5HKHA

Crystal structure of ufm1 in complex with uba5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GAMESKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of a Novel Interaction Motif within UFM1-activating Enzyme 5 (UBA5) Required for Binding to Ubiquitin-like Proteins and Ufmylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ubiquitin-fold modifier 1
total genus 18
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5hkhA00
1KOTA 2BWFA 3Q3FA 4KZ0A 3ALBA 4I6PA 2FCNA 3VH3B 1J19A 4BOZB 2I1JA 3PVLA 3KW5B 3MTNB 3SU8X 4GXBA 5J18A 3VAWA 1WJUA 2AEHA 2KJRA 3EFUA 5BO4B 4B9KA 3M62B 1I42A 1KLVA 4M8MA 1S1QB 4F8CB 2C5LC 2D07B 3IFWB 3DVGY 2RD0A 1SGHA 4GDLB 2N9PC 3ECIA 3BINA 3RUIB 4BBNC 4FJVB 4EUTA 1WE6A 4MGZE 4ZYNA 2MRPA 5CX3A 5AZFA 5EDSA 3H7PB 2N4FA 3OJ4B 2DYMA 1GUAB 4W9CA 2BYFA 1WM3A 2N1WA 4HPLB 4DHZB 3U8ZA 1E8WA 4HDQA 4OVVA 2KJ6A 2ZPNA 1SE9A 2IO0B 1E8ZA 3ZLZA 2C7MB 3PHWB 1H4RA 2AYOB 2WWZA 4IM2A 2C7HA 3A9KA 4GU2A 3DBLI 4GB9A 4FBJB 2B3AA 1TBEA 2K25A 4EOYA 3T9LA 3APFA 4KZCA 1V86A 1WJNA 3DPDA 3DCGA 1V2YA 4EZLA 2BKFA 2LGXA 2V1YA 2KTRA 1J8CA 3T8MA 3DVGX 3L13A 3KYDD 1RRBA 2V4LA 3H6NA 4LDTD 2GBMA 2K6DB 4W9EA 2JVCA 5G55A 3VH4B 3C0RB 1UD7A 2LUEA 3L0WB 2KNBA 3NOBA 2KD0A 3QWZB 4W9LA 4KSKC 2LI5A 4GGQA 3U30A 3RZWC 5FR6A 4NAWB 2KVRA 2ZEQA 4K1RB 4ZRJA 2KDIA 3P2BA 5DCNA 1Q1OA 1WI0A 4W9IA 4MJSB 1IP9A 2GOWA 4FJYA 3JSVA 3UIPB 2K8HA 1ISNA 3X23A 3O65B 2Y5BB 3PS6A 4G0NB 4HCNB 4FJZA 4JGHB 1YX6B 3A33B 3W1SA 1Q5WB 2FUHB 4DDID 2D2QA 2XBBC 3OJ3A 3R7QA 3VTWA 3ZNZB 3UQAA 4FHJA 2JPHA 4IWQA 4MEMA 3NZUA 1WRDB 2KWCA 5AZHA 2NS5A 2C60A 5KHOA 2JUOA 1WH3A 2HE7A 2JZ3B 4W9KA 4LJOB 3V6CB 1WFYA 3A9KB 1XQQA 1EO6A 2K39A 1C1YB 3L10B 1WXVA 1P3QU 2ZZPB 3APCA 4RM9A 2DZJA 5JHAA 3APDA 2LVQA 2KDBA 2KX3A 1NI2A 3K9OB 1UGMA 4E3CA 2K8BA 2UWQA 3PGEA 2AWTA 2JZZA 2W9NA 4MM3A 2JXXA 3PRPB 4KIKB 4RMAA 2G4DB 3DBHI 1OTRB 1V5OA 3WAPA 2MCNB 3D32A 2L0FA 3BY4B 1A5RA 3S2AA 1R4NI 3X0WA 4DDGD 2LVPA 3DBSA 3NZSA 2ZPYA 3B1LX 5CHWA 3W1SC 3ZO5B 3ZIMA 5TR5A 3EHVA 4NJ6A 2IY1B 2BGFA 1OQYA 2GBNA 3PRMB 2M0XA 4ANUA 3A9JA 1UBQA 4TKNA 4WQOB 1WR6E 2MBBB 1YX5B 2NPTB 3A9JB 4ANVA 4FLHA 4WJNA 4BBNF 4F7ZA 3SDLC 2ZNVB 3AI5A 3UF8A 1GNUA 2EKEC 1UBIA 1V6EA 4KV2A 4FHKA 4MELA 4HWIB 2EMTA 1WY8A 4B6WA 5JZEB 1WGYA 2NR2A 3ZTDA 2JF5A 2DYBA 3CSTA 2DYOA 1TGZB 4WWOA 3VUWA 2ZCCA 1L2NA 4JQWC 1ZGUB 4IUMB 3NY5A 3V61A 1WX8A 4EZKA 2KK8A 1OEYA 2Z59B 2WDTB 1SIFA 2LXCA 2R2QA 3KYCD 2LD9A 2CKHB 2Z0EB 2UYZB 4G50A 1TTNA 1X1MA 3H1UA 4LDTB 2BYEA 4MSMB 2M17A 4ASWC 2RSUA 2WX0A 5AZGA 1WF9A 3WALA 4A3OA 3ML9A 4HPMB 3L17A 1CMXB 4GDKB 4EZJA 1H8CA 1WXSA 4TQ0A 2FCMA 3PTFC 1EUVB 1FXTB 2KKCA 2FIFA 2L0TA 4W9HA 5DPTA 4GIVA 4CYEA 2MW5A 3RZFA 1E7VA 2XK5A 5G2NA 3VVWB 5DPWA 2IBIB 1WIAA 2RR9A 3DDCB 3TBLD 1EF1A 1E5WA 1J0GA 3QCAA 3TIXA 1C3TA 4K7WA 2ZJDA 4BVUC 2KQSA 5CHFA 3UGBB 1AARA 2MBHA 1L7YA 1P9DU 5J17A 3ZDMC 2K8CA 2YVCA 3PRZA 4FA6A 5D6JB 1Q0WB 5C1ZA 3SD5A 2KXJA 1YIWA 3ONSA 4GN1A 3ZNHB 1G6JA 2QHOA 3RCZA 1BT0A 1ZKHA 3QK0A 4KVGB 1UZXB 2KLCA 4AWJA 1KJTA 2KTFA 4K7SA 2N9EB 3LDZE 4KIKA 1MG8A 2DZIA 2KTRB 4II2B 4HJKA 1WMHA 4K7UA 3UINB 4KSLC 2N1VA 3KVFB 4JL9A 2KQ7A 4I6NB 1E8YA 2NVUI 3ENEA 1U4AA 3TCAA 5AEKB 2CHWA 2LWPA 4ZRKA 5L83A 2IO2B 2CU1A 5IAAC 3M95A 3V60A 4WAAA 4NAWA 4TUUA 3ZKJC 3CSFA 3IBEA 3H9DA 4IW0A 3WIMA 3ZRFA 2L76A 4EEWA 2MLBA 4FADA 2DAJA 4XC2A 3QHTA 4BFRA 2PPHA 2G45B 3ZTCA 1WR1A 2O2VB 4PYUA 2CS4A 1YD8U 2C7NB 3DQVA 4IWPA 3H7PA 3OLMD 2AL6A 3TJPA 4AOFA 1WYWB 2KFKB 2LVOA 3A1QB 3QQ8B 4BOSC 3L54A 4GSWA 4GDLA 4IM3A 1OGWA 3GOEA 2RPQA 3MJWA 3CMMB 3QAQA 4MSQB 4ZDVA 1WGRA 3TMPB 3HHMA 4HLEA 2PJHA 4FN2A 4K81A 2LXAA 4CO7A 1R4MI 2DAFA 2KWUB 3DBRI 2KMAA 2LGYA 2CHZA 2MA9B 4W9JA 2IO1B 1NDDA 4A20A 3ZRCA 3PV1A 5DPSA 3QJZA 3RT3B 2YLMA 4PS8A 1V5TA 3NS8A 2D10A 3H7SA 1YJ1A 2MBEA 4II3B 4IM0A 5L95C 3VTUA 2DX5B 4KDLB 4CHKA 2FCSA 3CF6E 5CTRC 4MGYE 3L16A 2ZVNA 2KFKA 3KH0A 4WJOA 5IA7A 1V49A 4GOCA 1WJ4A 3AU5A 5GMVA 2GMIC 2JRIB 4MDKE 3LJ3A 4M8NA 1E8XA 1GC6A 2GBJA 3KUZA 5LXHA 4OVUA 4TQ1A 4HXDA 2KX0A 2BWES 4BKGA 3IVFA 3PLVA 3V62A 3AXCA 3PPAA 5JH5C 4KDIC 4F1SA 1K8RB 3RD2A 3DOWA 4DK5A 5LLIA 2KC1A 1Z2MA 2KDFB 2KN5A 4WJPA 2GBRA 2KJHB 4FULA 4TV3A 2KC2A 1RLFA 2DZKA 2HD5B 4NQLB 4NQKE 4NY0A 3PT2B 3VDZA 2O6VA 1KM7A 2L8JA 4AP4C 1PQSA 2BKRB 1WXMA 4MH0E 2MSED 3RYTA 1WZ0A 2HTHA 1LQBA 2CHXA 2KLGA 3PHXB 3PZDA 2D3GA 3KUDB 3L08A 5J2RA 3VTVA 3QX1A 2J0JA 4LCDE 2GBKA 1WGDA 5C23A 3ZVVA 4IG7B 1T0YA 2O6VB 3QC8B 2LGDA 2DENB 3KUCB 3VUXA 4DBGA 4G3XB 4J6IA 2KMCA 1ZW7A 3M3JA 2R2OA 2MWSB 3IHPC 4HDOA 3R3MA 2NBVB 3UQBA 3OAWA 4PS3A 4DHJD 1S3SG 3B08A 4ANWA 1TZ1A 2FIDA 2NBWB 3GZNI 4GMVA 1LM8B 1P1AA 2ASQA 2RGFA 4EFOA 2JRHA 3HM6X 4M0WB 3RULA 3A4SC 2IZVB 3HIZA 3K9PB 4NPNA 2KDEB 4LJPB 4BKSA 3ML8A 4E71A 2IY0B 5DPRA 3QARA 4URKA 1UELA 4W9FA 1GG3A 1RAXA 5D94A 3WAMA 3B0AA 3VXWA 2M4NA 3JSVB 2PEAA 2G4SA 2REXA 3VFKA 2G3QB 3PREA 1VCBA 4DXAB 2KOXA 2VRRB 2EMSA 1WX9A 3U7DA 2CR5A 2LRUA 2AL3A 2BPSA 3PSEB 3QA8A 4ANXA 1D3ZA 4E74A 4AUQC 2J0MA 1XD3B 2MP2B 4W9DA 3VHTC 1IPGA 2NPTA 3N30A 2JT4B 2MBQA 2K1FA 4WJQA 2XK5B 3HM3A 1VD2A 1YQBA 2ZNVC 2KZRA 3NHEB 4W9GA 1JRUA 4HK2A 3ZW3A 1Z5SB 4JLCA 5LXIB 3VQIA 3TL5A 2L00B 3UIOB 2C9WB 3R66C 3A1QA 3R7RA 4GDKA 2J7QB 4NJ7A 4X57B 4IWOA 3DVNU 3N3KB 1V9JA 4BKTA 3WA0A 5E6PA 3Q3JA 4MGIE 2KWVB 5CHVC 5E6OA 1E7UA 1WX7A 3VUYA 2MBOA 2BF8B 2K6QA 4DHJB 2V3SA 3AULA 1LFDA 2FCQA 2LRWA 2PE6B 4P7IA 5E6NA 1GJZA 4XZ4A 3EC8A 2ZCBA 4MJSA 1XT9B 4DHZE 3EECA 1WZ3A 2NBUA 3AU4A 2I1KA 2J0KA 2Z0DB 2ZVOA 1WM2A 4G11A 1UH6A 2HJ8A 4AJYB 4IC7B 2L3ZA 2N7DA 1F9JA 1WMHB 2N7EA 5HKHA 5D2MB 4RM8A 2OOBB 4N9F4 3W1YA 2MQJA 1RFAA 1WGHA 2JY6A 3QIJA 1V80A 4NNJB 4A3PA 4B95A 3PLUA 2O6VD 3V6EB 4AJWA 1WXAA 1GC7A 4PS7A 3M63B 2A5UA 2N9XA 1NBFC 2JWZA 2DZMA 4HCPB 3ZDTA 1V81A 4ZRIA 1IYFA 2LZ6A 2MX2A 1WE7A 4I6LB 2BYVE 4PYZA 2A4ZA 2LJ5A 2L7RA 3JW0X 1WGGA 1OEYJ 1M94A 2FNJB 1EF5A 1QZEA 2KANA 4ICUA 3IG3A 4YL8A 2M8SA 2L05A 5JHBA 3JYUA 1WJ6A 3I3TB 4WWPA 3DVNV 2KHWB 2OJRA 2XEWA 3JVZX 4XX5A 1P0RA 1E90A 2WX1A 3WAOA 4DWFA 3ZUNA 2M1MA 3WANA 1LXDA 3A4RA 1P98A 3ZNID 4BKSD 2D11A 3MHSD 2KFJA 4MGKE 2MP2A 2DHZA 2IO3B 2IYDB 1I35A 2LASA 4HVBA 2O2VA 3N32A 1Y8RC 2NCNA 3SHQA 5KHQA 2WYQA 3ZNGC 5D7GA 4ICVA 1HE8A 2PE9A 3HK0A 2KO3A 4WWNA 4JIOU 2FAZA 4EKUA
chains in the Genus database with same CATH superfamily
2BWFA 1V8CA 3SFEB 3SU8X 5J18A 3BIID 1I42A 4B9KA 4F8CB 2C5LC 4US8A 3BINA 3BVGA 4M01A 4XGAB 1WE6A 2WXJA 4MGZE 3RMKC 2WLBA 2DYMA 2RDBC 2BYFA 1WM3A 2LUMA 2N1WA 1QT9A 3GS2A 4HKQA 1E8WA 3BVMA 1FEHA 4B0EA 3PHWB 5D3IB 4IM2A 3DBLI 1TBEA 2K25A 3GE8C 4KZCA 1WJNA 4M02A 1CZPA 2LGXA 2JWUA 1TKEA 3T8MA 3KYDD 2V4LA 4LDTD 1VDVA 2K6DB 2V3PA 3C0RB 4C80A 4KSKC 4GGQA 2WP9B 2IJ0A 2KVRA 4K3BA 2KDIA 3RNBC 3DWGC 1ISNA 5EE9A 4HCNB 4FJZA 1I4RA 3A33B 2FUHB 4DDID 2D2QA 3VTWA 3UQAA 4MEMA 2KWCA 2NS5A 2C60A 3EGRA 2HE7A 2IGDA 2AX5A 4M0WA 1WFYA 3A9KB 2K39A 1C1YB 2HDEA 1WXVA 2ZZPB 3APCA 4RM9A 4P1BC 2LVQA 1NI2A 2K8BA 2W9NA 4RMAA 1OTRB 1F77A 2L0FA 1WWTA 3B1LX 3ZIMA 4C4VA 3ZGZA 4NJ6A 1OQYA 4RCOA 1BXTA 1YNTE 1CJEA 1UBQA 2MBBB 2NPTB 2EKEC 2W54A 4FHKA 4B6WA 2NR2A 1L0YB 2ZCCA 4EZKA 4AS1A 3PZ8A 2G9HD 2R2QA 2LD9A 2CKHB 1C77A 4KGSA 2RSUA 5AZGA 5LNK1 3RNCC 2INNE 3WALA 4LNKA 2ICIA 1L4ZB 4GDKB 1WXSA 2FCMA 2QDFA 2ONQA 1MHHE 5H92C 1SJHD 2L0TA 4RNAA 4GIVA 1D4BA 1C79A 1JRPA 2XK5A 3VVWB 2N9LA 2IBIB 1WIAA 1PUTA 4LK0M 3TIXA 1C3TA 1K51A 2ZJDA 1MVKA 5CHFA 2K8CA 2ZW1A 4L2YA 5C1ZA 3SR6A 1C4AA 1YIWA 4JWSC 2PVGC 3RCZA 1BT0A 1ZKHA 3FAHA 2WDQB 5T8IA 2WXRA 4WURA 4KVGB 1UZXB 2KLCA 1YQ4B 1ESFA 2YEPB 3LDZE 3GZNB 1JQ4A 2X8XX 2KTRB 3GB1A 3EFCA 4JL9A 3R2TA 3AV8A 1SE3A 3ENEA 5BYSA 2LWPA 2CU1A 1SE2A 3CSFA 3IBEA 3H9DA 4EEWA 2XNAC 2L76A 1T0SC 1VZ6A 3NVYA 4XC2A 2G45B 3EUB2 3ZTCA 4RF1A 2CS4A 1YD8U 3TJPA 4BOSC 1FM0D 1HZ6A 1FFUA 1HA5A 4YTPB 1OGWA 4MSQB 1HZ5A 1VJKA 3HHMA 5IKCM 3BZDB 4FN2A 2PIAA 4PK1A 3AEBB 2IO1B 4ZHPA 4Q2JA 1V5TA 3NS8A 1TS5A 2JZPA 4II3B 4IM0A 2M0AA 1D6EC 4NZLB 1YQ3B 3RNGC 5CTRC 2KFKA 3KH0A 5IA7A 1WJ4A 1E8XA 1GC6A 1OQRA 4R3DA 1F0ZA 3PLVA 4C7ZA 1QKZA 3RD2A 1NYRA 1T0RC 1YN3A 2L83A 2KDFB 2MJEA 2BYTA 2GBRA 4FULA 4NQKE 3ETRA 3PT2B 1KM7A 2L8JA 1QLBB 2WU5B 1WXMA 3RYTA 1LQBA 2KLGA 4NAMA 2BS3B 5C23A 3ZVVA 3VUXA 3KWVA 1ZW7A 2N7JA 2MWSB 2WXOA 3FILA 4FXCA 2G1EA 1KF6B 3UQBA 1OQQA 3OAWA 4DHJD 2NBWB 3GZNI 2RGFA 2EELA 2IZVB 2KDEB 2CJNA 4E71A 2IY0B 2NMQA 5D94A 1I4XA 3VXWA 1E6EB 3JSVB 2G4SA 4OZCA 3PREA 2KOXA 1YMHE 3U7DA 4KGRA 2SEBD 2BPSA 4ANXA 2OEDA 2Y3AA 4AUQC 2MBQA 1ZXHA 2ZNVC 3NHEB 4HK2A 3VQIA 1KTKA 3R7RA 1UUPA 4NJ7A 4X57B 3DVNU 3N3KB 1V9JA 3WA0A 3BVZA 2K6QA 1LFDA 5E6NA 1K50A 2ZCBA 1Y56A 4DHZE 3EECA 1WZ3A 1UWXA 3TEYA 1N63A 2J0KA 3NZ3A 4IC7B 2L3ZA 5HKHA 3W1YA 2MQJA 3Q3OC 3V6EB 5FR3A 3L4PA 3ZYYX 1WXAA 1GC7A 4PS7A 4EE2A 5C2TB 2N9XA 1VLBA 1TS3A 3OG5A 3LB8C 2HJ1A 2LZ6A 4I6LB 2A4ZA 2LJ5A 4IKGA 1WGGA 1VR9A 3IG3A 3RPFC 1WJ6A 1ET9A 4WWPA 2KHWB 2XEWA 5HG2A 2N0SB 3C8YA 3WAOA 3GE3C 2JSVX 1Q10A 1E10A 3A4RA 1P98A 2LMCA 3NJTA 2MP2A 2DHZA 3TUOA 1I35A 4HVBA 2O2VA 2Z8LA 2WXMA 4C00A 1F52A 4WWNA 4JIOU 4EKUA 2V3NA 3H8HA 5IN7A 4XWWA 2I1JA 3KW5B 4K3CA 2V0GA 2KJRA 5BO4B 3Q2AC 1UNSA 3DBRB 1KLVA 4M8MA 1S1QB 1SXTA 3RFZB 2D07B 5BMGA 3DVGY 3T3NA 2RD0A 2K9XA 4BBNC 1L6VA 2JQRB 2D5GA 3GP7A 4ZYNA 1L5PA 2N4FA 2MEKA 4W9CA 2BVCA 4HPLB 3U8ZA 4OVZA 4OVVA 2KJ6A 2ZPNA 2IO0B 3ZLZA 4HEA1 2AYOB 1FPYA 1E9MA 2C7HA 2WGSA 1PYWD 1V2YA 5MPOA 1TYGB 2V1YA 2CU3A 5BMHA 2KTRA 1J8CA 2WXGA 1VZ8A 3DVGX 1FRRA 1T0QC 3H6NA 2JVCA 2GRIA 3VH4B 1V1PB 3QWZB 3AEFB 3NOBA 1SEBD 2FE8A 3RZWC 1QILA 5FR6A 1JW9D 4K1RB 4ZRJA 5DCNA 1WI0A 4FJYA 2K8HA 3X23A 1I4PA 3PS6A 5FKAC 4JGHB 1Q5WB 5IP4D 4FHJA 2M19A 1WRDB 5KHOA 5AUIA 1WH3A 2JZ3B 3E9SA 1P3QU 3APDA 1UGMA 3FILB 2UWQA 2AWTA 2JZZA 1KLGD 3AECB 4PT5A 1N61A 2MCNB 2LJIA 3D32A 1FXIA 3AM9A 2PMVA 1R4NI 2LHDA 2WXIA 4DDGD 1R4NB 3P4PB 5CHWA 2BGFA 5C3JB 5BMIA 1UWMA 2GBNA 2AQ2B 3AN1A 4TKNA 2PVOD 4FLHA 4WJNA 3W9CB 3AI5A 2QMTA 4CQNA 4KV2A 1TKGA 1WGYA 5G5GA 3ZTDA 3CSTA 2DYBA 2K3UA 4USAA 1TGZB 4IUMB 3NY5A 3V61A 2Z59B 1AN8A 4KKJA 2I38A 4G50A 1K53A 4ASWC 1OFFA 1F2RC 2JU6X 1WF9A 4HJGE 4A3OA 3L17A 2GLSA 4EZJA 3PTFC 1FXTB 2FIFA 2PTLA 5DPTA 4OHJA 2RPVA 3TBLD 1J0GA 5EE3A 1AARA 1P9DU 1JWBD 1Q0WB 1ZDXA 3ONSA 3Q8CA 4YSZB 2JX5A 3QK0A 1KJTA 3MC8A 2N9EB 1MG8A 2GI9A 4HJKA 2GB1A 2HTME 3U4EG 1J7AA 3MFGA 2W3SA 2NVUI 1L0VB 4ITKA 2CHWA 3V60A 3M95A 4WAAA 3VRAB 4IW0A 4FADA 4A55A 2PPHA 3I57A 1WR1A 2O2VB 3NG0A 2DBYA 2LVOA 2BS4B 3QQ8B 3L54A 4JX1C 3IT6B 4GSWA 4WQMA 1XLNA 1UF0A 3QAQA 1HTQA 3B9JA 3RNEC 1WGRA 3TMPB 4HLEA 1KRHA 1A70A 4K81A 2LXAA 2DAFA 1CK1A 1EU4A 2MA9B 1E0ZA 1GB1A 1NDDA 3PV1A 3U52E 1NEKB 2L52A 1JWAD 5L95C 4RGMA 2WXHA 2ZVNA 1V49A 5GMVA 4M8NA 2H88B 2QC8A 3SEBA 5LXHA 4HXDA 2KX0A 2BWES 4BKGA 1YJIA 3PPAA 3Q8EA 4F1SA 3B2GA 4LTUA 4OW0A 2KC1A 3BK2A 1AYFA 1Z2MA 4WJPA 2KJHB 3MC9A 2QEJC 1RLFA 2DZKA 2HD5B 3AEAB 2YEPF 2UU7A 4MH0E 2MSED 1XCTL 3PZDA 3PHXB 2D3GA 3KUDB 3QX1A 1ZPSA 2KAJA 4XWTA 3AE1B 2WXQA 4WH4A 3P63A 1TY0A 1V1PA 2J53A 2KMCA 3M3JA 2KYWA 4HDOA 1T6BX 2WXNA 3B08A 5FK9C 3W2DA 1P1AA 4LNNA 4EFOA 1PGAA 2JRHA 2KT7A 4M0WB 3RULA 3A4SC 1YJJA 2BQQA 1SBBB 3K9PB 3DHHC 3KWLA 5DPRA 3P4RB 1GG3A 3URYA 1RAXA 1TS2A 3ZJTA 3WAMA 3B0AA 1RYJA 4L1BA 1FCLA 2REXA 1GOZA 3NVZA 2G3QB 4RGNA 1M4VA 2VRRB 1L0XB 1ZOYB 4YWGG 1ENFA 2EMSA 2M56B 1FNUA 1XO3A 4ZRQA 4TMAB 4E74A 2TSSA 3ABVB 2NPTA 2K5PA 2K1FA 2XK5B 3HM3A 4ZYSA 4W9GA 1JRUA 2L32A 3ZW3A 4JLCA 5LXIB 2I2YA 3ZJVA 1SB3C 3TL5A 5BYQA 2SAKA 4GDKA 2J7QB 2VZKB 5G5HA 4BKTA 3Q3JA 5CHVC 5E6OA 4A8XC 4DHJB 3AULA 2PE6B 4XZ4A 2R61A 3EC8A 4MJSA 2I1KA 2Z0DB 2ZVOA 1L4DB 4AJYB 1FNWA 4RM8A 2OOBB 2LGIA 1RFAA 1WGHA 3IXSA 4AJWA 3E56A 2WXLA 3M63B 3T3OA 2A5UA 2IGHA 2DZMA 1SF0A 2BW2A 2MHJA 4LNIA 1V81A 1YOVB 1C76A 2MX2A 1WE7A 4PYZA 3KLSX 3JW0X 1I4QA 1EF5A 2KANA 2RDGA 4ICUA 2L05A 4J3OD 3NVVA 3JVZX 1P0RA 1PDXA 1E90A 2WX1A 1JMLA 4DWFA 3ZUNA 3WANA 1LXDA 4YSXB 3ZNID 2D11A 4WAFA 2IYDB 3MC0B 1Y8RC 4AQ7A 1LGRA 3SHQA 5KHQA 4ICVA 4HRSA 3HK0A 3EA6A 2NBVB 5TSSA 3Q3FA 1QQRA 1K52A 4I6PA 3VH3B 1J19A 4S0RA 3PVLA 2WXPA 4GXBA 5D3DA 1MPEA 3EFUA 1NENB 1R4MB 1EWYC 3AEGB 1SGHA 3RUIB 2MRPA 1B1ZA 5AZFA 4BZAA 1XXGA 4MACA 4XE0A 3MJ5A 4DQOC 1SE9A 1XLPA 2C7MB 4YT0B 1H4RA 4GB9A 4C7YA 1T5XD 4EOYA 3MP9A 3DCGA 1I4GA 1RRBA 4W9EA 2GBMA 1JALA 5G55A 4N59A 2KNBA 2KD0A 3U30A 4NAWB 2ZEQA 3P2BA 1EM7A 1Q1OA 4W9IA 4IOIE 1IP9A 2GOWA 1PGXA 2VH2A 3JSVA 3UIPB 3O65B 3W1SA 2JPHA 5AZHA 1F2RI 1FD6A 2KWDA 5JXVA 4W9KA 3V6CB 1XQQA 1EO6A 2J52A 4BAXA 5EE1A 3N20C 2DZJA 2INPE 5JHAA 1I7HA 3K9OB 2OJWA 3PGEA 4MM3A 2DNFA 1XLQA 2PKOA 4KIKB 2G4DB 3WAPA 1LO5D 1QOGA 1MG4A 3X0WA 1R7SA 3DBSA 3NZSA 2LEKA 3AEDB 2BB6A 1JWMD 3PRMB 2M0XA 4WQOB 3MHZA 1WR6E 3A9JB 4ANVA 3Q8BA 4F7ZA 1TKYA 3R8BA 4A9AA 2ZNVB 3UF8A 1GNUA 4HWIB 2EMTA 1WY8A 3LXFA 2DYOA 1ACCA 4WWOA 3VUWA 5AUKA 2WDVB 1ZGUB 2BT6A 1WX8A 1ROEA 2KK8A 1JWSD 2WDTB 1N62A 2LXCA 1QF6A 2D3BA 1TTNA 1X1MA 4MSMB 2KDMA 2WX0A 3ML9A 1CMXB 2Q5WD 1EUVB 2KKCA 3P1MA 4W9HA 4CYEA 2CJOA 5DPWA 3DDCB 2RR9A 1E5WA 4K7WA 3U7ZA 1L7YA 3ZDMC 5D6JB 3SD5A 2KXJA 4KX6B 4GN1A 3ZNHB 2QHOA 4AWJA 3Q14C 2KTFA 4K7SA 3V05A 2DZIA 3Q8AA 4II2B 5HFYA 4K7UA 3UINB 4KSLC 1FNVA 4UDUC 2KQ7A 1E8YA 4ARCA 2N9KA 3R2IA 3TCAA 5AEKB 4ZRKA 3SFDB 5IAAC 3ZKJC 4NAWA 4TUUA 4MH8A 3ZRFA 4M00A 3P4SB 3WIMA 2MLBA 2DAJA 1HEZE 3FC4A 3AE3B 3I9V1 3TSSA 3ZJUA 2C7NB 4IWPA 3H7PA 3OLMD 3Q3NC 1WYWB 2KFKB 1YN5A 3N1ZC 4GDLA 3AH7A 1ZUD2 3GOEA 2BS2B 3CMMB 4XDCA 3AB5A 4CO7A 2Y5CA 3DBRI 2KMAA 4A20A 1ET6A 3ZRCA 3QJZA 2MJDA 3RT3B 1FMAD 2IDYA 3I5JC 3H7SA 4TSSA 3PZ7A 3VTUA 3DBLB 4KDLB 4CHKA 3CF6E 3L16A 3AU5A 2GMIC 1C78A 4MDKE 4A90A 2KACA 2XN9C 3KUZA 3IVFA 1FFVA 3AXCA 4KDIC 1QOBA 3DOWA 3ZXRA 5LLIA 3BYTB 3NRZA 3WCQA 3IAM1 2KC2A 3VDZA 4NQLB 2O6VA 1PQSA 4WIPA 2BKRB 5IO9A 2DWQA 1SJED 2CHXA 5GXGB 3RNAC 3DWMA 3L08A 2GBKA 3TEZA 4IG7B 2K0PA 3QC8B 2DENB 3KUCB 4G3XB 4DXGA 2R2OA 3R3MA 1QOFA 2DLBA 1S3SG 1TZ1A 2VH1A 4GMVA 1J7CA 1LM8B 3HM6X 4P6VF 3HIZA 1D5XC 3NUHB 1DYQA 4BKSA 1T3QA 2Y5PA 4URKA 1UELA 2IGGA 4N6EB 2WXKA 3IT4B 2WNMA 3VFKA 2PEAA 5I4DA 3RNFC 1VCBA 4DXAB 1TJEA 4KKIA 2CR5A 3N9YC 2AL3A 3PSEB 1D3ZA 4QAYA 4WWMA 2J0MA 4W9DA 3VHTC 1IPGA 2JT4B 2D3CA 1WSPA 4RH6A 2KZRA 3P42A 5IOIA 2LGSA 1Z5SB 3ZQ4A 1KLUD 2L00B 1GAQB 3UIOB 3R66C 1L6UA 3BWUD 1EWCA 4IWOA 1HQRD 5E6PA 3VUYA 4MGIE 4JE3B 1E7UA 1WX7A 2QCZA 2BF8B 3IAS1 3ZXVA 2BTEA 1RM6C 4HPPA 2BB5A 1TT5B 1HXYD 1XT9B 1KH0A 3I63C 4O1NA 1WM2A 4G11A 1TZOA 2N7EA 4N9F4 2JY6A 1V80A 4B95A 2O6VD 4NJCA 1FIQA 1VRAB 3CWIA 2JWZA 2MJ3A 4ZRIA 2QJLA 2KN4A 1NI3A 2WHIA 3VR8B 2L7RA 4B0MA 1OEYJ 2FNJB 1QZEA 4YL8A 5JHBA 2M8SA 3JYUA 3I3TB 2OJRA 2FBWB 3LYYA 2ZW0A 3MHSD 2J42A 1N60A 1DOYA 2E3TA 1C4PA 2NCNA 3ZNGC 1VZ7A 3AMZA 5D7GA 2W55A 2PE9A 2KO3A 1KOTA 4KZ0A 3ALBA 2FCNA 1SSNA 4YSYB 4BOZB 3W5UB 3MTNB 2WQYB 3VAWA 1WJUA 2AEHA 3M62B 2J4XA 1DOIA 5H8YE 2H89B 3IFWB 3FKYA 3RN9C 4GDLB 2N9PC 4YTMB 3ECIA 1TS4A 5EE0A 2RMMA 4FJVB 3HVDA 4EUTA 2IPKD 5CX3A 5EDSA 3H7PB 2NTSA 3OJ4B 1GUAB 4DHZB 1SIJA 4HDQA 2W3RA 5HHDG 1E8ZA 4A6QA 2WWZA 3A9KA 4GU2A 4FBJB 4US9A 2B3AA 3T9LA 3APFA 1V86A 3OWEB 3DPDA 2V4IB 4EZLA 2BKFA 3L13A 5HI1A 1UD7A 2LUEA 3AE9B 3L0WB 4W9LA 2LI5A 3U2SC 1PGBA 3HRDD 3UI3A 3P4QB 4MJSB 1P7EA 4RGTA 2MH7A 2Y5BB 1P7FA 1XCQL 3PO0A 4G0NB 1N5WA 1YX6B 1SE4A 3R7QA 2XBBC 3OJ3A 3ZNZB 4IWQA 3NZUA 1WRIA 2JUOA 2L1AA 4RFBA 4LJOB 3Q8FA 3L10B 2ACZB 3HUIA 2FUG1 2KDBA 2KX3A 4E3CA 4ZRPA 2OHFA 2JXXA 3PRPB 1WGKA 3DBHI 1V5OA 2INDC 1IGDA 3BY4B 3DHGC 3S2AA 1A5RA 2LVPA 2ZPYA 3W1SC 3ZO5B 5TR5A 1ZDVA 3EHVA 3TEXA 2IY1B 4ZHOA 3BYYB 3C19A 4ANUA 3A9JA 4HROA 1YX5B 4BBNF 1IUEA 4LLGM 3SDLC 4XYCA 4MELA 1UBIA 1V6EA 1STEA 5JZEB 3W5VB 3RI7C 1D5MC 2JF5A 1L2NA 4JQWC 2LHEA 1OEYA 1SIFA 2KMMA 3KYCD 1TY2A 4YXDB 3VR9B 2Z0EB 2UYZB 3H1UA 4LDTB 2BYEA 2M17A 3AEEB 1EU3A 1CQVA 4HPMB 1H8CA 4TQ0A 1MFWA 2AQ3B 2ON8A 3BK1A 2MW5A 3RZFA 1E7VA 2BBCA 5G2NA 4D2KA 3Q6BA 4HKZE 2LFIA 4KGTA 1EF1A 3QCAA 4BVUC 2KQSA 3UGBB 2MBHA 5J17A 2YVCA 3PRZA 4FA6A 4LNOA 4JWUC 1E7PB 1XLOA 2PLPA 1G6JA 2V9HA 1KFYB 4P16A 1J7BA 4KIKA 4MM3B 1WMHA 2N1VA 3KVFB 2QILA 4I6NB 1U4AA 4IDIA 1TIFA 5L83A 2IO2B 3AE5B 2WXFA 3KQ4A 3QHTA 4BFRA 4PYUA 3HVZA 3DQVA 3NVWA 4L23A 1ZP0B 2VZKD 2AL6A 1ZE3D 4AOFA 3A1QB 1N5XA 4XDDA 1I4HA 4IM3A 2RPQA 3MJWA 4ZDVA 1NVID 2WDRB 1FO4A 2PJHA 1R4MI 2KWUB 4ZOHC 2LGYA 2CHZA 4H2AA 4W9JA 5DPSA 2YLMA 4PS8A 2D10A 1YJ1A 3DBHB 3AE6B 2MBEA 1N6ZA 4LNFA 4ARIA 1BMLC 2DX5B 2WU2B 2FCSA 3DHIC 4MGYE 4WJOA 4GOCA 1MI0A 3V3XA 2JRIB 3Q3MC 3LJ3A 4RF0A 3B2FA 2GBJA 4OVUA 4TQ1A 3V62A 1FCCC 2E6XA 5JH5C 1K8RB 4DK5A 1F1HA 3AE2B 1C4CA 1HTOA 2KN5A 1RWSA 4TV3A 4NY0A 1FXAA 4AP4C 2AQ1B 3AE8B 1FRDA 1WZ0A 4OZBA 2HTHA 1QOAA 5J2RA 3VTVA 4LCDE 2J0JA 4REZA 2JYTA 1WGDA 1T0YA 2O6VB 4DBGA 2LGDA 4J6IA 5E6JA 3IHPC 3AE7B 4PS3A 4ANWA 2FIDA 2ASQA 1IBXB 3CIRB 4NPNA 4LJPB 3ML8A 3Q69A 3QARA 3AE4B 4W9FA 1V1OA 1RFKA 2M4NA 1BUIC 2W82A 1UGJA 1WX9A 1GPXA 2LRUA 4RGOS 3NS1A 1MJDA 3QA8A 1MHXA 4OZAA 1ZXIA 1AWDA 1XD3B 2MP2B 1PFDA 4MT5A 2X38A 3N30A 1WXQA 4WJQA 1VD2A 1YQBA 4YTNB 4S17A 1WYGA 2C9WB 3A1QA 2RDHA 2D3AA 2JYEA 2QSDA 4DXFA 1NYQA 1JROA 2KWVB 2MBOA 2B76B 2V3SA 1GB4A 2FCQA 2LRWA 1YN4A 2JXTA 2QIEB 4P7IA 1GJZA 2NBUA 3AU4A 4C56C 1UH6A 2HJ8A 1F9JA 1WMHB 2N7DA 3N1XC 5D2MB 1V97A 3J9CA 4A3PA 3QIJA 4NNJB 3PLUA 2KVZA 2PW9A 1NBFC 1JCKB 1IBXA 4HCPB 3ZDTA 3N1YC 2WS3B 2NTTA 3O13A 1IYFA 2BYVE 4JPSA 1DOXA 1JWUD 1B9RA 1AW7A 1M94A 3TEWA 4ACFA 3DVNV 2KQ4X 2INCC 4N58A 4XX5A 4C4VB 1C9FA 2M1MA 1D5ZC 2K22A 1DGJA 4BKSD 4MGKE 1XEEA 2KFJA 2IO3B 2LASA 3N32A 3VRBB 2WYQA 4GLSC 5BYRA 1XF5L 2EKIA 4P1CC 1HE8A 1IGCA 2FAZA
chains in the Genus database with same CATH topology
1KOTA 2BWFA 3Q3FA 4KZ0A 3ALBA 4I6PA 2FCNA 3VH3B 1J19A 4BOZB 2I1JA 3PVLA 3KW5B 3MTNB 3SU8X 4GXBA 5J18A 3VAWA 1WJUA 2AEHA 2KJRA 3EFUA 5BO4B 4B9KA 3M62B 1I42A 1KLVA 4M8MA 1S1QB 4F8CB 2C5LC 2D07B 3IFWB 3DVGY 2RD0A 1SGHA 4GDLB 2N9PC 3ECIA 3BINA 3RUIB 4BBNC 4FJVB 4EUTA 1WE6A 4MGZE 4ZYNA 2MRPA 5CX3A 5AZFA 5EDSA 3H7PB 2N4FA 3OJ4B 2DYMA 1GUAB 4W9CA 2BYFA 1WM3A 2N1WA 4HPLB 4DHZB 3U8ZA 1E8WA 4HDQA 4OVVA 2KJ6A 2ZPNA 1SE9A 2IO0B 1E8ZA 3ZLZA 2C7MB 3PHWB 1H4RA 2AYOB 2WWZA 4IM2A 2C7HA 3A9KA 4GU2A 3DBLI 4GB9A 4FBJB 2B3AA 1TBEA 2K25A 4EOYA 3T9LA 3APFA 4KZCA 1V86A 1WJNA 3DPDA 3DCGA 1V2YA 4EZLA 2BKFA 2LGXA 2V1YA 2KTRA 1J8CA 3T8MA 3DVGX 3L13A 3KYDD 1RRBA 2V4LA 3H6NA 4LDTD 2GBMA 2K6DB 4W9EA 2JVCA 5G55A 3VH4B 3C0RB 1UD7A 2LUEA 3L0WB 2KNBA 3NOBA 2KD0A 3QWZB 4W9LA 4KSKC 2LI5A 4GGQA 3U30A 3RZWC 5FR6A 4NAWB 2KVRA 2ZEQA 4K1RB 4ZRJA 2KDIA 3P2BA 5DCNA 1Q1OA 1WI0A 4W9IA 4MJSB 1IP9A 2GOWA 4FJYA 3JSVA 3UIPB 2K8HA 1ISNA 3X23A 3O65B 2Y5BB 3PS6A 4G0NB 4HCNB 4FJZA 4JGHB 1YX6B 3A33B 3W1SA 1Q5WB 2FUHB 4DDID 2D2QA 2XBBC 3OJ3A 3R7QA 3VTWA 3ZNZB 3UQAA 4FHJA 2JPHA 4IWQA 4MEMA 3NZUA 1WRDB 2KWCA 5AZHA 2NS5A 2C60A 5KHOA 2JUOA 1WH3A 2HE7A 2JZ3B 4W9KA 4LJOB 3V6CB 1WFYA 3A9KB 1XQQA 1EO6A 2K39A 1C1YB 3L10B 1WXVA 1P3QU 2ZZPB 3APCA 4RM9A 2DZJA 5JHAA 3APDA 2LVQA 2KDBA 2KX3A 1NI2A 3K9OB 1UGMA 4E3CA 2K8BA 2UWQA 3PGEA 2AWTA 2JZZA 2W9NA 4MM3A 2JXXA 3PRPB 4KIKB 4RMAA 2G4DB 3DBHI 1OTRB 1V5OA 3WAPA 2MCNB 3D32A 2L0FA 3BY4B 1A5RA 3S2AA 1R4NI 3X0WA 4DDGD 2LVPA 3DBSA 3NZSA 2ZPYA 3B1LX 5CHWA 3W1SC 3ZO5B 3ZIMA 5TR5A 3EHVA 4NJ6A 2IY1B 2BGFA 1OQYA 2GBNA 3PRMB 2M0XA 4ANUA 3A9JA 1UBQA 4TKNA 4WQOB 1WR6E 2MBBB 1YX5B 2NPTB 3A9JB 4ANVA 4FLHA 4WJNA 4BBNF 4F7ZA 3SDLC 2ZNVB 3AI5A 3UF8A 1GNUA 2EKEC 1UBIA 1V6EA 4KV2A 4FHKA 4MELA 4HWIB 2EMTA 1WY8A 4B6WA 5JZEB 1WGYA 2NR2A 3ZTDA 2JF5A 2DYBA 3CSTA 2DYOA 1TGZB 4WWOA 3VUWA 2ZCCA 1L2NA 4JQWC 1ZGUB 4IUMB 3NY5A 3V61A 1WX8A 4EZKA 2KK8A 1OEYA 2Z59B 2WDTB 1SIFA 2LXCA 2R2QA 3KYCD 2LD9A 2CKHB 2Z0EB 2UYZB 4G50A 1TTNA 1X1MA 3H1UA 4LDTB 2BYEA 4MSMB 2M17A 4ASWC 2RSUA 2WX0A 5AZGA 1WF9A 3WALA 4A3OA 3ML9A 4HPMB 3L17A 1CMXB 4GDKB 4EZJA 1H8CA 1WXSA 4TQ0A 2FCMA 3PTFC 1EUVB 1FXTB 2KKCA 2FIFA 2L0TA 4W9HA 5DPTA 4GIVA 4CYEA 2MW5A 3RZFA 1E7VA 2XK5A 5G2NA 3VVWB 5DPWA 2IBIB 1WIAA 2RR9A 3DDCB 3TBLD 1EF1A 1E5WA 1J0GA 3QCAA 3TIXA 1C3TA 4K7WA 2ZJDA 4BVUC 2KQSA 5CHFA 3UGBB 1AARA 2MBHA 1L7YA 1P9DU 5J17A 3ZDMC 2K8CA 2YVCA 3PRZA 4FA6A 5D6JB 1Q0WB 5C1ZA 3SD5A 2KXJA 1YIWA 3ONSA 4GN1A 3ZNHB 1G6JA 2QHOA 3RCZA 1BT0A 1ZKHA 3QK0A 4KVGB 1UZXB 2KLCA 4AWJA 1KJTA 2KTFA 4K7SA 2N9EB 3LDZE 4KIKA 1MG8A 2DZIA 2KTRB 4II2B 4HJKA 1WMHA 4K7UA 3UINB 4KSLC 2N1VA 3KVFB 4JL9A 2KQ7A 4I6NB 1E8YA 2NVUI 3ENEA 1U4AA 3TCAA 5AEKB 2CHWA 2LWPA 4ZRKA 5L83A 2IO2B 2CU1A 5IAAC 3M95A 3V60A 4WAAA 4NAWA 4TUUA 3ZKJC 3CSFA 3IBEA 3H9DA 4IW0A 3WIMA 3ZRFA 2L76A 4EEWA 2MLBA 4FADA 2DAJA 4XC2A 3QHTA 4BFRA 2PPHA 2G45B 3ZTCA 1WR1A 2O2VB 4PYUA 2CS4A 1YD8U 2C7NB 3DQVA 4IWPA 3H7PA 3OLMD 2AL6A 3TJPA 4AOFA 1WYWB 2KFKB 2LVOA 3A1QB 3QQ8B 4BOSC 3L54A 4GSWA 4GDLA 4IM3A 1OGWA 3GOEA 2RPQA 3MJWA 3CMMB 3QAQA 4MSQB 4ZDVA 1WGRA 3TMPB 3HHMA 4HLEA 2PJHA 4FN2A 4K81A 2LXAA 4CO7A 1R4MI 2DAFA 2KWUB 3DBRI 2KMAA 2LGYA 2CHZA 2MA9B 4W9JA 2IO1B 1NDDA 4A20A 3ZRCA 3PV1A 5DPSA 3QJZA 3RT3B 2YLMA 4PS8A 1V5TA 3NS8A 2D10A 3H7SA 1YJ1A 2MBEA 4II3B 4IM0A 5L95C 3VTUA 2DX5B 4KDLB 4CHKA 2FCSA 3CF6E 5CTRC 4MGYE 3L16A 2ZVNA 2KFKA 3KH0A 4WJOA 5IA7A 1V49A 4GOCA 1WJ4A 3AU5A 5GMVA 2GMIC 2JRIB 4MDKE 3LJ3A 4M8NA 1E8XA 1GC6A 2GBJA 3KUZA 5LXHA 4OVUA 4TQ1A 4HXDA 2KX0A 2BWES 4BKGA 3IVFA 3PLVA 3V62A 3AXCA 3PPAA 5JH5C 4KDIC 4F1SA 1K8RB 3RD2A 3DOWA 4DK5A 5LLIA 2KC1A 1Z2MA 2KDFB 2KN5A 4WJPA 2GBRA 2KJHB 4FULA 4TV3A 2KC2A 1RLFA 2DZKA 2HD5B 4NQLB 4NQKE 4NY0A 3PT2B 3VDZA 2O6VA 1KM7A 2L8JA 4AP4C 1PQSA 2BKRB 1WXMA 4MH0E 2MSED 3RYTA 1WZ0A 2HTHA 1LQBA 2CHXA 2KLGA 3PHXB 3PZDA 2D3GA 3KUDB 3L08A 5J2RA 3VTVA 3QX1A 2J0JA 4LCDE 2GBKA 1WGDA 5C23A 3ZVVA 4IG7B 1T0YA 2O6VB 3QC8B 2LGDA 2DENB 3KUCB 3VUXA 4DBGA 4G3XB 4J6IA 2KMCA 1ZW7A 3M3JA 2R2OA 2MWSB 3IHPC 4HDOA 3R3MA 2NBVB 3UQBA 3OAWA 4PS3A 4DHJD 1S3SG 3B08A 4ANWA 1TZ1A 2FIDA 2NBWB 3GZNI 4GMVA 1LM8B 1P1AA 2ASQA 2RGFA 4EFOA 2JRHA 3HM6X 4M0WB 3RULA 3A4SC 2IZVB 3HIZA 3K9PB 4NPNA 2KDEB 4LJPB 4BKSA 3ML8A 4E71A 2IY0B 5DPRA 3QARA 4URKA 1UELA 4W9FA 1GG3A 1RAXA 5D94A 3WAMA 3B0AA 3VXWA 2M4NA 3JSVB 2PEAA 2G4SA 2REXA 3VFKA 2G3QB 3PREA 1VCBA 4DXAB 2KOXA 2VRRB 2EMSA 1WX9A 3U7DA 2CR5A 2LRUA 2AL3A 2BPSA 3PSEB 3QA8A 4ANXA 1D3ZA 4E74A 4AUQC 2J0MA 1XD3B 2MP2B 4W9DA 3VHTC 1IPGA 2NPTA 3N30A 2JT4B 2MBQA 2K1FA 4WJQA 2XK5B 3HM3A 1VD2A 1YQBA 2ZNVC 2KZRA 3NHEB 4W9GA 1JRUA 4HK2A 3ZW3A 1Z5SB 4JLCA 5LXIB 3VQIA 3TL5A 2L00B 3UIOB 2C9WB 3R66C 3A1QA 3R7RA 4GDKA 2J7QB 4NJ7A 4X57B 4IWOA 3DVNU 3N3KB 1V9JA 4BKTA 3WA0A 5E6PA 3Q3JA 4MGIE 2KWVB 5CHVC 5E6OA 1E7UA 1WX7A 3VUYA 2MBOA 2BF8B 2K6QA 4DHJB 2V3SA 3AULA 1LFDA 2FCQA 2LRWA 2PE6B 4P7IA 5E6NA 1GJZA 4XZ4A 3EC8A 2ZCBA 4MJSA 1XT9B 4DHZE 3EECA 1WZ3A 2NBUA 3AU4A 2I1KA 2J0KA 2Z0DB 2ZVOA 1WM2A 4G11A 1UH6A 2HJ8A 4AJYB 4IC7B 2L3ZA 2N7DA 1F9JA 1WMHB 2N7EA 5HKHA 5D2MB 4RM8A 2OOBB 4N9F4 3W1YA 2MQJA 1RFAA 1WGHA 2JY6A 3QIJA 1V80A 4NNJB 4A3PA 4B95A 3PLUA 2O6VD 3V6EB 4AJWA 1WXAA 1GC7A 4PS7A 3M63B 2A5UA 2N9XA 1NBFC 2JWZA 2DZMA 4HCPB 3ZDTA 1V81A 4ZRIA 1IYFA 2LZ6A 2MX2A 1WE7A 4I6LB 2BYVE 4PYZA 2A4ZA 2LJ5A 2L7RA 3JW0X 1WGGA 1OEYJ 1M94A 2FNJB 1EF5A 1QZEA 2KANA 4ICUA 3IG3A 4YL8A 2M8SA 2L05A 5JHBA 3JYUA 1WJ6A 3I3TB 4WWPA 3DVNV 2KHWB 2OJRA 2XEWA 3JVZX 4XX5A 1P0RA 1E90A 2WX1A 3WAOA 4DWFA 3ZUNA 2M1MA 3WANA 1LXDA 3A4RA 1P98A 3ZNID 4BKSD 2D11A 3MHSD 2KFJA 4MGKE 2MP2A 2DHZA 2IO3B 2IYDB 1I35A 2LASA 4HVBA 2O2VA 3N32A 1Y8RC 2NCNA 3SHQA 5KHQA 2WYQA 3ZNGC 5D7GA 4ICVA 1HE8A 2PE9A 3HK0A 2KO3A 4WWNA 4JIOU 2FAZA 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOT A;  2BWF A;  3Q3F A;  4KZ0 A;  3ALB A;  4I6P A;  2FCN A;  3VH3 B;  1J19 A;  4BOZ B;  2I1J A;  3PVL A;  3KW5 B;  3MTN B;  3SU8 X;  4GXB A;  5J18 A;  3VAW A;  1WJU A;  2AEH A;  2KJR A;  3EFU A;  5BO4 B;  4B9K A;  3M62 B;  1I42 A;  1KLV A;  4M8M A;  1S1Q B;  4F8C B;  2C5L C;  2D07 B;  3IFW B;  3DVG Y;  2RD0 A;  1SGH A;  4GDL B;  2N9P C;  3ECI A;  3BIN A;  3RUI B;  4BBN C;  4FJV B;  4EUT A;  1WE6 A;  4MGZ E;  4ZYN A;  2MRP A;  5CX3 A;  5AZF A;  5EDS A;  3H7P B;  2N4F A;  3OJ4 B;  2DYM A;  1GUA B;  4W9C A;  2BYF A;  1WM3 A;  2N1W A;  4HPL B;  4DHZ B;  3U8Z A;  1E8W A;  4HDQ A;  4OVV A;  2KJ6 A;  2ZPN A;  1SE9 A;  2IO0 B;  1E8Z A;  3ZLZ A;  2C7M B;  3PHW B;  1H4R A;  2AYO B;  2WWZ A;  4IM2 A;  2C7H A;  3A9K A;  4GU2 A;  3DBL I;  4GB9 A;  4FBJ B;  2B3A A;  1TBE A;  2K25 A;  4EOY A;  3T9L A;  3APF A;  4KZC A;  1V86 A;  1WJN A;  3DPD A;  3DCG A;  1V2Y A;  4EZL A;  2BKF A;  2LGX A;  2V1Y A;  2KTR A;  1J8C A;  3T8M A;  3DVG X;  3L13 A;  3KYD D;  1RRB A;  2V4L A;  3H6N A;  4LDT D;  2GBM A;  2K6D B;  4W9E A;  2JVC A;  5G55 A;  3VH4 B;  3C0R B;  1UD7 A;  2LUE A;  3L0W B;  2KNB A;  3NOB A;  2KD0 A;  3QWZ B;  4W9L A;  4KSK C;  2LI5 A;  4GGQ A;  3U30 A;  3RZW C;  5FR6 A;  4NAW B;  2KVR A;  2ZEQ A;  4K1R B;  4ZRJ A;  2KDI A;  3P2B A;  5DCN A;  1Q1O A;  1WI0 A;  4W9I A;  4MJS B;  1IP9 A;  2GOW A;  4FJY A;  3JSV A;  3UIP B;  2K8H A;  1ISN A;  3X23 A;  3O65 B;  2Y5B B;  3PS6 A;  4G0N B;  4HCN B;  4FJZ A;  4JGH B;  1YX6 B;  3A33 B;  3W1S A;  1Q5W B;  2FUH B;  4DDI D;  2D2Q A;  2XBB C;  3OJ3 A;  3R7Q A;  3VTW A;  3ZNZ B;  3UQA A;  4FHJ A;  2JPH A;  4IWQ A;  4MEM A;  3NZU A;  1WRD B;  2KWC A;  5AZH A;  2NS5 A;  2C60 A;  5KHO A;  2JUO A;  1WH3 A;  2HE7 A;  2JZ3 B;  4W9K A;  4LJO B;  3V6C B;  1WFY A;  3A9K B;  1XQQ A;  1EO6 A;  2K39 A;  1C1Y B;  3L10 B;  1WXV A;  1P3Q U;  2ZZP B;  3APC A;  4RM9 A;  2DZJ A;  5JHA A;  3APD A;  2LVQ A;  2KDB A;  2KX3 A;  1NI2 A;  3K9O B;  1UGM A;  4E3C A;  2K8B A;  2UWQ A;  3PGE A;  2AWT A;  2JZZ A;  2W9N A;  4MM3 A;  2JXX A;  3PRP B;  4KIK B;  4RMA A;  2G4D B;  3DBH I;  1OTR B;  1V5O A;  3WAP A;  2MCN B;  3D32 A;  2L0F A;  3BY4 B;  1A5R A;  3S2A A;  1R4N I;  3X0W A;  4DDG D;  2LVP A;  3DBS A;  3NZS A;  2ZPY A;  3B1L X;  5CHW A;  3W1S C;  3ZO5 B;  3ZIM A;  5TR5 A;  3EHV A;  4NJ6 A;  2IY1 B;  2BGF A;  1OQY A;  2GBN A;  3PRM B;  2M0X A;  4ANU A;  3A9J A;  1UBQ A;  4TKN A;  4WQO B;  1WR6 E;  2MBB B;  1YX5 B;  2NPT B;  3A9J B;  4ANV A;  4FLH A;  4WJN A;  4BBN F;  4F7Z A;  3SDL C;  2ZNV B;  3AI5 A;  3UF8 A;  1GNU A;  2EKE C;  1UBI A;  1V6E A;  4KV2 A;  4FHK A;  4MEL A;  4HWI B;  2EMT A;  1WY8 A;  4B6W A;  5JZE B;  1WGY A;  2NR2 A;  3ZTD A;  2JF5 A;  2DYB A;  3CST A;  2DYO A;  1TGZ B;  4WWO A;  3VUW A;  2ZCC A;  1L2N A;  4JQW C;  1ZGU B;  4IUM B;  3NY5 A;  3V61 A;  1WX8 A;  4EZK A;  2KK8 A;  1OEY A;  2Z59 B;  2WDT B;  1SIF A;  2LXC A;  2R2Q A;  3KYC D;  2LD9 A;  2CKH B;  2Z0E B;  2UYZ B;  4G50 A;  1TTN A;  1X1M A;  3H1U A;  4LDT B;  2BYE A;  4MSM B;  2M17 A;  4ASW C;  2RSU A;  2WX0 A;  5AZG A;  1WF9 A;  3WAL A;  4A3O A;  3ML9 A;  4HPM B;  3L17 A;  1CMX B;  4GDK B;  4EZJ A;  1H8C A;  1WXS A;  4TQ0 A;  2FCM A;  3PTF C;  1EUV B;  1FXT B;  2KKC A;  2FIF A;  2L0T A;  4W9H A;  5DPT A;  4GIV A;  4CYE A;  2MW5 A;  3RZF A;  1E7V A;  2XK5 A;  5G2N A;  3VVW B;  5DPW A;  2IBI B;  1WIA A;  2RR9 A;  3DDC B;  3TBL D;  1EF1 A;  1E5W A;  1J0G A;  3QCA A;  3TIX A;  1C3T A;  4K7W A;  2ZJD A;  4BVU C;  2KQS A;  5CHF A;  3UGB B;  1AAR A;  2MBH A;  1L7Y A;  1P9D U;  5J17 A;  3ZDM C;  2K8C A;  2YVC A;  3PRZ A;  4FA6 A;  5D6J B;  1Q0W B;  5C1Z A;  3SD5 A;  2KXJ A;  1YIW A;  3ONS A;  4GN1 A;  3ZNH B;  1G6J A;  2QHO A;  3RCZ A;  1BT0 A;  1ZKH A;  3QK0 A;  4KVG B;  1UZX B;  2KLC A;  4AWJ A;  1KJT A;  2KTF A;  4K7S A;  2N9E B;  3LDZ E;  4KIK A;  1MG8 A;  2DZI A;  2KTR B;  4II2 B;  4HJK A;  1WMH A;  4K7U A;  3UIN B;  4KSL C;  2N1V A;  3KVF B;  4JL9 A;  2KQ7 A;  4I6N B;  1E8Y A;  2NVU I;  3ENE A;  1U4A A;  3TCA A;  5AEK B;  2CHW A;  2LWP A;  4ZRK A;  5L83 A;  2IO2 B;  2CU1 A;  5IAA C;  3M95 A;  3V60 A;  4WAA A;  4NAW A;  4TUU A;  3ZKJ C;  3CSF A;  3IBE A;  3H9D A;  4IW0 A;  3WIM A;  3ZRF A;  2L76 A;  4EEW A;  2MLB A;  4FAD A;  2DAJ A;  4XC2 A;  3QHT A;  4BFR A;  2PPH A;  2G45 B;  3ZTC A;  1WR1 A;  2O2V B;  4PYU A;  2CS4 A;  1YD8 U;  2C7N B;  3DQV A;  4IWP A;  3H7P A;  3OLM D;  2AL6 A;  3TJP A;  4AOF A;  1WYW B;  2KFK B;  2LVO A;  3A1Q B;  3QQ8 B;  4BOS C;  3L54 A;  4GSW A;  4GDL A;  4IM3 A;  1OGW A;  3GOE A;  2RPQ A;  3MJW A;  3CMM B;  3QAQ A;  4MSQ B;  4ZDV A;  1WGR A;  3TMP B;  3HHM A;  4HLE A;  2PJH A;  4FN2 A;  4K81 A;  2LXA A;  4CO7 A;  1R4M I;  2DAF A;  2KWU B;  3DBR I;  2KMA A;  2LGY A;  2CHZ A;  2MA9 B;  4W9J A;  2IO1 B;  1NDD A;  4A20 A;  3ZRC A;  3PV1 A;  5DPS A;  3QJZ A;  3RT3 B;  2YLM A;  4PS8 A;  1V5T A;  3NS8 A;  2D10 A;  3H7S A;  1YJ1 A;  2MBE A;  4II3 B;  4IM0 A;  5L95 C;  3VTU A;  2DX5 B;  4KDL B;  4CHK A;  2FCS A;  3CF6 E;  5CTR C;  4MGY E;  3L16 A;  2ZVN A;  2KFK A;  3KH0 A;  4WJO A;  5IA7 A;  1V49 A;  4GOC A;  1WJ4 A;  3AU5 A;  5GMV A;  2GMI C;  2JRI B;  4MDK E;  3LJ3 A;  4M8N A;  1E8X A;  1GC6 A;  2GBJ A;  3KUZ A;  5LXH A;  4OVU A;  4TQ1 A;  4HXD A;  2KX0 A;  2BWE S;  4BKG A;  3IVF A;  3PLV A;  3V62 A;  3AXC A;  3PPA A;  5JH5 C;  4KDI C;  4F1S A;  1K8R B;  3RD2 A;  3DOW A;  4DK5 A;  5LLI A;  2KC1 A;  1Z2M A;  2KDF B;  2KN5 A;  4WJP A;  2GBR A;  2KJH B;  4FUL A;  4TV3 A;  2KC2 A;  1RLF A;  2DZK A;  2HD5 B;  4NQL B;  4NQK E;  4NY0 A;  3PT2 B;  3VDZ A;  2O6V A;  1KM7 A;  2L8J A;  4AP4 C;  1PQS A;  2BKR B;  1WXM A;  4MH0 E;  2MSE D;  3RYT A;  1WZ0 A;  2HTH A;  1LQB A;  2CHX A;  2KLG A;  3PHX B;  3PZD A;  2D3G A;  3KUD B;  3L08 A;  5J2R A;  3VTV A;  3QX1 A;  2J0J A;  4LCD E;  2GBK A;  1WGD A;  5C23 A;  3ZVV A;  4IG7 B;  1T0Y A;  2O6V B;  3QC8 B;  2LGD A;  2DEN B;  3KUC B;  3VUX A;  4DBG A;  4G3X B;  4J6I A;  2KMC A;  1ZW7 A;  3M3J A;  2R2O A;  2MWS B;  3IHP C;  4HDO A;  3R3M A;  2NBV B;  3UQB A;  3OAW A;  4PS3 A;  4DHJ D;  1S3S G;  3B08 A;  4ANW A;  1TZ1 A;  2FID A;  2NBW B;  3GZN I;  4GMV A;  1LM8 B;  1P1A A;  2ASQ A;  2RGF A;  4EFO A;  2JRH A;  3HM6 X;  4M0W B;  3RUL A;  3A4S C;  2IZV B;  3HIZ A;  3K9P B;  4NPN A;  2KDE B;  4LJP B;  4BKS A;  3ML8 A;  4E71 A;  2IY0 B;  5DPR A;  3QAR A;  4URK A;  1UEL A;  4W9F A;  1GG3 A;  1RAX A;  5D94 A;  3WAM A;  3B0A A;  3VXW A;  2M4N A;  3JSV B;  2PEA A;  2G4S A;  2REX A;  3VFK A;  2G3Q B;  3PRE A;  1VCB A;  4DXA B;  2KOX A;  2VRR B;  2EMS A;  1WX9 A;  3U7D A;  2CR5 A;  2LRU A;  2AL3 A;  2BPS A;  3PSE B;  3QA8 A;  4ANX A;  1D3Z A;  4E74 A;  4AUQ C;  2J0M A;  1XD3 B;  2MP2 B;  4W9D A;  3VHT C;  1IPG A;  2NPT A;  3N30 A;  2JT4 B;  2MBQ A;  2K1F A;  4WJQ A;  2XK5 B;  3HM3 A;  1VD2 A;  1YQB A;  2ZNV C;  2KZR A;  3NHE B;  4W9G A;  1JRU A;  4HK2 A;  3ZW3 A;  1Z5S B;  4JLC A;  5LXI B;  3VQI A;  3TL5 A;  2L00 B;  3UIO B;  2C9W B;  3R66 C;  3A1Q A;  3R7R A;  4GDK A;  2J7Q B;  4NJ7 A;  4X57 B;  4IWO A;  3DVN U;  3N3K B;  1V9J A;  4BKT A;  3WA0 A;  5E6P A;  3Q3J A;  4MGI E;  2KWV B;  5CHV C;  5E6O A;  1E7U A;  1WX7 A;  3VUY A;  2MBO A;  2BF8 B;  2K6Q A;  4DHJ B;  2V3S A;  3AUL A;  1LFD A;  2FCQ A;  2LRW A;  2PE6 B;  4P7I A;  5E6N A;  1GJZ A;  4XZ4 A;  3EC8 A;  2ZCB A;  4MJS A;  1XT9 B;  4DHZ E;  3EEC A;  1WZ3 A;  2NBU A;  3AU4 A;  2I1K A;  2J0K A;  2Z0D B;  2ZVO A;  1WM2 A;  4G11 A;  1UH6 A;  2HJ8 A;  4AJY B;  4IC7 B;  2L3Z A;  2N7D A;  1F9J A;  1WMH B;  2N7E A;  5HKH A;  5D2M B;  4RM8 A;  2OOB B;  4N9F 4;  3W1Y A;  2MQJ A;  1RFA A;  1WGH A;  2JY6 A;  3QIJ A;  1V80 A;  4NNJ B;  4A3P A;  4B95 A;  3PLU A;  2O6V D;  3V6E B;  4AJW A;  1WXA A;  1GC7 A;  4PS7 A;  3M63 B;  2A5U A;  2N9X A;  1NBF C;  2JWZ A;  2DZM A;  4HCP B;  3ZDT A;  1V81 A;  4ZRI A;  1IYF A;  2LZ6 A;  2MX2 A;  1WE7 A;  4I6L B;  2BYV E;  4PYZ A;  2A4Z A;  2LJ5 A;  2L7R A;  3JW0 X;  1WGG A;  1OEY J;  1M94 A;  2FNJ B;  1EF5 A;  1QZE A;  2KAN A;  4ICU A;  3IG3 A;  4YL8 A;  2M8S A;  2L05 A;  5JHB A;  3JYU A;  1WJ6 A;  3I3T B;  4WWP A;  3DVN V;  2KHW B;  2OJR A;  2XEW A;  3JVZ X;  4XX5 A;  1P0R A;  1E90 A;  2WX1 A;  3WAO A;  4DWF A;  3ZUN A;  2M1M A;  3WAN A;  1LXD A;  3A4R A;  1P98 A;  3ZNI D;  4BKS D;  2D11 A;  3MHS D;  2KFJ A;  4MGK E;  2MP2 A;  2DHZ A;  2IO3 B;  2IYD B;  1I35 A;  2LAS A;  4HVB A;  2O2V A;  3N32 A;  1Y8R C;  2NCN A;  3SHQ A;  5KHQ A;  2WYQ A;  3ZNG C;  5D7G A;  4ICV A;  1HE8 A;  2PE9 A;  3HK0 A;  2KO3 A;  4WWN A;  4JIO U;  2FAZ A;  4EKU A; 
#chains in the Genus database with same CATH topology
 2BWF A;  1V8C A;  3SFE B;  3SU8 X;  5J18 A;  3BII D;  1I42 A;  4B9K A;  4F8C B;  2C5L C;  4US8 A;  3BIN A;  3BVG A;  4M01 A;  4XGA B;  1WE6 A;  2WXJ A;  4MGZ E;  3RMK C;  2WLB A;  2DYM A;  2RDB C;  2BYF A;  1WM3 A;  2LUM A;  2N1W A;  1QT9 A;  3GS2 A;  4HKQ A;  1E8W A;  3BVM A;  1FEH A;  4B0E A;  3PHW B;  5D3I B;  4IM2 A;  3DBL I;  1TBE A;  2K25 A;  3GE8 C;  4KZC A;  1WJN A;  4M02 A;  1CZP A;  2LGX A;  2JWU A;  1TKE A;  3T8M A;  3KYD D;  2V4L A;  4LDT D;  1VDV A;  2K6D B;  2V3P A;  3C0R B;  4C80 A;  4KSK C;  4GGQ A;  2WP9 B;  2IJ0 A;  2KVR A;  4K3B A;  2KDI A;  3RNB C;  3DWG C;  1ISN A;  5EE9 A;  4HCN B;  4FJZ A;  1I4R A;  3A33 B;  2FUH B;  4DDI D;  2D2Q A;  3VTW A;  3UQA A;  4MEM A;  2KWC A;  2NS5 A;  2C60 A;  3EGR A;  2HE7 A;  2IGD A;  2AX5 A;  4M0W A;  1WFY A;  3A9K B;  2K39 A;  1C1Y B;  2HDE A;  1WXV A;  2ZZP B;  3APC A;  4RM9 A;  4P1B C;  2LVQ A;  1NI2 A;  2K8B A;  2W9N A;  4RMA A;  1OTR B;  1F77 A;  2L0F A;  1WWT A;  3B1L X;  3ZIM A;  4C4V A;  3ZGZ A;  4NJ6 A;  1OQY A;  4RCO A;  1BXT A;  1YNT E;  1CJE A;  1UBQ A;  2MBB B;  2NPT B;  2EKE C;  2W54 A;  4FHK A;  4B6W A;  2NR2 A;  1L0Y B;  2ZCC A;  4EZK A;  4AS1 A;  3PZ8 A;  2G9H D;  2R2Q A;  2LD9 A;  2CKH B;  1C77 A;  4KGS A;  2RSU A;  5AZG A;  5LNK 1;  3RNC C;  2INN E;  3WAL A;  4LNK A;  2ICI A;  1L4Z B;  4GDK B;  1WXS A;  2FCM A;  2QDF A;  2ONQ A;  1MHH E;  5H92 C;  1SJH D;  2L0T A;  4RNA A;  4GIV A;  1D4B A;  1C79 A;  1JRP A;  2XK5 A;  3VVW B;  2N9L A;  2IBI B;  1WIA A;  1PUT A;  4LK0 M;  3TIX A;  1C3T A;  1K51 A;  2ZJD A;  1MVK A;  5CHF A;  2K8C A;  2ZW1 A;  4L2Y A;  5C1Z A;  3SR6 A;  1C4A A;  1YIW A;  4JWS C;  2PVG C;  3RCZ A;  1BT0 A;  1ZKH A;  3FAH A;  2WDQ B;  5T8I A;  2WXR A;  4WUR A;  4KVG B;  1UZX B;  2KLC A;  1YQ4 B;  1ESF A;  2YEP B;  3LDZ E;  3GZN B;  1JQ4 A;  2X8X X;  2KTR B;  3GB1 A;  3EFC A;  4JL9 A;  3R2T A;  3AV8 A;  1SE3 A;  3ENE A;  5BYS A;  2LWP A;  2CU1 A;  1SE2 A;  3CSF A;  3IBE A;  3H9D A;  4EEW A;  2XNA C;  2L76 A;  1T0S C;  1VZ6 A;  3NVY A;  4XC2 A;  2G45 B;  3EUB 2;  3ZTC A;  4RF1 A;  2CS4 A;  1YD8 U;  3TJP A;  4BOS C;  1FM0 D;  1HZ6 A;  1FFU A;  1HA5 A;  4YTP B;  1OGW A;  4MSQ B;  1HZ5 A;  1VJK A;  3HHM A;  5IKC M;  3BZD B;  4FN2 A;  2PIA A;  4PK1 A;  3AEB B;  2IO1 B;  4ZHP A;  4Q2J A;  1V5T A;  3NS8 A;  1TS5 A;  2JZP A;  4II3 B;  4IM0 A;  2M0A A;  1D6E C;  4NZL B;  1YQ3 B;  3RNG C;  5CTR C;  2KFK A;  3KH0 A;  5IA7 A;  1WJ4 A;  1E8X A;  1GC6 A;  1OQR A;  4R3D A;  1F0Z A;  3PLV A;  4C7Z A;  1QKZ A;  3RD2 A;  1NYR A;  1T0R C;  1YN3 A;  2L83 A;  2KDF B;  2MJE A;  2BYT A;  2GBR A;  4FUL A;  4NQK E;  3ETR A;  3PT2 B;  1KM7 A;  2L8J A;  1QLB B;  2WU5 B;  1WXM A;  3RYT A;  1LQB A;  2KLG A;  4NAM A;  2BS3 B;  5C23 A;  3ZVV A;  3VUX A;  3KWV A;  1ZW7 A;  2N7J A;  2MWS B;  2WXO A;  3FIL A;  4FXC A;  2G1E A;  1KF6 B;  3UQB A;  1OQQ A;  3OAW A;  4DHJ D;  2NBW B;  3GZN I;  2RGF A;  2EEL A;  2IZV B;  2KDE B;  2CJN A;  4E71 A;  2IY0 B;  2NMQ A;  5D94 A;  1I4X A;  3VXW A;  1E6E B;  3JSV B;  2G4S A;  4OZC A;  3PRE A;  2KOX A;  1YMH E;  3U7D A;  4KGR A;  2SEB D;  2BPS A;  4ANX A;  2OED A;  2Y3A A;  4AUQ C;  2MBQ A;  1ZXH A;  2ZNV C;  3NHE B;  4HK2 A;  3VQI A;  1KTK A;  3R7R A;  1UUP A;  4NJ7 A;  4X57 B;  3DVN U;  3N3K B;  1V9J A;  3WA0 A;  3BVZ A;  2K6Q A;  1LFD A;  5E6N A;  1K50 A;  2ZCB A;  1Y56 A;  4DHZ E;  3EEC A;  1WZ3 A;  1UWX A;  3TEY A;  1N63 A;  2J0K A;  3NZ3 A;  4IC7 B;  2L3Z A;  5HKH A;  3W1Y A;  2MQJ A;  3Q3O C;  3V6E B;  5FR3 A;  3L4P A;  3ZYY X;  1WXA A;  1GC7 A;  4PS7 A;  4EE2 A;  5C2T B;  2N9X A;  1VLB A;  1TS3 A;  3OG5 A;  3LB8 C;  2HJ1 A;  2LZ6 A;  4I6L B;  2A4Z A;  2LJ5 A;  4IKG A;  1WGG A;  1VR9 A;  3IG3 A;  3RPF C;  1WJ6 A;  1ET9 A;  4WWP A;  2KHW B;  2XEW A;  5HG2 A;  2N0S B;  3C8Y A;  3WAO A;  3GE3 C;  2JSV X;  1Q10 A;  1E10 A;  3A4R A;  1P98 A;  2LMC A;  3NJT A;  2MP2 A;  2DHZ A;  3TUO A;  1I35 A;  4HVB A;  2O2V A;  2Z8L A;  2WXM A;  4C00 A;  1F52 A;  4WWN A;  4JIO U;  4EKU A;  2V3N A;  3H8H A;  5IN7 A;  4XWW A;  2I1J A;  3KW5 B;  4K3C A;  2V0G A;  2KJR A;  5BO4 B;  3Q2A C;  1UNS A;  3DBR B;  1KLV A;  4M8M A;  1S1Q B;  1SXT A;  3RFZ B;  2D07 B;  5BMG A;  3DVG Y;  3T3N A;  2RD0 A;  2K9X A;  4BBN C;  1L6V A;  2JQR B;  2D5G A;  3GP7 A;  4ZYN A;  1L5P A;  2N4F A;  2MEK A;  4W9C A;  2BVC A;  4HPL B;  3U8Z A;  4OVZ A;  4OVV A;  2KJ6 A;  2ZPN A;  2IO0 B;  3ZLZ A;  4HEA 1;  2AYO B;  1FPY A;  1E9M A;  2C7H A;  2WGS A;  1PYW D;  1V2Y A;  5MPO A;  1TYG B;  2V1Y A;  2CU3 A;  5BMH A;  2KTR A;  1J8C A;  2WXG A;  1VZ8 A;  3DVG X;  1FRR A;  1T0Q C;  3H6N A;  2JVC A;  2GRI A;  3VH4 B;  1V1P B;  3QWZ B;  3AEF B;  3NOB A;  1SEB D;  2FE8 A;  3RZW C;  1QIL A;  5FR6 A;  1JW9 D;  4K1R B;  4ZRJ A;  5DCN A;  1WI0 A;  4FJY A;  2K8H A;  3X23 A;  1I4P A;  3PS6 A;  5FKA C;  4JGH B;  1Q5W B;  5IP4 D;  4FHJ A;  2M19 A;  1WRD B;  5KHO A;  5AUI A;  1WH3 A;  2JZ3 B;  3E9S A;  1P3Q U;  3APD A;  1UGM A;  3FIL B;  2UWQ A;  2AWT A;  2JZZ A;  1KLG D;  3AEC B;  4PT5 A;  1N61 A;  2MCN B;  2LJI A;  3D32 A;  1FXI A;  3AM9 A;  2PMV A;  1R4N I;  2LHD A;  2WXI A;  4DDG D;  1R4N B;  3P4P B;  5CHW A;  2BGF A;  5C3J B;  5BMI A;  1UWM A;  2GBN A;  2AQ2 B;  3AN1 A;  4TKN A;  2PVO D;  4FLH A;  4WJN A;  3W9C B;  3AI5 A;  2QMT A;  4CQN A;  4KV2 A;  1TKG A;  1WGY A;  5G5G A;  3ZTD A;  3CST A;  2DYB A;  2K3U A;  4USA A;  1TGZ B;  4IUM B;  3NY5 A;  3V61 A;  2Z59 B;  1AN8 A;  4KKJ A;  2I38 A;  4G50 A;  1K53 A;  4ASW C;  1OFF A;  1F2R C;  2JU6 X;  1WF9 A;  4HJG E;  4A3O A;  3L17 A;  2GLS A;  4EZJ A;  3PTF C;  1FXT B;  2FIF A;  2PTL A;  5DPT A;  4OHJ A;  2RPV A;  3TBL D;  1J0G A;  5EE3 A;  1AAR A;  1P9D U;  1JWB D;  1Q0W B;  1ZDX A;  3ONS A;  3Q8C A;  4YSZ B;  2JX5 A;  3QK0 A;  1KJT A;  3MC8 A;  2N9E B;  1MG8 A;  2GI9 A;  4HJK A;  2GB1 A;  2HTM E;  3U4E G;  1J7A A;  3MFG A;  2W3S A;  2NVU I;  1L0V B;  4ITK A;  2CHW A;  3V60 A;  3M95 A;  4WAA A;  3VRA B;  4IW0 A;  4FAD A;  4A55 A;  2PPH A;  3I57 A;  1WR1 A;  2O2V B;  3NG0 A;  2DBY A;  2LVO A;  2BS4 B;  3QQ8 B;  3L54 A;  4JX1 C;  3IT6 B;  4GSW A;  4WQM A;  1XLN A;  1UF0 A;  3QAQ A;  1HTQ A;  3B9J A;  3RNE C;  1WGR A;  3TMP B;  4HLE A;  1KRH A;  1A70 A;  4K81 A;  2LXA A;  2DAF A;  1CK1 A;  1EU4 A;  2MA9 B;  1E0Z A;  1GB1 A;  1NDD A;  3PV1 A;  3U52 E;  1NEK B;  2L52 A;  1JWA D;  5L95 C;  4RGM A;  2WXH A;  2ZVN A;  1V49 A;  5GMV A;  4M8N A;  2H88 B;  2QC8 A;  3SEB A;  5LXH A;  4HXD A;  2KX0 A;  2BWE S;  4BKG A;  1YJI A;  3PPA A;  3Q8E A;  4F1S A;  3B2G A;  4LTU A;  4OW0 A;  2KC1 A;  3BK2 A;  1AYF A;  1Z2M A;  4WJP A;  2KJH B;  3MC9 A;  2QEJ C;  1RLF A;  2DZK A;  2HD5 B;  3AEA B;  2YEP F;  2UU7 A;  4MH0 E;  2MSE D;  1XCT L;  3PZD A;  3PHX B;  2D3G A;  3KUD B;  3QX1 A;  1ZPS A;  2KAJ A;  4XWT A;  3AE1 B;  2WXQ A;  4WH4 A;  3P63 A;  1TY0 A;  1V1P A;  2J53 A;  2KMC A;  3M3J A;  2KYW A;  4HDO A;  1T6B X;  2WXN A;  3B08 A;  5FK9 C;  3W2D A;  1P1A A;  4LNN A;  4EFO A;  1PGA A;  2JRH A;  2KT7 A;  4M0W B;  3RUL A;  3A4S C;  1YJJ A;  2BQQ A;  1SBB B;  3K9P B;  3DHH C;  3KWL A;  5DPR A;  3P4R B;  1GG3 A;  3URY A;  1RAX A;  1TS2 A;  3ZJT A;  3WAM A;  3B0A A;  1RYJ A;  4L1B A;  1FCL A;  2REX A;  1GOZ A;  3NVZ A;  2G3Q B;  4RGN A;  1M4V A;  2VRR B;  1L0X B;  1ZOY B;  4YWG G;  1ENF A;  2EMS A;  2M56 B;  1FNU A;  1XO3 A;  4ZRQ A;  4TMA B;  4E74 A;  2TSS A;  3ABV B;  2NPT A;  2K5P A;  2K1F A;  2XK5 B;  3HM3 A;  4ZYS A;  4W9G A;  1JRU A;  2L32 A;  3ZW3 A;  4JLC A;  5LXI B;  2I2Y A;  3ZJV A;  1SB3 C;  3TL5 A;  5BYQ A;  2SAK A;  4GDK A;  2J7Q B;  2VZK B;  5G5H A;  4BKT A;  3Q3J A;  5CHV C;  5E6O A;  4A8X C;  4DHJ B;  3AUL A;  2PE6 B;  4XZ4 A;  2R61 A;  3EC8 A;  4MJS A;  2I1K A;  2Z0D B;  2ZVO A;  1L4D B;  4AJY B;  1FNW A;  4RM8 A;  2OOB B;  2LGI A;  1RFA A;  1WGH A;  3IXS A;  4AJW A;  3E56 A;  2WXL A;  3M63 B;  3T3O A;  2A5U A;  2IGH A;  2DZM A;  1SF0 A;  2BW2 A;  2MHJ A;  4LNI A;  1V81 A;  1YOV B;  1C76 A;  2MX2 A;  1WE7 A;  4PYZ A;  3KLS X;  3JW0 X;  1I4Q A;  1EF5 A;  2KAN A;  2RDG A;  4ICU A;  2L05 A;  4J3O D;  3NVV A;  3JVZ X;  1P0R A;  1PDX A;  1E90 A;  2WX1 A;  1JML A;  4DWF A;  3ZUN A;  3WAN A;  1LXD A;  4YSX B;  3ZNI D;  2D11 A;  4WAF A;  2IYD B;  3MC0 B;  1Y8R C;  4AQ7 A;  1LGR A;  3SHQ A;  5KHQ A;  4ICV A;  4HRS A;  3HK0 A;  3EA6 A;  2NBV B;  5TSS A;  3Q3F A;  1QQR A;  1K52 A;  4I6P A;  3VH3 B;  1J19 A;  4S0R A;  3PVL A;  2WXP A;  4GXB A;  5D3D A;  1MPE A;  3EFU A;  1NEN B;  1R4M B;  1EWY C;  3AEG B;  1SGH A;  3RUI B;  2MRP A;  1B1Z A;  5AZF A;  4BZA A;  1XXG A;  4MAC A;  4XE0 A;  3MJ5 A;  4DQO C;  1SE9 A;  1XLP A;  2C7M B;  4YT0 B;  1H4R A;  4GB9 A;  4C7Y A;  1T5X D;  4EOY A;  3MP9 A;  3DCG A;  1I4G A;  1RRB A;  4W9E A;  2GBM A;  1JAL A;  5G55 A;  4N59 A;  2KNB A;  2KD0 A;  3U30 A;  4NAW B;  2ZEQ A;  3P2B A;  1EM7 A;  1Q1O A;  4W9I A;  4IOI E;  1IP9 A;  2GOW A;  1PGX A;  2VH2 A;  3JSV A;  3UIP B;  3O65 B;  3W1S A;  2JPH A;  5AZH A;  1F2R I;  1FD6 A;  2KWD A;  5JXV A;  4W9K A;  3V6C B;  1XQQ A;  1EO6 A;  2J52 A;  4BAX A;  5EE1 A;  3N20 C;  2DZJ A;  2INP E;  5JHA A;  1I7H A;  3K9O B;  2OJW A;  3PGE A;  4MM3 A;  2DNF A;  1XLQ A;  2PKO A;  4KIK B;  2G4D B;  3WAP A;  1LO5 D;  1QOG A;  1MG4 A;  3X0W A;  1R7S A;  3DBS A;  3NZS A;  2LEK A;  3AED B;  2BB6 A;  1JWM D;  3PRM B;  2M0X A;  4WQO B;  3MHZ A;  1WR6 E;  3A9J B;  4ANV A;  3Q8B A;  4F7Z A;  1TKY A;  3R8B A;  4A9A A;  2ZNV B;  3UF8 A;  1GNU A;  4HWI B;  2EMT A;  1WY8 A;  3LXF A;  2DYO A;  1ACC A;  4WWO A;  3VUW A;  5AUK A;  2WDV B;  1ZGU B;  2BT6 A;  1WX8 A;  1ROE A;  2KK8 A;  1JWS D;  2WDT B;  1N62 A;  2LXC A;  1QF6 A;  2D3B A;  1TTN A;  1X1M A;  4MSM B;  2KDM A;  2WX0 A;  3ML9 A;  1CMX B;  2Q5W D;  1EUV B;  2KKC A;  3P1M A;  4W9H A;  4CYE A;  2CJO A;  5DPW A;  3DDC B;  2RR9 A;  1E5W A;  4K7W A;  3U7Z A;  1L7Y A;  3ZDM C;  5D6J B;  3SD5 A;  2KXJ A;  4KX6 B;  4GN1 A;  3ZNH B;  2QHO A;  4AWJ A;  3Q14 C;  2KTF A;  4K7S A;  3V05 A;  2DZI A;  3Q8A A;  4II2 B;  5HFY A;  4K7U A;  3UIN B;  4KSL C;  1FNV A;  4UDU C;  2KQ7 A;  1E8Y A;  4ARC A;  2N9K A;  3R2I A;  3TCA A;  5AEK B;  4ZRK A;  3SFD B;  5IAA C;  3ZKJ C;  4NAW A;  4TUU A;  4MH8 A;  3ZRF A;  4M00 A;  3P4S B;  3WIM A;  2MLB A;  2DAJ A;  1HEZ E;  3FC4 A;  3AE3 B;  3I9V 1;  3TSS A;  3ZJU A;  2C7N B;  4IWP A;  3H7P A;  3OLM D;  3Q3N C;  1WYW B;  2KFK B;  1YN5 A;  3N1Z C;  4GDL A;  3AH7 A;  1ZUD 2;  3GOE A;  2BS2 B;  3CMM B;  4XDC A;  3AB5 A;  4CO7 A;  2Y5C A;  3DBR I;  2KMA A;  4A20 A;  1ET6 A;  3ZRC A;  3QJZ A;  2MJD A;  3RT3 B;  1FMA D;  2IDY A;  3I5J C;  3H7S A;  4TSS A;  3PZ7 A;  3VTU A;  3DBL B;  4KDL B;  4CHK A;  3CF6 E;  3L16 A;  3AU5 A;  2GMI C;  1C78 A;  4MDK E;  4A90 A;  2KAC A;  2XN9 C;  3KUZ A;  3IVF A;  1FFV A;  3AXC A;  4KDI C;  1QOB A;  3DOW A;  3ZXR A;  5LLI A;  3BYT B;  3NRZ A;  3WCQ A;  3IAM 1;  2KC2 A;  3VDZ A;  4NQL B;  2O6V A;  1PQS A;  4WIP A;  2BKR B;  5IO9 A;  2DWQ A;  1SJE D;  2CHX A;  5GXG B;  3RNA C;  3DWM A;  3L08 A;  2GBK A;  3TEZ A;  4IG7 B;  2K0P A;  3QC8 B;  2DEN B;  3KUC B;  4G3X B;  4DXG A;  2R2O A;  3R3M A;  1QOF A;  2DLB A;  1S3S G;  1TZ1 A;  2VH1 A;  4GMV A;  1J7C A;  1LM8 B;  3HM6 X;  4P6V F;  3HIZ A;  1D5X C;  3NUH B;  1DYQ A;  4BKS A;  1T3Q A;  2Y5P A;  4URK A;  1UEL A;  2IGG A;  4N6E B;  2WXK A;  3IT4 B;  2WNM A;  3VFK A;  2PEA A;  5I4D A;  3RNF C;  1VCB A;  4DXA B;  1TJE A;  4KKI A;  2CR5 A;  3N9Y C;  2AL3 A;  3PSE B;  1D3Z A;  4QAY A;  4WWM A;  2J0M A;  4W9D A;  3VHT C;  1IPG A;  2JT4 B;  2D3C A;  1WSP A;  4RH6 A;  2KZR A;  3P42 A;  5IOI A;  2LGS A;  1Z5S B;  3ZQ4 A;  1KLU D;  2L00 B;  1GAQ B;  3UIO B;  3R66 C;  1L6U A;  3BWU D;  1EWC A;  4IWO A;  1HQR D;  5E6P A;  3VUY A;  4MGI E;  4JE3 B;  1E7U A;  1WX7 A;  2QCZ A;  2BF8 B;  3IAS 1;  3ZXV A;  2BTE A;  1RM6 C;  4HPP A;  2BB5 A;  1TT5 B;  1HXY D;  1XT9 B;  1KH0 A;  3I63 C;  4O1N A;  1WM2 A;  4G11 A;  1TZO A;  2N7E A;  4N9F 4;  2JY6 A;  1V80 A;  4B95 A;  2O6V D;  4NJC A;  1FIQ A;  1VRA B;  3CWI A;  2JWZ A;  2MJ3 A;  4ZRI A;  2QJL A;  2KN4 A;  1NI3 A;  2WHI A;  3VR8 B;  2L7R A;  4B0M A;  1OEY J;  2FNJ B;  1QZE A;  4YL8 A;  5JHB A;  2M8S A;  3JYU A;  3I3T B;  2OJR A;  2FBW B;  3LYY A;  2ZW0 A;  3MHS D;  2J42 A;  1N60 A;  1DOY A;  2E3T A;  1C4P A;  2NCN A;  3ZNG C;  1VZ7 A;  3AMZ A;  5D7G A;  2W55 A;  2PE9 A;  2KO3 A;  1KOT A;  4KZ0 A;  3ALB A;  2FCN A;  1SSN A;  4YSY B;  4BOZ B;  3W5U B;  3MTN B;  2WQY B;  3VAW A;  1WJU A;  2AEH A;  3M62 B;  2J4X A;  1DOI A;  5H8Y E;  2H89 B;  3IFW B;  3FKY A;  3RN9 C;  4GDL B;  2N9P C;  4YTM B;  3ECI A;  1TS4 A;  5EE0 A;  2RMM A;  4FJV B;  3HVD A;  4EUT A;  2IPK D;  5CX3 A;  5EDS A;  3H7P B;  2NTS A;  3OJ4 B;  1GUA B;  4DHZ B;  1SIJ A;  4HDQ A;  2W3R A;  5HHD G;  1E8Z A;  4A6Q A;  2WWZ A;  3A9K A;  4GU2 A;  4FBJ B;  4US9 A;  2B3A A;  3T9L A;  3APF A;  1V86 A;  3OWE B;  3DPD A;  2V4I B;  4EZL A;  2BKF A;  3L13 A;  5HI1 A;  1UD7 A;  2LUE A;  3AE9 B;  3L0W B;  4W9L A;  2LI5 A;  3U2S C;  1PGB A;  3HRD D;  3UI3 A;  3P4Q B;  4MJS B;  1P7E A;  4RGT A;  2MH7 A;  2Y5B B;  1P7F A;  1XCQ L;  3PO0 A;  4G0N B;  1N5W A;  1YX6 B;  1SE4 A;  3R7Q A;  2XBB C;  3OJ3 A;  3ZNZ B;  4IWQ A;  3NZU A;  1WRI A;  2JUO A;  2L1A A;  4RFB A;  4LJO B;  3Q8F A;  3L10 B;  2ACZ B;  3HUI A;  2FUG 1;  2KDB A;  2KX3 A;  4E3C A;  4ZRP A;  2OHF A;  2JXX A;  3PRP B;  1WGK A;  3DBH I;  1V5O A;  2IND C;  1IGD A;  3BY4 B;  3DHG C;  3S2A A;  1A5R A;  2LVP A;  2ZPY A;  3W1S C;  3ZO5 B;  5TR5 A;  1ZDV A;  3EHV A;  3TEX A;  2IY1 B;  4ZHO A;  3BYY B;  3C19 A;  4ANU A;  3A9J A;  4HRO A;  1YX5 B;  4BBN F;  1IUE A;  4LLG M;  3SDL C;  4XYC A;  4MEL A;  1UBI A;  1V6E A;  1STE A;  5JZE B;  3W5V B;  3RI7 C;  1D5M C;  2JF5 A;  1L2N A;  4JQW C;  2LHE A;  1OEY A;  1SIF A;  2KMM A;  3KYC D;  1TY2 A;  4YXD B;  3VR9 B;  2Z0E B;  2UYZ B;  3H1U A;  4LDT B;  2BYE A;  2M17 A;  3AEE B;  1EU3 A;  1CQV A;  4HPM B;  1H8C A;  4TQ0 A;  1MFW A;  2AQ3 B;  2ON8 A;  3BK1 A;  2MW5 A;  3RZF A;  1E7V A;  2BBC A;  5G2N A;  4D2K A;  3Q6B A;  4HKZ E;  2LFI A;  4KGT A;  1EF1 A;  3QCA A;  4BVU C;  2KQS A;  3UGB B;  2MBH A;  5J17 A;  2YVC A;  3PRZ A;  4FA6 A;  4LNO A;  4JWU C;  1E7P B;  1XLO A;  2PLP A;  1G6J A;  2V9H A;  1KFY B;  4P16 A;  1J7B A;  4KIK A;  4MM3 B;  1WMH A;  2N1V A;  3KVF B;  2QIL A;  4I6N B;  1U4A A;  4IDI A;  1TIF A;  5L83 A;  2IO2 B;  3AE5 B;  2WXF A;  3KQ4 A;  3QHT A;  4BFR A;  4PYU A;  3HVZ A;  3DQV A;  3NVW A;  4L23 A;  1ZP0 B;  2VZK D;  2AL6 A;  1ZE3 D;  4AOF A;  3A1Q B;  1N5X A;  4XDD A;  1I4H A;  4IM3 A;  2RPQ A;  3MJW A;  4ZDV A;  1NVI D;  2WDR B;  1FO4 A;  2PJH A;  1R4M I;  2KWU B;  4ZOH C;  2LGY A;  2CHZ A;  4H2A A;  4W9J A;  5DPS A;  2YLM A;  4PS8 A;  2D10 A;  1YJ1 A;  3DBH B;  3AE6 B;  2MBE A;  1N6Z A;  4LNF A;  4ARI A;  1BML C;  2DX5 B;  2WU2 B;  2FCS A;  3DHI C;  4MGY E;  4WJO A;  4GOC A;  1MI0 A;  3V3X A;  2JRI B;  3Q3M C;  3LJ3 A;  4RF0 A;  3B2F A;  2GBJ A;  4OVU A;  4TQ1 A;  3V62 A;  1FCC C;  2E6X A;  5JH5 C;  1K8R B;  4DK5 A;  1F1H A;  3AE2 B;  1C4C A;  1HTO A;  2KN5 A;  1RWS A;  4TV3 A;  4NY0 A;  1FXA A;  4AP4 C;  2AQ1 B;  3AE8 B;  1FRD A;  1WZ0 A;  4OZB A;  2HTH A;  1QOA A;  5J2R A;  3VTV A;  4LCD E;  2J0J A;  4REZ A;  2JYT A;  1WGD A;  1T0Y A;  2O6V B;  4DBG A;  2LGD A;  4J6I A;  5E6J A;  3IHP C;  3AE7 B;  4PS3 A;  4ANW A;  2FID A;  2ASQ A;  1IBX B;  3CIR B;  4NPN A;  4LJP B;  3ML8 A;  3Q69 A;  3QAR A;  3AE4 B;  4W9F A;  1V1O A;  1RFK A;  2M4N A;  1BUI C;  2W82 A;  1UGJ A;  1WX9 A;  1GPX A;  2LRU A;  4RGO S;  3NS1 A;  1MJD A;  3QA8 A;  1MHX A;  4OZA A;  1ZXI A;  1AWD A;  1XD3 B;  2MP2 B;  1PFD A;  4MT5 A;  2X38 A;  3N30 A;  1WXQ A;  4WJQ A;  1VD2 A;  1YQB A;  4YTN B;  4S17 A;  1WYG A;  2C9W B;  3A1Q A;  2RDH A;  2D3A A;  2JYE A;  2QSD A;  4DXF A;  1NYQ A;  1JRO A;  2KWV B;  2MBO A;  2B76 B;  2V3S A;  1GB4 A;  2FCQ A;  2LRW A;  1YN4 A;  2JXT A;  2QIE B;  4P7I A;  1GJZ A;  2NBU A;  3AU4 A;  4C56 C;  1UH6 A;  2HJ8 A;  1F9J A;  1WMH B;  2N7D A;  3N1X C;  5D2M B;  1V97 A;  3J9C A;  4A3P A;  3QIJ A;  4NNJ B;  3PLU A;  2KVZ A;  2PW9 A;  1NBF C;  1JCK B;  1IBX A;  4HCP B;  3ZDT A;  3N1Y C;  2WS3 B;  2NTT A;  3O13 A;  1IYF A;  2BYV E;  4JPS A;  1DOX A;  1JWU D;  1B9R A;  1AW7 A;  1M94 A;  3TEW A;  4ACF A;  3DVN V;  2KQ4 X;  2INC C;  4N58 A;  4XX5 A;  4C4V B;  1C9F A;  2M1M A;  1D5Z C;  2K22 A;  1DGJ A;  4BKS D;  4MGK E;  1XEE A;  2KFJ A;  2IO3 B;  2LAS A;  3N32 A;  3VRB B;  2WYQ A;  4GLS C;  5BYR A;  1XF5 L;  2EKI A;  4P1C C;  1HE8 A;  1IGC A;  2FAZ A; 
#chains in the Genus database with same CATH homology
 1KOT A;  2BWF A;  3Q3F A;  4KZ0 A;  3ALB A;  4I6P A;  2FCN A;  3VH3 B;  1J19 A;  4BOZ B;  2I1J A;  3PVL A;  3KW5 B;  3MTN B;  3SU8 X;  4GXB A;  5J18 A;  3VAW A;  1WJU A;  2AEH A;  2KJR A;  3EFU A;  5BO4 B;  4B9K A;  3M62 B;  1I42 A;  1KLV A;  4M8M A;  1S1Q B;  4F8C B;  2C5L C;  2D07 B;  3IFW B;  3DVG Y;  2RD0 A;  1SGH A;  4GDL B;  2N9P C;  3ECI A;  3BIN A;  3RUI B;  4BBN C;  4FJV B;  4EUT A;  1WE6 A;  4MGZ E;  4ZYN A;  2MRP A;  5CX3 A;  5AZF A;  5EDS A;  3H7P B;  2N4F A;  3OJ4 B;  2DYM A;  1GUA B;  4W9C A;  2BYF A;  1WM3 A;  2N1W A;  4HPL B;  4DHZ B;  3U8Z A;  1E8W A;  4HDQ A;  4OVV A;  2KJ6 A;  2ZPN A;  1SE9 A;  2IO0 B;  1E8Z A;  3ZLZ A;  2C7M B;  3PHW B;  1H4R A;  2AYO B;  2WWZ A;  4IM2 A;  2C7H A;  3A9K A;  4GU2 A;  3DBL I;  4GB9 A;  4FBJ B;  2B3A A;  1TBE A;  2K25 A;  4EOY A;  3T9L A;  3APF A;  4KZC A;  1V86 A;  1WJN A;  3DPD A;  3DCG A;  1V2Y A;  4EZL A;  2BKF A;  2LGX A;  2V1Y A;  2KTR A;  1J8C A;  3T8M A;  3DVG X;  3L13 A;  3KYD D;  1RRB A;  2V4L A;  3H6N A;  4LDT D;  2GBM A;  2K6D B;  4W9E A;  2JVC A;  5G55 A;  3VH4 B;  3C0R B;  1UD7 A;  2LUE A;  3L0W B;  2KNB A;  3NOB A;  2KD0 A;  3QWZ B;  4W9L A;  4KSK C;  2LI5 A;  4GGQ A;  3U30 A;  3RZW C;  5FR6 A;  4NAW B;  2KVR A;  2ZEQ A;  4K1R B;  4ZRJ A;  2KDI A;  3P2B A;  5DCN A;  1Q1O A;  1WI0 A;  4W9I A;  4MJS B;  1IP9 A;  2GOW A;  4FJY A;  3JSV A;  3UIP B;  2K8H A;  1ISN A;  3X23 A;  3O65 B;  2Y5B B;  3PS6 A;  4G0N B;  4HCN B;  4FJZ A;  4JGH B;  1YX6 B;  3A33 B;  3W1S A;  1Q5W B;  2FUH B;  4DDI D;  2D2Q A;  2XBB C;  3OJ3 A;  3R7Q A;  3VTW A;  3ZNZ B;  3UQA A;  4FHJ A;  2JPH A;  4IWQ A;  4MEM A;  3NZU A;  1WRD B;  2KWC A;  5AZH A;  2NS5 A;  2C60 A;  5KHO A;  2JUO A;  1WH3 A;  2HE7 A;  2JZ3 B;  4W9K A;  4LJO B;  3V6C B;  1WFY A;  3A9K B;  1XQQ A;  1EO6 A;  2K39 A;  1C1Y B;  3L10 B;  1WXV A;  1P3Q U;  2ZZP B;  3APC A;  4RM9 A;  2DZJ A;  5JHA A;  3APD A;  2LVQ A;  2KDB A;  2KX3 A;  1NI2 A;  3K9O B;  1UGM A;  4E3C A;  2K8B A;  2UWQ A;  3PGE A;  2AWT A;  2JZZ A;  2W9N A;  4MM3 A;  2JXX A;  3PRP B;  4KIK B;  4RMA A;  2G4D B;  3DBH I;  1OTR B;  1V5O A;  3WAP A;  2MCN B;  3D32 A;  2L0F A;  3BY4 B;  1A5R A;  3S2A A;  1R4N I;  3X0W A;  4DDG D;  2LVP A;  3DBS A;  3NZS A;  2ZPY A;  3B1L X;  5CHW A;  3W1S C;  3ZO5 B;  3ZIM A;  5TR5 A;  3EHV A;  4NJ6 A;  2IY1 B;  2BGF A;  1OQY A;  2GBN A;  3PRM B;  2M0X A;  4ANU A;  3A9J A;  1UBQ A;  4TKN A;  4WQO B;  1WR6 E;  2MBB B;  1YX5 B;  2NPT B;  3A9J B;  4ANV A;  4FLH A;  4WJN A;  4BBN F;  4F7Z A;  3SDL C;  2ZNV B;  3AI5 A;  3UF8 A;  1GNU A;  2EKE C;  1UBI A;  1V6E A;  4KV2 A;  4FHK A;  4MEL A;  4HWI B;  2EMT A;  1WY8 A;  4B6W A;  5JZE B;  1WGY A;  2NR2 A;  3ZTD A;  2JF5 A;  2DYB A;  3CST A;  2DYO A;  1TGZ B;  4WWO A;  3VUW A;  2ZCC A;  1L2N A;  4JQW C;  1ZGU B;  4IUM B;  3NY5 A;  3V61 A;  1WX8 A;  4EZK A;  2KK8 A;  1OEY A;  2Z59 B;  2WDT B;  1SIF A;  2LXC A;  2R2Q A;  3KYC D;  2LD9 A;  2CKH B;  2Z0E B;  2UYZ B;  4G50 A;  1TTN A;  1X1M A;  3H1U A;  4LDT B;  2BYE A;  4MSM B;  2M17 A;  4ASW C;  2RSU A;  2WX0 A;  5AZG A;  1WF9 A;  3WAL A;  4A3O A;  3ML9 A;  4HPM B;  3L17 A;  1CMX B;  4GDK B;  4EZJ A;  1H8C A;  1WXS A;  4TQ0 A;  2FCM A;  3PTF C;  1EUV B;  1FXT B;  2KKC A;  2FIF A;  2L0T A;  4W9H A;  5DPT A;  4GIV A;  4CYE A;  2MW5 A;  3RZF A;  1E7V A;  2XK5 A;  5G2N A;  3VVW B;  5DPW A;  2IBI B;  1WIA A;  2RR9 A;  3DDC B;  3TBL D;  1EF1 A;  1E5W A;  1J0G A;  3QCA A;  3TIX A;  1C3T A;  4K7W A;  2ZJD A;  4BVU C;  2KQS A;  5CHF A;  3UGB B;  1AAR A;  2MBH A;  1L7Y A;  1P9D U;  5J17 A;  3ZDM C;  2K8C A;  2YVC A;  3PRZ A;  4FA6 A;  5D6J B;  1Q0W B;  5C1Z A;  3SD5 A;  2KXJ A;  1YIW A;  3ONS A;  4GN1 A;  3ZNH B;  1G6J A;  2QHO A;  3RCZ A;  1BT0 A;  1ZKH A;  3QK0 A;  4KVG B;  1UZX B;  2KLC A;  4AWJ A;  1KJT A;  2KTF A;  4K7S A;  2N9E B;  3LDZ E;  4KIK A;  1MG8 A;  2DZI A;  2KTR B;  4II2 B;  4HJK A;  1WMH A;  4K7U A;  3UIN B;  4KSL C;  2N1V A;  3KVF B;  4JL9 A;  2KQ7 A;  4I6N B;  1E8Y A;  2NVU I;  3ENE A;  1U4A A;  3TCA A;  5AEK B;  2CHW A;  2LWP A;  4ZRK A;  5L83 A;  2IO2 B;  2CU1 A;  5IAA C;  3M95 A;  3V60 A;  4WAA A;  4NAW A;  4TUU A;  3ZKJ C;  3CSF A;  3IBE A;  3H9D A;  4IW0 A;  3WIM A;  3ZRF A;  2L76 A;  4EEW A;  2MLB A;  4FAD A;  2DAJ A;  4XC2 A;  3QHT A;  4BFR A;  2PPH A;  2G45 B;  3ZTC A;  1WR1 A;  2O2V B;  4PYU A;  2CS4 A;  1YD8 U;  2C7N B;  3DQV A;  4IWP A;  3H7P A;  3OLM D;  2AL6 A;  3TJP A;  4AOF A;  1WYW B;  2KFK B;  2LVO A;  3A1Q B;  3QQ8 B;  4BOS C;  3L54 A;  4GSW A;  4GDL A;  4IM3 A;  1OGW A;  3GOE A;  2RPQ A;  3MJW A;  3CMM B;  3QAQ A;  4MSQ B;  4ZDV A;  1WGR A;  3TMP B;  3HHM A;  4HLE A;  2PJH A;  4FN2 A;  4K81 A;  2LXA A;  4CO7 A;  1R4M I;  2DAF A;  2KWU B;  3DBR I;  2KMA A;  2LGY A;  2CHZ A;  2MA9 B;  4W9J A;  2IO1 B;  1NDD A;  4A20 A;  3ZRC A;  3PV1 A;  5DPS A;  3QJZ A;  3RT3 B;  2YLM A;  4PS8 A;  1V5T A;  3NS8 A;  2D10 A;  3H7S A;  1YJ1 A;  2MBE A;  4II3 B;  4IM0 A;  5L95 C;  3VTU A;  2DX5 B;  4KDL B;  4CHK A;  2FCS A;  3CF6 E;  5CTR C;  4MGY E;  3L16 A;  2ZVN A;  2KFK A;  3KH0 A;  4WJO A;  5IA7 A;  1V49 A;  4GOC A;  1WJ4 A;  3AU5 A;  5GMV A;  2GMI C;  2JRI B;  4MDK E;  3LJ3 A;  4M8N A;  1E8X A;  1GC6 A;  2GBJ A;  3KUZ A;  5LXH A;  4OVU A;  4TQ1 A;  4HXD A;  2KX0 A;  2BWE S;  4BKG A;  3IVF A;  3PLV A;  3V62 A;  3AXC A;  3PPA A;  5JH5 C;  4KDI C;  4F1S A;  1K8R B;  3RD2 A;  3DOW A;  4DK5 A;  5LLI A;  2KC1 A;  1Z2M A;  2KDF B;  2KN5 A;  4WJP A;  2GBR A;  2KJH B;  4FUL A;  4TV3 A;  2KC2 A;  1RLF A;  2DZK A;  2HD5 B;  4NQL B;  4NQK E;  4NY0 A;  3PT2 B;  3VDZ A;  2O6V A;  1KM7 A;  2L8J A;  4AP4 C;  1PQS A;  2BKR B;  1WXM A;  4MH0 E;  2MSE D;  3RYT A;  1WZ0 A;  2HTH A;  1LQB A;  2CHX A;  2KLG A;  3PHX B;  3PZD A;  2D3G A;  3KUD B;  3L08 A;  5J2R A;  3VTV A;  3QX1 A;  2J0J A;  4LCD E;  2GBK A;  1WGD A;  5C23 A;  3ZVV A;  4IG7 B;  1T0Y A;  2O6V B;  3QC8 B;  2LGD A;  2DEN B;  3KUC B;  3VUX A;  4DBG A;  4G3X B;  4J6I A;  2KMC A;  1ZW7 A;  3M3J A;  2R2O A;  2MWS B;  3IHP C;  4HDO A;  3R3M A;  2NBV B;  3UQB A;  3OAW A;  4PS3 A;  4DHJ D;  1S3S G;  3B08 A;  4ANW A;  1TZ1 A;  2FID A;  2NBW B;  3GZN I;  4GMV A;  1LM8 B;  1P1A A;  2ASQ A;  2RGF A;  4EFO A;  2JRH A;  3HM6 X;  4M0W B;  3RUL A;  3A4S C;  2IZV B;  3HIZ A;  3K9P B;  4NPN A;  2KDE B;  4LJP B;  4BKS A;  3ML8 A;  4E71 A;  2IY0 B;  5DPR A;  3QAR A;  4URK A;  1UEL A;  4W9F A;  1GG3 A;  1RAX A;  5D94 A;  3WAM A;  3B0A A;  3VXW A;  2M4N A;  3JSV B;  2PEA A;  2G4S A;  2REX A;  3VFK A;  2G3Q B;  3PRE A;  1VCB A;  4DXA B;  2KOX A;  2VRR B;  2EMS A;  1WX9 A;  3U7D A;  2CR5 A;  2LRU A;  2AL3 A;  2BPS A;  3PSE B;  3QA8 A;  4ANX A;  1D3Z A;  4E74 A;  4AUQ C;  2J0M A;  1XD3 B;  2MP2 B;  4W9D A;  3VHT C;  1IPG A;  2NPT A;  3N30 A;  2JT4 B;  2MBQ A;  2K1F A;  4WJQ A;  2XK5 B;  3HM3 A;  1VD2 A;  1YQB A;  2ZNV C;  2KZR A;  3NHE B;  4W9G A;  1JRU A;  4HK2 A;  3ZW3 A;  1Z5S B;  4JLC A;  5LXI B;  3VQI A;  3TL5 A;  2L00 B;  3UIO B;  2C9W B;  3R66 C;  3A1Q A;  3R7R A;  4GDK A;  2J7Q B;  4NJ7 A;  4X57 B;  4IWO A;  3DVN U;  3N3K B;  1V9J A;  4BKT A;  3WA0 A;  5E6P A;  3Q3J A;  4MGI E;  2KWV B;  5CHV C;  5E6O A;  1E7U A;  1WX7 A;  3VUY A;  2MBO A;  2BF8 B;  2K6Q A;  4DHJ B;  2V3S A;  3AUL A;  1LFD A;  2FCQ A;  2LRW A;  2PE6 B;  4P7I A;  5E6N A;  1GJZ A;  4XZ4 A;  3EC8 A;  2ZCB A;  4MJS A;  1XT9 B;  4DHZ E;  3EEC A;  1WZ3 A;  2NBU A;  3AU4 A;  2I1K A;  2J0K A;  2Z0D B;  2ZVO A;  1WM2 A;  4G11 A;  1UH6 A;  2HJ8 A;  4AJY B;  4IC7 B;  2L3Z A;  2N7D A;  1F9J A;  1WMH B;  2N7E A;  5HKH A;  5D2M B;  4RM8 A;  2OOB B;  4N9F 4;  3W1Y A;  2MQJ A;  1RFA A;  1WGH A;  2JY6 A;  3QIJ A;  1V80 A;  4NNJ B;  4A3P A;  4B95 A;  3PLU A;  2O6V D;  3V6E B;  4AJW A;  1WXA A;  1GC7 A;  4PS7 A;  3M63 B;  2A5U A;  2N9X A;  1NBF C;  2JWZ A;  2DZM A;  4HCP B;  3ZDT A;  1V81 A;  4ZRI A;  1IYF A;  2LZ6 A;  2MX2 A;  1WE7 A;  4I6L B;  2BYV E;  4PYZ A;  2A4Z A;  2LJ5 A;  2L7R A;  3JW0 X;  1WGG A;  1OEY J;  1M94 A;  2FNJ B;  1EF5 A;  1QZE A;  2KAN A;  4ICU A;  3IG3 A;  4YL8 A;  2M8S A;  2L05 A;  5JHB A;  3JYU A;  1WJ6 A;  3I3T B;  4WWP A;  3DVN V;  2KHW B;  2OJR A;  2XEW A;  3JVZ X;  4XX5 A;  1P0R A;  1E90 A;  2WX1 A;  3WAO A;  4DWF A;  3ZUN A;  2M1M A;  3WAN A;  1LXD A;  3A4R A;  1P98 A;  3ZNI D;  4BKS D;  2D11 A;  3MHS D;  2KFJ A;  4MGK E;  2MP2 A;  2DHZ A;  2IO3 B;  2IYD B;  1I35 A;  2LAS A;  4HVB A;  2O2V A;  3N32 A;  1Y8R C;  2NCN A;  3SHQ A;  5KHQ A;  2WYQ A;  3ZNG C;  5D7G A;  4ICV A;  1HE8 A;  2PE9 A;  3HK0 A;  2KO3 A;  4WWN A;  4JIO U;  2FAZ A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...