1FXAA

Crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [2FE-2S] FERREDOXIN
publication title Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxaA00
1VJKA 4C80A 2K9XA 3CWIA 1NVID 2WP9B 1NEKB 1FRRA 5EE0A 4YSXB 1ZUD2 2BS2B 1ROEA 3DWMA 5GXGB 5C2TB 2JQRB 3AB5A 2WU2B 3B2FA 2BS4B 2L52A 3AE1B 3P4QB 1QOAA 3P4RB 3BIID 1TKGA 3SFEB 3WCQA 4A9AA 4N59A 2Q5WD 1YQ4B 1B9RA 1GAQB 1NYQA 4YTMB 5EE9A 1WWTA 1XO3A 3PO0A 3L4PA 4YTNB 1XLPA 1FXAA 2MJEA 3AEDB 3FC4A 5G5GA 3W5UB 3B2GA 4ZHOA 1NYRA 1J7CA 5AUKA 1OFFA 2WDRB 4WWMA 1PDXA 5AUIA 3AE9B 4JWSC 3SFDB 1NENB 4KX6B 2DBYA 1KFYB 1JALA 5H92C 2K5PA 2WS3B 2H88B 3AE4B 3LXFA 2HTME 3ZYYX 4IDIA 1NI3A 3AV8A 3AEFB 4USAA 1R7SA 3HRDD 1SF0A 3AE6B 3AE8B 1FXIA 1RM6C 3AECB 4YTPB 1RWSA 1N60A 2H89B 1DOIA 4US9A 2K22A 1OQRA 1CJEA 1L5PA 1JRPA 2PIAA 2PVOD 1QOBA 1TJEA 2QJLA 3W5VB 3P4SB 3ETRA 1T3QA 1ZP0B 1KF6B 2ACZB 1QOFA 1L0VB 3HVZA 4ZHPA 1N5WA 5H8YE 4YSZB 3AE7B 1N61A 1DOXA 4ZOHC 1L6UA 3AM9A 3VRAB 4YXDB 1FM0D 1JWBD 2M19A 1XLNA 2M56B 1FRDA 2B76B 1SB3C 1YQ3B 2N0SB 1IUEA 2JX5A 4N6EB 1I7HA 4C7YA 2PVGC 1E6EB 1RFKA 1FMAD 2QIEB 3KWLA 1E10A 1A70A 1N62A 3NS1A 1E7PB 2BT6A 3AH7A 1EWYC 1GPXA 4YSYB 2FBWB 1JROA 1OQQA 1AYFA 3AMZA 5EE1A 3ABVB 2W54A 1TKEA 1JQ4A 3W9CB 1WRIA 2WDQB 2MJ3A 2WQYB 1QOGA 3NVWA 2WDVB 3P1MA 3P63A 3P4PB 1CZPA 3NRZA 1FIQA 1PUTA 5G5HA 1F0ZA 1QT9A 2Y5CA 3FAHA 3AEEB 2W3RA 3AEBB 3AE3B 1N5XA 1TKYA 1WXQA 3DWGC 4JX1C 2CJOA 1J7BA 3EUB2 4WQMA 3VRBB 1QLBB 4US8A 4YT0B 1DGJA 2KMMA 3AEGB 2CJNA 2KAJA 1PFDA 2BS3B 3SR6A 1FFUA 2AX5A 3NVZA 4C7ZA 5C3JB 3AE5B 3CIRB 1WGKA 1SIJA 3AN1A 1V8CA 4ITKA 4P6VF 1VLBA 1YJIA 1E0ZA 1YJJA 1JWAD 2L83A 4JWUC 1VDVA 3NVVA 2CU3A 1ZXIA 1AWDA 1RYJA 1ZOYB 2W3SA 3RPFC 3VR8B 2MH7A 3LB8C 2E3TA 3VR9B 1TYGB 2MJDA 1DOYA 2EKIA 1KRHA 2G1EA 2WLBA 3AE2B 1FO4A 4HROA 5EE3A 1WYGA 3AEAB 3NVYA 1E9MA 1XLQA 1FFVA 2LEKA 2OHFA 4FXCA 4HRSA 1L6VA 4N58A 2W55A 1QF6A 1JW9D 1J7AA 1UWMA 2DWQA 3B9JA 1V97A 2PKOA 4LTUA 1N63A 2WU5B 5MPOA 3HUIA 1XLOA
chains in the Genus database with same CATH superfamily
2DYOA 2DNFA 1V49A 2K9XA 2KLCA 2KYWA 1WE7A 3KWVA 2IPKD 2CR5A 1QOAA 3P4RB 1TGZB 3DBSA 4PYUA 3TSSA 1ESFA 5EE9A 2N7JA 2L32A 4K7SA 3Q8EA 1GC6A 1OFFA 1F77A 3AE9B 1NENB 4XE0A 1KFYB 3WAMA 3I63C 3AE4B 1MPEA 2QEJC 2NVUI 1RM6C 4ZYSA 4IC7B 4US9A 1C1YB 4MJSB 4WWPA 2X38A 1JRPA 1JWUD 2O6VA 1AARA 3A9JB 4E74A 4P7IA 2MBEA 5J17A 4KZ0A 2WXNA 2DX5B 3WA0A 3FKYA 2JWUA 4GU2A 3HM3A 2XK5A 4YSZB 2INDC 3I9V1 2Z0DB 2M19A 5LXIB 5DPTA 2R2QA 3KWLA 2E6XA 1SIFA 5JHAA 2W54A 2WQYB 3P1MA 3NRZA 4E71A 4HCPB 2PLPA 3RZWC 1I4RA 1TKYA 3OG5A 2UYZB 5AEKB 1DGJA 1ZDVA 2W9NA 4TKNA 3DHIC 1E0ZA 4HXDA 2AYOB 2CHZA 2HD5B 3WALA 4IOIE 5AZHA 2PMVA 3VR8B 4K3BA 1V1PB 1YMHE 4KVGB 3RULA 2UU7A 4MGKE 4BZAA 1IGCA 4BOZB 3BVZA 4HPPA 1SGHA 1ZKHA 1N63A 2AL6A 3PZ7A 4BAXA 1TBEA 3LJ3A 3U8ZA 4IM3A 3IBEA 3L16A 1PQSA 4GOCA 4E3CA 2JQRB 3P2BA 4FJYA 3H8HA 2BGFA 2GBKA 1YQ4B 2NR2A 4C56C 3U2SC 3ZRCA 1UBIA 3FC4A 2GBJA 5CTRC 3SFDB 4W9KA 1IYFA 3DDCB 2LD9A 1IBXA 2N1WA 4ZYNA 2REXA 1R7SA 2GBMA 2D3GA 4XYCA 3RYTA 2PTLA 5IKCM 3NG0A 1YN5A 1TJEA 3O13A 1UD7A 2G3QB 2NTTA 2YVCA 2VZKB 3H7SA 1P98A 1NDDA 3TEYA 3DVGY 3B08A 2IYDB 1SB3C 5C1ZA 4ANXA 2KTFA 2WXKA 1K50A 2QIEB 4IWPA 3ZNZB 2KKCA 2LGSA 2Y5PA 4C4VB 1F2RI 2WDVB 4GLSC 1N5XA 4W9JA 1MVKA 4WWNA 1C4PA 5BYQA 2K8BA 2KC2A 4ZRPA 4IWOA 1E7UA 2MCNB 2KFJA 3NHEB 3URYA 2CHXA 2FUG1 1XCQL 4WQOB 1FCLA 5GMVA 2KANA 3D32A 4K1RB 3ZXRA 2V0GA 2LJ5A 3N30A 1TY0A 1VD2A 1I4PA 1K8RB 3B9JA 5MPOA 1EF5A 3HUIA 3BK2A 3PTFC 3CWIA 4YSXB 4J6IA 1ZUD2 2BS2B 2INPE 3NJTA 3TL5A 2WXMA 4MH8A 2JWZA 1UUPA 3RD2A 4ASWC 1GAQB 2BF8B 1V5TA 3VTVA 4F1SA 3PRMB 4TQ0A 3R8BA 4TMAB 3AXCA 3B2GA 3BY4B 1R4MI 2K0PA 2K5PA 4P1CC 4KDIC 1BT0A 3AE8B 1ZE3D 3TUOA 3Q2AC 2I1KA 2PIAA 2WNMA 1R4MB 1V5OA 1HXYD 2N9PC 3H7PB 3ZLZA 2GOWA 1I4HA 2ACZB 2IZVB 1T6BX 3Q14C 3VTUA 3FILA 4ZOHC 5TSSA 4DDGD 1WX9A 3U30A 4DHZE 3AULA 2GBNA 5IOIA 4NJ6A 4YSYB 1WRIA 5G5HA 4C00A 4LDTD 4O1NA 4KKJA 3MC8A 2LHEA 1V6EA 2W3RA 5DCNA 3L13A 3RZFA 4WQMA 2LZ6A 2PPHA 2ZVNA 4IKGA 2XEWA 4IM0A 1MG4A 3B1LX 3R66C 1ZXIA 1SSNA 4OHJA 3TJPA 4XWTA 4BKSA 4RGOS 3RNAC 1EU3A 1HEZE 3BVGA 5IO9A 1C76A 2WDTB 2GBRA 3NVYA 3GZNI 2FCSA 1WMHA 2IGDA 4CQNA 1QF6A 3IT4B 4LTUA 2ZPYA 2LJIA 4NAWA 3SEBA 4FJVB 1XD3B 1I4GA 4PS7A 3GZNB 1TKGA 4HWIB 3W1SC 2GLSA 1NBFC 1S3SG 2J0MA 2KN4A 2V3SA 4WJPA 4TUUA 1TS2A 4OVVA 5HI1A 4RGTA 3KUDB 1SBBB 3H9DA 2SEBD 2QILA 1SF0A 4BOSC 2MHJA 3MHSD 4QAYA 3Q69A 4A8XC 4CHKA 3A9KB 3V6CB 2LGIA 3EFCA 1KLUD 1HQRD 1YQBA 1MI0A 4XDDA 4OZCA 5CHFA 1Q5WB 4RFBA 4HKZE 3RI7C 1VZ7A 1SE4A 3NZUA 2KX0A 2KFKA 3A1QB 4MDKE 2QHOA 4NQLB 1WJ6A 5FR3A 2MW5A 4MM3B 1P7EA 3KH0A 1L4ZB 1VZ8A 2IO2B 3W9CB 3P4PB 1PUTA 3B0AA 3PRPB 2IY1B 4KIKB 4MELA 2DENB 3DVNV 2MP2A 3SR6A 1FFUA 4GN1A 2DZKA 1D5XC 3OLMD 1P0RA 2KQSA 1Q10A 2L7RA 3WANA 4BKGA 1XQQA 1V86A 2BYTA 3NOBA 1FO4A 1FFVA 1UWMA 2PKOA 3RT3B 4C80A 3EC8A 5IP4D 3KW5B 3U4EG 3ONSA 2K8CA 2L52A 4A90A 3VQIA 2LRUA 2JZZA 1AN8A 1Z2MA 3ZDMC 5D2MB 4IWQA 4GB9A 5T8IA 1NYRA 5AUIA 3RNGC 3KQ4A 4OZAA 2DBYA 3AU5A 5H92C 1C4AA 2FE8A 2GB1A 3N1ZC 1RWSA 2YEPF 3C8YA 1DOIA 2M1MA 1FPYA 3PT2B 3GP7A 1FCCC 1LXDA 2MBQA 3HK0A 3C19A 2RDHA 2WXJA 1TIFA 1ZW7A 4WURA 3V62A 2CU1A 1GC7A 2KZRA 5KHOA 2LGYA 3Q6BA 4K7UA 1YQ3B 2KJHB 1E8ZA 2BT6A 1X1MA 3PV1A 5EE1A 1ISNA 2V1YA 3NVWA 3ZJTA 4HPMB 1STEA 1CZPA 4DXFA 5DPRA 2BKRB 1PGXA 1WR1A 2KX3A 4WH4A 3HHMA 3VRBB 1QLBB 1KJTA 2JRIB 2N1VA 1EM7A 4L1BA 4REZA 4MGZE 2LVOA 1AWDA 3ZNID 3DBLI 2MH7A 4LNOA 2G4SA 2C7HA 3ZVVA 2WXLA 4AP4C 1DYQA 1F9JA 3Q8CA 3QWZB 5EE3A 3AEAB 4JL9A 1G6JA 2KDMA 3APCA 1XT9B 1V97A 2KMAA 2DZIA 3DVNU 3JVZX 3DBLB 4EZKA 2LHDA 1WJ4A 1UZXB 5EE0A 4EOYA 4IW0A 3ML8A 4LLGM 2EKEC 2I38A 3WCQA 3ZIMA 2Q5WD 1UF0A 1WX8A 2M4NA 1FXAA 3L10B 1WYWB 3ZO5B 4GIVA 5KHQA 2WWZA 1RLFA 2BB6A 4AJYB 3IAS1 1NI3A 3AV8A 1OTRB 2L0TA 4ZRKA 1N60A 3APFA 4K3CA 2O2VA 2D10A 5D3IB 4K81A 2QJLA 4AQ7A 2GMIC 4LK0M 4F7ZA 3RCZA 3PZDA 2JZPA 1QOFA 3MC9A 3QX1A 1YN4A 1IGDA 4FLHA 2HJ1A 1L6UA 4YWGG 1FD6A 2LFIA 3E9SA 3KYDD 1FNUA 1E10A 4BFRA 3OJ4B 4KGRA 3DBRI 1OQQA 1JQ4A 4W9IA 1R4NI 2D5GA 3DHGC 2WDQB 4L2YA 1GG3A 1GB1A 3ML9A 2C5LC 1J7BA 2KD0A 4WIPA 2BYFA 3DBRB 2CJNA 1PFDA 4ZRIA 1R4NB 3BWUD 2LUMA 2O6VB 3VH4B 1V81A 1V8CA 3ZXVA 3PS6A 2BB5A 2HDEA 2RDBC 1ZOYB 2N4FA 2XK5B 2NTSA 2J42A 3IFWB 3VAWA 1WZ0A 4HROA 1WY8A 3Q3JA 4LJPB 2W55A 1JW9D 3VXWA 1YX5B 1JRUA 1MJDA 3O65B 5CHWA 1NVID 2WP9B 3A4RA 4P1BC 5AZFA 3AE1B 4F8CB 5E6OA 1TZOA 1GUAB 1UELA 3TEXA 1B9RA 4AWJA 1ENFA 2LI5A 1V2YA 1WRDB 2KWDA 2L3ZA 3TEZA 2MEKA 2Z8LA 2NMQA 2I2YA 4KZCA 4HCNB 3IVFA 2DLBA 3AE6B 1FXIA 3VUXA 3ZW3A 3VTWA 3SHQA 4AJWA 4DXAB 1WXAA 2WXHA 3M63B 4B95A 4X57B 4ANUA 4MSQB 2FCNA 3N1YC 3QHTA 3DBHI 4IG7B 1IPGA 2MQJA 3K9OB 1Z5SB 1MHXA 1FRDA 1WX7A 2Z59B 2G45B 2JZ3B 2K1FA 3VHTC 2PVGC 1WM2A 3DBHB 1WE6A 1E5WA 3ECIA 3NS1A 2LASA 5TR5A 4XWWA 1XXGA 1WSPA 2FBWB 1JROA 1Y56A 4FHKA 3UIPB 3ABVB 3L54A 2KOXA 3QCAA 2LVQA 1IBXB 2IGGA 3EHVA 4II2B 3I3TB 3ZUNA 1WXQA 2J53A 1VZ6A 4JQWC 1FNVA 2BS3B 3RUIB 2IO0B 1WGKA 2HTHA 3SD5A 2V3NA 2JU6X 4EKUA 3PPAA 1H8CA 3U52E 1YNTE 2LEKA 2BTEA 4FXCA 4HRSA 4N58A 2K6DB 4A20A 1QILA 5HHDG 1T0YA 4HK2A 2KN5A 1ROEA 3DWMA 2IGHA 2PEAA 3BIID 1M94A 2RSUA 4YTMB 3QA8A 1F2RC 1WWTA 1HTOA 4Q2JA 1F52A 4YTNB 4W9EA 3W2DA 3W1YA 3TMPB 1N6ZA 3NS8A 2HTME 4USAA 4XGAB 2KJ6A 1L0YB 3PGEA 1ACCA 2INNE 1K52A 2KTRA 3VUYA 4TV3A 1MG8A 1LFDA 5D7GA 3ETRA 4NJ7A 1KF6B 2EMTA 4LNFA 4EZJA 3HM6X 2N7EA 3UIOB 2KLGA 3KVFB 2DYBA 1UH6A 3IHPC 1XLNA 2ZNVB 1C79A 3EECA 2N9KA 2OOBB 1A70A 1N62A 2LRWA 2YLMA 4W9LA 1AYFA 1WM3A 4BBNC 2D11A 1E8WA 2ZPNA 4W9DA 3EFUA 2DAJA 4B0EA 2CJOA 4WAAA 2A5UA 2ZW0A 3ZQ4A 5LXHA 2HJ8A 3GOEA 1NI2A 4HJKA 5C3JB 1TS5A 1L0XB 3M3JA 1XEEA 4DDID 2L05A 3APDA 4A3OA 1JMLA 3L0WB 1LM8B 3FILB 2EKIA 2PW9A 3C0RB 4JX1C 2J4XA 1WGDA 1JCKB 4HDQA 1GB4A 1ZXHA 4IUMB 3Q8BA 3RNFC 2D3BA 5BO4B 3L4PA 1TZ1A 2JT4B 1Y8RC 3KUCB 4NZLB 4WWMA 1WH3A 5G2NA 1I4QA 3R2IA 1GOZA 4LJOB 1SJED 2L0FA 2H89B 4RM8A 4H2AA 1SJHD 3W1SA 1WMHB 2BQQA 1OQRA 1RRBA 4M02A 1OGWA 2K8HA 3PHXB 4NAWB 1FNWA 4EZLA 1T3QA 1EU4A 2C7NB 3HVZA 4ZHPA 1BMLC 2D3CA 3QJZA 2WXQA 2OJRA 1QZEA 1MHHE 1E6EB 4HEA1 1ZPSA 5JH5C 3A33B 2EMSA 2N9XA 3AMZA 1TKEA 4OZBA 2G4DB 5IN7A 1XF5L 4UDUC 3AEEB 3X23A 4G11A 4GDLA 3KYCD 1WGGA 3H6NA 1KLVA 3IG3A 1C77A 3NVZA 4WJQA 2D3AA 4A55A 3TEWA 2KMCA 3Q3FA 4JWUC 2TSSA 2QMTA 2CKHB 1J19A 3U7DA 3UQBA 5CX3A 1TYGB 4RH6A 4CO7A 2KFKB 1YOVB 2ONQA 3ZJVA 4ANVA 2L00B 2JXXA 4S0RA 2BS4B 1WXVA 1EUVB 2KQ7A 3VFKA 3Q3NC 4GDKA 3WIMA 3K9PB 2MP2B 3PO0A 1TS3A 4TQ1A 3DCGA 4ZHOA 1E90A 1XCTL 2JYEA 4B9KA 4FADA 4HLEA 3PLVA 3R2TA 3WAOA 4DWFA 2KWVB 3HRDD 2JYTA 2IO3B 4YTPB 4P16A 1YIWA 2RPVA 5JHBA 2UWQA 1OQYA 2DZMA 5I4DA 1ZP0B 4KGTA 1WF9A 2VZKD 4JLCA 3OAWA 3J9CA 3HIZA 3SU8X 3QAQA 4C7YA 3T9LA 2WXRA 2FIFA 4M0WA 2N9EB 2KDEB 5D6JB 3FAHA 3BVMA 3BZDB 1UWXA 3ZTCA 4DQOC 3MTNB 2MSED 3AEGB 4M8NA 1KTKA 3VUWA 2N9LA 2WXFA 4B6WA 4NY0A 2A4ZA 4ARCA 3ZJUA 3VH3B 1C3TA 1YD8U 4WJNA 4AOFA 2M17A 4LCDE 3JSVA 3PHWB 3JW0X 2L8JA 1DOYA 1E9MA 4MGYE 1EWCA 1WXSA 4YL8A 3QK0A 2BYVE 1I42A 1U4AA 2J52A 1VJKA 5E6PA 1L7YA 1FRRA 2JSVX 1HZ5A 1JWSD 3VVWB 2MLBA 3T3NA 2Y5BB 5BYSA 2NCNA 3CF6E 3P42A 2NPTA 1KM7A 2MWSB 4HDOA 2WXOA 1WJUA 2AEHA 3AEDB 2MJEA 1GJZA 2AQ1B 3QARA 2R2OA 2WS3B 5DPWA 3ZYYX 2G9HD 4JIOU 1V80A 1C9FA 1KH0A 2BKFA 2IBIB 3ZKJC 2KVRA 5BMIA 4J3OD 3PREA 2BBCA 5BMHA 1FXTB 4MSMB 1VR9A 3DHHC 2X8XX 3N9YC 1D6EC 1DOXA 3NZ3A 3AM9A 4RCOA 1FM0D 1JWBD 1T0RC 2LGDA 4HPLB 2RR9A 3LYYA 4NNJB 2MX2A 2MBHA 4XDCA 2KDBA 2RDGA 3NY5A 2MJ3A 2WXPA 3V60A 3R7RA 4DHZB 3PLUA 1OEYA 3NZSA 4KGSA 4US8A 1HTQA 2O2VB 2AX5A 3X0WA 4KV2A 2BYEA 3U7ZA 1A5RA 3Q8AA 3RNCC 2XBBC 2LGXA 2CU3A 2W3SA 2M8SA 2E3TA 4CYEA 5BYRA 3GB1A 4TSSA 4KDLB 2WLBA 1D4BA 1P9DU 1TT5B 2OHFA 4MJSA 3RN9C 3A9JA 2DWQA 4RF0A 2V9HA 3V6EB 2XN9C 3MHZA 4RM9A 2XNAC 2VRRB 4BKSD 1EF1A 2NBUA 1V9JA 3I5JC 2MBBB 3P4QB 1FEHA 4M00A 4A9AA 2CS4A 4N59A 3Q3OC 4N9F4 5G55A 1MFWA 2ZCCA 5HG2A 1RAXA 2J7QB 4NAMA 1P1AA 5AUKA 1WIAA 1B1ZA 2RGFA 4KX6B 2INCC 1JALA 3LXFA 1Q0WB 5C23A 2YEPB 4BBNF 1KLGD 3AECB 2WHIA 4KKIA 3M95A 2MRPA 1L5PA 2PVOD 3DPDA 2WX0A 1J8CA 3W5VB 1BXTA 2ZJDA 1V1PA 4WWOA 1E8XA 3AE7B 2C60A 2KC1A 2ZW1A 4OVUA 1WXMA 3I57A 2B76B 2N0SB 2OJWA 1L2NA 2JX5A 1I7HA 1WR6E 4FHJA 1PGAA 4AUQC 3AH7A 2L76A 1GPXA 1VRAB 4DBGA 2FCMA 4MEMA 3AEBB 2K6QA 2JUOA 4LNKA 2KAJA 2KWUB 4C7ZA 3AE5B 1SIJA 2FAZA 4P6VF 1K53A 2LMCA 5L95C 2L83A 3TIXA 4ICUA 3TCAA 3UI3A 4ANWA 3VR9B 1UGMA 4FN2A 4M8MA 2G1EA 1C78A 1WYGA 1UGJA 2DZJA 2WU5B 4ZDVA 1HZ6A 4DHJB 4RGNA 5EDSA 1F1HA 1NEKB 3AB5A 2DHZA 2IO1B 4MACA 5JZEB 4XZ4A 3RMKC 1UBQA 1LO5D 2JVCA 2N7DA 1XLPA 4KSLC 4HJGE 2LVPA 3HVDA 1L4DB 3EA6A 1PDXA 4C4VA 2NBVB 1PGBA 2WX1A 2KHWB 2LXCA 4XX5A 2B3AA 4XC2A 3N32A 4I6LB 3ZTDA 3UGBB 4K7WA 1V1OA 2Z0EB 2IJ0A 1JWMD 4WAFA 2D2QA 1SXTA 4NQKE 2K22A 4FBJB 4BKTA 5HKHA 3R3MA 2RD0A 2WGSA 3N3KB 4RGMA 4L23A 4GGQA 1L0VB 2PE6B 3V61A 4PS8A 2V4LA 1IUEA 2LXAA 3IT6B 4MGIE 2SAKA 4GMVA 5FK9C 3IXSA 1E7PB 2AQ3B 1T5XD 4JGHB 4HKQA 1HA5A 3DVGX 1QOGA 3N20C 1QT9A 2RMMA 3QQ8B 3ZNHB 3EUB2 3QIJA 5D3DA 5L83A 1ZGUB 2KXJA 5JXVA 2KTRB 1LQBA 1VLBA 4JE3B 3V3XA 2JF5A 1VDVA 3NVVA 4D2KA 1PYWD 1RYJA 3RPFC 1QKZA 2K39A 3LB8C 2ZNVC 3MJ5A 4FULA 1ZDXA 2BVCA 2KDFB 3ZNGC 1L6VA 1J7AA 4G50A 2AWTA 3RFZB 3H7PA 4FJZA 2BW2A 4ICVA 4MH0E 2WU2B 3A4SC 2WXIA 1I4XA 2RPQA 4DXGA 5FKAC 3Q8FA 1CQVA 4OVZA 2WDRB 2K25A 2ZZPB 4ARIA 2FIDA 4B0MA 2ON8A 1WGHA 3NUHB 1CJEA 4W9FA 3DQVA 1OEYJ 2KVZA 2JRHA 2J0JA 3LDZE 3S2AA 2ASQA 1I35A 5H8YE 4W9HA 3RNBC 2V3PA 3VRAB 1YX6B 2BWFA 2V4IB 4I6NB 3VDZA 4GSWA 2ZCBA 3CSTA 3GE3C 2KO3A 4EEWA 1SE3A 3L08A 1EO6A 2QC8A 3N1XC 3UQAA 1F0ZA 2Y5CA 4RNAA 1ET9A 3AE3B 1WGYA 2BPSA 1K51A 4YT0B 4ACFA 2KMMA 2KWCA 4EFOA 1D5ZC 2DYMA 3CMMB 2O6VD 3AN1A 3QC8B 3GS2A 1YJIA 2C7MB 1JWAD 3AI5A 4NPNA 2KQ4X 4IM2A 1HE8A 1AW7A 2MBOA 4G3XB 5J18A 2K3UA 1KRHA 4EE2A 2PE9A 1CK1A 5AZGA 2BWES 2KJRA 3BINA 4R3DA 3A9KA 1XLOA 1YJ1A 2GRIA 2PJHA 3IAM1 2EELA 5LLIA 1E7VA 4MT5A 2KDIA 2IDYA 3B2FA 4KSKC 2VH2A 4GDLB 4WJOA 3BYYB 1SEBD 3T3OA 3A1QA 1WZ3A 1NYQA 3OWEB 1XO3A 3PSEB 4MM3A 1IP9A 1J0GA 3CSFA 5G5GA 4DK5A 1J7CA 3E56A 1ET6A 1LGRA 2J0KA 5D94A 3ZRFA 1D5MC 3KLSX 3AU4A 4KIKA 1WJNA 3KUZA 3MFGA 3OJ3A 4PK1A 1WGRA 4FA6A 2NBWB 3P4SB 5DPSA 1SE2A 3L17A 2QSDA 1UNSA 2AL3A 2KNBA 2QDFA 4NJCA 1TY2A 3ZGZA 1N5WA 1CMXB 1N61A 2GI9A 3TBLD 1WFYA 2M56B 4GDKB 2L1AA 1RFKA 4I6PA 1GNUA 4LNNA 1YN3A 3GE8C 4RMAA 4BVUC 4RF1A 4G0NB 2M0AA 4S17A 1M4VA 4EUTA 1FIQA 2AQ2B 3WAPA 3DWGC 3UF8A 4PYZA 3BK1A 5HFYA 4DHJD 3DOWA 3EGRA 2LWPA 3T8MA 2ICIA 4W9GA 2JXTA 2C9WB 2W82A 2JY6A 3UINB 2VH1A 1TTNA 3H1UA 4PT5A 2OEDA 5FR6A 2WXGA 1WI0A 3JYUA 4ZRQA 5J2RA 3PVLA 2KT7A 2JPHA 2I1JA 4M0WB 5GXGB 5C2TB 4HVBA 3ENEA 3SFEB 4II3B 3Q3MC 1VCBA 1D3ZA 1P7FA 5CHVC 3MC0B 1H4RA 3R7QA 2ZEQA 1Q1OA 4M01A 3MP9A 2FUHB 3W5UB 2Y3AA 2IY0B 2KK8A 4JWSC 5LNK1 1E8YA 2DAFA 5IA7A 2H88B 4IDIA 2HE7A 5IAAC 3AEFB 3JSVB 3SDLC 4AS1A 4GXBA 4A6QA 1S1QB 2MA9B 1RFAA 2QCZA 3V05A 3M62B 4URKA 1P3QU 1QOBA 1KOTA 5E6JA 2FCQA 3PZ8A 3MJWA 2R61A 2WYQA 4YXDB 4A3PA 2NPTB 4N6EB 5E6NA 1FMAD 4ZRJA 1TS4A 1EWYC 2M0XA 3ALBA 4LNIA 4PS3A 3P63A 1C4CA 2NS5A 4W9CA 2LUEA 2ZVOA 3CIRB 4ITKA 2CHWA 1YJJA 3PRZA 1T0QC 1T0SC 2D07B 2KACA 1SE9A 4JPSA 2MJDA 4LDTB 2FNJB 3BYTB 3AE2B 4OW0A 3RNEC 1XLQA 1BUIC 1QQRA 5BMGA 3ZDTA
chains in the Genus database with same CATH topology
2DYOA 1HZ6A 4C80A 2K9XA 4RGNA 3U4EG 1JCKB 1NEKB 1GB4A 1ZXHA 3KWVA 2IPKD 3AB5A 4MACA 2L52A 3Q8BA 1QOAA 3P4RB 4A90A 3VQIA 1AN8A 3TSSA 1ESFA 5EE9A 1LO5D 5T8IA 3L4PA 2N7JA 1XLPA 2L32A 4HJGE 3Q8EA 1NYRA 3HVDA 1L4DB 4NZLB 1OFFA 3EA6A 1F77A 4WWMA 1PDXA 5AUIA 3AE9B 1I4QA 1PGBA 1NENB 3KQ4A 4OZAA 2DBYA 4XE0A 1KFYB 5H92C 1C4AA 3AE4B 1MPEA 3R2IA 2FE8A 1GOZA 2GB1A 1SJED 2QEJC 1V1OA 1RM6C 2IJ0A 4ZYSA 1RWSA 2H89B 2YEPF 1DOIA 1JWMD 1SJHD 3C8YA 4H2AA 4US9A 4WAFA 1SXTA 3W1SA 2K22A 1OQRA 2X38A 1JRPA 1JWUD 4NAWB 1FNWA 3GP7A 1FCCC 1T3QA 2WXNA 4RGMA 1EU4A 4L23A 2JWUA 2RDHA 2WXJA 1L0VB 3HVZA 4ZHPA 4WURA 4YSZB 1BMLC 3I9V1 2M19A 2WXQA 1YQ3B 1IUEA 1MHHE 3IT6B 1E6EB 4HEA1 1ZPSA 2SAKA 3KWLA 5FK9C 3IXSA 1E7PB 2BT6A 2E6XA 2AQ3B 1T5XD 3AMZA 4HKQA 5EE1A 2W54A 1TKEA 1HA5A 4OZBA 3NVWA 2WQYB 3P1MA 1QOGA 3ZJTA 1STEA 1CZPA 3NRZA 4DXFA 1QT9A 1XF5L 4UDUC 1PGXA 2RMMA 2PLPA 3AEEB 1I4RA 1TKYA 4WH4A 3EUB2 5D3DA 3VRBB 1QLBB 1DGJA 1ZDVA 1C77A 1EM7A 3NVZA 4L1BA 4REZA 5JXVA 4A55A 3TEWA 1E0ZA 1VLBA 4JE3B 3V3XA 4JWUC 1VDVA 2TSSA 2QMTA 3NVVA 4D2KA 1AWDA 1PYWD 1RYJA 2PMVA 4IOIE 3RPFC 3VR8B 1V1PB 1YMHE 2MH7A 1QKZA 3LB8C 2WXLA 1IGCA 1TYGB 3BVZA 4RH6A 1DYQA 3MJ5A 3Q8CA 1ZDXA 5EE3A 3AEAB 2KDMA 1L6VA 1J7AA 2ONQA 1V97A 1N63A 3PZ7A 3RFZB 3ZJVA 2LHDA 2BW2A 5EE0A 4LLGM 2JQRB 2WU2B 2BS4B 2I38A 3WCQA 3H8HA 2WXIA 2Q5WD 1YQ4B 4C56C 1I4XA 3U2SC 3PO0A 1TS3A 4TQ1A 3FC4A 1FXAA 5FKAC 4DXGA 3Q8FA 4ZHOA 1CQVA 4OVZA 1XCTL 2JYEA 2WDRB 4ARIA 3SFDB 4B0MA 3R2TA 2BB6A 3IAS1 1IBXA 1NI3A 3AV8A 2ON8A 1R7SA 3HRDD 2JYTA 4YTPB 4P16A 1N60A 2RPVA 3NUHB 2PTLA 1CJEA 5D3IB 1YN5A 1TJEA 3O13A 2QJLA 4AQ7A 2NTTA 4LK0M 5I4DA 1ZP0B 2VZKB 2JZPA 1QOFA 4KGTA 3TEYA 2VZKD 5H8YE 1YN4A 1IGDA 1L6UA 2V3PA 3VRAB 4YWGG 1FD6A 3J9CA 2LFIA 2V4IB 1SB3C 2WXKA 3E9SA 4C7YA 1FNUA 1K50A 2QIEB 1E10A 4KGRA 2WXRA 1SE3A 1OQQA 1JQ4A 2Y5PA 2D5GA 2WDQB 1F2RI 4L2YA 1GB1A 2WDVB 4M0WA 4GLSC 1F0ZA 2Y5CA 3FAHA 4RNAA 1ET9A 3BVMA 3BZDB 1UWXA 3AE3B 1N5XA 1J7BA 4DQOC 1MVKA 1K51A 4WIPA 1C4PA 4YT0B 2KMMA 3AEGB 1KTKA 1D5ZC 1PFDA 2CJNA 2DYMA 5BYQA 3BWUD 2LUMA 2N9LA 3AN1A 4ZRPA 1V8CA 3GS2A 1YJIA 2WXFA 1JWAD 2BB5A 2HDEA 4ARCA 1ZOYB 3URYA 2KQ4X 3ZJUA 1AW7A 2NTSA 2J42A 2FUG1 1XCQL 1DOYA 1FCLA 2K3UA 1KRHA 4EE2A 1CK1A 4HROA 2V0GA 1E9MA 1EWCA 2W55A 1JW9D 1TY0A 1I4PA 3B9JA 5MPOA 4R3DA 3HUIA 1XLOA 2GRIA 3BK2A 2J52A 3IAM1 1VJKA 2EELA 3CWIA 1NVID 2WP9B 4YSXB 1FRRA 2JSVX 1HZ5A 4MT5A 1ZUD2 1JWSD 2BS2B 2IDYA 2INPE 3B2FA 3AE1B 2WXMA 1TZOA 4MH8A 3T3NA 4GDLB 3BYYB 1UUPA 1SEBD 3P42A 3TEXA 5BYSA 3T3OA 1B9RA 1ENFA 1GAQB 1NYQA 3OWEB 1XO3A 4TQ0A 2WXOA 3R8BA 3AEDB 2MJEA 4TMAB 5G5GA 2KWDA 3B2GA 1J7CA 2AQ1B 3E56A 1ET6A 3TEZA 2MEKA 4XWWA 2Z8LA 2K0PA 2K5PA 2NMQA 2WS3B 3ZYYX 2G9HD 2I2YA 1D5MC 3KLSX 2DLBA 3AE6B 1FXIA 3AE8B 1ZE3D 3TUOA 1C9FA 1KH0A 3MFGA 5BMIA 2PIAA 2WXHA 2WNMA 1HXYD 4J3OD 3P4SB 1SE2A 1I4HA 2QSDA 1UNSA 2BBCA 4NJCA 2ACZB 5BMHA 1TY2A 1T6BX 1VR9A 3ZGZA 1N5WA 3N9YC 1N61A 1D6EC 1DOXA 3FILA 3NZ3A 4ZOHC 3AM9A 4RCOA 5TSSA 2GI9A 1FM0D 1JWBD 1MHXA 2M56B 1FRDA 4GDKB 3LYYA 2L1AA 2PVGC 1RFKA 1YN3A 3NS1A 4YSYB 1XXGA 1WSPA 2FBWB 1JROA 1Y56A 2M0AA 4RF1A 4XDCA 3ABVB 2RDGA 1WRIA 2MJ3A 2WXPA 1M4VA 5G5HA 1FIQA 4O1NA 2AQ2B 4KKJA 2LHEA 1IBXB 2IGGA 2W3RA 1WXQA 3DWGC 4JX1C 2J53A 4WQMA 1VZ6A 4KGSA 4US8A 4IKGA 1FNVA 2BS3B 3BK1A 2AX5A 5HFYA 3U7ZA 3EGRA 3Q8AA 1WGKA 2ICIA 2JXTA 2CU3A 1ZXIA 2V3NA 2JU6X 2W82A 2W3SA 1SSNA 4OHJA 4XWTA 4RGOS 4PT5A 1EU3A 1HEZE 2E3TA 3BVGA 2OEDA 3U52E 5BYRA 1YNTE 1C76A 3GB1A 4TSSA 2WLBA 2WXGA 1D4BA 3NVYA 2LEKA 2OHFA 4FXCA 4HRSA 4ZRQA 2BTEA 2IGDA 4N58A 4CQNA 1QF6A 1QILA 3IT4B 2DWQA 4LTUA 4RF0A 5HHDG 2LJIA 2XN9C 3MHZA 2XNAC 3SEBA 1I4GA 1ROEA 3DWMA 5GXGB 5C2TB 2IGHA 3P4QB 1FEHA 4A9AA 3BIID 1TKGA 3SFEB 4N59A 1P7FA 3MC0B 4YTMB 5HG2A 1F2RC 1WWTA 2KN4A 4Q2JA 3MP9A 4YTNB 4NAMA 3W5UB 2Y3AA 3W2DA 1TS2A 5AUKA 5HI1A 4JWSC 1B1ZA 5LNK1 4KX6B 4RGTA 1JALA 1SBBB 2H88B 3LXFA 2SEBD 2HTME 2QILA 4IDIA 2YEPB 3AEFB 4USAA 1KLGD 1SF0A 4AS1A 3AECB 4A6QA 1L0YB 4KKIA 1ACCA 3V05A 1L5PA 2INNE 3Q69A 1K52A 2PVOD 4A8XC 1QOBA 2LGIA 1KLUD 3W5VB 1HQRD 1BXTA 5E6JA 1MI0A 4XDDA 3ETRA 4OZCA 5D7GA 1KF6B 1V1PA 3PZ8A 4RFBA 4HKZE 1VZ7A 1SE4A 3AE7B 2R61A 2ZW1A 4YXDB 1XLNA 3I57A 2B76B 2N0SB 4N6EB 1C79A 5FR3A 2JX5A 2N9KA 1I7HA 1PGAA 4MM3B 1FMAD 1P7EA 1A70A 1L4ZB 1N62A 3AH7A 1TS4A 1EWYC 1GPXA 1VZ8A 1AYFA 1VRAB 3W9CB 3P4PB 3P63A 1PUTA 1C4CA 3AEBB 4B0EA 2CJOA 2ZW0A 3ZQ4A 2KAJA 3SR6A 1FFUA 4C7ZA 5C3JB 1TS5A 3AE5B 3CIRB 1SIJA 4ITKA 4P6VF 1L0XB 1K53A 2LMCA 1YJJA 2L83A 1D5XC 1XEEA 2KACA 1Q10A 3UI3A 3VR9B 4JPSA 1JMLA 2BYTA 2MJDA 3FILB 2EKIA 2G1EA 3AE2B 3BYTB 1FO4A 4OW0A 2PW9A 1C78A 1WYGA 1XLQA 1FFVA 1BUIC 1QQRA 5BMGA 1UGJA 1UWMA 2PKOA 2WU5B 2J4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJK A;  4C80 A;  2K9X A;  3CWI A;  1NVI D;  2WP9 B;  1NEK B;  1FRR A;  5EE0 A;  4YSX B;  1ZUD 2;  2BS2 B;  1ROE A;  3DWM A;  5GXG B;  5C2T B;  2JQR B;  3AB5 A;  2WU2 B;  3B2F A;  2BS4 B;  2L52 A;  3AE1 B;  3P4Q B;  1QOA A;  3P4R B;  3BII D;  1TKG A;  3SFE B;  3WCQ A;  4A9A A;  4N59 A;  2Q5W D;  1YQ4 B;  1B9R A;  1GAQ B;  1NYQ A;  4YTM B;  5EE9 A;  1WWT A;  1XO3 A;  3PO0 A;  3L4P A;  4YTN B;  1XLP A;  1FXA A;  2MJE A;  3AED B;  3FC4 A;  5G5G A;  3W5U B;  3B2G A;  4ZHO A;  1NYR A;  1J7C A;  5AUK A;  1OFF A;  2WDR B;  4WWM A;  1PDX A;  5AUI A;  3AE9 B;  4JWS C;  3SFD B;  1NEN B;  4KX6 B;  2DBY A;  1KFY B;  1JAL A;  5H92 C;  2K5P A;  2WS3 B;  2H88 B;  3AE4 B;  3LXF A;  2HTM E;  3ZYY X;  4IDI A;  1NI3 A;  3AV8 A;  3AEF B;  4USA A;  1R7S A;  3HRD D;  1SF0 A;  3AE6 B;  3AE8 B;  1FXI A;  1RM6 C;  3AEC B;  4YTP B;  1RWS A;  1N60 A;  2H89 B;  1DOI A;  4US9 A;  2K22 A;  1OQR A;  1CJE A;  1L5P A;  1JRP A;  2PIA A;  2PVO D;  1QOB A;  1TJE A;  2QJL A;  3W5V B;  3P4S B;  3ETR A;  1T3Q A;  1ZP0 B;  1KF6 B;  2ACZ B;  1QOF A;  1L0V B;  3HVZ A;  4ZHP A;  1N5W A;  5H8Y E;  4YSZ B;  3AE7 B;  1N61 A;  1DOX A;  4ZOH C;  1L6U A;  3AM9 A;  3VRA B;  4YXD B;  1FM0 D;  1JWB D;  2M19 A;  1XLN A;  2M56 B;  1FRD A;  2B76 B;  1SB3 C;  1YQ3 B;  2N0S B;  1IUE A;  2JX5 A;  4N6E B;  1I7H A;  4C7Y A;  2PVG C;  1E6E B;  1RFK A;  1FMA D;  2QIE B;  3KWL A;  1E10 A;  1A70 A;  1N62 A;  3NS1 A;  1E7P B;  2BT6 A;  3AH7 A;  1EWY C;  1GPX A;  4YSY B;  2FBW B;  1JRO A;  1OQQ A;  1AYF A;  3AMZ A;  5EE1 A;  3ABV B;  2W54 A;  1TKE A;  1JQ4 A;  3W9C B;  1WRI A;  2WDQ B;  2MJ3 A;  2WQY B;  1QOG A;  3NVW A;  2WDV B;  3P1M A;  3P63 A;  3P4P B;  1CZP A;  3NRZ A;  1FIQ A;  1PUT A;  5G5H A;  1F0Z A;  1QT9 A;  2Y5C A;  3FAH A;  3AEE B;  2W3R A;  3AEB B;  3AE3 B;  1N5X A;  1TKY A;  1WXQ A;  3DWG C;  4JX1 C;  2CJO A;  1J7B A;  3EUB 2;  4WQM A;  3VRB B;  1QLB B;  4US8 A;  4YT0 B;  1DGJ A;  2KMM A;  3AEG B;  2CJN A;  2KAJ A;  1PFD A;  2BS3 B;  3SR6 A;  1FFU A;  2AX5 A;  3NVZ A;  4C7Z A;  5C3J B;  3AE5 B;  3CIR B;  1WGK A;  1SIJ A;  3AN1 A;  1V8C A;  4ITK A;  4P6V F;  1VLB A;  1YJI A;  1E0Z A;  1YJJ A;  1JWA D;  2L83 A;  4JWU C;  1VDV A;  3NVV A;  2CU3 A;  1ZXI A;  1AWD A;  1RYJ A;  1ZOY B;  2W3S A;  3RPF C;  3VR8 B;  2MH7 A;  3LB8 C;  2E3T A;  3VR9 B;  1TYG B;  2MJD A;  1DOY A;  2EKI A;  1KRH A;  2G1E A;  2WLB A;  3AE2 B;  1FO4 A;  4HRO A;  5EE3 A;  1WYG A;  3AEA B;  3NVY A;  1E9M A;  1XLQ A;  1FFV A;  2LEK A;  2OHF A;  4FXC A;  4HRS A;  1L6V A;  4N58 A;  2W55 A;  1QF6 A;  1JW9 D;  1J7A A;  1UWM A;  2DWQ A;  3B9J A;  1V97 A;  2PKO A;  4LTU A;  1N63 A;  2WU5 B;  5MPO A;  3HUI A;  1XLO A; 
#chains in the Genus database with same CATH topology
 2DYO A;  2DNF A;  1V49 A;  2K9X A;  2KLC A;  2KYW A;  1WE7 A;  3KWV A;  2IPK D;  2CR5 A;  1QOA A;  3P4R B;  1TGZ B;  3DBS A;  4PYU A;  3TSS A;  1ESF A;  5EE9 A;  2N7J A;  2L32 A;  4K7S A;  3Q8E A;  1GC6 A;  1OFF A;  1F77 A;  3AE9 B;  1NEN B;  4XE0 A;  1KFY B;  3WAM A;  3I63 C;  3AE4 B;  1MPE A;  2QEJ C;  2NVU I;  1RM6 C;  4ZYS A;  4IC7 B;  4US9 A;  1C1Y B;  4MJS B;  4WWP A;  2X38 A;  1JRP A;  1JWU D;  2O6V A;  1AAR A;  3A9J B;  4E74 A;  4P7I A;  2MBE A;  5J17 A;  4KZ0 A;  2WXN A;  2DX5 B;  3WA0 A;  3FKY A;  2JWU A;  4GU2 A;  3HM3 A;  2XK5 A;  4YSZ B;  2IND C;  3I9V 1;  2Z0D B;  2M19 A;  5LXI B;  5DPT A;  2R2Q A;  3KWL A;  2E6X A;  1SIF A;  5JHA A;  2W54 A;  2WQY B;  3P1M A;  3NRZ A;  4E71 A;  4HCP B;  2PLP A;  3RZW C;  1I4R A;  1TKY A;  3OG5 A;  2UYZ B;  5AEK B;  1DGJ A;  1ZDV A;  2W9N A;  4TKN A;  3DHI C;  1E0Z A;  4HXD A;  2AYO B;  2CHZ A;  2HD5 B;  3WAL A;  4IOI E;  5AZH A;  2PMV A;  3VR8 B;  4K3B A;  1V1P B;  1YMH E;  4KVG B;  3RUL A;  2UU7 A;  4MGK E;  4BZA A;  1IGC A;  4BOZ B;  3BVZ A;  4HPP A;  1SGH A;  1ZKH A;  1N63 A;  2AL6 A;  3PZ7 A;  4BAX A;  1TBE A;  3LJ3 A;  3U8Z A;  4IM3 A;  3IBE A;  3L16 A;  1PQS A;  4GOC A;  4E3C A;  2JQR B;  3P2B A;  4FJY A;  3H8H A;  2BGF A;  2GBK A;  1YQ4 B;  2NR2 A;  4C56 C;  3U2S C;  3ZRC A;  1UBI A;  3FC4 A;  2GBJ A;  5CTR C;  3SFD B;  4W9K A;  1IYF A;  3DDC B;  2LD9 A;  1IBX A;  2N1W A;  4ZYN A;  2REX A;  1R7S A;  2GBM A;  2D3G A;  4XYC A;  3RYT A;  2PTL A;  5IKC M;  3NG0 A;  1YN5 A;  1TJE A;  3O13 A;  1UD7 A;  2G3Q B;  2NTT A;  2YVC A;  2VZK B;  3H7S A;  1P98 A;  1NDD A;  3TEY A;  3DVG Y;  3B08 A;  2IYD B;  1SB3 C;  5C1Z A;  4ANX A;  2KTF A;  2WXK A;  1K50 A;  2QIE B;  4IWP A;  3ZNZ B;  2KKC A;  2LGS A;  2Y5P A;  4C4V B;  1F2R I;  2WDV B;  4GLS C;  1N5X A;  4W9J A;  1MVK A;  4WWN A;  1C4P A;  5BYQ A;  2K8B A;  2KC2 A;  4ZRP A;  4IWO A;  1E7U A;  2MCN B;  2KFJ A;  3NHE B;  3URY A;  2CHX A;  2FUG 1;  1XCQ L;  4WQO B;  1FCL A;  5GMV A;  2KAN A;  3D32 A;  4K1R B;  3ZXR A;  2V0G A;  2LJ5 A;  3N30 A;  1TY0 A;  1VD2 A;  1I4P A;  1K8R B;  3B9J A;  5MPO A;  1EF5 A;  3HUI A;  3BK2 A;  3PTF C;  3CWI A;  4YSX B;  4J6I A;  1ZUD 2;  2BS2 B;  2INP E;  3NJT A;  3TL5 A;  2WXM A;  4MH8 A;  2JWZ A;  1UUP A;  3RD2 A;  4ASW C;  1GAQ B;  2BF8 B;  1V5T A;  3VTV A;  4F1S A;  3PRM B;  4TQ0 A;  3R8B A;  4TMA B;  3AXC A;  3B2G A;  3BY4 B;  1R4M I;  2K0P A;  2K5P A;  4P1C C;  4KDI C;  1BT0 A;  3AE8 B;  1ZE3 D;  3TUO A;  3Q2A C;  2I1K A;  2PIA A;  2WNM A;  1R4M B;  1V5O A;  1HXY D;  2N9P C;  3H7P B;  3ZLZ A;  2GOW A;  1I4H A;  2ACZ B;  2IZV B;  1T6B X;  3Q14 C;  3VTU A;  3FIL A;  4ZOH C;  5TSS A;  4DDG D;  1WX9 A;  3U30 A;  4DHZ E;  3AUL A;  2GBN A;  5IOI A;  4NJ6 A;  4YSY B;  1WRI A;  5G5H A;  4C00 A;  4LDT D;  4O1N A;  4KKJ A;  3MC8 A;  2LHE A;  1V6E A;  2W3R A;  5DCN A;  3L13 A;  3RZF A;  4WQM A;  2LZ6 A;  2PPH A;  2ZVN A;  4IKG A;  2XEW A;  4IM0 A;  1MG4 A;  3B1L X;  3R66 C;  1ZXI A;  1SSN A;  4OHJ A;  3TJP A;  4XWT A;  4BKS A;  4RGO S;  3RNA C;  1EU3 A;  1HEZ E;  3BVG A;  5IO9 A;  1C76 A;  2WDT B;  2GBR A;  3NVY A;  3GZN I;  2FCS A;  1WMH A;  2IGD A;  4CQN A;  1QF6 A;  3IT4 B;  4LTU A;  2ZPY A;  2LJI A;  4NAW A;  3SEB A;  4FJV B;  1XD3 B;  1I4G A;  4PS7 A;  3GZN B;  1TKG A;  4HWI B;  3W1S C;  2GLS A;  1NBF C;  1S3S G;  2J0M A;  2KN4 A;  2V3S A;  4WJP A;  4TUU A;  1TS2 A;  4OVV A;  5HI1 A;  4RGT A;  3KUD B;  1SBB B;  3H9D A;  2SEB D;  2QIL A;  1SF0 A;  4BOS C;  2MHJ A;  3MHS D;  4QAY A;  3Q69 A;  4A8X C;  4CHK A;  3A9K B;  3V6C B;  2LGI A;  3EFC A;  1KLU D;  1HQR D;  1YQB A;  1MI0 A;  4XDD A;  4OZC A;  5CHF A;  1Q5W B;  4RFB A;  4HKZ E;  3RI7 C;  1VZ7 A;  1SE4 A;  3NZU A;  2KX0 A;  2KFK A;  3A1Q B;  4MDK E;  2QHO A;  4NQL B;  1WJ6 A;  5FR3 A;  2MW5 A;  4MM3 B;  1P7E A;  3KH0 A;  1L4Z B;  1VZ8 A;  2IO2 B;  3W9C B;  3P4P B;  1PUT A;  3B0A A;  3PRP B;  2IY1 B;  4KIK B;  4MEL A;  2DEN B;  3DVN V;  2MP2 A;  3SR6 A;  1FFU A;  4GN1 A;  2DZK A;  1D5X C;  3OLM D;  1P0R A;  2KQS A;  1Q10 A;  2L7R A;  3WAN A;  4BKG A;  1XQQ A;  1V86 A;  2BYT A;  3NOB A;  1FO4 A;  1FFV A;  1UWM A;  2PKO A;  3RT3 B;  4C80 A;  3EC8 A;  5IP4 D;  3KW5 B;  3U4E G;  3ONS A;  2K8C A;  2L52 A;  4A90 A;  3VQI A;  2LRU A;  2JZZ A;  1AN8 A;  1Z2M A;  3ZDM C;  5D2M B;  4IWQ A;  4GB9 A;  5T8I A;  1NYR A;  5AUI A;  3RNG C;  3KQ4 A;  4OZA A;  2DBY A;  3AU5 A;  5H92 C;  1C4A A;  2FE8 A;  2GB1 A;  3N1Z C;  1RWS A;  2YEP F;  3C8Y A;  1DOI A;  2M1M A;  1FPY A;  3PT2 B;  3GP7 A;  1FCC C;  1LXD A;  2MBQ A;  3HK0 A;  3C19 A;  2RDH A;  2WXJ A;  1TIF A;  1ZW7 A;  4WUR A;  3V62 A;  2CU1 A;  1GC7 A;  2KZR A;  5KHO A;  2LGY A;  3Q6B A;  4K7U A;  1YQ3 B;  2KJH B;  1E8Z A;  2BT6 A;  1X1M A;  3PV1 A;  5EE1 A;  1ISN A;  2V1Y A;  3NVW A;  3ZJT A;  4HPM B;  1STE A;  1CZP A;  4DXF A;  5DPR A;  2BKR B;  1PGX A;  1WR1 A;  2KX3 A;  4WH4 A;  3HHM A;  3VRB B;  1QLB B;  1KJT A;  2JRI B;  2N1V A;  1EM7 A;  4L1B A;  4REZ A;  4MGZ E;  2LVO A;  1AWD A;  3ZNI D;  3DBL I;  2MH7 A;  4LNO A;  2G4S A;  2C7H A;  3ZVV A;  2WXL A;  4AP4 C;  1DYQ A;  1F9J A;  3Q8C A;  3QWZ B;  5EE3 A;  3AEA B;  4JL9 A;  1G6J A;  2KDM A;  3APC A;  1XT9 B;  1V97 A;  2KMA A;  2DZI A;  3DVN U;  3JVZ X;  3DBL B;  4EZK A;  2LHD A;  1WJ4 A;  1UZX B;  5EE0 A;  4EOY A;  4IW0 A;  3ML8 A;  4LLG M;  2EKE C;  2I38 A;  3WCQ A;  3ZIM A;  2Q5W D;  1UF0 A;  1WX8 A;  2M4N A;  1FXA A;  3L10 B;  1WYW B;  3ZO5 B;  4GIV A;  5KHQ A;  2WWZ A;  1RLF A;  2BB6 A;  4AJY B;  3IAS 1;  1NI3 A;  3AV8 A;  1OTR B;  2L0T A;  4ZRK A;  1N60 A;  3APF A;  4K3C A;  2O2V A;  2D10 A;  5D3I B;  4K81 A;  2QJL A;  4AQ7 A;  2GMI C;  4LK0 M;  4F7Z A;  3RCZ A;  3PZD A;  2JZP A;  1QOF A;  3MC9 A;  3QX1 A;  1YN4 A;  1IGD A;  4FLH A;  2HJ1 A;  1L6U A;  4YWG G;  1FD6 A;  2LFI A;  3E9S A;  3KYD D;  1FNU A;  1E10 A;  4BFR A;  3OJ4 B;  4KGR A;  3DBR I;  1OQQ A;  1JQ4 A;  4W9I A;  1R4N I;  2D5G A;  3DHG C;  2WDQ B;  4L2Y A;  1GG3 A;  1GB1 A;  3ML9 A;  2C5L C;  1J7B A;  2KD0 A;  4WIP A;  2BYF A;  3DBR B;  2CJN A;  1PFD A;  4ZRI A;  1R4N B;  3BWU D;  2LUM A;  2O6V B;  3VH4 B;  1V81 A;  1V8C A;  3ZXV A;  3PS6 A;  2BB5 A;  2HDE A;  2RDB C;  1ZOY B;  2N4F A;  2XK5 B;  2NTS A;  2J42 A;  3IFW B;  3VAW A;  1WZ0 A;  4HRO A;  1WY8 A;  3Q3J A;  4LJP B;  2W55 A;  1JW9 D;  3VXW A;  1YX5 B;  1JRU A;  1MJD A;  3O65 B;  5CHW A;  1NVI D;  2WP9 B;  3A4R A;  4P1B C;  5AZF A;  3AE1 B;  4F8C B;  5E6O A;  1TZO A;  1GUA B;  1UEL A;  3TEX A;  1B9R A;  4AWJ A;  1ENF A;  2LI5 A;  1V2Y A;  1WRD B;  2KWD A;  2L3Z A;  3TEZ A;  2MEK A;  2Z8L A;  2NMQ A;  2I2Y A;  4KZC A;  4HCN B;  3IVF A;  2DLB A;  3AE6 B;  1FXI A;  3VUX A;  3ZW3 A;  3VTW A;  3SHQ A;  4AJW A;  4DXA B;  1WXA A;  2WXH A;  3M63 B;  4B95 A;  4X57 B;  4ANU A;  4MSQ B;  2FCN A;  3N1Y C;  3QHT A;  3DBH I;  4IG7 B;  1IPG A;  2MQJ A;  3K9O B;  1Z5S B;  1MHX A;  1FRD A;  1WX7 A;  2Z59 B;  2G45 B;  2JZ3 B;  2K1F A;  3VHT C;  2PVG C;  1WM2 A;  3DBH B;  1WE6 A;  1E5W A;  3ECI A;  3NS1 A;  2LAS A;  5TR5 A;  4XWW A;  1XXG A;  1WSP A;  2FBW B;  1JRO A;  1Y56 A;  4FHK A;  3UIP B;  3ABV B;  3L54 A;  2KOX A;  3QCA A;  2LVQ A;  1IBX B;  2IGG A;  3EHV A;  4II2 B;  3I3T B;  3ZUN A;  1WXQ A;  2J53 A;  1VZ6 A;  4JQW C;  1FNV A;  2BS3 B;  3RUI B;  2IO0 B;  1WGK A;  2HTH A;  3SD5 A;  2V3N A;  2JU6 X;  4EKU A;  3PPA A;  1H8C A;  3U52 E;  1YNT E;  2LEK A;  2BTE A;  4FXC A;  4HRS A;  4N58 A;  2K6D B;  4A20 A;  1QIL A;  5HHD G;  1T0Y A;  4HK2 A;  2KN5 A;  1ROE A;  3DWM A;  2IGH A;  2PEA A;  3BII D;  1M94 A;  2RSU A;  4YTM B;  3QA8 A;  1F2R C;  1WWT A;  1HTO A;  4Q2J A;  1F52 A;  4YTN B;  4W9E A;  3W2D A;  3W1Y A;  3TMP B;  1N6Z A;  3NS8 A;  2HTM E;  4USA A;  4XGA B;  2KJ6 A;  1L0Y B;  3PGE A;  1ACC A;  2INN E;  1K52 A;  2KTR A;  3VUY A;  4TV3 A;  1MG8 A;  1LFD A;  5D7G A;  3ETR A;  4NJ7 A;  1KF6 B;  2EMT A;  4LNF A;  4EZJ A;  3HM6 X;  2N7E A;  3UIO B;  2KLG A;  3KVF B;  2DYB A;  1UH6 A;  3IHP C;  1XLN A;  2ZNV B;  1C79 A;  3EEC A;  2N9K A;  2OOB B;  1A70 A;  1N62 A;  2LRW A;  2YLM A;  4W9L A;  1AYF A;  1WM3 A;  4BBN C;  2D11 A;  1E8W A;  2ZPN A;  4W9D A;  3EFU A;  2DAJ A;  4B0E A;  2CJO A;  4WAA A;  2A5U A;  2ZW0 A;  3ZQ4 A;  5LXH A;  2HJ8 A;  3GOE A;  1NI2 A;  4HJK A;  5C3J B;  1TS5 A;  1L0X B;  3M3J A;  1XEE A;  4DDI D;  2L05 A;  3APD A;  4A3O A;  1JML A;  3L0W B;  1LM8 B;  3FIL B;  2EKI A;  2PW9 A;  3C0R B;  4JX1 C;  2J4X A;  1WGD A;  1JCK B;  4HDQ A;  1GB4 A;  1ZXH A;  4IUM B;  3Q8B A;  3RNF C;  2D3B A;  5BO4 B;  3L4P A;  1TZ1 A;  2JT4 B;  1Y8R C;  3KUC B;  4NZL B;  4WWM A;  1WH3 A;  5G2N A;  1I4Q A;  3R2I A;  1GOZ A;  4LJO B;  1SJE D;  2L0F A;  2H89 B;  4RM8 A;  4H2A A;  1SJH D;  3W1S A;  1WMH B;  2BQQ A;  1OQR A;  1RRB A;  4M02 A;  1OGW A;  2K8H A;  3PHX B;  4NAW B;  1FNW A;  4EZL A;  1T3Q A;  1EU4 A;  2C7N B;  3HVZ A;  4ZHP A;  1BML C;  2D3C A;  3QJZ A;  2WXQ A;  2OJR A;  1QZE A;  1MHH E;  1E6E B;  4HEA 1;  1ZPS A;  5JH5 C;  3A33 B;  2EMS A;  2N9X A;  3AMZ A;  1TKE A;  4OZB A;  2G4D B;  5IN7 A;  1XF5 L;  4UDU C;  3AEE B;  3X23 A;  4G11 A;  4GDL A;  3KYC D;  1WGG A;  3H6N A;  1KLV A;  3IG3 A;  1C77 A;  3NVZ A;  4WJQ A;  2D3A A;  4A55 A;  3TEW A;  2KMC A;  3Q3F A;  4JWU C;  2TSS A;  2QMT A;  2CKH B;  1J19 A;  3U7D A;  3UQB A;  5CX3 A;  1TYG B;  4RH6 A;  4CO7 A;  2KFK B;  1YOV B;  2ONQ A;  3ZJV A;  4ANV A;  2L00 B;  2JXX A;  4S0R A;  2BS4 B;  1WXV A;  1EUV B;  2KQ7 A;  3VFK A;  3Q3N C;  4GDK A;  3WIM A;  3K9P B;  2MP2 B;  3PO0 A;  1TS3 A;  4TQ1 A;  3DCG A;  4ZHO A;  1E90 A;  1XCT L;  2JYE A;  4B9K A;  4FAD A;  4HLE A;  3PLV A;  3R2T A;  3WAO A;  4DWF A;  2KWV B;  3HRD D;  2JYT A;  2IO3 B;  4YTP B;  4P16 A;  1YIW A;  2RPV A;  5JHB A;  2UWQ A;  1OQY A;  2DZM A;  5I4D A;  1ZP0 B;  4KGT A;  1WF9 A;  2VZK D;  4JLC A;  3OAW A;  3J9C A;  3HIZ A;  3SU8 X;  3QAQ A;  4C7Y A;  3T9L A;  2WXR A;  2FIF A;  4M0W A;  2N9E B;  2KDE B;  5D6J B;  3FAH A;  3BVM A;  3BZD B;  1UWX A;  3ZTC A;  4DQO C;  3MTN B;  2MSE D;  3AEG B;  4M8N A;  1KTK A;  3VUW A;  2N9L A;  2WXF A;  4B6W A;  4NY0 A;  2A4Z A;  4ARC A;  3ZJU A;  3VH3 B;  1C3T A;  1YD8 U;  4WJN A;  4AOF A;  2M17 A;  4LCD E;  3JSV A;  3PHW B;  3JW0 X;  2L8J A;  1DOY A;  1E9M A;  4MGY E;  1EWC A;  1WXS A;  4YL8 A;  3QK0 A;  2BYV E;  1I42 A;  1U4A A;  2J52 A;  1VJK A;  5E6P A;  1L7Y A;  1FRR A;  2JSV X;  1HZ5 A;  1JWS D;  3VVW B;  2MLB A;  3T3N A;  2Y5B B;  5BYS A;  2NCN A;  3CF6 E;  3P42 A;  2NPT A;  1KM7 A;  2MWS B;  4HDO A;  2WXO A;  1WJU A;  2AEH A;  3AED B;  2MJE A;  1GJZ A;  2AQ1 B;  3QAR A;  2R2O A;  2WS3 B;  5DPW A;  3ZYY X;  2G9H D;  4JIO U;  1V80 A;  1C9F A;  1KH0 A;  2BKF A;  2IBI B;  3ZKJ C;  2KVR A;  5BMI A;  4J3O D;  3PRE A;  2BBC A;  5BMH A;  1FXT B;  4MSM B;  1VR9 A;  3DHH C;  2X8X X;  3N9Y C;  1D6E C;  1DOX A;  3NZ3 A;  3AM9 A;  4RCO A;  1FM0 D;  1JWB D;  1T0R C;  2LGD A;  4HPL B;  2RR9 A;  3LYY A;  4NNJ B;  2MX2 A;  2MBH A;  4XDC A;  2KDB A;  2RDG A;  3NY5 A;  2MJ3 A;  2WXP A;  3V60 A;  3R7R A;  4DHZ B;  3PLU A;  1OEY A;  3NZS A;  4KGS A;  4US8 A;  1HTQ A;  2O2V B;  2AX5 A;  3X0W A;  4KV2 A;  2BYE A;  3U7Z A;  1A5R A;  3Q8A A;  3RNC C;  2XBB C;  2LGX A;  2CU3 A;  2W3S A;  2M8S A;  2E3T A;  4CYE A;  5BYR A;  3GB1 A;  4TSS A;  4KDL B;  2WLB A;  1D4B A;  1P9D U;  1TT5 B;  2OHF A;  4MJS A;  3RN9 C;  3A9J A;  2DWQ A;  4RF0 A;  2V9H A;  3V6E B;  2XN9 C;  3MHZ A;  4RM9 A;  2XNA C;  2VRR B;  4BKS D;  1EF1 A;  2NBU A;  1V9J A;  3I5J C;  2MBB B;  3P4Q B;  1FEH A;  4M00 A;  4A9A A;  2CS4 A;  4N59 A;  3Q3O C;  4N9F 4;  5G55 A;  1MFW A;  2ZCC A;  5HG2 A;  1RAX A;  2J7Q B;  4NAM A;  1P1A A;  5AUK A;  1WIA A;  1B1Z A;  2RGF A;  4KX6 B;  2INC C;  1JAL A;  3LXF A;  1Q0W B;  5C23 A;  2YEP B;  4BBN F;  1KLG D;  3AEC B;  2WHI A;  4KKI A;  3M95 A;  2MRP A;  1L5P A;  2PVO D;  3DPD A;  2WX0 A;  1J8C A;  3W5V B;  1BXT A;  2ZJD A;  1V1P A;  4WWO A;  1E8X A;  3AE7 B;  2C60 A;  2KC1 A;  2ZW1 A;  4OVU A;  1WXM A;  3I57 A;  2B76 B;  2N0S B;  2OJW A;  1L2N A;  2JX5 A;  1I7H A;  1WR6 E;  4FHJ A;  1PGA A;  4AUQ C;  3AH7 A;  2L76 A;  1GPX A;  1VRA B;  4DBG A;  2FCM A;  4MEM A;  3AEB B;  2K6Q A;  2JUO A;  4LNK A;  2KAJ A;  2KWU B;  4C7Z A;  3AE5 B;  1SIJ A;  2FAZ A;  4P6V F;  1K53 A;  2LMC A;  5L95 C;  2L83 A;  3TIX A;  4ICU A;  3TCA A;  3UI3 A;  4ANW A;  3VR9 B;  1UGM A;  4FN2 A;  4M8M A;  2G1E A;  1C78 A;  1WYG A;  1UGJ A;  2DZJ A;  2WU5 B;  4ZDV A;  1HZ6 A;  4DHJ B;  4RGN A;  5EDS A;  1F1H A;  1NEK B;  3AB5 A;  2DHZ A;  2IO1 B;  4MAC A;  5JZE B;  4XZ4 A;  3RMK C;  1UBQ A;  1LO5 D;  2JVC A;  2N7D A;  1XLP A;  4KSL C;  4HJG E;  2LVP A;  3HVD A;  1L4D B;  3EA6 A;  1PDX A;  4C4V A;  2NBV B;  1PGB A;  2WX1 A;  2KHW B;  2LXC A;  4XX5 A;  2B3A A;  4XC2 A;  3N32 A;  4I6L B;  3ZTD A;  3UGB B;  4K7W A;  1V1O A;  2Z0E B;  2IJ0 A;  1JWM D;  4WAF A;  2D2Q A;  1SXT A;  4NQK E;  2K22 A;  4FBJ B;  4BKT A;  5HKH A;  3R3M A;  2RD0 A;  2WGS A;  3N3K B;  4RGM A;  4L23 A;  4GGQ A;  1L0V B;  2PE6 B;  3V61 A;  4PS8 A;  2V4L A;  1IUE A;  2LXA A;  3IT6 B;  4MGI E;  2SAK A;  4GMV A;  5FK9 C;  3IXS A;  1E7P B;  2AQ3 B;  1T5X D;  4JGH B;  4HKQ A;  1HA5 A;  3DVG X;  1QOG A;  3N20 C;  1QT9 A;  2RMM A;  3QQ8 B;  3ZNH B;  3EUB 2;  3QIJ A;  5D3D A;  5L83 A;  1ZGU B;  2KXJ A;  5JXV A;  2KTR B;  1LQB A;  1VLB A;  4JE3 B;  3V3X A;  2JF5 A;  1VDV A;  3NVV A;  4D2K A;  1PYW D;  1RYJ A;  3RPF C;  1QKZ A;  2K39 A;  3LB8 C;  2ZNV C;  3MJ5 A;  4FUL A;  1ZDX A;  2BVC A;  2KDF B;  3ZNG C;  1L6V A;  1J7A A;  4G50 A;  2AWT A;  3RFZ B;  3H7P A;  4FJZ A;  2BW2 A;  4ICV A;  4MH0 E;  2WU2 B;  3A4S C;  2WXI A;  1I4X A;  2RPQ A;  4DXG A;  5FKA C;  3Q8F A;  1CQV A;  4OVZ A;  2WDR B;  2K25 A;  2ZZP B;  4ARI A;  2FID A;  4B0M A;  2ON8 A;  1WGH A;  3NUH B;  1CJE A;  4W9F A;  3DQV A;  1OEY J;  2KVZ A;  2JRH A;  2J0J A;  3LDZ E;  3S2A A;  2ASQ A;  1I35 A;  5H8Y E;  4W9H A;  3RNB C;  2V3P A;  3VRA B;  1YX6 B;  2BWF A;  2V4I B;  4I6N B;  3VDZ A;  4GSW A;  2ZCB A;  3CST A;  3GE3 C;  2KO3 A;  4EEW A;  1SE3 A;  3L08 A;  1EO6 A;  2QC8 A;  3N1X C;  3UQA A;  1F0Z A;  2Y5C A;  4RNA A;  1ET9 A;  3AE3 B;  1WGY A;  2BPS A;  1K51 A;  4YT0 B;  4ACF A;  2KMM A;  2KWC A;  4EFO A;  1D5Z C;  2DYM A;  3CMM B;  2O6V D;  3AN1 A;  3QC8 B;  3GS2 A;  1YJI A;  2C7M B;  1JWA D;  3AI5 A;  4NPN A;  2KQ4 X;  4IM2 A;  1HE8 A;  1AW7 A;  2MBO A;  4G3X B;  5J18 A;  2K3U A;  1KRH A;  4EE2 A;  2PE9 A;  1CK1 A;  5AZG A;  2BWE S;  2KJR A;  3BIN A;  4R3D A;  3A9K A;  1XLO A;  1YJ1 A;  2GRI A;  2PJH A;  3IAM 1;  2EEL A;  5LLI A;  1E7V A;  4MT5 A;  2KDI A;  2IDY A;  3B2F A;  4KSK C;  2VH2 A;  4GDL B;  4WJO A;  3BYY B;  1SEB D;  3T3O A;  3A1Q A;  1WZ3 A;  1NYQ A;  3OWE B;  1XO3 A;  3PSE B;  4MM3 A;  1IP9 A;  1J0G A;  3CSF A;  5G5G A;  4DK5 A;  1J7C A;  3E56 A;  1ET6 A;  1LGR A;  2J0K A;  5D94 A;  3ZRF A;  1D5M C;  3KLS X;  3AU4 A;  4KIK A;  1WJN A;  3KUZ A;  3MFG A;  3OJ3 A;  4PK1 A;  1WGR A;  4FA6 A;  2NBW B;  3P4S B;  5DPS A;  1SE2 A;  3L17 A;  2QSD A;  1UNS A;  2AL3 A;  2KNB A;  2QDF A;  4NJC A;  1TY2 A;  3ZGZ A;  1N5W A;  1CMX B;  1N61 A;  2GI9 A;  3TBL D;  1WFY A;  2M56 B;  4GDK B;  2L1A A;  1RFK A;  4I6P A;  1GNU A;  4LNN A;  1YN3 A;  3GE8 C;  4RMA A;  4BVU C;  4RF1 A;  4G0N B;  2M0A A;  4S17 A;  1M4V A;  4EUT A;  1FIQ A;  2AQ2 B;  3WAP A;  3DWG C;  3UF8 A;  4PYZ A;  3BK1 A;  5HFY A;  4DHJ D;  3DOW A;  3EGR A;  2LWP A;  3T8M A;  2ICI A;  4W9G A;  2JXT A;  2C9W B;  2W82 A;  2JY6 A;  3UIN B;  2VH1 A;  1TTN A;  3H1U A;  4PT5 A;  2OED A;  5FR6 A;  2WXG A;  1WI0 A;  3JYU A;  4ZRQ A;  5J2R A;  3PVL A;  2KT7 A;  2JPH A;  2I1J A;  4M0W B;  5GXG B;  5C2T B;  4HVB A;  3ENE A;  3SFE B;  4II3 B;  3Q3M C;  1VCB A;  1D3Z A;  1P7F A;  5CHV C;  3MC0 B;  1H4R A;  3R7Q A;  2ZEQ A;  1Q1O A;  4M01 A;  3MP9 A;  2FUH B;  3W5U B;  2Y3A A;  2IY0 B;  2KK8 A;  4JWS C;  5LNK 1;  1E8Y A;  2DAF A;  5IA7 A;  2H88 B;  4IDI A;  2HE7 A;  5IAA C;  3AEF B;  3JSV B;  3SDL C;  4AS1 A;  4GXB A;  4A6Q A;  1S1Q B;  2MA9 B;  1RFA A;  2QCZ A;  3V05 A;  3M62 B;  4URK A;  1P3Q U;  1QOB A;  1KOT A;  5E6J A;  2FCQ A;  3PZ8 A;  3MJW A;  2R61 A;  2WYQ A;  4YXD B;  4A3P A;  2NPT B;  4N6E B;  5E6N A;  1FMA D;  4ZRJ A;  1TS4 A;  1EWY C;  2M0X A;  3ALB A;  4LNI A;  4PS3 A;  3P63 A;  1C4C A;  2NS5 A;  4W9C A;  2LUE A;  2ZVO A;  3CIR B;  4ITK A;  2CHW A;  1YJJ A;  3PRZ A;  1T0Q C;  1T0S C;  2D07 B;  2KAC A;  1SE9 A;  4JPS A;  2MJD A;  4LDT B;  2FNJ B;  3BYT B;  3AE2 B;  4OW0 A;  3RNE C;  1XLQ A;  1BUI C;  1QQR A;  5BMG A;  3ZDT A; 
#chains in the Genus database with same CATH homology
 2DYO A;  1HZ6 A;  4C80 A;  2K9X A;  4RGN A;  3U4E G;  1JCK B;  1NEK B;  1GB4 A;  1ZXH A;  3KWV A;  2IPK D;  3AB5 A;  4MAC A;  2L52 A;  3Q8B A;  1QOA A;  3P4R B;  4A90 A;  3VQI A;  1AN8 A;  3TSS A;  1ESF A;  5EE9 A;  1LO5 D;  5T8I A;  3L4P A;  2N7J A;  1XLP A;  2L32 A;  4HJG E;  3Q8E A;  1NYR A;  3HVD A;  1L4D B;  4NZL B;  1OFF A;  3EA6 A;  1F77 A;  4WWM A;  1PDX A;  5AUI A;  3AE9 B;  1I4Q A;  1PGB A;  1NEN B;  3KQ4 A;  4OZA A;  2DBY A;  4XE0 A;  1KFY B;  5H92 C;  1C4A A;  3AE4 B;  1MPE A;  3R2I A;  2FE8 A;  1GOZ A;  2GB1 A;  1SJE D;  2QEJ C;  1V1O A;  1RM6 C;  2IJ0 A;  4ZYS A;  1RWS A;  2H89 B;  2YEP F;  1DOI A;  1JWM D;  1SJH D;  3C8Y A;  4H2A A;  4US9 A;  4WAF A;  1SXT A;  3W1S A;  2K22 A;  1OQR A;  2X38 A;  1JRP A;  1JWU D;  4NAW B;  1FNW A;  3GP7 A;  1FCC C;  1T3Q A;  2WXN A;  4RGM A;  1EU4 A;  4L23 A;  2JWU A;  2RDH A;  2WXJ A;  1L0V B;  3HVZ A;  4ZHP A;  4WUR A;  4YSZ B;  1BML C;  3I9V 1;  2M19 A;  2WXQ A;  1YQ3 B;  1IUE A;  1MHH E;  3IT6 B;  1E6E B;  4HEA 1;  1ZPS A;  2SAK A;  3KWL A;  5FK9 C;  3IXS A;  1E7P B;  2BT6 A;  2E6X A;  2AQ3 B;  1T5X D;  3AMZ A;  4HKQ A;  5EE1 A;  2W54 A;  1TKE A;  1HA5 A;  4OZB A;  3NVW A;  2WQY B;  3P1M A;  1QOG A;  3ZJT A;  1STE A;  1CZP A;  3NRZ A;  4DXF A;  1QT9 A;  1XF5 L;  4UDU C;  1PGX A;  2RMM A;  2PLP A;  3AEE B;  1I4R A;  1TKY A;  4WH4 A;  3EUB 2;  5D3D A;  3VRB B;  1QLB B;  1DGJ A;  1ZDV A;  1C77 A;  1EM7 A;  3NVZ A;  4L1B A;  4REZ A;  5JXV A;  4A55 A;  3TEW A;  1E0Z A;  1VLB A;  4JE3 B;  3V3X A;  4JWU C;  1VDV A;  2TSS A;  2QMT A;  3NVV A;  4D2K A;  1AWD A;  1PYW D;  1RYJ A;  2PMV A;  4IOI E;  3RPF C;  3VR8 B;  1V1P B;  1YMH E;  2MH7 A;  1QKZ A;  3LB8 C;  2WXL A;  1IGC A;  1TYG B;  3BVZ A;  4RH6 A;  1DYQ A;  3MJ5 A;  3Q8C A;  1ZDX A;  5EE3 A;  3AEA B;  2KDM A;  1L6V A;  1J7A A;  2ONQ A;  1V97 A;  1N63 A;  3PZ7 A;  3RFZ B;  3ZJV A;  2LHD A;  2BW2 A;  5EE0 A;  4LLG M;  2JQR B;  2WU2 B;  2BS4 B;  2I38 A;  3WCQ A;  3H8H A;  2WXI A;  2Q5W D;  1YQ4 B;  4C56 C;  1I4X A;  3U2S C;  3PO0 A;  1TS3 A;  4TQ1 A;  3FC4 A;  1FXA A;  5FKA C;  4DXG A;  3Q8F A;  4ZHO A;  1CQV A;  4OVZ A;  1XCT L;  2JYE A;  2WDR B;  4ARI A;  3SFD B;  4B0M A;  3R2T A;  2BB6 A;  3IAS 1;  1IBX A;  1NI3 A;  3AV8 A;  2ON8 A;  1R7S A;  3HRD D;  2JYT A;  4YTP B;  4P16 A;  1N60 A;  2RPV A;  3NUH B;  2PTL A;  1CJE A;  5D3I B;  1YN5 A;  1TJE A;  3O13 A;  2QJL A;  4AQ7 A;  2NTT A;  4LK0 M;  5I4D A;  1ZP0 B;  2VZK B;  2JZP A;  1QOF A;  4KGT A;  3TEY A;  2VZK D;  5H8Y E;  1YN4 A;  1IGD A;  1L6U A;  2V3P A;  3VRA B;  4YWG G;  1FD6 A;  3J9C A;  2LFI A;  2V4I B;  1SB3 C;  2WXK A;  3E9S A;  4C7Y A;  1FNU A;  1K50 A;  2QIE B;  1E10 A;  4KGR A;  2WXR A;  1SE3 A;  1OQQ A;  1JQ4 A;  2Y5P A;  2D5G A;  2WDQ B;  1F2R I;  4L2Y A;  1GB1 A;  2WDV B;  4M0W A;  4GLS C;  1F0Z A;  2Y5C A;  3FAH A;  4RNA A;  1ET9 A;  3BVM A;  3BZD B;  1UWX A;  3AE3 B;  1N5X A;  1J7B A;  4DQO C;  1MVK A;  1K51 A;  4WIP A;  1C4P A;  4YT0 B;  2KMM A;  3AEG B;  1KTK A;  1D5Z C;  1PFD A;  2CJN A;  2DYM A;  5BYQ A;  3BWU D;  2LUM A;  2N9L A;  3AN1 A;  4ZRP A;  1V8C A;  3GS2 A;  1YJI A;  2WXF A;  1JWA D;  2BB5 A;  2HDE A;  4ARC A;  1ZOY B;  3URY A;  2KQ4 X;  3ZJU A;  1AW7 A;  2NTS A;  2J42 A;  2FUG 1;  1XCQ L;  1DOY A;  1FCL A;  2K3U A;  1KRH A;  4EE2 A;  1CK1 A;  4HRO A;  2V0G A;  1E9M A;  1EWC A;  2W55 A;  1JW9 D;  1TY0 A;  1I4P A;  3B9J A;  5MPO A;  4R3D A;  3HUI A;  1XLO A;  2GRI A;  3BK2 A;  2J52 A;  3IAM 1;  1VJK A;  2EEL A;  3CWI A;  1NVI D;  2WP9 B;  4YSX B;  1FRR A;  2JSV X;  1HZ5 A;  4MT5 A;  1ZUD 2;  1JWS D;  2BS2 B;  2IDY A;  2INP E;  3B2F A;  3AE1 B;  2WXM A;  1TZO A;  4MH8 A;  3T3N A;  4GDL B;  3BYY B;  1UUP A;  1SEB D;  3P42 A;  3TEX A;  5BYS A;  3T3O A;  1B9R A;  1ENF A;  1GAQ B;  1NYQ A;  3OWE B;  1XO3 A;  4TQ0 A;  2WXO A;  3R8B A;  3AED B;  2MJE A;  4TMA B;  5G5G A;  2KWD A;  3B2G A;  1J7C A;  2AQ1 B;  3E56 A;  1ET6 A;  3TEZ A;  2MEK A;  4XWW A;  2Z8L A;  2K0P A;  2K5P A;  2NMQ A;  2WS3 B;  3ZYY X;  2G9H D;  2I2Y A;  1D5M C;  3KLS X;  2DLB A;  3AE6 B;  1FXI A;  3AE8 B;  1ZE3 D;  3TUO A;  1C9F A;  1KH0 A;  3MFG A;  5BMI A;  2PIA A;  2WXH A;  2WNM A;  1HXY D;  4J3O D;  3P4S B;  1SE2 A;  1I4H A;  2QSD A;  1UNS A;  2BBC A;  4NJC A;  2ACZ B;  5BMH A;  1TY2 A;  1T6B X;  1VR9 A;  3ZGZ A;  1N5W A;  3N9Y C;  1N61 A;  1D6E C;  1DOX A;  3FIL A;  3NZ3 A;  4ZOH C;  3AM9 A;  4RCO A;  5TSS A;  2GI9 A;  1FM0 D;  1JWB D;  1MHX A;  2M56 B;  1FRD A;  4GDK B;  3LYY A;  2L1A A;  2PVG C;  1RFK A;  1YN3 A;  3NS1 A;  4YSY B;  1XXG A;  1WSP A;  2FBW B;  1JRO A;  1Y56 A;  2M0A A;  4RF1 A;  4XDC A;  3ABV B;  2RDG A;  1WRI A;  2MJ3 A;  2WXP A;  1M4V A;  5G5H A;  1FIQ A;  4O1N A;  2AQ2 B;  4KKJ A;  2LHE A;  1IBX B;  2IGG A;  2W3R A;  1WXQ A;  3DWG C;  4JX1 C;  2J53 A;  4WQM A;  1VZ6 A;  4KGS A;  4US8 A;  4IKG A;  1FNV A;  2BS3 B;  3BK1 A;  2AX5 A;  5HFY A;  3U7Z A;  3EGR A;  3Q8A A;  1WGK A;  2ICI A;  2JXT A;  2CU3 A;  1ZXI A;  2V3N A;  2JU6 X;  2W82 A;  2W3S A;  1SSN A;  4OHJ A;  4XWT A;  4RGO S;  4PT5 A;  1EU3 A;  1HEZ E;  2E3T A;  3BVG A;  2OED A;  3U52 E;  5BYR A;  1YNT E;  1C76 A;  3GB1 A;  4TSS A;  2WLB A;  2WXG A;  1D4B A;  3NVY A;  2LEK A;  2OHF A;  4FXC A;  4HRS A;  4ZRQ A;  2BTE A;  2IGD A;  4N58 A;  4CQN A;  1QF6 A;  1QIL A;  3IT4 B;  2DWQ A;  4LTU A;  4RF0 A;  5HHD G;  2LJI A;  2XN9 C;  3MHZ A;  2XNA C;  3SEB A;  1I4G A;  1ROE A;  3DWM A;  5GXG B;  5C2T B;  2IGH A;  3P4Q B;  1FEH A;  4A9A A;  3BII D;  1TKG A;  3SFE B;  4N59 A;  1P7F A;  3MC0 B;  4YTM B;  5HG2 A;  1F2R C;  1WWT A;  2KN4 A;  4Q2J A;  3MP9 A;  4YTN B;  4NAM A;  3W5U B;  2Y3A A;  3W2D A;  1TS2 A;  5AUK A;  5HI1 A;  4JWS C;  1B1Z A;  5LNK 1;  4KX6 B;  4RGT A;  1JAL A;  1SBB B;  2H88 B;  3LXF A;  2SEB D;  2HTM E;  2QIL A;  4IDI A;  2YEP B;  3AEF B;  4USA A;  1KLG D;  1SF0 A;  4AS1 A;  3AEC B;  4A6Q A;  1L0Y B;  4KKI A;  1ACC A;  3V05 A;  1L5P A;  2INN E;  3Q69 A;  1K52 A;  2PVO D;  4A8X C;  1QOB A;  2LGI A;  1KLU D;  3W5V B;  1HQR D;  1BXT A;  5E6J A;  1MI0 A;  4XDD A;  3ETR A;  4OZC A;  5D7G A;  1KF6 B;  1V1P A;  3PZ8 A;  4RFB A;  4HKZ E;  1VZ7 A;  1SE4 A;  3AE7 B;  2R61 A;  2ZW1 A;  4YXD B;  1XLN A;  3I57 A;  2B76 B;  2N0S B;  4N6E B;  1C79 A;  5FR3 A;  2JX5 A;  2N9K A;  1I7H A;  1PGA A;  4MM3 B;  1FMA D;  1P7E A;  1A70 A;  1L4Z B;  1N62 A;  3AH7 A;  1TS4 A;  1EWY C;  1GPX A;  1VZ8 A;  1AYF A;  1VRA B;  3W9C B;  3P4P B;  3P63 A;  1PUT A;  1C4C A;  3AEB B;  4B0E A;  2CJO A;  2ZW0 A;  3ZQ4 A;  2KAJ A;  3SR6 A;  1FFU A;  4C7Z A;  5C3J B;  1TS5 A;  3AE5 B;  3CIR B;  1SIJ A;  4ITK A;  4P6V F;  1L0X B;  1K53 A;  2LMC A;  1YJJ A;  2L83 A;  1D5X C;  1XEE A;  2KAC A;  1Q10 A;  3UI3 A;  3VR9 B;  4JPS A;  1JML A;  2BYT A;  2MJD A;  3FIL B;  2EKI A;  2G1E A;  3AE2 B;  3BYT B;  1FO4 A;  4OW0 A;  2PW9 A;  1C78 A;  1WYG A;  1XLQ A;  1FFV A;  1BUI C;  1QQR A;  5BMG A;  1UGJ A;  1UWM A;  2PKO A;  2WU5 B;  2J4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...