1XEEA

Solution structure of the chemotaxis inhibitory protein of staphylococcus aureus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords chemotaxis-inhibiting protein CHIPS
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xeeA01
2K3UA 1XEEA
chains in the Genus database with same CATH superfamily
4WQOB 4HJKA 1C3TA 2KQ7A 3U52E 3U8ZA 2KDEB 1YMHE 1VZ6A 2AYOB 3EGRA 3IFWB 4KZCA 2PKOA 1XLNA 2KVRA 4FHJA 2RMMA 3Q14C 2A5UA 2V3NA 5BMIA 4MSMB 2INPE 4L23A 2V3SA 2DZKA 3BVGA 4MJSA 3SDLC 3Q8FA 3ZXVA 5BYRA 5AEKB 1UD7A 4XX5A 1I4HA 3GB1A 1HEZE 1R4NI 5D3IB 2GI9A 4ZRIA 3RNGC 3H7PA 4MGIE 5C2TB 1YJJA 3W2DA 3PGEA 3BINA 3W9CB 1ZPSA 2NCNA 1KRHA 3DBHB 3IAS1 2D2QA 5AUIA 3NS8A 4P1CC 4MDKE 3MJ5A 4XWWA 2V0GA 1WJ6A 5T8IA 2VZKD 2NVUI 2IBIB 1B1ZA 3LXFA 3SD5A 1D4BA 2MBQA 1D3ZA 5C3JB 1I4PA 3C8YA 4GDLB 5I4DA 1NYRA 2QC8A 1R4NB 1E7PB 1T5XD 2BKRB 5J2RA 1GAQB 4W9DA 1V9JA 1QQRA 2GBJA 1WSPA 1TZOA 3K9PB 2FCQA 3I9V1 5LXIB 2J52A 3H9DA 3APCA 2WNMA 1ZKHA 1J7AA 2KTFA 4GXBA 1YIWA 2NBUA 3B08A 2JU6X 4AS1A 2GBNA 4ACFA 5D2MB 5L83A 1FCCC 1VZ7A 2G3QB 3QWZB 2IJ0A 4KKIA 3H1UA 4HDOA 2HJ1A 1FNWA 1N61A 3K9OB 3P42A 4XYCA 2MW5A 3AE2B 3P1MA 1F77A 3NG0A 1UBIA 3BVMA 4W9EA 3W5UB 3RCZA 4HKZE 1WWTA 4XWTA 1XXGA 1F2RI 1KF6B 3EA6A 2MJEA 1SIJA 1ROEA 2VRRB 4K81A 1J7CA 1ACCA 3ETRA 5DPWA 3QX1A 1B9RA 2O6VB 1CMXB 1SEBD 1KFYB 1N6ZA 1VJKA 3VRAB 4LNKA 3AV8A 3TBLD 3ML9A 4HXDA 4KZ0A 3RFZB 4J3OD 2JUOA 2L0TA 1IYFA 1VZ8A 1S1QB 1OEYJ 5LNK1 2MLBA 1H4RA 1K53A 4IM2A 2OHFA 3L10B 3SEBA 2D07B 3AB5A 1JW9D 1SIFA 2W3SA 2KFJA 4A8XC 2IY1B 2KQ4X 2WYQA 2BYEA 3PHWB 2UU7A 1SE3A 3E9SA 4HROA 2LI5A 4XDCA 1WXQA 2JZZA 3V6EB 1EF1A 5DPRA 1K8RB 1K50A 2LGSA 2KOXA 4PYUA 1TS2A 2FAZA 5G2NA 2ACZB 2K0PA 1WXVA 1DOYA 1HZ6A 3P4SB 1WMHB 1IBXA 3PS6A 3ONSA 2CS4A 1VR9A 2R2OA 2UYZB 3V61A 3TEWA 4IC7B 2L1AA 4WWNA 1FXIA 3DBHI 3DOWA 3ML8A 2R61A 2JRIB 1FXAA 3ZRCA 3M62B 2K9XA 2MBHA 1FEHA 1M94A 1Z2MA 2V1YA 1BXTA 3WANA 2L76A 4RM9A 4W9KA 3AEAB 4MH0E 3WALA 2MP2B 3BYYB 1WX9A 4RF0A 1PDXA 1QF6A 3JYUA 4B0EA 2FUG1 4GMVA 3VTVA 3B2FA 5E6PA 3T3NA 5BMHA 5BYQA 3UI3A 2WXPA 1P0RA 4KIKA 1FD6A 4IOIE 2JYTA 1Q1OA 1RLFA 1EF5A 3P4RB 1PGXA 1XF5L 4LJPB 4A9AA 4M01A 2O2VB 3DHIC 2GBKA 2MSED 3HM3A 1OGWA 5D7GA 3VXWA 2ZEQA 1YQ4B 2WWZA 1SGHA 4EEWA 4J6IA 3VUYA 3ENEA 4KVGB 2O6VD 5HHDG 1E8ZA 4W9GA 3DQVA 2SAKA 1YX5B 3EECA 3TMPB 4WJNA 2DZJA 1RWSA 3R2IA 4DHJD 1IUEA 1WGHA 3BK2A 1Q5WB 3AU4A 4AJYB 2INCC 2JQRB 1IGCA 4BBNC 1E9MA 3N3KB 1N63A 3PT2B 2OJWA 4KKJA 2PMVA 2WXOA 5EE3A 1C78A 1WXAA 1M4VA 5KHOA 4C80A 4KDIC 5FR3A 1A5RA 1XQQA 3A33B 4REZA 4KGSA 1F1HA 2KO3A 2V4LA 4EKUA 2KACA 1E7VA 3KLSX 1Z5SB 2VH1A 4B0MA 3AE6B 1D5XC 4URKA 4ZYNA 4HCPB 1IPGA 1TT5B 5CX3A 2K22A 3BZDB 3GZNB 1V97A 3VTWA 4CYEA 5EE1A 3UIOB 4A55A 5HFYA 2JXTA 3R8BA 3L17A 1V5OA 3EFUA 1P7FA 1WXMA 3TL5A 3ZNZB 3VRBB 2LMCA 2QEJC 3FILB 1TS3A 2R2QA 3GE3C 3V62A 1ESFA 2KWVB 2V3PA 4NPNA 1GC6A 3O13A 1UZXB 2X8XX 2REXA 1WRDB 3ZTDA 3QA8A 2HE7A 4C4VB 1PGBA 3DHGC 1XCQL 1FRRA 3A4RA 3UQAA 5E6OA 3CSFA 1HTOA 1T0YA 3C19A 2I1JA 4W9FA 1D5ZC 1FRDA 2BVCA 5JHBA 1QOFA 1WH3A 1EU4A 3U7ZA 2ZPYA 1HTQA 3RI7C 1JWUD 1UF0A 2YEPB 3AEGB 3Q8BA 3T9LA 4ARIA 2DAFA 2W82A 4XDDA 1VRAB 2MCNB 3AEFB 2KLCA 3OJ4B 4WJQA 1KM7A 5IO9A 1FIQA 1UWXA 5IN7A 1LFDA 3L13A 1WJNA 1G6JA 5EDSA 1KH0A 1LM8B 1J0GA 2WXFA 4JIOU 1E10A 1R4MB 2GLSA 4FHKA 2QJLA 3HK0A 1R7SA 3QJZA 4W9LA 3NOBA 1CQVA 4C4VA 4DHJB 2TSSA 2L52A 4MEMA 1QKZA 4ANXA 2KFKB 4ANUA 5FK9C 2NR2A 4RGMA 1I42A 4HWIB 1E8YA 1QZEA 2IDYA 3BVZA 3UIPB 5IOIA 4GN1A 3RNBC 3U30A 2K8BA 1WJUA 2H88B 1EM7A 1OFFA 4FJZA 2JZPA 1EUVB 1UELA 3VH4B 4KX6B 2WXQA 1P1AA 2KK8A 3ZKJC 2IO3B 2DENB 2C5LC 2G4SA 3AE4B 2N9PC 2BWFA 1LGRA 1NEKB 1TKEA 4JE3B 4LLGM 1N62A 1NI3A 1RAXA 1ET6A 3Q3MC 3PPAA 2FIFA 2RDGA 2N1VA 4KGRA 1X1MA 3KUDB 3NZ3A 3Q69A 2KN5A 4KDLB 4JX1C 1MJDA 2RR9A 3ZJVA 4UDUC 2D3GA 2WQYB 2N9EB 4QAYA 3W1YA 2KX3A 4M02A 1SE2A 3AI5A 2KD0A 2WXJA 5D3DA 4K7SA 2ZZPB 4JLCA 1EWCA 2KANA 2Z8LA 3WAOA 2WXLA 2PJHA 2W55A 4ITKA 3DDCB 2G9HD 1KLGD 4MGZE 4R3DA 3I3TB 1R4MI 4TKNA 3ZJUA 1NI2A 2KYWA 3NVYA 4LDTD 1JROA 3DVNV 3DWGC 2K8HA 3R7RA 2M19A 3L08A 4RFBA 1V80A 2CKHB 1KJTA 3VHTC 1L4ZB 4WAAA 2BW2A 3Q8CA 1JCKB 4NZLB 4F1SA 3BY4B 1JQ4A 1Y56A 3OAWA 2KQSA 1QLBB 5LLIA 1IGDA 3KUZA 4LNNA 4PS7A 2WU2B 2N7JA 1KOTA 2LHDA 4FULA 4RM8A 2C7NB 4NJCA 2DZMA 4ZRJA 4PK1A 4MM3B 4C00A 3PVLA 5LXHA 3AE3B 3NVVA 2XBBC 1GOZA 1HA5A 1WM2A 3FAHA 2BYTA 4YT0B 3PRPB 4DHZB 3KVFB 1RRBA 4HLEA 1AN8A 4PYZA 2WX0A 2NPTB 2VH2A 5TR5A 2DWQA 4F8CB 3QIJA 2K6DB 2BF8B 2WDQB 4A6QA 3OLMD 4N9F4 2JY6A 3L0WB 1N60A 5C1ZA 1T0QC 5HKHA 1EWYC 2IO1B 4OZCA 2EELA 4MELA 3IG3A 4HRSA 5CHFA 2QMTA 3H6NA 1F9JA 2CU3A 4L1BA 4LJOB 1QOAA 1XCTL 4XE0A 1PUTA 1JWMD 1WXSA 3U7DA 3KWVA 2GOWA 4EOYA 4XZ4A 3AH7A 2KLGA 3PZ8A 2ONQA 4MH8A 4K7WA 4GIVA 1XLPA 1V1PA 4MSQB 1OQYA 2EKEC 3L54A 3SU8X 1MHHE 1ZXHA 2PVGC 2QDFA 1YD8U 3RD2A 3ZGZA 4DK5A 2GMIC 5KHQA 2NTSA 3TJPA 3KUCB 3NHEB 1C77A 1STEA 3S2AA 4C56C 2D3AA 1TYGB 2I38A 4I6LB 3HVDA 3BYTB 1TZ1A 1YN4A 2LHEA 2E6XA 2WXNA 4A3PA 3H7PB 4BKSD 3NS1A 2IYDB 4F7ZA 3OWEB 2D5GA 2I2YA 4IKGA 4GLSC 4NY0A 4ZDVA 3TSSA 2KWCA 3W1SC 1PFDA 5JH5C 4LNOA 1GJZA 4EE2A 2RGFA 3Q8AA 3X0WA 2A4ZA 2N9XA 4ICVA 3KWLA 2Y3AA 3EFCA 5DPTA 3V05A 1NDDA 1WYWB 2B76B 4HPLB 2SEBD 2JX5A 3H7SA 1J8CA 1E5WA 2LVQA 2BS4B 4S17A 3QC8B 3M63B 2BT6A 2WLBA 3J9CA 3PLVA 3Q3NC 1VD2A 3C0RB 1WZ0A 1MFWA 3P4QB 3Q8EA 3T3OA 3TEZA 3RNEC 3DHHC 1BMLC 4OVVA 1WF9A 1XEEA 2PW9A 3KYDD 4IM0A 3VR9B 3KYCD 4LCDE 4NAMA 4YSZB 4NAWB 3JSVB 2LXCA 1YN3A 2N4FA 2BS3B 2L8JA 4G3XB 4LK0M 4YWGG 3BK1A 4GDKA 1DYQA 3PREA 3ZYYX 2ZNVC 4FJVB 4IWPA 4AWJA 2CJOA 3JVZX 1D6EC 3UGBB 2IZVB 3Q3JA 2N7EA 3BIID 4WH4A 1RM6C 2LGDA 3OJ3A 4TV3A 3PSEB 2O2VA 2INDC 3ZRFA 3MJWA 4LDTB 4DQOC 3PZDA 3NZUA 4DHZE 1SJED 2ASQA 4I6PA 2FUHB 4YTNB 3X23A 4FA6A 4G50A 3N9YC 1Q10A 5IKCM 1WY8A 2MH7A 4GDLA 4WAFA 2BGFA 1GB1A 2Y5BB 2WDRB 1L7YA 3WAPA 3RZFA 1RFAA 2M0AA 1F2RC 5AZHA 1L5PA 1WE7A 2AL3A 2RDHA 2MA9B 3E56A 3AULA 3I57A 3MP9A 3DBLB 5DCNA 3GE8C 1TY0A 3M95A 4W9JA 4C7ZA 5AUKA 3ZNGC 1E0ZA 1SB3C 2WXKA 1VDVA 3VQIA 1GNUA 3ZDTA 1CK1A 2XNAC 1WX7A 2UWQA 1WYGA 3MC0B 1NYQA 2BPSA 2QILA 2ZCCA 4A20A 2V9HA 1F52A 2M4NA 4BKTA 3RT3B 2PLPA 3WA0A 3ZUNA 2LVPA 1L0YB 3PO0A 2WU5B 2BWES 1WJ4A 4MGYE 1JMLA 2IO2B 2G45B 1WM3A 4MT5A 1N5WA 1F0ZA 2EKIA 3GS2A 3B1LX 3PRZA 2KHWB 4AUQC 5GXGB 2LJIA 3HHMA 3N20C 5H8YE 3P2BA 3TEXA 4W9IA 4BOZB 4W9CA 5D94A 4XGAB 1K51A 3R2TA 4EFOA 4XC2A 4JWSC 3MTNB 4DDID 1MPEA 4WIPA 4AQ7A 2KFKA 2N9KA 2DBYA 1BT0A 2L32A 4NJ7A 1ISNA 2KDMA 1SE9A 3ZDMC 2KAJA 2PIAA 3QQ8B 2RD0A 2LEKA 2DLBA 4S0RA 2DYOA 4IM3A 2MRPA 4HDQA 3ZLZA 2Y5PA 1JALA 2BYFA 3LB8C 4WWPA 1NENB 2OEDA 4K1RB 3I63C 3VH3B 2BQQA 3H8HA 3U2SC 2IGGA 3MFGA 2NPTA 4ZOHC 2WXGA 1KLVA 1C4PA 3EUB2 4BFRA 4B9KA 3DWMA 4JPSA 3BWUD 2J0MA 4K3BA 5TSSA 3R7QA 1WGGA 2N7DA 4ZRPA 4YTPB 4FXCA 4KGTA 1V5TA 1QOBA 4FN2A 3Q3FA 2WXIA 1E8XA 2JXXA 1GUAB 3CMMB 1LQBA 3EHVA 3TEYA 2MP2A 4TMAB 2ZCBA 5E6JA 3RNCC 3FILA 4E3CA 1WR1A 1TJEA 2L00B 1OTRB 4WURA 2GBRA 4RNAA 1YOVB 1ZE3D 1ZP0B 3MC9A 1E7UA 1DOIA 3JSVA 2KDIA 2PE9A 1FFVA 4CHKA 2JYEA 2LGIA 2AX5A 3IAM1 2W54A 2JVCA 3AN1A 3HRDD 5HI1A 1TGZB 2AQ3B 1C79A 3DBRB 4P16A 3SFDB 2HD5B 4YL8A 2CJNA 3VUWA 4A3OA 2Z0EB 4KV2A 2AEHA 1YX6B 2BKFA 4EZJA 1T0SC 1YQ3B 1YNTE 2BS2B 1UWMA 2GBMA 2KTRB 1WX8A 2ZJDA 1YJIA 2WGSA 1C76A 1KLUD 3N1ZC 4IW0A 2H89B 1WGKA 1ZUD2 4JWUC 4IWQA 4HVBA 2RSUA 1TBEA 2DYMA 3O65B 1Y8RC 4ZHOA 4GB9A 2K5PA 2YVCA 3NRZA 1YQBA 2MWSB 3IVFA 3PRMB 4YSYB 2L7RA 2MJ3A 2KZRA 2N9LA 4FBJB 2G1EA 3MHSD 1NVID 2N0SB 4NNJB 2LRWA 3A1QB 3R3MA 2E3TA 4WJPA 4BZAA 3A9KB 2W9NA 2LGXA 2WX1A 1L4DB 2LJ5A 3UINB 3AM9A 2L83A 3ZXRA 1MG4A 1WR6E 1I4XA 3ZIMA 2KXJA 3HM6X 5GMVA 3N1XC 2J42A 4ZRKA 4ASWC 2ZVNA 3UF8A 3EC8A 4TQ0A 1TKYA 4JL9A 4DXFA 1FNUA 2J4XA 2C7MB 2JWZA 1TIFA 1MVKA 1SJHD 2LZ6A 2QIEB 2D10A 2GRIA 1LO5D 1SSNA 3WAMA 4I6NB 2KVZA 4OVZA 4P6VF 4TSSA 4WQMA 1SXTA 2LFIA 4MACA 4H2AA 1YJ1A 2PTLA 2KMAA 2YEPF 4K7UA 3TCAA 2MHJA 2J7QB 4OZAA 2I1KA 2JWUA 1WMHA 4MM3A 4DXGA 1IBXB 1V2YA 2XEWA 4AJWA 1J7BA 1T0RC 4NJ6A 4O1NA 1FO4A 4ANWA 2OJRA 2B3AA 1WGDA 1HE8A 1XLQA 2CHWA 1AW7A 2FCNA 4AP4C 2KX0A 1UNSA 2MBBB 2DAJA 3A1QA 4NQKE 3A4SC 1V49A 3IXSA 4BKGA 3A9KA 3RYTA 3PV1A 1GG3A 2BB5A 1FMAD 3WIMA 2D3BA 3MHZA 4YSXB 5L95C 4JGHB 5D6JB 4RMAA 1DGJA 4DWFA 2N1WA 3RN9C 2FCMA 3HVZA 1T6BX 4A90A 4N59A 1UGMA 1YN5A 2C60A 3OG5A 1N5XA 1XLOA 3ZVVA 5CHVC 4EUTA 4EZLA 2MBEA 4LNFA 5FKAC 3FKYA 2JZ3B 1OQRA 3SR6A 2DNFA 2EMSA 2M17A 3RULA 2X38A 4ANVA 1WRIA 1IP9A 3KQ4A 3AEEB 4BAXA 4KSLC 3B2GA 3CF6E 2LXAA 1MHXA 3B9JA 5CHWA 2WXRA 4OVUA 2JF5A 2Y5CA 2FIDA 2WP9B 1JWAD 2LGYA 3VDZA 3V6CB 3URYA 1TTNA 4P1BC 4M8MA 5G55A 1Q0WB 3NY5A 3APDA 3ZO5B 1OQQA 1V1OA 2MEKA 2KT7A 2XN9C 2LRUA 1I4RA 1L0VB 4N6EB 1HZ5A 1JWSD 4HPPA 4RH6A 4TQ1A 1ZW7A 2DHZA 3AECB 4HK2A 3PLUA 3HIZA 1GC7A 2CU1A 1AARA 1XT9B 1PGAA 4ZHPA 2J53A 1ET9A 3ZQ4A 2KC1A 4RGNA 5BYSA 3A9JA 4IG7B 2CHXA 4FLHA 1A70A 1SF0A 2KJHB 5BMGA 3TUOA 4G0NB 4RGTA 3PTFC 2ZPNA 3L4PA 2CHZA 4B6WA 1ZDXA 1P9DU 1K52A 1S3SG 2AL6A 2ZW1A 3IT4B 5C23A 1UGJA 2LD9A 1P3QU 2Z59B 5EE0A 2DZIA 4GDKB 2M1MA 1VLBA 4YTMB 5IP4D 2LASA 2PPHA 2IGDA 3CSTA 2WHIA 4OHJA 2Z0DB 2ZVOA 1U4AA 1EO6A 1WE6A 2HDEA 4BVUC 3VTUA 2IGHA 2MX2A 2KWDA 2ZNVB 3KH0A 5FR6A 3RNFC 1CJEA 2NMQA 4RCOA 2RDBC 1QT9A 3N30A 2L3ZA 1P98A 3MC8A 4YXDB 1WFYA 2KJ6A 1AYFA 1P7EA 3NVZA 3ABVB 3ZNID 2D11A 3AE1B 4AOFA 1HXYD 2KMCA 3AE8B 2KMMA 1WI0A 3AE7B 3W5VB 2W3RA 2V4IB 5IA7A 2K3UA 3AU5A 1V1PB 4II2B 2J0JA 2WXHA 1C4AA 2OOBB 5DPSA 4M8NA 1VCBA 3ZNHB 3IT6B 4ARCA 3N1YC 3QCAA 3DBRI 4MJSB 3IBEA 4HPMB 1I35A 2M56B 2J0KA 4P7IA 1XO3A 3PHXB 3D32A 4CO7A 1FPYA 2KJRA 2KDBA 2MJDA 2HTME 3QK0A 1TS4A 2HJ8A 3LDZE 3GOEA 4K3CA 2QHOA 5BO4B 3RUIB 3V3XA 4PS3A 2INNE 3DVGY 2JPHA 1UBQA 3ECIA 4M0WB 4FJYA 4Q2JA 4D2KA 2RPQA 4US9A 4ZYSA 1L0XB 2Q5WD 4PT5A 2KKCA 4LTUA 1I7HA 2C9WB 4MGKE 1L6VA 4ZRQA 3N32A 4CQNA 3APFA 1JWBD 4BBNF 2QCZA 4GSWA 2K8CA 2O6VA 3QARA 3HUIA 4NQLB 2LUMA 1QILA 3LJ3A 3A9JB 1C4CA 4OZBA 3SHQA 3AE9B 3SFEB 2AWTA 4M0WA 2C7HA 3VFKA 2MBOA 1V81A 3DVGX 5AZGA 2FCSA 2JT4B 3AE5B 3T8MA 4W9HA 5EE9A 1BUIC 2K25A 3NVWA 4GOCA 3UQBA 1V6EA 4E71A 1PYWD 1E8WA 3QHTA 2WDVB 4OW0A 3VVWB 4HJGE 5JHAA 3QAQA 1C9FA 1OEYA 3ZJTA 2JSVX 3RZWC 2VZKB 2PVOD 2FE8A 2K1FA 2AQ1B 4BOSC 1KTKA 1AWDA 1ZGUB 3AXCA 3FC4A 1TS5A 1RYJA 1TKGA 4B95A 2QSDA 4US8A 4RF1A 1EU3A 4DBGA 4EZKA 2JRHA 2NBWB 3W1SA 2LWPA 1WGYA 4WWMA 2IY0B 2M0XA 4E74A 3JW0X 2CR5A 4X57B 2BBCA 1RFKA 2KDFB 4TUUA 3P4PB 1E90A 1I4GA 2HTHA 4ICUA 5E6NA 3RMKC 2ZW0A 2K6QA 2KTRA 2EMTA 3ZTCA 2BTEA 1C1YB 3VAWA 4JQWC 4L2YA 1FXTB 1D5MC 2ON8A 1GPXA 2KC2A 3IHPC 1E6EB 2WXMA 3GP7A 2PE6B 1H8CA 5CTRC 5J18A 3RPFC 4IDIA 4II3B 4GU2A 3DBSA 4G11A 3B0AA 2FBWB 4C7YA 2NTTA 5MPOA 3DPDA 1J19A 3VUXA 4DXAB 2WS3B 3TIXA 1L2NA 2K39A 1TY2A 4KSKC 4DDGD 4USAA 1ENFA 2NBVB 3GZNI 2LVOA 1WZ3A 2IPKD 3NJTA 3Q2AC 2XK5A 2MQJA 1V8CA 1UUPA 3Q3OC 1FNVA 1L6UA 4RGOS 3AEBB 4FADA 1FFUA 2AQ2B 1MI0A 4GGQA 5IAAC 1T3QA 2DX5B 4BKSA 4HKQA 3ALBA 2KNBA 3NZSA 5JXVA 3AMZA 2ICIA 2KN4A 4M00A 2M8SA 1JRUA 4HEA1 1WIAA 3R66C 2BYVE 5G5HA 1ZOYB 2LUEA 4PS8A 3CIRB 1FCLA 2WDTB 3V60A 4KIKB 1JRPA 5HG2A 2FNJB 5J17A 3M3JA 3DCGA 1GB4A 3L16A 4NAWA 5AZFA 2G4DB 1WGRA 2YLMA 3KW5B 1V86A 3DBLI 2DYBA 5H92C 4WJOA 3DVNU 4HCNB 2KWUB 2L0FA 1SE4A 1DOXA 1LXDA 3PZ7A 4LNIA 2IO0B 1MG8A 3NUHB 3LYYA 4IUMB 3WCQA 3I5JC 3U4EG 4N58A 3RNAC 1ZXIA 2D3CA 2NS5A 3CWIA 2BB6A 1QOGA 3AEDB 1SBBB 3P63A 1NBFC 2L05A 1CZPA 1PQSA 3VR8B 3Q6BA 4IWOA 1FM0D 2XK5B 1I4QA 5G5GA 1ZDVA 1XD3B 2PEAA 2RPVA 2GB1A 5JZEB 1HQRD 4WWOA 3ZW3A 1UH6A
chains in the Genus database with same CATH topology
2PLPA 1QOFA 1EU4A 3U7ZA 3U52E 3AECB 1L0YB 1JWUD 3PO0A 1YMHE 2YEPB 1PGAA 3AEGB 3Q8BA 4ZHPA 2WU5B 1VZ6A 2W82A 2J53A 4ARIA 1ET9A 3ZQ4A 3EGRA 4RGNA 4XDDA 1VRAB 1JMLA 3AEFB 5BYSA 2PKOA 1N5WA 4MT5A 1XLNA 1FIQA 1A70A 1UWXA 1F0ZA 1SF0A 2RMMA 2EKIA 5BMGA 3GS2A 2V3NA 5BMIA 2INPE 4L23A 1KH0A 3TUOA 4RGTA 2WXFA 1E10A 5GXGB 3L4PA 2LJIA 3BVGA 1ZDXA 3Q8FA 1K52A 2QJLA 2ZW1A 3IT4B 1R7SA 5H8YE 5BYRA 1UGJA 3TEXA 1I4HA 5EE0A 3GB1A 1HEZE 4GDKB 1CQVA 1VLBA 2TSSA 4YTMB 1K51A 5D3IB 2L52A 3R2TA 1QKZA 2GI9A 5FK9C 5C2TB 4JWSC 2IGDA 4RGMA 1YJJA 3W2DA 1MPEA 3W9CB 2IDYA 1ZPSA 3BVZA 4WIPA 2N9KA 4AQ7A 4OHJA 1KRHA 2DBYA 3IAS1 5AUIA 2HDEA 4XWWA 3MJ5A 2V0GA 2L32A 5T8IA 2VZKD 2H88B 1EM7A 1OFFA 2KDMA 1B1ZA 2JZPA 3LXFA 2IGHA 1D4BA 2KWDA 4KX6B 5C3JB 2KAJA 1I4PA 2WXQA 2PIAA 3C8YA 4GDLB 2LEKA 5I4DA 1CJEA 2DLBA 1NYRA 3AE4B 2NMQA 4RCOA 1E7PB 1T5XD 1QT9A 1NEKB 2DYOA 1TKEA 4JE3B 4LLGM 1GAQB 1N62A 1NI3A 1ET6A 1QQRA 2Y5PA 4YXDB 1WSPA 1AYFA 1P7EA 3NVZA 1TZOA 3ABVB 1JALA 3LB8C 3AE1B 2RDGA 1HXYD 1NENB 3AE8B 3I9V1 4KGRA 2OEDA 2J52A 2WNMA 2KMMA 3NZ3A 1J7AA 3AE7B 3Q69A 3W5VB 2W3RA 2V4IB 3H8HA 2JU6X 4JX1C 2K3UA 3U2SC 4AS1A 1V1PB 3ZJVA 2IGGA 4UDUC 2WXHA 2WQYB 1C4AA 3MFGA 1FCCC 1VZ7A 4ZOHC 2IJ0A 2WXGA 4KKIA 1C4PA 4ARCA 3EUB2 3IT6B 1FNWA 1SE2A 3DWMA 4JPSA 3BWUD 5TSSA 2WXJA 5D3DA 4ZRPA 4YTPB 1N61A 4FXCA 4KGTA 1EWCA 3P42A 1QOBA 3AE2B 3P1MA 1F77A 2Z8LA 2WXIA 2WXLA 2M56B 2W55A 4ITKA 3BVMA 1XO3A 2G9HD 3W5UB 1KLGD 3TEYA 4R3DA 4HKZE 1WWTA 4TMAB 4XWTA 1XXGA 5E6JA 1F2RI 1KF6B 3EA6A 2MJDA 3ZJUA 2HTME 1SIJA 1ROEA 2MJEA 1JROA 3NVYA 1TS4A 3DWGC 3FILA 2M19A 1TJEA 4RFBA 3V3XA 1J7CA 1ACCA 3ETRA 2INNE 4WURA 1B9RA 1SEBD 1KFYB 1VJKA 4RNAA 1L4ZB 4Q2JA 4D2KA 3VRAB 1ZE3D 1ZP0B 4US9A 3AV8A 2BW2A 3Q8CA 1JCKB 4ZYSA 1L0XB 4NZLB 2Q5WD 4PT5A 1JQ4A 1DOIA 1Y56A 1FFVA 4LTUA 3RFZB 4J3OD 1VZ8A 1I7HA 2JYEA 1L6VA 2LGIA 4ZRQA 5LNK1 2AX5A 1QLBB 2W54A 3IAM1 1IGDA 1K53A 3AN1A 3HRDD 4CQNA 2OHFA 2WU2B 5HI1A 2N7JA 1JWBD 3SEBA 2AQ3B 3AB5A 1JW9D 2LHDA 1C79A 2W3SA 4A8XC 4NJCA 4P16A 3SFDB 3HUIA 2CJNA 2KQ4X 2LUMA 4MM3B 1QILA 3AE3B 3NVVA 1GOZA 1C4CA 1SE3A 3E9SA 4HROA 4OZBA 1HA5A 4XDCA 3AE9B 1WXQA 3SFEB 1YQ3B 3FAHA 1YNTE 2BS2B 4M0WA 2BYTA 4YT0B 1UWMA 3AE5B 1AN8A 1K50A 1YJIA 5EE9A 1BUIC 1C76A 1KLUD 2DWQA 1TS2A 2H89B 1WGKA 2WDQB 4A6QA 1ZUD2 4JWUC 1N60A 2ACZB 3NVWA 1EWYC 2K0PA 4OZCA 1PYWD 1DOYA 2EELA 1HZ6A 3P4SB 2WDVB 4HRSA 2DYMA 4ZHOA 1IBXA 4OW0A 2QMTA 1VR9A 4HJGE 2K5PA 1C9FA 3TEWA 2CU3A 3ZJTA 2JSVX 3NRZA 4L1BA 1QOAA 1XCTL 2L1AA 2VZKB 4XE0A 1PUTA 2FE8A 2PVOD 1FXIA 2AQ1B 1JWMD 1KTKA 1AWDA 4YSYB 3FC4A 3KWVA 1TS5A 1RYJA 2MJ3A 3AH7A 2R61A 1TKGA 2N9LA 3PZ8A 2G1EA 2ONQA 4MH8A 1FXAA 2QSDA 1NVID 2K9XA 4US8A 1XLPA 2N0SB 1V1PA 4RF1A 1EU3A 1FEHA 1MHHE 1ZXHA 2E3TA 1BXTA 3W1SA 2PVGC 1L4DB 3AEAB 3ZGZA 4WWMA 3AM9A 2L83A 2NTSA 1C77A 1I4XA 1STEA 3BYYB 4C56C 4RF0A 2BBCA 1PDXA 1QF6A 1TYGB 1RFKA 4B0EA 2I38A 2FUG1 3HVDA 2J42A 3BYTB 4TQ0A 1YN4A 1TKYA 2LHEA 3P4PB 2E6XA 3B2FA 2WXNA 1I4GA 4DXFA 3T3NA 1FNUA 2J4XA 5BMHA 3NS1A 2ZW0A 5BYQA 3UI3A 2WXPA 1MVKA 1SJHD 3OWEB 2BTEA 1FD6A 4IOIE 2D5GA 2JYTA 4IKGA 2I2YA 4L2YA 4GLSC 2QIEB 2GRIA 3TSSA 1D5MC 3P4RB 1LO5D 1PFDA 1PGXA 1SSNA 1XF5L 2ON8A 1GPXA 1E6EB 4OVZA 4A9AA 4P6VF 2WXMA 4TSSA 3GP7A 4EE2A 3Q8AA 4WQMA 1SXTA 2LFIA 4MACA 3KWLA 3RPFC 4IDIA 2Y3AA 4H2AA 5D7GA 3V05A 1YQ4B 2PTLA 2YEPF 2B76B 2SEBD 2JX5A 2FBWB 4C7YA 2NTTA 5MPOA 2BS4B 5HHDG 4OZAA 2SAKA 2BT6A 2WS3B 2WLBA 2JWUA 1IBXB 3J9CA 4DXGA 1RWSA 1TY2A 3R2IA 1IUEA 4USAA 1ENFA 1J7BA 3BK2A 3P4QB 3Q8EA 3T3OA 2IPKD 3TEZA 1BMLC 4O1NA 1FO4A 1XEEA 1V8CA 2JQRB 2PW9A 3VR9B 1UUPA 1IGCA 4NAMA 4YSZB 1E9MA 1N63A 4NAWB 1XLQA 1AW7A 1FNVA 1L6UA 1YN3A 4RGOS 3AEBB 1FFUA 2AQ2B 1MI0A 1UNSA 4KKJA 1T3QA 2BS3B 2PMVA 4LK0M 4YWGG 2WXOA 3IXSA 3BK1A 5EE3A 1DYQA 1C78A 4HKQA 3ZYYX 1M4VA 5JXVA 2BB5A 1FMAD 3AMZA 2ICIA 2CJOA 2KN4A 4C80A 1D6EC 3MHZA 4YSXB 4HEA1 5FR3A 4REZA 4KGSA 5G5HA 1ZOYB 1DGJA 3BIID 1RM6C 4WH4A 3CIRB 1FCLA 1JRPA 2KACA 5HG2A 1GB4A 3HVZA 4DQOC 1T6BX 3KLSX 1SJED 4B0MA 4A90A 4N59A 3AE6B 4YTNB 1YN5A 1N5XA 1D5XC 1XLOA 5H92C 3N9YC 1Q10A 2MH7A 5FKAC 1OQRA 3SR6A 2K22A 3BZDB 2X38A 4WAFA 1SE4A 1V97A 1DOXA 3PZ7A 1GB1A 1WRIA 2WDRB 3KQ4A 3AEEB 5EE1A 2M0AA 1F2RC 3NUHB 3LYYA 1L5PA 4A55A 5HFYA 3B2GA 2JXTA 3R8BA 2RDHA 3WCQA 1MHXA 3B9JA 3U4EG 3E56A 3I57A 4N58A 1P7FA 2WXRA 3MP9A 3VRBB 2Y5CA 1ZXIA 2LMCA 1JWAD 2QEJC 2WP9B 3FILB 1TS3A 1TY0A 3CWIA 1ESFA 2BB6A 2V3PA 1QOGA 3AEDB 1SBBB 3P63A 5AUKA 4C7ZA 1E0ZA 3URYA 1CZPA 1SB3C 3O13A 3VR8B 2WXKA 1VDVA 3VQIA 1CK1A 2XNAC 1OQQA 1PGBA 1FM0D 3MC0B 1XCQL 1WYGA 1NYQA 1FRRA 1V1OA 1I4QA 5G5GA 2QILA 1ZDVA 2MEKA 2XN9C 1I4RA 2RPVA 1L0VB 4N6EB 2GB1A 1HZ5A 1HQRD 1JWSD 1D5ZC 1FRDA 4RH6A 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3U A;  1XEE A; 
#chains in the Genus database with same CATH topology
 4WQO B;  4HJK A;  1C3T A;  2KQ7 A;  3U52 E;  3U8Z A;  2KDE B;  1YMH E;  1VZ6 A;  2AYO B;  3EGR A;  3IFW B;  4KZC A;  2PKO A;  1XLN A;  2KVR A;  4FHJ A;  2RMM A;  3Q14 C;  2A5U A;  2V3N A;  5BMI A;  4MSM B;  2INP E;  4L23 A;  2V3S A;  2DZK A;  3BVG A;  4MJS A;  3SDL C;  3Q8F A;  3ZXV A;  5BYR A;  5AEK B;  1UD7 A;  4XX5 A;  1I4H A;  3GB1 A;  1HEZ E;  1R4N I;  5D3I B;  2GI9 A;  4ZRI A;  3RNG C;  3H7P A;  4MGI E;  5C2T B;  1YJJ A;  3W2D A;  3PGE A;  3BIN A;  3W9C B;  1ZPS A;  2NCN A;  1KRH A;  3DBH B;  3IAS 1;  2D2Q A;  5AUI A;  3NS8 A;  4P1C C;  4MDK E;  3MJ5 A;  4XWW A;  2V0G A;  1WJ6 A;  5T8I A;  2VZK D;  2NVU I;  2IBI B;  1B1Z A;  3LXF A;  3SD5 A;  1D4B A;  2MBQ A;  1D3Z A;  5C3J B;  1I4P A;  3C8Y A;  4GDL B;  5I4D A;  1NYR A;  2QC8 A;  1R4N B;  1E7P B;  1T5X D;  2BKR B;  5J2R A;  1GAQ B;  4W9D A;  1V9J A;  1QQR A;  2GBJ A;  1WSP A;  1TZO A;  3K9P B;  2FCQ A;  3I9V 1;  5LXI B;  2J52 A;  3H9D A;  3APC A;  2WNM A;  1ZKH A;  1J7A A;  2KTF A;  4GXB A;  1YIW A;  2NBU A;  3B08 A;  2JU6 X;  4AS1 A;  2GBN A;  4ACF A;  5D2M B;  5L83 A;  1FCC C;  1VZ7 A;  2G3Q B;  3QWZ B;  2IJ0 A;  4KKI A;  3H1U A;  4HDO A;  2HJ1 A;  1FNW A;  1N61 A;  3K9O B;  3P42 A;  4XYC A;  2MW5 A;  3AE2 B;  3P1M A;  1F77 A;  3NG0 A;  1UBI A;  3BVM A;  4W9E A;  3W5U B;  3RCZ A;  4HKZ E;  1WWT A;  4XWT A;  1XXG A;  1F2R I;  1KF6 B;  3EA6 A;  2MJE A;  1SIJ A;  1ROE A;  2VRR B;  4K81 A;  1J7C A;  1ACC A;  3ETR A;  5DPW A;  3QX1 A;  1B9R A;  2O6V B;  1CMX B;  1SEB D;  1KFY B;  1N6Z A;  1VJK A;  3VRA B;  4LNK A;  3AV8 A;  3TBL D;  3ML9 A;  4HXD A;  4KZ0 A;  3RFZ B;  4J3O D;  2JUO A;  2L0T A;  1IYF A;  1VZ8 A;  1S1Q B;  1OEY J;  5LNK 1;  2MLB A;  1H4R A;  1K53 A;  4IM2 A;  2OHF A;  3L10 B;  3SEB A;  2D07 B;  3AB5 A;  1JW9 D;  1SIF A;  2W3S A;  2KFJ A;  4A8X C;  2IY1 B;  2KQ4 X;  2WYQ A;  2BYE A;  3PHW B;  2UU7 A;  1SE3 A;  3E9S A;  4HRO A;  2LI5 A;  4XDC A;  1WXQ A;  2JZZ A;  3V6E B;  1EF1 A;  5DPR A;  1K8R B;  1K50 A;  2LGS A;  2KOX A;  4PYU A;  1TS2 A;  2FAZ A;  5G2N A;  2ACZ B;  2K0P A;  1WXV A;  1DOY A;  1HZ6 A;  3P4S B;  1WMH B;  1IBX A;  3PS6 A;  3ONS A;  2CS4 A;  1VR9 A;  2R2O A;  2UYZ B;  3V61 A;  3TEW A;  4IC7 B;  2L1A A;  4WWN A;  1FXI A;  3DBH I;  3DOW A;  3ML8 A;  2R61 A;  2JRI B;  1FXA A;  3ZRC A;  3M62 B;  2K9X A;  2MBH A;  1FEH A;  1M94 A;  1Z2M A;  2V1Y A;  1BXT A;  3WAN A;  2L76 A;  4RM9 A;  4W9K A;  3AEA B;  4MH0 E;  3WAL A;  2MP2 B;  3BYY B;  1WX9 A;  4RF0 A;  1PDX A;  1QF6 A;  3JYU A;  4B0E A;  2FUG 1;  4GMV A;  3VTV A;  3B2F A;  5E6P A;  3T3N A;  5BMH A;  5BYQ A;  3UI3 A;  2WXP A;  1P0R A;  4KIK A;  1FD6 A;  4IOI E;  2JYT A;  1Q1O A;  1RLF A;  1EF5 A;  3P4R B;  1PGX A;  1XF5 L;  4LJP B;  4A9A A;  4M01 A;  2O2V B;  3DHI C;  2GBK A;  2MSE D;  3HM3 A;  1OGW A;  5D7G A;  3VXW A;  2ZEQ A;  1YQ4 B;  2WWZ A;  1SGH A;  4EEW A;  4J6I A;  3VUY A;  3ENE A;  4KVG B;  2O6V D;  5HHD G;  1E8Z A;  4W9G A;  3DQV A;  2SAK A;  1YX5 B;  3EEC A;  3TMP B;  4WJN A;  2DZJ A;  1RWS A;  3R2I A;  4DHJ D;  1IUE A;  1WGH A;  3BK2 A;  1Q5W B;  3AU4 A;  4AJY B;  2INC C;  2JQR B;  1IGC A;  4BBN C;  1E9M A;  3N3K B;  1N63 A;  3PT2 B;  2OJW A;  4KKJ A;  2PMV A;  2WXO A;  5EE3 A;  1C78 A;  1WXA A;  1M4V A;  5KHO A;  4C80 A;  4KDI C;  5FR3 A;  1A5R A;  1XQQ A;  3A33 B;  4REZ A;  4KGS A;  1F1H A;  2KO3 A;  2V4L A;  4EKU A;  2KAC A;  1E7V A;  3KLS X;  1Z5S B;  2VH1 A;  4B0M A;  3AE6 B;  1D5X C;  4URK A;  4ZYN A;  4HCP B;  1IPG A;  1TT5 B;  5CX3 A;  2K22 A;  3BZD B;  3GZN B;  1V97 A;  3VTW A;  4CYE A;  5EE1 A;  3UIO B;  4A55 A;  5HFY A;  2JXT A;  3R8B A;  3L17 A;  1V5O A;  3EFU A;  1P7F A;  1WXM A;  3TL5 A;  3ZNZ B;  3VRB B;  2LMC A;  2QEJ C;  3FIL B;  1TS3 A;  2R2Q A;  3GE3 C;  3V62 A;  1ESF A;  2KWV B;  2V3P A;  4NPN A;  1GC6 A;  3O13 A;  1UZX B;  2X8X X;  2REX A;  1WRD B;  3ZTD A;  3QA8 A;  2HE7 A;  4C4V B;  1PGB A;  3DHG C;  1XCQ L;  1FRR A;  3A4R A;  3UQA A;  5E6O A;  3CSF A;  1HTO A;  1T0Y A;  3C19 A;  2I1J A;  4W9F A;  1D5Z C;  1FRD A;  2BVC A;  5JHB A;  1QOF A;  1WH3 A;  1EU4 A;  3U7Z A;  2ZPY A;  1HTQ A;  3RI7 C;  1JWU D;  1UF0 A;  2YEP B;  3AEG B;  3Q8B A;  3T9L A;  4ARI A;  2DAF A;  2W82 A;  4XDD A;  1VRA B;  2MCN B;  3AEF B;  2KLC A;  3OJ4 B;  4WJQ A;  1KM7 A;  5IO9 A;  1FIQ A;  1UWX A;  5IN7 A;  1LFD A;  3L13 A;  1WJN A;  1G6J A;  5EDS A;  1KH0 A;  1LM8 B;  1J0G A;  2WXF A;  4JIO U;  1E10 A;  1R4M B;  2GLS A;  4FHK A;  2QJL A;  3HK0 A;  1R7S A;  3QJZ A;  4W9L A;  3NOB A;  1CQV A;  4C4V A;  4DHJ B;  2TSS A;  2L52 A;  4MEM A;  1QKZ A;  4ANX A;  2KFK B;  4ANU A;  5FK9 C;  2NR2 A;  4RGM A;  1I42 A;  4HWI B;  1E8Y A;  1QZE A;  2IDY A;  3BVZ A;  3UIP B;  5IOI A;  4GN1 A;  3RNB C;  3U30 A;  2K8B A;  1WJU A;  2H88 B;  1EM7 A;  1OFF A;  4FJZ A;  2JZP A;  1EUV B;  1UEL A;  3VH4 B;  4KX6 B;  2WXQ A;  1P1A A;  2KK8 A;  3ZKJ C;  2IO3 B;  2DEN B;  2C5L C;  2G4S A;  3AE4 B;  2N9P C;  2BWF A;  1LGR A;  1NEK B;  1TKE A;  4JE3 B;  4LLG M;  1N62 A;  1NI3 A;  1RAX A;  1ET6 A;  3Q3M C;  3PPA A;  2FIF A;  2RDG A;  2N1V A;  4KGR A;  1X1M A;  3KUD B;  3NZ3 A;  3Q69 A;  2KN5 A;  4KDL B;  4JX1 C;  1MJD A;  2RR9 A;  3ZJV A;  4UDU C;  2D3G A;  2WQY B;  2N9E B;  4QAY A;  3W1Y A;  2KX3 A;  4M02 A;  1SE2 A;  3AI5 A;  2KD0 A;  2WXJ A;  5D3D A;  4K7S A;  2ZZP B;  4JLC A;  1EWC A;  2KAN A;  2Z8L A;  3WAO A;  2WXL A;  2PJH A;  2W55 A;  4ITK A;  3DDC B;  2G9H D;  1KLG D;  4MGZ E;  4R3D A;  3I3T B;  1R4M I;  4TKN A;  3ZJU A;  1NI2 A;  2KYW A;  3NVY A;  4LDT D;  1JRO A;  3DVN V;  3DWG C;  2K8H A;  3R7R A;  2M19 A;  3L08 A;  4RFB A;  1V80 A;  2CKH B;  1KJT A;  3VHT C;  1L4Z B;  4WAA A;  2BW2 A;  3Q8C A;  1JCK B;  4NZL B;  4F1S A;  3BY4 B;  1JQ4 A;  1Y56 A;  3OAW A;  2KQS A;  1QLB B;  5LLI A;  1IGD A;  3KUZ A;  4LNN A;  4PS7 A;  2WU2 B;  2N7J A;  1KOT A;  2LHD A;  4FUL A;  4RM8 A;  2C7N B;  4NJC A;  2DZM A;  4ZRJ A;  4PK1 A;  4MM3 B;  4C00 A;  3PVL A;  5LXH A;  3AE3 B;  3NVV A;  2XBB C;  1GOZ A;  1HA5 A;  1WM2 A;  3FAH A;  2BYT A;  4YT0 B;  3PRP B;  4DHZ B;  3KVF B;  1RRB A;  4HLE A;  1AN8 A;  4PYZ A;  2WX0 A;  2NPT B;  2VH2 A;  5TR5 A;  2DWQ A;  4F8C B;  3QIJ A;  2K6D B;  2BF8 B;  2WDQ B;  4A6Q A;  3OLM D;  4N9F 4;  2JY6 A;  3L0W B;  1N60 A;  5C1Z A;  1T0Q C;  5HKH A;  1EWY C;  2IO1 B;  4OZC A;  2EEL A;  4MEL A;  3IG3 A;  4HRS A;  5CHF A;  2QMT A;  3H6N A;  1F9J A;  2CU3 A;  4L1B A;  4LJO B;  1QOA A;  1XCT L;  4XE0 A;  1PUT A;  1JWM D;  1WXS A;  3U7D A;  3KWV A;  2GOW A;  4EOY A;  4XZ4 A;  3AH7 A;  2KLG A;  3PZ8 A;  2ONQ A;  4MH8 A;  4K7W A;  4GIV A;  1XLP A;  1V1P A;  4MSQ B;  1OQY A;  2EKE C;  3L54 A;  3SU8 X;  1MHH E;  1ZXH A;  2PVG C;  2QDF A;  1YD8 U;  3RD2 A;  3ZGZ A;  4DK5 A;  2GMI C;  5KHQ A;  2NTS A;  3TJP A;  3KUC B;  3NHE B;  1C77 A;  1STE A;  3S2A A;  4C56 C;  2D3A A;  1TYG B;  2I38 A;  4I6L B;  3HVD A;  3BYT B;  1TZ1 A;  1YN4 A;  2LHE A;  2E6X A;  2WXN A;  4A3P A;  3H7P B;  4BKS D;  3NS1 A;  2IYD B;  4F7Z A;  3OWE B;  2D5G A;  2I2Y A;  4IKG A;  4GLS C;  4NY0 A;  4ZDV A;  3TSS A;  2KWC A;  3W1S C;  1PFD A;  5JH5 C;  4LNO A;  1GJZ A;  4EE2 A;  2RGF A;  3Q8A A;  3X0W A;  2A4Z A;  2N9X A;  4ICV A;  3KWL A;  2Y3A A;  3EFC A;  5DPT A;  3V05 A;  1NDD A;  1WYW B;  2B76 B;  4HPL B;  2SEB D;  2JX5 A;  3H7S A;  1J8C A;  1E5W A;  2LVQ A;  2BS4 B;  4S17 A;  3QC8 B;  3M63 B;  2BT6 A;  2WLB A;  3J9C A;  3PLV A;  3Q3N C;  1VD2 A;  3C0R B;  1WZ0 A;  1MFW A;  3P4Q B;  3Q8E A;  3T3O A;  3TEZ A;  3RNE C;  3DHH C;  1BML C;  4OVV A;  1WF9 A;  1XEE A;  2PW9 A;  3KYD D;  4IM0 A;  3VR9 B;  3KYC D;  4LCD E;  4NAM A;  4YSZ B;  4NAW B;  3JSV B;  2LXC A;  1YN3 A;  2N4F A;  2BS3 B;  2L8J A;  4G3X B;  4LK0 M;  4YWG G;  3BK1 A;  4GDK A;  1DYQ A;  3PRE A;  3ZYY X;  2ZNV C;  4FJV B;  4IWP A;  4AWJ A;  2CJO A;  3JVZ X;  1D6E C;  3UGB B;  2IZV B;  3Q3J A;  2N7E A;  3BII D;  4WH4 A;  1RM6 C;  2LGD A;  3OJ3 A;  4TV3 A;  3PSE B;  2O2V A;  2IND C;  3ZRF A;  3MJW A;  4LDT B;  4DQO C;  3PZD A;  3NZU A;  4DHZ E;  1SJE D;  2ASQ A;  4I6P A;  2FUH B;  4YTN B;  3X23 A;  4FA6 A;  4G50 A;  3N9Y C;  1Q10 A;  5IKC M;  1WY8 A;  2MH7 A;  4GDL A;  4WAF A;  2BGF A;  1GB1 A;  2Y5B B;  2WDR B;  1L7Y A;  3WAP A;  3RZF A;  1RFA A;  2M0A A;  1F2R C;  5AZH A;  1L5P A;  1WE7 A;  2AL3 A;  2RDH A;  2MA9 B;  3E56 A;  3AUL A;  3I57 A;  3MP9 A;  3DBL B;  5DCN A;  3GE8 C;  1TY0 A;  3M95 A;  4W9J A;  4C7Z A;  5AUK A;  3ZNG C;  1E0Z A;  1SB3 C;  2WXK A;  1VDV A;  3VQI A;  1GNU A;  3ZDT A;  1CK1 A;  2XNA C;  1WX7 A;  2UWQ A;  1WYG A;  3MC0 B;  1NYQ A;  2BPS A;  2QIL A;  2ZCC A;  4A20 A;  2V9H A;  1F52 A;  2M4N A;  4BKT A;  3RT3 B;  2PLP A;  3WA0 A;  3ZUN A;  2LVP A;  1L0Y B;  3PO0 A;  2WU5 B;  2BWE S;  1WJ4 A;  4MGY E;  1JML A;  2IO2 B;  2G45 B;  1WM3 A;  4MT5 A;  1N5W A;  1F0Z A;  2EKI A;  3GS2 A;  3B1L X;  3PRZ A;  2KHW B;  4AUQ C;  5GXG B;  2LJI A;  3HHM A;  3N20 C;  5H8Y E;  3P2B A;  3TEX A;  4W9I A;  4BOZ B;  4W9C A;  5D94 A;  4XGA B;  1K51 A;  3R2T A;  4EFO A;  4XC2 A;  4JWS C;  3MTN B;  4DDI D;  1MPE A;  4WIP A;  4AQ7 A;  2KFK A;  2N9K A;  2DBY A;  1BT0 A;  2L32 A;  4NJ7 A;  1ISN A;  2KDM A;  1SE9 A;  3ZDM C;  2KAJ A;  2PIA A;  3QQ8 B;  2RD0 A;  2LEK A;  2DLB A;  4S0R A;  2DYO A;  4IM3 A;  2MRP A;  4HDQ A;  3ZLZ A;  2Y5P A;  1JAL A;  2BYF A;  3LB8 C;  4WWP A;  1NEN B;  2OED A;  4K1R B;  3I63 C;  3VH3 B;  2BQQ A;  3H8H A;  3U2S C;  2IGG A;  3MFG A;  2NPT A;  4ZOH C;  2WXG A;  1KLV A;  1C4P A;  3EUB 2;  4BFR A;  4B9K A;  3DWM A;  4JPS A;  3BWU D;  2J0M A;  4K3B A;  5TSS A;  3R7Q A;  1WGG A;  2N7D A;  4ZRP A;  4YTP B;  4FXC A;  4KGT A;  1V5T A;  1QOB A;  4FN2 A;  3Q3F A;  2WXI A;  1E8X A;  2JXX A;  1GUA B;  3CMM B;  1LQB A;  3EHV A;  3TEY A;  2MP2 A;  4TMA B;  2ZCB A;  5E6J A;  3RNC C;  3FIL A;  4E3C A;  1WR1 A;  1TJE A;  2L00 B;  1OTR B;  4WUR A;  2GBR A;  4RNA A;  1YOV B;  1ZE3 D;  1ZP0 B;  3MC9 A;  1E7U A;  1DOI A;  3JSV A;  2KDI A;  2PE9 A;  1FFV A;  4CHK A;  2JYE A;  2LGI A;  2AX5 A;  3IAM 1;  2W54 A;  2JVC A;  3AN1 A;  3HRD D;  5HI1 A;  1TGZ B;  2AQ3 B;  1C79 A;  3DBR B;  4P16 A;  3SFD B;  2HD5 B;  4YL8 A;  2CJN A;  3VUW A;  4A3O A;  2Z0E B;  4KV2 A;  2AEH A;  1YX6 B;  2BKF A;  4EZJ A;  1T0S C;  1YQ3 B;  1YNT E;  2BS2 B;  1UWM A;  2GBM A;  2KTR B;  1WX8 A;  2ZJD A;  1YJI A;  2WGS A;  1C76 A;  1KLU D;  3N1Z C;  4IW0 A;  2H89 B;  1WGK A;  1ZUD 2;  4JWU C;  4IWQ A;  4HVB A;  2RSU A;  1TBE A;  2DYM A;  3O65 B;  1Y8R C;  4ZHO A;  4GB9 A;  2K5P A;  2YVC A;  3NRZ A;  1YQB A;  2MWS B;  3IVF A;  3PRM B;  4YSY B;  2L7R A;  2MJ3 A;  2KZR A;  2N9L A;  4FBJ B;  2G1E A;  3MHS D;  1NVI D;  2N0S B;  4NNJ B;  2LRW A;  3A1Q B;  3R3M A;  2E3T A;  4WJP A;  4BZA A;  3A9K B;  2W9N A;  2LGX A;  2WX1 A;  1L4D B;  2LJ5 A;  3UIN B;  3AM9 A;  2L83 A;  3ZXR A;  1MG4 A;  1WR6 E;  1I4X A;  3ZIM A;  2KXJ A;  3HM6 X;  5GMV A;  3N1X C;  2J42 A;  4ZRK A;  4ASW C;  2ZVN A;  3UF8 A;  3EC8 A;  4TQ0 A;  1TKY A;  4JL9 A;  4DXF A;  1FNU A;  2J4X A;  2C7M B;  2JWZ A;  1TIF A;  1MVK A;  1SJH D;  2LZ6 A;  2QIE B;  2D10 A;  2GRI A;  1LO5 D;  1SSN A;  3WAM A;  4I6N B;  2KVZ A;  4OVZ A;  4P6V F;  4TSS A;  4WQM A;  1SXT A;  2LFI A;  4MAC A;  4H2A A;  1YJ1 A;  2PTL A;  2KMA A;  2YEP F;  4K7U A;  3TCA A;  2MHJ A;  2J7Q B;  4OZA A;  2I1K A;  2JWU A;  1WMH A;  4MM3 A;  4DXG A;  1IBX B;  1V2Y A;  2XEW A;  4AJW A;  1J7B A;  1T0R C;  4NJ6 A;  4O1N A;  1FO4 A;  4ANW A;  2OJR A;  2B3A A;  1WGD A;  1HE8 A;  1XLQ A;  2CHW A;  1AW7 A;  2FCN A;  4AP4 C;  2KX0 A;  1UNS A;  2MBB B;  2DAJ A;  3A1Q A;  4NQK E;  3A4S C;  1V49 A;  3IXS A;  4BKG A;  3A9K A;  3RYT A;  3PV1 A;  1GG3 A;  2BB5 A;  1FMA D;  3WIM A;  2D3B A;  3MHZ A;  4YSX B;  5L95 C;  4JGH B;  5D6J B;  4RMA A;  1DGJ A;  4DWF A;  2N1W A;  3RN9 C;  2FCM A;  3HVZ A;  1T6B X;  4A90 A;  4N59 A;  1UGM A;  1YN5 A;  2C60 A;  3OG5 A;  1N5X A;  1XLO A;  3ZVV A;  5CHV C;  4EUT A;  4EZL A;  2MBE A;  4LNF A;  5FKA C;  3FKY A;  2JZ3 B;  1OQR A;  3SR6 A;  2DNF A;  2EMS A;  2M17 A;  3RUL A;  2X38 A;  4ANV A;  1WRI A;  1IP9 A;  3KQ4 A;  3AEE B;  4BAX A;  4KSL C;  3B2G A;  3CF6 E;  2LXA A;  1MHX A;  3B9J A;  5CHW A;  2WXR A;  4OVU A;  2JF5 A;  2Y5C A;  2FID A;  2WP9 B;  1JWA D;  2LGY A;  3VDZ A;  3V6C B;  3URY A;  1TTN A;  4P1B C;  4M8M A;  5G55 A;  1Q0W B;  3NY5 A;  3APD A;  3ZO5 B;  1OQQ A;  1V1O A;  2MEK A;  2KT7 A;  2XN9 C;  2LRU A;  1I4R A;  1L0V B;  4N6E B;  1HZ5 A;  1JWS D;  4HPP A;  4RH6 A;  4TQ1 A;  1ZW7 A;  2DHZ A;  3AEC B;  4HK2 A;  3PLU A;  3HIZ A;  1GC7 A;  2CU1 A;  1AAR A;  1XT9 B;  1PGA A;  4ZHP A;  2J53 A;  1ET9 A;  3ZQ4 A;  2KC1 A;  4RGN A;  5BYS A;  3A9J A;  4IG7 B;  2CHX A;  4FLH A;  1A70 A;  1SF0 A;  2KJH B;  5BMG A;  3TUO A;  4G0N B;  4RGT A;  3PTF C;  2ZPN A;  3L4P A;  2CHZ A;  4B6W A;  1ZDX A;  1P9D U;  1K52 A;  1S3S G;  2AL6 A;  2ZW1 A;  3IT4 B;  5C23 A;  1UGJ A;  2LD9 A;  1P3Q U;  2Z59 B;  5EE0 A;  2DZI A;  4GDK B;  2M1M A;  1VLB A;  4YTM B;  5IP4 D;  2LAS A;  2PPH A;  2IGD A;  3CST A;  2WHI A;  4OHJ A;  2Z0D B;  2ZVO A;  1U4A A;  1EO6 A;  1WE6 A;  2HDE A;  4BVU C;  3VTU A;  2IGH A;  2MX2 A;  2KWD A;  2ZNV B;  3KH0 A;  5FR6 A;  3RNF C;  1CJE A;  2NMQ A;  4RCO A;  2RDB C;  1QT9 A;  3N30 A;  2L3Z A;  1P98 A;  3MC8 A;  4YXD B;  1WFY A;  2KJ6 A;  1AYF A;  1P7E A;  3NVZ A;  3ABV B;  3ZNI D;  2D11 A;  3AE1 B;  4AOF A;  1HXY D;  2KMC A;  3AE8 B;  2KMM A;  1WI0 A;  3AE7 B;  3W5V B;  2W3R A;  2V4I B;  5IA7 A;  2K3U A;  3AU5 A;  1V1P B;  4II2 B;  2J0J A;  2WXH A;  1C4A A;  2OOB B;  5DPS A;  4M8N A;  1VCB A;  3ZNH B;  3IT6 B;  4ARC A;  3N1Y C;  3QCA A;  3DBR I;  4MJS B;  3IBE A;  4HPM B;  1I35 A;  2M56 B;  2J0K A;  4P7I A;  1XO3 A;  3PHX B;  3D32 A;  4CO7 A;  1FPY A;  2KJR A;  2KDB A;  2MJD A;  2HTM E;  3QK0 A;  1TS4 A;  2HJ8 A;  3LDZ E;  3GOE A;  4K3C A;  2QHO A;  5BO4 B;  3RUI B;  3V3X A;  4PS3 A;  2INN E;  3DVG Y;  2JPH A;  1UBQ A;  3ECI A;  4M0W B;  4FJY A;  4Q2J A;  4D2K A;  2RPQ A;  4US9 A;  4ZYS A;  1L0X B;  2Q5W D;  4PT5 A;  2KKC A;  4LTU A;  1I7H A;  2C9W B;  4MGK E;  1L6V A;  4ZRQ A;  3N32 A;  4CQN A;  3APF A;  1JWB D;  4BBN F;  2QCZ A;  4GSW A;  2K8C A;  2O6V A;  3QAR A;  3HUI A;  4NQL B;  2LUM A;  1QIL A;  3LJ3 A;  3A9J B;  1C4C A;  4OZB A;  3SHQ A;  3AE9 B;  3SFE B;  2AWT A;  4M0W A;  2C7H A;  3VFK A;  2MBO A;  1V81 A;  3DVG X;  5AZG A;  2FCS A;  2JT4 B;  3AE5 B;  3T8M A;  4W9H A;  5EE9 A;  1BUI C;  2K25 A;  3NVW A;  4GOC A;  3UQB A;  1V6E A;  4E71 A;  1PYW D;  1E8W A;  3QHT A;  2WDV B;  4OW0 A;  3VVW B;  4HJG E;  5JHA A;  3QAQ A;  1C9F A;  1OEY A;  3ZJT A;  2JSV X;  3RZW C;  2VZK B;  2PVO D;  2FE8 A;  2K1F A;  2AQ1 B;  4BOS C;  1KTK A;  1AWD A;  1ZGU B;  3AXC A;  3FC4 A;  1TS5 A;  1RYJ A;  1TKG A;  4B95 A;  2QSD A;  4US8 A;  4RF1 A;  1EU3 A;  4DBG A;  4EZK A;  2JRH A;  2NBW B;  3W1S A;  2LWP A;  1WGY A;  4WWM A;  2IY0 B;  2M0X A;  4E74 A;  3JW0 X;  2CR5 A;  4X57 B;  2BBC A;  1RFK A;  2KDF B;  4TUU A;  3P4P B;  1E90 A;  1I4G A;  2HTH A;  4ICU A;  5E6N A;  3RMK C;  2ZW0 A;  2K6Q A;  2KTR A;  2EMT A;  3ZTC A;  2BTE A;  1C1Y B;  3VAW A;  4JQW C;  4L2Y A;  1FXT B;  1D5M C;  2ON8 A;  1GPX A;  2KC2 A;  3IHP C;  1E6E B;  2WXM A;  3GP7 A;  2PE6 B;  1H8C A;  5CTR C;  5J18 A;  3RPF C;  4IDI A;  4II3 B;  4GU2 A;  3DBS A;  4G11 A;  3B0A A;  2FBW B;  4C7Y A;  2NTT A;  5MPO A;  3DPD A;  1J19 A;  3VUX A;  4DXA B;  2WS3 B;  3TIX A;  1L2N A;  2K39 A;  1TY2 A;  4KSK C;  4DDG D;  4USA A;  1ENF A;  2NBV B;  3GZN I;  2LVO A;  1WZ3 A;  2IPK D;  3NJT A;  3Q2A C;  2XK5 A;  2MQJ A;  1V8C A;  1UUP A;  3Q3O C;  1FNV A;  1L6U A;  4RGO S;  3AEB B;  4FAD A;  1FFU A;  2AQ2 B;  1MI0 A;  4GGQ A;  5IAA C;  1T3Q A;  2DX5 B;  4BKS A;  4HKQ A;  3ALB A;  2KNB A;  3NZS A;  5JXV A;  3AMZ A;  2ICI A;  2KN4 A;  4M00 A;  2M8S A;  1JRU A;  4HEA 1;  1WIA A;  3R66 C;  2BYV E;  5G5H A;  1ZOY B;  2LUE A;  4PS8 A;  3CIR B;  1FCL A;  2WDT B;  3V60 A;  4KIK B;  1JRP A;  5HG2 A;  2FNJ B;  5J17 A;  3M3J A;  3DCG A;  1GB4 A;  3L16 A;  4NAW A;  5AZF A;  2G4D B;  1WGR A;  2YLM A;  3KW5 B;  1V86 A;  3DBL I;  2DYB A;  5H92 C;  4WJO A;  3DVN U;  4HCN B;  2KWU B;  2L0F A;  1SE4 A;  1DOX A;  1LXD A;  3PZ7 A;  4LNI A;  2IO0 B;  1MG8 A;  3NUH B;  3LYY A;  4IUM B;  3WCQ A;  3I5J C;  3U4E G;  4N58 A;  3RNA C;  1ZXI A;  2D3C A;  2NS5 A;  3CWI A;  2BB6 A;  1QOG A;  3AED B;  1SBB B;  3P63 A;  1NBF C;  2L05 A;  1CZP A;  1PQS A;  3VR8 B;  3Q6B A;  4IWO A;  1FM0 D;  2XK5 B;  1I4Q A;  5G5G A;  1ZDV A;  1XD3 B;  2PEA A;  2RPV A;  2GB1 A;  5JZE B;  1HQR D;  4WWO A;  3ZW3 A;  1UH6 A; 
#chains in the Genus database with same CATH homology
 2PLP A;  1QOF A;  1EU4 A;  3U7Z A;  3U52 E;  3AEC B;  1L0Y B;  1JWU D;  3PO0 A;  1YMH E;  2YEP B;  1PGA A;  3AEG B;  3Q8B A;  4ZHP A;  2WU5 B;  1VZ6 A;  2W82 A;  2J53 A;  4ARI A;  1ET9 A;  3ZQ4 A;  3EGR A;  4RGN A;  4XDD A;  1VRA B;  1JML A;  3AEF B;  5BYS A;  2PKO A;  1N5W A;  4MT5 A;  1XLN A;  1FIQ A;  1A70 A;  1UWX A;  1F0Z A;  1SF0 A;  2RMM A;  2EKI A;  5BMG A;  3GS2 A;  2V3N A;  5BMI A;  2INP E;  4L23 A;  1KH0 A;  3TUO A;  4RGT A;  2WXF A;  1E10 A;  5GXG B;  3L4P A;  2LJI A;  3BVG A;  1ZDX A;  3Q8F A;  1K52 A;  2QJL A;  2ZW1 A;  3IT4 B;  1R7S A;  5H8Y E;  5BYR A;  1UGJ A;  3TEX A;  1I4H A;  5EE0 A;  3GB1 A;  1HEZ E;  4GDK B;  1CQV A;  1VLB A;  2TSS A;  4YTM B;  1K51 A;  5D3I B;  2L52 A;  3R2T A;  1QKZ A;  2GI9 A;  5FK9 C;  5C2T B;  4JWS C;  2IGD A;  4RGM A;  1YJJ A;  3W2D A;  1MPE A;  3W9C B;  2IDY A;  1ZPS A;  3BVZ A;  4WIP A;  2N9K A;  4AQ7 A;  4OHJ A;  1KRH A;  2DBY A;  3IAS 1;  5AUI A;  2HDE A;  4XWW A;  3MJ5 A;  2V0G A;  2L32 A;  5T8I A;  2VZK D;  2H88 B;  1EM7 A;  1OFF A;  2KDM A;  1B1Z A;  2JZP A;  3LXF A;  2IGH A;  1D4B A;  2KWD A;  4KX6 B;  5C3J B;  2KAJ A;  1I4P A;  2WXQ A;  2PIA A;  3C8Y A;  4GDL B;  2LEK A;  5I4D A;  1CJE A;  2DLB A;  1NYR A;  3AE4 B;  2NMQ A;  4RCO A;  1E7P B;  1T5X D;  1QT9 A;  1NEK B;  2DYO A;  1TKE A;  4JE3 B;  4LLG M;  1GAQ B;  1N62 A;  1NI3 A;  1ET6 A;  1QQR A;  2Y5P A;  4YXD B;  1WSP A;  1AYF A;  1P7E A;  3NVZ A;  1TZO A;  3ABV B;  1JAL A;  3LB8 C;  3AE1 B;  2RDG A;  1HXY D;  1NEN B;  3AE8 B;  3I9V 1;  4KGR A;  2OED A;  2J52 A;  2WNM A;  2KMM A;  3NZ3 A;  1J7A A;  3AE7 B;  3Q69 A;  3W5V B;  2W3R A;  2V4I B;  3H8H A;  2JU6 X;  4JX1 C;  2K3U A;  3U2S C;  4AS1 A;  1V1P B;  3ZJV A;  2IGG A;  4UDU C;  2WXH A;  2WQY B;  1C4A A;  3MFG A;  1FCC C;  1VZ7 A;  4ZOH C;  2IJ0 A;  2WXG A;  4KKI A;  1C4P A;  4ARC A;  3EUB 2;  3IT6 B;  1FNW A;  1SE2 A;  3DWM A;  4JPS A;  3BWU D;  5TSS A;  2WXJ A;  5D3D A;  4ZRP A;  4YTP B;  1N61 A;  4FXC A;  4KGT A;  1EWC A;  3P42 A;  1QOB A;  3AE2 B;  3P1M A;  1F77 A;  2Z8L A;  2WXI A;  2WXL A;  2M56 B;  2W55 A;  4ITK A;  3BVM A;  1XO3 A;  2G9H D;  3W5U B;  1KLG D;  3TEY A;  4R3D A;  4HKZ E;  1WWT A;  4TMA B;  4XWT A;  1XXG A;  5E6J A;  1F2R I;  1KF6 B;  3EA6 A;  2MJD A;  3ZJU A;  2HTM E;  1SIJ A;  1ROE A;  2MJE A;  1JRO A;  3NVY A;  1TS4 A;  3DWG C;  3FIL A;  2M19 A;  1TJE A;  4RFB A;  3V3X A;  1J7C A;  1ACC A;  3ETR A;  2INN E;  4WUR A;  1B9R A;  1SEB D;  1KFY B;  1VJK A;  4RNA A;  1L4Z B;  4Q2J A;  4D2K A;  3VRA B;  1ZE3 D;  1ZP0 B;  4US9 A;  3AV8 A;  2BW2 A;  3Q8C A;  1JCK B;  4ZYS A;  1L0X B;  4NZL B;  2Q5W D;  4PT5 A;  1JQ4 A;  1DOI A;  1Y56 A;  1FFV A;  4LTU A;  3RFZ B;  4J3O D;  1VZ8 A;  1I7H A;  2JYE A;  1L6V A;  2LGI A;  4ZRQ A;  5LNK 1;  2AX5 A;  1QLB B;  2W54 A;  3IAM 1;  1IGD A;  1K53 A;  3AN1 A;  3HRD D;  4CQN A;  2OHF A;  2WU2 B;  5HI1 A;  2N7J A;  1JWB D;  3SEB A;  2AQ3 B;  3AB5 A;  1JW9 D;  2LHD A;  1C79 A;  2W3S A;  4A8X C;  4NJC A;  4P16 A;  3SFD B;  3HUI A;  2CJN A;  2KQ4 X;  2LUM A;  4MM3 B;  1QIL A;  3AE3 B;  3NVV A;  1GOZ A;  1C4C A;  1SE3 A;  3E9S A;  4HRO A;  4OZB A;  1HA5 A;  4XDC A;  3AE9 B;  1WXQ A;  3SFE B;  1YQ3 B;  3FAH A;  1YNT E;  2BS2 B;  4M0W A;  2BYT A;  4YT0 B;  1UWM A;  3AE5 B;  1AN8 A;  1K50 A;  1YJI A;  5EE9 A;  1BUI C;  1C76 A;  1KLU D;  2DWQ A;  1TS2 A;  2H89 B;  1WGK A;  2WDQ B;  4A6Q A;  1ZUD 2;  4JWU C;  1N60 A;  2ACZ B;  3NVW A;  1EWY C;  2K0P A;  4OZC A;  1PYW D;  1DOY A;  2EEL A;  1HZ6 A;  3P4S B;  2WDV B;  4HRS A;  2DYM A;  4ZHO A;  1IBX A;  4OW0 A;  2QMT A;  1VR9 A;  4HJG E;  2K5P A;  1C9F A;  3TEW A;  2CU3 A;  3ZJT A;  2JSV X;  3NRZ A;  4L1B A;  1QOA A;  1XCT L;  2L1A A;  2VZK B;  4XE0 A;  1PUT A;  2FE8 A;  2PVO D;  1FXI A;  2AQ1 B;  1JWM D;  1KTK A;  1AWD A;  4YSY B;  3FC4 A;  3KWV A;  1TS5 A;  1RYJ A;  2MJ3 A;  3AH7 A;  2R61 A;  1TKG A;  2N9L A;  3PZ8 A;  2G1E A;  2ONQ A;  4MH8 A;  1FXA A;  2QSD A;  1NVI D;  2K9X A;  4US8 A;  1XLP A;  2N0S B;  1V1P A;  4RF1 A;  1EU3 A;  1FEH A;  1MHH E;  1ZXH A;  2E3T A;  1BXT A;  3W1S A;  2PVG C;  1L4D B;  3AEA B;  3ZGZ A;  4WWM A;  3AM9 A;  2L83 A;  2NTS A;  1C77 A;  1I4X A;  1STE A;  3BYY B;  4C56 C;  4RF0 A;  2BBC A;  1PDX A;  1QF6 A;  1TYG B;  1RFK A;  4B0E A;  2I38 A;  2FUG 1;  3HVD A;  2J42 A;  3BYT B;  4TQ0 A;  1YN4 A;  1TKY A;  2LHE A;  3P4P B;  2E6X A;  3B2F A;  2WXN A;  1I4G A;  4DXF A;  3T3N A;  1FNU A;  2J4X A;  5BMH A;  3NS1 A;  2ZW0 A;  5BYQ A;  3UI3 A;  2WXP A;  1MVK A;  1SJH D;  3OWE B;  2BTE A;  1FD6 A;  4IOI E;  2D5G A;  2JYT A;  4IKG A;  2I2Y A;  4L2Y A;  4GLS C;  2QIE B;  2GRI A;  3TSS A;  1D5M C;  3P4R B;  1LO5 D;  1PFD A;  1PGX A;  1SSN A;  1XF5 L;  2ON8 A;  1GPX A;  1E6E B;  4OVZ A;  4A9A A;  4P6V F;  2WXM A;  4TSS A;  3GP7 A;  4EE2 A;  3Q8A A;  4WQM A;  1SXT A;  2LFI A;  4MAC A;  3KWL A;  3RPF C;  4IDI A;  2Y3A A;  4H2A A;  5D7G A;  3V05 A;  1YQ4 B;  2PTL A;  2YEP F;  2B76 B;  2SEB D;  2JX5 A;  2FBW B;  4C7Y A;  2NTT A;  5MPO A;  2BS4 B;  5HHD G;  4OZA A;  2SAK A;  2BT6 A;  2WS3 B;  2WLB A;  2JWU A;  1IBX B;  3J9C A;  4DXG A;  1RWS A;  1TY2 A;  3R2I A;  1IUE A;  4USA A;  1ENF A;  1J7B A;  3BK2 A;  3P4Q B;  3Q8E A;  3T3O A;  2IPK D;  3TEZ A;  1BML C;  4O1N A;  1FO4 A;  1XEE A;  1V8C A;  2JQR B;  2PW9 A;  3VR9 B;  1UUP A;  1IGC A;  4NAM A;  4YSZ B;  1E9M A;  1N63 A;  4NAW B;  1XLQ A;  1AW7 A;  1FNV A;  1L6U A;  1YN3 A;  4RGO S;  3AEB B;  1FFU A;  2AQ2 B;  1MI0 A;  1UNS A;  4KKJ A;  1T3Q A;  2BS3 B;  2PMV A;  4LK0 M;  4YWG G;  2WXO A;  3IXS A;  3BK1 A;  5EE3 A;  1DYQ A;  1C78 A;  4HKQ A;  3ZYY X;  1M4V A;  5JXV A;  2BB5 A;  1FMA D;  3AMZ A;  2ICI A;  2CJO A;  2KN4 A;  4C80 A;  1D6E C;  3MHZ A;  4YSX B;  4HEA 1;  5FR3 A;  4REZ A;  4KGS A;  5G5H A;  1ZOY B;  1DGJ A;  3BII D;  1RM6 C;  4WH4 A;  3CIR B;  1FCL A;  1JRP A;  2KAC A;  5HG2 A;  1GB4 A;  3HVZ A;  4DQO C;  1T6B X;  3KLS X;  1SJE D;  4B0M A;  4A90 A;  4N59 A;  3AE6 B;  4YTN B;  1YN5 A;  1N5X A;  1D5X C;  1XLO A;  5H92 C;  3N9Y C;  1Q10 A;  2MH7 A;  5FKA C;  1OQR A;  3SR6 A;  2K22 A;  3BZD B;  2X38 A;  4WAF A;  1SE4 A;  1V97 A;  1DOX A;  3PZ7 A;  1GB1 A;  1WRI A;  2WDR B;  3KQ4 A;  3AEE B;  5EE1 A;  2M0A A;  1F2R C;  3NUH B;  3LYY A;  1L5P A;  4A55 A;  5HFY A;  3B2G A;  2JXT A;  3R8B A;  2RDH A;  3WCQ A;  1MHX A;  3B9J A;  3U4E G;  3E56 A;  3I57 A;  4N58 A;  1P7F A;  2WXR A;  3MP9 A;  3VRB B;  2Y5C A;  1ZXI A;  2LMC A;  1JWA D;  2QEJ C;  2WP9 B;  3FIL B;  1TS3 A;  1TY0 A;  3CWI A;  1ESF A;  2BB6 A;  2V3P A;  1QOG A;  3AED B;  1SBB B;  3P63 A;  5AUK A;  4C7Z A;  1E0Z A;  3URY A;  1CZP A;  1SB3 C;  3O13 A;  3VR8 B;  2WXK A;  1VDV A;  3VQI A;  1CK1 A;  2XNA C;  1OQQ A;  1PGB A;  1FM0 D;  3MC0 B;  1XCQ L;  1WYG A;  1NYQ A;  1FRR A;  1V1O A;  1I4Q A;  5G5G A;  2QIL A;  1ZDV A;  2MEK A;  2XN9 C;  1I4R A;  2RPV A;  1L0V B;  4N6E B;  2GB1 A;  1HZ5 A;  1HQR D;  1JWS D;  1D5Z C;  1FRD A;  4RH6 A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...