 4R4QA 2J0JA 3H7PA 3JSVB 1JROA 5AUIA 1NE3A 4JI7Q 3RR5A 4B3TL 4UP9A 4HWIB 4JYAQ 3SE0A 4RAUC 1EIGA 4S17A 4I6NB 3RMKC 2PNHA 4LFCL 3HOUB 2AL6A 4QIWB 3H0GH 5JXVA 1SIJA 3JAML 4QUCA 2UUCQ 4HROA 3TBIB 1VCIA 2JA6B 3BYTB 4OX9Q 3L7ZC 4JW0A 5LMNQ 5T1GA 4A76A 3HM6X 2DYBA 1UE1A 4K7SA 3N52A 4DK1A 2N1VA 4MSMB 3MC9A 1MHXA 4K5VA 2DN8A 1MHHE 3DM3A 4D2KA 5DAUA 2R2QA 4YHHQ 4DR1L 1DOYA 1KXLA 3U58A 2IWHA 3LX0A 1WTHA 3GTMH 2N9EB 1GJZA 4GGQA 2KHIA 4GLAC 2JU6X 3VA7A 3NTKA 3AE5B 3SR6A 2F0IA 1N34L 2G5DA 5AZFA 4X3SA 3K5MA 2CQAA 1JJCB 4PK1A 1NTGA 1SNPA 5I6YA 2K39A 2DHZA 4LNIA 2WAQB 1BO0A 1G6JA 3QJZA 4YTNB 1VQHA 2OOBB 4KZ0A 2CHXA 4DV7Q 3D4WA 4W9LA 2NVQB 3U7ZA 3U4ZA 5L95C 1PTOC 4A3JH 1N36L 4FHJA 1YVCA 1M94A 2ZZPB 2IPKD 3FDTA 1LT3D 3NELA 4I7AA 2HDMA 3MTSA 1PRTF 1UF0A 2R2OA 2M17A 2Y5BB 4NKLA 2ASBA 1KRHA 3E5SA 3A4SC 4JBKA 2I1JA 3P4PB 2RA4A 4DR3Q 3CRLC 3ULPA 1FJGQ 1N63A 2E6XA 4C4VB 1LYLA 3PRZA 4HPPA 2RSOA 1ZE3D 2HCIA 3KK7A 4JCVE 2FIFA 5CGKA 1YEZA 3PLUA 1R4MB 3HKZG 1YITA 1ENAA 2D3AA 3I4NB 4RMFA 1QZHA 4FA6A 3PO2H 1XWEA 1KLGD 2I46A 3KJPA 1WTOA 2KQ4X 4AQYL 3FP9A 1A0IA 1GO3E 3OYYA 4A3EB 2D10A 4J6IA 1PZKD 3GTGH 1SB3C 3M95A 3H09A 5HI1A 1EY6A 1I4HA 3T3OA 5M5WB 4RHSA 3AEDB 1LO5D 2XNAC 5CMDA 2FBWB 3M63B 2LUMA 1ZW7A 3PZ8A 4C3IH 4NNJB 3RN9C 1SMYC 3BS1A 1HUNA 2J7QB 4M0WB 1PA6A 2QW7A 2JA8B 1S5DD 1JB3A 3QOJA 3B08A 3LWEA 5COYA 4C56C 3CC2A 3S9WA 2WXLA 4KKUA 3S1QB 5E6PA 5DCNA 4A3DB 4TUUA 3RNEC 1CA6A 5LLIA 4LUZA 1HNXQ 1CQFA 2C35B 4KHPQ 2Y5CA 3FEWX 3PIO3 1ZXTA 3PPAA 2KOXA 4BA1I 1UWXA 1X3EA 1L1OB 4CKBA 3TP6A 2IX0A 1FNVA 1SF0A 1SMXA 3HOYB 1X3FA 3PF4A 1JOQA 4ICVA 4F7XA 1TWFB 3FPUB 2GBNA 2KWDA 5E7NA 1L0VB 3RZFA 2INDC 2NVUI 5IT9E 4L5QA 1JORA 1UBQA 4K0KQ 4IM3A 3VR9B 4CQNA 3PIOA 5JVG3 2I2YA 2CU1A 1X3PA 2CKZB 2XGTA 1OFFA 3BY4B 3LNNA 1BBXC 3RNFC 1KIXA 4MELA 1WXQA 4OVZA 4CHTB 4LF8L 4L8JA 2Q8TA 3RZOB 2A1AA 2VS1A 3E9HA 4Y7NB 2KCTA 1JWBD 2WHIA 1U4AA 4AUQC 2M8SA 1H4RA 1TKWB 3OIPA 1IBLL 1IP9A 4K5WA 5FO8B 5LL6X 2LD9A 4YWGG 5ELDA 2F0KA 1Z47A 3R2IA 3HOVB 2EYMA 2KQ7A 2VH1A 1WF9A 1WM2A 1NVID 4IC7B 5DPTA 1NYQA 1E3PA 2F4VL 2SOBA 2L76A 3TP7A 3ZXRA 1MPEA 4AJWA 3TJPA 2PMVA 2EMSA 1MIUA 4NQLB 3TSSA 1B3QA 4P74A 1J7CA 2TSSA 5D6JB 1TIID 5C3EB 2R93G 1WR1A 2LUEA 4K81A 3FILB 1WFQA 2RPVA 1EIYB 3Q3NC 2EPBA 3PZ7A 2JSVX 1JQYD 1EQQA 2EYHA 2LVQA 1QG7A 2F03A 3CQZB 2XVSA 4BKSA 2D3CA 1VQ9A 2PNRC 3UQAA 1D5XC 1B4OA 3RNBC 2Z4HA 4E71A 3V6CB 3PREA 2I5LX 2IL8A 3HOWH 3NXWA 3MHBA 1RYJA 3J81i 2D5DA 4OZAA 5JZEB 1SNQA 1ML0D 1L7YA 2NPTA 3OAWA 1KABA 3QJYA 3PO3B 4NXMQ 2A69C 5IT9L 2KN5A 5H8YE 5GROA 2OTJA 1NI3A 3M4PA 5C3XA 3KWVA 3S1MB 5E3FA 2K75A 1J5EL 3LJ3A 1HXYD 1BF4A 2E5LQ 1CZGA 3MHSD 1MHWC 2Y0SG 3AEEB 5K5PA 2WB1G 2KZRA 4XZ4A 3W5VB 2L55A 3RNGC 3Q3MC 2DBYA 3MEFA 2MFIA 2JA5H 1MG8A 1B9RA 3S2DB 3OJ3A 1F0ZA 5HG2A 1Q46A 1BUVT 1A5RA 1NR4A 5BN3A 4X62L 2WV6D 2KYWA 3WA0A 3HEJA 3W2DA 4PT5A 1F2RI 4RKBA 4P6VF 4P2CB 3I7FA 4DXFA 2KDEB 3GE3C 3R93A 4JIOU 2F3VA 3PRMB 2D3BA 4WURA 2BA1A 1XMQL 1QWYA 2LXJA 1N8RC 2LVOA 1V86A 4OWTB 3DHHC 4W9HA 2PVOD 2EE1A 3I8ZA 1YNTE 1CT1D 3QO2A 1YMHE 3QA8A 3HKSA 4G50A 1UUPA 4RGNA 3D32A 2HQEA 2F0EA 2MH7A 1CHQD 2OJWA 4AH6A 4A3KB 1L5PA 2WDQB 3WALA 1WJJA 2ALYB 4KHZA 1U5KA 1YJJA 2FCSA 2B2YA 2OQ0A 1I4GA 4DV0L 5CBEE 4IOIE 3P2BA 2BF8B 4KN4C 1FXIA 5EPKA 2O6VD 3K81C 4MGIE 4E74A 4EOYA 2RBMA 1QNKA 1Q0WB 3I90A 4PS3A 4AOFA 1EEFD 1SE3A 2VQFQ 1F9PA 1JB7A 2R92B 2RGFA 4MGYE 5C23A 4IM0A 4F7ZA 4DV6L 3PCOB 1DYQA 4WWOA 3TMEA 3HOXG 1N5XA 4BY1B 2WP8J 3OWFA 1SMYD 3S17B 2MBQA 3PO0A 2QC8A 1Y56A 2JXTA 1WCMG 2O2LD 3AU4A 3HG9A 2WQYB 3P42A 3VVWB 1OXUA 4DR5Q 4J8QA 2D2CC 3H7SA 4K3CA 5IWAQ 1VMPA 2QDFA 2HUGA 1J0GA 2IGGA 1VQCA 3OSOA 4NJCA 2WXHA 4ZRJA 3NWTA 3MA2B 3SEBA 2B39A 3EUB2 1TWHB 1E1OA 2A6EC 1P7FA 4BBSB 4A93H 1GM5A 5D14A 2LGXA 1KLUD 2JZ3B 3Q3FA 4G0NB 2CU3A 3PV1A 4KY5A 1SSOA 1JOOA 3ICEA 3G7LA 1FM0D 2IGDA 2WU5B 3AU5A 1QVFA 5M3FB 5ELBA 4JI2Q 5I4DA 1OXXK 1L4DB 1F9SA 1X65A 3KUZA 3Q8EA 1BBUA 5C3JB 3CCMA 3ZNID 2AEHA 2RCNA 1GD7A 3DWMA 2DGYA 2PI2E 3H3VH 3TP5A 5MPOA 3GTLH 3ECIA
chains in the Genus database with same CATH topology
2KCNA 3FC4A 1W6KA 3HP3A 4G7ZC 2B2UA 3OOCA 3NPPA 5IGGA 1VJKA 4IZ8A 3IKJA 4RGOS 1EY0A 1W6JA 4HKQA 2FMCA 2OEDA 1STYA 3GV6A 3GP7A 3Q22A 2MJ3A 1X32A 1CJEA 1STEA 2AUKA 5IGFA 3IFTA 2HDLA 3HZXA 4A9AA 5KNCA 1LLRD 2DNEA 1PGXA 3P4SB 3BZDB 3GO5A 5FOBB 2F0MA 1F2MA 4OHJA 2PZWA 2A68C 4QUFA 1EQTA 4V190 3TUOA 4WQMA 2KAJA 1PFMA 3AMZA 5EJWA 1D4BA 2B76B 5KNDA 1C76A 2M19A 2A69D 3K5NA 3T3NA 4DXGA 2VZKB 2WNMA 4ZUIA 1N60A 3IFDA 3D4DA 3I91A 1R4PB 1EEID 1E2WA 1II3A 4XTCS 4IN3A 3P4QB 2Y0SB 2LEKA 4RHRA 1RFKA 1JW9D 1C79A 1U4PA 2WXOA 3TP8A 1ET6A 1WTVA 5AUKA 3SVMA 3EJIA 3Q8CA 1IYVA 5KGUA 5D7GA 3P63A 1I4PA 2ZT9C 4KX6B 2F0NA 1ILPA 1QOAA 5T1IA 2E75C 2AWOA 4EE2A 5E1FA 4OIKA 3D31A 5M3MB 1AFPA 1T5EA 4ARCA 2N9KA 5KYIA 5E6JA 1SAPA 2PMZB 4ZLTF 3FMCA 2PO4A 4DK0A 4Q0FA 3RMHA 2WLBA 2KQ3A 3L3OC 3SXHA 3SK6A 1GUTA 4LK1C 3HOXB 4X3TA 1K8MA 3Q23A 1WCMB 2BBCA 1DM0B 1S4ZA 2PIAA 1C8CA 1S5FD 1WYGA 3BIID 3KBGA 5JPNC 3DM1A 2I38A 3NS1A 3ZJUA 2V4DA 4JWUC 4XDCA 4ZHOA 1GB1A 1PRTC 2ZXOA 3K0YA 5G5HA 2L1AA 1DCZA 3NK9A 2K1BA 1JICA 1NUCA 1DXMA 3T4AC 4JBWA 1EYCA 1ROEA 2B63B 3ONAB 1EY4A 4C3HG 1RJTA 4N9PA 5JEAH 2L9HA 1B53A 1WD0A 4WRDA 1VF7A 1SFOB 3PUXA 4I65A 4FXDA 4C7YA 1V1OA 1GUWA 1E10A 3D8GA 3DWAA 4JE3B 2K9XA 1NYRA 2M2LA 2F0SA 4HR7B 3E0JA 5EKIA 5EKLA 3A8IE 1FFVA 2PW7A 3MAQA 2FHTA 1G2SA 4ZAIA 2A68D 2X6LA 4CKCA 4HEA1 1VDZA 2HTME 4IUQA 2A6HD 4HSVA 1KDCA 3QOLA 2N55A 4IUPA 4PMCA 4YXDB 2RMMA 3NE5B 1PDXA 5M5YB 2GB1A 3A55A 3GS2A 3CWIA 3I72A 3NRZA 1PTOH 1TY0A 3AE3B 4HMJA 4KKIA 1EZ8A 1GHJA 2K01A 1SXTA 1JCKB 3SR1A 3GTQB 1QE6A 2K7VA 3M7NA 2BB6A 3AE8B 1OXVA 3AE7B 4WJWA 4TSSA 1RF2D 4H2AA 2RVLA 1SNMA 2F0PA 3OMGA 4ZYSA 2F0DA 4KTAA 4A3FB 2Z4IA 1ZXIA 1D1KA 3J81E 1WTQA 3AE2B 4J3OD 2K28A 3M4OB 1TYGB 1CI3M 2JYEA 2D5GA 1ONLA 1QB5D 1YNND 3ITPA 3NP8A 2ENBA 1PFDA 4XQJA 1I6HB 5KYLA 1PDQA 1ZP0B 1HZ6A 1U4LA 1O7YA 3RPFC 4A3IB 1F2YA 1T3QA 2KHSA 2FJ2A 2WP9B 1LTSD 4ILWA 3S1RB 4DNTB 1F2RC 4KK7A 4C2MB 1PRTD 2IGHA 5ELEA 2WXJA 5E4XA 2QF7A 5EE0A 1C48A 1SYDA 4OW0A 2F0WA 1KFYB 1R7SA 2F0UA 1SNOA 1TT2A 1B1ZA 5D3IB 2J7ZA 3IT6B 2OXPA 1SYEA 4E6IA 2GA4B 4LAAA 5CR3A 2PW5A 3AH7A 1I6VC 2WXFA 4O42A 2RDHA 2N9LA 1HA6A 4ZQ3A 4MM3B 1IHZA 2RKSA 3H0GB 3AM9A 1JALA 3IXSA 3LB8C 2W55A 4PMWA 3FPPA 1FNUA 4K6LA 2H89B 1D2BA 3GQBA 3GTMB 5IODA 3VR8B 2C5CA 1UAPA 1MVKA 2IDYA 1PMRA 1BCPB 4C1NK 3CIRB 5JEAJ 1M4VA 2L4NA 3CKIB 2G9DA 4RA8A 1V1PA 2EYJA 4BS9A 1VZ6A 5C3WA 3QG1A 4Q2JA 4A3JB 3W1SA 1PYWD 4AS1A 3KUPA 5JAVA 2E76C 1ZOYB 3DMUA 5NUCA 4CJ2C 1JQ4A 2LY7A 3KLSX 2W3RA 2WXGA 4HCSA 4KHVA 1RDPD 1HQRD 3W3AA 4N6EB 4TQ0A 1U4RA 1QOHA 2WXRA 1HZ5A 1EZ6A 2V3NA 3PO2B 4N9TA 5A2QE 3B2GA 2AQ2B 1H9SB 4F88A 4LTUA 5FO9B 3GTGB 1IW7D 3SK8A 2IW3A 1QT9A 5EQ0A 4NAMA 3RD4A 1K52A 2YYZA 2X69A 1RWSA 4IDIA 4CJ1B 1L4ZB 1C77A 5C0XI 2PZTA 2G9HD 2WU2B 2ICEC 3NVVA 2JWUA 4G7HC 2DYOA 2LKVA 1DJRD 4FVMA 1RHPA 1CHPD 5IOCA 1EM7A 2KDMA 3IT4B 5CORA 1O7LA 2KCCA 1FRDA 5C4ZA 5J22A 1SEBD 3LYYA 1FMAD 3AEBB 4K8IA 1LABA 2LMCB 2Q8RE 1IGDA 4RGTA 2SEBD 1Q1BA 2O5IC 4FXKC 1O78A 4CBVA 3NVWA 1LTGD 4IURA 5C0XG 3VYSA 3TDQA 2K5DA 4IQZA 3BG3A 4IFDI 4EQOA 5IGBA 1SJED 2BE5C 4S3SA 4CGYB 1GOZA 1FYCA 1WVLA 4R8NA 3P75A 1HRJA 5FO7B 1KDBA 2ZXPA 3EROA 3AEAB 3CHBD 4FP5D 5CC4A 4TRDA 1C9FA 3AMUA 1OXTA 3VR5A 3D3RA 3VYUA 1BR9A 1SNCA 3C1EA 1T5XD 3EQLC 2N0SB 4JPSA 3MXUA 1NEKB 2FMMA 1JMLA 2WKCA 4OO1H 2QMTA 1XEEA 3NUCA 4X3KA 2QCPX 3HOWB 1B2TA 3OW7A 3SFEB 1Y8NB 3P1HA 3B2FA 4IFDG 3V3XA 5C5LA 4DN4M 3DUZA 3FAHA 2ICIA 1V8QA 4ODGA 2LFNA 2F3WA 1BNZA 5LHY1 4L23A 4KJNA 1WTRA 4DA2A 5KIXA 3Q8AA 1HTLD 2JA5B 2BS3B 4KD3A 3ZQ4A 4K2KA 2JQRB 2J52A 4O1NA 3NWSA 2LHEA 2M0AA 2PLPA 3DEPA 2VNUD 1C78A 1RTNA 5GXGB 2WIIB 2EY6A 1TKGA 2FUG1 4XIGS 3U9SA 4KI0A 5D3DA 1GAQB 2E3TA 4YTPB 1A15A 3OIQA 4XT3B 3AB5A 2INPE 1HTPA 5EGTA 5J1ZA 2JYTA 2JZPA 2XRSD 1LT6D 2DY7A 3O13A 4ITKA 3RLFA 4FF4A 2W82A 4B9WA 3H91A 5F2DA 3CU7A 1EWCA 1ZKOA 1H9MA 3DWQA 3ERQA 2FFKB 1WD1A 1XCTL 3NSWA 2QIEB 2EY1A 2EJMA 3ZJTA 2YEPB 4KN7C 3URYA 1A3UA 2CVRA 3I70A 2EYOA 1M8AA 4A93B 2F0OA 4N58A 2WXPA 5ELFA 3NVYA 2MJDA 1A3VA 2XSCA 5CV9A 3KWLA 1XLOA 1QILA 2K5WA 2WXIA 2AQ1B 2EYPA 2B8GA 3GTLB 5CV5A 4BA2I 1RTOA 1MSHA 5JEAG 4LK0M 1HHVA 1BXTA 3L9AX 4ZRQA 5IIFA 4US8A 3F2UA 2EY2A 5FR3A 2KJXA 3PV0A 4JX1C 3S15B 3Q8BA 2KACA 1IBXB 1XLNA 2BE5D 3K5LA 5E4WC 2MJ8A 1AWDA 1FRRA 1HCZA 5CV7A 4KY7A 2EDGA 2J53A 4RF1A 2JYOA 1Q8IA 3SK4A 1NAPA 2XRQD 3GTOB 2ZXRA 1WRIA 1CK1A 1E2ZA 1TWGB 3GTKB 1NCVA 1VDVA 2V0GA 4Z9CB 1XF5L 2J4XA 1FEHA 4UAIA 4WIPA 1AW7A 1PGBA 4HJGE 1F9RA 4A55A 2A6HC 3HOZB 2EXZA 1K83B 5K36G 2MJEA 4J1MA 1XLPA 2RDFA 4HMIA 2QEJC 3IL8A 4KGRA 3FVQA 4RF0A 2R6GA 1TWCB 2NYZD 1LTID 1E9MA 4XYOA 4U673 5JVH3 1T6BX 1E2VA 3BDCA 1B44D 1GPXA 2K3UA 5DM73 4RWSC 2FE8A 3WCQA 1G291 2NN6I 1HA5A 3J7AF 5J39A 4U68A 3D6WA 2KA7A 3KBXA 1QOGA 3I73A 2R61A 4IUTA 2JP1A 1EU3A 4K8JA 1FCLA 2XWBB 3BK2A 3BYYB 1TVXA 2O4XA 1YNNC 2L5TA 1L6UA 1V1PB 2F0FA 4N59A 3NHHA 4XQQA 3UI2A 1TU2B 4M1UB 1LV9A 3MXPA 4MIUA 1BUIC 5FK9C 5EE9A 4FNFA 5LNK1 2BOSA 1C4PA 4WFN3 3MJ5A 2NN6G 1JOKA 2XIWA 1PFNA 5D65A 1KH0A 1DOIA 1GXDC 1EWYC 2BS4B 3A7AB 3DEOA 2VUMB 1XTCD 3NBIA 4RCOA 4AQ7A 2WXMA 1MSGA 1ZDVA 3MZ5A 2L83A 1CM9A 4NP5A 4NMZA 3WOEA 2VXWA 1WTWA 3Q0AA 4TKOB 1WTXA 3HVDA 1Q12A 2V4IB 4ZKBB 1U9RA 2ZW0A 4XWTA 1ESRA 2JA7B 1DOKA 2O5JC 2WINB 3MC0B 4C7ZA 1BCPF 1G6ZA 2K22A 3BVGA 5EE1A 2L52A 4IUUA 2KVMA 4DF7A 5BYQA 3ND8A 3TEWA 1TS2A 1TKYA 1ZYRC 4KKJA 2LFIA 1F2LA 4MN3A 4BWGB 1SYCA 1XLQA 3W5UB 4BY7B 1N5WA 1PZID 2WXQA 2E2DC 1PFBA 2YU9B 1AZPA 4M8AA 4NDXA 1AYFA 1CTMA 4ULLA 1SDFA 3K5OA 1XX8A 3U52E 2Z1CA 4B08A 1Y69U 1Y1VB 2R3ZA 4PMBA 3VR6A 1YN4A 4G4KA 5H92C 5KEEA 2K03A 3I57A 3VR4A 2NZ1D 2M56B 4YSYB 2NB0A 1DD2A 2KUMA 3VYTA 5EE3A 3EFXD 1STNA 4LMQD 2NTSA 2A5HA 4OL7A 2DLBA 3C8YA 3TEZA 3PUVA 1XYIA 2JXMB 1ESFA 1LTRD 2EVBA 4YIJA 3Q6SA 1PTOB 2KN4A 3AE6B 5BYSA 4XDXA 2BW2A 2Y5PA 2LS01 1K8OA 1WWTA 1BDOA 3PUZA 1CZPA 5M5XB 2MPMA 1ZXHA 2IJ0A 4MACA 4A3MB 2KECA 4KY6A 2A73B 4EVOA 1I4RA 1EY5A 3T13A 1FO4A 1LT4D 1C4AA 5C6AA 1IW7C 4CJ0B 1Q10A 4XWWA 1TQOA 4L63B 4OIJA 4C3IG 2QDBA 4ZK9B 3IAM1 3GTJB 1TS5A 1K51A 1V97A 1D1IA 1EWHA 3NTIA 4DQOC 3S1NB 1STBA 2HDEA 4REZA 4KJOA 3NQTA 4Q5VA 1GHKA 3MXGA 3RFZB 3KLSA 5CYUA 5BMGA 4V0BA 1G8ZD 2EYLA 1P7EA 1YNJD 2RQXA 5FKAC 3AE1B 3T51B 1UNSA 2M9VA 3S16B 4K2LA 1GUOA 3U9OA 1KTKA 5G3LF 5BN4A 3H94A 3MEHA 4B0EA 1O7ZA 4C80A 3B9JA 4XDDA 1VLBA 5KRUA 2JEAI 3IAS1 2QILA 5C44B 5DM63 4K5XA 5EBCA 4G7OC 1Q1EA 3J81L 4YSXB 3NTHA 1YJIA 4DAVA 3AB9A 2JEBI 1OQRA 1K50A 2MEKA 2E74C 1HPCA 4A6QA 1EYDA 3I4LA 2QKIC 2EJFC 3U2SC 1UEAB 5EKKA 4ARIA 5AFWA 3N6RA 1IL8A 1B9NA 1SYBA 1ZYRD 3MXNA 1ILQA 1TS4A 3MHZA 3S14B 4I7ZC 2W54A 2DWQA 1EL0A 2J42A 1J7AA 3AE9B 1C4CA 3DWPA 3VRBB 3DXJC 4ZHPA 3X3MA 1CZWA 4AYBB 5I2YA 2QSDA 1QOBA 1TY2A 4J6HA 1DOXA 4TQUS 2ONQA 3ZYYX 4KKSA 5CBAE 2OF1A 1HFNA 2EOTA 3A8JE 2EKIA 5A35A 3I9V1 2WDVB 3SHLA 1HFGA 2EZVA 2VZKD 3BVMA 2KEEA 2XN9C 1MI2A 4WH4A 3Q24A 4GZYC 3OMCA 1XO3A 3BVZA 1QOFA 2YEPF 4HEDA 1FD6A 3FRPB 4DU9A 1ZDXA 1RD9D 1KAAA 2NMQA 4HKZE 3RZDB 2JX5A 2Q8IB 4A3BB 3T56B 3S2HB 3A56A 4ABNA 3ABVB 3I4MB 1IUEA 4RNAA 1EY9A 1L0XB 3J9CA 4PV1C 1NSNS 2OEOA 3N9YC 1FR3A 2GRIA 2LJIA 2H4OA 4C3IB 3PIP3 4PQXA 4R3DA 2H88B 2BDOA 4QMGA 1LACA 1UGJA 1MGSA 5C4XB 2PVGC 1OO9B 1XCQL 1ET9A 4EQNA 2F0GA 1JWMD 1H9RA 3X3NA 5ISRA 2WACA 1ENFA 4LLGM 1V8CA 2MUYA 1TJEA 2B2YC 3GB1A 3EGRA 3UI3A 1QF6A 2CHBD 1CQVA 3DWGC 3HRDD 4XYQA 1OQQA 5EPJA 1TS3A 3LXFA 3E6ZX 1LT5D 5A2QL 2C9OA 1VZ8A 1MI0A 1WTPA 2CW0D 2WS3B 2XWJB 4KGSA 4ME5A 4KKTA 1NENB 1G91A 3C3LA 1IKLA 2KOLA 2K32A 5M9OA 1RODA 4HCEA 4RKLA 3D6CA 3RUZA 2GI9A 4H7BA 1JRPA 4DNRB 1VRAB 1F2ZA 2MP1A 2WXKA 3E56A 2K05A 5CV8A 1ZPSA 2G1EA 5I9PA 4HTHA 4H0LC 2RSNA 5KNBA 1STHA 3VQIA 2MHVA 2E2JB 2D9UA 1E6EB 1ACCA 1JR0D 5DEHA 3GD7A 1V43A 3U4EG 2OHFA 2V3PA 4YTMB 3W9CB 4NW2A 3AEGB 1QLBB 2EJGC 1CA5A 2B2WC 2BB5A 4B0MA 4FF3A 2B2UC 4CKEA 1AP0A 2JE6I 4MH8A 3J80E 4DGZA 4C1NI 2BCOA 1B50A 2M00A 3ZJVA 1VMCA 1LTTD 3HS0C 3P7JA 1JE4A 2Y3AA 1F77A 4HN7A 1BCPC 2EY5A 1DOLA 3CRKC 1A3TA 3R3OA 3C46A 2BTEA 3VA5A 1BOSA 5HURA 2X38A 5IGEA 1J9OA 4ZUJA 2INNE 1JWSD 2IT1A 2B2VC 2IX3A 2OT2A 1PTOD 3Q69A 1FD7D 3M3YB 1YQ4B 5HFYA 4NZLB 4WORA 4H13C 2F0JA 4FF1A 1SE2A 4UDUC 1D5MC 4TQ1A 2VB3X 3VR3A 3TN2A 4R9WA 1AZQA 2E2IB 2LHDA 3HKZB 4XQNA 3IAYA 5HGTA 1I50B 3J80L 1TKEA 2F4IA 2W3SA 2BDNA 3OPOA 4IUVA 4FO2A 5I9OA 1BQQT 4WAFA 4GDKB 4OGQC 3PUWA 2K6AA 2NTTA 2TMPA 1VR9A 1KNEA 4X3UA 4JWSC 1EQVA 2PKOA 1YQ3B 1PRTB 1RCVD 3MWYW 4DAYA 2L12A 3G6JB 2AX5A 5C2TB 2NVTB 4F87A 4QB4A 4A8XC 2PYKA 2IX1A 3M85A 5FLXE 1A6XA 1L6VA 2DNCA 3K57A 2CJOA 4H44C 4WWMA 4IUNA 3PUYA 4BBRB 4YT0B 4HAEA 3KF8A 3C2PA 1QCBD 1K53A 1A2TA 4US9A 1SE4A 2B2WA 1KDAA 1FGBD 1Z6HA 3E9SA 3DHQA 1PTOF 5C0XH 5LL6S 3P1MA 1FNWA 2DYMA 3HUIA 3V2TA 2E2HB 4JK1C 1H9KA 1RM6C 1WGKA 2NWGA 2AWNA 2FINB 1B9MA 4XT1B 3SK5A 1SJHD 2CJNA 3QIAA 3MVVA 1JC7A 4RCNA 5BMIA 3TZUA 3PMFA 1DGJA 4MHEA 2R93B 2PW9A 2K33A 1Q90A 3BDOA 2B2VA 1AN8A 5BN5A 2K04A 1N61A 1QJOA 2B2TC 4ZOHC 3EA6A 1GUNA 5FLXL 1J8IA 3NVZA 1ICWA 4KD4A 3K58A 2NUCA 1O80A 1SYFA 4NAWB 3AE4B 3ETRA 3AV8A 1XXGA 3TZDA 4IFDH 3MFGA 3ND9A 2K5PA 3NBHA 3C1FA 1DZ1A 1BCPD 3A8KE 1VZ7A 2ID0A 4L6TB 2B8FA 4RH6A 4ID6A 1H9SA 1JWUD 1D6EC 3V05A 1B3AA 3SFDB 1N62A 3AN1A 1PXUA 2ZW1A 2WB1B 3V96A 1Q3LA 3A54A 4M0WA 1PUTA 4B9XA 5C4HA 1YN5A 4FF2A 4L2YA 1Y8OB 4TMAB 4K14A 2PCFB 1JWAD 2L1BA 4USAA 4ZRPA 1LTBD 4FXGC 1U4MA 3HGBA 3LWUA 3M4YA 5C5MA 1IGCA 5BYRA 3K59A 1I3QB 2NVXB 4C3JG 1S5ED 2F1MA 2JSOA 1EFID 3M7GA 2EELA 2L32A 1YNJC 2J0TD 2F0TA 1RKNA 1FFUA 3GV3A 2LMCA 3QWNA 2DY8A 3MFYA 5BMHA 3KQ4A 1H9JA 1HEZE 3R2TA 4IKGA 3SDZA 2X6GA 1L0YB 3OWEB 1G2TA 3H8HA 3ZGZA 2HCCA 4DAPA 1TWAB 4ZRZA 1EY8A 5JOBA 1GUSA 2F0HA 2A6ED 1EY7A 3TEXA 1UWMA 5T8IA 4A3GB 1SSNA 3FILA 1STGA 4OZBA 1DOMA 1DONA 2WXNA 3H3VC 4GDLB 1EYAA 4GLSC 4F8MA 4XE0A 1QKZA 1NR2A 3WDNA 1PLFA 2L0CA 4RGMA 5CV4A 3MP9A 4FXCA 3FKIB 1SBBB 3TEYA 3P20A 5ELCA 1S5BD 2B2TA 3AU7A 3HRZC 1Z7TA 4QCLA 3P4RB 4LJZC 1ZEQX 3K7AB 2NVYB 3NUHB 2I07B 4L1BA 4YSZB 1A70A 2F0LA 1E7PB 2WDRB 3L4PA 1VF5C 4ZKCB 4EQPA 1ENCA 2PQEA 5G3LD 1SNDA 2BA0A 2ON8A 1WSPA 1J7BA 3Q8FA 3NZ3A 1R9TB 3T53B 2D62A 2KMMA 4PNYA 5JPMC 2AQ3B 4A90A 3VR2A 1GB4A 4DFAA 2QJLA 1TZOA 2A74C 3EVQA 1ZUD2 2ACZB 1MD2D 1FIQA 1FCCC 1F9QA 3K6OA 1Y1WB 1GJXA 3T16A 1KF6B 5I2XA 2H1EA 2SDFA 5K36H 2BT6A 1QQRA 3H6MA 3GTPB 5C0XJ 3A7LA 1SYGA 1TR5A 2L11A 1LTAD 2N7JA 1IKMA 4FYDA 3BDLA 5JJZA 1I4XA 4IALA 1KNAA 2SNMA 1YN3A 2VB2X 1GUGA 1S5CD 1I7HA 4RFBA 1BMLC 1AEXA 4QF4A 4R8IA 1QNUA 4XXEA 1HUMA 5I6WA 5IGDA 3AEFB 5DNFA 4KMUC 3J7AV 3I3CA 1E0BA 2PZUA 2KEDA 3AECB 3WOFA 3D4RA 2EYFA 4G57A 4C3JB 1CFMA 1C4QA 2NBFA 3QB3A 4IFDJ 2SNSA 1MBYA 2RDGA 1EOTA 5EBDA 4K6DA 1IYUA 1PZJD 1OXSC 4KGTA 1STAA 1I4QA 1PGAA 3JAME 5HHDG 5C4JB 4HSPA 2MGSA 1IBXA 3HVZA 4P16A 2K5QA 4OO1I 2F0QA 3BWUD 2NN6H 2CW0C 1R4QB 1Y8PB 2PTLA 1HQMC 2LGIA 4KV6A 1D5ZC 3J7YW 1X3QA 2N88A 5TSSA 5G5GA 3R8BA 5CV6A 2SAKA 2Z8LA 1FXAA 1A2UA 2PPBC 1EIHA 4HRSA 4EGVA 2BS2B 4MT5A 2Q5WD 1E0ZA 2AUJD 2K0PA 2BYTA 3VYRA 2R7ZB 4OZCA 2F0VA 3NQIA 5IGCA 3VRAB 3OHXC 3KLRA 4C3HB 3BK1A 2WKDA 5EPLA 1EU4A 4OO1G 1JROA 5AUIA 3SE0A 4RAUC 1EIGA 3HOUB 4QIWB 5JXVA 1SIJA 3JAML 4QUCA 4HROA 3TBIB 1VCIA 2JA6B 3BYTB 4D2KA 3L7ZC 5T1GA 3N52A 4DK1A 1MHXA 4K5VA 2DN8A 1MHHE 5DAUA 1DOYA 2IWHA 3LX0A 2JU6X 3VA7A 3NTKA 3AE5B 3SR6A 2F0IA 4X3SA 3K5MA 2CQAA 1SNPA 5I6YA 2WAQB 1BO0A 4YTNB 3D4WA 2NVQB 3U7ZA 1PTOC 2IPKD 3FDTA 1LT3D 2HDMA 3MTSA 1PRTF 4NKLA 1KRHA 3E5SA 3P4PB 2RA4A 3CRLC 1N63A 2E6XA 2RSOA 1ZE3D 2HCIA 3KK7A 5CGKA 1ENAA 3I4NB 1XWEA 1KLGD 2I46A 1WTOA 2KQ4X 4A3EB 1PZKD 1SB3C 3H09A 5HI1A 1EY6A 1I4HA 3T3OA 5M5WB 4RHSA 3AEDB 1LO5D 2XNAC 5CMDA 2FBWB 2LUMA 3PZ8A 1SMYC 3BS1A 1HUNA 2JA8B 1S5DD 1JB3A 3QOJA 3LWEA 5COYA 4C56C 2WXLA 3S9WA 4KKUA 3S1QB 4A3DB 1CA6A 1CQFA 2Y5CA 3FEWX 3PIO3 1ZXTA 4BA1I 1UWXA 4CKBA 3TP6A 2IX0A 1FNVA 1SF0A 3HOYB 1JOQA 4F7XA 1TWFB 3FPUB 2KWDA 1L0VB 5IT9E 1JORA 3VR9B 4CQNA 5JVG3 2I2YA 1X3PA 1OFFA 3LNNA 1BBXC 4OVZA 1WXQA 4CHTB 4L8JA 2Q8TA 3RZOB 1JWBD 4Y7NB 1TKWB 3OIPA 4K5WA 5FO8B 5LL6X 4YWGG 5ELDA 2F0KA 1Z47A 3R2IA 3HOVB 2EYMA 1NVID 1NYQA 2SOBA 3TP7A 1MPEA 2PMVA 3TSSA 1J7CA 2TSSA 1TIID 5C3EB 3FILB 2RPVA 2EPBA 3PZ7A 2JSVX 1JQYD 2EYHA 1QG7A 2F03A 3CQZB 2XVSA 2PNRC 1D5XC 1B4OA 2Z4HA 2IL8A 3NXWA 3MHBA 1RYJA 4OZAA 2D5DA 1SNQA 1ML0D 1KABA 3QJYA 3PO3B 2A69C 5IT9L 5H8YE 1NI3A 5C3XA 3KWVA 3S1MB 5E3FA 1HXYD 1BF4A 1CZGA 3AEEB 5K5PA 3W5VB 2L55A 2DBYA 1B9RA 3S2DB 1F0ZA 5HG2A 1BUVT 1NR4A 5BN3A 2WV6D 3HEJA 3W2DA 4PT5A 1F2RI 4RKBA 4P6VF 4P2CB 4DXFA 3R93A 2F3VA 4WURA 2BA1A 1QWYA 2PVOD 2EE1A 3I8ZA 1YNTE 1CT1D 3QO2A 1YMHE 1UUPA 4RGNA 2HQEA 2F0EA 2MH7A 1CHQD 4A3KB 1L5PA 2WDQB 4KHZA 1YJJA 2B2YA 1I4GA 5CBEE