1XEEA

Solution structure of the chemotaxis inhibitory protein of staphylococcus aureus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemotaxis-inhibiting protein CHIPS
publication title The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xeeA01
1XEEA 2K3UA
chains in the Genus database with same CATH superfamily
2GI9A 1E8WA 1ROEA 3KVFB 4KKIA 2KOXA 2W9NA 3SR6A 2BPSA 1OFFA 1QF6A 1YQ4B 2XEWA 2DNFA 3D32A 1ENFA 2L00B 4GMVA 4MH0E 3DBRB 4QAYA 1I4HA 2KD0A 4NQKE 3TIXA 2XBBC 1AN8A 4WJQA 4YL8A 1IBXA 2ZNVB 2I1JA 3P4QB 2G3QB 4MGKE 2NVUI 3B0AA 2PE6B 1SGHA 3PZDA 4HJGE 2W3SA 1C78A 4W9JA 5D3DA 1FEHA 4RFBA 2RDBC 3M3JA 4A90A 1TBEA 2WXKA 3OWEB 2WXFA 3NVVA 2KYWA 4BBNF 2VH1A 4A8XC 3AXCA 1GC6A 4GOCA 3QA8A 2MBQA 4B9KA 3AI5A 2KANA 3VFKA 2V3NA 3LJ3A 2KAJA 4JL9A 5BMHA 3BZDB 5AZHA 3TEWA 3EC8A 3RMKC 3PZ8A 3W5UB 4A3PA 2LUMA 1B9RA 4LLGM 4YSXB 1HTOA 1E6EB 3ZRFA 5I4DA 2KQSA 1SXTA 2LGSA 4J3OD 2RSUA 3EECA 4TMAB 1N5WA 1QOBA 3V3XA 3BK1A 4C7ZA 1L6VA 4MJSB 3ZYYX 2RPVA 1YN3A 2WQYB 1RFAA 3TCAA 1WE7A 2JY6A 1PDXA 4C4VA 3MTNB 5AZFA 2NR2A 3RNCC 1DOYA 1JCKB 4YWGG 4WWPA 2ICIA 3APFA 1QZEA 4KSLC 4KV2A 1R4MI 1YOVB 3AE8B 4LJPB 1NI3A 1Q5WB 2M0XA 1WXQA 4LNIA 5FK9C 3Q8AA 4RM9A 3APDA 3LYYA 1WX9A 3I3TB 3U8ZA 2K6QA 3AULA 4BOSC 2N9KA 3N1XC 3I63C 3PHWB 4JIOU 1ET6A 3LDZE 3EGRA 1F2RI 1L4DB 2JPHA 5DPRA 2IPKD 4G3XB 3Q69A 2D11A 3P2BA 4JQWC 5LLIA 5IOIA 1QOFA 1BXTA 2Q5WD 1NVID 3ZDMC 1L4ZB 2AQ3B 1CZPA 3PT2B 1UWXA 1FM0D 1WGGA 3QARA 1Z2MA 1JWAD 1FNUA 3IAM1 3V05A 3GZNB 1SIFA 1STEA 2K5PA 1TKEA 4FJYA 4DHZB 2L05A 2RPQA 2Z0DB 1E5WA 3RD2A 3T8MA 2KFKA 4WH4A 3PSEB 1VRAB 2D3BA 1P9DU 1RFKA 5AZGA 2BGFA 3FC4A 1YD8U 5E6NA 1WJNA 3A1QB 1YNTE 1ZOYB 4OHJA 3ZLZA 3E9SA 4RGTA 4EZKA 2ZCBA 1T0RC 2CU3A 3TEXA 2DAFA 2I38A 1T0QC 4S17A 4ZRKA 2EKIA 1SE9A 3CSFA 4NJCA 1UGMA 3EFUA 1JRPA 3VUXA 3K9PB 1TYGB 4N58A 2DWQA 3I57A 2M56B 5TSSA 4NAMA 4G11A 4FHJA 1V86A 4ARIA 4PYUA 3ZDTA 3NHEB 1KH0A 4M8NA 1PGBA 2KJHB 2AQ1B 2BYTA 1R4NI 2LWPA 2YLMA 1V5TA 4AJYB 3A4RA 4GDLA 2JZZA 2MP2A 3Q6BA 3C19A 3FAHA 3ZW3A 2LXAA 3AH7A 2B3AA 4NAWB 4GGQA 3AB5A 4A55A 2WYQA 2NTSA 1EM7A 1R7SA 1OQRA 3ZO5B 2REXA 2L8JA 1L5PA 1NI2A 1BT0A 4NPNA 4TQ0A 1UF0A 4A20A 2BT6A 3EHVA 3U30A 3HRDD 5EDSA 3H8HA 3PGEA 3RZWC 4M8MA 1YQ3B 3SFDB 4ZYSA 4ARCA 3HM6X 4LJOB 1I7HA 1FRDA 2KQ4X 1FXTB 3NOBA 3V61A 1YX6B 1VZ6A 4DXAB 3W1YA 4HPLB 1AARA 2WNMA 2D07B 1JW9D 1XO3A 3BVMA 3L10B 1JRUA 2N7EA 2KC1A 1FXIA 4MEMA 1ZW7A 3QC8B 1FNWA 3KQ4A 1MHHE 3LB8C 4IC7B 5FR3A 3ZQ4A 5D7GA 1FFUA 2M1MA 2KJRA 1FO4A 2EKEC 1P98A 4HROA 2D2QA 3U52E 1WJ6A 1SIJA 2AEHA 3VTVA 4WQMA 3DVGY 5FR6A 3MJWA 4EFOA 3WAPA 3H7SA 4JLCA 2IO2B 3L08A 4LNKA 5IAAC 3VAWA 1V5OA 1F77A 2JRHA 4BKSA 2NBWB 4PS8A 1E90A 2C60A 2WX1A 4NJ6A 4IM3A 3QJZA 1I4XA 4LNNA 1FCLA 3HIZA 4UDUC 2DYBA 4KGSA 1NENB 2J7QB 2J0KA 2LUEA 4CO7A 3GB1A 5GMVA 1JWBD 3IAS1 1CQVA 3RPFC 3X0WA 4ZDVA 4DDID 3DWMA 4PK1A 2MBEA 3KH0A 4XWTA 1C76A 4CHKA 2V4IB 2O6VA 2PPHA 4MGYE 3DOWA 4FJZA 1Q1OA 5HI1A 1HZ5A 4OZBA 4BBNC 5LXHA 1F1HA 2N7JA 1ZXIA 2WXIA 3ENEA 1V6EA 4RGOS 3NVYA 3IT4B 4FBJB 4IDIA 4HDOA 3PS6A 1SF0A 1WF9A 1DYQA 2WXQA 1HXYD 1TKGA 2CS4A 3IT6B 2N9LA 1GOZA 3H7PB 3VR9B 2KO3A 2X8XX 4S0RA 1GUAB 4MM3B 5JZEB 1E10A 1MI0A 5CHVC 1UH6A 3ML9A 3FKYA 4KIKA 2PKOA 4C56C 4M00A 1TZOA 1WFYA 3DBRI 3RNGC 3KYDD 1E8XA 1WMHA 2LRUA 3PO0A 2FNJB 4WIPA 1RYJA 1H8CA 2FCSA 4KDLB 2DLBA 4JWUC 2JXXA 1HZ6A 3HHMA 4DBGA 2V9HA 2EMTA 4ANXA 3ZXRA 2IZVB 2WXLA 2LASA 3B08A 3H9DA 3HVDA 1K51A 4K7UA 2ASQA 5DPWA 1WRDB 1WY8A 2KX3A 1XEEA 2J4XA 4NQLB 4KVGB 1Q10A 4EEWA 3VRBB 1YJIA 2JU6X 1WGHA 1HQRD 1VD2A 2DYOA 2KDEB 1WXSA 2H88B 4G0NB 2KMCA 1MG4A 4GB9A 4KGRA 5J2RA 4C00A 3I5JC 2KLCA 4KX6B 2K6DB 2BB6A 4GIVA 4XYCA 3Q2AC 4MGZE 4DXFA 5C2TB 1XLPA 1ZDVA 3BY4B 3ALBA 2MEKA 4ANUA 2JYEA 4AOFA 1TKYA 1PGAA 2OHFA 3ZUNA 1GB4A 1V1PA 2FAZA 5EE9A 2XN9C 4IM0A 1J0GA 4HK2A 3UIPB 1ZPSA 2W82A 2PVGC 1XLQA 2PVOD 1VDVA 5CHWA 1E7PB 3GE3C 4J6IA 3W1SA 4NY0A 3DWGC 4ZRQA 2M8SA 1JQ4A 4FHKA 1EF5A 2JQRB 1EO6A 3A9JA 1IGCA 3RNAC 2OOBB 2JVCA 1PQSA 4W9IA 4KSKC 2K8BA 3KLSX 1RLFA 1G6JA 1GB1A 2M17A 2W54A 3WANA 3AEEB 3ZGZA 3JSVB 4BAXA 1L0VB 3ZJVA 4NJ7A 4KKJA 2MJ3A 3JYUA 2KN4A 4IWOA 4C7YA 4HCNB 3UF8A 1JWMD 3GZNI 4II3B 1QKZA 4I6NB 2HDEA 5DPSA 2C7HA 4B0EA 1FIQA 1C9FA 4F7ZA 4LDTB 2G1EA 1XD3B 4GDKA 3NS8A 3CF6E 3UGBB 4AJWA 3PHXB 1XT9B 2LRWA 2ZZPB 4N9F4 5L83A 4REZA 4ICUA 4B0MA 2NPTA 1MG8A 4W9CA 1Q0WB 4RF1A 2R2OA 1WSPA 1HEZE 2AL3A 3NZ3A 4HEA1 3W9CB 3AEAB 2CHXA 2L0TA 4ITKA 1JROA 4BVUC 2BYFA 3RN9C 4MSMB 3ONSA 1DOIA 4AUQC 3AEGB 3AE9B 3EUB2 3VUYA 1EUVB 4KDIC 1TY0A 1ESFA 2KC2A 2WDTB 2KWVB 4MT5A 1FNVA 3TEYA 5G5GA 2V1YA 3AEBB 2UWQA 4LDTD 1GPXA 1E7VA 1ZE3D 2BKRB 2RR9A 2JWZA 1SJED 2G4SA 2GBKA 4HCPB 3VTUA 2UU7A 2O2VB 4GU2A 3WA0A 2DZIA 1ACCA 1WRIA 1TIFA 3I9V1 5BYQA 3GOEA 1OTRB 2WU2B 3DHHC 4Q2JA 2R2QA 2N1WA 2QILA 3NUHB 3GS2A 2QMTA 4FN2A 4ZOHC 2MBBB 5JHAA 3J9CA 2KDMA 3RNBC 3FILB 3AEDB 4R3DA 4RH6A 1FFVA 3A4SC 3Q8BA 1Z5SB 1L2NA 2WXPA 2QC8A 2KTFA 2KZRA 2Y5BB 3TMPB 4ANVA 4C80A 2IY0B 2NMQA 2XK5A 2LXCA 3AECB 1WIAA 2G4DB 2KMMA 1N63A 1V2YA 2PIAA 2WDQB 3WALA 3T9LA 1TGZB 1WM3A 1SB3C 5BMGA 2BVCA 1HA5A 2KFJA 3RI7C 1WGKA 5JXVA 1L6UA 3P42A 3Q3JA 1TS4A 3VH4B 3L4PA 1C4CA 2HTME 3K9OB 4US8A 4PS3A 2CHWA 3R2IA 5MPOA 4TKNA 2VH2A 1MPEA 2QJLA 1YN5A 2NCNA 3AE1B 2Z59B 4WAAA 1WGYA 2LFIA 2ON8A 2LGXA 4YTPB 2A4ZA 2LMCA 1P7FA 3ZNHB 4TQ1A 2FE8A 4EOYA 2K39A 2HD5B 1ZGUB 2GB1A 2WWZA 4HWIB 2L3ZA 4WWOA 1OGWA 2N0SB 2K1FA 3M63B 5EE3A 1TS2A 4L1BA 4WJPA 1YN4A 2KDFB 4WAFA 1J8CA 1KFYB 5EE1A 3DBSA 3AE3B 4XE0A 2DZKA 3PRZA 1NDDA 2BWFA 2LEKA 4DXGA 2B76B 4OZCA 1D4BA 2MQJA 3AE4B 1PGXA 1CMXB 3PRMB 3KWVA 3U2SC 2JT4B 2CR5A 3L0WB 1D5ZC 3S2AA 2WDVB 2LHEA 4YSYB 2INCC 1LO5D 2AWTA 3QWZB 2WXGA 4EZLA 3UI3A 4ACFA 2WP9B 4WURA 3AE2B 2BYVE 1F0ZA 2IGGA 2K8CA 4P7IA 2MRPA 4EUTA 2WXOA 1BUIC 1YMHE 4KGTA 3URYA 1N62A 1QT9A 3UIOB 2JUOA 3VUWA 5D2MB 5IA7A 1MHXA 1VZ7A 3R3MA 2IO0B 1IYFA 3V6CB 4HKQA 2KKCA 1PYWD 4WWMA 5C23A 2BB5A 2GBNA 1I4GA 2KJ6A 2Z0EB 4N6EB 1VLBA 4W9LA 4M0WB 4ZHOA 2KWDA 4GLSC 4OVVA 4P1BC 4X57B 1P3QU 3ZNGC 1EWCA 2X38A 4GXBA 2FIDA 1YIWA 2N9PC 3OLMD 4RCOA 3SDLC 2KTRB 1NBFC 3BK2A 1WJ4A 3SHQA 4I6LB 4EZJA 4IWQA 1J7BA 3N20C 2FUG1 2V4LA 3PLUA 3MP9A 2KX0A 3QCAA 2DZMA 2V0GA 4AQ7A 5C1ZA 2RGFA 1QQRA 3DVNU 4A3OA 3GP7A 2JZ3B 4RNAA 4RF0A 3NVWA 1LQBA 1F52A 2D10A 2QIEB 4OZAA 1AWDA 3IXSA 2TSSA 1K50A 2LZ6A 1L0XB 2C5LC 4F8CB 1WZ3A 3KW5B 1J19A 2VZKD 4IW0A 4RM8A 5CX3A 1OEYJ 2D3GA 5IO9A 4DWFA 3M95A 3Q8EA 2D5GA 1P7EA 5H8YE 3B1LX 1DOXA 2CHZA 1L0YB 4TUUA 1FPYA 3RCZA 3OJ4B 3KUCB 4E71A 3L16A 1IBXB 2HE7A 1UBIA 4FADA 2Y5PA 1V49A 2KT7A 4JE3B 2AX5A 3A9KA 2W55A 3W2DA 2QDFA 3TEZA 4BZAA 2I1KA 3GE8C 2GBMA 1YJ1A 3RYTA 5D6JB 2WXJA 1UZXB 2LD9A 3EFCA 1AW7A 5HKHA 2FCQA 3N1ZC 2AL6A 3T3NA 2FBWB 2WX0A 5GXGB 2DHZA 3ZTCA 4XGAB 4ZYNA 4US9A 1GAQB 1XCTL 5IKCM 1X1MA 3AE5B 1CK1A 4DDGD 3ZNID 1C4PA 2NBUA 2LI5A 1OEYA 3DBHB 1UGJA 2EELA 2DBYA 3HVZA 1C79A 4AWJA 2PEAA 4A6QA 5J18A 2LGIA 3H1UA 1NYQA 2IO1B 4KZCA 4C4VB 3RULA 3X23A 1Y8RC 2NS5A 1KTKA 2ZPNA 2D3AA 2R61A 2IY1B 2L32A 3CIRB 1QILA 3ZXVA 2GOWA 4H2AA 3APCA 3R2TA 1E7UA 2GLSA 1GC7A 1D5XC 5D94A 3NRZA 1J7CA 2E3TA 1I42A 4ZRPA 4GN1A 1VZ8A 2K8HA 1VJKA 1YQBA 2ACZB 3VVWB 2IJ0A 4BFRA 3A1QA 5LXIB 3MHSD 3PPAA 3DVGX 2ZVOA 4XX5A 1KRHA 5G5HA 4MH8A 3BIID 1XLOA 1XQQA 2ZJDA 1UELA 3AMZA 5L95C 3N3KB 2M0AA 2RDGA 3AU5A 5BO4B 3WAOA 4OW0A 3DVNV 3P1MA 2K22A 2BS4B 2PE9A 2JF5A 5FKAC 4HVBA 1V97A 3HK0A 4F1SA 3MJ5A 3RNFC 1Y56A 4HXDA 3MC0B 2BS2B 4USAA 5DCNA 2WXHA 1GG3A 3U4EG 2QCZA 3IVFA 4E74A 1JWUD 2KFKB 3H6NA 2UYZB 2LGDA 4RGNA 3RZFA 2J42A 1WX7A 4B6WA 3QK0A 2XNAC 2CJNA 3AE6B 1EWYC 2JWUA 4NAWA 4K7SA 3P4SB 4BKTA 2N7DA 3L54A 4LNOA 1ISNA 2GBRA 3DPDA 1JALA 4DHJD 1FXAA 1PFDA 5E6PA 2BF8B 4OVUA 4WQOB 3KUZA 4AS1A 5JH5C 2JZPA 3CMMB 1UUPA 1V81A 4XDCA 2OJWA 2SAKA 1SBBB 1HTQA 4HLEA 2N9EB 1WYGA 2ZVNA 1EF1A 5LNK1 2KNBA 2J53A 4HPPA 2BYEA 2MLBA 1FRRA 3BINA 2WLBA 3NZSA 1LXDA 1D5MC 3AV8A 3BWUD 4FULA 1N6ZA 5AUIA 1TZ1A 3ML8A 1D3ZA 1SJHD 3Q3OC 2M4NA 3KYCD 4GDLB 2V3PA 4A9AA 2MP2B 5TR5A 3N9YC 2CJOA 2DX5B 3NG0A 2HJ1A 2DZJA 2K3UA 3MFGA 5T8IA 1H4RA 3HUIA 1WJUA 2MSED 2OJRA 2A5UA 1LGRA 1M94A 1C1YB 3OJ3A 3M62B 2YEPB 3L13A 5E6JA 3U7ZA 4ZRJA 1JMLA 4CYEA 4HRSA 5BMIA 4YTNB 1WR6E 4TSSA 2PW9A 2DENB 2QHOA 4XC2A 3VDZA 2BQQA 1RRBA 2NTTA 1MFWA 4W9FA 2KQ7A 1S1QB 2ZPYA 1TTNA 3V62A 1VCBA 2L52A 2IO3B 1K53A 2BKFA 2JRIB 4K3BA 1FD6A 3ETRA 2FCNA 3HM3A 4E3CA 2ZCCA 3Q3MC 3UQBA 1WWTA 3KUDB 4ZHPA 1E8YA 4PT5A 2L7RA 5H92C 3EA6A 1UWMA 3R8BA 4CQNA 2NBVB 1WM2A 3DHGC 1EU4A 4N59A 4MGIE 3IBEA 2K9XA 2QSDA 1N5XA 3W5VB 3RFZB 2J52A 2KHWB 2WDRB 1N60A 2KN5A 5KHOA 3H7PA 3CSTA 1TS3A 2BWES 1M4VA 4MM3A 2RDHA 5J17A 4LCDE 2SEBD 3O65B 1MVKA 1NYRA 3NJTA 1FCCC 1AYFA 4G50A 3B2GA 1T5XD 1WYWB 3AE7B 3KWLA 4K1RB 4BKGA 1KM7A 1WI0A 3A9KB 3C0RB 2MWSB 4W9EA 2PJHA 2O6VB 3DBLB 3LXFA 3VQIA 1KLGD 4W9GA 3U7DA 4XZ4A 1KJTA 2YEPF 4DHZE 3ABVB 4BKSD 2N4FA 3PTFC 2MX2A 4B95A 1JWSD 1OQYA 1K8RB 2H89B 4EE2A 1UBQA 2KVRA 3PLVA 1OQQA 3IFWB 3N30A 3OAWA 3W1SC 1FMAD 1YX5B 2M19A 1QOGA 2LJIA 3PV1A 3ECIA 2O6VD 4MACA 4AP4C 4KIKB 1TS5A 1KF6B 2MHJA 2QEJC 2INDC 3O13A 1F9JA 4L2YA 3AN1A 1WMHB 1F2RC 2G9HD 2C9WB 1KLUD 3QAQA 1IUEA 1V1OA 3L17A 2LJ5A 2C7NB 1VR9A 3ZJTA 2KLGA 3PRPB 4BOZB 3VTWA 2WGSA 3PZ7A 5AEKB 1I4PA 3AM9A 3RT3B 1T6BX 1WR1A 4D2KA 4NZLB 1WZ0A 4M01A 4EKUA 1E0ZA 1EU3A 1UD7A 5D3IB 3DDCB 1I4RA 1ET9A 1P1AA 4FLHA 4MDKE 2JX5A 2KXJA 4ANWA 2WS3B 5E6OA 4M02A 3ZIMA 1E9MA 1C3TA 2L76A 2LHDA 2LGYA 1XF5L 2ZW1A 3B9JA 2WXNA 4K81A 3BVZA 3DCGA 2PMVA 3QX1A 1KLVA 2PLPA 2BS3B 3DBHI 2N9XA 4W9HA 5HHDG 3ZJUA 5G2NA 3JSVA 2MH7A 4LNFA 3UQAA 2CKHB 4JPSA 2JYTA 5HFYA 2K25A 4JGHB 1RWSA 1SE3A 4YT0B 2KWUB 1K52A 1TT5B 2LVPA 2IGDA 3V6EB 1V1PB 4W9DA 1ZP0B 4URKA 2VRRB 1R4MB 4L23A 2DAJA 2EMSA 3P4RB 3JVZX 3VR8B 1V9JA 3Q14C 2BW2A 2VZKB 4MELA 3A9JB 3BYYB 4NNJB 3Q3FA 4RMAA 3ZTDA 4K7WA 3NS1A 3TJPA 3P4PB 2ZW0A 1GJZA 4MSQB 3C8YA 2MA9B 2GBJA 3QHTA 2GRIA 3VRAB 1ZXHA 2IGHA 3Q8CA 3TBLD 3IHPC 3UINB 3WAMA 3DHIC 2LVOA 1CJEA 3TL5A 3R7RA 2W3RA 2J0MA 3CWIA 3P63A 1ZUD2 4FJVB 2BTEA 1SE4A 5IP4D 2O2VA 1LM8B 2KMAA 4FA6A 2WU5B 2L1AA 1ZKHA 4GDKB 4HJKA 2KACA 2OEDA 3JW0X 3VXWA 2RMMA 2NPTB 4MJSA 1J7AA 1WXMA 1YJJA 4XWWA 1C77A 2L83A 1I4QA 2V3SA 2JSVX 1MJDA 3FILA 2E6XA 3NZUA 3E56A 4IWPA 1DGJA 4IKGA 2BBCA 3VH3B 2DYMA 2Z8LA 3N32A 1WXVA 1BMLC 3N1YC 5DPTA 2ZEQA 2Y3AA 3Q3NC 3WCQA 2D3CA 4ASWC 1TY2A 2FIFA 5C3JB 1ZDXA 3BVGA 2FCMA 1SEBD 4P6VF 5CHFA 1IGDA 4YTMB 2YVCA 1WX8A 1RM6C 3R66C 5CTRC 4I6PA 1R4NB 4P1CC 2AYOB 4JX1C 4YXDB 4WJNA 3VHTC 2AQ2B 4ZRIA 4PS7A 1C4AA 2RD0A 2KDBA 1T0YA 1WXAA 1SE2A 2WXMA 3DQVA 2JXTA 2WHIA 3NY5A 5G55A 3MC9A 4O1NA 3T3OA 2Y5CA 1NEKB 5BYRA 4DQOC 2FUHB 4IG7B 1SSNA 1LFDA 2XK5B 1V8CA 5BYSA 2J0JA 3WIMA 1T0SC 3SFEB 1P0RA 2HJ8A 2KDIA 2MJDA 5IN7A 1I35A 3SU8X 4PYZA 2MBOA 3SEBA 3MC8A 3A33B 4K3CA 3BYTB 2MBHA 4HKZE 5HG2A 4OVZA 2MCNB 3TSSA 2L0FA 2G45B 4LK0M 2KK8A 3QQ8B 4HPMB 4HDQA 1A70A 5KHQA 3TUOA 1WGDA 1D6EC 3PVLA 4DHJB 4WWNA 5EE0A 1GNUA 1PUTA 2ZNVC 4IM2A 3IG3A 2N1VA 2CU1A 1QLBB 3RNEC 1KOTA 1WH3A 3AU4A 3AEFB 2IYDB 3V60A 1XXGA 3SD5A 2IDYA 4KZ0A 2WXRA 1E8ZA 3QIJA 2MW5A 2ONQA 2LVQA 2INPE 2MJEA 4XDDA 2GMIC 3B2FA 3ZNZB 1HE8A 4TV3A 1IP9A 4JWSC 4IOIE 1UNSA 2C7MB 2KVZA 2PTLA 4II2B 3RUIB 1S3SG 3ZKJC 4DK5A 1L7YA 4RGMA 3OG5A 4LTUA 3PREA 4M0WA 2I2YA 3DBLI 4P16A 1RAXA 1WE6A 1XCQL 5AUKA 1B1ZA 1U4AA 5JHBA 4W9KA 1XLNA 3ZVVA 2KTRA 1QOAA 4GSWA 1TJEA 2K0PA 3NVZA 4YSZB 1T3QA 1WGRA 2KWCA 3ZRCA 2HTHA 1N61A 1A5RA 2INNE 4IUMB 3MHZA 4FXCA 4ICVA 1V80A 2IBIB 4WJOA 3Q8FA 3R7QA 1IPGA
chains in the Genus database with same CATH topology
2GI9A 1ROEA 4KKIA 3BK2A 1JWSD 3SR6A 4EE2A 2H89B 1OFFA 1QF6A 1OQQA 1YQ4B 3PO0A 1FMAD 4WIPA 1RYJA 1J7BA 1ENFA 2M19A 1QOGA 2FUG1 2DLBA 4JWUC 1HZ6A 2LJIA 3MP9A 4MACA 2WXLA 1I4HA 3HVDA 1K51A 2V0GA 4AQ7A 1TS5A 1KF6B 1QQRA 1XEEA 2QEJC 3O13A 2J4XA 1AN8A 1Q10A 1IBXA 3VRBB 3P4QB 1YJIA 4L2YA 3GP7A 3AN1A 1F2RC 2G9HD 2JU6X 1KLUD 4RNAA 4RF0A 3NVWA 4HJGE 2W3SA 1C78A 1IUEA 2QIEB 4OZAA 1AWDA 1FEHA 1V1OA 4RFBA 5D3DA 3IXSA 1HQRD 2TSSA 2DYOA 1K50A 1L0XB 4A90A 1VR9A 2H88B 3ZJTA 2WXKA 3OWEB 3PZ7A 2VZKD 4KGRA 2WXFA 1I4PA 3AM9A 3Q8EA 2D5GA 1P7EA 5H8YE 3NVVA 4KX6B 1DOXA 1T6BX 2BB6A 1L0YB 4D2KA 4NZLB 1IBXB 4A8XC 4DXFA 1E0ZA 1EU3A 5C2TB 1XLPA 5D3IB 1I4RA 1ZDVA 1ET9A 2V3NA 2KAJA 2MEKA 5BMHA 3BZDB 3TEWA 2Y5PA 2JX5A 4JE3B 3PZ8A 3W5UB 2AX5A 2JYEA 2LUMA 2WS3B 1B9RA 2W55A 4LLGM 3W2DA 4YSXB 3TEZA 1E9MA 1E6EB 5I4DA 2LHDA 1SXTA 1TKYA 1XF5L 2ZW1A 2WXJA 1PGAA 2OHFA 3B9JA 4J3OD 2WXNA 4TMAB 1N5WA 1QOBA 3V3XA 3BVZA 1AW7A 2PMVA 1GB4A 1V1PA 3BK1A 4C7ZA 1L6VA 2PLPA 2XN9C 5EE9A 2FBWB 3T3NA 3ZYYX 2BS3B 1ZPSA 2RPVA 2W82A 5GXGB 2PVGC 1YN3A 2WQYB 1XLQA 2PVOD 1VDVA 5HHDG 1PDXA 1E7PB 3ZJUA 3W1SA 4ZRQA 3DWGC 2MH7A 1DOYA 4US9A 1JQ4A 1GAQB 1XCTL 1JCKB 2JQRB 4JPSA 3AE5B 4YWGG 1CK1A 2ICIA 1C4PA 1IGCA 2JYTA 5HFYA 1RWSA 1UGJA 1SE3A 2EELA 4YT0B 2DBYA 1K52A 3AE8B 3HVZA 1NI3A 1C79A 3KLSX 2IGDA 1V1PB 4A6QA 1WXQA 5FK9C 3Q8AA 3LYYA 1ZP0B 2LGIA 1GB1A 1NYQA 2W54A 3AEEB 3ZGZA 1KTKA 4L23A 1L0VB 2N9KA 3P4RB 3VR8B 3ZJVA 2R61A 4KKJA 2BW2A 2L32A 2MJ3A 3CIRB 1QILA 1ET6A 2VZKB 4H2AA 3EGRA 3R2TA 3BYYB 1F2RI 2KN4A 1L4DB 1D5XC 3NS1A 4C7YA 3NRZA 2IPKD 1J7CA 3P4PB 2ZW0A 3Q69A 2E3TA 1JWMD 3C8YA 1QKZA 2GRIA 2HDEA 1QOFA 1BXTA 2Q5WD 4B0EA 1FIQA 3VRAB 1C9FA 1NVID 1ZXHA 2IGHA 4ZRPA 1VZ8A 3Q8CA 1L4ZB 2G1EA 1VJKA 2AQ3B 1CZPA 1UWXA 1FM0D 2ACZB 2IJ0A 1JWAD 1FNUA 3IAM1 3V05A 4REZA 1CJEA 4B0MA 1KRHA 2W3RA 5G5HA 1STEA 2K5PA 1TKEA 4MH8A 4RF1A 3CWIA 3BIID 1XLOA 1WSPA 3P63A 1ZUD2 1HEZE 2BTEA 3NZ3A 4HEA1 3W9CB 3AMZA 3AEAB 1SE4A 4ITKA 4WH4A 1JROA 2M0AA 2RDGA 1VRAB 1DOIA 4OW0A 2WU5B 3AEGB 1RFKA 3P1MA 2K22A 3AE9B 3FC4A 2L1AA 3EUB2 2BS4B 4GDKB 1TY0A 1ESFA 2KACA 2OEDA 5FKAC 1YNTE 4MT5A 3TEYA 1FNVA 1ZOYB 1V97A 5G5GA 3AEBB 2RMMA 1GPXA 4OHJA 3MJ5A 1ZE3D 1Y56A 3E9SA 4RGTA 1J7AA 3MC0B 2BS2B 4USAA 2CU3A 2WXHA 3TEXA 2I38A 2EKIA 3U4EG 1SJED 1YJJA 1JWUD 4XWWA 4NJCA 1C77A 2L83A 1I4QA 4RGNA 1JRPA 2JSVX 2J42A 3FILA 2E6XA 2CJNA 2XNAC 3AE6B 1EWYC 1TYGB 4N58A 2JWUA 3E56A 1DGJA 2DWQA 3I57A 1ACCA 1WRIA 2M56B 4IKGA 3P4SB 5TSSA 2BBCA 4NAMA 2DYMA 2Z8LA 3I9V1 1BMLC 5BYQA 2WU2B 4Q2JA 4ARIA 2Y3AA 1JALA 1FXAA 1PFDA 1KH0A 2QILA 3NUHB 4AS1A 2JZPA 3WCQA 1PGBA 3GS2A 1UUPA 2QMTA 2AQ1B 4ZOHC 1TY2A 2BYTA 5C3JB 1ZDXA 3BVGA 3J9CA 4XDCA 2KDMA 3FILB 1SEBD 4P6VF 2SAKA 1SBBB 3AEDB 3FAHA 4R3DA 4RH6A 1FFVA 3AH7A 3Q8BA 1IGDA 4NAWB 2WXPA 4YTMB 1WYGA 3AB5A 4A55A 5LNK1 1RM6C 2NTSA 4C80A 2J53A 1EM7A 2NMQA 1R7SA 1OQRA 1FRRA 2WLBA 4JX1C 1D5MC 1L5PA 3AECB 4YXDB 3AV8A 3BWUD 4TQ0A 2KMMA 1N63A 2AQ2B 2PIAA 2BT6A 5AUIA 3HRDD 2WDQB 3H8HA 1SJHD 1C4AA 1SB3C 5BMGA 1HA5A 2WXMA 1SE2A 2JXTA 1WGKA 5JXVA 1L6UA 3P42A 1YQ3B 3SFDB 1TS4A 4GDLB 2V3PA 4O1NA 4A9AA 3L4PA 4ZYSA 4ARCA 3T3OA 3N9YC 1C4CA 2HTME 2Y5CA 2CJOA 1NEKB 1I7HA 5BYRA 4DQOC 1FRDA 4US8A 2KQ4X 3R2IA 5MPOA 1SSNA 3MFGA 2K3UA 5T8IA 1V8CA 1VZ6A 5BYSA 1MPEA 2QJLA 1YN5A 3AE1B 3HUIA 3SFEB 2WNMA 2MJDA 2LFIA 1JW9D 1XO3A 3BVMA 2YEPB 5E6JA 1FXIA 2ON8A 3SEBA 4YTPB 3U7ZA 1JMLA 1FNWA 2LMCA 1MHHE 3KQ4A 3LB8C 5FR3A 4HRSA 5BMIA 1P7FA 3ZQ4A 4TQ1A 3BYTB 2FE8A 4YTNB 5D7GA 1FFUA 4HKZE 1FO4A 5HG2A 4OVZA 4TSSA 4HROA 2PW9A 3TSSA 2GB1A 3U52E 4LK0M 2NTTA 1SIJA 1A70A 3TUOA 4WQMA 1D6EC 2N0SB 2L52A 5EE0A 1K53A 5EE3A 1PUTA 1TS2A 1FD6A 4L1BA 3ETRA 1YN4A 4WAFA 1QLBB 1KFYB 5EE1A 3AE3B 4XE0A 3AEFB 2LEKA 1WWTA 4DXGA 1F77A 1XXGA 4ZHPA 2IDYA 4PT5A 2B76B 4OZCA 1D4BA 2WXRA 5H92C 3AE4B 3EA6A 1I4XA 1PGXA 1UWMA 3KWVA 3R8BA 3U2SC 4CQNA 1FCLA 4UDUC 4KGSA 1NENB 2ONQA 1D5ZC 1EU4A 2WDVB 2INPE 2MJEA 4XDDA 2LHEA 3GB1A 3B2FA 1JWBD 4N59A 4YSYB 1LO5D 2K9XA 3IAS1 1CQVA 2QSDA 4JWSC 4IOIE 2WXGA 1N5XA 1UNSA 3W5VB 3RPFC 3RFZB 2J52A 2WDRB 3UI3A 2PTLA 3DWMA 4XWTA 1C76A 2V4IB 2WP9B 1N60A 4WURA 3AE2B 1F0ZA 1TS3A 2IGGA 1M4VA 5HI1A 4RGMA 2RDHA 1HZ5A 2WXOA 2SEBD 4LTUA 4OZBA 1MVKA 1NYRA 1BUIC 2N7JA 1ZXIA 2WXIA 1FCCC 1AYFA 1YMHE 4KGTA 4M0WA 1N62A 3NVYA 4RGOS 3URYA 3B2GA 1T5XD 2I2YA 1QT9A 3IT4B 4P16A 4IDIA 1SF0A 1XCQL 1DYQA 1MHXA 5AUKA 1B1ZA 1HXYD 1TKGA 2WXQA 3AE7B 3KWLA 1XLNA 1QOAA 1VZ7A 3IT6B 2N9LA 1TJEA 2K0PA 3NVZA 4YSZB 1GOZA 1T3QA 4HKQA 3LXFA 1PYWD 3VR9B 4WWMA 3VQIA 2BB5A 1KLGD 4MM3B 1E10A 1N61A 1I4GA 1MI0A 2INNE 3MHZA 4FXCA 4N6EB 2YEPF 1VLBA 4ZHOA 2KWDA 4GLSC 3ABVB 2PKOA 1EWCA 2X38A 3Q8FA 4C56C 4RCOA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEE A;  2K3U A; 
#chains in the Genus database with same CATH topology
 2GI9 A;  1E8W A;  1ROE A;  3KVF B;  4KKI A;  2KOX A;  2W9N A;  3SR6 A;  2BPS A;  1OFF A;  1QF6 A;  1YQ4 B;  2XEW A;  2DNF A;  3D32 A;  1ENF A;  2L00 B;  4GMV A;  4MH0 E;  3DBR B;  4QAY A;  1I4H A;  2KD0 A;  4NQK E;  3TIX A;  2XBB C;  1AN8 A;  4WJQ A;  4YL8 A;  1IBX A;  2ZNV B;  2I1J A;  3P4Q B;  2G3Q B;  4MGK E;  2NVU I;  3B0A A;  2PE6 B;  1SGH A;  3PZD A;  4HJG E;  2W3S A;  1C78 A;  4W9J A;  5D3D A;  1FEH A;  4RFB A;  2RDB C;  3M3J A;  4A90 A;  1TBE A;  2WXK A;  3OWE B;  2WXF A;  3NVV A;  2KYW A;  4BBN F;  2VH1 A;  4A8X C;  3AXC A;  1GC6 A;  4GOC A;  3QA8 A;  2MBQ A;  4B9K A;  3AI5 A;  2KAN A;  3VFK A;  2V3N A;  3LJ3 A;  2KAJ A;  4JL9 A;  5BMH A;  3BZD B;  5AZH A;  3TEW A;  3EC8 A;  3RMK C;  3PZ8 A;  3W5U B;  4A3P A;  2LUM A;  1B9R A;  4LLG M;  4YSX B;  1HTO A;  1E6E B;  3ZRF A;  5I4D A;  2KQS A;  1SXT A;  2LGS A;  4J3O D;  2RSU A;  3EEC A;  4TMA B;  1N5W A;  1QOB A;  3V3X A;  3BK1 A;  4C7Z A;  1L6V A;  4MJS B;  3ZYY X;  2RPV A;  1YN3 A;  2WQY B;  1RFA A;  3TCA A;  1WE7 A;  2JY6 A;  1PDX A;  4C4V A;  3MTN B;  5AZF A;  2NR2 A;  3RNC C;  1DOY A;  1JCK B;  4YWG G;  4WWP A;  2ICI A;  3APF A;  1QZE A;  4KSL C;  4KV2 A;  1R4M I;  1YOV B;  3AE8 B;  4LJP B;  1NI3 A;  1Q5W B;  2M0X A;  1WXQ A;  4LNI A;  5FK9 C;  3Q8A A;  4RM9 A;  3APD A;  3LYY A;  1WX9 A;  3I3T B;  3U8Z A;  2K6Q A;  3AUL A;  4BOS C;  2N9K A;  3N1X C;  3I63 C;  3PHW B;  4JIO U;  1ET6 A;  3LDZ E;  3EGR A;  1F2R I;  1L4D B;  2JPH A;  5DPR A;  2IPK D;  4G3X B;  3Q69 A;  2D11 A;  3P2B A;  4JQW C;  5LLI A;  5IOI A;  1QOF A;  1BXT A;  2Q5W D;  1NVI D;  3ZDM C;  1L4Z B;  2AQ3 B;  1CZP A;  3PT2 B;  1UWX A;  1FM0 D;  1WGG A;  3QAR A;  1Z2M A;  1JWA D;  1FNU A;  3IAM 1;  3V05 A;  3GZN B;  1SIF A;  1STE A;  2K5P A;  1TKE A;  4FJY A;  4DHZ B;  2L05 A;  2RPQ A;  2Z0D B;  1E5W A;  3RD2 A;  3T8M A;  2KFK A;  4WH4 A;  3PSE B;  1VRA B;  2D3B A;  1P9D U;  1RFK A;  5AZG A;  2BGF A;  3FC4 A;  1YD8 U;  5E6N A;  1WJN A;  3A1Q B;  1YNT E;  1ZOY B;  4OHJ A;  3ZLZ A;  3E9S A;  4RGT A;  4EZK A;  2ZCB A;  1T0R C;  2CU3 A;  3TEX A;  2DAF A;  2I38 A;  1T0Q C;  4S17 A;  4ZRK A;  2EKI A;  1SE9 A;  3CSF A;  4NJC A;  1UGM A;  3EFU A;  1JRP A;  3VUX A;  3K9P B;  1TYG B;  4N58 A;  2DWQ A;  3I57 A;  2M56 B;  5TSS A;  4NAM A;  4G11 A;  4FHJ A;  1V86 A;  4ARI A;  4PYU A;  3ZDT A;  3NHE B;  1KH0 A;  4M8N A;  1PGB A;  2KJH B;  2AQ1 B;  2BYT A;  1R4N I;  2LWP A;  2YLM A;  1V5T A;  4AJY B;  3A4R A;  4GDL A;  2JZZ A;  2MP2 A;  3Q6B A;  3C19 A;  3FAH A;  3ZW3 A;  2LXA A;  3AH7 A;  2B3A A;  4NAW B;  4GGQ A;  3AB5 A;  4A55 A;  2WYQ A;  2NTS A;  1EM7 A;  1R7S A;  1OQR A;  3ZO5 B;  2REX A;  2L8J A;  1L5P A;  1NI2 A;  1BT0 A;  4NPN A;  4TQ0 A;  1UF0 A;  4A20 A;  2BT6 A;  3EHV A;  3U30 A;  3HRD D;  5EDS A;  3H8H A;  3PGE A;  3RZW C;  4M8M A;  1YQ3 B;  3SFD B;  4ZYS A;  4ARC A;  3HM6 X;  4LJO B;  1I7H A;  1FRD A;  2KQ4 X;  1FXT B;  3NOB A;  3V61 A;  1YX6 B;  1VZ6 A;  4DXA B;  3W1Y A;  4HPL B;  1AAR A;  2WNM A;  2D07 B;  1JW9 D;  1XO3 A;  3BVM A;  3L10 B;  1JRU A;  2N7E A;  2KC1 A;  1FXI A;  4MEM A;  1ZW7 A;  3QC8 B;  1FNW A;  3KQ4 A;  1MHH E;  3LB8 C;  4IC7 B;  5FR3 A;  3ZQ4 A;  5D7G A;  1FFU A;  2M1M A;  2KJR A;  1FO4 A;  2EKE C;  1P98 A;  4HRO A;  2D2Q A;  3U52 E;  1WJ6 A;  1SIJ A;  2AEH A;  3VTV A;  4WQM A;  3DVG Y;  5FR6 A;  3MJW A;  4EFO A;  3WAP A;  3H7S A;  4JLC A;  2IO2 B;  3L08 A;  4LNK A;  5IAA C;  3VAW A;  1V5O A;  1F77 A;  2JRH A;  4BKS A;  2NBW B;  4PS8 A;  1E90 A;  2C60 A;  2WX1 A;  4NJ6 A;  4IM3 A;  3QJZ A;  1I4X A;  4LNN A;  1FCL A;  3HIZ A;  4UDU C;  2DYB A;  4KGS A;  1NEN B;  2J7Q B;  2J0K A;  2LUE A;  4CO7 A;  3GB1 A;  5GMV A;  1JWB D;  3IAS 1;  1CQV A;  3RPF C;  3X0W A;  4ZDV A;  4DDI D;  3DWM A;  4PK1 A;  2MBE A;  3KH0 A;  4XWT A;  1C76 A;  4CHK A;  2V4I B;  2O6V A;  2PPH A;  4MGY E;  3DOW A;  4FJZ A;  1Q1O A;  5HI1 A;  1HZ5 A;  4OZB A;  4BBN C;  5LXH A;  1F1H A;  2N7J A;  1ZXI A;  2WXI A;  3ENE A;  1V6E A;  4RGO S;  3NVY A;  3IT4 B;  4FBJ B;  4IDI A;  4HDO A;  3PS6 A;  1SF0 A;  1WF9 A;  1DYQ A;  2WXQ A;  1HXY D;  1TKG A;  2CS4 A;  3IT6 B;  2N9L A;  1GOZ A;  3H7P B;  3VR9 B;  2KO3 A;  2X8X X;  4S0R A;  1GUA B;  4MM3 B;  5JZE B;  1E10 A;  1MI0 A;  5CHV C;  1UH6 A;  3ML9 A;  3FKY A;  4KIK A;  2PKO A;  4C56 C;  4M00 A;  1TZO A;  1WFY A;  3DBR I;  3RNG C;  3KYD D;  1E8X A;  1WMH A;  2LRU A;  3PO0 A;  2FNJ B;  4WIP A;  1RYJ A;  1H8C A;  2FCS A;  4KDL B;  2DLB A;  4JWU C;  2JXX A;  1HZ6 A;  3HHM A;  4DBG A;  2V9H A;  2EMT A;  4ANX A;  3ZXR A;  2IZV B;  2WXL A;  2LAS A;  3B08 A;  3H9D A;  3HVD A;  1K51 A;  4K7U A;  2ASQ A;  5DPW A;  1WRD B;  1WY8 A;  2KX3 A;  1XEE A;  2J4X A;  4NQL B;  4KVG B;  1Q10 A;  4EEW A;  3VRB B;  1YJI A;  2JU6 X;  1WGH A;  1HQR D;  1VD2 A;  2DYO A;  2KDE B;  1WXS A;  2H88 B;  4G0N B;  2KMC A;  1MG4 A;  4GB9 A;  4KGR A;  5J2R A;  4C00 A;  3I5J C;  2KLC A;  4KX6 B;  2K6D B;  2BB6 A;  4GIV A;  4XYC A;  3Q2A C;  4MGZ E;  4DXF A;  5C2T B;  1XLP A;  1ZDV A;  3BY4 B;  3ALB A;  2MEK A;  4ANU A;  2JYE A;  4AOF A;  1TKY A;  1PGA A;  2OHF A;  3ZUN A;  1GB4 A;  1V1P A;  2FAZ A;  5EE9 A;  2XN9 C;  4IM0 A;  1J0G A;  4HK2 A;  3UIP B;  1ZPS A;  2W82 A;  2PVG C;  1XLQ A;  2PVO D;  1VDV A;  5CHW A;  1E7P B;  3GE3 C;  4J6I A;  3W1S A;  4NY0 A;  3DWG C;  4ZRQ A;  2M8S A;  1JQ4 A;  4FHK A;  1EF5 A;  2JQR B;  1EO6 A;  3A9J A;  1IGC A;  3RNA C;  2OOB B;  2JVC A;  1PQS A;  4W9I A;  4KSK C;  2K8B A;  3KLS X;  1RLF A;  1G6J A;  1GB1 A;  2M17 A;  2W54 A;  3WAN A;  3AEE B;  3ZGZ A;  3JSV B;  4BAX A;  1L0V B;  3ZJV A;  4NJ7 A;  4KKJ A;  2MJ3 A;  3JYU A;  2KN4 A;  4IWO A;  4C7Y A;  4HCN B;  3UF8 A;  1JWM D;  3GZN I;  4II3 B;  1QKZ A;  4I6N B;  2HDE A;  5DPS A;  2C7H A;  4B0E A;  1FIQ A;  1C9F A;  4F7Z A;  4LDT B;  2G1E A;  1XD3 B;  4GDK A;  3NS8 A;  3CF6 E;  3UGB B;  4AJW A;  3PHX B;  1XT9 B;  2LRW A;  2ZZP B;  4N9F 4;  5L83 A;  4REZ A;  4ICU A;  4B0M A;  2NPT A;  1MG8 A;  4W9C A;  1Q0W B;  4RF1 A;  2R2O A;  1WSP A;  1HEZ E;  2AL3 A;  3NZ3 A;  4HEA 1;  3W9C B;  3AEA B;  2CHX A;  2L0T A;  4ITK A;  1JRO A;  4BVU C;  2BYF A;  3RN9 C;  4MSM B;  3ONS A;  1DOI A;  4AUQ C;  3AEG B;  3AE9 B;  3EUB 2;  3VUY A;  1EUV B;  4KDI C;  1TY0 A;  1ESF A;  2KC2 A;  2WDT B;  2KWV B;  4MT5 A;  1FNV A;  3TEY A;  5G5G A;  2V1Y A;  3AEB B;  2UWQ A;  4LDT D;  1GPX A;  1E7V A;  1ZE3 D;  2BKR B;  2RR9 A;  2JWZ A;  1SJE D;  2G4S A;  2GBK A;  4HCP B;  3VTU A;  2UU7 A;  2O2V B;  4GU2 A;  3WA0 A;  2DZI A;  1ACC A;  1WRI A;  1TIF A;  3I9V 1;  5BYQ A;  3GOE A;  1OTR B;  2WU2 B;  3DHH C;  4Q2J A;  2R2Q A;  2N1W A;  2QIL A;  3NUH B;  3GS2 A;  2QMT A;  4FN2 A;  4ZOH C;  2MBB B;  5JHA A;  3J9C A;  2KDM A;  3RNB C;  3FIL B;  3AED B;  4R3D A;  4RH6 A;  1FFV A;  3A4S C;  3Q8B A;  1Z5S B;  1L2N A;  2WXP A;  2QC8 A;  2KTF A;  2KZR A;  2Y5B B;  3TMP B;  4ANV A;  4C80 A;  2IY0 B;  2NMQ A;  2XK5 A;  2LXC A;  3AEC B;  1WIA A;  2G4D B;  2KMM A;  1N63 A;  1V2Y A;  2PIA A;  2WDQ B;  3WAL A;  3T9L A;  1TGZ B;  1WM3 A;  1SB3 C;  5BMG A;  2BVC A;  1HA5 A;  2KFJ A;  3RI7 C;  1WGK A;  5JXV A;  1L6U A;  3P42 A;  3Q3J A;  1TS4 A;  3VH4 B;  3L4P A;  1C4C A;  2HTM E;  3K9O B;  4US8 A;  4PS3 A;  2CHW A;  3R2I A;  5MPO A;  4TKN A;  2VH2 A;  1MPE A;  2QJL A;  1YN5 A;  2NCN A;  3AE1 B;  2Z59 B;  4WAA A;  1WGY A;  2LFI A;  2ON8 A;  2LGX A;  4YTP B;  2A4Z A;  2LMC A;  1P7F A;  3ZNH B;  4TQ1 A;  2FE8 A;  4EOY A;  2K39 A;  2HD5 B;  1ZGU B;  2GB1 A;  2WWZ A;  4HWI B;  2L3Z A;  4WWO A;  1OGW A;  2N0S B;  2K1F A;  3M63 B;  5EE3 A;  1TS2 A;  4L1B A;  4WJP A;  1YN4 A;  2KDF B;  4WAF A;  1J8C A;  1KFY B;  5EE1 A;  3DBS A;  3AE3 B;  4XE0 A;  2DZK A;  3PRZ A;  1NDD A;  2BWF A;  2LEK A;  4DXG A;  2B76 B;  4OZC A;  1D4B A;  2MQJ A;  3AE4 B;  1PGX A;  1CMX B;  3PRM B;  3KWV A;  3U2S C;  2JT4 B;  2CR5 A;  3L0W B;  1D5Z C;  3S2A A;  2WDV B;  2LHE A;  4YSY B;  2INC C;  1LO5 D;  2AWT A;  3QWZ B;  2WXG A;  4EZL A;  3UI3 A;  4ACF A;  2WP9 B;  4WUR A;  3AE2 B;  2BYV E;  1F0Z A;  2IGG A;  2K8C A;  4P7I A;  2MRP A;  4EUT A;  2WXO A;  1BUI C;  1YMH E;  4KGT A;  3URY A;  1N62 A;  1QT9 A;  3UIO B;  2JUO A;  3VUW A;  5D2M B;  5IA7 A;  1MHX A;  1VZ7 A;  3R3M A;  2IO0 B;  1IYF A;  3V6C B;  4HKQ A;  2KKC A;  1PYW D;  4WWM A;  5C23 A;  2BB5 A;  2GBN A;  1I4G A;  2KJ6 A;  2Z0E B;  4N6E B;  1VLB A;  4W9L A;  4M0W B;  4ZHO A;  2KWD A;  4GLS C;  4OVV A;  4P1B C;  4X57 B;  1P3Q U;  3ZNG C;  1EWC A;  2X38 A;  4GXB A;  2FID A;  1YIW A;  2N9P C;  3OLM D;  4RCO A;  3SDL C;  2KTR B;  1NBF C;  3BK2 A;  1WJ4 A;  3SHQ A;  4I6L B;  4EZJ A;  4IWQ A;  1J7B A;  3N20 C;  2FUG 1;  2V4L A;  3PLU A;  3MP9 A;  2KX0 A;  3QCA A;  2DZM A;  2V0G A;  4AQ7 A;  5C1Z A;  2RGF A;  1QQR A;  3DVN U;  4A3O A;  3GP7 A;  2JZ3 B;  4RNA A;  4RF0 A;  3NVW A;  1LQB A;  1F52 A;  2D10 A;  2QIE B;  4OZA A;  1AWD A;  3IXS A;  2TSS A;  1K50 A;  2LZ6 A;  1L0X B;  2C5L C;  4F8C B;  1WZ3 A;  3KW5 B;  1J19 A;  2VZK D;  4IW0 A;  4RM8 A;  5CX3 A;  1OEY J;  2D3G A;  5IO9 A;  4DWF A;  3M95 A;  3Q8E A;  2D5G A;  1P7E A;  5H8Y E;  3B1L X;  1DOX A;  2CHZ A;  1L0Y B;  4TUU A;  1FPY A;  3RCZ A;  3OJ4 B;  3KUC B;  4E71 A;  3L16 A;  1IBX B;  2HE7 A;  1UBI A;  4FAD A;  2Y5P A;  1V49 A;  2KT7 A;  4JE3 B;  2AX5 A;  3A9K A;  2W55 A;  3W2D A;  2QDF A;  3TEZ A;  4BZA A;  2I1K A;  3GE8 C;  2GBM A;  1YJ1 A;  3RYT A;  5D6J B;  2WXJ A;  1UZX B;  2LD9 A;  3EFC A;  1AW7 A;  5HKH A;  2FCQ A;  3N1Z C;  2AL6 A;  3T3N A;  2FBW B;  2WX0 A;  5GXG B;  2DHZ A;  3ZTC A;  4XGA B;  4ZYN A;  4US9 A;  1GAQ B;  1XCT L;  5IKC M;  1X1M A;  3AE5 B;  1CK1 A;  4DDG D;  3ZNI D;  1C4P A;  2NBU A;  2LI5 A;  1OEY A;  3DBH B;  1UGJ A;  2EEL A;  2DBY A;  3HVZ A;  1C79 A;  4AWJ A;  2PEA A;  4A6Q A;  5J18 A;  2LGI A;  3H1U A;  1NYQ A;  2IO1 B;  4KZC A;  4C4V B;  3RUL A;  3X23 A;  1Y8R C;  2NS5 A;  1KTK A;  2ZPN A;  2D3A A;  2R61 A;  2IY1 B;  2L32 A;  3CIR B;  1QIL A;  3ZXV A;  2GOW A;  4H2A A;  3APC A;  3R2T A;  1E7U A;  2GLS A;  1GC7 A;  1D5X C;  5D94 A;  3NRZ A;  1J7C A;  2E3T A;  1I42 A;  4ZRP A;  4GN1 A;  1VZ8 A;  2K8H A;  1VJK A;  1YQB A;  2ACZ B;  3VVW B;  2IJ0 A;  4BFR A;  3A1Q A;  5LXI B;  3MHS D;  3PPA A;  3DVG X;  2ZVO A;  4XX5 A;  1KRH A;  5G5H A;  4MH8 A;  3BII D;  1XLO A;  1XQQ A;  2ZJD A;  1UEL A;  3AMZ A;  5L95 C;  3N3K B;  2M0A A;  2RDG A;  3AU5 A;  5BO4 B;  3WAO A;  4OW0 A;  3DVN V;  3P1M A;  2K22 A;  2BS4 B;  2PE9 A;  2JF5 A;  5FKA C;  4HVB A;  1V97 A;  3HK0 A;  4F1S A;  3MJ5 A;  3RNF C;  1Y56 A;  4HXD A;  3MC0 B;  2BS2 B;  4USA A;  5DCN A;  2WXH A;  1GG3 A;  3U4E G;  2QCZ A;  3IVF A;  4E74 A;  1JWU D;  2KFK B;  3H6N A;  2UYZ B;  2LGD A;  4RGN A;  3RZF A;  2J42 A;  1WX7 A;  4B6W A;  3QK0 A;  2XNA C;  2CJN A;  3AE6 B;  1EWY C;  2JWU A;  4NAW A;  4K7S A;  3P4S B;  4BKT A;  2N7D A;  3L54 A;  4LNO A;  1ISN A;  2GBR A;  3DPD A;  1JAL A;  4DHJ D;  1FXA A;  1PFD A;  5E6P A;  2BF8 B;  4OVU A;  4WQO B;  3KUZ A;  4AS1 A;  5JH5 C;  2JZP A;  3CMM B;  1UUP A;  1V81 A;  4XDC A;  2OJW A;  2SAK A;  1SBB B;  1HTQ A;  4HLE A;  2N9E B;  1WYG A;  2ZVN A;  1EF1 A;  5LNK 1;  2KNB A;  2J53 A;  4HPP A;  2BYE A;  2MLB A;  1FRR A;  3BIN A;  2WLB A;  3NZS A;  1LXD A;  1D5M C;  3AV8 A;  3BWU D;  4FUL A;  1N6Z A;  5AUI A;  1TZ1 A;  3ML8 A;  1D3Z A;  1SJH D;  3Q3O C;  2M4N A;  3KYC D;  4GDL B;  2V3P A;  4A9A A;  2MP2 B;  5TR5 A;  3N9Y C;  2CJO A;  2DX5 B;  3NG0 A;  2HJ1 A;  2DZJ A;  2K3U A;  3MFG A;  5T8I A;  1H4R A;  3HUI A;  1WJU A;  2MSE D;  2OJR A;  2A5U A;  1LGR A;  1M94 A;  1C1Y B;  3OJ3 A;  3M62 B;  2YEP B;  3L13 A;  5E6J A;  3U7Z A;  4ZRJ A;  1JML A;  4CYE A;  4HRS A;  5BMI A;  4YTN B;  1WR6 E;  4TSS A;  2PW9 A;  2DEN B;  2QHO A;  4XC2 A;  3VDZ A;  2BQQ A;  1RRB A;  2NTT A;  1MFW A;  4W9F A;  2KQ7 A;  1S1Q B;  2ZPY A;  1TTN A;  3V62 A;  1VCB A;  2L52 A;  2IO3 B;  1K53 A;  2BKF A;  2JRI B;  4K3B A;  1FD6 A;  3ETR A;  2FCN A;  3HM3 A;  4E3C A;  2ZCC A;  3Q3M C;  3UQB A;  1WWT A;  3KUD B;  4ZHP A;  1E8Y A;  4PT5 A;  2L7R A;  5H92 C;  3EA6 A;  1UWM A;  3R8B A;  4CQN A;  2NBV B;  1WM2 A;  3DHG C;  1EU4 A;  4N59 A;  4MGI E;  3IBE A;  2K9X A;  2QSD A;  1N5X A;  3W5V B;  3RFZ B;  2J52 A;  2KHW B;  2WDR B;  1N60 A;  2KN5 A;  5KHO A;  3H7P A;  3CST A;  1TS3 A;  2BWE S;  1M4V A;  4MM3 A;  2RDH A;  5J17 A;  4LCD E;  2SEB D;  3O65 B;  1MVK A;  1NYR A;  3NJT A;  1FCC C;  1AYF A;  4G50 A;  3B2G A;  1T5X D;  1WYW B;  3AE7 B;  3KWL A;  4K1R B;  4BKG A;  1KM7 A;  1WI0 A;  3A9K B;  3C0R B;  2MWS B;  4W9E A;  2PJH A;  2O6V B;  3DBL B;  3LXF A;  3VQI A;  1KLG D;  4W9G A;  3U7D A;  4XZ4 A;  1KJT A;  2YEP F;  4DHZ E;  3ABV B;  4BKS D;  2N4F A;  3PTF C;  2MX2 A;  4B95 A;  1JWS D;  1OQY A;  1K8R B;  2H89 B;  4EE2 A;  1UBQ A;  2KVR A;  3PLV A;  1OQQ A;  3IFW B;  3N30 A;  3OAW A;  3W1S C;  1FMA D;  1YX5 B;  2M19 A;  1QOG A;  2LJI A;  3PV1 A;  3ECI A;  2O6V D;  4MAC A;  4AP4 C;  4KIK B;  1TS5 A;  1KF6 B;  2MHJ A;  2QEJ C;  2IND C;  3O13 A;  1F9J A;  4L2Y A;  3AN1 A;  1WMH B;  1F2R C;  2G9H D;  2C9W B;  1KLU D;  3QAQ A;  1IUE A;  1V1O A;  3L17 A;  2LJ5 A;  2C7N B;  1VR9 A;  3ZJT A;  2KLG A;  3PRP B;  4BOZ B;  3VTW A;  2WGS A;  3PZ7 A;  5AEK B;  1I4P A;  3AM9 A;  3RT3 B;  1T6B X;  1WR1 A;  4D2K A;  4NZL B;  1WZ0 A;  4M01 A;  4EKU A;  1E0Z A;  1EU3 A;  1UD7 A;  5D3I B;  3DDC B;  1I4R A;  1ET9 A;  1P1A A;  4FLH A;  4MDK E;  2JX5 A;  2KXJ A;  4ANW A;  2WS3 B;  5E6O A;  4M02 A;  3ZIM A;  1E9M A;  1C3T A;  2L76 A;  2LHD A;  2LGY A;  1XF5 L;  2ZW1 A;  3B9J A;  2WXN A;  4K81 A;  3BVZ A;  3DCG A;  2PMV A;  3QX1 A;  1KLV A;  2PLP A;  2BS3 B;  3DBH I;  2N9X A;  4W9H A;  5HHD G;  3ZJU A;  5G2N A;  3JSV A;  2MH7 A;  4LNF A;  3UQA A;  2CKH B;  4JPS A;  2JYT A;  5HFY A;  2K25 A;  4JGH B;  1RWS A;  1SE3 A;  4YT0 B;  2KWU B;  1K52 A;  1TT5 B;  2LVP A;  2IGD A;  3V6E B;  1V1P B;  4W9D A;  1ZP0 B;  4URK A;  2VRR B;  1R4M B;  4L23 A;  2DAJ A;  2EMS A;  3P4R B;  3JVZ X;  3VR8 B;  1V9J A;  3Q14 C;  2BW2 A;  2VZK B;  4MEL A;  3A9J B;  3BYY B;  4NNJ B;  3Q3F A;  4RMA A;  3ZTD A;  4K7W A;  3NS1 A;  3TJP A;  3P4P B;  2ZW0 A;  1GJZ A;  4MSQ B;  3C8Y A;  2MA9 B;  2GBJ A;  3QHT A;  2GRI A;  3VRA B;  1ZXH A;  2IGH A;  3Q8C A;  3TBL D;  3IHP C;  3UIN B;  3WAM A;  3DHI C;  2LVO A;  1CJE A;  3TL5 A;  3R7R A;  2W3R A;  2J0M A;  3CWI A;  3P63 A;  1ZUD 2;  4FJV B;  2BTE A;  1SE4 A;  5IP4 D;  2O2V A;  1LM8 B;  2KMA A;  4FA6 A;  2WU5 B;  2L1A A;  1ZKH A;  4GDK B;  4HJK A;  2KAC A;  2OED A;  3JW0 X;  3VXW A;  2RMM A;  2NPT B;  4MJS A;  1J7A A;  1WXM A;  1YJJ A;  4XWW A;  1C77 A;  2L83 A;  1I4Q A;  2V3S A;  2JSV X;  1MJD A;  3FIL A;  2E6X A;  3NZU A;  3E56 A;  4IWP A;  1DGJ A;  4IKG A;  2BBC A;  3VH3 B;  2DYM A;  2Z8L A;  3N32 A;  1WXV A;  1BML C;  3N1Y C;  5DPT A;  2ZEQ A;  2Y3A A;  3Q3N C;  3WCQ A;  2D3C A;  4ASW C;  1TY2 A;  2FIF A;  5C3J B;  1ZDX A;  3BVG A;  2FCM A;  1SEB D;  4P6V F;  5CHF A;  1IGD A;  4YTM B;  2YVC A;  1WX8 A;  1RM6 C;  3R66 C;  5CTR C;  4I6P A;  1R4N B;  4P1C C;  2AYO B;  4JX1 C;  4YXD B;  4WJN A;  3VHT C;  2AQ2 B;  4ZRI A;  4PS7 A;  1C4A A;  2RD0 A;  2KDB A;  1T0Y A;  1WXA A;  1SE2 A;  2WXM A;  3DQV A;  2JXT A;  2WHI A;  3NY5 A;  5G55 A;  3MC9 A;  4O1N A;  3T3O A;  2Y5C A;  1NEK B;  5BYR A;  4DQO C;  2FUH B;  4IG7 B;  1SSN A;  1LFD A;  2XK5 B;  1V8C A;  5BYS A;  2J0J A;  3WIM A;  1T0S C;  3SFE B;  1P0R A;  2HJ8 A;  2KDI A;  2MJD A;  5IN7 A;  1I35 A;  3SU8 X;  4PYZ A;  2MBO A;  3SEB A;  3MC8 A;  3A33 B;  4K3C A;  3BYT B;  2MBH A;  4HKZ E;  5HG2 A;  4OVZ A;  2MCN B;  3TSS A;  2L0F A;  2G45 B;  4LK0 M;  2KK8 A;  3QQ8 B;  4HPM B;  4HDQ A;  1A70 A;  5KHQ A;  3TUO A;  1WGD A;  1D6E C;  3PVL A;  4DHJ B;  4WWN A;  5EE0 A;  1GNU A;  1PUT A;  2ZNV C;  4IM2 A;  3IG3 A;  2N1V A;  2CU1 A;  1QLB B;  3RNE C;  1KOT A;  1WH3 A;  3AU4 A;  3AEF B;  2IYD B;  3V60 A;  1XXG A;  3SD5 A;  2IDY A;  4KZ0 A;  2WXR A;  1E8Z A;  3QIJ A;  2MW5 A;  2ONQ A;  2LVQ A;  2INP E;  2MJE A;  4XDD A;  2GMI C;  3B2F A;  3ZNZ B;  1HE8 A;  4TV3 A;  1IP9 A;  4JWS C;  4IOI E;  1UNS A;  2C7M B;  2KVZ A;  2PTL A;  4II2 B;  3RUI B;  1S3S G;  3ZKJ C;  4DK5 A;  1L7Y A;  4RGM A;  3OG5 A;  4LTU A;  3PRE A;  4M0W A;  2I2Y A;  3DBL I;  4P16 A;  1RAX A;  1WE6 A;  1XCQ L;  5AUK A;  1B1Z A;  1U4A A;  5JHB A;  4W9K A;  1XLN A;  3ZVV A;  2KTR A;  1QOA A;  4GSW A;  1TJE A;  2K0P A;  3NVZ A;  4YSZ B;  1T3Q A;  1WGR A;  2KWC A;  3ZRC A;  2HTH A;  1N61 A;  1A5R A;  2INN E;  4IUM B;  3MHZ A;  4FXC A;  4ICV A;  1V80 A;  2IBI B;  4WJO A;  3Q8F A;  3R7Q A;  1IPG A; 
#chains in the Genus database with same CATH homology
 2GI9 A;  1ROE A;  4KKI A;  3BK2 A;  1JWS D;  3SR6 A;  4EE2 A;  2H89 B;  1OFF A;  1QF6 A;  1OQQ A;  1YQ4 B;  3PO0 A;  1FMA D;  4WIP A;  1RYJ A;  1J7B A;  1ENF A;  2M19 A;  1QOG A;  2FUG 1;  2DLB A;  4JWU C;  1HZ6 A;  2LJI A;  3MP9 A;  4MAC A;  2WXL A;  1I4H A;  3HVD A;  1K51 A;  2V0G A;  4AQ7 A;  1TS5 A;  1KF6 B;  1QQR A;  1XEE A;  2QEJ C;  3O13 A;  2J4X A;  1AN8 A;  1Q10 A;  1IBX A;  3VRB B;  3P4Q B;  1YJI A;  4L2Y A;  3GP7 A;  3AN1 A;  1F2R C;  2G9H D;  2JU6 X;  1KLU D;  4RNA A;  4RF0 A;  3NVW A;  4HJG E;  2W3S A;  1C78 A;  1IUE A;  2QIE B;  4OZA A;  1AWD A;  1FEH A;  1V1O A;  4RFB A;  5D3D A;  3IXS A;  1HQR D;  2TSS A;  2DYO A;  1K50 A;  1L0X B;  4A90 A;  1VR9 A;  2H88 B;  3ZJT A;  2WXK A;  3OWE B;  3PZ7 A;  2VZK D;  4KGR A;  2WXF A;  1I4P A;  3AM9 A;  3Q8E A;  2D5G A;  1P7E A;  5H8Y E;  3NVV A;  4KX6 B;  1DOX A;  1T6B X;  2BB6 A;  1L0Y B;  4D2K A;  4NZL B;  1IBX B;  4A8X C;  4DXF A;  1E0Z A;  1EU3 A;  5C2T B;  1XLP A;  5D3I B;  1I4R A;  1ZDV A;  1ET9 A;  2V3N A;  2KAJ A;  2MEK A;  5BMH A;  3BZD B;  3TEW A;  2Y5P A;  2JX5 A;  4JE3 B;  3PZ8 A;  3W5U B;  2AX5 A;  2JYE A;  2LUM A;  2WS3 B;  1B9R A;  2W55 A;  4LLG M;  3W2D A;  4YSX B;  3TEZ A;  1E9M A;  1E6E B;  5I4D A;  2LHD A;  1SXT A;  1TKY A;  1XF5 L;  2ZW1 A;  2WXJ A;  1PGA A;  2OHF A;  3B9J A;  4J3O D;  2WXN A;  4TMA B;  1N5W A;  1QOB A;  3V3X A;  3BVZ A;  1AW7 A;  2PMV A;  1GB4 A;  1V1P A;  3BK1 A;  4C7Z A;  1L6V A;  2PLP A;  2XN9 C;  5EE9 A;  2FBW B;  3T3N A;  3ZYY X;  2BS3 B;  1ZPS A;  2RPV A;  2W82 A;  5GXG B;  2PVG C;  1YN3 A;  2WQY B;  1XLQ A;  2PVO D;  1VDV A;  5HHD G;  1PDX A;  1E7P B;  3ZJU A;  3W1S A;  4ZRQ A;  3DWG C;  2MH7 A;  1DOY A;  4US9 A;  1JQ4 A;  1GAQ B;  1XCT L;  1JCK B;  2JQR B;  4JPS A;  3AE5 B;  4YWG G;  1CK1 A;  2ICI A;  1C4P A;  1IGC A;  2JYT A;  5HFY A;  1RWS A;  1UGJ A;  1SE3 A;  2EEL A;  4YT0 B;  2DBY A;  1K52 A;  3AE8 B;  3HVZ A;  1NI3 A;  1C79 A;  3KLS X;  2IGD A;  1V1P B;  4A6Q A;  1WXQ A;  5FK9 C;  3Q8A A;  3LYY A;  1ZP0 B;  2LGI A;  1GB1 A;  1NYQ A;  2W54 A;  3AEE B;  3ZGZ A;  1KTK A;  4L23 A;  1L0V B;  2N9K A;  3P4R B;  3VR8 B;  3ZJV A;  2R61 A;  4KKJ A;  2BW2 A;  2L32 A;  2MJ3 A;  3CIR B;  1QIL A;  1ET6 A;  2VZK B;  4H2A A;  3EGR A;  3R2T A;  3BYY B;  1F2R I;  2KN4 A;  1L4D B;  1D5X C;  3NS1 A;  4C7Y A;  3NRZ A;  2IPK D;  1J7C A;  3P4P B;  2ZW0 A;  3Q69 A;  2E3T A;  1JWM D;  3C8Y A;  1QKZ A;  2GRI A;  2HDE A;  1QOF A;  1BXT A;  2Q5W D;  4B0E A;  1FIQ A;  3VRA B;  1C9F A;  1NVI D;  1ZXH A;  2IGH A;  4ZRP A;  1VZ8 A;  3Q8C A;  1L4Z B;  2G1E A;  1VJK A;  2AQ3 B;  1CZP A;  1UWX A;  1FM0 D;  2ACZ B;  2IJ0 A;  1JWA D;  1FNU A;  3IAM 1;  3V05 A;  4REZ A;  1CJE A;  4B0M A;  1KRH A;  2W3R A;  5G5H A;  1STE A;  2K5P A;  1TKE A;  4MH8 A;  4RF1 A;  3CWI A;  3BII D;  1XLO A;  1WSP A;  3P63 A;  1ZUD 2;  1HEZ E;  2BTE A;  3NZ3 A;  4HEA 1;  3W9C B;  3AMZ A;  3AEA B;  1SE4 A;  4ITK A;  4WH4 A;  1JRO A;  2M0A A;  2RDG A;  1VRA B;  1DOI A;  4OW0 A;  2WU5 B;  3AEG B;  1RFK A;  3P1M A;  2K22 A;  3AE9 B;  3FC4 A;  2L1A A;  3EUB 2;  2BS4 B;  4GDK B;  1TY0 A;  1ESF A;  2KAC A;  2OED A;  5FKA C;  1YNT E;  4MT5 A;  3TEY A;  1FNV A;  1ZOY B;  1V97 A;  5G5G A;  3AEB B;  2RMM A;  1GPX A;  4OHJ A;  3MJ5 A;  1ZE3 D;  1Y56 A;  3E9S A;  4RGT A;  1J7A A;  3MC0 B;  2BS2 B;  4USA A;  2CU3 A;  2WXH A;  3TEX A;  2I38 A;  2EKI A;  3U4E G;  1SJE D;  1YJJ A;  1JWU D;  4XWW A;  4NJC A;  1C77 A;  2L83 A;  1I4Q A;  4RGN A;  1JRP A;  2JSV X;  2J42 A;  3FIL A;  2E6X A;  2CJN A;  2XNA C;  3AE6 B;  1EWY C;  1TYG B;  4N58 A;  2JWU A;  3E56 A;  1DGJ A;  2DWQ A;  3I57 A;  1ACC A;  1WRI A;  2M56 B;  4IKG A;  3P4S B;  5TSS A;  2BBC A;  4NAM A;  2DYM A;  2Z8L A;  3I9V 1;  1BML C;  5BYQ A;  2WU2 B;  4Q2J A;  4ARI A;  2Y3A A;  1JAL A;  1FXA A;  1PFD A;  1KH0 A;  2QIL A;  3NUH B;  4AS1 A;  2JZP A;  3WCQ A;  1PGB A;  3GS2 A;  1UUP A;  2QMT A;  2AQ1 B;  4ZOH C;  1TY2 A;  2BYT A;  5C3J B;  1ZDX A;  3BVG A;  3J9C A;  4XDC A;  2KDM A;  3FIL B;  1SEB D;  4P6V F;  2SAK A;  1SBB B;  3AED B;  3FAH A;  4R3D A;  4RH6 A;  1FFV A;  3AH7 A;  3Q8B A;  1IGD A;  4NAW B;  2WXP A;  4YTM B;  1WYG A;  3AB5 A;  4A55 A;  5LNK 1;  1RM6 C;  2NTS A;  4C80 A;  2J53 A;  1EM7 A;  2NMQ A;  1R7S A;  1OQR A;  1FRR A;  2WLB A;  4JX1 C;  1D5M C;  1L5P A;  3AEC B;  4YXD B;  3AV8 A;  3BWU D;  4TQ0 A;  2KMM A;  1N63 A;  2AQ2 B;  2PIA A;  2BT6 A;  5AUI A;  3HRD D;  2WDQ B;  3H8H A;  1SJH D;  1C4A A;  1SB3 C;  5BMG A;  1HA5 A;  2WXM A;  1SE2 A;  2JXT A;  1WGK A;  5JXV A;  1L6U A;  3P42 A;  1YQ3 B;  3SFD B;  1TS4 A;  4GDL B;  2V3P A;  4O1N A;  4A9A A;  3L4P A;  4ZYS A;  4ARC A;  3T3O A;  3N9Y C;  1C4C A;  2HTM E;  2Y5C A;  2CJO A;  1NEK B;  1I7H A;  5BYR A;  4DQO C;  1FRD A;  4US8 A;  2KQ4 X;  3R2I A;  5MPO A;  1SSN A;  3MFG A;  2K3U A;  5T8I A;  1V8C A;  1VZ6 A;  5BYS A;  1MPE A;  2QJL A;  1YN5 A;  3AE1 B;  3HUI A;  3SFE B;  2WNM A;  2MJD A;  2LFI A;  1JW9 D;  1XO3 A;  3BVM A;  2YEP B;  5E6J A;  1FXI A;  2ON8 A;  3SEB A;  4YTP B;  3U7Z A;  1JML A;  1FNW A;  2LMC A;  1MHH E;  3KQ4 A;  3LB8 C;  5FR3 A;  4HRS A;  5BMI A;  1P7F A;  3ZQ4 A;  4TQ1 A;  3BYT B;  2FE8 A;  4YTN B;  5D7G A;  1FFU A;  4HKZ E;  1FO4 A;  5HG2 A;  4OVZ A;  4TSS A;  4HRO A;  2PW9 A;  3TSS A;  2GB1 A;  3U52 E;  4LK0 M;  2NTT A;  1SIJ A;  1A70 A;  3TUO A;  4WQM A;  1D6E C;  2N0S B;  2L52 A;  5EE0 A;  1K53 A;  5EE3 A;  1PUT A;  1TS2 A;  1FD6 A;  4L1B A;  3ETR A;  1YN4 A;  4WAF A;  1QLB B;  1KFY B;  5EE1 A;  3AE3 B;  4XE0 A;  3AEF B;  2LEK A;  1WWT A;  4DXG A;  1F77 A;  1XXG A;  4ZHP A;  2IDY A;  4PT5 A;  2B76 B;  4OZC A;  1D4B A;  2WXR A;  5H92 C;  3AE4 B;  3EA6 A;  1I4X A;  1PGX A;  1UWM A;  3KWV A;  3R8B A;  3U2S C;  4CQN A;  1FCL A;  4UDU C;  4KGS A;  1NEN B;  2ONQ A;  1D5Z C;  1EU4 A;  2WDV B;  2INP E;  2MJE A;  4XDD A;  2LHE A;  3GB1 A;  3B2F A;  1JWB D;  4N59 A;  4YSY B;  1LO5 D;  2K9X A;  3IAS 1;  1CQV A;  2QSD A;  4JWS C;  4IOI E;  2WXG A;  1N5X A;  1UNS A;  3W5V B;  3RPF C;  3RFZ B;  2J52 A;  2WDR B;  3UI3 A;  2PTL A;  3DWM A;  4XWT A;  1C76 A;  2V4I B;  2WP9 B;  1N60 A;  4WUR A;  3AE2 B;  1F0Z A;  1TS3 A;  2IGG A;  1M4V A;  5HI1 A;  4RGM A;  2RDH A;  1HZ5 A;  2WXO A;  2SEB D;  4LTU A;  4OZB A;  1MVK A;  1NYR A;  1BUI C;  2N7J A;  1ZXI A;  2WXI A;  1FCC C;  1AYF A;  1YMH E;  4KGT A;  4M0W A;  1N62 A;  3NVY A;  4RGO S;  3URY A;  3B2G A;  1T5X D;  2I2Y A;  1QT9 A;  3IT4 B;  4P16 A;  4IDI A;  1SF0 A;  1XCQ L;  1DYQ A;  1MHX A;  5AUK A;  1B1Z A;  1HXY D;  1TKG A;  2WXQ A;  3AE7 B;  3KWL A;  1XLN A;  1QOA A;  1VZ7 A;  3IT6 B;  2N9L A;  1TJE A;  2K0P A;  3NVZ A;  4YSZ B;  1GOZ A;  1T3Q A;  4HKQ A;  3LXF A;  1PYW D;  3VR9 B;  4WWM A;  3VQI A;  2BB5 A;  1KLG D;  4MM3 B;  1E10 A;  1N61 A;  1I4G A;  1MI0 A;  2INN E;  3MHZ A;  4FXC A;  4N6E B;  2YEP F;  1VLB A;  4ZHO A;  2KWD A;  4GLS C;  3ABV B;  2PKO A;  1EWC A;  2X38 A;  3Q8F A;  4C56 C;  4RCO A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...