1FXAA

Crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords [2FE-2S] FERREDOXIN
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxaA00
1FFUA 1QOAA 1UWMA 1QLBB 1QOGA 2WDVB 1JWAD 1GAQB 2WP9B 1RFKA 1VJKA 3L4PA 3P1MA 5AUIA 2EKIA 3P4PB 1N60A 2KAJA 1NYRA 2L83A 3AH7A 3AE6B 1L5PA 3AE3B 4YTMB 1TKGA 3AE2B 5C2TB 1EWYC 1XO3A 4HROA 1N5WA 3AM9A 2QIEB 4LTUA 1OFFA 1PUTA 1XLNA 1NI3A 1KF6B 3AE7B 3KWLA 2WU5B 3P63A 3VR9B 3WCQA 2JX5A 4YTPB 1NEKB 2BS3B 2PVOD 1TYGB 3P4SB 2QJLA 1SIJA 2ACZB 3HRDD 1XLQA 2CJNA 4N58A 1JROA 1RWSA 5EE9A 1QOFA 5EE3A 3B2GA 3W5UB 4ZHOA 1V8CA 1YJIA 4KX6B 1DGJA 2WDQB 2PIAA 3AE5B 1L6UA 1YQ3B 1FRRA 1WGKA 1XLOA 1YJJA 2CU3A 2DBYA 2OHFA 1QOBA 1J7CA 1ZXIA 3AEGB 4YTNB 4C7ZA 4YSXB 1E0ZA 3LB8C 1DOYA 1VDVA 4N59A 1FM0D 2Q5WD 3NS1A 2H88B 2WS3B 1ZOYB 3AE4B 3ETRA 3PO0A 4FXCA 1A70A 4USAA 5GXGB 3BIID 3W9CB 1JRPA 1WRIA 1ROEA 1OQQA 4YSZB 1SF0A 1QT9A 4IDIA 5C3JB 1KRHA 5G5GA 5H92C 4C7YA 1E7PB 2WDRB 2K9XA 1NENB 3AE8B 1JW9D 1JWBD 1WWTA 3DWMA 3NVVA 1E10A 3NVWA 1F0ZA 1I7HA 1NYQA 4YT0B 4JWSC 1N63A 3EUB2 1J7BA 1J7AA 4US8A 2H89B 1AWDA 3AMZA 2WQYB 3AB5A 3FAHA 3AE1B 2MJDA 1IUEA 5G5HA 1FIQA 1E9MA 4HRSA 2K5PA 2LEKA 4WQMA 4WWMA 2N0SB 2BS2B 1FXIA 1SB3C 2AX5A 2E3TA 2CJOA 2W3RA 4ZHPA 1NVID 1FFVA 1ZUD2 3AEFB 2PKOA 2DWQA 5H8YE 3NVYA 4YXDB 1RM6C 4ZOHC 1L6VA 2Y5CA 1FO4A 1CJEA 1N61A 3AEAB 1PFDA 1RYJA 1T3QA 1L0VB 2W55A 1TKYA 3HUIA 2FBWB 3NVZA 3RPFC 3NRZA 4JX1C 4JWUC 1CZPA 3CIRB 3LXFA 1V97A 3DWGC 1WYGA 2WU2B 3B2FA 3FC4A 2W3SA 2PVGC 4YSYB 4C80A 1E6EB 1DOXA 1DOIA 3B9JA 2HTME 1FRDA 1TJEA 2MJEA 1FMAD 1KFYB 2WLBA 3P4QB 2W54A 1QF6A 1FXAA 3AE9B 2G1EA 2K22A 3AV8A 2M56B 2L52A 1R7SA 2JQRB 3AECB 4N6EB 3SR6A 3VR8B 4ITKA 3AEDB 1VLBA 1PDXA 1YQ4B 2BS4B 3AEEB 3AN1A 5EE0A 2BT6A 1ZP0B 5MPOA 1JALA 3W5VB 1OQRA 1N5XA 2KMMA 1AYFA 3ABVB 1XLPA 3AEBB 3HVZA 4P6VF 4US9A 2MH7A 3VRAB 1B9RA 3SFDB 3VRBB 2M19A 5AUKA 2B76B 2MJ3A 3CWIA 4A9AA 1JQ4A 1WXQA 1N62A 3SFEB 3P4RB 1GPXA 5EE1A 3ZYYX 1TKEA
chains in the Genus database with same CATH superfamily
3R8BA 2HD5B 5L83A 1F52A 4XYCA 1C78A 4ICUA 3X23A 3N20C 4WJQA 4J6IA 4WJOA 2BF8B 3PZDA 3QARA 2KC1A 3ZIMA 2XN9C 2REXA 3VUYA 4C4VB 3LJ3A 4P7IA 3QC8B 3I3TB 1MVKA 4CQNA 4BAXA 1QOFA 1ISNA 3OLMD 4L23A 4RCOA 2WXNA 1UZXB 4HVBA 3DBRI 2KDBA 2BVCA 2Q5WD 4W9CA 2L7RA 4FHJA 2ZNVB 1P1AA 4ICVA 5GXGB 1ROEA 2KJ6A 3ZW3A 5C3JB 4YWGG 3UQAA 1IBXB 2JT4B 4B0MA 3ZNID 2B3AA 1Z5SB 1SJHD 1IP9A 4M0WA 5G5HA 4WWMA 2KVRA 4E71A 2N0SB 4ANUA 1V6EA 1WF9A 2KOXA 2LGYA 5IOIA 3T3OA 1TKYA 1T5XD 3NHEB 1FCLA 4XC2A 2MP2A 3QX1A 1WX8A 2EELA 2L32A 2MX2A 2L3ZA 3BY4B 2W54A 4GOCA 2FCSA 3QAQA 3SR6A 2C7HA 5DPRA 1YQ4B 2A4ZA 3PHWB 4NNJB 2LHEA 2K8CA 1TZOA 4NJ7A 5AUKA 1WFYA 4BBNC 4K7WA 2KN5A 4JIOU 1LM8B 2J0JA 4ANWA 4I6LB 5FR3A 2NVUI 4MH8A 2KX3A 2J42A 1C77A 1D6EC 4L1BA 4BFRA 4URKA 2FCNA 3RNFC 2C7MB 1KOTA 4TUUA 3MJWA 3AE6B 4M02A 1GOZA 2I1KA 3CSFA 3NZUA 3WIMA 2PE6B 1RRBA 1F2RI 2BS3B 1Y8RC 2BB6A 2KHWB 1K50A 2CJNA 2N9XA 3W5UB 3MJ5A 1YJIA 4MGIE 1K51A 1E7UA 2PIAA 3BYYB 1YQ3B 3KQ4A 4C7ZA 5JHAA 3ZRCA 2PTLA 1J8CA 3KVFB 3ZNHB 3ZO5B 4GDKA 2H88B 2WS3B 4FBJB 3Q3NC 2QEJC 3AI5A 3FKYA 2MW5A 1VZ8A 4UDUC 1I7HA 3ZXRA 2RPVA 1C1YB 1J7AA 1P7FA 2H89B 2N7EA 1Q0WB 3A1QB 1SB3C 1JRUA 2LVOA 5E6NA 3W1SA 1RFAA 1P0RA 2RSUA 5CHFA 1I4RA 1RYJA 3EC8A 2WDTB 3A4RA 3NRZA 1PYWD 2M0AA 3CIRB 3LXFA 3N1YC 2NS5A 3B2FA 4WWNA 3UF8A 3Q14C 1ZDVA 1JWUD 1V81A 1UELA 4CO7A 4MGZE 3PRZA 4XDDA 1EU4A 1HTOA 2MWSB 4KDLB 1FNUA 2KMMA 1YIWA 1TY2A 1L4DB 4KGSA 3H8HA 4DHZB 2Y3AA 3B08A 4K1RB 2KWUB 1P98A 4B6WA 2N9KA 1SBBB 1QOAA 1JWAD 3C19A 2JY6A 1EF1A 4FHKA 2L1AA 1R4MB 2DYMA 1N60A 3WA0A 4GXBA 2JVCA 5JHBA 2JYEA 3IVFA 3GE3C 2QJLA 1V5TA 2RDGA 4DXGA 3U4EG 1TZ1A 3SDLC 3MP9A 1WYWB 2GBKA 4MGKE 3N3KB 1YJJA 1QOBA 5FR6A 2LASA 2RR9A 1WIAA 2PMVA 1MFWA 5LLIA 4ARIA 3E56A 2JXXA 1JRPA 1WZ0A 1WX9A 1YJ1A 1RLFA 2K8BA 5FKAC 1WWTA 5KHQA 3CF6E 2DAFA 1J7BA 2LVPA 5D94A 4RGNA 4PS3A 4FA6A 2BS2B 3JSVA 5BMIA 3I63C 1WX7A 2G3QB 1Q5WB 4YXDB 4ZOHC 5FK9C 1NI2A 3DVGY 4RH6A 3AEAB 2KMAA 2W55A 5KHOA 2KDEB 4WJPA 2ZCCA 3TSSA 1MG4A 4OZAA 3RNBC 3MC0B 4YSYB 4WAAA 2NCNA 1FRDA 4HPMB 1TJEA 4J3OD 3S2AA 1FNWA 1HA5A 1FXAA 4TMAB 4HWIB 1YX6B 3DBLB 2M56B 5T8IA 1V9JA 1WE6A 3ZKJC 1XXGA 5MPOA 2WGSA 3DVNV 1XLPA 2TSSA 1SE3A 3PV1A 2DZIA 4RMAA 1V80A 1Z2MA 3C0RB 4A9AA 5AZGA 3NZ3A 1TS4A 3NJTA 1WGGA 4EZJA 1B1ZA 1GAQB 1STEA 1I4PA 2LGSA 4NJCA 2DHZA 2WNMA 2ICIA 2KZRA 3ZDMC 4EFOA 4AWJA 4IUMB 4DBGA 3RZWC 4WWOA 3AE3B 1ACCA 1TKGA 2EKEC 2PE9A 2WXRA 2QIEB 2KKCA 3Q6BA 1ZW7A 1WSPA 3VAWA 5D3IB 2V9HA 3Q3MC 3IT4B 4ANVA 5JH5C 1XLOA 1XCQL 4W9DA 1YNTE 2FIDA 3DQVA 4K81A 3DBHI 2NTSA 2AQ1B 2NBVB 4XWTA 4C7YA 3PVLA 1NYQA 4ZDVA 2KDMA 3SHQA 3EUB2 1FIQA 2WXIA 1TBEA 3K9PB 2DWQA 2KTRA 3NVYA 3OJ4B 4ZRPA 2Y5CA 2MQJA 3AULA 3OG5A 2LRUA 1BMLC 4A55A 2WX1A 1WM3A 4TV3A 4W9IA 4DWFA 2YEPB 2BW2A 2W3SA 2X38A 1DOXA 4G3XB 1C9FA 4HKZE 2K22A 1T0SC 2M0XA 1L2NA 3M95A 2JZZA 2MH7A 5J18A 1BUIC 1D5XC 4LNFA 2ZVOA 2L00B 1T0QC 4K7UA 3UIOB 2BYEA 4A90A 1VJKA 4NQKE 2KAJA 2JWUA 4HJKA 1BXTA 3PLUA 1XO3A 3B1LX 3VTVA 2XBBC 3VR9B 3V61A 3WCQA 3N32A 4HDOA 3L08A 2MBOA 4GSWA 3IT6B 2WXOA 2XEWA 1SXTA 2BWFA 2DBYA 2BQQA 2J0MA 5BO4B 2LRWA 3R2TA 2GLSA 2QDFA 4USAA 2GBRA 4EOYA 2JRHA 3U7DA 2KFKB 3TL5A 4MDKE 4W9HA 5HFYA 4US8A 4PYZA 4WAFA 1NVID 1ZUD2 3RFZB 1C76A 2N9PC 3NVZA 4RGOS 3RULA 4KDIC 2FBWB 3A9KA 4JE3B 4NAMA 4X57B 2DX5B 3DWGC 2FIFA 2SEBD 3EFCA 3Q8BA 4K3BA 5HG2A 3M3JA 1IGCA 1FMAD 2KMCA 1SSNA 1SIFA 2KTFA 4JPSA 1ZXHA 2K39A 4M8MA 5EE0A 2HJ8A 3A9KB 1LXDA 3DHIC 1TT5B 2BB5A 1HXYD 3KUCB 2HE7A 4MELA 2IYDB 3DPDA 2LUEA 3DDCB 3VVWB 1TKEA 3LDZE 3QWZB 3TMPB 4AQ7A 5AZHA 1QLBB 3L4PA 2LGIA 2CHWA 2EKIA 5D2MB 3JYUA 3IAS1 2C60A 3W1SC 1Q1OA 1UGJA 3D32A 5C2TB 4MEMA 3KH0A 3DOWA 1LQBA 1SE2A 4II3B 1RAXA 3PLVA 4DXAB 5EE9A 3IAM1 5HHDG 2BTEA 4OZCA 2D2QA 3BK2A 1KTKA 1J7CA 1ZOYB 2LI5A 2JZ3B 3UGBB 3EHVA 4R3DA 5G5GA 5E6PA 2NBWB 4PYUA 2LZ6A 4YT0B 1N63A 2IGGA 1A5RA 5GMVA 5AZFA 3ZNGC 3AB5A 2IY0B 2N1WA 1GB1A 2RDBC 4WQMA 4XZ4A 4I6NB 2PKOA 2C7NB 5LXHA 4M01A 1WGDA 3R7RA 4AP4C 4JWUC 1CZPA 4IKGA 4C00A 4PT5A 1WYGA 3Q2AC 1FNVA 2G1EA 2KK8A 4ITKA 2BS4B 4HEA1 2LD9A 1L0YB 3TBLD 2D11A 4OVZA 2YVCA 4IM0A 4C56C 4K3CA 1B9RA 2M19A 3C8YA 1E8YA 1S3SG 2BYTA 2OJWA 2IGDA 4H2AA 4AJYB 4WQOB 1U4AA 1E8XA 1WR1A 2IJ0A 4GDLB 3EECA 1L5PA 3AE2B 1ET6A 1N5WA 1OFFA 3KWLA 4MM3A 2LGDA 4TQ0A 3B0AA 2ACZB 1XLQA 2K3UA 4ZYNA 5EE3A 3L17A 2DAJA 4IW0A 5IO9A 3P42A 4FADA 3AE5B 3VUWA 4OW0A 4YTNB 2K8HA 2YEPF 2ZPYA 3ECIA 3HM6X 2PEAA 3NVVA 2AEHA 1E5WA 2KD0A 2KC2A 4D2KA 2BKRB 3RNGC 1WY8A 4A3PA 2K5PA 4GLSC 3V05A 2WXFA 2LJ5A 1MJDA 3AEFB 1JWSD 4LNIA 2AL3A 4JX1C 4IC7B 3H7PB 1R4NB 3PS6A 2WU2B 1Q10A 2J52A 4A6QA 2PVGC 2I2YA 4BZAA 1M4VA 1PGBA 4MJSA 3N30A 5E6OA 3AEDB 2BWES 2Z0DB 4DHJD 3FILB 1WMHB 3ZRFA 4M00A 5IA7A 2QILA 4ACFA 1GPXA 1ET9A 2Y5PA 4W9KA 2WDVB 2VZKD 2NTTA 4HCNB 2PPHA 3QIJA 2WX0A 1HTQA 5D3DA 5BYSA 3AH7A 2WWZA 4LNOA 1EWYC 3Q8EA 2UU7A 4LJPB 3HVDA 1I4GA 2N4FA 4LCDE 3MFGA 3URYA 1VCBA 1KLUD 3APCA 4ZHOA 3W1YA 4DDGD 2IPKD 2KLCA 4MJSB 1XEEA 4KIKB 1WXSA 3H7PA 1LO5D 3RN9C 1SF0A 2Z59B 1D5MC 1E7PB 3RD2A 3NVWA 2MBQA 3BZDB 3ZNZB 3TEXA 3HIZA 4DQOC 3AMZA 3DCGA 4KSLC 4LDTD 3T3NA 1E9MA 2GOWA 5DCNA 3UI3A 4AOFA 5BYRA 1TS3A 4KZCA 4ZHPA 4EKUA 4DXFA 1RM6C 1OGWA 3A1QA 4WURA 4MSQB 3IG3A 1KH0A 1V5OA 2WXPA 2WXKA 2V3SA 1EUVB 2NPTB 4C80A 2FAZA 2HTHA 3R2IA 1D4BA 2WXLA 3AXCA 1TIFA 1KFYB 3X0WA 2IO0B 3NZSA 3GZNI 3I57A 1UGMA 3W5VB 4P6VF 2KO3A 4IWPA 4LK0M 3VRBB 3K9OB 3CWIA 1TTNA 3TEWA 3UINB 3VTWA 1E8ZA 1HQRD 2NR2A 5AUIA 2LVQA 2J0KA 5DPTA 1ZPSA 1L7YA 1QQRA 1XQQA 3PRMB 4HROA 2V3PA 2JXTA 1PUTA 1F1HA 4F1SA 2O2VA 1TYGB 2I38A 1FXTB 1X1MA 3HRDD 5J17A 3NG0A 2L0TA 1DGJA 2WDQB 1AW7A 2ZVNA 4P16A 1EWCA 3PREA 2ZNVC 4NY0A 4FJYA 4JL9A 1HZ6A 3RNAC 4HJGE 3RNEC 4ZRIA 3H7SA 3AE4B 2OJRA 4KKJA 2BYFA 4JLCA 4REZA 3R3MA 1YX5B 1OQQA 4A20A 3DBRB 1S1QB 1NENB 3DWMA 4E74A 1F0ZA 1VZ6A 1WJUA 1I35A 2FCQA 4JWSC 4RGMA 1J0GA 3ZUNA 1ENFA 3AE1B 2DZKA 2RMMA 2LEKA 4DK5A 1SE9A 1SGHA 3BWUD 3ZTCA 2G9HD 1HEZE 3AU5A 3ZJUA 2JSVX 1J19A 5IP4D 3Q3FA 3R7QA 3ZJVA 3OWEB 2O2VB 4BKSD 4HPPA 3MC9A 2FUHB 4RGTA 3B9JA 3U2SC 3KW5B 4OHJA 1T6BX 3V60A 3MHZA 3KLSX 1VLBA 4YL8A 3RCZA 2UWQA 3GZNB 1CK1A 1AYFA 4US9A 1YMHE 2FE8A 4WJNA 1N62A 4GB9A 3HK0A 1GNUA 2JRIB 1I4XA 4M0WB 4EZKA 2MHJA 5J2RA 1SE4A 4HCPB 2V4LA 2AQ2B 3L54A 2PVOD 3CSTA 1PQSA 4F7ZA 1RWSA 4MACA 4W9EA 3BVGA 4KVGB 1V49A 3LB8C 4TKNA 3DVNU 2CKHB 3NS1A 5C23A 1SEBD 4IM2A 2CHXA 3BIID 3QK0A 1UNSA 5JZEB 4IDIA 4HLEA 1T0YA 2KX0A 2WHIA 2VH2A 4DDID 1E8WA 3VXWA 3NOBA 2MA9B 5HI1A 3R66C 4RNAA 2BKFA 4FLHA 5CHVC 2DENB 4DHZE 4HRSA 2GMIC 3KYDD 4GMVA 3QCAA 2AX5A 1V86A 2GB1A 2W82A 4NAWB 3SD5A 3ALBA 1L6VA 1FO4A 4P1CC 1T3QA 1L0VB 3RPFC 2XNAC 3O13A 3PHXB 4JGHB 1V97A 2CR5A 4AJWA 3BVMA 4CHKA 2OOBB 2EMSA 3VDZA 2RD0A 1XT9B 2XK5B 2I1JA 1DOIA 4ANXA 2LGXA 1WH3A 2MBEA 1D5ZC 4HPLB 1I42A 2WYQA 2INDC 3AEEB 3M63B 3ZGZA 3ABVB 3HVZA 5IN7A 1WZ3A 2O6VB 4EZLA 2DNFA 2K1FA 1N6ZA 3U8ZA 1JQ4A 4P1BC 4BOSC 3A33B 2RPQA 2DYOA 3P1MA 4KGRA 2L0FA 3GB1A 3P4PB 3Q8FA 4CYEA 5JXVA 1UWXA 3DHGC 2IO2B 2DZJA 2DYBA 2L76A 1L4ZB 2O6VA 2MP2B 1EU3A 2HJ1A 2N7DA 3OAWA 1UH6A 3OJ3A 2PW9A 1V8CA 4KX6B 2A5UA 3Q8CA 1L6UA 3HHMA 4II2B 2K25A 3QQ8B 2IGHA 4HK2A 1E90A 4YSXB 4FN2A 1M94A 1G6JA 4BOZB 4BKGA 4W9GA 3DHHC 4B95A 2N7JA 4OVUA 5H92C 2INNE 3WALA 1UUPA 3AE8B 4NJ6A 1K8RB 3U52E 4ZRQA 3A4SC 1MHXA 1GG3A 2IZVB 2LXCA 3ONSA 2E3TA 1QKZA 4Q2JA 1IGDA 3RI7C 5H8YE 3W2DA 1TGZB 3GS2A 4K7SA 3HUIA 1CMXB 2D3AA 3U7ZA 3M62B 1K53A 2R2QA 4NPNA 2IDYA 4W9LA 1E7VA 4N9F4 2M1MA 2ZW1A 4LDTB 3T9LA 3VH3B 1EM7A 3Q69A 4C4VA 2KNBA 2O6VD 3ENEA 4G50A 3DBLI 1MI0A 1WE7A 3H9DA 2N1VA 2N9LA 1V1OA 2WXQA 2ZCBA 1MG8A 4GN1A 4IM3A 4KZ0A 3V62A 4LNNA 2QSDA 3PZ7A 2KQ7A 1QOGA 1UBIA 1WJ4A 1WRDB 2QHOA 2L83A 2KTRB 3SEBA 2KVZA 4EUTA 3EFUA 1XLNA 2UYZB 2V0GA 3H1UA 1GUAB 1YN3A 3O65B 2R2OA 3P4SB 4GGQA 1SIJA 4RFBA 3ML8A 4XWWA 1NDDA 2AL6A 3PRPB 5D6JB 1ZGUB 2JPHA 2PLPA 2KFJA 1SJED 1EO6A 3TCAA 2ZW0A 4IOIE 4HKQA 2ASQA 3ETRA 4G11A 4HDQA 4I6PA 5IKCM 3RUIB 4F8CB 3DBSA 2KLGA 3UIPB 5E6JA 4PK1A 4IWOA 2ZJDA 2X8XX 3SU8X 3BK1A 2C9WB 1TS2A 1R4MI 4NAWA 1FFVA 3QHTA 2M4NA 3H6NA 4MGYE 1BT0A 2RGFA 2JZPA 1ZE3D 1N61A 1YN4A 2G4SA 2WXMA 2G45B 4W9JA 1I4HA 3PZ8A 3JW0X 2JU6X 3J9CA 3WAMA 3RMKC 1DYQA 2WLBA 3MC8A 2KN4A 4MT5A 1UBQA 3IFWB 2KANA 3AECB 4KKIA 2KQSA 3AN1A 4LJOB 3BVZA 2KWVB 3VRAB 1AARA 1H4RA 1GJZA 2KT7A 4MSMB 4XX5A 4A3OA 3IHPC 3VR8B 1JCKB 2KYWA 1FFUA 2JYTA 4RM8A 1VR9A 2K6QA 2WP9B 1RFKA 1TY0A 2PJHA 3EGRA 2M8SA 3L0WB 4YTMB 1AN8A 5EDSA 4LTUA 2K0PA 4KIKA 2OEDA 2JX5A 1NEKB 2YLMA 3TJPA 2G4DB 1FPYA 2AYOB 1WMHA 3B2GA 3L10B 2LHDA 2CU3A 1HE8A 4IG7B 3VHTC 3VUXA 5DPWA 1DOYA 3BYTB 3E9SA 4BKSA 2ZEQA 4B0EA 3RZFA 5L95C 1WRIA 2L05A 4YSZB 1QT9A 2JF5A 1KLVA 1D3ZA 2XK5A 4OZBA 1JW9D 1JWBD 3ML9A 3LYYA 1WXAA 1GB4A 2GRIA 2LWPA 2NBUA 3ZDTA 1C4CA 1IUEA 3PTFC 2GBMA 2NPTA 4KGTA 1WXMA 1P9DU 4BKTA 2WXGA 1C3TA 3KUZA 3V3XA 5AEKB 3ZVVA 3EA6A 2KACA 2MJEA 2MSED 1QF6A 2FUG1 2CU1A 3AE9B 2FNJB 2L52A 5LXIB 1OEYJ 2CS4A 3IXSA 2BT6A 1ZP0B 1QZEA 2RDHA 1N5XA 4M8NA 5BYQA 3AEBB 3VFKA 5HKHA 3SFDB 1R4NI 4E3CA 1WXQA 3FILA 2KQ4X 3SFEB 3ZYYX 3QA8A 2VRRB 1UWMA 3VH4B 1NYRA 1C4PA 4ZRKA 3TIXA 2KXJA 4ARCA 1NI3A 1KF6B 2WU5B 3RT3B 1VRAB 3NY5A 4WH4A 3RNCC 4FJZA 4GDKB 1GC6A 1FRRA 1WGKA 3APFA 3ZXVA 4KSKC 2MCNB 2ON8A 3DVGX 1VDVA 4N59A 4PS8A 2R61A 3GP7A 3PO0A 4FXCA 3BINA 2CHZA 1T0RC 2DZMA 3HM3A 5BMGA 1V1PA 2WDRB 4A8XC 2LUMA 2D5GA 2V4IB 4KV2A 2VZKB 4RM9A 1AWDA 1I4QA 4MH0E 3FAHA 4NQLB 2QCZA 1ZKHA 4PS7A 1FXIA 1K52A 1WJ6A 2CJOA 1YOVB 5D7GA 4OVVA 3P2BA 2KWDA 3JVZX 4ZYSA 4XDCA 2LXAA 2Z0EB 4BBNF 4B9KA 1V2YA 1LFDA 1IPGA 2JWZA 2FCMA 3V6CB 1UD7A 3NUHB 2QMTA 4GU2A 2GBJA 1PGXA 2D3BA 2HTME 1GC7A 3ZJTA 4RF0A 2HDEA 1KLGD 3AV8A 3GOEA 1R7SA 4N6EB 4W9FA 1CQVA 3WANA 1JALA 4HXDA 1XF5L 1YD8U 2BGFA 2KFKA 2IO3B 1EF5A 3L16A 1OEYA 2MJ3A 1TS5A 2SAKA 1JMLA 4XGAB 2J4XA 2INPE 2KJHB 3ZLZA 1YQBA 1WXVA 5G2NA 2DLBA 3RYTA 1WI0A 4L2YA 2V3NA 3KYCD 3AM9A 1V1PB 3AE7B 4YTPB 1WR6E 4AS1A 4EEWA 2MBBB 2ONQA 2Z8LA 4N58A 2E6XA 1JROA 4WWPA 5C1ZA 3MTNB 3WAOA 4DHJB 3T8MA 4FJVB 2MEKA 4RF1A 2OHFA 1ZXIA 3AEGB 1E0ZA 5LNK1 4XE0A 4S17A 2JUOA 2Y5BB 3PSEB 4AUQC 2AWTA 3W9CB 4ZRJA 1VZ7A 1UF0A 3APDA 2BPSA 1KM7A 1MHHE 3ZTDA 1WM2A 3VTUA 3A9JB 3JSVB 2GBNA 5DPSA 1FD6A 2WQYB 2MJDA 2L8JA 2M17A 3L13A 1MPEA 1C4AA 2W3RA 3Q3OC 2V1YA 4GDLA 1OQYA 3WAPA 2D10A 2D07B 1CJEA 4FULA 4JQWC 2KDFB 3KUDB 2LJIA 3A9JA 1NBFC 3FC4A 2MLBA 1P3QU 1E6EB 1XCTL 4S0RA 2GI9A 3P4QB 2AQ3B 3NS8A 4QAYA 3TUOA 2IBIB 2IO1B 2BBCA 2JQRB 3IBEA 4IWQA 3ZQ4A 3I9V1 2J53A 1WJNA 2WXJA 1QILA 1ZDXA 1IYFA 2LFIA 2B76B 4LNKA 2D3GA 1IBXA 3P4RB 3N1XC 1KJTA 3N9YC 3V6EB 2W9NA 3PPAA 3TEZA 2INCC 3AU4A 3KWVA 4O1NA 1HZ5A 1ESFA 3PT2B 3I5JC 3UQBA 3P63A 5CHWA 1H8CA 2IY1B 4TSSA 2N9EB 4EE2A 3Q3JA 1YN5A 1C79A 1LGRA 1FEHA 5CTRC 1Y56A 3MHSD 1XD3B 1FM0D 2KJRA 5G55A 3Q8AA 1A70A 5TSSA 1F2RC 2QC8A 3TEYA 5CX3A 1KRHA 2J7QB 2K9XA 1E10A 1JWMD 1L0XB 2KWCA 2NMQA 3U30A 5TR5A 2C5LC 1OTRB 2VH1A 2ZZPB 5IAAC 4LLGM 2MBHA 1F9JA 5I4DA 4MM3B 2D3CA 4NZLB 3GE8C 4ASWC 1VD2A 4BVUC 1WGYA 1PFDA 3QJZA 2ZPNA 2BYVE 1WGHA 1P7EA 1PGAA 2K6DB 2MRPA 1FCCC 3VQIA 5BMHA 2KDIA 1PDXA 1WGRA 2LMCA 2WXHA 3CMMB 3DBHB 1OQRA 3N1ZC 4TQ1A 1F77A 4GIVA 2EMTA 3PGEA 4WIPA 4G0NB 5EE1A
chains in the Genus database with same CATH topology
1FFUA 2JYTA 4A90A 1VR9A 1HQRD 2WP9B 1RFKA 1VJKA 3R8BA 1TY0A 5AUIA 3EGRA 1C78A 2JWUA 2KAJA 1BXTA 1ZPSA 1QQRA 4YTMB 1AN8A 1XO3A 2V3PA 4HROA 4LTUA 2JXTA 1PUTA 3VR9B 2K0PA 2OEDA 2XN9C 3WCQA 2JX5A 1NEKB 1TYGB 2I38A 3HRDD 1MVKA 4CQNA 3IT6B 1QOFA 2WXOA 3B2GA 1SXTA 1DGJA 2WDQB 1AW7A 4L23A 2LHDA 4P16A 1EWCA 4RCOA 2CU3A 1HZ6A 2DBYA 2WXNA 4HJGE 1DOYA 2Q5WD 3BYTB 3E9SA 3R2TA 3AE4B 4USAA 4KKJA 5GXGB 4B0EA 1WRIA 1ROEA 4REZA 1OQQA 4YSZB 5C3JB 1QT9A 4YWGG 1IBXB 1NENB 3DWMA 1JW9D 1JWBD 1VZ6A 4OZBA 4B0MA 1F0ZA 3LYYA 4JWSC 4RGMA 2GRIA 1GB4A 5HFYA 1C4CA 1SJHD 4US8A 4WAFA 4M0WA 1ENFA 3AE1B 1IUEA 5G5HA 2RMMA 4WWMA 2LEKA 2N0SB 3BWUD 4KGTA 1NVID 1ZUD2 3RFZB 1C76A 2G9HD 1HEZE 3ZJUA 3NVZA 4RGOS 3T3OA 2JSVX 1TKYA 2FBWB 1T5XD 1FCLA 2WXGA 4JE3B 3ZJVA 4NAMA 3OWEB 3DWGC 2SEBD 4RGTA 3V3XA 3Q8BA 5HG2A 2EELA 3EA6A 3B9JA 1IGCA 2KACA 3U2SC 2MJEA 2L32A 1FMAD 4OHJA 1QF6A 2FUG1 1T6BX 2W54A 3AE9B 1SSNA 3MHZA 4JPSA 2L52A 1ZXHA 3KLSX 3SR6A 1VLBA 3IXSA 1YQ4B 5EE0A 2BT6A 1ZP0B 1CK1A 2RDHA 1N5XA 1AYFA 5BYQA 2LHEA 3AEBB 4US9A 1YMHE 3SFDB 1TZOA 5AUKA 2FE8A 2BB5A 1HXYD 1WXQA 1N62A 2KQ4X 3FILA 3SFEB 5FR3A 3ZYYX 1TKEA 4AQ7A 4MH8A 1UWMA 1QLBB 2J42A 1C77A 1D6EC 3L4PA 2LGIA 4L1BA 1I4XA 2EKIA 1NYRA 3IAS1 1C4PA 3AE6B 1GOZA 1UGJA 5C2TB 1SE4A 4ARCA 1NI3A 1KF6B 1SE2A 2AQ2B 2WU5B 1F2RI 1VRAB 2BS3B 2PVOD 2BB6A 4WH4A 1K50A 2CJNA 1RWSA 3IAM1 5EE9A 3W5UB 4GDKB 4MACA 3MJ5A 1YJIA 5HHDG 1K51A 2PIAA 3BYYB 4OZCA 2BTEA 1YQ3B 3KQ4A 1FRRA 1WGKA 3BVGA 4C7ZA 3BK2A 1KTKA 1J7CA 2PTLA 3LB8C 2ON8A 1VDVA 4N59A 3NS1A 2H88B 2WS3B 1SEBD 2R61A 1ZOYB 3GP7A 3PO0A 4FXCA 2QEJC 3BIID 1VZ8A 1UNSA 4IDIA 4R3DA 5BMGA 5G5GA 4UDUC 1V1PA 2WDRB 4A8XC 2LUMA 2D5GA 2V4IB 1I7HA 4YT0B 1N63A 2RPVA 2IGGA 1J7AA 2VZKB 5HI1A 1P7FA 2H89B 1AWDA 1I4QA 3AB5A 3FAHA 4RNAA 1GB1A 4WQMA 4HRSA 1FXIA 1K52A 1SB3C 2AX5A 2CJOA 2GB1A 5D7GA 2PKOA 2KWDA 2W82A 4NAWB 3W1SA 4ZYSA 1L6VA 4XDCA 1I4RA 1FO4A 1RYJA 1T3QA 1L0VB 3RPFC 2XNAC 3O13A 3NRZA 4JWUC 1PYWD 1CZPA 2M0AA 3CIRB 3LXFA 4IKGA 1V97A 3BVMA 4PT5A 1WYGA 3B2FA 3NUHB 2QMTA 1DOIA 1FNVA 1PGXA 1ZDVA 1JWUD 2HTME 3ZJTA 1D5ZC 2G1EA 4RF0A 2HDEA 1KLGD 3AV8A 1R7SA 4N6EB 4ITKA 2BS4B 4XDDA 3AEEB 1EU4A 4HEA1 1CQVA 1L0YB 1JALA 1FNUA 2KMMA 1XF5L 3ABVB 3ZGZA 3HVZA 4OVZA 4C56C 1TY2A 1B9RA 1L4DB 2M19A 4KGSA 3C8YA 3H8HA 2Y3AA 2MJ3A 1TS5A 2SAKA 2BYTA 2N9KA 1JMLA 1JQ4A 2IGDA 4H2AA 2J4XA 2INPE 1SBBB 1QOAA 1JWAD 2DYOA 3P1MA 4KGRA 2IJ0A 3GB1A 2L1AA 3P4PB 2DYMA 1N60A 2DLBA 4GDLB 3Q8FA 5JXVA 1UWXA 4L2YA 1L5PA 2V3NA 3AE2B 1ET6A 1N5WA 2JYEA 1V1PB 3AM9A 1OFFA 3KWLA 3AE7B 1L4ZB 4YTPB 4AS1A 1EU3A 4TQ0A 2QJLA 2RDGA 2ACZB 2ONQA 1XLQA 4DXGA 2Z8LA 4N58A 2K3UA 2E6XA 1JROA 3U4EG 5EE3A 2PW9A 3MP9A 1V8CA 4KX6B 3P42A 3Q8CA 3AE5B 1L6UA 4RF1A 2MEKA 2IGHA 2OHFA 1YJJA 4OW0A 4YTNB 1QOBA 1ZXIA 4YSXB 2YEPF 3AEGB 1E0ZA 5LNK1 2PMVA 4XE0A 4ARIA 3E56A 3W9CB 1JRPA 1VZ7A 2N7JA 5H92C 2INNE 1UUPA 1MHHE 3AE8B 5FKAC 1WWTA 3NVVA 3U52E 4ZRQA 4D2KA 1MHXA 1J7BA 1FD6A 2WQYB 4RGNA 2MJDA 2K5PA 1MPEA 4GLSC 1C4AA 3V05A 2BS2B 2E3TA 2W3RA 1QKZA 2WXFA 1IGDA 4Q2JA 3AEFB 5BMIA 5H8YE 1JWSD 4YXDB 3W2DA 4ZOHC 5FK9C 3GS2A 4RH6A 1CJEA 3AEAB 2W55A 3HUIA 4JX1C 3U7ZA 2LJIA 3TSSA 4OZAA 2WU2B 1Q10A 2J52A 3FC4A 3MC0B 2PVGC 4YSYB 4A6QA 1K53A 1E6EB 2I2YA 1XCTL 1FRDA 2IDYA 1M4VA 1PGBA 1TJEA 2GI9A 3P4QB 2AQ3B 4J3OD 1FNWA 1HA5A 1FXAA 4TMAB 3TUOA 2M56B 5T8IA 2ZW1A 2BBCA 2JQRB 3VR8B 3ZQ4A 3AEDB 3I9V1 1EM7A 2J53A 2WXJA 1XXGA 3Q69A 5MPOA 1QILA 1XLPA 1ZDXA 3FILB 2TSSA 1MI0A 2LFIA 2B76B 1SE3A 2N9LA 1V1OA 2QILA 1IBXA 2WXQA 4A9AA 3NZ3A 1TS4A 3P4RB 1GPXA 1ET9A 2QSDA 2Y5PA 3PZ7A 2WDVB 1QOGA 1B1ZA 2VZKD 1GAQB 1STEA 2NTTA 1I4PA 3N9YC 4NJCA 2WNMA 3TEZA 2ICIA 3KWVA 2L83A 5D3DA 3SEBA 5BYSA 4O1NA 3AH7A 3AE3B 1HZ5A 1ACCA 1ESFA 1TKGA 2WXRA 1EWYC 3Q8EA 2QIEB 1XLNA 3HVDA 3P63A 2V0GA 1I4GA 1YN3A 3P4SB 4TSSA 4EE2A 3MFGA 3URYA 1SIJA 4RFBA 1KLUD 1WSPA 4XWWA 1YN5A 4ZHOA 1C79A 5D3IB 3IT4B 2PLPA 1XLOA 1SJED 1FEHA 1Y56A 2IPKD 1XEEA 1FM0D 1XCQL 2ZW0A 4IOIE 1YNTE 4HKQA 3ETRA 3Q8AA 1A70A 5TSSA 2NTSA 1F2RC 1LO5D 2AQ1B 3TEYA 1SF0A 1KRHA 4XWTA 4C7YA 1D5MC 1E7PB 2K9XA 1E10A 3NVWA 1JWMD 1NYQA 1L0XB 5E6JA 2KDMA 3BZDB 2NMQA 3EUB2 3TEXA 4DQOC 3AMZA 3BK1A 3T3NA 1FIQA 1E9MA 1TS2A 4LLGM 3UI3A 5BYRA 1TS3A 4ZHPA 1FFVA 2WXIA 4DXFA 2DWQA 3NVYA 5I4DA 1RM6C 4MM3B 4NZLB 4WURA 4ZRPA 1KH0A 2Y5CA 2JZPA 1ZE3D 1N61A 1YN4A 1PFDA 2WXMA 2WXPA 1BMLC 4A55A 2WXKA 1I4HA 3PZ8A 2JU6X 2YEPB 2BW2A 2W3SA 2X38A 4C80A 1P7EA 1PGAA 3R2IA 1D4BA 1DOXA 3J9CA 2WXLA 1C9FA 4HKZE 1DYQA 1KFYB 2WLBA 2KN4A 4MT5A 2K22A 1FCCC 3VQIA 5BMHA 3AECB 3AN1A 1PDXA 4KKIA 3I57A 2LMCA 2WXHA 3BVZA 3W5VB 1OQRA 3VRAB 4P6VF 4TQ1A 1F77A 2MH7A 3VRBB 4LK0M 1BUIC 1D5XC 3CWIA 4WIPA 3TEWA 5EE1A 1JCKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFU A;  1QOA A;  1UWM A;  1QLB B;  1QOG A;  2WDV B;  1JWA D;  1GAQ B;  2WP9 B;  1RFK A;  1VJK A;  3L4P A;  3P1M A;  5AUI A;  2EKI A;  3P4P B;  1N60 A;  2KAJ A;  1NYR A;  2L83 A;  3AH7 A;  3AE6 B;  1L5P A;  3AE3 B;  4YTM B;  1TKG A;  3AE2 B;  5C2T B;  1EWY C;  1XO3 A;  4HRO A;  1N5W A;  3AM9 A;  2QIE B;  4LTU A;  1OFF A;  1PUT A;  1XLN A;  1NI3 A;  1KF6 B;  3AE7 B;  3KWL A;  2WU5 B;  3P63 A;  3VR9 B;  3WCQ A;  2JX5 A;  4YTP B;  1NEK B;  2BS3 B;  2PVO D;  1TYG B;  3P4S B;  2QJL A;  1SIJ A;  2ACZ B;  3HRD D;  1XLQ A;  2CJN A;  4N58 A;  1JRO A;  1RWS A;  5EE9 A;  1QOF A;  5EE3 A;  3B2G A;  3W5U B;  4ZHO A;  1V8C A;  1YJI A;  4KX6 B;  1DGJ A;  2WDQ B;  2PIA A;  3AE5 B;  1L6U A;  1YQ3 B;  1FRR A;  1WGK A;  1XLO A;  1YJJ A;  2CU3 A;  2DBY A;  2OHF A;  1QOB A;  1J7C A;  1ZXI A;  3AEG B;  4YTN B;  4C7Z A;  4YSX B;  1E0Z A;  3LB8 C;  1DOY A;  1VDV A;  4N59 A;  1FM0 D;  2Q5W D;  3NS1 A;  2H88 B;  2WS3 B;  1ZOY B;  3AE4 B;  3ETR A;  3PO0 A;  4FXC A;  1A70 A;  4USA A;  5GXG B;  3BII D;  3W9C B;  1JRP A;  1WRI A;  1ROE A;  1OQQ A;  4YSZ B;  1SF0 A;  1QT9 A;  4IDI A;  5C3J B;  1KRH A;  5G5G A;  5H92 C;  4C7Y A;  1E7P B;  2WDR B;  2K9X A;  1NEN B;  3AE8 B;  1JW9 D;  1JWB D;  1WWT A;  3DWM A;  3NVV A;  1E10 A;  3NVW A;  1F0Z A;  1I7H A;  1NYQ A;  4YT0 B;  4JWS C;  1N63 A;  3EUB 2;  1J7B A;  1J7A A;  4US8 A;  2H89 B;  1AWD A;  3AMZ A;  2WQY B;  3AB5 A;  3FAH A;  3AE1 B;  2MJD A;  1IUE A;  5G5H A;  1FIQ A;  1E9M A;  4HRS A;  2K5P A;  2LEK A;  4WQM A;  4WWM A;  2N0S B;  2BS2 B;  1FXI A;  1SB3 C;  2AX5 A;  2E3T A;  2CJO A;  2W3R A;  4ZHP A;  1NVI D;  1FFV A;  1ZUD 2;  3AEF B;  2PKO A;  2DWQ A;  5H8Y E;  3NVY A;  4YXD B;  1RM6 C;  4ZOH C;  1L6V A;  2Y5C A;  1FO4 A;  1CJE A;  1N61 A;  3AEA B;  1PFD A;  1RYJ A;  1T3Q A;  1L0V B;  2W55 A;  1TKY A;  3HUI A;  2FBW B;  3NVZ A;  3RPF C;  3NRZ A;  4JX1 C;  4JWU C;  1CZP A;  3CIR B;  3LXF A;  1V97 A;  3DWG C;  1WYG A;  2WU2 B;  3B2F A;  3FC4 A;  2W3S A;  2PVG C;  4YSY B;  4C80 A;  1E6E B;  1DOX A;  1DOI A;  3B9J A;  2HTM E;  1FRD A;  1TJE A;  2MJE A;  1FMA D;  1KFY B;  2WLB A;  3P4Q B;  2W54 A;  1QF6 A;  1FXA A;  3AE9 B;  2G1E A;  2K22 A;  3AV8 A;  2M56 B;  2L52 A;  1R7S A;  2JQR B;  3AEC B;  4N6E B;  3SR6 A;  3VR8 B;  4ITK A;  3AED B;  1VLB A;  1PDX A;  1YQ4 B;  2BS4 B;  3AEE B;  3AN1 A;  5EE0 A;  2BT6 A;  1ZP0 B;  5MPO A;  1JAL A;  3W5V B;  1OQR A;  1N5X A;  2KMM A;  1AYF A;  3ABV B;  1XLP A;  3AEB B;  3HVZ A;  4P6V F;  4US9 A;  2MH7 A;  3VRA B;  1B9R A;  3SFD B;  3VRB B;  2M19 A;  5AUK A;  2B76 B;  2MJ3 A;  3CWI A;  4A9A A;  1JQ4 A;  1WXQ A;  1N62 A;  3SFE B;  3P4R B;  1GPX A;  5EE1 A;  3ZYY X;  1TKE A; 
#chains in the Genus database with same CATH topology
 3R8B A;  2HD5 B;  5L83 A;  1F52 A;  4XYC A;  1C78 A;  4ICU A;  3X23 A;  3N20 C;  4WJQ A;  4J6I A;  4WJO A;  2BF8 B;  3PZD A;  3QAR A;  2KC1 A;  3ZIM A;  2XN9 C;  2REX A;  3VUY A;  4C4V B;  3LJ3 A;  4P7I A;  3QC8 B;  3I3T B;  1MVK A;  4CQN A;  4BAX A;  1QOF A;  1ISN A;  3OLM D;  4L23 A;  4RCO A;  2WXN A;  1UZX B;  4HVB A;  3DBR I;  2KDB A;  2BVC A;  2Q5W D;  4W9C A;  2L7R A;  4FHJ A;  2ZNV B;  1P1A A;  4ICV A;  5GXG B;  1ROE A;  2KJ6 A;  3ZW3 A;  5C3J B;  4YWG G;  3UQA A;  1IBX B;  2JT4 B;  4B0M A;  3ZNI D;  2B3A A;  1Z5S B;  1SJH D;  1IP9 A;  4M0W A;  5G5H A;  4WWM A;  2KVR A;  4E71 A;  2N0S B;  4ANU A;  1V6E A;  1WF9 A;  2KOX A;  2LGY A;  5IOI A;  3T3O A;  1TKY A;  1T5X D;  3NHE B;  1FCL A;  4XC2 A;  2MP2 A;  3QX1 A;  1WX8 A;  2EEL A;  2L32 A;  2MX2 A;  2L3Z A;  3BY4 B;  2W54 A;  4GOC A;  2FCS A;  3QAQ A;  3SR6 A;  2C7H A;  5DPR A;  1YQ4 B;  2A4Z A;  3PHW B;  4NNJ B;  2LHE A;  2K8C A;  1TZO A;  4NJ7 A;  5AUK A;  1WFY A;  4BBN C;  4K7W A;  2KN5 A;  4JIO U;  1LM8 B;  2J0J A;  4ANW A;  4I6L B;  5FR3 A;  2NVU I;  4MH8 A;  2KX3 A;  2J42 A;  1C77 A;  1D6E C;  4L1B A;  4BFR A;  4URK A;  2FCN A;  3RNF C;  2C7M B;  1KOT A;  4TUU A;  3MJW A;  3AE6 B;  4M02 A;  1GOZ A;  2I1K A;  3CSF A;  3NZU A;  3WIM A;  2PE6 B;  1RRB A;  1F2R I;  2BS3 B;  1Y8R C;  2BB6 A;  2KHW B;  1K50 A;  2CJN A;  2N9X A;  3W5U B;  3MJ5 A;  1YJI A;  4MGI E;  1K51 A;  1E7U A;  2PIA A;  3BYY B;  1YQ3 B;  3KQ4 A;  4C7Z A;  5JHA A;  3ZRC A;  2PTL A;  1J8C A;  3KVF B;  3ZNH B;  3ZO5 B;  4GDK A;  2H88 B;  2WS3 B;  4FBJ B;  3Q3N C;  2QEJ C;  3AI5 A;  3FKY A;  2MW5 A;  1VZ8 A;  4UDU C;  1I7H A;  3ZXR A;  2RPV A;  1C1Y B;  1J7A A;  1P7F A;  2H89 B;  2N7E A;  1Q0W B;  3A1Q B;  1SB3 C;  1JRU A;  2LVO A;  5E6N A;  3W1S A;  1RFA A;  1P0R A;  2RSU A;  5CHF A;  1I4R A;  1RYJ A;  3EC8 A;  2WDT B;  3A4R A;  3NRZ A;  1PYW D;  2M0A A;  3CIR B;  3LXF A;  3N1Y C;  2NS5 A;  3B2F A;  4WWN A;  3UF8 A;  3Q14 C;  1ZDV A;  1JWU D;  1V81 A;  1UEL A;  4CO7 A;  4MGZ E;  3PRZ A;  4XDD A;  1EU4 A;  1HTO A;  2MWS B;  4KDL B;  1FNU A;  2KMM A;  1YIW A;  1TY2 A;  1L4D B;  4KGS A;  3H8H A;  4DHZ B;  2Y3A A;  3B08 A;  4K1R B;  2KWU B;  1P98 A;  4B6W A;  2N9K A;  1SBB B;  1QOA A;  1JWA D;  3C19 A;  2JY6 A;  1EF1 A;  4FHK A;  2L1A A;  1R4M B;  2DYM A;  1N60 A;  3WA0 A;  4GXB A;  2JVC A;  5JHB A;  2JYE A;  3IVF A;  3GE3 C;  2QJL A;  1V5T A;  2RDG A;  4DXG A;  3U4E G;  1TZ1 A;  3SDL C;  3MP9 A;  1WYW B;  2GBK A;  4MGK E;  3N3K B;  1YJJ A;  1QOB A;  5FR6 A;  2LAS A;  2RR9 A;  1WIA A;  2PMV A;  1MFW A;  5LLI A;  4ARI A;  3E56 A;  2JXX A;  1JRP A;  1WZ0 A;  1WX9 A;  1YJ1 A;  1RLF A;  2K8B A;  5FKA C;  1WWT A;  5KHQ A;  3CF6 E;  2DAF A;  1J7B A;  2LVP A;  5D94 A;  4RGN A;  4PS3 A;  4FA6 A;  2BS2 B;  3JSV A;  5BMI A;  3I63 C;  1WX7 A;  2G3Q B;  1Q5W B;  4YXD B;  4ZOH C;  5FK9 C;  1NI2 A;  3DVG Y;  4RH6 A;  3AEA B;  2KMA A;  2W55 A;  5KHO A;  2KDE B;  4WJP A;  2ZCC A;  3TSS A;  1MG4 A;  4OZA A;  3RNB C;  3MC0 B;  4YSY B;  4WAA A;  2NCN A;  1FRD A;  4HPM B;  1TJE A;  4J3O D;  3S2A A;  1FNW A;  1HA5 A;  1FXA A;  4TMA B;  4HWI B;  1YX6 B;  3DBL B;  2M56 B;  5T8I A;  1V9J A;  1WE6 A;  3ZKJ C;  1XXG A;  5MPO A;  2WGS A;  3DVN V;  1XLP A;  2TSS A;  1SE3 A;  3PV1 A;  2DZI A;  4RMA A;  1V80 A;  1Z2M A;  3C0R B;  4A9A A;  5AZG A;  3NZ3 A;  1TS4 A;  3NJT A;  1WGG A;  4EZJ A;  1B1Z A;  1GAQ B;  1STE A;  1I4P A;  2LGS A;  4NJC A;  2DHZ A;  2WNM A;  2ICI A;  2KZR A;  3ZDM C;  4EFO A;  4AWJ A;  4IUM B;  4DBG A;  3RZW C;  4WWO A;  3AE3 B;  1ACC A;  1TKG A;  2EKE C;  2PE9 A;  2WXR A;  2QIE B;  2KKC A;  3Q6B A;  1ZW7 A;  1WSP A;  3VAW A;  5D3I B;  2V9H A;  3Q3M C;  3IT4 B;  4ANV A;  5JH5 C;  1XLO A;  1XCQ L;  4W9D A;  1YNT E;  2FID A;  3DQV A;  4K81 A;  3DBH I;  2NTS A;  2AQ1 B;  2NBV B;  4XWT A;  4C7Y A;  3PVL A;  1NYQ A;  4ZDV A;  2KDM A;  3SHQ A;  3EUB 2;  1FIQ A;  2WXI A;  1TBE A;  3K9P B;  2DWQ A;  2KTR A;  3NVY A;  3OJ4 B;  4ZRP A;  2Y5C A;  2MQJ A;  3AUL A;  3OG5 A;  2LRU A;  1BML C;  4A55 A;  2WX1 A;  1WM3 A;  4TV3 A;  4W9I A;  4DWF A;  2YEP B;  2BW2 A;  2W3S A;  2X38 A;  1DOX A;  4G3X B;  1C9F A;  4HKZ E;  2K22 A;  1T0S C;  2M0X A;  1L2N A;  3M95 A;  2JZZ A;  2MH7 A;  5J18 A;  1BUI C;  1D5X C;  4LNF A;  2ZVO A;  2L00 B;  1T0Q C;  4K7U A;  3UIO B;  2BYE A;  4A90 A;  1VJK A;  4NQK E;  2KAJ A;  2JWU A;  4HJK A;  1BXT A;  3PLU A;  1XO3 A;  3B1L X;  3VTV A;  2XBB C;  3VR9 B;  3V61 A;  3WCQ A;  3N32 A;  4HDO A;  3L08 A;  2MBO A;  4GSW A;  3IT6 B;  2WXO A;  2XEW A;  1SXT A;  2BWF A;  2DBY A;  2BQQ A;  2J0M A;  5BO4 B;  2LRW A;  3R2T A;  2GLS A;  2QDF A;  4USA A;  2GBR A;  4EOY A;  2JRH A;  3U7D A;  2KFK B;  3TL5 A;  4MDK E;  4W9H A;  5HFY A;  4US8 A;  4PYZ A;  4WAF A;  1NVI D;  1ZUD 2;  3RFZ B;  1C76 A;  2N9P C;  3NVZ A;  4RGO S;  3RUL A;  4KDI C;  2FBW B;  3A9K A;  4JE3 B;  4NAM A;  4X57 B;  2DX5 B;  3DWG C;  2FIF A;  2SEB D;  3EFC A;  3Q8B A;  4K3B A;  5HG2 A;  3M3J A;  1IGC A;  1FMA D;  2KMC A;  1SSN A;  1SIF A;  2KTF A;  4JPS A;  1ZXH A;  2K39 A;  4M8M A;  5EE0 A;  2HJ8 A;  3A9K B;  1LXD A;  3DHI C;  1TT5 B;  2BB5 A;  1HXY D;  3KUC B;  2HE7 A;  4MEL A;  2IYD B;  3DPD A;  2LUE A;  3DDC B;  3VVW B;  1TKE A;  3LDZ E;  3QWZ B;  3TMP B;  4AQ7 A;  5AZH A;  1QLB B;  3L4P A;  2LGI A;  2CHW A;  2EKI A;  5D2M B;  3JYU A;  3IAS 1;  2C60 A;  3W1S C;  1Q1O A;  1UGJ A;  3D32 A;  5C2T B;  4MEM A;  3KH0 A;  3DOW A;  1LQB A;  1SE2 A;  4II3 B;  1RAX A;  3PLV A;  4DXA B;  5EE9 A;  3IAM 1;  5HHD G;  2BTE A;  4OZC A;  2D2Q A;  3BK2 A;  1KTK A;  1J7C A;  1ZOY B;  2LI5 A;  2JZ3 B;  3UGB B;  3EHV A;  4R3D A;  5G5G A;  5E6P A;  2NBW B;  4PYU A;  2LZ6 A;  4YT0 B;  1N63 A;  2IGG A;  1A5R A;  5GMV A;  5AZF A;  3ZNG C;  3AB5 A;  2IY0 B;  2N1W A;  1GB1 A;  2RDB C;  4WQM A;  4XZ4 A;  4I6N B;  2PKO A;  2C7N B;  5LXH A;  4M01 A;  1WGD A;  3R7R A;  4AP4 C;  4JWU C;  1CZP A;  4IKG A;  4C00 A;  4PT5 A;  1WYG A;  3Q2A C;  1FNV A;  2G1E A;  2KK8 A;  4ITK A;  2BS4 B;  4HEA 1;  2LD9 A;  1L0Y B;  3TBL D;  2D11 A;  4OVZ A;  2YVC A;  4IM0 A;  4C56 C;  4K3C A;  1B9R A;  2M19 A;  3C8Y A;  1E8Y A;  1S3S G;  2BYT A;  2OJW A;  2IGD A;  4H2A A;  4AJY B;  4WQO B;  1U4A A;  1E8X A;  1WR1 A;  2IJ0 A;  4GDL B;  3EEC A;  1L5P A;  3AE2 B;  1ET6 A;  1N5W A;  1OFF A;  3KWL A;  4MM3 A;  2LGD A;  4TQ0 A;  3B0A A;  2ACZ B;  1XLQ A;  2K3U A;  4ZYN A;  5EE3 A;  3L17 A;  2DAJ A;  4IW0 A;  5IO9 A;  3P42 A;  4FAD A;  3AE5 B;  3VUW A;  4OW0 A;  4YTN B;  2K8H A;  2YEP F;  2ZPY A;  3ECI A;  3HM6 X;  2PEA A;  3NVV A;  2AEH A;  1E5W A;  2KD0 A;  2KC2 A;  4D2K A;  2BKR B;  3RNG C;  1WY8 A;  4A3P A;  2K5P A;  4GLS C;  3V05 A;  2WXF A;  2LJ5 A;  1MJD A;  3AEF B;  1JWS D;  4LNI A;  2AL3 A;  4JX1 C;  4IC7 B;  3H7P B;  1R4N B;  3PS6 A;  2WU2 B;  1Q10 A;  2J52 A;  4A6Q A;  2PVG C;  2I2Y A;  4BZA A;  1M4V A;  1PGB A;  4MJS A;  3N30 A;  5E6O A;  3AED B;  2BWE S;  2Z0D B;  4DHJ D;  3FIL B;  1WMH B;  3ZRF A;  4M00 A;  5IA7 A;  2QIL A;  4ACF A;  1GPX A;  1ET9 A;  2Y5P A;  4W9K A;  2WDV B;  2VZK D;  2NTT A;  4HCN B;  2PPH A;  3QIJ A;  2WX0 A;  1HTQ A;  5D3D A;  5BYS A;  3AH7 A;  2WWZ A;  4LNO A;  1EWY C;  3Q8E A;  2UU7 A;  4LJP B;  3HVD A;  1I4G A;  2N4F A;  4LCD E;  3MFG A;  3URY A;  1VCB A;  1KLU D;  3APC A;  4ZHO A;  3W1Y A;  4DDG D;  2IPK D;  2KLC A;  4MJS B;  1XEE A;  4KIK B;  1WXS A;  3H7P A;  1LO5 D;  3RN9 C;  1SF0 A;  2Z59 B;  1D5M C;  1E7P B;  3RD2 A;  3NVW A;  2MBQ A;  3BZD B;  3ZNZ B;  3TEX A;  3HIZ A;  4DQO C;  3AMZ A;  3DCG A;  4KSL C;  4LDT D;  3T3N A;  1E9M A;  2GOW A;  5DCN A;  3UI3 A;  4AOF A;  5BYR A;  1TS3 A;  4KZC A;  4ZHP A;  4EKU A;  4DXF A;  1RM6 C;  1OGW A;  3A1Q A;  4WUR A;  4MSQ B;  3IG3 A;  1KH0 A;  1V5O A;  2WXP A;  2WXK A;  2V3S A;  1EUV B;  2NPT B;  4C80 A;  2FAZ A;  2HTH A;  3R2I A;  1D4B A;  2WXL A;  3AXC A;  1TIF A;  1KFY B;  3X0W A;  2IO0 B;  3NZS A;  3GZN I;  3I57 A;  1UGM A;  3W5V B;  4P6V F;  2KO3 A;  4IWP A;  4LK0 M;  3VRB B;  3K9O B;  3CWI A;  1TTN A;  3TEW A;  3UIN B;  3VTW A;  1E8Z A;  1HQR D;  2NR2 A;  5AUI A;  2LVQ A;  2J0K A;  5DPT A;  1ZPS A;  1L7Y A;  1QQR A;  1XQQ A;  3PRM B;  4HRO A;  2V3P A;  2JXT A;  1PUT A;  1F1H A;  4F1S A;  2O2V A;  1TYG B;  2I38 A;  1FXT B;  1X1M A;  3HRD D;  5J17 A;  3NG0 A;  2L0T A;  1DGJ A;  2WDQ B;  1AW7 A;  2ZVN A;  4P16 A;  1EWC A;  3PRE A;  2ZNV C;  4NY0 A;  4FJY A;  4JL9 A;  1HZ6 A;  3RNA C;  4HJG E;  3RNE C;  4ZRI A;  3H7S A;  3AE4 B;  2OJR A;  4KKJ A;  2BYF A;  4JLC A;  4REZ A;  3R3M A;  1YX5 B;  1OQQ A;  4A20 A;  3DBR B;  1S1Q B;  1NEN B;  3DWM A;  4E74 A;  1F0Z A;  1VZ6 A;  1WJU A;  1I35 A;  2FCQ A;  4JWS C;  4RGM A;  1J0G A;  3ZUN A;  1ENF A;  3AE1 B;  2DZK A;  2RMM A;  2LEK A;  4DK5 A;  1SE9 A;  1SGH A;  3BWU D;  3ZTC A;  2G9H D;  1HEZ E;  3AU5 A;  3ZJU A;  2JSV X;  1J19 A;  5IP4 D;  3Q3F A;  3R7Q A;  3ZJV A;  3OWE B;  2O2V B;  4BKS D;  4HPP A;  3MC9 A;  2FUH B;  4RGT A;  3B9J A;  3U2S C;  3KW5 B;  4OHJ A;  1T6B X;  3V60 A;  3MHZ A;  3KLS X;  1VLB A;  4YL8 A;  3RCZ A;  2UWQ A;  3GZN B;  1CK1 A;  1AYF A;  4US9 A;  1YMH E;  2FE8 A;  4WJN A;  1N62 A;  4GB9 A;  3HK0 A;  1GNU A;  2JRI B;  1I4X A;  4M0W B;  4EZK A;  2MHJ A;  5J2R A;  1SE4 A;  4HCP B;  2V4L A;  2AQ2 B;  3L54 A;  2PVO D;  3CST A;  1PQS A;  4F7Z A;  1RWS A;  4MAC A;  4W9E A;  3BVG A;  4KVG B;  1V49 A;  3LB8 C;  4TKN A;  3DVN U;  2CKH B;  3NS1 A;  5C23 A;  1SEB D;  4IM2 A;  2CHX A;  3BII D;  3QK0 A;  1UNS A;  5JZE B;  4IDI A;  4HLE A;  1T0Y A;  2KX0 A;  2WHI A;  2VH2 A;  4DDI D;  1E8W A;  3VXW A;  3NOB A;  2MA9 B;  5HI1 A;  3R66 C;  4RNA A;  2BKF A;  4FLH A;  5CHV C;  2DEN B;  4DHZ E;  4HRS A;  2GMI C;  3KYD D;  4GMV A;  3QCA A;  2AX5 A;  1V86 A;  2GB1 A;  2W82 A;  4NAW B;  3SD5 A;  3ALB A;  1L6V A;  1FO4 A;  4P1C C;  1T3Q A;  1L0V B;  3RPF C;  2XNA C;  3O13 A;  3PHX B;  4JGH B;  1V97 A;  2CR5 A;  4AJW A;  3BVM A;  4CHK A;  2OOB B;  2EMS A;  3VDZ A;  2RD0 A;  1XT9 B;  2XK5 B;  2I1J A;  1DOI A;  4ANX A;  2LGX A;  1WH3 A;  2MBE A;  1D5Z C;  4HPL B;  1I42 A;  2WYQ A;  2IND C;  3AEE B;  3M63 B;  3ZGZ A;  3ABV B;  3HVZ A;  5IN7 A;  1WZ3 A;  2O6V B;  4EZL A;  2DNF A;  2K1F A;  1N6Z A;  3U8Z A;  1JQ4 A;  4P1B C;  4BOS C;  3A33 B;  2RPQ A;  2DYO A;  3P1M A;  4KGR A;  2L0F A;  3GB1 A;  3P4P B;  3Q8F A;  4CYE A;  5JXV A;  1UWX A;  3DHG C;  2IO2 B;  2DZJ A;  2DYB A;  2L76 A;  1L4Z B;  2O6V A;  2MP2 B;  1EU3 A;  2HJ1 A;  2N7D A;  3OAW A;  1UH6 A;  3OJ3 A;  2PW9 A;  1V8C A;  4KX6 B;  2A5U A;  3Q8C A;  1L6U A;  3HHM A;  4II2 B;  2K25 A;  3QQ8 B;  2IGH A;  4HK2 A;  1E90 A;  4YSX B;  4FN2 A;  1M94 A;  1G6J A;  4BOZ B;  4BKG A;  4W9G A;  3DHH C;  4B95 A;  2N7J A;  4OVU A;  5H92 C;  2INN E;  3WAL A;  1UUP A;  3AE8 B;  4NJ6 A;  1K8R B;  3U52 E;  4ZRQ A;  3A4S C;  1MHX A;  1GG3 A;  2IZV B;  2LXC A;  3ONS A;  2E3T A;  1QKZ A;  4Q2J A;  1IGD A;  3RI7 C;  5H8Y E;  3W2D A;  1TGZ B;  3GS2 A;  4K7S A;  3HUI A;  1CMX B;  2D3A A;  3U7Z A;  3M62 B;  1K53 A;  2R2Q A;  4NPN A;  2IDY A;  4W9L A;  1E7V A;  4N9F 4;  2M1M A;  2ZW1 A;  4LDT B;  3T9L A;  3VH3 B;  1EM7 A;  3Q69 A;  4C4V A;  2KNB A;  2O6V D;  3ENE A;  4G50 A;  3DBL I;  1MI0 A;  1WE7 A;  3H9D A;  2N1V A;  2N9L A;  1V1O A;  2WXQ A;  2ZCB A;  1MG8 A;  4GN1 A;  4IM3 A;  4KZ0 A;  3V62 A;  4LNN A;  2QSD A;  3PZ7 A;  2KQ7 A;  1QOG A;  1UBI A;  1WJ4 A;  1WRD B;  2QHO A;  2L83 A;  2KTR B;  3SEB A;  2KVZ A;  4EUT A;  3EFU A;  1XLN A;  2UYZ B;  2V0G A;  3H1U A;  1GUA B;  1YN3 A;  3O65 B;  2R2O A;  3P4S B;  4GGQ A;  1SIJ A;  4RFB A;  3ML8 A;  4XWW A;  1NDD A;  2AL6 A;  3PRP B;  5D6J B;  1ZGU B;  2JPH A;  2PLP A;  2KFJ A;  1SJE D;  1EO6 A;  3TCA A;  2ZW0 A;  4IOI E;  4HKQ A;  2ASQ A;  3ETR A;  4G11 A;  4HDQ A;  4I6P A;  5IKC M;  3RUI B;  4F8C B;  3DBS A;  2KLG A;  3UIP B;  5E6J A;  4PK1 A;  4IWO A;  2ZJD A;  2X8X X;  3SU8 X;  3BK1 A;  2C9W B;  1TS2 A;  1R4M I;  4NAW A;  1FFV A;  3QHT A;  2M4N A;  3H6N A;  4MGY E;  1BT0 A;  2RGF A;  2JZP A;  1ZE3 D;  1N61 A;  1YN4 A;  2G4S A;  2WXM A;  2G45 B;  4W9J A;  1I4H A;  3PZ8 A;  3JW0 X;  2JU6 X;  3J9C A;  3WAM A;  3RMK C;  1DYQ A;  2WLB A;  3MC8 A;  2KN4 A;  4MT5 A;  1UBQ A;  3IFW B;  2KAN A;  3AEC B;  4KKI A;  2KQS A;  3AN1 A;  4LJO B;  3BVZ A;  2KWV B;  3VRA B;  1AAR A;  1H4R A;  1GJZ A;  2KT7 A;  4MSM B;  4XX5 A;  4A3O A;  3IHP C;  3VR8 B;  1JCK B;  2KYW A;  1FFU A;  2JYT A;  4RM8 A;  1VR9 A;  2K6Q A;  2WP9 B;  1RFK A;  1TY0 A;  2PJH A;  3EGR A;  2M8S A;  3L0W B;  4YTM B;  1AN8 A;  5EDS A;  4LTU A;  2K0P A;  4KIK A;  2OED A;  2JX5 A;  1NEK B;  2YLM A;  3TJP A;  2G4D B;  1FPY A;  2AYO B;  1WMH A;  3B2G A;  3L10 B;  2LHD A;  2CU3 A;  1HE8 A;  4IG7 B;  3VHT C;  3VUX A;  5DPW A;  1DOY A;  3BYT B;  3E9S A;  4BKS A;  2ZEQ A;  4B0E A;  3RZF A;  5L95 C;  1WRI A;  2L05 A;  4YSZ B;  1QT9 A;  2JF5 A;  1KLV A;  1D3Z A;  2XK5 A;  4OZB A;  1JW9 D;  1JWB D;  3ML9 A;  3LYY A;  1WXA A;  1GB4 A;  2GRI A;  2LWP A;  2NBU A;  3ZDT A;  1C4C A;  1IUE A;  3PTF C;  2GBM A;  2NPT A;  4KGT A;  1WXM A;  1P9D U;  4BKT A;  2WXG A;  1C3T A;  3KUZ A;  3V3X A;  5AEK B;  3ZVV A;  3EA6 A;  2KAC A;  2MJE A;  2MSE D;  1QF6 A;  2FUG 1;  2CU1 A;  3AE9 B;  2FNJ B;  2L52 A;  5LXI B;  1OEY J;  2CS4 A;  3IXS A;  2BT6 A;  1ZP0 B;  1QZE A;  2RDH A;  1N5X A;  4M8N A;  5BYQ A;  3AEB B;  3VFK A;  5HKH A;  3SFD B;  1R4N I;  4E3C A;  1WXQ A;  3FIL A;  2KQ4 X;  3SFE B;  3ZYY X;  3QA8 A;  2VRR B;  1UWM A;  3VH4 B;  1NYR A;  1C4P A;  4ZRK A;  3TIX A;  2KXJ A;  4ARC A;  1NI3 A;  1KF6 B;  2WU5 B;  3RT3 B;  1VRA B;  3NY5 A;  4WH4 A;  3RNC C;  4FJZ A;  4GDK B;  1GC6 A;  1FRR A;  1WGK A;  3APF A;  3ZXV A;  4KSK C;  2MCN B;  2ON8 A;  3DVG X;  1VDV A;  4N59 A;  4PS8 A;  2R61 A;  3GP7 A;  3PO0 A;  4FXC A;  3BIN A;  2CHZ A;  1T0R C;  2DZM A;  3HM3 A;  5BMG A;  1V1P A;  2WDR B;  4A8X C;  2LUM A;  2D5G A;  2V4I B;  4KV2 A;  2VZK B;  4RM9 A;  1AWD A;  1I4Q A;  4MH0 E;  3FAH A;  4NQL B;  2QCZ A;  1ZKH A;  4PS7 A;  1FXI A;  1K52 A;  1WJ6 A;  2CJO A;  1YOV B;  5D7G A;  4OVV A;  3P2B A;  2KWD A;  3JVZ X;  4ZYS A;  4XDC A;  2LXA A;  2Z0E B;  4BBN F;  4B9K A;  1V2Y A;  1LFD A;  1IPG A;  2JWZ A;  2FCM A;  3V6C B;  1UD7 A;  3NUH B;  2QMT A;  4GU2 A;  2GBJ A;  1PGX A;  2D3B A;  2HTM E;  1GC7 A;  3ZJT A;  4RF0 A;  2HDE A;  1KLG D;  3AV8 A;  3GOE A;  1R7S A;  4N6E B;  4W9F A;  1CQV A;  3WAN A;  1JAL A;  4HXD A;  1XF5 L;  1YD8 U;  2BGF A;  2KFK A;  2IO3 B;  1EF5 A;  3L16 A;  1OEY A;  2MJ3 A;  1TS5 A;  2SAK A;  1JML A;  4XGA B;  2J4X A;  2INP E;  2KJH B;  3ZLZ A;  1YQB A;  1WXV A;  5G2N A;  2DLB A;  3RYT A;  1WI0 A;  4L2Y A;  2V3N A;  3KYC D;  3AM9 A;  1V1P B;  3AE7 B;  4YTP B;  1WR6 E;  4AS1 A;  4EEW A;  2MBB B;  2ONQ A;  2Z8L A;  4N58 A;  2E6X A;  1JRO A;  4WWP A;  5C1Z A;  3MTN B;  3WAO A;  4DHJ B;  3T8M A;  4FJV B;  2MEK A;  4RF1 A;  2OHF A;  1ZXI A;  3AEG B;  1E0Z A;  5LNK 1;  4XE0 A;  4S17 A;  2JUO A;  2Y5B B;  3PSE B;  4AUQ C;  2AWT A;  3W9C B;  4ZRJ A;  1VZ7 A;  1UF0 A;  3APD A;  2BPS A;  1KM7 A;  1MHH E;  3ZTD A;  1WM2 A;  3VTU A;  3A9J B;  3JSV B;  2GBN A;  5DPS A;  1FD6 A;  2WQY B;  2MJD A;  2L8J A;  2M17 A;  3L13 A;  1MPE A;  1C4A A;  2W3R A;  3Q3O C;  2V1Y A;  4GDL A;  1OQY A;  3WAP A;  2D10 A;  2D07 B;  1CJE A;  4FUL A;  4JQW C;  2KDF B;  3KUD B;  2LJI A;  3A9J A;  1NBF C;  3FC4 A;  2MLB A;  1P3Q U;  1E6E B;  1XCT L;  4S0R A;  2GI9 A;  3P4Q B;  2AQ3 B;  3NS8 A;  4QAY A;  3TUO A;  2IBI B;  2IO1 B;  2BBC A;  2JQR B;  3IBE A;  4IWQ A;  3ZQ4 A;  3I9V 1;  2J53 A;  1WJN A;  2WXJ A;  1QIL A;  1ZDX A;  1IYF A;  2LFI A;  2B76 B;  4LNK A;  2D3G A;  1IBX A;  3P4R B;  3N1X C;  1KJT A;  3N9Y C;  3V6E B;  2W9N A;  3PPA A;  3TEZ A;  2INC C;  3AU4 A;  3KWV A;  4O1N A;  1HZ5 A;  1ESF A;  3PT2 B;  3I5J C;  3UQB A;  3P63 A;  5CHW A;  1H8C A;  2IY1 B;  4TSS A;  2N9E B;  4EE2 A;  3Q3J A;  1YN5 A;  1C79 A;  1LGR A;  1FEH A;  5CTR C;  1Y56 A;  3MHS D;  1XD3 B;  1FM0 D;  2KJR A;  5G55 A;  3Q8A A;  1A70 A;  5TSS A;  1F2R C;  2QC8 A;  3TEY A;  5CX3 A;  1KRH A;  2J7Q B;  2K9X A;  1E10 A;  1JWM D;  1L0X B;  2KWC A;  2NMQ A;  3U30 A;  5TR5 A;  2C5L C;  1OTR B;  2VH1 A;  2ZZP B;  5IAA C;  4LLG M;  2MBH A;  1F9J A;  5I4D A;  4MM3 B;  2D3C A;  4NZL B;  3GE8 C;  4ASW C;  1VD2 A;  4BVU C;  1WGY A;  1PFD A;  3QJZ A;  2ZPN A;  2BYV E;  1WGH A;  1P7E A;  1PGA A;  2K6D B;  2MRP A;  1FCC C;  3VQI A;  5BMH A;  2KDI A;  1PDX A;  1WGR A;  2LMC A;  2WXH A;  3CMM B;  3DBH B;  1OQR A;  3N1Z C;  4TQ1 A;  1F77 A;  4GIV A;  2EMT A;  3PGE A;  4WIP A;  4G0N B;  5EE1 A; 
#chains in the Genus database with same CATH homology
 1FFU A;  2JYT A;  4A90 A;  1VR9 A;  1HQR D;  2WP9 B;  1RFK A;  1VJK A;  3R8B A;  1TY0 A;  5AUI A;  3EGR A;  1C78 A;  2JWU A;  2KAJ A;  1BXT A;  1ZPS A;  1QQR A;  4YTM B;  1AN8 A;  1XO3 A;  2V3P A;  4HRO A;  4LTU A;  2JXT A;  1PUT A;  3VR9 B;  2K0P A;  2OED A;  2XN9 C;  3WCQ A;  2JX5 A;  1NEK B;  1TYG B;  2I38 A;  3HRD D;  1MVK A;  4CQN A;  3IT6 B;  1QOF A;  2WXO A;  3B2G A;  1SXT A;  1DGJ A;  2WDQ B;  1AW7 A;  4L23 A;  2LHD A;  4P16 A;  1EWC A;  4RCO A;  2CU3 A;  1HZ6 A;  2DBY A;  2WXN A;  4HJG E;  1DOY A;  2Q5W D;  3BYT B;  3E9S A;  3R2T A;  3AE4 B;  4USA A;  4KKJ A;  5GXG B;  4B0E A;  1WRI A;  1ROE A;  4REZ A;  1OQQ A;  4YSZ B;  5C3J B;  1QT9 A;  4YWG G;  1IBX B;  1NEN B;  3DWM A;  1JW9 D;  1JWB D;  1VZ6 A;  4OZB A;  4B0M A;  1F0Z A;  3LYY A;  4JWS C;  4RGM A;  2GRI A;  1GB4 A;  5HFY A;  1C4C A;  1SJH D;  4US8 A;  4WAF A;  4M0W A;  1ENF A;  3AE1 B;  1IUE A;  5G5H A;  2RMM A;  4WWM A;  2LEK A;  2N0S B;  3BWU D;  4KGT A;  1NVI D;  1ZUD 2;  3RFZ B;  1C76 A;  2G9H D;  1HEZ E;  3ZJU A;  3NVZ A;  4RGO S;  3T3O A;  2JSV X;  1TKY A;  2FBW B;  1T5X D;  1FCL A;  2WXG A;  4JE3 B;  3ZJV A;  4NAM A;  3OWE B;  3DWG C;  2SEB D;  4RGT A;  3V3X A;  3Q8B A;  5HG2 A;  2EEL A;  3EA6 A;  3B9J A;  1IGC A;  2KAC A;  3U2S C;  2MJE A;  2L32 A;  1FMA D;  4OHJ A;  1QF6 A;  2FUG 1;  1T6B X;  2W54 A;  3AE9 B;  1SSN A;  3MHZ A;  4JPS A;  2L52 A;  1ZXH A;  3KLS X;  3SR6 A;  1VLB A;  3IXS A;  1YQ4 B;  5EE0 A;  2BT6 A;  1ZP0 B;  1CK1 A;  2RDH A;  1N5X A;  1AYF A;  5BYQ A;  2LHE A;  3AEB B;  4US9 A;  1YMH E;  3SFD B;  1TZO A;  5AUK A;  2FE8 A;  2BB5 A;  1HXY D;  1WXQ A;  1N62 A;  2KQ4 X;  3FIL A;  3SFE B;  5FR3 A;  3ZYY X;  1TKE A;  4AQ7 A;  4MH8 A;  1UWM A;  1QLB B;  2J42 A;  1C77 A;  1D6E C;  3L4P A;  2LGI A;  4L1B A;  1I4X A;  2EKI A;  1NYR A;  3IAS 1;  1C4P A;  3AE6 B;  1GOZ A;  1UGJ A;  5C2T B;  1SE4 A;  4ARC A;  1NI3 A;  1KF6 B;  1SE2 A;  2AQ2 B;  2WU5 B;  1F2R I;  1VRA B;  2BS3 B;  2PVO D;  2BB6 A;  4WH4 A;  1K50 A;  2CJN A;  1RWS A;  3IAM 1;  5EE9 A;  3W5U B;  4GDK B;  4MAC A;  3MJ5 A;  1YJI A;  5HHD G;  1K51 A;  2PIA A;  3BYY B;  4OZC A;  2BTE A;  1YQ3 B;  3KQ4 A;  1FRR A;  1WGK A;  3BVG A;  4C7Z A;  3BK2 A;  1KTK A;  1J7C A;  2PTL A;  3LB8 C;  2ON8 A;  1VDV A;  4N59 A;  3NS1 A;  2H88 B;  2WS3 B;  1SEB D;  2R61 A;  1ZOY B;  3GP7 A;  3PO0 A;  4FXC A;  2QEJ C;  3BII D;  1VZ8 A;  1UNS A;  4IDI A;  4R3D A;  5BMG A;  5G5G A;  4UDU C;  1V1P A;  2WDR B;  4A8X C;  2LUM A;  2D5G A;  2V4I B;  1I7H A;  4YT0 B;  1N63 A;  2RPV A;  2IGG A;  1J7A A;  2VZK B;  5HI1 A;  1P7F A;  2H89 B;  1AWD A;  1I4Q A;  3AB5 A;  3FAH A;  4RNA A;  1GB1 A;  4WQM A;  4HRS A;  1FXI A;  1K52 A;  1SB3 C;  2AX5 A;  2CJO A;  2GB1 A;  5D7G A;  2PKO A;  2KWD A;  2W82 A;  4NAW B;  3W1S A;  4ZYS A;  1L6V A;  4XDC A;  1I4R A;  1FO4 A;  1RYJ A;  1T3Q A;  1L0V B;  3RPF C;  2XNA C;  3O13 A;  3NRZ A;  4JWU C;  1PYW D;  1CZP A;  2M0A A;  3CIR B;  3LXF A;  4IKG A;  1V97 A;  3BVM A;  4PT5 A;  1WYG A;  3B2F A;  3NUH B;  2QMT A;  1DOI A;  1FNV A;  1PGX A;  1ZDV A;  1JWU D;  2HTM E;  3ZJT A;  1D5Z C;  2G1E A;  4RF0 A;  2HDE A;  1KLG D;  3AV8 A;  1R7S A;  4N6E B;  4ITK A;  2BS4 B;  4XDD A;  3AEE B;  1EU4 A;  4HEA 1;  1CQV A;  1L0Y B;  1JAL A;  1FNU A;  2KMM A;  1XF5 L;  3ABV B;  3ZGZ A;  3HVZ A;  4OVZ A;  4C56 C;  1TY2 A;  1B9R A;  1L4D B;  2M19 A;  4KGS A;  3C8Y A;  3H8H A;  2Y3A A;  2MJ3 A;  1TS5 A;  2SAK A;  2BYT A;  2N9K A;  1JML A;  1JQ4 A;  2IGD A;  4H2A A;  2J4X A;  2INP E;  1SBB B;  1QOA A;  1JWA D;  2DYO A;  3P1M A;  4KGR A;  2IJ0 A;  3GB1 A;  2L1A A;  3P4P B;  2DYM A;  1N60 A;  2DLB A;  4GDL B;  3Q8F A;  5JXV A;  1UWX A;  4L2Y A;  1L5P A;  2V3N A;  3AE2 B;  1ET6 A;  1N5W A;  2JYE A;  1V1P B;  3AM9 A;  1OFF A;  3KWL A;  3AE7 B;  1L4Z B;  4YTP B;  4AS1 A;  1EU3 A;  4TQ0 A;  2QJL A;  2RDG A;  2ACZ B;  2ONQ A;  1XLQ A;  4DXG A;  2Z8L A;  4N58 A;  2K3U A;  2E6X A;  1JRO A;  3U4E G;  5EE3 A;  2PW9 A;  3MP9 A;  1V8C A;  4KX6 B;  3P42 A;  3Q8C A;  3AE5 B;  1L6U A;  4RF1 A;  2MEK A;  2IGH A;  2OHF A;  1YJJ A;  4OW0 A;  4YTN B;  1QOB A;  1ZXI A;  4YSX B;  2YEP F;  3AEG B;  1E0Z A;  5LNK 1;  2PMV A;  4XE0 A;  4ARI A;  3E56 A;  3W9C B;  1JRP A;  1VZ7 A;  2N7J A;  5H92 C;  2INN E;  1UUP A;  1MHH E;  3AE8 B;  5FKA C;  1WWT A;  3NVV A;  3U52 E;  4ZRQ A;  4D2K A;  1MHX A;  1J7B A;  1FD6 A;  2WQY B;  4RGN A;  2MJD A;  2K5P A;  1MPE A;  4GLS C;  1C4A A;  3V05 A;  2BS2 B;  2E3T A;  2W3R A;  1QKZ A;  2WXF A;  1IGD A;  4Q2J A;  3AEF B;  5BMI A;  5H8Y E;  1JWS D;  4YXD B;  3W2D A;  4ZOH C;  5FK9 C;  3GS2 A;  4RH6 A;  1CJE A;  3AEA B;  2W55 A;  3HUI A;  4JX1 C;  3U7Z A;  2LJI A;  3TSS A;  4OZA A;  2WU2 B;  1Q10 A;  2J52 A;  3FC4 A;  3MC0 B;  2PVG C;  4YSY B;  4A6Q A;  1K53 A;  1E6E B;  2I2Y A;  1XCT L;  1FRD A;  2IDY A;  1M4V A;  1PGB A;  1TJE A;  2GI9 A;  3P4Q B;  2AQ3 B;  4J3O D;  1FNW A;  1HA5 A;  1FXA A;  4TMA B;  3TUO A;  2M56 B;  5T8I A;  2ZW1 A;  2BBC A;  2JQR B;  3VR8 B;  3ZQ4 A;  3AED B;  3I9V 1;  1EM7 A;  2J53 A;  2WXJ A;  1XXG A;  3Q69 A;  5MPO A;  1QIL A;  1XLP A;  1ZDX A;  3FIL B;  2TSS A;  1MI0 A;  2LFI A;  2B76 B;  1SE3 A;  2N9L A;  1V1O A;  2QIL A;  1IBX A;  2WXQ A;  4A9A A;  3NZ3 A;  1TS4 A;  3P4R B;  1GPX A;  1ET9 A;  2QSD A;  2Y5P A;  3PZ7 A;  2WDV B;  1QOG A;  1B1Z A;  2VZK D;  1GAQ B;  1STE A;  2NTT A;  1I4P A;  3N9Y C;  4NJC A;  2WNM A;  3TEZ A;  2ICI A;  3KWV A;  2L83 A;  5D3D A;  3SEB A;  5BYS A;  4O1N A;  3AH7 A;  3AE3 B;  1HZ5 A;  1ACC A;  1ESF A;  1TKG A;  2WXR A;  1EWY C;  3Q8E A;  2QIE B;  1XLN A;  3HVD A;  3P63 A;  2V0G A;  1I4G A;  1YN3 A;  3P4S B;  4TSS A;  4EE2 A;  3MFG A;  3URY A;  1SIJ A;  4RFB A;  1KLU D;  1WSP A;  4XWW A;  1YN5 A;  4ZHO A;  1C79 A;  5D3I B;  3IT4 B;  2PLP A;  1XLO A;  1SJE D;  1FEH A;  1Y56 A;  2IPK D;  1XEE A;  1FM0 D;  1XCQ L;  2ZW0 A;  4IOI E;  1YNT E;  4HKQ A;  3ETR A;  3Q8A A;  1A70 A;  5TSS A;  2NTS A;  1F2R C;  1LO5 D;  2AQ1 B;  3TEY A;  1SF0 A;  1KRH A;  4XWT A;  4C7Y A;  1D5M C;  1E7P B;  2K9X A;  1E10 A;  3NVW A;  1JWM D;  1NYQ A;  1L0X B;  5E6J A;  2KDM A;  3BZD B;  2NMQ A;  3EUB 2;  3TEX A;  4DQO C;  3AMZ A;  3BK1 A;  3T3N A;  1FIQ A;  1E9M A;  1TS2 A;  4LLG M;  3UI3 A;  5BYR A;  1TS3 A;  4ZHP A;  1FFV A;  2WXI A;  4DXF A;  2DWQ A;  3NVY A;  5I4D A;  1RM6 C;  4MM3 B;  4NZL B;  4WUR A;  4ZRP A;  1KH0 A;  2Y5C A;  2JZP A;  1ZE3 D;  1N61 A;  1YN4 A;  1PFD A;  2WXM A;  2WXP A;  1BML C;  4A55 A;  2WXK A;  1I4H A;  3PZ8 A;  2JU6 X;  2YEP B;  2BW2 A;  2W3S A;  2X38 A;  4C80 A;  1P7E A;  1PGA A;  3R2I A;  1D4B A;  1DOX A;  3J9C A;  2WXL A;  1C9F A;  4HKZ E;  1DYQ A;  1KFY B;  2WLB A;  2KN4 A;  4MT5 A;  2K22 A;  1FCC C;  3VQI A;  5BMH A;  3AEC B;  3AN1 A;  1PDX A;  4KKI A;  3I57 A;  2LMC A;  2WXH A;  3BVZ A;  3W5V B;  1OQR A;  3VRA B;  4P6V F;  4TQ1 A;  1F77 A;  2MH7 A;  3VRB B;  4LK0 M;  1BUI C;  1D5X C;  3CWI A;  4WIP A;  3TEW A;  5EE1 A;  1JCK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...