2MSED

Nmr data-driven model of gtpase kras-gnp:arafrbd complex tethered to a lipid-bilayer nanodisc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Oncogenic and RASopathy-associated K-RAS mutations relieve membrane-dependent occlusion of the effector-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Apolipoprotein A-I
total genus 14
structure length 73
sequence length 73
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mseD01
1Z2MA 2DAJA 2C5LC 2IZVB 4GMVA 1E7VA 3DVNU 3ZLZA 3AU5A 3B0AA 4W9GA 4M0WB 4RM8A 2HD5B 3VH3B 4I6PA 4M8MA 1GG3A 2MBBB 4NQLB 5DPRA 4LJPB 2KQSA 4G3XB 1JRUA 2KJ6A 3SD5A 2O6VB 4W9EA 3RUIB 3JW0X 3A4RA 4ICVA 5AZGA 2KD0A 4MM3A 5D94A 1EF5A 1KLVA 3KUDB 3N32A 3EC8A 1TZ1A 2NCNA 1R4NI 2CHZA 3ML9A 5D2MB 3VVWB 2CU1A 3I3TB 3WANA 2JZZA 4EZJA 3LDZE 2KC1A 2O2VB 2J0JA 3A1QA 2M8SA 3IBEA 3R66C 3ZTDA 2KDEB 1WFYA 1EO6A 2KTRA 5KHQA 2CS4A 2IY1B 2NBWB 1OTRB 3EFUA 3H7PB 3P2BA 1ISNA 4EKUA 3V62A 1C3TA 2IO3B 1V49A 2KZRA 3PVLA 2LGYA 3DQVA 3ECIA 2D3GA 4KDIC 4W9LA 3OJ3A 3WAOA 3VXWA 2M0XA 4PS7A 4BKSA 4M8NA 2IBIB 4FN2A 2K8CA 3KH0A 5L95C 2G45B 4F7ZA 2ZCBA 5C23A 2N1WA 3U7DA 3K9PB 4F8CB 4WJNA 2R2QA 4X57B 2MWSB 2K25A 3WA0A 1GC7A 5DPWA 4W9FA 3AULA 3NY5A 2MW5A 4FULA 4FHJA 2IO1B 4GXBA 1IYFA 2JXXA 2RPQA 3V6EB 2NS5A 3DVNV 4I6LB 4WJOA 5EDSA 1OEYA 4RM9A 1EUVB 4I6NB 2D07B 1ZW7A 1P3QU 2MX2A 3KW5B 3W1SA 2MRPA 3L54A 5CHFA 3W1SC 4MDKE 1SE9A 2DYOA 2MBOA 1SGHA 5GMVA 4AOFA 3U30A 2BGFA 1H8CA 3UIOB 2HE7A 2ZNVB 1J19A 4NAWB 4LDTD 1TTNA 2KHWB 2YVCA 3DBSA 2KOXA 3VUWA 3S2AA 4PS3A 5DPTA 3APFA 1WXSA 4CYEA 1Z5SB 1YIWA 3PREA 4RMAA 2N9XA 3HHMA 3VAWA 4WAAA 2KO3A 4GDLB 4B9KA 5LLIA 2K8BA 3H7PA 3AI5A 4GGQA 1T0YA 5G55A 1M94A 4F1SA 3WAPA 4FLHA 4BVUC 4MELA 2NPTA 3ZDMC 3HIZA 4DWFA 2KN5A 4JL9A 3DPDA 3DBHI 4P7IA 1K8RB 2EMSA 1WR6E 4KSLC 4MJSA 4ANXA 1WH3A 5J18A 4HPMB 2PE6B 2RR9A 3HK0A 2MCNB 2IYDB 4NY0A 5J2RA 4MSMB 2BYEA 2KDBA 3VHTC 2RSUA 2V4LA 2JRHA 2B3AA 1WMHA 1WR1A 2MA9B 2Y5BB 3DBLI 4W9IA 1CMXB 2HJ8A 3H1UA 2KXJA 4AWJA 2M17A 2O6VA 2HTHA 3BY4B 1P9DU 2K6QA 2GMIC 2AL3A 2NVUI 3A9KB 4YL8A 1GC6A 2CHXA 2KJHB 5D6JB 4MGIE 3TCAA 2PJHA 3BINA 2N9EB 1P0RA 2V1YA 4K7UA 3RD2A 1E8WA 4HXDA 3PV1A 4WWNA 2FAZA 1WYWB 3QK0A 4CHKA 3IG3A 2KLCA 3WALA 4GIVA 2MP2A 3AU4A 1RAXA 3OJ4B 2I1KA 3WIMA 2KFKB 1QZEA 2PEAA 4WWOA 2DZKA 3M63B 4G0NB 3R7RA 3UQBA 3IHPC 1V86A 4MGZE 2KQ7A 1VCBA 4WQOB 3IFWB 1IP9A 4K81A 3R3MA 2G4DB 5IAAC 2KVRA 1WGRA 2LXCA 3SHQA 2MBQA 3APDA 4WJQA 3JVZX 3ZVVA 2Z0EB 1WGHA 2KC2A 4ASWC 4GSWA 2DZJA 4HCPB 4E74A 1WXMA 3RYTA 2LXAA 2D10A 4DK5A 4JGHB 1P1AA 4GU2A 5JZEB 2REXA 2XK5B 2MLBA 4PS8A 1YD8U 2FCNA 2C7NB 3VUYA 2KFJA 2NBUA 3ZNID 1WJ4A 2AEHA 4E3CA 1WZ0A 3QAQA 2L76A 3QJZA 3ZNGC 2D11A 3VH4B 2ZVNA 2JT4B 1UBIA 2ASQA 3PZDA 3N30A 1V81A 1WXVA 3TBLD 1D3ZA 3X0WA 2EMTA 3L10B 2DZIA 2KDFB 4OVUA 3W1YA 3GOEA 1HE8A 2ZPNA 3EECA 5E6PA 1WMHB 5AEKB 2QHOA 3ZW3A 1V2YA 4KSKC 3ZKJC 1WJNA 1YX6B 4NAWA 1J8CA 4G50A 1WXAA 4FHKA 2ZEQA 1LXDA 2CHWA 2K6DB 2KANA 3A9KA 4HVBA 4OVVA 1YQBA 1YJ1A 3Q3JA 4NPNA 3VQIA 3VUXA 3VDZA 2N9PC 5L83A 3QCAA 4ZRJA 3GZNI 3LJ3A 4N9F4 2KWCA 3NZSA 3M62B 5E6OA 4BFRA 2CKHB 2GBNA 2KFKA 3V60A 1E5WA 2WX1A 1Q0WB 4FADA 2OJRA 3CSFA 3APCA 3R7QA 3PPAA 3L16A 2LVPA 1KJTA 3DVGX 4KDLB 5JHBA 2KJRA 2ZNVC 1V5TA 2M1MA 4DXAB 2BKFA 2NBVB 4LDTB 3NHEB 3SDLC 2RGFA 3ZUNA 3ZIMA 1L2NA 2JPHA 3PSEB 3H6NA 2LVOA 1E90A 1EF1A 2MSED 5G2NA 2C60A 2LI5A 1WRDB 2XK5A 4E71A 3TIXA 1LFDA 4MGKE 2XEWA 3ALBA 5IA7A 4II2B 2UWQA 4IC7B 4KZCA 4IM2A 3ZRCA 3Q3FA 2FCMA 1ZKHA 3RULA 3RCZA 5DCNA 4TQ0A 1Q5WB 2KX3A 1WX7A 4IG7B 2CR5A 1E8YA 4K7WA 4B6WA 1WI0A 3M3JA 3ZTCA 2BWFA 3MJWA 1H4RA 1UH6A 3QA8A 4GN1A 4K1RB 4BBNF 4BOZB 2BPSA 4KIKA 4WJPA 1LQBA 2DX5B 2J7QB 2L05A 4ZRKA 4KVGB 3CF6E 2FCSA 4URKA 5CHWA 2JY6A 1WF9A 2BYFA 2O2VA 1WE7A 1KM7A 2M4NA 1OGWA 1MG8A 4K7SA 3UINB 1IPGA 3QIJA 1S3SG 2BWES 3NZUA 2L0FA 2J0MA 1R4MI 5CTRC 1UBQA 4NNJB 3K9OB 5CX3A 4EZKA 3ONSA 2JVCA 3QC8B 2KDIA 3A4SC 3ENEA 4GDKB 2WX0A 3PT2B 2PE9A 3TJPA 5HKHA 1OEYJ 2LRUA 2WDTB 2L8JA 3DCGA 1PQSA 1Q1OA 3JSVB 2GOWA 4ANVA 5JH5C 2R2OA 4IM3A 3U8ZA 2ZCCA 3QHTA 3NS8A 3DDCB 2KNBA 2KMAA 2C7HA 4W9JA 1NDDA 4AUQC 4FBJB 2NPTB 2LD9A 1OQYA 4W9DA 3VFKA 3D32A 1I35A 4GB9A 4BOSC 3T9LA 4HDQA 4CO7A 2A4ZA 2MQJA 4FJVB 1U4AA 1RLFA 4HJKA 4ICUA 4KZ0A 4EZLA 5AZFA 1AARA 2DAFA 1WX9A 3WAMA 1WGGA 3H7SA 4EFOA 4HK2A 4DHJB 4HDOA 1NBFC 2KWUB 2KWVB 1ZGUB 2JWZA 2AL6A 1UD7A 4IWPA 2D2QA 3QQ8B 3QX1A 5FR6A 4NJ6A 2ZPYA 2LGDA 4ANUA 2GBKA 4HCNB 4G11A 2XBBC 1V5OA 1V9JA 3PLVA 1WE6A 4FJZA 2DZMA 3L17A 2KTRB 1V80A 2MP2B 3EHVA 1I42A 2KK8A 4MH0E 1A5RA 4KV2A 2KKCA 2OOBB 4XX5A 3A9JB 1C1YB 1J0GA 3A33B 1RRBA 1V6EA 1X1MA 3PHWB 3VTUA 3PGEA 2DYMA 3PS6A 2KX0A 1WGYA 4LCDE 1RFAA 4JQWC 4II3B 5TR5A 2MBHA 1WY8A 2ZZPB 4XZ4A 4GOCA 4HWIB 2LGXA 3B08A 5DPSA 2MBEA 3HM3A 3DBRI 5CHVC 4A20A 3X23A 2C7MB 4KIKB 2AWTA 3NOBA 3ZRFA 4DDGD 4TQ1A 2NR2A 1NI2A 3PRPB 1WJ6A 1XQQA 2Z0DB 2LRWA 3PTFC 4DHJD 2KTFA 3OAWA 4ZDVA 4ZRIA 2VRRB 4AJYB 2L3ZA 1Y8RC 3JYUA 4TKNA 3V6CB 4DDID 4BKTA 3L0WB 5JHAA 3UGBB 3ZNZB 1LM8B 2RD0A 2GBJA 2G3QB 2LWPA 1FXTB 1WM2A 2YLMA 5LXIB 4IWQA 1SIFA 4DBGA 3QARA 2BKRB 4FJYA 1GUAB 2GBRA 3M95A 3OLMD 2IO0B 5J17A 1E8ZA 3PLUA 3PRZA 4HPLB 4ZYNA 1TBEA 1XD3B 3ZO5B 1KOTA 3JSVA 4MSQB 2UYZB 1S1QB 1F9JA 2FCQA 2LZ6A 3CMMB 2N4FA 2JF5A 4JIOU 3ZDTA 3A9JA 4TUUA 5LXHA 4W9KA 1YX5B 2J0KA 1L7YA 3MTNB 2K8HA 2V3SA 3IVFA 1E8XA 4EOYA 2KMCA 2PPHA 2EKEC 4IW0A 3UF8A 3C0RB 2BYVE 3L13A 2C9WB 4MJSB 5C1ZA 3UQAA 1WX8A 1TGZB 4W9HA 5D7GA 2DHZA 4PYZA 4EUTA 2L0TA 3KUCB 3RZWC 4A3OA 4DHZB 2FIDA 4BKGA 2KLGA 2ZJDA 2DYBA 3H9DA 3DOWA 1BT0A 2A5UA 3MHSD 2FUHB 4JLCA 4ANWA 3VTWA 4NJ7A 2N1VA 3KYDD 4PYUA 4IM0A 4J6IA 4FA6A 1UELA 4W9CA 3PRMB 2W9NA 4BBNC 2I1JA 1GJZA 3N3KB 3RT3B 3AXCA 2K1FA 4WWPA 4BKSD 3ML8A 3O65B 2ZVOA 1WGDA 1WIAA 2LASA 2WYQA 3QWZB 2L00B 4IUMB 1GNUA 5AZHA 2JRIB 3HM6X 2K39A 1WZ3A 3A1QB 2WWZA 5BO4B 1UGMA 2BF8B 3RZFA 3T8MA 1WJUA 3ZNHB 1XT9B 2AYOB 2O6VD 1UZXB 2IY0B 3CSTA 4LJOB 1G6JA 3KYCD 4NQKE 1WM3A 3L08A 4IWOA 3TMPB 4HLEA 2DENB 2FNJB 2FIFA 3PHXB 5KHOA 2LUEA 3UIPB 4MEMA 3KVFB 4GDKA 4DHZE 3SU8X 2Z59B 2G4SA 1E7UA 2N7DA 4MGYE 4EEWA 4B95A 3TL5A 1P98A 4TV3A 3V61A 4AP4C 2LVQA 3DVGY 4GDLA 3KUZA 2LJ5A 3B1LX 4XC2A 2L7RA 4AJWA 2IO2B 2JZ3B 2JUOA 1VD2A 3VTVA 2GBMA 5E6NA 4A3PA 2N7EA
chains in the Genus database with same CATH superfamily
1Z2MA 2WXPA 5IO9A 4GMVA 1E7VA 3B0AA 2GB1A 1HEZE 2K9XA 1GG3A 4NQLB 1K53A 2INPE 1JWAD 3SD5A 3RUIB 3JW0X 4ICVA 3BVZA 4P16A 1RM6C 1TZ1A 1R4NI 3VVWB 3NG0A 1TKGA 1I4GA 3I3TB 2O2VB 3A1QA 3IBEA 4XYCA 1WFYA 1EM7A 3FILB 2IJ0A 2NBWB 1E0ZA 4EKUA 1C3TA 2LGYA 3DQVA 3ECIA 4W9LA 3VXWA 1JMLA 4M8NA 1C4CA 2N1WA 4NZLB 2MWSB 3WA0A 4HRSA 4FULA 4S0RA 4XWWA 1VDVA 1FXIA 4TMAB 2D07B 2V3NA 2MX2A 2LUMA 2L52A 4MDKE 4XDCA 1SE4A 2MJDA 4MACA 1H8CA 2ZNVB 4ZOHC 3DBSA 3VUWA 4PS3A 4KKJA 1YJJA 3APFA 1WXSA 2XNAC 2X8XX 4OZCA 1LO5D 2VZKB 3TEYA 3VAWA 4WAAA 3H8HA 2KO3A 1GPXA 4XGAB 4B9KA 3AE9B 3FILA 2K8BA 4F1SA 4LNNA 2KAJA 4BVUC 2JU6X 3DPDA 4P7IA 1T0SC 5J18A 4HPMB 1YNTE 1FO4A 2KDBA 2RSUA 4W9IA 1WR1A 3DBLI 2HJ8A 2KXJA 3AEBB 3BY4B 4OZBA 3LYYA 2CHXA 2KJHB 2N9EB 4K7UA 4HXDA 3W9CB 2FAZA 1WYWB 2ONQA 2DWQA 3IG3A 1WSPA 3WALA 3OJ4B 3WIMA 2PEAA 1QZEA 4A8XC 4WWOA 2DZKA 1CJEA 3R7RA 2JYTA 3P4QB 5IAAC 2LXCA 2MBQA 4WJQA 5EE1A 3JVZX 1XXGA 4P6VF 4BAXA 4E74A 3RYTA 4DK5A 4GU2A 2XK5B 1PFDA 2HJ1A 1YD8U 2BS2B 2NBUA 3ZNID 1WJ4A 1JCKB 3QAQA 3VH4B 2JT4B 1SBBB 3RNEC 2QMTA 3N30A 1P7EA 3B2FA 2HDEA 2B76B 3X0WA 3W1YA 2BQQA 4US9A 3EECA 4KSKC 3ZKJC 1ZUD2 1J8CA 1I7HA 2ZEQA 1ET6A 1UUPA 1L4DB 1VJKA 3VDZA 4YXDB 5L83A 3SFEB 1FNUA 3NZSA 4BFRA 3CIRB 2GBNA 3V60A 1E6EB 4FADA 3R7QA 3DVGX 4KDLB 1IBXB 2ZNVC 2Y3AA 4DXAB 2BKFA 1L2NA 3ZIMA 3R8BA 3H6NA 5BYQA 2N0SB 2J53A 2C60A 2LI5A 4ZRPA 2XK5A 4E71A 2XEWA 3KWLA 2UWQA 3Q3FA 2FCMA 1Q5WB 1D5MC 1TYGB 1E8YA 2INDC 1AWDA 3I5JC 1OQRA 2BVCA 1H4RA 4HVBA 1HTOA 4KIKA 2WS3B 2ICIA 2L05A 4Q2JA 4RF0A 2JY6A 1WF9A 1KM7A 1MG4A 3QIJA 3AV8A 1S3SG 3C8YA 1JW9D 4AS1A 5HI1A 1UBQA 4HROA 4EZKA 3ENEA 3ZYYX 1TKEA 4RFBA 2LGSA 1PQSA 4ANVA 3U8ZA 2ZCCA 2KNBA 2WLBA 2C7HA 4AUQC 4NJCA 4BOSC 1EU4A 4HDQA 1RLFA 4KZ0A 1C4PA 5AZFA 1AARA 2DAFA 5AUKA 2KVZA 1K51A 2KWDA 1FCCC 2JWZA 2AL6A 3NVYA 1E9MA 3FC4A 3PLVA 1V8CA 3NVWA 3L17A 1GB1A 2K5PA 1FXAA 2KKCA 3MP9A 1C1YB 1XEEA 1KF6B 1V6EA 4KGTA 2LHEA 1RFAA 2MBHA 1XO3A 2Q5WD 1NVID 2GLSA 1DOYA 3B08A 3GS2A 3NS1A 1LGRA 4A20A 3NOBA 1XQQA 4A90A 3AB5A 1XCQL 4DHJD 3U4EG 4ZHOA 1TT5B 4IDIA 1Y8RC 2INCC 5JHAA 1LM8B 2RDHA 2N7JA 1WM2A 5LXIB 4IWQA 4M01A 2BKRB 3OLMD 3M95A 5J17A 3OG5A 2IO0B 3PLUA 3BIID 4LNKA 3PRZA 4ZHPA 1N61A 1XD3B 1SF0A 1F9JA 2LZ6A 2N4FA 2I2YA 1E8XA 2BYVE 1XCTL 4C80A 1WX8A 2KT7A 3AMZA 3KUCB 3DOWA 2PW9A 1IGCA 4L1BA 1IUEA 3MHSD 2ZW0A 4ANWA 3VTWA 2UU7A 3PZ7A 1AW7A 1GJZA 4BBNC 2I1JA 1SJED 1HZ5A 3ML8A 3O65B 4IUMB 1UGMA 1WJUA 2AYOB 3VRBB 4H2AA 2VZKD 1WGKA 4NQKE 3TMPB 5KHOA 3LB8C 4MEMA 2JSVX 1HTQA 3P4RB 4B95A 3V61A 2DLBA 2LVQA 3KUZA 3AECB 3B1LX 1SSNA 3RI7C 4O1NA 1HQRD 1JWBD 1N63A 2JUOA 1VD2A 5E6NA 4A3PA 2N7EA 3DVNU 3AU5A 3NRZA 2OJWA 3VH3B 4M8MA 3MC0B 5DPRA 4G3XB 1JRUA 4W9EA 3A4RA 1TKYA 3Q2AC 1FIQA 1EF5A 3EC8A 2CU3A 2NCNA 2E6XA 2M8SA 3KWVA 1EO6A 5KHQA 1DOXA 2CS4A 1N5WA 2EKIA 5MPOA 1OTRB 4JE3B 1P7FA 3V62A 4PK1A 2IO3B 5FR3A 2MHJA 1MI0A 4KDIC 1QOAA 3WAOA 4PS7A 1L6VA 4FN2A 3KH0A 5L95C 1ZDXA 4F7ZA 1KTKA 3U7DA 4X57B 2JZPA 2K25A 2PMVA 1GC7A 3L4PA 2MW5A 4IKGA 1C4AA 2IGDA 3IAS1 2M19A 1XLQA 4WJOA 3DVNV 1BMLC 1EUVB 3IXSA 2MRPA 5EE0A 5GMVA 4AOFA 5IP4D 2BS3B 4XWTA 3UIOB 1J19A 2YVCA 3I57A 5DPTA 3NJTA 3E56A 1WXQA 3AN1A 4DXGA 3N20C 1YIWA 2K3UA 3PREA 4RMAA 4B0MA 2N9XA 5IOIA 1K52A 1WWTA 4OZAA 1QILA 3AI5A 2K0PA 2LEKA 1M94A 1FRDA 3WAPA 4MELA 3ZDMC 1SE3A 3PZ8A 3TEWA 2KN5A 1EU3A 3DBHI 4REZA 3RFZB 1K8RB 4KSLC 4ANXA 5J2RA 2PE6B 3HK0A 2MCNB 2IYDB 1YN3A 4MSMB 2WXQA 1DYQA 2V4LA 4YTMB 4AWJA 4OHJA 2HTHA 1P9DU 3P63A 4MM3B 3A9KB 4YL8A 3TUOA 1GC6A 4AQ7A 2QEJC 3QK0A 1F1HA 2MP2A 4ZYSA 3M63B 4G0NB 3ABVB 3UQBA 3IHPC 4WQOB 2G4DB 2RDBC 3HVDA 1R4NB 3ZVVA 2Z0EB 1I4PA 2KC2A 1WXMA 4MH8A 4HKQA 2HTME 4JGHB 1TY2A 2MLBA 2C7NB 1MPEA 4YT0B 4XDDA 1FRRA 2L76A 2PVOD 3ZNGC 2ZVNA 1T5XD 4TSSA 4C7ZA 2ASQA 3PZDA 3MFGA 4JWUC 1WXVA 3AE2B 1MJDA 2EMTA 3VRAB 3L10B 2DZIA 4OVUA 3AEDB 3GOEA 2N9KA 3ZGZA 1V2YA 1WJNA 4JX1C 4G50A 3OWEB 4YWGG 5LNK1 2QSDA 3R2IA 2CHWA 2ON8A 4C56C 1YN4A 1M4VA 1CZPA 2N9PC 1YOVB 3QCAA 1E7PB 4N9F4 2ZW1A 1VZ8A 4DXFA 5E6OA 3Q3MC 2DNFA 2PLPA 2BTEA 1QKZA 1FCLA 2WX1A 1Q0WB 3APCA 4C7YA 3GZNB 1V5TA 2NBVB 2V9HA 2RGFA 1C9FA 1BUIC 2JPHA 1PGXA 1TJEA 1E90A 2WXOA 3C19A 2LJIA 1WRDB 1BXTA 1LFDA 2L32A 4MGKE 5IA7A 3ZRCA 4IC7B 3RULA 2MJ3A 3RCZA 4YSZB 1ET9A 4N59A 2BS4B 3ZTCA 2GI9A 4LTUA 2BPSA 2PTLA 1CK1A 4EE2A 2J7QB 3AE6B 4KVGB 1JWUD 3CF6E 2WP9B 1ACCA 1NYQA 1WE7A 2CJNA 2IDYA 4A9AA 3NZUA 1SEBD 1R4MI 1XLNA 5CTRC 4NNJB 3K9OB 3ONSA 2KDIA 1VZ6A 3BK1A 2LRUA 5GXGB 2L8JA 3DCGA 3BWUD 3JSVB 3V05A 5JH5C 2BT6A 2IGGA 5I4DA 4K3BA 3O13A 3QHTA 3NS8A 3TSSA 3N1YC 2KMAA 1UF0A 2NPTB 2LD9A 1I35A 1JRPA 4GB9A 3DBHB 4FJVB 1U4AA 3IT4B 3BVMA 3CWIA 2RMMA 4EFOA 5AUIA 1TS4A 2KWVB 1RWSA 1ZGUB 4PT5A 4IWPA 2D2QA 2ZPYA 2LGDA 4ANUA 4JWSC 2GBKA 1V5OA 2Y5CA 4BZAA 1C77A 4LNIA 2KK8A 4MH0E 1C78A 5H8YE 2BYTA 5H92C 4JQWC 2D3AA 4II3B 2MEKA 5TR5A 2QDFA 2LMCA 5DPSA 1D5XC 3RNCC 4P1CC 2QCZA 2QIEB 2LRWA 2KTFA 4TKNA 4QAYA 3R2TA 4N58A 2WU2B 1FEHA 2RD0A 2GBJA 2IPKD 4HEA1 1PYWD 1FXTB 1SIFA 1MHHE 4FJYA 1GUAB 3ZQ4A 2PKOA 4HPLB 1KRHA 3ZJVA 3N1ZC 2L83A 1TBEA 3ZO5B 4ARIA 4WIPA 1S1QB 3CMMB 2Z8LA 1YQ3B 3ZDTA 1QOFA 5LXHA 3MTNB 1T3QA 4LLGM 2RPVA 4WQMA 2KMCA 2EKEC 4KGRA 2C9WB 2FE8A 2JQRB 3UQAA 3DHIC 2NTSA 5D7GA 3RZWC 3NUHB 3H9DA 2X38A 1BT0A 2A5UA 1MFWA 2JXTA 2WU5B 4NJ7A 3Q8CA 1JWMD 2K22A 1UELA 4W9CA 2W9NA 3AH7A 3ZJTA 1WIAA 3QWZB 2L00B 2JRIB 2K39A 5BO4B 3AE7B 3AE8B 1XT9B 2O6VD 2IY0B 1PUTA 2INNE 4KGSA 2WXKA 3ETRA 1PDXA 3KYCD 3L08A 2LUEA 3MHZA 3UIPB 3I9V1 2G4SA 3LXFA 4MGYE 4EEWA 3ZXRA 4AP4C 3DVGY 4XC2A 3P4PB 2L7RA 4AJWA 5G5HA 2IO2B 3VTVA 2GBMA 2BW2A 2DAJA 2WXMA 4RCOA 4W9GA 4M0WB 4RM8A 2VH1A 2MBBB 4R3DA 4LJPB 2O6VB 3MC8A 5AZGA 4MM3A 1KLVA 3J9CA 5C2TB 3KUDB 3RNBC 1J7CA 2CHZA 4EZJA 2CU1A 2JZZA 3LDZE 2KC1A 2J0JA 2KDEB 1NENB 1MVKA 1K50A 1NEKB 3EFUA 1ISNA 2QILA 4YTNB 3P1MA 5BMIA 2KZRA 4YTPB 3OJ3A 2KDMA 1R4MB 1F0ZA 2IBIB 3URYA 2G45B 1L0VB 5G5GA 4WH4A 2ZCBA 4F8CB 3K9PB 1L0XB 1T0QC 4CQNA 3AULA 4FHJA 4GXBA 3V6EB 2NS5A 1QF6A 5EDSA 1F2RC 4RM9A 2D3BA 4I6NB 1ZW7A 3KW5B 3W1SA 3L54A 3W1SC 2KMMA 1J7BA 3GB1A 3U30A 2BGFA 2HE7A 4LDTD 1TTNA 2KHWB 1C79A 2KOXA 2AQ1B 1Z5SB 3HHMA 3Q3NC 4GDLB 4GLSC 5LLIA 1T0YA 2NPTA 4DWFA 5JXVA 3Q8AA 2EMSA 1WR6E 4MJSA 1WH3A 2RR9A 3VHTC 3AM9A 4JPSA 2B3AA 1V1PA 1WMHA 2MA9B 2Y5BB 3RPFC 1CMXB 3H1UA 2WDQB 2M17A 4M02A 1FPYA 3BYTB 4LK0M 2KQ4X 4S17A 2AL3A 2NVUI 4KX6B 4KKIA 2PJHA 3BINA 1P0RA 2V1YA 3AEEB 2WQYB 4GIVA 1RAXA 2I1KA 2KFKB 1ZE3D 5D3DA 4MGZE 2KQ7A 1AN8A 1UWMA 1VCBA 1FFUA 4K81A 3R3MA 1WGRA 1IBXA 1D5ZC 1WGHA 4ASWC 2DZJA 1MHXA 2D10A 1P1AA 5JZEB 3DWMA 3VUYA 2KFJA 2AEHA 4E3CA 1WZ0A 2D11A 1UBIA 3KQ4A 4C00A 1V81A 5C3JB 1FM0D 1D3ZA 2KDFB 5E6PA 1WMHB 2QHOA 3ZW3A 3NVVA 4NAWA 4DQOC 2G9HD 4J3OD 1N62A 1Q10A 4OVVA 1YJ1A 3Q3JA 4NPNA 2SEBD 4ZRJA 4WURA 2W82A 2KFKA 2OJRA 3CSFA 2FBWB 3PPAA 1I4QA 3L16A 2LVPA 1KJTA 4LDTB 4RGMA 3SDLC 3PSEB 2JWUA 5G2NA 3RNAC 3EUB2 3TIXA 4II2B 1TY0A 3BVGA 3W5UB 5DCNA 1WX7A 4IG7B 2CR5A 1WI0A 1UH6A 4BBNF 3AE1B 4RGNA 1XLOA 2I38A 2FCSA 1TS5A 5CHWA 1ENFA 2BYFA 2O2VA 2XN9C 2TSSA 1OGWA 3BYYB 1MG8A 3E9SA 4K7SA 4MT5A 3UINB 1IPGA 2BWES 1IGDA 2L0FA 2J0MA 5CX3A 1TS3A 3QC8B 3A4SC 3MC9A 1V97A 4GDKB 2WX0A 2WDTB 2WNMA 1Q1OA 3N1XC 3DDCB 1YJIA 4W9JA 5E6JA 3U52E 3GP7A 4WWMA 1ROEA 1N6ZA 2WXNA 3VFKA 4W9DA 2V0GA 3D32A 5IKCM 4CO7A 3HRDD 4HJKA 4ICUA 4EZLA 3H7SA 1D4BA 4DHJB 4HDOA 2KWUB 1GB4A 1UD7A 1HA5A 3U7ZA 3QQ8B 3QX1A 5FR6A 3SEBA 2GRIA 4HCNB 2V3PA 1V9JA 1WE6A 2LFIA 1UNSA 1V80A 2MP2B 3EHVA 3Q3OC 3RNFC 1I42A 4KV2A 3A9JB 1J0GA 2EELA 3ZJUA 1RRBA 2VH2A 1X1MA 3PHWB 1UWXA 4C4VA 3PS6A 2KX0A 1GAQB 4LCDE 4XZ4A 4GOCA 4HWIB 2LGXA 2MJEA 3I63C 2MBEA 4LNOA 3DBRI 5CHVC 4L2YA 1AYFA 2C7MB 4DDGD 4TQ1A 1NI2A 3PRPB 1JWSD 2Z0DB 4L23A 3OAWA 4ZDVA 4ZRIA 2VRRB 4AJYB 4ZRQA 4DDID 2SAKA 2WXIA 3L0WB 1DOIA 3DHHC 4A55A 4YSYB 1I4XA 2Y5PA 3AE4B 4DBGA 4OW0A 4M0WA 2GBRA 3NZ3A 1E8ZA 1TZOA 1VLBA 4ZYNA 3UI3A 1KOTA 3JSVA 1ESFA 2UYZB 2FCQA 2JF5A 3A9JA 4TUUA 4W9KA 2J0KA 1B1ZA 2PPHA 1XLPA 3UF8A 4MJSB 1FMAD 1TGZB 4W9HA 1PGBA 4EUTA 1E10A 2L0TA 2AX5A 4BKGA 2DYBA 2M56B 3TEXA 3TEZA 5BYRA 4JLCA 3HVZA 3DBRB 4FA6A 3IAM1 3RT3B 3AEFB 1UGJA 4WWPA 4BKSD 2ZVOA 1WGDA 2LASA 3Q8FA 3Q8EA 1GNUA 5AZHA 2WXHA 2BF8B 3RZFA 1HXYD 1UZXB 4LJOB 2OHFA 3AEAB 4HLEA 2FNJB 3PHXB 2MH7A 1ZXHA 4LNFA 3SU8X 4P1BC 3N9YC 1E7UA 3ZXVA 1QLBB 2N7DA 1WRIA 1P98A 4GDLA 2LJ5A 4RF1A 2W3RA 2WXLA 1J7AA 4ARCA 1NI3A 1YN5A 2JZ3B 2E3TA 3V3XA 2C5LC 2WXGA 4NAMA 4US8A 5T8IA 2IZVB 1KH0A 3ZLZA 1C76A 3BZDB 2HD5B 3DBLB 1FNVA 2BBCA 4I6PA 1KLUD 2KQSA 2KJ6A 4WAFA 2KD0A 3HUIA 5D94A 3N32A 3B9JA 3ML9A 5D2MB 3WANA 3R66C 2LHDA 4B0EA 1NYRA 3ZTDA 2KTRA 2W54A 1CQVA 2IY1B 3P2BA 1N60A 3H7PB 4ITKA 1D6EC 2KACA 4RNAA 1V49A 3PVLA 2DBYA 2D3GA 2M0XA 4BKSA 2K8CA 1F52A 3GE3C 5C23A 5BMHA 4WJNA 2R2QA 1VRAB 1SXTA 5DPWA 4W9FA 2J52A 3NY5A 5EE9A 2IO1B 1IYFA 2JXXA 2RPQA 1T6BX 2QJLA 4I6LB 4A6QA 1OEYA 1L0YB 1P3QU 5CHFA 1SE9A 2DYOA 2MBOA 1SGHA 1OFFA 1QT9A 2D5GA 5IN7A 3RMKC 4NAWB 3S2AA 2CJOA 2OEDA 4CYEA 2WDVB 3PO0A 1TS2A 3H7PA 2RDGA 4GGQA 3RNGC 5G55A 4FLHA 1SIJA 3HIZA 4JL9A 5TSSA 4NY0A 3AEGB 2BYEA 1HZ6A 2JRHA 2D3CA 4IOIE 2O6VA 2K6QA 3FAHA 1QOGA 5BMGA 3W2DA 2GMIC 2M0AA 1ZPSA 5D6JB 4MGIE 2LGIA 3TCAA 3RD2A 1E8WA 3PV1A 4WWNA 2V4IB 4CHKA 3DHGC 2KLCA 3AU4A 1L4ZB 2WDRB 1V86A 3SR6A 3IFWB 1IP9A 2KVRA 3SHQA 2BB5A 3APDA 4GSWA 3DWGC 4HCPB 2LXAA 2REXA 4PS8A 3EA6A 2FCNA 4D2KA 3QJZA 2IGHA 2NMQA 3SFDB 3TBLD 1SJHD 1HE8A 2ZPNA 2R61A 5AEKB 1KLGD 4HJGE 2YEPF 1YX6B 1WXAA 4FHKA 3EGRA 2G1EA 1LXDA 2K6DB 2KANA 3A9KA 1YQBA 4YSXB 1Y56A 3MJ5A 3VQIA 3VUXA 2H88B 3GZNI 3LJ3A 2KWCA 3M62B 2CKHB 1EWCA 1VZ7A 1E5WA 4HPPA 3BK2A 5EE3A 1L6UA 1XF5L 5JHBA 1F2RI 2KJRA 2M1MA 1JQ4A 3NHEB 3AE5B 3ZUNA 3T3NA 2LVOA 1EF1A 2MSED 3FKYA 5BYSA 3ALBA 4KZCA 4IM2A 1ZKHA 4TQ0A 2KX3A 4K7WA 4B6WA 3IT6B 3M3JA 2BWFA 3MJWA 3QA8A 4GN1A 4K1RB 4BOZB 1YQ4B 4WJPA 3RN9C 1LQBA 3P4SB 3T3OA 2DX5B 2L1AA 1WYGA 4ZRKA 4URKA 2KYWA 1F77A 2M4NA 4XE0A 3U2SC 1N5XA 1ZXIA 1A70A 2JVCA 1SB3C 5FK9C 3PT2B 2PE9A 3TJPA 5HKHA 1OEYJ 1RFKA 3Q8BA 2W3SA 3Q69A 4USAA 3KLSX 2NTTA 2GOWA 2BB6A 2R2OA 4IM3A 1T0RC 2KN4A 4M00A 1NDDA 4FBJB 1OQYA 4RH6A 3T9LA 2A4ZA 2MQJA 2YEPB 1WX9A 3WAMA 1WGGA 4K3CA 3P42A 4HK2A 1RYJA 1DGJA 1NBFC 3W5VB 2WXRA 1QOBA 4NJ6A 2H89B 4N6EB 2ACZB 4G11A 2XBBC 1OQQA 1R7SA 4FJZA 2J4XA 1QQRA 2DZMA 2KTRB 2J42A 1A5RA 1FNWA 4XX5A 2OOBB 3A33B 4RGOS 4OVZA 4UDUC 3VR8B 3VTUA 3PGEA 2DYMA 1FD6A 1WGYA 1WY8A 2ZZPB 2QC8A 5HFYA 3HM3A 3WCQA 3X23A 4KIKB 2AWTA 3ZRFA 4ACFA 1JALA 2NR2A 1YMHE 1WJ6A 2WXFA 3Q14C 3PTFC 2JX5A 2L3ZA 3NVZA 3JYUA 3V6CB 4BKTA 3UGBB 1V1PB 2JYEA 2WGSA 3ZNZB 3GE8C 2G3QB 2LWPA 2AQ2B 2PVGC 2YLMA 3QARA 1L5PA 3Q6BA 1STEA 5FKAC 4MSQB 1I4RA 4JIOU 1YX5B 4RGTA 1L7YA 2K8HA 2V3SA 4FXCA 3IVFA 4HKZE 4EOYA 2W55A 2N9LA 4IW0A 5D3IB 3C0RB 3L13A 5C1ZA 2DHZA 4PYZA 4DHZB 1B9RA 4A3OA 1VR9A 1TIFA 2FIDA 2KLGA 2ZJDA 1KFYB 1FFVA 1EWYC 2WHIA 2FUHB 2N1VA 3KYDD 4PYUA 2WXJA 3AE3B 4IM0A 4J6IA 3EFCA 1ZOYB 3PRMB 3N3KB 5HHDG 3AXCA 1V1OA 2K1FA 3B2GA 2WYQA 1ZDVA 3HM6X 1WZ3A 3A1QB 2WWZA 3T8MA 3ZNHB 1GOZA 4C4VB 3CSTA 1G6JA 1WM3A 4IWOA 2DENB 2FIFA 1JROA 3KVFB 1ZP0B 4GDKA 5HG2A 4DHZE 2Z59B 1I4HA 3TL5A 4TV3A 2PIAA 2FUG1 2AQ3B 1SE2A 1PGAA 3VR9B
chains in the Genus database with same CATH topology
1Z2MA 2DAJA 2C5LC 2IZVB 4GMVA 1E7VA 3DVNU 3ZLZA 3AU5A 3B0AA 4W9GA 4M0WB 4RM8A 2HD5B 3VH3B 4I6PA 4M8MA 1GG3A 2MBBB 4NQLB 5DPRA 4LJPB 2KQSA 4G3XB 1JRUA 2KJ6A 3SD5A 2O6VB 4W9EA 3RUIB 3JW0X 3A4RA 4ICVA 5AZGA 2KD0A 4MM3A 5D94A 1EF5A 1KLVA 3KUDB 3N32A 3EC8A 1TZ1A 2NCNA 1R4NI 2CHZA 3ML9A 5D2MB 3VVWB 2CU1A 3I3TB 3WANA 2JZZA 4EZJA 3LDZE 2KC1A 2O2VB 2J0JA 3A1QA 2M8SA 3IBEA 3R66C 3ZTDA 2KDEB 1WFYA 1EO6A 2KTRA 5KHQA 2CS4A 2IY1B 2NBWB 1OTRB 3EFUA 3H7PB 3P2BA 1ISNA 4EKUA 3V62A 1C3TA 2IO3B 1V49A 2KZRA 3PVLA 2LGYA 3DQVA 3ECIA 2D3GA 4KDIC 4W9LA 3OJ3A 3WAOA 3VXWA 2M0XA 4PS7A 4BKSA 4M8NA 2IBIB 4FN2A 2K8CA 3KH0A 5L95C 2G45B 4F7ZA 2ZCBA 5C23A 2N1WA 3U7DA 3K9PB 4F8CB 4WJNA 2R2QA 4X57B 2MWSB 2K25A 3WA0A 1GC7A 5DPWA 4W9FA 3AULA 3NY5A 2MW5A 4FULA 4FHJA 2IO1B 4GXBA 1IYFA 2JXXA 2RPQA 3V6EB 2NS5A 3DVNV 4I6LB 4WJOA 5EDSA 1OEYA 4RM9A 1EUVB 4I6NB 2D07B 1ZW7A 1P3QU 2MX2A 3KW5B 3W1SA 2MRPA 3L54A 5CHFA 3W1SC 4MDKE 1SE9A 2DYOA 2MBOA 1SGHA 5GMVA 4AOFA 3U30A 2BGFA 1H8CA 3UIOB 2HE7A 2ZNVB 1J19A 4NAWB 4LDTD 1TTNA 2KHWB 2YVCA 3DBSA 2KOXA 3VUWA 3S2AA 4PS3A 5DPTA 3APFA 1WXSA 4CYEA 1Z5SB 1YIWA 3PREA 4RMAA 2N9XA 3HHMA 3VAWA 4WAAA 2KO3A 4GDLB 4B9KA 5LLIA 2K8BA 3H7PA 3AI5A 4GGQA 1T0YA 5G55A 1M94A 4F1SA 3WAPA 4FLHA 4BVUC 4MELA 2NPTA 3ZDMC 3HIZA 4DWFA 2KN5A 4JL9A 3DPDA 3DBHI 4P7IA 1K8RB 2EMSA 1WR6E 4KSLC 4MJSA 4ANXA 1WH3A 5J18A 4HPMB 2PE6B 2RR9A 3HK0A 2MCNB 2IYDB 4NY0A 5J2RA 4MSMB 2BYEA 2KDBA 3VHTC 2RSUA 2V4LA 2JRHA 2B3AA 1WMHA 1WR1A 2MA9B 2Y5BB 3DBLI 4W9IA 1CMXB 2HJ8A 3H1UA 2KXJA 4AWJA 2M17A 2O6VA 2HTHA 3BY4B 1P9DU 2K6QA 2GMIC 2AL3A 2NVUI 3A9KB 4YL8A 1GC6A 2CHXA 2KJHB 5D6JB 4MGIE 3TCAA 2PJHA 3BINA 2N9EB 1P0RA 2V1YA 4K7UA 3RD2A 1E8WA 4HXDA 3PV1A 4WWNA 2FAZA 1WYWB 3QK0A 4CHKA 3IG3A 2KLCA 3WALA 4GIVA 2MP2A 3AU4A 1RAXA 3OJ4B 2I1KA 3WIMA 2KFKB 1QZEA 2PEAA 4WWOA 2DZKA 3M63B 4G0NB 3R7RA 3UQBA 3IHPC 1V86A 4MGZE 2KQ7A 1VCBA 4WQOB 3IFWB 1IP9A 4K81A 3R3MA 2G4DB 5IAAC 2KVRA 1WGRA 2LXCA 3SHQA 2MBQA 3APDA 4WJQA 3JVZX 3ZVVA 2Z0EB 1WGHA 2KC2A 4ASWC 4GSWA 2DZJA 4HCPB 4E74A 1WXMA 3RYTA 2LXAA 2D10A 4DK5A 4JGHB 1P1AA 4GU2A 5JZEB 2REXA 2XK5B 2MLBA 4PS8A 1YD8U 2FCNA 2C7NB 3VUYA 2KFJA 2NBUA 3ZNID 1WJ4A 2AEHA 4E3CA 1WZ0A 3QAQA 2L76A 3QJZA 3ZNGC 2D11A 3VH4B 2ZVNA 2JT4B 1UBIA 2ASQA 3PZDA 3N30A 1V81A 1WXVA 3TBLD 1D3ZA 3X0WA 2EMTA 3L10B 2DZIA 2KDFB 4OVUA 3W1YA 3GOEA 1HE8A 2ZPNA 3EECA 5E6PA 1WMHB 5AEKB 2QHOA 3ZW3A 1V2YA 4KSKC 3ZKJC 1WJNA 1YX6B 4NAWA 1J8CA 4G50A 1WXAA 4FHKA 2ZEQA 1LXDA 2CHWA 2K6DB 2KANA 3A9KA 4HVBA 4OVVA 1YQBA 1YJ1A 3Q3JA 4NPNA 3VQIA 3VUXA 3VDZA 2N9PC 5L83A 3QCAA 4ZRJA 3GZNI 3LJ3A 4N9F4 2KWCA 3NZSA 3M62B 5E6OA 4BFRA 2CKHB 2GBNA 2KFKA 3V60A 1E5WA 2WX1A 1Q0WB 4FADA 2OJRA 3CSFA 3APCA 3R7QA 3PPAA 3L16A 2LVPA 1KJTA 3DVGX 4KDLB 5JHBA 2KJRA 2ZNVC 1V5TA 2M1MA 4DXAB 2BKFA 2NBVB 4LDTB 3NHEB 3SDLC 2RGFA 3ZUNA 3ZIMA 1L2NA 2JPHA 3PSEB 3H6NA 2LVOA 1E90A 1EF1A 2MSED 5G2NA 2C60A 2LI5A 1WRDB 2XK5A 4E71A 3TIXA 1LFDA 4MGKE 2XEWA 3ALBA 5IA7A 4II2B 2UWQA 4IC7B 4KZCA 4IM2A 3ZRCA 3Q3FA 2FCMA 1ZKHA 3RULA 3RCZA 5DCNA 4TQ0A 1Q5WB 2KX3A 1WX7A 4IG7B 2CR5A 1E8YA 4K7WA 4B6WA 1WI0A 3M3JA 3ZTCA 2BWFA 3MJWA 1H4RA 1UH6A 3QA8A 4GN1A 4K1RB 4BBNF 4BOZB 2BPSA 4KIKA 4WJPA 1LQBA 2DX5B 2J7QB 2L05A 4ZRKA 4KVGB 3CF6E 2FCSA 4URKA 5CHWA 2JY6A 1WF9A 2BYFA 2O2VA 1WE7A 1KM7A 2M4NA 1OGWA 1MG8A 4K7SA 3UINB 1IPGA 3QIJA 1S3SG 2BWES 3NZUA 2L0FA 2J0MA 1R4MI 5CTRC 1UBQA 4NNJB 3K9OB 5CX3A 4EZKA 3ONSA 2JVCA 3QC8B 2KDIA 3A4SC 3ENEA 4GDKB 2WX0A 3PT2B 2PE9A 3TJPA 5HKHA 1OEYJ 2LRUA 2WDTB 2L8JA 3DCGA 1PQSA 1Q1OA 3JSVB 2GOWA 4ANVA 5JH5C 2R2OA 4IM3A 3U8ZA 2ZCCA 3QHTA 3NS8A 3DDCB 2KNBA 2KMAA 2C7HA 4W9JA 1NDDA 4AUQC 4FBJB 2NPTB 2LD9A 1OQYA 4W9DA 3VFKA 3D32A 1I35A 4GB9A 4BOSC 3T9LA 4HDQA 4CO7A 2A4ZA 2MQJA 4FJVB 1U4AA 1RLFA 4HJKA 4ICUA 4KZ0A 4EZLA 5AZFA 1AARA 2DAFA 1WX9A 3WAMA 1WGGA 3H7SA 4EFOA 4HK2A 4DHJB 4HDOA 1NBFC 2KWUB 2KWVB 1ZGUB 2JWZA 2AL6A 1UD7A 4IWPA 2D2QA 3QQ8B 3QX1A 5FR6A 4NJ6A 2ZPYA 2LGDA 4ANUA 2GBKA 4HCNB 4G11A 2XBBC 1V5OA 1V9JA 3PLVA 1WE6A 4FJZA 2DZMA 3L17A 2KTRB 1V80A 2MP2B 3EHVA 1I42A 2KK8A 4MH0E 1A5RA 4KV2A 2KKCA 2OOBB 4XX5A 3A9JB 1C1YB 1J0GA 3A33B 1RRBA 1V6EA 1X1MA 3PHWB 3VTUA 3PGEA 2DYMA 3PS6A 2KX0A 1WGYA 4LCDE 1RFAA 4JQWC 4II3B 5TR5A 2MBHA 1WY8A 2ZZPB 4XZ4A 4GOCA 4HWIB 2LGXA 3B08A 5DPSA 2MBEA 3HM3A 3DBRI 5CHVC 4A20A 3X23A 2C7MB 4KIKB 2AWTA 3NOBA 3ZRFA 4DDGD 4TQ1A 2NR2A 1NI2A 3PRPB 1WJ6A 1XQQA 2Z0DB 2LRWA 3PTFC 4DHJD 2KTFA 3OAWA 4ZDVA 4ZRIA 2VRRB 4AJYB 2L3ZA 1Y8RC 3JYUA 4TKNA 3V6CB 4DDID 4BKTA 3L0WB 5JHAA 3UGBB 3ZNZB 1LM8B 2RD0A 2GBJA 2G3QB 2LWPA 1FXTB 1WM2A 2YLMA 5LXIB 4IWQA 1SIFA 4DBGA 3QARA 2BKRB 4FJYA 1GUAB 2GBRA 3M95A 3OLMD 2IO0B 5J17A 1E8ZA 3PLUA 3PRZA 4HPLB 4ZYNA 1TBEA 1XD3B 3ZO5B 1KOTA 3JSVA 4MSQB 2UYZB 1S1QB 1F9JA 2FCQA 2LZ6A 3CMMB 2N4FA 2JF5A 4JIOU 3ZDTA 3A9JA 4TUUA 5LXHA 4W9KA 1YX5B 2J0KA 1L7YA 3MTNB 2K8HA 2V3SA 3IVFA 1E8XA 4EOYA 2KMCA 2PPHA 2EKEC 4IW0A 3UF8A 3C0RB 2BYVE 3L13A 2C9WB 4MJSB 5C1ZA 3UQAA 1WX8A 1TGZB 4W9HA 5D7GA 2DHZA 4PYZA 4EUTA 2L0TA 3KUCB 3RZWC 4A3OA 4DHZB 2FIDA 4BKGA 2KLGA 2ZJDA 2DYBA 3H9DA 3DOWA 1BT0A 2A5UA 3MHSD 2FUHB 4JLCA 4ANWA 3VTWA 4NJ7A 2N1VA 3KYDD 4PYUA 4IM0A 4J6IA 4FA6A 1UELA 4W9CA 3PRMB 2W9NA 4BBNC 2I1JA 1GJZA 3N3KB 3RT3B 3AXCA 2K1FA 4WWPA 4BKSD 3ML8A 3O65B 2ZVOA 1WGDA 1WIAA 2LASA 2WYQA 3QWZB 2L00B 4IUMB 1GNUA 5AZHA 2JRIB 3HM6X 2K39A 1WZ3A 3A1QB 2WWZA 5BO4B 1UGMA 2BF8B 3RZFA 3T8MA 1WJUA 3ZNHB 1XT9B 2AYOB 2O6VD 1UZXB 2IY0B 3CSTA 4LJOB 1G6JA 3KYCD 4NQKE 1WM3A 3L08A 4IWOA 3TMPB 4HLEA 2DENB 2FNJB 2FIFA 3PHXB 5KHOA 2LUEA 3UIPB 4MEMA 3KVFB 4GDKA 4DHZE 3SU8X 2Z59B 2G4SA 1E7UA 2N7DA 4MGYE 4EEWA 4B95A 3TL5A 1P98A 4TV3A 3V61A 4AP4C 2LVQA 3DVGY 4GDLA 3KUZA 2LJ5A 3B1LX 4XC2A 2L7RA 4AJWA 2IO2B 2JZ3B 2JUOA 1VD2A 3VTVA 2GBMA 5E6NA 4A3PA 2N7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2M A;  2DAJ A;  2C5L C;  2IZV B;  4GMV A;  1E7V A;  3DVN U;  3ZLZ A;  3AU5 A;  3B0A A;  4W9G A;  4M0W B;  4RM8 A;  2HD5 B;  3VH3 B;  4I6P A;  4M8M A;  1GG3 A;  2MBB B;  4NQL B;  5DPR A;  4LJP B;  2KQS A;  4G3X B;  1JRU A;  2KJ6 A;  3SD5 A;  2O6V B;  4W9E A;  3RUI B;  3JW0 X;  3A4R A;  4ICV A;  5AZG A;  2KD0 A;  4MM3 A;  5D94 A;  1EF5 A;  1KLV A;  3KUD B;  3N32 A;  3EC8 A;  1TZ1 A;  2NCN A;  1R4N I;  2CHZ A;  3ML9 A;  5D2M B;  3VVW B;  2CU1 A;  3I3T B;  3WAN A;  2JZZ A;  4EZJ A;  3LDZ E;  2KC1 A;  2O2V B;  2J0J A;  3A1Q A;  2M8S A;  3IBE A;  3R66 C;  3ZTD A;  2KDE B;  1WFY A;  1EO6 A;  2KTR A;  5KHQ A;  2CS4 A;  2IY1 B;  2NBW B;  1OTR B;  3EFU A;  3H7P B;  3P2B A;  1ISN A;  4EKU A;  3V62 A;  1C3T A;  2IO3 B;  1V49 A;  2KZR A;  3PVL A;  2LGY A;  3DQV A;  3ECI A;  2D3G A;  4KDI C;  4W9L A;  3OJ3 A;  3WAO A;  3VXW A;  2M0X A;  4PS7 A;  4BKS A;  4M8N A;  2IBI B;  4FN2 A;  2K8C A;  3KH0 A;  5L95 C;  2G45 B;  4F7Z A;  2ZCB A;  5C23 A;  2N1W A;  3U7D A;  3K9P B;  4F8C B;  4WJN A;  2R2Q A;  4X57 B;  2MWS B;  2K25 A;  3WA0 A;  1GC7 A;  5DPW A;  4W9F A;  3AUL A;  3NY5 A;  2MW5 A;  4FUL A;  4FHJ A;  2IO1 B;  4GXB A;  1IYF A;  2JXX A;  2RPQ A;  3V6E B;  2NS5 A;  3DVN V;  4I6L B;  4WJO A;  5EDS A;  1OEY A;  4RM9 A;  1EUV B;  4I6N B;  2D07 B;  1ZW7 A;  1P3Q U;  2MX2 A;  3KW5 B;  3W1S A;  2MRP A;  3L54 A;  5CHF A;  3W1S C;  4MDK E;  1SE9 A;  2DYO A;  2MBO A;  1SGH A;  5GMV A;  4AOF A;  3U30 A;  2BGF A;  1H8C A;  3UIO B;  2HE7 A;  2ZNV B;  1J19 A;  4NAW B;  4LDT D;  1TTN A;  2KHW B;  2YVC A;  3DBS A;  2KOX A;  3VUW A;  3S2A A;  4PS3 A;  5DPT A;  3APF A;  1WXS A;  4CYE A;  1Z5S B;  1YIW A;  3PRE A;  4RMA A;  2N9X A;  3HHM A;  3VAW A;  4WAA A;  2KO3 A;  4GDL B;  4B9K A;  5LLI A;  2K8B A;  3H7P A;  3AI5 A;  4GGQ A;  1T0Y A;  5G55 A;  1M94 A;  4F1S A;  3WAP A;  4FLH A;  4BVU C;  4MEL A;  2NPT A;  3ZDM C;  3HIZ A;  4DWF A;  2KN5 A;  4JL9 A;  3DPD A;  3DBH I;  4P7I A;  1K8R B;  2EMS A;  1WR6 E;  4KSL C;  4MJS A;  4ANX A;  1WH3 A;  5J18 A;  4HPM B;  2PE6 B;  2RR9 A;  3HK0 A;  2MCN B;  2IYD B;  4NY0 A;  5J2R A;  4MSM B;  2BYE A;  2KDB A;  3VHT C;  2RSU A;  2V4L A;  2JRH A;  2B3A A;  1WMH A;  1WR1 A;  2MA9 B;  2Y5B B;  3DBL I;  4W9I A;  1CMX B;  2HJ8 A;  3H1U A;  2KXJ A;  4AWJ A;  2M17 A;  2O6V A;  2HTH A;  3BY4 B;  1P9D U;  2K6Q A;  2GMI C;  2AL3 A;  2NVU I;  3A9K B;  4YL8 A;  1GC6 A;  2CHX A;  2KJH B;  5D6J B;  4MGI E;  3TCA A;  2PJH A;  3BIN A;  2N9E B;  1P0R A;  2V1Y A;  4K7U A;  3RD2 A;  1E8W A;  4HXD A;  3PV1 A;  4WWN A;  2FAZ A;  1WYW B;  3QK0 A;  4CHK A;  3IG3 A;  2KLC A;  3WAL A;  4GIV A;  2MP2 A;  3AU4 A;  1RAX A;  3OJ4 B;  2I1K A;  3WIM A;  2KFK B;  1QZE A;  2PEA A;  4WWO A;  2DZK A;  3M63 B;  4G0N B;  3R7R A;  3UQB A;  3IHP C;  1V86 A;  4MGZ E;  2KQ7 A;  1VCB A;  4WQO B;  3IFW B;  1IP9 A;  4K81 A;  3R3M A;  2G4D B;  5IAA C;  2KVR A;  1WGR A;  2LXC A;  3SHQ A;  2MBQ A;  3APD A;  4WJQ A;  3JVZ X;  3ZVV A;  2Z0E B;  1WGH A;  2KC2 A;  4ASW C;  4GSW A;  2DZJ A;  4HCP B;  4E74 A;  1WXM A;  3RYT A;  2LXA A;  2D10 A;  4DK5 A;  4JGH B;  1P1A A;  4GU2 A;  5JZE B;  2REX A;  2XK5 B;  2MLB A;  4PS8 A;  1YD8 U;  2FCN A;  2C7N B;  3VUY A;  2KFJ A;  2NBU A;  3ZNI D;  1WJ4 A;  2AEH A;  4E3C A;  1WZ0 A;  3QAQ A;  2L76 A;  3QJZ A;  3ZNG C;  2D11 A;  3VH4 B;  2ZVN A;  2JT4 B;  1UBI A;  2ASQ A;  3PZD A;  3N30 A;  1V81 A;  1WXV A;  3TBL D;  1D3Z A;  3X0W A;  2EMT A;  3L10 B;  2DZI A;  2KDF B;  4OVU A;  3W1Y A;  3GOE A;  1HE8 A;  2ZPN A;  3EEC A;  5E6P A;  1WMH B;  5AEK B;  2QHO A;  3ZW3 A;  1V2Y A;  4KSK C;  3ZKJ C;  1WJN A;  1YX6 B;  4NAW A;  1J8C A;  4G50 A;  1WXA A;  4FHK A;  2ZEQ A;  1LXD A;  2CHW A;  2K6D B;  2KAN A;  3A9K A;  4HVB A;  4OVV A;  1YQB A;  1YJ1 A;  3Q3J A;  4NPN A;  3VQI A;  3VUX A;  3VDZ A;  2N9P C;  5L83 A;  3QCA A;  4ZRJ A;  3GZN I;  3LJ3 A;  4N9F 4;  2KWC A;  3NZS A;  3M62 B;  5E6O A;  4BFR A;  2CKH B;  2GBN A;  2KFK A;  3V60 A;  1E5W A;  2WX1 A;  1Q0W B;  4FAD A;  2OJR A;  3CSF A;  3APC A;  3R7Q A;  3PPA A;  3L16 A;  2LVP A;  1KJT A;  3DVG X;  4KDL B;  5JHB A;  2KJR A;  2ZNV C;  1V5T A;  2M1M A;  4DXA B;  2BKF A;  2NBV B;  4LDT B;  3NHE B;  3SDL C;  2RGF A;  3ZUN A;  3ZIM A;  1L2N A;  2JPH A;  3PSE B;  3H6N A;  2LVO A;  1E90 A;  1EF1 A;  2MSE D;  5G2N A;  2C60 A;  2LI5 A;  1WRD B;  2XK5 A;  4E71 A;  3TIX A;  1LFD A;  4MGK E;  2XEW A;  3ALB A;  5IA7 A;  4II2 B;  2UWQ A;  4IC7 B;  4KZC A;  4IM2 A;  3ZRC A;  3Q3F A;  2FCM A;  1ZKH A;  3RUL A;  3RCZ A;  5DCN A;  4TQ0 A;  1Q5W B;  2KX3 A;  1WX7 A;  4IG7 B;  2CR5 A;  1E8Y A;  4K7W A;  4B6W A;  1WI0 A;  3M3J A;  3ZTC A;  2BWF A;  3MJW A;  1H4R A;  1UH6 A;  3QA8 A;  4GN1 A;  4K1R B;  4BBN F;  4BOZ B;  2BPS A;  4KIK A;  4WJP A;  1LQB A;  2DX5 B;  2J7Q B;  2L05 A;  4ZRK A;  4KVG B;  3CF6 E;  2FCS A;  4URK A;  5CHW A;  2JY6 A;  1WF9 A;  2BYF A;  2O2V A;  1WE7 A;  1KM7 A;  2M4N A;  1OGW A;  1MG8 A;  4K7S A;  3UIN B;  1IPG A;  3QIJ A;  1S3S G;  2BWE S;  3NZU A;  2L0F A;  2J0M A;  1R4M I;  5CTR C;  1UBQ A;  4NNJ B;  3K9O B;  5CX3 A;  4EZK A;  3ONS A;  2JVC A;  3QC8 B;  2KDI A;  3A4S C;  3ENE A;  4GDK B;  2WX0 A;  3PT2 B;  2PE9 A;  3TJP A;  5HKH A;  1OEY J;  2LRU A;  2WDT B;  2L8J A;  3DCG A;  1PQS A;  1Q1O A;  3JSV B;  2GOW A;  4ANV A;  5JH5 C;  2R2O A;  4IM3 A;  3U8Z A;  2ZCC A;  3QHT A;  3NS8 A;  3DDC B;  2KNB A;  2KMA A;  2C7H A;  4W9J A;  1NDD A;  4AUQ C;  4FBJ B;  2NPT B;  2LD9 A;  1OQY A;  4W9D A;  3VFK A;  3D32 A;  1I35 A;  4GB9 A;  4BOS C;  3T9L A;  4HDQ A;  4CO7 A;  2A4Z A;  2MQJ A;  4FJV B;  1U4A A;  1RLF A;  4HJK A;  4ICU A;  4KZ0 A;  4EZL A;  5AZF A;  1AAR A;  2DAF A;  1WX9 A;  3WAM A;  1WGG A;  3H7S A;  4EFO A;  4HK2 A;  4DHJ B;  4HDO A;  1NBF C;  2KWU B;  2KWV B;  1ZGU B;  2JWZ A;  2AL6 A;  1UD7 A;  4IWP A;  2D2Q A;  3QQ8 B;  3QX1 A;  5FR6 A;  4NJ6 A;  2ZPY A;  2LGD A;  4ANU A;  2GBK A;  4HCN B;  4G11 A;  2XBB C;  1V5O A;  1V9J A;  3PLV A;  1WE6 A;  4FJZ A;  2DZM A;  3L17 A;  2KTR B;  1V80 A;  2MP2 B;  3EHV A;  1I42 A;  2KK8 A;  4MH0 E;  1A5R A;  4KV2 A;  2KKC A;  2OOB B;  4XX5 A;  3A9J B;  1C1Y B;  1J0G A;  3A33 B;  1RRB A;  1V6E A;  1X1M A;  3PHW B;  3VTU A;  3PGE A;  2DYM A;  3PS6 A;  2KX0 A;  1WGY A;  4LCD E;  1RFA A;  4JQW C;  4II3 B;  5TR5 A;  2MBH A;  1WY8 A;  2ZZP B;  4XZ4 A;  4GOC A;  4HWI B;  2LGX A;  3B08 A;  5DPS A;  2MBE A;  3HM3 A;  3DBR I;  5CHV C;  4A20 A;  3X23 A;  2C7M B;  4KIK B;  2AWT A;  3NOB A;  3ZRF A;  4DDG D;  4TQ1 A;  2NR2 A;  1NI2 A;  3PRP B;  1WJ6 A;  1XQQ A;  2Z0D B;  2LRW A;  3PTF C;  4DHJ D;  2KTF A;  3OAW A;  4ZDV A;  4ZRI A;  2VRR B;  4AJY B;  2L3Z A;  1Y8R C;  3JYU A;  4TKN A;  3V6C B;  4DDI D;  4BKT A;  3L0W B;  5JHA A;  3UGB B;  3ZNZ B;  1LM8 B;  2RD0 A;  2GBJ A;  2G3Q B;  2LWP A;  1FXT B;  1WM2 A;  2YLM A;  5LXI B;  4IWQ A;  1SIF A;  4DBG A;  3QAR A;  2BKR B;  4FJY A;  1GUA B;  2GBR A;  3M95 A;  3OLM D;  2IO0 B;  5J17 A;  1E8Z A;  3PLU A;  3PRZ A;  4HPL B;  4ZYN A;  1TBE A;  1XD3 B;  3ZO5 B;  1KOT A;  3JSV A;  4MSQ B;  2UYZ B;  1S1Q B;  1F9J A;  2FCQ A;  2LZ6 A;  3CMM B;  2N4F A;  2JF5 A;  4JIO U;  3ZDT A;  3A9J A;  4TUU A;  5LXH A;  4W9K A;  1YX5 B;  2J0K A;  1L7Y A;  3MTN B;  2K8H A;  2V3S A;  3IVF A;  1E8X A;  4EOY A;  2KMC A;  2PPH A;  2EKE C;  4IW0 A;  3UF8 A;  3C0R B;  2BYV E;  3L13 A;  2C9W B;  4MJS B;  5C1Z A;  3UQA A;  1WX8 A;  1TGZ B;  4W9H A;  5D7G A;  2DHZ A;  4PYZ A;  4EUT A;  2L0T A;  3KUC B;  3RZW C;  4A3O A;  4DHZ B;  2FID A;  4BKG A;  2KLG A;  2ZJD A;  2DYB A;  3H9D A;  3DOW A;  1BT0 A;  2A5U A;  3MHS D;  2FUH B;  4JLC A;  4ANW A;  3VTW A;  4NJ7 A;  2N1V A;  3KYD D;  4PYU A;  4IM0 A;  4J6I A;  4FA6 A;  1UEL A;  4W9C A;  3PRM B;  2W9N A;  4BBN C;  2I1J A;  1GJZ A;  3N3K B;  3RT3 B;  3AXC A;  2K1F A;  4WWP A;  4BKS D;  3ML8 A;  3O65 B;  2ZVO A;  1WGD A;  1WIA A;  2LAS A;  2WYQ A;  3QWZ B;  2L00 B;  4IUM B;  1GNU A;  5AZH A;  2JRI B;  3HM6 X;  2K39 A;  1WZ3 A;  3A1Q B;  2WWZ A;  5BO4 B;  1UGM A;  2BF8 B;  3RZF A;  3T8M A;  1WJU A;  3ZNH B;  1XT9 B;  2AYO B;  2O6V D;  1UZX B;  2IY0 B;  3CST A;  4LJO B;  1G6J A;  3KYC D;  4NQK E;  1WM3 A;  3L08 A;  4IWO A;  3TMP B;  4HLE A;  2DEN B;  2FNJ B;  2FIF A;  3PHX B;  5KHO A;  2LUE A;  3UIP B;  4MEM A;  3KVF B;  4GDK A;  4DHZ E;  3SU8 X;  2Z59 B;  2G4S A;  1E7U A;  2N7D A;  4MGY E;  4EEW A;  4B95 A;  3TL5 A;  1P98 A;  4TV3 A;  3V61 A;  4AP4 C;  2LVQ A;  3DVG Y;  4GDL A;  3KUZ A;  2LJ5 A;  3B1L X;  4XC2 A;  2L7R A;  4AJW A;  2IO2 B;  2JZ3 B;  2JUO A;  1VD2 A;  3VTV A;  2GBM A;  5E6N A;  4A3P A;  2N7E A; 
#chains in the Genus database with same CATH topology
 1Z2M A;  2WXP A;  5IO9 A;  4GMV A;  1E7V A;  3B0A A;  2GB1 A;  1HEZ E;  2K9X A;  1GG3 A;  4NQL B;  1K53 A;  2INP E;  1JWA D;  3SD5 A;  3RUI B;  3JW0 X;  4ICV A;  3BVZ A;  4P16 A;  1RM6 C;  1TZ1 A;  1R4N I;  3VVW B;  3NG0 A;  1TKG A;  1I4G A;  3I3T B;  2O2V B;  3A1Q A;  3IBE A;  4XYC A;  1WFY A;  1EM7 A;  3FIL B;  2IJ0 A;  2NBW B;  1E0Z A;  4EKU A;  1C3T A;  2LGY A;  3DQV A;  3ECI A;  4W9L A;  3VXW A;  1JML A;  4M8N A;  1C4C A;  2N1W A;  4NZL B;  2MWS B;  3WA0 A;  4HRS A;  4FUL A;  4S0R A;  4XWW A;  1VDV A;  1FXI A;  4TMA B;  2D07 B;  2V3N A;  2MX2 A;  2LUM A;  2L52 A;  4MDK E;  4XDC A;  1SE4 A;  2MJD A;  4MAC A;  1H8C A;  2ZNV B;  4ZOH C;  3DBS A;  3VUW A;  4PS3 A;  4KKJ A;  1YJJ A;  3APF A;  1WXS A;  2XNA C;  2X8X X;  4OZC A;  1LO5 D;  2VZK B;  3TEY A;  3VAW A;  4WAA A;  3H8H A;  2KO3 A;  1GPX A;  4XGA B;  4B9K A;  3AE9 B;  3FIL A;  2K8B A;  4F1S A;  4LNN A;  2KAJ A;  4BVU C;  2JU6 X;  3DPD A;  4P7I A;  1T0S C;  5J18 A;  4HPM B;  1YNT E;  1FO4 A;  2KDB A;  2RSU A;  4W9I A;  1WR1 A;  3DBL I;  2HJ8 A;  2KXJ A;  3AEB B;  3BY4 B;  4OZB A;  3LYY A;  2CHX A;  2KJH B;  2N9E B;  4K7U A;  4HXD A;  3W9C B;  2FAZ A;  1WYW B;  2ONQ A;  2DWQ A;  3IG3 A;  1WSP A;  3WAL A;  3OJ4 B;  3WIM A;  2PEA A;  1QZE A;  4A8X C;  4WWO A;  2DZK A;  1CJE A;  3R7R A;  2JYT A;  3P4Q B;  5IAA C;  2LXC A;  2MBQ A;  4WJQ A;  5EE1 A;  3JVZ X;  1XXG A;  4P6V F;  4BAX A;  4E74 A;  3RYT A;  4DK5 A;  4GU2 A;  2XK5 B;  1PFD A;  2HJ1 A;  1YD8 U;  2BS2 B;  2NBU A;  3ZNI D;  1WJ4 A;  1JCK B;  3QAQ A;  3VH4 B;  2JT4 B;  1SBB B;  3RNE C;  2QMT A;  3N30 A;  1P7E A;  3B2F A;  2HDE A;  2B76 B;  3X0W A;  3W1Y A;  2BQQ A;  4US9 A;  3EEC A;  4KSK C;  3ZKJ C;  1ZUD 2;  1J8C A;  1I7H A;  2ZEQ A;  1ET6 A;  1UUP A;  1L4D B;  1VJK A;  3VDZ A;  4YXD B;  5L83 A;  3SFE B;  1FNU A;  3NZS A;  4BFR A;  3CIR B;  2GBN A;  3V60 A;  1E6E B;  4FAD A;  3R7Q A;  3DVG X;  4KDL B;  1IBX B;  2ZNV C;  2Y3A A;  4DXA B;  2BKF A;  1L2N A;  3ZIM A;  3R8B A;  3H6N A;  5BYQ A;  2N0S B;  2J53 A;  2C60 A;  2LI5 A;  4ZRP A;  2XK5 A;  4E71 A;  2XEW A;  3KWL A;  2UWQ A;  3Q3F A;  2FCM A;  1Q5W B;  1D5M C;  1TYG B;  1E8Y A;  2IND C;  1AWD A;  3I5J C;  1OQR A;  2BVC A;  1H4R A;  4HVB A;  1HTO A;  4KIK A;  2WS3 B;  2ICI A;  2L05 A;  4Q2J A;  4RF0 A;  2JY6 A;  1WF9 A;  1KM7 A;  1MG4 A;  3QIJ A;  3AV8 A;  1S3S G;  3C8Y A;  1JW9 D;  4AS1 A;  5HI1 A;  1UBQ A;  4HRO A;  4EZK A;  3ENE A;  3ZYY X;  1TKE A;  4RFB A;  2LGS A;  1PQS A;  4ANV A;  3U8Z A;  2ZCC A;  2KNB A;  2WLB A;  2C7H A;  4AUQ C;  4NJC A;  4BOS C;  1EU4 A;  4HDQ A;  1RLF A;  4KZ0 A;  1C4P A;  5AZF A;  1AAR A;  2DAF A;  5AUK A;  2KVZ A;  1K51 A;  2KWD A;  1FCC C;  2JWZ A;  2AL6 A;  3NVY A;  1E9M A;  3FC4 A;  3PLV A;  1V8C A;  3NVW A;  3L17 A;  1GB1 A;  2K5P A;  1FXA A;  2KKC A;  3MP9 A;  1C1Y B;  1XEE A;  1KF6 B;  1V6E A;  4KGT A;  2LHE A;  1RFA A;  2MBH A;  1XO3 A;  2Q5W D;  1NVI D;  2GLS A;  1DOY A;  3B08 A;  3GS2 A;  3NS1 A;  1LGR A;  4A20 A;  3NOB A;  1XQQ A;  4A90 A;  3AB5 A;  1XCQ L;  4DHJ D;  3U4E G;  4ZHO A;  1TT5 B;  4IDI A;  1Y8R C;  2INC C;  5JHA A;  1LM8 B;  2RDH A;  2N7J A;  1WM2 A;  5LXI B;  4IWQ A;  4M01 A;  2BKR B;  3OLM D;  3M95 A;  5J17 A;  3OG5 A;  2IO0 B;  3PLU A;  3BII D;  4LNK A;  3PRZ A;  4ZHP A;  1N61 A;  1XD3 B;  1SF0 A;  1F9J A;  2LZ6 A;  2N4F A;  2I2Y A;  1E8X A;  2BYV E;  1XCT L;  4C80 A;  1WX8 A;  2KT7 A;  3AMZ A;  3KUC B;  3DOW A;  2PW9 A;  1IGC A;  4L1B A;  1IUE A;  3MHS D;  2ZW0 A;  4ANW A;  3VTW A;  2UU7 A;  3PZ7 A;  1AW7 A;  1GJZ A;  4BBN C;  2I1J A;  1SJE D;  1HZ5 A;  3ML8 A;  3O65 B;  4IUM B;  1UGM A;  1WJU A;  2AYO B;  3VRB B;  4H2A A;  2VZK D;  1WGK A;  4NQK E;  3TMP B;  5KHO A;  3LB8 C;  4MEM A;  2JSV X;  1HTQ A;  3P4R B;  4B95 A;  3V61 A;  2DLB A;  2LVQ A;  3KUZ A;  3AEC B;  3B1L X;  1SSN A;  3RI7 C;  4O1N A;  1HQR D;  1JWB D;  1N63 A;  2JUO A;  1VD2 A;  5E6N A;  4A3P A;  2N7E A;  3DVN U;  3AU5 A;  3NRZ A;  2OJW A;  3VH3 B;  4M8M A;  3MC0 B;  5DPR A;  4G3X B;  1JRU A;  4W9E A;  3A4R A;  1TKY A;  3Q2A C;  1FIQ A;  1EF5 A;  3EC8 A;  2CU3 A;  2NCN A;  2E6X A;  2M8S A;  3KWV A;  1EO6 A;  5KHQ A;  1DOX A;  2CS4 A;  1N5W A;  2EKI A;  5MPO A;  1OTR B;  4JE3 B;  1P7F A;  3V62 A;  4PK1 A;  2IO3 B;  5FR3 A;  2MHJ A;  1MI0 A;  4KDI C;  1QOA A;  3WAO A;  4PS7 A;  1L6V A;  4FN2 A;  3KH0 A;  5L95 C;  1ZDX A;  4F7Z A;  1KTK A;  3U7D A;  4X57 B;  2JZP A;  2K25 A;  2PMV A;  1GC7 A;  3L4P A;  2MW5 A;  4IKG A;  1C4A A;  2IGD A;  3IAS 1;  2M19 A;  1XLQ A;  4WJO A;  3DVN V;  1BML C;  1EUV B;  3IXS A;  2MRP A;  5EE0 A;  5GMV A;  4AOF A;  5IP4 D;  2BS3 B;  4XWT A;  3UIO B;  1J19 A;  2YVC A;  3I57 A;  5DPT A;  3NJT A;  3E56 A;  1WXQ A;  3AN1 A;  4DXG A;  3N20 C;  1YIW A;  2K3U A;  3PRE A;  4RMA A;  4B0M A;  2N9X A;  5IOI A;  1K52 A;  1WWT A;  4OZA A;  1QIL A;  3AI5 A;  2K0P A;  2LEK A;  1M94 A;  1FRD A;  3WAP A;  4MEL A;  3ZDM C;  1SE3 A;  3PZ8 A;  3TEW A;  2KN5 A;  1EU3 A;  3DBH I;  4REZ A;  3RFZ B;  1K8R B;  4KSL C;  4ANX A;  5J2R A;  2PE6 B;  3HK0 A;  2MCN B;  2IYD B;  1YN3 A;  4MSM B;  2WXQ A;  1DYQ A;  2V4L A;  4YTM B;  4AWJ A;  4OHJ A;  2HTH A;  1P9D U;  3P63 A;  4MM3 B;  3A9K B;  4YL8 A;  3TUO A;  1GC6 A;  4AQ7 A;  2QEJ C;  3QK0 A;  1F1H A;  2MP2 A;  4ZYS A;  3M63 B;  4G0N B;  3ABV B;  3UQB A;  3IHP C;  4WQO B;  2G4D B;  2RDB C;  3HVD A;  1R4N B;  3ZVV A;  2Z0E B;  1I4P A;  2KC2 A;  1WXM A;  4MH8 A;  4HKQ A;  2HTM E;  4JGH B;  1TY2 A;  2MLB A;  2C7N B;  1MPE A;  4YT0 B;  4XDD A;  1FRR A;  2L76 A;  2PVO D;  3ZNG C;  2ZVN A;  1T5X D;  4TSS A;  4C7Z A;  2ASQ A;  3PZD A;  3MFG A;  4JWU C;  1WXV A;  3AE2 B;  1MJD A;  2EMT A;  3VRA B;  3L10 B;  2DZI A;  4OVU A;  3AED B;  3GOE A;  2N9K A;  3ZGZ A;  1V2Y A;  1WJN A;  4JX1 C;  4G50 A;  3OWE B;  4YWG G;  5LNK 1;  2QSD A;  3R2I A;  2CHW A;  2ON8 A;  4C56 C;  1YN4 A;  1M4V A;  1CZP A;  2N9P C;  1YOV B;  3QCA A;  1E7P B;  4N9F 4;  2ZW1 A;  1VZ8 A;  4DXF A;  5E6O A;  3Q3M C;  2DNF A;  2PLP A;  2BTE A;  1QKZ A;  1FCL A;  2WX1 A;  1Q0W B;  3APC A;  4C7Y A;  3GZN B;  1V5T A;  2NBV B;  2V9H A;  2RGF A;  1C9F A;  1BUI C;  2JPH A;  1PGX A;  1TJE A;  1E90 A;  2WXO A;  3C19 A;  2LJI A;  1WRD B;  1BXT A;  1LFD A;  2L32 A;  4MGK E;  5IA7 A;  3ZRC A;  4IC7 B;  3RUL A;  2MJ3 A;  3RCZ A;  4YSZ B;  1ET9 A;  4N59 A;  2BS4 B;  3ZTC A;  2GI9 A;  4LTU A;  2BPS A;  2PTL A;  1CK1 A;  4EE2 A;  2J7Q B;  3AE6 B;  4KVG B;  1JWU D;  3CF6 E;  2WP9 B;  1ACC A;  1NYQ A;  1WE7 A;  2CJN A;  2IDY A;  4A9A A;  3NZU A;  1SEB D;  1R4M I;  1XLN A;  5CTR C;  4NNJ B;  3K9O B;  3ONS A;  2KDI A;  1VZ6 A;  3BK1 A;  2LRU A;  5GXG B;  2L8J A;  3DCG A;  3BWU D;  3JSV B;  3V05 A;  5JH5 C;  2BT6 A;  2IGG A;  5I4D A;  4K3B A;  3O13 A;  3QHT A;  3NS8 A;  3TSS A;  3N1Y C;  2KMA A;  1UF0 A;  2NPT B;  2LD9 A;  1I35 A;  1JRP A;  4GB9 A;  3DBH B;  4FJV B;  1U4A A;  3IT4 B;  3BVM A;  3CWI A;  2RMM A;  4EFO A;  5AUI A;  1TS4 A;  2KWV B;  1RWS A;  1ZGU B;  4PT5 A;  4IWP A;  2D2Q A;  2ZPY A;  2LGD A;  4ANU A;  4JWS C;  2GBK A;  1V5O A;  2Y5C A;  4BZA A;  1C77 A;  4LNI A;  2KK8 A;  4MH0 E;  1C78 A;  5H8Y E;  2BYT A;  5H92 C;  4JQW C;  2D3A A;  4II3 B;  2MEK A;  5TR5 A;  2QDF A;  2LMC A;  5DPS A;  1D5X C;  3RNC C;  4P1C C;  2QCZ A;  2QIE B;  2LRW A;  2KTF A;  4TKN A;  4QAY A;  3R2T A;  4N58 A;  2WU2 B;  1FEH A;  2RD0 A;  2GBJ A;  2IPK D;  4HEA 1;  1PYW D;  1FXT B;  1SIF A;  1MHH E;  4FJY A;  1GUA B;  3ZQ4 A;  2PKO A;  4HPL B;  1KRH A;  3ZJV A;  3N1Z C;  2L83 A;  1TBE A;  3ZO5 B;  4ARI A;  4WIP A;  1S1Q B;  3CMM B;  2Z8L A;  1YQ3 B;  3ZDT A;  1QOF A;  5LXH A;  3MTN B;  1T3Q A;  4LLG M;  2RPV A;  4WQM A;  2KMC A;  2EKE C;  4KGR A;  2C9W B;  2FE8 A;  2JQR B;  3UQA A;  3DHI C;  2NTS A;  5D7G A;  3RZW C;  3NUH B;  3H9D A;  2X38 A;  1BT0 A;  2A5U A;  1MFW A;  2JXT A;  2WU5 B;  4NJ7 A;  3Q8C A;  1JWM D;  2K22 A;  1UEL A;  4W9C A;  2W9N A;  3AH7 A;  3ZJT A;  1WIA A;  3QWZ B;  2L00 B;  2JRI B;  2K39 A;  5BO4 B;  3AE7 B;  3AE8 B;  1XT9 B;  2O6V D;  2IY0 B;  1PUT A;  2INN E;  4KGS A;  2WXK A;  3ETR A;  1PDX A;  3KYC D;  3L08 A;  2LUE A;  3MHZ A;  3UIP B;  3I9V 1;  2G4S A;  3LXF A;  4MGY E;  4EEW A;  3ZXR A;  4AP4 C;  3DVG Y;  4XC2 A;  3P4P B;  2L7R A;  4AJW A;  5G5H A;  2IO2 B;  3VTV A;  2GBM A;  2BW2 A;  2DAJ A;  2WXM A;  4RCO A;  4W9G A;  4M0W B;  4RM8 A;  2VH1 A;  2MBB B;  4R3D A;  4LJP B;  2O6V B;  3MC8 A;  5AZG A;  4MM3 A;  1KLV A;  3J9C A;  5C2T B;  3KUD B;  3RNB C;  1J7C A;  2CHZ A;  4EZJ A;  2CU1 A;  2JZZ A;  3LDZ E;  2KC1 A;  2J0J A;  2KDE B;  1NEN B;  1MVK A;  1K50 A;  1NEK B;  3EFU A;  1ISN A;  2QIL A;  4YTN B;  3P1M A;  5BMI A;  2KZR A;  4YTP B;  3OJ3 A;  2KDM A;  1R4M B;  1F0Z A;  2IBI B;  3URY A;  2G45 B;  1L0V B;  5G5G A;  4WH4 A;  2ZCB A;  4F8C B;  3K9P B;  1L0X B;  1T0Q C;  4CQN A;  3AUL A;  4FHJ A;  4GXB A;  3V6E B;  2NS5 A;  1QF6 A;  5EDS A;  1F2R C;  4RM9 A;  2D3B A;  4I6N B;  1ZW7 A;  3KW5 B;  3W1S A;  3L54 A;  3W1S C;  2KMM A;  1J7B A;  3GB1 A;  3U30 A;  2BGF A;  2HE7 A;  4LDT D;  1TTN A;  2KHW B;  1C79 A;  2KOX A;  2AQ1 B;  1Z5S B;  3HHM A;  3Q3N C;  4GDL B;  4GLS C;  5LLI A;  1T0Y A;  2NPT A;  4DWF A;  5JXV A;  3Q8A A;  2EMS A;  1WR6 E;  4MJS A;  1WH3 A;  2RR9 A;  3VHT C;  3AM9 A;  4JPS A;  2B3A A;  1V1P A;  1WMH A;  2MA9 B;  2Y5B B;  3RPF C;  1CMX B;  3H1U A;  2WDQ B;  2M17 A;  4M02 A;  1FPY A;  3BYT B;  4LK0 M;  2KQ4 X;  4S17 A;  2AL3 A;  2NVU I;  4KX6 B;  4KKI A;  2PJH A;  3BIN A;  1P0R A;  2V1Y A;  3AEE B;  2WQY B;  4GIV A;  1RAX A;  2I1K A;  2KFK B;  1ZE3 D;  5D3D A;  4MGZ E;  2KQ7 A;  1AN8 A;  1UWM A;  1VCB A;  1FFU A;  4K81 A;  3R3M A;  1WGR A;  1IBX A;  1D5Z C;  1WGH A;  4ASW C;  2DZJ A;  1MHX A;  2D10 A;  1P1A A;  5JZE B;  3DWM A;  3VUY A;  2KFJ A;  2AEH A;  4E3C A;  1WZ0 A;  2D11 A;  1UBI A;  3KQ4 A;  4C00 A;  1V81 A;  5C3J B;  1FM0 D;  1D3Z A;  2KDF B;  5E6P A;  1WMH B;  2QHO A;  3ZW3 A;  3NVV A;  4NAW A;  4DQO C;  2G9H D;  4J3O D;  1N62 A;  1Q10 A;  4OVV A;  1YJ1 A;  3Q3J A;  4NPN A;  2SEB D;  4ZRJ A;  4WUR A;  2W82 A;  2KFK A;  2OJR A;  3CSF A;  2FBW B;  3PPA A;  1I4Q A;  3L16 A;  2LVP A;  1KJT A;  4LDT B;  4RGM A;  3SDL C;  3PSE B;  2JWU A;  5G2N A;  3RNA C;  3EUB 2;  3TIX A;  4II2 B;  1TY0 A;  3BVG A;  3W5U B;  5DCN A;  1WX7 A;  4IG7 B;  2CR5 A;  1WI0 A;  1UH6 A;  4BBN F;  3AE1 B;  4RGN A;  1XLO A;  2I38 A;  2FCS A;  1TS5 A;  5CHW A;  1ENF A;  2BYF A;  2O2V A;  2XN9 C;  2TSS A;  1OGW A;  3BYY B;  1MG8 A;  3E9S A;  4K7S A;  4MT5 A;  3UIN B;  1IPG A;  2BWE S;  1IGD A;  2L0F A;  2J0M A;  5CX3 A;  1TS3 A;  3QC8 B;  3A4S C;  3MC9 A;  1V97 A;  4GDK B;  2WX0 A;  2WDT B;  2WNM A;  1Q1O A;  3N1X C;  3DDC B;  1YJI A;  4W9J A;  5E6J A;  3U52 E;  3GP7 A;  4WWM A;  1ROE A;  1N6Z A;  2WXN A;  3VFK A;  4W9D A;  2V0G A;  3D32 A;  5IKC M;  4CO7 A;  3HRD D;  4HJK A;  4ICU A;  4EZL A;  3H7S A;  1D4B A;  4DHJ B;  4HDO A;  2KWU B;  1GB4 A;  1UD7 A;  1HA5 A;  3U7Z A;  3QQ8 B;  3QX1 A;  5FR6 A;  3SEB A;  2GRI A;  4HCN B;  2V3P A;  1V9J A;  1WE6 A;  2LFI A;  1UNS A;  1V80 A;  2MP2 B;  3EHV A;  3Q3O C;  3RNF C;  1I42 A;  4KV2 A;  3A9J B;  1J0G A;  2EEL A;  3ZJU A;  1RRB A;  2VH2 A;  1X1M A;  3PHW B;  1UWX A;  4C4V A;  3PS6 A;  2KX0 A;  1GAQ B;  4LCD E;  4XZ4 A;  4GOC A;  4HWI B;  2LGX A;  2MJE A;  3I63 C;  2MBE A;  4LNO A;  3DBR I;  5CHV C;  4L2Y A;  1AYF A;  2C7M B;  4DDG D;  4TQ1 A;  1NI2 A;  3PRP B;  1JWS D;  2Z0D B;  4L23 A;  3OAW A;  4ZDV A;  4ZRI A;  2VRR B;  4AJY B;  4ZRQ A;  4DDI D;  2SAK A;  2WXI A;  3L0W B;  1DOI A;  3DHH C;  4A55 A;  4YSY B;  1I4X A;  2Y5P A;  3AE4 B;  4DBG A;  4OW0 A;  4M0W A;  2GBR A;  3NZ3 A;  1E8Z A;  1TZO A;  1VLB A;  4ZYN A;  3UI3 A;  1KOT A;  3JSV A;  1ESF A;  2UYZ B;  2FCQ A;  2JF5 A;  3A9J A;  4TUU A;  4W9K A;  2J0K A;  1B1Z A;  2PPH A;  1XLP A;  3UF8 A;  4MJS B;  1FMA D;  1TGZ B;  4W9H A;  1PGB A;  4EUT A;  1E10 A;  2L0T A;  2AX5 A;  4BKG A;  2DYB A;  2M56 B;  3TEX A;  3TEZ A;  5BYR A;  4JLC A;  3HVZ A;  3DBR B;  4FA6 A;  3IAM 1;  3RT3 B;  3AEF B;  1UGJ A;  4WWP A;  4BKS D;  2ZVO A;  1WGD A;  2LAS A;  3Q8F A;  3Q8E A;  1GNU A;  5AZH A;  2WXH A;  2BF8 B;  3RZF A;  1HXY D;  1UZX B;  4LJO B;  2OHF A;  3AEA B;  4HLE A;  2FNJ B;  3PHX B;  2MH7 A;  1ZXH A;  4LNF A;  3SU8 X;  4P1B C;  3N9Y C;  1E7U A;  3ZXV A;  1QLB B;  2N7D A;  1WRI A;  1P98 A;  4GDL A;  2LJ5 A;  4RF1 A;  2W3R A;  2WXL A;  1J7A A;  4ARC A;  1NI3 A;  1YN5 A;  2JZ3 B;  2E3T A;  3V3X A;  2C5L C;  2WXG A;  4NAM A;  4US8 A;  5T8I A;  2IZV B;  1KH0 A;  3ZLZ A;  1C76 A;  3BZD B;  2HD5 B;  3DBL B;  1FNV A;  2BBC A;  4I6P A;  1KLU D;  2KQS A;  2KJ6 A;  4WAF A;  2KD0 A;  3HUI A;  5D94 A;  3N32 A;  3B9J A;  3ML9 A;  5D2M B;  3WAN A;  3R66 C;  2LHD A;  4B0E A;  1NYR A;  3ZTD A;  2KTR A;  2W54 A;  1CQV A;  2IY1 B;  3P2B A;  1N60 A;  3H7P B;  4ITK A;  1D6E C;  2KAC A;  4RNA A;  1V49 A;  3PVL A;  2DBY A;  2D3G A;  2M0X A;  4BKS A;  2K8C A;  1F52 A;  3GE3 C;  5C23 A;  5BMH A;  4WJN A;  2R2Q A;  1VRA B;  1SXT A;  5DPW A;  4W9F A;  2J52 A;  3NY5 A;  5EE9 A;  2IO1 B;  1IYF A;  2JXX A;  2RPQ A;  1T6B X;  2QJL A;  4I6L B;  4A6Q A;  1OEY A;  1L0Y B;  1P3Q U;  5CHF A;  1SE9 A;  2DYO A;  2MBO A;  1SGH A;  1OFF A;  1QT9 A;  2D5G A;  5IN7 A;  3RMK C;  4NAW B;  3S2A A;  2CJO A;  2OED A;  4CYE A;  2WDV B;  3PO0 A;  1TS2 A;  3H7P A;  2RDG A;  4GGQ A;  3RNG C;  5G55 A;  4FLH A;  1SIJ A;  3HIZ A;  4JL9 A;  5TSS A;  4NY0 A;  3AEG B;  2BYE A;  1HZ6 A;  2JRH A;  2D3C A;  4IOI E;  2O6V A;  2K6Q A;  3FAH A;  1QOG A;  5BMG A;  3W2D A;  2GMI C;  2M0A A;  1ZPS A;  5D6J B;  4MGI E;  2LGI A;  3TCA A;  3RD2 A;  1E8W A;  3PV1 A;  4WWN A;  2V4I B;  4CHK A;  3DHG C;  2KLC A;  3AU4 A;  1L4Z B;  2WDR B;  1V86 A;  3SR6 A;  3IFW B;  1IP9 A;  2KVR A;  3SHQ A;  2BB5 A;  3APD A;  4GSW A;  3DWG C;  4HCP B;  2LXA A;  2REX A;  4PS8 A;  3EA6 A;  2FCN A;  4D2K A;  3QJZ A;  2IGH A;  2NMQ A;  3SFD B;  3TBL D;  1SJH D;  1HE8 A;  2ZPN A;  2R61 A;  5AEK B;  1KLG D;  4HJG E;  2YEP F;  1YX6 B;  1WXA A;  4FHK A;  3EGR A;  2G1E A;  1LXD A;  2K6D B;  2KAN A;  3A9K A;  1YQB A;  4YSX B;  1Y56 A;  3MJ5 A;  3VQI A;  3VUX A;  2H88 B;  3GZN I;  3LJ3 A;  2KWC A;  3M62 B;  2CKH B;  1EWC A;  1VZ7 A;  1E5W A;  4HPP A;  3BK2 A;  5EE3 A;  1L6U A;  1XF5 L;  5JHB A;  1F2R I;  2KJR A;  2M1M A;  1JQ4 A;  3NHE B;  3AE5 B;  3ZUN A;  3T3N A;  2LVO A;  1EF1 A;  2MSE D;  3FKY A;  5BYS A;  3ALB A;  4KZC A;  4IM2 A;  1ZKH A;  4TQ0 A;  2KX3 A;  4K7W A;  4B6W A;  3IT6 B;  3M3J A;  2BWF A;  3MJW A;  3QA8 A;  4GN1 A;  4K1R B;  4BOZ B;  1YQ4 B;  4WJP A;  3RN9 C;  1LQB A;  3P4S B;  3T3O A;  2DX5 B;  2L1A A;  1WYG A;  4ZRK A;  4URK A;  2KYW A;  1F77 A;  2M4N A;  4XE0 A;  3U2S C;  1N5X A;  1ZXI A;  1A70 A;  2JVC A;  1SB3 C;  5FK9 C;  3PT2 B;  2PE9 A;  3TJP A;  5HKH A;  1OEY J;  1RFK A;  3Q8B A;  2W3S A;  3Q69 A;  4USA A;  3KLS X;  2NTT A;  2GOW A;  2BB6 A;  2R2O A;  4IM3 A;  1T0R C;  2KN4 A;  4M00 A;  1NDD A;  4FBJ B;  1OQY A;  4RH6 A;  3T9L A;  2A4Z A;  2MQJ A;  2YEP B;  1WX9 A;  3WAM A;  1WGG A;  4K3C A;  3P42 A;  4HK2 A;  1RYJ A;  1DGJ A;  1NBF C;  3W5V B;  2WXR A;  1QOB A;  4NJ6 A;  2H89 B;  4N6E B;  2ACZ B;  4G11 A;  2XBB C;  1OQQ A;  1R7S A;  4FJZ A;  2J4X A;  1QQR A;  2DZM A;  2KTR B;  2J42 A;  1A5R A;  1FNW A;  4XX5 A;  2OOB B;  3A33 B;  4RGO S;  4OVZ A;  4UDU C;  3VR8 B;  3VTU A;  3PGE A;  2DYM A;  1FD6 A;  1WGY A;  1WY8 A;  2ZZP B;  2QC8 A;  5HFY A;  3HM3 A;  3WCQ A;  3X23 A;  4KIK B;  2AWT A;  3ZRF A;  4ACF A;  1JAL A;  2NR2 A;  1YMH E;  1WJ6 A;  2WXF A;  3Q14 C;  3PTF C;  2JX5 A;  2L3Z A;  3NVZ A;  3JYU A;  3V6C B;  4BKT A;  3UGB B;  1V1P B;  2JYE A;  2WGS A;  3ZNZ B;  3GE8 C;  2G3Q B;  2LWP A;  2AQ2 B;  2PVG C;  2YLM A;  3QAR A;  1L5P A;  3Q6B A;  1STE A;  5FKA C;  4MSQ B;  1I4R A;  4JIO U;  1YX5 B;  4RGT A;  1L7Y A;  2K8H A;  2V3S A;  4FXC A;  3IVF A;  4HKZ E;  4EOY A;  2W55 A;  2N9L A;  4IW0 A;  5D3I B;  3C0R B;  3L13 A;  5C1Z A;  2DHZ A;  4PYZ A;  4DHZ B;  1B9R A;  4A3O A;  1VR9 A;  1TIF A;  2FID A;  2KLG A;  2ZJD A;  1KFY B;  1FFV A;  1EWY C;  2WHI A;  2FUH B;  2N1V A;  3KYD D;  4PYU A;  2WXJ A;  3AE3 B;  4IM0 A;  4J6I A;  3EFC A;  1ZOY B;  3PRM B;  3N3K B;  5HHD G;  3AXC A;  1V1O A;  2K1F A;  3B2G A;  2WYQ A;  1ZDV A;  3HM6 X;  1WZ3 A;  3A1Q B;  2WWZ A;  3T8M A;  3ZNH B;  1GOZ A;  4C4V B;  3CST A;  1G6J A;  1WM3 A;  4IWO A;  2DEN B;  2FIF A;  1JRO A;  3KVF B;  1ZP0 B;  4GDK A;  5HG2 A;  4DHZ E;  2Z59 B;  1I4H A;  3TL5 A;  4TV3 A;  2PIA A;  2FUG 1;  2AQ3 B;  1SE2 A;  1PGA A;  3VR9 B; 
#chains in the Genus database with same CATH homology
 1Z2M A;  2DAJ A;  2C5L C;  2IZV B;  4GMV A;  1E7V A;  3DVN U;  3ZLZ A;  3AU5 A;  3B0A A;  4W9G A;  4M0W B;  4RM8 A;  2HD5 B;  3VH3 B;  4I6P A;  4M8M A;  1GG3 A;  2MBB B;  4NQL B;  5DPR A;  4LJP B;  2KQS A;  4G3X B;  1JRU A;  2KJ6 A;  3SD5 A;  2O6V B;  4W9E A;  3RUI B;  3JW0 X;  3A4R A;  4ICV A;  5AZG A;  2KD0 A;  4MM3 A;  5D94 A;  1EF5 A;  1KLV A;  3KUD B;  3N32 A;  3EC8 A;  1TZ1 A;  2NCN A;  1R4N I;  2CHZ A;  3ML9 A;  5D2M B;  3VVW B;  2CU1 A;  3I3T B;  3WAN A;  2JZZ A;  4EZJ A;  3LDZ E;  2KC1 A;  2O2V B;  2J0J A;  3A1Q A;  2M8S A;  3IBE A;  3R66 C;  3ZTD A;  2KDE B;  1WFY A;  1EO6 A;  2KTR A;  5KHQ A;  2CS4 A;  2IY1 B;  2NBW B;  1OTR B;  3EFU A;  3H7P B;  3P2B A;  1ISN A;  4EKU A;  3V62 A;  1C3T A;  2IO3 B;  1V49 A;  2KZR A;  3PVL A;  2LGY A;  3DQV A;  3ECI A;  2D3G A;  4KDI C;  4W9L A;  3OJ3 A;  3WAO A;  3VXW A;  2M0X A;  4PS7 A;  4BKS A;  4M8N A;  2IBI B;  4FN2 A;  2K8C A;  3KH0 A;  5L95 C;  2G45 B;  4F7Z A;  2ZCB A;  5C23 A;  2N1W A;  3U7D A;  3K9P B;  4F8C B;  4WJN A;  2R2Q A;  4X57 B;  2MWS B;  2K25 A;  3WA0 A;  1GC7 A;  5DPW A;  4W9F A;  3AUL A;  3NY5 A;  2MW5 A;  4FUL A;  4FHJ A;  2IO1 B;  4GXB A;  1IYF A;  2JXX A;  2RPQ A;  3V6E B;  2NS5 A;  3DVN V;  4I6L B;  4WJO A;  5EDS A;  1OEY A;  4RM9 A;  1EUV B;  4I6N B;  2D07 B;  1ZW7 A;  1P3Q U;  2MX2 A;  3KW5 B;  3W1S A;  2MRP A;  3L54 A;  5CHF A;  3W1S C;  4MDK E;  1SE9 A;  2DYO A;  2MBO A;  1SGH A;  5GMV A;  4AOF A;  3U30 A;  2BGF A;  1H8C A;  3UIO B;  2HE7 A;  2ZNV B;  1J19 A;  4NAW B;  4LDT D;  1TTN A;  2KHW B;  2YVC A;  3DBS A;  2KOX A;  3VUW A;  3S2A A;  4PS3 A;  5DPT A;  3APF A;  1WXS A;  4CYE A;  1Z5S B;  1YIW A;  3PRE A;  4RMA A;  2N9X A;  3HHM A;  3VAW A;  4WAA A;  2KO3 A;  4GDL B;  4B9K A;  5LLI A;  2K8B A;  3H7P A;  3AI5 A;  4GGQ A;  1T0Y A;  5G55 A;  1M94 A;  4F1S A;  3WAP A;  4FLH A;  4BVU C;  4MEL A;  2NPT A;  3ZDM C;  3HIZ A;  4DWF A;  2KN5 A;  4JL9 A;  3DPD A;  3DBH I;  4P7I A;  1K8R B;  2EMS A;  1WR6 E;  4KSL C;  4MJS A;  4ANX A;  1WH3 A;  5J18 A;  4HPM B;  2PE6 B;  2RR9 A;  3HK0 A;  2MCN B;  2IYD B;  4NY0 A;  5J2R A;  4MSM B;  2BYE A;  2KDB A;  3VHT C;  2RSU A;  2V4L A;  2JRH A;  2B3A A;  1WMH A;  1WR1 A;  2MA9 B;  2Y5B B;  3DBL I;  4W9I A;  1CMX B;  2HJ8 A;  3H1U A;  2KXJ A;  4AWJ A;  2M17 A;  2O6V A;  2HTH A;  3BY4 B;  1P9D U;  2K6Q A;  2GMI C;  2AL3 A;  2NVU I;  3A9K B;  4YL8 A;  1GC6 A;  2CHX A;  2KJH B;  5D6J B;  4MGI E;  3TCA A;  2PJH A;  3BIN A;  2N9E B;  1P0R A;  2V1Y A;  4K7U A;  3RD2 A;  1E8W A;  4HXD A;  3PV1 A;  4WWN A;  2FAZ A;  1WYW B;  3QK0 A;  4CHK A;  3IG3 A;  2KLC A;  3WAL A;  4GIV A;  2MP2 A;  3AU4 A;  1RAX A;  3OJ4 B;  2I1K A;  3WIM A;  2KFK B;  1QZE A;  2PEA A;  4WWO A;  2DZK A;  3M63 B;  4G0N B;  3R7R A;  3UQB A;  3IHP C;  1V86 A;  4MGZ E;  2KQ7 A;  1VCB A;  4WQO B;  3IFW B;  1IP9 A;  4K81 A;  3R3M A;  2G4D B;  5IAA C;  2KVR A;  1WGR A;  2LXC A;  3SHQ A;  2MBQ A;  3APD A;  4WJQ A;  3JVZ X;  3ZVV A;  2Z0E B;  1WGH A;  2KC2 A;  4ASW C;  4GSW A;  2DZJ A;  4HCP B;  4E74 A;  1WXM A;  3RYT A;  2LXA A;  2D10 A;  4DK5 A;  4JGH B;  1P1A A;  4GU2 A;  5JZE B;  2REX A;  2XK5 B;  2MLB A;  4PS8 A;  1YD8 U;  2FCN A;  2C7N B;  3VUY A;  2KFJ A;  2NBU A;  3ZNI D;  1WJ4 A;  2AEH A;  4E3C A;  1WZ0 A;  3QAQ A;  2L76 A;  3QJZ A;  3ZNG C;  2D11 A;  3VH4 B;  2ZVN A;  2JT4 B;  1UBI A;  2ASQ A;  3PZD A;  3N30 A;  1V81 A;  1WXV A;  3TBL D;  1D3Z A;  3X0W A;  2EMT A;  3L10 B;  2DZI A;  2KDF B;  4OVU A;  3W1Y A;  3GOE A;  1HE8 A;  2ZPN A;  3EEC A;  5E6P A;  1WMH B;  5AEK B;  2QHO A;  3ZW3 A;  1V2Y A;  4KSK C;  3ZKJ C;  1WJN A;  1YX6 B;  4NAW A;  1J8C A;  4G50 A;  1WXA A;  4FHK A;  2ZEQ A;  1LXD A;  2CHW A;  2K6D B;  2KAN A;  3A9K A;  4HVB A;  4OVV A;  1YQB A;  1YJ1 A;  3Q3J A;  4NPN A;  3VQI A;  3VUX A;  3VDZ A;  2N9P C;  5L83 A;  3QCA A;  4ZRJ A;  3GZN I;  3LJ3 A;  4N9F 4;  2KWC A;  3NZS A;  3M62 B;  5E6O A;  4BFR A;  2CKH B;  2GBN A;  2KFK A;  3V60 A;  1E5W A;  2WX1 A;  1Q0W B;  4FAD A;  2OJR A;  3CSF A;  3APC A;  3R7Q A;  3PPA A;  3L16 A;  2LVP A;  1KJT A;  3DVG X;  4KDL B;  5JHB A;  2KJR A;  2ZNV C;  1V5T A;  2M1M A;  4DXA B;  2BKF A;  2NBV B;  4LDT B;  3NHE B;  3SDL C;  2RGF A;  3ZUN A;  3ZIM A;  1L2N A;  2JPH A;  3PSE B;  3H6N A;  2LVO A;  1E90 A;  1EF1 A;  2MSE D;  5G2N A;  2C60 A;  2LI5 A;  1WRD B;  2XK5 A;  4E71 A;  3TIX A;  1LFD A;  4MGK E;  2XEW A;  3ALB A;  5IA7 A;  4II2 B;  2UWQ A;  4IC7 B;  4KZC A;  4IM2 A;  3ZRC A;  3Q3F A;  2FCM A;  1ZKH A;  3RUL A;  3RCZ A;  5DCN A;  4TQ0 A;  1Q5W B;  2KX3 A;  1WX7 A;  4IG7 B;  2CR5 A;  1E8Y A;  4K7W A;  4B6W A;  1WI0 A;  3M3J A;  3ZTC A;  2BWF A;  3MJW A;  1H4R A;  1UH6 A;  3QA8 A;  4GN1 A;  4K1R B;  4BBN F;  4BOZ B;  2BPS A;  4KIK A;  4WJP A;  1LQB A;  2DX5 B;  2J7Q B;  2L05 A;  4ZRK A;  4KVG B;  3CF6 E;  2FCS A;  4URK A;  5CHW A;  2JY6 A;  1WF9 A;  2BYF A;  2O2V A;  1WE7 A;  1KM7 A;  2M4N A;  1OGW A;  1MG8 A;  4K7S A;  3UIN B;  1IPG A;  3QIJ A;  1S3S G;  2BWE S;  3NZU A;  2L0F A;  2J0M A;  1R4M I;  5CTR C;  1UBQ A;  4NNJ B;  3K9O B;  5CX3 A;  4EZK A;  3ONS A;  2JVC A;  3QC8 B;  2KDI A;  3A4S C;  3ENE A;  4GDK B;  2WX0 A;  3PT2 B;  2PE9 A;  3TJP A;  5HKH A;  1OEY J;  2LRU A;  2WDT B;  2L8J A;  3DCG A;  1PQS A;  1Q1O A;  3JSV B;  2GOW A;  4ANV A;  5JH5 C;  2R2O A;  4IM3 A;  3U8Z A;  2ZCC A;  3QHT A;  3NS8 A;  3DDC B;  2KNB A;  2KMA A;  2C7H A;  4W9J A;  1NDD A;  4AUQ C;  4FBJ B;  2NPT B;  2LD9 A;  1OQY A;  4W9D A;  3VFK A;  3D32 A;  1I35 A;  4GB9 A;  4BOS C;  3T9L A;  4HDQ A;  4CO7 A;  2A4Z A;  2MQJ A;  4FJV B;  1U4A A;  1RLF A;  4HJK A;  4ICU A;  4KZ0 A;  4EZL A;  5AZF A;  1AAR A;  2DAF A;  1WX9 A;  3WAM A;  1WGG A;  3H7S A;  4EFO A;  4HK2 A;  4DHJ B;  4HDO A;  1NBF C;  2KWU B;  2KWV B;  1ZGU B;  2JWZ A;  2AL6 A;  1UD7 A;  4IWP A;  2D2Q A;  3QQ8 B;  3QX1 A;  5FR6 A;  4NJ6 A;  2ZPY A;  2LGD A;  4ANU A;  2GBK A;  4HCN B;  4G11 A;  2XBB C;  1V5O A;  1V9J A;  3PLV A;  1WE6 A;  4FJZ A;  2DZM A;  3L17 A;  2KTR B;  1V80 A;  2MP2 B;  3EHV A;  1I42 A;  2KK8 A;  4MH0 E;  1A5R A;  4KV2 A;  2KKC A;  2OOB B;  4XX5 A;  3A9J B;  1C1Y B;  1J0G A;  3A33 B;  1RRB A;  1V6E A;  1X1M A;  3PHW B;  3VTU A;  3PGE A;  2DYM A;  3PS6 A;  2KX0 A;  1WGY A;  4LCD E;  1RFA A;  4JQW C;  4II3 B;  5TR5 A;  2MBH A;  1WY8 A;  2ZZP B;  4XZ4 A;  4GOC A;  4HWI B;  2LGX A;  3B08 A;  5DPS A;  2MBE A;  3HM3 A;  3DBR I;  5CHV C;  4A20 A;  3X23 A;  2C7M B;  4KIK B;  2AWT A;  3NOB A;  3ZRF A;  4DDG D;  4TQ1 A;  2NR2 A;  1NI2 A;  3PRP B;  1WJ6 A;  1XQQ A;  2Z0D B;  2LRW A;  3PTF C;  4DHJ D;  2KTF A;  3OAW A;  4ZDV A;  4ZRI A;  2VRR B;  4AJY B;  2L3Z A;  1Y8R C;  3JYU A;  4TKN A;  3V6C B;  4DDI D;  4BKT A;  3L0W B;  5JHA A;  3UGB B;  3ZNZ B;  1LM8 B;  2RD0 A;  2GBJ A;  2G3Q B;  2LWP A;  1FXT B;  1WM2 A;  2YLM A;  5LXI B;  4IWQ A;  1SIF A;  4DBG A;  3QAR A;  2BKR B;  4FJY A;  1GUA B;  2GBR A;  3M95 A;  3OLM D;  2IO0 B;  5J17 A;  1E8Z A;  3PLU A;  3PRZ A;  4HPL B;  4ZYN A;  1TBE A;  1XD3 B;  3ZO5 B;  1KOT A;  3JSV A;  4MSQ B;  2UYZ B;  1S1Q B;  1F9J A;  2FCQ A;  2LZ6 A;  3CMM B;  2N4F A;  2JF5 A;  4JIO U;  3ZDT A;  3A9J A;  4TUU A;  5LXH A;  4W9K A;  1YX5 B;  2J0K A;  1L7Y A;  3MTN B;  2K8H A;  2V3S A;  3IVF A;  1E8X A;  4EOY A;  2KMC A;  2PPH A;  2EKE C;  4IW0 A;  3UF8 A;  3C0R B;  2BYV E;  3L13 A;  2C9W B;  4MJS B;  5C1Z A;  3UQA A;  1WX8 A;  1TGZ B;  4W9H A;  5D7G A;  2DHZ A;  4PYZ A;  4EUT A;  2L0T A;  3KUC B;  3RZW C;  4A3O A;  4DHZ B;  2FID A;  4BKG A;  2KLG A;  2ZJD A;  2DYB A;  3H9D A;  3DOW A;  1BT0 A;  2A5U A;  3MHS D;  2FUH B;  4JLC A;  4ANW A;  3VTW A;  4NJ7 A;  2N1V A;  3KYD D;  4PYU A;  4IM0 A;  4J6I A;  4FA6 A;  1UEL A;  4W9C A;  3PRM B;  2W9N A;  4BBN C;  2I1J A;  1GJZ A;  3N3K B;  3RT3 B;  3AXC A;  2K1F A;  4WWP A;  4BKS D;  3ML8 A;  3O65 B;  2ZVO A;  1WGD A;  1WIA A;  2LAS A;  2WYQ A;  3QWZ B;  2L00 B;  4IUM B;  1GNU A;  5AZH A;  2JRI B;  3HM6 X;  2K39 A;  1WZ3 A;  3A1Q B;  2WWZ A;  5BO4 B;  1UGM A;  2BF8 B;  3RZF A;  3T8M A;  1WJU A;  3ZNH B;  1XT9 B;  2AYO B;  2O6V D;  1UZX B;  2IY0 B;  3CST A;  4LJO B;  1G6J A;  3KYC D;  4NQK E;  1WM3 A;  3L08 A;  4IWO A;  3TMP B;  4HLE A;  2DEN B;  2FNJ B;  2FIF A;  3PHX B;  5KHO A;  2LUE A;  3UIP B;  4MEM A;  3KVF B;  4GDK A;  4DHZ E;  3SU8 X;  2Z59 B;  2G4S A;  1E7U A;  2N7D A;  4MGY E;  4EEW A;  4B95 A;  3TL5 A;  1P98 A;  4TV3 A;  3V61 A;  4AP4 C;  2LVQ A;  3DVG Y;  4GDL A;  3KUZ A;  2LJ5 A;  3B1L X;  4XC2 A;  2L7R A;  4AJW A;  2IO2 B;  2JZ3 B;  2JUO A;  1VD2 A;  3VTV A;  2GBM A;  5E6N A;  4A3P A;  2N7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...