1FXAA

Crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords [2FE-2S] FERREDOXIN
publication title Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120.
pubmed doi rcsb
source organism Nostoc sp.
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxaA00
1NENB 2W3RA 4N59A 2WP9B 4YT0B 1JWBD 2K9XA 3LB8C 4USAA 2Y5CA 1WGKA 1DOIA 1J7BA 1RYJA 1XLQA 4YSZB 1WYGA 3AE9B 1J7AA 4WQMA 1ZXIA 1EWYC 1RM6C 1TJEA 1XLPA 3VR9B 5AUIA 4YSXB 2CJOA 3AB5A 2H88B 3AE7B 1L5PA 1NYQA 1T3QA 2MH7A 3AV8A 5H8YE 2CJNA 1VLBA 1TKYA 1JWAD 3AEFB 1F0ZA 1FXIA 3AEEB 1XLNA 4N6EB 1ROEA 1ZP0B 1SB3C 1CJEA 2MJ3A 2W3SA 1N5XA 1JW9D 3NVWA 2JX5A 1E7PB 3AE8B 3ZYYX 2BS4B 1PFDA 4JX1C 1FRDA 2WDQB 1E0ZA 2KMMA 1A70A 1GPXA 2WS3B 5EE9A 2L52A 2WU2B 3ABVB 1KRHA 3BIID 3ETRA 3HVZA 4ZHOA 4US8A 1QLBB 3VRBB 2WU5B 2W54A 1J7CA 1YQ4B 1QOAA 3P4SB 5EE1A 3NS1A 4JWSC 2PVOD 1FRRA 1VDVA 1B9RA 3B2FA 1NYRA 2CU3A 2FBWB 2G1EA 2L83A 3NRZA 3B2GA 4C7YA 4US9A 1FFUA 1OQQA 2HTME 4YTMB 1CZPA 3L4PA 2WDRB 4YXDB 1SF0A 2E3TA 4KX6B 4P6VF 5GXGB 5C3JB 1JQ4A 1FIQA 1TKGA 2MJEA 1KFYB 3AEDB 3P4QB 1YQ3B 2N0SB 1R7SA 1N62A 2AX5A 3P1MA 3P63A 4HRSA 1FO4A 3HRDD 2WDVB 2Q5WD 4C7ZA 5EE3A 1JALA 1UWMA 4WWMA 3W9CB 2JQRB 3VR8B 1N63A 1E9MA 1ZUD2 2BS3B 1KF6B 1OQRA 1QOGA 2K5PA 4IDIA 2EKIA 1QF6A 1RFKA 2OHFA 2ACZB 3NVZA 3AEBB 1XO3A 5G5GA 1DGJA 3KWLA 3SR6A 3RPFC 3AE3B 2B76B 1DOXA 3W5VB 3AE1B 4N58A 1JRPA 1PDXA 2DBYA 1WRIA 5EE0A 1VJKA 1GAQB 1TKEA 1WWTA 2BT6A 1QT9A 2MJDA 4LTUA 1N5WA 3AE6B 1N60A 1FXAA 3FAHA 1SIJA 3AMZA 1WXQA 3NVVA 4FXCA 3CIRB 2QJLA 5G5HA 2H89B 5AUKA 1TYGB 2BS2B 3WCQA 2M19A 3SFEB 3AE4B 1E6EB 3SFDB 1AYFA 3FC4A 1V97A 3CWIA 1FFVA 1AWDA 1JROA 1L6UA 3AM9A 2PKOA 2W55A 1L0VB 3P4PB 3EUB2 3AE2B 3LXFA 4C80A 3P4RB 4YTNB 1XLOA 3AEAB 1V8CA 2K22A 3AN1A 1QOFA 3VRAB 4A9AA 2PVGC 1FMAD 5MPOA 3HUIA 4JWUC 3AH7A 4ITKA 1E10A 1NI3A 2WLBA 1QOBA 1RWSA 3W5UB 2M56B 3DWMA 3NVYA 5H92C 2KAJA 2LEKA 1YJJA 2QIEB 1ZOYB 1NEKB 1I7HA 1OFFA 1IUEA 1FM0D 3DWGC 4ZOHC 4HROA 4YSYB 2PIAA 1NVID 4YTPB 5C2TB 3B9JA 1YJIA 1N61A 3AEGB 3AE5B 3PO0A 1DOYA 3AECB 2WQYB 4ZHPA 1PUTA 2DWQA 1L6VA
chains in the Genus database with same CATH superfamily
3BWUD 1ZE3D 2X38A 3IBEA 4S17A 5JHBA 4O1NA 3U2SC 4FADA 1V6EA 4MH0E 2KDIA 5DPSA 1WGYA 1TS2A 1SE2A 3MJWA 4HEA1 2KLGA 1E90A 1LO5D 2DX5B 4WJOA 4TKNA 2FCQA 2PE6B 4ANUA 3ZUNA 1KLVA 2QCZA 5G2NA 3NHEB 2IY1B 4NPNA 4B6WA 4WIPA 2RPVA 4MDKE 4ZRQA 3DBSA 4GLSC 3NZUA 4K7SA 4MGYE 5EE3A 3WAPA 1E8WA 4IWPA 1R4MB 3C0RB 4N9F4 1B1ZA 1DOXA 1TTNA 2WXGA 2Z59B 4A90A 5BO4B 2AQ2B 2DENB 4TV3A 1K51A 2K3UA 5FR3A 3QK0A 5HI1A 1WY8A 3VTWA 4TSSA 4MGKE 1VD2A 2WXOA 1FFVA 4E3CA 5E6JA 2INCC 5LXIB 3TEXA 2IO1B 1U4AA 4OZAA 2KHWB 1SSNA 2Y3AA 4M00A 3Q14C 2FNJB 4HCNB 5C2TB 3AE5B 1EO6A 2BTEA 4ZHPA 2LWPA 4USAA 2DHZA 2BWFA 4UDUC 3ZNZB 1VZ8A 2INNE 1RYJA 2V4LA 4NAWA 4GB9A 2JRIB 2MH7A 2GBRA 1CMXB 1OQYA 1JW9D 2RSUA 1FCCC 3UI3A 3CMMB 2N9EB 5AZGA 1OGWA 1HZ6A 3PVLA 2N9KA 5E6NA 1KRHA 3HK0A 3L0WB 1TIFA 2WX1A 3RI7C 2DYBA 3ECIA 1T0RC 1NYRA 2L83A 3FILB 4IUMB 1SGHA 2VZKB 1Y56A 2XN9C 1GC7A 2JSVX 3AEDB 2PE9A 1MJDA 3IVFA 3P1MA 4HRSA 1KH0A 3HRDD 1T5XD 5IAAC 2I1KA 1E9MA 4BKGA 2D3GA 2WXKA 1P9DU 4IM3A 4C4VA 3DHHC 3QJZA 2BF8B 1DGJA 1KLUD 1V1PB 4HJKA 2FUHB 1FCLA 5BYSA 2DYOA 3EC8A 3JSVA 3AU5A 1UBIA 3TUOA 1YMHE 4IG7B 3H8HA 2PKOA 1QILA 3AE2B 4FJZA 4OHJA 3J9CA 2YLMA 1VRAB 4MACA 1GB1A 1VCBA 1VZ6A 2VH2A 1TZOA 1QOBA 2QILA 5IA7A 2MBOA 1NEKB 1L2NA 4DHZE 2N7DA 5CHFA 4EZLA 5FK9C 1J7BA 2K25A 3OAWA 4BVUC 3W1SC 1LGRA 4CQNA 3VR9B 1XLPA 2LI5A 3AB5A 2H88B 4B9KA 1VLBA 2MCNB 3PTFC 3H7SA 4LNKA 3S2AA 1N5XA 5BYRA 2O6VD 3UIOB 4MM3B 1A70A 5EE9A 1WGGA 2RGFA 1MI0A 2WU2B 3BIID 1RFAA 3MHZA 2BGFA 3QARA 4W9DA 3RZFA 3L13A 1PGAA 2WHIA 2N7JA 3H9DA 3QAQA 1CZPA 3UGBB 2BQQA 2WXQA 2Y5BB 2GMIC 2K8HA 3KYDD 4ACFA 1Q1OA 2ASQA 4FN2A 3W9CB 4A55A 4DHJD 2EKIA 5D3DA 1K52A 3NVZA 1WZ3A 2WXPA 2NCNA 2Z8LA 3GZNI 3LDZE 1ET6A 5J17A 2D2QA 3QX1A 2KD0A 2L76A 2MJDA 1SJHD 4W9FA 3ZTCA 3ZTDA 2QJLA 5G5HA 3VTUA 2N9XA 2CHWA 2BWES 1D5MC 1E8YA 1ZPSA 1AWDA 3JYUA 3N1YC 3AXCA 1EU4A 4I6NB 3EUB2 3PLUA 3P4RB 2D07B 1TY0A 1WX8A 1IGCA 1MG8A 4MJSA 2OJRA 2KFKA 5JZEB 4AP4C 2E6XA 3APCA 1N6ZA 1L0XB 4M02A 3MC8A 2ZZPB 1MG4A 2WQYB 3ZDMC 1NENB 2WP9B 3A4RA 3DBRB 4OVUA 2IZVB 2D10A 4IKGA 2OJWA 2ZPNA 2KMAA 1J7AA 2EELA 2LRWA 1AW7A 1RM6C 3RULA 4YSXB 1E7VA 4RMAA 5H8YE 2JY6A 2D3BA 1NDDA 2M0AA 4GDKB 3APFA 1WR6E 1TZ1A 1PGBA 2G4SA 1K50A 2M1MA 4A3OA 3IHPC 4K3CA 1IGDA 1QLBB 1YN3A 3DBHB 4J6IA 5LNK1 3RUIB 2O2VA 5LXHA 3PRZA 3MHSD 1JQ4A 4W9JA 1C77A 2BB6A 1GB4A 1UWMA 2N9LA 2OEDA 4GIVA 3NZ3A 4IDIA 4ANWA 3HM6X 3DVGX 1VZ7A 3N32A 4N58A 1PDXA 2B3AA 2CS4A 4GU2A 2IGDA 3ZRFA 2LUMA 4FXCA 3Q8FA 3PRMB 4WQOB 1RAXA 3P2BA 3VFKA 1V5TA 1WI0A 1E6EB 2O6VA 1V97A 3AM9A 4DDID 2QEJC 4TMAB 2EKEC 1KTKA 2L00B 2PW9A 3KWVA 4YTNB 2K22A 3RNEC 3KH0A 4WJPA 2WLBA 1IPGA 2KDMA 4A3PA 4B0EA 3L54A 2PIAA 2JVCA 1H4RA 4W9HA 3VAWA 1UF0A 2PJHA 2KFJA 4BKSA 4OZBA 3LYYA 5CHVC 4A6QA 1C4AA 4KZ0A 2FCNA 4YSZB 4XZ4A 3ZJTA 2L7RA 2FAZA 2M8SA 1KM7A 1WJ4A 2JU6X 2HE7A 2LVOA 3H1UA 4MH8A 1JWMD 2IGGA 4XE0A 2CJNA 2MP2B 2KQSA 5JXVA 1P3QU 3Q3NC 1ZP0B 3OJ4B 4KKIA 1EF5A 3NVWA 3AE8B 3ZYYX 2DNFA 4REZA 2KMMA 1P7FA 4F7ZA 2QHOA 1I42A 3HVZA 2WXMA 1SJED 3Q3OC 1R4NI 1KLGD 3NS1A 3BVMA 2FBWB 3KVFB 4DHJB 4PK1A 2E3TA 2RR9A 1V2YA 2MJEA 4LLGM 1R7SA 1FO4A 4KV2A 2JYTA 1L0YB 4HPLB 5G5GA 4ANXA 1WMHB 1P1AA 3RT3B 1HE8A 2ZW1A 1WWTA 2EMSA 1N60A 3IG3A 2D3AA 3X0WA 1SIJA 2K8CA 3TEWA 2JUOA 4WWNA 1VR9A 4AOFA 2M19A 1GC6A 3M95A 1MPEA 4W9KA 3SFDB 4A8XC 3FC4A 2JXXA 1WGDA 4A9AA 2KC2A 3A1QB 4XX5A 1E10A 4IW0A 2V9HA 4L2YA 3W5UB 4GDLB 3GP7A 1YJJA 3VTVA 1WRDB 3H7PB 2INDC 4W9GA 4F8CB 1M4VA 4YTPB 2V0GA 1YJIA 1DOYA 3GE8C 3AU4A 2KOXA 2CR5A 2DZMA 4WAFA 2W3RA 4N59A 3BZDB 3WIMA 1Q5WB 2WXJA 4HKZE 4LNOA 2INPE 3TL5A 2LXCA 5D2MB 2GI9A 1WM3A 3AEEB 4L23A 3DBLB 2MJ3A 2XK5A 3RCZA 4DDGD 4PT5A 1F77A 2J0JA 2W82A 2W9NA 4ZRIA 5BMGA 3E9SA 1EF1A 2ZPYA 5CHWA 1VDVA 2J0MA 4L1BA 4LNIA 2HTME 4C00A 2WDRB 1WX7A 3ZW3A 1FIQA 2N0SB 4IC7B 3GB1A 5HHDG 3KW5B 1WX9A 1C9FA 3SHQA 1SXTA 2Z0DB 2LJ5A 4BZAA 4LJPB 3GS2A 2B76B 2IBIB 1LQBA 5EE0A 2K6QA 2BT6A 3QA8A 3BK1A 2DZIA 3FAHA 3NOBA 3U52E 1FNUA 2GBNA 3AE4B 2WXIA 3I5JC 3O13A 2FCMA 3O65B 4M0WB 4AQ7A 4EEWA 3L08A 2LVPA 3AN1A 1V8CA 1I35A 4J3OD 4P7IA 3W2DA 2ZJDA 3ZLZA 3NVYA 1L7YA 2BPSA 1SBBB 4XDDA 2PEAA 2PTLA 4W9CA 4BAXA 1YJ1A 1F52A 1FXTB 1OEYJ 4MT5A 1WGKA 2UU7A 5L83A 3AE9B 1E5WA 3Q3FA 2VH1A 3KUZA 1TKYA 2WGSA 3NS8A 4IM0A 2QC8A 2KWCA 3ZKJC 5JH5C 2UWQA 1S1QB 2JX5A 3MFGA 2IYDB 4PYUA 4FA6A 2KWVB 2JZ3B 2KJHB 4PS3A 4ZHOA 4US8A 2SAKA 2W54A 2ZVOA 2NR2A 2CU3A 3GE3C 2CU1A 3MJ5A 2FIDA 4KSKC 3EA6A 1OQQA 4II2B 1ESFA 1WJ6A 3ZJVA 4KVGB 3P4QB 4RM9A 2QMTA 2WDVB 2Q5WD 3HIZA 4LNFA 1QF6A 4ICUA 1R4MI 1F9JA 3A9JB 2G3QB 4FLHA 1F2RI 5DPWA 3SD5A 3RPFC 2I2YA 1FD6A 3W5VB 4HK2A 4XC2A 2LZ6A 2IPKD 1JMLA 3NVVA 3PGEA 3VVWB 2LGXA 3PRPB 1V1PA 2IGHA 1V80A 5MPOA 2KT7A 3HUIA 5C1ZA 5HFYA 2BVCA 3AH7A 4BOZB 1JWSD 3WANA 1RWSA 3DWGC 3C8YA 3MC9A 2YEPF 4GXBA 4YL8A 4D2KA 2PPHA 1QQRA 5L95C 2WXRA 1Z2MA 3M62B 3RMKC 2ZCCA 1V5OA 5KHOA 1STEA 2KQ7A 1XLQA 2LGSA 2OOBB 4BFRA 1TGZB 4MSQB 3HHMA 3X23A 4XWWA 2LHDA 3WALA 1HEZE 3BY4B 1WJUA 1WM2A 3CSTA 3PHXB 1V81A 2ZNVB 1FRDA 2WNMA 1E0ZA 4DXFA 1D4BA 4ANVA 3Q2AC 3JSVB 3ETRA 2KXJA 2IO3B 4JIOU 5CX3A 3ZGZA 4B0MA 2D5GA 1B9RA 2MW5A 2DZJA 1SF0A 4NY0A 2Y5PA 2G45B 1IYFA 2SEBD 4NZLB 2K39A 1ZUD2 1UELA 3ZNHB 1P7EA 5AEKB 2KKCA 3SR6A 2V3NA 3ALBA 2NBVB 4MGZE 1UZXB 1T0SC 2GB1A 2DBYA 3B0AA 3VXWA 1UUPA 1QT9A 4LTUA 1JCKB 4NAMA 3BVZA 4BKSD 2NVUI 4IOIE 2BKFA 2W55A 2BYTA 1AARA 1V1OA 2MLBA 3WA0A 3ZXVA 3U7ZA 2NTTA 3H6NA 1WE7A 4RGMA 4EOYA 4HKQA 2NBUA 1UD7A 2V4IB 3B9JA 3DPDA 3DVNU 3R7RA 1G6JA 4HXDA 3T3NA 4XGAB 3LB8C 2LMCA 4EZKA 1BMLC 4CHKA 1EWYC 1TJEA 1P0RA 1BUIC 3I9V1 2V1YA 3ZQ4A 4PS7A 2N4FA 4FJYA 2M4NA 4P1BC 3Q3JA 2LGIA 1XLNA 2DLBA 1ZKHA 2GBJA 4M01A 1XEEA 1CJEA 2L8JA 4E74A 2KNBA 3UQAA 3Q8CA 3NZSA 1C1YB 3ABVB 3NUHB 4BBNC 1T6BX 2QDFA 1E8ZA 4LDTD 2JRHA 2MRPA 2WXLA 5C3JB 4RNAA 1ZGUB 2WDTB 4FJVB 1N62A 2KTFA 3RNAC 2XBBC 2KFKB 3UINB 2VRRB 3VHTC 2IJ0A 4BKTA 2BS3B 4C56C 2K5PA 2REXA 4ZDVA 3BK2A 2L3ZA 5AZHA 3VUXA 4AJYB 3PSEB 4LK0M 3EFCA 3V62A 3A33B 1EU3A 4KDLB 3PZDA 3IAM1 1YQBA 1V49A 5C23A 4KIKA 4AS1A 2N7EA 1C3TA 1F1HA 2H89B 1GJZA 4RGOS 2LVQA 5IO9A 1MFWA 1UH6A 3A9KA 3FKYA 2KTRA 2AEHA 1IBXB 2AQ1B 3QQ8B 1SEBD 3IXSA 2DAFA 2WXNA 1WH3A 1IUEA 1FM0D 3DDCB 1WXAA 2WXFA 3D32A 5DPTA 2LUEA 1TS5A 1PUTA 3DBRI 2RDBC 4TQ0A 2IDYA 4CYEA 2J53A 1F2RC 1UBQA 1WGHA 1TY2A 1D3ZA 3PLVA 5BMHA 4DQOC 4ZYSA 1KOTA 5D7GA 2BYFA 3Q8AA 1L5PA 2MBBB 1F0ZA 5E6PA 2LASA 3MTNB 4N6EB 2AYOB 1I4QA 1ROEA 2W3SA 1IP9A 3R8BA 4EUTA 4ZRPA 2WX0A 4AJWA 1D5ZC 2WYQA 3DBHI 4M8NA 1UWXA 2MP2A 2CHXA 3U7DA 3EGRA 4FBJB 1XCQL 1YX6B 1E8XA 1JWUD 4TQ1A 2O6VB 1ET9A 1WR1A 2K1FA 5IOIA 1FFUA 3U30A 1YQ3B 2PMVA 3P63A 4NJCA 4W9IA 3TEYA 1OQRA 4KZCA 1NI2A 3R2IA 4Q2JA 3CF6E 4URKA 3GOEA 2NPTB 2R2OA 1PYWD 1VJKA 2MBHA 2C60A 1FNVA 1N5WA 4CO7A 4WJNA 1HTOA 1WMHA 3EECA 1LM8B 5AUKA 3K9PB 4RM8A 4H2AA 2FE8A 3ZDTA 1SE9A 2LRUA 2MBQA 3P4PB 4HPMB 4JGHB 1YOVB 3LXFA 4YWGG 2K6DB 2ZEQA 3L17A 1C4PA 2A5UA 3ZO5B 2KANA 1NI3A 3W1YA 2LD9A 3TMPB 2C7MB 4WJQA 1A5RA 3RNBC 2BB5A 1N61A 1ZXHA 3A1QA 1EUVB 2NBWB 2LGYA 4LNNA 2YVCA 4RGNA 2KMCA 4GDLA 1GOZA 2RDHA 4P16A 3H7PA 2JZZA 2XEWA 2KC1A 2ZVNA 2LHEA 2CJOA 3EHVA 2I1JA 2K0PA 1ZDXA 2G9HD 4AWJA 2KJRA 2TSSA 2GLSA 3UQBA 5T8IA 3B08A 3V6CB 4LDTB 2WS3B 2J7QB 2VZKD 5G55A 2L52A 4RF1A 2JZPA 2WU5B 2KVZA 1FRRA 1WXSA 1AN8A 4US9A 3VH4B 3L4PA 2X8XX 3MP9A 2I38A 4W9EA 2IO0B 1K8RB 1DYQA 2LFIA 4HVBA 3VR8B 1N63A 4GMVA 2MX2A 3DHIC 3N20C 4K7UA 3N1XC 1HTQA 1XF5L 1XO3A 1I4HA 3AE1B 4JPSA 3IAS1 3VUWA 2J42A 2G4DB 2D3CA 4I6LB 3AMZA 1WXQA 5AZFA 3KYCD 3JW0X 3RFZB 2LGDA 4GGQA 2KX3A 3UF8A 1WXVA 1WFYA 2XK5B 1XLOA 2RMMA 3N3KB 3EFUA 2J4XA 3E56A 4WURA 3ONSA 3SU8X 3Q69A 4F1SA 4M0WA 1I7HA 2MA9B 4HROA 2AL6A 1GG3A 5E6OA 2M17A 4ARCA 3SEBA 2KLCA 4KGSA 4DXAB 1DOIA 2GOWA 4ZYNA 2BYVE 2KK8A 2CHZA 4GOCA 2HJ8A 2HD5B 3IT4B 2L32A 2JXTA 3DBLI 1WXMA 3DOWA 1OEYA 1E7PB 5EDSA 4JX1C 4OW0A 4NNJB 2V3SA 1GPXA 3ENEA 2JT4B 2BKRB 1YQ4B 4BBNF 3BVGA 2N1VA 5GMVA 3NRZA 2XNAC 3PHWB 2JWUA 1SE4A 3ZXRA 2DZKA 4NQLB 5GXGB 2ONQA 1L4ZB 2KO3A 1FNWA 2V3PA 3ML9A 3LJ3A 2YEPB 3OLMD 3BYTB 4IWQA 4GSWA 2R2QA 2RDGA 4DXGA 3AE3B 1D5XC 4TUUA 3Q8EA 3JVZX 3CSFA 1FXAA 3A9JA 3HM3A 1V9JA 2UYZB 2BS2B 4LJOB 2BBCA 1Q0WB 3KUDB 3M3JA 4JE3B 3FILA 5DCNA 2GBKA 1ZW7A 1P98A 3MC0B 1PGXA 3ZRCA 3ZNGC 3L10B 3TEZA 2HTHA 1ZOYB 4K3BA 4EKUA 3R7QA 1ENFA 4YSYB 3AEGB 2RPQA 2NS5A 4RH6A 3TBLD 4NAWB 4WH4A 2GRIA 1YN5A 1Y8RC 3QCAA 4DBGA 1C76A 1ZXIA 3I57A 1S3SG 2AWTA 3HVDA 1WF9A 3APDA 1NYQA 2QSDA 2C5LC 3AEFB 1FXIA 2KVRA 2FCSA 2ICIA 4OZCA 1WJNA 3VDZA 2WXHA 4ASWC 1FEHA 1V86A 4XYCA 5I4DA 2PVOD 2J0KA 4MGIE 4W9LA 2ON8A 4C4VB 2JYEA 1TKGA 1BXTA 3R3MA 2AX5A 1CK1A 3NY5A 1YNTE 2KN5A 1KF6B 2ACZB 3VUYA 5J2RA 4NJ6A 3KWLA 4WWOA 1UGJA 3GZNB 5J18A 2K8BA 1TKEA 3V3XA 3BINA 3B1LX 4MM3A 2KJ6A 3DCGA 3Q3MC 1OTRB 1YIWA 4HPPA 2MSED 1TYGB 3WCQA 2MWSB 1WIAA 3R2TA 3V61A 3VH3B 3K9OB 1FMAD 4JLCA 4JWUC 4ITKA 1HQRD 1M94A 2KWDA 2M56B 3DWMA 2KAJA 5FR6A 2LEKA 5D94A 3T3OA 4XWTA 1JWBD 2AQ3B 2K9XA 4OVVA 2Y5CA 4MELA 4JL9A 2BYEA 1TT5B 3I63C 1SE3A 5HG2A 5AUIA 1UNSA 2J52A 3AE7B 3AV8A 5IP4D 2IY0B 3AI5A 3A4SC 5BMIA 2KN4A 3OWEB 4RGTA 5DPRA 2KZRA 4DK5A 1PFDA 2JWZA 2WDQB 2KWUB 2JF5A 3U4EG 2BW2A 3VRBB 2HJ1A 5EE1A 1JRUA 1WE6A 3B2FA 2ZW0A 3B2GA 2DYMA 1EWCA 4PYZA 1MVKA 4YXDB 4P6VF 4KGTA 3V05A 1KFYB 2KDEB 2MEKA 4R3DA 5BYQA 4C7ZA 1JALA 2JQRB 2KDBA 1TS3A 1QOGA 1XD3B 1X1MA 2L0FA 1J19A 3RNGC 3ML8A 3QHTA 4DWFA 3N9YC 1XT9B 1BT0A 3I3TB 4FHJA 1JRPA 4E71A 1WRIA 4GDKA 3AE6B 1FPYA 1L4DB 3PZ8A 1XQQA 3CIRB 3L16A 2FIFA 1YN4A 1D6EC 4MJSB 3QC8B 4WWPA 2MHJA 3SFEB 4EZJA 2D11A 2N1WA 1JROA 2KYWA 5FKAC 3AEAB 3C19A 2PVGC 4LCDE 3PS6A 4ZRKA 4S0RA 3T8MA 3Q8BA 3R66C 1HA5A 2R61A 3RN9C 2JPHA 1IBXA 1OFFA 3PT2B 3VQIA 2LXAA 4RF0A 1C78A 3KQ4A 2DAJA 2EMTA 2FUG1 3DQVA 3TSSA 4HWIB 4WAAA 1WYGA 3QWZB 4WQMA 4GN1A 2C7HA 3TCAA 2WWZA 1GUAB 1KJTA 1T3QA 2KQ4X 2CKHB 4FHKA 3PPAA 2L1AA 1C4CA 4JQWC 2O2VB 1QZEA 2MQJA 1T0QC 4KIKB 2Z0EB 2LJIA 3URYA 4EE2A 1QOAA 4K7WA 1ISNA 1R4NB 2G1EA 3A9KB 1HZ5A 1YX5B 2KTRB 1LFDA 1RLFA 4YTMB 4OVZA 3V60A 1MHXA 4KSLC 1GNUA 2KX0A 1CQVA 3TJPA 4WWMA 4I6PA 5D6JB 2M0XA 4NQKE 2L0TA 4G50A 4G0NB 3OG5A 5TR5A 3ZNID 1RFKA 2OHFA 3AEBB 3N30A 4M8MA 4XDCA 1ACCA 4QAYA 3NJTA 2NTSA 3T9LA 3RD2A 2IO2B 4AUQC 2NPTA 4X57B 1UGMA 2N9PC 1EM7A 1WYWB 1AYFA 3W1SA 3AULA 4HDQA 3V6EB 1TBEA 4MSMB 1T0YA 2L05A 1QOFA 2C7NB 3DVGY 4IM2A 4G11A 1SIFA 3TIXA 2KACA 5CTRC 4IWOA 3KLSX 4ZOHC 5IKCM 4ZRJA 2DWQA 2NMQA 1L6VA 4HJGE 4YT0B 3N1ZC 5TSSA 1PQSA 4A20A 5KHQA 5LLIA 1TS4A 4EFOA 4KKJA 3RZWC 1I4RA 1MHHE 3WAMA 1J0GA 1HXYD 3P42A 3ZVVA 5JHAA 1WSPA 4FULA 4RFBA 1RRBA 3SDLC 1JWAD 4G3XB 3BYYB 3RNFC 3NG0A 1QKZA 4ICVA 1SB3C 2BS4B 2AL3A 2PLPA 4DHZB 3IFWB 3KUCB 3RNCC 1J7CA 3P4SB 4JWSC 4NJ7A 3ZJUA 3DHGC 2ZCBA 4C7YA 2MBEA 2HDEA 4KX6B 1NBFC 3PZ7A 1XXGA 4B95A 1WGRA 3M63B 1I4XA 1Z5SB 4BOSC 1Q10A 1LXDA 4KGRA 4RCOA 3Q6BA 4ARIA 1K53A 3DVNV 3QIJA 4HCPB 4K1RB 1WZ0A 1ZDVA 3U8ZA 1GAQB 3WAOA 3UIPB 3PV1A 1E7UA 2GBMA 3ZIMA 1C79A 2ZNVC 1I4GA 3IT6B 3RYTA 1I4PA 5HKHA 4KDIC 4C80A 3CWIA 3VRAB 1L6UA 1J8CA 1L0VB 3OJ3A 4HDOA 4P1CC 4MEMA 5D3IB 4HLEA 5IN7A 1YD8U 2A4ZA 2RD0A 5H92C 4K81A 4II3B 2QIEB 1XCTL 4PS8A 2KDFB 1NVID 1H8CA 3PREA 3PO0A 2C9WB 3AECB
chains in the Genus database with same CATH topology
1YN5A 3T3NA 3BWUD 3LYYA 3LB8C 1ZE3D 2LMCA 4A6QA 2X38A 1C4AA 4YSZB 1BMLC 3ZJTA 1C76A 1ZXIA 3I57A 1EWYC 1TJEA 4O1NA 3HVDA 2JU6X 3U2SC 1BUIC 3I9V1 3ZQ4A 4MH8A 1JWMD 1NYQA 2IGGA 2QSDA 4XE0A 2CJNA 3AEFB 1FXIA 2LGIA 1XLNA 2DLBA 5JXVA 1ZP0B 1TS2A 1XEEA 1CJEA 1SE2A 2ICIA 4KKIA 3NVWA 4HEA1 3AE8B 4OZCA 3ZYYX 4REZA 1LO5D 2KMMA 2WXHA 1P7FA 3Q8CA 1FEHA 3ABVB 3HVZA 2WXMA 1SJED 3NUHB 5I4DA 1KLGD 3NS1A 1T6BX 2PVOD 3BVMA 2FBWB 2ON8A 4WIPA 2WXLA 2JYEA 2E3TA 2RPVA 4RNAA 5C3JB 1TKGA 1BXTA 2MJEA 4LLGM 4ZRQA 1R7SA 1N62A 1CK1A 2AX5A 4GLSC 1FO4A 5EE3A 1YNTE 2JYTA 2IJ0A 2BS3B 1KF6B 2K5PA 4C56C 1L0YB 2ACZB 3BK2A 5G5GA 3KWLA 1B1ZA 1DOXA 2WXGA 4LK0M 4A90A 1UGJA 2ZW1A 2AQ2B 1WWTA 1TKEA 1EU3A 3V3XA 3IAM1 1N60A 1K51A 2K3UA 1SIJA 5FR3A 4AS1A 5HI1A 3TEWA 2H89B 1VR9A 4TSSA 1TYGB 4RGOS 3WCQA 2M19A 1MPEA 3SFDB 4A8XC 3FC4A 2WXOA 1FFVA 3R2TA 1IBXB 5E6JA 2AQ1B 4A9AA 1SEBD 3IXSA 1FMAD 3TEXA 4JWUC 2WXNA 4ITKA 1E10A 4OZAA 1HQRD 4L2YA 2KWDA 2M56B 3DWMA 3W5UB 1SSNA 2Y3AA 2KAJA 4GDLB 2LEKA 1YJJA 3GP7A 1IUEA 1FM0D 1M4VA 4YTPB 2V0GA 5C2TB 3T3OA 1YJIA 1DOYA 4XWTA 3AE5B 2WXFA 2BTEA 4ZHPA 1TS5A 1PUTA 4WAFA 4TQ0A 2IDYA 2W3RA 2J53A 4N59A 3BZDB 1JWBD 2AQ3B 2K9XA 4USAA 4UDUC 2Y5CA 2WXJA 1F2RC 4HKZE 1VZ8A 2INNE 1RYJA 1TY2A 1SE3A 5BMHA 4DQOC 2INPE 4ZYSA 5HG2A 5AUIA 5D7GA 2J52A 1UNSA 1L5PA 3AE7B 2MH7A 3AV8A 3Q8AA 2GI9A 1F0ZA 3AEEB 4L23A 5BMIA 2KN4A 3OWEB 4N6EB 1I4QA 1ROEA 2MJ3A 2W3SA 4RGTA 3R8BA 1JW9D 1FCCC 1PFDA 4PT5A 2WDQB 3UI3A 4ZRPA 1F77A 1HZ6A 3U4EG 1D5ZC 2N9KA 2BW2A 2W82A 1UWXA 5BMGA 1KRHA 3E9SA 3EGRA 3VRBB 1XCQL 5EE1A 1JWUD 1VDVA 3B2FA 4TQ1A 1NYRA 2ZW0A 1ET9A 2L83A 3B2GA 2DYMA 3FILB 1EWCA 4L1BA 1FFUA 2HTME 1MVKA 2WDRB 2VZKB 4P6VF 4YXDB 1Y56A 1FIQA 2XN9C 4KGTA 3V05A 1KFYB 2JSVX 3AEDB 1YQ3B 2PMVA 2N0SB 3P63A 2MEKA 3P1MA 4R3DA 3GB1A 4HRSA 1KH0A 3HRDD 4NJCA 5HHDG 5BYQA 4C7ZA 1T5XD 1JALA 3TEYA 1C9FA 2JQRB 1TS3A 1E9MA 1OQRA 1QOGA 2WXKA 3R2IA 1SXTA 4Q2JA 1DGJA 1KLUD 3GS2A 2B76B 3N9YC 1PYWD 1JRPA 5EE0A 1WRIA 1VJKA 1FNVA 2BT6A 1V1PB 1N5WA 3AE6B 3BK1A 1FCLA 1L4DB 3FAHA 3PZ8A 3U52E 5BYSA 1FNUA 2DYOA 3CIRB 1YN4A 5AUKA 1D6EC 4H2AA 3SFEB 3AE4B 2FE8A 2WXIA 3TUOA 3O13A 1YMHE 1JROA 3H8HA 2PKOA 3P4PB 4AQ7A 1QILA 3AE2B 3LXFA 4YWGG 4OHJA 3J9CA 5FKAC 1VRAB 3AEAB 1V8CA 3AN1A 4MACA 1C4PA 1GB1A 2PVGC 4J3OD 1VZ6A 3W2DA 1TZOA 1NI3A 1QOBA 2QILA 3Q8BA 3NVYA 1HA5A 2R61A 1IBXA 1NEKB 1SBBB 1OFFA 4XDDA 2BB5A 1N61A 3VQIA 1ZXHA 2PTLA 4RF0A 1C78A 3KQ4A 4RGNA 5FK9C 2FUG1 1GOZA 2RDHA 4P16A 4MT5A 1WGKA 3TSSA 1J7BA 1WYGA 3AE9B 4WQMA 4CQNA 3VR9B 1XLPA 2LHEA 2CJOA 3AB5A 2H88B 1T3QA 2K0PA 1ZDXA 1VLBA 1TKYA 2KQ4X 2G9HD 2L1AA 1C4CA 2TSSA 1N5XA 5BYRA 2JX5A 5T8IA 3MFGA 4MM3B 1A70A 2WS3B 2VZKD 5EE9A 1MI0A 2L52A 2WU2B 3BIID 4RF1A 2JZPA 4ZHOA 4US8A 2LJIA 2SAKA 2W54A 2WU5B 3URYA 4EE2A 1QOAA 3MHZA 1FRRA 2CU3A 2G1EA 3MJ5A 1HZ5A 1AN8A 4US9A 3EA6A 1PGAA 1OQQA 2N7JA 4YTMB 1CZPA 3L4PA 1ESFA 3MP9A 2I38A 4OVZA 3ZJVA 1MHXA 2WXQA 3P4QB 2QMTA 1DYQA 2LFIA 2WDVB 2Q5WD 1CQVA 4WWMA 3W9CB 4A55A 3VR8B 1N63A 1QF6A 2EKIA 5D3DA 1RFKA 1K52A 2OHFA 3NVZA 3AEBB 1F2RI 1XF5L 1XO3A 1I4HA 2WXPA 2Z8LA 3RPFC 2I2YA 1FD6A 3W5VB 3AE1B 4JPSA 3IAS1 4XDCA 1ACCA 2J42A 1ET6A 2MJDA 1SJHD 2NTSA 2IPKD 1JMLA 3AMZA 1WXQA 3NVVA 2QJLA 5G5HA 3RFZB 1EM7A 1D5MC 1AYFA 3W1SA 1ZPSA 1AWDA 1V1PA 2IGHA 1EU4A 3EUB2 3P4RB 1TY0A 1XLOA 2RMMA 1QOFA 5MPOA 2J4XA 3HUIA 5HFYA 3AH7A 1JWSD 1IGCA 3E56A 4WURA 1RWSA 2KACA 3Q69A 2E6XA 3KLSX 4M0WA 1I7HA 1L0XB 3DWGC 4ZOHC 4HROA 3C8YA 2YEPF 4D2KA 2WQYB 4ARCA 2DWQA 1QQRA 2NMQA 1L6VA 1NENB 4HJGE 3SEBA 2WP9B 2WXRA 4KGSA 4YT0B 5TSSA 1STEA 4IKGA 1DOIA 1XLQA 1TS4A 1J7AA 2EELA 4KKJA 1AW7A 1I4RA 1MHHE 1RM6C 4YSXB 4XWWA 2LHDA 1HXYD 3P42A 3IT4B 2L32A 2JXTA 1WSPA 5H8YE 4RFBA 1JWAD 3BYYB 1HEZE 1QKZA 1SB3C 2M0AA 1E7PB 4GDKB 2BS4B 4JX1C 1FRDA 2WNMA 4OW0A 1E0ZA 4DXFA 1D4BA 2PLPA 1PGBA 1GPXA 1K50A 3ETRA 1IGDA 1QLBB 1YN3A 3ZGZA 1J7CA 1YQ4B 5LNK1 3P4SB 4JWSC 4B0MA 2D5GA 1B9RA 3BVGA 3ZJUA 3NRZA 2XNAC 2JWUA 4C7YA 1SE4A 2HDEA 1SF0A 4KX6B 5GXGB 2ONQA 3PZ7A 1JQ4A 1XXGA 1L4ZB 1C77A 1FNWA 2V3PA 2Y5PA 1I4XA 2SEBD 2BB6A 2YEPB 1GB4A 4NZLB 1Q10A 1UWMA 2N9LA 3BYTB 1ZUD2 2OEDA 4IDIA 3NZ3A 4KGRA 4RCOA 1VZ7A 4ARIA 1P7EA 1K53A 2RDGA 4DXGA 3SR6A 2V3NA 3AE3B 4N58A 2GB1A 1PDXA 1D5XC 2DBYA 1ZDVA 1GAQB 1UUPA 3Q8EA 1QT9A 4LTUA 1JCKB 4NAMA 2IGDA 1FXAA 2LUMA 1C79A 4FXCA 3Q8FA 1I4GA 3BVZA 3IT6B 2BS2B 1I4PA 2BBCA 1E6EB 4IOIE 4C80A 1V97A 3CWIA 1L6UA 3AM9A 3VRAB 4JE3B 2W55A 2QEJC 1L0VB 3FILA 4TMAB 2BYTA 1V1OA 1KTKA 2PW9A 3KWVA 4YTNB 2K22A 5D3IB 3U7ZA 2WLBA 3MC0B 1PGXA 2NTTA 2KDMA 3TEZA 5H92C 2QIEB 1XCTL 4RGMA 1ZOYB 4HKQA 4B0EA 1ENFA 4YSYB 2PIAA 1NVID 2V4IB 3B9JA 3AEGB 3PO0A 4RH6A 3AECB 4NAWB 4WH4A 2GRIA 4OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN B;  2W3R A;  4N59 A;  2WP9 B;  4YT0 B;  1JWB D;  2K9X A;  3LB8 C;  4USA A;  2Y5C A;  1WGK A;  1DOI A;  1J7B A;  1RYJ A;  1XLQ A;  4YSZ B;  1WYG A;  3AE9 B;  1J7A A;  4WQM A;  1ZXI A;  1EWY C;  1RM6 C;  1TJE A;  1XLP A;  3VR9 B;  5AUI A;  4YSX B;  2CJO A;  3AB5 A;  2H88 B;  3AE7 B;  1L5P A;  1NYQ A;  1T3Q A;  2MH7 A;  3AV8 A;  5H8Y E;  2CJN A;  1VLB A;  1TKY A;  1JWA D;  3AEF B;  1F0Z A;  1FXI A;  3AEE B;  1XLN A;  4N6E B;  1ROE A;  1ZP0 B;  1SB3 C;  1CJE A;  2MJ3 A;  2W3S A;  1N5X A;  1JW9 D;  3NVW A;  2JX5 A;  1E7P B;  3AE8 B;  3ZYY X;  2BS4 B;  1PFD A;  4JX1 C;  1FRD A;  2WDQ B;  1E0Z A;  2KMM A;  1A70 A;  1GPX A;  2WS3 B;  5EE9 A;  2L52 A;  2WU2 B;  3ABV B;  1KRH A;  3BII D;  3ETR A;  3HVZ A;  4ZHO A;  4US8 A;  1QLB B;  3VRB B;  2WU5 B;  2W54 A;  1J7C A;  1YQ4 B;  1QOA A;  3P4S B;  5EE1 A;  3NS1 A;  4JWS C;  2PVO D;  1FRR A;  1VDV A;  1B9R A;  3B2F A;  1NYR A;  2CU3 A;  2FBW B;  2G1E A;  2L83 A;  3NRZ A;  3B2G A;  4C7Y A;  4US9 A;  1FFU A;  1OQQ A;  2HTM E;  4YTM B;  1CZP A;  3L4P A;  2WDR B;  4YXD B;  1SF0 A;  2E3T A;  4KX6 B;  4P6V F;  5GXG B;  5C3J B;  1JQ4 A;  1FIQ A;  1TKG A;  2MJE A;  1KFY B;  3AED B;  3P4Q B;  1YQ3 B;  2N0S B;  1R7S A;  1N62 A;  2AX5 A;  3P1M A;  3P63 A;  4HRS A;  1FO4 A;  3HRD D;  2WDV B;  2Q5W D;  4C7Z A;  5EE3 A;  1JAL A;  1UWM A;  4WWM A;  3W9C B;  2JQR B;  3VR8 B;  1N63 A;  1E9M A;  1ZUD 2;  2BS3 B;  1KF6 B;  1OQR A;  1QOG A;  2K5P A;  4IDI A;  2EKI A;  1QF6 A;  1RFK A;  2OHF A;  2ACZ B;  3NVZ A;  3AEB B;  1XO3 A;  5G5G A;  1DGJ A;  3KWL A;  3SR6 A;  3RPF C;  3AE3 B;  2B76 B;  1DOX A;  3W5V B;  3AE1 B;  4N58 A;  1JRP A;  1PDX A;  2DBY A;  1WRI A;  5EE0 A;  1VJK A;  1GAQ B;  1TKE A;  1WWT A;  2BT6 A;  1QT9 A;  2MJD A;  4LTU A;  1N5W A;  3AE6 B;  1N60 A;  1FXA A;  3FAH A;  1SIJ A;  3AMZ A;  1WXQ A;  3NVV A;  4FXC A;  3CIR B;  2QJL A;  5G5H A;  2H89 B;  5AUK A;  1TYG B;  2BS2 B;  3WCQ A;  2M19 A;  3SFE B;  3AE4 B;  1E6E B;  3SFD B;  1AYF A;  3FC4 A;  1V97 A;  3CWI A;  1FFV A;  1AWD A;  1JRO A;  1L6U A;  3AM9 A;  2PKO A;  2W55 A;  1L0V B;  3P4P B;  3EUB 2;  3AE2 B;  3LXF A;  4C80 A;  3P4R B;  4YTN B;  1XLO A;  3AEA B;  1V8C A;  2K22 A;  3AN1 A;  1QOF A;  3VRA B;  4A9A A;  2PVG C;  1FMA D;  5MPO A;  3HUI A;  4JWU C;  3AH7 A;  4ITK A;  1E10 A;  1NI3 A;  2WLB A;  1QOB A;  1RWS A;  3W5U B;  2M56 B;  3DWM A;  3NVY A;  5H92 C;  2KAJ A;  2LEK A;  1YJJ A;  2QIE B;  1ZOY B;  1NEK B;  1I7H A;  1OFF A;  1IUE A;  1FM0 D;  3DWG C;  4ZOH C;  4HRO A;  4YSY B;  2PIA A;  1NVI D;  4YTP B;  5C2T B;  3B9J A;  1YJI A;  1N61 A;  3AEG B;  3AE5 B;  3PO0 A;  1DOY A;  3AEC B;  2WQY B;  4ZHP A;  1PUT A;  2DWQ A;  1L6V A; 
#chains in the Genus database with same CATH topology
 3BWU D;  1ZE3 D;  2X38 A;  3IBE A;  4S17 A;  5JHB A;  4O1N A;  3U2S C;  4FAD A;  1V6E A;  4MH0 E;  2KDI A;  5DPS A;  1WGY A;  1TS2 A;  1SE2 A;  3MJW A;  4HEA 1;  2KLG A;  1E90 A;  1LO5 D;  2DX5 B;  4WJO A;  4TKN A;  2FCQ A;  2PE6 B;  4ANU A;  3ZUN A;  1KLV A;  2QCZ A;  5G2N A;  3NHE B;  2IY1 B;  4NPN A;  4B6W A;  4WIP A;  2RPV A;  4MDK E;  4ZRQ A;  3DBS A;  4GLS C;  3NZU A;  4K7S A;  4MGY E;  5EE3 A;  3WAP A;  1E8W A;  4IWP A;  1R4M B;  3C0R B;  4N9F 4;  1B1Z A;  1DOX A;  1TTN A;  2WXG A;  2Z59 B;  4A90 A;  5BO4 B;  2AQ2 B;  2DEN B;  4TV3 A;  1K51 A;  2K3U A;  5FR3 A;  3QK0 A;  5HI1 A;  1WY8 A;  3VTW A;  4TSS A;  4MGK E;  1VD2 A;  2WXO A;  1FFV A;  4E3C A;  5E6J A;  2INC C;  5LXI B;  3TEX A;  2IO1 B;  1U4A A;  4OZA A;  2KHW B;  1SSN A;  2Y3A A;  4M00 A;  3Q14 C;  2FNJ B;  4HCN B;  5C2T B;  3AE5 B;  1EO6 A;  2BTE A;  4ZHP A;  2LWP A;  4USA A;  2DHZ A;  2BWF A;  4UDU C;  3ZNZ B;  1VZ8 A;  2INN E;  1RYJ A;  2V4L A;  4NAW A;  4GB9 A;  2JRI B;  2MH7 A;  2GBR A;  1CMX B;  1OQY A;  1JW9 D;  2RSU A;  1FCC C;  3UI3 A;  3CMM B;  2N9E B;  5AZG A;  1OGW A;  1HZ6 A;  3PVL A;  2N9K A;  5E6N A;  1KRH A;  3HK0 A;  3L0W B;  1TIF A;  2WX1 A;  3RI7 C;  2DYB A;  3ECI A;  1T0R C;  1NYR A;  2L83 A;  3FIL B;  4IUM B;  1SGH A;  2VZK B;  1Y56 A;  2XN9 C;  1GC7 A;  2JSV X;  3AED B;  2PE9 A;  1MJD A;  3IVF A;  3P1M A;  4HRS A;  1KH0 A;  3HRD D;  1T5X D;  5IAA C;  2I1K A;  1E9M A;  4BKG A;  2D3G A;  2WXK A;  1P9D U;  4IM3 A;  4C4V A;  3DHH C;  3QJZ A;  2BF8 B;  1DGJ A;  1KLU D;  1V1P B;  4HJK A;  2FUH B;  1FCL A;  5BYS A;  2DYO A;  3EC8 A;  3JSV A;  3AU5 A;  1UBI A;  3TUO A;  1YMH E;  4IG7 B;  3H8H A;  2PKO A;  1QIL A;  3AE2 B;  4FJZ A;  4OHJ A;  3J9C A;  2YLM A;  1VRA B;  4MAC A;  1GB1 A;  1VCB A;  1VZ6 A;  2VH2 A;  1TZO A;  1QOB A;  2QIL A;  5IA7 A;  2MBO A;  1NEK B;  1L2N A;  4DHZ E;  2N7D A;  5CHF A;  4EZL A;  5FK9 C;  1J7B A;  2K25 A;  3OAW A;  4BVU C;  3W1S C;  1LGR A;  4CQN A;  3VR9 B;  1XLP A;  2LI5 A;  3AB5 A;  2H88 B;  4B9K A;  1VLB A;  2MCN B;  3PTF C;  3H7S A;  4LNK A;  3S2A A;  1N5X A;  5BYR A;  2O6V D;  3UIO B;  4MM3 B;  1A70 A;  5EE9 A;  1WGG A;  2RGF A;  1MI0 A;  2WU2 B;  3BII D;  1RFA A;  3MHZ A;  2BGF A;  3QAR A;  4W9D A;  3RZF A;  3L13 A;  1PGA A;  2WHI A;  2N7J A;  3H9D A;  3QAQ A;  1CZP A;  3UGB B;  2BQQ A;  2WXQ A;  2Y5B B;  2GMI C;  2K8H A;  3KYD D;  4ACF A;  1Q1O A;  2ASQ A;  4FN2 A;  3W9C B;  4A55 A;  4DHJ D;  2EKI A;  5D3D A;  1K52 A;  3NVZ A;  1WZ3 A;  2WXP A;  2NCN A;  2Z8L A;  3GZN I;  3LDZ E;  1ET6 A;  5J17 A;  2D2Q A;  3QX1 A;  2KD0 A;  2L76 A;  2MJD A;  1SJH D;  4W9F A;  3ZTC A;  3ZTD A;  2QJL A;  5G5H A;  3VTU A;  2N9X A;  2CHW A;  2BWE S;  1D5M C;  1E8Y A;  1ZPS A;  1AWD A;  3JYU A;  3N1Y C;  3AXC A;  1EU4 A;  4I6N B;  3EUB 2;  3PLU A;  3P4R B;  2D07 B;  1TY0 A;  1WX8 A;  1IGC A;  1MG8 A;  4MJS A;  2OJR A;  2KFK A;  5JZE B;  4AP4 C;  2E6X A;  3APC A;  1N6Z A;  1L0X B;  4M02 A;  3MC8 A;  2ZZP B;  1MG4 A;  2WQY B;  3ZDM C;  1NEN B;  2WP9 B;  3A4R A;  3DBR B;  4OVU A;  2IZV B;  2D10 A;  4IKG A;  2OJW A;  2ZPN A;  2KMA A;  1J7A A;  2EEL A;  2LRW A;  1AW7 A;  1RM6 C;  3RUL A;  4YSX B;  1E7V A;  4RMA A;  5H8Y E;  2JY6 A;  2D3B A;  1NDD A;  2M0A A;  4GDK B;  3APF A;  1WR6 E;  1TZ1 A;  1PGB A;  2G4S A;  1K50 A;  2M1M A;  4A3O A;  3IHP C;  4K3C A;  1IGD A;  1QLB B;  1YN3 A;  3DBH B;  4J6I A;  5LNK 1;  3RUI B;  2O2V A;  5LXH A;  3PRZ A;  3MHS D;  1JQ4 A;  4W9J A;  1C77 A;  2BB6 A;  1GB4 A;  1UWM A;  2N9L A;  2OED A;  4GIV A;  3NZ3 A;  4IDI A;  4ANW A;  3HM6 X;  3DVG X;  1VZ7 A;  3N32 A;  4N58 A;  1PDX A;  2B3A A;  2CS4 A;  4GU2 A;  2IGD A;  3ZRF A;  2LUM A;  4FXC A;  3Q8F A;  3PRM B;  4WQO B;  1RAX A;  3P2B A;  3VFK A;  1V5T A;  1WI0 A;  1E6E B;  2O6V A;  1V97 A;  3AM9 A;  4DDI D;  2QEJ C;  4TMA B;  2EKE C;  1KTK A;  2L00 B;  2PW9 A;  3KWV A;  4YTN B;  2K22 A;  3RNE C;  3KH0 A;  4WJP A;  2WLB A;  1IPG A;  2KDM A;  4A3P A;  4B0E A;  3L54 A;  2PIA A;  2JVC A;  1H4R A;  4W9H A;  3VAW A;  1UF0 A;  2PJH A;  2KFJ A;  4BKS A;  4OZB A;  3LYY A;  5CHV C;  4A6Q A;  1C4A A;  4KZ0 A;  2FCN A;  4YSZ B;  4XZ4 A;  3ZJT A;  2L7R A;  2FAZ A;  2M8S A;  1KM7 A;  1WJ4 A;  2JU6 X;  2HE7 A;  2LVO A;  3H1U A;  4MH8 A;  1JWM D;  2IGG A;  4XE0 A;  2CJN A;  2MP2 B;  2KQS A;  5JXV A;  1P3Q U;  3Q3N C;  1ZP0 B;  3OJ4 B;  4KKI A;  1EF5 A;  3NVW A;  3AE8 B;  3ZYY X;  2DNF A;  4REZ A;  2KMM A;  1P7F A;  4F7Z A;  2QHO A;  1I42 A;  3HVZ A;  2WXM A;  1SJE D;  3Q3O C;  1R4N I;  1KLG D;  3NS1 A;  3BVM A;  2FBW B;  3KVF B;  4DHJ B;  4PK1 A;  2E3T A;  2RR9 A;  1V2Y A;  2MJE A;  4LLG M;  1R7S A;  1FO4 A;  4KV2 A;  2JYT A;  1L0Y B;  4HPL B;  5G5G A;  4ANX A;  1WMH B;  1P1A A;  3RT3 B;  1HE8 A;  2ZW1 A;  1WWT A;  2EMS A;  1N60 A;  3IG3 A;  2D3A A;  3X0W A;  1SIJ A;  2K8C A;  3TEW A;  2JUO A;  4WWN A;  1VR9 A;  4AOF A;  2M19 A;  1GC6 A;  3M95 A;  1MPE A;  4W9K A;  3SFD B;  4A8X C;  3FC4 A;  2JXX A;  1WGD A;  4A9A A;  2KC2 A;  3A1Q B;  4XX5 A;  1E10 A;  4IW0 A;  2V9H A;  4L2Y A;  3W5U B;  4GDL B;  3GP7 A;  1YJJ A;  3VTV A;  1WRD B;  3H7P B;  2IND C;  4W9G A;  4F8C B;  1M4V A;  4YTP B;  2V0G A;  1YJI A;  1DOY A;  3GE8 C;  3AU4 A;  2KOX A;  2CR5 A;  2DZM A;  4WAF A;  2W3R A;  4N59 A;  3BZD B;  3WIM A;  1Q5W B;  2WXJ A;  4HKZ E;  4LNO A;  2INP E;  3TL5 A;  2LXC A;  5D2M B;  2GI9 A;  1WM3 A;  3AEE B;  4L23 A;  3DBL B;  2MJ3 A;  2XK5 A;  3RCZ A;  4DDG D;  4PT5 A;  1F77 A;  2J0J A;  2W82 A;  2W9N A;  4ZRI A;  5BMG A;  3E9S A;  1EF1 A;  2ZPY A;  5CHW A;  1VDV A;  2J0M A;  4L1B A;  4LNI A;  2HTM E;  4C00 A;  2WDR B;  1WX7 A;  3ZW3 A;  1FIQ A;  2N0S B;  4IC7 B;  3GB1 A;  5HHD G;  3KW5 B;  1WX9 A;  1C9F A;  3SHQ A;  1SXT A;  2Z0D B;  2LJ5 A;  4BZA A;  4LJP B;  3GS2 A;  2B76 B;  2IBI B;  1LQB A;  5EE0 A;  2K6Q A;  2BT6 A;  3QA8 A;  3BK1 A;  2DZI A;  3FAH A;  3NOB A;  3U52 E;  1FNU A;  2GBN A;  3AE4 B;  2WXI A;  3I5J C;  3O13 A;  2FCM A;  3O65 B;  4M0W B;  4AQ7 A;  4EEW A;  3L08 A;  2LVP A;  3AN1 A;  1V8C A;  1I35 A;  4J3O D;  4P7I A;  3W2D A;  2ZJD A;  3ZLZ A;  3NVY A;  1L7Y A;  2BPS A;  1SBB B;  4XDD A;  2PEA A;  2PTL A;  4W9C A;  4BAX A;  1YJ1 A;  1F52 A;  1FXT B;  1OEY J;  4MT5 A;  1WGK A;  2UU7 A;  5L83 A;  3AE9 B;  1E5W A;  3Q3F A;  2VH1 A;  3KUZ A;  1TKY A;  2WGS A;  3NS8 A;  4IM0 A;  2QC8 A;  2KWC A;  3ZKJ C;  5JH5 C;  2UWQ A;  1S1Q B;  2JX5 A;  3MFG A;  2IYD B;  4PYU A;  4FA6 A;  2KWV B;  2JZ3 B;  2KJH B;  4PS3 A;  4ZHO A;  4US8 A;  2SAK A;  2W54 A;  2ZVO A;  2NR2 A;  2CU3 A;  3GE3 C;  2CU1 A;  3MJ5 A;  2FID A;  4KSK C;  3EA6 A;  1OQQ A;  4II2 B;  1ESF A;  1WJ6 A;  3ZJV A;  4KVG B;  3P4Q B;  4RM9 A;  2QMT A;  2WDV B;  2Q5W D;  3HIZ A;  4LNF A;  1QF6 A;  4ICU A;  1R4M I;  1F9J A;  3A9J B;  2G3Q B;  4FLH A;  1F2R I;  5DPW A;  3SD5 A;  3RPF C;  2I2Y A;  1FD6 A;  3W5V B;  4HK2 A;  4XC2 A;  2LZ6 A;  2IPK D;  1JML A;  3NVV A;  3PGE A;  3VVW B;  2LGX A;  3PRP B;  1V1P A;  2IGH A;  1V80 A;  5MPO A;  2KT7 A;  3HUI A;  5C1Z A;  5HFY A;  2BVC A;  3AH7 A;  4BOZ B;  1JWS D;  3WAN A;  1RWS A;  3DWG C;  3C8Y A;  3MC9 A;  2YEP F;  4GXB A;  4YL8 A;  4D2K A;  2PPH A;  1QQR A;  5L95 C;  2WXR A;  1Z2M A;  3M62 B;  3RMK C;  2ZCC A;  1V5O A;  5KHO A;  1STE A;  2KQ7 A;  1XLQ A;  2LGS A;  2OOB B;  4BFR A;  1TGZ B;  4MSQ B;  3HHM A;  3X23 A;  4XWW A;  2LHD A;  3WAL A;  1HEZ E;  3BY4 B;  1WJU A;  1WM2 A;  3CST A;  3PHX B;  1V81 A;  2ZNV B;  1FRD A;  2WNM A;  1E0Z A;  4DXF A;  1D4B A;  4ANV A;  3Q2A C;  3JSV B;  3ETR A;  2KXJ A;  2IO3 B;  4JIO U;  5CX3 A;  3ZGZ A;  4B0M A;  2D5G A;  1B9R A;  2MW5 A;  2DZJ A;  1SF0 A;  4NY0 A;  2Y5P A;  2G45 B;  1IYF A;  2SEB D;  4NZL B;  2K39 A;  1ZUD 2;  1UEL A;  3ZNH B;  1P7E A;  5AEK B;  2KKC A;  3SR6 A;  2V3N A;  3ALB A;  2NBV B;  4MGZ E;  1UZX B;  1T0S C;  2GB1 A;  2DBY A;  3B0A A;  3VXW A;  1UUP A;  1QT9 A;  4LTU A;  1JCK B;  4NAM A;  3BVZ A;  4BKS D;  2NVU I;  4IOI E;  2BKF A;  2W55 A;  2BYT A;  1AAR A;  1V1O A;  2MLB A;  3WA0 A;  3ZXV A;  3U7Z A;  2NTT A;  3H6N A;  1WE7 A;  4RGM A;  4EOY A;  4HKQ A;  2NBU A;  1UD7 A;  2V4I B;  3B9J A;  3DPD A;  3DVN U;  3R7R A;  1G6J A;  4HXD A;  3T3N A;  4XGA B;  3LB8 C;  2LMC A;  4EZK A;  1BML C;  4CHK A;  1EWY C;  1TJE A;  1P0R A;  1BUI C;  3I9V 1;  2V1Y A;  3ZQ4 A;  4PS7 A;  2N4F A;  4FJY A;  2M4N A;  4P1B C;  3Q3J A;  2LGI A;  1XLN A;  2DLB A;  1ZKH A;  2GBJ A;  4M01 A;  1XEE A;  1CJE A;  2L8J A;  4E74 A;  2KNB A;  3UQA A;  3Q8C A;  3NZS A;  1C1Y B;  3ABV B;  3NUH B;  4BBN C;  1T6B X;  2QDF A;  1E8Z A;  4LDT D;  2JRH A;  2MRP A;  2WXL A;  5C3J B;  4RNA A;  1ZGU B;  2WDT B;  4FJV B;  1N62 A;  2KTF A;  3RNA C;  2XBB C;  2KFK B;  3UIN B;  2VRR B;  3VHT C;  2IJ0 A;  4BKT A;  2BS3 B;  4C56 C;  2K5P A;  2REX A;  4ZDV A;  3BK2 A;  2L3Z A;  5AZH A;  3VUX A;  4AJY B;  3PSE B;  4LK0 M;  3EFC A;  3V62 A;  3A33 B;  1EU3 A;  4KDL B;  3PZD A;  3IAM 1;  1YQB A;  1V49 A;  5C23 A;  4KIK A;  4AS1 A;  2N7E A;  1C3T A;  1F1H A;  2H89 B;  1GJZ A;  4RGO S;  2LVQ A;  5IO9 A;  1MFW A;  1UH6 A;  3A9K A;  3FKY A;  2KTR A;  2AEH A;  1IBX B;  2AQ1 B;  3QQ8 B;  1SEB D;  3IXS A;  2DAF A;  2WXN A;  1WH3 A;  1IUE A;  1FM0 D;  3DDC B;  1WXA A;  2WXF A;  3D32 A;  5DPT A;  2LUE A;  1TS5 A;  1PUT A;  3DBR I;  2RDB C;  4TQ0 A;  2IDY A;  4CYE A;  2J53 A;  1F2R C;  1UBQ A;  1WGH A;  1TY2 A;  1D3Z A;  3PLV A;  5BMH A;  4DQO C;  4ZYS A;  1KOT A;  5D7G A;  2BYF A;  3Q8A A;  1L5P A;  2MBB B;  1F0Z A;  5E6P A;  2LAS A;  3MTN B;  4N6E B;  2AYO B;  1I4Q A;  1ROE A;  2W3S A;  1IP9 A;  3R8B A;  4EUT A;  4ZRP A;  2WX0 A;  4AJW A;  1D5Z C;  2WYQ A;  3DBH I;  4M8N A;  1UWX A;  2MP2 A;  2CHX A;  3U7D A;  3EGR A;  4FBJ B;  1XCQ L;  1YX6 B;  1E8X A;  1JWU D;  4TQ1 A;  2O6V B;  1ET9 A;  1WR1 A;  2K1F A;  5IOI A;  1FFU A;  3U30 A;  1YQ3 B;  2PMV A;  3P63 A;  4NJC A;  4W9I A;  3TEY A;  1OQR A;  4KZC A;  1NI2 A;  3R2I A;  4Q2J A;  3CF6 E;  4URK A;  3GOE A;  2NPT B;  2R2O A;  1PYW D;  1VJK A;  2MBH A;  2C60 A;  1FNV A;  1N5W A;  4CO7 A;  4WJN A;  1HTO A;  1WMH A;  3EEC A;  1LM8 B;  5AUK A;  3K9P B;  4RM8 A;  4H2A A;  2FE8 A;  3ZDT A;  1SE9 A;  2LRU A;  2MBQ A;  3P4P B;  4HPM B;  4JGH B;  1YOV B;  3LXF A;  4YWG G;  2K6D B;  2ZEQ A;  3L17 A;  1C4P A;  2A5U A;  3ZO5 B;  2KAN A;  1NI3 A;  3W1Y A;  2LD9 A;  3TMP B;  2C7M B;  4WJQ A;  1A5R A;  3RNB C;  2BB5 A;  1N61 A;  1ZXH A;  3A1Q A;  1EUV B;  2NBW B;  2LGY A;  4LNN A;  2YVC A;  4RGN A;  2KMC A;  4GDL A;  1GOZ A;  2RDH A;  4P16 A;  3H7P A;  2JZZ A;  2XEW A;  2KC1 A;  2ZVN A;  2LHE A;  2CJO A;  3EHV A;  2I1J A;  2K0P A;  1ZDX A;  2G9H D;  4AWJ A;  2KJR A;  2TSS A;  2GLS A;  3UQB A;  5T8I A;  3B08 A;  3V6C B;  4LDT B;  2WS3 B;  2J7Q B;  2VZK D;  5G55 A;  2L52 A;  4RF1 A;  2JZP A;  2WU5 B;  2KVZ A;  1FRR A;  1WXS A;  1AN8 A;  4US9 A;  3VH4 B;  3L4P A;  2X8X X;  3MP9 A;  2I38 A;  4W9E A;  2IO0 B;  1K8R B;  1DYQ A;  2LFI A;  4HVB A;  3VR8 B;  1N63 A;  4GMV A;  2MX2 A;  3DHI C;  3N20 C;  4K7U A;  3N1X C;  1HTQ A;  1XF5 L;  1XO3 A;  1I4H A;  3AE1 B;  4JPS A;  3IAS 1;  3VUW A;  2J42 A;  2G4D B;  2D3C A;  4I6L B;  3AMZ A;  1WXQ A;  5AZF A;  3KYC D;  3JW0 X;  3RFZ B;  2LGD A;  4GGQ A;  2KX3 A;  3UF8 A;  1WXV A;  1WFY A;  2XK5 B;  1XLO A;  2RMM A;  3N3K B;  3EFU A;  2J4X A;  3E56 A;  4WUR A;  3ONS A;  3SU8 X;  3Q69 A;  4F1S A;  4M0W A;  1I7H A;  2MA9 B;  4HRO A;  2AL6 A;  1GG3 A;  5E6O A;  2M17 A;  4ARC A;  3SEB A;  2KLC A;  4KGS A;  4DXA B;  1DOI A;  2GOW A;  4ZYN A;  2BYV E;  2KK8 A;  2CHZ A;  4GOC A;  2HJ8 A;  2HD5 B;  3IT4 B;  2L32 A;  2JXT A;  3DBL I;  1WXM A;  3DOW A;  1OEY A;  1E7P B;  5EDS A;  4JX1 C;  4OW0 A;  4NNJ B;  2V3S A;  1GPX A;  3ENE A;  2JT4 B;  2BKR B;  1YQ4 B;  4BBN F;  3BVG A;  2N1V A;  5GMV A;  3NRZ A;  2XNA C;  3PHW B;  2JWU A;  1SE4 A;  3ZXR A;  2DZK A;  4NQL B;  5GXG B;  2ONQ A;  1L4Z B;  2KO3 A;  1FNW A;  2V3P A;  3ML9 A;  3LJ3 A;  2YEP B;  3OLM D;  3BYT B;  4IWQ A;  4GSW A;  2R2Q A;  2RDG A;  4DXG A;  3AE3 B;  1D5X C;  4TUU A;  3Q8E A;  3JVZ X;  3CSF A;  1FXA A;  3A9J A;  3HM3 A;  1V9J A;  2UYZ B;  2BS2 B;  4LJO B;  2BBC A;  1Q0W B;  3KUD B;  3M3J A;  4JE3 B;  3FIL A;  5DCN A;  2GBK A;  1ZW7 A;  1P98 A;  3MC0 B;  1PGX A;  3ZRC A;  3ZNG C;  3L10 B;  3TEZ A;  2HTH A;  1ZOY B;  4K3B A;  4EKU A;  3R7Q A;  1ENF A;  4YSY B;  3AEG B;  2RPQ A;  2NS5 A;  4RH6 A;  3TBL D;  4NAW B;  4WH4 A;  2GRI A;  1YN5 A;  1Y8R C;  3QCA A;  4DBG A;  1C76 A;  1ZXI A;  3I57 A;  1S3S G;  2AWT A;  3HVD A;  1WF9 A;  3APD A;  1NYQ A;  2QSD A;  2C5L C;  3AEF B;  1FXI A;  2KVR A;  2FCS A;  2ICI A;  4OZC A;  1WJN A;  3VDZ A;  2WXH A;  4ASW C;  1FEH A;  1V86 A;  4XYC A;  5I4D A;  2PVO D;  2J0K A;  4MGI E;  4W9L A;  2ON8 A;  4C4V B;  2JYE A;  1TKG A;  1BXT A;  3R3M A;  2AX5 A;  1CK1 A;  3NY5 A;  1YNT E;  2KN5 A;  1KF6 B;  2ACZ B;  3VUY A;  5J2R A;  4NJ6 A;  3KWL A;  4WWO A;  1UGJ A;  3GZN B;  5J18 A;  2K8B A;  1TKE A;  3V3X A;  3BIN A;  3B1L X;  4MM3 A;  2KJ6 A;  3DCG A;  3Q3M C;  1OTR B;  1YIW A;  4HPP A;  2MSE D;  1TYG B;  3WCQ A;  2MWS B;  1WIA A;  3R2T A;  3V61 A;  3VH3 B;  3K9O B;  1FMA D;  4JLC A;  4JWU C;  4ITK A;  1HQR D;  1M94 A;  2KWD A;  2M56 B;  3DWM A;  2KAJ A;  5FR6 A;  2LEK A;  5D94 A;  3T3O A;  4XWT A;  1JWB D;  2AQ3 B;  2K9X A;  4OVV A;  2Y5C A;  4MEL A;  4JL9 A;  2BYE A;  1TT5 B;  3I63 C;  1SE3 A;  5HG2 A;  5AUI A;  1UNS A;  2J52 A;  3AE7 B;  3AV8 A;  5IP4 D;  2IY0 B;  3AI5 A;  3A4S C;  5BMI A;  2KN4 A;  3OWE B;  4RGT A;  5DPR A;  2KZR A;  4DK5 A;  1PFD A;  2JWZ A;  2WDQ B;  2KWU B;  2JF5 A;  3U4E G;  2BW2 A;  3VRB B;  2HJ1 A;  5EE1 A;  1JRU A;  1WE6 A;  3B2F A;  2ZW0 A;  3B2G A;  2DYM A;  1EWC A;  4PYZ A;  1MVK A;  4YXD B;  4P6V F;  4KGT A;  3V05 A;  1KFY B;  2KDE B;  2MEK A;  4R3D A;  5BYQ A;  4C7Z A;  1JAL A;  2JQR B;  2KDB A;  1TS3 A;  1QOG A;  1XD3 B;  1X1M A;  2L0F A;  1J19 A;  3RNG C;  3ML8 A;  3QHT A;  4DWF A;  3N9Y C;  1XT9 B;  1BT0 A;  3I3T B;  4FHJ A;  1JRP A;  4E71 A;  1WRI A;  4GDK A;  3AE6 B;  1FPY A;  1L4D B;  3PZ8 A;  1XQQ A;  3CIR B;  3L16 A;  2FIF A;  1YN4 A;  1D6E C;  4MJS B;  3QC8 B;  4WWP A;  2MHJ A;  3SFE B;  4EZJ A;  2D11 A;  2N1W A;  1JRO A;  2KYW A;  5FKA C;  3AEA B;  3C19 A;  2PVG C;  4LCD E;  3PS6 A;  4ZRK A;  4S0R A;  3T8M A;  3Q8B A;  3R66 C;  1HA5 A;  2R61 A;  3RN9 C;  2JPH A;  1IBX A;  1OFF A;  3PT2 B;  3VQI A;  2LXA A;  4RF0 A;  1C78 A;  3KQ4 A;  2DAJ A;  2EMT A;  2FUG 1;  3DQV A;  3TSS A;  4HWI B;  4WAA A;  1WYG A;  3QWZ B;  4WQM A;  4GN1 A;  2C7H A;  3TCA A;  2WWZ A;  1GUA B;  1KJT A;  1T3Q A;  2KQ4 X;  2CKH B;  4FHK A;  3PPA A;  2L1A A;  1C4C A;  4JQW C;  2O2V B;  1QZE A;  2MQJ A;  1T0Q C;  4KIK B;  2Z0E B;  2LJI A;  3URY A;  4EE2 A;  1QOA A;  4K7W A;  1ISN A;  1R4N B;  2G1E A;  3A9K B;  1HZ5 A;  1YX5 B;  2KTR B;  1LFD A;  1RLF A;  4YTM B;  4OVZ A;  3V60 A;  1MHX A;  4KSL C;  1GNU A;  2KX0 A;  1CQV A;  3TJP A;  4WWM A;  4I6P A;  5D6J B;  2M0X A;  4NQK E;  2L0T A;  4G50 A;  4G0N B;  3OG5 A;  5TR5 A;  3ZNI D;  1RFK A;  2OHF A;  3AEB B;  3N30 A;  4M8M A;  4XDC A;  1ACC A;  4QAY A;  3NJT A;  2NTS A;  3T9L A;  3RD2 A;  2IO2 B;  4AUQ C;  2NPT A;  4X57 B;  1UGM A;  2N9P C;  1EM7 A;  1WYW B;  1AYF A;  3W1S A;  3AUL A;  4HDQ A;  3V6E B;  1TBE A;  4MSM B;  1T0Y A;  2L05 A;  1QOF A;  2C7N B;  3DVG Y;  4IM2 A;  4G11 A;  1SIF A;  3TIX A;  2KAC A;  5CTR C;  4IWO A;  3KLS X;  4ZOH C;  5IKC M;  4ZRJ A;  2DWQ A;  2NMQ A;  1L6V A;  4HJG E;  4YT0 B;  3N1Z C;  5TSS A;  1PQS A;  4A20 A;  5KHQ A;  5LLI A;  1TS4 A;  4EFO A;  4KKJ A;  3RZW C;  1I4R A;  1MHH E;  3WAM A;  1J0G A;  1HXY D;  3P42 A;  3ZVV A;  5JHA A;  1WSP A;  4FUL A;  4RFB A;  1RRB A;  3SDL C;  1JWA D;  4G3X B;  3BYY B;  3RNF C;  3NG0 A;  1QKZ A;  4ICV A;  1SB3 C;  2BS4 B;  2AL3 A;  2PLP A;  4DHZ B;  3IFW B;  3KUC B;  3RNC C;  1J7C A;  3P4S B;  4JWS C;  4NJ7 A;  3ZJU A;  3DHG C;  2ZCB A;  4C7Y A;  2MBE A;  2HDE A;  4KX6 B;  1NBF C;  3PZ7 A;  1XXG A;  4B95 A;  1WGR A;  3M63 B;  1I4X A;  1Z5S B;  4BOS C;  1Q10 A;  1LXD A;  4KGR A;  4RCO A;  3Q6B A;  4ARI A;  1K53 A;  3DVN V;  3QIJ A;  4HCP B;  4K1R B;  1WZ0 A;  1ZDV A;  3U8Z A;  1GAQ B;  3WAO A;  3UIP B;  3PV1 A;  1E7U A;  2GBM A;  3ZIM A;  1C79 A;  2ZNV C;  1I4G A;  3IT6 B;  3RYT A;  1I4P A;  5HKH A;  4KDI C;  4C80 A;  3CWI A;  3VRA B;  1L6U A;  1J8C A;  1L0V B;  3OJ3 A;  4HDO A;  4P1C C;  4MEM A;  5D3I B;  4HLE A;  5IN7 A;  1YD8 U;  2A4Z A;  2RD0 A;  5H92 C;  4K81 A;  4II3 B;  2QIE B;  1XCT L;  4PS8 A;  2KDF B;  1NVI D;  1H8C A;  3PRE A;  3PO0 A;  2C9W B;  3AEC B; 
#chains in the Genus database with same CATH homology
 1YN5 A;  3T3N A;  3BWU D;  3LYY A;  3LB8 C;  1ZE3 D;  2LMC A;  4A6Q A;  2X38 A;  1C4A A;  4YSZ B;  1BML C;  3ZJT A;  1C76 A;  1ZXI A;  3I57 A;  1EWY C;  1TJE A;  4O1N A;  3HVD A;  2JU6 X;  3U2S C;  1BUI C;  3I9V 1;  3ZQ4 A;  4MH8 A;  1JWM D;  1NYQ A;  2IGG A;  2QSD A;  4XE0 A;  2CJN A;  3AEF B;  1FXI A;  2LGI A;  1XLN A;  2DLB A;  5JXV A;  1ZP0 B;  1TS2 A;  1XEE A;  1CJE A;  1SE2 A;  2ICI A;  4KKI A;  3NVW A;  4HEA 1;  3AE8 B;  4OZC A;  3ZYY X;  4REZ A;  1LO5 D;  2KMM A;  2WXH A;  1P7F A;  3Q8C A;  1FEH A;  3ABV B;  3HVZ A;  2WXM A;  1SJE D;  3NUH B;  5I4D A;  1KLG D;  3NS1 A;  1T6B X;  2PVO D;  3BVM A;  2FBW B;  2ON8 A;  4WIP A;  2WXL A;  2JYE A;  2E3T A;  2RPV A;  4RNA A;  5C3J B;  1TKG A;  1BXT A;  2MJE A;  4LLG M;  4ZRQ A;  1R7S A;  1N62 A;  1CK1 A;  2AX5 A;  4GLS C;  1FO4 A;  5EE3 A;  1YNT E;  2JYT A;  2IJ0 A;  2BS3 B;  1KF6 B;  2K5P A;  4C56 C;  1L0Y B;  2ACZ B;  3BK2 A;  5G5G A;  3KWL A;  1B1Z A;  1DOX A;  2WXG A;  4LK0 M;  4A90 A;  1UGJ A;  2ZW1 A;  2AQ2 B;  1WWT A;  1TKE A;  1EU3 A;  3V3X A;  3IAM 1;  1N60 A;  1K51 A;  2K3U A;  1SIJ A;  5FR3 A;  4AS1 A;  5HI1 A;  3TEW A;  2H89 B;  1VR9 A;  4TSS A;  1TYG B;  4RGO S;  3WCQ A;  2M19 A;  1MPE A;  3SFD B;  4A8X C;  3FC4 A;  2WXO A;  1FFV A;  3R2T A;  1IBX B;  5E6J A;  2AQ1 B;  4A9A A;  1SEB D;  3IXS A;  1FMA D;  3TEX A;  4JWU C;  2WXN A;  4ITK A;  1E10 A;  4OZA A;  1HQR D;  4L2Y A;  2KWD A;  2M56 B;  3DWM A;  3W5U B;  1SSN A;  2Y3A A;  2KAJ A;  4GDL B;  2LEK A;  1YJJ A;  3GP7 A;  1IUE A;  1FM0 D;  1M4V A;  4YTP B;  2V0G A;  5C2T B;  3T3O A;  1YJI A;  1DOY A;  4XWT A;  3AE5 B;  2WXF A;  2BTE A;  4ZHP A;  1TS5 A;  1PUT A;  4WAF A;  4TQ0 A;  2IDY A;  2W3R A;  2J53 A;  4N59 A;  3BZD B;  1JWB D;  2AQ3 B;  2K9X A;  4USA A;  4UDU C;  2Y5C A;  2WXJ A;  1F2R C;  4HKZ E;  1VZ8 A;  2INN E;  1RYJ A;  1TY2 A;  1SE3 A;  5BMH A;  4DQO C;  2INP E;  4ZYS A;  5HG2 A;  5AUI A;  5D7G A;  2J52 A;  1UNS A;  1L5P A;  3AE7 B;  2MH7 A;  3AV8 A;  3Q8A A;  2GI9 A;  1F0Z A;  3AEE B;  4L23 A;  5BMI A;  2KN4 A;  3OWE B;  4N6E B;  1I4Q A;  1ROE A;  2MJ3 A;  2W3S A;  4RGT A;  3R8B A;  1JW9 D;  1FCC C;  1PFD A;  4PT5 A;  2WDQ B;  3UI3 A;  4ZRP A;  1F77 A;  1HZ6 A;  3U4E G;  1D5Z C;  2N9K A;  2BW2 A;  2W82 A;  1UWX A;  5BMG A;  1KRH A;  3E9S A;  3EGR A;  3VRB B;  1XCQ L;  5EE1 A;  1JWU D;  1VDV A;  3B2F A;  4TQ1 A;  1NYR A;  2ZW0 A;  1ET9 A;  2L83 A;  3B2G A;  2DYM A;  3FIL B;  1EWC A;  4L1B A;  1FFU A;  2HTM E;  1MVK A;  2WDR B;  2VZK B;  4P6V F;  4YXD B;  1Y56 A;  1FIQ A;  2XN9 C;  4KGT A;  3V05 A;  1KFY B;  2JSV X;  3AED B;  1YQ3 B;  2PMV A;  2N0S B;  3P63 A;  2MEK A;  3P1M A;  4R3D A;  3GB1 A;  4HRS A;  1KH0 A;  3HRD D;  4NJC A;  5HHD G;  5BYQ A;  4C7Z A;  1T5X D;  1JAL A;  3TEY A;  1C9F A;  2JQR B;  1TS3 A;  1E9M A;  1OQR A;  1QOG A;  2WXK A;  3R2I A;  1SXT A;  4Q2J A;  1DGJ A;  1KLU D;  3GS2 A;  2B76 B;  3N9Y C;  1PYW D;  1JRP A;  5EE0 A;  1WRI A;  1VJK A;  1FNV A;  2BT6 A;  1V1P B;  1N5W A;  3AE6 B;  3BK1 A;  1FCL A;  1L4D B;  3FAH A;  3PZ8 A;  3U52 E;  5BYS A;  1FNU A;  2DYO A;  3CIR B;  1YN4 A;  5AUK A;  1D6E C;  4H2A A;  3SFE B;  3AE4 B;  2FE8 A;  2WXI A;  3TUO A;  3O13 A;  1YMH E;  1JRO A;  3H8H A;  2PKO A;  3P4P B;  4AQ7 A;  1QIL A;  3AE2 B;  3LXF A;  4YWG G;  4OHJ A;  3J9C A;  5FKA C;  1VRA B;  3AEA B;  1V8C A;  3AN1 A;  4MAC A;  1C4P A;  1GB1 A;  2PVG C;  4J3O D;  1VZ6 A;  3W2D A;  1TZO A;  1NI3 A;  1QOB A;  2QIL A;  3Q8B A;  3NVY A;  1HA5 A;  2R61 A;  1IBX A;  1NEK B;  1SBB B;  1OFF A;  4XDD A;  2BB5 A;  1N61 A;  3VQI A;  1ZXH A;  2PTL A;  4RF0 A;  1C78 A;  3KQ4 A;  4RGN A;  5FK9 C;  2FUG 1;  1GOZ A;  2RDH A;  4P16 A;  4MT5 A;  1WGK A;  3TSS A;  1J7B A;  1WYG A;  3AE9 B;  4WQM A;  4CQN A;  3VR9 B;  1XLP A;  2LHE A;  2CJO A;  3AB5 A;  2H88 B;  1T3Q A;  2K0P A;  1ZDX A;  1VLB A;  1TKY A;  2KQ4 X;  2G9H D;  2L1A A;  1C4C A;  2TSS A;  1N5X A;  5BYR A;  2JX5 A;  5T8I A;  3MFG A;  4MM3 B;  1A70 A;  2WS3 B;  2VZK D;  5EE9 A;  1MI0 A;  2L52 A;  2WU2 B;  3BII D;  4RF1 A;  2JZP A;  4ZHO A;  4US8 A;  2LJI A;  2SAK A;  2W54 A;  2WU5 B;  3URY A;  4EE2 A;  1QOA A;  3MHZ A;  1FRR A;  2CU3 A;  2G1E A;  3MJ5 A;  1HZ5 A;  1AN8 A;  4US9 A;  3EA6 A;  1PGA A;  1OQQ A;  2N7J A;  4YTM B;  1CZP A;  3L4P A;  1ESF A;  3MP9 A;  2I38 A;  4OVZ A;  3ZJV A;  1MHX A;  2WXQ A;  3P4Q B;  2QMT A;  1DYQ A;  2LFI A;  2WDV B;  2Q5W D;  1CQV A;  4WWM A;  3W9C B;  4A55 A;  3VR8 B;  1N63 A;  1QF6 A;  2EKI A;  5D3D A;  1RFK A;  1K52 A;  2OHF A;  3NVZ A;  3AEB B;  1F2R I;  1XF5 L;  1XO3 A;  1I4H A;  2WXP A;  2Z8L A;  3RPF C;  2I2Y A;  1FD6 A;  3W5V B;  3AE1 B;  4JPS A;  3IAS 1;  4XDC A;  1ACC A;  2J42 A;  1ET6 A;  2MJD A;  1SJH D;  2NTS A;  2IPK D;  1JML A;  3AMZ A;  1WXQ A;  3NVV A;  2QJL A;  5G5H A;  3RFZ B;  1EM7 A;  1D5M C;  1AYF A;  3W1S A;  1ZPS A;  1AWD A;  1V1P A;  2IGH A;  1EU4 A;  3EUB 2;  3P4R B;  1TY0 A;  1XLO A;  2RMM A;  1QOF A;  5MPO A;  2J4X A;  3HUI A;  5HFY A;  3AH7 A;  1JWS D;  1IGC A;  3E56 A;  4WUR A;  1RWS A;  2KAC A;  3Q69 A;  2E6X A;  3KLS X;  4M0W A;  1I7H A;  1L0X B;  3DWG C;  4ZOH C;  4HRO A;  3C8Y A;  2YEP F;  4D2K A;  2WQY B;  4ARC A;  2DWQ A;  1QQR A;  2NMQ A;  1L6V A;  1NEN B;  4HJG E;  3SEB A;  2WP9 B;  2WXR A;  4KGS A;  4YT0 B;  5TSS A;  1STE A;  4IKG A;  1DOI A;  1XLQ A;  1TS4 A;  1J7A A;  2EEL A;  4KKJ A;  1AW7 A;  1I4R A;  1MHH E;  1RM6 C;  4YSX B;  4XWW A;  2LHD A;  1HXY D;  3P42 A;  3IT4 B;  2L32 A;  2JXT A;  1WSP A;  5H8Y E;  4RFB A;  1JWA D;  3BYY B;  1HEZ E;  1QKZ A;  1SB3 C;  2M0A A;  1E7P B;  4GDK B;  2BS4 B;  4JX1 C;  1FRD A;  2WNM A;  4OW0 A;  1E0Z A;  4DXF A;  1D4B A;  2PLP A;  1PGB A;  1GPX A;  1K50 A;  3ETR A;  1IGD A;  1QLB B;  1YN3 A;  3ZGZ A;  1J7C A;  1YQ4 B;  5LNK 1;  3P4S B;  4JWS C;  4B0M A;  2D5G A;  1B9R A;  3BVG A;  3ZJU A;  3NRZ A;  2XNA C;  2JWU A;  4C7Y A;  1SE4 A;  2HDE A;  1SF0 A;  4KX6 B;  5GXG B;  2ONQ A;  3PZ7 A;  1JQ4 A;  1XXG A;  1L4Z B;  1C77 A;  1FNW A;  2V3P A;  2Y5P A;  1I4X A;  2SEB D;  2BB6 A;  2YEP B;  1GB4 A;  4NZL B;  1Q10 A;  1UWM A;  2N9L A;  3BYT B;  1ZUD 2;  2OED A;  4IDI A;  3NZ3 A;  4KGR A;  4RCO A;  1VZ7 A;  4ARI A;  1P7E A;  1K53 A;  2RDG A;  4DXG A;  3SR6 A;  2V3N A;  3AE3 B;  4N58 A;  2GB1 A;  1PDX A;  1D5X C;  2DBY A;  1ZDV A;  1GAQ B;  1UUP A;  3Q8E A;  1QT9 A;  4LTU A;  1JCK B;  4NAM A;  2IGD A;  1FXA A;  2LUM A;  1C79 A;  4FXC A;  3Q8F A;  1I4G A;  3BVZ A;  3IT6 B;  2BS2 B;  1I4P A;  2BBC A;  1E6E B;  4IOI E;  4C80 A;  1V97 A;  3CWI A;  1L6U A;  3AM9 A;  3VRA B;  4JE3 B;  2W55 A;  2QEJ C;  1L0V B;  3FIL A;  4TMA B;  2BYT A;  1V1O A;  1KTK A;  2PW9 A;  3KWV A;  4YTN B;  2K22 A;  5D3I B;  3U7Z A;  2WLB A;  3MC0 B;  1PGX A;  2NTT A;  2KDM A;  3TEZ A;  5H92 C;  2QIE B;  1XCT L;  4RGM A;  1ZOY B;  4HKQ A;  4B0E A;  1ENF A;  4YSY B;  2PIA A;  1NVI D;  2V4I B;  3B9J A;  3AEG B;  3PO0 A;  4RH6 A;  3AEC B;  4NAW B;  4WH4 A;  2GRI A;  4OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...