2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
5JZEB 2CU1A 1WE7A 4I6PA 3Q3FA 4IUMB 3A4RA 1IYFA 2RGFA 3DVGX 1XQQA 2KJHB 4HJKA 4B6WA 3ZLZA 2NCNA 1V86A 4FA6A 3KYDD 4HCPB 3V6EB 4DDGD 2ZEQA 5C23A 2L05A 4W9HA 2KKCA 2KMCA 4HLEA 1E5WA 2G4SA 3PRZA 2GBRA 4PS8A 3EC8A 2CR5A 4A20A 1EF1A 2LUEA 2MBHA 2G4DB 4F1SA 2ZZPB 4KVGB 2KVRA 1WGRA 4WAAA 2J0MA 4MGZE 2IY1B 3I3TB 4TV3A 5DPTA 2GMIC 2G3QB 2KC1A 2ZJDA 3QWZB 2LJ5A 1UGMA 2I1KA 4BOSC 1OTRB 1WGYA 4JGHB 2ZVOA 3VDZA 1GNUA 4G50A 2WDTB 3ZVVA 4EZLA 3EECA 2XEWA 4I6LB 4KDIC 3VVWB 4W9DA 2JF5A 3QK0A 2KX3A 4HDOA 4DDID 3APDA 5E6NA 1OGWA 1E8ZA 4ZRJA 2C5LC 2M8SA 3DPDA 3PREA 4DWFA 3ALBA 4DHZB 2M0XA 2KANA 4F8CB 4RM9A 3KUZA 3L13A 2LVQA 3QARA 3RUIB 1WF9A 2RSUA 3RD2A 4MGYE 4KSKC 4AOFA 3PV1A 2O6VA 1R4NI 4JL9A 3V60A 4HK2A 2GBMA 1E8XA 2OOBB 2MX2A 3HM3A 2A5UA 1WGDA 2QHOA 3WAOA 2XBBC 3ZUNA 2KXJA 4CHKA 1G6JA 3AULA 3ML9A 5JHBA 5J18A 2KD0A 3M95A 4BKTA 1KJTA 3QCAA 4CO7A 4XC2A 5BO4B 3V62A 3U30A 2AL6A 5CTRC 2JZ3B 2KTRA 4HPMB 3KH0A 4IG7B 4LDTD 4EFOA 5DPWA 3EHVA 3PPAA 2D3GA 4MEMA 5IA7A 1I42A 3KUCB 3Q3JA 2DZIA 4BBNC 4MGKE 2UWQA 2N9PC 3B1LX 2YLMA 2MP2A 1WR1A 2KLGA 1J0GA 4DBGA 3B08A 1WJ4A 2BYEA 4BVUC 5C1ZA 2K39A 4KZCA 2KFKA 3N3KB 2D2QA 2JY6A 1ZW7A 2HE7A 2KJ6A 3LJ3A 3PVLA 5E6PA 3RCZA 4KZ0A 1XD3B 3H1UA 4EKUA 1WH3A 4XX5A 2DZJA 4GSWA 1OEYA 1X1MA 2NBWB 3GOEA 2MRPA 5DCNA 4FN2A 1YQBA 4AP4C 1EUVB 2GOWA 2KDEB 3UIPB 4BOZB 2MBOA 3TCAA 4AJYB 4BKGA 4DHJD 4AJWA 3IFWB 3N32A 3TL5A 3MHSD 3B0AA 2BPSA 2LVOA 3IG3A 2R2OA 3CSFA 2KWUB 5CHFA 2PJHA 4IWOA 3W1SA 3RT3B 3M63B 4FJVB 3KW5B 1GC7A 2JT4B 3X23A 3ML8A 1OQYA 3HIZA 3L16A 4IM0A 3UQAA 2IO2B 1RLFA 3H7PA 4KDLB 3OAWA 3TBLD 3ZKJC 2M17A 1TBEA 1WX7A 2DHZA 3PGEA 5LXHA 4HXDA 5KHQA 4W9LA 1SGHA 2O2VA 2ZNVC 3A33B 4HVBA 3A9KA 2O6VB 1YX5B 5E6OA 2FAZA 3R3MA 4MELA 3GZNI 3VH3B 2BYFA 4IM3A 1LFDA 4ICUA 2PPHA 2IBIB 4NQLB 4OVVA 4G0NB 4PS7A 3U7DA 1ZGUB 4TUUA 2BGFA 2I1JA 3OLMD 2KTFA 4W9KA 1WR6E 4N9F4 2ZNVB 1S1QB 1WMHA 1WXAA 2MBEA 2MBQA 5AZFA 3APFA 3ZRFA 4W9CA 2KTRB 4BKSA 4K7WA 1PQSA 2KOXA 3APCA 3IBEA 4KIKA 1V81A 2JRHA 2D07B 4W9FA 2M1MA 2IO3B 5J17A 1TGZB 3QIJA 1UZXB 4WWOA 1RAXA 1WGGA 2MP2B 3ZO5B 1EF5A 3VUWA 1WXVA 5DPRA 3WALA 3NZUA 3W1YA 1YX6B 2NR2A 4W9JA 2K8HA 2KFKB 2IYDB 2KC2A 3BY4B 4AUQC 3ZDMC 1U4AA 4RMAA 4E3CA 1UBIA 3WIMA 1GJZA 5D6JB 2HJ8A 2KNBA 3S2AA 4LCDE 3H7SA 4ZRIA 2MBBB 3VTWA 4EEWA 2J7QB 4EZJA 3NHEB 3D32A 1SE9A 4FHKA 2FCNA 4FJZA 4M8MA 1UBQA 1RRBA 3L10B 4GDLA 2RPQA 1V6EA 5JHAA 2Z59B 2L3ZA 2AL3A 2KX0A 1ISNA 3NY5A 3P2BA 3L08A 3DOWA 3PZDA 3ENEA 3SD5A 1TTNA 1WZ0A 2PE6B 1P98A 1Q0WB 4E71A 3V61A 2FNJB 3VXWA 1Y8RC 1S3SG 2GBJA 4PYUA 3R7RA 2KZRA 4ANXA 4NQKE 3H7PB 1BT0A 2LZ6A 1WY8A 4TQ0A 4WWNA 4K1RB 3RZWC 3JYUA 3X0WA 2O2VB 4GMVA 3A9KB 2W9NA 2KJRA 2DX5B 1IPGA 1E7VA 2REXA 1K8RB 2HD5B 3ONSA 4DHZE 5GMVA 3ZNID 4X57B 1SIFA 1V49A 4EOYA 2ASQA 4GOCA 3OJ4B 2NBVB 2CS4A 4IW0A 3TIXA 3A1QA 4MH0E 1WMHB 3ZNHB 3DQVA 4ZDVA 3EFUA 4XZ4A 4II2B 4YL8A 2KWCA 1E8YA 2L7RA 4KIKB 4B9KA 2WWZA 1R4MI 2V1YA 3ZTCA 4WWPA 1Q1OA 1RFAA 3OJ3A 2Z0EB 4ZYNA 3NS8A 3LDZE 4HDQA 3ZNZB 1GG3A 2LRWA 3ZRCA 1GUAB 2J0KA 3L0WB 2KK8A 3VTUA 1P0RA 2K8BA 1MG8A 4M0WB 3RZFA 3T9LA 1J8CA 3ZTDA 1A5RA 2M4NA 2BWES 3UINB 4E74A 2Y5BB 1P3QU 3M62B 3PLUA 1WFYA 1WI0A 4RM8A 1H4RA 2BF8B 2KQ7A 2C7NB 3KUDB 5DPSA 1F9JA 3QHTA 1EO6A 1T0YA 3ECIA 2FUHB 3H9DA 5HKHA 1WIAA 2MSED 4GDLB 4KV2A 1LQBA 4IWPA 5KHOA 1M94A 2LXAA 1V9JA 3HM6X 4ICVA 3JW0X 3ZDTA 2O6VD 3K9OB 3NOBA 3WAPA 3L54A 1WX8A 2KO3A 1WE6A 4GB9A 3KYCD 4OVUA 2FCMA 4GDKA 2EMSA 1I35A 1AARA 3JSVA 2ZPNA 1WXMA 4AWJA 3IVFA 4II3B 3WAMA 2LASA 2K8CA 2IO0B 4GU2A 4DK5A 4ZRKA 2HTHA 4DXAB 3CSTA 3DVNU 1NBFC 1Z5SB 2DZMA 3PRPB 3VTVA 3PSEB 4GGQA 3UIOB 2NBUA 1CMXB 3UF8A 3CMMB 4WJQA 1XT9B 4WJOA 2G45B 4NJ6A 1WJNA 3QQ8B 2L00B 5AZHA 2MA9B 2MW5A 4EZKA 4GIVA 2CHXA 1C3TA 2N7EA 2DAFA 2LXCA 1UH6A 2KQSA 1C1YB 2DYBA 4J6IA 3MJWA 3A1QB 4ASWC 3HHMA 2R2QA 3BINA 2N4FA 3PS6A 4K7SA 2L76A 4W9GA 2XK5A 3TMPB 5AEKB 2K1FA 4PYZA 5J2RA 4GN1A 2K25A 2C60A 1WGHA 3QAQA 2DYOA 2BYVE 2KDIA 2UYZB 1WX9A 2LGDA 3PT2B 1GC6A 4FADA 4LJPB 2LWPA 3VQIA 2JVCA 5LLIA 2ZCBA 4NAWA 4JIOU 3SU8X 2BKFA 1KM7A 3PTFC 4KSLC 3AU4A 3W1SC 3HK0A 2LVPA 4IC7B 1OEYJ 3SHQA 3DBHI 5CHVC 3WANA 1E7UA 5D7GA 5L95C 1VD2A 2JRIB 2NPTA 4JQWC 5LXIB 2VRRB 3QC8B 3K9PB 1WM2A 3DBSA 3QX1A 4K81A 2FIFA 5AZGA 4ANUA 1P1AA 4A3PA 3M3JA 4BBNF 2FCQA 3DDCB 4A3OA 2MQJA 4GXBA 2K6DB 1YIWA 2KN5A 2L0FA 3VAWA 4EUTA 4GDKB 2N1VA 2V4LA 2GBNA 1HE8A 1V80A 2C7MB 3JSVB 1WYWB 1LXDA 2L8JA 3KVFB 1NI2A 4NNJB 3U8ZA 3PRMB 4FBJB 3DVNV 3ZIMA 1D3ZA 4MJSA 3SDLC 1KLVA 3A9JA 4HPLB 2J0JA 2KDBA 1WRDB 2PE9A 4MSQB 4P7IA 3PLVA 4BKSD 1WXSA 2LRUA 3A4SC 1WZ3A 1Z2MA 2DAJA 4MSMB 3AXCA 1UELA 2WX0A 3VHTC 2N7DA 2DENB 2BKRB 4WJPA 2MLBA 2FCSA 4IM2A 3O65B 3MTNB 5D94A 4IWQA 2D10A 3VUYA 2Z0DB 2GBKA 1QZEA 3ZNGC 4CYEA 4ANWA 4TQ1A 4FHJA 5L83A 4TKNA 2FIDA 2LI5A 4HWIB 1FXTB 2ZCCA 1Q5WB 1E90A 2XK5B 4W9EA 4FJYA 3UGBB 2KDFB 3QJZA 2JUOA 4MDKE 1V5TA 3N30A 2AWTA 5FR6A 4K7UA 1IP9A 5JH5C 4I6NB 2DZKA 2K6QA 3QA8A 2IO1B 1V5OA 3JVZX 4NPNA 2JXXA 2YVCA 3PHWB 4NAWB 5G55A 1WJ6A 1KOTA 2ZPYA 2KMAA 1JRUA 3PHXB 4LDTB 4F7ZA 3RULA 2EMTA 1UD7A 5EDSA 1ZKHA 3R7QA 3V6CB 3WA0A 2A4ZA 2NVUI 1NDDA 3UQBA 2KWVB 1V2YA 4NY0A 1L7YA 2C9WB 4FULA 1WJUA 3AU5A 4ANVA 3ZW3A 3NZSA 4PS3A 2WX1A 2NPTB 3VFKA 5TR5A 2IY0B 2IZVB 3AI5A 3CF6E 2KFJA 4NJ7A 1E8WA 2CHWA 2MCNB 2JZZA 2B3AA 2ZVNA 4MM3A 4JLCA 5G2NA 2V3SA 1VCBA 2C7HA 4WJNA 3TJPA 2PEAA 4HCNB 4URKA 1P9DU 2AEHA 1H8CA 5D2MB 3IHPC 4LJOB 2RR9A 2N9EB 1TZ1A 2N1WA 2OJRA 2D11A 2L0TA 5CX3A 3T8MA 4DHJB 3DCGA 3R66C 3DBLI 4MJSB 5CHWA 4FLHA 3A9JB 3RYTA 2AYOB 1YJ1A 1WM3A 2LGXA 4M8NA 4MGIE 2BWFA 2CHZA 3DBRI 3L17A 4W9IA 2JPHA 2N9XA 4G11A 4WQOB 4BFRA 2LD9A 5IAAC 3VH4B 2CKHB 2LGYA 2RD0A 2KLCA 4G3XB 3H6NA 3C0RB 3VUXA 1J19A 2WYQA 4B95A 1LM8B 3DVGY 1L2NA 1YD8U 2MWSB 2KHWB 2DYMA 2NS5A 2JWZA 2EKEC
chains in the Genus database with same CATH superfamily
5JZEB 1C77A 3C8YA 1WE7A 2VZKB 1J7CA 2IDYA 2GRIA 4OZBA 1TY0A 3RI7C 5C23A 2L05A 1QQRA 2KKCA 1ZXIA 4HLEA 1ACCA 1FO4A 3AH7A 2GBRA 4WIPA 4A20A 2MBHA 4F1SA 1WGRA 3AEBB 4MGZE 2IY1B 4LNKA 5DPTA 4P6VF 2WXLA 2G3QB 3AE9B 2OHFA 2LJ5A 2QEJC 3OG5A 1UGMA 1WGYA 4G50A 4I6LB 4W9DA 4DDID 4MM3B 1OGWA 4ZRJA 3CIRB 4DWFA 3ALBA 1MG4A 4Q2JA 2KANA 1K50A 5AUIA 1WF9A 2RSUA 1QLBB 3RD2A 1C4PA 3GB1A 1CK1A 2OOBB 4CHKA 2MH7A 2WXPA 3PZ8A 3HVZA 3QCAA 5BO4B 2EELA 1KRHA 4IG7B 4LDTD 2H88B 3EHVA 5G5HA 3B08A 2K39A 2QJLA 1P7EA 1F52A 2JY6A 2JYTA 3RNAC 3IT4B 3EUB2 2MJEA 1D5XC 5DCNA 4AP4C 2KDEB 3UIPB 4BOZB 1QOGA 4BKGA 1RM6C 3MHSD 3B0AA 2BPSA 3IG3A 2R2OA 3CSFA 3DHGC 3R2TA 2PJHA 2V4IB 4WAFA 3R8BA 1IGDA 3KW5B 1GC7A 3VR8B 1VJKA 5IO9A 3UQAA 3Q8CA 2JYEA 3I9V1 2BVCA 4KDLB 2WU5B 2IJ0A 3ZKJC 5KHQA 4DQOC 2O2VA 1NYRA 1VZ6A 3A9KA 1WXQA 1NEKB 3VH3B 3GZNI 2BQQA 2XN9C 2PPHA 4NQLB 4OVVA 2WHIA 3FILA 4PS7A 1J7AA 3U7DA 1ZGUB 2KTFA 1JWMD 1WR6E 4N9F4 2MBEA 3BVMA 1L4ZB 3NG0A 1QKZA 2J53A 1FM0D 1V81A 2JRHA 2D07B 2M1MA 4WWOA 2MP2B 3ZO5B 3VUWA 3WALA 2PTLA 3NZUA 4A8XC 4W9JA 1IBXB 2K8HA 3Q8BA 3U7ZA 4RMAA 4US9A 1UBIA 1GJZA 3H7SA 4ZRIA 3AE2B 2JXTA 4M8MA 4RF0A 1MVKA 1V6EA 5HHDG 1YN3A 4MH8A 1F0ZA 2JX5A 5BMGA 1WZ0A 1P98A 1Q0WB 1TKEA 2FNJB 1S3SG 3R7RA 4ANXA 2IGDA 2PIAA 3H7PB 4YSYB 1BT0A 1WY8A 2KJRA 1E7VA 2TSSA 1SIFA 2LHEA 2DNFA 4GOCA 2SEBD 3OJ4B 2K3UA 3NRZA 4IW0A 4MH0E 1WMHB 3DQVA 4YL8A 1TS2A 2KQ4X 2V1YA 3VR9B 3TUOA 1C76A 3AEAB 3L0WB 3J9CA 1JCKB 1XF5L 3TEWA 1A5RA 3UINB 1B9RA 3PLUA 1WI0A 3NVZA 4RM8A 1H4RA 3KUDB 1F9JA 1T0YA 4AQ7A 5HKHA 1WIAA 2MSED 1XEEA 5BYRA 1UUPA 3ZDTA 2D3BA 1VZ7A 1I35A 4BZAA 3IVFA 4II3B 3P4PB 4DXAB 1KFYB 2J4XA 1XO3A 5BMHA 2DZMA 3PSEB 3UIOB 4HJGE 3CMMB 3DBHB 1XT9B 4WJOA 1FRRA 1K52A 3MC0B 5IN7A 4GIVA 2CHXA 2HJ1A 1C1YB 4ASWC 3A1QB 2WXHA 1JRPA 2R2QA 4K7SA 2L76A 5J2RA 4GN1A 2K25A 2IGHA 2AQ2B 2DYOA 2BYVE 1WX9A 2LGDA 3PT2B 1GC6A 2LWPA 3SU8X 4KSLC 1QT9A 3ZXRA 2VRRB 3QC8B 3K9PB 1WM2A 3DBSA 4XYCA 4ANUA 1Q10A 4GXBA 3VAWA 4GDKB 4YTNB 4HKZE 1RFKA 2X8XX 4ZRPA 1ZP0B 3U8ZA 2KAJA 2KDBA 5EE1A 1WRDB 1ET9A 4P7IA 4BKSD 3KWLA 1Z2MA 4MSMB 3AXCA 3I5JC 1XLPA 3VHTC 2DENB 3AEGB 2MLBA 2D5GA 4IM2A 3O65B 2OEDA 2V9HA 3VUYA 4HPPA 3RFZB 5GXGB 2BT6A 2MJDA 2V0GA 5L83A 5HFYA 2FIDA 2W82A 2LI5A 4HWIB 3FC4A 1Q5WB 4FJYA 2KDFB 4MDKE 1V5TA 1IP9A 5JH5C 4LLGM 1V5OA 1KH0A 2YEPB 2JXXA 4NAWB 5G55A 2ZPYA 1HEZE 2KMAA 4EE2A 4YXDB 3MC8A 4CQNA 4C7ZA 3Q8EA 3UQBA 4P1BC 1WJUA 3ZW3A 3NZSA 3VFKA 1V8CA 3SFDB 2IZVB 2WXFA 3AI5A 4QAYA 3NVVA 5G2NA 3B2GA 1VCBA 2W54A 3TJPA 3ZJTA 1FNWA 4LJOB 2RR9A 2L0TA 1ESFA 3N1XC 3R66C 4DHJB 3DBLI 4MJSB 3BVGA 4FLHA 3RYTA 1WM3A 2LGXA 4WQOB 1AN8A 3DWGC 2LGYA 4MT5A 4A55A 1FIQA 2K22A 3ABVB 3DVGY 2BYTA 1L2NA 1YD8U 2NS5A 2JWZA 2EKEC 2CU1A 4I6PA 4NAMA 5BYSA 3A4RA 1IYFA 3DVGX 4HJKA 3ZLZA 1YN5A 4HCPB 2KMCA 2G4SA 3PRZA 3EC8A 1EWYC 1EF1A 1R4NB 2LUEA 1QF6A 3Q3OC 2I2YA 1P7FA 3HUIA 4KVGB 2KVRA 4N6EB 4HKQA 3I3TB 2MJ3A 2ZJDA 2I1KA 4BOSC 1OTRB 3VDZA 1V1PA 1GNUA 3EECA 3P4SB 4KDIC 1ZE3D 2JF5A 1YNTE 2KX3A 4HDOA 5E6NA 3MFGA 1E8ZA 2KACA 3PREA 4N59A 2INNE 2M0XA 2LHDA 5C2TB 3RUIB 2GLSA 4YSXB 4XE0A 4AOFA 3PV1A 2O6VA 4JL9A 1E8XA 3HM3A 2MX2A 2A5UA 2XBBC 2KXJA 4DXGA 1G6JA 3AULA 2AQ3B 3ML9A 4OVZA 1PUTA 4BKTA 2QMTA 3U30A 5CTRC 2JZ3B 1AYFA 2KTRA 4HPMB 4BAXA 2D3GA 1ET6A 4L1BA 2UWQA 2N9PC 3C19A 1JWUD 1J0GA 2UU7A 1WJ4A 5C1ZA 2KFKA 4YWGG 1ZW7A 3RCZA 1SE4A 4KZ0A 1XD3B 5E6JA 4C4VA 2MHJA 4GSWA 1OEYA 1X1MA 2NBWB 1EUVB 3TCAA 1QOAA 2L83A 3P42A 3AE6B 1N5WA 2KWUB 4PK1A 3M63B 1F2RI 1GB1A 5D3DA 3VRBB 2PLPA 2IO2B 1NENB 1I4HA 2M17A 3Q2AC 2DHZA 4HXDA 1SGHA 2ZNVC 3A33B 4HVBA 2VZKD 4MELA 2BYFA 2IBIB 4G0NB 1WGKA 1BUIC 4TUUA 2BGFA 4W9KA 3EFCA 1S1QB 2MBQA 1WXAA 4B0MA 1TYGB 1ENFA 4W9CA 1F1HA 3APCA 1FCCC 2WXMA 1UZXB 1RAXA 1OFFA 1L6VA 1YX6B 2GB1A 1I7HA 4M0WA 1D6EC 2B76B 4E3CA 2KNBA 2W3RA 3S2AA 1JWBD 4EEWA 4EZJA 3NHEB 1FXAA 4FJZA 4GDLA 2RPQA 5JHAA 1SBBB 2Z59B 2YEPF 1B1ZA 2LGSA 2KX0A 3NY5A 3DOWA 3AMZA 3V61A 3B2FA 1E10A 3VXWA 3IAM1 2KZRA 3P63A 1YQ4B 5IKCM 3SEBA 4K1RB 3RZWC 3BYTB 2O2VB 3A9KB 1FNVA 2RMMA 2REXA 2HTME 4EOYA 2ASQA 3FILB 2NBVB 3BK2A 1XXGA 3ZNHB 4YT0B 4II2B 1N62A 2L7RA 3ZJVA 1R4MI 4K3BA 1I4QA 1SIJA 2E3TA 3ZTCA 2RDHA 2ZW0A 4WWPA 3LDZE 4HDQA 3ZNZB 3FKYA 2J0KA 2K8BA 1T0RC 4GLSC 1J8CA 4E74A 1ZPSA 3DHIC 2KQ7A 2C7NB 1GPXA 1WWTA 2BS2B 1EO6A 3H9DA 3N1ZC 4IWPA 2WXIA 4XGAB 1M94A 1I4XA 1V9JA 1D5MC 1TIFA 3K9OB 3W2DA 3WAPA 1F77A 4OVUA 3AE3B 2EMSA 3PZ7A 1AARA 2L52A 2ZPNA 3JSVA 4M02A 1WXMA 4AWJA 2K8CA 4ZRKA 2HTHA 4H2AA 2LJIA 5H8YE 3PRPB 2NBUA 3RNCC 3UF8A 4WJQA 4UDUC 2QIEB 2G45B 4NJ6A 1WJNA 2L00B 2NTTA 5AZHA 2MA9B 4LTUA 1HZ6A 5FK9C 4C00A 1E6EB 2DAFA 1JW9D 2W3SA 1TKGA 2KQSA 3MJWA 3HHMA 2KDMA 5AEKB 3U2SC 3SR6A 2K1FA 2QDFA 4PYZA 4N58A 1N5XA 1VR9A 2C60A 2KWDA 3BZDB 2INDC 4JWSC 4LJPB 3VQIA 2JVCA 1JMLA 4JIOU 2IPKD 2DLBA 2BKFA 3Q69A 3HK0A 3LB8C 4MACA 3SHQA 5D7GA 1KLGD 2NPTA 5LXIB 1C4AA 3GS2A 3QX1A 2I38A 5AZGA 1YQ3B 1YN4A 2K6DB 1YIWA 2GBNA 1TZOA 1LXDA 3KVFB 1NI2A 3H8HA 3PRMB 3DVNV 3ZIMA 4FBJB 4HPLB 1HTOA 2PE9A 3PLVA 1WXSA 1WZ3A 1FPYA 2DAJA 3BVZA 3BIID 3LYYA 1FNUA 3AN1A 1SE3A 2BKRB 4WJPA 5G5GA 1YJJA 5FKAC 4IWQA 1CJEA 4ANWA 1V1OA 4TKNA 3DHHC 3R2IA 1FXTB 3QJZA 3N30A 4HEA1 4K7UA 4I6NB 4RGMA 1EM7A 2K6QA 3QA8A 2YVCA 1KOTA 2AQ1B 2Q5WD 2EMTA 2K9XA 3EA6A 3WA0A 4NY0A 4R3DA 1L7YA 4PS3A 5TR5A 1TS5A 1E8WA 2JZZA 2WDRB 1EWCA 3NVWA 4OZCA 2AEHA 1IUEA 3IHPC 1L4DB 1NI3A 2N9EB 1TJEA 2D11A 2KYWA 5CX3A 3Q3NC 2AYOB 1YJ1A 2HDEA 4M8NA 4REZA 2BWFA 2CHZA 3DBRI 4W9IA 2JPHA 2N9XA 4S17A 2LD9A 4M01A 1ZOYB 2RD0A 2KLCA 4LNIA 1VDVA 5H92C 4G3XB 1L5PA 3H6NA 5BYQA 1DYQA 3VUXA 2WYQA 2MWSB 1Y56A 3ENEA 3Q3MC 1E7PB 1FEHA 3Q3FA 2RGFA 2KJHB 4B6WA 4XWTA 4FA6A 3V6EB 4W9HA 1UWXA 3ZXVA 4PS8A 5I4DA 2QC8A 2PMVA 4B0EA 3NZ3A 1FFUA 1D5ZC 1QOBA 3CWIA 2J0MA 4TV3A 1SB3C 2KC1A 3SFEB 3QWZB 2FE8A 2ZVOA 3P1MA 2XEWA 3VVWB 4ZHPA 1FCLA 4YTPB 2R61A 4PT5A 2M8SA 2LMCA 3NVYA 1HQRD 4RFBA 4TMAB 4C56C 3KUZA 2LVQA 1GB4A 2WU2B 1SEBD 1N60A 3RN9C 2DBYA 4KKIA 3WAOA 3ZUNA 1F2RC 5J18A 2KD0A 3M95A 1I4GA 3KWVA 4CO7A 3V62A 2AL6A 1QILA 3FAHA 4MEMA 1GOZA 1I42A 3Q3JA 2DZIA 4BBNC 4MGKE 2WXKA 1WR1A 4DBGA 1D4BA 4XWWA 4KZCA 3N3KB 2D2QA 4ITKA 4O1NA 2KJ6A 3LJ3A 3GZNB 3UI3A 3H1UA 4HRSA 2JQRB 5FR3A 2MRPA 4FN2A 1YQBA 4RGOS 2MBOA 4DHJD 4AJWA 2Y5PA 1V1PB 4IWOA 3W1SA 3RT3B 2JU6X 1XCTL 1L0YB 1OQYA 3HIZA 4S0RA 4IM0A 2VH2A 5D3IB 1N63A 1TBEA 4ARCA 1C78A 1JROA 2KT7A 2NMQA 2O6VB 3R3MA 4IM3A 1LFDA 4JWUC 3L4PA 2I1JA 2FUG1 2ZNVB 3APFA 2LFIA 3ZRFA 2QCZA 2KTRB 4BKSA 4K7WA 1PQSA 4KIKA 1CQVA 4W9FA 5J17A 3QIJA 4LK0M 3RNBC 1WGGA 3AE1B 1EF5A 5DPRA 3W1YA 3P4QB 2KFKB 1SF0A 2ACZB 3ZDMC 1UF0A 3P4RB 4US8A 1M4VA 5D6JB 4C4VB 4LCDE 3BWUD 1ZDXA 3VTWA 4DXFA 3D32A 2FCNA 1V97A 2AL3A 3L08A 3PZDA 1C79A 2PE6B 2E6XA 2H89B 2K5PA 2GBJA 1SSNA 4PYUA 3WCQA 1I4RA 1LO5D 4HROA 4WWNA 3JYUA 2J52A 4GMVA 2W9NA 2DX5B 4YTMB 2HD5B 3KLSX 4DHZE 5GMVA 1C4CA 4X57B 3ZNID 1V49A 3MJ5A 4ACFA 1TT5B 4XDDA 2CS4A 2M56B 3AE7B 3TIXA 1FD6A 1IGCA 3I57A 1K53A 2KWCA 2WNMA 4B9KA 4ZYNA 4OW0A 1L6UA 4J3OD 3AB5A 1GG3A 2J42A 2LRWA 3Q8FA 1UNSA 2KK8A 1MG8A 4M0WB 1MFWA 2NTSA 3T9LA 4C7YA 3ZTDA 2INPE 2BWES 2Y5BB 1AWDA 1P3QU 1WFYA 1MI0A 5DPSA 1BMLC 4RGTA 1HXYD 3ECIA 2FUHB 4GDLB 2LXAA 3HRDD 2LEKA 3NOBA 4YSZB 2PW9A 2WP9B 3KYCD 2LUMA 1J7BA 2LASA 4GU2A 3CSTA 3TEZA 4GGQA 4K3CA 1CMXB 3AE8B 2WXQA 4KGSA 5EE0A 2GI9A 3AE4B 2MW5A 2CU3A 2RDGA 1UH6A 2DYBA 1E9MA 3BINA 2XK5A 1JWAD 3W5VB 2JZPA 3QAQA 1DOYA 3IT6B 2UYZB 4ARIA 5LLIA 2KN4A 2ZCBA 3PTFC 2L32A 2LVPA 4IC7B 1OEYJ 3DBHI 3WANA 1DOXA 1E7UA 3W5UB 4JQWC 1TS4A 4K81A 1PDXA 1P1AA 2PVOD 1SJHD 2FCQA 1MHXA 3DDCB 2KN5A 3RNFC 3JSVB 4NNJB 1WYWB 2L8JA 3TEYA 3SDLC 1KLVA 3A9JA 2J0JA 2WLBA 1FFVA 1KF6B 2WXNA 2LRUA 3A4SC 4RCOA 1T0SC 1XLOA 1UELA 2WX0A 2N7DA 1T3QA 1XCQL 4M00A 3PO0A 2FCSA 2D10A 2G1EA 3Q6BA 4CYEA 4TQ1A 3NUHB 4FHJA 3IAS1 4W9EA 2JUOA 3MHZA 2AWTA 3VRAB 2RDBC 3U4EG 3DBLB 2DZKA 2IO1B 3Q14C 4KX6B 3JVZX 3PHWB 1WJ6A 1ROEA 3PHXB 1OQQA 4LDTB 1HZ5A 1VLBA 1ZXHA 1UD7A 5EDSA 1ZKHA 3R7QA 3V6CB 2A4ZA 2W55A 2NVUI 5HI1A 4FULA 4ANVA 3AU5A 4ZRQA 2NPTB 2N0SB 2IY0B 4NJ7A 1UGJA 2CHWA 2MCNB 1AW7A 3TEXA 4JX1C 4MM3A 2CJNA 4JLCA 2C7HA 1K51A 4WJNA 4HCNB 2OJWA 1P9DU 3ZJUA 5D2MB 4USAA 1BXTA 2OJRA 2N1WA 2V3PA 3T8MA 4D2KA 3RNGC 1N6ZA 4G11A 4BFRA 1NYQA 1TY2A 1EU4A 2SAKA 4P16A 4RF1A 3C0RB 1T5XD 4B95A 2KHWB 2DYMA 4IUMB 1XQQA 2NCNA 1V86A 3KYDD 4DDGD 2ZEQA 1E5WA 3OWEB 2CR5A 2N9KA 2WXGA 2L1AA 2G4DB 1GAQB 1HTQA 2ZZPB 4WAAA 1YMHE 2GMIC 4JGHB 3ZVVA 4EZLA 2WDTB 1PFDA 3B9JA 3QK0A 3APDA 2N7JA 2C5LC 2WDQB 3DPDA 1WYGA 1L0VB 4DHZB 4F8CB 4RM9A 1XLNA 5HG2A 3L13A 3QARA 2WGSA 3N20C 4MGYE 4KSKC 2ON8A 5JXVA 1R4NI 3EGRA 3V60A 2XNAC 4HK2A 2GBMA 1WGDA 2QHOA 4ZYSA 5JHBA 4ZHOA 2M0AA 3ZGZA 1KJTA 5C3JB 4A9AA 4XC2A 1ZDVA 2D3CA 3KH0A 1JQ4A 4EFOA 5DPWA 3PPAA 5IA7A 3KUCB 3B1LX 2YLMA 2MP2A 3MC9A 4WURA 1UWMA 2KLGA 3I63C 2BYEA 2WXOA 5T8IA 4BVUC 1IBXA 2ICIA 4KGTA 1MJDA 1E0ZA 3PVLA 2HE7A 5E6PA 3T3NA 2WXJA 2ONQA 4EKUA 1WH3A 4XX5A 2DZJA 3T3OA 1SXTA 3GOEA 2GOWA 4AJYB 2WQYB 2CJOA 3IFWB 1N61A 3N32A 3TL5A 2LVOA 1YOVB 5CHFA 4FJVB 2JT4B 3X23A 3ML8A 3L16A 2FBWB 1RLFA 3H7PA 1RWSA 3OAWA 3TBLD 1XLQA 1WX7A 3PGEA 5LXHA 4W9LA 1EU3A 5IOIA 3RPFC 1YX5B 5E6OA 2FAZA 4ICUA 2RPVA 1PYWD 3AECB 3OLMD 3TSSA 1WMHA 5AZFA 3N1YC 5MPOA 1WRIA 2KOXA 3IBEA 3V05A 2IGGA 1C9FA 2IO3B 3AM9A 1TGZB 2EKIA 4LNFA 1WXVA 1JWSD 4AS1A 2NR2A 3N9YC 2IYDB 2KC2A 3BY4B 2AX5A 4AUQC 1QOFA 1U4AA 1DOIA 3WIMA 2HJ8A 2X38A 2MBBB 2BBCA 1I4PA 4IOIE 2J7QB 5AUKA 1HA5A 3W9CB 3AE5B 1SE9A 4FHKA 2KVZA 1UBQA 1RRBA 3L10B 1OQRA 4ZOHC 2L3ZA 3ETRA 1ISNA 1R4MB 3P2BA 3E9SA 4A6QA 1RYJA 3SD5A 1TTNA 2Y5CA 1STEA 1R7SA 1L0XB 2BTEA 1Y8RC 1KLUD 4TSSA 4NQKE 2LZ6A 4OZAA 4TQ0A 2KMMA 3X0WA 1IPGA 1K8RB 3ONSA 2LGIA 1FXIA 3GE8C 4OHJA 1MHHE 4RGNA 3AEFB 3A1QA 4LNOA 4ZDVA 3EFUA 4XZ4A 1WSPA 1E8YA 3DWMA 4KIKB 2WWZA 1JALA 1Q1OA 1RFAA 2PVGC 3OJ3A 2Z0EB 4WWMA 3NS8A 2MEKA 2BW2A 3ZRCA 4JPSA 1GUAB 4RH6A 2WDVB 3VTUA 1P0RA 3RZFA 3U52E 2M4NA 3M62B 1DGJA 2Y3AA 1KTKA 2BF8B 3QHTA 3LXFA 4KV2A 1LQBA 3BK1A 5KHOA 4KKJA 3HM6X 4ICVA 3JW0X 2O6VD 3L54A 1WX8A 2KO3A 1WE6A 4GB9A 1VZ8A 2FCMA 4GDKA 3BYYB 3WAMA 2IO0B 4DK5A 3ZYYX 2BB6A 3DVNU 1NBFC 1Z5SB 3NJTA 3VTVA 1CZPA 1PGXA 3O13A 2QILA 3QQ8B 4EZKA 1C3TA 2N7EA 4WH4A 2LXCA 1PGBA 4J6IA 2N4FA 3PS6A 4W9GA 3TMPB 1WGHA 2D3AA 2KDIA 4A90A 4WQMA 1T0QC 3E56A 2ZW1A 3KQ4A 4FADA 1TS3A 4NAWA 2WXRA 1KM7A 3AU4A 2PKOA 3W1SC 3AV8A 5CHVC 5L95C 1VD2A 4RNAA 5EE3A 2JRIB 2N9LA 2JWUA 2FIFA 1TKYA 3AEDB 1MPEA 4A3PA 3M3JA 3AEEB 4BBNF 4A3OA 1VRAB 2MQJA 2L0FA 4EUTA 2N1VA 2V4LA 5TSSA 1HE8A 1V80A 2C7MB 2VH1A 1D3ZA 2DWQA 4NJCA 3MP9A 4MJSA 4JE3B 4IDIA 4MSQB 1T6BX 3ZQ4A 1SJED 4L23A 5IP4D 2BS3B 1NVID 3MTNB 5LNK1 3RNEC 2JSVX 3V3XA 4IKGA 5D94A 2Z0DB 2GBKA 4P1CC 1QZEA 3ZNGC 2M19A 5BMIA 4LNNA 1YJIA 3HVDA 2ZCCA 3UGBB 1E90A 1FRDA 1SE2A 2XK5B 2K0PA 5FR6A 3IXSA 1LGRA 4NPNA 2G9HD 3Q8AA 3DBRB 4NZLB 1JRUA 4F7ZA 2BS4B 3RULA 4C80A 2Z8LA 1NDDA 2KWVB 1V2YA 2C9WB 2WX1A 2INCC 2BB5A 3NS1A 3CF6E 2KFJA 5EE9A 3GE3C 2B3AA 2ZVNA 1ZUD2 2V3SA 1PGAA 4KGRA 2WS3B 2PEAA 4URKA 1H8CA 1TZ1A 3URYA 2V3NA 4L2YA 3DCGA 5CHWA 3A9JB 4MGIE 4E71A 1A70A 3L17A 4FXCA 5IAAC 3VH4B 2CKHB 3GP7A 3RMKC 1J19A 4XDCA 1LM8B 2QSDA 1FMAD
chains in the Genus database with same CATH topology
5JZEB 2CU1A 1WE7A 4I6PA 3Q3FA 4IUMB 3A4RA 1IYFA 2RGFA 3DVGX 1XQQA 2KJHB 4HJKA 4B6WA 3ZLZA 2NCNA 1V86A 4FA6A 3KYDD 4HCPB 3V6EB 4DDGD 2ZEQA 5C23A 2L05A 4W9HA 2KKCA 2KMCA 4HLEA 1E5WA 2G4SA 3PRZA 2GBRA 4PS8A 3EC8A 2CR5A 4A20A 1EF1A 2LUEA 2MBHA 2G4DB 4F1SA 2ZZPB 4KVGB 2KVRA 1WGRA 4WAAA 2J0MA 4MGZE 2IY1B 3I3TB 4TV3A 5DPTA 2GMIC 2G3QB 2KC1A 2ZJDA 3QWZB 2LJ5A 1UGMA 2I1KA 4BOSC 1OTRB 1WGYA 4JGHB 2ZVOA 3VDZA 1GNUA 4G50A 2WDTB 3ZVVA 4EZLA 3EECA 2XEWA 4I6LB 4KDIC 3VVWB 4W9DA 2JF5A 3QK0A 2KX3A 4HDOA 4DDID 3APDA 5E6NA 1OGWA 1E8ZA 4ZRJA 2C5LC 2M8SA 3DPDA 3PREA 4DWFA 3ALBA 4DHZB 2M0XA 2KANA 4F8CB 4RM9A 3KUZA 3L13A 2LVQA 3QARA 3RUIB 1WF9A 2RSUA 3RD2A 4MGYE 4KSKC 4AOFA 3PV1A 2O6VA 1R4NI 4JL9A 3V60A 4HK2A 2GBMA 1E8XA 2OOBB 2MX2A 3HM3A 2A5UA 1WGDA 2QHOA 3WAOA 2XBBC 3ZUNA 2KXJA 4CHKA 1G6JA 3AULA 3ML9A 5JHBA 5J18A 2KD0A 3M95A 4BKTA 1KJTA 3QCAA 4CO7A 4XC2A 5BO4B 3V62A 3U30A 2AL6A 5CTRC 2JZ3B 2KTRA 4HPMB 3KH0A 4IG7B 4LDTD 4EFOA 5DPWA 3EHVA 3PPAA 2D3GA 4MEMA 5IA7A 1I42A 3KUCB 3Q3JA 2DZIA 4BBNC 4MGKE 2UWQA 2N9PC 3B1LX 2YLMA 2MP2A 1WR1A 2KLGA 1J0GA 4DBGA 3B08A 1WJ4A 2BYEA 4BVUC 5C1ZA 2K39A 4KZCA 2KFKA 3N3KB 2D2QA 2JY6A 1ZW7A 2HE7A 2KJ6A 3LJ3A 3PVLA 5E6PA 3RCZA 4KZ0A 1XD3B 3H1UA 4EKUA 1WH3A 4XX5A 2DZJA 4GSWA 1OEYA 1X1MA 2NBWB 3GOEA 2MRPA 5DCNA 4FN2A 1YQBA 4AP4C 1EUVB 2GOWA 2KDEB 3UIPB 4BOZB 2MBOA 3TCAA 4AJYB 4BKGA 4DHJD 4AJWA 3IFWB 3N32A 3TL5A 3MHSD 3B0AA 2BPSA 2LVOA 3IG3A 2R2OA 3CSFA 2KWUB 5CHFA 2PJHA 4IWOA 3W1SA 3RT3B 3M63B 4FJVB 3KW5B 1GC7A 2JT4B 3X23A 3ML8A 1OQYA 3HIZA 3L16A 4IM0A 3UQAA 2IO2B 1RLFA 3H7PA 4KDLB 3OAWA 3TBLD 3ZKJC 2M17A 1TBEA 1WX7A 2DHZA 3PGEA 5LXHA 4HXDA 5KHQA 4W9LA 1SGHA 2O2VA 2ZNVC 3A33B 4HVBA 3A9KA 2O6VB 1YX5B 5E6OA 2FAZA 3R3MA 4MELA 3GZNI 3VH3B 2BYFA 4IM3A 1LFDA 4ICUA 2PPHA 2IBIB 4NQLB 4OVVA 4G0NB 4PS7A 3U7DA 1ZGUB 4TUUA 2BGFA 2I1JA 3OLMD 2KTFA 4W9KA 1WR6E 4N9F4 2ZNVB 1S1QB 1WMHA 1WXAA 2MBEA 2MBQA 5AZFA 3APFA 3ZRFA 4W9CA 2KTRB 4BKSA 4K7WA 1PQSA 2KOXA 3APCA 3IBEA 4KIKA 1V81A 2JRHA 2D07B 4W9FA 2M1MA 2IO3B 5J17A 1TGZB 3QIJA 1UZXB 4WWOA 1RAXA 1WGGA 2MP2B 3ZO5B 1EF5A 3VUWA 1WXVA 5DPRA 3WALA 3NZUA 3W1YA 1YX6B 2NR2A 4W9JA 2K8HA 2KFKB 2IYDB 2KC2A 3BY4B 4AUQC 3ZDMC 1U4AA 4RMAA 4E3CA 1UBIA 3WIMA 1GJZA 5D6JB 2HJ8A 2KNBA 3S2AA 4LCDE 3H7SA 4ZRIA 2MBBB 3VTWA 4EEWA 2J7QB 4EZJA 3NHEB 3D32A 1SE9A 4FHKA 2FCNA 4FJZA 4M8MA 1UBQA 1RRBA 3L10B 4GDLA 2RPQA 1V6EA 5JHAA 2Z59B 2L3ZA 2AL3A 2KX0A 1ISNA 3NY5A 3P2BA 3L08A 3DOWA 3PZDA 3ENEA 3SD5A 1TTNA 1WZ0A 2PE6B 1P98A 1Q0WB 4E71A 3V61A 2FNJB 3VXWA 1Y8RC 1S3SG 2GBJA 4PYUA 3R7RA 2KZRA 4ANXA 4NQKE 3H7PB 1BT0A 2LZ6A 1WY8A 4TQ0A 4WWNA 4K1RB 3RZWC 3JYUA 3X0WA 2O2VB 4GMVA 3A9KB 2W9NA 2KJRA 2DX5B 1IPGA 1E7VA 2REXA 1K8RB 2HD5B 3ONSA 4DHZE 5GMVA 3ZNID 4X57B 1SIFA 1V49A 4EOYA 2ASQA 4GOCA 3OJ4B 2NBVB 2CS4A 4IW0A 3TIXA 3A1QA 4MH0E 1WMHB 3ZNHB 3DQVA 4ZDVA 3EFUA 4XZ4A 4II2B 4YL8A 2KWCA 1E8YA 2L7RA 4KIKB 4B9KA 2WWZA 1R4MI 2V1YA 3ZTCA 4WWPA 1Q1OA 1RFAA 3OJ3A 2Z0EB 4ZYNA 3NS8A 3LDZE 4HDQA 3ZNZB 1GG3A 2LRWA 3ZRCA 1GUAB 2J0KA 3L0WB 2KK8A 3VTUA 1P0RA 2K8BA 1MG8A 4M0WB 3RZFA 3T9LA 1J8CA 3ZTDA 1A5RA 2M4NA 2BWES 3UINB 4E74A 2Y5BB 1P3QU 3M62B 3PLUA 1WFYA 1WI0A 4RM8A 1H4RA 2BF8B 2KQ7A 2C7NB 3KUDB 5DPSA 1F9JA 3QHTA 1EO6A 1T0YA 3ECIA 2FUHB 3H9DA 5HKHA 1WIAA 2MSED 4GDLB 4KV2A 1LQBA 4IWPA 5KHOA 1M94A 2LXAA 1V9JA 3HM6X 4ICVA 3JW0X 3ZDTA 2O6VD 3K9OB 3NOBA 3WAPA 3L54A 1WX8A 2KO3A 1WE6A 4GB9A 3KYCD 4OVUA 2FCMA 4GDKA 2EMSA 1I35A 1AARA 3JSVA 2ZPNA 1WXMA 4AWJA 3IVFA 4II3B 3WAMA 2LASA 2K8CA 2IO0B 4GU2A 4DK5A 4ZRKA 2HTHA 4DXAB 3CSTA 3DVNU 1NBFC 1Z5SB 2DZMA 3PRPB 3VTVA 3PSEB 4GGQA 3UIOB 2NBUA 1CMXB 3UF8A 3CMMB 4WJQA 1XT9B 4WJOA 2G45B 4NJ6A 1WJNA 3QQ8B 2L00B 5AZHA 2MA9B 2MW5A 4EZKA 4GIVA 2CHXA 1C3TA 2N7EA 2DAFA 2LXCA 1UH6A 2KQSA 1C1YB 2DYBA 4J6IA 3MJWA 3A1QB 4ASWC 3HHMA 2R2QA 3BINA 2N4FA 3PS6A 4K7SA 2L76A 4W9GA 2XK5A 3TMPB 5AEKB 2K1FA 4PYZA 5J2RA 4GN1A 2K25A 2C60A 1WGHA 3QAQA 2DYOA 2BYVE 2KDIA 2UYZB 1WX9A 2LGDA 3PT2B 1GC6A 4FADA 4LJPB 2LWPA 3VQIA 2JVCA 5LLIA 2ZCBA 4NAWA 4JIOU 3SU8X 2BKFA 1KM7A 3PTFC 4KSLC 3AU4A 3W1SC 3HK0A 2LVPA 4IC7B 1OEYJ 3SHQA 3DBHI 5CHVC 3WANA 1E7UA 5D7GA 5L95C 1VD2A 2JRIB 2NPTA 4JQWC 5LXIB 2VRRB 3QC8B 3K9PB 1WM2A 3DBSA 3QX1A 4K81A 2FIFA 5AZGA 4ANUA 1P1AA 4A3PA 3M3JA 4BBNF 2FCQA 3DDCB 4A3OA 2MQJA 4GXBA 2K6DB 1YIWA 2KN5A 2L0FA 3VAWA 4EUTA 4GDKB 2N1VA 2V4LA 2GBNA 1HE8A 1V80A 2C7MB 3JSVB 1WYWB 1LXDA 2L8JA 3KVFB 1NI2A 4NNJB 3U8ZA 3PRMB 4FBJB 3DVNV 3ZIMA 1D3ZA 4MJSA 3SDLC 1KLVA 3A9JA 4HPLB 2J0JA 2KDBA 1WRDB 2PE9A 4MSQB 4P7IA 3PLVA 4BKSD 1WXSA 2LRUA 3A4SC 1WZ3A 1Z2MA 2DAJA 4MSMB 3AXCA 1UELA 2WX0A 3VHTC 2N7DA 2DENB 2BKRB 4WJPA 2MLBA 2FCSA 4IM2A 3O65B 3MTNB 5D94A 4IWQA 2D10A 3VUYA 2Z0DB 2GBKA 1QZEA 3ZNGC 4CYEA 4ANWA 4TQ1A 4FHJA 5L83A 4TKNA 2FIDA 2LI5A 4HWIB 1FXTB 2ZCCA 1Q5WB 1E90A 2XK5B 4W9EA 4FJYA 3UGBB 2KDFB 3QJZA 2JUOA 4MDKE 1V5TA 3N30A 2AWTA 5FR6A 4K7UA 1IP9A 5JH5C 4I6NB 2DZKA 2K6QA 3QA8A 2IO1B 1V5OA 3JVZX 4NPNA 2JXXA 2YVCA 3PHWB 4NAWB 5G55A 1WJ6A 1KOTA 2ZPYA 2KMAA 1JRUA 3PHXB 4LDTB 4F7ZA 3RULA 2EMTA 1UD7A 5EDSA 1ZKHA 3R7QA 3V6CB 3WA0A 2A4ZA 2NVUI 1NDDA 3UQBA 2KWVB 1V2YA 4NY0A 1L7YA 2C9WB 4FULA 1WJUA 3AU5A 4ANVA 3ZW3A 3NZSA 4PS3A 2WX1A 2NPTB 3VFKA 5TR5A 2IY0B 2IZVB 3AI5A 3CF6E 2KFJA 4NJ7A 1E8WA 2CHWA 2MCNB 2JZZA 2B3AA 2ZVNA 4MM3A 4JLCA 5G2NA 2V3SA 1VCBA 2C7HA 4WJNA 3TJPA 2PEAA 4HCNB 4URKA 1P9DU 2AEHA 1H8CA 5D2MB 3IHPC 4LJOB 2RR9A 2N9EB 1TZ1A 2N1WA 2OJRA 2D11A 2L0TA 5CX3A 3T8MA 4DHJB 3DCGA 3R66C 3DBLI 4MJSB 5CHWA 4FLHA 3A9JB 3RYTA 2AYOB 1YJ1A 1WM3A 2LGXA 4M8NA 4MGIE 2BWFA 2CHZA 3DBRI 3L17A 4W9IA 2JPHA 2N9XA 4G11A 4WQOB 4BFRA 2LD9A 5IAAC 3VH4B 2CKHB 2LGYA 2RD0A 2KLCA 4G3XB 3H6NA 3C0RB 3VUXA 1J19A 2WYQA 4B95A 1LM8B 3DVGY 1L2NA 1YD8U 2MWSB 2KHWB 2DYMA 2NS5A 2JWZA 2EKEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JZE B;  2CU1 A;  1WE7 A;  4I6P A;  3Q3F A;  4IUM B;  3A4R A;  1IYF A;  2RGF A;  3DVG X;  1XQQ A;  2KJH B;  4HJK A;  4B6W A;  3ZLZ A;  2NCN A;  1V86 A;  4FA6 A;  3KYD D;  4HCP B;  3V6E B;  4DDG D;  2ZEQ A;  5C23 A;  2L05 A;  4W9H A;  2KKC A;  2KMC A;  4HLE A;  1E5W A;  2G4S A;  3PRZ A;  2GBR A;  4PS8 A;  3EC8 A;  2CR5 A;  4A20 A;  1EF1 A;  2LUE A;  2MBH A;  2G4D B;  4F1S A;  2ZZP B;  4KVG B;  2KVR A;  1WGR A;  4WAA A;  2J0M A;  4MGZ E;  2IY1 B;  3I3T B;  4TV3 A;  5DPT A;  2GMI C;  2G3Q B;  2KC1 A;  2ZJD A;  3QWZ B;  2LJ5 A;  1UGM A;  2I1K A;  4BOS C;  1OTR B;  1WGY A;  4JGH B;  2ZVO A;  3VDZ A;  1GNU A;  4G50 A;  2WDT B;  3ZVV A;  4EZL A;  3EEC A;  2XEW A;  4I6L B;  4KDI C;  3VVW B;  4W9D A;  2JF5 A;  3QK0 A;  2KX3 A;  4HDO A;  4DDI D;  3APD A;  5E6N A;  1OGW A;  1E8Z A;  4ZRJ A;  2C5L C;  2M8S A;  3DPD A;  3PRE A;  4DWF A;  3ALB A;  4DHZ B;  2M0X A;  2KAN A;  4F8C B;  4RM9 A;  3KUZ A;  3L13 A;  2LVQ A;  3QAR A;  3RUI B;  1WF9 A;  2RSU A;  3RD2 A;  4MGY E;  4KSK C;  4AOF A;  3PV1 A;  2O6V A;  1R4N I;  4JL9 A;  3V60 A;  4HK2 A;  2GBM A;  1E8X A;  2OOB B;  2MX2 A;  3HM3 A;  2A5U A;  1WGD A;  2QHO A;  3WAO A;  2XBB C;  3ZUN A;  2KXJ A;  4CHK A;  1G6J A;  3AUL A;  3ML9 A;  5JHB A;  5J18 A;  2KD0 A;  3M95 A;  4BKT A;  1KJT A;  3QCA A;  4CO7 A;  4XC2 A;  5BO4 B;  3V62 A;  3U30 A;  2AL6 A;  5CTR C;  2JZ3 B;  2KTR A;  4HPM B;  3KH0 A;  4IG7 B;  4LDT D;  4EFO A;  5DPW A;  3EHV A;  3PPA A;  2D3G A;  4MEM A;  5IA7 A;  1I42 A;  3KUC B;  3Q3J A;  2DZI A;  4BBN C;  4MGK E;  2UWQ A;  2N9P C;  3B1L X;  2YLM A;  2MP2 A;  1WR1 A;  2KLG A;  1J0G A;  4DBG A;  3B08 A;  1WJ4 A;  2BYE A;  4BVU C;  5C1Z A;  2K39 A;  4KZC A;  2KFK A;  3N3K B;  2D2Q A;  2JY6 A;  1ZW7 A;  2HE7 A;  2KJ6 A;  3LJ3 A;  3PVL A;  5E6P A;  3RCZ A;  4KZ0 A;  1XD3 B;  3H1U A;  4EKU A;  1WH3 A;  4XX5 A;  2DZJ A;  4GSW A;  1OEY A;  1X1M A;  2NBW B;  3GOE A;  2MRP A;  5DCN A;  4FN2 A;  1YQB A;  4AP4 C;  1EUV B;  2GOW A;  2KDE B;  3UIP B;  4BOZ B;  2MBO A;  3TCA A;  4AJY B;  4BKG A;  4DHJ D;  4AJW A;  3IFW B;  3N32 A;  3TL5 A;  3MHS D;  3B0A A;  2BPS A;  2LVO A;  3IG3 A;  2R2O A;  3CSF A;  2KWU B;  5CHF A;  2PJH A;  4IWO A;  3W1S A;  3RT3 B;  3M63 B;  4FJV B;  3KW5 B;  1GC7 A;  2JT4 B;  3X23 A;  3ML8 A;  1OQY A;  3HIZ A;  3L16 A;  4IM0 A;  3UQA A;  2IO2 B;  1RLF A;  3H7P A;  4KDL B;  3OAW A;  3TBL D;  3ZKJ C;  2M17 A;  1TBE A;  1WX7 A;  2DHZ A;  3PGE A;  5LXH A;  4HXD A;  5KHQ A;  4W9L A;  1SGH A;  2O2V A;  2ZNV C;  3A33 B;  4HVB A;  3A9K A;  2O6V B;  1YX5 B;  5E6O A;  2FAZ A;  3R3M A;  4MEL A;  3GZN I;  3VH3 B;  2BYF A;  4IM3 A;  1LFD A;  4ICU A;  2PPH A;  2IBI B;  4NQL B;  4OVV A;  4G0N B;  4PS7 A;  3U7D A;  1ZGU B;  4TUU A;  2BGF A;  2I1J A;  3OLM D;  2KTF A;  4W9K A;  1WR6 E;  4N9F 4;  2ZNV B;  1S1Q B;  1WMH A;  1WXA A;  2MBE A;  2MBQ A;  5AZF A;  3APF A;  3ZRF A;  4W9C A;  2KTR B;  4BKS A;  4K7W A;  1PQS A;  2KOX A;  3APC A;  3IBE A;  4KIK A;  1V81 A;  2JRH A;  2D07 B;  4W9F A;  2M1M A;  2IO3 B;  5J17 A;  1TGZ B;  3QIJ A;  1UZX B;  4WWO A;  1RAX A;  1WGG A;  2MP2 B;  3ZO5 B;  1EF5 A;  3VUW A;  1WXV A;  5DPR A;  3WAL A;  3NZU A;  3W1Y A;  1YX6 B;  2NR2 A;  4W9J A;  2K8H A;  2KFK B;  2IYD B;  2KC2 A;  3BY4 B;  4AUQ C;  3ZDM C;  1U4A A;  4RMA A;  4E3C A;  1UBI A;  3WIM A;  1GJZ A;  5D6J B;  2HJ8 A;  2KNB A;  3S2A A;  4LCD E;  3H7S A;  4ZRI A;  2MBB B;  3VTW A;  4EEW A;  2J7Q B;  4EZJ A;  3NHE B;  3D32 A;  1SE9 A;  4FHK A;  2FCN A;  4FJZ A;  4M8M A;  1UBQ A;  1RRB A;  3L10 B;  4GDL A;  2RPQ A;  1V6E A;  5JHA A;  2Z59 B;  2L3Z A;  2AL3 A;  2KX0 A;  1ISN A;  3NY5 A;  3P2B A;  3L08 A;  3DOW A;  3PZD A;  3ENE A;  3SD5 A;  1TTN A;  1WZ0 A;  2PE6 B;  1P98 A;  1Q0W B;  4E71 A;  3V61 A;  2FNJ B;  3VXW A;  1Y8R C;  1S3S G;  2GBJ A;  4PYU A;  3R7R A;  2KZR A;  4ANX A;  4NQK E;  3H7P B;  1BT0 A;  2LZ6 A;  1WY8 A;  4TQ0 A;  4WWN A;  4K1R B;  3RZW C;  3JYU A;  3X0W A;  2O2V B;  4GMV A;  3A9K B;  2W9N A;  2KJR A;  2DX5 B;  1IPG A;  1E7V A;  2REX A;  1K8R B;  2HD5 B;  3ONS A;  4DHZ E;  5GMV A;  3ZNI D;  4X57 B;  1SIF A;  1V49 A;  4EOY A;  2ASQ A;  4GOC A;  3OJ4 B;  2NBV B;  2CS4 A;  4IW0 A;  3TIX A;  3A1Q A;  4MH0 E;  1WMH B;  3ZNH B;  3DQV A;  4ZDV A;  3EFU A;  4XZ4 A;  4II2 B;  4YL8 A;  2KWC A;  1E8Y A;  2L7R A;  4KIK B;  4B9K A;  2WWZ A;  1R4M I;  2V1Y A;  3ZTC A;  4WWP A;  1Q1O A;  1RFA A;  3OJ3 A;  2Z0E B;  4ZYN A;  3NS8 A;  3LDZ E;  4HDQ A;  3ZNZ B;  1GG3 A;  2LRW A;  3ZRC A;  1GUA B;  2J0K A;  3L0W B;  2KK8 A;  3VTU A;  1P0R A;  2K8B A;  1MG8 A;  4M0W B;  3RZF A;  3T9L A;  1J8C A;  3ZTD A;  1A5R A;  2M4N A;  2BWE S;  3UIN B;  4E74 A;  2Y5B B;  1P3Q U;  3M62 B;  3PLU A;  1WFY A;  1WI0 A;  4RM8 A;  1H4R A;  2BF8 B;  2KQ7 A;  2C7N B;  3KUD B;  5DPS A;  1F9J A;  3QHT A;  1EO6 A;  1T0Y A;  3ECI A;  2FUH B;  3H9D A;  5HKH A;  1WIA A;  2MSE D;  4GDL B;  4KV2 A;  1LQB A;  4IWP A;  5KHO A;  1M94 A;  2LXA A;  1V9J A;  3HM6 X;  4ICV A;  3JW0 X;  3ZDT A;  2O6V D;  3K9O B;  3NOB A;  3WAP A;  3L54 A;  1WX8 A;  2KO3 A;  1WE6 A;  4GB9 A;  3KYC D;  4OVU A;  2FCM A;  4GDK A;  2EMS A;  1I35 A;  1AAR A;  3JSV A;  2ZPN A;  1WXM A;  4AWJ A;  3IVF A;  4II3 B;  3WAM A;  2LAS A;  2K8C A;  2IO0 B;  4GU2 A;  4DK5 A;  4ZRK A;  2HTH A;  4DXA B;  3CST A;  3DVN U;  1NBF C;  1Z5S B;  2DZM A;  3PRP B;  3VTV A;  3PSE B;  4GGQ A;  3UIO B;  2NBU A;  1CMX B;  3UF8 A;  3CMM B;  4WJQ A;  1XT9 B;  4WJO A;  2G45 B;  4NJ6 A;  1WJN A;  3QQ8 B;  2L00 B;  5AZH A;  2MA9 B;  2MW5 A;  4EZK A;  4GIV A;  2CHX A;  1C3T A;  2N7E A;  2DAF A;  2LXC A;  1UH6 A;  2KQS A;  1C1Y B;  2DYB A;  4J6I A;  3MJW A;  3A1Q B;  4ASW C;  3HHM A;  2R2Q A;  3BIN A;  2N4F A;  3PS6 A;  4K7S A;  2L76 A;  4W9G A;  2XK5 A;  3TMP B;  5AEK B;  2K1F A;  4PYZ A;  5J2R A;  4GN1 A;  2K25 A;  2C60 A;  1WGH A;  3QAQ A;  2DYO A;  2BYV E;  2KDI A;  2UYZ B;  1WX9 A;  2LGD A;  3PT2 B;  1GC6 A;  4FAD A;  4LJP B;  2LWP A;  3VQI A;  2JVC A;  5LLI A;  2ZCB A;  4NAW A;  4JIO U;  3SU8 X;  2BKF A;  1KM7 A;  3PTF C;  4KSL C;  3AU4 A;  3W1S C;  3HK0 A;  2LVP A;  4IC7 B;  1OEY J;  3SHQ A;  3DBH I;  5CHV C;  3WAN A;  1E7U A;  5D7G A;  5L95 C;  1VD2 A;  2JRI B;  2NPT A;  4JQW C;  5LXI B;  2VRR B;  3QC8 B;  3K9P B;  1WM2 A;  3DBS A;  3QX1 A;  4K81 A;  2FIF A;  5AZG A;  4ANU A;  1P1A A;  4A3P A;  3M3J A;  4BBN F;  2FCQ A;  3DDC B;  4A3O A;  2MQJ A;  4GXB A;  2K6D B;  1YIW A;  2KN5 A;  2L0F A;  3VAW A;  4EUT A;  4GDK B;  2N1V A;  2V4L A;  2GBN A;  1HE8 A;  1V80 A;  2C7M B;  3JSV B;  1WYW B;  1LXD A;  2L8J A;  3KVF B;  1NI2 A;  4NNJ B;  3U8Z A;  3PRM B;  4FBJ B;  3DVN V;  3ZIM A;  1D3Z A;  4MJS A;  3SDL C;  1KLV A;  3A9J A;  4HPL B;  2J0J A;  2KDB A;  1WRD B;  2PE9 A;  4MSQ B;  4P7I A;  3PLV A;  4BKS D;  1WXS A;  2LRU A;  3A4S C;  1WZ3 A;  1Z2M A;  2DAJ A;  4MSM B;  3AXC A;  1UEL A;  2WX0 A;  3VHT C;  2N7D A;  2DEN B;  2BKR B;  4WJP A;  2MLB A;  2FCS A;  4IM2 A;  3O65 B;  3MTN B;  5D94 A;  4IWQ A;  2D10 A;  3VUY A;  2Z0D B;  2GBK A;  1QZE A;  3ZNG C;  4CYE A;  4ANW A;  4TQ1 A;  4FHJ A;  5L83 A;  4TKN A;  2FID A;  2LI5 A;  4HWI B;  1FXT B;  2ZCC A;  1Q5W B;  1E90 A;  2XK5 B;  4W9E A;  4FJY A;  3UGB B;  2KDF B;  3QJZ A;  2JUO A;  4MDK E;  1V5T A;  3N30 A;  2AWT A;  5FR6 A;  4K7U A;  1IP9 A;  5JH5 C;  4I6N B;  2DZK A;  2K6Q A;  3QA8 A;  2IO1 B;  1V5O A;  3JVZ X;  4NPN A;  2JXX A;  2YVC A;  3PHW B;  4NAW B;  5G55 A;  1WJ6 A;  1KOT A;  2ZPY A;  2KMA A;  1JRU A;  3PHX B;  4LDT B;  4F7Z A;  3RUL A;  2EMT A;  1UD7 A;  5EDS A;  1ZKH A;  3R7Q A;  3V6C B;  3WA0 A;  2A4Z A;  2NVU I;  1NDD A;  3UQB A;  2KWV B;  1V2Y A;  4NY0 A;  1L7Y A;  2C9W B;  4FUL A;  1WJU A;  3AU5 A;  4ANV A;  3ZW3 A;  3NZS A;  4PS3 A;  2WX1 A;  2NPT B;  3VFK A;  5TR5 A;  2IY0 B;  2IZV B;  3AI5 A;  3CF6 E;  2KFJ A;  4NJ7 A;  1E8W A;  2CHW A;  2MCN B;  2JZZ A;  2B3A A;  2ZVN A;  4MM3 A;  4JLC A;  5G2N A;  2V3S A;  1VCB A;  2C7H A;  4WJN A;  3TJP A;  2PEA A;  4HCN B;  4URK A;  1P9D U;  2AEH A;  1H8C A;  5D2M B;  3IHP C;  4LJO B;  2RR9 A;  2N9E B;  1TZ1 A;  2N1W A;  2OJR A;  2D11 A;  2L0T A;  5CX3 A;  3T8M A;  4DHJ B;  3DCG A;  3R66 C;  3DBL I;  4MJS B;  5CHW A;  4FLH A;  3A9J B;  3RYT A;  2AYO B;  1YJ1 A;  1WM3 A;  2LGX A;  4M8N A;  4MGI E;  2BWF A;  2CHZ A;  3DBR I;  3L17 A;  4W9I A;  2JPH A;  2N9X A;  4G11 A;  4WQO B;  4BFR A;  2LD9 A;  5IAA C;  3VH4 B;  2CKH B;  2LGY A;  2RD0 A;  2KLC A;  4G3X B;  3H6N A;  3C0R B;  3VUX A;  1J19 A;  2WYQ A;  4B95 A;  1LM8 B;  3DVG Y;  1L2N A;  1YD8 U;  2MWS B;  2KHW B;  2DYM A;  2NS5 A;  2JWZ A;  2EKE C; 
#chains in the Genus database with same CATH topology
 5JZE B;  1C77 A;  3C8Y A;  1WE7 A;  2VZK B;  1J7C A;  2IDY A;  2GRI A;  4OZB A;  1TY0 A;  3RI7 C;  5C23 A;  2L05 A;  1QQR A;  2KKC A;  1ZXI A;  4HLE A;  1ACC A;  1FO4 A;  3AH7 A;  2GBR A;  4WIP A;  4A20 A;  2MBH A;  4F1S A;  1WGR A;  3AEB B;  4MGZ E;  2IY1 B;  4LNK A;  5DPT A;  4P6V F;  2WXL A;  2G3Q B;  3AE9 B;  2OHF A;  2LJ5 A;  2QEJ C;  3OG5 A;  1UGM A;  1WGY A;  4G50 A;  4I6L B;  4W9D A;  4DDI D;  4MM3 B;  1OGW A;  4ZRJ A;  3CIR B;  4DWF A;  3ALB A;  1MG4 A;  4Q2J A;  2KAN A;  1K50 A;  5AUI A;  1WF9 A;  2RSU A;  1QLB B;  3RD2 A;  1C4P A;  3GB1 A;  1CK1 A;  2OOB B;  4CHK A;  2MH7 A;  2WXP A;  3PZ8 A;  3HVZ A;  3QCA A;  5BO4 B;  2EEL A;  1KRH A;  4IG7 B;  4LDT D;  2H88 B;  3EHV A;  5G5H A;  3B08 A;  2K39 A;  2QJL A;  1P7E A;  1F52 A;  2JY6 A;  2JYT A;  3RNA C;  3IT4 B;  3EUB 2;  2MJE A;  1D5X C;  5DCN A;  4AP4 C;  2KDE B;  3UIP B;  4BOZ B;  1QOG A;  4BKG A;  1RM6 C;  3MHS D;  3B0A A;  2BPS A;  3IG3 A;  2R2O A;  3CSF A;  3DHG C;  3R2T A;  2PJH A;  2V4I B;  4WAF A;  3R8B A;  1IGD A;  3KW5 B;  1GC7 A;  3VR8 B;  1VJK A;  5IO9 A;  3UQA A;  3Q8C A;  2JYE A;  3I9V 1;  2BVC A;  4KDL B;  2WU5 B;  2IJ0 A;  3ZKJ C;  5KHQ A;  4DQO C;  2O2V A;  1NYR A;  1VZ6 A;  3A9K A;  1WXQ A;  1NEK B;  3VH3 B;  3GZN I;  2BQQ A;  2XN9 C;  2PPH A;  4NQL B;  4OVV A;  2WHI A;  3FIL A;  4PS7 A;  1J7A A;  3U7D A;  1ZGU B;  2KTF A;  1JWM D;  1WR6 E;  4N9F 4;  2MBE A;  3BVM A;  1L4Z B;  3NG0 A;  1QKZ A;  2J53 A;  1FM0 D;  1V81 A;  2JRH A;  2D07 B;  2M1M A;  4WWO A;  2MP2 B;  3ZO5 B;  3VUW A;  3WAL A;  2PTL A;  3NZU A;  4A8X C;  4W9J A;  1IBX B;  2K8H A;  3Q8B A;  3U7Z A;  4RMA A;  4US9 A;  1UBI A;  1GJZ A;  3H7S A;  4ZRI A;  3AE2 B;  2JXT A;  4M8M A;  4RF0 A;  1MVK A;  1V6E A;  5HHD G;  1YN3 A;  4MH8 A;  1F0Z A;  2JX5 A;  5BMG A;  1WZ0 A;  1P98 A;  1Q0W B;  1TKE A;  2FNJ B;  1S3S G;  3R7R A;  4ANX A;  2IGD A;  2PIA A;  3H7P B;  4YSY B;  1BT0 A;  1WY8 A;  2KJR A;  1E7V A;  2TSS A;  1SIF A;  2LHE A;  2DNF A;  4GOC A;  2SEB D;  3OJ4 B;  2K3U A;  3NRZ A;  4IW0 A;  4MH0 E;  1WMH B;  3DQV A;  4YL8 A;  1TS2 A;  2KQ4 X;  2V1Y A;  3VR9 B;  3TUO A;  1C76 A;  3AEA B;  3L0W B;  3J9C A;  1JCK B;  1XF5 L;  3TEW A;  1A5R A;  3UIN B;  1B9R A;  3PLU A;  1WI0 A;  3NVZ A;  4RM8 A;  1H4R A;  3KUD B;  1F9J A;  1T0Y A;  4AQ7 A;  5HKH A;  1WIA A;  2MSE D;  1XEE A;  5BYR A;  1UUP A;  3ZDT A;  2D3B A;  1VZ7 A;  1I35 A;  4BZA A;  3IVF A;  4II3 B;  3P4P B;  4DXA B;  1KFY B;  2J4X A;  1XO3 A;  5BMH A;  2DZM A;  3PSE B;  3UIO B;  4HJG E;  3CMM B;  3DBH B;  1XT9 B;  4WJO A;  1FRR A;  1K52 A;  3MC0 B;  5IN7 A;  4GIV A;  2CHX A;  2HJ1 A;  1C1Y B;  4ASW C;  3A1Q B;  2WXH A;  1JRP A;  2R2Q A;  4K7S A;  2L76 A;  5J2R A;  4GN1 A;  2K25 A;  2IGH A;  2AQ2 B;  2DYO A;  2BYV E;  1WX9 A;  2LGD A;  3PT2 B;  1GC6 A;  2LWP A;  3SU8 X;  4KSL C;  1QT9 A;  3ZXR A;  2VRR B;  3QC8 B;  3K9P B;  1WM2 A;  3DBS A;  4XYC A;  4ANU A;  1Q10 A;  4GXB A;  3VAW A;  4GDK B;  4YTN B;  4HKZ E;  1RFK A;  2X8X X;  4ZRP A;  1ZP0 B;  3U8Z A;  2KAJ A;  2KDB A;  5EE1 A;  1WRD B;  1ET9 A;  4P7I A;  4BKS D;  3KWL A;  1Z2M A;  4MSM B;  3AXC A;  3I5J C;  1XLP A;  3VHT C;  2DEN B;  3AEG B;  2MLB A;  2D5G A;  4IM2 A;  3O65 B;  2OED A;  2V9H A;  3VUY A;  4HPP A;  3RFZ B;  5GXG B;  2BT6 A;  2MJD A;  2V0G A;  5L83 A;  5HFY A;  2FID A;  2W82 A;  2LI5 A;  4HWI B;  3FC4 A;  1Q5W B;  4FJY A;  2KDF B;  4MDK E;  1V5T A;  1IP9 A;  5JH5 C;  4LLG M;  1V5O A;  1KH0 A;  2YEP B;  2JXX A;  4NAW B;  5G55 A;  2ZPY A;  1HEZ E;  2KMA A;  4EE2 A;  4YXD B;  3MC8 A;  4CQN A;  4C7Z A;  3Q8E A;  3UQB A;  4P1B C;  1WJU A;  3ZW3 A;  3NZS A;  3VFK A;  1V8C A;  3SFD B;  2IZV B;  2WXF A;  3AI5 A;  4QAY A;  3NVV A;  5G2N A;  3B2G A;  1VCB A;  2W54 A;  3TJP A;  3ZJT A;  1FNW A;  4LJO B;  2RR9 A;  2L0T A;  1ESF A;  3N1X C;  3R66 C;  4DHJ B;  3DBL I;  4MJS B;  3BVG A;  4FLH A;  3RYT A;  1WM3 A;  2LGX A;  4WQO B;  1AN8 A;  3DWG C;  2LGY A;  4MT5 A;  4A55 A;  1FIQ A;  2K22 A;  3ABV B;  3DVG Y;  2BYT A;  1L2N A;  1YD8 U;  2NS5 A;  2JWZ A;  2EKE C;  2CU1 A;  4I6P A;  4NAM A;  5BYS A;  3A4R A;  1IYF A;  3DVG X;  4HJK A;  3ZLZ A;  1YN5 A;  4HCP B;  2KMC A;  2G4S A;  3PRZ A;  3EC8 A;  1EWY C;  1EF1 A;  1R4N B;  2LUE A;  1QF6 A;  3Q3O C;  2I2Y A;  1P7F A;  3HUI A;  4KVG B;  2KVR A;  4N6E B;  4HKQ A;  3I3T B;  2MJ3 A;  2ZJD A;  2I1K A;  4BOS C;  1OTR B;  3VDZ A;  1V1P A;  1GNU A;  3EEC A;  3P4S B;  4KDI C;  1ZE3 D;  2JF5 A;  1YNT E;  2KX3 A;  4HDO A;  5E6N A;  3MFG A;  1E8Z A;  2KAC A;  3PRE A;  4N59 A;  2INN E;  2M0X A;  2LHD A;  5C2T B;  3RUI B;  2GLS A;  4YSX B;  4XE0 A;  4AOF A;  3PV1 A;  2O6V A;  4JL9 A;  1E8X A;  3HM3 A;  2MX2 A;  2A5U A;  2XBB C;  2KXJ A;  4DXG A;  1G6J A;  3AUL A;  2AQ3 B;  3ML9 A;  4OVZ A;  1PUT A;  4BKT A;  2QMT A;  3U30 A;  5CTR C;  2JZ3 B;  1AYF A;  2KTR A;  4HPM B;  4BAX A;  2D3G A;  1ET6 A;  4L1B A;  2UWQ A;  2N9P C;  3C19 A;  1JWU D;  1J0G A;  2UU7 A;  1WJ4 A;  5C1Z A;  2KFK A;  4YWG G;  1ZW7 A;  3RCZ A;  1SE4 A;  4KZ0 A;  1XD3 B;  5E6J A;  4C4V A;  2MHJ A;  4GSW A;  1OEY A;  1X1M A;  2NBW B;  1EUV B;  3TCA A;  1QOA A;  2L83 A;  3P42 A;  3AE6 B;  1N5W A;  2KWU B;  4PK1 A;  3M63 B;  1F2R I;  1GB1 A;  5D3D A;  3VRB B;  2PLP A;  2IO2 B;  1NEN B;  1I4H A;  2M17 A;  3Q2A C;  2DHZ A;  4HXD A;  1SGH A;  2ZNV C;  3A33 B;  4HVB A;  2VZK D;  4MEL A;  2BYF A;  2IBI B;  4G0N B;  1WGK A;  1BUI C;  4TUU A;  2BGF A;  4W9K A;  3EFC A;  1S1Q B;  2MBQ A;  1WXA A;  4B0M A;  1TYG B;  1ENF A;  4W9C A;  1F1H A;  3APC A;  1FCC C;  2WXM A;  1UZX B;  1RAX A;  1OFF A;  1L6V A;  1YX6 B;  2GB1 A;  1I7H A;  4M0W A;  1D6E C;  2B76 B;  4E3C A;  2KNB A;  2W3R A;  3S2A A;  1JWB D;  4EEW A;  4EZJ A;  3NHE B;  1FXA A;  4FJZ A;  4GDL A;  2RPQ A;  5JHA A;  1SBB B;  2Z59 B;  2YEP F;  1B1Z A;  2LGS A;  2KX0 A;  3NY5 A;  3DOW A;  3AMZ A;  3V61 A;  3B2F A;  1E10 A;  3VXW A;  3IAM 1;  2KZR A;  3P63 A;  1YQ4 B;  5IKC M;  3SEB A;  4K1R B;  3RZW C;  3BYT B;  2O2V B;  3A9K B;  1FNV A;  2RMM A;  2REX A;  2HTM E;  4EOY A;  2ASQ A;  3FIL B;  2NBV B;  3BK2 A;  1XXG A;  3ZNH B;  4YT0 B;  4II2 B;  1N62 A;  2L7R A;  3ZJV A;  1R4M I;  4K3B A;  1I4Q A;  1SIJ A;  2E3T A;  3ZTC A;  2RDH A;  2ZW0 A;  4WWP A;  3LDZ E;  4HDQ A;  3ZNZ B;  3FKY A;  2J0K A;  2K8B A;  1T0R C;  4GLS C;  1J8C A;  4E74 A;  1ZPS A;  3DHI C;  2KQ7 A;  2C7N B;  1GPX A;  1WWT A;  2BS2 B;  1EO6 A;  3H9D A;  3N1Z C;  4IWP A;  2WXI A;  4XGA B;  1M94 A;  1I4X A;  1V9J A;  1D5M C;  1TIF A;  3K9O B;  3W2D A;  3WAP A;  1F77 A;  4OVU A;  3AE3 B;  2EMS A;  3PZ7 A;  1AAR A;  2L52 A;  2ZPN A;  3JSV A;  4M02 A;  1WXM A;  4AWJ A;  2K8C A;  4ZRK A;  2HTH A;  4H2A A;  2LJI A;  5H8Y E;  3PRP B;  2NBU A;  3RNC C;  3UF8 A;  4WJQ A;  4UDU C;  2QIE B;  2G45 B;  4NJ6 A;  1WJN A;  2L00 B;  2NTT A;  5AZH A;  2MA9 B;  4LTU A;  1HZ6 A;  5FK9 C;  4C00 A;  1E6E B;  2DAF A;  1JW9 D;  2W3S A;  1TKG A;  2KQS A;  3MJW A;  3HHM A;  2KDM A;  5AEK B;  3U2S C;  3SR6 A;  2K1F A;  2QDF A;  4PYZ A;  4N58 A;  1N5X A;  1VR9 A;  2C60 A;  2KWD A;  3BZD B;  2IND C;  4JWS C;  4LJP B;  3VQI A;  2JVC A;  1JML A;  4JIO U;  2IPK D;  2DLB A;  2BKF A;  3Q69 A;  3HK0 A;  3LB8 C;  4MAC A;  3SHQ A;  5D7G A;  1KLG D;  2NPT A;  5LXI B;  1C4A A;  3GS2 A;  3QX1 A;  2I38 A;  5AZG A;  1YQ3 B;  1YN4 A;  2K6D B;  1YIW A;  2GBN A;  1TZO A;  1LXD A;  3KVF B;  1NI2 A;  3H8H A;  3PRM B;  3DVN V;  3ZIM A;  4FBJ B;  4HPL B;  1HTO A;  2PE9 A;  3PLV A;  1WXS A;  1WZ3 A;  1FPY A;  2DAJ A;  3BVZ A;  3BII D;  3LYY A;  1FNU A;  3AN1 A;  1SE3 A;  2BKR B;  4WJP A;  5G5G A;  1YJJ A;  5FKA C;  4IWQ A;  1CJE A;  4ANW A;  1V1O A;  4TKN A;  3DHH C;  3R2I A;  1FXT B;  3QJZ A;  3N30 A;  4HEA 1;  4K7U A;  4I6N B;  4RGM A;  1EM7 A;  2K6Q A;  3QA8 A;  2YVC A;  1KOT A;  2AQ1 B;  2Q5W D;  2EMT A;  2K9X A;  3EA6 A;  3WA0 A;  4NY0 A;  4R3D A;  1L7Y A;  4PS3 A;  5TR5 A;  1TS5 A;  1E8W A;  2JZZ A;  2WDR B;  1EWC A;  3NVW A;  4OZC A;  2AEH A;  1IUE A;  3IHP C;  1L4D B;  1NI3 A;  2N9E B;  1TJE A;  2D11 A;  2KYW A;  5CX3 A;  3Q3N C;  2AYO B;  1YJ1 A;  2HDE A;  4M8N A;  4REZ A;  2BWF A;  2CHZ A;  3DBR I;  4W9I A;  2JPH A;  2N9X A;  4S17 A;  2LD9 A;  4M01 A;  1ZOY B;  2RD0 A;  2KLC A;  4LNI A;  1VDV A;  5H92 C;  4G3X B;  1L5P A;  3H6N A;  5BYQ A;  1DYQ A;  3VUX A;  2WYQ A;  2MWS B;  1Y56 A;  3ENE A;  3Q3M C;  1E7P B;  1FEH A;  3Q3F A;  2RGF A;  2KJH B;  4B6W A;  4XWT A;  4FA6 A;  3V6E B;  4W9H A;  1UWX A;  3ZXV A;  4PS8 A;  5I4D A;  2QC8 A;  2PMV A;  4B0E A;  3NZ3 A;  1FFU A;  1D5Z C;  1QOB A;  3CWI A;  2J0M A;  4TV3 A;  1SB3 C;  2KC1 A;  3SFE B;  3QWZ B;  2FE8 A;  2ZVO A;  3P1M A;  2XEW A;  3VVW B;  4ZHP A;  1FCL A;  4YTP B;  2R61 A;  4PT5 A;  2M8S A;  2LMC A;  3NVY A;  1HQR D;  4RFB A;  4TMA B;  4C56 C;  3KUZ A;  2LVQ A;  1GB4 A;  2WU2 B;  1SEB D;  1N60 A;  3RN9 C;  2DBY A;  4KKI A;  3WAO A;  3ZUN A;  1F2R C;  5J18 A;  2KD0 A;  3M95 A;  1I4G A;  3KWV A;  4CO7 A;  3V62 A;  2AL6 A;  1QIL A;  3FAH A;  4MEM A;  1GOZ A;  1I42 A;  3Q3J A;  2DZI A;  4BBN C;  4MGK E;  2WXK A;  1WR1 A;  4DBG A;  1D4B A;  4XWW A;  4KZC A;  3N3K B;  2D2Q A;  4ITK A;  4O1N A;  2KJ6 A;  3LJ3 A;  3GZN B;  3UI3 A;  3H1U A;  4HRS A;  2JQR B;  5FR3 A;  2MRP A;  4FN2 A;  1YQB A;  4RGO S;  2MBO A;  4DHJ D;  4AJW A;  2Y5P A;  1V1P B;  4IWO A;  3W1S A;  3RT3 B;  2JU6 X;  1XCT L;  1L0Y B;  1OQY A;  3HIZ A;  4S0R A;  4IM0 A;  2VH2 A;  5D3I B;  1N63 A;  1TBE A;  4ARC A;  1C78 A;  1JRO A;  2KT7 A;  2NMQ A;  2O6V B;  3R3M A;  4IM3 A;  1LFD A;  4JWU C;  3L4P A;  2I1J A;  2FUG 1;  2ZNV B;  3APF A;  2LFI A;  3ZRF A;  2QCZ A;  2KTR B;  4BKS A;  4K7W A;  1PQS A;  4KIK A;  1CQV A;  4W9F A;  5J17 A;  3QIJ A;  4LK0 M;  3RNB C;  1WGG A;  3AE1 B;  1EF5 A;  5DPR A;  3W1Y A;  3P4Q B;  2KFK B;  1SF0 A;  2ACZ B;  3ZDM C;  1UF0 A;  3P4R B;  4US8 A;  1M4V A;  5D6J B;  4C4V B;  4LCD E;  3BWU D;  1ZDX A;  3VTW A;  4DXF A;  3D32 A;  2FCN A;  1V97 A;  2AL3 A;  3L08 A;  3PZD A;  1C79 A;  2PE6 B;  2E6X A;  2H89 B;  2K5P A;  2GBJ A;  1SSN A;  4PYU A;  3WCQ A;  1I4R A;  1LO5 D;  4HRO A;  4WWN A;  3JYU A;  2J52 A;  4GMV A;  2W9N A;  2DX5 B;  4YTM B;  2HD5 B;  3KLS X;  4DHZ E;  5GMV A;  1C4C A;  4X57 B;  3ZNI D;  1V49 A;  3MJ5 A;  4ACF A;  1TT5 B;  4XDD A;  2CS4 A;  2M56 B;  3AE7 B;  3TIX A;  1FD6 A;  1IGC A;  3I57 A;  1K53 A;  2KWC A;  2WNM A;  4B9K A;  4ZYN A;  4OW0 A;  1L6U A;  4J3O D;  3AB5 A;  1GG3 A;  2J42 A;  2LRW A;  3Q8F A;  1UNS A;  2KK8 A;  1MG8 A;  4M0W B;  1MFW A;  2NTS A;  3T9L A;  4C7Y A;  3ZTD A;  2INP E;  2BWE S;  2Y5B B;  1AWD A;  1P3Q U;  1WFY A;  1MI0 A;  5DPS A;  1BML C;  4RGT A;  1HXY D;  3ECI A;  2FUH B;  4GDL B;  2LXA A;  3HRD D;  2LEK A;  3NOB A;  4YSZ B;  2PW9 A;  2WP9 B;  3KYC D;  2LUM A;  1J7B A;  2LAS A;  4GU2 A;  3CST A;  3TEZ A;  4GGQ A;  4K3C A;  1CMX B;  3AE8 B;  2WXQ A;  4KGS A;  5EE0 A;  2GI9 A;  3AE4 B;  2MW5 A;  2CU3 A;  2RDG A;  1UH6 A;  2DYB A;  1E9M A;  3BIN A;  2XK5 A;  1JWA D;  3W5V B;  2JZP A;  3QAQ A;  1DOY A;  3IT6 B;  2UYZ B;  4ARI A;  5LLI A;  2KN4 A;  2ZCB A;  3PTF C;  2L32 A;  2LVP A;  4IC7 B;  1OEY J;  3DBH I;  3WAN A;  1DOX A;  1E7U A;  3W5U B;  4JQW C;  1TS4 A;  4K81 A;  1PDX A;  1P1A A;  2PVO D;  1SJH D;  2FCQ A;  1MHX A;  3DDC B;  2KN5 A;  3RNF C;  3JSV B;  4NNJ B;  1WYW B;  2L8J A;  3TEY A;  3SDL C;  1KLV A;  3A9J A;  2J0J A;  2WLB A;  1FFV A;  1KF6 B;  2WXN A;  2LRU A;  3A4S C;  4RCO A;  1T0S C;  1XLO A;  1UEL A;  2WX0 A;  2N7D A;  1T3Q A;  1XCQ L;  4M00 A;  3PO0 A;  2FCS A;  2D10 A;  2G1E A;  3Q6B A;  4CYE A;  4TQ1 A;  3NUH B;  4FHJ A;  3IAS 1;  4W9E A;  2JUO A;  3MHZ A;  2AWT A;  3VRA B;  2RDB C;  3U4E G;  3DBL B;  2DZK A;  2IO1 B;  3Q14 C;  4KX6 B;  3JVZ X;  3PHW B;  1WJ6 A;  1ROE A;  3PHX B;  1OQQ A;  4LDT B;  1HZ5 A;  1VLB A;  1ZXH A;  1UD7 A;  5EDS A;  1ZKH A;  3R7Q A;  3V6C B;  2A4Z A;  2W55 A;  2NVU I;  5HI1 A;  4FUL A;  4ANV A;  3AU5 A;  4ZRQ A;  2NPT B;  2N0S B;  2IY0 B;  4NJ7 A;  1UGJ A;  2CHW A;  2MCN B;  1AW7 A;  3TEX A;  4JX1 C;  4MM3 A;  2CJN A;  4JLC A;  2C7H A;  1K51 A;  4WJN A;  4HCN B;  2OJW A;  1P9D U;  3ZJU A;  5D2M B;  4USA A;  1BXT A;  2OJR A;  2N1W A;  2V3P A;  3T8M A;  4D2K A;  3RNG C;  1N6Z A;  4G11 A;  4BFR A;  1NYQ A;  1TY2 A;  1EU4 A;  2SAK A;  4P16 A;  4RF1 A;  3C0R B;  1T5X D;  4B95 A;  2KHW B;  2DYM A;  4IUM B;  1XQQ A;  2NCN A;  1V86 A;  3KYD D;  4DDG D;  2ZEQ A;  1E5W A;  3OWE B;  2CR5 A;  2N9K A;  2WXG A;  2L1A A;  2G4D B;  1GAQ B;  1HTQ A;  2ZZP B;  4WAA A;  1YMH E;  2GMI C;  4JGH B;  3ZVV A;  4EZL A;  2WDT B;  1PFD A;  3B9J A;  3QK0 A;  3APD A;  2N7J A;  2C5L C;  2WDQ B;  3DPD A;  1WYG A;  1L0V B;  4DHZ B;  4F8C B;  4RM9 A;  1XLN A;  5HG2 A;  3L13 A;  3QAR A;  2WGS A;  3N20 C;  4MGY E;  4KSK C;  2ON8 A;  5JXV A;  1R4N I;  3EGR A;  3V60 A;  2XNA C;  4HK2 A;  2GBM A;  1WGD A;  2QHO A;  4ZYS A;  5JHB A;  4ZHO A;  2M0A A;  3ZGZ A;  1KJT A;  5C3J B;  4A9A A;  4XC2 A;  1ZDV A;  2D3C A;  3KH0 A;  1JQ4 A;  4EFO A;  5DPW A;  3PPA A;  5IA7 A;  3KUC B;  3B1L X;  2YLM A;  2MP2 A;  3MC9 A;  4WUR A;  1UWM A;  2KLG A;  3I63 C;  2BYE A;  2WXO A;  5T8I A;  4BVU C;  1IBX A;  2ICI A;  4KGT A;  1MJD A;  1E0Z A;  3PVL A;  2HE7 A;  5E6P A;  3T3N A;  2WXJ A;  2ONQ A;  4EKU A;  1WH3 A;  4XX5 A;  2DZJ A;  3T3O A;  1SXT A;  3GOE A;  2GOW A;  4AJY B;  2WQY B;  2CJO A;  3IFW B;  1N61 A;  3N32 A;  3TL5 A;  2LVO A;  1YOV B;  5CHF A;  4FJV B;  2JT4 B;  3X23 A;  3ML8 A;  3L16 A;  2FBW B;  1RLF A;  3H7P A;  1RWS A;  3OAW A;  3TBL D;  1XLQ A;  1WX7 A;  3PGE A;  5LXH A;  4W9L A;  1EU3 A;  5IOI A;  3RPF C;  1YX5 B;  5E6O A;  2FAZ A;  4ICU A;  2RPV A;  1PYW D;  3AEC B;  3OLM D;  3TSS A;  1WMH A;  5AZF A;  3N1Y C;  5MPO A;  1WRI A;  2KOX A;  3IBE A;  3V05 A;  2IGG A;  1C9F A;  2IO3 B;  3AM9 A;  1TGZ B;  2EKI A;  4LNF A;  1WXV A;  1JWS D;  4AS1 A;  2NR2 A;  3N9Y C;  2IYD B;  2KC2 A;  3BY4 B;  2AX5 A;  4AUQ C;  1QOF A;  1U4A A;  1DOI A;  3WIM A;  2HJ8 A;  2X38 A;  2MBB B;  2BBC A;  1I4P A;  4IOI E;  2J7Q B;  5AUK A;  1HA5 A;  3W9C B;  3AE5 B;  1SE9 A;  4FHK A;  2KVZ A;  1UBQ A;  1RRB A;  3L10 B;  1OQR A;  4ZOH C;  2L3Z A;  3ETR A;  1ISN A;  1R4M B;  3P2B A;  3E9S A;  4A6Q A;  1RYJ A;  3SD5 A;  1TTN A;  2Y5C A;  1STE A;  1R7S A;  1L0X B;  2BTE A;  1Y8R C;  1KLU D;  4TSS A;  4NQK E;  2LZ6 A;  4OZA A;  4TQ0 A;  2KMM A;  3X0W A;  1IPG A;  1K8R B;  3ONS A;  2LGI A;  1FXI A;  3GE8 C;  4OHJ A;  1MHH E;  4RGN A;  3AEF B;  3A1Q A;  4LNO A;  4ZDV A;  3EFU A;  4XZ4 A;  1WSP A;  1E8Y A;  3DWM A;  4KIK B;  2WWZ A;  1JAL A;  1Q1O A;  1RFA A;  2PVG C;  3OJ3 A;  2Z0E B;  4WWM A;  3NS8 A;  2MEK A;  2BW2 A;  3ZRC A;  4JPS A;  1GUA B;  4RH6 A;  2WDV B;  3VTU A;  1P0R A;  3RZF A;  3U52 E;  2M4N A;  3M62 B;  1DGJ A;  2Y3A A;  1KTK A;  2BF8 B;  3QHT A;  3LXF A;  4KV2 A;  1LQB A;  3BK1 A;  5KHO A;  4KKJ A;  3HM6 X;  4ICV A;  3JW0 X;  2O6V D;  3L54 A;  1WX8 A;  2KO3 A;  1WE6 A;  4GB9 A;  1VZ8 A;  2FCM A;  4GDK A;  3BYY B;  3WAM A;  2IO0 B;  4DK5 A;  3ZYY X;  2BB6 A;  3DVN U;  1NBF C;  1Z5S B;  3NJT A;  3VTV A;  1CZP A;  1PGX A;  3O13 A;  2QIL A;  3QQ8 B;  4EZK A;  1C3T A;  2N7E A;  4WH4 A;  2LXC A;  1PGB A;  4J6I A;  2N4F A;  3PS6 A;  4W9G A;  3TMP B;  1WGH A;  2D3A A;  2KDI A;  4A90 A;  4WQM A;  1T0Q C;  3E56 A;  2ZW1 A;  3KQ4 A;  4FAD A;  1TS3 A;  4NAW A;  2WXR A;  1KM7 A;  3AU4 A;  2PKO A;  3W1S C;  3AV8 A;  5CHV C;  5L95 C;  1VD2 A;  4RNA A;  5EE3 A;  2JRI B;  2N9L A;  2JWU A;  2FIF A;  1TKY A;  3AED B;  1MPE A;  4A3P A;  3M3J A;  3AEE B;  4BBN F;  4A3O A;  1VRA B;  2MQJ A;  2L0F A;  4EUT A;  2N1V A;  2V4L A;  5TSS A;  1HE8 A;  1V80 A;  2C7M B;  2VH1 A;  1D3Z A;  2DWQ A;  4NJC A;  3MP9 A;  4MJS A;  4JE3 B;  4IDI A;  4MSQ B;  1T6B X;  3ZQ4 A;  1SJE D;  4L23 A;  5IP4 D;  2BS3 B;  1NVI D;  3MTN B;  5LNK 1;  3RNE C;  2JSV X;  3V3X A;  4IKG A;  5D94 A;  2Z0D B;  2GBK A;  4P1C C;  1QZE A;  3ZNG C;  2M19 A;  5BMI A;  4LNN A;  1YJI A;  3HVD A;  2ZCC A;  3UGB B;  1E90 A;  1FRD A;  1SE2 A;  2XK5 B;  2K0P A;  5FR6 A;  3IXS A;  1LGR A;  4NPN A;  2G9H D;  3Q8A A;  3DBR B;  4NZL B;  1JRU A;  4F7Z A;  2BS4 B;  3RUL A;  4C80 A;  2Z8L A;  1NDD A;  2KWV B;  1V2Y A;  2C9W B;  2WX1 A;  2INC C;  2BB5 A;  3NS1 A;  3CF6 E;  2KFJ A;  5EE9 A;  3GE3 C;  2B3A A;  2ZVN A;  1ZUD 2;  2V3S A;  1PGA A;  4KGR A;  2WS3 B;  2PEA A;  4URK A;  1H8C A;  1TZ1 A;  3URY A;  2V3N A;  4L2Y A;  3DCG A;  5CHW A;  3A9J B;  4MGI E;  4E71 A;  1A70 A;  3L17 A;  4FXC A;  5IAA C;  3VH4 B;  2CKH B;  3GP7 A;  3RMK C;  1J19 A;  4XDC A;  1LM8 B;  2QSD A;  1FMA D; 
#chains in the Genus database with same CATH homology
 5JZE B;  2CU1 A;  1WE7 A;  4I6P A;  3Q3F A;  4IUM B;  3A4R A;  1IYF A;  2RGF A;  3DVG X;  1XQQ A;  2KJH B;  4HJK A;  4B6W A;  3ZLZ A;  2NCN A;  1V86 A;  4FA6 A;  3KYD D;  4HCP B;  3V6E B;  4DDG D;  2ZEQ A;  5C23 A;  2L05 A;  4W9H A;  2KKC A;  2KMC A;  4HLE A;  1E5W A;  2G4S A;  3PRZ A;  2GBR A;  4PS8 A;  3EC8 A;  2CR5 A;  4A20 A;  1EF1 A;  2LUE A;  2MBH A;  2G4D B;  4F1S A;  2ZZP B;  4KVG B;  2KVR A;  1WGR A;  4WAA A;  2J0M A;  4MGZ E;  2IY1 B;  3I3T B;  4TV3 A;  5DPT A;  2GMI C;  2G3Q B;  2KC1 A;  2ZJD A;  3QWZ B;  2LJ5 A;  1UGM A;  2I1K A;  4BOS C;  1OTR B;  1WGY A;  4JGH B;  2ZVO A;  3VDZ A;  1GNU A;  4G50 A;  2WDT B;  3ZVV A;  4EZL A;  3EEC A;  2XEW A;  4I6L B;  4KDI C;  3VVW B;  4W9D A;  2JF5 A;  3QK0 A;  2KX3 A;  4HDO A;  4DDI D;  3APD A;  5E6N A;  1OGW A;  1E8Z A;  4ZRJ A;  2C5L C;  2M8S A;  3DPD A;  3PRE A;  4DWF A;  3ALB A;  4DHZ B;  2M0X A;  2KAN A;  4F8C B;  4RM9 A;  3KUZ A;  3L13 A;  2LVQ A;  3QAR A;  3RUI B;  1WF9 A;  2RSU A;  3RD2 A;  4MGY E;  4KSK C;  4AOF A;  3PV1 A;  2O6V A;  1R4N I;  4JL9 A;  3V60 A;  4HK2 A;  2GBM A;  1E8X A;  2OOB B;  2MX2 A;  3HM3 A;  2A5U A;  1WGD A;  2QHO A;  3WAO A;  2XBB C;  3ZUN A;  2KXJ A;  4CHK A;  1G6J A;  3AUL A;  3ML9 A;  5JHB A;  5J18 A;  2KD0 A;  3M95 A;  4BKT A;  1KJT A;  3QCA A;  4CO7 A;  4XC2 A;  5BO4 B;  3V62 A;  3U30 A;  2AL6 A;  5CTR C;  2JZ3 B;  2KTR A;  4HPM B;  3KH0 A;  4IG7 B;  4LDT D;  4EFO A;  5DPW A;  3EHV A;  3PPA A;  2D3G A;  4MEM A;  5IA7 A;  1I42 A;  3KUC B;  3Q3J A;  2DZI A;  4BBN C;  4MGK E;  2UWQ A;  2N9P C;  3B1L X;  2YLM A;  2MP2 A;  1WR1 A;  2KLG A;  1J0G A;  4DBG A;  3B08 A;  1WJ4 A;  2BYE A;  4BVU C;  5C1Z A;  2K39 A;  4KZC A;  2KFK A;  3N3K B;  2D2Q A;  2JY6 A;  1ZW7 A;  2HE7 A;  2KJ6 A;  3LJ3 A;  3PVL A;  5E6P A;  3RCZ A;  4KZ0 A;  1XD3 B;  3H1U A;  4EKU A;  1WH3 A;  4XX5 A;  2DZJ A;  4GSW A;  1OEY A;  1X1M A;  2NBW B;  3GOE A;  2MRP A;  5DCN A;  4FN2 A;  1YQB A;  4AP4 C;  1EUV B;  2GOW A;  2KDE B;  3UIP B;  4BOZ B;  2MBO A;  3TCA A;  4AJY B;  4BKG A;  4DHJ D;  4AJW A;  3IFW B;  3N32 A;  3TL5 A;  3MHS D;  3B0A A;  2BPS A;  2LVO A;  3IG3 A;  2R2O A;  3CSF A;  2KWU B;  5CHF A;  2PJH A;  4IWO A;  3W1S A;  3RT3 B;  3M63 B;  4FJV B;  3KW5 B;  1GC7 A;  2JT4 B;  3X23 A;  3ML8 A;  1OQY A;  3HIZ A;  3L16 A;  4IM0 A;  3UQA A;  2IO2 B;  1RLF A;  3H7P A;  4KDL B;  3OAW A;  3TBL D;  3ZKJ C;  2M17 A;  1TBE A;  1WX7 A;  2DHZ A;  3PGE A;  5LXH A;  4HXD A;  5KHQ A;  4W9L A;  1SGH A;  2O2V A;  2ZNV C;  3A33 B;  4HVB A;  3A9K A;  2O6V B;  1YX5 B;  5E6O A;  2FAZ A;  3R3M A;  4MEL A;  3GZN I;  3VH3 B;  2BYF A;  4IM3 A;  1LFD A;  4ICU A;  2PPH A;  2IBI B;  4NQL B;  4OVV A;  4G0N B;  4PS7 A;  3U7D A;  1ZGU B;  4TUU A;  2BGF A;  2I1J A;  3OLM D;  2KTF A;  4W9K A;  1WR6 E;  4N9F 4;  2ZNV B;  1S1Q B;  1WMH A;  1WXA A;  2MBE A;  2MBQ A;  5AZF A;  3APF A;  3ZRF A;  4W9C A;  2KTR B;  4BKS A;  4K7W A;  1PQS A;  2KOX A;  3APC A;  3IBE A;  4KIK A;  1V81 A;  2JRH A;  2D07 B;  4W9F A;  2M1M A;  2IO3 B;  5J17 A;  1TGZ B;  3QIJ A;  1UZX B;  4WWO A;  1RAX A;  1WGG A;  2MP2 B;  3ZO5 B;  1EF5 A;  3VUW A;  1WXV A;  5DPR A;  3WAL A;  3NZU A;  3W1Y A;  1YX6 B;  2NR2 A;  4W9J A;  2K8H A;  2KFK B;  2IYD B;  2KC2 A;  3BY4 B;  4AUQ C;  3ZDM C;  1U4A A;  4RMA A;  4E3C A;  1UBI A;  3WIM A;  1GJZ A;  5D6J B;  2HJ8 A;  2KNB A;  3S2A A;  4LCD E;  3H7S A;  4ZRI A;  2MBB B;  3VTW A;  4EEW A;  2J7Q B;  4EZJ A;  3NHE B;  3D32 A;  1SE9 A;  4FHK A;  2FCN A;  4FJZ A;  4M8M A;  1UBQ A;  1RRB A;  3L10 B;  4GDL A;  2RPQ A;  1V6E A;  5JHA A;  2Z59 B;  2L3Z A;  2AL3 A;  2KX0 A;  1ISN A;  3NY5 A;  3P2B A;  3L08 A;  3DOW A;  3PZD A;  3ENE A;  3SD5 A;  1TTN A;  1WZ0 A;  2PE6 B;  1P98 A;  1Q0W B;  4E71 A;  3V61 A;  2FNJ B;  3VXW A;  1Y8R C;  1S3S G;  2GBJ A;  4PYU A;  3R7R A;  2KZR A;  4ANX A;  4NQK E;  3H7P B;  1BT0 A;  2LZ6 A;  1WY8 A;  4TQ0 A;  4WWN A;  4K1R B;  3RZW C;  3JYU A;  3X0W A;  2O2V B;  4GMV A;  3A9K B;  2W9N A;  2KJR A;  2DX5 B;  1IPG A;  1E7V A;  2REX A;  1K8R B;  2HD5 B;  3ONS A;  4DHZ E;  5GMV A;  3ZNI D;  4X57 B;  1SIF A;  1V49 A;  4EOY A;  2ASQ A;  4GOC A;  3OJ4 B;  2NBV B;  2CS4 A;  4IW0 A;  3TIX A;  3A1Q A;  4MH0 E;  1WMH B;  3ZNH B;  3DQV A;  4ZDV A;  3EFU A;  4XZ4 A;  4II2 B;  4YL8 A;  2KWC A;  1E8Y A;  2L7R A;  4KIK B;  4B9K A;  2WWZ A;  1R4M I;  2V1Y A;  3ZTC A;  4WWP A;  1Q1O A;  1RFA A;  3OJ3 A;  2Z0E B;  4ZYN A;  3NS8 A;  3LDZ E;  4HDQ A;  3ZNZ B;  1GG3 A;  2LRW A;  3ZRC A;  1GUA B;  2J0K A;  3L0W B;  2KK8 A;  3VTU A;  1P0R A;  2K8B A;  1MG8 A;  4M0W B;  3RZF A;  3T9L A;  1J8C A;  3ZTD A;  1A5R A;  2M4N A;  2BWE S;  3UIN B;  4E74 A;  2Y5B B;  1P3Q U;  3M62 B;  3PLU A;  1WFY A;  1WI0 A;  4RM8 A;  1H4R A;  2BF8 B;  2KQ7 A;  2C7N B;  3KUD B;  5DPS A;  1F9J A;  3QHT A;  1EO6 A;  1T0Y A;  3ECI A;  2FUH B;  3H9D A;  5HKH A;  1WIA A;  2MSE D;  4GDL B;  4KV2 A;  1LQB A;  4IWP A;  5KHO A;  1M94 A;  2LXA A;  1V9J A;  3HM6 X;  4ICV A;  3JW0 X;  3ZDT A;  2O6V D;  3K9O B;  3NOB A;  3WAP A;  3L54 A;  1WX8 A;  2KO3 A;  1WE6 A;  4GB9 A;  3KYC D;  4OVU A;  2FCM A;  4GDK A;  2EMS A;  1I35 A;  1AAR A;  3JSV A;  2ZPN A;  1WXM A;  4AWJ A;  3IVF A;  4II3 B;  3WAM A;  2LAS A;  2K8C A;  2IO0 B;  4GU2 A;  4DK5 A;  4ZRK A;  2HTH A;  4DXA B;  3CST A;  3DVN U;  1NBF C;  1Z5S B;  2DZM A;  3PRP B;  3VTV A;  3PSE B;  4GGQ A;  3UIO B;  2NBU A;  1CMX B;  3UF8 A;  3CMM B;  4WJQ A;  1XT9 B;  4WJO A;  2G45 B;  4NJ6 A;  1WJN A;  3QQ8 B;  2L00 B;  5AZH A;  2MA9 B;  2MW5 A;  4EZK A;  4GIV A;  2CHX A;  1C3T A;  2N7E A;  2DAF A;  2LXC A;  1UH6 A;  2KQS A;  1C1Y B;  2DYB A;  4J6I A;  3MJW A;  3A1Q B;  4ASW C;  3HHM A;  2R2Q A;  3BIN A;  2N4F A;  3PS6 A;  4K7S A;  2L76 A;  4W9G A;  2XK5 A;  3TMP B;  5AEK B;  2K1F A;  4PYZ A;  5J2R A;  4GN1 A;  2K25 A;  2C60 A;  1WGH A;  3QAQ A;  2DYO A;  2BYV E;  2KDI A;  2UYZ B;  1WX9 A;  2LGD A;  3PT2 B;  1GC6 A;  4FAD A;  4LJP B;  2LWP A;  3VQI A;  2JVC A;  5LLI A;  2ZCB A;  4NAW A;  4JIO U;  3SU8 X;  2BKF A;  1KM7 A;  3PTF C;  4KSL C;  3AU4 A;  3W1S C;  3HK0 A;  2LVP A;  4IC7 B;  1OEY J;  3SHQ A;  3DBH I;  5CHV C;  3WAN A;  1E7U A;  5D7G A;  5L95 C;  1VD2 A;  2JRI B;  2NPT A;  4JQW C;  5LXI B;  2VRR B;  3QC8 B;  3K9P B;  1WM2 A;  3DBS A;  3QX1 A;  4K81 A;  2FIF A;  5AZG A;  4ANU A;  1P1A A;  4A3P A;  3M3J A;  4BBN F;  2FCQ A;  3DDC B;  4A3O A;  2MQJ A;  4GXB A;  2K6D B;  1YIW A;  2KN5 A;  2L0F A;  3VAW A;  4EUT A;  4GDK B;  2N1V A;  2V4L A;  2GBN A;  1HE8 A;  1V80 A;  2C7M B;  3JSV B;  1WYW B;  1LXD A;  2L8J A;  3KVF B;  1NI2 A;  4NNJ B;  3U8Z A;  3PRM B;  4FBJ B;  3DVN V;  3ZIM A;  1D3Z A;  4MJS A;  3SDL C;  1KLV A;  3A9J A;  4HPL B;  2J0J A;  2KDB A;  1WRD B;  2PE9 A;  4MSQ B;  4P7I A;  3PLV A;  4BKS D;  1WXS A;  2LRU A;  3A4S C;  1WZ3 A;  1Z2M A;  2DAJ A;  4MSM B;  3AXC A;  1UEL A;  2WX0 A;  3VHT C;  2N7D A;  2DEN B;  2BKR B;  4WJP A;  2MLB A;  2FCS A;  4IM2 A;  3O65 B;  3MTN B;  5D94 A;  4IWQ A;  2D10 A;  3VUY A;  2Z0D B;  2GBK A;  1QZE A;  3ZNG C;  4CYE A;  4ANW A;  4TQ1 A;  4FHJ A;  5L83 A;  4TKN A;  2FID A;  2LI5 A;  4HWI B;  1FXT B;  2ZCC A;  1Q5W B;  1E90 A;  2XK5 B;  4W9E A;  4FJY A;  3UGB B;  2KDF B;  3QJZ A;  2JUO A;  4MDK E;  1V5T A;  3N30 A;  2AWT A;  5FR6 A;  4K7U A;  1IP9 A;  5JH5 C;  4I6N B;  2DZK A;  2K6Q A;  3QA8 A;  2IO1 B;  1V5O A;  3JVZ X;  4NPN A;  2JXX A;  2YVC A;  3PHW B;  4NAW B;  5G55 A;  1WJ6 A;  1KOT A;  2ZPY A;  2KMA A;  1JRU A;  3PHX B;  4LDT B;  4F7Z A;  3RUL A;  2EMT A;  1UD7 A;  5EDS A;  1ZKH A;  3R7Q A;  3V6C B;  3WA0 A;  2A4Z A;  2NVU I;  1NDD A;  3UQB A;  2KWV B;  1V2Y A;  4NY0 A;  1L7Y A;  2C9W B;  4FUL A;  1WJU A;  3AU5 A;  4ANV A;  3ZW3 A;  3NZS A;  4PS3 A;  2WX1 A;  2NPT B;  3VFK A;  5TR5 A;  2IY0 B;  2IZV B;  3AI5 A;  3CF6 E;  2KFJ A;  4NJ7 A;  1E8W A;  2CHW A;  2MCN B;  2JZZ A;  2B3A A;  2ZVN A;  4MM3 A;  4JLC A;  5G2N A;  2V3S A;  1VCB A;  2C7H A;  4WJN A;  3TJP A;  2PEA A;  4HCN B;  4URK A;  1P9D U;  2AEH A;  1H8C A;  5D2M B;  3IHP C;  4LJO B;  2RR9 A;  2N9E B;  1TZ1 A;  2N1W A;  2OJR A;  2D11 A;  2L0T A;  5CX3 A;  3T8M A;  4DHJ B;  3DCG A;  3R66 C;  3DBL I;  4MJS B;  5CHW A;  4FLH A;  3A9J B;  3RYT A;  2AYO B;  1YJ1 A;  1WM3 A;  2LGX A;  4M8N A;  4MGI E;  2BWF A;  2CHZ A;  3DBR I;  3L17 A;  4W9I A;  2JPH A;  2N9X A;  4G11 A;  4WQO B;  4BFR A;  2LD9 A;  5IAA C;  3VH4 B;  2CKH B;  2LGY A;  2RD0 A;  2KLC A;  4G3X B;  3H6N A;  3C0R B;  3VUX A;  1J19 A;  2WYQ A;  4B95 A;  1LM8 B;  3DVG Y;  1L2N A;  1YD8 U;  2MWS B;  2KHW B;  2DYM A;  2NS5 A;  2JWZ A;  2EKE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...