1WI0A

Solution structure of the pb1 domain of mouse mitogen activated protein kinase kinase 5 (map2k5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
GSSGSSGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PB1 domain of mouse mitogen activated protein kinase kinase 5 (MAP2K5)
rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitogen activated protein kinase kinase 5
total genus 19
structure length 113
sequence length 113
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wi0A00
2KQSA 3M63B 2KDFB 3QHTA 4A20A 4F7ZA 4HCPB 4IWQA 3WA0A 3SU8X 4GSWA 1NI2A 3C0RB 3ML9A 2C7MB 4DXAB 4NJ7A 5G2NA 4WAAA 5DPTA 3NZUA 4IWPA 1UD7A 3MJWA 3O65B 4EKUA 2J0JA 4II3B 1E8XA 1LFDA 2BWFA 3M62B 3N3KB 4MJSA 5CHWA 2LVQA 2LXAA 4IWOA 1WZ0A 2AL3A 3QJZA 2KWCA 2UWQA 2R2OA 2PEAA 1L2NA 2FCMA 1C3TA 3RD2A 4MM3A 4ZRKA 2L0FA 1BT0A 3TCAA 2IY1B 3S2AA 2LVOA 1NDDA 3RCZA 2HTHA 3I3TB 3GZNI 3DVGY 3NY5A 1LXDA 2LGXA 2RSUA 2DENB 4W9EA 3KUDB 4GB9A 2KDBA 2BWES 2ZVNA 2D2QA 2N7EA 3ZO5B 3H7PB 3VTVA 1WR1A 1TTNA 3B1LX 4JIOU 3WIMA 5LXHA 2G3QB 4KVGB 3QA8A 1Y8RC 2O2VA 2KJRA 4WWNA 5AZGA 3APCA 2L3ZA 4ASWC 3P2BA 2KFKA 3V60A 1V81A 2MSED 3NOBA 5D7GA 5L95C 1X1MA 3VAWA 2ZVOA 4HCNB 5DPRA 2KXJA 1Q5WB 4TUUA 4WJNA 2FUHB 2FIDA 1H4RA 2DZKA 1E8ZA 1EUVB 1WGDA 2BYFA 3UGBB 1D3ZA 2IBIB 1A5RA 2GBMA 4NAWA 3V61A 4I6LB 5TR5A 2N4FA 2L8JA 3VHTC 1EO6A 4MGZE 4W9GA 3JW0X 1RFAA 2FCSA 4ZYNA 1GG3A 2N9XA 3K9PB 4LCDE 2EMSA 4K7SA 2CKHB 2JUOA 1WX7A 4W9KA 4ZRJA 2MQJA 3CSTA 5CX3A 5LLIA 4K7UA 3DBLI 3DPDA 3QC8B 2ZEQA 3DVNU 2MA9B 3N30A 1UZXB 4KZ0A 4EZJA 4BBNF 4AJYB 2GMIC 1WJUA 1YX5B 4AOFA 1V5TA 5GMVA 4FJVB 2KK8A 4BFRA 1R4MI 5CTRC 2LGDA 2O6VB 4IW0A 2C7HA 3APDA 3QQ8B 3WAMA 3LJ3A 1UBIA 4GDKB 1WGRA 3JYUA 2LJ5A 1LQBA 5CHFA 2NBUA 1GUAB 3VDZA 4HDQA 3ZNZB 1V9JA 2LRUA 2LVPA 2KO3A 4ANWA 1IPGA 2DYBA 4W9JA 5C1ZA 4G3XB 1K8RB 3JVZX 1WMHB 3SHQA 3VFKA 4FJZA 4RM9A 2G4SA 4A3OA 3L17A 1WM3A 3DBRI 2JY6A 1SE9A 1V6EA 3OJ3A 1WMHA 3A9JB 4MH0E 3ZVVA 1CMXB 1ZKHA 5D6JB 3PRZA 2IO3B 4LJPB 5DCNA 4ANVA 2JRIB 3DQVA 2JXXA 3CF6E 4BKTA 1IP9A 3HM3A 2NVUI 3N32A 4M8MA 1V2YA 3V6EB 4PS3A 2JZ3B 4A3PA 2JT4B 2WDTB 3UINB 2KLCA 1I35A 3UIPB 3JSVB 2V3SA 3Q3JA 1E90A 1XT9B 3SDLC 2G45B 3JSVA 3W1YA 4HJKA 4N9F4 4TV3A 3MTNB 2KNBA 3ZIMA 3QIJA 2FAZA 3U30A 1E5WA 4II2B 1WE6A 2L7RA 3T8MA 1UGMA 2IZVB 2L76A 5JZEB 1WGGA 2IY0B 3H7PA 1Q0WB 3KH0A 2KZRA 1EF1A 4W9DA 1GJZA 2FCQA 2K8HA 4GGQA 4GIVA 4IC7B 1E7VA 1EF5A 3ZRCA 3EECA 5E6OA 1YQBA 2KC2A 3A9KA 3AU4A 5BO4B 2IO1B 3A1QA 3W1SC 3PV1A 3WAOA 1C1YB 1WJ4A 2C5LC 4IM3A 3H9DA 3U7DA 3PRPB 2GBNA 2WWZA 3UF8A 4E3CA 4WJQA 4GDLB 4AP4C 2K39A 4HLEA 2IYDB 4BKSA 4HPLB 1VD2A 4JLCA 1ZGUB 3DCGA 4BOZB 2KTFA 4FBJB 2K1FA 2CR5A 2KX0A 2N1VA 4NAWB 4GDKA 5J18A 4K81A 3DVNV 2ZCCA 2KDIA 1WE7A 3ZKJC 4ANXA 1M94A 3ZW3A 4DHZE 2RGFA 2I1JA 3KYDD 2KFJA 1OGWA 2KKCA 2KJ6A 2MBHA 2QHOA 4OVUA 4JGHB 2EMTA 2BGFA 3PREA 2D11A 4KSKC 4FJYA 2PE6B 5E6PA 2NBWB 3M95A 2FNJB 4DHJD 1KM7A 1MG8A 3D32A 1AARA 2DZMA 2JWZA 2KWUB 1Z2MA 2MP2B 4B6WA 4BOSC 4BKGA 1KJTA 2KMAA 4PYUA 2MBBB 5IAAC 2MBEA 1Q1OA 3BY4B 3VQIA 4IM2A 3ZTCA 3HIZA 4MGKE 2CHXA 2GOWA 4CHKA 1WR6E 4WJPA 2CHZA 4BVUC 1TGZB 2BYVE 3AI5A 4KSLC 3R7QA 2KTRA 4NPNA 2VRRB 3KVFB 3A1QB 4K7WA 2KN5A 2WX1A 3WANA 2C60A 3OAWA 5D94A 2YLMA 2IO2B 2K8BA 3RYTA 2O6VD 2DYMA 2AEHA 2LXCA 3V62A 5AZFA 3PRMB 3QX1A 3QAQA 4XZ4A 5DPWA 1T0YA 2ZPNA 4E74A 2W9NA 2A4ZA 4AJWA 4MSQB 5IA7A 2KX3A 4KDLB 1GC7A 2ASQA 5D2MB 2DX5B 4EOYA 2K25A 1E8YA 3PTFC 3DBSA 1IYFA 3KW5B 3QARA 4I6PA 1NBFC 3TL5A 5J2RA 3UQAA 3KYCD 1P3QU 3PSEB 2LI5A 1V5OA 2N9PC 2XEWA 3ZNHB 1WI0A 4AWJA 4URKA 2O6VA 3IFWB 3ECIA 4G0NB 2MCNB 2J0KA 3PHWB 3PT2B 4HK2A 3RZWC 3BINA 4M0WB 1HE8A 1U4AA 1S1QB 1WX8A 2RD0A 3NZSA 1WXMA 3R3MA 1PQSA 2KFKB 2KOXA 2ZCBA 1QZEA 3CMMB 4ICUA 2Z0EB 2MP2A 1P1AA 1WXSA 5L83A 4W9CA 4WQOB 2J7QB 3EC8A 2WX0A 2KWVB 1UH6A 2I1KA 3L0WB 1V86A 4W9HA 3A4SC 2N7DA 1WJNA 4PS8A 2KD0A 1XD3B 2M1MA 4WJOA 2M0XA 3PS6A 2MLBA 1RAXA 4FLHA 2D07B 4I6NB 4MJSB 4BBNC 1OQYA 2NS5A 3OLMD 3RZFA 2DYOA 1Z5SB 2DAJA 1R4NI 4GMVA 2KQ7A 2HJ8A 3QWZB 2V1YA 2BKFA 4XC2A 3ZUNA 3H1UA 2IO0B 3W1SA 3OJ4B 4NQKE 2LUEA 1KOTA 3VTWA 4B95A 1WM2A 3PHXB 3ZDTA 3GOEA 4FHKA 3B0AA 4W9LA 2G4DB 2OJRA 4YL8A 1KLVA 3DBHI 2XK5B 1J0GA 4AUQC 2M17A 3L16A 1WXVA 2MW5A 1WH3A 4GDLA 3TBLD 1S3SG 2Y5BB 2RPQA 2OOBB 1WZ3A 3QK0A 3A9JA 4MEMA 4FA6A 2DZIA 1J8CA 1ISNA 3L08A 1TZ1A 4KIKA 4DDID 2NCNA 4OVVA 4J6IA 4XX5A 4GU2A 2J0MA 2A5UA 3H7SA 3VUXA 2B3AA 2GBKA 3M3JA 3RT3B 3X23A 3ONSA 1E8WA 2CHWA 2K6DB 3ALBA 3TJPA 5HKHA 1H8CA 2RR9A 2NPTB 4F8CB 4PS7A 2MRPA 2LZ6A 4F1SA 2PPHA 3A9KB 4EEWA 4HXDA 4MGYE 3PLVA 3PZDA 5CHVC 4DHJB 2BF8B 1WGYA 3V6CB 2KC1A 3VTUA 2CS4A 1WX9A 1VCBA 3AU5A 1WIAA 3A33B 3VVWB 3VXWA 2LGYA 3IVFA 5LXIB 1XQQA 3A4RA 3DVGX 2MBOA 3VUYA 4TQ0A 1P9DU 1GNUA 3KUCB 4E71A 3ENEA 1YJ1A 2ZJDA 1V80A 5DPSA 5KHOA 1WYWB 4G11A 4CYEA 2FIFA 1V49A 1FXTB 2JZZA 2PJHA 3IG3A 4HPMB 2EKEC 3HK0A 2ZNVB 2KDEB 1I42A 4FHJA 3APFA 3ZLZA 2REXA 5JHAA 4BKSD 2MBQA 2KHWB 4FADA 1OTRB 3KUZA 3LDZE 4LDTD 2LD9A 1P0RA 3AULA 1OEYJ 4ICVA 2AL6A 2D10A 3DDCB 3PPAA 4MGIE 3NS8A 3WAPA 4NJ6A 2YVCA 1GC6A 4IUMB 4B9KA 5EDSA 4X57B 2XK5A 1JRUA 1RRBA 4NY0A 3TIXA 2DZJA 2ZZPB 4RMAA 2LWPA 2N1WA 5C23A 4W9IA 1SIFA 2L00B 4GXBA 3IHPC 4FN2A 4JQWC 3NHEB 3HM6X 4LJOB 4IM0A 4KDIC 3RULA 4MSMB 5JHBA 4CO7A 2O2VB 3PGEA 5E6NA 3ZTDA 2LRWA 2BPSA 2L05A 2ZNVC 2Z59B 3EHVA 4HDOA 4HVBA 1RLFA 1UELA 3R7RA 5JH5C 5KHQA 2LASA 1J19A 2K6QA 4TKNA 1WY8A 4WWPA 2Z0DB 3K9OB 4FULA 4DHZB 3T9LA 1WXAA 3L10B 2K8CA 1E7UA 1WFYA 2NBVB 3L13A 3ML8A 4P7IA 1ZW7A 3TMPB 4W9FA 1YIWA 1WGHA 3UQBA 3B08A 4ZRIA 2JF5A 4PYZA 4IG7B 2PE9A 2XBBC 3Q3FA 4LDTB 4JL9A 2KANA 2KVRA 3VUWA 3X0WA 5AEKB 1UBQA 2C7NB 2MX2A 3CSFA 3ZNGC 1YX6B 3AXCA 2V4LA 4KZCA 4ZDVA 1WJ6A 4G50A 2NPTA 1SGHA 3PLUA 1WRDB 4EFOA 4K1RB 4EUTA 2N9EB 5G55A 2KTRB 3SD5A 3R66C 4MELA 2D3GA 3UIOB 3ZDMC 4EZLA 4TQ1A 3IBEA 2KLGA 4DBGA 5J17A 4HWIB 2BKRB 4GOCA 1LM8B 2JVCA 2AYOB 2GBRA 1WF9A 1G6JA 4DWFA 4NNJB 2M8SA 2R2QA 4KIKB 2BYEA 2JPHA 4M8NA 5FR6A 3L54A 2CU1A 2GBJA 3VH3B 2MWSB 4RM8A 1OEYA 2C9WB 1L7YA 3RUIB 3U8ZA 4NQLB 4GN1A 3ZRFA 4ANUA 3H6NA 2KMCA 3WALA 2AWTA 4DDGD 2JRHA 2UYZB 2ZPYA 2DAFA 4MDKE 5AZHA 1F9JA 3ZNID 2WYQA 4DK5A 4EZKA 2FCNA 2HD5B 2HE7A 1TBEA 4WWOA 2M4NA 1P98A 3DOWA 4KV2A 1YD8U 2DHZA 2KJHB 3VH4B 3MHSD 3HHMA 3QCAA 2L0TA 3PVLA 3EFUA 2NR2A
chains in the Genus database with same CATH superfamily
2KQSA 3SU8X 2H88B 2KT7A 2MEKA 3DWGC 3AE2B 2LUMA 3BVMA 3LYYA 2BWFA 2Q5WD 4RGOS 4MJSA 2CJNA 5CHWA 2K3UA 1AN8A 2R2OA 1BXTA 2LMCA 1TZOA 4MM3A 4ZRKA 1BT0A 2LVOA 2HTHA 3NY5A 2DENB 4W9EA 3MFGA 4XDDA 1ROEA 3Q2AC 1HEZE 5BMGA 2UU7A 4JX1C 4JIOU 5LXHA 2Y5CA 4KVGB 2INNE 2O2VA 4WWNA 1ACCA 2WNMA 4ASWC 3P2BA 3V60A 1V81A 4IKGA 4HCNB 4XE0A 2FUHB 4A8XC 1IUEA 1E8ZA 5G5HA 2IBIB 1FM0D 3AE3B 2PMVA 1F0ZA 2N4FA 5FKAC 1C77A 2RPVA 4ZYNA 5T8IA 3K9PB 3AV8A 4MH8A 1E0ZA 4JWSC 1V5TA 5GMVA 4OHJA 4ITKA 5CTRC 2LGDA 2O6VB 3APDA 1NYQA 1T0QC 5LNK1 4GDKB 2V3PA 1WGRA 2B76B 2DLBA 2NBUA 4XWTA 3ZNZB 1NYRA 1XF5L 3SHQA 4AQ7A 3VFKA 4FJZA 2G4SA 1WM3A 3OJ3A 1WMHA 1XCTL 3PRZA 4XGAB 1PUTA 2IO3B 5DCNA 1TKGA 3N32A 2PLPA 4PS3A 4HRSA 2JT4B 2WDTB 3UINB 2D3AA 1N5WA 3JSVB 2V3SA 2CJOA 2G45B 4TV3A 3MTNB 2FAZA 1KFYB 1E5WA 4II2B 1UGMA 3RNEC 2IY0B 1NI3A 2KZRA 2ACZB 3AEBB 3ZJTA 3ZRCA 5E6OA 3A9KA 3AU4A 2IO1B 2M19A 3WAOA 4YT0B 1C1YB 1WJ4A 3GP7A 1ET9A 3H9DA 3U7DA 3PRPB 4PT5A 3Q3OC 1P7FA 4HLEA 2QC8A 2FBWB 4BKSA 4BOZB 4MM3B 4K81A 2ZCCA 1WE7A 1M94A 2KKCA 2ICIA 4OVUA 4RGMA 2D11A 4KSKC 2PE6B 3W9CB 3BK1A 3M95A 1KF6B 1YMHE 2KMMA 2JWZA 2KWUB 4HEA1 2VH1A 1L0VB 2MBEA 3HIZA 3AI5A 2BYVE 3B2FA 2VRRB 3KVFB 3Q8CA 3WANA 2WXGA 3H8HA 2KAJA 5D94A 2IO2B 2AEHA 1DOXA 1XXGA 2QEJC 5AZFA 3QX1A 1SF0A 1L5PA 2W9NA 1SBBB 1CQVA 1P7EA 2KX3A 2LFIA 4KDLB 4EOYA 1GOZA 1SEBD 2WXJA 4K3CA 3KW5B 3QARA 2WGSA 4K3BA 3NZ3A 3EUB2 2N9PC 4KX6B 4URKA 4G0NB 4M0WB 1HE8A 4A90A 3T3NA 3R3MA 2KFKB 2KOXA 1IBXB 3CMMB 1TKYA 2BB5A 2Z0EB 2PVGC 4YTPB 1WXSA 5L83A 2PTLA 2WDRB 2G1EA 2J7QB 3EC8A 2I1KA 4JE3B 3L0WB 1WJNA 3FAHA 1XD3B 1Q10A 4WJOA 2M0XA 1RAXA 4FLHA 2NS5A 3OLMD 2DYOA 1Z5SB 5HFYA 1R4NI 4GMVA 3W5UB 2NTSA 3W2DA 1MJDA 3VTWA 1YN3A 4NAMA 4LNIA 3B0AA 4W9LA 2G4DB 4YL8A 2D3BA 3IT6B 4OZBA 2Y5BB 1IGCA 2OOBB 1GPXA 1TZ1A 2NCNA 3O13A 2MJEA 3HVZA 2M0AA 2B3AA 2GBKA 3M3JA 3ONSA 3E56A 3TJPA 1SJED 1ZE3D 1C9FA 4PS7A 1J7AA 4GLSC 4DHJB 2IJ0A 1FO4A 1WX9A 2V9HA 3A33B 3A4RA 1I4PA 3VUYA 4TQ0A 3SEBA 2X38A 4E71A 3ENEA 1LGRA 1V80A 4JPSA 4CQNA 3DBHB 4M00A 2LHEA 2EKEC 1IGDA 1WYGA 3Q8AA 3EGRA 2REXA 2K22A 2MBQA 2KHWB 2ZW0A 4FADA 2K0PA 2LJIA 2PW9A 4RGTA 2JSVX 4C7ZA 4ICVA 3PPAA 4MGIE 1QKZA 2YVCA 1HA5A 4B9KA 3RNFC 4RFBA 2X8XX 4X57B 2XK5A 4NY0A 1YOVB 4W9IA 4GXBA 3I57A 4JQWC 3NHEB 4MSMB 1L6UA 2SAKA 2O2VB 2LRWA 2E3TA 4HDOA 4HVBA 3TEZA 1RLFA 1BMLC 4C4VB 3AB5A 1K50A 3AECB 3T9LA 4HJGE 3AE6B 1HZ6A 3L10B 3TMPB 4YTMB 4ZRIA 2XBBC 3Q3FA 2WP9B 4JL9A 2KVRA 3V3XA 3CSFA 1E9MA 1SE2A 3ZNGC 1YX6B 3KLSX 4KZCA 2DWQA 1WRDB 2IGDA 1I4QA 2N9EB 4EUTA 2AX5A 3UIOB 3KWVA 2KLGA 4HWIB 2JPHA 2WXHA 3AE4B 1V1OA 2W3SA 3N1YC 4EE2A 4A9AA 3N1ZC 2AQ3B 2UYZB 2INCC 2WXPA 4EZKA 2HD5B 2WQYB 1RM6C 2HE7A 1TBEA 2WU5B 1ZXIA 2DHZA 4KGSA 3HHMA 3QCAA 1HZ5A 2L0TA 4MACA 2NTTA 4LJPB 3FILA 2JX5A 3SR6A 3Q8EA 1J7CA 3M63B 2KDFB 2BQQA 1VR9A 4A20A 4IWQA 4L2YA 1V97A 2BTEA 3ML9A 2C7MB 4DXAB 4NJ7A 3Q6BA 3NZUA 3MJWA 5AUKA 1N61A 4II3B 2WS3B 3M62B 3N3KB 4IWOA 2AL3A 2UWQA 2FCMA 1C3TA 3RD2A 2L0FA 3NUHB 3NRZA 3RNAC 1R7SA 3GZNI 3DVGY 1KLGD 4WAFA 2LGXA 4S17A 1YJJA 3DWMA 3MP9A 2D2QA 3VTVA 3AE8B 1WR1A 3FC4A 4LNFA 2KJRA 2L3ZA 1ZPSA 1QLBB 2JZPA 5L95C 1X1MA 2ZVOA 5DPRA 3Q8BA 2FIDA 2DZKA 1EUVB 3AEDB 3VHTC 2WXIA 3LB8C 5HG2A 1YN5A 3JW0X 2AQ2B 2FCSA 1GG3A 3DHGC 4LCDE 2MQJA 3CSTA 4M01A 2MA9B 4KZ0A 3AEAB 2BW2A 1PDXA 4BFRA 1R4MI 4IW0A 3QQ8B 1I4HA 3LJ3A 3NVVA 3DHIC 1UNSA 2LJ5A 1LQBA 3DBRB 4A6QA 1GUAB 2BYTA 4ZRPA 1IPGA 1K8RB 3DBLB 4RM9A 3L17A 5EE9A 2JY6A 3Q8FA 3A9JB 2FE8A 3ZVVA 3DQVA 1SJHD 2JXXA 4BKTA 1IP9A 4KKIA 1V1PB 1KLUD 2R61A 3Q3JA 1E90A 5EE3A 3JSVA 3W1YA 4HJKA 4N9F4 5AUIA 2KNBA 3ZIMA 3CWIA 3QIJA 3AM9A 3U30A 1OQQA 4N6EB 2RDGA 3T8MA 1T0SC 1WGGA 1R4NB 3KH0A 5G5GA 3AEEB 4W9DA 2FCQA 2L1AA 4GIVA 1KH0A 3ZJUA 2KC2A 3PV1A 4IM3A 2GI9A 4GDLB 3WCQA 4AP4C 1TS5A 2IYDB 1ZGUB 4FBJB 2GB1A 2KX0A 2V4IB 3MHZA 3DVNV 1FNWA 1JWSD 2RGFA 3KYDD 2QHOA 1OGWA 4JGHB 2BBCA 2BGFA 3FKYA 2JU6X 1NVID 1MG8A 4LNOA 2DZMA 4RNAA 1TKEA 2MP2B 4B6WA 4BOSC 4EFOA 5IAAC 3ABVB 3VQIA 1Q1OA 4IM2A 1PGXA 4CHKA 3IXSA 1TGZB 3RNGC 4KSLC 4NPNA 4K7WA 2WX1A 1F2RC 1GB4A 3OAWA 2YLMA 2DYMA 2LXCA 3V62A 5DPWA 1T3QA 4RF1A 1OQRA 1K52A 4E74A 4RCOA 4AJWA 5IA7A 3Q3MC 1GC7A 2DX5B 3PTFC 4WQMA 3DBSA 3I9V1 4LLGM 1GAQB 3TL5A 3UQAA 3KYCD 1SB3C 3PSEB 3ZNHB 1ZDXA 1F52A 4AWJA 3IFWB 3ECIA 2MCNB 3RZWC 1U4AA 2TSSA 1WX8A 2ZCBA 1QZEA 2MP2A 4LTUA 4KGRA 3P4SB 5JXVA 2KWVB 1V86A 4W9HA 2N7DA 1LO5D 4BBNC 4I6NB 3RZFA 2DAJA 2HJ8A 3QWZB 2BKFA 3ZUNA 3H1UA 3OJ4B 2W54A 2LUEA 1KOTA 1TS2A 3GOEA 1E7PB 1C76A 1KLVA 1J0GA 1L6VA 3L16A 1WXVA 4GDLA 1JROA 1S3SG 1N5XA 4MEMA 4FA6A 2DZIA 1ISNA 5BYQA 4OVVA 1AYFA 2HDEA 3CIRB 1D5MC 1ESFA 1SIJA 3I5JC 3VUXA 3RT3B 1QILA 1E8WA 3ALBA 2K6DB 1H8CA 2NPTB 4RGNA 4F1SA 4EEWA 4MGYE 1WGYA 2VH2A 2KC1A 3V6CB 2CS4A 3AU5A 3VVWB 1XQQA 3P1MA 1GNUA 5KHOA 4XYCA 1V49A 1FXTB 2JZZA 3BVGA 4HPMB 2ZNVB 2KDEB 1I42A 5H8YE 4UDUC 3GZNB 5FR3A 2WDVB 4ARIA 3AULA 1OEYJ 3PZ7A 2AL6A 3DDCB 3WAPA 1IBXA 3N1XC 3W5VB 4KKJA 2CU3A 1F2RI 2ZZPB 4O1NA 3GE3C 1SIFA 1SXTA 2OHFA 1C4CA 4ZYSA 1MFWA 3HM6X 4LJOB 3NVZA 2JQRB 2BT6A 2BPSA 2V3NA 5JH5C 1ZXHA 2Z0DB 2WXMA 4FULA 4DHZB 4US8A 2K8CA 1E7UA 1WFYA 1JW9D 1YIWA 4WIPA 2JF5A 3KWLA 4PYZA 4IG7B 1L0YB 3X0WA 3MC8A 1QOFA 1RFKA 2I38A 4ZDVA 2V4LA 1CJEA 3PLUA 4K1RB 3SD5A 2N9KA 5G55A 4MELA 4EZLA 3IBEA 3VRAB 4GOCA 2Y5PA 1RWSA 4KIKB 3GE8C 5FR6A 1YJIA 5IKCM 1KTKA 4P6VF 4BZAA 3HRDD 3RUIB 2JYTA 4NQLB 1FNUA 3WALA 2DAFA 2W55A 5AZHA 1J7BA 1F9JA 3ZNID 2WYQA 2FCNA 2MJ3A 1FCCC 1N60A 2G9HD 1VZ6A 2M4NA 3T3OA 3DOWA 4KV2A 3QHTA 4HCPB 1QOAA 3Q14C 4GSWA 3C19A 2LEKA 4EKUA 5G2NA 4C80A 5DPTA 2J0JA 1HTQA 4D2KA 1FFVA 2LXAA 2VZKB 4TMAB 1KRHA 1L2NA 4DXFA 1I4RA 5H92C 3P4PB 3TCAA 2IY1B 1T0RC 2N0SB 3RI7C 4YXDB 1LXDA 2XN9C 2RSUA 4GB9A 2BWES 2ZVNA 4YSZB 3H7PB 3B1LX 1TTNA 3BYTB 3QA8A 1Y8RC 3NJTA 3URYA 3BVZA 3GS2A 3NOBA 5D7GA 2HJ1A 3C8YA 4WJNA 1WGKA 2HTME 3AN1A 1H4RA 3UGBB 2BYFA 1MI0A 1A5RA 3V61A 4NAWA 5TR5A 2L8JA 2DNFA 1EO6A 1XLPA 4MGZE 5D3IB 1RFAA 2N9XA 4ZRJA 2CKHB 1WX7A 4K7UA 3DBLI 3QC8B 2ZEQA 1C78A 2JYEA 5I4DA 4HKQA 4EZJA 4BBNF 2GMIC 4AOFA 2KK8A 2MH7A 3MJ5A 3MC0B 2QSDA 2C7HA 1OFFA 3WAMA 1BUIC 1UBIA 3JYUA 3EFCA 2VZKD 5CHFA 4XWWA 1VLBA 4HDQA 3VDZA 1V9JA 1EU3A 2LVPA 2KO3A 4ANWA 3AE1B 4W9JA 3HVDA 3JVZX 3TEXA 4A3OA 3DBRI 1SE9A 4J3OD 1CMXB 3ETRA 2JRIB 3Q3NC 3AEGB 3HM3A 1XCQL 2Z8LA 1V2YA 2JZ3B 4A3PA 2GRIA 1I35A 1XT9B 3SDLC 3IT4B 5HI1A 4USAA 1WE6A 2L7RA 2PKOA 4P1BC 1UWXA 5HHDG 2L76A 3RPFC 5IP4D 5JZEB 3H7PA 1FNVA 2J52A 1GJZA 1C4AA 2K8HA 4GGQA 4IC7B 1E7VA 1MHHE 3EECA 1JALA 1V8CA 5BO4B 3A1QA 3W1SC 1WRIA 1GB1A 2WWZA 4WJQA 2K39A 1DYQA 4JLCA 3DCGA 2CR5A 4NAWB 2EKIA 4GDKA 5J18A 1ET6A 4S0RA 1RYJA 4ANXA 2KDMA 4DXGA 1CZPA 4DHZE 4HROA 2MBHA 2AQ1B 2KJ6A 2EMTA 3PREA 4C7YA 5E6PA 2NBWB 1HXYD 4WURA 3VR9B 2ZW1A 1AARA 2L83A 4QAYA 1PGAA 4BKGA 2LGSA 4PYUA 2KMAA 3ZTCA 3B9JA 1WR6E 4BVUC 2D5GA 4NZLB 3R7QA 3A1QB 1QOGA 2K8BA 3RYTA 2WHIA 3PRMB 2L32A 1T0YA 2A4ZA 5D2MB 2K25A 1IYFA 5BMIA 1YQ3B 1XLOA 5J2RA 3U4EG 3P42A 1I4GA 4LNNA 2LI5A 2XEWA 1WI0A 2O6VA 4P16A 2INPE 3PHWB 3NZSA 1WXMA 1JWMD 1PGBA 2EELA 2V0GA 4WQOB 1UH6A 3A4SC 4PS8A 1PYWD 2M1MA 3KQ4A 3PS6A 2MLBA 4MJSB 4B0MA 1OQYA 1YNTE 2V1YA 4XC2A 4RF0A 3W1SA 1JWAD 3B2GA 1T5XD 1D6EC 3PHXB 1DOIA 1HTOA 1YQ4B 1FCLA 1JMLA 2M17A 2MW5A 3TBLD 2RPQA 1WZ3A 2WXFA 3L08A 2INDC 4DDID 2E6XA 2A5UA 5GXGB 3H7SA 1ZOYB 4L1BA 1XLNA 2MRPA 2LZ6A 4OZAA 3PLVA 2BF8B 2MHJA 3VTUA 2IDYA 1VCBA 1WIAA 4ACFA 2N9LA 2PVOD 3VXWA 2LGYA 3IVFA 5FK9C 5LXIB 5IN7A 3VR8B 4ZHPA 1P9DU 3KUCB 1K53A 2KYWA 2J53A 1WYWB 1FFUA 4CYEA 2FIFA 2PJHA 3HK0A 4KGTA 5C2TB 1TT5B 4FHJA 3APFA 3TEYA 2WXOA 5JHAA 4BKSD 1SSNA 1AWDA 3LDZE 3FILB 3AE5B 1D5ZC 2D10A 1D5XC 3U2SC 1GC6A 4IUMB 1YN4A 3I63C 2WDQB 2J42A 4DK5A 1JRUA 1RRBA 3TIXA 4RMAA 2LWPA 5C23A 3BYYB 4ZOHC 1XLQA 4FN2A 2NMQA 4Q2JA 3RULA 5JHBA 3EA6A 3EHVA 2L05A 2ZNVC 3SFDB 1TS4A 1UELA 2K5PA 2K9XA 5KHQA 3BZDB 4TKNA 3Q69A 3MC9A 1N62A 2NBVB 4YSYB 1HQRD 4W9FA 2QJLA 3UQBA 3AEFB 2GLSA 3PO0A 4LDTB 1EM7A 1NENB 2C7NB 2MX2A 4H2AA 2ONQA 4P1CC 1EWCA 1EWYC 4OW0A 1JQ4A 4C4VA 1A70A 2DBYA 1F1HA 3ZDMC 5J17A 2BKRB 2JVCA 2IGGA 2GBRA 5IO9A 1WF9A 4DWFA 5BYRA 2IGHA 3E9SA 2CU1A 2GBJA 3VH3B 2MWSB 3RNCC 2C9WB 1L7YA 1UGJA 4GN1A 1PFDA 3ZRFA 3H6NA 2KMCA 2AWTA 2ZPYA 1ZP0B 4MDKE 2OEDA 1B9RA 4WWOA 3BWUD 1TY0A 1YD8U 3VRBB 2KJHB 3VH4B 3TSSA 4YWGG 4F7ZA 3WA0A 1JRPA 1NI2A 3C0RB 3IAS1 4WAAA 4IWPA 3U7ZA 1UD7A 3O65B 1E8XA 1LFDA 4BAXA 2LVQA 1WZ0A 3QJZA 2KWCA 2PEAA 3P4QB 1ZDVA 2OJWA 2LGIA 5MPOA 3AMZA 1VJKA 3S2AA 2KWDA 1NDDA 3RCZA 3I3TB 1VDVA 4N58A 3J9CA 2WXQA 2BS3B 2WXNA 3KUDB 2KDBA 4LK0M 2RDHA 3ZO5B 2FUG1 2N7EA 4M02A 3WIMA 2G3QB 2W3RA 2BS2B 5AZGA 2QDFA 3APCA 2BS4B 2YEPB 1D4BA 2KFKA 3BK2A 2J4XA 2MSED 3R8BA 1FRRA 1FXAA 3VAWA 2KXJA 1DOYA 1Q5WB 2BVCA 4TUUA 1QT9A 3IAM1 3UI3A 4US9A 1WGDA 3RN9C 1D3ZA 3ZQ4A 2GBMA 4I6LB 2RMMA 3ZGZA 1E6EB 4W9GA 4R3DA 2EMSA 4K7SA 2JUOA 4W9KA 5LLIA 4OVZA 5CX3A 1R4MB 3DPDA 3DVNU 3N30A 3NVWA 1UZXB 1B1ZA 4AJYB 1WJUA 1MG4A 1YX5B 4FJVB 3P63A 3GB1A 3SFEB 4IDIA 2LRUA 3OWEB 3DHHC 1V1PA 2DYBA 5C1ZA 4G3XB 1UF0A 2H89B 1C79A 1WMHB 1VRAB 3P4RB 1V6EA 1WXQA 1XEEA 4MH0E 4ZHOA 2QCZA 1ZKHA 5D6JB 4NJCA 4ANVA 2ON8A 3CF6E 2I2YA 2NVUI 4M8MA 3AH7A 3V6EB 2KLCA 1T6BX 4WH4A 5E6JA 3UIPB 3TUOA 4RH6A 2KQ4X 4REZA 1FPYA 1E10A 2IZVB 2Y3AA 1Q0WB 4N59A 1EF1A 1MHXA 1UUPA 5IOIA 1EF5A 1YQBA 2RDBC 4YTNB 2C5LC 2GBNA 1XO3A 3UF8A 4E3CA 3ZXRA 3N9YC 1QOBA 1TS3A 4HPLB 1VD2A 4FXCA 2KTFA 2K1FA 2N1VA 2WXRA 3NS1A 3LXFA 2KDIA 1F77A 3ZKJC 1STEA 3ZW3A 4DQOC 2WXKA 1L0XB 2I1JA 1FMAD 2KFJA 4YSXB 2WXLA 1TJEA 1Y56A 2KACA 4FJYA 2N7JA 3NG0A 5D3DA 2FNJB 4DHJD 1KM7A 3D32A 4HKZE 1Z2MA 1VZ8A 2XNAC 1KJTA 2MBBB 3BY4B 4MGKE 1TIFA 2CHXA 2GOWA 4WJPA 2CHZA 1TY2A 2KTRA 2YEPF 2KN5A 1UWMA 3R2TA 2C60A 2O6VD 5EE1A 4M0WA 3QAQA 4XZ4A 2ZPNA 4MSQB 2ASQA 1E8YA 5C3JB 3TEWA 4I6PA 1NBFC 3V05A 3R2IA 1P3QU 3U52E 3OG5A 1V5OA 4B0EA 2J0KA 3PT2B 4HK2A 3BINA 1S1QB 2RD0A 1PQSA 2QMTA 4L23A 2QIEB 1M4VA 4ICUA 1N63A 1EU4A 2KN4A 4JWUC 1FRDA 1P1AA 2WLBA 3AE7B 4W9CA 2JWUA 1VZ7A 2WX0A 1FEHA 1FXIA 3HUIA 1ENFA 2KD0A 2M56B 2BB6A 2D07B 3BIID 2KQ7A 4C56C 1K51A 2IO0B 4NQKE 2KVZA 4B95A 1WM2A 3ZDTA 4FHKA 2OJRA 3DBHI 2XK5B 4AUQC 1WH3A 1L4ZB 1NEKB 1I7HA 4PK1A 1JWUD 3QK0A 3A9JA 1J8CA 4KIKA 4J6IA 4XX5A 1SE3A 4GU2A 2J0MA 3NVYA 3N20C 3X23A 2D3CA 2CHWA 5HKHA 2RR9A 3AE9B 4F8CB 2W82A 2PPHA 3A9KB 4HXDA 3PZDA 4TSSA 5CHVC 2L52A 4OZCA 1SE4A 2PIAA 4HPPA 2SEBD 3DVGX 2MBOA 1N6ZA 1YJ1A 2ZJDA 5DPSA 4A55A 1JWBD 3ZXVA 4G11A 3ZYYX 1JCKB 3RFZB 3IG3A 1QF6A 3ZLZA 2WU2B 3RNBC 1OTRB 3KUZA 4ARCA 4LDTD 1MPEA 2LD9A 1P0RA 3NS8A 1TYGB 4NJ6A 3PZ8A 2JXTA 2QILA 5EDSA 4WWMA 2DZJA 2N1WA 4MT5A 1ZUD2 2L00B 4C00A 3IHPC 4IOIE 4IM0A 4KDIC 5BYSA 4CO7A 1WSPA 3PGEA 5E6NA 3ZTDA 1FD6A 5TSSA 2Z59B 1WWTA 3R7RA 1MVKA 2LASA 1J19A 2K6QA 4WWPA 1WY8A 3K9OB 1WXAA 4P7IA 3ML8A 3L13A 5BMHA 1ZW7A 1AW7A 1WGHA 3B08A 2PE9A 2KANA 3VUWA 5AEKB 1UBQA 4ZRQA 1L4DB 3AXCA 5EE0A 1WJ6A 4G50A 2NPTA 1SGHA 2KTRB 3R66C 4XDCA 2D3GA 4TQ1A 4DBGA 3ZJVA 1LM8B 2LHDA 4AS1A 2AYOB 1G6JA 4NNJB 2M8SA 2R2QA 2BYEA 1QQRA 4M8NA 3RMKC 3L54A 4RM8A 1OEYA 2MJDA 1CK1A 4LNKA 3U8ZA 4ANUA 2IPKD 4DDGD 2JRHA 1I4XA 3L4PA 1P98A 1FIQA 1C4PA 3MHSD 3PVLA 3EFUA 1DGJA 2NR2A
chains in the Genus database with same CATH topology
2KQSA 3M63B 2KDFB 3QHTA 4A20A 4F7ZA 4HCPB 4IWQA 3WA0A 3SU8X 4GSWA 1NI2A 3C0RB 3ML9A 2C7MB 4DXAB 4NJ7A 5G2NA 4WAAA 5DPTA 3NZUA 4IWPA 1UD7A 3MJWA 3O65B 4EKUA 2J0JA 4II3B 1E8XA 1LFDA 2BWFA 3M62B 3N3KB 4MJSA 5CHWA 2LVQA 2LXAA 4IWOA 1WZ0A 2AL3A 3QJZA 2KWCA 2UWQA 2R2OA 2PEAA 1L2NA 2FCMA 1C3TA 3RD2A 4MM3A 4ZRKA 2L0FA 1BT0A 3TCAA 2IY1B 3S2AA 2LVOA 1NDDA 3RCZA 2HTHA 3I3TB 3GZNI 3DVGY 3NY5A 1LXDA 2LGXA 2RSUA 2DENB 4W9EA 3KUDB 4GB9A 2KDBA 2BWES 2ZVNA 2D2QA 2N7EA 3ZO5B 3H7PB 3VTVA 1WR1A 1TTNA 3B1LX 4JIOU 3WIMA 5LXHA 2G3QB 4KVGB 3QA8A 1Y8RC 2O2VA 2KJRA 4WWNA 5AZGA 3APCA 2L3ZA 4ASWC 3P2BA 2KFKA 3V60A 1V81A 2MSED 3NOBA 5D7GA 5L95C 1X1MA 3VAWA 2ZVOA 4HCNB 5DPRA 2KXJA 1Q5WB 4TUUA 4WJNA 2FUHB 2FIDA 1H4RA 2DZKA 1E8ZA 1EUVB 1WGDA 2BYFA 3UGBB 1D3ZA 2IBIB 1A5RA 2GBMA 4NAWA 3V61A 4I6LB 5TR5A 2N4FA 2L8JA 3VHTC 1EO6A 4MGZE 4W9GA 3JW0X 1RFAA 2FCSA 4ZYNA 1GG3A 2N9XA 3K9PB 4LCDE 2EMSA 4K7SA 2CKHB 2JUOA 1WX7A 4W9KA 4ZRJA 2MQJA 3CSTA 5CX3A 5LLIA 4K7UA 3DBLI 3DPDA 3QC8B 2ZEQA 3DVNU 2MA9B 3N30A 1UZXB 4KZ0A 4EZJA 4BBNF 4AJYB 2GMIC 1WJUA 1YX5B 4AOFA 1V5TA 5GMVA 4FJVB 2KK8A 4BFRA 1R4MI 5CTRC 2LGDA 2O6VB 4IW0A 2C7HA 3APDA 3QQ8B 3WAMA 3LJ3A 1UBIA 4GDKB 1WGRA 3JYUA 2LJ5A 1LQBA 5CHFA 2NBUA 1GUAB 3VDZA 4HDQA 3ZNZB 1V9JA 2LRUA 2LVPA 2KO3A 4ANWA 1IPGA 2DYBA 4W9JA 5C1ZA 4G3XB 1K8RB 3JVZX 1WMHB 3SHQA 3VFKA 4FJZA 4RM9A 2G4SA 4A3OA 3L17A 1WM3A 3DBRI 2JY6A 1SE9A 1V6EA 3OJ3A 1WMHA 3A9JB 4MH0E 3ZVVA 1CMXB 1ZKHA 5D6JB 3PRZA 2IO3B 4LJPB 5DCNA 4ANVA 2JRIB 3DQVA 2JXXA 3CF6E 4BKTA 1IP9A 3HM3A 2NVUI 3N32A 4M8MA 1V2YA 3V6EB 4PS3A 2JZ3B 4A3PA 2JT4B 2WDTB 3UINB 2KLCA 1I35A 3UIPB 3JSVB 2V3SA 3Q3JA 1E90A 1XT9B 3SDLC 2G45B 3JSVA 3W1YA 4HJKA 4N9F4 4TV3A 3MTNB 2KNBA 3ZIMA 3QIJA 2FAZA 3U30A 1E5WA 4II2B 1WE6A 2L7RA 3T8MA 1UGMA 2IZVB 2L76A 5JZEB 1WGGA 2IY0B 3H7PA 1Q0WB 3KH0A 2KZRA 1EF1A 4W9DA 1GJZA 2FCQA 2K8HA 4GGQA 4GIVA 4IC7B 1E7VA 1EF5A 3ZRCA 3EECA 5E6OA 1YQBA 2KC2A 3A9KA 3AU4A 5BO4B 2IO1B 3A1QA 3W1SC 3PV1A 3WAOA 1C1YB 1WJ4A 2C5LC 4IM3A 3H9DA 3U7DA 3PRPB 2GBNA 2WWZA 3UF8A 4E3CA 4WJQA 4GDLB 4AP4C 2K39A 4HLEA 2IYDB 4BKSA 4HPLB 1VD2A 4JLCA 1ZGUB 3DCGA 4BOZB 2KTFA 4FBJB 2K1FA 2CR5A 2KX0A 2N1VA 4NAWB 4GDKA 5J18A 4K81A 3DVNV 2ZCCA 2KDIA 1WE7A 3ZKJC 4ANXA 1M94A 3ZW3A 4DHZE 2RGFA 2I1JA 3KYDD 2KFJA 1OGWA 2KKCA 2KJ6A 2MBHA 2QHOA 4OVUA 4JGHB 2EMTA 2BGFA 3PREA 2D11A 4KSKC 4FJYA 2PE6B 5E6PA 2NBWB 3M95A 2FNJB 4DHJD 1KM7A 1MG8A 3D32A 1AARA 2DZMA 2JWZA 2KWUB 1Z2MA 2MP2B 4B6WA 4BOSC 4BKGA 1KJTA 2KMAA 4PYUA 2MBBB 5IAAC 2MBEA 1Q1OA 3BY4B 3VQIA 4IM2A 3ZTCA 3HIZA 4MGKE 2CHXA 2GOWA 4CHKA 1WR6E 4WJPA 2CHZA 4BVUC 1TGZB 2BYVE 3AI5A 4KSLC 3R7QA 2KTRA 4NPNA 2VRRB 3KVFB 3A1QB 4K7WA 2KN5A 2WX1A 3WANA 2C60A 3OAWA 5D94A 2YLMA 2IO2B 2K8BA 3RYTA 2O6VD 2DYMA 2AEHA 2LXCA 3V62A 5AZFA 3PRMB 3QX1A 3QAQA 4XZ4A 5DPWA 1T0YA 2ZPNA 4E74A 2W9NA 2A4ZA 4AJWA 4MSQB 5IA7A 2KX3A 4KDLB 1GC7A 2ASQA 5D2MB 2DX5B 4EOYA 2K25A 1E8YA 3PTFC 3DBSA 1IYFA 3KW5B 3QARA 4I6PA 1NBFC 3TL5A 5J2RA 3UQAA 3KYCD 1P3QU 3PSEB 2LI5A 1V5OA 2N9PC 2XEWA 3ZNHB 1WI0A 4AWJA 4URKA 2O6VA 3IFWB 3ECIA 4G0NB 2MCNB 2J0KA 3PHWB 3PT2B 4HK2A 3RZWC 3BINA 4M0WB 1HE8A 1U4AA 1S1QB 1WX8A 2RD0A 3NZSA 1WXMA 3R3MA 1PQSA 2KFKB 2KOXA 2ZCBA 1QZEA 3CMMB 4ICUA 2Z0EB 2MP2A 1P1AA 1WXSA 5L83A 4W9CA 4WQOB 2J7QB 3EC8A 2WX0A 2KWVB 1UH6A 2I1KA 3L0WB 1V86A 4W9HA 3A4SC 2N7DA 1WJNA 4PS8A 2KD0A 1XD3B 2M1MA 4WJOA 2M0XA 3PS6A 2MLBA 1RAXA 4FLHA 2D07B 4I6NB 4MJSB 4BBNC 1OQYA 2NS5A 3OLMD 3RZFA 2DYOA 1Z5SB 2DAJA 1R4NI 4GMVA 2KQ7A 2HJ8A 3QWZB 2V1YA 2BKFA 4XC2A 3ZUNA 3H1UA 2IO0B 3W1SA 3OJ4B 4NQKE 2LUEA 1KOTA 3VTWA 4B95A 1WM2A 3PHXB 3ZDTA 3GOEA 4FHKA 3B0AA 4W9LA 2G4DB 2OJRA 4YL8A 1KLVA 3DBHI 2XK5B 1J0GA 4AUQC 2M17A 3L16A 1WXVA 2MW5A 1WH3A 4GDLA 3TBLD 1S3SG 2Y5BB 2RPQA 2OOBB 1WZ3A 3QK0A 3A9JA 4MEMA 4FA6A 2DZIA 1J8CA 1ISNA 3L08A 1TZ1A 4KIKA 4DDID 2NCNA 4OVVA 4J6IA 4XX5A 4GU2A 2J0MA 2A5UA 3H7SA 3VUXA 2B3AA 2GBKA 3M3JA 3RT3B 3X23A 3ONSA 1E8WA 2CHWA 2K6DB 3ALBA 3TJPA 5HKHA 1H8CA 2RR9A 2NPTB 4F8CB 4PS7A 2MRPA 2LZ6A 4F1SA 2PPHA 3A9KB 4EEWA 4HXDA 4MGYE 3PLVA 3PZDA 5CHVC 4DHJB 2BF8B 1WGYA 3V6CB 2KC1A 3VTUA 2CS4A 1WX9A 1VCBA 3AU5A 1WIAA 3A33B 3VVWB 3VXWA 2LGYA 3IVFA 5LXIB 1XQQA 3A4RA 3DVGX 2MBOA 3VUYA 4TQ0A 1P9DU 1GNUA 3KUCB 4E71A 3ENEA 1YJ1A 2ZJDA 1V80A 5DPSA 5KHOA 1WYWB 4G11A 4CYEA 2FIFA 1V49A 1FXTB 2JZZA 2PJHA 3IG3A 4HPMB 2EKEC 3HK0A 2ZNVB 2KDEB 1I42A 4FHJA 3APFA 3ZLZA 2REXA 5JHAA 4BKSD 2MBQA 2KHWB 4FADA 1OTRB 3KUZA 3LDZE 4LDTD 2LD9A 1P0RA 3AULA 1OEYJ 4ICVA 2AL6A 2D10A 3DDCB 3PPAA 4MGIE 3NS8A 3WAPA 4NJ6A 2YVCA 1GC6A 4IUMB 4B9KA 5EDSA 4X57B 2XK5A 1JRUA 1RRBA 4NY0A 3TIXA 2DZJA 2ZZPB 4RMAA 2LWPA 2N1WA 5C23A 4W9IA 1SIFA 2L00B 4GXBA 3IHPC 4FN2A 4JQWC 3NHEB 3HM6X 4LJOB 4IM0A 4KDIC 3RULA 4MSMB 5JHBA 4CO7A 2O2VB 3PGEA 5E6NA 3ZTDA 2LRWA 2BPSA 2L05A 2ZNVC 2Z59B 3EHVA 4HDOA 4HVBA 1RLFA 1UELA 3R7RA 5JH5C 5KHQA 2LASA 1J19A 2K6QA 4TKNA 1WY8A 4WWPA 2Z0DB 3K9OB 4FULA 4DHZB 3T9LA 1WXAA 3L10B 2K8CA 1E7UA 1WFYA 2NBVB 3L13A 3ML8A 4P7IA 1ZW7A 3TMPB 4W9FA 1YIWA 1WGHA 3UQBA 3B08A 4ZRIA 2JF5A 4PYZA 4IG7B 2PE9A 2XBBC 3Q3FA 4LDTB 4JL9A 2KANA 2KVRA 3VUWA 3X0WA 5AEKB 1UBQA 2C7NB 2MX2A 3CSFA 3ZNGC 1YX6B 3AXCA 2V4LA 4KZCA 4ZDVA 1WJ6A 4G50A 2NPTA 1SGHA 3PLUA 1WRDB 4EFOA 4K1RB 4EUTA 2N9EB 5G55A 2KTRB 3SD5A 3R66C 4MELA 2D3GA 3UIOB 3ZDMC 4EZLA 4TQ1A 3IBEA 2KLGA 4DBGA 5J17A 4HWIB 2BKRB 4GOCA 1LM8B 2JVCA 2AYOB 2GBRA 1WF9A 1G6JA 4DWFA 4NNJB 2M8SA 2R2QA 4KIKB 2BYEA 2JPHA 4M8NA 5FR6A 3L54A 2CU1A 2GBJA 3VH3B 2MWSB 4RM8A 1OEYA 2C9WB 1L7YA 3RUIB 3U8ZA 4NQLB 4GN1A 3ZRFA 4ANUA 3H6NA 2KMCA 3WALA 2AWTA 4DDGD 2JRHA 2UYZB 2ZPYA 2DAFA 4MDKE 5AZHA 1F9JA 3ZNID 2WYQA 4DK5A 4EZKA 2FCNA 2HD5B 2HE7A 1TBEA 4WWOA 2M4NA 1P98A 3DOWA 4KV2A 1YD8U 2DHZA 2KJHB 3VH4B 3MHSD 3HHMA 3QCAA 2L0TA 3PVLA 3EFUA 2NR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQS A;  3M63 B;  2KDF B;  3QHT A;  4A20 A;  4F7Z A;  4HCP B;  4IWQ A;  3WA0 A;  3SU8 X;  4GSW A;  1NI2 A;  3C0R B;  3ML9 A;  2C7M B;  4DXA B;  4NJ7 A;  5G2N A;  4WAA A;  5DPT A;  3NZU A;  4IWP A;  1UD7 A;  3MJW A;  3O65 B;  4EKU A;  2J0J A;  4II3 B;  1E8X A;  1LFD A;  2BWF A;  3M62 B;  3N3K B;  4MJS A;  5CHW A;  2LVQ A;  2LXA A;  4IWO A;  1WZ0 A;  2AL3 A;  3QJZ A;  2KWC A;  2UWQ A;  2R2O A;  2PEA A;  1L2N A;  2FCM A;  1C3T A;  3RD2 A;  4MM3 A;  4ZRK A;  2L0F A;  1BT0 A;  3TCA A;  2IY1 B;  3S2A A;  2LVO A;  1NDD A;  3RCZ A;  2HTH A;  3I3T B;  3GZN I;  3DVG Y;  3NY5 A;  1LXD A;  2LGX A;  2RSU A;  2DEN B;  4W9E A;  3KUD B;  4GB9 A;  2KDB A;  2BWE S;  2ZVN A;  2D2Q A;  2N7E A;  3ZO5 B;  3H7P B;  3VTV A;  1WR1 A;  1TTN A;  3B1L X;  4JIO U;  3WIM A;  5LXH A;  2G3Q B;  4KVG B;  3QA8 A;  1Y8R C;  2O2V A;  2KJR A;  4WWN A;  5AZG A;  3APC A;  2L3Z A;  4ASW C;  3P2B A;  2KFK A;  3V60 A;  1V81 A;  2MSE D;  3NOB A;  5D7G A;  5L95 C;  1X1M A;  3VAW A;  2ZVO A;  4HCN B;  5DPR A;  2KXJ A;  1Q5W B;  4TUU A;  4WJN A;  2FUH B;  2FID A;  1H4R A;  2DZK A;  1E8Z A;  1EUV B;  1WGD A;  2BYF A;  3UGB B;  1D3Z A;  2IBI B;  1A5R A;  2GBM A;  4NAW A;  3V61 A;  4I6L B;  5TR5 A;  2N4F A;  2L8J A;  3VHT C;  1EO6 A;  4MGZ E;  4W9G A;  3JW0 X;  1RFA A;  2FCS A;  4ZYN A;  1GG3 A;  2N9X A;  3K9P B;  4LCD E;  2EMS A;  4K7S A;  2CKH B;  2JUO A;  1WX7 A;  4W9K A;  4ZRJ A;  2MQJ A;  3CST A;  5CX3 A;  5LLI A;  4K7U A;  3DBL I;  3DPD A;  3QC8 B;  2ZEQ A;  3DVN U;  2MA9 B;  3N30 A;  1UZX B;  4KZ0 A;  4EZJ A;  4BBN F;  4AJY B;  2GMI C;  1WJU A;  1YX5 B;  4AOF A;  1V5T A;  5GMV A;  4FJV B;  2KK8 A;  4BFR A;  1R4M I;  5CTR C;  2LGD A;  2O6V B;  4IW0 A;  2C7H A;  3APD A;  3QQ8 B;  3WAM A;  3LJ3 A;  1UBI A;  4GDK B;  1WGR A;  3JYU A;  2LJ5 A;  1LQB A;  5CHF A;  2NBU A;  1GUA B;  3VDZ A;  4HDQ A;  3ZNZ B;  1V9J A;  2LRU A;  2LVP A;  2KO3 A;  4ANW A;  1IPG A;  2DYB A;  4W9J A;  5C1Z A;  4G3X B;  1K8R B;  3JVZ X;  1WMH B;  3SHQ A;  3VFK A;  4FJZ A;  4RM9 A;  2G4S A;  4A3O A;  3L17 A;  1WM3 A;  3DBR I;  2JY6 A;  1SE9 A;  1V6E A;  3OJ3 A;  1WMH A;  3A9J B;  4MH0 E;  3ZVV A;  1CMX B;  1ZKH A;  5D6J B;  3PRZ A;  2IO3 B;  4LJP B;  5DCN A;  4ANV A;  2JRI B;  3DQV A;  2JXX A;  3CF6 E;  4BKT A;  1IP9 A;  3HM3 A;  2NVU I;  3N32 A;  4M8M A;  1V2Y A;  3V6E B;  4PS3 A;  2JZ3 B;  4A3P A;  2JT4 B;  2WDT B;  3UIN B;  2KLC A;  1I35 A;  3UIP B;  3JSV B;  2V3S A;  3Q3J A;  1E90 A;  1XT9 B;  3SDL C;  2G45 B;  3JSV A;  3W1Y A;  4HJK A;  4N9F 4;  4TV3 A;  3MTN B;  2KNB A;  3ZIM A;  3QIJ A;  2FAZ A;  3U30 A;  1E5W A;  4II2 B;  1WE6 A;  2L7R A;  3T8M A;  1UGM A;  2IZV B;  2L76 A;  5JZE B;  1WGG A;  2IY0 B;  3H7P A;  1Q0W B;  3KH0 A;  2KZR A;  1EF1 A;  4W9D A;  1GJZ A;  2FCQ A;  2K8H A;  4GGQ A;  4GIV A;  4IC7 B;  1E7V A;  1EF5 A;  3ZRC A;  3EEC A;  5E6O A;  1YQB A;  2KC2 A;  3A9K A;  3AU4 A;  5BO4 B;  2IO1 B;  3A1Q A;  3W1S C;  3PV1 A;  3WAO A;  1C1Y B;  1WJ4 A;  2C5L C;  4IM3 A;  3H9D A;  3U7D A;  3PRP B;  2GBN A;  2WWZ A;  3UF8 A;  4E3C A;  4WJQ A;  4GDL B;  4AP4 C;  2K39 A;  4HLE A;  2IYD B;  4BKS A;  4HPL B;  1VD2 A;  4JLC A;  1ZGU B;  3DCG A;  4BOZ B;  2KTF A;  4FBJ B;  2K1F A;  2CR5 A;  2KX0 A;  2N1V A;  4NAW B;  4GDK A;  5J18 A;  4K81 A;  3DVN V;  2ZCC A;  2KDI A;  1WE7 A;  3ZKJ C;  4ANX A;  1M94 A;  3ZW3 A;  4DHZ E;  2RGF A;  2I1J A;  3KYD D;  2KFJ A;  1OGW A;  2KKC A;  2KJ6 A;  2MBH A;  2QHO A;  4OVU A;  4JGH B;  2EMT A;  2BGF A;  3PRE A;  2D11 A;  4KSK C;  4FJY A;  2PE6 B;  5E6P A;  2NBW B;  3M95 A;  2FNJ B;  4DHJ D;  1KM7 A;  1MG8 A;  3D32 A;  1AAR A;  2DZM A;  2JWZ A;  2KWU B;  1Z2M A;  2MP2 B;  4B6W A;  4BOS C;  4BKG A;  1KJT A;  2KMA A;  4PYU A;  2MBB B;  5IAA C;  2MBE A;  1Q1O A;  3BY4 B;  3VQI A;  4IM2 A;  3ZTC A;  3HIZ A;  4MGK E;  2CHX A;  2GOW A;  4CHK A;  1WR6 E;  4WJP A;  2CHZ A;  4BVU C;  1TGZ B;  2BYV E;  3AI5 A;  4KSL C;  3R7Q A;  2KTR A;  4NPN A;  2VRR B;  3KVF B;  3A1Q B;  4K7W A;  2KN5 A;  2WX1 A;  3WAN A;  2C60 A;  3OAW A;  5D94 A;  2YLM A;  2IO2 B;  2K8B A;  3RYT A;  2O6V D;  2DYM A;  2AEH A;  2LXC A;  3V62 A;  5AZF A;  3PRM B;  3QX1 A;  3QAQ A;  4XZ4 A;  5DPW A;  1T0Y A;  2ZPN A;  4E74 A;  2W9N A;  2A4Z A;  4AJW A;  4MSQ B;  5IA7 A;  2KX3 A;  4KDL B;  1GC7 A;  2ASQ A;  5D2M B;  2DX5 B;  4EOY A;  2K25 A;  1E8Y A;  3PTF C;  3DBS A;  1IYF A;  3KW5 B;  3QAR A;  4I6P A;  1NBF C;  3TL5 A;  5J2R A;  3UQA A;  3KYC D;  1P3Q U;  3PSE B;  2LI5 A;  1V5O A;  2N9P C;  2XEW A;  3ZNH B;  1WI0 A;  4AWJ A;  4URK A;  2O6V A;  3IFW B;  3ECI A;  4G0N B;  2MCN B;  2J0K A;  3PHW B;  3PT2 B;  4HK2 A;  3RZW C;  3BIN A;  4M0W B;  1HE8 A;  1U4A A;  1S1Q B;  1WX8 A;  2RD0 A;  3NZS A;  1WXM A;  3R3M A;  1PQS A;  2KFK B;  2KOX A;  2ZCB A;  1QZE A;  3CMM B;  4ICU A;  2Z0E B;  2MP2 A;  1P1A A;  1WXS A;  5L83 A;  4W9C A;  4WQO B;  2J7Q B;  3EC8 A;  2WX0 A;  2KWV B;  1UH6 A;  2I1K A;  3L0W B;  1V86 A;  4W9H A;  3A4S C;  2N7D A;  1WJN A;  4PS8 A;  2KD0 A;  1XD3 B;  2M1M A;  4WJO A;  2M0X A;  3PS6 A;  2MLB A;  1RAX A;  4FLH A;  2D07 B;  4I6N B;  4MJS B;  4BBN C;  1OQY A;  2NS5 A;  3OLM D;  3RZF A;  2DYO A;  1Z5S B;  2DAJ A;  1R4N I;  4GMV A;  2KQ7 A;  2HJ8 A;  3QWZ B;  2V1Y A;  2BKF A;  4XC2 A;  3ZUN A;  3H1U A;  2IO0 B;  3W1S A;  3OJ4 B;  4NQK E;  2LUE A;  1KOT A;  3VTW A;  4B95 A;  1WM2 A;  3PHX B;  3ZDT A;  3GOE A;  4FHK A;  3B0A A;  4W9L A;  2G4D B;  2OJR A;  4YL8 A;  1KLV A;  3DBH I;  2XK5 B;  1J0G A;  4AUQ C;  2M17 A;  3L16 A;  1WXV A;  2MW5 A;  1WH3 A;  4GDL A;  3TBL D;  1S3S G;  2Y5B B;  2RPQ A;  2OOB B;  1WZ3 A;  3QK0 A;  3A9J A;  4MEM A;  4FA6 A;  2DZI A;  1J8C A;  1ISN A;  3L08 A;  1TZ1 A;  4KIK A;  4DDI D;  2NCN A;  4OVV A;  4J6I A;  4XX5 A;  4GU2 A;  2J0M A;  2A5U A;  3H7S A;  3VUX A;  2B3A A;  2GBK A;  3M3J A;  3RT3 B;  3X23 A;  3ONS A;  1E8W A;  2CHW A;  2K6D B;  3ALB A;  3TJP A;  5HKH A;  1H8C A;  2RR9 A;  2NPT B;  4F8C B;  4PS7 A;  2MRP A;  2LZ6 A;  4F1S A;  2PPH A;  3A9K B;  4EEW A;  4HXD A;  4MGY E;  3PLV A;  3PZD A;  5CHV C;  4DHJ B;  2BF8 B;  1WGY A;  3V6C B;  2KC1 A;  3VTU A;  2CS4 A;  1WX9 A;  1VCB A;  3AU5 A;  1WIA A;  3A33 B;  3VVW B;  3VXW A;  2LGY A;  3IVF A;  5LXI B;  1XQQ A;  3A4R A;  3DVG X;  2MBO A;  3VUY A;  4TQ0 A;  1P9D U;  1GNU A;  3KUC B;  4E71 A;  3ENE A;  1YJ1 A;  2ZJD A;  1V80 A;  5DPS A;  5KHO A;  1WYW B;  4G11 A;  4CYE A;  2FIF A;  1V49 A;  1FXT B;  2JZZ A;  2PJH A;  3IG3 A;  4HPM B;  2EKE C;  3HK0 A;  2ZNV B;  2KDE B;  1I42 A;  4FHJ A;  3APF A;  3ZLZ A;  2REX A;  5JHA A;  4BKS D;  2MBQ A;  2KHW B;  4FAD A;  1OTR B;  3KUZ A;  3LDZ E;  4LDT D;  2LD9 A;  1P0R A;  3AUL A;  1OEY J;  4ICV A;  2AL6 A;  2D10 A;  3DDC B;  3PPA A;  4MGI E;  3NS8 A;  3WAP A;  4NJ6 A;  2YVC A;  1GC6 A;  4IUM B;  4B9K A;  5EDS A;  4X57 B;  2XK5 A;  1JRU A;  1RRB A;  4NY0 A;  3TIX A;  2DZJ A;  2ZZP B;  4RMA A;  2LWP A;  2N1W A;  5C23 A;  4W9I A;  1SIF A;  2L00 B;  4GXB A;  3IHP C;  4FN2 A;  4JQW C;  3NHE B;  3HM6 X;  4LJO B;  4IM0 A;  4KDI C;  3RUL A;  4MSM B;  5JHB A;  4CO7 A;  2O2V B;  3PGE A;  5E6N A;  3ZTD A;  2LRW A;  2BPS A;  2L05 A;  2ZNV C;  2Z59 B;  3EHV A;  4HDO A;  4HVB A;  1RLF A;  1UEL A;  3R7R A;  5JH5 C;  5KHQ A;  2LAS A;  1J19 A;  2K6Q A;  4TKN A;  1WY8 A;  4WWP A;  2Z0D B;  3K9O B;  4FUL A;  4DHZ B;  3T9L A;  1WXA A;  3L10 B;  2K8C A;  1E7U A;  1WFY A;  2NBV B;  3L13 A;  3ML8 A;  4P7I A;  1ZW7 A;  3TMP B;  4W9F A;  1YIW A;  1WGH A;  3UQB A;  3B08 A;  4ZRI A;  2JF5 A;  4PYZ A;  4IG7 B;  2PE9 A;  2XBB C;  3Q3F A;  4LDT B;  4JL9 A;  2KAN A;  2KVR A;  3VUW A;  3X0W A;  5AEK B;  1UBQ A;  2C7N B;  2MX2 A;  3CSF A;  3ZNG C;  1YX6 B;  3AXC A;  2V4L A;  4KZC A;  4ZDV A;  1WJ6 A;  4G50 A;  2NPT A;  1SGH A;  3PLU A;  1WRD B;  4EFO A;  4K1R B;  4EUT A;  2N9E B;  5G55 A;  2KTR B;  3SD5 A;  3R66 C;  4MEL A;  2D3G A;  3UIO B;  3ZDM C;  4EZL A;  4TQ1 A;  3IBE A;  2KLG A;  4DBG A;  5J17 A;  4HWI B;  2BKR B;  4GOC A;  1LM8 B;  2JVC A;  2AYO B;  2GBR A;  1WF9 A;  1G6J A;  4DWF A;  4NNJ B;  2M8S A;  2R2Q A;  4KIK B;  2BYE A;  2JPH A;  4M8N A;  5FR6 A;  3L54 A;  2CU1 A;  2GBJ A;  3VH3 B;  2MWS B;  4RM8 A;  1OEY A;  2C9W B;  1L7Y A;  3RUI B;  3U8Z A;  4NQL B;  4GN1 A;  3ZRF A;  4ANU A;  3H6N A;  2KMC A;  3WAL A;  2AWT A;  4DDG D;  2JRH A;  2UYZ B;  2ZPY A;  2DAF A;  4MDK E;  5AZH A;  1F9J A;  3ZNI D;  2WYQ A;  4DK5 A;  4EZK A;  2FCN A;  2HD5 B;  2HE7 A;  1TBE A;  4WWO A;  2M4N A;  1P98 A;  3DOW A;  4KV2 A;  1YD8 U;  2DHZ A;  2KJH B;  3VH4 B;  3MHS D;  3HHM A;  3QCA A;  2L0T A;  3PVL A;  3EFU A;  2NR2 A; 
#chains in the Genus database with same CATH topology
 2KQS A;  3SU8 X;  2H88 B;  2KT7 A;  2MEK A;  3DWG C;  3AE2 B;  2LUM A;  3BVM A;  3LYY A;  2BWF A;  2Q5W D;  4RGO S;  4MJS A;  2CJN A;  5CHW A;  2K3U A;  1AN8 A;  2R2O A;  1BXT A;  2LMC A;  1TZO A;  4MM3 A;  4ZRK A;  1BT0 A;  2LVO A;  2HTH A;  3NY5 A;  2DEN B;  4W9E A;  3MFG A;  4XDD A;  1ROE A;  3Q2A C;  1HEZ E;  5BMG A;  2UU7 A;  4JX1 C;  4JIO U;  5LXH A;  2Y5C A;  4KVG B;  2INN E;  2O2V A;  4WWN A;  1ACC A;  2WNM A;  4ASW C;  3P2B A;  3V60 A;  1V81 A;  4IKG A;  4HCN B;  4XE0 A;  2FUH B;  4A8X C;  1IUE A;  1E8Z A;  5G5H A;  2IBI B;  1FM0 D;  3AE3 B;  2PMV A;  1F0Z A;  2N4F A;  5FKA C;  1C77 A;  2RPV A;  4ZYN A;  5T8I A;  3K9P B;  3AV8 A;  4MH8 A;  1E0Z A;  4JWS C;  1V5T A;  5GMV A;  4OHJ A;  4ITK A;  5CTR C;  2LGD A;  2O6V B;  3APD A;  1NYQ A;  1T0Q C;  5LNK 1;  4GDK B;  2V3P A;  1WGR A;  2B76 B;  2DLB A;  2NBU A;  4XWT A;  3ZNZ B;  1NYR A;  1XF5 L;  3SHQ A;  4AQ7 A;  3VFK A;  4FJZ A;  2G4S A;  1WM3 A;  3OJ3 A;  1WMH A;  1XCT L;  3PRZ A;  4XGA B;  1PUT A;  2IO3 B;  5DCN A;  1TKG A;  3N32 A;  2PLP A;  4PS3 A;  4HRS A;  2JT4 B;  2WDT B;  3UIN B;  2D3A A;  1N5W A;  3JSV B;  2V3S A;  2CJO A;  2G45 B;  4TV3 A;  3MTN B;  2FAZ A;  1KFY B;  1E5W A;  4II2 B;  1UGM A;  3RNE C;  2IY0 B;  1NI3 A;  2KZR A;  2ACZ B;  3AEB B;  3ZJT A;  3ZRC A;  5E6O A;  3A9K A;  3AU4 A;  2IO1 B;  2M19 A;  3WAO A;  4YT0 B;  1C1Y B;  1WJ4 A;  3GP7 A;  1ET9 A;  3H9D A;  3U7D A;  3PRP B;  4PT5 A;  3Q3O C;  1P7F A;  4HLE A;  2QC8 A;  2FBW B;  4BKS A;  4BOZ B;  4MM3 B;  4K81 A;  2ZCC A;  1WE7 A;  1M94 A;  2KKC A;  2ICI A;  4OVU A;  4RGM A;  2D11 A;  4KSK C;  2PE6 B;  3W9C B;  3BK1 A;  3M95 A;  1KF6 B;  1YMH E;  2KMM A;  2JWZ A;  2KWU B;  4HEA 1;  2VH1 A;  1L0V B;  2MBE A;  3HIZ A;  3AI5 A;  2BYV E;  3B2F A;  2VRR B;  3KVF B;  3Q8C A;  3WAN A;  2WXG A;  3H8H A;  2KAJ A;  5D94 A;  2IO2 B;  2AEH A;  1DOX A;  1XXG A;  2QEJ C;  5AZF A;  3QX1 A;  1SF0 A;  1L5P A;  2W9N A;  1SBB B;  1CQV A;  1P7E A;  2KX3 A;  2LFI A;  4KDL B;  4EOY A;  1GOZ A;  1SEB D;  2WXJ A;  4K3C A;  3KW5 B;  3QAR A;  2WGS A;  4K3B A;  3NZ3 A;  3EUB 2;  2N9P C;  4KX6 B;  4URK A;  4G0N B;  4M0W B;  1HE8 A;  4A90 A;  3T3N A;  3R3M A;  2KFK B;  2KOX A;  1IBX B;  3CMM B;  1TKY A;  2BB5 A;  2Z0E B;  2PVG C;  4YTP B;  1WXS A;  5L83 A;  2PTL A;  2WDR B;  2G1E A;  2J7Q B;  3EC8 A;  2I1K A;  4JE3 B;  3L0W B;  1WJN A;  3FAH A;  1XD3 B;  1Q10 A;  4WJO A;  2M0X A;  1RAX A;  4FLH A;  2NS5 A;  3OLM D;  2DYO A;  1Z5S B;  5HFY A;  1R4N I;  4GMV A;  3W5U B;  2NTS A;  3W2D A;  1MJD A;  3VTW A;  1YN3 A;  4NAM A;  4LNI A;  3B0A A;  4W9L A;  2G4D B;  4YL8 A;  2D3B A;  3IT6 B;  4OZB A;  2Y5B B;  1IGC A;  2OOB B;  1GPX A;  1TZ1 A;  2NCN A;  3O13 A;  2MJE A;  3HVZ A;  2M0A A;  2B3A A;  2GBK A;  3M3J A;  3ONS A;  3E56 A;  3TJP A;  1SJE D;  1ZE3 D;  1C9F A;  4PS7 A;  1J7A A;  4GLS C;  4DHJ B;  2IJ0 A;  1FO4 A;  1WX9 A;  2V9H A;  3A33 B;  3A4R A;  1I4P A;  3VUY A;  4TQ0 A;  3SEB A;  2X38 A;  4E71 A;  3ENE A;  1LGR A;  1V80 A;  4JPS A;  4CQN A;  3DBH B;  4M00 A;  2LHE A;  2EKE C;  1IGD A;  1WYG A;  3Q8A A;  3EGR A;  2REX A;  2K22 A;  2MBQ A;  2KHW B;  2ZW0 A;  4FAD A;  2K0P A;  2LJI A;  2PW9 A;  4RGT A;  2JSV X;  4C7Z A;  4ICV A;  3PPA A;  4MGI E;  1QKZ A;  2YVC A;  1HA5 A;  4B9K A;  3RNF C;  4RFB A;  2X8X X;  4X57 B;  2XK5 A;  4NY0 A;  1YOV B;  4W9I A;  4GXB A;  3I57 A;  4JQW C;  3NHE B;  4MSM B;  1L6U A;  2SAK A;  2O2V B;  2LRW A;  2E3T A;  4HDO A;  4HVB A;  3TEZ A;  1RLF A;  1BML C;  4C4V B;  3AB5 A;  1K50 A;  3AEC B;  3T9L A;  4HJG E;  3AE6 B;  1HZ6 A;  3L10 B;  3TMP B;  4YTM B;  4ZRI A;  2XBB C;  3Q3F A;  2WP9 B;  4JL9 A;  2KVR A;  3V3X A;  3CSF A;  1E9M A;  1SE2 A;  3ZNG C;  1YX6 B;  3KLS X;  4KZC A;  2DWQ A;  1WRD B;  2IGD A;  1I4Q A;  2N9E B;  4EUT A;  2AX5 A;  3UIO B;  3KWV A;  2KLG A;  4HWI B;  2JPH A;  2WXH A;  3AE4 B;  1V1O A;  2W3S A;  3N1Y C;  4EE2 A;  4A9A A;  3N1Z C;  2AQ3 B;  2UYZ B;  2INC C;  2WXP A;  4EZK A;  2HD5 B;  2WQY B;  1RM6 C;  2HE7 A;  1TBE A;  2WU5 B;  1ZXI A;  2DHZ A;  4KGS A;  3HHM A;  3QCA A;  1HZ5 A;  2L0T A;  4MAC A;  2NTT A;  4LJP B;  3FIL A;  2JX5 A;  3SR6 A;  3Q8E A;  1J7C A;  3M63 B;  2KDF B;  2BQQ A;  1VR9 A;  4A20 A;  4IWQ A;  4L2Y A;  1V97 A;  2BTE A;  3ML9 A;  2C7M B;  4DXA B;  4NJ7 A;  3Q6B A;  3NZU A;  3MJW A;  5AUK A;  1N61 A;  4II3 B;  2WS3 B;  3M62 B;  3N3K B;  4IWO A;  2AL3 A;  2UWQ A;  2FCM A;  1C3T A;  3RD2 A;  2L0F A;  3NUH B;  3NRZ A;  3RNA C;  1R7S A;  3GZN I;  3DVG Y;  1KLG D;  4WAF A;  2LGX A;  4S17 A;  1YJJ A;  3DWM A;  3MP9 A;  2D2Q A;  3VTV A;  3AE8 B;  1WR1 A;  3FC4 A;  4LNF A;  2KJR A;  2L3Z A;  1ZPS A;  1QLB B;  2JZP A;  5L95 C;  1X1M A;  2ZVO A;  5DPR A;  3Q8B A;  2FID A;  2DZK A;  1EUV B;  3AED B;  3VHT C;  2WXI A;  3LB8 C;  5HG2 A;  1YN5 A;  3JW0 X;  2AQ2 B;  2FCS A;  1GG3 A;  3DHG C;  4LCD E;  2MQJ A;  3CST A;  4M01 A;  2MA9 B;  4KZ0 A;  3AEA B;  2BW2 A;  1PDX A;  4BFR A;  1R4M I;  4IW0 A;  3QQ8 B;  1I4H A;  3LJ3 A;  3NVV A;  3DHI C;  1UNS A;  2LJ5 A;  1LQB A;  3DBR B;  4A6Q A;  1GUA B;  2BYT A;  4ZRP A;  1IPG A;  1K8R B;  3DBL B;  4RM9 A;  3L17 A;  5EE9 A;  2JY6 A;  3Q8F A;  3A9J B;  2FE8 A;  3ZVV A;  3DQV A;  1SJH D;  2JXX A;  4BKT A;  1IP9 A;  4KKI A;  1V1P B;  1KLU D;  2R61 A;  3Q3J A;  1E90 A;  5EE3 A;  3JSV A;  3W1Y A;  4HJK A;  4N9F 4;  5AUI A;  2KNB A;  3ZIM A;  3CWI A;  3QIJ A;  3AM9 A;  3U30 A;  1OQQ A;  4N6E B;  2RDG A;  3T8M A;  1T0S C;  1WGG A;  1R4N B;  3KH0 A;  5G5G A;  3AEE B;  4W9D A;  2FCQ A;  2L1A A;  4GIV A;  1KH0 A;  3ZJU A;  2KC2 A;  3PV1 A;  4IM3 A;  2GI9 A;  4GDL B;  3WCQ A;  4AP4 C;  1TS5 A;  2IYD B;  1ZGU B;  4FBJ B;  2GB1 A;  2KX0 A;  2V4I B;  3MHZ A;  3DVN V;  1FNW A;  1JWS D;  2RGF A;  3KYD D;  2QHO A;  1OGW A;  4JGH B;  2BBC A;  2BGF A;  3FKY A;  2JU6 X;  1NVI D;  1MG8 A;  4LNO A;  2DZM A;  4RNA A;  1TKE A;  2MP2 B;  4B6W A;  4BOS C;  4EFO A;  5IAA C;  3ABV B;  3VQI A;  1Q1O A;  4IM2 A;  1PGX A;  4CHK A;  3IXS A;  1TGZ B;  3RNG C;  4KSL C;  4NPN A;  4K7W A;  2WX1 A;  1F2R C;  1GB4 A;  3OAW A;  2YLM A;  2DYM A;  2LXC A;  3V62 A;  5DPW A;  1T3Q A;  4RF1 A;  1OQR A;  1K52 A;  4E74 A;  4RCO A;  4AJW A;  5IA7 A;  3Q3M C;  1GC7 A;  2DX5 B;  3PTF C;  4WQM A;  3DBS A;  3I9V 1;  4LLG M;  1GAQ B;  3TL5 A;  3UQA A;  3KYC D;  1SB3 C;  3PSE B;  3ZNH B;  1ZDX A;  1F52 A;  4AWJ A;  3IFW B;  3ECI A;  2MCN B;  3RZW C;  1U4A A;  2TSS A;  1WX8 A;  2ZCB A;  1QZE A;  2MP2 A;  4LTU A;  4KGR A;  3P4S B;  5JXV A;  2KWV B;  1V86 A;  4W9H A;  2N7D A;  1LO5 D;  4BBN C;  4I6N B;  3RZF A;  2DAJ A;  2HJ8 A;  3QWZ B;  2BKF A;  3ZUN A;  3H1U A;  3OJ4 B;  2W54 A;  2LUE A;  1KOT A;  1TS2 A;  3GOE A;  1E7P B;  1C76 A;  1KLV A;  1J0G A;  1L6V A;  3L16 A;  1WXV A;  4GDL A;  1JRO A;  1S3S G;  1N5X A;  4MEM A;  4FA6 A;  2DZI A;  1ISN A;  5BYQ A;  4OVV A;  1AYF A;  2HDE A;  3CIR B;  1D5M C;  1ESF A;  1SIJ A;  3I5J C;  3VUX A;  3RT3 B;  1QIL A;  1E8W A;  3ALB A;  2K6D B;  1H8C A;  2NPT B;  4RGN A;  4F1S A;  4EEW A;  4MGY E;  1WGY A;  2VH2 A;  2KC1 A;  3V6C B;  2CS4 A;  3AU5 A;  3VVW B;  1XQQ A;  3P1M A;  1GNU A;  5KHO A;  4XYC A;  1V49 A;  1FXT B;  2JZZ A;  3BVG A;  4HPM B;  2ZNV B;  2KDE B;  1I42 A;  5H8Y E;  4UDU C;  3GZN B;  5FR3 A;  2WDV B;  4ARI A;  3AUL A;  1OEY J;  3PZ7 A;  2AL6 A;  3DDC B;  3WAP A;  1IBX A;  3N1X C;  3W5V B;  4KKJ A;  2CU3 A;  1F2R I;  2ZZP B;  4O1N A;  3GE3 C;  1SIF A;  1SXT A;  2OHF A;  1C4C A;  4ZYS A;  1MFW A;  3HM6 X;  4LJO B;  3NVZ A;  2JQR B;  2BT6 A;  2BPS A;  2V3N A;  5JH5 C;  1ZXH A;  2Z0D B;  2WXM A;  4FUL A;  4DHZ B;  4US8 A;  2K8C A;  1E7U A;  1WFY A;  1JW9 D;  1YIW A;  4WIP A;  2JF5 A;  3KWL A;  4PYZ A;  4IG7 B;  1L0Y B;  3X0W A;  3MC8 A;  1QOF A;  1RFK A;  2I38 A;  4ZDV A;  2V4L A;  1CJE A;  3PLU A;  4K1R B;  3SD5 A;  2N9K A;  5G55 A;  4MEL A;  4EZL A;  3IBE A;  3VRA B;  4GOC A;  2Y5P A;  1RWS A;  4KIK B;  3GE8 C;  5FR6 A;  1YJI A;  5IKC M;  1KTK A;  4P6V F;  4BZA A;  3HRD D;  3RUI B;  2JYT A;  4NQL B;  1FNU A;  3WAL A;  2DAF A;  2W55 A;  5AZH A;  1J7B A;  1F9J A;  3ZNI D;  2WYQ A;  2FCN A;  2MJ3 A;  1FCC C;  1N60 A;  2G9H D;  1VZ6 A;  2M4N A;  3T3O A;  3DOW A;  4KV2 A;  3QHT A;  4HCP B;  1QOA A;  3Q14 C;  4GSW A;  3C19 A;  2LEK A;  4EKU A;  5G2N A;  4C80 A;  5DPT A;  2J0J A;  1HTQ A;  4D2K A;  1FFV A;  2LXA A;  2VZK B;  4TMA B;  1KRH A;  1L2N A;  4DXF A;  1I4R A;  5H92 C;  3P4P B;  3TCA A;  2IY1 B;  1T0R C;  2N0S B;  3RI7 C;  4YXD B;  1LXD A;  2XN9 C;  2RSU A;  4GB9 A;  2BWE S;  2ZVN A;  4YSZ B;  3H7P B;  3B1L X;  1TTN A;  3BYT B;  3QA8 A;  1Y8R C;  3NJT A;  3URY A;  3BVZ A;  3GS2 A;  3NOB A;  5D7G A;  2HJ1 A;  3C8Y A;  4WJN A;  1WGK A;  2HTM E;  3AN1 A;  1H4R A;  3UGB B;  2BYF A;  1MI0 A;  1A5R A;  3V61 A;  4NAW A;  5TR5 A;  2L8J A;  2DNF A;  1EO6 A;  1XLP A;  4MGZ E;  5D3I B;  1RFA A;  2N9X A;  4ZRJ A;  2CKH B;  1WX7 A;  4K7U A;  3DBL I;  3QC8 B;  2ZEQ A;  1C78 A;  2JYE A;  5I4D A;  4HKQ A;  4EZJ A;  4BBN F;  2GMI C;  4AOF A;  2KK8 A;  2MH7 A;  3MJ5 A;  3MC0 B;  2QSD A;  2C7H A;  1OFF A;  3WAM A;  1BUI C;  1UBI A;  3JYU A;  3EFC A;  2VZK D;  5CHF A;  4XWW A;  1VLB A;  4HDQ A;  3VDZ A;  1V9J A;  1EU3 A;  2LVP A;  2KO3 A;  4ANW A;  3AE1 B;  4W9J A;  3HVD A;  3JVZ X;  3TEX A;  4A3O A;  3DBR I;  1SE9 A;  4J3O D;  1CMX B;  3ETR A;  2JRI B;  3Q3N C;  3AEG B;  3HM3 A;  1XCQ L;  2Z8L A;  1V2Y A;  2JZ3 B;  4A3P A;  2GRI A;  1I35 A;  1XT9 B;  3SDL C;  3IT4 B;  5HI1 A;  4USA A;  1WE6 A;  2L7R A;  2PKO A;  4P1B C;  1UWX A;  5HHD G;  2L76 A;  3RPF C;  5IP4 D;  5JZE B;  3H7P A;  1FNV A;  2J52 A;  1GJZ A;  1C4A A;  2K8H A;  4GGQ A;  4IC7 B;  1E7V A;  1MHH E;  3EEC A;  1JAL A;  1V8C A;  5BO4 B;  3A1Q A;  3W1S C;  1WRI A;  1GB1 A;  2WWZ A;  4WJQ A;  2K39 A;  1DYQ A;  4JLC A;  3DCG A;  2CR5 A;  4NAW B;  2EKI A;  4GDK A;  5J18 A;  1ET6 A;  4S0R A;  1RYJ A;  4ANX A;  2KDM A;  4DXG A;  1CZP A;  4DHZ E;  4HRO A;  2MBH A;  2AQ1 B;  2KJ6 A;  2EMT A;  3PRE A;  4C7Y A;  5E6P A;  2NBW B;  1HXY D;  4WUR A;  3VR9 B;  2ZW1 A;  1AAR A;  2L83 A;  4QAY A;  1PGA A;  4BKG A;  2LGS A;  4PYU A;  2KMA A;  3ZTC A;  3B9J A;  1WR6 E;  4BVU C;  2D5G A;  4NZL B;  3R7Q A;  3A1Q B;  1QOG A;  2K8B A;  3RYT A;  2WHI A;  3PRM B;  2L32 A;  1T0Y A;  2A4Z A;  5D2M B;  2K25 A;  1IYF A;  5BMI A;  1YQ3 B;  1XLO A;  5J2R A;  3U4E G;  3P42 A;  1I4G A;  4LNN A;  2LI5 A;  2XEW A;  1WI0 A;  2O6V A;  4P16 A;  2INP E;  3PHW B;  3NZS A;  1WXM A;  1JWM D;  1PGB A;  2EEL A;  2V0G A;  4WQO B;  1UH6 A;  3A4S C;  4PS8 A;  1PYW D;  2M1M A;  3KQ4 A;  3PS6 A;  2MLB A;  4MJS B;  4B0M A;  1OQY A;  1YNT E;  2V1Y A;  4XC2 A;  4RF0 A;  3W1S A;  1JWA D;  3B2G A;  1T5X D;  1D6E C;  3PHX B;  1DOI A;  1HTO A;  1YQ4 B;  1FCL A;  1JML A;  2M17 A;  2MW5 A;  3TBL D;  2RPQ A;  1WZ3 A;  2WXF A;  3L08 A;  2IND C;  4DDI D;  2E6X A;  2A5U A;  5GXG B;  3H7S A;  1ZOY B;  4L1B A;  1XLN A;  2MRP A;  2LZ6 A;  4OZA A;  3PLV A;  2BF8 B;  2MHJ A;  3VTU A;  2IDY A;  1VCB A;  1WIA A;  4ACF A;  2N9L A;  2PVO D;  3VXW A;  2LGY A;  3IVF A;  5FK9 C;  5LXI B;  5IN7 A;  3VR8 B;  4ZHP A;  1P9D U;  3KUC B;  1K53 A;  2KYW A;  2J53 A;  1WYW B;  1FFU A;  4CYE A;  2FIF A;  2PJH A;  3HK0 A;  4KGT A;  5C2T B;  1TT5 B;  4FHJ A;  3APF A;  3TEY A;  2WXO A;  5JHA A;  4BKS D;  1SSN A;  1AWD A;  3LDZ E;  3FIL B;  3AE5 B;  1D5Z C;  2D10 A;  1D5X C;  3U2S C;  1GC6 A;  4IUM B;  1YN4 A;  3I63 C;  2WDQ B;  2J42 A;  4DK5 A;  1JRU A;  1RRB A;  3TIX A;  4RMA A;  2LWP A;  5C23 A;  3BYY B;  4ZOH C;  1XLQ A;  4FN2 A;  2NMQ A;  4Q2J A;  3RUL A;  5JHB A;  3EA6 A;  3EHV A;  2L05 A;  2ZNV C;  3SFD B;  1TS4 A;  1UEL A;  2K5P A;  2K9X A;  5KHQ A;  3BZD B;  4TKN A;  3Q69 A;  3MC9 A;  1N62 A;  2NBV B;  4YSY B;  1HQR D;  4W9F A;  2QJL A;  3UQB A;  3AEF B;  2GLS A;  3PO0 A;  4LDT B;  1EM7 A;  1NEN B;  2C7N B;  2MX2 A;  4H2A A;  2ONQ A;  4P1C C;  1EWC A;  1EWY C;  4OW0 A;  1JQ4 A;  4C4V A;  1A70 A;  2DBY A;  1F1H A;  3ZDM C;  5J17 A;  2BKR B;  2JVC A;  2IGG A;  2GBR A;  5IO9 A;  1WF9 A;  4DWF A;  5BYR A;  2IGH A;  3E9S A;  2CU1 A;  2GBJ A;  3VH3 B;  2MWS B;  3RNC C;  2C9W B;  1L7Y A;  1UGJ A;  4GN1 A;  1PFD A;  3ZRF A;  3H6N A;  2KMC A;  2AWT A;  2ZPY A;  1ZP0 B;  4MDK E;  2OED A;  1B9R A;  4WWO A;  3BWU D;  1TY0 A;  1YD8 U;  3VRB B;  2KJH B;  3VH4 B;  3TSS A;  4YWG G;  4F7Z A;  3WA0 A;  1JRP A;  1NI2 A;  3C0R B;  3IAS 1;  4WAA A;  4IWP A;  3U7Z A;  1UD7 A;  3O65 B;  1E8X A;  1LFD A;  4BAX A;  2LVQ A;  1WZ0 A;  3QJZ A;  2KWC A;  2PEA A;  3P4Q B;  1ZDV A;  2OJW A;  2LGI A;  5MPO A;  3AMZ A;  1VJK A;  3S2A A;  2KWD A;  1NDD A;  3RCZ A;  3I3T B;  1VDV A;  4N58 A;  3J9C A;  2WXQ A;  2BS3 B;  2WXN A;  3KUD B;  2KDB A;  4LK0 M;  2RDH A;  3ZO5 B;  2FUG 1;  2N7E A;  4M02 A;  3WIM A;  2G3Q B;  2W3R A;  2BS2 B;  5AZG A;  2QDF A;  3APC A;  2BS4 B;  2YEP B;  1D4B A;  2KFK A;  3BK2 A;  2J4X A;  2MSE D;  3R8B A;  1FRR A;  1FXA A;  3VAW A;  2KXJ A;  1DOY A;  1Q5W B;  2BVC A;  4TUU A;  1QT9 A;  3IAM 1;  3UI3 A;  4US9 A;  1WGD A;  3RN9 C;  1D3Z A;  3ZQ4 A;  2GBM A;  4I6L B;  2RMM A;  3ZGZ A;  1E6E B;  4W9G A;  4R3D A;  2EMS A;  4K7S A;  2JUO A;  4W9K A;  5LLI A;  4OVZ A;  5CX3 A;  1R4M B;  3DPD A;  3DVN U;  3N30 A;  3NVW A;  1UZX B;  1B1Z A;  4AJY B;  1WJU A;  1MG4 A;  1YX5 B;  4FJV B;  3P63 A;  3GB1 A;  3SFE B;  4IDI A;  2LRU A;  3OWE B;  3DHH C;  1V1P A;  2DYB A;  5C1Z A;  4G3X B;  1UF0 A;  2H89 B;  1C79 A;  1WMH B;  1VRA B;  3P4R B;  1V6E A;  1WXQ A;  1XEE A;  4MH0 E;  4ZHO A;  2QCZ A;  1ZKH A;  5D6J B;  4NJC A;  4ANV A;  2ON8 A;  3CF6 E;  2I2Y A;  2NVU I;  4M8M A;  3AH7 A;  3V6E B;  2KLC A;  1T6B X;  4WH4 A;  5E6J A;  3UIP B;  3TUO A;  4RH6 A;  2KQ4 X;  4REZ A;  1FPY A;  1E10 A;  2IZV B;  2Y3A A;  1Q0W B;  4N59 A;  1EF1 A;  1MHX A;  1UUP A;  5IOI A;  1EF5 A;  1YQB A;  2RDB C;  4YTN B;  2C5L C;  2GBN A;  1XO3 A;  3UF8 A;  4E3C A;  3ZXR A;  3N9Y C;  1QOB A;  1TS3 A;  4HPL B;  1VD2 A;  4FXC A;  2KTF A;  2K1F A;  2N1V A;  2WXR A;  3NS1 A;  3LXF A;  2KDI A;  1F77 A;  3ZKJ C;  1STE A;  3ZW3 A;  4DQO C;  2WXK A;  1L0X B;  2I1J A;  1FMA D;  2KFJ A;  4YSX B;  2WXL A;  1TJE A;  1Y56 A;  2KAC A;  4FJY A;  2N7J A;  3NG0 A;  5D3D A;  2FNJ B;  4DHJ D;  1KM7 A;  3D32 A;  4HKZ E;  1Z2M A;  1VZ8 A;  2XNA C;  1KJT A;  2MBB B;  3BY4 B;  4MGK E;  1TIF A;  2CHX A;  2GOW A;  4WJP A;  2CHZ A;  1TY2 A;  2KTR A;  2YEP F;  2KN5 A;  1UWM A;  3R2T A;  2C60 A;  2O6V D;  5EE1 A;  4M0W A;  3QAQ A;  4XZ4 A;  2ZPN A;  4MSQ B;  2ASQ A;  1E8Y A;  5C3J B;  3TEW A;  4I6P A;  1NBF C;  3V05 A;  3R2I A;  1P3Q U;  3U52 E;  3OG5 A;  1V5O A;  4B0E A;  2J0K A;  3PT2 B;  4HK2 A;  3BIN A;  1S1Q B;  2RD0 A;  1PQS A;  2QMT A;  4L23 A;  2QIE B;  1M4V A;  4ICU A;  1N63 A;  1EU4 A;  2KN4 A;  4JWU C;  1FRD A;  1P1A A;  2WLB A;  3AE7 B;  4W9C A;  2JWU A;  1VZ7 A;  2WX0 A;  1FEH A;  1FXI A;  3HUI A;  1ENF A;  2KD0 A;  2M56 B;  2BB6 A;  2D07 B;  3BII D;  2KQ7 A;  4C56 C;  1K51 A;  2IO0 B;  4NQK E;  2KVZ A;  4B95 A;  1WM2 A;  3ZDT A;  4FHK A;  2OJR A;  3DBH I;  2XK5 B;  4AUQ C;  1WH3 A;  1L4Z B;  1NEK B;  1I7H A;  4PK1 A;  1JWU D;  3QK0 A;  3A9J A;  1J8C A;  4KIK A;  4J6I A;  4XX5 A;  1SE3 A;  4GU2 A;  2J0M A;  3NVY A;  3N20 C;  3X23 A;  2D3C A;  2CHW A;  5HKH A;  2RR9 A;  3AE9 B;  4F8C B;  2W82 A;  2PPH A;  3A9K B;  4HXD A;  3PZD A;  4TSS A;  5CHV C;  2L52 A;  4OZC A;  1SE4 A;  2PIA A;  4HPP A;  2SEB D;  3DVG X;  2MBO A;  1N6Z A;  1YJ1 A;  2ZJD A;  5DPS A;  4A55 A;  1JWB D;  3ZXV A;  4G11 A;  3ZYY X;  1JCK B;  3RFZ B;  3IG3 A;  1QF6 A;  3ZLZ A;  2WU2 B;  3RNB C;  1OTR B;  3KUZ A;  4ARC A;  4LDT D;  1MPE A;  2LD9 A;  1P0R A;  3NS8 A;  1TYG B;  4NJ6 A;  3PZ8 A;  2JXT A;  2QIL A;  5EDS A;  4WWM A;  2DZJ A;  2N1W A;  4MT5 A;  1ZUD 2;  2L00 B;  4C00 A;  3IHP C;  4IOI E;  4IM0 A;  4KDI C;  5BYS A;  4CO7 A;  1WSP A;  3PGE A;  5E6N A;  3ZTD A;  1FD6 A;  5TSS A;  2Z59 B;  1WWT A;  3R7R A;  1MVK A;  2LAS A;  1J19 A;  2K6Q A;  4WWP A;  1WY8 A;  3K9O B;  1WXA A;  4P7I A;  3ML8 A;  3L13 A;  5BMH A;  1ZW7 A;  1AW7 A;  1WGH A;  3B08 A;  2PE9 A;  2KAN A;  3VUW A;  5AEK B;  1UBQ A;  4ZRQ A;  1L4D B;  3AXC A;  5EE0 A;  1WJ6 A;  4G50 A;  2NPT A;  1SGH A;  2KTR B;  3R66 C;  4XDC A;  2D3G A;  4TQ1 A;  4DBG A;  3ZJV A;  1LM8 B;  2LHD A;  4AS1 A;  2AYO B;  1G6J A;  4NNJ B;  2M8S A;  2R2Q A;  2BYE A;  1QQR A;  4M8N A;  3RMK C;  3L54 A;  4RM8 A;  1OEY A;  2MJD A;  1CK1 A;  4LNK A;  3U8Z A;  4ANU A;  2IPK D;  4DDG D;  2JRH A;  1I4X A;  3L4P A;  1P98 A;  1FIQ A;  1C4P A;  3MHS D;  3PVL A;  3EFU A;  1DGJ A;  2NR2 A; 
#chains in the Genus database with same CATH homology
 2KQS A;  3M63 B;  2KDF B;  3QHT A;  4A20 A;  4F7Z A;  4HCP B;  4IWQ A;  3WA0 A;  3SU8 X;  4GSW A;  1NI2 A;  3C0R B;  3ML9 A;  2C7M B;  4DXA B;  4NJ7 A;  5G2N A;  4WAA A;  5DPT A;  3NZU A;  4IWP A;  1UD7 A;  3MJW A;  3O65 B;  4EKU A;  2J0J A;  4II3 B;  1E8X A;  1LFD A;  2BWF A;  3M62 B;  3N3K B;  4MJS A;  5CHW A;  2LVQ A;  2LXA A;  4IWO A;  1WZ0 A;  2AL3 A;  3QJZ A;  2KWC A;  2UWQ A;  2R2O A;  2PEA A;  1L2N A;  2FCM A;  1C3T A;  3RD2 A;  4MM3 A;  4ZRK A;  2L0F A;  1BT0 A;  3TCA A;  2IY1 B;  3S2A A;  2LVO A;  1NDD A;  3RCZ A;  2HTH A;  3I3T B;  3GZN I;  3DVG Y;  3NY5 A;  1LXD A;  2LGX A;  2RSU A;  2DEN B;  4W9E A;  3KUD B;  4GB9 A;  2KDB A;  2BWE S;  2ZVN A;  2D2Q A;  2N7E A;  3ZO5 B;  3H7P B;  3VTV A;  1WR1 A;  1TTN A;  3B1L X;  4JIO U;  3WIM A;  5LXH A;  2G3Q B;  4KVG B;  3QA8 A;  1Y8R C;  2O2V A;  2KJR A;  4WWN A;  5AZG A;  3APC A;  2L3Z A;  4ASW C;  3P2B A;  2KFK A;  3V60 A;  1V81 A;  2MSE D;  3NOB A;  5D7G A;  5L95 C;  1X1M A;  3VAW A;  2ZVO A;  4HCN B;  5DPR A;  2KXJ A;  1Q5W B;  4TUU A;  4WJN A;  2FUH B;  2FID A;  1H4R A;  2DZK A;  1E8Z A;  1EUV B;  1WGD A;  2BYF A;  3UGB B;  1D3Z A;  2IBI B;  1A5R A;  2GBM A;  4NAW A;  3V61 A;  4I6L B;  5TR5 A;  2N4F A;  2L8J A;  3VHT C;  1EO6 A;  4MGZ E;  4W9G A;  3JW0 X;  1RFA A;  2FCS A;  4ZYN A;  1GG3 A;  2N9X A;  3K9P B;  4LCD E;  2EMS A;  4K7S A;  2CKH B;  2JUO A;  1WX7 A;  4W9K A;  4ZRJ A;  2MQJ A;  3CST A;  5CX3 A;  5LLI A;  4K7U A;  3DBL I;  3DPD A;  3QC8 B;  2ZEQ A;  3DVN U;  2MA9 B;  3N30 A;  1UZX B;  4KZ0 A;  4EZJ A;  4BBN F;  4AJY B;  2GMI C;  1WJU A;  1YX5 B;  4AOF A;  1V5T A;  5GMV A;  4FJV B;  2KK8 A;  4BFR A;  1R4M I;  5CTR C;  2LGD A;  2O6V B;  4IW0 A;  2C7H A;  3APD A;  3QQ8 B;  3WAM A;  3LJ3 A;  1UBI A;  4GDK B;  1WGR A;  3JYU A;  2LJ5 A;  1LQB A;  5CHF A;  2NBU A;  1GUA B;  3VDZ A;  4HDQ A;  3ZNZ B;  1V9J A;  2LRU A;  2LVP A;  2KO3 A;  4ANW A;  1IPG A;  2DYB A;  4W9J A;  5C1Z A;  4G3X B;  1K8R B;  3JVZ X;  1WMH B;  3SHQ A;  3VFK A;  4FJZ A;  4RM9 A;  2G4S A;  4A3O A;  3L17 A;  1WM3 A;  3DBR I;  2JY6 A;  1SE9 A;  1V6E A;  3OJ3 A;  1WMH A;  3A9J B;  4MH0 E;  3ZVV A;  1CMX B;  1ZKH A;  5D6J B;  3PRZ A;  2IO3 B;  4LJP B;  5DCN A;  4ANV A;  2JRI B;  3DQV A;  2JXX A;  3CF6 E;  4BKT A;  1IP9 A;  3HM3 A;  2NVU I;  3N32 A;  4M8M A;  1V2Y A;  3V6E B;  4PS3 A;  2JZ3 B;  4A3P A;  2JT4 B;  2WDT B;  3UIN B;  2KLC A;  1I35 A;  3UIP B;  3JSV B;  2V3S A;  3Q3J A;  1E90 A;  1XT9 B;  3SDL C;  2G45 B;  3JSV A;  3W1Y A;  4HJK A;  4N9F 4;  4TV3 A;  3MTN B;  2KNB A;  3ZIM A;  3QIJ A;  2FAZ A;  3U30 A;  1E5W A;  4II2 B;  1WE6 A;  2L7R A;  3T8M A;  1UGM A;  2IZV B;  2L76 A;  5JZE B;  1WGG A;  2IY0 B;  3H7P A;  1Q0W B;  3KH0 A;  2KZR A;  1EF1 A;  4W9D A;  1GJZ A;  2FCQ A;  2K8H A;  4GGQ A;  4GIV A;  4IC7 B;  1E7V A;  1EF5 A;  3ZRC A;  3EEC A;  5E6O A;  1YQB A;  2KC2 A;  3A9K A;  3AU4 A;  5BO4 B;  2IO1 B;  3A1Q A;  3W1S C;  3PV1 A;  3WAO A;  1C1Y B;  1WJ4 A;  2C5L C;  4IM3 A;  3H9D A;  3U7D A;  3PRP B;  2GBN A;  2WWZ A;  3UF8 A;  4E3C A;  4WJQ A;  4GDL B;  4AP4 C;  2K39 A;  4HLE A;  2IYD B;  4BKS A;  4HPL B;  1VD2 A;  4JLC A;  1ZGU B;  3DCG A;  4BOZ B;  2KTF A;  4FBJ B;  2K1F A;  2CR5 A;  2KX0 A;  2N1V A;  4NAW B;  4GDK A;  5J18 A;  4K81 A;  3DVN V;  2ZCC A;  2KDI A;  1WE7 A;  3ZKJ C;  4ANX A;  1M94 A;  3ZW3 A;  4DHZ E;  2RGF A;  2I1J A;  3KYD D;  2KFJ A;  1OGW A;  2KKC A;  2KJ6 A;  2MBH A;  2QHO A;  4OVU A;  4JGH B;  2EMT A;  2BGF A;  3PRE A;  2D11 A;  4KSK C;  4FJY A;  2PE6 B;  5E6P A;  2NBW B;  3M95 A;  2FNJ B;  4DHJ D;  1KM7 A;  1MG8 A;  3D32 A;  1AAR A;  2DZM A;  2JWZ A;  2KWU B;  1Z2M A;  2MP2 B;  4B6W A;  4BOS C;  4BKG A;  1KJT A;  2KMA A;  4PYU A;  2MBB B;  5IAA C;  2MBE A;  1Q1O A;  3BY4 B;  3VQI A;  4IM2 A;  3ZTC A;  3HIZ A;  4MGK E;  2CHX A;  2GOW A;  4CHK A;  1WR6 E;  4WJP A;  2CHZ A;  4BVU C;  1TGZ B;  2BYV E;  3AI5 A;  4KSL C;  3R7Q A;  2KTR A;  4NPN A;  2VRR B;  3KVF B;  3A1Q B;  4K7W A;  2KN5 A;  2WX1 A;  3WAN A;  2C60 A;  3OAW A;  5D94 A;  2YLM A;  2IO2 B;  2K8B A;  3RYT A;  2O6V D;  2DYM A;  2AEH A;  2LXC A;  3V62 A;  5AZF A;  3PRM B;  3QX1 A;  3QAQ A;  4XZ4 A;  5DPW A;  1T0Y A;  2ZPN A;  4E74 A;  2W9N A;  2A4Z A;  4AJW A;  4MSQ B;  5IA7 A;  2KX3 A;  4KDL B;  1GC7 A;  2ASQ A;  5D2M B;  2DX5 B;  4EOY A;  2K25 A;  1E8Y A;  3PTF C;  3DBS A;  1IYF A;  3KW5 B;  3QAR A;  4I6P A;  1NBF C;  3TL5 A;  5J2R A;  3UQA A;  3KYC D;  1P3Q U;  3PSE B;  2LI5 A;  1V5O A;  2N9P C;  2XEW A;  3ZNH B;  1WI0 A;  4AWJ A;  4URK A;  2O6V A;  3IFW B;  3ECI A;  4G0N B;  2MCN B;  2J0K A;  3PHW B;  3PT2 B;  4HK2 A;  3RZW C;  3BIN A;  4M0W B;  1HE8 A;  1U4A A;  1S1Q B;  1WX8 A;  2RD0 A;  3NZS A;  1WXM A;  3R3M A;  1PQS A;  2KFK B;  2KOX A;  2ZCB A;  1QZE A;  3CMM B;  4ICU A;  2Z0E B;  2MP2 A;  1P1A A;  1WXS A;  5L83 A;  4W9C A;  4WQO B;  2J7Q B;  3EC8 A;  2WX0 A;  2KWV B;  1UH6 A;  2I1K A;  3L0W B;  1V86 A;  4W9H A;  3A4S C;  2N7D A;  1WJN A;  4PS8 A;  2KD0 A;  1XD3 B;  2M1M A;  4WJO A;  2M0X A;  3PS6 A;  2MLB A;  1RAX A;  4FLH A;  2D07 B;  4I6N B;  4MJS B;  4BBN C;  1OQY A;  2NS5 A;  3OLM D;  3RZF A;  2DYO A;  1Z5S B;  2DAJ A;  1R4N I;  4GMV A;  2KQ7 A;  2HJ8 A;  3QWZ B;  2V1Y A;  2BKF A;  4XC2 A;  3ZUN A;  3H1U A;  2IO0 B;  3W1S A;  3OJ4 B;  4NQK E;  2LUE A;  1KOT A;  3VTW A;  4B95 A;  1WM2 A;  3PHX B;  3ZDT A;  3GOE A;  4FHK A;  3B0A A;  4W9L A;  2G4D B;  2OJR A;  4YL8 A;  1KLV A;  3DBH I;  2XK5 B;  1J0G A;  4AUQ C;  2M17 A;  3L16 A;  1WXV A;  2MW5 A;  1WH3 A;  4GDL A;  3TBL D;  1S3S G;  2Y5B B;  2RPQ A;  2OOB B;  1WZ3 A;  3QK0 A;  3A9J A;  4MEM A;  4FA6 A;  2DZI A;  1J8C A;  1ISN A;  3L08 A;  1TZ1 A;  4KIK A;  4DDI D;  2NCN A;  4OVV A;  4J6I A;  4XX5 A;  4GU2 A;  2J0M A;  2A5U A;  3H7S A;  3VUX A;  2B3A A;  2GBK A;  3M3J A;  3RT3 B;  3X23 A;  3ONS A;  1E8W A;  2CHW A;  2K6D B;  3ALB A;  3TJP A;  5HKH A;  1H8C A;  2RR9 A;  2NPT B;  4F8C B;  4PS7 A;  2MRP A;  2LZ6 A;  4F1S A;  2PPH A;  3A9K B;  4EEW A;  4HXD A;  4MGY E;  3PLV A;  3PZD A;  5CHV C;  4DHJ B;  2BF8 B;  1WGY A;  3V6C B;  2KC1 A;  3VTU A;  2CS4 A;  1WX9 A;  1VCB A;  3AU5 A;  1WIA A;  3A33 B;  3VVW B;  3VXW A;  2LGY A;  3IVF A;  5LXI B;  1XQQ A;  3A4R A;  3DVG X;  2MBO A;  3VUY A;  4TQ0 A;  1P9D U;  1GNU A;  3KUC B;  4E71 A;  3ENE A;  1YJ1 A;  2ZJD A;  1V80 A;  5DPS A;  5KHO A;  1WYW B;  4G11 A;  4CYE A;  2FIF A;  1V49 A;  1FXT B;  2JZZ A;  2PJH A;  3IG3 A;  4HPM B;  2EKE C;  3HK0 A;  2ZNV B;  2KDE B;  1I42 A;  4FHJ A;  3APF A;  3ZLZ A;  2REX A;  5JHA A;  4BKS D;  2MBQ A;  2KHW B;  4FAD A;  1OTR B;  3KUZ A;  3LDZ E;  4LDT D;  2LD9 A;  1P0R A;  3AUL A;  1OEY J;  4ICV A;  2AL6 A;  2D10 A;  3DDC B;  3PPA A;  4MGI E;  3NS8 A;  3WAP A;  4NJ6 A;  2YVC A;  1GC6 A;  4IUM B;  4B9K A;  5EDS A;  4X57 B;  2XK5 A;  1JRU A;  1RRB A;  4NY0 A;  3TIX A;  2DZJ A;  2ZZP B;  4RMA A;  2LWP A;  2N1W A;  5C23 A;  4W9I A;  1SIF A;  2L00 B;  4GXB A;  3IHP C;  4FN2 A;  4JQW C;  3NHE B;  3HM6 X;  4LJO B;  4IM0 A;  4KDI C;  3RUL A;  4MSM B;  5JHB A;  4CO7 A;  2O2V B;  3PGE A;  5E6N A;  3ZTD A;  2LRW A;  2BPS A;  2L05 A;  2ZNV C;  2Z59 B;  3EHV A;  4HDO A;  4HVB A;  1RLF A;  1UEL A;  3R7R A;  5JH5 C;  5KHQ A;  2LAS A;  1J19 A;  2K6Q A;  4TKN A;  1WY8 A;  4WWP A;  2Z0D B;  3K9O B;  4FUL A;  4DHZ B;  3T9L A;  1WXA A;  3L10 B;  2K8C A;  1E7U A;  1WFY A;  2NBV B;  3L13 A;  3ML8 A;  4P7I A;  1ZW7 A;  3TMP B;  4W9F A;  1YIW A;  1WGH A;  3UQB A;  3B08 A;  4ZRI A;  2JF5 A;  4PYZ A;  4IG7 B;  2PE9 A;  2XBB C;  3Q3F A;  4LDT B;  4JL9 A;  2KAN A;  2KVR A;  3VUW A;  3X0W A;  5AEK B;  1UBQ A;  2C7N B;  2MX2 A;  3CSF A;  3ZNG C;  1YX6 B;  3AXC A;  2V4L A;  4KZC A;  4ZDV A;  1WJ6 A;  4G50 A;  2NPT A;  1SGH A;  3PLU A;  1WRD B;  4EFO A;  4K1R B;  4EUT A;  2N9E B;  5G55 A;  2KTR B;  3SD5 A;  3R66 C;  4MEL A;  2D3G A;  3UIO B;  3ZDM C;  4EZL A;  4TQ1 A;  3IBE A;  2KLG A;  4DBG A;  5J17 A;  4HWI B;  2BKR B;  4GOC A;  1LM8 B;  2JVC A;  2AYO B;  2GBR A;  1WF9 A;  1G6J A;  4DWF A;  4NNJ B;  2M8S A;  2R2Q A;  4KIK B;  2BYE A;  2JPH A;  4M8N A;  5FR6 A;  3L54 A;  2CU1 A;  2GBJ A;  3VH3 B;  2MWS B;  4RM8 A;  1OEY A;  2C9W B;  1L7Y A;  3RUI B;  3U8Z A;  4NQL B;  4GN1 A;  3ZRF A;  4ANU A;  3H6N A;  2KMC A;  3WAL A;  2AWT A;  4DDG D;  2JRH A;  2UYZ B;  2ZPY A;  2DAF A;  4MDK E;  5AZH A;  1F9J A;  3ZNI D;  2WYQ A;  4DK5 A;  4EZK A;  2FCN A;  2HD5 B;  2HE7 A;  1TBE A;  4WWO A;  2M4N A;  1P98 A;  3DOW A;  4KV2 A;  1YD8 U;  2DHZ A;  2KJH B;  3VH4 B;  3MHS D;  3HHM A;  3QCA A;  2L0T A;  3PVL A;  3EFU A;  2NR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...