2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
4IW0A 5D94A 4GDLA 3ENEA 2HJ8A 1WY8A 1YD8U 3VQIA 3ZNGC 1E7UA 2V3SA 3TMPB 3VUXA 3NY5A 2RGFA 5KHQA 2R2QA 3QHTA 2UWQA 2L76A 3UF8A 3VH4B 2G45B 2L00B 4W9HA 2DENB 1I35A 2Z0DB 2K8HA 1OEYA 4E3CA 1KLVA 1WGRA 3SU8X 2BKFA 5IAAC 3ML8A 1ISNA 4URKA 2ZPYA 1E5WA 2K6DB 2KQ7A 3O65B 2RR9A 3P2BA 2KJRA 2MBHA 3QIJA 3RZWC 3VXWA 1R4NI 1YQBA 2NBUA 3L13A 4FBJB 4BBNC 2KD0A 1VCBA 2BKRB 1IPGA 2LXAA 3DBRI 3DBSA 3H6NA 3IG3A 3JSVA 2NS5A 2IY0B 3WAPA 2C7HA 3PHWB 2AL3A 4MM3A 4F1SA 3A1QA 3KW5B 5AEKB 2AEHA 3RZFA 3D32A 3H7PB 4BFRA 2JWZA 5JH5C 1E8XA 2G3QB 2L0TA 2ZVOA 2EMTA 2KDEB 1WGGA 1ZGUB 3H9DA 2KMCA 2GBMA 4G11A 1UD7A 2MP2A 2JZ3B 4GSWA 1A5RA 2LI5A 3QWZB 4X57B 3WIMA 2KFKA 2IO0B 4IUMB 3DVNU 1LM8B 2NR2A 2W9NA 1IYFA 3HM3A 4WJOA 2FCNA 2RPQA 5CHVC 3DVNV 1RFAA 4HJKA 4MDKE 2N1VA 1E8WA 1UGMA 3I3TB 3M3JA 1WGDA 1WXSA 2XEWA 2DAFA 3HK0A 1GNUA 2RD0A 3NOBA 3ZKJC 2LWPA 1SE9A 1AARA 1M94A 2DHZA 3RD2A 1Q1OA 1H4RA 4K81A 4LJPB 3RUIB 2N1WA 3R66C 3W1SA 4K7UA 4XX5A 4F8CB 2DZIA 1WR6E 2K25A 4PYUA 4JQWC 1S1QB 4F7ZA 3UIOB 3L10B 1WZ3A 4E71A 2N4FA 4GGQA 3HHMA 3PRPB 1P3QU 1WGYA 2K39A 2JRIB 2CHXA 4HDQA 4NQKE 3W1YA 4NQLB 3ZNZB 3KH0A 4B6WA 3ZRCA 1WGHA 4GU2A 2BYVE 2REXA 4BKSD 2J0JA 1X1MA 2JT4B 4KZCA 1Z5SB 3NZSA 2C7NB 2LGYA 1UBQA 4E74A 1OEYJ 1L7YA 4DK5A 1GJZA 1WIAA 1EF1A 1WXAA 2BGFA 4LJOB 2N9XA 4J6IA 3SHQA 1UELA 1V9JA 3DCGA 3ZO5B 1TBEA 4IWPA 2L05A 2LVQA 4GDKB 3A9KB 2IBIB 3NZUA 4AP4C 2MLBA 3KYCD 2GBJA 2LGXA 2CR5A 2NCNA 2KO3A 1VD2A 2V4LA 2ZNVC 1WM2A 2D3GA 2JUOA 1ZKHA 2B3AA 3IBEA 4KV2A 2GBKA 3MJWA 4MSQB 3L08A 5E6OA 3JSVB 3L16A 5TR5A 3N32A 1OQYA 4ZYNA 3U30A 4RMAA 5E6PA 4IWQA 2LASA 2MWSB 4II2B 4TQ0A 3APFA 5HKHA 3NS8A 2BYEA 4M8MA 2JRHA 4GMVA 3WAOA 4EEWA 3JYUA 2IY1B 1KM7A 2LGDA 4DBGA 2KXJA 3WAMA 4W9CA 1KOTA 3VUWA 5LXHA 3ZTDA 4DHZE 4NPNA 2D10A 3IVFA 3K9OB 2JY6A 3WA0A 3APDA 4EZJA 1WH3A 3M63B 4OVVA 1P9DU 4WQOB 2M8SA 3SD5A 5FR6A 4EUTA 2DX5B 5DPRA 2MA9B 2CHZA 2J0KA 2DYOA 3OJ3A 4W9FA 3T8MA 3R3MA 3PS6A 1P98A 4ZRIA 2NPTA 3V6EB 2XK5B 4G50A 4IG7B 1P0RA 1Q0WB 1XQQA 2M0XA 4ZRKA 2HE7A 4ASWC 3UINB 2K8BA 3PLVA 4WJQA 2A5UA 2KC2A 4HXDA 4NNJB 4KVGB 2AL6A 3CSFA 3QK0A 1G6JA 3HM6X 5AZHA 4BVUC 3N30A 3CMMB 3DQVA 1V86A 2BYFA 3TBLD 4HDOA 4DHJD 1WRDB 2KTFA 3ML9A 5D6JB 1P1AA 2O2VA 2MBBB 2K8CA 3B1LX 1E7VA 3QJZA 4MSMB 2V1YA 3A4RA 3BINA 4AWJA 1H8CA 3AU4A 3UIPB 2ZEQA 3VVWB 3PLUA 4LCDE 2D11A 2L3ZA 5J17A 3QAQA 1Z2MA 3QARA 2G4DB 4M8NA 2ZNVB 4ANWA 4A3PA 4MJSB 3JVZX 4I6LB 2FCQA 5DCNA 2O2VB 2M17A 2KX0A 3MHSD 4EZKA 2BF8B 5D7GA 4AJYB 2D2QA 3PSEB 1R4MI 5AZFA 3KYDD 3PZDA 5G2NA 1WJ4A 2MBOA 2ZZPB 4IC7B 4P7IA 1OTRB 2FIFA 4WWPA 2GBRA 2FIDA 3NHEB 2FAZA 2KANA 5BO4B 3VTWA 3OLMD 2ZCCA 4W9GA 3TCAA 3WALA 2C60A 1WF9A 4ICUA 2R2OA 5JHAA 2XK5A 4GB9A 2FCMA 2NPTB 3R7RA 3ZRFA 5JZEB 2PJHA 4K7WA 2PE6B 5CTRC 3ZDTA 4MGKE 4XC2A 3B0AA 1FXTB 3W1SC 2JVCA 2KWUB 2GBNA 2Z0EB 3IHPC 3KUZA 1C1YB 2N9PC 4MGZE 4TV3A 3A1QB 1UBIA 3ZIMA 4BKSA 3QX1A 4EZLA 2MX2A 1BT0A 4BBNF 3DOWA 4ICVA 2NVUI 4EKUA 1WYWB 3V61A 2KLGA 4G0NB 1TGZB 4JL9A 2LJ5A 5DPTA 3A9JA 4KDLB 3PREA 3UQBA 2DZJA 4NAWA 1PQSA 1V2YA 4DDGD 2KWVB 2LRWA 3A9JB 3B08A 4FHKA 2G4SA 4BKTA 3QA8A 3VUYA 3VFKA 2XBBC 1E90A 3Q3JA 2Y5BB 3TL5A 4NY0A 2O6VB 2LUEA 3ZDMC 4DWFA 2ZCBA 3N3KB 2YLMA 3EC8A 3PGEA 3ECIA 3VTUA 5L83A 1RLFA 3DPDA 3PRMB 3V62A 4KZ0A 4RM8A 2MCNB 3DBLI 4MGYE 2JXXA 2BWES 3S2AA 2HTHA 3DBHI 4HK2A 1RRBA 2C7MB 4W9DA 3ZNHB 3Q3FA 5E6NA 2J0MA 2KTRA 4OVUA 3ZTCA 4LDTD 3R7QA 3EECA 3RULA 2KZRA 2I1JA 2FUHB 4II3B 5LLIA 2KDIA 4JLCA 1YIWA 4FA6A 2DZMA 4HVBA 4M0WB 4KSKC 2RSUA 4B9KA 1V80A 2EMSA 2OJRA 4K7SA 2AWTA 4ANUA 2MBEA 2KFJA 3X23A 2MBQA 1WMHA 5IA7A 2AYOB 2K6QA 1K8RB 2N9EB 3ZW3A 2KJHB 2IO3B 4HPMB 3AI5A 2DYMA 1LQBA 4BKGA 5C1ZA 3OJ4B 5KHOA 2CS4A 4JGHB 1LXDA 2FNJB 4DDID 3TJPA 3KUCB 2LRUA 1WX9A 3U8ZA 2NBWB 2KOXA 2JZZA 4ANVA 2KMAA 4I6NB 2J7QB 4WWOA 3PT2B 1WR1A 1T0YA 5J18A 2MRPA 1E8ZA 2CHWA 3IFWB 2KN5A 3AU5A 3VDZA 3PHXB 1GC6A 3LJ3A 1WJNA 2KFKB 2L8JA 4HCPB 1E8YA 2JPHA 3AXCA 2KHWB 2LZ6A 3KVFB 1J0GA 3C0RB 2MP2B 2IYDB 4FADA 3DVGY 1CMXB 1EO6A 4YL8A 3A33B 1NDDA 5CHFA 1WI0A 1NI2A 3HIZA 2DZKA 1WX8A 3PPAA 4MELA 4A3OA 1XD3B 1WMHB 1D3ZA 2KLCA 2IO2B 4GN1A 1V49A 2BWFA 5DPWA 2YVCA 1V81A 4FJYA 5C23A 4CO7A 1Y8RC 3H1UA 4ZDVA 1IP9A 4B95A 3RCZA 5CHWA 2MW5A 3DDCB 4NJ7A 2DYBA 1WX7A 4W9JA 2CU1A 3KUDB 5GMVA 2C5LC 3EFUA 2L0FA 1JRUA 3OAWA 4AJWA 1J19A 1WJUA 2JF5A 4ANXA 1UH6A 2KKCA 1WM3A 2KTRB 2A4ZA 2KWCA 2QHOA 3A4SC 1SGHA 2PPHA 3ALBA 3VH3B 3PRZA 2DAJA 4TKNA 5LXIB 4W9KA 5D2MB 3A9KA 3U7DA 4GDKA 3WANA 3MTNB 4MEMA 2KC1A 4HCNB 4FULA 2PEAA 1KJTA 2MQJA 4PS8A 1TTNA 4GDLB 3L0WB 2UYZB 1EF5A 2ZJDA 5AZGA 2L7RA 5EDSA 5G55A 3QCAA 3VAWA 1LFDA 4IM3A 2O6VA 1F9JA 3JW0X 3PV1A 2LVOA 2M4NA 1YX6B 1GUAB 1XT9B 1WXVA 2MSED 5JHBA 4WJPA 3K9PB 4NAWB 1TZ1A 1I42A 2N7EA 3ZNID 1QZEA 4G3XB 2O6VD 3L17A 4GIVA 3M95A 1V5OA 2OOBB 3CSTA 4AOFA 4GOCA 4TQ1A 3L54A 4IM2A 3RT3B 3QC8B 4I6PA 4A20A 1GG3A 1EUVB 1WE7A 1HE8A 4NJ6A 1YX5B 4WWNA 1WE6A 3CF6E 4W9EA 3ONSA 4ZRJA 2Z59B 1ZW7A 2KDFB 1GC7A 4KIKA 3UQAA 3GZNI 2D07B 2M1MA 3ZLZA 4FN2A 2K1FA 1NBFC 3T9LA 4RM9A 4HLEA 4N9F4 3UGBB 2ZVNA 4PYZA 1YJ1A 5CX3A 2C9WB 4KSLC 1U4AA 4EOYA 5J2RA 1V6EA 4LDTB 3V60A 1RAXA 2KVRA 1J8CA 2WDTB 2WWZA 2KDBA 2N7DA 5DPSA 4IM0A 4BOSC 3PVLA 4MH0E 1WXMA 2FCSA 2KK8A 3AULA 2ZPNA 1S3SG 4CYEA 2NBVB 4MGIE 3GOEA 2IO1B 4DHZB 2VRRB 4FJZA 4JIOU 4KDIC 4WAAA 3H7PA 1Q5WB 4KIKB 2BPSA 4MJSA 1V5TA 4PS3A 2LXCA 3QQ8B 3TIXA 2WX0A 3DVGX 3V6CB 2PE9A 4HPLB 4W9IA 4FLHA 4IWOA 3VTVA 1L2NA 2I1KA 3SDLC 2WX1A 3RYTA 1WZ0A 4K1RB 3ZUNA 3ZVVA 3VHTC 3LDZE 3BY4B 4FHJA 2LD9A 2KNBA 4FJVB 1MG8A 2GOWA 1WFYA 4TUUA 4DXAB 5L95C 2KQSA 3M62B 4HWIB 2WYQA 2IZVB 2KX3A 4BOZB 4AUQC 4W9LA 3X0WA 1UZXB 2GMIC 4WJNA 2EKEC 2HD5B 4PS7A 4DHJB 1OGWA 1SIFA 3PTFC 1WJ6A 2ASQA 3APCA 4GXBA 4XZ4A 4CHKA 2KJ6A 2LVPA 2CKHB 3EHVA 4EFOA 1C3TA 3H7SA
chains in the Genus database with same CATH superfamily
1YD8U 3P4SB 1SXTA 2B76B 1YQ4B 3NY5A 3UF8A 2L00B 2Z0DB 1OEYA 3TEZA 3OWEB 3SU8X 1IGCA 2BKFA 5IAAC 4N58A 1XLNA 4BBNC 1KFYB 3N1ZC 3DBSA 1IPGA 3DBRI 2WDRB 3WAPA 2IY0B 3PHWB 1XCQL 2AL3A 2V3NA 4MM3A 1DOXA 1JWUD 3KW5B 3RNCC 3D32A 2JWZA 1FO4A 2KDEB 2D3BA 2KMCA 2GBMA 1UD7A 2MP2A 2KFKA 2IO0B 4IUMB 1IYFA 4WJOA 1YJJA 2OJWA 1WGDA 1ZP0B 3EA6A 1N6ZA 1WXSA 2BBCA 2LWPA 5JXVA 1SE9A 3RUIB 1M94A 1Q1OA 4XYCA 3LXFA 2M0AA 2IPKD 4F8CB 3ZJTA 1V8CA 1WZ3A 3N1YC 4E71A 4GGQA 2WU2B 1WGYA 2JRIB 2W3RA 5HHDG 3NG0A 2CHXA 4HDQA 4NQKE 1I4RA 2KQ4X 1HZ6A 2REXA 2JT4B 1Z5SB 1OEYJ 1L7YA 3IT4B 4BZAA 4DK5A 4RFBA 2BGFA 2N9XA 3MHZA 1V9JA 2WXIA 3DCGA 4IWPA 3W9CB 1MI0A 4GDKB 1N5XA 2LGXA 1MHXA 2V4LA 4HPPA 1FRDA 4WH4A 1ZKHA 4A90A 2GBKA 4MSQB 3AE6B 3L16A 1N63A 3ZGZA 4DQOC 2E3TA 2MWSB 3AE7B 1UF0A 3NS8A 1VDVA 4M8MA 4GMVA 4EEWA 4GLSC 3R2IA 4OZAA 2LGDA 2KXJA 4ITKA 3VUWA 4DHZE 3TEXA 4NPNA 3K9OB 3WA0A 1F2RI 3N9YC 3AEGB 4EZJA 4WQOB 3OJ3A 1SJHD 3R3MA 2D3AA 1P98A 3PS6A 4ZRIA 1Q0WB 2W82A 3SFDB 3FILA 1R7SA 4IKGA 4HXDA 2AQ3B 1G6JA 4UDUC 1V86A 3RN9C 5D6JB 2O2VA 4MSMB 2K8CA 2V1YA 5BMHA 3BYYB 4AWJA 3KWVA 2N9LA 1Z2MA 2G4DB 3U52E 4M8NA 2ZNVB 4ANWA 1C4AA 2WLBA 2BF8B 4EZKA 1JROA 1B1ZA 1STEA 2ZZPB 4HEA1 2FIFA 5EE1A 2IDYA 2FIDA 3OLMD 4W9GA 3TCAA 3WALA 4GB9A 3AEBB 1YJIA 2PE6B 3V3XA 1ZDXA 4MGKE 3Q69A 5IP4D 4ARIA 2JVCA 2RPVA 2KWUB 2TSSA 3KUZA 1C1YB 4MGZE 1UBIA 1FPYA 4ARCA 3RNGC 2MX2A 1WYWB 2KLGA 3BVZA 1TGZB 4JL9A 2LJ5A 5DPTA 5FKAC 5IOIA 3A9JB 1D6EC 4FHKA 4AQ7A 3W2DA 3VFKA 2XBBC 1E90A 4ZRPA 4DWFA 2ZCBA 1L0XB 2WXMA 3PGEA 3ECIA 3VTUA 2SEBD 3AE9B 3DPDA 1T0QC 2EELA 4KZ0A 3VR8B 4JWUC 3S2AA 2C7MB 2D5GA 3MC9A 5E6NA 1ET6A 2KTRA 2D3CA 2CJNA 3EECA 3VRAB 5BYRA 4JX1C 4KSKC 1V80A 2EMSA 2OJRA 4BAXA 3Q14C 4ANUA 3AECB 1WMHA 3Q3NC 4WURA 2IGHA 4N59A 2AYOB 2K6QA 1K8RB 2KJHB 3HRDD 1LQBA 5KHOA 4JGHB 3BVMA 2FNJB 4DDID 3TJPA 1RYJA 2KOXA 2KMAA 2LMCA 4I6NB 2J7QB 4WWOA 3W5VB 1T0YA 3AEFB 2CHWA 3BVGA 3RPFC 1ZXIA 1E8YA 2JPHA 5HI1A 2LHEA 3C0RB 1A70A 1QQRA 1LGRA 1YQ3B 4YL8A 2I38A 3SFEB 2MEKA 3A33B 1NDDA 4RF0A 5CHFA 2VH1A 1WI0A 5H92C 2LUMA 1WX8A 4A3OA 4MELA 3I9V1 2YVCA 1NYRA 4B95A 3RCZA 2PVOD 3DDCB 4W9JA 1DGJA 1YN3A 2C5LC 5GMVA 2L0FA 2WHIA 4ANXA 4C56C 1ZOYB 4B0EA 1UH6A 2KKCA 1WM3A 1QOBA 1J7BA 2QHOA 3ALBA 1FIQA 2DAJA 3A9KA 3MTNB 4MEMA 2KC1A 4HCNB 2MQJA 1TTNA 3L0WB 1ZXHA 5IN7A 3MP9A 2L7RA 3AE8B 3DBHB 4IM3A 3JW0X 1GUAB 1K51A 1R4MB 2MSED 5JHBA 1GB1A 4NAWB 3TUOA 5E6JA 3MFGA 2ONQA 3M95A 5HG2A 2OOBB 1K52A 3T3OA 4A20A 4MACA 1EUVB 1YX5B 1WE6A 3CF6E 1ZW7A 3GZNI 1QT9A 2M1MA 1N60A 2QEJC 4C7ZA 2ZVNA 2RDBC 1V6EA 3V60A 1HQRD 2WWZA 3BYTB 2N7DA 3FAHA 4BOSC 3PVLA 1SSNA 2KK8A 1S3SG 4JE3B 3GOEA 2WDVB 3ZXRA 4DHZB 4LK0M 3H7PA 1Q5WB 2L83A 1TKGA 2QCZA 3TIXA 1DYQA 5EE0A 4W9IA 1L2NA 3SDLC 3RYTA 2PW9A 1WZ0A 5HFYA 1JALA 4K1RB 3ZUNA 1JCKB 4FHJA 4FJVB 1WFYA 4TUUA 2IZVB 1UZXB 1SIFA 2AQ2B 5D3DA 2KJ6A 3B9JA 4EFOA 4DXFA 4IW0A 4GDLA 4AS1A 1T0RC 2V3SA 1TS5A 2KACA 2RGFA 3U2SC 2UWQA 1TKYA 1L4DB 2G45B 4W9HA 1I35A 3RNAC 2K8HA 1TY0A 2FBWB 2PVGC 3O65B 3P2BA 2MBHA 3RZWC 4FBJB 1FCCC 4P16A 4OVZA 2Y5PA 3JSVA 4RGNA 4F1SA 3A1QA 1WXQA 3H7PB 5C3JB 5LNK1 1V97A 4JPSA 3RI7C 1E8XA 2L0TA 1J7AA 2EMTA 1WGGA 3H9DA 4GSWA 2JZ3B 2NTTA 3WIMA 2NR2A 2E6XA 2W9NA 3RNFC 3HM3A 2FCNA 3DVNV 2N1VA 1E8WA 3M3JA 3AE2B 5BMIA 1WRIA 2X38A 3HK0A 2MJEA 3RD2A 3ZXVA 1F2RC 1WYGA 2N1WA 3R66C 2YEPF 2Z8LA 1S1QB 3UIOB 1HTOA 3HHMA 3PRPB 2K39A 3I57A 5IO9A 2MHJA 4NQLB 3KH0A 3ZRCA 3IAS1 4GU2A 4NZLB 4BKSD 2J0JA 3BZDB 1UBQA 4E74A 3P1MA 4L2YA 3FILB 1EF1A 4NAMA 1ET9A 3SHQA 1UELA 1F77A 1TS4A 5D3IB 2AX5A 3NZUA 4AP4C 2MLBA 2GBJA 2CR5A 3NUHB 1I4PA 2ZNVC 2D3GA 5G5HA 1FM0D 3U7ZA 3JSVB 3U30A 4RMAA 4IWQA 1C9FA 3RFZB 2BTEA 3PZ8A 5HKHA 4QAYA 2JRHA 3WAOA 1I4GA 3JYUA 3LB8C 4W9CA 2BS4B 3DBRB 3ZTDA 2VH2A 2D10A 4RGMA 2JY6A 1P9DU 5DPRA 3KQ4A 1OFFA 2J0KA 2NPTA 4IG7B 1XQQA 2M0XA 1EWYC 1RFKA 1Q10A 3ZYYX 4WJQA 2A5UA 2LFIA 1VR9A 2GRIA 2AL6A 4KX6B 1XLPA 1SIJA 3DQVA 2BYFA 3TBLD 4DHJD 2KTFA 2MBBB 3V05A 1E7VA 3MC8A 3BINA 3UIPB 2PMVA 1AN8A 1QOAA 1KH0A 1PGBA 2D11A 3QAQA 2M19A 2J52A 3W5UB 3U4EG 3IAM1 2L52A 2WXQA 5DCNA 2O2VB 3CIRB 3MHSD 4ZHOA 1GB4A 2D2QA 3PSEB 2JQRB 4IOIE 5G2NA 1WJ4A 2MBOA 2WXJA 1OTRB 4Q2JA 2KANA 1L5PA 4S0RA 5JHAA 2NPTB 3Q8CA 2PJHA 4K7WA 3P42A 1NEKB 4B0MA 1QILA 4KKIA 2Z0EB 3IHPC 4TV3A 1KLGD 1BT0A 1QLBB 4WQMA 2NVUI 2QIEB 3V61A 1TKEA 3A9JA 3UQBA 2DZJA 4LNFA 4DDGD 1PQSA 1V2YA 3B08A 3PO0A 1JW9D 1PDXA 3I5JC 1SBBB 2ZW0A 3Q3JA 1XLOA 4HKZE 1QOGA 2O6VB 1ACCA 2YLMA 1VZ6A 2NTSA 1FNUA 5BYQA 4RGTA 1C77A 3PRMB 4XWWA 3DBLI 4MGYE 2BWES 1YN5A 4HK2A 3Q3FA 4OVUA 3ZTCA 4HKQA 3ETRA 4LDTD 3HVZA 4HROA 2KDIA 4HVBA 4M0WB 4B9KA 4TMAB 3BWUD 3X23A 2MBQA 2V9HA 5G5GA 1OQRA 4KKJA 5I4DA 5FR3A 1M4VA 1TY2A 1WX9A 2JZZA 1UGJA 1MFWA 1C79A 3B2FA 1T0SC 1WR1A 2PTLA 5J18A 2WXFA 2WXLA 3PHXB 4HCPB 2KFKB 2L8JA 2RDGA 3KVFB 2LZ6A 2MH7A 4J3OD 2VZKD 4HRSA 3DVGY 3R8BA 3KWLA 1WSPA 1NI2A 3HIZA 2DZKA 2AQ1B 2N7JA 2INPE 2KMMA 3DWMA 5AUKA 1WMHB 2KLCA 2BWFA 1V81A 5C23A 1Y8RC 4HJGE 1HTQA 2MW5A 2PKOA 2DYBA 3GE3C 3NVYA 1J19A 1EU3A 1SGHA 2PPHA 3VH3B 5LXIB 4TKNA 3U7DA 4GDKA 2PEAA 4PS8A 1OQQA 2WXKA 1FRRA 2ZJDA 4A6QA 1F0ZA 3QCAA 1LFDA 3Q8AA 1BXTA 1PYWD 2O6VA 1YX6B 1XT9B 1QF6A 1MPEA 1R4NB 1PGAA 1VZ7A 2N7EA 3ZNID 1TS2A 1DOYA 1V5OA 4KGTA 4AOFA 4GOCA 1PFDA 3L54A 4I6PA 3GE8C 4PK1A 2MJ3A 4WWMA 4WWNA 1ENFA 1I4HA 1L0YB 2WU5B 2WXPA 3UQAA 1GAQB 1NBFC 4RM9A 1N5WA 4LLGM 2QILA 4PYZA 1YJ1A 5CX3A 2G9HD 3ZQ4A 4EOYA 2JSVX 2WDTB 2KDBA 4M02A 2WXRA 1WXMA 3AE1B 2ZPNA 2NBVB 3VRBB 4RNAA 2Y3AA 4MGIE 4YXDB 4KDIC 2WXOA 2BPSA 3N1XC 1V5TA 2WX0A 2BQQA 4HPLB 4IWOA 3LDZE 1CZPA 2ON8A 4N6EB 5L95C 3M62B 2J53A 3SR6A 4W9LA 2HD5B 1ZDVA 1V1OA 1WJ6A 3APCA 2CKHB 1KLUD 4XDCA 5D94A 3ENEA 1HEZE 1E7UA 2UU7A 3TMPB 4C00A 3VUXA 2R2QA 3QHTA 3VH4B 2L76A 1FNWA 2J4XA 4E3CA 1PGXA 2H89B 3ML8A 1ISNA 3NVWA 1I4XA 2ZPYA 1SJED 1E5WA 2IGGA 2K6DB 1JQ4A 3QIJA 2N9KA 4H2AA 2LHDA 3L13A 1ZPSA 2JYTA 1VCBA 2BKRB 3IG3A 1XEEA 2VZKB 1CK1A 2INCC 3AEDB 4R3DA 2AEHA 4BFRA 4ACFA 4C7YA 2G3QB 2ZVOA 1C4PA 3GZNB 1QKZA 4X57B 2RPQA 1RFAA 4HJKA 4RGOS 2ACZB 1UGMA 2SAKA 3E56A 2X8XX 3PZ7A 2XEWA 3NOBA 1GNUA 3ZKJC 3TEYA 2DHZA 1AARA 4US9A 4K81A 4LJPB 2FUG1 4K7UA 4XX5A 2DZIA 3R2TA 1WR6E 1D4BA 4OZBA 1F52A 1FCLA 4F7ZA 3L10B 1P3QU 3C8YA 4XE0A 2JX5A 1TT5B 3W1YA 3ZNZB 1DOIA 2DWQA 4B6WA 1WGHA 1RWSA 2RMMA 2DBYA 3BK2A 5EE9A 4KZCA 2C7NB 2QSDA 2LEKA 2GLSA 3Q8EA 1VJKA 2OHFA 1GJZA 1WXAA 1XLQA 1JWMD 1EU4A 1I7HA 4PT5A 4YTMB 3L4PA 2L05A 2LVQA 3A9KB 2IBIB 3AE5B 3TSSA 3IBEA 4KV2A 5E6OA 3MJWA 5TR5A 3N32A 2KVZA 1MG4A 2BB6A 2LASA 4II2B 3APFA 2BS2B 2KN4A 1F1HA 2HJ1A 2IY1B 1KOTA 3P4RB 5LXHA 2WGSA 3P4QB 3AE4B 3IVFA 1IBXA 2GI9A 4OVVA 2M8SA 2MA9B 2CHZA 4DXGA 1B9RA 1UUPA 2JZPA 2XK5B 2KT7A 1IUEA 2HE7A 2K8BA 4NNJB 4KVGB 3CSFA 3QK0A 3CMMB 4HDOA 1WRDB 5FR6A 3B1LX 3QJZA 3N20C 3A4RA 2J42A 1H8CA 3Q3MC 2ZEQA 1EM7A 2L3ZA 5J17A 3QARA 1FFVA 4A3PA 4MJSB 3JVZX 1Y56A 2M17A 1SE3A 3T3NA 2NMQA 5BMGA 1R4MI 3KYDD 3PZDA 2K3UA 1TS3A 1I4QA 4P7IA 4IC7B 1E6EB 2GBRA 3NHEB 2FAZA 2KWDA 3VTWA 2ZCCA 5H8YE 1WF9A 4ICUA 2R2OA 2QMTA 2FCMA 2WNMA 1UWMA 3TEWA 5CTRC 3ZDTA 3KLSX 4XC2A 3B0AA 4YWGG 2GBNA 4BKSA 3ZIMA 1PUTA 3QX1A 4EZLA 4BBNF 3RNEC 1E9MA 4KDLB 3PREA 1L4ZB 4NAWA 2KWVB 1GPXA 2G4SA 1FFUA 4BKTA 2CJOA 2H88B 1JRPA 3EUB2 2Y5BB 3TL5A 4NY0A 1ESFA 1C76A 2LUEA 2BT6A 2IJ0A 5L83A 1YNTE 1RLFA 2R61A 3AH7A 4RM8A 5GXGB 3ZJVA 2JXXA 3I63C 3DHHC 4W9DA 3ZNHB 5AUIA 4ZYSA 3R7QA 2I1JA 4II3B 1YIWA 2DZMA 2RSUA 3IXSA 2AWTA 3BK1A 2MBEA 2KFJA 3DWGC 2CU3A 1NENB 2IO3B 1HXYD 2DYMA 5C1ZA 1T3QA 1D5XC 1TJEA 2HDEA 2LRUA 3U8ZA 2NBWB 4ANVA 3NVZA 2HTME 2MJDA 2OEDA 2RDHA 3PT2B 2V3PA 2MRPA 2BB5A 1AYFA 3IFWB 2KN5A 1GC6A 1WJNA 2KDMA 4C4VA 3AXCA 2KHWB 4FXCA 4WIPA 2MP2B 2JU6X 1BUIC 3VR9B 4MM3B 3P63A 3RMKC 1EWCA 2IO2B 1UWXA 5DPWA 3H1UA 3ZJUA 2LGSA 1IP9A 4S17A 2INNE 2I2YA 1IGDA 1WX7A 2CU1A 3KUDB 4LNKA 2LJIA 3OAWA 1SEBD 1WJUA 2JF5A 3A4SC 2KTRB 5TSSA 1JMLA 3GB1A 4W9KA 5D2MB 1P7FA 4K3CA 4GDLB 4YSZB 2UYZB 5AZGA 2EKIA 1KTKA 4A55A 5G55A 1F9JA 3PV1A 1NVID 4MT5A 2LVOA 4O1NA 2M4NA 1KRHA 1WXVA 5IKCM 3K9PB 1TZ1A 1SE4A 4EE2A 4G3XB 2O6VD 3L17A 4GIVA 3CSTA 4TQ1A 3QC8B 1K53A 1WE7A 4NJ6A 4W9EA 4ZRJA 3ONSA 3Q8FA 2Z59B 4KIKA 3T9LA 4HLEA 3UGBB 2BS3B 4XWTA 1JWAD 2C9WB 4KSLC 5J2RA 4LDTB 1WGKA 1RAXA 4C80A 1J8CA 1RM6C 5DPSA 4MH0E 3AULA 2VRRB 2WS3B 4FJZA 4OZCA 4WAAA 4PS3A 4NJCA 2LXCA 3DVGX 2GB1A 4FLHA 3E9SA 2BYTA 4P1CC 3VHTC 3CWIA 2LD9A 2GOWA 3FC4A 2WYQA 2KX3A 2ZW1A 4AUQC 4BOZB 1C78A 3X0WA 2WP9B 1FNVA 1D5MC 2EKEC 4DHJB 4GXBA 2ASQA 3O13A 1C3TA 2HJ8A 1AWDA 1WY8A 3VQIA 3ZNGC 5KHQA 2DENB 3AN1A 1V1PA 1KLVA 1WGRA 4YT0B 4REZA 3MJ5A 4URKA 1XXGA 1FEHA 2KQ7A 2RR9A 2KJRA 3VXWA 3WCQA 1R4NI 1YQBA 2NBUA 1XO3A 2KD0A 4OHJA 5FK9C 3H6NA 2LXAA 1NI3A 1VZ8A 2NS5A 2C7HA 4LNNA 3HVDA 5AEKB 3RZFA 5JH5C 3HUIA 1ZE3D 1ZGUB 1N61A 2PLPA 4G11A 1A5RA 1TIFA 3AV8A 3H8HA 1BMLC 2LI5A 3QWZB 3DVNU 1LM8B 1CJEA 4LTUA 2ICIA 5CHVC 2L1AA 2QJLA 4MDKE 3I3TB 4D2KA 4YTPB 4US8A 2DLBA 2PIAA 2WXGA 1JWSD 2DAFA 2RD0A 2INDC 2LGIA 1H4RA 1D5ZC 3W1SA 2W55A 2K25A 3MC0B 4PYUA 1FXIA 4JQWC 1FD6A 2BW2A 2WXNA 2N4FA 2W54A 1FMAD 4M0WA 2BYVE 1X1MA 3NZSA 2LGYA 4OW0A 1WIAA 4LJOB 4J6IA 3ZO5B 1TBEA 2KYWA 1QOFA 3AEEB 3AMZA 3KYCD 3ABVB 2FE8A 2NCNA 1VD2A 2KO3A 2WQYB 1WM2A 2V4IB 2JUOA 2B3AA 4RF1A 3L08A 3P4PB 1FXAA 1OQYA 4ZYNA 3J9CA 5E6PA 1T5XD 4TQ0A 3Q2AC 2BYEA 2K5PA 1KM7A 2QC8A 4DBGA 3WAMA 3NVVA 3APDA 3NJTA 1WH3A 3M63B 4EUTA 3SD5A 2DX5B 2DYOA 3T8MA 4W9FA 4WAFA 3V6EB 4G50A 4C4VB 1P0RA 4ZRKA 4JWSC 4ASWC 4RH6A 3UINB 4CQNA 3PLVA 3LYYA 4LNOA 1MVKA 2KC2A 3AE3B 3HM6X 5AZHA 4BVUC 3N30A 3AM9A 3ML9A 1HZ5A 1P1AA 2K0PA 2IGDA 4KGRA 2KAJA 1K50A 3Q3OC 3AU4A 4LNIA 3VVWB 3PLUA 4LCDE 3EGRA 4A9AA 4I6LB 2FCQA 2KX0A 4P1BC 5D7GA 4AJYB 1VRAB 5AZFA 4YTNB 4WWPA 5BO4B 1E10A 2C60A 2XK5A 3R7RA 3GP7A 3ZRFA 1YOVB 5JZEB 4IDIA 1T6BX 1FXTB 3W1SC 4P6VF 1IBXB 2N9PC 3A1QB 2WDQB 2K9XA 3DOWA 3EFCA 4ICVA 1XCTL 2Y5CA 4A8XC 4EKUA 4G0NB 3B2GA 2YEPB 2LRWA 1SB3C 3QA8A 3VUYA 4K3BA 3AEAB 2JWUA 1YN4A 3ZDMC 3N3KB 1LO5D 3EC8A 3NRZA 3V62A 2MCNB 1GOZA 3NS1A 2WXHA 2HTHA 3DBHI 1RRBA 2DNFA 1HA5A 4L23A 2J0MA 1SE2A 1WWTA 1TZOA 3RULA 3GS2A 2KZRA 2FUHB 5LLIA 1ZUD2 4JLCA 4FA6A 4M00A 4K7SA 5EE3A 2W3SA 5IA7A 1L6VA 2N9EB 3DHGC 3ZW3A 4HPMB 3AI5A 4BKGA 1KF6B 3OJ4B 5MPOA 2CS4A 1JWBD 1LXDA 1SF0A 2JYEA 3KUCB 5T8IA 4MH8A 3OG5A 4M01A 1E8ZA 3URYA 3AU5A 3VDZA 3LJ3A 1J0GA 3Q8BA 2XNAC 2IYDB 3BIID 4FADA 1CMXB 1EO6A 1E7PB 1C4CA 1VLBA 1TYGB 4RCOA 3PPAA 4L1BA 1XD3B 1D3ZA 4GN1A 3Q6BA 1V49A 4XDDA 1L0VB 4FJYA 4CO7A 4ZDVA 3DHIC 2N0SB 2V0GA 2XN9C 1J7CA 5CHWA 5C2TB 4NJ7A 3EFUA 1JRUA 4AJWA 1CQVA 1UNSA 2KWCA 2A4ZA 3PRZA 1P7EA 4YSYB 3WANA 4FULA 1KJTA 3NZ3A 1EF5A 3FKYA 4KGSA 1MHHE 5EDSA 3VAWA 2BVCA 4ZOHC 4WJPA 1N62A 1I42A 1YMHE 4YSXB 1QZEA 1L6UA 1E0ZA 4IM2A 3AB5A 3RT3B 1XF5L 3RNBC 1GG3A 2L32A 3C19A 2K22A 1HE8A 4USAA 2G1EA 2KDFB 1GC7A 3SEBA 2D07B 3ZLZA 4FN2A 2K1FA 1NYQA 4N9F4 3UI3A 1U4AA 3IT6B 2KVRA 2M56B 4IM0A 2FCSA 4CYEA 1ROEA 2IO1B 4JIOU 4XGAB 1MJDA 4KIKB 2QDFA 4MJSA 2Q5WD 3QQ8B 4TSSA 3V6CB 2PE9A 2JXTA 3DBLB 3VTVA 2I1KA 2WX1A 1AW7A 3ZVVA 5BYSA 3BY4B 4ZHPA 2KNBA 1MG8A 4DXAB 4ZRQA 2KQSA 4HWIB 1V1PB 2GMIC 4WJNA 4PS7A 1OGWA 3PTFC 4XZ4A 4CHKA 2LVPA 3EHVA 3H7SA
chains in the Genus database with same CATH topology
4IW0A 5D94A 4GDLA 3ENEA 2HJ8A 1WY8A 1YD8U 3VQIA 3ZNGC 1E7UA 2V3SA 3TMPB 3VUXA 3NY5A 2RGFA 5KHQA 2R2QA 3QHTA 2UWQA 2L76A 3UF8A 3VH4B 2G45B 2L00B 4W9HA 2DENB 1I35A 2Z0DB 2K8HA 1OEYA 4E3CA 1KLVA 1WGRA 3SU8X 2BKFA 5IAAC 3ML8A 1ISNA 4URKA 2ZPYA 1E5WA 2K6DB 2KQ7A 3O65B 2RR9A 3P2BA 2KJRA 2MBHA 3QIJA 3RZWC 3VXWA 1R4NI 1YQBA 2NBUA 3L13A 4FBJB 4BBNC 2KD0A 1VCBA 2BKRB 1IPGA 2LXAA 3DBRI 3DBSA 3H6NA 3IG3A 3JSVA 2NS5A 2IY0B 3WAPA 2C7HA 3PHWB 2AL3A 4MM3A 4F1SA 3A1QA 3KW5B 5AEKB 2AEHA 3RZFA 3D32A 3H7PB 4BFRA 2JWZA 5JH5C 1E8XA 2G3QB 2L0TA 2ZVOA 2EMTA 2KDEB 1WGGA 1ZGUB 3H9DA 2KMCA 2GBMA 4G11A 1UD7A 2MP2A 2JZ3B 4GSWA 1A5RA 2LI5A 3QWZB 4X57B 3WIMA 2KFKA 2IO0B 4IUMB 3DVNU 1LM8B 2NR2A 2W9NA 1IYFA 3HM3A 4WJOA 2FCNA 2RPQA 5CHVC 3DVNV 1RFAA 4HJKA 4MDKE 2N1VA 1E8WA 1UGMA 3I3TB 3M3JA 1WGDA 1WXSA 2XEWA 2DAFA 3HK0A 1GNUA 2RD0A 3NOBA 3ZKJC 2LWPA 1SE9A 1AARA 1M94A 2DHZA 3RD2A 1Q1OA 1H4RA 4K81A 4LJPB 3RUIB 2N1WA 3R66C 3W1SA 4K7UA 4XX5A 4F8CB 2DZIA 1WR6E 2K25A 4PYUA 4JQWC 1S1QB 4F7ZA 3UIOB 3L10B 1WZ3A 4E71A 2N4FA 4GGQA 3HHMA 3PRPB 1P3QU 1WGYA 2K39A 2JRIB 2CHXA 4HDQA 4NQKE 3W1YA 4NQLB 3ZNZB 3KH0A 4B6WA 3ZRCA 1WGHA 4GU2A 2BYVE 2REXA 4BKSD 2J0JA 1X1MA 2JT4B 4KZCA 1Z5SB 3NZSA 2C7NB 2LGYA 1UBQA 4E74A 1OEYJ 1L7YA 4DK5A 1GJZA 1WIAA 1EF1A 1WXAA 2BGFA 4LJOB 2N9XA 4J6IA 3SHQA 1UELA 1V9JA 3DCGA 3ZO5B 1TBEA 4IWPA 2L05A 2LVQA 4GDKB 3A9KB 2IBIB 3NZUA 4AP4C 2MLBA 3KYCD 2GBJA 2LGXA 2CR5A 2NCNA 2KO3A 1VD2A 2V4LA 2ZNVC 1WM2A 2D3GA 2JUOA 1ZKHA 2B3AA 3IBEA 4KV2A 2GBKA 3MJWA 4MSQB 3L08A 5E6OA 3JSVB 3L16A 5TR5A 3N32A 1OQYA 4ZYNA 3U30A 4RMAA 5E6PA 4IWQA 2LASA 2MWSB 4II2B 4TQ0A 3APFA 5HKHA 3NS8A 2BYEA 4M8MA 2JRHA 4GMVA 3WAOA 4EEWA 3JYUA 2IY1B 1KM7A 2LGDA 4DBGA 2KXJA 3WAMA 4W9CA 1KOTA 3VUWA 5LXHA 3ZTDA 4DHZE 4NPNA 2D10A 3IVFA 3K9OB 2JY6A 3WA0A 3APDA 4EZJA 1WH3A 3M63B 4OVVA 1P9DU 4WQOB 2M8SA 3SD5A 5FR6A 4EUTA 2DX5B 5DPRA 2MA9B 2CHZA 2J0KA 2DYOA 3OJ3A 4W9FA 3T8MA 3R3MA 3PS6A 1P98A 4ZRIA 2NPTA 3V6EB 2XK5B 4G50A 4IG7B 1P0RA 1Q0WB 1XQQA 2M0XA 4ZRKA 2HE7A 4ASWC 3UINB 2K8BA 3PLVA 4WJQA 2A5UA 2KC2A 4HXDA 4NNJB 4KVGB 2AL6A 3CSFA 3QK0A 1G6JA 3HM6X 5AZHA 4BVUC 3N30A 3CMMB 3DQVA 1V86A 2BYFA 3TBLD 4HDOA 4DHJD 1WRDB 2KTFA 3ML9A 5D6JB 1P1AA 2O2VA 2MBBB 2K8CA 3B1LX 1E7VA 3QJZA 4MSMB 2V1YA 3A4RA 3BINA 4AWJA 1H8CA 3AU4A 3UIPB 2ZEQA 3VVWB 3PLUA 4LCDE 2D11A 2L3ZA 5J17A 3QAQA 1Z2MA 3QARA 2G4DB 4M8NA 2ZNVB 4ANWA 4A3PA 4MJSB 3JVZX 4I6LB 2FCQA 5DCNA 2O2VB 2M17A 2KX0A 3MHSD 4EZKA 2BF8B 5D7GA 4AJYB 2D2QA 3PSEB 1R4MI 5AZFA 3KYDD 3PZDA 5G2NA 1WJ4A 2MBOA 2ZZPB 4IC7B 4P7IA 1OTRB 2FIFA 4WWPA 2GBRA 2FIDA 3NHEB 2FAZA 2KANA 5BO4B 3VTWA 3OLMD 2ZCCA 4W9GA 3TCAA 3WALA 2C60A 1WF9A 4ICUA 2R2OA 5JHAA 2XK5A 4GB9A 2FCMA 2NPTB 3R7RA 3ZRFA 5JZEB 2PJHA 4K7WA 2PE6B 5CTRC 3ZDTA 4MGKE 4XC2A 3B0AA 1FXTB 3W1SC 2JVCA 2KWUB 2GBNA 2Z0EB 3IHPC 3KUZA 1C1YB 2N9PC 4MGZE 4TV3A 3A1QB 1UBIA 3ZIMA 4BKSA 3QX1A 4EZLA 2MX2A 1BT0A 4BBNF 3DOWA 4ICVA 2NVUI 4EKUA 1WYWB 3V61A 2KLGA 4G0NB 1TGZB 4JL9A 2LJ5A 5DPTA 3A9JA 4KDLB 3PREA 3UQBA 2DZJA 4NAWA 1PQSA 1V2YA 4DDGD 2KWVB 2LRWA 3A9JB 3B08A 4FHKA 2G4SA 4BKTA 3QA8A 3VUYA 3VFKA 2XBBC 1E90A 3Q3JA 2Y5BB 3TL5A 4NY0A 2O6VB 2LUEA 3ZDMC 4DWFA 2ZCBA 3N3KB 2YLMA 3EC8A 3PGEA 3ECIA 3VTUA 5L83A 1RLFA 3DPDA 3PRMB 3V62A 4KZ0A 4RM8A 2MCNB 3DBLI 4MGYE 2JXXA 2BWES 3S2AA 2HTHA 3DBHI 4HK2A 1RRBA 2C7MB 4W9DA 3ZNHB 3Q3FA 5E6NA 2J0MA 2KTRA 4OVUA 3ZTCA 4LDTD 3R7QA 3EECA 3RULA 2KZRA 2I1JA 2FUHB 4II3B 5LLIA 2KDIA 4JLCA 1YIWA 4FA6A 2DZMA 4HVBA 4M0WB 4KSKC 2RSUA 4B9KA 1V80A 2EMSA 2OJRA 4K7SA 2AWTA 4ANUA 2MBEA 2KFJA 3X23A 2MBQA 1WMHA 5IA7A 2AYOB 2K6QA 1K8RB 2N9EB 3ZW3A 2KJHB 2IO3B 4HPMB 3AI5A 2DYMA 1LQBA 4BKGA 5C1ZA 3OJ4B 5KHOA 2CS4A 4JGHB 1LXDA 2FNJB 4DDID 3TJPA 3KUCB 2LRUA 1WX9A 3U8ZA 2NBWB 2KOXA 2JZZA 4ANVA 2KMAA 4I6NB 2J7QB 4WWOA 3PT2B 1WR1A 1T0YA 5J18A 2MRPA 1E8ZA 2CHWA 3IFWB 2KN5A 3AU5A 3VDZA 3PHXB 1GC6A 3LJ3A 1WJNA 2KFKB 2L8JA 4HCPB 1E8YA 2JPHA 3AXCA 2KHWB 2LZ6A 3KVFB 1J0GA 3C0RB 2MP2B 2IYDB 4FADA 3DVGY 1CMXB 1EO6A 4YL8A 3A33B 1NDDA 5CHFA 1WI0A 1NI2A 3HIZA 2DZKA 1WX8A 3PPAA 4MELA 4A3OA 1XD3B 1WMHB 1D3ZA 2KLCA 2IO2B 4GN1A 1V49A 2BWFA 5DPWA 2YVCA 1V81A 4FJYA 5C23A 4CO7A 1Y8RC 3H1UA 4ZDVA 1IP9A 4B95A 3RCZA 5CHWA 2MW5A 3DDCB 4NJ7A 2DYBA 1WX7A 4W9JA 2CU1A 3KUDB 5GMVA 2C5LC 3EFUA 2L0FA 1JRUA 3OAWA 4AJWA 1J19A 1WJUA 2JF5A 4ANXA 1UH6A 2KKCA 1WM3A 2KTRB 2A4ZA 2KWCA 2QHOA 3A4SC 1SGHA 2PPHA 3ALBA 3VH3B 3PRZA 2DAJA 4TKNA 5LXIB 4W9KA 5D2MB 3A9KA 3U7DA 4GDKA 3WANA 3MTNB 4MEMA 2KC1A 4HCNB 4FULA 2PEAA 1KJTA 2MQJA 4PS8A 1TTNA 4GDLB 3L0WB 2UYZB 1EF5A 2ZJDA 5AZGA 2L7RA 5EDSA 5G55A 3QCAA 3VAWA 1LFDA 4IM3A 2O6VA 1F9JA 3JW0X 3PV1A 2LVOA 2M4NA 1YX6B 1GUAB 1XT9B 1WXVA 2MSED 5JHBA 4WJPA 3K9PB 4NAWB 1TZ1A 1I42A 2N7EA 3ZNID 1QZEA 4G3XB 2O6VD 3L17A 4GIVA 3M95A 1V5OA 2OOBB 3CSTA 4AOFA 4GOCA 4TQ1A 3L54A 4IM2A 3RT3B 3QC8B 4I6PA 4A20A 1GG3A 1EUVB 1WE7A 1HE8A 4NJ6A 1YX5B 4WWNA 1WE6A 3CF6E 4W9EA 3ONSA 4ZRJA 2Z59B 1ZW7A 2KDFB 1GC7A 4KIKA 3UQAA 3GZNI 2D07B 2M1MA 3ZLZA 4FN2A 2K1FA 1NBFC 3T9LA 4RM9A 4HLEA 4N9F4 3UGBB 2ZVNA 4PYZA 1YJ1A 5CX3A 2C9WB 4KSLC 1U4AA 4EOYA 5J2RA 1V6EA 4LDTB 3V60A 1RAXA 2KVRA 1J8CA 2WDTB 2WWZA 2KDBA 2N7DA 5DPSA 4IM0A 4BOSC 3PVLA 4MH0E 1WXMA 2FCSA 2KK8A 3AULA 2ZPNA 1S3SG 4CYEA 2NBVB 4MGIE 3GOEA 2IO1B 4DHZB 2VRRB 4FJZA 4JIOU 4KDIC 4WAAA 3H7PA 1Q5WB 4KIKB 2BPSA 4MJSA 1V5TA 4PS3A 2LXCA 3QQ8B 3TIXA 2WX0A 3DVGX 3V6CB 2PE9A 4HPLB 4W9IA 4FLHA 4IWOA 3VTVA 1L2NA 2I1KA 3SDLC 2WX1A 3RYTA 1WZ0A 4K1RB 3ZUNA 3ZVVA 3VHTC 3LDZE 3BY4B 4FHJA 2LD9A 2KNBA 4FJVB 1MG8A 2GOWA 1WFYA 4TUUA 4DXAB 5L95C 2KQSA 3M62B 4HWIB 2WYQA 2IZVB 2KX3A 4BOZB 4AUQC 4W9LA 3X0WA 1UZXB 2GMIC 4WJNA 2EKEC 2HD5B 4PS7A 4DHJB 1OGWA 1SIFA 3PTFC 1WJ6A 2ASQA 3APCA 4GXBA 4XZ4A 4CHKA 2KJ6A 2LVPA 2CKHB 3EHVA 4EFOA 1C3TA 3H7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IW0 A;  5D94 A;  4GDL A;  3ENE A;  2HJ8 A;  1WY8 A;  1YD8 U;  3VQI A;  3ZNG C;  1E7U A;  2V3S A;  3TMP B;  3VUX A;  3NY5 A;  2RGF A;  5KHQ A;  2R2Q A;  3QHT A;  2UWQ A;  2L76 A;  3UF8 A;  3VH4 B;  2G45 B;  2L00 B;  4W9H A;  2DEN B;  1I35 A;  2Z0D B;  2K8H A;  1OEY A;  4E3C A;  1KLV A;  1WGR A;  3SU8 X;  2BKF A;  5IAA C;  3ML8 A;  1ISN A;  4URK A;  2ZPY A;  1E5W A;  2K6D B;  2KQ7 A;  3O65 B;  2RR9 A;  3P2B A;  2KJR A;  2MBH A;  3QIJ A;  3RZW C;  3VXW A;  1R4N I;  1YQB A;  2NBU A;  3L13 A;  4FBJ B;  4BBN C;  2KD0 A;  1VCB A;  2BKR B;  1IPG A;  2LXA A;  3DBR I;  3DBS A;  3H6N A;  3IG3 A;  3JSV A;  2NS5 A;  2IY0 B;  3WAP A;  2C7H A;  3PHW B;  2AL3 A;  4MM3 A;  4F1S A;  3A1Q A;  3KW5 B;  5AEK B;  2AEH A;  3RZF A;  3D32 A;  3H7P B;  4BFR A;  2JWZ A;  5JH5 C;  1E8X A;  2G3Q B;  2L0T A;  2ZVO A;  2EMT A;  2KDE B;  1WGG A;  1ZGU B;  3H9D A;  2KMC A;  2GBM A;  4G11 A;  1UD7 A;  2MP2 A;  2JZ3 B;  4GSW A;  1A5R A;  2LI5 A;  3QWZ B;  4X57 B;  3WIM A;  2KFK A;  2IO0 B;  4IUM B;  3DVN U;  1LM8 B;  2NR2 A;  2W9N A;  1IYF A;  3HM3 A;  4WJO A;  2FCN A;  2RPQ A;  5CHV C;  3DVN V;  1RFA A;  4HJK A;  4MDK E;  2N1V A;  1E8W A;  1UGM A;  3I3T B;  3M3J A;  1WGD A;  1WXS A;  2XEW A;  2DAF A;  3HK0 A;  1GNU A;  2RD0 A;  3NOB A;  3ZKJ C;  2LWP A;  1SE9 A;  1AAR A;  1M94 A;  2DHZ A;  3RD2 A;  1Q1O A;  1H4R A;  4K81 A;  4LJP B;  3RUI B;  2N1W A;  3R66 C;  3W1S A;  4K7U A;  4XX5 A;  4F8C B;  2DZI A;  1WR6 E;  2K25 A;  4PYU A;  4JQW C;  1S1Q B;  4F7Z A;  3UIO B;  3L10 B;  1WZ3 A;  4E71 A;  2N4F A;  4GGQ A;  3HHM A;  3PRP B;  1P3Q U;  1WGY A;  2K39 A;  2JRI B;  2CHX A;  4HDQ A;  4NQK E;  3W1Y A;  4NQL B;  3ZNZ B;  3KH0 A;  4B6W A;  3ZRC A;  1WGH A;  4GU2 A;  2BYV E;  2REX A;  4BKS D;  2J0J A;  1X1M A;  2JT4 B;  4KZC A;  1Z5S B;  3NZS A;  2C7N B;  2LGY A;  1UBQ A;  4E74 A;  1OEY J;  1L7Y A;  4DK5 A;  1GJZ A;  1WIA A;  1EF1 A;  1WXA A;  2BGF A;  4LJO B;  2N9X A;  4J6I A;  3SHQ A;  1UEL A;  1V9J A;  3DCG A;  3ZO5 B;  1TBE A;  4IWP A;  2L05 A;  2LVQ A;  4GDK B;  3A9K B;  2IBI B;  3NZU A;  4AP4 C;  2MLB A;  3KYC D;  2GBJ A;  2LGX A;  2CR5 A;  2NCN A;  2KO3 A;  1VD2 A;  2V4L A;  2ZNV C;  1WM2 A;  2D3G A;  2JUO A;  1ZKH A;  2B3A A;  3IBE A;  4KV2 A;  2GBK A;  3MJW A;  4MSQ B;  3L08 A;  5E6O A;  3JSV B;  3L16 A;  5TR5 A;  3N32 A;  1OQY A;  4ZYN A;  3U30 A;  4RMA A;  5E6P A;  4IWQ A;  2LAS A;  2MWS B;  4II2 B;  4TQ0 A;  3APF A;  5HKH A;  3NS8 A;  2BYE A;  4M8M A;  2JRH A;  4GMV A;  3WAO A;  4EEW A;  3JYU A;  2IY1 B;  1KM7 A;  2LGD A;  4DBG A;  2KXJ A;  3WAM A;  4W9C A;  1KOT A;  3VUW A;  5LXH A;  3ZTD A;  4DHZ E;  4NPN A;  2D10 A;  3IVF A;  3K9O B;  2JY6 A;  3WA0 A;  3APD A;  4EZJ A;  1WH3 A;  3M63 B;  4OVV A;  1P9D U;  4WQO B;  2M8S A;  3SD5 A;  5FR6 A;  4EUT A;  2DX5 B;  5DPR A;  2MA9 B;  2CHZ A;  2J0K A;  2DYO A;  3OJ3 A;  4W9F A;  3T8M A;  3R3M A;  3PS6 A;  1P98 A;  4ZRI A;  2NPT A;  3V6E B;  2XK5 B;  4G50 A;  4IG7 B;  1P0R A;  1Q0W B;  1XQQ A;  2M0X A;  4ZRK A;  2HE7 A;  4ASW C;  3UIN B;  2K8B A;  3PLV A;  4WJQ A;  2A5U A;  2KC2 A;  4HXD A;  4NNJ B;  4KVG B;  2AL6 A;  3CSF A;  3QK0 A;  1G6J A;  3HM6 X;  5AZH A;  4BVU C;  3N30 A;  3CMM B;  3DQV A;  1V86 A;  2BYF A;  3TBL D;  4HDO A;  4DHJ D;  1WRD B;  2KTF A;  3ML9 A;  5D6J B;  1P1A A;  2O2V A;  2MBB B;  2K8C A;  3B1L X;  1E7V A;  3QJZ A;  4MSM B;  2V1Y A;  3A4R A;  3BIN A;  4AWJ A;  1H8C A;  3AU4 A;  3UIP B;  2ZEQ A;  3VVW B;  3PLU A;  4LCD E;  2D11 A;  2L3Z A;  5J17 A;  3QAQ A;  1Z2M A;  3QAR A;  2G4D B;  4M8N A;  2ZNV B;  4ANW A;  4A3P A;  4MJS B;  3JVZ X;  4I6L B;  2FCQ A;  5DCN A;  2O2V B;  2M17 A;  2KX0 A;  3MHS D;  4EZK A;  2BF8 B;  5D7G A;  4AJY B;  2D2Q A;  3PSE B;  1R4M I;  5AZF A;  3KYD D;  3PZD A;  5G2N A;  1WJ4 A;  2MBO A;  2ZZP B;  4IC7 B;  4P7I A;  1OTR B;  2FIF A;  4WWP A;  2GBR A;  2FID A;  3NHE B;  2FAZ A;  2KAN A;  5BO4 B;  3VTW A;  3OLM D;  2ZCC A;  4W9G A;  3TCA A;  3WAL A;  2C60 A;  1WF9 A;  4ICU A;  2R2O A;  5JHA A;  2XK5 A;  4GB9 A;  2FCM A;  2NPT B;  3R7R A;  3ZRF A;  5JZE B;  2PJH A;  4K7W A;  2PE6 B;  5CTR C;  3ZDT A;  4MGK E;  4XC2 A;  3B0A A;  1FXT B;  3W1S C;  2JVC A;  2KWU B;  2GBN A;  2Z0E B;  3IHP C;  3KUZ A;  1C1Y B;  2N9P C;  4MGZ E;  4TV3 A;  3A1Q B;  1UBI A;  3ZIM A;  4BKS A;  3QX1 A;  4EZL A;  2MX2 A;  1BT0 A;  4BBN F;  3DOW A;  4ICV A;  2NVU I;  4EKU A;  1WYW B;  3V61 A;  2KLG A;  4G0N B;  1TGZ B;  4JL9 A;  2LJ5 A;  5DPT A;  3A9J A;  4KDL B;  3PRE A;  3UQB A;  2DZJ A;  4NAW A;  1PQS A;  1V2Y A;  4DDG D;  2KWV B;  2LRW A;  3A9J B;  3B08 A;  4FHK A;  2G4S A;  4BKT A;  3QA8 A;  3VUY A;  3VFK A;  2XBB C;  1E90 A;  3Q3J A;  2Y5B B;  3TL5 A;  4NY0 A;  2O6V B;  2LUE A;  3ZDM C;  4DWF A;  2ZCB A;  3N3K B;  2YLM A;  3EC8 A;  3PGE A;  3ECI A;  3VTU A;  5L83 A;  1RLF A;  3DPD A;  3PRM B;  3V62 A;  4KZ0 A;  4RM8 A;  2MCN B;  3DBL I;  4MGY E;  2JXX A;  2BWE S;  3S2A A;  2HTH A;  3DBH I;  4HK2 A;  1RRB A;  2C7M B;  4W9D A;  3ZNH B;  3Q3F A;  5E6N A;  2J0M A;  2KTR A;  4OVU A;  3ZTC A;  4LDT D;  3R7Q A;  3EEC A;  3RUL A;  2KZR A;  2I1J A;  2FUH B;  4II3 B;  5LLI A;  2KDI A;  4JLC A;  1YIW A;  4FA6 A;  2DZM A;  4HVB A;  4M0W B;  4KSK C;  2RSU A;  4B9K A;  1V80 A;  2EMS A;  2OJR A;  4K7S A;  2AWT A;  4ANU A;  2MBE A;  2KFJ A;  3X23 A;  2MBQ A;  1WMH A;  5IA7 A;  2AYO B;  2K6Q A;  1K8R B;  2N9E B;  3ZW3 A;  2KJH B;  2IO3 B;  4HPM B;  3AI5 A;  2DYM A;  1LQB A;  4BKG A;  5C1Z A;  3OJ4 B;  5KHO A;  2CS4 A;  4JGH B;  1LXD A;  2FNJ B;  4DDI D;  3TJP A;  3KUC B;  2LRU A;  1WX9 A;  3U8Z A;  2NBW B;  2KOX A;  2JZZ A;  4ANV A;  2KMA A;  4I6N B;  2J7Q B;  4WWO A;  3PT2 B;  1WR1 A;  1T0Y A;  5J18 A;  2MRP A;  1E8Z A;  2CHW A;  3IFW B;  2KN5 A;  3AU5 A;  3VDZ A;  3PHX B;  1GC6 A;  3LJ3 A;  1WJN A;  2KFK B;  2L8J A;  4HCP B;  1E8Y A;  2JPH A;  3AXC A;  2KHW B;  2LZ6 A;  3KVF B;  1J0G A;  3C0R B;  2MP2 B;  2IYD B;  4FAD A;  3DVG Y;  1CMX B;  1EO6 A;  4YL8 A;  3A33 B;  1NDD A;  5CHF A;  1WI0 A;  1NI2 A;  3HIZ A;  2DZK A;  1WX8 A;  3PPA A;  4MEL A;  4A3O A;  1XD3 B;  1WMH B;  1D3Z A;  2KLC A;  2IO2 B;  4GN1 A;  1V49 A;  2BWF A;  5DPW A;  2YVC A;  1V81 A;  4FJY A;  5C23 A;  4CO7 A;  1Y8R C;  3H1U A;  4ZDV A;  1IP9 A;  4B95 A;  3RCZ A;  5CHW A;  2MW5 A;  3DDC B;  4NJ7 A;  2DYB A;  1WX7 A;  4W9J A;  2CU1 A;  3KUD B;  5GMV A;  2C5L C;  3EFU A;  2L0F A;  1JRU A;  3OAW A;  4AJW A;  1J19 A;  1WJU A;  2JF5 A;  4ANX A;  1UH6 A;  2KKC A;  1WM3 A;  2KTR B;  2A4Z A;  2KWC A;  2QHO A;  3A4S C;  1SGH A;  2PPH A;  3ALB A;  3VH3 B;  3PRZ A;  2DAJ A;  4TKN A;  5LXI B;  4W9K A;  5D2M B;  3A9K A;  3U7D A;  4GDK A;  3WAN A;  3MTN B;  4MEM A;  2KC1 A;  4HCN B;  4FUL A;  2PEA A;  1KJT A;  2MQJ A;  4PS8 A;  1TTN A;  4GDL B;  3L0W B;  2UYZ B;  1EF5 A;  2ZJD A;  5AZG A;  2L7R A;  5EDS A;  5G55 A;  3QCA A;  3VAW A;  1LFD A;  4IM3 A;  2O6V A;  1F9J A;  3JW0 X;  3PV1 A;  2LVO A;  2M4N A;  1YX6 B;  1GUA B;  1XT9 B;  1WXV A;  2MSE D;  5JHB A;  4WJP A;  3K9P B;  4NAW B;  1TZ1 A;  1I42 A;  2N7E A;  3ZNI D;  1QZE A;  4G3X B;  2O6V D;  3L17 A;  4GIV A;  3M95 A;  1V5O A;  2OOB B;  3CST A;  4AOF A;  4GOC A;  4TQ1 A;  3L54 A;  4IM2 A;  3RT3 B;  3QC8 B;  4I6P A;  4A20 A;  1GG3 A;  1EUV B;  1WE7 A;  1HE8 A;  4NJ6 A;  1YX5 B;  4WWN A;  1WE6 A;  3CF6 E;  4W9E A;  3ONS A;  4ZRJ A;  2Z59 B;  1ZW7 A;  2KDF B;  1GC7 A;  4KIK A;  3UQA A;  3GZN I;  2D07 B;  2M1M A;  3ZLZ A;  4FN2 A;  2K1F A;  1NBF C;  3T9L A;  4RM9 A;  4HLE A;  4N9F 4;  3UGB B;  2ZVN A;  4PYZ A;  1YJ1 A;  5CX3 A;  2C9W B;  4KSL C;  1U4A A;  4EOY A;  5J2R A;  1V6E A;  4LDT B;  3V60 A;  1RAX A;  2KVR A;  1J8C A;  2WDT B;  2WWZ A;  2KDB A;  2N7D A;  5DPS A;  4IM0 A;  4BOS C;  3PVL A;  4MH0 E;  1WXM A;  2FCS A;  2KK8 A;  3AUL A;  2ZPN A;  1S3S G;  4CYE A;  2NBV B;  4MGI E;  3GOE A;  2IO1 B;  4DHZ B;  2VRR B;  4FJZ A;  4JIO U;  4KDI C;  4WAA A;  3H7P A;  1Q5W B;  4KIK B;  2BPS A;  4MJS A;  1V5T A;  4PS3 A;  2LXC A;  3QQ8 B;  3TIX A;  2WX0 A;  3DVG X;  3V6C B;  2PE9 A;  4HPL B;  4W9I A;  4FLH A;  4IWO A;  3VTV A;  1L2N A;  2I1K A;  3SDL C;  2WX1 A;  3RYT A;  1WZ0 A;  4K1R B;  3ZUN A;  3ZVV A;  3VHT C;  3LDZ E;  3BY4 B;  4FHJ A;  2LD9 A;  2KNB A;  4FJV B;  1MG8 A;  2GOW A;  1WFY A;  4TUU A;  4DXA B;  5L95 C;  2KQS A;  3M62 B;  4HWI B;  2WYQ A;  2IZV B;  2KX3 A;  4BOZ B;  4AUQ C;  4W9L A;  3X0W A;  1UZX B;  2GMI C;  4WJN A;  2EKE C;  2HD5 B;  4PS7 A;  4DHJ B;  1OGW A;  1SIF A;  3PTF C;  1WJ6 A;  2ASQ A;  3APC A;  4GXB A;  4XZ4 A;  4CHK A;  2KJ6 A;  2LVP A;  2CKH B;  3EHV A;  4EFO A;  1C3T A;  3H7S A; 
#chains in the Genus database with same CATH topology
 1YD8 U;  3P4S B;  1SXT A;  2B76 B;  1YQ4 B;  3NY5 A;  3UF8 A;  2L00 B;  2Z0D B;  1OEY A;  3TEZ A;  3OWE B;  3SU8 X;  1IGC A;  2BKF A;  5IAA C;  4N58 A;  1XLN A;  4BBN C;  1KFY B;  3N1Z C;  3DBS A;  1IPG A;  3DBR I;  2WDR B;  3WAP A;  2IY0 B;  3PHW B;  1XCQ L;  2AL3 A;  2V3N A;  4MM3 A;  1DOX A;  1JWU D;  3KW5 B;  3RNC C;  3D32 A;  2JWZ A;  1FO4 A;  2KDE B;  2D3B A;  2KMC A;  2GBM A;  1UD7 A;  2MP2 A;  2KFK A;  2IO0 B;  4IUM B;  1IYF A;  4WJO A;  1YJJ A;  2OJW A;  1WGD A;  1ZP0 B;  3EA6 A;  1N6Z A;  1WXS A;  2BBC A;  2LWP A;  5JXV A;  1SE9 A;  3RUI B;  1M94 A;  1Q1O A;  4XYC A;  3LXF A;  2M0A A;  2IPK D;  4F8C B;  3ZJT A;  1V8C A;  1WZ3 A;  3N1Y C;  4E71 A;  4GGQ A;  2WU2 B;  1WGY A;  2JRI B;  2W3R A;  5HHD G;  3NG0 A;  2CHX A;  4HDQ A;  4NQK E;  1I4R A;  2KQ4 X;  1HZ6 A;  2REX A;  2JT4 B;  1Z5S B;  1OEY J;  1L7Y A;  3IT4 B;  4BZA A;  4DK5 A;  4RFB A;  2BGF A;  2N9X A;  3MHZ A;  1V9J A;  2WXI A;  3DCG A;  4IWP A;  3W9C B;  1MI0 A;  4GDK B;  1N5X A;  2LGX A;  1MHX A;  2V4L A;  4HPP A;  1FRD A;  4WH4 A;  1ZKH A;  4A90 A;  2GBK A;  4MSQ B;  3AE6 B;  3L16 A;  1N63 A;  3ZGZ A;  4DQO C;  2E3T A;  2MWS B;  3AE7 B;  1UF0 A;  3NS8 A;  1VDV A;  4M8M A;  4GMV A;  4EEW A;  4GLS C;  3R2I A;  4OZA A;  2LGD A;  2KXJ A;  4ITK A;  3VUW A;  4DHZ E;  3TEX A;  4NPN A;  3K9O B;  3WA0 A;  1F2R I;  3N9Y C;  3AEG B;  4EZJ A;  4WQO B;  3OJ3 A;  1SJH D;  3R3M A;  2D3A A;  1P98 A;  3PS6 A;  4ZRI A;  1Q0W B;  2W82 A;  3SFD B;  3FIL A;  1R7S A;  4IKG A;  4HXD A;  2AQ3 B;  1G6J A;  4UDU C;  1V86 A;  3RN9 C;  5D6J B;  2O2V A;  4MSM B;  2K8C A;  2V1Y A;  5BMH A;  3BYY B;  4AWJ A;  3KWV A;  2N9L A;  1Z2M A;  2G4D B;  3U52 E;  4M8N A;  2ZNV B;  4ANW A;  1C4A A;  2WLB A;  2BF8 B;  4EZK A;  1JRO A;  1B1Z A;  1STE A;  2ZZP B;  4HEA 1;  2FIF A;  5EE1 A;  2IDY A;  2FID A;  3OLM D;  4W9G A;  3TCA A;  3WAL A;  4GB9 A;  3AEB B;  1YJI A;  2PE6 B;  3V3X A;  1ZDX A;  4MGK E;  3Q69 A;  5IP4 D;  4ARI A;  2JVC A;  2RPV A;  2KWU B;  2TSS A;  3KUZ A;  1C1Y B;  4MGZ E;  1UBI A;  1FPY A;  4ARC A;  3RNG C;  2MX2 A;  1WYW B;  2KLG A;  3BVZ A;  1TGZ B;  4JL9 A;  2LJ5 A;  5DPT A;  5FKA C;  5IOI A;  3A9J B;  1D6E C;  4FHK A;  4AQ7 A;  3W2D A;  3VFK A;  2XBB C;  1E90 A;  4ZRP A;  4DWF A;  2ZCB A;  1L0X B;  2WXM A;  3PGE A;  3ECI A;  3VTU A;  2SEB D;  3AE9 B;  3DPD A;  1T0Q C;  2EEL A;  4KZ0 A;  3VR8 B;  4JWU C;  3S2A A;  2C7M B;  2D5G A;  3MC9 A;  5E6N A;  1ET6 A;  2KTR A;  2D3C A;  2CJN A;  3EEC A;  3VRA B;  5BYR A;  4JX1 C;  4KSK C;  1V80 A;  2EMS A;  2OJR A;  4BAX A;  3Q14 C;  4ANU A;  3AEC B;  1WMH A;  3Q3N C;  4WUR A;  2IGH A;  4N59 A;  2AYO B;  2K6Q A;  1K8R B;  2KJH B;  3HRD D;  1LQB A;  5KHO A;  4JGH B;  3BVM A;  2FNJ B;  4DDI D;  3TJP A;  1RYJ A;  2KOX A;  2KMA A;  2LMC A;  4I6N B;  2J7Q B;  4WWO A;  3W5V B;  1T0Y A;  3AEF B;  2CHW A;  3BVG A;  3RPF C;  1ZXI A;  1E8Y A;  2JPH A;  5HI1 A;  2LHE A;  3C0R B;  1A70 A;  1QQR A;  1LGR A;  1YQ3 B;  4YL8 A;  2I38 A;  3SFE B;  2MEK A;  3A33 B;  1NDD A;  4RF0 A;  5CHF A;  2VH1 A;  1WI0 A;  5H92 C;  2LUM A;  1WX8 A;  4A3O A;  4MEL A;  3I9V 1;  2YVC A;  1NYR A;  4B95 A;  3RCZ A;  2PVO D;  3DDC B;  4W9J A;  1DGJ A;  1YN3 A;  2C5L C;  5GMV A;  2L0F A;  2WHI A;  4ANX A;  4C56 C;  1ZOY B;  4B0E A;  1UH6 A;  2KKC A;  1WM3 A;  1QOB A;  1J7B A;  2QHO A;  3ALB A;  1FIQ A;  2DAJ A;  3A9K A;  3MTN B;  4MEM A;  2KC1 A;  4HCN B;  2MQJ A;  1TTN A;  3L0W B;  1ZXH A;  5IN7 A;  3MP9 A;  2L7R A;  3AE8 B;  3DBH B;  4IM3 A;  3JW0 X;  1GUA B;  1K51 A;  1R4M B;  2MSE D;  5JHB A;  1GB1 A;  4NAW B;  3TUO A;  5E6J A;  3MFG A;  2ONQ A;  3M95 A;  5HG2 A;  2OOB B;  1K52 A;  3T3O A;  4A20 A;  4MAC A;  1EUV B;  1YX5 B;  1WE6 A;  3CF6 E;  1ZW7 A;  3GZN I;  1QT9 A;  2M1M A;  1N60 A;  2QEJ C;  4C7Z A;  2ZVN A;  2RDB C;  1V6E A;  3V60 A;  1HQR D;  2WWZ A;  3BYT B;  2N7D A;  3FAH A;  4BOS C;  3PVL A;  1SSN A;  2KK8 A;  1S3S G;  4JE3 B;  3GOE A;  2WDV B;  3ZXR A;  4DHZ B;  4LK0 M;  3H7P A;  1Q5W B;  2L83 A;  1TKG A;  2QCZ A;  3TIX A;  1DYQ A;  5EE0 A;  4W9I A;  1L2N A;  3SDL C;  3RYT A;  2PW9 A;  1WZ0 A;  5HFY A;  1JAL A;  4K1R B;  3ZUN A;  1JCK B;  4FHJ A;  4FJV B;  1WFY A;  4TUU A;  2IZV B;  1UZX B;  1SIF A;  2AQ2 B;  5D3D A;  2KJ6 A;  3B9J A;  4EFO A;  4DXF A;  4IW0 A;  4GDL A;  4AS1 A;  1T0R C;  2V3S A;  1TS5 A;  2KAC A;  2RGF A;  3U2S C;  2UWQ A;  1TKY A;  1L4D B;  2G45 B;  4W9H A;  1I35 A;  3RNA C;  2K8H A;  1TY0 A;  2FBW B;  2PVG C;  3O65 B;  3P2B A;  2MBH A;  3RZW C;  4FBJ B;  1FCC C;  4P16 A;  4OVZ A;  2Y5P A;  3JSV A;  4RGN A;  4F1S A;  3A1Q A;  1WXQ A;  3H7P B;  5C3J B;  5LNK 1;  1V97 A;  4JPS A;  3RI7 C;  1E8X A;  2L0T A;  1J7A A;  2EMT A;  1WGG A;  3H9D A;  4GSW A;  2JZ3 B;  2NTT A;  3WIM A;  2NR2 A;  2E6X A;  2W9N A;  3RNF C;  3HM3 A;  2FCN A;  3DVN V;  2N1V A;  1E8W A;  3M3J A;  3AE2 B;  5BMI A;  1WRI A;  2X38 A;  3HK0 A;  2MJE A;  3RD2 A;  3ZXV A;  1F2R C;  1WYG A;  2N1W A;  3R66 C;  2YEP F;  2Z8L A;  1S1Q B;  3UIO B;  1HTO A;  3HHM A;  3PRP B;  2K39 A;  3I57 A;  5IO9 A;  2MHJ A;  4NQL B;  3KH0 A;  3ZRC A;  3IAS 1;  4GU2 A;  4NZL B;  4BKS D;  2J0J A;  3BZD B;  1UBQ A;  4E74 A;  3P1M A;  4L2Y A;  3FIL B;  1EF1 A;  4NAM A;  1ET9 A;  3SHQ A;  1UEL A;  1F77 A;  1TS4 A;  5D3I B;  2AX5 A;  3NZU A;  4AP4 C;  2MLB A;  2GBJ A;  2CR5 A;  3NUH B;  1I4P A;  2ZNV C;  2D3G A;  5G5H A;  1FM0 D;  3U7Z A;  3JSV B;  3U30 A;  4RMA A;  4IWQ A;  1C9F A;  3RFZ B;  2BTE A;  3PZ8 A;  5HKH A;  4QAY A;  2JRH A;  3WAO A;  1I4G A;  3JYU A;  3LB8 C;  4W9C A;  2BS4 B;  3DBR B;  3ZTD A;  2VH2 A;  2D10 A;  4RGM A;  2JY6 A;  1P9D U;  5DPR A;  3KQ4 A;  1OFF A;  2J0K A;  2NPT A;  4IG7 B;  1XQQ A;  2M0X A;  1EWY C;  1RFK A;  1Q10 A;  3ZYY X;  4WJQ A;  2A5U A;  2LFI A;  1VR9 A;  2GRI A;  2AL6 A;  4KX6 B;  1XLP A;  1SIJ A;  3DQV A;  2BYF A;  3TBL D;  4DHJ D;  2KTF A;  2MBB B;  3V05 A;  1E7V A;  3MC8 A;  3BIN A;  3UIP B;  2PMV A;  1AN8 A;  1QOA A;  1KH0 A;  1PGB A;  2D11 A;  3QAQ A;  2M19 A;  2J52 A;  3W5U B;  3U4E G;  3IAM 1;  2L52 A;  2WXQ A;  5DCN A;  2O2V B;  3CIR B;  3MHS D;  4ZHO A;  1GB4 A;  2D2Q A;  3PSE B;  2JQR B;  4IOI E;  5G2N A;  1WJ4 A;  2MBO A;  2WXJ A;  1OTR B;  4Q2J A;  2KAN A;  1L5P A;  4S0R A;  5JHA A;  2NPT B;  3Q8C A;  2PJH A;  4K7W A;  3P42 A;  1NEK B;  4B0M A;  1QIL A;  4KKI A;  2Z0E B;  3IHP C;  4TV3 A;  1KLG D;  1BT0 A;  1QLB B;  4WQM A;  2NVU I;  2QIE B;  3V61 A;  1TKE A;  3A9J A;  3UQB A;  2DZJ A;  4LNF A;  4DDG D;  1PQS A;  1V2Y A;  3B08 A;  3PO0 A;  1JW9 D;  1PDX A;  3I5J C;  1SBB B;  2ZW0 A;  3Q3J A;  1XLO A;  4HKZ E;  1QOG A;  2O6V B;  1ACC A;  2YLM A;  1VZ6 A;  2NTS A;  1FNU A;  5BYQ A;  4RGT A;  1C77 A;  3PRM B;  4XWW A;  3DBL I;  4MGY E;  2BWE S;  1YN5 A;  4HK2 A;  3Q3F A;  4OVU A;  3ZTC A;  4HKQ A;  3ETR A;  4LDT D;  3HVZ A;  4HRO A;  2KDI A;  4HVB A;  4M0W B;  4B9K A;  4TMA B;  3BWU D;  3X23 A;  2MBQ A;  2V9H A;  5G5G A;  1OQR A;  4KKJ A;  5I4D A;  5FR3 A;  1M4V A;  1TY2 A;  1WX9 A;  2JZZ A;  1UGJ A;  1MFW A;  1C79 A;  3B2F A;  1T0S C;  1WR1 A;  2PTL A;  5J18 A;  2WXF A;  2WXL A;  3PHX B;  4HCP B;  2KFK B;  2L8J A;  2RDG A;  3KVF B;  2LZ6 A;  2MH7 A;  4J3O D;  2VZK D;  4HRS A;  3DVG Y;  3R8B A;  3KWL A;  1WSP A;  1NI2 A;  3HIZ A;  2DZK A;  2AQ1 B;  2N7J A;  2INP E;  2KMM A;  3DWM A;  5AUK A;  1WMH B;  2KLC A;  2BWF A;  1V81 A;  5C23 A;  1Y8R C;  4HJG E;  1HTQ A;  2MW5 A;  2PKO A;  2DYB A;  3GE3 C;  3NVY A;  1J19 A;  1EU3 A;  1SGH A;  2PPH A;  3VH3 B;  5LXI B;  4TKN A;  3U7D A;  4GDK A;  2PEA A;  4PS8 A;  1OQQ A;  2WXK A;  1FRR A;  2ZJD A;  4A6Q A;  1F0Z A;  3QCA A;  1LFD A;  3Q8A A;  1BXT A;  1PYW D;  2O6V A;  1YX6 B;  1XT9 B;  1QF6 A;  1MPE A;  1R4N B;  1PGA A;  1VZ7 A;  2N7E A;  3ZNI D;  1TS2 A;  1DOY A;  1V5O A;  4KGT A;  4AOF A;  4GOC A;  1PFD A;  3L54 A;  4I6P A;  3GE8 C;  4PK1 A;  2MJ3 A;  4WWM A;  4WWN A;  1ENF A;  1I4H A;  1L0Y B;  2WU5 B;  2WXP A;  3UQA A;  1GAQ B;  1NBF C;  4RM9 A;  1N5W A;  4LLG M;  2QIL A;  4PYZ A;  1YJ1 A;  5CX3 A;  2G9H D;  3ZQ4 A;  4EOY A;  2JSV X;  2WDT B;  2KDB A;  4M02 A;  2WXR A;  1WXM A;  3AE1 B;  2ZPN A;  2NBV B;  3VRB B;  4RNA A;  2Y3A A;  4MGI E;  4YXD B;  4KDI C;  2WXO A;  2BPS A;  3N1X C;  1V5T A;  2WX0 A;  2BQQ A;  4HPL B;  4IWO A;  3LDZ E;  1CZP A;  2ON8 A;  4N6E B;  5L95 C;  3M62 B;  2J53 A;  3SR6 A;  4W9L A;  2HD5 B;  1ZDV A;  1V1O A;  1WJ6 A;  3APC A;  2CKH B;  1KLU D;  4XDC A;  5D94 A;  3ENE A;  1HEZ E;  1E7U A;  2UU7 A;  3TMP B;  4C00 A;  3VUX A;  2R2Q A;  3QHT A;  3VH4 B;  2L76 A;  1FNW A;  2J4X A;  4E3C A;  1PGX A;  2H89 B;  3ML8 A;  1ISN A;  3NVW A;  1I4X A;  2ZPY A;  1SJE D;  1E5W A;  2IGG A;  2K6D B;  1JQ4 A;  3QIJ A;  2N9K A;  4H2A A;  2LHD A;  3L13 A;  1ZPS A;  2JYT A;  1VCB A;  2BKR B;  3IG3 A;  1XEE A;  2VZK B;  1CK1 A;  2INC C;  3AED B;  4R3D A;  2AEH A;  4BFR A;  4ACF A;  4C7Y A;  2G3Q B;  2ZVO A;  1C4P A;  3GZN B;  1QKZ A;  4X57 B;  2RPQ A;  1RFA A;  4HJK A;  4RGO S;  2ACZ B;  1UGM A;  2SAK A;  3E56 A;  2X8X X;  3PZ7 A;  2XEW A;  3NOB A;  1GNU A;  3ZKJ C;  3TEY A;  2DHZ A;  1AAR A;  4US9 A;  4K81 A;  4LJP B;  2FUG 1;  4K7U A;  4XX5 A;  2DZI A;  3R2T A;  1WR6 E;  1D4B A;  4OZB A;  1F52 A;  1FCL A;  4F7Z A;  3L10 B;  1P3Q U;  3C8Y A;  4XE0 A;  2JX5 A;  1TT5 B;  3W1Y A;  3ZNZ B;  1DOI A;  2DWQ A;  4B6W A;  1WGH A;  1RWS A;  2RMM A;  2DBY A;  3BK2 A;  5EE9 A;  4KZC A;  2C7N B;  2QSD A;  2LEK A;  2GLS A;  3Q8E A;  1VJK A;  2OHF A;  1GJZ A;  1WXA A;  1XLQ A;  1JWM D;  1EU4 A;  1I7H A;  4PT5 A;  4YTM B;  3L4P A;  2L05 A;  2LVQ A;  3A9K B;  2IBI B;  3AE5 B;  3TSS A;  3IBE A;  4KV2 A;  5E6O A;  3MJW A;  5TR5 A;  3N32 A;  2KVZ A;  1MG4 A;  2BB6 A;  2LAS A;  4II2 B;  3APF A;  2BS2 B;  2KN4 A;  1F1H A;  2HJ1 A;  2IY1 B;  1KOT A;  3P4R B;  5LXH A;  2WGS A;  3P4Q B;  3AE4 B;  3IVF A;  1IBX A;  2GI9 A;  4OVV A;  2M8S A;  2MA9 B;  2CHZ A;  4DXG A;  1B9R A;  1UUP A;  2JZP A;  2XK5 B;  2KT7 A;  1IUE A;  2HE7 A;  2K8B A;  4NNJ B;  4KVG B;  3CSF A;  3QK0 A;  3CMM B;  4HDO A;  1WRD B;  5FR6 A;  3B1L X;  3QJZ A;  3N20 C;  3A4R A;  2J42 A;  1H8C A;  3Q3M C;  2ZEQ A;  1EM7 A;  2L3Z A;  5J17 A;  3QAR A;  1FFV A;  4A3P A;  4MJS B;  3JVZ X;  1Y56 A;  2M17 A;  1SE3 A;  3T3N A;  2NMQ A;  5BMG A;  1R4M I;  3KYD D;  3PZD A;  2K3U A;  1TS3 A;  1I4Q A;  4P7I A;  4IC7 B;  1E6E B;  2GBR A;  3NHE B;  2FAZ A;  2KWD A;  3VTW A;  2ZCC A;  5H8Y E;  1WF9 A;  4ICU A;  2R2O A;  2QMT A;  2FCM A;  2WNM A;  1UWM A;  3TEW A;  5CTR C;  3ZDT A;  3KLS X;  4XC2 A;  3B0A A;  4YWG G;  2GBN A;  4BKS A;  3ZIM A;  1PUT A;  3QX1 A;  4EZL A;  4BBN F;  3RNE C;  1E9M A;  4KDL B;  3PRE A;  1L4Z B;  4NAW A;  2KWV B;  1GPX A;  2G4S A;  1FFU A;  4BKT A;  2CJO A;  2H88 B;  1JRP A;  3EUB 2;  2Y5B B;  3TL5 A;  4NY0 A;  1ESF A;  1C76 A;  2LUE A;  2BT6 A;  2IJ0 A;  5L83 A;  1YNT E;  1RLF A;  2R61 A;  3AH7 A;  4RM8 A;  5GXG B;  3ZJV A;  2JXX A;  3I63 C;  3DHH C;  4W9D A;  3ZNH B;  5AUI A;  4ZYS A;  3R7Q A;  2I1J A;  4II3 B;  1YIW A;  2DZM A;  2RSU A;  3IXS A;  2AWT A;  3BK1 A;  2MBE A;  2KFJ A;  3DWG C;  2CU3 A;  1NEN B;  2IO3 B;  1HXY D;  2DYM A;  5C1Z A;  1T3Q A;  1D5X C;  1TJE A;  2HDE A;  2LRU A;  3U8Z A;  2NBW B;  4ANV A;  3NVZ A;  2HTM E;  2MJD A;  2OED A;  2RDH A;  3PT2 B;  2V3P A;  2MRP A;  2BB5 A;  1AYF A;  3IFW B;  2KN5 A;  1GC6 A;  1WJN A;  2KDM A;  4C4V A;  3AXC A;  2KHW B;  4FXC A;  4WIP A;  2MP2 B;  2JU6 X;  1BUI C;  3VR9 B;  4MM3 B;  3P63 A;  3RMK C;  1EWC A;  2IO2 B;  1UWX A;  5DPW A;  3H1U A;  3ZJU A;  2LGS A;  1IP9 A;  4S17 A;  2INN E;  2I2Y A;  1IGD A;  1WX7 A;  2CU1 A;  3KUD B;  4LNK A;  2LJI A;  3OAW A;  1SEB D;  1WJU A;  2JF5 A;  3A4S C;  2KTR B;  5TSS A;  1JML A;  3GB1 A;  4W9K A;  5D2M B;  1P7F A;  4K3C A;  4GDL B;  4YSZ B;  2UYZ B;  5AZG A;  2EKI A;  1KTK A;  4A55 A;  5G55 A;  1F9J A;  3PV1 A;  1NVI D;  4MT5 A;  2LVO A;  4O1N A;  2M4N A;  1KRH A;  1WXV A;  5IKC M;  3K9P B;  1TZ1 A;  1SE4 A;  4EE2 A;  4G3X B;  2O6V D;  3L17 A;  4GIV A;  3CST A;  4TQ1 A;  3QC8 B;  1K53 A;  1WE7 A;  4NJ6 A;  4W9E A;  4ZRJ A;  3ONS A;  3Q8F A;  2Z59 B;  4KIK A;  3T9L A;  4HLE A;  3UGB B;  2BS3 B;  4XWT A;  1JWA D;  2C9W B;  4KSL C;  5J2R A;  4LDT B;  1WGK A;  1RAX A;  4C80 A;  1J8C A;  1RM6 C;  5DPS A;  4MH0 E;  3AUL A;  2VRR B;  2WS3 B;  4FJZ A;  4OZC A;  4WAA A;  4PS3 A;  4NJC A;  2LXC A;  3DVG X;  2GB1 A;  4FLH A;  3E9S A;  2BYT A;  4P1C C;  3VHT C;  3CWI A;  2LD9 A;  2GOW A;  3FC4 A;  2WYQ A;  2KX3 A;  2ZW1 A;  4AUQ C;  4BOZ B;  1C78 A;  3X0W A;  2WP9 B;  1FNV A;  1D5M C;  2EKE C;  4DHJ B;  4GXB A;  2ASQ A;  3O13 A;  1C3T A;  2HJ8 A;  1AWD A;  1WY8 A;  3VQI A;  3ZNG C;  5KHQ A;  2DEN B;  3AN1 A;  1V1P A;  1KLV A;  1WGR A;  4YT0 B;  4REZ A;  3MJ5 A;  4URK A;  1XXG A;  1FEH A;  2KQ7 A;  2RR9 A;  2KJR A;  3VXW A;  3WCQ A;  1R4N I;  1YQB A;  2NBU A;  1XO3 A;  2KD0 A;  4OHJ A;  5FK9 C;  3H6N A;  2LXA A;  1NI3 A;  1VZ8 A;  2NS5 A;  2C7H A;  4LNN A;  3HVD A;  5AEK B;  3RZF A;  5JH5 C;  3HUI A;  1ZE3 D;  1ZGU B;  1N61 A;  2PLP A;  4G11 A;  1A5R A;  1TIF A;  3AV8 A;  3H8H A;  1BML C;  2LI5 A;  3QWZ B;  3DVN U;  1LM8 B;  1CJE A;  4LTU A;  2ICI A;  5CHV C;  2L1A A;  2QJL A;  4MDK E;  3I3T B;  4D2K A;  4YTP B;  4US8 A;  2DLB A;  2PIA A;  2WXG A;  1JWS D;  2DAF A;  2RD0 A;  2IND C;  2LGI A;  1H4R A;  1D5Z C;  3W1S A;  2W55 A;  2K25 A;  3MC0 B;  4PYU A;  1FXI A;  4JQW C;  1FD6 A;  2BW2 A;  2WXN A;  2N4F A;  2W54 A;  1FMA D;  4M0W A;  2BYV E;  1X1M A;  3NZS A;  2LGY A;  4OW0 A;  1WIA A;  4LJO B;  4J6I A;  3ZO5 B;  1TBE A;  2KYW A;  1QOF A;  3AEE B;  3AMZ A;  3KYC D;  3ABV B;  2FE8 A;  2NCN A;  1VD2 A;  2KO3 A;  2WQY B;  1WM2 A;  2V4I B;  2JUO A;  2B3A A;  4RF1 A;  3L08 A;  3P4P B;  1FXA A;  1OQY A;  4ZYN A;  3J9C A;  5E6P A;  1T5X D;  4TQ0 A;  3Q2A C;  2BYE A;  2K5P A;  1KM7 A;  2QC8 A;  4DBG A;  3WAM A;  3NVV A;  3APD A;  3NJT A;  1WH3 A;  3M63 B;  4EUT A;  3SD5 A;  2DX5 B;  2DYO A;  3T8M A;  4W9F A;  4WAF A;  3V6E B;  4G50 A;  4C4V B;  1P0R A;  4ZRK A;  4JWS C;  4ASW C;  4RH6 A;  3UIN B;  4CQN A;  3PLV A;  3LYY A;  4LNO A;  1MVK A;  2KC2 A;  3AE3 B;  3HM6 X;  5AZH A;  4BVU C;  3N30 A;  3AM9 A;  3ML9 A;  1HZ5 A;  1P1A A;  2K0P A;  2IGD A;  4KGR A;  2KAJ A;  1K50 A;  3Q3O C;  3AU4 A;  4LNI A;  3VVW B;  3PLU A;  4LCD E;  3EGR A;  4A9A A;  4I6L B;  2FCQ A;  2KX0 A;  4P1B C;  5D7G A;  4AJY B;  1VRA B;  5AZF A;  4YTN B;  4WWP A;  5BO4 B;  1E10 A;  2C60 A;  2XK5 A;  3R7R A;  3GP7 A;  3ZRF A;  1YOV B;  5JZE B;  4IDI A;  1T6B X;  1FXT B;  3W1S C;  4P6V F;  1IBX B;  2N9P C;  3A1Q B;  2WDQ B;  2K9X A;  3DOW A;  3EFC A;  4ICV A;  1XCT L;  2Y5C A;  4A8X C;  4EKU A;  4G0N B;  3B2G A;  2YEP B;  2LRW A;  1SB3 C;  3QA8 A;  3VUY A;  4K3B A;  3AEA B;  2JWU A;  1YN4 A;  3ZDM C;  3N3K B;  1LO5 D;  3EC8 A;  3NRZ A;  3V62 A;  2MCN B;  1GOZ A;  3NS1 A;  2WXH A;  2HTH A;  3DBH I;  1RRB A;  2DNF A;  1HA5 A;  4L23 A;  2J0M A;  1SE2 A;  1WWT A;  1TZO A;  3RUL A;  3GS2 A;  2KZR A;  2FUH B;  5LLI A;  1ZUD 2;  4JLC A;  4FA6 A;  4M00 A;  4K7S A;  5EE3 A;  2W3S A;  5IA7 A;  1L6V A;  2N9E B;  3DHG C;  3ZW3 A;  4HPM B;  3AI5 A;  4BKG A;  1KF6 B;  3OJ4 B;  5MPO A;  2CS4 A;  1JWB D;  1LXD A;  1SF0 A;  2JYE A;  3KUC B;  5T8I A;  4MH8 A;  3OG5 A;  4M01 A;  1E8Z A;  3URY A;  3AU5 A;  3VDZ A;  3LJ3 A;  1J0G A;  3Q8B A;  2XNA C;  2IYD B;  3BII D;  4FAD A;  1CMX B;  1EO6 A;  1E7P B;  1C4C A;  1VLB A;  1TYG B;  4RCO A;  3PPA A;  4L1B A;  1XD3 B;  1D3Z A;  4GN1 A;  3Q6B A;  1V49 A;  4XDD A;  1L0V B;  4FJY A;  4CO7 A;  4ZDV A;  3DHI C;  2N0S B;  2V0G A;  2XN9 C;  1J7C A;  5CHW A;  5C2T B;  4NJ7 A;  3EFU A;  1JRU A;  4AJW A;  1CQV A;  1UNS A;  2KWC A;  2A4Z A;  3PRZ A;  1P7E A;  4YSY B;  3WAN A;  4FUL A;  1KJT A;  3NZ3 A;  1EF5 A;  3FKY A;  4KGS A;  1MHH E;  5EDS A;  3VAW A;  2BVC A;  4ZOH C;  4WJP A;  1N62 A;  1I42 A;  1YMH E;  4YSX B;  1QZE A;  1L6U A;  1E0Z A;  4IM2 A;  3AB5 A;  3RT3 B;  1XF5 L;  3RNB C;  1GG3 A;  2L32 A;  3C19 A;  2K22 A;  1HE8 A;  4USA A;  2G1E A;  2KDF B;  1GC7 A;  3SEB A;  2D07 B;  3ZLZ A;  4FN2 A;  2K1F A;  1NYQ A;  4N9F 4;  3UI3 A;  1U4A A;  3IT6 B;  2KVR A;  2M56 B;  4IM0 A;  2FCS A;  4CYE A;  1ROE A;  2IO1 B;  4JIO U;  4XGA B;  1MJD A;  4KIK B;  2QDF A;  4MJS A;  2Q5W D;  3QQ8 B;  4TSS A;  3V6C B;  2PE9 A;  2JXT A;  3DBL B;  3VTV A;  2I1K A;  2WX1 A;  1AW7 A;  3ZVV A;  5BYS A;  3BY4 B;  4ZHP A;  2KNB A;  1MG8 A;  4DXA B;  4ZRQ A;  2KQS A;  4HWI B;  1V1P B;  2GMI C;  4WJN A;  4PS7 A;  1OGW A;  3PTF C;  4XZ4 A;  4CHK A;  2LVP A;  3EHV A;  3H7S A; 
#chains in the Genus database with same CATH homology
 4IW0 A;  5D94 A;  4GDL A;  3ENE A;  2HJ8 A;  1WY8 A;  1YD8 U;  3VQI A;  3ZNG C;  1E7U A;  2V3S A;  3TMP B;  3VUX A;  3NY5 A;  2RGF A;  5KHQ A;  2R2Q A;  3QHT A;  2UWQ A;  2L76 A;  3UF8 A;  3VH4 B;  2G45 B;  2L00 B;  4W9H A;  2DEN B;  1I35 A;  2Z0D B;  2K8H A;  1OEY A;  4E3C A;  1KLV A;  1WGR A;  3SU8 X;  2BKF A;  5IAA C;  3ML8 A;  1ISN A;  4URK A;  2ZPY A;  1E5W A;  2K6D B;  2KQ7 A;  3O65 B;  2RR9 A;  3P2B A;  2KJR A;  2MBH A;  3QIJ A;  3RZW C;  3VXW A;  1R4N I;  1YQB A;  2NBU A;  3L13 A;  4FBJ B;  4BBN C;  2KD0 A;  1VCB A;  2BKR B;  1IPG A;  2LXA A;  3DBR I;  3DBS A;  3H6N A;  3IG3 A;  3JSV A;  2NS5 A;  2IY0 B;  3WAP A;  2C7H A;  3PHW B;  2AL3 A;  4MM3 A;  4F1S A;  3A1Q A;  3KW5 B;  5AEK B;  2AEH A;  3RZF A;  3D32 A;  3H7P B;  4BFR A;  2JWZ A;  5JH5 C;  1E8X A;  2G3Q B;  2L0T A;  2ZVO A;  2EMT A;  2KDE B;  1WGG A;  1ZGU B;  3H9D A;  2KMC A;  2GBM A;  4G11 A;  1UD7 A;  2MP2 A;  2JZ3 B;  4GSW A;  1A5R A;  2LI5 A;  3QWZ B;  4X57 B;  3WIM A;  2KFK A;  2IO0 B;  4IUM B;  3DVN U;  1LM8 B;  2NR2 A;  2W9N A;  1IYF A;  3HM3 A;  4WJO A;  2FCN A;  2RPQ A;  5CHV C;  3DVN V;  1RFA A;  4HJK A;  4MDK E;  2N1V A;  1E8W A;  1UGM A;  3I3T B;  3M3J A;  1WGD A;  1WXS A;  2XEW A;  2DAF A;  3HK0 A;  1GNU A;  2RD0 A;  3NOB A;  3ZKJ C;  2LWP A;  1SE9 A;  1AAR A;  1M94 A;  2DHZ A;  3RD2 A;  1Q1O A;  1H4R A;  4K81 A;  4LJP B;  3RUI B;  2N1W A;  3R66 C;  3W1S A;  4K7U A;  4XX5 A;  4F8C B;  2DZI A;  1WR6 E;  2K25 A;  4PYU A;  4JQW C;  1S1Q B;  4F7Z A;  3UIO B;  3L10 B;  1WZ3 A;  4E71 A;  2N4F A;  4GGQ A;  3HHM A;  3PRP B;  1P3Q U;  1WGY A;  2K39 A;  2JRI B;  2CHX A;  4HDQ A;  4NQK E;  3W1Y A;  4NQL B;  3ZNZ B;  3KH0 A;  4B6W A;  3ZRC A;  1WGH A;  4GU2 A;  2BYV E;  2REX A;  4BKS D;  2J0J A;  1X1M A;  2JT4 B;  4KZC A;  1Z5S B;  3NZS A;  2C7N B;  2LGY A;  1UBQ A;  4E74 A;  1OEY J;  1L7Y A;  4DK5 A;  1GJZ A;  1WIA A;  1EF1 A;  1WXA A;  2BGF A;  4LJO B;  2N9X A;  4J6I A;  3SHQ A;  1UEL A;  1V9J A;  3DCG A;  3ZO5 B;  1TBE A;  4IWP A;  2L05 A;  2LVQ A;  4GDK B;  3A9K B;  2IBI B;  3NZU A;  4AP4 C;  2MLB A;  3KYC D;  2GBJ A;  2LGX A;  2CR5 A;  2NCN A;  2KO3 A;  1VD2 A;  2V4L A;  2ZNV C;  1WM2 A;  2D3G A;  2JUO A;  1ZKH A;  2B3A A;  3IBE A;  4KV2 A;  2GBK A;  3MJW A;  4MSQ B;  3L08 A;  5E6O A;  3JSV B;  3L16 A;  5TR5 A;  3N32 A;  1OQY A;  4ZYN A;  3U30 A;  4RMA A;  5E6P A;  4IWQ A;  2LAS A;  2MWS B;  4II2 B;  4TQ0 A;  3APF A;  5HKH A;  3NS8 A;  2BYE A;  4M8M A;  2JRH A;  4GMV A;  3WAO A;  4EEW A;  3JYU A;  2IY1 B;  1KM7 A;  2LGD A;  4DBG A;  2KXJ A;  3WAM A;  4W9C A;  1KOT A;  3VUW A;  5LXH A;  3ZTD A;  4DHZ E;  4NPN A;  2D10 A;  3IVF A;  3K9O B;  2JY6 A;  3WA0 A;  3APD A;  4EZJ A;  1WH3 A;  3M63 B;  4OVV A;  1P9D U;  4WQO B;  2M8S A;  3SD5 A;  5FR6 A;  4EUT A;  2DX5 B;  5DPR A;  2MA9 B;  2CHZ A;  2J0K A;  2DYO A;  3OJ3 A;  4W9F A;  3T8M A;  3R3M A;  3PS6 A;  1P98 A;  4ZRI A;  2NPT A;  3V6E B;  2XK5 B;  4G50 A;  4IG7 B;  1P0R A;  1Q0W B;  1XQQ A;  2M0X A;  4ZRK A;  2HE7 A;  4ASW C;  3UIN B;  2K8B A;  3PLV A;  4WJQ A;  2A5U A;  2KC2 A;  4HXD A;  4NNJ B;  4KVG B;  2AL6 A;  3CSF A;  3QK0 A;  1G6J A;  3HM6 X;  5AZH A;  4BVU C;  3N30 A;  3CMM B;  3DQV A;  1V86 A;  2BYF A;  3TBL D;  4HDO A;  4DHJ D;  1WRD B;  2KTF A;  3ML9 A;  5D6J B;  1P1A A;  2O2V A;  2MBB B;  2K8C A;  3B1L X;  1E7V A;  3QJZ A;  4MSM B;  2V1Y A;  3A4R A;  3BIN A;  4AWJ A;  1H8C A;  3AU4 A;  3UIP B;  2ZEQ A;  3VVW B;  3PLU A;  4LCD E;  2D11 A;  2L3Z A;  5J17 A;  3QAQ A;  1Z2M A;  3QAR A;  2G4D B;  4M8N A;  2ZNV B;  4ANW A;  4A3P A;  4MJS B;  3JVZ X;  4I6L B;  2FCQ A;  5DCN A;  2O2V B;  2M17 A;  2KX0 A;  3MHS D;  4EZK A;  2BF8 B;  5D7G A;  4AJY B;  2D2Q A;  3PSE B;  1R4M I;  5AZF A;  3KYD D;  3PZD A;  5G2N A;  1WJ4 A;  2MBO A;  2ZZP B;  4IC7 B;  4P7I A;  1OTR B;  2FIF A;  4WWP A;  2GBR A;  2FID A;  3NHE B;  2FAZ A;  2KAN A;  5BO4 B;  3VTW A;  3OLM D;  2ZCC A;  4W9G A;  3TCA A;  3WAL A;  2C60 A;  1WF9 A;  4ICU A;  2R2O A;  5JHA A;  2XK5 A;  4GB9 A;  2FCM A;  2NPT B;  3R7R A;  3ZRF A;  5JZE B;  2PJH A;  4K7W A;  2PE6 B;  5CTR C;  3ZDT A;  4MGK E;  4XC2 A;  3B0A A;  1FXT B;  3W1S C;  2JVC A;  2KWU B;  2GBN A;  2Z0E B;  3IHP C;  3KUZ A;  1C1Y B;  2N9P C;  4MGZ E;  4TV3 A;  3A1Q B;  1UBI A;  3ZIM A;  4BKS A;  3QX1 A;  4EZL A;  2MX2 A;  1BT0 A;  4BBN F;  3DOW A;  4ICV A;  2NVU I;  4EKU A;  1WYW B;  3V61 A;  2KLG A;  4G0N B;  1TGZ B;  4JL9 A;  2LJ5 A;  5DPT A;  3A9J A;  4KDL B;  3PRE A;  3UQB A;  2DZJ A;  4NAW A;  1PQS A;  1V2Y A;  4DDG D;  2KWV B;  2LRW A;  3A9J B;  3B08 A;  4FHK A;  2G4S A;  4BKT A;  3QA8 A;  3VUY A;  3VFK A;  2XBB C;  1E90 A;  3Q3J A;  2Y5B B;  3TL5 A;  4NY0 A;  2O6V B;  2LUE A;  3ZDM C;  4DWF A;  2ZCB A;  3N3K B;  2YLM A;  3EC8 A;  3PGE A;  3ECI A;  3VTU A;  5L83 A;  1RLF A;  3DPD A;  3PRM B;  3V62 A;  4KZ0 A;  4RM8 A;  2MCN B;  3DBL I;  4MGY E;  2JXX A;  2BWE S;  3S2A A;  2HTH A;  3DBH I;  4HK2 A;  1RRB A;  2C7M B;  4W9D A;  3ZNH B;  3Q3F A;  5E6N A;  2J0M A;  2KTR A;  4OVU A;  3ZTC A;  4LDT D;  3R7Q A;  3EEC A;  3RUL A;  2KZR A;  2I1J A;  2FUH B;  4II3 B;  5LLI A;  2KDI A;  4JLC A;  1YIW A;  4FA6 A;  2DZM A;  4HVB A;  4M0W B;  4KSK C;  2RSU A;  4B9K A;  1V80 A;  2EMS A;  2OJR A;  4K7S A;  2AWT A;  4ANU A;  2MBE A;  2KFJ A;  3X23 A;  2MBQ A;  1WMH A;  5IA7 A;  2AYO B;  2K6Q A;  1K8R B;  2N9E B;  3ZW3 A;  2KJH B;  2IO3 B;  4HPM B;  3AI5 A;  2DYM A;  1LQB A;  4BKG A;  5C1Z A;  3OJ4 B;  5KHO A;  2CS4 A;  4JGH B;  1LXD A;  2FNJ B;  4DDI D;  3TJP A;  3KUC B;  2LRU A;  1WX9 A;  3U8Z A;  2NBW B;  2KOX A;  2JZZ A;  4ANV A;  2KMA A;  4I6N B;  2J7Q B;  4WWO A;  3PT2 B;  1WR1 A;  1T0Y A;  5J18 A;  2MRP A;  1E8Z A;  2CHW A;  3IFW B;  2KN5 A;  3AU5 A;  3VDZ A;  3PHX B;  1GC6 A;  3LJ3 A;  1WJN A;  2KFK B;  2L8J A;  4HCP B;  1E8Y A;  2JPH A;  3AXC A;  2KHW B;  2LZ6 A;  3KVF B;  1J0G A;  3C0R B;  2MP2 B;  2IYD B;  4FAD A;  3DVG Y;  1CMX B;  1EO6 A;  4YL8 A;  3A33 B;  1NDD A;  5CHF A;  1WI0 A;  1NI2 A;  3HIZ A;  2DZK A;  1WX8 A;  3PPA A;  4MEL A;  4A3O A;  1XD3 B;  1WMH B;  1D3Z A;  2KLC A;  2IO2 B;  4GN1 A;  1V49 A;  2BWF A;  5DPW A;  2YVC A;  1V81 A;  4FJY A;  5C23 A;  4CO7 A;  1Y8R C;  3H1U A;  4ZDV A;  1IP9 A;  4B95 A;  3RCZ A;  5CHW A;  2MW5 A;  3DDC B;  4NJ7 A;  2DYB A;  1WX7 A;  4W9J A;  2CU1 A;  3KUD B;  5GMV A;  2C5L C;  3EFU A;  2L0F A;  1JRU A;  3OAW A;  4AJW A;  1J19 A;  1WJU A;  2JF5 A;  4ANX A;  1UH6 A;  2KKC A;  1WM3 A;  2KTR B;  2A4Z A;  2KWC A;  2QHO A;  3A4S C;  1SGH A;  2PPH A;  3ALB A;  3VH3 B;  3PRZ A;  2DAJ A;  4TKN A;  5LXI B;  4W9K A;  5D2M B;  3A9K A;  3U7D A;  4GDK A;  3WAN A;  3MTN B;  4MEM A;  2KC1 A;  4HCN B;  4FUL A;  2PEA A;  1KJT A;  2MQJ A;  4PS8 A;  1TTN A;  4GDL B;  3L0W B;  2UYZ B;  1EF5 A;  2ZJD A;  5AZG A;  2L7R A;  5EDS A;  5G55 A;  3QCA A;  3VAW A;  1LFD A;  4IM3 A;  2O6V A;  1F9J A;  3JW0 X;  3PV1 A;  2LVO A;  2M4N A;  1YX6 B;  1GUA B;  1XT9 B;  1WXV A;  2MSE D;  5JHB A;  4WJP A;  3K9P B;  4NAW B;  1TZ1 A;  1I42 A;  2N7E A;  3ZNI D;  1QZE A;  4G3X B;  2O6V D;  3L17 A;  4GIV A;  3M95 A;  1V5O A;  2OOB B;  3CST A;  4AOF A;  4GOC A;  4TQ1 A;  3L54 A;  4IM2 A;  3RT3 B;  3QC8 B;  4I6P A;  4A20 A;  1GG3 A;  1EUV B;  1WE7 A;  1HE8 A;  4NJ6 A;  1YX5 B;  4WWN A;  1WE6 A;  3CF6 E;  4W9E A;  3ONS A;  4ZRJ A;  2Z59 B;  1ZW7 A;  2KDF B;  1GC7 A;  4KIK A;  3UQA A;  3GZN I;  2D07 B;  2M1M A;  3ZLZ A;  4FN2 A;  2K1F A;  1NBF C;  3T9L A;  4RM9 A;  4HLE A;  4N9F 4;  3UGB B;  2ZVN A;  4PYZ A;  1YJ1 A;  5CX3 A;  2C9W B;  4KSL C;  1U4A A;  4EOY A;  5J2R A;  1V6E A;  4LDT B;  3V60 A;  1RAX A;  2KVR A;  1J8C A;  2WDT B;  2WWZ A;  2KDB A;  2N7D A;  5DPS A;  4IM0 A;  4BOS C;  3PVL A;  4MH0 E;  1WXM A;  2FCS A;  2KK8 A;  3AUL A;  2ZPN A;  1S3S G;  4CYE A;  2NBV B;  4MGI E;  3GOE A;  2IO1 B;  4DHZ B;  2VRR B;  4FJZ A;  4JIO U;  4KDI C;  4WAA A;  3H7P A;  1Q5W B;  4KIK B;  2BPS A;  4MJS A;  1V5T A;  4PS3 A;  2LXC A;  3QQ8 B;  3TIX A;  2WX0 A;  3DVG X;  3V6C B;  2PE9 A;  4HPL B;  4W9I A;  4FLH A;  4IWO A;  3VTV A;  1L2N A;  2I1K A;  3SDL C;  2WX1 A;  3RYT A;  1WZ0 A;  4K1R B;  3ZUN A;  3ZVV A;  3VHT C;  3LDZ E;  3BY4 B;  4FHJ A;  2LD9 A;  2KNB A;  4FJV B;  1MG8 A;  2GOW A;  1WFY A;  4TUU A;  4DXA B;  5L95 C;  2KQS A;  3M62 B;  4HWI B;  2WYQ A;  2IZV B;  2KX3 A;  4BOZ B;  4AUQ C;  4W9L A;  3X0W A;  1UZX B;  2GMI C;  4WJN A;  2EKE C;  2HD5 B;  4PS7 A;  4DHJ B;  1OGW A;  1SIF A;  3PTF C;  1WJ6 A;  2ASQ A;  3APC A;  4GXB A;  4XZ4 A;  4CHK A;  2KJ6 A;  2LVP A;  2CKH B;  3EHV A;  4EFO A;  1C3T A;  3H7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...