1FXAA

Crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords [2FE-2S] FERREDOXIN
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxaA00
4A9AA 5EE3A 1NYQA 1QOGA 1RWSA 1QOBA 3AEFB 1XLQA 2MJDA 4US8A 1L6UA 3P4SB 4LTUA 1V8CA 4C7YA 1CJEA 5C3JB 3DWMA 2K5PA 1FO4A 1SB3C 2BS3B 1FRDA 1JWBD 1KRHA 4YTPB 1ZOYB 3HVZA 3P1MA 2L83A 1I7HA 1L6VA 4JWSC 3BIID 3AEGB 1T3QA 1XLOA 3AE7B 3VRAB 2E3TA 2DBYA 2KMMA 3KWLA 1N62A 1L5PA 3AV8A 1J7AA 2BT6A 1TYGB 1SIJA 3LB8C 3NVWA 4FXCA 3FAHA 1FIQA 4HRSA 3W5UB 1IUEA 2WLBA 1N60A 1OQRA 1GPXA 2H89B 4YTNB 4WQMA 1DOYA 3AEAB 2JQRB 1JALA 2N0SB 2WDVB 1N5XA 4JX1C 4YSYB 1N61A 1TKGA 4YSZB 4YTMB 1ZXIA 1TKYA 1NI3A 1L0VB 2CJNA 2K9XA 3HUIA 1JRPA 4IDIA 5G5GA 3B9JA 1E6EB 2QIEB 2W3SA 3CIRB 2LEKA 2HTME 5EE9A 2WP9B 3AE4B 1E9MA 1XLNA 3NVZA 5EE1A 2B76B 4N59A 3W9CB 2H88B 2K22A 2WDQB 1QT9A 2MH7A 1EWYC 3P4PB 5EE0A 1R7SA 4YXDB 4C80A 1B9RA 1PUTA 3NVVA 2Y5CA 1NVID 2QJLA 3AE8B 3EUB2 1JROA 4N58A 3AH7A 1VLBA 3SR6A 2L52A 2MJEA 1F0ZA 1E0ZA 1FXAA 1FFUA 1DOXA 3L4PA 1JWAD 2PVOD 3AECB 4ZHOA 1XLPA 3SFDB 1FRRA 1J7CA 1FFVA 1NEKB 5H92C 1ZP0B 1WYGA 1V97A 3NS1A 1SF0A 2WU2B 1VDVA 1KFYB 4ZHPA 1JQ4A 3CWIA 1QLBB 1PDXA 1KF6B 3DWGC 2FBWB 3W5VB 3AN1A 5MPOA 3AE1B 3AE3B 2W55A 4ITKA 1AWDA 4USAA 1J7BA 1N63A 4N6EB 1UWMA 2EKIA 1RFKA 3HRDD 4ZOHC 2DWQA 1ROEA 3B2GA 2G1EA 3VRBB 3WCQA 3VR8B 1OFFA 1QF6A 3ETRA 2BS2B 1FM0D 4YT0B 5AUIA 5C2TB 1TJEA 1GAQB 2WS3B 2Q5WD 1XO3A 2BS4B 2PKOA 2ACZB 3P4QB 2CU3A 1QOAA 3AE2B 1JW9D 5G5HA 3RPFC 1CZPA 2WDRB 1AYFA 2CJOA 1DGJA 4C7ZA 2KAJA 3AE6B 1FXIA 1NYRA 2M19A 4US9A 3SFEB 1RM6C 1YJIA 3AE9B 2MJ3A 3AM9A 1ZUD2 4P6VF 1E10A 4HROA 1FMAD 1VJKA 3AEBB 4JWUC 1N5WA 1WXQA 3NVYA 2AX5A 5AUKA 4WWMA 4YSXB 1YJJA 3P63A 1YQ3B 1TKEA 1WRIA 1WWTA 2JX5A 2WQYB 3AE5B 1A70A 5GXGB 2OHFA 1QOFA 2M56B 3ZYYX 1WGKA 5H8YE 1OQQA 4KX6B 1RYJA 2W54A 3NRZA 3AMZA 1PFDA 2W3RA 1DOIA 3B2FA 1YQ4B 2PIAA 3P4RB 3AEDB 1NENB 2PVGC 3AB5A 3ABVB 1E7PB 2WU5B 3PO0A 3AEEB 3VR9B 3LXFA 3FC4A
chains in the Genus database with same CATH superfamily
1SXTA 3PT2B 4EZLA 1XLQA 1WGHA 2MJDA 3P4SB 4A20A 5C3JB 2J42A 2IO1B 1C79A 2AWTA 1SE9A 1SEBD 1JRUA 4HKZE 3Q8EA 3UINB 1JWSD 1SE3A 1T3QA 5GMVA 4IWPA 4IW0A 1LFDA 2LI5A 2KX3A 4PYUA 2QMTA 4YTNB 4QAYA 4YTMB 1EM7A 4ZHOA 1QKZA 1JRPA 2Y3AA 1XD3B 2IO0B 4KIKB 4XDDA 1EWYC 3GE3C 2YLMA 4WWPA 1IGDA 4WJPA 2YEPF 3R3MA 3AECB 3DVNU 3N20C 3A1QB 3IVFA 2GOWA 4K3BA 3HRDD 2DWQA 2LUEA 1F77A 3ZDTA 1KJTA 4KGTA 1QF6A 1LO5D 4YT0B 2CKHB 5CHWA 1GAQB 4J6IA 3P4QB 3MC9A 1JW9D 1OGWA 5CX3A 1EUVB 3M62B 3TBLD 3DHHC 2HD5B 3N1YC 1MVKA 4RGNA 3PPAA 4K1RB 4TQ1A 1ZPSA 5AUKA 2JXTA 5FR3A 2IBIB 1QOFA 1WXMA 4RGMA 1WGKA 3A1QA 2KWUB 2KQ4X 1C77A 4H2AA 1SBBB 3P4RB 2PVGC 3KW5B 3NHEB 1SGHA 2BYEA 3VTVA 3DBHB 1IP9A 1TS2A 1E8ZA 1QOBA 3C8YA 4MSMB 2JPHA 1Q5WB 3K9OB 5G2NA 1V8CA 4C7YA 2K5PA 3PZ8A 2NBWB 1VCBA 2INNE 5LNK1 2L05A 1I7HA 4F1SA 4YWGG 5IKCM 2JF5A 2GMIC 3NY5A 1ACCA 3SEBA 3Q3NC 1DOYA 1JALA 2WDVB 1R4MI 4II2B 2WDQB 4GB9A 2MH7A 3P4PB 2MHJA 1UNSA 5DPSA 4N9F4 2MQJA 3EFUA 1C4CA 1PYWD 2XK5B 2LVOA 1V97A 2D3GA 2WU2B 4KV2A 4ZHPA 3ALBA 1PDXA 3APDA 3DWGC 2AQ1B 4XGAB 4MGYE 3TEXA 1P98A 4GDLA 1GC6A 3BZDB 1FM0D 4ARCA 1QOAA 3ZNGC 1L4DB 4J3OD 2ZEQA 2V9HA 1WFYA 3ZRFA 3NVYA 3HK0A 1YJJA 2KO3A 3P63A 1WRIA 2M8SA 2J7QB 1ZDXA 3KVFB 1L7YA 4JE3B 2W3RA 1WF9A 3AEDB 4JQWC 1UH6A 2D3BA 2REXA 4FA6A 2G45B 2WXKA 4OW0A 1VD2A 3FC4A 3A9KA 1NYQA 4DDID 4OZBA 2JUOA 4BFRA 4KDLB 4XWTA 1P0RA 5BMHA 2QHOA 1TT5B 1WE6A 2DAFA 3N9YC 2KDIA 4P7IA 2N9EB 3BVMA 5FR6A 3P1MA 2D2QA 3UGBB 3BVGA 3AU5A 3M95A 3KWLA 3UQAA 3U7ZA 4IOIE 4EFOA 1OQYA 2LVPA 4JL9A 4WAFA 4TUUA 2D10A 1N61A 2PMVA 3L17A 4RH6A 2KTRA 3RFZB 5DPWA 2GBJA 2XNAC 3DVNV 2WP9B 1XLNA 2N9LA 2UWQA 2BYFA 1MFWA 2Z0DB 2GLSA 1YQBA 5FKAC 2DENB 2QJLA 1FNVA 1ZDVA 4A6QA 4M00A 1FXAA 2HJ8A 2KACA 3PREA 3RUIB 1JWAD 2W9NA 2QILA 3QJZA 2ON8A 1NEKB 2KC2A 2WXIA 1VDVA 1MJDA 2LHEA 3WANA 3AE1B 3AE3B 4USAA 2EKIA 2MLBA 2L00B 3B2GA 3WCQA 1EU4A 4DHZE 3N1XC 4BOSC 2AL6A 2IO2B 4M01A 1DGJA 2G4SA 1DYQA 4P6VF 4LLGM 2LXCA 1SE2A 4NPNA 2FCNA 3MC0B 3N1ZC 3CSFA 2D3AA 3GP7A 4HDOA 2V3NA 1Q10A 3ZJTA 3EGRA 4LDTD 2YEPB 5H8YE 1HZ5A 2RPVA 3Q3OC 3DCGA 2HDEA 1V80A 1NENB 2WU5B 3W1SC 1ZW7A 3VR9B 1F9JA 5E6PA 1TS4A 3MJ5A 4HKQA 3PLVA 4AUQC 2I38A 4MELA 2PE6B 4HJKA 3PHWB 5DPRA 4I6LB 3ENEA 1F2RC 4WURA 3PGEA 1SE4A 3KLSX 2BGFA 2J53A 2DZJA 2A4ZA 1ISNA 2EMSA 5BMGA 1GB1A 1F0ZA 4E74A 4CYEA 3ONSA 3A9JB 5G5GA 3RT3B 4ARIA 3TJPA 2BVCA 2LRWA 5J17A 4N59A 2IZVB 2PTLA 2R61A 2L32A 3E56A 3DVGX 2KN4A 2MBOA 4MH0E 3AH7A 1A5RA 1LQBA 2L52A 1YX6B 2KXJA 4RF0A 1N6ZA 1K51A 1TZOA 2C7HA 4TV3A 2PVOD 3SFDB 2MBEA 4OVUA 1FFVA 5H92C 2K6QA 2QCZA 5CHVC 3AN1A 4BAXA 2PW9A 1GOZA 3RNAC 3S2AA 5C2TB 4ANXA 2WX1A 5BMIA 2BS4B 5HI1A 3RPFC 4MGIE 1AN8A 4DXFA 2M19A 3UIPB 3RN9C 1E10A 4MGZE 3DBLI 2VZKB 4W9DA 4FLHA 3Q8BA 2NVUI 1KLUD 1V9JA 2INPE 3LYYA 3AULA 2LFIA 1KOTA 1E5WA 3HIZA 1QZEA 4DWFA 4PS3A 2L8JA 3QQ8B 5T8IA 3V6CB 1TY0A 4Q2JA 5L83A 3AEEB 1WH3A 4IM3A 3ZIMA 4MH8A 4E71A 4RNAA 1UUPA 2KFKA 2FNJB 4WJQA 1JWUD 4GGQA 4LNFA 1XCQL 4XE0A 2V4LA 3Q14C 4JWSC 1STEA 3AE7B 3VRAB 2ZPYA 1YOVB 4RMAA 1L5PA 4M02A 2KKCA 1B1ZA 1XF5L 4EZKA 1D4BA 4NJCA 2K8HA 4B9KA 3BK1A 2GB1A 4BOZB 1N5XA 1TKGA 3ZRCA 2JWUA 3DBRB 1V1PB 1MHXA 2QIEB 4HWIB 3CIRB 3VTWA 1PGAA 3BK2A 1E7UA 2RR9A 4P1CC 1T0SC 5BYSA 1Z5SB 3HHMA 3RNFC 3NVVA 3ZKJC 1K52A 1WGDA 1VLBA 3T8MA 3H7PB 3TEWA 1RRBA 4L1BA 2DZKA 1FRRA 2GI9A 4XC2A 3WIMA 5CHFA 1C4AA 4JGHB 3VH4B 1ZKHA 3NOBA 1E8XA 2FCSA 3BWUD 3WAOA 2GBKA 4ITKA 1UWMA 4OZCA 2W82A 3IXSA 2MBQA 1WGYA 1R4NB 2WS3B 1HA5A 4EKUA 2WXOA 1ZUD2 3U30A 2KJHB 2M0XA 1FMAD 1VJKA 2O6VA 2JU6X 1WX9A 1XXGA 4JWUC 3SD5A 3KUCB 4FHKA 4C4VB 3N32A 2MRPA 1U4AA 3R2IA 1J19A 1IGCA 1L0XB 1VRAB 3AE5B 3Q6BA 4DK5A 3ZNZB 1YD8U 1OEYJ 4WWNA 1TZ1A 2CHWA 4WIPA 4X57B 3PO0A 2D5GA 2KTFA 2L7RA 1D5XC 4TSSA 3U4EG 2INCC 2Y5BB 1PGBA 4LTUA 5D94A 5HHDG 1FCLA 1H8CA 4HPMB 1JWBD 4W9FA 4YTPB 4KVGB 3T3OA 2WHIA 3DHGC 4K3CA 4FXCA 3OAWA 3QK0A 4C4VA 2HJ1A 3PV1A 1IPGA 2MBHA 2O6VB 1TKYA 1FNUA 2CS4A 2LEKA 2Z59B 5HFYA 1V6EA 2B76B 3ZDMC 3K9PB 5EE0A 3U7DA 1M4VA 1B9RA 3AE8B 2OOBB 1L4ZB 2MJEA 3ZNHB 1D6EC 1KFYB 3GB1A 2NPTA 4NAMA 4ACFA 3ZNID 3BY4B 3EA6A 2K8BA 3IBEA 4DDGD 4KSLC 1GUAB 5JHAA 5DPTA 4FJYA 3U8ZA 2PEAA 2PKOA 2WDRB 1AYFA 1WGGA 2RSUA 3SFEB 2ZW0A 1WMHA 3AE9B 1T0RC 1C78A 4A3PA 3CSTA 4REZA 1N5WA 3IAM1 2G3QB 2N1WA 2Z8LA 4PYZA 2ONQA 5C1ZA 4NQLB 4HCPB 3DPDA 4G3XB 5GXGB 2CU1A 2M56B 3QARA 1WX7A 4KX6B 3NRZA 3DOWA 3QCAA 3ZJVA 1I35A 4AP4C 3PHXB 4ZDVA 1RWSA 3IAS1 4US8A 4ANUA 1EU3A 3RD2A 2IO3B 2K39A 4BVUC 1WXVA 1SB3C 2IPKD 4ICUA 3A4SC 4LK0M 1YIWA 1N62A 1F1HA 3FAHA 3V3XA 3H7PA 3RULA 3NZUA 2WGSA 1I4GA 1UBQA 3L0WB 2JQRB 1ZXIA 1NI3A 2CJNA 1YNTE 4ICVA 4P16A 3I57A 1MG8A 2K22A 2KLGA 4WQOB 1J0GA 2IYDB 5LXHA 1NVID 1P7FA 3OG5A 1FFUA 4MT5A 4KSKC 3PRMB 1WYGA 1WM3A 2OJWA 2AQ2B 1HTOA 2A5UA 3Q8AA 1Z2MA 5IP4D 5MPOA 2L0TA 2LGDA 2KJ6A 2N9XA 4WAAA 1AWDA 1GC7A 1QILA 1GB4A 4DBGA 1V86A 2OJRA 1GJZA 1WIAA 4DXAB 5LLIA 3VDZA 2LASA 4II3B 3TEZA 2AL3A 4NJ6A 2KDEB 3ZGZA 4NAWA 3AEBB 4IM2A 2DYOA 4MM3A 4KZ0A 3ECIA 1D5ZC 3TMPB 2BF8B 2WXHA 2KHWB 2N7JA 5BO4B 2R2OA 2KX0A 3ZVVA 1KM7A 2K8CA 2LVQA 4MDKE 4C56C 1D5MC 4FN2A 1G6JA 1GNUA 1L6UA 4OVZA 2GBMA 2VRRB 2NR2A 5HG2A 4HXDA 1FRDA 1T5XD 1WE7A 1YX5B 3SHQA 1YJ1A 4ZYNA 3TEYA 2RDHA 3KUDB 3R2TA 2ZNVC 4M0WB 3EHVA 2BT6A 4OVVA 4D2KA 2JWZA 4IG7B 4WQMA 3R66C 4YSYB 4JX1C 2CHXA 3M3JA 1L0VB 2DHZA 2LHDA 4IWOA 3LDZE 2WXJA 5KHQA 3KQ4A 2BYTA 3DVGY 1CQVA 1R7SA 5BYRA 4RCOA 3UQBA 2BTEA 4N58A 2KWDA 3P42A 2ZPNA 1HQRD 3L13A 1FEHA 3PTFC 2JYTA 3HVDA 1N63A 1RFKA 1I4PA 3QC8B 1WR1A 4K7SA 1L2NA 2CJOA 3QA8A 1FXIA 3V62A 3VVWB 1GG3A 4AJYB 1LM8B 3PZDA 1FPYA 1X1MA 2ZVNA 3RI7C 4TMAB 1AW7A 1TKEA 3H1UA 3ML8A 3I9V1 2BB6A 2INDC 2C9WB 5EDSA 1E7PB 2O2VB 4G50A 3LXFA 3IT6B 3E9SA 3MTNB 4KGRA 4A8XC 1FO4A 4HJGE 3ZTCA 3Q3MC 2BB5A 2LGIA 2KZRA 3AEGB 1J8CA 2KMMA 5AZHA 4PS8A 2KD0A 2KJRA 5AZFA 3I3TB 4GLSC 5E6JA 4GN1A 4S17A 3AXCA 1OQRA 2WYQA 4AOFA 3PLUA 1C3TA 1C76A 3APCA 2RPQA 5EE1A 3V61A 2CHZA 4YL8A 3VH3B 5E6OA 1SJED 1YN5A 3O65B 2JVCA 2BYVE 3ZUNA 2DNFA 3ZXVA 4DHJD 3I5JC 3JW0X 3RNGC 1AARA 3H6NA 4L23A 2DX5B 2KQSA 4ZRIA 2K25A 2EELA 2WWZA 4KDIC 1ZP0B 2JRHA 1S1QB 2D07B 2WXPA 1WZ0A 1PQSA 3C0RB 2ZCCA 2FCQA 2UU7A 2LJ5A 4W9EA 4B0MA 3VRBB 1OFFA 1TJEA 4FBJB 1UWXA 3MP9A 4KIKA 1JCKB 2QDFA 3WAMA 3OWEB 3N30A 3W2DA 4GXBA 4GMVA 4WWMA 2PJHA 2O2VA 4S0RA 2XBBC 5AZGA 2ZZPB 4IKGA 5J2RA 3R7RA 1DOIA 2KFJA 1YQ4B 1KTKA 4GU2A 4FHJA 4GDLB 3FILA 2KFKB 3UI3A 2LD9A 2C7NB 2UYZB 4WJNA 3DDCB 2KMCA 2LXAA 1XCTL 1L6VA 2SAKA 3BIID 2JSVX 4XZ4A 3VHTC 3RNEC 4W9JA 2J0JA 4EE2A 1GPXA 1M94A 5IA7A 3HM3A 3VUYA 1C9FA 2GBNA 3DBHI 3HUIA 2K9XA 3CF6E 2JZPA 3UF8A 1NDDA 2HTME 3GZNI 1QT9A 2M0AA 3ZO5B 4BKSD 4NZLB 2WXLA 4YXDB 3V6EB 1VZ6A 2LGXA 3H9DA 1KLGD 5IN7A 2C7MB 2LUMA 1P3QU 2KC1A 2WXNA 1WRDB 2KK8A 2RGFA 3L16A 1WMHB 2BWES 4AWJA 1MG4A 2N9KA 4MACA 1KLVA 3RCZA 4W9LA 2FBWB 3FKYA 4ANVA 1HE8A 2MW5A 3VAWA 2KVRA 4ZOHC 3JYUA 2NBUA 1ROEA 2I2YA 3GE8C 4HVBA 4HLEA 2KNBA 3NZSA 2CU3A 2BWFA 1RLFA 4ANWA 4A90A 3OLMD 2M1MA 2IY1B 1OEYA 1Q1OA 4KKJA 2OEDA 1UBIA 4XDCA 3QIJA 2DYMA 2JX5A 2KDFB 4F8CB 3T9LA 3A33B 1LGRA 2K3UA 2W54A 2GRIA 1PFDA 1I4RA 2PIAA 3ABVB 3AB5A 1WJNA 5FK9C 4GSWA 4LNNA 4YSZB 3MC8A 3B0AA 1KH0A 3MHSD 2MEKA 1WJ4A 4EEWA 1HXYD 2M4NA 4LNKA 1EWCA 1T0QC 2DYBA 2HE7A 4KZCA 5IAAC 3KYCD 2WXQA 1TYGB 3AU4A 5JXVA 3MJWA 1WI0A 1ENFA 1QQRA 1E8WA 1CMXB 3AEAB 2V4IB 4EOYA 1ZGUB 2BBCA 5D3DA 2J4XA 1E7VA 4DQOC 2N9PC 3AE4B 2FUG1 3W9CB 3NUHB 2WDTB 3TSSA 1YMHE 4C80A 3A9JA 1F52A 1PUTA 3D32A 1ZE3D 1E0ZA 4JPSA 1EF1A 2K6DB 4NJ7A 2BKRB 3RMKC 3B1LX 3I63C 1TY2A 2KDBA 3NS1A 2FAZA 4MJSA 2L3ZA 4RM9A 3W5VB 1CK1A 4NQKE 2JRIB 2KMAA 3A4RA 3ML9A 5AUIA 4PK1A 2WXGA 3X23A 3DQVA 2IGDA 2XK5A 2WXRA 1YJIA 1V49A 1MHHE 4WH4A 2KTRB 1IYFA 1WXQA 4C00A 3ZQ4A 1FNWA 3Q3JA 2E6XA 3L08A 3RYTA 4MGKE 3NZ3A 2Y5PA 1RYJA 1V2YA 1VZ8A 2GBRA 2JXXA 3VUWA 3V05A 4B0EA 4B95A 3Q3FA 2C60A 5TR5A 4HK2A 1ET6A 4PS7A 2KWCA 3H8HA 5I4DA 1I4QA 4AQ7A 1FD6A 4ZRQA 1R4NI 1NBFC 2JZ3B 3JSVB 2XEWA 1FCCC 5CTRC 1WY8A 4ZRJA 4LDTB 2JT4B 2L1AA 3SU8X 1OTRB 3NVWA 1FIQA 3QAQA 3W1YA 1N60A 2FIDA 3ZLZA 2RMMA 2V1YA 1F2RI 2RD0A 5JH5C 3EFCA 4M8NA 3IHPC 4AS1A 2H88B 3VTUA 4XYCA 4HPLB 1VZ7A 3BYTB 2IGHA 2D3CA 2IY0B 4HEA1 3KWVA 3RNCC 2SEBD 1UGJA 2V3SA 2VZKD 3L4PA 3MHZA 4UDUC 4XWWA 4RFBA 2WNMA 2O6VD 2RDBC 2PLPA 1UF0A 1EF5A 4K81A 5AEKB 3PZ7A 3BYYB 2YVCA 2I1KA 3Q8CA 3AE2B 2IDYA 4I6PA 4KGSA 2DAJA 4LNIA 2EKEC 4EUTA 1TBEA 1WR6E 5G55A 2AX5A 1E90A 2ZNVB 3PRZA 2M17A 4PT5A 1A70A 2LGSA 3EC8A 1XEEA 4OZAA 1H4RA 5J18A 2TSSA 3L54A 1P7EA 2BPSA 1QOGA 2FUHB 4LJPB 2MWSB 2PPHA 5D6JB 1CJEA 2V0GA 1HEZE 2L76A 3IG3A 4L2YA 3HVZA 2L83A 1XLOA 2E3TA 2DBYA 3LJ3A 2MBBB 1SIJA 1MI0A 3W5UB 1IUEA 4GOCA 3BINA 2DZIA 3WAPA 4IDIA 2BW2A 4RM8A 3L10B 1P1AA 4O1NA 1T6BX 5IO9A 4IWQA 3VUXA 4FULA 1WJUA 2Y5CA 4RGTA 4HPPA 1BT0A 1JROA 2N1VA 2J0MA 2MA9B 2NPTB 4NNJB 3NG0A 3JSVA 2G4DB 2KOXA 3J9CA 4ASWC 2KANA 3URYA 2EMTA 2FE8A 1C4PA 4TKNA 4R3DA 3HM6X 2W55A 4W9KA 1J7BA 5DCNA 3DBRI 3WALA 2G1EA 4FJZA 2BS2B 4IC7B 4ZYSA 2ACZB 2C5LC 3U2SC 2G9HD 2Z0EB 2KAJA 2IGGA 2N4FA 4B6WA 1P9DU 2ZCBA 4HROA 1BUIC 3PVLA 2LMCA 2LWPA 3KYDD 1YQ3B 1WWTA 2WQYB 4GDKA 2LZ6A 5HKHA 1YN3A 3B2FA 5D7GA 3PS6A 1S3SG 4EZJA 4W9GA 4A9AA 2N7EA 3OJ3A 1ET9A 1TGZB 4HDQA 2WX0A 2ASQA 4MJSB 1SSNA 1WJ6A 3BVZA 4I6NB 4BKTA 3DWMA 4MM3B 1RAXA 1T0YA 1K50A 2NCNA 4K7WA 1ZOYB 1Y8RC 1WZ3A 1XT9B 3AI5A 3U52E 3NJTA 2PE9A 2WLBA 4BKGA 3A9KB 2N0SB 3VQIA 3R7QA 1BMLC 3B9JA 1EO6A 3VFKA 3M63B 2KQ7A 1E9MA 4DXGA 3ZTDA 2FCMA 3C19A 1UGMA 2NS5A 1HTQA 4CQNA 3TUOA 1UD7A 3EUB2 3Q2AC 3IFWB 2IJ0A 4IUMB 1R4MB 5JHBA 1XLPA 3GZNB 2WXFA 3TIXA 1KF6B 2JY6A 3Q69A 5LXIB 3DBLB 4BZAA 1E8YA 3B08A 3ETRA 1UELA 4FJVB 5KHOA 2R2QA 5G5HA 1MPEA 4C7ZA 1NYRA 1ESFA 1WYWB 4JLCA 2FIFA 3EECA 3ZXRA 2BQQA 4URKA 4YSXB 2J0KA 1I42A 1V5OA 4G11A 1JWMD 1LXDA 4W9IA 2MX2A 3ZYYX 2CR5A 1I4HA 2RDGA 4IM0A 1TS3A 4BBNC 1WXSA 2X8XX 2KWVB 4GIVA 1YN4A 4TQ0A 4DHZB 3AEFB 2ICIA 4AJWA 2BS3B 1K8RB 4G0NB 4WWOA 2VH1A 5L95C 3MFGA 4JIOU 1V5TA 3CMMB 2V3PA 3AV8A 3IT4B 4HRSA 1C1YB 2KYWA 3NS8A 4M8MA 2H89B 2NMQA 3X0WA 2W3SA 2L0FA 1TIFA 5EE9A 3NVZA 2QSDA 4OHJA 1SJHD 2AEHA 4LCDE 5D2MB 2QC8A 3APFA 2JYEA 1IBXA 1BXTA 1WM2A 2ZVOA 3SR6A 1WGRA 3V60A 2LRUA 1ZXHA 2VH2A 3GOEA 1WX8A 1WSPA 1QLBB 2AYOB 1WXAA 1JMLA 3Q8FA 3N3KB 4N6EB 1FXTB 3VR8B 3ZW3A 2HTHA 5IOIA 2KLCA 2Q5WD 1NI2A 1CZPA 4RF1A 4BBNF 1Y56A 2D11A 2X38A 3AE6B 1Q0WB 1TTNA 4DHJB 2MJ3A 3AM9A 3RZWC 2ZW1A 3QWZB 2NTTA 3W1SA 3OJ4B 2DZMA 2OHFA 3QHTA 2MSED 1OQQA 3PSEB 2XN9C 3KUZA 1V81A 3GS2A 2KT7A 3H7SA 3T3NA 4W9CA 3JVZX 5EE3A 4KKIA 4FADA 1UZXB 1RFAA 4CHKA 1K53A 4MEMA 4XX5A 2BKFA 2AQ3B 5D3IB 3UIOB 1KRHA 2K1FA 1SIFA 4RGOS 4F7ZA 1D3ZA 2MP2A 4WJOA 3SDLC 3FILB 2WXMA 1PGXA 3LB8C 1J7AA 3VXWA 4A3OA 3PRPB 1VR9A 4P1BC 2KVZA 4ZRKA 4A55A 5E6NA 3TCAA 1IBXB 1E6EB 2B3AA 4W9HA 2ZJDA 3RNBC 4LJOB 4GDKB 1XQQA 3DBSA 4ZRPA 2LJIA 2QEJC 2JZZA 4M0WA 2J52A 4LNOA 1DOXA 2NTSA 3P2BA 2LGYA 1J7CA 2MP2B 3WA0A 1SF0A 4HCNB 1L0YB 1JQ4A 3CWIA 4BKSA 2KN5A 1V1PA 2I1JA 1V1OA 2N7DA 2MCNB 5TSSA 4NY0A 1XO3A 3R8BA 3ZJUA 1I4XA 4US9A 1RM6C 3TL5A 5BYQA 4E3CA 4MSQB 2K0PA 4CO7A 3RZFA 1HZ6A 3O13A 3DHIC 2DLBA 4NAWB 5C23A 2KDMA 3AMZA 3KH0A 3QX1A 4K7UA 1TS5A 2NBVB 5JZEB
chains in the Genus database with same CATH topology
1SXTA 3IT6B 3E9SA 4MH8A 1QOGA 4RNAA 1XLQA 4KGRA 2MJDA 1UUPA 3P4SB 1CJEA 2J42A 5C3JB 1JWUD 2V0GA 4A8XC 1C79A 1FO4A 1HEZE 1XCQL 4HJGE 4L2YA 1SEBD 4XE0A 2BB5A 2LGIA 3HVZA 2L83A 4HKZE 3Q8EA 4JWSC 1JWSD 1SE3A 1STEA 1T3QA 1XLOA 3AE7B 3AEGB 2E3TA 3VRAB 2DBYA 2KMMA 1L5PA 1SIJA 1MI0A 4GLSC 5E6JA 3W5UB 1B1ZA 1XF5L 1D4BA 1IUEA 4NJCA 1OQRA 2QMTA 3BK1A 1C76A 4YTNB 2GB1A 1N5XA 4YTMB 1TKGA 1EM7A 4ZHOA 2JWUA 4IDIA 1QKZA 1JRPA 2BW2A 2Y3AA 1V1PB 1MHXA 2QIEB 3CIRB 4O1NA 1PGAA 5EE1A 3BK2A 4XDDA 1T6BX 1EWYC 1SJED 5BYSA 1YN5A 3NVVA 1K52A 2Y5CA 4RGTA 1JROA 1VLBA 3TEWA 4L23A 1IGDA 4L1BA 2EELA 2YEPF 3AECB 3J9CA 1FRRA 2GI9A 1ZP0B 3URYA 1C4AA 2FE8A 1C4PA 4R3DA 2WXPA 2W55A 3BWUD 4ITKA 1J7BA 1UWMA 3HRDD 4B0MA 4OZCA 2DWQA 2W82A 1F77A 3IXSA 2G1EA 3VRBB 4KGTA 1OFFA 1QF6A 2BS2B 1LO5D 4YT0B 1TJEA 4ZYSA 1GAQB 2WS3B 3P4QB 1UWXA 2ACZB 1HA5A 3MP9A 1JW9D 3U2SC 2G9HD 2WXOA 2KAJA 2IGGA 1ZUD2 1JCKB 4HROA 1MVKA 1FMAD 4RGNA 1VJKA 1BUIC 3OWEB 2JU6X 1XXGA 4JWUC 2LMCA 3W2DA 4TQ1A 1ZPSA 5AUKA 4WWMA 2JXTA 1YQ3B 5FR3A 1WWTA 2WQYB 3R2IA 1IGCA 1L0XB 1VRAB 3AE5B 1QOFA 4RGMA 1WGKA 4IKGA 2KQ4X 1YN3A 1C77A 1DOIA 4H2AA 1SBBB 3B2FA 1YQ4B 3P4RB 5D7GA 1KTKA 2PVGC 4WIPA 3PO0A 2D5GA 4A9AA 1D5XC 1ET9A 4TSSA 3U4EG 1TS2A 1QOBA 1PGBA 3C8YA 4GDLB 3FILA 3UI3A 1SSNA 4LTUA 3BVZA 1V8CA 4C7YA 3DWMA 2K5PA 4MM3B 5HHDG 1FCLA 3PZ8A 1K50A 2INNE 1JWBD 4YTPB 5LNK1 3T3OA 1ZOYB 1XCTL 1I7HA 1L6VA 2SAKA 3BIID 2JSVX 3U52E 4YWGG 4FXCA 4EE2A 2WLBA 1GPXA 1ACCA 3SEBA 1DOYA 1JALA 2N0SB 2WDVB 1C9FA 3VQIA 1TKYA 1BMLC 3HUIA 2K9XA 1FNUA 3B9JA 2JZPA 2LEKA 2HTME 5HFYA 1E9MA 2B76B 2WDQB 1QT9A 2M0AA 2MH7A 3P4PB 5EE0A 4DXGA 4NZLB 2WXLA 4YXDB 1M4VA 1VZ6A 4CQNA 1B9RA 1KLGD 3TUOA 3EUB2 3AE8B 1UNSA 2IJ0A 2LUMA 1L4ZB 2MJEA 2WXNA 1C4CA 1PYWD 1XLPA 1V97A 2N9KA 1D6EC 2WXFA 4MACA 2WU2B 1KFYB 3GB1A 4ZHPA 1PDXA 1KF6B 3DWGC 2FBWB 4NAMA 3Q69A 2AQ1B 3EA6A 4ZOHC 3TEXA 2I2YA 1ROEA 3BZDB 3ETRA 1FM0D 4ARCA 2PKOA 2CU3A 1QOAA 5G5HA 2WDRB 1MPEA 1AYFA 4C7ZA 4A90A 3SFEB 1NYRA 1ESFA 2ZW0A 3AE9B 1L4DB 4J3OD 1C78A 4KKJA 4REZA 2OEDA 1N5WA 3IAM1 3NVYA 4XDCA 2Z8LA 4YSXB 2ONQA 1YJJA 3P63A 1JWMD 2DYMA 2JX5A 1WRIA 5GXGB 2M56B 3ZYYX 1ZDXA 4KX6B 2K3UA 1I4HA 2W54A 3NRZA 2GRIA 1PFDA 2RDGA 2W3RA 4JE3B 1I4RA 2PIAA 3ZJVA 3AEDB 3ABVB 3AB5A 1TS3A 5FK9C 2WXKA 4OW0A 3FC4A 4YSZB 1NYQA 1YN4A 4TQ0A 1RWSA 3AEFB 3IAS1 2ICIA 4OZBA 1KH0A 4US8A 2MEKA 1EU3A 4XWTA 5BMHA 1HXYD 1EWCA 1SB3C 2IPKD 3N9YC 2BS3B 3BVMA 4LK0M 3P1MA 3MFGA 3BVGA 2V3PA 2WXQA 3KWLA 1N62A 3AV8A 1TYGB 3U7ZA 3IT4B 4HRSA 3FAHA 4IOIE 3V3XA 5JXVA 1ENFA 1QQRA 1I4GA 2H89B 4WAFA 2NMQA 2JQRB 3AEAB 2V4IB 1N61A 2PMVA 4RH6A 1ZXIA 1NI3A 2BBCA 2CJNA 1YNTE 5D3DA 3RFZB 2W3SA 2XNAC 2J4XA 4DQOC 4P16A 5EE9A 2WP9B 2QSDA 1XLNA 2N9LA 3AE4B 3I57A 2FUG1 3NVZA 4OHJA 1SJHD 3W9CB 2K22A 3NUHB 3TSSA 1YMHE 4C80A 2JYEA 1IBXA 1PUTA 5FKAC 1BXTA 1NVID 1P7FA 2QJLA 1FNVA 3SR6A 1ZE3D 1ZDVA 4A6QA 1E0ZA 4JPSA 1FXAA 1FFUA 2KACA 1ZXHA 1JWAD 2QILA 4MT5A 2ON8A 1NEKB 1WYGA 1TY2A 3NS1A 2WXIA 1WSPA 2AQ2B 1VDVA 1QLBB 3Q8AA 5MPOA 2LHEA 3W5VB 1CK1A 1JMLA 3AE1B 3AE3B 3Q8FA 1AWDA 4USAA 4N6EB 2EKIA 1QILA 1GB4A 3B2GA 3WCQA 3VR8B 1EU4A 5AUIA 2Q5WD 2WXGA 3TEZA 1CZPA 4RF1A 1Y56A 1DGJA 2IGDA 3AE6B 2X38A 2WXRA 3ZGZA 1YJIA 2MJ3A 3AM9A 1DYQA 4P6VF 1MHHE 4LLGM 1SE2A 2ZW1A 2NTTA 3MC0B 3AEBB 4WH4A 3GP7A 1WXQA 2DYOA 3W1SA 3ZQ4A 1FNWA 2V3NA 2E6XA 3NZ3A 2Y5PA 1D5ZC 1Q10A 3ZJTA 2WXHA 2OHFA 3EGRA 2YEPB 5H8YE 1HZ5A 1OQQA 2RPVA 2N7JA 1RYJA 2XN9C 1VZ8A 2HDEA 3GS2A 1NENB 2WU5B 3T3NA 3VR9B 4C56C 3V05A 4B0EA 1D5MC 1TS4A 5EE3A 4KKIA 3MJ5A 4HKQA 1ET6A 1K53A 1L6UA 4OVZA 2I38A 3H8HA 5I4DA 5HG2A 1I4QA 4AQ7A 2AQ3B 5D3IB 4ZRQA 1FD6A 1FRDA 1KRHA 4RGOS 1T5XD 1FCCC 1F2RC 4WURA 3TEYA 3FILB 2RDHA 3R2TA 2WXMA 1PGXA 2L1AA 1J7AA 2BT6A 3LB8C 3NVWA 1SE4A 3KLSX 1FIQA 1VR9A 2J53A 4A55A 4D2KA 1N60A 5BMGA 1GB1A 4WQMA 1F0ZA 4YSYB 4JX1C 2RMMA 1F2RI 1L0VB 1IBXB 2LHDA 5G5GA 1E6EB 4ARIA 2WXJA 4GDKB 4N59A 4AS1A 2H88B 3KQ4A 2BYTA 2PTLA 1CQVA 1R7SA 2R61A 4ZRPA 2L32A 1VZ7A 2LJIA 3BYTB 5BYRA 3E56A 2IGHA 2QEJC 2KN4A 4HEA1 3KWVA 4RCOA 4N58A 3AH7A 2BTEA 2L52A 2SEBD 4M0WA 2J52A 2KWDA 4RF0A 3P42A 1UGJA 1DOXA 2NTSA 2VZKD 1K51A 1TZOA 3L4PA 3MHZA 2PVOD 3SFDB 1J7CA 4UDUC 1FFVA 5H92C 1HQRD 1FEHA 1SF0A 1L0YB 4XWWA 1JQ4A 3CWIA 4RFBA 2JYTA 2WNMA 3HVDA 3AN1A 1V1PA 1V1OA 1N63A 2PLPA 1RFKA 2PW9A 1I4PA 1GOZA 5C2TB 5TSSA 3PZ7A 1XO3A 2BS4B 3BYYB 3Q8CA 5HI1A 5BMIA 3AE2B 2IDYA 4KGSA 3R8BA 3RPFC 1AN8A 2CJOA 4DXFA 3ZJUA 1FXIA 2M19A 1I4XA 4US9A 1RM6C 1E10A 2VZKB 4TMAB 5BYQA 2AX5A 1AW7A 2K0PA 3Q8BA 1KLUD 1TKEA 2INPE 3LYYA 4PT5A 1A70A 1HZ6A 2LFIA 3O13A 2DLBA 3I9V1 4NAWB 2KDMA 1XEEA 3AMZA 4OZAA 2BB6A 2TSSA 5T8IA 1TS5A 1E7PB 1TY0A 4Q2JA 1P7EA 3AEEB 3LXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9A A;  5EE3 A;  1NYQ A;  1QOG A;  1RWS A;  1QOB A;  3AEF B;  1XLQ A;  2MJD A;  4US8 A;  1L6U A;  3P4S B;  4LTU A;  1V8C A;  4C7Y A;  1CJE A;  5C3J B;  3DWM A;  2K5P A;  1FO4 A;  1SB3 C;  2BS3 B;  1FRD A;  1JWB D;  1KRH A;  4YTP B;  1ZOY B;  3HVZ A;  3P1M A;  2L83 A;  1I7H A;  1L6V A;  4JWS C;  3BII D;  3AEG B;  1T3Q A;  1XLO A;  3AE7 B;  3VRA B;  2E3T A;  2DBY A;  2KMM A;  3KWL A;  1N62 A;  1L5P A;  3AV8 A;  1J7A A;  2BT6 A;  1TYG B;  1SIJ A;  3LB8 C;  3NVW A;  4FXC A;  3FAH A;  1FIQ A;  4HRS A;  3W5U B;  1IUE A;  2WLB A;  1N60 A;  1OQR A;  1GPX A;  2H89 B;  4YTN B;  4WQM A;  1DOY A;  3AEA B;  2JQR B;  1JAL A;  2N0S B;  2WDV B;  1N5X A;  4JX1 C;  4YSY B;  1N61 A;  1TKG A;  4YSZ B;  4YTM B;  1ZXI A;  1TKY A;  1NI3 A;  1L0V B;  2CJN A;  2K9X A;  3HUI A;  1JRP A;  4IDI A;  5G5G A;  3B9J A;  1E6E B;  2QIE B;  2W3S A;  3CIR B;  2LEK A;  2HTM E;  5EE9 A;  2WP9 B;  3AE4 B;  1E9M A;  1XLN A;  3NVZ A;  5EE1 A;  2B76 B;  4N59 A;  3W9C B;  2H88 B;  2K22 A;  2WDQ B;  1QT9 A;  2MH7 A;  1EWY C;  3P4P B;  5EE0 A;  1R7S A;  4YXD B;  4C80 A;  1B9R A;  1PUT A;  3NVV A;  2Y5C A;  1NVI D;  2QJL A;  3AE8 B;  3EUB 2;  1JRO A;  4N58 A;  3AH7 A;  1VLB A;  3SR6 A;  2L52 A;  2MJE A;  1F0Z A;  1E0Z A;  1FXA A;  1FFU A;  1DOX A;  3L4P A;  1JWA D;  2PVO D;  3AEC B;  4ZHO A;  1XLP A;  3SFD B;  1FRR A;  1J7C A;  1FFV A;  1NEK B;  5H92 C;  1ZP0 B;  1WYG A;  1V97 A;  3NS1 A;  1SF0 A;  2WU2 B;  1VDV A;  1KFY B;  4ZHP A;  1JQ4 A;  3CWI A;  1QLB B;  1PDX A;  1KF6 B;  3DWG C;  2FBW B;  3W5V B;  3AN1 A;  5MPO A;  3AE1 B;  3AE3 B;  2W55 A;  4ITK A;  1AWD A;  4USA A;  1J7B A;  1N63 A;  4N6E B;  1UWM A;  2EKI A;  1RFK A;  3HRD D;  4ZOH C;  2DWQ A;  1ROE A;  3B2G A;  2G1E A;  3VRB B;  3WCQ A;  3VR8 B;  1OFF A;  1QF6 A;  3ETR A;  2BS2 B;  1FM0 D;  4YT0 B;  5AUI A;  5C2T B;  1TJE A;  1GAQ B;  2WS3 B;  2Q5W D;  1XO3 A;  2BS4 B;  2PKO A;  2ACZ B;  3P4Q B;  2CU3 A;  1QOA A;  3AE2 B;  1JW9 D;  5G5H A;  3RPF C;  1CZP A;  2WDR B;  1AYF A;  2CJO A;  1DGJ A;  4C7Z A;  2KAJ A;  3AE6 B;  1FXI A;  1NYR A;  2M19 A;  4US9 A;  3SFE B;  1RM6 C;  1YJI A;  3AE9 B;  2MJ3 A;  3AM9 A;  1ZUD 2;  4P6V F;  1E10 A;  4HRO A;  1FMA D;  1VJK A;  3AEB B;  4JWU C;  1N5W A;  1WXQ A;  3NVY A;  2AX5 A;  5AUK A;  4WWM A;  4YSX B;  1YJJ A;  3P63 A;  1YQ3 B;  1TKE A;  1WRI A;  1WWT A;  2JX5 A;  2WQY B;  3AE5 B;  1A70 A;  5GXG B;  2OHF A;  1QOF A;  2M56 B;  3ZYY X;  1WGK A;  5H8Y E;  1OQQ A;  4KX6 B;  1RYJ A;  2W54 A;  3NRZ A;  3AMZ A;  1PFD A;  2W3R A;  1DOI A;  3B2F A;  1YQ4 B;  2PIA A;  3P4R B;  3AED B;  1NEN B;  2PVG C;  3AB5 A;  3ABV B;  1E7P B;  2WU5 B;  3PO0 A;  3AEE B;  3VR9 B;  3LXF A;  3FC4 A; 
#chains in the Genus database with same CATH topology
 1SXT A;  3PT2 B;  4EZL A;  1XLQ A;  1WGH A;  2MJD A;  3P4S B;  4A20 A;  5C3J B;  2J42 A;  2IO1 B;  1C79 A;  2AWT A;  1SE9 A;  1SEB D;  1JRU A;  4HKZ E;  3Q8E A;  3UIN B;  1JWS D;  1SE3 A;  1T3Q A;  5GMV A;  4IWP A;  4IW0 A;  1LFD A;  2LI5 A;  2KX3 A;  4PYU A;  2QMT A;  4YTN B;  4QAY A;  4YTM B;  1EM7 A;  4ZHO A;  1QKZ A;  1JRP A;  2Y3A A;  1XD3 B;  2IO0 B;  4KIK B;  4XDD A;  1EWY C;  3GE3 C;  2YLM A;  4WWP A;  1IGD A;  4WJP A;  2YEP F;  3R3M A;  3AEC B;  3DVN U;  3N20 C;  3A1Q B;  3IVF A;  2GOW A;  4K3B A;  3HRD D;  2DWQ A;  2LUE A;  1F77 A;  3ZDT A;  1KJT A;  4KGT A;  1QF6 A;  1LO5 D;  4YT0 B;  2CKH B;  5CHW A;  1GAQ B;  4J6I A;  3P4Q B;  3MC9 A;  1JW9 D;  1OGW A;  5CX3 A;  1EUV B;  3M62 B;  3TBL D;  3DHH C;  2HD5 B;  3N1Y C;  1MVK A;  4RGN A;  3PPA A;  4K1R B;  4TQ1 A;  1ZPS A;  5AUK A;  2JXT A;  5FR3 A;  2IBI B;  1QOF A;  1WXM A;  4RGM A;  1WGK A;  3A1Q A;  2KWU B;  2KQ4 X;  1C77 A;  4H2A A;  1SBB B;  3P4R B;  2PVG C;  3KW5 B;  3NHE B;  1SGH A;  2BYE A;  3VTV A;  3DBH B;  1IP9 A;  1TS2 A;  1E8Z A;  1QOB A;  3C8Y A;  4MSM B;  2JPH A;  1Q5W B;  3K9O B;  5G2N A;  1V8C A;  4C7Y A;  2K5P A;  3PZ8 A;  2NBW B;  1VCB A;  2INN E;  5LNK 1;  2L05 A;  1I7H A;  4F1S A;  4YWG G;  5IKC M;  2JF5 A;  2GMI C;  3NY5 A;  1ACC A;  3SEB A;  3Q3N C;  1DOY A;  1JAL A;  2WDV B;  1R4M I;  4II2 B;  2WDQ B;  4GB9 A;  2MH7 A;  3P4P B;  2MHJ A;  1UNS A;  5DPS A;  4N9F 4;  2MQJ A;  3EFU A;  1C4C A;  1PYW D;  2XK5 B;  2LVO A;  1V97 A;  2D3G A;  2WU2 B;  4KV2 A;  4ZHP A;  3ALB A;  1PDX A;  3APD A;  3DWG C;  2AQ1 B;  4XGA B;  4MGY E;  3TEX A;  1P98 A;  4GDL A;  1GC6 A;  3BZD B;  1FM0 D;  4ARC A;  1QOA A;  3ZNG C;  1L4D B;  4J3O D;  2ZEQ A;  2V9H A;  1WFY A;  3ZRF A;  3NVY A;  3HK0 A;  1YJJ A;  2KO3 A;  3P63 A;  1WRI A;  2M8S A;  2J7Q B;  1ZDX A;  3KVF B;  1L7Y A;  4JE3 B;  2W3R A;  1WF9 A;  3AED B;  4JQW C;  1UH6 A;  2D3B A;  2REX A;  4FA6 A;  2G45 B;  2WXK A;  4OW0 A;  1VD2 A;  3FC4 A;  3A9K A;  1NYQ A;  4DDI D;  4OZB A;  2JUO A;  4BFR A;  4KDL B;  4XWT A;  1P0R A;  5BMH A;  2QHO A;  1TT5 B;  1WE6 A;  2DAF A;  3N9Y C;  2KDI A;  4P7I A;  2N9E B;  3BVM A;  5FR6 A;  3P1M A;  2D2Q A;  3UGB B;  3BVG A;  3AU5 A;  3M95 A;  3KWL A;  3UQA A;  3U7Z A;  4IOI E;  4EFO A;  1OQY A;  2LVP A;  4JL9 A;  4WAF A;  4TUU A;  2D10 A;  1N61 A;  2PMV A;  3L17 A;  4RH6 A;  2KTR A;  3RFZ B;  5DPW A;  2GBJ A;  2XNA C;  3DVN V;  2WP9 B;  1XLN A;  2N9L A;  2UWQ A;  2BYF A;  1MFW A;  2Z0D B;  2GLS A;  1YQB A;  5FKA C;  2DEN B;  2QJL A;  1FNV A;  1ZDV A;  4A6Q A;  4M00 A;  1FXA A;  2HJ8 A;  2KAC A;  3PRE A;  3RUI B;  1JWA D;  2W9N A;  2QIL A;  3QJZ A;  2ON8 A;  1NEK B;  2KC2 A;  2WXI A;  1VDV A;  1MJD A;  2LHE A;  3WAN A;  3AE1 B;  3AE3 B;  4USA A;  2EKI A;  2MLB A;  2L00 B;  3B2G A;  3WCQ A;  1EU4 A;  4DHZ E;  3N1X C;  4BOS C;  2AL6 A;  2IO2 B;  4M01 A;  1DGJ A;  2G4S A;  1DYQ A;  4P6V F;  4LLG M;  2LXC A;  1SE2 A;  4NPN A;  2FCN A;  3MC0 B;  3N1Z C;  3CSF A;  2D3A A;  3GP7 A;  4HDO A;  2V3N A;  1Q10 A;  3ZJT A;  3EGR A;  4LDT D;  2YEP B;  5H8Y E;  1HZ5 A;  2RPV A;  3Q3O C;  3DCG A;  2HDE A;  1V80 A;  1NEN B;  2WU5 B;  3W1S C;  1ZW7 A;  3VR9 B;  1F9J A;  5E6P A;  1TS4 A;  3MJ5 A;  4HKQ A;  3PLV A;  4AUQ C;  2I38 A;  4MEL A;  2PE6 B;  4HJK A;  3PHW B;  5DPR A;  4I6L B;  3ENE A;  1F2R C;  4WUR A;  3PGE A;  1SE4 A;  3KLS X;  2BGF A;  2J53 A;  2DZJ A;  2A4Z A;  1ISN A;  2EMS A;  5BMG A;  1GB1 A;  1F0Z A;  4E74 A;  4CYE A;  3ONS A;  3A9J B;  5G5G A;  3RT3 B;  4ARI A;  3TJP A;  2BVC A;  2LRW A;  5J17 A;  4N59 A;  2IZV B;  2PTL A;  2R61 A;  2L32 A;  3E56 A;  3DVG X;  2KN4 A;  2MBO A;  4MH0 E;  3AH7 A;  1A5R A;  1LQB A;  2L52 A;  1YX6 B;  2KXJ A;  4RF0 A;  1N6Z A;  1K51 A;  1TZO A;  2C7H A;  4TV3 A;  2PVO D;  3SFD B;  2MBE A;  4OVU A;  1FFV A;  5H92 C;  2K6Q A;  2QCZ A;  5CHV C;  3AN1 A;  4BAX A;  2PW9 A;  1GOZ A;  3RNA C;  3S2A A;  5C2T B;  4ANX A;  2WX1 A;  5BMI A;  2BS4 B;  5HI1 A;  3RPF C;  4MGI E;  1AN8 A;  4DXF A;  2M19 A;  3UIP B;  3RN9 C;  1E10 A;  4MGZ E;  3DBL I;  2VZK B;  4W9D A;  4FLH A;  3Q8B A;  2NVU I;  1KLU D;  1V9J A;  2INP E;  3LYY A;  3AUL A;  2LFI A;  1KOT A;  1E5W A;  3HIZ A;  1QZE A;  4DWF A;  4PS3 A;  2L8J A;  3QQ8 B;  5T8I A;  3V6C B;  1TY0 A;  4Q2J A;  5L83 A;  3AEE B;  1WH3 A;  4IM3 A;  3ZIM A;  4MH8 A;  4E71 A;  4RNA A;  1UUP A;  2KFK A;  2FNJ B;  4WJQ A;  1JWU D;  4GGQ A;  4LNF A;  1XCQ L;  4XE0 A;  2V4L A;  3Q14 C;  4JWS C;  1STE A;  3AE7 B;  3VRA B;  2ZPY A;  1YOV B;  4RMA A;  1L5P A;  4M02 A;  2KKC A;  1B1Z A;  1XF5 L;  4EZK A;  1D4B A;  4NJC A;  2K8H A;  4B9K A;  3BK1 A;  2GB1 A;  4BOZ B;  1N5X A;  1TKG A;  3ZRC A;  2JWU A;  3DBR B;  1V1P B;  1MHX A;  2QIE B;  4HWI B;  3CIR B;  3VTW A;  1PGA A;  3BK2 A;  1E7U A;  2RR9 A;  4P1C C;  1T0S C;  5BYS A;  1Z5S B;  3HHM A;  3RNF C;  3NVV A;  3ZKJ C;  1K52 A;  1WGD A;  1VLB A;  3T8M A;  3H7P B;  3TEW A;  1RRB A;  4L1B A;  2DZK A;  1FRR A;  2GI9 A;  4XC2 A;  3WIM A;  5CHF A;  1C4A A;  4JGH B;  3VH4 B;  1ZKH A;  3NOB A;  1E8X A;  2FCS A;  3BWU D;  3WAO A;  2GBK A;  4ITK A;  1UWM A;  4OZC A;  2W82 A;  3IXS A;  2MBQ A;  1WGY A;  1R4N B;  2WS3 B;  1HA5 A;  4EKU A;  2WXO A;  1ZUD 2;  3U30 A;  2KJH B;  2M0X A;  1FMA D;  1VJK A;  2O6V A;  2JU6 X;  1WX9 A;  1XXG A;  4JWU C;  3SD5 A;  3KUC B;  4FHK A;  4C4V B;  3N32 A;  2MRP A;  1U4A A;  3R2I A;  1J19 A;  1IGC A;  1L0X B;  1VRA B;  3AE5 B;  3Q6B A;  4DK5 A;  3ZNZ B;  1YD8 U;  1OEY J;  4WWN A;  1TZ1 A;  2CHW A;  4WIP A;  4X57 B;  3PO0 A;  2D5G A;  2KTF A;  2L7R A;  1D5X C;  4TSS A;  3U4E G;  2INC C;  2Y5B B;  1PGB A;  4LTU A;  5D94 A;  5HHD G;  1FCL A;  1H8C A;  4HPM B;  1JWB D;  4W9F A;  4YTP B;  4KVG B;  3T3O A;  2WHI A;  3DHG C;  4K3C A;  4FXC A;  3OAW A;  3QK0 A;  4C4V A;  2HJ1 A;  3PV1 A;  1IPG A;  2MBH A;  2O6V B;  1TKY A;  1FNU A;  2CS4 A;  2LEK A;  2Z59 B;  5HFY A;  1V6E A;  2B76 B;  3ZDM C;  3K9P B;  5EE0 A;  3U7D A;  1M4V A;  1B9R A;  3AE8 B;  2OOB B;  1L4Z B;  2MJE A;  3ZNH B;  1D6E C;  1KFY B;  3GB1 A;  2NPT A;  4NAM A;  4ACF A;  3ZNI D;  3BY4 B;  3EA6 A;  2K8B A;  3IBE A;  4DDG D;  4KSL C;  1GUA B;  5JHA A;  5DPT A;  4FJY A;  3U8Z A;  2PEA A;  2PKO A;  2WDR B;  1AYF A;  1WGG A;  2RSU A;  3SFE B;  2ZW0 A;  1WMH A;  3AE9 B;  1T0R C;  1C78 A;  4A3P A;  3CST A;  4REZ A;  1N5W A;  3IAM 1;  2G3Q B;  2N1W A;  2Z8L A;  4PYZ A;  2ONQ A;  5C1Z A;  4NQL B;  4HCP B;  3DPD A;  4G3X B;  5GXG B;  2CU1 A;  2M56 B;  3QAR A;  1WX7 A;  4KX6 B;  3NRZ A;  3DOW A;  3QCA A;  3ZJV A;  1I35 A;  4AP4 C;  3PHX B;  4ZDV A;  1RWS A;  3IAS 1;  4US8 A;  4ANU A;  1EU3 A;  3RD2 A;  2IO3 B;  2K39 A;  4BVU C;  1WXV A;  1SB3 C;  2IPK D;  4ICU A;  3A4S C;  4LK0 M;  1YIW A;  1N62 A;  1F1H A;  3FAH A;  3V3X A;  3H7P A;  3RUL A;  3NZU A;  2WGS A;  1I4G A;  1UBQ A;  3L0W B;  2JQR B;  1ZXI A;  1NI3 A;  2CJN A;  1YNT E;  4ICV A;  4P16 A;  3I57 A;  1MG8 A;  2K22 A;  2KLG A;  4WQO B;  1J0G A;  2IYD B;  5LXH A;  1NVI D;  1P7F A;  3OG5 A;  1FFU A;  4MT5 A;  4KSK C;  3PRM B;  1WYG A;  1WM3 A;  2OJW A;  2AQ2 B;  1HTO A;  2A5U A;  3Q8A A;  1Z2M A;  5IP4 D;  5MPO A;  2L0T A;  2LGD A;  2KJ6 A;  2N9X A;  4WAA A;  1AWD A;  1GC7 A;  1QIL A;  1GB4 A;  4DBG A;  1V86 A;  2OJR A;  1GJZ A;  1WIA A;  4DXA B;  5LLI A;  3VDZ A;  2LAS A;  4II3 B;  3TEZ A;  2AL3 A;  4NJ6 A;  2KDE B;  3ZGZ A;  4NAW A;  3AEB B;  4IM2 A;  2DYO A;  4MM3 A;  4KZ0 A;  3ECI A;  1D5Z C;  3TMP B;  2BF8 B;  2WXH A;  2KHW B;  2N7J A;  5BO4 B;  2R2O A;  2KX0 A;  3ZVV A;  1KM7 A;  2K8C A;  2LVQ A;  4MDK E;  4C56 C;  1D5M C;  4FN2 A;  1G6J A;  1GNU A;  1L6U A;  4OVZ A;  2GBM A;  2VRR B;  2NR2 A;  5HG2 A;  4HXD A;  1FRD A;  1T5X D;  1WE7 A;  1YX5 B;  3SHQ A;  1YJ1 A;  4ZYN A;  3TEY A;  2RDH A;  3KUD B;  3R2T A;  2ZNV C;  4M0W B;  3EHV A;  2BT6 A;  4OVV A;  4D2K A;  2JWZ A;  4IG7 B;  4WQM A;  3R66 C;  4YSY B;  4JX1 C;  2CHX A;  3M3J A;  1L0V B;  2DHZ A;  2LHD A;  4IWO A;  3LDZ E;  2WXJ A;  5KHQ A;  3KQ4 A;  2BYT A;  3DVG Y;  1CQV A;  1R7S A;  5BYR A;  4RCO A;  3UQB A;  2BTE A;  4N58 A;  2KWD A;  3P42 A;  2ZPN A;  1HQR D;  3L13 A;  1FEH A;  3PTF C;  2JYT A;  3HVD A;  1N63 A;  1RFK A;  1I4P A;  3QC8 B;  1WR1 A;  4K7S A;  1L2N A;  2CJO A;  3QA8 A;  1FXI A;  3V62 A;  3VVW B;  1GG3 A;  4AJY B;  1LM8 B;  3PZD A;  1FPY A;  1X1M A;  2ZVN A;  3RI7 C;  4TMA B;  1AW7 A;  1TKE A;  3H1U A;  3ML8 A;  3I9V 1;  2BB6 A;  2IND C;  2C9W B;  5EDS A;  1E7P B;  2O2V B;  4G50 A;  3LXF A;  3IT6 B;  3E9S A;  3MTN B;  4KGR A;  4A8X C;  1FO4 A;  4HJG E;  3ZTC A;  3Q3M C;  2BB5 A;  2LGI A;  2KZR A;  3AEG B;  1J8C A;  2KMM A;  5AZH A;  4PS8 A;  2KD0 A;  2KJR A;  5AZF A;  3I3T B;  4GLS C;  5E6J A;  4GN1 A;  4S17 A;  3AXC A;  1OQR A;  2WYQ A;  4AOF A;  3PLU A;  1C3T A;  1C76 A;  3APC A;  2RPQ A;  5EE1 A;  3V61 A;  2CHZ A;  4YL8 A;  3VH3 B;  5E6O A;  1SJE D;  1YN5 A;  3O65 B;  2JVC A;  2BYV E;  3ZUN A;  2DNF A;  3ZXV A;  4DHJ D;  3I5J C;  3JW0 X;  3RNG C;  1AAR A;  3H6N A;  4L23 A;  2DX5 B;  2KQS A;  4ZRI A;  2K25 A;  2EEL A;  2WWZ A;  4KDI C;  1ZP0 B;  2JRH A;  1S1Q B;  2D07 B;  2WXP A;  1WZ0 A;  1PQS A;  3C0R B;  2ZCC A;  2FCQ A;  2UU7 A;  2LJ5 A;  4W9E A;  4B0M A;  3VRB B;  1OFF A;  1TJE A;  4FBJ B;  1UWX A;  3MP9 A;  4KIK A;  1JCK B;  2QDF A;  3WAM A;  3OWE B;  3N30 A;  3W2D A;  4GXB A;  4GMV A;  4WWM A;  2PJH A;  2O2V A;  4S0R A;  2XBB C;  5AZG A;  2ZZP B;  4IKG A;  5J2R A;  3R7R A;  1DOI A;  2KFJ A;  1YQ4 B;  1KTK A;  4GU2 A;  4FHJ A;  4GDL B;  3FIL A;  2KFK B;  3UI3 A;  2LD9 A;  2C7N B;  2UYZ B;  4WJN A;  3DDC B;  2KMC A;  2LXA A;  1XCT L;  1L6V A;  2SAK A;  3BII D;  2JSV X;  4XZ4 A;  3VHT C;  3RNE C;  4W9J A;  2J0J A;  4EE2 A;  1GPX A;  1M94 A;  5IA7 A;  3HM3 A;  3VUY A;  1C9F A;  2GBN A;  3DBH I;  3HUI A;  2K9X A;  3CF6 E;  2JZP A;  3UF8 A;  1NDD A;  2HTM E;  3GZN I;  1QT9 A;  2M0A A;  3ZO5 B;  4BKS D;  4NZL B;  2WXL A;  4YXD B;  3V6E B;  1VZ6 A;  2LGX A;  3H9D A;  1KLG D;  5IN7 A;  2C7M B;  2LUM A;  1P3Q U;  2KC1 A;  2WXN A;  1WRD B;  2KK8 A;  2RGF A;  3L16 A;  1WMH B;  2BWE S;  4AWJ A;  1MG4 A;  2N9K A;  4MAC A;  1KLV A;  3RCZ A;  4W9L A;  2FBW B;  3FKY A;  4ANV A;  1HE8 A;  2MW5 A;  3VAW A;  2KVR A;  4ZOH C;  3JYU A;  2NBU A;  1ROE A;  2I2Y A;  3GE8 C;  4HVB A;  4HLE A;  2KNB A;  3NZS A;  2CU3 A;  2BWF A;  1RLF A;  4ANW A;  4A90 A;  3OLM D;  2M1M A;  2IY1 B;  1OEY A;  1Q1O A;  4KKJ A;  2OED A;  1UBI A;  4XDC A;  3QIJ A;  2DYM A;  2JX5 A;  2KDF B;  4F8C B;  3T9L A;  3A33 B;  1LGR A;  2K3U A;  2W54 A;  2GRI A;  1PFD A;  1I4R A;  2PIA A;  3ABV B;  3AB5 A;  1WJN A;  5FK9 C;  4GSW A;  4LNN A;  4YSZ B;  3MC8 A;  3B0A A;  1KH0 A;  3MHS D;  2MEK A;  1WJ4 A;  4EEW A;  1HXY D;  2M4N A;  4LNK A;  1EWC A;  1T0Q C;  2DYB A;  2HE7 A;  4KZC A;  5IAA C;  3KYC D;  2WXQ A;  1TYG B;  3AU4 A;  5JXV A;  3MJW A;  1WI0 A;  1ENF A;  1QQR A;  1E8W A;  1CMX B;  3AEA B;  2V4I B;  4EOY A;  1ZGU B;  2BBC A;  5D3D A;  2J4X A;  1E7V A;  4DQO C;  2N9P C;  3AE4 B;  2FUG 1;  3W9C B;  3NUH B;  2WDT B;  3TSS A;  1YMH E;  4C80 A;  3A9J A;  1F52 A;  1PUT A;  3D32 A;  1ZE3 D;  1E0Z A;  4JPS A;  1EF1 A;  2K6D B;  4NJ7 A;  2BKR B;  3RMK C;  3B1L X;  3I63 C;  1TY2 A;  2KDB A;  3NS1 A;  2FAZ A;  4MJS A;  2L3Z A;  4RM9 A;  3W5V B;  1CK1 A;  4NQK E;  2JRI B;  2KMA A;  3A4R A;  3ML9 A;  5AUI A;  4PK1 A;  2WXG A;  3X23 A;  3DQV A;  2IGD A;  2XK5 A;  2WXR A;  1YJI A;  1V49 A;  1MHH E;  4WH4 A;  2KTR B;  1IYF A;  1WXQ A;  4C00 A;  3ZQ4 A;  1FNW A;  3Q3J A;  2E6X A;  3L08 A;  3RYT A;  4MGK E;  3NZ3 A;  2Y5P A;  1RYJ A;  1V2Y A;  1VZ8 A;  2GBR A;  2JXX A;  3VUW A;  3V05 A;  4B0E A;  4B95 A;  3Q3F A;  2C60 A;  5TR5 A;  4HK2 A;  1ET6 A;  4PS7 A;  2KWC A;  3H8H A;  5I4D A;  1I4Q A;  4AQ7 A;  1FD6 A;  4ZRQ A;  1R4N I;  1NBF C;  2JZ3 B;  3JSV B;  2XEW A;  1FCC C;  5CTR C;  1WY8 A;  4ZRJ A;  4LDT B;  2JT4 B;  2L1A A;  3SU8 X;  1OTR B;  3NVW A;  1FIQ A;  3QAQ A;  3W1Y A;  1N60 A;  2FID A;  3ZLZ A;  2RMM A;  2V1Y A;  1F2R I;  2RD0 A;  5JH5 C;  3EFC A;  4M8N A;  3IHP C;  4AS1 A;  2H88 B;  3VTU A;  4XYC A;  4HPL B;  1VZ7 A;  3BYT B;  2IGH A;  2D3C A;  2IY0 B;  4HEA 1;  3KWV A;  3RNC C;  2SEB D;  1UGJ A;  2V3S A;  2VZK D;  3L4P A;  3MHZ A;  4UDU C;  4XWW A;  4RFB A;  2WNM A;  2O6V D;  2RDB C;  2PLP A;  1UF0 A;  1EF5 A;  4K81 A;  5AEK B;  3PZ7 A;  3BYY B;  2YVC A;  2I1K A;  3Q8C A;  3AE2 B;  2IDY A;  4I6P A;  4KGS A;  2DAJ A;  4LNI A;  2EKE C;  4EUT A;  1TBE A;  1WR6 E;  5G55 A;  2AX5 A;  1E90 A;  2ZNV B;  3PRZ A;  2M17 A;  4PT5 A;  1A70 A;  2LGS A;  3EC8 A;  1XEE A;  4OZA A;  1H4R A;  5J18 A;  2TSS A;  3L54 A;  1P7E A;  2BPS A;  1QOG A;  2FUH B;  4LJP B;  2MWS B;  2PPH A;  5D6J B;  1CJE A;  2V0G A;  1HEZ E;  2L76 A;  3IG3 A;  4L2Y A;  3HVZ A;  2L83 A;  1XLO A;  2E3T A;  2DBY A;  3LJ3 A;  2MBB B;  1SIJ A;  1MI0 A;  3W5U B;  1IUE A;  4GOC A;  3BIN A;  2DZI A;  3WAP A;  4IDI A;  2BW2 A;  4RM8 A;  3L10 B;  1P1A A;  4O1N A;  1T6B X;  5IO9 A;  4IWQ A;  3VUX A;  4FUL A;  1WJU A;  2Y5C A;  4RGT A;  4HPP A;  1BT0 A;  1JRO A;  2N1V A;  2J0M A;  2MA9 B;  2NPT B;  4NNJ B;  3NG0 A;  3JSV A;  2G4D B;  2KOX A;  3J9C A;  4ASW C;  2KAN A;  3URY A;  2EMT A;  2FE8 A;  1C4P A;  4TKN A;  4R3D A;  3HM6 X;  2W55 A;  4W9K A;  1J7B A;  5DCN A;  3DBR I;  3WAL A;  2G1E A;  4FJZ A;  2BS2 B;  4IC7 B;  4ZYS A;  2ACZ B;  2C5L C;  3U2S C;  2G9H D;  2Z0E B;  2KAJ A;  2IGG A;  2N4F A;  4B6W A;  1P9D U;  2ZCB A;  4HRO A;  1BUI C;  3PVL A;  2LMC A;  2LWP A;  3KYD D;  1YQ3 B;  1WWT A;  2WQY B;  4GDK A;  2LZ6 A;  5HKH A;  1YN3 A;  3B2F A;  5D7G A;  3PS6 A;  1S3S G;  4EZJ A;  4W9G A;  4A9A A;  2N7E A;  3OJ3 A;  1ET9 A;  1TGZ B;  4HDQ A;  2WX0 A;  2ASQ A;  4MJS B;  1SSN A;  1WJ6 A;  3BVZ A;  4I6N B;  4BKT A;  3DWM A;  4MM3 B;  1RAX A;  1T0Y A;  1K50 A;  2NCN A;  4K7W A;  1ZOY B;  1Y8R C;  1WZ3 A;  1XT9 B;  3AI5 A;  3U52 E;  3NJT A;  2PE9 A;  2WLB A;  4BKG A;  3A9K B;  2N0S B;  3VQI A;  3R7Q A;  1BML C;  3B9J A;  1EO6 A;  3VFK A;  3M63 B;  2KQ7 A;  1E9M A;  4DXG A;  3ZTD A;  2FCM A;  3C19 A;  1UGM A;  2NS5 A;  1HTQ A;  4CQN A;  3TUO A;  1UD7 A;  3EUB 2;  3Q2A C;  3IFW B;  2IJ0 A;  4IUM B;  1R4M B;  5JHB A;  1XLP A;  3GZN B;  2WXF A;  3TIX A;  1KF6 B;  2JY6 A;  3Q69 A;  5LXI B;  3DBL B;  4BZA A;  1E8Y A;  3B08 A;  3ETR A;  1UEL A;  4FJV B;  5KHO A;  2R2Q A;  5G5H A;  1MPE A;  4C7Z A;  1NYR A;  1ESF A;  1WYW B;  4JLC A;  2FIF A;  3EEC A;  3ZXR A;  2BQQ A;  4URK A;  4YSX B;  2J0K A;  1I42 A;  1V5O A;  4G11 A;  1JWM D;  1LXD A;  4W9I A;  2MX2 A;  3ZYY X;  2CR5 A;  1I4H A;  2RDG A;  4IM0 A;  1TS3 A;  4BBN C;  1WXS A;  2X8X X;  2KWV B;  4GIV A;  1YN4 A;  4TQ0 A;  4DHZ B;  3AEF B;  2ICI A;  4AJW A;  2BS3 B;  1K8R B;  4G0N B;  4WWO A;  2VH1 A;  5L95 C;  3MFG A;  4JIO U;  1V5T A;  3CMM B;  2V3P A;  3AV8 A;  3IT4 B;  4HRS A;  1C1Y B;  2KYW A;  3NS8 A;  4M8M A;  2H89 B;  2NMQ A;  3X0W A;  2W3S A;  2L0F A;  1TIF A;  5EE9 A;  3NVZ A;  2QSD A;  4OHJ A;  1SJH D;  2AEH A;  4LCD E;  5D2M B;  2QC8 A;  3APF A;  2JYE A;  1IBX A;  1BXT A;  1WM2 A;  2ZVO A;  3SR6 A;  1WGR A;  3V60 A;  2LRU A;  1ZXH A;  2VH2 A;  3GOE A;  1WX8 A;  1WSP A;  1QLB B;  2AYO B;  1WXA A;  1JML A;  3Q8F A;  3N3K B;  4N6E B;  1FXT B;  3VR8 B;  3ZW3 A;  2HTH A;  5IOI A;  2KLC A;  2Q5W D;  1NI2 A;  1CZP A;  4RF1 A;  4BBN F;  1Y56 A;  2D11 A;  2X38 A;  3AE6 B;  1Q0W B;  1TTN A;  4DHJ B;  2MJ3 A;  3AM9 A;  3RZW C;  2ZW1 A;  3QWZ B;  2NTT A;  3W1S A;  3OJ4 B;  2DZM A;  2OHF A;  3QHT A;  2MSE D;  1OQQ A;  3PSE B;  2XN9 C;  3KUZ A;  1V81 A;  3GS2 A;  2KT7 A;  3H7S A;  3T3N A;  4W9C A;  3JVZ X;  5EE3 A;  4KKI A;  4FAD A;  1UZX B;  1RFA A;  4CHK A;  1K53 A;  4MEM A;  4XX5 A;  2BKF A;  2AQ3 B;  5D3I B;  3UIO B;  1KRH A;  2K1F A;  1SIF A;  4RGO S;  4F7Z A;  1D3Z A;  2MP2 A;  4WJO A;  3SDL C;  3FIL B;  2WXM A;  1PGX A;  3LB8 C;  1J7A A;  3VXW A;  4A3O A;  3PRP B;  1VR9 A;  4P1B C;  2KVZ A;  4ZRK A;  4A55 A;  5E6N A;  3TCA A;  1IBX B;  1E6E B;  2B3A A;  4W9H A;  2ZJD A;  3RNB C;  4LJO B;  4GDK B;  1XQQ A;  3DBS A;  4ZRP A;  2LJI A;  2QEJ C;  2JZZ A;  4M0W A;  2J52 A;  4LNO A;  1DOX A;  2NTS A;  3P2B A;  2LGY A;  1J7C A;  2MP2 B;  3WA0 A;  1SF0 A;  4HCN B;  1L0Y B;  1JQ4 A;  3CWI A;  4BKS A;  2KN5 A;  1V1P A;  2I1J A;  1V1O A;  2N7D A;  2MCN B;  5TSS A;  4NY0 A;  1XO3 A;  3R8B A;  3ZJU A;  1I4X A;  4US9 A;  1RM6 C;  3TL5 A;  5BYQ A;  4E3C A;  4MSQ B;  2K0P A;  4CO7 A;  3RZF A;  1HZ6 A;  3O13 A;  3DHI C;  2DLB A;  4NAW B;  5C23 A;  2KDM A;  3AMZ A;  3KH0 A;  3QX1 A;  4K7U A;  1TS5 A;  2NBV B;  5JZE B; 
#chains in the Genus database with same CATH homology
 1SXT A;  3IT6 B;  3E9S A;  4MH8 A;  1QOG A;  4RNA A;  1XLQ A;  4KGR A;  2MJD A;  1UUP A;  3P4S B;  1CJE A;  2J42 A;  5C3J B;  1JWU D;  2V0G A;  4A8X C;  1C79 A;  1FO4 A;  1HEZ E;  1XCQ L;  4HJG E;  4L2Y A;  1SEB D;  4XE0 A;  2BB5 A;  2LGI A;  3HVZ A;  2L83 A;  4HKZ E;  3Q8E A;  4JWS C;  1JWS D;  1SE3 A;  1STE A;  1T3Q A;  1XLO A;  3AE7 B;  3AEG B;  2E3T A;  3VRA B;  2DBY A;  2KMM A;  1L5P A;  1SIJ A;  1MI0 A;  4GLS C;  5E6J A;  3W5U B;  1B1Z A;  1XF5 L;  1D4B A;  1IUE A;  4NJC A;  1OQR A;  2QMT A;  3BK1 A;  1C76 A;  4YTN B;  2GB1 A;  1N5X A;  4YTM B;  1TKG A;  1EM7 A;  4ZHO A;  2JWU A;  4IDI A;  1QKZ A;  1JRP A;  2BW2 A;  2Y3A A;  1V1P B;  1MHX A;  2QIE B;  3CIR B;  4O1N A;  1PGA A;  5EE1 A;  3BK2 A;  4XDD A;  1T6B X;  1EWY C;  1SJE D;  5BYS A;  1YN5 A;  3NVV A;  1K52 A;  2Y5C A;  4RGT A;  1JRO A;  1VLB A;  3TEW A;  4L23 A;  1IGD A;  4L1B A;  2EEL A;  2YEP F;  3AEC B;  3J9C A;  1FRR A;  2GI9 A;  1ZP0 B;  3URY A;  1C4A A;  2FE8 A;  1C4P A;  4R3D A;  2WXP A;  2W55 A;  3BWU D;  4ITK A;  1J7B A;  1UWM A;  3HRD D;  4B0M A;  4OZC A;  2DWQ A;  2W82 A;  1F77 A;  3IXS A;  2G1E A;  3VRB B;  4KGT A;  1OFF A;  1QF6 A;  2BS2 B;  1LO5 D;  4YT0 B;  1TJE A;  4ZYS A;  1GAQ B;  2WS3 B;  3P4Q B;  1UWX A;  2ACZ B;  1HA5 A;  3MP9 A;  1JW9 D;  3U2S C;  2G9H D;  2WXO A;  2KAJ A;  2IGG A;  1ZUD 2;  1JCK B;  4HRO A;  1MVK A;  1FMA D;  4RGN A;  1VJK A;  1BUI C;  3OWE B;  2JU6 X;  1XXG A;  4JWU C;  2LMC A;  3W2D A;  4TQ1 A;  1ZPS A;  5AUK A;  4WWM A;  2JXT A;  1YQ3 B;  5FR3 A;  1WWT A;  2WQY B;  3R2I A;  1IGC A;  1L0X B;  1VRA B;  3AE5 B;  1QOF A;  4RGM A;  1WGK A;  4IKG A;  2KQ4 X;  1YN3 A;  1C77 A;  1DOI A;  4H2A A;  1SBB B;  3B2F A;  1YQ4 B;  3P4R B;  5D7G A;  1KTK A;  2PVG C;  4WIP A;  3PO0 A;  2D5G A;  4A9A A;  1D5X C;  1ET9 A;  4TSS A;  3U4E G;  1TS2 A;  1QOB A;  1PGB A;  3C8Y A;  4GDL B;  3FIL A;  3UI3 A;  1SSN A;  4LTU A;  3BVZ A;  1V8C A;  4C7Y A;  3DWM A;  2K5P A;  4MM3 B;  5HHD G;  1FCL A;  3PZ8 A;  1K50 A;  2INN E;  1JWB D;  4YTP B;  5LNK 1;  3T3O A;  1ZOY B;  1XCT L;  1I7H A;  1L6V A;  2SAK A;  3BII D;  2JSV X;  3U52 E;  4YWG G;  4FXC A;  4EE2 A;  2WLB A;  1GPX A;  1ACC A;  3SEB A;  1DOY A;  1JAL A;  2N0S B;  2WDV B;  1C9F A;  3VQI A;  1TKY A;  1BML C;  3HUI A;  2K9X A;  1FNU A;  3B9J A;  2JZP A;  2LEK A;  2HTM E;  5HFY A;  1E9M A;  2B76 B;  2WDQ B;  1QT9 A;  2M0A A;  2MH7 A;  3P4P B;  5EE0 A;  4DXG A;  4NZL B;  2WXL A;  4YXD B;  1M4V A;  1VZ6 A;  4CQN A;  1B9R A;  1KLG D;  3TUO A;  3EUB 2;  3AE8 B;  1UNS A;  2IJ0 A;  2LUM A;  1L4Z B;  2MJE A;  2WXN A;  1C4C A;  1PYW D;  1XLP A;  1V97 A;  2N9K A;  1D6E C;  2WXF A;  4MAC A;  2WU2 B;  1KFY B;  3GB1 A;  4ZHP A;  1PDX A;  1KF6 B;  3DWG C;  2FBW B;  4NAM A;  3Q69 A;  2AQ1 B;  3EA6 A;  4ZOH C;  3TEX A;  2I2Y A;  1ROE A;  3BZD B;  3ETR A;  1FM0 D;  4ARC A;  2PKO A;  2CU3 A;  1QOA A;  5G5H A;  2WDR B;  1MPE A;  1AYF A;  4C7Z A;  4A90 A;  3SFE B;  1NYR A;  1ESF A;  2ZW0 A;  3AE9 B;  1L4D B;  4J3O D;  1C78 A;  4KKJ A;  4REZ A;  2OED A;  1N5W A;  3IAM 1;  3NVY A;  4XDC A;  2Z8L A;  4YSX B;  2ONQ A;  1YJJ A;  3P63 A;  1JWM D;  2DYM A;  2JX5 A;  1WRI A;  5GXG B;  2M56 B;  3ZYY X;  1ZDX A;  4KX6 B;  2K3U A;  1I4H A;  2W54 A;  3NRZ A;  2GRI A;  1PFD A;  2RDG A;  2W3R A;  4JE3 B;  1I4R A;  2PIA A;  3ZJV A;  3AED B;  3ABV B;  3AB5 A;  1TS3 A;  5FK9 C;  2WXK A;  4OW0 A;  3FC4 A;  4YSZ B;  1NYQ A;  1YN4 A;  4TQ0 A;  1RWS A;  3AEF B;  3IAS 1;  2ICI A;  4OZB A;  1KH0 A;  4US8 A;  2MEK A;  1EU3 A;  4XWT A;  5BMH A;  1HXY D;  1EWC A;  1SB3 C;  2IPK D;  3N9Y C;  2BS3 B;  3BVM A;  4LK0 M;  3P1M A;  3MFG A;  3BVG A;  2V3P A;  2WXQ A;  3KWL A;  1N62 A;  3AV8 A;  1TYG B;  3U7Z A;  3IT4 B;  4HRS A;  3FAH A;  4IOI E;  3V3X A;  5JXV A;  1ENF A;  1QQR A;  1I4G A;  2H89 B;  4WAF A;  2NMQ A;  2JQR B;  3AEA B;  2V4I B;  1N61 A;  2PMV A;  4RH6 A;  1ZXI A;  1NI3 A;  2BBC A;  2CJN A;  1YNT E;  5D3D A;  3RFZ B;  2W3S A;  2XNA C;  2J4X A;  4DQO C;  4P16 A;  5EE9 A;  2WP9 B;  2QSD A;  1XLN A;  2N9L A;  3AE4 B;  3I57 A;  2FUG 1;  3NVZ A;  4OHJ A;  1SJH D;  3W9C B;  2K22 A;  3NUH B;  3TSS A;  1YMH E;  4C80 A;  2JYE A;  1IBX A;  1PUT A;  5FKA C;  1BXT A;  1NVI D;  1P7F A;  2QJL A;  1FNV A;  3SR6 A;  1ZE3 D;  1ZDV A;  4A6Q A;  1E0Z A;  4JPS A;  1FXA A;  1FFU A;  2KAC A;  1ZXH A;  1JWA D;  2QIL A;  4MT5 A;  2ON8 A;  1NEK B;  1WYG A;  1TY2 A;  3NS1 A;  2WXI A;  1WSP A;  2AQ2 B;  1VDV A;  1QLB B;  3Q8A A;  5MPO A;  2LHE A;  3W5V B;  1CK1 A;  1JML A;  3AE1 B;  3AE3 B;  3Q8F A;  1AWD A;  4USA A;  4N6E B;  2EKI A;  1QIL A;  1GB4 A;  3B2G A;  3WCQ A;  3VR8 B;  1EU4 A;  5AUI A;  2Q5W D;  2WXG A;  3TEZ A;  1CZP A;  4RF1 A;  1Y56 A;  1DGJ A;  2IGD A;  3AE6 B;  2X38 A;  2WXR A;  3ZGZ A;  1YJI A;  2MJ3 A;  3AM9 A;  1DYQ A;  4P6V F;  1MHH E;  4LLG M;  1SE2 A;  2ZW1 A;  2NTT A;  3MC0 B;  3AEB B;  4WH4 A;  3GP7 A;  1WXQ A;  2DYO A;  3W1S A;  3ZQ4 A;  1FNW A;  2V3N A;  2E6X A;  3NZ3 A;  2Y5P A;  1D5Z C;  1Q10 A;  3ZJT A;  2WXH A;  2OHF A;  3EGR A;  2YEP B;  5H8Y E;  1HZ5 A;  1OQQ A;  2RPV A;  2N7J A;  1RYJ A;  2XN9 C;  1VZ8 A;  2HDE A;  3GS2 A;  1NEN B;  2WU5 B;  3T3N A;  3VR9 B;  4C56 C;  3V05 A;  4B0E A;  1D5M C;  1TS4 A;  5EE3 A;  4KKI A;  3MJ5 A;  4HKQ A;  1ET6 A;  1K53 A;  1L6U A;  4OVZ A;  2I38 A;  3H8H A;  5I4D A;  5HG2 A;  1I4Q A;  4AQ7 A;  2AQ3 B;  5D3I B;  4ZRQ A;  1FD6 A;  1FRD A;  1KRH A;  4RGO S;  1T5X D;  1FCC C;  1F2R C;  4WUR A;  3TEY A;  3FIL B;  2RDH A;  3R2T A;  2WXM A;  1PGX A;  2L1A A;  1J7A A;  2BT6 A;  3LB8 C;  3NVW A;  1SE4 A;  3KLS X;  1FIQ A;  1VR9 A;  2J53 A;  4A55 A;  4D2K A;  1N60 A;  5BMG A;  1GB1 A;  4WQM A;  1F0Z A;  4YSY B;  4JX1 C;  2RMM A;  1F2R I;  1L0V B;  1IBX B;  2LHD A;  5G5G A;  1E6E B;  4ARI A;  2WXJ A;  4GDK B;  4N59 A;  4AS1 A;  2H88 B;  3KQ4 A;  2BYT A;  2PTL A;  1CQV A;  1R7S A;  2R61 A;  4ZRP A;  2L32 A;  1VZ7 A;  2LJI A;  3BYT B;  5BYR A;  3E56 A;  2IGH A;  2QEJ C;  2KN4 A;  4HEA 1;  3KWV A;  4RCO A;  4N58 A;  3AH7 A;  2BTE A;  2L52 A;  2SEB D;  4M0W A;  2J52 A;  2KWD A;  4RF0 A;  3P42 A;  1UGJ A;  1DOX A;  2NTS A;  2VZK D;  1K51 A;  1TZO A;  3L4P A;  3MHZ A;  2PVO D;  3SFD B;  1J7C A;  4UDU C;  1FFV A;  5H92 C;  1HQR D;  1FEH A;  1SF0 A;  1L0Y B;  4XWW A;  1JQ4 A;  3CWI A;  4RFB A;  2JYT A;  2WNM A;  3HVD A;  3AN1 A;  1V1P A;  1V1O A;  1N63 A;  2PLP A;  1RFK A;  2PW9 A;  1I4P A;  1GOZ A;  5C2T B;  5TSS A;  3PZ7 A;  1XO3 A;  2BS4 B;  3BYY B;  3Q8C A;  5HI1 A;  5BMI A;  3AE2 B;  2IDY A;  4KGS A;  3R8B A;  3RPF C;  1AN8 A;  2CJO A;  4DXF A;  3ZJU A;  1FXI A;  2M19 A;  1I4X A;  4US9 A;  1RM6 C;  1E10 A;  2VZK B;  4TMA B;  5BYQ A;  2AX5 A;  1AW7 A;  2K0P A;  3Q8B A;  1KLU D;  1TKE A;  2INP E;  3LYY A;  4PT5 A;  1A70 A;  1HZ6 A;  2LFI A;  3O13 A;  2DLB A;  3I9V 1;  4NAW B;  2KDM A;  1XEE A;  3AMZ A;  4OZA A;  2BB6 A;  2TSS A;  5T8I A;  1TS5 A;  1E7P B;  1TY0 A;  4Q2J A;  1P7E A;  3AEE B;  3LXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...