4WJQA

Crystal structure of sumo1 in complex with daxx
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 19
structure length 78
sequence length 78
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjqA00
2BKRB 3KUDB 4IM3A 1V2YA 3KUZA 4GN1A 5JH5C 3VAWA 4KZ0A 3DCGA 2KMCA 4GMVA 1WMHA 3QHTA 5AZGA 2A5UA 1WF9A 4TV3A 2KX3A 4ZRIA 3CSTA 2NPTB 3HK0A 5TR5A 3PS6A 3SHQA 3IBEA 2IY1B 4ICVA 1OEYJ 2MQJA 3QJZA 3W1SA 3MTNB 1WE7A 3KH0A 3LDZE 2RSUA 1V49A 5EDSA 4AUQC 5LXHA 2NBUA 4KIKA 2ZCBA 3R7RA 1IP9A 3PRMB 4TQ1A 3V6CB 2KQ7A 3KUCB 2JRHA 1LFDA 1WJUA 2KDBA 3ZRCA 5DPWA 4K81A 3ZTDA 2KFKA 3VXWA 1C3TA 3ZNZB 4AWJA 2MWSB 2NBWB 3R7QA 1WM2A 1MG8A 2DENB 3V60A 2JUOA 2K6QA 2ZVNA 4W9KA 4E74A 1UBIA 2PEAA 4CHKA 4BFRA 2PE6B 3QARA 4G50A 1F9JA 5FR6A 4FHKA 2RGFA 1Q0WB 2KVRA 4X57B 1E7VA 3H1UA 2ZPNA 1E5WA 3NHEB 3PHXB 5E6PA 1UGMA 2RR9A 1GC7A 4W9LA 2NCNA 3O65B 3JW0X 4JQWC 3K9OB 5AZFA 1SGHA 1U4AA 1WZ3A 2UWQA 5D7GA 3A1QA 2A4ZA 5HKHA 2KFKB 5DCNA 4EEWA 4W9DA 3SDLC 3I3TB 2IO3B 4WJNA 4GXBA 4EOYA 2ZVOA 3K9PB 1V86A 2IBIB 4FULA 2JPHA 1LM8B 3M63B 4IC7B 2MA9B 4GDKA 1P3QU 1FXTB 1KM7A 5D94A 3WANA 2BF8B 3L0WB 3DVGX 2KFJA 4BKTA 5L95C 1J19A 3DBRI 3A4SC 3PSEB 1HE8A 4NJ7A 3VDZA 4LJPB 4IG7B 1RLFA 2LZ6A 3WAOA 2IZVB 2G45B 2C5LC 3RD2A 2KOXA 2QHOA 2K8HA 2LI5A 2PPHA 4WJPA 3HIZA 4F7ZA 3APFA 3APCA 2LASA 1D3ZA 1UZXB 1WX7A 3A1QB 3QK0A 2UYZB 4NAWB 1R4MI 3VQIA 1WXVA 2JT4B 1WX8A 3A33B 1P1AA 2LGYA 3DVNV 4HPLB 2BPSA 2DYMA 2L0FA 2N9XA 4FJZA 1GNUA 5J2RA 1C1YB 3QCAA 2KDIA 4WWNA 2XK5A 1Q1OA 4WWOA 4ZRKA 3ZNGC 3L10B 2DZKA 1AARA 1EUVB 3ZO5B 2JVCA 2FUHB 4RM9A 1E7UA 2BWFA 4LCDE 1WGDA 2C7HA 2MW5A 3BINA 3PGEA 4GDKB 2MBEA 2AL3A 1NDDA 3ONSA 1S1QB 4IWPA 2KTFA 2YLMA 3JYUA 1UELA 1Y8RC 1ZW7A 1OTRB 2D10A 5C23A 3U30A 1WE6A 1V5TA 3L16A 2PE9A 2BYEA 2KNBA 2G4SA 1WR1A 5J17A 2RPQA 2CKHB 3AXCA 2M0XA 2GMIC 5L83A 4ICUA 2WX1A 1EF1A 4MGIE 3UQBA 2AEHA 1NBFC 1WY8A 2K1FA 4MSQB 3DVNU 1T0YA 1WXSA 2AL6A 2L0TA 4TUUA 2MX2A 3R66C 3VFKA 4FA6A 2FCMA 2LVPA 3TCAA 2KTRA 3UINB 3U7DA 3PREA 4JIOU 3VUYA 2CHWA 4GU2A 4ASWC 1XD3B 3RYTA 4F1SA 2RD0A 2AYOB 1WIAA 2KN5A 3PV1A 1R4NI 1RRBA 4PS7A 2LJ5A 1J8CA 4CYEA 3UQAA 3NY5A 2MBQA 1WM3A 3VUWA 3ZNID 4KV2A 1WGGA 5CHWA 3WA0A 4LJOB 2WDTB 3B0AA 3EC8A 1WI0A 3T8MA 3P2BA 3VHTC 2NS5A 4XX5A 4EFOA 5JZEB 2AWTA 1E8YA 2GBNA 2MBBB 3ML8A 4IWQA 3TL5A 2G4DB 4DBGA 5IA7A 4W9JA 2KTRB 3A9JA 2L8JA 3PTFC 2J7QB 2I1KA 4KDIC 4FADA 3D32A 3QWZB 3LJ3A 3SU8X 1WMHB 1E90A 4BKSD 2M17A 2KMAA 1LQBA 2LD9A 3U8ZA 2VRRB 2ZJDA 2FNJB 3BY4B 3PLUA 3ZRFA 1YJ1A 2JZZA 4IWOA 4ZDVA 3ZUNA 2KC1A 2KK8A 2KWCA 3B1LX 3VTUA 3ML9A 4KIKB 2HD5B 4DWFA 4BOSC 1Q5WB 2KD0A 1UH6A 4XZ4A 3ZDMC 3X23A 4MGZE 3QQ8B 4IUMB 2KDEB 3JVZX 4KVGB 1RFAA 1UD7A 2B3AA 2DYOA 2EMTA 2K8CA 3ZDTA 2ZNVC 4WWPA 4HPMB 4DXAB 4KZCA 3PRPB 1WJ4A 4NQKE 1A5RA 5KHQA 1YIWA 4BOZB 1LXDA 2KJ6A 4E3CA 1WXMA 1E8XA 3DBHI 4DDID 5G2NA 2J0MA 4NY0A 2D3GA 3PZDA 3ZIMA 2EKEC 5CX3A 1WX9A 2HTHA 1WR6E 4ZRJA 4A20A 2MP2A 4NNJB 3IFWB 1V5OA 2O2VA 3HM6X 4CO7A 2N4FA 3KYCD 1TGZB 1KOTA 5D6JB 4ANVA 2LVQA 4B95A 1VCBA 2W9NA 2IO0B 3PLVA 4MGKE 2L05A 2KKCA 1OQYA 2DX5B 3AI5A 3KVFB 4AOFA 3H6NA 3Q3FA 4G0NB 1EO6A 1K8RB 2KC2A 2FCQA 2LGDA 1P0RA 3EFUA 2IO1B 4DHJD 2KO3A 2MBOA 1V80A 3EECA 2DYBA 1VD2A 2MRPA 4MGYE 5LLIA 3WAPA 2KLCA 4RMAA 2BYVE 2Y5BB 3JSVA 4DK5A 4HDOA 2BGFA 2G3QB 5D2MB 3X0WA 3ENEA 2DZIA 4N9F4 4BKSA 4II3B 5E6NA 2GOWA 5IAAC 4B6WA 2JXXA 4I6PA 4II2B 4NJ6A 3TBLD 3NZUA 4W9GA 2O2VB 1WZ0A 4DHZE 1WJNA 2YVCA 4IM2A 2D07B 2LGXA 3PVLA 1SE9A 4FBJB 2CHZA 2I1JA 2O6VD 3DOWA 4LDTD 4WQOB 2R2OA 1WH3A 3AULA 2LRUA 5C1ZA 3TMPB 3ZNHB 1WYWB 1YX5B 1V9JA 1WRDB 3L54A 4HJKA 2KZRA 5E6OA 4GB9A 2KWUB 4MH0E 1ZGUB 1KJTA 3W1SC 4EUTA 2XK5B 2WWZA 1XT9B 2GBRA 2IYDB 2M4NA 3ECIA 1UBQA 3JSVB 2LXAA 4PYZA 2MLBA 4HK2A 2LVOA 2V3SA 4AJYB 4XC2A 1OEYA 1P98A 1H8CA 1TBEA 3H7SA 3RUIB 4DDGD 1CMXB 2N7EA 3PRZA 3WAMA 3CF6E 2NR2A 3N3KB 3APDA 4HLEA 3UIOB 1EF5A 2NVUI 2XBBC 3OLMD 3A9KA 2K8BA 3RCZA 1E8WA 4BKGA 1G6JA 2HJ8A 1PQSA 1H4RA 2KQSA 2OJRA 4W9EA 4PS3A 3VVWB 1KLVA 2BKFA 4GDLA 5LXIB 3HM3A 2LWPA 3QX1A 2L76A 2MSED 3H7PA 1ISNA 1L7YA 2GBMA 4FN2A 5KHOA 3MJWA 4GIVA 3B08A 4RM8A 1L2NA 2Z0DB 3QIJA 3RULA 3NOBA 2KX0A 5DPTA 1M94A 3C0RB 3AU4A 1YQBA 3L17A 4HWIB 3ALBA 4EZKA 2K6DB 4FJYA 3PPAA 4K7UA 2KJRA 2FAZA 3Q3JA 1WJ6A 2CR5A 3KW5B 4GGQA 4NPNA 4B9KA 5JHBA 1J0GA 2MBHA 4ANUA 4HXDA 3SD5A 4HDQA 3UGBB 3NS8A 3ZLZA 1WGYA 3ZTCA 5G55A 3NZSA 3ZVVA 4IW0A 3UIPB 3V61A 4AJWA 3H9DA 1P9DU 2DZJA 2FCSA 2V4LA 4W9FA 2N1VA 3A9KB 2NBVB 4HCNB 2CHXA 3ZW3A 1V81A 4WJOA 3V6EB 1IPGA 2O6VA 4BBNF 4IM0A 4GDLB 1JRUA 4I6LB 4MJSA 2ZCCA 3H7PB 2DHZA 3L08A 3VH4B 4K7WA 5J18A 2IO2B 4WAAA 4FLHA 3GOEA 3WALA 4HCPB 3T9LA 1OGWA 2REXA 3R3MA 2N9PC 3TIXA 4DHJB 2BWES 4MSMB 4ANWA 3IG3A 2LUEA 1SIFA 3OJ4B 4TKNA 4ZYNA 3ZKJC 4EZLA 3AU5A 2R2QA 2LXCA 3PT2B 4HVBA 1GJZA 2EMSA 3QA8A 4DHZB 2N1WA 3DQVA 2J0KA 2C60A 4I6NB 4MELA 3A9JB 4MM3A 4KSKC 3CMMB 4WJQA 4OVUA 4F8CB 3VTVA 2GBJA 2ZPYA 3M62B 2BYFA 2JRIB 4JGHB 2N9EB 2V1YA 4KDLB 3VUXA 3A4RA 2C7MB 2FIFA 1S3SG 2FCNA 1ZKHA 4EZJA 1GC6A 3PHWB 3VTWA 4W9IA 4NAWA 2O6VB 2OOBB 2M8SA 4LDTB 4MEMA 2D2QA 3DDCB 2L7RA 4MJSB 3GZNI 3RT3B 2KWVB 1WFYA 2CS4A 2XEWA 4KSLC 2N7DA 1RAXA 5CTRC 4ANXA 2K25A 2GBKA 2Z0EB 1QZEA 4EKUA 3DBSA 2FIDA 1WGHA 4JL9A 3RZWC 2IY0B 2JY6A 4GOCA 3TJPA 4K1RB 1GG3A 5GMVA 3W1YA 2KDFB 1Z5SB 1NI2A 1YX6B 3OJ3A 4URKA 1BT0A 2CU1A 4A3PA 2HE7A 3WIMA 2DAFA 4A3OA 4PS8A 2K39A 3KYDD 2L3ZA 5AZHA 2JZ3B 2MP2B 2ZEQA 3N30A 4G11A 4K7SA 2D11A 2C9WB 4M8NA 4FHJA 3QAQA 2DAJA 2WX0A 5JHAA 3DPDA 2KXJA 4PYUA 4W9CA 5DPRA 1WXAA 2Z59B 4YL8A 4AP4C 1GUAB 1I42A 2KANA 5BO4B 4TQ0A 1YD8U 2WYQA 4M0WB 1V6EA 1XQQA 1TTNA 4JLCA 2KLGA 4OVVA 3UF8A 4NQLB 2DZMA 4W9HA 3QC8B 3OAWA 3S2AA 2ASQA 3IVFA 2JWZA 1IYFA 4J6IA 2NPTA 3CSFA 2MCNB 2ZNVB 4G3XB 4BBNC 3M3JA 3V62A 5DPSA 3DBLI 3M95A 4E71A 4MDKE 3RZFA 3N32A 1I35A 4BVUC 1X1MA 3DVGY 4M8MA 2M1MA 2KHWB 2JF5A 3IHPC 3HHMA 5AEKB 5CHFA 2J0JA 4FJVB 2L00B 3MHSD 1TZ1A 3EHVA 1E8ZA 1WGRA 2C7NB 2KJHB 4GSWA 5CHVC 3VH3B 2PJHA 4P7IA 2LRWA 2ZZPB 3L13A 1Z2MA
chains in the Genus database with same CATH superfamily
3KUDB 4IM3A 3VAWA 4KZ0A 4TV3A 2KX3A 2NPTB 1TS5A 4RGNA 3PS6A 5HG2A 2BS2B 3SEBA 4AQ7A 2RSUA 2ONQA 1SE3A 2NBUA 3BIID 3IAS1 4A90A 1FO4A 3ZRCA 2NMQA 1C3TA 3ZNZB 4AWJA 2NBWB 3V60A 3MJ5A 4CHKA 1JALA 4P1CC 5FR6A 3NZ3A 1P7FA 4A9AA 1N5WA 2INCC 5E6PA 3P4QB 3O65B 3SR6A 4YTNB 5AZFA 2V0GA 1E10A 1N62A 4EEWA 4NZLB 4L1BA 4GXBA 1F77A 5MPOA 2KVZA 1LM8B 3M63B 4WURA 4GDKA 2BVCA 2PLPA 1J19A 4PK1A 3PZ7A 3WAOA 2WXNA 2C5LC 2LI5A 2PPHA 3HIZA 3APCA 3Q8BA 1PUTA 2LASA 2V3NA 3A1QB 3QK0A 4NAWB 1R4MI 1WXVA 2G9HD 4FJZA 3RMKC 2XK5A 4XDCA 1C79A 1QOAA 3L10B 3C19A 4TMAB 2WS3B 1WGDA 3PGEA 4LNKA 2MBEA 2AL3A 3LB8C 1NDDA 1T3QA 3VRBB 3ZJTA 1OTRB 5C23A 2PE9A 3AM9A 2BYEA 3N20C 1K50A 3AEBB 3FAHA 2WX1A 1T0YA 2L0TA 2MX2A 1KLGD 1AW7A 1TS3A 3PREA 2CHWA 3N1ZC 1FPYA 3ABVB 1XD3B 4F1SA 1WIAA 1R4NI 3LYYA 2E3TA 2WLBA 2WDVB 4KV2A 5EE9A 1WGGA 4RGTA 3HUIA 3T8MA 4XDDA 2NS5A 5JZEB 1E6EB 4IWQA 4K3CA 2MH7A 3N9YC 3PTFC 4KDIC 1EWCA 1EM7A 3GE8C 4BKSD 2M17A 2RDBC 1LQBA 2LHEA 2FNJB 3BY4B 3PLUA 2RDHA 3ZRFA 4IWOA 5EE1A 2INDC 4KKIA 4B0MA 2CJNA 4KIKB 2QJLA 4BOSC 1SEBD 3I9V1 1KF6B 1RFAA 2WXFA 4WWPA 3PRPB 5BYQA 2XN9C 4NAMA 3P1MA 1JWBD 1T0SC 4BOZB 4IKGA 1YMHE 3EA6A 5TSSA 4DDID 2EKEC 5CX3A 1WX9A 4NNJB 3IFWB 4CO7A 1TGZB 2LVQA 4ZHOA 3C8YA 5FK9C 1N60A 2INNE 3KVFB 3Q3FA 1EO6A 2KC2A 2FCQA 1P0RA 3FC4A 2IO1B 2HTME 1SXTA 1V80A 2JX5A 2MRPA 1HZ5A 1TY2A 5LLIA 3JSVA 4OZBA 4DK5A 2GLSA 2BGFA 5D2MB 3X0WA 4BKSA 1XEEA 4I6PA 4NJ6A 3NZUA 3NVZA 1WZ0A 4IM2A 4FBJB 2CHZA 3RNFC 1AYFA 2RDGA 2WXQA 4D2KA 2BB6A 5C1ZA 3RFZB 1WYWB 2H88B 4HJKA 2KZRA 3AEAB 1KJTA 3W1SC 4KKJA 2INPE 2IYDB 1SJED 3ECIA 4PYZA 2MLBA 3AEDB 2ON8A 2MJ3A 4AJYB 1OEYA 1TBEA 1CMXB 3WAMA 4HLEA 2XBBC 3OLMD 1TJEA 3RCZA 4BKGA 2KQSA 4PS3A 3NRZA 3HM3A 2LWPA 2L76A 2MSED 1ISNA 2GBMA 2QDFA 3MJWA 2Z0DB 3NOBA 2WQYB 2KX0A 2QSDA 1JWMD 3L17A 1ET6A 2X38A 4FJYA 2KJRA 4GGQA 2BYTA 2CR5A 4ARIA 2MBHA 2KDMA 3ZLZA 5AUIA 2W55A 5G55A 3ZVVA 4IW0A 2CU3A 1P9DU 1L0VB 3ZW3A 3V6EB 1C9FA 3LXFA 4I6LB 4JE3B 4WAAA 4FLHA 3P4SB 2VH1A 3TIXA 3ZKJC 2LUEA 2BT6A 4EZLA 3AEEB 3TSSA 2LXCA 1DOXA 3QA8A 3W2DA 4DHZB 3AE3B 3DHGC 3DQVA 2C60A 1XF5L 2GBJA 2HJ1A 4JGHB 3VTVA 2WU2B 2N9EB 4KDLB 3U52E 2FCNA 1GC6A 2B76B 4LDTB 4MEMA 2L7RA 3MP9A 3RT3B 4ANXA 3ZJUA 2Z0EB 4EKUA 3ZJVA 3GB1A 4YTPB 3W1YA 2KDFB 1FNUA 2CU1A 4A3PA 2OEDA 4RF0A 3ZXVA 4A3OA 1YJJA 4DXFA 4N6EB 1EU3A 5AZHA 3N30A 4K7SA 4G11A 2HDEA 3MC9A 2K22A 5DPRA 2FE8A 1GUAB 1I42A 2KANA 2JZPA 5BO4B 4M0WB 4P16A 3RNBC 4NQLB 3QC8B 3OAWA 1F52A 1QF6A 2ASQA 3IVFA 3DBHB 1ZOYB 4UDUC 1JWSD 4BBNC 3DBRB 1MJDA 2WHIA 2M1MA 1HEZE 1NYRA 1TS4A 4EE2A 5CHFA 2AQ1B 4FJVB 2L00B 3MHSD 3EHVA 3CF6E 1J7CA 3HVDA 4KGRA 1Z2MA 2BKRB 1MI0A 4GN1A 3DCGA 2L83A 2V9HA 3NVYA 5AZGA 2A5UA 4ZRIA 4K3BA 1XCQL 2LMCA 3Q3NC 1FFVA 1SF0A 4AUQC 3R7RA 2ZCBA 1IP9A 4A55A 4TQ1A 3KUCB 4C4VA 5DPWA 5AUKA 2KFKA 1F2RC 3P4RB 1WM2A 1MG8A 2JUOA 2K6QA 2ZVNA 1UBIA 1T5XD 1F9JA 2D5GA 3NVWA 4RNAA 2KVRA 2ZW1A 2ZPNA 4XE0A 3PHXB 3BK1A 1LO5D 1UGMA 1HTOA 2CJOA 1GC7A 4N59A 4JQWC 3K9OB 5HKHA 4RGOS 5DCNA 3IT4B 5EE3A 2Z8LA 4YWGG 1V1PB 4EOYA 1TT5B 4LNOA 5HFYA 3BZDB 5D94A 2KFJA 4BKTA 3MHZA 4LJPB 1SE2A 1OQRA 4WJPA 2KAJA 4F7ZA 1QOFA 1D3ZA 1UZXB 3VQIA 3A33B 3DVNV 2WXIA 4HPLB 1XLOA 2N9XA 2UU7A 5J2RA 1C1YB 4WWNA 4KGSA 4XGAB 2JVCA 2FUHB 4GDKB 2KMMA 3ONSA 4IWPA 2YLMA 1ESFA 4OZCA 3NG0A 4YXDB 3TEXA 1FXAA 1ZE3D 2Y3AA 1XXGA 2GB1A 2KNBA 1WR1A 5J17A 2EELA 3AXCA 3GZNB 3H8HA 4P1BC 3ZQ4A 3UQBA 2AEHA 3MC0B 2QIEB 1QLBB 1WXSA 4FA6A 3TCAA 3W5UB 4JIOU 2W54A 2NTSA 5D3IB 1B9RA 2AYOB 3KQ4A 3AE2B 1RRBA 2DNFA 2LJ5A 3ZYYX 2KACA 3UQAA 3MFGA 1WM3A 3ZNID 3WA0A 1E0ZA 3EC8A 1WI0A 3VHTC 4XX5A 5FR3A 4C7ZA 1E8YA 1NVID 5IA7A 4DBGA 4W9JA 3A9JA 2L8JA 2J7QB 2I1KA 4FADA 3AE9B 3D32A 3SU8X 3LJ3A 1WMHB 2KMAA 1WSPA 1IGCA 2MEKA 2LGIA 1C77A 2VRRB 4GLSC 2PIAA 2PTLA 2KC1A 2KK8A 1D4BA 3VTUA 3B2FA 4R3DA 4DWFA 2KD0A 1UH6A 3ZDMC 3X23A 4MGZE 3QQ8B 4IUMB 1SIJA 3JVZX 4ZRPA 1UD7A 2EMTA 2DYOA 3ZDTA 2ZNVC 3V05A 5EE0A 1LXDA 1VZ6A 2GRIA 2J4XA 3HRDD 5HI1A 1D5ZC 2D3GA 3PZDA 2HTHA 1N6ZA 4ZRJA 2MP2A 1V5OA 5D6JB 3T3OA 2W9NA 1OQYA 3AI5A 5G5HA 1K8RB 5H92C 2ICIA 3W9CB 2MBOA 5FKAC 2DYBA 4RMAA 3BWUD 3B2GA 4XWWA 4HRSA 3BK2A 2G3QB 3ENEA 2V3PA 3KLSX 4B6WA 1L5PA 4BAXA 4DHZE 2D07B 1JQ4A 2KN4A 2O6VD 3DOWA 3Q3OC 2NTTA 4L2YA 3CWIA 4LNIA 2E6XA 2W3SA 3TMPB 5IKCM 1K51A 1FM0D 1V9JA 2JYTA 1TYGB 4HROA 5E6OA 4MH0E 4EUTA 1XT9B 2GBRA 2JSVX 3JSVB 2LXAA 2PKOA 4XC2A 2DBYA 1UWMA 2N7EA 3PRZA 2D3CA 3N3KB 3T3NA 3AH7A 2J42A 4J3OD 4WWMA 3A9KA 1E8WA 1QOBA 1H4RA 4W9EA 1KLVA 3EGRA 1JCKB 4GDLA 3QX1A 1L6VA 1EWYC 1R4MB 4GIVA 3B08A 4RM8A 2WXKA 4MT5A 3RULA 1EU4A 2WXRA 1N61A 4HWIB 3ALBA 4EZKA 2K6DB 2FAZA 3Q3JA 1WJ6A 1FMAD 4ZYSA 4ANUA 4HDQA 3UGBB 3GS2A 1TZOA 1IBXB 2WGSA 3V61A 2DZJA 2O6VA 2VZKD 4IM0A 1L0YB 2ZCCA 3L08A 5J18A 4K7WA 1CZPA 2N9KA 3WALA 3R3MA 2N9PC 3I57A 4MSMB 4TKNA 4ZYNA 4WH4A 2EMSA 3RNCC 1KLUD 2N1WA 2J0KA 4JX1C 4WJQA 4KSKC 3CMMB 4OW0A 1V1OA 2V1YA 1QKZA 1S3SG 2IDYA 1R4NB 4W9IA 4NAWA 1J7BA 2QILA 2OJWA 1RYJA 2QCZA 3Q3MC 1STEA 1RAXA 1RFKA 5IOIA 1QZEA 2AQ3B 1XLPA 1I4XA 1ET9A 3AECB 1CJEA 2HE7A 1T6BX 3WIMA 1KRHA 2K9XA 1VJKA 4YSXB 5GXGB 1J7AA 4M00A 4FHJA 2DAJA 2WX0A 4PT5A 1SJHD 3P63A 4PYUA 4YL8A 4AP4C 2M19A 4TQ0A 1FFUA 2SEBD 4N58A 3DWMA 5IP4D 1TTNA 4OVVA 2KLGA 4JWSC 2PW9A 2JWZA 4J6IA 1VZ7A 2MCNB 4G3XB 1MFWA 3M3JA 1TIFA 4E71A 2DLBA 1SBBB 4MDKE 3N32A 3U4EG 1SE4A 2KHWB 2JF5A 3AEFB 3IHPC 3HHMA 2WXHA 1YOVB 2Y5PA 4LNNA 2J0JA 1CQVA 1PYWD 1E8ZA 2C7NB 4GSWA 2KJHB 5CHVC 3VH3B 4YTMB 4P7IA 2MA9B 2LRWA 2ZZPB 2XNAC 3L13A 1QILA 4ZRQA 1I4HA 4FXCA 1OFFA 1RM6C 3QHTA 1JWAD 1WF9A 1UUPA 4USAA 3FILB 3HK0A 2IY1B 3W1SA 3MTNB 1WE7A 3BYYB 1V49A 1C4CA 4LNFA 4KIKA 3PRMB 2KQ7A 2JRHA 1LFDA 4K81A 4A8XC 3KWLA 3O13A 4RH6A 2QC8A 2GI9A 1FRDA 3KWVA 3QARA 4WAFA 1F2RI 3AE5B 1JROA 1Q0WB 4X57B 3H1UA 1E5WA 2K3UA 4W9LA 3JW0X 1XLNA 1TKGA 3IXSA 2UWQA 5D7GA 1FNVA 3P42A 1FIQA 3AE6B 2KFKB 1B1ZA 2IO3B 4WJNA 2WU5B 3BYTB 1E7PB 3CIRB 2ZVOA 4FULA 1A70A 2JPHA 3GP7A 1I4GA 4RF1A 1FXTB 3DVGX 3Q69A 3DBRI 2SAKA 4MM3B 3VDZA 1AWDA 4IG7B 2LZ6A 1YNTE 3R2TA 3RD2A 2QHOA 3APFA 3I5JC 2R61A 1WX8A 2FUG1 1MPEA 1CK1A 5JXVA 1FCCC 1P1AA 2BPSA 2DYMA 2KDIA 4WWOA 4ZRKA 2DZKA 1EUVB 4IOIE 3TEWA 4RM9A 1E7UA 3AMZA 2MW5A 1QQRA 3ETRA 3P4PB 1UELA 2D10A 3U30A 3BVGA 1YN4A 3FKYA 2RPQA 2KWDA 2CKHB 1BXTA 2GMIC 3IT6B 4ICUA 4HEA1 4MGIE 1EF1A 2K1FA 3DVNU 4TUUA 2BW2A 3DWGC 3EUB2 2WXOA 3R66C 5C2TB 4ARCA 2FCMA 2LHDA 2KTRA 3UINB 3U7DA 2Q5WD 1QOGA 3RYTA 1MVKA 2RD0A 2M0AA 2ZW0A 2KN5A 1HQRD 1F1HA 1HA5A 2WDRB 4PS7A 2JXTA 3NY5A 3VUWA 5CHWA 4LJOB 4C7YA 3DHIC 3B0AA 2BBCA 4OVZA 1C4AA 3PZ8A 1HZ6A 2GBNA 2MBBB 3TUOA 3TL5A 2G4DB 1MHHE 3SFEB 3NUHB 4S0RA 1DOYA 1L4DB 3RPFC 1E90A 2LGSA 2MJEA 2ZJDA 2BQQA 5E6JA 2JZZA 3ZUNA 3URYA 4BZAA 2KWCA 3B1LX 5BMGA 3ML9A 2HD5B 1Q5WB 4HJGE 4XZ4A 4DXGA 3B9JA 2KDEB 3VRAB 2B3AA 2RMMA 2PMVA 4HPMB 4DXAB 4KZCA 1WJ4A 4NQKE 1A5RA 3AEGB 5KHQA 1DYQA 4TSSA 2M56B 4CQNA 4E3CA 1E8XA 4NY0A 3N1YC 1WR6E 3RN9C 2O2VA 3HM6X 1WWTA 1GOZA 1GAQB 4B95A 4C80A 3RNEC 1MG4A 4MGKE 2ACZB 3Q8CA 2D3BA 2KKCA 1TS2A 2L05A 2DX5B 4AOFA 3H6NA 1M4VA 1TKYA 3EFUA 4DHJD 2KO3A 1JW9D 3WAPA 2JU6X 2KLCA 4RGMA 4HDOA 2D3AA 3Q2AC 3NS1A 2WDQB 2DZIA 1KH0A 2GOWA 4A6QA 1PGBA 1WYGA 3TBLD 3AE7B 2L52A 4ZHPA 1WJNA 1MHXA 1SE9A 2I1JA 2R2OA 3AULA 2LRUA 4RCOA 1K53A 1I7HA 1ZGUB 2XK5B 2WWZA 2M4NA 4HK2A 2V3SA 1H8CA 4DDGD 3AB5A 3AE8B 5H8YE 3AN1A 3APDA 1EF5A 2K8BA 1G6JA 4LTUA 2PVOD 2HJ8A 3NVVA 4B0EA 2OJRA 2BKFA 4FN2A 3H7PA 1L2NA 3QIJA 3EFCA 5DPTA 1M94A 3C0RB 2WXMA 3PPAA 4K7UA 1TKEA 3KW5B 4RFBA 4HXDA 1WGYA 1D6EC 3UIPB 4AJWA 4ZOHC 1GB4A 2JYEA 1YQ3B 2YEPB 4W9FA 2N1VA 3A9KB 4HCNB 1V81A 2BB5A 1R7SA 1ZPSA 3DBLB 1FEHA 1NI3A 2WXGA 4GDLB 1JRUA 4MJSA 1UGJA 2DHZA 4JWUC 1WRIA 2IO2B 2WNMA 3GOEA 4HCPB 1OGWA 1V1PA 4O1NA 2BWES 2N9LA 3IG3A 1SIFA 3AU5A 1XLQA 2R2QA 3PT2B 4HVBA 1GJZA 1FNWA 2W82A 4MELA 1I4PA 1SB3C 4OVUA 2ZPYA 2JRIB 5D3DA 2FIFA 1FXIA 3PHWB 3VR9B 3WCQA 1NENB 4XWTA 2O6VB 1PFDA 2KWVB 2AX5A 1WFYA 2CS4A 3PO0A 2N7DA 5CTRC 2BS3B 2K25A 2GBKA 4HKQA 1ZUD2 1ZDVA 3DBSA 2BS4B 1ZXIA 1WGHA 2FIDA 3RZWC 3BVZA 1GG3A 1Z5SB 1BUIC 1NI2A 1YX6B 3OJ3A 4URKA 4PS8A 2K39A 3AE1B 3KYDD 2L3ZA 1YN5A 1L4ZB 2C9WB 4M8NA 1UWXA 3QAQA 3DPDA 3TEZA 2KXJA 4W9CA 1WXAA 1ACCA 3V3XA 2QEJC 1YD8U 2WYQA 2KQ4X 1XQQA 4US9A 4W9HA 1L6UA 1LGRA 1IYFA 2NPTA 3CSFA 2Y5CA 5DPSA 1IGDA 3M95A 1I35A 4BVUC 2VZKB 4DQOC 1I4QA 3AE4B 1XCTL 1WGRA 2LUMA 3IAM1 2JQRB 4S17A 4MH8A 1V2YA 5C3JB 3KUZA 5JH5C 2YEPF 2KMCA 4GMVA 1WMHA 3CSTA 5TR5A 3SHQA 3IBEA 4ICVA 1OEYJ 2MQJA 3QJZA 3KH0A 3LDZE 5EDSA 5LXHA 1V8CA 5I4DA 3V6CB 2KDBA 1WJUA 3I63C 3ZTDA 3VXWA 4M02A 3U7ZA 2MWSB 3R7QA 2DENB 1NEKB 4W9KA 4E74A 1TY0A 2PEAA 2MJDA 4BFRA 2PE6B 1RWSA 1UNSA 4G50A 3OWEB 3Q8EA 2K5PA 3RNGC 4FHKA 2RGFA 4AS1A 1E7VA 3NHEB 2DWQA 5HHDG 4C00A 2RR9A 5G5GA 2NCNA 1SGHA 4JPSA 1U4AA 1WZ3A 4H2AA 3Q6BA 4KGTA 3A1QA 2A4ZA 4L23A 4W9DA 1VR9A 3SDLC 3I3TB 1HTQA 3Q14C 1KFYB 4WIPA 3K9PB 1V86A 2IBIB 2MHJA 4IC7B 4KX6B 4XYCA 1P3QU 1KM7A 3WANA 2BF8B 3L0WB 5L95C 3A4SC 1L0XB 1HE8A 3PSEB 4NJ7A 2KT7A 1RLFA 2IZVB 2G45B 2KOXA 4NJCA 5BMIA 2K8HA 3N1XC 1YJIA 1WX7A 2UYZB 2JT4B 3VR8B 4C56C 1ZP0B 2IGGA 2LGYA 2L0FA 1GNUA 3QCAA 1Q1OA 3ZNGC 1AARA 1JRPA 1ZDXA 2K0PA 3ZO5B 1UF0A 1P7EA 2BWFA 2C7HA 4LCDE 3BINA 1S1QB 2KTFA 2TSSA 2N7JA 3JYUA 4P6VF 2L1AA 1Y8RC 1ZW7A 1WE6A 1V5TA 3L16A 1AN8A 3U2SC 2G4SA 4LK0M 2M0XA 5L83A 3L4PA 2V4IB 1NBFC 1WY8A 4MSQB 2AL6A 4Q2JA 1DOIA 1V97A 3VFKA 2LVPA 3VUYA 1IBXA 2BTEA 4GU2A 4ASWC 4OZAA 3PV1A 1N5XA 3ZGZA 1NYQA 1J8CA 4CYEA 2MBQA 2IJ0A 1C78A 1PDXA 2WDTB 3P2BA 2IPKD 2I38A 4EFOA 2AWTA 3ML8A 2KTRB 3MC8A 3QWZB 5BYSA 2LD9A 3U8ZA 2G1EA 3DHHC 1YJ1A 4MACA 4ZDVA 1FCLA 1I4RA 1ROEA 4C4VB 1FD6A 1IUEA 2WXJA 2VH2A 3AV8A 4IDIA 5IN7A 4KVGB 2K8CA 3R2IA 2FBWB 1C4PA 1YIWA 2KJ6A 2W3RA 1WXMA 3DBHI 1T0QC 5G2NA 2J0MA 2N0SB 3ZIMA 2J52A 4A20A 3OG5A 1C76A 2N4FA 3KYCD 1KOTA 1DGJA 4ANVA 1VCBA 1GB1A 2IO0B 3PLVA 5BMHA 4G0NB 1SSNA 2LGDA 1VLBA 3EECA 1VD2A 1XO3A 4MGYE 2BYVE 2Y5BB 3TEYA 4N9F4 1WXQA 4II3B 5E6NA 5IAAC 2JXXA 1OQQA 4II2B 4W9GA 2IGDA 4HKZE 2O2VB 4LLGM 2YVCA 3PVLA 2LGXA 3RI7C 4WQOB 4LDTD 1WH3A 2WP9B 3ZNHB 1VZ8A 1YX5B 1WRDB 3L54A 2H89B 4GB9A 2KWUB 4WQMA 1QT9A 1UBQA 2LVOA 1P98A 2AQ2B 3FILA 3H7SA 3RUIB 2NR2A 2PVGC 3UIOB 2NVUI 3R8BA 4ITKA 1PQSA 4QAYA 1PGXA 3VVWB 2KYWA 3E56A 2QMTA 5LXIB 1L7YA 5KHOA 3J9CA 3AU4A 1YQBA 3BVMA 3Q8FA 1VDVA 1N63A 5BYRA 4NPNA 4B9KA 5JHBA 1F0ZA 1J0GA 3SD5A 4US8A 3NS8A 3ZTCA 3NZSA 4OHJA 3H9DA 2FCSA 2V4LA 2NBVB 2CHXA 3SFDB 2IGHA 4WJOA 1IPGA 1VRAB 4BBNF 2J53A 3H7PB 3VH4B 2LJIA 2OHFA 2X8XX 5T8IA 3T9LA 2REXA 1D5MC 4DHJB 4ANWA 3OJ4B 2JWUA 3ZXRA 1E9MA 4MM3A 4I6NB 3A9JB 4F8CB 5IO9A 3M62B 2BYFA 3VUXA 3A4RA 2C7MB 1ZKHA 4EZJA 3VTWA 2OOBB 2M8SA 1KTKA 2D2QA 3DDCB 4MJSB 3GZNI 1JMLA 1K52A 2XEWA 4KSLC 1WGKA 4YSZB 3HVZA 3Q8AA 4YSYB 4M0WA 1Y56A 4JL9A 2IY0B 2JY6A 4GOCA 3TJPA 4K1RB 5GMVA 2I2YA 1YQ4B 4REZA 1Q10A 1BT0A 1ENFA 2DAFA 3GE3C 2WXLA 2JZ3B 2MP2B 2ZEQA 2L32A 2D11A 5JHAA 2LFIA 1T0RC 2Z59B 3UI3A 3W5VB 5LNK1 4ACFA 4HPPA 1V6EA 4JLCA 3UF8A 2DZMA 1D5XC 2RPVA 3S2AA 3NJTA 4YT0B 1GPXA 1FRRA 1YN3A 2ZNVB 1PGAA 3V62A 2LEKA 1HXYD 3DBLI 4M01A 3RZFA 1X1MA 3DVGY 3E9SA 4M8MA 1BMLC 2EKIA 5AEKB 2WXPA 1TZ1A 2PJHA 3RNAC 1ZXHA 1JWUD
chains in the Genus database with same CATH topology
2BKRB 3KUDB 4IM3A 1V2YA 3KUZA 4GN1A 5JH5C 3VAWA 4KZ0A 3DCGA 2KMCA 4GMVA 1WMHA 3QHTA 5AZGA 2A5UA 1WF9A 4TV3A 2KX3A 4ZRIA 3CSTA 2NPTB 3HK0A 5TR5A 3PS6A 3SHQA 3IBEA 2IY1B 4ICVA 1OEYJ 2MQJA 3QJZA 3W1SA 3MTNB 1WE7A 3KH0A 3LDZE 2RSUA 1V49A 5EDSA 4AUQC 5LXHA 2NBUA 4KIKA 2ZCBA 3R7RA 1IP9A 3PRMB 4TQ1A 3V6CB 2KQ7A 3KUCB 2JRHA 1LFDA 1WJUA 2KDBA 3ZRCA 5DPWA 4K81A 3ZTDA 2KFKA 3VXWA 1C3TA 3ZNZB 4AWJA 2MWSB 2NBWB 3R7QA 1WM2A 1MG8A 2DENB 3V60A 2JUOA 2K6QA 2ZVNA 4W9KA 4E74A 1UBIA 2PEAA 4CHKA 4BFRA 2PE6B 3QARA 4G50A 1F9JA 5FR6A 4FHKA 2RGFA 1Q0WB 2KVRA 4X57B 1E7VA 3H1UA 2ZPNA 1E5WA 3NHEB 3PHXB 5E6PA 1UGMA 2RR9A 1GC7A 4W9LA 2NCNA 3O65B 3JW0X 4JQWC 3K9OB 5AZFA 1SGHA 1U4AA 1WZ3A 2UWQA 5D7GA 3A1QA 2A4ZA 5HKHA 2KFKB 5DCNA 4EEWA 4W9DA 3SDLC 3I3TB 2IO3B 4WJNA 4GXBA 4EOYA 2ZVOA 3K9PB 1V86A 2IBIB 4FULA 2JPHA 1LM8B 3M63B 4IC7B 2MA9B 4GDKA 1P3QU 1FXTB 1KM7A 5D94A 3WANA 2BF8B 3L0WB 3DVGX 2KFJA 4BKTA 5L95C 1J19A 3DBRI 3A4SC 3PSEB 1HE8A 4NJ7A 3VDZA 4LJPB 4IG7B 1RLFA 2LZ6A 3WAOA 2IZVB 2G45B 2C5LC 3RD2A 2KOXA 2QHOA 2K8HA 2LI5A 2PPHA 4WJPA 3HIZA 4F7ZA 3APFA 3APCA 2LASA 1D3ZA 1UZXB 1WX7A 3A1QB 3QK0A 2UYZB 4NAWB 1R4MI 3VQIA 1WXVA 2JT4B 1WX8A 3A33B 1P1AA 2LGYA 3DVNV 4HPLB 2BPSA 2DYMA 2L0FA 2N9XA 4FJZA 1GNUA 5J2RA 1C1YB 3QCAA 2KDIA 4WWNA 2XK5A 1Q1OA 4WWOA 4ZRKA 3ZNGC 3L10B 2DZKA 1AARA 1EUVB 3ZO5B 2JVCA 2FUHB 4RM9A 1E7UA 2BWFA 4LCDE 1WGDA 2C7HA 2MW5A 3BINA 3PGEA 4GDKB 2MBEA 2AL3A 1NDDA 3ONSA 1S1QB 4IWPA 2KTFA 2YLMA 3JYUA 1UELA 1Y8RC 1ZW7A 1OTRB 2D10A 5C23A 3U30A 1WE6A 1V5TA 3L16A 2PE9A 2BYEA 2KNBA 2G4SA 1WR1A 5J17A 2RPQA 2CKHB 3AXCA 2M0XA 2GMIC 5L83A 4ICUA 2WX1A 1EF1A 4MGIE 3UQBA 2AEHA 1NBFC 1WY8A 2K1FA 4MSQB 3DVNU 1T0YA 1WXSA 2AL6A 2L0TA 4TUUA 2MX2A 3R66C 3VFKA 4FA6A 2FCMA 2LVPA 3TCAA 2KTRA 3UINB 3U7DA 3PREA 4JIOU 3VUYA 2CHWA 4GU2A 4ASWC 1XD3B 3RYTA 4F1SA 2RD0A 2AYOB 1WIAA 2KN5A 3PV1A 1R4NI 1RRBA 4PS7A 2LJ5A 1J8CA 4CYEA 3UQAA 3NY5A 2MBQA 1WM3A 3VUWA 3ZNID 4KV2A 1WGGA 5CHWA 3WA0A 4LJOB 2WDTB 3B0AA 3EC8A 1WI0A 3T8MA 3P2BA 3VHTC 2NS5A 4XX5A 4EFOA 5JZEB 2AWTA 1E8YA 2GBNA 2MBBB 3ML8A 4IWQA 3TL5A 2G4DB 4DBGA 5IA7A 4W9JA 2KTRB 3A9JA 2L8JA 3PTFC 2J7QB 2I1KA 4KDIC 4FADA 3D32A 3QWZB 3LJ3A 3SU8X 1WMHB 1E90A 4BKSD 2M17A 2KMAA 1LQBA 2LD9A 3U8ZA 2VRRB 2ZJDA 2FNJB 3BY4B 3PLUA 3ZRFA 1YJ1A 2JZZA 4IWOA 4ZDVA 3ZUNA 2KC1A 2KK8A 2KWCA 3B1LX 3VTUA 3ML9A 4KIKB 2HD5B 4DWFA 4BOSC 1Q5WB 2KD0A 1UH6A 4XZ4A 3ZDMC 3X23A 4MGZE 3QQ8B 4IUMB 2KDEB 3JVZX 4KVGB 1RFAA 1UD7A 2B3AA 2DYOA 2EMTA 2K8CA 3ZDTA 2ZNVC 4WWPA 4HPMB 4DXAB 4KZCA 3PRPB 1WJ4A 4NQKE 1A5RA 5KHQA 1YIWA 4BOZB 1LXDA 2KJ6A 4E3CA 1WXMA 1E8XA 3DBHI 4DDID 5G2NA 2J0MA 4NY0A 2D3GA 3PZDA 3ZIMA 2EKEC 5CX3A 1WX9A 2HTHA 1WR6E 4ZRJA 4A20A 2MP2A 4NNJB 3IFWB 1V5OA 2O2VA 3HM6X 4CO7A 2N4FA 3KYCD 1TGZB 1KOTA 5D6JB 4ANVA 2LVQA 4B95A 1VCBA 2W9NA 2IO0B 3PLVA 4MGKE 2L05A 2KKCA 1OQYA 2DX5B 3AI5A 3KVFB 4AOFA 3H6NA 3Q3FA 4G0NB 1EO6A 1K8RB 2KC2A 2FCQA 2LGDA 1P0RA 3EFUA 2IO1B 4DHJD 2KO3A 2MBOA 1V80A 3EECA 2DYBA 1VD2A 2MRPA 4MGYE 5LLIA 3WAPA 2KLCA 4RMAA 2BYVE 2Y5BB 3JSVA 4DK5A 4HDOA 2BGFA 2G3QB 5D2MB 3X0WA 3ENEA 2DZIA 4N9F4 4BKSA 4II3B 5E6NA 2GOWA 5IAAC 4B6WA 2JXXA 4I6PA 4II2B 4NJ6A 3TBLD 3NZUA 4W9GA 2O2VB 1WZ0A 4DHZE 1WJNA 2YVCA 4IM2A 2D07B 2LGXA 3PVLA 1SE9A 4FBJB 2CHZA 2I1JA 2O6VD 3DOWA 4LDTD 4WQOB 2R2OA 1WH3A 3AULA 2LRUA 5C1ZA 3TMPB 3ZNHB 1WYWB 1YX5B 1V9JA 1WRDB 3L54A 4HJKA 2KZRA 5E6OA 4GB9A 2KWUB 4MH0E 1ZGUB 1KJTA 3W1SC 4EUTA 2XK5B 2WWZA 1XT9B 2GBRA 2IYDB 2M4NA 3ECIA 1UBQA 3JSVB 2LXAA 4PYZA 2MLBA 4HK2A 2LVOA 2V3SA 4AJYB 4XC2A 1OEYA 1P98A 1H8CA 1TBEA 3H7SA 3RUIB 4DDGD 1CMXB 2N7EA 3PRZA 3WAMA 3CF6E 2NR2A 3N3KB 3APDA 4HLEA 3UIOB 1EF5A 2NVUI 2XBBC 3OLMD 3A9KA 2K8BA 3RCZA 1E8WA 4BKGA 1G6JA 2HJ8A 1PQSA 1H4RA 2KQSA 2OJRA 4W9EA 4PS3A 3VVWB 1KLVA 2BKFA 4GDLA 5LXIB 3HM3A 2LWPA 3QX1A 2L76A 2MSED 3H7PA 1ISNA 1L7YA 2GBMA 4FN2A 5KHOA 3MJWA 4GIVA 3B08A 4RM8A 1L2NA 2Z0DB 3QIJA 3RULA 3NOBA 2KX0A 5DPTA 1M94A 3C0RB 3AU4A 1YQBA 3L17A 4HWIB 3ALBA 4EZKA 2K6DB 4FJYA 3PPAA 4K7UA 2KJRA 2FAZA 3Q3JA 1WJ6A 2CR5A 3KW5B 4GGQA 4NPNA 4B9KA 5JHBA 1J0GA 2MBHA 4ANUA 4HXDA 3SD5A 4HDQA 3UGBB 3NS8A 3ZLZA 1WGYA 3ZTCA 5G55A 3NZSA 3ZVVA 4IW0A 3UIPB 3V61A 4AJWA 3H9DA 1P9DU 2DZJA 2FCSA 2V4LA 4W9FA 2N1VA 3A9KB 2NBVB 4HCNB 2CHXA 3ZW3A 1V81A 4WJOA 3V6EB 1IPGA 2O6VA 4BBNF 4IM0A 4GDLB 1JRUA 4I6LB 4MJSA 2ZCCA 3H7PB 2DHZA 3L08A 3VH4B 4K7WA 5J18A 2IO2B 4WAAA 4FLHA 3GOEA 3WALA 4HCPB 3T9LA 1OGWA 2REXA 3R3MA 2N9PC 3TIXA 4DHJB 2BWES 4MSMB 4ANWA 3IG3A 2LUEA 1SIFA 3OJ4B 4TKNA 4ZYNA 3ZKJC 4EZLA 3AU5A 2R2QA 2LXCA 3PT2B 4HVBA 1GJZA 2EMSA 3QA8A 4DHZB 2N1WA 3DQVA 2J0KA 2C60A 4I6NB 4MELA 3A9JB 4MM3A 4KSKC 3CMMB 4WJQA 4OVUA 4F8CB 3VTVA 2GBJA 2ZPYA 3M62B 2BYFA 2JRIB 4JGHB 2N9EB 2V1YA 4KDLB 3VUXA 3A4RA 2C7MB 2FIFA 1S3SG 2FCNA 1ZKHA 4EZJA 1GC6A 3PHWB 3VTWA 4W9IA 4NAWA 2O6VB 2OOBB 2M8SA 4LDTB 4MEMA 2D2QA 3DDCB 2L7RA 4MJSB 3GZNI 3RT3B 2KWVB 1WFYA 2CS4A 2XEWA 4KSLC 2N7DA 1RAXA 5CTRC 4ANXA 2K25A 2GBKA 2Z0EB 1QZEA 4EKUA 3DBSA 2FIDA 1WGHA 4JL9A 3RZWC 2IY0B 2JY6A 4GOCA 3TJPA 4K1RB 1GG3A 5GMVA 3W1YA 2KDFB 1Z5SB 1NI2A 1YX6B 3OJ3A 4URKA 1BT0A 2CU1A 4A3PA 2HE7A 3WIMA 2DAFA 4A3OA 4PS8A 2K39A 3KYDD 2L3ZA 5AZHA 2JZ3B 2MP2B 2ZEQA 3N30A 4G11A 4K7SA 2D11A 2C9WB 4M8NA 4FHJA 3QAQA 2DAJA 2WX0A 5JHAA 3DPDA 2KXJA 4PYUA 4W9CA 5DPRA 1WXAA 2Z59B 4YL8A 4AP4C 1GUAB 1I42A 2KANA 5BO4B 4TQ0A 1YD8U 2WYQA 4M0WB 1V6EA 1XQQA 1TTNA 4JLCA 2KLGA 4OVVA 3UF8A 4NQLB 2DZMA 4W9HA 3QC8B 3OAWA 3S2AA 2ASQA 3IVFA 2JWZA 1IYFA 4J6IA 2NPTA 3CSFA 2MCNB 2ZNVB 4G3XB 4BBNC 3M3JA 3V62A 5DPSA 3DBLI 3M95A 4E71A 4MDKE 3RZFA 3N32A 1I35A 4BVUC 1X1MA 3DVGY 4M8MA 2M1MA 2KHWB 2JF5A 3IHPC 3HHMA 5AEKB 5CHFA 2J0JA 4FJVB 2L00B 3MHSD 1TZ1A 3EHVA 1E8ZA 1WGRA 2C7NB 2KJHB 4GSWA 5CHVC 3VH3B 2PJHA 4P7IA 2LRWA 2ZZPB 3L13A 1Z2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKR B;  3KUD B;  4IM3 A;  1V2Y A;  3KUZ A;  4GN1 A;  5JH5 C;  3VAW A;  4KZ0 A;  3DCG A;  2KMC A;  4GMV A;  1WMH A;  3QHT A;  5AZG A;  2A5U A;  1WF9 A;  4TV3 A;  2KX3 A;  4ZRI A;  3CST A;  2NPT B;  3HK0 A;  5TR5 A;  3PS6 A;  3SHQ A;  3IBE A;  2IY1 B;  4ICV A;  1OEY J;  2MQJ A;  3QJZ A;  3W1S A;  3MTN B;  1WE7 A;  3KH0 A;  3LDZ E;  2RSU A;  1V49 A;  5EDS A;  4AUQ C;  5LXH A;  2NBU A;  4KIK A;  2ZCB A;  3R7R A;  1IP9 A;  3PRM B;  4TQ1 A;  3V6C B;  2KQ7 A;  3KUC B;  2JRH A;  1LFD A;  1WJU A;  2KDB A;  3ZRC A;  5DPW A;  4K81 A;  3ZTD A;  2KFK A;  3VXW A;  1C3T A;  3ZNZ B;  4AWJ A;  2MWS B;  2NBW B;  3R7Q A;  1WM2 A;  1MG8 A;  2DEN B;  3V60 A;  2JUO A;  2K6Q A;  2ZVN A;  4W9K A;  4E74 A;  1UBI A;  2PEA A;  4CHK A;  4BFR A;  2PE6 B;  3QAR A;  4G50 A;  1F9J A;  5FR6 A;  4FHK A;  2RGF A;  1Q0W B;  2KVR A;  4X57 B;  1E7V A;  3H1U A;  2ZPN A;  1E5W A;  3NHE B;  3PHX B;  5E6P A;  1UGM A;  2RR9 A;  1GC7 A;  4W9L A;  2NCN A;  3O65 B;  3JW0 X;  4JQW C;  3K9O B;  5AZF A;  1SGH A;  1U4A A;  1WZ3 A;  2UWQ A;  5D7G A;  3A1Q A;  2A4Z A;  5HKH A;  2KFK B;  5DCN A;  4EEW A;  4W9D A;  3SDL C;  3I3T B;  2IO3 B;  4WJN A;  4GXB A;  4EOY A;  2ZVO A;  3K9P B;  1V86 A;  2IBI B;  4FUL A;  2JPH A;  1LM8 B;  3M63 B;  4IC7 B;  2MA9 B;  4GDK A;  1P3Q U;  1FXT B;  1KM7 A;  5D94 A;  3WAN A;  2BF8 B;  3L0W B;  3DVG X;  2KFJ A;  4BKT A;  5L95 C;  1J19 A;  3DBR I;  3A4S C;  3PSE B;  1HE8 A;  4NJ7 A;  3VDZ A;  4LJP B;  4IG7 B;  1RLF A;  2LZ6 A;  3WAO A;  2IZV B;  2G45 B;  2C5L C;  3RD2 A;  2KOX A;  2QHO A;  2K8H A;  2LI5 A;  2PPH A;  4WJP A;  3HIZ A;  4F7Z A;  3APF A;  3APC A;  2LAS A;  1D3Z A;  1UZX B;  1WX7 A;  3A1Q B;  3QK0 A;  2UYZ B;  4NAW B;  1R4M I;  3VQI A;  1WXV A;  2JT4 B;  1WX8 A;  3A33 B;  1P1A A;  2LGY A;  3DVN V;  4HPL B;  2BPS A;  2DYM A;  2L0F A;  2N9X A;  4FJZ A;  1GNU A;  5J2R A;  1C1Y B;  3QCA A;  2KDI A;  4WWN A;  2XK5 A;  1Q1O A;  4WWO A;  4ZRK A;  3ZNG C;  3L10 B;  2DZK A;  1AAR A;  1EUV B;  3ZO5 B;  2JVC A;  2FUH B;  4RM9 A;  1E7U A;  2BWF A;  4LCD E;  1WGD A;  2C7H A;  2MW5 A;  3BIN A;  3PGE A;  4GDK B;  2MBE A;  2AL3 A;  1NDD A;  3ONS A;  1S1Q B;  4IWP A;  2KTF A;  2YLM A;  3JYU A;  1UEL A;  1Y8R C;  1ZW7 A;  1OTR B;  2D10 A;  5C23 A;  3U30 A;  1WE6 A;  1V5T A;  3L16 A;  2PE9 A;  2BYE A;  2KNB A;  2G4S A;  1WR1 A;  5J17 A;  2RPQ A;  2CKH B;  3AXC A;  2M0X A;  2GMI C;  5L83 A;  4ICU A;  2WX1 A;  1EF1 A;  4MGI E;  3UQB A;  2AEH A;  1NBF C;  1WY8 A;  2K1F A;  4MSQ B;  3DVN U;  1T0Y A;  1WXS A;  2AL6 A;  2L0T A;  4TUU A;  2MX2 A;  3R66 C;  3VFK A;  4FA6 A;  2FCM A;  2LVP A;  3TCA A;  2KTR A;  3UIN B;  3U7D A;  3PRE A;  4JIO U;  3VUY A;  2CHW A;  4GU2 A;  4ASW C;  1XD3 B;  3RYT A;  4F1S A;  2RD0 A;  2AYO B;  1WIA A;  2KN5 A;  3PV1 A;  1R4N I;  1RRB A;  4PS7 A;  2LJ5 A;  1J8C A;  4CYE A;  3UQA A;  3NY5 A;  2MBQ A;  1WM3 A;  3VUW A;  3ZNI D;  4KV2 A;  1WGG A;  5CHW A;  3WA0 A;  4LJO B;  2WDT B;  3B0A A;  3EC8 A;  1WI0 A;  3T8M A;  3P2B A;  3VHT C;  2NS5 A;  4XX5 A;  4EFO A;  5JZE B;  2AWT A;  1E8Y A;  2GBN A;  2MBB B;  3ML8 A;  4IWQ A;  3TL5 A;  2G4D B;  4DBG A;  5IA7 A;  4W9J A;  2KTR B;  3A9J A;  2L8J A;  3PTF C;  2J7Q B;  2I1K A;  4KDI C;  4FAD A;  3D32 A;  3QWZ B;  3LJ3 A;  3SU8 X;  1WMH B;  1E90 A;  4BKS D;  2M17 A;  2KMA A;  1LQB A;  2LD9 A;  3U8Z A;  2VRR B;  2ZJD A;  2FNJ B;  3BY4 B;  3PLU A;  3ZRF A;  1YJ1 A;  2JZZ A;  4IWO A;  4ZDV A;  3ZUN A;  2KC1 A;  2KK8 A;  2KWC A;  3B1L X;  3VTU A;  3ML9 A;  4KIK B;  2HD5 B;  4DWF A;  4BOS C;  1Q5W B;  2KD0 A;  1UH6 A;  4XZ4 A;  3ZDM C;  3X23 A;  4MGZ E;  3QQ8 B;  4IUM B;  2KDE B;  3JVZ X;  4KVG B;  1RFA A;  1UD7 A;  2B3A A;  2DYO A;  2EMT A;  2K8C A;  3ZDT A;  2ZNV C;  4WWP A;  4HPM B;  4DXA B;  4KZC A;  3PRP B;  1WJ4 A;  4NQK E;  1A5R A;  5KHQ A;  1YIW A;  4BOZ B;  1LXD A;  2KJ6 A;  4E3C A;  1WXM A;  1E8X A;  3DBH I;  4DDI D;  5G2N A;  2J0M A;  4NY0 A;  2D3G A;  3PZD A;  3ZIM A;  2EKE C;  5CX3 A;  1WX9 A;  2HTH A;  1WR6 E;  4ZRJ A;  4A20 A;  2MP2 A;  4NNJ B;  3IFW B;  1V5O A;  2O2V A;  3HM6 X;  4CO7 A;  2N4F A;  3KYC D;  1TGZ B;  1KOT A;  5D6J B;  4ANV A;  2LVQ A;  4B95 A;  1VCB A;  2W9N A;  2IO0 B;  3PLV A;  4MGK E;  2L05 A;  2KKC A;  1OQY A;  2DX5 B;  3AI5 A;  3KVF B;  4AOF A;  3H6N A;  3Q3F A;  4G0N B;  1EO6 A;  1K8R B;  2KC2 A;  2FCQ A;  2LGD A;  1P0R A;  3EFU A;  2IO1 B;  4DHJ D;  2KO3 A;  2MBO A;  1V80 A;  3EEC A;  2DYB A;  1VD2 A;  2MRP A;  4MGY E;  5LLI A;  3WAP A;  2KLC A;  4RMA A;  2BYV E;  2Y5B B;  3JSV A;  4DK5 A;  4HDO A;  2BGF A;  2G3Q B;  5D2M B;  3X0W A;  3ENE A;  2DZI A;  4N9F 4;  4BKS A;  4II3 B;  5E6N A;  2GOW A;  5IAA C;  4B6W A;  2JXX A;  4I6P A;  4II2 B;  4NJ6 A;  3TBL D;  3NZU A;  4W9G A;  2O2V B;  1WZ0 A;  4DHZ E;  1WJN A;  2YVC A;  4IM2 A;  2D07 B;  2LGX A;  3PVL A;  1SE9 A;  4FBJ B;  2CHZ A;  2I1J A;  2O6V D;  3DOW A;  4LDT D;  4WQO B;  2R2O A;  1WH3 A;  3AUL A;  2LRU A;  5C1Z A;  3TMP B;  3ZNH B;  1WYW B;  1YX5 B;  1V9J A;  1WRD B;  3L54 A;  4HJK A;  2KZR A;  5E6O A;  4GB9 A;  2KWU B;  4MH0 E;  1ZGU B;  1KJT A;  3W1S C;  4EUT A;  2XK5 B;  2WWZ A;  1XT9 B;  2GBR A;  2IYD B;  2M4N A;  3ECI A;  1UBQ A;  3JSV B;  2LXA A;  4PYZ A;  2MLB A;  4HK2 A;  2LVO A;  2V3S A;  4AJY B;  4XC2 A;  1OEY A;  1P98 A;  1H8C A;  1TBE A;  3H7S A;  3RUI B;  4DDG D;  1CMX B;  2N7E A;  3PRZ A;  3WAM A;  3CF6 E;  2NR2 A;  3N3K B;  3APD A;  4HLE A;  3UIO B;  1EF5 A;  2NVU I;  2XBB C;  3OLM D;  3A9K A;  2K8B A;  3RCZ A;  1E8W A;  4BKG A;  1G6J A;  2HJ8 A;  1PQS A;  1H4R A;  2KQS A;  2OJR A;  4W9E A;  4PS3 A;  3VVW B;  1KLV A;  2BKF A;  4GDL A;  5LXI B;  3HM3 A;  2LWP A;  3QX1 A;  2L76 A;  2MSE D;  3H7P A;  1ISN A;  1L7Y A;  2GBM A;  4FN2 A;  5KHO A;  3MJW A;  4GIV A;  3B08 A;  4RM8 A;  1L2N A;  2Z0D B;  3QIJ A;  3RUL A;  3NOB A;  2KX0 A;  5DPT A;  1M94 A;  3C0R B;  3AU4 A;  1YQB A;  3L17 A;  4HWI B;  3ALB A;  4EZK A;  2K6D B;  4FJY A;  3PPA A;  4K7U A;  2KJR A;  2FAZ A;  3Q3J A;  1WJ6 A;  2CR5 A;  3KW5 B;  4GGQ A;  4NPN A;  4B9K A;  5JHB A;  1J0G A;  2MBH A;  4ANU A;  4HXD A;  3SD5 A;  4HDQ A;  3UGB B;  3NS8 A;  3ZLZ A;  1WGY A;  3ZTC A;  5G55 A;  3NZS A;  3ZVV A;  4IW0 A;  3UIP B;  3V61 A;  4AJW A;  3H9D A;  1P9D U;  2DZJ A;  2FCS A;  2V4L A;  4W9F A;  2N1V A;  3A9K B;  2NBV B;  4HCN B;  2CHX A;  3ZW3 A;  1V81 A;  4WJO A;  3V6E B;  1IPG A;  2O6V A;  4BBN F;  4IM0 A;  4GDL B;  1JRU A;  4I6L B;  4MJS A;  2ZCC A;  3H7P B;  2DHZ A;  3L08 A;  3VH4 B;  4K7W A;  5J18 A;  2IO2 B;  4WAA A;  4FLH A;  3GOE A;  3WAL A;  4HCP B;  3T9L A;  1OGW A;  2REX A;  3R3M A;  2N9P C;  3TIX A;  4DHJ B;  2BWE S;  4MSM B;  4ANW A;  3IG3 A;  2LUE A;  1SIF A;  3OJ4 B;  4TKN A;  4ZYN A;  3ZKJ C;  4EZL A;  3AU5 A;  2R2Q A;  2LXC A;  3PT2 B;  4HVB A;  1GJZ A;  2EMS A;  3QA8 A;  4DHZ B;  2N1W A;  3DQV A;  2J0K A;  2C60 A;  4I6N B;  4MEL A;  3A9J B;  4MM3 A;  4KSK C;  3CMM B;  4WJQ A;  4OVU A;  4F8C B;  3VTV A;  2GBJ A;  2ZPY A;  3M62 B;  2BYF A;  2JRI B;  4JGH B;  2N9E B;  2V1Y A;  4KDL B;  3VUX A;  3A4R A;  2C7M B;  2FIF A;  1S3S G;  2FCN A;  1ZKH A;  4EZJ A;  1GC6 A;  3PHW B;  3VTW A;  4W9I A;  4NAW A;  2O6V B;  2OOB B;  2M8S A;  4LDT B;  4MEM A;  2D2Q A;  3DDC B;  2L7R A;  4MJS B;  3GZN I;  3RT3 B;  2KWV B;  1WFY A;  2CS4 A;  2XEW A;  4KSL C;  2N7D A;  1RAX A;  5CTR C;  4ANX A;  2K25 A;  2GBK A;  2Z0E B;  1QZE A;  4EKU A;  3DBS A;  2FID A;  1WGH A;  4JL9 A;  3RZW C;  2IY0 B;  2JY6 A;  4GOC A;  3TJP A;  4K1R B;  1GG3 A;  5GMV A;  3W1Y A;  2KDF B;  1Z5S B;  1NI2 A;  1YX6 B;  3OJ3 A;  4URK A;  1BT0 A;  2CU1 A;  4A3P A;  2HE7 A;  3WIM A;  2DAF A;  4A3O A;  4PS8 A;  2K39 A;  3KYD D;  2L3Z A;  5AZH A;  2JZ3 B;  2MP2 B;  2ZEQ A;  3N30 A;  4G11 A;  4K7S A;  2D11 A;  2C9W B;  4M8N A;  4FHJ A;  3QAQ A;  2DAJ A;  2WX0 A;  5JHA A;  3DPD A;  2KXJ A;  4PYU A;  4W9C A;  5DPR A;  1WXA A;  2Z59 B;  4YL8 A;  4AP4 C;  1GUA B;  1I42 A;  2KAN A;  5BO4 B;  4TQ0 A;  1YD8 U;  2WYQ A;  4M0W B;  1V6E A;  1XQQ A;  1TTN A;  4JLC A;  2KLG A;  4OVV A;  3UF8 A;  4NQL B;  2DZM A;  4W9H A;  3QC8 B;  3OAW A;  3S2A A;  2ASQ A;  3IVF A;  2JWZ A;  1IYF A;  4J6I A;  2NPT A;  3CSF A;  2MCN B;  2ZNV B;  4G3X B;  4BBN C;  3M3J A;  3V62 A;  5DPS A;  3DBL I;  3M95 A;  4E71 A;  4MDK E;  3RZF A;  3N32 A;  1I35 A;  4BVU C;  1X1M A;  3DVG Y;  4M8M A;  2M1M A;  2KHW B;  2JF5 A;  3IHP C;  3HHM A;  5AEK B;  5CHF A;  2J0J A;  4FJV B;  2L00 B;  3MHS D;  1TZ1 A;  3EHV A;  1E8Z A;  1WGR A;  2C7N B;  2KJH B;  4GSW A;  5CHV C;  3VH3 B;  2PJH A;  4P7I A;  2LRW A;  2ZZP B;  3L13 A;  1Z2M A; 
#chains in the Genus database with same CATH topology
 3KUD B;  4IM3 A;  3VAW A;  4KZ0 A;  4TV3 A;  2KX3 A;  2NPT B;  1TS5 A;  4RGN A;  3PS6 A;  5HG2 A;  2BS2 B;  3SEB A;  4AQ7 A;  2RSU A;  2ONQ A;  1SE3 A;  2NBU A;  3BII D;  3IAS 1;  4A90 A;  1FO4 A;  3ZRC A;  2NMQ A;  1C3T A;  3ZNZ B;  4AWJ A;  2NBW B;  3V60 A;  3MJ5 A;  4CHK A;  1JAL A;  4P1C C;  5FR6 A;  3NZ3 A;  1P7F A;  4A9A A;  1N5W A;  2INC C;  5E6P A;  3P4Q B;  3O65 B;  3SR6 A;  4YTN B;  5AZF A;  2V0G A;  1E10 A;  1N62 A;  4EEW A;  4NZL B;  4L1B A;  4GXB A;  1F77 A;  5MPO A;  2KVZ A;  1LM8 B;  3M63 B;  4WUR A;  4GDK A;  2BVC A;  2PLP A;  1J19 A;  4PK1 A;  3PZ7 A;  3WAO A;  2WXN A;  2C5L C;  2LI5 A;  2PPH A;  3HIZ A;  3APC A;  3Q8B A;  1PUT A;  2LAS A;  2V3N A;  3A1Q B;  3QK0 A;  4NAW B;  1R4M I;  1WXV A;  2G9H D;  4FJZ A;  3RMK C;  2XK5 A;  4XDC A;  1C79 A;  1QOA A;  3L10 B;  3C19 A;  4TMA B;  2WS3 B;  1WGD A;  3PGE A;  4LNK A;  2MBE A;  2AL3 A;  3LB8 C;  1NDD A;  1T3Q A;  3VRB B;  3ZJT A;  1OTR B;  5C23 A;  2PE9 A;  3AM9 A;  2BYE A;  3N20 C;  1K50 A;  3AEB B;  3FAH A;  2WX1 A;  1T0Y A;  2L0T A;  2MX2 A;  1KLG D;  1AW7 A;  1TS3 A;  3PRE A;  2CHW A;  3N1Z C;  1FPY A;  3ABV B;  1XD3 B;  4F1S A;  1WIA A;  1R4N I;  3LYY A;  2E3T A;  2WLB A;  2WDV B;  4KV2 A;  5EE9 A;  1WGG A;  4RGT A;  3HUI A;  3T8M A;  4XDD A;  2NS5 A;  5JZE B;  1E6E B;  4IWQ A;  4K3C A;  2MH7 A;  3N9Y C;  3PTF C;  4KDI C;  1EWC A;  1EM7 A;  3GE8 C;  4BKS D;  2M17 A;  2RDB C;  1LQB A;  2LHE A;  2FNJ B;  3BY4 B;  3PLU A;  2RDH A;  3ZRF A;  4IWO A;  5EE1 A;  2IND C;  4KKI A;  4B0M A;  2CJN A;  4KIK B;  2QJL A;  4BOS C;  1SEB D;  3I9V 1;  1KF6 B;  1RFA A;  2WXF A;  4WWP A;  3PRP B;  5BYQ A;  2XN9 C;  4NAM A;  3P1M A;  1JWB D;  1T0S C;  4BOZ B;  4IKG A;  1YMH E;  3EA6 A;  5TSS A;  4DDI D;  2EKE C;  5CX3 A;  1WX9 A;  4NNJ B;  3IFW B;  4CO7 A;  1TGZ B;  2LVQ A;  4ZHO A;  3C8Y A;  5FK9 C;  1N60 A;  2INN E;  3KVF B;  3Q3F A;  1EO6 A;  2KC2 A;  2FCQ A;  1P0R A;  3FC4 A;  2IO1 B;  2HTM E;  1SXT A;  1V80 A;  2JX5 A;  2MRP A;  1HZ5 A;  1TY2 A;  5LLI A;  3JSV A;  4OZB A;  4DK5 A;  2GLS A;  2BGF A;  5D2M B;  3X0W A;  4BKS A;  1XEE A;  4I6P A;  4NJ6 A;  3NZU A;  3NVZ A;  1WZ0 A;  4IM2 A;  4FBJ B;  2CHZ A;  3RNF C;  1AYF A;  2RDG A;  2WXQ A;  4D2K A;  2BB6 A;  5C1Z A;  3RFZ B;  1WYW B;  2H88 B;  4HJK A;  2KZR A;  3AEA B;  1KJT A;  3W1S C;  4KKJ A;  2INP E;  2IYD B;  1SJE D;  3ECI A;  4PYZ A;  2MLB A;  3AED B;  2ON8 A;  2MJ3 A;  4AJY B;  1OEY A;  1TBE A;  1CMX B;  3WAM A;  4HLE A;  2XBB C;  3OLM D;  1TJE A;  3RCZ A;  4BKG A;  2KQS A;  4PS3 A;  3NRZ A;  3HM3 A;  2LWP A;  2L76 A;  2MSE D;  1ISN A;  2GBM A;  2QDF A;  3MJW A;  2Z0D B;  3NOB A;  2WQY B;  2KX0 A;  2QSD A;  1JWM D;  3L17 A;  1ET6 A;  2X38 A;  4FJY A;  2KJR A;  4GGQ A;  2BYT A;  2CR5 A;  4ARI A;  2MBH A;  2KDM A;  3ZLZ A;  5AUI A;  2W55 A;  5G55 A;  3ZVV A;  4IW0 A;  2CU3 A;  1P9D U;  1L0V B;  3ZW3 A;  3V6E B;  1C9F A;  3LXF A;  4I6L B;  4JE3 B;  4WAA A;  4FLH A;  3P4S B;  2VH1 A;  3TIX A;  3ZKJ C;  2LUE A;  2BT6 A;  4EZL A;  3AEE B;  3TSS A;  2LXC A;  1DOX A;  3QA8 A;  3W2D A;  4DHZ B;  3AE3 B;  3DHG C;  3DQV A;  2C60 A;  1XF5 L;  2GBJ A;  2HJ1 A;  4JGH B;  3VTV A;  2WU2 B;  2N9E B;  4KDL B;  3U52 E;  2FCN A;  1GC6 A;  2B76 B;  4LDT B;  4MEM A;  2L7R A;  3MP9 A;  3RT3 B;  4ANX A;  3ZJU A;  2Z0E B;  4EKU A;  3ZJV A;  3GB1 A;  4YTP B;  3W1Y A;  2KDF B;  1FNU A;  2CU1 A;  4A3P A;  2OED A;  4RF0 A;  3ZXV A;  4A3O A;  1YJJ A;  4DXF A;  4N6E B;  1EU3 A;  5AZH A;  3N30 A;  4K7S A;  4G11 A;  2HDE A;  3MC9 A;  2K22 A;  5DPR A;  2FE8 A;  1GUA B;  1I42 A;  2KAN A;  2JZP A;  5BO4 B;  4M0W B;  4P16 A;  3RNB C;  4NQL B;  3QC8 B;  3OAW A;  1F52 A;  1QF6 A;  2ASQ A;  3IVF A;  3DBH B;  1ZOY B;  4UDU C;  1JWS D;  4BBN C;  3DBR B;  1MJD A;  2WHI A;  2M1M A;  1HEZ E;  1NYR A;  1TS4 A;  4EE2 A;  5CHF A;  2AQ1 B;  4FJV B;  2L00 B;  3MHS D;  3EHV A;  3CF6 E;  1J7C A;  3HVD A;  4KGR A;  1Z2M A;  2BKR B;  1MI0 A;  4GN1 A;  3DCG A;  2L83 A;  2V9H A;  3NVY A;  5AZG A;  2A5U A;  4ZRI A;  4K3B A;  1XCQ L;  2LMC A;  3Q3N C;  1FFV A;  1SF0 A;  4AUQ C;  3R7R A;  2ZCB A;  1IP9 A;  4A55 A;  4TQ1 A;  3KUC B;  4C4V A;  5DPW A;  5AUK A;  2KFK A;  1F2R C;  3P4R B;  1WM2 A;  1MG8 A;  2JUO A;  2K6Q A;  2ZVN A;  1UBI A;  1T5X D;  1F9J A;  2D5G A;  3NVW A;  4RNA A;  2KVR A;  2ZW1 A;  2ZPN A;  4XE0 A;  3PHX B;  3BK1 A;  1LO5 D;  1UGM A;  1HTO A;  2CJO A;  1GC7 A;  4N59 A;  4JQW C;  3K9O B;  5HKH A;  4RGO S;  5DCN A;  3IT4 B;  5EE3 A;  2Z8L A;  4YWG G;  1V1P B;  4EOY A;  1TT5 B;  4LNO A;  5HFY A;  3BZD B;  5D94 A;  2KFJ A;  4BKT A;  3MHZ A;  4LJP B;  1SE2 A;  1OQR A;  4WJP A;  2KAJ A;  4F7Z A;  1QOF A;  1D3Z A;  1UZX B;  3VQI A;  3A33 B;  3DVN V;  2WXI A;  4HPL B;  1XLO A;  2N9X A;  2UU7 A;  5J2R A;  1C1Y B;  4WWN A;  4KGS A;  4XGA B;  2JVC A;  2FUH B;  4GDK B;  2KMM A;  3ONS A;  4IWP A;  2YLM A;  1ESF A;  4OZC A;  3NG0 A;  4YXD B;  3TEX A;  1FXA A;  1ZE3 D;  2Y3A A;  1XXG A;  2GB1 A;  2KNB A;  1WR1 A;  5J17 A;  2EEL A;  3AXC A;  3GZN B;  3H8H A;  4P1B C;  3ZQ4 A;  3UQB A;  2AEH A;  3MC0 B;  2QIE B;  1QLB B;  1WXS A;  4FA6 A;  3TCA A;  3W5U B;  4JIO U;  2W54 A;  2NTS A;  5D3I B;  1B9R A;  2AYO B;  3KQ4 A;  3AE2 B;  1RRB A;  2DNF A;  2LJ5 A;  3ZYY X;  2KAC A;  3UQA A;  3MFG A;  1WM3 A;  3ZNI D;  3WA0 A;  1E0Z A;  3EC8 A;  1WI0 A;  3VHT C;  4XX5 A;  5FR3 A;  4C7Z A;  1E8Y A;  1NVI D;  5IA7 A;  4DBG A;  4W9J A;  3A9J A;  2L8J A;  2J7Q B;  2I1K A;  4FAD A;  3AE9 B;  3D32 A;  3SU8 X;  3LJ3 A;  1WMH B;  2KMA A;  1WSP A;  1IGC A;  2MEK A;  2LGI A;  1C77 A;  2VRR B;  4GLS C;  2PIA A;  2PTL A;  2KC1 A;  2KK8 A;  1D4B A;  3VTU A;  3B2F A;  4R3D A;  4DWF A;  2KD0 A;  1UH6 A;  3ZDM C;  3X23 A;  4MGZ E;  3QQ8 B;  4IUM B;  1SIJ A;  3JVZ X;  4ZRP A;  1UD7 A;  2EMT A;  2DYO A;  3ZDT A;  2ZNV C;  3V05 A;  5EE0 A;  1LXD A;  1VZ6 A;  2GRI A;  2J4X A;  3HRD D;  5HI1 A;  1D5Z C;  2D3G A;  3PZD A;  2HTH A;  1N6Z A;  4ZRJ A;  2MP2 A;  1V5O A;  5D6J B;  3T3O A;  2W9N A;  1OQY A;  3AI5 A;  5G5H A;  1K8R B;  5H92 C;  2ICI A;  3W9C B;  2MBO A;  5FKA C;  2DYB A;  4RMA A;  3BWU D;  3B2G A;  4XWW A;  4HRS A;  3BK2 A;  2G3Q B;  3ENE A;  2V3P A;  3KLS X;  4B6W A;  1L5P A;  4BAX A;  4DHZ E;  2D07 B;  1JQ4 A;  2KN4 A;  2O6V D;  3DOW A;  3Q3O C;  2NTT A;  4L2Y A;  3CWI A;  4LNI A;  2E6X A;  2W3S A;  3TMP B;  5IKC M;  1K51 A;  1FM0 D;  1V9J A;  2JYT A;  1TYG B;  4HRO A;  5E6O A;  4MH0 E;  4EUT A;  1XT9 B;  2GBR A;  2JSV X;  3JSV B;  2LXA A;  2PKO A;  4XC2 A;  2DBY A;  1UWM A;  2N7E A;  3PRZ A;  2D3C A;  3N3K B;  3T3N A;  3AH7 A;  2J42 A;  4J3O D;  4WWM A;  3A9K A;  1E8W A;  1QOB A;  1H4R A;  4W9E A;  1KLV A;  3EGR A;  1JCK B;  4GDL A;  3QX1 A;  1L6V A;  1EWY C;  1R4M B;  4GIV A;  3B08 A;  4RM8 A;  2WXK A;  4MT5 A;  3RUL A;  1EU4 A;  2WXR A;  1N61 A;  4HWI B;  3ALB A;  4EZK A;  2K6D B;  2FAZ A;  3Q3J A;  1WJ6 A;  1FMA D;  4ZYS A;  4ANU A;  4HDQ A;  3UGB B;  3GS2 A;  1TZO A;  1IBX B;  2WGS A;  3V61 A;  2DZJ A;  2O6V A;  2VZK D;  4IM0 A;  1L0Y B;  2ZCC A;  3L08 A;  5J18 A;  4K7W A;  1CZP A;  2N9K A;  3WAL A;  3R3M A;  2N9P C;  3I57 A;  4MSM B;  4TKN A;  4ZYN A;  4WH4 A;  2EMS A;  3RNC C;  1KLU D;  2N1W A;  2J0K A;  4JX1 C;  4WJQ A;  4KSK C;  3CMM B;  4OW0 A;  1V1O A;  2V1Y A;  1QKZ A;  1S3S G;  2IDY A;  1R4N B;  4W9I A;  4NAW A;  1J7B A;  2QIL A;  2OJW A;  1RYJ A;  2QCZ A;  3Q3M C;  1STE A;  1RAX A;  1RFK A;  5IOI A;  1QZE A;  2AQ3 B;  1XLP A;  1I4X A;  1ET9 A;  3AEC B;  1CJE A;  2HE7 A;  1T6B X;  3WIM A;  1KRH A;  2K9X A;  1VJK A;  4YSX B;  5GXG B;  1J7A A;  4M00 A;  4FHJ A;  2DAJ A;  2WX0 A;  4PT5 A;  1SJH D;  3P63 A;  4PYU A;  4YL8 A;  4AP4 C;  2M19 A;  4TQ0 A;  1FFU A;  2SEB D;  4N58 A;  3DWM A;  5IP4 D;  1TTN A;  4OVV A;  2KLG A;  4JWS C;  2PW9 A;  2JWZ A;  4J6I A;  1VZ7 A;  2MCN B;  4G3X B;  1MFW A;  3M3J A;  1TIF A;  4E71 A;  2DLB A;  1SBB B;  4MDK E;  3N32 A;  3U4E G;  1SE4 A;  2KHW B;  2JF5 A;  3AEF B;  3IHP C;  3HHM A;  2WXH A;  1YOV B;  2Y5P A;  4LNN A;  2J0J A;  1CQV A;  1PYW D;  1E8Z A;  2C7N B;  4GSW A;  2KJH B;  5CHV C;  3VH3 B;  4YTM B;  4P7I A;  2MA9 B;  2LRW A;  2ZZP B;  2XNA C;  3L13 A;  1QIL A;  4ZRQ A;  1I4H A;  4FXC A;  1OFF A;  1RM6 C;  3QHT A;  1JWA D;  1WF9 A;  1UUP A;  4USA A;  3FIL B;  3HK0 A;  2IY1 B;  3W1S A;  3MTN B;  1WE7 A;  3BYY B;  1V49 A;  1C4C A;  4LNF A;  4KIK A;  3PRM B;  2KQ7 A;  2JRH A;  1LFD A;  4K81 A;  4A8X C;  3KWL A;  3O13 A;  4RH6 A;  2QC8 A;  2GI9 A;  1FRD A;  3KWV A;  3QAR A;  4WAF A;  1F2R I;  3AE5 B;  1JRO A;  1Q0W B;  4X57 B;  3H1U A;  1E5W A;  2K3U A;  4W9L A;  3JW0 X;  1XLN A;  1TKG A;  3IXS A;  2UWQ A;  5D7G A;  1FNV A;  3P42 A;  1FIQ A;  3AE6 B;  2KFK B;  1B1Z A;  2IO3 B;  4WJN A;  2WU5 B;  3BYT B;  1E7P B;  3CIR B;  2ZVO A;  4FUL A;  1A70 A;  2JPH A;  3GP7 A;  1I4G A;  4RF1 A;  1FXT B;  3DVG X;  3Q69 A;  3DBR I;  2SAK A;  4MM3 B;  3VDZ A;  1AWD A;  4IG7 B;  2LZ6 A;  1YNT E;  3R2T A;  3RD2 A;  2QHO A;  3APF A;  3I5J C;  2R61 A;  1WX8 A;  2FUG 1;  1MPE A;  1CK1 A;  5JXV A;  1FCC C;  1P1A A;  2BPS A;  2DYM A;  2KDI A;  4WWO A;  4ZRK A;  2DZK A;  1EUV B;  4IOI E;  3TEW A;  4RM9 A;  1E7U A;  3AMZ A;  2MW5 A;  1QQR A;  3ETR A;  3P4P B;  1UEL A;  2D10 A;  3U30 A;  3BVG A;  1YN4 A;  3FKY A;  2RPQ A;  2KWD A;  2CKH B;  1BXT A;  2GMI C;  3IT6 B;  4ICU A;  4HEA 1;  4MGI E;  1EF1 A;  2K1F A;  3DVN U;  4TUU A;  2BW2 A;  3DWG C;  3EUB 2;  2WXO A;  3R66 C;  5C2T B;  4ARC A;  2FCM A;  2LHD A;  2KTR A;  3UIN B;  3U7D A;  2Q5W D;  1QOG A;  3RYT A;  1MVK A;  2RD0 A;  2M0A A;  2ZW0 A;  2KN5 A;  1HQR D;  1F1H A;  1HA5 A;  2WDR B;  4PS7 A;  2JXT A;  3NY5 A;  3VUW A;  5CHW A;  4LJO B;  4C7Y A;  3DHI C;  3B0A A;  2BBC A;  4OVZ A;  1C4A A;  3PZ8 A;  1HZ6 A;  2GBN A;  2MBB B;  3TUO A;  3TL5 A;  2G4D B;  1MHH E;  3SFE B;  3NUH B;  4S0R A;  1DOY A;  1L4D B;  3RPF C;  1E90 A;  2LGS A;  2MJE A;  2ZJD A;  2BQQ A;  5E6J A;  2JZZ A;  3ZUN A;  3URY A;  4BZA A;  2KWC A;  3B1L X;  5BMG A;  3ML9 A;  2HD5 B;  1Q5W B;  4HJG E;  4XZ4 A;  4DXG A;  3B9J A;  2KDE B;  3VRA B;  2B3A A;  2RMM A;  2PMV A;  4HPM B;  4DXA B;  4KZC A;  1WJ4 A;  4NQK E;  1A5R A;  3AEG B;  5KHQ A;  1DYQ A;  4TSS A;  2M56 B;  4CQN A;  4E3C A;  1E8X A;  4NY0 A;  3N1Y C;  1WR6 E;  3RN9 C;  2O2V A;  3HM6 X;  1WWT A;  1GOZ A;  1GAQ B;  4B95 A;  4C80 A;  3RNE C;  1MG4 A;  4MGK E;  2ACZ B;  3Q8C A;  2D3B A;  2KKC A;  1TS2 A;  2L05 A;  2DX5 B;  4AOF A;  3H6N A;  1M4V A;  1TKY A;  3EFU A;  4DHJ D;  2KO3 A;  1JW9 D;  3WAP A;  2JU6 X;  2KLC A;  4RGM A;  4HDO A;  2D3A A;  3Q2A C;  3NS1 A;  2WDQ B;  2DZI A;  1KH0 A;  2GOW A;  4A6Q A;  1PGB A;  1WYG A;  3TBL D;  3AE7 B;  2L52 A;  4ZHP A;  1WJN A;  1MHX A;  1SE9 A;  2I1J A;  2R2O A;  3AUL A;  2LRU A;  4RCO A;  1K53 A;  1I7H A;  1ZGU B;  2XK5 B;  2WWZ A;  2M4N A;  4HK2 A;  2V3S A;  1H8C A;  4DDG D;  3AB5 A;  3AE8 B;  5H8Y E;  3AN1 A;  3APD A;  1EF5 A;  2K8B A;  1G6J A;  4LTU A;  2PVO D;  2HJ8 A;  3NVV A;  4B0E A;  2OJR A;  2BKF A;  4FN2 A;  3H7P A;  1L2N A;  3QIJ A;  3EFC A;  5DPT A;  1M94 A;  3C0R B;  2WXM A;  3PPA A;  4K7U A;  1TKE A;  3KW5 B;  4RFB A;  4HXD A;  1WGY A;  1D6E C;  3UIP B;  4AJW A;  4ZOH C;  1GB4 A;  2JYE A;  1YQ3 B;  2YEP B;  4W9F A;  2N1V A;  3A9K B;  4HCN B;  1V81 A;  2BB5 A;  1R7S A;  1ZPS A;  3DBL B;  1FEH A;  1NI3 A;  2WXG A;  4GDL B;  1JRU A;  4MJS A;  1UGJ A;  2DHZ A;  4JWU C;  1WRI A;  2IO2 B;  2WNM A;  3GOE A;  4HCP B;  1OGW A;  1V1P A;  4O1N A;  2BWE S;  2N9L A;  3IG3 A;  1SIF A;  3AU5 A;  1XLQ A;  2R2Q A;  3PT2 B;  4HVB A;  1GJZ A;  1FNW A;  2W82 A;  4MEL A;  1I4P A;  1SB3 C;  4OVU A;  2ZPY A;  2JRI B;  5D3D A;  2FIF A;  1FXI A;  3PHW B;  3VR9 B;  3WCQ A;  1NEN B;  4XWT A;  2O6V B;  1PFD A;  2KWV B;  2AX5 A;  1WFY A;  2CS4 A;  3PO0 A;  2N7D A;  5CTR C;  2BS3 B;  2K25 A;  2GBK A;  4HKQ A;  1ZUD 2;  1ZDV A;  3DBS A;  2BS4 B;  1ZXI A;  1WGH A;  2FID A;  3RZW C;  3BVZ A;  1GG3 A;  1Z5S B;  1BUI C;  1NI2 A;  1YX6 B;  3OJ3 A;  4URK A;  4PS8 A;  2K39 A;  3AE1 B;  3KYD D;  2L3Z A;  1YN5 A;  1L4Z B;  2C9W B;  4M8N A;  1UWX A;  3QAQ A;  3DPD A;  3TEZ A;  2KXJ A;  4W9C A;  1WXA A;  1ACC A;  3V3X A;  2QEJ C;  1YD8 U;  2WYQ A;  2KQ4 X;  1XQQ A;  4US9 A;  4W9H A;  1L6U A;  1LGR A;  1IYF A;  2NPT A;  3CSF A;  2Y5C A;  5DPS A;  1IGD A;  3M95 A;  1I35 A;  4BVU C;  2VZK B;  4DQO C;  1I4Q A;  3AE4 B;  1XCT L;  1WGR A;  2LUM A;  3IAM 1;  2JQR B;  4S17 A;  4MH8 A;  1V2Y A;  5C3J B;  3KUZ A;  5JH5 C;  2YEP F;  2KMC A;  4GMV A;  1WMH A;  3CST A;  5TR5 A;  3SHQ A;  3IBE A;  4ICV A;  1OEY J;  2MQJ A;  3QJZ A;  3KH0 A;  3LDZ E;  5EDS A;  5LXH A;  1V8C A;  5I4D A;  3V6C B;  2KDB A;  1WJU A;  3I63 C;  3ZTD A;  3VXW A;  4M02 A;  3U7Z A;  2MWS B;  3R7Q A;  2DEN B;  1NEK B;  4W9K A;  4E74 A;  1TY0 A;  2PEA A;  2MJD A;  4BFR A;  2PE6 B;  1RWS A;  1UNS A;  4G50 A;  3OWE B;  3Q8E A;  2K5P A;  3RNG C;  4FHK A;  2RGF A;  4AS1 A;  1E7V A;  3NHE B;  2DWQ A;  5HHD G;  4C00 A;  2RR9 A;  5G5G A;  2NCN A;  1SGH A;  4JPS A;  1U4A A;  1WZ3 A;  4H2A A;  3Q6B A;  4KGT A;  3A1Q A;  2A4Z A;  4L23 A;  4W9D A;  1VR9 A;  3SDL C;  3I3T B;  1HTQ A;  3Q14 C;  1KFY B;  4WIP A;  3K9P B;  1V86 A;  2IBI B;  2MHJ A;  4IC7 B;  4KX6 B;  4XYC A;  1P3Q U;  1KM7 A;  3WAN A;  2BF8 B;  3L0W B;  5L95 C;  3A4S C;  1L0X B;  1HE8 A;  3PSE B;  4NJ7 A;  2KT7 A;  1RLF A;  2IZV B;  2G45 B;  2KOX A;  4NJC A;  5BMI A;  2K8H A;  3N1X C;  1YJI A;  1WX7 A;  2UYZ B;  2JT4 B;  3VR8 B;  4C56 C;  1ZP0 B;  2IGG A;  2LGY A;  2L0F A;  1GNU A;  3QCA A;  1Q1O A;  3ZNG C;  1AAR A;  1JRP A;  1ZDX A;  2K0P A;  3ZO5 B;  1UF0 A;  1P7E A;  2BWF A;  2C7H A;  4LCD E;  3BIN A;  1S1Q B;  2KTF A;  2TSS A;  2N7J A;  3JYU A;  4P6V F;  2L1A A;  1Y8R C;  1ZW7 A;  1WE6 A;  1V5T A;  3L16 A;  1AN8 A;  3U2S C;  2G4S A;  4LK0 M;  2M0X A;  5L83 A;  3L4P A;  2V4I B;  1NBF C;  1WY8 A;  4MSQ B;  2AL6 A;  4Q2J A;  1DOI A;  1V97 A;  3VFK A;  2LVP A;  3VUY A;  1IBX A;  2BTE A;  4GU2 A;  4ASW C;  4OZA A;  3PV1 A;  1N5X A;  3ZGZ A;  1NYQ A;  1J8C A;  4CYE A;  2MBQ A;  2IJ0 A;  1C78 A;  1PDX A;  2WDT B;  3P2B A;  2IPK D;  2I38 A;  4EFO A;  2AWT A;  3ML8 A;  2KTR B;  3MC8 A;  3QWZ B;  5BYS A;  2LD9 A;  3U8Z A;  2G1E A;  3DHH C;  1YJ1 A;  4MAC A;  4ZDV A;  1FCL A;  1I4R A;  1ROE A;  4C4V B;  1FD6 A;  1IUE A;  2WXJ A;  2VH2 A;  3AV8 A;  4IDI A;  5IN7 A;  4KVG B;  2K8C A;  3R2I A;  2FBW B;  1C4P A;  1YIW A;  2KJ6 A;  2W3R A;  1WXM A;  3DBH I;  1T0Q C;  5G2N A;  2J0M A;  2N0S B;  3ZIM A;  2J52 A;  4A20 A;  3OG5 A;  1C76 A;  2N4F A;  3KYC D;  1KOT A;  1DGJ A;  4ANV A;  1VCB A;  1GB1 A;  2IO0 B;  3PLV A;  5BMH A;  4G0N B;  1SSN A;  2LGD A;  1VLB A;  3EEC A;  1VD2 A;  1XO3 A;  4MGY E;  2BYV E;  2Y5B B;  3TEY A;  4N9F 4;  1WXQ A;  4II3 B;  5E6N A;  5IAA C;  2JXX A;  1OQQ A;  4II2 B;  4W9G A;  2IGD A;  4HKZ E;  2O2V B;  4LLG M;  2YVC A;  3PVL A;  2LGX A;  3RI7 C;  4WQO B;  4LDT D;  1WH3 A;  2WP9 B;  3ZNH B;  1VZ8 A;  1YX5 B;  1WRD B;  3L54 A;  2H89 B;  4GB9 A;  2KWU B;  4WQM A;  1QT9 A;  1UBQ A;  2LVO A;  1P98 A;  2AQ2 B;  3FIL A;  3H7S A;  3RUI B;  2NR2 A;  2PVG C;  3UIO B;  2NVU I;  3R8B A;  4ITK A;  1PQS A;  4QAY A;  1PGX A;  3VVW B;  2KYW A;  3E56 A;  2QMT A;  5LXI B;  1L7Y A;  5KHO A;  3J9C A;  3AU4 A;  1YQB A;  3BVM A;  3Q8F A;  1VDV A;  1N63 A;  5BYR A;  4NPN A;  4B9K A;  5JHB A;  1F0Z A;  1J0G A;  3SD5 A;  4US8 A;  3NS8 A;  3ZTC A;  3NZS A;  4OHJ A;  3H9D A;  2FCS A;  2V4L A;  2NBV B;  2CHX A;  3SFD B;  2IGH A;  4WJO A;  1IPG A;  1VRA B;  4BBN F;  2J53 A;  3H7P B;  3VH4 B;  2LJI A;  2OHF A;  2X8X X;  5T8I A;  3T9L A;  2REX A;  1D5M C;  4DHJ B;  4ANW A;  3OJ4 B;  2JWU A;  3ZXR A;  1E9M A;  4MM3 A;  4I6N B;  3A9J B;  4F8C B;  5IO9 A;  3M62 B;  2BYF A;  3VUX A;  3A4R A;  2C7M B;  1ZKH A;  4EZJ A;  3VTW A;  2OOB B;  2M8S A;  1KTK A;  2D2Q A;  3DDC B;  4MJS B;  3GZN I;  1JML A;  1K52 A;  2XEW A;  4KSL C;  1WGK A;  4YSZ B;  3HVZ A;  3Q8A A;  4YSY B;  4M0W A;  1Y56 A;  4JL9 A;  2IY0 B;  2JY6 A;  4GOC A;  3TJP A;  4K1R B;  5GMV A;  2I2Y A;  1YQ4 B;  4REZ A;  1Q10 A;  1BT0 A;  1ENF A;  2DAF A;  3GE3 C;  2WXL A;  2JZ3 B;  2MP2 B;  2ZEQ A;  2L32 A;  2D11 A;  5JHA A;  2LFI A;  1T0R C;  2Z59 B;  3UI3 A;  3W5V B;  5LNK 1;  4ACF A;  4HPP A;  1V6E A;  4JLC A;  3UF8 A;  2DZM A;  1D5X C;  2RPV A;  3S2A A;  3NJT A;  4YT0 B;  1GPX A;  1FRR A;  1YN3 A;  2ZNV B;  1PGA A;  3V62 A;  2LEK A;  1HXY D;  3DBL I;  4M01 A;  3RZF A;  1X1M A;  3DVG Y;  3E9S A;  4M8M A;  1BML C;  2EKI A;  5AEK B;  2WXP A;  1TZ1 A;  2PJH A;  3RNA C;  1ZXH A;  1JWU D; 
#chains in the Genus database with same CATH homology
 2BKR B;  3KUD B;  4IM3 A;  1V2Y A;  3KUZ A;  4GN1 A;  5JH5 C;  3VAW A;  4KZ0 A;  3DCG A;  2KMC A;  4GMV A;  1WMH A;  3QHT A;  5AZG A;  2A5U A;  1WF9 A;  4TV3 A;  2KX3 A;  4ZRI A;  3CST A;  2NPT B;  3HK0 A;  5TR5 A;  3PS6 A;  3SHQ A;  3IBE A;  2IY1 B;  4ICV A;  1OEY J;  2MQJ A;  3QJZ A;  3W1S A;  3MTN B;  1WE7 A;  3KH0 A;  3LDZ E;  2RSU A;  1V49 A;  5EDS A;  4AUQ C;  5LXH A;  2NBU A;  4KIK A;  2ZCB A;  3R7R A;  1IP9 A;  3PRM B;  4TQ1 A;  3V6C B;  2KQ7 A;  3KUC B;  2JRH A;  1LFD A;  1WJU A;  2KDB A;  3ZRC A;  5DPW A;  4K81 A;  3ZTD A;  2KFK A;  3VXW A;  1C3T A;  3ZNZ B;  4AWJ A;  2MWS B;  2NBW B;  3R7Q A;  1WM2 A;  1MG8 A;  2DEN B;  3V60 A;  2JUO A;  2K6Q A;  2ZVN A;  4W9K A;  4E74 A;  1UBI A;  2PEA A;  4CHK A;  4BFR A;  2PE6 B;  3QAR A;  4G50 A;  1F9J A;  5FR6 A;  4FHK A;  2RGF A;  1Q0W B;  2KVR A;  4X57 B;  1E7V A;  3H1U A;  2ZPN A;  1E5W A;  3NHE B;  3PHX B;  5E6P A;  1UGM A;  2RR9 A;  1GC7 A;  4W9L A;  2NCN A;  3O65 B;  3JW0 X;  4JQW C;  3K9O B;  5AZF A;  1SGH A;  1U4A A;  1WZ3 A;  2UWQ A;  5D7G A;  3A1Q A;  2A4Z A;  5HKH A;  2KFK B;  5DCN A;  4EEW A;  4W9D A;  3SDL C;  3I3T B;  2IO3 B;  4WJN A;  4GXB A;  4EOY A;  2ZVO A;  3K9P B;  1V86 A;  2IBI B;  4FUL A;  2JPH A;  1LM8 B;  3M63 B;  4IC7 B;  2MA9 B;  4GDK A;  1P3Q U;  1FXT B;  1KM7 A;  5D94 A;  3WAN A;  2BF8 B;  3L0W B;  3DVG X;  2KFJ A;  4BKT A;  5L95 C;  1J19 A;  3DBR I;  3A4S C;  3PSE B;  1HE8 A;  4NJ7 A;  3VDZ A;  4LJP B;  4IG7 B;  1RLF A;  2LZ6 A;  3WAO A;  2IZV B;  2G45 B;  2C5L C;  3RD2 A;  2KOX A;  2QHO A;  2K8H A;  2LI5 A;  2PPH A;  4WJP A;  3HIZ A;  4F7Z A;  3APF A;  3APC A;  2LAS A;  1D3Z A;  1UZX B;  1WX7 A;  3A1Q B;  3QK0 A;  2UYZ B;  4NAW B;  1R4M I;  3VQI A;  1WXV A;  2JT4 B;  1WX8 A;  3A33 B;  1P1A A;  2LGY A;  3DVN V;  4HPL B;  2BPS A;  2DYM A;  2L0F A;  2N9X A;  4FJZ A;  1GNU A;  5J2R A;  1C1Y B;  3QCA A;  2KDI A;  4WWN A;  2XK5 A;  1Q1O A;  4WWO A;  4ZRK A;  3ZNG C;  3L10 B;  2DZK A;  1AAR A;  1EUV B;  3ZO5 B;  2JVC A;  2FUH B;  4RM9 A;  1E7U A;  2BWF A;  4LCD E;  1WGD A;  2C7H A;  2MW5 A;  3BIN A;  3PGE A;  4GDK B;  2MBE A;  2AL3 A;  1NDD A;  3ONS A;  1S1Q B;  4IWP A;  2KTF A;  2YLM A;  3JYU A;  1UEL A;  1Y8R C;  1ZW7 A;  1OTR B;  2D10 A;  5C23 A;  3U30 A;  1WE6 A;  1V5T A;  3L16 A;  2PE9 A;  2BYE A;  2KNB A;  2G4S A;  1WR1 A;  5J17 A;  2RPQ A;  2CKH B;  3AXC A;  2M0X A;  2GMI C;  5L83 A;  4ICU A;  2WX1 A;  1EF1 A;  4MGI E;  3UQB A;  2AEH A;  1NBF C;  1WY8 A;  2K1F A;  4MSQ B;  3DVN U;  1T0Y A;  1WXS A;  2AL6 A;  2L0T A;  4TUU A;  2MX2 A;  3R66 C;  3VFK A;  4FA6 A;  2FCM A;  2LVP A;  3TCA A;  2KTR A;  3UIN B;  3U7D A;  3PRE A;  4JIO U;  3VUY A;  2CHW A;  4GU2 A;  4ASW C;  1XD3 B;  3RYT A;  4F1S A;  2RD0 A;  2AYO B;  1WIA A;  2KN5 A;  3PV1 A;  1R4N I;  1RRB A;  4PS7 A;  2LJ5 A;  1J8C A;  4CYE A;  3UQA A;  3NY5 A;  2MBQ A;  1WM3 A;  3VUW A;  3ZNI D;  4KV2 A;  1WGG A;  5CHW A;  3WA0 A;  4LJO B;  2WDT B;  3B0A A;  3EC8 A;  1WI0 A;  3T8M A;  3P2B A;  3VHT C;  2NS5 A;  4XX5 A;  4EFO A;  5JZE B;  2AWT A;  1E8Y A;  2GBN A;  2MBB B;  3ML8 A;  4IWQ A;  3TL5 A;  2G4D B;  4DBG A;  5IA7 A;  4W9J A;  2KTR B;  3A9J A;  2L8J A;  3PTF C;  2J7Q B;  2I1K A;  4KDI C;  4FAD A;  3D32 A;  3QWZ B;  3LJ3 A;  3SU8 X;  1WMH B;  1E90 A;  4BKS D;  2M17 A;  2KMA A;  1LQB A;  2LD9 A;  3U8Z A;  2VRR B;  2ZJD A;  2FNJ B;  3BY4 B;  3PLU A;  3ZRF A;  1YJ1 A;  2JZZ A;  4IWO A;  4ZDV A;  3ZUN A;  2KC1 A;  2KK8 A;  2KWC A;  3B1L X;  3VTU A;  3ML9 A;  4KIK B;  2HD5 B;  4DWF A;  4BOS C;  1Q5W B;  2KD0 A;  1UH6 A;  4XZ4 A;  3ZDM C;  3X23 A;  4MGZ E;  3QQ8 B;  4IUM B;  2KDE B;  3JVZ X;  4KVG B;  1RFA A;  1UD7 A;  2B3A A;  2DYO A;  2EMT A;  2K8C A;  3ZDT A;  2ZNV C;  4WWP A;  4HPM B;  4DXA B;  4KZC A;  3PRP B;  1WJ4 A;  4NQK E;  1A5R A;  5KHQ A;  1YIW A;  4BOZ B;  1LXD A;  2KJ6 A;  4E3C A;  1WXM A;  1E8X A;  3DBH I;  4DDI D;  5G2N A;  2J0M A;  4NY0 A;  2D3G A;  3PZD A;  3ZIM A;  2EKE C;  5CX3 A;  1WX9 A;  2HTH A;  1WR6 E;  4ZRJ A;  4A20 A;  2MP2 A;  4NNJ B;  3IFW B;  1V5O A;  2O2V A;  3HM6 X;  4CO7 A;  2N4F A;  3KYC D;  1TGZ B;  1KOT A;  5D6J B;  4ANV A;  2LVQ A;  4B95 A;  1VCB A;  2W9N A;  2IO0 B;  3PLV A;  4MGK E;  2L05 A;  2KKC A;  1OQY A;  2DX5 B;  3AI5 A;  3KVF B;  4AOF A;  3H6N A;  3Q3F A;  4G0N B;  1EO6 A;  1K8R B;  2KC2 A;  2FCQ A;  2LGD A;  1P0R A;  3EFU A;  2IO1 B;  4DHJ D;  2KO3 A;  2MBO A;  1V80 A;  3EEC A;  2DYB A;  1VD2 A;  2MRP A;  4MGY E;  5LLI A;  3WAP A;  2KLC A;  4RMA A;  2BYV E;  2Y5B B;  3JSV A;  4DK5 A;  4HDO A;  2BGF A;  2G3Q B;  5D2M B;  3X0W A;  3ENE A;  2DZI A;  4N9F 4;  4BKS A;  4II3 B;  5E6N A;  2GOW A;  5IAA C;  4B6W A;  2JXX A;  4I6P A;  4II2 B;  4NJ6 A;  3TBL D;  3NZU A;  4W9G A;  2O2V B;  1WZ0 A;  4DHZ E;  1WJN A;  2YVC A;  4IM2 A;  2D07 B;  2LGX A;  3PVL A;  1SE9 A;  4FBJ B;  2CHZ A;  2I1J A;  2O6V D;  3DOW A;  4LDT D;  4WQO B;  2R2O A;  1WH3 A;  3AUL A;  2LRU A;  5C1Z A;  3TMP B;  3ZNH B;  1WYW B;  1YX5 B;  1V9J A;  1WRD B;  3L54 A;  4HJK A;  2KZR A;  5E6O A;  4GB9 A;  2KWU B;  4MH0 E;  1ZGU B;  1KJT A;  3W1S C;  4EUT A;  2XK5 B;  2WWZ A;  1XT9 B;  2GBR A;  2IYD B;  2M4N A;  3ECI A;  1UBQ A;  3JSV B;  2LXA A;  4PYZ A;  2MLB A;  4HK2 A;  2LVO A;  2V3S A;  4AJY B;  4XC2 A;  1OEY A;  1P98 A;  1H8C A;  1TBE A;  3H7S A;  3RUI B;  4DDG D;  1CMX B;  2N7E A;  3PRZ A;  3WAM A;  3CF6 E;  2NR2 A;  3N3K B;  3APD A;  4HLE A;  3UIO B;  1EF5 A;  2NVU I;  2XBB C;  3OLM D;  3A9K A;  2K8B A;  3RCZ A;  1E8W A;  4BKG A;  1G6J A;  2HJ8 A;  1PQS A;  1H4R A;  2KQS A;  2OJR A;  4W9E A;  4PS3 A;  3VVW B;  1KLV A;  2BKF A;  4GDL A;  5LXI B;  3HM3 A;  2LWP A;  3QX1 A;  2L76 A;  2MSE D;  3H7P A;  1ISN A;  1L7Y A;  2GBM A;  4FN2 A;  5KHO A;  3MJW A;  4GIV A;  3B08 A;  4RM8 A;  1L2N A;  2Z0D B;  3QIJ A;  3RUL A;  3NOB A;  2KX0 A;  5DPT A;  1M94 A;  3C0R B;  3AU4 A;  1YQB A;  3L17 A;  4HWI B;  3ALB A;  4EZK A;  2K6D B;  4FJY A;  3PPA A;  4K7U A;  2KJR A;  2FAZ A;  3Q3J A;  1WJ6 A;  2CR5 A;  3KW5 B;  4GGQ A;  4NPN A;  4B9K A;  5JHB A;  1J0G A;  2MBH A;  4ANU A;  4HXD A;  3SD5 A;  4HDQ A;  3UGB B;  3NS8 A;  3ZLZ A;  1WGY A;  3ZTC A;  5G55 A;  3NZS A;  3ZVV A;  4IW0 A;  3UIP B;  3V61 A;  4AJW A;  3H9D A;  1P9D U;  2DZJ A;  2FCS A;  2V4L A;  4W9F A;  2N1V A;  3A9K B;  2NBV B;  4HCN B;  2CHX A;  3ZW3 A;  1V81 A;  4WJO A;  3V6E B;  1IPG A;  2O6V A;  4BBN F;  4IM0 A;  4GDL B;  1JRU A;  4I6L B;  4MJS A;  2ZCC A;  3H7P B;  2DHZ A;  3L08 A;  3VH4 B;  4K7W A;  5J18 A;  2IO2 B;  4WAA A;  4FLH A;  3GOE A;  3WAL A;  4HCP B;  3T9L A;  1OGW A;  2REX A;  3R3M A;  2N9P C;  3TIX A;  4DHJ B;  2BWE S;  4MSM B;  4ANW A;  3IG3 A;  2LUE A;  1SIF A;  3OJ4 B;  4TKN A;  4ZYN A;  3ZKJ C;  4EZL A;  3AU5 A;  2R2Q A;  2LXC A;  3PT2 B;  4HVB A;  1GJZ A;  2EMS A;  3QA8 A;  4DHZ B;  2N1W A;  3DQV A;  2J0K A;  2C60 A;  4I6N B;  4MEL A;  3A9J B;  4MM3 A;  4KSK C;  3CMM B;  4WJQ A;  4OVU A;  4F8C B;  3VTV A;  2GBJ A;  2ZPY A;  3M62 B;  2BYF A;  2JRI B;  4JGH B;  2N9E B;  2V1Y A;  4KDL B;  3VUX A;  3A4R A;  2C7M B;  2FIF A;  1S3S G;  2FCN A;  1ZKH A;  4EZJ A;  1GC6 A;  3PHW B;  3VTW A;  4W9I A;  4NAW A;  2O6V B;  2OOB B;  2M8S A;  4LDT B;  4MEM A;  2D2Q A;  3DDC B;  2L7R A;  4MJS B;  3GZN I;  3RT3 B;  2KWV B;  1WFY A;  2CS4 A;  2XEW A;  4KSL C;  2N7D A;  1RAX A;  5CTR C;  4ANX A;  2K25 A;  2GBK A;  2Z0E B;  1QZE A;  4EKU A;  3DBS A;  2FID A;  1WGH A;  4JL9 A;  3RZW C;  2IY0 B;  2JY6 A;  4GOC A;  3TJP A;  4K1R B;  1GG3 A;  5GMV A;  3W1Y A;  2KDF B;  1Z5S B;  1NI2 A;  1YX6 B;  3OJ3 A;  4URK A;  1BT0 A;  2CU1 A;  4A3P A;  2HE7 A;  3WIM A;  2DAF A;  4A3O A;  4PS8 A;  2K39 A;  3KYD D;  2L3Z A;  5AZH A;  2JZ3 B;  2MP2 B;  2ZEQ A;  3N30 A;  4G11 A;  4K7S A;  2D11 A;  2C9W B;  4M8N A;  4FHJ A;  3QAQ A;  2DAJ A;  2WX0 A;  5JHA A;  3DPD A;  2KXJ A;  4PYU A;  4W9C A;  5DPR A;  1WXA A;  2Z59 B;  4YL8 A;  4AP4 C;  1GUA B;  1I42 A;  2KAN A;  5BO4 B;  4TQ0 A;  1YD8 U;  2WYQ A;  4M0W B;  1V6E A;  1XQQ A;  1TTN A;  4JLC A;  2KLG A;  4OVV A;  3UF8 A;  4NQL B;  2DZM A;  4W9H A;  3QC8 B;  3OAW A;  3S2A A;  2ASQ A;  3IVF A;  2JWZ A;  1IYF A;  4J6I A;  2NPT A;  3CSF A;  2MCN B;  2ZNV B;  4G3X B;  4BBN C;  3M3J A;  3V62 A;  5DPS A;  3DBL I;  3M95 A;  4E71 A;  4MDK E;  3RZF A;  3N32 A;  1I35 A;  4BVU C;  1X1M A;  3DVG Y;  4M8M A;  2M1M A;  2KHW B;  2JF5 A;  3IHP C;  3HHM A;  5AEK B;  5CHF A;  2J0J A;  4FJV B;  2L00 B;  3MHS D;  1TZ1 A;  3EHV A;  1E8Z A;  1WGR A;  2C7N B;  2KJH B;  4GSW A;  5CHV C;  3VH3 B;  2PJH A;  4P7I A;  2LRW A;  2ZZP B;  3L13 A;  1Z2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...