2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
4JLCA 1WMHB 2KD0A 2M8SA 2PPHA 1UELA 3ZNHB 4FA6A 2KMAA 3WIMA 4HLEA 5BO4B 2IYDB 2AL6A 2FCQA 2DYMA 3Q3FA 3VHTC 3UQAA 2I1KA 2WX1A 2KZRA 4IM2A 3RT3B 1EO6A 1KOTA 1E8ZA 4I6NB 4K7UA 3ZO5B 1E7UA 4M8NA 2DZKA 1T0YA 3RYTA 2KDIA 5EDSA 3QWZB 4IUMB 1J0GA 3W1YA 1KLVA 3BY4B 2LRWA 3DQVA 1S3SG 3H9DA 3RZFA 4B95A 2ZNVB 2AYOB 4DHJD 4XC2A 1WI0A 2BPSA 3A33B 3PHWB 2JZZA 4G11A 4MJSB 4NQKE 5HKHA 1WM2A 4BKTA 4GSWA 1YX5B 4HJKA 2FCMA 3PZDA 1I42A 3ECIA 2JY6A 3N32A 4F7ZA 5J2RA 4URKA 1TTNA 2KFKB 1LM8B 4WJQA 2LUEA 4NNJB 5IAAC 4WWPA 1U4AA 3ZNGC 2LGDA 2JT4B 3UIPB 4EFOA 2LD9A 3DDCB 1V2YA 2K6DB 1WR6E 1IPGA 2DZJA 2FAZA 3ENEA 1V5OA 2C7HA 2K39A 4A3OA 1WXSA 3APCA 1H8CA 4KSKC 4K81A 1Q5WB 4G3XB 2C7NB 3H7PB 3PTFC 4ANWA 4WJNA 1SGHA 2XBBC 4MSMB 2BKRB 2JPHA 2PE9A 2V1YA 2Z0DB 4GXBA 2N9XA 3DCGA 5J18A 3ML8A 2L76A 1C3TA 4ANUA 5JZEB 1L7YA 1WIAA 1WJNA 2CHWA 2D10A 2UWQA 4G0NB 4IWQA 2HD5B 2KWCA 1GC6A 2MP2A 2KQSA 3ZDTA 2J0JA 3V6CB 5JH5C 4BVUC 2RD0A 3KH0A 2BWFA 3VUWA 4NY0A 2KLCA 3QAQA 4EZLA 4JL9A 2Z0EB 3VQIA 1X1MA 1RRBA 2IO0B 3UGBB 1LQBA 4WWOA 3JW0X 3V60A 2MBQA 3A9KB 1P9DU 1WH3A 3PPAA 1E8YA 4HWIB 2C9WB 3QQ8B 1TGZB 2FCNA 3R7QA 4W9HA 2ZPNA 3TL5A 3T9LA 2G4DB 4IW0A 4XZ4A 2CS4A 2LGXA 4FULA 5TR5A 1UGMA 4ANVA 3L0WB 3NHEB 5D6JB 3NOBA 4LJOB 3TBLD 5JHBA 2KTRB 2KWUB 2JWZA 3OJ4B 3NY5A 1EF1A 3QHTA 4ZYNA 2QHOA 3N30A 5FR6A 1GJZA 2KO3A 5IA7A 2RPQA 2A5UA 3H6NA 1WF9A 4FN2A 3VH4B 5C23A 3JSVA 3B0AA 2A4ZA 4IWPA 1OEYA 1TBEA 2KANA 3PREA 3ZNID 2J7QB 4DK5A 4BKSA 3L54A 4MGYE 4N9F4 4DXAB 3HM3A 2PE6B 2CHXA 4EUTA 2M0XA 4BBNF 1GNUA 1Q0WB 4W9LA 2YVCA 2EKEC 1TZ1A 3ZKJC 3KW5B 3RULA 3VVWB 4HPLB 3L08A 4KIKB 2DAFA 4F1SA 2C5LC 1V6EA 3DVGX 2KJRA 4EEWA 1L2NA 3AXCA 2LXCA 4AP4C 2MBOA 3WAMA 1D3ZA 1WM3A 1SE9A 1WGDA 3KYCD 2GBKA 2N4FA 3QCAA 4ANXA 1WJ6A 3NS8A 1PQSA 2IY1B 2BKFA 3R66C 4GDLB 4GGQA 1H4RA 4HDQA 3S2AA 2KN5A 2CKHB 4HVBA 1UBQA 2KJ6A 4KDIC 4AJYB 4IG7B 2BWES 1LFDA 4ZRJA 1WGGA 5LLIA 1Z2MA 1R4MI 2HJ8A 2L7RA 2NBVB 2NPTA 2KFJA 3SD5A 3EC8A 4AWJA 2HE7A 2KC2A 4IM0A 3IBEA 1K8RB 2O2VB 3KYDD 5DPTA 3R7RA 3B08A 5G2NA 2L05A 2GBNA 1UD7A 2CU1A 5CHVC 2AEHA 2N1VA 2KXJA 4HXDA 3QIJA 3RUIB 3M3JA 5KHOA 4I6LB 5KHQA 3OAWA 4GMVA 3JYUA 2M17A 4II3B 4OVVA 4FHJA 3GOEA 2LZ6A 1V5TA 2FUHB 2K6QA 3NZSA 1V86A 5D94A 4BKSD 4KVGB 3VFKA 2M4NA 3DVNV 1WE6A 3DBHI 4FBJB 3X23A 2NBUA 4FJVB 2K8BA 2K25A 2CR5A 4G50A 3OJ3A 3ZNZB 2I1JA 2J0KA 1WRDB 4W9DA 3LJ3A 1YX6B 4NQLB 4TV3A 3WAOA 4AJWA 3DBSA 3QARA 4HCNB 4MDKE 4RMAA 4NPNA 1G6JA 1E8WA 2KTFA 2KJHB 1IYFA 2Z59B 1WGYA 4ZDVA 2WYQA 2MQJA 2JXXA 4W9JA 2FNJB 1GG3A 3A9JA 3ZTDA 2KDEB 2L0TA 3A4RA 3PRZA 4HDOA 2GBMA 4ZRIA 3V6EB 4NJ7A 4LCDE 4EKUA 3T8MA 5GMVA 4A20A 2DAJA 2RSUA 1WX9A 2NBWB 2AL3A 4GDKA 3VDZA 4DBGA 3ONSA 3DOWA 2LVPA 4BKGA 2G3QB 1GC7A 4DWFA 2FCSA 4RM8A 1GUAB 3I3TB 2ZPYA 4LDTD 2L3ZA 2KKCA 2MBBB 2XK5A 3PSEB 1EF5A 2JRIB 3GZNI 4MH0E 2ASQA 2D2QA 2DYBA 1UBIA 3QX1A 1IP9A 4CO7A 3RCZA 5AZHA 4OVUA 3OLMD 2EMSA 4LJPB 3VH3B 1SIFA 2KVRA 3ML9A 3VUXA 1KJTA 1V80A 1V9JA 3AU5A 3UINB 2KX0A 4KSLC 1KM7A 2LASA 2MP2B 2N9EB 3ZLZA 3ZRCA 1VCBA 1LXDA 4WAAA 4K7WA 4ZRKA 1OTRB 2ZEQA 2WX0A 3MJWA 1A5RA 1Q1OA 3KUZA 5D7GA 3V62A 2KNBA 3DVNU 3HK0A 2MBEA 4GOCA 4HPMB 2MCNB 3TJPA 2RGFA 2WDTB 3CMMB 3DPDA 4GB9A 4W9IA 1YIWA 4W9CA 5DPWA 4TQ0A 3ZVVA 2AWTA 4W9FA 3A1QA 3DBRI 2N1WA 3SDLC 3QJZA 3L10B 2KHWB 5CHFA 1I35A 2LVOA 3IHPC 2W9NA 2HTHA 3IFWB 1UZXB 1V49A 4E74A 1P98A 1XD3B 1P0RA 3RZWC 2O6VA 1Y8RC 2K8HA 2KWVB 1F9JA 1WJ4A 1Z5SB 3QC8B 4WJPA 4X57B 2B3AA 4IWOA 2K8CA 4NAWA 3O65B 3H1UA 3TCAA 1E7VA 4II2B 4F8CB 1J8CA 1RAXA 2PEAA 3JSVB 3KUDB 2JVCA 4MGIE 3PV1A 2L00B 3VTWA 1WXMA 2KMCA 1WXVA 3KUCB 1NDDA 2C7MB 3PVLA 3ZW3A 2ZJDA 3R3MA 2ZNVC 2ZCBA 2KDBA 4WQOB 4A3PA 3PRPB 2LI5A 2MX2A 3W1SC 3WAPA 1OQYA 3IVFA 4TQ1A 1WXAA 3CSFA 3VXWA 4FLHA 2N7EA 1YJ1A 1ZGUB 4KDLB 2RR9A 4M8MA 1P1AA 1WMHA 4RM9A 3AU4A 3PLVA 4CYEA 2DYOA 2LRUA 3APDA 5C1ZA 5L83A 2WWZA 3UQBA 1C1YB 3PHXB 4EOYA 3L13A 1NI2A 4NJ6A 4J6IA 3WANA 5CHWA 3C0RB 3L17A 5D2MB 2L0FA 2NPTB 5E6OA 4BBNC 2C60A 3EECA 4MGKE 1JRUA 5E6NA 2BYEA 3W1SA 1V81A 2K1FA 4MM3A 5DCNA 4MJSA 1NBFC 2LJ5A 4E71A 2NS5A 4LDTB 1ZKHA 3L16A 3M95A 4YL8A 3BINA 2MBHA 2NR2A 2KDFB 3DVGY 3SU8X 3ZUNA 2JUOA 3AULA 2REXA 2UYZB 3N3KB 2KC1A 1RFAA 3Q3JA 4W9GA 1VD2A 5DPSA 2KFKA 4EZKA 2LVQA 2XEWA 2ZCCA 1M94A 2G4SA 3D32A 1R4NI 3JVZX 2LXAA 3EHVA 3PS6A 4DDGD 2IBIB 3QA8A 1XT9B 4PS7A 4W9KA 1WX7A 3ZDMC 3KVFB 3IG3A 4MSQB 1XQQA 2KX3A 2NVUI 2MSED 1ZW7A 3ZTCA 2BF8B 2V3SA 4HK2A 4GIVA 4ICVA 3M62B 2N9PC 2D07B 3H7PA 3M63B 5DPRA 2KLGA 4MEMA 5LXHA 3NZUA 2BYVE 2EMTA 3HHMA 4PS8A 3A9JB 5J17A 4PS3A 3A4SC 2ZZPB 3WA0A 1E5WA 4GN1A 2FIFA 1WGRA 2IY0B 2JF5A 3P2BA 2MLBA 2DHZA 5CTRC 4GDKB 3TIXA 3LDZE 3MTNB 2KK8A 4KZ0A 2BGFA 2GBRA 3B1LX 1WGHA 2VRRB 3PLUA 3U7DA 1OGWA 2V4LA 3V61A 2D11A 3VUYA 2GBJA 3UF8A 4ICUA 3A9KA 2DENB 3VTVA 5E6PA 3CSTA 2GMIC 1OEYJ 2XK5B 4I6PA 4B6WA 3K9PB 3ALBA 3PGEA 3QK0A 2OJRA 2PJHA 4AUQC 4FHKA 1P3QU 4W9EA 4IC7B 4XX5A 3X0WA 2CHZA 4M0WB 1FXTB 2IO3B 1WR1A 3UIOB 2L8JA 3WALA 2R2QA 4ASWC 5AEKB 3ZRFA 1E90A 1QZEA 3VTUA 2KTRA 4CHKA 1UH6A 1BT0A 3CF6E 4EZJA 4IM3A 3ZIMA 5JHAA 3U8ZA 3SHQA 1WZ3A 1CMXB 4K7SA 2JZ3B 1WE7A 2MA9B 1WY8A 5G55A 1J19A 3PRMB 2D3GA 4TKNA 3A1QB 3H7SA 5L95C 4BOZB 4MGZE 1WJUA 4KV2A 4AOFA 5CX3A 4E3CA 1HE8A 4JQWC 2DX5B 4PYZA 2Y5BB 2R2OA 2JRHA 1AARA 1YQBA 2O6VB 2G45B 1EUVB 1WFYA 3DBLI 4KIKA 2GOWA 4KZCA 2BYFA 4P7IA 3EFUA 1WZ0A 3HIZA 4NAWB 4DHZB 2OOBB 4HCPB 4FJYA 3AI5A 3RD2A 4DDID 4GDLA 4BOSC 4B9KA 2IO2B 2M1MA 1RLFA 3APFA 2KQ7A 2MW5A 4K1RB 4PYUA 5AZGA 3K9OB 3HM6X 2LGYA 4MELA 4DHJB 1WYWB 2LWPA 2DZIA 2MRPA 2J0MA 5AZFA 3U30A 2IZVB 1S1QB 2YLMA 4WWNA 2IO1B 2ZVOA 2ZVNA 2O2VA 2DZMA 2NCNA 2N7DA 4JIOU 4WJOA 3VAWA 4FJZA 3PT2B 1E8XA 4TUUA 2FIDA 3TMPB 4FADA 3MHSD 1MG8A 1YD8U 2KOXA 1WX8A 2MWSB 4GU2A 4BFRA 5LXIB 1ISNA 4DHZE 2O6VD 4JGHB
chains in the Genus database with same CATH superfamily
4JLCA 4FA6A 2M8SA 1MPEA 1XXGA 2KMAA 2MHJA 4HLEA 1OFFA 1ZOYB 3Q3FA 3UQAA 1TY2A 4K7UA 1E7UA 3GE3C 3RYTA 4K3CA 4RGNA 4P6VF 1KLVA 3RZFA 3EFCA 4HROA 3P1MA 1FXAA 2YEPF 3IT6B 1JWUD 3V3XA 4HJKA 1YX5B 4XWWA 1JMLA 2D5GA 1TTNA 2KFKB 4WJQA 3GP7A 2MEKA 4EFOA 2K6DB 3LB8C 1KLUD 1V1OA 2X38A 1H8CA 4K81A 2JXTA 1Q5WB 4G3XB 4BAXA 3AEBB 4ANWA 1HZ6A 1VR9A 4WJNA 1D6EC 1SGHA 1L0XB 4A9AA 5BMIA 1N5WA 1HQRD 2PE9A 2V1YA 1YN5A 2N9XA 3DCGA 5J18A 1C3TA 5JZEB 1L7YA 1WJNA 3NUHB 2UWQA 4KX6B 1FMAD 1I7HA 1ZE3D 1FFVA 3V60A 3Q8AA 1N60A 4S0RA 4ZHOA 4YWGG 1E8YA 3AE3B 2JWUA 3AE5B 1DYQA 2LGXA 1UGMA 4ANVA 5D6JB 2WGSA 3NOBA 3TBLD 2JWZA 3OJ4B 1EF1A 2QHOA 1GB4A 4FN2A 4IWPA 2A4ZA 3AE6B 2J7QB 2KN4A 3L54A 3BVMA 4N9F4 4HKZE 2PE6B 1GNUA 4C4VB 2W3SA 2YVCA 2EKEC 5GXGB 4C7ZA 1TZ1A 2QEJC 3EGRA 3ZKJC 2IDYA 4HPLB 1JWAD 1I4GA 2C5LC 1V6EA 3GE8C 1JW9D 1ZPSA 2LXCA 2FUG1 1D3ZA 1WM3A 4NAMA 2GBKA 2N4FA 3NS8A 1PQSA 3R66C 3S2AA 2CKHB 4WIPA 1WGGA 3BVZA 3EC8A 3N1ZC 4IM0A 3IBEA 4OW0A 2O2VB 2W54A 4LNKA 1AN8A 2L05A 1UD7A 5CHVC 3AV8A 2KXJA 4HXDA 3RUIB 3UI3A 5KHOA 3OAWA 3TEWA 3JYUA 1C4AA 4OVVA 2LZ6A 3I57A 1V5TA 1ZDVA 3NZSA 4KVGB 3VFKA 1WE6A 3DBHI 1I4QA 3X23A 4FJVB 3RMKC 3OJ3A 1YJIA 3W5UB 2I1JA 2J0KA 4QAYA 1WYGA 3DBSA 4MDKE 1G6JA 4NPNA 1R4MB 2GB1A 2Z59B 2MQJA 4RCOA 5HG2A 3A9JA 3A4RA 3PRZA 1KFYB 1J7CA 2WXQA 1PFDA 2IJ0A 2PW9A 1WX9A 2NBWB 3DOWA 1GC7A 4ZYSA 1C78A 4RM8A 1GUAB 3I3TB 4LDTD 4JWUC 2RDHA 1JROA 2XK5A 3B9JA 3GZNI 4RH6A 2DYBA 2D2QA 2W55A 4L2YA 4USAA 3U7ZA 2WXLA 3ML9A 1L6VA 1V80A 3ZYYX 4H2AA 1A5RA 3V62A 3P4SB 1QOFA 2KNBA 4GOCA 4HPMB 2RGFA 1MG4A 4GB9A 5IP4D 1YQ4B 4TQ0A 3SDLC 5CHFA 2LVOA 4M02A 3BK2A 3RZWC 2O6VA 3AE4B 3PZ7A 1PYWD 4JWSC 2B3AA 1CZPA 4RGMA 5IKCM 1SBBB 1PUTA 1J8CA 1RAXA 1YQ3B 2AQ1B 3PV1A 3VTWA 1WXMA 4KKJA 3SR6A 3R3MA 2ZNVC 1K53A 2LI5A 3HVDA 1UUPA 3W1SC 1QT9A 1E7PB 3CSFA 2QIEB 3VXWA 4FLHA 2RR9A 1P1AA 1YN4A 1KRHA 2BB5A 3U4EG 2LRUA 4N6EB 2HJ1A 4EOYA 3L13A 1KH0A 3IAM1 5CHWA 5BYSA 3C0RB 2L0FA 5E6OA 4BBNC 2GLSA 1PGBA 5E6NA 2BYEA 4OVZA 5DCNA 1XO3A 3DHIC 1NBFC 2LJ5A 1HZ5A 1TY0A 4LDTB 1ZKHA 3GB1A 1SIJA 4YL8A 2MBHA 3AMZA 1FNVA 4JPSA 1F1HA 3Q3JA 1TKYA 2LVQA 2ZCCA 2G4SA 3EHVA 3SEBA 2Y3AA 1XQQA 1N61A 1ZW7A 2BF8B 2V3SA 1T0RC 2N9PC 2D07B 3H7PA 1WSPA 4MEMA 5LXHA 3NZUA 2CJOA 2AQ2B 4PS8A 3A9JB 3DWGC 5J17A 3WA0A 2L52A 1K51A 3P2BA 2DHZA 5CTRC 2JU6X 3TIXA 3LDZE 2KK8A 5BYQA 3B1LX 1RYJA 3VUYA 2GBJA 4ICUA 3A9KA 1FM0D 2GMIC 1HEZE 3DHGC 3MJ5A 2XK5B 5D3IB 4I6PA 3Q69A 3K9PB 1TZOA 4YTNB 1QKZA 1P3QU 3RNBC 3X0WA 1FXTB 1JWBD 3WALA 3Q6BA 1E90A 1UH6A 3C19A 2LHEA 4IM3A 3ZIMA 5JHAA 3SHQA 3NVVA 4C56C 1WJUA 4E3CA 1UGJA 1HE8A 4JQWC 2J42A 2Y5BB 4PYZA 1UWMA 1NEKB 2JRHA 1YQBA 2O6VB 5D3DA 1EUVB 2I2YA 4KIKA 3Q3OC 4DDID 4IOIE 1QF6A 2MW5A 4HRSA 2BTEA 2LWPA 2MRPA 1S1QB 2YLMA 2ZVOA 2V9HA 1E8XA 2FIDA 3I63C 2KOXA 2MWSB 5LXIB 1ISNA 4JGHB 3WCQA 2LJIA 1UELA 5BO4B 2FCQA 2DYMA 3VHTC 1D5MC 4IM2A 5BMHA 2KDIA 2NMQA 3W1YA 1UNSA 3H9DA 4B95A 4M01A 1TIFA 2D3AA 4NQKE 3B2GA 1J7BA 4BKTA 4GSWA 3PZDA 1VLBA 3ECIA 4YXDB 2JY6A 4M00A 3Q2AC 4URKA 2V3PA 3FAHA 1E6EB 4NNJB 4WWPA 1U4AA 3ZNGC 2JT4B 2SEBD 2LD9A 3DDCB 1VZ7A 5E6JA 5HI1A 4A3OA 1LO5D 4KSKC 2C7NB 3H7PB 2WXOA 1XF5L 3W2DA 3TEZA 2XBBC 3NZ3A 2BKRB 2JPHA 2Z0DB 4GXBA 3AE2B 3U52E 2L76A 4ANUA 2D10A 1STEA 4G0NB 4IWQA 2KWCA 5HFYA 3IAS1 3L4PA 3VUWA 5FR3A 4NY0A 2KLCA 3QAQA 1E9MA 2IO0B 3N1XC 2OJWA 3A9KB 1P9DU 1WH3A 4HEA1 1TGZB 3TL5A 3T9LA 4IW0A 2L1AA 1SB3C 4WAFA 3L0WB 3NHEB 1JCKB 1EWYC 4RF0A 4DXGA 4ZYNA 3TEXA 1GJZA 5FR6A 4HPPA 1WF9A 5C23A 1TBEA 3ZNID 3PREA 4DK5A 4YT0B 4DXAB 1VJKA 2M0XA 1Q0WB 1N62A 2L83A 3L08A 4JX1C 4KIKB 2GI9A 4OZAA 2K3UA 2KJRA 4EEWA 3RN9C 3AXCA 2MBOA 3WAMA 1SE9A 4ANXA 1WJ6A 2IY1B 2BKFA 3FC4A 2KN5A 2BYTA 4AJYB 4ZRJA 5LLIA 1Z2MA 2KFJA 2HE7A 2KC2A 3DBLB 2D3BA 1K8RB 2QMTA 3KYDD 3B08A 5G2NA 2R61A 1LGRA 2PKOA 1ESFA 2M17A 4II3B 4ACFA 3GOEA 2FUHB 1V86A 2LEKA 2M4NA 3P42A 4FBJB 2JYEA 2WS3B 2CR5A 4G50A 3ZNZB 3MP9A 1WRDB 4W9DA 1IGCA 3LJ3A 3AB5A 3DHHC 4HCNB 1NYRA 1E8WA 2KTFA 2IGGA 4ZDVA 1HTOA 1EU3A 2JXXA 3ZTDA 2KDEB 3V6EB 3FILA 4NJ7A 3KLSX 2MJDA 5GMVA 4A20A 3FKYA 1AYFA 2RSUA 4WH4A 3VDZA 2BQQA 2LVPA 4BKGA 1JWSD 1BXTA 2MBBB 2JRIB 1UBIA 3QX1A 3I5JC 1FEHA 1V9JA 2KX0A 4KSLC 3ZRCA 3ZLZA 4WAAA 1UWXA 1OTRB 1XLPA 3DVNU 3TJPA 3CMMB 2KACA 3DPDA 4W9CA 1YIWA 4TSSA 5MPOA 1BUIC 2DLBA 1SE2A 2KDMA 1UZXB 4E74A 4KGRA 1HXYD 4TMAB 1Y8RC 3AH7A 2N9KA 1Z5SB 2WXFA 1TS3A 4IWOA 2K8CA 4NAWA 3O65B 3N9YC 3TCAA 2MJEA 3KUDB 1P7FA 3RNFC 2FBWB 2L00B 1WXQA 5H92C 2VH2A 3CIRB 3ZQ4A 1NDDA 2C7MB 3PVLA 4WQOB 4A3PA 2XN9C 3P4PB 2MX2A 2N7JA 1WXAA 2DBYA 3AM9A 4M8MA 4YSXB 4RM9A 3AU4A 2INPE 3NJTA 3UQBA 3BK1A 1C1YB 1NI2A 3WANA 4J6IA 1L6UA 3Q3NC 4JE3B 5D2MB 2WXPA 2WU5B 3BIID 1E10A 1GPXA 3W1SA 2K1FA 4MM3A 1GB1A 4MJSA 1CJEA 2NS5A 3L16A 1KTKA 1TT5B 2KDFB 1N6ZA 3AULA 3N3KB 5IOIA 5EE9A 4W9GA 4N58A 4EZKA 4YSZB 1C79A 3O13A 4LTUA 1WGKA 2IBIB 3QA8A 2AX5A 3ZDMC 4MSQB 3NG0A 2NVUI 4KKIA 4GIVA 4ICVA 3M62B 2K5PA 2BYVE 2EMTA 2QCZA 1E5WA 3B2FA 3FILB 4GN1A 3ZXRA 2FIFA 2TSSA 2MLBA 1FO4A 2INDC 2Y5PA 2GBRA 1ZXHA 1WGHA 2DENB 3VTVA 4EE2A 3TUOA 4B6WA 2PVOD 3BYYB 4WQMA 3PGEA 4FHKA 3AEAB 1XLOA 3PZ8A 5C2TB 1XLQA 4CHKA 3SFDB 2PIAA 4EZJA 3U8ZA 4Q2JA 1WZ3A 2JZ3B 1WY8A 4L1BA 3ZJUA 2WXNA 3PRMB 2D3GA 4BOZB 1I4PA 4R3DA 2WXHA 2WHIA 2N0SB 2HDEA 3DBLI 3TSSA 5EE1A 2BYFA 4P7IA 4DHZB 4NAWB 4HCPB 2LHDA 3AI5A 4GDLA 2M1MA 1GAQB 4K1RB 3DBRB 3HM6X 2LGYA 5T8IA 4DHJB 1L4ZB 5BYRA 2DZIA 2J0MA 2IZVB 4US9A 4C00A 3VAWA 2N7DA 3TMPB 3MFGA 3MHSD 3W9CB 1YD8U 1L5PA 2O6VD 2BT6A 5AUIA 2PPHA 3ZNHB 1EU4A 2AL6A 3RT3B 1EO6A 4UDUC 1KOTA 4I6NB 3ZO5B 4M8NA 2DZKA 1T0YA 2LFIA 1J0GA 3QWZB 4IUMB 2RMMA 5G5GA 3BY4B 2LRWA 3DQVA 1L4DB 1ACCA 1S3SG 2ZNVB 2AYOB 4N59A 3NRZA 4XC2A 2NTSA 1WI0A 4MM3B 3A33B 3PHWB 4G11A 4MJSB 5HKHA 2BVCA 3MC8A 4P1CC 4F7ZA 1DOIA 1SJED 1T5XD 2JSVX 5IAAC 1ENFA 2LUEA 1KF6B 2GRIA 2LGDA 2INNE 3RPFC 1V2YA 1JALA 1WR6E 2DZJA 2FAZA 1V5OA 4REZA 2C7HA 2K39A 3BWUD 1L0VB 3RI7C 1XEEA 3NVYA 2N9LA 1PDXA 3VR9B 2JZPA 2UU7A 3ML8A 1F77A 2HD5B 3Q8CA 2KQSA 2J0JA 3V6CB 1SSNA 3T3OA 1IBXA 4BVUC 2RD0A 2BWFA 1FFUA 4EZLA 1RRBA 4WWOA 3DWMA 4HWIB 2C9WB 3QQ8B 5BMGA 2QSDA 3R7QA 4W9HA 3ZJTA 2G4DB 4XZ4A 2CS4A 1ZDXA 4FULA 2H88B 1K52A 1C4PA 3KWVA 5JHBA 3NY5A 3QHTA 2KO3A 5IA7A 2RPQA 2A5UA 3H6NA 3VH4B 4MACA 3JSVA 3B0AA 1OEYA 5IN7A 4MGYE 3HM3A 2K22A 4BBNF 3R2TA 4W9LA 4XDCA 1FRDA 4XYCA 2JQRB 1EWCA 1QOBA 1C77A 2DAFA 4F1SA 2WXKA 3DVGX 3E9SA 1XCQL 1ET9A 4B0EA 1L2NA 4RGTA 2FE8A 4AP4C 3KYCD 1T0QC 3QCAA 2LUMA 4GDLB 4GGQA 2G9HD 2J4XA 1UBQA 4IG7B 2BWES 4XE0A 1R4MI 2L7RA 1JWMD 2NBVB 2NPTA 3N20C 4LNOA 2AEHA 1D4BA 3Q8EA 2BB6A 3E56A 2INCC 2LGIA 1PGXA 1VZ8A 4XWTA 1R7SA 2NBUA 3R8BA 1BMLC 1PGAA 4TV3A 4AJWA 3P63A 4RMAA 1QOGA 2G1EA 2KJHB 3IT4B 1IYFA 1RWSA 2WYQA 4MH8A 4W9JA 2ZW1A 1GG3A 1D5ZC 2GBMA 1FRRA 1QQRA 3CWIA 4EKUA 3T8MA 3GS2A 4DBGA 2ZW0A 1T6BX 1MI0A 3ONSA 1FNUA 2G3QB 3RNEC 4IKGA 2FCSA 4ARCA 2L3ZA 2RDGA 2KKCA 3KWLA 1EF5A 1IP9A 4CO7A 3RCZA 5AZHA 4OVUA 2RDBC 3VH3B 3VUXA 5EE0A 1KJTA 3UINB 3SFEB 2N9EB 1VCBA 1LXDA 2XNAC 2OHFA 4K7WA 4ZRKA 1IBXB 3AEEB 3MJWA 1V8CA 2MBEA 2KAJA 2MCNB 2WDTB 4W9IA 5DPWA 4NJCA 4W9FA 3DBRI 5HHDG 3QJZA 3L10B 4ARIA 2HTHA 3IFWB 1V49A 4YTMB 1P98A 4A90A 1XD3B 1DOYA 2KVZA 4A6QA 1FCLA 1F9JA 1WJ4A 4WJPA 5EE3A 2RPVA 4YSYB 1MJDA 4F8CB 3JSVB 2JVCA 4MGIE 2KMCA 3KUCB 2ZJDA 2ZCBA 2H89B 2KMMA 5H8YE 3PRPB 2HTME 3MC9A 2JX5A 4XGAB 5AUKA 3RFZB 1YNTE 1YJ1A 1ZGUB 4KDLB 4P16A 1B9RA 1WMHA 1FPYA 4CYEA 1OQRA 5C1ZA 3AEGB 2SAKA 3ABVB 2BS3B 2D3CA 4AQ7A 2NPTB 3VR8B 1K50A 2VZKB 1QLBB 4E71A 2B76B 2K9XA 3ZUNA 3MC0B 2JUOA 1TS4A 2REXA 2KC1A 4C80A 1F52A 5DPSA 2XEWA 1M94A 1T0SC 3JVZX 2LXAA 1P7EA 1ZP0B 1XT9B 4W9KA 4RF1A 3T3NA 3KVFB 4O1NA 1I4RA 3HUIA 2KX3A 4FXCA 3ZTCA 4OHJA 3M63B 5DPRA 1FNWA 2KLGA 1MFWA 3HHMA 4PS3A 1WGRA 1YJJA 4IDIA 3R2IA 2MJ3A 3HVZA 1E0ZA 4YTPB 2BGFA 3U7DA 2WXGA 2D11A 3CSTA 2WXRA 1OEYJ 3QK0A 2PJHA 4AUQC 4W9EA 1C9FA 4XX5A 1KLGD 1WR1A 2L8JA 3ZRFA 1QZEA 3VTUA 2KTRA 3VRBB 2LMCA 3CF6E 4ZRPA 1QOAA 1C4CA 4K7SA 5C3JB 3N1YC 1WE7A 2IGHA 2MA9B 2WDQB 5G55A 1J19A 4TKNA 3H7SA 4ITKA 1C76A 4KV2A 2DX5B 2R2OA 2JYTA 2WDRB 1AARA 2G45B 1YOVB 2GOWA 4KZCA 2BS2B 3NS1A 4J3OD 3EFUA 3ZGZA 3OWEB 3HIZA 2OOBB 4FJYA 4B0MA 2WDVB 3RD2A 4BOSC 4B9KA 1N63A 2IO2B 3APFA 4PYUA 5AZGA 1L0YB 3K9OB 1FIQA 2AQ3B 1FXIA 2IO1B 4WJOA 4JIOU 2QJLA 4TUUA 4S17A 1WX8A 1A70A 1WMHB 2KD0A 1WRIA 3Q3MC 3WIMA 2IYDB 2NTTA 3EUB2 3IXSA 2I1KA 2WX1A 2KZRA 1E8ZA 1CQVA 3LXFA 2WXJA 5EDSA 2J53A 2DNFA 2I38A 2PTLA 1NI3A 2BW2A 4DHJD 1IGDA 2BPSA 2JZZA 1WM2A 3URYA 2FCMA 1SXTA 1I42A 1V97A 3N32A 3TEYA 1F2RI 2E6XA 5J2RA 1TKEA 1LM8B 4RFBA 3BVGA 2Q5WD 3UIPB 2W82A 1YMHE 3NVZA 2EELA 1IPGA 3ENEA 1WXSA 3APCA 2ICIA 3PTFC 3P4RB 4MSMB 4K3BA 1QILA 1ZUD2 4KGSA 2M56B 1R4NB 3HRDD 1WIAA 2CHWA 1GC6A 2MP2A 1TYGB 3ZDTA 5JH5C 2PLPA 4OZBA 3KH0A 1HTQA 4GLSC 4JL9A 2Z0EB 3VQIA 1X1MA 5IO9A 1LQBA 3UGBB 3JW0X 2MBQA 3AE8B 3PPAA 4ZRQA 2FCNA 2ZPNA 2IPKD 5TR5A 3ZJVA 3MHZA 1V1PA 4LJOB 2KTRB 2KWUB 2WU2B 2QDFA 3BYTB 4DQOC 3N30A 2CU3A 4PK1A 3VRAB 1HA5A 1YN3A 4NZLB 2KANA 4BKSA 3RNAC 2CHXA 4EUTA 1ROEA 2BS4B 3BZDB 3KW5B 3RULA 3VVWB 2W3RA 4WWMA 2J52A 3I9V1 1WGDA 4XDDA 2LGSA 1H4RA 4HDQA 4HVBA 2KJ6A 4KDIC 1J7AA 1LFDA 2HJ8A 4AWJA 3SD5A 1F0ZA 5DPTA 3R7RA 1Q10A 2GBNA 2CU1A 2N1VA 3QIJA 1SE3A 3M3JA 4I6LB 5KHQA 4GMVA 4FHJA 2K6QA 5D94A 4BKSD 3DVNV 3ETRA 5TSSA 2K8BA 2K25A 4A55A 3EA6A 1SF0A 2KYWA 3AE1B 1YX6B 4NQLB 5FK9C 3AE9B 3Q14C 3WAOA 3QARA 1N5XA 1Y56A 1WGYA 2KQ4X 2M19A 2Y5CA 2QILA 4ZOHC 2FNJB 3J9CA 2L0TA 4HDOA 1XCTL 4ZRIA 2OEDA 2VH1A 4LCDE 3RNGC 2DAJA 3P4QB 3C8YA 2KWDA 4GDKA 2AL3A 3NVWA 3ZXVA 2PMVA 4CQNA 2WQYB 4DWFA 1VRAB 2QC8A 2ZPYA 1RM6C 1WWTA 2L32A 4ZHPA 3PSEB 4MH0E 2ASQA 1VDVA 2V0GA 3OLMD 2EMSA 4LK0M 4LJPB 1SIFA 1FCCC 2KVRA 1NENB 4M0WA 2PVGC 3AECB 3AU5A 1M4VA 1KM7A 2LASA 2MP2B 2KT7A 2ZEQA 2WX0A 1Q1OA 3KUZA 5D7GA 3HK0A 1SEBD 3ZVVA 2AWTA 4A8XC 5LNK1 3A1QA 2N1WA 1I35A 1DGJA 2KHWB 3IHPC 2W9NA 4HJGE 2ON8A 1MHXA 1P0RA 5G5HA 2K8HA 4LNIA 2ONQA 2KWVB 1FD6A 3QC8B 1V1PB 4LNNA 4X57B 5JXVA 3H1UA 1E7VA 4II2B 3V05A 2PEAA 2CJNA 1WXVA 3ZW3A 1MHHE 1SE4A 1AW7A 3PO0A 3U2SC 2KDBA 2M0AA 3WAPA 1B1ZA 4LNFA 1AWDA 3Q8FA 1OQYA 1JQ4A 3IVFA 4TQ1A 1ET6A 3OG5A 2N7EA 1NYQA 3AEDB 4MT5A 3PLVA 2DYOA 3APDA 2ACZB 1CK1A 5L83A 2EKIA 2V3NA 2WWZA 3PHXB 2X8XX 4NJ6A 1I4XA 3AN1A 3L17A 2WNMA 2WXMA 2C60A 3EECA 4L23A 2WXIA 4AS1A 4MGKE 1JRUA 1V81A 2IGDA 1MVKA 3M95A 3BINA 4OZCA 2NR2A 3SU8X 3DVGY 1VZ6A 2Z8LA 2UYZB 1RFAA 1VD2A 2KFKA 1TJEA 3D32A 1R4NI 3LYYA 3PS6A 1F2RC 4DDGD 3RNCC 4PS7A 1WX7A 4KGTA 3IG3A 2MSED 4HK2A 2VZKD 3A4SC 2ZZPB 2E3TA 3DBHB 2MH7A 1I4HA 2IY0B 2JF5A 4GDKB 1T3QA 2BBCA 3MTNB 1JRPA 1DOXA 4KZ0A 2VRRB 3PLUA 3V61A 1OGWA 2V4LA 4RNAA 3UF8A 5FKAC 4BZAA 3Q8BA 1ZXIA 5E6PA 1NVID 1XLNA 3ALBA 2OJRA 5I4DA 4IC7B 2CHZA 4M0WB 2IO3B 3UIOB 5AEKB 2R2QA 4ASWC 2WP9B 3AE7B 3W5VB 1D5XC 4LLGM 4HKQA 1BT0A 2WLBA 1RFKA 1CMXB 4DXFA 3GZNB 4P1BC 1SJHD 2YEPB 3A1QB 5L95C 4MGZE 4C4VA 4AOFA 1GOZA 5CX3A 1TS2A 4D2KA 4RGOS 3KQ4A 1WFYA 2K0PA 4US8A 1TKGA 1TS5A 1EM7A 1WZ0A 1IUEA 1RLFA 2KQ7A 3AEFB 4MELA 1WYWB 1UF0A 3H8HA 5AZFA 2DWQA 3U30A 4WWNA 2ZVNA 4C7YA 4PT5A 2O2VA 2DZMA 2NCNA 4FJZA 4WURA 3PT2B 4FADA 1OQQA 1MG8A 4GU2A 4BFRA 2V4IB 4DHZE
chains in the Genus database with same CATH topology
4JLCA 1WMHB 2KD0A 2M8SA 2PPHA 1UELA 3ZNHB 4FA6A 2KMAA 3WIMA 4HLEA 5BO4B 2IYDB 2AL6A 2FCQA 2DYMA 3Q3FA 3VHTC 3UQAA 2I1KA 2WX1A 2KZRA 4IM2A 3RT3B 1EO6A 1KOTA 1E8ZA 4I6NB 4K7UA 3ZO5B 1E7UA 4M8NA 2DZKA 1T0YA 3RYTA 2KDIA 5EDSA 3QWZB 4IUMB 1J0GA 3W1YA 1KLVA 3BY4B 2LRWA 3DQVA 1S3SG 3H9DA 3RZFA 4B95A 2ZNVB 2AYOB 4DHJD 4XC2A 1WI0A 2BPSA 3A33B 3PHWB 2JZZA 4G11A 4MJSB 4NQKE 5HKHA 1WM2A 4BKTA 4GSWA 1YX5B 4HJKA 2FCMA 3PZDA 1I42A 3ECIA 2JY6A 3N32A 4F7ZA 5J2RA 4URKA 1TTNA 2KFKB 1LM8B 4WJQA 2LUEA 4NNJB 5IAAC 4WWPA 1U4AA 3ZNGC 2LGDA 2JT4B 3UIPB 4EFOA 2LD9A 3DDCB 1V2YA 2K6DB 1WR6E 1IPGA 2DZJA 2FAZA 3ENEA 1V5OA 2C7HA 2K39A 4A3OA 1WXSA 3APCA 1H8CA 4KSKC 4K81A 1Q5WB 4G3XB 2C7NB 3H7PB 3PTFC 4ANWA 4WJNA 1SGHA 2XBBC 4MSMB 2BKRB 2JPHA 2PE9A 2V1YA 2Z0DB 4GXBA 2N9XA 3DCGA 5J18A 3ML8A 2L76A 1C3TA 4ANUA 5JZEB 1L7YA 1WIAA 1WJNA 2CHWA 2D10A 2UWQA 4G0NB 4IWQA 2HD5B 2KWCA 1GC6A 2MP2A 2KQSA 3ZDTA 2J0JA 3V6CB 5JH5C 4BVUC 2RD0A 3KH0A 2BWFA 3VUWA 4NY0A 2KLCA 3QAQA 4EZLA 4JL9A 2Z0EB 3VQIA 1X1MA 1RRBA 2IO0B 3UGBB 1LQBA 4WWOA 3JW0X 3V60A 2MBQA 3A9KB 1P9DU 1WH3A 3PPAA 1E8YA 4HWIB 2C9WB 3QQ8B 1TGZB 2FCNA 3R7QA 4W9HA 2ZPNA 3TL5A 3T9LA 2G4DB 4IW0A 4XZ4A 2CS4A 2LGXA 4FULA 5TR5A 1UGMA 4ANVA 3L0WB 3NHEB 5D6JB 3NOBA 4LJOB 3TBLD 5JHBA 2KTRB 2KWUB 2JWZA 3OJ4B 3NY5A 1EF1A 3QHTA 4ZYNA 2QHOA 3N30A 5FR6A 1GJZA 2KO3A 5IA7A 2RPQA 2A5UA 3H6NA 1WF9A 4FN2A 3VH4B 5C23A 3JSVA 3B0AA 2A4ZA 4IWPA 1OEYA 1TBEA 2KANA 3PREA 3ZNID 2J7QB 4DK5A 4BKSA 3L54A 4MGYE 4N9F4 4DXAB 3HM3A 2PE6B 2CHXA 4EUTA 2M0XA 4BBNF 1GNUA 1Q0WB 4W9LA 2YVCA 2EKEC 1TZ1A 3ZKJC 3KW5B 3RULA 3VVWB 4HPLB 3L08A 4KIKB 2DAFA 4F1SA 2C5LC 1V6EA 3DVGX 2KJRA 4EEWA 1L2NA 3AXCA 2LXCA 4AP4C 2MBOA 3WAMA 1D3ZA 1WM3A 1SE9A 1WGDA 3KYCD 2GBKA 2N4FA 3QCAA 4ANXA 1WJ6A 3NS8A 1PQSA 2IY1B 2BKFA 3R66C 4GDLB 4GGQA 1H4RA 4HDQA 3S2AA 2KN5A 2CKHB 4HVBA 1UBQA 2KJ6A 4KDIC 4AJYB 4IG7B 2BWES 1LFDA 4ZRJA 1WGGA 5LLIA 1Z2MA 1R4MI 2HJ8A 2L7RA 2NBVB 2NPTA 2KFJA 3SD5A 3EC8A 4AWJA 2HE7A 2KC2A 4IM0A 3IBEA 1K8RB 2O2VB 3KYDD 5DPTA 3R7RA 3B08A 5G2NA 2L05A 2GBNA 1UD7A 2CU1A 5CHVC 2AEHA 2N1VA 2KXJA 4HXDA 3QIJA 3RUIB 3M3JA 5KHOA 4I6LB 5KHQA 3OAWA 4GMVA 3JYUA 2M17A 4II3B 4OVVA 4FHJA 3GOEA 2LZ6A 1V5TA 2FUHB 2K6QA 3NZSA 1V86A 5D94A 4BKSD 4KVGB 3VFKA 2M4NA 3DVNV 1WE6A 3DBHI 4FBJB 3X23A 2NBUA 4FJVB 2K8BA 2K25A 2CR5A 4G50A 3OJ3A 3ZNZB 2I1JA 2J0KA 1WRDB 4W9DA 3LJ3A 1YX6B 4NQLB 4TV3A 3WAOA 4AJWA 3DBSA 3QARA 4HCNB 4MDKE 4RMAA 4NPNA 1G6JA 1E8WA 2KTFA 2KJHB 1IYFA 2Z59B 1WGYA 4ZDVA 2WYQA 2MQJA 2JXXA 4W9JA 2FNJB 1GG3A 3A9JA 3ZTDA 2KDEB 2L0TA 3A4RA 3PRZA 4HDOA 2GBMA 4ZRIA 3V6EB 4NJ7A 4LCDE 4EKUA 3T8MA 5GMVA 4A20A 2DAJA 2RSUA 1WX9A 2NBWB 2AL3A 4GDKA 3VDZA 4DBGA 3ONSA 3DOWA 2LVPA 4BKGA 2G3QB 1GC7A 4DWFA 2FCSA 4RM8A 1GUAB 3I3TB 2ZPYA 4LDTD 2L3ZA 2KKCA 2MBBB 2XK5A 3PSEB 1EF5A 2JRIB 3GZNI 4MH0E 2ASQA 2D2QA 2DYBA 1UBIA 3QX1A 1IP9A 4CO7A 3RCZA 5AZHA 4OVUA 3OLMD 2EMSA 4LJPB 3VH3B 1SIFA 2KVRA 3ML9A 3VUXA 1KJTA 1V80A 1V9JA 3AU5A 3UINB 2KX0A 4KSLC 1KM7A 2LASA 2MP2B 2N9EB 3ZLZA 3ZRCA 1VCBA 1LXDA 4WAAA 4K7WA 4ZRKA 1OTRB 2ZEQA 2WX0A 3MJWA 1A5RA 1Q1OA 3KUZA 5D7GA 3V62A 2KNBA 3DVNU 3HK0A 2MBEA 4GOCA 4HPMB 2MCNB 3TJPA 2RGFA 2WDTB 3CMMB 3DPDA 4GB9A 4W9IA 1YIWA 4W9CA 5DPWA 4TQ0A 3ZVVA 2AWTA 4W9FA 3A1QA 3DBRI 2N1WA 3SDLC 3QJZA 3L10B 2KHWB 5CHFA 1I35A 2LVOA 3IHPC 2W9NA 2HTHA 3IFWB 1UZXB 1V49A 4E74A 1P98A 1XD3B 1P0RA 3RZWC 2O6VA 1Y8RC 2K8HA 2KWVB 1F9JA 1WJ4A 1Z5SB 3QC8B 4WJPA 4X57B 2B3AA 4IWOA 2K8CA 4NAWA 3O65B 3H1UA 3TCAA 1E7VA 4II2B 4F8CB 1J8CA 1RAXA 2PEAA 3JSVB 3KUDB 2JVCA 4MGIE 3PV1A 2L00B 3VTWA 1WXMA 2KMCA 1WXVA 3KUCB 1NDDA 2C7MB 3PVLA 3ZW3A 2ZJDA 3R3MA 2ZNVC 2ZCBA 2KDBA 4WQOB 4A3PA 3PRPB 2LI5A 2MX2A 3W1SC 3WAPA 1OQYA 3IVFA 4TQ1A 1WXAA 3CSFA 3VXWA 4FLHA 2N7EA 1YJ1A 1ZGUB 4KDLB 2RR9A 4M8MA 1P1AA 1WMHA 4RM9A 3AU4A 3PLVA 4CYEA 2DYOA 2LRUA 3APDA 5C1ZA 5L83A 2WWZA 3UQBA 1C1YB 3PHXB 4EOYA 3L13A 1NI2A 4NJ6A 4J6IA 3WANA 5CHWA 3C0RB 3L17A 5D2MB 2L0FA 2NPTB 5E6OA 4BBNC 2C60A 3EECA 4MGKE 1JRUA 5E6NA 2BYEA 3W1SA 1V81A 2K1FA 4MM3A 5DCNA 4MJSA 1NBFC 2LJ5A 4E71A 2NS5A 4LDTB 1ZKHA 3L16A 3M95A 4YL8A 3BINA 2MBHA 2NR2A 2KDFB 3DVGY 3SU8X 3ZUNA 2JUOA 3AULA 2REXA 2UYZB 3N3KB 2KC1A 1RFAA 3Q3JA 4W9GA 1VD2A 5DPSA 2KFKA 4EZKA 2LVQA 2XEWA 2ZCCA 1M94A 2G4SA 3D32A 1R4NI 3JVZX 2LXAA 3EHVA 3PS6A 4DDGD 2IBIB 3QA8A 1XT9B 4PS7A 4W9KA 1WX7A 3ZDMC 3KVFB 3IG3A 4MSQB 1XQQA 2KX3A 2NVUI 2MSED 1ZW7A 3ZTCA 2BF8B 2V3SA 4HK2A 4GIVA 4ICVA 3M62B 2N9PC 2D07B 3H7PA 3M63B 5DPRA 2KLGA 4MEMA 5LXHA 3NZUA 2BYVE 2EMTA 3HHMA 4PS8A 3A9JB 5J17A 4PS3A 3A4SC 2ZZPB 3WA0A 1E5WA 4GN1A 2FIFA 1WGRA 2IY0B 2JF5A 3P2BA 2MLBA 2DHZA 5CTRC 4GDKB 3TIXA 3LDZE 3MTNB 2KK8A 4KZ0A 2BGFA 2GBRA 3B1LX 1WGHA 2VRRB 3PLUA 3U7DA 1OGWA 2V4LA 3V61A 2D11A 3VUYA 2GBJA 3UF8A 4ICUA 3A9KA 2DENB 3VTVA 5E6PA 3CSTA 2GMIC 1OEYJ 2XK5B 4I6PA 4B6WA 3K9PB 3ALBA 3PGEA 3QK0A 2OJRA 2PJHA 4AUQC 4FHKA 1P3QU 4W9EA 4IC7B 4XX5A 3X0WA 2CHZA 4M0WB 1FXTB 2IO3B 1WR1A 3UIOB 2L8JA 3WALA 2R2QA 4ASWC 5AEKB 3ZRFA 1E90A 1QZEA 3VTUA 2KTRA 4CHKA 1UH6A 1BT0A 3CF6E 4EZJA 4IM3A 3ZIMA 5JHAA 3U8ZA 3SHQA 1WZ3A 1CMXB 4K7SA 2JZ3B 1WE7A 2MA9B 1WY8A 5G55A 1J19A 3PRMB 2D3GA 4TKNA 3A1QB 3H7SA 5L95C 4BOZB 4MGZE 1WJUA 4KV2A 4AOFA 5CX3A 4E3CA 1HE8A 4JQWC 2DX5B 4PYZA 2Y5BB 2R2OA 2JRHA 1AARA 1YQBA 2O6VB 2G45B 1EUVB 1WFYA 3DBLI 4KIKA 2GOWA 4KZCA 2BYFA 4P7IA 3EFUA 1WZ0A 3HIZA 4NAWB 4DHZB 2OOBB 4HCPB 4FJYA 3AI5A 3RD2A 4DDID 4GDLA 4BOSC 4B9KA 2IO2B 2M1MA 1RLFA 3APFA 2KQ7A 2MW5A 4K1RB 4PYUA 5AZGA 3K9OB 3HM6X 2LGYA 4MELA 4DHJB 1WYWB 2LWPA 2DZIA 2MRPA 2J0MA 5AZFA 3U30A 2IZVB 1S1QB 2YLMA 4WWNA 2IO1B 2ZVOA 2ZVNA 2O2VA 2DZMA 2NCNA 2N7DA 4JIOU 4WJOA 3VAWA 4FJZA 3PT2B 1E8XA 4TUUA 2FIDA 3TMPB 4FADA 3MHSD 1MG8A 1YD8U 2KOXA 1WX8A 2MWSB 4GU2A 4BFRA 5LXIB 1ISNA 4DHZE 2O6VD 4JGHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLC A;  1WMH B;  2KD0 A;  2M8S A;  2PPH A;  1UEL A;  3ZNH B;  4FA6 A;  2KMA A;  3WIM A;  4HLE A;  5BO4 B;  2IYD B;  2AL6 A;  2FCQ A;  2DYM A;  3Q3F A;  3VHT C;  3UQA A;  2I1K A;  2WX1 A;  2KZR A;  4IM2 A;  3RT3 B;  1EO6 A;  1KOT A;  1E8Z A;  4I6N B;  4K7U A;  3ZO5 B;  1E7U A;  4M8N A;  2DZK A;  1T0Y A;  3RYT A;  2KDI A;  5EDS A;  3QWZ B;  4IUM B;  1J0G A;  3W1Y A;  1KLV A;  3BY4 B;  2LRW A;  3DQV A;  1S3S G;  3H9D A;  3RZF A;  4B95 A;  2ZNV B;  2AYO B;  4DHJ D;  4XC2 A;  1WI0 A;  2BPS A;  3A33 B;  3PHW B;  2JZZ A;  4G11 A;  4MJS B;  4NQK E;  5HKH A;  1WM2 A;  4BKT A;  4GSW A;  1YX5 B;  4HJK A;  2FCM A;  3PZD A;  1I42 A;  3ECI A;  2JY6 A;  3N32 A;  4F7Z A;  5J2R A;  4URK A;  1TTN A;  2KFK B;  1LM8 B;  4WJQ A;  2LUE A;  4NNJ B;  5IAA C;  4WWP A;  1U4A A;  3ZNG C;  2LGD A;  2JT4 B;  3UIP B;  4EFO A;  2LD9 A;  3DDC B;  1V2Y A;  2K6D B;  1WR6 E;  1IPG A;  2DZJ A;  2FAZ A;  3ENE A;  1V5O A;  2C7H A;  2K39 A;  4A3O A;  1WXS A;  3APC A;  1H8C A;  4KSK C;  4K81 A;  1Q5W B;  4G3X B;  2C7N B;  3H7P B;  3PTF C;  4ANW A;  4WJN A;  1SGH A;  2XBB C;  4MSM B;  2BKR B;  2JPH A;  2PE9 A;  2V1Y A;  2Z0D B;  4GXB A;  2N9X A;  3DCG A;  5J18 A;  3ML8 A;  2L76 A;  1C3T A;  4ANU A;  5JZE B;  1L7Y A;  1WIA A;  1WJN A;  2CHW A;  2D10 A;  2UWQ A;  4G0N B;  4IWQ A;  2HD5 B;  2KWC A;  1GC6 A;  2MP2 A;  2KQS A;  3ZDT A;  2J0J A;  3V6C B;  5JH5 C;  4BVU C;  2RD0 A;  3KH0 A;  2BWF A;  3VUW A;  4NY0 A;  2KLC A;  3QAQ A;  4EZL A;  4JL9 A;  2Z0E B;  3VQI A;  1X1M A;  1RRB A;  2IO0 B;  3UGB B;  1LQB A;  4WWO A;  3JW0 X;  3V60 A;  2MBQ A;  3A9K B;  1P9D U;  1WH3 A;  3PPA A;  1E8Y A;  4HWI B;  2C9W B;  3QQ8 B;  1TGZ B;  2FCN A;  3R7Q A;  4W9H A;  2ZPN A;  3TL5 A;  3T9L A;  2G4D B;  4IW0 A;  4XZ4 A;  2CS4 A;  2LGX A;  4FUL A;  5TR5 A;  1UGM A;  4ANV A;  3L0W B;  3NHE B;  5D6J B;  3NOB A;  4LJO B;  3TBL D;  5JHB A;  2KTR B;  2KWU B;  2JWZ A;  3OJ4 B;  3NY5 A;  1EF1 A;  3QHT A;  4ZYN A;  2QHO A;  3N30 A;  5FR6 A;  1GJZ A;  2KO3 A;  5IA7 A;  2RPQ A;  2A5U A;  3H6N A;  1WF9 A;  4FN2 A;  3VH4 B;  5C23 A;  3JSV A;  3B0A A;  2A4Z A;  4IWP A;  1OEY A;  1TBE A;  2KAN A;  3PRE A;  3ZNI D;  2J7Q B;  4DK5 A;  4BKS A;  3L54 A;  4MGY E;  4N9F 4;  4DXA B;  3HM3 A;  2PE6 B;  2CHX A;  4EUT A;  2M0X A;  4BBN F;  1GNU A;  1Q0W B;  4W9L A;  2YVC A;  2EKE C;  1TZ1 A;  3ZKJ C;  3KW5 B;  3RUL A;  3VVW B;  4HPL B;  3L08 A;  4KIK B;  2DAF A;  4F1S A;  2C5L C;  1V6E A;  3DVG X;  2KJR A;  4EEW A;  1L2N A;  3AXC A;  2LXC A;  4AP4 C;  2MBO A;  3WAM A;  1D3Z A;  1WM3 A;  1SE9 A;  1WGD A;  3KYC D;  2GBK A;  2N4F A;  3QCA A;  4ANX A;  1WJ6 A;  3NS8 A;  1PQS A;  2IY1 B;  2BKF A;  3R66 C;  4GDL B;  4GGQ A;  1H4R A;  4HDQ A;  3S2A A;  2KN5 A;  2CKH B;  4HVB A;  1UBQ A;  2KJ6 A;  4KDI C;  4AJY B;  4IG7 B;  2BWE S;  1LFD A;  4ZRJ A;  1WGG A;  5LLI A;  1Z2M A;  1R4M I;  2HJ8 A;  2L7R A;  2NBV B;  2NPT A;  2KFJ A;  3SD5 A;  3EC8 A;  4AWJ A;  2HE7 A;  2KC2 A;  4IM0 A;  3IBE A;  1K8R B;  2O2V B;  3KYD D;  5DPT A;  3R7R A;  3B08 A;  5G2N A;  2L05 A;  2GBN A;  1UD7 A;  2CU1 A;  5CHV C;  2AEH A;  2N1V A;  2KXJ A;  4HXD A;  3QIJ A;  3RUI B;  3M3J A;  5KHO A;  4I6L B;  5KHQ A;  3OAW A;  4GMV A;  3JYU A;  2M17 A;  4II3 B;  4OVV A;  4FHJ A;  3GOE A;  2LZ6 A;  1V5T A;  2FUH B;  2K6Q A;  3NZS A;  1V86 A;  5D94 A;  4BKS D;  4KVG B;  3VFK A;  2M4N A;  3DVN V;  1WE6 A;  3DBH I;  4FBJ B;  3X23 A;  2NBU A;  4FJV B;  2K8B A;  2K25 A;  2CR5 A;  4G50 A;  3OJ3 A;  3ZNZ B;  2I1J A;  2J0K A;  1WRD B;  4W9D A;  3LJ3 A;  1YX6 B;  4NQL B;  4TV3 A;  3WAO A;  4AJW A;  3DBS A;  3QAR A;  4HCN B;  4MDK E;  4RMA A;  4NPN A;  1G6J A;  1E8W A;  2KTF A;  2KJH B;  1IYF A;  2Z59 B;  1WGY A;  4ZDV A;  2WYQ A;  2MQJ A;  2JXX A;  4W9J A;  2FNJ B;  1GG3 A;  3A9J A;  3ZTD A;  2KDE B;  2L0T A;  3A4R A;  3PRZ A;  4HDO A;  2GBM A;  4ZRI A;  3V6E B;  4NJ7 A;  4LCD E;  4EKU A;  3T8M A;  5GMV A;  4A20 A;  2DAJ A;  2RSU A;  1WX9 A;  2NBW B;  2AL3 A;  4GDK A;  3VDZ A;  4DBG A;  3ONS A;  3DOW A;  2LVP A;  4BKG A;  2G3Q B;  1GC7 A;  4DWF A;  2FCS A;  4RM8 A;  1GUA B;  3I3T B;  2ZPY A;  4LDT D;  2L3Z A;  2KKC A;  2MBB B;  2XK5 A;  3PSE B;  1EF5 A;  2JRI B;  3GZN I;  4MH0 E;  2ASQ A;  2D2Q A;  2DYB A;  1UBI A;  3QX1 A;  1IP9 A;  4CO7 A;  3RCZ A;  5AZH A;  4OVU A;  3OLM D;  2EMS A;  4LJP B;  3VH3 B;  1SIF A;  2KVR A;  3ML9 A;  3VUX A;  1KJT A;  1V80 A;  1V9J A;  3AU5 A;  3UIN B;  2KX0 A;  4KSL C;  1KM7 A;  2LAS A;  2MP2 B;  2N9E B;  3ZLZ A;  3ZRC A;  1VCB A;  1LXD A;  4WAA A;  4K7W A;  4ZRK A;  1OTR B;  2ZEQ A;  2WX0 A;  3MJW A;  1A5R A;  1Q1O A;  3KUZ A;  5D7G A;  3V62 A;  2KNB A;  3DVN U;  3HK0 A;  2MBE A;  4GOC A;  4HPM B;  2MCN B;  3TJP A;  2RGF A;  2WDT B;  3CMM B;  3DPD A;  4GB9 A;  4W9I A;  1YIW A;  4W9C A;  5DPW A;  4TQ0 A;  3ZVV A;  2AWT A;  4W9F A;  3A1Q A;  3DBR I;  2N1W A;  3SDL C;  3QJZ A;  3L10 B;  2KHW B;  5CHF A;  1I35 A;  2LVO A;  3IHP C;  2W9N A;  2HTH A;  3IFW B;  1UZX B;  1V49 A;  4E74 A;  1P98 A;  1XD3 B;  1P0R A;  3RZW C;  2O6V A;  1Y8R C;  2K8H A;  2KWV B;  1F9J A;  1WJ4 A;  1Z5S B;  3QC8 B;  4WJP A;  4X57 B;  2B3A A;  4IWO A;  2K8C A;  4NAW A;  3O65 B;  3H1U A;  3TCA A;  1E7V A;  4II2 B;  4F8C B;  1J8C A;  1RAX A;  2PEA A;  3JSV B;  3KUD B;  2JVC A;  4MGI E;  3PV1 A;  2L00 B;  3VTW A;  1WXM A;  2KMC A;  1WXV A;  3KUC B;  1NDD A;  2C7M B;  3PVL A;  3ZW3 A;  2ZJD A;  3R3M A;  2ZNV C;  2ZCB A;  2KDB A;  4WQO B;  4A3P A;  3PRP B;  2LI5 A;  2MX2 A;  3W1S C;  3WAP A;  1OQY A;  3IVF A;  4TQ1 A;  1WXA A;  3CSF A;  3VXW A;  4FLH A;  2N7E A;  1YJ1 A;  1ZGU B;  4KDL B;  2RR9 A;  4M8M A;  1P1A A;  1WMH A;  4RM9 A;  3AU4 A;  3PLV A;  4CYE A;  2DYO A;  2LRU A;  3APD A;  5C1Z A;  5L83 A;  2WWZ A;  3UQB A;  1C1Y B;  3PHX B;  4EOY A;  3L13 A;  1NI2 A;  4NJ6 A;  4J6I A;  3WAN A;  5CHW A;  3C0R B;  3L17 A;  5D2M B;  2L0F A;  2NPT B;  5E6O A;  4BBN C;  2C60 A;  3EEC A;  4MGK E;  1JRU A;  5E6N A;  2BYE A;  3W1S A;  1V81 A;  2K1F A;  4MM3 A;  5DCN A;  4MJS A;  1NBF C;  2LJ5 A;  4E71 A;  2NS5 A;  4LDT B;  1ZKH A;  3L16 A;  3M95 A;  4YL8 A;  3BIN A;  2MBH A;  2NR2 A;  2KDF B;  3DVG Y;  3SU8 X;  3ZUN A;  2JUO A;  3AUL A;  2REX A;  2UYZ B;  3N3K B;  2KC1 A;  1RFA A;  3Q3J A;  4W9G A;  1VD2 A;  5DPS A;  2KFK A;  4EZK A;  2LVQ A;  2XEW A;  2ZCC A;  1M94 A;  2G4S A;  3D32 A;  1R4N I;  3JVZ X;  2LXA A;  3EHV A;  3PS6 A;  4DDG D;  2IBI B;  3QA8 A;  1XT9 B;  4PS7 A;  4W9K A;  1WX7 A;  3ZDM C;  3KVF B;  3IG3 A;  4MSQ B;  1XQQ A;  2KX3 A;  2NVU I;  2MSE D;  1ZW7 A;  3ZTC A;  2BF8 B;  2V3S A;  4HK2 A;  4GIV A;  4ICV A;  3M62 B;  2N9P C;  2D07 B;  3H7P A;  3M63 B;  5DPR A;  2KLG A;  4MEM A;  5LXH A;  3NZU A;  2BYV E;  2EMT A;  3HHM A;  4PS8 A;  3A9J B;  5J17 A;  4PS3 A;  3A4S C;  2ZZP B;  3WA0 A;  1E5W A;  4GN1 A;  2FIF A;  1WGR A;  2IY0 B;  2JF5 A;  3P2B A;  2MLB A;  2DHZ A;  5CTR C;  4GDK B;  3TIX A;  3LDZ E;  3MTN B;  2KK8 A;  4KZ0 A;  2BGF A;  2GBR A;  3B1L X;  1WGH A;  2VRR B;  3PLU A;  3U7D A;  1OGW A;  2V4L A;  3V61 A;  2D11 A;  3VUY A;  2GBJ A;  3UF8 A;  4ICU A;  3A9K A;  2DEN B;  3VTV A;  5E6P A;  3CST A;  2GMI C;  1OEY J;  2XK5 B;  4I6P A;  4B6W A;  3K9P B;  3ALB A;  3PGE A;  3QK0 A;  2OJR A;  2PJH A;  4AUQ C;  4FHK A;  1P3Q U;  4W9E A;  4IC7 B;  4XX5 A;  3X0W A;  2CHZ A;  4M0W B;  1FXT B;  2IO3 B;  1WR1 A;  3UIO B;  2L8J A;  3WAL A;  2R2Q A;  4ASW C;  5AEK B;  3ZRF A;  1E90 A;  1QZE A;  3VTU A;  2KTR A;  4CHK A;  1UH6 A;  1BT0 A;  3CF6 E;  4EZJ A;  4IM3 A;  3ZIM A;  5JHA A;  3U8Z A;  3SHQ A;  1WZ3 A;  1CMX B;  4K7S A;  2JZ3 B;  1WE7 A;  2MA9 B;  1WY8 A;  5G55 A;  1J19 A;  3PRM B;  2D3G A;  4TKN A;  3A1Q B;  3H7S A;  5L95 C;  4BOZ B;  4MGZ E;  1WJU A;  4KV2 A;  4AOF A;  5CX3 A;  4E3C A;  1HE8 A;  4JQW C;  2DX5 B;  4PYZ A;  2Y5B B;  2R2O A;  2JRH A;  1AAR A;  1YQB A;  2O6V B;  2G45 B;  1EUV B;  1WFY A;  3DBL I;  4KIK A;  2GOW A;  4KZC A;  2BYF A;  4P7I A;  3EFU A;  1WZ0 A;  3HIZ A;  4NAW B;  4DHZ B;  2OOB B;  4HCP B;  4FJY A;  3AI5 A;  3RD2 A;  4DDI D;  4GDL A;  4BOS C;  4B9K A;  2IO2 B;  2M1M A;  1RLF A;  3APF A;  2KQ7 A;  2MW5 A;  4K1R B;  4PYU A;  5AZG A;  3K9O B;  3HM6 X;  2LGY A;  4MEL A;  4DHJ B;  1WYW B;  2LWP A;  2DZI A;  2MRP A;  2J0M A;  5AZF A;  3U30 A;  2IZV B;  1S1Q B;  2YLM A;  4WWN A;  2IO1 B;  2ZVO A;  2ZVN A;  2O2V A;  2DZM A;  2NCN A;  2N7D A;  4JIO U;  4WJO A;  3VAW A;  4FJZ A;  3PT2 B;  1E8X A;  4TUU A;  2FID A;  3TMP B;  4FAD A;  3MHS D;  1MG8 A;  1YD8 U;  2KOX A;  1WX8 A;  2MWS B;  4GU2 A;  4BFR A;  5LXI B;  1ISN A;  4DHZ E;  2O6V D;  4JGH B; 
#chains in the Genus database with same CATH topology
 4JLC A;  4FA6 A;  2M8S A;  1MPE A;  1XXG A;  2KMA A;  2MHJ A;  4HLE A;  1OFF A;  1ZOY B;  3Q3F A;  3UQA A;  1TY2 A;  4K7U A;  1E7U A;  3GE3 C;  3RYT A;  4K3C A;  4RGN A;  4P6V F;  1KLV A;  3RZF A;  3EFC A;  4HRO A;  3P1M A;  1FXA A;  2YEP F;  3IT6 B;  1JWU D;  3V3X A;  4HJK A;  1YX5 B;  4XWW A;  1JML A;  2D5G A;  1TTN A;  2KFK B;  4WJQ A;  3GP7 A;  2MEK A;  4EFO A;  2K6D B;  3LB8 C;  1KLU D;  1V1O A;  2X38 A;  1H8C A;  4K81 A;  2JXT A;  1Q5W B;  4G3X B;  4BAX A;  3AEB B;  4ANW A;  1HZ6 A;  1VR9 A;  4WJN A;  1D6E C;  1SGH A;  1L0X B;  4A9A A;  5BMI A;  1N5W A;  1HQR D;  2PE9 A;  2V1Y A;  1YN5 A;  2N9X A;  3DCG A;  5J18 A;  1C3T A;  5JZE B;  1L7Y A;  1WJN A;  3NUH B;  2UWQ A;  4KX6 B;  1FMA D;  1I7H A;  1ZE3 D;  1FFV A;  3V60 A;  3Q8A A;  1N60 A;  4S0R A;  4ZHO A;  4YWG G;  1E8Y A;  3AE3 B;  2JWU A;  3AE5 B;  1DYQ A;  2LGX A;  1UGM A;  4ANV A;  5D6J B;  2WGS A;  3NOB A;  3TBL D;  2JWZ A;  3OJ4 B;  1EF1 A;  2QHO A;  1GB4 A;  4FN2 A;  4IWP A;  2A4Z A;  3AE6 B;  2J7Q B;  2KN4 A;  3L54 A;  3BVM A;  4N9F 4;  4HKZ E;  2PE6 B;  1GNU A;  4C4V B;  2W3S A;  2YVC A;  2EKE C;  5GXG B;  4C7Z A;  1TZ1 A;  2QEJ C;  3EGR A;  3ZKJ C;  2IDY A;  4HPL B;  1JWA D;  1I4G A;  2C5L C;  1V6E A;  3GE8 C;  1JW9 D;  1ZPS A;  2LXC A;  2FUG 1;  1D3Z A;  1WM3 A;  4NAM A;  2GBK A;  2N4F A;  3NS8 A;  1PQS A;  3R66 C;  3S2A A;  2CKH B;  4WIP A;  1WGG A;  3BVZ A;  3EC8 A;  3N1Z C;  4IM0 A;  3IBE A;  4OW0 A;  2O2V B;  2W54 A;  4LNK A;  1AN8 A;  2L05 A;  1UD7 A;  5CHV C;  3AV8 A;  2KXJ A;  4HXD A;  3RUI B;  3UI3 A;  5KHO A;  3OAW A;  3TEW A;  3JYU A;  1C4A A;  4OVV A;  2LZ6 A;  3I57 A;  1V5T A;  1ZDV A;  3NZS A;  4KVG B;  3VFK A;  1WE6 A;  3DBH I;  1I4Q A;  3X23 A;  4FJV B;  3RMK C;  3OJ3 A;  1YJI A;  3W5U B;  2I1J A;  2J0K A;  4QAY A;  1WYG A;  3DBS A;  4MDK E;  1G6J A;  4NPN A;  1R4M B;  2GB1 A;  2Z59 B;  2MQJ A;  4RCO A;  5HG2 A;  3A9J A;  3A4R A;  3PRZ A;  1KFY B;  1J7C A;  2WXQ A;  1PFD A;  2IJ0 A;  2PW9 A;  1WX9 A;  2NBW B;  3DOW A;  1GC7 A;  4ZYS A;  1C78 A;  4RM8 A;  1GUA B;  3I3T B;  4LDT D;  4JWU C;  2RDH A;  1JRO A;  2XK5 A;  3B9J A;  3GZN I;  4RH6 A;  2DYB A;  2D2Q A;  2W55 A;  4L2Y A;  4USA A;  3U7Z A;  2WXL A;  3ML9 A;  1L6V A;  1V80 A;  3ZYY X;  4H2A A;  1A5R A;  3V62 A;  3P4S B;  1QOF A;  2KNB A;  4GOC A;  4HPM B;  2RGF A;  1MG4 A;  4GB9 A;  5IP4 D;  1YQ4 B;  4TQ0 A;  3SDL C;  5CHF A;  2LVO A;  4M02 A;  3BK2 A;  3RZW C;  2O6V A;  3AE4 B;  3PZ7 A;  1PYW D;  4JWS C;  2B3A A;  1CZP A;  4RGM A;  5IKC M;  1SBB B;  1PUT A;  1J8C A;  1RAX A;  1YQ3 B;  2AQ1 B;  3PV1 A;  3VTW A;  1WXM A;  4KKJ A;  3SR6 A;  3R3M A;  2ZNV C;  1K53 A;  2LI5 A;  3HVD A;  1UUP A;  3W1S C;  1QT9 A;  1E7P B;  3CSF A;  2QIE B;  3VXW A;  4FLH A;  2RR9 A;  1P1A A;  1YN4 A;  1KRH A;  2BB5 A;  3U4E G;  2LRU A;  4N6E B;  2HJ1 A;  4EOY A;  3L13 A;  1KH0 A;  3IAM 1;  5CHW A;  5BYS A;  3C0R B;  2L0F A;  5E6O A;  4BBN C;  2GLS A;  1PGB A;  5E6N A;  2BYE A;  4OVZ A;  5DCN A;  1XO3 A;  3DHI C;  1NBF C;  2LJ5 A;  1HZ5 A;  1TY0 A;  4LDT B;  1ZKH A;  3GB1 A;  1SIJ A;  4YL8 A;  2MBH A;  3AMZ A;  1FNV A;  4JPS A;  1F1H A;  3Q3J A;  1TKY A;  2LVQ A;  2ZCC A;  2G4S A;  3EHV A;  3SEB A;  2Y3A A;  1XQQ A;  1N61 A;  1ZW7 A;  2BF8 B;  2V3S A;  1T0R C;  2N9P C;  2D07 B;  3H7P A;  1WSP A;  4MEM A;  5LXH A;  3NZU A;  2CJO A;  2AQ2 B;  4PS8 A;  3A9J B;  3DWG C;  5J17 A;  3WA0 A;  2L52 A;  1K51 A;  3P2B A;  2DHZ A;  5CTR C;  2JU6 X;  3TIX A;  3LDZ E;  2KK8 A;  5BYQ A;  3B1L X;  1RYJ A;  3VUY A;  2GBJ A;  4ICU A;  3A9K A;  1FM0 D;  2GMI C;  1HEZ E;  3DHG C;  3MJ5 A;  2XK5 B;  5D3I B;  4I6P A;  3Q69 A;  3K9P B;  1TZO A;  4YTN B;  1QKZ A;  1P3Q U;  3RNB C;  3X0W A;  1FXT B;  1JWB D;  3WAL A;  3Q6B A;  1E90 A;  1UH6 A;  3C19 A;  2LHE A;  4IM3 A;  3ZIM A;  5JHA A;  3SHQ A;  3NVV A;  4C56 C;  1WJU A;  4E3C A;  1UGJ A;  1HE8 A;  4JQW C;  2J42 A;  2Y5B B;  4PYZ A;  1UWM A;  1NEK B;  2JRH A;  1YQB A;  2O6V B;  5D3D A;  1EUV B;  2I2Y A;  4KIK A;  3Q3O C;  4DDI D;  4IOI E;  1QF6 A;  2MW5 A;  4HRS A;  2BTE A;  2LWP A;  2MRP A;  1S1Q B;  2YLM A;  2ZVO A;  2V9H A;  1E8X A;  2FID A;  3I63 C;  2KOX A;  2MWS B;  5LXI B;  1ISN A;  4JGH B;  3WCQ A;  2LJI A;  1UEL A;  5BO4 B;  2FCQ A;  2DYM A;  3VHT C;  1D5M C;  4IM2 A;  5BMH A;  2KDI A;  2NMQ A;  3W1Y A;  1UNS A;  3H9D A;  4B95 A;  4M01 A;  1TIF A;  2D3A A;  4NQK E;  3B2G A;  1J7B A;  4BKT A;  4GSW A;  3PZD A;  1VLB A;  3ECI A;  4YXD B;  2JY6 A;  4M00 A;  3Q2A C;  4URK A;  2V3P A;  3FAH A;  1E6E B;  4NNJ B;  4WWP A;  1U4A A;  3ZNG C;  2JT4 B;  2SEB D;  2LD9 A;  3DDC B;  1VZ7 A;  5E6J A;  5HI1 A;  4A3O A;  1LO5 D;  4KSK C;  2C7N B;  3H7P B;  2WXO A;  1XF5 L;  3W2D A;  3TEZ A;  2XBB C;  3NZ3 A;  2BKR B;  2JPH A;  2Z0D B;  4GXB A;  3AE2 B;  3U52 E;  2L76 A;  4ANU A;  2D10 A;  1STE A;  4G0N B;  4IWQ A;  2KWC A;  5HFY A;  3IAS 1;  3L4P A;  3VUW A;  5FR3 A;  4NY0 A;  2KLC A;  3QAQ A;  1E9M A;  2IO0 B;  3N1X C;  2OJW A;  3A9K B;  1P9D U;  1WH3 A;  4HEA 1;  1TGZ B;  3TL5 A;  3T9L A;  4IW0 A;  2L1A A;  1SB3 C;  4WAF A;  3L0W B;  3NHE B;  1JCK B;  1EWY C;  4RF0 A;  4DXG A;  4ZYN A;  3TEX A;  1GJZ A;  5FR6 A;  4HPP A;  1WF9 A;  5C23 A;  1TBE A;  3ZNI D;  3PRE A;  4DK5 A;  4YT0 B;  4DXA B;  1VJK A;  2M0X A;  1Q0W B;  1N62 A;  2L83 A;  3L08 A;  4JX1 C;  4KIK B;  2GI9 A;  4OZA A;  2K3U A;  2KJR A;  4EEW A;  3RN9 C;  3AXC A;  2MBO A;  3WAM A;  1SE9 A;  4ANX A;  1WJ6 A;  2IY1 B;  2BKF A;  3FC4 A;  2KN5 A;  2BYT A;  4AJY B;  4ZRJ A;  5LLI A;  1Z2M A;  2KFJ A;  2HE7 A;  2KC2 A;  3DBL B;  2D3B A;  1K8R B;  2QMT A;  3KYD D;  3B08 A;  5G2N A;  2R61 A;  1LGR A;  2PKO A;  1ESF A;  2M17 A;  4II3 B;  4ACF A;  3GOE A;  2FUH B;  1V86 A;  2LEK A;  2M4N A;  3P42 A;  4FBJ B;  2JYE A;  2WS3 B;  2CR5 A;  4G50 A;  3ZNZ B;  3MP9 A;  1WRD B;  4W9D A;  1IGC A;  3LJ3 A;  3AB5 A;  3DHH C;  4HCN B;  1NYR A;  1E8W A;  2KTF A;  2IGG A;  4ZDV A;  1HTO A;  1EU3 A;  2JXX A;  3ZTD A;  2KDE B;  3V6E B;  3FIL A;  4NJ7 A;  3KLS X;  2MJD A;  5GMV A;  4A20 A;  3FKY A;  1AYF A;  2RSU A;  4WH4 A;  3VDZ A;  2BQQ A;  2LVP A;  4BKG A;  1JWS D;  1BXT A;  2MBB B;  2JRI B;  1UBI A;  3QX1 A;  3I5J C;  1FEH A;  1V9J A;  2KX0 A;  4KSL C;  3ZRC A;  3ZLZ A;  4WAA A;  1UWX A;  1OTR B;  1XLP A;  3DVN U;  3TJP A;  3CMM B;  2KAC A;  3DPD A;  4W9C A;  1YIW A;  4TSS A;  5MPO A;  1BUI C;  2DLB A;  1SE2 A;  2KDM A;  1UZX B;  4E74 A;  4KGR A;  1HXY D;  4TMA B;  1Y8R C;  3AH7 A;  2N9K A;  1Z5S B;  2WXF A;  1TS3 A;  4IWO A;  2K8C A;  4NAW A;  3O65 B;  3N9Y C;  3TCA A;  2MJE A;  3KUD B;  1P7F A;  3RNF C;  2FBW B;  2L00 B;  1WXQ A;  5H92 C;  2VH2 A;  3CIR B;  3ZQ4 A;  1NDD A;  2C7M B;  3PVL A;  4WQO B;  4A3P A;  2XN9 C;  3P4P B;  2MX2 A;  2N7J A;  1WXA A;  2DBY A;  3AM9 A;  4M8M A;  4YSX B;  4RM9 A;  3AU4 A;  2INP E;  3NJT A;  3UQB A;  3BK1 A;  1C1Y B;  1NI2 A;  3WAN A;  4J6I A;  1L6U A;  3Q3N C;  4JE3 B;  5D2M B;  2WXP A;  2WU5 B;  3BII D;  1E10 A;  1GPX A;  3W1S A;  2K1F A;  4MM3 A;  1GB1 A;  4MJS A;  1CJE A;  2NS5 A;  3L16 A;  1KTK A;  1TT5 B;  2KDF B;  1N6Z A;  3AUL A;  3N3K B;  5IOI A;  5EE9 A;  4W9G A;  4N58 A;  4EZK A;  4YSZ B;  1C79 A;  3O13 A;  4LTU A;  1WGK A;  2IBI B;  3QA8 A;  2AX5 A;  3ZDM C;  4MSQ B;  3NG0 A;  2NVU I;  4KKI A;  4GIV A;  4ICV A;  3M62 B;  2K5P A;  2BYV E;  2EMT A;  2QCZ A;  1E5W A;  3B2F A;  3FIL B;  4GN1 A;  3ZXR A;  2FIF A;  2TSS A;  2MLB A;  1FO4 A;  2IND C;  2Y5P A;  2GBR A;  1ZXH A;  1WGH A;  2DEN B;  3VTV A;  4EE2 A;  3TUO A;  4B6W A;  2PVO D;  3BYY B;  4WQM A;  3PGE A;  4FHK A;  3AEA B;  1XLO A;  3PZ8 A;  5C2T B;  1XLQ A;  4CHK A;  3SFD B;  2PIA A;  4EZJ A;  3U8Z A;  4Q2J A;  1WZ3 A;  2JZ3 B;  1WY8 A;  4L1B A;  3ZJU A;  2WXN A;  3PRM B;  2D3G A;  4BOZ B;  1I4P A;  4R3D A;  2WXH A;  2WHI A;  2N0S B;  2HDE A;  3DBL I;  3TSS A;  5EE1 A;  2BYF A;  4P7I A;  4DHZ B;  4NAW B;  4HCP B;  2LHD A;  3AI5 A;  4GDL A;  2M1M A;  1GAQ B;  4K1R B;  3DBR B;  3HM6 X;  2LGY A;  5T8I A;  4DHJ B;  1L4Z B;  5BYR A;  2DZI A;  2J0M A;  2IZV B;  4US9 A;  4C00 A;  3VAW A;  2N7D A;  3TMP B;  3MFG A;  3MHS D;  3W9C B;  1YD8 U;  1L5P A;  2O6V D;  2BT6 A;  5AUI A;  2PPH A;  3ZNH B;  1EU4 A;  2AL6 A;  3RT3 B;  1EO6 A;  4UDU C;  1KOT A;  4I6N B;  3ZO5 B;  4M8N A;  2DZK A;  1T0Y A;  2LFI A;  1J0G A;  3QWZ B;  4IUM B;  2RMM A;  5G5G A;  3BY4 B;  2LRW A;  3DQV A;  1L4D B;  1ACC A;  1S3S G;  2ZNV B;  2AYO B;  4N59 A;  3NRZ A;  4XC2 A;  2NTS A;  1WI0 A;  4MM3 B;  3A33 B;  3PHW B;  4G11 A;  4MJS B;  5HKH A;  2BVC A;  3MC8 A;  4P1C C;  4F7Z A;  1DOI A;  1SJE D;  1T5X D;  2JSV X;  5IAA C;  1ENF A;  2LUE A;  1KF6 B;  2GRI A;  2LGD A;  2INN E;  3RPF C;  1V2Y A;  1JAL A;  1WR6 E;  2DZJ A;  2FAZ A;  1V5O A;  4REZ A;  2C7H A;  2K39 A;  3BWU D;  1L0V B;  3RI7 C;  1XEE A;  3NVY A;  2N9L A;  1PDX A;  3VR9 B;  2JZP A;  2UU7 A;  3ML8 A;  1F77 A;  2HD5 B;  3Q8C A;  2KQS A;  2J0J A;  3V6C B;  1SSN A;  3T3O A;  1IBX A;  4BVU C;  2RD0 A;  2BWF A;  1FFU A;  4EZL A;  1RRB A;  4WWO A;  3DWM A;  4HWI B;  2C9W B;  3QQ8 B;  5BMG A;  2QSD A;  3R7Q A;  4W9H A;  3ZJT A;  2G4D B;  4XZ4 A;  2CS4 A;  1ZDX A;  4FUL A;  2H88 B;  1K52 A;  1C4P A;  3KWV A;  5JHB A;  3NY5 A;  3QHT A;  2KO3 A;  5IA7 A;  2RPQ A;  2A5U A;  3H6N A;  3VH4 B;  4MAC A;  3JSV A;  3B0A A;  1OEY A;  5IN7 A;  4MGY E;  3HM3 A;  2K22 A;  4BBN F;  3R2T A;  4W9L A;  4XDC A;  1FRD A;  4XYC A;  2JQR B;  1EWC A;  1QOB A;  1C77 A;  2DAF A;  4F1S A;  2WXK A;  3DVG X;  3E9S A;  1XCQ L;  1ET9 A;  4B0E A;  1L2N A;  4RGT A;  2FE8 A;  4AP4 C;  3KYC D;  1T0Q C;  3QCA A;  2LUM A;  4GDL B;  4GGQ A;  2G9H D;  2J4X A;  1UBQ A;  4IG7 B;  2BWE S;  4XE0 A;  1R4M I;  2L7R A;  1JWM D;  2NBV B;  2NPT A;  3N20 C;  4LNO A;  2AEH A;  1D4B A;  3Q8E A;  2BB6 A;  3E56 A;  2INC C;  2LGI A;  1PGX A;  1VZ8 A;  4XWT A;  1R7S A;  2NBU A;  3R8B A;  1BML C;  1PGA A;  4TV3 A;  4AJW A;  3P63 A;  4RMA A;  1QOG A;  2G1E A;  2KJH B;  3IT4 B;  1IYF A;  1RWS A;  2WYQ A;  4MH8 A;  4W9J A;  2ZW1 A;  1GG3 A;  1D5Z C;  2GBM A;  1FRR A;  1QQR A;  3CWI A;  4EKU A;  3T8M A;  3GS2 A;  4DBG A;  2ZW0 A;  1T6B X;  1MI0 A;  3ONS A;  1FNU A;  2G3Q B;  3RNE C;  4IKG A;  2FCS A;  4ARC A;  2L3Z A;  2RDG A;  2KKC A;  3KWL A;  1EF5 A;  1IP9 A;  4CO7 A;  3RCZ A;  5AZH A;  4OVU A;  2RDB C;  3VH3 B;  3VUX A;  5EE0 A;  1KJT A;  3UIN B;  3SFE B;  2N9E B;  1VCB A;  1LXD A;  2XNA C;  2OHF A;  4K7W A;  4ZRK A;  1IBX B;  3AEE B;  3MJW A;  1V8C A;  2MBE A;  2KAJ A;  2MCN B;  2WDT B;  4W9I A;  5DPW A;  4NJC A;  4W9F A;  3DBR I;  5HHD G;  3QJZ A;  3L10 B;  4ARI A;  2HTH A;  3IFW B;  1V49 A;  4YTM B;  1P98 A;  4A90 A;  1XD3 B;  1DOY A;  2KVZ A;  4A6Q A;  1FCL A;  1F9J A;  1WJ4 A;  4WJP A;  5EE3 A;  2RPV A;  4YSY B;  1MJD A;  4F8C B;  3JSV B;  2JVC A;  4MGI E;  2KMC A;  3KUC B;  2ZJD A;  2ZCB A;  2H89 B;  2KMM A;  5H8Y E;  3PRP B;  2HTM E;  3MC9 A;  2JX5 A;  4XGA B;  5AUK A;  3RFZ B;  1YNT E;  1YJ1 A;  1ZGU B;  4KDL B;  4P16 A;  1B9R A;  1WMH A;  1FPY A;  4CYE A;  1OQR A;  5C1Z A;  3AEG B;  2SAK A;  3ABV B;  2BS3 B;  2D3C A;  4AQ7 A;  2NPT B;  3VR8 B;  1K50 A;  2VZK B;  1QLB B;  4E71 A;  2B76 B;  2K9X A;  3ZUN A;  3MC0 B;  2JUO A;  1TS4 A;  2REX A;  2KC1 A;  4C80 A;  1F52 A;  5DPS A;  2XEW A;  1M94 A;  1T0S C;  3JVZ X;  2LXA A;  1P7E A;  1ZP0 B;  1XT9 B;  4W9K A;  4RF1 A;  3T3N A;  3KVF B;  4O1N A;  1I4R A;  3HUI A;  2KX3 A;  4FXC A;  3ZTC A;  4OHJ A;  3M63 B;  5DPR A;  1FNW A;  2KLG A;  1MFW A;  3HHM A;  4PS3 A;  1WGR A;  1YJJ A;  4IDI A;  3R2I A;  2MJ3 A;  3HVZ A;  1E0Z A;  4YTP B;  2BGF A;  3U7D A;  2WXG A;  2D11 A;  3CST A;  2WXR A;  1OEY J;  3QK0 A;  2PJH A;  4AUQ C;  4W9E A;  1C9F A;  4XX5 A;  1KLG D;  1WR1 A;  2L8J A;  3ZRF A;  1QZE A;  3VTU A;  2KTR A;  3VRB B;  2LMC A;  3CF6 E;  4ZRP A;  1QOA A;  1C4C A;  4K7S A;  5C3J B;  3N1Y C;  1WE7 A;  2IGH A;  2MA9 B;  2WDQ B;  5G55 A;  1J19 A;  4TKN A;  3H7S A;  4ITK A;  1C76 A;  4KV2 A;  2DX5 B;  2R2O A;  2JYT A;  2WDR B;  1AAR A;  2G45 B;  1YOV B;  2GOW A;  4KZC A;  2BS2 B;  3NS1 A;  4J3O D;  3EFU A;  3ZGZ A;  3OWE B;  3HIZ A;  2OOB B;  4FJY A;  4B0M A;  2WDV B;  3RD2 A;  4BOS C;  4B9K A;  1N63 A;  2IO2 B;  3APF A;  4PYU A;  5AZG A;  1L0Y B;  3K9O B;  1FIQ A;  2AQ3 B;  1FXI A;  2IO1 B;  4WJO A;  4JIO U;  2QJL A;  4TUU A;  4S17 A;  1WX8 A;  1A70 A;  1WMH B;  2KD0 A;  1WRI A;  3Q3M C;  3WIM A;  2IYD B;  2NTT A;  3EUB 2;  3IXS A;  2I1K A;  2WX1 A;  2KZR A;  1E8Z A;  1CQV A;  3LXF A;  2WXJ A;  5EDS A;  2J53 A;  2DNF A;  2I38 A;  2PTL A;  1NI3 A;  2BW2 A;  4DHJ D;  1IGD A;  2BPS A;  2JZZ A;  1WM2 A;  3URY A;  2FCM A;  1SXT A;  1I42 A;  1V97 A;  3N32 A;  3TEY A;  1F2R I;  2E6X A;  5J2R A;  1TKE A;  1LM8 B;  4RFB A;  3BVG A;  2Q5W D;  3UIP B;  2W82 A;  1YMH E;  3NVZ A;  2EEL A;  1IPG A;  3ENE A;  1WXS A;  3APC A;  2ICI A;  3PTF C;  3P4R B;  4MSM B;  4K3B A;  1QIL A;  1ZUD 2;  4KGS A;  2M56 B;  1R4N B;  3HRD D;  1WIA A;  2CHW A;  1GC6 A;  2MP2 A;  1TYG B;  3ZDT A;  5JH5 C;  2PLP A;  4OZB A;  3KH0 A;  1HTQ A;  4GLS C;  4JL9 A;  2Z0E B;  3VQI A;  1X1M A;  5IO9 A;  1LQB A;  3UGB B;  3JW0 X;  2MBQ A;  3AE8 B;  3PPA A;  4ZRQ A;  2FCN A;  2ZPN A;  2IPK D;  5TR5 A;  3ZJV A;  3MHZ A;  1V1P A;  4LJO B;  2KTR B;  2KWU B;  2WU2 B;  2QDF A;  3BYT B;  4DQO C;  3N30 A;  2CU3 A;  4PK1 A;  3VRA B;  1HA5 A;  1YN3 A;  4NZL B;  2KAN A;  4BKS A;  3RNA C;  2CHX A;  4EUT A;  1ROE A;  2BS4 B;  3BZD B;  3KW5 B;  3RUL A;  3VVW B;  2W3R A;  4WWM A;  2J52 A;  3I9V 1;  1WGD A;  4XDD A;  2LGS A;  1H4R A;  4HDQ A;  4HVB A;  2KJ6 A;  4KDI C;  1J7A A;  1LFD A;  2HJ8 A;  4AWJ A;  3SD5 A;  1F0Z A;  5DPT A;  3R7R A;  1Q10 A;  2GBN A;  2CU1 A;  2N1V A;  3QIJ A;  1SE3 A;  3M3J A;  4I6L B;  5KHQ A;  4GMV A;  4FHJ A;  2K6Q A;  5D94 A;  4BKS D;  3DVN V;  3ETR A;  5TSS A;  2K8B A;  2K25 A;  4A55 A;  3EA6 A;  1SF0 A;  2KYW A;  3AE1 B;  1YX6 B;  4NQL B;  5FK9 C;  3AE9 B;  3Q14 C;  3WAO A;  3QAR A;  1N5X A;  1Y56 A;  1WGY A;  2KQ4 X;  2M19 A;  2Y5C A;  2QIL A;  4ZOH C;  2FNJ B;  3J9C A;  2L0T A;  4HDO A;  1XCT L;  4ZRI A;  2OED A;  2VH1 A;  4LCD E;  3RNG C;  2DAJ A;  3P4Q B;  3C8Y A;  2KWD A;  4GDK A;  2AL3 A;  3NVW A;  3ZXV A;  2PMV A;  4CQN A;  2WQY B;  4DWF A;  1VRA B;  2QC8 A;  2ZPY A;  1RM6 C;  1WWT A;  2L32 A;  4ZHP A;  3PSE B;  4MH0 E;  2ASQ A;  1VDV A;  2V0G A;  3OLM D;  2EMS A;  4LK0 M;  4LJP B;  1SIF A;  1FCC C;  2KVR A;  1NEN B;  4M0W A;  2PVG C;  3AEC B;  3AU5 A;  1M4V A;  1KM7 A;  2LAS A;  2MP2 B;  2KT7 A;  2ZEQ A;  2WX0 A;  1Q1O A;  3KUZ A;  5D7G A;  3HK0 A;  1SEB D;  3ZVV A;  2AWT A;  4A8X C;  5LNK 1;  3A1Q A;  2N1W A;  1I35 A;  1DGJ A;  2KHW B;  3IHP C;  2W9N A;  4HJG E;  2ON8 A;  1MHX A;  1P0R A;  5G5H A;  2K8H A;  4LNI A;  2ONQ A;  2KWV B;  1FD6 A;  3QC8 B;  1V1P B;  4LNN A;  4X57 B;  5JXV A;  3H1U A;  1E7V A;  4II2 B;  3V05 A;  2PEA A;  2CJN A;  1WXV A;  3ZW3 A;  1MHH E;  1SE4 A;  1AW7 A;  3PO0 A;  3U2S C;  2KDB A;  2M0A A;  3WAP A;  1B1Z A;  4LNF A;  1AWD A;  3Q8F A;  1OQY A;  1JQ4 A;  3IVF A;  4TQ1 A;  1ET6 A;  3OG5 A;  2N7E A;  1NYQ A;  3AED B;  4MT5 A;  3PLV A;  2DYO A;  3APD A;  2ACZ B;  1CK1 A;  5L83 A;  2EKI A;  2V3N A;  2WWZ A;  3PHX B;  2X8X X;  4NJ6 A;  1I4X A;  3AN1 A;  3L17 A;  2WNM A;  2WXM A;  2C60 A;  3EEC A;  4L23 A;  2WXI A;  4AS1 A;  4MGK E;  1JRU A;  1V81 A;  2IGD A;  1MVK A;  3M95 A;  3BIN A;  4OZC A;  2NR2 A;  3SU8 X;  3DVG Y;  1VZ6 A;  2Z8L A;  2UYZ B;  1RFA A;  1VD2 A;  2KFK A;  1TJE A;  3D32 A;  1R4N I;  3LYY A;  3PS6 A;  1F2R C;  4DDG D;  3RNC C;  4PS7 A;  1WX7 A;  4KGT A;  3IG3 A;  2MSE D;  4HK2 A;  2VZK D;  3A4S C;  2ZZP B;  2E3T A;  3DBH B;  2MH7 A;  1I4H A;  2IY0 B;  2JF5 A;  4GDK B;  1T3Q A;  2BBC A;  3MTN B;  1JRP A;  1DOX A;  4KZ0 A;  2VRR B;  3PLU A;  3V61 A;  1OGW A;  2V4L A;  4RNA A;  3UF8 A;  5FKA C;  4BZA A;  3Q8B A;  1ZXI A;  5E6P A;  1NVI D;  1XLN A;  3ALB A;  2OJR A;  5I4D A;  4IC7 B;  2CHZ A;  4M0W B;  2IO3 B;  3UIO B;  5AEK B;  2R2Q A;  4ASW C;  2WP9 B;  3AE7 B;  3W5V B;  1D5X C;  4LLG M;  4HKQ A;  1BT0 A;  2WLB A;  1RFK A;  1CMX B;  4DXF A;  3GZN B;  4P1B C;  1SJH D;  2YEP B;  3A1Q B;  5L95 C;  4MGZ E;  4C4V A;  4AOF A;  1GOZ A;  5CX3 A;  1TS2 A;  4D2K A;  4RGO S;  3KQ4 A;  1WFY A;  2K0P A;  4US8 A;  1TKG A;  1TS5 A;  1EM7 A;  1WZ0 A;  1IUE A;  1RLF A;  2KQ7 A;  3AEF B;  4MEL A;  1WYW B;  1UF0 A;  3H8H A;  5AZF A;  2DWQ A;  3U30 A;  4WWN A;  2ZVN A;  4C7Y A;  4PT5 A;  2O2V A;  2DZM A;  2NCN A;  4FJZ A;  4WUR A;  3PT2 B;  4FAD A;  1OQQ A;  1MG8 A;  4GU2 A;  4BFR A;  2V4I B;  4DHZ E; 
#chains in the Genus database with same CATH homology
 4JLC A;  1WMH B;  2KD0 A;  2M8S A;  2PPH A;  1UEL A;  3ZNH B;  4FA6 A;  2KMA A;  3WIM A;  4HLE A;  5BO4 B;  2IYD B;  2AL6 A;  2FCQ A;  2DYM A;  3Q3F A;  3VHT C;  3UQA A;  2I1K A;  2WX1 A;  2KZR A;  4IM2 A;  3RT3 B;  1EO6 A;  1KOT A;  1E8Z A;  4I6N B;  4K7U A;  3ZO5 B;  1E7U A;  4M8N A;  2DZK A;  1T0Y A;  3RYT A;  2KDI A;  5EDS A;  3QWZ B;  4IUM B;  1J0G A;  3W1Y A;  1KLV A;  3BY4 B;  2LRW A;  3DQV A;  1S3S G;  3H9D A;  3RZF A;  4B95 A;  2ZNV B;  2AYO B;  4DHJ D;  4XC2 A;  1WI0 A;  2BPS A;  3A33 B;  3PHW B;  2JZZ A;  4G11 A;  4MJS B;  4NQK E;  5HKH A;  1WM2 A;  4BKT A;  4GSW A;  1YX5 B;  4HJK A;  2FCM A;  3PZD A;  1I42 A;  3ECI A;  2JY6 A;  3N32 A;  4F7Z A;  5J2R A;  4URK A;  1TTN A;  2KFK B;  1LM8 B;  4WJQ A;  2LUE A;  4NNJ B;  5IAA C;  4WWP A;  1U4A A;  3ZNG C;  2LGD A;  2JT4 B;  3UIP B;  4EFO A;  2LD9 A;  3DDC B;  1V2Y A;  2K6D B;  1WR6 E;  1IPG A;  2DZJ A;  2FAZ A;  3ENE A;  1V5O A;  2C7H A;  2K39 A;  4A3O A;  1WXS A;  3APC A;  1H8C A;  4KSK C;  4K81 A;  1Q5W B;  4G3X B;  2C7N B;  3H7P B;  3PTF C;  4ANW A;  4WJN A;  1SGH A;  2XBB C;  4MSM B;  2BKR B;  2JPH A;  2PE9 A;  2V1Y A;  2Z0D B;  4GXB A;  2N9X A;  3DCG A;  5J18 A;  3ML8 A;  2L76 A;  1C3T A;  4ANU A;  5JZE B;  1L7Y A;  1WIA A;  1WJN A;  2CHW A;  2D10 A;  2UWQ A;  4G0N B;  4IWQ A;  2HD5 B;  2KWC A;  1GC6 A;  2MP2 A;  2KQS A;  3ZDT A;  2J0J A;  3V6C B;  5JH5 C;  4BVU C;  2RD0 A;  3KH0 A;  2BWF A;  3VUW A;  4NY0 A;  2KLC A;  3QAQ A;  4EZL A;  4JL9 A;  2Z0E B;  3VQI A;  1X1M A;  1RRB A;  2IO0 B;  3UGB B;  1LQB A;  4WWO A;  3JW0 X;  3V60 A;  2MBQ A;  3A9K B;  1P9D U;  1WH3 A;  3PPA A;  1E8Y A;  4HWI B;  2C9W B;  3QQ8 B;  1TGZ B;  2FCN A;  3R7Q A;  4W9H A;  2ZPN A;  3TL5 A;  3T9L A;  2G4D B;  4IW0 A;  4XZ4 A;  2CS4 A;  2LGX A;  4FUL A;  5TR5 A;  1UGM A;  4ANV A;  3L0W B;  3NHE B;  5D6J B;  3NOB A;  4LJO B;  3TBL D;  5JHB A;  2KTR B;  2KWU B;  2JWZ A;  3OJ4 B;  3NY5 A;  1EF1 A;  3QHT A;  4ZYN A;  2QHO A;  3N30 A;  5FR6 A;  1GJZ A;  2KO3 A;  5IA7 A;  2RPQ A;  2A5U A;  3H6N A;  1WF9 A;  4FN2 A;  3VH4 B;  5C23 A;  3JSV A;  3B0A A;  2A4Z A;  4IWP A;  1OEY A;  1TBE A;  2KAN A;  3PRE A;  3ZNI D;  2J7Q B;  4DK5 A;  4BKS A;  3L54 A;  4MGY E;  4N9F 4;  4DXA B;  3HM3 A;  2PE6 B;  2CHX A;  4EUT A;  2M0X A;  4BBN F;  1GNU A;  1Q0W B;  4W9L A;  2YVC A;  2EKE C;  1TZ1 A;  3ZKJ C;  3KW5 B;  3RUL A;  3VVW B;  4HPL B;  3L08 A;  4KIK B;  2DAF A;  4F1S A;  2C5L C;  1V6E A;  3DVG X;  2KJR A;  4EEW A;  1L2N A;  3AXC A;  2LXC A;  4AP4 C;  2MBO A;  3WAM A;  1D3Z A;  1WM3 A;  1SE9 A;  1WGD A;  3KYC D;  2GBK A;  2N4F A;  3QCA A;  4ANX A;  1WJ6 A;  3NS8 A;  1PQS A;  2IY1 B;  2BKF A;  3R66 C;  4GDL B;  4GGQ A;  1H4R A;  4HDQ A;  3S2A A;  2KN5 A;  2CKH B;  4HVB A;  1UBQ A;  2KJ6 A;  4KDI C;  4AJY B;  4IG7 B;  2BWE S;  1LFD A;  4ZRJ A;  1WGG A;  5LLI A;  1Z2M A;  1R4M I;  2HJ8 A;  2L7R A;  2NBV B;  2NPT A;  2KFJ A;  3SD5 A;  3EC8 A;  4AWJ A;  2HE7 A;  2KC2 A;  4IM0 A;  3IBE A;  1K8R B;  2O2V B;  3KYD D;  5DPT A;  3R7R A;  3B08 A;  5G2N A;  2L05 A;  2GBN A;  1UD7 A;  2CU1 A;  5CHV C;  2AEH A;  2N1V A;  2KXJ A;  4HXD A;  3QIJ A;  3RUI B;  3M3J A;  5KHO A;  4I6L B;  5KHQ A;  3OAW A;  4GMV A;  3JYU A;  2M17 A;  4II3 B;  4OVV A;  4FHJ A;  3GOE A;  2LZ6 A;  1V5T A;  2FUH B;  2K6Q A;  3NZS A;  1V86 A;  5D94 A;  4BKS D;  4KVG B;  3VFK A;  2M4N A;  3DVN V;  1WE6 A;  3DBH I;  4FBJ B;  3X23 A;  2NBU A;  4FJV B;  2K8B A;  2K25 A;  2CR5 A;  4G50 A;  3OJ3 A;  3ZNZ B;  2I1J A;  2J0K A;  1WRD B;  4W9D A;  3LJ3 A;  1YX6 B;  4NQL B;  4TV3 A;  3WAO A;  4AJW A;  3DBS A;  3QAR A;  4HCN B;  4MDK E;  4RMA A;  4NPN A;  1G6J A;  1E8W A;  2KTF A;  2KJH B;  1IYF A;  2Z59 B;  1WGY A;  4ZDV A;  2WYQ A;  2MQJ A;  2JXX A;  4W9J A;  2FNJ B;  1GG3 A;  3A9J A;  3ZTD A;  2KDE B;  2L0T A;  3A4R A;  3PRZ A;  4HDO A;  2GBM A;  4ZRI A;  3V6E B;  4NJ7 A;  4LCD E;  4EKU A;  3T8M A;  5GMV A;  4A20 A;  2DAJ A;  2RSU A;  1WX9 A;  2NBW B;  2AL3 A;  4GDK A;  3VDZ A;  4DBG A;  3ONS A;  3DOW A;  2LVP A;  4BKG A;  2G3Q B;  1GC7 A;  4DWF A;  2FCS A;  4RM8 A;  1GUA B;  3I3T B;  2ZPY A;  4LDT D;  2L3Z A;  2KKC A;  2MBB B;  2XK5 A;  3PSE B;  1EF5 A;  2JRI B;  3GZN I;  4MH0 E;  2ASQ A;  2D2Q A;  2DYB A;  1UBI A;  3QX1 A;  1IP9 A;  4CO7 A;  3RCZ A;  5AZH A;  4OVU A;  3OLM D;  2EMS A;  4LJP B;  3VH3 B;  1SIF A;  2KVR A;  3ML9 A;  3VUX A;  1KJT A;  1V80 A;  1V9J A;  3AU5 A;  3UIN B;  2KX0 A;  4KSL C;  1KM7 A;  2LAS A;  2MP2 B;  2N9E B;  3ZLZ A;  3ZRC A;  1VCB A;  1LXD A;  4WAA A;  4K7W A;  4ZRK A;  1OTR B;  2ZEQ A;  2WX0 A;  3MJW A;  1A5R A;  1Q1O A;  3KUZ A;  5D7G A;  3V62 A;  2KNB A;  3DVN U;  3HK0 A;  2MBE A;  4GOC A;  4HPM B;  2MCN B;  3TJP A;  2RGF A;  2WDT B;  3CMM B;  3DPD A;  4GB9 A;  4W9I A;  1YIW A;  4W9C A;  5DPW A;  4TQ0 A;  3ZVV A;  2AWT A;  4W9F A;  3A1Q A;  3DBR I;  2N1W A;  3SDL C;  3QJZ A;  3L10 B;  2KHW B;  5CHF A;  1I35 A;  2LVO A;  3IHP C;  2W9N A;  2HTH A;  3IFW B;  1UZX B;  1V49 A;  4E74 A;  1P98 A;  1XD3 B;  1P0R A;  3RZW C;  2O6V A;  1Y8R C;  2K8H A;  2KWV B;  1F9J A;  1WJ4 A;  1Z5S B;  3QC8 B;  4WJP A;  4X57 B;  2B3A A;  4IWO A;  2K8C A;  4NAW A;  3O65 B;  3H1U A;  3TCA A;  1E7V A;  4II2 B;  4F8C B;  1J8C A;  1RAX A;  2PEA A;  3JSV B;  3KUD B;  2JVC A;  4MGI E;  3PV1 A;  2L00 B;  3VTW A;  1WXM A;  2KMC A;  1WXV A;  3KUC B;  1NDD A;  2C7M B;  3PVL A;  3ZW3 A;  2ZJD A;  3R3M A;  2ZNV C;  2ZCB A;  2KDB A;  4WQO B;  4A3P A;  3PRP B;  2LI5 A;  2MX2 A;  3W1S C;  3WAP A;  1OQY A;  3IVF A;  4TQ1 A;  1WXA A;  3CSF A;  3VXW A;  4FLH A;  2N7E A;  1YJ1 A;  1ZGU B;  4KDL B;  2RR9 A;  4M8M A;  1P1A A;  1WMH A;  4RM9 A;  3AU4 A;  3PLV A;  4CYE A;  2DYO A;  2LRU A;  3APD A;  5C1Z A;  5L83 A;  2WWZ A;  3UQB A;  1C1Y B;  3PHX B;  4EOY A;  3L13 A;  1NI2 A;  4NJ6 A;  4J6I A;  3WAN A;  5CHW A;  3C0R B;  3L17 A;  5D2M B;  2L0F A;  2NPT B;  5E6O A;  4BBN C;  2C60 A;  3EEC A;  4MGK E;  1JRU A;  5E6N A;  2BYE A;  3W1S A;  1V81 A;  2K1F A;  4MM3 A;  5DCN A;  4MJS A;  1NBF C;  2LJ5 A;  4E71 A;  2NS5 A;  4LDT B;  1ZKH A;  3L16 A;  3M95 A;  4YL8 A;  3BIN A;  2MBH A;  2NR2 A;  2KDF B;  3DVG Y;  3SU8 X;  3ZUN A;  2JUO A;  3AUL A;  2REX A;  2UYZ B;  3N3K B;  2KC1 A;  1RFA A;  3Q3J A;  4W9G A;  1VD2 A;  5DPS A;  2KFK A;  4EZK A;  2LVQ A;  2XEW A;  2ZCC A;  1M94 A;  2G4S A;  3D32 A;  1R4N I;  3JVZ X;  2LXA A;  3EHV A;  3PS6 A;  4DDG D;  2IBI B;  3QA8 A;  1XT9 B;  4PS7 A;  4W9K A;  1WX7 A;  3ZDM C;  3KVF B;  3IG3 A;  4MSQ B;  1XQQ A;  2KX3 A;  2NVU I;  2MSE D;  1ZW7 A;  3ZTC A;  2BF8 B;  2V3S A;  4HK2 A;  4GIV A;  4ICV A;  3M62 B;  2N9P C;  2D07 B;  3H7P A;  3M63 B;  5DPR A;  2KLG A;  4MEM A;  5LXH A;  3NZU A;  2BYV E;  2EMT A;  3HHM A;  4PS8 A;  3A9J B;  5J17 A;  4PS3 A;  3A4S C;  2ZZP B;  3WA0 A;  1E5W A;  4GN1 A;  2FIF A;  1WGR A;  2IY0 B;  2JF5 A;  3P2B A;  2MLB A;  2DHZ A;  5CTR C;  4GDK B;  3TIX A;  3LDZ E;  3MTN B;  2KK8 A;  4KZ0 A;  2BGF A;  2GBR A;  3B1L X;  1WGH A;  2VRR B;  3PLU A;  3U7D A;  1OGW A;  2V4L A;  3V61 A;  2D11 A;  3VUY A;  2GBJ A;  3UF8 A;  4ICU A;  3A9K A;  2DEN B;  3VTV A;  5E6P A;  3CST A;  2GMI C;  1OEY J;  2XK5 B;  4I6P A;  4B6W A;  3K9P B;  3ALB A;  3PGE A;  3QK0 A;  2OJR A;  2PJH A;  4AUQ C;  4FHK A;  1P3Q U;  4W9E A;  4IC7 B;  4XX5 A;  3X0W A;  2CHZ A;  4M0W B;  1FXT B;  2IO3 B;  1WR1 A;  3UIO B;  2L8J A;  3WAL A;  2R2Q A;  4ASW C;  5AEK B;  3ZRF A;  1E90 A;  1QZE A;  3VTU A;  2KTR A;  4CHK A;  1UH6 A;  1BT0 A;  3CF6 E;  4EZJ A;  4IM3 A;  3ZIM A;  5JHA A;  3U8Z A;  3SHQ A;  1WZ3 A;  1CMX B;  4K7S A;  2JZ3 B;  1WE7 A;  2MA9 B;  1WY8 A;  5G55 A;  1J19 A;  3PRM B;  2D3G A;  4TKN A;  3A1Q B;  3H7S A;  5L95 C;  4BOZ B;  4MGZ E;  1WJU A;  4KV2 A;  4AOF A;  5CX3 A;  4E3C A;  1HE8 A;  4JQW C;  2DX5 B;  4PYZ A;  2Y5B B;  2R2O A;  2JRH A;  1AAR A;  1YQB A;  2O6V B;  2G45 B;  1EUV B;  1WFY A;  3DBL I;  4KIK A;  2GOW A;  4KZC A;  2BYF A;  4P7I A;  3EFU A;  1WZ0 A;  3HIZ A;  4NAW B;  4DHZ B;  2OOB B;  4HCP B;  4FJY A;  3AI5 A;  3RD2 A;  4DDI D;  4GDL A;  4BOS C;  4B9K A;  2IO2 B;  2M1M A;  1RLF A;  3APF A;  2KQ7 A;  2MW5 A;  4K1R B;  4PYU A;  5AZG A;  3K9O B;  3HM6 X;  2LGY A;  4MEL A;  4DHJ B;  1WYW B;  2LWP A;  2DZI A;  2MRP A;  2J0M A;  5AZF A;  3U30 A;  2IZV B;  1S1Q B;  2YLM A;  4WWN A;  2IO1 B;  2ZVO A;  2ZVN A;  2O2V A;  2DZM A;  2NCN A;  2N7D A;  4JIO U;  4WJO A;  3VAW A;  4FJZ A;  3PT2 B;  1E8X A;  4TUU A;  2FID A;  3TMP B;  4FAD A;  3MHS D;  1MG8 A;  1YD8 U;  2KOX A;  1WX8 A;  2MWS B;  4GU2 A;  4BFR A;  5LXI B;  1ISN A;  4DHZ E;  2O6V D;  4JGH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...