1XEEA

Solution structure of the chemotaxis inhibitory protein of staphylococcus aureus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords chemotaxis-inhibiting protein CHIPS
publication title The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xeeA01
2K3UA 1XEEA
chains in the Genus database with same CATH superfamily
1QOAA 3BIID 3BY4B 3VH3B 2M0AA 2L32A 4ZYNA 3P63A 1B1ZA 2NBWB 1QKZA 1MVKA 3RYTA 2NCNA 2W9NA 3E56A 2MX2A 3NVWA 4USAA 2KD0A 2RSUA 4AJYB 2W3RA 1C4AA 4IKGA 4IOIE 2CS4A 2IYDB 4HKQA 3ABVB 3IHPC 4EFOA 2JWZA 3DPDA 4HKZE 2FBWB 3ZXRA 3ZJTA 2BWES 1IBXB 4BKTA 3ZQ4A 2VZKB 3NY5A 1JWMD 3RNCC 3OAWA 1C1YB 1ZKHA 4REZA 5J18A 1RFAA 2R61A 1YNTE 2K22A 2QJLA 4II2B 4NJ7A 3VUWA 3IAM1 5JH5C 4IUMB 2RD0A 3KUCB 3R2IA 1GC6A 1WM2A 2BWFA 3RZFA 2N4FA 1HQRD 1L7YA 3I57A 2FIDA 1NYQA 2ZPNA 2QIEB 3ZUNA 2JQRB 3SHQA 1IBXA 4M8MA 4CQNA 1R4NB 2J0MA 1I42A 2LXCA 2IY1B 2WGSA 4WQOB 5L95C 3QWZB 5GXGB 3MHSD 2X8XX 2LVQA 3AE7B 3TUOA 2LD9A 2Y5PA 1WGKA 2L8JA 4KIKB 2DYBA 1T0YA 3AI5A 3VXWA 2V1YA 2LUEA 4NNJB 1VDVA 2EMSA 4MGKE 2SAKA 3KVFB 4DXGA 2JXXA 3OWEB 2KJHB 4HCNB 2PMVA 2FUHB 5TSSA 4PYZA 1G6JA 2KYWA 1KLGD 2EKEC 5BMIA 2MW5A 4M01A 3HM6X 2AYOB 3U4EG 3VR8B 2CHWA 4C4VB 1GAQB 3CMMB 1LXDA 2MA9B 2ON8A 2FE8A 4L2YA 4KIKA 1EU3A 2K8CA 2V0GA 2A5UA 2XN9C 1L2NA 2EKIA 2YVCA 4BZAA 4HWIB 4J6IA 3Q3OC 1I4HA 2K5PA 4MEMA 2PPHA 2D10A 4MM3A 3B0AA 3AE2B 4ITKA 1EO6A 1LM8B 3DBSA 2REXA 2WHIA 5DCNA 1VD2A 3ZYYX 3KWVA 5AEKB 1GB4A 1RRBA 4C80A 3Q6BA 1OTRB 3AE6B 4KZ0A 4YTMB 4J3OD 1GNUA 1TS2A 4M8NA 1WGGA 1ACCA 1Q10A 5E6PA 4AQ7A 5IP4D 2MCNB 3CIRB 2BTEA 1WMHB 1LO5D 2M8SA 3CF6E 2PE6B 1SJHD 3H8HA 3PSEB 4ACFA 2KZRA 2X38A 2NVUI 4FADA 2JU6X 4MELA 1UGMA 2BYTA 3PHWB 4DK5A 1E7VA 4K1RB 2BYFA 5IKCM 2QILA 5JHAA 2QC8A 2DAJA 3IVFA 4FJYA 1P3QU 2JX5A 4GDKA 1UELA 5T8IA 2V9HA 2BGFA 2GRIA 1ZDVA 3A4SC 4OVUA 3R66C 2ZPYA 1WMHA 4KGTA 1VZ8A 1GOZA 3W9CB 3ZGZA 2C7NB 1LFDA 2O6VD 1ZXHA 3AEFB 4P1BC 2W55A 3QJZA 4YXDB 1MG4A 1MFWA 1ISNA 5H8YE 2M0XA 2KMAA 3DBRI 2GBJA 2GMIC 2MBOA 2M4NA 2ASQA 5DPRA 1UBIA 5BYSA 2YLMA 4GB9A 1E10A 4OVZA 3B2GA 2SEBD 1L5PA 3AU4A 1WWTA 4JQWC 2PTLA 3FILB 1WXMA 1QLBB 1SE2A 2BW2A 2LZ6A 4RGMA 2CJOA 2K8HA 3NG0A 4ASWC 2W54A 3ZXVA 1SIFA 3V6EB 1HEZE 1OEYJ 1PGAA 3Q3NC 1SBBB 2H88B 1FXTB 2BPSA 1XD3B 3W1SA 3JVZX 1L0VB 1UNSA 2I38A 5E6NA 3CSTA 1JWUD 1K51A 4KZCA 2KDEB 1I4QA 3N30A 3P4QB 4K7SA 4DHJB 5DPWA 3FILA 1C76A 1FXIA 3VH4B 2KHWB 2Z59B 1J19A 3PREA 4W9IA 1F2RI 1L4DB 2JVCA 3NVVA 1OFFA 3EC8A 1E8ZA 1VCBA 2WXNA 1ZPSA 1XCTL 1BUIC 2BKRB 2KWUB 1T5XD 1KFYB 3H7PB 3RNFC 3DVNU 2E6XA 4MGZE 2IPKD 2M56B 3BVGA 3WAPA 3UGBB 1WF9A 1FM0D 3ZIMA 3V60A 1JQ4A 1D3ZA 3OG5A 3GE3C 1YN4A 5EE1A 2K6QA 3WANA 4IM3A 4BOSC 1WXVA 1P0RA 3URYA 3SR6A 5MPOA 3T3NA 2RDHA 4TMAB 1V49A 4F1SA 2YEPB 2JY6A 3ALBA 2M1MA 3P2BA 3IXSA 1KJTA 4LCDE 3H7PA 4GLSC 4W9KA 2OJRA 2BKFA 1JALA 2WXHA 4LJPB 1D6EC 1QT9A 2N0SB 2M19A 1WGDA 2HE7A 3H9DA 4W9HA 5D2MB 4DHZB 1WM3A 3JSVB 5AUKA 1FO4A 2BYVE 5JHBA 2QSDA 3RMKC 1YJ1A 2D3BA 2GOWA 4M0WB 4YWGG 3AM9A 3RPFC 5LLIA 2K39A 3QQ8B 2WXIA 3QK0A 1I4RA 2AQ3B 3AMZA 2C5LC 4MDKE 2FIFA 2I1JA 4FJVB 1PGXA 3Q14C 4X57B 2LGSA 5FKAC 4GDLB 3HIZA 1IUEA 3JSVA 4B0MA 1DOXA 3EA6A 2K1FA 4RFBA 2BVCA 3PS6A 1V6EA 4WURA 4M0WA 3H7SA 3ZJUA 2KQ7A 1ENFA 1T3QA 4HDQA 3NZSA 1R4MI 2L0FA 2LHDA 3TEWA 4A3PA 4DXFA 3DVNV 4MH8A 2AL6A 1WGYA 1RYJA 2WQYB 2MJEA 1B9RA 3IFWB 1I4XA 3DBHI 4FHKA 3VTVA 2N7JA 2NTTA 2MH7A 2V3SA 1SE3A 2ZNVB 2OOBB 4PS3A 1WFYA 4B9KA 3SU8X 1L4ZB 3DHIC 2J7QB 4GDLA 4JPSA 1ZXIA 3N1YC 3EHVA 2KAJA 2HJ8A 1EUVB 3OJ4B 2GB1A 1WYWB 5G2NA 2G45B 1NEKB 4YSZB 4HRSA 1K8RB 4W9CA 1VZ6A 1QILA 1N60A 3TMPB 3HRDD 1SEBD 1TT5B 2J42A 1WJNA 3PRPB 4KGRA 4N6EB 2RDBC 4DDID 4FJZA 1R7SA 5JZEB 2LMCA 4NAMA 4B95A 2NPTB 3AE4B 5CHWA 2ZEQA 1MI0A 3UQBA 4W9JA 3AEAB 1NI2A 3EECA 3U52E 4OVVA 2HTHA 1OQRA 4N58A 2XBBC 4XYCA 2MJDA 2K9XA 2R2QA 5FR3A 2CKHB 4DBGA 1UUPA 3PLUA 3ZLZA 1RWSA 1YD8U 4LNFA 3AE8B 4BKSD 4B6WA 4YT0B 2WDVB 2ZZPB 2D3CA 2C60A 1FFUA 2PVGC 3ZRCA 3P4PB 3FKYA 3M62B 4MSQB 5KHQA 4BBNC 4HPPA 3A9KA 2IO0B 1FCLA 1IGCA 3GZNB 2LJ5A 3KYDD 1YX6B 2KANA 2JYTA 1WGRA 2K8BA 3LB8C 4L1BA 2G4DB 2Z8LA 2QDFA 2QHOA 3PHXB 2IO3B 5HKHA 4XC2A 1XXGA 2IJ0A 3OJ3A 3NZ3A 4IWQA 3MP9A 3U30A 1C4CA 2Q5WD 3DHGC 3DCGA 5G5HA 3V62A 1Q5WB 3QARA 1D5XC 1K50A 3VAWA 3ETRA 2XK5A 2G9HD 1MG8A 3A9JB 2KC1A 3QA8A 1VJKA 1WJ6A 2AQ2B 3WAMA 5D7GA 4N9F4 3ZRFA 3VTUA 1WJ4A 4K7WA 1XLPA 3C19A 3TIXA 4BAXA 4IM0A 2J0KA 1VLBA 2E3TA 1K52A 2IZVB 1QQRA 2G3QB 3QAQA 5CX3A 4WH4A 4LNOA 2N7EA 1WY8A 1E8YA 4E74A 5D6JB 3PLVA 1ZOYB 3A9JA 1KH0A 4JWSC 2LGYA 2NR2A 4F8CB 3W2DA 1P7EA 1SXTA 1J8CA 4ZRQA 3WIMA 4L23A 2MBEA 3KWLA 1OQQA 3K9OB 4WJPA 2WWZA 4HK2A 3N9YC 3PTFC 2KTFA 4DQOC 5D94A 2JRIB 2MBQA 2O6VB 3O65B 2GLSA 2KVRA 2J4XA 3PRMB 1I4GA 3T8MA 3LXFA 4PS7A 4E71A 1TKYA 4CHKA 1C77A 2CR5A 1BT0A 2DZIA 2DLBA 4GXBA 3HHMA 1XT9B 2BB6A 2WXQA 3DBLI 2WU2B 1LGRA 2M17A 3L16A 1XQQA 2GBRA 2WXKA 4MJSB 4ICUA 2JZPA 2RR9A 4ARIA 1HTQA 2IY0B 4HJKA 3ZKJC 1EF5A 2KQ4X 4A3OA 4S17A 3ML9A 1ZW7A 2C7HA 2ZVNA 1JRUA 1ESFA 4FULA 4WWOA 4IM2A 1V1OA 4C7ZA 1FFVA 3BZDB 1WIAA 1MJDA 3LDZE 1Z5SB 4MGIE 4GGQA 3AXCA 2QMTA 2R2OA 1V5TA 3PPAA 5G5GA 2K0PA 4KSLC 2KFKB 3A33B 3L08A 2QEJC 4P6VF 1D4BA 3DVGX 2V3NA 4C7YA 1QOFA 4WAAA 4II3B 4A8XC 3NS8A 3L13A 4C4VA 4NJCA 3DBRB 2L83A 1XF5L 4KDIC 3KH0A 1UF0A 1MHXA 2LJIA 1OGWA 1YOVB 1T0RC 3RNGC 2BS4B 2WXJA 4K7UA 2MJ3A 3SD5A 1F52A 4LDTD 2DZJA 1TS4A 4JLCA 5C3JB 3IT4B 3AB5A 2KFKA 3SDLC 1JWSD 2WDQB 4A55A 4D2KA 4AOFA 1WX7A 4NZLB 1HZ6A 3PZ7A 1SF0A 5EE9A 2D5GA 3P4SB 4HPMB 1P7FA 3TJPA 1UZXB 4IWOA 3RNBC 1NDDA 3AE5B 3M95A 2JSVX 1HA5A 2DZKA 2LRUA 4NY0A 4XE0A 2KLCA 5J17A 1IYFA 3B1LX 3Q8AA 1C9FA 2D2QA 1KM7A 2HJ1A 2KVZA 2QCZA 4JWUC 1FPYA 4LNNA 1GC7A 4Q2JA 4BKGA 1DGJA 2WYQA 3MC9A 5AZHA 1PYWD 5CHVC 5IA7A 4G0NB 2PLPA 4RGNA 1VZ7A 4G50A 3LYYA 3R7RA 2IBIB 2LFIA 3BK1A 2L0TA 2A4ZA 2N9PC 1WJUA 2GI9A 1MHHE 2V4IB 4ZHPA 3BWUD 3X0WA 4AUQC 1EU4A 1GPXA 3MC8A 4AWJA 2BBCA 1KOTA 2WX1A 4BOZB 3QHTA 3AE3B 3WCQA 4RM8A 1Y56A 3HVZA 3ZO5B 2N9LA 3ZTCA 2MP2B 1KRHA 5H92C 4WJNA 2XNAC 4JGHB 2CHZA 2JYEA 2RDGA 4OZCA 4NAWB 1F9JA 1TZOA 2JZ3B 4WJQA 1SE9A 5BMHA 2I2YA 2IDYA 3SEBA 3N1ZC 5HHDG 5IO9A 2J53A 1Q1OA 2WLBA 5E6JA 1FXAA 2J0JA 1ZDXA 2KMMA 1FD6A 1WZ0A 2JUOA 1V1PB 2CU3A 1I35A 1TBEA 3PV1A 3Q8CA 2MEKA 4I6NB 4FHJA 2TSSA 2KOXA 5CHFA 2KJRA 1RAXA 4KV2A 1IGDA 2WXFA 2MP2A 2EMTA 3NHEB 2WP9B 3VRAB 2PE9A 1Q0WB 3VVWB 4A90A 1WGHA 1WR6E 4NAWA 4RCOA 3VDZA 2L1AA 2JXTA 1DOYA 1JMLA 3RNAC 4MH0E 1T6BX 1CJEA 3DWMA 3NUHB 2DNFA 2IGHA 1L6UA 3W1SC 3AEGB 1TZ1A 1V1PA 1FNWA 3WA0A 4H2AA 3DHHC 2BT6A 4EOYA 1M4VA 3KUDB 2KX0A 3VTWA 4TKNA 2MBBB 4MSMB 1SB3C 3H1UA 4C56C 1A70A 3W5VB 3AN1A 1L0YB 3VHTC 3ZDMC 1YJIA 4OZAA 3DBHB 1EWCA 2B76B 1YQ4B 1P98A 3I9V1 3RT3B 4AJWA 2DZMA 2ACZB 3B9JA 3RUIB 3RZWC 1WH3A 1FNVA 4TSSA 4A20A 1DYQA 1YN3A 4EE2A 1WI0A 1XLNA 1WE7A 1NBFC 3L4PA 1ZE3D 4ZHOA 1TY0A 1YX5B 4KGSA 4W9GA 5C23A 2WU5B 2CU1A 1WYGA 3O13A 3VR9B 4LTUA 1P1AA 3W1YA 3ZNID 3T9LA 4GIVA 5EDSA 3APDA 5HG2A 1UGJA 4A9AA 5BYRA 3U7DA 4YTPB 3IBEA 1M94A 3ZNHB 4FBJB 4N59A 3X23A 1E90A 2KDMA 5IOIA 4TQ0A 1MPEA 3GS2A 1V2YA 1HZ5A 4WAFA 1N61A 1F0ZA 2KQSA 5LNK1 2PKOA 5D3DA 4GU2A 2JWUA 1IPGA 2I1KA 1KLVA 2DHZA 2GBMA 1XLOA 4RNAA 2FCSA 1HXYD 5JXVA 4NQKE 2NTSA 4FA6A 2IO2B 1NVID 1FNUA 3LJ3A 1RLFA 1D5MC 1QF6A 2ZJDA 3APFA 1Y8RC 2CJNA 4FN2A 3HK0A 4WWMA 3I5JC 5LXIB 1J7AA 1UWMA 1JCKB 4TUUA 3I3TB 1E8WA 1XCQL 5D3IB 3VFKA 4F7ZA 1T0SC 2N9XA 4TV3A 1E8XA 2MLBA 1TKEA 4MT5A 4G11A 2ZVOA 4ZRJA 4JIOU 3AV8A 1J0GA 2NBVB 4ZDVA 5L83A 4RGTA 2KWVB 1N5XA 3NJTA 4BVUC 3IT6B 3MC0B 2KWDA 3KQ4A 1V86A 2WXMA 3AEEB 4ARCA 3Q3FA 5AZFA 3E9SA 4RMAA 1ZUD2 2LRWA 2KKCA 1KTKA 5KHOA 2NMQA 5IAAC 3ZTDA 3Q3JA 4KX6B 3EFUA 2ZNVC 4IDIA 2FNJB 1V5OA 4CYEA 1WX8A 1LQBA 4AP4C 2NPTA 2NBUA 3ZVVA 3CWIA 3FC4A 1CQVA 1JWAD 2AWTA 4LNKA 1TYGB 4URKA 5EE3A 1VRAB 4W9FA 4G3XB 4LLGM 3DVGY 2KNBA 2IGDA 2PIAA 5CTRC 2ICIA 1FCCC 3Q8BA 3PZ8A 3V05A 2JT4B 4W9EA 1C78A 4ZRPA 1YQ3B 1C3TA 5FK9C 3BYYB 2VRRB 3HVDA 1J7CA 3EUB2 4KVGB 3IAS1 2L05A 3DBLB 2LHEA 4XWTA 1V9JA 1TS3A 3CSFA 1YQBA 2INDC 2KT7A 4LDTB 5BYQA 1BXTA 3V61A 1WXAA 1PUTA 3P4RB 4S0RA 2ONQA 3N20C 4JE3B 3D32A 1I4PA 4QAYA 4AS1A 2FCMA 2KXJA 2KACA 1ET9A 3R7QA 1GJZA 1UD7A 1N6ZA 1E7UA 4MGYE 3TCAA 4FLHA 3ZNGC 3GOEA 2KN5A 2N1VA 3AU5A 5EE0A 4K3CA 3MHZA 3HM3A 1WXSA 1S3SG 1HE8A 3BK2A 2AX5A 2JRHA 3FAHA 3C0RB 1SE4A 2FCQA 4LK0M 3T3OA 2KFJA 2L00B 2DYMA 3L10B 4HCPB 2WS3B 2GBNA 1WRIA 2OJWA 2NS5A 4ZYSA 4US9A 3MJ5A 5E6OA 1UWXA 3KYCD 2Y5BB 1AWDA 3WAOA 1Z2MA 5G55A 2JZZA 1CK1A 3Q8FA 2WXGA 3AH7A 4E3CA 3Q69A 4XGAB 3RCZA 1S1QB 2HTME 2L76A 4A6QA 1BMLC 3PVLA 2PJHA 3GZNI 2B3AA 3KLSX 4DDGD 1YN5A 3AECB 4HROA 1YMHE 2LI5A 2K6DB 3ZJVA 2BS3B 2KDIA 2O6VA 2XEWA 4US8A 2UYZB 3M63B 2G1EA 2WXRA 3MTNB 2KX3A 5AZGA 4DWFA 4EZJA 2KMCA 3C8YA 4DXAB 4MM3B 1F1HA 4MJSA 3S2AA 2KC2A 2D3GA 2KN4A 3OLMD 2BF8B 3R8BA 1QOBA 3JYUA 1N5WA 4GMVA 3A1QB 5IN7A 2LEKA 4XDCA 4DHZE 1V8CA 4KKJA 4M02A 1ZGUB 4ANVA 5TR5A 5C1ZA 2HD5B 1U4AA 4B0EA 2LGIA 2O2VB 3ZDTA 1STEA 3MFGA 3QCAA 1E6EB 1EF1A 2KWCA 4W9DA 2PEAA 2RPQA 3VQIA 4UDUC 3ECIA 4W9LA 4IG7B 4HLEA 2K3UA 3SFEB 1WE6A 5GMVA 3NS1A 1JRPA 3A1QA 1R4NI 3UIOB 2UWQA 2Z0EB 4HEA1 4O1NA 3QC8B 1IP9A 5C2TB 2KDFB 2MRPA 2Y5CA 1ET6A 1ZP0B 1H4RA 4P7IA 3ML8A 4CO7A 4OW0A 2O2VA 1C79A 2KK8A 3QIJA 1WR1A 4WWNA 4HXDA 3GB1A 4GDKB 2Y3AA 5FR6A 1UBQA 2KTRB 5BMGA 4IWPA 2L52A 1N62A 4YSXB 2DBYA 1TKGA 2N9KA 3K9PB 3HUIA 2VZKD 4IW0A 3IG3A 2N7DA 4EKUA 1XO3A 2RGFA 2ZW1A 4MACA 4HDOA 2GBKA 2INPE 3M3JA 3BINA 4P1CC 4ANUA 1CMXB 3B2FA 2ZCBA 3JW0X 5DPTA 5BO4B 3W5UB 1TS5A 2RPVA 4XZ4A 1XLQA 1WZ3A 2KTRA 5AUIA 3N3KB 4GSWA 1F77A 3AE9B 1T0QC 2LUMA 1C4PA 1L0XB 3NOBA 1CZPA 2WDRB 2OHFA 3PRZA 3EFCA 5LXHA 1TJEA 4EEWA 4PYUA 4GN1A 4K81A 4I6LB 1GG3A 3AE1B 2YEPF 3VRBB 3KUZA 2AEHA 3R3MA 1J7BA 2FCNA 4JL9A 4YSYB 3RFZB 1FIQA 2JF5A 1F2RC 2VH2A 3ZW3A 1FEHA 4ZRKA 3RNEC 2LGDA 2OEDA 3BYTB 1EWYC 3TL5A 4YL8A 4ZRIA 3RD2A 4ANXA 3I63C 3L17A 3TEYA 2V3PA 3AULA 4LJOB 2HDEA 2FAZA 2DAFA 1GUAB 2BQQA 3P42A 3L0WB 4YTNB 3QX1A 4HJGE 2KJ6A 3PT2B 5DPSA 3Q2AC 2N9EB 3GE8C 2N1WA 5J2RA 3TEZA 1AW7A 1ROEA 2DWQA 3Q8EA 1R4MB 3B08A 2G4SA 3GP7A 1JROA 2UU7A 2Z0DB 2MBHA 1YIWA 2AQ1B 5HI1A 5I4DA 1E9MA 1E0ZA 1YJJA 2INNE 1L6VA 4RH6A 1SSNA 2L7RA 3APCA 4I6PA 4NPNA 2WX0A 4RF0A 1K53A 1I7HA 3PZDA 3VUXA 3L54A 3UF8A 3ZNZB 4PS8A 2BYEA 3WALA 1N63A 4PK1A 1SJED 3AEDB 1TGZB 2WXOA 3U7ZA 1JWBD 4BBNF 4BKSA 1PFDA 3N1XC 4RGOS 3DWGC 2LASA 2WNMA 2D07B 1H8CA 2DENB 1SGHA 3TBLD 3UINB 1E5WA 1TY2A 5HFYA 4ZOHC 1A5RA 2MHJA 3RULA 1NI3A 1KF6B 3EGRA 2KO3A 4BFRA 1FRRA 2VH1A 4FXCA 3U2SC 4EZKA 1GB1A 3ONSA 3KW5B 2AL3A 1OQYA 3UQAA 3BVZA 2WXPA 1JW9D 4R3DA 3BVMA 2L3ZA 4IC7B 1E7PB 1NYRA 2K25A 1AYFA 4OHJA 4WWPA 3NRZA 3MJWA 2WXLA 1RM6C 2RMMA 4KKIA 1NENB 2EELA 3AEBB 3Q3MC 4KDLB 4JX1C 3NVZA 4KSKC 1P9DU 1WSPA 2JPHA 2FUG1 2LVOA 1VR9A 2LXAA 2MSED 1PGBA 2H89B 4HPLB 3SFDB 3PGEA 2LWPA 2BS2B 2MWSB 2D3AA 2IO1B 1KLUD 2C9WB 3RN9C 4EZLA 1XEEA 2MQJA 3VUYA 1D5ZC 4HVBA 2C7MB 1WRDB 1TTNA 2KLGA 3DQVA 1AN8A 1OEYA 1UH6A 3UIPB 2DX5B 2LGXA 3V3XA 1SIJA 3TSSA 4ICVA 4DHJD 1X1MA 4C00A 2D11A 1FMAD 2W82A 3DDCB 4TQ1A 2INCC 2IGGA 3NZUA 4WJOA 2KDBA 2J52A 4RM9A 4XWWA 2BB5A 3DOWA 4GOCA 2PVOD 3PO0A 1RFKA 3J9CA 2ZCCA 3A4RA 4XX5A 2ZW0A 1V80A 3TEXA 3A9KB 1QOGA 4NQLB 4LNIA 1V97A 1PQSA 1PDXA 2WDTB 4EUTA 4RF1A 4P16A 3P1MA 1EM7A 3U8ZA 4XDDA 3RI7C 2V4LA 1FRDA 2CHXA 4ANWA 1AARA 1V81A 2W3SA 4OZBA 1DOIA 3ENEA 1WXQA 1TIFA 4PT5A 3V6CB 4K3BA 2DYOA 3H6NA 1WX9A 4WQMA 3R2TA 2XK5B 3NVYA 3UI3A 4M00A 1QZEA 2LVPA 2PW9A 4NJ6A 1HTOA 4WIPA 3N32A
chains in the Genus database with same CATH topology
1QOAA 3R8BA 1PGXA 3BIID 1QOBA 2IDYA 5BMHA 2I2YA 3SEBA 5HHDG 2J53A 2WLBA 5E6JA 2M0AA 2L32A 1FXAA 5FKAC 1N5WA 1ZDXA 4GDLB 1IUEA 2KMMA 3P63A 1FD6A 2LEKA 4XDCA 4B0MA 1DOXA 1B1ZA 3EA6A 1V1PB 1V8CA 2CU3A 4KKJA 1QKZA 1MVKA 4RFBA 4WURA 4M0WA 3Q8CA 2MEKA 3E56A 2TSSA 3ZJUA 1ENFA 1T3QA 3NVWA 4USAA 4B0EA 2LGIA 2LHDA 3TEWA 1IGDA 2WXFA 4DXFA 4MH8A 1STEA 3MFGA 2W3RA 1C4AA 1E6EB 2WP9B 3VRAB 4IKGA 1RYJA 2WQYB 2MJEA 4A90A 1B9RA 1I4XA 3VQIA 4RCOA 2L1AA 2N7JA 2NTTA 2MH7A 4UDUC 2JXTA 4IOIE 1DOYA 1JMLA 4HKQA 3ABVB 2K3UA 1SE3A 4HKZE 2FBWB 1L4ZB 1T6BX 3SFEB 3ZJTA 1CJEA 3DWMA 3NUHB 3NS1A 1JRPA 2IGHA 1L6UA 1ZXIA 3AEGB 4JPSA 1IBXB 2KAJA 1V1PA 1FNWA 4HEA1 4O1NA 4H2AA 2GB1A 3ZQ4A 2VZKB 2BT6A 5C2TB 1JWMD 1M4VA 4REZA 1NEKB 2Y5CA 1ET6A 4HRSA 1ZP0B 4YSZB 1VZ6A 2R61A 1QILA 1N60A 1SB3C 4OW0A 1YNTE 2K22A 3HRDD 1C79A 1SEBD 2QJLA 1A70A 4C56C 3W5VB 3IAM1 2J42A 4KGRA 3AN1A 3GB1A 4N6EB 3R2IA 1L0YB 4GDKB 2Y3AA 1R7SA 5BMGA 1YJIA 4OZAA 2L52A 1EWCA 1HQRD 1N62A 4YSXB 3I57A 2LMCA 2B76B 2DBYA 4NAMA 1TKGA 1YQ4B 3AE4B 2N9KA 3I9V1 3HUIA 2ACZB 2VZKD 3B9JA 1NYQA 2QIEB 1MI0A 2JQRB 1FNVA 1IBXA 3AEAB 4TSSA 1XO3A 1DYQA 2ZW1A 4CQNA 3U52E 1YN3A 4EE2A 1XLNA 1OQRA 4N58A 4MACA 2MJDA 3L4PA 1ZE3D 4ZHOA 1TY0A 2K9XA 4KGSA 5FR3A 2INPE 2WU5B 1UUPA 5GXGB 1WYGA 3O13A 3AE7B 3TUOA 1RWSA 3VR9B 3B2FA 4LTUA 3AE8B 3W5UB 1TS5A 2RPVA 2Y5PA 1WGKA 1XLQA 4YT0B 5AUIA 2WDVB 1F77A 3AE9B 2LUMA 1C4PA 1FFUA 1L0XB 2PVGC 5HG2A 3P4PB 1UGJA 4A9AA 1VDVA 1CZPA 2WDRB 2OHFA 5BYRA 2SAKA 4DXGA 4YTPB 3OWEB 1TJEA 2PMVA 4N59A 5TSSA 2KDMA 4TQ0A 3AE1B 2YEPF 1MPEA 3GS2A 1KLGD 3VRBB 1FCLA 1HZ5A 1IGCA 4WAFA 1N61A 5BMIA 3U4EG 1F0ZA 3VR8B 5LNK1 1GAQB 2PKOA 1J7BA 2JYTA 4YSYB 5D3DA 3RFZB 1FIQA 3LB8C 4L1BA 2Z8LA 1F2RC 2JWUA 2ON8A 2FE8A 4L2YA 1EU3A 1XXGA 2IJ0A 1FEHA 3NZ3A 2V0GA 1XLOA 2OEDA 3BYTB 3MP9A 4RNAA 1HXYD 2XN9C 5JXVA 1C4CA 2EKIA 2Q5WD 2NTSA 1EWYC 5G5HA 1I4HA 2K5PA 1D5XC 1K50A 3ETRA 1NVID 2G9HD 3TEYA 1FNUA 2V3PA 1D5MC 1QF6A 1VJKA 2CJNA 2HDEA 2AQ2B 3AE2B 4ITKA 5D7GA 3P42A 4WWMA 1XLPA 4YTNB 1J7AA 1UWMA 1JCKB 4HJGE 1XCQL 5D3IB 3ZYYX 3KWVA 1GB4A 1VLBA 2E3TA 1TKEA 1K52A 4MT5A 1QQRA 1AW7A 3TEZA 3AV8A 4C80A 1ROEA 4WH4A 3AE6B 2DWQA 4YTMB 3Q8EA 4J3OD 1TS2A 4RGTA 3GP7A 1ZOYB 1JROA 1ACCA 1KH0A 1Q10A 1N5XA 4JWSC 2AQ1B 4AQ7A 5HI1A 5I4DA 1E9MA 3IT6B 3MC0B 1E0ZA 3CIRB 1YJJA 2KWDA 3KQ4A 2INNE 2BTEA 1L6VA 1LO5D 4RH6A 1SSNA 2WXMA 3W2DA 1P7EA 1SXTA 4ZRQA 4RF0A 1K53A 1SJHD 4L23A 3AEEB 1OQQA 3KWLA 3H8HA 1I7HA 4ARCA 3E9SA 3N9YC 2X38A 1ZUD2 4DQOC 1KTKA 2JU6X 2BYTA 2J4XA 1N63A 1I4GA 2NMQA 3LXFA 2QILA 1TKYA 1SJED 1C77A 4KX6B 2JX5A 3AEDB 4IDIA 2DLBA 5T8IA 2WXOA 3U7ZA 2BB6A 2WXQA 1JWBD 2WU2B 2GRIA 1ZDVA 1PFDA 4RGOS 2WXKA 3DWGC 3CWIA 3FC4A 2WNMA 2JZPA 1CQVA 4KGTA 1VZ8A 1JWAD 4ARIA 1GOZA 1TYGB 3W9CB 3ZGZA 2KQ4X 1ZXHA 5EE3A 3AEFB 1VRAB 4LLGM 1TY2A 2W55A 4YXDB 5HFYA 4ZOHC 2IGDA 1NI3A 2PIAA 1KF6B 5H8YE 1ESFA 2ICIA 3EGRA 1FCCC 1V1OA 4C7ZA 1FFVA 3Q8BA 3PZ8A 3V05A 1FRRA 3BZDB 5BYSA 1C78A 4ZRPA 1E10A 1YQ3B 4FXCA 3U2SC 5FK9C 4OVZA 3BYYB 3HVDA 1GB1A 1J7CA 2QMTA 3B2GA 2SEBD 3EUB2 1L5PA 3BVZA 2WXPA 1JW9D 1WWTA 3IAS1 2PTLA 5G5GA 3FILB 2LHEA 3BVMA 4R3DA 2K0PA 4XWTA 1TS3A 1QLBB 1SE2A 2BW2A 2QEJC 4P6VF 4RGMA 1D4BA 1E7PB 2CJOA 5BYQA 1NYRA 2V3NA 1BXTA 1QOFA 4C7YA 1AYFA 4OHJA 1PUTA 2W54A 3NRZA 3P4RB 2ONQA 4JE3B 1HEZE 2WXLA 1RM6C 1I4PA 1PGAA 4A8XC 4AS1A 2RMMA 1SBBB 2H88B 4KKIA 1NENB 2EELA 3AEBB 4NJCA 2KACA 1ET9A 2L83A 1L0VB 1UNSA 1XF5L 2I38A 3W1SA 1JWUD 1MHXA 1K51A 2LJIA 4JX1C 3NVZA 1WSPA 2BS4B 2FUG1 1I4QA 2MJ3A 1VR9A 2WXJA 1PGBA 2H89B 3SFDB 3P4QB 2BS2B 1TS4A 5C3JB 3IT4B 3FILA 3AB5A 1C76A 1FXIA 1KLUD 5EE0A 1JWSD 2WDQB 1F2RI 3MHZA 4A55A 1L4DB 4D2KA 1XEEA 3BK2A 4NZLB 1HZ6A 3NVVA 3PZ7A 2AX5A 1D5ZC 1OFFA 1SF0A 5EE9A 2D5GA 2WXNA 1AN8A 3P4SB 1ZPSA 1XCTL 1P7FA 3FAHA 1BUIC 1T5XD 1KFYB 3V3XA 1SIJA 1SE4A 3TSSA 2E6XA 4LK0M 3T3OA 2IPKD 2M56B 3AE5B 3BVGA 2DYMA 2JSVX 1HA5A 4XE0A 3Q8AA 1FMAD 1C9FA 1FM0D 2W82A 2WS3B 1WRIA 4TQ1A 1JQ4A 4ZYSA 4US9A 2IGGA 4JWUC 3MJ5A 1YN4A 4Q2JA 5EE1A 1UWXA 1AWDA 1DGJA 3URYA 3SR6A 1CK1A 1PYWD 2J52A 5MPOA 3T3NA 3Q8FA 2RDHA 2WXGA 2PLPA 3AH7A 4RGNA 4XWWA 2BB5A 4TMAB 3Q69A 1VZ7A 2PVOD 2YEPB 3PO0A 2HTME 1RFKA 3J9CA 3LYYA 3IXSA 4A6QA 1BMLC 2ZW0A 2LFIA 3BK1A 4GLSC 2GI9A 3TEXA 1JALA 1MHHE 2V4IB 3KLSX 4ZHPA 1QOGA 2WXHA 3BWUD 1D6EC 1YN5A 1V97A 1QT9A 2N0SB 1PDXA 2M19A 3AECB 1EU4A 4RF1A 4P16A 1GPXA 4HROA 1YMHE 3P1MA 1EM7A 4XDDA 2BBCA 5AUKA 1FO4A 1FRDA 3ZJVA 2BS3B 4US8A 2QSDA 2G1EA 2WXRA 3AE3B 2W3SA 4OZBA 3WCQA 1DOIA 1WXQA 1Y56A 4PT5A 3HVZA 2DYOA 4YWGG 3AM9A 3RPFC 2N9LA 4WQMA 2WXIA 1I4RA 3R2TA 1KRHA 3NVYA 5H92C 3C8YA 3UI3A 2AQ3B 2XNAC 3AMZA 2JYEA 4MM3B 2RDGA 4OZCA 2PW9A 4NAWB 4WIPA 1TZOA 2KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3U A;  1XEE A; 
#chains in the Genus database with same CATH topology
 1QOA A;  3BII D;  3BY4 B;  3VH3 B;  2M0A A;  2L32 A;  4ZYN A;  3P63 A;  1B1Z A;  2NBW B;  1QKZ A;  1MVK A;  3RYT A;  2NCN A;  2W9N A;  3E56 A;  2MX2 A;  3NVW A;  4USA A;  2KD0 A;  2RSU A;  4AJY B;  2W3R A;  1C4A A;  4IKG A;  4IOI E;  2CS4 A;  2IYD B;  4HKQ A;  3ABV B;  3IHP C;  4EFO A;  2JWZ A;  3DPD A;  4HKZ E;  2FBW B;  3ZXR A;  3ZJT A;  2BWE S;  1IBX B;  4BKT A;  3ZQ4 A;  2VZK B;  3NY5 A;  1JWM D;  3RNC C;  3OAW A;  1C1Y B;  1ZKH A;  4REZ A;  5J18 A;  1RFA A;  2R61 A;  1YNT E;  2K22 A;  2QJL A;  4II2 B;  4NJ7 A;  3VUW A;  3IAM 1;  5JH5 C;  4IUM B;  2RD0 A;  3KUC B;  3R2I A;  1GC6 A;  1WM2 A;  2BWF A;  3RZF A;  2N4F A;  1HQR D;  1L7Y A;  3I57 A;  2FID A;  1NYQ A;  2ZPN A;  2QIE B;  3ZUN A;  2JQR B;  3SHQ A;  1IBX A;  4M8M A;  4CQN A;  1R4N B;  2J0M A;  1I42 A;  2LXC A;  2IY1 B;  2WGS A;  4WQO B;  5L95 C;  3QWZ B;  5GXG B;  3MHS D;  2X8X X;  2LVQ A;  3AE7 B;  3TUO A;  2LD9 A;  2Y5P A;  1WGK A;  2L8J A;  4KIK B;  2DYB A;  1T0Y A;  3AI5 A;  3VXW A;  2V1Y A;  2LUE A;  4NNJ B;  1VDV A;  2EMS A;  4MGK E;  2SAK A;  3KVF B;  4DXG A;  2JXX A;  3OWE B;  2KJH B;  4HCN B;  2PMV A;  2FUH B;  5TSS A;  4PYZ A;  1G6J A;  2KYW A;  1KLG D;  2EKE C;  5BMI A;  2MW5 A;  4M01 A;  3HM6 X;  2AYO B;  3U4E G;  3VR8 B;  2CHW A;  4C4V B;  1GAQ B;  3CMM B;  1LXD A;  2MA9 B;  2ON8 A;  2FE8 A;  4L2Y A;  4KIK A;  1EU3 A;  2K8C A;  2V0G A;  2A5U A;  2XN9 C;  1L2N A;  2EKI A;  2YVC A;  4BZA A;  4HWI B;  4J6I A;  3Q3O C;  1I4H A;  2K5P A;  4MEM A;  2PPH A;  2D10 A;  4MM3 A;  3B0A A;  3AE2 B;  4ITK A;  1EO6 A;  1LM8 B;  3DBS A;  2REX A;  2WHI A;  5DCN A;  1VD2 A;  3ZYY X;  3KWV A;  5AEK B;  1GB4 A;  1RRB A;  4C80 A;  3Q6B A;  1OTR B;  3AE6 B;  4KZ0 A;  4YTM B;  4J3O D;  1GNU A;  1TS2 A;  4M8N A;  1WGG A;  1ACC A;  1Q10 A;  5E6P A;  4AQ7 A;  5IP4 D;  2MCN B;  3CIR B;  2BTE A;  1WMH B;  1LO5 D;  2M8S A;  3CF6 E;  2PE6 B;  1SJH D;  3H8H A;  3PSE B;  4ACF A;  2KZR A;  2X38 A;  2NVU I;  4FAD A;  2JU6 X;  4MEL A;  1UGM A;  2BYT A;  3PHW B;  4DK5 A;  1E7V A;  4K1R B;  2BYF A;  5IKC M;  2QIL A;  5JHA A;  2QC8 A;  2DAJ A;  3IVF A;  4FJY A;  1P3Q U;  2JX5 A;  4GDK A;  1UEL A;  5T8I A;  2V9H A;  2BGF A;  2GRI A;  1ZDV A;  3A4S C;  4OVU A;  3R66 C;  2ZPY A;  1WMH A;  4KGT A;  1VZ8 A;  1GOZ A;  3W9C B;  3ZGZ A;  2C7N B;  1LFD A;  2O6V D;  1ZXH A;  3AEF B;  4P1B C;  2W55 A;  3QJZ A;  4YXD B;  1MG4 A;  1MFW A;  1ISN A;  5H8Y E;  2M0X A;  2KMA A;  3DBR I;  2GBJ A;  2GMI C;  2MBO A;  2M4N A;  2ASQ A;  5DPR A;  1UBI A;  5BYS A;  2YLM A;  4GB9 A;  1E10 A;  4OVZ A;  3B2G A;  2SEB D;  1L5P A;  3AU4 A;  1WWT A;  4JQW C;  2PTL A;  3FIL B;  1WXM A;  1QLB B;  1SE2 A;  2BW2 A;  2LZ6 A;  4RGM A;  2CJO A;  2K8H A;  3NG0 A;  4ASW C;  2W54 A;  3ZXV A;  1SIF A;  3V6E B;  1HEZ E;  1OEY J;  1PGA A;  3Q3N C;  1SBB B;  2H88 B;  1FXT B;  2BPS A;  1XD3 B;  3W1S A;  3JVZ X;  1L0V B;  1UNS A;  2I38 A;  5E6N A;  3CST A;  1JWU D;  1K51 A;  4KZC A;  2KDE B;  1I4Q A;  3N30 A;  3P4Q B;  4K7S A;  4DHJ B;  5DPW A;  3FIL A;  1C76 A;  1FXI A;  3VH4 B;  2KHW B;  2Z59 B;  1J19 A;  3PRE A;  4W9I A;  1F2R I;  1L4D B;  2JVC A;  3NVV A;  1OFF A;  3EC8 A;  1E8Z A;  1VCB A;  2WXN A;  1ZPS A;  1XCT L;  1BUI C;  2BKR B;  2KWU B;  1T5X D;  1KFY B;  3H7P B;  3RNF C;  3DVN U;  2E6X A;  4MGZ E;  2IPK D;  2M56 B;  3BVG A;  3WAP A;  3UGB B;  1WF9 A;  1FM0 D;  3ZIM A;  3V60 A;  1JQ4 A;  1D3Z A;  3OG5 A;  3GE3 C;  1YN4 A;  5EE1 A;  2K6Q A;  3WAN A;  4IM3 A;  4BOS C;  1WXV A;  1P0R A;  3URY A;  3SR6 A;  5MPO A;  3T3N A;  2RDH A;  4TMA B;  1V49 A;  4F1S A;  2YEP B;  2JY6 A;  3ALB A;  2M1M A;  3P2B A;  3IXS A;  1KJT A;  4LCD E;  3H7P A;  4GLS C;  4W9K A;  2OJR A;  2BKF A;  1JAL A;  2WXH A;  4LJP B;  1D6E C;  1QT9 A;  2N0S B;  2M19 A;  1WGD A;  2HE7 A;  3H9D A;  4W9H A;  5D2M B;  4DHZ B;  1WM3 A;  3JSV B;  5AUK A;  1FO4 A;  2BYV E;  5JHB A;  2QSD A;  3RMK C;  1YJ1 A;  2D3B A;  2GOW A;  4M0W B;  4YWG G;  3AM9 A;  3RPF C;  5LLI A;  2K39 A;  3QQ8 B;  2WXI A;  3QK0 A;  1I4R A;  2AQ3 B;  3AMZ A;  2C5L C;  4MDK E;  2FIF A;  2I1J A;  4FJV B;  1PGX A;  3Q14 C;  4X57 B;  2LGS A;  5FKA C;  4GDL B;  3HIZ A;  1IUE A;  3JSV A;  4B0M A;  1DOX A;  3EA6 A;  2K1F A;  4RFB A;  2BVC A;  3PS6 A;  1V6E A;  4WUR A;  4M0W A;  3H7S A;  3ZJU A;  2KQ7 A;  1ENF A;  1T3Q A;  4HDQ A;  3NZS A;  1R4M I;  2L0F A;  2LHD A;  3TEW A;  4A3P A;  4DXF A;  3DVN V;  4MH8 A;  2AL6 A;  1WGY A;  1RYJ A;  2WQY B;  2MJE A;  1B9R A;  3IFW B;  1I4X A;  3DBH I;  4FHK A;  3VTV A;  2N7J A;  2NTT A;  2MH7 A;  2V3S A;  1SE3 A;  2ZNV B;  2OOB B;  4PS3 A;  1WFY A;  4B9K A;  3SU8 X;  1L4Z B;  3DHI C;  2J7Q B;  4GDL A;  4JPS A;  1ZXI A;  3N1Y C;  3EHV A;  2KAJ A;  2HJ8 A;  1EUV B;  3OJ4 B;  2GB1 A;  1WYW B;  5G2N A;  2G45 B;  1NEK B;  4YSZ B;  4HRS A;  1K8R B;  4W9C A;  1VZ6 A;  1QIL A;  1N60 A;  3TMP B;  3HRD D;  1SEB D;  1TT5 B;  2J42 A;  1WJN A;  3PRP B;  4KGR A;  4N6E B;  2RDB C;  4DDI D;  4FJZ A;  1R7S A;  5JZE B;  2LMC A;  4NAM A;  4B95 A;  2NPT B;  3AE4 B;  5CHW A;  2ZEQ A;  1MI0 A;  3UQB A;  4W9J A;  3AEA B;  1NI2 A;  3EEC A;  3U52 E;  4OVV A;  2HTH A;  1OQR A;  4N58 A;  2XBB C;  4XYC A;  2MJD A;  2K9X A;  2R2Q A;  5FR3 A;  2CKH B;  4DBG A;  1UUP A;  3PLU A;  3ZLZ A;  1RWS A;  1YD8 U;  4LNF A;  3AE8 B;  4BKS D;  4B6W A;  4YT0 B;  2WDV B;  2ZZP B;  2D3C A;  2C60 A;  1FFU A;  2PVG C;  3ZRC A;  3P4P B;  3FKY A;  3M62 B;  4MSQ B;  5KHQ A;  4BBN C;  4HPP A;  3A9K A;  2IO0 B;  1FCL A;  1IGC A;  3GZN B;  2LJ5 A;  3KYD D;  1YX6 B;  2KAN A;  2JYT A;  1WGR A;  2K8B A;  3LB8 C;  4L1B A;  2G4D B;  2Z8L A;  2QDF A;  2QHO A;  3PHX B;  2IO3 B;  5HKH A;  4XC2 A;  1XXG A;  2IJ0 A;  3OJ3 A;  3NZ3 A;  4IWQ A;  3MP9 A;  3U30 A;  1C4C A;  2Q5W D;  3DHG C;  3DCG A;  5G5H A;  3V62 A;  1Q5W B;  3QAR A;  1D5X C;  1K50 A;  3VAW A;  3ETR A;  2XK5 A;  2G9H D;  1MG8 A;  3A9J B;  2KC1 A;  3QA8 A;  1VJK A;  1WJ6 A;  2AQ2 B;  3WAM A;  5D7G A;  4N9F 4;  3ZRF A;  3VTU A;  1WJ4 A;  4K7W A;  1XLP A;  3C19 A;  3TIX A;  4BAX A;  4IM0 A;  2J0K A;  1VLB A;  2E3T A;  1K52 A;  2IZV B;  1QQR A;  2G3Q B;  3QAQ A;  5CX3 A;  4WH4 A;  4LNO A;  2N7E A;  1WY8 A;  1E8Y A;  4E74 A;  5D6J B;  3PLV A;  1ZOY B;  3A9J A;  1KH0 A;  4JWS C;  2LGY A;  2NR2 A;  4F8C B;  3W2D A;  1P7E A;  1SXT A;  1J8C A;  4ZRQ A;  3WIM A;  4L23 A;  2MBE A;  3KWL A;  1OQQ A;  3K9O B;  4WJP A;  2WWZ A;  4HK2 A;  3N9Y C;  3PTF C;  2KTF A;  4DQO C;  5D94 A;  2JRI B;  2MBQ A;  2O6V B;  3O65 B;  2GLS A;  2KVR A;  2J4X A;  3PRM B;  1I4G A;  3T8M A;  3LXF A;  4PS7 A;  4E71 A;  1TKY A;  4CHK A;  1C77 A;  2CR5 A;  1BT0 A;  2DZI A;  2DLB A;  4GXB A;  3HHM A;  1XT9 B;  2BB6 A;  2WXQ A;  3DBL I;  2WU2 B;  1LGR A;  2M17 A;  3L16 A;  1XQQ A;  2GBR A;  2WXK A;  4MJS B;  4ICU A;  2JZP A;  2RR9 A;  4ARI A;  1HTQ A;  2IY0 B;  4HJK A;  3ZKJ C;  1EF5 A;  2KQ4 X;  4A3O A;  4S17 A;  3ML9 A;  1ZW7 A;  2C7H A;  2ZVN A;  1JRU A;  1ESF A;  4FUL A;  4WWO A;  4IM2 A;  1V1O A;  4C7Z A;  1FFV A;  3BZD B;  1WIA A;  1MJD A;  3LDZ E;  1Z5S B;  4MGI E;  4GGQ A;  3AXC A;  2QMT A;  2R2O A;  1V5T A;  3PPA A;  5G5G A;  2K0P A;  4KSL C;  2KFK B;  3A33 B;  3L08 A;  2QEJ C;  4P6V F;  1D4B A;  3DVG X;  2V3N A;  4C7Y A;  1QOF A;  4WAA A;  4II3 B;  4A8X C;  3NS8 A;  3L13 A;  4C4V A;  4NJC A;  3DBR B;  2L83 A;  1XF5 L;  4KDI C;  3KH0 A;  1UF0 A;  1MHX A;  2LJI A;  1OGW A;  1YOV B;  1T0R C;  3RNG C;  2BS4 B;  2WXJ A;  4K7U A;  2MJ3 A;  3SD5 A;  1F52 A;  4LDT D;  2DZJ A;  1TS4 A;  4JLC A;  5C3J B;  3IT4 B;  3AB5 A;  2KFK A;  3SDL C;  1JWS D;  2WDQ B;  4A55 A;  4D2K A;  4AOF A;  1WX7 A;  4NZL B;  1HZ6 A;  3PZ7 A;  1SF0 A;  5EE9 A;  2D5G A;  3P4S B;  4HPM B;  1P7F A;  3TJP A;  1UZX B;  4IWO A;  3RNB C;  1NDD A;  3AE5 B;  3M95 A;  2JSV X;  1HA5 A;  2DZK A;  2LRU A;  4NY0 A;  4XE0 A;  2KLC A;  5J17 A;  1IYF A;  3B1L X;  3Q8A A;  1C9F A;  2D2Q A;  1KM7 A;  2HJ1 A;  2KVZ A;  2QCZ A;  4JWU C;  1FPY A;  4LNN A;  1GC7 A;  4Q2J A;  4BKG A;  1DGJ A;  2WYQ A;  3MC9 A;  5AZH A;  1PYW D;  5CHV C;  5IA7 A;  4G0N B;  2PLP A;  4RGN A;  1VZ7 A;  4G50 A;  3LYY A;  3R7R A;  2IBI B;  2LFI A;  3BK1 A;  2L0T A;  2A4Z A;  2N9P C;  1WJU A;  2GI9 A;  1MHH E;  2V4I B;  4ZHP A;  3BWU D;  3X0W A;  4AUQ C;  1EU4 A;  1GPX A;  3MC8 A;  4AWJ A;  2BBC A;  1KOT A;  2WX1 A;  4BOZ B;  3QHT A;  3AE3 B;  3WCQ A;  4RM8 A;  1Y56 A;  3HVZ A;  3ZO5 B;  2N9L A;  3ZTC A;  2MP2 B;  1KRH A;  5H92 C;  4WJN A;  2XNA C;  4JGH B;  2CHZ A;  2JYE A;  2RDG A;  4OZC A;  4NAW B;  1F9J A;  1TZO A;  2JZ3 B;  4WJQ A;  1SE9 A;  5BMH A;  2I2Y A;  2IDY A;  3SEB A;  3N1Z C;  5HHD G;  5IO9 A;  2J53 A;  1Q1O A;  2WLB A;  5E6J A;  1FXA A;  2J0J A;  1ZDX A;  2KMM A;  1FD6 A;  1WZ0 A;  2JUO A;  1V1P B;  2CU3 A;  1I35 A;  1TBE A;  3PV1 A;  3Q8C A;  2MEK A;  4I6N B;  4FHJ A;  2TSS A;  2KOX A;  5CHF A;  2KJR A;  1RAX A;  4KV2 A;  1IGD A;  2WXF A;  2MP2 A;  2EMT A;  3NHE B;  2WP9 B;  3VRA B;  2PE9 A;  1Q0W B;  3VVW B;  4A90 A;  1WGH A;  1WR6 E;  4NAW A;  4RCO A;  3VDZ A;  2L1A A;  2JXT A;  1DOY A;  1JML A;  3RNA C;  4MH0 E;  1T6B X;  1CJE A;  3DWM A;  3NUH B;  2DNF A;  2IGH A;  1L6U A;  3W1S C;  3AEG B;  1TZ1 A;  1V1P A;  1FNW A;  3WA0 A;  4H2A A;  3DHH C;  2BT6 A;  4EOY A;  1M4V A;  3KUD B;  2KX0 A;  3VTW A;  4TKN A;  2MBB B;  4MSM B;  1SB3 C;  3H1U A;  4C56 C;  1A70 A;  3W5V B;  3AN1 A;  1L0Y B;  3VHT C;  3ZDM C;  1YJI A;  4OZA A;  3DBH B;  1EWC A;  2B76 B;  1YQ4 B;  1P98 A;  3I9V 1;  3RT3 B;  4AJW A;  2DZM A;  2ACZ B;  3B9J A;  3RUI B;  3RZW C;  1WH3 A;  1FNV A;  4TSS A;  4A20 A;  1DYQ A;  1YN3 A;  4EE2 A;  1WI0 A;  1XLN A;  1WE7 A;  1NBF C;  3L4P A;  1ZE3 D;  4ZHO A;  1TY0 A;  1YX5 B;  4KGS A;  4W9G A;  5C23 A;  2WU5 B;  2CU1 A;  1WYG A;  3O13 A;  3VR9 B;  4LTU A;  1P1A A;  3W1Y A;  3ZNI D;  3T9L A;  4GIV A;  5EDS A;  3APD A;  5HG2 A;  1UGJ A;  4A9A A;  5BYR A;  3U7D A;  4YTP B;  3IBE A;  1M94 A;  3ZNH B;  4FBJ B;  4N59 A;  3X23 A;  1E90 A;  2KDM A;  5IOI A;  4TQ0 A;  1MPE A;  3GS2 A;  1V2Y A;  1HZ5 A;  4WAF A;  1N61 A;  1F0Z A;  2KQS A;  5LNK 1;  2PKO A;  5D3D A;  4GU2 A;  2JWU A;  1IPG A;  2I1K A;  1KLV A;  2DHZ A;  2GBM A;  1XLO A;  4RNA A;  2FCS A;  1HXY D;  5JXV A;  4NQK E;  2NTS A;  4FA6 A;  2IO2 B;  1NVI D;  1FNU A;  3LJ3 A;  1RLF A;  1D5M C;  1QF6 A;  2ZJD A;  3APF A;  1Y8R C;  2CJN A;  4FN2 A;  3HK0 A;  4WWM A;  3I5J C;  5LXI B;  1J7A A;  1UWM A;  1JCK B;  4TUU A;  3I3T B;  1E8W A;  1XCQ L;  5D3I B;  3VFK A;  4F7Z A;  1T0S C;  2N9X A;  4TV3 A;  1E8X A;  2MLB A;  1TKE A;  4MT5 A;  4G11 A;  2ZVO A;  4ZRJ A;  4JIO U;  3AV8 A;  1J0G A;  2NBV B;  4ZDV A;  5L83 A;  4RGT A;  2KWV B;  1N5X A;  3NJT A;  4BVU C;  3IT6 B;  3MC0 B;  2KWD A;  3KQ4 A;  1V86 A;  2WXM A;  3AEE B;  4ARC A;  3Q3F A;  5AZF A;  3E9S A;  4RMA A;  1ZUD 2;  2LRW A;  2KKC A;  1KTK A;  5KHO A;  2NMQ A;  5IAA C;  3ZTD A;  3Q3J A;  4KX6 B;  3EFU A;  2ZNV C;  4IDI A;  2FNJ B;  1V5O A;  4CYE A;  1WX8 A;  1LQB A;  4AP4 C;  2NPT A;  2NBU A;  3ZVV A;  3CWI A;  3FC4 A;  1CQV A;  1JWA D;  2AWT A;  4LNK A;  1TYG B;  4URK A;  5EE3 A;  1VRA B;  4W9F A;  4G3X B;  4LLG M;  3DVG Y;  2KNB A;  2IGD A;  2PIA A;  5CTR C;  2ICI A;  1FCC C;  3Q8B A;  3PZ8 A;  3V05 A;  2JT4 B;  4W9E A;  1C78 A;  4ZRP A;  1YQ3 B;  1C3T A;  5FK9 C;  3BYY B;  2VRR B;  3HVD A;  1J7C A;  3EUB 2;  4KVG B;  3IAS 1;  2L05 A;  3DBL B;  2LHE A;  4XWT A;  1V9J A;  1TS3 A;  3CSF A;  1YQB A;  2IND C;  2KT7 A;  4LDT B;  5BYQ A;  1BXT A;  3V61 A;  1WXA A;  1PUT A;  3P4R B;  4S0R A;  2ONQ A;  3N20 C;  4JE3 B;  3D32 A;  1I4P A;  4QAY A;  4AS1 A;  2FCM A;  2KXJ A;  2KAC A;  1ET9 A;  3R7Q A;  1GJZ A;  1UD7 A;  1N6Z A;  1E7U A;  4MGY E;  3TCA A;  4FLH A;  3ZNG C;  3GOE A;  2KN5 A;  2N1V A;  3AU5 A;  5EE0 A;  4K3C A;  3MHZ A;  3HM3 A;  1WXS A;  1S3S G;  1HE8 A;  3BK2 A;  2AX5 A;  2JRH A;  3FAH A;  3C0R B;  1SE4 A;  2FCQ A;  4LK0 M;  3T3O A;  2KFJ A;  2L00 B;  2DYM A;  3L10 B;  4HCP B;  2WS3 B;  2GBN A;  1WRI A;  2OJW A;  2NS5 A;  4ZYS A;  4US9 A;  3MJ5 A;  5E6O A;  1UWX A;  3KYC D;  2Y5B B;  1AWD A;  3WAO A;  1Z2M A;  5G55 A;  2JZZ A;  1CK1 A;  3Q8F A;  2WXG A;  3AH7 A;  4E3C A;  3Q69 A;  4XGA B;  3RCZ A;  1S1Q B;  2HTM E;  2L76 A;  4A6Q A;  1BML C;  3PVL A;  2PJH A;  3GZN I;  2B3A A;  3KLS X;  4DDG D;  1YN5 A;  3AEC B;  4HRO A;  1YMH E;  2LI5 A;  2K6D B;  3ZJV A;  2BS3 B;  2KDI A;  2O6V A;  2XEW A;  4US8 A;  2UYZ B;  3M63 B;  2G1E A;  2WXR A;  3MTN B;  2KX3 A;  5AZG A;  4DWF A;  4EZJ A;  2KMC A;  3C8Y A;  4DXA B;  4MM3 B;  1F1H A;  4MJS A;  3S2A A;  2KC2 A;  2D3G A;  2KN4 A;  3OLM D;  2BF8 B;  3R8B A;  1QOB A;  3JYU A;  1N5W A;  4GMV A;  3A1Q B;  5IN7 A;  2LEK A;  4XDC A;  4DHZ E;  1V8C A;  4KKJ A;  4M02 A;  1ZGU B;  4ANV A;  5TR5 A;  5C1Z A;  2HD5 B;  1U4A A;  4B0E A;  2LGI A;  2O2V B;  3ZDT A;  1STE A;  3MFG A;  3QCA A;  1E6E B;  1EF1 A;  2KWC A;  4W9D A;  2PEA A;  2RPQ A;  3VQI A;  4UDU C;  3ECI A;  4W9L A;  4IG7 B;  4HLE A;  2K3U A;  3SFE B;  1WE6 A;  5GMV A;  3NS1 A;  1JRP A;  3A1Q A;  1R4N I;  3UIO B;  2UWQ A;  2Z0E B;  4HEA 1;  4O1N A;  3QC8 B;  1IP9 A;  5C2T B;  2KDF B;  2MRP A;  2Y5C A;  1ET6 A;  1ZP0 B;  1H4R A;  4P7I A;  3ML8 A;  4CO7 A;  4OW0 A;  2O2V A;  1C79 A;  2KK8 A;  3QIJ A;  1WR1 A;  4WWN A;  4HXD A;  3GB1 A;  4GDK B;  2Y3A A;  5FR6 A;  1UBQ A;  2KTR B;  5BMG A;  4IWP A;  2L52 A;  1N62 A;  4YSX B;  2DBY A;  1TKG A;  2N9K A;  3K9P B;  3HUI A;  2VZK D;  4IW0 A;  3IG3 A;  2N7D A;  4EKU A;  1XO3 A;  2RGF A;  2ZW1 A;  4MAC A;  4HDO A;  2GBK A;  2INP E;  3M3J A;  3BIN A;  4P1C C;  4ANU A;  1CMX B;  3B2F A;  2ZCB A;  3JW0 X;  5DPT A;  5BO4 B;  3W5U B;  1TS5 A;  2RPV A;  4XZ4 A;  1XLQ A;  1WZ3 A;  2KTR A;  5AUI A;  3N3K B;  4GSW A;  1F77 A;  3AE9 B;  1T0Q C;  2LUM A;  1C4P A;  1L0X B;  3NOB A;  1CZP A;  2WDR B;  2OHF A;  3PRZ A;  3EFC A;  5LXH A;  1TJE A;  4EEW A;  4PYU A;  4GN1 A;  4K81 A;  4I6L B;  1GG3 A;  3AE1 B;  2YEP F;  3VRB B;  3KUZ A;  2AEH A;  3R3M A;  1J7B A;  2FCN A;  4JL9 A;  4YSY B;  3RFZ B;  1FIQ A;  2JF5 A;  1F2R C;  2VH2 A;  3ZW3 A;  1FEH A;  4ZRK A;  3RNE C;  2LGD A;  2OED A;  3BYT B;  1EWY C;  3TL5 A;  4YL8 A;  4ZRI A;  3RD2 A;  4ANX A;  3I63 C;  3L17 A;  3TEY A;  2V3P A;  3AUL A;  4LJO B;  2HDE A;  2FAZ A;  2DAF A;  1GUA B;  2BQQ A;  3P42 A;  3L0W B;  4YTN B;  3QX1 A;  4HJG E;  2KJ6 A;  3PT2 B;  5DPS A;  3Q2A C;  2N9E B;  3GE8 C;  2N1W A;  5J2R A;  3TEZ A;  1AW7 A;  1ROE A;  2DWQ A;  3Q8E A;  1R4M B;  3B08 A;  2G4S A;  3GP7 A;  1JRO A;  2UU7 A;  2Z0D B;  2MBH A;  1YIW A;  2AQ1 B;  5HI1 A;  5I4D A;  1E9M A;  1E0Z A;  1YJJ A;  2INN E;  1L6V A;  4RH6 A;  1SSN A;  2L7R A;  3APC A;  4I6P A;  4NPN A;  2WX0 A;  4RF0 A;  1K53 A;  1I7H A;  3PZD A;  3VUX A;  3L54 A;  3UF8 A;  3ZNZ B;  4PS8 A;  2BYE A;  3WAL A;  1N63 A;  4PK1 A;  1SJE D;  3AED B;  1TGZ B;  2WXO A;  3U7Z A;  1JWB D;  4BBN F;  4BKS A;  1PFD A;  3N1X C;  4RGO S;  3DWG C;  2LAS A;  2WNM A;  2D07 B;  1H8C A;  2DEN B;  1SGH A;  3TBL D;  3UIN B;  1E5W A;  1TY2 A;  5HFY A;  4ZOH C;  1A5R A;  2MHJ A;  3RUL A;  1NI3 A;  1KF6 B;  3EGR A;  2KO3 A;  4BFR A;  1FRR A;  2VH1 A;  4FXC A;  3U2S C;  4EZK A;  1GB1 A;  3ONS A;  3KW5 B;  2AL3 A;  1OQY A;  3UQA A;  3BVZ A;  2WXP A;  1JW9 D;  4R3D A;  3BVM A;  2L3Z A;  4IC7 B;  1E7P B;  1NYR A;  2K25 A;  1AYF A;  4OHJ A;  4WWP A;  3NRZ A;  3MJW A;  2WXL A;  1RM6 C;  2RMM A;  4KKI A;  1NEN B;  2EEL A;  3AEB B;  3Q3M C;  4KDL B;  4JX1 C;  3NVZ A;  4KSK C;  1P9D U;  1WSP A;  2JPH A;  2FUG 1;  2LVO A;  1VR9 A;  2LXA A;  2MSE D;  1PGB A;  2H89 B;  4HPL B;  3SFD B;  3PGE A;  2LWP A;  2BS2 B;  2MWS B;  2D3A A;  2IO1 B;  1KLU D;  2C9W B;  3RN9 C;  4EZL A;  1XEE A;  2MQJ A;  3VUY A;  1D5Z C;  4HVB A;  2C7M B;  1WRD B;  1TTN A;  2KLG A;  3DQV A;  1AN8 A;  1OEY A;  1UH6 A;  3UIP B;  2DX5 B;  2LGX A;  3V3X A;  1SIJ A;  3TSS A;  4ICV A;  4DHJ D;  1X1M A;  4C00 A;  2D11 A;  1FMA D;  2W82 A;  3DDC B;  4TQ1 A;  2INC C;  2IGG A;  3NZU A;  4WJO A;  2KDB A;  2J52 A;  4RM9 A;  4XWW A;  2BB5 A;  3DOW A;  4GOC A;  2PVO D;  3PO0 A;  1RFK A;  3J9C A;  2ZCC A;  3A4R A;  4XX5 A;  2ZW0 A;  1V80 A;  3TEX A;  3A9K B;  1QOG A;  4NQL B;  4LNI A;  1V97 A;  1PQS A;  1PDX A;  2WDT B;  4EUT A;  4RF1 A;  4P16 A;  3P1M A;  1EM7 A;  3U8Z A;  4XDD A;  3RI7 C;  2V4L A;  1FRD A;  2CHX A;  4ANW A;  1AAR A;  1V81 A;  2W3S A;  4OZB A;  1DOI A;  3ENE A;  1WXQ A;  1TIF A;  4PT5 A;  3V6C B;  4K3B A;  2DYO A;  3H6N A;  1WX9 A;  4WQM A;  3R2T A;  2XK5 B;  3NVY A;  3UI3 A;  4M00 A;  1QZE A;  2LVP A;  2PW9 A;  4NJ6 A;  1HTO A;  4WIP A;  3N32 A; 
#chains in the Genus database with same CATH homology
 1QOA A;  3R8B A;  1PGX A;  3BII D;  1QOB A;  2IDY A;  5BMH A;  2I2Y A;  3SEB A;  5HHD G;  2J53 A;  2WLB A;  5E6J A;  2M0A A;  2L32 A;  1FXA A;  5FKA C;  1N5W A;  1ZDX A;  4GDL B;  1IUE A;  2KMM A;  3P63 A;  1FD6 A;  2LEK A;  4XDC A;  4B0M A;  1DOX A;  1B1Z A;  3EA6 A;  1V1P B;  1V8C A;  2CU3 A;  4KKJ A;  1QKZ A;  1MVK A;  4RFB A;  4WUR A;  4M0W A;  3Q8C A;  2MEK A;  3E56 A;  2TSS A;  3ZJU A;  1ENF A;  1T3Q A;  3NVW A;  4USA A;  4B0E A;  2LGI A;  2LHD A;  3TEW A;  1IGD A;  2WXF A;  4DXF A;  4MH8 A;  1STE A;  3MFG A;  2W3R A;  1C4A A;  1E6E B;  2WP9 B;  3VRA B;  4IKG A;  1RYJ A;  2WQY B;  2MJE A;  4A90 A;  1B9R A;  1I4X A;  3VQI A;  4RCO A;  2L1A A;  2N7J A;  2NTT A;  2MH7 A;  4UDU C;  2JXT A;  4IOI E;  1DOY A;  1JML A;  4HKQ A;  3ABV B;  2K3U A;  1SE3 A;  4HKZ E;  2FBW B;  1L4Z B;  1T6B X;  3SFE B;  3ZJT A;  1CJE A;  3DWM A;  3NUH B;  3NS1 A;  1JRP A;  2IGH A;  1L6U A;  1ZXI A;  3AEG B;  4JPS A;  1IBX B;  2KAJ A;  1V1P A;  1FNW A;  4HEA 1;  4O1N A;  4H2A A;  2GB1 A;  3ZQ4 A;  2VZK B;  2BT6 A;  5C2T B;  1JWM D;  1M4V A;  4REZ A;  1NEK B;  2Y5C A;  1ET6 A;  4HRS A;  1ZP0 B;  4YSZ B;  1VZ6 A;  2R61 A;  1QIL A;  1N60 A;  1SB3 C;  4OW0 A;  1YNT E;  2K22 A;  3HRD D;  1C79 A;  1SEB D;  2QJL A;  1A70 A;  4C56 C;  3W5V B;  3IAM 1;  2J42 A;  4KGR A;  3AN1 A;  3GB1 A;  4N6E B;  3R2I A;  1L0Y B;  4GDK B;  2Y3A A;  1R7S A;  5BMG A;  1YJI A;  4OZA A;  2L52 A;  1EWC A;  1HQR D;  1N62 A;  4YSX B;  3I57 A;  2LMC A;  2B76 B;  2DBY A;  4NAM A;  1TKG A;  1YQ4 B;  3AE4 B;  2N9K A;  3I9V 1;  3HUI A;  2ACZ B;  2VZK D;  3B9J A;  1NYQ A;  2QIE B;  1MI0 A;  2JQR B;  1FNV A;  1IBX A;  3AEA B;  4TSS A;  1XO3 A;  1DYQ A;  2ZW1 A;  4CQN A;  3U52 E;  1YN3 A;  4EE2 A;  1XLN A;  1OQR A;  4N58 A;  4MAC A;  2MJD A;  3L4P A;  1ZE3 D;  4ZHO A;  1TY0 A;  2K9X A;  4KGS A;  5FR3 A;  2INP E;  2WU5 B;  1UUP A;  5GXG B;  1WYG A;  3O13 A;  3AE7 B;  3TUO A;  1RWS A;  3VR9 B;  3B2F A;  4LTU A;  3AE8 B;  3W5U B;  1TS5 A;  2RPV A;  2Y5P A;  1WGK A;  1XLQ A;  4YT0 B;  5AUI A;  2WDV B;  1F77 A;  3AE9 B;  2LUM A;  1C4P A;  1FFU A;  1L0X B;  2PVG C;  5HG2 A;  3P4P B;  1UGJ A;  4A9A A;  1VDV A;  1CZP A;  2WDR B;  2OHF A;  5BYR A;  2SAK A;  4DXG A;  4YTP B;  3OWE B;  1TJE A;  2PMV A;  4N59 A;  5TSS A;  2KDM A;  4TQ0 A;  3AE1 B;  2YEP F;  1MPE A;  3GS2 A;  1KLG D;  3VRB B;  1FCL A;  1HZ5 A;  1IGC A;  4WAF A;  1N61 A;  5BMI A;  3U4E G;  1F0Z A;  3VR8 B;  5LNK 1;  1GAQ B;  2PKO A;  1J7B A;  2JYT A;  4YSY B;  5D3D A;  3RFZ B;  1FIQ A;  3LB8 C;  4L1B A;  2Z8L A;  1F2R C;  2JWU A;  2ON8 A;  2FE8 A;  4L2Y A;  1EU3 A;  1XXG A;  2IJ0 A;  1FEH A;  3NZ3 A;  2V0G A;  1XLO A;  2OED A;  3BYT B;  3MP9 A;  4RNA A;  1HXY D;  2XN9 C;  5JXV A;  1C4C A;  2EKI A;  2Q5W D;  2NTS A;  1EWY C;  5G5H A;  1I4H A;  2K5P A;  1D5X C;  1K50 A;  3ETR A;  1NVI D;  2G9H D;  3TEY A;  1FNU A;  2V3P A;  1D5M C;  1QF6 A;  1VJK A;  2CJN A;  2HDE A;  2AQ2 B;  3AE2 B;  4ITK A;  5D7G A;  3P42 A;  4WWM A;  1XLP A;  4YTN B;  1J7A A;  1UWM A;  1JCK B;  4HJG E;  1XCQ L;  5D3I B;  3ZYY X;  3KWV A;  1GB4 A;  1VLB A;  2E3T A;  1TKE A;  1K52 A;  4MT5 A;  1QQR A;  1AW7 A;  3TEZ A;  3AV8 A;  4C80 A;  1ROE A;  4WH4 A;  3AE6 B;  2DWQ A;  4YTM B;  3Q8E A;  4J3O D;  1TS2 A;  4RGT A;  3GP7 A;  1ZOY B;  1JRO A;  1ACC A;  1KH0 A;  1Q10 A;  1N5X A;  4JWS C;  2AQ1 B;  4AQ7 A;  5HI1 A;  5I4D A;  1E9M A;  3IT6 B;  3MC0 B;  1E0Z A;  3CIR B;  1YJJ A;  2KWD A;  3KQ4 A;  2INN E;  2BTE A;  1L6V A;  1LO5 D;  4RH6 A;  1SSN A;  2WXM A;  3W2D A;  1P7E A;  1SXT A;  4ZRQ A;  4RF0 A;  1K53 A;  1SJH D;  4L23 A;  3AEE B;  1OQQ A;  3KWL A;  3H8H A;  1I7H A;  4ARC A;  3E9S A;  3N9Y C;  2X38 A;  1ZUD 2;  4DQO C;  1KTK A;  2JU6 X;  2BYT A;  2J4X A;  1N63 A;  1I4G A;  2NMQ A;  3LXF A;  2QIL A;  1TKY A;  1SJE D;  1C77 A;  4KX6 B;  2JX5 A;  3AED B;  4IDI A;  2DLB A;  5T8I A;  2WXO A;  3U7Z A;  2BB6 A;  2WXQ A;  1JWB D;  2WU2 B;  2GRI A;  1ZDV A;  1PFD A;  4RGO S;  2WXK A;  3DWG C;  3CWI A;  3FC4 A;  2WNM A;  2JZP A;  1CQV A;  4KGT A;  1VZ8 A;  1JWA D;  4ARI A;  1GOZ A;  1TYG B;  3W9C B;  3ZGZ A;  2KQ4 X;  1ZXH A;  5EE3 A;  3AEF B;  1VRA B;  4LLG M;  1TY2 A;  2W55 A;  4YXD B;  5HFY A;  4ZOH C;  2IGD A;  1NI3 A;  2PIA A;  1KF6 B;  5H8Y E;  1ESF A;  2ICI A;  3EGR A;  1FCC C;  1V1O A;  4C7Z A;  1FFV A;  3Q8B A;  3PZ8 A;  3V05 A;  1FRR A;  3BZD B;  5BYS A;  1C78 A;  4ZRP A;  1E10 A;  1YQ3 B;  4FXC A;  3U2S C;  5FK9 C;  4OVZ A;  3BYY B;  3HVD A;  1GB1 A;  1J7C A;  2QMT A;  3B2G A;  2SEB D;  3EUB 2;  1L5P A;  3BVZ A;  2WXP A;  1JW9 D;  1WWT A;  3IAS 1;  2PTL A;  5G5G A;  3FIL B;  2LHE A;  3BVM A;  4R3D A;  2K0P A;  4XWT A;  1TS3 A;  1QLB B;  1SE2 A;  2BW2 A;  2QEJ C;  4P6V F;  4RGM A;  1D4B A;  1E7P B;  2CJO A;  5BYQ A;  1NYR A;  2V3N A;  1BXT A;  1QOF A;  4C7Y A;  1AYF A;  4OHJ A;  1PUT A;  2W54 A;  3NRZ A;  3P4R B;  2ONQ A;  4JE3 B;  1HEZ E;  2WXL A;  1RM6 C;  1I4P A;  1PGA A;  4A8X C;  4AS1 A;  2RMM A;  1SBB B;  2H88 B;  4KKI A;  1NEN B;  2EEL A;  3AEB B;  4NJC A;  2KAC A;  1ET9 A;  2L83 A;  1L0V B;  1UNS A;  1XF5 L;  2I38 A;  3W1S A;  1JWU D;  1MHX A;  1K51 A;  2LJI A;  4JX1 C;  3NVZ A;  1WSP A;  2BS4 B;  2FUG 1;  1I4Q A;  2MJ3 A;  1VR9 A;  2WXJ A;  1PGB A;  2H89 B;  3SFD B;  3P4Q B;  2BS2 B;  1TS4 A;  5C3J B;  3IT4 B;  3FIL A;  3AB5 A;  1C76 A;  1FXI A;  1KLU D;  5EE0 A;  1JWS D;  2WDQ B;  1F2R I;  3MHZ A;  4A55 A;  1L4D B;  4D2K A;  1XEE A;  3BK2 A;  4NZL B;  1HZ6 A;  3NVV A;  3PZ7 A;  2AX5 A;  1D5Z C;  1OFF A;  1SF0 A;  5EE9 A;  2D5G A;  2WXN A;  1AN8 A;  3P4S B;  1ZPS A;  1XCT L;  1P7F A;  3FAH A;  1BUI C;  1T5X D;  1KFY B;  3V3X A;  1SIJ A;  1SE4 A;  3TSS A;  2E6X A;  4LK0 M;  3T3O A;  2IPK D;  2M56 B;  3AE5 B;  3BVG A;  2DYM A;  2JSV X;  1HA5 A;  4XE0 A;  3Q8A A;  1FMA D;  1C9F A;  1FM0 D;  2W82 A;  2WS3 B;  1WRI A;  4TQ1 A;  1JQ4 A;  4ZYS A;  4US9 A;  2IGG A;  4JWU C;  3MJ5 A;  1YN4 A;  4Q2J A;  5EE1 A;  1UWX A;  1AWD A;  1DGJ A;  3URY A;  3SR6 A;  1CK1 A;  1PYW D;  2J52 A;  5MPO A;  3T3N A;  3Q8F A;  2RDH A;  2WXG A;  2PLP A;  3AH7 A;  4RGN A;  4XWW A;  2BB5 A;  4TMA B;  3Q69 A;  1VZ7 A;  2PVO D;  2YEP B;  3PO0 A;  2HTM E;  1RFK A;  3J9C A;  3LYY A;  3IXS A;  4A6Q A;  1BML C;  2ZW0 A;  2LFI A;  3BK1 A;  4GLS C;  2GI9 A;  3TEX A;  1JAL A;  1MHH E;  2V4I B;  3KLS X;  4ZHP A;  1QOG A;  2WXH A;  3BWU D;  1D6E C;  1YN5 A;  1V97 A;  1QT9 A;  2N0S B;  1PDX A;  2M19 A;  3AEC B;  1EU4 A;  4RF1 A;  4P16 A;  1GPX A;  4HRO A;  1YMH E;  3P1M A;  1EM7 A;  4XDD A;  2BBC A;  5AUK A;  1FO4 A;  1FRD A;  3ZJV A;  2BS3 B;  4US8 A;  2QSD A;  2G1E A;  2WXR A;  3AE3 B;  2W3S A;  4OZB A;  3WCQ A;  1DOI A;  1WXQ A;  1Y56 A;  4PT5 A;  3HVZ A;  2DYO A;  4YWG G;  3AM9 A;  3RPF C;  2N9L A;  4WQM A;  2WXI A;  1I4R A;  3R2T A;  1KRH A;  3NVY A;  5H92 C;  3C8Y A;  3UI3 A;  2AQ3 B;  2XNA C;  3AMZ A;  2JYE A;  4MM3 B;  2RDG A;  4OZC A;  2PW9 A;  4NAW B;  4WIP A;  1TZO A;  2KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...