2MSED

Nmr data-driven model of gtpase kras-gnp:arafrbd complex tethered to a lipid-bilayer nanodisc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Apolipoprotein A-I
publication title Oncogenic and RASopathy-associated K-RAS mutations relieve membrane-dependent occlusion of the effector-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 14
structure length 73
sequence length 73
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mseD01
2DZKA 2J7QB 3AU5A 4K81A 1WGRA 2CR5A 2JWZA 2EMTA 2YLMA 4W9LA 2L76A 2LXAA 1UBQA 2LZ6A 4KV2A 4IWOA 3V61A 2NPTA 3TJPA 2LWPA 1GG3A 5C23A 1JRUA 3BINA 4LDTD 4BVUC 4MGIE 3OAWA 2N7EA 3RZFA 2K8HA 3VTVA 1PQSA 1OTRB 2JUOA 4E74A 3PTFC 1TGZB 3NY5A 3PRZA 2KMCA 2XK5A 2C7MB 3ZTDA 2AYOB 5C1ZA 2JT4B 3DBRI 1Y8RC 3PSEB 4NJ6A 2LVPA 3NZSA 2V1YA 2A5UA 2I1JA 2JXXA 1XD3B 2OOBB 1WJUA 2V4LA 4G11A 4E3CA 2KC2A 2L0FA 3JVZX 3MTNB 4MM3A 1OEYJ 4K7UA 2UWQA 1NI2A 2KNBA 2KOXA 3QHTA 4NPNA 5FR6A 2KXJA 2LRWA 4CYEA 2N7DA 5IAAC 4BOZB 2KWVB 3RCZA 2BKRB 4K7WA 2MBOA 2KTRA 2L05A 4AP4C 2K6DB 3Q3JA 2C7NB 2DZIA 1ZW7A 3HM6X 2FUHB 1WMHB 4HJKA 4DHJD 2FCMA 5JH5C 1BT0A 4GDKA 1E7VA 5DPTA 4NY0A 1LFDA 4IUMB 4TUUA 4BBNF 2DZMA 2KFKB 3H6NA 3ECIA 4GXBA 2KLCA 5HKHA 1X1MA 4MGYE 2JZ3B 2PEAA 4HDQA 4F7ZA 2GBMA 1WGYA 3WAOA 4EKUA 3VFKA 4HK2A 4M8MA 4NAWA 4DDGD 4B95A 2DAFA 4FJYA 2K6QA 1VD2A 3EFUA 4DDID 3DCGA 2KFJA 2HE7A 3TMPB 1J0GA 3SHQA 3ZIMA 2KZRA 3OJ3A 2KDEB 2W9NA 4FHKA 4KZCA 1LQBA 2Y5BB 3A9JB 2NS5A 3R66C 1E5WA 4WWPA 3JSVA 3I3TB 4KZ0A 1RFAA 3C0RB 4PYZA 3A4SC 1KJTA 2IYDB 3UQAA 1C1YB 3S2AA 1L7YA 3H1UA 5DPRA 1P9DU 1FXTB 2MSED 4JIOU 2FIDA 2JVCA 2N9EB 3QK0A 2O2VA 3PRPB 4M8NA 2KDFB 3KYDD 4AUQC 3VXWA 2C5LC 3A9KB 4EEWA 2AEHA 4WAAA 1WXAA 1WY8A 3PREA 1VCBA 2CHZA 2MX2A 3WAMA 4AWJA 4NJ7A 5BO4B 5JZEB 2DENB 1WJ4A 2G4DB 4TKNA 3OLMD 3MHSD 3CF6E 2DYOA 2C60A 3NS8A 4JLCA 3ZDMC 4PS8A 4XZ4A 2KJRA 1YQBA 1WGHA 3UF8A 1EF5A 2RSUA 1WX8A 2M0XA 4URKA 3H7PB 3UINB 4KIKA 1WM2A 3QCAA 4MSMB 2ZVNA 2BWES 2Z0DB 4DXAB 2CKHB 1U4AA 2L7RA 1TTNA 2JRHA 2JF5A 3ONSA 1E8YA 4FJVB 4AJWA 5J17A 4LCDE 1UD7A 3QWZB 3EECA 1WR1A 3AXCA 3K9OB 4W9HA 2DYBA 1WFYA 2KHWB 4I6PA 3QA8A 1T0YA 2CHWA 3AU4A 4P7IA 1OEYA 1WGDA 3TIXA 2LRUA 3PS6A 4HPLB 5CTRC 2YVCA 3VHTC 3APDA 2BWFA 3L08A 4TQ0A 4IM2A 1LM8B 1WX7A 2XEWA 1YJ1A 1IPGA 4HLEA 4MH0E 1UBIA 2R2QA 4NNJB 5CX3A 2PPHA 4BKTA 1XT9B 2JY6A 1WRDB 2C9WB 2NBWB 5JHBA 1YD8U 3DBHI 2KQSA 5D7GA 4TQ1A 5E6PA 2N1WA 5TR5A 3T9LA 5E6OA 1H8CA 4B6WA 1WI0A 2LGDA 3R7QA 2N9PC 4PYUA 2MBQA 3U8ZA 3ZUNA 2BYVE 1V2YA 4KVGB 4TV3A 2RPQA 2O6VA 3X23A 3ZW3A 3OJ4B 3DOWA 3KYCD 1WGGA 3WA0A 2C7HA 3DVGX 2MP2A 1WMHA 4BKSA 2HD5B 4ANXA 3QIJA 1S1QB 4HCNB 4A3PA 1P98A 2O6VD 4XX5A 4W9DA 4WJPA 3VAWA 4M0WB 1WIAA 2GMIC 2MA9B 2KFKA 1CMXB 3ZNHB 4BKSD 3KUDB 1D3ZA 3ZRFA 4HCPB 2N9XA 1P3QU 2GBKA 2BPSA 3Q3FA 1H4RA 2KD0A 2KLGA 1V9JA 1WYWB 2MBEA 2MQJA 5LXHA 5J2RA 3A1QA 2WX1A 2M17A 4MSQB 4MGZE 2IO2B 2KVRA 4LDTB 1WF9A 1GNUA 2GBNA 4BFRA 1YIWA 3IBEA 5D94A 4HPMB 1P1AA 3GZNI 2IO3B 4ANUA 4ZRIA 3VUWA 4CHKA 2NR2A 4WWNA 2Z59B 3DQVA 1WJ6A 2GBRA 3IHPC 4G50A 3DBSA 4MJSA 3NZUA 2FCNA 1V5TA 1WXSA 3L10B 2BYFA 2XK5B 1KLVA 2LGXA 2DYMA 2IO1B 3ZNID 2LVQA 3RZWC 2ZZPB 1P0RA 1GC7A 2L8JA 3DDCB 3RYTA 5G55A 3L16A 4MGKE 4EZLA 1TBEA 2RR9A 2WX0A 4LJPB 1YX6B 3L54A 4OVVA 1EUVB 2AL6A 4IM0A 4RM9A 4CO7A 2LVOA 1ISNA 2G4SA 2D11A 3M95A 3TL5A 5CHWA 3JYUA 5E6NA 2KN5A 2FCQA 1G6JA 3W1SA 2CS4A 2K39A 4WQOB 3IFWB 4FN2A 1IP9A 3LJ3A 1NDDA 1EO6A 2LI5A 3AULA 2HJ8A 2L3ZA 4IW0A 4FJZA 1HE8A 2DZJA 3VDZA 4W9CA 1V86A 4B9KA 4DHZE 2MBHA 4GGQA 4DHJB 3B1LX 4FBJB 4ICUA 4I6LB 3VVWB 2D2QA 2R2OA 3V6EB 1F9JA 3IVFA 3RD2A 2MBBB 4GDLA 3PLUA 1WZ0A 3ZDTA 4HDOA 3SDLC 2J0MA 2MLBA 3L17A 4WJQA 4DK5A 3MJWA 3UIOB 4FULA 4MDKE 3VH3B 2M1MA 1UELA 1E7UA 1Q5WB 1Q0WB 2MRPA 3APFA 3PT2B 2J0KA 4AJYB 2XBBC 5DPWA 1A5RA 2DHZA 2ZJDA 1IYFA 3ZRCA 1S3SG 3DVNU 5JHAA 2B3AA 4MELA 3VQIA 2LD9A 4IC7B 5G2NA 4ZDVA 3NOBA 4W9FA 2KDIA 2NBUA 3VH4B 2KJ6A 2V3SA 3DVNV 5L95C 3HM3A 2WYQA 1OGWA 3QC8B 1GJZA 4J6IA 1KOTA 3RULA 4GN1A 3EHVA 2HTHA 1OQYA 3PHWB 4JQWC 4AOFA 4YL8A 1TZ1A 3HHMA 4EFOA 5DPSA 2CHXA 2ASQA 3JSVB 1J8CA 1LXDA 1E8ZA 3L13A 3R3MA 5KHOA 4KSKC 2LASA 3V62A 3KVFB 4DBGA 1NBFC 3RT3B 2EMSA 3DPDA 3PVLA 4W9IA 3HK0A 4WWOA 3WIMA 2KX0A 2QHOA 2UYZB 2O2VB 2KC1A 2JZZA 4PS3A 2M4NA 4JL9A 3ALBA 3U7DA 4GU2A 2ZPYA 3M3JA 4KDLB 4ZRKA 2ZEQA 5EDSA 3NHEB 3ZKJC 2JPHA 4EUTA 1WXVA 4F8CB 3ZLZA 1RAXA 3K9PB 3N32A 4A20A 4DWFA 2J0JA 1WX9A 2GOWA 3QARA 3L0WB 3QX1A 3QAQA 4FLHA 2DX5B 2IY1B 3D32A 1Z2MA 2KWCA 1WR6E 2NCNA 4GIVA 3R7RA 4KIKB 3SU8X 3WALA 2L0TA 2RGFA 3AI5A 3M63B 3PV1A 4W9KA 4II2B 3VUYA 4HWIB 1C3TA 3JW0X 2K1FA 2IZVB 1Q1OA 3CSFA 3ENEA 2KJHB 4K1RB 3PGEA 4ZRJA 4FADA 4MEMA 5AZHA 4ANWA 2AWTA 1SE9A 4W9EA 1Z5SB 4EZJA 3U30A 4BKGA 2MW5A 3M62B 3ZTCA 1WM3A 2ZCCA 3B0AA 3BY4B 1WH3A 3QQ8B 4FA6A 5LXIB 4DHZB 4IG7B 3PRMB 2IBIB 2BKFA 3KUZA 2IO0B 1UZXB 5GMVA 3KUCB 4IWQA 4KDIC 1AARA 2CU1A 2WWZA 4K7SA 2KANA 3UIPB 3WAPA 2ZVOA 3KH0A 2K8CA 3ZNZB 4BOSC 2NPTB 2LUEA 2N4FA 3A9JA 1V80A 3IG3A 2G45B 2LJ5A 5L83A 1K8RB 1R4NI 1L2NA 3O65B 2M8SA 4OVUA 1WE6A 4G0NB 2VRRB 3APCA 2NVUI 2REXA 4HXDA 4X57B 2K8BA 4F1SA 1WZ3A 2D10A 3N30A 5CHFA 3N3KB 2O6VB 3HIZA 4FHJA 1SGHA 2A4ZA 3A9KA 4LJOB 2FAZA 1J19A 1V6EA 2FIFA 2AL3A 2ZCBA 4BBNC 5KHQA 4II3B 4HVBA 2MP2B 2PJHA 4ANVA 2Z0EB 4GSWA 4XC2A 4KSLC 4RMAA 1RLFA 2D3GA 3PHXB 3TBLD 3VTUA 2KMAA 3LDZE 2BYEA 4E71A 4IM3A 2ZNVC 3QJZA 4NQKE 4NQLB 2KX3A 4EZKA 1UGMA 1EF1A 3H7PA 1XQQA 2FNJB 3UGBB 4W9GA 2KTRB 5AZFA 3A1QB 3PLVA 1R4MI 1GC6A 3W1SC 2WDTB 4G3XB 2KO3A 3A4RA 1YX5B 4WJOA 1SIFA 1RRBA 1GUAB 4GB9A 2FCSA 5J18A 4GDKB 3X0WA 2ZPNA 2LGYA 3W1YA 3H7SA 3ZVVA 2KTFA 3VUXA 2JRIB 3WANA 4MJSB 4PS7A 3KW5B 2KWUB 5D2MB 2KQ7A 3H9DA 2D07B 3VTWA 5D6JB 2K25A 3SD5A 3CMMB 4RM8A 3V6CB 1UH6A 5AEKB 4NAWB 2OJRA 4ASWC 2I1KA 5CHVC 2ZNVB 4N9F4 1E90A 2MWSB 2GBJA 3GOEA 2EKEC 3DBLI 1M94A 1WXMA 2BGFA 1E8XA 4IWPA 4A3OA 4WJNA 2PE9A 1I35A 2PE6B 4GOCA 3T8MA 4GMVA 1WJNA 4W9JA 3ZO5B 2MCNB 1KM7A 1V5OA 2N1VA 3B08A 4ZYNA 3ZNGC 3P2BA 5AZGA 3RUIB 2KKCA 3PPAA 2G3QB 3A33B 2KK8A 3EC8A 4JGHB 2L00B 1E8WA 4ICVA 4GDLB 5LLIA 3TCAA 1ZKHA 1ZGUB 1V49A 2DAJA 1QZEA 2RD0A 2BF8B 3V60A 1I42A 1MG8A 3PZDA 2LXCA 1V81A 3DVGY 4EOYA 2KDBA 2IY0B 5DCNA 2NBVB 1WE7A 3CSTA 3UQBA 3ML8A 5IA7A 4I6NB 3ML9A
chains in the Genus database with same CATH superfamily
2J7QB 4K81A 1FM0D 2JWZA 1C78A 1UBQA 4IOIE 1D5ZC 4KV2A 4RGOS 3TJPA 1GG3A 4MGIE 1PQSA 2C7MB 4WURA 3HRDD 1Y8RC 4NJ6A 2CJOA 5T8IA 2LVPA 3KWLA 2ICIA 2V4LA 1Q10A 5BMGA 1QOGA 4G11A 2KC2A 3JVZX 3MC8A 4RGMA 3MTNB 4MM3A 4K7UA 5IN7A 4DXFA 2LRWA 2L83A 5IAAC 4BOZB 4ZHOA 1E0ZA 2BKRB 2WHIA 5HG2A 2LGIA 2L05A 4AP4C 1L4DB 2WLBA 2C7NB 2PW9A 2FUHB 1SXTA 2FCMA 5JH5C 2WQYB 4GDKA 1SJED 2JX5A 1LFDA 4BBNF 4WQMA 3ECIA 1EU4A 4MGYE 1EU3A 4HDQA 3RNGC 3WAOA 1JWAD 4M8MA 4B95A 2DAFA 3BWUD 4DXGA 1C79A 4L1BA 2Z8LA 1T5XD 2KDEB 4KZCA 1LQBA 3R66C 2IYDB 2ONQA 2BS4B 3H1UA 5DPRA 2JVCA 1WXAA 1WY8A 3NVYA 4REZA 4NJ7A 5JZEB 2IGHA 1XLQA 4TKNA 3IT4B 3OLMD 3MHSD 2D5GA 3NS8A 4JLCA 3ZDMC 3RNAC 3AE6B 1EF5A 4PK1A 3H7PB 1MHXA 3C19A 4MSMB 1JROA 4FJVB 1WXQA 4LCDE 2W3RA 3CWIA 3Q8EA 1C76A 3ZGZA 2DYBA 2RDHA 2AQ3B 3N1YC 1OEYA 3Q8CA 4HPLB 5CTRC 2JYTA 2LHEA 3MC9A 1YQ4B 2WXLA 3L08A 1DOXA 1V97A 1YQ3B 4YTPB 1TS2A 1K52A 4BKTA 2JY6A 2FBWB 1NVID 3DBHI 4TQ1A 5E6PA 3T9LA 4B6WA 1HTOA 2LGDA 2QIEB 2N9PC 4OW0A 4XE0A 3R7QA 2DWQA 5E6JA 3AE8B 3PZ8A 4TV3A 1QOBA 1N6ZA 5BMHA 5IKCM 1WGGA 3WA0A 3DVGX 1WMHA 2HD5B 1VRAB 4TMAB 4XX5A 4YWGG 1SJHD 2KFKA 3ZNHB 1BXTA 2MHJA 3KUDB 3RNBC 1D3ZA 4HCPB 1P3QU 1JWSD 2KD0A 2KLGA 3AEEB 1WF9A 1E7PB 4MACA 2IO3B 4ZRIA 2NR2A 4WWNA 1OFFA 5HFYA 2PLPA 1V5TA 3RN9C 2BYFA 2XK5B 3FC4A 3BK2A 2LVQA 1L0YB 1AYFA 1P0RA 3DDCB 3L16A 2WX0A 4LJPB 4OVVA 2AL6A 2LVOA 3M95A 3TL5A 5CHWA 2FCQA 2E3TA 1G6JA 4WQOB 1FRDA 3IFWB 1XO3A 2BB6A 1NDDA 3DHIC 2TSSA 1HE8A 3VDZA 2IGDA 3TEXA 2MBHA 4ICUA 2R2OA 3V6EB 3L4PA 3RD2A 3IVFA 2MBBB 3PLUA 3ZDTA 2IGGA 3SDLC 1NYQA 2X8XX 2MLBA 1PGXA 2AQ2B 4WJQA 1TKGA 3TEZA 3MJWA 3ETRA 2M1MA 3APFA 2J0KA 4AJYB 1IYFA 2ZJDA 3ZRCA 3AEGB 1IUEA 2LD9A 4C7YA 4ZDVA 5FKAC 2KJ6A 2V3SA 2BS3B 4JQWC 2QC8A 4YL8A 1TZ1A 5DPSA 2CHXA 3AN1A 1C4PA 2ASQA 2NTSA 1YN5A 3L13A 3R3MA 4KSKC 4R3DA 1NBFC 3WIMA 2QHOA 2UYZB 2JZZA 4PS3A 3PZ7A 5EDSA 3M3JA 4ACFA 1WWTA 2KVZA 2QCZA 5H8YE 1PDXA 3ZLZA 1RAXA 2WP9B 3QAQA 3OG5A 3DWMA 4FLHA 3RNCC 5IOIA 2IY1B 3D32A 2KWCA 2NCNA 1XLOA 2KWDA 2RGFA 5BMIA 4LNIA 4HWIB 3GP7A 1C3TA 2KACA 3Q8FA 3PGEA 4ZRJA 1C4AA 4O1NA 3B9JA 1Y56A 4EZJA 1ZDVA 3M62B 2ZCCA 3B0AA 1VDVA 3QQ8B 1I4QA 4DHZB 1XEEA 3EUB2 2IO0B 2W3SA 4IWQA 4N6EB 2CU1A 4K7SA 3UIPB 2ZVOA 3KH0A 4BOSC 2LUEA 1TKEA 1KLGD 1R4NI 1L2NA 3U7ZA 2REXA 3AE4B 4HXDA 3U2SC 1I4HA 2V9HA 3E56A 5CHFA 4FHJA 1ZE3D 2A4ZA 3N20C 3Q3NC 2FAZA 3VR9B 2PJHA 1AWDA 2D3GA 3VTUA 2KMAA 4E71A 4RCOA 1F77A 1EF1A 3H7PA 1XQQA 3BK1A 3PLVA 1GC6A 1F0ZA 2WDTB 1YX5B 5J18A 4GDKB 3X0WA 3ZVVA 5H92C 2JRIB 4XDDA 3H9DA 3VTWA 1UH6A 2J42A 2I1KA 2ZNVB 1QQRA 2H88B 4ZOHC 2EKEC 3DBLI 4A3OA 1E8XA 2PE9A 4S17A 3T8MA 1UNSA 3I5JC 4OZCA 2VZKD 4JE3B 1E6EB 2KKCA 4YXDB 4JGHB 4ICVA 3TCAA 2BQQA 3RFZB 3V60A 1TT5B 2W55A 2LXCA 1V81A 2IY0B 2NBVB 1WE7A 2BVCA 3UQBA 3ML8A 1VLBA 4I6NB 4AJWA 2G9HD 2EMTA 4NAMA 1TIFA 3O13A 3DWGC 2NPTA 1SE2A 4JPSA 3BINA 4LDTD 4GLSC 2N7EA 3RZFA 3VTVA 4E74A 3PTFC 1TGZB 2XK5A 2WXNA 1HTQA 2V1YA 2A5UA 2JXXA 2OOBB 1WJUA 1OEYJ 1NI2A 2KNBA 2KOXA 3QHTA 5FR6A 4XWTA 2KXJA 1SBBB 2N7DA 2BT6A 2KWVB 5C2TB 3Q8AA 4QAYA 1I4RA 1I4GA 1ZW7A 5EE3A 4N58A 2INNE 1WMHB 4DHJD 1BT0A 5DPTA 4P16A 4IUMB 2DZMA 2KFKB 1UF0A 1C77A 4GXBA 2KLCA 2D3AA 5HKHA 1FRRA 1PGAA 1YMHE 1WGYA 4EKUA 4HRSA 4FJYA 1ESFA 1KLUD 2K6QA 4DDID 4CQNA 1BMLC 3TMPB 3SHQA 3ZIMA 3N1XC 2KZRA 4WIPA 3OJ3A 2W9NA 2Y5BB 2INDC 3I3TB 4PYZA 2SAKA 3A4SC 1KJTA 3UQAA 3S2AA 1FNVA 4B0MA 2N9EB 1DYQA 4B0EA 2KDFB 2AEHA 1PGBA 3PREA 4AWJA 1ZPSA 5GXGB 2PTLA 2G4DB 2C60A 2KJRA 1YQBA 2RSUA 1WX8A 2M0XA 3QCAA 1HEZE 1ZOYB 2Z0DB 1OQRA 2CKHB 2L7RA 1V1OA 2X38A 2JF5A 4L23A 4US8A 1F1HA 2JU6X 2HDEA 2MJEA 1WR1A 4N59A 3ZXVA 4KKJA 2DBYA 1WFYA 1QOAA 1NYRA 1IGDA 1YNTE 1N5XA 1LM8B 2L52A 2XEWA 4NNJB 2L32A 2QSDA 2PPHA 1XXGA 2VZKB 2NBWB 2WXPA 1I4PA 1YD8U 3B2FA 2KQSA 3URYA 5E6OA 3GE3C 2Y5PA 2BYVE 1V2YA 4KVGB 2IJ0A 2BB5A 3X23A 2G1EA 4RH6A 3KYCD 1XCTL 3I63C 1P98A 2O6VD 4W9DA 4WJPA 4M0WB 1QKZA 2MA9B 4BKSD 2W82A 4M01A 1HA5A 3Q3FA 1V9JA 2MQJA 4FXCA 3C8YA 2M17A 3Q3MC 1FXAA 4LDTB 1GNUA 4BFRA 4HPMB 3GZNI 2Z59B 2NTTA 3DBSA 1N62A 3NZUA 1WXSA 4WAFA 1KLVA 1MJDA 1V8CA 3SR6A 2RR9A 3L54A 4LNNA 4IM0A 4RM9A 1SB3C 1KF6B 2D11A 3AE3B 4ZYSA 3W1SA 2CS4A 2K39A 3NG0A 3U4EG 1PFDA 3NVZA 1EO6A 3AULA 4IW0A 4FJZA 4A6QA 2ACZB 1V86A 4DHZE 4DHJB 3V05A 2W54A 1MG4A 5D3IB 2AQ1B 2RPVA 1EM7A 4RF0A 1ZDXA 4MDKE 1QF6A 1E7UA 1UELA 2MRPA 2EKIA 4RFBA 2XBBC 4HROA 2DHZA 1S3SG 1YJJA 3CIRB 3DVNU 3J9CA 3VQIA 1VZ8A 1B1ZA 2NBUA 3VH4B 1JALA 3DVNV 1B9RA 5L95C 3HM3A 4J6IA 1KOTA 3RULA 3EHVA 3PHWB 1OQYA 1JCKB 3HHMA 4EFOA 5LNK1 1VR9A 1J8CA 1LXDA 2GI9A 3V62A 2CJNA 3HK0A 4WWOA 2KX0A 2O2VB 2IPKD 3SFDB 2Q5WD 3ALBA 4ZRKA 3KWVA 2B76B 4BAXA 2J0JA 2GOWA 3L0WB 5D3DA 2WDVB 3W5VB 3NRZA 1RFKA 2V3NA 3R7RA 4GIVA 1FPYA 3AEBB 1FO4A 2LJIA 2WXGA 4LNFA 1FXIA 2J4XA 2K1FA 2GLSA 4MEMA 5AZHA 2AWTA 3I9V1 4LK0M 1TS5A 1UWMA 2MW5A 3ZTCA 3BY4B 1UUPA 4FA6A 5LXIB 1MVKA 4IG7B 3PRMB 2BYTA 3KUZA 1MFWA 1AW7A 2KN4A 3AEDB 3KUCB 4KDIC 1AARA 4K3BA 2KANA 3WAPA 3ZNZB 2ZW1A 2NPTB 3IG3A 2D3CA 2G45B 2LJ5A 4ARIA 2E6XA 1TS3A 3O65B 2M8SA 3P42A 1C4CA 1JRPA 4C56C 2O6VB 1J19A 2ZCBA 4II3B 1DGJA 1FNWA 2MP2B 4BZAA 2Z0EB 1SIJA 1V1PB 2XN9C 3T3NA 1DOYA 4RMAA 3LDZE 2ZNVC 4NQKE 5IP4D 4NQLB 3BYTB 5AZFA 3A1QB 3W1SC 2GB1A 3A4RA 1SIFA 2FCSA 1WRIA 2RDGA 1ZXIA 3H7SA 1JQ4A 2KTFA 3VUXA 4ITKA 4MJSB 5D2MB 2DLBA 5MPOA 2K25A 3SD5A 5AEKB 4ASWC 1GB4A 5CHVC 4N9F4 2YEPB 1TS4A 2GBJA 1EWCA 3NVVA 5BYQA 5AUKA 1WXMA 1ROEA 2BGFA 1NI3A 4WJNA 4ZRPA 4P1CC 1L5PA 4GMVA 4K3CA 2QJLA 3B08A 4ZYNA 3AB5A 3RUIB 2G3QB 5LLIA 1ZGUB 1TJEA 1HZ5A 2DAJA 4M0WA 1YOVB 2RD0A 4RGTA 1WGKA 2SEBD 3DVGY 2PVGC 1L6UA 4A90A 3CSTA 3AU5A 1WGRA 3DHGC 2YLMA 2L76A 3GS2A 3NJTA 3W9CB 3MFGA 3V61A 2LWPA 5C23A 4BVUC 3OAWA 2JUOA 1OTRB 3NY5A 1IBXB 1WYGA 3ZTDA 5C1ZA 2WXJA 2WXOA 3NZSA 3AE5B 1XD3B 3P4QB 3HVDA 1TY0A 3DBRB 4KKIA 3IXSA 1STEA 2K5PA 1SEBD 3NS1A 4UDUC 1A70A 3ZQ4A 4CYEA 5EE9A 1XF5L 3RCZA 4K7WA 2KTRA 3W5UB 1JWMD 3Q3JA 2DZIA 4HJKA 1YN4A 3E9SA 1HQRD 1E7VA 3H6NA 1HXYD 1VZ7A 4DQOC 3FILA 1X1MA 2PEAA 2GBMA 3VFKA 4HK2A 4DDGD 1VD2A 1J0GA 2HE7A 3P63A 3AE1B 3U52E 2PIAA 4YTNB 1L4ZB 3SFEB 3A9JB 1N5WA 1E5WA 4WWPA 4KZ0A 3C0RB 1C1YB 4M00A 1P9DU 1FXTB 4YTMB 2MSED 3R2TA 1NEKB 1GPXA 2O2VA 3PRPB 3KYDD 3H8HA 2C5LC 3A9KB 4WAAA 3WAMA 2CHZA 2MX2A 2DENB 1WJ4A 2FUG1 3CF6E 3OWEB 3V3XA 2WXIA 3ABVB 4URKA 3UINB 1WM2A 2BWES 4DXAB 1U4AA 1GOZA 2PKOA 3ZJTA 2JRHA 4H2AA 1IGCA 3UI3A 1JMLA 3EECA 3EA6A 4JWUC 2HJ1A 5BYRA 2KHWB 4I6PA 1T0YA 2CHWA 4P6VF 3AU4A 1WGDA 3TIXA 4HKQA 3PS6A 3VHTC 3APDA 4IDIA 2V3PA 1XLNA 1WX7A 3RI7C 1IPGA 4HLEA 1UBIA 2R2QA 1SSNA 3Q6BA 2VH2A 1KH0A 3B2GA 1WRDB 5JHBA 1LGRA 2N1WA 1H8CA 1WI0A 1N60A 2MBQA 1T0SC 3KLSX 2O6VA 3ZW3A 3OJ4B 2C7HA 2MP2A 4BKSA 3QIJA 1S1QB 4HCNB 4A3PA 1V1PA 2WU2B 3VAWA 1WIAA 1GB1A 2LUMA 1TY2A 1CMXB 1CZPA 1K51A 2N9XA 2GBKA 2BPSA 1VZ6A 2MBEA 5J2RA 3A1QA 1TYGB 3VR8B 2KVRA 1J7BA 4TSSA 1FD6A 2GBNA 3MHZA 1YIWA 5D94A 2QDFA 3LYYA 3VUWA 4CHKA 3DQVA 4US9A 3Q2AC 3GE8C 4MJSA 2FCNA 2LGXA 4RNAA 2L8JA 1GC7A 1R7SA 1YX6B 1MI0A 1EUVB 2NMQA 2WGSA 4CO7A 2KQ4X 1ISNA 1JW9D 3JYUA 2KN5A 2M0AA 3LJ3A 2LI5A 2HJ8A 2L3ZA 2LFIA 4W9CA 4B9KA 3B1LX 4FBJB 2D2QA 1F9JA 1WSPA 3WCQA 2J0MA 4P1BC 1D6EC 1OQQA 3P4SB 4FULA 3VH3B 1Q0WB 3PT2B 5DPWA 3AEAB 2JZPA 5G2NA 2HTME 2JSVX 3NOBA 2KDIA 4L2YA 1OGWA 3QC8B 1GJZA 3NVWA 4GN1A 2RMMA 3N9YC 1IBXA 3JSVB 1E8ZA 4DBGA 2EMSA 3DPDA 1I7HA 2KC1A 2M4NA 4JL9A 4JX1C 4KDLB 2QMTA 2ZEQA 3Q69A 4EUTA 1FMAD 1WXVA 3GB1A 2MJ3A 3T3OA 3K9PB 1QT9A 1P7EA 4DWFA 3QARA 2BS2B 1ET6A 2K0PA 1N63A 2CU3A 4KIKB 3SU8X 3BZDB 3I57A 3VUYA 4II2B 3ZXRA 1QLBB 2IZVB 3TUOA 1Q1OA 3ENEA 2KT7A 4FADA 1DOIA 1RM6C 3RNFC 4W9EA 1Z5SB 3TSSA 3IAS1 2LEKA 2INCC 2K9XA 4WWMA 2BKFA 1FFVA 2WWZA 3A9JA 1TKYA 1K8RB 4LNOA 3MJ5A 3APCA 1MHHE 4RF1A 2JYEA 2PVOD 3HIZA 3LXFA 1SGHA 3A9KA 4LJOB 1V6EA 2FIFA 3R8BA 4ANVA 4GSWA 4XC2A 2M19A 4KSLC 1HZ6A 2J53A 2I38A 4IM3A 1T6BX 3QJZA 1RYJA 2FNJB 4W9GA 2KTRB 4C4VB 5FK9C 4G3XB 2KO3A 1F2RC 4C00A 1GUAB 3EFCA 1R4MB 2ZPNA 2LGYA 1FIQA 3KW5B 5AUIA 4OHJA 3FILB 1L6VA 2FE8A 3CMMB 3VRAB 4RM8A 3IAM1 4KX6B 2OJRA 2K3UA 1KTKA 1F2RI 2MWSB 2VH1A 1M94A 4ZRQA 2JXTA 2PE6B 4W9JA 3ZO5B 1V5OA 2BBCA 2KYWA 5TSSA 3ZNGC 4D2KA 1YN3A 1ZXHA 3P2BA 2QEJC 5AZGA 3A33B 2L1AA 2KK8A 3EC8A 2L00B 4A9AA 4GDLB 1V49A 1QZEA 2WXQA 1I42A 2JQRB 3PZDA 2PMVA 5IA7A 3P4PB 3ML9A 2DZKA 3BYYB 3VRBB 2CR5A 3RPFC 4W9LA 1ET9A 2Y3AA 5C3JB 2LXAA 2LZ6A 5FR3A 4IWOA 4USAA 1JRUA 2EELA 2K8HA 2MJDA 3RNEC 3LB8C 2QILA 3PRZA 2KMCA 2WXRA 4YSXB 2AYOB 4A8XC 2JT4B 3DBRI 3PSEB 4S0RA 4YSZB 1J7AA 2I1JA 4ARCA 2WNMA 1K53A 4OZBA 1GAQB 4E3CA 2L0FA 4J3OD 1L0VB 4HPPA 2I2YA 2UWQA 2WXMA 4NPNA 2KAJA 1PYWD 2MBOA 1CJEA 1FFUA 2K6DB 2LMCA 2OHFA 5HHDG 5G5HA 3P4RB 3HM6X 1J7CA 5EE0A 3R2IA 3HVZA 4NY0A 1T0QC 4TUUA 4A55A 4YT0B 3BIID 4AS1A 3AEFB 3GZNB 1FNUA 1ZUD2 2JZ3B 4F7ZA 1AN8A 4NAWA 4C7ZA 2YEPF 3EFUA 3DCGA 4MH8A 2KFJA 4FHKA 3AV8A 2NS5A 3NUHB 4XYCA 1UGJA 3JSVA 3Q3OC 1RFAA 2J52A 3MC0B 4KGSA 1L7YA 4JIOU 2FIDA 4OZAA 3TEYA 3QK0A 3FKYA 4M8NA 4AUQC 3VXWA 4EEWA 2N7JA 1VCBA 5BO4B 1T3QA 1T0RC 1CQVA 2WDQB 2DYOA 4ZHPA 4PS8A 4XZ4A 3AE2B 1WGHA 3UF8A 2V0GA 1XCQL 4WH4A 1UWXA 1QOFA 4KIKA 2ZVNA 2WS3B 1TTNA 3ONSA 1E8YA 5J17A 1ACCA 1UD7A 3QWZB 1RWSA 3AXCA 3K9OB 1SE3A 4W9HA 3QA8A 4P7IA 2D3BA 2LRUA 2YVCA 2BTEA 2BWFA 1N61A 3NZ3A 2XNAC 4TQ0A 4IM2A 5G5GA 2KDMA 4LNKA 1YJ1A 4MH0E 5CX3A 1XT9B 2C9WB 5D7GA 4KGTA 5TR5A 4XGAB 3U8ZA 2AX5A 4PYUA 2WDRB 3ZUNA 2JWUA 2RPQA 1CK1A 2LHDA 3DBHB 3DOWA 4HJGE 3ZJUA 3IT6B 4ANXA 2WXHA 2GMIC 1D5MC 1D5XC 3BVZA 1C9FA 3ZRFA 1H4RA 1WYWB 5LXHA 4MSQB 2WX1A 4MGZE 2IO2B 2OEDA 4C4VA 3IBEA 1P1AA 4ANUA 1WJ6A 2GBRA 3IHPC 1ENFA 4G50A 2KMMA 1KFYB 2MEKA 3HUIA 3L10B 4Q2JA 2DYMA 2IO1B 3ZNID 3RZWC 2ZZPB 2IDYA 3RYTA 5G55A 4MGKE 4EZLA 1TBEA 1E9MA 1YJIA 2ZW0A 4XDCA 3AE7B 4OVZA 4MM3B 2G4SA 5E6NA 1ZP0B 1F52A 4FN2A 1IP9A 2DNFA 2DZJA 4HEA1 4GGQA 3VVWB 4I6LB 2WXFA 3AH7A 4GDLA 1WZ0A 4HDOA 3L17A 3EGRA 4DK5A 3P1MA 3UIOB 2Y5CA 1Q5WB 3AE9B 2UU7A 1JWUD 1A5RA 1MPEA 4NZLB 5JHAA 2B3AA 4MELA 4IC7B 1PUTA 4YSYB 1I4XA 5EE1A 4W9FA 5HI1A 4XWWA 2ON8A 2N9LA 2WYQA 2HTHA 4AOFA 2OJWA 2WXKA 3AMZA 5KHOA 2LASA 3KVFB 3RMKC 3W2DA 3RT3B 3PVLA 4W9IA 5BYSA 2MH7A 3ZYYX 1FCLA 3DHHC 3U7DA 4GU2A 2ZPYA 3NHEB 3ZKJC 1VJKA 2JPHA 3BVMA 4F8CB 3N32A 4A20A 1WX9A 1L0XB 1SE4A 3QX1A 2RDBC 2DX5B 1Z2MA 1M4VA 4LTUA 4AQ7A 1WR6E 3WALA 2L0TA 3TEWA 3M63B 3AI5A 3MP9A 3PV1A 4W9KA 3JW0X 4RGNA 4K1RB 3CSFA 2KJHB 4JWSC 2K22A 4LLGM 4ANWA 1SE9A 3U30A 4BKGA 1WM3A 1WH3A 3N1ZC 2H89B 2IBIB 1UZXB 4KGRA 5GMVA 1FEHA 4PT5A 2K8CA 2N4FA 1V80A 5L83A 1FCCC 3KQ4A 4OVUA 1WE6A 4G0NB 2VRRB 2NVUI 3PO0A 4X57B 2K8BA 4F1SA 1WZ3A 2D10A 1R4NB 3N30A 3N3KB 3AM9A 1D4BA 5IO9A 5KHQA 2AL3A 4NJCA 4BBNC 4HVBA 1SF0A 4C80A 1K50A 4IKGA 1RLFA 3PHXB 3TBLD 2BYEA 2KX3A 4EZKA 4EE2A 1UGMA 3UGBB 2R61A 2V4IB 1R4MI 2M56B 1BUIC 4WJOA 2N0SB 4HKZE 1RRBA 4GB9A 1QILA 3ZJVA 3W1YA 2LGSA 3WANA 4MT5A 2GRIA 4PS7A 2KWUB 3BVGA 1TZOA 2KQ7A 2D07B 1E10A 5D6JB 2WU5B 3V6CB 3AECB 4NAWB 5I4DA 3SEBA 1E90A 3GOEA 4IWPA 1KRHA 2INPE 1EWYC 1I35A 4GOCA 1WJNA 1P7FA 5JXVA 2BW2A 2MCNB 1KM7A 2N1VA 3DBLB 1NENB 2N9KA 3PPAA 3Q8BA 1E8WA 1ZKHA 3FAHA 1LO5D 2BF8B 4M02A 1JWBD 3Q14C 1MG8A 1XLPA 4EOYA 2KDBA 5DCNA
chains in the Genus database with same CATH topology
2DZKA 2J7QB 3AU5A 4K81A 1WGRA 2CR5A 2JWZA 2EMTA 2YLMA 4W9LA 2L76A 2LXAA 1UBQA 2LZ6A 4KV2A 4IWOA 3V61A 2NPTA 3TJPA 2LWPA 1GG3A 5C23A 1JRUA 3BINA 4LDTD 4BVUC 4MGIE 3OAWA 2N7EA 3RZFA 2K8HA 3VTVA 1PQSA 1OTRB 2JUOA 4E74A 3PTFC 1TGZB 3NY5A 3PRZA 2KMCA 2XK5A 2C7MB 3ZTDA 2AYOB 5C1ZA 2JT4B 3DBRI 1Y8RC 3PSEB 4NJ6A 2LVPA 3NZSA 2V1YA 2A5UA 2I1JA 2JXXA 1XD3B 2OOBB 1WJUA 2V4LA 4G11A 4E3CA 2KC2A 2L0FA 3JVZX 3MTNB 4MM3A 1OEYJ 4K7UA 2UWQA 1NI2A 2KNBA 2KOXA 3QHTA 4NPNA 5FR6A 2KXJA 2LRWA 4CYEA 2N7DA 5IAAC 4BOZB 2KWVB 3RCZA 2BKRB 4K7WA 2MBOA 2KTRA 2L05A 4AP4C 2K6DB 3Q3JA 2C7NB 2DZIA 1ZW7A 3HM6X 2FUHB 1WMHB 4HJKA 4DHJD 2FCMA 5JH5C 1BT0A 4GDKA 1E7VA 5DPTA 4NY0A 1LFDA 4IUMB 4TUUA 4BBNF 2DZMA 2KFKB 3H6NA 3ECIA 4GXBA 2KLCA 5HKHA 1X1MA 4MGYE 2JZ3B 2PEAA 4HDQA 4F7ZA 2GBMA 1WGYA 3WAOA 4EKUA 3VFKA 4HK2A 4M8MA 4NAWA 4DDGD 4B95A 2DAFA 4FJYA 2K6QA 1VD2A 3EFUA 4DDID 3DCGA 2KFJA 2HE7A 3TMPB 1J0GA 3SHQA 3ZIMA 2KZRA 3OJ3A 2KDEB 2W9NA 4FHKA 4KZCA 1LQBA 2Y5BB 3A9JB 2NS5A 3R66C 1E5WA 4WWPA 3JSVA 3I3TB 4KZ0A 1RFAA 3C0RB 4PYZA 3A4SC 1KJTA 2IYDB 3UQAA 1C1YB 3S2AA 1L7YA 3H1UA 5DPRA 1P9DU 1FXTB 2MSED 4JIOU 2FIDA 2JVCA 2N9EB 3QK0A 2O2VA 3PRPB 4M8NA 2KDFB 3KYDD 4AUQC 3VXWA 2C5LC 3A9KB 4EEWA 2AEHA 4WAAA 1WXAA 1WY8A 3PREA 1VCBA 2CHZA 2MX2A 3WAMA 4AWJA 4NJ7A 5BO4B 5JZEB 2DENB 1WJ4A 2G4DB 4TKNA 3OLMD 3MHSD 3CF6E 2DYOA 2C60A 3NS8A 4JLCA 3ZDMC 4PS8A 4XZ4A 2KJRA 1YQBA 1WGHA 3UF8A 1EF5A 2RSUA 1WX8A 2M0XA 4URKA 3H7PB 3UINB 4KIKA 1WM2A 3QCAA 4MSMB 2ZVNA 2BWES 2Z0DB 4DXAB 2CKHB 1U4AA 2L7RA 1TTNA 2JRHA 2JF5A 3ONSA 1E8YA 4FJVB 4AJWA 5J17A 4LCDE 1UD7A 3QWZB 3EECA 1WR1A 3AXCA 3K9OB 4W9HA 2DYBA 1WFYA 2KHWB 4I6PA 3QA8A 1T0YA 2CHWA 3AU4A 4P7IA 1OEYA 1WGDA 3TIXA 2LRUA 3PS6A 4HPLB 5CTRC 2YVCA 3VHTC 3APDA 2BWFA 3L08A 4TQ0A 4IM2A 1LM8B 1WX7A 2XEWA 1YJ1A 1IPGA 4HLEA 4MH0E 1UBIA 2R2QA 4NNJB 5CX3A 2PPHA 4BKTA 1XT9B 2JY6A 1WRDB 2C9WB 2NBWB 5JHBA 1YD8U 3DBHI 2KQSA 5D7GA 4TQ1A 5E6PA 2N1WA 5TR5A 3T9LA 5E6OA 1H8CA 4B6WA 1WI0A 2LGDA 3R7QA 2N9PC 4PYUA 2MBQA 3U8ZA 3ZUNA 2BYVE 1V2YA 4KVGB 4TV3A 2RPQA 2O6VA 3X23A 3ZW3A 3OJ4B 3DOWA 3KYCD 1WGGA 3WA0A 2C7HA 3DVGX 2MP2A 1WMHA 4BKSA 2HD5B 4ANXA 3QIJA 1S1QB 4HCNB 4A3PA 1P98A 2O6VD 4XX5A 4W9DA 4WJPA 3VAWA 4M0WB 1WIAA 2GMIC 2MA9B 2KFKA 1CMXB 3ZNHB 4BKSD 3KUDB 1D3ZA 3ZRFA 4HCPB 2N9XA 1P3QU 2GBKA 2BPSA 3Q3FA 1H4RA 2KD0A 2KLGA 1V9JA 1WYWB 2MBEA 2MQJA 5LXHA 5J2RA 3A1QA 2WX1A 2M17A 4MSQB 4MGZE 2IO2B 2KVRA 4LDTB 1WF9A 1GNUA 2GBNA 4BFRA 1YIWA 3IBEA 5D94A 4HPMB 1P1AA 3GZNI 2IO3B 4ANUA 4ZRIA 3VUWA 4CHKA 2NR2A 4WWNA 2Z59B 3DQVA 1WJ6A 2GBRA 3IHPC 4G50A 3DBSA 4MJSA 3NZUA 2FCNA 1V5TA 1WXSA 3L10B 2BYFA 2XK5B 1KLVA 2LGXA 2DYMA 2IO1B 3ZNID 2LVQA 3RZWC 2ZZPB 1P0RA 1GC7A 2L8JA 3DDCB 3RYTA 5G55A 3L16A 4MGKE 4EZLA 1TBEA 2RR9A 2WX0A 4LJPB 1YX6B 3L54A 4OVVA 1EUVB 2AL6A 4IM0A 4RM9A 4CO7A 2LVOA 1ISNA 2G4SA 2D11A 3M95A 3TL5A 5CHWA 3JYUA 5E6NA 2KN5A 2FCQA 1G6JA 3W1SA 2CS4A 2K39A 4WQOB 3IFWB 4FN2A 1IP9A 3LJ3A 1NDDA 1EO6A 2LI5A 3AULA 2HJ8A 2L3ZA 4IW0A 4FJZA 1HE8A 2DZJA 3VDZA 4W9CA 1V86A 4B9KA 4DHZE 2MBHA 4GGQA 4DHJB 3B1LX 4FBJB 4ICUA 4I6LB 3VVWB 2D2QA 2R2OA 3V6EB 1F9JA 3IVFA 3RD2A 2MBBB 4GDLA 3PLUA 1WZ0A 3ZDTA 4HDOA 3SDLC 2J0MA 2MLBA 3L17A 4WJQA 4DK5A 3MJWA 3UIOB 4FULA 4MDKE 3VH3B 2M1MA 1UELA 1E7UA 1Q5WB 1Q0WB 2MRPA 3APFA 3PT2B 2J0KA 4AJYB 2XBBC 5DPWA 1A5RA 2DHZA 2ZJDA 1IYFA 3ZRCA 1S3SG 3DVNU 5JHAA 2B3AA 4MELA 3VQIA 2LD9A 4IC7B 5G2NA 4ZDVA 3NOBA 4W9FA 2KDIA 2NBUA 3VH4B 2KJ6A 2V3SA 3DVNV 5L95C 3HM3A 2WYQA 1OGWA 3QC8B 1GJZA 4J6IA 1KOTA 3RULA 4GN1A 3EHVA 2HTHA 1OQYA 3PHWB 4JQWC 4AOFA 4YL8A 1TZ1A 3HHMA 4EFOA 5DPSA 2CHXA 2ASQA 3JSVB 1J8CA 1LXDA 1E8ZA 3L13A 3R3MA 5KHOA 4KSKC 2LASA 3V62A 3KVFB 4DBGA 1NBFC 3RT3B 2EMSA 3DPDA 3PVLA 4W9IA 3HK0A 4WWOA 3WIMA 2KX0A 2QHOA 2UYZB 2O2VB 2KC1A 2JZZA 4PS3A 2M4NA 4JL9A 3ALBA 3U7DA 4GU2A 2ZPYA 3M3JA 4KDLB 4ZRKA 2ZEQA 5EDSA 3NHEB 3ZKJC 2JPHA 4EUTA 1WXVA 4F8CB 3ZLZA 1RAXA 3K9PB 3N32A 4A20A 4DWFA 2J0JA 1WX9A 2GOWA 3QARA 3L0WB 3QX1A 3QAQA 4FLHA 2DX5B 2IY1B 3D32A 1Z2MA 2KWCA 1WR6E 2NCNA 4GIVA 3R7RA 4KIKB 3SU8X 3WALA 2L0TA 2RGFA 3AI5A 3M63B 3PV1A 4W9KA 4II2B 3VUYA 4HWIB 1C3TA 3JW0X 2K1FA 2IZVB 1Q1OA 3CSFA 3ENEA 2KJHB 4K1RB 3PGEA 4ZRJA 4FADA 4MEMA 5AZHA 4ANWA 2AWTA 1SE9A 4W9EA 1Z5SB 4EZJA 3U30A 4BKGA 2MW5A 3M62B 3ZTCA 1WM3A 2ZCCA 3B0AA 3BY4B 1WH3A 3QQ8B 4FA6A 5LXIB 4DHZB 4IG7B 3PRMB 2IBIB 2BKFA 3KUZA 2IO0B 1UZXB 5GMVA 3KUCB 4IWQA 4KDIC 1AARA 2CU1A 2WWZA 4K7SA 2KANA 3UIPB 3WAPA 2ZVOA 3KH0A 2K8CA 3ZNZB 4BOSC 2NPTB 2LUEA 2N4FA 3A9JA 1V80A 3IG3A 2G45B 2LJ5A 5L83A 1K8RB 1R4NI 1L2NA 3O65B 2M8SA 4OVUA 1WE6A 4G0NB 2VRRB 3APCA 2NVUI 2REXA 4HXDA 4X57B 2K8BA 4F1SA 1WZ3A 2D10A 3N30A 5CHFA 3N3KB 2O6VB 3HIZA 4FHJA 1SGHA 2A4ZA 3A9KA 4LJOB 2FAZA 1J19A 1V6EA 2FIFA 2AL3A 2ZCBA 4BBNC 5KHQA 4II3B 4HVBA 2MP2B 2PJHA 4ANVA 2Z0EB 4GSWA 4XC2A 4KSLC 4RMAA 1RLFA 2D3GA 3PHXB 3TBLD 3VTUA 2KMAA 3LDZE 2BYEA 4E71A 4IM3A 2ZNVC 3QJZA 4NQKE 4NQLB 2KX3A 4EZKA 1UGMA 1EF1A 3H7PA 1XQQA 2FNJB 3UGBB 4W9GA 2KTRB 5AZFA 3A1QB 3PLVA 1R4MI 1GC6A 3W1SC 2WDTB 4G3XB 2KO3A 3A4RA 1YX5B 4WJOA 1SIFA 1RRBA 1GUAB 4GB9A 2FCSA 5J18A 4GDKB 3X0WA 2ZPNA 2LGYA 3W1YA 3H7SA 3ZVVA 2KTFA 3VUXA 2JRIB 3WANA 4MJSB 4PS7A 3KW5B 2KWUB 5D2MB 2KQ7A 3H9DA 2D07B 3VTWA 5D6JB 2K25A 3SD5A 3CMMB 4RM8A 3V6CB 1UH6A 5AEKB 4NAWB 2OJRA 4ASWC 2I1KA 5CHVC 2ZNVB 4N9F4 1E90A 2MWSB 2GBJA 3GOEA 2EKEC 3DBLI 1M94A 1WXMA 2BGFA 1E8XA 4IWPA 4A3OA 4WJNA 2PE9A 1I35A 2PE6B 4GOCA 3T8MA 4GMVA 1WJNA 4W9JA 3ZO5B 2MCNB 1KM7A 1V5OA 2N1VA 3B08A 4ZYNA 3ZNGC 3P2BA 5AZGA 3RUIB 2KKCA 3PPAA 2G3QB 3A33B 2KK8A 3EC8A 4JGHB 2L00B 1E8WA 4ICVA 4GDLB 5LLIA 3TCAA 1ZKHA 1ZGUB 1V49A 2DAJA 1QZEA 2RD0A 2BF8B 3V60A 1I42A 1MG8A 3PZDA 2LXCA 1V81A 3DVGY 4EOYA 2KDBA 2IY0B 5DCNA 2NBVB 1WE7A 3CSTA 3UQBA 3ML8A 5IA7A 4I6NB 3ML9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZK A;  2J7Q B;  3AU5 A;  4K81 A;  1WGR A;  2CR5 A;  2JWZ A;  2EMT A;  2YLM A;  4W9L A;  2L76 A;  2LXA A;  1UBQ A;  2LZ6 A;  4KV2 A;  4IWO A;  3V61 A;  2NPT A;  3TJP A;  2LWP A;  1GG3 A;  5C23 A;  1JRU A;  3BIN A;  4LDT D;  4BVU C;  4MGI E;  3OAW A;  2N7E A;  3RZF A;  2K8H A;  3VTV A;  1PQS A;  1OTR B;  2JUO A;  4E74 A;  3PTF C;  1TGZ B;  3NY5 A;  3PRZ A;  2KMC A;  2XK5 A;  2C7M B;  3ZTD A;  2AYO B;  5C1Z A;  2JT4 B;  3DBR I;  1Y8R C;  3PSE B;  4NJ6 A;  2LVP A;  3NZS A;  2V1Y A;  2A5U A;  2I1J A;  2JXX A;  1XD3 B;  2OOB B;  1WJU A;  2V4L A;  4G11 A;  4E3C A;  2KC2 A;  2L0F A;  3JVZ X;  3MTN B;  4MM3 A;  1OEY J;  4K7U A;  2UWQ A;  1NI2 A;  2KNB A;  2KOX A;  3QHT A;  4NPN A;  5FR6 A;  2KXJ A;  2LRW A;  4CYE A;  2N7D A;  5IAA C;  4BOZ B;  2KWV B;  3RCZ A;  2BKR B;  4K7W A;  2MBO A;  2KTR A;  2L05 A;  4AP4 C;  2K6D B;  3Q3J A;  2C7N B;  2DZI A;  1ZW7 A;  3HM6 X;  2FUH B;  1WMH B;  4HJK A;  4DHJ D;  2FCM A;  5JH5 C;  1BT0 A;  4GDK A;  1E7V A;  5DPT A;  4NY0 A;  1LFD A;  4IUM B;  4TUU A;  4BBN F;  2DZM A;  2KFK B;  3H6N A;  3ECI A;  4GXB A;  2KLC A;  5HKH A;  1X1M A;  4MGY E;  2JZ3 B;  2PEA A;  4HDQ A;  4F7Z A;  2GBM A;  1WGY A;  3WAO A;  4EKU A;  3VFK A;  4HK2 A;  4M8M A;  4NAW A;  4DDG D;  4B95 A;  2DAF A;  4FJY A;  2K6Q A;  1VD2 A;  3EFU A;  4DDI D;  3DCG A;  2KFJ A;  2HE7 A;  3TMP B;  1J0G A;  3SHQ A;  3ZIM A;  2KZR A;  3OJ3 A;  2KDE B;  2W9N A;  4FHK A;  4KZC A;  1LQB A;  2Y5B B;  3A9J B;  2NS5 A;  3R66 C;  1E5W A;  4WWP A;  3JSV A;  3I3T B;  4KZ0 A;  1RFA A;  3C0R B;  4PYZ A;  3A4S C;  1KJT A;  2IYD B;  3UQA A;  1C1Y B;  3S2A A;  1L7Y A;  3H1U A;  5DPR A;  1P9D U;  1FXT B;  2MSE D;  4JIO U;  2FID A;  2JVC A;  2N9E B;  3QK0 A;  2O2V A;  3PRP B;  4M8N A;  2KDF B;  3KYD D;  4AUQ C;  3VXW A;  2C5L C;  3A9K B;  4EEW A;  2AEH A;  4WAA A;  1WXA A;  1WY8 A;  3PRE A;  1VCB A;  2CHZ A;  2MX2 A;  3WAM A;  4AWJ A;  4NJ7 A;  5BO4 B;  5JZE B;  2DEN B;  1WJ4 A;  2G4D B;  4TKN A;  3OLM D;  3MHS D;  3CF6 E;  2DYO A;  2C60 A;  3NS8 A;  4JLC A;  3ZDM C;  4PS8 A;  4XZ4 A;  2KJR A;  1YQB A;  1WGH A;  3UF8 A;  1EF5 A;  2RSU A;  1WX8 A;  2M0X A;  4URK A;  3H7P B;  3UIN B;  4KIK A;  1WM2 A;  3QCA A;  4MSM B;  2ZVN A;  2BWE S;  2Z0D B;  4DXA B;  2CKH B;  1U4A A;  2L7R A;  1TTN A;  2JRH A;  2JF5 A;  3ONS A;  1E8Y A;  4FJV B;  4AJW A;  5J17 A;  4LCD E;  1UD7 A;  3QWZ B;  3EEC A;  1WR1 A;  3AXC A;  3K9O B;  4W9H A;  2DYB A;  1WFY A;  2KHW B;  4I6P A;  3QA8 A;  1T0Y A;  2CHW A;  3AU4 A;  4P7I A;  1OEY A;  1WGD A;  3TIX A;  2LRU A;  3PS6 A;  4HPL B;  5CTR C;  2YVC A;  3VHT C;  3APD A;  2BWF A;  3L08 A;  4TQ0 A;  4IM2 A;  1LM8 B;  1WX7 A;  2XEW A;  1YJ1 A;  1IPG A;  4HLE A;  4MH0 E;  1UBI A;  2R2Q A;  4NNJ B;  5CX3 A;  2PPH A;  4BKT A;  1XT9 B;  2JY6 A;  1WRD B;  2C9W B;  2NBW B;  5JHB A;  1YD8 U;  3DBH I;  2KQS A;  5D7G A;  4TQ1 A;  5E6P A;  2N1W A;  5TR5 A;  3T9L A;  5E6O A;  1H8C A;  4B6W A;  1WI0 A;  2LGD A;  3R7Q A;  2N9P C;  4PYU A;  2MBQ A;  3U8Z A;  3ZUN A;  2BYV E;  1V2Y A;  4KVG B;  4TV3 A;  2RPQ A;  2O6V A;  3X23 A;  3ZW3 A;  3OJ4 B;  3DOW A;  3KYC D;  1WGG A;  3WA0 A;  2C7H A;  3DVG X;  2MP2 A;  1WMH A;  4BKS A;  2HD5 B;  4ANX A;  3QIJ A;  1S1Q B;  4HCN B;  4A3P A;  1P98 A;  2O6V D;  4XX5 A;  4W9D A;  4WJP A;  3VAW A;  4M0W B;  1WIA A;  2GMI C;  2MA9 B;  2KFK A;  1CMX B;  3ZNH B;  4BKS D;  3KUD B;  1D3Z A;  3ZRF A;  4HCP B;  2N9X A;  1P3Q U;  2GBK A;  2BPS A;  3Q3F A;  1H4R A;  2KD0 A;  2KLG A;  1V9J A;  1WYW B;  2MBE A;  2MQJ A;  5LXH A;  5J2R A;  3A1Q A;  2WX1 A;  2M17 A;  4MSQ B;  4MGZ E;  2IO2 B;  2KVR A;  4LDT B;  1WF9 A;  1GNU A;  2GBN A;  4BFR A;  1YIW A;  3IBE A;  5D94 A;  4HPM B;  1P1A A;  3GZN I;  2IO3 B;  4ANU A;  4ZRI A;  3VUW A;  4CHK A;  2NR2 A;  4WWN A;  2Z59 B;  3DQV A;  1WJ6 A;  2GBR A;  3IHP C;  4G50 A;  3DBS A;  4MJS A;  3NZU A;  2FCN A;  1V5T A;  1WXS A;  3L10 B;  2BYF A;  2XK5 B;  1KLV A;  2LGX A;  2DYM A;  2IO1 B;  3ZNI D;  2LVQ A;  3RZW C;  2ZZP B;  1P0R A;  1GC7 A;  2L8J A;  3DDC B;  3RYT A;  5G55 A;  3L16 A;  4MGK E;  4EZL A;  1TBE A;  2RR9 A;  2WX0 A;  4LJP B;  1YX6 B;  3L54 A;  4OVV A;  1EUV B;  2AL6 A;  4IM0 A;  4RM9 A;  4CO7 A;  2LVO A;  1ISN A;  2G4S A;  2D11 A;  3M95 A;  3TL5 A;  5CHW A;  3JYU A;  5E6N A;  2KN5 A;  2FCQ A;  1G6J A;  3W1S A;  2CS4 A;  2K39 A;  4WQO B;  3IFW B;  4FN2 A;  1IP9 A;  3LJ3 A;  1NDD A;  1EO6 A;  2LI5 A;  3AUL A;  2HJ8 A;  2L3Z A;  4IW0 A;  4FJZ A;  1HE8 A;  2DZJ A;  3VDZ A;  4W9C A;  1V86 A;  4B9K A;  4DHZ E;  2MBH A;  4GGQ A;  4DHJ B;  3B1L X;  4FBJ B;  4ICU A;  4I6L B;  3VVW B;  2D2Q A;  2R2O A;  3V6E B;  1F9J A;  3IVF A;  3RD2 A;  2MBB B;  4GDL A;  3PLU A;  1WZ0 A;  3ZDT A;  4HDO A;  3SDL C;  2J0M A;  2MLB A;  3L17 A;  4WJQ A;  4DK5 A;  3MJW A;  3UIO B;  4FUL A;  4MDK E;  3VH3 B;  2M1M A;  1UEL A;  1E7U A;  1Q5W B;  1Q0W B;  2MRP A;  3APF A;  3PT2 B;  2J0K A;  4AJY B;  2XBB C;  5DPW A;  1A5R A;  2DHZ A;  2ZJD A;  1IYF A;  3ZRC A;  1S3S G;  3DVN U;  5JHA A;  2B3A A;  4MEL A;  3VQI A;  2LD9 A;  4IC7 B;  5G2N A;  4ZDV A;  3NOB A;  4W9F A;  2KDI A;  2NBU A;  3VH4 B;  2KJ6 A;  2V3S A;  3DVN V;  5L95 C;  3HM3 A;  2WYQ A;  1OGW A;  3QC8 B;  1GJZ A;  4J6I A;  1KOT A;  3RUL A;  4GN1 A;  3EHV A;  2HTH A;  1OQY A;  3PHW B;  4JQW C;  4AOF A;  4YL8 A;  1TZ1 A;  3HHM A;  4EFO A;  5DPS A;  2CHX A;  2ASQ A;  3JSV B;  1J8C A;  1LXD A;  1E8Z A;  3L13 A;  3R3M A;  5KHO A;  4KSK C;  2LAS A;  3V62 A;  3KVF B;  4DBG A;  1NBF C;  3RT3 B;  2EMS A;  3DPD A;  3PVL A;  4W9I A;  3HK0 A;  4WWO A;  3WIM A;  2KX0 A;  2QHO A;  2UYZ B;  2O2V B;  2KC1 A;  2JZZ A;  4PS3 A;  2M4N A;  4JL9 A;  3ALB A;  3U7D A;  4GU2 A;  2ZPY A;  3M3J A;  4KDL B;  4ZRK A;  2ZEQ A;  5EDS A;  3NHE B;  3ZKJ C;  2JPH A;  4EUT A;  1WXV A;  4F8C B;  3ZLZ A;  1RAX A;  3K9P B;  3N32 A;  4A20 A;  4DWF A;  2J0J A;  1WX9 A;  2GOW A;  3QAR A;  3L0W B;  3QX1 A;  3QAQ A;  4FLH A;  2DX5 B;  2IY1 B;  3D32 A;  1Z2M A;  2KWC A;  1WR6 E;  2NCN A;  4GIV A;  3R7R A;  4KIK B;  3SU8 X;  3WAL A;  2L0T A;  2RGF A;  3AI5 A;  3M63 B;  3PV1 A;  4W9K A;  4II2 B;  3VUY A;  4HWI B;  1C3T A;  3JW0 X;  2K1F A;  2IZV B;  1Q1O A;  3CSF A;  3ENE A;  2KJH B;  4K1R B;  3PGE A;  4ZRJ A;  4FAD A;  4MEM A;  5AZH A;  4ANW A;  2AWT A;  1SE9 A;  4W9E A;  1Z5S B;  4EZJ A;  3U30 A;  4BKG A;  2MW5 A;  3M62 B;  3ZTC A;  1WM3 A;  2ZCC A;  3B0A A;  3BY4 B;  1WH3 A;  3QQ8 B;  4FA6 A;  5LXI B;  4DHZ B;  4IG7 B;  3PRM B;  2IBI B;  2BKF A;  3KUZ A;  2IO0 B;  1UZX B;  5GMV A;  3KUC B;  4IWQ A;  4KDI C;  1AAR A;  2CU1 A;  2WWZ A;  4K7S A;  2KAN A;  3UIP B;  3WAP A;  2ZVO A;  3KH0 A;  2K8C A;  3ZNZ B;  4BOS C;  2NPT B;  2LUE A;  2N4F A;  3A9J A;  1V80 A;  3IG3 A;  2G45 B;  2LJ5 A;  5L83 A;  1K8R B;  1R4N I;  1L2N A;  3O65 B;  2M8S A;  4OVU A;  1WE6 A;  4G0N B;  2VRR B;  3APC A;  2NVU I;  2REX A;  4HXD A;  4X57 B;  2K8B A;  4F1S A;  1WZ3 A;  2D10 A;  3N30 A;  5CHF A;  3N3K B;  2O6V B;  3HIZ A;  4FHJ A;  1SGH A;  2A4Z A;  3A9K A;  4LJO B;  2FAZ A;  1J19 A;  1V6E A;  2FIF A;  2AL3 A;  2ZCB A;  4BBN C;  5KHQ A;  4II3 B;  4HVB A;  2MP2 B;  2PJH A;  4ANV A;  2Z0E B;  4GSW A;  4XC2 A;  4KSL C;  4RMA A;  1RLF A;  2D3G A;  3PHX B;  3TBL D;  3VTU A;  2KMA A;  3LDZ E;  2BYE A;  4E71 A;  4IM3 A;  2ZNV C;  3QJZ A;  4NQK E;  4NQL B;  2KX3 A;  4EZK A;  1UGM A;  1EF1 A;  3H7P A;  1XQQ A;  2FNJ B;  3UGB B;  4W9G A;  2KTR B;  5AZF A;  3A1Q B;  3PLV A;  1R4M I;  1GC6 A;  3W1S C;  2WDT B;  4G3X B;  2KO3 A;  3A4R A;  1YX5 B;  4WJO A;  1SIF A;  1RRB A;  1GUA B;  4GB9 A;  2FCS A;  5J18 A;  4GDK B;  3X0W A;  2ZPN A;  2LGY A;  3W1Y A;  3H7S A;  3ZVV A;  2KTF A;  3VUX A;  2JRI B;  3WAN A;  4MJS B;  4PS7 A;  3KW5 B;  2KWU B;  5D2M B;  2KQ7 A;  3H9D A;  2D07 B;  3VTW A;  5D6J B;  2K25 A;  3SD5 A;  3CMM B;  4RM8 A;  3V6C B;  1UH6 A;  5AEK B;  4NAW B;  2OJR A;  4ASW C;  2I1K A;  5CHV C;  2ZNV B;  4N9F 4;  1E90 A;  2MWS B;  2GBJ A;  3GOE A;  2EKE C;  3DBL I;  1M94 A;  1WXM A;  2BGF A;  1E8X A;  4IWP A;  4A3O A;  4WJN A;  2PE9 A;  1I35 A;  2PE6 B;  4GOC A;  3T8M A;  4GMV A;  1WJN A;  4W9J A;  3ZO5 B;  2MCN B;  1KM7 A;  1V5O A;  2N1V A;  3B08 A;  4ZYN A;  3ZNG C;  3P2B A;  5AZG A;  3RUI B;  2KKC A;  3PPA A;  2G3Q B;  3A33 B;  2KK8 A;  3EC8 A;  4JGH B;  2L00 B;  1E8W A;  4ICV A;  4GDL B;  5LLI A;  3TCA A;  1ZKH A;  1ZGU B;  1V49 A;  2DAJ A;  1QZE A;  2RD0 A;  2BF8 B;  3V60 A;  1I42 A;  1MG8 A;  3PZD A;  2LXC A;  1V81 A;  3DVG Y;  4EOY A;  2KDB A;  2IY0 B;  5DCN A;  2NBV B;  1WE7 A;  3CST A;  3UQB A;  3ML8 A;  5IA7 A;  4I6N B;  3ML9 A; 
#chains in the Genus database with same CATH topology
 2J7Q B;  4K81 A;  1FM0 D;  2JWZ A;  1C78 A;  1UBQ A;  4IOI E;  1D5Z C;  4KV2 A;  4RGO S;  3TJP A;  1GG3 A;  4MGI E;  1PQS A;  2C7M B;  4WUR A;  3HRD D;  1Y8R C;  4NJ6 A;  2CJO A;  5T8I A;  2LVP A;  3KWL A;  2ICI A;  2V4L A;  1Q10 A;  5BMG A;  1QOG A;  4G11 A;  2KC2 A;  3JVZ X;  3MC8 A;  4RGM A;  3MTN B;  4MM3 A;  4K7U A;  5IN7 A;  4DXF A;  2LRW A;  2L83 A;  5IAA C;  4BOZ B;  4ZHO A;  1E0Z A;  2BKR B;  2WHI A;  5HG2 A;  2LGI A;  2L05 A;  4AP4 C;  1L4D B;  2WLB A;  2C7N B;  2PW9 A;  2FUH B;  1SXT A;  2FCM A;  5JH5 C;  2WQY B;  4GDK A;  1SJE D;  2JX5 A;  1LFD A;  4BBN F;  4WQM A;  3ECI A;  1EU4 A;  4MGY E;  1EU3 A;  4HDQ A;  3RNG C;  3WAO A;  1JWA D;  4M8M A;  4B95 A;  2DAF A;  3BWU D;  4DXG A;  1C79 A;  4L1B A;  2Z8L A;  1T5X D;  2KDE B;  4KZC A;  1LQB A;  3R66 C;  2IYD B;  2ONQ A;  2BS4 B;  3H1U A;  5DPR A;  2JVC A;  1WXA A;  1WY8 A;  3NVY A;  4REZ A;  4NJ7 A;  5JZE B;  2IGH A;  1XLQ A;  4TKN A;  3IT4 B;  3OLM D;  3MHS D;  2D5G A;  3NS8 A;  4JLC A;  3ZDM C;  3RNA C;  3AE6 B;  1EF5 A;  4PK1 A;  3H7P B;  1MHX A;  3C19 A;  4MSM B;  1JRO A;  4FJV B;  1WXQ A;  4LCD E;  2W3R A;  3CWI A;  3Q8E A;  1C76 A;  3ZGZ A;  2DYB A;  2RDH A;  2AQ3 B;  3N1Y C;  1OEY A;  3Q8C A;  4HPL B;  5CTR C;  2JYT A;  2LHE A;  3MC9 A;  1YQ4 B;  2WXL A;  3L08 A;  1DOX A;  1V97 A;  1YQ3 B;  4YTP B;  1TS2 A;  1K52 A;  4BKT A;  2JY6 A;  2FBW B;  1NVI D;  3DBH I;  4TQ1 A;  5E6P A;  3T9L A;  4B6W A;  1HTO A;  2LGD A;  2QIE B;  2N9P C;  4OW0 A;  4XE0 A;  3R7Q A;  2DWQ A;  5E6J A;  3AE8 B;  3PZ8 A;  4TV3 A;  1QOB A;  1N6Z A;  5BMH A;  5IKC M;  1WGG A;  3WA0 A;  3DVG X;  1WMH A;  2HD5 B;  1VRA B;  4TMA B;  4XX5 A;  4YWG G;  1SJH D;  2KFK A;  3ZNH B;  1BXT A;  2MHJ A;  3KUD B;  3RNB C;  1D3Z A;  4HCP B;  1P3Q U;  1JWS D;  2KD0 A;  2KLG A;  3AEE B;  1WF9 A;  1E7P B;  4MAC A;  2IO3 B;  4ZRI A;  2NR2 A;  4WWN A;  1OFF A;  5HFY A;  2PLP A;  1V5T A;  3RN9 C;  2BYF A;  2XK5 B;  3FC4 A;  3BK2 A;  2LVQ A;  1L0Y B;  1AYF A;  1P0R A;  3DDC B;  3L16 A;  2WX0 A;  4LJP B;  4OVV A;  2AL6 A;  2LVO A;  3M95 A;  3TL5 A;  5CHW A;  2FCQ A;  2E3T A;  1G6J A;  4WQO B;  1FRD A;  3IFW B;  1XO3 A;  2BB6 A;  1NDD A;  3DHI C;  2TSS A;  1HE8 A;  3VDZ A;  2IGD A;  3TEX A;  2MBH A;  4ICU A;  2R2O A;  3V6E B;  3L4P A;  3RD2 A;  3IVF A;  2MBB B;  3PLU A;  3ZDT A;  2IGG A;  3SDL C;  1NYQ A;  2X8X X;  2MLB A;  1PGX A;  2AQ2 B;  4WJQ A;  1TKG A;  3TEZ A;  3MJW A;  3ETR A;  2M1M A;  3APF A;  2J0K A;  4AJY B;  1IYF A;  2ZJD A;  3ZRC A;  3AEG B;  1IUE A;  2LD9 A;  4C7Y A;  4ZDV A;  5FKA C;  2KJ6 A;  2V3S A;  2BS3 B;  4JQW C;  2QC8 A;  4YL8 A;  1TZ1 A;  5DPS A;  2CHX A;  3AN1 A;  1C4P A;  2ASQ A;  2NTS A;  1YN5 A;  3L13 A;  3R3M A;  4KSK C;  4R3D A;  1NBF C;  3WIM A;  2QHO A;  2UYZ B;  2JZZ A;  4PS3 A;  3PZ7 A;  5EDS A;  3M3J A;  4ACF A;  1WWT A;  2KVZ A;  2QCZ A;  5H8Y E;  1PDX A;  3ZLZ A;  1RAX A;  2WP9 B;  3QAQ A;  3OG5 A;  3DWM A;  4FLH A;  3RNC C;  5IOI A;  2IY1 B;  3D32 A;  2KWC A;  2NCN A;  1XLO A;  2KWD A;  2RGF A;  5BMI A;  4LNI A;  4HWI B;  3GP7 A;  1C3T A;  2KAC A;  3Q8F A;  3PGE A;  4ZRJ A;  1C4A A;  4O1N A;  3B9J A;  1Y56 A;  4EZJ A;  1ZDV A;  3M62 B;  2ZCC A;  3B0A A;  1VDV A;  3QQ8 B;  1I4Q A;  4DHZ B;  1XEE A;  3EUB 2;  2IO0 B;  2W3S A;  4IWQ A;  4N6E B;  2CU1 A;  4K7S A;  3UIP B;  2ZVO A;  3KH0 A;  4BOS C;  2LUE A;  1TKE A;  1KLG D;  1R4N I;  1L2N A;  3U7Z A;  2REX A;  3AE4 B;  4HXD A;  3U2S C;  1I4H A;  2V9H A;  3E56 A;  5CHF A;  4FHJ A;  1ZE3 D;  2A4Z A;  3N20 C;  3Q3N C;  2FAZ A;  3VR9 B;  2PJH A;  1AWD A;  2D3G A;  3VTU A;  2KMA A;  4E71 A;  4RCO A;  1F77 A;  1EF1 A;  3H7P A;  1XQQ A;  3BK1 A;  3PLV A;  1GC6 A;  1F0Z A;  2WDT B;  1YX5 B;  5J18 A;  4GDK B;  3X0W A;  3ZVV A;  5H92 C;  2JRI B;  4XDD A;  3H9D A;  3VTW A;  1UH6 A;  2J42 A;  2I1K A;  2ZNV B;  1QQR A;  2H88 B;  4ZOH C;  2EKE C;  3DBL I;  4A3O A;  1E8X A;  2PE9 A;  4S17 A;  3T8M A;  1UNS A;  3I5J C;  4OZC A;  2VZK D;  4JE3 B;  1E6E B;  2KKC A;  4YXD B;  4JGH B;  4ICV A;  3TCA A;  2BQQ A;  3RFZ B;  3V60 A;  1TT5 B;  2W55 A;  2LXC A;  1V81 A;  2IY0 B;  2NBV B;  1WE7 A;  2BVC A;  3UQB A;  3ML8 A;  1VLB A;  4I6N B;  4AJW A;  2G9H D;  2EMT A;  4NAM A;  1TIF A;  3O13 A;  3DWG C;  2NPT A;  1SE2 A;  4JPS A;  3BIN A;  4LDT D;  4GLS C;  2N7E A;  3RZF A;  3VTV A;  4E74 A;  3PTF C;  1TGZ B;  2XK5 A;  2WXN A;  1HTQ A;  2V1Y A;  2A5U A;  2JXX A;  2OOB B;  1WJU A;  1OEY J;  1NI2 A;  2KNB A;  2KOX A;  3QHT A;  5FR6 A;  4XWT A;  2KXJ A;  1SBB B;  2N7D A;  2BT6 A;  2KWV B;  5C2T B;  3Q8A A;  4QAY A;  1I4R A;  1I4G A;  1ZW7 A;  5EE3 A;  4N58 A;  2INN E;  1WMH B;  4DHJ D;  1BT0 A;  5DPT A;  4P16 A;  4IUM B;  2DZM A;  2KFK B;  1UF0 A;  1C77 A;  4GXB A;  2KLC A;  2D3A A;  5HKH A;  1FRR A;  1PGA A;  1YMH E;  1WGY A;  4EKU A;  4HRS A;  4FJY A;  1ESF A;  1KLU D;  2K6Q A;  4DDI D;  4CQN A;  1BML C;  3TMP B;  3SHQ A;  3ZIM A;  3N1X C;  2KZR A;  4WIP A;  3OJ3 A;  2W9N A;  2Y5B B;  2IND C;  3I3T B;  4PYZ A;  2SAK A;  3A4S C;  1KJT A;  3UQA A;  3S2A A;  1FNV A;  4B0M A;  2N9E B;  1DYQ A;  4B0E A;  2KDF B;  2AEH A;  1PGB A;  3PRE A;  4AWJ A;  1ZPS A;  5GXG B;  2PTL A;  2G4D B;  2C60 A;  2KJR A;  1YQB A;  2RSU A;  1WX8 A;  2M0X A;  3QCA A;  1HEZ E;  1ZOY B;  2Z0D B;  1OQR A;  2CKH B;  2L7R A;  1V1O A;  2X38 A;  2JF5 A;  4L23 A;  4US8 A;  1F1H A;  2JU6 X;  2HDE A;  2MJE A;  1WR1 A;  4N59 A;  3ZXV A;  4KKJ A;  2DBY A;  1WFY A;  1QOA A;  1NYR A;  1IGD A;  1YNT E;  1N5X A;  1LM8 B;  2L52 A;  2XEW A;  4NNJ B;  2L32 A;  2QSD A;  2PPH A;  1XXG A;  2VZK B;  2NBW B;  2WXP A;  1I4P A;  1YD8 U;  3B2F A;  2KQS A;  3URY A;  5E6O A;  3GE3 C;  2Y5P A;  2BYV E;  1V2Y A;  4KVG B;  2IJ0 A;  2BB5 A;  3X23 A;  2G1E A;  4RH6 A;  3KYC D;  1XCT L;  3I63 C;  1P98 A;  2O6V D;  4W9D A;  4WJP A;  4M0W B;  1QKZ A;  2MA9 B;  4BKS D;  2W82 A;  4M01 A;  1HA5 A;  3Q3F A;  1V9J A;  2MQJ A;  4FXC A;  3C8Y A;  2M17 A;  3Q3M C;  1FXA A;  4LDT B;  1GNU A;  4BFR A;  4HPM B;  3GZN I;  2Z59 B;  2NTT A;  3DBS A;  1N62 A;  3NZU A;  1WXS A;  4WAF A;  1KLV A;  1MJD A;  1V8C A;  3SR6 A;  2RR9 A;  3L54 A;  4LNN A;  4IM0 A;  4RM9 A;  1SB3 C;  1KF6 B;  2D11 A;  3AE3 B;  4ZYS A;  3W1S A;  2CS4 A;  2K39 A;  3NG0 A;  3U4E G;  1PFD A;  3NVZ A;  1EO6 A;  3AUL A;  4IW0 A;  4FJZ A;  4A6Q A;  2ACZ B;  1V86 A;  4DHZ E;  4DHJ B;  3V05 A;  2W54 A;  1MG4 A;  5D3I B;  2AQ1 B;  2RPV A;  1EM7 A;  4RF0 A;  1ZDX A;  4MDK E;  1QF6 A;  1E7U A;  1UEL A;  2MRP A;  2EKI A;  4RFB A;  2XBB C;  4HRO A;  2DHZ A;  1S3S G;  1YJJ A;  3CIR B;  3DVN U;  3J9C A;  3VQI A;  1VZ8 A;  1B1Z A;  2NBU A;  3VH4 B;  1JAL A;  3DVN V;  1B9R A;  5L95 C;  3HM3 A;  4J6I A;  1KOT A;  3RUL A;  3EHV A;  3PHW B;  1OQY A;  1JCK B;  3HHM A;  4EFO A;  5LNK 1;  1VR9 A;  1J8C A;  1LXD A;  2GI9 A;  3V62 A;  2CJN A;  3HK0 A;  4WWO A;  2KX0 A;  2O2V B;  2IPK D;  3SFD B;  2Q5W D;  3ALB A;  4ZRK A;  3KWV A;  2B76 B;  4BAX A;  2J0J A;  2GOW A;  3L0W B;  5D3D A;  2WDV B;  3W5V B;  3NRZ A;  1RFK A;  2V3N A;  3R7R A;  4GIV A;  1FPY A;  3AEB B;  1FO4 A;  2LJI A;  2WXG A;  4LNF A;  1FXI A;  2J4X A;  2K1F A;  2GLS A;  4MEM A;  5AZH A;  2AWT A;  3I9V 1;  4LK0 M;  1TS5 A;  1UWM A;  2MW5 A;  3ZTC A;  3BY4 B;  1UUP A;  4FA6 A;  5LXI B;  1MVK A;  4IG7 B;  3PRM B;  2BYT A;  3KUZ A;  1MFW A;  1AW7 A;  2KN4 A;  3AED B;  3KUC B;  4KDI C;  1AAR A;  4K3B A;  2KAN A;  3WAP A;  3ZNZ B;  2ZW1 A;  2NPT B;  3IG3 A;  2D3C A;  2G45 B;  2LJ5 A;  4ARI A;  2E6X A;  1TS3 A;  3O65 B;  2M8S A;  3P42 A;  1C4C A;  1JRP A;  4C56 C;  2O6V B;  1J19 A;  2ZCB A;  4II3 B;  1DGJ A;  1FNW A;  2MP2 B;  4BZA A;  2Z0E B;  1SIJ A;  1V1P B;  2XN9 C;  3T3N A;  1DOY A;  4RMA A;  3LDZ E;  2ZNV C;  4NQK E;  5IP4 D;  4NQL B;  3BYT B;  5AZF A;  3A1Q B;  3W1S C;  2GB1 A;  3A4R A;  1SIF A;  2FCS A;  1WRI A;  2RDG A;  1ZXI A;  3H7S A;  1JQ4 A;  2KTF A;  3VUX A;  4ITK A;  4MJS B;  5D2M B;  2DLB A;  5MPO A;  2K25 A;  3SD5 A;  5AEK B;  4ASW C;  1GB4 A;  5CHV C;  4N9F 4;  2YEP B;  1TS4 A;  2GBJ A;  1EWC A;  3NVV A;  5BYQ A;  5AUK A;  1WXM A;  1ROE A;  2BGF A;  1NI3 A;  4WJN A;  4ZRP A;  4P1C C;  1L5P A;  4GMV A;  4K3C A;  2QJL A;  3B08 A;  4ZYN A;  3AB5 A;  3RUI B;  2G3Q B;  5LLI A;  1ZGU B;  1TJE A;  1HZ5 A;  2DAJ A;  4M0W A;  1YOV B;  2RD0 A;  4RGT A;  1WGK A;  2SEB D;  3DVG Y;  2PVG C;  1L6U A;  4A90 A;  3CST A;  3AU5 A;  1WGR A;  3DHG C;  2YLM A;  2L76 A;  3GS2 A;  3NJT A;  3W9C B;  3MFG A;  3V61 A;  2LWP A;  5C23 A;  4BVU C;  3OAW A;  2JUO A;  1OTR B;  3NY5 A;  1IBX B;  1WYG A;  3ZTD A;  5C1Z A;  2WXJ A;  2WXO A;  3NZS A;  3AE5 B;  1XD3 B;  3P4Q B;  3HVD A;  1TY0 A;  3DBR B;  4KKI A;  3IXS A;  1STE A;  2K5P A;  1SEB D;  3NS1 A;  4UDU C;  1A70 A;  3ZQ4 A;  4CYE A;  5EE9 A;  1XF5 L;  3RCZ A;  4K7W A;  2KTR A;  3W5U B;  1JWM D;  3Q3J A;  2DZI A;  4HJK A;  1YN4 A;  3E9S A;  1HQR D;  1E7V A;  3H6N A;  1HXY D;  1VZ7 A;  4DQO C;  3FIL A;  1X1M A;  2PEA A;  2GBM A;  3VFK A;  4HK2 A;  4DDG D;  1VD2 A;  1J0G A;  2HE7 A;  3P63 A;  3AE1 B;  3U52 E;  2PIA A;  4YTN B;  1L4Z B;  3SFE B;  3A9J B;  1N5W A;  1E5W A;  4WWP A;  4KZ0 A;  3C0R B;  1C1Y B;  4M00 A;  1P9D U;  1FXT B;  4YTM B;  2MSE D;  3R2T A;  1NEK B;  1GPX A;  2O2V A;  3PRP B;  3KYD D;  3H8H A;  2C5L C;  3A9K B;  4WAA A;  3WAM A;  2CHZ A;  2MX2 A;  2DEN B;  1WJ4 A;  2FUG 1;  3CF6 E;  3OWE B;  3V3X A;  2WXI A;  3ABV B;  4URK A;  3UIN B;  1WM2 A;  2BWE S;  4DXA B;  1U4A A;  1GOZ A;  2PKO A;  3ZJT A;  2JRH A;  4H2A A;  1IGC A;  3UI3 A;  1JML A;  3EEC A;  3EA6 A;  4JWU C;  2HJ1 A;  5BYR A;  2KHW B;  4I6P A;  1T0Y A;  2CHW A;  4P6V F;  3AU4 A;  1WGD A;  3TIX A;  4HKQ A;  3PS6 A;  3VHT C;  3APD A;  4IDI A;  2V3P A;  1XLN A;  1WX7 A;  3RI7 C;  1IPG A;  4HLE A;  1UBI A;  2R2Q A;  1SSN A;  3Q6B A;  2VH2 A;  1KH0 A;  3B2G A;  1WRD B;  5JHB A;  1LGR A;  2N1W A;  1H8C A;  1WI0 A;  1N60 A;  2MBQ A;  1T0S C;  3KLS X;  2O6V A;  3ZW3 A;  3OJ4 B;  2C7H A;  2MP2 A;  4BKS A;  3QIJ A;  1S1Q B;  4HCN B;  4A3P A;  1V1P A;  2WU2 B;  3VAW A;  1WIA A;  1GB1 A;  2LUM A;  1TY2 A;  1CMX B;  1CZP A;  1K51 A;  2N9X A;  2GBK A;  2BPS A;  1VZ6 A;  2MBE A;  5J2R A;  3A1Q A;  1TYG B;  3VR8 B;  2KVR A;  1J7B A;  4TSS A;  1FD6 A;  2GBN A;  3MHZ A;  1YIW A;  5D94 A;  2QDF A;  3LYY A;  3VUW A;  4CHK A;  3DQV A;  4US9 A;  3Q2A C;  3GE8 C;  4MJS A;  2FCN A;  2LGX A;  4RNA A;  2L8J A;  1GC7 A;  1R7S A;  1YX6 B;  1MI0 A;  1EUV B;  2NMQ A;  2WGS A;  4CO7 A;  2KQ4 X;  1ISN A;  1JW9 D;  3JYU A;  2KN5 A;  2M0A A;  3LJ3 A;  2LI5 A;  2HJ8 A;  2L3Z A;  2LFI A;  4W9C A;  4B9K A;  3B1L X;  4FBJ B;  2D2Q A;  1F9J A;  1WSP A;  3WCQ A;  2J0M A;  4P1B C;  1D6E C;  1OQQ A;  3P4S B;  4FUL A;  3VH3 B;  1Q0W B;  3PT2 B;  5DPW A;  3AEA B;  2JZP A;  5G2N A;  2HTM E;  2JSV X;  3NOB A;  2KDI A;  4L2Y A;  1OGW A;  3QC8 B;  1GJZ A;  3NVW A;  4GN1 A;  2RMM A;  3N9Y C;  1IBX A;  3JSV B;  1E8Z A;  4DBG A;  2EMS A;  3DPD A;  1I7H A;  2KC1 A;  2M4N A;  4JL9 A;  4JX1 C;  4KDL B;  2QMT A;  2ZEQ A;  3Q69 A;  4EUT A;  1FMA D;  1WXV A;  3GB1 A;  2MJ3 A;  3T3O A;  3K9P B;  1QT9 A;  1P7E A;  4DWF A;  3QAR A;  2BS2 B;  1ET6 A;  2K0P A;  1N63 A;  2CU3 A;  4KIK B;  3SU8 X;  3BZD B;  3I57 A;  3VUY A;  4II2 B;  3ZXR A;  1QLB B;  2IZV B;  3TUO A;  1Q1O A;  3ENE A;  2KT7 A;  4FAD A;  1DOI A;  1RM6 C;  3RNF C;  4W9E A;  1Z5S B;  3TSS A;  3IAS 1;  2LEK A;  2INC C;  2K9X A;  4WWM A;  2BKF A;  1FFV A;  2WWZ A;  3A9J A;  1TKY A;  1K8R B;  4LNO A;  3MJ5 A;  3APC A;  1MHH E;  4RF1 A;  2JYE A;  2PVO D;  3HIZ A;  3LXF A;  1SGH A;  3A9K A;  4LJO B;  1V6E A;  2FIF A;  3R8B A;  4ANV A;  4GSW A;  4XC2 A;  2M19 A;  4KSL C;  1HZ6 A;  2J53 A;  2I38 A;  4IM3 A;  1T6B X;  3QJZ A;  1RYJ A;  2FNJ B;  4W9G A;  2KTR B;  4C4V B;  5FK9 C;  4G3X B;  2KO3 A;  1F2R C;  4C00 A;  1GUA B;  3EFC A;  1R4M B;  2ZPN A;  2LGY A;  1FIQ A;  3KW5 B;  5AUI A;  4OHJ A;  3FIL B;  1L6V A;  2FE8 A;  3CMM B;  3VRA B;  4RM8 A;  3IAM 1;  4KX6 B;  2OJR A;  2K3U A;  1KTK A;  1F2R I;  2MWS B;  2VH1 A;  1M94 A;  4ZRQ A;  2JXT A;  2PE6 B;  4W9J A;  3ZO5 B;  1V5O A;  2BBC A;  2KYW A;  5TSS A;  3ZNG C;  4D2K A;  1YN3 A;  1ZXH A;  3P2B A;  2QEJ C;  5AZG A;  3A33 B;  2L1A A;  2KK8 A;  3EC8 A;  2L00 B;  4A9A A;  4GDL B;  1V49 A;  1QZE A;  2WXQ A;  1I42 A;  2JQR B;  3PZD A;  2PMV A;  5IA7 A;  3P4P B;  3ML9 A;  2DZK A;  3BYY B;  3VRB B;  2CR5 A;  3RPF C;  4W9L A;  1ET9 A;  2Y3A A;  5C3J B;  2LXA A;  2LZ6 A;  5FR3 A;  4IWO A;  4USA A;  1JRU A;  2EEL A;  2K8H A;  2MJD A;  3RNE C;  3LB8 C;  2QIL A;  3PRZ A;  2KMC A;  2WXR A;  4YSX B;  2AYO B;  4A8X C;  2JT4 B;  3DBR I;  3PSE B;  4S0R A;  4YSZ B;  1J7A A;  2I1J A;  4ARC A;  2WNM A;  1K53 A;  4OZB A;  1GAQ B;  4E3C A;  2L0F A;  4J3O D;  1L0V B;  4HPP A;  2I2Y A;  2UWQ A;  2WXM A;  4NPN A;  2KAJ A;  1PYW D;  2MBO A;  1CJE A;  1FFU A;  2K6D B;  2LMC A;  2OHF A;  5HHD G;  5G5H A;  3P4R B;  3HM6 X;  1J7C A;  5EE0 A;  3R2I A;  3HVZ A;  4NY0 A;  1T0Q C;  4TUU A;  4A55 A;  4YT0 B;  3BII D;  4AS1 A;  3AEF B;  3GZN B;  1FNU A;  1ZUD 2;  2JZ3 B;  4F7Z A;  1AN8 A;  4NAW A;  4C7Z A;  2YEP F;  3EFU A;  3DCG A;  4MH8 A;  2KFJ A;  4FHK A;  3AV8 A;  2NS5 A;  3NUH B;  4XYC A;  1UGJ A;  3JSV A;  3Q3O C;  1RFA A;  2J52 A;  3MC0 B;  4KGS A;  1L7Y A;  4JIO U;  2FID A;  4OZA A;  3TEY A;  3QK0 A;  3FKY A;  4M8N A;  4AUQ C;  3VXW A;  4EEW A;  2N7J A;  1VCB A;  5BO4 B;  1T3Q A;  1T0R C;  1CQV A;  2WDQ B;  2DYO A;  4ZHP A;  4PS8 A;  4XZ4 A;  3AE2 B;  1WGH A;  3UF8 A;  2V0G A;  1XCQ L;  4WH4 A;  1UWX A;  1QOF A;  4KIK A;  2ZVN A;  2WS3 B;  1TTN A;  3ONS A;  1E8Y A;  5J17 A;  1ACC A;  1UD7 A;  3QWZ B;  1RWS A;  3AXC A;  3K9O B;  1SE3 A;  4W9H A;  3QA8 A;  4P7I A;  2D3B A;  2LRU A;  2YVC A;  2BTE A;  2BWF A;  1N61 A;  3NZ3 A;  2XNA C;  4TQ0 A;  4IM2 A;  5G5G A;  2KDM A;  4LNK A;  1YJ1 A;  4MH0 E;  5CX3 A;  1XT9 B;  2C9W B;  5D7G A;  4KGT A;  5TR5 A;  4XGA B;  3U8Z A;  2AX5 A;  4PYU A;  2WDR B;  3ZUN A;  2JWU A;  2RPQ A;  1CK1 A;  2LHD A;  3DBH B;  3DOW A;  4HJG E;  3ZJU A;  3IT6 B;  4ANX A;  2WXH A;  2GMI C;  1D5M C;  1D5X C;  3BVZ A;  1C9F A;  3ZRF A;  1H4R A;  1WYW B;  5LXH A;  4MSQ B;  2WX1 A;  4MGZ E;  2IO2 B;  2OED A;  4C4V A;  3IBE A;  1P1A A;  4ANU A;  1WJ6 A;  2GBR A;  3IHP C;  1ENF A;  4G50 A;  2KMM A;  1KFY B;  2MEK A;  3HUI A;  3L10 B;  4Q2J A;  2DYM A;  2IO1 B;  3ZNI D;  3RZW C;  2ZZP B;  2IDY A;  3RYT A;  5G55 A;  4MGK E;  4EZL A;  1TBE A;  1E9M A;  1YJI A;  2ZW0 A;  4XDC A;  3AE7 B;  4OVZ A;  4MM3 B;  2G4S A;  5E6N A;  1ZP0 B;  1F52 A;  4FN2 A;  1IP9 A;  2DNF A;  2DZJ A;  4HEA 1;  4GGQ A;  3VVW B;  4I6L B;  2WXF A;  3AH7 A;  4GDL A;  1WZ0 A;  4HDO A;  3L17 A;  3EGR A;  4DK5 A;  3P1M A;  3UIO B;  2Y5C A;  1Q5W B;  3AE9 B;  2UU7 A;  1JWU D;  1A5R A;  1MPE A;  4NZL B;  5JHA A;  2B3A A;  4MEL A;  4IC7 B;  1PUT A;  4YSY B;  1I4X A;  5EE1 A;  4W9F A;  5HI1 A;  4XWW A;  2ON8 A;  2N9L A;  2WYQ A;  2HTH A;  4AOF A;  2OJW A;  2WXK A;  3AMZ A;  5KHO A;  2LAS A;  3KVF B;  3RMK C;  3W2D A;  3RT3 B;  3PVL A;  4W9I A;  5BYS A;  2MH7 A;  3ZYY X;  1FCL A;  3DHH C;  3U7D A;  4GU2 A;  2ZPY A;  3NHE B;  3ZKJ C;  1VJK A;  2JPH A;  3BVM A;  4F8C B;  3N32 A;  4A20 A;  1WX9 A;  1L0X B;  1SE4 A;  3QX1 A;  2RDB C;  2DX5 B;  1Z2M A;  1M4V A;  4LTU A;  4AQ7 A;  1WR6 E;  3WAL A;  2L0T A;  3TEW A;  3M63 B;  3AI5 A;  3MP9 A;  3PV1 A;  4W9K A;  3JW0 X;  4RGN A;  4K1R B;  3CSF A;  2KJH B;  4JWS C;  2K22 A;  4LLG M;  4ANW A;  1SE9 A;  3U30 A;  4BKG A;  1WM3 A;  1WH3 A;  3N1Z C;  2H89 B;  2IBI B;  1UZX B;  4KGR A;  5GMV A;  1FEH A;  4PT5 A;  2K8C A;  2N4F A;  1V80 A;  5L83 A;  1FCC C;  3KQ4 A;  4OVU A;  1WE6 A;  4G0N B;  2VRR B;  2NVU I;  3PO0 A;  4X57 B;  2K8B A;  4F1S A;  1WZ3 A;  2D10 A;  1R4N B;  3N30 A;  3N3K B;  3AM9 A;  1D4B A;  5IO9 A;  5KHQ A;  2AL3 A;  4NJC A;  4BBN C;  4HVB A;  1SF0 A;  4C80 A;  1K50 A;  4IKG A;  1RLF A;  3PHX B;  3TBL D;  2BYE A;  2KX3 A;  4EZK A;  4EE2 A;  1UGM A;  3UGB B;  2R61 A;  2V4I B;  1R4M I;  2M56 B;  1BUI C;  4WJO A;  2N0S B;  4HKZ E;  1RRB A;  4GB9 A;  1QIL A;  3ZJV A;  3W1Y A;  2LGS A;  3WAN A;  4MT5 A;  2GRI A;  4PS7 A;  2KWU B;  3BVG A;  1TZO A;  2KQ7 A;  2D07 B;  1E10 A;  5D6J B;  2WU5 B;  3V6C B;  3AEC B;  4NAW B;  5I4D A;  3SEB A;  1E90 A;  3GOE A;  4IWP A;  1KRH A;  2INP E;  1EWY C;  1I35 A;  4GOC A;  1WJN A;  1P7F A;  5JXV A;  2BW2 A;  2MCN B;  1KM7 A;  2N1V A;  3DBL B;  1NEN B;  2N9K A;  3PPA A;  3Q8B A;  1E8W A;  1ZKH A;  3FAH A;  1LO5 D;  2BF8 B;  4M02 A;  1JWB D;  3Q14 C;  1MG8 A;  1XLP A;  4EOY A;  2KDB A;  5DCN A; 
#chains in the Genus database with same CATH homology
 2DZK A;  2J7Q B;  3AU5 A;  4K81 A;  1WGR A;  2CR5 A;  2JWZ A;  2EMT A;  2YLM A;  4W9L A;  2L76 A;  2LXA A;  1UBQ A;  2LZ6 A;  4KV2 A;  4IWO A;  3V61 A;  2NPT A;  3TJP A;  2LWP A;  1GG3 A;  5C23 A;  1JRU A;  3BIN A;  4LDT D;  4BVU C;  4MGI E;  3OAW A;  2N7E A;  3RZF A;  2K8H A;  3VTV A;  1PQS A;  1OTR B;  2JUO A;  4E74 A;  3PTF C;  1TGZ B;  3NY5 A;  3PRZ A;  2KMC A;  2XK5 A;  2C7M B;  3ZTD A;  2AYO B;  5C1Z A;  2JT4 B;  3DBR I;  1Y8R C;  3PSE B;  4NJ6 A;  2LVP A;  3NZS A;  2V1Y A;  2A5U A;  2I1J A;  2JXX A;  1XD3 B;  2OOB B;  1WJU A;  2V4L A;  4G11 A;  4E3C A;  2KC2 A;  2L0F A;  3JVZ X;  3MTN B;  4MM3 A;  1OEY J;  4K7U A;  2UWQ A;  1NI2 A;  2KNB A;  2KOX A;  3QHT A;  4NPN A;  5FR6 A;  2KXJ A;  2LRW A;  4CYE A;  2N7D A;  5IAA C;  4BOZ B;  2KWV B;  3RCZ A;  2BKR B;  4K7W A;  2MBO A;  2KTR A;  2L05 A;  4AP4 C;  2K6D B;  3Q3J A;  2C7N B;  2DZI A;  1ZW7 A;  3HM6 X;  2FUH B;  1WMH B;  4HJK A;  4DHJ D;  2FCM A;  5JH5 C;  1BT0 A;  4GDK A;  1E7V A;  5DPT A;  4NY0 A;  1LFD A;  4IUM B;  4TUU A;  4BBN F;  2DZM A;  2KFK B;  3H6N A;  3ECI A;  4GXB A;  2KLC A;  5HKH A;  1X1M A;  4MGY E;  2JZ3 B;  2PEA A;  4HDQ A;  4F7Z A;  2GBM A;  1WGY A;  3WAO A;  4EKU A;  3VFK A;  4HK2 A;  4M8M A;  4NAW A;  4DDG D;  4B95 A;  2DAF A;  4FJY A;  2K6Q A;  1VD2 A;  3EFU A;  4DDI D;  3DCG A;  2KFJ A;  2HE7 A;  3TMP B;  1J0G A;  3SHQ A;  3ZIM A;  2KZR A;  3OJ3 A;  2KDE B;  2W9N A;  4FHK A;  4KZC A;  1LQB A;  2Y5B B;  3A9J B;  2NS5 A;  3R66 C;  1E5W A;  4WWP A;  3JSV A;  3I3T B;  4KZ0 A;  1RFA A;  3C0R B;  4PYZ A;  3A4S C;  1KJT A;  2IYD B;  3UQA A;  1C1Y B;  3S2A A;  1L7Y A;  3H1U A;  5DPR A;  1P9D U;  1FXT B;  2MSE D;  4JIO U;  2FID A;  2JVC A;  2N9E B;  3QK0 A;  2O2V A;  3PRP B;  4M8N A;  2KDF B;  3KYD D;  4AUQ C;  3VXW A;  2C5L C;  3A9K B;  4EEW A;  2AEH A;  4WAA A;  1WXA A;  1WY8 A;  3PRE A;  1VCB A;  2CHZ A;  2MX2 A;  3WAM A;  4AWJ A;  4NJ7 A;  5BO4 B;  5JZE B;  2DEN B;  1WJ4 A;  2G4D B;  4TKN A;  3OLM D;  3MHS D;  3CF6 E;  2DYO A;  2C60 A;  3NS8 A;  4JLC A;  3ZDM C;  4PS8 A;  4XZ4 A;  2KJR A;  1YQB A;  1WGH A;  3UF8 A;  1EF5 A;  2RSU A;  1WX8 A;  2M0X A;  4URK A;  3H7P B;  3UIN B;  4KIK A;  1WM2 A;  3QCA A;  4MSM B;  2ZVN A;  2BWE S;  2Z0D B;  4DXA B;  2CKH B;  1U4A A;  2L7R A;  1TTN A;  2JRH A;  2JF5 A;  3ONS A;  1E8Y A;  4FJV B;  4AJW A;  5J17 A;  4LCD E;  1UD7 A;  3QWZ B;  3EEC A;  1WR1 A;  3AXC A;  3K9O B;  4W9H A;  2DYB A;  1WFY A;  2KHW B;  4I6P A;  3QA8 A;  1T0Y A;  2CHW A;  3AU4 A;  4P7I A;  1OEY A;  1WGD A;  3TIX A;  2LRU A;  3PS6 A;  4HPL B;  5CTR C;  2YVC A;  3VHT C;  3APD A;  2BWF A;  3L08 A;  4TQ0 A;  4IM2 A;  1LM8 B;  1WX7 A;  2XEW A;  1YJ1 A;  1IPG A;  4HLE A;  4MH0 E;  1UBI A;  2R2Q A;  4NNJ B;  5CX3 A;  2PPH A;  4BKT A;  1XT9 B;  2JY6 A;  1WRD B;  2C9W B;  2NBW B;  5JHB A;  1YD8 U;  3DBH I;  2KQS A;  5D7G A;  4TQ1 A;  5E6P A;  2N1W A;  5TR5 A;  3T9L A;  5E6O A;  1H8C A;  4B6W A;  1WI0 A;  2LGD A;  3R7Q A;  2N9P C;  4PYU A;  2MBQ A;  3U8Z A;  3ZUN A;  2BYV E;  1V2Y A;  4KVG B;  4TV3 A;  2RPQ A;  2O6V A;  3X23 A;  3ZW3 A;  3OJ4 B;  3DOW A;  3KYC D;  1WGG A;  3WA0 A;  2C7H A;  3DVG X;  2MP2 A;  1WMH A;  4BKS A;  2HD5 B;  4ANX A;  3QIJ A;  1S1Q B;  4HCN B;  4A3P A;  1P98 A;  2O6V D;  4XX5 A;  4W9D A;  4WJP A;  3VAW A;  4M0W B;  1WIA A;  2GMI C;  2MA9 B;  2KFK A;  1CMX B;  3ZNH B;  4BKS D;  3KUD B;  1D3Z A;  3ZRF A;  4HCP B;  2N9X A;  1P3Q U;  2GBK A;  2BPS A;  3Q3F A;  1H4R A;  2KD0 A;  2KLG A;  1V9J A;  1WYW B;  2MBE A;  2MQJ A;  5LXH A;  5J2R A;  3A1Q A;  2WX1 A;  2M17 A;  4MSQ B;  4MGZ E;  2IO2 B;  2KVR A;  4LDT B;  1WF9 A;  1GNU A;  2GBN A;  4BFR A;  1YIW A;  3IBE A;  5D94 A;  4HPM B;  1P1A A;  3GZN I;  2IO3 B;  4ANU A;  4ZRI A;  3VUW A;  4CHK A;  2NR2 A;  4WWN A;  2Z59 B;  3DQV A;  1WJ6 A;  2GBR A;  3IHP C;  4G50 A;  3DBS A;  4MJS A;  3NZU A;  2FCN A;  1V5T A;  1WXS A;  3L10 B;  2BYF A;  2XK5 B;  1KLV A;  2LGX A;  2DYM A;  2IO1 B;  3ZNI D;  2LVQ A;  3RZW C;  2ZZP B;  1P0R A;  1GC7 A;  2L8J A;  3DDC B;  3RYT A;  5G55 A;  3L16 A;  4MGK E;  4EZL A;  1TBE A;  2RR9 A;  2WX0 A;  4LJP B;  1YX6 B;  3L54 A;  4OVV A;  1EUV B;  2AL6 A;  4IM0 A;  4RM9 A;  4CO7 A;  2LVO A;  1ISN A;  2G4S A;  2D11 A;  3M95 A;  3TL5 A;  5CHW A;  3JYU A;  5E6N A;  2KN5 A;  2FCQ A;  1G6J A;  3W1S A;  2CS4 A;  2K39 A;  4WQO B;  3IFW B;  4FN2 A;  1IP9 A;  3LJ3 A;  1NDD A;  1EO6 A;  2LI5 A;  3AUL A;  2HJ8 A;  2L3Z A;  4IW0 A;  4FJZ A;  1HE8 A;  2DZJ A;  3VDZ A;  4W9C A;  1V86 A;  4B9K A;  4DHZ E;  2MBH A;  4GGQ A;  4DHJ B;  3B1L X;  4FBJ B;  4ICU A;  4I6L B;  3VVW B;  2D2Q A;  2R2O A;  3V6E B;  1F9J A;  3IVF A;  3RD2 A;  2MBB B;  4GDL A;  3PLU A;  1WZ0 A;  3ZDT A;  4HDO A;  3SDL C;  2J0M A;  2MLB A;  3L17 A;  4WJQ A;  4DK5 A;  3MJW A;  3UIO B;  4FUL A;  4MDK E;  3VH3 B;  2M1M A;  1UEL A;  1E7U A;  1Q5W B;  1Q0W B;  2MRP A;  3APF A;  3PT2 B;  2J0K A;  4AJY B;  2XBB C;  5DPW A;  1A5R A;  2DHZ A;  2ZJD A;  1IYF A;  3ZRC A;  1S3S G;  3DVN U;  5JHA A;  2B3A A;  4MEL A;  3VQI A;  2LD9 A;  4IC7 B;  5G2N A;  4ZDV A;  3NOB A;  4W9F A;  2KDI A;  2NBU A;  3VH4 B;  2KJ6 A;  2V3S A;  3DVN V;  5L95 C;  3HM3 A;  2WYQ A;  1OGW A;  3QC8 B;  1GJZ A;  4J6I A;  1KOT A;  3RUL A;  4GN1 A;  3EHV A;  2HTH A;  1OQY A;  3PHW B;  4JQW C;  4AOF A;  4YL8 A;  1TZ1 A;  3HHM A;  4EFO A;  5DPS A;  2CHX A;  2ASQ A;  3JSV B;  1J8C A;  1LXD A;  1E8Z A;  3L13 A;  3R3M A;  5KHO A;  4KSK C;  2LAS A;  3V62 A;  3KVF B;  4DBG A;  1NBF C;  3RT3 B;  2EMS A;  3DPD A;  3PVL A;  4W9I A;  3HK0 A;  4WWO A;  3WIM A;  2KX0 A;  2QHO A;  2UYZ B;  2O2V B;  2KC1 A;  2JZZ A;  4PS3 A;  2M4N A;  4JL9 A;  3ALB A;  3U7D A;  4GU2 A;  2ZPY A;  3M3J A;  4KDL B;  4ZRK A;  2ZEQ A;  5EDS A;  3NHE B;  3ZKJ C;  2JPH A;  4EUT A;  1WXV A;  4F8C B;  3ZLZ A;  1RAX A;  3K9P B;  3N32 A;  4A20 A;  4DWF A;  2J0J A;  1WX9 A;  2GOW A;  3QAR A;  3L0W B;  3QX1 A;  3QAQ A;  4FLH A;  2DX5 B;  2IY1 B;  3D32 A;  1Z2M A;  2KWC A;  1WR6 E;  2NCN A;  4GIV A;  3R7R A;  4KIK B;  3SU8 X;  3WAL A;  2L0T A;  2RGF A;  3AI5 A;  3M63 B;  3PV1 A;  4W9K A;  4II2 B;  3VUY A;  4HWI B;  1C3T A;  3JW0 X;  2K1F A;  2IZV B;  1Q1O A;  3CSF A;  3ENE A;  2KJH B;  4K1R B;  3PGE A;  4ZRJ A;  4FAD A;  4MEM A;  5AZH A;  4ANW A;  2AWT A;  1SE9 A;  4W9E A;  1Z5S B;  4EZJ A;  3U30 A;  4BKG A;  2MW5 A;  3M62 B;  3ZTC A;  1WM3 A;  2ZCC A;  3B0A A;  3BY4 B;  1WH3 A;  3QQ8 B;  4FA6 A;  5LXI B;  4DHZ B;  4IG7 B;  3PRM B;  2IBI B;  2BKF A;  3KUZ A;  2IO0 B;  1UZX B;  5GMV A;  3KUC B;  4IWQ A;  4KDI C;  1AAR A;  2CU1 A;  2WWZ A;  4K7S A;  2KAN A;  3UIP B;  3WAP A;  2ZVO A;  3KH0 A;  2K8C A;  3ZNZ B;  4BOS C;  2NPT B;  2LUE A;  2N4F A;  3A9J A;  1V80 A;  3IG3 A;  2G45 B;  2LJ5 A;  5L83 A;  1K8R B;  1R4N I;  1L2N A;  3O65 B;  2M8S A;  4OVU A;  1WE6 A;  4G0N B;  2VRR B;  3APC A;  2NVU I;  2REX A;  4HXD A;  4X57 B;  2K8B A;  4F1S A;  1WZ3 A;  2D10 A;  3N30 A;  5CHF A;  3N3K B;  2O6V B;  3HIZ A;  4FHJ A;  1SGH A;  2A4Z A;  3A9K A;  4LJO B;  2FAZ A;  1J19 A;  1V6E A;  2FIF A;  2AL3 A;  2ZCB A;  4BBN C;  5KHQ A;  4II3 B;  4HVB A;  2MP2 B;  2PJH A;  4ANV A;  2Z0E B;  4GSW A;  4XC2 A;  4KSL C;  4RMA A;  1RLF A;  2D3G A;  3PHX B;  3TBL D;  3VTU A;  2KMA A;  3LDZ E;  2BYE A;  4E71 A;  4IM3 A;  2ZNV C;  3QJZ A;  4NQK E;  4NQL B;  2KX3 A;  4EZK A;  1UGM A;  1EF1 A;  3H7P A;  1XQQ A;  2FNJ B;  3UGB B;  4W9G A;  2KTR B;  5AZF A;  3A1Q B;  3PLV A;  1R4M I;  1GC6 A;  3W1S C;  2WDT B;  4G3X B;  2KO3 A;  3A4R A;  1YX5 B;  4WJO A;  1SIF A;  1RRB A;  1GUA B;  4GB9 A;  2FCS A;  5J18 A;  4GDK B;  3X0W A;  2ZPN A;  2LGY A;  3W1Y A;  3H7S A;  3ZVV A;  2KTF A;  3VUX A;  2JRI B;  3WAN A;  4MJS B;  4PS7 A;  3KW5 B;  2KWU B;  5D2M B;  2KQ7 A;  3H9D A;  2D07 B;  3VTW A;  5D6J B;  2K25 A;  3SD5 A;  3CMM B;  4RM8 A;  3V6C B;  1UH6 A;  5AEK B;  4NAW B;  2OJR A;  4ASW C;  2I1K A;  5CHV C;  2ZNV B;  4N9F 4;  1E90 A;  2MWS B;  2GBJ A;  3GOE A;  2EKE C;  3DBL I;  1M94 A;  1WXM A;  2BGF A;  1E8X A;  4IWP A;  4A3O A;  4WJN A;  2PE9 A;  1I35 A;  2PE6 B;  4GOC A;  3T8M A;  4GMV A;  1WJN A;  4W9J A;  3ZO5 B;  2MCN B;  1KM7 A;  1V5O A;  2N1V A;  3B08 A;  4ZYN A;  3ZNG C;  3P2B A;  5AZG A;  3RUI B;  2KKC A;  3PPA A;  2G3Q B;  3A33 B;  2KK8 A;  3EC8 A;  4JGH B;  2L00 B;  1E8W A;  4ICV A;  4GDL B;  5LLI A;  3TCA A;  1ZKH A;  1ZGU B;  1V49 A;  2DAJ A;  1QZE A;  2RD0 A;  2BF8 B;  3V60 A;  1I42 A;  1MG8 A;  3PZD A;  2LXC A;  1V81 A;  3DVG Y;  4EOY A;  2KDB A;  2IY0 B;  5DCN A;  2NBV B;  1WE7 A;  3CST A;  3UQB A;  3ML8 A;  5IA7 A;  4I6N B;  3ML9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...