4WJQA

Crystal structure of sumo1 in complex with daxx
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
b'EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 19
structure length 78
sequence length 78
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjqA00
2FIDA 1H4RA 4GXBA 4HCPB 2OOBB 3JYUA 1UD7A 3NZSA 2KMAA 2EMSA 3PREA 2CHZA 2NBUA 3RUIB 3H9DA 1XD3B 4DHJB 3ZVVA 1J0GA 2RR9A 3H6NA 1E8ZA 2KWCA 5G2NA 1L2NA 2BWFA 5C23A 3DBRI 2HTHA 2BPSA 4WJPA 3BY4B 4M0WB 2L7RA 2JF5A 3OJ3A 3WANA 2JXXA 4TQ0A 3NS8A 3S2AA 2DAJA 1V49A 2K6DB 4KZ0A 2ASQA 1WMHA 2JT4B 2KX3A 4GDKB 1T0YA 2RSUA 3PGEA 5DCNA 3DBLI 2LVOA 1J19A 1LQBA 3U8ZA 2DZMA 2K39A 3RCZA 3PT2B 4LJOB 4ZYNA 1LFDA 3WAMA 3GOEA 2GBRA 2JY6A 4GGQA 5E6PA 1JRUA 5DPTA 2KDEB 1WMHB 2K25A 2KLCA 4WWNA 2W9NA 3DVNV 3ZO5B 3PVLA 3ZTCA 3ZNZB 4KZCA 2CHWA 3AXCA 4FA6A 1KOTA 2KFKA 3VH4B 1KJTA 2CS4A 3V6CB 3R7RA 3APDA 2MSED 1OGWA 2CR5A 2LVPA 1WGYA 4WWPA 2D07B 2L0FA 1WX7A 4HDOA 1RLFA 2D3GA 4AWJA 1R4MI 4A20A 2J0KA 3HM6X 3K9PB 2KFKB 3MHSD 5AEKB 2C7NB 4DDID 2N7EA 4BBNC 3PLVA 5AZHA 4MJSA 1WJ4A 4MSQB 1U4AA 2K8BA 5HKHA 3QC8B 3DCGA 4F1SA 1E7VA 4BOSC 2J0MA 2M4NA 3L08A 3BINA 4KVGB 5KHQA 1E8YA 4WAAA 2KQSA 3APCA 3VUWA 4ANUA 1YX5B 3JW0X 2MBBB 4TUUA 2GMIC 4II2B 3ZNGC 4HVBA 4MJSB 3ZTDA 2O6VD 1WE6A 4LDTB 3H7SA 3EECA 1OEYA 3L10B 2KWVB 2KZRA 2IZVB 3AU5A 4M8MA 2KJHB 4BFRA 2L76A 5JHBA 3RD2A 1S1QB 3NY5A 1I42A 2ZZPB 2IO1B 4ZRJA 4NAWA 2RD0A 3T9LA 3CF6E 2LJ5A 1WE7A 3O65B 4NJ7A 3VQIA 3EC8A 2IY1B 2NBWB 3QARA 2RPQA 4FHKA 3M3JA 3SU8X 1ISNA 2HE7A 1SIFA 2FNJB 4CYEA 1SGHA 4ZRKA 3U7DA 2J7QB 1YD8U 4RM9A 4NAWB 4DBGA 3AULA 2KK8A 2MWSB 4IWQA 4WWOA 1WZ0A 3L16A 1EF5A 4LJPB 3VTUA 3HIZA 4FLHA 2MLBA 4JIOU 4K1RB 4BKSA 4JGHB 2BYVE 2M0XA 4DXAB 4FADA 4G3XB 4MGZE 2C7MB 4WJQA 2BF8B 3V62A 4WJOA 4MEMA 4N9F4 4HJKA 1S3SG 3JVZX 2BKFA 1P98A 4PS8A 4GN1A 2Z0DB 1WXMA 4FJVB 2FCQA 3TL5A 1WR6E 1OTRB 3JSVA 3L54A 3T8MA 2YVCA 1Z2MA 2XK5A 3VXWA 4HCNB 1WM2A 1MG8A 4GU2A 1WX8A 3Q3FA 3NHEB 3DDCB 4FULA 2Z0EB 3P2BA 4W9CA 4WQOB 3LDZE 1WYWB 1E5WA 1TBEA 2R2QA 2WX0A 3VH3B 3QX1A 4MM3A 4I6LB 2KDBA 3JSVB 1C3TA 2L3ZA 4IG7B 3C0RB 3VTVA 1M94A 2XK5B 1KM7A 1WXSA 4K7WA 2G4DB 3ONSA 2HJ8A 2M17A 1AARA 4GDKA 3DVNU 3R7QA 4E71A 3QIJA 5AZFA 5CHVC 4M8NA 5CHWA 1HE8A 5TR5A 1WGHA 2L0TA 1YJ1A 1XT9B 2K8HA 4ANVA 3VUYA 2KHWB 2MBQA 3H7PA 4JLCA 2CHXA 4DHZB 4NPNA 1OQYA 3A33B 2ZCBA 4PS7A 4W9FA 1XQQA 5C1ZA 2LXAA 4HPMB 1E8WA 2LASA 2KTRA 3HK0A 4FBJB 1WM3A 1ZKHA 2MA9B 2R2OA 3PV1A 3H7PB 4F8CB 3ZRFA 2N1VA 4ICUA 1IPGA 2JZ3B 1A5RA 3KYDD 2KTFA 2LXCA 4TV3A 1KLVA 3I3TB 3V60A 2MBEA 2WDTB 3DVGX 3DQVA 1EUVB 3UINB 2DX5B 4W9GA 1V2YA 2IO0B 3A1QA 4KDLB 2KTRB 2M1MA 5E6NA 5LXHA 2AYOB 4BKGA 4EZJA 3X0WA 4DDGD 2GOWA 4CHKA 3PRZA 2NPTA 2WX1A 1PQSA 2KANA 3DBHI 4W9JA 1IP9A 4DHJD 3M62B 5D94A 4E74A 4YL8A 2FCMA 4G0NB 3ECIA 2ZEQA 5J2RA 2N9PC 3A1QB 1WGGA 3VDZA 2LGDA 2G4SA 2LGXA 3PRMB 4A3PA 3KYCD 3DBSA 2BKRB 2NPTB 2B3AA 4ZRIA 1Y8RC 3MJWA 2CKHB 2KC1A 4FJZA 4AJWA 5FR6A 1V6EA 3OAWA 4FJYA 3Q3JA 4LCDE 4URKA 5J17A 2ZJDA 4FN2A 1WJUA 1V86A 3ZDTA 4CO7A 2M8SA 2N9XA 3UQAA 4IWOA 1ZGUB 4IM0A 1GC7A 3KUDB 3PHXB 2KJRA 2PEAA 2N4FA 3KUCB 4GOCA 4NJ6A 3W1SC 2KD0A 1RRBA 4A3OA 2NS5A 3L17A 3TMPB 1OEYJ 2VRRB 4HDQA 2AL3A 2PPHA 1WR1A 2KKCA 1P0RA 1UBQA 2PE9A 3N30A 2EMTA 3AI5A 1WY8A 5AZGA 4AOFA 1LM8B 4WJNA 1RAXA 3KVFB 1UH6A 2DZIA 4BKTA 2IO3B 2AEHA 2GBKA 1Q5WB 3ENEA 3A9JA 1H8CA 2KFJA 1D3ZA 3VAWA 3UIOB 3WIMA 2C5LC 3PHWB 3QK0A 3UIPB 5IA7A 2LUEA 3KH0A 3RZWC 3ZNID 1WZ3A 2DZKA 3HHMA 2K8CA 3HM3A 1CMXB 3IG3A 2JPHA 3UGBB 3U30A 2DAFA 1V5OA 3IHPC 4TKNA 4GDLA 4ASWC 3A9JB 2ZNVC 4OVUA 2G3QB 5JHAA 2G45B 3OLMD 1EO6A 4EZKA 2UWQA 4OVVA 1Q0WB 2KN5A 5DPWA 2KDIA 4IWPA 4W9LA 2KJ6A 4F7ZA 2NR2A 1WH3A 2LD9A 1P9DU 3ML8A 3VVWB 4MDKE 3D32A 4NQKE 4KIKB 1TTNA 4GDLB 4MGKE 2IO2B 3QHTA 1J8CA 2NBVB 4BBNF 4LDTD 3V6EB 1GUAB 1Q1OA 2IY0B 1WF9A 2KDFB 2GBJA 3B08A 4MGYE 4DK5A 1WXVA 1UELA 4EUTA 4G11A 2KO3A 4NY0A 2D11A 3V61A 4AP4C 2LRWA 1I35A 2DYMA 2N7DA 3ML9A 4JQWC 4P7IA 1SE9A 2BYEA 2L05A 3R3MA 3CMMB 3AU4A 2FCSA 2BYFA 1YQBA 2HD5B 2L8JA 2LRUA 1QZEA 4RM8A 3W1YA 3WAPA 3QCAA 4E3CA 1WXAA 2GBNA 4W9DA 3PPAA 4JL9A 1IYFA 2KOXA 2Y5BB 3LJ3A 1RFAA 3QQ8B 1GJZA 4W9KA 2AWTA 2RGFA 1X1MA 4BOZB 5EDSA 2BGFA 1V9JA 2K1FA 5L83A 1V81A 2MCNB 3EFUA 4MSMB 3A4SC 4IM3A 2V1YA 2PJHA 2ZVNA 4BVUC 4NQLB 2IYDB 1GC6A 5CX3A 3WA0A 4X57B 2ZVOA 2FCNA 3NZUA 3N32A 2FAZA 4GMVA 4KV2A 4GIVA 4BKSD 2KWUB 2C7HA 5D6JB 5DPSA 2KXJA 2KQ7A 3B0AA 5J18A 3QJZA 3RYTA 2J0JA 5G55A 1L7YA 1NBFC 2QHOA 4EZLA 2I1KA 3X23A 1E90A 5GMVA 3H1UA 2OJRA 3W1SA 3SD5A 2LZ6A 2O6VA 1WX9A 4NNJB 1P3QU 4B6WA 2MBOA 2LVQA 4IM2A 4ICVA 3SHQA 3UQBA 4GSWA 2XEWA 2MW5A 3N3KB 2BWES 2JZZA 2LI5A 2JRIB 4FHJA 3SDLC 2O6VB 2CU1A 3ZDMC 2KLGA 2KMCA 1F9JA 4J6IA 2LGYA 1YIWA 2DYBA 5LLIA 2MQJA 4II3B 1WJ6A 2D10A 2C60A 3KW5B 5E6OA 3TCAA 1R4NI 1Z5SB 4PS3A 4HPLB 5D2MB 2WYQA 5LXIB 1E7UA 2K6QA 3A9KA 1UBIA 3DOWA 3PLUA 4EKUA 4GB9A 4KSKC 1YX6B 1WRDB 3CSTA 3UF8A 3ZIMA 3DVGY 2GBMA 2WWZA 4B9KA 4AJYB 3PZDA 2ZCCA 1G6JA 2JRHA 3TIXA 4TQ1A 3PRPB 2IBIB 1VD2A 2EKEC 2JUOA 2N1WA 2XBBC 2D2QA 2DZJA 3A9KB 3IFWB 2DYOA 4G50A 3IVFA 2ZNVB 4ANXA 4HK2A 3ZKJC 3RULA 2NCNA 3M63B 2A5UA 1NI2A 2PE6B 3GZNI 4ZDVA 4K7SA 3IBEA 3PSEB 2JVCA 3CSFA 3TBLD 2MBHA 4DWFA 3DPDA 1TGZB 3QAQA 4W9EA 4I6NB 4EFOA 1K8RB 5CTRC 1WGRA 3M95A 1VCBA 1WFYA 2AL6A 4K7UA 2FUHB 3ZNHB 3WAOA 3R66C 4KDIC 3ZUNA 2V3SA 5BO4B 1NDDA 3ALBA 3L0WB 4KSLC 4XZ4A 3VFKA 1UZXB 4KIKA 1UGMA 3TJPA 3WALA 2KVRA 4DHZE 4HWIB 4HLEA 1GG3A 2LWPA 4AUQC 3VTWA 2KX0A 4IC7B 2FIFA 3L13A 5JH5C 3PTFC 3PS6A 1ZW7A 4ANWA 4B95A 1WI0A 4I6PA 3ZRCA 1GNUA 5L95C 4RMAA 3K9OB 2KNBA 1TZ1A 1WJNA 4PYZA 2I1JA 3B1LX 1V80A 4XX5A 2ZPNA 5KHOA 3ZLZA 1WGDA 4W9HA 3QA8A 1EF1A 3QWZB 2MP2A 1P1AA 2C9WB 3OJ4B 2MRPA 3KUZA 5JZEB 1LXDA 2O2VA 2REXA 2UYZB 4PYUA 5D7GA 4EEWA 5CHFA 5IAAC 4IUMB 2DENB 2A4ZA 2N9EB 2KC2A 3APFA 3VUXA 3VHTC 4EOYA 2MP2B 1C1YB 3A4RA 3ZW3A 4MH0E 4IW0A 2O2VB 1E8XA 3EHVA 3MTNB 2V4LA 4MGIE 2JWZA 1V5TA 4XC2A 2L00B 4K81A 1FXTB 2DHZA 2NVUI 4HXDA 4W9IA 2YLMA 3RT3B 2MX2A 2ZPYA 3NOBA 5DPRA 3RZFA 1WIAA 1BT0A 2Z59B 4MELA
chains in the Genus database with same CATH superfamily
2FIDA 1H4RA 4GXBA 4HCPB 4KGTA 1FNVA 2L1AA 3H9DA 4DHJB 2WXFA 3P4SB 2KWCA 1L2NA 3DWMA 3AE4B 5C23A 1RFKA 2BPSA 3WANA 4ZRPA 4TQ0A 4C80A 1V49A 4P6VF 1PFDA 2VZKD 3PGEA 1J19A 3BIID 1LFDA 2JY6A 2KDEB 1WMHB 2K25A 2KLCA 2LMCA 2PW9A 3ZNZB 1XF5L 3AXCA 1KOTA 3VR8B 2CS4A 2CR5A 1RLFA 2D3GA 3NVVA 1HQRD 2J0KA 1JWMD 3N1XC 2KFKB 3AEFB 4DDID 2XNAC 1ACCA 5AZHA 1GPXA 2QC8A 4RH6A 2J0MA 3L08A 3AM9A 1E8YA 1FEHA 1WXQA 4ANUA 2KDMA 3AN1A 3ZNGC 2GMIC 1FRDA 1OEYA 3AU5A 2BBCA 2KJHB 2ZZPB 3CF6E 2LJ5A 1WE7A 4JPSA 3EA6A 3I9V1 2RPQA 4ZRKA 3TEXA 4A8XC 1YD8U 4HJGE 1F52A 2OJWA 3AULA 2MEKA 3AEAB 3FILA 2MLBA 4K1RB 1P7EA 4WH4A 2M0XA 2V9HA 1XLQA 5HI1A 2BF8B 4MEMA 3JVZX 3W5UB 2PMVA 1P98A 2MH7A 2N9LA 4LNOA 1WXMA 4FJVB 1FMAD 1OTRB 4WURA 2XK5A 4GU2A 2FBWB 3DWGC 1SXTA 2V3NA 1TBEA 2R2QA 2WX0A 4MM3A 4I6LB 4ZYSA 1AN8A 3LYYA 3U52E 2K5PA 4C7YA 1L0VB 1HEZE 2KVZA 4WIPA 2IGHA 3DVNU 3R7QA 1HZ5A 3PZ8A 2M56B 4ANVA 2L0TA 1YJ1A 1XT9B 2I38A 2KHWB 4JLCA 4USAA 2W54A 4NPNA 3CIRB 1XQQA 2LXAA 5IP4D 4HPMB 1FNWA 4IDIA 4P1CC 5D3IB 1WM3A 1ZKHA 4FBJB 2MA9B 3PV1A 5HHDG 2BS4B 1A5RA 2BS3B 4ICUA 1IPGA 2LXCA 2BVCA 3I3TB 3V60A 2MBEA 2WDTB 3MHZA 2V3PA 2DX5B 2LGSA 4W9GA 5IN7A 2IO0B 4XE0A 1WWTA 2KTRB 2WDVB 5E6NA 4K3BA 4LLGM 1TIFA 3NJTA 3MJ5A 4DHJD 1YOVB 4G0NB 5C2TB 3ECIA 2ZEQA 5J2RA 2N9PC 1WGGA 3PRMB 1R4MB 2L83A 3KYCD 3DBSA 1L0XB 4ACFA 1UWXA 4ZRQA 3MJWA 3N1ZC 4LCDE 1ZOYB 3RNEC 5J17A 1L0YB 3ZDTA 2M8SA 4IWOA 1UNSA 1B1ZA 3PHXB 4NJ6A 3U7ZA 2ACZB 3W1SC 1M4VA 4S0RA 3I57A 1IBXB 2PE9A 5E6JA 3AI5A 1EU3A 1MG4A 3ZXVA 4RF1A 4YSYB 1V1OA 2GBKA 1Q5WB 1D3ZA 3ZJVA 1C4PA 3WIMA 3GB1A 3UIPB 1FPYA 3RZWC 3HHMA 2CU3A 2K8CA 3HVZA 3UGBB 4TKNA 4YWGG 4GDLA 3A9JB 1VZ8A 1JWUD 4EZKA 1B9RA 1JALA 1GB1A 5DPWA 4F7ZA 2NR2A 2LD9A 3URYA 4NQKE 1TTNA 4WQMA 2QMTA 4DK5A 1SSNA 1I4HA 2KO3A 4NY0A 2LRWA 3ML9A 2LHEA 2FCSA 2L8JA 3QCAA 5HG2A 3ABVB 5H8YE 3LJ3A 1SB3C 1VLBA 2AWTA 2RGFA 1X1MA 4RGOS 1UGJA 1V81A 1LGRA 4IM3A 2D3AA 5D3DA 4X57B 4GMVA 3N32A 4KV2A 1D5ZC 3V05A 1BXTA 2KXJA 2KQ7A 2MHJA 1DOYA 4Q2JA 5G55A 1NBFC 4EZLA 2CJOA 3H1UA 4KGSA 3GE3C 4GSWA 3AE2B 1MI0A 1IGCA 2O6VB 3SDLC 1F9JA 1YQ4B 4XGAB 2MQJA 4II3B 3KW5B 5E6OA 3TCAA 1WGKA 5LNK1 5D2MB 4EKUA 3Q8FA 4B9KA 2INPE 3TEYA 1CK1A 2DZJA 2PVGC 3NVYA 3IVFA 4HK2A 1TKGA 2NCNA 2L52A 1NI2A 4ZDVA 2ICIA 4K7SA 4DWFA 2EELA 1HXYD 4W9EA 4I6NB 3P4RB 1VCBA 2AL6A 4K7UA 4J3OD 1SBBB 3ALBA 4MT5A 1I4XA 2ZW0A 3EUB2 4DHZE 4AUQC 1D6EC 4B95A 4YTPB 1WJNA 3B1LX 1V80A 2RDGA 2ZPNA 1EF1A 1YJJA 2WXKA 4RGTA 3QWZB 1P1AA 1A70A 1STEA 2D5GA 3OJ4B 2REXA 1Q10A 3EGRA 4EEWA 4IUMB 2BT6A 4XDCA 2BB6A 1TS2A 2MP2B 1C1YB 3A4RA 3ZW3A 1IUEA 4MH0E 2WNMA 2O2VB 4KGRA 4C56C 1FM0D 4MGIE 1HTQA 4XC2A 2L00B 4K81A 4W9IA 3NOBA 1RAXA 3HVDA 3JYUA 3NZSA 2KMAA 2N9KA 2CHZA 2MJEA 1MHXA 3RUIB 4HROA 4A55A 1J0GA 1TYGB 3H6NA 2BWFA 2JXTA 4M0WB 3Q8AA 3Q3OC 3OJ3A 4YSXB 3RPFC 2DAJA 2ASQA 1WMHA 4GDKB 2KX3A 3AEBB 2RSUA 3DBLI 2WXOA 2TSSA 2K39A 3RN9C 3PT2B 4ZYNA 3GOEA 1YN3A 1QOFA 2PLPA 2X38A 2W9NA 3P4QB 3ZO5B 4JX1C 4KZCA 4PT5A 4FA6A 1R4NB 2DWQA 2KFKA 2MSED 3O13A 2WU5B 2H88B 2L0FA 1OFFA 4AWJA 3MHSD 1XLOA 2I2YA 2IPKD 2N7EA 4BBNC 3B2GA 3PLVA 1OQQA 4LNFA 1U4AA 3N9YC 2DBYA 2V0GA 4F1SA 2M4NA 5KHQA 2KQSA 3AE5B 3APCA 4YSZB 3VUWA 3SFDB 3ZTDA 2O6VD 1WE6A 3H7SA 5FR3A 3L10B 3KLSX 4M8MA 2L76A 1S1QB 4ZRJA 3T9LA 3HUIA 3O65B 4S17A 2NBWB 4FHKA 3BVGA 1ISNA 1SIFA 2FNJB 1VZ7A 1SGHA 3U7DA 2RDHA 1E7PB 4KKIA 4IWQA 3L16A 1EF5A 4LJPB 2Y3AA 4FADA 4G3XB 1N61A 3IAS1 2JX5A 4N9F4 4HJKA 2BKFA 4PS8A 1QOBA 4GN1A 2Z0DB 4B0MA 4HKZE 2QJLA 2CJNA 3TL5A 3E9SA 3T8MA 3VXWA 1XO3A 3BK1A 2WQYB 4HCNB 1QOGA 3DDCB 3P2BA 4WQOB 2XN9C 3VH3B 1C3TA 3C0RB 1M94A 1XCQL 1C76A 2G4DB 3AH7A 3U2SC 4E71A 5AZFA 3DBRB 1WGHA 4C00A 2K8HA 4ARIA 3Q14C 3Q8EA 2MBQA 1NEKB 2CHXA 4DHZB 2KT7A 4AQ7A 1OQYA 3N20C 2LASA 3R8BA 2KTRA 3HK0A 1AWDA 2WXNA 1CZPA 2KTFA 4TV3A 1TT5B 3DQVA 3VRAB 1V2YA 1L5PA 1K52A 2K3UA 4KDLB 3X0WA 4WAFA 2GOWA 3PRZA 4W9JA 1NI3A 3DBHI 1IP9A 4ARCA 3BVMA 4E74A 5H92C 4XWTA 3VDZA 2LGDA 2SAKA 2BKRB 2NPTB 4ZRIA 1Y8RC 2KC1A 1V6EA 2H89B 3BWUD 1FNUA 1IBXA 3GS2A 3Q69A 3OWEB 1ZGUB 5G5HA 1ZDVA 2KJRA 3KUCB 4GOCA 1RRBA 4A3OA 3L17A 1C9FA 3HRDD 4HDQA 2PPHA 3KWVA 3GP7A 1WY8A 4WJNA 2DZIA 4BKTA 2IO3B 2KYWA 2KQ4X 3A9JA 3ZQ4A 2KFJA 3MC0B 3UIOB 2C5LC 2LUEA 1TZOA 2JSVX 3HM3A 2QEJC 4NJCA 1F0ZA 2DAFA 1V5OA 2ZNVC 1VR9A 1ET6A 4OVUA 2G45B 2M19A 1I4PA 1Q0WB 2KN5A 3I63C 4US9A 4OZAA 2KJ6A 3AE3B 1WH3A 4MDKE 2KN4A 1MPEA 1J7AA 1JWBD 1Q1OA 2IY0B 4ZHPA 1WXVA 4EUTA 1C4CA 2IGDA 2DYMA 4P7IA 4JQWC 1SE9A 3R3MA 2WHIA 3AU4A 1YQBA 4RM8A 1QZEA 1JWAD 1WXAA 4AS1A 4W9DA 2WXLA 1IYFA 2KOXA 1T3QA 5IO9A 1RFAA 3QQ8B 4IOIE 2AQ1B 2MCNB 3EFUA 4MSMB 4YTNB 3A4SC 2V1YA 2IYDB 2IGGA 2FAZA 4BKSD 1CJEA 2KWUB 1F77A 1TKEA 2C7HA 5D6JB 5DPSA 3B0AA 3AE1B 2R61A 5MPOA 2J0JA 1XXGA 1N5XA 5EE3A 2QHOA 1E90A 1KFYB 2LZ6A 2O6VA 3BK2A 2K0PA 1WX9A 4NNJB 1P3QU 4ICVA 3RNAC 3N3KB 1IGDA 3BYTB 2GRIA 4UDUC 3AE6B 5JXVA 4C4VB 1JQ4A 2KLGA 4RGMA 2DYBA 4RGNA 2JU6X 1Z5SB 4PS3A 2RDBC 4A90A 4QAYA 2K6QA 1UBIA 1JW9D 3DOWA 2KWDA 3ZIMA 1QF6A 1XLPA 3DVGY 1NYRA 4AJYB 1XEEA 3PZDA 1G6JA 2JRHA 3TIXA 4TQ1A 3PRPB 1VD2A 1T0RC 3A9KB 2Z8LA 4ANXA 3ZKJC 3MFGA 4OHJA 2MBHA 3RNBC 1TGZB 4EFOA 1WFYA 3ZNHB 4ITKA 3R66C 2UU7A 3AV8A 3L0WB 4KSLC 4XZ4A 4KIKA 1TY0A 1XLNA 3ZJTA 1GG3A 2LWPA 2W82A 3VTWA 3PS6A 4I6PA 1FXAA 5L95C 2KNBA 4XX5A 1QILA 1WGDA 2MP2A 1BMLC 2O2VA 2UYZB 4PYUA 1DYQA 2WDRB 5CHFA 2G1EA 2A4ZA 3C8YA 3VUXA 2L32A 3W2DA 3IT4B 4K3CA 2KMMA 4L1BA 4IW0A 1E8XA 5T8IA 1FXTB 1JCKB 1NVID 2ZPYA 4OW0A 2M1MA 2Q5WD 4KZ0A 3QA8A 4MELA 4W9HA 4M0WA 2WLBA 1UD7A 2NBUA 3FKYA 3ZVVA 2RR9A 3SFEB 5G2NA 1WSPA 1VZ6A 2HTHA 1ENFA 3PZ7A 1MHHE 2JXXA 1SE4A 1QLBB 1EWCA 1L4ZB 1C78A 1SE3A 1L6VA 5DCNA 5E6PA 1JRUA 5DPTA 4GLSC 4WWNA 2J42A 3ZJUA 5IOIA 3WCQA 2J4XA 2JYEA 2CHWA 5C3JB 2WGSA 1KJTA 3APDA 2LVPA 2D07B 1TS3A 1WX7A 4HDOA 3TEWA 1R4MI 2C7NB 1F2RI 4MSQB 1DOIA 1EU4A 2K8BA 3QC8B 5EE1A 4BOSC 3BINA 3GZNB 4A9AA 2RMMA 1TY2A 3JW0X 1CQVA 2MBBB 4II2B 4HVBA 4MJSB 1SJED 5BMIA 2WS3B 1PUTA 4LDTB 4BAXA 2KWVB 2KZRA 2IZVB 4BFRA 5JHBA 1I42A 3RD2A 3NY5A 3Q2AC 1HZ6A 2RD0A 5FK9C 2V4IB 3IAM1 4NJ7A 1ESFA 3VQIA 3EC8A 4HRSA 2IY1B 1F2RC 2ON8A 3M3JA 2HE7A 4CYEA 2WXIA 4RM9A 4NAWB 3DHHC 4DBGA 1RYJA 2MWSB 1ZXIA 1HTOA 4FLHA 4JIOU 4BKSA 1AYFA 1E6EB 2FE8A 1N63A 2C7MB 4CQNA 4WJQA 1OQRA 1PGXA 2QCZA 1YNTE 2GB1A 4WJOA 1DGJA 2ZW1A 1S3SG 2B76B 1ZDXA 2YVCA 1Z2MA 1WM2A 1WX8A 3NHEB 2BYTA 4FULA 2Z0EB 4W9CA 1WYWB 1KTKA 1QT9A 1E5WA 4O1NA 3QX1A 2KDBA 1C77A 3JSVB 1FD6A 5AUKA 1KM7A 3IT6B 3W9CB 2HJ8A 1YJIA 3AEGB 5TSSA 1KF6B 1HE8A 1I4QA 3Q8CA 3ZGZA 3I5JC 2LFIA 1R7SA 2HJ1A 3A33B 4PS7A 4M00A 4DQOC 1E8WA 4L23A 3PO0A 4N6EB 1KH0A 3H7PB 2N1VA 3KYDD 1ZPSA 3Q3NC 3DVGX 3UINB 1C79A 1SIJA 3RFZB 2MJDA 2AYOB 4EZJA 4DDGD 4JWUC 1EWYC 2NPTA 3T3OA 2KANA 3M62B 5D94A 5BMHA 2FCMA 1K53A 3A1QB 2LGXA 2G4SA 1YN4A 3FC4A 2B3AA 4RNAA 4AJWA 5FR6A 1FRRA 3OAWA 1TS5A 4NZLB 3Q3JA 4A6QA 2ZJDA 1WJUA 5FKAC 3KWLA 2WP9B 1V86A 3ZYYX 1YMHE 2N9XA 4IM0A 2PIAA 4LNKA 2N4FA 1T0SC 2KD0A 2NS5A 3TMPB 1J7CA 1VRAB 2WXQA 3NG0A 4HPPA 1UBQA 1SE2A 2EMTA 2QILA 4AOFA 1LM8B 4B0EA 3KVFB 2KAJA 3ENEA 5BYSA 2SEBD 3QK0A 1RM6C 5IA7A 3KH0A 2DZKA 2D3CA 3IG3A 1CMXB 2JPHA 3U30A 2VH1A 4ASWC 1T6BX 5JHAA 4LNNA 1EO6A 2KDIA 4IWPA 5BMGA 3D32A 4MGKE 2BW2A 2IO2B 1J8CA 1FIQA 4BBNF 4LDTD 3V6EB 1GUAB 1SF0A 2JQRB 3ZXRA 1WF9A 2KDFB 2BS2B 2WXRA 1UELA 4AP4C 3V61A 2N7DA 2L05A 3CMMB 1T0QC 2BYFA 3WAPA 2LRUA 4EE2A 1T5XD 3H8HA 1UF0A 1GJZA 4W9KA 4BOZB 2BGFA 3RNCC 1PGAA 2ZVNA 4BVUC 1NYQA 3TUOA 3WA0A 3NZUA 4OZCA 4ZHOA 2AX5A 3QJZA 2LHDA 3BVZA 1L7YA 3N1YC 2I1KA 4C4VA 3SD5A 1MVKA 2MBOA 1I4GA 2PKOA 3SHQA 3UQBA 2MW5A 2K9XA 3P4PB 2JZZA 2LI5A 1YQ3B 4FHJA 3AE9B 3MC9A 3ZDMC 5LLIA 2LGYA 3KQ4A 2D10A 2C60A 1R4NI 4HPLB 2WYQA 1E0ZA 1V1PB 2Y5PA 5G5GA 4BZAA 3A9KA 4GB9A 1YX6B 3UF8A 2WWZA 4R3DA 1FFUA 2IBIB 3ETRA 2EKEC 2XBBC 2N1WA 3IFWB 2DYOA 4G50A 1HA5A 3OG5A 2PE6B 4M01A 2J53A 3IBEA 3PSEB 3CSFA 3AMZA 3TBLD 1TKYA 1I7HA 5BYQA 2FUHB 3WAOA 5BYRA 3ZUNA 3RNGC 5BO4B 1NDDA 1TJEA 3TJPA 2PVOD 3WALA 3VRBB 2LGIA 1GOZA 3TEZA 2KX0A 4IC7B 3L13A 3R2IA 4ANWA 1WI0A 1GB4A 4PK1A 1GNUA 3CWIA 2KACA 4JWSC 5KHOA 3ZLZA 2C9WB 2N7JA 3E56A 5JZEB 3AEDB 5IAAC 1JMLA 2DENB 2N9EB 1GAQB 4EOYA 1J7BA 2OHFA 1FCCC 2INNE 1ZE3D 2V4LA 2JWZA 1V5TA 2E3TA 1WRIA 2DHZA 4HXDA 2YLMA 1K50A 3TSSA 5DPRA 3RZFA 2Z59B 2OOBB 1KLGD 2EMSA 3PREA 1PGBA 1XD3B 2YEPB 1E8ZA 2INDC 3DBRI 4WJPA 3BY4B 1UUPA 2L7RA 2JF5A 2JZPA 2INCC 3NS8A 3S2AA 2K6DB 3BZDB 2JT4B 4JE3B 1T0YA 3DHIC 2LVOA 1LQBA 3U8ZA 2DZMA 3RCZA 4LJOB 3WAMA 2GBRA 4GGQA 3T3NA 2E6XA 4P1BC 3DVNV 3PVLA 3ZTCA 1PDXA 2LUMA 2NTSA 3VH4B 3V6CB 3R7RA 5HFYA 1OGWA 4LK0M 1WGYA 5EE9A 4WWPA 1RWSA 4A20A 2HTME 3HM6X 3SEBA 3K9PB 1EM7A 5AEKB 4YTMB 3B2FA 2AQ2B 4MJSA 1WJ4A 1KRHA 5HKHA 3DCGA 1E7VA 4KVGB 4WAAA 3GE8C 2BB5A 1YX5B 1N5WA 4TUUA 3EFCA 4LNIA 3EECA 1QKZA 4YT0B 2IO1B 4NAWA 1NENB 4WWMA 4US8A 4OZBA 3J9CA 3QARA 3SU8X 4IKGA 2J7QB 2JWUA 4REZA 3L4PA 2EKIA 2KK8A 4WWOA 1WZ0A 1AW7A 2LJIA 3VTUA 3HIZA 3NRZA 4JGHB 2BYVE 4DXAB 3DHGC 4MGZE 2LEKA 3V62A 3NZ3A 3AE7B 3FILB 3NS1A 2FCQA 4XDDA 1WR6E 3JSVA 3L54A 4KX6B 1MG8A 4YXDB 5EE0A 3Q3FA 2IDYA 1JWSD 3LDZE 2X8XX 2WXGA 2L3ZA 4IG7B 3VTVA 2XK5B 1WXSA 2WXJA 4K7WA 3ONSA 2M17A 4GDKA 1AARA 1WYGA 3P63A 1V97A 2NMQA 3QIJA 1FFVA 4M8NA 5CHVC 5CHWA 2IJ0A 2WXPA 3LB8C 4MM3B 5TR5A 2VH2A 1ZXHA 3VUYA 3H7PA 3RMKC 1I4RA 2ZCBA 4W9FA 1JROA 5C1ZA 3DBLB 2R2OA 2QDFA 4F8CB 3ZRFA 2JZ3B 3SR6A 1KLVA 1DOXA 1SEBD 1UWMA 4OVZA 4HEA1 1EUVB 2QIEB 2BTEA 2GI9A 2NTTA 3NUHB 3A1QA 5LXHA 4BKGA 4CHKA 2WX1A 1PQSA 4N58A 1ET9A 4TMAB 4YL8A 1SJHD 4NAMA 4A3PA 2M0AA 4MACA 4RCOA 4FJZA 1MJDA 2CKHB 4FJYA 1L4DB 4URKA 4FN2A 4CO7A 1D4BA 3Q3MC 3UQAA 3AEEB 1L6UA 1GC7A 3KUDB 3AB5A 2PEAA 3IXSA 1OEYJ 2AQ3B 2VRRB 2AL3A 4C7ZA 1WR1A 2KKCA 1P0RA 3U4EG 3N30A 3W5VB 5AZGA 1UH6A 3P1MA 1VJKA 2AEHA 1H8CA 2YEPF 4MH8A 3VAWA 3FAHA 3PHWB 3P42A 3ZNID 1WZ3A 1LO5D 3IHPC 1D5XC 2G3QB 3OLMD 2UWQA 4OVVA 1FCLA 4W9LA 2DNFA 1P9DU 1ZUD2 3ML8A 3VVWB 2N0SB 4KIKB 4TSSA 4XWWA 4GDLB 3AECB 3QHTA 3UI3A 2NBVB 1ZP0B 2GBJA 3B08A 4MGYE 1ROEA 3RNFC 4G11A 5IKCM 2D11A 1I35A 2BYEA 2HDEA 3MC8A 5I4DA 2HD5B 2W55A 3W1YA 4RF0A 4E3CA 2VZKB 1K51A 2GBNA 3PPAA 2BQQA 4JL9A 2Y5BB 3Q6BA 1D5MC 5EDSA 1V9JA 2J52A 2K1FA 5L83A 2MJ3A 5AUIA 3MP9A 2PJHA 2WU2B 4NQLB 4DXFA 1QOAA 1GC6A 5CX3A 4HKQA 2ZVOA 1VDVA 2FCNA 2RPVA 1KLUD 3Q8BA 4GIVA 1XCTL 4M02A 4P16A 1FXIA 3R2TA 4H2AA 5J18A 3RYTA 3BYYB 2PTLA 3X23A 5GMVA 2OJRA 4DXGA 3W1SA 1TS4A 3LXFA 4B6WA 2LVQA 4IM2A 1N62A 2XEWA 2BWES 1E9MA 1V8CA 1V1PA 2JRIB 3DBHB 1BUIC 2CU1A 2KMCA 2GLSA 4J6IA 1YIWA 4FXCA 1WJ6A 4KKJA 5LXIB 1E7UA 3PLUA 4ZOHC 4KSKC 1WRDB 3CSTA 2DLBA 2GBMA 3VR9B 2OEDA 2ZCCA 2ONQA 1YN5A 2JUOA 4N59A 1N6ZA 2D2QA 2W3SA 2ZNVB 2FUG1 1Y56A 1JRPA 3RULA 3M63B 2A5UA 5GXGB 3GZNI 1P7FA 2JVCA 2JYTA 2QSDA 3DPDA 4D2KA 2WXMA 3QAQA 1K8RB 4LTUA 5CTRC 1WGRA 3V3XA 3M95A 1MFWA 4KDIC 2V3SA 3VFKA 1UZXB 1UGMA 4RFBA 2KVRA 4HLEA 4HWIB 5JH5C 2FIFA 3PTFC 1ZW7A 3ZRCA 2G9HD 4RMAA 3K9OB 1TZ1A 4PYZA 2I1JA 2K22A 3NVWA 2D3BA 3C19A 2MRPA 3KUZA 1LXDA 3B9JA 5D7GA 1PYWD 3NVZA 2Y5CA 1E10A 2KC2A 1C4AA 3APFA 3VHTC 3RI7C 1QQRA 3AE8B 3MTNB 3EHVA 2WXHA 1F1HA 2WDQB 2W3RA 2NVUI 3RT3B 2MX2A 1N60A 1FO4A 1WIAA 4XYCA 4L2YA 1BT0A
chains in the Genus database with same CATH topology
2FIDA 1H4RA 4GXBA 4HCPB 2OOBB 3JYUA 1UD7A 3NZSA 2KMAA 2EMSA 3PREA 2CHZA 2NBUA 3RUIB 3H9DA 1XD3B 4DHJB 3ZVVA 1J0GA 2RR9A 3H6NA 1E8ZA 2KWCA 5G2NA 1L2NA 2BWFA 5C23A 3DBRI 2HTHA 2BPSA 4WJPA 3BY4B 4M0WB 2L7RA 2JF5A 3OJ3A 3WANA 2JXXA 4TQ0A 3NS8A 3S2AA 2DAJA 1V49A 2K6DB 4KZ0A 2ASQA 1WMHA 2JT4B 2KX3A 4GDKB 1T0YA 2RSUA 3PGEA 5DCNA 3DBLI 2LVOA 1J19A 1LQBA 3U8ZA 2DZMA 2K39A 3RCZA 3PT2B 4LJOB 4ZYNA 1LFDA 3WAMA 3GOEA 2GBRA 2JY6A 4GGQA 5E6PA 1JRUA 5DPTA 2KDEB 1WMHB 2K25A 2KLCA 4WWNA 2W9NA 3DVNV 3ZO5B 3PVLA 3ZTCA 3ZNZB 4KZCA 2CHWA 3AXCA 4FA6A 1KOTA 2KFKA 3VH4B 1KJTA 2CS4A 3V6CB 3R7RA 3APDA 2MSED 1OGWA 2CR5A 2LVPA 1WGYA 4WWPA 2D07B 2L0FA 1WX7A 4HDOA 1RLFA 2D3GA 4AWJA 1R4MI 4A20A 2J0KA 3HM6X 3K9PB 2KFKB 3MHSD 5AEKB 2C7NB 4DDID 2N7EA 4BBNC 3PLVA 5AZHA 4MJSA 1WJ4A 4MSQB 1U4AA 2K8BA 5HKHA 3QC8B 3DCGA 4F1SA 1E7VA 4BOSC 2J0MA 2M4NA 3L08A 3BINA 4KVGB 5KHQA 1E8YA 4WAAA 2KQSA 3APCA 3VUWA 4ANUA 1YX5B 3JW0X 2MBBB 4TUUA 2GMIC 4II2B 3ZNGC 4HVBA 4MJSB 3ZTDA 2O6VD 1WE6A 4LDTB 3H7SA 3EECA 1OEYA 3L10B 2KWVB 2KZRA 2IZVB 3AU5A 4M8MA 2KJHB 4BFRA 2L76A 5JHBA 3RD2A 1S1QB 3NY5A 1I42A 2ZZPB 2IO1B 4ZRJA 4NAWA 2RD0A 3T9LA 3CF6E 2LJ5A 1WE7A 3O65B 4NJ7A 3VQIA 3EC8A 2IY1B 2NBWB 3QARA 2RPQA 4FHKA 3M3JA 3SU8X 1ISNA 2HE7A 1SIFA 2FNJB 4CYEA 1SGHA 4ZRKA 3U7DA 2J7QB 1YD8U 4RM9A 4NAWB 4DBGA 3AULA 2KK8A 2MWSB 4IWQA 4WWOA 1WZ0A 3L16A 1EF5A 4LJPB 3VTUA 3HIZA 4FLHA 2MLBA 4JIOU 4K1RB 4BKSA 4JGHB 2BYVE 2M0XA 4DXAB 4FADA 4G3XB 4MGZE 2C7MB 4WJQA 2BF8B 3V62A 4WJOA 4MEMA 4N9F4 4HJKA 1S3SG 3JVZX 2BKFA 1P98A 4PS8A 4GN1A 2Z0DB 1WXMA 4FJVB 2FCQA 3TL5A 1WR6E 1OTRB 3JSVA 3L54A 3T8MA 2YVCA 1Z2MA 2XK5A 3VXWA 4HCNB 1WM2A 1MG8A 4GU2A 1WX8A 3Q3FA 3NHEB 3DDCB 4FULA 2Z0EB 3P2BA 4W9CA 4WQOB 3LDZE 1WYWB 1E5WA 1TBEA 2R2QA 2WX0A 3VH3B 3QX1A 4MM3A 4I6LB 2KDBA 3JSVB 1C3TA 2L3ZA 4IG7B 3C0RB 3VTVA 1M94A 2XK5B 1KM7A 1WXSA 4K7WA 2G4DB 3ONSA 2HJ8A 2M17A 1AARA 4GDKA 3DVNU 3R7QA 4E71A 3QIJA 5AZFA 5CHVC 4M8NA 5CHWA 1HE8A 5TR5A 1WGHA 2L0TA 1YJ1A 1XT9B 2K8HA 4ANVA 3VUYA 2KHWB 2MBQA 3H7PA 4JLCA 2CHXA 4DHZB 4NPNA 1OQYA 3A33B 2ZCBA 4PS7A 4W9FA 1XQQA 5C1ZA 2LXAA 4HPMB 1E8WA 2LASA 2KTRA 3HK0A 4FBJB 1WM3A 1ZKHA 2MA9B 2R2OA 3PV1A 3H7PB 4F8CB 3ZRFA 2N1VA 4ICUA 1IPGA 2JZ3B 1A5RA 3KYDD 2KTFA 2LXCA 4TV3A 1KLVA 3I3TB 3V60A 2MBEA 2WDTB 3DVGX 3DQVA 1EUVB 3UINB 2DX5B 4W9GA 1V2YA 2IO0B 3A1QA 4KDLB 2KTRB 2M1MA 5E6NA 5LXHA 2AYOB 4BKGA 4EZJA 3X0WA 4DDGD 2GOWA 4CHKA 3PRZA 2NPTA 2WX1A 1PQSA 2KANA 3DBHI 4W9JA 1IP9A 4DHJD 3M62B 5D94A 4E74A 4YL8A 2FCMA 4G0NB 3ECIA 2ZEQA 5J2RA 2N9PC 3A1QB 1WGGA 3VDZA 2LGDA 2G4SA 2LGXA 3PRMB 4A3PA 3KYCD 3DBSA 2BKRB 2NPTB 2B3AA 4ZRIA 1Y8RC 3MJWA 2CKHB 2KC1A 4FJZA 4AJWA 5FR6A 1V6EA 3OAWA 4FJYA 3Q3JA 4LCDE 4URKA 5J17A 2ZJDA 4FN2A 1WJUA 1V86A 3ZDTA 4CO7A 2M8SA 2N9XA 3UQAA 4IWOA 1ZGUB 4IM0A 1GC7A 3KUDB 3PHXB 2KJRA 2PEAA 2N4FA 3KUCB 4GOCA 4NJ6A 3W1SC 2KD0A 1RRBA 4A3OA 2NS5A 3L17A 3TMPB 1OEYJ 2VRRB 4HDQA 2AL3A 2PPHA 1WR1A 2KKCA 1P0RA 1UBQA 2PE9A 3N30A 2EMTA 3AI5A 1WY8A 5AZGA 4AOFA 1LM8B 4WJNA 1RAXA 3KVFB 1UH6A 2DZIA 4BKTA 2IO3B 2AEHA 2GBKA 1Q5WB 3ENEA 3A9JA 1H8CA 2KFJA 1D3ZA 3VAWA 3UIOB 3WIMA 2C5LC 3PHWB 3QK0A 3UIPB 5IA7A 2LUEA 3KH0A 3RZWC 3ZNID 1WZ3A 2DZKA 3HHMA 2K8CA 3HM3A 1CMXB 3IG3A 2JPHA 3UGBB 3U30A 2DAFA 1V5OA 3IHPC 4TKNA 4GDLA 4ASWC 3A9JB 2ZNVC 4OVUA 2G3QB 5JHAA 2G45B 3OLMD 1EO6A 4EZKA 2UWQA 4OVVA 1Q0WB 2KN5A 5DPWA 2KDIA 4IWPA 4W9LA 2KJ6A 4F7ZA 2NR2A 1WH3A 2LD9A 1P9DU 3ML8A 3VVWB 4MDKE 3D32A 4NQKE 4KIKB 1TTNA 4GDLB 4MGKE 2IO2B 3QHTA 1J8CA 2NBVB 4BBNF 4LDTD 3V6EB 1GUAB 1Q1OA 2IY0B 1WF9A 2KDFB 2GBJA 3B08A 4MGYE 4DK5A 1WXVA 1UELA 4EUTA 4G11A 2KO3A 4NY0A 2D11A 3V61A 4AP4C 2LRWA 1I35A 2DYMA 2N7DA 3ML9A 4JQWC 4P7IA 1SE9A 2BYEA 2L05A 3R3MA 3CMMB 3AU4A 2FCSA 2BYFA 1YQBA 2HD5B 2L8JA 2LRUA 1QZEA 4RM8A 3W1YA 3WAPA 3QCAA 4E3CA 1WXAA 2GBNA 4W9DA 3PPAA 4JL9A 1IYFA 2KOXA 2Y5BB 3LJ3A 1RFAA 3QQ8B 1GJZA 4W9KA 2AWTA 2RGFA 1X1MA 4BOZB 5EDSA 2BGFA 1V9JA 2K1FA 5L83A 1V81A 2MCNB 3EFUA 4MSMB 3A4SC 4IM3A 2V1YA 2PJHA 2ZVNA 4BVUC 4NQLB 2IYDB 1GC6A 5CX3A 3WA0A 4X57B 2ZVOA 2FCNA 3NZUA 3N32A 2FAZA 4GMVA 4KV2A 4GIVA 4BKSD 2KWUB 2C7HA 5D6JB 5DPSA 2KXJA 2KQ7A 3B0AA 5J18A 3QJZA 3RYTA 2J0JA 5G55A 1L7YA 1NBFC 2QHOA 4EZLA 2I1KA 3X23A 1E90A 5GMVA 3H1UA 2OJRA 3W1SA 3SD5A 2LZ6A 2O6VA 1WX9A 4NNJB 1P3QU 4B6WA 2MBOA 2LVQA 4IM2A 4ICVA 3SHQA 3UQBA 4GSWA 2XEWA 2MW5A 3N3KB 2BWES 2JZZA 2LI5A 2JRIB 4FHJA 3SDLC 2O6VB 2CU1A 3ZDMC 2KLGA 2KMCA 1F9JA 4J6IA 2LGYA 1YIWA 2DYBA 5LLIA 2MQJA 4II3B 1WJ6A 2D10A 2C60A 3KW5B 5E6OA 3TCAA 1R4NI 1Z5SB 4PS3A 4HPLB 5D2MB 2WYQA 5LXIB 1E7UA 2K6QA 3A9KA 1UBIA 3DOWA 3PLUA 4EKUA 4GB9A 4KSKC 1YX6B 1WRDB 3CSTA 3UF8A 3ZIMA 3DVGY 2GBMA 2WWZA 4B9KA 4AJYB 3PZDA 2ZCCA 1G6JA 2JRHA 3TIXA 4TQ1A 3PRPB 2IBIB 1VD2A 2EKEC 2JUOA 2N1WA 2XBBC 2D2QA 2DZJA 3A9KB 3IFWB 2DYOA 4G50A 3IVFA 2ZNVB 4ANXA 4HK2A 3ZKJC 3RULA 2NCNA 3M63B 2A5UA 1NI2A 2PE6B 3GZNI 4ZDVA 4K7SA 3IBEA 3PSEB 2JVCA 3CSFA 3TBLD 2MBHA 4DWFA 3DPDA 1TGZB 3QAQA 4W9EA 4I6NB 4EFOA 1K8RB 5CTRC 1WGRA 3M95A 1VCBA 1WFYA 2AL6A 4K7UA 2FUHB 3ZNHB 3WAOA 3R66C 4KDIC 3ZUNA 2V3SA 5BO4B 1NDDA 3ALBA 3L0WB 4KSLC 4XZ4A 3VFKA 1UZXB 4KIKA 1UGMA 3TJPA 3WALA 2KVRA 4DHZE 4HWIB 4HLEA 1GG3A 2LWPA 4AUQC 3VTWA 2KX0A 4IC7B 2FIFA 3L13A 5JH5C 3PTFC 3PS6A 1ZW7A 4ANWA 4B95A 1WI0A 4I6PA 3ZRCA 1GNUA 5L95C 4RMAA 3K9OB 2KNBA 1TZ1A 1WJNA 4PYZA 2I1JA 3B1LX 1V80A 4XX5A 2ZPNA 5KHOA 3ZLZA 1WGDA 4W9HA 3QA8A 1EF1A 3QWZB 2MP2A 1P1AA 2C9WB 3OJ4B 2MRPA 3KUZA 5JZEB 1LXDA 2O2VA 2REXA 2UYZB 4PYUA 5D7GA 4EEWA 5CHFA 5IAAC 4IUMB 2DENB 2A4ZA 2N9EB 2KC2A 3APFA 3VUXA 3VHTC 4EOYA 2MP2B 1C1YB 3A4RA 3ZW3A 4MH0E 4IW0A 2O2VB 1E8XA 3EHVA 3MTNB 2V4LA 4MGIE 2JWZA 1V5TA 4XC2A 2L00B 4K81A 1FXTB 2DHZA 2NVUI 4HXDA 4W9IA 2YLMA 3RT3B 2MX2A 2ZPYA 3NOBA 5DPRA 3RZFA 1WIAA 1BT0A 2Z59B 4MELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FID A;  1H4R A;  4GXB A;  4HCP B;  2OOB B;  3JYU A;  1UD7 A;  3NZS A;  2KMA A;  2EMS A;  3PRE A;  2CHZ A;  2NBU A;  3RUI B;  3H9D A;  1XD3 B;  4DHJ B;  3ZVV A;  1J0G A;  2RR9 A;  3H6N A;  1E8Z A;  2KWC A;  5G2N A;  1L2N A;  2BWF A;  5C23 A;  3DBR I;  2HTH A;  2BPS A;  4WJP A;  3BY4 B;  4M0W B;  2L7R A;  2JF5 A;  3OJ3 A;  3WAN A;  2JXX A;  4TQ0 A;  3NS8 A;  3S2A A;  2DAJ A;  1V49 A;  2K6D B;  4KZ0 A;  2ASQ A;  1WMH A;  2JT4 B;  2KX3 A;  4GDK B;  1T0Y A;  2RSU A;  3PGE A;  5DCN A;  3DBL I;  2LVO A;  1J19 A;  1LQB A;  3U8Z A;  2DZM A;  2K39 A;  3RCZ A;  3PT2 B;  4LJO B;  4ZYN A;  1LFD A;  3WAM A;  3GOE A;  2GBR A;  2JY6 A;  4GGQ A;  5E6P A;  1JRU A;  5DPT A;  2KDE B;  1WMH B;  2K25 A;  2KLC A;  4WWN A;  2W9N A;  3DVN V;  3ZO5 B;  3PVL A;  3ZTC A;  3ZNZ B;  4KZC A;  2CHW A;  3AXC A;  4FA6 A;  1KOT A;  2KFK A;  3VH4 B;  1KJT A;  2CS4 A;  3V6C B;  3R7R A;  3APD A;  2MSE D;  1OGW A;  2CR5 A;  2LVP A;  1WGY A;  4WWP A;  2D07 B;  2L0F A;  1WX7 A;  4HDO A;  1RLF A;  2D3G A;  4AWJ A;  1R4M I;  4A20 A;  2J0K A;  3HM6 X;  3K9P B;  2KFK B;  3MHS D;  5AEK B;  2C7N B;  4DDI D;  2N7E A;  4BBN C;  3PLV A;  5AZH A;  4MJS A;  1WJ4 A;  4MSQ B;  1U4A A;  2K8B A;  5HKH A;  3QC8 B;  3DCG A;  4F1S A;  1E7V A;  4BOS C;  2J0M A;  2M4N A;  3L08 A;  3BIN A;  4KVG B;  5KHQ A;  1E8Y A;  4WAA A;  2KQS A;  3APC A;  3VUW A;  4ANU A;  1YX5 B;  3JW0 X;  2MBB B;  4TUU A;  2GMI C;  4II2 B;  3ZNG C;  4HVB A;  4MJS B;  3ZTD A;  2O6V D;  1WE6 A;  4LDT B;  3H7S A;  3EEC A;  1OEY A;  3L10 B;  2KWV B;  2KZR A;  2IZV B;  3AU5 A;  4M8M A;  2KJH B;  4BFR A;  2L76 A;  5JHB A;  3RD2 A;  1S1Q B;  3NY5 A;  1I42 A;  2ZZP B;  2IO1 B;  4ZRJ A;  4NAW A;  2RD0 A;  3T9L A;  3CF6 E;  2LJ5 A;  1WE7 A;  3O65 B;  4NJ7 A;  3VQI A;  3EC8 A;  2IY1 B;  2NBW B;  3QAR A;  2RPQ A;  4FHK A;  3M3J A;  3SU8 X;  1ISN A;  2HE7 A;  1SIF A;  2FNJ B;  4CYE A;  1SGH A;  4ZRK A;  3U7D A;  2J7Q B;  1YD8 U;  4RM9 A;  4NAW B;  4DBG A;  3AUL A;  2KK8 A;  2MWS B;  4IWQ A;  4WWO A;  1WZ0 A;  3L16 A;  1EF5 A;  4LJP B;  3VTU A;  3HIZ A;  4FLH A;  2MLB A;  4JIO U;  4K1R B;  4BKS A;  4JGH B;  2BYV E;  2M0X A;  4DXA B;  4FAD A;  4G3X B;  4MGZ E;  2C7M B;  4WJQ A;  2BF8 B;  3V62 A;  4WJO A;  4MEM A;  4N9F 4;  4HJK A;  1S3S G;  3JVZ X;  2BKF A;  1P98 A;  4PS8 A;  4GN1 A;  2Z0D B;  1WXM A;  4FJV B;  2FCQ A;  3TL5 A;  1WR6 E;  1OTR B;  3JSV A;  3L54 A;  3T8M A;  2YVC A;  1Z2M A;  2XK5 A;  3VXW A;  4HCN B;  1WM2 A;  1MG8 A;  4GU2 A;  1WX8 A;  3Q3F A;  3NHE B;  3DDC B;  4FUL A;  2Z0E B;  3P2B A;  4W9C A;  4WQO B;  3LDZ E;  1WYW B;  1E5W A;  1TBE A;  2R2Q A;  2WX0 A;  3VH3 B;  3QX1 A;  4MM3 A;  4I6L B;  2KDB A;  3JSV B;  1C3T A;  2L3Z A;  4IG7 B;  3C0R B;  3VTV A;  1M94 A;  2XK5 B;  1KM7 A;  1WXS A;  4K7W A;  2G4D B;  3ONS A;  2HJ8 A;  2M17 A;  1AAR A;  4GDK A;  3DVN U;  3R7Q A;  4E71 A;  3QIJ A;  5AZF A;  5CHV C;  4M8N A;  5CHW A;  1HE8 A;  5TR5 A;  1WGH A;  2L0T A;  1YJ1 A;  1XT9 B;  2K8H A;  4ANV A;  3VUY A;  2KHW B;  2MBQ A;  3H7P A;  4JLC A;  2CHX A;  4DHZ B;  4NPN A;  1OQY A;  3A33 B;  2ZCB A;  4PS7 A;  4W9F A;  1XQQ A;  5C1Z A;  2LXA A;  4HPM B;  1E8W A;  2LAS A;  2KTR A;  3HK0 A;  4FBJ B;  1WM3 A;  1ZKH A;  2MA9 B;  2R2O A;  3PV1 A;  3H7P B;  4F8C B;  3ZRF A;  2N1V A;  4ICU A;  1IPG A;  2JZ3 B;  1A5R A;  3KYD D;  2KTF A;  2LXC A;  4TV3 A;  1KLV A;  3I3T B;  3V60 A;  2MBE A;  2WDT B;  3DVG X;  3DQV A;  1EUV B;  3UIN B;  2DX5 B;  4W9G A;  1V2Y A;  2IO0 B;  3A1Q A;  4KDL B;  2KTR B;  2M1M A;  5E6N A;  5LXH A;  2AYO B;  4BKG A;  4EZJ A;  3X0W A;  4DDG D;  2GOW A;  4CHK A;  3PRZ A;  2NPT A;  2WX1 A;  1PQS A;  2KAN A;  3DBH I;  4W9J A;  1IP9 A;  4DHJ D;  3M62 B;  5D94 A;  4E74 A;  4YL8 A;  2FCM A;  4G0N B;  3ECI A;  2ZEQ A;  5J2R A;  2N9P C;  3A1Q B;  1WGG A;  3VDZ A;  2LGD A;  2G4S A;  2LGX A;  3PRM B;  4A3P A;  3KYC D;  3DBS A;  2BKR B;  2NPT B;  2B3A A;  4ZRI A;  1Y8R C;  3MJW A;  2CKH B;  2KC1 A;  4FJZ A;  4AJW A;  5FR6 A;  1V6E A;  3OAW A;  4FJY A;  3Q3J A;  4LCD E;  4URK A;  5J17 A;  2ZJD A;  4FN2 A;  1WJU A;  1V86 A;  3ZDT A;  4CO7 A;  2M8S A;  2N9X A;  3UQA A;  4IWO A;  1ZGU B;  4IM0 A;  1GC7 A;  3KUD B;  3PHX B;  2KJR A;  2PEA A;  2N4F A;  3KUC B;  4GOC A;  4NJ6 A;  3W1S C;  2KD0 A;  1RRB A;  4A3O A;  2NS5 A;  3L17 A;  3TMP B;  1OEY J;  2VRR B;  4HDQ A;  2AL3 A;  2PPH A;  1WR1 A;  2KKC A;  1P0R A;  1UBQ A;  2PE9 A;  3N30 A;  2EMT A;  3AI5 A;  1WY8 A;  5AZG A;  4AOF A;  1LM8 B;  4WJN A;  1RAX A;  3KVF B;  1UH6 A;  2DZI A;  4BKT A;  2IO3 B;  2AEH A;  2GBK A;  1Q5W B;  3ENE A;  3A9J A;  1H8C A;  2KFJ A;  1D3Z A;  3VAW A;  3UIO B;  3WIM A;  2C5L C;  3PHW B;  3QK0 A;  3UIP B;  5IA7 A;  2LUE A;  3KH0 A;  3RZW C;  3ZNI D;  1WZ3 A;  2DZK A;  3HHM A;  2K8C A;  3HM3 A;  1CMX B;  3IG3 A;  2JPH A;  3UGB B;  3U30 A;  2DAF A;  1V5O A;  3IHP C;  4TKN A;  4GDL A;  4ASW C;  3A9J B;  2ZNV C;  4OVU A;  2G3Q B;  5JHA A;  2G45 B;  3OLM D;  1EO6 A;  4EZK A;  2UWQ A;  4OVV A;  1Q0W B;  2KN5 A;  5DPW A;  2KDI A;  4IWP A;  4W9L A;  2KJ6 A;  4F7Z A;  2NR2 A;  1WH3 A;  2LD9 A;  1P9D U;  3ML8 A;  3VVW B;  4MDK E;  3D32 A;  4NQK E;  4KIK B;  1TTN A;  4GDL B;  4MGK E;  2IO2 B;  3QHT A;  1J8C A;  2NBV B;  4BBN F;  4LDT D;  3V6E B;  1GUA B;  1Q1O A;  2IY0 B;  1WF9 A;  2KDF B;  2GBJ A;  3B08 A;  4MGY E;  4DK5 A;  1WXV A;  1UEL A;  4EUT A;  4G11 A;  2KO3 A;  4NY0 A;  2D11 A;  3V61 A;  4AP4 C;  2LRW A;  1I35 A;  2DYM A;  2N7D A;  3ML9 A;  4JQW C;  4P7I A;  1SE9 A;  2BYE A;  2L05 A;  3R3M A;  3CMM B;  3AU4 A;  2FCS A;  2BYF A;  1YQB A;  2HD5 B;  2L8J A;  2LRU A;  1QZE A;  4RM8 A;  3W1Y A;  3WAP A;  3QCA A;  4E3C A;  1WXA A;  2GBN A;  4W9D A;  3PPA A;  4JL9 A;  1IYF A;  2KOX A;  2Y5B B;  3LJ3 A;  1RFA A;  3QQ8 B;  1GJZ A;  4W9K A;  2AWT A;  2RGF A;  1X1M A;  4BOZ B;  5EDS A;  2BGF A;  1V9J A;  2K1F A;  5L83 A;  1V81 A;  2MCN B;  3EFU A;  4MSM B;  3A4S C;  4IM3 A;  2V1Y A;  2PJH A;  2ZVN A;  4BVU C;  4NQL B;  2IYD B;  1GC6 A;  5CX3 A;  3WA0 A;  4X57 B;  2ZVO A;  2FCN A;  3NZU A;  3N32 A;  2FAZ A;  4GMV A;  4KV2 A;  4GIV A;  4BKS D;  2KWU B;  2C7H A;  5D6J B;  5DPS A;  2KXJ A;  2KQ7 A;  3B0A A;  5J18 A;  3QJZ A;  3RYT A;  2J0J A;  5G55 A;  1L7Y A;  1NBF C;  2QHO A;  4EZL A;  2I1K A;  3X23 A;  1E90 A;  5GMV A;  3H1U A;  2OJR A;  3W1S A;  3SD5 A;  2LZ6 A;  2O6V A;  1WX9 A;  4NNJ B;  1P3Q U;  4B6W A;  2MBO A;  2LVQ A;  4IM2 A;  4ICV A;  3SHQ A;  3UQB A;  4GSW A;  2XEW A;  2MW5 A;  3N3K B;  2BWE S;  2JZZ A;  2LI5 A;  2JRI B;  4FHJ A;  3SDL C;  2O6V B;  2CU1 A;  3ZDM C;  2KLG A;  2KMC A;  1F9J A;  4J6I A;  2LGY A;  1YIW A;  2DYB A;  5LLI A;  2MQJ A;  4II3 B;  1WJ6 A;  2D10 A;  2C60 A;  3KW5 B;  5E6O A;  3TCA A;  1R4N I;  1Z5S B;  4PS3 A;  4HPL B;  5D2M B;  2WYQ A;  5LXI B;  1E7U A;  2K6Q A;  3A9K A;  1UBI A;  3DOW A;  3PLU A;  4EKU A;  4GB9 A;  4KSK C;  1YX6 B;  1WRD B;  3CST A;  3UF8 A;  3ZIM A;  3DVG Y;  2GBM A;  2WWZ A;  4B9K A;  4AJY B;  3PZD A;  2ZCC A;  1G6J A;  2JRH A;  3TIX A;  4TQ1 A;  3PRP B;  2IBI B;  1VD2 A;  2EKE C;  2JUO A;  2N1W A;  2XBB C;  2D2Q A;  2DZJ A;  3A9K B;  3IFW B;  2DYO A;  4G50 A;  3IVF A;  2ZNV B;  4ANX A;  4HK2 A;  3ZKJ C;  3RUL A;  2NCN A;  3M63 B;  2A5U A;  1NI2 A;  2PE6 B;  3GZN I;  4ZDV A;  4K7S A;  3IBE A;  3PSE B;  2JVC A;  3CSF A;  3TBL D;  2MBH A;  4DWF A;  3DPD A;  1TGZ B;  3QAQ A;  4W9E A;  4I6N B;  4EFO A;  1K8R B;  5CTR C;  1WGR A;  3M95 A;  1VCB A;  1WFY A;  2AL6 A;  4K7U A;  2FUH B;  3ZNH B;  3WAO A;  3R66 C;  4KDI C;  3ZUN A;  2V3S A;  5BO4 B;  1NDD A;  3ALB A;  3L0W B;  4KSL C;  4XZ4 A;  3VFK A;  1UZX B;  4KIK A;  1UGM A;  3TJP A;  3WAL A;  2KVR A;  4DHZ E;  4HWI B;  4HLE A;  1GG3 A;  2LWP A;  4AUQ C;  3VTW A;  2KX0 A;  4IC7 B;  2FIF A;  3L13 A;  5JH5 C;  3PTF C;  3PS6 A;  1ZW7 A;  4ANW A;  4B95 A;  1WI0 A;  4I6P A;  3ZRC A;  1GNU A;  5L95 C;  4RMA A;  3K9O B;  2KNB A;  1TZ1 A;  1WJN A;  4PYZ A;  2I1J A;  3B1L X;  1V80 A;  4XX5 A;  2ZPN A;  5KHO A;  3ZLZ A;  1WGD A;  4W9H A;  3QA8 A;  1EF1 A;  3QWZ B;  2MP2 A;  1P1A A;  2C9W B;  3OJ4 B;  2MRP A;  3KUZ A;  5JZE B;  1LXD A;  2O2V A;  2REX A;  2UYZ B;  4PYU A;  5D7G A;  4EEW A;  5CHF A;  5IAA C;  4IUM B;  2DEN B;  2A4Z A;  2N9E B;  2KC2 A;  3APF A;  3VUX A;  3VHT C;  4EOY A;  2MP2 B;  1C1Y B;  3A4R A;  3ZW3 A;  4MH0 E;  4IW0 A;  2O2V B;  1E8X A;  3EHV A;  3MTN B;  2V4L A;  4MGI E;  2JWZ A;  1V5T A;  4XC2 A;  2L00 B;  4K81 A;  1FXT B;  2DHZ A;  2NVU I;  4HXD A;  4W9I A;  2YLM A;  3RT3 B;  2MX2 A;  2ZPY A;  3NOB A;  5DPR A;  3RZF A;  1WIA A;  1BT0 A;  2Z59 B;  4MEL A; 
#chains in the Genus database with same CATH topology
 2FID A;  1H4R A;  4GXB A;  4HCP B;  4KGT A;  1FNV A;  2L1A A;  3H9D A;  4DHJ B;  2WXF A;  3P4S B;  2KWC A;  1L2N A;  3DWM A;  3AE4 B;  5C23 A;  1RFK A;  2BPS A;  3WAN A;  4ZRP A;  4TQ0 A;  4C80 A;  1V49 A;  4P6V F;  1PFD A;  2VZK D;  3PGE A;  1J19 A;  3BII D;  1LFD A;  2JY6 A;  2KDE B;  1WMH B;  2K25 A;  2KLC A;  2LMC A;  2PW9 A;  3ZNZ B;  1XF5 L;  3AXC A;  1KOT A;  3VR8 B;  2CS4 A;  2CR5 A;  1RLF A;  2D3G A;  3NVV A;  1HQR D;  2J0K A;  1JWM D;  3N1X C;  2KFK B;  3AEF B;  4DDI D;  2XNA C;  1ACC A;  5AZH A;  1GPX A;  2QC8 A;  4RH6 A;  2J0M A;  3L08 A;  3AM9 A;  1E8Y A;  1FEH A;  1WXQ A;  4ANU A;  2KDM A;  3AN1 A;  3ZNG C;  2GMI C;  1FRD A;  1OEY A;  3AU5 A;  2BBC A;  2KJH B;  2ZZP B;  3CF6 E;  2LJ5 A;  1WE7 A;  4JPS A;  3EA6 A;  3I9V 1;  2RPQ A;  4ZRK A;  3TEX A;  4A8X C;  1YD8 U;  4HJG E;  1F52 A;  2OJW A;  3AUL A;  2MEK A;  3AEA B;  3FIL A;  2MLB A;  4K1R B;  1P7E A;  4WH4 A;  2M0X A;  2V9H A;  1XLQ A;  5HI1 A;  2BF8 B;  4MEM A;  3JVZ X;  3W5U B;  2PMV A;  1P98 A;  2MH7 A;  2N9L A;  4LNO A;  1WXM A;  4FJV B;  1FMA D;  1OTR B;  4WUR A;  2XK5 A;  4GU2 A;  2FBW B;  3DWG C;  1SXT A;  2V3N A;  1TBE A;  2R2Q A;  2WX0 A;  4MM3 A;  4I6L B;  4ZYS A;  1AN8 A;  3LYY A;  3U52 E;  2K5P A;  4C7Y A;  1L0V B;  1HEZ E;  2KVZ A;  4WIP A;  2IGH A;  3DVN U;  3R7Q A;  1HZ5 A;  3PZ8 A;  2M56 B;  4ANV A;  2L0T A;  1YJ1 A;  1XT9 B;  2I38 A;  2KHW B;  4JLC A;  4USA A;  2W54 A;  4NPN A;  3CIR B;  1XQQ A;  2LXA A;  5IP4 D;  4HPM B;  1FNW A;  4IDI A;  4P1C C;  5D3I B;  1WM3 A;  1ZKH A;  4FBJ B;  2MA9 B;  3PV1 A;  5HHD G;  2BS4 B;  1A5R A;  2BS3 B;  4ICU A;  1IPG A;  2LXC A;  2BVC A;  3I3T B;  3V60 A;  2MBE A;  2WDT B;  3MHZ A;  2V3P A;  2DX5 B;  2LGS A;  4W9G A;  5IN7 A;  2IO0 B;  4XE0 A;  1WWT A;  2KTR B;  2WDV B;  5E6N A;  4K3B A;  4LLG M;  1TIF A;  3NJT A;  3MJ5 A;  4DHJ D;  1YOV B;  4G0N B;  5C2T B;  3ECI A;  2ZEQ A;  5J2R A;  2N9P C;  1WGG A;  3PRM B;  1R4M B;  2L83 A;  3KYC D;  3DBS A;  1L0X B;  4ACF A;  1UWX A;  4ZRQ A;  3MJW A;  3N1Z C;  4LCD E;  1ZOY B;  3RNE C;  5J17 A;  1L0Y B;  3ZDT A;  2M8S A;  4IWO A;  1UNS A;  1B1Z A;  3PHX B;  4NJ6 A;  3U7Z A;  2ACZ B;  3W1S C;  1M4V A;  4S0R A;  3I57 A;  1IBX B;  2PE9 A;  5E6J A;  3AI5 A;  1EU3 A;  1MG4 A;  3ZXV A;  4RF1 A;  4YSY B;  1V1O A;  2GBK A;  1Q5W B;  1D3Z A;  3ZJV A;  1C4P A;  3WIM A;  3GB1 A;  3UIP B;  1FPY A;  3RZW C;  3HHM A;  2CU3 A;  2K8C A;  3HVZ A;  3UGB B;  4TKN A;  4YWG G;  4GDL A;  3A9J B;  1VZ8 A;  1JWU D;  4EZK A;  1B9R A;  1JAL A;  1GB1 A;  5DPW A;  4F7Z A;  2NR2 A;  2LD9 A;  3URY A;  4NQK E;  1TTN A;  4WQM A;  2QMT A;  4DK5 A;  1SSN A;  1I4H A;  2KO3 A;  4NY0 A;  2LRW A;  3ML9 A;  2LHE A;  2FCS A;  2L8J A;  3QCA A;  5HG2 A;  3ABV B;  5H8Y E;  3LJ3 A;  1SB3 C;  1VLB A;  2AWT A;  2RGF A;  1X1M A;  4RGO S;  1UGJ A;  1V81 A;  1LGR A;  4IM3 A;  2D3A A;  5D3D A;  4X57 B;  4GMV A;  3N32 A;  4KV2 A;  1D5Z C;  3V05 A;  1BXT A;  2KXJ A;  2KQ7 A;  2MHJ A;  1DOY A;  4Q2J A;  5G55 A;  1NBF C;  4EZL A;  2CJO A;  3H1U A;  4KGS A;  3GE3 C;  4GSW A;  3AE2 B;  1MI0 A;  1IGC A;  2O6V B;  3SDL C;  1F9J A;  1YQ4 B;  4XGA B;  2MQJ A;  4II3 B;  3KW5 B;  5E6O A;  3TCA A;  1WGK A;  5LNK 1;  5D2M B;  4EKU A;  3Q8F A;  4B9K A;  2INP E;  3TEY A;  1CK1 A;  2DZJ A;  2PVG C;  3NVY A;  3IVF A;  4HK2 A;  1TKG A;  2NCN A;  2L52 A;  1NI2 A;  4ZDV A;  2ICI A;  4K7S A;  4DWF A;  2EEL A;  1HXY D;  4W9E A;  4I6N B;  3P4R B;  1VCB A;  2AL6 A;  4K7U A;  4J3O D;  1SBB B;  3ALB A;  4MT5 A;  1I4X A;  2ZW0 A;  3EUB 2;  4DHZ E;  4AUQ C;  1D6E C;  4B95 A;  4YTP B;  1WJN A;  3B1L X;  1V80 A;  2RDG A;  2ZPN A;  1EF1 A;  1YJJ A;  2WXK A;  4RGT A;  3QWZ B;  1P1A A;  1A70 A;  1STE A;  2D5G A;  3OJ4 B;  2REX A;  1Q10 A;  3EGR A;  4EEW A;  4IUM B;  2BT6 A;  4XDC A;  2BB6 A;  1TS2 A;  2MP2 B;  1C1Y B;  3A4R A;  3ZW3 A;  1IUE A;  4MH0 E;  2WNM A;  2O2V B;  4KGR A;  4C56 C;  1FM0 D;  4MGI E;  1HTQ A;  4XC2 A;  2L00 B;  4K81 A;  4W9I A;  3NOB A;  1RAX A;  3HVD A;  3JYU A;  3NZS A;  2KMA A;  2N9K A;  2CHZ A;  2MJE A;  1MHX A;  3RUI B;  4HRO A;  4A55 A;  1J0G A;  1TYG B;  3H6N A;  2BWF A;  2JXT A;  4M0W B;  3Q8A A;  3Q3O C;  3OJ3 A;  4YSX B;  3RPF C;  2DAJ A;  2ASQ A;  1WMH A;  4GDK B;  2KX3 A;  3AEB B;  2RSU A;  3DBL I;  2WXO A;  2TSS A;  2K39 A;  3RN9 C;  3PT2 B;  4ZYN A;  3GOE A;  1YN3 A;  1QOF A;  2PLP A;  2X38 A;  2W9N A;  3P4Q B;  3ZO5 B;  4JX1 C;  4KZC A;  4PT5 A;  4FA6 A;  1R4N B;  2DWQ A;  2KFK A;  2MSE D;  3O13 A;  2WU5 B;  2H88 B;  2L0F A;  1OFF A;  4AWJ A;  3MHS D;  1XLO A;  2I2Y A;  2IPK D;  2N7E A;  4BBN C;  3B2G A;  3PLV A;  1OQQ A;  4LNF A;  1U4A A;  3N9Y C;  2DBY A;  2V0G A;  4F1S A;  2M4N A;  5KHQ A;  2KQS A;  3AE5 B;  3APC A;  4YSZ B;  3VUW A;  3SFD B;  3ZTD A;  2O6V D;  1WE6 A;  3H7S A;  5FR3 A;  3L10 B;  3KLS X;  4M8M A;  2L76 A;  1S1Q B;  4ZRJ A;  3T9L A;  3HUI A;  3O65 B;  4S17 A;  2NBW B;  4FHK A;  3BVG A;  1ISN A;  1SIF A;  2FNJ B;  1VZ7 A;  1SGH A;  3U7D A;  2RDH A;  1E7P B;  4KKI A;  4IWQ A;  3L16 A;  1EF5 A;  4LJP B;  2Y3A A;  4FAD A;  4G3X B;  1N61 A;  3IAS 1;  2JX5 A;  4N9F 4;  4HJK A;  2BKF A;  4PS8 A;  1QOB A;  4GN1 A;  2Z0D B;  4B0M A;  4HKZ E;  2QJL A;  2CJN A;  3TL5 A;  3E9S A;  3T8M A;  3VXW A;  1XO3 A;  3BK1 A;  2WQY B;  4HCN B;  1QOG A;  3DDC B;  3P2B A;  4WQO B;  2XN9 C;  3VH3 B;  1C3T A;  3C0R B;  1M94 A;  1XCQ L;  1C76 A;  2G4D B;  3AH7 A;  3U2S C;  4E71 A;  5AZF A;  3DBR B;  1WGH A;  4C00 A;  2K8H A;  4ARI A;  3Q14 C;  3Q8E A;  2MBQ A;  1NEK B;  2CHX A;  4DHZ B;  2KT7 A;  4AQ7 A;  1OQY A;  3N20 C;  2LAS A;  3R8B A;  2KTR A;  3HK0 A;  1AWD A;  2WXN A;  1CZP A;  2KTF A;  4TV3 A;  1TT5 B;  3DQV A;  3VRA B;  1V2Y A;  1L5P A;  1K52 A;  2K3U A;  4KDL B;  3X0W A;  4WAF A;  2GOW A;  3PRZ A;  4W9J A;  1NI3 A;  3DBH I;  1IP9 A;  4ARC A;  3BVM A;  4E74 A;  5H92 C;  4XWT A;  3VDZ A;  2LGD A;  2SAK A;  2BKR B;  2NPT B;  4ZRI A;  1Y8R C;  2KC1 A;  1V6E A;  2H89 B;  3BWU D;  1FNU A;  1IBX A;  3GS2 A;  3Q69 A;  3OWE B;  1ZGU B;  5G5H A;  1ZDV A;  2KJR A;  3KUC B;  4GOC A;  1RRB A;  4A3O A;  3L17 A;  1C9F A;  3HRD D;  4HDQ A;  2PPH A;  3KWV A;  3GP7 A;  1WY8 A;  4WJN A;  2DZI A;  4BKT A;  2IO3 B;  2KYW A;  2KQ4 X;  3A9J A;  3ZQ4 A;  2KFJ A;  3MC0 B;  3UIO B;  2C5L C;  2LUE A;  1TZO A;  2JSV X;  3HM3 A;  2QEJ C;  4NJC A;  1F0Z A;  2DAF A;  1V5O A;  2ZNV C;  1VR9 A;  1ET6 A;  4OVU A;  2G45 B;  2M19 A;  1I4P A;  1Q0W B;  2KN5 A;  3I63 C;  4US9 A;  4OZA A;  2KJ6 A;  3AE3 B;  1WH3 A;  4MDK E;  2KN4 A;  1MPE A;  1J7A A;  1JWB D;  1Q1O A;  2IY0 B;  4ZHP A;  1WXV A;  4EUT A;  1C4C A;  2IGD A;  2DYM A;  4P7I A;  4JQW C;  1SE9 A;  3R3M A;  2WHI A;  3AU4 A;  1YQB A;  4RM8 A;  1QZE A;  1JWA D;  1WXA A;  4AS1 A;  4W9D A;  2WXL A;  1IYF A;  2KOX A;  1T3Q A;  5IO9 A;  1RFA A;  3QQ8 B;  4IOI E;  2AQ1 B;  2MCN B;  3EFU A;  4MSM B;  4YTN B;  3A4S C;  2V1Y A;  2IYD B;  2IGG A;  2FAZ A;  4BKS D;  1CJE A;  2KWU B;  1F77 A;  1TKE A;  2C7H A;  5D6J B;  5DPS A;  3B0A A;  3AE1 B;  2R61 A;  5MPO A;  2J0J A;  1XXG A;  1N5X A;  5EE3 A;  2QHO A;  1E90 A;  1KFY B;  2LZ6 A;  2O6V A;  3BK2 A;  2K0P A;  1WX9 A;  4NNJ B;  1P3Q U;  4ICV A;  3RNA C;  3N3K B;  1IGD A;  3BYT B;  2GRI A;  4UDU C;  3AE6 B;  5JXV A;  4C4V B;  1JQ4 A;  2KLG A;  4RGM A;  2DYB A;  4RGN A;  2JU6 X;  1Z5S B;  4PS3 A;  2RDB C;  4A90 A;  4QAY A;  2K6Q A;  1UBI A;  1JW9 D;  3DOW A;  2KWD A;  3ZIM A;  1QF6 A;  1XLP A;  3DVG Y;  1NYR A;  4AJY B;  1XEE A;  3PZD A;  1G6J A;  2JRH A;  3TIX A;  4TQ1 A;  3PRP B;  1VD2 A;  1T0R C;  3A9K B;  2Z8L A;  4ANX A;  3ZKJ C;  3MFG A;  4OHJ A;  2MBH A;  3RNB C;  1TGZ B;  4EFO A;  1WFY A;  3ZNH B;  4ITK A;  3R66 C;  2UU7 A;  3AV8 A;  3L0W B;  4KSL C;  4XZ4 A;  4KIK A;  1TY0 A;  1XLN A;  3ZJT A;  1GG3 A;  2LWP A;  2W82 A;  3VTW A;  3PS6 A;  4I6P A;  1FXA A;  5L95 C;  2KNB A;  4XX5 A;  1QIL A;  1WGD A;  2MP2 A;  1BML C;  2O2V A;  2UYZ B;  4PYU A;  1DYQ A;  2WDR B;  5CHF A;  2G1E A;  2A4Z A;  3C8Y A;  3VUX A;  2L32 A;  3W2D A;  3IT4 B;  4K3C A;  2KMM A;  4L1B A;  4IW0 A;  1E8X A;  5T8I A;  1FXT B;  1JCK B;  1NVI D;  2ZPY A;  4OW0 A;  2M1M A;  2Q5W D;  4KZ0 A;  3QA8 A;  4MEL A;  4W9H A;  4M0W A;  2WLB A;  1UD7 A;  2NBU A;  3FKY A;  3ZVV A;  2RR9 A;  3SFE B;  5G2N A;  1WSP A;  1VZ6 A;  2HTH A;  1ENF A;  3PZ7 A;  1MHH E;  2JXX A;  1SE4 A;  1QLB B;  1EWC A;  1L4Z B;  1C78 A;  1SE3 A;  1L6V A;  5DCN A;  5E6P A;  1JRU A;  5DPT A;  4GLS C;  4WWN A;  2J42 A;  3ZJU A;  5IOI A;  3WCQ A;  2J4X A;  2JYE A;  2CHW A;  5C3J B;  2WGS A;  1KJT A;  3APD A;  2LVP A;  2D07 B;  1TS3 A;  1WX7 A;  4HDO A;  3TEW A;  1R4M I;  2C7N B;  1F2R I;  4MSQ B;  1DOI A;  1EU4 A;  2K8B A;  3QC8 B;  5EE1 A;  4BOS C;  3BIN A;  3GZN B;  4A9A A;  2RMM A;  1TY2 A;  3JW0 X;  1CQV A;  2MBB B;  4II2 B;  4HVB A;  4MJS B;  1SJE D;  5BMI A;  2WS3 B;  1PUT A;  4LDT B;  4BAX A;  2KWV B;  2KZR A;  2IZV B;  4BFR A;  5JHB A;  1I42 A;  3RD2 A;  3NY5 A;  3Q2A C;  1HZ6 A;  2RD0 A;  5FK9 C;  2V4I B;  3IAM 1;  4NJ7 A;  1ESF A;  3VQI A;  3EC8 A;  4HRS A;  2IY1 B;  1F2R C;  2ON8 A;  3M3J A;  2HE7 A;  4CYE A;  2WXI A;  4RM9 A;  4NAW B;  3DHH C;  4DBG A;  1RYJ A;  2MWS B;  1ZXI A;  1HTO A;  4FLH A;  4JIO U;  4BKS A;  1AYF A;  1E6E B;  2FE8 A;  1N63 A;  2C7M B;  4CQN A;  4WJQ A;  1OQR A;  1PGX A;  2QCZ A;  1YNT E;  2GB1 A;  4WJO A;  1DGJ A;  2ZW1 A;  1S3S G;  2B76 B;  1ZDX A;  2YVC A;  1Z2M A;  1WM2 A;  1WX8 A;  3NHE B;  2BYT A;  4FUL A;  2Z0E B;  4W9C A;  1WYW B;  1KTK A;  1QT9 A;  1E5W A;  4O1N A;  3QX1 A;  2KDB A;  1C77 A;  3JSV B;  1FD6 A;  5AUK A;  1KM7 A;  3IT6 B;  3W9C B;  2HJ8 A;  1YJI A;  3AEG B;  5TSS A;  1KF6 B;  1HE8 A;  1I4Q A;  3Q8C A;  3ZGZ A;  3I5J C;  2LFI A;  1R7S A;  2HJ1 A;  3A33 B;  4PS7 A;  4M00 A;  4DQO C;  1E8W A;  4L23 A;  3PO0 A;  4N6E B;  1KH0 A;  3H7P B;  2N1V A;  3KYD D;  1ZPS A;  3Q3N C;  3DVG X;  3UIN B;  1C79 A;  1SIJ A;  3RFZ B;  2MJD A;  2AYO B;  4EZJ A;  4DDG D;  4JWU C;  1EWY C;  2NPT A;  3T3O A;  2KAN A;  3M62 B;  5D94 A;  5BMH A;  2FCM A;  1K53 A;  3A1Q B;  2LGX A;  2G4S A;  1YN4 A;  3FC4 A;  2B3A A;  4RNA A;  4AJW A;  5FR6 A;  1FRR A;  3OAW A;  1TS5 A;  4NZL B;  3Q3J A;  4A6Q A;  2ZJD A;  1WJU A;  5FKA C;  3KWL A;  2WP9 B;  1V86 A;  3ZYY X;  1YMH E;  2N9X A;  4IM0 A;  2PIA A;  4LNK A;  2N4F A;  1T0S C;  2KD0 A;  2NS5 A;  3TMP B;  1J7C A;  1VRA B;  2WXQ A;  3NG0 A;  4HPP A;  1UBQ A;  1SE2 A;  2EMT A;  2QIL A;  4AOF A;  1LM8 B;  4B0E A;  3KVF B;  2KAJ A;  3ENE A;  5BYS A;  2SEB D;  3QK0 A;  1RM6 C;  5IA7 A;  3KH0 A;  2DZK A;  2D3C A;  3IG3 A;  1CMX B;  2JPH A;  3U30 A;  2VH1 A;  4ASW C;  1T6B X;  5JHA A;  4LNN A;  1EO6 A;  2KDI A;  4IWP A;  5BMG A;  3D32 A;  4MGK E;  2BW2 A;  2IO2 B;  1J8C A;  1FIQ A;  4BBN F;  4LDT D;  3V6E B;  1GUA B;  1SF0 A;  2JQR B;  3ZXR A;  1WF9 A;  2KDF B;  2BS2 B;  2WXR A;  1UEL A;  4AP4 C;  3V61 A;  2N7D A;  2L05 A;  3CMM B;  1T0Q C;  2BYF A;  3WAP A;  2LRU A;  4EE2 A;  1T5X D;  3H8H A;  1UF0 A;  1GJZ A;  4W9K A;  4BOZ B;  2BGF A;  3RNC C;  1PGA A;  2ZVN A;  4BVU C;  1NYQ A;  3TUO A;  3WA0 A;  3NZU A;  4OZC A;  4ZHO A;  2AX5 A;  3QJZ A;  2LHD A;  3BVZ A;  1L7Y A;  3N1Y C;  2I1K A;  4C4V A;  3SD5 A;  1MVK A;  2MBO A;  1I4G A;  2PKO A;  3SHQ A;  3UQB A;  2MW5 A;  2K9X A;  3P4P B;  2JZZ A;  2LI5 A;  1YQ3 B;  4FHJ A;  3AE9 B;  3MC9 A;  3ZDM C;  5LLI A;  2LGY A;  3KQ4 A;  2D10 A;  2C60 A;  1R4N I;  4HPL B;  2WYQ A;  1E0Z A;  1V1P B;  2Y5P A;  5G5G A;  4BZA A;  3A9K A;  4GB9 A;  1YX6 B;  3UF8 A;  2WWZ A;  4R3D A;  1FFU A;  2IBI B;  3ETR A;  2EKE C;  2XBB C;  2N1W A;  3IFW B;  2DYO A;  4G50 A;  1HA5 A;  3OG5 A;  2PE6 B;  4M01 A;  2J53 A;  3IBE A;  3PSE B;  3CSF A;  3AMZ A;  3TBL D;  1TKY A;  1I7H A;  5BYQ A;  2FUH B;  3WAO A;  5BYR A;  3ZUN A;  3RNG C;  5BO4 B;  1NDD A;  1TJE A;  3TJP A;  2PVO D;  3WAL A;  3VRB B;  2LGI A;  1GOZ A;  3TEZ A;  2KX0 A;  4IC7 B;  3L13 A;  3R2I A;  4ANW A;  1WI0 A;  1GB4 A;  4PK1 A;  1GNU A;  3CWI A;  2KAC A;  4JWS C;  5KHO A;  3ZLZ A;  2C9W B;  2N7J A;  3E56 A;  5JZE B;  3AED B;  5IAA C;  1JML A;  2DEN B;  2N9E B;  1GAQ B;  4EOY A;  1J7B A;  2OHF A;  1FCC C;  2INN E;  1ZE3 D;  2V4L A;  2JWZ A;  1V5T A;  2E3T A;  1WRI A;  2DHZ A;  4HXD A;  2YLM A;  1K50 A;  3TSS A;  5DPR A;  3RZF A;  2Z59 B;  2OOB B;  1KLG D;  2EMS A;  3PRE A;  1PGB A;  1XD3 B;  2YEP B;  1E8Z A;  2IND C;  3DBR I;  4WJP A;  3BY4 B;  1UUP A;  2L7R A;  2JF5 A;  2JZP A;  2INC C;  3NS8 A;  3S2A A;  2K6D B;  3BZD B;  2JT4 B;  4JE3 B;  1T0Y A;  3DHI C;  2LVO A;  1LQB A;  3U8Z A;  2DZM A;  3RCZ A;  4LJO B;  3WAM A;  2GBR A;  4GGQ A;  3T3N A;  2E6X A;  4P1B C;  3DVN V;  3PVL A;  3ZTC A;  1PDX A;  2LUM A;  2NTS A;  3VH4 B;  3V6C B;  3R7R A;  5HFY A;  1OGW A;  4LK0 M;  1WGY A;  5EE9 A;  4WWP A;  1RWS A;  4A20 A;  2HTM E;  3HM6 X;  3SEB A;  3K9P B;  1EM7 A;  5AEK B;  4YTM B;  3B2F A;  2AQ2 B;  4MJS A;  1WJ4 A;  1KRH A;  5HKH A;  3DCG A;  1E7V A;  4KVG B;  4WAA A;  3GE8 C;  2BB5 A;  1YX5 B;  1N5W A;  4TUU A;  3EFC A;  4LNI A;  3EEC A;  1QKZ A;  4YT0 B;  2IO1 B;  4NAW A;  1NEN B;  4WWM A;  4US8 A;  4OZB A;  3J9C A;  3QAR A;  3SU8 X;  4IKG A;  2J7Q B;  2JWU A;  4REZ A;  3L4P A;  2EKI A;  2KK8 A;  4WWO A;  1WZ0 A;  1AW7 A;  2LJI A;  3VTU A;  3HIZ A;  3NRZ A;  4JGH B;  2BYV E;  4DXA B;  3DHG C;  4MGZ E;  2LEK A;  3V62 A;  3NZ3 A;  3AE7 B;  3FIL B;  3NS1 A;  2FCQ A;  4XDD A;  1WR6 E;  3JSV A;  3L54 A;  4KX6 B;  1MG8 A;  4YXD B;  5EE0 A;  3Q3F A;  2IDY A;  1JWS D;  3LDZ E;  2X8X X;  2WXG A;  2L3Z A;  4IG7 B;  3VTV A;  2XK5 B;  1WXS A;  2WXJ A;  4K7W A;  3ONS A;  2M17 A;  4GDK A;  1AAR A;  1WYG A;  3P63 A;  1V97 A;  2NMQ A;  3QIJ A;  1FFV A;  4M8N A;  5CHV C;  5CHW A;  2IJ0 A;  2WXP A;  3LB8 C;  4MM3 B;  5TR5 A;  2VH2 A;  1ZXH A;  3VUY A;  3H7P A;  3RMK C;  1I4R A;  2ZCB A;  4W9F A;  1JRO A;  5C1Z A;  3DBL B;  2R2O A;  2QDF A;  4F8C B;  3ZRF A;  2JZ3 B;  3SR6 A;  1KLV A;  1DOX A;  1SEB D;  1UWM A;  4OVZ A;  4HEA 1;  1EUV B;  2QIE B;  2BTE A;  2GI9 A;  2NTT A;  3NUH B;  3A1Q A;  5LXH A;  4BKG A;  4CHK A;  2WX1 A;  1PQS A;  4N58 A;  1ET9 A;  4TMA B;  4YL8 A;  1SJH D;  4NAM A;  4A3P A;  2M0A A;  4MAC A;  4RCO A;  4FJZ A;  1MJD A;  2CKH B;  4FJY A;  1L4D B;  4URK A;  4FN2 A;  4CO7 A;  1D4B A;  3Q3M C;  3UQA A;  3AEE B;  1L6U A;  1GC7 A;  3KUD B;  3AB5 A;  2PEA A;  3IXS A;  1OEY J;  2AQ3 B;  2VRR B;  2AL3 A;  4C7Z A;  1WR1 A;  2KKC A;  1P0R A;  3U4E G;  3N30 A;  3W5V B;  5AZG A;  1UH6 A;  3P1M A;  1VJK A;  2AEH A;  1H8C A;  2YEP F;  4MH8 A;  3VAW A;  3FAH A;  3PHW B;  3P42 A;  3ZNI D;  1WZ3 A;  1LO5 D;  3IHP C;  1D5X C;  2G3Q B;  3OLM D;  2UWQ A;  4OVV A;  1FCL A;  4W9L A;  2DNF A;  1P9D U;  1ZUD 2;  3ML8 A;  3VVW B;  2N0S B;  4KIK B;  4TSS A;  4XWW A;  4GDL B;  3AEC B;  3QHT A;  3UI3 A;  2NBV B;  1ZP0 B;  2GBJ A;  3B08 A;  4MGY E;  1ROE A;  3RNF C;  4G11 A;  5IKC M;  2D11 A;  1I35 A;  2BYE A;  2HDE A;  3MC8 A;  5I4D A;  2HD5 B;  2W55 A;  3W1Y A;  4RF0 A;  4E3C A;  2VZK B;  1K51 A;  2GBN A;  3PPA A;  2BQQ A;  4JL9 A;  2Y5B B;  3Q6B A;  1D5M C;  5EDS A;  1V9J A;  2J52 A;  2K1F A;  5L83 A;  2MJ3 A;  5AUI A;  3MP9 A;  2PJH A;  2WU2 B;  4NQL B;  4DXF A;  1QOA A;  1GC6 A;  5CX3 A;  4HKQ A;  2ZVO A;  1VDV A;  2FCN A;  2RPV A;  1KLU D;  3Q8B A;  4GIV A;  1XCT L;  4M02 A;  4P16 A;  1FXI A;  3R2T A;  4H2A A;  5J18 A;  3RYT A;  3BYY B;  2PTL A;  3X23 A;  5GMV A;  2OJR A;  4DXG A;  3W1S A;  1TS4 A;  3LXF A;  4B6W A;  2LVQ A;  4IM2 A;  1N62 A;  2XEW A;  2BWE S;  1E9M A;  1V8C A;  1V1P A;  2JRI B;  3DBH B;  1BUI C;  2CU1 A;  2KMC A;  2GLS A;  4J6I A;  1YIW A;  4FXC A;  1WJ6 A;  4KKJ A;  5LXI B;  1E7U A;  3PLU A;  4ZOH C;  4KSK C;  1WRD B;  3CST A;  2DLB A;  2GBM A;  3VR9 B;  2OED A;  2ZCC A;  2ONQ A;  1YN5 A;  2JUO A;  4N59 A;  1N6Z A;  2D2Q A;  2W3S A;  2ZNV B;  2FUG 1;  1Y56 A;  1JRP A;  3RUL A;  3M63 B;  2A5U A;  5GXG B;  3GZN I;  1P7F A;  2JVC A;  2JYT A;  2QSD A;  3DPD A;  4D2K A;  2WXM A;  3QAQ A;  1K8R B;  4LTU A;  5CTR C;  1WGR A;  3V3X A;  3M95 A;  1MFW A;  4KDI C;  2V3S A;  3VFK A;  1UZX B;  1UGM A;  4RFB A;  2KVR A;  4HLE A;  4HWI B;  5JH5 C;  2FIF A;  3PTF C;  1ZW7 A;  3ZRC A;  2G9H D;  4RMA A;  3K9O B;  1TZ1 A;  4PYZ A;  2I1J A;  2K22 A;  3NVW A;  2D3B A;  3C19 A;  2MRP A;  3KUZ A;  1LXD A;  3B9J A;  5D7G A;  1PYW D;  3NVZ A;  2Y5C A;  1E10 A;  2KC2 A;  1C4A A;  3APF A;  3VHT C;  3RI7 C;  1QQR A;  3AE8 B;  3MTN B;  3EHV A;  2WXH A;  1F1H A;  2WDQ B;  2W3R A;  2NVU I;  3RT3 B;  2MX2 A;  1N60 A;  1FO4 A;  1WIA A;  4XYC A;  4L2Y A;  1BT0 A; 
#chains in the Genus database with same CATH homology
 2FID A;  1H4R A;  4GXB A;  4HCP B;  2OOB B;  3JYU A;  1UD7 A;  3NZS A;  2KMA A;  2EMS A;  3PRE A;  2CHZ A;  2NBU A;  3RUI B;  3H9D A;  1XD3 B;  4DHJ B;  3ZVV A;  1J0G A;  2RR9 A;  3H6N A;  1E8Z A;  2KWC A;  5G2N A;  1L2N A;  2BWF A;  5C23 A;  3DBR I;  2HTH A;  2BPS A;  4WJP A;  3BY4 B;  4M0W B;  2L7R A;  2JF5 A;  3OJ3 A;  3WAN A;  2JXX A;  4TQ0 A;  3NS8 A;  3S2A A;  2DAJ A;  1V49 A;  2K6D B;  4KZ0 A;  2ASQ A;  1WMH A;  2JT4 B;  2KX3 A;  4GDK B;  1T0Y A;  2RSU A;  3PGE A;  5DCN A;  3DBL I;  2LVO A;  1J19 A;  1LQB A;  3U8Z A;  2DZM A;  2K39 A;  3RCZ A;  3PT2 B;  4LJO B;  4ZYN A;  1LFD A;  3WAM A;  3GOE A;  2GBR A;  2JY6 A;  4GGQ A;  5E6P A;  1JRU A;  5DPT A;  2KDE B;  1WMH B;  2K25 A;  2KLC A;  4WWN A;  2W9N A;  3DVN V;  3ZO5 B;  3PVL A;  3ZTC A;  3ZNZ B;  4KZC A;  2CHW A;  3AXC A;  4FA6 A;  1KOT A;  2KFK A;  3VH4 B;  1KJT A;  2CS4 A;  3V6C B;  3R7R A;  3APD A;  2MSE D;  1OGW A;  2CR5 A;  2LVP A;  1WGY A;  4WWP A;  2D07 B;  2L0F A;  1WX7 A;  4HDO A;  1RLF A;  2D3G A;  4AWJ A;  1R4M I;  4A20 A;  2J0K A;  3HM6 X;  3K9P B;  2KFK B;  3MHS D;  5AEK B;  2C7N B;  4DDI D;  2N7E A;  4BBN C;  3PLV A;  5AZH A;  4MJS A;  1WJ4 A;  4MSQ B;  1U4A A;  2K8B A;  5HKH A;  3QC8 B;  3DCG A;  4F1S A;  1E7V A;  4BOS C;  2J0M A;  2M4N A;  3L08 A;  3BIN A;  4KVG B;  5KHQ A;  1E8Y A;  4WAA A;  2KQS A;  3APC A;  3VUW A;  4ANU A;  1YX5 B;  3JW0 X;  2MBB B;  4TUU A;  2GMI C;  4II2 B;  3ZNG C;  4HVB A;  4MJS B;  3ZTD A;  2O6V D;  1WE6 A;  4LDT B;  3H7S A;  3EEC A;  1OEY A;  3L10 B;  2KWV B;  2KZR A;  2IZV B;  3AU5 A;  4M8M A;  2KJH B;  4BFR A;  2L76 A;  5JHB A;  3RD2 A;  1S1Q B;  3NY5 A;  1I42 A;  2ZZP B;  2IO1 B;  4ZRJ A;  4NAW A;  2RD0 A;  3T9L A;  3CF6 E;  2LJ5 A;  1WE7 A;  3O65 B;  4NJ7 A;  3VQI A;  3EC8 A;  2IY1 B;  2NBW B;  3QAR A;  2RPQ A;  4FHK A;  3M3J A;  3SU8 X;  1ISN A;  2HE7 A;  1SIF A;  2FNJ B;  4CYE A;  1SGH A;  4ZRK A;  3U7D A;  2J7Q B;  1YD8 U;  4RM9 A;  4NAW B;  4DBG A;  3AUL A;  2KK8 A;  2MWS B;  4IWQ A;  4WWO A;  1WZ0 A;  3L16 A;  1EF5 A;  4LJP B;  3VTU A;  3HIZ A;  4FLH A;  2MLB A;  4JIO U;  4K1R B;  4BKS A;  4JGH B;  2BYV E;  2M0X A;  4DXA B;  4FAD A;  4G3X B;  4MGZ E;  2C7M B;  4WJQ A;  2BF8 B;  3V62 A;  4WJO A;  4MEM A;  4N9F 4;  4HJK A;  1S3S G;  3JVZ X;  2BKF A;  1P98 A;  4PS8 A;  4GN1 A;  2Z0D B;  1WXM A;  4FJV B;  2FCQ A;  3TL5 A;  1WR6 E;  1OTR B;  3JSV A;  3L54 A;  3T8M A;  2YVC A;  1Z2M A;  2XK5 A;  3VXW A;  4HCN B;  1WM2 A;  1MG8 A;  4GU2 A;  1WX8 A;  3Q3F A;  3NHE B;  3DDC B;  4FUL A;  2Z0E B;  3P2B A;  4W9C A;  4WQO B;  3LDZ E;  1WYW B;  1E5W A;  1TBE A;  2R2Q A;  2WX0 A;  3VH3 B;  3QX1 A;  4MM3 A;  4I6L B;  2KDB A;  3JSV B;  1C3T A;  2L3Z A;  4IG7 B;  3C0R B;  3VTV A;  1M94 A;  2XK5 B;  1KM7 A;  1WXS A;  4K7W A;  2G4D B;  3ONS A;  2HJ8 A;  2M17 A;  1AAR A;  4GDK A;  3DVN U;  3R7Q A;  4E71 A;  3QIJ A;  5AZF A;  5CHV C;  4M8N A;  5CHW A;  1HE8 A;  5TR5 A;  1WGH A;  2L0T A;  1YJ1 A;  1XT9 B;  2K8H A;  4ANV A;  3VUY A;  2KHW B;  2MBQ A;  3H7P A;  4JLC A;  2CHX A;  4DHZ B;  4NPN A;  1OQY A;  3A33 B;  2ZCB A;  4PS7 A;  4W9F A;  1XQQ A;  5C1Z A;  2LXA A;  4HPM B;  1E8W A;  2LAS A;  2KTR A;  3HK0 A;  4FBJ B;  1WM3 A;  1ZKH A;  2MA9 B;  2R2O A;  3PV1 A;  3H7P B;  4F8C B;  3ZRF A;  2N1V A;  4ICU A;  1IPG A;  2JZ3 B;  1A5R A;  3KYD D;  2KTF A;  2LXC A;  4TV3 A;  1KLV A;  3I3T B;  3V60 A;  2MBE A;  2WDT B;  3DVG X;  3DQV A;  1EUV B;  3UIN B;  2DX5 B;  4W9G A;  1V2Y A;  2IO0 B;  3A1Q A;  4KDL B;  2KTR B;  2M1M A;  5E6N A;  5LXH A;  2AYO B;  4BKG A;  4EZJ A;  3X0W A;  4DDG D;  2GOW A;  4CHK A;  3PRZ A;  2NPT A;  2WX1 A;  1PQS A;  2KAN A;  3DBH I;  4W9J A;  1IP9 A;  4DHJ D;  3M62 B;  5D94 A;  4E74 A;  4YL8 A;  2FCM A;  4G0N B;  3ECI A;  2ZEQ A;  5J2R A;  2N9P C;  3A1Q B;  1WGG A;  3VDZ A;  2LGD A;  2G4S A;  2LGX A;  3PRM B;  4A3P A;  3KYC D;  3DBS A;  2BKR B;  2NPT B;  2B3A A;  4ZRI A;  1Y8R C;  3MJW A;  2CKH B;  2KC1 A;  4FJZ A;  4AJW A;  5FR6 A;  1V6E A;  3OAW A;  4FJY A;  3Q3J A;  4LCD E;  4URK A;  5J17 A;  2ZJD A;  4FN2 A;  1WJU A;  1V86 A;  3ZDT A;  4CO7 A;  2M8S A;  2N9X A;  3UQA A;  4IWO A;  1ZGU B;  4IM0 A;  1GC7 A;  3KUD B;  3PHX B;  2KJR A;  2PEA A;  2N4F A;  3KUC B;  4GOC A;  4NJ6 A;  3W1S C;  2KD0 A;  1RRB A;  4A3O A;  2NS5 A;  3L17 A;  3TMP B;  1OEY J;  2VRR B;  4HDQ A;  2AL3 A;  2PPH A;  1WR1 A;  2KKC A;  1P0R A;  1UBQ A;  2PE9 A;  3N30 A;  2EMT A;  3AI5 A;  1WY8 A;  5AZG A;  4AOF A;  1LM8 B;  4WJN A;  1RAX A;  3KVF B;  1UH6 A;  2DZI A;  4BKT A;  2IO3 B;  2AEH A;  2GBK A;  1Q5W B;  3ENE A;  3A9J A;  1H8C A;  2KFJ A;  1D3Z A;  3VAW A;  3UIO B;  3WIM A;  2C5L C;  3PHW B;  3QK0 A;  3UIP B;  5IA7 A;  2LUE A;  3KH0 A;  3RZW C;  3ZNI D;  1WZ3 A;  2DZK A;  3HHM A;  2K8C A;  3HM3 A;  1CMX B;  3IG3 A;  2JPH A;  3UGB B;  3U30 A;  2DAF A;  1V5O A;  3IHP C;  4TKN A;  4GDL A;  4ASW C;  3A9J B;  2ZNV C;  4OVU A;  2G3Q B;  5JHA A;  2G45 B;  3OLM D;  1EO6 A;  4EZK A;  2UWQ A;  4OVV A;  1Q0W B;  2KN5 A;  5DPW A;  2KDI A;  4IWP A;  4W9L A;  2KJ6 A;  4F7Z A;  2NR2 A;  1WH3 A;  2LD9 A;  1P9D U;  3ML8 A;  3VVW B;  4MDK E;  3D32 A;  4NQK E;  4KIK B;  1TTN A;  4GDL B;  4MGK E;  2IO2 B;  3QHT A;  1J8C A;  2NBV B;  4BBN F;  4LDT D;  3V6E B;  1GUA B;  1Q1O A;  2IY0 B;  1WF9 A;  2KDF B;  2GBJ A;  3B08 A;  4MGY E;  4DK5 A;  1WXV A;  1UEL A;  4EUT A;  4G11 A;  2KO3 A;  4NY0 A;  2D11 A;  3V61 A;  4AP4 C;  2LRW A;  1I35 A;  2DYM A;  2N7D A;  3ML9 A;  4JQW C;  4P7I A;  1SE9 A;  2BYE A;  2L05 A;  3R3M A;  3CMM B;  3AU4 A;  2FCS A;  2BYF A;  1YQB A;  2HD5 B;  2L8J A;  2LRU A;  1QZE A;  4RM8 A;  3W1Y A;  3WAP A;  3QCA A;  4E3C A;  1WXA A;  2GBN A;  4W9D A;  3PPA A;  4JL9 A;  1IYF A;  2KOX A;  2Y5B B;  3LJ3 A;  1RFA A;  3QQ8 B;  1GJZ A;  4W9K A;  2AWT A;  2RGF A;  1X1M A;  4BOZ B;  5EDS A;  2BGF A;  1V9J A;  2K1F A;  5L83 A;  1V81 A;  2MCN B;  3EFU A;  4MSM B;  3A4S C;  4IM3 A;  2V1Y A;  2PJH A;  2ZVN A;  4BVU C;  4NQL B;  2IYD B;  1GC6 A;  5CX3 A;  3WA0 A;  4X57 B;  2ZVO A;  2FCN A;  3NZU A;  3N32 A;  2FAZ A;  4GMV A;  4KV2 A;  4GIV A;  4BKS D;  2KWU B;  2C7H A;  5D6J B;  5DPS A;  2KXJ A;  2KQ7 A;  3B0A A;  5J18 A;  3QJZ A;  3RYT A;  2J0J A;  5G55 A;  1L7Y A;  1NBF C;  2QHO A;  4EZL A;  2I1K A;  3X23 A;  1E90 A;  5GMV A;  3H1U A;  2OJR A;  3W1S A;  3SD5 A;  2LZ6 A;  2O6V A;  1WX9 A;  4NNJ B;  1P3Q U;  4B6W A;  2MBO A;  2LVQ A;  4IM2 A;  4ICV A;  3SHQ A;  3UQB A;  4GSW A;  2XEW A;  2MW5 A;  3N3K B;  2BWE S;  2JZZ A;  2LI5 A;  2JRI B;  4FHJ A;  3SDL C;  2O6V B;  2CU1 A;  3ZDM C;  2KLG A;  2KMC A;  1F9J A;  4J6I A;  2LGY A;  1YIW A;  2DYB A;  5LLI A;  2MQJ A;  4II3 B;  1WJ6 A;  2D10 A;  2C60 A;  3KW5 B;  5E6O A;  3TCA A;  1R4N I;  1Z5S B;  4PS3 A;  4HPL B;  5D2M B;  2WYQ A;  5LXI B;  1E7U A;  2K6Q A;  3A9K A;  1UBI A;  3DOW A;  3PLU A;  4EKU A;  4GB9 A;  4KSK C;  1YX6 B;  1WRD B;  3CST A;  3UF8 A;  3ZIM A;  3DVG Y;  2GBM A;  2WWZ A;  4B9K A;  4AJY B;  3PZD A;  2ZCC A;  1G6J A;  2JRH A;  3TIX A;  4TQ1 A;  3PRP B;  2IBI B;  1VD2 A;  2EKE C;  2JUO A;  2N1W A;  2XBB C;  2D2Q A;  2DZJ A;  3A9K B;  3IFW B;  2DYO A;  4G50 A;  3IVF A;  2ZNV B;  4ANX A;  4HK2 A;  3ZKJ C;  3RUL A;  2NCN A;  3M63 B;  2A5U A;  1NI2 A;  2PE6 B;  3GZN I;  4ZDV A;  4K7S A;  3IBE A;  3PSE B;  2JVC A;  3CSF A;  3TBL D;  2MBH A;  4DWF A;  3DPD A;  1TGZ B;  3QAQ A;  4W9E A;  4I6N B;  4EFO A;  1K8R B;  5CTR C;  1WGR A;  3M95 A;  1VCB A;  1WFY A;  2AL6 A;  4K7U A;  2FUH B;  3ZNH B;  3WAO A;  3R66 C;  4KDI C;  3ZUN A;  2V3S A;  5BO4 B;  1NDD A;  3ALB A;  3L0W B;  4KSL C;  4XZ4 A;  3VFK A;  1UZX B;  4KIK A;  1UGM A;  3TJP A;  3WAL A;  2KVR A;  4DHZ E;  4HWI B;  4HLE A;  1GG3 A;  2LWP A;  4AUQ C;  3VTW A;  2KX0 A;  4IC7 B;  2FIF A;  3L13 A;  5JH5 C;  3PTF C;  3PS6 A;  1ZW7 A;  4ANW A;  4B95 A;  1WI0 A;  4I6P A;  3ZRC A;  1GNU A;  5L95 C;  4RMA A;  3K9O B;  2KNB A;  1TZ1 A;  1WJN A;  4PYZ A;  2I1J A;  3B1L X;  1V80 A;  4XX5 A;  2ZPN A;  5KHO A;  3ZLZ A;  1WGD A;  4W9H A;  3QA8 A;  1EF1 A;  3QWZ B;  2MP2 A;  1P1A A;  2C9W B;  3OJ4 B;  2MRP A;  3KUZ A;  5JZE B;  1LXD A;  2O2V A;  2REX A;  2UYZ B;  4PYU A;  5D7G A;  4EEW A;  5CHF A;  5IAA C;  4IUM B;  2DEN B;  2A4Z A;  2N9E B;  2KC2 A;  3APF A;  3VUX A;  3VHT C;  4EOY A;  2MP2 B;  1C1Y B;  3A4R A;  3ZW3 A;  4MH0 E;  4IW0 A;  2O2V B;  1E8X A;  3EHV A;  3MTN B;  2V4L A;  4MGI E;  2JWZ A;  1V5T A;  4XC2 A;  2L00 B;  4K81 A;  1FXT B;  2DHZ A;  2NVU I;  4HXD A;  4W9I A;  2YLM A;  3RT3 B;  2MX2 A;  2ZPY A;  3NOB A;  5DPR A;  3RZF A;  1WIA A;  1BT0 A;  2Z59 B;  4MEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...