2MSED

Nmr data-driven model of gtpase kras-gnp:arafrbd complex tethered to a lipid-bilayer nanodisc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Apolipoprotein A-I
publication title Oncogenic and RASopathy-associated K-RAS mutations relieve membrane-dependent occlusion of the effector-binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 73
sequence length 73
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mseD01
4DHJD 3EECA 3N32A 2NR2A 4FLHA 1V81A 3QCAA 4PS3A 3T8MA 4CHKA 4CO7A 4DK5A 1HE8A 1WGDA 3TBLD 1C1YB 2PPHA 3ZNID 3TIXA 1P98A 2AL6A 2KQSA 1WGYA 1WXMA 4J6IA 3UQAA 3ZRCA 1TGZB 1WGGA 2EMSA 2J0MA 4MGZE 4X57B 1ISNA 3ZO5B 4DDGD 2DYBA 2LVPA 2L76A 2KZRA 4JLCA 2LWPA 3QARA 3V61A 5AZFA 2ZCCA 3CSFA 4HPLB 2LXCA 4TQ1A 3V6CB 2LGXA 1YJ1A 3I3TB 2KNBA 4IG7B 2N4FA 3A4SC 2BYEA 4EZKA 1OTRB 4G11A 3C0RB 5BO4B 1Z5SB 1NDDA 2CS4A 2G4DB 1TTNA 2MBHA 2FCSA 4MH0E 2ZPYA 4P7IA 1V5TA 4M8MA 4OVVA 4WWNA 5JHAA 4OVUA 5J17A 4DHZE 5JZEB 3AULA 1WJUA 3Q3JA 4MELA 3UIPB 2ASQA 3P2BA 5AZGA 3V6EB 1GJZA 1M94A 2ZVNA 4FHKA 2GBKA 4I6NB 3KYCD 4IM3A 4KIKA 5DPWA 2QHOA 4EEWA 2KTRA 2XBBC 3V60A 3GZNI 3A9JA 3DOWA 4KIKB 2M1MA 1OEYA 4NQLB 2KTRB 2KJ6A 2NS5A 2KFJA 2DHZA 3A9JB 4BFRA 2AEHA 2IZVB 2EKEC 2IYDB 2L0TA 2NPTA 2J0KA 3ECIA 4FJVB 4LJPB 4M0WB 4MDKE 4EZLA 1QZEA 2GBRA 5CHFA 2ZZPB 2N1WA 2NPTB 5G2NA 4RMAA 3BY4B 4GMVA 3H1UA 2CHZA 2LRWA 3OJ4B 4TV3A 2N7EA 1YD8U 2ZNVC 3DBRI 3Q3FA 1WFYA 1WXVA 2K25A 4JQWC 3K9PB 3VTUA 5IAAC 2EMTA 2VRRB 5AZHA 1I42A 3HM3A 3DVNU 4FBJB 3PLUA 3UINB 2BKRB 3SD5A 2V1YA 4URKA 3OJ3A 3A9KA 2ZPNA 3NZSA 2NVUI 5DPSA 4HCNB 1V5OA 1XD3B 3N30A 3PTFC 2KLCA 3A9KB 4WJOA 4TQ0A 2KWUB 3A33B 2C60A 4IWOA 1UELA 1P0RA 2CHWA 2ZVOA 4ANWA 1WM2A 2O2VA 2C7HA 3KVFB 2HTHA 2DZKA 2O2VB 2DYMA 3IHPC 3JW0X 2AL3A 2V3SA 3APCA 3JVZX 3UGBB 2K39A 3TL5A 2PE9A 4LCDE 2IO2B 3OLMD 4XC2A 4GGQA 2IY1B 3UF8A 2IO3B 1XQQA 4MGYE 4W9JA 2BWES 4I6PA 4PS7A 4EFOA 1E5WA 1KOTA 1RLFA 1GUAB 1WMHA 5AEKB 2M0XA 4MGIE 1WMHB 2CHXA 3QJZA 2DZMA 3ONSA 4IW0A 2J0JA 4MGKE 2CU1A 2KOXA 4PS8A 3VVWB 4MJSA 1SIFA 2DZJA 2N7DA 4GDKA 3PT2B 3X23A 1WYWB 5DPRA 4GDLA 4MJSB 1RFAA 4GDKB 3PREA 2RPQA 3D32A 2AYOB 4K1RB 4GDLB 3QX1A 5CTRC 3ZTDA 1RRBA 4W9LA 2K8CA 1IP9A 4K81A 4KVGB 2BYVE 4ZRIA 2IY0B 2HE7A 2Y5BB 2KKCA 4BOZB 1YX5B 4GSWA 3WANA 2MW5A 3ZIMA 1E8WA 3M62B 4GB9A 4FA6A 2HD5B 2KDBA 3ZVVA 2D2QA 4BBNC 2DENB 3ALBA 4HJKA 2JWZA 2MA9B 2DAFA 1V86A 2LGDA 2PEAA 3M63B 1V49A 2YVCA 3QIJA 2D10A 3TMPB 3WIMA 4EKUA 4NAWA 3RZFA 5CHWA 4W9GA 4HLEA 5LXHA 3PRMB 4NAWB 3L0WB 3VUYA 4LDTB 1WRDB 1KJTA 3KW5B 3PZDA 3DBSA 2KQ7A 3IG3A 4GU2A 1P9DU 1YIWA 1A5RA 3QAQA 3MTNB 2NBUA 3CMMB 4BKSA 4K7SA 2C5LC 3W1SC 5J18A 4W9IA 3QK0A 2OJRA 1BT0A 2KLGA 1G6JA 2KX0A 2DZIA 3S2AA 3T9LA 1OGWA 2WX0A 2KDEB 4CYEA 3RZWC 4AP4C 1R4NI 4W9FA 2M8SA 5LXIB 4BKSD 3QHTA 1WR1A 3HIZA 1WF9A 1E8XA 4TUUA 3R7RA 2WX1A 2L7RA 1JRUA 2MLBA 4G0NB 2G3QB 3UQBA 4AJYB 2LVQA 3NY5A 1E8YA 2C7NB 2MP2A 2N9EB 2NBVB 3JYUA 4XX5A 3VXWA 2UYZB 4NJ6A 4GN1A 4NNJB 2MP2B 1UBQA 4KDIC 1K8RB 4AUQC 4AWJA 1LFDA 3HM6X 3SHQA 4II3B 4G3XB 4IWQA 4JL9A 3DQVA 4BVUC 4FADA 3LJ3A 2M4NA 1XT9B 3B1LX 1Y8RC 3PLVA 2FCNA 2KDFB 4E71A 4EUTA 1IYFA 1LQBA 5L95C 2KMAA 4EOYA 2D11A 4KSLC 3LDZE 3PRZA 4HPMB 1Z2MA 2JZ3B 3VQIA 5L83A 2ZEQA 3DDCB 1WH3A 2O6VA 3EC8A 4W9HA 3ZDMC 2WYQA 1P3QU 2O6VB 3AXCA 2KHWB 4WQOB 3KUDB 3L54A 3QA8A 4WAAA 3KUZA 4WJQA 1V6EA 3B08A 2PE6B 1H4RA 3SU8X 2KWCA 3A4RA 3M95A 3SDLC 2CKHB 4DDID 3ZDTA 2KDIA 2ZNVB 3NS8A 3DVNV 4A20A 1ZKHA 2W9NA 3M3JA 2JT4B 4NPNA 3NHEB 4KDLB 2L00B 3WAMA 5HKHA 4IWPA 3ZLZA 1WZ0A 4E3CA 1UBIA 2JRHA 2Z0DB 2ZJDA 2DAJA 1H8CA 4NQKE 2MWSB 2LRUA 2KMCA 2LASA 2KXJA 2REXA 1WX7A 4KZCA 2FAZA 1SGHA 1WX9A 2Z0EB 3L17A 4N9F4 4WJPA 3VTWA 2BWFA 2MBOA 1WGHA 4RM8A 2LI5A 1UH6A 2XK5A 1E8ZA 2DYOA 4ICVA 4KV2A 1WE7A 1L2NA 3R66C 3AI5A 2LZ6A 1E90A 2JF5A 2XK5B 3APDA 2K6QA 3H7PA 4HWIB 1NBFC 2N1VA 4HK2A 5G55A 2FNJB 1WM3A 4JGHB 3DPDA 4GIVA 3QC8B 3X0WA 1I35A 3H7PB 1PQSA 2GBNA 1OEYJ 5CX3A 4JIOU 5IA7A 2KD0A 3EHVA 2OOBB 4HXDA 3RT3B 4K7UA 2CR5A 2KK8A 2NBWB 5E6NA 4FULA 4MEMA 2UWQA 3PGEA 4ZDVA 2NCNA 4TKNA 3MHSD 3ML9A 2LJ5A 2GOWA 2FCQA 3RYTA 1J8CA 1YQBA 1ZGUB 5TR5A 4HDOA 4ASWC 2K8BA 4LJOB 2KO3A 4PYUA 2FIDA 1D3ZA 4ICUA 3VDZA 5CHVC 2RSUA 3RD2A 3VAWA 2K8HA 1V2YA 1C3TA 2JUOA 4BKGA 1J19A 1WJ6A 3PSEB 3OAWA 1P1AA 4HVBA 4PYZA 1WI0A 1V80A 4MSQB 2YLMA 4ZYNA 2I1JA 2RGFA 3BINA 4BBNF 2LVOA 2BGFA 2MSED 1S1QB 3PHXB 4RM9A 5E6PA 3WAPA 1WX8A 2IO1B 3ZKJC 2MRPA 3VTVA 2JXXA 4AJWA 2MCNB 1TBEA 3U8ZA 2MBQA 1ZW7A 2AWTA 3DBHI 2JY6A 1WGRA 4W9CA 3WA0A 3WALA 2N9PC 3VUWA 4LDTD 4IUMB 4M8NA 3VUXA 3NOBA 3UIOB 4W9DA 1WJNA 2L3ZA 3IBEA 2MQJA 2G4SA 2GBMA 1EO6A 2JPHA 2MBBB 2KX3A 3ML8A 4G50A 2FCMA 2KC1A 5KHQA 1T0YA 3PPAA 1NI2A 1L7YA 4IM0A 3IFWB 3RULA 2WDTB 4HCPB 3HHMA 3KH0A 3O65B 3W1SA 2HJ8A 2GMIC 2LD9A 3PVLA 3PS6A 4ZRJA 4XZ4A 3RCZA 5JH5C 5C23A 2DX5B 3R3MA 3ZUNA 3ENEA 1S3SG 3WAOA 2KJHB 1GC7A 3VH3B 4E74A 4W9EA 5E6OA 1CMXB 4MM3A 2IBIB 1Q5WB 2BYFA 4F7ZA 4A3PA 1WR6E 1UD7A 2RD0A 4DBGA 5D6JB 2PJHA 2BKFA 2J7QB 2A4ZA 2JVCA 4NJ7A 2KFKA 5JHBA 2N9XA 4WJNA 2FIFA 4IM2A 2KFKB 4AOFA 1MG8A 3MJWA 4MSMB 1Q1OA 1EUVB 3ZNGC 4DWFA 4WWPA 5D94A 4GOCA 2D07B 4YL8A 4II2B 4NY0A 5DPTA 3VH4B 3A1QA 2L8JA 3HK0A 3PV1A 3AU5A 3A1QB 3ZNZB 1X1MA 2BF8B 2O6VD 2JZZA 4ANXA 3N3KB 2Z59B 2ZCBA 3W1YA 4ANVA 4ANUA 4F1SA 2KN5A 2A5UA 3ZTCA 4BKTA 1WZ3A 2KJRA 2L05A 1GNUA 1VCBA 1YX6B 2D3GA 1IPGA 1UGMA 1VD2A 4EZJA 3VHTC 3DCGA 3R7QA 2R2QA 4FJYA 2MX2A 1UZXB 2GBJA 3TJPA 2C7MB 2LUEA 3APFA 4B9KA 3U7DA 1F9JA 3EFUA 2KANA 1EF5A 1SE9A 2G45B 4HDQA 2RR9A 4FN2A 2I1KA 2L0FA 1FXTB 3L16A 5GMVA 1LM8B 3H7SA 1V9JA 2B3AA 2KWVB 3JSVA 4FJZA 4I6LB 3V62A 5C1ZA 3QQ8B 3JSVB 2WWZA 2KVRA 2XEWA 4B95A 1GG3A 1KM7A 3QWZB 3VFKA 2BPSA 4FHJA 5FR6A 3ZNHB 2LGYA 3NZUA 5D7GA 4KZ0A 5J2RA 3H6NA 2V4LA 3KUCB 3IVFA 1OQYA 1WJ4A 4GXBA 1WIAA 2IO0B 3TCAA 3L10B 3RUIB 2KC2A 3AU4A 3CSTA 2LXAA 1E7UA 5LLIA 3U30A 4DHZB 4ZRKA 4WWOA 5D2MB 4F8CB 2JRIB 5KHOA 1AARA 2R2OA 4IC7B 1Q0WB 1J0GA 1U4AA 3ZRFA 4W9KA 4A3OA 2M17A 3CF6E 1KLVA 1GC6A 2MBEA 2C9WB 1WXSA 3PRPB 5DCNA 4DXAB 1WXAA 1WY8A 1WE6A 2K6DB 1TZ1A 1E7VA 3B0AA 3K9OB 3DVGX 5EDSA 3L08A 3PHWB 4K7WA 4DHJB 2FUHB 1EF1A 1LXDA 3KYDD 4B6WA 3H9DA 2K1FA 1RAXA 4BOSC 3GOEA 3DBLI 1R4MI 4KSKC 3L13A 3DVGY 3ZW3A 2KTFA
chains in the Genus database with same CATH superfamily
2VZKB 2QJLA 1V81A 3DHGC 3QCAA 1M4VA 3N9YC 3W9CB 1JALA 3ZRCA 1WGGA 2EMSA 3P4QB 4X57B 1TKYA 2CJNA 2L76A 3QARA 2KN4A 2ZCCA 2QCZA 2G9HD 4IG7B 2BYEA 1NDDA 3GB1A 2WS3B 3Q8CA 4MH0E 4P7IA 1V5TA 4M8MA 1F0ZA 5J17A 3AULA 1WJUA 3Q3JA 4MELA 4C7ZA 2NTTA 4TSSA 2GBKA 2PW9A 5G5GA 2QHOA 3V60A 3A9JA 4KIKB 1ENFA 1YQ3B 2KTRB 4JPSA 1EWYC 2DHZA 4BFRA 4A6QA 2DBYA 2IZVB 2L0TA 2J0KA 4M0WB 2RPVA 1QZEA 2GBRA 3TUOA 2N1WA 2NPTB 2HTME 4GMVA 4YTNB 1P7EA 1IUEA 5BYQA 1JWAD 1WFYA 5FR3A 2OJWA 1N60A 3J9CA 3HM3A 3UINB 3OJ3A 3A9KA 4HCNB 1I7HA 1AN8A 1C4CA 3N30A 4WJOA 2BB6A 1P0RA 4ANWA 4ITKA 1CK1A 2HTHA 3JW0X 5H8YE 2W3SA 2PE9A 4LCDE 2IO2B 4M00A 2K9XA 2IY1B 3UF8A 2IO3B 2QEJC 4QAYA 1WMHA 4RGTA 2CHXA 5D3IB 2J0JA 2CU1A 4PS8A 2DZJA 3U4EG 2WDRB 3X23A 1JWMD 4GDLA 5DPRA 4GDKB 1FRDA 2RPQA 3D32A 3PZ8A 1GB1A 1E7PB 1J7BA 2WXFA 5BYRA 3LB8C 4US8A 2BBCA 2R61A 2MW5A 5HG2A 1E8WA 3M62B 2WLBA 2V3PA 2D2QA 3ALBA 3NVWA 1C78A 2JYEA 2WDVB 4ZRPA 2DAFA 1V86A 1V49A 2YVCA 2QILA 4EKUA 4W9GA 4HLEA 2L32A 1MFWA 5LXHA 3L0WB 1XEEA 4LDTB 1WRDB 1KJTA 2D5GA 1L0XB 3QAQA 2NBUA 5LNK1 2BS3B 4NAMA 1G6JA 2KX0A 3S2AA 3T9LA 3AM9A 3RZWC 4AP4C 1V1PA 4BKSD 3QHTA 1WF9A 4TUUA 1JRUA 3UQBA 1NEKB 2C7NB 2N9EB 3VXWA 3O13A 2QC8A 4WWMA 2EKIA 4AUQC 3ZJVA 3HM6X 3SHQA 3LJ3A 3PLVA 1ZOYB 2FCNA 2KDFB 5L95C 4EOYA 2D11A 3AEEB 3PRZA 1Z2MA 2M56B 2PKOA 1SE3A 1WH3A 1KF6B 3U7ZA 3EC8A 1P3QU 1SSNA 2KHWB 4XWWA 4WQOB 4WIPA 1SIJA 1GOZA 2X38A 1HA5A 1N63A 3B08A 3SU8X 2KWCA 3SDLC 2MHJA 3DVNV 1ZKHA 2W9NA 3M3JA 4ACFA 1N61A 4E3CA 5AUKA 1OQQA 2Z0DB 4XYCA 2W3RA 2LRUA 2KMCA 3VTWA 4KZCA 2FAZA 5TSSA 4WJPA 4R3DA 2BWFA 4RM8A 1VR9A 2DYOA 1WE7A 3AI5A 3APDA 2JF5A 2XK5B 2K6QA 3AEGB 4JGHB 4GIVA 1YN3A 3EHVA 2CR5A 2KK8A 3TSSA 4MEMA 4ZDVA 4HKZE 2NCNA 2UU7A 3MHSD 2CJOA 1YQBA 1ZGUB 4ICUA 3VDZA 3VAWA 3B2FA 4BKGA 3PSEB 4NJCA 1P1AA 4ARCA 4ZYNA 2I1JA 3MHZA 4BBNF 2BGFA 1S1QB 3PHXB 4RCOA 1MHXA 1WX8A 1TBEA 1R4MB 3ZXVA 3WA0A 2N9PC 1I4PA 4RGMA 2JQRB 3VUXA 3NOBA 3UIOB 1UNSA 2GBMA 3ML8A 5C3JB 2FCMA 2GI9A 5KHQA 3PPAA 1NI2A 2LEKA 1L7YA 4HCPB 3DVGY 1CQVA 4WQMA 3N1XC 3PVLA 2LD9A 5JH5C 3RCZA 3IXSA 2ZW1A 3WAOA 2JSVX 2GB1A 2E6XA 4MM3A 1Q5WB 4DBGA 2WP9B 1F2RI 4NJ7A 2KFKA 2N9XA 2AQ1B 1MG8A 3C8YA 2D07B 3P1MA 5HHDG 1OQRA 4EE2A 2O6VD 2ZCBA 2QSDA 2KN5A 4BKTA 1CJEA 2GRIA 4EZJA 1WXQA 3VHTC 3DCGA 3R7QA 5IN7A 2IJ0A 2KANA 2G45B 2L0FA 1FXTB 5GMVA 3Q3NC 1V9JA 4FJZA 3V62A 1C77A 3JSVB 1JQ4A 2KVRA 4RF1A 1GG3A 3EA6A 2BPSA 1ZDVA 1VDVA 4P6VF 1SB3C 2WU2B 4JE3B 1WJ4A 4MACA 1JMLA 1NYQA 3AU4A 3CSTA 3KLSX 4DHZB 2D3CA 1QOAA 4WWOA 1AARA 4W9KA 3PZ7A 2M17A 1STEA 3CF6E 2MBEA 2C9WB 5DCNA 1GAQB 4DXAB 1WY8A 2K6DB 1TZ1A 3K9OB 3I63C 4DHJB 1KLGD 3Q2AC 2WXQA 2K1FA 1EU3A 3GOEA 3ZW3A 4DHJD 3EECA 2MH7A 4CHKA 4CO7A 1XLNA 3P4RB 3ZNID 3TIXA 1WGYA 1Q10A 5BMIA 5E6JA 2J0MA 5C2TB 1E0ZA 3LXFA 1YOVB 3V61A 1ZPSA 4HPLB 3MP9A 4IOIE 2KNBA 2BYTA 2XNAC 1L4DB 3C0RB 2CS4A 2G4DB 1TTNA 2ZPYA 1R4NB 4WWNA 4LNOA 3TEWA 2FBWB 3UIPB 1MPEA 2ASQA 3P2BA 3V6EB 4UDUC 2ZVNA 1V1OA 4IM3A 2XBBC 1TKEA 3GZNI 3BVGA 4HROA 2KJ6A 3GS2A 2NS5A 2KFJA 3ECIA 4MDKE 2DLBA 1J7AA 4HEA1 5CHFA 1KRHA 4XE0A 4LLGM 4O1NA 4C7YA 3IT6B 2LRWA 4TV3A 2N7EA 2ZNVC 3VTUA 1WXVA 4JQWC 1I42A 4FBJB 3SD5A 4URKA 3AE6B 3PTFC 4TQ0A 3A33B 4C80A 1UELA 2CHWA 2O2VA 2C7HA 2V3NA 3IHPC 3P42A 2W82A 3APCA 1NYRA 3UGBB 1VJKA 1XLOA 3OLMD 4XC2A 3E56A 3DHHC 2GLSA 1XQQA 2BWES 4PS7A 1E5WA 1GUAB 2IPKD 3Q3MC 1F52A 4MGKE 2KOXA 3PT2B 3GE8C 1HQRD 4MJSB 1RFAA 2Y5PA 3PREA 3AE2B 3TEZA 5CTRC 3QX1A 4XGAB 1ESFA 4W9LA 2K8CA 4KVGB 2QDFA 3SFDB 4ZRIA 1FEHA 2HE7A 1WWTA 4GB9A 3ZVVA 2LGDA 3BYTB 1DYQA 3DWGC 2D10A 3TMPB 1PYWD 4NAWB 1GPXA 1L6UA 2KVZA 4GU2A 1N6ZA 2VZKD 2N9LA 5BMGA 2C5LC 4W9IA 3QK0A 1KTKA 2DZIA 1OGWA 2WX0A 1YJJA 1FXIA 3RMKC 3HIZA 4OZAA 1SEBD 2MLBA 2G3QB 1R7SA 2LVQA 3NY5A 1L5PA 2MP2A 2NBVB 2BTEA 1UUPA 2PMVA 4G3XB 4II3B 2H89B 1DOYA 4E71A 1XT9B 4YTPB 1LQBA 1L0YB 4US9A 3VR9B 5L83A 1JROA 2O6VA 2OEDA 1C76A 4W9HA 2WXPA 3WCQA 3KUDB 3L54A 1JCKB 3ZQ4A 1PGBA 3P63A 4WJQA 1XCTL 2PE6B 1H4RA 4IDIA 2BB5A 3M95A 2CKHB 4DDID 2WNMA 2JYTA 2KDIA 4A20A 2WXMA 3NHEB 1FFUA 3WAMA 4L2YA 1ACCA 2WDQB 5MPOA 4YSZB 2Z8LA 2DAJA 3IAS1 2MWSB 2KXJA 1WX7A 1SGHA 3BIID 2SEBD 3EUB2 2KYWA 4ZYSA 4KV2A 1T0QC 1E90A 1JWSD 3BYYB 5G55A 5HFYA 2FNJB 3DPDA 1I4RA 3HVDA 3L4PA 3H7PB 2VH2A 5IA7A 1JWUD 2OOBB 3B9JA 4K7UA 2NBWB 2NTSA 3RFZB 3PGEA 1YJIA 1IBXB 3FILB 3ML9A 2LJ5A 4HJGE 4YSYB 1J8CA 1BUIC 4LJOB 2KO3A 2YEPF 4PYUA 4L1BA 2FIDA 1D3ZA 3RD2A 1YMHE 1C3TA 4HVBA 1WI0A 3NZ3A 3E9SA 1V80A 4MSQB 3UI3A 2YLMA 2RGFA 3T3NA 2LVOA 3BWUD 4RM9A 4B0EA 2IO1B 4L23A 2LJIA 3VTVA 4AJWA 2MCNB 1QT9A 1ZW7A 2AWTA 3DBHI 2JY6A 2X8XX 4C4VB 4LDTD 5GXGB 5IKCM 4IUMB 4W9DA 1KH0A 1FCCC 3IBEA 1SE2A 2MQJA 1JW9D 1EO6A 2JPHA 2KX3A 2KC1A 1T0YA 4J3OD 2AQ2B 4IM0A 2WDTB 3KH0A 1N5XA 4YSXB 4XZ4A 5C23A 2DX5B 3R3MA 3ZUNA 3ENEA 5IP4D 1MVKA 1B9RA 1GC7A 3VH3B 4E74A 1SJHD 4W9EA 2BW2A 4GLSC 2IBIB 2BYFA 1UD7A 4C56C 2WGSA 1ET9A 2RDBC 1I4QA 2J7QB 2A4ZA 5JHBA 1FO4A 3GP7A 1FXAA 4WJNA 2K0PA 1K53A 3NRZA 1EUVB 3NVZA 4DWFA 1SXTA 2RMMA 4Q2JA 4YL8A 4II2B 3KWVA 4NY0A 3FAHA 3A1QB 3ZNZB 1VRAB 2BF8B 1E9MA 3DHIC 4ANXA 1I35A 1DOIA 2Z59B 3W1YA 4ANUA 3ZXRA 4BZAA 1WRIA 3NVVA 1WZ3A 1C4AA 2KJRA 1VCBA 1NENB 2R2QA 4FJYA 2MX2A 2GBJA 3OG5A 3U7DA 5FKAC 4ZRQA 3EFUA 1SE9A 2RDHA 4HDQA 2AX5A 5H92C 3AE1B 1LM8B 2B3AA 4I6LB 2WXRA 2XEWA 4B95A 3AE4B 3NZUA 5D7GA 5J2RA 3H6NA 2KQ4X 2V4LA 1HTOA 4XDDA 2ZW0A 3L10B 2KC2A 2JX5A 5LLIA 3C19A 4ZRKA 3BZDB 1J0GA 4IC7B 4XDCA 3HVZA 4CQNA 3SR6A 2MJEA 3KQ4A 4HRSA 3V3XA 1WXAA 1WE6A 4K7WA 1EF1A 4KGRA 5HI1A 1RAXA 4BOSC 1TIFA 3L13A 3N1ZC 1I4GA 4RF0A 3N32A 2NR2A 1I4XA 4FLHA 2Y3AA 4PS3A 4DK5A 2J53A 1C1YB 2PPHA 2L1AA 1P98A 1K50A 1WXMA 2ACZB 1PGAA 3UQAA 2ICIA 1TGZB 1TY2A 3DBHB 4MGZE 4DDGD 3ZO5B 1ISNA 2WXIA 2LWPA 2LXCA 1FNUA 2N9KA 3I3TB 2N4FA 3A4SC 4ZOHC 4G11A 5BO4B 1Z5SB 2MBHA 2IGHA 3VRAB 5JHAA 1MI0A 4OVUA 4JX1C 4DHZE 1QOGA 5JZEB 5AZGA 2WQYB 4KIKA 2LGIA 5DPWA 3KWLA 2KTRA 2M1MA 3A9JB 4M0WA 2EKEC 2NPTA 4LJPB 4EZLA 4RMAA 3H1UA 3OJ4B 1YD8U 2FE8A 2K25A 5IAAC 2EMTA 2VRRB 5AZHA 1L4ZB 1UF0A 1OFFA 3PLUA 2BKRB 3NZSA 2NVUI 5DPSA 2KLCA 3A9KB 1TKGA 2KWUB 2C60A 2W55A 1WM2A 4K3BA 1TT5B 2DZKA 4OZCA 1C9FA 1D4BA 2V3SA 4KKJA 1XXGA 3JVZX 2K39A 3TL5A 2M0AA 4MGYE 4I6PA 1KOTA 2BT6A 1RLFA 5EE3A 5AEKB 4B0MA 2M0XA 4MGIE 1WMHB 3QJZA 3ONSA 4IW0A 3SEBA 3VVWB 3SFEB 1VZ6A 1VZ8A 2N7DA 1YN4A 1FIQA 4GDKA 1WYWB 4REZA 4K1RB 4GDLB 3ZTDA 3RNFC 4K81A 3FILA 1XF5L 2IY0B 2Y5BB 1E6EB 2KKCA 4BOZB 3ZIMA 2KDBA 1ZUD2 2LUMA 4BBNC 3B2GA 2KACA 3M63B 2CU3A 2MJ3A 1PDXA 3OWEB 3WIMA 3BK1A 3NUHB 3RZFA 5CHWA 3PRMB 2SAKA 3KW5B 3DBSA 3IG3A 4MT5A 3AV8A 2L83A 2ON8A 1A5RA 3CMMB 4N59A 4BKSA 2PTLA 3W1SC 2LGSA 4P1CC 2I2YA 2KLGA 3EFCA 3URYA 2LHDA 2RDGA 3I57A 4CYEA 2HDEA 4W9FA 1JRPA 4LNNA 1V1PB 1E8XA 5EE0A 3MC0B 3MJ5A 3R7RA 2KT7A 1XO3A 4IKGA 4WH4A 4G0NB 3Q6BA 4AJYB 2TSSA 1RM6C 1E8YA 3JYUA 4XX5A 2IGDA 1LGRA 4GN1A 4KDIC 4AWJA 4KGTA 2WHIA 4IWQA 3VRBB 2M4NA 3ZJUA 2IDYA 2KMAA 3LDZE 4HPMB 1KFYB 3Q14C 2JZ3B 3VQIA 2ZEQA 3ETRA 3ZDMC 2WYQA 3AXCA 1ROEA 3AE3B 1RYJA 3KUZA 1RFKA 1V6EA 2K22A 2V9HA 2QIEB 3MC9A 3A4RA 1P7FA 4OZBA 3ZDTA 3RNBC 2L00B 3ZLZA 1TZOA 2JRHA 2ZJDA 4LTUA 1H8CA 4A55A 4NQKE 2LASA 4N9F4 1WX9A 2MBOA 2LI5A 1UH6A 2XK5A 1E8ZA 1L2NA 3R66C 2LZ6A 1YQ4B 1NBFC 2N1VA 4HK2A 1QF6A 3AEBB 2W54A 5CX3A 1ZXHA 4JIOU 2KD0A 3LYYA 4AQ7A 1ZP0B 4FULA 1AWDA 4OHJA 3ZGZA 1XLQA 2VH1A 1SJED 4TKNA 5T8IA 3RYTA 4ASWC 5TR5A 4HDOA 2K8BA 3GE3C 2RSUA 2K8HA 1V2YA 1Y56A 1K52A 1J19A 2WXOA 3OAWA 4PYZA 1DOXA 3CWIA 5EE9A 3NVYA 5BYSA 3AEAB 3WAPA 1BXTA 4TMAB 3ZKJC 1J7CA 2JXXA 2I38A 3U8ZA 2MBQA 3RNEC 1WGRA 3WALA 1B1ZA 4A9AA 3U52E 1YNTE 2J4XA 1TJEA 4M8NA 2L3ZA 1UWMA 4H2AA 4G50A 3IFWB 1MHHE 1UWXA 3W1SA 3Q69A 2FUG1 3V05A 5AUIA 4KX6B 4RFBA 5E6OA 1F2RC 1WYGA 5IOIA 4A3PA 4F7ZA 1WR6E 4MM3B 3AH7A 3GZNB 5D6JB 1QQRA 2BKFA 2WXGA 2JVCA 2FIFA 4IM2A 2KFKB 2M19A 1HTQA 3MJWA 1Q1OA 1RWSA 3ZNGC 4YTMB 3W5UB 3R2TA 3NJTA 2WXLA 4D2KA 3ABVB 3PV1A 2V4IB 3AE9B 1T0SC 4F1SA 5BMHA 3N3KB 2L05A 2D3GA 1IPGA 3P4SB 2E3TA 1F1HA 3APFA 1F9JA 2RR9A 2OHFA 4FN2A 2WXHA 2I1KA 3RN9C 1WGKA 3JSVA 1MG4A 5C1ZA 2V0GA 2WU5B 1N5WA 2WWZA 1BMLC 1KM7A 4FHJA 1TS3A 2INCC 3KUCB 3AN1A 4PK1A 1JWBD 4WURA 4GXBA 1WIAA 1HZ6A 1XCQL 1EU4A 1E7UA 2PVGC 5D2MB 2R2OA 3IT4B 2WXNA 3ZRFA 2XN9C 3R8BA 1FRRA 1KLVA 4KGSA 4N58A 3PRPB 1TY0A 3B0AA 3FKYA 2YEPB 3L08A 3PHWB 2FUHB 1LXDA 1SBBB 3AE7B 3KYDD 4B6WA 4S0RA 2BVCA 3MC8A 3DBLI 1FD6A 1R4MI 2KTFA 1T3QA 1L0VB 1PUTA 3T8MA 1HE8A 1WGDA 3TBLD 1ZE3D 2AL6A 2KQSA 4DXFA 3Q8EA 4J6IA 4LK0M 4P1BC 1PFDA 3BK2A 2DYBA 2LVPA 4JLCA 2KZRA 2QMTA 5AZFA 3CSFA 4TQ1A 3V6CB 2LGXA 1YJ1A 4EZKA 1OTRB 4K3CA 1FNWA 3RI7C 2FCSA 1FM0D 2N7JA 4OVVA 4DXGA 1FMAD 1M94A 1F77A 4FHKA 4I6NB 3KYCD 4EEWA 4JWSC 3DOWA 3HRDD 2INDC 1OEYA 1D6EC 4NQLB 4DQOC 2G1EA 2AEHA 2IYDB 4FJVB 2JZPA 2ZZPB 5G2NA 2EELA 3BY4B 2DWQA 4RGNA 1I4HA 2CHZA 3DBRI 3Q3FA 3K9PB 2JWUA 3DVNU 2V1YA 2HJ1A 2ZPNA 1EM7A 2MEKA 1V5OA 1XD3B 3PO0A 1D5MC 4IWOA 4OVZA 2ZVOA 3I9V1 2BS4B 4RNAA 1QOFA 3KVFB 4LNIA 2O2VB 2DYMA 2NMQA 2AL3A 2LFIA 4GGQA 2L52A 3AB5A 3RNGC 5JXVA 4W9JA 2D3BA 4EFOA 2Q5WD 5IO9A 1TYGB 2JU6X 1LO5D 1A70A 2J52A 2DZMA 1GJZA 4MJSA 1SIFA 3Q8FA 2AYOB 1RRBA 4BAXA 2B76B 2BYVE 4YT0B 4A8XC 3ZJTA 1WSPA 1IGDA 1YX5B 4GSWA 3WANA 2LMCA 4FA6A 2HD5B 3FC4A 3RPFC 2DENB 3N1YC 4HJKA 2JWZA 2MA9B 1AW7A 2PEAA 3I5JC 3AEFB 3QIJA 1FFVA 4NAWA 3IAM1 1V97A 1QLBB 3VUYA 3DWMA 3RNAC 3PZDA 2KQ7A 1P9DU 1YIWA 2DNFA 3CIRB 3MTNB 3DBLB 4YWGG 1N62A 4K7SA 3R2IA 5J18A 2OJRA 1BT0A 2KDEB 1FCLA 1R4NI 2M8SA 5LXIB 3AEDB 1WR1A 4A90A 5FK9C 5EE1A 2WX1A 2L7RA 2UYZB 4NJ6A 4NNJB 2MP2B 3ZYYX 1UBQA 2PVOD 1K8RB 1LFDA 2J42A 4BVUC 4FADA 4JL9A 3DQVA 4USAA 1PGXA 3HUIA 3AE8B 3B1LX 1HXYD 1Y8RC 4EUTA 1IYFA 4S17A 1ZXIA 4KSLC 4PT5A 3DDCB 3Q3OC 4RGOS 3W2DA 1QILA 2O6VB 1D5ZC 3QA8A 4WAAA 3DBRB 1C4PA 2ZNVB 3NS8A 3AECB 4NPNA 2JT4B 2ONQA 4KDLB 5HKHA 4IWPA 1WZ0A 1UBIA 1TS2A 1VZ7A 3MFGA 2REXA 3L17A 2Z0EB 1WGHA 2KMMA 1ET6A 2N0SB 4ICVA 1EWCA 1T6BX 3N20C 3TEXA 4HWIB 3H7PA 1SE4A 1WM3A 3QC8B 3X0WA 1PQSA 2GBNA 1OEYJ 4XWTA 4HXDA 4FXCA 3RT3B 1IBXA 2H88B 1FPYA 5E6NA 4LNFA 2UWQA 2LHEA 2GOWA 2FCQA 1FNVA 3NG0A 1HZ5A 4NZLB 4MH8A 2IGGA 1XLPA 2WXKA 1L6VA 5CHVC 1V8CA 2JUOA 5G5HA 1WJ6A 4RH6A 3BINA 2PLPA 2MSED 4N6EB 1HEZE 5D3DA 5E6PA 4JWUC 2MRPA 4C4VA 3P4PB 4W9CA 1C79A 1KLUD 3VUWA 1WJNA 2PIAA 1DGJA 2D3AA 2G4SA 2MBBB 2INPE 4ARIA 3U2SC 4M02A 3RULA 3H8HA 1T0RC 3HHMA 4AS1A 2HJ8A 2GMIC 3PS6A 4ZRJA 2BS2B 4WAFA 1TS5A 1S3SG 3BVMA 2KJHB 1D5XC 4HKQA 1CMXB 1TS4A 4P16A 2RD0A 1QKZA 2PJHA 4M01A 3NS1A 1E10A 4HPPA 4AOFA 4MSMB 3RNCC 4WWPA 5D94A 4GOCA 2BQQA 4KKIA 3Q8AA 3VH4B 5DPTA 3A1QA 1T5XD 2L8JA 3HK0A 3AU5A 1AYFA 1X1MA 2JZZA 4ANVA 2A5UA 2AQ3B 2KWDA 3ZTCA 1GNUA 1YX6B 1K51A 1UGMA 1VD2A 2INNE 1QOBA 1UGJA 1UZXB 3TJPA 3VR8B 2C7MB 2LUEA 4B9KA 1EF5A 1NI3A 1ZDXA 3L16A 1YN5A 3H7SA 2KWVB 3AE5B 2JXTA 1SF0A 2WXJA 1VLBA 3QQ8B 4ZHPA 4YXDB 1IP9A 3QWZB 2K5PA 3VFKA 3ZNHB 5FR6A 2LGYA 4KZ0A 3IVFA 1OQYA 1MJDA 1CZPA 1IGCA 2IO0B 3TCAA 3RUIB 2Y5CA 2LXAA 3U30A 2MJDA 4F8CB 2JRIB 5KHOA 1Q0WB 1U4AA 4A3OA 3AMZA 1NVID 3W5VB 3T3OA 1GC6A 1WXSA 3BVZA 4OW0A 2KAJA 3Q8BA 4ZHOA 1E7VA 2KDMA 5EDSA 3DVGX 3TEYA 5I4DA 1GB4A 4C00A 4LNKA 3H9DA 3EGRA 4KSKC 3O65B 2K3UA
chains in the Genus database with same CATH topology
4DHJD 3EECA 3N32A 2NR2A 4FLHA 1V81A 3QCAA 4PS3A 3T8MA 4CHKA 4CO7A 4DK5A 1HE8A 1WGDA 3TBLD 1C1YB 2PPHA 3ZNID 3TIXA 1P98A 2AL6A 2KQSA 1WGYA 1WXMA 4J6IA 3UQAA 3ZRCA 1TGZB 1WGGA 2EMSA 2J0MA 4MGZE 4X57B 1ISNA 3ZO5B 4DDGD 2DYBA 2LVPA 2L76A 2KZRA 4JLCA 2LWPA 3QARA 3V61A 5AZFA 2ZCCA 3CSFA 4HPLB 2LXCA 4TQ1A 3V6CB 2LGXA 1YJ1A 3I3TB 2KNBA 4IG7B 2N4FA 3A4SC 2BYEA 4EZKA 1OTRB 4G11A 3C0RB 5BO4B 1Z5SB 1NDDA 2CS4A 2G4DB 1TTNA 2MBHA 2FCSA 4MH0E 2ZPYA 4P7IA 1V5TA 4M8MA 4OVVA 4WWNA 5JHAA 4OVUA 5J17A 4DHZE 5JZEB 3AULA 1WJUA 3Q3JA 4MELA 3UIPB 2ASQA 3P2BA 5AZGA 3V6EB 1GJZA 1M94A 2ZVNA 4FHKA 2GBKA 4I6NB 3KYCD 4IM3A 4KIKA 5DPWA 2QHOA 4EEWA 2KTRA 2XBBC 3V60A 3GZNI 3A9JA 3DOWA 4KIKB 2M1MA 1OEYA 4NQLB 2KTRB 2KJ6A 2NS5A 2KFJA 2DHZA 3A9JB 4BFRA 2AEHA 2IZVB 2EKEC 2IYDB 2L0TA 2NPTA 2J0KA 3ECIA 4FJVB 4LJPB 4M0WB 4MDKE 4EZLA 1QZEA 2GBRA 5CHFA 2ZZPB 2N1WA 2NPTB 5G2NA 4RMAA 3BY4B 4GMVA 3H1UA 2CHZA 2LRWA 3OJ4B 4TV3A 2N7EA 1YD8U 2ZNVC 3DBRI 3Q3FA 1WFYA 1WXVA 2K25A 4JQWC 3K9PB 3VTUA 5IAAC 2EMTA 2VRRB 5AZHA 1I42A 3HM3A 3DVNU 4FBJB 3PLUA 3UINB 2BKRB 3SD5A 2V1YA 4URKA 3OJ3A 3A9KA 2ZPNA 3NZSA 2NVUI 5DPSA 4HCNB 1V5OA 1XD3B 3N30A 3PTFC 2KLCA 3A9KB 4WJOA 4TQ0A 2KWUB 3A33B 2C60A 4IWOA 1UELA 1P0RA 2CHWA 2ZVOA 4ANWA 1WM2A 2O2VA 2C7HA 3KVFB 2HTHA 2DZKA 2O2VB 2DYMA 3IHPC 3JW0X 2AL3A 2V3SA 3APCA 3JVZX 3UGBB 2K39A 3TL5A 2PE9A 4LCDE 2IO2B 3OLMD 4XC2A 4GGQA 2IY1B 3UF8A 2IO3B 1XQQA 4MGYE 4W9JA 2BWES 4I6PA 4PS7A 4EFOA 1E5WA 1KOTA 1RLFA 1GUAB 1WMHA 5AEKB 2M0XA 4MGIE 1WMHB 2CHXA 3QJZA 2DZMA 3ONSA 4IW0A 2J0JA 4MGKE 2CU1A 2KOXA 4PS8A 3VVWB 4MJSA 1SIFA 2DZJA 2N7DA 4GDKA 3PT2B 3X23A 1WYWB 5DPRA 4GDLA 4MJSB 1RFAA 4GDKB 3PREA 2RPQA 3D32A 2AYOB 4K1RB 4GDLB 3QX1A 5CTRC 3ZTDA 1RRBA 4W9LA 2K8CA 1IP9A 4K81A 4KVGB 2BYVE 4ZRIA 2IY0B 2HE7A 2Y5BB 2KKCA 4BOZB 1YX5B 4GSWA 3WANA 2MW5A 3ZIMA 1E8WA 3M62B 4GB9A 4FA6A 2HD5B 2KDBA 3ZVVA 2D2QA 4BBNC 2DENB 3ALBA 4HJKA 2JWZA 2MA9B 2DAFA 1V86A 2LGDA 2PEAA 3M63B 1V49A 2YVCA 3QIJA 2D10A 3TMPB 3WIMA 4EKUA 4NAWA 3RZFA 5CHWA 4W9GA 4HLEA 5LXHA 3PRMB 4NAWB 3L0WB 3VUYA 4LDTB 1WRDB 1KJTA 3KW5B 3PZDA 3DBSA 2KQ7A 3IG3A 4GU2A 1P9DU 1YIWA 1A5RA 3QAQA 3MTNB 2NBUA 3CMMB 4BKSA 4K7SA 2C5LC 3W1SC 5J18A 4W9IA 3QK0A 2OJRA 1BT0A 2KLGA 1G6JA 2KX0A 2DZIA 3S2AA 3T9LA 1OGWA 2WX0A 2KDEB 4CYEA 3RZWC 4AP4C 1R4NI 4W9FA 2M8SA 5LXIB 4BKSD 3QHTA 1WR1A 3HIZA 1WF9A 1E8XA 4TUUA 3R7RA 2WX1A 2L7RA 1JRUA 2MLBA 4G0NB 2G3QB 3UQBA 4AJYB 2LVQA 3NY5A 1E8YA 2C7NB 2MP2A 2N9EB 2NBVB 3JYUA 4XX5A 3VXWA 2UYZB 4NJ6A 4GN1A 4NNJB 2MP2B 1UBQA 4KDIC 1K8RB 4AUQC 4AWJA 1LFDA 3HM6X 3SHQA 4II3B 4G3XB 4IWQA 4JL9A 3DQVA 4BVUC 4FADA 3LJ3A 2M4NA 1XT9B 3B1LX 1Y8RC 3PLVA 2FCNA 2KDFB 4E71A 4EUTA 1IYFA 1LQBA 5L95C 2KMAA 4EOYA 2D11A 4KSLC 3LDZE 3PRZA 4HPMB 1Z2MA 2JZ3B 3VQIA 5L83A 2ZEQA 3DDCB 1WH3A 2O6VA 3EC8A 4W9HA 3ZDMC 2WYQA 1P3QU 2O6VB 3AXCA 2KHWB 4WQOB 3KUDB 3L54A 3QA8A 4WAAA 3KUZA 4WJQA 1V6EA 3B08A 2PE6B 1H4RA 3SU8X 2KWCA 3A4RA 3M95A 3SDLC 2CKHB 4DDID 3ZDTA 2KDIA 2ZNVB 3NS8A 3DVNV 4A20A 1ZKHA 2W9NA 3M3JA 2JT4B 4NPNA 3NHEB 4KDLB 2L00B 3WAMA 5HKHA 4IWPA 3ZLZA 1WZ0A 4E3CA 1UBIA 2JRHA 2Z0DB 2ZJDA 2DAJA 1H8CA 4NQKE 2MWSB 2LRUA 2KMCA 2LASA 2KXJA 2REXA 1WX7A 4KZCA 2FAZA 1SGHA 1WX9A 2Z0EB 3L17A 4N9F4 4WJPA 3VTWA 2BWFA 2MBOA 1WGHA 4RM8A 2LI5A 1UH6A 2XK5A 1E8ZA 2DYOA 4ICVA 4KV2A 1WE7A 1L2NA 3R66C 3AI5A 2LZ6A 1E90A 2JF5A 2XK5B 3APDA 2K6QA 3H7PA 4HWIB 1NBFC 2N1VA 4HK2A 5G55A 2FNJB 1WM3A 4JGHB 3DPDA 4GIVA 3QC8B 3X0WA 1I35A 3H7PB 1PQSA 2GBNA 1OEYJ 5CX3A 4JIOU 5IA7A 2KD0A 3EHVA 2OOBB 4HXDA 3RT3B 4K7UA 2CR5A 2KK8A 2NBWB 5E6NA 4FULA 4MEMA 2UWQA 3PGEA 4ZDVA 2NCNA 4TKNA 3MHSD 3ML9A 2LJ5A 2GOWA 2FCQA 3RYTA 1J8CA 1YQBA 1ZGUB 5TR5A 4HDOA 4ASWC 2K8BA 4LJOB 2KO3A 4PYUA 2FIDA 1D3ZA 4ICUA 3VDZA 5CHVC 2RSUA 3RD2A 3VAWA 2K8HA 1V2YA 1C3TA 2JUOA 4BKGA 1J19A 1WJ6A 3PSEB 3OAWA 1P1AA 4HVBA 4PYZA 1WI0A 1V80A 4MSQB 2YLMA 4ZYNA 2I1JA 2RGFA 3BINA 4BBNF 2LVOA 2BGFA 2MSED 1S1QB 3PHXB 4RM9A 5E6PA 3WAPA 1WX8A 2IO1B 3ZKJC 2MRPA 3VTVA 2JXXA 4AJWA 2MCNB 1TBEA 3U8ZA 2MBQA 1ZW7A 2AWTA 3DBHI 2JY6A 1WGRA 4W9CA 3WA0A 3WALA 2N9PC 3VUWA 4LDTD 4IUMB 4M8NA 3VUXA 3NOBA 3UIOB 4W9DA 1WJNA 2L3ZA 3IBEA 2MQJA 2G4SA 2GBMA 1EO6A 2JPHA 2MBBB 2KX3A 3ML8A 4G50A 2FCMA 2KC1A 5KHQA 1T0YA 3PPAA 1NI2A 1L7YA 4IM0A 3IFWB 3RULA 2WDTB 4HCPB 3HHMA 3KH0A 3O65B 3W1SA 2HJ8A 2GMIC 2LD9A 3PVLA 3PS6A 4ZRJA 4XZ4A 3RCZA 5JH5C 5C23A 2DX5B 3R3MA 3ZUNA 3ENEA 1S3SG 3WAOA 2KJHB 1GC7A 3VH3B 4E74A 4W9EA 5E6OA 1CMXB 4MM3A 2IBIB 1Q5WB 2BYFA 4F7ZA 4A3PA 1WR6E 1UD7A 2RD0A 4DBGA 5D6JB 2PJHA 2BKFA 2J7QB 2A4ZA 2JVCA 4NJ7A 2KFKA 5JHBA 2N9XA 4WJNA 2FIFA 4IM2A 2KFKB 4AOFA 1MG8A 3MJWA 4MSMB 1Q1OA 1EUVB 3ZNGC 4DWFA 4WWPA 5D94A 4GOCA 2D07B 4YL8A 4II2B 4NY0A 5DPTA 3VH4B 3A1QA 2L8JA 3HK0A 3PV1A 3AU5A 3A1QB 3ZNZB 1X1MA 2BF8B 2O6VD 2JZZA 4ANXA 3N3KB 2Z59B 2ZCBA 3W1YA 4ANVA 4ANUA 4F1SA 2KN5A 2A5UA 3ZTCA 4BKTA 1WZ3A 2KJRA 2L05A 1GNUA 1VCBA 1YX6B 2D3GA 1IPGA 1UGMA 1VD2A 4EZJA 3VHTC 3DCGA 3R7QA 2R2QA 4FJYA 2MX2A 1UZXB 2GBJA 3TJPA 2C7MB 2LUEA 3APFA 4B9KA 3U7DA 1F9JA 3EFUA 2KANA 1EF5A 1SE9A 2G45B 4HDQA 2RR9A 4FN2A 2I1KA 2L0FA 1FXTB 3L16A 5GMVA 1LM8B 3H7SA 1V9JA 2B3AA 2KWVB 3JSVA 4FJZA 4I6LB 3V62A 5C1ZA 3QQ8B 3JSVB 2WWZA 2KVRA 2XEWA 4B95A 1GG3A 1KM7A 3QWZB 3VFKA 2BPSA 4FHJA 5FR6A 3ZNHB 2LGYA 3NZUA 5D7GA 4KZ0A 5J2RA 3H6NA 2V4LA 3KUCB 3IVFA 1OQYA 1WJ4A 4GXBA 1WIAA 2IO0B 3TCAA 3L10B 3RUIB 2KC2A 3AU4A 3CSTA 2LXAA 1E7UA 5LLIA 3U30A 4DHZB 4ZRKA 4WWOA 5D2MB 4F8CB 2JRIB 5KHOA 1AARA 2R2OA 4IC7B 1Q0WB 1J0GA 1U4AA 3ZRFA 4W9KA 4A3OA 2M17A 3CF6E 1KLVA 1GC6A 2MBEA 2C9WB 1WXSA 3PRPB 5DCNA 4DXAB 1WXAA 1WY8A 1WE6A 2K6DB 1TZ1A 1E7VA 3B0AA 3K9OB 3DVGX 5EDSA 3L08A 3PHWB 4K7WA 4DHJB 2FUHB 1EF1A 1LXDA 3KYDD 4B6WA 3H9DA 2K1FA 1RAXA 4BOSC 3GOEA 3DBLI 1R4MI 4KSKC 3L13A 3DVGY 3ZW3A 2KTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHJ D;  3EEC A;  3N32 A;  2NR2 A;  4FLH A;  1V81 A;  3QCA A;  4PS3 A;  3T8M A;  4CHK A;  4CO7 A;  4DK5 A;  1HE8 A;  1WGD A;  3TBL D;  1C1Y B;  2PPH A;  3ZNI D;  3TIX A;  1P98 A;  2AL6 A;  2KQS A;  1WGY A;  1WXM A;  4J6I A;  3UQA A;  3ZRC A;  1TGZ B;  1WGG A;  2EMS A;  2J0M A;  4MGZ E;  4X57 B;  1ISN A;  3ZO5 B;  4DDG D;  2DYB A;  2LVP A;  2L76 A;  2KZR A;  4JLC A;  2LWP A;  3QAR A;  3V61 A;  5AZF A;  2ZCC A;  3CSF A;  4HPL B;  2LXC A;  4TQ1 A;  3V6C B;  2LGX A;  1YJ1 A;  3I3T B;  2KNB A;  4IG7 B;  2N4F A;  3A4S C;  2BYE A;  4EZK A;  1OTR B;  4G11 A;  3C0R B;  5BO4 B;  1Z5S B;  1NDD A;  2CS4 A;  2G4D B;  1TTN A;  2MBH A;  2FCS A;  4MH0 E;  2ZPY A;  4P7I A;  1V5T A;  4M8M A;  4OVV A;  4WWN A;  5JHA A;  4OVU A;  5J17 A;  4DHZ E;  5JZE B;  3AUL A;  1WJU A;  3Q3J A;  4MEL A;  3UIP B;  2ASQ A;  3P2B A;  5AZG A;  3V6E B;  1GJZ A;  1M94 A;  2ZVN A;  4FHK A;  2GBK A;  4I6N B;  3KYC D;  4IM3 A;  4KIK A;  5DPW A;  2QHO A;  4EEW A;  2KTR A;  2XBB C;  3V60 A;  3GZN I;  3A9J A;  3DOW A;  4KIK B;  2M1M A;  1OEY A;  4NQL B;  2KTR B;  2KJ6 A;  2NS5 A;  2KFJ A;  2DHZ A;  3A9J B;  4BFR A;  2AEH A;  2IZV B;  2EKE C;  2IYD B;  2L0T A;  2NPT A;  2J0K A;  3ECI A;  4FJV B;  4LJP B;  4M0W B;  4MDK E;  4EZL A;  1QZE A;  2GBR A;  5CHF A;  2ZZP B;  2N1W A;  2NPT B;  5G2N A;  4RMA A;  3BY4 B;  4GMV A;  3H1U A;  2CHZ A;  2LRW A;  3OJ4 B;  4TV3 A;  2N7E A;  1YD8 U;  2ZNV C;  3DBR I;  3Q3F A;  1WFY A;  1WXV A;  2K25 A;  4JQW C;  3K9P B;  3VTU A;  5IAA C;  2EMT A;  2VRR B;  5AZH A;  1I42 A;  3HM3 A;  3DVN U;  4FBJ B;  3PLU A;  3UIN B;  2BKR B;  3SD5 A;  2V1Y A;  4URK A;  3OJ3 A;  3A9K A;  2ZPN A;  3NZS A;  2NVU I;  5DPS A;  4HCN B;  1V5O A;  1XD3 B;  3N30 A;  3PTF C;  2KLC A;  3A9K B;  4WJO A;  4TQ0 A;  2KWU B;  3A33 B;  2C60 A;  4IWO A;  1UEL A;  1P0R A;  2CHW A;  2ZVO A;  4ANW A;  1WM2 A;  2O2V A;  2C7H A;  3KVF B;  2HTH A;  2DZK A;  2O2V B;  2DYM A;  3IHP C;  3JW0 X;  2AL3 A;  2V3S A;  3APC A;  3JVZ X;  3UGB B;  2K39 A;  3TL5 A;  2PE9 A;  4LCD E;  2IO2 B;  3OLM D;  4XC2 A;  4GGQ A;  2IY1 B;  3UF8 A;  2IO3 B;  1XQQ A;  4MGY E;  4W9J A;  2BWE S;  4I6P A;  4PS7 A;  4EFO A;  1E5W A;  1KOT A;  1RLF A;  1GUA B;  1WMH A;  5AEK B;  2M0X A;  4MGI E;  1WMH B;  2CHX A;  3QJZ A;  2DZM A;  3ONS A;  4IW0 A;  2J0J A;  4MGK E;  2CU1 A;  2KOX A;  4PS8 A;  3VVW B;  4MJS A;  1SIF A;  2DZJ A;  2N7D A;  4GDK A;  3PT2 B;  3X23 A;  1WYW B;  5DPR A;  4GDL A;  4MJS B;  1RFA A;  4GDK B;  3PRE A;  2RPQ A;  3D32 A;  2AYO B;  4K1R B;  4GDL B;  3QX1 A;  5CTR C;  3ZTD A;  1RRB A;  4W9L A;  2K8C A;  1IP9 A;  4K81 A;  4KVG B;  2BYV E;  4ZRI A;  2IY0 B;  2HE7 A;  2Y5B B;  2KKC A;  4BOZ B;  1YX5 B;  4GSW A;  3WAN A;  2MW5 A;  3ZIM A;  1E8W A;  3M62 B;  4GB9 A;  4FA6 A;  2HD5 B;  2KDB A;  3ZVV A;  2D2Q A;  4BBN C;  2DEN B;  3ALB A;  4HJK A;  2JWZ A;  2MA9 B;  2DAF A;  1V86 A;  2LGD A;  2PEA A;  3M63 B;  1V49 A;  2YVC A;  3QIJ A;  2D10 A;  3TMP B;  3WIM A;  4EKU A;  4NAW A;  3RZF A;  5CHW A;  4W9G A;  4HLE A;  5LXH A;  3PRM B;  4NAW B;  3L0W B;  3VUY A;  4LDT B;  1WRD B;  1KJT A;  3KW5 B;  3PZD A;  3DBS A;  2KQ7 A;  3IG3 A;  4GU2 A;  1P9D U;  1YIW A;  1A5R A;  3QAQ A;  3MTN B;  2NBU A;  3CMM B;  4BKS A;  4K7S A;  2C5L C;  3W1S C;  5J18 A;  4W9I A;  3QK0 A;  2OJR A;  1BT0 A;  2KLG A;  1G6J A;  2KX0 A;  2DZI A;  3S2A A;  3T9L A;  1OGW A;  2WX0 A;  2KDE B;  4CYE A;  3RZW C;  4AP4 C;  1R4N I;  4W9F A;  2M8S A;  5LXI B;  4BKS D;  3QHT A;  1WR1 A;  3HIZ A;  1WF9 A;  1E8X A;  4TUU A;  3R7R A;  2WX1 A;  2L7R A;  1JRU A;  2MLB A;  4G0N B;  2G3Q B;  3UQB A;  4AJY B;  2LVQ A;  3NY5 A;  1E8Y A;  2C7N B;  2MP2 A;  2N9E B;  2NBV B;  3JYU A;  4XX5 A;  3VXW A;  2UYZ B;  4NJ6 A;  4GN1 A;  4NNJ B;  2MP2 B;  1UBQ A;  4KDI C;  1K8R B;  4AUQ C;  4AWJ A;  1LFD A;  3HM6 X;  3SHQ A;  4II3 B;  4G3X B;  4IWQ A;  4JL9 A;  3DQV A;  4BVU C;  4FAD A;  3LJ3 A;  2M4N A;  1XT9 B;  3B1L X;  1Y8R C;  3PLV A;  2FCN A;  2KDF B;  4E71 A;  4EUT A;  1IYF A;  1LQB A;  5L95 C;  2KMA A;  4EOY A;  2D11 A;  4KSL C;  3LDZ E;  3PRZ A;  4HPM B;  1Z2M A;  2JZ3 B;  3VQI A;  5L83 A;  2ZEQ A;  3DDC B;  1WH3 A;  2O6V A;  3EC8 A;  4W9H A;  3ZDM C;  2WYQ A;  1P3Q U;  2O6V B;  3AXC A;  2KHW B;  4WQO B;  3KUD B;  3L54 A;  3QA8 A;  4WAA A;  3KUZ A;  4WJQ A;  1V6E A;  3B08 A;  2PE6 B;  1H4R A;  3SU8 X;  2KWC A;  3A4R A;  3M95 A;  3SDL C;  2CKH B;  4DDI D;  3ZDT A;  2KDI A;  2ZNV B;  3NS8 A;  3DVN V;  4A20 A;  1ZKH A;  2W9N A;  3M3J A;  2JT4 B;  4NPN A;  3NHE B;  4KDL B;  2L00 B;  3WAM A;  5HKH A;  4IWP A;  3ZLZ A;  1WZ0 A;  4E3C A;  1UBI A;  2JRH A;  2Z0D B;  2ZJD A;  2DAJ A;  1H8C A;  4NQK E;  2MWS B;  2LRU A;  2KMC A;  2LAS A;  2KXJ A;  2REX A;  1WX7 A;  4KZC A;  2FAZ A;  1SGH A;  1WX9 A;  2Z0E B;  3L17 A;  4N9F 4;  4WJP A;  3VTW A;  2BWF A;  2MBO A;  1WGH A;  4RM8 A;  2LI5 A;  1UH6 A;  2XK5 A;  1E8Z A;  2DYO A;  4ICV A;  4KV2 A;  1WE7 A;  1L2N A;  3R66 C;  3AI5 A;  2LZ6 A;  1E90 A;  2JF5 A;  2XK5 B;  3APD A;  2K6Q A;  3H7P A;  4HWI B;  1NBF C;  2N1V A;  4HK2 A;  5G55 A;  2FNJ B;  1WM3 A;  4JGH B;  3DPD A;  4GIV A;  3QC8 B;  3X0W A;  1I35 A;  3H7P B;  1PQS A;  2GBN A;  1OEY J;  5CX3 A;  4JIO U;  5IA7 A;  2KD0 A;  3EHV A;  2OOB B;  4HXD A;  3RT3 B;  4K7U A;  2CR5 A;  2KK8 A;  2NBW B;  5E6N A;  4FUL A;  4MEM A;  2UWQ A;  3PGE A;  4ZDV A;  2NCN A;  4TKN A;  3MHS D;  3ML9 A;  2LJ5 A;  2GOW A;  2FCQ A;  3RYT A;  1J8C A;  1YQB A;  1ZGU B;  5TR5 A;  4HDO A;  4ASW C;  2K8B A;  4LJO B;  2KO3 A;  4PYU A;  2FID A;  1D3Z A;  4ICU A;  3VDZ A;  5CHV C;  2RSU A;  3RD2 A;  3VAW A;  2K8H A;  1V2Y A;  1C3T A;  2JUO A;  4BKG A;  1J19 A;  1WJ6 A;  3PSE B;  3OAW A;  1P1A A;  4HVB A;  4PYZ A;  1WI0 A;  1V80 A;  4MSQ B;  2YLM A;  4ZYN A;  2I1J A;  2RGF A;  3BIN A;  4BBN F;  2LVO A;  2BGF A;  2MSE D;  1S1Q B;  3PHX B;  4RM9 A;  5E6P A;  3WAP A;  1WX8 A;  2IO1 B;  3ZKJ C;  2MRP A;  3VTV A;  2JXX A;  4AJW A;  2MCN B;  1TBE A;  3U8Z A;  2MBQ A;  1ZW7 A;  2AWT A;  3DBH I;  2JY6 A;  1WGR A;  4W9C A;  3WA0 A;  3WAL A;  2N9P C;  3VUW A;  4LDT D;  4IUM B;  4M8N A;  3VUX A;  3NOB A;  3UIO B;  4W9D A;  1WJN A;  2L3Z A;  3IBE A;  2MQJ A;  2G4S A;  2GBM A;  1EO6 A;  2JPH A;  2MBB B;  2KX3 A;  3ML8 A;  4G50 A;  2FCM A;  2KC1 A;  5KHQ A;  1T0Y A;  3PPA A;  1NI2 A;  1L7Y A;  4IM0 A;  3IFW B;  3RUL A;  2WDT B;  4HCP B;  3HHM A;  3KH0 A;  3O65 B;  3W1S A;  2HJ8 A;  2GMI C;  2LD9 A;  3PVL A;  3PS6 A;  4ZRJ A;  4XZ4 A;  3RCZ A;  5JH5 C;  5C23 A;  2DX5 B;  3R3M A;  3ZUN A;  3ENE A;  1S3S G;  3WAO A;  2KJH B;  1GC7 A;  3VH3 B;  4E74 A;  4W9E A;  5E6O A;  1CMX B;  4MM3 A;  2IBI B;  1Q5W B;  2BYF A;  4F7Z A;  4A3P A;  1WR6 E;  1UD7 A;  2RD0 A;  4DBG A;  5D6J B;  2PJH A;  2BKF A;  2J7Q B;  2A4Z A;  2JVC A;  4NJ7 A;  2KFK A;  5JHB A;  2N9X A;  4WJN A;  2FIF A;  4IM2 A;  2KFK B;  4AOF A;  1MG8 A;  3MJW A;  4MSM B;  1Q1O A;  1EUV B;  3ZNG C;  4DWF A;  4WWP A;  5D94 A;  4GOC A;  2D07 B;  4YL8 A;  4II2 B;  4NY0 A;  5DPT A;  3VH4 B;  3A1Q A;  2L8J A;  3HK0 A;  3PV1 A;  3AU5 A;  3A1Q B;  3ZNZ B;  1X1M A;  2BF8 B;  2O6V D;  2JZZ A;  4ANX A;  3N3K B;  2Z59 B;  2ZCB A;  3W1Y A;  4ANV A;  4ANU A;  4F1S A;  2KN5 A;  2A5U A;  3ZTC A;  4BKT A;  1WZ3 A;  2KJR A;  2L05 A;  1GNU A;  1VCB A;  1YX6 B;  2D3G A;  1IPG A;  1UGM A;  1VD2 A;  4EZJ A;  3VHT C;  3DCG A;  3R7Q A;  2R2Q A;  4FJY A;  2MX2 A;  1UZX B;  2GBJ A;  3TJP A;  2C7M B;  2LUE A;  3APF A;  4B9K A;  3U7D A;  1F9J A;  3EFU A;  2KAN A;  1EF5 A;  1SE9 A;  2G45 B;  4HDQ A;  2RR9 A;  4FN2 A;  2I1K A;  2L0F A;  1FXT B;  3L16 A;  5GMV A;  1LM8 B;  3H7S A;  1V9J A;  2B3A A;  2KWV B;  3JSV A;  4FJZ A;  4I6L B;  3V62 A;  5C1Z A;  3QQ8 B;  3JSV B;  2WWZ A;  2KVR A;  2XEW A;  4B95 A;  1GG3 A;  1KM7 A;  3QWZ B;  3VFK A;  2BPS A;  4FHJ A;  5FR6 A;  3ZNH B;  2LGY A;  3NZU A;  5D7G A;  4KZ0 A;  5J2R A;  3H6N A;  2V4L A;  3KUC B;  3IVF A;  1OQY A;  1WJ4 A;  4GXB A;  1WIA A;  2IO0 B;  3TCA A;  3L10 B;  3RUI B;  2KC2 A;  3AU4 A;  3CST A;  2LXA A;  1E7U A;  5LLI A;  3U30 A;  4DHZ B;  4ZRK A;  4WWO A;  5D2M B;  4F8C B;  2JRI B;  5KHO A;  1AAR A;  2R2O A;  4IC7 B;  1Q0W B;  1J0G A;  1U4A A;  3ZRF A;  4W9K A;  4A3O A;  2M17 A;  3CF6 E;  1KLV A;  1GC6 A;  2MBE A;  2C9W B;  1WXS A;  3PRP B;  5DCN A;  4DXA B;  1WXA A;  1WY8 A;  1WE6 A;  2K6D B;  1TZ1 A;  1E7V A;  3B0A A;  3K9O B;  3DVG X;  5EDS A;  3L08 A;  3PHW B;  4K7W A;  4DHJ B;  2FUH B;  1EF1 A;  1LXD A;  3KYD D;  4B6W A;  3H9D A;  2K1F A;  1RAX A;  4BOS C;  3GOE A;  3DBL I;  1R4M I;  4KSK C;  3L13 A;  3DVG Y;  3ZW3 A;  2KTF A; 
#chains in the Genus database with same CATH topology
 2VZK B;  2QJL A;  1V81 A;  3DHG C;  3QCA A;  1M4V A;  3N9Y C;  3W9C B;  1JAL A;  3ZRC A;  1WGG A;  2EMS A;  3P4Q B;  4X57 B;  1TKY A;  2CJN A;  2L76 A;  3QAR A;  2KN4 A;  2ZCC A;  2QCZ A;  2G9H D;  4IG7 B;  2BYE A;  1NDD A;  3GB1 A;  2WS3 B;  3Q8C A;  4MH0 E;  4P7I A;  1V5T A;  4M8M A;  1F0Z A;  5J17 A;  3AUL A;  1WJU A;  3Q3J A;  4MEL A;  4C7Z A;  2NTT A;  4TSS A;  2GBK A;  2PW9 A;  5G5G A;  2QHO A;  3V60 A;  3A9J A;  4KIK B;  1ENF A;  1YQ3 B;  2KTR B;  4JPS A;  1EWY C;  2DHZ A;  4BFR A;  4A6Q A;  2DBY A;  2IZV B;  2L0T A;  2J0K A;  4M0W B;  2RPV A;  1QZE A;  2GBR A;  3TUO A;  2N1W A;  2NPT B;  2HTM E;  4GMV A;  4YTN B;  1P7E A;  1IUE A;  5BYQ A;  1JWA D;  1WFY A;  5FR3 A;  2OJW A;  1N60 A;  3J9C A;  3HM3 A;  3UIN B;  3OJ3 A;  3A9K A;  4HCN B;  1I7H A;  1AN8 A;  1C4C A;  3N30 A;  4WJO A;  2BB6 A;  1P0R A;  4ANW A;  4ITK A;  1CK1 A;  2HTH A;  3JW0 X;  5H8Y E;  2W3S A;  2PE9 A;  4LCD E;  2IO2 B;  4M00 A;  2K9X A;  2IY1 B;  3UF8 A;  2IO3 B;  2QEJ C;  4QAY A;  1WMH A;  4RGT A;  2CHX A;  5D3I B;  2J0J A;  2CU1 A;  4PS8 A;  2DZJ A;  3U4E G;  2WDR B;  3X23 A;  1JWM D;  4GDL A;  5DPR A;  4GDK B;  1FRD A;  2RPQ A;  3D32 A;  3PZ8 A;  1GB1 A;  1E7P B;  1J7B A;  2WXF A;  5BYR A;  3LB8 C;  4US8 A;  2BBC A;  2R61 A;  2MW5 A;  5HG2 A;  1E8W A;  3M62 B;  2WLB A;  2V3P A;  2D2Q A;  3ALB A;  3NVW A;  1C78 A;  2JYE A;  2WDV B;  4ZRP A;  2DAF A;  1V86 A;  1V49 A;  2YVC A;  2QIL A;  4EKU A;  4W9G A;  4HLE A;  2L32 A;  1MFW A;  5LXH A;  3L0W B;  1XEE A;  4LDT B;  1WRD B;  1KJT A;  2D5G A;  1L0X B;  3QAQ A;  2NBU A;  5LNK 1;  2BS3 B;  4NAM A;  1G6J A;  2KX0 A;  3S2A A;  3T9L A;  3AM9 A;  3RZW C;  4AP4 C;  1V1P A;  4BKS D;  3QHT A;  1WF9 A;  4TUU A;  1JRU A;  3UQB A;  1NEK B;  2C7N B;  2N9E B;  3VXW A;  3O13 A;  2QC8 A;  4WWM A;  2EKI A;  4AUQ C;  3ZJV A;  3HM6 X;  3SHQ A;  3LJ3 A;  3PLV A;  1ZOY B;  2FCN A;  2KDF B;  5L95 C;  4EOY A;  2D11 A;  3AEE B;  3PRZ A;  1Z2M A;  2M56 B;  2PKO A;  1SE3 A;  1WH3 A;  1KF6 B;  3U7Z A;  3EC8 A;  1P3Q U;  1SSN A;  2KHW B;  4XWW A;  4WQO B;  4WIP A;  1SIJ A;  1GOZ A;  2X38 A;  1HA5 A;  1N63 A;  3B08 A;  3SU8 X;  2KWC A;  3SDL C;  2MHJ A;  3DVN V;  1ZKH A;  2W9N A;  3M3J A;  4ACF A;  1N61 A;  4E3C A;  5AUK A;  1OQQ A;  2Z0D B;  4XYC A;  2W3R A;  2LRU A;  2KMC A;  3VTW A;  4KZC A;  2FAZ A;  5TSS A;  4WJP A;  4R3D A;  2BWF A;  4RM8 A;  1VR9 A;  2DYO A;  1WE7 A;  3AI5 A;  3APD A;  2JF5 A;  2XK5 B;  2K6Q A;  3AEG B;  4JGH B;  4GIV A;  1YN3 A;  3EHV A;  2CR5 A;  2KK8 A;  3TSS A;  4MEM A;  4ZDV A;  4HKZ E;  2NCN A;  2UU7 A;  3MHS D;  2CJO A;  1YQB A;  1ZGU B;  4ICU A;  3VDZ A;  3VAW A;  3B2F A;  4BKG A;  3PSE B;  4NJC A;  1P1A A;  4ARC A;  4ZYN A;  2I1J A;  3MHZ A;  4BBN F;  2BGF A;  1S1Q B;  3PHX B;  4RCO A;  1MHX A;  1WX8 A;  1TBE A;  1R4M B;  3ZXV A;  3WA0 A;  2N9P C;  1I4P A;  4RGM A;  2JQR B;  3VUX A;  3NOB A;  3UIO B;  1UNS A;  2GBM A;  3ML8 A;  5C3J B;  2FCM A;  2GI9 A;  5KHQ A;  3PPA A;  1NI2 A;  2LEK A;  1L7Y A;  4HCP B;  3DVG Y;  1CQV A;  4WQM A;  3N1X C;  3PVL A;  2LD9 A;  5JH5 C;  3RCZ A;  3IXS A;  2ZW1 A;  3WAO A;  2JSV X;  2GB1 A;  2E6X A;  4MM3 A;  1Q5W B;  4DBG A;  2WP9 B;  1F2R I;  4NJ7 A;  2KFK A;  2N9X A;  2AQ1 B;  1MG8 A;  3C8Y A;  2D07 B;  3P1M A;  5HHD G;  1OQR A;  4EE2 A;  2O6V D;  2ZCB A;  2QSD A;  2KN5 A;  4BKT A;  1CJE A;  2GRI A;  4EZJ A;  1WXQ A;  3VHT C;  3DCG A;  3R7Q A;  5IN7 A;  2IJ0 A;  2KAN A;  2G45 B;  2L0F A;  1FXT B;  5GMV A;  3Q3N C;  1V9J A;  4FJZ A;  3V62 A;  1C77 A;  3JSV B;  1JQ4 A;  2KVR A;  4RF1 A;  1GG3 A;  3EA6 A;  2BPS A;  1ZDV A;  1VDV A;  4P6V F;  1SB3 C;  2WU2 B;  4JE3 B;  1WJ4 A;  4MAC A;  1JML A;  1NYQ A;  3AU4 A;  3CST A;  3KLS X;  4DHZ B;  2D3C A;  1QOA A;  4WWO A;  1AAR A;  4W9K A;  3PZ7 A;  2M17 A;  1STE A;  3CF6 E;  2MBE A;  2C9W B;  5DCN A;  1GAQ B;  4DXA B;  1WY8 A;  2K6D B;  1TZ1 A;  3K9O B;  3I63 C;  4DHJ B;  1KLG D;  3Q2A C;  2WXQ A;  2K1F A;  1EU3 A;  3GOE A;  3ZW3 A;  4DHJ D;  3EEC A;  2MH7 A;  4CHK A;  4CO7 A;  1XLN A;  3P4R B;  3ZNI D;  3TIX A;  1WGY A;  1Q10 A;  5BMI A;  5E6J A;  2J0M A;  5C2T B;  1E0Z A;  3LXF A;  1YOV B;  3V61 A;  1ZPS A;  4HPL B;  3MP9 A;  4IOI E;  2KNB A;  2BYT A;  2XNA C;  1L4D B;  3C0R B;  2CS4 A;  2G4D B;  1TTN A;  2ZPY A;  1R4N B;  4WWN A;  4LNO A;  3TEW A;  2FBW B;  3UIP B;  1MPE A;  2ASQ A;  3P2B A;  3V6E B;  4UDU C;  2ZVN A;  1V1O A;  4IM3 A;  2XBB C;  1TKE A;  3GZN I;  3BVG A;  4HRO A;  2KJ6 A;  3GS2 A;  2NS5 A;  2KFJ A;  3ECI A;  4MDK E;  2DLB A;  1J7A A;  4HEA 1;  5CHF A;  1KRH A;  4XE0 A;  4LLG M;  4O1N A;  4C7Y A;  3IT6 B;  2LRW A;  4TV3 A;  2N7E A;  2ZNV C;  3VTU A;  1WXV A;  4JQW C;  1I42 A;  4FBJ B;  3SD5 A;  4URK A;  3AE6 B;  3PTF C;  4TQ0 A;  3A33 B;  4C80 A;  1UEL A;  2CHW A;  2O2V A;  2C7H A;  2V3N A;  3IHP C;  3P42 A;  2W82 A;  3APC A;  1NYR A;  3UGB B;  1VJK A;  1XLO A;  3OLM D;  4XC2 A;  3E56 A;  3DHH C;  2GLS A;  1XQQ A;  2BWE S;  4PS7 A;  1E5W A;  1GUA B;  2IPK D;  3Q3M C;  1F52 A;  4MGK E;  2KOX A;  3PT2 B;  3GE8 C;  1HQR D;  4MJS B;  1RFA A;  2Y5P A;  3PRE A;  3AE2 B;  3TEZ A;  5CTR C;  3QX1 A;  4XGA B;  1ESF A;  4W9L A;  2K8C A;  4KVG B;  2QDF A;  3SFD B;  4ZRI A;  1FEH A;  2HE7 A;  1WWT A;  4GB9 A;  3ZVV A;  2LGD A;  3BYT B;  1DYQ A;  3DWG C;  2D10 A;  3TMP B;  1PYW D;  4NAW B;  1GPX A;  1L6U A;  2KVZ A;  4GU2 A;  1N6Z A;  2VZK D;  2N9L A;  5BMG A;  2C5L C;  4W9I A;  3QK0 A;  1KTK A;  2DZI A;  1OGW A;  2WX0 A;  1YJJ A;  1FXI A;  3RMK C;  3HIZ A;  4OZA A;  1SEB D;  2MLB A;  2G3Q B;  1R7S A;  2LVQ A;  3NY5 A;  1L5P A;  2MP2 A;  2NBV B;  2BTE A;  1UUP A;  2PMV A;  4G3X B;  4II3 B;  2H89 B;  1DOY A;  4E71 A;  1XT9 B;  4YTP B;  1LQB A;  1L0Y B;  4US9 A;  3VR9 B;  5L83 A;  1JRO A;  2O6V A;  2OED A;  1C76 A;  4W9H A;  2WXP A;  3WCQ A;  3KUD B;  3L54 A;  1JCK B;  3ZQ4 A;  1PGB A;  3P63 A;  4WJQ A;  1XCT L;  2PE6 B;  1H4R A;  4IDI A;  2BB5 A;  3M95 A;  2CKH B;  4DDI D;  2WNM A;  2JYT A;  2KDI A;  4A20 A;  2WXM A;  3NHE B;  1FFU A;  3WAM A;  4L2Y A;  1ACC A;  2WDQ B;  5MPO A;  4YSZ B;  2Z8L A;  2DAJ A;  3IAS 1;  2MWS B;  2KXJ A;  1WX7 A;  1SGH A;  3BII D;  2SEB D;  3EUB 2;  2KYW A;  4ZYS A;  4KV2 A;  1T0Q C;  1E90 A;  1JWS D;  3BYY B;  5G55 A;  5HFY A;  2FNJ B;  3DPD A;  1I4R A;  3HVD A;  3L4P A;  3H7P B;  2VH2 A;  5IA7 A;  1JWU D;  2OOB B;  3B9J A;  4K7U A;  2NBW B;  2NTS A;  3RFZ B;  3PGE A;  1YJI A;  1IBX B;  3FIL B;  3ML9 A;  2LJ5 A;  4HJG E;  4YSY B;  1J8C A;  1BUI C;  4LJO B;  2KO3 A;  2YEP F;  4PYU A;  4L1B A;  2FID A;  1D3Z A;  3RD2 A;  1YMH E;  1C3T A;  4HVB A;  1WI0 A;  3NZ3 A;  3E9S A;  1V80 A;  4MSQ B;  3UI3 A;  2YLM A;  2RGF A;  3T3N A;  2LVO A;  3BWU D;  4RM9 A;  4B0E A;  2IO1 B;  4L23 A;  2LJI A;  3VTV A;  4AJW A;  2MCN B;  1QT9 A;  1ZW7 A;  2AWT A;  3DBH I;  2JY6 A;  2X8X X;  4C4V B;  4LDT D;  5GXG B;  5IKC M;  4IUM B;  4W9D A;  1KH0 A;  1FCC C;  3IBE A;  1SE2 A;  2MQJ A;  1JW9 D;  1EO6 A;  2JPH A;  2KX3 A;  2KC1 A;  1T0Y A;  4J3O D;  2AQ2 B;  4IM0 A;  2WDT B;  3KH0 A;  1N5X A;  4YSX B;  4XZ4 A;  5C23 A;  2DX5 B;  3R3M A;  3ZUN A;  3ENE A;  5IP4 D;  1MVK A;  1B9R A;  1GC7 A;  3VH3 B;  4E74 A;  1SJH D;  4W9E A;  2BW2 A;  4GLS C;  2IBI B;  2BYF A;  1UD7 A;  4C56 C;  2WGS A;  1ET9 A;  2RDB C;  1I4Q A;  2J7Q B;  2A4Z A;  5JHB A;  1FO4 A;  3GP7 A;  1FXA A;  4WJN A;  2K0P A;  1K53 A;  3NRZ A;  1EUV B;  3NVZ A;  4DWF A;  1SXT A;  2RMM A;  4Q2J A;  4YL8 A;  4II2 B;  3KWV A;  4NY0 A;  3FAH A;  3A1Q B;  3ZNZ B;  1VRA B;  2BF8 B;  1E9M A;  3DHI C;  4ANX A;  1I35 A;  1DOI A;  2Z59 B;  3W1Y A;  4ANU A;  3ZXR A;  4BZA A;  1WRI A;  3NVV A;  1WZ3 A;  1C4A A;  2KJR A;  1VCB A;  1NEN B;  2R2Q A;  4FJY A;  2MX2 A;  2GBJ A;  3OG5 A;  3U7D A;  5FKA C;  4ZRQ A;  3EFU A;  1SE9 A;  2RDH A;  4HDQ A;  2AX5 A;  5H92 C;  3AE1 B;  1LM8 B;  2B3A A;  4I6L B;  2WXR A;  2XEW A;  4B95 A;  3AE4 B;  3NZU A;  5D7G A;  5J2R A;  3H6N A;  2KQ4 X;  2V4L A;  1HTO A;  4XDD A;  2ZW0 A;  3L10 B;  2KC2 A;  2JX5 A;  5LLI A;  3C19 A;  4ZRK A;  3BZD B;  1J0G A;  4IC7 B;  4XDC A;  3HVZ A;  4CQN A;  3SR6 A;  2MJE A;  3KQ4 A;  4HRS A;  3V3X A;  1WXA A;  1WE6 A;  4K7W A;  1EF1 A;  4KGR A;  5HI1 A;  1RAX A;  4BOS C;  1TIF A;  3L13 A;  3N1Z C;  1I4G A;  4RF0 A;  3N32 A;  2NR2 A;  1I4X A;  4FLH A;  2Y3A A;  4PS3 A;  4DK5 A;  2J53 A;  1C1Y B;  2PPH A;  2L1A A;  1P98 A;  1K50 A;  1WXM A;  2ACZ B;  1PGA A;  3UQA A;  2ICI A;  1TGZ B;  1TY2 A;  3DBH B;  4MGZ E;  4DDG D;  3ZO5 B;  1ISN A;  2WXI A;  2LWP A;  2LXC A;  1FNU A;  2N9K A;  3I3T B;  2N4F A;  3A4S C;  4ZOH C;  4G11 A;  5BO4 B;  1Z5S B;  2MBH A;  2IGH A;  3VRA B;  5JHA A;  1MI0 A;  4OVU A;  4JX1 C;  4DHZ E;  1QOG A;  5JZE B;  5AZG A;  2WQY B;  4KIK A;  2LGI A;  5DPW A;  3KWL A;  2KTR A;  2M1M A;  3A9J B;  4M0W A;  2EKE C;  2NPT A;  4LJP B;  4EZL A;  4RMA A;  3H1U A;  3OJ4 B;  1YD8 U;  2FE8 A;  2K25 A;  5IAA C;  2EMT A;  2VRR B;  5AZH A;  1L4Z B;  1UF0 A;  1OFF A;  3PLU A;  2BKR B;  3NZS A;  2NVU I;  5DPS A;  2KLC A;  3A9K B;  1TKG A;  2KWU B;  2C60 A;  2W55 A;  1WM2 A;  4K3B A;  1TT5 B;  2DZK A;  4OZC A;  1C9F A;  1D4B A;  2V3S A;  4KKJ A;  1XXG A;  3JVZ X;  2K39 A;  3TL5 A;  2M0A A;  4MGY E;  4I6P A;  1KOT A;  2BT6 A;  1RLF A;  5EE3 A;  5AEK B;  4B0M A;  2M0X A;  4MGI E;  1WMH B;  3QJZ A;  3ONS A;  4IW0 A;  3SEB A;  3VVW B;  3SFE B;  1VZ6 A;  1VZ8 A;  2N7D A;  1YN4 A;  1FIQ A;  4GDK A;  1WYW B;  4REZ A;  4K1R B;  4GDL B;  3ZTD A;  3RNF C;  4K81 A;  3FIL A;  1XF5 L;  2IY0 B;  2Y5B B;  1E6E B;  2KKC A;  4BOZ B;  3ZIM A;  2KDB A;  1ZUD 2;  2LUM A;  4BBN C;  3B2G A;  2KAC A;  3M63 B;  2CU3 A;  2MJ3 A;  1PDX A;  3OWE B;  3WIM A;  3BK1 A;  3NUH B;  3RZF A;  5CHW A;  3PRM B;  2SAK A;  3KW5 B;  3DBS A;  3IG3 A;  4MT5 A;  3AV8 A;  2L83 A;  2ON8 A;  1A5R A;  3CMM B;  4N59 A;  4BKS A;  2PTL A;  3W1S C;  2LGS A;  4P1C C;  2I2Y A;  2KLG A;  3EFC A;  3URY A;  2LHD A;  2RDG A;  3I57 A;  4CYE A;  2HDE A;  4W9F A;  1JRP A;  4LNN A;  1V1P B;  1E8X A;  5EE0 A;  3MC0 B;  3MJ5 A;  3R7R A;  2KT7 A;  1XO3 A;  4IKG A;  4WH4 A;  4G0N B;  3Q6B A;  4AJY B;  2TSS A;  1RM6 C;  1E8Y A;  3JYU A;  4XX5 A;  2IGD A;  1LGR A;  4GN1 A;  4KDI C;  4AWJ A;  4KGT A;  2WHI A;  4IWQ A;  3VRB B;  2M4N A;  3ZJU A;  2IDY A;  2KMA A;  3LDZ E;  4HPM B;  1KFY B;  3Q14 C;  2JZ3 B;  3VQI A;  2ZEQ A;  3ETR A;  3ZDM C;  2WYQ A;  3AXC A;  1ROE A;  3AE3 B;  1RYJ A;  3KUZ A;  1RFK A;  1V6E A;  2K22 A;  2V9H A;  2QIE B;  3MC9 A;  3A4R A;  1P7F A;  4OZB A;  3ZDT A;  3RNB C;  2L00 B;  3ZLZ A;  1TZO A;  2JRH A;  2ZJD A;  4LTU A;  1H8C A;  4A55 A;  4NQK E;  2LAS A;  4N9F 4;  1WX9 A;  2MBO A;  2LI5 A;  1UH6 A;  2XK5 A;  1E8Z A;  1L2N A;  3R66 C;  2LZ6 A;  1YQ4 B;  1NBF C;  2N1V A;  4HK2 A;  1QF6 A;  3AEB B;  2W54 A;  5CX3 A;  1ZXH A;  4JIO U;  2KD0 A;  3LYY A;  4AQ7 A;  1ZP0 B;  4FUL A;  1AWD A;  4OHJ A;  3ZGZ A;  1XLQ A;  2VH1 A;  1SJE D;  4TKN A;  5T8I A;  3RYT A;  4ASW C;  5TR5 A;  4HDO A;  2K8B A;  3GE3 C;  2RSU A;  2K8H A;  1V2Y A;  1Y56 A;  1K52 A;  1J19 A;  2WXO A;  3OAW A;  4PYZ A;  1DOX A;  3CWI A;  5EE9 A;  3NVY A;  5BYS A;  3AEA B;  3WAP A;  1BXT A;  4TMA B;  3ZKJ C;  1J7C A;  2JXX A;  2I38 A;  3U8Z A;  2MBQ A;  3RNE C;  1WGR A;  3WAL A;  1B1Z A;  4A9A A;  3U52 E;  1YNT E;  2J4X A;  1TJE A;  4M8N A;  2L3Z A;  1UWM A;  4H2A A;  4G50 A;  3IFW B;  1MHH E;  1UWX A;  3W1S A;  3Q69 A;  2FUG 1;  3V05 A;  5AUI A;  4KX6 B;  4RFB A;  5E6O A;  1F2R C;  1WYG A;  5IOI A;  4A3P A;  4F7Z A;  1WR6 E;  4MM3 B;  3AH7 A;  3GZN B;  5D6J B;  1QQR A;  2BKF A;  2WXG A;  2JVC A;  2FIF A;  4IM2 A;  2KFK B;  2M19 A;  1HTQ A;  3MJW A;  1Q1O A;  1RWS A;  3ZNG C;  4YTM B;  3W5U B;  3R2T A;  3NJT A;  2WXL A;  4D2K A;  3ABV B;  3PV1 A;  2V4I B;  3AE9 B;  1T0S C;  4F1S A;  5BMH A;  3N3K B;  2L05 A;  2D3G A;  1IPG A;  3P4S B;  2E3T A;  1F1H A;  3APF A;  1F9J A;  2RR9 A;  2OHF A;  4FN2 A;  2WXH A;  2I1K A;  3RN9 C;  1WGK A;  3JSV A;  1MG4 A;  5C1Z A;  2V0G A;  2WU5 B;  1N5W A;  2WWZ A;  1BML C;  1KM7 A;  4FHJ A;  1TS3 A;  2INC C;  3KUC B;  3AN1 A;  4PK1 A;  1JWB D;  4WUR A;  4GXB A;  1WIA A;  1HZ6 A;  1XCQ L;  1EU4 A;  1E7U A;  2PVG C;  5D2M B;  2R2O A;  3IT4 B;  2WXN A;  3ZRF A;  2XN9 C;  3R8B A;  1FRR A;  1KLV A;  4KGS A;  4N58 A;  3PRP B;  1TY0 A;  3B0A A;  3FKY A;  2YEP B;  3L08 A;  3PHW B;  2FUH B;  1LXD A;  1SBB B;  3AE7 B;  3KYD D;  4B6W A;  4S0R A;  2BVC A;  3MC8 A;  3DBL I;  1FD6 A;  1R4M I;  2KTF A;  1T3Q A;  1L0V B;  1PUT A;  3T8M A;  1HE8 A;  1WGD A;  3TBL D;  1ZE3 D;  2AL6 A;  2KQS A;  4DXF A;  3Q8E A;  4J6I A;  4LK0 M;  4P1B C;  1PFD A;  3BK2 A;  2DYB A;  2LVP A;  4JLC A;  2KZR A;  2QMT A;  5AZF A;  3CSF A;  4TQ1 A;  3V6C B;  2LGX A;  1YJ1 A;  4EZK A;  1OTR B;  4K3C A;  1FNW A;  3RI7 C;  2FCS A;  1FM0 D;  2N7J A;  4OVV A;  4DXG A;  1FMA D;  1M94 A;  1F77 A;  4FHK A;  4I6N B;  3KYC D;  4EEW A;  4JWS C;  3DOW A;  3HRD D;  2IND C;  1OEY A;  1D6E C;  4NQL B;  4DQO C;  2G1E A;  2AEH A;  2IYD B;  4FJV B;  2JZP A;  2ZZP B;  5G2N A;  2EEL A;  3BY4 B;  2DWQ A;  4RGN A;  1I4H A;  2CHZ A;  3DBR I;  3Q3F A;  3K9P B;  2JWU A;  3DVN U;  2V1Y A;  2HJ1 A;  2ZPN A;  1EM7 A;  2MEK A;  1V5O A;  1XD3 B;  3PO0 A;  1D5M C;  4IWO A;  4OVZ A;  2ZVO A;  3I9V 1;  2BS4 B;  4RNA A;  1QOF A;  3KVF B;  4LNI A;  2O2V B;  2DYM A;  2NMQ A;  2AL3 A;  2LFI A;  4GGQ A;  2L52 A;  3AB5 A;  3RNG C;  5JXV A;  4W9J A;  2D3B A;  4EFO A;  2Q5W D;  5IO9 A;  1TYG B;  2JU6 X;  1LO5 D;  1A70 A;  2J52 A;  2DZM A;  1GJZ A;  4MJS A;  1SIF A;  3Q8F A;  2AYO B;  1RRB A;  4BAX A;  2B76 B;  2BYV E;  4YT0 B;  4A8X C;  3ZJT A;  1WSP A;  1IGD A;  1YX5 B;  4GSW A;  3WAN A;  2LMC A;  4FA6 A;  2HD5 B;  3FC4 A;  3RPF C;  2DEN B;  3N1Y C;  4HJK A;  2JWZ A;  2MA9 B;  1AW7 A;  2PEA A;  3I5J C;  3AEF B;  3QIJ A;  1FFV A;  4NAW A;  3IAM 1;  1V97 A;  1QLB B;  3VUY A;  3DWM A;  3RNA C;  3PZD A;  2KQ7 A;  1P9D U;  1YIW A;  2DNF A;  3CIR B;  3MTN B;  3DBL B;  4YWG G;  1N62 A;  4K7S A;  3R2I A;  5J18 A;  2OJR A;  1BT0 A;  2KDE B;  1FCL A;  1R4N I;  2M8S A;  5LXI B;  3AED B;  1WR1 A;  4A90 A;  5FK9 C;  5EE1 A;  2WX1 A;  2L7R A;  2UYZ B;  4NJ6 A;  4NNJ B;  2MP2 B;  3ZYY X;  1UBQ A;  2PVO D;  1K8R B;  1LFD A;  2J42 A;  4BVU C;  4FAD A;  4JL9 A;  3DQV A;  4USA A;  1PGX A;  3HUI A;  3AE8 B;  3B1L X;  1HXY D;  1Y8R C;  4EUT A;  1IYF A;  4S17 A;  1ZXI A;  4KSL C;  4PT5 A;  3DDC B;  3Q3O C;  4RGO S;  3W2D A;  1QIL A;  2O6V B;  1D5Z C;  3QA8 A;  4WAA A;  3DBR B;  1C4P A;  2ZNV B;  3NS8 A;  3AEC B;  4NPN A;  2JT4 B;  2ONQ A;  4KDL B;  5HKH A;  4IWP A;  1WZ0 A;  1UBI A;  1TS2 A;  1VZ7 A;  3MFG A;  2REX A;  3L17 A;  2Z0E B;  1WGH A;  2KMM A;  1ET6 A;  2N0S B;  4ICV A;  1EWC A;  1T6B X;  3N20 C;  3TEX A;  4HWI B;  3H7P A;  1SE4 A;  1WM3 A;  3QC8 B;  3X0W A;  1PQS A;  2GBN A;  1OEY J;  4XWT A;  4HXD A;  4FXC A;  3RT3 B;  1IBX A;  2H88 B;  1FPY A;  5E6N A;  4LNF A;  2UWQ A;  2LHE A;  2GOW A;  2FCQ A;  1FNV A;  3NG0 A;  1HZ5 A;  4NZL B;  4MH8 A;  2IGG A;  1XLP A;  2WXK A;  1L6V A;  5CHV C;  1V8C A;  2JUO A;  5G5H A;  1WJ6 A;  4RH6 A;  3BIN A;  2PLP A;  2MSE D;  4N6E B;  1HEZ E;  5D3D A;  5E6P A;  4JWU C;  2MRP A;  4C4V A;  3P4P B;  4W9C A;  1C79 A;  1KLU D;  3VUW A;  1WJN A;  2PIA A;  1DGJ A;  2D3A A;  2G4S A;  2MBB B;  2INP E;  4ARI A;  3U2S C;  4M02 A;  3RUL A;  3H8H A;  1T0R C;  3HHM A;  4AS1 A;  2HJ8 A;  2GMI C;  3PS6 A;  4ZRJ A;  2BS2 B;  4WAF A;  1TS5 A;  1S3S G;  3BVM A;  2KJH B;  1D5X C;  4HKQ A;  1CMX B;  1TS4 A;  4P16 A;  2RD0 A;  1QKZ A;  2PJH A;  4M01 A;  3NS1 A;  1E10 A;  4HPP A;  4AOF A;  4MSM B;  3RNC C;  4WWP A;  5D94 A;  4GOC A;  2BQQ A;  4KKI A;  3Q8A A;  3VH4 B;  5DPT A;  3A1Q A;  1T5X D;  2L8J A;  3HK0 A;  3AU5 A;  1AYF A;  1X1M A;  2JZZ A;  4ANV A;  2A5U A;  2AQ3 B;  2KWD A;  3ZTC A;  1GNU A;  1YX6 B;  1K51 A;  1UGM A;  1VD2 A;  2INN E;  1QOB A;  1UGJ A;  1UZX B;  3TJP A;  3VR8 B;  2C7M B;  2LUE A;  4B9K A;  1EF5 A;  1NI3 A;  1ZDX A;  3L16 A;  1YN5 A;  3H7S A;  2KWV B;  3AE5 B;  2JXT A;  1SF0 A;  2WXJ A;  1VLB A;  3QQ8 B;  4ZHP A;  4YXD B;  1IP9 A;  3QWZ B;  2K5P A;  3VFK A;  3ZNH B;  5FR6 A;  2LGY A;  4KZ0 A;  3IVF A;  1OQY A;  1MJD A;  1CZP A;  1IGC A;  2IO0 B;  3TCA A;  3RUI B;  2Y5C A;  2LXA A;  3U30 A;  2MJD A;  4F8C B;  2JRI B;  5KHO A;  1Q0W B;  1U4A A;  4A3O A;  3AMZ A;  1NVI D;  3W5V B;  3T3O A;  1GC6 A;  1WXS A;  3BVZ A;  4OW0 A;  2KAJ A;  3Q8B A;  4ZHO A;  1E7V A;  2KDM A;  5EDS A;  3DVG X;  3TEY A;  5I4D A;  1GB4 A;  4C00 A;  4LNK A;  3H9D A;  3EGR A;  4KSK C;  3O65 B;  2K3U A; 
#chains in the Genus database with same CATH homology
 4DHJ D;  3EEC A;  3N32 A;  2NR2 A;  4FLH A;  1V81 A;  3QCA A;  4PS3 A;  3T8M A;  4CHK A;  4CO7 A;  4DK5 A;  1HE8 A;  1WGD A;  3TBL D;  1C1Y B;  2PPH A;  3ZNI D;  3TIX A;  1P98 A;  2AL6 A;  2KQS A;  1WGY A;  1WXM A;  4J6I A;  3UQA A;  3ZRC A;  1TGZ B;  1WGG A;  2EMS A;  2J0M A;  4MGZ E;  4X57 B;  1ISN A;  3ZO5 B;  4DDG D;  2DYB A;  2LVP A;  2L76 A;  2KZR A;  4JLC A;  2LWP A;  3QAR A;  3V61 A;  5AZF A;  2ZCC A;  3CSF A;  4HPL B;  2LXC A;  4TQ1 A;  3V6C B;  2LGX A;  1YJ1 A;  3I3T B;  2KNB A;  4IG7 B;  2N4F A;  3A4S C;  2BYE A;  4EZK A;  1OTR B;  4G11 A;  3C0R B;  5BO4 B;  1Z5S B;  1NDD A;  2CS4 A;  2G4D B;  1TTN A;  2MBH A;  2FCS A;  4MH0 E;  2ZPY A;  4P7I A;  1V5T A;  4M8M A;  4OVV A;  4WWN A;  5JHA A;  4OVU A;  5J17 A;  4DHZ E;  5JZE B;  3AUL A;  1WJU A;  3Q3J A;  4MEL A;  3UIP B;  2ASQ A;  3P2B A;  5AZG A;  3V6E B;  1GJZ A;  1M94 A;  2ZVN A;  4FHK A;  2GBK A;  4I6N B;  3KYC D;  4IM3 A;  4KIK A;  5DPW A;  2QHO A;  4EEW A;  2KTR A;  2XBB C;  3V60 A;  3GZN I;  3A9J A;  3DOW A;  4KIK B;  2M1M A;  1OEY A;  4NQL B;  2KTR B;  2KJ6 A;  2NS5 A;  2KFJ A;  2DHZ A;  3A9J B;  4BFR A;  2AEH A;  2IZV B;  2EKE C;  2IYD B;  2L0T A;  2NPT A;  2J0K A;  3ECI A;  4FJV B;  4LJP B;  4M0W B;  4MDK E;  4EZL A;  1QZE A;  2GBR A;  5CHF A;  2ZZP B;  2N1W A;  2NPT B;  5G2N A;  4RMA A;  3BY4 B;  4GMV A;  3H1U A;  2CHZ A;  2LRW A;  3OJ4 B;  4TV3 A;  2N7E A;  1YD8 U;  2ZNV C;  3DBR I;  3Q3F A;  1WFY A;  1WXV A;  2K25 A;  4JQW C;  3K9P B;  3VTU A;  5IAA C;  2EMT A;  2VRR B;  5AZH A;  1I42 A;  3HM3 A;  3DVN U;  4FBJ B;  3PLU A;  3UIN B;  2BKR B;  3SD5 A;  2V1Y A;  4URK A;  3OJ3 A;  3A9K A;  2ZPN A;  3NZS A;  2NVU I;  5DPS A;  4HCN B;  1V5O A;  1XD3 B;  3N30 A;  3PTF C;  2KLC A;  3A9K B;  4WJO A;  4TQ0 A;  2KWU B;  3A33 B;  2C60 A;  4IWO A;  1UEL A;  1P0R A;  2CHW A;  2ZVO A;  4ANW A;  1WM2 A;  2O2V A;  2C7H A;  3KVF B;  2HTH A;  2DZK A;  2O2V B;  2DYM A;  3IHP C;  3JW0 X;  2AL3 A;  2V3S A;  3APC A;  3JVZ X;  3UGB B;  2K39 A;  3TL5 A;  2PE9 A;  4LCD E;  2IO2 B;  3OLM D;  4XC2 A;  4GGQ A;  2IY1 B;  3UF8 A;  2IO3 B;  1XQQ A;  4MGY E;  4W9J A;  2BWE S;  4I6P A;  4PS7 A;  4EFO A;  1E5W A;  1KOT A;  1RLF A;  1GUA B;  1WMH A;  5AEK B;  2M0X A;  4MGI E;  1WMH B;  2CHX A;  3QJZ A;  2DZM A;  3ONS A;  4IW0 A;  2J0J A;  4MGK E;  2CU1 A;  2KOX A;  4PS8 A;  3VVW B;  4MJS A;  1SIF A;  2DZJ A;  2N7D A;  4GDK A;  3PT2 B;  3X23 A;  1WYW B;  5DPR A;  4GDL A;  4MJS B;  1RFA A;  4GDK B;  3PRE A;  2RPQ A;  3D32 A;  2AYO B;  4K1R B;  4GDL B;  3QX1 A;  5CTR C;  3ZTD A;  1RRB A;  4W9L A;  2K8C A;  1IP9 A;  4K81 A;  4KVG B;  2BYV E;  4ZRI A;  2IY0 B;  2HE7 A;  2Y5B B;  2KKC A;  4BOZ B;  1YX5 B;  4GSW A;  3WAN A;  2MW5 A;  3ZIM A;  1E8W A;  3M62 B;  4GB9 A;  4FA6 A;  2HD5 B;  2KDB A;  3ZVV A;  2D2Q A;  4BBN C;  2DEN B;  3ALB A;  4HJK A;  2JWZ A;  2MA9 B;  2DAF A;  1V86 A;  2LGD A;  2PEA A;  3M63 B;  1V49 A;  2YVC A;  3QIJ A;  2D10 A;  3TMP B;  3WIM A;  4EKU A;  4NAW A;  3RZF A;  5CHW A;  4W9G A;  4HLE A;  5LXH A;  3PRM B;  4NAW B;  3L0W B;  3VUY A;  4LDT B;  1WRD B;  1KJT A;  3KW5 B;  3PZD A;  3DBS A;  2KQ7 A;  3IG3 A;  4GU2 A;  1P9D U;  1YIW A;  1A5R A;  3QAQ A;  3MTN B;  2NBU A;  3CMM B;  4BKS A;  4K7S A;  2C5L C;  3W1S C;  5J18 A;  4W9I A;  3QK0 A;  2OJR A;  1BT0 A;  2KLG A;  1G6J A;  2KX0 A;  2DZI A;  3S2A A;  3T9L A;  1OGW A;  2WX0 A;  2KDE B;  4CYE A;  3RZW C;  4AP4 C;  1R4N I;  4W9F A;  2M8S A;  5LXI B;  4BKS D;  3QHT A;  1WR1 A;  3HIZ A;  1WF9 A;  1E8X A;  4TUU A;  3R7R A;  2WX1 A;  2L7R A;  1JRU A;  2MLB A;  4G0N B;  2G3Q B;  3UQB A;  4AJY B;  2LVQ A;  3NY5 A;  1E8Y A;  2C7N B;  2MP2 A;  2N9E B;  2NBV B;  3JYU A;  4XX5 A;  3VXW A;  2UYZ B;  4NJ6 A;  4GN1 A;  4NNJ B;  2MP2 B;  1UBQ A;  4KDI C;  1K8R B;  4AUQ C;  4AWJ A;  1LFD A;  3HM6 X;  3SHQ A;  4II3 B;  4G3X B;  4IWQ A;  4JL9 A;  3DQV A;  4BVU C;  4FAD A;  3LJ3 A;  2M4N A;  1XT9 B;  3B1L X;  1Y8R C;  3PLV A;  2FCN A;  2KDF B;  4E71 A;  4EUT A;  1IYF A;  1LQB A;  5L95 C;  2KMA A;  4EOY A;  2D11 A;  4KSL C;  3LDZ E;  3PRZ A;  4HPM B;  1Z2M A;  2JZ3 B;  3VQI A;  5L83 A;  2ZEQ A;  3DDC B;  1WH3 A;  2O6V A;  3EC8 A;  4W9H A;  3ZDM C;  2WYQ A;  1P3Q U;  2O6V B;  3AXC A;  2KHW B;  4WQO B;  3KUD B;  3L54 A;  3QA8 A;  4WAA A;  3KUZ A;  4WJQ A;  1V6E A;  3B08 A;  2PE6 B;  1H4R A;  3SU8 X;  2KWC A;  3A4R A;  3M95 A;  3SDL C;  2CKH B;  4DDI D;  3ZDT A;  2KDI A;  2ZNV B;  3NS8 A;  3DVN V;  4A20 A;  1ZKH A;  2W9N A;  3M3J A;  2JT4 B;  4NPN A;  3NHE B;  4KDL B;  2L00 B;  3WAM A;  5HKH A;  4IWP A;  3ZLZ A;  1WZ0 A;  4E3C A;  1UBI A;  2JRH A;  2Z0D B;  2ZJD A;  2DAJ A;  1H8C A;  4NQK E;  2MWS B;  2LRU A;  2KMC A;  2LAS A;  2KXJ A;  2REX A;  1WX7 A;  4KZC A;  2FAZ A;  1SGH A;  1WX9 A;  2Z0E B;  3L17 A;  4N9F 4;  4WJP A;  3VTW A;  2BWF A;  2MBO A;  1WGH A;  4RM8 A;  2LI5 A;  1UH6 A;  2XK5 A;  1E8Z A;  2DYO A;  4ICV A;  4KV2 A;  1WE7 A;  1L2N A;  3R66 C;  3AI5 A;  2LZ6 A;  1E90 A;  2JF5 A;  2XK5 B;  3APD A;  2K6Q A;  3H7P A;  4HWI B;  1NBF C;  2N1V A;  4HK2 A;  5G55 A;  2FNJ B;  1WM3 A;  4JGH B;  3DPD A;  4GIV A;  3QC8 B;  3X0W A;  1I35 A;  3H7P B;  1PQS A;  2GBN A;  1OEY J;  5CX3 A;  4JIO U;  5IA7 A;  2KD0 A;  3EHV A;  2OOB B;  4HXD A;  3RT3 B;  4K7U A;  2CR5 A;  2KK8 A;  2NBW B;  5E6N A;  4FUL A;  4MEM A;  2UWQ A;  3PGE A;  4ZDV A;  2NCN A;  4TKN A;  3MHS D;  3ML9 A;  2LJ5 A;  2GOW A;  2FCQ A;  3RYT A;  1J8C A;  1YQB A;  1ZGU B;  5TR5 A;  4HDO A;  4ASW C;  2K8B A;  4LJO B;  2KO3 A;  4PYU A;  2FID A;  1D3Z A;  4ICU A;  3VDZ A;  5CHV C;  2RSU A;  3RD2 A;  3VAW A;  2K8H A;  1V2Y A;  1C3T A;  2JUO A;  4BKG A;  1J19 A;  1WJ6 A;  3PSE B;  3OAW A;  1P1A A;  4HVB A;  4PYZ A;  1WI0 A;  1V80 A;  4MSQ B;  2YLM A;  4ZYN A;  2I1J A;  2RGF A;  3BIN A;  4BBN F;  2LVO A;  2BGF A;  2MSE D;  1S1Q B;  3PHX B;  4RM9 A;  5E6P A;  3WAP A;  1WX8 A;  2IO1 B;  3ZKJ C;  2MRP A;  3VTV A;  2JXX A;  4AJW A;  2MCN B;  1TBE A;  3U8Z A;  2MBQ A;  1ZW7 A;  2AWT A;  3DBH I;  2JY6 A;  1WGR A;  4W9C A;  3WA0 A;  3WAL A;  2N9P C;  3VUW A;  4LDT D;  4IUM B;  4M8N A;  3VUX A;  3NOB A;  3UIO B;  4W9D A;  1WJN A;  2L3Z A;  3IBE A;  2MQJ A;  2G4S A;  2GBM A;  1EO6 A;  2JPH A;  2MBB B;  2KX3 A;  3ML8 A;  4G50 A;  2FCM A;  2KC1 A;  5KHQ A;  1T0Y A;  3PPA A;  1NI2 A;  1L7Y A;  4IM0 A;  3IFW B;  3RUL A;  2WDT B;  4HCP B;  3HHM A;  3KH0 A;  3O65 B;  3W1S A;  2HJ8 A;  2GMI C;  2LD9 A;  3PVL A;  3PS6 A;  4ZRJ A;  4XZ4 A;  3RCZ A;  5JH5 C;  5C23 A;  2DX5 B;  3R3M A;  3ZUN A;  3ENE A;  1S3S G;  3WAO A;  2KJH B;  1GC7 A;  3VH3 B;  4E74 A;  4W9E A;  5E6O A;  1CMX B;  4MM3 A;  2IBI B;  1Q5W B;  2BYF A;  4F7Z A;  4A3P A;  1WR6 E;  1UD7 A;  2RD0 A;  4DBG A;  5D6J B;  2PJH A;  2BKF A;  2J7Q B;  2A4Z A;  2JVC A;  4NJ7 A;  2KFK A;  5JHB A;  2N9X A;  4WJN A;  2FIF A;  4IM2 A;  2KFK B;  4AOF A;  1MG8 A;  3MJW A;  4MSM B;  1Q1O A;  1EUV B;  3ZNG C;  4DWF A;  4WWP A;  5D94 A;  4GOC A;  2D07 B;  4YL8 A;  4II2 B;  4NY0 A;  5DPT A;  3VH4 B;  3A1Q A;  2L8J A;  3HK0 A;  3PV1 A;  3AU5 A;  3A1Q B;  3ZNZ B;  1X1M A;  2BF8 B;  2O6V D;  2JZZ A;  4ANX A;  3N3K B;  2Z59 B;  2ZCB A;  3W1Y A;  4ANV A;  4ANU A;  4F1S A;  2KN5 A;  2A5U A;  3ZTC A;  4BKT A;  1WZ3 A;  2KJR A;  2L05 A;  1GNU A;  1VCB A;  1YX6 B;  2D3G A;  1IPG A;  1UGM A;  1VD2 A;  4EZJ A;  3VHT C;  3DCG A;  3R7Q A;  2R2Q A;  4FJY A;  2MX2 A;  1UZX B;  2GBJ A;  3TJP A;  2C7M B;  2LUE A;  3APF A;  4B9K A;  3U7D A;  1F9J A;  3EFU A;  2KAN A;  1EF5 A;  1SE9 A;  2G45 B;  4HDQ A;  2RR9 A;  4FN2 A;  2I1K A;  2L0F A;  1FXT B;  3L16 A;  5GMV A;  1LM8 B;  3H7S A;  1V9J A;  2B3A A;  2KWV B;  3JSV A;  4FJZ A;  4I6L B;  3V62 A;  5C1Z A;  3QQ8 B;  3JSV B;  2WWZ A;  2KVR A;  2XEW A;  4B95 A;  1GG3 A;  1KM7 A;  3QWZ B;  3VFK A;  2BPS A;  4FHJ A;  5FR6 A;  3ZNH B;  2LGY A;  3NZU A;  5D7G A;  4KZ0 A;  5J2R A;  3H6N A;  2V4L A;  3KUC B;  3IVF A;  1OQY A;  1WJ4 A;  4GXB A;  1WIA A;  2IO0 B;  3TCA A;  3L10 B;  3RUI B;  2KC2 A;  3AU4 A;  3CST A;  2LXA A;  1E7U A;  5LLI A;  3U30 A;  4DHZ B;  4ZRK A;  4WWO A;  5D2M B;  4F8C B;  2JRI B;  5KHO A;  1AAR A;  2R2O A;  4IC7 B;  1Q0W B;  1J0G A;  1U4A A;  3ZRF A;  4W9K A;  4A3O A;  2M17 A;  3CF6 E;  1KLV A;  1GC6 A;  2MBE A;  2C9W B;  1WXS A;  3PRP B;  5DCN A;  4DXA B;  1WXA A;  1WY8 A;  1WE6 A;  2K6D B;  1TZ1 A;  1E7V A;  3B0A A;  3K9O B;  3DVG X;  5EDS A;  3L08 A;  3PHW B;  4K7W A;  4DHJ B;  2FUH B;  1EF1 A;  1LXD A;  3KYD D;  4B6W A;  3H9D A;  2K1F A;  1RAX A;  4BOS C;  3GOE A;  3DBL I;  1R4M I;  4KSK C;  3L13 A;  3DVG Y;  3ZW3 A;  2KTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...