2KKCA

Nmr structure of the p62 pb1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
HMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
publication title The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kkcA00
3RT3B 3IBEA 1EO6A 5AZFA 3ZDTA 5IAAC 4DHZE 1R4NI 2IO0B 1E7VA 4P7IA 1H8CA 2KFKA 4HCPB 4HPMB 4M8MA 1J0GA 4CHKA 3LDZE 4W9CA 4JLCA 3WAOA 2LVPA 4DHZB 1WZ0A 2JY6A 4HK2A 3VUYA 4JIOU 1Q1OA 3DVGX 2BYFA 2I1KA 4PYZA 2JRHA 2RD0A 2BPSA 4TKNA 2ZNVB 3PTFC 2V4LA 3QAQA 4BBNC 3HK0A 2GBJA 2NCNA 3BY4B 4M8NA 3QA8A 3T9LA 4GDLA 3TL5A 4KZ0A 4FLHA 3V60A 3PHWB 4RMAA 2FCMA 2KLCA 3IFWB 5GMVA 2M0XA 3EC8A 3PRPB 4B9KA 4F1SA 2LD9A 4DHJB 3MJWA 3WANA 2KD0A 3A9KA 4MGYE 2WX1A 1WXVA 2CHWA 2REXA 4WWPA 3U30A 4I6LB 4ANWA 4KIKB 1TZ1A 3APCA 1HE8A 1GC6A 2V3SA 3JYUA 4E71A 2CHZA 3H6NA 2NVUI 2KJRA 3PGEA 3W1YA 4IUMB 5IA7A 4BKTA 3H7PB 3KUDB 4MJSB 5HKHA 1E5WA 1WGGA 4FULA 3U7DA 1LQBA 3D32A 3IVFA 1H4RA 2D07B 3MHSD 3PREA 4W9DA 3IHPC 2L00B 4BBNF 2O6VD 1UBQA 3RUIB 3N32A 3PLUA 4KDLB 3N3KB 2FUHB 3L10B 1S3SG 1UELA 1WJ6A 2KFJA 2MBHA 2NR2A 2NPTA 2R2QA 3PS6A 1KJTA 2MBOA 3BINA 4FHJA 4GMVA 4LDTD 5E6OA 3VH4B 2W9NA 3W1SC 4DDGD 3HIZA 5D7GA 2V1YA 2EKEC 2DX5B 4WJOA 4PYUA 2DZIA 2LGXA 2C5LC 3L16A 2C60A 3H7SA 5LXHA 4G3XB 3QJZA 4GDKA 4HDQA 3ZLZA 3L54A 3QCAA 2KDBA 5DPSA 1TGZB 2DYBA 2O2VA 2XBBC 1P98A 4W9GA 3VAWA 2O6VB 3VTVA 4AUQC 4DK5A 1U4AA 3APDA 2LWPA 2G45B 1ISNA 4N9F4 4HLEA 1RRBA 3SD5A 3L08A 4IWPA 2LVQA 3L17A 4G11A 5DPWA 3B08A 2KNBA 2KTRA 2M8SA 4FJZA 1K8RB 3R7RA 1BT0A 4LDTB 4KVGB 4A3PA 2NBWB 2RSUA 4WQOB 4AP4C 4GB9A 1V80A 2DENB 2EMTA 3R66C 1WE7A 4HCNB 2JVCA 4MM3A 2MW5A 3OLMD 2J0KA 4KSKC 2AYOB 3WIMA 4WJQA 3GOEA 2KQSA 2PPHA 2WWZA 2M4NA 4KIKA 4XX5A 2IO2B 5CHFA 3WALA 3AXCA 1WX8A 3SU8X 5D2MB 3TBLD 2BGFA 1Q0WB 3Q3FA 4IM3A 3H7PA 2JXXA 5BO4B 2XK5A 1Z5SB 4BKSA 2WDTB 1G6JA 1WGYA 2K6QA 2LVOA 4JGHB 1P3QU 3UF8A 2MBQA 1D3ZA 3VDZA 2G3QB 2L3ZA 1MG8A 4ANUA 2N7DA 4CO7A 1WZ3A 2KZRA 2N4FA 3M62B 3X0WA 3I3TB 2KVRA 1LFDA 3KYDD 3PRZA 4GXBA 2N1WA 3KH0A 1L7YA 3DBHI 3EHVA 4WJNA 5G55A 1WF9A 1WRDB 2Z59B 4W9KA 4JQWC 4W9FA 4TQ0A 4RM8A 2JF5A 1YIWA 2KJHB 2R2OA 3VTUA 3CSTA 3VFKA 3B1LX 2KC1A 3HHMA 1Y8RC 3JW0X 1F9JA 4M0WB 3UGBB 4E3CA 3JVZX 2BKFA 3PRMB 3V62A 3PZDA 4OVUA 1WE6A 1KLVA 2PEAA 1GC7A 1P9DU 2LGYA 1XQQA 1RAXA 1YD8U 2LASA 4A3OA 4LJPB 3CMMB 1AARA 2OJRA 3B0AA 3H1UA 3K9PB 1OQYA 2BF8B 2K1FA 1WR6E 2K39A 4TQ1A 2ZVNA 5C23A 2L0FA 1X1MA 2EMSA 2KO3A 3QC8B 1KOTA 2LZ6A 2N9XA 3PPAA 3UQAA 3ZRFA 2MBEA 3CSFA 5TR5A 2ZPYA 5D94A 1IYFA 2KKCA 4EOYA 4IG7B 4EEWA 4MGIE 4TUUA 3QIJA 4I6NB 5AZGA 2UWQA 4IW0A 3RULA 4HWIB 1V9JA 4DHJD 1WR1A 4KV2A 3ZVVA 2LUEA 4YL8A 1XD3B 1WYWB 3ZIMA 1UD7A 3R3MA 2KWVB 3DCGA 5DPTA 1Z2MA 3ZDMC 4MELA 3ZNZB 2HJ8A 2YLMA 5LXIB 1C3TA 1CMXB 4NJ6A 2DAFA 2K6DB 1R4MI 2MA9B 3PV1A 4ASWC 5DPRA 3NOBA 3NY5A 4DBGA 4FJVB 1RLFA 4F7ZA 2KLGA 1LXDA 3IG3A 3QK0A 1OTRB 4W9JA 3UINB 2AEHA 4AWJA 2JWZA 3H9DA 1WMHB 3SDLC 4KDIC 4MDKE 1V2YA 1OGWA 2YVCA 2N9PC 3NS8A 2JPHA 3TMPB 2IYDB 4K7WA 1P0RA 1M94A 2LGDA 1WGRA 4GN1A 2OOBB 4MGKE 2MCNB 3ENEA 3OJ3A 1RFAA 3KUZA 4B6WA 3Q3JA 5L83A 4ZRJA 4K7UA 2ZPNA 3M3JA 2KX0A 1S1QB 5E6PA 4ICVA 4W9LA 3A9JB 5JHAA 4DWFA 1WJNA 2IO3B 1VCBA 3AULA 2IY1B 4WJPA 3TJPA 4DDID 2IZVB 3WAMA 1V5OA 2BKRB 2GMIC 2Y5BB 4GOCA 4II3B 4J6IA 4F8CB 4II2B 3JSVB 3V6CB 4NQKE 3WA0A 4DXAB 5DCNA 2KN5A 3M63B 5JZEB 1YX5B 2WX0A 2ZZPB 4WAAA 1E8YA 2NBUA 2ZVOA 3PSEB 3NZUA 3V6EB 1EUVB 3K9OB 4ICUA 4OVVA 3A4SC 2KFKB 1GUAB 2Z0DB 3ZO5B 3ZW3A 4ZYNA 2GBNA 3KYCD 2K8BA 2NS5A 2L0TA 2QHOA 2AWTA 2N1VA 3RZFA 4CYEA 2KANA 2MLBA 1FXTB 4GIVA 1WXAA 2KDFB 1TBEA 2L8JA 3M95A 4NJ7A 3UIOB 3PLVA 5C1ZA 4MJSA 4GDLB 4G0NB 2D3GA 3W1SA 3DDCB 2G4DB 2PJHA 2GBKA 2DZKA 2XEWA 2G4SA 4KZCA 3ML9A 3QARA 2C7NB 2M17A 3A9KB 4ZRKA 1NI2A 3ZNGC 1WJ4A 3ECIA 3NZSA 5JH5C 5G2NA 4ANVA 1V6EA 4FN2A 2RR9A 2ZEQA 3DVNU 1E7UA 1I42A 1WIAA 3DQVA 4NAWB 1J19A 3AU5A 2J0MA 2CR5A 2KDEB 1E8WA 1V86A 2FCQA 2HTHA 3EFUA 5FR6A 4BFRA 3TCAA 4XZ4A 4MGZE 1WFYA 4BKGA 3DPDA 3PHXB 4A20A 4HVBA 2FIDA 2WYQA 2IO1B 3VTWA 4K81A 3OJ4B 4PS7A 2FCNA 2JZ3B 1EF1A 1WX7A 1Q5WB 2A5UA 4IC7B 3VQIA 1YQBA 3WAPA 1L2NA 2O6VA 1UBIA 3DBSA 2K8CA 1NDDA 2KXJA 2DAJA 3A33B 3ZNHB 2AL3A 2RPQA 4XC2A 3V61A 2AL6A 2BWFA 3JSVA 2C7MB 3OAWA 3T8MA 2CKHB 2KX3A 1I35A 1EF5A 2FCSA 2MP2B 4MEMA 3ZRCA 1TTNA 5CHVC 3L0WB 5CX3A 2CS4A 2KTFA 2L05A 4GDKB 3P2BA 1UZXB 4HJKA 5J17A 2O2VB 1WM2A 1UGMA 3MTNB 4FA6A 1E8XA 3HM3A 4FHKA 2J0JA 5D6JB 3X23A 4BKSD 2FIFA 5J18A 4PS3A 4B95A 1E90A 1J8CA 4G50A 2HE7A 3APFA 2KQ7A 1OEYA 2KTRB 1WH3A 1KM7A 4AOFA 3VH3B 2DHZA 5JHBA 2J7QB 3A1QB 3DVGY 4K1RB 4FADA 3RYTA 4LJOB 2JZZA 2CHXA 1GNUA 3LJ3A 3S2AA 1SGHA 2FAZA 1WI0A 2ZNVC 3DBRI 2LRUA 1LM8B 1QZEA 2MQJA 4AJYB 1VD2A 2K25A 4RM9A 4IWQA 3ZUNA 2GBMA 3QQ8B 2JUOA 3RZWC 1V49A 4NAWA 4ZDVA 2ZCBA 2DYOA 2N7EA 2RGFA 4NNJB 1SE9A 1JRUA 2I1JA 2DZJA 3QX1A 1C1YB 2XK5B 2MX2A 2KWUB 3KVFB 3DVNV 4MSQB 3QWZB 3VUXA 2DZMA 2M1MA 2MSED 3ML8A 5KHQA 4EZLA 1V5TA 4BVUC 5AEKB 3VXWA 1XT9B 2KDIA 3DBLI 3N30A 4NQLB 1WY8A 2KC2A 2KMCA 4AJWA 4EZKA 2PE6B 3C0RB 1IP9A 2CU1A 4K7SA 1WX9A 3L13A 4EKUA 2MRPA 4NPNA 2D10A 2L76A 2HD5B 3PT2B 3SHQA 2KMAA 4HPLB 2MWSB 1E8ZA 1UH6A 2LXAA 2ASQA 3QHTA 2KHWB 2MP2A 4GU2A 1ZW7A 3PVLA 4BOZB 2LJ5A 2BYEA 5AZHA 2MBBB 4FJYA 3UIPB 3ZKJC 2IY0B 1ZGUB 3ZTDA 4W9EA 3DOWA 2ZJDA 3VUWA 2KWCA 4GGQA 3AU4A 1YX6B 1A5RA 1YJ1A 3ONSA 3A4RA 3EECA 2KJ6A 3HM6X 4E74A 3R7QA 1V81A 1WM3A 1GG3A 2Z0EB 1SIFA 4MH0E 1IPGA 3RCZA 2JRIB 4KSLC 5LLIA 2UYZB 5EDSA 3A1QA 2BYVE 1T0YA 2L7RA 3KW5B 3NHEB 2LI5A 1WXMA 2C9WB 2DYMA 1P1AA 2ZCCA 4WWOA 1PQSA 1OEYJ 3RD2A 2LXCA 5CHWA 1WMHA 4WWNA 3ALBA 3VHTC 1NBFC 4JL9A 4MSMB 2FNJB 3GZNI 2JT4B 4W9HA 5E6NA 4NY0A 4TV3A 4EUTA 3O65B 5J2RA 4IM2A 4URKA 4X57B 2BWES 2NBVB 5CTRC 4ANXA 5L95C 2D2QA 2LRWA 4BOSC 3ZNID 3KUCB 4GSWA 4IM0A 2VRRB 2PE9A 4PS8A 4HDOA 3A9JA 2C7HA 2KK8A 4LCDE 2IBIB 3U8ZA 3UQBA 3CF6E 3VVWB 3ZTCA 4FBJB 4EZJA 4EFOA 2D11A 1WXSA 1WGDA 1ZKHA 2K8HA 2NPTB 3AI5A 2GOWA 4IWOA 4ZRIA 2N9EB 2KOXA 4HXDA 1WJUA 2GBRA 1GJZA 4W9IA 5KHOA 2A4ZA 2B3AA 1WGHA 4I6PA 3TIXA
chains in the Genus database with same CATH superfamily
4XGAB 5EE0A 5IAAC 1EWYC 1E7VA 2IO0B 3TSSA 2PMVA 1J0GA 3WAOA 1DOXA 1Q1OA 2K22A 4PYZA 2RD0A 2M19A 3DHGC 4TKNA 4YWGG 4USAA 3T9LA 2KLCA 2KAJA 5IO9A 3GE8C 4MGYE 4WWPA 2REXA 1VRAB 1IBXB 4ANWA 4KIKB 3JYUA 2CHZA 2WLBA 5FKAC 5IA7A 2JXTA 1E5WA 5HKHA 3Q3OC 1FNWA 3PREA 3RUIB 3UI3A 1FRRA 4A8XC 1HXYD 4RCOA 4TMAB 5E6OA 3HIZA 4PYUA 2LGXA 3MJ5A 4XYCA 5LXHA 4HDQA 3QCAA 3VR8B 2KDBA 2HJ1A 2O2VA 1P98A 4W9GA 3VAWA 1K53A 1N5WA 2O6VB 4DK5A 2LWPA 2X38A 3SD5A 4FXCA 3B9JA 3L17A 3B08A 3MP9A 4FJZA 4LDTB 4WQOB 1Y56A 4AP4C 2QIEB 3RN9C 2RPVA 2EMTA 3R66C 3GZNB 4KSKC 1RFKA 3WIMA 2WWZA 4HROA 2N0SB 3ABVB 5D2MB 1Q0WB 2WDTB 2K6QA 5FR3A 3UF8A 2G3QB 1QF6A 2LUMA 3AEDB 2BTEA 2WNMA 4GXBA 3KH0A 2KMMA 2Z59B 4TQ0A 4RM8A 3CSTA 3VFKA 4ACFA 1P7EA 2KC1A 3Q69A 1F9JA 4M0WB 3JVZX 3U7ZA 3PRMB 3V62A 1F1HA 4YSXB 1QLBB 1KLVA 2PEAA 1TS2A 2K0PA 2LGYA 2MEKA 1XQQA 4K3CA 5BMHA 3CMMB 3B0AA 5AUIA 1OQYA 2K1FA 4Q2JA 4TQ1A 2ZVNA 5IOIA 2OEDA 2KO3A 3QC8B 2LZ6A 3CSFA 5TR5A 5D94A 1IYFA 1F2RC 4IG7B 1PFDA 3QIJA 4IW0A 5HG2A 4HWIB 1R4MB 2VZKB 2V3PA 4YL8A 1XD3B 3U52E 3R3MA 2KYWA 4MELA 5IN7A 3VRAB 1C3TA 5C3JB 2JU6X 1T3QA 4J3OD 4IOIE 5DPRA 3NY5A 1AWDA 1SB3C 1MHHE 2LJIA 3IG3A 3RFZB 2JYEA 2JWZA 2K9XA 4MDKE 5E6JA 4MACA 2IYDB 1P0RA 2Y5PA 3AEGB 3ENEA 3OJ3A 1RFAA 4B6WA 4WAFA 3SR6A 3I57A 1WJNA 1QOBA 3BWUD 1YMHE 3AULA 4YTMB 4WJPA 3TJPA 2IZVB 4GOCA 1ZPSA 3V6CB 2KN5A 2MH7A 4US9A 1D6EC 5JZEB 2WX0A 1E8YA 3PSEB 3NZUA 1EUVB 4OVVA 2JQRB 3A4SC 1GUAB 3ZW3A 1GPXA 4ZYNA 1AW7A 2WXRA 2K8BA 1IBXA 2AWTA 2N1VA 3RZFA 1MG4A 1WXAA 1TBEA 3TEWA 2G9HD 4PT5A 3TUOA 3DDCB 3MC9A 2W54A 4YXDB 2XEWA 3HVZA 3P4RB 1MPEA 2DBYA 3QARA 2C7NB 1JWUD 3A9KB 1EM7A 3ECIA 3NZSA 2RR9A 1JROA 2BT6A 4ZOHC 2KDEB 3AH7A 2HTHA 4BFRA 3P63A 4MGZE 1WFYA 4BKGA 3DPDA 3EFCA 1WX7A 1Q5WB 4IC7B 2O6VA 1HQRD 3O13A 2K8CA 1PUTA 2DAJA 3A33B 2RPQA 1C78A 2E6XA 2C7MB 2CKHB 2KX3A 5JXVA 4K3BA 3ZRCA 3L0WB 1TKYA 2LGSA 3P2BA 1UZXB 3L4PA 4XDCA 1UGMA 1EU3A 5D6JB 5J18A 4PS3A 4G50A 2HE7A 2KQ7A 2WU2B 4LNIA 1OEYA 4PK1A 3GE3C 1KM7A 1UF0A 3GS2A 4K1RB 4LNNA 3AEFB 2JZZA 3LJ3A 1D5XC 1JMLA 3TEZA 1QZEA 2H89B 4RM9A 3ZUNA 1FMAD 4RF0A 1V1PA 3RZWC 3R2TA 1EU4A 2QCZA 2XK5B 2MX2A 4MSQB 3QWZB 3VUXA 2M1MA 3ML8A 1V5TA 2KDIA 4AJWA 2KMCA 4K7SA 1WX9A 2V0GA 4EKUA 2MRPA 3RNAC 1RWSA 2KMAA 2IPKD 1UH6A 4A55A 1JQ4A 4A90A 4BOZB 2FE8A 2MBBB 1JWSD 4FJYA 1ZGUB 2W55A 4W9EA 3VUWA 2KWCA 2KQ4X 1FFVA 4MH8A 1N60A 4ZHOA 1SIFA 3E56A 5IP4D 3U2SC 1XLQA 2DYMA 2C9WB 4WWOA 3FAHA 3DWGC 1OEYJ 2LXCA 4HEA1 3SEBA 1YN5A 1ZDVA 1NBFC 2JZPA 3B2FA 4MSMB 3GZNI 2JT4B 3IT6B 3NS1A 2ZW0A 4X57B 5CTRC 2CJOA 3ZNID 5BYRA 1UUPA 4HDOA 2KK8A 4NJCA 2IBIB 3Q3MC 3VVWB 3ZTCA 4FBJB 5G5HA 2D11A 1WGDA 2K8HA 3AI5A 2GOWA 1K50A 4HXDA 5KHOA 2B3AA 1ESFA 1WGHA 4DHJD 1EO6A 2N7JA 5AZFA 3ZDTA 2L52A 4P1CC 1YN3A 4JLCA 4DHZB 1WZ0A 2JY6A 1I4PA 2XN9C 3DVGX 3LYYA 2BPSA 3AE9B 3QAQA 2GBJA 2NCNA 3BY4B 4M8NA 3QA8A 2TSSA 3W5VB 5GMVA 3IFWB 3PRPB 4B9KA 1N5XA 3A9KA 4OVZA 1WXVA 2CHWA 4I6LB 2WS3B 2ON8A 1HE8A 1GC6A 2V3SA 3APCA 4E71A 4IUMB 2KACA 4RGOS 1WGGA 4FULA 1LQBA 3D32A 4W9DA 2D07B 4BBNF 2GI9A 2WHIA 1PGXA 4JX1C 2FUHB 3L10B 5MPOA 2ACZB 2IJ0A 3BINA 2EKEC 2DX5B 4NZLB 1FD6A 3NVYA 1JWMD 2C60A 4G3XB 1MFWA 3L54A 5DPSA 1TGZB 2DYBA 1JALA 3V05A 1U4AA 2G45B 1ISNA 4N9F4 4IWPA 4G11A 4HKQA 2H88B 3BYTB 2NBWB 4LLGM 4JE3B 1V80A 3AE2B 2MW5A 2KT7A 2J0KA 3OLMD 4WJQA 4XX5A 1P7FA 4S0RA 1YQ3B 3AXCA 3TBLD 3SU8X 2WXHA 2JXXA 2XK5A 1ZXIA 1G6JA 4L1BA 1FO4A 2LVOA 1J7CA 1JRPA 1QKZA 2I2YA 3X0WA 3IT4B 3LXFA 2N1WA 3J9CA 5G55A 1WRDB 4JQWC 2M0AA 3FC4A 2R2OA 3U4EG 4RF1A 1STEA 4E3CA 3CIRB 5FK9C 1DOIA 4RGNA 1RAXA 4C00A 2L32A 4LJPB 3AEEB 1AARA 2OJRA 5T8IA 2YEPB 2BF8B 2Y3AA 2KN4A 5C23A 2KVZA 4KGTA 2L0FA 2AQ1B 1F2RI 2ONQA 2N9XA 3PPAA 4UDUC 2MBEA 2ZPYA 1AYFA 1FNUA 3KWVA 1FNVA 4IDIA 1FCLA 4S17A 4A6QA 1V9JA 4KV2A 3ZIMA 1WYWB 2KWVB 3Q8CA 5LXIB 2WXLA 3RNEC 2YLMA 4NJ6A 2K6DB 2MA9B 1I4XA 3PV1A 2Q5WD 1F77A 4DBGA 4F7ZA 1RLFA 4N6EB 1OTRB 4AWJA 3H9DA 1WGKA 2G1EA 3KWLA 4KDIC 3RNGC 3ZJUA 2JPHA 3SFEB 4GN1A 4MGKE 1T0RC 5L83A 1J7BA 3M3JA 5C2TB 2KX0A 1S1QB 4ICVA 5EE3A 3N20C 3A9JB 5JHAA 4DWFA 2IO3B 1VCBA 1R7SA 1L0XB 2BKRB 4II3B 4F8CB 4II2B 2WDRB 4NQKE 1YJJA 4DXFA 2GB1A 1YX5B 2NBUA 3AM9A 1QT9A 2KFKB 3ZO5B 2INPE 3NJTA 2GBNA 3KYCD 5BYQA 2KANA 2MLBA 1FXTB 3I5JC 2L8JA 3UIOB 3PLVA 4AQ7A 5C1ZA 4GDLB 1GOZA 2G4DB 5GXGB 2GBKA 2DZKA 1V1OA 2WP9B 3ML9A 2QC8A 2BS3B 3DBHB 1MI0A 3ZNGC 1WJ4A 5G2NA 2MJEA 4ANVA 2WQYB 2ZEQA 4TSSA 1V1PB 3N1YC 3P4PB 3MHZA 1PDXA 2FCQA 5FR6A 3DHHC 2WYQA 1VLBA 4PS7A 2FCNA 1EF1A 2JZ3B 3ZNHB 1FIQA 2A5UA 1L2NA 1YQBA 3DBSA 2J52A 4JPSA 2KXJA 4IKGA 3AE1B 3V61A 1RYJA 1PYWD 3JSVA 2DWQA 1EF5A 5CHVC 2CJNA 4B0EA 3P4SB 4GDKB 4WWMA 2INNE 1L6UA 1WM2A 1D4BA 1B9RA 2J0JA 2ZW1A 3W9CB 4BKSD 4B95A 4M00A 2KTRB 1HZ5A 1KF6B 3W5UB 1GB1A 1YNTE 3HUIA 4FADA 1L4DB 4MM3B 1GNUA 5LNK1 1WYGA 3S2AA 2W3RA 2LRUA 1VZ6A 2WXFA 1NENB 4AJYB 4L2YA 3QQ8B 2JUOA 4NAWA 4C4VB 2RGFA 1E10A 2I1JA 2DZJA 1I7HA 4P6VF 2KWUB 2D5GA 2DZMA 5KHQA 3BYYB 5AEKB 3VXWA 1XT9B 3I63C 4ZRPA 1WY8A 2KC2A 1T0SC 2PE6B 3BZDB 5HFYA 1KLGD 3AV8A 3SHQA 1K51A 2BB6A 2MWSB 2LXAA 1EWCA 2MP2A 5AZHA 3PO0A 4L23A 1TS3A 3NVWA 3ZKJC 3AU4A 1A5RA 1YJ1A 3A4RA 3EECA 2B76B 5G5GA 3HM6X 1Q10A 4E74A 1VZ7A 1GG3A 2Z0EB 4RNAA 4O1NA 3RCZA 2JRIB 5LLIA 5EDSA 2UYZB 1IGCA 3NHEB 2QDFA 1P1AA 3WCQA 3RD2A 5CHWA 4CQNA 2FBWB 3ALBA 3AE3B 4JL9A 2WXIA 5E6NA 4W9HA 1XXGA 1HZ6A 4NY0A 3NG0A 4EUTA 3O65B 4AS1A 3OWEB 1E6EB 4GSWA 3A9JA 1TZOA 2C7HA 2Y5CA 1XCTL 1ET6A 1TKEA 4EFOA 3H8HA 1WXSA 3MC8A 2N9EB 4YSYB 1CJEA 4W9IA 1HA5A 1F52A 2WXJA 2GRIA 2LGIA 1T0QC 3IBEA 1R4NI 4P7IA 2KFKA 3EGRA 1NEKB 2RDBC 4HK2A 1DGJA 3B2GA 4JIOU 3FKYA 4BZAA 2BYFA 2I1KA 1SE3A 3HRDD 3PTFC 1OQRA 2V4LA 4GDLA 3TL5A 4KZ0A 4FLHA 3V60A 3PHWB 4KKJA 3DBRB 2M0XA 3EC8A 4F1SA 2LD9A 4DHJB 3MJWA 2CU3A 2KD0A 3I9V1 3WANA 4LNFA 3RNBC 2WX1A 2V9HA 1TZ1A 3T3NA 4DXGA 3H6NA 3PGEA 3W1YA 3KUDB 4MJSB 2DLBA 1TY0A 3RPFC 3U7DA 3MHSD 1H4RA 2L00B 1UBQA 2K5PA 1JW9D 4REZA 3N32A 3ZJTA 2VH1A 4KDLB 3N3KB 4ZYSA 1UELA 1WJ6A 2KFJA 1TIFA 2NPTA 2R2QA 3PS6A 1KJTA 4FHJA 2JX5A 4N59A 5D7GA 4WJOA 1JCKB 3L16A 3H7SA 1SF0A 3Q3NC 3QJZA 4YSZB 1V8CA 4GDKA 1TYGB 3ZLZA 3R8BA 2WXNA 4AUQC 1E9MA 1RRBA 1ROEA 3L08A 4JWSC 2LVQA 4EE2A 5DPWA 2KNBA 2KTRA 2M8SA 1K8RB 2N9KA 5BMIA 1BT0A 5I4DA 1ENFA 3AECB 1YN4A 2QMTA 1ZOYB 3EUB2 4MM3A 2AYOB 3NUHB 1DOYA 3AE6B 3GOEA 2KQSA 2M4NA 4XDDA 5CHFA 3Q8EA 3WALA 1KFYB 4C4VA 2BW2A 4C80A 1MHXA 4IM3A 3H7PA 4N58A 4ARCA 1WGYA 4JGHB 1FXIA 2MBQA 1D3ZA 3VDZA 3OG5A 3URYA 1MG8A 4ANUA 2WXGA 2N7DA 4CO7A 2KZRA 3M62B 2SEBD 2KVRA 1LFDA 3PRZA 2INCC 1L7YA 3DBHI 3EHVA 4WJNA 1WF9A 4W9FA 1JWAD 1YIWA 2JF5A 2KJHB 2W82A 3HHMA 1Y8RC 3JW0X 1QOGA 2RMMA 4WH4A 2BKFA 3P1MA 4OVUA 2J42A 4DQOC 1YD8U 2BB5A 2LASA 4C7ZA 4KKIA 2K39A 2EMSA 1KOTA 3Q8FA 3UQAA 3ZRFA 1XLOA 2IGDA 4EOYA 3AEBB 4TUUA 5AZGA 2UWQA 3RULA 4NAMA 1WR1A 2LUEA 1L0YB 2IDYA 3DCGA 5DPTA 1Z2MA 2QILA 1CMXB 1R4MI 4RGMA 4ASWC 3NOBA 4FJVB 2KLGA 2KWDA 4KX6B 1ZXHA 3UINB 3VRBB 1WMHB 3SDLC 2PTLA 4HRSA 2YVCA 2N9PC 4K7WA 1M94A 4H2AA 1WGRA 2MCNB 3KUZA 1LGRA 1RM6C 3Q3JA 4ZRJA 2FUG1 4K7UA 2PLPA 5E6PA 4LNOA 2WDVB 1TJEA 2D3AA 1TKGA 1V5OA 2GMIC 2Y5BB 1C9FA 3CWIA 3BK1A 3JSVB 3WA0A 4DXAB 5DCNA 1HEZE 3V6EB 4ICUA 1SJHD 2Z0DB 2LHEA 2NS5A 2UU7A 4YTNB 3E9SA 2XNAC 2WXKA 2KDFB 1D5MC 4MJSA 2D3GA 3AMZA 3W1SA 3TEXA 1FXAA 2G4SA 4KZCA 4KGSA 1NI2A 2E3TA 1V6EA 2GLSA 3DVNU 1E7UA 1I42A 1WIAA 3DQVA 4NAWB 2J0MA 2CR5A 1V86A 2HTME 3EFUA 3NVVA 1HTOA 4HVBA 1NYRA 2IO1B 3OJ4B 1L6VA 4D2KA 1UWMA 3WAPA 1UBIA 1MJDA 1UNSA 2AL3A 1L4ZB 2EELA 2WU5B 2Z8LA 3T8MA 4ZHPA 2MP2B 4MEMA 2HDEA 3ZXVA 2KTFA 2L05A 2K3UA 1DYQA 4OZCA 3MTNB 3X23A 2FIFA 1E90A 1J8CA 3APFA 1WH3A 4AOFA 1ACCA 1A70A 1QQRA 5JHBA 3DVGY 2BYTA 3RYTA 4LJOB 2CHXA 1AN8A 3ZJVA 2FAZA 1WI0A 2ZNVC 3DBRI 1BUIC 1VD2A 2V3NA 2GBMA 1CQVA 2DYOA 4NNJB 1WXQA 2I38A 3NVZA 4RGTA 3C19A 3Q8AA 3ETRA 3BVZA 3AB5A 3AEAB 3NZ3A 3FILA 3ZYYX 4EZKA 1IP9A 3IAS1 3C0RB 1XO3A 2CU1A 5BYSA 4NPNA 1V97A 2L76A 1JWBD 2HD5B 4HPLB 2LHDA 1I4GA 1E8ZA 3QHTA 1YQ4B 3N1ZC 1ZW7A 3KLSX 3PVLA 2WDQB 2LJ5A 1CZPA 1N6ZA 3UIPB 3ZTDA 3DOWA 4GGQA 1YX6B 2BQQA 3ONSA 1D5ZC 3R7QA 1WM3A 1XLNA 3RNCC 2MJ3A 1SJED 3A1QA 2BYVE 1T0YA 1WXMA 1ZUD2 2LI5A 1PQSA 2EKIA 1WMHA 4WWNA 1VZ8A 2N9LA 4A9AA 3IAM1 1CK1A 4TV3A 4WURA 4ANXA 2NBVB 5L95C 2D2QA 4IM0A 3LB8C 1HTQA 2VRRB 4OZAA 4PS8A 4WIPA 1I4RA 4ITKA 2PW9A 4M02A 2NPTB 4ZRIA 2KOXA 4ZRQA 1SBBB 1TS5A 3DHIC 3KQ4A 4I6PA 4ARIA 2NTSA 3RT3B 1FM0D 1MVKA 4DHZE 1H8CA 4HCPB 4HPMB 4M8MA 1PGAA 4CHKA 3LDZE 4W9CA 1F0ZA 2LVPA 3PZ7A 3VUYA 1BXTA 4LTUA 1XLPA 2NTTA 2JRHA 4BBNC 2ZNVB 3HK0A 4MT5A 4RMAA 2FCMA 2JSVX 3IXSA 3U30A 3AE4B 4XWWA 3R2IA 2NVUI 2KJRA 1C4PA 4BKTA 3H7PB 1OFFA 2OHFA 4R3DA 1VJKA 4B0MA 3DBLB 1BMLC 3IVFA 2ICIA 2NMQA 3IHPC 2O6VD 3PLUA 3AE5B 4OW0A 1S3SG 2MBHA 2BBCA 4P16A 2LEKA 2NR2A 4GMVA 4LDTD 3VH4B 2MBOA 3W1SC 2YEPF 2W9NA 5EE1A 4DDGD 2V1YA 1UGJA 2DZIA 4OHJA 1FRDA 2C5LC 1FFUA 2INDC 2XBBC 3T3OA 1T6BX 2LMCA 3VTVA 1FEHA 3APDA 4LK0M 4HLEA 3EA6A 3R7RA 1K52A 4KVGB 4A3PA 2RSUA 4GB9A 1VR9A 1LO5D 2DENB 1WE7A 4HCNB 2JVCA 1SXTA 1IUEA 2PPHA 4KIKA 4JWUC 2IO2B 5D3IB 3MFGA 1WX8A 4KGRA 2BGFA 3Q3FA 4BKSA 5BO4B 1Z5SB 1L0VB 1KRHA 2SAKA 1P3QU 5EE9A 4US8A 2L3ZA 2WXOA 1TS4A 4M01A 2VH2A 1TT5B 1WZ3A 1XCQL 2N4FA 4XWTA 3I3TB 2PIAA 3ZGZA 3KYDD 3DWMA 2WXQA 3MC0B 3ZXRA 4W9KA 3AE7B 1C76A 3VTUA 3B1LX 1C79A 1NYQA 2DNFA 5BMGA 3Q6BA 3UGBB 2VZKD 1IGDA 2BVCA 3PZDA 1WE6A 1GC7A 1P9DU 1TY2A 2QEJC 4A3OA 3RMKC 3H1UA 3K9PB 1PGBA 1WR6E 1WSPA 1KTKA 2L83A 5H92C 1X1MA 1B1ZA 2KKCA 1I4HA 4EEWA 4MGIE 4I6NB 3ZVVA 1UD7A 3ZDMC 3ZNZB 1E0ZA 2PVGC 2HJ8A 5HHDG 2DAFA 1ZE3D 1C4CA 1LXDA 5HI1A 1M4VA 3QK0A 4W9JA 1GAQB 1ZDXA 2AEHA 2WXPA 3W2DA 1V2YA 1OGWA 3NS8A 3TMPB 2LGDA 2OOBB 2AX5A 2V4IB 2ZPNA 4M0WA 1YOVB 2LFIA 4W9LA 1WRIA 1QOAA 2IY1B 4C56C 4DDID 3WAMA 4J6IA 2D3CA 1J7AA 4HKZE 3M63B 1N63A 2ZZPB 4WAAA 2ZVOA 1XEEA 2PVOD 2WGSA 3K9OB 3VR9B 4XE0A 3BVGA 2QJLA 4P1BC 2BS4B 2L0TA 2QHOA 4HJGE 4CYEA 3BVMA 2JYTA 4GIVA 3M95A 3Q14C 4NJ7A 2OJWA 1YJIA 1C77A 4G0NB 1QOFA 2RDGA 2PJHA 1SE4A 3BIID 3Q2AC 3BK2A 2M17A 4ZRKA 5JH5C 1L5PA 3P4QB 4FN2A 4WQMA 4OZBA 2X8XX 1J19A 3AU5A 1C4AA 2MHJA 4GLSC 1E8WA 2R61A 3RI7C 3TCAA 4XZ4A 1N61A 3PHXB 4A20A 2FIDA 3VTWA 1T5XD 4K81A 3PZ8A 3VQIA 3FILB 4YT0B 1NDDA 2BS2B 1VDVA 3N1XC 2AL6A 2M56B 4XC2A 3RNFC 2BWFA 3OAWA 1I35A 2FCSA 2RDHA 1TTNA 5CX3A 2CS4A 2J4XA 4HJKA 5J17A 2O2VB 2JWUA 4FA6A 2WXMA 1E8XA 3HM3A 4FHKA 1UWXA 2QSDA 3GB1A 1XF5L 3P42A 5D3DA 3VH3B 2DHZA 2J7QB 2KDMA 3A1QB 5H8YE 4QAYA 3AE8B 4YTPB 1SGHA 1LM8B 2MQJA 4C7YA 2K25A 4IWQA 5IKCM 1N62A 1V49A 3V3XA 3Q8BA 2ZCBA 4ZDVA 1GB4A 2N7EA 1NI3A 1SE9A 1JRUA 3QX1A 1C1YB 3KVFB 3DVNV 2MSED 3NRZA 4EZLA 2J53A 4BVUC 2AQ3B 3DBLI 3N30A 4NQLB 3SFDB 4HPPA 3L13A 3TEYA 2D10A 3PT2B 1ZP0B 2ASQA 4GU2A 2KHWB 2BYEA 1OQQA 2MJDA 2IY0B 2W3SA 2ZJDA 1SIJA 2L1AA 1WWTA 3GP7A 2KJ6A 2IGHA 1V81A 2PKOA 3AN1A 1FCCC 4MH0E 1SSNA 1IPGA 4KSLC 5AUKA 1E7PB 2L7RA 3KW5B 2ZCCA 5TSSA 2AQ2B 3VHTC 4BAXA 4RFBA 2FNJB 3N9YC 1NVID 1KH0A 5J2RA 4IM2A 3C8YA 4URKA 1SE2A 2BWES 2LRWA 4BOSC 2IGGA 3KUCB 4RH6A 4LNKA 2PE9A 1FPYA 4LCDE 3U8ZA 3UQBA 3CF6E 2D3BA 4EZJA 3ZQ4A 1KLUD 3HVDA 1ZKHA 4IWOA 1QILA 1ET9A 1WJUA 2GBRA 1GJZA 1SEBD 1R4NB 2A4ZA 1I4QA 3TIXA
chains in the Genus database with same CATH topology
3RT3B 3IBEA 1EO6A 5AZFA 3ZDTA 5IAAC 4DHZE 1R4NI 2IO0B 1E7VA 4P7IA 1H8CA 2KFKA 4HCPB 4HPMB 4M8MA 1J0GA 4CHKA 3LDZE 4W9CA 4JLCA 3WAOA 2LVPA 4DHZB 1WZ0A 2JY6A 4HK2A 3VUYA 4JIOU 1Q1OA 3DVGX 2BYFA 2I1KA 4PYZA 2JRHA 2RD0A 2BPSA 4TKNA 2ZNVB 3PTFC 2V4LA 3QAQA 4BBNC 3HK0A 2GBJA 2NCNA 3BY4B 4M8NA 3QA8A 3T9LA 4GDLA 3TL5A 4KZ0A 4FLHA 3V60A 3PHWB 4RMAA 2FCMA 2KLCA 3IFWB 5GMVA 2M0XA 3EC8A 3PRPB 4B9KA 4F1SA 2LD9A 4DHJB 3MJWA 3WANA 2KD0A 3A9KA 4MGYE 2WX1A 1WXVA 2CHWA 2REXA 4WWPA 3U30A 4I6LB 4ANWA 4KIKB 1TZ1A 3APCA 1HE8A 1GC6A 2V3SA 3JYUA 4E71A 2CHZA 3H6NA 2NVUI 2KJRA 3PGEA 3W1YA 4IUMB 5IA7A 4BKTA 3H7PB 3KUDB 4MJSB 5HKHA 1E5WA 1WGGA 4FULA 3U7DA 1LQBA 3D32A 3IVFA 1H4RA 2D07B 3MHSD 3PREA 4W9DA 3IHPC 2L00B 4BBNF 2O6VD 1UBQA 3RUIB 3N32A 3PLUA 4KDLB 3N3KB 2FUHB 3L10B 1S3SG 1UELA 1WJ6A 2KFJA 2MBHA 2NR2A 2NPTA 2R2QA 3PS6A 1KJTA 2MBOA 3BINA 4FHJA 4GMVA 4LDTD 5E6OA 3VH4B 2W9NA 3W1SC 4DDGD 3HIZA 5D7GA 2V1YA 2EKEC 2DX5B 4WJOA 4PYUA 2DZIA 2LGXA 2C5LC 3L16A 2C60A 3H7SA 5LXHA 4G3XB 3QJZA 4GDKA 4HDQA 3ZLZA 3L54A 3QCAA 2KDBA 5DPSA 1TGZB 2DYBA 2O2VA 2XBBC 1P98A 4W9GA 3VAWA 2O6VB 3VTVA 4AUQC 4DK5A 1U4AA 3APDA 2LWPA 2G45B 1ISNA 4N9F4 4HLEA 1RRBA 3SD5A 3L08A 4IWPA 2LVQA 3L17A 4G11A 5DPWA 3B08A 2KNBA 2KTRA 2M8SA 4FJZA 1K8RB 3R7RA 1BT0A 4LDTB 4KVGB 4A3PA 2NBWB 2RSUA 4WQOB 4AP4C 4GB9A 1V80A 2DENB 2EMTA 3R66C 1WE7A 4HCNB 2JVCA 4MM3A 2MW5A 3OLMD 2J0KA 4KSKC 2AYOB 3WIMA 4WJQA 3GOEA 2KQSA 2PPHA 2WWZA 2M4NA 4KIKA 4XX5A 2IO2B 5CHFA 3WALA 3AXCA 1WX8A 3SU8X 5D2MB 3TBLD 2BGFA 1Q0WB 3Q3FA 4IM3A 3H7PA 2JXXA 5BO4B 2XK5A 1Z5SB 4BKSA 2WDTB 1G6JA 1WGYA 2K6QA 2LVOA 4JGHB 1P3QU 3UF8A 2MBQA 1D3ZA 3VDZA 2G3QB 2L3ZA 1MG8A 4ANUA 2N7DA 4CO7A 1WZ3A 2KZRA 2N4FA 3M62B 3X0WA 3I3TB 2KVRA 1LFDA 3KYDD 3PRZA 4GXBA 2N1WA 3KH0A 1L7YA 3DBHI 3EHVA 4WJNA 5G55A 1WF9A 1WRDB 2Z59B 4W9KA 4JQWC 4W9FA 4TQ0A 4RM8A 2JF5A 1YIWA 2KJHB 2R2OA 3VTUA 3CSTA 3VFKA 3B1LX 2KC1A 3HHMA 1Y8RC 3JW0X 1F9JA 4M0WB 3UGBB 4E3CA 3JVZX 2BKFA 3PRMB 3V62A 3PZDA 4OVUA 1WE6A 1KLVA 2PEAA 1GC7A 1P9DU 2LGYA 1XQQA 1RAXA 1YD8U 2LASA 4A3OA 4LJPB 3CMMB 1AARA 2OJRA 3B0AA 3H1UA 3K9PB 1OQYA 2BF8B 2K1FA 1WR6E 2K39A 4TQ1A 2ZVNA 5C23A 2L0FA 1X1MA 2EMSA 2KO3A 3QC8B 1KOTA 2LZ6A 2N9XA 3PPAA 3UQAA 3ZRFA 2MBEA 3CSFA 5TR5A 2ZPYA 5D94A 1IYFA 2KKCA 4EOYA 4IG7B 4EEWA 4MGIE 4TUUA 3QIJA 4I6NB 5AZGA 2UWQA 4IW0A 3RULA 4HWIB 1V9JA 4DHJD 1WR1A 4KV2A 3ZVVA 2LUEA 4YL8A 1XD3B 1WYWB 3ZIMA 1UD7A 3R3MA 2KWVB 3DCGA 5DPTA 1Z2MA 3ZDMC 4MELA 3ZNZB 2HJ8A 2YLMA 5LXIB 1C3TA 1CMXB 4NJ6A 2DAFA 2K6DB 1R4MI 2MA9B 3PV1A 4ASWC 5DPRA 3NOBA 3NY5A 4DBGA 4FJVB 1RLFA 4F7ZA 2KLGA 1LXDA 3IG3A 3QK0A 1OTRB 4W9JA 3UINB 2AEHA 4AWJA 2JWZA 3H9DA 1WMHB 3SDLC 4KDIC 4MDKE 1V2YA 1OGWA 2YVCA 2N9PC 3NS8A 2JPHA 3TMPB 2IYDB 4K7WA 1P0RA 1M94A 2LGDA 1WGRA 4GN1A 2OOBB 4MGKE 2MCNB 3ENEA 3OJ3A 1RFAA 3KUZA 4B6WA 3Q3JA 5L83A 4ZRJA 4K7UA 2ZPNA 3M3JA 2KX0A 1S1QB 5E6PA 4ICVA 4W9LA 3A9JB 5JHAA 4DWFA 1WJNA 2IO3B 1VCBA 3AULA 2IY1B 4WJPA 3TJPA 4DDID 2IZVB 3WAMA 1V5OA 2BKRB 2GMIC 2Y5BB 4GOCA 4II3B 4J6IA 4F8CB 4II2B 3JSVB 3V6CB 4NQKE 3WA0A 4DXAB 5DCNA 2KN5A 3M63B 5JZEB 1YX5B 2WX0A 2ZZPB 4WAAA 1E8YA 2NBUA 2ZVOA 3PSEB 3NZUA 3V6EB 1EUVB 3K9OB 4ICUA 4OVVA 3A4SC 2KFKB 1GUAB 2Z0DB 3ZO5B 3ZW3A 4ZYNA 2GBNA 3KYCD 2K8BA 2NS5A 2L0TA 2QHOA 2AWTA 2N1VA 3RZFA 4CYEA 2KANA 2MLBA 1FXTB 4GIVA 1WXAA 2KDFB 1TBEA 2L8JA 3M95A 4NJ7A 3UIOB 3PLVA 5C1ZA 4MJSA 4GDLB 4G0NB 2D3GA 3W1SA 3DDCB 2G4DB 2PJHA 2GBKA 2DZKA 2XEWA 2G4SA 4KZCA 3ML9A 3QARA 2C7NB 2M17A 3A9KB 4ZRKA 1NI2A 3ZNGC 1WJ4A 3ECIA 3NZSA 5JH5C 5G2NA 4ANVA 1V6EA 4FN2A 2RR9A 2ZEQA 3DVNU 1E7UA 1I42A 1WIAA 3DQVA 4NAWB 1J19A 3AU5A 2J0MA 2CR5A 2KDEB 1E8WA 1V86A 2FCQA 2HTHA 3EFUA 5FR6A 4BFRA 3TCAA 4XZ4A 4MGZE 1WFYA 4BKGA 3DPDA 3PHXB 4A20A 4HVBA 2FIDA 2WYQA 2IO1B 3VTWA 4K81A 3OJ4B 4PS7A 2FCNA 2JZ3B 1EF1A 1WX7A 1Q5WB 2A5UA 4IC7B 3VQIA 1YQBA 3WAPA 1L2NA 2O6VA 1UBIA 3DBSA 2K8CA 1NDDA 2KXJA 2DAJA 3A33B 3ZNHB 2AL3A 2RPQA 4XC2A 3V61A 2AL6A 2BWFA 3JSVA 2C7MB 3OAWA 3T8MA 2CKHB 2KX3A 1I35A 1EF5A 2FCSA 2MP2B 4MEMA 3ZRCA 1TTNA 5CHVC 3L0WB 5CX3A 2CS4A 2KTFA 2L05A 4GDKB 3P2BA 1UZXB 4HJKA 5J17A 2O2VB 1WM2A 1UGMA 3MTNB 4FA6A 1E8XA 3HM3A 4FHKA 2J0JA 5D6JB 3X23A 4BKSD 2FIFA 5J18A 4PS3A 4B95A 1E90A 1J8CA 4G50A 2HE7A 3APFA 2KQ7A 1OEYA 2KTRB 1WH3A 1KM7A 4AOFA 3VH3B 2DHZA 5JHBA 2J7QB 3A1QB 3DVGY 4K1RB 4FADA 3RYTA 4LJOB 2JZZA 2CHXA 1GNUA 3LJ3A 3S2AA 1SGHA 2FAZA 1WI0A 2ZNVC 3DBRI 2LRUA 1LM8B 1QZEA 2MQJA 4AJYB 1VD2A 2K25A 4RM9A 4IWQA 3ZUNA 2GBMA 3QQ8B 2JUOA 3RZWC 1V49A 4NAWA 4ZDVA 2ZCBA 2DYOA 2N7EA 2RGFA 4NNJB 1SE9A 1JRUA 2I1JA 2DZJA 3QX1A 1C1YB 2XK5B 2MX2A 2KWUB 3KVFB 3DVNV 4MSQB 3QWZB 3VUXA 2DZMA 2M1MA 2MSED 3ML8A 5KHQA 4EZLA 1V5TA 4BVUC 5AEKB 3VXWA 1XT9B 2KDIA 3DBLI 3N30A 4NQLB 1WY8A 2KC2A 2KMCA 4AJWA 4EZKA 2PE6B 3C0RB 1IP9A 2CU1A 4K7SA 1WX9A 3L13A 4EKUA 2MRPA 4NPNA 2D10A 2L76A 2HD5B 3PT2B 3SHQA 2KMAA 4HPLB 2MWSB 1E8ZA 1UH6A 2LXAA 2ASQA 3QHTA 2KHWB 2MP2A 4GU2A 1ZW7A 3PVLA 4BOZB 2LJ5A 2BYEA 5AZHA 2MBBB 4FJYA 3UIPB 3ZKJC 2IY0B 1ZGUB 3ZTDA 4W9EA 3DOWA 2ZJDA 3VUWA 2KWCA 4GGQA 3AU4A 1YX6B 1A5RA 1YJ1A 3ONSA 3A4RA 3EECA 2KJ6A 3HM6X 4E74A 3R7QA 1V81A 1WM3A 1GG3A 2Z0EB 1SIFA 4MH0E 1IPGA 3RCZA 2JRIB 4KSLC 5LLIA 2UYZB 5EDSA 3A1QA 2BYVE 1T0YA 2L7RA 3KW5B 3NHEB 2LI5A 1WXMA 2C9WB 2DYMA 1P1AA 2ZCCA 4WWOA 1PQSA 1OEYJ 3RD2A 2LXCA 5CHWA 1WMHA 4WWNA 3ALBA 3VHTC 1NBFC 4JL9A 4MSMB 2FNJB 3GZNI 2JT4B 4W9HA 5E6NA 4NY0A 4TV3A 4EUTA 3O65B 5J2RA 4IM2A 4URKA 4X57B 2BWES 2NBVB 5CTRC 4ANXA 5L95C 2D2QA 2LRWA 4BOSC 3ZNID 3KUCB 4GSWA 4IM0A 2VRRB 2PE9A 4PS8A 4HDOA 3A9JA 2C7HA 2KK8A 4LCDE 2IBIB 3U8ZA 3UQBA 3CF6E 3VVWB 3ZTCA 4FBJB 4EZJA 4EFOA 2D11A 1WXSA 1WGDA 1ZKHA 2K8HA 2NPTB 3AI5A 2GOWA 4IWOA 4ZRIA 2N9EB 2KOXA 4HXDA 1WJUA 2GBRA 1GJZA 4W9IA 5KHOA 2A4ZA 2B3AA 1WGHA 4I6PA 3TIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 B;  3IBE A;  1EO6 A;  5AZF A;  3ZDT A;  5IAA C;  4DHZ E;  1R4N I;  2IO0 B;  1E7V A;  4P7I A;  1H8C A;  2KFK A;  4HCP B;  4HPM B;  4M8M A;  1J0G A;  4CHK A;  3LDZ E;  4W9C A;  4JLC A;  3WAO A;  2LVP A;  4DHZ B;  1WZ0 A;  2JY6 A;  4HK2 A;  3VUY A;  4JIO U;  1Q1O A;  3DVG X;  2BYF A;  2I1K A;  4PYZ A;  2JRH A;  2RD0 A;  2BPS A;  4TKN A;  2ZNV B;  3PTF C;  2V4L A;  3QAQ A;  4BBN C;  3HK0 A;  2GBJ A;  2NCN A;  3BY4 B;  4M8N A;  3QA8 A;  3T9L A;  4GDL A;  3TL5 A;  4KZ0 A;  4FLH A;  3V60 A;  3PHW B;  4RMA A;  2FCM A;  2KLC A;  3IFW B;  5GMV A;  2M0X A;  3EC8 A;  3PRP B;  4B9K A;  4F1S A;  2LD9 A;  4DHJ B;  3MJW A;  3WAN A;  2KD0 A;  3A9K A;  4MGY E;  2WX1 A;  1WXV A;  2CHW A;  2REX A;  4WWP A;  3U30 A;  4I6L B;  4ANW A;  4KIK B;  1TZ1 A;  3APC A;  1HE8 A;  1GC6 A;  2V3S A;  3JYU A;  4E71 A;  2CHZ A;  3H6N A;  2NVU I;  2KJR A;  3PGE A;  3W1Y A;  4IUM B;  5IA7 A;  4BKT A;  3H7P B;  3KUD B;  4MJS B;  5HKH A;  1E5W A;  1WGG A;  4FUL A;  3U7D A;  1LQB A;  3D32 A;  3IVF A;  1H4R A;  2D07 B;  3MHS D;  3PRE A;  4W9D A;  3IHP C;  2L00 B;  4BBN F;  2O6V D;  1UBQ A;  3RUI B;  3N32 A;  3PLU A;  4KDL B;  3N3K B;  2FUH B;  3L10 B;  1S3S G;  1UEL A;  1WJ6 A;  2KFJ A;  2MBH A;  2NR2 A;  2NPT A;  2R2Q A;  3PS6 A;  1KJT A;  2MBO A;  3BIN A;  4FHJ A;  4GMV A;  4LDT D;  5E6O A;  3VH4 B;  2W9N A;  3W1S C;  4DDG D;  3HIZ A;  5D7G A;  2V1Y A;  2EKE C;  2DX5 B;  4WJO A;  4PYU A;  2DZI A;  2LGX A;  2C5L C;  3L16 A;  2C60 A;  3H7S A;  5LXH A;  4G3X B;  3QJZ A;  4GDK A;  4HDQ A;  3ZLZ A;  3L54 A;  3QCA A;  2KDB A;  5DPS A;  1TGZ B;  2DYB A;  2O2V A;  2XBB C;  1P98 A;  4W9G A;  3VAW A;  2O6V B;  3VTV A;  4AUQ C;  4DK5 A;  1U4A A;  3APD A;  2LWP A;  2G45 B;  1ISN A;  4N9F 4;  4HLE A;  1RRB A;  3SD5 A;  3L08 A;  4IWP A;  2LVQ A;  3L17 A;  4G11 A;  5DPW A;  3B08 A;  2KNB A;  2KTR A;  2M8S A;  4FJZ A;  1K8R B;  3R7R A;  1BT0 A;  4LDT B;  4KVG B;  4A3P A;  2NBW B;  2RSU A;  4WQO B;  4AP4 C;  4GB9 A;  1V80 A;  2DEN B;  2EMT A;  3R66 C;  1WE7 A;  4HCN B;  2JVC A;  4MM3 A;  2MW5 A;  3OLM D;  2J0K A;  4KSK C;  2AYO B;  3WIM A;  4WJQ A;  3GOE A;  2KQS A;  2PPH A;  2WWZ A;  2M4N A;  4KIK A;  4XX5 A;  2IO2 B;  5CHF A;  3WAL A;  3AXC A;  1WX8 A;  3SU8 X;  5D2M B;  3TBL D;  2BGF A;  1Q0W B;  3Q3F A;  4IM3 A;  3H7P A;  2JXX A;  5BO4 B;  2XK5 A;  1Z5S B;  4BKS A;  2WDT B;  1G6J A;  1WGY A;  2K6Q A;  2LVO A;  4JGH B;  1P3Q U;  3UF8 A;  2MBQ A;  1D3Z A;  3VDZ A;  2G3Q B;  2L3Z A;  1MG8 A;  4ANU A;  2N7D A;  4CO7 A;  1WZ3 A;  2KZR A;  2N4F A;  3M62 B;  3X0W A;  3I3T B;  2KVR A;  1LFD A;  3KYD D;  3PRZ A;  4GXB A;  2N1W A;  3KH0 A;  1L7Y A;  3DBH I;  3EHV A;  4WJN A;  5G55 A;  1WF9 A;  1WRD B;  2Z59 B;  4W9K A;  4JQW C;  4W9F A;  4TQ0 A;  4RM8 A;  2JF5 A;  1YIW A;  2KJH B;  2R2O A;  3VTU A;  3CST A;  3VFK A;  3B1L X;  2KC1 A;  3HHM A;  1Y8R C;  3JW0 X;  1F9J A;  4M0W B;  3UGB B;  4E3C A;  3JVZ X;  2BKF A;  3PRM B;  3V62 A;  3PZD A;  4OVU A;  1WE6 A;  1KLV A;  2PEA A;  1GC7 A;  1P9D U;  2LGY A;  1XQQ A;  1RAX A;  1YD8 U;  2LAS A;  4A3O A;  4LJP B;  3CMM B;  1AAR A;  2OJR A;  3B0A A;  3H1U A;  3K9P B;  1OQY A;  2BF8 B;  2K1F A;  1WR6 E;  2K39 A;  4TQ1 A;  2ZVN A;  5C23 A;  2L0F A;  1X1M A;  2EMS A;  2KO3 A;  3QC8 B;  1KOT A;  2LZ6 A;  2N9X A;  3PPA A;  3UQA A;  3ZRF A;  2MBE A;  3CSF A;  5TR5 A;  2ZPY A;  5D94 A;  1IYF A;  2KKC A;  4EOY A;  4IG7 B;  4EEW A;  4MGI E;  4TUU A;  3QIJ A;  4I6N B;  5AZG A;  2UWQ A;  4IW0 A;  3RUL A;  4HWI B;  1V9J A;  4DHJ D;  1WR1 A;  4KV2 A;  3ZVV A;  2LUE A;  4YL8 A;  1XD3 B;  1WYW B;  3ZIM A;  1UD7 A;  3R3M A;  2KWV B;  3DCG A;  5DPT A;  1Z2M A;  3ZDM C;  4MEL A;  3ZNZ B;  2HJ8 A;  2YLM A;  5LXI B;  1C3T A;  1CMX B;  4NJ6 A;  2DAF A;  2K6D B;  1R4M I;  2MA9 B;  3PV1 A;  4ASW C;  5DPR A;  3NOB A;  3NY5 A;  4DBG A;  4FJV B;  1RLF A;  4F7Z A;  2KLG A;  1LXD A;  3IG3 A;  3QK0 A;  1OTR B;  4W9J A;  3UIN B;  2AEH A;  4AWJ A;  2JWZ A;  3H9D A;  1WMH B;  3SDL C;  4KDI C;  4MDK E;  1V2Y A;  1OGW A;  2YVC A;  2N9P C;  3NS8 A;  2JPH A;  3TMP B;  2IYD B;  4K7W A;  1P0R A;  1M94 A;  2LGD A;  1WGR A;  4GN1 A;  2OOB B;  4MGK E;  2MCN B;  3ENE A;  3OJ3 A;  1RFA A;  3KUZ A;  4B6W A;  3Q3J A;  5L83 A;  4ZRJ A;  4K7U A;  2ZPN A;  3M3J A;  2KX0 A;  1S1Q B;  5E6P A;  4ICV A;  4W9L A;  3A9J B;  5JHA A;  4DWF A;  1WJN A;  2IO3 B;  1VCB A;  3AUL A;  2IY1 B;  4WJP A;  3TJP A;  4DDI D;  2IZV B;  3WAM A;  1V5O A;  2BKR B;  2GMI C;  2Y5B B;  4GOC A;  4II3 B;  4J6I A;  4F8C B;  4II2 B;  3JSV B;  3V6C B;  4NQK E;  3WA0 A;  4DXA B;  5DCN A;  2KN5 A;  3M63 B;  5JZE B;  1YX5 B;  2WX0 A;  2ZZP B;  4WAA A;  1E8Y A;  2NBU A;  2ZVO A;  3PSE B;  3NZU A;  3V6E B;  1EUV B;  3K9O B;  4ICU A;  4OVV A;  3A4S C;  2KFK B;  1GUA B;  2Z0D B;  3ZO5 B;  3ZW3 A;  4ZYN A;  2GBN A;  3KYC D;  2K8B A;  2NS5 A;  2L0T A;  2QHO A;  2AWT A;  2N1V A;  3RZF A;  4CYE A;  2KAN A;  2MLB A;  1FXT B;  4GIV A;  1WXA A;  2KDF B;  1TBE A;  2L8J A;  3M95 A;  4NJ7 A;  3UIO B;  3PLV A;  5C1Z A;  4MJS A;  4GDL B;  4G0N B;  2D3G A;  3W1S A;  3DDC B;  2G4D B;  2PJH A;  2GBK A;  2DZK A;  2XEW A;  2G4S A;  4KZC A;  3ML9 A;  3QAR A;  2C7N B;  2M17 A;  3A9K B;  4ZRK A;  1NI2 A;  3ZNG C;  1WJ4 A;  3ECI A;  3NZS A;  5JH5 C;  5G2N A;  4ANV A;  1V6E A;  4FN2 A;  2RR9 A;  2ZEQ A;  3DVN U;  1E7U A;  1I42 A;  1WIA A;  3DQV A;  4NAW B;  1J19 A;  3AU5 A;  2J0M A;  2CR5 A;  2KDE B;  1E8W A;  1V86 A;  2FCQ A;  2HTH A;  3EFU A;  5FR6 A;  4BFR A;  3TCA A;  4XZ4 A;  4MGZ E;  1WFY A;  4BKG A;  3DPD A;  3PHX B;  4A20 A;  4HVB A;  2FID A;  2WYQ A;  2IO1 B;  3VTW A;  4K81 A;  3OJ4 B;  4PS7 A;  2FCN A;  2JZ3 B;  1EF1 A;  1WX7 A;  1Q5W B;  2A5U A;  4IC7 B;  3VQI A;  1YQB A;  3WAP A;  1L2N A;  2O6V A;  1UBI A;  3DBS A;  2K8C A;  1NDD A;  2KXJ A;  2DAJ A;  3A33 B;  3ZNH B;  2AL3 A;  2RPQ A;  4XC2 A;  3V61 A;  2AL6 A;  2BWF A;  3JSV A;  2C7M B;  3OAW A;  3T8M A;  2CKH B;  2KX3 A;  1I35 A;  1EF5 A;  2FCS A;  2MP2 B;  4MEM A;  3ZRC A;  1TTN A;  5CHV C;  3L0W B;  5CX3 A;  2CS4 A;  2KTF A;  2L05 A;  4GDK B;  3P2B A;  1UZX B;  4HJK A;  5J17 A;  2O2V B;  1WM2 A;  1UGM A;  3MTN B;  4FA6 A;  1E8X A;  3HM3 A;  4FHK A;  2J0J A;  5D6J B;  3X23 A;  4BKS D;  2FIF A;  5J18 A;  4PS3 A;  4B95 A;  1E90 A;  1J8C A;  4G50 A;  2HE7 A;  3APF A;  2KQ7 A;  1OEY A;  2KTR B;  1WH3 A;  1KM7 A;  4AOF A;  3VH3 B;  2DHZ A;  5JHB A;  2J7Q B;  3A1Q B;  3DVG Y;  4K1R B;  4FAD A;  3RYT A;  4LJO B;  2JZZ A;  2CHX A;  1GNU A;  3LJ3 A;  3S2A A;  1SGH A;  2FAZ A;  1WI0 A;  2ZNV C;  3DBR I;  2LRU A;  1LM8 B;  1QZE A;  2MQJ A;  4AJY B;  1VD2 A;  2K25 A;  4RM9 A;  4IWQ A;  3ZUN A;  2GBM A;  3QQ8 B;  2JUO A;  3RZW C;  1V49 A;  4NAW A;  4ZDV A;  2ZCB A;  2DYO A;  2N7E A;  2RGF A;  4NNJ B;  1SE9 A;  1JRU A;  2I1J A;  2DZJ A;  3QX1 A;  1C1Y B;  2XK5 B;  2MX2 A;  2KWU B;  3KVF B;  3DVN V;  4MSQ B;  3QWZ B;  3VUX A;  2DZM A;  2M1M A;  2MSE D;  3ML8 A;  5KHQ A;  4EZL A;  1V5T A;  4BVU C;  5AEK B;  3VXW A;  1XT9 B;  2KDI A;  3DBL I;  3N30 A;  4NQL B;  1WY8 A;  2KC2 A;  2KMC A;  4AJW A;  4EZK A;  2PE6 B;  3C0R B;  1IP9 A;  2CU1 A;  4K7S A;  1WX9 A;  3L13 A;  4EKU A;  2MRP A;  4NPN A;  2D10 A;  2L76 A;  2HD5 B;  3PT2 B;  3SHQ A;  2KMA A;  4HPL B;  2MWS B;  1E8Z A;  1UH6 A;  2LXA A;  2ASQ A;  3QHT A;  2KHW B;  2MP2 A;  4GU2 A;  1ZW7 A;  3PVL A;  4BOZ B;  2LJ5 A;  2BYE A;  5AZH A;  2MBB B;  4FJY A;  3UIP B;  3ZKJ C;  2IY0 B;  1ZGU B;  3ZTD A;  4W9E A;  3DOW A;  2ZJD A;  3VUW A;  2KWC A;  4GGQ A;  3AU4 A;  1YX6 B;  1A5R A;  1YJ1 A;  3ONS A;  3A4R A;  3EEC A;  2KJ6 A;  3HM6 X;  4E74 A;  3R7Q A;  1V81 A;  1WM3 A;  1GG3 A;  2Z0E B;  1SIF A;  4MH0 E;  1IPG A;  3RCZ A;  2JRI B;  4KSL C;  5LLI A;  2UYZ B;  5EDS A;  3A1Q A;  2BYV E;  1T0Y A;  2L7R A;  3KW5 B;  3NHE B;  2LI5 A;  1WXM A;  2C9W B;  2DYM A;  1P1A A;  2ZCC A;  4WWO A;  1PQS A;  1OEY J;  3RD2 A;  2LXC A;  5CHW A;  1WMH A;  4WWN A;  3ALB A;  3VHT C;  1NBF C;  4JL9 A;  4MSM B;  2FNJ B;  3GZN I;  2JT4 B;  4W9H A;  5E6N A;  4NY0 A;  4TV3 A;  4EUT A;  3O65 B;  5J2R A;  4IM2 A;  4URK A;  4X57 B;  2BWE S;  2NBV B;  5CTR C;  4ANX A;  5L95 C;  2D2Q A;  2LRW A;  4BOS C;  3ZNI D;  3KUC B;  4GSW A;  4IM0 A;  2VRR B;  2PE9 A;  4PS8 A;  4HDO A;  3A9J A;  2C7H A;  2KK8 A;  4LCD E;  2IBI B;  3U8Z A;  3UQB A;  3CF6 E;  3VVW B;  3ZTC A;  4FBJ B;  4EZJ A;  4EFO A;  2D11 A;  1WXS A;  1WGD A;  1ZKH A;  2K8H A;  2NPT B;  3AI5 A;  2GOW A;  4IWO A;  4ZRI A;  2N9E B;  2KOX A;  4HXD A;  1WJU A;  2GBR A;  1GJZ A;  4W9I A;  5KHO A;  2A4Z A;  2B3A A;  1WGH A;  4I6P A;  3TIX A; 
#chains in the Genus database with same CATH topology
 4XGA B;  5EE0 A;  5IAA C;  1EWY C;  1E7V A;  2IO0 B;  3TSS A;  2PMV A;  1J0G A;  3WAO A;  1DOX A;  1Q1O A;  2K22 A;  4PYZ A;  2RD0 A;  2M19 A;  3DHG C;  4TKN A;  4YWG G;  4USA A;  3T9L A;  2KLC A;  2KAJ A;  5IO9 A;  3GE8 C;  4MGY E;  4WWP A;  2REX A;  1VRA B;  1IBX B;  4ANW A;  4KIK B;  3JYU A;  2CHZ A;  2WLB A;  5FKA C;  5IA7 A;  2JXT A;  1E5W A;  5HKH A;  3Q3O C;  1FNW A;  3PRE A;  3RUI B;  3UI3 A;  1FRR A;  4A8X C;  1HXY D;  4RCO A;  4TMA B;  5E6O A;  3HIZ A;  4PYU A;  2LGX A;  3MJ5 A;  4XYC A;  5LXH A;  4HDQ A;  3QCA A;  3VR8 B;  2KDB A;  2HJ1 A;  2O2V A;  1P98 A;  4W9G A;  3VAW A;  1K53 A;  1N5W A;  2O6V B;  4DK5 A;  2LWP A;  2X38 A;  3SD5 A;  4FXC A;  3B9J A;  3L17 A;  3B08 A;  3MP9 A;  4FJZ A;  4LDT B;  4WQO B;  1Y56 A;  4AP4 C;  2QIE B;  3RN9 C;  2RPV A;  2EMT A;  3R66 C;  3GZN B;  4KSK C;  1RFK A;  3WIM A;  2WWZ A;  4HRO A;  2N0S B;  3ABV B;  5D2M B;  1Q0W B;  2WDT B;  2K6Q A;  5FR3 A;  3UF8 A;  2G3Q B;  1QF6 A;  2LUM A;  3AED B;  2BTE A;  2WNM A;  4GXB A;  3KH0 A;  2KMM A;  2Z59 B;  4TQ0 A;  4RM8 A;  3CST A;  3VFK A;  4ACF A;  1P7E A;  2KC1 A;  3Q69 A;  1F9J A;  4M0W B;  3JVZ X;  3U7Z A;  3PRM B;  3V62 A;  1F1H A;  4YSX B;  1QLB B;  1KLV A;  2PEA A;  1TS2 A;  2K0P A;  2LGY A;  2MEK A;  1XQQ A;  4K3C A;  5BMH A;  3CMM B;  3B0A A;  5AUI A;  1OQY A;  2K1F A;  4Q2J A;  4TQ1 A;  2ZVN A;  5IOI A;  2OED A;  2KO3 A;  3QC8 B;  2LZ6 A;  3CSF A;  5TR5 A;  5D94 A;  1IYF A;  1F2R C;  4IG7 B;  1PFD A;  3QIJ A;  4IW0 A;  5HG2 A;  4HWI B;  1R4M B;  2VZK B;  2V3P A;  4YL8 A;  1XD3 B;  3U52 E;  3R3M A;  2KYW A;  4MEL A;  5IN7 A;  3VRA B;  1C3T A;  5C3J B;  2JU6 X;  1T3Q A;  4J3O D;  4IOI E;  5DPR A;  3NY5 A;  1AWD A;  1SB3 C;  1MHH E;  2LJI A;  3IG3 A;  3RFZ B;  2JYE A;  2JWZ A;  2K9X A;  4MDK E;  5E6J A;  4MAC A;  2IYD B;  1P0R A;  2Y5P A;  3AEG B;  3ENE A;  3OJ3 A;  1RFA A;  4B6W A;  4WAF A;  3SR6 A;  3I57 A;  1WJN A;  1QOB A;  3BWU D;  1YMH E;  3AUL A;  4YTM B;  4WJP A;  3TJP A;  2IZV B;  4GOC A;  1ZPS A;  3V6C B;  2KN5 A;  2MH7 A;  4US9 A;  1D6E C;  5JZE B;  2WX0 A;  1E8Y A;  3PSE B;  3NZU A;  1EUV B;  4OVV A;  2JQR B;  3A4S C;  1GUA B;  3ZW3 A;  1GPX A;  4ZYN A;  1AW7 A;  2WXR A;  2K8B A;  1IBX A;  2AWT A;  2N1V A;  3RZF A;  1MG4 A;  1WXA A;  1TBE A;  3TEW A;  2G9H D;  4PT5 A;  3TUO A;  3DDC B;  3MC9 A;  2W54 A;  4YXD B;  2XEW A;  3HVZ A;  3P4R B;  1MPE A;  2DBY A;  3QAR A;  2C7N B;  1JWU D;  3A9K B;  1EM7 A;  3ECI A;  3NZS A;  2RR9 A;  1JRO A;  2BT6 A;  4ZOH C;  2KDE B;  3AH7 A;  2HTH A;  4BFR A;  3P63 A;  4MGZ E;  1WFY A;  4BKG A;  3DPD A;  3EFC A;  1WX7 A;  1Q5W B;  4IC7 B;  2O6V A;  1HQR D;  3O13 A;  2K8C A;  1PUT A;  2DAJ A;  3A33 B;  2RPQ A;  1C78 A;  2E6X A;  2C7M B;  2CKH B;  2KX3 A;  5JXV A;  4K3B A;  3ZRC A;  3L0W B;  1TKY A;  2LGS A;  3P2B A;  1UZX B;  3L4P A;  4XDC A;  1UGM A;  1EU3 A;  5D6J B;  5J18 A;  4PS3 A;  4G50 A;  2HE7 A;  2KQ7 A;  2WU2 B;  4LNI A;  1OEY A;  4PK1 A;  3GE3 C;  1KM7 A;  1UF0 A;  3GS2 A;  4K1R B;  4LNN A;  3AEF B;  2JZZ A;  3LJ3 A;  1D5X C;  1JML A;  3TEZ A;  1QZE A;  2H89 B;  4RM9 A;  3ZUN A;  1FMA D;  4RF0 A;  1V1P A;  3RZW C;  3R2T A;  1EU4 A;  2QCZ A;  2XK5 B;  2MX2 A;  4MSQ B;  3QWZ B;  3VUX A;  2M1M A;  3ML8 A;  1V5T A;  2KDI A;  4AJW A;  2KMC A;  4K7S A;  1WX9 A;  2V0G A;  4EKU A;  2MRP A;  3RNA C;  1RWS A;  2KMA A;  2IPK D;  1UH6 A;  4A55 A;  1JQ4 A;  4A90 A;  4BOZ B;  2FE8 A;  2MBB B;  1JWS D;  4FJY A;  1ZGU B;  2W55 A;  4W9E A;  3VUW A;  2KWC A;  2KQ4 X;  1FFV A;  4MH8 A;  1N60 A;  4ZHO A;  1SIF A;  3E56 A;  5IP4 D;  3U2S C;  1XLQ A;  2DYM A;  2C9W B;  4WWO A;  3FAH A;  3DWG C;  1OEY J;  2LXC A;  4HEA 1;  3SEB A;  1YN5 A;  1ZDV A;  1NBF C;  2JZP A;  3B2F A;  4MSM B;  3GZN I;  2JT4 B;  3IT6 B;  3NS1 A;  2ZW0 A;  4X57 B;  5CTR C;  2CJO A;  3ZNI D;  5BYR A;  1UUP A;  4HDO A;  2KK8 A;  4NJC A;  2IBI B;  3Q3M C;  3VVW B;  3ZTC A;  4FBJ B;  5G5H A;  2D11 A;  1WGD A;  2K8H A;  3AI5 A;  2GOW A;  1K50 A;  4HXD A;  5KHO A;  2B3A A;  1ESF A;  1WGH A;  4DHJ D;  1EO6 A;  2N7J A;  5AZF A;  3ZDT A;  2L52 A;  4P1C C;  1YN3 A;  4JLC A;  4DHZ B;  1WZ0 A;  2JY6 A;  1I4P A;  2XN9 C;  3DVG X;  3LYY A;  2BPS A;  3AE9 B;  3QAQ A;  2GBJ A;  2NCN A;  3BY4 B;  4M8N A;  3QA8 A;  2TSS A;  3W5V B;  5GMV A;  3IFW B;  3PRP B;  4B9K A;  1N5X A;  3A9K A;  4OVZ A;  1WXV A;  2CHW A;  4I6L B;  2WS3 B;  2ON8 A;  1HE8 A;  1GC6 A;  2V3S A;  3APC A;  4E71 A;  4IUM B;  2KAC A;  4RGO S;  1WGG A;  4FUL A;  1LQB A;  3D32 A;  4W9D A;  2D07 B;  4BBN F;  2GI9 A;  2WHI A;  1PGX A;  4JX1 C;  2FUH B;  3L10 B;  5MPO A;  2ACZ B;  2IJ0 A;  3BIN A;  2EKE C;  2DX5 B;  4NZL B;  1FD6 A;  3NVY A;  1JWM D;  2C60 A;  4G3X B;  1MFW A;  3L54 A;  5DPS A;  1TGZ B;  2DYB A;  1JAL A;  3V05 A;  1U4A A;  2G45 B;  1ISN A;  4N9F 4;  4IWP A;  4G11 A;  4HKQ A;  2H88 B;  3BYT B;  2NBW B;  4LLG M;  4JE3 B;  1V80 A;  3AE2 B;  2MW5 A;  2KT7 A;  2J0K A;  3OLM D;  4WJQ A;  4XX5 A;  1P7F A;  4S0R A;  1YQ3 B;  3AXC A;  3TBL D;  3SU8 X;  2WXH A;  2JXX A;  2XK5 A;  1ZXI A;  1G6J A;  4L1B A;  1FO4 A;  2LVO A;  1J7C A;  1JRP A;  1QKZ A;  2I2Y A;  3X0W A;  3IT4 B;  3LXF A;  2N1W A;  3J9C A;  5G55 A;  1WRD B;  4JQW C;  2M0A A;  3FC4 A;  2R2O A;  3U4E G;  4RF1 A;  1STE A;  4E3C A;  3CIR B;  5FK9 C;  1DOI A;  4RGN A;  1RAX A;  4C00 A;  2L32 A;  4LJP B;  3AEE B;  1AAR A;  2OJR A;  5T8I A;  2YEP B;  2BF8 B;  2Y3A A;  2KN4 A;  5C23 A;  2KVZ A;  4KGT A;  2L0F A;  2AQ1 B;  1F2R I;  2ONQ A;  2N9X A;  3PPA A;  4UDU C;  2MBE A;  2ZPY A;  1AYF A;  1FNU A;  3KWV A;  1FNV A;  4IDI A;  1FCL A;  4S17 A;  4A6Q A;  1V9J A;  4KV2 A;  3ZIM A;  1WYW B;  2KWV B;  3Q8C A;  5LXI B;  2WXL A;  3RNE C;  2YLM A;  4NJ6 A;  2K6D B;  2MA9 B;  1I4X A;  3PV1 A;  2Q5W D;  1F77 A;  4DBG A;  4F7Z A;  1RLF A;  4N6E B;  1OTR B;  4AWJ A;  3H9D A;  1WGK A;  2G1E A;  3KWL A;  4KDI C;  3RNG C;  3ZJU A;  2JPH A;  3SFE B;  4GN1 A;  4MGK E;  1T0R C;  5L83 A;  1J7B A;  3M3J A;  5C2T B;  2KX0 A;  1S1Q B;  4ICV A;  5EE3 A;  3N20 C;  3A9J B;  5JHA A;  4DWF A;  2IO3 B;  1VCB A;  1R7S A;  1L0X B;  2BKR B;  4II3 B;  4F8C B;  4II2 B;  2WDR B;  4NQK E;  1YJJ A;  4DXF A;  2GB1 A;  1YX5 B;  2NBU A;  3AM9 A;  1QT9 A;  2KFK B;  3ZO5 B;  2INP E;  3NJT A;  2GBN A;  3KYC D;  5BYQ A;  2KAN A;  2MLB A;  1FXT B;  3I5J C;  2L8J A;  3UIO B;  3PLV A;  4AQ7 A;  5C1Z A;  4GDL B;  1GOZ A;  2G4D B;  5GXG B;  2GBK A;  2DZK A;  1V1O A;  2WP9 B;  3ML9 A;  2QC8 A;  2BS3 B;  3DBH B;  1MI0 A;  3ZNG C;  1WJ4 A;  5G2N A;  2MJE A;  4ANV A;  2WQY B;  2ZEQ A;  4TSS A;  1V1P B;  3N1Y C;  3P4P B;  3MHZ A;  1PDX A;  2FCQ A;  5FR6 A;  3DHH C;  2WYQ A;  1VLB A;  4PS7 A;  2FCN A;  1EF1 A;  2JZ3 B;  3ZNH B;  1FIQ A;  2A5U A;  1L2N A;  1YQB A;  3DBS A;  2J52 A;  4JPS A;  2KXJ A;  4IKG A;  3AE1 B;  3V61 A;  1RYJ A;  1PYW D;  3JSV A;  2DWQ A;  1EF5 A;  5CHV C;  2CJN A;  4B0E A;  3P4S B;  4GDK B;  4WWM A;  2INN E;  1L6U A;  1WM2 A;  1D4B A;  1B9R A;  2J0J A;  2ZW1 A;  3W9C B;  4BKS D;  4B95 A;  4M00 A;  2KTR B;  1HZ5 A;  1KF6 B;  3W5U B;  1GB1 A;  1YNT E;  3HUI A;  4FAD A;  1L4D B;  4MM3 B;  1GNU A;  5LNK 1;  1WYG A;  3S2A A;  2W3R A;  2LRU A;  1VZ6 A;  2WXF A;  1NEN B;  4AJY B;  4L2Y A;  3QQ8 B;  2JUO A;  4NAW A;  4C4V B;  2RGF A;  1E10 A;  2I1J A;  2DZJ A;  1I7H A;  4P6V F;  2KWU B;  2D5G A;  2DZM A;  5KHQ A;  3BYY B;  5AEK B;  3VXW A;  1XT9 B;  3I63 C;  4ZRP A;  1WY8 A;  2KC2 A;  1T0S C;  2PE6 B;  3BZD B;  5HFY A;  1KLG D;  3AV8 A;  3SHQ A;  1K51 A;  2BB6 A;  2MWS B;  2LXA A;  1EWC A;  2MP2 A;  5AZH A;  3PO0 A;  4L23 A;  1TS3 A;  3NVW A;  3ZKJ C;  3AU4 A;  1A5R A;  1YJ1 A;  3A4R A;  3EEC A;  2B76 B;  5G5G A;  3HM6 X;  1Q10 A;  4E74 A;  1VZ7 A;  1GG3 A;  2Z0E B;  4RNA A;  4O1N A;  3RCZ A;  2JRI B;  5LLI A;  5EDS A;  2UYZ B;  1IGC A;  3NHE B;  2QDF A;  1P1A A;  3WCQ A;  3RD2 A;  5CHW A;  4CQN A;  2FBW B;  3ALB A;  3AE3 B;  4JL9 A;  2WXI A;  5E6N A;  4W9H A;  1XXG A;  1HZ6 A;  4NY0 A;  3NG0 A;  4EUT A;  3O65 B;  4AS1 A;  3OWE B;  1E6E B;  4GSW A;  3A9J A;  1TZO A;  2C7H A;  2Y5C A;  1XCT L;  1ET6 A;  1TKE A;  4EFO A;  3H8H A;  1WXS A;  3MC8 A;  2N9E B;  4YSY B;  1CJE A;  4W9I A;  1HA5 A;  1F52 A;  2WXJ A;  2GRI A;  2LGI A;  1T0Q C;  3IBE A;  1R4N I;  4P7I A;  2KFK A;  3EGR A;  1NEK B;  2RDB C;  4HK2 A;  1DGJ A;  3B2G A;  4JIO U;  3FKY A;  4BZA A;  2BYF A;  2I1K A;  1SE3 A;  3HRD D;  3PTF C;  1OQR A;  2V4L A;  4GDL A;  3TL5 A;  4KZ0 A;  4FLH A;  3V60 A;  3PHW B;  4KKJ A;  3DBR B;  2M0X A;  3EC8 A;  4F1S A;  2LD9 A;  4DHJ B;  3MJW A;  2CU3 A;  2KD0 A;  3I9V 1;  3WAN A;  4LNF A;  3RNB C;  2WX1 A;  2V9H A;  1TZ1 A;  3T3N A;  4DXG A;  3H6N A;  3PGE A;  3W1Y A;  3KUD B;  4MJS B;  2DLB A;  1TY0 A;  3RPF C;  3U7D A;  3MHS D;  1H4R A;  2L00 B;  1UBQ A;  2K5P A;  1JW9 D;  4REZ A;  3N32 A;  3ZJT A;  2VH1 A;  4KDL B;  3N3K B;  4ZYS A;  1UEL A;  1WJ6 A;  2KFJ A;  1TIF A;  2NPT A;  2R2Q A;  3PS6 A;  1KJT A;  4FHJ A;  2JX5 A;  4N59 A;  5D7G A;  4WJO A;  1JCK B;  3L16 A;  3H7S A;  1SF0 A;  3Q3N C;  3QJZ A;  4YSZ B;  1V8C A;  4GDK A;  1TYG B;  3ZLZ A;  3R8B A;  2WXN A;  4AUQ C;  1E9M A;  1RRB A;  1ROE A;  3L08 A;  4JWS C;  2LVQ A;  4EE2 A;  5DPW A;  2KNB A;  2KTR A;  2M8S A;  1K8R B;  2N9K A;  5BMI A;  1BT0 A;  5I4D A;  1ENF A;  3AEC B;  1YN4 A;  2QMT A;  1ZOY B;  3EUB 2;  4MM3 A;  2AYO B;  3NUH B;  1DOY A;  3AE6 B;  3GOE A;  2KQS A;  2M4N A;  4XDD A;  5CHF A;  3Q8E A;  3WAL A;  1KFY B;  4C4V A;  2BW2 A;  4C80 A;  1MHX A;  4IM3 A;  3H7P A;  4N58 A;  4ARC A;  1WGY A;  4JGH B;  1FXI A;  2MBQ A;  1D3Z A;  3VDZ A;  3OG5 A;  3URY A;  1MG8 A;  4ANU A;  2WXG A;  2N7D A;  4CO7 A;  2KZR A;  3M62 B;  2SEB D;  2KVR A;  1LFD A;  3PRZ A;  2INC C;  1L7Y A;  3DBH I;  3EHV A;  4WJN A;  1WF9 A;  4W9F A;  1JWA D;  1YIW A;  2JF5 A;  2KJH B;  2W82 A;  3HHM A;  1Y8R C;  3JW0 X;  1QOG A;  2RMM A;  4WH4 A;  2BKF A;  3P1M A;  4OVU A;  2J42 A;  4DQO C;  1YD8 U;  2BB5 A;  2LAS A;  4C7Z A;  4KKI A;  2K39 A;  2EMS A;  1KOT A;  3Q8F A;  3UQA A;  3ZRF A;  1XLO A;  2IGD A;  4EOY A;  3AEB B;  4TUU A;  5AZG A;  2UWQ A;  3RUL A;  4NAM A;  1WR1 A;  2LUE A;  1L0Y B;  2IDY A;  3DCG A;  5DPT A;  1Z2M A;  2QIL A;  1CMX B;  1R4M I;  4RGM A;  4ASW C;  3NOB A;  4FJV B;  2KLG A;  2KWD A;  4KX6 B;  1ZXH A;  3UIN B;  3VRB B;  1WMH B;  3SDL C;  2PTL A;  4HRS A;  2YVC A;  2N9P C;  4K7W A;  1M94 A;  4H2A A;  1WGR A;  2MCN B;  3KUZ A;  1LGR A;  1RM6 C;  3Q3J A;  4ZRJ A;  2FUG 1;  4K7U A;  2PLP A;  5E6P A;  4LNO A;  2WDV B;  1TJE A;  2D3A A;  1TKG A;  1V5O A;  2GMI C;  2Y5B B;  1C9F A;  3CWI A;  3BK1 A;  3JSV B;  3WA0 A;  4DXA B;  5DCN A;  1HEZ E;  3V6E B;  4ICU A;  1SJH D;  2Z0D B;  2LHE A;  2NS5 A;  2UU7 A;  4YTN B;  3E9S A;  2XNA C;  2WXK A;  2KDF B;  1D5M C;  4MJS A;  2D3G A;  3AMZ A;  3W1S A;  3TEX A;  1FXA A;  2G4S A;  4KZC A;  4KGS A;  1NI2 A;  2E3T A;  1V6E A;  2GLS A;  3DVN U;  1E7U A;  1I42 A;  1WIA A;  3DQV A;  4NAW B;  2J0M A;  2CR5 A;  1V86 A;  2HTM E;  3EFU A;  3NVV A;  1HTO A;  4HVB A;  1NYR A;  2IO1 B;  3OJ4 B;  1L6V A;  4D2K A;  1UWM A;  3WAP A;  1UBI A;  1MJD A;  1UNS A;  2AL3 A;  1L4Z B;  2EEL A;  2WU5 B;  2Z8L A;  3T8M A;  4ZHP A;  2MP2 B;  4MEM A;  2HDE A;  3ZXV A;  2KTF A;  2L05 A;  2K3U A;  1DYQ A;  4OZC A;  3MTN B;  3X23 A;  2FIF A;  1E90 A;  1J8C A;  3APF A;  1WH3 A;  4AOF A;  1ACC A;  1A70 A;  1QQR A;  5JHB A;  3DVG Y;  2BYT A;  3RYT A;  4LJO B;  2CHX A;  1AN8 A;  3ZJV A;  2FAZ A;  1WI0 A;  2ZNV C;  3DBR I;  1BUI C;  1VD2 A;  2V3N A;  2GBM A;  1CQV A;  2DYO A;  4NNJ B;  1WXQ A;  2I38 A;  3NVZ A;  4RGT A;  3C19 A;  3Q8A A;  3ETR A;  3BVZ A;  3AB5 A;  3AEA B;  3NZ3 A;  3FIL A;  3ZYY X;  4EZK A;  1IP9 A;  3IAS 1;  3C0R B;  1XO3 A;  2CU1 A;  5BYS A;  4NPN A;  1V97 A;  2L76 A;  1JWB D;  2HD5 B;  4HPL B;  2LHD A;  1I4G A;  1E8Z A;  3QHT A;  1YQ4 B;  3N1Z C;  1ZW7 A;  3KLS X;  3PVL A;  2WDQ B;  2LJ5 A;  1CZP A;  1N6Z A;  3UIP B;  3ZTD A;  3DOW A;  4GGQ A;  1YX6 B;  2BQQ A;  3ONS A;  1D5Z C;  3R7Q A;  1WM3 A;  1XLN A;  3RNC C;  2MJ3 A;  1SJE D;  3A1Q A;  2BYV E;  1T0Y A;  1WXM A;  1ZUD 2;  2LI5 A;  1PQS A;  2EKI A;  1WMH A;  4WWN A;  1VZ8 A;  2N9L A;  4A9A A;  3IAM 1;  1CK1 A;  4TV3 A;  4WUR A;  4ANX A;  2NBV B;  5L95 C;  2D2Q A;  4IM0 A;  3LB8 C;  1HTQ A;  2VRR B;  4OZA A;  4PS8 A;  4WIP A;  1I4R A;  4ITK A;  2PW9 A;  4M02 A;  2NPT B;  4ZRI A;  2KOX A;  4ZRQ A;  1SBB B;  1TS5 A;  3DHI C;  3KQ4 A;  4I6P A;  4ARI A;  2NTS A;  3RT3 B;  1FM0 D;  1MVK A;  4DHZ E;  1H8C A;  4HCP B;  4HPM B;  4M8M A;  1PGA A;  4CHK A;  3LDZ E;  4W9C A;  1F0Z A;  2LVP A;  3PZ7 A;  3VUY A;  1BXT A;  4LTU A;  1XLP A;  2NTT A;  2JRH A;  4BBN C;  2ZNV B;  3HK0 A;  4MT5 A;  4RMA A;  2FCM A;  2JSV X;  3IXS A;  3U30 A;  3AE4 B;  4XWW A;  3R2I A;  2NVU I;  2KJR A;  1C4P A;  4BKT A;  3H7P B;  1OFF A;  2OHF A;  4R3D A;  1VJK A;  4B0M A;  3DBL B;  1BML C;  3IVF A;  2ICI A;  2NMQ A;  3IHP C;  2O6V D;  3PLU A;  3AE5 B;  4OW0 A;  1S3S G;  2MBH A;  2BBC A;  4P16 A;  2LEK A;  2NR2 A;  4GMV A;  4LDT D;  3VH4 B;  2MBO A;  3W1S C;  2YEP F;  2W9N A;  5EE1 A;  4DDG D;  2V1Y A;  1UGJ A;  2DZI A;  4OHJ A;  1FRD A;  2C5L C;  1FFU A;  2IND C;  2XBB C;  3T3O A;  1T6B X;  2LMC A;  3VTV A;  1FEH A;  3APD A;  4LK0 M;  4HLE A;  3EA6 A;  3R7R A;  1K52 A;  4KVG B;  4A3P A;  2RSU A;  4GB9 A;  1VR9 A;  1LO5 D;  2DEN B;  1WE7 A;  4HCN B;  2JVC A;  1SXT A;  1IUE A;  2PPH A;  4KIK A;  4JWU C;  2IO2 B;  5D3I B;  3MFG A;  1WX8 A;  4KGR A;  2BGF A;  3Q3F A;  4BKS A;  5BO4 B;  1Z5S B;  1L0V B;  1KRH A;  2SAK A;  1P3Q U;  5EE9 A;  4US8 A;  2L3Z A;  2WXO A;  1TS4 A;  4M01 A;  2VH2 A;  1TT5 B;  1WZ3 A;  1XCQ L;  2N4F A;  4XWT A;  3I3T B;  2PIA A;  3ZGZ A;  3KYD D;  3DWM A;  2WXQ A;  3MC0 B;  3ZXR A;  4W9K A;  3AE7 B;  1C76 A;  3VTU A;  3B1L X;  1C79 A;  1NYQ A;  2DNF A;  5BMG A;  3Q6B A;  3UGB B;  2VZK D;  1IGD A;  2BVC A;  3PZD A;  1WE6 A;  1GC7 A;  1P9D U;  1TY2 A;  2QEJ C;  4A3O A;  3RMK C;  3H1U A;  3K9P B;  1PGB A;  1WR6 E;  1WSP A;  1KTK A;  2L83 A;  5H92 C;  1X1M A;  1B1Z A;  2KKC A;  1I4H A;  4EEW A;  4MGI E;  4I6N B;  3ZVV A;  1UD7 A;  3ZDM C;  3ZNZ B;  1E0Z A;  2PVG C;  2HJ8 A;  5HHD G;  2DAF A;  1ZE3 D;  1C4C A;  1LXD A;  5HI1 A;  1M4V A;  3QK0 A;  4W9J A;  1GAQ B;  1ZDX A;  2AEH A;  2WXP A;  3W2D A;  1V2Y A;  1OGW A;  3NS8 A;  3TMP B;  2LGD A;  2OOB B;  2AX5 A;  2V4I B;  2ZPN A;  4M0W A;  1YOV B;  2LFI A;  4W9L A;  1WRI A;  1QOA A;  2IY1 B;  4C56 C;  4DDI D;  3WAM A;  4J6I A;  2D3C A;  1J7A A;  4HKZ E;  3M63 B;  1N63 A;  2ZZP B;  4WAA A;  2ZVO A;  1XEE A;  2PVO D;  2WGS A;  3K9O B;  3VR9 B;  4XE0 A;  3BVG A;  2QJL A;  4P1B C;  2BS4 B;  2L0T A;  2QHO A;  4HJG E;  4CYE A;  3BVM A;  2JYT A;  4GIV A;  3M95 A;  3Q14 C;  4NJ7 A;  2OJW A;  1YJI A;  1C77 A;  4G0N B;  1QOF A;  2RDG A;  2PJH A;  1SE4 A;  3BII D;  3Q2A C;  3BK2 A;  2M17 A;  4ZRK A;  5JH5 C;  1L5P A;  3P4Q B;  4FN2 A;  4WQM A;  4OZB A;  2X8X X;  1J19 A;  3AU5 A;  1C4A A;  2MHJ A;  4GLS C;  1E8W A;  2R61 A;  3RI7 C;  3TCA A;  4XZ4 A;  1N61 A;  3PHX B;  4A20 A;  2FID A;  3VTW A;  1T5X D;  4K81 A;  3PZ8 A;  3VQI A;  3FIL B;  4YT0 B;  1NDD A;  2BS2 B;  1VDV A;  3N1X C;  2AL6 A;  2M56 B;  4XC2 A;  3RNF C;  2BWF A;  3OAW A;  1I35 A;  2FCS A;  2RDH A;  1TTN A;  5CX3 A;  2CS4 A;  2J4X A;  4HJK A;  5J17 A;  2O2V B;  2JWU A;  4FA6 A;  2WXM A;  1E8X A;  3HM3 A;  4FHK A;  1UWX A;  2QSD A;  3GB1 A;  1XF5 L;  3P42 A;  5D3D A;  3VH3 B;  2DHZ A;  2J7Q B;  2KDM A;  3A1Q B;  5H8Y E;  4QAY A;  3AE8 B;  4YTP B;  1SGH A;  1LM8 B;  2MQJ A;  4C7Y A;  2K25 A;  4IWQ A;  5IKC M;  1N62 A;  1V49 A;  3V3X A;  3Q8B A;  2ZCB A;  4ZDV A;  1GB4 A;  2N7E A;  1NI3 A;  1SE9 A;  1JRU A;  3QX1 A;  1C1Y B;  3KVF B;  3DVN V;  2MSE D;  3NRZ A;  4EZL A;  2J53 A;  4BVU C;  2AQ3 B;  3DBL I;  3N30 A;  4NQL B;  3SFD B;  4HPP A;  3L13 A;  3TEY A;  2D10 A;  3PT2 B;  1ZP0 B;  2ASQ A;  4GU2 A;  2KHW B;  2BYE A;  1OQQ A;  2MJD A;  2IY0 B;  2W3S A;  2ZJD A;  1SIJ A;  2L1A A;  1WWT A;  3GP7 A;  2KJ6 A;  2IGH A;  1V81 A;  2PKO A;  3AN1 A;  1FCC C;  4MH0 E;  1SSN A;  1IPG A;  4KSL C;  5AUK A;  1E7P B;  2L7R A;  3KW5 B;  2ZCC A;  5TSS A;  2AQ2 B;  3VHT C;  4BAX A;  4RFB A;  2FNJ B;  3N9Y C;  1NVI D;  1KH0 A;  5J2R A;  4IM2 A;  3C8Y A;  4URK A;  1SE2 A;  2BWE S;  2LRW A;  4BOS C;  2IGG A;  3KUC B;  4RH6 A;  4LNK A;  2PE9 A;  1FPY A;  4LCD E;  3U8Z A;  3UQB A;  3CF6 E;  2D3B A;  4EZJ A;  3ZQ4 A;  1KLU D;  3HVD A;  1ZKH A;  4IWO A;  1QIL A;  1ET9 A;  1WJU A;  2GBR A;  1GJZ A;  1SEB D;  1R4N B;  2A4Z A;  1I4Q A;  3TIX A; 
#chains in the Genus database with same CATH homology
 3RT3 B;  3IBE A;  1EO6 A;  5AZF A;  3ZDT A;  5IAA C;  4DHZ E;  1R4N I;  2IO0 B;  1E7V A;  4P7I A;  1H8C A;  2KFK A;  4HCP B;  4HPM B;  4M8M A;  1J0G A;  4CHK A;  3LDZ E;  4W9C A;  4JLC A;  3WAO A;  2LVP A;  4DHZ B;  1WZ0 A;  2JY6 A;  4HK2 A;  3VUY A;  4JIO U;  1Q1O A;  3DVG X;  2BYF A;  2I1K A;  4PYZ A;  2JRH A;  2RD0 A;  2BPS A;  4TKN A;  2ZNV B;  3PTF C;  2V4L A;  3QAQ A;  4BBN C;  3HK0 A;  2GBJ A;  2NCN A;  3BY4 B;  4M8N A;  3QA8 A;  3T9L A;  4GDL A;  3TL5 A;  4KZ0 A;  4FLH A;  3V60 A;  3PHW B;  4RMA A;  2FCM A;  2KLC A;  3IFW B;  5GMV A;  2M0X A;  3EC8 A;  3PRP B;  4B9K A;  4F1S A;  2LD9 A;  4DHJ B;  3MJW A;  3WAN A;  2KD0 A;  3A9K A;  4MGY E;  2WX1 A;  1WXV A;  2CHW A;  2REX A;  4WWP A;  3U30 A;  4I6L B;  4ANW A;  4KIK B;  1TZ1 A;  3APC A;  1HE8 A;  1GC6 A;  2V3S A;  3JYU A;  4E71 A;  2CHZ A;  3H6N A;  2NVU I;  2KJR A;  3PGE A;  3W1Y A;  4IUM B;  5IA7 A;  4BKT A;  3H7P B;  3KUD B;  4MJS B;  5HKH A;  1E5W A;  1WGG A;  4FUL A;  3U7D A;  1LQB A;  3D32 A;  3IVF A;  1H4R A;  2D07 B;  3MHS D;  3PRE A;  4W9D A;  3IHP C;  2L00 B;  4BBN F;  2O6V D;  1UBQ A;  3RUI B;  3N32 A;  3PLU A;  4KDL B;  3N3K B;  2FUH B;  3L10 B;  1S3S G;  1UEL A;  1WJ6 A;  2KFJ A;  2MBH A;  2NR2 A;  2NPT A;  2R2Q A;  3PS6 A;  1KJT A;  2MBO A;  3BIN A;  4FHJ A;  4GMV A;  4LDT D;  5E6O A;  3VH4 B;  2W9N A;  3W1S C;  4DDG D;  3HIZ A;  5D7G A;  2V1Y A;  2EKE C;  2DX5 B;  4WJO A;  4PYU A;  2DZI A;  2LGX A;  2C5L C;  3L16 A;  2C60 A;  3H7S A;  5LXH A;  4G3X B;  3QJZ A;  4GDK A;  4HDQ A;  3ZLZ A;  3L54 A;  3QCA A;  2KDB A;  5DPS A;  1TGZ B;  2DYB A;  2O2V A;  2XBB C;  1P98 A;  4W9G A;  3VAW A;  2O6V B;  3VTV A;  4AUQ C;  4DK5 A;  1U4A A;  3APD A;  2LWP A;  2G45 B;  1ISN A;  4N9F 4;  4HLE A;  1RRB A;  3SD5 A;  3L08 A;  4IWP A;  2LVQ A;  3L17 A;  4G11 A;  5DPW A;  3B08 A;  2KNB A;  2KTR A;  2M8S A;  4FJZ A;  1K8R B;  3R7R A;  1BT0 A;  4LDT B;  4KVG B;  4A3P A;  2NBW B;  2RSU A;  4WQO B;  4AP4 C;  4GB9 A;  1V80 A;  2DEN B;  2EMT A;  3R66 C;  1WE7 A;  4HCN B;  2JVC A;  4MM3 A;  2MW5 A;  3OLM D;  2J0K A;  4KSK C;  2AYO B;  3WIM A;  4WJQ A;  3GOE A;  2KQS A;  2PPH A;  2WWZ A;  2M4N A;  4KIK A;  4XX5 A;  2IO2 B;  5CHF A;  3WAL A;  3AXC A;  1WX8 A;  3SU8 X;  5D2M B;  3TBL D;  2BGF A;  1Q0W B;  3Q3F A;  4IM3 A;  3H7P A;  2JXX A;  5BO4 B;  2XK5 A;  1Z5S B;  4BKS A;  2WDT B;  1G6J A;  1WGY A;  2K6Q A;  2LVO A;  4JGH B;  1P3Q U;  3UF8 A;  2MBQ A;  1D3Z A;  3VDZ A;  2G3Q B;  2L3Z A;  1MG8 A;  4ANU A;  2N7D A;  4CO7 A;  1WZ3 A;  2KZR A;  2N4F A;  3M62 B;  3X0W A;  3I3T B;  2KVR A;  1LFD A;  3KYD D;  3PRZ A;  4GXB A;  2N1W A;  3KH0 A;  1L7Y A;  3DBH I;  3EHV A;  4WJN A;  5G55 A;  1WF9 A;  1WRD B;  2Z59 B;  4W9K A;  4JQW C;  4W9F A;  4TQ0 A;  4RM8 A;  2JF5 A;  1YIW A;  2KJH B;  2R2O A;  3VTU A;  3CST A;  3VFK A;  3B1L X;  2KC1 A;  3HHM A;  1Y8R C;  3JW0 X;  1F9J A;  4M0W B;  3UGB B;  4E3C A;  3JVZ X;  2BKF A;  3PRM B;  3V62 A;  3PZD A;  4OVU A;  1WE6 A;  1KLV A;  2PEA A;  1GC7 A;  1P9D U;  2LGY A;  1XQQ A;  1RAX A;  1YD8 U;  2LAS A;  4A3O A;  4LJP B;  3CMM B;  1AAR A;  2OJR A;  3B0A A;  3H1U A;  3K9P B;  1OQY A;  2BF8 B;  2K1F A;  1WR6 E;  2K39 A;  4TQ1 A;  2ZVN A;  5C23 A;  2L0F A;  1X1M A;  2EMS A;  2KO3 A;  3QC8 B;  1KOT A;  2LZ6 A;  2N9X A;  3PPA A;  3UQA A;  3ZRF A;  2MBE A;  3CSF A;  5TR5 A;  2ZPY A;  5D94 A;  1IYF A;  2KKC A;  4EOY A;  4IG7 B;  4EEW A;  4MGI E;  4TUU A;  3QIJ A;  4I6N B;  5AZG A;  2UWQ A;  4IW0 A;  3RUL A;  4HWI B;  1V9J A;  4DHJ D;  1WR1 A;  4KV2 A;  3ZVV A;  2LUE A;  4YL8 A;  1XD3 B;  1WYW B;  3ZIM A;  1UD7 A;  3R3M A;  2KWV B;  3DCG A;  5DPT A;  1Z2M A;  3ZDM C;  4MEL A;  3ZNZ B;  2HJ8 A;  2YLM A;  5LXI B;  1C3T A;  1CMX B;  4NJ6 A;  2DAF A;  2K6D B;  1R4M I;  2MA9 B;  3PV1 A;  4ASW C;  5DPR A;  3NOB A;  3NY5 A;  4DBG A;  4FJV B;  1RLF A;  4F7Z A;  2KLG A;  1LXD A;  3IG3 A;  3QK0 A;  1OTR B;  4W9J A;  3UIN B;  2AEH A;  4AWJ A;  2JWZ A;  3H9D A;  1WMH B;  3SDL C;  4KDI C;  4MDK E;  1V2Y A;  1OGW A;  2YVC A;  2N9P C;  3NS8 A;  2JPH A;  3TMP B;  2IYD B;  4K7W A;  1P0R A;  1M94 A;  2LGD A;  1WGR A;  4GN1 A;  2OOB B;  4MGK E;  2MCN B;  3ENE A;  3OJ3 A;  1RFA A;  3KUZ A;  4B6W A;  3Q3J A;  5L83 A;  4ZRJ A;  4K7U A;  2ZPN A;  3M3J A;  2KX0 A;  1S1Q B;  5E6P A;  4ICV A;  4W9L A;  3A9J B;  5JHA A;  4DWF A;  1WJN A;  2IO3 B;  1VCB A;  3AUL A;  2IY1 B;  4WJP A;  3TJP A;  4DDI D;  2IZV B;  3WAM A;  1V5O A;  2BKR B;  2GMI C;  2Y5B B;  4GOC A;  4II3 B;  4J6I A;  4F8C B;  4II2 B;  3JSV B;  3V6C B;  4NQK E;  3WA0 A;  4DXA B;  5DCN A;  2KN5 A;  3M63 B;  5JZE B;  1YX5 B;  2WX0 A;  2ZZP B;  4WAA A;  1E8Y A;  2NBU A;  2ZVO A;  3PSE B;  3NZU A;  3V6E B;  1EUV B;  3K9O B;  4ICU A;  4OVV A;  3A4S C;  2KFK B;  1GUA B;  2Z0D B;  3ZO5 B;  3ZW3 A;  4ZYN A;  2GBN A;  3KYC D;  2K8B A;  2NS5 A;  2L0T A;  2QHO A;  2AWT A;  2N1V A;  3RZF A;  4CYE A;  2KAN A;  2MLB A;  1FXT B;  4GIV A;  1WXA A;  2KDF B;  1TBE A;  2L8J A;  3M95 A;  4NJ7 A;  3UIO B;  3PLV A;  5C1Z A;  4MJS A;  4GDL B;  4G0N B;  2D3G A;  3W1S A;  3DDC B;  2G4D B;  2PJH A;  2GBK A;  2DZK A;  2XEW A;  2G4S A;  4KZC A;  3ML9 A;  3QAR A;  2C7N B;  2M17 A;  3A9K B;  4ZRK A;  1NI2 A;  3ZNG C;  1WJ4 A;  3ECI A;  3NZS A;  5JH5 C;  5G2N A;  4ANV A;  1V6E A;  4FN2 A;  2RR9 A;  2ZEQ A;  3DVN U;  1E7U A;  1I42 A;  1WIA A;  3DQV A;  4NAW B;  1J19 A;  3AU5 A;  2J0M A;  2CR5 A;  2KDE B;  1E8W A;  1V86 A;  2FCQ A;  2HTH A;  3EFU A;  5FR6 A;  4BFR A;  3TCA A;  4XZ4 A;  4MGZ E;  1WFY A;  4BKG A;  3DPD A;  3PHX B;  4A20 A;  4HVB A;  2FID A;  2WYQ A;  2IO1 B;  3VTW A;  4K81 A;  3OJ4 B;  4PS7 A;  2FCN A;  2JZ3 B;  1EF1 A;  1WX7 A;  1Q5W B;  2A5U A;  4IC7 B;  3VQI A;  1YQB A;  3WAP A;  1L2N A;  2O6V A;  1UBI A;  3DBS A;  2K8C A;  1NDD A;  2KXJ A;  2DAJ A;  3A33 B;  3ZNH B;  2AL3 A;  2RPQ A;  4XC2 A;  3V61 A;  2AL6 A;  2BWF A;  3JSV A;  2C7M B;  3OAW A;  3T8M A;  2CKH B;  2KX3 A;  1I35 A;  1EF5 A;  2FCS A;  2MP2 B;  4MEM A;  3ZRC A;  1TTN A;  5CHV C;  3L0W B;  5CX3 A;  2CS4 A;  2KTF A;  2L05 A;  4GDK B;  3P2B A;  1UZX B;  4HJK A;  5J17 A;  2O2V B;  1WM2 A;  1UGM A;  3MTN B;  4FA6 A;  1E8X A;  3HM3 A;  4FHK A;  2J0J A;  5D6J B;  3X23 A;  4BKS D;  2FIF A;  5J18 A;  4PS3 A;  4B95 A;  1E90 A;  1J8C A;  4G50 A;  2HE7 A;  3APF A;  2KQ7 A;  1OEY A;  2KTR B;  1WH3 A;  1KM7 A;  4AOF A;  3VH3 B;  2DHZ A;  5JHB A;  2J7Q B;  3A1Q B;  3DVG Y;  4K1R B;  4FAD A;  3RYT A;  4LJO B;  2JZZ A;  2CHX A;  1GNU A;  3LJ3 A;  3S2A A;  1SGH A;  2FAZ A;  1WI0 A;  2ZNV C;  3DBR I;  2LRU A;  1LM8 B;  1QZE A;  2MQJ A;  4AJY B;  1VD2 A;  2K25 A;  4RM9 A;  4IWQ A;  3ZUN A;  2GBM A;  3QQ8 B;  2JUO A;  3RZW C;  1V49 A;  4NAW A;  4ZDV A;  2ZCB A;  2DYO A;  2N7E A;  2RGF A;  4NNJ B;  1SE9 A;  1JRU A;  2I1J A;  2DZJ A;  3QX1 A;  1C1Y B;  2XK5 B;  2MX2 A;  2KWU B;  3KVF B;  3DVN V;  4MSQ B;  3QWZ B;  3VUX A;  2DZM A;  2M1M A;  2MSE D;  3ML8 A;  5KHQ A;  4EZL A;  1V5T A;  4BVU C;  5AEK B;  3VXW A;  1XT9 B;  2KDI A;  3DBL I;  3N30 A;  4NQL B;  1WY8 A;  2KC2 A;  2KMC A;  4AJW A;  4EZK A;  2PE6 B;  3C0R B;  1IP9 A;  2CU1 A;  4K7S A;  1WX9 A;  3L13 A;  4EKU A;  2MRP A;  4NPN A;  2D10 A;  2L76 A;  2HD5 B;  3PT2 B;  3SHQ A;  2KMA A;  4HPL B;  2MWS B;  1E8Z A;  1UH6 A;  2LXA A;  2ASQ A;  3QHT A;  2KHW B;  2MP2 A;  4GU2 A;  1ZW7 A;  3PVL A;  4BOZ B;  2LJ5 A;  2BYE A;  5AZH A;  2MBB B;  4FJY A;  3UIP B;  3ZKJ C;  2IY0 B;  1ZGU B;  3ZTD A;  4W9E A;  3DOW A;  2ZJD A;  3VUW A;  2KWC A;  4GGQ A;  3AU4 A;  1YX6 B;  1A5R A;  1YJ1 A;  3ONS A;  3A4R A;  3EEC A;  2KJ6 A;  3HM6 X;  4E74 A;  3R7Q A;  1V81 A;  1WM3 A;  1GG3 A;  2Z0E B;  1SIF A;  4MH0 E;  1IPG A;  3RCZ A;  2JRI B;  4KSL C;  5LLI A;  2UYZ B;  5EDS A;  3A1Q A;  2BYV E;  1T0Y A;  2L7R A;  3KW5 B;  3NHE B;  2LI5 A;  1WXM A;  2C9W B;  2DYM A;  1P1A A;  2ZCC A;  4WWO A;  1PQS A;  1OEY J;  3RD2 A;  2LXC A;  5CHW A;  1WMH A;  4WWN A;  3ALB A;  3VHT C;  1NBF C;  4JL9 A;  4MSM B;  2FNJ B;  3GZN I;  2JT4 B;  4W9H A;  5E6N A;  4NY0 A;  4TV3 A;  4EUT A;  3O65 B;  5J2R A;  4IM2 A;  4URK A;  4X57 B;  2BWE S;  2NBV B;  5CTR C;  4ANX A;  5L95 C;  2D2Q A;  2LRW A;  4BOS C;  3ZNI D;  3KUC B;  4GSW A;  4IM0 A;  2VRR B;  2PE9 A;  4PS8 A;  4HDO A;  3A9J A;  2C7H A;  2KK8 A;  4LCD E;  2IBI B;  3U8Z A;  3UQB A;  3CF6 E;  3VVW B;  3ZTC A;  4FBJ B;  4EZJ A;  4EFO A;  2D11 A;  1WXS A;  1WGD A;  1ZKH A;  2K8H A;  2NPT B;  3AI5 A;  2GOW A;  4IWO A;  4ZRI A;  2N9E B;  2KOX A;  4HXD A;  1WJU A;  2GBR A;  1GJZ A;  4W9I A;  5KHO A;  2A4Z A;  2B3A A;  1WGH A;  4I6P A;  3TIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...