2MSED

Nmr data-driven model of gtpase kras-gnp:arafrbd complex tethered to a lipid-bilayer nanodisc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Apolipoprotein A-I
publication title Oncogenic and RASopathy-associated K-RAS mutations relieve membrane-dependent occlusion of the effector-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 14
structure length 73
sequence length 73
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mseD01
3KH0A 4LJOB 3WA0A 4GOCA 3GOEA 1J19A 4MGKE 2KQ7A 3QHTA 2D3GA 3PGEA 5TR5A 4B6WA 3H9DA 3RZFA 4BKGA 4G50A 5IA7A 4IM0A 3PPAA 2C9WB 4W9HA 3DBSA 1Q0WB 2ZVNA 3PSEB 2G4SA 4ZDVA 4B9KA 3VDZA 4W9KA 5AZGA 1E8ZA 2PE6B 3ZDMC 2K1FA 4IUMB 4LJPB 2RGFA 4EEWA 1T0YA 3VTWA 1V2YA 2KDFB 2N4FA 4W9GA 4PS8A 3AU5A 2JY6A 4GXBA 3TIXA 4ANXA 2O2VA 1BT0A 4HXDA 4DWFA 4W9FA 2J0MA 1WH3A 3OJ3A 4NNJB 3VAWA 1V81A 4BBNC 3L08A 4ZYNA 4BKTA 1KJTA 1C1YB 1S3SG 1G6JA 2BWES 3SD5A 2IO1B 3TCAA 1I35A 1UELA 2D10A 3OAWA 5DPSA 3ZTDA 3VHTC 4TUUA 2JUOA 2N1WA 3A33B 1WZ0A 2KX3A 4G11A 2V3SA 3ZNHB 4HDQA 4JLCA 5JHBA 3JYUA 2DHZA 1TBEA 3MHSD 3QC8B 5E6OA 3UIOB 4HPLB 4K7SA 3KVFB 4NJ6A 2D2QA 3VTUA 4W9EA 2GBMA 2ZEQA 4IWPA 1WXAA 2M0XA 2LVOA 2FCSA 2KHWB 4ICUA 3X0WA 3A4SC 2OOBB 3ZLZA 2LI5A 4IM2A 1D3ZA 1X1MA 3RT3B 5LLIA 1WXSA 2EMTA 2ZNVB 3Q3JA 3VH4B 3ZRFA 3AXCA 2DYOA 5KHOA 3ZNZB 1WE6A 2Z0DB 3JSVB 3A1QA 4HCNB 4BOSC 4DHJB 4XC2A 1Z5SB 2MA9B 2Z0EB 2MBOA 3B08A 2BGFA 3B0AA 3ALBA 2K6QA 1ZKHA 3PREA 2FUHB 2KFKB 4NAWA 1WM2A 2O6VA 2MWSB 1AARA 2NR2A 3IFWB 2C5LC 4TQ1A 3TJPA 3HIZA 3L0WB 2MBEA 1NI2A 2C7MB 2L7RA 2M17A 3QARA 4MH0E 1S1QB 2LRWA 4CHKA 4JIOU 4KSLC 1V80A 1WE7A 1WM3A 1PQSA 2KD0A 3EECA 3EHVA 4BVUC 4DK5A 5J18A 4II3B 4KIKA 2A4ZA 2KDIA 4JL9A 3ZUNA 1WR6E 2KWUB 5CTRC 3L17A 2MP2B 3D32A 5AZHA 3WANA 3NHEB 3VXWA 4F7ZA 3DBHI 3PT2B 3ZVVA 1IYFA 1UBIA 2HE7A 3V62A 4F1SA 4FHJA 5CHWA 3H7PA 3APDA 4HPMB 4II2B 3I3TB 1WF9A 4FLHA 4OVUA 3WAPA 2RSUA 2NBWB 2NPTB 4NQKE 3UQAA 2J0JA 4FULA 3DBLI 2BWFA 4IWQA 2LGYA 3P2BA 1EO6A 3M95A 2N7DA 3UIPB 4EZKA 4A20A 1V5OA 2KC2A 4KDIC 1EF5A 5HKHA 1WJUA 5DPTA 3VUXA 1WGHA 3AULA 1KM7A 2EKEC 5EDSA 2I1JA 5G55A 2LRUA 2J0KA 2LGDA 4MEMA 3PV1A 2KJ6A 1ZGUB 4HDOA 4WJQA 1TGZB 2NS5A 5CX3A 1SIFA 2FCNA 2ZCCA 1LFDA 4LDTD 3ZNGC 1WX8A 3A9KB 3KW5B 4G3XB 1MG8A 2DZJA 1ISNA 2REXA 3PHXB 4BOZB 1P1AA 3ZW3A 3N30A 3PS6A 3T9LA 5LXHA 2KWCA 3NOBA 3VTVA 4DDID 2LUEA 4PS3A 2R2OA 4XZ4A 5GMVA 1GG3A 1WI0A 2BYVE 3KUZA 2YLMA 1YD8U 3A9JB 1NDDA 2DX5B 1V49A 4M8MA 3RYTA 3VUYA 1EUVB 2CR5A 2CHXA 3BY4B 4BKSD 2B3AA 3W1SA 2IO0B 2WX1A 1P3QU 1GUAB 4HVBA 1HE8A 2ASQA 2BYEA 2V1YA 3N32A 3H7SA 3QA8A 4URKA 4J6IA 4AOFA 4MDKE 1JRUA 5JZEB 2BF8B 2Z59B 1Z2MA 3NZUA 1H8CA 1UGMA 2BKRB 2NVUI 2ZJDA 2JPHA 4GDKB 2FAZA 4FBJB 1KLVA 4AUQC 4PS7A 2C60A 2KOXA 5E6NA 1OEYJ 3IHPC 3QAQA 2KTFA 5D94A 3BINA 3V60A 2D07B 3PTFC 4DBGA 3SDLC 4IW0A 2L05A 2FCQA 2R2QA 2JWZA 4AP4C 4N9F4 4WWOA 1YX5B 4I6NB 4M8NA 4KSKC 3LDZE 4YL8A 4W9CA 2NCNA 1XD3B 4G0NB 2MQJA 5AEKB 2D11A 4AWJA 4EOYA 2A5UA 1OEYA 4F8CB 2LGXA 3O65B 1YX6B 4K1RB 2JZZA 4HCPB 1E7VA 4HWIB 3RCZA 3JSVA 2IBIB 1GJZA 3ZTCA 2VRRB 4IG7B 4HLEA 3PZDA 1XQQA 2RR9A 2ZPYA 1LQBA 1OQYA 4LDTB 4MSQB 5CHVC 3U30A 2K39A 4W9LA 1UZXB 2N9EB 3PLUA 2IO3B 1WJ4A 1UH6A 2KFKA 4MGYE 3X23A 4K7UA 1I42A 2DZIA 2LZ6A 2PPHA 4IWOA 3L13A 3ZDTA 2G45B 4NPNA 4RMAA 2CKHB 2LWPA 3UINB 2G4DB 2JF5A 1WMHB 2KMCA 1YJ1A 3Q3FA 4TV3A 5G2NA 2FIDA 1CMXB 2DAJA 5J2RA 5JH5C 3R66C 2Y5BB 4KVGB 1Q5WB 2AL3A 5E6PA 1U4AA 3UGBB 2KQSA 3JW0X 1OGWA 4WJPA 1VCBA 3CSFA 3DVNV 2MP2A 4NY0A 1V9JA 4GDLB 2DZMA 4B95A 4WWNA 2MBQA 4PYUA 4WQOB 3VH3B 1WXMA 1NBFC 5L83A 2XK5B 2AEHA 4I6LB 2IO2B 1KOTA 4JQWC 2L3ZA 4EZLA 4RM9A 3PVLA 2DYBA 2NPTA 1OTRB 1WX7A 1WX9A 2K25A 3NY5A 3U7DA 3DQVA 2IZVB 3L16A 3DVNU 1IP9A 2J7QB 2LJ5A 3M63B 2IY0B 2PJHA 2GMIC 2V4LA 4AJYB 1YQBA 1Q1OA 2KX0A 2MBHA 3HK0A 2WDTB 4GSWA 1J0GA 1GC7A 3WIMA 3A4RA 3KUDB 3HM3A 2HD5B 3PRPB 4X57B 4A3OA 4FJYA 3H6NA 2ZCBA 4W9DA 4ANWA 4ICVA 4W9IA 4CYEA 5LXIB 3QIJA 4FADA 2I1KA 2C7NB 1IPGA 5IAAC 2JVCA 3A9KA 2KTRB 1VD2A 3W1YA 2KANA 3RUIB 3KUCB 4E3CA 4RM8A 4MGIE 2OJRA 1GC6A 5FR6A 3W1SC 4FJZA 5JHAA 4K81A 3T8MA 5C23A 2KLGA 4FN2A 1RAXA 2LXCA 2WX0A 3OLMD 2FCMA 3DBRI 1V6EA 4A3PA 2M4NA 3ZNID 2LVPA 1WGDA 3QJZA 3APCA 4LCDE 4MJSB 3DPDA 4AJWA 2L0TA 3A9JA 3QCAA 3L10B 3OJ4B 4DHZE 1WGRA 2KWVB 3EC8A 1WR1A 2KJRA 2W9NA 1RFAA 2M1MA 2KC1A 2JT4B 3PRMB 1E7UA 4BBNF 4EZJA 3GZNI 1XT9B 4BFRA 2DENB 3H1UA 2WYQA 2LVQA 3ZIMA 5BO4B 5KHQA 5L95C 3AU4A 3KYDD 3TL5A 3ML8A 4KDLB 4GB9A 1UD7A 1WY8A 1EF1A 1YIWA 5D6JB 4ZRKA 1F9JA 2MSED 2BPSA 2LASA 1E90A 1WXVA 1WRDB 2UYZB 2WWZA 1GNUA 2JXXA 4MM3A 3V6EB 4ANUA 2O6VD 2EMSA 2KK8A 3R3MA 4GDKA 4HJKA 2ZNVC 3M3JA 3M62B 3ML9A 4MSMB 2ZVOA 5CHFA 4MELA 1P0RA 2HTHA 3VQIA 3N3KB 3WAMA 5DPWA 3RZWC 2PEAA 2BYFA 2XBBC 3LJ3A 2L76A 3ONSA 3IBEA 2DZKA 3DVGX 5D2MB 4IC7B 2L00B 1M94A 2IYDB 1E5WA 1TZ1A 2K6DB 2N7EA 3VVWB 2KN5A 4OVVA 2KJHB 2O2VB 1R4NI 1E8XA 4WJNA 4ZRJA 1SE9A 2L0FA 3B1LX 3HM6X 4FJVB 3R7QA 3S2AA 4EKUA 2DAFA 3VFKA 4P7IA 4DHZB 3ENEA 3ZKJC 3JVZX 2GBJA 2MCNB 4M0WB 3WAOA 3V61A 3UF8A 3AI5A 1WFYA 4EFOA 1WGGA 1H4RA 1WMHA 2KO3A 1J8CA 4FA6A 3DCGA 5D7GA 2NBVB 2KFJA 2NBUA 5DPRA 4HK2A 1QZEA 2KDBA 2KXJA 2G3QB 2UWQA 3IVFA 3QQ8B 4WWPA 1L7YA 5J17A 1WJNA 1A5RA 1L2NA 2AL6A 3TBLD 4XX5A 3CMMB 2MLBA 3SU8X 1FXTB 1LXDA 2HJ8A 4GU2A 1ZW7A 4IM3A 4GDLA 4BKSA 1C3TA 2CHWA 2KVRA 5C1ZA 1V5TA 3MJWA 4KZ0A 3UQBA 2IY1B 4WAAA 2BKFA 2XK5A 4GN1A 4KV2A 4NJ7A 4EUTA 3U8ZA 3TMPB 4E74A 4GIVA 2FNJB 3A1QB 3QX1A 4ZRIA 3V6CB 3R7RA 2CU1A 2KLCA 1R4MI 2GOWA 2JZ3B 2PE9A 3PLVA 2MW5A 4K7WA 4GGQA 4ASWC 3EFUA 3PHWB 3ECIA 3QK0A 1P98A 3L54A 4NAWB 1TTNA 1V86A 2O6VB 2QHOA 4WJOA 2LD9A 2KMAA 2N9PC 2K8BA 5DCNA 2AYOB 2KKCA 4PYZA 4JGHB 1SGHA 1WZ3A 5AZFA 1WIAA 3IG3A 3KYCD 2L8JA 2KDEB 3NZSA 4KIKB 4W9JA 4ANVA 1UBQA 2N9XA 2KTRA 3SHQA 2ZPNA 1WGYA 1LM8B 3ZRCA 2FIFA 2K8HA 2KNBA 3CSTA 1WYWB 2YVCA 2DYMA 3MTNB 2XEWA 2RD0A 3RULA 4TQ0A 2LXAA 1WJ6A 3H7PB 2KZRA 3HHMA 2N1VA 4FHKA 3DDCB 3APFA 3DOWA 2M8SA 4MJSA 2JRHA 2GBKA 2GBNA 2AWTA 2CHZA 4NQLB 1P9DU 2GBRA 2RPQA 2CS4A 2MX2A 3CF6E 1K8RB 4KZCA 1E8YA 1RRBA 3WALA 3ZO5B 3QWZB 1E8WA 3K9OB 2MBBB 4CO7A 4DDGD 4TKNA 4DXAB 4E71A 3VUWA 2C7HA 2ZZPB 2JRIB 1Y8RC 3C0RB 4DHJD 3DVGY 4I6PA 3RD2A 1RLFA 2K8CA 3K9PB 3PRZA 2MRPA 4MGZE 3NS8A 4GMVA
chains in the Genus database with same CATH superfamily
3WA0A 5TR5A 1HTQA 5IA7A 4IM0A 4W9HA 1Q0WB 3I9V1 4KGTA 3VDZA 4W9KA 1T5XD 2WXKA 2RGFA 4EEWA 1WGKA 3DBRB 2N4FA 3AU5A 2JY6A 1E7PB 1SSNA 1HEZE 3OJ3A 4NNJB 4BBNC 4KGSA 2WGSA 1S3SG 2BWES 1UELA 4TUUA 3A33B 2M56B 4FXCA 1SF0A 4HDQA 2DHZA 4K7SA 2D2QA 2GBMA 3C19A 2FCSA 3AE5B 1QOAA 3DHIC 3ZRFA 2Z0DB 1CK1A 2Z0EB 1TKYA 2BGFA 3B0AA 1GPXA 2INPE 1L0XB 3PREA 4NAWA 2MWSB 3IFWB 2C5LC 4TQ1A 3HIZA 3L0WB 4CQNA 2MBEA 4L23A 2BS4B 3QARA 4MH0E 1S1QB 4XGAB 3MFGA 4BVUC 2KDIA 2N9KA 4YSZB 2JWUA 1YQ4B 2MP2B 2ICIA 3PT2B 3ZVVA 1IYFA 4F1SA 2QCZA 1I7HA 1TYGB 3OG5A 2J0JA 4FULA 1ESFA 3P2BA 1XCTL 5T8IA 4C56C 2KC2A 3VUXA 3MHZA 3AULA 1KM7A 1V97A 2EKEC 2GLSA 4DXGA 2KJ6A 2DWQA 4AQ7A 1FIQA 2ONQA 5CX3A 2DBYA 2FCNA 4LDTD 3A9KB 3KW5B 3ZJUA 3PZ7A 1MG8A 3ZW3A 5FR3A 2PIAA 3HVZA 3Q8AA 3T9LA 1JWSD 3VTVA 4DDID 4XZ4A 1UNSA 1UUPA 1YD8U 1IGCA 3AE8B 4AS1A 2CHXA 1AN8A 1J7AA 1GUAB 4HVBA 2ASQA 3N32A 1QT9A 1XXGA 1D5MC 4AOFA 4MDKE 2WXRA 3DHHC 1Z2MA 3NS1A 3NZUA 3C8YA 5HG2A 2BKRB 4PK1A 1F77A 4PS7A 2C60A 2UU7A 1OEYJ 2D3BA 3N1YC 3BINA 4IW0A 2L05A 3B2FA 3PZ8A 4N9F4 2OEDA 2K9XA 1E0ZA 1SIJA 4WQMA 4M8NA 4KSKC 4RCOA 1YJIA 1FRDA 4OZCA 4HCPB 3W5VB 1E7VA 4HWIB 3RCZA 2IBIB 3RNGC 4A90A 4IG7B 2RR9A 3U30A 2WXQA 3X23A 2IO3B 4C80A 1UH6A 2KFKA 1AW7A 1V8CA 2PPHA 4IWOA 2BT6A 2G45B 2WXPA 4RMAA 2CKHB 4C7YA 2LWPA 5D3IB 3UINB 2G4DB 2BYTA 4HEA1 2V3PA 2DAJA 4TMAB 2AL3A 1U4AA 1I4PA 1OGWA 3CSFA 1EWCA 2J4XA 2XK5B 2AQ2B 2IO2B 1C78A 1KOTA 3L4PA 3L16A 1VZ8A 3M63B 1QOBA 2GMIC 3E56A 4AJYB 1Q1OA 2D5GA 2MBHA 3V3XA 3WIMA 2KWDA 2OJWA 3GS2A 3BIID 5EE1A 2ZCBA 2JZPA 4LTUA 4ANWA 4CYEA 1PGAA 1IPGA 1DOYA 1PGBA 3KUCB 2Y5PA 3RNAC 3W1SC 3T8MA 2KLGA 4FN2A 2J52A 4A3PA 1WGDA 2XN9C 2L0TA 4WH4A 2Y3AA 2BBCA 1ZE3D 1ZDXA 2W9NA 4EZJA 2M1MA 2KC1A 4BBNF 3GZNI 4BFRA 1V1OA 2LVQA 4WWMA 5KHQA 3Q2AC 1T3QA 3ML8A 4GB9A 2LUMA 3AE1B 5D6JB 4ZRKA 3NZ3A 2RPVA 2LASA 1VR9A 2O6VD 2EMSA 2KK8A 3R3MA 5BYRA 2HJ1A 1YN4A 2W3RA 2HTHA 3N3KB 3AE3B 2PEAA 2PKOA 1C4PA 4RH6A 2ON8A 5D2MB 4IC7B 2L00B 1M94A 2KN5A 4OVVA 4WJNA 4M01A 4FJVB 2W3SA 1N61A 3R7QA 3S2AA 1T0SC 2DAFA 3R2IA 3VFKA 4ITKA 3ENEA 4M0WB 1ZPSA 3UF8A 2QJLA 3AI5A 2WLBA 1WFYA 4EFOA 5C2TB 1WMHA 3DCGA 5D7GA 2NBVB 2NBUA 4UDUC 2UWQA 2G3QB 3QQ8B 4WWPA 1L7YA 5J17A 1WJNA 1A5RA 2MH7A 1LXDA 1ZW7A 2LFIA 1C3TA 5C1ZA 2KVRA 3TEWA 3MJWA 3LYYA 4GN1A 4NJ7A 4GIVA 2YEPF 3A1QB 3V6CB 2CU1A 2JZ3B 2PE9A 2MW5A 3EFUA 1L0YB 3QK0A 2QHOA 1V86A 2LD9A 2K8BA 4ZYSA 4ZRPA 2VZKB 3BVZA 1WIAA 3TEZA 3GE8C 2L8JA 5IP4D 2K0PA 1E9MA 4MH8A 1WGYA 2CJNA 1WYWB 1P7EA 3MTNB 2KVZA 2NMQA 4QAYA 2KZRA 1JW9D 2M8SA 1OQRA 2GBKA 1P9DU 2RPQA 4KZCA 2CS4A 1JQ4A 3ZO5B 1ET6A 4DXAB 2WDQB 3U7ZA 1Y8RC 3PRZA 2JSVX 3B9JA 1N5XA 3NZSA 5EE3A 3KH0A 4LJOB 2LHDA 3VRBB 1XLNA 4Q2JA 4GOCA 3GOEA 2KQ7A 5C3JB 3PGEA 1SE3A 1IUEA 2QILA 3DBSA 4ZDVA 4B9KA 2PE6B 3ZDMC 1TS5A 1UGJA 1V2YA 5H92C 4J3OD 4W9GA 3TIXA 2O2VA 2MHJA 3ZJTA 2J0MA 1WH3A 1AWDA 2PVGC 3HUIA 3Q69A 2IO1B 3TCAA 4P1CC 2D10A 3GZNB 3OAWA 3VHTC 2N1WA 4US9A 3MC0B 4NZLB 2V3SA 3ZNHB 1N6ZA 3IT6B 3JYUA 5E6OA 3VTUA 4BAXA 3IXSA 2M0XA 3ZXVA 4ICUA 4A55A 2JYTA 2LI5A 5LLIA 2DYOA 4HKZE 2INDC 3NG0A 4BOSC 4DHJB 4XC2A 3P1MA 2MA9B 2MBOA 1NI3A 1V1PA 1VZ6A 2E6XA 4ARCA 3P4SB 4OW0A 2L1AA 1OQQA 3AEBB 1N60A 1FMAD 2C7MB 2L7RA 4JIOU 4A9AA 1PQSA 1Q10A 4DK5A 1N5WA 4II3B 4JL9A 1SE2A 1WR6E 5CTRC 2B76B 2I38A 3D32A 4F7ZA 3VXWA 3ZQ4A 1UBIA 3V62A 4FHJA 3H7PA 3I3TB 4KKJA 2LGSA 3WAPA 2RSUA 1DGJA 3VR9B 4NQKE 4OZAA 3BYYB 3DBLI 4IWQA 2N9LA 3Q8BA 3M95A 3DWMA 2X8XX 5HKHA 5DPTA 5G55A 2LGDA 3PV1A 3AE7B 1WYGA 1TGZB 1SIFA 2ZCCA 1ZDVA 3ZNGC 1WX8A 1I4RA 2DZJA 1ISNA 4RNAA 2REXA 3N1XC 1QLBB 2Y5CA 1PDXA 3PS6A 3DBHB 2FUG1 1GG3A 1WI0A 2WXFA 2BYVE 3Q6BA 3KUZA 3A9JB 1V49A 2PW9A 1EUVB 4BKSD 1F52A 3NVZA 3NUHB 1JWAD 2WX1A 3DHGC 2V1YA 2JX5A 1SEBD 4URKA 1UWXA 2BF8B 4K3CA 4BZAA 1UGMA 1TY2A 2NVUI 2ZJDA 2JPHA 4GDKB 1KLVA 2KOXA 5E6NA 1IBXB 2IGGA 2LMCA 1JALA 3KWVA 5D94A 4LK0M 3SDLC 1FFVA 2KT7A 4L1BA 4PT5A 1YX5B 4JE3B 5AEKB 2MQJA 2D11A 4AWJA 4EOYA 1OEYA 4F8CB 2HTME 1T0RC 3NRZA 2VRRB 2BVCA 3PZDA 4LNIA 4A6QA 2ZPYA 4LDTB 1OQYA 3BVMA 2I2YA 1D6EC 2N9EB 3P4PB 1WJ4A 3RMKC 1I42A 3L13A 3SFDB 1EU4A 4S0RA 3Q3FA 2FIDA 2LHEA 3R66C 1TZOA 4C7ZA 1L4ZB 3DVNV 2MP2A 1V9JA 2DZMA 2RDBC 2MBQA 4HJGE 3VH3B 1WXMA 1NBFC 3Q14C 1F2RI 3R8BA 2L3ZA 4EZLA 4EE2A 1OTRB 1WX9A 3DQVA 3DVNU 3AE9B 2LJ5A 2PJHA 3RNEC 2WDTB 1GC7A 3RI7C 1B1ZA 3HM3A 2WS3B 1RM6C 4FJYA 2AQ3B 4FADA 3A9KA 1VD2A 3W1YA 4E3CA 5FR6A 1RAXA 2LXCA 3FKYA 4XE0A 1SBBB 3ZNID 3QJZA 3U4EG 3QCAA 3OJ4B 3PRMB 4RGMA 4XDDA 1XT9B 2D3AA 3DBLB 1UD7A 4C00A 4P6VF 2UYZB 1K52A 2YEPB 3AMZA 3AECB 1ZXHA 5BMHA 2ZNVC 3M3JA 3M62B 2X38A 4MELA 1P0RA 3V05A 3WAMA 1WSPA 2L76A 3ONSA 2SEBD 3P42A 2DZKA 2NTTA 1A70A 4LNNA 1TZ1A 2N7EA 5IO9A 1AYFA 3CIRB 2L0FA 3B1LX 2RDHA 3HM6X 1VDVA 4EKUA 4R3DA 4P7IA 4DHZB 2BQQA 2GBJA 3LXFA 3WAOA 1XF5L 1WGGA 3W2DA 3Q3MC 1FEHA 2R61A 3AM9A 3IVFA 3EA6A 1L2NA 3TBLD 2W54A 3CMMB 3SU8X 1FXTB 2HJ8A 1WRIA 4B0MA 2CHWA 1V5TA 3RNCC 2XK5A 4KV2A 4EUTA 3U8ZA 1XCQL 3SEBA 4TSSA 2FNJB 3QX1A 2KLCA 2GOWA 3PLVA 3Q3NC 4ASWC 3ECIA 3L54A 2O6VB 2MJDA 2KMAA 3FAHA 5DCNA 5AZFA 1SB3C 3IG3A 3AEEB 4HROA 1PFDA 1FXIA 3NVVA 4KIKB 1EWYC 1UBQA 2N9XA 1EU3A 3SHQA 2ZPNA 2FIFA 2K8HA 2KNBA 2YVCA 2XEWA 5LNK1 4TQ0A 2LXAA 1ZXIA 4FHKA 3DDCB 4JX1C 1CJEA 1KLUD 2GBNA 2CHZA 1HQRD 1K8RB 1E8YA 1D5XC 4LNFA 2WHIA 2BB5A 1VZ7A 3VUWA 2MJEA 1JMLA 2JRIB 1RLFA 1HTOA 3K9PB 5GXGB 4MGZE 3NS8A 4GMVA 2QSDA 1NYQA 1J19A 4MGKE 3H9DA 4G50A 1SJED 3PSEB 3GB1A 1E8ZA 2K1FA 4LJPB 1YQ3B 2DNFA 1T0YA 2EELA 1XLOA 2KDFB 1UF0A 1HXYD 4GXBA 4ANXA 1QOFA 4HXDA 1ZUD2 4DWFA 4W9FA 3VAWA 1YN5A 1NENB 1C1YB 2WU2B 5DPSA 1YNTE 5D3DA 1WZ0A 2KX3A 4JLCA 3UIOB 4HPLB 4NJ6A 2ZEQA 2PTLA 5BMGA 1WXAA 2LVOA 2KHWB 3X0WA 3A4SC 2OOBB 1TS2A 2H88B 3RT3B 3Q3OC 1WXSA 4K3BA 3Q3JA 3VH4B 5I4DA 5KHOA 3ZNZB 1WE6A 3JSVB 3A1QA 4KGRA 1C4AA 1Z5SB 3ALBA 2KYWA 1IGDA 1OFFA 2K6QA 3BVGA 2FUHB 1C9FA 1WM2A 2NR2A 3W9CB 1FNUA 3TJPA 2RDGA 2KACA 4ARIA 2M17A 2WU5B 4CHKA 1WE7A 3LB8C 3AEFB 3EECA 3EHVA 2A4ZA 3VRAB 3ZUNA 3MC9A 2WXLA 1YN3A 3L17A 5IOIA 5AZHA 3NHEB 3DBHI 4LNKA 2HE7A 4HPMB 4FLHA 2ZW0A 2NPTB 3UQAA 3U2SC 1EO6A 4XWTA 3UIPB 1V5OA 1EF5A 3NVWA 1FCCC 2L32A 5EDSA 1ROEA 2I1JA 2J0KA 3WCQA 4HDOA 4WJQA 2W82A 2GB1A 4C4VB 3N9YC 3RN9C 1TKGA 5G5GA 1GAQB 4BOZB 3N30A 2LUEA 4PS3A 2R2OA 1L6UA 2YLMA 2DX5B 4M8MA 2CR5A 2WQYB 3BK2A 1P3QU 4OVZA 1GB1A 1JCKB 1GB4A 1VLBA 4J6IA 1HZ5A 4RF1A 1JRUA 4RFBA 4RF0A 2Z59B 2QIEB 1F1HA 3TEYA 4MM3B 2IJ0A 3AE6B 2V4IB 4YSYB 1FCLA 3W5UB 1MHXA 1UWMA 3PTFC 4DBGA 1XLQA 2QMTA 1VRAB 2R2QA 4RGOS 3TSSA 4YL8A 3T3NA 2A5UA 2LGXA 3O65B 1YX6B 4K1RB 2JZZA 1FNVA 2G1EA 1GJZA 1QKZA 5HHDG 2OHFA 1XQQA 1LQBA 5CHVC 3PLUA 1XO3A 4K7UA 2AX5A 3ZXRA 4NPNA 2KMCA 2LGIA 3KQ4A 1YJ1A 4TV3A 4S17A 1CMXB 1L0VB 2RMMA 2Y5BB 1NVID 1Q5WB 4N58A 1I4HA 2KQSA 4KX6B 1JWMD 4WJPA 2IPKD 2V0GA 4D2KA 4NY0A 4GDLB 4WWNA 4WQOB 3UI3A 5L83A 2JXTA 2AEHA 1RYJA 3MC8A 4JQWC 4RM9A 3U52E 2CJOA 1WX7A 2K25A 3NY5A 1MG4A 3U7DA 5AUKA 2IZVB 2J7QB 2INNE 2V4LA 2KX0A 4XYCA 3AN1A 3HK0A 1J0GA 5HI1A 3PRPB 3H6NA 4YTNB 4DQOC 3BYTB 4ICVA 4W9IA 1MFWA 3BK1A 3QIJA 2I1KA 1SE4A 2JVCA 2KTRB 3AEAB 2HDEA 2OJRA 1GC6A 3AV8A 5JHAA 4K81A 2WX0A 5IN7A 3OLMD 2FCMA 3ETRA 4JWUC 1V6EA 5E6JA 1HZ6A 2LVPA 1XLPA 4MJSB 4MACA 3EUB2 3A9JA 3L10B 3P4QB 3RPFC 4DHZE 2KWVB 1WR1A 3EFCA 3FILB 2V9HA 1STEA 2DENB 3H1UA 3ZIMA 5BO4B 3Q8FA 3TL5A 2M0AA 3HRDD 2K5PA 1EF1A 1YIWA 2IDYA 2BPSA 4OZBA 2WWZA 4ANUA 2JXXA 1HA5A 4GDKA 4HJKA 5BYQA 1IBXA 1MVKA 2INCC 3VQIA 5DPWA 2XBBC 3LJ3A 3HVDA 2KN4A 3IBEA 1CZPA 2L52A 4NAMA 1FD6A 2WXOA 5TSSA 2IYDB 1E5WA 2K6DB 3VVWB 1R4NI 1E8XA 2DLBA 2E3TA 1SE9A 4ZRJA 2IGDA 2BS2B 1VJKA 2WDRB 2MCNB 4ZHPA 1YMHE 1MJDA 1TS3A 4FA6A 1R7SA 2KFJA 5JXVA 4HK2A 1RFKA 1KRHA 1QZEA 4HRSA 4MT5A 1FPYA 2MLBA 4GU2A 4IM3A 4KKIA 5MPOA 3UQBA 2IY1B 4DXFA 4L2YA 3SFEB 3TMPB 4E74A 4ZRIA 1R4MI 3FC4A 4K7WA 2L83A 1I4GA 3J9CA 4NAWB 1TTNA 4WJOA 3BZDB 3Q8EA 3I57A 2J53A 4US8A 5HFYA 2WXHA 3AE4B 3IAS1 3EGRA 4ANVA 3P63A 1LM8B 3CSTA 2RD0A 3RULA 4OHJA 1WJ6A 3HHMA 1PGXA 3DOWA 3VR8B 4N6EB 1MHHE 2JRHA 2JYEA 1FM0D 4WURA 4NQLB 2GBRA 3CF6E 3E9SA 2BS3B 2G9HD 3QWZB 4DDGD 3K9OB 4TKNA 5EE9A 2WXMA 2C7HA 2ZZPB 3IAM1 3DVGY 4I6PA 4LNOA 1ENFA 4P1BC 3TEXA 4NJCA 3QHTA 1T0QC 2D3GA 3RFZB 4B6WA 3RZFA 4BKGA 3PPAA 2C9WB 1L6VA 3N1ZC 1T6BX 2ZVNA 2G4SA 1WXQA 5AZGA 4IUMB 3VTWA 2GI9A 4PS8A 1MPEA 1BT0A 4USAA 1QQRA 1V81A 3L08A 4ZYNA 4BKTA 1I4XA 1KJTA 1E6EB 1G6JA 3SD5A 1I35A 2TSSA 2M19A 2MJ3A 2JUOA 2LJIA 1SXTA 4G11A 5JHBA 1TBEA 3MHSD 3QC8B 2VH1A 1Y56A 3KVFB 4WAFA 4W9EA 3URYA 4IWPA 2BTEA 4ZRQA 1JROA 2WDVB 3ZLZA 4IM2A 1D3ZA 1X1MA 2EMTA 2ZNVB 3AEGB 3AXCA 4M02A 4HCNB 3O13A 3B08A 1ZOYB 4IKGA 2K3UA 3R2TA 1ZKHA 1R4NB 2KFKB 2O6VA 1B9RA 1AARA 1D5ZC 4JPSA 1NI2A 1KTKA 1C4CA 2LRWA 4KSLC 1V80A 1WM3A 1F2RC 2KD0A 5J18A 4KIKA 1QOGA 2KWUB 2K22A 2N7JA 2AQ1B 3WANA 2WXNA 5CHWA 4II2B 3APDA 1WF9A 4OVUA 5IKCM 2NBWB 2BWFA 2LGYA 2QDFA 2PVOD 2N7DA 1LGRA 4EZKA 4A20A 4B0EA 4KDIC 1R4MB 1WJUA 4YXDB 1WGHA 2WXJA 2LRUA 4MEMA 3ZJVA 1ZGUB 4ZOHC 2NS5A 5AUIA 1LFDA 2VH2A 4G3XB 2WXGA 2Q5WD 1N63A 1QILA 3PHXB 1P1AA 1FFUA 1JWBD 2H89B 5LXHA 2KWCA 1DOXA 3NOBA 1KH0A 2PLPA 5GMVA 1J7CA 3GP7A 1FO4A 1NDDA 4WIPA 3RYTA 3VUYA 2QEJC 4XDCA 3BY4B 2D3CA 2B3AA 1MI0A 3W1SA 2IO0B 3AB5A 2QC8A 3KWLA 1FXAA 3ZYYX 1BUIC 1HE8A 2BYEA 2BW2A 3H7SA 3QA8A 3TUOA 5JZEB 1H8CA 1P7FA 4RGNA 2FAZA 4FBJB 2KDMA 4M0WA 4AUQC 4GLSC 1DOIA 3IHPC 3QAQA 2KTFA 3V60A 2D07B 2W55A 2FCQA 3DWGC 2JWZA 4AP4C 4WWOA 1CQVA 2WP9B 4I6NB 3LDZE 4W9CA 2NCNA 1KLGD 1XD3B 4G0NB 3JSVA 3ZTCA 1TKEA 5EE0A 4HLEA 5G5HA 1L5PA 2GRIA 4MSQB 2K39A 4W9LA 1UZXB 3ZTDA 1YJJA 4MGYE 5BYSA 2KMMA 3RNFC 2DZIA 2LZ6A 1PYWD 3ZGZA 3ZDTA 1C77A 2JF5A 1WMHB 1KFYB 5G2NA 2NTSA 5J2RA 2KAJA 5JH5C 4KVGB 5E6PA 2ZW1A 3UGBB 1SJHD 3JW0X 3RNBC 1VCBA 1NYRA 1C79A 5BMIA 4JWSC 4B95A 4ZHOA 2WNMA 2SAKA 2MEKA 4PYUA 3MP9A 5FKAC 1EM7A 4I6LB 4N59A 4A8XC 4LLGM 1BMLC 3PVLA 1I4QA 2DYBA 2NPTA 3OWEB 2FBWB 3I5JC 1IP9A 2IY0B 1YQBA 2JU6X 4GSWA 3KLSX 3CWIA 3A4RA 2BB6A 3SR6A 3KUDB 1N62A 2HD5B 4X57B 4A3OA 4W9DA 4C4VA 5LXIB 2C7NB 5IAAC 2XNAC 2IGHA 2Z8LA 2KANA 3RUIB 4RM8A 4MGIE 4FJZA 3BWUD 5C23A 2KQ4X 3MJ5A 3NJTA 1TIFA 3DBRI 2CU3A 2M4NA 4O1NA 4YTMB 1TT5B 3APCA 4LCDE 4AJWA 3DPDA 1ACCA 2ACZB 1WGRA 3EC8A 1C76A 2KJRA 1RFAA 2JT4B 1E7UA 3AH7A 3GE3C 1ET9A 2WYQA 3IT4B 3P4RB 5L95C 3AU4A 3KYDD 2J42A 1D4BA 4KDLB 4HPPA 1WY8A 4RGTA 1F9JA 2MSED 1E90A 1WXVA 1WRDB 2V3NA 1GNUA 4MM3A 3V6EB 3AEDB 1L4DB 1PUTA 3AE2B 3ML9A 2ZVOA 4MSMB 5CHFA 2VZKD 3N20C 3RZWC 2BYFA 2WXIA 1YOVB 1TY0A 1BXTA 3DVGX 3ABVB 4YT0B 4P16A 4XWWA 2KJHB 2O2VB 4H2AA 1F0ZA 3Q8CA 3ZKJC 3JVZX 1K53A 3V61A 5FK9C 1H4RA 2KO3A 1TJEA 1J8CA 1NEKB 1DYQA 1K50A 5DPRA 2KDBA 2KXJA 3B2GA 2AL6A 4XX5A 4YWGG 4M00A 4YTPB 2PMVA 4BKSA 4GDLA 4KZ0A 4WAAA 2BKFA 3PO0A 4IDIA 4IOIE 5H8YE 4ACFA 3R7RA 4GGQA 3PHWB 1V1PB 1P98A 4YSXB 1WWTA 4REZA 2N9PC 1ZP0B 2AYOB 2KKCA 3H8HA 4PYZA 2EKIA 4JGHB 1SGHA 2FE8A 3NVYA 1JRPA 1J7BA 1WZ3A 2LEKA 3KYCD 2KDEB 4W9JA 1FNWA 2KTRA 3ZRCA 2DYMA 1QF6A 3T3OA 1JWUD 1LO5D 2N0SB 4HKQA 3H7PB 2JQRB 1M4VA 2N1VA 3APFA 4MJSA 1RWSA 3I63C 2AWTA 2MX2A 3FILA 1RRBA 3WALA 1E8WA 1K51A 2MBBB 4CO7A 1TS4A 4E71A 1E10A 1KF6B 1XEEA 3C0RB 4DHJD 3RD2A 2K8CA 1FRRA 1GOZA 2MRPA
chains in the Genus database with same CATH topology
3KH0A 4LJOB 3WA0A 4GOCA 3GOEA 1J19A 4MGKE 2KQ7A 3QHTA 2D3GA 3PGEA 5TR5A 4B6WA 3H9DA 3RZFA 4BKGA 4G50A 5IA7A 4IM0A 3PPAA 2C9WB 4W9HA 3DBSA 1Q0WB 2ZVNA 3PSEB 2G4SA 4ZDVA 4B9KA 3VDZA 4W9KA 5AZGA 1E8ZA 2PE6B 3ZDMC 2K1FA 4IUMB 4LJPB 2RGFA 4EEWA 1T0YA 3VTWA 1V2YA 2KDFB 2N4FA 4W9GA 4PS8A 3AU5A 2JY6A 4GXBA 3TIXA 4ANXA 2O2VA 1BT0A 4HXDA 4DWFA 4W9FA 2J0MA 1WH3A 3OJ3A 4NNJB 3VAWA 1V81A 4BBNC 3L08A 4ZYNA 4BKTA 1KJTA 1C1YB 1S3SG 1G6JA 2BWES 3SD5A 2IO1B 3TCAA 1I35A 1UELA 2D10A 3OAWA 5DPSA 3ZTDA 3VHTC 4TUUA 2JUOA 2N1WA 3A33B 1WZ0A 2KX3A 4G11A 2V3SA 3ZNHB 4HDQA 4JLCA 5JHBA 3JYUA 2DHZA 1TBEA 3MHSD 3QC8B 5E6OA 3UIOB 4HPLB 4K7SA 3KVFB 4NJ6A 2D2QA 3VTUA 4W9EA 2GBMA 2ZEQA 4IWPA 1WXAA 2M0XA 2LVOA 2FCSA 2KHWB 4ICUA 3X0WA 3A4SC 2OOBB 3ZLZA 2LI5A 4IM2A 1D3ZA 1X1MA 3RT3B 5LLIA 1WXSA 2EMTA 2ZNVB 3Q3JA 3VH4B 3ZRFA 3AXCA 2DYOA 5KHOA 3ZNZB 1WE6A 2Z0DB 3JSVB 3A1QA 4HCNB 4BOSC 4DHJB 4XC2A 1Z5SB 2MA9B 2Z0EB 2MBOA 3B08A 2BGFA 3B0AA 3ALBA 2K6QA 1ZKHA 3PREA 2FUHB 2KFKB 4NAWA 1WM2A 2O6VA 2MWSB 1AARA 2NR2A 3IFWB 2C5LC 4TQ1A 3TJPA 3HIZA 3L0WB 2MBEA 1NI2A 2C7MB 2L7RA 2M17A 3QARA 4MH0E 1S1QB 2LRWA 4CHKA 4JIOU 4KSLC 1V80A 1WE7A 1WM3A 1PQSA 2KD0A 3EECA 3EHVA 4BVUC 4DK5A 5J18A 4II3B 4KIKA 2A4ZA 2KDIA 4JL9A 3ZUNA 1WR6E 2KWUB 5CTRC 3L17A 2MP2B 3D32A 5AZHA 3WANA 3NHEB 3VXWA 4F7ZA 3DBHI 3PT2B 3ZVVA 1IYFA 1UBIA 2HE7A 3V62A 4F1SA 4FHJA 5CHWA 3H7PA 3APDA 4HPMB 4II2B 3I3TB 1WF9A 4FLHA 4OVUA 3WAPA 2RSUA 2NBWB 2NPTB 4NQKE 3UQAA 2J0JA 4FULA 3DBLI 2BWFA 4IWQA 2LGYA 3P2BA 1EO6A 3M95A 2N7DA 3UIPB 4EZKA 4A20A 1V5OA 2KC2A 4KDIC 1EF5A 5HKHA 1WJUA 5DPTA 3VUXA 1WGHA 3AULA 1KM7A 2EKEC 5EDSA 2I1JA 5G55A 2LRUA 2J0KA 2LGDA 4MEMA 3PV1A 2KJ6A 1ZGUB 4HDOA 4WJQA 1TGZB 2NS5A 5CX3A 1SIFA 2FCNA 2ZCCA 1LFDA 4LDTD 3ZNGC 1WX8A 3A9KB 3KW5B 4G3XB 1MG8A 2DZJA 1ISNA 2REXA 3PHXB 4BOZB 1P1AA 3ZW3A 3N30A 3PS6A 3T9LA 5LXHA 2KWCA 3NOBA 3VTVA 4DDID 2LUEA 4PS3A 2R2OA 4XZ4A 5GMVA 1GG3A 1WI0A 2BYVE 3KUZA 2YLMA 1YD8U 3A9JB 1NDDA 2DX5B 1V49A 4M8MA 3RYTA 3VUYA 1EUVB 2CR5A 2CHXA 3BY4B 4BKSD 2B3AA 3W1SA 2IO0B 2WX1A 1P3QU 1GUAB 4HVBA 1HE8A 2ASQA 2BYEA 2V1YA 3N32A 3H7SA 3QA8A 4URKA 4J6IA 4AOFA 4MDKE 1JRUA 5JZEB 2BF8B 2Z59B 1Z2MA 3NZUA 1H8CA 1UGMA 2BKRB 2NVUI 2ZJDA 2JPHA 4GDKB 2FAZA 4FBJB 1KLVA 4AUQC 4PS7A 2C60A 2KOXA 5E6NA 1OEYJ 3IHPC 3QAQA 2KTFA 5D94A 3BINA 3V60A 2D07B 3PTFC 4DBGA 3SDLC 4IW0A 2L05A 2FCQA 2R2QA 2JWZA 4AP4C 4N9F4 4WWOA 1YX5B 4I6NB 4M8NA 4KSKC 3LDZE 4YL8A 4W9CA 2NCNA 1XD3B 4G0NB 2MQJA 5AEKB 2D11A 4AWJA 4EOYA 2A5UA 1OEYA 4F8CB 2LGXA 3O65B 1YX6B 4K1RB 2JZZA 4HCPB 1E7VA 4HWIB 3RCZA 3JSVA 2IBIB 1GJZA 3ZTCA 2VRRB 4IG7B 4HLEA 3PZDA 1XQQA 2RR9A 2ZPYA 1LQBA 1OQYA 4LDTB 4MSQB 5CHVC 3U30A 2K39A 4W9LA 1UZXB 2N9EB 3PLUA 2IO3B 1WJ4A 1UH6A 2KFKA 4MGYE 3X23A 4K7UA 1I42A 2DZIA 2LZ6A 2PPHA 4IWOA 3L13A 3ZDTA 2G45B 4NPNA 4RMAA 2CKHB 2LWPA 3UINB 2G4DB 2JF5A 1WMHB 2KMCA 1YJ1A 3Q3FA 4TV3A 5G2NA 2FIDA 1CMXB 2DAJA 5J2RA 5JH5C 3R66C 2Y5BB 4KVGB 1Q5WB 2AL3A 5E6PA 1U4AA 3UGBB 2KQSA 3JW0X 1OGWA 4WJPA 1VCBA 3CSFA 3DVNV 2MP2A 4NY0A 1V9JA 4GDLB 2DZMA 4B95A 4WWNA 2MBQA 4PYUA 4WQOB 3VH3B 1WXMA 1NBFC 5L83A 2XK5B 2AEHA 4I6LB 2IO2B 1KOTA 4JQWC 2L3ZA 4EZLA 4RM9A 3PVLA 2DYBA 2NPTA 1OTRB 1WX7A 1WX9A 2K25A 3NY5A 3U7DA 3DQVA 2IZVB 3L16A 3DVNU 1IP9A 2J7QB 2LJ5A 3M63B 2IY0B 2PJHA 2GMIC 2V4LA 4AJYB 1YQBA 1Q1OA 2KX0A 2MBHA 3HK0A 2WDTB 4GSWA 1J0GA 1GC7A 3WIMA 3A4RA 3KUDB 3HM3A 2HD5B 3PRPB 4X57B 4A3OA 4FJYA 3H6NA 2ZCBA 4W9DA 4ANWA 4ICVA 4W9IA 4CYEA 5LXIB 3QIJA 4FADA 2I1KA 2C7NB 1IPGA 5IAAC 2JVCA 3A9KA 2KTRB 1VD2A 3W1YA 2KANA 3RUIB 3KUCB 4E3CA 4RM8A 4MGIE 2OJRA 1GC6A 5FR6A 3W1SC 4FJZA 5JHAA 4K81A 3T8MA 5C23A 2KLGA 4FN2A 1RAXA 2LXCA 2WX0A 3OLMD 2FCMA 3DBRI 1V6EA 4A3PA 2M4NA 3ZNID 2LVPA 1WGDA 3QJZA 3APCA 4LCDE 4MJSB 3DPDA 4AJWA 2L0TA 3A9JA 3QCAA 3L10B 3OJ4B 4DHZE 1WGRA 2KWVB 3EC8A 1WR1A 2KJRA 2W9NA 1RFAA 2M1MA 2KC1A 2JT4B 3PRMB 1E7UA 4BBNF 4EZJA 3GZNI 1XT9B 4BFRA 2DENB 3H1UA 2WYQA 2LVQA 3ZIMA 5BO4B 5KHQA 5L95C 3AU4A 3KYDD 3TL5A 3ML8A 4KDLB 4GB9A 1UD7A 1WY8A 1EF1A 1YIWA 5D6JB 4ZRKA 1F9JA 2MSED 2BPSA 2LASA 1E90A 1WXVA 1WRDB 2UYZB 2WWZA 1GNUA 2JXXA 4MM3A 3V6EB 4ANUA 2O6VD 2EMSA 2KK8A 3R3MA 4GDKA 4HJKA 2ZNVC 3M3JA 3M62B 3ML9A 4MSMB 2ZVOA 5CHFA 4MELA 1P0RA 2HTHA 3VQIA 3N3KB 3WAMA 5DPWA 3RZWC 2PEAA 2BYFA 2XBBC 3LJ3A 2L76A 3ONSA 3IBEA 2DZKA 3DVGX 5D2MB 4IC7B 2L00B 1M94A 2IYDB 1E5WA 1TZ1A 2K6DB 2N7EA 3VVWB 2KN5A 4OVVA 2KJHB 2O2VB 1R4NI 1E8XA 4WJNA 4ZRJA 1SE9A 2L0FA 3B1LX 3HM6X 4FJVB 3R7QA 3S2AA 4EKUA 2DAFA 3VFKA 4P7IA 4DHZB 3ENEA 3ZKJC 3JVZX 2GBJA 2MCNB 4M0WB 3WAOA 3V61A 3UF8A 3AI5A 1WFYA 4EFOA 1WGGA 1H4RA 1WMHA 2KO3A 1J8CA 4FA6A 3DCGA 5D7GA 2NBVB 2KFJA 2NBUA 5DPRA 4HK2A 1QZEA 2KDBA 2KXJA 2G3QB 2UWQA 3IVFA 3QQ8B 4WWPA 1L7YA 5J17A 1WJNA 1A5RA 1L2NA 2AL6A 3TBLD 4XX5A 3CMMB 2MLBA 3SU8X 1FXTB 1LXDA 2HJ8A 4GU2A 1ZW7A 4IM3A 4GDLA 4BKSA 1C3TA 2CHWA 2KVRA 5C1ZA 1V5TA 3MJWA 4KZ0A 3UQBA 2IY1B 4WAAA 2BKFA 2XK5A 4GN1A 4KV2A 4NJ7A 4EUTA 3U8ZA 3TMPB 4E74A 4GIVA 2FNJB 3A1QB 3QX1A 4ZRIA 3V6CB 3R7RA 2CU1A 2KLCA 1R4MI 2GOWA 2JZ3B 2PE9A 3PLVA 2MW5A 4K7WA 4GGQA 4ASWC 3EFUA 3PHWB 3ECIA 3QK0A 1P98A 3L54A 4NAWB 1TTNA 1V86A 2O6VB 2QHOA 4WJOA 2LD9A 2KMAA 2N9PC 2K8BA 5DCNA 2AYOB 2KKCA 4PYZA 4JGHB 1SGHA 1WZ3A 5AZFA 1WIAA 3IG3A 3KYCD 2L8JA 2KDEB 3NZSA 4KIKB 4W9JA 4ANVA 1UBQA 2N9XA 2KTRA 3SHQA 2ZPNA 1WGYA 1LM8B 3ZRCA 2FIFA 2K8HA 2KNBA 3CSTA 1WYWB 2YVCA 2DYMA 3MTNB 2XEWA 2RD0A 3RULA 4TQ0A 2LXAA 1WJ6A 3H7PB 2KZRA 3HHMA 2N1VA 4FHKA 3DDCB 3APFA 3DOWA 2M8SA 4MJSA 2JRHA 2GBKA 2GBNA 2AWTA 2CHZA 4NQLB 1P9DU 2GBRA 2RPQA 2CS4A 2MX2A 3CF6E 1K8RB 4KZCA 1E8YA 1RRBA 3WALA 3ZO5B 3QWZB 1E8WA 3K9OB 2MBBB 4CO7A 4DDGD 4TKNA 4DXAB 4E71A 3VUWA 2C7HA 2ZZPB 2JRIB 1Y8RC 3C0RB 4DHJD 3DVGY 4I6PA 3RD2A 1RLFA 2K8CA 3K9PB 3PRZA 2MRPA 4MGZE 3NS8A 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH0 A;  4LJO B;  3WA0 A;  4GOC A;  3GOE A;  1J19 A;  4MGK E;  2KQ7 A;  3QHT A;  2D3G A;  3PGE A;  5TR5 A;  4B6W A;  3H9D A;  3RZF A;  4BKG A;  4G50 A;  5IA7 A;  4IM0 A;  3PPA A;  2C9W B;  4W9H A;  3DBS A;  1Q0W B;  2ZVN A;  3PSE B;  2G4S A;  4ZDV A;  4B9K A;  3VDZ A;  4W9K A;  5AZG A;  1E8Z A;  2PE6 B;  3ZDM C;  2K1F A;  4IUM B;  4LJP B;  2RGF A;  4EEW A;  1T0Y A;  3VTW A;  1V2Y A;  2KDF B;  2N4F A;  4W9G A;  4PS8 A;  3AU5 A;  2JY6 A;  4GXB A;  3TIX A;  4ANX A;  2O2V A;  1BT0 A;  4HXD A;  4DWF A;  4W9F A;  2J0M A;  1WH3 A;  3OJ3 A;  4NNJ B;  3VAW A;  1V81 A;  4BBN C;  3L08 A;  4ZYN A;  4BKT A;  1KJT A;  1C1Y B;  1S3S G;  1G6J A;  2BWE S;  3SD5 A;  2IO1 B;  3TCA A;  1I35 A;  1UEL A;  2D10 A;  3OAW A;  5DPS A;  3ZTD A;  3VHT C;  4TUU A;  2JUO A;  2N1W A;  3A33 B;  1WZ0 A;  2KX3 A;  4G11 A;  2V3S A;  3ZNH B;  4HDQ A;  4JLC A;  5JHB A;  3JYU A;  2DHZ A;  1TBE A;  3MHS D;  3QC8 B;  5E6O A;  3UIO B;  4HPL B;  4K7S A;  3KVF B;  4NJ6 A;  2D2Q A;  3VTU A;  4W9E A;  2GBM A;  2ZEQ A;  4IWP A;  1WXA A;  2M0X A;  2LVO A;  2FCS A;  2KHW B;  4ICU A;  3X0W A;  3A4S C;  2OOB B;  3ZLZ A;  2LI5 A;  4IM2 A;  1D3Z A;  1X1M A;  3RT3 B;  5LLI A;  1WXS A;  2EMT A;  2ZNV B;  3Q3J A;  3VH4 B;  3ZRF A;  3AXC A;  2DYO A;  5KHO A;  3ZNZ B;  1WE6 A;  2Z0D B;  3JSV B;  3A1Q A;  4HCN B;  4BOS C;  4DHJ B;  4XC2 A;  1Z5S B;  2MA9 B;  2Z0E B;  2MBO A;  3B08 A;  2BGF A;  3B0A A;  3ALB A;  2K6Q A;  1ZKH A;  3PRE A;  2FUH B;  2KFK B;  4NAW A;  1WM2 A;  2O6V A;  2MWS B;  1AAR A;  2NR2 A;  3IFW B;  2C5L C;  4TQ1 A;  3TJP A;  3HIZ A;  3L0W B;  2MBE A;  1NI2 A;  2C7M B;  2L7R A;  2M17 A;  3QAR A;  4MH0 E;  1S1Q B;  2LRW A;  4CHK A;  4JIO U;  4KSL C;  1V80 A;  1WE7 A;  1WM3 A;  1PQS A;  2KD0 A;  3EEC A;  3EHV A;  4BVU C;  4DK5 A;  5J18 A;  4II3 B;  4KIK A;  2A4Z A;  2KDI A;  4JL9 A;  3ZUN A;  1WR6 E;  2KWU B;  5CTR C;  3L17 A;  2MP2 B;  3D32 A;  5AZH A;  3WAN A;  3NHE B;  3VXW A;  4F7Z A;  3DBH I;  3PT2 B;  3ZVV A;  1IYF A;  1UBI A;  2HE7 A;  3V62 A;  4F1S A;  4FHJ A;  5CHW A;  3H7P A;  3APD A;  4HPM B;  4II2 B;  3I3T B;  1WF9 A;  4FLH A;  4OVU A;  3WAP A;  2RSU A;  2NBW B;  2NPT B;  4NQK E;  3UQA A;  2J0J A;  4FUL A;  3DBL I;  2BWF A;  4IWQ A;  2LGY A;  3P2B A;  1EO6 A;  3M95 A;  2N7D A;  3UIP B;  4EZK A;  4A20 A;  1V5O A;  2KC2 A;  4KDI C;  1EF5 A;  5HKH A;  1WJU A;  5DPT A;  3VUX A;  1WGH A;  3AUL A;  1KM7 A;  2EKE C;  5EDS A;  2I1J A;  5G55 A;  2LRU A;  2J0K A;  2LGD A;  4MEM A;  3PV1 A;  2KJ6 A;  1ZGU B;  4HDO A;  4WJQ A;  1TGZ B;  2NS5 A;  5CX3 A;  1SIF A;  2FCN A;  2ZCC A;  1LFD A;  4LDT D;  3ZNG C;  1WX8 A;  3A9K B;  3KW5 B;  4G3X B;  1MG8 A;  2DZJ A;  1ISN A;  2REX A;  3PHX B;  4BOZ B;  1P1A A;  3ZW3 A;  3N30 A;  3PS6 A;  3T9L A;  5LXH A;  2KWC A;  3NOB A;  3VTV A;  4DDI D;  2LUE A;  4PS3 A;  2R2O A;  4XZ4 A;  5GMV A;  1GG3 A;  1WI0 A;  2BYV E;  3KUZ A;  2YLM A;  1YD8 U;  3A9J B;  1NDD A;  2DX5 B;  1V49 A;  4M8M A;  3RYT A;  3VUY A;  1EUV B;  2CR5 A;  2CHX A;  3BY4 B;  4BKS D;  2B3A A;  3W1S A;  2IO0 B;  2WX1 A;  1P3Q U;  1GUA B;  4HVB A;  1HE8 A;  2ASQ A;  2BYE A;  2V1Y A;  3N32 A;  3H7S A;  3QA8 A;  4URK A;  4J6I A;  4AOF A;  4MDK E;  1JRU A;  5JZE B;  2BF8 B;  2Z59 B;  1Z2M A;  3NZU A;  1H8C A;  1UGM A;  2BKR B;  2NVU I;  2ZJD A;  2JPH A;  4GDK B;  2FAZ A;  4FBJ B;  1KLV A;  4AUQ C;  4PS7 A;  2C60 A;  2KOX A;  5E6N A;  1OEY J;  3IHP C;  3QAQ A;  2KTF A;  5D94 A;  3BIN A;  3V60 A;  2D07 B;  3PTF C;  4DBG A;  3SDL C;  4IW0 A;  2L05 A;  2FCQ A;  2R2Q A;  2JWZ A;  4AP4 C;  4N9F 4;  4WWO A;  1YX5 B;  4I6N B;  4M8N A;  4KSK C;  3LDZ E;  4YL8 A;  4W9C A;  2NCN A;  1XD3 B;  4G0N B;  2MQJ A;  5AEK B;  2D11 A;  4AWJ A;  4EOY A;  2A5U A;  1OEY A;  4F8C B;  2LGX A;  3O65 B;  1YX6 B;  4K1R B;  2JZZ A;  4HCP B;  1E7V A;  4HWI B;  3RCZ A;  3JSV A;  2IBI B;  1GJZ A;  3ZTC A;  2VRR B;  4IG7 B;  4HLE A;  3PZD A;  1XQQ A;  2RR9 A;  2ZPY A;  1LQB A;  1OQY A;  4LDT B;  4MSQ B;  5CHV C;  3U30 A;  2K39 A;  4W9L A;  1UZX B;  2N9E B;  3PLU A;  2IO3 B;  1WJ4 A;  1UH6 A;  2KFK A;  4MGY E;  3X23 A;  4K7U A;  1I42 A;  2DZI A;  2LZ6 A;  2PPH A;  4IWO A;  3L13 A;  3ZDT A;  2G45 B;  4NPN A;  4RMA A;  2CKH B;  2LWP A;  3UIN B;  2G4D B;  2JF5 A;  1WMH B;  2KMC A;  1YJ1 A;  3Q3F A;  4TV3 A;  5G2N A;  2FID A;  1CMX B;  2DAJ A;  5J2R A;  5JH5 C;  3R66 C;  2Y5B B;  4KVG B;  1Q5W B;  2AL3 A;  5E6P A;  1U4A A;  3UGB B;  2KQS A;  3JW0 X;  1OGW A;  4WJP A;  1VCB A;  3CSF A;  3DVN V;  2MP2 A;  4NY0 A;  1V9J A;  4GDL B;  2DZM A;  4B95 A;  4WWN A;  2MBQ A;  4PYU A;  4WQO B;  3VH3 B;  1WXM A;  1NBF C;  5L83 A;  2XK5 B;  2AEH A;  4I6L B;  2IO2 B;  1KOT A;  4JQW C;  2L3Z A;  4EZL A;  4RM9 A;  3PVL A;  2DYB A;  2NPT A;  1OTR B;  1WX7 A;  1WX9 A;  2K25 A;  3NY5 A;  3U7D A;  3DQV A;  2IZV B;  3L16 A;  3DVN U;  1IP9 A;  2J7Q B;  2LJ5 A;  3M63 B;  2IY0 B;  2PJH A;  2GMI C;  2V4L A;  4AJY B;  1YQB A;  1Q1O A;  2KX0 A;  2MBH A;  3HK0 A;  2WDT B;  4GSW A;  1J0G A;  1GC7 A;  3WIM A;  3A4R A;  3KUD B;  3HM3 A;  2HD5 B;  3PRP B;  4X57 B;  4A3O A;  4FJY A;  3H6N A;  2ZCB A;  4W9D A;  4ANW A;  4ICV A;  4W9I A;  4CYE A;  5LXI B;  3QIJ A;  4FAD A;  2I1K A;  2C7N B;  1IPG A;  5IAA C;  2JVC A;  3A9K A;  2KTR B;  1VD2 A;  3W1Y A;  2KAN A;  3RUI B;  3KUC B;  4E3C A;  4RM8 A;  4MGI E;  2OJR A;  1GC6 A;  5FR6 A;  3W1S C;  4FJZ A;  5JHA A;  4K81 A;  3T8M A;  5C23 A;  2KLG A;  4FN2 A;  1RAX A;  2LXC A;  2WX0 A;  3OLM D;  2FCM A;  3DBR I;  1V6E A;  4A3P A;  2M4N A;  3ZNI D;  2LVP A;  1WGD A;  3QJZ A;  3APC A;  4LCD E;  4MJS B;  3DPD A;  4AJW A;  2L0T A;  3A9J A;  3QCA A;  3L10 B;  3OJ4 B;  4DHZ E;  1WGR A;  2KWV B;  3EC8 A;  1WR1 A;  2KJR A;  2W9N A;  1RFA A;  2M1M A;  2KC1 A;  2JT4 B;  3PRM B;  1E7U A;  4BBN F;  4EZJ A;  3GZN I;  1XT9 B;  4BFR A;  2DEN B;  3H1U A;  2WYQ A;  2LVQ A;  3ZIM A;  5BO4 B;  5KHQ A;  5L95 C;  3AU4 A;  3KYD D;  3TL5 A;  3ML8 A;  4KDL B;  4GB9 A;  1UD7 A;  1WY8 A;  1EF1 A;  1YIW A;  5D6J B;  4ZRK A;  1F9J A;  2MSE D;  2BPS A;  2LAS A;  1E90 A;  1WXV A;  1WRD B;  2UYZ B;  2WWZ A;  1GNU A;  2JXX A;  4MM3 A;  3V6E B;  4ANU A;  2O6V D;  2EMS A;  2KK8 A;  3R3M A;  4GDK A;  4HJK A;  2ZNV C;  3M3J A;  3M62 B;  3ML9 A;  4MSM B;  2ZVO A;  5CHF A;  4MEL A;  1P0R A;  2HTH A;  3VQI A;  3N3K B;  3WAM A;  5DPW A;  3RZW C;  2PEA A;  2BYF A;  2XBB C;  3LJ3 A;  2L76 A;  3ONS A;  3IBE A;  2DZK A;  3DVG X;  5D2M B;  4IC7 B;  2L00 B;  1M94 A;  2IYD B;  1E5W A;  1TZ1 A;  2K6D B;  2N7E A;  3VVW B;  2KN5 A;  4OVV A;  2KJH B;  2O2V B;  1R4N I;  1E8X A;  4WJN A;  4ZRJ A;  1SE9 A;  2L0F A;  3B1L X;  3HM6 X;  4FJV B;  3R7Q A;  3S2A A;  4EKU A;  2DAF A;  3VFK A;  4P7I A;  4DHZ B;  3ENE A;  3ZKJ C;  3JVZ X;  2GBJ A;  2MCN B;  4M0W B;  3WAO A;  3V61 A;  3UF8 A;  3AI5 A;  1WFY A;  4EFO A;  1WGG A;  1H4R A;  1WMH A;  2KO3 A;  1J8C A;  4FA6 A;  3DCG A;  5D7G A;  2NBV B;  2KFJ A;  2NBU A;  5DPR A;  4HK2 A;  1QZE A;  2KDB A;  2KXJ A;  2G3Q B;  2UWQ A;  3IVF A;  3QQ8 B;  4WWP A;  1L7Y A;  5J17 A;  1WJN A;  1A5R A;  1L2N A;  2AL6 A;  3TBL D;  4XX5 A;  3CMM B;  2MLB A;  3SU8 X;  1FXT B;  1LXD A;  2HJ8 A;  4GU2 A;  1ZW7 A;  4IM3 A;  4GDL A;  4BKS A;  1C3T A;  2CHW A;  2KVR A;  5C1Z A;  1V5T A;  3MJW A;  4KZ0 A;  3UQB A;  2IY1 B;  4WAA A;  2BKF A;  2XK5 A;  4GN1 A;  4KV2 A;  4NJ7 A;  4EUT A;  3U8Z A;  3TMP B;  4E74 A;  4GIV A;  2FNJ B;  3A1Q B;  3QX1 A;  4ZRI A;  3V6C B;  3R7R A;  2CU1 A;  2KLC A;  1R4M I;  2GOW A;  2JZ3 B;  2PE9 A;  3PLV A;  2MW5 A;  4K7W A;  4GGQ A;  4ASW C;  3EFU A;  3PHW B;  3ECI A;  3QK0 A;  1P98 A;  3L54 A;  4NAW B;  1TTN A;  1V86 A;  2O6V B;  2QHO A;  4WJO A;  2LD9 A;  2KMA A;  2N9P C;  2K8B A;  5DCN A;  2AYO B;  2KKC A;  4PYZ A;  4JGH B;  1SGH A;  1WZ3 A;  5AZF A;  1WIA A;  3IG3 A;  3KYC D;  2L8J A;  2KDE B;  3NZS A;  4KIK B;  4W9J A;  4ANV A;  1UBQ A;  2N9X A;  2KTR A;  3SHQ A;  2ZPN A;  1WGY A;  1LM8 B;  3ZRC A;  2FIF A;  2K8H A;  2KNB A;  3CST A;  1WYW B;  2YVC A;  2DYM A;  3MTN B;  2XEW A;  2RD0 A;  3RUL A;  4TQ0 A;  2LXA A;  1WJ6 A;  3H7P B;  2KZR A;  3HHM A;  2N1V A;  4FHK A;  3DDC B;  3APF A;  3DOW A;  2M8S A;  4MJS A;  2JRH A;  2GBK A;  2GBN A;  2AWT A;  2CHZ A;  4NQL B;  1P9D U;  2GBR A;  2RPQ A;  2CS4 A;  2MX2 A;  3CF6 E;  1K8R B;  4KZC A;  1E8Y A;  1RRB A;  3WAL A;  3ZO5 B;  3QWZ B;  1E8W A;  3K9O B;  2MBB B;  4CO7 A;  4DDG D;  4TKN A;  4DXA B;  4E71 A;  3VUW A;  2C7H A;  2ZZP B;  2JRI B;  1Y8R C;  3C0R B;  4DHJ D;  3DVG Y;  4I6P A;  3RD2 A;  1RLF A;  2K8C A;  3K9P B;  3PRZ A;  2MRP A;  4MGZ E;  3NS8 A;  4GMV A; 
#chains in the Genus database with same CATH topology
 3WA0 A;  5TR5 A;  1HTQ A;  5IA7 A;  4IM0 A;  4W9H A;  1Q0W B;  3I9V 1;  4KGT A;  3VDZ A;  4W9K A;  1T5X D;  2WXK A;  2RGF A;  4EEW A;  1WGK A;  3DBR B;  2N4F A;  3AU5 A;  2JY6 A;  1E7P B;  1SSN A;  1HEZ E;  3OJ3 A;  4NNJ B;  4BBN C;  4KGS A;  2WGS A;  1S3S G;  2BWE S;  1UEL A;  4TUU A;  3A33 B;  2M56 B;  4FXC A;  1SF0 A;  4HDQ A;  2DHZ A;  4K7S A;  2D2Q A;  2GBM A;  3C19 A;  2FCS A;  3AE5 B;  1QOA A;  3DHI C;  3ZRF A;  2Z0D B;  1CK1 A;  2Z0E B;  1TKY A;  2BGF A;  3B0A A;  1GPX A;  2INP E;  1L0X B;  3PRE A;  4NAW A;  2MWS B;  3IFW B;  2C5L C;  4TQ1 A;  3HIZ A;  3L0W B;  4CQN A;  2MBE A;  4L23 A;  2BS4 B;  3QAR A;  4MH0 E;  1S1Q B;  4XGA B;  3MFG A;  4BVU C;  2KDI A;  2N9K A;  4YSZ B;  2JWU A;  1YQ4 B;  2MP2 B;  2ICI A;  3PT2 B;  3ZVV A;  1IYF A;  4F1S A;  2QCZ A;  1I7H A;  1TYG B;  3OG5 A;  2J0J A;  4FUL A;  1ESF A;  3P2B A;  1XCT L;  5T8I A;  4C56 C;  2KC2 A;  3VUX A;  3MHZ A;  3AUL A;  1KM7 A;  1V97 A;  2EKE C;  2GLS A;  4DXG A;  2KJ6 A;  2DWQ A;  4AQ7 A;  1FIQ A;  2ONQ A;  5CX3 A;  2DBY A;  2FCN A;  4LDT D;  3A9K B;  3KW5 B;  3ZJU A;  3PZ7 A;  1MG8 A;  3ZW3 A;  5FR3 A;  2PIA A;  3HVZ A;  3Q8A A;  3T9L A;  1JWS D;  3VTV A;  4DDI D;  4XZ4 A;  1UNS A;  1UUP A;  1YD8 U;  1IGC A;  3AE8 B;  4AS1 A;  2CHX A;  1AN8 A;  1J7A A;  1GUA B;  4HVB A;  2ASQ A;  3N32 A;  1QT9 A;  1XXG A;  1D5M C;  4AOF A;  4MDK E;  2WXR A;  3DHH C;  1Z2M A;  3NS1 A;  3NZU A;  3C8Y A;  5HG2 A;  2BKR B;  4PK1 A;  1F77 A;  4PS7 A;  2C60 A;  2UU7 A;  1OEY J;  2D3B A;  3N1Y C;  3BIN A;  4IW0 A;  2L05 A;  3B2F A;  3PZ8 A;  4N9F 4;  2OED A;  2K9X A;  1E0Z A;  1SIJ A;  4WQM A;  4M8N A;  4KSK C;  4RCO A;  1YJI A;  1FRD A;  4OZC A;  4HCP B;  3W5V B;  1E7V A;  4HWI B;  3RCZ A;  2IBI B;  3RNG C;  4A90 A;  4IG7 B;  2RR9 A;  3U30 A;  2WXQ A;  3X23 A;  2IO3 B;  4C80 A;  1UH6 A;  2KFK A;  1AW7 A;  1V8C A;  2PPH A;  4IWO A;  2BT6 A;  2G45 B;  2WXP A;  4RMA A;  2CKH B;  4C7Y A;  2LWP A;  5D3I B;  3UIN B;  2G4D B;  2BYT A;  4HEA 1;  2V3P A;  2DAJ A;  4TMA B;  2AL3 A;  1U4A A;  1I4P A;  1OGW A;  3CSF A;  1EWC A;  2J4X A;  2XK5 B;  2AQ2 B;  2IO2 B;  1C78 A;  1KOT A;  3L4P A;  3L16 A;  1VZ8 A;  3M63 B;  1QOB A;  2GMI C;  3E56 A;  4AJY B;  1Q1O A;  2D5G A;  2MBH A;  3V3X A;  3WIM A;  2KWD A;  2OJW A;  3GS2 A;  3BII D;  5EE1 A;  2ZCB A;  2JZP A;  4LTU A;  4ANW A;  4CYE A;  1PGA A;  1IPG A;  1DOY A;  1PGB A;  3KUC B;  2Y5P A;  3RNA C;  3W1S C;  3T8M A;  2KLG A;  4FN2 A;  2J52 A;  4A3P A;  1WGD A;  2XN9 C;  2L0T A;  4WH4 A;  2Y3A A;  2BBC A;  1ZE3 D;  1ZDX A;  2W9N A;  4EZJ A;  2M1M A;  2KC1 A;  4BBN F;  3GZN I;  4BFR A;  1V1O A;  2LVQ A;  4WWM A;  5KHQ A;  3Q2A C;  1T3Q A;  3ML8 A;  4GB9 A;  2LUM A;  3AE1 B;  5D6J B;  4ZRK A;  3NZ3 A;  2RPV A;  2LAS A;  1VR9 A;  2O6V D;  2EMS A;  2KK8 A;  3R3M A;  5BYR A;  2HJ1 A;  1YN4 A;  2W3R A;  2HTH A;  3N3K B;  3AE3 B;  2PEA A;  2PKO A;  1C4P A;  4RH6 A;  2ON8 A;  5D2M B;  4IC7 B;  2L00 B;  1M94 A;  2KN5 A;  4OVV A;  4WJN A;  4M01 A;  4FJV B;  2W3S A;  1N61 A;  3R7Q A;  3S2A A;  1T0S C;  2DAF A;  3R2I A;  3VFK A;  4ITK A;  3ENE A;  4M0W B;  1ZPS A;  3UF8 A;  2QJL A;  3AI5 A;  2WLB A;  1WFY A;  4EFO A;  5C2T B;  1WMH A;  3DCG A;  5D7G A;  2NBV B;  2NBU A;  4UDU C;  2UWQ A;  2G3Q B;  3QQ8 B;  4WWP A;  1L7Y A;  5J17 A;  1WJN A;  1A5R A;  2MH7 A;  1LXD A;  1ZW7 A;  2LFI A;  1C3T A;  5C1Z A;  2KVR A;  3TEW A;  3MJW A;  3LYY A;  4GN1 A;  4NJ7 A;  4GIV A;  2YEP F;  3A1Q B;  3V6C B;  2CU1 A;  2JZ3 B;  2PE9 A;  2MW5 A;  3EFU A;  1L0Y B;  3QK0 A;  2QHO A;  1V86 A;  2LD9 A;  2K8B A;  4ZYS A;  4ZRP A;  2VZK B;  3BVZ A;  1WIA A;  3TEZ A;  3GE8 C;  2L8J A;  5IP4 D;  2K0P A;  1E9M A;  4MH8 A;  1WGY A;  2CJN A;  1WYW B;  1P7E A;  3MTN B;  2KVZ A;  2NMQ A;  4QAY A;  2KZR A;  1JW9 D;  2M8S A;  1OQR A;  2GBK A;  1P9D U;  2RPQ A;  4KZC A;  2CS4 A;  1JQ4 A;  3ZO5 B;  1ET6 A;  4DXA B;  2WDQ B;  3U7Z A;  1Y8R C;  3PRZ A;  2JSV X;  3B9J A;  1N5X A;  3NZS A;  5EE3 A;  3KH0 A;  4LJO B;  2LHD A;  3VRB B;  1XLN A;  4Q2J A;  4GOC A;  3GOE A;  2KQ7 A;  5C3J B;  3PGE A;  1SE3 A;  1IUE A;  2QIL A;  3DBS A;  4ZDV A;  4B9K A;  2PE6 B;  3ZDM C;  1TS5 A;  1UGJ A;  1V2Y A;  5H92 C;  4J3O D;  4W9G A;  3TIX A;  2O2V A;  2MHJ A;  3ZJT A;  2J0M A;  1WH3 A;  1AWD A;  2PVG C;  3HUI A;  3Q69 A;  2IO1 B;  3TCA A;  4P1C C;  2D10 A;  3GZN B;  3OAW A;  3VHT C;  2N1W A;  4US9 A;  3MC0 B;  4NZL B;  2V3S A;  3ZNH B;  1N6Z A;  3IT6 B;  3JYU A;  5E6O A;  3VTU A;  4BAX A;  3IXS A;  2M0X A;  3ZXV A;  4ICU A;  4A55 A;  2JYT A;  2LI5 A;  5LLI A;  2DYO A;  4HKZ E;  2IND C;  3NG0 A;  4BOS C;  4DHJ B;  4XC2 A;  3P1M A;  2MA9 B;  2MBO A;  1NI3 A;  1V1P A;  1VZ6 A;  2E6X A;  4ARC A;  3P4S B;  4OW0 A;  2L1A A;  1OQQ A;  3AEB B;  1N60 A;  1FMA D;  2C7M B;  2L7R A;  4JIO U;  4A9A A;  1PQS A;  1Q10 A;  4DK5 A;  1N5W A;  4II3 B;  4JL9 A;  1SE2 A;  1WR6 E;  5CTR C;  2B76 B;  2I38 A;  3D32 A;  4F7Z A;  3VXW A;  3ZQ4 A;  1UBI A;  3V62 A;  4FHJ A;  3H7P A;  3I3T B;  4KKJ A;  2LGS A;  3WAP A;  2RSU A;  1DGJ A;  3VR9 B;  4NQK E;  4OZA A;  3BYY B;  3DBL I;  4IWQ A;  2N9L A;  3Q8B A;  3M95 A;  3DWM A;  2X8X X;  5HKH A;  5DPT A;  5G55 A;  2LGD A;  3PV1 A;  3AE7 B;  1WYG A;  1TGZ B;  1SIF A;  2ZCC A;  1ZDV A;  3ZNG C;  1WX8 A;  1I4R A;  2DZJ A;  1ISN A;  4RNA A;  2REX A;  3N1X C;  1QLB B;  2Y5C A;  1PDX A;  3PS6 A;  3DBH B;  2FUG 1;  1GG3 A;  1WI0 A;  2WXF A;  2BYV E;  3Q6B A;  3KUZ A;  3A9J B;  1V49 A;  2PW9 A;  1EUV B;  4BKS D;  1F52 A;  3NVZ A;  3NUH B;  1JWA D;  2WX1 A;  3DHG C;  2V1Y A;  2JX5 A;  1SEB D;  4URK A;  1UWX A;  2BF8 B;  4K3C A;  4BZA A;  1UGM A;  1TY2 A;  2NVU I;  2ZJD A;  2JPH A;  4GDK B;  1KLV A;  2KOX A;  5E6N A;  1IBX B;  2IGG A;  2LMC A;  1JAL A;  3KWV A;  5D94 A;  4LK0 M;  3SDL C;  1FFV A;  2KT7 A;  4L1B A;  4PT5 A;  1YX5 B;  4JE3 B;  5AEK B;  2MQJ A;  2D11 A;  4AWJ A;  4EOY A;  1OEY A;  4F8C B;  2HTM E;  1T0R C;  3NRZ A;  2VRR B;  2BVC A;  3PZD A;  4LNI A;  4A6Q A;  2ZPY A;  4LDT B;  1OQY A;  3BVM A;  2I2Y A;  1D6E C;  2N9E B;  3P4P B;  1WJ4 A;  3RMK C;  1I42 A;  3L13 A;  3SFD B;  1EU4 A;  4S0R A;  3Q3F A;  2FID A;  2LHE A;  3R66 C;  1TZO A;  4C7Z A;  1L4Z B;  3DVN V;  2MP2 A;  1V9J A;  2DZM A;  2RDB C;  2MBQ A;  4HJG E;  3VH3 B;  1WXM A;  1NBF C;  3Q14 C;  1F2R I;  3R8B A;  2L3Z A;  4EZL A;  4EE2 A;  1OTR B;  1WX9 A;  3DQV A;  3DVN U;  3AE9 B;  2LJ5 A;  2PJH A;  3RNE C;  2WDT B;  1GC7 A;  3RI7 C;  1B1Z A;  3HM3 A;  2WS3 B;  1RM6 C;  4FJY A;  2AQ3 B;  4FAD A;  3A9K A;  1VD2 A;  3W1Y A;  4E3C A;  5FR6 A;  1RAX A;  2LXC A;  3FKY A;  4XE0 A;  1SBB B;  3ZNI D;  3QJZ A;  3U4E G;  3QCA A;  3OJ4 B;  3PRM B;  4RGM A;  4XDD A;  1XT9 B;  2D3A A;  3DBL B;  1UD7 A;  4C00 A;  4P6V F;  2UYZ B;  1K52 A;  2YEP B;  3AMZ A;  3AEC B;  1ZXH A;  5BMH A;  2ZNV C;  3M3J A;  3M62 B;  2X38 A;  4MEL A;  1P0R A;  3V05 A;  3WAM A;  1WSP A;  2L76 A;  3ONS A;  2SEB D;  3P42 A;  2DZK A;  2NTT A;  1A70 A;  4LNN A;  1TZ1 A;  2N7E A;  5IO9 A;  1AYF A;  3CIR B;  2L0F A;  3B1L X;  2RDH A;  3HM6 X;  1VDV A;  4EKU A;  4R3D A;  4P7I A;  4DHZ B;  2BQQ A;  2GBJ A;  3LXF A;  3WAO A;  1XF5 L;  1WGG A;  3W2D A;  3Q3M C;  1FEH A;  2R61 A;  3AM9 A;  3IVF A;  3EA6 A;  1L2N A;  3TBL D;  2W54 A;  3CMM B;  3SU8 X;  1FXT B;  2HJ8 A;  1WRI A;  4B0M A;  2CHW A;  1V5T A;  3RNC C;  2XK5 A;  4KV2 A;  4EUT A;  3U8Z A;  1XCQ L;  3SEB A;  4TSS A;  2FNJ B;  3QX1 A;  2KLC A;  2GOW A;  3PLV A;  3Q3N C;  4ASW C;  3ECI A;  3L54 A;  2O6V B;  2MJD A;  2KMA A;  3FAH A;  5DCN A;  5AZF A;  1SB3 C;  3IG3 A;  3AEE B;  4HRO A;  1PFD A;  1FXI A;  3NVV A;  4KIK B;  1EWY C;  1UBQ A;  2N9X A;  1EU3 A;  3SHQ A;  2ZPN A;  2FIF A;  2K8H A;  2KNB A;  2YVC A;  2XEW A;  5LNK 1;  4TQ0 A;  2LXA A;  1ZXI A;  4FHK A;  3DDC B;  4JX1 C;  1CJE A;  1KLU D;  2GBN A;  2CHZ A;  1HQR D;  1K8R B;  1E8Y A;  1D5X C;  4LNF A;  2WHI A;  2BB5 A;  1VZ7 A;  3VUW A;  2MJE A;  1JML A;  2JRI B;  1RLF A;  1HTO A;  3K9P B;  5GXG B;  4MGZ E;  3NS8 A;  4GMV A;  2QSD A;  1NYQ A;  1J19 A;  4MGK E;  3H9D A;  4G50 A;  1SJE D;  3PSE B;  3GB1 A;  1E8Z A;  2K1F A;  4LJP B;  1YQ3 B;  2DNF A;  1T0Y A;  2EEL A;  1XLO A;  2KDF B;  1UF0 A;  1HXY D;  4GXB A;  4ANX A;  1QOF A;  4HXD A;  1ZUD 2;  4DWF A;  4W9F A;  3VAW A;  1YN5 A;  1NEN B;  1C1Y B;  2WU2 B;  5DPS A;  1YNT E;  5D3D A;  1WZ0 A;  2KX3 A;  4JLC A;  3UIO B;  4HPL B;  4NJ6 A;  2ZEQ A;  2PTL A;  5BMG A;  1WXA A;  2LVO A;  2KHW B;  3X0W A;  3A4S C;  2OOB B;  1TS2 A;  2H88 B;  3RT3 B;  3Q3O C;  1WXS A;  4K3B A;  3Q3J A;  3VH4 B;  5I4D A;  5KHO A;  3ZNZ B;  1WE6 A;  3JSV B;  3A1Q A;  4KGR A;  1C4A A;  1Z5S B;  3ALB A;  2KYW A;  1IGD A;  1OFF A;  2K6Q A;  3BVG A;  2FUH B;  1C9F A;  1WM2 A;  2NR2 A;  3W9C B;  1FNU A;  3TJP A;  2RDG A;  2KAC A;  4ARI A;  2M17 A;  2WU5 B;  4CHK A;  1WE7 A;  3LB8 C;  3AEF B;  3EEC A;  3EHV A;  2A4Z A;  3VRA B;  3ZUN A;  3MC9 A;  2WXL A;  1YN3 A;  3L17 A;  5IOI A;  5AZH A;  3NHE B;  3DBH I;  4LNK A;  2HE7 A;  4HPM B;  4FLH A;  2ZW0 A;  2NPT B;  3UQA A;  3U2S C;  1EO6 A;  4XWT A;  3UIP B;  1V5O A;  1EF5 A;  3NVW A;  1FCC C;  2L32 A;  5EDS A;  1ROE A;  2I1J A;  2J0K A;  3WCQ A;  4HDO A;  4WJQ A;  2W82 A;  2GB1 A;  4C4V B;  3N9Y C;  3RN9 C;  1TKG A;  5G5G A;  1GAQ B;  4BOZ B;  3N30 A;  2LUE A;  4PS3 A;  2R2O A;  1L6U A;  2YLM A;  2DX5 B;  4M8M A;  2CR5 A;  2WQY B;  3BK2 A;  1P3Q U;  4OVZ A;  1GB1 A;  1JCK B;  1GB4 A;  1VLB A;  4J6I A;  1HZ5 A;  4RF1 A;  1JRU A;  4RFB A;  4RF0 A;  2Z59 B;  2QIE B;  1F1H A;  3TEY A;  4MM3 B;  2IJ0 A;  3AE6 B;  2V4I B;  4YSY B;  1FCL A;  3W5U B;  1MHX A;  1UWM A;  3PTF C;  4DBG A;  1XLQ A;  2QMT A;  1VRA B;  2R2Q A;  4RGO S;  3TSS A;  4YL8 A;  3T3N A;  2A5U A;  2LGX A;  3O65 B;  1YX6 B;  4K1R B;  2JZZ A;  1FNV A;  2G1E A;  1GJZ A;  1QKZ A;  5HHD G;  2OHF A;  1XQQ A;  1LQB A;  5CHV C;  3PLU A;  1XO3 A;  4K7U A;  2AX5 A;  3ZXR A;  4NPN A;  2KMC A;  2LGI A;  3KQ4 A;  1YJ1 A;  4TV3 A;  4S17 A;  1CMX B;  1L0V B;  2RMM A;  2Y5B B;  1NVI D;  1Q5W B;  4N58 A;  1I4H A;  2KQS A;  4KX6 B;  1JWM D;  4WJP A;  2IPK D;  2V0G A;  4D2K A;  4NY0 A;  4GDL B;  4WWN A;  4WQO B;  3UI3 A;  5L83 A;  2JXT A;  2AEH A;  1RYJ A;  3MC8 A;  4JQW C;  4RM9 A;  3U52 E;  2CJO A;  1WX7 A;  2K25 A;  3NY5 A;  1MG4 A;  3U7D A;  5AUK A;  2IZV B;  2J7Q B;  2INN E;  2V4L A;  2KX0 A;  4XYC A;  3AN1 A;  3HK0 A;  1J0G A;  5HI1 A;  3PRP B;  3H6N A;  4YTN B;  4DQO C;  3BYT B;  4ICV A;  4W9I A;  1MFW A;  3BK1 A;  3QIJ A;  2I1K A;  1SE4 A;  2JVC A;  2KTR B;  3AEA B;  2HDE A;  2OJR A;  1GC6 A;  3AV8 A;  5JHA A;  4K81 A;  2WX0 A;  5IN7 A;  3OLM D;  2FCM A;  3ETR A;  4JWU C;  1V6E A;  5E6J A;  1HZ6 A;  2LVP A;  1XLP A;  4MJS B;  4MAC A;  3EUB 2;  3A9J A;  3L10 B;  3P4Q B;  3RPF C;  4DHZ E;  2KWV B;  1WR1 A;  3EFC A;  3FIL B;  2V9H A;  1STE A;  2DEN B;  3H1U A;  3ZIM A;  5BO4 B;  3Q8F A;  3TL5 A;  2M0A A;  3HRD D;  2K5P A;  1EF1 A;  1YIW A;  2IDY A;  2BPS A;  4OZB A;  2WWZ A;  4ANU A;  2JXX A;  1HA5 A;  4GDK A;  4HJK A;  5BYQ A;  1IBX A;  1MVK A;  2INC C;  3VQI A;  5DPW A;  2XBB C;  3LJ3 A;  3HVD A;  2KN4 A;  3IBE A;  1CZP A;  2L52 A;  4NAM A;  1FD6 A;  2WXO A;  5TSS A;  2IYD B;  1E5W A;  2K6D B;  3VVW B;  1R4N I;  1E8X A;  2DLB A;  2E3T A;  1SE9 A;  4ZRJ A;  2IGD A;  2BS2 B;  1VJK A;  2WDR B;  2MCN B;  4ZHP A;  1YMH E;  1MJD A;  1TS3 A;  4FA6 A;  1R7S A;  2KFJ A;  5JXV A;  4HK2 A;  1RFK A;  1KRH A;  1QZE A;  4HRS A;  4MT5 A;  1FPY A;  2MLB A;  4GU2 A;  4IM3 A;  4KKI A;  5MPO A;  3UQB A;  2IY1 B;  4DXF A;  4L2Y A;  3SFE B;  3TMP B;  4E74 A;  4ZRI A;  1R4M I;  3FC4 A;  4K7W A;  2L83 A;  1I4G A;  3J9C A;  4NAW B;  1TTN A;  4WJO A;  3BZD B;  3Q8E A;  3I57 A;  2J53 A;  4US8 A;  5HFY A;  2WXH A;  3AE4 B;  3IAS 1;  3EGR A;  4ANV A;  3P63 A;  1LM8 B;  3CST A;  2RD0 A;  3RUL A;  4OHJ A;  1WJ6 A;  3HHM A;  1PGX A;  3DOW A;  3VR8 B;  4N6E B;  1MHH E;  2JRH A;  2JYE A;  1FM0 D;  4WUR A;  4NQL B;  2GBR A;  3CF6 E;  3E9S A;  2BS3 B;  2G9H D;  3QWZ B;  4DDG D;  3K9O B;  4TKN A;  5EE9 A;  2WXM A;  2C7H A;  2ZZP B;  3IAM 1;  3DVG Y;  4I6P A;  4LNO A;  1ENF A;  4P1B C;  3TEX A;  4NJC A;  3QHT A;  1T0Q C;  2D3G A;  3RFZ B;  4B6W A;  3RZF A;  4BKG A;  3PPA A;  2C9W B;  1L6V A;  3N1Z C;  1T6B X;  2ZVN A;  2G4S A;  1WXQ A;  5AZG A;  4IUM B;  3VTW A;  2GI9 A;  4PS8 A;  1MPE A;  1BT0 A;  4USA A;  1QQR A;  1V81 A;  3L08 A;  4ZYN A;  4BKT A;  1I4X A;  1KJT A;  1E6E B;  1G6J A;  3SD5 A;  1I35 A;  2TSS A;  2M19 A;  2MJ3 A;  2JUO A;  2LJI A;  1SXT A;  4G11 A;  5JHB A;  1TBE A;  3MHS D;  3QC8 B;  2VH1 A;  1Y56 A;  3KVF B;  4WAF A;  4W9E A;  3URY A;  4IWP A;  2BTE A;  4ZRQ A;  1JRO A;  2WDV B;  3ZLZ A;  4IM2 A;  1D3Z A;  1X1M A;  2EMT A;  2ZNV B;  3AEG B;  3AXC A;  4M02 A;  4HCN B;  3O13 A;  3B08 A;  1ZOY B;  4IKG A;  2K3U A;  3R2T A;  1ZKH A;  1R4N B;  2KFK B;  2O6V A;  1B9R A;  1AAR A;  1D5Z C;  4JPS A;  1NI2 A;  1KTK A;  1C4C A;  2LRW A;  4KSL C;  1V80 A;  1WM3 A;  1F2R C;  2KD0 A;  5J18 A;  4KIK A;  1QOG A;  2KWU B;  2K22 A;  2N7J A;  2AQ1 B;  3WAN A;  2WXN A;  5CHW A;  4II2 B;  3APD A;  1WF9 A;  4OVU A;  5IKC M;  2NBW B;  2BWF A;  2LGY A;  2QDF A;  2PVO D;  2N7D A;  1LGR A;  4EZK A;  4A20 A;  4B0E A;  4KDI C;  1R4M B;  1WJU A;  4YXD B;  1WGH A;  2WXJ A;  2LRU A;  4MEM A;  3ZJV A;  1ZGU B;  4ZOH C;  2NS5 A;  5AUI A;  1LFD A;  2VH2 A;  4G3X B;  2WXG A;  2Q5W D;  1N63 A;  1QIL A;  3PHX B;  1P1A A;  1FFU A;  1JWB D;  2H89 B;  5LXH A;  2KWC A;  1DOX A;  3NOB A;  1KH0 A;  2PLP A;  5GMV A;  1J7C A;  3GP7 A;  1FO4 A;  1NDD A;  4WIP A;  3RYT A;  3VUY A;  2QEJ C;  4XDC A;  3BY4 B;  2D3C A;  2B3A A;  1MI0 A;  3W1S A;  2IO0 B;  3AB5 A;  2QC8 A;  3KWL A;  1FXA A;  3ZYY X;  1BUI C;  1HE8 A;  2BYE A;  2BW2 A;  3H7S A;  3QA8 A;  3TUO A;  5JZE B;  1H8C A;  1P7F A;  4RGN A;  2FAZ A;  4FBJ B;  2KDM A;  4M0W A;  4AUQ C;  4GLS C;  1DOI A;  3IHP C;  3QAQ A;  2KTF A;  3V60 A;  2D07 B;  2W55 A;  2FCQ A;  3DWG C;  2JWZ A;  4AP4 C;  4WWO A;  1CQV A;  2WP9 B;  4I6N B;  3LDZ E;  4W9C A;  2NCN A;  1KLG D;  1XD3 B;  4G0N B;  3JSV A;  3ZTC A;  1TKE A;  5EE0 A;  4HLE A;  5G5H A;  1L5P A;  2GRI A;  4MSQ B;  2K39 A;  4W9L A;  1UZX B;  3ZTD A;  1YJJ A;  4MGY E;  5BYS A;  2KMM A;  3RNF C;  2DZI A;  2LZ6 A;  1PYW D;  3ZGZ A;  3ZDT A;  1C77 A;  2JF5 A;  1WMH B;  1KFY B;  5G2N A;  2NTS A;  5J2R A;  2KAJ A;  5JH5 C;  4KVG B;  5E6P A;  2ZW1 A;  3UGB B;  1SJH D;  3JW0 X;  3RNB C;  1VCB A;  1NYR A;  1C79 A;  5BMI A;  4JWS C;  4B95 A;  4ZHO A;  2WNM A;  2SAK A;  2MEK A;  4PYU A;  3MP9 A;  5FKA C;  1EM7 A;  4I6L B;  4N59 A;  4A8X C;  4LLG M;  1BML C;  3PVL A;  1I4Q A;  2DYB A;  2NPT A;  3OWE B;  2FBW B;  3I5J C;  1IP9 A;  2IY0 B;  1YQB A;  2JU6 X;  4GSW A;  3KLS X;  3CWI A;  3A4R A;  2BB6 A;  3SR6 A;  3KUD B;  1N62 A;  2HD5 B;  4X57 B;  4A3O A;  4W9D A;  4C4V A;  5LXI B;  2C7N B;  5IAA C;  2XNA C;  2IGH A;  2Z8L A;  2KAN A;  3RUI B;  4RM8 A;  4MGI E;  4FJZ A;  3BWU D;  5C23 A;  2KQ4 X;  3MJ5 A;  3NJT A;  1TIF A;  3DBR I;  2CU3 A;  2M4N A;  4O1N A;  4YTM B;  1TT5 B;  3APC A;  4LCD E;  4AJW A;  3DPD A;  1ACC A;  2ACZ B;  1WGR A;  3EC8 A;  1C76 A;  2KJR A;  1RFA A;  2JT4 B;  1E7U A;  3AH7 A;  3GE3 C;  1ET9 A;  2WYQ A;  3IT4 B;  3P4R B;  5L95 C;  3AU4 A;  3KYD D;  2J42 A;  1D4B A;  4KDL B;  4HPP A;  1WY8 A;  4RGT A;  1F9J A;  2MSE D;  1E90 A;  1WXV A;  1WRD B;  2V3N A;  1GNU A;  4MM3 A;  3V6E B;  3AED B;  1L4D B;  1PUT A;  3AE2 B;  3ML9 A;  2ZVO A;  4MSM B;  5CHF A;  2VZK D;  3N20 C;  3RZW C;  2BYF A;  2WXI A;  1YOV B;  1TY0 A;  1BXT A;  3DVG X;  3ABV B;  4YT0 B;  4P16 A;  4XWW A;  2KJH B;  2O2V B;  4H2A A;  1F0Z A;  3Q8C A;  3ZKJ C;  3JVZ X;  1K53 A;  3V61 A;  5FK9 C;  1H4R A;  2KO3 A;  1TJE A;  1J8C A;  1NEK B;  1DYQ A;  1K50 A;  5DPR A;  2KDB A;  2KXJ A;  3B2G A;  2AL6 A;  4XX5 A;  4YWG G;  4M00 A;  4YTP B;  2PMV A;  4BKS A;  4GDL A;  4KZ0 A;  4WAA A;  2BKF A;  3PO0 A;  4IDI A;  4IOI E;  5H8Y E;  4ACF A;  3R7R A;  4GGQ A;  3PHW B;  1V1P B;  1P98 A;  4YSX B;  1WWT A;  4REZ A;  2N9P C;  1ZP0 B;  2AYO B;  2KKC A;  3H8H A;  4PYZ A;  2EKI A;  4JGH B;  1SGH A;  2FE8 A;  3NVY A;  1JRP A;  1J7B A;  1WZ3 A;  2LEK A;  3KYC D;  2KDE B;  4W9J A;  1FNW A;  2KTR A;  3ZRC A;  2DYM A;  1QF6 A;  3T3O A;  1JWU D;  1LO5 D;  2N0S B;  4HKQ A;  3H7P B;  2JQR B;  1M4V A;  2N1V A;  3APF A;  4MJS A;  1RWS A;  3I63 C;  2AWT A;  2MX2 A;  3FIL A;  1RRB A;  3WAL A;  1E8W A;  1K51 A;  2MBB B;  4CO7 A;  1TS4 A;  4E71 A;  1E10 A;  1KF6 B;  1XEE A;  3C0R B;  4DHJ D;  3RD2 A;  2K8C A;  1FRR A;  1GOZ A;  2MRP A; 
#chains in the Genus database with same CATH homology
 3KH0 A;  4LJO B;  3WA0 A;  4GOC A;  3GOE A;  1J19 A;  4MGK E;  2KQ7 A;  3QHT A;  2D3G A;  3PGE A;  5TR5 A;  4B6W A;  3H9D A;  3RZF A;  4BKG A;  4G50 A;  5IA7 A;  4IM0 A;  3PPA A;  2C9W B;  4W9H A;  3DBS A;  1Q0W B;  2ZVN A;  3PSE B;  2G4S A;  4ZDV A;  4B9K A;  3VDZ A;  4W9K A;  5AZG A;  1E8Z A;  2PE6 B;  3ZDM C;  2K1F A;  4IUM B;  4LJP B;  2RGF A;  4EEW A;  1T0Y A;  3VTW A;  1V2Y A;  2KDF B;  2N4F A;  4W9G A;  4PS8 A;  3AU5 A;  2JY6 A;  4GXB A;  3TIX A;  4ANX A;  2O2V A;  1BT0 A;  4HXD A;  4DWF A;  4W9F A;  2J0M A;  1WH3 A;  3OJ3 A;  4NNJ B;  3VAW A;  1V81 A;  4BBN C;  3L08 A;  4ZYN A;  4BKT A;  1KJT A;  1C1Y B;  1S3S G;  1G6J A;  2BWE S;  3SD5 A;  2IO1 B;  3TCA A;  1I35 A;  1UEL A;  2D10 A;  3OAW A;  5DPS A;  3ZTD A;  3VHT C;  4TUU A;  2JUO A;  2N1W A;  3A33 B;  1WZ0 A;  2KX3 A;  4G11 A;  2V3S A;  3ZNH B;  4HDQ A;  4JLC A;  5JHB A;  3JYU A;  2DHZ A;  1TBE A;  3MHS D;  3QC8 B;  5E6O A;  3UIO B;  4HPL B;  4K7S A;  3KVF B;  4NJ6 A;  2D2Q A;  3VTU A;  4W9E A;  2GBM A;  2ZEQ A;  4IWP A;  1WXA A;  2M0X A;  2LVO A;  2FCS A;  2KHW B;  4ICU A;  3X0W A;  3A4S C;  2OOB B;  3ZLZ A;  2LI5 A;  4IM2 A;  1D3Z A;  1X1M A;  3RT3 B;  5LLI A;  1WXS A;  2EMT A;  2ZNV B;  3Q3J A;  3VH4 B;  3ZRF A;  3AXC A;  2DYO A;  5KHO A;  3ZNZ B;  1WE6 A;  2Z0D B;  3JSV B;  3A1Q A;  4HCN B;  4BOS C;  4DHJ B;  4XC2 A;  1Z5S B;  2MA9 B;  2Z0E B;  2MBO A;  3B08 A;  2BGF A;  3B0A A;  3ALB A;  2K6Q A;  1ZKH A;  3PRE A;  2FUH B;  2KFK B;  4NAW A;  1WM2 A;  2O6V A;  2MWS B;  1AAR A;  2NR2 A;  3IFW B;  2C5L C;  4TQ1 A;  3TJP A;  3HIZ A;  3L0W B;  2MBE A;  1NI2 A;  2C7M B;  2L7R A;  2M17 A;  3QAR A;  4MH0 E;  1S1Q B;  2LRW A;  4CHK A;  4JIO U;  4KSL C;  1V80 A;  1WE7 A;  1WM3 A;  1PQS A;  2KD0 A;  3EEC A;  3EHV A;  4BVU C;  4DK5 A;  5J18 A;  4II3 B;  4KIK A;  2A4Z A;  2KDI A;  4JL9 A;  3ZUN A;  1WR6 E;  2KWU B;  5CTR C;  3L17 A;  2MP2 B;  3D32 A;  5AZH A;  3WAN A;  3NHE B;  3VXW A;  4F7Z A;  3DBH I;  3PT2 B;  3ZVV A;  1IYF A;  1UBI A;  2HE7 A;  3V62 A;  4F1S A;  4FHJ A;  5CHW A;  3H7P A;  3APD A;  4HPM B;  4II2 B;  3I3T B;  1WF9 A;  4FLH A;  4OVU A;  3WAP A;  2RSU A;  2NBW B;  2NPT B;  4NQK E;  3UQA A;  2J0J A;  4FUL A;  3DBL I;  2BWF A;  4IWQ A;  2LGY A;  3P2B A;  1EO6 A;  3M95 A;  2N7D A;  3UIP B;  4EZK A;  4A20 A;  1V5O A;  2KC2 A;  4KDI C;  1EF5 A;  5HKH A;  1WJU A;  5DPT A;  3VUX A;  1WGH A;  3AUL A;  1KM7 A;  2EKE C;  5EDS A;  2I1J A;  5G55 A;  2LRU A;  2J0K A;  2LGD A;  4MEM A;  3PV1 A;  2KJ6 A;  1ZGU B;  4HDO A;  4WJQ A;  1TGZ B;  2NS5 A;  5CX3 A;  1SIF A;  2FCN A;  2ZCC A;  1LFD A;  4LDT D;  3ZNG C;  1WX8 A;  3A9K B;  3KW5 B;  4G3X B;  1MG8 A;  2DZJ A;  1ISN A;  2REX A;  3PHX B;  4BOZ B;  1P1A A;  3ZW3 A;  3N30 A;  3PS6 A;  3T9L A;  5LXH A;  2KWC A;  3NOB A;  3VTV A;  4DDI D;  2LUE A;  4PS3 A;  2R2O A;  4XZ4 A;  5GMV A;  1GG3 A;  1WI0 A;  2BYV E;  3KUZ A;  2YLM A;  1YD8 U;  3A9J B;  1NDD A;  2DX5 B;  1V49 A;  4M8M A;  3RYT A;  3VUY A;  1EUV B;  2CR5 A;  2CHX A;  3BY4 B;  4BKS D;  2B3A A;  3W1S A;  2IO0 B;  2WX1 A;  1P3Q U;  1GUA B;  4HVB A;  1HE8 A;  2ASQ A;  2BYE A;  2V1Y A;  3N32 A;  3H7S A;  3QA8 A;  4URK A;  4J6I A;  4AOF A;  4MDK E;  1JRU A;  5JZE B;  2BF8 B;  2Z59 B;  1Z2M A;  3NZU A;  1H8C A;  1UGM A;  2BKR B;  2NVU I;  2ZJD A;  2JPH A;  4GDK B;  2FAZ A;  4FBJ B;  1KLV A;  4AUQ C;  4PS7 A;  2C60 A;  2KOX A;  5E6N A;  1OEY J;  3IHP C;  3QAQ A;  2KTF A;  5D94 A;  3BIN A;  3V60 A;  2D07 B;  3PTF C;  4DBG A;  3SDL C;  4IW0 A;  2L05 A;  2FCQ A;  2R2Q A;  2JWZ A;  4AP4 C;  4N9F 4;  4WWO A;  1YX5 B;  4I6N B;  4M8N A;  4KSK C;  3LDZ E;  4YL8 A;  4W9C A;  2NCN A;  1XD3 B;  4G0N B;  2MQJ A;  5AEK B;  2D11 A;  4AWJ A;  4EOY A;  2A5U A;  1OEY A;  4F8C B;  2LGX A;  3O65 B;  1YX6 B;  4K1R B;  2JZZ A;  4HCP B;  1E7V A;  4HWI B;  3RCZ A;  3JSV A;  2IBI B;  1GJZ A;  3ZTC A;  2VRR B;  4IG7 B;  4HLE A;  3PZD A;  1XQQ A;  2RR9 A;  2ZPY A;  1LQB A;  1OQY A;  4LDT B;  4MSQ B;  5CHV C;  3U30 A;  2K39 A;  4W9L A;  1UZX B;  2N9E B;  3PLU A;  2IO3 B;  1WJ4 A;  1UH6 A;  2KFK A;  4MGY E;  3X23 A;  4K7U A;  1I42 A;  2DZI A;  2LZ6 A;  2PPH A;  4IWO A;  3L13 A;  3ZDT A;  2G45 B;  4NPN A;  4RMA A;  2CKH B;  2LWP A;  3UIN B;  2G4D B;  2JF5 A;  1WMH B;  2KMC A;  1YJ1 A;  3Q3F A;  4TV3 A;  5G2N A;  2FID A;  1CMX B;  2DAJ A;  5J2R A;  5JH5 C;  3R66 C;  2Y5B B;  4KVG B;  1Q5W B;  2AL3 A;  5E6P A;  1U4A A;  3UGB B;  2KQS A;  3JW0 X;  1OGW A;  4WJP A;  1VCB A;  3CSF A;  3DVN V;  2MP2 A;  4NY0 A;  1V9J A;  4GDL B;  2DZM A;  4B95 A;  4WWN A;  2MBQ A;  4PYU A;  4WQO B;  3VH3 B;  1WXM A;  1NBF C;  5L83 A;  2XK5 B;  2AEH A;  4I6L B;  2IO2 B;  1KOT A;  4JQW C;  2L3Z A;  4EZL A;  4RM9 A;  3PVL A;  2DYB A;  2NPT A;  1OTR B;  1WX7 A;  1WX9 A;  2K25 A;  3NY5 A;  3U7D A;  3DQV A;  2IZV B;  3L16 A;  3DVN U;  1IP9 A;  2J7Q B;  2LJ5 A;  3M63 B;  2IY0 B;  2PJH A;  2GMI C;  2V4L A;  4AJY B;  1YQB A;  1Q1O A;  2KX0 A;  2MBH A;  3HK0 A;  2WDT B;  4GSW A;  1J0G A;  1GC7 A;  3WIM A;  3A4R A;  3KUD B;  3HM3 A;  2HD5 B;  3PRP B;  4X57 B;  4A3O A;  4FJY A;  3H6N A;  2ZCB A;  4W9D A;  4ANW A;  4ICV A;  4W9I A;  4CYE A;  5LXI B;  3QIJ A;  4FAD A;  2I1K A;  2C7N B;  1IPG A;  5IAA C;  2JVC A;  3A9K A;  2KTR B;  1VD2 A;  3W1Y A;  2KAN A;  3RUI B;  3KUC B;  4E3C A;  4RM8 A;  4MGI E;  2OJR A;  1GC6 A;  5FR6 A;  3W1S C;  4FJZ A;  5JHA A;  4K81 A;  3T8M A;  5C23 A;  2KLG A;  4FN2 A;  1RAX A;  2LXC A;  2WX0 A;  3OLM D;  2FCM A;  3DBR I;  1V6E A;  4A3P A;  2M4N A;  3ZNI D;  2LVP A;  1WGD A;  3QJZ A;  3APC A;  4LCD E;  4MJS B;  3DPD A;  4AJW A;  2L0T A;  3A9J A;  3QCA A;  3L10 B;  3OJ4 B;  4DHZ E;  1WGR A;  2KWV B;  3EC8 A;  1WR1 A;  2KJR A;  2W9N A;  1RFA A;  2M1M A;  2KC1 A;  2JT4 B;  3PRM B;  1E7U A;  4BBN F;  4EZJ A;  3GZN I;  1XT9 B;  4BFR A;  2DEN B;  3H1U A;  2WYQ A;  2LVQ A;  3ZIM A;  5BO4 B;  5KHQ A;  5L95 C;  3AU4 A;  3KYD D;  3TL5 A;  3ML8 A;  4KDL B;  4GB9 A;  1UD7 A;  1WY8 A;  1EF1 A;  1YIW A;  5D6J B;  4ZRK A;  1F9J A;  2MSE D;  2BPS A;  2LAS A;  1E90 A;  1WXV A;  1WRD B;  2UYZ B;  2WWZ A;  1GNU A;  2JXX A;  4MM3 A;  3V6E B;  4ANU A;  2O6V D;  2EMS A;  2KK8 A;  3R3M A;  4GDK A;  4HJK A;  2ZNV C;  3M3J A;  3M62 B;  3ML9 A;  4MSM B;  2ZVO A;  5CHF A;  4MEL A;  1P0R A;  2HTH A;  3VQI A;  3N3K B;  3WAM A;  5DPW A;  3RZW C;  2PEA A;  2BYF A;  2XBB C;  3LJ3 A;  2L76 A;  3ONS A;  3IBE A;  2DZK A;  3DVG X;  5D2M B;  4IC7 B;  2L00 B;  1M94 A;  2IYD B;  1E5W A;  1TZ1 A;  2K6D B;  2N7E A;  3VVW B;  2KN5 A;  4OVV A;  2KJH B;  2O2V B;  1R4N I;  1E8X A;  4WJN A;  4ZRJ A;  1SE9 A;  2L0F A;  3B1L X;  3HM6 X;  4FJV B;  3R7Q A;  3S2A A;  4EKU A;  2DAF A;  3VFK A;  4P7I A;  4DHZ B;  3ENE A;  3ZKJ C;  3JVZ X;  2GBJ A;  2MCN B;  4M0W B;  3WAO A;  3V61 A;  3UF8 A;  3AI5 A;  1WFY A;  4EFO A;  1WGG A;  1H4R A;  1WMH A;  2KO3 A;  1J8C A;  4FA6 A;  3DCG A;  5D7G A;  2NBV B;  2KFJ A;  2NBU A;  5DPR A;  4HK2 A;  1QZE A;  2KDB A;  2KXJ A;  2G3Q B;  2UWQ A;  3IVF A;  3QQ8 B;  4WWP A;  1L7Y A;  5J17 A;  1WJN A;  1A5R A;  1L2N A;  2AL6 A;  3TBL D;  4XX5 A;  3CMM B;  2MLB A;  3SU8 X;  1FXT B;  1LXD A;  2HJ8 A;  4GU2 A;  1ZW7 A;  4IM3 A;  4GDL A;  4BKS A;  1C3T A;  2CHW A;  2KVR A;  5C1Z A;  1V5T A;  3MJW A;  4KZ0 A;  3UQB A;  2IY1 B;  4WAA A;  2BKF A;  2XK5 A;  4GN1 A;  4KV2 A;  4NJ7 A;  4EUT A;  3U8Z A;  3TMP B;  4E74 A;  4GIV A;  2FNJ B;  3A1Q B;  3QX1 A;  4ZRI A;  3V6C B;  3R7R A;  2CU1 A;  2KLC A;  1R4M I;  2GOW A;  2JZ3 B;  2PE9 A;  3PLV A;  2MW5 A;  4K7W A;  4GGQ A;  4ASW C;  3EFU A;  3PHW B;  3ECI A;  3QK0 A;  1P98 A;  3L54 A;  4NAW B;  1TTN A;  1V86 A;  2O6V B;  2QHO A;  4WJO A;  2LD9 A;  2KMA A;  2N9P C;  2K8B A;  5DCN A;  2AYO B;  2KKC A;  4PYZ A;  4JGH B;  1SGH A;  1WZ3 A;  5AZF A;  1WIA A;  3IG3 A;  3KYC D;  2L8J A;  2KDE B;  3NZS A;  4KIK B;  4W9J A;  4ANV A;  1UBQ A;  2N9X A;  2KTR A;  3SHQ A;  2ZPN A;  1WGY A;  1LM8 B;  3ZRC A;  2FIF A;  2K8H A;  2KNB A;  3CST A;  1WYW B;  2YVC A;  2DYM A;  3MTN B;  2XEW A;  2RD0 A;  3RUL A;  4TQ0 A;  2LXA A;  1WJ6 A;  3H7P B;  2KZR A;  3HHM A;  2N1V A;  4FHK A;  3DDC B;  3APF A;  3DOW A;  2M8S A;  4MJS A;  2JRH A;  2GBK A;  2GBN A;  2AWT A;  2CHZ A;  4NQL B;  1P9D U;  2GBR A;  2RPQ A;  2CS4 A;  2MX2 A;  3CF6 E;  1K8R B;  4KZC A;  1E8Y A;  1RRB A;  3WAL A;  3ZO5 B;  3QWZ B;  1E8W A;  3K9O B;  2MBB B;  4CO7 A;  4DDG D;  4TKN A;  4DXA B;  4E71 A;  3VUW A;  2C7H A;  2ZZP B;  2JRI B;  1Y8R C;  3C0R B;  4DHJ D;  3DVG Y;  4I6P A;  3RD2 A;  1RLF A;  2K8C A;  3K9P B;  3PRZ A;  2MRP A;  4MGZ E;  3NS8 A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...