4WJQA

Crystal structure of sumo1 in complex with daxx
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
molecule keywords Small ubiquitin-related modifier 1
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 19
structure length 78
sequence length 78
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjqA00
4TKNA 5GMVA 4B9KA 2G4SA 1TBEA 1Z2MA 1TTNA 2M17A 4GOCA 4GDKB 5E6NA 2KX3A 4A20A 3P2BA 3QCAA 4GDLB 3L17A 3H7PA 1Q0WB 1SE9A 1HE8A 4ZRIA 2LXCA 4NQKE 1R4MI 2KFJA 1WIAA 2BGFA 5D2MB 2A5UA 2JVCA 3R7QA 3NHEB 2JZZA 1WE6A 2DENB 1WJUA 3DPDA 5L83A 3N30A 4WAAA 3VFKA 4BKSD 2GBMA 2ZVNA 1WR6E 3UF8A 4BVUC 1RRBA 1JRUA 2L3ZA 2QHOA 2MLBA 2NR2A 3QAQA 4G11A 1WE7A 3W1YA 3UIOB 2KLCA 2ZCBA 2ZEQA 2CHZA 1UBQA 4LDTB 3SU8X 2JXXA 5E6PA 4EZJA 2AYOB 3EC8A 4W9FA 3ZDTA 4EFOA 1Q5WB 2CKHB 4EOYA 2LVQA 3PLUA 2LZ6A 2ZNVC 3DVGX 3V60A 1K8RB 4HPMB 5CX3A 1OTRB 2WWZA 1E7UA 3H1UA 3RD2A 1V49A 4BKGA 4BKSA 2I1JA 4KSLC 3L0WB 3KVFB 4URKA 3UQBA 2NPTB 1E8ZA 4MGIE 4BBNF 3O65B 3WA0A 2KDFB 2D2QA 3WALA 2KJHB 3L13A 2DYBA 1WH3A 2C9WB 3PT2B 1VCBA 3VUYA 3EHVA 5LXIB 3KYCD 4KIKA 2L0TA 2XEWA 2KTRB 1R4NI 3H7PB 5AZHA 3A9KA 4MJSB 2L05A 4M8NA 4K7SA 2JPHA 1EUVB 1H4RA 2LRWA 4DHZB 3AU5A 2EMSA 5FR6A 2FCQA 3PRPB 3V62A 3DVGY 4EZKA 2J7QB 2NS5A 2O2VB 4DBGA 4F8CB 3T9LA 3L54A 4F1SA 2OJRA 3HHMA 3M62B 3VH4B 2L76A 3EECA 3QHTA 4IM3A 2J0KA 3A9JA 4JL9A 3N3KB 4E71A 1YJ1A 4NJ6A 2GMIC 3KH0A 4NY0A 2CR5A 2D3GA 4K1RB 1U4AA 3LDZE 4JLCA 4FADA 4WJPA 4W9JA 3TL5A 5J18A 2MP2B 2ZNVB 2FUHB 4DK5A 2XK5B 2MBBB 1UGMA 4W9HA 2W9NA 5JHBA 1Q1OA 3EFUA 2JT4B 1EO6A 4ZRKA 4A3PA 4A3OA 4AUQC 2O6VA 4TUUA 5J2RA 4WJNA 2KZRA 2PE9A 4HDOA 3B08A 2K8HA 3AI5A 4KSKC 2MSED 3JW0X 1WX9A 2XBBC 3NY5A 4FLHA 3ZNZB 4BFRA 5DCNA 4JIOU 4G0NB 3ZIMA 2DZIA 3JVZX 2KD0A 1E5WA 1UH6A 2JZ3B 4MEMA 3ZNHB 1NI2A 2WYQA 2EMTA 4FJZA 1TGZB 3AULA 1E7VA 2G45B 4CYEA 4KIKB 2MBHA 1WX7A 2J0MA 1GC7A 1OGWA 2FCNA 2RR9A 3ZRCA 5KHQA 3A9KB 2BYFA 2FNJB 2C7NB 2GBNA 1ZKHA 2RD0A 2Y5BB 3QJZA 4FN2A 3QARA 3VHTC 2KN5A 3PHWB 4K81A 4TQ0A 5JZEB 1S3SG 4GSWA 4TQ1A 2LGXA 2LRUA 2YLMA 3AU4A 4RMAA 4II2B 4W9DA 5JH5C 2M4NA 3JSVB 4FJYA 1P98A 2UWQA 2V4LA 3DVNU 4IWOA 3ZTCA 2C5LC 2BWES 4PS7A 3RCZA 1LFDA 5AZFA 1WGGA 3A9JB 3PREA 2L0FA 2BKRB 2KXJA 2CHXA 2KFKA 5J17A 1V2YA 1ZW7A 4KDIC 4EKUA 2BF8B 4W9CA 2DZKA 4HXDA 4K7UA 3RULA 4P7IA 3TCAA 4BOZB 1L7YA 2LUEA 2CS4A 1Z5SB 2GOWA 2NBVB 2NCNA 3X0WA 1X1MA 3D32A 3N32A 4TV3A 2ZJDA 1IP9A 3ALBA 3PS6A 4OVVA 1E90A 4W9IA 2JY6A 3PRZA 4NJ7A 5DPRA 3M95A 3V61A 2C60A 4BKTA 5DPWA 4FULA 4WJQA 5D7GA 3ZDMC 4F7ZA 1YD8U 1G6JA 2R2QA 3Q3FA 1V9JA 1J8CA 1KLVA 1WX8A 4AP4C 3RYTA 2MW5A 3UQAA 2O6VB 2VRRB 3KYDD 4IM2A 2NBUA 3DBSA 2LASA 3H6NA 3IFWB 4WWOA 4FBJB 2N7EA 3W1SA 1F9JA 3A4RA 1OEYJ 2IYDB 2G3QB 1ISNA 2JF5A 3HM6X 1T0YA 2GBKA 2GBRA 1M94A 3DBHI 4DDGD 3PV1A 2DAFA 2L8JA 3HIZA 3DBLI 3B1LX 4GU2A 3PPAA 1C1YB 4I6PA 5G2NA 4DXAB 5IAAC 3TMPB 3PSEB 3K9PB 4FJVB 3VUWA 3CSTA 4IC7B 1E8WA 3B0AA 2LGDA 4XX5A 4DHJD 2B3AA 2MQJA 3VTVA 2A4ZA 5C1ZA 1WXVA 2KVRA 2N9PC 2AL3A 2K6QA 2KWCA 2CHWA 2REXA 2DZJA 3GOEA 3H9DA 3RT3B 1GNUA 1SIFA 3OLMD 3MJWA 1WMHA 2IO2B 4KV2A 5IA7A 4HK2A 2N9XA 1WYWB 1WY8A 1WI0A 2MRPA 1CMXB 3SHQA 4EZLA 1L2NA 1LM8B 5DPTA 2C7HA 4WWPA 3VTWA 1XQQA 3VH3B 1NDDA 4DWFA 2LJ5A 1V6EA 4EEWA 1OEYA 3K9OB 2MX2A 3ZUNA 3R3MA 4OVUA 3C0RB 2K6DB 2BKFA 4ZRJA 4BBNC 2PE6B 4W9EA 3ONSA 2DHZA 2IY0B 1XT9B 3IBEA 4HVBA 3UINB 2WX0A 4IW0A 1A5RA 3WAMA 3GZNI 3T8MA 4MGZE 2MWSB 1GUAB 2KKCA 1YX5B 4IG7B 1WM3A 4LDTD 1H8CA 2ZPYA 5DPSA 1KOTA 2NBWB 4KZCA 4NPNA 5AZGA 2D11A 5C23A 2NVUI 1WGYA 3DCGA 4ZDVA 4GB9A 1QZEA 2DX5B 1WXMA 3S2AA 2YVCA 2FIFA 1KJTA 3OAWA 2IBIB 4AWJA 1WJNA 2AWTA 2N1VA 1YQBA 1MG8A 2K39A 2L00B 3MHSD 3QA8A 4EUTA 3RUIB 2AL6A 4AJYB 2LGYA 2HTHA 1WFYA 2KMAA 3A33B 2ZPNA 4PYZA 5TR5A 5AEKB 2D07B 2BPSA 1I42A 4DHZE 4HDQA 2KMCA 3ZNGC 2KX0A 3WIMA 2M1MA 1EF1A 3ZLZA 2ZZPB 4RM8A 1RLFA 4ANXA 1I35A 1WM2A 3ZRFA 3PTFC 2V3SA 1YIWA 2I1KA 3NS8A 3RZFA 3IVFA 3V6EB 3SDLC 1PQSA 4KDLB 3KUZA 4W9KA 1Y8RC 1WGHA 1LXDA 4LJPB 3V6CB 1V80A 3H7SA 2KNBA 3HM3A 5KHOA 1E8YA 3ZKJC 1S1QB 2KC1A 2LVPA 2N4FA 4GMVA 1WJ6A 2KC2A 2FCMA 4K7WA 5BO4B 4YL8A 4AOFA 3PRMB 2IO3B 3APCA 5CHFA 2PPHA 2OOBB 3TBLD 4PS8A 2JUOA 2KTRA 3UGBB 3DVNV 3OJ3A 5E6OA 4MJSA 4GGQA 2KANA 3VDZA 3ZO5B 3M3JA 4LCDE 3LJ3A 2AEHA 1AARA 2KHWB 3PLVA 4MELA 2ZCCA 3HK0A 3TJPA 4XC2A 2HJ8A 2KOXA 3L16A 3Q3JA 4W9GA 4B95A 1UELA 1WR1A 4CHKA 5D6JB 4II3B 4PS3A 3UIPB 4NAWA 2RPQA 2K8BA 1UBIA 2O2VA 2Z0EB 3ML8A 3QQ8B 3W1SC 4HWIB 4M8MA 2MA9B 2KDEB 4FA6A 2KJRA 2M0XA 4JQWC 3JYUA 3OJ4B 4JGHB 3A1QA 1P9DU 2LVOA 2N7DA 4E3CA 2HD5B 1J0GA 4IM0A 2KLGA 3SD5A 4ANWA 2DZMA 4XZ4A 2FIDA 1WZ0A 3APDA 3VAWA 3VTUA 3NZUA 5HKHA 3WAOA 1SGHA 3CMMB 3L08A 4MSMB 2WX1A 3WANA 3L10B 4ANUA 2N1WA 2K8CA 4AJWA 3DOWA 1FXTB 2LI5A 4KVGB 2MP2A 4ICUA 1WXAA 2XK5A 1UD7A 2IY1B 2KWUB 2DYMA 1WF9A 2ASQA 2Z59B 1V5OA 2KQ7A 4NQLB 1RFAA 3M63B 4LJOB 4GN1A 4HLEA 3AXCA 2HE7A 4MDKE 1J19A 3U30A 5CTRC 2KFKB 3ZVVA 2GBJA 2BYEA 3ML9A 1GG3A 2UYZB 5JHAA 4WWNA 3R7RA 4B6WA 2DAJA 4FHJA 3NZSA 1BT0A 1WGRA 4I6LB 5LLIA 3QC8B 3ZNID 2DYOA 1VD2A 3MTNB 4ZYNA 3U7DA 4IWPA 1OQYA 2IZVB 1P3QU 2K1FA 1TZ1A 3QWZB 4HPLB 2LXAA 4I6NB 4MGYE 4IUMB 2KJ6A 1WZ3A 3ECIA 2MBEA 2FCSA 3DDCB 3VVWB 2FAZA 4GDKA 2L7RA 2MBQA 4GDLA 3DQVA 2JRHA 3R66C 5CHVC 2MCNB 3TIXA 2LD9A 4NAWB 1E8XA 3KUCB 3WAPA 3JSVA 4HCNB 3CSFA 3PGEA 2CU1A 5D94A 1WJ4A 3RZWC 1RAXA 3X23A 1ZGUB 3A1QB 3KW5B 4GXBA 4ANVA 1V86A 4GIVA 4KZ0A 2M8SA 5L95C 4MH0E 3VXWA 3CF6E 2O6VD 4FHKA 2LWPA 4W9LA 2KK8A 4E74A 3PHXB 3DBRI 1LQBA 2IO0B 2IO1B 3QX1A 5CHWA 4WQOB 3NOBA 4M0WB 4MSQB 2ZVOA 3QIJA 3U8ZA 1XD3B 4PYUA 3ZTDA 2N9EB 2G4DB 2BYVE 1P1AA 4N9F4 1IPGA 2KDBA 1GC6A 2Z0DB 4ASWC 4NNJB 1C3TA 2C7MB 1V5TA 2WDTB 2JWZA 4HCPB 1UZXB 1NBFC 3PVLA 1IYFA 1EF5A 2K25A 2J0JA 2KDIA 4RM9A 4G50A 1V81A 4MGKE 1WGDA 3I3TB 1WMHB 3ENEA 2V1YA 3ZW3A 3IHPC 1WXSA 4ICVA 4MM3A 2MBOA 2R2OA 2KWVB 3VUXA 5LXHA 2PJHA 2KTFA 4IWQA 3VQIA 4DDID 2EKEC 4WJOA 1GJZA 4J6IA 2JRIB 2BWFA 2NPTA 3QK0A 1YX6B 3KUDB 3PZDA 4X57B 3BY4B 4DHJB 5G55A 4CO7A 4HJKA 5EDSA 2KO3A 4G3XB 1WRDB 2D10A 3BINA 1P0RA 2PEAA 1D3ZA 3A4SC 2RGFA 4BOSC 1KM7A 2KQSA 3IG3A 3APFA 2RSUA
chains in the Genus database with same CATH superfamily
3NS1A 1FMAD 2M17A 2KX3A 3P63A 3QCAA 1AN8A 4N59A 2KMMA 1SE9A 4ZRIA 2LXCA 1EWCA 5JXVA 1I4XA 2BGFA 5D2MB 3NHEB 3W5UB 1KTKA 2QSDA 3FKYA 4RH6A 5IKCM 1F2RC 1VR9A 3H8HA 2NR2A 3W1YA 3DWMA 2JXXA 2AYOB 4W9FA 2CKHB 2LVQA 1YJIA 2WXOA 3V60A 1K8RB 2WXQA 4N58A 3KQ4A 4BAXA 2WWZA 4BKGA 1R7SA 2I1JA 2AQ3B 4KSLC 1V1OA 3L0WB 3UQBA 4BBNF 3WA0A 1UUPA 1FCLA 1TS3A 1I4QA 5HG2A 3I63C 1T5XD 4JWUC 3VUYA 2L0TA 4ITKA 2XEWA 2KTRB 1R4NI 2YEPF 3SR6A 1MFWA 2LGSA 3NVVA 1SSNA 3AU5A 4S0RA 4TMAB 3RMKC 3V62A 4LNNA 1WSPA 4EZKA 2J7QB 3EECA 3QHTA 1E9MA 5AUKA 3A9JA 3MFGA 1GB1A 4YWGG 2IGDA 2CR5A 4K1RB 2N9KA 4KKIA 1SJHD 1TY0A 2J52A 3R2IA 5FR3A 2MP2B 2ZNVB 2FUHB 2PIAA 2WXJA 3Q14C 1UGMA 5JHBA 1EO6A 2E3TA 5J2RA 4HDOA 4NJCA 3AI5A 2MSED 2PW9A 1FNUA 4ZHPA 4FLHA 4JIOU 4G0NB 5FKAC 2KD0A 3ZNHB 1UH6A 2JZ3B 2WYQA 4FJZA 1ZOYB 3MC9A 2G45B 1LO5D 2JX5A 2RR9A 4XYCA 3ZRCA 2FNJB 2C7NB 2Y5BB 4FN2A 4US8A 3ETRA 2KN5A 1V1PB 4TQ0A 1S3SG 2LRUA 3Q69A 2BWES 2BS2B 3A9JB 3AE7B 1SE4A 4B0MA 4BOZB 1L7YA 1Z5SB 2FUG1 2NCNA 2PTLA 3D32A 1AWDA 1IP9A 2ONQA 1ZP0B 3PRZA 5C2TB 3V61A 5IP4D 1YMHE 4BKTA 1VDVA 1JRPA 5D7GA 3ZDMC 1YD8U 3Q3FA 1V9JA 1J8CA 1WX8A 4AP4C 3RYTA 2VRRB 4IM2A 3DBSA 1N63A 3IFWB 3H6NA 1STEA 1J7CA 1I4RA 3WCQA 1F1HA 1OEYJ 4DDGD 3PV1A 2V9HA 3DBLI 4DXAB 4ARCA 3PPAA 4I6PA 5G2NA 2WDRB 5IAAC 3N20C 3PSEB 3K9PB 3VUWA 3B0AA 3GB1A 4XX5A 2MQJA 3AE6B 1WXVA 2KVRA 4LNKA 3RT3B 3GOEA 4P1CC 4NAMA 1SIFA 4KV2A 2N9XA 1WYWB 2MRPA 1XQQA 3VH3B 1NDDA 1ZXIA 1SE2A 3K9OB 1FCCC 1SE3A 3R3MA 4OVUA 4ZRJA 2BKFA 3ONSA 1N5WA 3UINB 2IPKD 4D2KA 4IW0A 4IDIA 2DBYA 3GZNI 2WLBA 1MVKA 3Q8FA 4LNIA 1JALA 2D3CA 1JROA 3NRZA 2VZKB 2ZW1A 2BYTA 4M00A 1EU4A 1KJTA 2IBIB 1WJNA 2AWTA 3QA8A 3VRAB 3FILB 4AJYB 2HTHA 3ZNGC 4KGTA 3WIMA 2M1MA 4RM8A 3O13A 1XO3A 3B9JA 3PTFC 4HROA 2V3SA 1YIWA 3RZFA 3IVFA 1PQSA 1Y8RC 3V6CB 3H7SA 3HM3A 2KC1A 2LVPA 2N4FA 4K7WA 4HJGE 4C7ZA 3TBLD 2L32A 2W82A 3OJ3A 4MJSA 2ZCCA 4XC2A 2N7JA 4B95A 3Q3JA 1FEHA 4PS3A 1V8CA 1UBIA 2O2VA 3ML8A 3BK2A 3W1SC 1C76A 2KDEB 4FA6A 2KJRA 4R3DA 3JYUA 2BS4B 1VJKA 3IXSA 1SXTA 1BXTA 1QT9A 1WZ0A 3APDA 3VAWA 2V3NA 1UWXA 3WAOA 1R4MB 4ANUA 3L10B 4HPPA 5T8IA 2K8CA 4AJWA 3DOWA 3ZJUA 4KVGB 4ICUA 2N0SB 2IY1B 5HI1A 2KDMA 1TJEA 3OG5A 2ASQA 5D3IB 3AE2B 3ZJVA 4GN1A 3FAHA 2D3BA 2RPVA 3AE9B 3ZJTA 1K51A 5JHAA 3R7RA 3NZSA 1BT0A 1TT5B 3ZNID 4ZYNA 2IZVB 4A9AA 4HPLB 2LXAA 4IUMB 2ICIA 2KJ6A 3ECIA 2JSVX 2MBEA 2FCSA 3DDCB 4MT5A 4GDKA 2WQYB 3WAPA 3W9CB 1N60A 3CSFA 3PGEA 5D94A 1ZE3D 1RAXA 3X23A 3VXWA 2O6VD 3C19A 5CHWA 4WQOB 4JPSA 4YSZB 2ZVOA 4A90A 2V4IB 2N9EB 2H89B 1NBFC 1IYFA 1FFUA 4RM9A 2KDIA 1K53A 2V1YA 1WXSA 4ICVA 2R2OA 2KWVB 4NZLB 3VUXA 2KTFA 2EKEC 1FIQA 4J6IA 2NPTA 3QK0A 1YX6B 3BY4B 2D10A 1QILA 3BINA 2PEAA 1TZOA 1QOFA 2RGFA 4BOSC 1KM7A 2J4XA 4YSXB 3APFA 1OFFA 2D3AA 4GOCA 1TTNA 4RGNA 4GDKB 5E6NA 1UF0A 1I4HA 2KQ4X 4DXGA 2PKOA 1ZXHA 1F77A 1HE8A 3I9V1 4C7YA 2QIEB 2WDQB 3RNGC 1N6ZA 4QAYA 1RWSA 3I5JC 3TEWA 1WJUA 5L83A 4O1NA 3N30A 4WAAA 1L4ZB 2N9LA 1WR6E 3UF8A 1PGBA 1RRBA 1JRUA 2L3ZA 1SF0A 3URYA 2MLBA 1MI0A 2QILA 2ZEQA 2CHZA 1UBQA 5E6PA 2QC8A 3EC8A 3P42A 3ABVB 4OZCA 2KT7A 5BYSA 1V49A 1UNSA 1QOGA 4ZRQA 2NPTB 2KDFB 2D2QA 4P6VF 3WALA 2C9WB 1HQRD 3B2FA 3PT2B 2INDC 1XLOA 1YOVB 1L5PA 1ZUD2 3KYCD 4EE2A 4XWWA 1NI3A 3A9KA 2L05A 1K50A 4K7SA 2JPHA 1EUVB 2LRWA 4DHZB 2EMSA 2FCQA 1T0SC 1JWBD 3OWEB 3EUB2 4DBGA 3T9LA 2WXMA 4AS1A 2AQ2B 2L76A 3NVZA 4JL9A 2H88B 4NJ6A 1FO4A 4KKJA 3AEAB 1HEZE 2LHDA 3IT4B 1ESFA 3LDZE 1HTOA 3Q8EA 2V0GA 2QMTA 2RDHA 4W9JA 4XWTA 1J7BA 4LNFA 1ZDXA 4RGMA 4DK5A 1B1ZA 3NJTA 5LNK1 2WXIA 2J53A 2L83A 2R61A 2CU3A 4WJNA 3B08A 2LEKA 3JW0X 2XBBC 3NY5A 5DCNA 4L2YA 1EU3A 1PYWD 3JVZX 4MEMA 4M02A 1NI2A 1TGZB 2MBHA 3A9KB 3QJZA 2XNAC 4GSWA 2LGXA 5JH5C 4RMAA 4II2B 4YXDB 4FJYA 1P98A 3ZTCA 2C5LC 4PS7A 3RCZA 3LB8C 2CHXA 2WXLA 1KOTA 2Y5PA 2DZKA 3EFCA 3BYTB 3RULA 2LUEA 2NBVB 3N32A 4TV3A 4C00A 3ALBA 4OVVA 2JY6A 1FRRA 4FULA 4WJQA 1V97A 4F7ZA 1F52A 3KYDD 4MM3B 4WWOA 3W1SA 2MEKA 1JWUD 4HKZE 2IYDB 2JF5A 3AEBB 1GB4A 2GBRA 1FD6A 3DBHI 1RYJA 4YT0B 3HIZA 4GU2A 3B1LX 1TS4A 1KFYB 2RMMA 1E8WA 3AB5A 2AL3A 2REXA 2DZJA 3MJWA 3KLSX 1JCKB 1CMXB 1TYGB 4ZOHC 5DPTA 2C7HA 4JWSC 3VTWA 2LJ5A 1V6EA 3IAS1 1SBBB 3ZUNA 5BYQA 3RNFC 4BBNC 4W9EA 2IY0B 1FM0D 1Q10A 3P4QB 1FNWA 1YJJA 4YSYB 5H92C 3T8MA 4MGZE 3C8YA 1WM3A 4WWMA 4LDTD 5DPSA 1PGAA 5AZGA 3N9YC 3DCGA 4A8XC 1WYGA 4GB9A 2INNE 1QZEA 2DX5B 4A6QA 4AWJA 3OAWA 2N1VA 1MG8A 2K39A 1WFYA 5AEKB 1I42A 2ZPNA 3Q3OC 2D07B 3BZDB 2X38A 4HDQA 3ZLZA 1EF1A 2ZZPB 1RLFA 4ANXA 1WM2A 2JU6X 3RNCC 2WGSA 1KLUD 3NS8A 2JYEA 5G5HA 3KUZA 4W9KA 4RGTA 4LJPB 1V80A 1S1QB 4AOFA 3PRMB 4KGRA 5E6JA 4WH4A 5CHFA 3BIID 2OOBB 4M01A 5E6OA 3VDZA 1QF6A 4LCDE 1AARA 1P7EA 2FBWB 2KOXA 1UELA 1WR1A 1CK1A 4CHKA 4II3B 2Z0EB 4C56C 2INPE 1JMLA 2M0XA 4JQWC 1QOBA 3ZQ4A 4IM0A 3SD5A 3RNAC 1SGHA 4A55A 2BTEA 2WX1A 1FXTB 3AM9A 1WXAA 2XK5A 2KWUB 3BVZA 2KQ7A 3W5VB 1DOYA 1UWMA 2HE7A 1FNVA 2KYWA 4RGOS 3TSSA 2GBJA 3P4PB 2BYEA 2UYZB 2J42A 4WWNA 2WDVB 1ZPSA 4I6LB 2WXGA 3P4SB 3U7DA 4IWPA 2CJNA 3QWZB 4I6NB 3Q6BA 2KWDA 4US9A 3TEYA 2FAZA 2L7RA 2DNFA 4GDLA 3DQVA 2MCNB 2IDYA 3JSVA 4FXCA 2OEDA 2CU1A 1WJ4A 4JX1C 4GXBA 1SB3C 4ANVA 4GIVA 4KZ0A 4RF1A 4MH0E 4IKGA 4JE3B 4W9LA 4E74A 3PHXB 2IO1B 1ACCA 3QX1A 4HKQA 2WNMA 1NVID 4PYUA 4REZA 2G4DB 2BYVE 1P1AA 4ASWC 1IPGA 4BZAA 1C3TA 1XCQL 3AE4B 4NNJB 5EE0A 1QKZA 3LYYA 1UZXB 3PVLA 5HFYA 2K25A 2J0JA 2JYTA 5MPOA 3IHPC 2PVGC 2MBOA 1FXIA 3ZYYX 1GJZA 3PZDA 2KO3A 4G3XB 1J7AA 1DYQA 2PMVA 2BBCA 3IG3A 4WAFA 5BMIA 1TBEA 2NTTA 1TKYA 3P2BA 5TSSA 4GDLB 3L17A 1ZDVA 1NENB 2WXKA 4C4VA 1R4MI 2KFJA 1WIAA 2A5UA 1CJEA 3R7QA 5HHDG 2JZZA 1P7FA 3N1YC 3NZ3A 1VRAB 3DPDA 1T0QC 4BKSD 2ZVNA 4TSSA 5BMGA 4BVUC 2QHOA 3QAQA 3UIOB 2KLCA 1RFKA 4WIPA 3SU8X 4EZJA 3ZDTA 4EFOA 1Q5WB 3PLUA 4RCOA 2LZ6A 2ZNVC 3VRBB 3H1UA 1PDXA 3RD2A 4BKSA 1L4DB 3FC4A 3KVFB 4URKA 2M19A 1E8ZA 4MGIE 1CQVA 3O65B 4WQMA 2KJHB 2DYBA 1DGJA 2LMCA 3AE8B 1TS5A 1VCBA 4XGAB 2K9XA 5LXIB 4MJSB 1I7HA 2V3PA 4HRSA 3Q3NC 1KLGD 2NTSA 5FR6A 2X8XX 3PRPB 3AH7A 3NG0A 2O2VB 1F0ZA 3M62B 3RN9C 4IM3A 2J0KA 3KH0A 4ARIA 1U4AA 2W54A 4FADA 1Y56A 4WJPA 4ZRPA 1YN4A 3TL5A 1D4BA 2MBBB 2VH1A 1T0RC 1WXQA 2JT4B 4ZRKA 4A3OA 1GOZA 2O6VA 1K52A 1YN5A 2PE9A 1ET9A 2ZW0A 2K8HA 3SEBA 4KSKC 4XDDA 4LTUA 3ZNZB 3ZIMA 1KH0A 5G5GA 2DZIA 2EMTA 1M4VA 1N62A 3AULA 4CYEA 3VR8B 1WX7A 1GC7A 1OGWA 5C3JB 5KHQA 3PO0A 2BYFA 2GBNA 2MJDA 3QARA 4K81A 5JZEB 2YLMA 3AU4A 1EWYC 1PFDA 4W9DA 2M4NA 2I38A 2SEBD 2V4LA 4IWOA 1E10A 1LFDA 1WGGA 3PREA 4MH8A 2L0FA 4XE0A 2KFKA 4KDIC 1OQRA 1ZW7A 4EKUA 2BF8B 3BK1A 4P7IA 1NYRA 3X0WA 2GOWA 1VZ7A 2RDBC 1D5XC 4W9IA 3N1XC 1XEEA 3M95A 3V3XA 4ACFA 1BMLC 3T3OA 2W3SA 2YEPB 5IOIA 1KRHA 1UGJA 1E7PB 2O6VB 2G1EA 2NMQA 2NBUA 1YQ3B 1DOXA 3A4RA 1RM6C 3I57A 2G3QB 1ISNA 3HM6X 1JWAD 1T0YA 2GBKA 1EM7A 5GXGB 2DAFA 2L8JA 1C1YB 4M0WA 1PUTA 2EELA 4IC7B 1L0YB 3CSTA 3Q2AC 4DHJD 1B9RA 3VTVA 2A4ZA 2WXFA 2KWCA 1D6EC 3Q8AA 3OLMD 1C4CA 1WMHA 5IA7A 1C4AA 1WY8A 1WI0A 4EZLA 1LM8B 3AEDB 1D5ZC 2DWQA 4EEWA 1OEYA 2VH2A 3RNEC 2MX2A 1C4PA 3C0RB 2K6DB 3EGRA 3NVWA 2EKIA 3V05A 1XT9B 3IBEA 3W2DA 4HVBA 3AMZA 1L0XB 3UI3A 4WURA 3WAMA 2KKCA 1YX5B 4IG7B 3NUHB 3EA6A 2ZPYA 4ZYSA 4NPNA 2WP9B 3P4RB 2NVUI 1WGYA 3RFZB 4ZDVA 1TIFA 2W3RA 1FRDA 1WXMA 3J9CA 4HEA1 1C78A 1C9FA 2FIFA 2L00B 2BT6A 3RUIB 2AL6A 2LGYA 3ZXRA 4DHZE 2KMCA 3LXFA 2KX0A 4K3CA 2FE8A 1I35A 1MPEA 3ZRFA 3DBRB 2HJ1A 5BMHA 2I1KA 3V6EB 2QDFA 1TKEA 4B0EA 2LFIA 1E8YA 5EE1A 4GMVA 5H8YE 3E56A 5BO4B 4YL8A 1PGXA 4YTPB 3APCA 2KTRA 3DVNV 4GGQA 2KANA 3BVMA 3M3JA 3P1MA 3E9SA 3HK0A 3TJPA 4W9GA 4LNOA 1JQ4A 3UIPB 4NAWA 2RPQA 3HRDD 3QQ8B 5I4DA 2JWUA 4JGHB 3A1QA 4OVZA 2N7DA 2HD5B 3BVGA 4ANWA 4LLGM 1MHXA 2DZMA 2FIDA 4XZ4A 2PLPA 3L08A 3CMMB 4CQNA 3WANA 2N1WA 2MP2A 1DOIA 1HTQA 1XLNA 2HTME 1UD7A 2DYMA 2BQQA 1V5OA 4LK0M 3DHHC 1SJED 3M63B 3KWVA 2HDEA 3AXCA 4MDKE 3U30A 1XLQA 1GG3A 2DAJA 3AV8A 4FHJA 1GPXA 1VD2A 1P3QU 3BWUD 3SFEB 1ENFA 5IN7A 1V1PA 5D3DA 3VVWB 3DBHB 3TIXA 2LD9A 2QCZA 1JWMD 4NAWB 4HCNB 5BYRA 3GS2A 2DLBA 1ZGUB 1XF5L 3A1QB 4XDCA 1V86A 5L95C 4ZHOA 3SFDB 4FHKA 2KK8A 1R4NB 2IO0B 2LGIA 3DHGC 4MSQB 3DWGC 1XD3B 1YQ4B 4KX6B 2GB1A 2KDBA 2IGGA 1V5TA 1OQQA 4G50A 4MGKE 3I3TB 4KGSA 1HZ6A 4IWQA 4WJOA 2JRIB 1T6BX 2JZPA 4YTMB 1P0RA 4USAA 3BYYB 3A4SC 1BUIC 2L52A 1IGCA 2KQSA 4TKNA 5GMVA 4B9KA 2G4SA 1Z2MA 2BS3B 4A20A 3MHZA 1MG4A 2AQ1B 2B76B 3H7PA 1Q0WB 1XLPA 2BB5A 4NQKE 3U2SC 1TKGA 2JVCA 2IGHA 1E0ZA 1WE6A 2GLSA 1ET6A 2DENB 3VFKA 2GBMA 1TS2A 4G11A 1WE7A 2ZCBA 4LDTB 4EOYA 5EE3A 2VZKD 3DVGX 4HPMB 5CX3A 1OTRB 1E7UA 1HZ5A 1E6EB 1QOAA 2WXNA 1N5XA 3B2GA 1L6VA 3MC0B 3L13A 2LUMA 3ZXVA 1WH3A 3CWIA 1T3QA 3EHVA 3FILA 2KN4A 4KIKA 3U52E 3DHIC 2I2YA 1AYFA 2E6XA 1XXGA 3H7PB 5AZHA 3U7ZA 4M8NA 1H4RA 2JQRB 3GP7A 3DVGY 1QQRA 3GE3C 3HVZA 3DBLB 2NS5A 4F8CB 1HXYD 4P16A 3L54A 4F1SA 2OJRA 3HHMA 3VH4B 3N3KB 1MHHE 4E71A 1YJ1A 2GMIC 4NY0A 2D3GA 2WHIA 4JLCA 3AE3B 2XN9C 3TEXA 5J18A 2IJ0A 3HVDA 2XK5B 4DXFA 1MJDA 3L4PA 4RNAA 4W9HA 2MH7A 2W9NA 1Q1OA 3EFUA 4A3PA 1CZPA 4AUQC 2AX5A 4TUUA 2KZRA 1LGRA 2BW2A 1C79A 1WX9A 4BFRA 2Y3AA 1E5WA 3RNBC 3GZNB 2G9HD 1E7VA 4KIKB 2L1AA 1WGKA 2J0MA 2FCNA 2Y5CA 3AE5B 3TUOA 2RD0A 4OZAA 1ZKHA 2MJ3A 3VHTC 3PHWB 1ROEA 1YNTE 4TQ1A 3JSVB 2K22A 2UWQA 3DVNU 4P1BC 5AZFA 1L0VB 2WXHA 2BKRB 2KXJA 5J17A 1V2YA 1A70A 4W9CA 4HXDA 4K7UA 3TCAA 1NYQA 2CS4A 1X1MA 2ZJDA 3PS6A 1E90A 4OZBA 4DQOC 4NJ7A 5DPRA 2M0AA 3Q8CA 2C60A 4YTNB 5DPWA 1IUEA 3U4EG 1G6JA 2R2QA 1KLVA 1WRIA 2MW5A 3UQAA 2LASA 1IGDA 4FBJB 2N7EA 1F9JA 4C80A 3T3NA 3N1ZC 4N6EB 2KAJA 1YN3A 1M94A 5IO9A 3HUIA 2BVCA 3MC8A 1VZ6A 3TMPB 2ACZB 4FJVB 2LGDA 2B3AA 2K3UA 5C1ZA 4RF0A 1F2RI 2N9PC 3AECB 4Q2JA 2K6QA 1SEBD 2CHWA 3H9DA 4MACA 1GNUA 3MJ5A 4OHJA 1FPYA 2IO2B 1L6UA 3ZGZA 4AQ7A 4C4VB 4HK2A 3SHQA 1L2NA 4PT5A 4WWPA 3Q8BA 4DWFA 2MHJA 2PE6B 2DHZA 4L1BA 1I4PA 1I4GA 4J3OD 4RFBA 2WU5B 2MJEA 2WX0A 1A5RA 1C77A 2Z8LA 5EE9A 2MWSB 1GUAB 2OHFA 2INCC 3AEEB 3KWLA 3MP9A 1H8CA 2NBWB 4KZCA 2D11A 5C23A 1XCTL 4H2AA 2RDGA 3PZ8A 1N61A 3GE8C 1IBXA 3S2AA 2YVCA 3NVYA 1YQBA 3MHSD 4EUTA 2LJIA 2KMAA 5TR5A 3A33B 4PYZA 5FK9C 2BPSA 4K3BA 2ON8A 2D5GA 2GI9A 3SDLC 4KDLB 3AN1A 1WGHA 1LXDA 4S17A 2KNBA 3R2TA 5KHOA 3ZKJC 2QJLA 1WJ6A 2KC2A 2FCMA 2M56B 2WS3B 2IO3B 2WXPA 1AW7A 2PPHA 4PS8A 2JUOA 2KACA 3UGBB 1WWTA 2QEJC 3ZO5B 3LJ3A 2AEHA 2KHWB 3PLVA 4MELA 2HJ8A 3L16A 3AEFB 2Q5WD 3Q3MC 5D6JB 2K8BA 4HWIB 4M8MA 2MA9B 3OJ4B 1P9DU 2WU2B 2LVOA 4E3CA 4PK1A 1IBXB 3PZ7A 1J0GA 2KLGA 3VTUA 1KF6B 3NZUA 5HKHA 4MSMB 2LI5A 3TEZA 1SIJA 1WF9A 2Z59B 4NQLB 1RFAA 4UDUC 1GAQB 1JWSD 1VLBA 4L23A 4LJOB 4HLEA 1VZ8A 1JW9D 1J19A 4IOIE 5CTRC 2KFKB 1FXAA 3ZVVA 3ML9A 4B6WA 1HA5A 5LLIA 1WGRA 3QC8B 3RPFC 2DYOA 3MTNB 2PVOD 1OQYA 2K1FA 1TY2A 1TZ1A 2TSSA 4MGYE 2WXRA 1WZ3A 4OW0A 2OJWA 2MBQA 5CHVC 2JRHA 3R66C 1QLBB 1E8XA 3KUCB 3R8BA 3IAM1 2BB6A 3RZWC 2KVZA 3KW5B 2CJOA 2M8SA 3CF6E 2LWPA 3DBRI 1LQBA 4GLSC 3NOBA 4M0WB 1D5MC 3QIJA 2GRIA 3U8ZA 3ZTDA 3VR9B 2UU7A 4N9F4 2Z0DB 1GC6A 3AE1B 3CIRB 2C7MB 5AUIA 2WDTB 2JWZA 4HCPB 2W55A 3IT6B 1EF5A 1V81A 1WGDA 1WMHB 3ENEA 1NEKB 3ZW3A 2K5PA 4MM3A 3RI7C 5LXHA 2PJHA 1FFVA 3VQIA 3AEGB 4DDID 2BWFA 3KUDB 4X57B 4DHJB 5EDSA 5G55A 4CO7A 4HJKA 2SAKA 1WRDB 2K0PA 2JXTA 1D3ZA 2LHEA 2RSUA
chains in the Genus database with same CATH topology
4TKNA 5GMVA 4B9KA 2G4SA 1TBEA 1Z2MA 1TTNA 2M17A 4GOCA 4GDKB 5E6NA 2KX3A 4A20A 3P2BA 3QCAA 4GDLB 3L17A 3H7PA 1Q0WB 1SE9A 1HE8A 4ZRIA 2LXCA 4NQKE 1R4MI 2KFJA 1WIAA 2BGFA 5D2MB 2A5UA 2JVCA 3R7QA 3NHEB 2JZZA 1WE6A 2DENB 1WJUA 3DPDA 5L83A 3N30A 4WAAA 3VFKA 4BKSD 2GBMA 2ZVNA 1WR6E 3UF8A 4BVUC 1RRBA 1JRUA 2L3ZA 2QHOA 2MLBA 2NR2A 3QAQA 4G11A 1WE7A 3W1YA 3UIOB 2KLCA 2ZCBA 2ZEQA 2CHZA 1UBQA 4LDTB 3SU8X 2JXXA 5E6PA 4EZJA 2AYOB 3EC8A 4W9FA 3ZDTA 4EFOA 1Q5WB 2CKHB 4EOYA 2LVQA 3PLUA 2LZ6A 2ZNVC 3DVGX 3V60A 1K8RB 4HPMB 5CX3A 1OTRB 2WWZA 1E7UA 3H1UA 3RD2A 1V49A 4BKGA 4BKSA 2I1JA 4KSLC 3L0WB 3KVFB 4URKA 3UQBA 2NPTB 1E8ZA 4MGIE 4BBNF 3O65B 3WA0A 2KDFB 2D2QA 3WALA 2KJHB 3L13A 2DYBA 1WH3A 2C9WB 3PT2B 1VCBA 3VUYA 3EHVA 5LXIB 3KYCD 4KIKA 2L0TA 2XEWA 2KTRB 1R4NI 3H7PB 5AZHA 3A9KA 4MJSB 2L05A 4M8NA 4K7SA 2JPHA 1EUVB 1H4RA 2LRWA 4DHZB 3AU5A 2EMSA 5FR6A 2FCQA 3PRPB 3V62A 3DVGY 4EZKA 2J7QB 2NS5A 2O2VB 4DBGA 4F8CB 3T9LA 3L54A 4F1SA 2OJRA 3HHMA 3M62B 3VH4B 2L76A 3EECA 3QHTA 4IM3A 2J0KA 3A9JA 4JL9A 3N3KB 4E71A 1YJ1A 4NJ6A 2GMIC 3KH0A 4NY0A 2CR5A 2D3GA 4K1RB 1U4AA 3LDZE 4JLCA 4FADA 4WJPA 4W9JA 3TL5A 5J18A 2MP2B 2ZNVB 2FUHB 4DK5A 2XK5B 2MBBB 1UGMA 4W9HA 2W9NA 5JHBA 1Q1OA 3EFUA 2JT4B 1EO6A 4ZRKA 4A3PA 4A3OA 4AUQC 2O6VA 4TUUA 5J2RA 4WJNA 2KZRA 2PE9A 4HDOA 3B08A 2K8HA 3AI5A 4KSKC 2MSED 3JW0X 1WX9A 2XBBC 3NY5A 4FLHA 3ZNZB 4BFRA 5DCNA 4JIOU 4G0NB 3ZIMA 2DZIA 3JVZX 2KD0A 1E5WA 1UH6A 2JZ3B 4MEMA 3ZNHB 1NI2A 2WYQA 2EMTA 4FJZA 1TGZB 3AULA 1E7VA 2G45B 4CYEA 4KIKB 2MBHA 1WX7A 2J0MA 1GC7A 1OGWA 2FCNA 2RR9A 3ZRCA 5KHQA 3A9KB 2BYFA 2FNJB 2C7NB 2GBNA 1ZKHA 2RD0A 2Y5BB 3QJZA 4FN2A 3QARA 3VHTC 2KN5A 3PHWB 4K81A 4TQ0A 5JZEB 1S3SG 4GSWA 4TQ1A 2LGXA 2LRUA 2YLMA 3AU4A 4RMAA 4II2B 4W9DA 5JH5C 2M4NA 3JSVB 4FJYA 1P98A 2UWQA 2V4LA 3DVNU 4IWOA 3ZTCA 2C5LC 2BWES 4PS7A 3RCZA 1LFDA 5AZFA 1WGGA 3A9JB 3PREA 2L0FA 2BKRB 2KXJA 2CHXA 2KFKA 5J17A 1V2YA 1ZW7A 4KDIC 4EKUA 2BF8B 4W9CA 2DZKA 4HXDA 4K7UA 3RULA 4P7IA 3TCAA 4BOZB 1L7YA 2LUEA 2CS4A 1Z5SB 2GOWA 2NBVB 2NCNA 3X0WA 1X1MA 3D32A 3N32A 4TV3A 2ZJDA 1IP9A 3ALBA 3PS6A 4OVVA 1E90A 4W9IA 2JY6A 3PRZA 4NJ7A 5DPRA 3M95A 3V61A 2C60A 4BKTA 5DPWA 4FULA 4WJQA 5D7GA 3ZDMC 4F7ZA 1YD8U 1G6JA 2R2QA 3Q3FA 1V9JA 1J8CA 1KLVA 1WX8A 4AP4C 3RYTA 2MW5A 3UQAA 2O6VB 2VRRB 3KYDD 4IM2A 2NBUA 3DBSA 2LASA 3H6NA 3IFWB 4WWOA 4FBJB 2N7EA 3W1SA 1F9JA 3A4RA 1OEYJ 2IYDB 2G3QB 1ISNA 2JF5A 3HM6X 1T0YA 2GBKA 2GBRA 1M94A 3DBHI 4DDGD 3PV1A 2DAFA 2L8JA 3HIZA 3DBLI 3B1LX 4GU2A 3PPAA 1C1YB 4I6PA 5G2NA 4DXAB 5IAAC 3TMPB 3PSEB 3K9PB 4FJVB 3VUWA 3CSTA 4IC7B 1E8WA 3B0AA 2LGDA 4XX5A 4DHJD 2B3AA 2MQJA 3VTVA 2A4ZA 5C1ZA 1WXVA 2KVRA 2N9PC 2AL3A 2K6QA 2KWCA 2CHWA 2REXA 2DZJA 3GOEA 3H9DA 3RT3B 1GNUA 1SIFA 3OLMD 3MJWA 1WMHA 2IO2B 4KV2A 5IA7A 4HK2A 2N9XA 1WYWB 1WY8A 1WI0A 2MRPA 1CMXB 3SHQA 4EZLA 1L2NA 1LM8B 5DPTA 2C7HA 4WWPA 3VTWA 1XQQA 3VH3B 1NDDA 4DWFA 2LJ5A 1V6EA 4EEWA 1OEYA 3K9OB 2MX2A 3ZUNA 3R3MA 4OVUA 3C0RB 2K6DB 2BKFA 4ZRJA 4BBNC 2PE6B 4W9EA 3ONSA 2DHZA 2IY0B 1XT9B 3IBEA 4HVBA 3UINB 2WX0A 4IW0A 1A5RA 3WAMA 3GZNI 3T8MA 4MGZE 2MWSB 1GUAB 2KKCA 1YX5B 4IG7B 1WM3A 4LDTD 1H8CA 2ZPYA 5DPSA 1KOTA 2NBWB 4KZCA 4NPNA 5AZGA 2D11A 5C23A 2NVUI 1WGYA 3DCGA 4ZDVA 4GB9A 1QZEA 2DX5B 1WXMA 3S2AA 2YVCA 2FIFA 1KJTA 3OAWA 2IBIB 4AWJA 1WJNA 2AWTA 2N1VA 1YQBA 1MG8A 2K39A 2L00B 3MHSD 3QA8A 4EUTA 3RUIB 2AL6A 4AJYB 2LGYA 2HTHA 1WFYA 2KMAA 3A33B 2ZPNA 4PYZA 5TR5A 5AEKB 2D07B 2BPSA 1I42A 4DHZE 4HDQA 2KMCA 3ZNGC 2KX0A 3WIMA 2M1MA 1EF1A 3ZLZA 2ZZPB 4RM8A 1RLFA 4ANXA 1I35A 1WM2A 3ZRFA 3PTFC 2V3SA 1YIWA 2I1KA 3NS8A 3RZFA 3IVFA 3V6EB 3SDLC 1PQSA 4KDLB 3KUZA 4W9KA 1Y8RC 1WGHA 1LXDA 4LJPB 3V6CB 1V80A 3H7SA 2KNBA 3HM3A 5KHOA 1E8YA 3ZKJC 1S1QB 2KC1A 2LVPA 2N4FA 4GMVA 1WJ6A 2KC2A 2FCMA 4K7WA 5BO4B 4YL8A 4AOFA 3PRMB 2IO3B 3APCA 5CHFA 2PPHA 2OOBB 3TBLD 4PS8A 2JUOA 2KTRA 3UGBB 3DVNV 3OJ3A 5E6OA 4MJSA 4GGQA 2KANA 3VDZA 3ZO5B 3M3JA 4LCDE 3LJ3A 2AEHA 1AARA 2KHWB 3PLVA 4MELA 2ZCCA 3HK0A 3TJPA 4XC2A 2HJ8A 2KOXA 3L16A 3Q3JA 4W9GA 4B95A 1UELA 1WR1A 4CHKA 5D6JB 4II3B 4PS3A 3UIPB 4NAWA 2RPQA 2K8BA 1UBIA 2O2VA 2Z0EB 3ML8A 3QQ8B 3W1SC 4HWIB 4M8MA 2MA9B 2KDEB 4FA6A 2KJRA 2M0XA 4JQWC 3JYUA 3OJ4B 4JGHB 3A1QA 1P9DU 2LVOA 2N7DA 4E3CA 2HD5B 1J0GA 4IM0A 2KLGA 3SD5A 4ANWA 2DZMA 4XZ4A 2FIDA 1WZ0A 3APDA 3VAWA 3VTUA 3NZUA 5HKHA 3WAOA 1SGHA 3CMMB 3L08A 4MSMB 2WX1A 3WANA 3L10B 4ANUA 2N1WA 2K8CA 4AJWA 3DOWA 1FXTB 2LI5A 4KVGB 2MP2A 4ICUA 1WXAA 2XK5A 1UD7A 2IY1B 2KWUB 2DYMA 1WF9A 2ASQA 2Z59B 1V5OA 2KQ7A 4NQLB 1RFAA 3M63B 4LJOB 4GN1A 4HLEA 3AXCA 2HE7A 4MDKE 1J19A 3U30A 5CTRC 2KFKB 3ZVVA 2GBJA 2BYEA 3ML9A 1GG3A 2UYZB 5JHAA 4WWNA 3R7RA 4B6WA 2DAJA 4FHJA 3NZSA 1BT0A 1WGRA 4I6LB 5LLIA 3QC8B 3ZNID 2DYOA 1VD2A 3MTNB 4ZYNA 3U7DA 4IWPA 1OQYA 2IZVB 1P3QU 2K1FA 1TZ1A 3QWZB 4HPLB 2LXAA 4I6NB 4MGYE 4IUMB 2KJ6A 1WZ3A 3ECIA 2MBEA 2FCSA 3DDCB 3VVWB 2FAZA 4GDKA 2L7RA 2MBQA 4GDLA 3DQVA 2JRHA 3R66C 5CHVC 2MCNB 3TIXA 2LD9A 4NAWB 1E8XA 3KUCB 3WAPA 3JSVA 4HCNB 3CSFA 3PGEA 2CU1A 5D94A 1WJ4A 3RZWC 1RAXA 3X23A 1ZGUB 3A1QB 3KW5B 4GXBA 4ANVA 1V86A 4GIVA 4KZ0A 2M8SA 5L95C 4MH0E 3VXWA 3CF6E 2O6VD 4FHKA 2LWPA 4W9LA 2KK8A 4E74A 3PHXB 3DBRI 1LQBA 2IO0B 2IO1B 3QX1A 5CHWA 4WQOB 3NOBA 4M0WB 4MSQB 2ZVOA 3QIJA 3U8ZA 1XD3B 4PYUA 3ZTDA 2N9EB 2G4DB 2BYVE 1P1AA 4N9F4 1IPGA 2KDBA 1GC6A 2Z0DB 4ASWC 4NNJB 1C3TA 2C7MB 1V5TA 2WDTB 2JWZA 4HCPB 1UZXB 1NBFC 3PVLA 1IYFA 1EF5A 2K25A 2J0JA 2KDIA 4RM9A 4G50A 1V81A 4MGKE 1WGDA 3I3TB 1WMHB 3ENEA 2V1YA 3ZW3A 3IHPC 1WXSA 4ICVA 4MM3A 2MBOA 2R2OA 2KWVB 3VUXA 5LXHA 2PJHA 2KTFA 4IWQA 3VQIA 4DDID 2EKEC 4WJOA 1GJZA 4J6IA 2JRIB 2BWFA 2NPTA 3QK0A 1YX6B 3KUDB 3PZDA 4X57B 3BY4B 4DHJB 5G55A 4CO7A 4HJKA 5EDSA 2KO3A 4G3XB 1WRDB 2D10A 3BINA 1P0RA 2PEAA 1D3ZA 3A4SC 2RGFA 4BOSC 1KM7A 2KQSA 3IG3A 3APFA 2RSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  5GMV A;  4B9K A;  2G4S A;  1TBE A;  1Z2M A;  1TTN A;  2M17 A;  4GOC A;  4GDK B;  5E6N A;  2KX3 A;  4A20 A;  3P2B A;  3QCA A;  4GDL B;  3L17 A;  3H7P A;  1Q0W B;  1SE9 A;  1HE8 A;  4ZRI A;  2LXC A;  4NQK E;  1R4M I;  2KFJ A;  1WIA A;  2BGF A;  5D2M B;  2A5U A;  2JVC A;  3R7Q A;  3NHE B;  2JZZ A;  1WE6 A;  2DEN B;  1WJU A;  3DPD A;  5L83 A;  3N30 A;  4WAA A;  3VFK A;  4BKS D;  2GBM A;  2ZVN A;  1WR6 E;  3UF8 A;  4BVU C;  1RRB A;  1JRU A;  2L3Z A;  2QHO A;  2MLB A;  2NR2 A;  3QAQ A;  4G11 A;  1WE7 A;  3W1Y A;  3UIO B;  2KLC A;  2ZCB A;  2ZEQ A;  2CHZ A;  1UBQ A;  4LDT B;  3SU8 X;  2JXX A;  5E6P A;  4EZJ A;  2AYO B;  3EC8 A;  4W9F A;  3ZDT A;  4EFO A;  1Q5W B;  2CKH B;  4EOY A;  2LVQ A;  3PLU A;  2LZ6 A;  2ZNV C;  3DVG X;  3V60 A;  1K8R B;  4HPM B;  5CX3 A;  1OTR B;  2WWZ A;  1E7U A;  3H1U A;  3RD2 A;  1V49 A;  4BKG A;  4BKS A;  2I1J A;  4KSL C;  3L0W B;  3KVF B;  4URK A;  3UQB A;  2NPT B;  1E8Z A;  4MGI E;  4BBN F;  3O65 B;  3WA0 A;  2KDF B;  2D2Q A;  3WAL A;  2KJH B;  3L13 A;  2DYB A;  1WH3 A;  2C9W B;  3PT2 B;  1VCB A;  3VUY A;  3EHV A;  5LXI B;  3KYC D;  4KIK A;  2L0T A;  2XEW A;  2KTR B;  1R4N I;  3H7P B;  5AZH A;  3A9K A;  4MJS B;  2L05 A;  4M8N A;  4K7S A;  2JPH A;  1EUV B;  1H4R A;  2LRW A;  4DHZ B;  3AU5 A;  2EMS A;  5FR6 A;  2FCQ A;  3PRP B;  3V62 A;  3DVG Y;  4EZK A;  2J7Q B;  2NS5 A;  2O2V B;  4DBG A;  4F8C B;  3T9L A;  3L54 A;  4F1S A;  2OJR A;  3HHM A;  3M62 B;  3VH4 B;  2L76 A;  3EEC A;  3QHT A;  4IM3 A;  2J0K A;  3A9J A;  4JL9 A;  3N3K B;  4E71 A;  1YJ1 A;  4NJ6 A;  2GMI C;  3KH0 A;  4NY0 A;  2CR5 A;  2D3G A;  4K1R B;  1U4A A;  3LDZ E;  4JLC A;  4FAD A;  4WJP A;  4W9J A;  3TL5 A;  5J18 A;  2MP2 B;  2ZNV B;  2FUH B;  4DK5 A;  2XK5 B;  2MBB B;  1UGM A;  4W9H A;  2W9N A;  5JHB A;  1Q1O A;  3EFU A;  2JT4 B;  1EO6 A;  4ZRK A;  4A3P A;  4A3O A;  4AUQ C;  2O6V A;  4TUU A;  5J2R A;  4WJN A;  2KZR A;  2PE9 A;  4HDO A;  3B08 A;  2K8H A;  3AI5 A;  4KSK C;  2MSE D;  3JW0 X;  1WX9 A;  2XBB C;  3NY5 A;  4FLH A;  3ZNZ B;  4BFR A;  5DCN A;  4JIO U;  4G0N B;  3ZIM A;  2DZI A;  3JVZ X;  2KD0 A;  1E5W A;  1UH6 A;  2JZ3 B;  4MEM A;  3ZNH B;  1NI2 A;  2WYQ A;  2EMT A;  4FJZ A;  1TGZ B;  3AUL A;  1E7V A;  2G45 B;  4CYE A;  4KIK B;  2MBH A;  1WX7 A;  2J0M A;  1GC7 A;  1OGW A;  2FCN A;  2RR9 A;  3ZRC A;  5KHQ A;  3A9K B;  2BYF A;  2FNJ B;  2C7N B;  2GBN A;  1ZKH A;  2RD0 A;  2Y5B B;  3QJZ A;  4FN2 A;  3QAR A;  3VHT C;  2KN5 A;  3PHW B;  4K81 A;  4TQ0 A;  5JZE B;  1S3S G;  4GSW A;  4TQ1 A;  2LGX A;  2LRU A;  2YLM A;  3AU4 A;  4RMA A;  4II2 B;  4W9D A;  5JH5 C;  2M4N A;  3JSV B;  4FJY A;  1P98 A;  2UWQ A;  2V4L A;  3DVN U;  4IWO A;  3ZTC A;  2C5L C;  2BWE S;  4PS7 A;  3RCZ A;  1LFD A;  5AZF A;  1WGG A;  3A9J B;  3PRE A;  2L0F A;  2BKR B;  2KXJ A;  2CHX A;  2KFK A;  5J17 A;  1V2Y A;  1ZW7 A;  4KDI C;  4EKU A;  2BF8 B;  4W9C A;  2DZK A;  4HXD A;  4K7U A;  3RUL A;  4P7I A;  3TCA A;  4BOZ B;  1L7Y A;  2LUE A;  2CS4 A;  1Z5S B;  2GOW A;  2NBV B;  2NCN A;  3X0W A;  1X1M A;  3D32 A;  3N32 A;  4TV3 A;  2ZJD A;  1IP9 A;  3ALB A;  3PS6 A;  4OVV A;  1E90 A;  4W9I A;  2JY6 A;  3PRZ A;  4NJ7 A;  5DPR A;  3M95 A;  3V61 A;  2C60 A;  4BKT A;  5DPW A;  4FUL A;  4WJQ A;  5D7G A;  3ZDM C;  4F7Z A;  1YD8 U;  1G6J A;  2R2Q A;  3Q3F A;  1V9J A;  1J8C A;  1KLV A;  1WX8 A;  4AP4 C;  3RYT A;  2MW5 A;  3UQA A;  2O6V B;  2VRR B;  3KYD D;  4IM2 A;  2NBU A;  3DBS A;  2LAS A;  3H6N A;  3IFW B;  4WWO A;  4FBJ B;  2N7E A;  3W1S A;  1F9J A;  3A4R A;  1OEY J;  2IYD B;  2G3Q B;  1ISN A;  2JF5 A;  3HM6 X;  1T0Y A;  2GBK A;  2GBR A;  1M94 A;  3DBH I;  4DDG D;  3PV1 A;  2DAF A;  2L8J A;  3HIZ A;  3DBL I;  3B1L X;  4GU2 A;  3PPA A;  1C1Y B;  4I6P A;  5G2N A;  4DXA B;  5IAA C;  3TMP B;  3PSE B;  3K9P B;  4FJV B;  3VUW A;  3CST A;  4IC7 B;  1E8W A;  3B0A A;  2LGD A;  4XX5 A;  4DHJ D;  2B3A A;  2MQJ A;  3VTV A;  2A4Z A;  5C1Z A;  1WXV A;  2KVR A;  2N9P C;  2AL3 A;  2K6Q A;  2KWC A;  2CHW A;  2REX A;  2DZJ A;  3GOE A;  3H9D A;  3RT3 B;  1GNU A;  1SIF A;  3OLM D;  3MJW A;  1WMH A;  2IO2 B;  4KV2 A;  5IA7 A;  4HK2 A;  2N9X A;  1WYW B;  1WY8 A;  1WI0 A;  2MRP A;  1CMX B;  3SHQ A;  4EZL A;  1L2N A;  1LM8 B;  5DPT A;  2C7H A;  4WWP A;  3VTW A;  1XQQ A;  3VH3 B;  1NDD A;  4DWF A;  2LJ5 A;  1V6E A;  4EEW A;  1OEY A;  3K9O B;  2MX2 A;  3ZUN A;  3R3M A;  4OVU A;  3C0R B;  2K6D B;  2BKF A;  4ZRJ A;  4BBN C;  2PE6 B;  4W9E A;  3ONS A;  2DHZ A;  2IY0 B;  1XT9 B;  3IBE A;  4HVB A;  3UIN B;  2WX0 A;  4IW0 A;  1A5R A;  3WAM A;  3GZN I;  3T8M A;  4MGZ E;  2MWS B;  1GUA B;  2KKC A;  1YX5 B;  4IG7 B;  1WM3 A;  4LDT D;  1H8C A;  2ZPY A;  5DPS A;  1KOT A;  2NBW B;  4KZC A;  4NPN A;  5AZG A;  2D11 A;  5C23 A;  2NVU I;  1WGY A;  3DCG A;  4ZDV A;  4GB9 A;  1QZE A;  2DX5 B;  1WXM A;  3S2A A;  2YVC A;  2FIF A;  1KJT A;  3OAW A;  2IBI B;  4AWJ A;  1WJN A;  2AWT A;  2N1V A;  1YQB A;  1MG8 A;  2K39 A;  2L00 B;  3MHS D;  3QA8 A;  4EUT A;  3RUI B;  2AL6 A;  4AJY B;  2LGY A;  2HTH A;  1WFY A;  2KMA A;  3A33 B;  2ZPN A;  4PYZ A;  5TR5 A;  5AEK B;  2D07 B;  2BPS A;  1I42 A;  4DHZ E;  4HDQ A;  2KMC A;  3ZNG C;  2KX0 A;  3WIM A;  2M1M A;  1EF1 A;  3ZLZ A;  2ZZP B;  4RM8 A;  1RLF A;  4ANX A;  1I35 A;  1WM2 A;  3ZRF A;  3PTF C;  2V3S A;  1YIW A;  2I1K A;  3NS8 A;  3RZF A;  3IVF A;  3V6E B;  3SDL C;  1PQS A;  4KDL B;  3KUZ A;  4W9K A;  1Y8R C;  1WGH A;  1LXD A;  4LJP B;  3V6C B;  1V80 A;  3H7S A;  2KNB A;  3HM3 A;  5KHO A;  1E8Y A;  3ZKJ C;  1S1Q B;  2KC1 A;  2LVP A;  2N4F A;  4GMV A;  1WJ6 A;  2KC2 A;  2FCM A;  4K7W A;  5BO4 B;  4YL8 A;  4AOF A;  3PRM B;  2IO3 B;  3APC A;  5CHF A;  2PPH A;  2OOB B;  3TBL D;  4PS8 A;  2JUO A;  2KTR A;  3UGB B;  3DVN V;  3OJ3 A;  5E6O A;  4MJS A;  4GGQ A;  2KAN A;  3VDZ A;  3ZO5 B;  3M3J A;  4LCD E;  3LJ3 A;  2AEH A;  1AAR A;  2KHW B;  3PLV A;  4MEL A;  2ZCC A;  3HK0 A;  3TJP A;  4XC2 A;  2HJ8 A;  2KOX A;  3L16 A;  3Q3J A;  4W9G A;  4B95 A;  1UEL A;  1WR1 A;  4CHK A;  5D6J B;  4II3 B;  4PS3 A;  3UIP B;  4NAW A;  2RPQ A;  2K8B A;  1UBI A;  2O2V A;  2Z0E B;  3ML8 A;  3QQ8 B;  3W1S C;  4HWI B;  4M8M A;  2MA9 B;  2KDE B;  4FA6 A;  2KJR A;  2M0X A;  4JQW C;  3JYU A;  3OJ4 B;  4JGH B;  3A1Q A;  1P9D U;  2LVO A;  2N7D A;  4E3C A;  2HD5 B;  1J0G A;  4IM0 A;  2KLG A;  3SD5 A;  4ANW A;  2DZM A;  4XZ4 A;  2FID A;  1WZ0 A;  3APD A;  3VAW A;  3VTU A;  3NZU A;  5HKH A;  3WAO A;  1SGH A;  3CMM B;  3L08 A;  4MSM B;  2WX1 A;  3WAN A;  3L10 B;  4ANU A;  2N1W A;  2K8C A;  4AJW A;  3DOW A;  1FXT B;  2LI5 A;  4KVG B;  2MP2 A;  4ICU A;  1WXA A;  2XK5 A;  1UD7 A;  2IY1 B;  2KWU B;  2DYM A;  1WF9 A;  2ASQ A;  2Z59 B;  1V5O A;  2KQ7 A;  4NQL B;  1RFA A;  3M63 B;  4LJO B;  4GN1 A;  4HLE A;  3AXC A;  2HE7 A;  4MDK E;  1J19 A;  3U30 A;  5CTR C;  2KFK B;  3ZVV A;  2GBJ A;  2BYE A;  3ML9 A;  1GG3 A;  2UYZ B;  5JHA A;  4WWN A;  3R7R A;  4B6W A;  2DAJ A;  4FHJ A;  3NZS A;  1BT0 A;  1WGR A;  4I6L B;  5LLI A;  3QC8 B;  3ZNI D;  2DYO A;  1VD2 A;  3MTN B;  4ZYN A;  3U7D A;  4IWP A;  1OQY A;  2IZV B;  1P3Q U;  2K1F A;  1TZ1 A;  3QWZ B;  4HPL B;  2LXA A;  4I6N B;  4MGY E;  4IUM B;  2KJ6 A;  1WZ3 A;  3ECI A;  2MBE A;  2FCS A;  3DDC B;  3VVW B;  2FAZ A;  4GDK A;  2L7R A;  2MBQ A;  4GDL A;  3DQV A;  2JRH A;  3R66 C;  5CHV C;  2MCN B;  3TIX A;  2LD9 A;  4NAW B;  1E8X A;  3KUC B;  3WAP A;  3JSV A;  4HCN B;  3CSF A;  3PGE A;  2CU1 A;  5D94 A;  1WJ4 A;  3RZW C;  1RAX A;  3X23 A;  1ZGU B;  3A1Q B;  3KW5 B;  4GXB A;  4ANV A;  1V86 A;  4GIV A;  4KZ0 A;  2M8S A;  5L95 C;  4MH0 E;  3VXW A;  3CF6 E;  2O6V D;  4FHK A;  2LWP A;  4W9L A;  2KK8 A;  4E74 A;  3PHX B;  3DBR I;  1LQB A;  2IO0 B;  2IO1 B;  3QX1 A;  5CHW A;  4WQO B;  3NOB A;  4M0W B;  4MSQ B;  2ZVO A;  3QIJ A;  3U8Z A;  1XD3 B;  4PYU A;  3ZTD A;  2N9E B;  2G4D B;  2BYV E;  1P1A A;  4N9F 4;  1IPG A;  2KDB A;  1GC6 A;  2Z0D B;  4ASW C;  4NNJ B;  1C3T A;  2C7M B;  1V5T A;  2WDT B;  2JWZ A;  4HCP B;  1UZX B;  1NBF C;  3PVL A;  1IYF A;  1EF5 A;  2K25 A;  2J0J A;  2KDI A;  4RM9 A;  4G50 A;  1V81 A;  4MGK E;  1WGD A;  3I3T B;  1WMH B;  3ENE A;  2V1Y A;  3ZW3 A;  3IHP C;  1WXS A;  4ICV A;  4MM3 A;  2MBO A;  2R2O A;  2KWV B;  3VUX A;  5LXH A;  2PJH A;  2KTF A;  4IWQ A;  3VQI A;  4DDI D;  2EKE C;  4WJO A;  1GJZ A;  4J6I A;  2JRI B;  2BWF A;  2NPT A;  3QK0 A;  1YX6 B;  3KUD B;  3PZD A;  4X57 B;  3BY4 B;  4DHJ B;  5G55 A;  4CO7 A;  4HJK A;  5EDS A;  2KO3 A;  4G3X B;  1WRD B;  2D10 A;  3BIN A;  1P0R A;  2PEA A;  1D3Z A;  3A4S C;  2RGF A;  4BOS C;  1KM7 A;  2KQS A;  3IG3 A;  3APF A;  2RSU A; 
#chains in the Genus database with same CATH topology
 3NS1 A;  1FMA D;  2M17 A;  2KX3 A;  3P63 A;  3QCA A;  1AN8 A;  4N59 A;  2KMM A;  1SE9 A;  4ZRI A;  2LXC A;  1EWC A;  5JXV A;  1I4X A;  2BGF A;  5D2M B;  3NHE B;  3W5U B;  1KTK A;  2QSD A;  3FKY A;  4RH6 A;  5IKC M;  1F2R C;  1VR9 A;  3H8H A;  2NR2 A;  3W1Y A;  3DWM A;  2JXX A;  2AYO B;  4W9F A;  2CKH B;  2LVQ A;  1YJI A;  2WXO A;  3V60 A;  1K8R B;  2WXQ A;  4N58 A;  3KQ4 A;  4BAX A;  2WWZ A;  4BKG A;  1R7S A;  2I1J A;  2AQ3 B;  4KSL C;  1V1O A;  3L0W B;  3UQB A;  4BBN F;  3WA0 A;  1UUP A;  1FCL A;  1TS3 A;  1I4Q A;  5HG2 A;  3I63 C;  1T5X D;  4JWU C;  3VUY A;  2L0T A;  4ITK A;  2XEW A;  2KTR B;  1R4N I;  2YEP F;  3SR6 A;  1MFW A;  2LGS A;  3NVV A;  1SSN A;  3AU5 A;  4S0R A;  4TMA B;  3RMK C;  3V62 A;  4LNN A;  1WSP A;  4EZK A;  2J7Q B;  3EEC A;  3QHT A;  1E9M A;  5AUK A;  3A9J A;  3MFG A;  1GB1 A;  4YWG G;  2IGD A;  2CR5 A;  4K1R B;  2N9K A;  4KKI A;  1SJH D;  1TY0 A;  2J52 A;  3R2I A;  5FR3 A;  2MP2 B;  2ZNV B;  2FUH B;  2PIA A;  2WXJ A;  3Q14 C;  1UGM A;  5JHB A;  1EO6 A;  2E3T A;  5J2R A;  4HDO A;  4NJC A;  3AI5 A;  2MSE D;  2PW9 A;  1FNU A;  4ZHP A;  4FLH A;  4JIO U;  4G0N B;  5FKA C;  2KD0 A;  3ZNH B;  1UH6 A;  2JZ3 B;  2WYQ A;  4FJZ A;  1ZOY B;  3MC9 A;  2G45 B;  1LO5 D;  2JX5 A;  2RR9 A;  4XYC A;  3ZRC A;  2FNJ B;  2C7N B;  2Y5B B;  4FN2 A;  4US8 A;  3ETR A;  2KN5 A;  1V1P B;  4TQ0 A;  1S3S G;  2LRU A;  3Q69 A;  2BWE S;  2BS2 B;  3A9J B;  3AE7 B;  1SE4 A;  4B0M A;  4BOZ B;  1L7Y A;  1Z5S B;  2FUG 1;  2NCN A;  2PTL A;  3D32 A;  1AWD A;  1IP9 A;  2ONQ A;  1ZP0 B;  3PRZ A;  5C2T B;  3V61 A;  5IP4 D;  1YMH E;  4BKT A;  1VDV A;  1JRP A;  5D7G A;  3ZDM C;  1YD8 U;  3Q3F A;  1V9J A;  1J8C A;  1WX8 A;  4AP4 C;  3RYT A;  2VRR B;  4IM2 A;  3DBS A;  1N63 A;  3IFW B;  3H6N A;  1STE A;  1J7C A;  1I4R A;  3WCQ A;  1F1H A;  1OEY J;  4DDG D;  3PV1 A;  2V9H A;  3DBL I;  4DXA B;  4ARC A;  3PPA A;  4I6P A;  5G2N A;  2WDR B;  5IAA C;  3N20 C;  3PSE B;  3K9P B;  3VUW A;  3B0A A;  3GB1 A;  4XX5 A;  2MQJ A;  3AE6 B;  1WXV A;  2KVR A;  4LNK A;  3RT3 B;  3GOE A;  4P1C C;  4NAM A;  1SIF A;  4KV2 A;  2N9X A;  1WYW B;  2MRP A;  1XQQ A;  3VH3 B;  1NDD A;  1ZXI A;  1SE2 A;  3K9O B;  1FCC C;  1SE3 A;  3R3M A;  4OVU A;  4ZRJ A;  2BKF A;  3ONS A;  1N5W A;  3UIN B;  2IPK D;  4D2K A;  4IW0 A;  4IDI A;  2DBY A;  3GZN I;  2WLB A;  1MVK A;  3Q8F A;  4LNI A;  1JAL A;  2D3C A;  1JRO A;  3NRZ A;  2VZK B;  2ZW1 A;  2BYT A;  4M00 A;  1EU4 A;  1KJT A;  2IBI B;  1WJN A;  2AWT A;  3QA8 A;  3VRA B;  3FIL B;  4AJY B;  2HTH A;  3ZNG C;  4KGT A;  3WIM A;  2M1M A;  4RM8 A;  3O13 A;  1XO3 A;  3B9J A;  3PTF C;  4HRO A;  2V3S A;  1YIW A;  3RZF A;  3IVF A;  1PQS A;  1Y8R C;  3V6C B;  3H7S A;  3HM3 A;  2KC1 A;  2LVP A;  2N4F A;  4K7W A;  4HJG E;  4C7Z A;  3TBL D;  2L32 A;  2W82 A;  3OJ3 A;  4MJS A;  2ZCC A;  4XC2 A;  2N7J A;  4B95 A;  3Q3J A;  1FEH A;  4PS3 A;  1V8C A;  1UBI A;  2O2V A;  3ML8 A;  3BK2 A;  3W1S C;  1C76 A;  2KDE B;  4FA6 A;  2KJR A;  4R3D A;  3JYU A;  2BS4 B;  1VJK A;  3IXS A;  1SXT A;  1BXT A;  1QT9 A;  1WZ0 A;  3APD A;  3VAW A;  2V3N A;  1UWX A;  3WAO A;  1R4M B;  4ANU A;  3L10 B;  4HPP A;  5T8I A;  2K8C A;  4AJW A;  3DOW A;  3ZJU A;  4KVG B;  4ICU A;  2N0S B;  2IY1 B;  5HI1 A;  2KDM A;  1TJE A;  3OG5 A;  2ASQ A;  5D3I B;  3AE2 B;  3ZJV A;  4GN1 A;  3FAH A;  2D3B A;  2RPV A;  3AE9 B;  3ZJT A;  1K51 A;  5JHA A;  3R7R A;  3NZS A;  1BT0 A;  1TT5 B;  3ZNI D;  4ZYN A;  2IZV B;  4A9A A;  4HPL B;  2LXA A;  4IUM B;  2ICI A;  2KJ6 A;  3ECI A;  2JSV X;  2MBE A;  2FCS A;  3DDC B;  4MT5 A;  4GDK A;  2WQY B;  3WAP A;  3W9C B;  1N60 A;  3CSF A;  3PGE A;  5D94 A;  1ZE3 D;  1RAX A;  3X23 A;  3VXW A;  2O6V D;  3C19 A;  5CHW A;  4WQO B;  4JPS A;  4YSZ B;  2ZVO A;  4A90 A;  2V4I B;  2N9E B;  2H89 B;  1NBF C;  1IYF A;  1FFU A;  4RM9 A;  2KDI A;  1K53 A;  2V1Y A;  1WXS A;  4ICV A;  2R2O A;  2KWV B;  4NZL B;  3VUX A;  2KTF A;  2EKE C;  1FIQ A;  4J6I A;  2NPT A;  3QK0 A;  1YX6 B;  3BY4 B;  2D10 A;  1QIL A;  3BIN A;  2PEA A;  1TZO A;  1QOF A;  2RGF A;  4BOS C;  1KM7 A;  2J4X A;  4YSX B;  3APF A;  1OFF A;  2D3A A;  4GOC A;  1TTN A;  4RGN A;  4GDK B;  5E6N A;  1UF0 A;  1I4H A;  2KQ4 X;  4DXG A;  2PKO A;  1ZXH A;  1F77 A;  1HE8 A;  3I9V 1;  4C7Y A;  2QIE B;  2WDQ B;  3RNG C;  1N6Z A;  4QAY A;  1RWS A;  3I5J C;  3TEW A;  1WJU A;  5L83 A;  4O1N A;  3N30 A;  4WAA A;  1L4Z B;  2N9L A;  1WR6 E;  3UF8 A;  1PGB A;  1RRB A;  1JRU A;  2L3Z A;  1SF0 A;  3URY A;  2MLB A;  1MI0 A;  2QIL A;  2ZEQ A;  2CHZ A;  1UBQ A;  5E6P A;  2QC8 A;  3EC8 A;  3P42 A;  3ABV B;  4OZC A;  2KT7 A;  5BYS A;  1V49 A;  1UNS A;  1QOG A;  4ZRQ A;  2NPT B;  2KDF B;  2D2Q A;  4P6V F;  3WAL A;  2C9W B;  1HQR D;  3B2F A;  3PT2 B;  2IND C;  1XLO A;  1YOV B;  1L5P A;  1ZUD 2;  3KYC D;  4EE2 A;  4XWW A;  1NI3 A;  3A9K A;  2L05 A;  1K50 A;  4K7S A;  2JPH A;  1EUV B;  2LRW A;  4DHZ B;  2EMS A;  2FCQ A;  1T0S C;  1JWB D;  3OWE B;  3EUB 2;  4DBG A;  3T9L A;  2WXM A;  4AS1 A;  2AQ2 B;  2L76 A;  3NVZ A;  4JL9 A;  2H88 B;  4NJ6 A;  1FO4 A;  4KKJ A;  3AEA B;  1HEZ E;  2LHD A;  3IT4 B;  1ESF A;  3LDZ E;  1HTO A;  3Q8E A;  2V0G A;  2QMT A;  2RDH A;  4W9J A;  4XWT A;  1J7B A;  4LNF A;  1ZDX A;  4RGM A;  4DK5 A;  1B1Z A;  3NJT A;  5LNK 1;  2WXI A;  2J53 A;  2L83 A;  2R61 A;  2CU3 A;  4WJN A;  3B08 A;  2LEK A;  3JW0 X;  2XBB C;  3NY5 A;  5DCN A;  4L2Y A;  1EU3 A;  1PYW D;  3JVZ X;  4MEM A;  4M02 A;  1NI2 A;  1TGZ B;  2MBH A;  3A9K B;  3QJZ A;  2XNA C;  4GSW A;  2LGX A;  5JH5 C;  4RMA A;  4II2 B;  4YXD B;  4FJY A;  1P98 A;  3ZTC A;  2C5L C;  4PS7 A;  3RCZ A;  3LB8 C;  2CHX A;  2WXL A;  1KOT A;  2Y5P A;  2DZK A;  3EFC A;  3BYT B;  3RUL A;  2LUE A;  2NBV B;  3N32 A;  4TV3 A;  4C00 A;  3ALB A;  4OVV A;  2JY6 A;  1FRR A;  4FUL A;  4WJQ A;  1V97 A;  4F7Z A;  1F52 A;  3KYD D;  4MM3 B;  4WWO A;  3W1S A;  2MEK A;  1JWU D;  4HKZ E;  2IYD B;  2JF5 A;  3AEB B;  1GB4 A;  2GBR A;  1FD6 A;  3DBH I;  1RYJ A;  4YT0 B;  3HIZ A;  4GU2 A;  3B1L X;  1TS4 A;  1KFY B;  2RMM A;  1E8W A;  3AB5 A;  2AL3 A;  2REX A;  2DZJ A;  3MJW A;  3KLS X;  1JCK B;  1CMX B;  1TYG B;  4ZOH C;  5DPT A;  2C7H A;  4JWS C;  3VTW A;  2LJ5 A;  1V6E A;  3IAS 1;  1SBB B;  3ZUN A;  5BYQ A;  3RNF C;  4BBN C;  4W9E A;  2IY0 B;  1FM0 D;  1Q10 A;  3P4Q B;  1FNW A;  1YJJ A;  4YSY B;  5H92 C;  3T8M A;  4MGZ E;  3C8Y A;  1WM3 A;  4WWM A;  4LDT D;  5DPS A;  1PGA A;  5AZG A;  3N9Y C;  3DCG A;  4A8X C;  1WYG A;  4GB9 A;  2INN E;  1QZE A;  2DX5 B;  4A6Q A;  4AWJ A;  3OAW A;  2N1V A;  1MG8 A;  2K39 A;  1WFY A;  5AEK B;  1I42 A;  2ZPN A;  3Q3O C;  2D07 B;  3BZD B;  2X38 A;  4HDQ A;  3ZLZ A;  1EF1 A;  2ZZP B;  1RLF A;  4ANX A;  1WM2 A;  2JU6 X;  3RNC C;  2WGS A;  1KLU D;  3NS8 A;  2JYE A;  5G5H A;  3KUZ A;  4W9K A;  4RGT A;  4LJP B;  1V80 A;  1S1Q B;  4AOF A;  3PRM B;  4KGR A;  5E6J A;  4WH4 A;  5CHF A;  3BII D;  2OOB B;  4M01 A;  5E6O A;  3VDZ A;  1QF6 A;  4LCD E;  1AAR A;  1P7E A;  2FBW B;  2KOX A;  1UEL A;  1WR1 A;  1CK1 A;  4CHK A;  4II3 B;  2Z0E B;  4C56 C;  2INP E;  1JML A;  2M0X A;  4JQW C;  1QOB A;  3ZQ4 A;  4IM0 A;  3SD5 A;  3RNA C;  1SGH A;  4A55 A;  2BTE A;  2WX1 A;  1FXT B;  3AM9 A;  1WXA A;  2XK5 A;  2KWU B;  3BVZ A;  2KQ7 A;  3W5V B;  1DOY A;  1UWM A;  2HE7 A;  1FNV A;  2KYW A;  4RGO S;  3TSS A;  2GBJ A;  3P4P B;  2BYE A;  2UYZ B;  2J42 A;  4WWN A;  2WDV B;  1ZPS A;  4I6L B;  2WXG A;  3P4S B;  3U7D A;  4IWP A;  2CJN A;  3QWZ B;  4I6N B;  3Q6B A;  2KWD A;  4US9 A;  3TEY A;  2FAZ A;  2L7R A;  2DNF A;  4GDL A;  3DQV A;  2MCN B;  2IDY A;  3JSV A;  4FXC A;  2OED A;  2CU1 A;  1WJ4 A;  4JX1 C;  4GXB A;  1SB3 C;  4ANV A;  4GIV A;  4KZ0 A;  4RF1 A;  4MH0 E;  4IKG A;  4JE3 B;  4W9L A;  4E74 A;  3PHX B;  2IO1 B;  1ACC A;  3QX1 A;  4HKQ A;  2WNM A;  1NVI D;  4PYU A;  4REZ A;  2G4D B;  2BYV E;  1P1A A;  4ASW C;  1IPG A;  4BZA A;  1C3T A;  1XCQ L;  3AE4 B;  4NNJ B;  5EE0 A;  1QKZ A;  3LYY A;  1UZX B;  3PVL A;  5HFY A;  2K25 A;  2J0J A;  2JYT A;  5MPO A;  3IHP C;  2PVG C;  2MBO A;  1FXI A;  3ZYY X;  1GJZ A;  3PZD A;  2KO3 A;  4G3X B;  1J7A A;  1DYQ A;  2PMV A;  2BBC A;  3IG3 A;  4WAF A;  5BMI A;  1TBE A;  2NTT A;  1TKY A;  3P2B A;  5TSS A;  4GDL B;  3L17 A;  1ZDV A;  1NEN B;  2WXK A;  4C4V A;  1R4M I;  2KFJ A;  1WIA A;  2A5U A;  1CJE A;  3R7Q A;  5HHD G;  2JZZ A;  1P7F A;  3N1Y C;  3NZ3 A;  1VRA B;  3DPD A;  1T0Q C;  4BKS D;  2ZVN A;  4TSS A;  5BMG A;  4BVU C;  2QHO A;  3QAQ A;  3UIO B;  2KLC A;  1RFK A;  4WIP A;  3SU8 X;  4EZJ A;  3ZDT A;  4EFO A;  1Q5W B;  3PLU A;  4RCO A;  2LZ6 A;  2ZNV C;  3VRB B;  3H1U A;  1PDX A;  3RD2 A;  4BKS A;  1L4D B;  3FC4 A;  3KVF B;  4URK A;  2M19 A;  1E8Z A;  4MGI E;  1CQV A;  3O65 B;  4WQM A;  2KJH B;  2DYB A;  1DGJ A;  2LMC A;  3AE8 B;  1TS5 A;  1VCB A;  4XGA B;  2K9X A;  5LXI B;  4MJS B;  1I7H A;  2V3P A;  4HRS A;  3Q3N C;  1KLG D;  2NTS A;  5FR6 A;  2X8X X;  3PRP B;  3AH7 A;  3NG0 A;  2O2V B;  1F0Z A;  3M62 B;  3RN9 C;  4IM3 A;  2J0K A;  3KH0 A;  4ARI A;  1U4A A;  2W54 A;  4FAD A;  1Y56 A;  4WJP A;  4ZRP A;  1YN4 A;  3TL5 A;  1D4B A;  2MBB B;  2VH1 A;  1T0R C;  1WXQ A;  2JT4 B;  4ZRK A;  4A3O A;  1GOZ A;  2O6V A;  1K52 A;  1YN5 A;  2PE9 A;  1ET9 A;  2ZW0 A;  2K8H A;  3SEB A;  4KSK C;  4XDD A;  4LTU A;  3ZNZ B;  3ZIM A;  1KH0 A;  5G5G A;  2DZI A;  2EMT A;  1M4V A;  1N62 A;  3AUL A;  4CYE A;  3VR8 B;  1WX7 A;  1GC7 A;  1OGW A;  5C3J B;  5KHQ A;  3PO0 A;  2BYF A;  2GBN A;  2MJD A;  3QAR A;  4K81 A;  5JZE B;  2YLM A;  3AU4 A;  1EWY C;  1PFD A;  4W9D A;  2M4N A;  2I38 A;  2SEB D;  2V4L A;  4IWO A;  1E10 A;  1LFD A;  1WGG A;  3PRE A;  4MH8 A;  2L0F A;  4XE0 A;  2KFK A;  4KDI C;  1OQR A;  1ZW7 A;  4EKU A;  2BF8 B;  3BK1 A;  4P7I A;  1NYR A;  3X0W A;  2GOW A;  1VZ7 A;  2RDB C;  1D5X C;  4W9I A;  3N1X C;  1XEE A;  3M95 A;  3V3X A;  4ACF A;  1BML C;  3T3O A;  2W3S A;  2YEP B;  5IOI A;  1KRH A;  1UGJ A;  1E7P B;  2O6V B;  2G1E A;  2NMQ A;  2NBU A;  1YQ3 B;  1DOX A;  3A4R A;  1RM6 C;  3I57 A;  2G3Q B;  1ISN A;  3HM6 X;  1JWA D;  1T0Y A;  2GBK A;  1EM7 A;  5GXG B;  2DAF A;  2L8J A;  1C1Y B;  4M0W A;  1PUT A;  2EEL A;  4IC7 B;  1L0Y B;  3CST A;  3Q2A C;  4DHJ D;  1B9R A;  3VTV A;  2A4Z A;  2WXF A;  2KWC A;  1D6E C;  3Q8A A;  3OLM D;  1C4C A;  1WMH A;  5IA7 A;  1C4A A;  1WY8 A;  1WI0 A;  4EZL A;  1LM8 B;  3AED B;  1D5Z C;  2DWQ A;  4EEW A;  1OEY A;  2VH2 A;  3RNE C;  2MX2 A;  1C4P A;  3C0R B;  2K6D B;  3EGR A;  3NVW A;  2EKI A;  3V05 A;  1XT9 B;  3IBE A;  3W2D A;  4HVB A;  3AMZ A;  1L0X B;  3UI3 A;  4WUR A;  3WAM A;  2KKC A;  1YX5 B;  4IG7 B;  3NUH B;  3EA6 A;  2ZPY A;  4ZYS A;  4NPN A;  2WP9 B;  3P4R B;  2NVU I;  1WGY A;  3RFZ B;  4ZDV A;  1TIF A;  2W3R A;  1FRD A;  1WXM A;  3J9C A;  4HEA 1;  1C78 A;  1C9F A;  2FIF A;  2L00 B;  2BT6 A;  3RUI B;  2AL6 A;  2LGY A;  3ZXR A;  4DHZ E;  2KMC A;  3LXF A;  2KX0 A;  4K3C A;  2FE8 A;  1I35 A;  1MPE A;  3ZRF A;  3DBR B;  2HJ1 A;  5BMH A;  2I1K A;  3V6E B;  2QDF A;  1TKE A;  4B0E A;  2LFI A;  1E8Y A;  5EE1 A;  4GMV A;  5H8Y E;  3E56 A;  5BO4 B;  4YL8 A;  1PGX A;  4YTP B;  3APC A;  2KTR A;  3DVN V;  4GGQ A;  2KAN A;  3BVM A;  3M3J A;  3P1M A;  3E9S A;  3HK0 A;  3TJP A;  4W9G A;  4LNO A;  1JQ4 A;  3UIP B;  4NAW A;  2RPQ A;  3HRD D;  3QQ8 B;  5I4D A;  2JWU A;  4JGH B;  3A1Q A;  4OVZ A;  2N7D A;  2HD5 B;  3BVG A;  4ANW A;  4LLG M;  1MHX A;  2DZM A;  2FID A;  4XZ4 A;  2PLP A;  3L08 A;  3CMM B;  4CQN A;  3WAN A;  2N1W A;  2MP2 A;  1DOI A;  1HTQ A;  1XLN A;  2HTM E;  1UD7 A;  2DYM A;  2BQQ A;  1V5O A;  4LK0 M;  3DHH C;  1SJE D;  3M63 B;  3KWV A;  2HDE A;  3AXC A;  4MDK E;  3U30 A;  1XLQ A;  1GG3 A;  2DAJ A;  3AV8 A;  4FHJ A;  1GPX A;  1VD2 A;  1P3Q U;  3BWU D;  3SFE B;  1ENF A;  5IN7 A;  1V1P A;  5D3D A;  3VVW B;  3DBH B;  3TIX A;  2LD9 A;  2QCZ A;  1JWM D;  4NAW B;  4HCN B;  5BYR A;  3GS2 A;  2DLB A;  1ZGU B;  1XF5 L;  3A1Q B;  4XDC A;  1V86 A;  5L95 C;  4ZHO A;  3SFD B;  4FHK A;  2KK8 A;  1R4N B;  2IO0 B;  2LGI A;  3DHG C;  4MSQ B;  3DWG C;  1XD3 B;  1YQ4 B;  4KX6 B;  2GB1 A;  2KDB A;  2IGG A;  1V5T A;  1OQQ A;  4G50 A;  4MGK E;  3I3T B;  4KGS A;  1HZ6 A;  4IWQ A;  4WJO A;  2JRI B;  1T6B X;  2JZP A;  4YTM B;  1P0R A;  4USA A;  3BYY B;  3A4S C;  1BUI C;  2L52 A;  1IGC A;  2KQS A;  4TKN A;  5GMV A;  4B9K A;  2G4S A;  1Z2M A;  2BS3 B;  4A20 A;  3MHZ A;  1MG4 A;  2AQ1 B;  2B76 B;  3H7P A;  1Q0W B;  1XLP A;  2BB5 A;  4NQK E;  3U2S C;  1TKG A;  2JVC A;  2IGH A;  1E0Z A;  1WE6 A;  2GLS A;  1ET6 A;  2DEN B;  3VFK A;  2GBM A;  1TS2 A;  4G11 A;  1WE7 A;  2ZCB A;  4LDT B;  4EOY A;  5EE3 A;  2VZK D;  3DVG X;  4HPM B;  5CX3 A;  1OTR B;  1E7U A;  1HZ5 A;  1E6E B;  1QOA A;  2WXN A;  1N5X A;  3B2G A;  1L6V A;  3MC0 B;  3L13 A;  2LUM A;  3ZXV A;  1WH3 A;  3CWI A;  1T3Q A;  3EHV A;  3FIL A;  2KN4 A;  4KIK A;  3U52 E;  3DHI C;  2I2Y A;  1AYF A;  2E6X A;  1XXG A;  3H7P B;  5AZH A;  3U7Z A;  4M8N A;  1H4R A;  2JQR B;  3GP7 A;  3DVG Y;  1QQR A;  3GE3 C;  3HVZ A;  3DBL B;  2NS5 A;  4F8C B;  1HXY D;  4P16 A;  3L54 A;  4F1S A;  2OJR A;  3HHM A;  3VH4 B;  3N3K B;  1MHH E;  4E71 A;  1YJ1 A;  2GMI C;  4NY0 A;  2D3G A;  2WHI A;  4JLC A;  3AE3 B;  2XN9 C;  3TEX A;  5J18 A;  2IJ0 A;  3HVD A;  2XK5 B;  4DXF A;  1MJD A;  3L4P A;  4RNA A;  4W9H A;  2MH7 A;  2W9N A;  1Q1O A;  3EFU A;  4A3P A;  1CZP A;  4AUQ C;  2AX5 A;  4TUU A;  2KZR A;  1LGR A;  2BW2 A;  1C79 A;  1WX9 A;  4BFR A;  2Y3A A;  1E5W A;  3RNB C;  3GZN B;  2G9H D;  1E7V A;  4KIK B;  2L1A A;  1WGK A;  2J0M A;  2FCN A;  2Y5C A;  3AE5 B;  3TUO A;  2RD0 A;  4OZA A;  1ZKH A;  2MJ3 A;  3VHT C;  3PHW B;  1ROE A;  1YNT E;  4TQ1 A;  3JSV B;  2K22 A;  2UWQ A;  3DVN U;  4P1B C;  5AZF A;  1L0V B;  2WXH A;  2BKR B;  2KXJ A;  5J17 A;  1V2Y A;  1A70 A;  4W9C A;  4HXD A;  4K7U A;  3TCA A;  1NYQ A;  2CS4 A;  1X1M A;  2ZJD A;  3PS6 A;  1E90 A;  4OZB A;  4DQO C;  4NJ7 A;  5DPR A;  2M0A A;  3Q8C A;  2C60 A;  4YTN B;  5DPW A;  1IUE A;  3U4E G;  1G6J A;  2R2Q A;  1KLV A;  1WRI A;  2MW5 A;  3UQA A;  2LAS A;  1IGD A;  4FBJ B;  2N7E A;  1F9J A;  4C80 A;  3T3N A;  3N1Z C;  4N6E B;  2KAJ A;  1YN3 A;  1M94 A;  5IO9 A;  3HUI A;  2BVC A;  3MC8 A;  1VZ6 A;  3TMP B;  2ACZ B;  4FJV B;  2LGD A;  2B3A A;  2K3U A;  5C1Z A;  4RF0 A;  1F2R I;  2N9P C;  3AEC B;  4Q2J A;  2K6Q A;  1SEB D;  2CHW A;  3H9D A;  4MAC A;  1GNU A;  3MJ5 A;  4OHJ A;  1FPY A;  2IO2 B;  1L6U A;  3ZGZ A;  4AQ7 A;  4C4V B;  4HK2 A;  3SHQ A;  1L2N A;  4PT5 A;  4WWP A;  3Q8B A;  4DWF A;  2MHJ A;  2PE6 B;  2DHZ A;  4L1B A;  1I4P A;  1I4G A;  4J3O D;  4RFB A;  2WU5 B;  2MJE A;  2WX0 A;  1A5R A;  1C77 A;  2Z8L A;  5EE9 A;  2MWS B;  1GUA B;  2OHF A;  2INC C;  3AEE B;  3KWL A;  3MP9 A;  1H8C A;  2NBW B;  4KZC A;  2D11 A;  5C23 A;  1XCT L;  4H2A A;  2RDG A;  3PZ8 A;  1N61 A;  3GE8 C;  1IBX A;  3S2A A;  2YVC A;  3NVY A;  1YQB A;  3MHS D;  4EUT A;  2LJI A;  2KMA A;  5TR5 A;  3A33 B;  4PYZ A;  5FK9 C;  2BPS A;  4K3B A;  2ON8 A;  2D5G A;  2GI9 A;  3SDL C;  4KDL B;  3AN1 A;  1WGH A;  1LXD A;  4S17 A;  2KNB A;  3R2T A;  5KHO A;  3ZKJ C;  2QJL A;  1WJ6 A;  2KC2 A;  2FCM A;  2M56 B;  2WS3 B;  2IO3 B;  2WXP A;  1AW7 A;  2PPH A;  4PS8 A;  2JUO A;  2KAC A;  3UGB B;  1WWT A;  2QEJ C;  3ZO5 B;  3LJ3 A;  2AEH A;  2KHW B;  3PLV A;  4MEL A;  2HJ8 A;  3L16 A;  3AEF B;  2Q5W D;  3Q3M C;  5D6J B;  2K8B A;  4HWI B;  4M8M A;  2MA9 B;  3OJ4 B;  1P9D U;  2WU2 B;  2LVO A;  4E3C A;  4PK1 A;  1IBX B;  3PZ7 A;  1J0G A;  2KLG A;  3VTU A;  1KF6 B;  3NZU A;  5HKH A;  4MSM B;  2LI5 A;  3TEZ A;  1SIJ A;  1WF9 A;  2Z59 B;  4NQL B;  1RFA A;  4UDU C;  1GAQ B;  1JWS D;  1VLB A;  4L23 A;  4LJO B;  4HLE A;  1VZ8 A;  1JW9 D;  1J19 A;  4IOI E;  5CTR C;  2KFK B;  1FXA A;  3ZVV A;  3ML9 A;  4B6W A;  1HA5 A;  5LLI A;  1WGR A;  3QC8 B;  3RPF C;  2DYO A;  3MTN B;  2PVO D;  1OQY A;  2K1F A;  1TY2 A;  1TZ1 A;  2TSS A;  4MGY E;  2WXR A;  1WZ3 A;  4OW0 A;  2OJW A;  2MBQ A;  5CHV C;  2JRH A;  3R66 C;  1QLB B;  1E8X A;  3KUC B;  3R8B A;  3IAM 1;  2BB6 A;  3RZW C;  2KVZ A;  3KW5 B;  2CJO A;  2M8S A;  3CF6 E;  2LWP A;  3DBR I;  1LQB A;  4GLS C;  3NOB A;  4M0W B;  1D5M C;  3QIJ A;  2GRI A;  3U8Z A;  3ZTD A;  3VR9 B;  2UU7 A;  4N9F 4;  2Z0D B;  1GC6 A;  3AE1 B;  3CIR B;  2C7M B;  5AUI A;  2WDT B;  2JWZ A;  4HCP B;  2W55 A;  3IT6 B;  1EF5 A;  1V81 A;  1WGD A;  1WMH B;  3ENE A;  1NEK B;  3ZW3 A;  2K5P A;  4MM3 A;  3RI7 C;  5LXH A;  2PJH A;  1FFV A;  3VQI A;  3AEG B;  4DDI D;  2BWF A;  3KUD B;  4X57 B;  4DHJ B;  5EDS A;  5G55 A;  4CO7 A;  4HJK A;  2SAK A;  1WRD B;  2K0P A;  2JXT A;  1D3Z A;  2LHE A;  2RSU A; 
#chains in the Genus database with same CATH homology
 4TKN A;  5GMV A;  4B9K A;  2G4S A;  1TBE A;  1Z2M A;  1TTN A;  2M17 A;  4GOC A;  4GDK B;  5E6N A;  2KX3 A;  4A20 A;  3P2B A;  3QCA A;  4GDL B;  3L17 A;  3H7P A;  1Q0W B;  1SE9 A;  1HE8 A;  4ZRI A;  2LXC A;  4NQK E;  1R4M I;  2KFJ A;  1WIA A;  2BGF A;  5D2M B;  2A5U A;  2JVC A;  3R7Q A;  3NHE B;  2JZZ A;  1WE6 A;  2DEN B;  1WJU A;  3DPD A;  5L83 A;  3N30 A;  4WAA A;  3VFK A;  4BKS D;  2GBM A;  2ZVN A;  1WR6 E;  3UF8 A;  4BVU C;  1RRB A;  1JRU A;  2L3Z A;  2QHO A;  2MLB A;  2NR2 A;  3QAQ A;  4G11 A;  1WE7 A;  3W1Y A;  3UIO B;  2KLC A;  2ZCB A;  2ZEQ A;  2CHZ A;  1UBQ A;  4LDT B;  3SU8 X;  2JXX A;  5E6P A;  4EZJ A;  2AYO B;  3EC8 A;  4W9F A;  3ZDT A;  4EFO A;  1Q5W B;  2CKH B;  4EOY A;  2LVQ A;  3PLU A;  2LZ6 A;  2ZNV C;  3DVG X;  3V60 A;  1K8R B;  4HPM B;  5CX3 A;  1OTR B;  2WWZ A;  1E7U A;  3H1U A;  3RD2 A;  1V49 A;  4BKG A;  4BKS A;  2I1J A;  4KSL C;  3L0W B;  3KVF B;  4URK A;  3UQB A;  2NPT B;  1E8Z A;  4MGI E;  4BBN F;  3O65 B;  3WA0 A;  2KDF B;  2D2Q A;  3WAL A;  2KJH B;  3L13 A;  2DYB A;  1WH3 A;  2C9W B;  3PT2 B;  1VCB A;  3VUY A;  3EHV A;  5LXI B;  3KYC D;  4KIK A;  2L0T A;  2XEW A;  2KTR B;  1R4N I;  3H7P B;  5AZH A;  3A9K A;  4MJS B;  2L05 A;  4M8N A;  4K7S A;  2JPH A;  1EUV B;  1H4R A;  2LRW A;  4DHZ B;  3AU5 A;  2EMS A;  5FR6 A;  2FCQ A;  3PRP B;  3V62 A;  3DVG Y;  4EZK A;  2J7Q B;  2NS5 A;  2O2V B;  4DBG A;  4F8C B;  3T9L A;  3L54 A;  4F1S A;  2OJR A;  3HHM A;  3M62 B;  3VH4 B;  2L76 A;  3EEC A;  3QHT A;  4IM3 A;  2J0K A;  3A9J A;  4JL9 A;  3N3K B;  4E71 A;  1YJ1 A;  4NJ6 A;  2GMI C;  3KH0 A;  4NY0 A;  2CR5 A;  2D3G A;  4K1R B;  1U4A A;  3LDZ E;  4JLC A;  4FAD A;  4WJP A;  4W9J A;  3TL5 A;  5J18 A;  2MP2 B;  2ZNV B;  2FUH B;  4DK5 A;  2XK5 B;  2MBB B;  1UGM A;  4W9H A;  2W9N A;  5JHB A;  1Q1O A;  3EFU A;  2JT4 B;  1EO6 A;  4ZRK A;  4A3P A;  4A3O A;  4AUQ C;  2O6V A;  4TUU A;  5J2R A;  4WJN A;  2KZR A;  2PE9 A;  4HDO A;  3B08 A;  2K8H A;  3AI5 A;  4KSK C;  2MSE D;  3JW0 X;  1WX9 A;  2XBB C;  3NY5 A;  4FLH A;  3ZNZ B;  4BFR A;  5DCN A;  4JIO U;  4G0N B;  3ZIM A;  2DZI A;  3JVZ X;  2KD0 A;  1E5W A;  1UH6 A;  2JZ3 B;  4MEM A;  3ZNH B;  1NI2 A;  2WYQ A;  2EMT A;  4FJZ A;  1TGZ B;  3AUL A;  1E7V A;  2G45 B;  4CYE A;  4KIK B;  2MBH A;  1WX7 A;  2J0M A;  1GC7 A;  1OGW A;  2FCN A;  2RR9 A;  3ZRC A;  5KHQ A;  3A9K B;  2BYF A;  2FNJ B;  2C7N B;  2GBN A;  1ZKH A;  2RD0 A;  2Y5B B;  3QJZ A;  4FN2 A;  3QAR A;  3VHT C;  2KN5 A;  3PHW B;  4K81 A;  4TQ0 A;  5JZE B;  1S3S G;  4GSW A;  4TQ1 A;  2LGX A;  2LRU A;  2YLM A;  3AU4 A;  4RMA A;  4II2 B;  4W9D A;  5JH5 C;  2M4N A;  3JSV B;  4FJY A;  1P98 A;  2UWQ A;  2V4L A;  3DVN U;  4IWO A;  3ZTC A;  2C5L C;  2BWE S;  4PS7 A;  3RCZ A;  1LFD A;  5AZF A;  1WGG A;  3A9J B;  3PRE A;  2L0F A;  2BKR B;  2KXJ A;  2CHX A;  2KFK A;  5J17 A;  1V2Y A;  1ZW7 A;  4KDI C;  4EKU A;  2BF8 B;  4W9C A;  2DZK A;  4HXD A;  4K7U A;  3RUL A;  4P7I A;  3TCA A;  4BOZ B;  1L7Y A;  2LUE A;  2CS4 A;  1Z5S B;  2GOW A;  2NBV B;  2NCN A;  3X0W A;  1X1M A;  3D32 A;  3N32 A;  4TV3 A;  2ZJD A;  1IP9 A;  3ALB A;  3PS6 A;  4OVV A;  1E90 A;  4W9I A;  2JY6 A;  3PRZ A;  4NJ7 A;  5DPR A;  3M95 A;  3V61 A;  2C60 A;  4BKT A;  5DPW A;  4FUL A;  4WJQ A;  5D7G A;  3ZDM C;  4F7Z A;  1YD8 U;  1G6J A;  2R2Q A;  3Q3F A;  1V9J A;  1J8C A;  1KLV A;  1WX8 A;  4AP4 C;  3RYT A;  2MW5 A;  3UQA A;  2O6V B;  2VRR B;  3KYD D;  4IM2 A;  2NBU A;  3DBS A;  2LAS A;  3H6N A;  3IFW B;  4WWO A;  4FBJ B;  2N7E A;  3W1S A;  1F9J A;  3A4R A;  1OEY J;  2IYD B;  2G3Q B;  1ISN A;  2JF5 A;  3HM6 X;  1T0Y A;  2GBK A;  2GBR A;  1M94 A;  3DBH I;  4DDG D;  3PV1 A;  2DAF A;  2L8J A;  3HIZ A;  3DBL I;  3B1L X;  4GU2 A;  3PPA A;  1C1Y B;  4I6P A;  5G2N A;  4DXA B;  5IAA C;  3TMP B;  3PSE B;  3K9P B;  4FJV B;  3VUW A;  3CST A;  4IC7 B;  1E8W A;  3B0A A;  2LGD A;  4XX5 A;  4DHJ D;  2B3A A;  2MQJ A;  3VTV A;  2A4Z A;  5C1Z A;  1WXV A;  2KVR A;  2N9P C;  2AL3 A;  2K6Q A;  2KWC A;  2CHW A;  2REX A;  2DZJ A;  3GOE A;  3H9D A;  3RT3 B;  1GNU A;  1SIF A;  3OLM D;  3MJW A;  1WMH A;  2IO2 B;  4KV2 A;  5IA7 A;  4HK2 A;  2N9X A;  1WYW B;  1WY8 A;  1WI0 A;  2MRP A;  1CMX B;  3SHQ A;  4EZL A;  1L2N A;  1LM8 B;  5DPT A;  2C7H A;  4WWP A;  3VTW A;  1XQQ A;  3VH3 B;  1NDD A;  4DWF A;  2LJ5 A;  1V6E A;  4EEW A;  1OEY A;  3K9O B;  2MX2 A;  3ZUN A;  3R3M A;  4OVU A;  3C0R B;  2K6D B;  2BKF A;  4ZRJ A;  4BBN C;  2PE6 B;  4W9E A;  3ONS A;  2DHZ A;  2IY0 B;  1XT9 B;  3IBE A;  4HVB A;  3UIN B;  2WX0 A;  4IW0 A;  1A5R A;  3WAM A;  3GZN I;  3T8M A;  4MGZ E;  2MWS B;  1GUA B;  2KKC A;  1YX5 B;  4IG7 B;  1WM3 A;  4LDT D;  1H8C A;  2ZPY A;  5DPS A;  1KOT A;  2NBW B;  4KZC A;  4NPN A;  5AZG A;  2D11 A;  5C23 A;  2NVU I;  1WGY A;  3DCG A;  4ZDV A;  4GB9 A;  1QZE A;  2DX5 B;  1WXM A;  3S2A A;  2YVC A;  2FIF A;  1KJT A;  3OAW A;  2IBI B;  4AWJ A;  1WJN A;  2AWT A;  2N1V A;  1YQB A;  1MG8 A;  2K39 A;  2L00 B;  3MHS D;  3QA8 A;  4EUT A;  3RUI B;  2AL6 A;  4AJY B;  2LGY A;  2HTH A;  1WFY A;  2KMA A;  3A33 B;  2ZPN A;  4PYZ A;  5TR5 A;  5AEK B;  2D07 B;  2BPS A;  1I42 A;  4DHZ E;  4HDQ A;  2KMC A;  3ZNG C;  2KX0 A;  3WIM A;  2M1M A;  1EF1 A;  3ZLZ A;  2ZZP B;  4RM8 A;  1RLF A;  4ANX A;  1I35 A;  1WM2 A;  3ZRF A;  3PTF C;  2V3S A;  1YIW A;  2I1K A;  3NS8 A;  3RZF A;  3IVF A;  3V6E B;  3SDL C;  1PQS A;  4KDL B;  3KUZ A;  4W9K A;  1Y8R C;  1WGH A;  1LXD A;  4LJP B;  3V6C B;  1V80 A;  3H7S A;  2KNB A;  3HM3 A;  5KHO A;  1E8Y A;  3ZKJ C;  1S1Q B;  2KC1 A;  2LVP A;  2N4F A;  4GMV A;  1WJ6 A;  2KC2 A;  2FCM A;  4K7W A;  5BO4 B;  4YL8 A;  4AOF A;  3PRM B;  2IO3 B;  3APC A;  5CHF A;  2PPH A;  2OOB B;  3TBL D;  4PS8 A;  2JUO A;  2KTR A;  3UGB B;  3DVN V;  3OJ3 A;  5E6O A;  4MJS A;  4GGQ A;  2KAN A;  3VDZ A;  3ZO5 B;  3M3J A;  4LCD E;  3LJ3 A;  2AEH A;  1AAR A;  2KHW B;  3PLV A;  4MEL A;  2ZCC A;  3HK0 A;  3TJP A;  4XC2 A;  2HJ8 A;  2KOX A;  3L16 A;  3Q3J A;  4W9G A;  4B95 A;  1UEL A;  1WR1 A;  4CHK A;  5D6J B;  4II3 B;  4PS3 A;  3UIP B;  4NAW A;  2RPQ A;  2K8B A;  1UBI A;  2O2V A;  2Z0E B;  3ML8 A;  3QQ8 B;  3W1S C;  4HWI B;  4M8M A;  2MA9 B;  2KDE B;  4FA6 A;  2KJR A;  2M0X A;  4JQW C;  3JYU A;  3OJ4 B;  4JGH B;  3A1Q A;  1P9D U;  2LVO A;  2N7D A;  4E3C A;  2HD5 B;  1J0G A;  4IM0 A;  2KLG A;  3SD5 A;  4ANW A;  2DZM A;  4XZ4 A;  2FID A;  1WZ0 A;  3APD A;  3VAW A;  3VTU A;  3NZU A;  5HKH A;  3WAO A;  1SGH A;  3CMM B;  3L08 A;  4MSM B;  2WX1 A;  3WAN A;  3L10 B;  4ANU A;  2N1W A;  2K8C A;  4AJW A;  3DOW A;  1FXT B;  2LI5 A;  4KVG B;  2MP2 A;  4ICU A;  1WXA A;  2XK5 A;  1UD7 A;  2IY1 B;  2KWU B;  2DYM A;  1WF9 A;  2ASQ A;  2Z59 B;  1V5O A;  2KQ7 A;  4NQL B;  1RFA A;  3M63 B;  4LJO B;  4GN1 A;  4HLE A;  3AXC A;  2HE7 A;  4MDK E;  1J19 A;  3U30 A;  5CTR C;  2KFK B;  3ZVV A;  2GBJ A;  2BYE A;  3ML9 A;  1GG3 A;  2UYZ B;  5JHA A;  4WWN A;  3R7R A;  4B6W A;  2DAJ A;  4FHJ A;  3NZS A;  1BT0 A;  1WGR A;  4I6L B;  5LLI A;  3QC8 B;  3ZNI D;  2DYO A;  1VD2 A;  3MTN B;  4ZYN A;  3U7D A;  4IWP A;  1OQY A;  2IZV B;  1P3Q U;  2K1F A;  1TZ1 A;  3QWZ B;  4HPL B;  2LXA A;  4I6N B;  4MGY E;  4IUM B;  2KJ6 A;  1WZ3 A;  3ECI A;  2MBE A;  2FCS A;  3DDC B;  3VVW B;  2FAZ A;  4GDK A;  2L7R A;  2MBQ A;  4GDL A;  3DQV A;  2JRH A;  3R66 C;  5CHV C;  2MCN B;  3TIX A;  2LD9 A;  4NAW B;  1E8X A;  3KUC B;  3WAP A;  3JSV A;  4HCN B;  3CSF A;  3PGE A;  2CU1 A;  5D94 A;  1WJ4 A;  3RZW C;  1RAX A;  3X23 A;  1ZGU B;  3A1Q B;  3KW5 B;  4GXB A;  4ANV A;  1V86 A;  4GIV A;  4KZ0 A;  2M8S A;  5L95 C;  4MH0 E;  3VXW A;  3CF6 E;  2O6V D;  4FHK A;  2LWP A;  4W9L A;  2KK8 A;  4E74 A;  3PHX B;  3DBR I;  1LQB A;  2IO0 B;  2IO1 B;  3QX1 A;  5CHW A;  4WQO B;  3NOB A;  4M0W B;  4MSQ B;  2ZVO A;  3QIJ A;  3U8Z A;  1XD3 B;  4PYU A;  3ZTD A;  2N9E B;  2G4D B;  2BYV E;  1P1A A;  4N9F 4;  1IPG A;  2KDB A;  1GC6 A;  2Z0D B;  4ASW C;  4NNJ B;  1C3T A;  2C7M B;  1V5T A;  2WDT B;  2JWZ A;  4HCP B;  1UZX B;  1NBF C;  3PVL A;  1IYF A;  1EF5 A;  2K25 A;  2J0J A;  2KDI A;  4RM9 A;  4G50 A;  1V81 A;  4MGK E;  1WGD A;  3I3T B;  1WMH B;  3ENE A;  2V1Y A;  3ZW3 A;  3IHP C;  1WXS A;  4ICV A;  4MM3 A;  2MBO A;  2R2O A;  2KWV B;  3VUX A;  5LXH A;  2PJH A;  2KTF A;  4IWQ A;  3VQI A;  4DDI D;  2EKE C;  4WJO A;  1GJZ A;  4J6I A;  2JRI B;  2BWF A;  2NPT A;  3QK0 A;  1YX6 B;  3KUD B;  3PZD A;  4X57 B;  3BY4 B;  4DHJ B;  5G55 A;  4CO7 A;  4HJK A;  5EDS A;  2KO3 A;  4G3X B;  1WRD B;  2D10 A;  3BIN A;  1P0R A;  2PEA A;  1D3Z A;  3A4S C;  2RGF A;  4BOS C;  1KM7 A;  2KQS A;  3IG3 A;  3APF A;  2RSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...