3BVZA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type C-3
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 63
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvzA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvzA01
1LLRD 3BVZA 1S5ED 4ZYSA 5TSSA 4BWGB 2AQ3B 3DWPA 1PZID 1EEID 1FNUA 1JWMD 1SXTA 1SEBD 1YN5A 2QILA 1HQRD 3BVMA 1QILA 1SE3A 1SJED 1JCKB 1LTAD 2NTTA 5ELCA 1ET6A 1I4GA 2XRSD 1BCPB 1S5DD 1TY0A 2G9HD 4DXGA 1G8ZD 1EWCA 1BCPD 1I4PA 2XNAC 1S5FD 1FGBD 2AQ1B 5ELFA 1CK1A 1SE4A 4DXFA 2IPKD 1I4RA 1B44D 2AQ2B 2XRQD 3W2DA 4L6TB 3V05A 2Z8LA 1KLUD 1LTGD 1TS3A 1UNSA 1PTOB 1S5BD 4OHJA 4RH6A 1BCPC 1RCVD 3GP7A 1BXTA 1DJRD 2CHBD 2RDGA 4RGMA 1CT1D 1PTOD 1LT3D 2IJ0A 1AW7A 1L0XB 1UUPA 2NTSA 3BYYB 1EU3A 5D3DA 5FK9C 1XTCD 1DYQA 1FNWA 1SE2A 1EEFD 1L0YB 1D6EC 1TS5A 3MC0B 1STEA 3CHBD 2XN9C 1PRTB 2TSSA 3R8BA 4O1NA 1KLGD 1RF2D 4RFBA 1PTOC 2QEJC 1PZKD 1YN3A 1PRTD 1LT5D 1JWSD 4Z9CB 1D5ZC 1I4XA 1RDPD 3R2TA 1PTOH 1ET9A 3BVGA 1JWUD 1LO5D 1B1ZA 1TS2A 1SJHD 1V1OA 1LTTD 1PRTC 3BYTB 3EA6A 1JR0D 1LTID 1SBBB 1FD7D 2RDHA 1F77A 4UDUC 1HTLD 1V1PB 1M4VA 1KTKA 1S5CD 2WV6D 1FNVA 1XXGA 3O13A 4RGOS 1HA5A 3OWEB 1ESFA 3R2IA 1LTSD 5ELDA 1D5MC 1V1PA 4C56C 1MD2D 2SEBD 4RGNA 1LTRD 3SEBA 2J4XA 1HXYD 4NZLB 1AN8A 1LT6D 3TSSA 1TY2A 2O2LD 2R61A 4RGTA 1D5XC 5D3IB 1I4HA 1RD9D 1YN4A 3URYA 3EFXD 5I4DA 1PTOF 3MFGA 1CHQD 1CHPD 4RHRA 1LTBD 4K6LA 5ELEA 1T5XD 1LT4D 3DWQA 3DWAA 1EFID 1ENFA 4L63B 2ICIA 4TSSA 5FKAC 1GOZA 1I4QA 1PYWD 1BCPF 3KLSX 3BZDB 4RCOA 1EU4A 1PZJD 1PRTF 4RHSA 5ELBA 1TS4A 1CQVA 1JQYD
chains in the Genus database with same CATH superfamily
4AIMA 1LLRD 4GLXA 1UWMA 1EIFA 2WX0A 2B2TC 1GC7A 1VQDA 1I50B 2BDNA 2NVYB 5BN5A 3PO3H 1CI3M 3Q3MC 4I6NB 1VR9A 2IY0B 1FNUA 2FCNA 4GN5A 4KKJA 2FXQA 3G7LA 2JXMB 3PLVA 4TQ0A 3MC8A 2K01A 1XPOA 3KWVA 2QGQA 2WDQB 1JCKB 3ND9A 3S1QH 1NSNS 1YJIA 1GUSA 1KH0A 4LNOA 4MH0E 4BXXH 4MACA 4LNIA 3S9WA 2MJDA 1E24A 2PYKA 2B3GA 1YITA 1L0VB 2KLCA 2X38A 4Y7NB 2CHXA 3QAQA 4PQXA 3AU7A 2FIDA 4HDOA 5DCNA 3V6EB 3OG5A 3A8KE 2MJEA 4RWSC 1N5XA 3G6JB 4KKUA 4II2B 2ALYB 2G4SA 1IBKL 1E7PB 1R4PB 2E2JH 4A3FH 2WP9B 4TV3A 5D94A 2JX5A 1LUZA 2BDOA 2NTSA 2ZM6L 2F4VQ 1C7YA 3BDCA 2IO3B 2KA7A 2OJWA 3OJ3A 3KUZA 3NG0A 4L2YA 5CV4A 2DNFA 2JA6B 1L6UA 2A68C 3QQ8B 2KT7A 4DHJD 2NVTB 2J53A 2FNJB 4R1JA 4F8CB 1KFYB 4IO9A 2D2CC 4C3HH 1WRIA 2KWDA 3S1RH 3V3XA 4XDDA 1JWBD 2OHFA 3GTLB 4X62Q 1SMYD 4BKSA 3VR5A 4DR2Q 2CVRA 2ZCBA 4IC7B 4LWCA 2JY6A 3QCAA 3VR9B 4I7ZC 4B3TL 5KHQA 2CJNA 2E2HB 1YIWA 1V1OA 3L13A 3VTWA 3QHTA 4A3OA 1WXAA 3S1NH 3HZXA 1VZ8A 2QSDA 1JR0D 2WXLA 4MN3A 3L7ZC 1ZP0B 2A5UA 5C4JB 3H7PB 1VCBA 4II3B 1F9QA 1S40A 4A3KH 1N33L 4CGYB 3CF5A 1M90C 4B3RQ 1UEBA 4FA6A 1E6EB 3FRPB 1FPYA 3CMMB 3WWVA 2VH1A 4BAXA 4FJYA 5HGTA 2SEBD 5DPSA 3Q6BA 4OVVA 1LT6D 1EF1A 2Y5PA 3H1UA 5C5MA 4KK7A 2FUHB 5NUCA 3LXFA 1T5EA 5E7NA 1VZ6A 1SE8A 3VYSA 4PZ6A 2K5WA 1QWYA 3CQZH 3OW2A 3HP3A 1XPRA 1UELA 3DWMA 4BS9A 4POFA 3PZDA 4O2DA 2PVGC 1K52A 4JI7L 4KZCA 2W3RA 4HLEA 1VQOA 1XLPA 4ZUJA 2IY5B 1WGDA 1BVSA 4DR3L 2L0CA 1TIID 3I91A 3IRBA 3M4OB 4L63B 1BKBA 5AFWA 2EZVA 4LF5L 2DJGC 3B0AA 4BOZB 2MQHA 4HR7B 3KLSX 4PMWA 4ANXA 2F0MA 1IBXA 4KN7C 1HZAA 1MJEA 1G2SA 1VZ7A 4ZRKA 4GDLB 3I4NB 1SNOA 3Q8AA 1SNQA 1CQVA 1V6EA 4MM3A 2YVCA 1VLBA 3UE0A 4GN3B 3SVMA 2F0NA 2I46A 2RVLA 4AOFA 4NNJB 1BBXC 1RFKA 2KXJA 4G57A 4DV3L 4DV6L 2C9WB 1SEBD 2IL8A 3NS8A 4N58A 2L7RA 3S16B 3BVMA 3RT3B 4QUCA 2CKZB 3UDXA 2F0QA 2A5HA 2K3UA 3A55A 4WWMA 5M5XH 2BS2B 2V3NA 2G9HD 2CCZA 3RZFA 4IOCA 4A3JH 4ZRJA 5IWAL 3TJPA 5CGKA 3TP5A 2UXCQ 1FYCA 1FGBD 1HTPA 2I0QA 1JORA 2KACA 1JQ4A 3CSFA 2ZJPA 2GBNA 2XRQD 2OTLA 2JF5A 1SN8A 3ND8A 3ECIA 2NUCA 3MWYW 1S3OA 4ZRPA 1CM9A 3TBLD 1GUTA 5C4XH 2YTVA 1AFPA 2O2VB 1WX8A 3RZOH 1UH6A 4C1NI 4A3LG 1IBLQ 2IX3A 5LXHA 3T1HL 4YTMB 4L1BA 3IT4B 2VZKD 4NJ7A 3U2SC 2PZUA 3M63B 3KDFA 2JA8H 2G3QB 4P71A 2MP2B 2MBQA 4NQKE 2CH4A 3N32A 1EEFD 4PZ7A 1MI0A 2QCPX 1K8AC 2DX5B 4X3KA 1ML0D 5BR8Q 4X64L 5C3EG 3ML8A 4DNRB 1N9WA 1RF2D 2KVRA 1WY8A 3PIOA 1GJXA 2NZOA 1XNRL 2CU3A 2CS4A 2L0FA 2O6VA 4C3JB 5L83A 1PQSA 2M0XA 1NI2A 5DPTA 1WX9A 3W1YA 1N60A 3I8ZA 3T13A 3ZNZB 3HOYB 4RMAA 2K5NA 5IIFA 2DZJA 1PH6A 3S15B 1P9DU 3VVWB 1HHVA 2KC1A 1VQAA 4A3DB 1B3QA 4F87A 1WFQA 3HRDD 4JX1C 2XWJB 1ICFB 1QKZA 1Q86C 4YCVA 1L7YA 1TWCB 3MJ5A 3ULJA 1XNQL 3C1EA 4OZAA 3DHHC 3ULLA 3I3CA 4KKTA 3S1MH 2UXBQ 5G3LD 4RGOS 1V5OA 1JJGA 4ICVA 2N4FA 2KD0A 4LF9L 2UU9L 2D10A 1XF5L 2CKHB 1PGAA 4ZUIA 3CIRB 2LXAA 4L23A 1HXYD 5IE8A 3DM3A 3AE7B 1A62A 2K03A 1R9TB 2V0GA 3I55A 1GG3A 1SYEA 4JI6L 1SNMA 1N34L 2PQAB 3H0GB 1WGKA 4NXNL 3L54A 4GKJQ 4M8AA 1R7SA 3H6NA 5G2NA 2N88A 3RUIB 2Y0SG 4ZRQA 3K8AA 2FMMA 1VDVA 1Q5WB 1CHPD 4BY7G 1VRAB 4LJOB 1T5XD 5C0XJ 4ODGA 1WCMB 3AMUA 2ZVNA 4XQJA 4LK1C 2WHIA 4XDCA 3GE8C 1J5EL 1KOTA 2BE5C 4RCOA 3I2ZA 3DVGX 4QAYA 1TGZB 5D6JB 3U52E 3DUZA 4JPSA 4N9F4 1A0IA 1VQIA 2W3SA 4YL8A 4BY1H 3SR6A 3CPFA 3AE1B 2Y3AA 3S14H 2E2DC 1DD2A 2DYOA 1V1QA 1PH4A 4JLCA 3NE5B 5EKIA 2MWSB 4W9CA 3NEMA 3K0XA 3PF5A 1I3QB 5AZHA 1TKEA 4XDXA 2VUMB 4P75A 1UAPA 1TWFH 1ZEQX 1LTAD 5K5PA 1YHQA 2BKRB 2NVQH 5A2QL 1RTOA 5IYCG 3S2DB 4OWTB 5AZGA 1Z7TA 1U4LA 4DXGA 1L4DB 2LVQA 3U9SA 5C4ZA 3NBHA 2M8SA 2RPVA 1CK1A 1F9SA 3TIXA 1AE3A 1CFMA 2B8FA 2LXJA 1YVCA 4YTPB 4X3SA 1F2YA 1Q10A 5FLXc 4HN7A 1FIQA 3WA0A 4DGZA 2VW9A 1VQLA 1YNTE 3K80C 4KJOA 4RH6A 2LMCA 2VZKB 2ZNVC 1ASYA 3HOUB 3AU4A 4IM2A 4DR4L 1E2WA 4LNFA 3RULA 1FJGQ 4AJWA 1UUPA 3AH7A 1BO0A 3MHBA 3K6OA 1PFDA 5AZFA 3DM1A 4ZHPA 4K2KA 2LVPA 2RDFA 3K9PB 2ON8A 1XLOA 3IL8A 4DHZE 3PQIA 2R3ZA 5EE0A 3I4NH 2M0AA 4CO7A 5IY0A 4H2AA 2F3IA 4CQNA 1YN3A 1JB3A 1SYGA 2K6QA 5EPLA 1XMQQ 4XE0A 3SFDB 2KWCA 3B2GA 4ARCA 4H44C 3HGBA 3R2TA 4DA2A 4L8JA 1NE3A 2GVAA 4KTAA 5IP7H 3CMEA 2QDLA 5M3FG 4HAEA 2IYDB 4A4IA 2Z6BA 4X66Q 1N32Q 2A1AA 3KUCB 2BYEA 3NOBA 1QVCA 4DBGA 4YXDB 1A63A 5JPNC 1UGJA 3DVNU 1KQSA 2F0SA 1DOIA 2PE9A 3SDLC 1BDOA 4IQZA 2LJ5A 4QIWE 2KN5A 4R4OA 4IUMB 1M4VA 1IYUA 1CKNB 3I72A 2B2YC 3BDOA 3OSOA 1YOVB 1B8AA 2SDFA 2KN4A 3U4VA 1ILPA 1WXQA 1MD2D 1VD2A 1PXUA 1KNAA 5LMNQ 3HRZC 3NVWA 2L12A 1T0SC 4KV2A 5D14A 2I5LX 1C4CA 2D0PA 1YN4A 4X3UA 4WJOA 2HCCA 2XWBB 3C1FA 3D3RA 3STBD 1P7EA 3IT6B 3P4SB 5AUIA 4JBWA 1VF7A 4DF7A 3HOVG 3IXSA 4A3LH 3NJTA 4YCWA 3PHXB 1GAQB 1B9RA 2RF4A 1WF9A 4NAMA 2K5QA 4M02A 5LL6X 4JWUC 4WAAA 1V49A 3G6EA 2LGIA 3SFEB 4DV1Q 1TS4A 2LKVA 1UE6A 2F3WA 2KDFB 3PO2G 3C0RB 4MDKE 5G5HA 5L37A 5C3EH 3T1YQ 1IL2A 3AEBB 1LM8B 3NPPA 3MXNB 3J7AV 2NMQA 2B63G 2KQ3A 1N6ZA 1Y1VG 3RNAC 3U50C 4J15A 1SSOA 3I4MG 5F2DA 2QILA 1I6HH 4RMFA 2L83A 2LSSA 2GN5A 4IM3A 1B70B 4WFN3 4DR2L 2I1JA 1KHIA 3P20A 1HEZE 5JJIA 1GUNA 3GE3C 3HOZB 4EX5A 3AEFB 2OOBB 2HE7A 1NY4A 1I4PA 2BA1A 2J0TD 2VL6A 1KRHA 3FEWX 1K8GA 2F0PA 2JA5G 1P3QU 2BT6A 1KAWA 2KO3A 1I35A 3V61A 3I4OA 3F2DA 1VQ8A 3PRZA 2WS3B 5EJWA 4B3RL 1JE4A 1RIPA 2X6LA 4JV5Q 4NAWB 4HMIA 3HOWB 1IZ6A 1IKMA 2M56B 1AZPA 4X3TA 2MBOA 3B08A 4NJCA 3QA8A 2NN6G 3N3KB 3IAM1 5CV5A 2YU9B 4KX6B 1A6XA 3TN2A 3DBRI 2O5IC 1ZXTA 1LFDA 2VB2X 4FDBA 3RMHA 3M7NA 4MEMA 2DUDA 4I6PA 1J9OA 4KY7A 3NQIA 2ZJRA 1KF6B 2KFKA 4R4QA 2PW9A 3K5NA 1HFNA 1QZEA 4QIWB 2WB1B 2PMZB 3GD7A 1JWAD 1HNZQ 2GBRA 1Q82C 1N36L 1HTOA 2OEDA 3IFWB 1K28A 1SR3A 3H3VI 2BGFA 1ENCA 4RKBA 1PHJA 3PZ8A 2NN6I 2KX3A 2H4OA 1JB7A 2V3PA 2SAKA 4LF4Q 3PSEB 4C3IG 4HEA1 4LTUA 3KUPA 4A3MB 1SAPA 4YHHL 1N5WA 3UF8A 4FBJB 1H9KA 3C3LA 3Q8EA 2N9PC 3NVZA 3T56B 1VQEA 1PH9A 1WWTA 1YZ6A 4JI1Q 4OIJA 2DY7A 1XYIA 2K7VA 2YTYA 3A74A 5K36G 2IW3A 1BUIC 3K58A 5CMDA 5J39A 3KFUA 3LB8C 5IYCH 1TTNA 2NS5A 1PFMA 1G6ZA 1M1KC 1VMCA 4TKNA 1UBIA 2N7DA 3EVQA 3PRPB 3F1ZA 2ZEQA 4Q2JA 1RYJA 3PVLA 1WR1A 3WOEA 4LF6Q 5EE3A 3ZDTA 3VYRA 2IBIB 4FJVB 5CTRC 4P16A 3PO3B 5BYRA 3GTGB 1GUWA 1C9OA 3MFGA 5DPWA 4DAYB 1HZ6A 2DNCA 3IBEA 2LEKA 4P6VF 2Z4HA 3AB5A 3HK0A 1WI0A 4KD3A 2F3VA 4WRDA 2EYFA 2JXXA 4JL9A 1YX5B 3ZW3A 1RM6C 2HDLA 3S1QB 4DPGA 3VXWA 1FD6A 2ZTCA 5FKAC 2AUJD 2JA7G 2KDMA 1PYWD 3UE1A 4O42A 4E74A 1FFUA 5HY6A 1D2BA 3MJWA 1NR2A 1DOYA 5DEHA 1H9SA 2JSVX 5M5WH 4EQPA 3IVFA 3NZ3A 4ZYSA 5TSSA 1UWXA 5IODA 3X23A 2R7DA 3U58A 4WJ4A 1E8ZA 1K83H 2OXPA 5E6NA 2RHQB 3K81C 1SROA 1E0ZA 1C4PA 1YN5A 2MA9B 1J7BA 3ZDMC 3WANA 2WX1A 4A3FB 1KXLA 2DJFC 5JHBA 4AUQC 1V8CA 1ET6A 1HCZA 3VR6A 2DAJA 4DK0A 1TR5A 1QCBD 4K8IA 1BBWA 2WQYB 4YCUA 4P1CC 4HJ5A 3X3NA 2K5DA 4HEDA 1STYA 2ZVOA 2JK8A 3ERSX 2IPKD 1E7UA 3N1ZC 4HIMA 1HNXL 5KNDA 3L0WB 4ZOHC 3ZLZA 4C3HB 1KLUD 1NBWA 4AYBE 3UDFA 3S1RB 2N7EA 4JI4Q 4AS1A 3ZRCA 3AM9A 1WIAA 4HJKA 3RZDH 1FVIA 3NHEB 3C46A 3PSIA 3DCGA 2NYZD 1BXTA 3GP7A 1OEYA 4JC0A 1CT1D 1DOXA 2O2VA 3I56A 1YIJA 1TXYA 1E7VA 4A3IH 3S1NB 5J1ZA 3Q8DA 2L76A 1GKHA 1SE2A 3A56A 2BYFA 2V4IB 1D6EC 4JCVE 5GAHC 1WM3A 3ABVB 3AULA 3HOVH 2KHSA 3PIO3 4A3KB 4MT5A 2MP2A 4A55A 1JC7A 4UY8C 3FKIG 4JPBW 3BWUD 1TT2A 3N1XC 1T0QC 1V2YA 1JWSD 4FP5D 4KLKA 4DUYL 1D5ZC 1M94A 4B0MA 2N1WA 3RLFA 1RJTA 4X65L 1G51A 1B2TA 4BKGA 1J8CA 3G48A 5T1IA 2ZPYA 4V0BA 2BOSA 4OONA 3PO2H 1WGYA 1X3EA 1K51A 2L1BA 1XCQL 3CQZB 1ACCA 2FUG1 4A3BH 3ZUNA 3PPAA 1C4AA 1Q90A 2ZW0A 3NRZA 1Y1VH 3EA6A 4B9KA 3VA5A 2OF1A 1G6PA 1EO6A 2EJFC 1VQJA 4IWQA 1VQBA 4AJYB 1B50A 1Q7YC 2EYHA 3S2HH 1BQQT 2E6XA 4KV6A 1YQBA 3BG3A 3NQTA 3UIPB 4YSZB 4L5TA 2F0GA 2EY2A 2BVCA 4S3SA 1K8OA 4W9LA 1D5MC 3PIP3 3RD2A 4C4VB 4QY7A 3AMZA 3ETRA 1OFFA 3RNBC 1TU2B 1HPCA 4CBVA 1TY2A 3K5MA 3OWFA 2BCOA 2JA5H 4JIOU 3HOWH 4JI3Q 4HCSA 4A75A 2JRIB 3A1QB 4ID6A 1NR4A 5IT9E 3SK5A 5FLXL 4LFCQ 2PQAA 2L8JA 2N9EB 3HKZB 4LF7Q 1WM2A 2F4IA 2MO0A 3E5SA 3JSVB 3PTFC 3KF6B 3TUOA 3VR8B 4IURA 2F0DA 3A9JB 2F0IA 5J22A 5M5XB 5M9OA 3FPUB 2KKCA 3D0FA 4MGZE 1HJPA 2WNMA 4A3JB 2M9VA 1WJUA 2L1AA 2WAQG 4XT1B 3N6RA 4AYBG 3VA7A 1CQFA 2KEDA 3TP7A 4B3ML 1HZ9A 1AE2A 3C19A 3NWTA 3WAOA 4ZCKA 2JZZA 2RA4A 1FRRA 3RZOB 2Q2HA 2IO1B 4MSQB 2KTFA 1WYWB 1U4PA 3DEOA 3M85A 3GTKH 2EDGA 1JW9D 1WYGA 4BBSG 1NMFA 4HMJA 1OXSC 4C3IH 1IGCA 4LJPB 5IP4D 5ELCA 1R4MB 1Y1WG 1OGWA 3A4RA 1Y14B 2IY1B 4CDDC 1IKLA 2JA8B 4KZ0A 4R8IA 3ML9A 3V60A 1SNCA 3QB3A 2KJHB 1LQBA 1X6OA 1VQPA 2Z6KA 1E8WA 3RCZA 2XNAC 2FCMA 4DV7Q 3RLOA 4GN1A 4ICUA 4W9KA 2AQ2B 3W2DA 4C00A 5K36H 3V05A 4W9DA 2Z8LA 1QZGA 1FCCC 2ONQA 4LDTB 1EIYB 1NENB 2Z0SA 2RSOA 1F52A 1JRUA 1BCPC 4CKEA 1D3ZA 3SXHA 3GTGH 2EYMA 3I70A 4GDKB 5FLXE 1PH1A 2H5XA 4IFDH 1ONLA 4GKKQ 2HCIA 2INDC 4R3DA 3VTVA 4ANUA 2W54A 2K33A 3A0JA 4KN4C 4A3GG 5FK9C 2FMCA 1FNWA 3TMEA 3N30A 1EY0A 3JAME 1E0BA 4N9PA 1QOGA 1RL2A 1AH9A 2Z9HA 3DDCB 2AHOB 4KIKB 4DV2Q 1D7QA 2WDRB 1KLGD 1XWEA 4DR1L 3S1MB 1PTOC 4G50A 1GHJA 3ZRFA 1WTPA 5JOBA 2A69D 4LFAQ 4GLVB 2B39A 1LGRA 1LT5D 3PT2B 2L15A 2B2VC 1Y56A 3VUWA 1BUVT 1IBMQ 2A4ZA 1YNJC 3BVGA 3SR1A 3TBIB 1L6VA 1VQCA 3PLUA 3I57A 4OZCA 1L1OC 3G4SA 4B3SQ 2DWQA 2KZRA 1PRTC 2AWOA 2IGDA 2F03A 1QG7A 4B9WA 2JZPA 3QIAA 2YYZA 1TZ1A 1Q8KA 1P8LA 2L5TA 1QOBA 2F1MA 4KKIA 2MFIA 2K6AA 1KTKA 4GNXC 1FNVA 1XXGA 3H15A 4X6AH 1WJ4A 2I38A 1GC6A 4DNTB 3TEXA 3L9AX 5ELDA 2XVSA 1CJEA 1RHPA 1NAPA 1E8XA 2PQEA 3TS0A 1FXTB 4I6LB 1CKNA 5LNK1 4WJNA 4JBKA 4MSMB 4GOPB 1OQYA 2DZKA 2QCZA 1MGSA 4BY1B 4DR7Q 1C79A 1EM7A 1F2MA 4KHPQ 2D5DA 3S14B 1HZ5A 3DBLI 4FN2A 3I9V1 2CU1A 3EFXD 2H1EA 1WOCA 5I9PA 1NDDA 4HDQA 2KANA 1N62A 2FBWB 2WDTB 4NXML 4DAPA 1STAA 1CHQD 1DCZA 4RG1A 1I7HA 4C2MH 1IL8A 1MG4A 1HZCA 4EZJA 1K8MA 2MHVA 1TWFB 3H8HA 3DWAA 3PREA 4NKLA 3P75A 1ZPSA 3MZ5A 2NVQB 5FOBB 1JT8A 1Y69U 5IO9A 4XIGS 1X65A 4TQUS 3K9OB 3UDIA 4JI2Q 1TY0A 4ZKBB 4DAVA 5LMUQ 2WU2B 3GV6A 2XBBC 4ZQ3A 3FKIH 4BWGB 2NVUI 5EBDA 2KC2A 1HNZL 3AXCA 1IUEA 1Z6HA 2J7ZA 3W9CB 4IOIE 2MH7A 1UE1A 3MXNA 3F2UA 3PHWB 2B2UA 1CZWA 2OWOA 2NTTA 1GB4A 2G4DB 1U0LA 5J2RA 1YNJD 4HJ7A 4OO1G 2L3ZA 2KUMA 3QOLA 4DV5Q 3N20C 1E5WA 3OIPA 4WJ3M 3ZJTA 2J0MA 1S5FD 4TVAB 2UUBL 4LF8L 1V5TA 2F0KA 3H9DA 1E9MA 1STNA 1U4MA 2EQSA 2KCCA 4HJGE 2C9OA 1LTGD 5C6AA 1NJIC 1EYGA 3E0EA 4WURA 4CDEC 4ZKCB 2BQQA 4ITKA 4NY0A 5IGCA 2UXDQ 1XX8A 1B53A 2A68D 4FXGC 2CHBD 4OO1I 1NYQA 4IPCA 3UQBA 4NAWA 1UEAB 2Y0SE 4LF6L 2JXTA 3DVGY 1DGSA 2A6EC 1EZ6A 1TS5A 3FILB 2F0UA 3E9IA 3PO0A 4ANVA 4J3OD 1YNNC 1P98A 4A6QA 4D2KA 2KWUB 3FMCA 2QDBA 4RKLA 3G71A 2EMSA 3NY5A 4HKQA 3Q3OC 4LUVA 4IUQA 1VQKA 3RNEC 4DR5L 3D6CA 1XMOL 3Q3JA 2KEEA 2NWGA 3EJIA 1K3BC 3RN5A 2HHHQ 3TRZA 2G1EA 2KTRB 1MBYA 3KLRA 4QMGA 4E3CA 5EE1A 1JWUD 1DOLA 3RNCC 2LI5A 5MPOA 3D6WA 3HM6X 1E2VA 4YY3L 5FR6A 3S2AA 4IALA 1LTTD 5CYUA 1GB1A 3Q69A 5D7GA 2WXFA 4XYOA 3NUHB 2F0HA 3E9HA 3JAMi 3AECB 1EZ8A 2ZJDA 3FPPA 1XTDA 2K1BA 2RSNA 3PZ7A 4K5XA 4BBSH 1WXSA 1FGUA 3LDZE 1MSGA 3J81E 2PMVA 5AEKB 2KJRA 2MJ3A 4OW0A 2KOXA 4XTCS 3D4RA 3PUXA 4JI5Q 1QQRA 2VNUD 3EHVA 4NZLB 2R61A 1J0GA 2BA0A 5LL6S 5C3EB 2KWVB 1ZDXA 2D11A 2LY7A 4AQYQ 4LFBL 3GO5A 3WALA 2VXWA 2OCEA 5BO4B 4DNIA 4W9EA 3ZIMA 2O4XA 3T53B 1OTCA 2INNE 4NP5A 1SYDA 3Q22A 1WRDB 3NVYA 2WXMA 1BT0A 1I6HB 1R4QB 3SGIA 3X0WA 2H89B 3MHZA 4DUZQ 4JI8Q 4XWWA 4NDXA 3DWQA 4C3JG 3CRKC 2AWNA 3W1BA 4DAYA 3TMPB 3K7UC 1HFGA 2I5HA 4LMQD 5E3FA 3CSTA 3N9YC 2E8GA 1EY5A 3BDLA 3HOYG 1HR0Q 3H09A 1PZJD 4IPHA 3PUWA 2UUCL 3B2FA 3M3JA 3RZWC 4DK5A 1PYSB 4HCNB 4A3DG 4YTNB 2PI2A 4XQNA 1HTQA 5CORA 1S5ED 2RCFA 3M3YH 3AU5A 1VQGA 4GLSC 1XO3A 3WDNA 2DYBA 1ILQA 5IT9c 4YWMA 3FDTA 4DN4M 1WTXA 2BYTA 4HJ9A 2CHWA 1I94L 4KDIC 3H3VC 1LACA 1ZOYB 1LABA 2HIVA 2I07B 2BW2A 4IDIA 3NVVA 4JYAQ 3L0OA 3CF6E 3VFKA 3J80c 2WDVB 4MGKE 5DNFA 5IOIA 4TUUA 1CTMA 3FKYA 1SDFA 1BR9A 2OT2A 1BOSA 5H8YE 3KOJA 1TKYA 3H0GG 3P42A 1QOFA 1ZUD2 3D4WA 2GMIC 2K39A 1K3RA 4IWOA 1WJ6A 3M4QA 3P1HA 4J1MA 3E56A 1WD1A 5CV8A 4DXFA 2VQFQ 4BKSD 2N78A 4GNXB 4DV0L 1S1QB 3PV0A 3O65B 5M3MG 2HT1A 2XSCA 4EVOA 1C76A 1QUQA 2WIIB 5IGFA 1MSHA 1WCMG 3MTSA 2KQ7A 3Q0AA 2AEHA 2LHEA 3DWGC 4GZYC 5L95C 2NPTA 1DJRD 5C0XG 2F0VA 3VR4A 3L17A 4A90A 3D32A 2RCNA 3MHSD 4LCDE 1KRSA 4HJ8A 4ZAIA 2RGFA 2R7ZG 1SYCA 1YHBA 5J3BA 2XN9C 3A5UA 2JE6I 2K4KA 2AUKA 4LFCL 4DV4Q 2FCSA 1T3QA 2N0SB 3EC8A 3DQVA 4EQNA 3NP8A 1YJ9A 4LF7L 3B1LX 1F2LA 2HD3A 2D3GA 5CHWA 3SDZA 2MQJA 1ZYRC 3N52A 1JJ2A 1I4XA 4DAMA 1HZBA 2D9UA 5C0XI 4Q5VA 2D5GA 2HTHA 2EYPA 3SK4A 1VJKA 2WXJA 1SE9A 2E2IH 4ILWA 1O7IA 4BA1I 1T0RC 1PDQA 2KX0A 2PZWA 4DKAC 3KJPA 1IYVA 3AN1A 4NPNA 4PYUA 3SHLA 2GBKA 2WWZA 4XZ4A 4A8XC 1QLBB 1YHAA 5C3WA 4JI0Q 3OTOQ 4BBNC 5LXIB 3C8YA 1C78A 3ICEA 5D65A 1QOAA 1WJJA 2JN4A 3RR5A 1F2RC 1UD7A 2K8BA 2RDHA 3JAMc 3NBIA 4ABNA 2WXRA 4G3XB 3HKSA 5I2YA 4FXDA 4UP8A 3DHQA 1XQQA 4DR6Q 4OX9L 2D3AA 2VZAA 1KDCA 3MVVA 4GB9A 4G7OC 4C56C 3KF8B 1LTRD 1KABA 3BK1A 2ID0A 1R4NI 3AE2B 2UUAQ 3CWIA 4K7WA 4NW2A 4JG2A 5M5WB 1ZXIA 3VH3B 4PNYA 3QO2A 4GOCA 1S4ZA 2R92G 1CZPA 2BYVE 4QF4A 1K50A 2VQEQ 2JYOA 1L0WA 4EZKA 1FXIA 1G291 1K83B 1PTOF 2BE5D 2Q8IB 3Q8CA 1EF5A 3U4ZA 2DN8A 4IM0A 1C77A 4K6LA 2QW7A 3VYUA 4CYEA 5DAUA 1YQ3B 3A1QA 2CWAA 4PV1C 1SFOH 2E74C 2J0JA 2D3CA 3M95A 1SMXA 3IFTA 3L10B 3WCQA 2ICIA 2JWZA 1EUJA 2KENA 5T1GA 4B08A 4A3EG 4IUTA 2LUEA 3J81i 5ELNA 4K0KQ 2R93G 3KF6A 1PRTF 4FF1A 2CW0C 1IP9A 1STHA 3A9JA 4F8MA 1EL0A 2NCNA 1X3FA 3W1SA 3P1MA 5JEAG 2LGYA 3PUZA 4DV2L 3HIZA 4KSKC 1AEXA 3RPFC 3NUCA 3OJ4B 1H9JA 5C44G 2EXDA 3LGJA 4YWLA 3D8GA 3RZDB 2LJIA 4N8FA 4HSPA 5KIXA 3Q3NC 1IBML 3MAQA 2RDBC 5E6PA 4L5QA 4EGVA 2E5LQ 1SJED 3GTQH 4ZHOA 2XIWA 1K8RB 4DK6C 4RCNA 3WIMA 2FFKB 4A3IB 1Q81C 4B3SL 2HIXA 4DQOC 3RNFC 3KYCD 4AWJA 5CHVC 3HOVB 3ZO5B 3DPDA 2O6VD 5BYQA 3GQBA 2F4VL 1S3SG 2KDBA 4K14A 1GPXA 3ZGZA 3MC9A 3I5JC 4L6TB 2M00A 4OXPA 1Q1BA 3TQYA 1TJEA 2JEBI 3TCAA 4DFAA 5HURA 1KLVA 4MH8A 3NZSA 2Z0EB 1WE6A 5FJ8G 3PO2B 4HKZE 3ZTDA 3OMCA 3CKIB 4X62L 4A3BB 1K0SA 4HIDA 1QNUA 2B63B 4A3CG 1IYJB 1DYQA 1Y1VB 4GDKA 1TWAB 4QGUA 1STEA 1KIXA 4YT0B 4IOAA 4CHTB 1MKHA 2DYMA 4N6EB 3LYYA 2PNRC 3VDYA 3S2HB 4Y52H 5HHDG 1EIGA 1IBKQ 4P1BC 4OWWB 1HUNA 3J7A5 5FLMG 5GAEC 3W5VB 3Q8FA 2A74C 4Z9CB 4DHZB 2GI9A 3CCMA 1NBFC 1QNKA 4KIKA 1PTOH 2WXHA 2N7JA 1GVPA 2NBUA 4FF3A 1ZW7A 1YBYA 1LO5D 2KCNA 2JA5B 4JI2L 2C7HA 3DBSA 4OWXB 1F1HA 3AEGB 1U9RA 1IBXB 4MIUA 5KNCA 1JALA 2ZXOA 2JWUA 4N59A 2SNSA 1UE5A 2EOTA 4XT3B 2C7NB 1EQTA 4KMUC 4ZRZA 4V190 4JE3B 3T51B 3KH0A 4REZA 4JOIA 1MPEA 3OHXC 4MM3B 4W9JA 1TQOA 1TZOA 4R4IA 3V6CB 2JPHA 4C1NK 4BY7H 3A7AB 3HVZA 1EWIA 4B3TQ 4EKUA 3R2IA 1C9FA 5CBEE 5CR3A 5C3JB 2DNEA 2KHWB 3GDEA 2TMPA 2RQXA 1JE5A 3HG9A 4BBRG 3EFUA 3KW5B 1AN8A 4EQOA 2O2LD 3VH4B 1WTOA 1JICA 2F0JA 2LUMA 2R7FA 4US9A 2WLBA 2BBCA 3GTOH 1EOVA 3V96A 1N33Q 5M3MH 5H1SE 2JP1A 4GOPA 3QJZA 3VQIA 1XLNA 1LTLA 2WB1G 1NVID 1V9JA 5IKCM 3CC4A 4UP7A 3NSWA 3GTKB 1SIJA 4OVUA 3M4YA 2UXDL 2KYWA 4C3IB 2BS4B 2BS3B 1PVOA 2A6HC 3R7QA 2K5HA 4WORA 1A3VA 1KJTA 5JJKA 1VQ9A 1ENAA 3GV3A 1QT9A 2KAJA 1GOZA 3J81c 1KD1C 4JK1C 1GO3E 3IAYA 3EQLC 2GBJA 3ZNGC 2K5VA 3CCEA 3HS0C 5BMGA 3H7PA 2R7ZH 1G91A 3NXWA 2IHFA 3BVZA 3VR2A 4JI7Q 2RPQA 4NB3A 5BN4A 2VY3A 4HROA 3L3OC 3DWPA 2GBMA 1U5KA 4DR3Q 3PUVA 2UXCL 3A4SC 4JW0A 3CCUA 3CD6A 3GZNI 4LF5Q 4IFDJ 2IX1A 4BZAA 1MHWC 3MXPA 1QILA 1SE3A 3FC4A 3AYHB 4LK0M 4RM9A 4F7ZA 2ZNVB 1NMGA 4USAA 2WP8J 3PUYA 4G11A 4RAUC 2MW5A 4M0WB 2ATWA 1IBLL 2O6VB 4BOSC 5CV9A 1MJDA 4LAAA 2GB1A 2QEXA 1WMHB 3A9KB 2NBFA 4F7XA 2DZMA 3KVFB 3E9SA 4PS3A 4DV6Q 5EGTA 1V9PA 4M01A 3U7DA 5AUKA 1CZGA 3ZTCA 4B0EA 1F2RI 3DBHI 5BR8L 4GDLA 4FNFA 5D2MB 3E6ZX 1C1YB 4KGRA 2CWPA 5IWAQ 2K5PA 4JI5L 2IGHA 3TZDA 1K0RA 4C7ZA 2MJ8A 3NENA 4XXEA 2N1VA 2REXA 3ENEA 1N61A 1AW7A 5M3FH 4TMAB 1EU3A 4JGHB 3H7SA 4WWOA 3GB1A 3QARA 3MC0B 3APFA 4R8NA 2N9XA 1CSPA 1A70A 4DXAB 3ZJVA 2FAZA 2ASQA 2ZW1A 4DUZL 2QEJC 4KD4A 1PZKD 3KJOA 5C23A 4QJFA 4A3EH 1WSPA 4A3FG 5KHOA 4LUOA 2WAQE 2JUOA 4IPDA 2DHZA 4OEMB 3E0JA 2UXBL 2MBBB 1P1AA 1PYBA 5IOCA 3M62B 4HIKA 3RI7C 2Z59B 4GSWA 1SJHD 2PEAA 2DY8A 2PPBC 5JEAH 1LV9A 4E6IA 2G45B 4LDTD 1EYDA 5IT9L 2HDEA 3IHPC 1SSNA 1C3TA 2ZT9C 1II3A 4KJNA 1XNRQ 5C44H 4GKJL 4C2MB 1KM7A 5CV7A 5JJLA 2JSOA 3GS2A 3K5OA 1U4RA 4EFOA 1PGXA 3VHTC 4YSYB 2F0FA 3BS1A 1YX6B 4HPMB 4IPGA 1G2TA 2E76C 1PH7A 3TS2A 2VS1A 2NBVB 1JMCA 3R3MA 1Z5SB 2QDFA 1EQVA 3FKIB 1YJ1A 1XLQA 2B29A 1XNQQ 4GLAC 1WZ0A 2BWFA 1RTNA 4IG7B 4NPSA 4A3KG 4FHJA 3CCLA 1S72A 3B6YA 2B63H 1MHHE 2K14A 3HOXG 2UU9Q 4MGIE 3HVDA 1TWAH 3I7FA 3TZUA 1EFID 3OYYA 3I4MH 1L5PA 4OZBA 2B2TA 2YEPB 4TSSA 4JI6Q 1B9MA 1N34Q 3I63C 1I4QA 4H7BA 2M17A 4BBNF 4A3CH 1EU4A 4OL7A 3CP0A 2CQAA 3CCJA 4P73A 4LJZC 2VRRB 1JQYD 4H13C 2EYJA 4WAFA 3OLMD 5KEEA 4FHKA 5I6YA 1DZ1A 2LXKA 2MUYA 1PZID 5FLMH 2K22A 2KMAA 1Q1EA 1JWMD 1A3TA 2Q2UA 2K25A 2JA9A 5I2XA 3T8MA 5IGGA 2WFWA 1HQRD 3R3OA 5HKHA 2NR2A 2IHEA 2IZVB 1F9PA 2QJLA 2B3AA 3QIJA 1QOHA 2XRSD 3H3VH 1HRJA 5GXGB 2N9LA 2PW5A 3R93A 2NN6H 3J80E 3QWNA 1K9MC 3OTOL 4JI0L 1WGGA 3JAML 5M5YH 1FJGL 3AEAB 3EROA 2JQRB 2BPSA 1C48A 5IAAC 1TWGH 4G4KA 2V9HA 2DAFA 1PMRA 1V43A 1X3QA 4RA8A 1X3GA 3MXGA 2V4DA 3VTUA 4BBRH 3Q8BA 2WAQB 4K2LA 2HD5B 2XTIA 1TKWB 3ALBA 3SD5A 4AYBB 2C60A 4WIPA 2UUAL 1XMQL 2WXIA 1DOKA 4A3JG 2G5DA 1PDXA 2Q5WD 2UU7A 4XYCA 2V1CC 4CJ2C 1WR6E 1T9HA 2D0OA 1JOQA 3LJ3A 1PH3A 1GUAB 4WJQA 1EOTA 4FF2A 1HUMA 2NZ1D 4A93G 4X66L 1N32L 5IGEA 1Y8PB 2FIFA 1OO9B 2HDMA 2IO2B 3T16A 4POGA 4BBSB 4O1NA 2ZXRA 5C4XG 2EKEC 5E4WC 1E10A 1CUKA 3SK6A 3PGZA 2KQ4X 4C7YA 4IUPA 3TREA 4DR4Q 3KYDD 2OTJA 1Q12A 2ZTEA 4APVA 1SNPA 2LASA 5EPKA 1EUVB 1OXUA 1W3SA 2NZHA 3QJYA 1TBEA 3S24A 1B1ZA 2KK8A 4IUVA 3SHQA 1CA5A 3HEJA 4MNOA 4JWSC 4IKGA 4J8QA 5LMNL 1EYCA 2MGSA 3GTMH 2DLBA 2KMCA 4J6IA 4IZ8A 2EYOA 4OVZA 4KVGB 1ZE3D 3VUXA 1SMYC 4EEWA 4UDUC 1EIHA 1WGRA 3RYTA 1L2FA 1ZGUB 2CQOA 2QMTA 2KLGA 1S5CD 3KUDB 3P4QB 1YMHE 2ZTDA 3AFPA 1ESFA 2M19A 4RF0A 1DM0B 5FO9B 2YEPF 3ZKJC 1JRPA 3UI2A 1AYFA 3D31A 4CKBA 2BH8A 2JA7H 4R4TA 1LM0A 1C8CA 1DOMA 5D3IB 5LMNW 3M3YB 3P7JA 3KF8A 2JYEA 2ACZB 2L32A 3MA2B 4DV1L 2HTME 1CA6A 2KNBA 5LLIA 3T1YL 3K59A 1K73C 2X6GA 4RHRA 1VQHA 3RUZA 2CJOA 3TL5A 2PPHA 1NTGA 1PA6A 5ISRA 3DEPA 3DLLA 1KRTA 1OXVA 2BF8B 2FJ2A 1PFBA 3ZNHB 1I5FA 2B76B 2AX5A 2EY1A 3DBLB 5G55A 4RHSA 2PZTA 2LRUA 3PGEA 4G7HC 1DONA 4ZDVA 1E3PA 3M4PA 4FJZA 2VB3X 3EUB2 1EYAA 3CXCA 3T3NA 1O7LA 2X69A 3JVZX 4ZK9B 3LX0A 1A3UA 3MEFA 2JA6G 4M8MA 3W5OA 2KFKB 5GMVA 4KHZA 3VRAB 3VYTA 4QQBX 4GU2A 5TR5A 2WACA 5AJ3Q 4JV5L 4M0WA 3FHWA 4L5SA 1WTWA 4BY1G 3NK9A 1G8ZD 2N49A 1BCPD 1WFYA 1BNZA 4N8X1 3SK8A 5EE9A 1X32A 5IGDA 1EY7A 4P7IA 4RF1A 1MVKA 3QR8A 1TS3A 1F0ZA 4YWKA 3J7AF 1S5BD 2SNMA 2Z6KC 3DXJC 4OHJA 4CDFC 5A35A 1UWVA 2LRWA 4B9XA 4KKSA 4XYQA 2E2IB 1WXVA 4F1SA 1VDZA 2Q2IA 2W9NA 5KYIA 1NNXA 1PTOD 3OMGA 3K57A 1D4BA 1EFWA 4U68A 3IG3A 4HPLB 5GAGC 3FAHA 1UZXB 3J80i 1UBQA 4LF4L 1STGA 1A2TA 2MPMA 4IN3A 2A73B 2EJGC 1U4AA 4IW0A 3HOXH 4PT5A 3MEHA 1W6JA 3ERQA 1HA6A 2B2WA 4HCPB 3ZYYX 4JI1L 1PRTD 3J81L 2EMTA 1SF0A 2PW7A 4MGYE 1RLFA 1ET9A 3OAWA 5LHY1 2INPE 1HH2P 4E71A 2R2QA 1HNWQ 1A15A 1BF4A 3GOEA 3I90A 4P72A 1E1OA 1O7YA 4FVMA 3SE0A 2KJ6A 1GNUA 3NZUA 1N36Q 3I4NG 1FCLA 2WGSA 1H9SB 4N9TA 3CCQA 1V1PB 5EKKA 1SFOB 1TVXA 2WV6D 2JVCA 4HPPA 1SNDA 1NI3A 3A8JE 5IP7G 3OWEB 3NTIA 3PRMB 1JOOA 2BTEA 3QX1A 4YHHQ 1YQ4B 4LUZA 1RWSA 5JXVA 3EFCA 5EAYA 2K8CA 1W6KA 1I4HA 3T4AC 2YLMA 3DHGC 1RD9D 4UP9A 3E3XA 1DXMA 1XPUA 3PCOB 3L4PA 3UI3A 4IWPA 3OOCA 1ESRA 3W5UB 1P0RA 4LNQA 2FE8A 2MX2A 5BMIA 2D2QA 2KHIA 3ONSA 1NCVA 3N1YC 1D8LA 3GTQB 4CHKA 3BZCA 3GTJH 1ENFA 2AWTA 4WJPA 3GTPH 4ASWC 5JZEB 4LLGM 5IA7A 1GUOA 5KRUA 1OEYJ 1PUTA 1Y1WH 2BB5A 2QHOA 4A76A 1TT5B 1I6VC 2PKOA 1LXDA 3VR3A 4QL5A 3K7AH 4A93H 3APCA 4ARIA 1QJOA 1WTHA 2Z1CA 3ZJYC 1YJWA 1WD0A 2PIAA 2PVOD 2XK5B 3C2PA 1WTQA 4QB4A 4BKTA 2GA4B 3L2PA 1XD3B 2MHJA 2ZPNA 2CHZA 5HGQA 2LFNA 2EXZA 3KLWA 5C4HA 1Y8NB 1GJZA 2JRHA 1TWHH 2BWES 3ONAB 3VAWA 3I73A 4JVZA 4JI4L 4DHJB 2KCMA 1BCPB 2KECA 1PH2A 1FFVA 3L16A 2K0PA 5EBCA 1SYBA 5JVG3 3CCRA 5FO7B 4A3GH 2AL6A 3IAS1 3CU7A 4W9IA 1B7YB 2B2UC 5E1FA 5JVH3 4EUTA 1F9RA 1I50H 2NVYH 2D07B 5C1ZA 1V80A 4QUFA 4FLHA 1OQRA 1WMHA 2R6GA 1GM5A 3A8IE 2A6ED 1WH3A 2JT4B 3A9KA 1P16A 1FR3A 3W1GA 2EJMA 1PTOB 2WXOA 4G0NB 5EKLA 1YNND 2B2WC 4CDCC 1RCVD 2E3TA 3RLNA 3PMFA 4U673 1EY8A 3AFQA 4ZYNA 2JJQA 2WINB 1LT3D 1UE7A 1C0AA 3DOWA 1D1KA 1RFAA 5D3DA 3EECA 1KDBA 3H6MA 2KVMA 3F8TA 3JC66 1PV4A 1HNXQ 4FXCA 1L1OB 1OXXK 2KJXA 1STBA 4GN4B 2AL3A 3RN9C 2Y0SB 1CMXB 1PRTB 3TP8A 3QK0A 3TEWA 3R8BA 2ZJQA 2RR9A 4BY7B 4Y7NH 4CKCA 4TKOB 3PIPA 4PYZA 4XWTA 2IO0B 3MFYA 5IYDG 3ZQ4A 2GVBA 1IYFA 1FEHA 4HSVA 2K6DB 4ACFA 4HCEA 3KLSA 3U30A 1DGJA 1TIFA 3OW7A 1MI2A 3X3MA 2WKDA 2IT1A 3GTOB 2B2YA 2N55A 4GS3A 1ZXHA 3VRBB 5M3MB 4DWFA 2MBEA 1QVGA 1SBBB 1FD7D 3CRLC 4FULA 1AZQA 5ELOA 4JI3L 3PV1A 4DUYQ 2JA6H 5JAVA 4PS8A 1VQFA 4BA2I 2MRPA 4K8JA 4X65Q 1YI2A 2QC8A 1VQ7A 4KY5A 2NVTH 2WXPA 3KK7A 1X55A 1J8IA 1SLJA 1X1MA 3LWEA 1JMLA 3UQAA 3ZJUA 4RGNA 1H8CA 3GTLH 1SB3C 3U7ZA 2VUMG 2J0KA 2R7ZB 1T0YA 1IGDA 2NVXB 4MELA 2GOWA 2J52A 2F52A 1F9JA 2KFJA 3H91A 1IXRA 3K5LA 1PFNA 3ZXVA 2E2HH 1VS0A 4EZLA 1QE6A 5CV6A 1V86A 4NJ6A 3BIID 1LYLA 3AQQA 2K50A 2Z0DB 1XT9B 5C4JH 4MJSB 3Q3FA 3T9LA 4KSLC 2A19A 1MG8A 5JH5C 1R4NB 1LT4D 4P2CB 1YD8U 3QWZB 2Q8RE 4ANWA 1VQ5A 1BCPF 3STBC 2Y5BB 3BINA 3J81j 4IJHA 2RKSA 1FM0D 4A9AA 5EDSA 4OO1H 3M7GA 3HOUG 2MP1A 2CFMA 1YJNA 5IP9G 4OIKA 4YWGG 1FMAD 2NBWB 4PG3A 1AP0A 2JEAI 4PMBA 2C5CA 3J7YW 1TYGB 5EPJA 3KBGA 4C4VA 1MJCA 5IYBG 4ZLTF 4DV7L 1TKGA 4K81A 1SXTA 3AV8A 1CSQA 2QKIC 3AE4B 3HHMA 5E6OA 1FRDA 3KYHC 2K75A 2R92B 4HIOA 3M4OH 1I4GA 1O78A 2EY6A 5M3FB 4J6HA 2L0TA 3TEYA 1EWYC 2LZ6A 4RM8A 3U9OA 3MP9A 4B3MQ 4WQOB 5C5LA 3WAPA 1KL9A 1M8AA 1ZDVA 5GADC 4FADA 4GKKL 3Q24A 1KNEA 4ULLA 2XGTA 2CH4W 5ELFA 2WXQA 2WXGA 3JSVA 4HWIB 1RODA 3I3TB 4EQ5A 1I4RA 1B44D 1B9NA 5EQ0A 3F2BA 1O80A 5G5GA 2L52A 4A3EB 1MHXA 1QB5D 3NTHA 2R93B 5GROA 4KGTA 3AB9A 1ASZA 4US8A 2L11A 5JEAJ 1C4QA 4LFAL 4H0LC 1Q46A 1ZKOA 1V8QA 3S16H 4HVBA 5J18A 2Q8TA 1L0XB 5A2QE 3BYYB 3UGBB 1ZYRD 4K1RB 2WB1E 2PMZE 3V2TA 2V3SA 5C44B 5CBAE 5KGUA 2J42A 1WZ3A 1ROEA 4AQ7A 2KOLA 3W3AA 1G6JA 4X57B 2KDIA 3AI5A 4AP4C 1RDPD 3RNUA 1RAXA 1PFSA 3JW0X 3WOFA 2L00B 1QF6A 2HJ1A 4FXKC 4A3IG 2OQ0A 4QCLA 1TS2A 3LNNA 5I6WA 5BN3A 4OGQC 5BYSA 1PH5A 4S0RA 2P5ZX 1KC8C 1V97A 2IDYA 4DR1Q 4IUUA 2PCFB 1LTID 3CAMA 2K28A 3RN2A 4DR7L 3ZXRA 2QIEB 4KHPL 3NWSA 5GQOA 3EBEA 2JU6X 3QG1A 1D1IA 1Y8RC 1VQMA 4AH6A 1EQQA 3I4MB 4F88A 4FF4A 4WWNA 1X56A 1EY4A 1PLFA 1W2BA 2MO1A 3S17B 2F0EA 5AJ3L 1GD7A 4C3JH 2MNAA 1J7CA 2M1MA 3P63A 5HG2A 2R2OA 3SEBA 4WQMA 4XC2A 4PZ8A 1EWHA 4K5WA 3BY4B 3TSSA 3Q6SA 4A3BG 2F0LA 1MIUA 4K7SA 4YIJA 5BMHA 3HOYH 3DBRB 2ZM6Q 4I7AA 3A7LA 3S15H 2V1YA 4URKA 2RBMA 3PF4A 4DDID 4A3DH 3URYA 2K04A 3HOZG 1XJVA 1ICWA 1A8VA 1UGMA 3ITPA 4DK1A 5LMUL 2WU5B 4KDLB 5KNBA 2K8HA 5JHAA 1WGHA 2ENBA 4ME5A 2PE6B 2CW0D 2PI2E 1TWCH 1IHZA 2RHSB 5ELEA 4CJ1B 1SGHA 4ALPA 5J17A 4W9HA 1WYDA 2EVBA 4P74A 1J6QA 1EY6A 3BZDB 2BH2A 2EY5A 1RRBA 3HOWG 5M5YB 1R9TH 2PNHA 2K52A 2M2LA 3AEDB 3F2CA 2PTLA 3QOJA 1Q3LA 3H0GH 5I9OA 4DV5L 4NXMQ 2WXNA 3P4RB 4GIVA 2HJ8A 3DVNV 2JQOA 1TWGB 2AQ3B 3TP6A 2GRIA 1J7AA 2H88B 4UHVA 4FYDA 4PK1A 2WKCA 3WAMA 5IYDH 4KY6A 1YNXA 4BBRB 1FXAA 1BMLC 2LFIA 2K9XA 3IKJA 3W1SC 4DK3C 1WCMH 3HUIA 5JJZA 1HNWL 3OPOA 1WJNA 3FVQA 2EYLA 1S5DD 5C0XH 3U4EG 2EKIA 1H4RA 5G3LF 4GXBA 4B95A 2RMMA 3CCSA 1SRUA 4HRSA 4LNKA 3V62A 2ICEC 1H9MA 1E90A 1KAAA 1VF5C 2AQ1B 3UDGA 4A3MG 2KDEB 2KVZA 1T6BX 1SE4A 3GZNB 2NVXH 3MXUA 3ER0A 1N63A 5DPRA 2PJHA 1E1TA 3ZVVA 1UNSA 1L4ZB 1QZHA 2FCQA 3AE6B 3APDA 1I3QH 3PS6A 4PS7A 3KDFB 4RNAA 1Y8OB 5HFYA 2VUMH 4UAIA 2KHJA 1L2NA 2L55A 4K3CA 1E22A 4KHVA 4RGMA 1Q8IA 1X9NA 3Q14C 2DENB 1VQNA 2IJ0A 2HHHL 2UUBQ 4LF8Q 2EE1A 2LXCA 3GTMB 3DMUA 3S2DH 1XTCD 1Z47A 1HE8A 2F0WA 2LVOA 1X54A 2D3BA 3ZNID 1Z2MA 3H94A 2YTXA 2ZZPB 2Z4IA 2I1KA 2UWQA 1SIFA 2TSSA 4MZ9A 3DBHB 4JBJA 5KYLA 3SU8X 1NEKB 2OEOA 4NMZA 2OQKA 3PO3G 4TRDA 1QVFA 4DV3Q 2G9DA 1J19A 5FR3A 3A5ZB 4IFDG 3CMAA 1AWDA 2JA7B 4B6WA 1SYFA 3HOUH 2ES2A 5IP9H 4HK2A 2AKWB 1WE7A 2IWHA 4BXXG 1P7FA 2LGSA 3BYTB 3LWUA 2R92H 2ZCCA 4W9GA 3FP9A 2KCTA 5IYBH 3K0YA 2CR5A 2LWPA 1F77A 4DR5Q 1XMOQ 3BK2A 4AQYL 4K6DA 4I65A 1WTRA 4BVUC 4HJAA 4LW1A 2C7MB 2KMMA 3OIQA 4IFDI 1HA5A 5IGBA 1JROA 1V1PA 2YV5A 1F2ZA 4JI8L 4XQQA 4YY3Q 2A8VA 3FILA 1IW7C 4JOIC 3RMKC 3T1HQ 1WX7A 3BZKA 2DZIA 4LNNA 4W9FA 2BB6A 3RFZB 1Z9FA 2R93H 2HUGA 2A6HD 1I42A 5C3XA 2MLBA 1GUGA 3HKZE 1HR0L 3IFDA 2RSUA 4EE2A 1B3AA 1EQRA 3NELA 2E2JB 4TQ1A 4X64Q 1PGBA 2KTRA 1JOKA 2DBYA 4L5RC 2MEKA 3AE8B 3TEZA 1LTBD 2K05A 2EPBA 2W82A 2LHDA 3KBXA 1O7ZA 4H02A 4R9WA 4KGSA 1H9RA 4XGAB 4C3HG 4GOPC 1CKOA 1WXMA 1QUQB 3J80L 4LFBQ 3EGRA 4K3BA 2UYZB 4M8NA 3RNGC 4JYAL 4A20A 1XEEA 4GMVA 1UF0A 3KQ4A 3HM3A 2LGDA 2NPTB 1FO4A 1HR0W 2WXKA 4XX5A 3M9BA 2DGYA 3EIVA 3EN2A 2N9KA 4JBMA 1EEID 2L4NA 3Q2AC 1VMPA 5CX3A 5DM63 4M1UB 2FHTA 3U8ZA 2EIFA 1HQMC 2LS01 2VQFL 2XK5A 4M00A 1Q1OA 2LD9A 3TDQA 2JZ3B 3CC7A 1X3PA 2WYQA 3TEHB 2UUCQ 3BU2A 1MFWA 4LF9Q 3NBHB 1V81A 5T8IA 3NS1A 5FJ8H 2AMCB 2NB0A 1WTVA 3J9CA 4K7UA 2F0TA 3VDZA 2L9HA 3AEVA 3J7ZC 3S17H 1EWCA 2L05A 4NXNQ 1CKMA 5CHFA 2IX0A 3HOXB 1VQ4A 1I94Q 2LMCB 1RKNA 4IJLA 1IPGA 2Q2TA 2FINB 1GXDC 4CJ0B 3L08A 3A33B 2KQSA 4DV4L 3AEEB 1A2UA 4KI0A 3D4DA 2K32A 5H92C 4IUNA 2KBNA 4Q0FA 1E8YA 2M4NA 1NUCA 4JQWC 2RDGA 4NQLB 4G7ZC 1J5EQ 3JYUA 1VQ6A 1IW7D 1ZKHA 1Q0WB 4OELB 5JPMC 2MCNB 3HOZH 4WJWA 2IGGA 2B2VA 1L0YB 1FL0A 2ZXPA 5DM73 4DV0Q 4O0AA 1NYRA 3B9JA 2SOBA 2V4LA 3CHBD 1K53A 2BKFA 3HFZB 3QC8B 4WH4A 5E6JA 4RFBA 1KDAA 3A54A 1E2ZA 2QF7A 1L1OA 1PH8A 1WVLA 4GGQA 2I5MX 4WWPA 3CCVA 2ASBA 2B8GA 4FO2A 3DHIC 2O5JC 3HKZG 5CC4A 4PMCA 4DR6L 2GLSA 2PLPA 4S17A 4BFRA 3T3OA 3CC2A 2N3SA 2INCC 2VH2A 2PO4A 1B4OA 3R7RA 5DLQE 4YSXB 2YU9H 2RD0A 1XCTL 4GNXA 2EELA 1OXTA 2A69C 1A5RA 3R66C 1N8RC 3CPWA 3AE5B 2XEWA 2K1FA 3BJUA 1OTRB 1YJJA 2HQLA 2VQEL 1HTLD 4DDGD 3RD4A 1OQQA 2D62A 2N8NA 3GTJB 2I2YA 4ME3A 3O13A 3GTPB 3P4PB 2QA4A 1LTSD 2LGXA 2X8XX 2Y5CA 1GHKA 1Y1WB 2C5LC 2J4XA 5C2TB 2MSED 1AARA 2E75C 1VCIA 1YEZA 3K7AB 4RGTA 2JYTA 4A93B 1D5XC 3MTNB 5E4XA 3CW2C 4A3MH 2AYOB 3VUYA 4C80A 4K0KL 5C4XB 1ISNA 4ZRIA 1BBUA 2JA8G 3NHHA 4MHEA 5I4DA 2MBHA 5FO8B 4OX9Q 3AE3B 3KWLA 2HQEA 5IN7A 2OJRA 3I4LA 1WI5A 4MTKA 2W55A 4DU9A 1TWHB 2F0OA 1EY9A 4K5VA 3NTKA 3Q23A 2J7QB 4UPAA 3P2BA 3ULPA 4MTNA 4MJSA 5COYA 3UINB 1JJCB 1E7ZA 4EOYA 5HI1A 4HTHA 3AE9B 4HXDA 4A3PA 1H95A 4R4CA 2E5LL 5ELBA 1R4MI 3UIOB 4A3GB 2C35B
chains in the Genus database with same CATH topology
1LLRD 1UWMA 2B2TC 1I50B 2BDNA 2NVYB 5BN5A 1CI3M 1VR9A 1FNUA 4KKJA 3G7LA 2JXMB 4TQ0A 2K01A 3KWVA 2WDQB 1JCKB 3ND9A 1YJIA 1NSNS 1GUSA 1KH0A 4MACA 3S9WA 2MJDA 2PYKA 2X38A 1L0VB 4Y7NB 4PQXA 3AU7A 3A8KE 2MJEA 4RWSC 1N5XA 3G6JB 4KKUA 1E7PB 1R4PB 2WP9B 2JX5A 2BDOA 2NTSA 3BDCA 2KA7A 4L2YA 5CV4A 2JA6B 1L6UA 2A68C 2NVTB 2J53A 1KFYB 2D2CC 1WRIA 2KWDA 3V3XA 4XDDA 1JWBD 2OHFA 3GTLB 1SMYD 3VR5A 2CVRA 3VR9B 4I7ZC 2CJNA 2E2HB 1V1OA 3HZXA 1VZ8A 2QSDA 1JR0D 2WXLA 4MN3A 3L7ZC 1ZP0B 5C4JB 1F9QA 4CGYB 1E6EB 3FRPB 5HGTA 2SEBD 1LT6D 2Y5PA 5C5MA 4KK7A 5NUCA 3LXFA 1T5EA 1VZ6A 3VYSA 2K5WA 1QWYA 3HP3A 3DWMA 4BS9A 2PVGC 1K52A 2W3RA 1XLPA 4ZUJA 2L0CA 1TIID 3I91A 3M4OB 3NVVA 4L63B 5AFWA 2EZVA 1IBXA 4PMWA 4HR7B 3KLSX 2F0MA 4KN7C 1G2SA 1VZ7A 4GDLB 3I4NB 1SNOA 3Q8AA 1SNQA 1CQVA 1VLBA 3SVMA 2F0NA 2I46A 2RVLA 1BBXC 1RFKA 4G57A 1SEBD 2IL8A 4N58A 3S16B 3BVMA 4QUCA 2F0QA 2A5HA 2K3UA 3A55A 4WWMA 2BS2B 2V3NA 2G9HD 5CGKA 3TP5A 1FYCA 1FGBD 1HTPA 2KACA 1JORA 1JQ4A 2XRQD 3ND8A 2NUCA 3MWYW 4ZRPA 1CM9A 1GUTA 1AFPA 4C1NI 2IX3A 4L1BA 3IT4B 2VZKD 3U2SC 2PZUA 1EEFD 1MI0A 2QCPX 4X3KA 1ML0D 4DNRB 1RF2D 1GJXA 2CU3A 4C3JB 1N60A 3I8ZA 3T13A 3HOYB 5IIFA 3S15B 1HHVA 4A3DB 4F87A 4JX1C 3HRDD 2XWJB 1QKZA 1TWCB 3MJ5A 3C1EA 4OZAA 3I3CA 4KKTA 5G3LD 4RGOS 1XF5L 4L23A 1PGAA 4ZUIA 3CIRB 1HXYD 3AE7B 2K03A 1R9TB 2V0GA 1SYEA 1SNMA 1WGKA 3H0GB 4M8AA 1R7SA 2N88A 4ZRQA 2FMMA 1VDVA 1CHPD 1VRAB 1T5XD 5C0XJ 4ODGA 1WCMB 3AMUA 4XQJA 4LK1C 4XDCA 2BE5C 4RCOA 3U52E 3DUZA 4JPSA 2W3SA 3SR6A 3AE1B 2Y3AA 2E2DC 1DD2A 2DYOA 3NE5B 5EKIA 1I3QB 1TKEA 4XDXA 2VUMB 1UAPA 1ZEQX 1LTAD 5K5PA 5A2QL 1RTOA 3S2DB 1Z7TA 1U4LA 4DXGA 1L4DB 3U9SA 5C4ZA 3NBHA 2RPVA 1CK1A 1F9SA 1CFMA 2B8FA 4YTPB 4X3SA 1F2YA 1Q10A 4HN7A 1FIQA 4DGZA 1YNTE 2VZKB 2LMCA 4KJOA 4RH6A 3HOUB 1E2WA 1UUPA 3AH7A 1BO0A 3MHBA 3K6OA 1PFDA 3DM1A 4ZHPA 4K2KA 2RDFA 2ON8A 1XLOA 3IL8A 2R3ZA 5EE0A 2M0AA 4H2AA 4CQNA 1YN3A 1JB3A 1SYGA 5EPLA 3SFDB 4XE0A 3B2GA 4ARCA 4H44C 3HGBA 3R2TA 4DA2A 4L8JA 4KTAA 4HAEA 4YXDB 5JPNC 1UGJA 4C80A 1DOIA 2F0SA 1BDOA 4IQZA 1M4VA 1IYUA 3I72A 2B2YC 3BDOA 3OSOA 2SDFA 2KN4A 1ILPA 1WXQA 1MD2D 1PXUA 1KNAA 3HRZC 3NVWA 2L12A 5D14A 1C4CA 1YN4A 4X3UA 2HCCA 2XWBB 3C1FA 3D3RA 1P7EA 3IT6B 3P4SB 5AUIA 4JBWA 1VF7A 4DF7A 3IXSA 1GAQB 1B9RA 4NAMA 2K5QA 5LL6X 4JWUC 2LGIA 3SFEB 1TS4A 2LKVA 2F3WA 5G5HA 3AEBB 3NPPA 3J7AV 2NMQA 2KQ3A 1SSOA 5F2DA 2QILA 2L83A 4WFN3 1HEZE 3P20A 1GUNA 3HOZB 3AEFB 1I4PA 2BA1A 2J0TD 1KRHA 3FEWX 2F0PA 2BT6A 2WS3B 5EJWA 1JE4A 2X6LA 4NAWB 4HMIA 3HOWB 1IKMA 4NJCA 2M56B 1AZPA 4X3TA 2NN6G 3IAM1 5CV5A 2YU9B 4KX6B 1A6XA 3TN2A 2O5IC 1ZXTA 2VB2X 3RMHA 3M7NA 1J9OA 4KY7A 3NQIA 1KF6B 2PW9A 3K5NA 1HFNA 4QIWB 2WB1B 2PMZB 3GD7A 1JWAD 2OEDA 1ENCA 4RKBA 3PZ8A 2NN6I 2H4OA 2V3PA 2SAKA 4HEA1 4C3IG 4LTUA 3KUPA 4A3MB 1SAPA 1N5WA 1H9KA 3C3LA 3Q8EA 3NVZA 3T56B 1WWTA 4OIJA 2DY7A 1XYIA 2K7VA 5K36G 2IW3A 1BUIC 3K58A 5CMDA 5J39A 3LB8C 1PFMA 1G6ZA 1VMCA 3EVQA 4Q2JA 1RYJA 3WOEA 5EE3A 3VYRA 4P16A 3PO3B 5BYRA 3GTGB 1GUWA 3MFGA 1HZ6A 2DNCA 2LEKA 4P6VF 2Z4HA 3AB5A 4KD3A 2F3VA 4WRDA 2EYFA 1RM6C 2HDLA 3S1QB 1FD6A 5FKAC 2AUJD 2KDMA 1PYWD 4O42A 1FFUA 1D2BA 1NR2A 1DOYA 5DEHA 1H9SA 2JSVX 4EQPA 3NZ3A 4ZYSA 5TSSA 1UWXA 5IODA 2OXPA 1E0ZA 1C4PA 1YN5A 1J7BA 4A3FB 1V8CA 1ET6A 1HCZA 3VR6A 4DK0A 1TR5A 1QCBD 4K8IA 2WQYB 3X3NA 2K5DA 4HEDA 1STYA 2IPKD 5KNDA 4ZOHC 4C3HB 1KLUD 4AS1A 3S1RB 3AM9A 3C46A 2NYZD 1BXTA 3GP7A 1CT1D 1DOXA 3S1NB 5J1ZA 1SE2A 3A56A 2V4IB 1D6EC 3ABVB 2KHSA 3PIO3 4A3KB 4MT5A 4A55A 1JC7A 3BWUD 1TT2A 1JWSD 4FP5D 1D5ZC 4B0MA 3RLFA 1RJTA 1B2TA 5T1IA 4V0BA 2BOSA 1K51A 2L1BA 1XCQL 3CQZB 1ACCA 2FUG1 1C4AA 1Q90A 2ZW0A 3NRZA 3EA6A 3VA5A 2OF1A 2EJFC 1B50A 2EYHA 1BQQT 2E6XA 4KV6A 3BG3A 3NQTA 4YSZB 2F0GA 2EY2A 4S3SA 1K8OA 1D5MC 3PIP3 3AMZA 3ETRA 1OFFA 1TU2B 1HPCA 4CBVA 1TY2A 3K5MA 3OWFA 2BCOA 4HCSA 4ID6A 1NR4A 5IT9E 3SK5A 5FLXL 3HKZB 2F4IA 3E5SA 3TUOA 3VR8B 4IURA 2F0DA 2F0IA 5J22A 5M5XB 5M9OA 3FPUB 2WNMA 4A3JB 2M9VA 2L1AA 4XT1B 3N6RA 3VA7A 1CQFA 2KEDA 3TP7A 3NWTA 2RA4A 1FRRA 3RZOB 1U4PA 3DEOA 3M85A 1JW9D 2EDGA 1WYGA 3IAS1 4HMJA 1OXSC 1IGCA 5ELCA 1IKLA 2JA8B 4R8IA 1SNCA 3QB3A 2XNAC 2AQ2B 3W2DA 5K36H 3V05A 2Z8LA 1FCCC 2ONQA 1NENB 2RSOA 1BCPC 4CKEA 3SXHA 4GDKB 2EYMA 3I70A 5FLXE 4IFDH 1ONLA 2HCIA 4R3DA 2W54A 2K33A 4KN4C 5FK9C 2FMCA 1FNWA 3TMEA 1EY0A 3JAME 1E0BA 4N9PA 1QOGA 2WDRB 1KLGD 1XWEA 3S1MB 1PTOC 1GHJA 1WTPA 5JOBA 2A69D 2B39A 1LT5D 2B2VC 1Y56A 1BUVT 1YNJC 3BVGA 3SR1A 3TBIB 1L6VA 3I57A 4OZCA 2DWQA 1PRTC 2AWOA 2IGDA 2F03A 1QG7A 4B9WA 2JZPA 3QIAA 2YYZA 2L5TA 1QOBA 2F1MA 4KKIA 2K6AA 1KTKA 1FNVA 1XXGA 2I38A 4DNTB 3TEXA 3L9AX 5ELDA 2XVSA 1CJEA 1RHPA 1NAPA 2PQEA 5LNK1 1MGSA 4BY1B 1C79A 1EM7A 1F2MA 2D5DA 3S14B 1HZ5A 3I9V1 3EFXD 2H1EA 5I9PA 1N62A 2FBWB 1I7HA 4DAPA 1STAA 1CHQD 1DCZA 1IL8A 1K8MA 2MHVA 1TWFB 3H8HA 3DWAA 4NKLA 3P75A 1ZPSA 3MZ5A 2NVQB 5FOBB 1Y69U 4XIGS 4TQUS 1TY0A 4ZKBB 4DAVA 2WU2B 3GV6A 4ZQ3A 4BWGB 5EBDA 1IUEA 1Z6HA 2J7ZA 3W9CB 4IOIE 2MH7A 3MXNA 3F2UA 2B2UA 1CZWA 2NTTA 1GB4A 1YNJD 4OO1G 2KUMA 3QOLA 3OIPA 3ZJTA 1S5FD 2F0KA 1E9MA 1STNA 1U4MA 2KCCA 4HJGE 2C9OA 1LTGD 5C6AA 4WURA 4ZKCB 4ITKA 5IGCA 1XX8A 1B53A 2A68D 4FXGC 2CHBD 4OO1I 1NYQA 1UEAB 2JXTA 2A6EC 1EZ6A 1TS5A 3FILB 2F0UA 3PO0A 4J3OD 1YNNC 4A6QA 4D2KA 3FMCA 2QDBA 4RKLA 4HKQA 4IUQA 3D6CA 2KEEA 2NWGA 3EJIA 2G1EA 4YTMB 1MBYA 3KLRA 4QMGA 5EE1A 1JWUD 1DOLA 5MPOA 3D6WA 1E2VA 4IALA 1LTTD 5CYUA 1GB1A 3Q69A 5D7GA 2WXFA 4XYOA 3NUHB 2F0HA 3AECB 1EZ8A 3FPPA 2K1BA 3PZ7A 2RSNA 4K5XA 1MSGA 3J81E 2PMVA 2MJ3A 4OW0A 4XTCS 3D4RA 3PUXA 4NZLB 1QQRA 2VNUD 2R61A 2BA0A 5LL6S 5C3EB 1ZDXA 2LY7A 3GO5A 2VXWA 2O4XA 3T53B 2INNE 4NP5A 1SYDA 3Q22A 3NVYA 2WXMA 1I6HB 1R4QB 2H89B 3MHZA 4XWWA 4NDXA 3DWQA 4C3JG 3CRKC 2AWNA 4DAYA 1HFGA 4LMQD 5E3FA 3N9YC 1EY5A 3BDLA 3H09A 1PZJD 3PUWA 3B2FA 4YTNB 4XQNA 5CORA 1S5ED 4GLSC 1XO3A 3WDNA 1ILQA 3FDTA 4DN4M 1WTXA 2BYTA 3H3VC 1LACA 1ZOYB 1LABA 2I07B 2BW2A 4IDIA 2WDVB 5DNFA 1CTMA 1SDFA 1BR9A 2OT2A 1BOSA 5H8YE 1TKYA 3P42A 1QOFA 1ZUD2 3D4WA 3P1HA 4J1MA 3E56A 1WD1A 5CV8A 4DXFA 3PV0A 1C76A 2XSCA 4EVOA 2WIIB 5IGFA 1MSHA 3MTSA 3Q0AA 3DWGC 2LHEA 4GZYC 1DJRD 5C0XG 2F0VA 3VR4A 4A90A 4ZAIA 1SYCA 2XN9C 2JE6I 2AUKA 2N0SB 1T3QA 4EQNA 3NP8A 1F2LA 3SDZA 1ZYRC 3N52A 1I4XA 2D9UA 5C0XI 4Q5VA 2D5GA 2WXJA 2EYPA 3SK4A 1VJKA 4ILWA 4BA1I 1PDQA 2PZWA 1IYVA 3AN1A 3SHLA 4A8XC 1QLBB 5C3WA 3C8YA 1C78A 1QOAA 5D65A 1F2RC 2RDHA 3NBIA 4ABNA 2WXRA 5I2YA 4FXDA 3DHQA 1KDCA 3MVVA 4G7OC 4C56C 1LTRD 1KABA 3BK1A 2ID0A 3AE2B 3CWIA 4NW2A 1ZXIA 5M5WB 4PNYA 3QO2A 1S4ZA 1CZPA 4QF4A 1K50A 2JYOA 1FXIA 1G291 1K83B 1PTOF 2BE5D 2Q8IB 3Q8CA 2DN8A 1C77A 4K6LA 3VYUA 5DAUA 1YQ3B 4PV1C 2E74C 3IFTA 3WCQA 2ICIA 5T1GA 4B08A 4IUTA 1PRTF 4FF1A 2CW0C 1STHA 4F8MA 1EL0A 3W1SA 3P1MA 5JEAG 3PUZA 1AEXA 3RPFC 3NUCA 1H9JA 3RZDB 3D8GA 2LJIA 4HSPA 5KIXA 3MAQA 4EGVA 1SJED 4ZHOA 2XIWA 4RCNA 2FFKB 4A3IB 4DQOC 3HOVB 5BYQA 3GQBA 4K14A 1GPXA 3ZGZA 4L6TB 2M00A 1Q1BA 1TJEA 2JEBI 4DFAA 5HURA 4MH8A 3PO2B 4HKZE 3OMCA 3CKIB 4A3BB 1QNUA 2B63B 1DYQA 1Y1VB 1TWAB 1STEA 4YT0B 4CHTB 2DYMA 4N6EB 3LYYA 2PNRC 3S2HB 5HHDG 1EIGA 1HUNA 3W5VB 3Q8FA 2A74C 4Z9CB 2GI9A 1QNKA 1PTOH 2WXHA 2N7JA 4FF3A 1LO5D 2KCNA 2JA5B 3AEGB 1U9RA 1IBXB 4MIUA 5KNCA 1JALA 2ZXOA 2JWUA 4N59A 2SNSA 2EOTA 4XT3B 1EQTA 4KMUC 4ZRZA 4V190 4JE3B 3T51B 4REZA 1MPEA 3OHXC 4MM3B 1TQOA 1TZOA 4C1NK 3A7AB 3HVZA 3R2IA 1C9FA 5CBEE 5CR3A 5C3JB 2DNEA 2TMPA 2RQXA 3HG9A 1AN8A 4EQOA 2O2LD 1WTOA 1JICA 2F0JA 2LUMA 4US9A 2WLBA 2BBCA 3V96A 2JP1A 3VQIA 1XLNA 1NVID 3NSWA 3GTKB 1SIJA 3M4YA 4C3IB 2BS4B 2BS3B 2A6HC 4WORA 1A3VA 1QT9A 2KAJA 1ENAA 3GV3A 1GOZA 4JK1C 3IAYA 3EQLC 3HS0C 5BMGA 1G91A 3NXWA 3BVZA 3VR2A 5BN4A 4HROA 3L3OC 3DWPA 3PUVA 4IFDJ 2IX1A 3MXPA 1QILA 1SE3A 3FC4A 4LK0M 4USAA 2WP8J 3PUYA 4RAUC 5CV9A 4LAAA 2GB1A 2NBFA 4F7XA 3E9SA 5EGTA 5AUKA 1CZGA 4B0EA 1F2RI 4FNFA 3E6ZX 4KGRA 2K5PA 2IGHA 3TZDA 4C7ZA 2MJ8A 4XXEA 4TMAB 1N61A 1AW7A 1EU3A 3GB1A 3MC0B 4R8NA 1A70A 3ZJVA 2ZW1A 2QEJC 4KD4A 1PZKD 1WSPA 3E0JA 5IOCA 1SJHD 2DY8A 2PPBC 5JEAH 1LV9A 4E6IA 1EYDA 5IT9L 2HDEA 1SSNA 2ZT9C 1II3A 4KJNA 4C2MB 5CV7A 2JSOA 3GS2A 3K5OA 1U4RA 1PGXA 4YSYB 2F0FA 3BS1A 1G2TA 2E76C 1EQVA 3FKIB 1XLQA 1RTNA 1MHHE 3HVDA 3TZUA 1EFID 1L5PA 4OZBA 2B2TA 2YEPB 4TSSA 1B9MA 1I4QA 4H7BA 1EU4A 4OL7A 2CQAA 4LJZC 1JQYD 4H13C 2EYJA 4WAFA 5KEEA 5I6YA 1DZ1A 2MUYA 1PZID 2K22A 1Q1EA 1JWMD 1A3TA 5I2XA 5IGGA 3R3OA 1HQRD 1F9PA 2QJLA 1QOHA 2XRSD 1HRJA 5GXGB 2N9LA 3R93A 2PW5A 2NN6H 3J80E 3QWNA 3JAML 3AEAB 3EROA 2JQRB 1C48A 4G4KA 1PMRA 1V43A 1X3QA 4RA8A 3MXGA 2V4DA 3Q8BA 2WAQB 4K2LA 1TKWB 4AYBB 4WIPA 2WXIA 1DOKA 1PDXA 2Q5WD 4CJ2C 1JOQA 1EOTA 4FF2A 1HUMA 2NZ1D 5IGEA 1Y8PB 1OO9B 2HDMA 3T16A 4BBSB 1E10A 4O1NA 2ZXRA 5E4WC 3SK6A 2KQ4X 4C7YA 4IUPA 1Q12A 1SNPA 5EPKA 1OXUA 3QJYA 1B1ZA 4IUVA 1CA5A 3HEJA 4JWSC 4J8QA 1EYCA 2MGSA 2DLBA 4IZ8A 2EYOA 4OVZA 1ZE3D 1SMYC 4UDUC 1EIHA 2QMTA 1S5CD 3P4QB 1YMHE 1ESFA 2M19A 4RF0A 1DM0B 5FO9B 2YEPF 1JRPA 3UI2A 1AYFA 3D31A 4CKBA 1C8CA 1DOMA 5D3IB 3M3YB 3P7JA 3KF8A 2JYEA 2ACZB 2L32A 3MA2B 2HTME 1CA6A 3K59A 2X6GA 4RHRA 3RUZA 2CJOA 5ISRA 3DEPA 1OXVA 2FJ2A 1PFBA 2B76B 2AX5A 2EY1A 4RHSA 2PZTA 4G7HC 1DONA 2VB3X 3EUB2 1EYAA 3T3NA 1O7LA 2X69A 4ZK9B 3LX0A 1A3UA 4KHZA 3VRAB 3VYTA 2WACA 4M0WA 1WTWA 3NK9A 1G8ZD 1BCPD 1BNZA 3SK8A 5EE9A 1X32A 5IGDA 1EY7A 4RF1A 1MVKA 1TS3A 1F0ZA 3J7AF 1S5BD 2SNMA 3DXJC 4OHJA 5A35A 4B9XA 4KKSA 4XYQA 2E2IB 1VDZA 5KYIA 1PTOD 3OMGA 3K57A 1D4BA 4U68A 3FAHA 1STGA 1A2TA 2MPMA 4IN3A 2A73B 2EJGC 4PT5A 3MEHA 1W6JA 3ERQA 1HA6A 2B2WA 3ZYYX 1PRTD 3J81L 1SF0A 2PW7A 1ET9A 5LHY1 2INPE 1A15A 1BF4A 3I90A 1O7YA 4FVMA 3SE0A 1FCLA 1H9SB 4N9TA 1V1PB 5EKKA 1SFOB 1TVXA 2WV6D 1SNDA 1NI3A 3A8JE 3OWEB 3NTIA 2BTEA 1JOOA 1YQ4B 1RWSA 5JXVA 1W6KA 1I4HA 3T4AC 1RD9D 1DXMA 3L4PA 3UI3A 3OOCA 1ESRA 3W5UB 2FE8A 5BMIA 1NCVA 3GTQB 1ENFA 4LLGM 1GUOA 5KRUA 1PUTA 2BB5A 1I6VC 2PKOA 3VR3A 4ARIA 1QJOA 2Z1CA 1WD0A 2PIAA 2PVOD 3C2PA 1WTQA 4QB4A 2GA4B 2LFNA 2EXZA 5C4HA 1Y8NB 3ONAB 3I73A 1BCPB 2KECA 1FFVA 2K0PA 5EBCA 1SYBA 5JVG3 5FO7B 3CU7A 2B2UC 5E1FA 5JVH3 1F9RA 4QUFA 1OQRA 2R6GA 3A8IE 2A6ED 1FR3A 2WXOA 2EJMA 1PTOB 5EKLA 1YNND 2B2WC 1RCVD 2E3TA 3PMFA 4U673 1EY8A 2WINB 1LT3D 1D1KA 5D3DA 1KDBA 2KVMA 3H6MA 4FXCA 1OXXK 2KJXA 1STBA 2Y0SB 1PRTB 3TP8A 3TEWA 3R8BA 4BY7B 4CKCA 4TKOB 4XWTA 3MFYA 3ZQ4A 1FEHA 4HSVA 4HCEA 3KLSA 1DGJA 3OW7A 1MI2A 3X3MA 2WKDA 2IT1A 3GTOB 2B2YA 2N55A 1ZXHA 3VRBB 5M3MB 1SBBB 1FD7D 3CRLC 1AZQA 5JAVA 4BA2I 4K8JA 2WXPA 4KY5A 3KK7A 1J8IA 3LWEA 1JMLA 3ZJUA 4RGNA 1SB3C 3U7ZA 2R7ZB 1IGDA 2NVXB 2J52A 3H91A 3K5LA 1PFNA 1QE6A 5CV6A 3BIID 1LT4D 4P2CB 2Q8RE 1BCPF 2RKSA 1FM0D 4A9AA 4OO1H 3M7GA 2MP1A 4OIKA 4YWGG 1FMAD 1AP0A 2JEAI 4PMBA 2C5CA 3J7YW 1TYGB 5EPJA 3KBGA 4ZLTF 1TKGA 1SXTA 3AV8A 2QKIC 3AE4B 1FRDA 2R92B 1I4GA 1O78A 2EY6A 5M3FB 4J6HA 3TEYA 1EWYC 3U9OA 3MP9A 5C5LA 1M8AA 1ZDVA 3Q24A 1KNEA 4ULLA 5ELFA 2WXQA 2WXGA 4IKGA 1RODA 1I4RA 1B44D 1B9NA 5EQ0A 1O80A 5G5GA 2L52A 4A3EB 1MHXA 1QB5D 3NTHA 2R93B 4KGTA 3AB9A 4US8A 2L11A 5JEAJ 1C4QA 4H0LC 1ZKOA 1V8QA 2Q8TA 1L0XB 5A2QE 3BYYB 1ZYRD 3V2TA 5C44B 5CBAE 5KGUA 2J42A 1ROEA 4AQ7A 2KOLA 3W3AA 1RDPD 3WOFA 1QF6A 4FXKC 4QCLA 1TS2A 3LNNA 5I6WA 5BN3A 4OGQC 5BYSA 1V97A 2IDYA 4IUUA 2PCFB 1LTID 2K28A 2QIEB 3NWSA 2JU6X 3QG1A 1D1IA 3I4MB 4F88A 4FF4A 1EY4A 1PLFA 3S17B 2F0EA 5HG2A 1J7CA 3P63A 3SEBA 4WQMA 1EWHA 4K5WA 3TSSA 3Q6SA 2F0LA 4YIJA 5BMHA 3A7LA 2RBMA 3URYA 2K04A 1ICWA 2WU5B 3ITPA 4DK1A 5KNBA 2ENBA 4ME5A 2CW0D 5ELEA 1IHZA 4CJ1B 2EVBA 1EY6A 3BZDB 2EY5A 5M5YB 3AEDB 2M2LA 2PTLA 3QOJA 1Q3LA 5I9OA 2WXNA 3P4RB 1TWGB 2AQ3B 3TP6A 2GRIA 1J7AA 2H88B 4FYDA 2WKCA 4KY6A 4BBRB 1FXAA 1BMLC 2LFIA 2K9XA 3IKJA 3HUIA 5JJZA 3OPOA 3FVQA 2EYLA 1S5DD 5C0XH 3U4EG 2EKIA 5G3LF 2RMMA 4HRSA 2ICEC 1H9MA 1KAAA 1VF5C 2AQ1B 1T6BX 1SE4A 3MXUA 1N63A 1UNSA 1L4ZB 4RNAA 3AE6B 1Y8OB 5HFYA 4UAIA 2L55A 4KHVA 4RGMA 1Q8IA 2IJ0A 2EE1A 3GTMB 3DMUA 1XTCD 1Z47A 2F0WA 3H94A 2Z4IA 2TSSA 5KYLA 1NEKB 2OEOA 4NMZA 4TRDA 2G9DA 5FR3A 4IFDG 1AWDA 2JA7B 1SYFA 2IWHA 1P7FA 3BYTB 3LWUA 3K0YA 1F77A 3BK2A 4K6DA 4I65A 1WTRA 2KMMA 3OIQA 4IFDI 1HA5A 5IGBA 1JROA 1V1PA 1F2ZA 4XQQA 3FILA 1IW7C 3RFZB 2BB6A 2HUGA 2A6HD 5C3XA 1GUGA 3IFDA 4EE2A 1B3AA 4TQ1A 2E2JB 1PGBA 3TEZA 1JOKA 2DBYA 2MEKA 3AE8B 1LTBD 2K05A 2EPBA 2W82A 2LHDA 3KBXA 1O7ZA 4R9WA 4KGSA 1H9RA 4C3HG 3J80L 3EGRA 1XEEA 3KQ4A 1FO4A 2WXKA 2N9KA 1EEID 2L4NA 1VMPA 5DM63 4M1UB 2FHTA 1HQMC 2LS01 3TDQA 1X3PA 5T8IA 3NS1A 2NB0A 1WTVA 3J9CA 2F0TA 2L9HA 1EWCA 2IX0A 3HOXB 2LMCB 1RKNA 2FINB 1GXDC 4CJ0B 3AEEB 1A2UA 4KI0A 3D4DA 2K32A 5H92C 4IUNA 4Q0FA 1NUCA 2RDGA 4G7ZC 1IW7D 5JPMC 4WJWA 2IGGA 2B2VA 1L0YB 2ZXPA 5DM73 1NYRA 3B9JA 2SOBA 3CHBD 1K53A 4WH4A 5E6JA 4RFBA 1KDAA 3A54A