1XEEA

Solution structure of the chemotaxis inhibitory protein of staphylococcus aureus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords chemotaxis-inhibiting protein CHIPS
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xeeA01
2K3UA 1XEEA
chains in the Genus database with same CATH superfamily
1JMLA 2RDGA 2V0GA 4JWSC 4EKUA 1QF6A 3U2SC 2VRRB 2KTRB 2R2OA 1HE8A 2DYMA 4G3XB 4MSQB 2UWQA 4AOFA 5J18A 4FXCA 3VTVA 1I4XA 2LRWA 4WJQA 2MCNB 2W82A 3L16A 4OHJA 4A3PA 3JSVB 5CHFA 2N4FA 2M17A 4G11A 1YQBA 2WP9B 1JW9D 2N0SB 4MH0E 1PGBA 2MEKA 2XNAC 5HKHA 1Y8RC 3R3MA 3P63A 3HIZA 5HHDG 2CU1A 2IGDA 4ITKA 3MHZA 1EM7A 4GDLB 4J6IA 2K39A 3NVZA 1E7VA 4EZJA 4IWQA 1SE3A 1E9MA 1TIFA 4LTUA 2WHIA 2JRHA 2PJHA 2KOXA 3UIPB 2QEJC 2KN4A 1TGZB 2KMAA 2IO2B 3KYCD 4XX5A 4FHJA 3AB5A 2Q5WD 3MC0B 3NOBA 3AECB 2WXFA 1RAXA 2QHOA 1UBIA 2GBNA 3HVDA 2RGFA 3CSTA 1UGMA 4LNNA 2CR5A 1FCCC 5DPTA 5FR6A 4K7SA 3HHMA 2YVCA 1T0SC 3NG0A 1WGDA 3W1YA 4DHJD 1MPEA 2KAJA 1YJJA 1ZXHA 4CO7A 3AE4B 1WRDB 4B9KA 4W9GA 3GB1A 2WXOA 1DYQA 1MI0A 2KACA 3ZTDA 4MJSA 4OVZA 1TJEA 4HEA1 2KFKB 2VH2A 1KTKA 2FUHB 2MP2A 2V3PA 1IPGA 3A9KA 2JF5A 3P4RB 3Q8CA 2KYWA 2L76A 2MQJA 1CJEA 2DYOA 2RPVA 3BINA 5E6JA 2PW9A 2WQYB 3U52E 2WU5B 4HROA 3AE1B 1OQYA 3R66C 1N5XA 3PZDA 1FO4A 3PS6A 1FIQA 3V6CB 1KLUD 4A55A 3IVFA 4ANWA 2KVRA 3AI5A 1R4MB 2M56B 4TQ1A 3N30A 4NAWA 5BMIA 3EUB2 2D3GA 4HDQA 1MVKA 4AQ7A 3UGBB 3U4EG 2Y5CA 1QZEA 2KC2A 2RPQA 3U8ZA 2WGSA 1IYFA 3MJ5A 4XWWA 1D6EC 1K51A 4LNFA 2MBEA 3QHTA 3NVYA 1L0VB 2YEPB 3APDA 1P1AA 4YSXB 2R2QA 3GS2A 4YXDB 1YIWA 3N32A 2ZCBA 5IOIA 2BS4B 2K0PA 4DQOC 4PS8A 3SU8X 1TT5B 2ONQA 3TCAA 1E10A 4HJKA 2K22A 3DBHI 3KQ4A 2NS5A 3W9CB 3ENEA 3GP7A 5DCNA 4NPNA 1ZOYB 3OLMD 3QC8B 1WXQA 2LRUA 3GE3C 3IT6B 4KSLC 1CZPA 2I1JA 2WS3B 1E90A 2CKHB 1EF1A 1GOZA 4KIKA 3PT2B 4C7YA 2KWVB 4MH8A 3GOEA 2WXRA 4DXGA 4W9JA 1ESFA 5FR3A 5J2RA 5DPWA 1TS2A 1ZKHA 2K8HA 1FM0D 5H92C 2JRIB 4HVBA 4FJYA 5D2MB 4XC2A 3RNEC 4AWJA 1I42A 1LGRA 3PZ8A 2IPKD 1EWCA 2BB5A 2FAZA 3RNAC 4YL8A 2PIAA 2PLPA 3Q3JA 1HZ5A 2N7JA 3NZUA 1TTNA 2NPTA 2GOWA 4K3BA 3MTNB 4BBNC 3PLVA 1K53A 4G50A 2RD0A 2NVUI 3QWZB 5L95C 4OZCA 3H7PA 2L83A 1N5WA 1QQRA 4FHKA 3L54A 3ZKJC 3IXSA 2LZ6A 2PPHA 1SE2A 1FXIA 1Q1OA 1WM2A 5J17A 2B76B 1IP9A 3M3JA 4YT0B 2MP2B 1NYRA 4HLEA 2DENB 5TSSA 3W1SA 4OVUA 1HEZE 2KDIA 4GN1A 2KLCA 4IW0A 3HUIA 2NTSA 3AE3B 3VVWB 3PRPB 4ZRPA 2WWZA 3DBRI 4IWOA 4L1BA 1V1OA 1I7HA 1HTOA 3ZIMA 3A4RA 1XCTL 1Q10A 3U7DA 3N20C 3B08A 2MHJA 1FXAA 3AULA 4NQKE 3I9V1 2LVQA 3EECA 2JYTA 3QARA 4I6NB 5E6PA 1V81A 1GC7A 5LXHA 4B6WA 5E6NA 1N61A 3BVGA 3MHSD 2Y5BB 1XEEA 4WWPA 2C7NB 2LMCA 4F1SA 2BYVE 2HJ1A 2DAFA 2L0TA 3TIXA 3RMKC 3KUDB 2GBRA 2JX5A 4FULA 2VZKD 1P0RA 3Q69A 3TEWA 2X8XX 4A3OA 2XK5B 2EELA 4LDTD 3UIOB 2Z0EB 2MSED 2VH1A 1JWMD 1WI0A 3ALBA 4C4VA 3R7QA 2WXNA 1WX7A 3RZFA 1JWAD 1SB3C 1QOFA 3CWIA 1Q0WB 4EOYA 2UYZB 3LJ3A 1V5OA 3DBRB 2WX1A 1N60A 1R4MI 2FCSA 1ZW7A 2LWPA 3TSSA 2EMTA 1UWMA 4MDKE 5TR5A 2FCQA 3Q8EA 1KF6B 3O65B 2ZNVC 1WGHA 4WJOA 3BIID 1TKEA 2OEDA 1EUVB 2PKOA 4DHJB 1WJ4A 3ZYYX 3VRBB 2LUMA 3R8BA 4TQ0A 2OOBB 1V2YA 1B1ZA 2WX0A 2DAJA 1TYGB 1K8RB 5G5HA 1MHXA 2EKIA 1YN4A 3ZJVA 5G5GA 3DBHB 3AV8A 2MBQA 3UINB 2TSSA 1KH0A 2NMQA 3KVFB 1LM8B 1RLFA 1VDVA 4II2B 3SEBA 4KGRA 4H2AA 3W5VB 2V9HA 5CHWA 4ZYNA 3WIMA 4ANXA 2WDTB 4YWGG 4W9HA 2KT7A 3AEEB 2KHWB 2JT4B 1IUEA 1ZDVA 2KK8A 5EDSA 3KUCB 3DHGC 4GOCA 2WYQA 3M63B 3BVMA 2XN9C 3AE7B 4PYZA 4CYEA 2XBBC 1V6EA 4P1BC 4KKIA 4EZLA 3CIRB 4BOZB 2KFKA 3GE8C 3DHHC 1F52A 3A9KB 4W9KA 1GB1A 2L7RA 3KLSX 2C9WB 4A20A 1P98A 1HZ6A 2DNFA 4E71A 2K3UA 5E6OA 3H6NA 2DYBA 2JPHA 3BVZA 2IJ0A 4NQLB 1E7UA 3VQIA 2FCMA 1UZXB 3TBLD 3AM9A 4YSYB 1NI2A 2D5GA 5IKCM 1C9FA 1ROEA 1XLOA 2QJLA 1P7EA 3B1LX 4CQNA 4M0WA 5JHAA 4A90A 1SE9A 4KZCA 1VLBA 3A9JA 1ACCA 2BBCA 2FNJB 1R4NI 1UUPA 3JVZX 1YD8U 2GI9A 1YOVB 2DX5B 3ZQ4A 5G2NA 4W9DA 1V1PB 3V05A 4ZHOA 4AS1A 2MBBB 1SIFA 1D3ZA 1UH6A 1QOAA 2JZPA 2NTTA 4PK1A 2L1AA 3IG3A 3KYDD 3LYYA 2Z8LA 2L8JA 4K81A 1GAQB 1J19A 2LXAA 3EHVA 1N6ZA 3J9CA 1HTQA 4HRSA 3DBLI 2KJHB 2KXJA 4EUTA 5MPOA 4JGHB 1FNUA 4W9FA 3EFUA 3IFWB 4PS7A 3RFZB 1V9JA 1YX6B 2CS4A 2KMCA 3U7ZA 1H4RA 3ZUNA 1KOTA 1L6UA 2BTEA 1WH3A 2IGHA 3PVLA 3APCA 2E3TA 3OJ4B 3SD5A 3APFA 3IBEA 1UBQA 1WF9A 2AEHA 3IT4B 3OWEB 4P1CC 1TY0A 4FLHA 2WXQA 1WX8A 2W9NA 5KHOA 4DHZE 1OEYA 3VH3B 3PLUA 4P16A 5D94A 3BY4B 4W9LA 4HJGE 1HXYD 3JSVA 3K9OB 3Q8FA 4L23A 1MG4A 1WR6E 3DVGX 2ASQA 4GLSC 3UF8A 2W3RA 2LHDA 1SEBD 4WURA 2O6VD 3BYYB 3D32A 2LGSA 1KJTA 4ZRJA 3RD2A 2G45B 4EFOA 3L4PA 1HA5A 4ZHPA 4REZA 1T6BX 3RYTA 1P9DU 3PRZA 4RH6A 3ZGZA 2N1VA 4MM3A 5AEKB 3L17A 4KZ0A 1D5ZC 3ECIA 2J7QB 1E7PB 3ZNGC 1UELA 2LUEA 3CF6E 2G9HD 5D6JB 3I57A 3ZDTA 1TKGA 3DHIC 1L7YA 3NUHB 3L13A 3Q3MC 5EE0A 1ZXIA 3QX1A 3PGEA 2MJDA 5C2TB 4HDOA 1N62A 1NBFC 2K25A 3GZNB 2N7DA 2PE6B 1E8YA 1VR9A 4RM9A 4BKGA 2KTRA 3AEFB 2KJRA 2IY0B 4TMAB 2N7EA 3OG5A 4W9EA 1WGYA 4ASWC 4J3OD 2MA9B 1CMXB 3QAQA 4KIKB 2KQ4X 4LCDE 3VTUA 2IO3B 4M02A 3H1UA 1KRHA 2O6VA 2WXHA 2WDQB 4MJSB 1WYWB 3ZNID 3PZ7A 3DQVA 5CHVC 2BWES 2L0FA 2KJ6A 3RULA 3HM3A 4K1RB 4LLGM 5BMHA 1BUIC 2JXTA 4MGKE 1D4BA 1L4ZB 1V80A 2QIEB 1I35A 3ZVVA 1JALA 2LGDA 4TSSA 2N9EB 2WXKA 4OZBA 4XWTA 4N6EB 1EF5A 4HPMB 4DK5A 3V6EB 5D7GA 2DZKA 4RFBA 1SSNA 4LK0M 4B0EA 4OW0A 1SIJA 2O6VB 3BWUD 4US8A 2E6XA 5T8IA 4M0WB 3N1XC 1ET9A 3TL5A 2M19A 2GMIC 1YJIA 2LXCA 1FNWA 3H7SA 2JU6X 2HTHA 2FBWB 3NY5A 4HPPA 4JLCA 3DVGY 2DZJA 5BMGA 4P6VF 4WQOB 3R2IA 2B3AA 2V3NA 4BZAA 5KHQA 4O1NA 3ZXVA 1UWXA 1UGJA 4JX1C 1ZUD2 4DDGD 3RUIB 4BKTA 2DZIA 2JUOA 2MJ3A 1ZDXA 2W3SA 2Z59B 4JPSA 3S2AA 1V97A 3AEAB 1I4PA 1K52A 4NY0A 1RM6C 4NNJB 4X57B 3E9SA 2W55A 1Z5SB 2BB6A 3WALA 3KWLA 2KQSA 2WXPA 1S3SG 1WR1A 2V4LA 2L32A 1V5TA 1WYGA 2LJIA 4ZDVA 1GNUA 2GBMA 4KSKC 3Q3NC 4G0NB 4FBJB 3WAOA 1TBEA 2ZPYA 3ZNZB 1E8XA 4M00A 1H8CA 5D3IB 4HXDA 2BKFA 5FK9C 2PVGC 3TEXA 2LHEA 2NBVB 4ZOHC 1KLGD 5EE1A 2G4DB 4ZRIA 3P4PB 3ABVB 1OEYJ 2OJWA 1WFYA 5JXVA 4IM0A 1VCBA 2NPTB 1VZ7A 1TZ1A 2IO0B 1WJUA 2Z0DB 3AH7A 3DPDA 4RGOS 1KM7A 3W2DA 3LB8C 1BMLC 3P2BA 1VZ8A 1DGJA 1EU3A 4II3B 4WWMA 3KWVA 3WAPA 2J0JA 2SEBD 3SFEB 5IA7A 1F0ZA 3K9PB 5AUIA 1C79A 4RGNA 1ET6A 4HK2A 2ICIA 3PREA 4WH4A 3KW5B 1QOGA 1XO3A 2LEKA 2R61A 1L0YB 2DWQA 1K50A 4ANVA 5L83A 1M4VA 2G3QB 5HI1A 1AWDA 2I38A 1WXMA 2IY1B 3PSEB 3EC8A 1WWTA 3AEGB 3SHQA 3RN9C 1T0RC 1PUTA 3ZW3A 2RSUA 3P42A 3W5UB 4JQWC 3NZSA 1JRUA 1C76A 1SBBB 5EE9A 1FRDA 5AZFA 4A8XC 3T3OA 3B9JA 2QCZA 4I6PA 1OQRA 1GPXA 1OFFA 3VUXA 3NS1A 4MGYE 1I4HA 1J7CA 1E6EB 2JSVX 2BVCA 2J53A 3CSFA 2N1WA 4QAYA 2V4IB 2LGXA 1XT9B 3Q8AA 3L0WB 2MWSB 4KX6B 1QILA 3P4QB 1RFKA 2EKEC 3KUZA 4TKNA 2C5LC 1JROA 2CU3A 5HFYA 3ONSA 4L2YA 4E3CA 3I5JC 3ZXRA 2O2VA 4C80A 3ZRFA 2WXMA 4HKQA 1PYWD 4GDKB 2D3CA 1T3QA 2Y3AA 3VFKA 2V3SA 4WWOA 1GJZA 4KVGB 2BYTA 2WU2B 1TS3A 5C3JB 2ZZPB 4C00A 1WE7A 4D2KA 4IOIE 3P1MA 2LI5A 2H89B 1J7AA 5G55A 2MW5A 2C7HA 2L3ZA 2SAKA 2JZ3B 1STEA 2AYOB 2KX0A 3RCZA 2QC8A 4HKZE 1M94A 1C77A 3CMMB 4HPLB 3FILB 1WIAA 4N9F4 2RDHA 1IGCA 4OZAA 4YTMB 1JQ4A 2L52A 2KNBA 3LDZE 4IKGA 4WWNA 4N59A 5IO9A 1SF0A 2LFIA 3WA0A 4HCNB 3MC8A 1SJED 1PGXA 2ZVNA 2ZNVB 3ZLZA 4WIPA 2WNMA 1I4RA 1IBXB 2ZVOA 1QOBA 4M8NA 4LDTB 2INCC 3PHWB 4GSWA 3RT3B 4LNKA 2N9LA 1QKZA 3NHEB 4E74A 1J7BA 2V1YA 1NVID 2MX2A 1FXTB 4MM3B 3NRZA 2KANA 2H88B 4US9A 4F7ZA 2HE7A 1ZGUB 2ON8A 2XEWA 1TKYA 3N3KB 2QMTA 2GBKA 4EEWA 3DVNV 4BKSA 4K7UA 3VTWA 2FCNA 2K6DB 3PO0A 1AW7A 1D5MC 5EE3A 2IGGA 2KDFB 2MLBA 4A9AA 1T5XD 5LLIA 4RF0A 3HM6X 2KN5A 4ANUA 3BK1A 2I1KA 2RDBC 1X1MA 3TJPA 2M4NA 2KTFA 4KGTA 1B9RA 4AP4C 4RCOA 4B0MA 2BT6A 3X0WA 2W54A 1R7SA 2I2YA 3V60A 2DBYA 1C78A 2KO3A 4RF1A 4MSMB 1DOIA 1L0XB 5AZHA 2GB1A 3RNCC 4RNAA 2VZKB 4EE2A 3AE9B 4DXAB 1GUAB 2D2QA 2WXJA 3A33B 2ZJDA 3DDCB 4MGZE 2XK5A 2FE8A 1YQ4B 1AYFA 4XZ4A 1WZ0A 4BKSD 2MH7A 2CHZA 1WGKA 2BS3B 1A70A 2JXXA 4MELA 3A1QA 3H8HA 3RPFC 2BQQA 2D07B 4UDUC 3AU5A 4URKA 4WQMA 1FFUA 4JIOU 4LNIA 5C23A 2D3AA 2CJNA 4Q2JA 2ZCCA 3QJZA 3VUWA 4M8MA 1QT9A 1XCQL 1UD7A 4JL9A 1I4GA 2J4XA 3IAS1 5AZGA 3LXFA 4RGMA 1TZOA 3B2GA 2OHFA 1JRPA 1YMHE 2NBUA 3OAWA 3ZTCA 1JCKB 3EGRA 3VR8B 1OTRB 3AU4A 4K7WA 2LVOA 3V62A 1WM3A 1Z2MA 5BYQA 2AWTA 4GXBA 4GB9A 5C1ZA 1MHHE 3ZDMC 1FCLA 3A9JB 3I3TB 1NYQA 3MFGA 5CX3A 2J0MA 1ENFA 4S0RA 1PQSA 3AE5B 4AUQC 3BYTB 4P7IA 3L10B 3NVWA 3VUYA 4NJ6A 2JVCA 1EWYC 4BBNF 2M0AA 3JYUA 3VAWA 3VHTC 3DVNU 2YEPF 1XLPA 1E8WA 1OQQA 1SXTA 3QCAA 2GLSA 1XD3B 2JZZA 4KDLB 1BXTA 3FILA 1L4DB 1WMHA 3WAMA 2BPSA 2MBHA 2KWCA 3DWMA 1WXVA 3T3NA 1AN8A 4IWPA 2JY6A 2DZMA 4HWIB 1WJNA 3WCQA 3VR9B 2IO1B 1LO5D 2M0XA 2INPE 3R2TA 3SDLC 4IC7B 1WXSA 2IZVB 1FRRA 1NENB 3HRDD 2KQ7A 1WGGA 4DBGA 2PEAA 1P7FA 3DWGC 3ZJTA 4I6LB 1XQQA 4WAFA 3ZRCA 2QSDA 3ML8A 3HVZA 4RGTA 4LJPB 2KX3A 2JQRB 3NS8A 2ZEQA 2KWDA 1ZPSA 4FJVB 3QK0A 2NBWB 4WJPA 2WXGA 4IUMB 4RM8A 3MC9A 5LNK1 4XDCA 2PTLA 2KFJA 1FPYA 3H7PB 1ZP0B 1C1YB 4FN2A 2LD9A 5DPSA 3EFCA 2M1MA 2KC1A 4MACA 1JWBD 2AQ1B 3TEZA 2HDEA 3AN1A 4A6QA 4MGIE 1IGDA 2AX5A 2PVOD 3UQAA 3PTFC 1ZE3D 1PGAA 4PT5A 4ICVA 5HG2A 2JWUA 1S1QB 4EZKA 3AE6B 2RR9A 3AE2B 4IM3A 3RNFC 2LGIA 1JWUD 2A5UA 3EA6A 5JH5C 2BW2A 1WGRA 3VXWA 1PDXA 3KH0A 2AQ3B 2O2VB 4PYUA 4ACFA 4FJZA 2KZRA 1HQRD 3ZNHB 3OJ3A 3VH4B 4BAXA 3Q14C 1IBXA 1LFDA 5I4DA 1RYJA 3B2FA 2K1FA 1KLVA 1ISNA 1SE4A 1GG3A 4DHZB 1MG8A 2L05A 3FC4A 2MBOA 2QDFA 2IDYA 3I63C 2BYEA 2LVPA 2A4ZA 4RMAA 4TV3A 3TMPB 2WXLA 3Q3OC 2J42A 1YN5A 2AL6A 3NJTA 1FFVA 3R7RA 1XXGA 1F2RC 2HJ8A 1R4NB 4XYCA 4GGQA 4NAWB 3DBLB 1FNVA 2BYFA 2HTME 1FMAD 5JZEB 4ARCA 1A5RA 1WY8A 1E8ZA 1L5PA 2CJOA 4W9CA 2D10A 2M8SA 2KWUB 2UU7A 3N1ZC 3HK0A 1U4AA 3NZ3A 4NZLB 4DWFA 3C19A 1XF5L 4FADA 4C7ZA 3E56A 1C3TA 5AUKA 4NJ7A 2DHZA 2C60A 1Y56A 1F77A 2LJ5A 2N9KA 3A4SC 3M95A 1LXDA 4LNOA 2KDMA 2LASA 3UQBA 1LQBA 3Q8BA 4TUUA 2FIFA 1TY2A 1XLNA 4N58A 1J8CA 1VZ6A 1VJKA 4GDKA 3N1YC 5GMVA 1KFYB 4LJOB 4IDIA 3DBSA 2PE9A 2DLBA 2INNE 2OJRA 1RFAA 4IG7B 4KDIC 3URYA 4YTPB 2ZPNA 1I4QA 4DXFA 4JWUC 1QLBB 4XDDA 3QIJA 3T8MA 4BOSC 4PS3A 2J52A 3FKYA 4K3CA 3V3XA 4AJYB 1BT0A 1PFDA 2FUG1 4ARIA 5JHBA 1NEKB 4F8CB 3M62B 1TS5A 3AEDB 2CHWA 4IM2A 2N9XA 1F2RI 3ML9A 4MEMA 2JWZA 3RZWC 1L2NA 2D11A 2CHXA 3B0AA 5H8YE 3P4SB 3RNGC 3RNBC 4XGAB 3QA8A 1YQ3B 2WLBA 3PV1A 2G1EA 3VRAB 4C56C 1NI3A 3MJWA 3C8YA 1E0ZA 4B95A 1DOXA 1SGHA 3DOWA 3Q3FA 4WAAA 1UNSA 1EO6A 3AMZA 2WXIA 1CQVA 2WDRB 2ZW0A 4GDLA 2AL3A 4R3DA 2YLMA 4OVVA 2MRPA 2C7MB 2D3BA 5GXGB 1WRIA 4ZYSA 2KMMA 3SFDB 1C4CA 1T0YA 3A1QB 4NAMA 3QQ8B 3V61A 1E5WA 1XLQA 1TS4A 1V86A 1F9JA 3U30A 5BYRA 4WJNA 5FKAC 2KKCA 4JE3B 1NDDA 2PMVA 3AE8B 4GIVA 3O13A 4BVUC 1CK1A 1V1PA 4XE0A 2GRIA 1N63A 1L6VA 1FD6A 2K8BA 5BYSA 3N9YC 1YN3A 4FA6A 1VRAB 2NR2A 1D5XC 2KLGA 3Q6BA 4GMVA 1GB4A 2AQ2B 1C4PA 3PHXB 4CHKA 1YX5B 1EU4A 2X38A 2KDBA 4KV2A 1J0GA 5D3DA 3UI3A 2K5PA 1UF0A 3Q2AC 1G6JA 1T0QC 5IN7A 2IBIB 4GU2A 5DPRA 4AJWA 4MT5A 4W9IA 3H9DA 4YTNB 3T9LA 3TEYA 3X23A 1WXAA 2G4SA 2K6QA 5BO4B 2L00B 2GBJA 4YSZB 3PRMB 2ZW1A 2NCNA 3TUOA 3ZO5B 1P3QU 4NJCA 1V49A 5IAAC 1FEHA 1JWSD 2BWFA 2K9XA 4S17A 3ETRA 2KVZA 2HD5B 4KKJA 2BKRB 2KD0A 3VDZA 2Y5PA 2K8CA 3IHPC 1Q5WB 3MP9A 1F1HA 2MJEA 1WMHB 4ZRQA 3SR6A 1WJ6A 3FAHA 3NVVA 1YJ1A 2LGYA 1WX9A 4ZRKA 3AEBB 3RI7C 1MFWA 2REXA 2INDC 1OGWA 3C0RB 2QILA 4USAA 4BFRA 1GC6A 2J0KA 2IYDB 3W1SC 1AARA 2JYEA 3JW0X 4HCPB 3WANA 1RWSA 4DDID 4KGSA 3ZJUA 3IAM1 2BS2B 3DCGA 3PPAA 1DOYA 1V8CA 2KDEB 2EMSA 1C4AA 1WE6A 3AXCA 1RRBA 4ICUA 1YNTE 4C4VB 5CTRC 2RMMA 1WZ3A 3BZDB 3L08A 3GZNI 2BGFA 5LXIB 1SJHD 5IP4D 1WSPA 4M01A 3BK2A 1VD2A 2N9PC 2FIDA 2WDVB 2ACZB 2BF8B 1MJDA
chains in the Genus database with same CATH topology
4WAFA 1JMLA 2RDGA 2V0GA 2QSDA 1B1ZA 5JXVA 1TYGB 4JWSC 3HVZA 4RGTA 5G5HA 1QF6A 1MHXA 2EKIA 1YN4A 1VZ7A 3ZJVA 5G5GA 3U2SC 2JQRB 3AH7A 4RGOS 2KWDA 3LB8C 3W2DA 1BMLC 3AV8A 1ZPSA 2DYMA 2TSSA 1KH0A 2NMQA 1VZ8A 2WXGA 1DGJA 1EU3A 1VDVA 4WWMA 5LNK1 3KWVA 4FXCA 2PTLA 4XDCA 3SEBA 2SEBD 1I4XA 4KGRA 3SFEB 4H2AA 2W82A 3W5VB 1F0ZA 1ZP0B 4OHJA 4YWGG 5AUIA 1C79A 4RGNA 1ET6A 4MACA 1JWBD 2AQ1B 3AEEB 2WP9B 3TEZA 1IUEA 2ICIA 1JW9D 1ZDVA 2HDEA 2N0SB 1PGBA 2MEKA 2XNAC 3AN1A 4A6QA 4WH4A 1IGDA 2AX5A 2PVOD 3BVMA 2XN9C 3P63A 3AE7B 1QOGA 1ZE3D 1PGAA 4PT5A 1XO3A 2LEKA 2R61A 2IGDA 4ITKA 4KKIA 5HHDG 3CIRB 3MHZA 1L0YB 2DWQA 1K50A 2JWUA 5HG2A 1EM7A 4GDLB 1M4VA 3AE6B 5HI1A 1AWDA 2I38A 3NVZA 1GB1A 3KLSX 3AE2B 1SE3A 1E9MA 2LGIA 1HZ6A 1WWTA 1JWUD 3AEGB 2K3UA 3EA6A 1PUTA 4LTUA 3BVZA 2IJ0A 3P42A 3W5UB 2BW2A 3VQIA 1C76A 1SBBB 5EE9A 1FRDA 2QEJC 2KN4A 4A8XC 3B9JA 3T3OA 1PDXA 3AM9A 1OQRA 2AQ3B 1GPXA 1OFFA 4YSYB 3NS1A 1I4HA 1J7CA 1E6EB 2JSVX 2D5GA 1HQRD 3AB5A 2J53A 1C9FA 1ROEA 2Q5WD 1XLOA 2V4IB 2QJLA 1P7EA 3MC0B 1IBXA 3AECB 3Q8AA 4CQNA 2WXFA 4M0WA 5I4DA 1RYJA 4A90A 3B2FA 4KX6B 3HVDA 1QILA 3P4QB 1SE4A 1RFKA 1VLBA 1FCCC 1ACCA 2BBCA 1JROA 1UUPA 3FC4A 2GI9A 2CU3A 2IDYA 3ZQ4A 5HFYA 4L2YA 1V1PB 3V05A 4C80A 2WXLA 4ZHOA 4HKQA 2WXMA 2J42A 1PYWD 1MPEA 1YN5A 4GDKB 4AS1A 1FFVA 2KAJA 1XXGA 1QOAA 1YJJA 1F2RC 1ZXHA 2JZPA 2NTTA 2Y3AA 1T3QA 3AE4B 4NAWB 1FNVA 2HTME 3GB1A 1FMAD 2BYTA 2WU2B 2L1AA 2WXOA 1TS3A 1DYQA 3LYYA 5C3JB 4ARCA 1MI0A 2KACA 4OVZA 2Z8LA 1TJEA 1L5PA 1GAQB 4D2KA 2CJOA 4IOIE 4HEA1 3P1MA 2H89B 1J7AA 3J9CA 4HRSA 2SAKA 1KTKA 3NZ3A 4NZLB 2V3PA 5MPOA 3P4RB 3Q8CA 1STEA 1XF5L 1FNUA 4C7ZA 3E56A 5AUKA 1CJEA 4HKZE 2DYOA 2RPVA 1C77A 5E6JA 2PW9A 1Y56A 1F77A 2N9KA 2WQYB 3U52E 3FILB 3RFZB 2WU5B 4HROA 3AE1B 1N5XA 1IGCA 2KDMA 2RDHA 4OZAA 4YTMB 3U7ZA 1JQ4A 1FO4A 2L52A 1L6UA 3Q8BA 1FIQA 2BTEA 4IKGA 1TY2A 1XLNA 4N58A 1KLUD 4A55A 4N59A 2IGHA 1SF0A 1VZ6A 2LFIA 1VJKA 2E3TA 1KFYB 2M56B 4IDIA 4TQ1A 1SJED 1PGXA 3IT4B 3OWEB 4WIPA 3EUB2 5BMIA 2WNMA 1TY0A 2DLBA 1I4RA 2INNE 2WXQA 1IBXB 1MVKA 3URYA 4YTPB 1I4QA 4AQ7A 1QOBA 4DXFA 4JWUC 1QLBB 4XDDA 3U4EG 2Y5CA 2J52A 3V3XA 2N9LA 1QKZA 3MJ5A 4XWWA 4P16A 1PFDA 2FUG1 1J7BA 4ARIA 1D6EC 1NEKB 1K51A 1NVID 4MM3B 1TS5A 4HJGE 1HXYD 3AEDB 3NVYA 1L0VB 2YEPB 3NRZA 3Q8FA 4YSXB 3GS2A 4YXDB 4L23A 1F2RI 2BS4B 2H88B 2K0PA 4US9A 4GLSC 2W3RA 4DQOC 2LHDA 2ON8A 1SEBD 2ONQA 1E10A 2K22A 1TKYA 3P4SB 5H8YE 4WURA 2QMTA 3KQ4A 3W9CB 3BYYB 3GP7A 1ZOYB 1YQ3B 2WLBA 3L4PA 1HA5A 1WXQA 2G1EA 3PO0A 1AW7A 1D5MC 4REZA 3VRAB 4C56C 4ZHPA 3IT6B 1T6BX 1NI3A 5EE3A 2IGGA 1CZPA 3C8YA 4A9AA 4RH6A 1T5XD 1E0ZA 2WS3B 1DOXA 3ZGZA 4RF0A 1UNSA 3AMZA 2WXIA 1CQVA 1GOZA 2WDRB 2ZW0A 1D5ZC 3BK1A 4C7YA 4MH8A 1E7PB 4KGTA 2WXRA 4R3DA 4DXGA 1B9RA 2G9HD 1ESFA 5FR3A 3I57A 4RCOA 4B0MA 5GXGB 1TKGA 1WRIA 4ZYSA 1TS2A 2BT6A 2KMMA 3SFDB 2W54A 1FM0D 1C4CA 1R7SA 5H92C 3NUHB 2I2YA 5EE0A 2DBYA 1ZXIA 1C78A 4NAMA 4RF1A 3PZ8A 2IPKD 1EWCA 2BB5A 2MJDA 1XLQA 1TS4A 5C2TB 1DOIA 1L0XB 1N62A 5BYRA 2PIAA 2PLPA 5FKAC 2GB1A 1VR9A 1HZ5A 2N7JA 4RNAA 2VZKB 4JE3B 4EE2A 3AE9B 2PMVA 2WXJA 3AE8B 3AEFB 3O13A 1CK1A 1V1PA 4XE0A 4TMAB 2GRIA 1K53A 1N63A 1L6VA 1FD6A 5BYSA 3N9YC 4J3OD 1YN3A 1VRAB 4OZCA 2KQ4X 2FE8A 1D5XC 1YQ4B 1AYFA 3ABVB 2AQ2B 1KRHA 1GB4A 2WXHA 2L83A 1N5WA 1QQRA 2WDQB 1C4PA 3IXSA 2MH7A 3PZ7A 1SE2A 1EU4A 2X38A 1FXIA 1WGKA 2BS3B 1A70A 5D3DA 2B76B 3UI3A 3H8HA 3RPFC 2K5PA 4YT0B 1NYRA 3ZJTA 4LLGM 4UDUC 5BMHA 4WQMA 1BUIC 2JXTA 4MT5A 5TSSA 1D4BA 3W1SA 1FFUA 1L4ZB 2QIEB 4YTNB 3TEYA 1JALA 1HEZE 4TSSA 2WXKA 4OZBA 4XWTA 2CJNA 4N6EB 4Q2JA 3HUIA 4YSZB 2NTSA 3AE3B 2ZW1A 4ZRPA 1QT9A 1XCQL 3TUOA 5D7GA 4RFBA 4L1BA 1V1OA 1I7HA 4NJCA 1SSNA 4LK0M 1I4GA 2J4XA 4B0EA 3IAS1 4OW0A 1XCTL 1Q10A 1SIJA 1FEHA 1JWSD 3BWUD 3LXFA 2K9XA 3ETRA 4US8A 2E6XA 5T8IA 4RGMA 1TZOA 1FXAA 3B2GA 2OHFA 1JRPA 1ET9A 1YMHE 4KKJA 3I9V1 2M19A 2JYTA 1YJIA 1JCKB 1FNWA 3EGRA 2Y5PA 3VR8B 3MP9A 2JU6X 2MJEA 1N61A 2FBWB 3BVGA 4ZRQA 1XEEA 5BYQA 2LMCA 3SR6A 5BMGA 3FAHA 3NVVA 1MHHE 4P6VF 1FCLA 2JX5A 3R2IA 2V3NA 1NYQA 2VZKD 3MFGA 4O1NA 3Q69A 3AEBB 1UWXA 1ENFA 1UGJA 4JX1C 3TEWA 3AE5B 1ZUD2 2EELA 3BYTB 1JWMD 3NVWA 2MJ3A 1ZDXA 2QILA 4USAA 2W3SA 4JPSA 1V97A 2WXNA 3AEAB 1I4PA 1EWYC 1K52A 1JWAD 2M0AA 1SB3C 1RM6C 3E9SA 2W55A 1QOFA 2YEPF 3CWIA 1XLPA 2JYEA 1OQQA 2BB6A 1SXTA 1RWSA 3KWLA 4KGSA 2WXPA 1N60A 1BXTA 3FILA 3ZJUA 1L4DB 2L32A 3IAM1 3TSSA 2BS2B 1UWMA 1DOYA 1V8CA 3DWMA 1WYGA 1C4AA 2LJIA 3Q8EA 3T3NA 1KF6B 1YNTE 1AN8A 2RMMA 3BIID 1TKEA 3BZDB 3WCQA 3VR9B 2OEDA 1SJHD 1LO5D 2PKOA 5D3IB 2INPE 3R2TA 5FK9C 2PVGC 1WSPA 3TEXA 3BK2A 3ZYYX 2LHEA 1FRRA 3VRBB 4ZOHC 1NENB 1KLGD 2LUMA 5EE1A 3HRDD 3R8BA 2WDVB 4TQ0A 2ACZB 3P4PB 1P7FA 3DWGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3U A;  1XEE A; 
#chains in the Genus database with same CATH topology
 1JML A;  2RDG A;  2V0G A;  4JWS C;  4EKU A;  1QF6 A;  3U2S C;  2VRR B;  2KTR B;  2R2O A;  1HE8 A;  2DYM A;  4G3X B;  4MSQ B;  2UWQ A;  4AOF A;  5J18 A;  4FXC A;  3VTV A;  1I4X A;  2LRW A;  4WJQ A;  2MCN B;  2W82 A;  3L16 A;  4OHJ A;  4A3P A;  3JSV B;  5CHF A;  2N4F A;  2M17 A;  4G11 A;  1YQB A;  2WP9 B;  1JW9 D;  2N0S B;  4MH0 E;  1PGB A;  2MEK A;  2XNA C;  5HKH A;  1Y8R C;  3R3M A;  3P63 A;  3HIZ A;  5HHD G;  2CU1 A;  2IGD A;  4ITK A;  3MHZ A;  1EM7 A;  4GDL B;  4J6I A;  2K39 A;  3NVZ A;  1E7V A;  4EZJ A;  4IWQ A;  1SE3 A;  1E9M A;  1TIF A;  4LTU A;  2WHI A;  2JRH A;  2PJH A;  2KOX A;  3UIP B;  2QEJ C;  2KN4 A;  1TGZ B;  2KMA A;  2IO2 B;  3KYC D;  4XX5 A;  4FHJ A;  3AB5 A;  2Q5W D;  3MC0 B;  3NOB A;  3AEC B;  2WXF A;  1RAX A;  2QHO A;  1UBI A;  2GBN A;  3HVD A;  2RGF A;  3CST A;  1UGM A;  4LNN A;  2CR5 A;  1FCC C;  5DPT A;  5FR6 A;  4K7S A;  3HHM A;  2YVC A;  1T0S C;  3NG0 A;  1WGD A;  3W1Y A;  4DHJ D;  1MPE A;  2KAJ A;  1YJJ A;  1ZXH A;  4CO7 A;  3AE4 B;  1WRD B;  4B9K A;  4W9G A;  3GB1 A;  2WXO A;  1DYQ A;  1MI0 A;  2KAC A;  3ZTD A;  4MJS A;  4OVZ A;  1TJE A;  4HEA 1;  2KFK B;  2VH2 A;  1KTK A;  2FUH B;  2MP2 A;  2V3P A;  1IPG A;  3A9K A;  2JF5 A;  3P4R B;  3Q8C A;  2KYW A;  2L76 A;  2MQJ A;  1CJE A;  2DYO A;  2RPV A;  3BIN A;  5E6J A;  2PW9 A;  2WQY B;  3U52 E;  2WU5 B;  4HRO A;  3AE1 B;  1OQY A;  3R66 C;  1N5X A;  3PZD A;  1FO4 A;  3PS6 A;  1FIQ A;  3V6C B;  1KLU D;  4A55 A;  3IVF A;  4ANW A;  2KVR A;  3AI5 A;  1R4M B;  2M56 B;  4TQ1 A;  3N30 A;  4NAW A;  5BMI A;  3EUB 2;  2D3G A;  4HDQ A;  1MVK A;  4AQ7 A;  3UGB B;  3U4E G;  2Y5C A;  1QZE A;  2KC2 A;  2RPQ A;  3U8Z A;  2WGS A;  1IYF A;  3MJ5 A;  4XWW A;  1D6E C;  1K51 A;  4LNF A;  2MBE A;  3QHT A;  3NVY A;  1L0V B;  2YEP B;  3APD A;  1P1A A;  4YSX B;  2R2Q A;  3GS2 A;  4YXD B;  1YIW A;  3N32 A;  2ZCB A;  5IOI A;  2BS4 B;  2K0P A;  4DQO C;  4PS8 A;  3SU8 X;  1TT5 B;  2ONQ A;  3TCA A;  1E10 A;  4HJK A;  2K22 A;  3DBH I;  3KQ4 A;  2NS5 A;  3W9C B;  3ENE A;  3GP7 A;  5DCN A;  4NPN A;  1ZOY B;  3OLM D;  3QC8 B;  1WXQ A;  2LRU A;  3GE3 C;  3IT6 B;  4KSL C;  1CZP A;  2I1J A;  2WS3 B;  1E90 A;  2CKH B;  1EF1 A;  1GOZ A;  4KIK A;  3PT2 B;  4C7Y A;  2KWV B;  4MH8 A;  3GOE A;  2WXR A;  4DXG A;  4W9J A;  1ESF A;  5FR3 A;  5J2R A;  5DPW A;  1TS2 A;  1ZKH A;  2K8H A;  1FM0 D;  5H92 C;  2JRI B;  4HVB A;  4FJY A;  5D2M B;  4XC2 A;  3RNE C;  4AWJ A;  1I42 A;  1LGR A;  3PZ8 A;  2IPK D;  1EWC A;  2BB5 A;  2FAZ A;  3RNA C;  4YL8 A;  2PIA A;  2PLP A;  3Q3J A;  1HZ5 A;  2N7J A;  3NZU A;  1TTN A;  2NPT A;  2GOW A;  4K3B A;  3MTN B;  4BBN C;  3PLV A;  1K53 A;  4G50 A;  2RD0 A;  2NVU I;  3QWZ B;  5L95 C;  4OZC A;  3H7P A;  2L83 A;  1N5W A;  1QQR A;  4FHK A;  3L54 A;  3ZKJ C;  3IXS A;  2LZ6 A;  2PPH A;  1SE2 A;  1FXI A;  1Q1O A;  1WM2 A;  5J17 A;  2B76 B;  1IP9 A;  3M3J A;  4YT0 B;  2MP2 B;  1NYR A;  4HLE A;  2DEN B;  5TSS A;  3W1S A;  4OVU A;  1HEZ E;  2KDI A;  4GN1 A;  2KLC A;  4IW0 A;  3HUI A;  2NTS A;  3AE3 B;  3VVW B;  3PRP B;  4ZRP A;  2WWZ A;  3DBR I;  4IWO A;  4L1B A;  1V1O A;  1I7H A;  1HTO A;  3ZIM A;  3A4R A;  1XCT L;  1Q10 A;  3U7D A;  3N20 C;  3B08 A;  2MHJ A;  1FXA A;  3AUL A;  4NQK E;  3I9V 1;  2LVQ A;  3EEC A;  2JYT A;  3QAR A;  4I6N B;  5E6P A;  1V81 A;  1GC7 A;  5LXH A;  4B6W A;  5E6N A;  1N61 A;  3BVG A;  3MHS D;  2Y5B B;  1XEE A;  4WWP A;  2C7N B;  2LMC A;  4F1S A;  2BYV E;  2HJ1 A;  2DAF A;  2L0T A;  3TIX A;  3RMK C;  3KUD B;  2GBR A;  2JX5 A;  4FUL A;  2VZK D;  1P0R A;  3Q69 A;  3TEW A;  2X8X X;  4A3O A;  2XK5 B;  2EEL A;  4LDT D;  3UIO B;  2Z0E B;  2MSE D;  2VH1 A;  1JWM D;  1WI0 A;  3ALB A;  4C4V A;  3R7Q A;  2WXN A;  1WX7 A;  3RZF A;  1JWA D;  1SB3 C;  1QOF A;  3CWI A;  1Q0W B;  4EOY A;  2UYZ B;  3LJ3 A;  1V5O A;  3DBR B;  2WX1 A;  1N60 A;  1R4M I;  2FCS A;  1ZW7 A;  2LWP A;  3TSS A;  2EMT A;  1UWM A;  4MDK E;  5TR5 A;  2FCQ A;  3Q8E A;  1KF6 B;  3O65 B;  2ZNV C;  1WGH A;  4WJO A;  3BII D;  1TKE A;  2OED A;  1EUV B;  2PKO A;  4DHJ B;  1WJ4 A;  3ZYY X;  3VRB B;  2LUM A;  3R8B A;  4TQ0 A;  2OOB B;  1V2Y A;  1B1Z A;  2WX0 A;  2DAJ A;  1TYG B;  1K8R B;  5G5H A;  1MHX A;  2EKI A;  1YN4 A;  3ZJV A;  5G5G A;  3DBH B;  3AV8 A;  2MBQ A;  3UIN B;  2TSS A;  1KH0 A;  2NMQ A;  3KVF B;  1LM8 B;  1RLF A;  1VDV A;  4II2 B;  3SEB A;  4KGR A;  4H2A A;  3W5V B;  2V9H A;  5CHW A;  4ZYN A;  3WIM A;  4ANX A;  2WDT B;  4YWG G;  4W9H A;  2KT7 A;  3AEE B;  2KHW B;  2JT4 B;  1IUE A;  1ZDV A;  2KK8 A;  5EDS A;  3KUC B;  3DHG C;  4GOC A;  2WYQ A;  3M63 B;  3BVM A;  2XN9 C;  3AE7 B;  4PYZ A;  4CYE A;  2XBB C;  1V6E A;  4P1B C;  4KKI A;  4EZL A;  3CIR B;  4BOZ B;  2KFK A;  3GE8 C;  3DHH C;  1F52 A;  3A9K B;  4W9K A;  1GB1 A;  2L7R A;  3KLS X;  2C9W B;  4A20 A;  1P98 A;  1HZ6 A;  2DNF A;  4E71 A;  2K3U A;  5E6O A;  3H6N A;  2DYB A;  2JPH A;  3BVZ A;  2IJ0 A;  4NQL B;  1E7U A;  3VQI A;  2FCM A;  1UZX B;  3TBL D;  3AM9 A;  4YSY B;  1NI2 A;  2D5G A;  5IKC M;  1C9F A;  1ROE A;  1XLO A;  2QJL A;  1P7E A;  3B1L X;  4CQN A;  4M0W A;  5JHA A;  4A90 A;  1SE9 A;  4KZC A;  1VLB A;  3A9J A;  1ACC A;  2BBC A;  2FNJ B;  1R4N I;  1UUP A;  3JVZ X;  1YD8 U;  2GI9 A;  1YOV B;  2DX5 B;  3ZQ4 A;  5G2N A;  4W9D A;  1V1P B;  3V05 A;  4ZHO A;  4AS1 A;  2MBB B;  1SIF A;  1D3Z A;  1UH6 A;  1QOA A;  2JZP A;  2NTT A;  4PK1 A;  2L1A A;  3IG3 A;  3KYD D;  3LYY A;  2Z8L A;  2L8J A;  4K81 A;  1GAQ B;  1J19 A;  2LXA A;  3EHV A;  1N6Z A;  3J9C A;  1HTQ A;  4HRS A;  3DBL I;  2KJH B;  2KXJ A;  4EUT A;  5MPO A;  4JGH B;  1FNU A;  4W9F A;  3EFU A;  3IFW B;  4PS7 A;  3RFZ B;  1V9J A;  1YX6 B;  2CS4 A;  2KMC A;  3U7Z A;  1H4R A;  3ZUN A;  1KOT A;  1L6U A;  2BTE A;  1WH3 A;  2IGH A;  3PVL A;  3APC A;  2E3T A;  3OJ4 B;  3SD5 A;  3APF A;  3IBE A;  1UBQ A;  1WF9 A;  2AEH A;  3IT4 B;  3OWE B;  4P1C C;  1TY0 A;  4FLH A;  2WXQ A;  1WX8 A;  2W9N A;  5KHO A;  4DHZ E;  1OEY A;  3VH3 B;  3PLU A;  4P16 A;  5D94 A;  3BY4 B;  4W9L A;  4HJG E;  1HXY D;  3JSV A;  3K9O B;  3Q8F A;  4L23 A;  1MG4 A;  1WR6 E;  3DVG X;  2ASQ A;  4GLS C;  3UF8 A;  2W3R A;  2LHD A;  1SEB D;  4WUR A;  2O6V D;  3BYY B;  3D32 A;  2LGS A;  1KJT A;  4ZRJ A;  3RD2 A;  2G45 B;  4EFO A;  3L4P A;  1HA5 A;  4ZHP A;  4REZ A;  1T6B X;  3RYT A;  1P9D U;  3PRZ A;  4RH6 A;  3ZGZ A;  2N1V A;  4MM3 A;  5AEK B;  3L17 A;  4KZ0 A;  1D5Z C;  3ECI A;  2J7Q B;  1E7P B;  3ZNG C;  1UEL A;  2LUE A;  3CF6 E;  2G9H D;  5D6J B;  3I57 A;  3ZDT A;  1TKG A;  3DHI C;  1L7Y A;  3NUH B;  3L13 A;  3Q3M C;  5EE0 A;  1ZXI A;  3QX1 A;  3PGE A;  2MJD A;  5C2T B;  4HDO A;  1N62 A;  1NBF C;  2K25 A;  3GZN B;  2N7D A;  2PE6 B;  1E8Y A;  1VR9 A;  4RM9 A;  4BKG A;  2KTR A;  3AEF B;  2KJR A;  2IY0 B;  4TMA B;  2N7E A;  3OG5 A;  4W9E A;  1WGY A;  4ASW C;  4J3O D;  2MA9 B;  1CMX B;  3QAQ A;  4KIK B;  2KQ4 X;  4LCD E;  3VTU A;  2IO3 B;  4M02 A;  3H1U A;  1KRH A;  2O6V A;  2WXH A;  2WDQ B;  4MJS B;  1WYW B;  3ZNI D;  3PZ7 A;  3DQV A;  5CHV C;  2BWE S;  2L0F A;  2KJ6 A;  3RUL A;  3HM3 A;  4K1R B;  4LLG M;  5BMH A;  1BUI C;  2JXT A;  4MGK E;  1D4B A;  1L4Z B;  1V80 A;  2QIE B;  1I35 A;  3ZVV A;  1JAL A;  2LGD A;  4TSS A;  2N9E B;  2WXK A;  4OZB A;  4XWT A;  4N6E B;  1EF5 A;  4HPM B;  4DK5 A;  3V6E B;  5D7G A;  2DZK A;  4RFB A;  1SSN A;  4LK0 M;  4B0E A;  4OW0 A;  1SIJ A;  2O6V B;  3BWU D;  4US8 A;  2E6X A;  5T8I A;  4M0W B;  3N1X C;  1ET9 A;  3TL5 A;  2M19 A;  2GMI C;  1YJI A;  2LXC A;  1FNW A;  3H7S A;  2JU6 X;  2HTH A;  2FBW B;  3NY5 A;  4HPP A;  4JLC A;  3DVG Y;  2DZJ A;  5BMG A;  4P6V F;  4WQO B;  3R2I A;  2B3A A;  2V3N A;  4BZA A;  5KHQ A;  4O1N A;  3ZXV A;  1UWX A;  1UGJ A;  4JX1 C;  1ZUD 2;  4DDG D;  3RUI B;  4BKT A;  2DZI A;  2JUO A;  2MJ3 A;  1ZDX A;  2W3S A;  2Z59 B;  4JPS A;  3S2A A;  1V97 A;  3AEA B;  1I4P A;  1K52 A;  4NY0 A;  1RM6 C;  4NNJ B;  4X57 B;  3E9S A;  2W55 A;  1Z5S B;  2BB6 A;  3WAL A;  3KWL A;  2KQS A;  2WXP A;  1S3S G;  1WR1 A;  2V4L A;  2L32 A;  1V5T A;  1WYG A;  2LJI A;  4ZDV A;  1GNU A;  2GBM A;  4KSK C;  3Q3N C;  4G0N B;  4FBJ B;  3WAO A;  1TBE A;  2ZPY A;  3ZNZ B;  1E8X A;  4M00 A;  1H8C A;  5D3I B;  4HXD A;  2BKF A;  5FK9 C;  2PVG C;  3TEX A;  2LHE A;  2NBV B;  4ZOH C;  1KLG D;  5EE1 A;  2G4D B;  4ZRI A;  3P4P B;  3ABV B;  1OEY J;  2OJW A;  1WFY A;  5JXV A;  4IM0 A;  1VCB A;  2NPT B;  1VZ7 A;  1TZ1 A;  2IO0 B;  1WJU A;  2Z0D B;  3AH7 A;  3DPD A;  4RGO S;  1KM7 A;  3W2D A;  3LB8 C;  1BML C;  3P2B A;  1VZ8 A;  1DGJ A;  1EU3 A;  4II3 B;  4WWM A;  3KWV A;  3WAP A;  2J0J A;  2SEB D;  3SFE B;  5IA7 A;  1F0Z A;  3K9P B;  5AUI A;  1C79 A;  4RGN A;  1ET6 A;  4HK2 A;  2ICI A;  3PRE A;  4WH4 A;  3KW5 B;  1QOG A;  1XO3 A;  2LEK A;  2R61 A;  1L0Y B;  2DWQ A;  1K50 A;  4ANV A;  5L83 A;  1M4V A;  2G3Q B;  5HI1 A;  1AWD A;  2I38 A;  1WXM A;  2IY1 B;  3PSE B;  3EC8 A;  1WWT A;  3AEG B;  3SHQ A;  3RN9 C;  1T0R C;  1PUT A;  3ZW3 A;  2RSU A;  3P42 A;  3W5U B;  4JQW C;  3NZS A;  1JRU A;  1C76 A;  1SBB B;  5EE9 A;  1FRD A;  5AZF A;  4A8X C;  3T3O A;  3B9J A;  2QCZ A;  4I6P A;  1OQR A;  1GPX A;  1OFF A;  3VUX A;  3NS1 A;  4MGY E;  1I4H A;  1J7C A;  1E6E B;  2JSV X;  2BVC A;  2J53 A;  3CSF A;  2N1W A;  4QAY A;  2V4I B;  2LGX A;  1XT9 B;  3Q8A A;  3L0W B;  2MWS B;  4KX6 B;  1QIL A;  3P4Q B;  1RFK A;  2EKE C;  3KUZ A;  4TKN A;  2C5L C;  1JRO A;  2CU3 A;  5HFY A;  3ONS A;  4L2Y A;  4E3C A;  3I5J C;  3ZXR A;  2O2V A;  4C80 A;  3ZRF A;  2WXM A;  4HKQ A;  1PYW D;  4GDK B;  2D3C A;  1T3Q A;  2Y3A A;  3VFK A;  2V3S A;  4WWO A;  1GJZ A;  4KVG B;  2BYT A;  2WU2 B;  1TS3 A;  5C3J B;  2ZZP B;  4C00 A;  1WE7 A;  4D2K A;  4IOI E;  3P1M A;  2LI5 A;  2H89 B;  1J7A A;  5G55 A;  2MW5 A;  2C7H A;  2L3Z A;  2SAK A;  2JZ3 B;  1STE A;  2AYO B;  2KX0 A;  3RCZ A;  2QC8 A;  4HKZ E;  1M94 A;  1C77 A;  3CMM B;  4HPL B;  3FIL B;  1WIA A;  4N9F 4;  2RDH A;  1IGC A;  4OZA A;  4YTM B;  1JQ4 A;  2L52 A;  2KNB A;  3LDZ E;  4IKG A;  4WWN A;  4N59 A;  5IO9 A;  1SF0 A;  2LFI A;  3WA0 A;  4HCN B;  3MC8 A;  1SJE D;  1PGX A;  2ZVN A;  2ZNV B;  3ZLZ A;  4WIP A;  2WNM A;  1I4R A;  1IBX B;  2ZVO A;  1QOB A;  4M8N A;  4LDT B;  2INC C;  3PHW B;  4GSW A;  3RT3 B;  4LNK A;  2N9L A;  1QKZ A;  3NHE B;  4E74 A;  1J7B A;  2V1Y A;  1NVI D;  2MX2 A;  1FXT B;  4MM3 B;  3NRZ A;  2KAN A;  2H88 B;  4US9 A;  4F7Z A;  2HE7 A;  1ZGU B;  2ON8 A;  2XEW A;  1TKY A;  3N3K B;  2QMT A;  2GBK A;  4EEW A;  3DVN V;  4BKS A;  4K7U A;  3VTW A;  2FCN A;  2K6D B;  3PO0 A;  1AW7 A;  1D5M C;  5EE3 A;  2IGG A;  2KDF B;  2MLB A;  4A9A A;  1T5X D;  5LLI A;  4RF0 A;  3HM6 X;  2KN5 A;  4ANU A;  3BK1 A;  2I1K A;  2RDB C;  1X1M A;  3TJP A;  2M4N A;  2KTF A;  4KGT A;  1B9R A;  4AP4 C;  4RCO A;  4B0M A;  2BT6 A;  3X0W A;  2W54 A;  1R7S A;  2I2Y A;  3V60 A;  2DBY A;  1C78 A;  2KO3 A;  4RF1 A;  4MSM B;  1DOI A;  1L0X B;  5AZH A;  2GB1 A;  3RNC C;  4RNA A;  2VZK B;  4EE2 A;  3AE9 B;  4DXA B;  1GUA B;  2D2Q A;  2WXJ A;  3A33 B;  2ZJD A;  3DDC B;  4MGZ E;  2XK5 A;  2FE8 A;  1YQ4 B;  1AYF A;  4XZ4 A;  1WZ0 A;  4BKS D;  2MH7 A;  2CHZ A;  1WGK A;  2BS3 B;  1A70 A;  2JXX A;  4MEL A;  3A1Q A;  3H8H A;  3RPF C;  2BQQ A;  2D07 B;  4UDU C;  3AU5 A;  4URK A;  4WQM A;  1FFU A;  4JIO U;  4LNI A;  5C23 A;  2D3A A;  2CJN A;  4Q2J A;  2ZCC A;  3QJZ A;  3VUW A;  4M8M A;  1QT9 A;  1XCQ L;  1UD7 A;  4JL9 A;  1I4G A;  2J4X A;  3IAS 1;  5AZG A;  3LXF A;  4RGM A;  1TZO A;  3B2G A;  2OHF A;  1JRP A;  1YMH E;  2NBU A;  3OAW A;  3ZTC A;  1JCK B;  3EGR A;  3VR8 B;  1OTR B;  3AU4 A;  4K7W A;  2LVO A;  3V62 A;  1WM3 A;  1Z2M A;  5BYQ A;  2AWT A;  4GXB A;  4GB9 A;  5C1Z A;  1MHH E;  3ZDM C;  1FCL A;  3A9J B;  3I3T B;  1NYQ A;  3MFG A;  5CX3 A;  2J0M A;  1ENF A;  4S0R A;  1PQS A;  3AE5 B;  4AUQ C;  3BYT B;  4P7I A;  3L10 B;  3NVW A;  3VUY A;  4NJ6 A;  2JVC A;  1EWY C;  4BBN F;  2M0A A;  3JYU A;  3VAW A;  3VHT C;  3DVN U;  2YEP F;  1XLP A;  1E8W A;  1OQQ A;  1SXT A;  3QCA A;  2GLS A;  1XD3 B;  2JZZ A;  4KDL B;  1BXT A;  3FIL A;  1L4D B;  1WMH A;  3WAM A;  2BPS A;  2MBH A;  2KWC A;  3DWM A;  1WXV A;  3T3N A;  1AN8 A;  4IWP A;  2JY6 A;  2DZM A;  4HWI B;  1WJN A;  3WCQ A;  3VR9 B;  2IO1 B;  1LO5 D;  2M0X A;  2INP E;  3R2T A;  3SDL C;  4IC7 B;  1WXS A;  2IZV B;  1FRR A;  1NEN B;  3HRD D;  2KQ7 A;  1WGG A;  4DBG A;  2PEA A;  1P7F A;  3DWG C;  3ZJT A;  4I6L B;  1XQQ A;  4WAF A;  3ZRC A;  2QSD A;  3ML8 A;  3HVZ A;  4RGT A;  4LJP B;  2KX3 A;  2JQR B;  3NS8 A;  2ZEQ A;  2KWD A;  1ZPS A;  4FJV B;  3QK0 A;  2NBW B;  4WJP A;  2WXG A;  4IUM B;  4RM8 A;  3MC9 A;  5LNK 1;  4XDC A;  2PTL A;  2KFJ A;  1FPY A;  3H7P B;  1ZP0 B;  1C1Y B;  4FN2 A;  2LD9 A;  5DPS A;  3EFC A;  2M1M A;  2KC1 A;  4MAC A;  1JWB D;  2AQ1 B;  3TEZ A;  2HDE A;  3AN1 A;  4A6Q A;  4MGI E;  1IGD A;  2AX5 A;  2PVO D;  3UQA A;  3PTF C;  1ZE3 D;  1PGA A;  4PT5 A;  4ICV A;  5HG2 A;  2JWU A;  1S1Q B;  4EZK A;  3AE6 B;  2RR9 A;  3AE2 B;  4IM3 A;  3RNF C;  2LGI A;  1JWU D;  2A5U A;  3EA6 A;  5JH5 C;  2BW2 A;  1WGR A;  3VXW A;  1PDX A;  3KH0 A;  2AQ3 B;  2O2V B;  4PYU A;  4ACF A;  4FJZ A;  2KZR A;  1HQR D;  3ZNH B;  3OJ3 A;  3VH4 B;  4BAX A;  3Q14 C;  1IBX A;  1LFD A;  5I4D A;  1RYJ A;  3B2F A;  2K1F A;  1KLV A;  1ISN A;  1SE4 A;  1GG3 A;  4DHZ B;  1MG8 A;  2L05 A;  3FC4 A;  2MBO A;  2QDF A;  2IDY A;  3I63 C;  2BYE A;  2LVP A;  2A4Z A;  4RMA A;  4TV3 A;  3TMP B;  2WXL A;  3Q3O C;  2J42 A;  1YN5 A;  2AL6 A;  3NJT A;  1FFV A;  3R7R A;  1XXG A;  1F2R C;  2HJ8 A;  1R4N B;  4XYC A;  4GGQ A;  4NAW B;  3DBL B;  1FNV A;  2BYF A;  2HTM E;  1FMA D;  5JZE B;  4ARC A;  1A5R A;  1WY8 A;  1E8Z A;  1L5P A;  2CJO A;  4W9C A;  2D10 A;  2M8S A;  2KWU B;  2UU7 A;  3N1Z C;  3HK0 A;  1U4A A;  3NZ3 A;  4NZL B;  4DWF A;  3C19 A;  1XF5 L;  4FAD A;  4C7Z A;  3E56 A;  1C3T A;  5AUK A;  4NJ7 A;  2DHZ A;  2C60 A;  1Y56 A;  1F77 A;  2LJ5 A;  2N9K A;  3A4S C;  3M95 A;  1LXD A;  4LNO A;  2KDM A;  2LAS A;  3UQB A;  1LQB A;  3Q8B A;  4TUU A;  2FIF A;  1TY2 A;  1XLN A;  4N58 A;  1J8C A;  1VZ6 A;  1VJK A;  4GDK A;  3N1Y C;  5GMV A;  1KFY B;  4LJO B;  4IDI A;  3DBS A;  2PE9 A;  2DLB A;  2INN E;  2OJR A;  1RFA A;  4IG7 B;  4KDI C;  3URY A;  4YTP B;  2ZPN A;  1I4Q A;  4DXF A;  4JWU C;  1QLB B;  4XDD A;  3QIJ A;  3T8M A;  4BOS C;  4PS3 A;  2J52 A;  3FKY A;  4K3C A;  3V3X A;  4AJY B;  1BT0 A;  1PFD A;  2FUG 1;  4ARI A;  5JHB A;  1NEK B;  4F8C B;  3M62 B;  1TS5 A;  3AED B;  2CHW A;  4IM2 A;  2N9X A;  1F2R I;  3ML9 A;  4MEM A;  2JWZ A;  3RZW C;  1L2N A;  2D11 A;  2CHX A;  3B0A A;  5H8Y E;  3P4S B;  3RNG C;  3RNB C;  4XGA B;  3QA8 A;  1YQ3 B;  2WLB A;  3PV1 A;  2G1E A;  3VRA B;  4C56 C;  1NI3 A;  3MJW A;  3C8Y A;  1E0Z A;  4B95 A;  1DOX A;  1SGH A;  3DOW A;  3Q3F A;  4WAA A;  1UNS A;  1EO6 A;  3AMZ A;  2WXI A;  1CQV A;  2WDR B;  2ZW0 A;  4GDL A;  2AL3 A;  4R3D A;  2YLM A;  4OVV A;  2MRP A;  2C7M B;  2D3B A;  5GXG B;  1WRI A;  4ZYS A;  2KMM A;  3SFD B;  1C4C A;  1T0Y A;  3A1Q B;  4NAM A;  3QQ8 B;  3V61 A;  1E5W A;  1XLQ A;  1TS4 A;  1V86 A;  1F9J A;  3U30 A;  5BYR A;  4WJN A;  5FKA C;  2KKC A;  4JE3 B;  1NDD A;  2PMV A;  3AE8 B;  4GIV A;  3O13 A;  4BVU C;  1CK1 A;  1V1P A;  4XE0 A;  2GRI A;  1N63 A;  1L6V A;  1FD6 A;  2K8B A;  5BYS A;  3N9Y C;  1YN3 A;  4FA6 A;  1VRA B;  2NR2 A;  1D5X C;  2KLG A;  3Q6B A;  4GMV A;  1GB4 A;  2AQ2 B;  1C4P A;  3PHX B;  4CHK A;  1YX5 B;  1EU4 A;  2X38 A;  2KDB A;  4KV2 A;  1J0G A;  5D3D A;  3UI3 A;  2K5P A;  1UF0 A;  3Q2A C;  1G6J A;  1T0Q C;  5IN7 A;  2IBI B;  4GU2 A;  5DPR A;  4AJW A;  4MT5 A;  4W9I A;  3H9D A;  4YTN B;  3T9L A;  3TEY A;  3X23 A;  1WXA A;  2G4S A;  2K6Q A;  5BO4 B;  2L00 B;  2GBJ A;  4YSZ B;  3PRM B;  2ZW1 A;  2NCN A;  3TUO A;  3ZO5 B;  1P3Q U;  4NJC A;  1V49 A;  5IAA C;  1FEH A;  1JWS D;  2BWF A;  2K9X A;  4S17 A;  3ETR A;  2KVZ A;  2HD5 B;  4KKJ A;  2BKR B;  2KD0 A;  3VDZ A;  2Y5P A;  2K8C A;  3IHP C;  1Q5W B;  3MP9 A;  1F1H A;  2MJE A;  1WMH B;  4ZRQ A;  3SR6 A;  1WJ6 A;  3FAH A;  3NVV A;  1YJ1 A;  2LGY A;  1WX9 A;  4ZRK A;  3AEB B;  3RI7 C;  1MFW A;  2REX A;  2IND C;  1OGW A;  3C0R B;  2QIL A;  4USA A;  4BFR A;  1GC6 A;  2J0K A;  2IYD B;  3W1S C;  1AAR A;  2JYE A;  3JW0 X;  4HCP B;  3WAN A;  1RWS A;  4DDI D;  4KGS A;  3ZJU A;  3IAM 1;  2BS2 B;  3DCG A;  3PPA A;  1DOY A;  1V8C A;  2KDE B;  2EMS A;  1C4A A;  1WE6 A;  3AXC A;  1RRB A;  4ICU A;  1YNT E;  4C4V B;  5CTR C;  2RMM A;  1WZ3 A;  3BZD B;  3L08 A;  3GZN I;  2BGF A;  5LXI B;  1SJH D;  5IP4 D;  1WSP A;  4M01 A;  3BK2 A;  1VD2 A;  2N9P C;  2FID A;  2WDV B;  2ACZ B;  2BF8 B;  1MJD A; 
#chains in the Genus database with same CATH homology
 4WAF A;  1JML A;  2RDG A;  2V0G A;  2QSD A;  1B1Z A;  5JXV A;  1TYG B;  4JWS C;  3HVZ A;  4RGT A;  5G5H A;  1QF6 A;  1MHX A;  2EKI A;  1YN4 A;  1VZ7 A;  3ZJV A;  5G5G A;  3U2S C;  2JQR B;  3AH7 A;  4RGO S;  2KWD A;  3LB8 C;  3W2D A;  1BML C;  3AV8 A;  1ZPS A;  2DYM A;  2TSS A;  1KH0 A;  2NMQ A;  1VZ8 A;  2WXG A;  1DGJ A;  1EU3 A;  1VDV A;  4WWM A;  5LNK 1;  3KWV A;  4FXC A;  2PTL A;  4XDC A;  3SEB A;  2SEB D;  1I4X A;  4KGR A;  3SFE B;  4H2A A;  2W82 A;  3W5V B;  1F0Z A;  1ZP0 B;  4OHJ A;  4YWG G;  5AUI A;  1C79 A;  4RGN A;  1ET6 A;  4MAC A;  1JWB D;  2AQ1 B;  3AEE B;  2WP9 B;  3TEZ A;  1IUE A;  2ICI A;  1JW9 D;  1ZDV A;  2HDE A;  2N0S B;  1PGB A;  2MEK A;  2XNA C;  3AN1 A;  4A6Q A;  4WH4 A;  1IGD A;  2AX5 A;  2PVO D;  3BVM A;  2XN9 C;  3P63 A;  3AE7 B;  1QOG A;  1ZE3 D;  1PGA A;  4PT5 A;  1XO3 A;  2LEK A;  2R61 A;  2IGD A;  4ITK A;  4KKI A;  5HHD G;  3CIR B;  3MHZ A;  1L0Y B;  2DWQ A;  1K50 A;  2JWU A;  5HG2 A;  1EM7 A;  4GDL B;  1M4V A;  3AE6 B;  5HI1 A;  1AWD A;  2I38 A;  3NVZ A;  1GB1 A;  3KLS X;  3AE2 B;  1SE3 A;  1E9M A;  2LGI A;  1HZ6 A;  1WWT A;  1JWU D;  3AEG B;  2K3U A;  3EA6 A;  1PUT A;  4LTU A;  3BVZ A;  2IJ0 A;  3P42 A;  3W5U B;  2BW2 A;  3VQI A;  1C76 A;  1SBB B;  5EE9 A;  1FRD A;  2QEJ C;  2KN4 A;  4A8X C;  3B9J A;  3T3O A;  1PDX A;  3AM9 A;  1OQR A;  2AQ3 B;  1GPX A;  1OFF A;  4YSY B;  3NS1 A;  1I4H A;  1J7C A;  1E6E B;  2JSV X;  2D5G A;  1HQR D;  3AB5 A;  2J53 A;  1C9F A;  1ROE A;  2Q5W D;  1XLO A;  2V4I B;  2QJL A;  1P7E A;  3MC0 B;  1IBX A;  3AEC B;  3Q8A A;  4CQN A;  2WXF A;  4M0W A;  5I4D A;  1RYJ A;  4A90 A;  3B2F A;  4KX6 B;  3HVD A;  1QIL A;  3P4Q B;  1SE4 A;  1RFK A;  1VLB A;  1FCC C;  1ACC A;  2BBC A;  1JRO A;  1UUP A;  3FC4 A;  2GI9 A;  2CU3 A;  2IDY A;  3ZQ4 A;  5HFY A;  4L2Y A;  1V1P B;  3V05 A;  4C80 A;  2WXL A;  4ZHO A;  4HKQ A;  2WXM A;  2J42 A;  1PYW D;  1MPE A;  1YN5 A;  4GDK B;  4AS1 A;  1FFV A;  2KAJ A;  1XXG A;  1QOA A;  1YJJ A;  1F2R C;  1ZXH A;  2JZP A;  2NTT A;  2Y3A A;  1T3Q A;  3AE4 B;  4NAW B;  1FNV A;  2HTM E;  3GB1 A;  1FMA D;  2BYT A;  2WU2 B;  2L1A A;  2WXO A;  1TS3 A;  1DYQ A;  3LYY A;  5C3J B;  4ARC A;  1MI0 A;  2KAC A;  4OVZ A;  2Z8L A;  1TJE A;  1L5P A;  1GAQ B;  4D2K A;  2CJO A;  4IOI E;  4HEA 1;  3P1M A;  2H89 B;  1J7A A;  3J9C A;  4HRS A;  2SAK A;  1KTK A;  3NZ3 A;  4NZL B;  2V3P A;  5MPO A;  3P4R B;  3Q8C A;  1STE A;  1XF5 L;  1FNU A;  4C7Z A;  3E56 A;  5AUK A;  1CJE A;  4HKZ E;  2DYO A;  2RPV A;  1C77 A;  5E6J A;  2PW9 A;  1Y56 A;  1F77 A;  2N9K A;  2WQY B;  3U52 E;  3FIL B;  3RFZ B;  2WU5 B;  4HRO A;  3AE1 B;  1N5X A;  1IGC A;  2KDM A;  2RDH A;  4OZA A;  4YTM B;  3U7Z A;  1JQ4 A;  1FO4 A;  2L52 A;  1L6U A;  3Q8B A;  1FIQ A;  2BTE A;  4IKG A;  1TY2 A;  1XLN A;  4N58 A;  1KLU D;  4A55 A;  4N59 A;  2IGH A;  1SF0 A;  1VZ6 A;  2LFI A;  1VJK A;  2E3T A;  1KFY B;  2M56 B;  4IDI A;  4TQ1 A;  1SJE D;  1PGX A;  3IT4 B;  3OWE B;  4WIP A;  3EUB 2;  5BMI A;  2WNM A;  1TY0 A;  2DLB A;  1I4R A;  2INN E;  2WXQ A;  1IBX B;  1MVK A;  3URY A;  4YTP B;  1I4Q A;  4AQ7 A;  1QOB A;  4DXF A;  4JWU C;  1QLB B;  4XDD A;  3U4E G;  2Y5C A;  2J52 A;  3V3X A;  2N9L A;  1QKZ A;  3MJ5 A;  4XWW A;  4P16 A;  1PFD A;  2FUG 1;  1J7B A;  4ARI A;  1D6E C;  1NEK B;  1K51 A;  1NVI D;  4MM3 B;  1TS5 A;  4HJG E;  1HXY D;  3AED B;  3NVY A;  1L0V B;  2YEP B;  3NRZ A;  3Q8F A;  4YSX B;  3GS2 A;  4YXD B;  4L23 A;  1F2R I;  2BS4 B;  2H88 B;  2K0P A;  4US9 A;  4GLS C;  2W3R A;  4DQO C;  2LHD A;  2ON8 A;  1SEB D;  2ONQ A;  1E10 A;  2K22 A;  1TKY A;  3P4S B;  5H8Y E;  4WUR A;  2QMT A;  3KQ4 A;  3W9C B;  3BYY B;  3GP7 A;  1ZOY B;  1YQ3 B;  2WLB A;  3L4P A;  1HA5 A;  1WXQ A;  2G1E A;  3PO0 A;  1AW7 A;  1D5M C;  4REZ A;  3VRA B;  4C56 C;  4ZHP A;  3IT6 B;  1T6B X;  1NI3 A;  5EE3 A;  2IGG A;  1CZP A;  3C8Y A;  4A9A A;  4RH6 A;  1T5X D;  1E0Z A;  2WS3 B;  1DOX A;  3ZGZ A;  4RF0 A;  1UNS A;  3AMZ A;  2WXI A;  1CQV A;  1GOZ A;  2WDR B;  2ZW0 A;  1D5Z C;  3BK1 A;  4C7Y A;  4MH8 A;  1E7P B;  4KGT A;  2WXR A;  4R3D A;  4DXG A;  1B9R A;  2G9H D;  1ESF A;  5FR3 A;  3I57 A;  4RCO A;  4B0M A;  5GXG B;  1TKG A;  1WRI A;  4ZYS A;  1TS2 A;  2BT6 A;  2KMM A;  3SFD B;  2W54 A;  1FM0 D;  1C4C A;  1R7S A;  5H92 C;  3NUH B;  2I2Y A;  5EE0 A;  2DBY A;  1ZXI A;  1C78 A;  4NAM A;  4RF1 A;  3PZ8 A;  2IPK D;  1EWC A;  2BB5 A;  2MJD A;  1XLQ A;  1TS4 A;  5C2T B;  1DOI A;  1L0X B;  1N62 A;  5BYR A;  2PIA A;  2PLP A;  5FKA C;  2GB1 A;  1VR9 A;  1HZ5 A;  2N7J A;  4RNA A;  2VZK B;  4JE3 B;  4EE2 A;  3AE9 B;  2PMV A;  2WXJ A;  3AE8 B;  3AEF B;  3O13 A;  1CK1 A;  1V1P A;  4XE0 A;  4TMA B;  2GRI A;  1K53 A;  1N63 A;  1L6V A;  1FD6 A;  5BYS A;  3N9Y C;  4J3O D;  1YN3 A;  1VRA B;  4OZC A;  2KQ4 X;  2FE8 A;  1D5X C;  1YQ4 B;  1AYF A;  3ABV B;  2AQ2 B;  1KRH A;  1GB4 A;  2WXH A;  2L83 A;  1N5W A;  1QQR A;  2WDQ B;  1C4P A;  3IXS A;  2MH7 A;  3PZ7 A;  1SE2 A;  1EU4 A;  2X38 A;  1FXI A;  1WGK A;  2BS3 B;  1A70 A;  5D3D A;  2B76 B;  3UI3 A;  3H8H A;  3RPF C;  2K5P A;  4YT0 B;  1NYR A;  3ZJT A;  4LLG M;  4UDU C;  5BMH A;  4WQM A;  1BUI C;  2JXT A;  4MT5 A;  5TSS A;  1D4B A;  3W1S A;  1FFU A;  1L4Z B;  2QIE B;  4YTN B;  3TEY A;  1JAL A;  1HEZ E;  4TSS A;  2WXK A;  4OZB A;  4XWT A;  2CJN A;  4N6E B;  4Q2J A;  3HUI A;  4YSZ B;  2NTS A;  3AE3 B;  2ZW1 A;  4ZRP A;  1QT9 A;  1XCQ L;  3TUO A;  5D7G A;  4RFB A;  4L1B A;  1V1O A;  1I7H A;  4NJC A;  1SSN A;  4LK0 M;  1I4G A;  2J4X A;  4B0E A;  3IAS 1;  4OW0 A;  1XCT L;  1Q10 A;  1SIJ A;  1FEH A;  1JWS D;  3BWU D;  3LXF A;  2K9X A;  3ETR A;  4US8 A;  2E6X A;  5T8I A;  4RGM A;  1TZO A;  1FXA A;  3B2G A;  2OHF A;  1JRP A;  1ET9 A;  1YMH E;  4KKJ A;  3I9V 1;  2M19 A;  2JYT A;  1YJI A;  1JCK B;  1FNW A;  3EGR A;  2Y5P A;  3VR8 B;  3MP9 A;  2JU6 X;  2MJE A;  1N61 A;  2FBW B;  3BVG A;  4ZRQ A;  1XEE A;  5BYQ A;  2LMC A;  3SR6 A;  5BMG A;  3FAH A;  3NVV A;  1MHH E;  4P6V F;  1FCL A;  2JX5 A;  3R2I A;  2V3N A;  1NYQ A;  2VZK D;  3MFG A;  4O1N A;  3Q69 A;  3AEB B;  1UWX A;  1ENF A;  1UGJ A;  4JX1 C;  3TEW A;  3AE5 B;  1ZUD 2;  2EEL A;  3BYT B;  1JWM D;  3NVW A;  2MJ3 A;  1ZDX A;  2QIL A;  4USA A;  2W3S A;  4JPS A;  1V97 A;  2WXN A;  3AEA B;  1I4P A;  1EWY C;  1K52 A;  1JWA D;  2M0A A;  1SB3 C;  1RM6 C;  3E9S A;  2W55 A;  1QOF A;  2YEP F;  3CWI A;  1XLP A;  2JYE A;  1OQQ A;  2BB6 A;  1SXT A;  1RWS A;  3KWL A;  4KGS A;  2WXP A;  1N60 A;  1BXT A;  3FIL A;  3ZJU A;  1L4D B;  2L32 A;  3IAM 1;  3TSS A;  2BS2 B;  1UWM A;  1DOY A;  1V8C A;  3DWM A;  1WYG A;  1C4A A;  2LJI A;  3Q8E A;  3T3N A;  1KF6 B;  1YNT E;  1AN8 A;  2RMM A;  3BII D;  1TKE A;  3BZD B;  3WCQ A;  3VR9 B;  2OED A;  1SJH D;  1LO5 D;  2PKO A;  5D3I B;  2INP E;  3R2T A;  5FK9 C;  2PVG C;  1WSP A;  3TEX A;  3BK2 A;  3ZYY X;  2LHE A;  1FRR A;  3VRB B;  4ZOH C;  1NEN B;  1KLG D;  2LUM A;  5EE1 A;  3HRD D;  3R8B A;  2WDV B;  4TQ0 A;  2ACZ B;  3P4P B;  1P7F A;  3DWG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...