3BVZA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Enterotoxin type C-3
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Staphylococcus aureus
total genus 63
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvzA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvzA01
1PRTF 3EFXD 1LT5D 1MD2D 2SEBD 1PTOH 4RGTA 4BWGB 1V1PA 4C56C 3DWQA 1XTCD 1EWCA 1SEBD 1EFID 3R8BA 2AQ3B 4Z9CB 1EU4A 1FNUA 5I4DA 2IPKD 4RGMA 1STEA 1RDPD 1BXTA 3MFGA 1DJRD 1SBBB 1SJHD 2XRSD 2NTTA 1PRTD 1BCPF 2IJ0A 1LLRD 1I4GA 1FNVA 1JWMD 1KTKA 3TSSA 5ELBA 1JWSD 5D3DA 1YN4A 1L0XB 2ICIA 3MC0B 1RCVD 1LTSD 2QEJC 1LT3D 4L6TB 1I4HA 4RHSA 1I4RA 2RDHA 5D3IB 1JR0D 1LT6D 1I4PA 1EU3A 2RDGA 1PTOF 1D5XC 1ET9A 4L63B 1LTBD 5FKAC 1BCPD 3O13A 1D5ZC 3DWAA 1G8ZD 3CHBD 5ELDA 1TS3A 1JCKB 1T5XD 5TSSA 3GP7A 1ET6A 1EEFD 1RD9D 3R2IA 2AQ2B 3R2TA 1SXTA 2TSSA 1UUPA 2AQ1B 3SEBA 1CHPD 1FGBD 1B1ZA 1PTOD 2O2LD 1HQRD 2CHBD 1TS2A 4RHRA 3BVZA 4NZLB 1M4VA 1BCPB 1XXGA 1S5ED 3URYA 1YN3A 2Z8LA 1KLUD 1SE2A 4RH6A 1RF2D 1DYQA 1PRTC 1LTAD 2G9HD 3V05A 1CK1A 1LTGD 1PRTB 2XRQD 1V1OA 1SJED 3W2DA 1LTRD 1LT4D 2XN9C 1FNWA 2QILA 3BVGA 1TS4A 1HA5A 1CHQD 2WV6D 1CT1D 1I4XA 4RGOS 3EA6A 1ESFA 1CQVA 4UDUC 1BCPC 5ELFA 4RGNA 1LO5D 3BZDB 4RCOA 1S5BD 1HXYD 1JWUD 1JQYD 2NTSA 1EEID 3KLSX 4OHJA 3BYYB 3BYTB 1B44D 1F77A 4RFBA 1S5FD 1TS5A 1D5MC 1I4QA 1PTOC 1TY0A 2R61A 1HTLD 1LTTD 3BVMA 4O1NA 3OWEB 1PZKD 4TSSA 1SE4A 1UNSA 5ELEA 1LTID 1PTOB 1SE3A 4ZYSA 1AW7A 5FK9C 1QILA 4DXGA 1L0YB 1PYWD 1KLGD 4DXFA 1V1PB 5ELCA 1FD7D 1D6EC 1S5DD 3DWPA 4K6LA 1GOZA 1ENFA 1S5CD 2J4XA 1TY2A 2XNAC 1AN8A 1PZID 1PZJD 1YN5A
chains in the Genus database with same CATH superfamily
1F9JA 1MG4A 4IFDI 5L37A 3LJ3A 1ICWA 3WALA 5IY0A 1LTLA 4LK1C 3NBHA 4HWIB 1Q12A 1J0GA 2LVOA 1YJIA 2MJDA 3PRZA 5FJ8G 2YYZA 3Q23A 2R92G 1WXVA 4MSQB 4KGSA 1YITA 1V1QA 3S2AA 1Y1VB 1SFOH 2WXQA 3RNCC 1VMPA 3CCSA 1I6HH 5FO8B 4QQBX 1JWMD 1EF1A 1HZ6A 1X54A 2ZTDA 2QW7A 3V3XA 1C9FA 4R4TA 1PFSA 1JMCA 1QOFA 5I2XA 2ZXPA 1X3EA 1V43A 2ZCBA 3RUZA 3K9OB 3AB5A 1KRHA 3V60A 4JBJA 2VNUD 4EQNA 4DR3L 4A3IG 1D5XC 3ZTCA 4EKUA 4JYAQ 1LTBD 3NTKA 5HY6A 1NR4A 2MHVA 1L4DB 4WURA 1PLFA 4JC0A 5FLMG 2VB2X 2F0SA 3TUOA 4KV6A 4GLSC 1P8LA 1UBQA 3KJOA 2K5PA 2R93B 3TZUA 1QOAA 1S3OA 2A5HA 4EQ5A 3SR6A 1VQFA 5LL6X 3DLLA 4C4VA 5E7NA 1JE4A 1E8XA 4HPPA 1GB4A 2AL6A 1FGBD 2HDLA 1EY5A 4KKUA 3DVGX 1N34L 1GO3E 3A8KE 4DAYB 1C79A 2REXA 2RGFA 4JI2Q 1KF6B 1YHBA 1SNPA 2KMAA 4JOIA 1XNRL 2IX0A 5HHDG 1DCZA 1ZP0B 4LFAL 4BS9A 1ICFB 4JBKA 4DV7Q 3Q3OC 1UE7A 4RM9A 3V05A 3CMMB 4OVZA 1XLPA 1UGMA 3PZ8A 2PO4A 4DR2Q 2NN6G 1QZEA 4C80A 2I2YA 4WQOB 1FRDA 4A3BG 1MI2A 4A3MH 1G6ZA 2CU1A 4LMQD 4F87A 1LT4D 1JJGA 1P7FA 2FCQA 2B2UA 2K8BA 3H1UA 3BVGA 1CHQD 3NRZA 1TTNA 2A6ED 3LDZE 4YY3L 3I4MB 3H9DA 2DGYA 3V6CB 5J17A 2FUHB 1NNXA 5D65A 3E0EA 1Y14B 4GKJL 2K5NA 4K0KQ 3L0WB 1AP0A 1NY4A 2OCEA 2IY5B 2JWZA 2JA6H 2LXCA 2Q8RE 2R7ZH 2E5LQ 2BH8A 4DV1L 2DZIA 1TWGH 1Y1WB 5CGKA 3CF5A 2PVGC 4X62L 1E6EB 3HOWH 4A3LH 2KJRA 4LLGM 1R4NB 3RPFC 4KD4A 3A1QA 5AZHA 2EVBA 4KN7C 4BY7H 1F2LA 4P1BC 3T1HL 3VQIA 1IP9A 4ICVA 1EIFA 2LEKA 3WOFA 1WGKA 3H3VI 1AE2A 4C3IB 4H13C 2VQFL 1S5CD 2BW2A 1T9HA 3FAHA 4A3EH 2HCIA 2D11A 2RCFA 4PV1C 3AI5A 4IOIE 1A0IA 2HJ1A 5EE0A 3BG3A 1TWFB 1QE6A 5D14A 4DGZA 2MLBA 1EWHA 3P2BA 1YNNC 4BOZB 2HT1A 1PH7A 2PQAB 3OW7A 2UU7A 3ER0A 4BBRH 3A9JB 4XQNA 2NBFA 1IYJB 4OL7A 3RLFA 3AV8A 2PE6B 4EUTA 1NI3A 4NPNA 4WWMA 4N9F4 4DHZB 5L83A 4PZ6A 4WWPA 4NW2A 3L17A 3L7ZC 2IJ0A 3NELA 4A3FH 4AYBB 5ELBA 4BVUC 3NZSA 5IGCA 1QZGA 4UP9A 4QL5A 2L0TA 3N20C 1QVCA 4HROA 1Q81C 1LTSD 4LNIA 2JZPA 3L16A 5J2RA 1WR6E 3TMPB 4LFBQ 2PW5A 1VCBA 1Z5SB 1DZ1A 1VCIA 3L2PA 2F0FA 4S17A 3GTQB 3NS1A 5H1SE 1R4MB 1GB1A 3VYUA 1N63A 2MH7A 3VTWA 1D5ZC 4UP8A 4GOPC 5FJ8H 1XD3B 4W9KA 3DBRI 5IT9L 2R92H 3GTKB 2N1WA 4BAXA 1YJWA 4ZHPA 3FP9A 2F0JA 1NE3A 3NUCA 2R2QA 3PF4A 2B2TC 1YMHE 1EZ6A 2JA8B 4LUZA 3SDLC 3DBHB 2SNSA 3EFCA 1PH6A 4N58A 1RHPA 4XT1B 3VDZA 2KTFA 3EFUA 2K6QA 2G4SA 1BCPB 1TVXA 1TWCB 1Y8NB 3J81E 1OQYA 2A8VA 1F0ZA 2PKOA 4KI0A 2EYOA 2ZXOA 3GTLH 4A3IH 1J7CA 2MWSB 3FRPB 3CC7A 2CCZA 2J0MA 5CV8A 4JI1L 4MH8A 5KHOA 2CJOA 1ONLA 1Q46A 2B76B 2VH2A 4FP5D 1XMQQ 3T8MA 4XC2A 2O4XA 1H9MA 5D6JB 1Q0WB 2DAJA 3K6OA 3DBRB 3NHHA 1GJZA 1FVIA 3AH7A 1WYWB 2A5UA 3VA7A 1ZYRD 4EGVA 5G3LD 4JI2L 4CKBA 3HUIA 1I7HA 2KDBA 1RTNA 3L3OC 5JEAH 1LO5D 2VQEL 5FR6A 3E6ZX 1C7YA 1SN8A 2EYFA 2IW3A 4B3MQ 2RBMA 3KF6B 2INPE 4W9DA 1GUSA 1PXUA 4GNXC 2EYJA 1IW7C 1BUIC 2GA4B 1KM7A 2IX1A 1F77A 1PQSA 3L9AX 4IWOA 1K8AC 2DNEA 3E0JA 4B3TQ 1F2ZA 5M3FB 3G48A 1SMYD 1WJ4A 3M4OH 2B63G 1N6ZA 1V2YA 2JT4B 4HJGE 3N6RA 4HCNB 4I6PA 5H8YE 2NN6H 5EBDA 2KFKA 1TZOA 4A3BH 1LTID 1O80A 2F0NA 2M00A 4LW1A 4O0AA 4DN4M 4YSXB 4K0KL 5E4XA 2WDQB 1WTQA 1L0YB 2WKCA 3VYRA 5IYDG 1PVOA 2LGDA 3CIRB 4F8CB 1FD7D 1IBLQ 4QF4A 1OXTA 2N49A 1XWEA 1J8IA 1C78A 2GB1A 1BUVT 5J18A 1PDXA 1F2MA 1D1KA 3VRBB 1KD1C 1SFOB 3OYYA 4HIMA 2L55A 3STBD 3A56A 1I6HB 2YLMA 3G6EA 2K28A 2K7VA 1M1KC 2Z0DB 3GZNB 3N30A 3TBLD 3UGBB 2K03A 1S3SG 2F0TA 5ELOA 2J52A 4ZCKA 3P4RB 5I4DA 1EYGA 5C4ZA 2F3VA 3KBXA 4I6LB 4L2YA 4XWWA 3CKIB 1PV4A 4JI7Q 4DFAA 4XDDA 1GUNA 2Q8TA 2A68D 2CQAA 3SVMA 5C5LA 2CHWA 4EVOA 2KK8A 1EUVB 3LYYA 3ZKJC 1SNDA 3R93A 4XYCA 1VMCA 3IFTA 1B4OA 4II3B 4IQZA 2KECA 2K33A 2F03A 2JK8A 4LF8Q 3KF8B 3C8YA 4DHZE 3W5UB 3T4AC 1B3QA 1ET9A 3RMHA 4A3OA 4TKOB 1L1OC 4AYBE 2A6HC 3PO2B 3RMKC 5M5YB 4M8NA 3QA8A 3WAPA 2NZOA 2JXTA 5I2YA 4K6DA 4GLXA 5IA7A 3KK7A 1VQGA 2BS2B 5IYCG 4DR6Q 2AQ1B 3N32A 4DAPA 4OWXB 5IWAQ 1PTOD 1B1ZA 2E2HH 1CKNA 1Q82C 3AEGB 1K53A 4IFDG 2LRWA 1HH2P 1LABA 1WX9A 3MC8A 1EY0A 1CZGA 1VQLA 1ACCA 1CFMA 4DPGA 4A3JG 4A3MB 4A55A 1EWIA 3OIQA 4OELB 1VQ5A 2ON8A 5CV6A 1ZDXA 1TIFA 1P16A 2XSCA 2OJRA 1EFWA 1CZWA 3I2ZA 4M1UB 1L4ZB 2O2VA 4MM3A 4DAVA 2WLBA 1SRUA 4RKBA 3JYUA 3ZIMA 2NB0A 2EY5A 2VB3X 2HTME 2K8HA 3W1SC 3W2DA 4F88A 3ONSA 2JA6B 4EQOA 1M8AA 2QILA 4ZYNA 1IBMQ 5C4XG 1F1HA 1JE5A 2EE1A 2R7ZB 4C7YA 2FHTA 4MT5A 3KJPA 1TWGB 4PYZA 1C3TA 1OQRA 2BB6A 3HOWB 1C4AA 5CYUA 1BBWA 5H92C 3DBSA 1S5BD 4KKIA 4USAA 1GKHA 3VR9B 4MGKE 1XYIA 2NTSA 4CQNA 1XMQL 3RYTA 3U58A 3AE5B 4N9TA 3TN2A 1QOGA 4MGIE 3D4DA 2B3AA 3QIJA 1QLBB 4OW0A 4RM8A 3TEXA 5CR3A 3ZNID 4ID6A 1S5FD 2EXZA 1J5EL 5LNK1 1MJEA 4A3EB 4O1NA 3JAMc 4JPBW 3J7YW 3PQIA 4A93H 1BBXC 1YJ1A 4APVA 1D2BA 2V9HA 2L0FA 1DGSA 4ZK9B 1HQMC 1WWTA 2KANA 3FPUB 2L1AA 1PYWD 3CSFA 3AE8B 1Z7TA 3CU7A 4QUFA 2F4VQ 4OO1G 1GOZA 4BBRB 3HRZC 4NB3A 2J7ZA 4A3CG 2R7FA 1TY2A 4MTNA 3UDGA 4B3TL 3FILA 2QCZA 1QUQA 3DPDA 2A69D 3G71A 1N60A 1WGRA 3K58A 4A3FB 2MP2B 2N7EA 1K73C 4C4VB 1PFNA 1IL8A 3L13A 5D94A 5T8IA 1HCZA 2DNCA 2B63H 2KDFB 3DCGA 4J8QA 4OGQC 4I7ZC 2I5HA 4BY1G 1R9TH 2FXQA 2KZRA 4XZ4A 3F8TA 1EO6A 2FBWB 4C3IG 1EQVA 3I56A 5DLQE 3HOUG 3N1YC 2KT7A 2JN4A 4OIKA 5IYDH 4UPAA 2R7DA 2WU5B 2WACA 4HJKA 3RD2A 1FNVA 2PNRC 3DM1A 2K5WA 3I8ZA 4UHVA 3HKZG 1MSGA 4NKLA 1WTXA 5D2MB 4PQXA 3MC0B 1IGDA 2R92B 4E74A 3OSOA 1F2RC 2KCCA 4HKZE 1JR0D 3RLOA 3QOLA 1I4PA 4L5TA 1WSPA 3PVLA 4GDKA 1EIYB 4NY0A 4DV4L 2PI2E 3KLSA 3S14H 1ZE3D 1IZ6A 1BCPD 2ALYB 1DD2A 2N8NA 3O13A 3N9YC 4K3BA 2NVXH 5IT9E 1BBUA 2DBYA 5C0XG 4K2KA 1C77A 5M5WH 2UXCQ 1VQIA 3I3CA 4LF9Q 4M8MA 5D7GA 4NJCA 3VTVA 4F7ZA 2ID0A 3GTLB 4A3IB 3ZGZA 4PT5A 2TSSA 4G7OC 4NNJB 3I9V1 3CAMA 3NOBA 4LF8L 1G291 1TS2A 1QNKA 2I46A 2N0SB 3CC2A 2MJ8A 2NS5A 2QDBA 3TP5A 5CV5A 1XNQQ 1QKZA 3URYA 1BKBA 3A1QB 4ZUJA 2OTLA 1WJ6A 3HKSA 4ZRQA 3QG1A 2J0JA 3P4PB 2C5LC 1SR3A 2Z9HA 5CBEE 2G9HD 1YD8U 4DR6L 2UUBL 4KY7A 3ZDMC 5DAUA 4A3KG 2PEAA 5IWAL 1PH4A 2KOXA 1R4PB 2HD3A 3H94A 5EJWA 5A35A 5C6AA 1SYCA 2WQYB 4KDIC 4XYOA 5IYCH 2CW0D 1JT8A 1MFWA 3X3MA 1HA5A 2RKSA 3Q8AA 3RZWC 2V3PA 3ZW3A 2NVYH 4IFDH 4J3OD 1YEZA 3M4OB 4C7ZA 2G45B 4PMWA 2HQLA 4GN1A 1Z47A 4A3JH 4A3BB 2F0PA 1VQDA 2C7HA 2WP9B 2Q2HA 4IUPA 4HDOA 4LTUA 1HXYD 1JWUD 2CWPA 5IGFA 4YWLA 1NENB 2CKHB 5JPNC 5FLXL 4JVZA 1OGWA 4RAUC 3PREA 4JW0A 3SR1A 2PPBC 1IBML 3MHZA 1TY0A 3CRKC 1N62A 1HTLD 2KKCA 4A20A 2BYFA 5TR5A 1JQ4A 4OZAA 1SE4A 2WXGA 5BN4A 1RRBA 2AUKA 5C4HA 2D3GA 2MBHA 4K3CA 3RNAC 5JH5C 2GBJA 4ZLTF 5GROA 4IWQA 4KK7A 2JA7B 1AFPA 1HPCA 2I1KA 2KDIA 2RF4A 4JI6Q 3PTFC 3J81c 4NDXA 4DV0L 4DXFA 1V1PB 1HR0Q 2CKZB 2NVQH 4AOFA 1NJIC 3DEPA 3KOJA 1ZOYB 4P74A 5AUKA 1HA6A 2QJLA 3M63B 2WXFA 4KJNA 1MI0A 2F0UA 5JVH3 4IPHA 4I65A 1PTOH 3O65B 5G2NA 1UWMA 1VQCA 1VQHA 3D0FA 3U4ZA 2PCFB 3DWQA 2LGIA 3ERSX 4WWOA 1EFID 4GXBA 1UE1A 4GZYC 3GOEA 5GQOA 4DK3C 2F4VL 2KD0A 3NXWA 1QB5D 2AWTA 1AE3A 2LZ6A 3C3LA 3TREA 1E8WA 1SYDA 4TKNA 4P75A 1T0QC 4OVVA 2UXBL 1M94A 2AUJD 2K5VA 1C4PA 1OEYA 4ZRIA 1ZXHA 2ZNVC 4OO1H 4JV5L 3DHHC 1HZ5A 2HTHA 2WXPA 4A3CH 3VR4A 4V0BA 3B2GA 1BDOA 1H9SA 3I90A 3NZUA 2UU9Q 3TRZA 2KC2A 1UWXA 2AHOB 2L11A 1KDAA 4II2B 2PMZE 3AYHB 3B1LX 4YL8A 2LFNA 3QX1A 3I57A 5FKAC 3FKIG 2GBMA 3GD7A 4KN4C 4BY1H 2H1EA 2M9VA 4ODGA 4XDXA 1V9PA 1K50A 3PV0A 4NP5A 4C3IH 3OWFA 5CORA 2KFJA 3PZDA 4ANUA 4NAMA 1A2UA 3VR6A 1HNXL 3HOUH 2DLBA 2D0OA 2MCNB 2KUMA 1XQQA 5BN3A 2V3SA 3PGEA 3RR5A 4XYQA 2BTEA 4G7ZC 1CSPA 2LKVA 1FEHA 1NTGA 1J7BA 2V1CC 3RNUA 1FJGL 2CHBD 2DY8A 4C3HG 3MJ5A 1N36Q 3I3TB 4NAWA 3TDQA 2IL8A 4GOPA 1U5KA 2F0HA 4L5QA 1WYDA 1AH9A 1YQ4B 2IZVB 1IYUA 2PPHA 2KFKB 1UELA 2ONQA 5G3LF 1P9DU 4LF9L 4TMAB 4DUZQ 3I72A 2B2TA 2P5ZX 5BO4B 3ALBA 1QG7A 4C3JG 2MQHA 5C0XH 4IUNA 1VDVA 3ABVB 1NAPA 5C2TB 4A3PA 2L00B 2YV5A 3AN1A 4J1MA 4B6WA 2VUMG 1HHVA 4K2LA 4YSZB 3SK5A 3J81i 3Q8CA 3KWLA 3NZ3A 1XNQL 3LWEA 3OW2A 3SFDB 4MNOA 3P42A 1T0YA 3K7AH 2CHXA 1U9RA 4FXCA 4FJYA 4LJOB 4DDID 4ZHOA 2B2YC 4XT3B 4TUUA 1TU2B 1BMLC 2EOTA 3H0GG 2BKFA 4KVGB 4JIOU 2B2WA 4F1SA 1LFDA 3VUWA 1N9WA 3A9KA 3ZNZB 1E24A 3BYYB 3ZTDA 1B44D 2F0EA 1EYCA 1PH3A 4TQ1A 2WDRB 2R2OA 1C76A 1D5MC 3KYCD 2F1MA 5IO9A 4A3KH 2IO0B 1VDZA 2JWUA 2DNFA 5E4WC 2V0GA 3OWEB 2EPBA 4H7BA 4K8IA 2WXRA 1PFBA 2KWUB 2Q8IB 5IN7A 1FL0A 1Q3LA 4NMZA 1QILA 1WOCA 5FOBB 1E90A 1TYGB 2RSUA 4GNXA 4FVMA 4BZAA 1YZ6A 4LUOA 2B63B 2K52A 3VDYA 2MNAA 1R9TB 5G5HA 5AUIA 4AQYQ 2IGGA 3QJYA 3BDOA 3APCA 1IGCA 4EZLA 4MZ9A 2B8FA 2IX3A 4KX6B 3S16H 1I6VC 3QIAA 1O78A 2E74C 3DUZA 4N8FA 3AE9B 2KVMA 1CA6A 4A90A 1ZW7A 1EWCA 1GAQB 2F0MA 2FCSA 3HM3A 3IBEA 4JI6L 1FNUA 3F2UA 2IPKD 2X6LA 1HR0L 2D2QA 1X3PA 3A7AB 1X3GA 3ZJTA 3V2TA 3IAM1 1DJRD 4DV5Q 3ITPA 1PRTD 3OTOQ 2WAQG 3S14B 1NSNS 1NEKB 3ML8A 5JHAA 3IRBA 4BFRA 4LDTD 3IXSA 1TQOA 3B2FA 2B2VC 2KJ6A 4MM3B 3UDXA 3ZDTA 3PT2B 4PZ7A 2RSNA 2L12A 4G0NB 2N78A 2CH4A 5LHY1 1HZBA 3C1EA 3RZDH 1GUWA 2KLGA 1KNAA 1GNUA 4DXAB 1I35A 1T5EA 2AMCB 3Q8DA 2F0QA 1PTOF 5JEAJ 1VQJA 3VR5A 2A68C 2JEBI 4OIJA 3S1RH 2JZZA 4L63B 1U4AA 1E9MA 4YXDB 5DM63 1G8ZD 4IO9A 1WR1A 3SFEB 3L4PA 4KY6A 4W9GA 3VFKA 4IG7B 1OFFA 4X6AH 3W1BA 4DK1A 4HIDA 2ZJRA 2UU9L 1TKGA 1SSNA 4A8XC 1KXLA 2YEPF 4RA8A 1L1OA 1QOHA 4CKEA 5EKKA 3VYSA 4Y7NH 2W3RA 1S5ED 2MO1A 3HOYG 1E10A 1PMRA 2K04A 4ALPA 3G7LA 2NVYB 3X0WA 3FKIH 2K50A 2DZKA 2M56B 5K36G 4M0WA 1T0RC 2MBBB 3TEHB 4ULLA 4A3JB 1PHJA 3KW5B 2EZVA 4FADA 1LTGD 1NDDA 1I3QH 3FILB 1SJED 4QIWB 4TRDA 5JZEB 3TIXA 1STAA 1FNWA 3CCMA 2I1JA 1V6EA 1A3UA 3MXPA 1RODA 5BMGA 2XK5A 5JJKA 1SAPA 2K32A 2QCPX 4YT0B 5CV4A 1CQVA 4XIGS 4C3HH 4DUZL 1E8YA 1GG3A 2X69A 2GBNA 2HDEA 2NBWB 2JE6I 3RI7C 4M02A 3TBIB 1LUZA 3PLUA 4ABNA 3JSVA 1P7EA 1N33L 5FLXE 5M5YH 3PO2H 3MHSD 2LY7A 3W1SA 3FHWA 5IT9c 5C4XB 3L08A 4KSLC 2JF5A 4ZOHC 4OO1I 3MEHA 2Z6BA 2NVQB 2NVUI 4O42A 2C7MB 2DYMA 2HIXA 4C3JH 4KTAA 3PHWB 1C4QA 3TCAA 4D2KA 4Q0FA 3GTJH 1EQRA 2FINB 2FIFA 1FFUA 2NPTB 3NVZA 1RTOA 1FCCC 1ZKHA 2VUMH 1PTOB 3EGRA 2LD9A 3KDFB 3T1YL 2K0PA 2ASBA 3ND9A 4ZRZA 1HRJA 2DZMA 2GMIC 4A4IA 3B08A 2Z59B 1GJXA 4DAMA 2BDNA 3H0GH 5ISRA 1N5XA 3VR3A 2K4KA 2XN9C 2HUGA 2GI9A 2MW5A 4P6VF 2WXIA 3ZNGC 2JQOA 4CHTB 5JJLA 3E9SA 2IYDB 3K5LA 4A75A 2YEPB 3R66C 3K5OA 3DBLI 5DCNA 2Y3AA 3NPPA 1N61A 1VQ6A 2LXKA 2LASA 3NP8A 2JA7G 4Z9CB 5GAGC 2BBCA 1E3PA 1EU4A 1K83H 1HTPA 2X8XX 1LV9A 2W54A 3V61A 3M95A 2BA1A 3CQZH 1NBWA 2FMMA 4LFCQ 3BIID 1SB3C 2JEAI 2A69C 4AQYL 1A62A 4ME3A 2JSVX 1BCPF 3NWSA 5C0XI 4HXDA 4F7XA 3H15A 4YSYB 4R4CA 4BY1B 3SHLA 3HOXG 3CPWA 3U7DA 3EQLC 4X3TA 2UXDQ 1L5PA 3DXJC 3I4NB 2GBRA 3HOVG 2L9HA 4IJLA 1I4RA 3HOUB 1HE8A 1NI2A 4M00A 2PMVA 4G3XB 3NUHB 4W9IA 3K5MA 4MACA 3K8AA 2JRHA 3HKZB 3D4RA 1Q86C 4GMVA 4DV5L 4NJ7A 1B9MA 2C5CA 4FYDA 1MVKA 2LHEA 1TWHH 1XJVA 4WJPA 1EIGA 3VXWA 4GLVB 1YX5B 1JCKB 5TSSA 4C1NI 2RHQB 3NTHA 4K5WA 4LF4Q 1QNUA 1A70A 3VH4B 5BMHA 1STHA 2EYLA 1UBIA 5IP7G 3DMUA 1WRDB 2EY6A 2WXMA 1JB7A 2XEWA 3K9PB 4NZLB 3BVZA 2MA9B 5LLIA 1KAWA 3CP0A 2L83A 2N9EB 2N9KA 4YWKA 2D62A 1KABA 4POGA 1IYFA 3CD6A 3BZKA 2MX2A 1EQTA 3CXCA 1JJCB 3ZRFA 2KMCA 2KTRA 4K81A 5GAEC 3TMEA 1RF2D 4KIKA 4ANXA 3K7AB 4B3SQ 3NK9A 1X9NA 3WAMA 4YTMB 2WWZA 1IHZA 2BPSA 2OWOA 3H6NA 1PUTA 2JRIB 3GB1A 3JW0X 2SAKA 4GSWA 3Q8EA 2HCCA 1LTRD 2BDOA 4IM0A 5IKCM 4AS1A 1XMOQ 1E0BA 4S3SA 4NXMQ 2N55A 1E7ZA 4LWCA 3EECA 4A3KB 2EKIA 2ENBA 2KXJA 2G9DA 1Q1OA 1E22A 1YVCA 4KSKC 4HJAA 4JYAL 3BZDB 5LMUQ 3EUB2 1RKNA 3HOYH 2WB1G 1RIPA 2L3ZA 1B3AA 4YTNB 4ANVA 3KUDB 3KLSX 4QIWE 3B0AA 3BYTB 4PMCA 5KGUA 2KACA 2GRIA 1C48A 1C1YB 2C9OA 5K36H 3WANA 2MUYA 2PW7A 2Z6KC 1VQ4A 4LNQA 1FMAD 1X32A 2KO3A 5FLMH 4A76A 2L52A 2Y5BB 3A54A 3EBEA 1FXIA 4TSSA 1ENCA 3WWVA 5KYLA 2Y5CA 5E3FA 1H9SB 3S16B 2MBQA 4IPGA 3PRPB 4IUTA 1I94Q 3Q3FA 4R4OA 3VH3B 3DHGC 2UYZB 5IOIA 1B2TA 1DOIA 4ICUA 3PLVA 4TV3A 3ZJVA 2KVZA 3U9OA 2BQQA 4DF7A 3PMFA 4AQ7A 2J4XA 4HMJA 2H4OA 2XTIA 2J42A 3WOEA 1VQ8A 2KCTA 4LF5Q 2VZKB 3T16A 1MD2D 3MXNA 4DV7L 1LQBA 1P98A 1ZDVA 1S40A 4DR2L 4HTHA 2WU2B 3E3XA 3RNBC 3MWYW 4US9A 3ZO5B 1B9NA 2ZTEA 3PIPA 4JE3B 4DK5A 2KJHB 3X3NA 3QWZB 3RZDB 1X55A 4NAWB 4GOPB 2K6AA 2KQ7A 1VD2A 2HD5B 3S1RB 2NTTA 5I6WA 2WDTB 4J6IA 4EE2A 3ULJA 4MSMB 1U4RA 3TSSA 1JWSD 1OXUA 3IFWB 4KD3A 2RR9A 1WD1A 4AH6A 1R4QB 1RCVD 1KAAA 4KLKA 1FM0D 2LGYA 4FJZA 4B3RQ 3N1ZC 2KC1A 1Y69U 2E5LL 4DQOC 4HKQA 3QJZA 4IFDJ 4IC7B 3D6CA 4DUYQ 1E8ZA 4C2MH 3J81j 2G4DB 2C60A 3MTNB 4WORA 5HFYA 1GUAB 1UH6A 2JA7H 1SF0A 1WGYA 3DWAA 3VUXA 2D0PA 2O5IC 4Y7NB 3NS8A 4R3DA 2SOBA 4IN3A 3QC8B 3I7FA 2A19A 2G5DA 3H91A 3UI2A 1ET6A 3R2TA 2UXDL 1J6QA 4MIUA 2LJ5A 4XTCS 4W9EA 4B0MA 5DPWA 1TR5A 3FKIB 3F2DA 3A9KB 1OO9B 1UUPA 2OT2A 3PUZA 4HJ7A 1LM0A 3QHTA 1EUJA 2O2LD 4IWPA 1K8MA 3HOXH 4DR5Q 3HKZE 3T3OA 3IVFA 1I3QB 3HOVH 2BWFA 1II3A 1YX6B 1CQFA 4WJ3M 1E7VA 1P1AA 2QGQA 1SE2A 4ASWC 1T0SC 1WJUA 4LNFA 4BKSA 4C3HB 3SK8A 4CJ0B 3CCEA 4X65Q 1Q8KA 1TKWB 4IJHA 1EZ8A 2EYPA 2F0IA 5FO7B 4LF4L 2BE5D 4OWWB 1A6XA 4R4QA 4OVUA 5GADC 1Q1EA 2BGFA 4W9FA 1WX7A 4W9HA 5BMIA 2D5DA 3AULA 3RFZB 3AFQA 3ZXRA 2N9LA 4YCUA 2HE7A 2RD0A 1WI5A 5IP7H 3C46A 4C3JB 4M01A 4L1BA 1KOTA 3PCOB 4LFBL 1SNMA 4QGUA 2Q2IA 2JZ3B 2NZ1D 5IE8A 3GTJB 4HIKA 4R1JA 3BZCA 1DGJA 3GQBA 3MZ5A 4B3SL 3PPAA 2VUMB 2BCOA 2GVBA 1J19A 1WCMG 2BYVE 3LX0A 4OHJA 2MPMA 2WHIA 1AWDA 2E8GA 3P4QB 4PS3A 1JORA 2MHJA 3SD5A 4EFOA 4US8A 2BB5A 3MVVA 2KA7A 1TS5A 3M4PA 1K0SA 2Z4HA 3GTOH 3ZNHB 1I4QA 3M9BA 1WF9A 1MKHA 2QF7A 3H0GB 1XMOL 2Z0SA 2UUAQ 5IYBG 2B2YA 4NXML 2BWES 1WZ3A 4ZYSA 1JOKA 3EJIA 2IO2B 2W55A 2XBBC 1WJNA 3MJWA 1JB3A 1BVSA 5AJ3Q 1SNOA 1TKEA 4RF1A 1QJOA 4WJNA 1QVGA 1F52A 1K83B 1IKMA 3ZXVA 2JA9A 3TQYA 3KLWA 3NBHB 1KH0A 3CQZB 2F52A 3MP9A 3K5NA 1K8RB 4OXPA 4RF0A 5KIXA 2OOBB 4FDBA 1PRTF 3Q14C 2ZPNA 2D3CA 3SDZA 1PGXA 1VF7A 3Q3MC 4ZKCB 1XTCD 2RHSB 1YNXA 1I94L 2K39A 4KGRA 1AEXA 3U4VA 1NR2A 2AQ3B 5G5GA 1RLFA 5EE1A 4QUCA 3H09A 4DV6Q 3AU7A 5CHWA 3KLRA 1B50A 3K59A 4GN5A 3PSEB 1BXTA 4GDLA 1SBBB 1V5OA 5E6PA 1DOYA 2XRSD 4EZKA 5C0XJ 5E6NA 3AE2B 4LF5L 2DENB 4B3ML 1F9RA 5FLXc 1TWHB 1J7AA 1FPYA 1KFYB 4ZUIA 1WZ0A 4ITKA 3RULA 2DJGC 3TL5A 1XX8A 1MBYA 4IUVA 3CCRA 1GUTA 3M4QA 5EE9A 4HSPA 3ERQA 1GHKA 1HFNA 2B2UC 2Q2UA 1VQBA 2EJFC 2IT1A 2WAQB 1OQQA 2Q5WD 2ZVNA 4MEMA 1P0RA 2FAZA 1GPXA 2RDGA 4HJ8A 1KDBA 2L05A 3PHXB 3RN9C 2J0TD 4PZ8A 2XK5B 3QCAA 2B2VA 1T5XD 1IBLL 4BA1I 1HFGA 3KFUA 2O6VA 3I4NG 3JSVB 1P3QU 2UWQA 2PMZB 4OX9Q 4B3RL 2BKRB 3SEBA 4FA6A 4ARCA 1CHPD 3H8HA 1E0ZA 5IP9G 1WJJA 1Q1BA 3A8IE 4KGTA 3U4EG 4DUYL 4WJOA 2G1EA 4CBVA 1KL9A 2RA4A 2QC8A 4IDIA 2ZZPB 2JX5A 4DR7Q 1H9KA 5BR8Q 3A4SC 1YJNA 1W3SA 1X65A 2F0DA 5BYRA 4XXEA 1N32Q 4JI7L 1D8LA 4ZRKA 4R8IA 4DV2Q 2KBNA 5CV7A 4DAYA 1ZGUB 1PRTB 3Q3NC 3HOYB 2NUCA 4DR5L 1MHHE 1SYBA 4LDTB 5T1GA 5HGTA 2M8SA 1S1QB 4GIVA 4YTPB 2CJNA 3ZVVA 4B9XA 2Z4IA 1YNND 5HKHA 1HNZQ 1KDCA 1O7ZA 4FO2A 4DK0A 2GBKA 5M5XH 4W9LA 1HR0W 5ELFA 3ND8A 2JY6A 3A7LA 1PYSB 4X65L 3VAWA 5DEHA 1F2RI 2NMQA 4C00A 3SE0A 5CC4A 3ECIA 5GXGB 3AXCA 4PYUA 4IKGA 1WTRA 3IL8A 4G57A 1ZKOA 2KQSA 1Q7YC 2CU3A 1MPEA 2VZKD 2ZXRA 1VQEA 1KHIA 1ZXIA 2J7QB 1F9SA 2V4DA 3H6MA 4P73A 3QQ8B 1T6BX 2WXHA 1SSOA 2L8JA 1KNEA 2V4IB 4GGQA 2DX5B 3IG3A 3I4OA 1WXQA 2JQRB 3P1MA 1LGRA 1S5DD 1ENFA 2IO3B 2JJQA 2PZTA 3APDA 3NENA 1MHWC 2OHFA 4PS7A 1WGDA 4LAAA 3QO2A 2AKWB 3EFXD 1LT5D 2UUAL 3ZJUA 4RGTA 2G3QB 2XWBB 2LUEA 1FGUA 4TVAB 2JYTA 5J3BA 2YTVA 2A6EC 5C3XA 5IP4D 3U2SC 5AJ3L 5DNFA 4QMGA 5IYBH 4QCLA 1VRAB 2N7JA 4J6HA 3W1YA 1U4LA 3MFGA 2NYZD 4C2MB 1E7UA 1EQQA 1ILPA 1LLRD 1WRIA 1VS0A 2ICEC 5C4XH 2RSOA 4KIKB 4WJQA 4L8JA 3A9JA 4N6EB 5D3DA 5C44B 4LJZC 3S2DH 4A3GG 2K5HA 4CJ1B 1VQOA 2Y5PA 2K05A 4X57B 2E2JB 2BYTA 5D3IB 4PNYA 1FXTB 2DHZA 3AEDB 3PUVA 4O2DA 5CBAE 4JG2A 2WX1A 4HAEA 3EC8A 4KHPQ 3HHMA 2K01A 2VY3A 3HOXB 2IGHA 2K1FA 2M1MA 3Q69A 3UDIA 3KUPA 4QY7A 3HOVB 4ZKBB 1UZXB 4FXGC 1A63A 2OTJA 1VJKA 3BU2A 2KENA 3WIMA 3AFPA 3IT6B 5JPMC 2QDFA 3PUXA 5F2DA 3H7PA 3VRAB 1IW7D 2LWPA 3T56B 2W9NA 5IGEA 3R2IA 2AQ2B 1QZHA 1SXTA 1L6UA 4ZQ3A 3RUIB 1HTQA 2HDMA 2WAQE 2ZJDA 1BR9A 3DWGC 1JJ2A 4ANWA 2J0KA 1F2YA 4H02A 4K5VA 3I70A 2KN5A 4MJSA 2PTLA 2D5GA 1DM0B 1KRSA 3SU8X 4PK1A 1XPUA 1SGHA 1A8VA 3PS6A 3PIO3 5AZGA 1CJEA 3SXHA 4HEDA 4HRSA 3W3AA 4LF7Q 1HUMA 4B9WA 3LNNA 2EMSA 4OX9L 1ZPSA 5LMNQ 3U52E 1CK1A 5COYA 3QAQA 1MGSA 1ROEA 3P4SB 3NEMA 2GLSA 3I4NH 4LK0M 1QQRA 5JXVA 2WS3B 2ZJPA 4A3DB 2L7RA 1YNJD 3MXNB 3L10B 2EJGC 1TS4A 2KHJA 5IP9H 2N1VA 1YI2A 5EPKA 3BY4B 3GTOB 2V3NA 5BR8L 1AZPA 2BOSA 3QARA 5E6JA 1PGBA 3UI3A 1EY8A 4EZJA 2WKDA 1N32L 3CSTA 2CFMA 4RCOA 2M4NA 4DV2L 2WNMA 3AEEB 1JQYD 2WIIB 1NVID 1EEID 5AEKB 3D8GA 4CHKA 2D10A 2UXCL 4KKJA 1EY6A 3M85A 2XVSA 4A6QA 4KV2A 1EWYC 2KHSA 3U8ZA 2A73B 2BS4B 3Q6BA 1IYVA 4WQMA 2FE8A 1HNZL 2EYMA 2WB1B 3KF6A 4JQWC 4PS8A 3X23A 4FBJB 2QEXA 5E6OA 1O7YA 1A15A 3PO3G 3C1FA 1ESRA 4FXDA 3NJTA 1KRTA 4KZCA 4DXGA 3N3KB 5J39A 4DBGA 5KRUA 3UQBA 2A6HD 2C35B 1FYCA 3OHXC 4K6LA 4URKA 1GC7A 2ZNVB 4N59A 2F3WA 1CZPA 1SE9A 1WTVA 1YN5A 2E3TA 4P7IA 3OPOA 1OTCA 2SEBD 4BWGB 1I5FA 1STBA 1YIJA 3MHBA 4KMUC 4C56C 4C1NK 4CDEC 3K0XA 2GOWA 1ZYRC 2IO1B 2CQOA 4JI4Q 1IPGA 4ACFA 4BBNF 1OXXK 1VF5C 4TQUS 1G2SA 3RNGC 2Y0SB 1KC8C 2VH1A 1XNRQ 3A55A 1X3QA 1WM3A 4LF6Q 2I5LX 2K3UA 4L5RC 4XQQA 2N7DA 5JAVA 3GO5A 2AWNA 1YJJA 4WAFA 1KTKA 1DOKA 1H9JA 4ZRJA 2JSOA 3M62B 4X66Q 1MG8A 3PSIA 4J15A 1SMYC 4YCWA 4K5XA 4YY3Q 4JCVE 3OAWA 2MJEA 2AL3A 2KVRA 1K51A 1WMHA 3E56A 2WDVB 2VRRB 4EOYA 2MBEA 4RCNA 4X3UA 3G6JB 3NHEB 1F9PA 2R3ZA 4WH4A 4WJWA 1CM9A 2DUDA 1HNWQ 5CHFA 3S17B 1CKNB 3CRLC 1FXAA 1WX8A 2PIAA 2MO0A 4WIPA 2KWCA 2RQXA 3KF8A 5HG2A 1SMXA 3ONAB 1WTPA 1ASYA 3OMCA 3GTMB 4BA2I 3STBC 1XPOA 3P63A 4A9AA 5C5MA 1UEAB 1EIHA 1GC6A 2R6GA 4UY8C 1YJ9A 3ZJYC 3QOJA 1E1TA 2F4IA 1CKOA 4RHRA 1JC7A 5KNDA 3T1HQ 4A3GH 4KHPL 1TT5B 1TZ1A 2MQJA 2O2VB 1M4VA 3V6EB 5HURA 4LJPB 4KY5A 1HUNA 1SLJA 4KDLB 4EEWA 1DYQA 2PQEA 5M5XB 2I5MX 3DVNU 2XWJB 3A5ZB 3T51B 3AQQA 2K5DA 3RNEC 1WFYA 3L0OA 4MHEA 3VYTA 2INDC 1V1OA 1UE6A 3CCJA 3EHVA 3BK1A 4PG3A 1SYFA 4BOSC 3S1NH 1V8QA 3GTGH 3KBGA 2QIEB 1I50H 3VHTC 3RLNA 2JYOA 1C9OA 4H2AA 3KQ4A 2LJIA 4LF7L 1VZ8A 1VZ6A 2HHHQ 1V9JA 4X64Q 5JOBA 3AE1B 3I55A 3LWUA 1PH2A 2TMPA 1CA5A 5LMNL 4GDLB 2IHEA 4KHZA 3UDFA 1CKMA 3ZQ4A 4E71A 1K8OA 1AYFA 3TS2A 3K7UC 1WD0A 2EY2A 3HP3A 1PTOC 1WCMB 2ZTCA 4GN3B 2EKEC 1LXDA 3FC4A 2B29A 1YQ3B 1Q90A 1SDFA 1A3VA 1PH5A 5DPRA 1FD6A 5CV9A 2F0KA 4K7UA 1WY8A 1QUQB 1X1MA 3P1HA 5I6YA 3ULPA 1N36L 4BXXG 1WXSA 1G6JA 4JWSC 1KLGD 2PNHA 5AZFA 2JA5G 4NQKE 4RWSC 2ZJQA 4HPMB 4DHJD 1OXVA 3EVQA 2VXWA 1B70B 1VQAA 1X56A 1PH8A 1AN8A 1ZXTA 2Z0EB 3AE4B 2WB1E 2ES2A 5FR3A 1EY7A 1WI0A 4JI3Q 3K81C 2O6VB 1V86A 2QMTA 1IL2A 1JMLA 1RWSA 5GAHC 1RJTA 4NJ6A 2O5JC 4K14A 3R8BA 2UUCQ 1NMGA 3S2DB 2BS3B 2BVCA 3LB8C 5CX3A 4YWGG 1WTWA 4AJYB 1Q8IA 4JI1Q 2MP2A 3PO3H 5JVG3 3E5SA 3JAME 4JBMA 2FUG1 2OQKA 2KDEB 2AX5A 3GE8C 1H9RA 4GDKB 4IUQA 3Q8BA 3J9CA 5JEAG 1YN4A 4YIJA 1EM7A 2QEJC 1I4HA 4JI4L 3S2HH 1N5WA 4CDDC 2Y0SE 4POFA 2LSSA 5I9OA 2VQEQ 3CCVA 4LF6L 4YCVA 5EKLA 3AB9A 2NVTH 1TBEA 3I63C 1ILQA 2MGSA 1R4NI 4DU9A 2DZJA 3AEVA 1RM6C 3PUYA 1HJPA 5C44G 1QWYA 4X66L 1E5WA 5E1FA 4HK2A 4XGAB 1V5TA 3TEYA 3CF6E 3CMAA 3WAOA 2E6XA 3H3VC 1E2WA 2N4FA 1E2ZA 1DONA 4CGYB 1QOBA 4U673 3KVFB 4MELA 1HNWL 3KYHC 2K6DB 4OONA 2LXJA 1Y8PB 1S4ZA 1GHJA 4TQ0A 2B39A 3DQVA 3CCLA 4FN2A 5EDSA 3I73A 1LTAD 1JW9D 2KCNA 3D31A 1SIFA 3DBLB 5CMDA 3ZUNA 2SDFA 3OTOL 2M0AA 3OJ4B 4BKGA 1FO4A 2KNBA 1YQBA 2J53A 2YU9H 2ZT9C 3V96A 4AWJA 3PV1A 3J7A5 1V97A 3AECB 1J9OA 1PYBA 2BH2A 5LL6S 2L5TA 1CT1D 1ENAA 4GLAC 1VQMA 1VR9A 1CUKA 3V62A 5IGGA 2KQ3A 3IAS1 3CW2C 1Y8RC 4ME5A 1BCPC 3KYDD 4RGNA 1YIWA 2HJ8A 1F9QA 4K7SA 1HEZE 3UIOB 1B7YB 2KJXA 1HZ9A 2N9XA 3T9LA 4FHKA 1R4MI 2K5QA 4X3SA 1U4PA 3M4YA 5C4JH 4A3DG 2CS4A 3S15H 2LVQA 2QKIC 1X6OA 2R61A 1L0VB 5A2QL 4HVBA 1K9MC 3VR8B 1PZKD 4I6NB 5ELEA 4DR4Q 1TKYA 4B9KA 2ASQA 4AIMA 2HHHL 4X64L 1YHQA 2L15A 2ZEQA 3DBHI 4UP7A 2V1YA 2MP1A 4NQLB 1CI3M 5LXIB 4HLEA 2N3SA 3NY5A 5M9OA 4XX5A 4NXNQ 3EN2A 2HQEA 2LVPA 4QAYA 2YTYA 1ASZA 3N1XC 4DV3Q 4BKSD 1WVLA 4W9CA 3H7PB 3A8JE 1Q5WB 4V190 1PFDA 3PZ7A 2WINB 5DPSA 5MPOA 1V1PA 2H88B 2CW0C 1CMXB 1D3ZA 2L76A 5M3MG 4I7AA 3F2CA 4MJSB 2OEOA 1XPRA 1XF5L 4JWUC 1YOVB 3JVZX 4Q2JA 1STEA 4HSVA 2L32A 4RG1A 4DNIA 3FDTA 4N8X1 5C3EG 1IBXA 4ARIA 3TP7A 4BXXH 1D4BA 3WDNA 3QK0A 2KLCA 3VVWB 3OOCA 1I4GA 4FNFA 3KUCB 3RT3B 2A1AA 2JA5H 4JI3L 1WFQA 2I07B 2H89B 3BJUA 3LXFA 3J80E 5HI1A 4JI8Q 3AU5A 4L6TB 3MAQA 3R3MA 2X6GA 3EROA 2UUCL 1E2VA 4FHJA 2B8GA 3HIZA 2Y0SG 1WE6A 2IGDA 3ULLA 4CO7A 4OWTB 3GTPH 4N9PA 1IBKQ 1A5RA 1HZCA 4OEMB 1IKLA 1BF4A 4A3GB 4HCEA 5KHQA 2B2WC 1SIJA 3U30A 2MBOA 4A93G 2EELA 3Q24A 3P20A 1QT9A 2CR5A 3IT4B 3Q2AC 3DDCB 4FF2A 1EEFD 1RD9D 2IDYA 2NBVB 1J5EQ 3KUZA 3JC66 4K7WA 5C23A 2MEKA 4IW0A 1VQKA 4H44C 2K22A 2PZUA 5ELNA 1GUGA 3MTSA 2KN4A 4IM2A 4AP4C 1UAPA 2PE9A 1DXMA 1VQ7A 3DVGY 3MC9A 1NUCA 2OEDA 4HDQA 3HOZG 3IKJA 1WGGA 4P2CB 3RN2A 1A2TA 1BQQT 2PYKA 2PZWA 1EOTA 3GTGB 3S1NB 1MJDA 3HRDD 1KLUD 3OJ3A 1I50B 1W2BA 3DOWA 1L2FA 2BYEA 1PH1A 4IOAA 2CWAA 4LFCL 1FFVA 3WCQA 1GD7A 2VL6A 3AE6B 5C44H 4JK1C 1Z6HA 1PH9A 1NYRA 2OXPA 1Q10A 1VQPA 3MFYA 2WFWA 2ZCCA 1O7LA 3PUWA 2E2JH 2K9XA 5KYIA 1WM2A 2JUOA 3MXUA 5EPLA 1L0WA 1FIQA 1T3QA 3DEOA 2QA4A 2INNE 3FPPA 2ZVOA 2ACZB 1PDQA 1YNJC 3AE7B 3M3YH 4K1RB 1DOMA 5EQ0A 3OLMD 4GNXB 2LHDA 1LACA 3R7RA 3B6YA 1LTTD 4B08A 2O6VD 4DV4Q 4B0EA 4E6IA 1MJCA 4ZDVA 1ZUD2 3S1MH 2I0QA 4MN3A 1C8CA 1GXDC 3TZDA 2INCC 3DVNV 5EGTA 1MIUA 4G4KA 1K0RA 4BBSG 2PLPA 4Q5VA 3R7QA 3W9CB 5FK9C 1FRRA 1SYGA 2LMCA 2XGTA 4R9WA 1WMHB 3UQAA 4HN7A 2H5XA 3NVVA 4XWTA 1TWAH 5ELCA 1V81A 3QB3A 3OG5A 2DYBA 3NE5B 4IPDA 1U4MA 2XNAC 3OIPA 3U7ZA 3PO3B 5BN5A 1PZJD 5DPTA 5K5PA 3G4SA 1NCVA 3HGBA 2NBUA 2GN5A 4XQJA 3ML9A 5IGBA 3RCZA 4DR4L 4WWNA 1Y1VG 2WXJA 4P16A 4F8MA 4YWMA 4A3DH 2C9WB 1XCQL 4M8AA 1PGAA 2FJ2A 3C0RB 1R7SA 5IAAC 2KEDA 4ZRPA 3S2HB 3D32A 3UF8A 1STNA 2IWHA 1RDPD 4IUUA 2WYQA 5IGDA 4NXNL 1WXAA 1SJHD 2UUBQ 5JJIA 2OJWA 5LMUL 1UGJA 4DV3L 5LXHA 1N8RC 1JWBD 2NVTB 3PIOA 2PVOD 3HM6X 2KX0A 3PGZA 3IAYA 4JLCA 1L7YA 1L0XB 1PFMA 2ICIA 3CCUA 3AEBB 3B9JA 3I4LA 4RHSA 3KH0A 3GE3C 3OMGA 3UIPB 4AJWA 3TJPA 3M7GA 1WYGA 2R93G 4P71A 1IUEA 3A0JA 4FJVB 3UINB 1YHAA 3K0YA 3HEJA 2K1BA 5M3MH 4HIOA 5T1IA 4L5SA 3GV3A 2KWDA 5ELDA 1K3BC 3L54A 4IURA 1QF6A 1TS3A 3RD4A 4RMAA 1WIAA 2OQ0A 3NSWA 5C3EH 1L1OB 1H4RA 2AEHA 3H7SA 3NVYA 2KCMA 4JI8L 3NTIA 2EMTA 4JOIC 4CJ2C 4KKSA 2NCNA 3GV6A 3Q0AA 1M90C 1JRPA 1EY4A 1IBKL 2WX0A 1WGHA 2YU9B 4WRDA 4KKTA 4M0WB 1EOVA 4BY7B 4BKTA 5J1ZA 5IIFA 4DV0Q 1YN3A 1EYDA 2Z8LA 5G55A 4E3CA 3HG9A 4K8JA 3I91A 2IBIB 2LRUA 1TIID 4LCDE 3DM3A 1PRTC 5C1ZA 2QDLA 1SROA 3I4MG 1XLNA 5EKIA 1EY9A 4CDCC 2D3BA 3PF5A 2LXAA 4S0RA 5EBCA 1BO0A 3NWTA 3C2PA 1KLVA 1LYLA 2IY1B 1I42A 1XEEA 5C4JB 1XTDA 3S15B 1VLBA 2QHOA 4HJ5A 1AZQA 2WXNA 1ESFA 4UDUC 1GUOA 3BS1A 2UXBQ 3DWMA 1Y1WG 1W6JA 3N52A 4DK6C 2F3IA 3RZOH 3HOZH 3W1GA 3S17H 1H95A 4JV5Q 1Z2MA 2E75C 3K80C 1SYEA 2WXOA 2DN8A 3M7NA 4HCPB 1K8GA 1RFAA 1TJEA 3FMCA 5JJZA 1OEYJ 1SE8A 2C7NB 3F2BA 3GTMH 3A5UA 5A2QE 2DYOA 3HFZB 1RFKA 2LI5A 4JPSA 1UE5A 1V8CA 2ZPYA 3U9SA 3AEAB 3BVMA 3QR8A 2L0CA 4IOCA 2D3AA 2DWQA 3PO0A 1QVFA 5BYSA 3NBIA 4MTKA 3FKYA 5EPJA 2ZM6Q 4DKAC 4KHVA 2F0WA 1HNXQ 3Q22A 2E2IH 1C4CA 2NPTA 3VR2A 2RDBC 3KDFA 4YHHQ 1G91A 1E7PB 4MH0E 1MHXA 2EJMA 1B8AA 1FJGQ 4NPSA 2KX3A 3NVWA 2E76C 2JA5B 3K57A 2KMMA 1DOXA 3Q3JA 3CCQA 1VQ9A 1K28A 4KZ0A 4IPCA 3MEFA 2V4LA 4AYBG 3W5VB 1BNZA 3S1QH 1A3TA 1RAXA 1TGZB 3PIP3 2M2LA 4BBSH 4RKLA 1ISNA 2RMMA 4RMFA 3GTPB 2EIFA 3GDEA 3CPFA 3QWNA 2RCNA 1XCTL 2BT6A 2FNJB 2MRPA 1OTRB 2WP8J 1Z9FA 1NYQA 3A4RA 5KNCA 2NN6I 1D7QA 2WXKA 3HVDA 2KQ4X 1B9RA 5NUCA 1LT3D 3A33B 4DNRB 1WCMH 1ZEQX 2JPHA 1AARA 1JOQA 3E9HA 1WTHA 2X38A 1Y1VH 4OZBA 2A4ZA 4GKKQ 1GM5A 3JAMi 2JA8G 4QB4A 2FIDA 1HTOA 3SGIA 1TT2A 1G51A 3TS0A 2F0GA 1U0LA 5LMNW 2Q2TA 2WXLA 3E9IA 1JROA 3RNFC 3BDLA 1DOLA 4DHJB 4JBWA 3T3NA 3F1ZA 3VUYA 4XE0A 5L95C 3CC4A 3WA0A 4WAAA 2KTRB 2PQAA 3JAML 1HQRD 2K75A 1UEBA 2IY0B 3DHQA 3HK0A 4JI5Q 4MGZE 3D6WA 1C0AA 2LFIA 1CTMA 2YVCA 1EF5A 5CHVC 1XXGA 2LGXA 3BINA 5KEEA 2R93H 1XO3A 3EIVA 2W3SA 4DV6L 4IZ8A 4RH6A 4FXKC 1RL2A 1HZAA 3Q8FA 1NMFA 4EQPA 3BWUD 1W6KA 1EL0A 3IHPC 4P72A 1MSHA 5FO9B 4P1CC 4DR1Q 1UF0A 2KHWB 4R4IA 1H8CA 3NQTA 1VZ7A 2K14A 4ILWA 2EYHA 4HEA1 4HPLB 4LNKA 2FCMA 2MJ3A 3J80c 4WJ4A 2AYOB 3M3YB 3SK6A 2QSDA 1FCLA 2WV6D 3TP8A 4JI0Q 1I4XA 4RGOS 3EA6A 1WXMA 3FVQA 4HCSA 1V80A 4CYEA 2JYEA 4DNTB 4DA2A 5M3FG 3S1MB 3IFDA 5AFWA 3C19A 2BF8B 2RDFA 1B53A 1JWAD 3CWIA 4G7HC 1STGA 2F0VA 3T53B 2JU6X 1IBXB 3DHIC 1PA6A 1LM8B 2FCNA 2FFKB 2SNMA 1TWAB 3MXGA 4RFBA 4JX1C 3I4MH 4Y52H 1G2TA 2WGSA 3P7JA 1JICA 4FF4A 3J7AV 2JXMB 3BK2A 2KHIA 5CTRC 3VA5A 1Y56A 1AW7A 3ENEA 2F0LA 4OZCA 3RZFA 2KAJA 2RPVA 1X3FA 4IM3A 4X3KA 4RNAA 3VTUA 1D6EC 3DWPA 4DR7L 3CMEA 3HZXA 2GVAA 2EDGA 2VZAA 1Y1WH 2F0OA 5EAYA 2OF1A 3AM9A 3U50C 3NQIA 3HS0C 3ZRCA 4PMBA 4QJFA 1L6VA 2W82A 2E2HB 3AMZA 1IXRA 4HR7B 4HJ9A 3S24A 4LNNA 4JGHB 2L4NA 1SEBD 2KDMA 2ZW1A 4W9JA 1E1OA 3BDCA 3UE1A 4CDFC 2RVLA 5JHBA 2VS1A 2ZM6L 4RGMA 3A74A 4DR3Q 3AU4A 2D07B 2KWVB 5C3JB 3S9WA 1VQNA 1XLQA 2K8CA 4YHHL 1L2NA 5M3MB 3I5JC 1TWFH 3T13A 3ZLZA 2YTXA 3P75A 2NZHA 2Z6KA 4LUVA 1YNTE 4MDKE 5C3EB 4DDGD 4JL9A 3TEZA 1FR3A 2RDHA 3PO2G 2JP1A 1KQSA 1LT6D 4FULA 2PW9A 2MFIA 5EE3A 1EU3A 1G6PA 4LNOA 2RPQA 4FF3A 3SK4A 3FEWX 2M0XA 5C3WA 1JALA 2XIWA 1TXYA 3LGJA 1JRUA 1J8CA 1N33Q 3ZYYX 1N34Q 1RYJA 3CHBD 2B3GA 3H3VH 2LGSA 3D3RA 2VW9A 3TEWA 4IUMB 4UAIA 2D9UA 2M17A 3J80i 3GP7A 4R8NA 5IOCA 4A3MG 3MA2B 2JXXA 1YBYA 4LFAQ 2KYWA 2N9PC 3GZNI 1NBFC 2D2CC 1EYAA 1S72A 1JOOA 1ML0D 1KIXA 4GN4B 4EX5A 3J7AF 4G50A 3GTQH 3ICEA 1WH3A 2AWOA 2N88A 4ZAIA 1KJTA 4A93B 4GU2A 2EY1A 4GKKL 3T1YQ 4WFN3 1BOSA 2PI2A 2EQSA 2M19A 2ATWA 3GTKH 3J80L 4KJOA 3J81L 2LUMA 2NR2A 5DM73 4CKCA 2JA6G 1XT9B 2LS01 2LMCB 4GKJQ 2JVCA 4FLHA 2JA8H 2IHFA 2KEEA 1BT0A 2R7ZG 1STYA 2CHZA 4GB9A 1QCBD 1WE7A 2ZW0A 3RZOB 5GMVA 2XRQD 3HOZB 3J7ZC 4H0LC 3HOWG 4A3LG 3W5OA 1UWVA 1GVPA 4JI5L 4BBNC 2DY7A 1TWCH 2HIVA 1SNQA 2DAFA 2K25A 4BY7G 4DV1Q 5BYQA 3KWVA 1O7IA 4XDCA 4X62Q 3RN5A 4U68A 1SNCA 3UE0A 2L1BA 5IODA 3HVZA 4IALA 2DJFC 5I9PA 3ETRA 2BA0A 3D4WA 4A3EG 2MSED 4B95A 5J22A 2NWGA 3Q6SA 4DR1L 1UD7A 4HMIA 4MGYE 3PRMB 1K3RA 2VQFQ 4L23A 5KNBA 4DWFA 1CSQA 2E2IB 2A74C 2EXDA 3M3JA 1D1IA 1K52A 2Z1CA 4G11A 4JI0L 2CVRA 4BBRG 4GS3A 3AMUA 2I38A 2FMCA 1UNSA 1V49A 1OXSC 1SE3A 3AEFB 1Y8OB 3TP6A 3AE3B 2E2DC 3NG0A 4AUQC 2KOLA 2NVXB 3APFA 2CH4W 1XLOA 4A3FG 1WTOA 5M5WB 4FF1A 3SHQA 5M3FH 3S1QB 2PJHA 4REZA 5HGQA 3R3OA 4BBSB 3GS2A 2BE5C 4GOCA 1PZID
chains in the Genus database with same CATH topology
4IFDI 1ICWA 4LK1C 3NBHA 1Q12A 2MJDA 1YJIA 2YYZA 3Q23A 4KGSA 1Y1VB 2WXQA 1VMPA 5FO8B 1JWMD 1HZ6A 3V3XA 1QOFA 5I2XA 2ZXPA 1V43A 3RUZA 3AB5A 1KRHA 2VNUD 4EQNA 1D5XC 1LTBD 3NTKA 1NR4A 2MHVA 1L4DB 4WURA 1PLFA 2VB2X 2F0SA 3TUOA 4KV6A 4GLSC 2K5PA 2R93B 3TZUA 1QOAA 2A5HA 3SR6A 5LL6X 1JE4A 1GB4A 1FGBD 2HDLA 1EY5A 4KKUA 3A8KE 1C79A 1KF6B 1SNPA 2IX0A 5HHDG 1DCZA 1ZP0B 4BS9A 3V05A 4OVZA 1XLPA 3PZ8A 2PO4A 2NN6G 2I2YA 4C80A 1FRDA 1MI2A 1G6ZA 4LMQD 4F87A 1LT4D 1P7FA 2B2UA 3BVGA 1CHQD 3NRZA 2A6ED 3I4MB 5D65A 1AP0A 2Q8RE 1Y1WB 5CGKA 2PVGC 1E6EB 4LLGM 3RPFC 4KD4A 2EVBA 4KN7C 1F2LA 3VQIA 2LEKA 3WOFA 1WGKA 4C3IB 4H13C 1S5CD 2BW2A 3FAHA 2HCIA 4PV1C 4IOIE 5EE0A 3BG3A 1TWFB 1QE6A 5D14A 4DGZA 1EWHA 1YNNC 3OW7A 4XQNA 2NBFA 4OL7A 3AV8A 3RLFA 1NI3A 4WWMA 4NW2A 3L7ZC 2IJ0A 4AYBB 5ELBA 5IGCA 4HROA 1LTSD 2JZPA 2PW5A 1DZ1A 1VCIA 2F0FA 3GTQB 3NS1A 1GB1A 3VYUA 1N63A 2MH7A 1D5ZC 5IT9L 3GTKB 4ZHPA 2F0JA 3NUCA 2B2TC 1YMHE 1EZ6A 2JA8B 2SNSA 4N58A 1RHPA 4XT1B 1BCPB 1TVXA 1TWCB 1Y8NB 3J81E 1F0ZA 2PKOA 4KI0A 2EYOA 2ZXOA 1J7CA 3FRPB 5CV8A 4MH8A 2CJOA 1ONLA 2B76B 4FP5D 2O4XA 1H9MA 3K6OA 3NHHA 3AH7A 3VA7A 1ZYRD 4EGVA 5G3LD 4CKBA 3HUIA 1I7HA 1RTNA 3L3OC 5JEAH 1LO5D 3E6ZX 2IW3A 2EYFA 2INPE 2RBMA 1GUSA 1PXUA 2EYJA 1IW7C 1BUIC 2GA4B 2IX1A 1F77A 3L9AX 2DNEA 3E0JA 1F2ZA 5M3FB 1SMYD 4HJGE 5H8YE 3N6RA 2NN6H 5EBDA 1TZOA 1LTID 1O80A 2F0NA 2M00A 4DN4M 4YSXB 5E4XA 2WDQB 1WTQA 1L0YB 2WKCA 3VYRA 3CIRB 1FD7D 4QF4A 1OXTA 1XWEA 1J8IA 1C78A 2GB1A 1BUVT 1PDXA 1F2MA 1D1KA 3VRBB 1SFOB 2L55A 3A56A 1I6HB 2K28A 2K7VA 2K03A 2F0TA 2J52A 3P4RB 5I4DA 5C4ZA 2F3VA 3KBXA 4L2YA 4XWWA 3CKIB 4DFAA 4XDDA 1GUNA 2Q8TA 2A68D 2CQAA 3SVMA 5C5LA 4EVOA 3LYYA 1SNDA 3R93A 1VMCA 3IFTA 1B4OA 4IQZA 2KECA 2K33A 2F03A 3C8YA 3W5UB 3T4AC 1ET9A 3RMHA 4TKOB 2A6HC 3PO2B 5M5YB 2JXTA 5I2YA 4K6DA 3KK7A 2BS2B 2AQ1B 4DAPA 1PTOD 1B1ZA 3AEGB 1K53A 4IFDG 1LABA 1EY0A 1CZGA 1ACCA 1CFMA 4A55A 4A3MB 3OIQA 2ON8A 5CV6A 1ZDXA 2XSCA 1CZWA 4M1UB 1L4ZB 4DAVA 2WLBA 4RKBA 2NB0A 2EY5A 2VB3X 2HTME 3W2DA 4F88A 2JA6B 4EQOA 1M8AA 2QILA 4C7YA 2EE1A 2R7ZB 2FHTA 4MT5A 1TWGB 1OQRA 2BB6A 3HOWB 1C4AA 5CYUA 5H92C 1S5BD 4KKIA 4USAA 3VR9B 1XYIA 2NTSA 4CQNA 3AE5B 4N9TA 3TN2A 1QOGA 3D4DA 4OW0A 3TEXA 1QLBB 5CR3A 4ID6A 1S5FD 2EXZA 5LNK1 4A3EB 4O1NA 3J7YW 1BBXC 1D2BA 4ZK9B 1HQMC 1WWTA 3FPUB 2L1AA 1PYWD 3AE8B 1Z7TA 3CU7A 4QUFA 4OO1G 1GOZA 4BBRB 3HRZC 2J7ZA 3FILA 1TY2A 2A69D 1N60A 3K58A 4A3FB 1PFNA 1IL8A 5T8IA 1HCZA 2DNCA 4J8QA 4OGQC 4I7ZC 2FBWB 4C3IG 1EQVA 4OIKA 2WU5B 2WACA 1FNVA 2PNRC 3DM1A 2K5WA 3I8ZA 1MSGA 4NKLA 1WTXA 4PQXA 3MC0B 1IGDA 2R92B 3OSOA 1F2RC 2KCCA 4HKZE 1JR0D 3QOLA 1I4PA 1WSPA 3KLSA 1ZE3D 1BCPD 1DD2A 3O13A 3N9YC 5IT9E 2DBYA 5C0XG 4K2KA 1C77A 5D7GA 3I3CA 4NJCA 2ID0A 3GTLB 4A3IB 3ZGZA 4PT5A 2TSSA 4G7OC 3I9V1 1G291 1TS2A 1QNKA 2I46A 2N0SB 2MJ8A 2QDBA 3TP5A 5CV5A 1QKZA 3URYA 4ZUJA 4ZRQA 3QG1A 3P4PB 5CBEE 2G9HD 4KY7A 5DAUA 1R4PB 5EJWA 3H94A 5A35A 5C6AA 1SYCA 2WQYB 4XYOA 2CW0D 3X3MA 1HA5A 2RKSA 3Q8AA 2V3PA 4IFDH 4J3OD 3M4OB 4C7ZA 4PMWA 1Z47A 4A3BB 2F0PA 2WP9B 4IUPA 4LTUA 1HXYD 1JWUD 5IGFA 1NENB 5JPNC 5FLXL 4RAUC 3SR1A 2PPBC 3MHZA 1TY0A 3CRKC 1N62A 1HTLD 1JQ4A 4OZAA 1SE4A 2WXGA 5BN4A 2AUKA 5C4HA 4ZLTF 4KK7A 2JA7B 1AFPA 1HPCA 4NDXA 4DXFA 1V1PB 3DEPA 1ZOYB 5AUKA 1HA6A 2QJLA 2WXFA 4KJNA 1MI0A 2F0UA 5JVH3 4I65A 1PTOH 1UWMA 2PCFB 3DWQA 2LGIA 1EFID 4GZYC 3NXWA 1QB5D 3C3LA 1SYDA 2AUJD 1C4PA 1ZXHA 4OO1H 1HZ5A 2WXPA 3VR4A 4V0BA 3B2GA 1BDOA 1H9SA 3I90A 1UWXA 2L11A 1KDAA 2LFNA 3I57A 5FKAC 3GD7A 4KN4C 2H1EA 2M9VA 4ODGA 4XDXA 1K50A 3PV0A 4NP5A 3OWFA 5CORA 4NAMA 1A2UA 3VR6A 2DLBA 2KUMA 5BN3A 4XYQA 2BTEA 4G7ZC 2LKVA 1FEHA 1J7BA 2CHBD 2DY8A 4C3HG 3MJ5A 3TDQA 2IL8A 2F0HA 1YQ4B 1IYUA 2ONQA 5G3LF 4TMAB 3I72A 2B2TA 1QG7A 4C3JG 5C0XH 4IUNA 1VDVA 3ABVB 1NAPA 5C2TB 3AN1A 4J1MA 1HHVA 4K2LA 4YSZB 3SK5A 3Q8CA 3KWLA 3NZ3A 3LWEA 3SFDB 3P42A 1U9RA 4FXCA 4ZHOA 2B2YC 4XT3B 1TU2B 1BMLC 2EOTA 2B2WA 3BYYB 1B44D 2F0EA 1EYCA 4TQ1A 2WDRB 1C76A 1D5MC 2F1MA 1VDZA 2JWUA 2V0GA 5E4WC 3OWEB 2EPBA 4H7BA 4K8IA 2WXRA 1PFBA 2Q8IB 1Q3LA 4NMZA 1QILA 5FOBB 1TYGB 4FVMA 2B63B 1R9TB 5G5HA 5AUIA 2IGGA 3QJYA 3BDOA 1IGCA 4KX6B 2B8FA 2IX3A 1C9FA 1I6VC 3QIAA 1O78A 2E74C 3DUZA 3AE9B 2KVMA 1CA6A 4A90A 1EWCA 1GAQB 2F0MA 1FNUA 3F2UA 2IPKD 2X6LA 3ZJTA 1X3PA 3A7AB 3V2TA 3IAM1 1DJRD 3ITPA 1PRTD 3S14B 1NSNS 1NEKB 3IXSA 1TQOA 3B2FA 2B2VC 4MM3B 2RSNA 2L12A 5LHY1 3C1EA 1GUWA 1KNAA 1T5EA 2F0QA 1PTOF 5JEAJ 3VR5A 2A68C 2JEBI 4OIJA 4L63B 1E9MA 4YXDB 5DM63 1G8ZD 3SFEB 3L4PA 4KY6A 1OFFA 4DK1A 1TKGA 1SSNA 4A8XC 2YEPF 4RA8A 1QOHA 4CKEA 5EKKA 3VYSA 2W3RA 1S5ED 1E10A 1PMRA 2K04A 3G7LA 2NVYB 2M56B 5K36G 4M0WA 4A3JB 4ULLA 2EZVA 1LTGD 3FILB 1SJED 4QIWB 4TRDA 1STAA 1FNWA 1A3UA 3MXPA 1RODA 5BMGA 1SAPA 2K32A 2QCPX 4YT0B 5CV4A 1CQVA 4XIGS 2HDEA 2X69A 2JE6I 3TBIB 4ABNA 1P7EA 5FLXE 2LY7A 3W1SA 5C4XB 4ZOHC 4OO1I 3MEHA 2NVQB 4O42A 2DYMA 4KTAA 1C4QA 4D2KA 4Q0FA 2FINB 1FFUA 3NVZA 1RTOA 1FCCC 1PTOB 3EGRA 2K0PA 3ND9A 4ZRZA 1HRJA 1GJXA 2BDNA 5ISRA 1N5XA 3VR3A 2XN9C 2HUGA 2GI9A 4P6VF 2WXIA 3E9SA 4CHTB 3K5LA 2YEPB 3K5OA 2Y3AA 3NPPA 1N61A 3NP8A 2BBCA 4Z9CB 1EU4A 1HTPA 1LV9A 2W54A 2BA1A 2FMMA 3BIID 1SB3C 2JEAI 2A69C 2JSVX 1BCPF 3NWSA 5C0XI 4F7XA 4YSYB 4BY1B 3SHLA 3EQLC 4X3TA 1L5PA 3DXJC 3I4NB 2L9HA 1I4RA 3HOUB 2PMVA 3NUHB 3K5MA 4MACA 3HKZB 3D4RA 1B9MA 2C5CA 4FYDA 1MVKA 2LHEA 1EIGA 1JCKB 5TSSA 4C1NI 3NTHA 4K5WA 1QNUA 1A70A 5BMHA 1STHA 2EYLA 3DMUA 2EY6A 2WXMA 4NZLB 3BVZA 2L83A 2N9KA 2D62A 1KABA 1EQTA 3TMEA 1RF2D 3K7AB 3NK9A 4YTMB 1IHZA 1PUTA 3GB1A 2SAKA 3Q8EA 2HCCA 1LTRD 2BDOA 4AS1A 1E0BA 4S3SA 2N55A 4A3KB 2EKIA 2ENBA 2G9DA 3BZDB 3EUB2 1RKNA 1B3AA 4YTNB 3KLSX 3BYTB 4PMCA 5KGUA 2KACA 2GRIA 1C48A 2C9OA 5K36H 2MUYA 2PW7A 1FMAD 1X32A 2L52A 3A54A 1FXIA 4TSSA 1ENCA 5KYLA 2Y5CA 5E3FA 1H9SB 3S16B 4IUTA 1B2TA 1DOIA 3ZJVA 3U9OA 4AQ7A 4DF7A 3PMFA 2J4XA 4HMJA 2H4OA 2J42A 3WOEA 2VZKB 3T16A 1MD2D 3MXNA 1ZDVA 2WU2B 4HTHA 3MWYW 4US9A 1B9NA 4JE3B 3X3NA 3RZDB 4NAWB 2K6AA 3S1RB 2NTTA 5I6WA 4EE2A 1U4RA 3TSSA 1JWSD 1OXUA 4KD3A 1WD1A 1FM0D 1R4QB 1RCVD 1KAAA 1Y69U 4DQOC 4HKQA 4IFDJ 3D6CA 5HFYA 4WORA 1SF0A 3DWAA 2O5IC 4Y7NB 4R3DA 2SOBA 4IN3A 3H91A 3UI2A 1ET6A 3R2TA 4MIUA 4B0MA 4XTCS 1B9RA 1TR5A 3FKIB 1OO9B 1UUPA 2OT2A 3PUZA 2O2LD 1K8MA 3T3OA 1I3QB 1II3A 1CQFA 1SE2A 4C3HB 3SK8A 4CJ0B 1TKWB 1EZ8A 2EYPA 2F0IA 5FO7B 1A6XA 2BE5D 1Q1EA 5BMIA 2D5DA 3RFZB 2N9LA 3C46A 4C3JB 4L1BA 1SNMA 2NZ1D 3GTJB 1DGJA 3GQBA 3MZ5A 2VUMB 2BCOA 3LX0A 4OHJA 2MPMA 3P4QB 1AWDA 1JORA 4US8A 2BB5A 3MVVA 2KA7A 1TS5A 2Z4HA 1I4QA 2QF7A 3H0GB 2B2YA 4ZYSA 1JOKA 3EJIA 2W55A 1JB3A 1SNOA 1TKEA 4RF1A 1QJOA 1K83B 1IKMA 1KH0A 3CQZB 3MP9A 3K5NA 4RF0A 5KIXA 1PRTF 3SDZA 1PGXA 1VF7A 4ZKCB 1XTCD 4KGRA 1AEXA 5G5GA 1NR2A 2AQ3B 5EE1A 4QUCA 3H09A 3AU7A 3KLRA 1B50A 3K59A 1BXTA 1SBBB 1DOYA 2XRSD 5C0XJ 3AE2B 1F9RA 1TWHB 1J7AA 1KFYB 4ZUIA 4ITKA 1XX8A 1MBYA 4IUVA 1GUTA 5EE9A 4HSPA 3ERQA 1GHKA 1HFNA 2B2UC 2EJFC 2IT1A 2WAQB 1OQQA 1GPXA 2Q5WD 2RDGA 1KDBA 2J0TD 2B2VA 1T5XD 4BA1I 1HFGA 2PMZB 3SEBA 4ARCA 1E0ZA 1CHPD 3H8HA 4KGTA 3A8IE 1Q1BA 3U4EG 2G1EA 4CBVA 2RA4A 4IDIA 2JX5A 1H9KA 2F0DA 5BYRA 4XXEA 4R8IA 5CV7A 4DAYA 1PRTB 3HOYB 2NUCA 1MHHE 1SYBA 5T1GA 5HGTA 4YTPB 2CJNA 4B9XA 2Z4IA 1YNND 1KDCA 1O7ZA 4FO2A 4DK0A 5ELFA 3ND8A 3A7LA 5DEHA 1F2RI 2NMQA 3SE0A 5CC4A 5GXGB 4IKGA 1WTRA 3IL8A 4G57A 1ZKOA 2CU3A 1MPEA 2VZKD 2ZXRA 1ZXIA 1F9SA 2V4DA 3H6MA 1T6BX 2WXHA 1SSOA 2V4IB 1KNEA 1WXQA 2JQRB 3P1MA 1S5DD 1ENFA 2PZTA 2OHFA 4LAAA 3QO2A 3EFXD 1LT5D 3ZJUA 4RGTA 2XWBB 2JYTA 2A6EC 5C3XA 3U2SC 5DNFA 4QMGA 4QCLA 1VRAB 2N7JA 4J6HA 1U4LA 3MFGA 2NYZD 4C2MB 1ILPA 1LLRD 1WRIA 2ICEC 2RSOA 4L8JA 4N6EB 5D3DA 5C44B 4LJZC 4CJ1B 2Y5PA 2K05A 2E2JB 2BYTA 5D3IB 4PNYA 3AEDB 3PUVA 5CBAE 4HAEA 2K01A 3HOXB 2IGHA 3Q69A 3KUPA 3HOVB 4ZKBB 4FXGC 1VJKA 3IT6B 5JPMC 3PUXA 5F2DA 3VRAB 1IW7D 3T56B 5IGEA 3R2IA 2AQ2B 1L6UA 1SXTA 4ZQ3A 2HDMA 1BR9A 3DWGC 1F2YA 4K5VA 3I70A 2PTLA 2D5GA 1DM0B 3PIO3 1CJEA 3SXHA 4HEDA 4HRSA 3W3AA 1HUMA 4B9WA 3LNNA 1ZPSA 3U52E 1CK1A 5COYA 1MGSA 1ROEA 3P4SB 4LK0M 1QQRA 5JXVA 2WS3B 4A3DB 1YNJD 2EJGC 1TS4A 5EPKA 3GTOB 2V3NA 1AZPA 2BOSA 3UI3A 5E6JA 1PGBA 1EY8A 2WKDA 4RCOA 2WNMA 3AEEB 1JQYD 2WIIB 1NVID 1EEID 3D8GA 4KKJA 1EY6A 3M85A 2XVSA 4A6QA 1EWYC 2KHSA 2A73B 2BS4B 4WQMA 1IYVA 2FE8A 2EYMA 2WB1B 1O7YA 1A15A 4FXDA 3C1FA 1ESRA 4DXGA 5J39A 5KRUA 2A6HD 1FYCA 3OHXC 4K6LA 4N59A 2F3WA 1CZPA 1WTVA 1YN5A 2E3TA 3OPOA 2SEBD 4BWGB 1STBA 3MHBA 4KMUC 4C56C 4C1NK 1ZYRC 1OXXK 1VF5C 4TQUS 1G2SA 2Y0SB 3A55A 1X3QA 2K3UA 4XQQA 5JAVA 3GO5A 2AWNA 1YJJA 4WAFA 1KTKA 1DOKA 1H9JA 2JSOA 1SMYC 4K5XA 2MJEA 1K51A 3E56A 2WDVB 4RCNA 4X3UA 3G6JB 1F9PA 2R3ZA 4WH4A 4WJWA 1CM9A 3S17B 3CRLC 1FXAA 2PIAA 4WIPA 2RQXA 3KF8A 5HG2A 3ONAB 1WTPA 3GTMB 4BA2I 3OMCA 3P63A 4A9AA 5C5MA 1UEAB 1EIHA 2R6GA 3QOJA 2F4IA 5KNDA 4RHRA 1JC7A 1M4VA 5HURA 4KY5A 1HUNA 1DYQA 2PQEA 5M5XB 2XWJB 3T51B 2K5DA 4MHEA 3VYTA 1V1OA 3BK1A 1SYFA 1V8QA 3KBGA 2QIEB 2JYOA 4H2AA 3KQ4A 2LJIA 1VZ8A 1VZ6A 5JOBA 3AE1B 3LWUA 2TMPA 1CA5A 4GDLB 4KHZA 3ZQ4A 1K8OA 1AYFA 1WD0A 2EY2A 3HP3A 1PTOC 1WCMB 3FC4A 1YQ3B 1SDFA 1Q90A 1A3VA 1FD6A 5CV9A 2F0KA 3P1HA 5I6YA 4JWSC 1KLGD 4RWSC 1OXVA 3EVQA 2VXWA 1AN8A 1ZXTA 3AE4B 5FR3A 1EY7A 2QMTA 1JMLA 1RWSA 1RJTA 2O5JC 4K14A 3R8BA 2BS3B 3S2DB 3LB8C 4YWGG 1WTWA 1Q8IA 5JVG3 3E5SA 3JAME 2FUG1 2AX5A 1H9RA 4GDKB 4IUQA 3Q8BA 3J9CA 5JEAG 1YN4A 4YIJA 1EM7A 2QEJC 1I4HA 1N5WA 5I9OA 5EKLA 3AB9A 1ILQA 2MGSA 4DU9A 1RM6C 3PUYA 1QWYA 5E1FA 3TEYA 2E6XA 3H3VC 1E2WA 1E2ZA 1DONA 4CGYB 1QOBA 4U673 1Y8PB 1S4ZA 1GHJA 4TQ0A 2B39A 3I73A 1LTAD 1JW9D 2KCNA 3D31A 1FO4A 5CMDA 2SDFA 2M0AA 2J53A 2ZT9C 3V96A 1V97A 3AECB 1J9OA 5LL6S 2L5TA 1CT1D 1ENAA 1VR9A 5IGGA 2KQ3A 3IAS1 4ME5A 1BCPC 4RGNA 1F9QA 1HEZE 2KJXA 2K5QA 4X3SA 1U4PA 3M4YA 2QKIC 2R61A 1L0VB 5A2QL 3VR8B 1PZKD 5ELEA 1TKYA 2MP1A 1CI3M 5M9OA 2HQEA 1WVLA 3W9CB 3A8JE 4V190 1PFDA 3PZ7A 2WINB 5MPOA 1V1PA 2H88B 2CW0C 2OEOA 1XF5L 4JWUC 4Q2JA 1STEA 4HSVA 2L32A 1IBXA 3FDTA 4ARIA 3TP7A 1D4BA 3WDNA 3OOCA 1I4GA 4FNFA 2I07B 2H89B 3LXFA 3J80E 5HI1A 4L6TB 3MAQA 2X6GA 3EROA 1E2VA 2B8GA 2IGDA 4N9PA 1IKLA 1BF4A 4A3GB 4HCEA 2B2WC 1SIJA 2EELA 3Q24A 3P20A 1QT9A 3IT4B 4FF2A 1EEFD 1RD9D 2IDYA 2MEKA 2K22A 4H44C 2PZUA 2KN4A 1GUGA 3MTSA 1UAPA 1DXMA 1NUCA 2OEDA 3IKJA 4P2CB 1A2TA 1BQQT 2PYKA 2PZWA 1EOTA 3GTGB 3S1NB 3HRDD 1KLUD 1I50B 1FFVA 3WCQA 3AE6B 4JK1C 1Z6HA 1Q10A 1NYRA 2OXPA 3MFYA 1O7LA 3PUWA 2K9XA 5KYIA 3MXUA 5EPLA 1FIQA 1T3QA 3DEOA 2INNE 3FPPA 2ACZB 1PDQA 1YNJC 3AE7B 1DOMA 5EQ0A 2LHDA 1LACA 1LTTD 4B08A 4B0EA 4E6IA 1ZUD2 4MN3A 1C8CA 1GXDC 3TZDA 5EGTA 4G4KA 2PLPA 4Q5VA 5FK9C 1FRRA 1SYGA 2LMCA 4R9WA 4HN7A 3NVVA 4XWTA 5ELCA 3QB3A 3NE5B 1U4MA 2XNAC 3OIPA 3U7ZA 3PO3B 5BN5A 1PZJD 5K5PA 1NCVA 3HGBA 4XQJA 5IGBA 4P16A 2WXJA 4F8MA 1XCQL 4M8AA 1PGAA 2FJ2A 1R7SA 2KEDA 4ZRPA 3S2HB 1STNA 2IWHA 1RDPD 4IUUA 5IGDA 1SJHD 1UGJA 1JWBD 2NVTB 2PVOD 3IAYA 1L0XB 1PFMA 2ICIA 3B9JA 3AEBB 3I4LA 4RHSA 3OMGA 3M7GA 1WYGA 1IUEA 3K0YA 3HEJA 2K1BA 5T1IA 3GV3A 2KWDA 5ELDA 4IURA 1QF6A 1TS3A 3RD4A 3NSWA 3NVYA 3NTIA 4CJ2C 4KKSA 3GV6A 3Q0AA 1JRPA 1EY4A 2YU9B 4WRDA 4KKTA 4BY7B 5J1ZA 5IIFA 1YN3A 1EYDA 2Z8LA 3HG9A 4K8JA 3I91A 1TIID 1PRTC 1XLNA 5EKIA 1EY9A 5EBCA 1BO0A 3NWTA 3C2PA 1XEEA 5C4JB 3S15B 1VLBA 1AZQA 2WXNA 1ESFA 4UDUC 1GUOA 3BS1A 3DWMA 1W6JA 3N52A 2E75C 1SYEA 2WXOA 2DN8A 3M7NA 1TJEA 3FMCA 5JJZA 5A2QE 2DYOA 1RFKA 4JPSA 1V8CA 3U9SA 3AEAB 3BVMA 2L0CA 2DWQA 3PO0A 5BYSA 3NBIA 5EPJA 4KHVA 2F0WA 3Q22A 1C4CA 3VR2A 1E7PB 1G91A 1MHXA 2EJMA 3NVWA 2E76C 2JA5B 3K57A 2KMMA 1DOXA 3W5VB 1BNZA 1A3TA 3PIP3 2M2LA 4RKLA 2RMMA 3GTPB 3QWNA 1XCTL 2BT6A 2WP8J 1NYQA 5KNCA 2NN6I 2WXKA 3HVDA 2KQ4X 5NUCA 1LT3D 4DNRB 1ZEQX 1JOQA 4OZBA 2X38A 4QB4A 1TT2A 2F0GA 2WXLA 1JROA 3BDLA 1DOLA 4JBWA 3T3NA 4XE0A 3JAML 1HQRD 3DHQA 3D6WA 2LFIA 1CTMA 1XXGA 5KEEA 1XO3A 2W3SA 4IZ8A 4RH6A 4FXKC 3Q8FA 4EQPA 3BWUD 1W6KA 1EL0A 5FO9B 1MSHA 3NQTA 1VZ7A 4ILWA 4HEA1 2EYHA 2MJ3A 3M3YB 3SK6A 2QSDA 1FCLA 2WV6D 3TP8A 1I4XA 4RGOS 3EA6A 3FVQA 4HCSA 2JYEA 4DNTB 4DA2A 3S1MB 3IFDA 5AFWA 3CWIA 2RDFA 1B53A 1JWAD 4G7HC 1STGA 2F0VA 3T53B 2JU6X 1IBXB 2FFKB 2SNMA 1TWAB 3MXGA 4RFBA 4JX1C 1G2TA 3P7JA 1JICA 4FF4A 3J7AV 2JXMB 3BK2A 3VA5A 1Y56A 1AW7A 4OZCA 2F0LA 2KAJA 2RPVA 4X3KA 4RNAA 1D6EC 3DWPA 3HZXA 2EDGA 2F0OA 2OF1A 3AM9A 3NQIA 3HS0C 4PMBA 1L6VA 2W82A 2E2HB 3AMZA 4HR7B 2L4NA 1SEBD 2KDMA 2ZW1A 3BDCA 2RVLA 4RGMA 5C3JB 3S9WA 1XLQA 5M3MB 3T13A 3P75A 1YNTE 5C3EB 3TEZA 1FR3A 2RDHA 2JP1A 1LT6D 2PW9A 5EE3A 1EU3A 4FF3A 3SK4A 3FEWX 5C3WA 1JALA 2XIWA 3ZYYX 1RYJA 3CHBD 3D3RA 3TEWA 4UAIA 2D9UA 3GP7A 4R8NA 5IOCA 3MA2B 2D2CC 1EYAA 3J7AF 1JOOA 1ML0D 2AWOA 2N88A 4ZAIA 4A93B 2EY1A 4WFN3 1BOSA 2M19A 3J80L 4KJOA</