1XEEA

Solution structure of the chemotaxis inhibitory protein of staphylococcus aureus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
b'NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemotaxis-inhibiting protein CHIPS
publication title The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xeeA01
2K3UA 1XEEA
chains in the Genus database with same CATH superfamily
4DHZB 2K3UA 3KWLA 2KN5A 1N60A 1SJED 1XLOA 5HFYA 4KGTA 3ALBA 4TUUA 2WXMA 2JRHA 1T0QC 3ECIA 3DBRI 1KRHA 2DZMA 4HPPA 2WXPA 1I35A 4MGIE 4G3XB 1DOYA 4ZHPA 4FXCA 4OW0A 1JWMD 2FBWB 2AYOB 3H7PB 2AWTA 1HQRD 3VTWA 1YNTE 3VTVA 3RT3B 4EE2A 1XD3B 1BXTA 1SJHD 2KWVB 2DYMA 3RULA 1XLPA 1DOIA 3NUHB 1L2NA 1FCCC 2BB6A 2VRRB 3WALA 1EU4A 5D7GA 1L4DB 3H1UA 1Y8RC 3I63C 4BOZB 2WXQA 1MVKA 4GIVA 1TBEA 1SF0A 2ZJDA 3VDZA 4C00A 1WJUA 2KX0A 4FADA 5JHAA 1YN4A 1QOBA 2SAKA 1TS3A 3MTNB 1PGBA 2PKOA 3KUCB 4ANXA 2I38A 2AL3A 4MSMB 2KNBA 5JZEB 4QAYA 1F0ZA 3DHHC 4WWOA 1J8CA 3RPFC 5DCNA 4RGNA 4KDLB 1WGYA 1GC6A 3ZNHB 5C1ZA 1QOGA 4W9LA 4ZYNA 5IO9A 1LQBA 4M00A 3BK2A 1C76A 1NDDA 1TS4A 2WS3B 3M3JA 4D2KA 4ACFA 3MC9A 2PIAA 3SEBA 4RMAA 2GRIA 1LGRA 3Q8FA 2N9EB 4IM0A 3DVNV 3AU4A 3R3MA 4I6PA 4YWGG 2J7QB 2W9NA 4YSZB 1WH3A 3VVWB 2QJLA 4LNNA 4P7IA 2BWFA 1NYQA 4M02A 2WXRA 1YQ3B 2DNFA 3U30A 1D4BA 4A3OA 2A4ZA 5HHDG 2YLMA 2LGIA 2QHOA 3V3XA 3MHSD 5DPSA 3E9SA 2VZKD 3V62A 3IAM1 4YTMB 2EKEC 2RR9A 2LFIA 4JX1C 1PGXA 3Q69A 4NJCA 3NOBA 4MSQB 3PPAA 3IFWB 4II2B 3T9LA 4AWJA 1WRDB 2D5GA 3A9KA 4M0WB 1JRUA 3QK0A 1RM6C 2WDRB 2KWDA 1EWYC 2D3AA 1I4RA 2JQRB 1Q1OA 1RYJA 3L0WB 3W9CB 4A6QA 1UWMA 2DYBA 4YSYB 5TR5A 1GAQB 5FR6A 1AW7A 4BKTA 3VUWA 3EFUA 3IAS1 1V6EA 2RGFA 1RLFA 3KQ4A 3ML8A 1TZOA 3DWGC 2YEPF 1V1OA 2X38A 1WX8A 1SXTA 2N9LA 2KQ7A 3R7RA 3QA8A 2M56B 1E9MA 2JWUA 1DOXA 3AH7A 4IOIE 1SE9A 3C8YA 1FNWA 3FKYA 1L0XB 3V60A 4II3B 4RM8A 3IT6B 1J0GA 3R66C 1NENB 3HVDA 4ARCA 1RFAA 4LCDE 4XC2A 1UZXB 5J17A 2LWPA 2N7JA 3QC8B 3AI5A 3ZJVA 1UUPA 4HEA1 2DZKA 4OVZA 5AUIA 4WH4A 4DBGA 2KANA 3AMZA 3RI7C 1C4CA 4FA6A 2Z0DB 1KF6B 2FCQA 1GPXA 4PS3A 2PVGC 1XEEA 2IJ0A 4HVBA 2N9XA 3AE9B 4NZLB 2CHWA 2J52A 5AZFA 2V4LA 4KKIA 4W9HA 3IHPC 1VRAB 3N1ZC 5BMGA 1WWTA 4A55A 5C23A 3R8BA 3PREA 5HG2A 1T5XD 1DYQA 4LDTD 3RMKC 3AV8A 1MPEA 4AJYB 2CJNA 3L17A 3W1YA 2LJ5A 2KDFB 3NZ3A 3A4SC 4AOFA 1WJNA 2NR2A 1ROEA 4LK0M 4NAMA 1YX6B 2ZPNA 4L23A 3BIID 2G1EA 1KM7A 1V8CA 2KAJA 2Z59B 1TS2A 4NQKE 2WU5B 1WZ3A 2KC2A 4RH6A 1OQQA 3CSTA 3DVGY 1AYFA 3WAPA 5KHOA 5D2MB 2AQ2B 3HM3A 3PVLA 4RF1A 2YVCA 1NBFC 3LDZE 3DBHB 1OTRB 1OEYJ 4G50A 3RD2A 4LNOA 2BVCA 4B0EA 3UIPB 1ZGUB 2JPHA 3CF6E 5CTRC 2JYEA 4KZ0A 1JWUD 1C3TA 1Z5SB 1EF1A 1M94A 2KACA 2OJRA 3AN1A 2O2VA 2KXJA 3NVYA 3GZNI 3DQVA 3A9KB 3C19A 2M1MA 1WX9A 4S17A 1C78A 3RNFC 2JSVX 3TUOA 3LXFA 2XNAC 4FN2A 4HK2A 1UH6A 4ASWC 4C7ZA 4GSWA 4PYZA 3L4PA 3UI3A 4JE3B 3NVVA 4I6NB 2C7HA 2G45B 4TSSA 1JRPA 3TEYA 4IKGA 4AQ7A 4N59A 2NTTA 1LO5D 3SD5A 1JWSD 2KJRA 3A33B 1OEYA 2XBBC 2J53A 2WHIA 4YTPB 1T0SC 4HDQA 2K6QA 4A3PA 1STEA 3ZDMC 4LNFA 5D3DA 2KMAA 2D11A 1E8XA 4NNJB 3RFZB 4US8A 5FR3A 2INDC 4C80A 1TY2A 3KUDB 1WGGA 2BS2B 4G0NB 1N6ZA 3SFDB 1R4NI 1GOZA 5CHWA 1L0YB 1CMXB 3Q8EA 2INPE 4JWSC 1LFDA 3H6NA 2RDGA 3VQIA 2M19A 5G5HA 2KDBA 3BVGA 1H8CA 3IBEA 2EELA 4WJOA 2VH1A 1MFWA 4BVUC 4DHJB 4ANWA 3DBSA 1LXDA 2N9KA 1WGHA 5EDSA 1WRIA 2WU2B 1V80A 1XT9B 2PW9A 2L05A 3UF8A 1KLGD 3TSSA 4PT5A 4B0MA 2JZPA 3PSEB 3ZYYX 1B1ZA 1UD7A 2K39A 2JX5A 5DPRA 2Y5CA 3AE6B 2MW5A 4UDUC 5TSSA 2MH7A 2NBUA 2O6VD 1D5XC 4FLHA 5CHVC 2QSDA 4ZOHC 2MP2A 3ETRA 4AP4C 3TL5A 4GLSC 1S3SG 1C9FA 3AEEB 4DDID 4KIKA 3L16A 2M4NA 5BO4B 1E8WA 1WE6A 2CU3A 1NI2A 1ZXIA 1C77A 4REZA 2LUEA 5H92C 2BPSA 1IPGA 1ENFA 2JVCA 2Y5BB 4EKUA 1I4HA 1Q10A 2KZRA 2RDBC 5EE1A 3EA6A 3B9JA 2KKCA 4MGYE 3T3NA 3AEGB 2V3NA 1WF9A 4E71A 1L6UA 4J3OD 5BYQA 1UBIA 1FM0D 1TY0A 2O2VB 3AE1B 4K1RB 1HXYD 3KLSX 3MC8A 2DENB 1PUTA 1R7SA 4ITKA 3KW5B 3ZNID 2J4XA 2MBQA 2OEDA 4M01A 5C2TB 1LM8B 3RNGC 3BZDB 3N20C 4WURA 3VRAB 1E0ZA 1EWCA 3RUIB 3ML9A 1E7PB 1SB3C 4B9KA 1E5WA 1QOFA 1P7FA 3UGBB 3ONSA 2V4IB 1GJZA 1TS5A 2WXLA 4RGMA 1AWDA 2KVZA 2GLSA 2N7DA 4US9A 2BYEA 3KUZA 3Q3OC 4MT5A 1KOTA 2MJ3A 1EM7A 1KLVA 2LVQA 4XX5A 4P16A 4FJZA 4C56C 2KDIA 2WGSA 2KTFA 5IOIA 1WXAA 2JXTA 1Y56A 3BYYB 2AQ1B 3B2GA 4KKJA 2MBBB 3H8HA 4TKNA 1YIWA 3AEBB 2V1YA 4HKQA 1F2RI 3VFKA 3U2SC 1R4MB 4GMVA 5I4DA 3BWUD 4DXAB 2KC1A 3H9DA 3RNCC 2M8SA 3L54A 5L83A 2PLPA 2W3RA 2ZNVB 3X0WA 1TKYA 2LVOA 2E6XA 1K51A 4XYCA 3DBLI 2WDQB 5GMVA 2QIEB 3HUIA 3RYTA 2LGSA 2M0AA 1E8YA 1EF5A 1WGDA 1ACCA 4HJKA 2H88B 3NG0A 1BT0A 1KFYB 3Q8BA 2J0KA 1E7VA 2VH2A 3JYUA 3M95A 2NTSA 4JIOU 1FIQA 4CO7A 3LB8C 3ZJTA 3AU5A 5CHFA 4XZ4A 1V49A 3T8MA 3QIJA 4BKGA 1HE8A 2LXCA 2GBNA 2N1WA 2X8XX 1YJJA 3AEAB 3P63A 2L0TA 3W5VB 2LXAA 2KQ4X 2EMTA 2MP2B 5EE3A 5JXVA 3SFEB 1HA5A 1ZE3D 2C7MB 1V81A 4B6WA 2V0GA 4KIKB 4DDGD 5IN7A 2KVRA 2I1KA 4IC7B 1AARA 4URKA 1V1PA 1HZ5A 3FILB 3QCAA 3QHTA 3GP7A 2ZW1A 1ZKHA 3KWVA 3ZNZB 2KJ6A 2LZ6A 3U4EG 1T0RC 2BBCA 2JWZA 3ZVVA 3VUYA 3NHEB 4M8MA 3E56A 3ZUNA 3PTFC 1NEKB 3RN9C 2XN9C 1WR6E 2KX3A 3PT2B 2ZVNA 1SEBD 4WIPA 1GUAB 4MH0E 1HTOA 3V6EB 2PJHA 3ZTCA 2PPHA 3QARA 1TJEA 2BT6A 3VUXA 2FIFA 1E6EB 2DBYA 2ZW0A 3P4QB 1WSPA 2NCNA 3EHVA 1WZ0A 2OJWA 3DVGX 5C3JB 2PMVA 3EFCA 2ICIA 1SBBB 2NMQA 2BYVE 3R2IA 3B1LX 1FPYA 3ENEA 1N62A 2PTLA 2KN4A 1DGJA 2KO3A 2ZEQA 4K81A 3W1SA 1KTKA 2KLCA 3A4RA 3BY4B 2OHFA 4BKSA 3BINA 2GBRA 2KFKA 2V3PA 2L83A 3I3TB 2LEKA 2N0SB 1P1AA 2FCSA 2UWQA 3V05A 3DPDA 1L0VB 3P2BA 1ET9A 1V86A 2FE8A 3BVMA 2KFJA 2JXXA 1L6VA 1PDXA 3GE3C 2PEAA 1FD6A 4DHJD 4ZRQA 4W9DA 4XE0A 3O65B 2NBWB 2R61A 1E10A 1C4PA 2KT7A 2NPTA 1WJ4A 4EZKA 4OVUA 1WXMA 2QMTA 1P98A 2GMIC 3MC0B 1FFUA 2LASA 2FUG1 2G4SA 2DX5B 1TKEA 1ZOYB 1E8ZA 4YT0B 4FJYA 2K9XA 5D94A 1RAXA 3NZUA 1OQYA 3W2DA 3JVZX 4JLCA 3ZXVA 2D2QA 4TQ0A 4IWPA 4WWMA 2MJEA 2KJHB 3PHXB 1J7CA 2MBEA 2WWZA 3H7SA 5AEKB 4RFBA 3JW0X 3PZ8A 4DXFA 1I4PA 4ZRIA 1E7UA 4DK5A 4FULA 2FCNA 3VRBB 2D3BA 1I42A 1N5XA 2MX2A 1P0RA 3UINB 3TEXA 2L0FA 5BMHA 3AE2B 1FRRA 3AE7B 2L32A 4IW0A 3GE8C 4EOYA 3TJPA 1VD2A 1WFYA 2D3CA 4WJQA 3PRPB 1TT5B 2E3TA 1EU3A 4A90A 1WJ6A 1WGKA 2AEHA 1F9JA 1V1PB 2HDEA 3WIMA 2M0XA 2G9HD 5JH5C 4C7YA 2REXA 2BB5A 2ZNVC 1VCBA 1YD8U 2HJ1A 5H8YE 4ZYSA 3BVZA 1VLBA 4KGRA 2QEJC 3R2TA 2WNMA 1WXSA 2ZCBA 1NVID 5E6NA 3DHIC 4HPLB 4N58A 2JRIB 4NAWA 1P9DU 1EO6A 1WMHA 2KWUB 4KGSA 1WM3A 2DAJA 4MM3A 1T6BX 4XDCA 3UIOB 4GN1A 3NRZA 1KLUD 2WXJA 4TQ1A 3KH0A 2MHJA 3VR9B 3OWEB 3O13A 2FNJB 1IYFA 1GNUA 3HHMA 2DWQA 5G5GA 1A5RA 5GXGB 4WJPA 2KWCA 5LNK1 1K50A 4OVVA 3N30A 3T3OA 3MHZA 2XEWA 1WR1A 1CK1A 3MFGA 2KFKB 2WQYB 1L5PA 2V3SA 4FHJA 1J19A 4R3DA 4GDKA 3RZWC 4C4VA 1WE7A 1V2YA 2W82A 1XQQA 4AUQC 1UBQA 1GG3A 2WX0A 1WXQA 4NQLB 2RMMA 4ANVA 2J0MA 2WXIA 2KMCA 2NPTB 2CJOA 1B9RA 1KH0A 1YQ4B 1ZDXA 3NZSA 3VAWA 3WAOA 2LJIA 2J42A 3B08A 1QF6A 3OJ4B 1Q0WB 3A9JA 4N6EB 3R7QA 1ZW7A 3N32A 1OFFA 3HIZA 3ZQ4A 4E3CA 4I6LB 3CWIA 4B95A 2K8HA 2G4DB 2H89B 1T3QA 4HXDA 2K8CA 4WWNA 2TSSA 2KYWA 4BAXA 3V6CB 4EZJA 3U52E 1PGAA 5LXHA 1U4AA 1UELA 1K8RB 2OOBB 2BWES 1NYRA 4ZRPA 2MA9B 5EE0A 3PZ7A 2INNE 3IG3A 3RNBC 4KSKC 3WCQA 2WXKA 3SHQA 3P1MA 2QC8A 2K1FA 3CSFA 1FCLA 3I5JC 2DHZA 2IZVB 4ICUA 1ESFA 1FFVA 3Q2AC 1TTNA 2D10A 2FCMA 2EKIA 3QJZA 2LD9A 3RNAC 1SGHA 2K25A 4RGOS 1FNUA 2CR5A 3TBLD 4S0RA 4YSXB 2RDHA 3VH3B 4AJWA 2LHDA 1BMLC 1TYGB 1SE2A 4K3CA 2IY0B 2ZZPB 1WM2A 5AZGA 3L08A 1D5ZC 4PS8A 3VR8B 3X23A 4W9FA 4NAWB 2GOWA 2KK8A 3RCZA 1RWSA 1WMHB 2Y3AA 3ZRFA 2PE6B 3V61A 4MM3B 4IG7B 4KX6B 4DQOC 4WAFA 3TEWA 4J6IA 1F1HA 2B76B 1FXIA 4PK1A 1XLQA 2HTHA 5JHBA 3PGEA 3Q6BA 4AS1A 1HTQA 2LGYA 4HROA 1FXAA 3AE8B 1XCQL 3PS6A 2W55A 3LYYA 1VJKA 3AB5A 4BZAA 2O6VA 2GBMA 2W54A 2K6DB 2BYTA 1P3QU 4NJ7A 3QX1A 3BYTB 2LI5A 4MACA 4ZRJA 1Q5WB 4CHKA 1K53A 3HK0A 3N1XC 4GDKB 1J7BA 2DAFA 1OGWA 4C4VB 5IP4D 3KYDD 3GZNB 3MJWA 1JQ4A 3Q14C 1V5OA 1K52A 3FC4A 1XF5L 4RGTA 2Z0EB 2RSUA 2R2QA 3A1QA 1S1QB 1SE3A 5IAAC 1WYWB 1YJIA 1JMLA 2CHXA 1ISNA 5CX3A 3VHTC 2IO3B 2WXNA 4JL9A 4L1BA 4MEMA 3MP9A 3A9JB 4K3BA 2QILA 2IO0B 4WQMA 4LLGM 3APFA 1SE4A 2CU1A 4GU2A 1N5WA 4TMAB 3HRDD 1YQBA 2ACZB 3U7ZA 3OJ3A 3W1SC 2NS5A 1FRDA 5AUKA 2C5LC 4K7SA 1R4NB 3PRZA 3UQBA 1L4ZB 2JUOA 4HRSA 2FAZA 4FJVB 4WJNA 5KHQA 5HI1A 2D07B 3QQ8B 1WX7A 4P6VF 3U7DA 3PRMB 3NS8A 2GB1A 2L8JA 1YMHE 2JY6A 1WIAA 4KVGB 4YXDB 3PHWB 1MG8A 4BOSC 5BYSA 4OZAA 2C7NB 2N1VA 5L95C 4JQWC 2ZCCA 1PYWD 2IY1B 2IO2B 2GI9A 2BKRB 2L1AA 2I1JA 4DHZE 1I4XA 4HKZE 2INCC 4EFOA 3TIXA 2Y5PA 3L13A 1ZXHA 4CQNA 2FIDA 3ZTDA 3DBHI 2MQJA 3ZIMA 5IA7A 4LJOB 4EUTA 4NJ6A 4G11A 4PYUA 4NPNA 3PLUA 1ZDVA 1FNVA 5DPTA 1G6JA 2NVUI 4GXBA 2R2OA 4CYEA 3NVWA 4BKSD 3PV1A 4LNKA 2IYDB 3B2FA 4ZDVA 1T0YA 2KDEB 2KOXA 3WAMA 1GC7A 3PZDA 4W9GA 4JGHB 1CZPA 3J9CA 2O6VB 3C0RB 4KZCA 3M63B 2XK5A 2CS4A 2ASQA 3VTUA 4XDDA 4X57B 2IGHA 2AX5A 4KSLC 4W9EA 2N4FA 3DWMA 1RRBA 4YTNB 2UYZB 1C79A 1HZ6A 4EEWA 4MGKE 1FEHA 1I4GA 2KTRA 3D32A 2WP9B 3DOWA 4K7WA 2IGDA 5J2RA 1PQSA 2IBIB 4ANUA 5FK9C 4FBJB 1NI3A 5HKHA 2MEKA 2BS3B 3AE4B 5E6OA 5BYRA 1H4RA 4IDIA 2PVOD 3AXCA 4TV3A 3NY5A 1WY8A 1ZUD2 4A20A 2RPQA 2BS4B 3DDCB 3ZRCA 2L7RA 3A1QB 1P7EA 4GOCA 4Q2JA 4WQOB 4ZHOA 1IGCA 2WXOA 1YOVB 3P4RB 2RD0A 4IM2A 1YX5B 3WANA 1F52A 1KJTA 2JZZA 4EZLA 4RF0A 2ONQA 3ZXRA 3URYA 2LGXA 3ZKJC 3BK1A 1JWBD 3AEDB 4IUMB 2IPKD 2LVPA 4W9KA 1N61A 3DBRB 1A70A 1YN5A 3L10B 3CIRB 1JCKB 1JW9D 4USAA 1TZ1A 3PLVA 3K9OB 3Q3JA 1V97A 3B0AA 3OAWA 3CMMB 3W5UB 2MJDA 4LNIA 1F77A 3AEFB 2QDFA 2B3AA 4HDOA 4WAAA 4A8XC 4GDLA 1QT9A 4F7ZA 4RCOA 4NY0A 3DBLB 4H2AA 4PS7A 1OQRA 3NVZA 2M17A 1VDVA 3GB1A 3N3KB 2KDMA 2KD0A 2ZVOA 5AZHA 1MJDA 2DYOA 1QOAA 2L00B 1IGDA 1CQVA 2MSED 4N9F4 2W3SA 1V9JA 1JWAD 3N1YC 1PFDA 2RPVA 2BYFA 1FMAD 2AL6A 3VH4B 3TEZA 1GB4A 1V5TA 4F1SA 3IXSA 2ON8A 3AE3B 2V9HA 2L52A 3P42A 4K7UA 1WXVA 1XCTL 3IVFA 4F8CB 3EUB2 4P1CC 3Q3MC 1SSNA 3I9V1 3S2AA 2C9WB 1UNSA 3OLMD 2JF5A 4JWUC 2EMSA 3Q8AA 4HCNB 4MJSA 2HTME 5IKCM 3UQAA 3MJ5A 1L7YA 2IDYA 2Z8LA 2WX1A 1EUVB 5LXIB 5LLIA 2K22A 3EECA 5DPWA 3DVNU 4M8NA 3AECB 1XO3A 4OZBA 2XK5B 1Z2MA 1C1YB 2SEBD 2IGGA 2Q5WD 3RNEC 2G3QB 3NS1A 1M4VA 5J18A 1D5MC 2CHZA 3KYCD 4LTUA 3ZNGC 1ZP0B 2GBKA 2K5PA 2KTRB 2WXHA 2KLGA 3WA0A 2UU7A 2FUHB 2BF8B 3IT4B 2BKFA 1IBXA 3HVZA 2MCNB 4A9AA 1CJEA 2PE9A 3I57A 5T8IA 4GGQA 3ZGZA 1WYGA 3GOEA 3P4SB 3P4PB 2LRWA 1IP9A 1UWXA 2C60A 1YJ1A 5MPOA 1D6EC 2VZKB 3EC8A 3APDA 1QKZA 1R4MI 4HWIB 5D6JB 1SIFA 4IWQA 4W9JA 3VXWA 3TCAA 4XWTA 2MRPA 1VR9A 1VZ7A 1J7AA 4LJPB 2WXFA 2LRUA 3JSVA 1MG4A 5G2NA 3AM9A 4ARIA 4KDIC 1XLNA 4OZCA 2MLBA 3HM6X 2D3GA 3EGRA 4W9CA 1SIJA 4JPSA 3QAQA 4P1BC 3KVFB 4XWWA 1WGRA 3PO0A 1I7HA 4W9IA 1I4QA 3H7PA 1ZPSA 4XGAB 2BW2A 4GDLB 3M62B 2MBHA 4MH8A 1VZ6A 1JALA 2L3ZA 4O1NA 1D3ZA 2BGFA 4DWFA 1FO4A 3RZFA 4MGZE 1VZ8A 2CKHB 1E90A 1QZEA 3ZDTA 2JZ3B 2WLBA 4RM9A 4HCPB 5FKAC 3ZJUA 2DZJA 1QLBB 2IO1B 2WYQA 2AQ3B 3ZLZA 1UF0A 3SDLC 3ABVB 1TGZB 4GB9A 2LHEA 2K0PA 4HJGE 2LGDA 2HJ8A 4BFRA 4DXGA 3APCA 2JU6X 2DZIA 4IM3A 3AULA 3OG5A 2YEPB 2A5UA 1GB1A 5G55A 3Q8CA 1N63A 4OHJA 1TIFA 5BMIA 2DLBA 2WXGA 3GS2A 3QWZB 4MJSB 1ET6A 1XXGA 4KV2A 3LJ3A 4BBNC 2BTEA 3FAHA 4FHKA 4HPMB 1F2RC 3U8ZA 2GBJA 3DHGC 1BUIC 1TKGA 4L2YA 1IUEA 1MHHE 1MHXA 2LMCA 1HEZE 1UGMA 2WDTB 2N9PC 1RFKA 3FILA 2BQQA 4LDTB 2HD5B 2WDVB 2JYTA 2L76A 2ZPYA 3AE5B 3ZW3A 1X1MA 3Q3FA 4ZRKA 2MWSB 2QCZA 1WI0A 1QQRA 2HE7A 2LUMA 1IBXB 4BBNF 2JT4B 1QILA 1UGJA 1C4AA 2NBVB 3NJTA 3K9PB 2J0JA 5E6PA 3TMPB 5EE9A 3Q3NC 5D3IB 4HLEA 4WWPA 4E74A 3DCGA 3SR6A 1MI0A 1YN3A 4YL8A 3SU8X 4MDKE 1JROA 2KHWB 1AN8A 4RNAA 4ICVA 4IWOA 4MELA 5E6JA 4M0WA 2MBOA 2KMMA 3ZO5B 2KQSA 2N7EA 2I2YA 2K8BA 1FXTB 3N9YC 3JSVB
chains in the Genus database with same CATH topology
2BB5A 4YTNB 2K3UA 3KWLA 1C79A 1HZ6A 5H8YE 1N60A 1SJED 1XLOA 3BVZA 4KGTA 4ZYSA 5HFYA 1FEHA 1I4GA 2WXMA 2N9KA 1VLBA 4KGRA 2WP9B 2QEJC 2IGDA 3R2TA 2WNMA 1WRIA 2WU2B 5FK9C 1KRHA 1NVID 2PW9A 1NI3A 2WXPA 1KLGD 3TSSA 4PT5A 4B0MA 1DOYA 2JZPA 2MEKA 3ZYYX 2BS3B 4ZHPA 4FXCA 4OW0A 1JWMD 3AE4B 4N58A 1B1ZA 2FBWB 5BYRA 4IDIA 2PVOD 1HQRD 1YNTE 4KGSA 2JX5A 1ZUD2 2BS4B 4EE2A 2Y5CA 3AE6B 1T6BX 1BXTA 1SJHD 4XDCA 4UDUC 3NRZA 1P7EA 2MH7A 5TSSA 2DYMA 1XLPA 1DOIA 4Q2JA 3NUHB 1D5XC 1KLUD 1FCCC 2WXJA 1IGCA 4ZHOA 4TQ1A 2WXOA 3P4RB 2QSDA 4ZOHC 3VR9B 3OWEB 3ETRA 3O13A 2BB6A 4GLSC 1EU4A 5D7GA 1L4DB 1C9FA 2WXQA 3AEEB 1MVKA 2DWQA 5G5GA 4RF0A 2ONQA 1SF0A 5GXGB 3URYA 5LNK1 2CU3A 1K50A 1ZXIA 1C77A 3T3OA 1YN4A 3MHZA 1QOBA 2SAKA 3BK1A 1JWBD 1TS3A 3AEDB 4REZA 5H92C 1PGBA 2PKOA 2IPKD 1CK1A 2I38A 3MFGA 1ENFA 1N61A 1A70A 2WQYB 1YN5A 1L5PA 1I4HA 1Q10A 1F0ZA 3CIRB 5EE1A 1JCKB 3EA6A 3RPFC 4RGNA 1JW9D 4USAA 3B9JA 3T3NA 3AEGB 4R3DA 2V3NA 1V97A 1QOGA 3W5UB 1L6UA 4J3OD 5BYQA 2MJDA 2W82A 3BK2A 1F77A 1FM0D 3AEFB 1TY0A 1WXQA 3AE1B 1C76A 1HXYD 3KLSX 4A8XC 1QT9A 1PUTA 2RMMA 1R7SA 1TS4A 2WS3B 4ITKA 4D2KA 2J4XA 4RCOA 2OEDA 2WXIA 2PIAA 3SEBA 5C2TB 4H2AA 3BZDB 4WURA 2CJOA 1OQRA 3VRAB 1B9RA 1KH0A 2GRIA 3NVZA 3Q8FA 1E0ZA 1YQ4B 1EWCA 1VDVA 1ZDXA 3GB1A 2KDMA 4YWGG 1E7PB 2DYOA 1QOAA 2LJIA 1IGDA 4YSZB 1CQVA 2J42A 1SB3C 2W3SA 1QF6A 1JWAD 2QJLA 1QOFA 1P7FA 2V4IB 1PFDA 4N6EB 1NYQA 2RPVA 1TS5A 2WXLA 1YQ3B 2WXRA 1AWDA 4RGMA 1FMAD 1OFFA 3TEZA 4US9A 1D4BA 1GB4A 3IXSA 2ON8A 4MT5A 3ZQ4A 5HHDG 2MJ3A 3AE3B 2LGIA 3V3XA 3CWIA 1EM7A 2H89B 4P16A 2L52A 3P42A 1T3QA 2TSSA 4C56C 1XCTL 3EUB2 3E9SA 2VZKD 3U52E 1PGAA 3IAM1 2JXTA 4YTMB 1Y56A 1NYRA 4ZRPA 3BYYB 2AQ1B 2LFIA 4JX1C 1SSNA 1PGXA 3I9V1 3Q69A 4NJCA 1UNSA 3B2GA 4KKJA 4JWUC 5EE0A 3PZ7A 3Q8AA 2INNE 3H8HA 3AEBB 4HKQA 1F2RI 2HTME 3U2SC 3MJ5A 3WCQA 2WXKA 5I4DA 2D5GA 3BWUD 3P1MA 2IDYA 2Z8LA 1FCLA 1RM6C 2K22A 2WDRB 2PLPA 2W3RA 2KWDA 1EWYC 1I4RA 1TKYA 2JQRB 3AECB 2E6XA 1XO3A 4OZBA 1ESFA 1FFVA 1RYJA 1K51A 3W9CB 2SEBD 2IGGA 2Q5WD 2EKIA 4A6QA 1UWMA 2WDQB 3NS1A 1M4VA 2QIEB 4RGOS 1FNUA 1D5MC 3HUIA 4LTUA 4YSYB 4YSXB 1GAQB 2RDHA 1AW7A 3IAS1 1ZP0B 2LHDA 1BMLC 2K5PA 2M0AA 1TYGB 1SE2A 2WXHA 1ACCA 2H88B 3KQ4A 1TZOA 1KFYB 3Q8BA 1D5ZC 3DWGC 3IT4B 2NTSA 2YEPF 1FIQA 3VR8B 1IBXA 3LB8C 1V1OA 3HVZA 4A9AA 3ZJTA 2X38A 4NAWB 1CJEA 1SXTA 2N9LA 3I57A 5T8IA 1RWSA 2Y3AA 3ZGZA 1WYGA 4MM3B 2M56B 1E9MA 3P4SB 3P4PB 2JWUA 1DOXA 1YJJA 4KX6B 3AEAB 3AH7A 4WAFA 4DQOC 3TEWA 3P63A 1UWXA 4IOIE 3W5VB 2B76B 3C8YA 1FXIA 1XLQA 1FNWA 2KQ4X 5EE3A 4AS1A 5JXVA 5MPOA 1L0XB 1D6EC 4HROA 1FXAA 3SFEB 1HA5A 1ZE3D 2VZKB 3AE8B 3IT6B 4C7YA 1QKZA 1XCQL 2V0GA 1NENB 3HVDA 4ARCA 2W55A 3LYYA 1VJKA 3AB5A 4XWTA 1VR9A 2N7JA 1VZ7A 3ZJVA 1UUPA 4HEA1 2W54A 1J7AA 1V1PA 1HZ5A 2BYTA 4OVZA 5AUIA 3FILB 2WXFA 4WH4A 3AMZA 1C4CA 2ZW1A 3AM9A 3GP7A 3KWVA 4ARIA 3BYTB 1XLNA 4MACA 4OZCA 1KF6B 1GPXA 3U4EG 2BBCA 2PVGC 1XEEA 2IJ0A 3AE9B 3EGRA 1K53A 3E56A 4NZLB 1SIJA 4JPSA 1NEKB 2J52A 4XWWA 2XN9C 3PO0A 1I7HA 4GDKB 1SEBD 4KKIA 4WIPA 1I4QA 1J7BA 1VRAB 5BMGA 1WWTA 4A55A 3R8BA 5HG2A 1T5XD 1DYQA 3AV8A 1MPEA 1ZPSA 1JQ4A 2BW2A 1K52A 1TJEA 1XF5L 3FC4A 4GDLB 4RGTA 2BT6A 2CJNA 1E6EB 4MH8A 1VZ6A 2DBYA 1JALA 4O1NA 3NZ3A 2ZW0A 1FO4A 3P4QB 1SE3A 1VZ8A 1YJIA 1ROEA 1JMLA 4LK0M 2WLBA 4NAMA 1WSPA 4L23A 3BIID 2G1EA 5FKAC 1V8CA 3ZJUA 2KAJA 5C3JB 2PMVA 1QLBB 1TS2A 2WXNA 4L1BA 2WU5B 2ICIA 1SBBB 2AQ3B 2NMQA 4RH6A 1OQQA 3R2IA 3MP9A 2QILA 1AYFA 4WQMA 1N62A 2PTLA 4LLGM 2KN4A 2AQ2B 1SE4A 1DGJA 3ABVB 3W1SA 1KTKA 1N5WA 4RF1A 4TMAB 2OHFA 2LHEA 3HRDD 2K0PA 4HJGE 4DXGA 2ACZB 3U7ZA 4B0EA 2V3PA 2JU6X 2L83A 1FRDA 2LEKA 5AUKA 2YEPB 2N0SB 1GB1A 3V05A 1L4ZB 3Q8CA 2JYEA 4HRSA 1JWUD 1N63A 4OHJA 5BMIA 2DLBA 1L0VB 2WXGA 5HI1A 1ET9A 3GS2A 2KACA 1ET6A 1XXGA 2FE8A 3BVMA 3AN1A 4P6VF 1L6VA 1PDXA 2BTEA 3NVYA 3FAHA 1FD6A 1F2RC 2GB1A 4ZRQA 1C78A 2JSVX 1YMHE 4XE0A 3TUOA 3LXFA 2XNAC 1BUIC 1TKGA 2R61A 4L2YA 1IUEA 4YXDB 1E10A 1C4PA 1MHHE 1MHXA 2LMCA 1HEZE 4C7ZA 2QMTA 3FILA 1RFKA 5BYSA 3MC0B 4OZAA 3L4PA 3UI3A 4JE3B 2WDVB 3NVVA 1FFUA 2JYTA 2FUG1 1PYWD 3AE5B 4TSSA 1JRPA 1TKEA 3TEYA 4IKGA 4AQ7A 1ZOYB 4N59A 4YT0B 2NTTA 1LO5D 2K9XA 1JWSD 2GI9A 2J53A 2L1AA 3W2DA 4YTPB 1I4XA 4HKZE 1QQRA 1STEA 4TQ0A 5D3DA 4WWMA 2LUMA 2MJEA 1IBXB 2Y5PA 1QILA 1J7CA 1ZXHA 4CQNA 1UGJA 1C4AA 4RFBA 3RFZB 3PZ8A 4DXFA 4US8A 1I4PA 5FR3A 4C80A 1TY2A 2BS2B 3VRBB 5EE9A 1N5XA 5D3IB 3SFDB 1GOZA 3TEXA 1L0YB 1ZDVA 1FNVA 5BMHA 3AE2B 3SR6A 3Q8EA 1MI0A 2INPE 4JWSC 1FRRA 3AE7B 1YN3A 2L32A 1JROA 1AN8A 4RNAA 3NVWA 3B2FA 2RDGA 5E6JA 4M0WA 3VQIA 2M19A 2KMMA 1CZPA 5G5HA 3J9CA 3BVGA 2E3TA 1EU3A 4A90A 1WGKA 4XDDA 2I2YA 1V1PB 2HDEA 2G9HD 2IGHA 2AX5A 3N9YC 2EELA 3DWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3U A;  1XEE A; 
#chains in the Genus database with same CATH topology
 4DHZ B;  2K3U A;  3KWL A;  2KN5 A;  1N60 A;  1SJE D;  1XLO A;  5HFY A;  4KGT A;  3ALB A;  4TUU A;  2WXM A;  2JRH A;  1T0Q C;  3ECI A;  3DBR I;  1KRH A;  2DZM A;  4HPP A;  2WXP A;  1I35 A;  4MGI E;  4G3X B;  1DOY A;  4ZHP A;  4FXC A;  4OW0 A;  1JWM D;  2FBW B;  2AYO B;  3H7P B;  2AWT A;  1HQR D;  3VTW A;  1YNT E;  3VTV A;  3RT3 B;  4EE2 A;  1XD3 B;  1BXT A;  1SJH D;  2KWV B;  2DYM A;  3RUL A;  1XLP A;  1DOI A;  3NUH B;  1L2N A;  1FCC C;  2BB6 A;  2VRR B;  3WAL A;  1EU4 A;  5D7G A;  1L4D B;  3H1U A;  1Y8R C;  3I63 C;  4BOZ B;  2WXQ A;  1MVK A;  4GIV A;  1TBE A;  1SF0 A;  2ZJD A;  3VDZ A;  4C00 A;  1WJU A;  2KX0 A;  4FAD A;  5JHA A;  1YN4 A;  1QOB A;  2SAK A;  1TS3 A;  3MTN B;  1PGB A;  2PKO A;  3KUC B;  4ANX A;  2I38 A;  2AL3 A;  4MSM B;  2KNB A;  5JZE B;  4QAY A;  1F0Z A;  3DHH C;  4WWO A;  1J8C A;  3RPF C;  5DCN A;  4RGN A;  4KDL B;  1WGY A;  1GC6 A;  3ZNH B;  5C1Z A;  1QOG A;  4W9L A;  4ZYN A;  5IO9 A;  1LQB A;  4M00 A;  3BK2 A;  1C76 A;  1NDD A;  1TS4 A;  2WS3 B;  3M3J A;  4D2K A;  4ACF A;  3MC9 A;  2PIA A;  3SEB A;  4RMA A;  2GRI A;  1LGR A;  3Q8F A;  2N9E B;  4IM0 A;  3DVN V;  3AU4 A;  3R3M A;  4I6P A;  4YWG G;  2J7Q B;  2W9N A;  4YSZ B;  1WH3 A;  3VVW B;  2QJL A;  4LNN A;  4P7I A;  2BWF A;  1NYQ A;  4M02 A;  2WXR A;  1YQ3 B;  2DNF A;  3U30 A;  1D4B A;  4A3O A;  2A4Z A;  5HHD G;  2YLM A;  2LGI A;  2QHO A;  3V3X A;  3MHS D;  5DPS A;  3E9S A;  2VZK D;  3V62 A;  3IAM 1;  4YTM B;  2EKE C;  2RR9 A;  2LFI A;  4JX1 C;  1PGX A;  3Q69 A;  4NJC A;  3NOB A;  4MSQ B;  3PPA A;  3IFW B;  4II2 B;  3T9L A;  4AWJ A;  1WRD B;  2D5G A;  3A9K A;  4M0W B;  1JRU A;  3QK0 A;  1RM6 C;  2WDR B;  2KWD A;  1EWY C;  2D3A A;  1I4R A;  2JQR B;  1Q1O A;  1RYJ A;  3L0W B;  3W9C B;  4A6Q A;  1UWM A;  2DYB A;  4YSY B;  5TR5 A;  1GAQ B;  5FR6 A;  1AW7 A;  4BKT A;  3VUW A;  3EFU A;  3IAS 1;  1V6E A;  2RGF A;  1RLF A;  3KQ4 A;  3ML8 A;  1TZO A;  3DWG C;  2YEP F;  1V1O A;  2X38 A;  1WX8 A;  1SXT A;  2N9L A;  2KQ7 A;  3R7R A;  3QA8 A;  2M56 B;  1E9M A;  2JWU A;  1DOX A;  3AH7 A;  4IOI E;  1SE9 A;  3C8Y A;  1FNW A;  3FKY A;  1L0X B;  3V60 A;  4II3 B;  4RM8 A;  3IT6 B;  1J0G A;  3R66 C;  1NEN B;  3HVD A;  4ARC A;  1RFA A;  4LCD E;  4XC2 A;  1UZX B;  5J17 A;  2LWP A;  2N7J A;  3QC8 B;  3AI5 A;  3ZJV A;  1UUP A;  4HEA 1;  2DZK A;  4OVZ A;  5AUI A;  4WH4 A;  4DBG A;  2KAN A;  3AMZ A;  3RI7 C;  1C4C A;  4FA6 A;  2Z0D B;  1KF6 B;  2FCQ A;  1GPX A;  4PS3 A;  2PVG C;  1XEE A;  2IJ0 A;  4HVB A;  2N9X A;  3AE9 B;  4NZL B;  2CHW A;  2J52 A;  5AZF A;  2V4L A;  4KKI A;  4W9H A;  3IHP C;  1VRA B;  3N1Z C;  5BMG A;  1WWT A;  4A55 A;  5C23 A;  3R8B A;  3PRE A;  5HG2 A;  1T5X D;  1DYQ A;  4LDT D;  3RMK C;  3AV8 A;  1MPE A;  4AJY B;  2CJN A;  3L17 A;  3W1Y A;  2LJ5 A;  2KDF B;  3NZ3 A;  3A4S C;  4AOF A;  1WJN A;  2NR2 A;  1ROE A;  4LK0 M;  4NAM A;  1YX6 B;  2ZPN A;  4L23 A;  3BII D;  2G1E A;  1KM7 A;  1V8C A;  2KAJ A;  2Z59 B;  1TS2 A;  4NQK E;  2WU5 B;  1WZ3 A;  2KC2 A;  4RH6 A;  1OQQ A;  3CST A;  3DVG Y;  1AYF A;  3WAP A;  5KHO A;  5D2M B;  2AQ2 B;  3HM3 A;  3PVL A;  4RF1 A;  2YVC A;  1NBF C;  3LDZ E;  3DBH B;  1OTR B;  1OEY J;  4G50 A;  3RD2 A;  4LNO A;  2BVC A;  4B0E A;  3UIP B;  1ZGU B;  2JPH A;  3CF6 E;  5CTR C;  2JYE A;  4KZ0 A;  1JWU D;  1C3T A;  1Z5S B;  1EF1 A;  1M94 A;  2KAC A;  2OJR A;  3AN1 A;  2O2V A;  2KXJ A;  3NVY A;  3GZN I;  3DQV A;  3A9K B;  3C19 A;  2M1M A;  1WX9 A;  4S17 A;  1C78 A;  3RNF C;  2JSV X;  3TUO A;  3LXF A;  2XNA C;  4FN2 A;  4HK2 A;  1UH6 A;  4ASW C;  4C7Z A;  4GSW A;  4PYZ A;  3L4P A;  3UI3 A;  4JE3 B;  3NVV A;  4I6N B;  2C7H A;  2G45 B;  4TSS A;  1JRP A;  3TEY A;  4IKG A;  4AQ7 A;  4N59 A;  2NTT A;  1LO5 D;  3SD5 A;  1JWS D;  2KJR A;  3A33 B;  1OEY A;  2XBB C;  2J53 A;  2WHI A;  4YTP B;  1T0S C;  4HDQ A;  2K6Q A;  4A3P A;  1STE A;  3ZDM C;  4LNF A;  5D3D A;  2KMA A;  2D11 A;  1E8X A;  4NNJ B;  3RFZ B;  4US8 A;  5FR3 A;  2IND C;  4C80 A;  1TY2 A;  3KUD B;  1WGG A;  2BS2 B;  4G0N B;  1N6Z A;  3SFD B;  1R4N I;  1GOZ A;  5CHW A;  1L0Y B;  1CMX B;  3Q8E A;  2INP E;  4JWS C;  1LFD A;  3H6N A;  2RDG A;  3VQI A;  2M19 A;  5G5H A;  2KDB A;  3BVG A;  1H8C A;  3IBE A;  2EEL A;  4WJO A;  2VH1 A;  1MFW A;  4BVU C;  4DHJ B;  4ANW A;  3DBS A;  1LXD A;  2N9K A;  1WGH A;  5EDS A;  1WRI A;  2WU2 B;  1V80 A;  1XT9 B;  2PW9 A;  2L05 A;  3UF8 A;  1KLG D;  3TSS A;  4PT5 A;  4B0M A;  2JZP A;  3PSE B;  3ZYY X;  1B1Z A;  1UD7 A;  2K39 A;  2JX5 A;  5DPR A;  2Y5C A;  3AE6 B;  2MW5 A;  4UDU C;  5TSS A;  2MH7 A;  2NBU A;  2O6V D;  1D5X C;  4FLH A;  5CHV C;  2QSD A;  4ZOH C;  2MP2 A;  3ETR A;  4AP4 C;  3TL5 A;  4GLS C;  1S3S G;  1C9F A;  3AEE B;  4DDI D;  4KIK A;  3L16 A;  2M4N A;  5BO4 B;  1E8W A;  1WE6 A;  2CU3 A;  1NI2 A;  1ZXI A;  1C77 A;  4REZ A;  2LUE A;  5H92 C;  2BPS A;  1IPG A;  1ENF A;  2JVC A;  2Y5B B;  4EKU A;  1I4H A;  1Q10 A;  2KZR A;  2RDB C;  5EE1 A;  3EA6 A;  3B9J A;  2KKC A;  4MGY E;  3T3N A;  3AEG B;  2V3N A;  1WF9 A;  4E71 A;  1L6U A;  4J3O D;  5BYQ A;  1UBI A;  1FM0 D;  1TY0 A;  2O2V B;  3AE1 B;  4K1R B;  1HXY D;  3KLS X;  3MC8 A;  2DEN B;  1PUT A;  1R7S A;  4ITK A;  3KW5 B;  3ZNI D;  2J4X A;  2MBQ A;  2OED A;  4M01 A;  5C2T B;  1LM8 B;  3RNG C;  3BZD B;  3N20 C;  4WUR A;  3VRA B;  1E0Z A;  1EWC A;  3RUI B;  3ML9 A;  1E7P B;  1SB3 C;  4B9K A;  1E5W A;  1QOF A;  1P7F A;  3UGB B;  3ONS A;  2V4I B;  1GJZ A;  1TS5 A;  2WXL A;  4RGM A;  1AWD A;  2KVZ A;  2GLS A;  2N7D A;  4US9 A;  2BYE A;  3KUZ A;  3Q3O C;  4MT5 A;  1KOT A;  2MJ3 A;  1EM7 A;  1KLV A;  2LVQ A;  4XX5 A;  4P16 A;  4FJZ A;  4C56 C;  2KDI A;  2WGS A;  2KTF A;  5IOI A;  1WXA A;  2JXT A;  1Y56 A;  3BYY B;  2AQ1 B;  3B2G A;  4KKJ A;  2MBB B;  3H8H A;  4TKN A;  1YIW A;  3AEB B;  2V1Y A;  4HKQ A;  1F2R I;  3VFK A;  3U2S C;  1R4M B;  4GMV A;  5I4D A;  3BWU D;  4DXA B;  2KC1 A;  3H9D A;  3RNC C;  2M8S A;  3L54 A;  5L83 A;  2PLP A;  2W3R A;  2ZNV B;  3X0W A;  1TKY A;  2LVO A;  2E6X A;  1K51 A;  4XYC A;  3DBL I;  2WDQ B;  5GMV A;  2QIE B;  3HUI A;  3RYT A;  2LGS A;  2M0A A;  1E8Y A;  1EF5 A;  1WGD A;  1ACC A;  4HJK A;  2H88 B;  3NG0 A;  1BT0 A;  1KFY B;  3Q8B A;  2J0K A;  1E7V A;  2VH2 A;  3JYU A;  3M95 A;  2NTS A;  4JIO U;  1FIQ A;  4CO7 A;  3LB8 C;  3ZJT A;  3AU5 A;  5CHF A;  4XZ4 A;  1V49 A;  3T8M A;  3QIJ A;  4BKG A;  1HE8 A;  2LXC A;  2GBN A;  2N1W A;  2X8X X;  1YJJ A;  3AEA B;  3P63 A;  2L0T A;  3W5V B;  2LXA A;  2KQ4 X;  2EMT A;  2MP2 B;  5EE3 A;  5JXV A;  3SFE B;  1HA5 A;  1ZE3 D;  2C7M B;  1V81 A;  4B6W A;  2V0G A;  4KIK B;  4DDG D;  5IN7 A;  2KVR A;  2I1K A;  4IC7 B;  1AAR A;  4URK A;  1V1P A;  1HZ5 A;  3FIL B;  3QCA A;  3QHT A;  3GP7 A;  2ZW1 A;  1ZKH A;  3KWV A;  3ZNZ B;  2KJ6 A;  2LZ6 A;  3U4E G;  1T0R C;  2BBC A;  2JWZ A;  3ZVV A;  3VUY A;  3NHE B;  4M8M A;  3E56 A;  3ZUN A;  3PTF C;  1NEK B;  3RN9 C;  2XN9 C;  1WR6 E;  2KX3 A;  3PT2 B;  2ZVN A;  1SEB D;  4WIP A;  1GUA B;  4MH0 E;  1HTO A;  3V6E B;  2PJH A;  3ZTC A;  2PPH A;  3QAR A;  1TJE A;  2BT6 A;  3VUX A;  2FIF A;  1E6E B;  2DBY A;  2ZW0 A;  3P4Q B;  1WSP A;  2NCN A;  3EHV A;  1WZ0 A;  2OJW A;  3DVG X;  5C3J B;  2PMV A;  3EFC A;  2ICI A;  1SBB B;  2NMQ A;  2BYV E;  3R2I A;  3B1L X;  1FPY A;  3ENE A;  1N62 A;  2PTL A;  2KN4 A;  1DGJ A;  2KO3 A;  2ZEQ A;  4K81 A;  3W1S A;  1KTK A;  2KLC A;  3A4R A;  3BY4 B;  2OHF A;  4BKS A;  3BIN A;  2GBR A;  2KFK A;  2V3P A;  2L83 A;  3I3T B;  2LEK A;  2N0S B;  1P1A A;  2FCS A;  2UWQ A;  3V05 A;  3DPD A;  1L0V B;  3P2B A;  1ET9 A;  1V86 A;  2FE8 A;  3BVM A;  2KFJ A;  2JXX A;  1L6V A;  1PDX A;  3GE3 C;  2PEA A;  1FD6 A;  4DHJ D;  4ZRQ A;  4W9D A;  4XE0 A;  3O65 B;  2NBW B;  2R61 A;  1E10 A;  1C4P A;  2KT7 A;  2NPT A;  1WJ4 A;  4EZK A;  4OVU A;  1WXM A;  2QMT A;  1P98 A;  2GMI C;  3MC0 B;  1FFU A;  2LAS A;  2FUG 1;  2G4S A;  2DX5 B;  1TKE A;  1ZOY B;  1E8Z A;  4YT0 B;  4FJY A;  2K9X A;  5D94 A;  1RAX A;  3NZU A;  1OQY A;  3W2D A;  3JVZ X;  4JLC A;  3ZXV A;  2D2Q A;  4TQ0 A;  4IWP A;  4WWM A;  2MJE A;  2KJH B;  3PHX B;  1J7C A;  2MBE A;  2WWZ A;  3H7S A;  5AEK B;  4RFB A;  3JW0 X;  3PZ8 A;  4DXF A;  1I4P A;  4ZRI A;  1E7U A;  4DK5 A;  4FUL A;  2FCN A;  3VRB B;  2D3B A;  1I42 A;  1N5X A;  2MX2 A;  1P0R A;  3UIN B;  3TEX A;  2L0F A;  5BMH A;  3AE2 B;  1FRR A;  3AE7 B;  2L32 A;  4IW0 A;  3GE8 C;  4EOY A;  3TJP A;  1VD2 A;  1WFY A;  2D3C A;  4WJQ A;  3PRP B;  1TT5 B;  2E3T A;  1EU3 A;  4A90 A;  1WJ6 A;  1WGK A;  2AEH A;  1F9J A;  1V1P B;  2HDE A;  3WIM A;  2M0X A;  2G9H D;  5JH5 C;  4C7Y A;  2REX A;  2BB5 A;  2ZNV C;  1VCB A;  1YD8 U;  2HJ1 A;  5H8Y E;  4ZYS A;  3BVZ A;  1VLB A;  4KGR A;  2QEJ C;  3R2T A;  2WNM A;  1WXS A;  2ZCB A;  1NVI D;  5E6N A;  3DHI C;  4HPL B;  4N58 A;  2JRI B;  4NAW A;  1P9D U;  1EO6 A;  1WMH A;  2KWU B;  4KGS A;  1WM3 A;  2DAJ A;  4MM3 A;  1T6B X;  4XDC A;  3UIO B;  4GN1 A;  3NRZ A;  1KLU D;  2WXJ A;  4TQ1 A;  3KH0 A;  2MHJ A;  3VR9 B;  3OWE B;  3O13 A;  2FNJ B;  1IYF A;  1GNU A;  3HHM A;  2DWQ A;  5G5G A;  1A5R A;  5GXG B;  4WJP A;  2KWC A;  5LNK 1;  1K50 A;  4OVV A;  3N30 A;  3T3O A;  3MHZ A;  2XEW A;  1WR1 A;  1CK1 A;  3MFG A;  2KFK B;  2WQY B;  1L5P A;  2V3S A;  4FHJ A;  1J19 A;  4R3D A;  4GDK A;  3RZW C;  4C4V A;  1WE7 A;  1V2Y A;  2W82 A;  1XQQ A;  4AUQ C;  1UBQ A;  1GG3 A;  2WX0 A;  1WXQ A;  4NQL B;  2RMM A;  4ANV A;  2J0M A;  2WXI A;  2KMC A;  2NPT B;  2CJO A;  1B9R A;  1KH0 A;  1YQ4 B;  1ZDX A;  3NZS A;  3VAW A;  3WAO A;  2LJI A;  2J42 A;  3B08 A;  1QF6 A;  3OJ4 B;  1Q0W B;  3A9J A;  4N6E B;  3R7Q A;  1ZW7 A;  3N32 A;  1OFF A;  3HIZ A;  3ZQ4 A;  4E3C A;  4I6L B;  3CWI A;  4B95 A;  2K8H A;  2G4D B;  2H89 B;  1T3Q A;  4HXD A;  2K8C A;  4WWN A;  2TSS A;  2KYW A;  4BAX A;  3V6C B;  4EZJ A;  3U52 E;  1PGA A;  5LXH A;  1U4A A;  1UEL A;  1K8R B;  2OOB B;  2BWE S;  1NYR A;  4ZRP A;  2MA9 B;  5EE0 A;  3PZ7 A;  2INN E;  3IG3 A;  3RNB C;  4KSK C;  3WCQ A;  2WXK A;  3SHQ A;  3P1M A;  2QC8 A;  2K1F A;  3CSF A;  1FCL A;  3I5J C;  2DHZ A;  2IZV B;  4ICU A;  1ESF A;  1FFV A;  3Q2A C;  1TTN A;  2D10 A;  2FCM A;  2EKI A;  3QJZ A;  2LD9 A;  3RNA C;  1SGH A;  2K25 A;  4RGO S;  1FNU A;  2CR5 A;  3TBL D;  4S0R A;  4YSX B;  2RDH A;  3VH3 B;  4AJW A;  2LHD A;  1BML C;  1TYG B;  1SE2 A;  4K3C A;  2IY0 B;  2ZZP B;  1WM2 A;  5AZG A;  3L08 A;  1D5Z C;  4PS8 A;  3VR8 B;  3X23 A;  4W9F A;  4NAW B;  2GOW A;  2KK8 A;  3RCZ A;  1RWS A;  1WMH B;  2Y3A A;  3ZRF A;  2PE6 B;  3V61 A;  4MM3 B;  4IG7 B;  4KX6 B;  4DQO C;  4WAF A;  3TEW A;  4J6I A;  1F1H A;  2B76 B;  1FXI A;  4PK1 A;  1XLQ A;  2HTH A;  5JHB A;  3PGE A;  3Q6B A;  4AS1 A;  1HTQ A;  2LGY A;  4HRO A;  1FXA A;  3AE8 B;  1XCQ L;  3PS6 A;  2W55 A;  3LYY A;  1VJK A;  3AB5 A;  4BZA A;  2O6V A;  2GBM A;  2W54 A;  2K6D B;  2BYT A;  1P3Q U;  4NJ7 A;  3QX1 A;  3BYT B;  2LI5 A;  4MAC A;  4ZRJ A;  1Q5W B;  4CHK A;  1K53 A;  3HK0 A;  3N1X C;  4GDK B;  1J7B A;  2DAF A;  1OGW A;  4C4V B;  5IP4 D;  3KYD D;  3GZN B;  3MJW A;  1JQ4 A;  3Q14 C;  1V5O A;  1K52 A;  3FC4 A;  1XF5 L;  4RGT A;  2Z0E B;  2RSU A;  2R2Q A;  3A1Q A;  1S1Q B;  1SE3 A;  5IAA C;  1WYW B;  1YJI A;  1JML A;  2CHX A;  1ISN A;  5CX3 A;  3VHT C;  2IO3 B;  2WXN A;  4JL9 A;  4L1B A;  4MEM A;  3MP9 A;  3A9J B;  4K3B A;  2QIL A;  2IO0 B;  4WQM A;  4LLG M;  3APF A;  1SE4 A;  2CU1 A;  4GU2 A;  1N5W A;  4TMA B;  3HRD D;  1YQB A;  2ACZ B;  3U7Z A;  3OJ3 A;  3W1S C;  2NS5 A;  1FRD A;  5AUK A;  2C5L C;  4K7S A;  1R4N B;  3PRZ A;  3UQB A;  1L4Z B;  2JUO A;  4HRS A;  2FAZ A;  4FJV B;  4WJN A;  5KHQ A;  5HI1 A;  2D07 B;  3QQ8 B;  1WX7 A;  4P6V F;  3U7D A;  3PRM B;  3NS8 A;  2GB1 A;  2L8J A;  1YMH E;  2JY6 A;  1WIA A;  4KVG B;  4YXD B;  3PHW B;  1MG8 A;  4BOS C;  5BYS A;  4OZA A;  2C7N B;  2N1V A;  5L95 C;  4JQW C;  2ZCC A;  1PYW D;  2IY1 B;  2IO2 B;  2GI9 A;  2BKR B;  2L1A A;  2I1J A;  4DHZ E;  1I4X A;  4HKZ E;  2INC C;  4EFO A;  3TIX A;  2Y5P A;  3L13 A;  1ZXH A;  4CQN A;  2FID A;  3ZTD A;  3DBH I;  2MQJ A;  3ZIM A;  5IA7 A;  4LJO B;  4EUT A;  4NJ6 A;  4G11 A;  4PYU A;  4NPN A;  3PLU A;  1ZDV A;  1FNV A;  5DPT A;  1G6J A;  2NVU I;  4GXB A;  2R2O A;  4CYE A;  3NVW A;  4BKS D;  3PV1 A;  4LNK A;  2IYD B;  3B2F A;  4ZDV A;  1T0Y A;  2KDE B;  2KOX A;  3WAM A;  1GC7 A;  3PZD A;  4W9G A;  4JGH B;  1CZP A;  3J9C A;  2O6V B;  3C0R B;  4KZC A;  3M63 B;  2XK5 A;  2CS4 A;  2ASQ A;  3VTU A;  4XDD A;  4X57 B;  2IGH A;  2AX5 A;  4KSL C;  4W9E A;  2N4F A;  3DWM A;  1RRB A;  4YTN B;  2UYZ B;  1C79 A;  1HZ6 A;  4EEW A;  4MGK E;  1FEH A;  1I4G A;  2KTR A;  3D32 A;  2WP9 B;  3DOW A;  4K7W A;  2IGD A;  5J2R A;  1PQS A;  2IBI B;  4ANU A;  5FK9 C;  4FBJ B;  1NI3 A;  5HKH A;  2MEK A;  2BS3 B;  3AE4 B;  5E6O A;  5BYR A;  1H4R A;  4IDI A;  2PVO D;  3AXC A;  4TV3 A;  3NY5 A;  1WY8 A;  1ZUD 2;  4A20 A;  2RPQ A;  2BS4 B;  3DDC B;  3ZRC A;  2L7R A;  3A1Q B;  1P7E A;  4GOC A;  4Q2J A;  4WQO B;  4ZHO A;  1IGC A;  2WXO A;  1YOV B;  3P4R B;  2RD0 A;  4IM2 A;  1YX5 B;  3WAN A;  1F52 A;  1KJT A;  2JZZ A;  4EZL A;  4RF0 A;  2ONQ A;  3ZXR A;  3URY A;  2LGX A;  3ZKJ C;  3BK1 A;  1JWB D;  3AED B;  4IUM B;  2IPK D;  2LVP A;  4W9K A;  1N61 A;  3DBR B;  1A70 A;  1YN5 A;  3L10 B;  3CIR B;  1JCK B;  1JW9 D;  4USA A;  1TZ1 A;  3PLV A;  3K9O B;  3Q3J A;  1V97 A;  3B0A A;  3OAW A;  3CMM B;  3W5U B;  2MJD A;  4LNI A;  1F77 A;  3AEF B;  2QDF A;  2B3A A;  4HDO A;  4WAA A;  4A8X C;  4GDL A;  1QT9 A;  4F7Z A;  4RCO A;  4NY0 A;  3DBL B;  4H2A A;  4PS7 A;  1OQR A;  3NVZ A;  2M17 A;  1VDV A;  3GB1 A;  3N3K B;  2KDM A;  2KD0 A;  2ZVO A;  5AZH A;  1MJD A;  2DYO A;  1QOA A;  2L00 B;  1IGD A;  1CQV A;  2MSE D;  4N9F 4;  2W3S A;  1V9J A;  1JWA D;  3N1Y C;  1PFD A;  2RPV A;  2BYF A;  1FMA D;  2AL6 A;  3VH4 B;  3TEZ A;  1GB4 A;  1V5T A;  4F1S A;  3IXS A;  2ON8 A;  3AE3 B;  2V9H A;  2L52 A;  3P42 A;  4K7U A;  1WXV A;  1XCT L;  3IVF A;  4F8C B;  3EUB 2;  4P1C C;  3Q3M C;  1SSN A;  3I9V 1;  3S2A A;  2C9W B;  1UNS A;  3OLM D;  2JF5 A;  4JWU C;  2EMS A;  3Q8A A;  4HCN B;  4MJS A;  2HTM E;  5IKC M;  3UQA A;  3MJ5 A;  1L7Y A;  2IDY A;  2Z8L A;  2WX1 A;  1EUV B;  5LXI B;  5LLI A;  2K22 A;  3EEC A;  5DPW A;  3DVN U;  4M8N A;  3AEC B;  1XO3 A;  4OZB A;  2XK5 B;  1Z2M A;  1C1Y B;  2SEB D;  2IGG A;  2Q5W D;  3RNE C;  2G3Q B;  3NS1 A;  1M4V A;  5J18 A;  1D5M C;  2CHZ A;  3KYC D;  4LTU A;  3ZNG C;  1ZP0 B;  2GBK A;  2K5P A;  2KTR B;  2WXH A;  2KLG A;  3WA0 A;  2UU7 A;  2FUH B;  2BF8 B;  3IT4 B;  2BKF A;  1IBX A;  3HVZ A;  2MCN B;  4A9A A;  1CJE A;  2PE9 A;  3I57 A;  5T8I A;  4GGQ A;  3ZGZ A;  1WYG A;  3GOE A;  3P4S B;  3P4P B;  2LRW A;  1IP9 A;  1UWX A;  2C60 A;  1YJ1 A;  5MPO A;  1D6E C;  2VZK B;  3EC8 A;  3APD A;  1QKZ A;  1R4M I;  4HWI B;  5D6J B;  1SIF A;  4IWQ A;  4W9J A;  3VXW A;  3TCA A;  4XWT A;  2MRP A;  1VR9 A;  1VZ7 A;  1J7A A;  4LJP B;  2WXF A;  2LRU A;  3JSV A;  1MG4 A;  5G2N A;  3AM9 A;  4ARI A;  4KDI C;  1XLN A;  4OZC A;  2MLB A;  3HM6 X;  2D3G A;  3EGR A;  4W9C A;  1SIJ A;  4JPS A;  3QAQ A;  4P1B C;  3KVF B;  4XWW A;  1WGR A;  3PO0 A;  1I7H A;  4W9I A;  1I4Q A;  3H7P A;  1ZPS A;  4XGA B;  2BW2 A;  4GDL B;  3M62 B;  2MBH A;  4MH8 A;  1VZ6 A;  1JAL A;  2L3Z A;  4O1N A;  1D3Z A;  2BGF A;  4DWF A;  1FO4 A;  3RZF A;  4MGZ E;  1VZ8 A;  2CKH B;  1E90 A;  1QZE A;  3ZDT A;  2JZ3 B;  2WLB A;  4RM9 A;  4HCP B;  5FKA C;  3ZJU A;  2DZJ A;  1QLB B;  2IO1 B;  2WYQ A;  2AQ3 B;  3ZLZ A;  1UF0 A;  3SDL C;  3ABV B;  1TGZ B;  4GB9 A;  2LHE A;  2K0P A;  4HJG E;  2LGD A;  2HJ8 A;  4BFR A;  4DXG A;  3APC A;  2JU6 X;  2DZI A;  4IM3 A;  3AUL A;  3OG5 A;  2YEP B;  2A5U A;  1GB1 A;  5G55 A;  3Q8C A;  1N63 A;  4OHJ A;  1TIF A;  5BMI A;  2DLB A;  2WXG A;  3GS2 A;  3QWZ B;  4MJS B;  1ET6 A;  1XXG A;  4KV2 A;  3LJ3 A;  4BBN C;  2BTE A;  3FAH A;  4FHK A;  4HPM B;  1F2R C;  3U8Z A;  2GBJ A;  3DHG C;  1BUI C;  1TKG A;  4L2Y A;  1IUE A;  1MHH E;  1MHX A;  2LMC A;  1HEZ E;  1UGM A;  2WDT B;  2N9P C;  1RFK A;  3FIL A;  2BQQ A;  4LDT B;  2HD5 B;  2WDV B;  2JYT A;  2L76 A;  2ZPY A;  3AE5 B;  3ZW3 A;  1X1M A;  3Q3F A;  4ZRK A;  2MWS B;  2QCZ A;  1WI0 A;  1QQR A;  2HE7 A;  2LUM A;  1IBX B;  4BBN F;  2JT4 B;  1QIL A;  1UGJ A;  1C4A A;  2NBV B;  3NJT A;  3K9P B;  2J0J A;  5E6P A;  3TMP B;  5EE9 A;  3Q3N C;  5D3I B;  4HLE A;  4WWP A;  4E74 A;  3DCG A;  3SR6 A;  1MI0 A;  1YN3 A;  4YL8 A;  3SU8 X;  4MDK E;  1JRO A;  2KHW B;  1AN8 A;  4RNA A;  4ICV A;  4IWO A;  4MEL A;  5E6J A;  4M0W A;  2MBO A;  2KMM A;  3ZO5 B;  2KQS A;  2N7E A;  2I2Y A;  2K8B A;  1FXT B;  3N9Y C;  3JSV B; 
#chains in the Genus database with same CATH homology
 2BB5 A;  4YTN B;  2K3U A;  3KWL A;  1C79 A;  1HZ6 A;  5H8Y E;  1N60 A;  1SJE D;  1XLO A;  3BVZ A;  4KGT A;  4ZYS A;  5HFY A;  1FEH A;  1I4G A;  2WXM A;  2N9K A;  1VLB A;  4KGR A;  2WP9 B;  2QEJ C;  2IGD A;  3R2T A;  2WNM A;  1WRI A;  2WU2 B;  5FK9 C;  1KRH A;  1NVI D;  2PW9 A;  1NI3 A;  2WXP A;  1KLG D;  3TSS A;  4PT5 A;  4B0M A;  1DOY A;  2JZP A;  2MEK A;  3ZYY X;  2BS3 B;  4ZHP A;  4FXC A;  4OW0 A;  1JWM D;  3AE4 B;  4N58 A;  1B1Z A;  2FBW B;  5BYR A;  4IDI A;  2PVO D;  1HQR D;  1YNT E;  4KGS A;  2JX5 A;  1ZUD 2;  2BS4 B;  4EE2 A;  2Y5C A;  3AE6 B;  1T6B X;  1BXT A;  1SJH D;  4XDC A;  4UDU C;  3NRZ A;  1P7E A;  2MH7 A;  5TSS A;  2DYM A;  1XLP A;  1DOI A;  4Q2J A;  3NUH B;  1D5X C;  1KLU D;  1FCC C;  2WXJ A;  1IGC A;  4ZHO A;  4TQ1 A;  2WXO A;  3P4R B;  2QSD A;  4ZOH C;  3VR9 B;  3OWE B;  3ETR A;  3O13 A;  2BB6 A;  4GLS C;  1EU4 A;  5D7G A;  1L4D B;  1C9F A;  2WXQ A;  3AEE B;  1MVK A;  2DWQ A;  5G5G A;  4RF0 A;  2ONQ A;  1SF0 A;  5GXG B;  3URY A;  5LNK 1;  2CU3 A;  1K50 A;  1ZXI A;  1C77 A;  3T3O A;  1YN4 A;  3MHZ A;  1QOB A;  2SAK A;  3BK1 A;  1JWB D;  1TS3 A;  3AED B;  4REZ A;  5H92 C;  1PGB A;  2PKO A;  2IPK D;  1CK1 A;  2I38 A;  3MFG A;  1ENF A;  1N61 A;  1A70 A;  2WQY B;  1YN5 A;  1L5P A;  1I4H A;  1Q10 A;  1F0Z A;  3CIR B;  5EE1 A;  1JCK B;  3EA6 A;  3RPF C;  4RGN A;  1JW9 D;  4USA A;  3B9J A;  3T3N A;  3AEG B;  4R3D A;  2V3N A;  1V97 A;  1QOG A;  3W5U B;  1L6U A;  4J3O D;  5BYQ A;  2MJD A;  2W82 A;  3BK2 A;  1F77 A;  1FM0 D;  3AEF B;  1TY0 A;  1WXQ A;  3AE1 B;  1C76 A;  1HXY D;  3KLS X;  4A8X C;  1QT9 A;  1PUT A;  2RMM A;  1R7S A;  1TS4 A;  2WS3 B;  4ITK A;  4D2K A;  2J4X A;  4RCO A;  2OED A;  2WXI A;  2PIA A;  3SEB A;  5C2T B;  4H2A A;  3BZD B;  4WUR A;  2CJO A;  1OQR A;  3VRA B;  1B9R A;  1KH0 A;  2GRI A;  3NVZ A;  3Q8F A;  1E0Z A;  1YQ4 B;  1EWC A;  1VDV A;  1ZDX A;  3GB1 A;  2KDM A;  4YWG G;  1E7P B;  2DYO A;  1QOA A;  2LJI A;  1IGD A;  4YSZ B;  1CQV A;  2J42 A;  1SB3 C;  2W3S A;  1QF6 A;  1JWA D;  2QJL A;  1QOF A;  1P7F A;  2V4I B;  1PFD A;  4N6E B;  1NYQ A;  2RPV A;  1TS5 A;  2WXL A;  1YQ3 B;  2WXR A;  1AWD A;  4RGM A;  1FMA D;  1OFF A;  3TEZ A;  4US9 A;  1D4B A;  1GB4 A;  3IXS A;  2ON8 A;  4MT5 A;  3ZQ4 A;  5HHD G;  2MJ3 A;  3AE3 B;  2LGI A;  3V3X A;  3CWI A;  1EM7 A;  2H89 B;  4P16 A;  2L52 A;  3P42 A;  1T3Q A;  2TSS A;  4C56 C;  1XCT L;  3EUB 2;  3E9S A;  2VZK D;  3U52 E;  1PGA A;  3IAM 1;  2JXT A;  4YTM B;  1Y56 A;  1NYR A;  4ZRP A;  3BYY B;  2AQ1 B;  2LFI A;  4JX1 C;  1SSN A;  1PGX A;  3I9V 1;  3Q69 A;  4NJC A;  1UNS A;  3B2G A;  4KKJ A;  4JWU C;  5EE0 A;  3PZ7 A;  3Q8A A;  2INN E;  3H8H A;  3AEB B;  4HKQ A;  1F2R I;  2HTM E;  3U2S C;  3MJ5 A;  3WCQ A;  2WXK A;  5I4D A;  2D5G A;  3BWU D;  3P1M A;  2IDY A;  2Z8L A;  1FCL A;  1RM6 C;  2K22 A;  2WDR B;  2PLP A;  2W3R A;  2KWD A;  1EWY C;  1I4R A;  1TKY A;  2JQR B;  3AEC B;  2E6X A;  1XO3 A;  4OZB A;  1ESF A;  1FFV A;  1RYJ A;  1K51 A;  3W9C B;  2SEB D;  2IGG A;  2Q5W D;  2EKI A;  4A6Q A;  1UWM A;  2WDQ B;  3NS1 A;  1M4V A;  2QIE B;  4RGO S;  1FNU A;  1D5M C;  3HUI A;  4LTU A;  4YSY B;  4YSX B;  1GAQ B;  2RDH A;  1AW7 A;  3IAS 1;  1ZP0 B;  2LHD A;  1BML C;  2K5P A;  2M0A A;  1TYG B;  1SE2 A;  2WXH A;  1ACC A;  2H88 B;  3KQ4 A;  1TZO A;  1KFY B;  3Q8B A;  1D5Z C;  3DWG C;  3IT4 B;  2NTS A;  2YEP F;  1FIQ A;  3VR8 B;  1IBX A;  3LB8 C;  1V1O A;  3HVZ A;  4A9A A;  3ZJT A;  2X38 A;  4NAW B;  1CJE A;  1SXT A;  2N9L A;  3I57 A;  5T8I A;  1RWS A;  2Y3A A;  3ZGZ A;  1WYG A;  4MM3 B;  2M56 B;  1E9M A;  3P4S B;  3P4P B;  2JWU A;  1DOX A;  1YJJ A;  4KX6 B;  3AEA B;  3AH7 A;  4WAF A;  4DQO C;  3TEW A;  3P63 A;  1UWX A;  4IOI E;  3W5V B;  2B76 B;  3C8Y A;  1FXI A;  1XLQ A;  1FNW A;  2KQ4 X;  5EE3 A;  4AS1 A;  5JXV A;  5MPO A;  1L0X B;  1D6E C;  4HRO A;  1FXA A;  3SFE B;  1HA5 A;  1ZE3 D;  2VZK B;  3AE8 B;  3IT6 B;  4C7Y A;  1QKZ A;  1XCQ L;  2V0G A;  1NEN B;  3HVD A;  4ARC A;  2W55 A;  3LYY A;  1VJK A;  3AB5 A;  4XWT A;  1VR9 A;  2N7J A;  1VZ7 A;  3ZJV A;  1UUP A;  4HEA 1;  2W54 A;  1J7A A;  1V1P A;  1HZ5 A;  2BYT A;  4OVZ A;  5AUI A;  3FIL B;  2WXF A;  4WH4 A;  3AMZ A;  1C4C A;  2ZW1 A;  3AM9 A;  3GP7 A;  3KWV A;  4ARI A;  3BYT B;  1XLN A;  4MAC A;  4OZC A;  1KF6 B;  1GPX A;  3U4E G;  2BBC A;  2PVG C;  1XEE A;  2IJ0 A;  3AE9 B;  3EGR A;  1K53 A;  3E56 A;  4NZL B;  1SIJ A;  4JPS A;  1NEK B;  2J52 A;  4XWW A;  2XN9 C;  3PO0 A;  1I7H A;  4GDK B;  1SEB D;  4KKI A;  4WIP A;  1I4Q A;  1J7B A;  1VRA B;  5BMG A;  1WWT A;  4A55 A;  3R8B A;  5HG2 A;  1T5X D;  1DYQ A;  3AV8 A;  1MPE A;  1ZPS A;  1JQ4 A;  2BW2 A;  1K52 A;  1TJE A;  1XF5 L;  3FC4 A;  4GDL B;  4RGT A;  2BT6 A;  2CJN A;  1E6E B;  4MH8 A;  1VZ6 A;  2DBY A;  1JAL A;  4O1N A;  3NZ3 A;  2ZW0 A;  1FO4 A;  3P4Q B;  1SE3 A;  1VZ8 A;  1YJI A;  1ROE A;  1JML A;  4LK0 M;  2WLB A;  4NAM A;  1WSP A;  4L23 A;  3BII D;  2G1E A;  5FKA C;  1V8C A;  3ZJU A;  2KAJ A;  5C3J B;  2PMV A;  1QLB B;  1TS2 A;  2WXN A;  4L1B A;  2WU5 B;  2ICI A;  1SBB B;  2AQ3 B;  2NMQ A;  4RH6 A;  1OQQ A;  3R2I A;  3MP9 A;  2QIL A;  1AYF A;  4WQM A;  1N62 A;  2PTL A;  4LLG M;  2KN4 A;  2AQ2 B;  1SE4 A;  1DGJ A;  3ABV B;  3W1S A;  1KTK A;  1N5W A;  4RF1 A;  4TMA B;  2OHF A;  2LHE A;  3HRD D;  2K0P A;  4HJG E;  4DXG A;  2ACZ B;  3U7Z A;  4B0E A;  2V3P A;  2JU6 X;  2L83 A;  1FRD A;  2LEK A;  5AUK A;  2YEP B;  2N0S B;  1GB1 A;  3V05 A;  1L4Z B;  3Q8C A;  2JYE A;  4HRS A;  1JWU D;  1N63 A;  4OHJ A;  5BMI A;  2DLB A;  1L0V B;  2WXG A;  5HI1 A;  1ET9 A;  3GS2 A;  2KAC A;  1ET6 A;  1XXG A;  2FE8 A;  3BVM A;  3AN1 A;  4P6V F;  1L6V A;  1PDX A;  2BTE A;  3NVY A;  3FAH A;  1FD6 A;  1F2R C;  2GB1 A;  4ZRQ A;  1C78 A;  2JSV X;  1YMH E;  4XE0 A;  3TUO A;  3LXF A;  2XNA C;  1BUI C;  1TKG A;  2R61 A;  4L2Y A;  1IUE A;  4YXD B;  1E10 A;  1C4P A;  1MHH E;  1MHX A;  2LMC A;  1HEZ E;  4C7Z A;  2QMT A;  3FIL A;  1RFK A;  5BYS A;  3MC0 B;  4OZA A;  3L4P A;  3UI3 A;  4JE3 B;  2WDV B;  3NVV A;  1FFU A;  2JYT A;  2FUG 1;  1PYW D;  3AE5 B;  4TSS A;  1JRP A;  1TKE A;  3TEY A;  4IKG A;  4AQ7 A;  1ZOY B;  4N59 A;  4YT0 B;  2NTT A;  1LO5 D;  2K9X A;  1JWS D;  2GI9 A;  2J53 A;  2L1A A;  3W2D A;  4YTP B;  1I4X A;  4HKZ E;  1QQR A;  1STE A;  4TQ0 A;  5D3D A;  4WWM A;  2LUM A;  2MJE A;  1IBX B;  2Y5P A;  1QIL A;  1J7C A;  1ZXH A;  4CQN A;  1UGJ A;  1C4A A;  4RFB A;  3RFZ B;  3PZ8 A;  4DXF A;  4US8 A;  1I4P A;  5FR3 A;  4C80 A;  1TY2 A;  2BS2 B;  3VRB B;  5EE9 A;  1N5X A;  5D3I B;  3SFD B;  1GOZ A;  3TEX A;  1L0Y B;  1ZDV A;  1FNV A;  5BMH A;  3AE2 B;  3SR6 A;  3Q8E A;  1MI0 A;  2INP E;  4JWS C;  1FRR A;  3AE7 B;  1YN3 A;  2L32 A;  1JRO A;  1AN8 A;  4RNA A;  3NVW A;  3B2F A;  2RDG A;  5E6J A;  4M0W A;  3VQI A;  2M19 A;  2KMM A;  1CZP A;  5G5H A;  3J9C A;  3BVG A;  2E3T A;  1EU3 A;  4A90 A;  1WGK A;  4XDD A;  2I2Y A;  1V1P B;  2HDE A;  2G9H D;  2IGH A;  2AX5 A;  3N9Y C;  2EEL A;  3DWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...