5HKHA

Crystal structure of ufm1 in complex with uba5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GAMESKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ubiquitin-fold modifier 1
publication title Structural and Functional Analysis of a Novel Interaction Motif within UFM1-activating Enzyme 5 (UBA5) Required for Binding to Ubiquitin-like Proteins and Ufmylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5hkhA00
2NBUA 3KW5B 4NNJB 1C1YB 1WE6A 2IY1B 1UBQA 2KC2A 3PVLA 4MEMA 3OJ3A 3H7PB 3TBLD 2IO2B 5JHAA 4KV2A 1LFDA 2N9PC 4ANUA 3KUCB 4MGYE 1XT9B 5TR5A 1E7VA 2XK5A 4MM3A 2WDTB 4W9KA 1V81A 2EMSA 4HVBA 1LM8B 4IM2A 2ZVNA 2K8BA 2BWES 2D2QA 3B08A 3WAPA 3H6NA 2KTFA 2ZCBA 1OEYJ 2AL6A 3DQVA 4BOZB 2O6VB 1OGWA 1R4MI 4GXBA 1WM3A 3QK0A 4AUQC 2KWVB 2DZJA 4IWOA 4B95A 3Q3FA 1R4NI 4RMAA 4HCNB 5AZFA 3R66C 2JZ3B 3PSEB 5IA7A 3ZTDA 2ZNVC 4DHZB 2IO0B 2LXCA 2NR2A 1WXAA 3HM3A 2NBVB 2LGYA 4HXDA 4WAAA 4AJWA 4MJSB 2NS5A 4GB9A 3KVFB 2KJ6A 4IWPA 4G3XB 3R7QA 3RT3B 4ZRKA 4IC7B 3QAQA 2KDIA 4A3OA 3D32A 1WR6E 1E90A 2FIFA 2UYZB 3PLVA 3T9LA 1G6JA 3RULA 4NY0A 3SU8X 2FAZA 2YVCA 4WWOA 4ZRJA 4AP4C 1M94A 1E8ZA 4W9DA 3PZDA 1WH3A 3EECA 2KDFB 2HJ8A 2M8SA 4GGQA 1WGYA 4AJYB 2KO3A 2L00B 5D7GA 3KH0A 3VH3B 4BKSD 4EFOA 4TQ0A 2KFJA 3L17A 2C7MB 1WRDB 2LXAA 4HCPB 4EOYA 4ASWC 1BT0A 1OEYA 3M3JA 2K1FA 4LCDE 1WI0A 1WJ4A 3A9KB 2JWZA 3QJZA 2BF8B 5DPSA 2BGFA 2J7QB 5BO4B 3M63B 3DBLI 2PJHA 1WXVA 2V3SA 2L0TA 5DCNA 1WMHA 2JZZA 2MBQA 1IP9A 3APDA 3DCGA 1K8RB 4GOCA 3WANA 4JGHB 4EZKA 2ZVOA 2ZZPB 3NS8A 3RUIB 3QQ8B 2GBNA 2K39A 3A1QB 2N1VA 1V9JA 1WZ3A 3UIPB 3UINB 2O2VB 3LJ3A 4W9LA 2GOWA 5CHFA 2W9NA 2AL3A 3AI5A 4HDOA 2WX0A 2LRWA 3RYTA 2ASQA 2C9WB 2KTRB 4KZ0A 5E6NA 2K8CA 3VHTC 3ZDMC 2O6VD 2OOBB 2I1KA 3ZW3A 4EKUA 1WIAA 1Q5WB 4FJVB 3VH4B 3N3KB 4TKNA 1GC7A 4MELA 1A5RA 1H4RA 3DVGY 4ICVA 3L08A 2EKEC 2REXA 3UQAA 1GJZA 1P98A 3VDZA 2GBRA 3W1YA 1TTNA 4I6LB 2C7HA 4FLHA 3EC8A 4CHKA 4JL9A 3IBEA 4KVGB 3VFKA 3NZSA 2JF5A 2Z0EB 2LWPA 4W9HA 1GUAB 2FCNA 4GN1A 2KANA 1LQBA 3WIMA 3KUZA 1RRBA 4EUTA 1P0RA 1VD2A 4FULA 3I3TB 4W9FA 3ZNGC 4TQ1A 1GC6A 3DVGX 3W1SC 3Q3JA 2BKRB 3NOBA 2KVRA 3DDCB 5KHQA 4KDIC 3ZNZB 2LI5A 3EFUA 4I6NB 2HD5B 2KLCA 2KC1A 3NHEB 2KHWB 2MLBA 2XK5B 2RSUA 3LDZE 4X57B 4ZRIA 2FIDA 2D11A 4BOSC 1UBIA 3UQBA 5LXIB 2BYVE 1XQQA 1Q1OA 2MP2B 4FADA 2NPTA 3PRMB 1TBEA 2Z59B 4HLEA 1IYFA 2JVCA 1WX7A 2LVQA 2AYOB 3NZUA 2PEAA 1ISNA 2MQJA 3U7DA 5CHVC 5CHWA 4E3CA 5D94A 2MSED 4DDGD 2DYBA 2BPSA 4IWQA 2K25A 2KK8A 5KHOA 4B9KA 1NBFC 2BYEA 1IPGA 1V86A 1V5TA 4LJOB 4BBNC 2KKCA 1S3SG 5G2NA 2IYDB 1WY8A 2DYOA 4DK5A 4TV3A 1V49A 2R2OA 5DPTA 1Y8RC 2OJRA 3RCZA 2CS4A 3DBHI 2DAJA 3M95A 4GMVA 1V80A 1WF9A 2K8HA 3W1SA 2IZVB 5AZGA 2N7EA 1H8CA 2JUOA 2Z0DB 2IO3B 3OJ4B 2M0XA 1WM2A 3IFWB 2LVOA 3JSVB 2KWUB 4IM3A 5CTRC 4FBJB 5LLIA 5JZEB 4OVUA 3VAWA 4K7UA 3PTFC 4B6WA 1YIWA 2IY0B 1ZW7A 2IBIB 4DBGA 3VUXA 4MSMB 2WX1A 1J8CA 3JYUA 3B1LX 2BKFA 2DZIA 4DHJD 3L10B 2CHXA 3ZDTA 2RPQA 2KOXA 2PPHA 5J17A 3RZWC 2R2QA 4ANXA 3V62A 1SIFA 3DOWA 3KUDB 1WGRA 1E5WA 3ML8A 2L7RA 4G50A 4WJOA 3TIXA 4HJKA 3QARA 5DPWA 3V61A 4W9EA 4ANWA 1FXTB 1ZGUB 2AEHA 4A20A 4HK2A 1J19A 2KMCA 2VRRB 3A9JA 2M1MA 3PHXB 2C60A 1LXDA 5D2MB 1V5OA 4BBNF 3K9PB 3U30A 3ZO5B 4GDLA 4CO7A 3M62B 2L8JA 4NAWA 4JLCA 2J0MA 1I35A 4ZYNA 2ZCCA 1P1AA 2KD0A 3VQIA 3QA8A 1D3ZA 2RGFA 3T8MA 2L3ZA 3CSTA 4PS3A 4EEWA 2N7DA 4FJYA 3MTNB 2MW5A 2AWTA 3APCA 1Z5SB 4KSKC 1OQYA 4W9IA 2G45B 3EHVA 4FA6A 5L83A 2HE7A 4DDID 2G4SA 1SGHA 2D3GA 3R7RA 4BVUC 2FCSA 3CF6E 4KDLB 2BWFA 2KFKA 3QIJA 3QX1A 2D10A 2JY6A 3DBSA 1P9DU 3VVWB 1UGMA 3S2AA 3SDLC 4ANVA 4DHZE 3QC8B 4WJNA 3PLUA 3V6CB 4WJPA 3TJPA 2KZRA 1TGZB 5FR6A 2KLGA 4HWIB 4PS7A 4I6PA 3C0RB 2FCMA 3L16A 1YQBA 3ZIMA 2DYMA 2LVPA 2NBWB 4ICUA 1U4AA 2M4NA 2DAFA 1GG3A 2KJHB 4DHJB 4FJZA 1VCBA 1WX8A 2KXJA 1NI2A 1E8XA 1L7YA 4NJ6A 2UWQA 4RM8A 4XZ4A 4DWFA 2KQ7A 5C1ZA 5IAAC 4KZCA 2LZ6A 3H7SA 4LDTD 2KQSA 4K7WA 3WA0A 2CKHB 4M0WB 4AWJA 1F9JA 4LJPB 2KN5A 4NQKE 1YD8U 3PPAA 2Y5BB 3PS6A 4F1SA 1X1MA 3O65B 4II2B 3ZNHB 3ZRFA 3X23A 2MCNB 2NPTB 3KYCD 2KTRA 3ALBA 4M8MA 2IO1B 4N9F4 4K1RB 4NJ7A 5D6JB 2LASA 3KYDD 3APFA 1WE7A 5E6OA 3BINA 3HIZA 2FCQA 1EO6A 2NVUI 1V6EA 2M17A 3TMPB 4BKGA 3AU4A 1TZ1A 1WYWB 2XEWA 2WWZA 2A5UA 4GU2A 2CHWA 2LGXA 4GDKA 4IM0A 1WGGA 4KIKA 4YL8A 4BKSA 3U8ZA 2ZEQA 2KNBA 2L0FA 2LUEA 2MRPA 4G11A 4MGZE 4E74A 3CMMB 2J0KA 2MWSB 4K7SA 4PS8A 2LJ5A 4FHJA 3A4RA 5AZHA 2QHOA 4ZDVA 1GNUA 2DX5B 2ZJDA 2XBBC 4IG7B 1UELA 3AU5A 4DXAB 3VTVA 4WQOB 3ZLZA 1RLFA 2GBJA 4IUMB 3L13A 3IVFA 1UH6A 4MGIE 2L76A 4KSLC 3ZVVA 4J6IA 4II3B 4W9JA 4WJQA 5EDSA 2RD0A 4EZLA 2KX3A 3WAMA 3ZTCA 2N4FA 2MP2A 3H7PA 4PYZA 1KLVA 4CYEA 5GMVA 3AXCA 3HM6X 3TCAA 4LDTB 4HDQA 4XX5A 4NQLB 1KOTA 5L95C 5E6PA 3JW0X 3OAWA 1RAXA 3VXWA 2J0JA 3DVNV 2I1JA 3MJWA 2EMTA 3ML9A 5DPRA 3P2BA 3NY5A 2YLMA 5C23A 2DHZA 4E71A 3AULA 2N9XA 3A9JB 1QZEA 2O6VA 3HK0A 4F7ZA 2DZMA 2GMIC 4GDLB 4MDKE 4NAWB 1Q0WB 1JRUA 3DBRI 2ZNVB 2V1YA 3PRZA 1WR1A 5HKHA 4W9CA 1ZKHA 2WYQA 2K6QA 2PE9A 2LRUA 3HHMA 4AOFA 5CX3A 2C5LC 1WMHB 3DPDA 2FUHB 3N32A 3N30A 4FHKA 4PYUA 2CU1A 3JSVA 3A33B 2V4LA 4HPMB 3ENEA 2CHZA 4MJSA 3IHPC 2KDEB 2KFKB 4OVVA 1WXMA 1Z2MA 3A4SC 5G55A 3V6EB 1NDDA 2FNJB 3WAOA 1SE9A 1EUVB 2KMAA 3PHWB 3VUYA 2MBBB 2DZKA 4BKTA 4GIVA 2D07B 1PQSA 2JPHA 1C3TA 3UGBB 3L54A 4M8NA 1I42A 3ZNID 3RD2A 1RFAA 3QWZB 1WJNA 5JH5C 3QHTA 4BFRA 1EF5A 3QCAA 1UD7A 2KJRA 1XD3B 1E7UA 2PE6B 2LD9A 3H1UA 4P7IA 4EZJA 5J18A 3UF8A 4F8CB 1WZ0A 1WJUA 2N1WA 4JIOU 2MBOA 3IG3A 1HE8A 3BY4B 4IW0A 2MA9B 3ECIA 2LGDA 3A9KA 2RR9A 4WWPA 1EF1A 1KJTA 5JHBA 2DENB 4GSWA 4HPLB 4JQWC 4G0NB 4NPNA 1YX5B 1V2YA 3R3MA 3PV1A 3PT2B 2MX2A 4URKA 2HTHA 1P3QU 1WJ6A 4K81A 2N9EB 3CSFA 2K6DB 1YJ1A 2JT4B 4FN2A 3A1QA 1WGHA 2KX0A 4RM9A 5LXHA 1L2NA 3PREA 3VTUA 2KDBA 4TUUA 1WX9A 2G3QB 2O2VA 3UIOB 3ZKJC 1KM7A 3B0AA 3K9OB 3PGEA 3DVNU 1WFYA 1J0GA 3SD5A 1S1QB 1YX6B 2BYFA 4XC2A 3PRPB 2KWCA 1UZXB 2MBEA 5J2RA 1T0YA 1AARA 4GDKB 4MGKE 3SHQA 4KIKB 4W9GA 3MHSD 3ZRCA 3X0WA 3GZNI 3OLMD 3RZFA 3ONSA 3VUWA 2JXXA 1WGDA 2GBMA 3GOEA 2NCNA 4A3PA 2G4DB 1OTRB 3WALA 3H9DA 2GBKA 2ZPNA 3L0WB 5AEKB 1CMXB 2JRHA 3TL5A 2L05A 2MBHA 1E8WA 3ZUNA 4MSQB 2C7NB 2CR5A 3V60A 3VTWA 2JRIB 2A4ZA 1E8YA 4WWNA 2B3AA 2ZPYA 4MH0E 1MG8A 3JVZX 1WXSA
chains in the Genus database with same CATH superfamily
4NNJB 1C1YB 1WE6A 3MC8A 2IO2B 2D3BA 5TR5A 1HQRD 5MPOA 1C9FA 3HRDD 2EMSA 1LM8B 4N6EB 2ZVNA 3DWGC 4DXFA 2KTFA 2ZCBA 4GXBA 3MHZA 4AUQC 4IWOA 2RDHA 2ON8A 4RMAA 4HCNB 5AZFA 3R66C 1STEA 2M19A 5IA7A 3HM3A 1JQ4A 4HXDA 1LO5D 2QDFA 1AW7A 3KVFB 3D32A 1WR6E 4RGMA 4J3OD 1E90A 1VLBA 1UWMA 2UYZB 4A55A 4NJCA 4AP4C 4W9DA 4RGTA 2KDFB 2L00B 1XO3A 2L1AA 4TQ0A 2KFJA 1NYQA 1OFFA 4ARIA 4LTUA 1XLQA 2N0SB 4HCPB 4L23A 3DHIC 3M3JA 4LCDE 3AB5A 1KLGD 1CJEA 5DPSA 3RNBC 4MACA 2KAJA 1WMHA 4US8A 3WANA 4JGHB 4EZKA 2KMMA 2W54A 3RUIB 3QQ8B 2GBNA 4ZRPA 1WZ3A 3NVWA 1LGRA 4W9LA 4OW0A 2C9WB 4KZ0A 1N6ZA 1WIAA 1PGBA 4OZBA 1H4RA 5G5GA 4ICVA 2QSDA 2D3AA 3KQ4A 3IT4B 3T3NA 2WDVB 2SEBD 2LFIA 1N60A 1LQBA 2QIEB 2H88B 2Y3AA 1MI0A 1VD2A 4FULA 3I3TB 4KGTA 1HA5A 3ZNGC 4TQ1A 1GC6A 3DVGX 3Q3JA 2WXGA 2Y5CA 1RM6C 2SAKA 3EUB2 2KVRA 3DDCB 1PFDA 4HJGE 3EFUA 3NHEB 3LDZE 2D11A 3UQBA 5LXIB 2I38A 2MP2B 2JZPA 3AEDB 2JVCA 1EU3A 2LVQA 2OJWA 2PEAA 2MQJA 5CHWA 1C4AA 2DYBA 1DYQA 2BS4B 3BVGA 1IPGA 4LJOB 2KKCA 1SB3C 3AM9A 1MG4A 2DYOA 4A8XC 4TV3A 1V49A 1J7BA 4IOIE 1Y8RC 2CS4A 4GMVA 4L1BA 2IZVB 5AZGA 5CTRC 3WCQA 1WM2A 2WLBA 5LLIA 3VAWA 3VR9B 1YIWA 2IY0B 1ZW7A 1FEHA 2IBIB 3VUXA 2WX1A 4XYCA 3B1LX 2PMVA 4LNFA 3L10B 4DHJD 2PPHA 2IPKD 1T0SC 1WGRA 1E5WA 3I63C 4WJOA 3QARA 4W9EA 2AQ1B 1FXTB 2N9KA 4HK2A 2VRRB 3SFEB 1C4CA 2HDEA 4DQOC 2J0MA 1P1AA 4PS3A 2N7DA 2OHFA 4FJYA 3MTNB 3N9YC 2MW5A 3APCA 4KSKC 3H8HA 1OQYA 2BW2A 2G45B 2FBWB 4W9IA 1FO4A 2MH7A 3QIJA 2D10A 3CWIA 3V6CB 4WH4A 1ZPSA 1MHHE 2J4XA 5FR6A 4PS7A 4I6PA 3BVZA 3HVDA 3ZXVA 1WGKA 1FD6A 3NVZA 2NBWB 4ICUA 2M4NA 1TY2A 2KJHB 2BT6A 1VCBA 2MHJA 1XCQL 1E8XA 4JX1C 1QILA 3H7SA 2KYWA 3O13A 3WA0A 2CKHB 4M0WB 3O65B 3OWEB 2IO1B 2LASA 3KYDD 4WIPA 3RNFC 2KACA 2FE8A 1V6EA 2M17A 2BTEA 5IN7A 1HZ5A 3AU4A 1QOFA 2XEWA 2WWZA 4GU2A 3CIRB 1SIJA 1UGJA 4G11A 1K50A 1SEBD 4HKQA 4K7SA 3AE2B 5AZHA 4IG7B 1UELA 3AECB 2ACZB 2GBJA 1FCLA 4IUMB 1UH6A 4XWTA 4J6IA 2X38A 2N4FA 4KX6B 4PYZA 1KLVA 2K22A 4XX5A 1KOTA 5E6PA 3JW0X 1RYJA 3AEGB 4XWWA 1PGAA 3P2BA 5HG2A 2N9XA 2O6VA 1UF0A 4F7ZA 3E56A 1BUIC 1WR1A 2K6QA 4M01A 2LRUA 1GB4A 5CX3A 2C5LC 1QQRA 3A33B 4WAFA 4HPMB 2KDEB 3V6EB 3AMZA 1NDDA 2QCZA 3PHWB 4REZA 1SXTA 4YWGG 1E10A 2B76B 2CU3A 2M56B 5BMGA 1TY0A 3RI7C 1RFAA 3QCAA 5AUIA 1FFVA 4ARCA 3LB8C 3IT6B 2BB5A 2N1WA 2MA9B 3ECIA 2LGDA 3A9KA 2RR9A 5JHBA 1RWSA 3MC9A 4HPLB 4JQWC 1I4QA 4G0NB 4NPNA 3R3MA 1VZ7A 3PT2B 1L6UA 2WDQB 3CSFA 4FN2A 1JROA 3PREA 1WX9A 1KM7A 2GI9A 4L2YA 1BXTA 3RFZB 3N20C 1YX6B 3AEAB 1ROEA 4MGKE 2ICIA 3Q3NC 2MEKA 2BBCA 3Q3MC 2GLSA 2JXXA 1N63A 3GOEA 2Z8LA 2KVZA 4A3PA 1OTRB 1CK1A 3H9DA 2QEJC 1E8WA 3ZUNA 2C7NB 2CR5A 5EE0A 2A4ZA 2ZPYA 4MH0E 2KC2A 3PVLA 4EE2A 5FR3A 4ANUA 1Y56A 3KUCB 4MGYE 1E7VA 2D3CA 4MM3A 2JYTA 2WDTB 4W9KA 1V81A 4CQNA 4HVBA 4IM2A 2K8BA 2BWES 3WAPA 3H6NA 4HROA 2O6VB 2WP9B 1FXIA 2KWVB 2DZJA 2QILA 3Q3FA 3Q69A 3Q8FA 2JZ3B 2KN4A 4DHZB 3DHHC 2LGYA 2G1EA 1JCKB 2NS5A 2IGHA 1YOVB 1P7FA 4A3OA 3EGRA 3RULA 3NJTA 2YEPF 4WWOA 1M94A 4KGSA 1L0XB 3PZDA 3EECA 2M8SA 4BZAA 4EFOA 1YN5A 3RPFC 2LXAA 2QJLA 1BT0A 1OEYA 2K1FA 2LGIA 1YJIA 5G5HA 3A9KB 2WDRB 2BGFA 1ZP0B 1WXVA 2ZW1A 4ZHPA 2JZZA 2MBQA 1IP9A 1YN3A 1V1PA 1K8RB 2PVGC 3NS8A 2K39A 2N1VA 4OZAA 4QAYA 3LJ3A 3ZXRA 2INCC 2W9NA 2R61A 2WX0A 1ZXIA 4LLGM 2LRWA 4LNIA 5E6NA 2K8CA 4EOYA 4EKUA 4FBJB 5IOIA 1OQRA 4FJVB 4OVZA 3N3KB 4TKNA 3DVGY 1C4PA 2EKEC 2REXA 2RDBC 1GJZA 2WXIA 2GBRA 1WYGA 1C76A 3W1YA 4CHKA 5IP4D 2JF5A 3KUZA 2DWQA 2W82A 1RRBA 1P0RA 4W9FA 1QLBB 2JX5A 1TKEA 2DNFA 1SE3A 4GLSC 3BZDB 4AQ7A 4IDIA 3ZNZB 1JW9D 3P1MA 2LI5A 3SR6A 4I6NB 2PTLA 2MLBA 4MM3B 2H89B 1XQQA 1Q1OA 4FADA 1HXYD 1TBEA 1YN4A 2Z59B 3TUOA 2AYOB 3NZUA 4Q2JA 1TKGA 3U7DA 5CHVC 4E3CA 1MHXA 2K25A 4B9KA 1V5TA 1S3SG 2IYDB 4US9A 4KKIA 1E9MA 5DPTA 3RN9C 2JUOA 2IO3B 3JSVB 2LVOA 4OVUA 3PTFC 3ABVB 5E6JA 2G9HD 2BB6A 4DBGA 1SJED 1YNTE 3J9CA 1F0ZA 2DZIA 3N1YC 4ANXA 1HTQA 3KUDB 4C80A 2L7RA 3P4SB 3V61A 2AX5A 3Q14C 4ANWA 1ZGUB 3MFGA 1HEZE 3P42A 1J19A 2WU5B 3PHXB 2NTSA 4BBNF 2KT7A 3K9PB 3ZO5B 4CO7A 1V1PB 1KF6B 2N9LA 2LGSA 4H2AA 2L3ZA 3CSTA 3NRZA 3T3OA 2AWTA 1Z5SB 3EHVA 4DDID 2G4SA 2D3GA 2JY6A 3P4PB 4YXDB 1KH0A 1UGMA 3SDLC 3VVWB 4DHZE 3PLUA 3TJPA 4LNNA 1TGZB 1XXGA 1N5WA 5H8YE 3BVMA 1YQBA 3FILA 5C3JB 2CJNA 1U4AA 2NMQA 1GG3A 4HRSA 1AN8A 2UWQA 3P63A 2KQ7A 2LZ6A 1KTKA 3P4RB 4AWJA 1YD8U 1V97A 3PS6A 1OQQA 2E3TA 2MCNB 2KTRA 4IKGA 2BYTA 1MVKA 3BINA 5BMIA 2FCQA 3UI3A 1SE2A 2NVUI 1NEKB 4DXGA 1EU4A 1TZ1A 2MJEA 2A5UA 2CHWA 2LGXA 1WGGA 1YQ3B 3GE3C 2OEDA 2KNBA 4MGZE 1QKZA 3CMMB 2MWSB 3U7ZA 4PS8A 1I7HA 2JXTA 3A4RA 1FCCC 2DX5B 1WRIA 3AU5A 2V3PA 1RLFA 5T8IA 3AE8B 1FRDA 4MGIE 4WJQA 5EDSA 2RD0A 1FNUA 3WAMA 1ET9A 3PZ7A 3VRBB 4CYEA 3AXCA 4LDTB 4HDQA 3SEBA 5L95C 2NTTA 4YTPB 3VXWA 2J0JA 3DVNV 2DLBA 5HI1A 2DHZA 3NS1A 3AULA 1PGXA 2DZMA 1YJJA 4C7ZA 2V1YA 3RMKC 1V8CA 1D5XC 4XDDA 4AOFA 1WMHB 3AE1B 1XEEA 4FHKA 1TYGB 2IDYA 3ENEA 3IHPC 3BYYB 3KLSX 1WXMA 2WXJA 3A4SC 1L4ZB 2KMAA 2MBBB 2DZKA 2D07B 2JPHA 3I9V1 4JPSA 1J7AA 3RD2A 5BYRA 3QWZB 1WJNA 3QHTA 3TEZA 1NI3A 3FILB 4RCOA 1UD7A 3AEEB 1E7UA 2LD9A 3H1UA 1WZ0A 1WJUA 4ZHOA 1HE8A 1XF5L 5GXGB 3BY4B 3AE4B 1IGCA 4WWPA 1V1OA 1SF0A 2MX2A 2HTHA 3RNCC 4K81A 2PIAA 1SSNA 2JT4B 3A1QA 1WGHA 4RM9A 5LXHA 2WS3B 3VTUA 2O2VA 2G3QB 1GB1A 3B0AA 3RNEC 3K9OB 4NZLB 2CJOA 3PGEA 1ZOYB 3DVNU 1WFYA 1R7SA 4XGAB 4YT0B 2LEKA 3PRPB 1IBXA 1UZXB 3V05A 3X0WA 1TS5A 3OLMD 1D5ZC 4ITKA 1TZOA 1I4GA 2G4DB 3Q6BA 2BQQA 4XE0A 2ZPNA 3L0WB 1CMXB 1J7CA 2L05A 3TL5A 1FNWA 3V60A 3VTWA 3I57A 1CQVA 2B3AA 1WXSA 3KW5B 1UBQA 4MEMA 3OJ3A 1T6BX 3AE3B 5C2TB 3TBLD 4KV2A 1LFDA 2N9PC 3AN1A 2L52A 3TEXA 3B2GA 4UDUC 1R4MB 1TKYA 3B08A 2D2QA 4PK1A 1ZDXA 2AL6A 4BOZB 1OGWA 1R4MI 1F77A 1FIQA 3QK0A 3N1XC 3BK2A 2ZNVC 4P6VF 2IO0B 2NR2A 4OHJA 2GB1A 2NBVB 1ZDVA 5IO9A 3FKYA 1IGDA 1XLOA 2KJ6A 3U52E 4G3XB 3R7QA 3RT3B 4ZRKA 4IC7B 3QAQA 4WQMA 3T9LA 3HUIA 2QC8A 4NY0A 3SU8X 1TT5B 4GGQA 1VZ8A 1WH3A 4AJYB 1JWBD 1WGYA 2KO3A 5D7GA 3KH0A 3VH3B 4BKSD 1ENFA 1MFWA 2XNAC 4B0EA 2D5GA 3DBLB 1WJ4A 2JWZA 3C19A 2J7QB 3DBLI 2L0TA 5DCNA 3APDA 4GOCA 3KWLA 4N58A 5AUKA 5TSSA 2ZZPB 3BWUD 1C78A 3A1QB 3R8BA 3UINB 2O2VB 3UIPB 1SE4A 2GOWA 4YTNB 2AL3A 3AI5A 4HDOA 3ZDMC 3ZW3A 1Q5WB 3VH4B 2K0PA 4XDCA 1C77A 3ZJUA 3UQAA 1P98A 1FXAA 4I6LB 4KGRA 4FLHA 3EC8A 1E0ZA 4JL9A 3IBEA 4KVGB 3NZSA 2Z0EB 2KANA 1I4HA 2RPVA 4EUTA 2VH1A 4HKZE 1M4VA 3ZQ4A 3FAHA 3W1SC 1JWSD 3NOBA 2VZKB 5KHQA 1D6EC 2HD5B 2KLCA 2KC1A 4ZRIA 5FK9C 2FIDA 4BOSC 5I4DA 3R2TA 3PRMB 3I5JC 4HLEA 3SFDB 3N1ZC 1WX7A 1YMHE 2RDGA 4M02A 1XCTL 1AYFA 5D94A 2EKIA 4IWQA 1QF6A 2KK8A 5KHOA 1NBFC 2BYEA 1QOGA 2INPE 3DBHB 4DK5A 4RH6A 2OJRA 3RCZA 3DBHI 2DAJA 4JE3B 1V80A 2K8HA 3W1SA 2N7EA 1ZXHA 3AE9B 1H8CA 2Z0DB 2VH2A 3OJ4B 3IFWB 4IM3A 2KWUB 3VR8B 4B6WA 4K7UA 2ONQA 2HJ1A 1HZ6A 2PLPA 4MSMB 4S0RA 1T0QC 3JYUA 1ZUD2 3VRAB 2CHXA 3ZDTA 1FFUA 2KOXA 3RZWC 2R2QA 1SIFA 3ML8A 4G50A 4USAA 4HJKA 2WXPA 3A9JA 5D2MB 1V5OA 3M62B 2L8JA 4JLCA 2WXRA 2WQYB 1VRAB 2WXFA 4RFBA 3QA8A 3VQIA 2RGFA 1MJDA 3T8MA 1PYWD 2MJDA 4EEWA 1YQ4B 2W55A 2HE7A 1N5XA 3R7RA 3U4EG 3BYTB 2BWFA 2PKOA 1MPEA 2TSSA 3DBSA 1P9DU 2WXQA 3QC8B 1GPXA 5EE3A 2KLGA 4HWIB 2W3SA 4FXCA 1C79A 1SBBB 2DYMA 2DAFA 4FJZA 2M0AA 1WX8A 4K3BA 3TEWA 4DWFA 1L7YA 4NJ6A 5C1ZA 1E7PB 5IAAC 4LDTD 2KQSA 2ZW0A 3B9JA 2LHEA 4LJPB 1WSPA 2KN5A 4NQKE 3PPAA 4F1SA 4II2B 3ZRFA 3KYCD 1KLUD 4M8MA 4N9F4 4NJ7A 4OZCA 3APFA 1WE7A 5E6OA 4D2KA 4BKGA 2V9HA 3NVVA 4S17A 4GDKA 4P16A 3U8ZA 2ZEQA 5BYSA 2L0FA 2LUEA 4E74A 2J0KA 4ZRQA 1KRHA 2LJ5A 4ZDVA 1GNUA 2ZJDA 1BMLC 3VTVA 1TS3A 2WXNA 1K51A 1XLNA 3ZVVA 3B2FA 4W9JA 1HTOA 3ZGZA 4A9AA 2KX3A 3ZTCA 1JWUD 2MP2A 2WXLA 3H7PA 5GMVA 4NQLB 1TS4A 3OAWA 3Q8EA 2I1JA 4NAMA 2EMTA 2IGDA 1F52A 3NY5A 2YLMA 5C23A 3A9JB 3GE8C 1N61A 4MDKE 1CZPA 1JRUA 3W5VB 3MC0B 3RNGC 3ZJTA 4W9CA 3HHMA 4A6QA 2V4LA 4MJSA 4OVVA 5G55A 1SE9A 2JQRB 2PVOD 3VUYA 3AE6B 1C3TA 3UGBB 3L54A 2FUG1 4M8NA 1I42A 3ZNID 2QMTA 1GOZA 5D3IB 1T0RC 1XD3B 5J18A 3UF8A 4IW0A 4MT5A 5BMHA 1JWAD 3C8YA 3AEBB 1EF1A 2L83A 1L4DB 1Q10A 1DGJA 2DBYA 1YX5B 1V2YA 3NZ3A 2PW9A 4URKA 1P3QU 1DOIA 1L6VA 2K6DB 2KDMA 1L2NA 1UUPA 2BS2B 2KDBA 4TUUA 1I4XA 4P1BC 4ZOHC 1JMLA 5EE1A 3PO0A 1S1QB 2BYFA 3GZNB 2KWCA 2Q5WD 2JU6X 1T0YA 1AARA 1KFYB 4GDKB 3SHQA 3ZRCA 1JALA 4C7YA 1SJHD 3GZNI 3VUWA 3BK1A 3ONSA 3ETRA 2NCNA 1EWYC 5AEKB 2K3UA 2JRHA 2MBHA 4M0WA 4WWNA 2LUMA 3W5UB 1MG8A 3Q8BA 2NBUA 1ACCA 2IY1B 3H7PB 4AS1A 5JHAA 1XT9B 2W3RA 2XK5A 4JWSC 1T5XD 4JWUC 2MJ3A 3DQVA 1OEYJ 2X8XX 1R4NB 1WM3A 3ZJVA 2WXKA 4BAXA 2KQ4X 4B95A 1R4NI 3PSEB 3ZYYX 3ZTDA 3NUHB 2LXCA 1WXAA 2K5PA 1EWCA 4WAAA 4C56C 3P4QB 4AJWA 2N7JA 3Q3OC 4MJSB 4GB9A 4IWPA 3AE7B 5FKAC 2KDIA 3AE5B 4R3DA 4TSSA 2FIFA 3PLVA 1G6JA 1NENB 2FAZA 2YVCA 2WXOA 3BIID 4ZRJA 1FMAD 1E8ZA 3OG5A 1FM0D 2HJ8A 2RMMA 2KWDA 3L17A 2C7MB 1WRDB 2GRIA 1A70A 1B1ZA 1JRPA 3GP7A 4ASWC 2VZKD 1WI0A 4M00A 2BS3B 2V4IB 1K53A 3QJZA 2BF8B 4RF1A 3R2IA 3MJ5A 5BO4B 3M63B 2PJHA 2V3SA 3HVZA 3TSSA 3DHGC 3DCGA 2ZVOA 4YSZB 1V9JA 1IUEA 5CHFA 1F1HA 3RYTA 2ASQA 2KTRB 3VHTC 2O6VD 2OOBB 2I1KA 4KKJA 5JXVA 1GC7A 4MELA 1A5RA 3FC4A 3L08A 2J42A 1ZE3D 1RFKA 3VDZA 1TTNA 2C7HA 4A90A 3VFKA 5BYQA 2LWPA 3GB1A 4W9HA 1GUAB 2FCNA 4GN1A 1T3QA 3WIMA 4YSYB 3RNAC 1UWXA 2BKRB 1NVID 4KDIC 3AV8A 4LNKA 2KHWB 1QT9A 2XK5B 2RSUA 4X57B 5H92C 1L5PA 1UBIA 2BYVE 2NPTA 1TS2A 4YTMB 1IYFA 4RNAA 3TEYA 1ISNA 3Q8CA 2MSED 4DDGD 2BPSA 1VDVA 2LMCA 4P1CC 1V86A 1WWTA 4BBNC 5G2NA 4B0MA 1WY8A 1ESFA 2R2OA 2BVCA 3M95A 5EE9A 1WF9A 2IGGA 4LK0M 3IXSA 2WU2B 2YEPB 1VR9A 5IKCM 2LHDA 2M0XA 2UU7A 5JZEB 1E6EB 2JSVX 3LXFA 1J8CA 2BKFA 3EFCA 2RPQA 5J17A 3V62A 3X23A 3DOWA 3TIXA 5DPWA 1B9RA 2AEHA 4A20A 2KMCA 2M1MA 1WXQA 2C60A 1LXDA 1D4BA 3U30A 4GDLA 5HHDG 4NAWA 1I35A 4ZYNA 2ZCCA 2KD0A 1D3ZA 2Y5PA 3DWMA 4YSXB 2I2YA 1FNVA 1TIFA 4FA6A 5L83A 1VJKA 1SGHA 4BVUC 2FCSA 3CF6E 4KDLB 4RGNA 2KFKA 3QX1A 5LNK1 2V3NA 3S2AA 4ANVA 2L32A 4WJNA 1N62A 4WJPA 2KZRA 4PT5A 3W2DA 1IBXB 3C0RB 2JWUA 2EELA 2FCMA 3L16A 3ZIMA 1P7EA 4C4VA 2LVPA 1DOYA 4DHJB 2KXJA 1F2RC 1NI2A 4XZ4A 4RM8A 4KZCA 1XLPA 4K7WA 1F9JA 2Y5BB 1PDXA 4O1NA 1X1MA 1PUTA 4MH8A 3ZNHB 1UNSA 2NPTB 3ALBA 4K1RB 5D6JB 4LNOA 3HIZA 2WGSA 3NG0A 1EO6A 3PZ8A 3TMPB 1WYWB 4C00A 4IM0A 4KIKA 4YL8A 3E9SA 4BKSA 2MRPA 5HFYA 4FHJA 2E6XA 2QHOA 2XBBC 3L4PA 4DXAB 4WQOB 3ZLZA 3L13A 3IVFA 1I4RA 2L76A 4KSLC 4II3B 4EZLA 3V3XA 3HM6X 3TCAA 3MP9A 1RAXA 3MJWA 5DPRA 3ML9A 3GS2A 4WURA 1L0VB 4E71A 3DBRB 1QZEA 3HK0A 3IAM1 4GDLB 2GMIC 1FPYA 4NAWB 1Q0WB 2AQ3B 3DBRI 2ZNVB 3PRZA 3IAS1 5HKHA 1ZKHA 2WYQA 1I4PA 2LJIA 2PE9A 2WXMA 2XN9C 3N30A 3DPDA 4PYUA 2FUHB 3N32A 1JWMD 2CU1A 3JSVA 2CHZA 4RF0A 2KFKB 3KWVA 1Z2MA 3WAOA 4RGOS 2FNJB 1EUVB 4BKTA 4GIVA 2AQ2B 1PQSA 4WWMA 1D5MC 1ET6A 2J53A 3NVYA 2V0GA 5JH5C 5D3DA 4BFRA 1EF5A 2WNMA 2K9XA 4C4VB 2KJRA 1K52A 4HPPA 2PE6B 3U2SC 4ZYSA 4P7IA 4EZJA 3EA6A 4F8CB 4JIOU 2MBOA 3IG3A 3W9CB 1KJTA 2DENB 4GSWA 3PV1A 2INDC 1WJ6A 2N9EB 2WXHA 1YJ1A 2KX0A 1L0YB 2INNE 1FRRA 3UIOB 3ZKJC 3AEFB 1GAQB 1J0GA 3SD5A 4XC2A 1NYRA 2MBEA 2IJ0A 5J2RA 4TMAB 1QOBA 4KIKB 4W9GA 3MHSD 4ACFA 3RZFA 3URYA 1TJEA 4N59A 1WGDA 1AWDA 2GBMA 1QOAA 2HTME 3WALA 3Q8AA 3Q2AC 2GBKA 2J52A 1VZ6A 1F2RI 2JYEA 4K3CA 4MSQB 2JRIB 3AH7A 4HEA1 1E8YA 1EM7A 1DOXA 3LYYA 3JVZX 2WHIA
chains in the Genus database with same CATH topology
2NBUA 3KW5B 4NNJB 1C1YB 1WE6A 2IY1B 1UBQA 2KC2A 3PVLA 4MEMA 3OJ3A 3H7PB 3TBLD 2IO2B 5JHAA 4KV2A 1LFDA 2N9PC 4ANUA 3KUCB 4MGYE 1XT9B 5TR5A 1E7VA 2XK5A 4MM3A 2WDTB 4W9KA 1V81A 2EMSA 4HVBA 1LM8B 4IM2A 2ZVNA 2K8BA 2BWES 2D2QA 3B08A 3WAPA 3H6NA 2KTFA 2ZCBA 1OEYJ 2AL6A 3DQVA 4BOZB 2O6VB 1OGWA 1R4MI 4GXBA 1WM3A 3QK0A 4AUQC 2KWVB 2DZJA 4IWOA 4B95A 3Q3FA 1R4NI 4RMAA 4HCNB 5AZFA 3R66C 2JZ3B 3PSEB 5IA7A 3ZTDA 2ZNVC 4DHZB 2IO0B 2LXCA 2NR2A 1WXAA 3HM3A 2NBVB 2LGYA 4HXDA 4WAAA 4AJWA 4MJSB 2NS5A 4GB9A 3KVFB 2KJ6A 4IWPA 4G3XB 3R7QA 3RT3B 4ZRKA 4IC7B 3QAQA 2KDIA 4A3OA 3D32A 1WR6E 1E90A 2FIFA 2UYZB 3PLVA 3T9LA 1G6JA 3RULA 4NY0A 3SU8X 2FAZA 2YVCA 4WWOA 4ZRJA 4AP4C 1M94A 1E8ZA 4W9DA 3PZDA 1WH3A 3EECA 2KDFB 2HJ8A 2M8SA 4GGQA 1WGYA 4AJYB 2KO3A 2L00B 5D7GA 3KH0A 3VH3B 4BKSD 4EFOA 4TQ0A 2KFJA 3L17A 2C7MB 1WRDB 2LXAA 4HCPB 4EOYA 4ASWC 1BT0A 1OEYA 3M3JA 2K1FA 4LCDE 1WI0A 1WJ4A 3A9KB 2JWZA 3QJZA 2BF8B 5DPSA 2BGFA 2J7QB 5BO4B 3M63B 3DBLI 2PJHA 1WXVA 2V3SA 2L0TA 5DCNA 1WMHA 2JZZA 2MBQA 1IP9A 3APDA 3DCGA 1K8RB 4GOCA 3WANA 4JGHB 4EZKA 2ZVOA 2ZZPB 3NS8A 3RUIB 3QQ8B 2GBNA 2K39A 3A1QB 2N1VA 1V9JA 1WZ3A 3UIPB 3UINB 2O2VB 3LJ3A 4W9LA 2GOWA 5CHFA 2W9NA 2AL3A 3AI5A 4HDOA 2WX0A 2LRWA 3RYTA 2ASQA 2C9WB 2KTRB 4KZ0A 5E6NA 2K8CA 3VHTC 3ZDMC 2O6VD 2OOBB 2I1KA 3ZW3A 4EKUA 1WIAA 1Q5WB 4FJVB 3VH4B 3N3KB 4TKNA 1GC7A 4MELA 1A5RA 1H4RA 3DVGY 4ICVA 3L08A 2EKEC 2REXA 3UQAA 1GJZA 1P98A 3VDZA 2GBRA 3W1YA 1TTNA 4I6LB 2C7HA 4FLHA 3EC8A 4CHKA 4JL9A 3IBEA 4KVGB 3VFKA 3NZSA 2JF5A 2Z0EB 2LWPA 4W9HA 1GUAB 2FCNA 4GN1A 2KANA 1LQBA 3WIMA 3KUZA 1RRBA 4EUTA 1P0RA 1VD2A 4FULA 3I3TB 4W9FA 3ZNGC 4TQ1A 1GC6A 3DVGX 3W1SC 3Q3JA 2BKRB 3NOBA 2KVRA 3DDCB 5KHQA 4KDIC 3ZNZB 2LI5A 3EFUA 4I6NB 2HD5B 2KLCA 2KC1A 3NHEB 2KHWB 2MLBA 2XK5B 2RSUA 3LDZE 4X57B 4ZRIA 2FIDA 2D11A 4BOSC 1UBIA 3UQBA 5LXIB 2BYVE 1XQQA 1Q1OA 2MP2B 4FADA 2NPTA 3PRMB 1TBEA 2Z59B 4HLEA 1IYFA 2JVCA 1WX7A 2LVQA 2AYOB 3NZUA 2PEAA 1ISNA 2MQJA 3U7DA 5CHVC 5CHWA 4E3CA 5D94A 2MSED 4DDGD 2DYBA 2BPSA 4IWQA 2K25A 2KK8A 5KHOA 4B9KA 1NBFC 2BYEA 1IPGA 1V86A 1V5TA 4LJOB 4BBNC 2KKCA 1S3SG 5G2NA 2IYDB 1WY8A 2DYOA 4DK5A 4TV3A 1V49A 2R2OA 5DPTA 1Y8RC 2OJRA 3RCZA 2CS4A 3DBHI 2DAJA 3M95A 4GMVA 1V80A 1WF9A 2K8HA 3W1SA 2IZVB 5AZGA 2N7EA 1H8CA 2JUOA 2Z0DB 2IO3B 3OJ4B 2M0XA 1WM2A 3IFWB 2LVOA 3JSVB 2KWUB 4IM3A 5CTRC 4FBJB 5LLIA 5JZEB 4OVUA 3VAWA 4K7UA 3PTFC 4B6WA 1YIWA 2IY0B 1ZW7A 2IBIB 4DBGA 3VUXA 4MSMB 2WX1A 1J8CA 3JYUA 3B1LX 2BKFA 2DZIA 4DHJD 3L10B 2CHXA 3ZDTA 2RPQA 2KOXA 2PPHA 5J17A 3RZWC 2R2QA 4ANXA 3V62A 1SIFA 3DOWA 3KUDB 1WGRA 1E5WA 3ML8A 2L7RA 4G50A 4WJOA 3TIXA 4HJKA 3QARA 5DPWA 3V61A 4W9EA 4ANWA 1FXTB 1ZGUB 2AEHA 4A20A 4HK2A 1J19A 2KMCA 2VRRB 3A9JA 2M1MA 3PHXB 2C60A 1LXDA 5D2MB 1V5OA 4BBNF 3K9PB 3U30A 3ZO5B 4GDLA 4CO7A 3M62B 2L8JA 4NAWA 4JLCA 2J0MA 1I35A 4ZYNA 2ZCCA 1P1AA 2KD0A 3VQIA 3QA8A 1D3ZA 2RGFA 3T8MA 2L3ZA 3CSTA 4PS3A 4EEWA 2N7DA 4FJYA 3MTNB 2MW5A 2AWTA 3APCA 1Z5SB 4KSKC 1OQYA 4W9IA 2G45B 3EHVA 4FA6A 5L83A 2HE7A 4DDID 2G4SA 1SGHA 2D3GA 3R7RA 4BVUC 2FCSA 3CF6E 4KDLB 2BWFA 2KFKA 3QIJA 3QX1A 2D10A 2JY6A 3DBSA 1P9DU 3VVWB 1UGMA 3S2AA 3SDLC 4ANVA 4DHZE 3QC8B 4WJNA 3PLUA 3V6CB 4WJPA 3TJPA 2KZRA 1TGZB 5FR6A 2KLGA 4HWIB 4PS7A 4I6PA 3C0RB 2FCMA 3L16A 1YQBA 3ZIMA 2DYMA 2LVPA 2NBWB 4ICUA 1U4AA 2M4NA 2DAFA 1GG3A 2KJHB 4DHJB 4FJZA 1VCBA 1WX8A 2KXJA 1NI2A 1E8XA 1L7YA 4NJ6A 2UWQA 4RM8A 4XZ4A 4DWFA 2KQ7A 5C1ZA 5IAAC 4KZCA 2LZ6A 3H7SA 4LDTD 2KQSA 4K7WA 3WA0A 2CKHB 4M0WB 4AWJA 1F9JA 4LJPB 2KN5A 4NQKE 1YD8U 3PPAA 2Y5BB 3PS6A 4F1SA 1X1MA 3O65B 4II2B 3ZNHB 3ZRFA 3X23A 2MCNB 2NPTB 3KYCD 2KTRA 3ALBA 4M8MA 2IO1B 4N9F4 4K1RB 4NJ7A 5D6JB 2LASA 3KYDD 3APFA 1WE7A 5E6OA 3BINA 3HIZA 2FCQA 1EO6A 2NVUI 1V6EA 2M17A 3TMPB 4BKGA 3AU4A 1TZ1A 1WYWB 2XEWA 2WWZA 2A5UA 4GU2A 2CHWA 2LGXA 4GDKA 4IM0A 1WGGA 4KIKA 4YL8A 4BKSA 3U8ZA 2ZEQA 2KNBA 2L0FA 2LUEA 2MRPA 4G11A 4MGZE 4E74A 3CMMB 2J0KA 2MWSB 4K7SA 4PS8A 2LJ5A 4FHJA 3A4RA 5AZHA 2QHOA 4ZDVA 1GNUA 2DX5B 2ZJDA 2XBBC 4IG7B 1UELA 3AU5A 4DXAB 3VTVA 4WQOB 3ZLZA 1RLFA 2GBJA 4IUMB 3L13A 3IVFA 1UH6A 4MGIE 2L76A 4KSLC 3ZVVA 4J6IA 4II3B 4W9JA 4WJQA 5EDSA 2RD0A 4EZLA 2KX3A 3WAMA 3ZTCA 2N4FA 2MP2A 3H7PA 4PYZA 1KLVA 4CYEA 5GMVA 3AXCA 3HM6X 3TCAA 4LDTB 4HDQA 4XX5A 4NQLB 1KOTA 5L95C 5E6PA 3JW0X 3OAWA 1RAXA 3VXWA 2J0JA 3DVNV 2I1JA 3MJWA 2EMTA 3ML9A 5DPRA 3P2BA 3NY5A 2YLMA 5C23A 2DHZA 4E71A 3AULA 2N9XA 3A9JB 1QZEA 2O6VA 3HK0A 4F7ZA 2DZMA 2GMIC 4GDLB 4MDKE 4NAWB 1Q0WB 1JRUA 3DBRI 2ZNVB 2V1YA 3PRZA 1WR1A 5HKHA 4W9CA 1ZKHA 2WYQA 2K6QA 2PE9A 2LRUA 3HHMA 4AOFA 5CX3A 2C5LC 1WMHB 3DPDA 2FUHB 3N32A 3N30A 4FHKA 4PYUA 2CU1A 3JSVA 3A33B 2V4LA 4HPMB 3ENEA 2CHZA 4MJSA 3IHPC 2KDEB 2KFKB 4OVVA 1WXMA 1Z2MA 3A4SC 5G55A 3V6EB 1NDDA 2FNJB 3WAOA 1SE9A 1EUVB 2KMAA 3PHWB 3VUYA 2MBBB 2DZKA 4BKTA 4GIVA 2D07B 1PQSA 2JPHA 1C3TA 3UGBB 3L54A 4M8NA 1I42A 3ZNID 3RD2A 1RFAA 3QWZB 1WJNA 5JH5C 3QHTA 4BFRA 1EF5A 3QCAA 1UD7A 2KJRA 1XD3B 1E7UA 2PE6B 2LD9A 3H1UA 4P7IA 4EZJA 5J18A 3UF8A 4F8CB 1WZ0A 1WJUA 2N1WA 4JIOU 2MBOA 3IG3A 1HE8A 3BY4B 4IW0A 2MA9B 3ECIA 2LGDA 3A9KA 2RR9A 4WWPA 1EF1A 1KJTA 5JHBA 2DENB 4GSWA 4HPLB 4JQWC 4G0NB 4NPNA 1YX5B 1V2YA 3R3MA 3PV1A 3PT2B 2MX2A 4URKA 2HTHA 1P3QU 1WJ6A 4K81A 2N9EB 3CSFA 2K6DB 1YJ1A 2JT4B 4FN2A 3A1QA 1WGHA 2KX0A 4RM9A 5LXHA 1L2NA 3PREA 3VTUA 2KDBA 4TUUA 1WX9A 2G3QB 2O2VA 3UIOB 3ZKJC 1KM7A 3B0AA 3K9OB 3PGEA 3DVNU 1WFYA 1J0GA 3SD5A 1S1QB 1YX6B 2BYFA 4XC2A 3PRPB 2KWCA 1UZXB 2MBEA 5J2RA 1T0YA 1AARA 4GDKB 4MGKE 3SHQA 4KIKB 4W9GA 3MHSD 3ZRCA 3X0WA 3GZNI 3OLMD 3RZFA 3ONSA 3VUWA 2JXXA 1WGDA 2GBMA 3GOEA 2NCNA 4A3PA 2G4DB 1OTRB 3WALA 3H9DA 2GBKA 2ZPNA 3L0WB 5AEKB 1CMXB 2JRHA 3TL5A 2L05A 2MBHA 1E8WA 3ZUNA 4MSQB 2C7NB 2CR5A 3V60A 3VTWA 2JRIB 2A4ZA 1E8YA 4WWNA 2B3AA 2ZPYA 4MH0E 1MG8A 3JVZX 1WXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBU A;  3KW5 B;  4NNJ B;  1C1Y B;  1WE6 A;  2IY1 B;  1UBQ A;  2KC2 A;  3PVL A;  4MEM A;  3OJ3 A;  3H7P B;  3TBL D;  2IO2 B;  5JHA A;  4KV2 A;  1LFD A;  2N9P C;  4ANU A;  3KUC B;  4MGY E;  1XT9 B;  5TR5 A;  1E7V A;  2XK5 A;  4MM3 A;  2WDT B;  4W9K A;  1V81 A;  2EMS A;  4HVB A;  1LM8 B;  4IM2 A;  2ZVN A;  2K8B A;  2BWE S;  2D2Q A;  3B08 A;  3WAP A;  3H6N A;  2KTF A;  2ZCB A;  1OEY J;  2AL6 A;  3DQV A;  4BOZ B;  2O6V B;  1OGW A;  1R4M I;  4GXB A;  1WM3 A;  3QK0 A;  4AUQ C;  2KWV B;  2DZJ A;  4IWO A;  4B95 A;  3Q3F A;  1R4N I;  4RMA A;  4HCN B;  5AZF A;  3R66 C;  2JZ3 B;  3PSE B;  5IA7 A;  3ZTD A;  2ZNV C;  4DHZ B;  2IO0 B;  2LXC A;  2NR2 A;  1WXA A;  3HM3 A;  2NBV B;  2LGY A;  4HXD A;  4WAA A;  4AJW A;  4MJS B;  2NS5 A;  4GB9 A;  3KVF B;  2KJ6 A;  4IWP A;  4G3X B;  3R7Q A;  3RT3 B;  4ZRK A;  4IC7 B;  3QAQ A;  2KDI A;  4A3O A;  3D32 A;  1WR6 E;  1E90 A;  2FIF A;  2UYZ B;  3PLV A;  3T9L A;  1G6J A;  3RUL A;  4NY0 A;  3SU8 X;  2FAZ A;  2YVC A;  4WWO A;  4ZRJ A;  4AP4 C;  1M94 A;  1E8Z A;  4W9D A;  3PZD A;  1WH3 A;  3EEC A;  2KDF B;  2HJ8 A;  2M8S A;  4GGQ A;  1WGY A;  4AJY B;  2KO3 A;  2L00 B;  5D7G A;  3KH0 A;  3VH3 B;  4BKS D;  4EFO A;  4TQ0 A;  2KFJ A;  3L17 A;  2C7M B;  1WRD B;  2LXA A;  4HCP B;  4EOY A;  4ASW C;  1BT0 A;  1OEY A;  3M3J A;  2K1F A;  4LCD E;  1WI0 A;  1WJ4 A;  3A9K B;  2JWZ A;  3QJZ A;  2BF8 B;  5DPS A;  2BGF A;  2J7Q B;  5BO4 B;  3M63 B;  3DBL I;  2PJH A;  1WXV A;  2V3S A;  2L0T A;  5DCN A;  1WMH A;  2JZZ A;  2MBQ A;  1IP9 A;  3APD A;  3DCG A;  1K8R B;  4GOC A;  3WAN A;  4JGH B;  4EZK A;  2ZVO A;  2ZZP B;  3NS8 A;  3RUI B;  3QQ8 B;  2GBN A;  2K39 A;  3A1Q B;  2N1V A;  1V9J A;  1WZ3 A;  3UIP B;  3UIN B;  2O2V B;  3LJ3 A;  4W9L A;  2GOW A;  5CHF A;  2W9N A;  2AL3 A;  3AI5 A;  4HDO A;  2WX0 A;  2LRW A;  3RYT A;  2ASQ A;  2C9W B;  2KTR B;  4KZ0 A;  5E6N A;  2K8C A;  3VHT C;  3ZDM C;  2O6V D;  2OOB B;  2I1K A;  3ZW3 A;  4EKU A;  1WIA A;  1Q5W B;  4FJV B;  3VH4 B;  3N3K B;  4TKN A;  1GC7 A;  4MEL A;  1A5R A;  1H4R A;  3DVG Y;  4ICV A;  3L08 A;  2EKE C;  2REX A;  3UQA A;  1GJZ A;  1P98 A;  3VDZ A;  2GBR A;  3W1Y A;  1TTN A;  4I6L B;  2C7H A;  4FLH A;  3EC8 A;  4CHK A;  4JL9 A;  3IBE A;  4KVG B;  3VFK A;  3NZS A;  2JF5 A;  2Z0E B;  2LWP A;  4W9H A;  1GUA B;  2FCN A;  4GN1 A;  2KAN A;  1LQB A;  3WIM A;  3KUZ A;  1RRB A;  4EUT A;  1P0R A;  1VD2 A;  4FUL A;  3I3T B;  4W9F A;  3ZNG C;  4TQ1 A;  1GC6 A;  3DVG X;  3W1S C;  3Q3J A;  2BKR B;  3NOB A;  2KVR A;  3DDC B;  5KHQ A;  4KDI C;  3ZNZ B;  2LI5 A;  3EFU A;  4I6N B;  2HD5 B;  2KLC A;  2KC1 A;  3NHE B;  2KHW B;  2MLB A;  2XK5 B;  2RSU A;  3LDZ E;  4X57 B;  4ZRI A;  2FID A;  2D11 A;  4BOS C;  1UBI A;  3UQB A;  5LXI B;  2BYV E;  1XQQ A;  1Q1O A;  2MP2 B;  4FAD A;  2NPT A;  3PRM B;  1TBE A;  2Z59 B;  4HLE A;  1IYF A;  2JVC A;  1WX7 A;  2LVQ A;  2AYO B;  3NZU A;  2PEA A;  1ISN A;  2MQJ A;  3U7D A;  5CHV C;  5CHW A;  4E3C A;  5D94 A;  2MSE D;  4DDG D;  2DYB A;  2BPS A;  4IWQ A;  2K25 A;  2KK8 A;  5KHO A;  4B9K A;  1NBF C;  2BYE A;  1IPG A;  1V86 A;  1V5T A;  4LJO B;  4BBN C;  2KKC A;  1S3S G;  5G2N A;  2IYD B;  1WY8 A;  2DYO A;  4DK5 A;  4TV3 A;  1V49 A;  2R2O A;  5DPT A;  1Y8R C;  2OJR A;  3RCZ A;  2CS4 A;  3DBH I;  2DAJ A;  3M95 A;  4GMV A;  1V80 A;  1WF9 A;  2K8H A;  3W1S A;  2IZV B;  5AZG A;  2N7E A;  1H8C A;  2JUO A;  2Z0D B;  2IO3 B;  3OJ4 B;  2M0X A;  1WM2 A;  3IFW B;  2LVO A;  3JSV B;  2KWU B;  4IM3 A;  5CTR C;  4FBJ B;  5LLI A;  5JZE B;  4OVU A;  3VAW A;  4K7U A;  3PTF C;  4B6W A;  1YIW A;  2IY0 B;  1ZW7 A;  2IBI B;  4DBG A;  3VUX A;  4MSM B;  2WX1 A;  1J8C A;  3JYU A;  3B1L X;  2BKF A;  2DZI A;  4DHJ D;  3L10 B;  2CHX A;  3ZDT A;  2RPQ A;  2KOX A;  2PPH A;  5J17 A;  3RZW C;  2R2Q A;  4ANX A;  3V62 A;  1SIF A;  3DOW A;  3KUD B;  1WGR A;  1E5W A;  3ML8 A;  2L7R A;  4G50 A;  4WJO A;  3TIX A;  4HJK A;  3QAR A;  5DPW A;  3V61 A;  4W9E A;  4ANW A;  1FXT B;  1ZGU B;  2AEH A;  4A20 A;  4HK2 A;  1J19 A;  2KMC A;  2VRR B;  3A9J A;  2M1M A;  3PHX B;  2C60 A;  1LXD A;  5D2M B;  1V5O A;  4BBN F;  3K9P B;  3U30 A;  3ZO5 B;  4GDL A;  4CO7 A;  3M62 B;  2L8J A;  4NAW A;  4JLC A;  2J0M A;  1I35 A;  4ZYN A;  2ZCC A;  1P1A A;  2KD0 A;  3VQI A;  3QA8 A;  1D3Z A;  2RGF A;  3T8M A;  2L3Z A;  3CST A;  4PS3 A;  4EEW A;  2N7D A;  4FJY A;  3MTN B;  2MW5 A;  2AWT A;  3APC A;  1Z5S B;  4KSK C;  1OQY A;  4W9I A;  2G45 B;  3EHV A;  4FA6 A;  5L83 A;  2HE7 A;  4DDI D;  2G4S A;  1SGH A;  2D3G A;  3R7R A;  4BVU C;  2FCS A;  3CF6 E;  4KDL B;  2BWF A;  2KFK A;  3QIJ A;  3QX1 A;  2D10 A;  2JY6 A;  3DBS A;  1P9D U;  3VVW B;  1UGM A;  3S2A A;  3SDL C;  4ANV A;  4DHZ E;  3QC8 B;  4WJN A;  3PLU A;  3V6C B;  4WJP A;  3TJP A;  2KZR A;  1TGZ B;  5FR6 A;  2KLG A;  4HWI B;  4PS7 A;  4I6P A;  3C0R B;  2FCM A;  3L16 A;  1YQB A;  3ZIM A;  2DYM A;  2LVP A;  2NBW B;  4ICU A;  1U4A A;  2M4N A;  2DAF A;  1GG3 A;  2KJH B;  4DHJ B;  4FJZ A;  1VCB A;  1WX8 A;  2KXJ A;  1NI2 A;  1E8X A;  1L7Y A;  4NJ6 A;  2UWQ A;  4RM8 A;  4XZ4 A;  4DWF A;  2KQ7 A;  5C1Z A;  5IAA C;  4KZC A;  2LZ6 A;  3H7S A;  4LDT D;  2KQS A;  4K7W A;  3WA0 A;  2CKH B;  4M0W B;  4AWJ A;  1F9J A;  4LJP B;  2KN5 A;  4NQK E;  1YD8 U;  3PPA A;  2Y5B B;  3PS6 A;  4F1S A;  1X1M A;  3O65 B;  4II2 B;  3ZNH B;  3ZRF A;  3X23 A;  2MCN B;  2NPT B;  3KYC D;  2KTR A;  3ALB A;  4M8M A;  2IO1 B;  4N9F 4;  4K1R B;  4NJ7 A;  5D6J B;  2LAS A;  3KYD D;  3APF A;  1WE7 A;  5E6O A;  3BIN A;  3HIZ A;  2FCQ A;  1EO6 A;  2NVU I;  1V6E A;  2M17 A;  3TMP B;  4BKG A;  3AU4 A;  1TZ1 A;  1WYW B;  2XEW A;  2WWZ A;  2A5U A;  4GU2 A;  2CHW A;  2LGX A;  4GDK A;  4IM0 A;  1WGG A;  4KIK A;  4YL8 A;  4BKS A;  3U8Z A;  2ZEQ A;  2KNB A;  2L0F A;  2LUE A;  2MRP A;  4G11 A;  4MGZ E;  4E74 A;  3CMM B;  2J0K A;  2MWS B;  4K7S A;  4PS8 A;  2LJ5 A;  4FHJ A;  3A4R A;  5AZH A;  2QHO A;  4ZDV A;  1GNU A;  2DX5 B;  2ZJD A;  2XBB C;  4IG7 B;  1UEL A;  3AU5 A;  4DXA B;  3VTV A;  4WQO B;  3ZLZ A;  1RLF A;  2GBJ A;  4IUM B;  3L13 A;  3IVF A;  1UH6 A;  4MGI E;  2L76 A;  4KSL C;  3ZVV A;  4J6I A;  4II3 B;  4W9J A;  4WJQ A;  5EDS A;  2RD0 A;  4EZL A;  2KX3 A;  3WAM A;  3ZTC A;  2N4F A;  2MP2 A;  3H7P A;  4PYZ A;  1KLV A;  4CYE A;  5GMV A;  3AXC A;  3HM6 X;  3TCA A;  4LDT B;  4HDQ A;  4XX5 A;  4NQL B;  1KOT A;  5L95 C;  5E6P A;  3JW0 X;  3OAW A;  1RAX A;  3VXW A;  2J0J A;  3DVN V;  2I1J A;  3MJW A;  2EMT A;  3ML9 A;  5DPR A;  3P2B A;  3NY5 A;  2YLM A;  5C23 A;  2DHZ A;  4E71 A;  3AUL A;  2N9X A;  3A9J B;  1QZE A;  2O6V A;  3HK0 A;  4F7Z A;  2DZM A;  2GMI C;  4GDL B;  4MDK E;  4NAW B;  1Q0W B;  1JRU A;  3DBR I;  2ZNV B;  2V1Y A;  3PRZ A;  1WR1 A;  5HKH A;  4W9C A;  1ZKH A;  2WYQ A;  2K6Q A;  2PE9 A;  2LRU A;  3HHM A;  4AOF A;  5CX3 A;  2C5L C;  1WMH B;  3DPD A;  2FUH B;  3N32 A;  3N30 A;  4FHK A;  4PYU A;  2CU1 A;  3JSV A;  3A33 B;  2V4L A;  4HPM B;  3ENE A;  2CHZ A;  4MJS A;  3IHP C;  2KDE B;  2KFK B;  4OVV A;  1WXM A;  1Z2M A;  3A4S C;  5G55 A;  3V6E B;  1NDD A;  2FNJ B;  3WAO A;  1SE9 A;  1EUV B;  2KMA A;  3PHW B;  3VUY A;  2MBB B;  2DZK A;  4BKT A;  4GIV A;  2D07 B;  1PQS A;  2JPH A;  1C3T A;  3UGB B;  3L54 A;  4M8N A;  1I42 A;  3ZNI D;  3RD2 A;  1RFA A;  3QWZ B;  1WJN A;  5JH5 C;  3QHT A;  4BFR A;  1EF5 A;  3QCA A;  1UD7 A;  2KJR A;  1XD3 B;  1E7U A;  2PE6 B;  2LD9 A;  3H1U A;  4P7I A;  4EZJ A;  5J18 A;  3UF8 A;  4F8C B;  1WZ0 A;  1WJU A;  2N1W A;  4JIO U;  2MBO A;  3IG3 A;  1HE8 A;  3BY4 B;  4IW0 A;  2MA9 B;  3ECI A;  2LGD A;  3A9K A;  2RR9 A;  4WWP A;  1EF1 A;  1KJT A;  5JHB A;  2DEN B;  4GSW A;  4HPL B;  4JQW C;  4G0N B;  4NPN A;  1YX5 B;  1V2Y A;  3R3M A;  3PV1 A;  3PT2 B;  2MX2 A;  4URK A;  2HTH A;  1P3Q U;  1WJ6 A;  4K81 A;  2N9E B;  3CSF A;  2K6D B;  1YJ1 A;  2JT4 B;  4FN2 A;  3A1Q A;  1WGH A;  2KX0 A;  4RM9 A;  5LXH A;  1L2N A;  3PRE A;  3VTU A;  2KDB A;  4TUU A;  1WX9 A;  2G3Q B;  2O2V A;  3UIO B;  3ZKJ C;  1KM7 A;  3B0A A;  3K9O B;  3PGE A;  3DVN U;  1WFY A;  1J0G A;  3SD5 A;  1S1Q B;  1YX6 B;  2BYF A;  4XC2 A;  3PRP B;  2KWC A;  1UZX B;  2MBE A;  5J2R A;  1T0Y A;  1AAR A;  4GDK B;  4MGK E;  3SHQ A;  4KIK B;  4W9G A;  3MHS D;  3ZRC A;  3X0W A;  3GZN I;  3OLM D;  3RZF A;  3ONS A;  3VUW A;  2JXX A;  1WGD A;  2GBM A;  3GOE A;  2NCN A;  4A3P A;  2G4D B;  1OTR B;  3WAL A;  3H9D A;  2GBK A;  2ZPN A;  3L0W B;  5AEK B;  1CMX B;  2JRH A;  3TL5 A;  2L05 A;  2MBH A;  1E8W A;  3ZUN A;  4MSQ B;  2C7N B;  2CR5 A;  3V60 A;  3VTW A;  2JRI B;  2A4Z A;  1E8Y A;  4WWN A;  2B3A A;  2ZPY A;  4MH0 E;  1MG8 A;  3JVZ X;  1WXS A; 
#chains in the Genus database with same CATH topology
 4NNJ B;  1C1Y B;  1WE6 A;  3MC8 A;  2IO2 B;  2D3B A;  5TR5 A;  1HQR D;  5MPO A;  1C9F A;  3HRD D;  2EMS A;  1LM8 B;  4N6E B;  2ZVN A;  3DWG C;  4DXF A;  2KTF A;  2ZCB A;  4GXB A;  3MHZ A;  4AUQ C;  4IWO A;  2RDH A;  2ON8 A;  4RMA A;  4HCN B;  5AZF A;  3R66 C;  1STE A;  2M19 A;  5IA7 A;  3HM3 A;  1JQ4 A;  4HXD A;  1LO5 D;  2QDF A;  1AW7 A;  3KVF B;  3D32 A;  1WR6 E;  4RGM A;  4J3O D;  1E90 A;  1VLB A;  1UWM A;  2UYZ B;  4A55 A;  4NJC A;  4AP4 C;  4W9D A;  4RGT A;  2KDF B;  2L00 B;  1XO3 A;  2L1A A;  4TQ0 A;  2KFJ A;  1NYQ A;  1OFF A;  4ARI A;  4LTU A;  1XLQ A;  2N0S B;  4HCP B;  4L23 A;  3DHI C;  3M3J A;  4LCD E;  3AB5 A;  1KLG D;  1CJE A;  5DPS A;  3RNB C;  4MAC A;  2KAJ A;  1WMH A;  4US8 A;  3WAN A;  4JGH B;  4EZK A;  2KMM A;  2W54 A;  3RUI B;  3QQ8 B;  2GBN A;  4ZRP A;  1WZ3 A;  3NVW A;  1LGR A;  4W9L A;  4OW0 A;  2C9W B;  4KZ0 A;  1N6Z A;  1WIA A;  1PGB A;  4OZB A;  1H4R A;  5G5G A;  4ICV A;  2QSD A;  2D3A A;  3KQ4 A;  3IT4 B;  3T3N A;  2WDV B;  2SEB D;  2LFI A;  1N60 A;  1LQB A;  2QIE B;  2H88 B;  2Y3A A;  1MI0 A;  1VD2 A;  4FUL A;  3I3T B;  4KGT A;  1HA5 A;  3ZNG C;  4TQ1 A;  1GC6 A;  3DVG X;  3Q3J A;  2WXG A;  2Y5C A;  1RM6 C;  2SAK A;  3EUB 2;  2KVR A;  3DDC B;  1PFD A;  4HJG E;  3EFU A;  3NHE B;  3LDZ E;  2D11 A;  3UQB A;  5LXI B;  2I38 A;  2MP2 B;  2JZP A;  3AED B;  2JVC A;  1EU3 A;  2LVQ A;  2OJW A;  2PEA A;  2MQJ A;  5CHW A;  1C4A A;  2DYB A;  1DYQ A;  2BS4 B;  3BVG A;  1IPG A;  4LJO B;  2KKC A;  1SB3 C;  3AM9 A;  1MG4 A;  2DYO A;  4A8X C;  4TV3 A;  1V49 A;  1J7B A;  4IOI E;  1Y8R C;  2CS4 A;  4GMV A;  4L1B A;  2IZV B;  5AZG A;  5CTR C;  3WCQ A;  1WM2 A;  2WLB A;  5LLI A;  3VAW A;  3VR9 B;  1YIW A;  2IY0 B;  1ZW7 A;  1FEH A;  2IBI B;  3VUX A;  2WX1 A;  4XYC A;  3B1L X;  2PMV A;  4LNF A;  3L10 B;  4DHJ D;  2PPH A;  2IPK D;  1T0S C;  1WGR A;  1E5W A;  3I63 C;  4WJO A;  3QAR A;  4W9E A;  2AQ1 B;  1FXT B;  2N9K A;  4HK2 A;  2VRR B;  3SFE B;  1C4C A;  2HDE A;  4DQO C;  2J0M A;  1P1A A;  4PS3 A;  2N7D A;  2OHF A;  4FJY A;  3MTN B;  3N9Y C;  2MW5 A;  3APC A;  4KSK C;  3H8H A;  1OQY A;  2BW2 A;  2G45 B;  2FBW B;  4W9I A;  1FO4 A;  2MH7 A;  3QIJ A;  2D10 A;  3CWI A;  3V6C B;  4WH4 A;  1ZPS A;  1MHH E;  2J4X A;  5FR6 A;  4PS7 A;  4I6P A;  3BVZ A;  3HVD A;  3ZXV A;  1WGK A;  1FD6 A;  3NVZ A;  2NBW B;  4ICU A;  2M4N A;  1TY2 A;  2KJH B;  2BT6 A;  1VCB A;  2MHJ A;  1XCQ L;  1E8X A;  4JX1 C;  1QIL A;  3H7S A;  2KYW A;  3O13 A;  3WA0 A;  2CKH B;  4M0W B;  3O65 B;  3OWE B;  2IO1 B;  2LAS A;  3KYD D;  4WIP A;  3RNF C;  2KAC A;  2FE8 A;  1V6E A;  2M17 A;  2BTE A;  5IN7 A;  1HZ5 A;  3AU4 A;  1QOF A;  2XEW A;  2WWZ A;  4GU2 A;  3CIR B;  1SIJ A;  1UGJ A;  4G11 A;  1K50 A;  1SEB D;  4HKQ A;  4K7S A;  3AE2 B;  5AZH A;  4IG7 B;  1UEL A;  3AEC B;  2ACZ B;  2GBJ A;  1FCL A;  4IUM B;  1UH6 A;  4XWT A;  4J6I A;  2X38 A;  2N4F A;  4KX6 B;  4PYZ A;  1KLV A;  2K22 A;  4XX5 A;  1KOT A;  5E6P A;  3JW0 X;  1RYJ A;  3AEG B;  4XWW A;  1PGA A;  3P2B A;  5HG2 A;  2N9X A;  2O6V A;  1UF0 A;  4F7Z A;  3E56 A;  1BUI C;  1WR1 A;  2K6Q A;  4M01 A;  2LRU A;  1GB4 A;  5CX3 A;  2C5L C;  1QQR A;  3A33 B;  4WAF A;  4HPM B;  2KDE B;  3V6E B;  3AMZ A;  1NDD A;  2QCZ A;  3PHW B;  4REZ A;  1SXT A;  4YWG G;  1E10 A;  2B76 B;  2CU3 A;  2M56 B;  5BMG A;  1TY0 A;  3RI7 C;  1RFA A;  3QCA A;  5AUI A;  1FFV A;  4ARC A;  3LB8 C;  3IT6 B;  2BB5 A;  2N1W A;  2MA9 B;  3ECI A;  2LGD A;  3A9K A;  2RR9 A;  5JHB A;  1RWS A;  3MC9 A;  4HPL B;  4JQW C;  1I4Q A;  4G0N B;  4NPN A;  3R3M A;  1VZ7 A;  3PT2 B;  1L6U A;  2WDQ B;  3CSF A;  4FN2 A;  1JRO A;  3PRE A;  1WX9 A;  1KM7 A;  2GI9 A;  4L2Y A;  1BXT A;  3RFZ B;  3N20 C;  1YX6 B;  3AEA B;  1ROE A;  4MGK E;  2ICI A;  3Q3N C;  2MEK A;  2BBC A;  3Q3M C;  2GLS A;  2JXX A;  1N63 A;  3GOE A;  2Z8L A;  2KVZ A;  4A3P A;  1OTR B;  1CK1 A;  3H9D A;  2QEJ C;  1E8W A;  3ZUN A;  2C7N B;  2CR5 A;  5EE0 A;  2A4Z A;  2ZPY A;  4MH0 E;  2KC2 A;  3PVL A;  4EE2 A;  5FR3 A;  4ANU A;  1Y56 A;  3KUC B;  4MGY E;  1E7V A;  2D3C A;  4MM3 A;  2JYT A;  2WDT B;  4W9K A;  1V81 A;  4CQN A;  4HVB A;  4IM2 A;  2K8B A;  2BWE S;  3WAP A;  3H6N A;  4HRO A;  2O6V B;  2WP9 B;  1FXI A;  2KWV B;  2DZJ A;  2QIL A;  3Q3F A;  3Q69 A;  3Q8F A;  2JZ3 B;  2KN4 A;  4DHZ B;  3DHH C;  2LGY A;  2G1E A;  1JCK B;  2NS5 A;  2IGH A;  1YOV B;  1P7F A;  4A3O A;  3EGR A;  3RUL A;  3NJT A;  2YEP F;  4WWO A;  1M94 A;  4KGS A;  1L0X B;  3PZD A;  3EEC A;  2M8S A;  4BZA A;  4EFO A;  1YN5 A;  3RPF C;  2LXA A;  2QJL A;  1BT0 A;  1OEY A;  2K1F A;  2LGI A;  1YJI A;  5G5H A;  3A9K B;  2WDR B;  2BGF A;  1ZP0 B;  1WXV A;  2ZW1 A;  4ZHP A;  2JZZ A;  2MBQ A;  1IP9 A;  1YN3 A;  1V1P A;  1K8R B;  2PVG C;  3NS8 A;  2K39 A;  2N1V A;  4OZA A;  4QAY A;  3LJ3 A;  3ZXR A;  2INC C;  2W9N A;  2R61 A;  2WX0 A;  1ZXI A;  4LLG M;  2LRW A;  4LNI A;  5E6N A;  2K8C A;  4EOY A;  4EKU A;  4FBJ B;  5IOI A;  1OQR A;  4FJV B;  4OVZ A;  3N3K B;  4TKN A;  3DVG Y;  1C4P A;  2EKE C;  2REX A;  2RDB C;  1GJZ A;  2WXI A;  2GBR A;  1WYG A;  1C76 A;  3W1Y A;  4CHK A;  5IP4 D;  2JF5 A;  3KUZ A;  2DWQ A;  2W82 A;  1RRB A;  1P0R A;  4W9F A;  1QLB B;  2JX5 A;  1TKE A;  2DNF A;  1SE3 A;  4GLS C;  3BZD B;  4AQ7 A;  4IDI A;  3ZNZ B;  1JW9 D;  3P1M A;  2LI5 A;  3SR6 A;  4I6N B;  2PTL A;  2MLB A;  4MM3 B;  2H89 B;  1XQQ A;  1Q1O A;  4FAD A;  1HXY D;  1TBE A;  1YN4 A;  2Z59 B;  3TUO A;  2AYO B;  3NZU A;  4Q2J A;  1TKG A;  3U7D A;  5CHV C;  4E3C A;  1MHX A;  2K25 A;  4B9K A;  1V5T A;  1S3S G;  2IYD B;  4US9 A;  4KKI A;  1E9M A;  5DPT A;  3RN9 C;  2JUO A;  2IO3 B;  3JSV B;  2LVO A;  4OVU A;  3PTF C;  3ABV B;  5E6J A;  2G9H D;  2BB6 A;  4DBG A;  1SJE D;  1YNT E;  3J9C A;  1F0Z A;  2DZI A;  3N1Y C;  4ANX A;  1HTQ A;  3KUD B;  4C80 A;  2L7R A;  3P4S B;  3V61 A;  2AX5 A;  3Q14 C;  4ANW A;  1ZGU B;  3MFG A;  1HEZ E;  3P42 A;  1J19 A;  2WU5 B;  3PHX B;  2NTS A;  4BBN F;  2KT7 A;  3K9P B;  3ZO5 B;  4CO7 A;  1V1P B;  1KF6 B;  2N9L A;  2LGS A;  4H2A A;  2L3Z A;  3CST A;  3NRZ A;  3T3O A;  2AWT A;  1Z5S B;  3EHV A;  4DDI D;  2G4S A;  2D3G A;  2JY6 A;  3P4P B;  4YXD B;  1KH0 A;  1UGM A;  3SDL C;  3VVW B;  4DHZ E;  3PLU A;  3TJP A;  4LNN A;  1TGZ B;  1XXG A;  1N5W A;  5H8Y E;  3BVM A;  1YQB A;  3FIL A;  5C3J B;  2CJN A;  1U4A A;  2NMQ A;  1GG3 A;  4HRS A;  1AN8 A;  2UWQ A;  3P63 A;  2KQ7 A;  2LZ6 A;  1KTK A;  3P4R B;  4AWJ A;  1YD8 U;  1V97 A;  3PS6 A;  1OQQ A;  2E3T A;  2MCN B;  2KTR A;  4IKG A;  2BYT A;  1MVK A;  3BIN A;  5BMI A;  2FCQ A;  3UI3 A;  1SE2 A;  2NVU I;  1NEK B;  4DXG A;  1EU4 A;  1TZ1 A;  2MJE A;  2A5U A;  2CHW A;  2LGX A;  1WGG A;  1YQ3 B;  3GE3 C;  2OED A;  2KNB A;  4MGZ E;  1QKZ A;  3CMM B;  2MWS B;  3U7Z A;  4PS8 A;  1I7H A;  2JXT A;  3A4R A;  1FCC C;  2DX5 B;  1WRI A;  3AU5 A;  2V3P A;  1RLF A;  5T8I A;  3AE8 B;  1FRD A;  4MGI E;  4WJQ A;  5EDS A;  2RD0 A;  1FNU A;  3WAM A;  1ET9 A;  3PZ7 A;  3VRB B;  4CYE A;  3AXC A;  4LDT B;  4HDQ A;  3SEB A;  5L95 C;  2NTT A;  4YTP B;  3VXW A;  2J0J A;  3DVN V;  2DLB A;  5HI1 A;  2DHZ A;  3NS1 A;  3AUL A;  1PGX A;  2DZM A;  1YJJ A;  4C7Z A;  2V1Y A;  3RMK C;  1V8C A;  1D5X C;  4XDD A;  4AOF A;  1WMH B;  3AE1 B;  1XEE A;  4FHK A;  1TYG B;  2IDY A;  3ENE A;  3IHP C;  3BYY B;  3KLS X;  1WXM A;  2WXJ A;  3A4S C;  1L4Z B;  2KMA A;  2MBB B;  2DZK A;  2D07 B;  2JPH A;  3I9V 1;  4JPS A;  1J7A A;  3RD2 A;  5BYR A;  3QWZ B;  1WJN A;  3QHT A;  3TEZ A;  1NI3 A;  3FIL B;  4RCO A;  1UD7 A;  3AEE B;  1E7U A;  2LD9 A;  3H1U A;  1WZ0 A;  1WJU A;  4ZHO A;  1HE8 A;  1XF5 L;  5GXG B;  3BY4 B;  3AE4 B;  1IGC A;  4WWP A;  1V1O A;  1SF0 A;  2MX2 A;  2HTH A;  3RNC C;  4K81 A;  2PIA A;  1SSN A;  2JT4 B;  3A1Q A;  1WGH A;  4RM9 A;  5LXH A;  2WS3 B;  3VTU A;  2O2V A;  2G3Q B;  1GB1 A;  3B0A A;  3RNE C;  3K9O B;  4NZL B;  2CJO A;  3PGE A;  1ZOY B;  3DVN U;  1WFY A;  1R7S A;  4XGA B;  4YT0 B;  2LEK A;  3PRP B;  1IBX A;  1UZX B;  3V05 A;  3X0W A;  1TS5 A;  3OLM D;  1D5Z C;  4ITK A;  1TZO A;  1I4G A;  2G4D B;  3Q6B A;  2BQQ A;  4XE0 A;  2ZPN A;  3L0W B;  1CMX B;  1J7C A;  2L05 A;  3TL5 A;  1FNW A;  3V60 A;  3VTW A;  3I57 A;  1CQV A;  2B3A A;  1WXS A;  3KW5 B;  1UBQ A;  4MEM A;  3OJ3 A;  1T6B X;  3AE3 B;  5C2T B;  3TBL D;  4KV2 A;  1LFD A;  2N9P C;  3AN1 A;  2L52 A;  3TEX A;  3B2G A;  4UDU C;  1R4M B;  1TKY A;  3B08 A;  2D2Q A;  4PK1 A;  1ZDX A;  2AL6 A;  4BOZ B;  1OGW A;  1R4M I;  1F77 A;  1FIQ A;  3QK0 A;  3N1X C;  3BK2 A;  2ZNV C;  4P6V F;  2IO0 B;  2NR2 A;  4OHJ A;  2GB1 A;  2NBV B;  1ZDV A;  5IO9 A;  3FKY A;  1IGD A;  1XLO A;  2KJ6 A;  3U52 E;  4G3X B;  3R7Q A;  3RT3 B;  4ZRK A;  4IC7 B;  3QAQ A;  4WQM A;  3T9L A;  3HUI A;  2QC8 A;  4NY0 A;  3SU8 X;  1TT5 B;  4GGQ A;  1VZ8 A;  1WH3 A;  4AJY B;  1JWB D;  1WGY A;  2KO3 A;  5D7G A;  3KH0 A;  3VH3 B;  4BKS D;  1ENF A;  1MFW A;  2XNA C;  4B0E A;  2D5G A;  3DBL B;  1WJ4 A;  2JWZ A;  3C19 A;  2J7Q B;  3DBL I;  2L0T A;  5DCN A;  3APD A;  4GOC A;  3KWL A;  4N58 A;  5AUK A;  5TSS A;  2ZZP B;  3BWU D;  1C78 A;  3A1Q B;  3R8B A;  3UIN B;  2O2V B;  3UIP B;  1SE4 A;  2GOW A;  4YTN B;  2AL3 A;  3AI5 A;  4HDO A;  3ZDM C;  3ZW3 A;  1Q5W B;  3VH4 B;  2K0P A;  4XDC A;  1C77 A;  3ZJU A;  3UQA A;  1P98 A;  1FXA A;  4I6L B;  4KGR A;  4FLH A;  3EC8 A;  1E0Z A;  4JL9 A;  3IBE A;  4KVG B;  3NZS A;  2Z0E B;  2KAN A;  1I4H A;  2RPV A;  4EUT A;  2VH1 A;  4HKZ E;  1M4V A;  3ZQ4 A;  3FAH A;  3W1S C;  1JWS D;  3NOB A;  2VZK B;  5KHQ A;  1D6E C;  2HD5 B;  2KLC A;  2KC1 A;  4ZRI A;  5FK9 C;  2FID A;  4BOS C;  5I4D A;  3R2T A;  3PRM B;  3I5J C;  4HLE A;  3SFD B;  3N1Z C;  1WX7 A;  1YMH E;  2RDG A;  4M02 A;  1XCT L;  1AYF A;  5D94 A;  2EKI A;  4IWQ A;  1QF6 A;  2KK8 A;  5KHO A;  1NBF C;  2BYE A;  1QOG A;  2INP E;  3DBH B;  4DK5 A;  4RH6 A;  2OJR A;  3RCZ A;  3DBH I;  2DAJ A;  4JE3 B;  1V80 A;  2K8H A;  3W1S A;  2N7E A;  1ZXH A;  3AE9 B;  1H8C A;  2Z0D B;  2VH2 A;  3OJ4 B;  3IFW B;  4IM3 A;  2KWU B;  3VR8 B;  4B6W A;  4K7U A;  2ONQ A;  2HJ1 A;  1HZ6 A;  2PLP A;  4MSM B;  4S0R A;  1T0Q C;  3JYU A;  1ZUD 2;  3VRA B;  2CHX A;  3ZDT A;  1FFU A;  2KOX A;  3RZW C;  2R2Q A;  1SIF A;  3ML8 A;  4G50 A;  4USA A;  4HJK A;  2WXP A;  3A9J A;  5D2M B;  1V5O A;  3M62 B;  2L8J A;  4JLC A;  2WXR A;  2WQY B;  1VRA B;  2WXF A;  4RFB A;  3QA8 A;  3VQI A;  2RGF A;  1MJD A;  3T8M A;  1PYW D;  2MJD A;  4EEW A;  1YQ4 B;  2W55 A;  2HE7 A;  1N5X A;  3R7R A;  3U4E G;  3BYT B;  2BWF A;  2PKO A;  1MPE A;  2TSS A;  3DBS A;  1P9D U;  2WXQ A;  3QC8 B;  1GPX A;  5EE3 A;  2KLG A;  4HWI B;  2W3S A;  4FXC A;  1C79 A;  1SBB B;  2DYM A;  2DAF A;  4FJZ A;  2M0A A;  1WX8 A;  4K3B A;  3TEW A;  4DWF A;  1L7Y A;  4NJ6 A;  5C1Z A;  1E7P B;  5IAA C;  4LDT D;  2KQS A;  2ZW0 A;  3B9J A;  2LHE A;  4LJP B;  1WSP A;  2KN5 A;  4NQK E;  3PPA A;  4F1S A;  4II2 B;  3ZRF A;  3KYC D;  1KLU D;  4M8M A;  4N9F 4;  4NJ7 A;  4OZC A;  3APF A;  1WE7 A;  5E6O A;  4D2K A;  4BKG A;  2V9H A;  3NVV A;  4S17 A;  4GDK A;  4P16 A;  3U8Z A;  2ZEQ A;  5BYS A;  2L0F A;  2LUE A;  4E74 A;  2J0K A;  4ZRQ A;  1KRH A;  2LJ5 A;  4ZDV A;  1GNU A;  2ZJD A;  1BML C;  3VTV A;  1TS3 A;  2WXN A;  1K51 A;  1XLN A;  3ZVV A;  3B2F A;  4W9J A;  1HTO A;  3ZGZ A;  4A9A A;  2KX3 A;  3ZTC A;  1JWU D;  2MP2 A;  2WXL A;  3H7P A;  5GMV A;  4NQL B;  1TS4 A;  3OAW A;  3Q8E A;  2I1J A;  4NAM A;  2EMT A;  2IGD A;  1F52 A;  3NY5 A;  2YLM A;  5C23 A;  3A9J B;  3GE8 C;  1N61 A;  4MDK E;  1CZP A;  1JRU A;  3W5V B;  3MC0 B;  3RNG C;  3ZJT A;  4W9C A;  3HHM A;  4A6Q A;  2V4L A;  4MJS A;  4OVV A;  5G55 A;  1SE9 A;  2JQR B;  2PVO D;  3VUY A;  3AE6 B;  1C3T A;  3UGB B;  3L54 A;  2FUG 1;  4M8N A;  1I42 A;  3ZNI D;  2QMT A;  1GOZ A;  5D3I B;  1T0R C;  1XD3 B;  5J18 A;  3UF8 A;  4IW0 A;  4MT5 A;  5BMH A;  1JWA D;  3C8Y A;  3AEB B;  1EF1 A;  2L83 A;  1L4D B;  1Q10 A;  1DGJ A;  2DBY A;  1YX5 B;  1V2Y A;  3NZ3 A;  2PW9 A;  4URK A;  1P3Q U;  1DOI A;  1L6V A;  2K6D B;  2KDM A;  1L2N A;  1UUP A;  2BS2 B;  2KDB A;  4TUU A;  1I4X A;  4P1B C;  4ZOH C;  1JML A;  5EE1 A;  3PO0 A;  1S1Q B;  2BYF A;  3GZN B;  2KWC A;  2Q5W D;  2JU6 X;  1T0Y A;  1AAR A;  1KFY B;  4GDK B;  3SHQ A;  3ZRC A;  1JAL A;  4C7Y A;  1SJH D;  3GZN I;  3VUW A;  3BK1 A;  3ONS A;  3ETR A;  2NCN A;  1EWY C;  5AEK B;  2K3U A;  2JRH A;  2MBH A;  4M0W A;  4WWN A;  2LUM A;  3W5U B;  1MG8 A;  3Q8B A;  2NBU A;  1ACC A;  2IY1 B;  3H7P B;  4AS1 A;  5JHA A;  1XT9 B;  2W3R A;  2XK5 A;  4JWS C;  1T5X D;  4JWU C;  2MJ3 A;  3DQV A;  1OEY J;  2X8X X;  1R4N B;  1WM3 A;  3ZJV A;  2WXK A;  4BAX A;  2KQ4 X;  4B95 A;  1R4N I;  3PSE B;  3ZYY X;  3ZTD A;  3NUH B;  2LXC A;  1WXA A;  2K5P A;  1EWC A;  4WAA A;  4C56 C;  3P4Q B;  4AJW A;  2N7J A;  3Q3O C;  4MJS B;  4GB9 A;  4IWP A;  3AE7 B;  5FKA C;  2KDI A;  3AE5 B;  4R3D A;  4TSS A;  2FIF A;  3PLV A;  1G6J A;  1NEN B;  2FAZ A;  2YVC A;  2WXO A;  3BII D;  4ZRJ A;  1FMA D;  1E8Z A;  3OG5 A;  1FM0 D;  2HJ8 A;  2RMM A;  2KWD A;  3L17 A;  2C7M B;  1WRD B;  2GRI A;  1A70 A;  1B1Z A;  1JRP A;  3GP7 A;  4ASW C;  2VZK D;  1WI0 A;  4M00 A;  2BS3 B;  2V4I B;  1K53 A;  3QJZ A;  2BF8 B;  4RF1 A;  3R2I A;  3MJ5 A;  5BO4 B;  3M63 B;  2PJH A;  2V3S A;  3HVZ A;  3TSS A;  3DHG C;  3DCG A;  2ZVO A;  4YSZ B;  1V9J A;  1IUE A;  5CHF A;  1F1H A;  3RYT A;  2ASQ A;  2KTR B;  3VHT C;  2O6V D;  2OOB B;  2I1K A;  4KKJ A;  5JXV A;  1GC7 A;  4MEL A;  1A5R A;  3FC4 A;  3L08 A;  2J42 A;  1ZE3 D;  1RFK A;  3VDZ A;  1TTN A;  2C7H A;  4A90 A;  3VFK A;  5BYQ A;  2LWP A;  3GB1 A;  4W9H A;  1GUA B;  2FCN A;  4GN1 A;  1T3Q A;  3WIM A;  4YSY B;  3RNA C;  1UWX A;  2BKR B;  1NVI D;  4KDI C;  3AV8 A;  4LNK A;  2KHW B;  1QT9 A;  2XK5 B;  2RSU A;  4X57 B;  5H92 C;  1L5P A;  1UBI A;  2BYV E;  2NPT A;  1TS2 A;  4YTM B;  1IYF A;  4RNA A;  3TEY A;  1ISN A;  3Q8C A;  2MSE D;  4DDG D;  2BPS A;  1VDV A;  2LMC A;  4P1C C;  1V86 A;  1WWT A;  4BBN C;  5G2N A;  4B0M A;  1WY8 A;  1ESF A;  2R2O A;  2BVC A;  3M95 A;  5EE9 A;  1WF9 A;  2IGG A;  4LK0 M;  3IXS A;  2WU2 B;  2YEP B;  1VR9 A;  5IKC M;  2LHD A;  2M0X A;  2UU7 A;  5JZE B;  1E6E B;  2JSV X;  3LXF A;  1J8C A;  2BKF A;  3EFC A;  2RPQ A;  5J17 A;  3V62 A;  3X23 A;  3DOW A;  3TIX A;  5DPW A;  1B9R A;  2AEH A;  4A20 A;  2KMC A;  2M1M A;  1WXQ A;  2C60 A;  1LXD A;  1D4B A;  3U30 A;  4GDL A;  5HHD G;  4NAW A;  1I35 A;  4ZYN A;  2ZCC A;  2KD0 A;  1D3Z A;  2Y5P A;  3DWM A;  4YSX B;  2I2Y A;  1FNV A;  1TIF A;  4FA6 A;  5L83 A;  1VJK A;  1SGH A;  4BVU C;  2FCS A;  3CF6 E;  4KDL B;  4RGN A;  2KFK A;  3QX1 A;  5LNK 1;  2V3N A;  3S2A A;  4ANV A;  2L32 A;  4WJN A;  1N62 A;  4WJP A;  2KZR A;  4PT5 A;  3W2D A;  1IBX B;  3C0R B;  2JWU A;  2EEL A;  2FCM A;  3L16 A;  3ZIM A;  1P7E A;  4C4V A;  2LVP A;  1DOY A;  4DHJ B;  2KXJ A;  1F2R C;  1NI2 A;  4XZ4 A;  4RM8 A;  4KZC A;  1XLP A;  4K7W A;  1F9J A;  2Y5B B;  1PDX A;  4O1N A;  1X1M A;  1PUT A;  4MH8 A;  3ZNH B;  1UNS A;  2NPT B;  3ALB A;  4K1R B;  5D6J B;  4LNO A;  3HIZ A;  2WGS A;  3NG0 A;  1EO6 A;  3PZ8 A;  3TMP B;  1WYW B;  4C00 A;  4IM0 A;  4KIK A;  4YL8 A;  3E9S A;  4BKS A;  2MRP A;  5HFY A;  4FHJ A;  2E6X A;  2QHO A;  2XBB C;  3L4P A;  4DXA B;  4WQO B;  3ZLZ A;  3L13 A;  3IVF A;  1I4R A;  2L76 A;  4KSL C;  4II3 B;  4EZL A;  3V3X A;  3HM6 X;  3TCA A;  3MP9 A;  1RAX A;  3MJW A;  5DPR A;  3ML9 A;  3GS2 A;  4WUR A;  1L0V B;  4E71 A;  3DBR B;  1QZE A;  3HK0 A;  3IAM 1;  4GDL B;  2GMI C;  1FPY A;  4NAW B;  1Q0W B;  2AQ3 B;  3DBR I;  2ZNV B;  3PRZ A;  3IAS 1;  5HKH A;  1ZKH A;  2WYQ A;  1I4P A;  2LJI A;  2PE9 A;  2WXM A;  2XN9 C;  3N30 A;  3DPD A;  4PYU A;  2FUH B;  3N32 A;  1JWM D;  2CU1 A;  3JSV A;  2CHZ A;  4RF0 A;  2KFK B;  3KWV A;  1Z2M A;  3WAO A;  4RGO S;  2FNJ B;  1EUV B;  4BKT A;  4GIV A;  2AQ2 B;  1PQS A;  4WWM A;  1D5M C;  1ET6 A;  2J53 A;  3NVY A;  2V0G A;  5JH5 C;  5D3D A;  4BFR A;  1EF5 A;  2WNM A;  2K9X A;  4C4V B;  2KJR A;  1K52 A;  4HPP A;  2PE6 B;  3U2S C;  4ZYS A;  4P7I A;  4EZJ A;  3EA6 A;  4F8C B;  4JIO U;  2MBO A;  3IG3 A;  3W9C B;  1KJT A;  2DEN B;  4GSW A;  3PV1 A;  2IND C;  1WJ6 A;  2N9E B;  2WXH A;  1YJ1 A;  2KX0 A;  1L0Y B;  2INN E;  1FRR A;  3UIO B;  3ZKJ C;  3AEF B;  1GAQ B;  1J0G A;  3SD5 A;  4XC2 A;  1NYR A;  2MBE A;  2IJ0 A;  5J2R A;  4TMA B;  1QOB A;  4KIK B;  4W9G A;  3MHS D;  4ACF A;  3RZF A;  3URY A;  1TJE A;  4N59 A;  1WGD A;  1AWD A;  2GBM A;  1QOA A;  2HTM E;  3WAL A;  3Q8A A;  3Q2A C;  2GBK A;  2J52 A;  1VZ6 A;  1F2R I;  2JYE A;  4K3C A;  4MSQ B;  2JRI B;  3AH7 A;  4HEA 1;  1E8Y A;  1EM7 A;  1DOX A;  3LYY A;  3JVZ X;  2WHI A; 
#chains in the Genus database with same CATH homology
 2NBU A;  3KW5 B;  4NNJ B;  1C1Y B;  1WE6 A;  2IY1 B;  1UBQ A;  2KC2 A;  3PVL A;  4MEM A;  3OJ3 A;  3H7P B;  3TBL D;  2IO2 B;  5JHA A;  4KV2 A;  1LFD A;  2N9P C;  4ANU A;  3KUC B;  4MGY E;  1XT9 B;  5TR5 A;  1E7V A;  2XK5 A;  4MM3 A;  2WDT B;  4W9K A;  1V81 A;  2EMS A;  4HVB A;  1LM8 B;  4IM2 A;  2ZVN A;  2K8B A;  2BWE S;  2D2Q A;  3B08 A;  3WAP A;  3H6N A;  2KTF A;  2ZCB A;  1OEY J;  2AL6 A;  3DQV A;  4BOZ B;  2O6V B;  1OGW A;  1R4M I;  4GXB A;  1WM3 A;  3QK0 A;  4AUQ C;  2KWV B;  2DZJ A;  4IWO A;  4B95 A;  3Q3F A;  1R4N I;  4RMA A;  4HCN B;  5AZF A;  3R66 C;  2JZ3 B;  3PSE B;  5IA7 A;  3ZTD A;  2ZNV C;  4DHZ B;  2IO0 B;  2LXC A;  2NR2 A;  1WXA A;  3HM3 A;  2NBV B;  2LGY A;  4HXD A;  4WAA A;  4AJW A;  4MJS B;  2NS5 A;  4GB9 A;  3KVF B;  2KJ6 A;  4IWP A;  4G3X B;  3R7Q A;  3RT3 B;  4ZRK A;  4IC7 B;  3QAQ A;  2KDI A;  4A3O A;  3D32 A;  1WR6 E;  1E90 A;  2FIF A;  2UYZ B;  3PLV A;  3T9L A;  1G6J A;  3RUL A;  4NY0 A;  3SU8 X;  2FAZ A;  2YVC A;  4WWO A;  4ZRJ A;  4AP4 C;  1M94 A;  1E8Z A;  4W9D A;  3PZD A;  1WH3 A;  3EEC A;  2KDF B;  2HJ8 A;  2M8S A;  4GGQ A;  1WGY A;  4AJY B;  2KO3 A;  2L00 B;  5D7G A;  3KH0 A;  3VH3 B;  4BKS D;  4EFO A;  4TQ0 A;  2KFJ A;  3L17 A;  2C7M B;  1WRD B;  2LXA A;  4HCP B;  4EOY A;  4ASW C;  1BT0 A;  1OEY A;  3M3J A;  2K1F A;  4LCD E;  1WI0 A;  1WJ4 A;  3A9K B;  2JWZ A;  3QJZ A;  2BF8 B;  5DPS A;  2BGF A;  2J7Q B;  5BO4 B;  3M63 B;  3DBL I;  2PJH A;  1WXV A;  2V3S A;  2L0T A;  5DCN A;  1WMH A;  2JZZ A;  2MBQ A;  1IP9 A;  3APD A;  3DCG A;  1K8R B;  4GOC A;  3WAN A;  4JGH B;  4EZK A;  2ZVO A;  2ZZP B;  3NS8 A;  3RUI B;  3QQ8 B;  2GBN A;  2K39 A;  3A1Q B;  2N1V A;  1V9J A;  1WZ3 A;  3UIP B;  3UIN B;  2O2V B;  3LJ3 A;  4W9L A;  2GOW A;  5CHF A;  2W9N A;  2AL3 A;  3AI5 A;  4HDO A;  2WX0 A;  2LRW A;  3RYT A;  2ASQ A;  2C9W B;  2KTR B;  4KZ0 A;  5E6N A;  2K8C A;  3VHT C;  3ZDM C;  2O6V D;  2OOB B;  2I1K A;  3ZW3 A;  4EKU A;  1WIA A;  1Q5W B;  4FJV B;  3VH4 B;  3N3K B;  4TKN A;  1GC7 A;  4MEL A;  1A5R A;  1H4R A;  3DVG Y;  4ICV A;  3L08 A;  2EKE C;  2REX A;  3UQA A;  1GJZ A;  1P98 A;  3VDZ A;  2GBR A;  3W1Y A;  1TTN A;  4I6L B;  2C7H A;  4FLH A;  3EC8 A;  4CHK A;  4JL9 A;  3IBE A;  4KVG B;  3VFK A;  3NZS A;  2JF5 A;  2Z0E B;  2LWP A;  4W9H A;  1GUA B;  2FCN A;  4GN1 A;  2KAN A;  1LQB A;  3WIM A;  3KUZ A;  1RRB A;  4EUT A;  1P0R A;  1VD2 A;  4FUL A;  3I3T B;  4W9F A;  3ZNG C;  4TQ1 A;  1GC6 A;  3DVG X;  3W1S C;  3Q3J A;  2BKR B;  3NOB A;  2KVR A;  3DDC B;  5KHQ A;  4KDI C;  3ZNZ B;  2LI5 A;  3EFU A;  4I6N B;  2HD5 B;  2KLC A;  2KC1 A;  3NHE B;  2KHW B;  2MLB A;  2XK5 B;  2RSU A;  3LDZ E;  4X57 B;  4ZRI A;  2FID A;  2D11 A;  4BOS C;  1UBI A;  3UQB A;  5LXI B;  2BYV E;  1XQQ A;  1Q1O A;  2MP2 B;  4FAD A;  2NPT A;  3PRM B;  1TBE A;  2Z59 B;  4HLE A;  1IYF A;  2JVC A;  1WX7 A;  2LVQ A;  2AYO B;  3NZU A;  2PEA A;  1ISN A;  2MQJ A;  3U7D A;  5CHV C;  5CHW A;  4E3C A;  5D94 A;  2MSE D;  4DDG D;  2DYB A;  2BPS A;  4IWQ A;  2K25 A;  2KK8 A;  5KHO A;  4B9K A;  1NBF C;  2BYE A;  1IPG A;  1V86 A;  1V5T A;  4LJO B;  4BBN C;  2KKC A;  1S3S G;  5G2N A;  2IYD B;  1WY8 A;  2DYO A;  4DK5 A;  4TV3 A;  1V49 A;  2R2O A;  5DPT A;  1Y8R C;  2OJR A;  3RCZ A;  2CS4 A;  3DBH I;  2DAJ A;  3M95 A;  4GMV A;  1V80 A;  1WF9 A;  2K8H A;  3W1S A;  2IZV B;  5AZG A;  2N7E A;  1H8C A;  2JUO A;  2Z0D B;  2IO3 B;  3OJ4 B;  2M0X A;  1WM2 A;  3IFW B;  2LVO A;  3JSV B;  2KWU B;  4IM3 A;  5CTR C;  4FBJ B;  5LLI A;  5JZE B;  4OVU A;  3VAW A;  4K7U A;  3PTF C;  4B6W A;  1YIW A;  2IY0 B;  1ZW7 A;  2IBI B;  4DBG A;  3VUX A;  4MSM B;  2WX1 A;  1J8C A;  3JYU A;  3B1L X;  2BKF A;  2DZI A;  4DHJ D;  3L10 B;  2CHX A;  3ZDT A;  2RPQ A;  2KOX A;  2PPH A;  5J17 A;  3RZW C;  2R2Q A;  4ANX A;  3V62 A;  1SIF A;  3DOW A;  3KUD B;  1WGR A;  1E5W A;  3ML8 A;  2L7R A;  4G50 A;  4WJO A;  3TIX A;  4HJK A;  3QAR A;  5DPW A;  3V61 A;  4W9E A;  4ANW A;  1FXT B;  1ZGU B;  2AEH A;  4A20 A;  4HK2 A;  1J19 A;  2KMC A;  2VRR B;  3A9J A;  2M1M A;  3PHX B;  2C60 A;  1LXD A;  5D2M B;  1V5O A;  4BBN F;  3K9P B;  3U30 A;  3ZO5 B;  4GDL A;  4CO7 A;  3M62 B;  2L8J A;  4NAW A;  4JLC A;  2J0M A;  1I35 A;  4ZYN A;  2ZCC A;  1P1A A;  2KD0 A;  3VQI A;  3QA8 A;  1D3Z A;  2RGF A;  3T8M A;  2L3Z A;  3CST A;  4PS3 A;  4EEW A;  2N7D A;  4FJY A;  3MTN B;  2MW5 A;  2AWT A;  3APC A;  1Z5S B;  4KSK C;  1OQY A;  4W9I A;  2G45 B;  3EHV A;  4FA6 A;  5L83 A;  2HE7 A;  4DDI D;  2G4S A;  1SGH A;  2D3G A;  3R7R A;  4BVU C;  2FCS A;  3CF6 E;  4KDL B;  2BWF A;  2KFK A;  3QIJ A;  3QX1 A;  2D10 A;  2JY6 A;  3DBS A;  1P9D U;  3VVW B;  1UGM A;  3S2A A;  3SDL C;  4ANV A;  4DHZ E;  3QC8 B;  4WJN A;  3PLU A;  3V6C B;  4WJP A;  3TJP A;  2KZR A;  1TGZ B;  5FR6 A;  2KLG A;  4HWI B;  4PS7 A;  4I6P A;  3C0R B;  2FCM A;  3L16 A;  1YQB A;  3ZIM A;  2DYM A;  2LVP A;  2NBW B;  4ICU A;  1U4A A;  2M4N A;  2DAF A;  1GG3 A;  2KJH B;  4DHJ B;  4FJZ A;  1VCB A;  1WX8 A;  2KXJ A;  1NI2 A;  1E8X A;  1L7Y A;  4NJ6 A;  2UWQ A;  4RM8 A;  4XZ4 A;  4DWF A;  2KQ7 A;  5C1Z A;  5IAA C;  4KZC A;  2LZ6 A;  3H7S A;  4LDT D;  2KQS A;  4K7W A;  3WA0 A;  2CKH B;  4M0W B;  4AWJ A;  1F9J A;  4LJP B;  2KN5 A;  4NQK E;  1YD8 U;  3PPA A;  2Y5B B;  3PS6 A;  4F1S A;  1X1M A;  3O65 B;  4II2 B;  3ZNH B;  3ZRF A;  3X23 A;  2MCN B;  2NPT B;  3KYC D;  2KTR A;  3ALB A;  4M8M A;  2IO1 B;  4N9F 4;  4K1R B;  4NJ7 A;  5D6J B;  2LAS A;  3KYD D;  3APF A;  1WE7 A;  5E6O A;  3BIN A;  3HIZ A;  2FCQ A;  1EO6 A;  2NVU I;  1V6E A;  2M17 A;  3TMP B;  4BKG A;  3AU4 A;  1TZ1 A;  1WYW B;  2XEW A;  2WWZ A;  2A5U A;  4GU2 A;  2CHW A;  2LGX A;  4GDK A;  4IM0 A;  1WGG A;  4KIK A;  4YL8 A;  4BKS A;  3U8Z A;  2ZEQ A;  2KNB A;  2L0F A;  2LUE A;  2MRP A;  4G11 A;  4MGZ E;  4E74 A;  3CMM B;  2J0K A;  2MWS B;  4K7S A;  4PS8 A;  2LJ5 A;  4FHJ A;  3A4R A;  5AZH A;  2QHO A;  4ZDV A;  1GNU A;  2DX5 B;  2ZJD A;  2XBB C;  4IG7 B;  1UEL A;  3AU5 A;  4DXA B;  3VTV A;  4WQO B;  3ZLZ A;  1RLF A;  2GBJ A;  4IUM B;  3L13 A;  3IVF A;  1UH6 A;  4MGI E;  2L76 A;  4KSL C;  3ZVV A;  4J6I A;  4II3 B;  4W9J A;  4WJQ A;  5EDS A;  2RD0 A;  4EZL A;  2KX3 A;  3WAM A;  3ZTC A;  2N4F A;  2MP2 A;  3H7P A;  4PYZ A;  1KLV A;  4CYE A;  5GMV A;  3AXC A;  3HM6 X;  3TCA A;  4LDT B;  4HDQ A;  4XX5 A;  4NQL B;  1KOT A;  5L95 C;  5E6P A;  3JW0 X;  3OAW A;  1RAX A;  3VXW A;  2J0J A;  3DVN V;  2I1J A;  3MJW A;  2EMT A;  3ML9 A;  5DPR A;  3P2B A;  3NY5 A;  2YLM A;  5C23 A;  2DHZ A;  4E71 A;  3AUL A;  2N9X A;  3A9J B;  1QZE A;  2O6V A;  3HK0 A;  4F7Z A;  2DZM A;  2GMI C;  4GDL B;  4MDK E;  4NAW B;  1Q0W B;  1JRU A;  3DBR I;  2ZNV B;  2V1Y A;  3PRZ A;  1WR1 A;  5HKH A;  4W9C A;  1ZKH A;  2WYQ A;  2K6Q A;  2PE9 A;  2LRU A;  3HHM A;  4AOF A;  5CX3 A;  2C5L C;  1WMH B;  3DPD A;  2FUH B;  3N32 A;  3N30 A;  4FHK A;  4PYU A;  2CU1 A;  3JSV A;  3A33 B;  2V4L A;  4HPM B;  3ENE A;  2CHZ A;  4MJS A;  3IHP C;  2KDE B;  2KFK B;  4OVV A;  1WXM A;  1Z2M A;  3A4S C;  5G55 A;  3V6E B;  1NDD A;  2FNJ B;  3WAO A;  1SE9 A;  1EUV B;  2KMA A;  3PHW B;  3VUY A;  2MBB B;  2DZK A;  4BKT A;  4GIV A;  2D07 B;  1PQS A;  2JPH A;  1C3T A;  3UGB B;  3L54 A;  4M8N A;  1I42 A;  3ZNI D;  3RD2 A;  1RFA A;  3QWZ B;  1WJN A;  5JH5 C;  3QHT A;  4BFR A;  1EF5 A;  3QCA A;  1UD7 A;  2KJR A;  1XD3 B;  1E7U A;  2PE6 B;  2LD9 A;  3H1U A;  4P7I A;  4EZJ A;  5J18 A;  3UF8 A;  4F8C B;  1WZ0 A;  1WJU A;  2N1W A;  4JIO U;  2MBO A;  3IG3 A;  1HE8 A;  3BY4 B;  4IW0 A;  2MA9 B;  3ECI A;  2LGD A;  3A9K A;  2RR9 A;  4WWP A;  1EF1 A;  1KJT A;  5JHB A;  2DEN B;  4GSW A;  4HPL B;  4JQW C;  4G0N B;  4NPN A;  1YX5 B;  1V2Y A;  3R3M A;  3PV1 A;  3PT2 B;  2MX2 A;  4URK A;  2HTH A;  1P3Q U;  1WJ6 A;  4K81 A;  2N9E B;  3CSF A;  2K6D B;  1YJ1 A;  2JT4 B;  4FN2 A;  3A1Q A;  1WGH A;  2KX0 A;  4RM9 A;  5LXH A;  1L2N A;  3PRE A;  3VTU A;  2KDB A;  4TUU A;  1WX9 A;  2G3Q B;  2O2V A;  3UIO B;  3ZKJ C;  1KM7 A;  3B0A A;  3K9O B;  3PGE A;  3DVN U;  1WFY A;  1J0G A;  3SD5 A;  1S1Q B;  1YX6 B;  2BYF A;  4XC2 A;  3PRP B;  2KWC A;  1UZX B;  2MBE A;  5J2R A;  1T0Y A;  1AAR A;  4GDK B;  4MGK E;  3SHQ A;  4KIK B;  4W9G A;  3MHS D;  3ZRC A;  3X0W A;  3GZN I;  3OLM D;  3RZF A;  3ONS A;  3VUW A;  2JXX A;  1WGD A;  2GBM A;  3GOE A;  2NCN A;  4A3P A;  2G4D B;  1OTR B;  3WAL A;  3H9D A;  2GBK A;  2ZPN A;  3L0W B;  5AEK B;  1CMX B;  2JRH A;  3TL5 A;  2L05 A;  2MBH A;  1E8W A;  3ZUN A;  4MSQ B;  2C7N B;  2CR5 A;  3V60 A;  3VTW A;  2JRI B;  2A4Z A;  1E8Y A;  4WWN A;  2B3A A;  2ZPY A;  4MH0 E;  1MG8 A;  3JVZ X;  1WXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...