2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
4MJSA 3CSTA 3MTNB 4MDKE 2DZMA 2KDIA 4MSMB 1RAXA 2C7NB 3DVGX 2V3SA 2KX0A 2NVUI 1LXDA 1E8XA 3ZLZA 2HD5B 2KTRB 2ASQA 2DHZA 1UD7A 2LJ5A 4W9EA 3TCAA 1WXAA 4LDTB 4W9JA 5L83A 1XD3B 4HVBA 2KDFB 3LDZE 4NNJB 2DZJA 2IO0B 3ML8A 2J0MA 3N30A 1V81A 2KD0A 2MBEA 4TUUA 3PHWB 3M62B 4EFOA 3DBSA 2AWTA 3VFKA 2LUEA 3VUYA 4MH0E 2G45B 2V4LA 4HLEA 5JHAA 2JVCA 3W1SA 4EZKA 1YQBA 3T8MA 1TZ1A 3V6CB 2JY6A 2KJHB 4F7ZA 1UELA 2KN5A 1UBIA 3QHTA 5AEKB 2O6VB 2IO1B 1NDDA 1OTRB 3ECIA 3AI5A 1VCBA 4G0NB 3A9KB 4HDOA 3TJPA 2CR5A 1OEYJ 3KYCD 3ALBA 4LDTD 2RPQA 2GBJA 2KTRA 1NBFC 4EZJA 5JH5C 1E90A 2KX3A 3BINA 2I1KA 2ZNVC 3M63B 4GMVA 3PHXB 2KFJA 2M0XA 2GMIC 1KOTA 3UIPB 3ZDTA 3X23A 3CMMB 5E6PA 4MJSB 5KHQA 4ANXA 5CX3A 3N3KB 3ZTCA 3QWZB 2WX1A 1J19A 3KUCB 4BOZB 2LRWA 2O6VA 3NZSA 3PRPB 4P7IA 1L2NA 2OOBB 4IWQA 2IZVB 2BF8B 3ZRFA 2LGYA 2NS5A 4DHZB 1MG8A 1P9DU 2QHOA 1WMHA 4ANUA 2K6QA 1V80A 2MBHA 2N7EA 5LXHA 4IWPA 1WI0A 3AU5A 1FXTB 4URKA 1WE7A 3ONSA 4WWPA 5G2NA 4AJWA 2N7DA 4E71A 3BY4B 3WIMA 4NAWA 4WJPA 2J0JA 3R66C 1GJZA 4AUQC 2MQJA 4ICVA 3PS6A 4JL9A 1XT9B 2D07B 2JZZA 2CU1A 4MGKE 2KQSA 5C23A 1G6JA 2KVRA 1QZEA 4HWIB 5IAAC 5IA7A 2DAFA 4BKGA 4DHZE 5BO4B 3C0RB 2LXAA 4F1SA 2BYEA 4FN2A 3N32A 1I35A 1WMHB 3AULA 5KHOA 5DPTA 4IWOA 5CHWA 2MSED 3H7PB 5EDSA 1E8YA 2J7QB 2KNBA 4HPMB 1WGHA 2RD0A 2FIFA 2KLGA 3JVZX 2JZ3B 2GBRA 2ZEQA 2R2QA 4IC7B 3AU4A 4ZRJA 1TGZB 5LLIA 2G3QB 3DPDA 4B9KA 1U4AA 2NBVB 4K7SA 4NJ6A 2N9EB 2KO3A 1P98A 2JT4B 2CKHB 1E7UA 2KK8A 2KFKB 3M3JA 3OJ3A 3H6NA 4BOSC 5J18A 4CO7A 3U8ZA 4I6NB 2XEWA 4JGHB 1GC6A 1WX7A 1P0RA 1LQBA 3H9DA 4NQLB 3APDA 2ZCCA 3VTVA 3DBHI 4K7UA 2NR2A 3A33B 2FIDA 2KDEB 2LVQA 4K1RB 4ZRKA 4W9DA 4E74A 2LD9A 1NI2A 1XQQA 1WYWB 1WRDB 3RZWC 2IYDB 4WAAA 3R3MA 5TR5A 4HJKA 3APFA 2KKCA 3QA8A 3SHQA 2DYOA 2LZ6A 1EUVB 1Q5WB 3R7QA 3W1SC 3A9JB 1V6EA 2C60A 1UGMA 2BWFA 2KWUB 2MBBB 3KUDB 4A20A 4EKUA 3VH3B 4TQ1A 3VXWA 1GG3A 3RULA 1WR6E 1LFDA 2NPTA 4BKTA 1E5WA 1SE9A 1WE6A 3KUZA 4F8CB 2I1JA 3UQAA 4XC2A 3ZNGC 5AZFA 4M0WB 2DAJA 2C7MB 2BKFA 3NOBA 3WA0A 3P2BA 1Y8RC 2K6DB 3KVFB 2W9NA 4G3XB 1AARA 3ZRCA 2GOWA 2ZNVB 1D3ZA 4PYZA 4W9IA 3ZUNA 2PE9A 2IY0B 2LI5A 3JYUA 3WALA 1YIWA 1WR1A 2KANA 2A4ZA 3IVFA 3ML9A 3QAQA 3TMPB 1EF1A 3L10B 4II2B 2KQ7A 2MLBA 1WJUA 3NY5A 5D7GA 2D11A 2LGXA 2ZZPB 3H7SA 2MW5A 4K81A 5GMVA 2CHWA 4M8MA 5LXIB 2JPHA 2MP2A 2MX2A 4RM8A 4FBJB 1WJ4A 2MBOA 1PQSA 2YLMA 1TBEA 2D3GA 2DZKA 3PSEB 2HTHA 1C3TA 3APCA 3ZNHB 2MRPA 1IYFA 3MJWA 2L00B 3Q3JA 5AZHA 3T9LA 4GN1A 1UH6A 4TKNA 3VUWA 1KLVA 2AEHA 2K1FA 1RRBA 2DYMA 1WX9A 3PRZA 5JZEB 2IBIB 4GDKA 3TL5A 2FCSA 5E6NA 1JRUA 1WM2A 1KM7A 2R2OA 2ZVNA 2CHXA 3PTFC 1IP9A 3PVLA 3QX1A 1WIAA 3DDCB 4DHJD 4PS7A 4BFRA 1OGWA 1V86A 3DVNV 4XZ4A 4NJ7A 5DPWA 3HM6X 3RT3B 4MEMA 3EC8A 3L0WB 3OAWA 2AYOB 4BKSA 4IM2A 4IM3A 1YJ1A 4TQ0A 2RR9A 1RLFA 4NPNA 3HM3A 1ZW7A 4KV2A 1SIFA 4ASWC 2NBUA 2FAZA 5D6JB 3H1UA 3D32A 4JIOU 3VTUA 1F9JA 3L13A 3AXCA 3RCZA 2VRRB 1WXSA 4J6IA 3ZNZB 4RM9A 2JF5A 1S1QB 3U7DA 3PV1A 3RYTA 1ZGUB 2FCMA 2JRHA 3M95A 2RGFA 2GBNA 2RSUA 2KWVB 3QQ8B 1K8RB 2D10A 5D94A 4ZDVA 2KMCA 2C5LC 2YVCA 2G4DB 4FHJA 2XBBC 3Q3FA 2MBQA 3UF8A 4XX5A 1M94A 4FJZA 2LVPA 4JLCA 4FA6A 3A1QB 2O2VA 4TV3A 4FJVB 4KIKB 3PPAA 3OLMD 2KHWB 4GDLB 3VDZA 1SGHA 3RZFA 1WZ3A 1KJTA 3ZDMC 1WXVA 2BGFA 4KZCA 2K8CA 3VUXA 2O6VD 5DPSA 4EZLA 3IFWB 3CSFA 3ZKJC 4AJYB 1E8ZA 3PGEA 4W9KA 2DZIA 3B0AA 3DCGA 4G11A 2JXXA 2KC1A 3SD5A 3QK0A 3MHSD 2L8JA 5FR6A 1OQYA 2MP2B 4KSKC 5CHVC 2K39A 5HKHA 2Y5BB 2M1MA 1GNUA 3B1LX 3B08A 4KIKA 3VQIA 3EECA 2PEAA 1WFYA 1BT0A 2FNJB 3NHEB 4OVVA 4AWJA 2C9WB 4HK2A 4NY0A 3VHTC 3NZUA 4PS8A 3ZW3A 4FLHA 3JW0X 1OEYA 4LCDE 3WAMA 3JSVA 1WJ6A 5E6OA 2M8SA 2DENB 3A4SC 4WJOA 1GUAB 2G4SA 3W1YA 2XK5B 2CHZA 1Z5SB 4DXAB 4FADA 3JSVB 3X0WA 4E3CA 4GOCA 3VVWB 4II3B 5L95C 4MGZE 3QARA 1H8CA 4DWFA 1C1YB 4WWOA 2UWQA 4IG7B 1EF5A 1HE8A 3EFUA 2N9XA 4FULA 4ICUA 4JQWC 5AZGA 1WZ0A 2NPTB 4KDIC 4DDID 3PZDA 2PJHA 3V6EB 2BKRB 4A3PA 1WGGA 4YL8A 2MCNB 1ISNA 2OJRA 2LASA 2EKEC 3QC8B 2K25A 4BBNF 4W9FA 5CHFA 4DHJB 2PE6B 3CF6E 4I6LB 4NQKE 4FHKA 2KLCA 2ZCBA 2WDTB 3O65B 4GDLA 1UZXB 4MGIE 4WJNA 4ZRIA 1WH3A 4CYEA 4GGQA 2MA9B 1V9JA 4KVGB 3UQBA 2FCQA 3DBLI 2M4NA 4HPLB 3A1QA 5JHBA 2D2QA 4MELA 3GOEA 2GBMA 4GDKB 4W9HA 3L54A 2HJ8A 2LVOA 3QCAA 2LXCA 1L7YA 1T0YA 4W9CA 4GXBA 4DDGD 3HK0A 1P1AA 3KH0A 1E8WA 3PT2B 3RD2A 4M8NA 2A5UA 3ZNID 2Z0EB 4HCNB 4W9LA 2KOXA 2KZRA 1J8CA 2IO3B 3ENEA 3ZTDA 3K9PB 3PRMB 4GU2A 2KWCA 2KXJA 4IUMB 3SU8X 1EO6A 2IY1B 1I42A 3VAWA 3V61A 2N1VA 3PLVA 4FJYA 4EEWA 4GSWA 1WJNA 4HDQA 3DBRI 2V1YA 2AL6A 2L7RA 2XK5A 1UBQA 2BYVE 3DOWA 2Z0DB 3GZNI 5J17A 1E7VA 3PREA 2L76A 3PLUA 2WWZA 1YD8U 3ZVVA 2EMSA 2ZJDA 4WWNA 4A3OA 1WGYA 2BWES 4B95A 4PYUA 4MSQB 3UGBB 3K9OB 1R4NI 2K8HA 4AP4C 2PPHA 1ZKHA 2REXA 4BKSD 2KTFA 4BVUC 2N9PC 3A4RA 4CHKA 1X1MA 4LJPB 3DVGY 1WGDA 4WJQA 2JRIB 1WY8A 3RUIB 4ANVA 1R4MI 2ZVOA 4DK5A 1WF9A 3A9JA 3EHVA 2L0TA 5DCNA 3UIOB 2L0FA 1CMXB 4PS3A 2JWZA 2N4FA 2O2VB 5DPRA 2MWSB 5G55A 3KYDD 4X57B 1YX6B 1WGRA 3DQVA 1V49A 4KDLB 4K7WA 1LM8B 5CTRC 2ZPNA 4W9GA 2KMAA 2NCNA 1Q1OA 2BYFA 1J0GA 4GB9A 2HE7A 4DBGA 3R7RA 1WX8A 1RFAA 4ANWA 3HIZA 3UINB 5C1ZA 3V60A 3QJZA 3NS8A 1V5OA 2KJ6A 3WAOA 3ZO5B 4B6WA 4ZYNA 3A9KA 1VD2A 2UYZB 2Z59B 4GIVA 4MGYE 2JUOA 4EUTA 1S3SG 3IG3A 1TTNA 3H7PA 2B3AA 3TBLD 5D2MB 4RMAA 4WQOB 2WX0A 2IO2B 3KW5B 2FCNA 3QIJA 4EOYA 4BBNC 1H4RA 1P3QU 1V5TA 3OJ4B 2KDBA 4IM0A 3IBEA 3IHPC 2L05A 1WM3A 4MM3A 2DX5B 1GC7A 3DVNU 2LWPA 3WANA 3LJ3A 3L16A 2BPSA 3L08A 2N1WA 4HXDA 4IW0A 2FUHB 4NAWB 3TIXA 4AOFA 4I6PA 3L17A 3V62A 4KSLC 3S2AA 3HHMA 4N9F4 3ZIMA 2KFKA 2GBKA 4HCPB 2J0KA 2NBWB 2LRUA 2CS4A 2KC2A 3SDLC 3WAPA 5J2RA 1YX5B 1IPGA 1WXMA 2EMTA 2WYQA 4LJOB 2AL3A 1A5RA 3I3TB 4OVUA 2L3ZA 2LGDA 1Q0WB 3VH4B 2K8BA 4G50A 1Z2MA 1V2YA 2ZPYA 3VTWA 2DYBA 4KZ0A 2C7HA 2M17A 3U30A 2KJRA
chains in the Genus database with same CATH superfamily
5D3DA 4MSMB 2V3SA 1LXDA 2LJ5A 4W9EA 2DZJA 3ML8A 3Q8AA 1V81A 2QSDA 4XWTA 1QLBB 3PHWB 3DBSA 3NZ3A 2AWTA 3PO0A 2LUEA 4MH0E 5JHAA 4KKJA 2JVCA 4OHJA 4EZKA 3V6CB 2JY6A 3MC8A 2KN5A 1ET6A 1C76A 1UBIA 1VZ7A 2IO1B 1VCBA 4G0NB 1OEYJ 4OZAA 3KYCD 1SF0A 4EZJA 5H8YE 1YN5A 2KFJA 2GMIC 2M0XA 1T0QC 2WXFA 4ANXA 5CX3A 1XF5L 3SR6A 3QWZB 3KUCB 4BOZB 3AEEB 3PRPB 2PLPA 2IZVB 2LGYA 4MACA 2NS5A 1MG8A 2MBHA 5LXHA 3I5JC 2KYWA 1JQ4A 4URKA 1YJIA 1ET9A 5G2NA 2N7DA 4JWUC 2PIAA 4NAWA 3TEZA 1XLOA 2J0JA 1GJZA 4C56C 4KX6B 1XT9B 3KWLA 1HA5A 2CU1A 4MGKE 2KVRA 4HWIB 4F1SA 2BYEA 4FN2A 4C4VB 3AULA 5BYQA 5DPTA 4IWOA 5FKAC 2MSED 1E8YA 4HPMB 4WURA 2RD0A 2ZEQA 4IC7B 3W9CB 1KLUD 1TS2A 3UI3A 2N9EB 2KO3A 2CKHB 2KFKB 3M3JA 2RDHA 2JU6X 2G9HD 4NQLB 1LQBA 2ZCCA 1WSPA 2NR2A 2DWQA 1IUEA 3APFA 1F1HA 2MJDA 3SFEB 3W1SC 2DLBA 2C60A 2KWUB 2BWFA 3NRZA 4N58A 3VXWA 2DNFA 2QIEB 2NPTA 1E5WA 1C77A 3KQ4A 4F8CB 2I1JA 2XN9C 3UQAA 4XC2A 3ZNGC 4M0WB 1DGJA 2IGGA 2BT6A 3P2BA 3KVFB 2W9NA 2H88B 2GOWA 1EU3A 2PE9A 3JYUA 2LI5A 3WALA 2KANA 3QAQA 1CZPA 1V97A 1IBXB 5D7GA 2ZZPB 3H7SA 1ROEA 2MX2A 2MP2A 4RGNA 4P1BC 1TBEA 2D3GA 1C3TA 1UUPA 2L1AA 2L00B 2WLBA 4GN1A 3N1XC 2AEHA 3AE8B 3PRZA 2FCSA 4MH8A 3PTFC 3PVLA 3QX1A 3DDCB 4MM3B 4XZ4A 3OAWA 2RDBC 4IM2A 4IM3A 4TQ0A 1N60A 1ZW7A 1L0VB 2BYTA 5IOIA 3RMKC 3D32A 2VRRB 3RNAC 1K53A 3HUIA 1ZGUB 2FCMA 2JRHA 1P7FA 3AE7B 1FRDA 2D10A 4ZDVA 2C5LC 2YVCA 1PDXA 2XBBC 4JLCA 3A1QB 3E9SA 4YSYB 2MEKA 3BYYB 1J7CA 5H92C 4GDLB 3AN1A 3VDZA 1SGHA 3RZFA 1WZ3A 1SEBD 1KJTA 4P6VF 1OQQA 2N0SB 1XO3A 2BS4B 4AJYB 3PGEA 4W9KA 1VZ8A 3QK0A 3B1LX 2QILA 1WFYA 4OVVA 4HK2A 4PS8A 4XDDA 4A55A 2W55A 1WJ6A 4WJOA 1TYGB 3L4PA 4FADA 1F52A 3VVWB 3P42A 1EWCA 1Q10A 1M4VA 5AZGA 2OJWA 2BKRB 4A3PA 3ETRA 3QC8B 3I57A 4BBNF 3IAS1 1P7EA 1ENFA 4I6LB 4NQKE 2KLCA 2WDTB 3EUB2 2MA9B 5JHBA 1C9FA 2GBMA 2JX5A 4NZLB 2HJ1A 2HJ8A 1PFDA 2LVOA 2LXCA 4DDGD 3HK0A 3NUHB 1FNWA 1E8WA 1YQ3B 3ZNID 4W9LA 1N5XA 2Z0EB 2IO3B 1EO6A 2RPVA 1I42A 3Q8FA 2WXGA 4WH4A 2WXIA 3PLVA 2PW9A 4FJYA 4EEWA 1FXAA 2JQRB 3DBRI 1UBQA 4HEA1 4YSZB 3R2IA 4YTMB 3RNBC 2BS3B 3LYYA 1E10A 2AQ1B 2K8HA 1C78A 2K5PA 2N9PC 1D5MC 3GZNB 1UGJA 1X1MA 1WGDA 2JRIB 4ZOHC 3RUIB 2ZVOA 2JSVX 4A90A 4DK5A 1JROA 3EHVA 2RDGA 1K51A 4LNNA 4PK1A 3AE9B 1QT9A 1LM8B 2NCNA 3ZQ4A 3R7RA 2M19A 3UINB 2W82A 3Q6BA 3QJZA 3NS8A 2KJ6A 3ZO5B 4M0WA 3A9KA 1SE2A 2MJEA 2Z59B 4GIVA 3EA6A 1KRHA 5D2MB 4RMAA 4WQOB 2X38A 3Q2AC 1UF0A 4EOYA 1H4RA 1P3QU 3OJ4B 3IBEA 1STEA 3IHPC 1MHXA 1SXTA 1WM3A 1FO4A 1GC7A 1VR9A 3WANA 1ZOYB 1VLBA 1HXYD 2V9HA 3BVGA 4KSLC 1NI3A 4HCPB 1WRIA 2J0KA 2LRUA 1IPGA 2WXMA 5AUKA 1A5RA 4HKQA 1TY2A 2D3BA 1XLQA 1YNTE 3IAM1 4KZ0A 2PVGC 3KLSX 5LXIB 3CSTA 4MDKE 2N9KA 2DZMA 1RAXA 2C7NB 5IO9A 3DVGX 2NVUI 4XE0A 3BWUD 3GE8C 2KTRB 2ASQA 1UD7A 4LDTB 5IN7A 4H2AA 1XCQL 3N30A 1HTQA 2EKIA 1GB4A 4EE2A 2EELA 1J7AA 5EE1A 1TS3A 4HLEA 1T0RC 3RNEC 1FRRA 2DBYA 3AMZA 2KJHB 1QF6A 5AEKB 1OTRB 1GPXA 2W3RA 2BB6A 3ALBA 4LDTD 2RPQA 4N59A 1NBFC 2VZKD 3M63B 5GXGB 1KOTA 3UIPB 3CMMB 5KHQA 1JRPA 3N3KB 1J19A 2INCC 3DBLB 2LRWA 1L2NA 1NYQA 1QKZA 4ARCA 1TS5A 2QHOA 5G5GA 4ANUA 2N7EA 2ICIA 4IWPA 3AU5A 5AUIA 4E71A 4AJWA 4AUQC 2FBWB 4ICVA 5C2TB 1YMHE 1E9MA 4JL9A 2J42A 2E3TA 1AYFA 1G6JA 1JWAD 4HJGE 2WXRA 1N6ZA 4BKGA 5BO4B 3C0RB 2GB1A 1I35A 1WMHB 1SB3C 2BVCA 2J7QB 2KNBA 3FKYA 2D3AA 2GBRA 2R2QA 4ZRJA 4YXDB 5LLIA 3Q3MC 2G3QB 2NBVB 1TY0A 1J7BA 1P98A 4WQMA 1MPEA 2KK8A 3OJ3A 5J18A 3H6NA 1FXIA 4CO7A 2AX5A 3VTVA 1NEKB 3FILA 1SSNA 2LVQA 3FC4A 4K1RB 4E74A 5IP4D 1V1OA 1NI2A 1XQQA 3RZWC 2IYDB 1D5ZC 3R3MA 2KKCA 3QA8A 2AQ2B 4YTNB 3KUDB 4A20A 1UGMA 4TQ1A 1GG3A 1UWMA 4BKTA 3KUZA 4XDCA 1HZ5A 4A6QA 3BK1A 2WXNA 3NOBA 4S0RA 3RPFC 1FD6A 1AARA 3ZUNA 3ZXVA 2WXQA 3IVFA 2A4ZA 4II2B 2KQ7A 2MLBA 4LNIA 2D5GA 2LGXA 2MW5A 3ZJUA 1JWSD 4RM8A 1WJ4A 1FFUA 3ZNHB 3T9LA 2PKOA 2Z8LA 3VUWA 4US9A 3VRBB 2DYMA 1WX9A 1E7PB 2IBIB 2Q5WD 4M01A 3Q8BA 5HHDG 1KM7A 3NVYA 1WIAA 2QMTA 2KQ4X 4NJ7A 3RT3B 4MEMA 3EC8A 3L0WB 2PMVA 4BKSA 3NVVA 1YJ1A 2QCZA 3HM3A 2FAZA 5D6JB 4JIOU 3L13A 2MHJA 3AXCA 3RCZA 3DWMA 1WXSA 2JF5A 2UU7A 3RNFC 1DOXA 2RGFA 1YJJA 1YQ4B 2RSUA 2ACZB 1K8RB 4A9AA 1KH0A 4FHJA 2G4DB 1VDVA 1M94A 4FJZA 4FA6A 2O2VA 3B9JA 4TV3A 5E6JA 2KHWB 2FUG1 3VUXA 5DPSA 3ZKJC 4XGAB 2DZIA 3DCGA 2JXXA 1TS4A 3HRDD 2L8JA 1XXGA 5TSSA 5HKHA 2K39A 2M1MA 3N1YC 4KIKA 1BT0A 1PGAA 1NENB 3NZUA 3ZW3A 4FLHA 3JW0X 1OEYA 3WAMA 1JWUD 1FCCC 2DENB 2M8SA 1GUAB 2XK5B 2OEDA 1Z5SB 4ZHOA 1ZDXA 3X0WA 2CJNA 2FE8A 4GOCA 5L95C 1K50A 1JMLA 1H8CA 4WWOA 3EFUA 1HE8A 4RGMA 2N9XA 3VTUA 2NPTB 3V6EB 2GRIA 4L23A 2OJRA 2EKEC 2K25A 3P63A 4W9FA 3ZYYX 5CHFA 3CF6E 4HPPA 4N6EB 1ZPSA 2ZCBA 3O65B 4GDLA 4MGIE 3N20C 2WXPA 4GGQA 2JYTA 2FCQA 4HPLB 3A1QA 2YEPB 2CJOA 3FILB 3GOEA 2V4IB 1T0YA 5HI1A 2J4XA 4GXBA 3J9CA 1P1AA 3KH0A 2L83A 3RD2A 2A5UA 2LFIA 2IDYA 1J8CA 3K9PB 4RFBA 3W5VB 3OWEB 2HTME 2N1VA 3V61A 4LNOA 4C4VA 4RNAA 1FMAD 4GSWA 2V1YA 2AL6A 2XK5A 2BYVE 3EFCA 1OFFA 5J17A 1E7VA 2VH1A 3IT6B 2ZJDA 1GOZA 1VRAB 1WGYA 2BWES 4MSQB 1R4NI 2PPHA 1ZKHA 1SE4A 4RH6A 1E0ZA 3PZ8A 3DVGY 1WF9A 3A9JA 2WDQB 5DCNA 3UIOB 3MC0B 4DQOC 2N4FA 2O2VB 3NG0A 3EGRA 3KYDD 1YX6B 3DQVA 3P4SB 1V49A 1DOYA 4K7WA 5FK9C 1C79A 5LNK1 3DBHB 1PYWD 1ACCA 1RFAA 2M56B 4YSXB 5C1ZA 2X8XX 1V5OA 4RF1A 3WAOA 2Y5PA 3P4RB 4MGYE 2JUOA 1TTNA 1DYQA 3DWGC 3TBLD 1A70A 2WX0A 2IO2B 2FCNA 3C8YA 4UDUC 2KDBA 2L05A 4O1NA 3BK2A 2KVZA 1TKEA 3L08A 2N1WA 3Q14C 3S2AA 3ZIMA 2KFKA 2NBWB 2KC2A 3SDLC 5J2RA 1WXMA 1UNSA 1F77A 2L3ZA 2LGDA 1VJKA 4D2KA 2ZPYA 1TJEA 2D3CA 1K52A 4HROA 1T3QA 2C7HA 4BKSD 3U30A 4MJSA 4US8A 1E8XA 2HD5B 3TCAA 1ZXHA 5L83A 1XD3B 1MJDA 1RM6C 2IO0B 5BMIA 2KD0A 4TUUA 4R3DA 1TKYA 3CWIA 3M62B 4EFOA 2I38A 4GLSC 3VUYA 2J53A 3T8MA 1F0ZA 3AEFB 2O6VB 1NDDA 4HDOA 4ARIA 3A9KB 4LLGM 3TJPA 1LO5D 3WCQA 4B0EA 2KTRA 1L4ZB 1YN4A 2K22A 3P4PB 2NMQA 2KX3A 5JH5C 2I1KA 2ZNVC 4GMVA 3NJTA 3PHXB 1DOIA 5E6PA 4MJSB 5HG2A 4L2YA 3E56A 3ABVB 2OOBB 4K3BA 1QILA 4IWQA 3ZRFA 1WGKA 1FPYA 1P9DU 1WMHA 2K6QA 1V80A 1UWXA 4ZRQA 1WI0A 2VH2A 1FXTB 3AB5A 1QQRA 4WWPA 3BY4B 3RNGC 3AE3B 2INDC 4WJPA 2LMCA 3R66C 2MQJA 4REZA 4JPSA 1JALA 2D07B 2JZZA 2KQSA 1SIJA 4P1CC 1QZEA 1SE3A 5IA7A 4C80A 4DHZE 3Q8CA 1I4GA 1TT5B 5KHOA 5EDSA 1PGXA 1WGHA 2FIFA 2KLGA 3JVZX 5G5HA 2WP9B 2WNMA 3Q69A 2WHIA 3DHIC 4B9KA 3DPDA 1U4AA 1XEEA 2ZW0A 2KACA 2WDVB 4OVZA 1P0RA 3APDA 3DBHI 2KN4A 3A33B 2KDEB 4ZRKA 4W9DA 3DHGC 5TR5A 4HJKA 3RI7C 3SHQA 1EM7A 1EUVB 1Q5WB 2LZ6A 3MFGA 3A9JB 1V6EA 2MBBB 3VH3B 4DXGA 3HVDA 1R4MB 3RULA 1WR6E 1LFDA 4Q2JA 3GE3C 1SE9A 1WE6A 5AZFA 1V1PA 2DAJA 2C7MB 2BKFA 3WA0A 1L0YB 1MG4A 1Y8RC 2VZKB 2K6DB 2OHFA 1B1ZA 3ZRCA 2INPE 2ZNVB 3GB1A 1MI0A 2IY0B 2MH7A 1YIWA 1WR1A 3ML9A 3TMPB 1EF1A 1FIQA 1WJUA 3NY5A 4IKGA 2D11A 4K81A 4M8MA 1F2RC 1PQSA 2YLMA 3PSEB 2DZKA 1IYFA 2HTHA 3TEWA 2MRPA 2M0AA 3Q3JA 5D3IB 1UH6A 4TKNA 1MHHE 2WXHA 3U52E 4CQNA 1RRBA 3TL5A 5E6NA 1JRUA 1WM2A 2ZVNA 1C4PA 4DHJD 4PS7A 4BFRA 1OGWA 1V86A 5DPWA 3HM6X 4ZYSA 2AYOB 2RR9A 2LUMA 4NPNA 4KV2A 3U7ZA 1SIFA 4ASWC 2NBUA 3H1UA 1WWTA 4J6IA 4RM9A 4LNKA 3PV1A 3RYTA 3M95A 2MJ3A 2BBCA 3N1ZC 1T5XD 2MBQA 2INNE 2N9LA 1ZXIA 1TIFA 2WU2B 4KIKB 1NYRA 5BMHA 2K8CA 4EZLA 1RWSA 3CSFA 3AECB 1E8ZA 3B0AA 4G11A 3MP9A 2R61A 3SD5A 2KC1A 3MHSD 5FR6A 1OQYA 2MP2B 2Y5BB 3VQIA 3EECA 3Q3OC 2W3SA 2FNJB 2BW2A 2QEJC 4NY0A 3VHTC 1FNUA 4C00A 3JSVA 5E6OA 4ZHPA 3A4SC 3W1YA 3JSVB 2H89B 2QDFA 3AE5B 5EE0A 3T3OA 1C4AA 4II3B 3ZGZA 1I4QA 1C1YB 2N7JA 2UWQA 4IG7B 4FULA 3VR8B 2PJHA 4LNFA 4YL8A 1ISNA 4DHJB 2PE6B 3TEXA 2B76B 4JWSC 2K9XA 3P1MA 4WJNA 1I4HA 5BMGA 4CYEA 1V9JA 2YEPF 4USAA 2D2QA 4MELA 1RFKA 1CQVA 3L54A 3QCAA 1L7YA 4RCOA 2LEKA 1L4DB 4TSSA 3PT2B 2QC8A 1D6EC 2KOXA 3ENEA 3ZTDA 3SEBA 1HQRD 3OG5A 4JE3B 2IY1B 4S17A 3V05A 1VZ6A 1FM0D 2IGHA 2L7RA 2Z0DB 3GZNI 2G1EA 3PLUA 2WWZA 3ZVVA 2EMSA 1Y56A 2LHEA 4A3OA 3TUOA 4XYCA 4B95A 2WXJA 3UGBB 5FR3A 1N61A 2SEBD 3K9OB 4AP4C 4FXCA 2REXA 5MPOA 2KTFA 3GS2A 3A4RA 4CHKA 4LJPB 1R4MI 4RGOS 2L0TA 2KWDA 1CMXB 2JWZA 3AE4B 2MWSB 1R4NB 4X57B 2JYEA 4KDLB 2BYFA 2QJLA 2V3NA 1XCTL 1EU4A 1WX8A 4C7ZA 4ANWA 1HZ6A 3HIZA 2KAJA 2L32A 4ZYNA 4ZRPA 2W54A 2UYZB 3FAHA 4J3OD 3V3XA 1QOFA 1QOBA 4TMAB 1IGCA 3KW5B 3QIJA 2NTSA 4BBNC 1V5TA 4MM3A 5JXVA 2LWPA 3LJ3A 3IT4B 3L16A 2BPSA 4NAWB 3TSSA 4AOFA 4I6PA 3U2SC 2IJ0A 3V62A 1TZOA 3LB8C 3IXSA 2CS4A 3WAPA 1YX5B 1JCKB 3R2TA 2EMTA 4LJOB 2AL3A 2XNAC 3KWVA 3I3TB 1Q0WB 5BYRA 1L6VA 4KGTA 1JWMD 1V2YA 3VTWA 1KFYB 2LGIA 1IBXA 1KF6B 4AQ7A 2M17A 2KJRA 1EWYC 3RN9C 4K3CA 3MTNB 2KDIA 3ZJTA 4WAFA 1HTOA 2KX0A 3BIID 1XLNA 3ZLZA 3SFDB 2AQ3B 2DHZA 1WXAA 4W9JA 1QOGA 4HVBA 2KDFB 3LDZE 4NNJB 1E6EB 2J0MA 3NS1A 4ACFA 2MBEA 2I2YA 3MHZA 3VFKA 1L6UA 2JZPA 2CU3A 2G45B 2V4LA 3R8BA 3W1SA 1YQBA 4YWGG 2GLSA 1TZ1A 4F7ZA 1UELA 1LGRA 3QHTA 1BUIC 3ECIA 3AI5A 2CR5A 2GBJA 2KT7A 2E6XA 1KLGD 1E90A 3BINA 2J52A 1V8CA 2ON8A 3ZDTA 3X23A 2HDEA 3ZTCA 1PGBA 2WX1A 1AWDA 1HEZE 2O6VA 3NZSA 4P7IA 2BF8B 4DHZB 3W2DA 4HRSA 3URYA 1FNVA 1WE7A 1AW7A 3ONSA 4L1BA 1IGDA 2IGDA 3WIMA 1BMLC 3PS6A 3LXFA 2WU5B 1GAQB 5C23A 2BB5A 5IAAC 2DAFA 1YOVB 2LXAA 3AM9A 3N32A 4DXFA 2Y5CA 1D5XC 4LTUA 1JW9D 5CHWA 3AV8A 3H7PB 2WQYB 2K0PA 3MC9A 2JZ3B 1SJHD 1SJED 1MFWA 3AU4A 1TGZB 1ZUD2 2JXTA 4K7SA 4NJ6A 3O13A 2JT4B 4RGTA 4BOSC 1E7UA 3PZ7A 3U4EG 3U8ZA 4I6NB 2XEWA 4C7YA 4JGHB 1GC6A 1WX7A 3H9DA 2WGSA 1L0XB 4K7UA 2FIDA 5BYSA 2LD9A 1WYWB 1WRDB 1NVID 1FFVA 4WAAA 4OZCA 4AS1A 4YTPB 2DYOA 3R7QA 4EKUA 1N5WA 2GI9A 1OQRA 3RNCC 3VR9B 4WIPA 1T6BX 4PT5A 4G3XB 1D3ZA 1AN8A 4PYZA 4W9IA 2BTEA 1I7HA 2LGSA 3L10B 4P16A 3AEGB 5GMVA 2CHWA 1ZP0B 2JPHA 1BXTA 3I9V1 4QAYA 4FBJB 2MBOA 3APCA 3MJWA 5AZHA 1KLVA 1WYGA 2K1FA 2WDRB 5JZEB 1ZDVA 4GDKA 1ESFA 3ZXRA 4OW0A 1TKGA 2R2OA 2CHXA 1IP9A 3AE6B 3DVNV 2PTLA 3Q3NC 4XWWA 4M02A 4MT5A 1RLFA 3MJ5A 1F9JA 1ZE3D 3ZNZB 1S1QB 2WS3B 3U7DA 2JWUA 3C19A 2L52A 2GBNA 2KWVB 3QQ8B 5D94A 2KMCA 3Q3FA 3UF8A 4BAXA 4M00A 4XX5A 1QOAA 2LVPA 3W5UB 1GB1A 4FJVB 1RYJA 3PPAA 3OLMD 1SBBB 1PUTA 3H8HA 3ZDMC 1WXVA 2BGFA 4KZCA 2O6VD 2Y3AA 3NVZA 3IFWB 4WWMA 3I63C 5CHVC 4KSKC 3VRAB 1GNUA 4BZAA 3B08A 4NAMA 5IKCM 2PEAA 3NHEB 4AWJA 2C9WB 1C4CA 4LCDE 2IPKD 3BYTB 2SAKA 2G4SA 2CHZA 3BVMA 5C3JB 1L5PA 2TSSA 4DXAB 5T8IA 1CJEA 4E3CA 1V1PB 3DBRB 4MGZE 3QARA 2KDMA 4DWFA 4JQWC 1EF5A 4ICUA 1WZ0A 4KDIC 4DDID 3PZDA 2KMMA 1WGGA 2MCNB 4KGRA 2LASA 3CIRB 1D4BA 5I4DA 3HVZA 4FHKA 4ZRIA 4ITKA 1UZXB 1WH3A 4KVGB 3UQBA 1F2RI 2ZW1A 2M4NA 3DBLI 2V3PA 4GDKB 4YT0B 4IDIA 4W9HA 5EE3A 4W9CA 3B2GA 4M8NA 1T0SC 3P4QB 1JWBD 4HCNB 3N9YC 2KZRA 3PRMB 4GU2A 2KWCA 2KXJA 4OZBA 2BS2B 1MVKA 4IUMB 3SU8X 1I4PA 3GP7A 3VAWA 3AE2B 5HFYA 1WJNA 4HDQA 1I4RA 3DOWA 4HKZE 4NJCA 3PREA 2L76A 1YD8U 4WWNA 1FCLA 4PYUA 3ZJVA 1XLPA 3AEBB 1I4XA 4KKIA 2PVOD 4BVUC 2K3UA 4WJQA 1B9RA 1WY8A 4ANVA 4IOIE 1FEHA 2WXOA 2L0FA 4PS3A 2LJIA 4B0MA 5DPRA 5G55A 3B2FA 1N63A 2BQQA 1WGRA 2WXLA 3RFZB 5EE9A 5CTRC 4W9GA 2ZPNA 2KMAA 1J0GA 1Q1OA 3AE1B 4GB9A 2HE7A 1N62A 4DBGA 2RMMA 3T3NA 3AEAB 3AH7A 4LK0M 3TEYA 3V60A 3BZDB 2WXKA 4B6WA 3DHHC 1VD2A 2V0GA 4A8XC 4EUTA 1S3SG 3IG3A 3H7PA 2LHDA 2B3AA 2NTTA 1KTKA 1R7SA 4IM0A 1YN3A 2DX5B 1WXQA 3DVNU 4JX1C 3NVWA 4HXDA 3TIXA 4IW0A 2FUHB 3L17A 3HHMA 4N9F4 3Q8EA 2GBKA 1CK1A 2ONQA 2WYQA 4KGSA 4OVUA 3VH4B 2K8BA 3BVZA 4G50A 1Z2MA 4RF0A 2DYBA 3AEDB
chains in the Genus database with same CATH topology
4MJSA 3CSTA 3MTNB 4MDKE 2DZMA 2KDIA 4MSMB 1RAXA 2C7NB 3DVGX 2V3SA 2KX0A 2NVUI 1LXDA 1E8XA 3ZLZA 2HD5B 2KTRB 2ASQA 2DHZA 1UD7A 2LJ5A 4W9EA 3TCAA 1WXAA 4LDTB 4W9JA 5L83A 1XD3B 4HVBA 2KDFB 3LDZE 4NNJB 2DZJA 2IO0B 3ML8A 2J0MA 3N30A 1V81A 2KD0A 2MBEA 4TUUA 3PHWB 3M62B 4EFOA 3DBSA 2AWTA 3VFKA 2LUEA 3VUYA 4MH0E 2G45B 2V4LA 4HLEA 5JHAA 2JVCA 3W1SA 4EZKA 1YQBA 3T8MA 1TZ1A 3V6CB 2JY6A 2KJHB 4F7ZA 1UELA 2KN5A 1UBIA 3QHTA 5AEKB 2O6VB 2IO1B 1NDDA 1OTRB 3ECIA 3AI5A 1VCBA 4G0NB 3A9KB 4HDOA 3TJPA 2CR5A 1OEYJ 3KYCD 3ALBA 4LDTD 2RPQA 2GBJA 2KTRA 1NBFC 4EZJA 5JH5C 1E90A 2KX3A 3BINA 2I1KA 2ZNVC 3M63B 4GMVA 3PHXB 2KFJA 2M0XA 2GMIC 1KOTA 3UIPB 3ZDTA 3X23A 3CMMB 5E6PA 4MJSB 5KHQA 4ANXA 5CX3A 3N3KB 3ZTCA 3QWZB 2WX1A 1J19A 3KUCB 4BOZB 2LRWA 2O6VA 3NZSA 3PRPB 4P7IA 1L2NA 2OOBB 4IWQA 2IZVB 2BF8B 3ZRFA 2LGYA 2NS5A 4DHZB 1MG8A 1P9DU 2QHOA 1WMHA 4ANUA 2K6QA 1V80A 2MBHA 2N7EA 5LXHA 4IWPA 1WI0A 3AU5A 1FXTB 4URKA 1WE7A 3ONSA 4WWPA 5G2NA 4AJWA 2N7DA 4E71A 3BY4B 3WIMA 4NAWA 4WJPA 2J0JA 3R66C 1GJZA 4AUQC 2MQJA 4ICVA 3PS6A 4JL9A 1XT9B 2D07B 2JZZA 2CU1A 4MGKE 2KQSA 5C23A 1G6JA 2KVRA 1QZEA 4HWIB 5IAAC 5IA7A 2DAFA 4BKGA 4DHZE 5BO4B 3C0RB 2LXAA 4F1SA 2BYEA 4FN2A 3N32A 1I35A 1WMHB 3AULA 5KHOA 5DPTA 4IWOA 5CHWA 2MSED 3H7PB 5EDSA 1E8YA 2J7QB 2KNBA 4HPMB 1WGHA 2RD0A 2FIFA 2KLGA 3JVZX 2JZ3B 2GBRA 2ZEQA 2R2QA 4IC7B 3AU4A 4ZRJA 1TGZB 5LLIA 2G3QB 3DPDA 4B9KA 1U4AA 2NBVB 4K7SA 4NJ6A 2N9EB 2KO3A 1P98A 2JT4B 2CKHB 1E7UA 2KK8A 2KFKB 3M3JA 3OJ3A 3H6NA 4BOSC 5J18A 4CO7A 3U8ZA 4I6NB 2XEWA 4JGHB 1GC6A 1WX7A 1P0RA 1LQBA 3H9DA 4NQLB 3APDA 2ZCCA 3VTVA 3DBHI 4K7UA 2NR2A 3A33B 2FIDA 2KDEB 2LVQA 4K1RB 4ZRKA 4W9DA 4E74A 2LD9A 1NI2A 1XQQA 1WYWB 1WRDB 3RZWC 2IYDB 4WAAA 3R3MA 5TR5A 4HJKA 3APFA 2KKCA 3QA8A 3SHQA 2DYOA 2LZ6A 1EUVB 1Q5WB 3R7QA 3W1SC 3A9JB 1V6EA 2C60A 1UGMA 2BWFA 2KWUB 2MBBB 3KUDB 4A20A 4EKUA 3VH3B 4TQ1A 3VXWA 1GG3A 3RULA 1WR6E 1LFDA 2NPTA 4BKTA 1E5WA 1SE9A 1WE6A 3KUZA 4F8CB 2I1JA 3UQAA 4XC2A 3ZNGC 5AZFA 4M0WB 2DAJA 2C7MB 2BKFA 3NOBA 3WA0A 3P2BA 1Y8RC 2K6DB 3KVFB 2W9NA 4G3XB 1AARA 3ZRCA 2GOWA 2ZNVB 1D3ZA 4PYZA 4W9IA 3ZUNA 2PE9A 2IY0B 2LI5A 3JYUA 3WALA 1YIWA 1WR1A 2KANA 2A4ZA 3IVFA 3ML9A 3QAQA 3TMPB 1EF1A 3L10B 4II2B 2KQ7A 2MLBA 1WJUA 3NY5A 5D7GA 2D11A 2LGXA 2ZZPB 3H7SA 2MW5A 4K81A 5GMVA 2CHWA 4M8MA 5LXIB 2JPHA 2MP2A 2MX2A 4RM8A 4FBJB 1WJ4A 2MBOA 1PQSA 2YLMA 1TBEA 2D3GA 2DZKA 3PSEB 2HTHA 1C3TA 3APCA 3ZNHB 2MRPA 1IYFA 3MJWA 2L00B 3Q3JA 5AZHA 3T9LA 4GN1A 1UH6A 4TKNA 3VUWA 1KLVA 2AEHA 2K1FA 1RRBA 2DYMA 1WX9A 3PRZA 5JZEB 2IBIB 4GDKA 3TL5A 2FCSA 5E6NA 1JRUA 1WM2A 1KM7A 2R2OA 2ZVNA 2CHXA 3PTFC 1IP9A 3PVLA 3QX1A 1WIAA 3DDCB 4DHJD 4PS7A 4BFRA 1OGWA 1V86A 3DVNV 4XZ4A 4NJ7A 5DPWA 3HM6X 3RT3B 4MEMA 3EC8A 3L0WB 3OAWA 2AYOB 4BKSA 4IM2A 4IM3A 1YJ1A 4TQ0A 2RR9A 1RLFA 4NPNA 3HM3A 1ZW7A 4KV2A 1SIFA 4ASWC 2NBUA 2FAZA 5D6JB 3H1UA 3D32A 4JIOU 3VTUA 1F9JA 3L13A 3AXCA 3RCZA 2VRRB 1WXSA 4J6IA 3ZNZB 4RM9A 2JF5A 1S1QB 3U7DA 3PV1A 3RYTA 1ZGUB 2FCMA 2JRHA 3M95A 2RGFA 2GBNA 2RSUA 2KWVB 3QQ8B 1K8RB 2D10A 5D94A 4ZDVA 2KMCA 2C5LC 2YVCA 2G4DB 4FHJA 2XBBC 3Q3FA 2MBQA 3UF8A 4XX5A 1M94A 4FJZA 2LVPA 4JLCA 4FA6A 3A1QB 2O2VA 4TV3A 4FJVB 4KIKB 3PPAA 3OLMD 2KHWB 4GDLB 3VDZA 1SGHA 3RZFA 1WZ3A 1KJTA 3ZDMC 1WXVA 2BGFA 4KZCA 2K8CA 3VUXA 2O6VD 5DPSA 4EZLA 3IFWB 3CSFA 3ZKJC 4AJYB 1E8ZA 3PGEA 4W9KA 2DZIA 3B0AA 3DCGA 4G11A 2JXXA 2KC1A 3SD5A 3QK0A 3MHSD 2L8JA 5FR6A 1OQYA 2MP2B 4KSKC 5CHVC 2K39A 5HKHA 2Y5BB 2M1MA 1GNUA 3B1LX 3B08A 4KIKA 3VQIA 3EECA 2PEAA 1WFYA 1BT0A 2FNJB 3NHEB 4OVVA 4AWJA 2C9WB 4HK2A 4NY0A 3VHTC 3NZUA 4PS8A 3ZW3A 4FLHA 3JW0X 1OEYA 4LCDE 3WAMA 3JSVA 1WJ6A 5E6OA 2M8SA 2DENB 3A4SC 4WJOA 1GUAB 2G4SA 3W1YA 2XK5B 2CHZA 1Z5SB 4DXAB 4FADA 3JSVB 3X0WA 4E3CA 4GOCA 3VVWB 4II3B 5L95C 4MGZE 3QARA 1H8CA 4DWFA 1C1YB 4WWOA 2UWQA 4IG7B 1EF5A 1HE8A 3EFUA 2N9XA 4FULA 4ICUA 4JQWC 5AZGA 1WZ0A 2NPTB 4KDIC 4DDID 3PZDA 2PJHA 3V6EB 2BKRB 4A3PA 1WGGA 4YL8A 2MCNB 1ISNA 2OJRA 2LASA 2EKEC 3QC8B 2K25A 4BBNF 4W9FA 5CHFA 4DHJB 2PE6B 3CF6E 4I6LB 4NQKE 4FHKA 2KLCA 2ZCBA 2WDTB 3O65B 4GDLA 1UZXB 4MGIE 4WJNA 4ZRIA 1WH3A 4CYEA 4GGQA 2MA9B 1V9JA 4KVGB 3UQBA 2FCQA 3DBLI 2M4NA 4HPLB 3A1QA 5JHBA 2D2QA 4MELA 3GOEA 2GBMA 4GDKB 4W9HA 3L54A 2HJ8A 2LVOA 3QCAA 2LXCA 1L7YA 1T0YA 4W9CA 4GXBA 4DDGD 3HK0A 1P1AA 3KH0A 1E8WA 3PT2B 3RD2A 4M8NA 2A5UA 3ZNID 2Z0EB 4HCNB 4W9LA 2KOXA 2KZRA 1J8CA 2IO3B 3ENEA 3ZTDA 3K9PB 3PRMB 4GU2A 2KWCA 2KXJA 4IUMB 3SU8X 1EO6A 2IY1B 1I42A 3VAWA 3V61A 2N1VA 3PLVA 4FJYA 4EEWA 4GSWA 1WJNA 4HDQA 3DBRI 2V1YA 2AL6A 2L7RA 2XK5A 1UBQA 2BYVE 3DOWA 2Z0DB 3GZNI 5J17A 1E7VA 3PREA 2L76A 3PLUA 2WWZA 1YD8U 3ZVVA 2EMSA 2ZJDA 4WWNA 4A3OA 1WGYA 2BWES 4B95A 4PYUA 4MSQB 3UGBB 3K9OB 1R4NI 2K8HA 4AP4C 2PPHA 1ZKHA 2REXA 4BKSD 2KTFA 4BVUC 2N9PC 3A4RA 4CHKA 1X1MA 4LJPB 3DVGY 1WGDA 4WJQA 2JRIB 1WY8A 3RUIB 4ANVA 1R4MI 2ZVOA 4DK5A 1WF9A 3A9JA 3EHVA 2L0TA 5DCNA 3UIOB 2L0FA 1CMXB 4PS3A 2JWZA 2N4FA 2O2VB 5DPRA 2MWSB 5G55A 3KYDD 4X57B 1YX6B 1WGRA 3DQVA 1V49A 4KDLB 4K7WA 1LM8B 5CTRC 2ZPNA 4W9GA 2KMAA 2NCNA 1Q1OA 2BYFA 1J0GA 4GB9A 2HE7A 4DBGA 3R7RA 1WX8A 1RFAA 4ANWA 3HIZA 3UINB 5C1ZA 3V60A 3QJZA 3NS8A 1V5OA 2KJ6A 3WAOA 3ZO5B 4B6WA 4ZYNA 3A9KA 1VD2A 2UYZB 2Z59B 4GIVA 4MGYE 2JUOA 4EUTA 1S3SG 3IG3A 1TTNA 3H7PA 2B3AA 3TBLD 5D2MB 4RMAA 4WQOB 2WX0A 2IO2B 3KW5B 2FCNA 3QIJA 4EOYA 4BBNC 1H4RA 1P3QU 1V5TA 3OJ4B 2KDBA 4IM0A 3IBEA 3IHPC 2L05A 1WM3A 4MM3A 2DX5B 1GC7A 3DVNU 2LWPA 3WANA 3LJ3A 3L16A 2BPSA 3L08A 2N1WA 4HXDA 4IW0A 2FUHB 4NAWB 3TIXA 4AOFA 4I6PA 3L17A 3V62A 4KSLC 3S2AA 3HHMA 4N9F4 3ZIMA 2KFKA 2GBKA 4HCPB 2J0KA 2NBWB 2LRUA 2CS4A 2KC2A 3SDLC 3WAPA 5J2RA 1YX5B 1IPGA 1WXMA 2EMTA 2WYQA 4LJOB 2AL3A 1A5RA 3I3TB 4OVUA 2L3ZA 2LGDA 1Q0WB 3VH4B 2K8BA 4G50A 1Z2MA 1V2YA 2ZPYA 3VTWA 2DYBA 4KZ0A 2C7HA 2M17A 3U30A 2KJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS A;  3CST A;  3MTN B;  4MDK E;  2DZM A;  2KDI A;  4MSM B;  1RAX A;  2C7N B;  3DVG X;  2V3S A;  2KX0 A;  2NVU I;  1LXD A;  1E8X A;  3ZLZ A;  2HD5 B;  2KTR B;  2ASQ A;  2DHZ A;  1UD7 A;  2LJ5 A;  4W9E A;  3TCA A;  1WXA A;  4LDT B;  4W9J A;  5L83 A;  1XD3 B;  4HVB A;  2KDF B;  3LDZ E;  4NNJ B;  2DZJ A;  2IO0 B;  3ML8 A;  2J0M A;  3N30 A;  1V81 A;  2KD0 A;  2MBE A;  4TUU A;  3PHW B;  3M62 B;  4EFO A;  3DBS A;  2AWT A;  3VFK A;  2LUE A;  3VUY A;  4MH0 E;  2G45 B;  2V4L A;  4HLE A;  5JHA A;  2JVC A;  3W1S A;  4EZK A;  1YQB A;  3T8M A;  1TZ1 A;  3V6C B;  2JY6 A;  2KJH B;  4F7Z A;  1UEL A;  2KN5 A;  1UBI A;  3QHT A;  5AEK B;  2O6V B;  2IO1 B;  1NDD A;  1OTR B;  3ECI A;  3AI5 A;  1VCB A;  4G0N B;  3A9K B;  4HDO A;  3TJP A;  2CR5 A;  1OEY J;  3KYC D;  3ALB A;  4LDT D;  2RPQ A;  2GBJ A;  2KTR A;  1NBF C;  4EZJ A;  5JH5 C;  1E90 A;  2KX3 A;  3BIN A;  2I1K A;  2ZNV C;  3M63 B;  4GMV A;  3PHX B;  2KFJ A;  2M0X A;  2GMI C;  1KOT A;  3UIP B;  3ZDT A;  3X23 A;  3CMM B;  5E6P A;  4MJS B;  5KHQ A;  4ANX A;  5CX3 A;  3N3K B;  3ZTC A;  3QWZ B;  2WX1 A;  1J19 A;  3KUC B;  4BOZ B;  2LRW A;  2O6V A;  3NZS A;  3PRP B;  4P7I A;  1L2N A;  2OOB B;  4IWQ A;  2IZV B;  2BF8 B;  3ZRF A;  2LGY A;  2NS5 A;  4DHZ B;  1MG8 A;  1P9D U;  2QHO A;  1WMH A;  4ANU A;  2K6Q A;  1V80 A;  2MBH A;  2N7E A;  5LXH A;  4IWP A;  1WI0 A;  3AU5 A;  1FXT B;  4URK A;  1WE7 A;  3ONS A;  4WWP A;  5G2N A;  4AJW A;  2N7D A;  4E71 A;  3BY4 B;  3WIM A;  4NAW A;  4WJP A;  2J0J A;  3R66 C;  1GJZ A;  4AUQ C;  2MQJ A;  4ICV A;  3PS6 A;  4JL9 A;  1XT9 B;  2D07 B;  2JZZ A;  2CU1 A;  4MGK E;  2KQS A;  5C23 A;  1G6J A;  2KVR A;  1QZE A;  4HWI B;  5IAA C;  5IA7 A;  2DAF A;  4BKG A;  4DHZ E;  5BO4 B;  3C0R B;  2LXA A;  4F1S A;  2BYE A;  4FN2 A;  3N32 A;  1I35 A;  1WMH B;  3AUL A;  5KHO A;  5DPT A;  4IWO A;  5CHW A;  2MSE D;  3H7P B;  5EDS A;  1E8Y A;  2J7Q B;  2KNB A;  4HPM B;  1WGH A;  2RD0 A;  2FIF A;  2KLG A;  3JVZ X;  2JZ3 B;  2GBR A;  2ZEQ A;  2R2Q A;  4IC7 B;  3AU4 A;  4ZRJ A;  1TGZ B;  5LLI A;  2G3Q B;  3DPD A;  4B9K A;  1U4A A;  2NBV B;  4K7S A;  4NJ6 A;  2N9E B;  2KO3 A;  1P98 A;  2JT4 B;  2CKH B;  1E7U A;  2KK8 A;  2KFK B;  3M3J A;  3OJ3 A;  3H6N A;  4BOS C;  5J18 A;  4CO7 A;  3U8Z A;  4I6N B;  2XEW A;  4JGH B;  1GC6 A;  1WX7 A;  1P0R A;  1LQB A;  3H9D A;  4NQL B;  3APD A;  2ZCC A;  3VTV A;  3DBH I;  4K7U A;  2NR2 A;  3A33 B;  2FID A;  2KDE B;  2LVQ A;  4K1R B;  4ZRK A;  4W9D A;  4E74 A;  2LD9 A;  1NI2 A;  1XQQ A;  1WYW B;  1WRD B;  3RZW C;  2IYD B;  4WAA A;  3R3M A;  5TR5 A;  4HJK A;  3APF A;  2KKC A;  3QA8 A;  3SHQ A;  2DYO A;  2LZ6 A;  1EUV B;  1Q5W B;  3R7Q A;  3W1S C;  3A9J B;  1V6E A;  2C60 A;  1UGM A;  2BWF A;  2KWU B;  2MBB B;  3KUD B;  4A20 A;  4EKU A;  3VH3 B;  4TQ1 A;  3VXW A;  1GG3 A;  3RUL A;  1WR6 E;  1LFD A;  2NPT A;  4BKT A;  1E5W A;  1SE9 A;  1WE6 A;  3KUZ A;  4F8C B;  2I1J A;  3UQA A;  4XC2 A;  3ZNG C;  5AZF A;  4M0W B;  2DAJ A;  2C7M B;  2BKF A;  3NOB A;  3WA0 A;  3P2B A;  1Y8R C;  2K6D B;  3KVF B;  2W9N A;  4G3X B;  1AAR A;  3ZRC A;  2GOW A;  2ZNV B;  1D3Z A;  4PYZ A;  4W9I A;  3ZUN A;  2PE9 A;  2IY0 B;  2LI5 A;  3JYU A;  3WAL A;  1YIW A;  1WR1 A;  2KAN A;  2A4Z A;  3IVF A;  3ML9 A;  3QAQ A;  3TMP B;  1EF1 A;  3L10 B;  4II2 B;  2KQ7 A;  2MLB A;  1WJU A;  3NY5 A;  5D7G A;  2D11 A;  2LGX A;  2ZZP B;  3H7S A;  2MW5 A;  4K81 A;  5GMV A;  2CHW A;  4M8M A;  5LXI B;  2JPH A;  2MP2 A;  2MX2 A;  4RM8 A;  4FBJ B;  1WJ4 A;  2MBO A;  1PQS A;  2YLM A;  1TBE A;  2D3G A;  2DZK A;  3PSE B;  2HTH A;  1C3T A;  3APC A;  3ZNH B;  2MRP A;  1IYF A;  3MJW A;  2L00 B;  3Q3J A;  5AZH A;  3T9L A;  4GN1 A;  1UH6 A;  4TKN A;  3VUW A;  1KLV A;  2AEH A;  2K1F A;  1RRB A;  2DYM A;  1WX9 A;  3PRZ A;  5JZE B;  2IBI B;  4GDK A;  3TL5 A;  2FCS A;  5E6N A;  1JRU A;  1WM2 A;  1KM7 A;  2R2O A;  2ZVN A;  2CHX A;  3PTF C;  1IP9 A;  3PVL A;  3QX1 A;  1WIA A;  3DDC B;  4DHJ D;  4PS7 A;  4BFR A;  1OGW A;  1V86 A;  3DVN V;  4XZ4 A;  4NJ7 A;  5DPW A;  3HM6 X;  3RT3 B;  4MEM A;  3EC8 A;  3L0W B;  3OAW A;  2AYO B;  4BKS A;  4IM2 A;  4IM3 A;  1YJ1 A;  4TQ0 A;  2RR9 A;  1RLF A;  4NPN A;  3HM3 A;  1ZW7 A;  4KV2 A;  1SIF A;  4ASW C;  2NBU A;  2FAZ A;  5D6J B;  3H1U A;  3D32 A;  4JIO U;  3VTU A;  1F9J A;  3L13 A;  3AXC A;  3RCZ A;  2VRR B;  1WXS A;  4J6I A;  3ZNZ B;  4RM9 A;  2JF5 A;  1S1Q B;  3U7D A;  3PV1 A;  3RYT A;  1ZGU B;  2FCM A;  2JRH A;  3M95 A;  2RGF A;  2GBN A;  2RSU A;  2KWV B;  3QQ8 B;  1K8R B;  2D10 A;  5D94 A;  4ZDV A;  2KMC A;  2C5L C;  2YVC A;  2G4D B;  4FHJ A;  2XBB C;  3Q3F A;  2MBQ A;  3UF8 A;  4XX5 A;  1M94 A;  4FJZ A;  2LVP A;  4JLC A;  4FA6 A;  3A1Q B;  2O2V A;  4TV3 A;  4FJV B;  4KIK B;  3PPA A;  3OLM D;  2KHW B;  4GDL B;  3VDZ A;  1SGH A;  3RZF A;  1WZ3 A;  1KJT A;  3ZDM C;  1WXV A;  2BGF A;  4KZC A;  2K8C A;  3VUX A;  2O6V D;  5DPS A;  4EZL A;  3IFW B;  3CSF A;  3ZKJ C;  4AJY B;  1E8Z A;  3PGE A;  4W9K A;  2DZI A;  3B0A A;  3DCG A;  4G11 A;  2JXX A;  2KC1 A;  3SD5 A;  3QK0 A;  3MHS D;  2L8J A;  5FR6 A;  1OQY A;  2MP2 B;  4KSK C;  5CHV C;  2K39 A;  5HKH A;  2Y5B B;  2M1M A;  1GNU A;  3B1L X;  3B08 A;  4KIK A;  3VQI A;  3EEC A;  2PEA A;  1WFY A;  1BT0 A;  2FNJ B;  3NHE B;  4OVV A;  4AWJ A;  2C9W B;  4HK2 A;  4NY0 A;  3VHT C;  3NZU A;  4PS8 A;  3ZW3 A;  4FLH A;  3JW0 X;  1OEY A;  4LCD E;  3WAM A;  3JSV A;  1WJ6 A;  5E6O A;  2M8S A;  2DEN B;  3A4S C;  4WJO A;  1GUA B;  2G4S A;  3W1Y A;  2XK5 B;  2CHZ A;  1Z5S B;  4DXA B;  4FAD A;  3JSV B;  3X0W A;  4E3C A;  4GOC A;  3VVW B;  4II3 B;  5L95 C;  4MGZ E;  3QAR A;  1H8C A;  4DWF A;  1C1Y B;  4WWO A;  2UWQ A;  4IG7 B;  1EF5 A;  1HE8 A;  3EFU A;  2N9X A;  4FUL A;  4ICU A;  4JQW C;  5AZG A;  1WZ0 A;  2NPT B;  4KDI C;  4DDI D;  3PZD A;  2PJH A;  3V6E B;  2BKR B;  4A3P A;  1WGG A;  4YL8 A;  2MCN B;  1ISN A;  2OJR A;  2LAS A;  2EKE C;  3QC8 B;  2K25 A;  4BBN F;  4W9F A;  5CHF A;  4DHJ B;  2PE6 B;  3CF6 E;  4I6L B;  4NQK E;  4FHK A;  2KLC A;  2ZCB A;  2WDT B;  3O65 B;  4GDL A;  1UZX B;  4MGI E;  4WJN A;  4ZRI A;  1WH3 A;  4CYE A;  4GGQ A;  2MA9 B;  1V9J A;  4KVG B;  3UQB A;  2FCQ A;  3DBL I;  2M4N A;  4HPL B;  3A1Q A;  5JHB A;  2D2Q A;  4MEL A;  3GOE A;  2GBM A;  4GDK B;  4W9H A;  3L54 A;  2HJ8 A;  2LVO A;  3QCA A;  2LXC A;  1L7Y A;  1T0Y A;  4W9C A;  4GXB A;  4DDG D;  3HK0 A;  1P1A A;  3KH0 A;  1E8W A;  3PT2 B;  3RD2 A;  4M8N A;  2A5U A;  3ZNI D;  2Z0E B;  4HCN B;  4W9L A;  2KOX A;  2KZR A;  1J8C A;  2IO3 B;  3ENE A;  3ZTD A;  3K9P B;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  4IUM B;  3SU8 X;  1EO6 A;  2IY1 B;  1I42 A;  3VAW A;  3V61 A;  2N1V A;  3PLV A;  4FJY A;  4EEW A;  4GSW A;  1WJN A;  4HDQ A;  3DBR I;  2V1Y A;  2AL6 A;  2L7R A;  2XK5 A;  1UBQ A;  2BYV E;  3DOW A;  2Z0D B;  3GZN I;  5J17 A;  1E7V A;  3PRE A;  2L76 A;  3PLU A;  2WWZ A;  1YD8 U;  3ZVV A;  2EMS A;  2ZJD A;  4WWN A;  4A3O A;  1WGY A;  2BWE S;  4B95 A;  4PYU A;  4MSQ B;  3UGB B;  3K9O B;  1R4N I;  2K8H A;  4AP4 C;  2PPH A;  1ZKH A;  2REX A;  4BKS D;  2KTF A;  4BVU C;  2N9P C;  3A4R A;  4CHK A;  1X1M A;  4LJP B;  3DVG Y;  1WGD A;  4WJQ A;  2JRI B;  1WY8 A;  3RUI B;  4ANV A;  1R4M I;  2ZVO A;  4DK5 A;  1WF9 A;  3A9J A;  3EHV A;  2L0T A;  5DCN A;  3UIO B;  2L0F A;  1CMX B;  4PS3 A;  2JWZ A;  2N4F A;  2O2V B;  5DPR A;  2MWS B;  5G55 A;  3KYD D;  4X57 B;  1YX6 B;  1WGR A;  3DQV A;  1V49 A;  4KDL B;  4K7W A;  1LM8 B;  5CTR C;  2ZPN A;  4W9G A;  2KMA A;  2NCN A;  1Q1O A;  2BYF A;  1J0G A;  4GB9 A;  2HE7 A;  4DBG A;  3R7R A;  1WX8 A;  1RFA A;  4ANW A;  3HIZ A;  3UIN B;  5C1Z A;  3V60 A;  3QJZ A;  3NS8 A;  1V5O A;  2KJ6 A;  3WAO A;  3ZO5 B;  4B6W A;  4ZYN A;  3A9K A;  1VD2 A;  2UYZ B;  2Z59 B;  4GIV A;  4MGY E;  2JUO A;  4EUT A;  1S3S G;  3IG3 A;  1TTN A;  3H7P A;  2B3A A;  3TBL D;  5D2M B;  4RMA A;  4WQO B;  2WX0 A;  2IO2 B;  3KW5 B;  2FCN A;  3QIJ A;  4EOY A;  4BBN C;  1H4R A;  1P3Q U;  1V5T A;  3OJ4 B;  2KDB A;  4IM0 A;  3IBE A;  3IHP C;  2L05 A;  1WM3 A;  4MM3 A;  2DX5 B;  1GC7 A;  3DVN U;  2LWP A;  3WAN A;  3LJ3 A;  3L16 A;  2BPS A;  3L08 A;  2N1W A;  4HXD A;  4IW0 A;  2FUH B;  4NAW B;  3TIX A;  4AOF A;  4I6P A;  3L17 A;  3V62 A;  4KSL C;  3S2A A;  3HHM A;  4N9F 4;  3ZIM A;  2KFK A;  2GBK A;  4HCP B;  2J0K A;  2NBW B;  2LRU A;  2CS4 A;  2KC2 A;  3SDL C;  3WAP A;  5J2R A;  1YX5 B;  1IPG A;  1WXM A;  2EMT A;  2WYQ A;  4LJO B;  2AL3 A;  1A5R A;  3I3T B;  4OVU A;  2L3Z A;  2LGD A;  1Q0W B;  3VH4 B;  2K8B A;  4G50 A;  1Z2M A;  1V2Y A;  2ZPY A;  3VTW A;  2DYB A;  4KZ0 A;  2C7H A;  2M17 A;  3U30 A;  2KJR A; 
#chains in the Genus database with same CATH topology
 5D3D A;  4MSM B;  2V3S A;  1LXD A;  2LJ5 A;  4W9E A;  2DZJ A;  3ML8 A;  3Q8A A;  1V81 A;  2QSD A;  4XWT A;  1QLB B;  3PHW B;  3DBS A;  3NZ3 A;  2AWT A;  3PO0 A;  2LUE A;  4MH0 E;  5JHA A;  4KKJ A;  2JVC A;  4OHJ A;  4EZK A;  3V6C B;  2JY6 A;  3MC8 A;  2KN5 A;  1ET6 A;  1C76 A;  1UBI A;  1VZ7 A;  2IO1 B;  1VCB A;  4G0N B;  1OEY J;  4OZA A;  3KYC D;  1SF0 A;  4EZJ A;  5H8Y E;  1YN5 A;  2KFJ A;  2GMI C;  2M0X A;  1T0Q C;  2WXF A;  4ANX A;  5CX3 A;  1XF5 L;  3SR6 A;  3QWZ B;  3KUC B;  4BOZ B;  3AEE B;  3PRP B;  2PLP A;  2IZV B;  2LGY A;  4MAC A;  2NS5 A;  1MG8 A;  2MBH A;  5LXH A;  3I5J C;  2KYW A;  1JQ4 A;  4URK A;  1YJI A;  1ET9 A;  5G2N A;  2N7D A;  4JWU C;  2PIA A;  4NAW A;  3TEZ A;  1XLO A;  2J0J A;  1GJZ A;  4C56 C;  4KX6 B;  1XT9 B;  3KWL A;  1HA5 A;  2CU1 A;  4MGK E;  2KVR A;  4HWI B;  4F1S A;  2BYE A;  4FN2 A;  4C4V B;  3AUL A;  5BYQ A;  5DPT A;  4IWO A;  5FKA C;  2MSE D;  1E8Y A;  4HPM B;  4WUR A;  2RD0 A;  2ZEQ A;  4IC7 B;  3W9C B;  1KLU D;  1TS2 A;  3UI3 A;  2N9E B;  2KO3 A;  2CKH B;  2KFK B;  3M3J A;  2RDH A;  2JU6 X;  2G9H D;  4NQL B;  1LQB A;  2ZCC A;  1WSP A;  2NR2 A;  2DWQ A;  1IUE A;  3APF A;  1F1H A;  2MJD A;  3SFE B;  3W1S C;  2DLB A;  2C60 A;  2KWU B;  2BWF A;  3NRZ A;  4N58 A;  3VXW A;  2DNF A;  2QIE B;  2NPT A;  1E5W A;  1C77 A;  3KQ4 A;  4F8C B;  2I1J A;  2XN9 C;  3UQA A;  4XC2 A;  3ZNG C;  4M0W B;  1DGJ A;  2IGG A;  2BT6 A;  3P2B A;  3KVF B;  2W9N A;  2H88 B;  2GOW A;  1EU3 A;  2PE9 A;  3JYU A;  2LI5 A;  3WAL A;  2KAN A;  3QAQ A;  1CZP A;  1V97 A;  1IBX B;  5D7G A;  2ZZP B;  3H7S A;  1ROE A;  2MX2 A;  2MP2 A;  4RGN A;  4P1B C;  1TBE A;  2D3G A;  1C3T A;  1UUP A;  2L1A A;  2L00 B;  2WLB A;  4GN1 A;  3N1X C;  2AEH A;  3AE8 B;  3PRZ A;  2FCS A;  4MH8 A;  3PTF C;  3PVL A;  3QX1 A;  3DDC B;  4MM3 B;  4XZ4 A;  3OAW A;  2RDB C;  4IM2 A;  4IM3 A;  4TQ0 A;  1N60 A;  1ZW7 A;  1L0V B;  2BYT A;  5IOI A;  3RMK C;  3D32 A;  2VRR B;  3RNA C;  1K53 A;  3HUI A;  1ZGU B;  2FCM A;  2JRH A;  1P7F A;  3AE7 B;  1FRD A;  2D10 A;  4ZDV A;  2C5L C;  2YVC A;  1PDX A;  2XBB C;  4JLC A;  3A1Q B;  3E9S A;  4YSY B;  2MEK A;  3BYY B;  1J7C A;  5H92 C;  4GDL B;  3AN1 A;  3VDZ A;  1SGH A;  3RZF A;  1WZ3 A;  1SEB D;  1KJT A;  4P6V F;  1OQQ A;  2N0S B;  1XO3 A;  2BS4 B;  4AJY B;  3PGE A;  4W9K A;  1VZ8 A;  3QK0 A;  3B1L X;  2QIL A;  1WFY A;  4OVV A;  4HK2 A;  4PS8 A;  4XDD A;  4A55 A;  2W55 A;  1WJ6 A;  4WJO A;  1TYG B;  3L4P A;  4FAD A;  1F52 A;  3VVW B;  3P42 A;  1EWC A;  1Q10 A;  1M4V A;  5AZG A;  2OJW A;  2BKR B;  4A3P A;  3ETR A;  3QC8 B;  3I57 A;  4BBN F;  3IAS 1;  1P7E A;  1ENF A;  4I6L B;  4NQK E;  2KLC A;  2WDT B;  3EUB 2;  2MA9 B;  5JHB A;  1C9F A;  2GBM A;  2JX5 A;  4NZL B;  2HJ1 A;  2HJ8 A;  1PFD A;  2LVO A;  2LXC A;  4DDG D;  3HK0 A;  3NUH B;  1FNW A;  1E8W A;  1YQ3 B;  3ZNI D;  4W9L A;  1N5X A;  2Z0E B;  2IO3 B;  1EO6 A;  2RPV A;  1I42 A;  3Q8F A;  2WXG A;  4WH4 A;  2WXI A;  3PLV A;  2PW9 A;  4FJY A;  4EEW A;  1FXA A;  2JQR B;  3DBR I;  1UBQ A;  4HEA 1;  4YSZ B;  3R2I A;  4YTM B;  3RNB C;  2BS3 B;  3LYY A;  1E10 A;  2AQ1 B;  2K8H A;  1C78 A;  2K5P A;  2N9P C;  1D5M C;  3GZN B;  1UGJ A;  1X1M A;  1WGD A;  2JRI B;  4ZOH C;  3RUI B;  2ZVO A;  2JSV X;  4A90 A;  4DK5 A;  1JRO A;  3EHV A;  2RDG A;  1K51 A;  4LNN A;  4PK1 A;  3AE9 B;  1QT9 A;  1LM8 B;  2NCN A;  3ZQ4 A;  3R7R A;  2M19 A;  3UIN B;  2W82 A;  3Q6B A;  3QJZ A;  3NS8 A;  2KJ6 A;  3ZO5 B;  4M0W A;  3A9K A;  1SE2 A;  2MJE A;  2Z59 B;  4GIV A;  3EA6 A;  1KRH A;  5D2M B;  4RMA A;  4WQO B;  2X38 A;  3Q2A C;  1UF0 A;  4EOY A;  1H4R A;  1P3Q U;  3OJ4 B;  3IBE A;  1STE A;  3IHP C;  1MHX A;  1SXT A;  1WM3 A;  1FO4 A;  1GC7 A;  1VR9 A;  3WAN A;  1ZOY B;  1VLB A;  1HXY D;  2V9H A;  3BVG A;  4KSL C;  1NI3 A;  4HCP B;  1WRI A;  2J0K A;  2LRU A;  1IPG A;  2WXM A;  5AUK A;  1A5R A;  4HKQ A;  1TY2 A;  2D3B A;  1XLQ A;  1YNT E;  3IAM 1;  4KZ0 A;  2PVG C;  3KLS X;  5LXI B;  3CST A;  4MDK E;  2N9K A;  2DZM A;  1RAX A;  2C7N B;  5IO9 A;  3DVG X;  2NVU I;  4XE0 A;  3BWU D;  3GE8 C;  2KTR B;  2ASQ A;  1UD7 A;  4LDT B;  5IN7 A;  4H2A A;  1XCQ L;  3N30 A;  1HTQ A;  2EKI A;  1GB4 A;  4EE2 A;  2EEL A;  1J7A A;  5EE1 A;  1TS3 A;  4HLE A;  1T0R C;  3RNE C;  1FRR A;  2DBY A;  3AMZ A;  2KJH B;  1QF6 A;  5AEK B;  1OTR B;  1GPX A;  2W3R A;  2BB6 A;  3ALB A;  4LDT D;  2RPQ A;  4N59 A;  1NBF C;  2VZK D;  3M63 B;  5GXG B;  1KOT A;  3UIP B;  3CMM B;  5KHQ A;  1JRP A;  3N3K B;  1J19 A;  2INC C;  3DBL B;  2LRW A;  1L2N A;  1NYQ A;  1QKZ A;  4ARC A;  1TS5 A;  2QHO A;  5G5G A;  4ANU A;  2N7E A;  2ICI A;  4IWP A;  3AU5 A;  5AUI A;  4E71 A;  4AJW A;  4AUQ C;  2FBW B;  4ICV A;  5C2T B;  1YMH E;  1E9M A;  4JL9 A;  2J42 A;  2E3T A;  1AYF A;  1G6J A;  1JWA D;  4HJG E;  2WXR A;  1N6Z A;  4BKG A;  5BO4 B;  3C0R B;  2GB1 A;  1I35 A;  1WMH B;  1SB3 C;  2BVC A;  2J7Q B;  2KNB A;  3FKY A;  2D3A A;  2GBR A;  2R2Q A;  4ZRJ A;  4YXD B;  5LLI A;  3Q3M C;  2G3Q B;  2NBV B;  1TY0 A;  1J7B A;  1P98 A;  4WQM A;  1MPE A;  2KK8 A;  3OJ3 A;  5J18 A;  3H6N A;  1FXI A;  4CO7 A;  2AX5 A;  3VTV A;  1NEK B;  3FIL A;  1SSN A;  2LVQ A;  3FC4 A;  4K1R B;  4E74 A;  5IP4 D;  1V1O A;  1NI2 A;  1XQQ A;  3RZW C;  2IYD B;  1D5Z C;  3R3M A;  2KKC A;  3QA8 A;  2AQ2 B;  4YTN B;  3KUD B;  4A20 A;  1UGM A;  4TQ1 A;  1GG3 A;  1UWM A;  4BKT A;  3KUZ A;  4XDC A;  1HZ5 A;  4A6Q A;  3BK1 A;  2WXN A;  3NOB A;  4S0R A;  3RPF C;  1FD6 A;  1AAR A;  3ZUN A;  3ZXV A;  2WXQ A;  3IVF A;  2A4Z A;  4II2 B;  2KQ7 A;  2MLB A;  4LNI A;  2D5G A;  2LGX A;  2MW5 A;  3ZJU A;  1JWS D;  4RM8 A;  1WJ4 A;  1FFU A;  3ZNH B;  3T9L A;  2PKO A;  2Z8L A;  3VUW A;  4US9 A;  3VRB B;  2DYM A;  1WX9 A;  1E7P B;  2IBI B;  2Q5W D;  4M01 A;  3Q8B A;  5HHD G;  1KM7 A;  3NVY A;  1WIA A;  2QMT A;  2KQ4 X;  4NJ7 A;  3RT3 B;  4MEM A;  3EC8 A;  3L0W B;  2PMV A;  4BKS A;  3NVV A;  1YJ1 A;  2QCZ A;  3HM3 A;  2FAZ A;  5D6J B;  4JIO U;  3L13 A;  2MHJ A;  3AXC A;  3RCZ A;  3DWM A;  1WXS A;  2JF5 A;  2UU7 A;  3RNF C;  1DOX A;  2RGF A;  1YJJ A;  1YQ4 B;  2RSU A;  2ACZ B;  1K8R B;  4A9A A;  1KH0 A;  4FHJ A;  2G4D B;  1VDV A;  1M94 A;  4FJZ A;  4FA6 A;  2O2V A;  3B9J A;  4TV3 A;  5E6J A;  2KHW B;  2FUG 1;  3VUX A;  5DPS A;  3ZKJ C;  4XGA B;  2DZI A;  3DCG A;  2JXX A;  1TS4 A;  3HRD D;  2L8J A;  1XXG A;  5TSS A;  5HKH A;  2K39 A;  2M1M A;  3N1Y C;  4KIK A;  1BT0 A;  1PGA A;  1NEN B;  3NZU A;  3ZW3 A;  4FLH A;  3JW0 X;  1OEY A;  3WAM A;  1JWU D;  1FCC C;  2DEN B;  2M8S A;  1GUA B;  2XK5 B;  2OED A;  1Z5S B;  4ZHO A;  1ZDX A;  3X0W A;  2CJN A;  2FE8 A;  4GOC A;  5L95 C;  1K50 A;  1JML A;  1H8C A;  4WWO A;  3EFU A;  1HE8 A;  4RGM A;  2N9X A;  3VTU A;  2NPT B;  3V6E B;  2GRI A;  4L23 A;  2OJR A;  2EKE C;  2K25 A;  3P63 A;  4W9F A;  3ZYY X;  5CHF A;  3CF6 E;  4HPP A;  4N6E B;  1ZPS A;  2ZCB A;  3O65 B;  4GDL A;  4MGI E;  3N20 C;  2WXP A;  4GGQ A;  2JYT A;  2FCQ A;  4HPL B;  3A1Q A;  2YEP B;  2CJO A;  3FIL B;  3GOE A;  2V4I B;  1T0Y A;  5HI1 A;  2J4X A;  4GXB A;  3J9C A;  1P1A A;  3KH0 A;  2L83 A;  3RD2 A;  2A5U A;  2LFI A;  2IDY A;  1J8C A;  3K9P B;  4RFB A;  3W5V B;  3OWE B;  2HTM E;  2N1V A;  3V61 A;  4LNO A;  4C4V A;  4RNA A;  1FMA D;  4GSW A;  2V1Y A;  2AL6 A;  2XK5 A;  2BYV E;  3EFC A;  1OFF A;  5J17 A;  1E7V A;  2VH1 A;  3IT6 B;  2ZJD A;  1GOZ A;  1VRA B;  1WGY A;  2BWE S;  4MSQ B;  1R4N I;  2PPH A;  1ZKH A;  1SE4 A;  4RH6 A;  1E0Z A;  3PZ8 A;  3DVG Y;  1WF9 A;  3A9J A;  2WDQ B;  5DCN A;  3UIO B;  3MC0 B;  4DQO C;  2N4F A;  2O2V B;  3NG0 A;  3EGR A;  3KYD D;  1YX6 B;  3DQV A;  3P4S B;  1V49 A;  1DOY A;  4K7W A;  5FK9 C;  1C79 A;  5LNK 1;  3DBH B;  1PYW D;  1ACC A;  1RFA A;  2M56 B;  4YSX B;  5C1Z A;  2X8X X;  1V5O A;  4RF1 A;  3WAO A;  2Y5P A;  3P4R B;  4MGY E;  2JUO A;  1TTN A;  1DYQ A;  3DWG C;  3TBL D;  1A70 A;  2WX0 A;  2IO2 B;  2FCN A;  3C8Y A;  4UDU C;  2KDB A;  2L05 A;  4O1N A;  3BK2 A;  2KVZ A;  1TKE A;  3L08 A;  2N1W A;  3Q14 C;  3S2A A;  3ZIM A;  2KFK A;  2NBW B;  2KC2 A;  3SDL C;  5J2R A;  1WXM A;  1UNS A;  1F77 A;  2L3Z A;  2LGD A;  1VJK A;  4D2K A;  2ZPY A;  1TJE A;  2D3C A;  1K52 A;  4HRO A;  1T3Q A;  2C7H A;  4BKS D;  3U30 A;  4MJS A;  4US8 A;  1E8X A;  2HD5 B;  3TCA A;  1ZXH A;  5L83 A;  1XD3 B;  1MJD A;  1RM6 C;  2IO0 B;  5BMI A;  2KD0 A;  4TUU A;  4R3D A;  1TKY A;  3CWI A;  3M62 B;  4EFO A;  2I38 A;  4GLS C;  3VUY A;  2J53 A;  3T8M A;  1F0Z A;  3AEF B;  2O6V B;  1NDD A;  4HDO A;  4ARI A;  3A9K B;  4LLG M;  3TJP A;  1LO5 D;  3WCQ A;  4B0E A;  2KTR A;  1L4Z B;  1YN4 A;  2K22 A;  3P4P B;  2NMQ A;  2KX3 A;  5JH5 C;  2I1K A;  2ZNV C;  4GMV A;  3NJT A;  3PHX B;  1DOI A;  5E6P A;  4MJS B;  5HG2 A;  4L2Y A;  3E56 A;  3ABV B;  2OOB B;  4K3B A;  1QIL A;  4IWQ A;  3ZRF A;  1WGK A;  1FPY A;  1P9D U;  1WMH A;  2K6Q A;  1V80 A;  1UWX A;  4ZRQ A;  1WI0 A;  2VH2 A;  1FXT B;  3AB5 A;  1QQR A;  4WWP A;  3BY4 B;  3RNG C;  3AE3 B;  2IND C;  4WJP A;  2LMC A;  3R66 C;  2MQJ A;  4REZ A;  4JPS A;  1JAL A;  2D07 B;  2JZZ A;  2KQS A;  1SIJ A;  4P1C C;  1QZE A;  1SE3 A;  5IA7 A;  4C80 A;  4DHZ E;  3Q8C A;  1I4G A;  1TT5 B;  5KHO A;  5EDS A;  1PGX A;  1WGH A;  2FIF A;  2KLG A;  3JVZ X;  5G5H A;  2WP9 B;  2WNM A;  3Q69 A;  2WHI A;  3DHI C;  4B9K A;  3DPD A;  1U4A A;  1XEE A;  2ZW0 A;  2KAC A;  2WDV B;  4OVZ A;  1P0R A;  3APD A;  3DBH I;  2KN4 A;  3A33 B;  2KDE B;  4ZRK A;  4W9D A;  3DHG C;  5TR5 A;  4HJK A;  3RI7 C;  3SHQ A;  1EM7 A;  1EUV B;  1Q5W B;  2LZ6 A;  3MFG A;  3A9J B;  1V6E A;  2MBB B;  3VH3 B;  4DXG A;  3HVD A;  1R4M B;  3RUL A;  1WR6 E;  1LFD A;  4Q2J A;  3GE3 C;  1SE9 A;  1WE6 A;  5AZF A;  1V1P A;  2DAJ A;  2C7M B;  2BKF A;  3WA0 A;  1L0Y B;  1MG4 A;  1Y8R C;  2VZK B;  2K6D B;  2OHF A;  1B1Z A;  3ZRC A;  2INP E;  2ZNV B;  3GB1 A;  1MI0 A;  2IY0 B;  2MH7 A;  1YIW A;  1WR1 A;  3ML9 A;  3TMP B;  1EF1 A;  1FIQ A;  1WJU A;  3NY5 A;  4IKG A;  2D11 A;  4K81 A;  4M8M A;  1F2R C;  1PQS A;  2YLM A;  3PSE B;  2DZK A;  1IYF A;  2HTH A;  3TEW A;  2MRP A;  2M0A A;  3Q3J A;  5D3I B;  1UH6 A;  4TKN A;  1MHH E;  2WXH A;  3U52 E;  4CQN A;  1RRB A;  3TL5 A;  5E6N A;  1JRU A;  1WM2 A;  2ZVN A;  1C4P A;  4DHJ D;  4PS7 A;  4BFR A;  1OGW A;  1V86 A;  5DPW A;  3HM6 X;  4ZYS A;  2AYO B;  2RR9 A;  2LUM A;  4NPN A;  4KV2 A;  3U7Z A;  1SIF A;  4ASW C;  2NBU A;  3H1U A;  1WWT A;  4J6I A;  4RM9 A;  4LNK A;  3PV1 A;  3RYT A;  3M95 A;  2MJ3 A;  2BBC A;  3N1Z C;  1T5X D;  2MBQ A;  2INN E;  2N9L A;  1ZXI A;  1TIF A;  2WU2 B;  4KIK B;  1NYR A;  5BMH A;  2K8C A;  4EZL A;  1RWS A;  3CSF A;  3AEC B;  1E8Z A;  3B0A A;  4G11 A;  3MP9 A;  2R61 A;  3SD5 A;  2KC1 A;  3MHS D;  5FR6 A;  1OQY A;  2MP2 B;  2Y5B B;  3VQI A;  3EEC A;  3Q3O C;  2W3S A;  2FNJ B;  2BW2 A;  2QEJ C;  4NY0 A;  3VHT C;  1FNU A;  4C00 A;  3JSV A;  5E6O A;  4ZHP A;  3A4S C;  3W1Y A;  3JSV B;  2H89 B;  2QDF A;  3AE5 B;  5EE0 A;  3T3O A;  1C4A A;  4II3 B;  3ZGZ A;  1I4Q A;  1C1Y B;  2N7J A;  2UWQ A;  4IG7 B;  4FUL A;  3VR8 B;  2PJH A;  4LNF A;  4YL8 A;  1ISN A;  4DHJ B;  2PE6 B;  3TEX A;  2B76 B;  4JWS C;  2K9X A;  3P1M A;  4WJN A;  1I4H A;  5BMG A;  4CYE A;  1V9J A;  2YEP F;  4USA A;  2D2Q A;  4MEL A;  1RFK A;  1CQV A;  3L54 A;  3QCA A;  1L7Y A;  4RCO A;  2LEK A;  1L4D B;  4TSS A;  3PT2 B;  2QC8 A;  1D6E C;  2KOX A;  3ENE A;  3ZTD A;  3SEB A;  1HQR D;  3OG5 A;  4JE3 B;  2IY1 B;  4S17 A;  3V05 A;  1VZ6 A;  1FM0 D;  2IGH A;  2L7R A;  2Z0D B;  3GZN I;  2G1E A;  3PLU A;  2WWZ A;  3ZVV A;  2EMS A;  1Y56 A;  2LHE A;  4A3O A;  3TUO A;  4XYC A;  4B95 A;  2WXJ A;  3UGB B;  5FR3 A;  1N61 A;  2SEB D;  3K9O B;  4AP4 C;  4FXC A;  2REX A;  5MPO A;  2KTF A;  3GS2 A;  3A4R A;  4CHK A;  4LJP B;  1R4M I;  4RGO S;  2L0T A;  2KWD A;  1CMX B;  2JWZ A;  3AE4 B;  2MWS B;  1R4N B;  4X57 B;  2JYE A;  4KDL B;  2BYF A;  2QJL A;  2V3N A;  1XCT L;  1EU4 A;  1WX8 A;  4C7Z A;  4ANW A;  1HZ6 A;  3HIZ A;  2KAJ A;  2L32 A;  4ZYN A;  4ZRP A;  2W54 A;  2UYZ B;  3FAH A;  4J3O D;  3V3X A;  1QOF A;  1QOB A;  4TMA B;  1IGC A;  3KW5 B;  3QIJ A;  2NTS A;  4BBN C;  1V5T A;  4MM3 A;  5JXV A;  2LWP A;  3LJ3 A;  3IT4 B;  3L16 A;  2BPS A;  4NAW B;  3TSS A;  4AOF A;  4I6P A;  3U2S C;  2IJ0 A;  3V62 A;  1TZO A;  3LB8 C;  3IXS A;  2CS4 A;  3WAP A;  1YX5 B;  1JCK B;  3R2T A;  2EMT A;  4LJO B;  2AL3 A;  2XNA C;  3KWV A;  3I3T B;  1Q0W B;  5BYR A;  1L6V A;  4KGT A;  1JWM D;  1V2Y A;  3VTW A;  1KFY B;  2LGI A;  1IBX A;  1KF6 B;  4AQ7 A;  2M17 A;  2KJR A;  1EWY C;  3RN9 C;  4K3C A;  3MTN B;  2KDI A;  3ZJT A;  4WAF A;  1HTO A;  2KX0 A;  3BII D;  1XLN A;  3ZLZ A;  3SFD B;  2AQ3 B;  2DHZ A;  1WXA A;  4W9J A;  1QOG A;  4HVB A;  2KDF B;  3LDZ E;  4NNJ B;  1E6E B;  2J0M A;  3NS1 A;  4ACF A;  2MBE A;  2I2Y A;  3MHZ A;  3VFK A;  1L6U A;  2JZP A;  2CU3 A;  2G45 B;  2V4L A;  3R8B A;  3W1S A;  1YQB A;  4YWG G;  2GLS A;  1TZ1 A;  4F7Z A;  1UEL A;  1LGR A;  3QHT A;  1BUI C;  3ECI A;  3AI5 A;  2CR5 A;  2GBJ A;  2KT7 A;  2E6X A;  1KLG D;  1E90 A;  3BIN A;  2J52 A;  1V8C A;  2ON8 A;  3ZDT A;  3X23 A;  2HDE A;  3ZTC A;  1PGB A;  2WX1 A;  1AWD A;  1HEZ E;  2O6V A;  3NZS A;  4P7I A;  2BF8 B;  4DHZ B;  3W2D A;  4HRS A;  3URY A;  1FNV A;  1WE7 A;  1AW7 A;  3ONS A;  4L1B A;  1IGD A;  2IGD A;  3WIM A;  1BML C;  3PS6 A;  3LXF A;  2WU5 B;  1GAQ B;  5C23 A;  2BB5 A;  5IAA C;  2DAF A;  1YOV B;  2LXA A;  3AM9 A;  3N32 A;  4DXF A;  2Y5C A;  1D5X C;  4LTU A;  1JW9 D;  5CHW A;  3AV8 A;  3H7P B;  2WQY B;  2K0P A;  3MC9 A;  2JZ3 B;  1SJH D;  1SJE D;  1MFW A;  3AU4 A;  1TGZ B;  1ZUD 2;  2JXT A;  4K7S A;  4NJ6 A;  3O13 A;  2JT4 B;  4RGT A;  4BOS C;  1E7U A;  3PZ7 A;  3U4E G;  3U8Z A;  4I6N B;  2XEW A;  4C7Y A;  4JGH B;  1GC6 A;  1WX7 A;  3H9D A;  2WGS A;  1L0X B;  4K7U A;  2FID A;  5BYS A;  2LD9 A;  1WYW B;  1WRD B;  1NVI D;  1FFV A;  4WAA A;  4OZC A;  4AS1 A;  4YTP B;  2DYO A;  3R7Q A;  4EKU A;  1N5W A;  2GI9 A;  1OQR A;  3RNC C;  3VR9 B;  4WIP A;  1T6B X;  4PT5 A;  4G3X B;  1D3Z A;  1AN8 A;  4PYZ A;  4W9I A;  2BTE A;  1I7H A;  2LGS A;  3L10 B;  4P16 A;  3AEG B;  5GMV A;  2CHW A;  1ZP0 B;  2JPH A;  1BXT A;  3I9V 1;  4QAY A;  4FBJ B;  2MBO A;  3APC A;  3MJW A;  5AZH A;  1KLV A;  1WYG A;  2K1F A;  2WDR B;  5JZE B;  1ZDV A;  4GDK A;  1ESF A;  3ZXR A;  4OW0 A;  1TKG A;  2R2O A;  2CHX A;  1IP9 A;  3AE6 B;  3DVN V;  2PTL A;  3Q3N C;  4XWW A;  4M02 A;  4MT5 A;  1RLF A;  3MJ5 A;  1F9J A;  1ZE3 D;  3ZNZ B;  1S1Q B;  2WS3 B;  3U7D A;  2JWU A;  3C19 A;  2L52 A;  2GBN A;  2KWV B;  3QQ8 B;  5D94 A;  2KMC A;  3Q3F A;  3UF8 A;  4BAX A;  4M00 A;  4XX5 A;  1QOA A;  2LVP A;  3W5U B;  1GB1 A;  4FJV B;  1RYJ A;  3PPA A;  3OLM D;  1SBB B;  1PUT A;  3H8H A;  3ZDM C;  1WXV A;  2BGF A;  4KZC A;  2O6V D;  2Y3A A;  3NVZ A;  3IFW B;  4WWM A;  3I63 C;  5CHV C;  4KSK C;  3VRA B;  1GNU A;  4BZA A;  3B08 A;  4NAM A;  5IKC M;  2PEA A;  3NHE B;  4AWJ A;  2C9W B;  1C4C A;  4LCD E;  2IPK D;  3BYT B;  2SAK A;  2G4S A;  2CHZ A;  3BVM A;  5C3J B;  1L5P A;  2TSS A;  4DXA B;  5T8I A;  1CJE A;  4E3C A;  1V1P B;  3DBR B;  4MGZ E;  3QAR A;  2KDM A;  4DWF A;  4JQW C;  1EF5 A;  4ICU A;  1WZ0 A;  4KDI C;  4DDI D;  3PZD A;  2KMM A;  1WGG A;  2MCN B;  4KGR A;  2LAS A;  3CIR B;  1D4B A;  5I4D A;  3HVZ A;  4FHK A;  4ZRI A;  4ITK A;  1UZX B;  1WH3 A;  4KVG B;  3UQB A;  1F2R I;  2ZW1 A;  2M4N A;  3DBL I;  2V3P A;  4GDK B;  4YT0 B;  4IDI A;  4W9H A;  5EE3 A;  4W9C A;  3B2G A;  4M8N A;  1T0S C;  3P4Q B;  1JWB D;  4HCN B;  3N9Y C;  2KZR A;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  4OZB A;  2BS2 B;  1MVK A;  4IUM B;  3SU8 X;  1I4P A;  3GP7 A;  3VAW A;  3AE2 B;  5HFY A;  1WJN A;  4HDQ A;  1I4R A;  3DOW A;  4HKZ E;  4NJC A;  3PRE A;  2L76 A;  1YD8 U;  4WWN A;  1FCL A;  4PYU A;  3ZJV A;  1XLP A;  3AEB B;  1I4X A;  4KKI A;  2PVO D;  4BVU C;  2K3U A;  4WJQ A;  1B9R A;  1WY8 A;  4ANV A;  4IOI E;  1FEH A;  2WXO A;  2L0F A;  4PS3 A;  2LJI A;  4B0M A;  5DPR A;  5G55 A;  3B2F A;  1N63 A;  2BQQ A;  1WGR A;  2WXL A;  3RFZ B;  5EE9 A;  5CTR C;  4W9G A;  2ZPN A;  2KMA A;  1J0G A;  1Q1O A;  3AE1 B;  4GB9 A;  2HE7 A;  1N62 A;  4DBG A;  2RMM A;  3T3N A;  3AEA B;  3AH7 A;  4LK0 M;  3TEY A;  3V60 A;  3BZD B;  2WXK A;  4B6W A;  3DHH C;  1VD2 A;  2V0G A;  4A8X C;  4EUT A;  1S3S G;  3IG3 A;  3H7P A;  2LHD A;  2B3A A;  2NTT A;  1KTK A;  1R7S A;  4IM0 A;  1YN3 A;  2DX5 B;  1WXQ A;  3DVN U;  4JX1 C;  3NVW A;  4HXD A;  3TIX A;  4IW0 A;  2FUH B;  3L17 A;  3HHM A;  4N9F 4;  3Q8E A;  2GBK A;  1CK1 A;  2ONQ A;  2WYQ A;  4KGS A;  4OVU A;  3VH4 B;  2K8B A;  3BVZ A;  4G50 A;  1Z2M A;  4RF0 A;  2DYB A;  3AED B; 
#chains in the Genus database with same CATH homology
 4MJS A;  3CST A;  3MTN B;  4MDK E;  2DZM A;  2KDI A;  4MSM B;  1RAX A;  2C7N B;  3DVG X;  2V3S A;  2KX0 A;  2NVU I;  1LXD A;  1E8X A;  3ZLZ A;  2HD5 B;  2KTR B;  2ASQ A;  2DHZ A;  1UD7 A;  2LJ5 A;  4W9E A;  3TCA A;  1WXA A;  4LDT B;  4W9J A;  5L83 A;  1XD3 B;  4HVB A;  2KDF B;  3LDZ E;  4NNJ B;  2DZJ A;  2IO0 B;  3ML8 A;  2J0M A;  3N30 A;  1V81 A;  2KD0 A;  2MBE A;  4TUU A;  3PHW B;  3M62 B;  4EFO A;  3DBS A;  2AWT A;  3VFK A;  2LUE A;  3VUY A;  4MH0 E;  2G45 B;  2V4L A;  4HLE A;  5JHA A;  2JVC A;  3W1S A;  4EZK A;  1YQB A;  3T8M A;  1TZ1 A;  3V6C B;  2JY6 A;  2KJH B;  4F7Z A;  1UEL A;  2KN5 A;  1UBI A;  3QHT A;  5AEK B;  2O6V B;  2IO1 B;  1NDD A;  1OTR B;  3ECI A;  3AI5 A;  1VCB A;  4G0N B;  3A9K B;  4HDO A;  3TJP A;  2CR5 A;  1OEY J;  3KYC D;  3ALB A;  4LDT D;  2RPQ A;  2GBJ A;  2KTR A;  1NBF C;  4EZJ A;  5JH5 C;  1E90 A;  2KX3 A;  3BIN A;  2I1K A;  2ZNV C;  3M63 B;  4GMV A;  3PHX B;  2KFJ A;  2M0X A;  2GMI C;  1KOT A;  3UIP B;  3ZDT A;  3X23 A;  3CMM B;  5E6P A;  4MJS B;  5KHQ A;  4ANX A;  5CX3 A;  3N3K B;  3ZTC A;  3QWZ B;  2WX1 A;  1J19 A;  3KUC B;  4BOZ B;  2LRW A;  2O6V A;  3NZS A;  3PRP B;  4P7I A;  1L2N A;  2OOB B;  4IWQ A;  2IZV B;  2BF8 B;  3ZRF A;  2LGY A;  2NS5 A;  4DHZ B;  1MG8 A;  1P9D U;  2QHO A;  1WMH A;  4ANU A;  2K6Q A;  1V80 A;  2MBH A;  2N7E A;  5LXH A;  4IWP A;  1WI0 A;  3AU5 A;  1FXT B;  4URK A;  1WE7 A;  3ONS A;  4WWP A;  5G2N A;  4AJW A;  2N7D A;  4E71 A;  3BY4 B;  3WIM A;  4NAW A;  4WJP A;  2J0J A;  3R66 C;  1GJZ A;  4AUQ C;  2MQJ A;  4ICV A;  3PS6 A;  4JL9 A;  1XT9 B;  2D07 B;  2JZZ A;  2CU1 A;  4MGK E;  2KQS A;  5C23 A;  1G6J A;  2KVR A;  1QZE A;  4HWI B;  5IAA C;  5IA7 A;  2DAF A;  4BKG A;  4DHZ E;  5BO4 B;  3C0R B;  2LXA A;  4F1S A;  2BYE A;  4FN2 A;  3N32 A;  1I35 A;  1WMH B;  3AUL A;  5KHO A;  5DPT A;  4IWO A;  5CHW A;  2MSE D;  3H7P B;  5EDS A;  1E8Y A;  2J7Q B;  2KNB A;  4HPM B;  1WGH A;  2RD0 A;  2FIF A;  2KLG A;  3JVZ X;  2JZ3 B;  2GBR A;  2ZEQ A;  2R2Q A;  4IC7 B;  3AU4 A;  4ZRJ A;  1TGZ B;  5LLI A;  2G3Q B;  3DPD A;  4B9K A;  1U4A A;  2NBV B;  4K7S A;  4NJ6 A;  2N9E B;  2KO3 A;  1P98 A;  2JT4 B;  2CKH B;  1E7U A;  2KK8 A;  2KFK B;  3M3J A;  3OJ3 A;  3H6N A;  4BOS C;  5J18 A;  4CO7 A;  3U8Z A;  4I6N B;  2XEW A;  4JGH B;  1GC6 A;  1WX7 A;  1P0R A;  1LQB A;  3H9D A;  4NQL B;  3APD A;  2ZCC A;  3VTV A;  3DBH I;  4K7U A;  2NR2 A;  3A33 B;  2FID A;  2KDE B;  2LVQ A;  4K1R B;  4ZRK A;  4W9D A;  4E74 A;  2LD9 A;  1NI2 A;  1XQQ A;  1WYW B;  1WRD B;  3RZW C;  2IYD B;  4WAA A;  3R3M A;  5TR5 A;  4HJK A;  3APF A;  2KKC A;  3QA8 A;  3SHQ A;  2DYO A;  2LZ6 A;  1EUV B;  1Q5W B;  3R7Q A;  3W1S C;  3A9J B;  1V6E A;  2C60 A;  1UGM A;  2BWF A;  2KWU B;  2MBB B;  3KUD B;  4A20 A;  4EKU A;  3VH3 B;  4TQ1 A;  3VXW A;  1GG3 A;  3RUL A;  1WR6 E;  1LFD A;  2NPT A;  4BKT A;  1E5W A;  1SE9 A;  1WE6 A;  3KUZ A;  4F8C B;  2I1J A;  3UQA A;  4XC2 A;  3ZNG C;  5AZF A;  4M0W B;  2DAJ A;  2C7M B;  2BKF A;  3NOB A;  3WA0 A;  3P2B A;  1Y8R C;  2K6D B;  3KVF B;  2W9N A;  4G3X B;  1AAR A;  3ZRC A;  2GOW A;  2ZNV B;  1D3Z A;  4PYZ A;  4W9I A;  3ZUN A;  2PE9 A;  2IY0 B;  2LI5 A;  3JYU A;  3WAL A;  1YIW A;  1WR1 A;  2KAN A;  2A4Z A;  3IVF A;  3ML9 A;  3QAQ A;  3TMP B;  1EF1 A;  3L10 B;  4II2 B;  2KQ7 A;  2MLB A;  1WJU A;  3NY5 A;  5D7G A;  2D11 A;  2LGX A;  2ZZP B;  3H7S A;  2MW5 A;  4K81 A;  5GMV A;  2CHW A;  4M8M A;  5LXI B;  2JPH A;  2MP2 A;  2MX2 A;  4RM8 A;  4FBJ B;  1WJ4 A;  2MBO A;  1PQS A;  2YLM A;  1TBE A;  2D3G A;  2DZK A;  3PSE B;  2HTH A;  1C3T A;  3APC A;  3ZNH B;  2MRP A;  1IYF A;  3MJW A;  2L00 B;  3Q3J A;  5AZH A;  3T9L A;  4GN1 A;  1UH6 A;  4TKN A;  3VUW A;  1KLV A;  2AEH A;  2K1F A;  1RRB A;  2DYM A;  1WX9 A;  3PRZ A;  5JZE B;  2IBI B;  4GDK A;  3TL5 A;  2FCS A;  5E6N A;  1JRU A;  1WM2 A;  1KM7 A;  2R2O A;  2ZVN A;  2CHX A;  3PTF C;  1IP9 A;  3PVL A;  3QX1 A;  1WIA A;  3DDC B;  4DHJ D;  4PS7 A;  4BFR A;  1OGW A;  1V86 A;  3DVN V;  4XZ4 A;  4NJ7 A;  5DPW A;  3HM6 X;  3RT3 B;  4MEM A;  3EC8 A;  3L0W B;  3OAW A;  2AYO B;  4BKS A;  4IM2 A;  4IM3 A;  1YJ1 A;  4TQ0 A;  2RR9 A;  1RLF A;  4NPN A;  3HM3 A;  1ZW7 A;  4KV2 A;  1SIF A;  4ASW C;  2NBU A;  2FAZ A;  5D6J B;  3H1U A;  3D32 A;  4JIO U;  3VTU A;  1F9J A;  3L13 A;  3AXC A;  3RCZ A;  2VRR B;  1WXS A;  4J6I A;  3ZNZ B;  4RM9 A;  2JF5 A;  1S1Q B;  3U7D A;  3PV1 A;  3RYT A;  1ZGU B;  2FCM A;  2JRH A;  3M95 A;  2RGF A;  2GBN A;  2RSU A;  2KWV B;  3QQ8 B;  1K8R B;  2D10 A;  5D94 A;  4ZDV A;  2KMC A;  2C5L C;  2YVC A;  2G4D B;  4FHJ A;  2XBB C;  3Q3F A;  2MBQ A;  3UF8 A;  4XX5 A;  1M94 A;  4FJZ A;  2LVP A;  4JLC A;  4FA6 A;  3A1Q B;  2O2V A;  4TV3 A;  4FJV B;  4KIK B;  3PPA A;  3OLM D;  2KHW B;  4GDL B;  3VDZ A;  1SGH A;  3RZF A;  1WZ3 A;  1KJT A;  3ZDM C;  1WXV A;  2BGF A;  4KZC A;  2K8C A;  3VUX A;  2O6V D;  5DPS A;  4EZL A;  3IFW B;  3CSF A;  3ZKJ C;  4AJY B;  1E8Z A;  3PGE A;  4W9K A;  2DZI A;  3B0A A;  3DCG A;  4G11 A;  2JXX A;  2KC1 A;  3SD5 A;  3QK0 A;  3MHS D;  2L8J A;  5FR6 A;  1OQY A;  2MP2 B;  4KSK C;  5CHV C;  2K39 A;  5HKH A;  2Y5B B;  2M1M A;  1GNU A;  3B1L X;  3B08 A;  4KIK A;  3VQI A;  3EEC A;  2PEA A;  1WFY A;  1BT0 A;  2FNJ B;  3NHE B;  4OVV A;  4AWJ A;  2C9W B;  4HK2 A;  4NY0 A;  3VHT C;  3NZU A;  4PS8 A;  3ZW3 A;  4FLH A;  3JW0 X;  1OEY A;  4LCD E;  3WAM A;  3JSV A;  1WJ6 A;  5E6O A;  2M8S A;  2DEN B;  3A4S C;  4WJO A;  1GUA B;  2G4S A;  3W1Y A;  2XK5 B;  2CHZ A;  1Z5S B;  4DXA B;  4FAD A;  3JSV B;  3X0W A;  4E3C A;  4GOC A;  3VVW B;  4II3 B;  5L95 C;  4MGZ E;  3QAR A;  1H8C A;  4DWF A;  1C1Y B;  4WWO A;  2UWQ A;  4IG7 B;  1EF5 A;  1HE8 A;  3EFU A;  2N9X A;  4FUL A;  4ICU A;  4JQW C;  5AZG A;  1WZ0 A;  2NPT B;  4KDI C;  4DDI D;  3PZD A;  2PJH A;  3V6E B;  2BKR B;  4A3P A;  1WGG A;  4YL8 A;  2MCN B;  1ISN A;  2OJR A;  2LAS A;  2EKE C;  3QC8 B;  2K25 A;  4BBN F;  4W9F A;  5CHF A;  4DHJ B;  2PE6 B;  3CF6 E;  4I6L B;  4NQK E;  4FHK A;  2KLC A;  2ZCB A;  2WDT B;  3O65 B;  4GDL A;  1UZX B;  4MGI E;  4WJN A;  4ZRI A;  1WH3 A;  4CYE A;  4GGQ A;  2MA9 B;  1V9J A;  4KVG B;  3UQB A;  2FCQ A;  3DBL I;  2M4N A;  4HPL B;  3A1Q A;  5JHB A;  2D2Q A;  4MEL A;  3GOE A;  2GBM A;  4GDK B;  4W9H A;  3L54 A;  2HJ8 A;  2LVO A;  3QCA A;  2LXC A;  1L7Y A;  1T0Y A;  4W9C A;  4GXB A;  4DDG D;  3HK0 A;  1P1A A;  3KH0 A;  1E8W A;  3PT2 B;  3RD2 A;  4M8N A;  2A5U A;  3ZNI D;  2Z0E B;  4HCN B;  4W9L A;  2KOX A;  2KZR A;  1J8C A;  2IO3 B;  3ENE A;  3ZTD A;  3K9P B;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  4IUM B;  3SU8 X;  1EO6 A;  2IY1 B;  1I42 A;  3VAW A;  3V61 A;  2N1V A;  3PLV A;  4FJY A;  4EEW A;  4GSW A;  1WJN A;  4HDQ A;  3DBR I;  2V1Y A;  2AL6 A;  2L7R A;  2XK5 A;  1UBQ A;  2BYV E;  3DOW A;  2Z0D B;  3GZN I;  5J17 A;  1E7V A;  3PRE A;  2L76 A;  3PLU A;  2WWZ A;  1YD8 U;  3ZVV A;  2EMS A;  2ZJD A;  4WWN A;  4A3O A;  1WGY A;  2BWE S;  4B95 A;  4PYU A;  4MSQ B;  3UGB B;  3K9O B;  1R4N I;  2K8H A;  4AP4 C;  2PPH A;  1ZKH A;  2REX A;  4BKS D;  2KTF A;  4BVU C;  2N9P C;  3A4R A;  4CHK A;  1X1M A;  4LJP B;  3DVG Y;  1WGD A;  4WJQ A;  2JRI B;  1WY8 A;  3RUI B;  4ANV A;  1R4M I;  2ZVO A;  4DK5 A;  1WF9 A;  3A9J A;  3EHV A;  2L0T A;  5DCN A;  3UIO B;  2L0F A;  1CMX B;  4PS3 A;  2JWZ A;  2N4F A;  2O2V B;  5DPR A;  2MWS B;  5G55 A;  3KYD D;  4X57 B;  1YX6 B;  1WGR A;  3DQV A;  1V49 A;  4KDL B;  4K7W A;  1LM8 B;  5CTR C;  2ZPN A;  4W9G A;  2KMA A;  2NCN A;  1Q1O A;  2BYF A;  1J0G A;  4GB9 A;  2HE7 A;  4DBG A;  3R7R A;  1WX8 A;  1RFA A;  4ANW A;  3HIZ A;  3UIN B;  5C1Z A;  3V60 A;  3QJZ A;  3NS8 A;  1V5O A;  2KJ6 A;  3WAO A;  3ZO5 B;  4B6W A;  4ZYN A;  3A9K A;  1VD2 A;  2UYZ B;  2Z59 B;  4GIV A;  4MGY E;  2JUO A;  4EUT A;  1S3S G;  3IG3 A;  1TTN A;  3H7P A;  2B3A A;  3TBL D;  5D2M B;  4RMA A;  4WQO B;  2WX0 A;  2IO2 B;  3KW5 B;  2FCN A;  3QIJ A;  4EOY A;  4BBN C;  1H4R A;  1P3Q U;  1V5T A;  3OJ4 B;  2KDB A;  4IM0 A;  3IBE A;  3IHP C;  2L05 A;  1WM3 A;  4MM3 A;  2DX5 B;  1GC7 A;  3DVN U;  2LWP A;  3WAN A;  3LJ3 A;  3L16 A;  2BPS A;  3L08 A;  2N1W A;  4HXD A;  4IW0 A;  2FUH B;  4NAW B;  3TIX A;  4AOF A;  4I6P A;  3L17 A;  3V62 A;  4KSL C;  3S2A A;  3HHM A;  4N9F 4;  3ZIM A;  2KFK A;  2GBK A;  4HCP B;  2J0K A;  2NBW B;  2LRU A;  2CS4 A;  2KC2 A;  3SDL C;  3WAP A;  5J2R A;  1YX5 B;  1IPG A;  1WXM A;  2EMT A;  2WYQ A;  4LJO B;  2AL3 A;  1A5R A;  3I3T B;  4OVU A;  2L3Z A;  2LGD A;  1Q0W B;  3VH4 B;  2K8B A;  4G50 A;  1Z2M A;  1V2Y A;  2ZPY A;  3VTW A;  2DYB A;  4KZ0 A;  2C7H A;  2M17 A;  3U30 A;  2KJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...