1WI0A

Solution structure of the pb1 domain of mouse mitogen activated protein kinase kinase 5 (map2k5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
GSSGSSGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen activated protein kinase kinase 5
publication title Solution structure of the PB1 domain of mouse mitogen activated protein kinase kinase 5 (MAP2K5)
rcsb
source organism Mus musculus
total genus 19
structure length 113
sequence length 113
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wi0A00
3QK0A 3PLUA 4XX5A 3IFWB 4E3CA 4DBGA 4NAWB 5JHAA 2L3ZA 1Z2MA 2V4LA 2KJHB 2M1MA 2Z0EB 5DPSA 3UGBB 4BKTA 1E8YA 4E71A 1WJUA 5C23A 4PS3A 2RD0A 4MEMA 2WDTB 2ZCBA 3AULA 3M95A 2DZIA 2N7EA 3A4RA 2O6VA 4W9FA 2LXCA 2HTHA 4HDQA 3WALA 4NQKE 4IG7B 5DCNA 3A9JA 1V49A 2BWFA 4DDID 1C1YB 2MBQA 2KC1A 5AEKB 3HM6X 5GMVA 2J0MA 5D2MB 2LRUA 1LXDA 2D2QA 4KZ0A 5J18A 2FIFA 1WF9A 4YL8A 4F1SA 4GU2A 2MCNB 4FJYA 2KFKA 4ZRJA 2CKHB 1WFYA 4ICVA 4DHJB 2JRHA 2BYVE 2JXXA 2KDBA 3NZUA 1E7VA 3HHMA 3KYCD 3I3TB 3ML8A 3PVLA 2O2VB 4DK5A 2KK8A 1E90A 3DVNV 1WJ6A 2BF8B 3L16A 4GOCA 4NJ6A 1GUAB 1WE6A 5BO4B 3VUWA 2MP2A 4G0NB 1F9JA 4HXDA 1RLFA 3DQVA 1EF5A 3A1QB 2KXJA 1YX5B 2DZKA 2KJ6A 3DBLI 4F8CB 1WR1A 4FJZA 1L7YA 3W1SA 3NOBA 3VXWA 1V2YA 3AU5A 3L0WB 1ZKHA 2K8HA 4K7WA 4MELA 4FADA 5KHQA 2G3QB 2PJHA 3R66C 3CSFA 4LCDE 4W9JA 1RAXA 2ZPNA 5CHFA 3KUCB 1H4RA 4ANXA 4NQLB 1XD3B 4GB9A 4B9KA 3JW0X 2JWZA 4I6PA 2NBWB 2KLGA 4FA6A 4DDGD 3MJWA 3IVFA 4HPMB 2KWUB 1OGWA 2FUHB 4BVUC 2MRPA 4HLEA 2CS4A 3ZKJC 2GBMA 3IG3A 4BFRA 4GN1A 3NHEB 2PPHA 2IY1B 3TL5A 1J0GA 5L95C 2D11A 4WJQA 1RFAA 1SGHA 1WIAA 1WGHA 2KVRA 2KHWB 4AP4C 2AL6A 1WXMA 2CHZA 2J0KA 5KHOA 1A5RA 2YVCA 4WWOA 4W9GA 1KLVA 5LXIB 4LDTB 2Z59B 5DPWA 1WY8A 3ZDMC 4EZLA 4ZDVA 1HE8A 3APFA 4J6IA 2CR5A 3PHXB 2FCQA 4MGIE 4IUMB 1WR6E 3LJ3A 2Z0DB 4BOSC 2KTRA 2NCNA 3A4SC 1ISNA 3EECA 3DOWA 1V80A 2DAJA 2MW5A 3M62B 4FN2A 4MJSA 3VUXA 2WYQA 5D7GA 2LXAA 1YJ1A 3PHWB 2B3AA 3ZLZA 2UYZB 3KUDB 4IC7B 3ZNID 5J2RA 3PPAA 4A20A 2DX5B 3PRMB 2K1FA 1RRBA 2NBUA 2KWCA 4KSKC 4MGYE 2EKEC 2ZEQA 3ZTDA 3DVGY 1JRUA 2KANA 4E74A 4EZKA 4W9CA 2KKCA 2L0FA 1UBQA 2G4SA 3PGEA 1WXVA 4JLCA 3ZVVA 1WM2A 4FULA 4DWFA 1QZEA 1X1MA 5JZEB 3PS6A 2DZJA 3QQ8B 3ZNGC 1C3TA 1WRDB 1WMHB 2KOXA 2YLMA 2ASQA 3X23A 4KV2A 2IYDB 2J7QB 2G4DB 4B6WA 3H1UA 3OJ3A 1LM8B 2N1WA 4WAAA 2K8BA 4DHZE 1WE7A 3JVZX 1R4MI 4OVVA 2A5UA 2CU1A 3RUIB 1P9DU 3U7DA 3VVWB 1E8XA 4GDLA 2DENB 2NBVB 4A3OA 2ZVOA 1IP9A 4K1RB 4NNJB 2LI5A 1VCBA 3RZWC 1WXAA 2L0TA 3WAPA 1WGDA 4CHKA 2XEWA 1NI2A 3L13A 1OTRB 3DVNU 2KZRA 2JRIB 2N7DA 3ENEA 1S1QB 2O6VB 3PLVA 5G2NA 2UWQA 2LWPA 4JQWC 1TBEA 4KDIC 1WGRA 4HK2A 3A9JB 4GIVA 3WIMA 3UIOB 1OQYA 1WX7A 4W9EA 3WANA 4NJ7A 1V9JA 1R4NI 2KC2A 1I35A 2GBJA 2DYMA 1UELA 3APDA 4PYUA 2KFKB 3BY4B 2C60A 2Y5BB 2L05A 4TQ1A 3PTFC 4EOYA 3N3KB 2LUEA 2ZJDA 1V81A 2J0JA 2W9NA 3WA0A 1WJNA 2KDIA 4KSLC 4OVUA 3HK0A 5JH5C 2AL3A 3VQIA 2DAFA 2MP2B 3L08A 3B0AA 4GMVA 2LGDA 1I42A 1YQBA 3EFUA 3RYTA 3S2AA 1WXSA 4GDKA 5L83A 1UH6A 4NPNA 3TCAA 1GC7A 3TBLD 2LD9A 3H7PA 3NS8A 2C7HA 4DHZB 2FAZA 3R3MA 1P1AA 4MH0E 4KIKA 3VH3B 3KYDD 3A9KA 4KZCA 2K8CA 1K8RB 2XBBC 3R7RA 2EMSA 3AI5A 4II2B 2MLBA 4K7SA 3QWZB 1Q0WB 4ANWA 2LZ6A 4IM2A 2BKRB 2C5LC 1OEYA 4MGZE 4AOFA 2JT4B 1VD2A 3UINB 1EF1A 2MBHA 4RMAA 4HPLB 3Q3FA 3L54A 1WYWB 3SU8X 3A33B 3KH0A 1EO6A 3DDCB 3LDZE 3L17A 2NS5A 2A4ZA 2WX0A 4P7IA 3CMMB 1GG3A 3QA8A 2NPTA 3OLMD 2I1KA 2DYOA 2MQJA 1WGYA 2N9XA 4MSMB 2MBEA 3QIJA 3RT3B 2DZMA 3WAOA 3ZRCA 2RPQA 3ZDTA 2BYFA 3HIZA 3PT2B 2LVQA 4FLHA 2MX2A 2KNBA 3HM3A 3T8MA 1NDDA 2KQSA 3PRPB 3VTUA 1WX8A 3H6NA 3H7SA 3T9LA 3JSVA 2L8JA 2KTRB 3AXCA 3PREA 1KOTA 3RCZA 3P2BA 4MJSB 5D94A 3SHQA 4CO7A 3UQBA 2N9EB 1H8CA 4ANVA 2KWVB 3V6CB 3RULA 2LGYA 2VRRB 1YD8U 2KN5A 3ONSA 5LLIA 2QHOA 4RM9A 2MWSB 5CTRC 4BKSD 4PS8A 4BBNF 4HDOA 3W1YA 1G6JA 4HCNB 4WQOB 1P3QU 2ZNVC 2NVUI 3ECIA 2V3SA 2GMIC 2WX1A 5G55A 1SIFA 2KX3A 4PYZA 2M8SA 2BYEA 1WZ0A 2M0XA 3SD5A 3KW5B 2L76A 2ZZPB 2M17A 3UIPB 4ZRKA 5E6OA 3OAWA 4WWPA 2OJRA 5IAAC 3VAWA 1WH3A 2RR9A 5CX3A 3PV1A 4K81A 2JZ3B 3KVFB 1UBIA 4FJVB 2KLCA 5DPRA 3ML9A 4F7ZA 1YIWA 4ANUA 1GJZA 1AARA 1P98A 1V5OA 3EHVA 3QARA 3ZNZB 4GDLB 4N9F4 2MBBB 2K39A 4K7UA 2FCNA 3QC8B 4DHJD 2XK5A 4ZYNA 2KJRA 2L00B 3N32A 4BKSA 4CYEA 3K9PB 1E8ZA 1V86A 3U8ZA 5AZGA 2GBKA 2IO0B 2KMAA 2KTFA 4NAWA 4M8NA 1Q5WB 4RM8A 4W9LA 4JL9A 3EC8A 3Q3JA 4ZRIA 3VHTC 1J8CA 1TGZB 2CHXA 3B1LX 4XZ4A 2N1VA 3QCAA 1V5TA 3QJZA 2WWZA 4JIOU 2NR2A 4G3XB 2AYOB 4HJKA 4WJPA 3RD2A 2ZPYA 2JY6A 2I1JA 2IO2B 3L10B 1Y8RC 5E6NA 1KJTA 4WJOA 2BPSA 1D3ZA 3WAMA 2N4FA 2FCSA 2K6QA 4W9IA 2L7RA 4LJOB 5D6JB 1TTNA 3M63B 2RGFA 5HKHA 4EZJA 2D10A 2ZVNA 4EKUA 3UQAA 2ZCCA 3V6EB 4WWNA 4ICUA 3VTVA 3X0WA 2MA9B 3RZFA 2JPHA 3N30A 3CSTA 2K25A 1LFDA 1NBFC 1ZW7A 2KQ7A 3V62A 1IPGA 3M3JA 3CF6E 2O2VA 3DBSA 1XT9B 1OEYJ 3TJPA 2AEHA 4XC2A 4FHJA 5C1ZA 4I6NB 2RSUA 1MG8A 1WX9A 4PS7A 2KFJA 2C7NB 3DBHI 2M4NA 3A1QA 5CHWA 4AUQC 3DVGX 2HD5B 1GC6A 2KDEB 4GDKB 4TUUA 3ZRFA 4AJWA 1P0RA 4AWJA 2DHZA 2IY0B 3QAQA 4DXAB 3GZNI 2IZVB 3H7PB 3AU4A 2KMCA 3NY5A 1WJ4A 3B08A 3K9OB 3PZDA 4KIKB 3O65B 3A9KB 5IA7A 4B95A 4IWQA 4LJPB 4BKGA 2D07B 3SDLC 4LDTD 2LVPA 4WJNA 3IBEA 4M0WB 3R7QA 2C7MB 3APCA 3MHSD 2GBNA 3W1SC 2PE6B 3VDZA 1PQSA 4EEWA 1FXTB 2R2OA 2JVCA 4NY0A 3ZTCA 4IWOA 2LVOA 2HJ8A 1UZXB 3NZSA 3VFKA 2FNJB 3ALBA 4II3B 1CMXB 1WGGA 2KDFB 3ZO5B 1U4AA 2GBRA 4BOZB 1M94A 1E7UA 2PEAA 2FIDA 5FR6A 4GSWA 1LQBA 1V6EA 2BWES 4W9DA 3MTNB 1SE9A 3JYUA 4TKNA 2NPTB 3V60A 3QX1A 3QHTA 4HCPB 3C0RB 2LASA 1T0YA 4G11A 2D3GA 2GOWA 4GXBA 1J19A 2MBOA 2KD0A 1ZGUB 2JUOA 3PSEB 2MSED 3VH4B 3H9DA 2JZZA 3V61A 2LJ5A 4KDLB 3TMPB 2BGFA 3ZNHB 4EUTA 2CHWA 4FHKA 3JSVB 1XQQA 2FCMA 5JHBA 2JF5A 2BKFA 1KM7A 2KO3A 3BINA 4MM3A 4W9KA 2K6DB 2HE7A 1E8WA 4IWPA 4GGQA 5EDSA 3DPDA 2KX0A 2R2QA 5AZHA 4HWIB 5AZFA 4IW0A 2PE9A 3PRZA 4MSQB 5CHVC 4JGHB 2AWTA 2LRWA 2OOBB 3ZW3A 5J17A 4URKA 1EUVB 3OJ4B 4MGKE 2V1YA 4IM3A 4TV3A 2ZNVB 1GNUA 1BT0A 4EFOA 4BBNC 1WZ3A 1WM3A 5LXHA 1E5WA 2IBIB 3KUZA 3VUYA 1UGMA 4X57B 2C9WB 5TR5A 4TQ0A 2N9PC 2O6VD 1S3SG 1Q1OA 3U30A 3TIXA 1IYFA 1YX6B 3DCGA 4G50A 2LGXA 3GOEA 2IO1B 4IM0A 4W9HA 4M8MA 4AJYB 3VTWA 1Z5SB 1WMHA 2DYBA 4ASWC 3ZIMA 3D32A 4KVGB 3UF8A 3IHPC 1UD7A 1L2NA 2EMTA 3DBRI 2REXA 5E6PA 4FBJB 4HVBA 4I6LB 1TZ1A 2G45B 1WI0A 2IO3B 3ZUNA 2XK5B 4A3PA 4MDKE 5DPTA
chains in the Genus database with same CATH superfamily
1I4PA 3QK0A 4XX5A 3NVWA 3IAM1 2KJHB 2M1MA 1PGBA 2LGSA 4PS3A 2N7EA 3A4RA 4IG7B 1R7SA 2WXQA 4DDID 1C1YB 1UGJA 1IBXB 2LRUA 3BWUD 1UWMA 3EUB2 2IGDA 4RGTA 4Q2JA 5HI1A 2KFKA 1WFYA 4ICVA 2W3RA 2JRHA 4YSZB 2BYVE 3KYCD 2O2VB 2WXKA 4DK5A 1C9FA 3AECB 1GUAB 1WE6A 3AEAB 3VUWA 4G0NB 1RLFA 2K22A 4XWTA 1YX5B 5AUKA 3BYYB 2K3UA 1QT9A 1WR1A 1D4BA 3H8HA 3FKYA 1L7YA 3W1SA 2DWQA 3AB5A 3VXWA 2K8HA 1WWTA 4YTMB 1OQRA 3IAS1 2CU3A 4W9JA 5CHFA 1H4RA 4A8XC 4ANXA 1XD3B 3N1XC 2JWZA 1R4MB 4BVUC 1I4RA 3AE5B 3ZKJC 2M19A 1TJEA 1IGDA 2N9KA 4L23A 3W5UB 2OEDA 1J0GA 5L95C 2D11A 4WJQA 1WIAA 2PKOA 3Q8FA 2KHWB 1I4GA 2J0KA 1KFYB 2YVCA 3Q8AA 2H89B 4M02A 4ZDVA 2Z0DB 4TMAB 3EECA 2K0PA 2MW5A 4MJSA 2WYQA 3B9JA 4YTPB 4J3OD 4USAA 4XE0A 2UYZB 4IC7B 2GI9A 4RGNA 2RMMA 4A20A 2DX5B 4OW0A 1L6VA 2NBUA 3HVDA 2EKEC 1SIJA 1JRUA 4EZKA 1XLQA 2WDQB 2KKCA 2L0FA 3RNAC 4DWFA 2XN9C 1TKEA 2LEKA 3ZNGC 1WMHB 2WXPA 4KGTA 3P4RB 4KV2A 2N1WA 4WAAA 3IT6B 4DHZE 4OVVA 1P9DU 1E8XA 2DENB 2NBVB 1IP9A 3KLSX 2L0TA 3RZWC 4CHKA 1N61A 3U7ZA 1LO5D 1OTRB 3T3OA 3DVNU 1ESFA 2O6VB 1CK1A 2LWPA 4ITKA 3A9JB 4ZOHC 3WIMA 1ZPSA 4EE2A 3UIOB 1E9MA 1OQYA 1V9JA 4C7ZA 1R4NI 1QQRA 2DYMA 2Y5BB 2L05A 4S0RA 2ZJDA 1L4DB 1V81A 1C78A 2MH7A 3WA0A 1WJNA 1TKGA 1CZPA 2ZW0A 2LGDA 1C4PA 2WU2B 4NPNA 3TCAA 3N1YC 1KF6B 3TBLD 2LD9A 4DHZB 5JXVA 3VH3B 3KYDD 1QOBA 3A9KA 1K8RB 2XBBC 2MLBA 5IP4D 4ANWA 2LZ6A 3URYA 4YXDB 3Q3OC 2LUMA 1JWMD 4HPLB 1WYWB 4FXCA 5EE3A 3SU8X 2JWUA 1MJDA 2NS5A 3TUOA 1ET6A 2WX0A 4P7IA 1GG3A 2KMMA 3QA8A 4M00A 2I1KA 2D3AA 2DYOA 2MQJA 2LGIA 2N9XA 3ZRCA 2LFIA 3ZDTA 3PT2B 2KNBA 5FR3A 1WX8A 3AXCA 3PREA 3P2BA 3AH7A 5D94A 1EU4A 1J7CA 3UQBA 2AQ2B 2KWVB 1N60A 5MPOA 1EWCA 2PIAA 4RM9A 2WXJA 2RDHA 5TSSA 4PS8A 4HDOA 1N5WA 2PLPA 3ECIA 2GMIC 2KX3A 3UIPB 2L76A 4YSXB 5E6OA 2OJRA 1XF5L 4K81A 4HKQA 1ET9A 4FJVB 5DPRA 2I2YA 3FAHA 1GJZA 1AARA 1P98A 3QARA 4GDLB 4N9F4 2YEPB 3BYTB 3Q8BA 3QC8B 2KJRA 4BKSA 4CYEA 3K9PB 1HA5A 1YQ3B 2GBKA 4M8NA 4JL9A 3VHTC 3ZGZA 1TGZB 2NR2A 2AYOB 3RD2A 3W5VB 2JY6A 2I1JA 2WHIA 1Y8RC 4WJOA 2J52A 1JWUD 1IBXA 1PYWD 2L7RA 2QMTA 4RH6A 1TTNA 1YMHE 4EKUA 3X0WA 2SEBD 2MA9B 3RZFA 2JPHA 3N30A 3CSTA 3B2GA 1ZW7A 2KQ7A 5BYRA 3CF6E 1VRAB 2O2VA 1XT9B 1OEYJ 3HVZA 4R3DA 4A6QA 4XC2A 2RSUA 2KACA 1WX9A 3DBHI 2M4NA 5CHWA 3DVGX 2KDEB 1P0RA 5T8IA 2DHZA 3QAQA 1HZ5A 1HQRD 2IZVB 3NY5A 4HKZE 3K9OB 4DQOC 3O65B 1T0QC 4LNKA 3Q8EA 3IBEA 2C7MB 2QC8A 1PQSA 1A70A 1FXTB 2R2OA 1IUEA 4ZRQA 2FNJB 1NYRA 4II3B 2KDFB 1U4AA 3VRAB 2Q5WD 3AE9B 4BOZB 2FUG1 1JALA 1SF0A 4LNNA 1L0VB 3MFGA 2NPTB 2L52A 4L2YA 3C0RB 2D3GA 2GOWA 2QCZA 2JUOA 5BMGA 2XNAC 3V61A 3TMPB 3EFCA 2CHWA 4KGRA 2JF5A 1KRHA 1RYJA 2HE7A 4GGQA 5EDSA 2KX0A 2KN4A 5AZHA 3J9CA 4IW0A 2KDMA 3GE3C 2PE9A 4MSQB 1ZOYB 2AWTA 2LRWA 1E6EB 5J17A 3FC4A 2J42A 3Q69A 1GNUA 2G9HD 2NTSA 1WM3A 3KUZA 3AEBB 2C9WB 3NRZA 2N9PC 1S3SG 4IOIE 2M56B 4G50A 1T3QA 1SJED 4W9HA 4AJYB 4C7YA 3LXFA 1WMHA 2DYBA 3IHPC 1UD7A 4N6EB 2W54A 2EMTA 3DBRI 4HVBA 4YSYB 5IOIA 3EGRA 4E3CA 3IFWB 4NAWB 2L3ZA 2V4LA 5DPSA 3UGBB 4BKTA 4E71A 1E8YA 1L4ZB 1FXIA 2DZIA 1N62A 2O6VA 2LXCA 3WALA 1QLBB 3A9JA 3Q6BA 1XXGA 2KC1A 2BQQA 5AEKB 3KQ4A 5J18A 3HRDD 4FJYA 1OQQA 2CKHB 4ZRJA 1UNSA 3P4PB 3W2DA 4REZA 2JXXA 2KDBA 3NZUA 3HHMA 2OHFA 3E56A 3I3TB 5EE9A 3PVLA 2KK8A 1E90A 1WJ6A 2EELA 4HXDA 3DQVA 3TEYA 1J7AA 4MH8A 3GE8C 2DZKA 3I63C 4FJZA 4AS1A 1QKZA 5KHQA 2G3QB 4B0EA 3R66C 3CSFA 3UI3A 1RAXA 2ZPNA 3BVGA 3WCQA 3JW0X 2NBWB 2W3SA 4DDGD 2Y5PA 4HPMB 3AEGB 2GBMA 4BFRA 4GN1A 2PPHA 2IY1B 3TL5A 2LHEA 4L1BA 3SEBA 2W55A 1SGHA 5KHOA 2CHZA 1VR9A 1CQVA 3P63A 5LXIB 2Z59B 1WY8A 4EZLA 1HE8A 2CR5A 3PHXB 2FCQA 4MGIE 4IUMB 1WR6E 2BTEA 1RM6C 3DOWA 1V80A 2DAJA 3M62B 3LB8C 1E10A 2GLSA 2BB6A 1SB3C 2LXAA 1YJ1A 1GB1A 1MHXA 2IJ0A 1YQ4B 1YN3A 3ZTDA 4YWGG 4QAYA 2KANA 1JQ4A 2D3CA 1WXVA 1I4HA 4JLCA 1X1MA 2KVZA 3AE3B 1C3TA 3RPFC 3FILB 2YLMA 2KOXA 1XLNA 1NI3A 3OJ3A 1LM8B 3JVZX 1R4MI 2CU1A 3AE1B 4GDLA 2ZVOA 4K1RB 2HDEA 4IDIA 1WGDA 2HJ1A 3ENEA 5G2NA 1HXYD 2E6XA 1WX7A 4W9EA 3WANA 3R2IA 1K51A 1SE4A 1I35A 2GBJA 1UELA 3APDA 4PYUA 2PVOD 4C80A 4EOYA 4DXFA 3ZJTA 2W9NA 2WDRB 4OVUA 4PT5A 2AL3A 3ZXVA 3VQIA 2DAFA 3L08A 3ZJUA 1I42A 1MPEA 1YQBA 3RYTA 3S2AA 5L83A 1UH6A 1HZ6A 4KKIA 2C7HA 4A90A 3R3MA 3AEFB 4KZCA 3BK2A 3R7RA 1OEYA 4MGZE 2PTLA 4OZBA 3U52E 2JT4B 1XLOA 4ARIA 1VD2A 2MBHA 4A55A 3Q3FA 1F77A 3A33B 3KH0A 3P42A 3LDZE 1ZE3D 1K50A 3CMMB 2NPTA 4P1BC 1WGYA 4MSMB 2WU5B 3NZ3A 3HIZA 1NDDA 3H7SA 1WSPA 1KOTA 3RCZA 4CO7A 2N9EB 4N58A 2VRRB 3ONSA 5LLIA 1WRIA 5CTRC 4BBNF 1PGXA 4HJGE 3W1YA 4HCNB 2AQ3B 4WQOB 5EE0A 2V3SA 2WX1A 3MC0B 3GZNB 1CJEA 2M0XA 3NVYA 2ZZPB 3AE8B 1NVID 5IAAC 1WH3A 1D5XC 3U2SC 1UBIA 4RFBA 3W9CB 4YT0B 1YIWA 2QIEB 4ACFA 2MBBB 2FCNA 4DHJD 4ZYNA 3N32A 1E8ZA 4TSSA 5AZGA 2IO0B 4NAWA 4B0MA 4RM8A 4W9LA 4ZRIA 3P1MA 1L0YB 1V5TA 3QJZA 4G3XB 1M4VA 1PFDA 4HJKA 3ABVB 1ZXHA 2ZPYA 2LJIA 4K3BA 2IO2B 4RNAA 5E6NA 3WAMA 2N4FA 2RGFA 2M0AA 2Y3AA 2K25A 4XDCA 1LFDA 1NBFC 2CJNA 5H92C 1IPGA 1VDVA 1C77A 2VZKD 3DBSA 2AEHA 1C4CA 2IGGA 4N59A 4PS7A 2BB5A 1BMLC 4RGMA 4TUUA 2HD5B 1GC6A 3ZRFA 5JZEB 4AWJA 4DXAB 2BS4B 1FNUA 3AU4A 1DGJA 1WJ4A 1TS4A 1V97A 4KIKB 2MJDA 4AQ7A 5IA7A 4B95A 4IWQA 2KT7A 4BKGA 2D07B 2AX5A 1ZXIA 2LVPA 3MHSD 4EEWA 2K5PA 4NY0A 4IWOA 4IKGA 1UZXB 3NVZA 3NZSA 1CMXB 3ZO5B 1T6BX 1M94A 2PEAA 5FR6A 3RN9C 4W9DA 3MTNB 3JYUA 3RNGC 4HCPB 3QHTA 4G11A 4GXBA 1J19A 2BBCA 3GS2A 2KD0A 4ARCA 3PSEB 2LJ5A 4XYCA 1XQQA 2FCMA 2BKFA 1E7PB 1KM7A 3BINA 4W9KA 2K6DB 1E8WA 2N9LA 3AE7B 4IWPA 1QF6A 1C76A 4KX6B 5CHVC 4JGHB 5BMHA 2OOBB 3RMKC 1HTQA 4ZYSA 3R8BA 1EUVB 2HTME 3OJ4B 2V1YA 1FXAA 2ZNVB 3BVZA 4BBNC 4HROA 2G1EA 5AUIA 1UGMA 5TR5A 4TQ0A 3MC9A 1Q1OA 3TIXA 1IYFA 3DCGA 2DLBA 1RWSA 1N5XA 3FILA 3ETRA 4KVGB 4JWUC 4US9A 2YEPF 5E6PA 4FBJB 2G45B 3VRBB 1WI0A 1NYQA 4A3PA 1WXQA 3PLUA 1Z2MA 1VZ6A 3AE6B 5C23A 3CIRB 3Q14C 2RD0A 4MEMA 2WDTB 2ZCBA 3AULA 1JCKB 3M95A 4W9FA 4HDQA 2HTHA 4ZRPA 4XWWA 1V49A 4RCOA 3TEWA 1NEKB 2MBQA 1FPYA 2J0MA 5D2MB 1LXDA 2D2QA 4KZ0A 1B9RA 2D3BA 1GPXA 4DHJB 5G5GA 5BYSA 1F0ZA 5HG2A 3ML8A 3DVNV 2QILA 3L16A 4GOCA 4NJ6A 5BO4B 3RNFC 1F9JA 1T0SC 1ZP0B 1EF5A 1ZUD2 3A1QB 2KXJA 3DBLI 2WXMA 3NOBA 2BW2A 1L0XB 1ZKHA 4K7WA 2KYWA 4MELA 4FADA 2WXHA 2PJHA 5EE1A 4WH4A 3MP9A 1KH0A 4B9KA 2VZKB 4I6PA 1TY0A 4FA6A 3IVFA 2KWUB 1OGWA 4HLEA 4ZHOA 3NHEB 1RFAA 2AL6A 1SSNA 1WXMA 4OVZA 4YTNB 1MI0A 5D3DA 3ZDMC 3L4PA 4J6IA 1IGCA 2V3NA 3O13A 4MM3B 1ISNA 2QDFA 2TSSA 3P4QB 5D7GA 4C4VB 3PHWB 3ZLZA 5HFYA 3ZNID 3RNBC 3PPAA 5J2RA 1FMAD 3C19A 2K1FA 1SBBB 5H8YE 2KWCA 4KSKC 4MGYE 3DBLB 2ZEQA 3DWMA 3DVGY 4C56C 4GLSC 4NAMA 4W9CA 2G4SA 3PGEA 1K52A 4FULA 2QSDA 3TEXA 3NG0A 3PS6A 4MT5A 3RI7C 2ICIA 2E3TA 1N63A 3Q3MC 4H2AA 2J7QB 2G4DB 4B6WA 1UF0A 1WE7A 2A5UA 4JWSC 3VVWB 4A3OA 4NNJB 3OWEB 2XEWA 1NI2A 3L13A 2X8XX 2N7DA 3PLVA 2UWQA 4JQWC 5IN7A 1WGRA 4GIVA 4JE3B 4NJ7A 3AEEB 1LGRA 4HEA1 2Y5CA 3BY4B 1FRRA 2C60A 4TQ1A 3PTFC 3N3KB 2LUEA 2J0JA 4KSLC 5JH5C 1TIFA 1P7FA 1JMLA 3T3NA 2MP2B 4GMVA 4BZAA 1T0RC 2WQYB 5LNK1 1V8CA 1WYGA 3EFUA 1WXSA 1GB4A 1FCLA 1KLUD 1AW7A 1Q10A 1P1AA 4KIKA 1TS2A 2K8CA 2EMSA 3AI5A 4K7SA 4IM2A 2C5LC 3V05A 1XO3A 1JWBD 4AOFA 1FIQA 1EF1A 3R2TA 3NJTA 3TEZA 1T5XD 2IPKD 3SFEB 2L83A 1EO6A 3DDCB 1FFUA 1TZOA 3Q8CA 2JYEA 2MBEA 3TSSA 3RT3B 2DZMA 3BVMA 2BYFA 1DOIA 2LVQA 4MACA 2MX2A 3HM3A 3VTUA 3T9LA 3MHZA 2MJEA 2L8JA 2KTRB 4JPSA 1XEEA 3SHQA 3V6CB 3RULA 3DHHC 2LGYA 1I4XA 1UUPA 1D5ZC 2V0GA 2EKIA 5G55A 3SFDB 4PYZA 1WZ0A 3SD5A 1Y56A 4ZRKA 2RR9A 2H88B 3PV1A 2JZ3B 1VJKA 2KLCA 1EU3A 4F7ZA 4ANUA 3Q2AC 1FFVA 2L32A 1V5OA 2NTTA 3P4SB 2WXFA 4K7UA 1V86A 4LTUA 2WXLA 2KMAA 1YOVB 1J8CA 2CHXA 3B1LX 4XZ4A 2N1VA 3QCAA 3AE4B 1GAQB 1V1PB 3RNCC 2BPSA 3AN1A 4W9IA 2K6QA 4RGOS 1C4AA 4LJOB 5D6JB 3M63B 1YJIA 4LNOA 2ONQA 4EZJA 2ZVNA 2ZCCA 4WWNA 1GOZA 3VTVA 4S17A 1DOXA 3V62A 4A9AA 2FE8A 3TJPA 2RDGA 3KWLA 4FHJA 5C1ZA 2WGSA 4I6NB 2C7NB 1VZ8A 2V9HA 3A1QA 1STEA 2WXGA 4AUQC 4GDKB 5IO9A 5IKCM 1QILA 3GZNI 3H7PB 2KMCA 5BYQA 3PZDA 1EM7A 4LDTD 4WJNA 3PZ8A 4M0WB 3R7QA 1SXTA 3APCA 2GRIA 2GBNA 4JX1C 3NVVA 2JVCA 3ZTCA 3VFKA 5G5HA 3N20C 1E7UA 4GSWA 2BWES 2BT6A 3I57A 4WAFA 1J7BA 2V4IB 1XCQL 4TKNA 3QX1A 2LASA 1T0YA 1ZGUB 3H9DA 4KDLB 3ZNHB 4FHKA 3JSVB 3IT4B 5JHBA 2KO3A 4MM3A 3N9YC 1TY2A 1D6EC 3DPDA 2R2QA 3PO0A 4C4VA 3ZW3A 4URKA 3ZJVA 2Z8LA 4MGKE 1MG4A 3RFZB 2BS2B 4IM3A 4TV3A 1BT0A 5LXHA 1E5WA 2IBIB 4X57B 1I4QA 1FRDA 4WIPA 3U30A 2IO1B 4IM0A 1E0ZA 3VTWA 4D2KA 4ASWC 3D32A 5FK9C 1L2NA 2CJOA 2KWDA 3B2FA 1TZ1A 2MJ3A 2I38A 2IO3B 2WDVB 3ZUNA 2XK5B 2JZPA 3AV8A 2N0SB 4MDKE 5DPTA 1ENFA 4DBGA 5JHAA 2Z0EB 1QOGA 1WJUA 1TT5B 1V1OA 3BZDB 1FEHA 2VH2A 4NQKE 5DCNA 3OG5A 2BWFA 3HM6X 5GMVA 1L5PA 2FIFA 1WF9A 4YL8A 4F1SA 1JWAD 4GU2A 2MCNB 4CQNA 1FNWA 3I5JC 2UU7A 1E7VA 4NZLB 2B76B 1QOFA 1JW9D 3VR8B 3CWIA 2BF8B 3DWGC 2MP2A 4HRSA 2PVGC 2KJ6A 1K53A 3Q3NC 2JSVX 4F8CB 4C00A 1C79A 1V2YA 3AU5A 3L0WB 4US8A 4HPPA 2BVCA 3ZQ4A 2RPVA 4LCDE 2BS3B 3KUCB 1XLPA 4NQLB 1SE2A 4GB9A 2KLGA 3MJWA 2WXRA 2FUHB 5GXGB 1F2RI 2MRPA 2CS4A 3IG3A 1SJHD 1WGKA 2QJLA 1WGHA 2KVRA 4AP4C 2PMVA 1A5RA 2X38A 4WWOA 4W9GA 1KLVA 4LDTB 1FO4A 5DPWA 4RF1A 1KLGD 5HHDG 3APFA 1R4NB 3NS1A 3LJ3A 4BOSC 2KTRA 2NCNA 3A4SC 2JXTA 3MJ5A 3BK1A 4FN2A 3VUXA 2J53A 4KKJA 1PGAA 2B3AA 1P7EA 1MFWA 3KUDB 2ON8A 2ZW1A 3E9SA 3HUIA 3PRMB 1PUTA 1FM0D 1RRBA 4E74A 1UBQA 3ZVVA 1WM2A 2JYTA 1QZEA 2DZJA 3QQ8B 1WRDB 4DXGA 2ASQA 3X23A 1B1ZA 2K9XA 2MHJA 2IYDB 3H1UA 2IGHA 2K8BA 3RUIB 3U7DA 2LI5A 1VCBA 1WXAA 3WAPA 4BAXA 3IXSA 4OHJA 2INNE 2KZRA 1NENB 2JRIB 2GB1A 1S1QB 2WS3B 1TBEA 4KDIC 4OZCA 4HK2A 4LK0M 3LYYA 1V1PA 1SEBD 3SR6A 1N6ZA 2KC2A 1MHHE 2KFKB 3GP7A 1TS5A 2KDIA 3HK0A 1AN8A 4O1NA 1DOYA 1F52A 2RDBC 3B0AA 2V3PA 5I4DA 2IDYA 4GDKA 2JX5A 2MEKA 4WURA 4UDUC 1GC7A 5D3IB 3H7PA 3NS8A 2FAZA 4MH0E 1BUIC 4II2B 1AYFA 1F1HA 3QWZB 1Q0WB 2NMQA 4M0WA 4RF0A 1HEZE 2BKRB 3NUHB 1XCTL 4PK1A 1ROEA 3UINB 4RMAA 3L54A 3RNEC 2DBYA 3DHGC 4K3CA 1TS3A 3L17A 2A4ZA 1OFFA 3OLMD 1DYQA 4XDDA 1UWXA 3QIJA 3ZXRA 3WAOA 2RPQA 4FLHA 3T8MA 2KQSA 3PRPB 4LNFA 3H6NA 3JSVA 4MJSB 4ZHPA 1BXTA 1H8CA 4ANVA 3GB1A 5C2TB 1ACCA 1YD8U 2KN5A 1HTOA 5FKAC 2QHOA 2MWSB 5E6JA 4BKSD 1G6JA 2W82A 3DBHB 1YN4A 2QEJC 1P3QU 2ZNVC 2INPE 2NVUI 1SIFA 2M8SA 2BYEA 4LLGM 1ZDVA 2INDC 3KW5B 2M17A 3OAWA 4WWPA 1FNVA 3VAWA 1QOAA 2AQ1B 5CX3A 3KVFB 3ML9A 4P16A 3AEDB 1KTKA 2LMCA 2L1AA 1YNTE 3ZNZB 1YJJA 3EHVA 2K39A 3DHIC 3I9V1 2XK5A 2L00B 2PW9A 3U4EG 1VZ7A 3U8ZA 1F2RC 2KTFA 1Q5WB 3PZ7A 3EC8A 3Q3JA 2ACZB 1FD6A 2J4XA 1I7HA 2WLBA 2WWZA 4JIOU 4WJPA 2KQ4X 3L10B 4P6VF 1KJTA 1D3ZA 3V3XA 2WXNA 3AE2B 2FCSA 2D5GA 2R61A 2BYTA 5HKHA 2KAJA 2D10A 3UQAA 2DNFA 1JROA 1MVKA 3V6EB 4ICUA 3M3JA 3BIID 3N1ZC 4WWMA 1SE3A 3AMZA 1JWSD 1MG8A 2KFJA 2LHDA 4AJWA 2IY0B 1FCCC 3B08A 4LNIA 3A9KB 1JRPA 3VR9B 4LJPB 4P1CC 3SDLC 4WQMA 3W1SC 2PE6B 3VDZA 1RFKA 2LVOA 2HJ8A 4OZAA 3ALBA 1AWDA 3MC8A 1WGGA 3DBRB 2N7JA 2GBRA 2WXIA 2SAKA 2WXOA 3C8YA 2INCC 2FIDA 2WP9B 1LQBA 1V6EA 2WNMA 2FBWB 1SE9A 3V60A 2OJWA 4KGSA 2MBOA 1VLBA 5BMIA 1EWYC 3VH4B 2MSED 2JZZA 1TKYA 2BGFA 3KWVA 4EUTA 1YN5A 3ZYYX 5C3JB 4HWIB 5AZFA 3EA6A 3PRZA 2JU6X 4NJCA 4XGAB 2JQRB 4EFOA 1WZ3A 3VUYA 1L6UA 2O6VD 1TYGB 1YX6B 1ZDXA 2LGXA 3GOEA 2VH1A 1PDXA 4M8MA 1Z5SB 3ZIMA 3AM9A 3UF8A 2REXA 4I6LB 4M01A 1D5MC
chains in the Genus database with same CATH topology
3QK0A 3PLUA 4XX5A 3IFWB 4E3CA 4DBGA 4NAWB 5JHAA 2L3ZA 1Z2MA 2V4LA 2KJHB 2M1MA 2Z0EB 5DPSA 3UGBB 4BKTA 1E8YA 4E71A 1WJUA 5C23A 4PS3A 2RD0A 4MEMA 2WDTB 2ZCBA 3AULA 3M95A 2DZIA 2N7EA 3A4RA 2O6VA 4W9FA 2LXCA 2HTHA 4HDQA 3WALA 4NQKE 4IG7B 5DCNA 3A9JA 1V49A 2BWFA 4DDID 1C1YB 2MBQA 2KC1A 5AEKB 3HM6X 5GMVA 2J0MA 5D2MB 2LRUA 1LXDA 2D2QA 4KZ0A 5J18A 2FIFA 1WF9A 4YL8A 4F1SA 4GU2A 2MCNB 4FJYA 2KFKA 4ZRJA 2CKHB 1WFYA 4ICVA 4DHJB 2JRHA 2BYVE 2JXXA 2KDBA 3NZUA 1E7VA 3HHMA 3KYCD 3I3TB 3ML8A 3PVLA 2O2VB 4DK5A 2KK8A 1E90A 3DVNV 1WJ6A 2BF8B 3L16A 4GOCA 4NJ6A 1GUAB 1WE6A 5BO4B 3VUWA 2MP2A 4G0NB 1F9JA 4HXDA 1RLFA 3DQVA 1EF5A 3A1QB 2KXJA 1YX5B 2DZKA 2KJ6A 3DBLI 4F8CB 1WR1A 4FJZA 1L7YA 3W1SA 3NOBA 3VXWA 1V2YA 3AU5A 3L0WB 1ZKHA 2K8HA 4K7WA 4MELA 4FADA 5KHQA 2G3QB 2PJHA 3R66C 3CSFA 4LCDE 4W9JA 1RAXA 2ZPNA 5CHFA 3KUCB 1H4RA 4ANXA 4NQLB 1XD3B 4GB9A 4B9KA 3JW0X 2JWZA 4I6PA 2NBWB 2KLGA 4FA6A 4DDGD 3MJWA 3IVFA 4HPMB 2KWUB 1OGWA 2FUHB 4BVUC 2MRPA 4HLEA 2CS4A 3ZKJC 2GBMA 3IG3A 4BFRA 4GN1A 3NHEB 2PPHA 2IY1B 3TL5A 1J0GA 5L95C 2D11A 4WJQA 1RFAA 1SGHA 1WIAA 1WGHA 2KVRA 2KHWB 4AP4C 2AL6A 1WXMA 2CHZA 2J0KA 5KHOA 1A5RA 2YVCA 4WWOA 4W9GA 1KLVA 5LXIB 4LDTB 2Z59B 5DPWA 1WY8A 3ZDMC 4EZLA 4ZDVA 1HE8A 3APFA 4J6IA 2CR5A 3PHXB 2FCQA 4MGIE 4IUMB 1WR6E 3LJ3A 2Z0DB 4BOSC 2KTRA 2NCNA 3A4SC 1ISNA 3EECA 3DOWA 1V80A 2DAJA 2MW5A 3M62B 4FN2A 4MJSA 3VUXA 2WYQA 5D7GA 2LXAA 1YJ1A 3PHWB 2B3AA 3ZLZA 2UYZB 3KUDB 4IC7B 3ZNID 5J2RA 3PPAA 4A20A 2DX5B 3PRMB 2K1FA 1RRBA 2NBUA 2KWCA 4KSKC 4MGYE 2EKEC 2ZEQA 3ZTDA 3DVGY 1JRUA 2KANA 4E74A 4EZKA 4W9CA 2KKCA 2L0FA 1UBQA 2G4SA 3PGEA 1WXVA 4JLCA 3ZVVA 1WM2A 4FULA 4DWFA 1QZEA 1X1MA 5JZEB 3PS6A 2DZJA 3QQ8B 3ZNGC 1C3TA 1WRDB 1WMHB 2KOXA 2YLMA 2ASQA 3X23A 4KV2A 2IYDB 2J7QB 2G4DB 4B6WA 3H1UA 3OJ3A 1LM8B 2N1WA 4WAAA 2K8BA 4DHZE 1WE7A 3JVZX 1R4MI 4OVVA 2A5UA 2CU1A 3RUIB 1P9DU 3U7DA 3VVWB 1E8XA 4GDLA 2DENB 2NBVB 4A3OA 2ZVOA 1IP9A 4K1RB 4NNJB 2LI5A 1VCBA 3RZWC 1WXAA 2L0TA 3WAPA 1WGDA 4CHKA 2XEWA 1NI2A 3L13A 1OTRB 3DVNU 2KZRA 2JRIB 2N7DA 3ENEA 1S1QB 2O6VB 3PLVA 5G2NA 2UWQA 2LWPA 4JQWC 1TBEA 4KDIC 1WGRA 4HK2A 3A9JB 4GIVA 3WIMA 3UIOB 1OQYA 1WX7A 4W9EA 3WANA 4NJ7A 1V9JA 1R4NI 2KC2A 1I35A 2GBJA 2DYMA 1UELA 3APDA 4PYUA 2KFKB 3BY4B 2C60A 2Y5BB 2L05A 4TQ1A 3PTFC 4EOYA 3N3KB 2LUEA 2ZJDA 1V81A 2J0JA 2W9NA 3WA0A 1WJNA 2KDIA 4KSLC 4OVUA 3HK0A 5JH5C 2AL3A 3VQIA 2DAFA 2MP2B 3L08A 3B0AA 4GMVA 2LGDA 1I42A 1YQBA 3EFUA 3RYTA 3S2AA 1WXSA 4GDKA 5L83A 1UH6A 4NPNA 3TCAA 1GC7A 3TBLD 2LD9A 3H7PA 3NS8A 2C7HA 4DHZB 2FAZA 3R3MA 1P1AA 4MH0E 4KIKA 3VH3B 3KYDD 3A9KA 4KZCA 2K8CA 1K8RB 2XBBC 3R7RA 2EMSA 3AI5A 4II2B 2MLBA 4K7SA 3QWZB 1Q0WB 4ANWA 2LZ6A 4IM2A 2BKRB 2C5LC 1OEYA 4MGZE 4AOFA 2JT4B 1VD2A 3UINB 1EF1A 2MBHA 4RMAA 4HPLB 3Q3FA 3L54A 1WYWB 3SU8X 3A33B 3KH0A 1EO6A 3DDCB 3LDZE 3L17A 2NS5A 2A4ZA 2WX0A 4P7IA 3CMMB 1GG3A 3QA8A 2NPTA 3OLMD 2I1KA 2DYOA 2MQJA 1WGYA 2N9XA 4MSMB 2MBEA 3QIJA 3RT3B 2DZMA 3WAOA 3ZRCA 2RPQA 3ZDTA 2BYFA 3HIZA 3PT2B 2LVQA 4FLHA 2MX2A 2KNBA 3HM3A 3T8MA 1NDDA 2KQSA 3PRPB 3VTUA 1WX8A 3H6NA 3H7SA 3T9LA 3JSVA 2L8JA 2KTRB 3AXCA 3PREA 1KOTA 3RCZA 3P2BA 4MJSB 5D94A 3SHQA 4CO7A 3UQBA 2N9EB 1H8CA 4ANVA 2KWVB 3V6CB 3RULA 2LGYA 2VRRB 1YD8U 2KN5A 3ONSA 5LLIA 2QHOA 4RM9A 2MWSB 5CTRC 4BKSD 4PS8A 4BBNF 4HDOA 3W1YA 1G6JA 4HCNB 4WQOB 1P3QU 2ZNVC 2NVUI 3ECIA 2V3SA 2GMIC 2WX1A 5G55A 1SIFA 2KX3A 4PYZA 2M8SA 2BYEA 1WZ0A 2M0XA 3SD5A 3KW5B 2L76A 2ZZPB 2M17A 3UIPB 4ZRKA 5E6OA 3OAWA 4WWPA 2OJRA 5IAAC 3VAWA 1WH3A 2RR9A 5CX3A 3PV1A 4K81A 2JZ3B 3KVFB 1UBIA 4FJVB 2KLCA 5DPRA 3ML9A 4F7ZA 1YIWA 4ANUA 1GJZA 1AARA 1P98A 1V5OA 3EHVA 3QARA 3ZNZB 4GDLB 4N9F4 2MBBB 2K39A 4K7UA 2FCNA 3QC8B 4DHJD 2XK5A 4ZYNA 2KJRA 2L00B 3N32A 4BKSA 4CYEA 3K9PB 1E8ZA 1V86A 3U8ZA 5AZGA 2GBKA 2IO0B 2KMAA 2KTFA 4NAWA 4M8NA 1Q5WB 4RM8A 4W9LA 4JL9A 3EC8A 3Q3JA 4ZRIA 3VHTC 1J8CA 1TGZB 2CHXA 3B1LX 4XZ4A 2N1VA 3QCAA 1V5TA 3QJZA 2WWZA 4JIOU 2NR2A 4G3XB 2AYOB 4HJKA 4WJPA 3RD2A 2ZPYA 2JY6A 2I1JA 2IO2B 3L10B 1Y8RC 5E6NA 1KJTA 4WJOA 2BPSA 1D3ZA 3WAMA 2N4FA 2FCSA 2K6QA 4W9IA 2L7RA 4LJOB 5D6JB 1TTNA 3M63B 2RGFA 5HKHA 4EZJA 2D10A 2ZVNA 4EKUA 3UQAA 2ZCCA 3V6EB 4WWNA 4ICUA 3VTVA 3X0WA 2MA9B 3RZFA 2JPHA 3N30A 3CSTA 2K25A 1LFDA 1NBFC 1ZW7A 2KQ7A 3V62A 1IPGA 3M3JA 3CF6E 2O2VA 3DBSA 1XT9B 1OEYJ 3TJPA 2AEHA 4XC2A 4FHJA 5C1ZA 4I6NB 2RSUA 1MG8A 1WX9A 4PS7A 2KFJA 2C7NB 3DBHI 2M4NA 3A1QA 5CHWA 4AUQC 3DVGX 2HD5B 1GC6A 2KDEB 4GDKB 4TUUA 3ZRFA 4AJWA 1P0RA 4AWJA 2DHZA 2IY0B 3QAQA 4DXAB 3GZNI 2IZVB 3H7PB 3AU4A 2KMCA 3NY5A 1WJ4A 3B08A 3K9OB 3PZDA 4KIKB 3O65B 3A9KB 5IA7A 4B95A 4IWQA 4LJPB 4BKGA 2D07B 3SDLC 4LDTD 2LVPA 4WJNA 3IBEA 4M0WB 3R7QA 2C7MB 3APCA 3MHSD 2GBNA 3W1SC 2PE6B 3VDZA 1PQSA 4EEWA 1FXTB 2R2OA 2JVCA 4NY0A 3ZTCA 4IWOA 2LVOA 2HJ8A 1UZXB 3NZSA 3VFKA 2FNJB 3ALBA 4II3B 1CMXB 1WGGA 2KDFB 3ZO5B 1U4AA 2GBRA 4BOZB 1M94A 1E7UA 2PEAA 2FIDA 5FR6A 4GSWA 1LQBA 1V6EA 2BWES 4W9DA 3MTNB 1SE9A 3JYUA 4TKNA 2NPTB 3V60A 3QX1A 3QHTA 4HCPB 3C0RB 2LASA 1T0YA 4G11A 2D3GA 2GOWA 4GXBA 1J19A 2MBOA 2KD0A 1ZGUB 2JUOA 3PSEB 2MSED 3VH4B 3H9DA 2JZZA 3V61A 2LJ5A 4KDLB 3TMPB 2BGFA 3ZNHB 4EUTA 2CHWA 4FHKA 3JSVB 1XQQA 2FCMA 5JHBA 2JF5A 2BKFA 1KM7A 2KO3A 3BINA 4MM3A 4W9KA 2K6DB 2HE7A 1E8WA 4IWPA 4GGQA 5EDSA 3DPDA 2KX0A 2R2QA 5AZHA 4HWIB 5AZFA 4IW0A 2PE9A 3PRZA 4MSQB 5CHVC 4JGHB 2AWTA 2LRWA 2OOBB 3ZW3A 5J17A 4URKA 1EUVB 3OJ4B 4MGKE 2V1YA 4IM3A 4TV3A 2ZNVB 1GNUA 1BT0A 4EFOA 4BBNC 1WZ3A 1WM3A 5LXHA 1E5WA 2IBIB 3KUZA 3VUYA 1UGMA 4X57B 2C9WB 5TR5A 4TQ0A 2N9PC 2O6VD 1S3SG 1Q1OA 3U30A 3TIXA 1IYFA 1YX6B 3DCGA 4G50A 2LGXA 3GOEA 2IO1B 4IM0A 4W9HA 4M8MA 4AJYB 3VTWA 1Z5SB 1WMHA 2DYBA 4ASWC 3ZIMA 3D32A 4KVGB 3UF8A 3IHPC 1UD7A 1L2NA 2EMTA 3DBRI 2REXA 5E6PA 4FBJB 4HVBA 4I6LB 1TZ1A 2G45B 1WI0A 2IO3B 3ZUNA 2XK5B 4A3PA 4MDKE 5DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK0 A;  3PLU A;  4XX5 A;  3IFW B;  4E3C A;  4DBG A;  4NAW B;  5JHA A;  2L3Z A;  1Z2M A;  2V4L A;  2KJH B;  2M1M A;  2Z0E B;  5DPS A;  3UGB B;  4BKT A;  1E8Y A;  4E71 A;  1WJU A;  5C23 A;  4PS3 A;  2RD0 A;  4MEM A;  2WDT B;  2ZCB A;  3AUL A;  3M95 A;  2DZI A;  2N7E A;  3A4R A;  2O6V A;  4W9F A;  2LXC A;  2HTH A;  4HDQ A;  3WAL A;  4NQK E;  4IG7 B;  5DCN A;  3A9J A;  1V49 A;  2BWF A;  4DDI D;  1C1Y B;  2MBQ A;  2KC1 A;  5AEK B;  3HM6 X;  5GMV A;  2J0M A;  5D2M B;  2LRU A;  1LXD A;  2D2Q A;  4KZ0 A;  5J18 A;  2FIF A;  1WF9 A;  4YL8 A;  4F1S A;  4GU2 A;  2MCN B;  4FJY A;  2KFK A;  4ZRJ A;  2CKH B;  1WFY A;  4ICV A;  4DHJ B;  2JRH A;  2BYV E;  2JXX A;  2KDB A;  3NZU A;  1E7V A;  3HHM A;  3KYC D;  3I3T B;  3ML8 A;  3PVL A;  2O2V B;  4DK5 A;  2KK8 A;  1E90 A;  3DVN V;  1WJ6 A;  2BF8 B;  3L16 A;  4GOC A;  4NJ6 A;  1GUA B;  1WE6 A;  5BO4 B;  3VUW A;  2MP2 A;  4G0N B;  1F9J A;  4HXD A;  1RLF A;  3DQV A;  1EF5 A;  3A1Q B;  2KXJ A;  1YX5 B;  2DZK A;  2KJ6 A;  3DBL I;  4F8C B;  1WR1 A;  4FJZ A;  1L7Y A;  3W1S A;  3NOB A;  3VXW A;  1V2Y A;  3AU5 A;  3L0W B;  1ZKH A;  2K8H A;  4K7W A;  4MEL A;  4FAD A;  5KHQ A;  2G3Q B;  2PJH A;  3R66 C;  3CSF A;  4LCD E;  4W9J A;  1RAX A;  2ZPN A;  5CHF A;  3KUC B;  1H4R A;  4ANX A;  4NQL B;  1XD3 B;  4GB9 A;  4B9K A;  3JW0 X;  2JWZ A;  4I6P A;  2NBW B;  2KLG A;  4FA6 A;  4DDG D;  3MJW A;  3IVF A;  4HPM B;  2KWU B;  1OGW A;  2FUH B;  4BVU C;  2MRP A;  4HLE A;  2CS4 A;  3ZKJ C;  2GBM A;  3IG3 A;  4BFR A;  4GN1 A;  3NHE B;  2PPH A;  2IY1 B;  3TL5 A;  1J0G A;  5L95 C;  2D11 A;  4WJQ A;  1RFA A;  1SGH A;  1WIA A;  1WGH A;  2KVR A;  2KHW B;  4AP4 C;  2AL6 A;  1WXM A;  2CHZ A;  2J0K A;  5KHO A;  1A5R A;  2YVC A;  4WWO A;  4W9G A;  1KLV A;  5LXI B;  4LDT B;  2Z59 B;  5DPW A;  1WY8 A;  3ZDM C;  4EZL A;  4ZDV A;  1HE8 A;  3APF A;  4J6I A;  2CR5 A;  3PHX B;  2FCQ A;  4MGI E;  4IUM B;  1WR6 E;  3LJ3 A;  2Z0D B;  4BOS C;  2KTR A;  2NCN A;  3A4S C;  1ISN A;  3EEC A;  3DOW A;  1V80 A;  2DAJ A;  2MW5 A;  3M62 B;  4FN2 A;  4MJS A;  3VUX A;  2WYQ A;  5D7G A;  2LXA A;  1YJ1 A;  3PHW B;  2B3A A;  3ZLZ A;  2UYZ B;  3KUD B;  4IC7 B;  3ZNI D;  5J2R A;  3PPA A;  4A20 A;  2DX5 B;  3PRM B;  2K1F A;  1RRB A;  2NBU A;  2KWC A;  4KSK C;  4MGY E;  2EKE C;  2ZEQ A;  3ZTD A;  3DVG Y;  1JRU A;  2KAN A;  4E74 A;  4EZK A;  4W9C A;  2KKC A;  2L0F A;  1UBQ A;  2G4S A;  3PGE A;  1WXV A;  4JLC A;  3ZVV A;  1WM2 A;  4FUL A;  4DWF A;  1QZE A;  1X1M A;  5JZE B;  3PS6 A;  2DZJ A;  3QQ8 B;  3ZNG C;  1C3T A;  1WRD B;  1WMH B;  2KOX A;  2YLM A;  2ASQ A;  3X23 A;  4KV2 A;  2IYD B;  2J7Q B;  2G4D B;  4B6W A;  3H1U A;  3OJ3 A;  1LM8 B;  2N1W A;  4WAA A;  2K8B A;  4DHZ E;  1WE7 A;  3JVZ X;  1R4M I;  4OVV A;  2A5U A;  2CU1 A;  3RUI B;  1P9D U;  3U7D A;  3VVW B;  1E8X A;  4GDL A;  2DEN B;  2NBV B;  4A3O A;  2ZVO A;  1IP9 A;  4K1R B;  4NNJ B;  2LI5 A;  1VCB A;  3RZW C;  1WXA A;  2L0T A;  3WAP A;  1WGD A;  4CHK A;  2XEW A;  1NI2 A;  3L13 A;  1OTR B;  3DVN U;  2KZR A;  2JRI B;  2N7D A;  3ENE A;  1S1Q B;  2O6V B;  3PLV A;  5G2N A;  2UWQ A;  2LWP A;  4JQW C;  1TBE A;  4KDI C;  1WGR A;  4HK2 A;  3A9J B;  4GIV A;  3WIM A;  3UIO B;  1OQY A;  1WX7 A;  4W9E A;  3WAN A;  4NJ7 A;  1V9J A;  1R4N I;  2KC2 A;  1I35 A;  2GBJ A;  2DYM A;  1UEL A;  3APD A;  4PYU A;  2KFK B;  3BY4 B;  2C60 A;  2Y5B B;  2L05 A;  4TQ1 A;  3PTF C;  4EOY A;  3N3K B;  2LUE A;  2ZJD A;  1V81 A;  2J0J A;  2W9N A;  3WA0 A;  1WJN A;  2KDI A;  4KSL C;  4OVU A;  3HK0 A;  5JH5 C;  2AL3 A;  3VQI A;  2DAF A;  2MP2 B;  3L08 A;  3B0A A;  4GMV A;  2LGD A;  1I42 A;  1YQB A;  3EFU A;  3RYT A;  3S2A A;  1WXS A;  4GDK A;  5L83 A;  1UH6 A;  4NPN A;  3TCA A;  1GC7 A;  3TBL D;  2LD9 A;  3H7P A;  3NS8 A;  2C7H A;  4DHZ B;  2FAZ A;  3R3M A;  1P1A A;  4MH0 E;  4KIK A;  3VH3 B;  3KYD D;  3A9K A;  4KZC A;  2K8C A;  1K8R B;  2XBB C;  3R7R A;  2EMS A;  3AI5 A;  4II2 B;  2MLB A;  4K7S A;  3QWZ B;  1Q0W B;  4ANW A;  2LZ6 A;  4IM2 A;  2BKR B;  2C5L C;  1OEY A;  4MGZ E;  4AOF A;  2JT4 B;  1VD2 A;  3UIN B;  1EF1 A;  2MBH A;  4RMA A;  4HPL B;  3Q3F A;  3L54 A;  1WYW B;  3SU8 X;  3A33 B;  3KH0 A;  1EO6 A;  3DDC B;  3LDZ E;  3L17 A;  2NS5 A;  2A4Z A;  2WX0 A;  4P7I A;  3CMM B;  1GG3 A;  3QA8 A;  2NPT A;  3OLM D;  2I1K A;  2DYO A;  2MQJ A;  1WGY A;  2N9X A;  4MSM B;  2MBE A;  3QIJ A;  3RT3 B;  2DZM A;  3WAO A;  3ZRC A;  2RPQ A;  3ZDT A;  2BYF A;  3HIZ A;  3PT2 B;  2LVQ A;  4FLH A;  2MX2 A;  2KNB A;  3HM3 A;  3T8M A;  1NDD A;  2KQS A;  3PRP B;  3VTU A;  1WX8 A;  3H6N A;  3H7S A;  3T9L A;  3JSV A;  2L8J A;  2KTR B;  3AXC A;  3PRE A;  1KOT A;  3RCZ A;  3P2B A;  4MJS B;  5D94 A;  3SHQ A;  4CO7 A;  3UQB A;  2N9E B;  1H8C A;  4ANV A;  2KWV B;  3V6C B;  3RUL A;  2LGY A;  2VRR B;  1YD8 U;  2KN5 A;  3ONS A;  5LLI A;  2QHO A;  4RM9 A;  2MWS B;  5CTR C;  4BKS D;  4PS8 A;  4BBN F;  4HDO A;  3W1Y A;  1G6J A;  4HCN B;  4WQO B;  1P3Q U;  2ZNV C;  2NVU I;  3ECI A;  2V3S A;  2GMI C;  2WX1 A;  5G55 A;  1SIF A;  2KX3 A;  4PYZ A;  2M8S A;  2BYE A;  1WZ0 A;  2M0X A;  3SD5 A;  3KW5 B;  2L76 A;  2ZZP B;  2M17 A;  3UIP B;  4ZRK A;  5E6O A;  3OAW A;  4WWP A;  2OJR A;  5IAA C;  3VAW A;  1WH3 A;  2RR9 A;  5CX3 A;  3PV1 A;  4K81 A;  2JZ3 B;  3KVF B;  1UBI A;  4FJV B;  2KLC A;  5DPR A;  3ML9 A;  4F7Z A;  1YIW A;  4ANU A;  1GJZ A;  1AAR A;  1P98 A;  1V5O A;  3EHV A;  3QAR A;  3ZNZ B;  4GDL B;  4N9F 4;  2MBB B;  2K39 A;  4K7U A;  2FCN A;  3QC8 B;  4DHJ D;  2XK5 A;  4ZYN A;  2KJR A;  2L00 B;  3N32 A;  4BKS A;  4CYE A;  3K9P B;  1E8Z A;  1V86 A;  3U8Z A;  5AZG A;  2GBK A;  2IO0 B;  2KMA A;  2KTF A;  4NAW A;  4M8N A;  1Q5W B;  4RM8 A;  4W9L A;  4JL9 A;  3EC8 A;  3Q3J A;  4ZRI A;  3VHT C;  1J8C A;  1TGZ B;  2CHX A;  3B1L X;  4XZ4 A;  2N1V A;  3QCA A;  1V5T A;  3QJZ A;  2WWZ A;  4JIO U;  2NR2 A;  4G3X B;  2AYO B;  4HJK A;  4WJP A;  3RD2 A;  2ZPY A;  2JY6 A;  2I1J A;  2IO2 B;  3L10 B;  1Y8R C;  5E6N A;  1KJT A;  4WJO A;  2BPS A;  1D3Z A;  3WAM A;  2N4F A;  2FCS A;  2K6Q A;  4W9I A;  2L7R A;  4LJO B;  5D6J B;  1TTN A;  3M63 B;  2RGF A;  5HKH A;  4EZJ A;  2D10 A;  2ZVN A;  4EKU A;  3UQA A;  2ZCC A;  3V6E B;  4WWN A;  4ICU A;  3VTV A;  3X0W A;  2MA9 B;  3RZF A;  2JPH A;  3N30 A;  3CST A;  2K25 A;  1LFD A;  1NBF C;  1ZW7 A;  2KQ7 A;  3V62 A;  1IPG A;  3M3J A;  3CF6 E;  2O2V A;  3DBS A;  1XT9 B;  1OEY J;  3TJP A;  2AEH A;  4XC2 A;  4FHJ A;  5C1Z A;  4I6N B;  2RSU A;  1MG8 A;  1WX9 A;  4PS7 A;  2KFJ A;  2C7N B;  3DBH I;  2M4N A;  3A1Q A;  5CHW A;  4AUQ C;  3DVG X;  2HD5 B;  1GC6 A;  2KDE B;  4GDK B;  4TUU A;  3ZRF A;  4AJW A;  1P0R A;  4AWJ A;  2DHZ A;  2IY0 B;  3QAQ A;  4DXA B;  3GZN I;  2IZV B;  3H7P B;  3AU4 A;  2KMC A;  3NY5 A;  1WJ4 A;  3B08 A;  3K9O B;  3PZD A;  4KIK B;  3O65 B;  3A9K B;  5IA7 A;  4B95 A;  4IWQ A;  4LJP B;  4BKG A;  2D07 B;  3SDL C;  4LDT D;  2LVP A;  4WJN A;  3IBE A;  4M0W B;  3R7Q A;  2C7M B;  3APC A;  3MHS D;  2GBN A;  3W1S C;  2PE6 B;  3VDZ A;  1PQS A;  4EEW A;  1FXT B;  2R2O A;  2JVC A;  4NY0 A;  3ZTC A;  4IWO A;  2LVO A;  2HJ8 A;  1UZX B;  3NZS A;  3VFK A;  2FNJ B;  3ALB A;  4II3 B;  1CMX B;  1WGG A;  2KDF B;  3ZO5 B;  1U4A A;  2GBR A;  4BOZ B;  1M94 A;  1E7U A;  2PEA A;  2FID A;  5FR6 A;  4GSW A;  1LQB A;  1V6E A;  2BWE S;  4W9D A;  3MTN B;  1SE9 A;  3JYU A;  4TKN A;  2NPT B;  3V60 A;  3QX1 A;  3QHT A;  4HCP B;  3C0R B;  2LAS A;  1T0Y A;  4G11 A;  2D3G A;  2GOW A;  4GXB A;  1J19 A;  2MBO A;  2KD0 A;  1ZGU B;  2JUO A;  3PSE B;  2MSE D;  3VH4 B;  3H9D A;  2JZZ A;  3V61 A;  2LJ5 A;  4KDL B;  3TMP B;  2BGF A;  3ZNH B;  4EUT A;  2CHW A;  4FHK A;  3JSV B;  1XQQ A;  2FCM A;  5JHB A;  2JF5 A;  2BKF A;  1KM7 A;  2KO3 A;  3BIN A;  4MM3 A;  4W9K A;  2K6D B;  2HE7 A;  1E8W A;  4IWP A;  4GGQ A;  5EDS A;  3DPD A;  2KX0 A;  2R2Q A;  5AZH A;  4HWI B;  5AZF A;  4IW0 A;  2PE9 A;  3PRZ A;  4MSQ B;  5CHV C;  4JGH B;  2AWT A;  2LRW A;  2OOB B;  3ZW3 A;  5J17 A;  4URK A;  1EUV B;  3OJ4 B;  4MGK E;  2V1Y A;  4IM3 A;  4TV3 A;  2ZNV B;  1GNU A;  1BT0 A;  4EFO A;  4BBN C;  1WZ3 A;  1WM3 A;  5LXH A;  1E5W A;  2IBI B;  3KUZ A;  3VUY A;  1UGM A;  4X57 B;  2C9W B;  5TR5 A;  4TQ0 A;  2N9P C;  2O6V D;  1S3S G;  1Q1O A;  3U30 A;  3TIX A;  1IYF A;  1YX6 B;  3DCG A;  4G50 A;  2LGX A;  3GOE A;  2IO1 B;  4IM0 A;  4W9H A;  4M8M A;  4AJY B;  3VTW A;  1Z5S B;  1WMH A;  2DYB A;  4ASW C;  3ZIM A;  3D32 A;  4KVG B;  3UF8 A;  3IHP C;  1UD7 A;  1L2N A;  2EMT A;  3DBR I;  2REX A;  5E6P A;  4FBJ B;  4HVB A;  4I6L B;  1TZ1 A;  2G45 B;  1WI0 A;  2IO3 B;  3ZUN A;  2XK5 B;  4A3P A;  4MDK E;  5DPT A; 
#chains in the Genus database with same CATH topology
 1I4P A;  3QK0 A;  4XX5 A;  3NVW A;  3IAM 1;  2KJH B;  2M1M A;  1PGB A;  2LGS A;  4PS3 A;  2N7E A;  3A4R A;  4IG7 B;  1R7S A;  2WXQ A;  4DDI D;  1C1Y B;  1UGJ A;  1IBX B;  2LRU A;  3BWU D;  1UWM A;  3EUB 2;  2IGD A;  4RGT A;  4Q2J A;  5HI1 A;  2KFK A;  1WFY A;  4ICV A;  2W3R A;  2JRH A;  4YSZ B;  2BYV E;  3KYC D;  2O2V B;  2WXK A;  4DK5 A;  1C9F A;  3AEC B;  1GUA B;  1WE6 A;  3AEA B;  3VUW A;  4G0N B;  1RLF A;  2K22 A;  4XWT A;  1YX5 B;  5AUK A;  3BYY B;  2K3U A;  1QT9 A;  1WR1 A;  1D4B A;  3H8H A;  3FKY A;  1L7Y A;  3W1S A;  2DWQ A;  3AB5 A;  3VXW A;  2K8H A;  1WWT A;  4YTM B;  1OQR A;  3IAS 1;  2CU3 A;  4W9J A;  5CHF A;  1H4R A;  4A8X C;  4ANX A;  1XD3 B;  3N1X C;  2JWZ A;  1R4M B;  4BVU C;  1I4R A;  3AE5 B;  3ZKJ C;  2M19 A;  1TJE A;  1IGD A;  2N9K A;  4L23 A;  3W5U B;  2OED A;  1J0G A;  5L95 C;  2D11 A;  4WJQ A;  1WIA A;  2PKO A;  3Q8F A;  2KHW B;  1I4G A;  2J0K A;  1KFY B;  2YVC A;  3Q8A A;  2H89 B;  4M02 A;  4ZDV A;  2Z0D B;  4TMA B;  3EEC A;  2K0P A;  2MW5 A;  4MJS A;  2WYQ A;  3B9J A;  4YTP B;  4J3O D;  4USA A;  4XE0 A;  2UYZ B;  4IC7 B;  2GI9 A;  4RGN A;  2RMM A;  4A20 A;  2DX5 B;  4OW0 A;  1L6V A;  2NBU A;  3HVD A;  2EKE C;  1SIJ A;  1JRU A;  4EZK A;  1XLQ A;  2WDQ B;  2KKC A;  2L0F A;  3RNA C;  4DWF A;  2XN9 C;  1TKE A;  2LEK A;  3ZNG C;  1WMH B;  2WXP A;  4KGT A;  3P4R B;  4KV2 A;  2N1W A;  4WAA A;  3IT6 B;  4DHZ E;  4OVV A;  1P9D U;  1E8X A;  2DEN B;  2NBV B;  1IP9 A;  3KLS X;  2L0T A;  3RZW C;  4CHK A;  1N61 A;  3U7Z A;  1LO5 D;  1OTR B;  3T3O A;  3DVN U;  1ESF A;  2O6V B;  1CK1 A;  2LWP A;  4ITK A;  3A9J B;  4ZOH C;  3WIM A;  1ZPS A;  4EE2 A;  3UIO B;  1E9M A;  1OQY A;  1V9J A;  4C7Z A;  1R4N I;  1QQR A;  2DYM A;  2Y5B B;  2L05 A;  4S0R A;  2ZJD A;  1L4D B;  1V81 A;  1C78 A;  2MH7 A;  3WA0 A;  1WJN A;  1TKG A;  1CZP A;  2ZW0 A;  2LGD A;  1C4P A;  2WU2 B;  4NPN A;  3TCA A;  3N1Y C;  1KF6 B;  3TBL D;  2LD9 A;  4DHZ B;  5JXV A;  3VH3 B;  3KYD D;  1QOB A;  3A9K A;  1K8R B;  2XBB C;  2MLB A;  5IP4 D;  4ANW A;  2LZ6 A;  3URY A;  4YXD B;  3Q3O C;  2LUM A;  1JWM D;  4HPL B;  1WYW B;  4FXC A;  5EE3 A;  3SU8 X;  2JWU A;  1MJD A;  2NS5 A;  3TUO A;  1ET6 A;  2WX0 A;  4P7I A;  1GG3 A;  2KMM A;  3QA8 A;  4M00 A;  2I1K A;  2D3A A;  2DYO A;  2MQJ A;  2LGI A;  2N9X A;  3ZRC A;  2LFI A;  3ZDT A;  3PT2 B;  2KNB A;  5FR3 A;  1WX8 A;  3AXC A;  3PRE A;  3P2B A;  3AH7 A;  5D94 A;  1EU4 A;  1J7C A;  3UQB A;  2AQ2 B;  2KWV B;  1N60 A;  5MPO A;  1EWC A;  2PIA A;  4RM9 A;  2WXJ A;  2RDH A;  5TSS A;  4PS8 A;  4HDO A;  1N5W A;  2PLP A;  3ECI A;  2GMI C;  2KX3 A;  3UIP B;  2L76 A;  4YSX B;  5E6O A;  2OJR A;  1XF5 L;  4K81 A;  4HKQ A;  1ET9 A;  4FJV B;  5DPR A;  2I2Y A;  3FAH A;  1GJZ A;  1AAR A;  1P98 A;  3QAR A;  4GDL B;  4N9F 4;  2YEP B;  3BYT B;  3Q8B A;  3QC8 B;  2KJR A;  4BKS A;  4CYE A;  3K9P B;  1HA5 A;  1YQ3 B;  2GBK A;  4M8N A;  4JL9 A;  3VHT C;  3ZGZ A;  1TGZ B;  2NR2 A;  2AYO B;  3RD2 A;  3W5V B;  2JY6 A;  2I1J A;  2WHI A;  1Y8R C;  4WJO A;  2J52 A;  1JWU D;  1IBX A;  1PYW D;  2L7R A;  2QMT A;  4RH6 A;  1TTN A;  1YMH E;  4EKU A;  3X0W A;  2SEB D;  2MA9 B;  3RZF A;  2JPH A;  3N30 A;  3CST A;  3B2G A;  1ZW7 A;  2KQ7 A;  5BYR A;  3CF6 E;  1VRA B;  2O2V A;  1XT9 B;  1OEY J;  3HVZ A;  4R3D A;  4A6Q A;  4XC2 A;  2RSU A;  2KAC A;  1WX9 A;  3DBH I;  2M4N A;  5CHW A;  3DVG X;  2KDE B;  1P0R A;  5T8I A;  2DHZ A;  3QAQ A;  1HZ5 A;  1HQR D;  2IZV B;  3NY5 A;  4HKZ E;  3K9O B;  4DQO C;  3O65 B;  1T0Q C;  4LNK A;  3Q8E A;  3IBE A;  2C7M B;  2QC8 A;  1PQS A;  1A70 A;  1FXT B;  2R2O A;  1IUE A;  4ZRQ A;  2FNJ B;  1NYR A;  4II3 B;  2KDF B;  1U4A A;  3VRA B;  2Q5W D;  3AE9 B;  4BOZ B;  2FUG 1;  1JAL A;  1SF0 A;  4LNN A;  1L0V B;  3MFG A;  2NPT B;  2L52 A;  4L2Y A;  3C0R B;  2D3G A;  2GOW A;  2QCZ A;  2JUO A;  5BMG A;  2XNA C;  3V61 A;  3TMP B;  3EFC A;  2CHW A;  4KGR A;  2JF5 A;  1KRH A;  1RYJ A;  2HE7 A;  4GGQ A;  5EDS A;  2KX0 A;  2KN4 A;  5AZH A;  3J9C A;  4IW0 A;  2KDM A;  3GE3 C;  2PE9 A;  4MSQ B;  1ZOY B;  2AWT A;  2LRW A;  1E6E B;  5J17 A;  3FC4 A;  2J42 A;  3Q69 A;  1GNU A;  2G9H D;  2NTS A;  1WM3 A;  3KUZ A;  3AEB B;  2C9W B;  3NRZ A;  2N9P C;  1S3S G;  4IOI E;  2M56 B;  4G50 A;  1T3Q A;  1SJE D;  4W9H A;  4AJY B;  4C7Y A;  3LXF A;  1WMH A;  2DYB A;  3IHP C;  1UD7 A;  4N6E B;  2W54 A;  2EMT A;  3DBR I;  4HVB A;  4YSY B;  5IOI A;  3EGR A;  4E3C A;  3IFW B;  4NAW B;  2L3Z A;  2V4L A;  5DPS A;  3UGB B;  4BKT A;  4E71 A;  1E8Y A;  1L4Z B;  1FXI A;  2DZI A;  1N62 A;  2O6V A;  2LXC A;  3WAL A;  1QLB B;  3A9J A;  3Q6B A;  1XXG A;  2KC1 A;  2BQQ A;  5AEK B;  3KQ4 A;  5J18 A;  3HRD D;  4FJY A;  1OQQ A;  2CKH B;  4ZRJ A;  1UNS A;  3P4P B;  3W2D A;  4REZ A;  2JXX A;  2KDB A;  3NZU A;  3HHM A;  2OHF A;  3E56 A;  3I3T B;  5EE9 A;  3PVL A;  2KK8 A;  1E90 A;  1WJ6 A;  2EEL A;  4HXD A;  3DQV A;  3TEY A;  1J7A A;  4MH8 A;  3GE8 C;  2DZK A;  3I63 C;  4FJZ A;  4AS1 A;  1QKZ A;  5KHQ A;  2G3Q B;  4B0E A;  3R66 C;  3CSF A;  3UI3 A;  1RAX A;  2ZPN A;  3BVG A;  3WCQ A;  3JW0 X;  2NBW B;  2W3S A;  4DDG D;  2Y5P A;  4HPM B;  3AEG B;  2GBM A;  4BFR A;  4GN1 A;  2PPH A;  2IY1 B;  3TL5 A;  2LHE A;  4L1B A;  3SEB A;  2W55 A;  1SGH A;  5KHO A;  2CHZ A;  1VR9 A;  1CQV A;  3P63 A;  5LXI B;  2Z59 B;  1WY8 A;  4EZL A;  1HE8 A;  2CR5 A;  3PHX B;  2FCQ A;  4MGI E;  4IUM B;  1WR6 E;  2BTE A;  1RM6 C;  3DOW A;  1V80 A;  2DAJ A;  3M62 B;  3LB8 C;  1E10 A;  2GLS A;  2BB6 A;  1SB3 C;  2LXA A;  1YJ1 A;  1GB1 A;  1MHX A;  2IJ0 A;  1YQ4 B;  1YN3 A;  3ZTD A;  4YWG G;  4QAY A;  2KAN A;  1JQ4 A;  2D3C A;  1WXV A;  1I4H A;  4JLC A;  1X1M A;  2KVZ A;  3AE3 B;  1C3T A;  3RPF C;  3FIL B;  2YLM A;  2KOX A;  1XLN A;  1NI3 A;  3OJ3 A;  1LM8 B;  3JVZ X;  1R4M I;  2CU1 A;  3AE1 B;  4GDL A;  2ZVO A;  4K1R B;  2HDE A;  4IDI A;  1WGD A;  2HJ1 A;  3ENE A;  5G2N A;  1HXY D;  2E6X A;  1WX7 A;  4W9E A;  3WAN A;  3R2I A;  1K51 A;  1SE4 A;  1I35 A;  2GBJ A;  1UEL A;  3APD A;  4PYU A;  2PVO D;  4C80 A;  4EOY A;  4DXF A;  3ZJT A;  2W9N A;  2WDR B;  4OVU A;  4PT5 A;  2AL3 A;  3ZXV A;  3VQI A;  2DAF A;  3L08 A;  3ZJU A;  1I42 A;  1MPE A;  1YQB A;  3RYT A;  3S2A A;  5L83 A;  1UH6 A;  1HZ6 A;  4KKI A;  2C7H A;  4A90 A;  3R3M A;  3AEF B;  4KZC A;  3BK2 A;  3R7R A;  1OEY A;  4MGZ E;  2PTL A;  4OZB A;  3U52 E;  2JT4 B;  1XLO A;  4ARI A;  1VD2 A;  2MBH A;  4A55 A;  3Q3F A;  1F77 A;  3A33 B;  3KH0 A;  3P42 A;  3LDZ E;  1ZE3 D;  1K50 A;  3CMM B;  2NPT A;  4P1B C;  1WGY A;  4MSM B;  2WU5 B;  3NZ3 A;  3HIZ A;  1NDD A;  3H7S A;  1WSP A;  1KOT A;  3RCZ A;  4CO7 A;  2N9E B;  4N58 A;  2VRR B;  3ONS A;  5LLI A;  1WRI A;  5CTR C;  4BBN F;  1PGX A;  4HJG E;  3W1Y A;  4HCN B;  2AQ3 B;  4WQO B;  5EE0 A;  2V3S A;  2WX1 A;  3MC0 B;  3GZN B;  1CJE A;  2M0X A;  3NVY A;  2ZZP B;  3AE8 B;  1NVI D;  5IAA C;  1WH3 A;  1D5X C;  3U2S C;  1UBI A;  4RFB A;  3W9C B;  4YT0 B;  1YIW A;  2QIE B;  4ACF A;  2MBB B;  2FCN A;  4DHJ D;  4ZYN A;  3N32 A;  1E8Z A;  4TSS A;  5AZG A;  2IO0 B;  4NAW A;  4B0M A;  4RM8 A;  4W9L A;  4ZRI A;  3P1M A;  1L0Y B;  1V5T A;  3QJZ A;  4G3X B;  1M4V A;  1PFD A;  4HJK A;  3ABV B;  1ZXH A;  2ZPY A;  2LJI A;  4K3B A;  2IO2 B;  4RNA A;  5E6N A;  3WAM A;  2N4F A;  2RGF A;  2M0A A;  2Y3A A;  2K25 A;  4XDC A;  1LFD A;  1NBF C;  2CJN A;  5H92 C;  1IPG A;  1VDV A;  1C77 A;  2VZK D;  3DBS A;  2AEH A;  1C4C A;  2IGG A;  4N59 A;  4PS7 A;  2BB5 A;  1BML C;  4RGM A;  4TUU A;  2HD5 B;  1GC6 A;  3ZRF A;  5JZE B;  4AWJ A;  4DXA B;  2BS4 B;  1FNU A;  3AU4 A;  1DGJ A;  1WJ4 A;  1TS4 A;  1V97 A;  4KIK B;  2MJD A;  4AQ7 A;  5IA7 A;  4B95 A;  4IWQ A;  2KT7 A;  4BKG A;  2D07 B;  2AX5 A;  1ZXI A;  2LVP A;  3MHS D;  4EEW A;  2K5P A;  4NY0 A;  4IWO A;  4IKG A;  1UZX B;  3NVZ A;  3NZS A;  1CMX B;  3ZO5 B;  1T6B X;  1M94 A;  2PEA A;  5FR6 A;  3RN9 C;  4W9D A;  3MTN B;  3JYU A;  3RNG C;  4HCP B;  3QHT A;  4G11 A;  4GXB A;  1J19 A;  2BBC A;  3GS2 A;  2KD0 A;  4ARC A;  3PSE B;  2LJ5 A;  4XYC A;  1XQQ A;  2FCM A;  2BKF A;  1E7P B;  1KM7 A;  3BIN A;  4W9K A;  2K6D B;  1E8W A;  2N9L A;  3AE7 B;  4IWP A;  1QF6 A;  1C76 A;  4KX6 B;  5CHV C;  4JGH B;  5BMH A;  2OOB B;  3RMK C;  1HTQ A;  4ZYS A;  3R8B A;  1EUV B;  2HTM E;  3OJ4 B;  2V1Y A;  1FXA A;  2ZNV B;  3BVZ A;  4BBN C;  4HRO A;  2G1E A;  5AUI A;  1UGM A;  5TR5 A;  4TQ0 A;  3MC9 A;  1Q1O A;  3TIX A;  1IYF A;  3DCG A;  2DLB A;  1RWS A;  1N5X A;  3FIL A;  3ETR A;  4KVG B;  4JWU C;  4US9 A;  2YEP F;  5E6P A;  4FBJ B;  2G45 B;  3VRB B;  1WI0 A;  1NYQ A;  4A3P A;  1WXQ A;  3PLU A;  1Z2M A;  1VZ6 A;  3AE6 B;  5C23 A;  3CIR B;  3Q14 C;  2RD0 A;  4MEM A;  2WDT B;  2ZCB A;  3AUL A;  1JCK B;  3M95 A;  4W9F A;  4HDQ A;  2HTH A;  4ZRP A;  4XWW A;  1V49 A;  4RCO A;  3TEW A;  1NEK B;  2MBQ A;  1FPY A;  2J0M A;  5D2M B;  1LXD A;  2D2Q A;  4KZ0 A;  1B9R A;  2D3B A;  1GPX A;  4DHJ B;  5G5G A;  5BYS A;  1F0Z A;  5HG2 A;  3ML8 A;  3DVN V;  2QIL A;  3L16 A;  4GOC A;  4NJ6 A;  5BO4 B;  3RNF C;  1F9J A;  1T0S C;  1ZP0 B;  1EF5 A;  1ZUD 2;  3A1Q B;  2KXJ A;  3DBL I;  2WXM A;  3NOB A;  2BW2 A;  1L0X B;  1ZKH A;  4K7W A;  2KYW A;  4MEL A;  4FAD A;  2WXH A;  2PJH A;  5EE1 A;  4WH4 A;  3MP9 A;  1KH0 A;  4B9K A;  2VZK B;  4I6P A;  1TY0 A;  4FA6 A;  3IVF A;  2KWU B;  1OGW A;  4HLE A;  4ZHO A;  3NHE B;  1RFA A;  2AL6 A;  1SSN A;  1WXM A;  4OVZ A;  4YTN B;  1MI0 A;  5D3D A;  3ZDM C;  3L4P A;  4J6I A;  1IGC A;  2V3N A;  3O13 A;  4MM3 B;  1ISN A;  2QDF A;  2TSS A;  3P4Q B;  5D7G A;  4C4V B;  3PHW B;  3ZLZ A;  5HFY A;  3ZNI D;  3RNB C;  3PPA A;  5J2R A;  1FMA D;  3C19 A;  2K1F A;  1SBB B;  5H8Y E;  2KWC A;  4KSK C;  4MGY E;  3DBL B;  2ZEQ A;  3DWM A;  3DVG Y;  4C56 C;  4GLS C;  4NAM A;  4W9C A;  2G4S A;  3PGE A;  1K52 A;  4FUL A;  2QSD A;  3TEX A;  3NG0 A;  3PS6 A;  4MT5 A;  3RI7 C;  2ICI A;  2E3T A;  1N63 A;  3Q3M C;  4H2A A;  2J7Q B;  2G4D B;  4B6W A;  1UF0 A;  1WE7 A;  2A5U A;  4JWS C;  3VVW B;  4A3O A;  4NNJ B;  3OWE B;  2XEW A;  1NI2 A;  3L13 A;  2X8X X;  2N7D A;  3PLV A;  2UWQ A;  4JQW C;  5IN7 A;  1WGR A;  4GIV A;  4JE3 B;  4NJ7 A;  3AEE B;  1LGR A;  4HEA 1;  2Y5C A;  3BY4 B;  1FRR A;  2C60 A;  4TQ1 A;  3PTF C;  3N3K B;  2LUE A;  2J0J A;  4KSL C;  5JH5 C;  1TIF A;  1P7F A;  1JML A;  3T3N A;  2MP2 B;  4GMV A;  4BZA A;  1T0R C;  2WQY B;  5LNK 1;  1V8C A;  1WYG A;  3EFU A;  1WXS A;  1GB4 A;  1FCL A;  1KLU D;  1AW7 A;  1Q10 A;  1P1A A;  4KIK A;  1TS2 A;  2K8C A;  2EMS A;  3AI5 A;  4K7S A;  4IM2 A;  2C5L C;  3V05 A;  1XO3 A;  1JWB D;  4AOF A;  1FIQ A;  1EF1 A;  3R2T A;  3NJT A;  3TEZ A;  1T5X D;  2IPK D;  3SFE B;  2L83 A;  1EO6 A;  3DDC B;  1FFU A;  1TZO A;  3Q8C A;  2JYE A;  2MBE A;  3TSS A;  3RT3 B;  2DZM A;  3BVM A;  2BYF A;  1DOI A;  2LVQ A;  4MAC A;  2MX2 A;  3HM3 A;  3VTU A;  3T9L A;  3MHZ A;  2MJE A;  2L8J A;  2KTR B;  4JPS A;  1XEE A;  3SHQ A;  3V6C B;  3RUL A;  3DHH C;  2LGY A;  1I4X A;  1UUP A;  1D5Z C;  2V0G A;  2EKI A;  5G55 A;  3SFD B;  4PYZ A;  1WZ0 A;  3SD5 A;  1Y56 A;  4ZRK A;  2RR9 A;  2H88 B;  3PV1 A;  2JZ3 B;  1VJK A;  2KLC A;  1EU3 A;  4F7Z A;  4ANU A;  3Q2A C;  1FFV A;  2L32 A;  1V5O A;  2NTT A;  3P4S B;  2WXF A;  4K7U A;  1V86 A;  4LTU A;  2WXL A;  2KMA A;  1YOV B;  1J8C A;  2CHX A;  3B1L X;  4XZ4 A;  2N1V A;  3QCA A;  3AE4 B;  1GAQ B;  1V1P B;  3RNC C;  2BPS A;  3AN1 A;  4W9I A;  2K6Q A;  4RGO S;  1C4A A;  4LJO B;  5D6J B;  3M63 B;  1YJI A;  4LNO A;  2ONQ A;  4EZJ A;  2ZVN A;  2ZCC A;  4WWN A;  1GOZ A;  3VTV A;  4S17 A;  1DOX A;  3V62 A;  4A9A A;  2FE8 A;  3TJP A;  2RDG A;  3KWL A;  4FHJ A;  5C1Z A;  2WGS A;  4I6N B;  2C7N B;  1VZ8 A;  2V9H A;  3A1Q A;  1STE A;  2WXG A;  4AUQ C;  4GDK B;  5IO9 A;  5IKC M;  1QIL A;  3GZN I;  3H7P B;  2KMC A;  5BYQ A;  3PZD A;  1EM7 A;  4LDT D;  4WJN A;  3PZ8 A;  4M0W B;  3R7Q A;  1SXT A;  3APC A;  2GRI A;  2GBN A;  4JX1 C;  3NVV A;  2JVC A;  3ZTC A;  3VFK A;  5G5H A;  3N20 C;  1E7U A;  4GSW A;  2BWE S;  2BT6 A;  3I57 A;  4WAF A;  1J7B A;  2V4I B;  1XCQ L;  4TKN A;  3QX1 A;  2LAS A;  1T0Y A;  1ZGU B;  3H9D A;  4KDL B;  3ZNH B;  4FHK A;  3JSV B;  3IT4 B;  5JHB A;  2KO3 A;  4MM3 A;  3N9Y C;  1TY2 A;  1D6E C;  3DPD A;  2R2Q A;  3PO0 A;  4C4V A;  3ZW3 A;  4URK A;  3ZJV A;  2Z8L A;  4MGK E;  1MG4 A;  3RFZ B;  2BS2 B;  4IM3 A;  4TV3 A;  1BT0 A;  5LXH A;  1E5W A;  2IBI B;  4X57 B;  1I4Q A;  1FRD A;  4WIP A;  3U30 A;  2IO1 B;  4IM0 A;  1E0Z A;  3VTW A;  4D2K A;  4ASW C;  3D32 A;  5FK9 C;  1L2N A;  2CJO A;  2KWD A;  3B2F A;  1TZ1 A;  2MJ3 A;  2I38 A;  2IO3 B;  2WDV B;  3ZUN A;  2XK5 B;  2JZP A;  3AV8 A;  2N0S B;  4MDK E;  5DPT A;  1ENF A;  4DBG A;  5JHA A;  2Z0E B;  1QOG A;  1WJU A;  1TT5 B;  1V1O A;  3BZD B;  1FEH A;  2VH2 A;  4NQK E;  5DCN A;  3OG5 A;  2BWF A;  3HM6 X;  5GMV A;  1L5P A;  2FIF A;  1WF9 A;  4YL8 A;  4F1S A;  1JWA D;  4GU2 A;  2MCN B;  4CQN A;  1FNW A;  3I5J C;  2UU7 A;  1E7V A;  4NZL B;  2B76 B;  1QOF A;  1JW9 D;  3VR8 B;  3CWI A;  2BF8 B;  3DWG C;  2MP2 A;  4HRS A;  2PVG C;  2KJ6 A;  1K53 A;  3Q3N C;  2JSV X;  4F8C B;  4C00 A;  1C79 A;  1V2Y A;  3AU5 A;  3L0W B;  4US8 A;  4HPP A;  2BVC A;  3ZQ4 A;  2RPV A;  4LCD E;  2BS3 B;  3KUC B;  1XLP A;  4NQL B;  1SE2 A;  4GB9 A;  2KLG A;  3MJW A;  2WXR A;  2FUH B;  5GXG B;  1F2R I;  2MRP A;  2CS4 A;  3IG3 A;  1SJH D;  1WGK A;  2QJL A;  1WGH A;  2KVR A;  4AP4 C;  2PMV A;  1A5R A;  2X38 A;  4WWO A;  4W9G A;  1KLV A;  4LDT B;  1FO4 A;  5DPW A;  4RF1 A;  1KLG D;  5HHD G;  3APF A;  1R4N B;  3NS1 A;  3LJ3 A;  4BOS C;  2KTR A;  2NCN A;  3A4S C;  2JXT A;  3MJ5 A;  3BK1 A;  4FN2 A;  3VUX A;  2J53 A;  4KKJ A;  1PGA A;  2B3A A;  1P7E A;  1MFW A;  3KUD B;  2ON8 A;  2ZW1 A;  3E9S A;  3HUI A;  3PRM B;  1PUT A;  1FM0 D;  1RRB A;  4E74 A;  1UBQ A;  3ZVV A;  1WM2 A;  2JYT A;  1QZE A;  2DZJ A;  3QQ8 B;  1WRD B;  4DXG A;  2ASQ A;  3X23 A;  1B1Z A;  2K9X A;  2MHJ A;  2IYD B;  3H1U A;  2IGH A;  2K8B A;  3RUI B;  3U7D A;  2LI5 A;  1VCB A;  1WXA A;  3WAP A;  4BAX A;  3IXS A;  4OHJ A;  2INN E;  2KZR A;  1NEN B;  2JRI B;  2GB1 A;  1S1Q B;  2WS3 B;  1TBE A;  4KDI C;  4OZC A;  4HK2 A;  4LK0 M;  3LYY A;  1V1P A;  1SEB D;  3SR6 A;  1N6Z A;  2KC2 A;  1MHH E;  2KFK B;  3GP7 A;  1TS5 A;  2KDI A;  3HK0 A;  1AN8 A;  4O1N A;  1DOY A;  1F52 A;  2RDB C;  3B0A A;  2V3P A;  5I4D A;  2IDY A;  4GDK A;  2JX5 A;  2MEK A;  4WUR A;  4UDU C;  1GC7 A;  5D3I B;  3H7P A;  3NS8 A;  2FAZ A;  4MH0 E;  1BUI C;  4II2 B;  1AYF A;  1F1H A;  3QWZ B;  1Q0W B;  2NMQ A;  4M0W A;  4RF0 A;  1HEZ E;  2BKR B;  3NUH B;  1XCT L;  4PK1 A;  1ROE A;  3UIN B;  4RMA A;  3L54 A;  3RNE C;  2DBY A;  3DHG C;  4K3C A;  1TS3 A;  3L17 A;  2A4Z A;  1OFF A;  3OLM D;  1DYQ A;  4XDD A;  1UWX A;  3QIJ A;  3ZXR A;  3WAO A;  2RPQ A;  4FLH A;  3T8M A;  2KQS A;  3PRP B;  4LNF A;  3H6N A;  3JSV A;  4MJS B;  4ZHP A;  1BXT A;  1H8C A;  4ANV A;  3GB1 A;  5C2T B;  1ACC A;  1YD8 U;  2KN5 A;  1HTO A;  5FKA C;  2QHO A;  2MWS B;  5E6J A;  4BKS D;  1G6J A;  2W82 A;  3DBH B;  1YN4 A;  2QEJ C;  1P3Q U;  2ZNV C;  2INP E;  2NVU I;  1SIF A;  2M8S A;  2BYE A;  4LLG M;  1ZDV A;  2IND C;  3KW5 B;  2M17 A;  3OAW A;  4WWP A;  1FNV A;  3VAW A;  1QOA A;  2AQ1 B;  5CX3 A;  3KVF B;  3ML9 A;  4P16 A;  3AED B;  1KTK A;  2LMC A;  2L1A A;  1YNT E;  3ZNZ B;  1YJJ A;  3EHV A;  2K39 A;  3DHI C;  3I9V 1;  2XK5 A;  2L00 B;  2PW9 A;  3U4E G;  1VZ7 A;  3U8Z A;  1F2R C;  2KTF A;  1Q5W B;  3PZ7 A;  3EC8 A;  3Q3J A;  2ACZ B;  1FD6 A;  2J4X A;  1I7H A;  2WLB A;  2WWZ A;  4JIO U;  4WJP A;  2KQ4 X;  3L10 B;  4P6V F;  1KJT A;  1D3Z A;  3V3X A;  2WXN A;  3AE2 B;  2FCS A;  2D5G A;  2R61 A;  2BYT A;  5HKH A;  2KAJ A;  2D10 A;  3UQA A;  2DNF A;  1JRO A;  1MVK A;  3V6E B;  4ICU A;  3M3J A;  3BII D;  3N1Z C;  4WWM A;  1SE3 A;  3AMZ A;  1JWS D;  1MG8 A;  2KFJ A;  2LHD A;  4AJW A;  2IY0 B;  1FCC C;  3B08 A;  4LNI A;  3A9K B;  1JRP A;  3VR9 B;  4LJP B;  4P1C C;  3SDL C;  4WQM A;  3W1S C;  2PE6 B;  3VDZ A;  1RFK A;  2LVO A;  2HJ8 A;  4OZA A;  3ALB A;  1AWD A;  3MC8 A;  1WGG A;  3DBR B;  2N7J A;  2GBR A;  2WXI A;  2SAK A;  2WXO A;  3C8Y A;  2INC C;  2FID A;  2WP9 B;  1LQB A;  1V6E A;  2WNM A;  2FBW B;  1SE9 A;  3V60 A;  2OJW A;  4KGS A;  2MBO A;  1VLB A;  5BMI A;  1EWY C;  3VH4 B;  2MSE D;  2JZZ A;  1TKY A;  2BGF A;  3KWV A;  4EUT A;  1YN5 A;  3ZYY X;  5C3J B;  4HWI B;  5AZF A;  3EA6 A;  3PRZ A;  2JU6 X;  4NJC A;  4XGA B;  2JQR B;  4EFO A;  1WZ3 A;  3VUY A;  1L6U A;  2O6V D;  1TYG B;  1YX6 B;  1ZDX A;  2LGX A;  3GOE A;  2VH1 A;  1PDX A;  4M8M A;  1Z5S B;  3ZIM A;  3AM9 A;  3UF8 A;  2REX A;  4I6L B;  4M01 A;  1D5M C; 
#chains in the Genus database with same CATH homology
 3QK0 A;  3PLU A;  4XX5 A;  3IFW B;  4E3C A;  4DBG A;  4NAW B;  5JHA A;  2L3Z A;  1Z2M A;  2V4L A;  2KJH B;  2M1M A;  2Z0E B;  5DPS A;  3UGB B;  4BKT A;  1E8Y A;  4E71 A;  1WJU A;  5C23 A;  4PS3 A;  2RD0 A;  4MEM A;  2WDT B;  2ZCB A;  3AUL A;  3M95 A;  2DZI A;  2N7E A;  3A4R A;  2O6V A;  4W9F A;  2LXC A;  2HTH A;  4HDQ A;  3WAL A;  4NQK E;  4IG7 B;  5DCN A;  3A9J A;  1V49 A;  2BWF A;  4DDI D;  1C1Y B;  2MBQ A;  2KC1 A;  5AEK B;  3HM6 X;  5GMV A;  2J0M A;  5D2M B;  2LRU A;  1LXD A;  2D2Q A;  4KZ0 A;  5J18 A;  2FIF A;  1WF9 A;  4YL8 A;  4F1S A;  4GU2 A;  2MCN B;  4FJY A;  2KFK A;  4ZRJ A;  2CKH B;  1WFY A;  4ICV A;  4DHJ B;  2JRH A;  2BYV E;  2JXX A;  2KDB A;  3NZU A;  1E7V A;  3HHM A;  3KYC D;  3I3T B;  3ML8 A;  3PVL A;  2O2V B;  4DK5 A;  2KK8 A;  1E90 A;  3DVN V;  1WJ6 A;  2BF8 B;  3L16 A;  4GOC A;  4NJ6 A;  1GUA B;  1WE6 A;  5BO4 B;  3VUW A;  2MP2 A;  4G0N B;  1F9J A;  4HXD A;  1RLF A;  3DQV A;  1EF5 A;  3A1Q B;  2KXJ A;  1YX5 B;  2DZK A;  2KJ6 A;  3DBL I;  4F8C B;  1WR1 A;  4FJZ A;  1L7Y A;  3W1S A;  3NOB A;  3VXW A;  1V2Y A;  3AU5 A;  3L0W B;  1ZKH A;  2K8H A;  4K7W A;  4MEL A;  4FAD A;  5KHQ A;  2G3Q B;  2PJH A;  3R66 C;  3CSF A;  4LCD E;  4W9J A;  1RAX A;  2ZPN A;  5CHF A;  3KUC B;  1H4R A;  4ANX A;  4NQL B;  1XD3 B;  4GB9 A;  4B9K A;  3JW0 X;  2JWZ A;  4I6P A;  2NBW B;  2KLG A;  4FA6 A;  4DDG D;  3MJW A;  3IVF A;  4HPM B;  2KWU B;  1OGW A;  2FUH B;  4BVU C;  2MRP A;  4HLE A;  2CS4 A;  3ZKJ C;  2GBM A;  3IG3 A;  4BFR A;  4GN1 A;  3NHE B;  2PPH A;  2IY1 B;  3TL5 A;  1J0G A;  5L95 C;  2D11 A;  4WJQ A;  1RFA A;  1SGH A;  1WIA A;  1WGH A;  2KVR A;  2KHW B;  4AP4 C;  2AL6 A;  1WXM A;  2CHZ A;  2J0K A;  5KHO A;  1A5R A;  2YVC A;  4WWO A;  4W9G A;  1KLV A;  5LXI B;  4LDT B;  2Z59 B;  5DPW A;  1WY8 A;  3ZDM C;  4EZL A;  4ZDV A;  1HE8 A;  3APF A;  4J6I A;  2CR5 A;  3PHX B;  2FCQ A;  4MGI E;  4IUM B;  1WR6 E;  3LJ3 A;  2Z0D B;  4BOS C;  2KTR A;  2NCN A;  3A4S C;  1ISN A;  3EEC A;  3DOW A;  1V80 A;  2DAJ A;  2MW5 A;  3M62 B;  4FN2 A;  4MJS A;  3VUX A;  2WYQ A;  5D7G A;  2LXA A;  1YJ1 A;  3PHW B;  2B3A A;  3ZLZ A;  2UYZ B;  3KUD B;  4IC7 B;  3ZNI D;  5J2R A;  3PPA A;  4A20 A;  2DX5 B;  3PRM B;  2K1F A;  1RRB A;  2NBU A;  2KWC A;  4KSK C;  4MGY E;  2EKE C;  2ZEQ A;  3ZTD A;  3DVG Y;  1JRU A;  2KAN A;  4E74 A;  4EZK A;  4W9C A;  2KKC A;  2L0F A;  1UBQ A;  2G4S A;  3PGE A;  1WXV A;  4JLC A;  3ZVV A;  1WM2 A;  4FUL A;  4DWF A;  1QZE A;  1X1M A;  5JZE B;  3PS6 A;  2DZJ A;  3QQ8 B;  3ZNG C;  1C3T A;  1WRD B;  1WMH B;  2KOX A;  2YLM A;  2ASQ A;  3X23 A;  4KV2 A;  2IYD B;  2J7Q B;  2G4D B;  4B6W A;  3H1U A;  3OJ3 A;  1LM8 B;  2N1W A;  4WAA A;  2K8B A;  4DHZ E;  1WE7 A;  3JVZ X;  1R4M I;  4OVV A;  2A5U A;  2CU1 A;  3RUI B;  1P9D U;  3U7D A;  3VVW B;  1E8X A;  4GDL A;  2DEN B;  2NBV B;  4A3O A;  2ZVO A;  1IP9 A;  4K1R B;  4NNJ B;  2LI5 A;  1VCB A;  3RZW C;  1WXA A;  2L0T A;  3WAP A;  1WGD A;  4CHK A;  2XEW A;  1NI2 A;  3L13 A;  1OTR B;  3DVN U;  2KZR A;  2JRI B;  2N7D A;  3ENE A;  1S1Q B;  2O6V B;  3PLV A;  5G2N A;  2UWQ A;  2LWP A;  4JQW C;  1TBE A;  4KDI C;  1WGR A;  4HK2 A;  3A9J B;  4GIV A;  3WIM A;  3UIO B;  1OQY A;  1WX7 A;  4W9E A;  3WAN A;  4NJ7 A;  1V9J A;  1R4N I;  2KC2 A;  1I35 A;  2GBJ A;  2DYM A;  1UEL A;  3APD A;  4PYU A;  2KFK B;  3BY4 B;  2C60 A;  2Y5B B;  2L05 A;  4TQ1 A;  3PTF C;  4EOY A;  3N3K B;  2LUE A;  2ZJD A;  1V81 A;  2J0J A;  2W9N A;  3WA0 A;  1WJN A;  2KDI A;  4KSL C;  4OVU A;  3HK0 A;  5JH5 C;  2AL3 A;  3VQI A;  2DAF A;  2MP2 B;  3L08 A;  3B0A A;  4GMV A;  2LGD A;  1I42 A;  1YQB A;  3EFU A;  3RYT A;  3S2A A;  1WXS A;  4GDK A;  5L83 A;  1UH6 A;  4NPN A;  3TCA A;  1GC7 A;  3TBL D;  2LD9 A;  3H7P A;  3NS8 A;  2C7H A;  4DHZ B;  2FAZ A;  3R3M A;  1P1A A;  4MH0 E;  4KIK A;  3VH3 B;  3KYD D;  3A9K A;  4KZC A;  2K8C A;  1K8R B;  2XBB C;  3R7R A;  2EMS A;  3AI5 A;  4II2 B;  2MLB A;  4K7S A;  3QWZ B;  1Q0W B;  4ANW A;  2LZ6 A;  4IM2 A;  2BKR B;  2C5L C;  1OEY A;  4MGZ E;  4AOF A;  2JT4 B;  1VD2 A;  3UIN B;  1EF1 A;  2MBH A;  4RMA A;  4HPL B;  3Q3F A;  3L54 A;  1WYW B;  3SU8 X;  3A33 B;  3KH0 A;  1EO6 A;  3DDC B;  3LDZ E;  3L17 A;  2NS5 A;  2A4Z A;  2WX0 A;  4P7I A;  3CMM B;  1GG3 A;  3QA8 A;  2NPT A;  3OLM D;  2I1K A;  2DYO A;  2MQJ A;  1WGY A;  2N9X A;  4MSM B;  2MBE A;  3QIJ A;  3RT3 B;  2DZM A;  3WAO A;  3ZRC A;  2RPQ A;  3ZDT A;  2BYF A;  3HIZ A;  3PT2 B;  2LVQ A;  4FLH A;  2MX2 A;  2KNB A;  3HM3 A;  3T8M A;  1NDD A;  2KQS A;  3PRP B;  3VTU A;  1WX8 A;  3H6N A;  3H7S A;  3T9L A;  3JSV A;  2L8J A;  2KTR B;  3AXC A;  3PRE A;  1KOT A;  3RCZ A;  3P2B A;  4MJS B;  5D94 A;  3SHQ A;  4CO7 A;  3UQB A;  2N9E B;  1H8C A;  4ANV A;  2KWV B;  3V6C B;  3RUL A;  2LGY A;  2VRR B;  1YD8 U;  2KN5 A;  3ONS A;  5LLI A;  2QHO A;  4RM9 A;  2MWS B;  5CTR C;  4BKS D;  4PS8 A;  4BBN F;  4HDO A;  3W1Y A;  1G6J A;  4HCN B;  4WQO B;  1P3Q U;  2ZNV C;  2NVU I;  3ECI A;  2V3S A;  2GMI C;  2WX1 A;  5G55 A;  1SIF A;  2KX3 A;  4PYZ A;  2M8S A;  2BYE A;  1WZ0 A;  2M0X A;  3SD5 A;  3KW5 B;  2L76 A;  2ZZP B;  2M17 A;  3UIP B;  4ZRK A;  5E6O A;  3OAW A;  4WWP A;  2OJR A;  5IAA C;  3VAW A;  1WH3 A;  2RR9 A;  5CX3 A;  3PV1 A;  4K81 A;  2JZ3 B;  3KVF B;  1UBI A;  4FJV B;  2KLC A;  5DPR A;  3ML9 A;  4F7Z A;  1YIW A;  4ANU A;  1GJZ A;  1AAR A;  1P98 A;  1V5O A;  3EHV A;  3QAR A;  3ZNZ B;  4GDL B;  4N9F 4;  2MBB B;  2K39 A;  4K7U A;  2FCN A;  3QC8 B;  4DHJ D;  2XK5 A;  4ZYN A;  2KJR A;  2L00 B;  3N32 A;  4BKS A;  4CYE A;  3K9P B;  1E8Z A;  1V86 A;  3U8Z A;  5AZG A;  2GBK A;  2IO0 B;  2KMA A;  2KTF A;  4NAW A;  4M8N A;  1Q5W B;  4RM8 A;  4W9L A;  4JL9 A;  3EC8 A;  3Q3J A;  4ZRI A;  3VHT C;  1J8C A;  1TGZ B;  2CHX A;  3B1L X;  4XZ4 A;  2N1V A;  3QCA A;  1V5T A;  3QJZ A;  2WWZ A;  4JIO U;  2NR2 A;  4G3X B;  2AYO B;  4HJK A;  4WJP A;  3RD2 A;  2ZPY A;  2JY6 A;  2I1J A;  2IO2 B;  3L10 B;  1Y8R C;  5E6N A;  1KJT A;  4WJO A;  2BPS A;  1D3Z A;  3WAM A;  2N4F A;  2FCS A;  2K6Q A;  4W9I A;  2L7R A;  4LJO B;  5D6J B;  1TTN A;  3M63 B;  2RGF A;  5HKH A;  4EZJ A;  2D10 A;  2ZVN A;  4EKU A;  3UQA A;  2ZCC A;  3V6E B;  4WWN A;  4ICU A;  3VTV A;  3X0W A;  2MA9 B;  3RZF A;  2JPH A;  3N30 A;  3CST A;  2K25 A;  1LFD A;  1NBF C;  1ZW7 A;  2KQ7 A;  3V62 A;  1IPG A;  3M3J A;  3CF6 E;  2O2V A;  3DBS A;  1XT9 B;  1OEY J;  3TJP A;  2AEH A;  4XC2 A;  4FHJ A;  5C1Z A;  4I6N B;  2RSU A;  1MG8 A;  1WX9 A;  4PS7 A;  2KFJ A;  2C7N B;  3DBH I;  2M4N A;  3A1Q A;  5CHW A;  4AUQ C;  3DVG X;  2HD5 B;  1GC6 A;  2KDE B;  4GDK B;  4TUU A;  3ZRF A;  4AJW A;  1P0R A;  4AWJ A;  2DHZ A;  2IY0 B;  3QAQ A;  4DXA B;  3GZN I;  2IZV B;  3H7P B;  3AU4 A;  2KMC A;  3NY5 A;  1WJ4 A;  3B08 A;  3K9O B;  3PZD A;  4KIK B;  3O65 B;  3A9K B;  5IA7 A;  4B95 A;  4IWQ A;  4LJP B;  4BKG A;  2D07 B;  3SDL C;  4LDT D;  2LVP A;  4WJN A;  3IBE A;  4M0W B;  3R7Q A;  2C7M B;  3APC A;  3MHS D;  2GBN A;  3W1S C;  2PE6 B;  3VDZ A;  1PQS A;  4EEW A;  1FXT B;  2R2O A;  2JVC A;  4NY0 A;  3ZTC A;  4IWO A;  2LVO A;  2HJ8 A;  1UZX B;  3NZS A;  3VFK A;  2FNJ B;  3ALB A;  4II3 B;  1CMX B;  1WGG A;  2KDF B;  3ZO5 B;  1U4A A;  2GBR A;  4BOZ B;  1M94 A;  1E7U A;  2PEA A;  2FID A;  5FR6 A;  4GSW A;  1LQB A;  1V6E A;  2BWE S;  4W9D A;  3MTN B;  1SE9 A;  3JYU A;  4TKN A;  2NPT B;  3V60 A;  3QX1 A;  3QHT A;  4HCP B;  3C0R B;  2LAS A;  1T0Y A;  4G11 A;  2D3G A;  2GOW A;  4GXB A;  1J19 A;  2MBO A;  2KD0 A;  1ZGU B;  2JUO A;  3PSE B;  2MSE D;  3VH4 B;  3H9D A;  2JZZ A;  3V61 A;  2LJ5 A;  4KDL B;  3TMP B;  2BGF A;  3ZNH B;  4EUT A;  2CHW A;  4FHK A;  3JSV B;  1XQQ A;  2FCM A;  5JHB A;  2JF5 A;  2BKF A;  1KM7 A;  2KO3 A;  3BIN A;  4MM3 A;  4W9K A;  2K6D B;  2HE7 A;  1E8W A;  4IWP A;  4GGQ A;  5EDS A;  3DPD A;  2KX0 A;  2R2Q A;  5AZH A;  4HWI B;  5AZF A;  4IW0 A;  2PE9 A;  3PRZ A;  4MSQ B;  5CHV C;  4JGH B;  2AWT A;  2LRW A;  2OOB B;  3ZW3 A;  5J17 A;  4URK A;  1EUV B;  3OJ4 B;  4MGK E;  2V1Y A;  4IM3 A;  4TV3 A;  2ZNV B;  1GNU A;  1BT0 A;  4EFO A;  4BBN C;  1WZ3 A;  1WM3 A;  5LXH A;  1E5W A;  2IBI B;  3KUZ A;  3VUY A;  1UGM A;  4X57 B;  2C9W B;  5TR5 A;  4TQ0 A;  2N9P C;  2O6V D;  1S3S G;  1Q1O A;  3U30 A;  3TIX A;  1IYF A;  1YX6 B;  3DCG A;  4G50 A;  2LGX A;  3GOE A;  2IO1 B;  4IM0 A;  4W9H A;  4M8M A;  4AJY B;  3VTW A;  1Z5S B;  1WMH A;  2DYB A;  4ASW C;  3ZIM A;  3D32 A;  4KVG B;  3UF8 A;  3IHP C;  1UD7 A;  1L2N A;  2EMT A;  3DBR I;  2REX A;  5E6P A;  4FBJ B;  4HVB A;  4I6L B;  1TZ1 A;  2G45 B;  1WI0 A;  2IO3 B;  3ZUN A;  2XK5 B;  4A3P A;  4MDK E;  5DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...