2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
2G45B 3PHXB 4GSWA 2N7EA 3VUXA 2FCSA 2DZKA 1WY8A 5DPSA 1YIWA 1RRBA 4KZ0A 3ZNHB 4AP4C 2UWQA 3HIZA 2D07B 4EKUA 2KVRA 3WALA 3PGEA 3D32A 3PRPB 2EMSA 3DBRI 1OEYJ 2MW5A 2FIDA 4LDTB 2KOXA 2IO1B 3ZUNA 3WA0A 3M3JA 3APFA 3RCZA 4LDTD 2KANA 4E71A 3K9PB 1GC6A 2MBOA 2GBMA 2J7QB 3WAMA 3GZNI 3DCGA 4G11A 2NBVB 4JQWC 3VUWA 4URKA 1L2NA 4WAAA 1GC7A 2JT4B 3RZWC 3W1SC 4FJYA 1WZ3A 2RR9A 4LCDE 1WJUA 4TUUA 4IW0A 4DK5A 2IZVB 2OJRA 3L16A 2DZIA 4G0NB 4A20A 1X1MA 2MX2A 4TQ1A 1QZEA 3A9KA 4DHZE 4WWPA 2KTFA 1YJ1A 1M94A 2MWSB 4II2B 3OAWA 2JRHA 4KIKB 2RGFA 2LASA 2R2OA 4WWOA 4ZRJA 5AZHA 4HK2A 3IVFA 3M62B 4HDOA 2Z0EB 1F9JA 1BT0A 3V6EB 1IYFA 2MP2B 4AWJA 4G50A 5E6PA 2N9PC 4B9KA 3ONSA 4M8MA 3T8MA 1RFAA 1WGHA 3ML9A 1E7UA 4EZLA 1Q5WB 2MRPA 2IO2B 2KTRA 2KHWB 3QHTA 3IBEA 1V86A 2CS4A 4IM3A 4DHJB 2LVQA 1V49A 1WRDB 2IYDB 4II3B 1J8CA 4DHJD 1YX6B 2C60A 2K8CA 1UH6A 3A9JA 4FADA 3JW0X 4RMAA 3NOBA 3DDCB 4KZCA 4PYZA 3UIPB 2CU1A 3NZUA 3U8ZA 4N9F4 3EHVA 5G55A 5C1ZA 2IO3B 2L7RA 4KSLC 2EMTA 2MA9B 2IY0B 2FIFA 2KWCA 3QC8B 3ZIMA 3DVGX 1V81A 5LXIB 3C0RB 3DVNU 5DCNA 2AEHA 2GOWA 2V3SA 2GBJA 2LRWA 4NJ7A 3L54A 5AZFA 3Q3FA 3TCAA 2AWTA 3QK0A 2K1FA 4GGQA 4KV2A 2K6QA 3MJWA 4TV3A 1WXVA 4MGKE 3VUYA 2GBNA 2JZZA 2I1KA 2EKEC 3SDLC 2BYVE 2KDBA 4W9KA 2REXA 2FAZA 1G6JA 2G4SA 4GIVA 2MCNB 5BO4B 3IFWB 2JY6A 3DBLI 4W9LA 1CMXB 4W9IA 2PEAA 2LJ5A 3VH4B 3A9KB 2ZVNA 2DAFA 2JXXA 3QAQA 3UINB 3Q3JA 1RLFA 2FUHB 3APDA 3PRZA 4ICUA 1J0GA 2M1MA 3UQBA 2ZNVC 4IUMB 4ZDVA 1AARA 1OEYA 2MLBA 1P3QU 4EZKA 1WZ0A 3RT3B 2K6DB 4G3XB 3VFKA 3OJ4B 4IWQA 1ISNA 2KLGA 5KHOA 3PV1A 1YD8U 3NS8A 3QIJA 4NAWA 2DHZA 2O6VB 2NVUI 2B3AA 4IM2A 1NDDA 2KMAA 3N30A 4XX5A 1WGYA 2DYOA 2RPQA 4NPNA 4NNJB 2C7MB 2LD9A 4BBNF 5D7GA 2KZRA 3A9JB 4WJQA 4I6NB 1KJTA 2D3GA 3UF8A 1VD2A 2QHOA 2M8SA 2ZVOA 3EFUA 2KN5A 2KKCA 3VQIA 5CHWA 3QWZB 3U7DA 2PE9A 2LVPA 4WQOB 2N4FA 1C1YB 2DYBA 3ZRCA 4DWFA 4HDQA 2FCQA 3QX1A 2HTHA 2KLCA 1J19A 2ZJDA 2DAJA 2BF8B 2UYZB 2C9WB 2J0KA 3X0WA 2ZPYA 3M63B 3VDZA 3S2AA 1E8ZA 1KM7A 2ZCBA 2KJHB 3HK0A 4I6LB 2KFKA 4IG7B 2K25A 1ZW7A 4PS3A 3V6CB 3KUDB 4ANVA 3RYTA 4MH0E 3R3MA 3ML8A 5DPRA 1WM3A 1WR6E 1XD3B 2NBUA 2OOBB 4BKTA 1ZGUB 4JL9A 2MQJA 3PREA 2BGFA 2PE6B 2R2QA 3N32A 2AL6A 1I35A 3DBHI 1D3ZA 3AU4A 5DPWA 1E8WA 2MBBB 4JLCA 2BYFA 4BVUC 3DOWA 4FULA 3WAOA 2IY1B 4K7SA 2KJRA 1TTNA 4CYEA 3JSVA 4HLEA 2CHZA 1WX7A 2C7HA 5JH5C 1EUVB 3QJZA 4HJKA 3KH0A 3M95A 1WMHA 2XEWA 1L7YA 1ZKHA 3NHEB 4TQ0A 2ASQA 2PJHA 2NPTA 3R66C 3VHTC 1UGMA 2KDFB 3DVNV 4NAWB 3W1SA 2GMIC 4EOYA 4KSKC 2O6VA 2WX1A 2VRRB 2BWES 3OJ3A 3PT2B 3NY5A 3TMPB 2LXCA 2YLMA 4ZRIA 2L8JA 2V1YA 3O65B 3ZNGC 2FNJB 4ANUA 3APCA 3EC8A 2O2VA 2XK5A 2KJ6A 4B6WA 1GUAB 1WXAA 2AYOB 1Y8RC 5IA7A 3W1YA 3VXWA 2I1JA 3VAWA 1RAXA 2JWZA 3L10B 1WFYA 2V4LA 2Z0DB 3ECIA 2WX0A 3PSEB 4HXDA 3ZTCA 4F7ZA 5L83A 4KDLB 2HJ8A 2M0XA 3QARA 2MBEA 4NQKE 5G2NA 5IAAC 2NS5A 4BFRA 2JZ3B 1JRUA 3UQAA 2KFKB 3QQ8B 2KC1A 3PTFC 1WYWB 4HWIB 3V61A 2D10A 2LUEA 2NBWB 2N7DA 4WJOA 2KWVB 2AL3A 3H7PA 1Z5SB 2DZJA 2LGYA 1V5OA 5CX3A 4NY0A 4FJZA 3H1UA 3ZLZA 4DXAB 5J17A 2N1VA 3NZSA 4IWPA 5E6OA 3T9LA 2K39A 2W9NA 2N9EB 1UD7A 5DPTA 4GMVA 1EF1A 3U30A 5D2MB 1E90A 2L00B 2WDTB 4JGHB 5CHFA 5CTRC 2D11A 1EO6A 4DDGD 3PLVA 1XT9B 3JSVB 2IO0B 3ENEA 4GN1A 3PPAA 1WMHB 2LVOA 1KOTA 1WF9A 1U4AA 2KK8A 2J0JA 2K8HA 4EFOA 4B95A 3ZKJC 2KNBA 4GU2A 3VTVA 2M17A 3VH3B 3VTWA 4ANWA 2NPTB 4GDLA 4HCPB 3V62A 2IBIB 2CKHB 3A1QA 1NBFC 1S3SG 2BKFA 3BY4B 4EUTA 1UZXB 1GJZA 1WH3A 3SD5A 1WGRA 4RM9A 5EDSA 4XC2A 2NCNA 4MM3A 2RD0A 3OLMD 3TBLD 3V60A 3ZTDA 1H8CA 2DYMA 4AJWA 2O6VD 3CMMB 4BKSA 2N9XA 3ZDMC 2KO3A 5LLIA 3B0AA 1WM2A 3K9OB 4HPLB 5HKHA 3PHWB 2BYEA 2O2VB 3KYDD 3P2BA 2XK5B 3H9DA 4XZ4A 3RULA 4FJVB 4EEWA 1A5RA 1FXTB 1V80A 2JRIB 2J0MA 2KQ7A 4PYUA 3H7SA 3MTNB 3AI5A 2WYQA 5J2RA 2DENB 3HHMA 4F8CB 3BINA 1KLVA 1NI2A 2KMCA 1Q1OA 1UELA 4RM8A 4W9JA 1E5WA 2ZZPB 4BBNC 5AEKB 2BPSA 4MGIE 1HE8A 1UBQA 4X57B 3ZW3A 4LJOB 2GBKA 2CHXA 5D6JB 2KFJA 3WANA 4FN2A 3AXCA 3ZVVA 4EZJA 1H4RA 3H7PB 2JPHA 4MDKE 3CF6E 3GOEA 3SU8X 4FLHA 4K7UA 4FHJA 3PZDA 2KDIA 4MJSA 3N3KB 2L05A 4K7WA 2KQSA 1LM8B 3ZDTA 1XQQA 3L17A 4MSQB 3RD2A 3ZO5B 4CHKA 4ZYNA 2L0TA 3ZNID 1YX5B 1WIAA 3B08A 4GDKA 4OVVA 2YVCA 2LXAA 1LQBA 2BKRB 3UIOB 2CHWA 4OVUA 1WXSA 1Z2MA 1P1AA 1I42A 1WGGA 4MSMB 3QCAA 3SHQA 2ZCCA 2LGDA 3H6NA 4GDLB 3A1QB 3PLUA 4MELA 2FCNA 4CO7A 4K1RB 1SE9A 1WR1A 2MBHA 2KWUB 2LZ6A 2LRUA 2KC2A 2D2QA 3L13A 4PS8A 4HCNB 3WAPA 4HPMB 2A5UA 3TIXA 4YL8A 4ZRKA 3DVGY 4ANXA 1OGWA 2KX3A 4BOSC 2L3ZA 2LWPA 4BKSD 2ZNVB 2KD0A 1R4NI 1EF5A 5TR5A 3KYCD 3MHSD 2HE7A 1WXMA 4W9FA 5JHAA 1PQSA 3WIMA 2KX0A 2M4NA 2KXJA 3KW5B 3PS6A 4E74A 4GXBA 2C5LC 1R4MI 4W9EA 1GNUA 4P7IA 4BOZB 4WJNA 1LXDA 2NR2A 3HM3A 3L0WB 4WWNA 1WJNA 3R7QA 5D94A 3CSFA 2KDEB 4W9HA 4E3CA 1WI0A 4MGZE 4HVBA 1TGZB 2MSED 5JHBA 3JYUA 5CHVC 3TL5A 2RSUA 1E8XA 3QA8A 2MBQA 2L76A 4MGYE 2A4ZA 4MJSB 4ASWC 3A4SC 3IHPC 4JIOU 5LXHA 5JZEB 1V5TA 4GDKB 2L0FA 4GB9A 3DBSA 3JVZX 3DQVA 1WX9A 4AOFA 2CR5A 1Q0WB 4J6IA 5FR6A 4W9CA 4M0WB 1LFDA 1C3TA 1K8RB 5GMVA 2JUOA 1OTRB 4FHKA 4IC7B 1S1QB 2PPHA 2Z59B 1TBEA 3KVFB 1V2YA 4TKNA 3A33B 3X23A 3LDZE 3L08A 2K8BA 3AULA 5KHQA 1MG8A 1VCBA 2DZMA 1WX8A 2BWFA 3KUZA 3KUCB 3A4RA 3UGBB 1P9DU 3ZRFA 4AUQC 4A3OA 2LI5A 4GOCA 2Y5BB 1SGHA 1GG3A 2G3QB 1SIFA 5L95C 1P98A 3B1LX 1WJ6A 4IM0A 3ALBA 5AZGA 4FBJB 3VVWB 3AU5A 2DX5B 4A3PA 1E7VA 3RUIB 4KIKA 4NJ6A 4MEMA 5C23A 1WE6A 1V9JA 4IWOA 4W9DA 4F1SA 5J18A 1IP9A 3TJPA 2C7NB 3LJ3A 3HM6X 1WJ4A 2MP2A 2N1WA 1P0RA 2FCMA 4M8NA 1YQBA 2GBRA 3CSTA 3DPDA 4PS7A 1TZ1A 2KTRB 4NQLB 4DDID 4DBGA 2JVCA 3RZFA 1T0YA 4I6PA 2JF5A 1WE7A 2ZPNA 4WJPA 4ICVA 5E6NA 3R7RA 2G4DB 1UBIA 2LGXA 1IPGA 4KDIC 1V6EA 2WWZA 3IG3A 4AJYB 2HD5B 1E8YA 3VTUA 3ZNZB 4BKGA 4DHZB 2ZEQA 3PVLA 4K81A 1WGDA 4FA6A 4KVGB 1OQYA 2XBBC 3EECA 3I3TB 4LJPB 4W9GA 3PRMB
chains in the Genus database with same CATH superfamily
4GSWA 2N7EA 4OZAA 3VUXA 3Q2AC 1GB1A 3ZQ4A 2DZKA 1TS4A 1YIWA 4A9AA 1F2RC 2UWQA 3BWUD 2TSSA 1OEYJ 2MW5A 1YMHE 3RCZA 3BK2A 2KANA 1C9FA 1BMLC 2MBOA 3RFZB 2GBMA 3DCGA 1SF0A 2NBVB 4M00A 1L2NA 1FMAD 3BIID 2RR9A 4TUUA 4DK5A 3NVZA 3L16A 2DZIA 4G0NB 4C00A 1X1MA 3OG5A 4WWPA 3NVWA 3BVMA 1YJ1A 4KIKB 2K9XA 4HDOA 1NYQA 1BT0A 1E7PB 2OJWA 4G50A 3RNFC 1P7EA 4M8MA 3T8MA 1K53A 2MJDA 1Q5WB 1L0YB 2OHFA 4P16A 4P6VF 1V8CA 3KWLA 3U4EG 1J8CA 3AE9B 2QDFA 2C60A 1MG4A 3NOBA 2WDQB 3IXSA 2G9HD 3NZUA 4N9F4 4S0RA 1E9MA 2J42A 2EMTA 2INPE 5EE0A 1WRIA 2MA9B 3P4PB 2FIFA 2KWCA 3DVGX 1XLNA 3DVNU 2JX5A 2GOWA 2JYTA 4ZRQA 2LRWA 5AZFA 5H92C 3MJWA 2QMTA 4MGKE 2JZZA 2EKEC 2KQ4X 2REXA 3P4SB 2G4SA 2PMVA 2MCNB 2J52A 5BO4B 3AE6B 1CMXB 4W9IA 2PEAA 3A9KB 2JXXA 1J7BA 3UINB 2MJ3A 4USAA 2M1MA 2ZNVC 4ZDVA 4YXDB 2W3RA 1WZ0A 3RT3B 4G3XB 4XWTA 4IWQA 1YOVB 1YD8U 3HUIA 3QIJA 4NAWA 2DHZA 2O6VB 1R7SA 2NVUI 3AEAB 1ESFA 3LB8C 4IM2A 1NDDA 3N30A 4XX5A 3P4QB 2DYOA 4RGNA 1KJTA 3UF8A 2XN9C 1OFFA 2M8SA 2W3SA 2KKCA 5HI1A 3U7DA 3DWGC 4WQOB 3DHGC 4HDQA 3QX1A 2HTHA 2KLCA 3ZXVA 2UYZB 2C9WB 2J0KA 1F1HA 1L4ZB 3S2AA 2ZCBA 2K25A 1ZW7A 4PS3A 2DWQA 4ANVA 3R3MA 3ML8A 5DPRA 1WM3A 1XD3B 2OOBB 2ZW0A 1GOZA 3MFGA 3PREA 2KACA 2PE6B 1N5WA 1MJDA 2CJOA 1K50A 3AU4A 2MBBB 3DOWA 4FULA 2W54A 2CHZA 1WX7A 5BYQA 5JH5C 3URYA 3NHEB 2PJHA 1Y56A 4DQOC 2O6VA 2WX1A 3N9YC 1D6EC 3OJ3A 3NY5A 3BYYB 2V1YA 3ZNGC 1WGKA 5IO9A 3AV8A 4B6WA 5IA7A 1KFYB 3VXWA 1FCLA 3O13A 3AEFB 1KF6B 2V4LA 2Z0DB 4HXDA 3ZTCA 1R4NB 4KDLB 1DOIA 3QARA 2NS5A 2KC1A 3PTFC 3MC9A 2WXLA 2D10A 2LUEA 2N7DA 4WJOA 5CX3A 2N9EB 4MH8A 4C56C 1EF1A 3I5JC 2QILA 5D2MB 2D11A 2IO0B 1C78A 3EA6A 1WF9A 5D3IB 4EFOA 3TUOA 4B95A 3VTWA 2NPTB 4GDLA 1NBFC 1S3SG 4YSYB 1VR9A 4XC2A 2NCNA 2RD0A 3OLMD 2GI9A 3ZTDA 2DYMA 3RN9C 3ZDMC 1M4VA 5HKHA 2JWUA 2WP9B 2XK5B 3H9DA 3IAM1 3RULA 4EEWA 3W5UB 3H7SA 3AI5A 5J2RA 3N1ZC 3BK1A 2DENB 4F8CB 3ZJVA 3UI3A 2KMCA 3Q8FA 1Q1OA 2ZZPB 3AE3B 4L2YA 5AEKB 2CJNA 2BQQA 2BPSA 4MGIE 1UBQA 3R8BA 2W82A 1E10A 2CHXA 4NAMA 4EZJA 4MDKE 1L0VB 4K7UA 2DNFA 3N3KB 4CHKA 3BVGA 3CIRB 4ZYNA 2L0TA 3AM9A 1XLQA 1WIAA 2VH1A 1ZXIA 3UIOB 4RGTA 4P1CC 1Z2MA 1T0RC 5G5HA 1E6EB 3I9V1 1HXYD 2LZ6A 4QAYA 2A5UA 3TIXA 1FD6A 4ZRKA 2KX3A 4BOSC 2G1EA 2LWPA 2WXKA 4JWSC 2QJLA 3DBHB 5BYSA 4S17A 5TR5A 3KYCD 5EE3A 1NVID 1PQSA 3SFDB 4BAXA 2PVGC 2KXJA 1RFKA 2LJIA 4W9EA 2QSDA 4B0EA 4WJNA 3L0WB 1V1PA 3CSFA 2KDEB 2M56B 2QIEB 4W9HA 3P42A 4XGAB 4E3CA 1WI0A 4HRSA 5JHBA 5CHVC 1PUTA 2RSUA 1TY2A 2L76A 4JE3B 5LXHA 4M02A 1V5TA 4GB9A 2BT6A 1WX9A 4AOFA 4YTMB 1WXQA 4KX6B 2JUOA 1FIQA 3KVFB 1QOFA 1MPEA 3A33B 3LDZE 3L08A 2K8BA 3AULA 2SAKA 1VCBA 3KUCB 3UGBB 4TQ0A 3A4RA 1WYGA 4A3OA 4YWGG 2Y5BB 1SIFA 5L95C 3B1LX 4LNIA 5AZGA 4FBJB 3Q3OC 1YJJA 3AE2B 3RUIB 4NJ6A 2BS2B 4YTNB 5C23A 3HRDD 1V9JA 2FBWB 2ON8A 4ITKA 3TJPA 5FR3A 2N1WA 2GBRA 3DPDA 3P63A 4PS7A 1TZ1A 2BS3B 2WQYB 4DBGA 3GE3C 4I6PA 1UBIA 1CK1A 1IPGA 4AJYB 3ZNZB 4BKGA 1IGCA 1JRPA 2QCZA 1WGDA 4FA6A 2XBBC 3EECA 3HVZA 1JWUD 4LJPB 5EE9A 1WY8A 4KZ0A 3ZNHB 4AP4C 3TEWA 1QLBB 2KVRA 3WALA 3AMZA 3PGEA 3PRPB 2NTTA 1VRAB 3ZUNA 3TEYA 2WNMA 3FAHA 1GC6A 1K52A 3RNBC 1ZXHA 4WAAA 1GC7A 2JT4B 2WXPA 4FJYA 4PT5A 2J4XA 3AEBB 2OJRA 4A20A 3MP9A 1FO4A 4DHZE 1SJHD 2M0AA 5IOIA 3Q3NC 4WWMA 2L52A 2RGFA 2LASA 2R2OA 4WWOA 4ZRJA 2LGIA 1F9JA 2LFIA 2MP2B 1RFAA 3BYTB 1WGHA 2OEDA 3QHTA 4JPSA 1V86A 1IBXA 4IM3A 4DHJB 4LTUA 1A70A 1YX6B 3ZYYX 3A9JA 4FADA 3IT4B 2LEKA 4RH6A 1YN3A 2CU1A 2D3AA 3EHVA 5C1ZA 2L7RA 4KSLC 3CWIA 4XWWA 1TZOA 4LLGM 2KYWA 3ZIMA 2N0SB 4NJ7A 1VZ7A 2VZKB 3ZGZA 2AWTA 4TV3A 2GBNA 1I4RA 3C19A 1FNUA 1QOAA 4GIVA 1C76A 1YQ4B 3FC4A 4HJGE 3Q3JA 1CJEA 3PRZA 1FCCC 1V97A 5C3JB 1AARA 2V3NA 3ZXRA 3U52E 3OJ4B 1ISNA 2KLGA 3PV1A 4WH4A 1XCQL 2B3AA 1TS5A 2NTSA 2C7MB 4RF0A 4BBNF 5D7GA 4WJQA 1T6BX 1VD2A 2KN5A 3AE8B 2E3TA 3P1MA 2PE9A 2DYBA 4DWFA 1J19A 2SEBD 4XYCA 3FILA 4HEA1 3N1YC 2GLSA 3RYTA 1WR6E 3B2GA 4JX1C 2BGFA 3N32A 2AL6A 1I35A 1NEKB 3DBHI 1B9RA 1D3ZA 5DPWA 1E8WA 5BMGA 1AN8A 3WAOA 2KJRA 4CYEA 2JU6X 3LYYA 3LXFA 1EUVB 1RWSA 3QJZA 4HJKA 3KH0A 3M95A 1WMHA 2XEWA 1L7YA 1L6UA 1FNVA 2X38A 3AEEB 4C7YA 1UGMA 4NAWB 5IP4D 2VRRB 4US8A 2LHDA 3E9SA 2L32A 2YLMA 4NZLB 2FNJB 3AE7B 2O2VA 1YN4A 3GE8C 3R2IA 4NJCA 2Y5CA 4ACFA 2PW9A 3VAWA 2AQ1B 3Q8AA 3L10B 1QQRA 2WX0A 3ECIA 3PSEB 3IAS1 1T5XD 2HJ8A 1KTKA 5G2NA 2BVCA 1JRUA 3MC0B 3V61A 2NBWB 3H7PA 2WDVB 2RDBC 2N1VA 3DHHC 3NZSA 1UD7A 1C77A 1GB4A 1TKEA 3HVDA 4JGHB 1HTQA 1EO6A 4DDGD 1XT9B 4HKZE 4GN1A 3PPAA 2D3CA 1KOTA 1U4AA 3ZKJC 2KNBA 3VRBB 4HCPB 2CKHB 3A1QA 1JROA 1WH3A 3SD5A 1WGRA 4RM9A 3V60A 1H8CA 2HTME 3CMMB 1CZPA 3KLSX 2KO3A 3K9OB 4AS1A 4HPLB 1BXTA 3PHWB 3KYDD 3VRAB 1B1ZA 1T0QC 2JRIB 1GPXA 2J0MA 2KQ7A 4PYUA 4OHJA 2WYQA 1XEEA 3HHMA 3IT6B 1HZ5A 4W9JA 4BBNC 1HE8A 2GBKA 2KMMA 3WANA 2WHIA 4FN2A 3AXCA 4FXCA 1H4RA 4Q2JA 3CF6E 1MHHE 2AX5A 1FRRA 3Q69A 1WWTA 5G5GA 2KDIA 2L05A 2KQSA 1LM8B 3ZDTA 3ZO5B 4MSQB 1MHXA 4GDKA 2BYTA 4M0WA 1F0ZA 1WXSA 5T8IA 3SHQA 1FFVA 1VZ8A 2LGDA 4GDLB 4MELA 3AEDB 1KLGD 1SE9A 2MBHA 2LRUA 2PTLA 3L13A 1I4QA 3NUHB 4HPMB 3AEGB 3WAPA 4C80A 1OGWA 5H8YE 1FM0D 1V1OA 2L3ZA 4BKSD 2ZNVB 2KD0A 3MJ5A 2MH7A 3SEBA 2Z8LA 4KGSA 1VDVA 2M4NA 3GS2A 1JQ4A 3KW5B 4E74A 1YN5A 4GXBA 2C5LC 1R4MI 2K3UA 2WXNA 3I63C 1JCKB 2L1AA 3NG0A 1LXDA 1ZPSA 4WWNA 2D3BA 2MHJA 1L4DB 1UNSA 1EWCA 4MGZE 1C4AA 1NENB 3JYUA 1E8XA 4BZAA 1IUEA 1ROEA 1C79A 4ASWC 5JZEB 5C2TB 4DXFA 1IGDA 3DBSA 3DQVA 1LFDA 1C3TA 1OTRB 4FHKA 1FFUA 2Z59B 1TBEA 1AYFA 2JZPA 5MPOA 1MG8A 3KUZA 2BWFA 3ZRFA 4AUQC 1YNTE 2AQ3B 1JALA 2UU7A 2LUMA 1K51A 3VVWB 3AU5A 4A3PA 4L23A 4MEMA 4IWOA 4F1SA 5J18A 2C7NB 1L0XB 3LJ3A 1WJ4A 3RNGC 1YQBA 1NI3A 5AUKA 4A8XC 4DDID 2FE8A 1T0YA 2DBYA 2JF5A 2ZPNA 4WJPA 2G4DB 4H2AA 4KDIC 1V1PB 4EE2A 1OQYA 3I3TB 4ZYSA 1KRHA 4E71A 3PRMB 2G45B 3PHXB 4R3DA 5HHDG 3R2TA 3VR9B 3W5VB 2D07B 4EKUA 3NVVA 1PFDA 5IKCM 2EMSA 2FIDA 4LDTB 3M3JA 3APFA 2JQRB 2BBCA 3V05A 4RFBA 3K9PB 4YSXB 1D5MC 3WAMA 3GZNI 4G11A 3VUWA 4URKA 2R61A 3RZWC 3W1SC 3ZJUA 4D2KA 1WZ3A 4LCDE 4IW0A 4N59A 4TQ1A 1QZEA 4LNNA 1M94A 2JRHA 5AZHA 3IVFA 3M62B 2Z0EB 1F77A 1LO5D 2ICIA 2YEPF 2MRPA 4A90A 2IO2B 4OZCA 3IBEA 2CS4A 1V49A 2IYDB 2QC8A 4DHJD 1HZ6A 1F2RI 3U2SC 1N61A 1TYGB 4RMAA 1SBBB 4PK1A 4KZCA 2RDHA 2GRIA 3RNEC 5LNK1 4K3CA 1D5ZC 5G55A 1TIFA 1VJKA 2Q5WD 3QC8B 1VLBA 5LXIB 1V81A 2KVZA 3C0RB 2V3SA 1KLUD 2VZKD 4GGQA 1WXVA 3VUYA 2W55A 2I1KA 3SDLC 2BYVE 4W9KA 2FAZA 4OZBA 4HROA 3DBLI 4W9LA 1I4XA 2DAFA 2ZVNA 3QAQA 1RLFA 3APDA 4ICUA 1J0GA 4IUMB 2WDRB 1ZDVA 4DXGA 2IPKD 1P3QU 3NZ3A 3VFKA 4C4VA 4RF1A 3L4PA 3TEXA 2I2YA 1IBXB 4ZRPA 1WGYA 1I4GA 2KZRA 1EM7A 2K22A 3A9JB 5JXVA 4I6NB 3I57A 2ZVOA 5CHWA 3QWZB 2BTEA 2N4FA 1N60A 1J7CA 2DAJA 2BF8B 2ZPYA 1SJED 3VDZA 3TEZA 1ACCA 1KM7A 2KJHB 4I6LB 4ARCA 2KFKA 4IG7B 3V6CB 4HPPA 2KAJA 4XE0A 4BKTA 4JL9A 1L6VA 2MQJA 1ZUD2 1CQVA 1SIJA 1SE4A 3Q3MC 2Y5PA 4JLCA 2B76B 3V3XA 2BYFA 4BVUC 2IY1B 1TTNA 3JSVA 4HLEA 1XLOA 2C7HA 4MACA 4P1BC 2BB5A 1I4HA 2WXJA 2KDFB 3DVNV 1HA5A 1DYQA 3W1SA 1XO3A 4EOYA 4B0MA 5D3DA 2BWES 4YSZB 1QKZA 2ACZB 3EC8A 1WXAA 2AYOB 3U7ZA 2V9HA 1RAXA 2IGHA 2JWZA 5BYRA 2E6XA 2KN4A 4A6QA 2M0XA 4BFRA 5IAAC 2JZ3B 3FILB 3QQ8B 3GP7A 3FKYA 1MVKA 1C4PA 5FKAC 1WYWB 4HWIB 3AECB 4KKJA 1EU4A 1R4MB 1Z5SB 2DZJA 1V5OA 4NY0A 3ZLZA 3H1UA 4DXAB 3RI7C 4IWPA 5E6OA 2K39A 1QILA 5DPTA 3W2DA 1SXTA 3ABVB 1NYRA 2WDTB 1KH0A 5CHFA 5CTRC 1DOYA 4N6EB 1TY0A 2H88B 4IDIA 1WMHB 2NMQA 3KQ4A 2KK8A 2K8HA 4J3OD 3VH3B 4ANWA 1SE3A 4CQNA 3V62A 1UZXB 1GJZA 1BUIC 2WXIA 4MM3A 1N62A 4AJWA 2O6VD 3T3OA 4WIPA 5LLIA 1WM2A 2INDC 1QF6A 2BYEA 2O2VB 1QOBA 3P2BA 2FUG1 4FJVB 2INCC 1VZ6A 1FXTB 1V80A 1QOGA 2X8XX 2AQ2B 5HFYA 3RPFC 3EGRA 3T3NA 1FNWA 1UELA 5GXGB 1WSPA 4X57B 3ZW3A 3E56A 2KFJA 3H7PB 2YEPB 3GOEA 4FLHA 4FHJA 3PZDA 4MJSA 2PVOD 4K7WA 1XQQA 3L17A 4YT0B 3AE1B 1FXAA 1YX5B 3B08A 4OVVA 2LXAA 3VR8B 1TKYA 1LQBA 3AN1A 2CHWA 1I7HA 2V0GA 1I42A 1WGGA 4HKQA 3QCAA 2ZCCA 3H6NA 3A1QB 2D5GA 2KWUB 2KC2A 2D2QA 4A55A 4HCNB 3RNAC 4ANXA 3NVYA 3GZNB 3SR6A 2HJ1A 1ET9A 2HE7A 1WXMA 4W9FA 5FK9C 2MEKA 4LK0M 1DGJA 2BB6A 1GNUA 4P7IA 4BOZB 1C4CA 5D94A 3P4RB 4HVBA 1TGZB 3TL5A 1J7AA 4MGYE 2A4ZA 3WCQA 3A4SC 3IHPC 4JIOU 1HEZE 2Y3AA 2MJEA 4GDKB 2L0FA 4WAFA 2N9KA 2WXOA 2CR5A 3BZDB 5FR6A 4M0WB 1K8RB 5GMVA 2CU3A 1T0SC 2DLBA 2IJ0A 4TKNA 4JWUC 2JYEA 2LMCA 1ZP0B 5KHQA 4AWJA 1P9DU 2LI5A 2G3QB 1N6ZA 1P98A 1WJ6A 1PGAA 1UF0A 2DX5B 1E7VA 4KIKA 1WE6A 3DBLB 1JWAD 2WXRA 4W9DA 1P0RA 2FCMA 4M8NA 3CSTA 2KTRB 4NQLB 4GLSC 4RGMA 3RZFA 1WE7A 5E6NA 3R7RA 1T3QA 2WXQA 1V6EA 4TMAB 1E8YA 3PZ8A 3VTUA 4ZHOA 2ZEQA 3PVLA 4KVGB 4W9GA 1ZOYB 2FCSA 3TSSA 3MC8A 5DPSA 1RRBA 3HIZA 3D32A 1UUPA 4XDDA 3ETRA 3DBRI 4RCOA 4REZA 1E0ZA 2KOXA 2IO1B 2I38A 3WA0A 4OVZA 4LDTD 2J7QB 1TT5B 4JQWC 4N58A 4IOIE 1HTOA 2LGSA 4TSSA 4ZOHC 1WJUA 2IZVB 2MX2A 2PLPA 2WXHA 3A9KA 2JSVX 2IGGA 2KTFA 2MWSB 1PYWD 4II2B 2WU2B 1ZDXA 3OAWA 3ZVVA 4HK2A 5BMHA 2VH2A 2M19A 3V6EB 1IYFA 5E6PA 1ET6A 3NS1A 2N9PC 4B9KA 3Q8CA 3ONSA 3ML9A 1DOXA 1E7UA 4RNAA 4WQMA 4EZLA 2KTRA 2KHWB 4XDCA 1Q10A 2LVQA 2IGDA 1WRDB 2N7JA 1UWXA 4II3B 2WLBA 3GB1A 2K8CA 1UH6A 1ENFA 3JW0X 2EKIA 3DDCB 4PYZA 5TSSA 3UIPB 1PDXA 1PGXA 3U8ZA 1XF5L 1RYJA 2KT7A 2IO3B 3Q14C 2IY0B 2N9LA 5DCNA 1MFWA 2RMMA 2AEHA 2GBJA 3L54A 3Q3FA 3TCAA 2K0PA 3QK0A 2K1FA 1EU3A 3NJTA 2K6QA 4KV2A 2J53A 2KDBA 1G6JA 3IFWB 2JY6A 2QEJC 1XLPA 4IKGA 2LJ5A 3VH4B 1JW9D 2FUHB 1SB3C 2RPVA 2RDGA 3UQBA 4AQ7A 1OEYA 2MLBA 4ZHPA 1JMLA 4EZKA 2K6DB 5KHOA 5EE1A 3NS8A 2KMAA 2RPQA 4NPNA 2GB1A 3ZJTA 4NNJB 2LD9A 1FEHA 2D3GA 2QHOA 3EFUA 1ZE3D 3VQIA 4OW0A 2LVPA 1C1YB 3ZRCA 2FCQA 1UWMA 1TS3A 2ZJDA 2WXGA 2H89B 3W9CB 3X0WA 3M63B 4ARIA 3DWMA 1E8ZA 3HK0A 3AE5B 4YTPB 3KUDB 3MHZA 3N1XC 4MH0E 3H8HA 2NBUA 1ZGUB 2WU5B 1LGRA 2R2QA 3PO0A 1QT9A 4LNFA 3N20C 2V4IB 4K7SA 3EUB2 2PIAA 1ZKHA 2ASQA 4C4VB 2NPTA 3R66C 3VHTC 3PZ7A 2EELA 2GMIC 3B9JA 4KSKC 3KWVA 3PT2B 3TMPB 2LXCA 4ZRIA 2L8JA 3O65B 4ANUA 1FRDA 3APCA 3Q6BA 5BMIA 2XK5A 2KJ6A 1GUAB 1Y8RC 3DHIC 3W1YA 1XXGA 2I1JA 1WFYA 1EWYC 5L83A 1N63A 2JXTA 4F7ZA 1FXIA 4NQKE 2MBEA 3UQAA 1TS2A 2KFKB 3AH7A 1SE2A 2V3PA 2KWVB 2AL3A 2LGYA 4L1BA 4FJZA 5J17A 3T9LA 2W9NA 4GMVA 2WGSA 3U30A 1E90A 2L00B 3EFCA 3PLVA 3JSVB 3ENEA 2LVOA 2J0JA 4GU2A 3VTVA 2M17A 1OQQA 2IBIB 3BY4B 1GAQB 2BKFA 4EUTA 4MT5A 5EDSA 3TBLD 4UDUC 1JWSD 3Q8BA 4BKSA 2N9XA 2WXFA 3B0AA 1AWDA 2BW2A 4K3BA 3C8YA 4XZ4A 1N5XA 1A5RA 3MTNB 1F52A 4WURA 3BINA 1KLVA 1NI2A 4RM8A 1STEA 1E5WA 3AE4B 2XNAC 4LJOB 5D6JB 3NRZA 1FPYA 2JPHA 1TKGA 3SU8X 3RD2A 1SEBD 4LNKA 3ZNID 2YVCA 1P7FA 2BKRB 4OVUA 1P1AA 4KGTA 4MSMB 5AUIA 4KKIA 3PLUA 1YQ3B 2FCNA 3DBRB 4US9A 4CO7A 2INNE 4K1RB 1WR1A 1UGJA 3AB5A 3Q8EA 1XCTL 4MM3B 4PS8A 3RMKC 2KDMA 3OWEB 4YL8A 3DVGY 2K5PA 5HG2A 1R4NI 1EF5A 2L83A 3MHSD 5JHAA 2ZW1A 3WIMA 2KX0A 3PS6A 1SSNA 1RM6C 2WS3B 4LNOA 2IDYA 2WXMA 2NR2A 3HM3A 1WJNA 3R7QA 1JWBD 2MSED 4KGRA 3QA8A 2MBQA 3BVZA 4MJSB 1TJEA 2PKOA 5I4DA 1HQRD 1D5XC 3JVZX 4J6IA 1Q0WB 3RNCC 1D4BA 4W9CA 1PGBA 4IC7B 4C7ZA 1S1QB 2PPHA 1V2YA 4O1NA 3X23A 5E6JA 3SFEB 2DZMA 1WX8A 4GOCA 1SGHA 1GG3A 3J9CA 4IM0A 3ALBA 5IN7A 4RGOS 2KWDA 1IP9A 3HM6X 2BS4B 2MP2A 1YJIA 1I4PA 2ONQA 1AW7A 4M01A 2JVCA 1L5PA 4ICVA 3B2FA 2LGXA 2WWZA 3IG3A 1MI0A 2HD5B 4DHZB 2LHEA 1JWMD 4K81A 2HDEA 1OQRA
chains in the Genus database with same CATH topology
2G45B 3PHXB 4GSWA 2N7EA 3VUXA 2FCSA 2DZKA 1WY8A 5DPSA 1YIWA 1RRBA 4KZ0A 3ZNHB 4AP4C 2UWQA 3HIZA 2D07B 4EKUA 2KVRA 3WALA 3PGEA 3D32A 3PRPB 2EMSA 3DBRI 1OEYJ 2MW5A 2FIDA 4LDTB 2KOXA 2IO1B 3ZUNA 3WA0A 3M3JA 3APFA 3RCZA 4LDTD 2KANA 4E71A 3K9PB 1GC6A 2MBOA 2GBMA 2J7QB 3WAMA 3GZNI 3DCGA 4G11A 2NBVB 4JQWC 3VUWA 4URKA 1L2NA 4WAAA 1GC7A 2JT4B 3RZWC 3W1SC 4FJYA 1WZ3A 2RR9A 4LCDE 1WJUA 4TUUA 4IW0A 4DK5A 2IZVB 2OJRA 3L16A 2DZIA 4G0NB 4A20A 1X1MA 2MX2A 4TQ1A 1QZEA 3A9KA 4DHZE 4WWPA 2KTFA 1YJ1A 1M94A 2MWSB 4II2B 3OAWA 2JRHA 4KIKB 2RGFA 2LASA 2R2OA 4WWOA 4ZRJA 5AZHA 4HK2A 3IVFA 3M62B 4HDOA 2Z0EB 1F9JA 1BT0A 3V6EB 1IYFA 2MP2B 4AWJA 4G50A 5E6PA 2N9PC 4B9KA 3ONSA 4M8MA 3T8MA 1RFAA 1WGHA 3ML9A 1E7UA 4EZLA 1Q5WB 2MRPA 2IO2B 2KTRA 2KHWB 3QHTA 3IBEA 1V86A 2CS4A 4IM3A 4DHJB 2LVQA 1V49A 1WRDB 2IYDB 4II3B 1J8CA 4DHJD 1YX6B 2C60A 2K8CA 1UH6A 3A9JA 4FADA 3JW0X 4RMAA 3NOBA 3DDCB 4KZCA 4PYZA 3UIPB 2CU1A 3NZUA 3U8ZA 4N9F4 3EHVA 5G55A 5C1ZA 2IO3B 2L7RA 4KSLC 2EMTA 2MA9B 2IY0B 2FIFA 2KWCA 3QC8B 3ZIMA 3DVGX 1V81A 5LXIB 3C0RB 3DVNU 5DCNA 2AEHA 2GOWA 2V3SA 2GBJA 2LRWA 4NJ7A 3L54A 5AZFA 3Q3FA 3TCAA 2AWTA 3QK0A 2K1FA 4GGQA 4KV2A 2K6QA 3MJWA 4TV3A 1WXVA 4MGKE 3VUYA 2GBNA 2JZZA 2I1KA 2EKEC 3SDLC 2BYVE 2KDBA 4W9KA 2REXA 2FAZA 1G6JA 2G4SA 4GIVA 2MCNB 5BO4B 3IFWB 2JY6A 3DBLI 4W9LA 1CMXB 4W9IA 2PEAA 2LJ5A 3VH4B 3A9KB 2ZVNA 2DAFA 2JXXA 3QAQA 3UINB 3Q3JA 1RLFA 2FUHB 3APDA 3PRZA 4ICUA 1J0GA 2M1MA 3UQBA 2ZNVC 4IUMB 4ZDVA 1AARA 1OEYA 2MLBA 1P3QU 4EZKA 1WZ0A 3RT3B 2K6DB 4G3XB 3VFKA 3OJ4B 4IWQA 1ISNA 2KLGA 5KHOA 3PV1A 1YD8U 3NS8A 3QIJA 4NAWA 2DHZA 2O6VB 2NVUI 2B3AA 4IM2A 1NDDA 2KMAA 3N30A 4XX5A 1WGYA 2DYOA 2RPQA 4NPNA 4NNJB 2C7MB 2LD9A 4BBNF 5D7GA 2KZRA 3A9JB 4WJQA 4I6NB 1KJTA 2D3GA 3UF8A 1VD2A 2QHOA 2M8SA 2ZVOA 3EFUA 2KN5A 2KKCA 3VQIA 5CHWA 3QWZB 3U7DA 2PE9A 2LVPA 4WQOB 2N4FA 1C1YB 2DYBA 3ZRCA 4DWFA 4HDQA 2FCQA 3QX1A 2HTHA 2KLCA 1J19A 2ZJDA 2DAJA 2BF8B 2UYZB 2C9WB 2J0KA 3X0WA 2ZPYA 3M63B 3VDZA 3S2AA 1E8ZA 1KM7A 2ZCBA 2KJHB 3HK0A 4I6LB 2KFKA 4IG7B 2K25A 1ZW7A 4PS3A 3V6CB 3KUDB 4ANVA 3RYTA 4MH0E 3R3MA 3ML8A 5DPRA 1WM3A 1WR6E 1XD3B 2NBUA 2OOBB 4BKTA 1ZGUB 4JL9A 2MQJA 3PREA 2BGFA 2PE6B 2R2QA 3N32A 2AL6A 1I35A 3DBHI 1D3ZA 3AU4A 5DPWA 1E8WA 2MBBB 4JLCA 2BYFA 4BVUC 3DOWA 4FULA 3WAOA 2IY1B 4K7SA 2KJRA 1TTNA 4CYEA 3JSVA 4HLEA 2CHZA 1WX7A 2C7HA 5JH5C 1EUVB 3QJZA 4HJKA 3KH0A 3M95A 1WMHA 2XEWA 1L7YA 1ZKHA 3NHEB 4TQ0A 2ASQA 2PJHA 2NPTA 3R66C 3VHTC 1UGMA 2KDFB 3DVNV 4NAWB 3W1SA 2GMIC 4EOYA 4KSKC 2O6VA 2WX1A 2VRRB 2BWES 3OJ3A 3PT2B 3NY5A 3TMPB 2LXCA 2YLMA 4ZRIA 2L8JA 2V1YA 3O65B 3ZNGC 2FNJB 4ANUA 3APCA 3EC8A 2O2VA 2XK5A 2KJ6A 4B6WA 1GUAB 1WXAA 2AYOB 1Y8RC 5IA7A 3W1YA 3VXWA 2I1JA 3VAWA 1RAXA 2JWZA 3L10B 1WFYA 2V4LA 2Z0DB 3ECIA 2WX0A 3PSEB 4HXDA 3ZTCA 4F7ZA 5L83A 4KDLB 2HJ8A 2M0XA 3QARA 2MBEA 4NQKE 5G2NA 5IAAC 2NS5A 4BFRA 2JZ3B 1JRUA 3UQAA 2KFKB 3QQ8B 2KC1A 3PTFC 1WYWB 4HWIB 3V61A 2D10A 2LUEA 2NBWB 2N7DA 4WJOA 2KWVB 2AL3A 3H7PA 1Z5SB 2DZJA 2LGYA 1V5OA 5CX3A 4NY0A 4FJZA 3H1UA 3ZLZA 4DXAB 5J17A 2N1VA 3NZSA 4IWPA 5E6OA 3T9LA 2K39A 2W9NA 2N9EB 1UD7A 5DPTA 4GMVA 1EF1A 3U30A 5D2MB 1E90A 2L00B 2WDTB 4JGHB 5CHFA 5CTRC 2D11A 1EO6A 4DDGD 3PLVA 1XT9B 3JSVB 2IO0B 3ENEA 4GN1A 3PPAA 1WMHB 2LVOA 1KOTA 1WF9A 1U4AA 2KK8A 2J0JA 2K8HA 4EFOA 4B95A 3ZKJC 2KNBA 4GU2A 3VTVA 2M17A 3VH3B 3VTWA 4ANWA 2NPTB 4GDLA 4HCPB 3V62A 2IBIB 2CKHB 3A1QA 1NBFC 1S3SG 2BKFA 3BY4B 4EUTA 1UZXB 1GJZA 1WH3A 3SD5A 1WGRA 4RM9A 5EDSA 4XC2A 2NCNA 4MM3A 2RD0A 3OLMD 3TBLD 3V60A 3ZTDA 1H8CA 2DYMA 4AJWA 2O6VD 3CMMB 4BKSA 2N9XA 3ZDMC 2KO3A 5LLIA 3B0AA 1WM2A 3K9OB 4HPLB 5HKHA 3PHWB 2BYEA 2O2VB 3KYDD 3P2BA 2XK5B 3H9DA 4XZ4A 3RULA 4FJVB 4EEWA 1A5RA 1FXTB 1V80A 2JRIB 2J0MA 2KQ7A 4PYUA 3H7SA 3MTNB 3AI5A 2WYQA 5J2RA 2DENB 3HHMA 4F8CB 3BINA 1KLVA 1NI2A 2KMCA 1Q1OA 1UELA 4RM8A 4W9JA 1E5WA 2ZZPB 4BBNC 5AEKB 2BPSA 4MGIE 1HE8A 1UBQA 4X57B 3ZW3A 4LJOB 2GBKA 2CHXA 5D6JB 2KFJA 3WANA 4FN2A 3AXCA 3ZVVA 4EZJA 1H4RA 3H7PB 2JPHA 4MDKE 3CF6E 3GOEA 3SU8X 4FLHA 4K7UA 4FHJA 3PZDA 2KDIA 4MJSA 3N3KB 2L05A 4K7WA 2KQSA 1LM8B 3ZDTA 1XQQA 3L17A 4MSQB 3RD2A 3ZO5B 4CHKA 4ZYNA 2L0TA 3ZNID 1YX5B 1WIAA 3B08A 4GDKA 4OVVA 2YVCA 2LXAA 1LQBA 2BKRB 3UIOB 2CHWA 4OVUA 1WXSA 1Z2MA 1P1AA 1I42A 1WGGA 4MSMB 3QCAA 3SHQA 2ZCCA 2LGDA 3H6NA 4GDLB 3A1QB 3PLUA 4MELA 2FCNA 4CO7A 4K1RB 1SE9A 1WR1A 2MBHA 2KWUB 2LZ6A 2LRUA 2KC2A 2D2QA 3L13A 4PS8A 4HCNB 3WAPA 4HPMB 2A5UA 3TIXA 4YL8A 4ZRKA 3DVGY 4ANXA 1OGWA 2KX3A 4BOSC 2L3ZA 2LWPA 4BKSD 2ZNVB 2KD0A 1R4NI 1EF5A 5TR5A 3KYCD 3MHSD 2HE7A 1WXMA 4W9FA 5JHAA 1PQSA 3WIMA 2KX0A 2M4NA 2KXJA 3KW5B 3PS6A 4E74A 4GXBA 2C5LC 1R4MI 4W9EA 1GNUA 4P7IA 4BOZB 4WJNA 1LXDA 2NR2A 3HM3A 3L0WB 4WWNA 1WJNA 3R7QA 5D94A 3CSFA 2KDEB 4W9HA 4E3CA 1WI0A 4MGZE 4HVBA 1TGZB 2MSED 5JHBA 3JYUA 5CHVC 3TL5A 2RSUA 1E8XA 3QA8A 2MBQA 2L76A 4MGYE 2A4ZA 4MJSB 4ASWC 3A4SC 3IHPC 4JIOU 5LXHA 5JZEB 1V5TA 4GDKB 2L0FA 4GB9A 3DBSA 3JVZX 3DQVA 1WX9A 4AOFA 2CR5A 1Q0WB 4J6IA 5FR6A 4W9CA 4M0WB 1LFDA 1C3TA 1K8RB 5GMVA 2JUOA 1OTRB 4FHKA 4IC7B 1S1QB 2PPHA 2Z59B 1TBEA 3KVFB 1V2YA 4TKNA 3A33B 3X23A 3LDZE 3L08A 2K8BA 3AULA 5KHQA 1MG8A 1VCBA 2DZMA 1WX8A 2BWFA 3KUZA 3KUCB 3A4RA 3UGBB 1P9DU 3ZRFA 4AUQC 4A3OA 2LI5A 4GOCA 2Y5BB 1SGHA 1GG3A 2G3QB 1SIFA 5L95C 1P98A 3B1LX 1WJ6A 4IM0A 3ALBA 5AZGA 4FBJB 3VVWB 3AU5A 2DX5B 4A3PA 1E7VA 3RUIB 4KIKA 4NJ6A 4MEMA 5C23A 1WE6A 1V9JA 4IWOA 4W9DA 4F1SA 5J18A 1IP9A 3TJPA 2C7NB 3LJ3A 3HM6X 1WJ4A 2MP2A 2N1WA 1P0RA 2FCMA 4M8NA 1YQBA 2GBRA 3CSTA 3DPDA 4PS7A 1TZ1A 2KTRB 4NQLB 4DDID 4DBGA 2JVCA 3RZFA 1T0YA 4I6PA 2JF5A 1WE7A 2ZPNA 4WJPA 4ICVA 5E6NA 3R7RA 2G4DB 1UBIA 2LGXA 1IPGA 4KDIC 1V6EA 2WWZA 3IG3A 4AJYB 2HD5B 1E8YA 3VTUA 3ZNZB 4BKGA 4DHZB 2ZEQA 3PVLA 4K81A 1WGDA 4FA6A 4KVGB 1OQYA 2XBBC 3EECA 3I3TB 4LJPB 4W9GA 3PRMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G45 B;  3PHX B;  4GSW A;  2N7E A;  3VUX A;  2FCS A;  2DZK A;  1WY8 A;  5DPS A;  1YIW A;  1RRB A;  4KZ0 A;  3ZNH B;  4AP4 C;  2UWQ A;  3HIZ A;  2D07 B;  4EKU A;  2KVR A;  3WAL A;  3PGE A;  3D32 A;  3PRP B;  2EMS A;  3DBR I;  1OEY J;  2MW5 A;  2FID A;  4LDT B;  2KOX A;  2IO1 B;  3ZUN A;  3WA0 A;  3M3J A;  3APF A;  3RCZ A;  4LDT D;  2KAN A;  4E71 A;  3K9P B;  1GC6 A;  2MBO A;  2GBM A;  2J7Q B;  3WAM A;  3GZN I;  3DCG A;  4G11 A;  2NBV B;  4JQW C;  3VUW A;  4URK A;  1L2N A;  4WAA A;  1GC7 A;  2JT4 B;  3RZW C;  3W1S C;  4FJY A;  1WZ3 A;  2RR9 A;  4LCD E;  1WJU A;  4TUU A;  4IW0 A;  4DK5 A;  2IZV B;  2OJR A;  3L16 A;  2DZI A;  4G0N B;  4A20 A;  1X1M A;  2MX2 A;  4TQ1 A;  1QZE A;  3A9K A;  4DHZ E;  4WWP A;  2KTF A;  1YJ1 A;  1M94 A;  2MWS B;  4II2 B;  3OAW A;  2JRH A;  4KIK B;  2RGF A;  2LAS A;  2R2O A;  4WWO A;  4ZRJ A;  5AZH A;  4HK2 A;  3IVF A;  3M62 B;  4HDO A;  2Z0E B;  1F9J A;  1BT0 A;  3V6E B;  1IYF A;  2MP2 B;  4AWJ A;  4G50 A;  5E6P A;  2N9P C;  4B9K A;  3ONS A;  4M8M A;  3T8M A;  1RFA A;  1WGH A;  3ML9 A;  1E7U A;  4EZL A;  1Q5W B;  2MRP A;  2IO2 B;  2KTR A;  2KHW B;  3QHT A;  3IBE A;  1V86 A;  2CS4 A;  4IM3 A;  4DHJ B;  2LVQ A;  1V49 A;  1WRD B;  2IYD B;  4II3 B;  1J8C A;  4DHJ D;  1YX6 B;  2C60 A;  2K8C A;  1UH6 A;  3A9J A;  4FAD A;  3JW0 X;  4RMA A;  3NOB A;  3DDC B;  4KZC A;  4PYZ A;  3UIP B;  2CU1 A;  3NZU A;  3U8Z A;  4N9F 4;  3EHV A;  5G55 A;  5C1Z A;  2IO3 B;  2L7R A;  4KSL C;  2EMT A;  2MA9 B;  2IY0 B;  2FIF A;  2KWC A;  3QC8 B;  3ZIM A;  3DVG X;  1V81 A;  5LXI B;  3C0R B;  3DVN U;  5DCN A;  2AEH A;  2GOW A;  2V3S A;  2GBJ A;  2LRW A;  4NJ7 A;  3L54 A;  5AZF A;  3Q3F A;  3TCA A;  2AWT A;  3QK0 A;  2K1F A;  4GGQ A;  4KV2 A;  2K6Q A;  3MJW A;  4TV3 A;  1WXV A;  4MGK E;  3VUY A;  2GBN A;  2JZZ A;  2I1K A;  2EKE C;  3SDL C;  2BYV E;  2KDB A;  4W9K A;  2REX A;  2FAZ A;  1G6J A;  2G4S A;  4GIV A;  2MCN B;  5BO4 B;  3IFW B;  2JY6 A;  3DBL I;  4W9L A;  1CMX B;  4W9I A;  2PEA A;  2LJ5 A;  3VH4 B;  3A9K B;  2ZVN A;  2DAF A;  2JXX A;  3QAQ A;  3UIN B;  3Q3J A;  1RLF A;  2FUH B;  3APD A;  3PRZ A;  4ICU A;  1J0G A;  2M1M A;  3UQB A;  2ZNV C;  4IUM B;  4ZDV A;  1AAR A;  1OEY A;  2MLB A;  1P3Q U;  4EZK A;  1WZ0 A;  3RT3 B;  2K6D B;  4G3X B;  3VFK A;  3OJ4 B;  4IWQ A;  1ISN A;  2KLG A;  5KHO A;  3PV1 A;  1YD8 U;  3NS8 A;  3QIJ A;  4NAW A;  2DHZ A;  2O6V B;  2NVU I;  2B3A A;  4IM2 A;  1NDD A;  2KMA A;  3N30 A;  4XX5 A;  1WGY A;  2DYO A;  2RPQ A;  4NPN A;  4NNJ B;  2C7M B;  2LD9 A;  4BBN F;  5D7G A;  2KZR A;  3A9J B;  4WJQ A;  4I6N B;  1KJT A;  2D3G A;  3UF8 A;  1VD2 A;  2QHO A;  2M8S A;  2ZVO A;  3EFU A;  2KN5 A;  2KKC A;  3VQI A;  5CHW A;  3QWZ B;  3U7D A;  2PE9 A;  2LVP A;  4WQO B;  2N4F A;  1C1Y B;  2DYB A;  3ZRC A;  4DWF A;  4HDQ A;  2FCQ A;  3QX1 A;  2HTH A;  2KLC A;  1J19 A;  2ZJD A;  2DAJ A;  2BF8 B;  2UYZ B;  2C9W B;  2J0K A;  3X0W A;  2ZPY A;  3M63 B;  3VDZ A;  3S2A A;  1E8Z A;  1KM7 A;  2ZCB A;  2KJH B;  3HK0 A;  4I6L B;  2KFK A;  4IG7 B;  2K25 A;  1ZW7 A;  4PS3 A;  3V6C B;  3KUD B;  4ANV A;  3RYT A;  4MH0 E;  3R3M A;  3ML8 A;  5DPR A;  1WM3 A;  1WR6 E;  1XD3 B;  2NBU A;  2OOB B;  4BKT A;  1ZGU B;  4JL9 A;  2MQJ A;  3PRE A;  2BGF A;  2PE6 B;  2R2Q A;  3N32 A;  2AL6 A;  1I35 A;  3DBH I;  1D3Z A;  3AU4 A;  5DPW A;  1E8W A;  2MBB B;  4JLC A;  2BYF A;  4BVU C;  3DOW A;  4FUL A;  3WAO A;  2IY1 B;  4K7S A;  2KJR A;  1TTN A;  4CYE A;  3JSV A;  4HLE A;  2CHZ A;  1WX7 A;  2C7H A;  5JH5 C;  1EUV B;  3QJZ A;  4HJK A;  3KH0 A;  3M95 A;  1WMH A;  2XEW A;  1L7Y A;  1ZKH A;  3NHE B;  4TQ0 A;  2ASQ A;  2PJH A;  2NPT A;  3R66 C;  3VHT C;  1UGM A;  2KDF B;  3DVN V;  4NAW B;  3W1S A;  2GMI C;  4EOY A;  4KSK C;  2O6V A;  2WX1 A;  2VRR B;  2BWE S;  3OJ3 A;  3PT2 B;  3NY5 A;  3TMP B;  2LXC A;  2YLM A;  4ZRI A;  2L8J A;  2V1Y A;  3O65 B;  3ZNG C;  2FNJ B;  4ANU A;  3APC A;  3EC8 A;  2O2V A;  2XK5 A;  2KJ6 A;  4B6W A;  1GUA B;  1WXA A;  2AYO B;  1Y8R C;  5IA7 A;  3W1Y A;  3VXW A;  2I1J A;  3VAW A;  1RAX A;  2JWZ A;  3L10 B;  1WFY A;  2V4L A;  2Z0D B;  3ECI A;  2WX0 A;  3PSE B;  4HXD A;  3ZTC A;  4F7Z A;  5L83 A;  4KDL B;  2HJ8 A;  2M0X A;  3QAR A;  2MBE A;  4NQK E;  5G2N A;  5IAA C;  2NS5 A;  4BFR A;  2JZ3 B;  1JRU A;  3UQA A;  2KFK B;  3QQ8 B;  2KC1 A;  3PTF C;  1WYW B;  4HWI B;  3V61 A;  2D10 A;  2LUE A;  2NBW B;  2N7D A;  4WJO A;  2KWV B;  2AL3 A;  3H7P A;  1Z5S B;  2DZJ A;  2LGY A;  1V5O A;  5CX3 A;  4NY0 A;  4FJZ A;  3H1U A;  3ZLZ A;  4DXA B;  5J17 A;  2N1V A;  3NZS A;  4IWP A;  5E6O A;  3T9L A;  2K39 A;  2W9N A;  2N9E B;  1UD7 A;  5DPT A;  4GMV A;  1EF1 A;  3U30 A;  5D2M B;  1E90 A;  2L00 B;  2WDT B;  4JGH B;  5CHF A;  5CTR C;  2D11 A;  1EO6 A;  4DDG D;  3PLV A;  1XT9 B;  3JSV B;  2IO0 B;  3ENE A;  4GN1 A;  3PPA A;  1WMH B;  2LVO A;  1KOT A;  1WF9 A;  1U4A A;  2KK8 A;  2J0J A;  2K8H A;  4EFO A;  4B95 A;  3ZKJ C;  2KNB A;  4GU2 A;  3VTV A;  2M17 A;  3VH3 B;  3VTW A;  4ANW A;  2NPT B;  4GDL A;  4HCP B;  3V62 A;  2IBI B;  2CKH B;  3A1Q A;  1NBF C;  1S3S G;  2BKF A;  3BY4 B;  4EUT A;  1UZX B;  1GJZ A;  1WH3 A;  3SD5 A;  1WGR A;  4RM9 A;  5EDS A;  4XC2 A;  2NCN A;  4MM3 A;  2RD0 A;  3OLM D;  3TBL D;  3V60 A;  3ZTD A;  1H8C A;  2DYM A;  4AJW A;  2O6V D;  3CMM B;  4BKS A;  2N9X A;  3ZDM C;  2KO3 A;  5LLI A;  3B0A A;  1WM2 A;  3K9O B;  4HPL B;  5HKH A;  3PHW B;  2BYE A;  2O2V B;  3KYD D;  3P2B A;  2XK5 B;  3H9D A;  4XZ4 A;  3RUL A;  4FJV B;  4EEW A;  1A5R A;  1FXT B;  1V80 A;  2JRI B;  2J0M A;  2KQ7 A;  4PYU A;  3H7S A;  3MTN B;  3AI5 A;  2WYQ A;  5J2R A;  2DEN B;  3HHM A;  4F8C B;  3BIN A;  1KLV A;  1NI2 A;  2KMC A;  1Q1O A;  1UEL A;  4RM8 A;  4W9J A;  1E5W A;  2ZZP B;  4BBN C;  5AEK B;  2BPS A;  4MGI E;  1HE8 A;  1UBQ A;  4X57 B;  3ZW3 A;  4LJO B;  2GBK A;  2CHX A;  5D6J B;  2KFJ A;  3WAN A;  4FN2 A;  3AXC A;  3ZVV A;  4EZJ A;  1H4R A;  3H7P B;  2JPH A;  4MDK E;  3CF6 E;  3GOE A;  3SU8 X;  4FLH A;  4K7U A;  4FHJ A;  3PZD A;  2KDI A;  4MJS A;  3N3K B;  2L05 A;  4K7W A;  2KQS A;  1LM8 B;  3ZDT A;  1XQQ A;  3L17 A;  4MSQ B;  3RD2 A;  3ZO5 B;  4CHK A;  4ZYN A;  2L0T A;  3ZNI D;  1YX5 B;  1WIA A;  3B08 A;  4GDK A;  4OVV A;  2YVC A;  2LXA A;  1LQB A;  2BKR B;  3UIO B;  2CHW A;  4OVU A;  1WXS A;  1Z2M A;  1P1A A;  1I42 A;  1WGG A;  4MSM B;  3QCA A;  3SHQ A;  2ZCC A;  2LGD A;  3H6N A;  4GDL B;  3A1Q B;  3PLU A;  4MEL A;  2FCN A;  4CO7 A;  4K1R B;  1SE9 A;  1WR1 A;  2MBH A;  2KWU B;  2LZ6 A;  2LRU A;  2KC2 A;  2D2Q A;  3L13 A;  4PS8 A;  4HCN B;  3WAP A;  4HPM B;  2A5U A;  3TIX A;  4YL8 A;  4ZRK A;  3DVG Y;  4ANX A;  1OGW A;  2KX3 A;  4BOS C;  2L3Z A;  2LWP A;  4BKS D;  2ZNV B;  2KD0 A;  1R4N I;  1EF5 A;  5TR5 A;  3KYC D;  3MHS D;  2HE7 A;  1WXM A;  4W9F A;  5JHA A;  1PQS A;  3WIM A;  2KX0 A;  2M4N A;  2KXJ A;  3KW5 B;  3PS6 A;  4E74 A;  4GXB A;  2C5L C;  1R4M I;  4W9E A;  1GNU A;  4P7I A;  4BOZ B;  4WJN A;  1LXD A;  2NR2 A;  3HM3 A;  3L0W B;  4WWN A;  1WJN A;  3R7Q A;  5D94 A;  3CSF A;  2KDE B;  4W9H A;  4E3C A;  1WI0 A;  4MGZ E;  4HVB A;  1TGZ B;  2MSE D;  5JHB A;  3JYU A;  5CHV C;  3TL5 A;  2RSU A;  1E8X A;  3QA8 A;  2MBQ A;  2L76 A;  4MGY E;  2A4Z A;  4MJS B;  4ASW C;  3A4S C;  3IHP C;  4JIO U;  5LXH A;  5JZE B;  1V5T A;  4GDK B;  2L0F A;  4GB9 A;  3DBS A;  3JVZ X;  3DQV A;  1WX9 A;  4AOF A;  2CR5 A;  1Q0W B;  4J6I A;  5FR6 A;  4W9C A;  4M0W B;  1LFD A;  1C3T A;  1K8R B;  5GMV A;  2JUO A;  1OTR B;  4FHK A;  4IC7 B;  1S1Q B;  2PPH A;  2Z59 B;  1TBE A;  3KVF B;  1V2Y A;  4TKN A;  3A33 B;  3X23 A;  3LDZ E;  3L08 A;  2K8B A;  3AUL A;  5KHQ A;  1MG8 A;  1VCB A;  2DZM A;  1WX8 A;  2BWF A;  3KUZ A;  3KUC B;  3A4R A;  3UGB B;  1P9D U;  3ZRF A;  4AUQ C;  4A3O A;  2LI5 A;  4GOC A;  2Y5B B;  1SGH A;  1GG3 A;  2G3Q B;  1SIF A;  5L95 C;  1P98 A;  3B1L X;  1WJ6 A;  4IM0 A;  3ALB A;  5AZG A;  4FBJ B;  3VVW B;  3AU5 A;  2DX5 B;  4A3P A;  1E7V A;  3RUI B;  4KIK A;  4NJ6 A;  4MEM A;  5C23 A;  1WE6 A;  1V9J A;  4IWO A;  4W9D A;  4F1S A;  5J18 A;  1IP9 A;  3TJP A;  2C7N B;  3LJ3 A;  3HM6 X;  1WJ4 A;  2MP2 A;  2N1W A;  1P0R A;  2FCM A;  4M8N A;  1YQB A;  2GBR A;  3CST A;  3DPD A;  4PS7 A;  1TZ1 A;  2KTR B;  4NQL B;  4DDI D;  4DBG A;  2JVC A;  3RZF A;  1T0Y A;  4I6P A;  2JF5 A;  1WE7 A;  2ZPN A;  4WJP A;  4ICV A;  5E6N A;  3R7R A;  2G4D B;  1UBI A;  2LGX A;  1IPG A;  4KDI C;  1V6E A;  2WWZ A;  3IG3 A;  4AJY B;  2HD5 B;  1E8Y A;  3VTU A;  3ZNZ B;  4BKG A;  4DHZ B;  2ZEQ A;  3PVL A;  4K81 A;  1WGD A;  4FA6 A;  4KVG B;  1OQY A;  2XBB C;  3EEC A;  3I3T B;  4LJP B;  4W9G A;  3PRM B; 
#chains in the Genus database with same CATH topology
 4GSW A;  2N7E A;  4OZA A;  3VUX A;  3Q2A C;  1GB1 A;  3ZQ4 A;  2DZK A;  1TS4 A;  1YIW A;  4A9A A;  1F2R C;  2UWQ A;  3BWU D;  2TSS A;  1OEY J;  2MW5 A;  1YMH E;  3RCZ A;  3BK2 A;  2KAN A;  1C9F A;  1BML C;  2MBO A;  3RFZ B;  2GBM A;  3DCG A;  1SF0 A;  2NBV B;  4M00 A;  1L2N A;  1FMA D;  3BII D;  2RR9 A;  4TUU A;  4DK5 A;  3NVZ A;  3L16 A;  2DZI A;  4G0N B;  4C00 A;  1X1M A;  3OG5 A;  4WWP A;  3NVW A;  3BVM A;  1YJ1 A;  4KIK B;  2K9X A;  4HDO A;  1NYQ A;  1BT0 A;  1E7P B;  2OJW A;  4G50 A;  3RNF C;  1P7E A;  4M8M A;  3T8M A;  1K53 A;  2MJD A;  1Q5W B;  1L0Y B;  2OHF A;  4P16 A;  4P6V F;  1V8C A;  3KWL A;  3U4E G;  1J8C A;  3AE9 B;  2QDF A;  2C60 A;  1MG4 A;  3NOB A;  2WDQ B;  3IXS A;  2G9H D;  3NZU A;  4N9F 4;  4S0R A;  1E9M A;  2J42 A;  2EMT A;  2INP E;  5EE0 A;  1WRI A;  2MA9 B;  3P4P B;  2FIF A;  2KWC A;  3DVG X;  1XLN A;  3DVN U;  2JX5 A;  2GOW A;  2JYT A;  4ZRQ A;  2LRW A;  5AZF A;  5H92 C;  3MJW A;  2QMT A;  4MGK E;  2JZZ A;  2EKE C;  2KQ4 X;  2REX A;  3P4S B;  2G4S A;  2PMV A;  2MCN B;  2J52 A;  5BO4 B;  3AE6 B;  1CMX B;  4W9I A;  2PEA A;  3A9K B;  2JXX A;  1J7B A;  3UIN B;  2MJ3 A;  4USA A;  2M1M A;  2ZNV C;  4ZDV A;  4YXD B;  2W3R A;  1WZ0 A;  3RT3 B;  4G3X B;  4XWT A;  4IWQ A;  1YOV B;  1YD8 U;  3HUI A;  3QIJ A;  4NAW A;  2DHZ A;  2O6V B;  1R7S A;  2NVU I;  3AEA B;  1ESF A;  3LB8 C;  4IM2 A;  1NDD A;  3N30 A;  4XX5 A;  3P4Q B;  2DYO A;  4RGN A;  1KJT A;  3UF8 A;  2XN9 C;  1OFF A;  2M8S A;  2W3S A;  2KKC A;  5HI1 A;  3U7D A;  3DWG C;  4WQO B;  3DHG C;  4HDQ A;  3QX1 A;  2HTH A;  2KLC A;  3ZXV A;  2UYZ B;  2C9W B;  2J0K A;  1F1H A;  1L4Z B;  3S2A A;  2ZCB A;  2K25 A;  1ZW7 A;  4PS3 A;  2DWQ A;  4ANV A;  3R3M A;  3ML8 A;  5DPR A;  1WM3 A;  1XD3 B;  2OOB B;  2ZW0 A;  1GOZ A;  3MFG A;  3PRE A;  2KAC A;  2PE6 B;  1N5W A;  1MJD A;  2CJO A;  1K50 A;  3AU4 A;  2MBB B;  3DOW A;  4FUL A;  2W54 A;  2CHZ A;  1WX7 A;  5BYQ A;  5JH5 C;  3URY A;  3NHE B;  2PJH A;  1Y56 A;  4DQO C;  2O6V A;  2WX1 A;  3N9Y C;  1D6E C;  3OJ3 A;  3NY5 A;  3BYY B;  2V1Y A;  3ZNG C;  1WGK A;  5IO9 A;  3AV8 A;  4B6W A;  5IA7 A;  1KFY B;  3VXW A;  1FCL A;  3O13 A;  3AEF B;  1KF6 B;  2V4L A;  2Z0D B;  4HXD A;  3ZTC A;  1R4N B;  4KDL B;  1DOI A;  3QAR A;  2NS5 A;  2KC1 A;  3PTF C;  3MC9 A;  2WXL A;  2D10 A;  2LUE A;  2N7D A;  4WJO A;  5CX3 A;  2N9E B;  4MH8 A;  4C56 C;  1EF1 A;  3I5J C;  2QIL A;  5D2M B;  2D11 A;  2IO0 B;  1C78 A;  3EA6 A;  1WF9 A;  5D3I B;  4EFO A;  3TUO A;  4B95 A;  3VTW A;  2NPT B;  4GDL A;  1NBF C;  1S3S G;  4YSY B;  1VR9 A;  4XC2 A;  2NCN A;  2RD0 A;  3OLM D;  2GI9 A;  3ZTD A;  2DYM A;  3RN9 C;  3ZDM C;  1M4V A;  5HKH A;  2JWU A;  2WP9 B;  2XK5 B;  3H9D A;  3IAM 1;  3RUL A;  4EEW A;  3W5U B;  3H7S A;  3AI5 A;  5J2R A;  3N1Z C;  3BK1 A;  2DEN B;  4F8C B;  3ZJV A;  3UI3 A;  2KMC A;  3Q8F A;  1Q1O A;  2ZZP B;  3AE3 B;  4L2Y A;  5AEK B;  2CJN A;  2BQQ A;  2BPS A;  4MGI E;  1UBQ A;  3R8B A;  2W82 A;  1E10 A;  2CHX A;  4NAM A;  4EZJ A;  4MDK E;  1L0V B;  4K7U A;  2DNF A;  3N3K B;  4CHK A;  3BVG A;  3CIR B;  4ZYN A;  2L0T A;  3AM9 A;  1XLQ A;  1WIA A;  2VH1 A;  1ZXI A;  3UIO B;  4RGT A;  4P1C C;  1Z2M A;  1T0R C;  5G5H A;  1E6E B;  3I9V 1;  1HXY D;  2LZ6 A;  4QAY A;  2A5U A;  3TIX A;  1FD6 A;  4ZRK A;  2KX3 A;  4BOS C;  2G1E A;  2LWP A;  2WXK A;  4JWS C;  2QJL A;  3DBH B;  5BYS A;  4S17 A;  5TR5 A;  3KYC D;  5EE3 A;  1NVI D;  1PQS A;  3SFD B;  4BAX A;  2PVG C;  2KXJ A;  1RFK A;  2LJI A;  4W9E A;  2QSD A;  4B0E A;  4WJN A;  3L0W B;  1V1P A;  3CSF A;  2KDE B;  2M56 B;  2QIE B;  4W9H A;  3P42 A;  4XGA B;  4E3C A;  1WI0 A;  4HRS A;  5JHB A;  5CHV C;  1PUT A;  2RSU A;  1TY2 A;  2L76 A;  4JE3 B;  5LXH A;  4M02 A;  1V5T A;  4GB9 A;  2BT6 A;  1WX9 A;  4AOF A;  4YTM B;  1WXQ A;  4KX6 B;  2JUO A;  1FIQ A;  3KVF B;  1QOF A;  1MPE A;  3A33 B;  3LDZ E;  3L08 A;  2K8B A;  3AUL A;  2SAK A;  1VCB A;  3KUC B;  3UGB B;  4TQ0 A;  3A4R A;  1WYG A;  4A3O A;  4YWG G;  2Y5B B;  1SIF A;  5L95 C;  3B1L X;  4LNI A;  5AZG A;  4FBJ B;  3Q3O C;  1YJJ A;  3AE2 B;  3RUI B;  4NJ6 A;  2BS2 B;  4YTN B;  5C23 A;  3HRD D;  1V9J A;  2FBW B;  2ON8 A;  4ITK A;  3TJP A;  5FR3 A;  2N1W A;  2GBR A;  3DPD A;  3P63 A;  4PS7 A;  1TZ1 A;  2BS3 B;  2WQY B;  4DBG A;  3GE3 C;  4I6P A;  1UBI A;  1CK1 A;  1IPG A;  4AJY B;  3ZNZ B;  4BKG A;  1IGC A;  1JRP A;  2QCZ A;  1WGD A;  4FA6 A;  2XBB C;  3EEC A;  3HVZ A;  1JWU D;  4LJP B;  5EE9 A;  1WY8 A;  4KZ0 A;  3ZNH B;  4AP4 C;  3TEW A;  1QLB B;  2KVR A;  3WAL A;  3AMZ A;  3PGE A;  3PRP B;  2NTT A;  1VRA B;  3ZUN A;  3TEY A;  2WNM A;  3FAH A;  1GC6 A;  1K52 A;  3RNB C;  1ZXH A;  4WAA A;  1GC7 A;  2JT4 B;  2WXP A;  4FJY A;  4PT5 A;  2J4X A;  3AEB B;  2OJR A;  4A20 A;  3MP9 A;  1FO4 A;  4DHZ E;  1SJH D;  2M0A A;  5IOI A;  3Q3N C;  4WWM A;  2L52 A;  2RGF A;  2LAS A;  2R2O A;  4WWO A;  4ZRJ A;  2LGI A;  1F9J A;  2LFI A;  2MP2 B;  1RFA A;  3BYT B;  1WGH A;  2OED A;  3QHT A;  4JPS A;  1V86 A;  1IBX A;  4IM3 A;  4DHJ B;  4LTU A;  1A70 A;  1YX6 B;  3ZYY X;  3A9J A;  4FAD A;  3IT4 B;  2LEK A;  4RH6 A;  1YN3 A;  2CU1 A;  2D3A A;  3EHV A;  5C1Z A;  2L7R A;  4KSL C;  3CWI A;  4XWW A;  1TZO A;  4LLG M;  2KYW A;  3ZIM A;  2N0S B;  4NJ7 A;  1VZ7 A;  2VZK B;  3ZGZ A;  2AWT A;  4TV3 A;  2GBN A;  1I4R A;  3C19 A;  1FNU A;  1QOA A;  4GIV A;  1C76 A;  1YQ4 B;  3FC4 A;  4HJG E;  3Q3J A;  1CJE A;  3PRZ A;  1FCC C;  1V97 A;  5C3J B;  1AAR A;  2V3N A;  3ZXR A;  3U52 E;  3OJ4 B;  1ISN A;  2KLG A;  3PV1 A;  4WH4 A;  1XCQ L;  2B3A A;  1TS5 A;  2NTS A;  2C7M B;  4RF0 A;  4BBN F;  5D7G A;  4WJQ A;  1T6B X;  1VD2 A;  2KN5 A;  3AE8 B;  2E3T A;  3P1M A;  2PE9 A;  2DYB A;  4DWF A;  1J19 A;  2SEB D;  4XYC A;  3FIL A;  4HEA 1;  3N1Y C;  2GLS A;  3RYT A;  1WR6 E;  3B2G A;  4JX1 C;  2BGF A;  3N32 A;  2AL6 A;  1I35 A;  1NEK B;  3DBH I;  1B9R A;  1D3Z A;  5DPW A;  1E8W A;  5BMG A;  1AN8 A;  3WAO A;  2KJR A;  4CYE A;  2JU6 X;  3LYY A;  3LXF A;  1EUV B;  1RWS A;  3QJZ A;  4HJK A;  3KH0 A;  3M95 A;  1WMH A;  2XEW A;  1L7Y A;  1L6U A;  1FNV A;  2X38 A;  3AEE B;  4C7Y A;  1UGM A;  4NAW B;  5IP4 D;  2VRR B;  4US8 A;  2LHD A;  3E9S A;  2L32 A;  2YLM A;  4NZL B;  2FNJ B;  3AE7 B;  2O2V A;  1YN4 A;  3GE8 C;  3R2I A;  4NJC A;  2Y5C A;  4ACF A;  2PW9 A;  3VAW A;  2AQ1 B;  3Q8A A;  3L10 B;  1QQR A;  2WX0 A;  3ECI A;  3PSE B;  3IAS 1;  1T5X D;  2HJ8 A;  1KTK A;  5G2N A;  2BVC A;  1JRU A;  3MC0 B;  3V61 A;  2NBW B;  3H7P A;  2WDV B;  2RDB C;  2N1V A;  3DHH C;  3NZS A;  1UD7 A;  1C77 A;  1GB4 A;  1TKE A;  3HVD A;  4JGH B;  1HTQ A;  1EO6 A;  4DDG D;  1XT9 B;  4HKZ E;  4GN1 A;  3PPA A;  2D3C A;  1KOT A;  1U4A A;  3ZKJ C;  2KNB A;  3VRB B;  4HCP B;  2CKH B;  3A1Q A;  1JRO A;  1WH3 A;  3SD5 A;  1WGR A;  4RM9 A;  3V60 A;  1H8C A;  2HTM E;  3CMM B;  1CZP A;  3KLS X;  2KO3 A;  3K9O B;  4AS1 A;  4HPL B;  1BXT A;  3PHW B;  3KYD D;  3VRA B;  1B1Z A;  1T0Q C;  2JRI B;  1GPX A;  2J0M A;  2KQ7 A;  4PYU A;  4OHJ A;  2WYQ A;  1XEE A;  3HHM A;  3IT6 B;  1HZ5 A;  4W9J A;  4BBN C;  1HE8 A;  2GBK A;  2KMM A;  3WAN A;  2WHI A;  4FN2 A;  3AXC A;  4FXC A;  1H4R A;  4Q2J A;  3CF6 E;  1MHH E;  2AX5 A;  1FRR A;  3Q69 A;  1WWT A;  5G5G A;  2KDI A;  2L05 A;  2KQS A;  1LM8 B;  3ZDT A;  3ZO5 B;  4MSQ B;  1MHX A;  4GDK A;  2BYT A;  4M0W A;  1F0Z A;  1WXS A;  5T8I A;  3SHQ A;  1FFV A;  1VZ8 A;  2LGD A;  4GDL B;  4MEL A;  3AED B;  1KLG D;  1SE9 A;  2MBH A;  2LRU A;  2PTL A;  3L13 A;  1I4Q A;  3NUH B;  4HPM B;  3AEG B;  3WAP A;  4C80 A;  1OGW A;  5H8Y E;  1FM0 D;  1V1O A;  2L3Z A;  4BKS D;  2ZNV B;  2KD0 A;  3MJ5 A;  2MH7 A;  3SEB A;  2Z8L A;  4KGS A;  1VDV A;  2M4N A;  3GS2 A;  1JQ4 A;  3KW5 B;  4E74 A;  1YN5 A;  4GXB A;  2C5L C;  1R4M I;  2K3U A;  2WXN A;  3I63 C;  1JCK B;  2L1A A;  3NG0 A;  1LXD A;  1ZPS A;  4WWN A;  2D3B A;  2MHJ A;  1L4D B;  1UNS A;  1EWC A;  4MGZ E;  1C4A A;  1NEN B;  3JYU A;  1E8X A;  4BZA A;  1IUE A;  1ROE A;  1C79 A;  4ASW C;  5JZE B;  5C2T B;  4DXF A;  1IGD A;  3DBS A;  3DQV A;  1LFD A;  1C3T A;  1OTR B;  4FHK A;  1FFU A;  2Z59 B;  1TBE A;  1AYF A;  2JZP A;  5MPO A;  1MG8 A;  3KUZ A;  2BWF A;  3ZRF A;  4AUQ C;  1YNT E;  2AQ3 B;  1JAL A;  2UU7 A;  2LUM A;  1K51 A;  3VVW B;  3AU5 A;  4A3P A;  4L23 A;  4MEM A;  4IWO A;  4F1S A;  5J18 A;  2C7N B;  1L0X B;  3LJ3 A;  1WJ4 A;  3RNG C;  1YQB A;  1NI3 A;  5AUK A;  4A8X C;  4DDI D;  2FE8 A;  1T0Y A;  2DBY A;  2JF5 A;  2ZPN A;  4WJP A;  2G4D B;  4H2A A;  4KDI C;  1V1P B;  4EE2 A;  1OQY A;  3I3T B;  4ZYS A;  1KRH A;  4E71 A;  3PRM B;  2G45 B;  3PHX B;  4R3D A;  5HHD G;  3R2T A;  3VR9 B;  3W5V B;  2D07 B;  4EKU A;  3NVV A;  1PFD A;  5IKC M;  2EMS A;  2FID A;  4LDT B;  3M3J A;  3APF A;  2JQR B;  2BBC A;  3V05 A;  4RFB A;  3K9P B;  4YSX B;  1D5M C;  3WAM A;  3GZN I;  4G11 A;  3VUW A;  4URK A;  2R61 A;  3RZW C;  3W1S C;  3ZJU A;  4D2K A;  1WZ3 A;  4LCD E;  4IW0 A;  4N59 A;  4TQ1 A;  1QZE A;  4LNN A;  1M94 A;  2JRH A;  5AZH A;  3IVF A;  3M62 B;  2Z0E B;  1F77 A;  1LO5 D;  2ICI A;  2YEP F;  2MRP A;  4A90 A;  2IO2 B;  4OZC A;  3IBE A;  2CS4 A;  1V49 A;  2IYD B;  2QC8 A;  4DHJ D;  1HZ6 A;  1F2R I;  3U2S C;  1N61 A;  1TYG B;  4RMA A;  1SBB B;  4PK1 A;  4KZC A;  2RDH A;  2GRI A;  3RNE C;  5LNK 1;  4K3C A;  1D5Z C;  5G55 A;  1TIF A;  1VJK A;  2Q5W D;  3QC8 B;  1VLB A;  5LXI B;  1V81 A;  2KVZ A;  3C0R B;  2V3S A;  1KLU D;  2VZK D;  4GGQ A;  1WXV A;  3VUY A;  2W55 A;  2I1K A;  3SDL C;  2BYV E;  4W9K A;  2FAZ A;  4OZB A;  4HRO A;  3DBL I;  4W9L A;  1I4X A;  2DAF A;  2ZVN A;  3QAQ A;  1RLF A;  3APD A;  4ICU A;  1J0G A;  4IUM B;  2WDR B;  1ZDV A;  4DXG A;  2IPK D;  1P3Q U;  3NZ3 A;  3VFK A;  4C4V A;  4RF1 A;  3L4P A;  3TEX A;  2I2Y A;  1IBX B;  4ZRP A;  1WGY A;  1I4G A;  2KZR A;  1EM7 A;  2K22 A;  3A9J B;  5JXV A;  4I6N B;  3I57 A;  2ZVO A;  5CHW A;  3QWZ B;  2BTE A;  2N4F A;  1N60 A;  1J7C A;  2DAJ A;  2BF8 B;  2ZPY A;  1SJE D;  3VDZ A;  3TEZ A;  1ACC A;  1KM7 A;  2KJH B;  4I6L B;  4ARC A;  2KFK A;  4IG7 B;  3V6C B;  4HPP A;  2KAJ A;  4XE0 A;  4BKT A;  4JL9 A;  1L6V A;  2MQJ A;  1ZUD 2;  1CQV A;  1SIJ A;  1SE4 A;  3Q3M C;  2Y5P A;  4JLC A;  2B76 B;  3V3X A;  2BYF A;  4BVU C;  2IY1 B;  1TTN A;  3JSV A;  4HLE A;  1XLO A;  2C7H A;  4MAC A;  4P1B C;  2BB5 A;  1I4H A;  2WXJ A;  2KDF B;  3DVN V;  1HA5 A;  1DYQ A;  3W1S A;  1XO3 A;  4EOY A;  4B0M A;  5D3D A;  2BWE S;  4YSZ B;  1QKZ A;  2ACZ B;  3EC8 A;  1WXA A;  2AYO B;  3U7Z A;  2V9H A;  1RAX A;  2IGH A;  2JWZ A;  5BYR A;  2E6X A;  2KN4 A;  4A6Q A;  2M0X A;  4BFR A;  5IAA C;  2JZ3 B;  3FIL B;  3QQ8 B;  3GP7 A;  3FKY A;  1MVK A;  1C4P A;  5FKA C;  1WYW B;  4HWI B;  3AEC B;  4KKJ A;  1EU4 A;  1R4M B;  1Z5S B;  2DZJ A;  1V5O A;  4NY0 A;  3ZLZ A;  3H1U A;  4DXA B;  3RI7 C;  4IWP A;  5E6O A;  2K39 A;  1QIL A;  5DPT A;  3W2D A;  1SXT A;  3ABV B;  1NYR A;  2WDT B;  1KH0 A;  5CHF A;  5CTR C;  1DOY A;  4N6E B;  1TY0 A;  2H88 B;  4IDI A;  1WMH B;  2NMQ A;  3KQ4 A;  2KK8 A;  2K8H A;  4J3O D;  3VH3 B;  4ANW A;  1SE3 A;  4CQN A;  3V62 A;  1UZX B;  1GJZ A;  1BUI C;  2WXI A;  4MM3 A;  1N62 A;  4AJW A;  2O6V D;  3T3O A;  4WIP A;  5LLI A;  1WM2 A;  2IND C;  1QF6 A;  2BYE A;  2O2V B;  1QOB A;  3P2B A;  2FUG 1;  4FJV B;  2INC C;  1VZ6 A;  1FXT B;  1V80 A;  1QOG A;  2X8X X;  2AQ2 B;  5HFY A;  3RPF C;  3EGR A;  3T3N A;  1FNW A;  1UEL A;  5GXG B;  1WSP A;  4X57 B;  3ZW3 A;  3E56 A;  2KFJ A;  3H7P B;  2YEP B;  3GOE A;  4FLH A;  4FHJ A;  3PZD A;  4MJS A;  2PVO D;  4K7W A;  1XQQ A;  3L17 A;  4YT0 B;  3AE1 B;  1FXA A;  1YX5 B;  3B08 A;  4OVV A;  2LXA A;  3VR8 B;  1TKY A;  1LQB A;  3AN1 A;  2CHW A;  1I7H A;  2V0G A;  1I42 A;  1WGG A;  4HKQ A;  3QCA A;  2ZCC A;  3H6N A;  3A1Q B;  2D5G A;  2KWU B;  2KC2 A;  2D2Q A;  4A55 A;  4HCN B;  3RNA C;  4ANX A;  3NVY A;  3GZN B;  3SR6 A;  2HJ1 A;  1ET9 A;  2HE7 A;  1WXM A;  4W9F A;  5FK9 C;  2MEK A;  4LK0 M;  1DGJ A;  2BB6 A;  1GNU A;  4P7I A;  4BOZ B;  1C4C A;  5D94 A;  3P4R B;  4HVB A;  1TGZ B;  3TL5 A;  1J7A A;  4MGY E;  2A4Z A;  3WCQ A;  3A4S C;  3IHP C;  4JIO U;  1HEZ E;  2Y3A A;  2MJE A;  4GDK B;  2L0F A;  4WAF A;  2N9K A;  2WXO A;  2CR5 A;  3BZD B;  5FR6 A;  4M0W B;  1K8R B;  5GMV A;  2CU3 A;  1T0S C;  2DLB A;  2IJ0 A;  4TKN A;  4JWU C;  2JYE A;  2LMC A;  1ZP0 B;  5KHQ A;  4AWJ A;  1P9D U;  2LI5 A;  2G3Q B;  1N6Z A;  1P98 A;  1WJ6 A;  1PGA A;  1UF0 A;  2DX5 B;  1E7V A;  4KIK A;  1WE6 A;  3DBL B;  1JWA D;  2WXR A;  4W9D A;  1P0R A;  2FCM A;  4M8N A;  3CST A;  2KTR B;  4NQL B;  4GLS C;  4RGM A;  3RZF A;  1WE7 A;  5E6N A;  3R7R A;  1T3Q A;  2WXQ A;  1V6E A;  4TMA B;  1E8Y A;  3PZ8 A;  3VTU A;  4ZHO A;  2ZEQ A;  3PVL A;  4KVG B;  4W9G A;  1ZOY B;  2FCS A;  3TSS A;  3MC8 A;  5DPS A;  1RRB A;  3HIZ A;  3D32 A;  1UUP A;  4XDD A;  3ETR A;  3DBR I;  4RCO A;  4REZ A;  1E0Z A;  2KOX A;  2IO1 B;  2I38 A;  3WA0 A;  4OVZ A;  4LDT D;  2J7Q B;  1TT5 B;  4JQW C;  4N58 A;  4IOI E;  1HTO A;  2LGS A;  4TSS A;  4ZOH C;  1WJU A;  2IZV B;  2MX2 A;  2PLP A;  2WXH A;  3A9K A;  2JSV X;  2IGG A;  2KTF A;  2MWS B;  1PYW D;  4II2 B;  2WU2 B;  1ZDX A;  3OAW A;  3ZVV A;  4HK2 A;  5BMH A;  2VH2 A;  2M19 A;  3V6E B;  1IYF A;  5E6P A;  1ET6 A;  3NS1 A;  2N9P C;  4B9K A;  3Q8C A;  3ONS A;  3ML9 A;  1DOX A;  1E7U A;  4RNA A;  4WQM A;  4EZL A;  2KTR A;  2KHW B;  4XDC A;  1Q10 A;  2LVQ A;  2IGD A;  1WRD B;  2N7J A;  1UWX A;  4II3 B;  2WLB A;  3GB1 A;  2K8C A;  1UH6 A;  1ENF A;  3JW0 X;  2EKI A;  3DDC B;  4PYZ A;  5TSS A;  3UIP B;  1PDX A;  1PGX A;  3U8Z A;  1XF5 L;  1RYJ A;  2KT7 A;  2IO3 B;  3Q14 C;  2IY0 B;  2N9L A;  5DCN A;  1MFW A;  2RMM A;  2AEH A;  2GBJ A;  3L54 A;  3Q3F A;  3TCA A;  2K0P A;  3QK0 A;  2K1F A;  1EU3 A;  3NJT A;  2K6Q A;  4KV2 A;  2J53 A;  2KDB A;  1G6J A;  3IFW B;  2JY6 A;  2QEJ C;  1XLP A;  4IKG A;  2LJ5 A;  3VH4 B;  1JW9 D;  2FUH B;  1SB3 C;  2RPV A;  2RDG A;  3UQB A;  4AQ7 A;  1OEY A;  2MLB A;  4ZHP A;  1JML A;  4EZK A;  2K6D B;  5KHO A;  5EE1 A;  3NS8 A;  2KMA A;  2RPQ A;  4NPN A;  2GB1 A;  3ZJT A;  4NNJ B;  2LD9 A;  1FEH A;  2D3G A;  2QHO A;  3EFU A;  1ZE3 D;  3VQI A;  4OW0 A;  2LVP A;  1C1Y B;  3ZRC A;  2FCQ A;  1UWM A;  1TS3 A;  2ZJD A;  2WXG A;  2H89 B;  3W9C B;  3X0W A;  3M63 B;  4ARI A;  3DWM A;  1E8Z A;  3HK0 A;  3AE5 B;  4YTP B;  3KUD B;  3MHZ A;  3N1X C;  4MH0 E;  3H8H A;  2NBU A;  1ZGU B;  2WU5 B;  1LGR A;  2R2Q A;  3PO0 A;  1QT9 A;  4LNF A;  3N20 C;  2V4I B;  4K7S A;  3EUB 2;  2PIA A;  1ZKH A;  2ASQ A;  4C4V B;  2NPT A;  3R66 C;  3VHT C;  3PZ7 A;  2EEL A;  2GMI C;  3B9J A;  4KSK C;  3KWV A;  3PT2 B;  3TMP B;  2LXC A;  4ZRI A;  2L8J A;  3O65 B;  4ANU A;  1FRD A;  3APC A;  3Q6B A;  5BMI A;  2XK5 A;  2KJ6 A;  1GUA B;  1Y8R C;  3DHI C;  3W1Y A;  1XXG A;  2I1J A;  1WFY A;  1EWY C;  5L83 A;  1N63 A;  2JXT A;  4F7Z A;  1FXI A;  4NQK E;  2MBE A;  3UQA A;  1TS2 A;  2KFK B;  3AH7 A;  1SE2 A;  2V3P A;  2KWV B;  2AL3 A;  2LGY A;  4L1B A;  4FJZ A;  5J17 A;  3T9L A;  2W9N A;  4GMV A;  2WGS A;  3U30 A;  1E90 A;  2L00 B;  3EFC A;  3PLV A;  3JSV B;  3ENE A;  2LVO A;  2J0J A;  4GU2 A;  3VTV A;  2M17 A;  1OQQ A;  2IBI B;  3BY4 B;  1GAQ B;  2BKF A;  4EUT A;  4MT5 A;  5EDS A;  3TBL D;  4UDU C;  1JWS D;  3Q8B A;  4BKS A;  2N9X A;  2WXF A;  3B0A A;  1AWD A;  2BW2 A;  4K3B A;  3C8Y A;  4XZ4 A;  1N5X A;  1A5R A;  3MTN B;  1F52 A;  4WUR A;  3BIN A;  1KLV A;  1NI2 A;  4RM8 A;  1STE A;  1E5W A;  3AE4 B;  2XNA C;  4LJO B;  5D6J B;  3NRZ A;  1FPY A;  2JPH A;  1TKG A;  3SU8 X;  3RD2 A;  1SEB D;  4LNK A;  3ZNI D;  2YVC A;  1P7F A;  2BKR B;  4OVU A;  1P1A A;  4KGT A;  4MSM B;  5AUI A;  4KKI A;  3PLU A;  1YQ3 B;  2FCN A;  3DBR B;  4US9 A;  4CO7 A;  2INN E;  4K1R B;  1WR1 A;  1UGJ A;  3AB5 A;  3Q8E A;  1XCT L;  4MM3 B;  4PS8 A;  3RMK C;  2KDM A;  3OWE B;  4YL8 A;  3DVG Y;  2K5P A;  5HG2 A;  1R4N I;  1EF5 A;  2L83 A;  3MHS D;  5JHA A;  2ZW1 A;  3WIM A;  2KX0 A;  3PS6 A;  1SSN A;  1RM6 C;  2WS3 B;  4LNO A;  2IDY A;  2WXM A;  2NR2 A;  3HM3 A;  1WJN A;  3R7Q A;  1JWB D;  2MSE D;  4KGR A;  3QA8 A;  2MBQ A;  3BVZ A;  4MJS B;  1TJE A;  2PKO A;  5I4D A;  1HQR D;  1D5X C;  3JVZ X;  4J6I A;  1Q0W B;  3RNC C;  1D4B A;  4W9C A;  1PGB A;  4IC7 B;  4C7Z A;  1S1Q B;  2PPH A;  1V2Y A;  4O1N A;  3X23 A;  5E6J A;  3SFE B;  2DZM A;  1WX8 A;  4GOC A;  1SGH A;  1GG3 A;  3J9C A;  4IM0 A;  3ALB A;  5IN7 A;  4RGO S;  2KWD A;  1IP9 A;  3HM6 X;  2BS4 B;  2MP2 A;  1YJI A;  1I4P A;  2ONQ A;  1AW7 A;  4M01 A;  2JVC A;  1L5P A;  4ICV A;  3B2F A;  2LGX A;  2WWZ A;  3IG3 A;  1MI0 A;  2HD5 B;  4DHZ B;  2LHE A;  1JWM D;  4K81 A;  2HDE A;  1OQR A; 
#chains in the Genus database with same CATH homology
 2G45 B;  3PHX B;  4GSW A;  2N7E A;  3VUX A;  2FCS A;  2DZK A;  1WY8 A;  5DPS A;  1YIW A;  1RRB A;  4KZ0 A;  3ZNH B;  4AP4 C;  2UWQ A;  3HIZ A;  2D07 B;  4EKU A;  2KVR A;  3WAL A;  3PGE A;  3D32 A;  3PRP B;  2EMS A;  3DBR I;  1OEY J;  2MW5 A;  2FID A;  4LDT B;  2KOX A;  2IO1 B;  3ZUN A;  3WA0 A;  3M3J A;  3APF A;  3RCZ A;  4LDT D;  2KAN A;  4E71 A;  3K9P B;  1GC6 A;  2MBO A;  2GBM A;  2J7Q B;  3WAM A;  3GZN I;  3DCG A;  4G11 A;  2NBV B;  4JQW C;  3VUW A;  4URK A;  1L2N A;  4WAA A;  1GC7 A;  2JT4 B;  3RZW C;  3W1S C;  4FJY A;  1WZ3 A;  2RR9 A;  4LCD E;  1WJU A;  4TUU A;  4IW0 A;  4DK5 A;  2IZV B;  2OJR A;  3L16 A;  2DZI A;  4G0N B;  4A20 A;  1X1M A;  2MX2 A;  4TQ1 A;  1QZE A;  3A9K A;  4DHZ E;  4WWP A;  2KTF A;  1YJ1 A;  1M94 A;  2MWS B;  4II2 B;  3OAW A;  2JRH A;  4KIK B;  2RGF A;  2LAS A;  2R2O A;  4WWO A;  4ZRJ A;  5AZH A;  4HK2 A;  3IVF A;  3M62 B;  4HDO A;  2Z0E B;  1F9J A;  1BT0 A;  3V6E B;  1IYF A;  2MP2 B;  4AWJ A;  4G50 A;  5E6P A;  2N9P C;  4B9K A;  3ONS A;  4M8M A;  3T8M A;  1RFA A;  1WGH A;  3ML9 A;  1E7U A;  4EZL A;  1Q5W B;  2MRP A;  2IO2 B;  2KTR A;  2KHW B;  3QHT A;  3IBE A;  1V86 A;  2CS4 A;  4IM3 A;  4DHJ B;  2LVQ A;  1V49 A;  1WRD B;  2IYD B;  4II3 B;  1J8C A;  4DHJ D;  1YX6 B;  2C60 A;  2K8C A;  1UH6 A;  3A9J A;  4FAD A;  3JW0 X;  4RMA A;  3NOB A;  3DDC B;  4KZC A;  4PYZ A;  3UIP B;  2CU1 A;  3NZU A;  3U8Z A;  4N9F 4;  3EHV A;  5G55 A;  5C1Z A;  2IO3 B;  2L7R A;  4KSL C;  2EMT A;  2MA9 B;  2IY0 B;  2FIF A;  2KWC A;  3QC8 B;  3ZIM A;  3DVG X;  1V81 A;  5LXI B;  3C0R B;  3DVN U;  5DCN A;  2AEH A;  2GOW A;  2V3S A;  2GBJ A;  2LRW A;  4NJ7 A;  3L54 A;  5AZF A;  3Q3F A;  3TCA A;  2AWT A;  3QK0 A;  2K1F A;  4GGQ A;  4KV2 A;  2K6Q A;  3MJW A;  4TV3 A;  1WXV A;  4MGK E;  3VUY A;  2GBN A;  2JZZ A;  2I1K A;  2EKE C;  3SDL C;  2BYV E;  2KDB A;  4W9K A;  2REX A;  2FAZ A;  1G6J A;  2G4S A;  4GIV A;  2MCN B;  5BO4 B;  3IFW B;  2JY6 A;  3DBL I;  4W9L A;  1CMX B;  4W9I A;  2PEA A;  2LJ5 A;  3VH4 B;  3A9K B;  2ZVN A;  2DAF A;  2JXX A;  3QAQ A;  3UIN B;  3Q3J A;  1RLF A;  2FUH B;  3APD A;  3PRZ A;  4ICU A;  1J0G A;  2M1M A;  3UQB A;  2ZNV C;  4IUM B;  4ZDV A;  1AAR A;  1OEY A;  2MLB A;  1P3Q U;  4EZK A;  1WZ0 A;  3RT3 B;  2K6D B;  4G3X B;  3VFK A;  3OJ4 B;  4IWQ A;  1ISN A;  2KLG A;  5KHO A;  3PV1 A;  1YD8 U;  3NS8 A;  3QIJ A;  4NAW A;  2DHZ A;  2O6V B;  2NVU I;  2B3A A;  4IM2 A;  1NDD A;  2KMA A;  3N30 A;  4XX5 A;  1WGY A;  2DYO A;  2RPQ A;  4NPN A;  4NNJ B;  2C7M B;  2LD9 A;  4BBN F;  5D7G A;  2KZR A;  3A9J B;  4WJQ A;  4I6N B;  1KJT A;  2D3G A;  3UF8 A;  1VD2 A;  2QHO A;  2M8S A;  2ZVO A;  3EFU A;  2KN5 A;  2KKC A;  3VQI A;  5CHW A;  3QWZ B;  3U7D A;  2PE9 A;  2LVP A;  4WQO B;  2N4F A;  1C1Y B;  2DYB A;  3ZRC A;  4DWF A;  4HDQ A;  2FCQ A;  3QX1 A;  2HTH A;  2KLC A;  1J19 A;  2ZJD A;  2DAJ A;  2BF8 B;  2UYZ B;  2C9W B;  2J0K A;  3X0W A;  2ZPY A;  3M63 B;  3VDZ A;  3S2A A;  1E8Z A;  1KM7 A;  2ZCB A;  2KJH B;  3HK0 A;  4I6L B;  2KFK A;  4IG7 B;  2K25 A;  1ZW7 A;  4PS3 A;  3V6C B;  3KUD B;  4ANV A;  3RYT A;  4MH0 E;  3R3M A;  3ML8 A;  5DPR A;  1WM3 A;  1WR6 E;  1XD3 B;  2NBU A;  2OOB B;  4BKT A;  1ZGU B;  4JL9 A;  2MQJ A;  3PRE A;  2BGF A;  2PE6 B;  2R2Q A;  3N32 A;  2AL6 A;  1I35 A;  3DBH I;  1D3Z A;  3AU4 A;  5DPW A;  1E8W A;  2MBB B;  4JLC A;  2BYF A;  4BVU C;  3DOW A;  4FUL A;  3WAO A;  2IY1 B;  4K7S A;  2KJR A;  1TTN A;  4CYE A;  3JSV A;  4HLE A;  2CHZ A;  1WX7 A;  2C7H A;  5JH5 C;  1EUV B;  3QJZ A;  4HJK A;  3KH0 A;  3M95 A;  1WMH A;  2XEW A;  1L7Y A;  1ZKH A;  3NHE B;  4TQ0 A;  2ASQ A;  2PJH A;  2NPT A;  3R66 C;  3VHT C;  1UGM A;  2KDF B;  3DVN V;  4NAW B;  3W1S A;  2GMI C;  4EOY A;  4KSK C;  2O6V A;  2WX1 A;  2VRR B;  2BWE S;  3OJ3 A;  3PT2 B;  3NY5 A;  3TMP B;  2LXC A;  2YLM A;  4ZRI A;  2L8J A;  2V1Y A;  3O65 B;  3ZNG C;  2FNJ B;  4ANU A;  3APC A;  3EC8 A;  2O2V A;  2XK5 A;  2KJ6 A;  4B6W A;  1GUA B;  1WXA A;  2AYO B;  1Y8R C;  5IA7 A;  3W1Y A;  3VXW A;  2I1J A;  3VAW A;  1RAX A;  2JWZ A;  3L10 B;  1WFY A;  2V4L A;  2Z0D B;  3ECI A;  2WX0 A;  3PSE B;  4HXD A;  3ZTC A;  4F7Z A;  5L83 A;  4KDL B;  2HJ8 A;  2M0X A;  3QAR A;  2MBE A;  4NQK E;  5G2N A;  5IAA C;  2NS5 A;  4BFR A;  2JZ3 B;  1JRU A;  3UQA A;  2KFK B;  3QQ8 B;  2KC1 A;  3PTF C;  1WYW B;  4HWI B;  3V61 A;  2D10 A;  2LUE A;  2NBW B;  2N7D A;  4WJO A;  2KWV B;  2AL3 A;  3H7P A;  1Z5S B;  2DZJ A;  2LGY A;  1V5O A;  5CX3 A;  4NY0 A;  4FJZ A;  3H1U A;  3ZLZ A;  4DXA B;  5J17 A;  2N1V A;  3NZS A;  4IWP A;  5E6O A;  3T9L A;  2K39 A;  2W9N A;  2N9E B;  1UD7 A;  5DPT A;  4GMV A;  1EF1 A;  3U30 A;  5D2M B;  1E90 A;  2L00 B;  2WDT B;  4JGH B;  5CHF A;  5CTR C;  2D11 A;  1EO6 A;  4DDG D;  3PLV A;  1XT9 B;  3JSV B;  2IO0 B;  3ENE A;  4GN1 A;  3PPA A;  1WMH B;  2LVO A;  1KOT A;  1WF9 A;  1U4A A;  2KK8 A;  2J0J A;  2K8H A;  4EFO A;  4B95 A;  3ZKJ C;  2KNB A;  4GU2 A;  3VTV A;  2M17 A;  3VH3 B;  3VTW A;  4ANW A;  2NPT B;  4GDL A;  4HCP B;  3V62 A;  2IBI B;  2CKH B;  3A1Q A;  1NBF C;  1S3S G;  2BKF A;  3BY4 B;  4EUT A;  1UZX B;  1GJZ A;  1WH3 A;  3SD5 A;  1WGR A;  4RM9 A;  5EDS A;  4XC2 A;  2NCN A;  4MM3 A;  2RD0 A;  3OLM D;  3TBL D;  3V60 A;  3ZTD A;  1H8C A;  2DYM A;  4AJW A;  2O6V D;  3CMM B;  4BKS A;  2N9X A;  3ZDM C;  2KO3 A;  5LLI A;  3B0A A;  1WM2 A;  3K9O B;  4HPL B;  5HKH A;  3PHW B;  2BYE A;  2O2V B;  3KYD D;  3P2B A;  2XK5 B;  3H9D A;  4XZ4 A;  3RUL A;  4FJV B;  4EEW A;  1A5R A;  1FXT B;  1V80 A;  2JRI B;  2J0M A;  2KQ7 A;  4PYU A;  3H7S A;  3MTN B;  3AI5 A;  2WYQ A;  5J2R A;  2DEN B;  3HHM A;  4F8C B;  3BIN A;  1KLV A;  1NI2 A;  2KMC A;  1Q1O A;  1UEL A;  4RM8 A;  4W9J A;  1E5W A;  2ZZP B;  4BBN C;  5AEK B;  2BPS A;  4MGI E;  1HE8 A;  1UBQ A;  4X57 B;  3ZW3 A;  4LJO B;  2GBK A;  2CHX A;  5D6J B;  2KFJ A;  3WAN A;  4FN2 A;  3AXC A;  3ZVV A;  4EZJ A;  1H4R A;  3H7P B;  2JPH A;  4MDK E;  3CF6 E;  3GOE A;  3SU8 X;  4FLH A;  4K7U A;  4FHJ A;  3PZD A;  2KDI A;  4MJS A;  3N3K B;  2L05 A;  4K7W A;  2KQS A;  1LM8 B;  3ZDT A;  1XQQ A;  3L17 A;  4MSQ B;  3RD2 A;  3ZO5 B;  4CHK A;  4ZYN A;  2L0T A;  3ZNI D;  1YX5 B;  1WIA A;  3B08 A;  4GDK A;  4OVV A;  2YVC A;  2LXA A;  1LQB A;  2BKR B;  3UIO B;  2CHW A;  4OVU A;  1WXS A;  1Z2M A;  1P1A A;  1I42 A;  1WGG A;  4MSM B;  3QCA A;  3SHQ A;  2ZCC A;  2LGD A;  3H6N A;  4GDL B;  3A1Q B;  3PLU A;  4MEL A;  2FCN A;  4CO7 A;  4K1R B;  1SE9 A;  1WR1 A;  2MBH A;  2KWU B;  2LZ6 A;  2LRU A;  2KC2 A;  2D2Q A;  3L13 A;  4PS8 A;  4HCN B;  3WAP A;  4HPM B;  2A5U A;  3TIX A;  4YL8 A;  4ZRK A;  3DVG Y;  4ANX A;  1OGW A;  2KX3 A;  4BOS C;  2L3Z A;  2LWP A;  4BKS D;  2ZNV B;  2KD0 A;  1R4N I;  1EF5 A;  5TR5 A;  3KYC D;  3MHS D;  2HE7 A;  1WXM A;  4W9F A;  5JHA A;  1PQS A;  3WIM A;  2KX0 A;  2M4N A;  2KXJ A;  3KW5 B;  3PS6 A;  4E74 A;  4GXB A;  2C5L C;  1R4M I;  4W9E A;  1GNU A;  4P7I A;  4BOZ B;  4WJN A;  1LXD A;  2NR2 A;  3HM3 A;  3L0W B;  4WWN A;  1WJN A;  3R7Q A;  5D94 A;  3CSF A;  2KDE B;  4W9H A;  4E3C A;  1WI0 A;  4MGZ E;  4HVB A;  1TGZ B;  2MSE D;  5JHB A;  3JYU A;  5CHV C;  3TL5 A;  2RSU A;  1E8X A;  3QA8 A;  2MBQ A;  2L76 A;  4MGY E;  2A4Z A;  4MJS B;  4ASW C;  3A4S C;  3IHP C;  4JIO U;  5LXH A;  5JZE B;  1V5T A;  4GDK B;  2L0F A;  4GB9 A;  3DBS A;  3JVZ X;  3DQV A;  1WX9 A;  4AOF A;  2CR5 A;  1Q0W B;  4J6I A;  5FR6 A;  4W9C A;  4M0W B;  1LFD A;  1C3T A;  1K8R B;  5GMV A;  2JUO A;  1OTR B;  4FHK A;  4IC7 B;  1S1Q B;  2PPH A;  2Z59 B;  1TBE A;  3KVF B;  1V2Y A;  4TKN A;  3A33 B;  3X23 A;  3LDZ E;  3L08 A;  2K8B A;  3AUL A;  5KHQ A;  1MG8 A;  1VCB A;  2DZM A;  1WX8 A;  2BWF A;  3KUZ A;  3KUC B;  3A4R A;  3UGB B;  1P9D U;  3ZRF A;  4AUQ C;  4A3O A;  2LI5 A;  4GOC A;  2Y5B B;  1SGH A;  1GG3 A;  2G3Q B;  1SIF A;  5L95 C;  1P98 A;  3B1L X;  1WJ6 A;  4IM0 A;  3ALB A;  5AZG A;  4FBJ B;  3VVW B;  3AU5 A;  2DX5 B;  4A3P A;  1E7V A;  3RUI B;  4KIK A;  4NJ6 A;  4MEM A;  5C23 A;  1WE6 A;  1V9J A;  4IWO A;  4W9D A;  4F1S A;  5J18 A;  1IP9 A;  3TJP A;  2C7N B;  3LJ3 A;  3HM6 X;  1WJ4 A;  2MP2 A;  2N1W A;  1P0R A;  2FCM A;  4M8N A;  1YQB A;  2GBR A;  3CST A;  3DPD A;  4PS7 A;  1TZ1 A;  2KTR B;  4NQL B;  4DDI D;  4DBG A;  2JVC A;  3RZF A;  1T0Y A;  4I6P A;  2JF5 A;  1WE7 A;  2ZPN A;  4WJP A;  4ICV A;  5E6N A;  3R7R A;  2G4D B;  1UBI A;  2LGX A;  1IPG A;  4KDI C;  1V6E A;  2WWZ A;  3IG3 A;  4AJY B;  2HD5 B;  1E8Y A;  3VTU A;  3ZNZ B;  4BKG A;  4DHZ B;  2ZEQ A;  3PVL A;  4K81 A;  1WGD A;  4FA6 A;  4KVG B;  1OQY A;  2XBB C;  3EEC A;  3I3T B;  4LJP B;  4W9G A;  3PRM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...