4WJQA

Crystal structure of sumo1 in complex with daxx
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 19
structure length 78
sequence length 78
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjqA00
2AYOB 3ZW3A 1WJ6A 2AL6A 4GXBA 4PS8A 1G6JA 3VUWA 3L08A 3DCGA 1WRDB 4NNJB 3X0WA 3VUYA 2BF8B 3ZDMC 1C3TA 2KVRA 2V4LA 2KLCA 4NPNA 2KKCA 3PLVA 3ZNZB 4WAAA 2ZCBA 3A4RA 4MSMB 4AWJA 3KUCB 2CU1A 3GOEA 3P2BA 5L83A 4G0NB 1QZEA 3Q3JA 3H6NA 5CHFA 3BINA 1OEYA 2KFJA 2DYOA 4FLHA 2GBJA 2BGFA 1LQBA 2XK5B 1YQBA 2M0XA 2G3QB 3T9LA 3TCAA 3ML9A 3A9KA 2DAJA 1V6EA 2ZZPB 1WZ3A 4LJOB 3VAWA 5JHBA 3HM3A 2OOBB 2NBVB 2WWZA 4MJSB 2C9WB 2K39A 3VHTC 2O6VA 1HE8A 1UELA 2WX0A 1WGRA 5C23A 3APCA 1UGMA 4NAWB 5JZEB 4AJWA 2JY6A 2FCMA 1KM7A 3KYCD 4W9KA 3WAOA 1V81A 4W9IA 2V1YA 4MDKE 3ZTDA 2D07B 3OJ4B 1F9JA 4IWPA 4B95A 1J19A 3ZDTA 2BYEA 2K25A 4WWOA 4IM3A 3QHTA 5E6PA 1E8YA 4K81A 3A1QA 4II2B 4NY0A 4FADA 3PRZA 1VD2A 3RZWC 3ENEA 1UBQA 3ZIMA 2AEHA 3ALBA 3L54A 3RULA 2C7NB 4M8NA 2DYBA 2UYZB 4EZLA 5JH5C 1YX5B 2BKRB 2C7MB 2FCSA 1CMXB 1SIFA 4ZRIA 1UH6A 2B3AA 3CMMB 5GMVA 2G4SA 2ZVOA 3AU5A 2DENB 1WGHA 1UD7A 2MW5A 4TQ1A 1RAXA 3PTFC 2YVCA 4GIVA 4EFOA 3PVLA 3C0RB 3DVGX 2KTRB 2FAZA 2ZNVB 1EUVB 3A9KB 3V60A 1WY8A 3DDCB 5BO4B 1M94A 2LASA 3TJPA 1D3ZA 2EKEC 5J2RA 2QHOA 4TV3A 1E8XA 2O6VB 2MQJA 4PYZA 4LDTD 1GC6A 3TIXA 1WJ4A 3SU8X 5JHAA 2ZNVC 3R3MA 4KZ0A 5AEKB 2YLMA 2XK5A 4F8CB 2M8SA 1V5TA 2LGYA 1WXVA 4DXAB 3W1SA 2LD9A 2IY0B 3CSFA 3KW5B 3MTNB 2N9XA 4LJPB 2KQSA 2D10A 3QK0A 2K6QA 3NHEB 4IWQA 1GJZA 4HVBA 3VFKA 4K7SA 4KVGB 3PZDA 3S2AA 3VQIA 2JVCA 1IPGA 4GDKA 4DK5A 4EZJA 3R66C 3L10B 1ZGUB 3VVWB 1UZXB 2BPSA 2KHWB 4X57B 3U8ZA 4HCPB 4E3CA 1KLVA 1PQSA 3VUXA 4WQOB 1H8CA 1RRBA 2KDBA 2KXJA 2C7HA 2ZCCA 1XT9B 2L8JA 2NPTA 2PPHA 4MGKE 2K6DB 4KSKC 3QAQA 4M8MA 4YL8A 2AL3A 3N30A 2HE7A 4XX5A 2KANA 2N1WA 3PLUA 2Z0DB 4WWNA 3IFWB 4GMVA 4F1SA 1ZKHA 2KTFA 2O6VD 4TQ0A 3DVNV 2K8HA 4I6PA 2MWSB 3PT2B 1P0RA 2LRUA 3L17A 3V61A 4WJPA 2D3GA 4PYUA 2EMTA 2IO2B 2BYFA 4EUTA 1WM2A 3KUZA 2A4ZA 3ZNGC 4PS3A 4BKTA 5DPWA 1V9JA 1R4NI 2OJRA 4IC7B 1WGGA 5CHVC 5IA7A 2Z59B 3CF6E 2KLGA 2W9NA 2DAFA 2DZKA 3TBLD 3ZNHB 2J0KA 4TUUA 2JXXA 3PRPB 5DPRA 4BKSA 2O2VA 4K1RB 4KSLC 3OJ3A 2BWFA 4IW0A 2DZJA 2Z0EB 4FN2A 1EF1A 4EKUA 1XD3B 4DDGD 3H7PB 3LJ3A 1U4AA 1WX8A 4RMAA 3PPAA 4CO7A 2FCQA 2EMSA 2G4DB 4HDOA 1TZ1A 5IAAC 3QC8B 4ASWC 3DPDA 3NY5A 4FULA 1WXMA 2LXCA 4DHJB 5LXIB 2ZEQA 2PEAA 3L16A 2FNJB 4ICVA 3ZLZA 4BKSD 1IYFA 1GUAB 5KHQA 2N9PC 1I35A 4G50A 1WF9A 3PREA 3AULA 2HD5B 1WYWB 3DBHI 3RT3B 4EOYA 4PS7A 3V6CB 3RZFA 5LXHA 2MBQA 3DVNU 3M3JA 2I1KA 3HM6X 4MGYE 3U30A 4WJNA 5G2NA 3ZRFA 4ZRJA 1LXDA 2N7DA 2L3ZA 5J18A 2GBNA 1WXSA 2JZZA 4XC2A 2MCNB 3VTWA 1OGWA 4ANUA 2K8CA 2NS5A 1WR6E 2KDIA 4HXDA 2M17A 2PJHA 3AXCA 3VH3B 2ZJDA 3ML8A 3QCAA 2JF5A 4CYEA 4HPMB 3DBRI 4KIKA 4NQKE 3T8MA 4RM8A 4FA6A 2L00B 3KYDD 4ANWA 2KWUB 2ZPYA 2C60A 1LFDA 1FXTB 4GN1A 3PSEB 2FIDA 3UINB 5DPTA 1XQQA 3UIOB 1AARA 2GBMA 3KH0A 2MP2A 2MRPA 2K1FA 2G45B 3N3KB 1E8WA 4FJVB 2KK8A 3H7SA 1J8CA 2Y5BB 1WGYA 4LDTB 4BBNF 4FHJA 2GBRA 1NDDA 4K7WA 5DPSA 2KDFB 2NR2A 3IBEA 4OVUA 1ISNA 2AWTA 4AJYB 4P7IA 4HLEA 2KJRA 2GMIC 1NBFC 4HCNB 4MH0E 1Z5SB 2MSED 2KX0A 3ZKJC 2O2VB 2RPQA 1P9DU 4BKGA 1GNUA 1H4RA 3ZTCA 4AP4C 4HDQA 1V80A 1V49A 2KJ6A 1YD8U 3IG3A 3DVGY 5D94A 3H7PA 1WM3A 4ZYNA 4FJZA 4A3OA 2UWQA 1NI2A 1A5RA 2L7RA 1SE9A 3A4SC 2IBIB 3WA0A 4JQWC 3I3TB 4F7ZA 3PV1A 4HWIB 4W9FA 3JW0X 2MLBA 4W9EA 3SDLC 4ANVA 1WJUA 1WMHA 2CS4A 3QX1A 1X1MA 3PS6A 2LGDA 1BT0A 3EECA 2L0FA 2KZRA 2L76A 2RSUA 3MJWA 3APDA 4J6IA 2GBKA 2MA9B 3AU4A 2IYDB 4FHKA 4K7UA 4BBNC 2IY1B 3WALA 4B6WA 3EFUA 1OEYJ 2N4FA 4BOZB 3O65B 2IO3B 3M63B 1YX6B 3M62B 2RD0A 3QIJA 3HIZA 2R2OA 4IM0A 4DDID 2KX3A 2C5LC 2HTHA 2KMCA 2NPTB 4KDIC 1E7VA 1LM8B 5DCNA 2LRWA 3UF8A 1WR1A 1WZ0A 2KC1A 2DYMA 1GG3A 5FR6A 2KD0A 4AOFA 3PGEA 1YJ1A 1WH3A 4IM2A 2DX5B 1E90A 1UBIA 4G3XB 2WDTB 4W9HA 2XEWA 3B08A 4FJYA 3W1SC 3JSVA 2LI5A 4MGZE 1GC7A 4EEWA 1L2NA 2HJ8A 4DWFA 2REXA 2J7QB 1JRUA 3H9DA 3N32A 4W9LA 2CHXA 3PHWB 4MELA 4ANXA 1Q0WB 1YIWA 4HPLB 4MEMA 4BFRA 3OLMD 5J17A 1WX9A 2L0TA 3IHPC 3VDZA 2CHWA 3Q3FA 4ICUA 3QQ8B 4GGQA 3ONSA 5E6NA 4ZDVA 2KO3A 4WWPA 4AUQC 4FBJB 4GDLB 5LLIA 2KFKB 2MX2A 3A9JA 1WE6A 1K8RB 4NJ6A 4E74A 1TBEA 4RM9A 2MP2B 5C1ZA 1P1AA 3IVFA 2XBBC 1P98A 2L05A 1KOTA 2RGFA 2KC2A 3HHMA 2LWPA 4ZRKA 3RUIB 4A3PA 5D7GA 3WAPA 1WE7A 2M4NA 3DBSA 2MBEA 3NZUA 2WYQA 2D2QA 1RFAA 2V3SA 3K9OB 3TMPB 4NQLB 2BWES 2ASQA 2LGXA 1OQYA 3QWZB 4KIKB 5L95C 2JUOA 3VH4B 5EDSA 3KUDB 5CHWA 4W9GA 1WXAA 4W9CA 2JZ3B 3EC8A 3V6EB 2KJHB 3NOBA 5HKHA 1MG8A 5G55A 2IO1B 5KHOA 2LVPA 1V5OA 2NBWB 3A33B 3MHSD 3ZO5B 3UQAA 4LCDE 3HK0A 2LXAA 3CSTA 4N9F4 3ZVVA 4TKNA 4URKA 3NS8A 5CTRC 3QARA 1Y8RC 1Q5WB 3U7DA 4MJSA 2MBOA 1WMHB 2ZPNA 1I42A 2KNBA 2LZ6A 1TGZB 3JVZX 3OAWA 4A20A 1ZW7A 3DQVA 4JLCA 1J0GA 5D2MB 2IZVB 3RCZA 3PRMB 5AZHA 4GOCA 3JSVB 3ZUNA 1WI0A 1WIAA 3L13A 2JRHA 2VRRB 2KOXA 1S1QB 2KWCA 2DZIA 2DZMA 1WGDA 4E71A 2MBBB 2PE9A 2WX1A 1T0YA 2J0JA 3SHQA 4B9KA 1WFYA 4KDLB 1E5WA 5E6OA 3WIMA 1Z2MA 2JT4B 2KWVB 2K8BA 3M95A 5TR5A 4EZKA 3H1UA 4W9JA 4I6LB 2PE6B 4DBGA 4KZCA 4M0WB 3X23A 2R2QA 2M1MA 2KFKA 3EHVA 3V62A 4DHJD 4XZ4A 4IG7B 1E8ZA 3GZNI 4HK2A 2LVOA 4CHKA 2FIFA 3WAMA 2KN5A 4DHZE 2BYVE 1E7UA 4BOSC 4NJ7A 3VTUA 2LUEA 3ZRCA 4BVUC 2J0MA 2A5UA 3LDZE 2LVQA 4I6NB 2BKFA 2CKHB 4IUMB 1V2YA 4MGIE 4JIOU 3TL5A 1VCBA 2KDEB 3VXWA 3W1YA 2N1VA 2ZVNA 2KTRA 2NVUI 3B0AA 3B1LX 1EO6A 4GU2A 2FUHB 4OVVA 2NCNA 3KVFB 3R7QA 1S3SG 3APFA 1SGHA 3JYUA 2JRIB 4GDKB 3UQBA 2I1JA 3RD2A 2CHZA 4WJOA 2NBUA 4WJQA 3QJZA 3QA8A 4HJKA 5AZFA 1C1YB 4JL9A 1OTRB 1P3QU 3DOWA 3R7RA 1WX7A 2KQ7A 3ECIA 4GSWA 4KV2A 2N7EA 3PHXB 3A1QB 3NZSA 1TTNA 5AZGA 1KJTA 1R4MI 3UIPB 2CR5A 2N9EB 2JWZA 2RR9A 3DBLI 4GDLA 3WANA 4IWOA 4MSQB 2KMAA 1IP9A 3D32A 4NAWA 1EF5A 2JPHA 3L0WB 4II3B 2DHZA 5D6JB 1V86A 4JGHB 3UGBB 2FCNA 3SD5A 4W9DA 1L7YA 2D11A 3AI5A 1WJNA 1Q1OA 3A9JB 2GOWA 4DHZB 3ZNID 3VTVA 4GB9A 3BY4B 5CX3A 3RYTA 3K9PB 4G11A 2LJ5A 4MM3A 1RLFA 2MBHA 2IO0B
chains in the Genus database with same CATH superfamily
3AEAB 1PGBA 3VR8B 5AUIA 4A8XC 3X0WA 3VUYA 4XYCA 1WGKA 4NPNA 3ZNZB 2ZCBA 3A4RA 4AWJA 1UWMA 3P2BA 1F52A 3H6NA 1YQ4B 2GBJA 1YQBA 2G3QB 2ZZPB 4S0RA 2TSSA 2PLPA 4MJSB 2O6VA 1UELA 1JROA 3DWMA 1UGMA 2JY6A 3KYCD 2BB5A 3ZTDA 4IWPA 4NJCA 1VD2A 1UBQA 1VR9A 2AEHA 1DOYA 3AEBB 2AQ3B 2FE8A 2FCSA 1CZPA 2M19A 2AX5A 2V3NA 3CMMB 1N63A 2GLSA 3PO0A 1JWUD 1UD7A 2MW5A 1RAXA 3PVLA 3C0RB 2KTRB 1L4DB 1EWCA 1YN5A 1MHXA 3AEFB 4LTUA 4P1CC 4XDDA 4LDTD 4J3OD 1GC6A 1WJ4A 3RNCC 1QQRA 1XCQL 2ZNVC 2H88B 3RMKC 2LGYA 4EE2A 3KW5B 3CSFA 4JWUC 2D10A 1C77A 2ACZB 4C80A 3PZDA 3ETRA 4HRSA 3VQIA 3OG5A 4DK5A 2WXQA 3L10B 3VVWB 4BZAA 4X57B 4HCPB 3VUXA 4WQOB 3KWVA 2ZCCA 2NPTA 2WXKA 1NYRA 4YL8A 2AL3A 2HE7A 4XX5A 2KANA 2KYWA 4OZBA 3NZ3A 2Z0DB 5BYQA 3IFWB 1MG4A 4YTMB 1ZKHA 2KTFA 2O6VD 3AE6B 4TQ0A 2K8HA 3NG0A 2MWSB 3L17A 2IO2B 3KUZA 3AE3B 2WXPA 4PS3A 4BKTA 1V9JA 1R4NI 1WGGA 5IA7A 4ACFA 3RI7C 2DAFA 2DZKA 3PZ8A 4TUUA 2WXHA 3BIID 4BKSA 2O2VA 2W3SA 4KSLC 1L0VB 5BMIA 2BWFA 4IW0A 4EKUA 1XD3B 4DDGD 1FFUA 1HA5A 4RMAA 1WX8A 5EE1A 3IT6B 4HROA 2EMSA 3QC8B 4FULA 4DHJB 2LXCA 3MJ5A 1WYGA 1SF0A 2N9PC 1XF5L 1BUIC 3DBHI 3ZJTA 2AQ1B 4MGYE 3AE9B 4ZRJA 2KT7A 2IJ0A 2L3ZA 1CJEA 2MCNB 3VTWA 4ANUA 2K8CA 3CWIA 3Q8AA 2KDIA 1ESFA 3BVMA 2PJHA 3ML8A 3QCAA 4KIKA 1D6EC 2KWUB 3E56A 1FXTB 3PSEB 3Q3NC 4IKGA 2GBMA 3KH0A 2MRPA 3N3KB 1E8WA 3AE2B 2KK8A 2GBRA 1NDDA 4K7WA 2NR2A 4AJYB 1AW7A 2VH2A 4YTPB 4MH0E 2KX0A 4ZHPA 1YD8U 4ZYNA 3DVGY 1EM7A 4A3OA 2UWQA 3A4SC 4R3DA 4F7ZA 2L52A 1QOBA 4ANVA 1X1MA 1UGJA 2L0FA 3MJWA 2MA9B 3AU4A 4K7UA 4LNNA 1QOGA 3P4SB 1YX6B 2RD0A 1C4AA 2GRIA 3J9CA 4DDID 1FMAD 4KDIC 3UF8A 2KC1A 4LNKA 1YJ1A 1V1OA 1E90A 2WXOA 2X8XX 4LNFA 1KTKA 2LI5A 2JWUA 4EEWA 2BB6A 2REXA 2LMCA 3TUOA 3VR9B 3H9DA 2CHXA 4ANXA 4HPLB 4BFRA 2PVOD 4A55A 5IOIA 4ICUA 5E6NA 1B9RA 4WWPA 4AQ7A 4GDLB 3T3NA 1TBEA 5C1ZA 2XBBC 2L05A 2KMMA 3I57A 5D7GA 1FXIA 1HTQA 3K9OB 5G5HA 1OQYA 3QWZB 3VH4B 3PZ7A 5D3IB 3V6EB 2JZ3B 4MM3B 1N62A 2IO1B 2INCC 3FAHA 4KGTA 4AS1A 4N9F4 4OW0A 2QC8A 3QARA 3GS2A 1I42A 3SFDB 2CJNA 2LZ6A 3OAWA 3DQVA 3NS1A 3WCQA 2IGHA 5IO9A 3ZUNA 1WIAA 2JRHA 3SFEB 3EFCA 2KWCA 2Y3AA 2WX1A 4B9KA 3SHQA 5E6OA 2KWVB 3M95A 5TR5A 4EZKA 3H1UA 5EE0A 2K22A 3BZDB 1E8ZA 4YSXB 2LVOA 4US9A 4CHKA 1VLBA 2KN5A 3UI3A 1E7UA 1JQ4A 1XLQA 4BVUC 3ZRCA 2IPKD 2A5UA 1M4VA 3RNEC 2CKHB 4IUMB 1RYJA 4MGIE 2BTEA 1N61A 4JIOU 2N1VA 4B0MA 2HJ1A 2FUHB 4OVVA 3APFA 4NZLB 2I1JA 4QAYA 4WJOA 5AZFA 3R7RA 1SB3C 4GSWA 2N7EA 1KJTA 3UIPB 2WXRA 2RR9A 2J53A 1IP9A 1C9FA 4II3B 1V86A 3AE5B 4W9DA 2D11A 2GOWA 3VTVA 1YN4A 3RYTA 1WJ6A 2UU7A 3L08A 4NNJB 3ZDMC 1C3TA 3GP7A 2V4LA 2KLCA 1FCCC 3PLVA 3TEWA 3GOEA 2IDYA 3RNFC 2BGFA 1LQBA 2XK5B 3TCAA 2YEPB 3ML9A 3A9KA 1ZDXA 1V6EA 2KAJA 2WDRB 5JHBA 2JYTA 2OOBB 1Q10A 3VHTC 2GI9A 1HE8A 1WGRA 2JQRB 1E9MA 3APCA 4AJWA 1TKGA 2WHIA 2X38A 4W9IA 2V1YA 1F9JA 4ZHOA 3ZDTA 2K25A 3QHTA 4RGOS 4K81A 5E6PA 4NY0A 1SJHD 4C7ZA 3RZWC 3BVZA 2WXIA 3ALBA 2D3AA 1J7CA 2C7NB 1WSPA 3SR6A 2C7MB 1CMXB 1ROEA 4ZRIA 1J7BA 1UUPA 1PYWD 3HVDA 3SEBA 2YVCA 4EFOA 3AN1A 1AYFA 2FAZA 1PDXA 2ZNVB 2EKIA 3N20C 1KRHA 1EU3A 3V60A 4L1BA 5BO4B 1M94A 2LASA 3AMZA 3TJPA 2EKEC 1NVID 4TV3A 1QF6A 2MQJA 3EA6A 3TIXA 1JW9D 3FILB 3SU8X 5JHAA 3Q8FA 2KACA 3R3MA 4KZ0A 1FCLA 1PFDA 2YLMA 2XK5A 2ZW0A 2M8SA 4DXAB 4LJPB 2N9XA 3QK0A 2K6QA 3NVVA 4KVGB 3S2AA 3HUIA 3T3OA 2B76B 4C4VA 1ZGUB 2BPSA 3U8ZA 1PQSA 4NAMA 2PVGC 1RRBA 2C7HA 1XT9B 2PPHA 3IAS1 4MGKE 1ACCA 2QCZA 2VZKD 3QAQA 4KSKC 4WIPA 4JPSA 2N1WA 4HEA1 1TIFA 2L32A 2PIAA 2L1AA 3DVNV 1FNVA 4I6PA 1N5WA 4LNOA 4PYUA 1DYQA 2A4ZA 5DPWA 3DBRB 1TKEA 3CF6E 1UWXA 2N9KA 1I4PA 1QILA 3PRPB 1YN3A 1FRRA 3OJ3A 2Z0EB 1EF1A 3NVZA 3LJ3A 2WDVB 1U4AA 1T0QC 4YSYB 2G4DB 4HDOA 5IAAC 4ZYSA 3NY5A 1WXMA 5LXIB 1XXGA 2ZEQA 3L16A 1V97A 3ZLZA 2CJOA 5KHQA 1F1HA 1WYWB 2V3PA 4PS7A 1CQVA 3RZFA 3AEDB 2MBQA 3DVNU 4WJNA 3ZJUA 5J18A 1LXDA 2GBNA 4K3CA 5G5GA 4ARIA 3Q2AC 2WP9B 2ZJDA 2KQ4X 2L00B 3KYDD 2WGSA 4GN1A 2I2YA 1XQQA 1EWYC 1KLUD 4GLSC 4P6VF 1AARA 2K1FA 4RF0A 3H7SA 1C4PA 4LDTB 4WURA 4BBNF 3LXFA 4FHJA 4RF1A 4A6QA 1TT5B 4OVUA 5E6JA 1ISNA 4HLEA 1NBFC 5T8IA 3AV8A 2O2VB 3RNBC 1P9DU 4BKGA 5BMHA 4AP4C 4HDQA 1V80A 5D94A 3H7PA 1WM3A 2MJ3A 3HRDD 2L7RA 3WA0A 3RN9C 3R2TA 2WNMA 3I3TB 4W9FA 3JW0X 3SDLC 2HDEA 2W54A 3QX1A 2LGDA 1ZXIA 3P4PB 5FK9C 4J6IA 1KF6B 2IY1B 1OEYJ 1N5XA 2N4FA 3O65B 3M63B 2RDGA 2R2OA 2WXLA 2HTHA 2NPTB 1WZ0A 5FR6A 2VZKB 1WH3A 1UBIA 2WDTB 2XEWA 2ICIA 3B08A 3W1SC 2JYEA 4MGZE 1XCTL 3VRAB 2BQQA 1SXTA 4MELA 2INDC 4MEMA 4ZOHC 2XNAC 1WX9A 1N6ZA 1K53A 1K50A 2L0TA 3Q3FA 4PK1A 3CIRB 4FXCA 4GGQA 4ZDVA 2ONQA 2LEKA 3GE8C 3AE7B 5LLIA 1IUEA 3A9JA 1WE6A 4REZA 4E74A 4RM9A 5H92C 5TSSA 2RPVA 3RNGC 1P1AA 1P98A 3R8BA 4N6EB 1I4GA 1ZP0B 1ZDVA 3HHMA 1WE7A 2M4NA 2MBEA 2WYQA 2D2QA 1RFAA 2V3SA 3TMPB 4Q2JA 4NQLB 5L95C 2NTSA 3KUDB 1E6EB 1WXAA 4W9CA 2JSVX 2V4IB 1MG8A 3Q3MC 3B2GA 3HK0A 2LXAA 3CSTA 4URKA 3W5UB 2KWDA 1GB4A 3DHIC 2ZPNA 2LHDA 1V1PA 3FKYA 1TGZB 4A20A 1QOAA 1J0GA 5D2MB 3RCZA 2MJDA 3PRMB 4GOCA 3JSVB 1WI0A 1D5ZC 1DOIA 1WGDA 4E71A 2KN4A 4KDLB 1K52A 4W9JA 1I4XA 4DBGA 4KZCA 4M0WB 3X23A 2CU3A 2R2QA 3V62A 1DOXA 1Y56A 2L83A 4XZ4A 3GZNI 4HK2A 2IGDA 2FIFA 3IT4B 4BOSC 1XLPA 4NJ7A 2LUEA 4L2YA 2BS2B 3LDZE 4H2AA 2DLBA 2BKFA 1V2YA 2PW9A 2ZVNA 2KTRA 3B1LX 4GU2A 2EELA 3KVFB 3KQ4A 4RGTA 3BWUD 4JX1C 1P3QU 3DOWA 4RFBA 3FILA 1BXTA 2KQ7A 4IDIA 2BYTA 1T0RC 5AZGA 3ZJVA 1FPYA 2CR5A 2JWZA 4GDLA 2BW2A 4ARCA 2SEBD 4IWOA 4MSQB 2KMAA 1F2RC 1KLGD 2JPHA 3L0WB 5D6JB 3W2DA 2FCNA 1MFWA 3SD5A 1Q1OA 2E3TA 1OQQA 3BY4B 2Y5PA 4CQNA 1TY2A 4BAXA 4MM3A 2J52A 4DXGA 1YJJA 2WS3B 3DHHC 4GXBA 4PS8A 3VUWA 1C78A 1ZE3D 2KVRA 1IGDA 4WAAA 4MSMB 3KUCB 1SBBB 5HI1A 1T5XD 4G0NB 1QZEA 3Q3JA 1I4RA 3BINA 3BYYB 1D5XC 3TEYA 3VAWA 3HM3A 2WWZA 2K39A 1F2RI 4JE3B 5C23A 4US8A 2VH1A 4NAWB 2WXJA 2FCMA 1KM7A 3E9SA 4MDKE 4KX6B 2D07B 4WWMA 4B95A 1J19A 1JWAD 1SEBD 4IM3A 2HTME 4II2B 1QT9A 3PRZA 1D5MC 2PTLA 4A9AA 3U7ZA 3L54A 1MPEA 4M8NA 2DYBA 4EZLA 5JH5C 1CK1A 1YX5B 1D4BA 1SIFA 1UH6A 2B3AA 3P42A 4S17A 3VRBB 2ZVOA 3AU5A 1WGHA 3PTFC 3LB8C 1TS3A 3DVGX 2QDFA 1EUVB 3A9KB 1WY8A 3DDCB 1J7AA 2QHOA 4MACA 1E8XA 1VDVA 2MHJA 2O6VB 4PYZA 3I9V1 3W5VB 1OFFA 2MH7A 5AEKB 1V5TA 3MP9A 1WXVA 1HEZE 2FUG1 2LD9A 2IY0B 3MTNB 4LLGM 2KQSA 4IWQA 1YQ3B 2LJIA 3VFKA 4K7SA 4YXDB 1IPGA 3V3XA 4GDKA 3R66C 1RWSA 1UZXB 4HKZE 2KHWB 4E3CA 4L23A 1SSNA 1KLVA 2LFIA 5BYSA 1H8CA 1FRDA 2BVCA 2KDBA 2KXJA 2W82A 1P7FA 2K6DB 3NJTA 3ZGZA 4WWNA 1YMHE 3W9CB 2WLBA 3RPFC 2FBWB 1P0RA 2LRUA 2EMTA 2BYFA 5C2TB 5CHVC 3BYTB 2Z59B 2KLGA 2W9NA 3ZNHB 3GE3C 2J0KA 5DPRA 4K1RB 3NRZA 2KDMA 1YJIA 3N1ZC 2WXMA 3AE8B 2DBYA 2RDHA 2V9HA 1TZ1A 1HXYD 1FO4A 2PEAA 2QMTA 4ICVA 2FNJB 4MT5A 1I35A 1GUAB 4G50A 3PREA 2WU5B 1HTOA 1VZ7A 2Y5CA 5LXHA 3U30A 2I1KA 1UNSA 1KH0A 5G2NA 2N7DA 1WXSA 1MJDA 1UF0A 4XC2A 3ZYYX 2NS5A 2MJEA 3VH3B 3AXCA 4CYEA 4HPMB 1FD6A 4NQKE 4FA6A 3B2FA 4OHJA 2C60A 2OHFA 2K0PA 5DPTA 1MI0A 3U2SC 1YOVB 3KLSX 4FJVB 1NI3A 3NVWA 1WGYA 4JWSC 3IBEA 2KJRA 5I4DA 2GMIC 4HCNB 3DWGC 3ZKJC 1GNUA 1H4RA 3I5JC 1V49A 2KJ6A 3IG3A 4FJZA 1TS2A 1SE9A 4A90A 2IBIB 1HZ5A 2JXTA 2SAKA 4HWIB 2MLBA 4W9EA 1WMHA 2CS4A 2WU2B 3IXSA 2KZRA 3APDA 2GBKA 2D5GA 4BBNC 3WALA 3EFUA 4D2KA 4BOZB 2IO3B 3M62B 3QIJA 3HIZA 3MC9A 4IM0A 2KMCA 1E7VA 1LM8B 2LRWA 4WAFA 1WR1A 1R4MB 3TEXA 2DYMA 1HQRD 1N60A 4IM2A 2DX5B 2WQYB 4W9HA 4FJYA 1ZPSA 3JSVA 3AM9A 1TZOA 5LNK1 1L2NA 3N9YC 4TSSA 2HJ8A 4DWFA 1XLNA 4LK0M 4KGRA 2ZW1A 3PHWB 5BMGA 1YIWA 5IKCM 2AQ2B 5EE3A 3IHPC 3QQ8B 2DWQA 4AUQC 4OVZA 3NVYA 3MHZA 1K8RB 3C19A 3IVFA 1IBXB 1KOTA 2RGFA 2KC2A 4ZRPA 3RUIB 4A3PA 5JXVA 3WAPA 2H89B 2LGIA 2QILA 2LGXA 4KIKB 1STEA 5EDSA 5CHWA 2J42A 3EC8A 5G55A 5KHOA 1V5OA 2NBWB 3UQAA 4WH4A 4LCDE 4YT0B 3ZVVA 4TKNA 5FR3A 1Y8RC 1ET6A 3U7DA 4MJSA 2Z8LA 2KNBA 3NUHB 3MFGA 1ZW7A 3Q8EA 4JLCA 4XDCA 1EU4A 5AZHA 1GB1A 1SE4A 1C79A 2J4XA 1BMLC 3EUB2 2N9LA 3L13A 3AB5A 2IGGA 1AWDA 2KOXA 1S1QB 2DZIA 2PE9A 3URYA 1T0YA 3EGRA 1JWSD 3WIMA 1RM6C 2JT4B 4C56C 1ENFA 4I6LB 1PGXA 1T6BX 5FKAC 2KFKA 4DHJD 2G1EA 1ZXHA 1HZ6A 2N0SB 1ZUD2 3VTUA 2J0MA 2R61A 5MPOA 4I6NB 3TL5A 3VXWA 2KDEB 2NVUI 3B0AA 1EO6A 1I7HA 1QKZA 2NCNA 1T3QA 2E6XA 1S3SG 4USAA 4C4VB 4HPPA 3UQBA 3RD2A 2CHZA 2NBUA 4WJQA 3QJZA 1C1YB 4JL9A 1WX7A 3PHXB 3A1QB 1TTNA 2LUMA 2N9EB 4KKIA 1GOZA 1WRIA 4NAWA 1EF5A 4JGHB 1L7YA 3AI5A 1WJNA 3A9JB 3ZNID 2BS3B 5CX3A 2M0AA 3K9PB 1ET9A 2LJ5A 2JZPA 1SE2A 2AYOB 3ZW3A 2AL6A 3P4RB 1G6JA 1C4CA 5BYRA 3DCGA 1WRDB 1QLBB 1V8CA 2BF8B 1IGCA 1P7EA 2BBCA 2KKCA 3LYYA 4XGAB 2CU1A 2K5PA 2OJWA 5L83A 5CHFA 1OEYA 2KFJA 2DYOA 4FLHA 5EE9A 2M0XA 3T9LA 2DAJA 1WZ3A 4LJOB 3U52E 5GXGB 2NBVB 2C9WB 1F77A 2WX0A 2INPE 5JZEB 1FM0D 4XE0A 4DQOC 1I4QA 3AEGB 4W9KA 1NYQA 1PGAA 2INNE 3Q3OC 3WAOA 1V81A 1GPXA 3KWLA 3OJ4B 1C76A 2BYEA 1PUTA 3C8YA 4WWOA 5AUKA 1E8YA 1R7SA 3TSSA 3A1QA 4FADA 3ENEA 3ZIMA 3RULA 1SJED 1L0YB 2UYZB 1JRPA 2BKRB 3AE4B 1FEHA 1VZ8A 4KKJA 1L5PA 4M01A 5GMVA 2G4SA 2DENB 4TQ1A 4YWGG 1XEEA 4GIVA 3N1XC 1E10A 5H8YE 3B9JA 1QOFA 1JMLA 1D3ZA 5HG2A 1RFKA 2WXGA 4M0WA 3AEEB 1VJKA 3ABVB 5J2RA 1SIJA 2QJLA 2OEDA 1ZOYB 1LGRA 4N59A 3R2IA 2V0GA 4F8CB 1R4NB 2RMMA 2WXNA 5IP4D 3W1SA 1JALA 3DBLB 3NHEB 1GJZA 4HVBA 4LNIA 1L6VA 4HJGE 2PKOA 2JVCA 1L6UA 4EZJA 4C00A 2DNFA 4TMAB 1MVKA 1KFYB 1TJEA 2L8JA 2PMVA 2BT6A 4M8MA 3N30A 3PLUA 4GMVA 3BK1A 4F1SA 3AH7A 3DBHB 3AECB 3PT2B 2BS4B 2QIEB 3V61A 4WJPA 2D3GA 4IOIE 4EUTA 1DGJA 3AE1B 1WM2A 3RNAC 3ZNGC 2OJRA 4IC7B 3TBLD 1K51A 2JXXA 4KGSA 3HVZA 2DZJA 4O1NA 4FN2A 1WWTA 1FXAA 3H7PB 4CO7A 3PPAA 2FCQA 4ASWC 3DPDA 4YTNB 4RGMA 4N58A 1VZ6A 2W3RA 4BKSD 1IYFA 1L0XB 1WF9A 3AULA 2GB1A 2HD5B 3BK2A 1TYGB 3RT3B 4EOYA 3V6CB 3M3JA 3HM6X 3ZRFA 4C7YA 2JZZA 1OGWA 4RCOA 1JWBD 1WR6E 4HXDA 2M17A 2JF5A 3DBRI 3T8MA 5IN7A 4RM8A 4ANWA 4RNAA 2ZPYA 1LFDA 4XWTA 1FNUA 1IBXA 2FIDA 3UINB 2N7JA 3MC0B 3UIOB 3V05A 1GAQB 3Q8BA 2MP2A 2W55A 3OWEB 2G45B 1AN8A 1J8CA 1TS4A 2Y5BB 5DPSA 2KDFB 4DXFA 1TKYA 2AWTA 2I38A 4P7IA 1Z5SB 2MSED 3GB1A 2RPQA 4ZRQA 3ZTCA 5HFYA 4K3BA 4XWWA 1NI2A 2MEKA 1A5RA 4JQWC 3N1YC 3PV1A 1I4HA 1VRAB 1WJUA 2LGSA 3PS6A 1BT0A 3EECA 2L76A 1B1ZA 2RSUA 4UDUC 1JCKB 2IYDB 4FHKA 4WQMA 4B6WA 1FFVA 1TY0A 1YNTE 2KX3A 1NEKB 2C5LC 2Q5WD 5DCNA 3BVGA 1GG3A 1JWMD 1V1PB 2KD0A 4AOFA 3PGEA 1E0ZA 2NTTA 3GZNB 4G3XB 1NENB 4B0EA 1GC7A 2JU6X 3Q8CA 4P16A 2J7QB 1JRUA 2QSDA 3N32A 4W9LA 1Q0WB 3OLMD 4RH6A 5J17A 4MH8A 1SE3A 3VDZA 1XO3A 2CHWA 1OQRA 3ONSA 2KO3A 3TEZA 4FBJB 2KFKB 2MX2A 1XLOA 4NJ6A 2MP2B 3I63C 2WDQB 4OZAA 4PT5A 3Q69A 3P4QB 4M00A 2LWPA 4ZRKA 1FNWA 3DBSA 3NZUA 3U4EG 1RLFA 2BWES 2ASQA 4OZCA 2JUOA 1T0SC 2RDBC 3FC4A 3IAM1 4W9GA 3Q6BA 5HKHA 2KJHB 3NOBA 1WXQA 2LVPA 3A33B 3MHSD 3ZO5B 3DHGC 1LO5D 3NS8A 5CTRC 2K3UA 1E7PB 1Q5WB 5D3DA 3O13A 4YSZB 2MBOA 1WMHB 4M02A 3JVZX 2IZVB 5HHDG 3ZXVA 1A70A 3Q14C 2XN9C 3P1MA 2VRRB 4HKQA 2DZMA 2D3BA 2MBBB 2J0JA 2K9XA 1WFYA 1E5WA 2ON8A 1Z2MA 1L4ZB 2K8BA 3MC8A 2PE6B 2M1MA 3EHVA 2NMQA 4IG7B 2G9HD 3WAMA 4DHZE 3H8HA 2BYVE 2KVZA 3P63A 2LVQA 3L4PA 1VCBA 3W1YA 1MHHE 2LHEA 2YEPF 3ZXRA 3R7QA 1SGHA 3JYUA 2JRIB 4GDKB 2WXFA 4HJKA 3QA8A 3RFZB 1OTRB 3ZQ4A 3ECIA 4KV2A 2JX5A 3NZSA 4P1BC 1R4MI 1TS5A 3DBLI 3WANA 2QEJC 3D32A 2M56B 4ITKA 2D3CA 2DHZA 3UGBB 4RGNA 5C3JB 4DHZB 4GB9A 1F0ZA 4G11A 1FIQA 2MBHA 2IO0B
chains in the Genus database with same CATH topology
2AYOB 3ZW3A 1WJ6A 2AL6A 4GXBA 4PS8A 1G6JA 3VUWA 3L08A 3DCGA 1WRDB 4NNJB 3X0WA 3VUYA 2BF8B 3ZDMC 1C3TA 2KVRA 2V4LA 2KLCA 4NPNA 2KKCA 3PLVA 3ZNZB 4WAAA 2ZCBA 3A4RA 4MSMB 4AWJA 3KUCB 2CU1A 3GOEA 3P2BA 5L83A 4G0NB 1QZEA 3Q3JA 3H6NA 5CHFA 3BINA 1OEYA 2KFJA 2DYOA 4FLHA 2GBJA 2BGFA 1LQBA 2XK5B 1YQBA 2M0XA 2G3QB 3T9LA 3TCAA 3ML9A 3A9KA 2DAJA 1V6EA 2ZZPB 1WZ3A 4LJOB 3VAWA 5JHBA 3HM3A 2OOBB 2NBVB 2WWZA 4MJSB 2C9WB 2K39A 3VHTC 2O6VA 1HE8A 1UELA 2WX0A 1WGRA 5C23A 3APCA 1UGMA 4NAWB 5JZEB 4AJWA 2JY6A 2FCMA 1KM7A 3KYCD 4W9KA 3WAOA 1V81A 4W9IA 2V1YA 4MDKE 3ZTDA 2D07B 3OJ4B 1F9JA 4IWPA 4B95A 1J19A 3ZDTA 2BYEA 2K25A 4WWOA 4IM3A 3QHTA 5E6PA 1E8YA 4K81A 3A1QA 4II2B 4NY0A 4FADA 3PRZA 1VD2A 3RZWC 3ENEA 1UBQA 3ZIMA 2AEHA 3ALBA 3L54A 3RULA 2C7NB 4M8NA 2DYBA 2UYZB 4EZLA 5JH5C 1YX5B 2BKRB 2C7MB 2FCSA 1CMXB 1SIFA 4ZRIA 1UH6A 2B3AA 3CMMB 5GMVA 2G4SA 2ZVOA 3AU5A 2DENB 1WGHA 1UD7A 2MW5A 4TQ1A 1RAXA 3PTFC 2YVCA 4GIVA 4EFOA 3PVLA 3C0RB 3DVGX 2KTRB 2FAZA 2ZNVB 1EUVB 3A9KB 3V60A 1WY8A 3DDCB 5BO4B 1M94A 2LASA 3TJPA 1D3ZA 2EKEC 5J2RA 2QHOA 4TV3A 1E8XA 2O6VB 2MQJA 4PYZA 4LDTD 1GC6A 3TIXA 1WJ4A 3SU8X 5JHAA 2ZNVC 3R3MA 4KZ0A 5AEKB 2YLMA 2XK5A 4F8CB 2M8SA 1V5TA 2LGYA 1WXVA 4DXAB 3W1SA 2LD9A 2IY0B 3CSFA 3KW5B 3MTNB 2N9XA 4LJPB 2KQSA 2D10A 3QK0A 2K6QA 3NHEB 4IWQA 1GJZA 4HVBA 3VFKA 4K7SA 4KVGB 3PZDA 3S2AA 3VQIA 2JVCA 1IPGA 4GDKA 4DK5A 4EZJA 3R66C 3L10B 1ZGUB 3VVWB 1UZXB 2BPSA 2KHWB 4X57B 3U8ZA 4HCPB 4E3CA 1KLVA 1PQSA 3VUXA 4WQOB 1H8CA 1RRBA 2KDBA 2KXJA 2C7HA 2ZCCA 1XT9B 2L8JA 2NPTA 2PPHA 4MGKE 2K6DB 4KSKC 3QAQA 4M8MA 4YL8A 2AL3A 3N30A 2HE7A 4XX5A 2KANA 2N1WA 3PLUA 2Z0DB 4WWNA 3IFWB 4GMVA 4F1SA 1ZKHA 2KTFA 2O6VD 4TQ0A 3DVNV 2K8HA 4I6PA 2MWSB 3PT2B 1P0RA 2LRUA 3L17A 3V61A 4WJPA 2D3GA 4PYUA 2EMTA 2IO2B 2BYFA 4EUTA 1WM2A 3KUZA 2A4ZA 3ZNGC 4PS3A 4BKTA 5DPWA 1V9JA 1R4NI 2OJRA 4IC7B 1WGGA 5CHVC 5IA7A 2Z59B 3CF6E 2KLGA 2W9NA 2DAFA 2DZKA 3TBLD 3ZNHB 2J0KA 4TUUA 2JXXA 3PRPB 5DPRA 4BKSA 2O2VA 4K1RB 4KSLC 3OJ3A 2BWFA 4IW0A 2DZJA 2Z0EB 4FN2A 1EF1A 4EKUA 1XD3B 4DDGD 3H7PB 3LJ3A 1U4AA 1WX8A 4RMAA 3PPAA 4CO7A 2FCQA 2EMSA 2G4DB 4HDOA 1TZ1A 5IAAC 3QC8B 4ASWC 3DPDA 3NY5A 4FULA 1WXMA 2LXCA 4DHJB 5LXIB 2ZEQA 2PEAA 3L16A 2FNJB 4ICVA 3ZLZA 4BKSD 1IYFA 1GUAB 5KHQA 2N9PC 1I35A 4G50A 1WF9A 3PREA 3AULA 2HD5B 1WYWB 3DBHI 3RT3B 4EOYA 4PS7A 3V6CB 3RZFA 5LXHA 2MBQA 3DVNU 3M3JA 2I1KA 3HM6X 4MGYE 3U30A 4WJNA 5G2NA 3ZRFA 4ZRJA 1LXDA 2N7DA 2L3ZA 5J18A 2GBNA 1WXSA 2JZZA 4XC2A 2MCNB 3VTWA 1OGWA 4ANUA 2K8CA 2NS5A 1WR6E 2KDIA 4HXDA 2M17A 2PJHA 3AXCA 3VH3B 2ZJDA 3ML8A 3QCAA 2JF5A 4CYEA 4HPMB 3DBRI 4KIKA 4NQKE 3T8MA 4RM8A 4FA6A 2L00B 3KYDD 4ANWA 2KWUB 2ZPYA 2C60A 1LFDA 1FXTB 4GN1A 3PSEB 2FIDA 3UINB 5DPTA 1XQQA 3UIOB 1AARA 2GBMA 3KH0A 2MP2A 2MRPA 2K1FA 2G45B 3N3KB 1E8WA 4FJVB 2KK8A 3H7SA 1J8CA 2Y5BB 1WGYA 4LDTB 4BBNF 4FHJA 2GBRA 1NDDA 4K7WA 5DPSA 2KDFB 2NR2A 3IBEA 4OVUA 1ISNA 2AWTA 4AJYB 4P7IA 4HLEA 2KJRA 2GMIC 1NBFC 4HCNB 4MH0E 1Z5SB 2MSED 2KX0A 3ZKJC 2O2VB 2RPQA 1P9DU 4BKGA 1GNUA 1H4RA 3ZTCA 4AP4C 4HDQA 1V80A 1V49A 2KJ6A 1YD8U 3IG3A 3DVGY 5D94A 3H7PA 1WM3A 4ZYNA 4FJZA 4A3OA 2UWQA 1NI2A 1A5RA 2L7RA 1SE9A 3A4SC 2IBIB 3WA0A 4JQWC 3I3TB 4F7ZA 3PV1A 4HWIB 4W9FA 3JW0X 2MLBA 4W9EA 3SDLC 4ANVA 1WJUA 1WMHA 2CS4A 3QX1A 1X1MA 3PS6A 2LGDA 1BT0A 3EECA 2L0FA 2KZRA 2L76A 2RSUA 3MJWA 3APDA 4J6IA 2GBKA 2MA9B 3AU4A 2IYDB 4FHKA 4K7UA 4BBNC 2IY1B 3WALA 4B6WA 3EFUA 1OEYJ 2N4FA 4BOZB 3O65B 2IO3B 3M63B 1YX6B 3M62B 2RD0A 3QIJA 3HIZA 2R2OA 4IM0A 4DDID 2KX3A 2C5LC 2HTHA 2KMCA 2NPTB 4KDIC 1E7VA 1LM8B 5DCNA 2LRWA 3UF8A 1WR1A 1WZ0A 2KC1A 2DYMA 1GG3A 5FR6A 2KD0A 4AOFA 3PGEA 1YJ1A 1WH3A 4IM2A 2DX5B 1E90A 1UBIA 4G3XB 2WDTB 4W9HA 2XEWA 3B08A 4FJYA 3W1SC 3JSVA 2LI5A 4MGZE 1GC7A 4EEWA 1L2NA 2HJ8A 4DWFA 2REXA 2J7QB 1JRUA 3H9DA 3N32A 4W9LA 2CHXA 3PHWB 4MELA 4ANXA 1Q0WB 1YIWA 4HPLB 4MEMA 4BFRA 3OLMD 5J17A 1WX9A 2L0TA 3IHPC 3VDZA 2CHWA 3Q3FA 4ICUA 3QQ8B 4GGQA 3ONSA 5E6NA 4ZDVA 2KO3A 4WWPA 4AUQC 4FBJB 4GDLB 5LLIA 2KFKB 2MX2A 3A9JA 1WE6A 1K8RB 4NJ6A 4E74A 1TBEA 4RM9A 2MP2B 5C1ZA 1P1AA 3IVFA 2XBBC 1P98A 2L05A 1KOTA 2RGFA 2KC2A 3HHMA 2LWPA 4ZRKA 3RUIB 4A3PA 5D7GA 3WAPA 1WE7A 2M4NA 3DBSA 2MBEA 3NZUA 2WYQA 2D2QA 1RFAA 2V3SA 3K9OB 3TMPB 4NQLB 2BWES 2ASQA 2LGXA 1OQYA 3QWZB 4KIKB 5L95C 2JUOA 3VH4B 5EDSA 3KUDB 5CHWA 4W9GA 1WXAA 4W9CA 2JZ3B 3EC8A 3V6EB 2KJHB 3NOBA 5HKHA 1MG8A 5G55A 2IO1B 5KHOA 2LVPA 1V5OA 2NBWB 3A33B 3MHSD 3ZO5B 3UQAA 4LCDE 3HK0A 2LXAA 3CSTA 4N9F4 3ZVVA 4TKNA 4URKA 3NS8A 5CTRC 3QARA 1Y8RC 1Q5WB 3U7DA 4MJSA 2MBOA 1WMHB 2ZPNA 1I42A 2KNBA 2LZ6A 1TGZB 3JVZX 3OAWA 4A20A 1ZW7A 3DQVA 4JLCA 1J0GA 5D2MB 2IZVB 3RCZA 3PRMB 5AZHA 4GOCA 3JSVB 3ZUNA 1WI0A 1WIAA 3L13A 2JRHA 2VRRB 2KOXA 1S1QB 2KWCA 2DZIA 2DZMA 1WGDA 4E71A 2MBBB 2PE9A 2WX1A 1T0YA 2J0JA 3SHQA 4B9KA 1WFYA 4KDLB 1E5WA 5E6OA 3WIMA 1Z2MA 2JT4B 2KWVB 2K8BA 3M95A 5TR5A 4EZKA 3H1UA 4W9JA 4I6LB 2PE6B 4DBGA 4KZCA 4M0WB 3X23A 2R2QA 2M1MA 2KFKA 3EHVA 3V62A 4DHJD 4XZ4A 4IG7B 1E8ZA 3GZNI 4HK2A 2LVOA 4CHKA 2FIFA 3WAMA 2KN5A 4DHZE 2BYVE 1E7UA 4BOSC 4NJ7A 3VTUA 2LUEA 3ZRCA 4BVUC 2J0MA 2A5UA 3LDZE 2LVQA 4I6NB 2BKFA 2CKHB 4IUMB 1V2YA 4MGIE 4JIOU 3TL5A 1VCBA 2KDEB 3VXWA 3W1YA 2N1VA 2ZVNA 2KTRA 2NVUI 3B0AA 3B1LX 1EO6A 4GU2A 2FUHB 4OVVA 2NCNA 3KVFB 3R7QA 1S3SG 3APFA 1SGHA 3JYUA 2JRIB 4GDKB 3UQBA 2I1JA 3RD2A 2CHZA 4WJOA 2NBUA 4WJQA 3QJZA 3QA8A 4HJKA 5AZFA 1C1YB 4JL9A 1OTRB 1P3QU 3DOWA 3R7RA 1WX7A 2KQ7A 3ECIA 4GSWA 4KV2A 2N7EA 3PHXB 3A1QB 3NZSA 1TTNA 5AZGA 1KJTA 1R4MI 3UIPB 2CR5A 2N9EB 2JWZA 2RR9A 3DBLI 4GDLA 3WANA 4IWOA 4MSQB 2KMAA 1IP9A 3D32A 4NAWA 1EF5A 2JPHA 3L0WB 4II3B 2DHZA 5D6JB 1V86A 4JGHB 3UGBB 2FCNA 3SD5A 4W9DA 1L7YA 2D11A 3AI5A 1WJNA 1Q1OA 3A9JB 2GOWA 4DHZB 3ZNID 3VTVA 4GB9A 3BY4B 5CX3A 3RYTA 3K9PB 4G11A 2LJ5A 4MM3A 1RLFA 2MBHA 2IO0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYO B;  3ZW3 A;  1WJ6 A;  2AL6 A;  4GXB A;  4PS8 A;  1G6J A;  3VUW A;  3L08 A;  3DCG A;  1WRD B;  4NNJ B;  3X0W A;  3VUY A;  2BF8 B;  3ZDM C;  1C3T A;  2KVR A;  2V4L A;  2KLC A;  4NPN A;  2KKC A;  3PLV A;  3ZNZ B;  4WAA A;  2ZCB A;  3A4R A;  4MSM B;  4AWJ A;  3KUC B;  2CU1 A;  3GOE A;  3P2B A;  5L83 A;  4G0N B;  1QZE A;  3Q3J A;  3H6N A;  5CHF A;  3BIN A;  1OEY A;  2KFJ A;  2DYO A;  4FLH A;  2GBJ A;  2BGF A;  1LQB A;  2XK5 B;  1YQB A;  2M0X A;  2G3Q B;  3T9L A;  3TCA A;  3ML9 A;  3A9K A;  2DAJ A;  1V6E A;  2ZZP B;  1WZ3 A;  4LJO B;  3VAW A;  5JHB A;  3HM3 A;  2OOB B;  2NBV B;  2WWZ A;  4MJS B;  2C9W B;  2K39 A;  3VHT C;  2O6V A;  1HE8 A;  1UEL A;  2WX0 A;  1WGR A;  5C23 A;  3APC A;  1UGM A;  4NAW B;  5JZE B;  4AJW A;  2JY6 A;  2FCM A;  1KM7 A;  3KYC D;  4W9K A;  3WAO A;  1V81 A;  4W9I A;  2V1Y A;  4MDK E;  3ZTD A;  2D07 B;  3OJ4 B;  1F9J A;  4IWP A;  4B95 A;  1J19 A;  3ZDT A;  2BYE A;  2K25 A;  4WWO A;  4IM3 A;  3QHT A;  5E6P A;  1E8Y A;  4K81 A;  3A1Q A;  4II2 B;  4NY0 A;  4FAD A;  3PRZ A;  1VD2 A;  3RZW C;  3ENE A;  1UBQ A;  3ZIM A;  2AEH A;  3ALB A;  3L54 A;  3RUL A;  2C7N B;  4M8N A;  2DYB A;  2UYZ B;  4EZL A;  5JH5 C;  1YX5 B;  2BKR B;  2C7M B;  2FCS A;  1CMX B;  1SIF A;  4ZRI A;  1UH6 A;  2B3A A;  3CMM B;  5GMV A;  2G4S A;  2ZVO A;  3AU5 A;  2DEN B;  1WGH A;  1UD7 A;  2MW5 A;  4TQ1 A;  1RAX A;  3PTF C;  2YVC A;  4GIV A;  4EFO A;  3PVL A;  3C0R B;  3DVG X;  2KTR B;  2FAZ A;  2ZNV B;  1EUV B;  3A9K B;  3V60 A;  1WY8 A;  3DDC B;  5BO4 B;  1M94 A;  2LAS A;  3TJP A;  1D3Z A;  2EKE C;  5J2R A;  2QHO A;  4TV3 A;  1E8X A;  2O6V B;  2MQJ A;  4PYZ A;  4LDT D;  1GC6 A;  3TIX A;  1WJ4 A;  3SU8 X;  5JHA A;  2ZNV C;  3R3M A;  4KZ0 A;  5AEK B;  2YLM A;  2XK5 A;  4F8C B;  2M8S A;  1V5T A;  2LGY A;  1WXV A;  4DXA B;  3W1S A;  2LD9 A;  2IY0 B;  3CSF A;  3KW5 B;  3MTN B;  2N9X A;  4LJP B;  2KQS A;  2D10 A;  3QK0 A;  2K6Q A;  3NHE B;  4IWQ A;  1GJZ A;  4HVB A;  3VFK A;  4K7S A;  4KVG B;  3PZD A;  3S2A A;  3VQI A;  2JVC A;  1IPG A;  4GDK A;  4DK5 A;  4EZJ A;  3R66 C;  3L10 B;  1ZGU B;  3VVW B;  1UZX B;  2BPS A;  2KHW B;  4X57 B;  3U8Z A;  4HCP B;  4E3C A;  1KLV A;  1PQS A;  3VUX A;  4WQO B;  1H8C A;  1RRB A;  2KDB A;  2KXJ A;  2C7H A;  2ZCC A;  1XT9 B;  2L8J A;  2NPT A;  2PPH A;  4MGK E;  2K6D B;  4KSK C;  3QAQ A;  4M8M A;  4YL8 A;  2AL3 A;  3N30 A;  2HE7 A;  4XX5 A;  2KAN A;  2N1W A;  3PLU A;  2Z0D B;  4WWN A;  3IFW B;  4GMV A;  4F1S A;  1ZKH A;  2KTF A;  2O6V D;  4TQ0 A;  3DVN V;  2K8H A;  4I6P A;  2MWS B;  3PT2 B;  1P0R A;  2LRU A;  3L17 A;  3V61 A;  4WJP A;  2D3G A;  4PYU A;  2EMT A;  2IO2 B;  2BYF A;  4EUT A;  1WM2 A;  3KUZ A;  2A4Z A;  3ZNG C;  4PS3 A;  4BKT A;  5DPW A;  1V9J A;  1R4N I;  2OJR A;  4IC7 B;  1WGG A;  5CHV C;  5IA7 A;  2Z59 B;  3CF6 E;  2KLG A;  2W9N A;  2DAF A;  2DZK A;  3TBL D;  3ZNH B;  2J0K A;  4TUU A;  2JXX A;  3PRP B;  5DPR A;  4BKS A;  2O2V A;  4K1R B;  4KSL C;  3OJ3 A;  2BWF A;  4IW0 A;  2DZJ A;  2Z0E B;  4FN2 A;  1EF1 A;  4EKU A;  1XD3 B;  4DDG D;  3H7P B;  3LJ3 A;  1U4A A;  1WX8 A;  4RMA A;  3PPA A;  4CO7 A;  2FCQ A;  2EMS A;  2G4D B;  4HDO A;  1TZ1 A;  5IAA C;  3QC8 B;  4ASW C;  3DPD A;  3NY5 A;  4FUL A;  1WXM A;  2LXC A;  4DHJ B;  5LXI B;  2ZEQ A;  2PEA A;  3L16 A;  2FNJ B;  4ICV A;  3ZLZ A;  4BKS D;  1IYF A;  1GUA B;  5KHQ A;  2N9P C;  1I35 A;  4G50 A;  1WF9 A;  3PRE A;  3AUL A;  2HD5 B;  1WYW B;  3DBH I;  3RT3 B;  4EOY A;  4PS7 A;  3V6C B;  3RZF A;  5LXH A;  2MBQ A;  3DVN U;  3M3J A;  2I1K A;  3HM6 X;  4MGY E;  3U30 A;  4WJN A;  5G2N A;  3ZRF A;  4ZRJ A;  1LXD A;  2N7D A;  2L3Z A;  5J18 A;  2GBN A;  1WXS A;  2JZZ A;  4XC2 A;  2MCN B;  3VTW A;  1OGW A;  4ANU A;  2K8C A;  2NS5 A;  1WR6 E;  2KDI A;  4HXD A;  2M17 A;  2PJH A;  3AXC A;  3VH3 B;  2ZJD A;  3ML8 A;  3QCA A;  2JF5 A;  4CYE A;  4HPM B;  3DBR I;  4KIK A;  4NQK E;  3T8M A;  4RM8 A;  4FA6 A;  2L00 B;  3KYD D;  4ANW A;  2KWU B;  2ZPY A;  2C60 A;  1LFD A;  1FXT B;  4GN1 A;  3PSE B;  2FID A;  3UIN B;  5DPT A;  1XQQ A;  3UIO B;  1AAR A;  2GBM A;  3KH0 A;  2MP2 A;  2MRP A;  2K1F A;  2G45 B;  3N3K B;  1E8W A;  4FJV B;  2KK8 A;  3H7S A;  1J8C A;  2Y5B B;  1WGY A;  4LDT B;  4BBN F;  4FHJ A;  2GBR A;  1NDD A;  4K7W A;  5DPS A;  2KDF B;  2NR2 A;  3IBE A;  4OVU A;  1ISN A;  2AWT A;  4AJY B;  4P7I A;  4HLE A;  2KJR A;  2GMI C;  1NBF C;  4HCN B;  4MH0 E;  1Z5S B;  2MSE D;  2KX0 A;  3ZKJ C;  2O2V B;  2RPQ A;  1P9D U;  4BKG A;  1GNU A;  1H4R A;  3ZTC A;  4AP4 C;  4HDQ A;  1V80 A;  1V49 A;  2KJ6 A;  1YD8 U;  3IG3 A;  3DVG Y;  5D94 A;  3H7P A;  1WM3 A;  4ZYN A;  4FJZ A;  4A3O A;  2UWQ A;  1NI2 A;  1A5R A;  2L7R A;  1SE9 A;  3A4S C;  2IBI B;  3WA0 A;  4JQW C;  3I3T B;  4F7Z A;  3PV1 A;  4HWI B;  4W9F A;  3JW0 X;  2MLB A;  4W9E A;  3SDL C;  4ANV A;  1WJU A;  1WMH A;  2CS4 A;  3QX1 A;  1X1M A;  3PS6 A;  2LGD A;  1BT0 A;  3EEC A;  2L0F A;  2KZR A;  2L76 A;  2RSU A;  3MJW A;  3APD A;  4J6I A;  2GBK A;  2MA9 B;  3AU4 A;  2IYD B;  4FHK A;  4K7U A;  4BBN C;  2IY1 B;  3WAL A;  4B6W A;  3EFU A;  1OEY J;  2N4F A;  4BOZ B;  3O65 B;  2IO3 B;  3M63 B;  1YX6 B;  3M62 B;  2RD0 A;  3QIJ A;  3HIZ A;  2R2O A;  4IM0 A;  4DDI D;  2KX3 A;  2C5L C;  2HTH A;  2KMC A;  2NPT B;  4KDI C;  1E7V A;  1LM8 B;  5DCN A;  2LRW A;  3UF8 A;  1WR1 A;  1WZ0 A;  2KC1 A;  2DYM A;  1GG3 A;  5FR6 A;  2KD0 A;  4AOF A;  3PGE A;  1YJ1 A;  1WH3 A;  4IM2 A;  2DX5 B;  1E90 A;  1UBI A;  4G3X B;  2WDT B;  4W9H A;  2XEW A;  3B08 A;  4FJY A;  3W1S C;  3JSV A;  2LI5 A;  4MGZ E;  1GC7 A;  4EEW A;  1L2N A;  2HJ8 A;  4DWF A;  2REX A;  2J7Q B;  1JRU A;  3H9D A;  3N32 A;  4W9L A;  2CHX A;  3PHW B;  4MEL A;  4ANX A;  1Q0W B;  1YIW A;  4HPL B;  4MEM A;  4BFR A;  3OLM D;  5J17 A;  1WX9 A;  2L0T A;  3IHP C;  3VDZ A;  2CHW A;  3Q3F A;  4ICU A;  3QQ8 B;  4GGQ A;  3ONS A;  5E6N A;  4ZDV A;  2KO3 A;  4WWP A;  4AUQ C;  4FBJ B;  4GDL B;  5LLI A;  2KFK B;  2MX2 A;  3A9J A;  1WE6 A;  1K8R B;  4NJ6 A;  4E74 A;  1TBE A;  4RM9 A;  2MP2 B;  5C1Z A;  1P1A A;  3IVF A;  2XBB C;  1P98 A;  2L05 A;  1KOT A;  2RGF A;  2KC2 A;  3HHM A;  2LWP A;  4ZRK A;  3RUI B;  4A3P A;  5D7G A;  3WAP A;  1WE7 A;  2M4N A;  3DBS A;  2MBE A;  3NZU A;  2WYQ A;  2D2Q A;  1RFA A;  2V3S A;  3K9O B;  3TMP B;  4NQL B;  2BWE S;  2ASQ A;  2LGX A;  1OQY A;  3QWZ B;  4KIK B;  5L95 C;  2JUO A;  3VH4 B;  5EDS A;  3KUD B;  5CHW A;  4W9G A;  1WXA A;  4W9C A;  2JZ3 B;  3EC8 A;  3V6E B;  2KJH B;  3NOB A;  5HKH A;  1MG8 A;  5G55 A;  2IO1 B;  5KHO A;  2LVP A;  1V5O A;  2NBW B;  3A33 B;  3MHS D;  3ZO5 B;  3UQA A;  4LCD E;  3HK0 A;  2LXA A;  3CST A;  4N9F 4;  3ZVV A;  4TKN A;  4URK A;  3NS8 A;  5CTR C;  3QAR A;  1Y8R C;  1Q5W B;  3U7D A;  4MJS A;  2MBO A;  1WMH B;  2ZPN A;  1I42 A;  2KNB A;  2LZ6 A;  1TGZ B;  3JVZ X;  3OAW A;  4A20 A;  1ZW7 A;  3DQV A;  4JLC A;  1J0G A;  5D2M B;  2IZV B;  3RCZ A;  3PRM B;  5AZH A;  4GOC A;  3JSV B;  3ZUN A;  1WI0 A;  1WIA A;  3L13 A;  2JRH A;  2VRR B;  2KOX A;  1S1Q B;  2KWC A;  2DZI A;  2DZM A;  1WGD A;  4E71 A;  2MBB B;  2PE9 A;  2WX1 A;  1T0Y A;  2J0J A;  3SHQ A;  4B9K A;  1WFY A;  4KDL B;  1E5W A;  5E6O A;  3WIM A;  1Z2M A;  2JT4 B;  2KWV B;  2K8B A;  3M95 A;  5TR5 A;  4EZK A;  3H1U A;  4W9J A;  4I6L B;  2PE6 B;  4DBG A;  4KZC A;  4M0W B;  3X23 A;  2R2Q A;  2M1M A;  2KFK A;  3EHV A;  3V62 A;  4DHJ D;  4XZ4 A;  4IG7 B;  1E8Z A;  3GZN I;  4HK2 A;  2LVO A;  4CHK A;  2FIF A;  3WAM A;  2KN5 A;  4DHZ E;  2BYV E;  1E7U A;  4BOS C;  4NJ7 A;  3VTU A;  2LUE A;  3ZRC A;  4BVU C;  2J0M A;  2A5U A;  3LDZ E;  2LVQ A;  4I6N B;  2BKF A;  2CKH B;  4IUM B;  1V2Y A;  4MGI E;  4JIO U;  3TL5 A;  1VCB A;  2KDE B;  3VXW A;  3W1Y A;  2N1V A;  2ZVN A;  2KTR A;  2NVU I;  3B0A A;  3B1L X;  1EO6 A;  4GU2 A;  2FUH B;  4OVV A;  2NCN A;  3KVF B;  3R7Q A;  1S3S G;  3APF A;  1SGH A;  3JYU A;  2JRI B;  4GDK B;  3UQB A;  2I1J A;  3RD2 A;  2CHZ A;  4WJO A;  2NBU A;  4WJQ A;  3QJZ A;  3QA8 A;  4HJK A;  5AZF A;  1C1Y B;  4JL9 A;  1OTR B;  1P3Q U;  3DOW A;  3R7R A;  1WX7 A;  2KQ7 A;  3ECI A;  4GSW A;  4KV2 A;  2N7E A;  3PHX B;  3A1Q B;  3NZS A;  1TTN A;  5AZG A;  1KJT A;  1R4M I;  3UIP B;  2CR5 A;  2N9E B;  2JWZ A;  2RR9 A;  3DBL I;  4GDL A;  3WAN A;  4IWO A;  4MSQ B;  2KMA A;  1IP9 A;  3D32 A;  4NAW A;  1EF5 A;  2JPH A;  3L0W B;  4II3 B;  2DHZ A;  5D6J B;  1V86 A;  4JGH B;  3UGB B;  2FCN A;  3SD5 A;  4W9D A;  1L7Y A;  2D11 A;  3AI5 A;  1WJN A;  1Q1O A;  3A9J B;  2GOW A;  4DHZ B;  3ZNI D;  3VTV A;  4GB9 A;  3BY4 B;  5CX3 A;  3RYT A;  3K9P B;  4G11 A;  2LJ5 A;  4MM3 A;  1RLF A;  2MBH A;  2IO0 B; 
#chains in the Genus database with same CATH topology
 3AEA B;  1PGB A;  3VR8 B;  5AUI A;  4A8X C;  3X0W A;  3VUY A;  4XYC A;  1WGK A;  4NPN A;  3ZNZ B;  2ZCB A;  3A4R A;  4AWJ A;  1UWM A;  3P2B A;  1F52 A;  3H6N A;  1YQ4 B;  2GBJ A;  1YQB A;  2G3Q B;  2ZZP B;  4S0R A;  2TSS A;  2PLP A;  4MJS B;  2O6V A;  1UEL A;  1JRO A;  3DWM A;  1UGM A;  2JY6 A;  3KYC D;  2BB5 A;  3ZTD A;  4IWP A;  4NJC A;  1VD2 A;  1UBQ A;  1VR9 A;  2AEH A;  1DOY A;  3AEB B;  2AQ3 B;  2FE8 A;  2FCS A;  1CZP A;  2M19 A;  2AX5 A;  2V3N A;  3CMM B;  1N63 A;  2GLS A;  3PO0 A;  1JWU D;  1UD7 A;  2MW5 A;  1RAX A;  3PVL A;  3C0R B;  2KTR B;  1L4D B;  1EWC A;  1YN5 A;  1MHX A;  3AEF B;  4LTU A;  4P1C C;  4XDD A;  4LDT D;  4J3O D;  1GC6 A;  1WJ4 A;  3RNC C;  1QQR A;  1XCQ L;  2ZNV C;  2H88 B;  3RMK C;  2LGY A;  4EE2 A;  3KW5 B;  3CSF A;  4JWU C;  2D10 A;  1C77 A;  2ACZ B;  4C80 A;  3PZD A;  3ETR A;  4HRS A;  3VQI A;  3OG5 A;  4DK5 A;  2WXQ A;  3L10 B;  3VVW B;  4BZA A;  4X57 B;  4HCP B;  3VUX A;  4WQO B;  3KWV A;  2ZCC A;  2NPT A;  2WXK A;  1NYR A;  4YL8 A;  2AL3 A;  2HE7 A;  4XX5 A;  2KAN A;  2KYW A;  4OZB A;  3NZ3 A;  2Z0D B;  5BYQ A;  3IFW B;  1MG4 A;  4YTM B;  1ZKH A;  2KTF A;  2O6V D;  3AE6 B;  4TQ0 A;  2K8H A;  3NG0 A;  2MWS B;  3L17 A;  2IO2 B;  3KUZ A;  3AE3 B;  2WXP A;  4PS3 A;  4BKT A;  1V9J A;  1R4N I;  1WGG A;  5IA7 A;  4ACF A;  3RI7 C;  2DAF A;  2DZK A;  3PZ8 A;  4TUU A;  2WXH A;  3BII D;  4BKS A;  2O2V A;  2W3S A;  4KSL C;  1L0V B;  5BMI A;  2BWF A;  4IW0 A;  4EKU A;  1XD3 B;  4DDG D;  1FFU A;  1HA5 A;  4RMA A;  1WX8 A;  5EE1 A;  3IT6 B;  4HRO A;  2EMS A;  3QC8 B;  4FUL A;  4DHJ B;  2LXC A;  3MJ5 A;  1WYG A;  1SF0 A;  2N9P C;  1XF5 L;  1BUI C;  3DBH I;  3ZJT A;  2AQ1 B;  4MGY E;  3AE9 B;  4ZRJ A;  2KT7 A;  2IJ0 A;  2L3Z A;  1CJE A;  2MCN B;  3VTW A;  4ANU A;  2K8C A;  3CWI A;  3Q8A A;  2KDI A;  1ESF A;  3BVM A;  2PJH A;  3ML8 A;  3QCA A;  4KIK A;  1D6E C;  2KWU B;  3E56 A;  1FXT B;  3PSE B;  3Q3N C;  4IKG A;  2GBM A;  3KH0 A;  2MRP A;  3N3K B;  1E8W A;  3AE2 B;  2KK8 A;  2GBR A;  1NDD A;  4K7W A;  2NR2 A;  4AJY B;  1AW7 A;  2VH2 A;  4YTP B;  4MH0 E;  2KX0 A;  4ZHP A;  1YD8 U;  4ZYN A;  3DVG Y;  1EM7 A;  4A3O A;  2UWQ A;  3A4S C;  4R3D A;  4F7Z A;  2L52 A;  1QOB A;  4ANV A;  1X1M A;  1UGJ A;  2L0F A;  3MJW A;  2MA9 B;  3AU4 A;  4K7U A;  4LNN A;  1QOG A;  3P4S B;  1YX6 B;  2RD0 A;  1C4A A;  2GRI A;  3J9C A;  4DDI D;  1FMA D;  4KDI C;  3UF8 A;  2KC1 A;  4LNK A;  1YJ1 A;  1V1O A;  1E90 A;  2WXO A;  2X8X X;  4LNF A;  1KTK A;  2LI5 A;  2JWU A;  4EEW A;  2BB6 A;  2REX A;  2LMC A;  3TUO A;  3VR9 B;  3H9D A;  2CHX A;  4ANX A;  4HPL B;  4BFR A;  2PVO D;  4A55 A;  5IOI A;  4ICU A;  5E6N A;  1B9R A;  4WWP A;  4AQ7 A;  4GDL B;  3T3N A;  1TBE A;  5C1Z A;  2XBB C;  2L05 A;  2KMM A;  3I57 A;  5D7G A;  1FXI A;  1HTQ A;  3K9O B;  5G5H A;  1OQY A;  3QWZ B;  3VH4 B;  3PZ7 A;  5D3I B;  3V6E B;  2JZ3 B;  4MM3 B;  1N62 A;  2IO1 B;  2INC C;  3FAH A;  4KGT A;  4AS1 A;  4N9F 4;  4OW0 A;  2QC8 A;  3QAR A;  3GS2 A;  1I42 A;  3SFD B;  2CJN A;  2LZ6 A;  3OAW A;  3DQV A;  3NS1 A;  3WCQ A;  2IGH A;  5IO9 A;  3ZUN A;  1WIA A;  2JRH A;  3SFE B;  3EFC A;  2KWC A;  2Y3A A;  2WX1 A;  4B9K A;  3SHQ A;  5E6O A;  2KWV B;  3M95 A;  5TR5 A;  4EZK A;  3H1U A;  5EE0 A;  2K22 A;  3BZD B;  1E8Z A;  4YSX B;  2LVO A;  4US9 A;  4CHK A;  1VLB A;  2KN5 A;  3UI3 A;  1E7U A;  1JQ4 A;  1XLQ A;  4BVU C;  3ZRC A;  2IPK D;  2A5U A;  1M4V A;  3RNE C;  2CKH B;  4IUM B;  1RYJ A;  4MGI E;  2BTE A;  1N61 A;  4JIO U;  2N1V A;  4B0M A;  2HJ1 A;  2FUH B;  4OVV A;  3APF A;  4NZL B;  2I1J A;  4QAY A;  4WJO A;  5AZF A;  3R7R A;  1SB3 C;  4GSW A;  2N7E A;  1KJT A;  3UIP B;  2WXR A;  2RR9 A;  2J53 A;  1IP9 A;  1C9F A;  4II3 B;  1V86 A;  3AE5 B;  4W9D A;  2D11 A;  2GOW A;  3VTV A;  1YN4 A;  3RYT A;  1WJ6 A;  2UU7 A;  3L08 A;  4NNJ B;  3ZDM C;  1C3T A;  3GP7 A;  2V4L A;  2KLC A;  1FCC C;  3PLV A;  3TEW A;  3GOE A;  2IDY A;  3RNF C;  2BGF A;  1LQB A;  2XK5 B;  3TCA A;  2YEP B;  3ML9 A;  3A9K A;  1ZDX A;  1V6E A;  2KAJ A;  2WDR B;  5JHB A;  2JYT A;  2OOB B;  1Q10 A;  3VHT C;  2GI9 A;  1HE8 A;  1WGR A;  2JQR B;  1E9M A;  3APC A;  4AJW A;  1TKG A;  2WHI A;  2X38 A;  4W9I A;  2V1Y A;  1F9J A;  4ZHO A;  3ZDT A;  2K25 A;  3QHT A;  4RGO S;  4K81 A;  5E6P A;  4NY0 A;  1SJH D;  4C7Z A;  3RZW C;  3BVZ A;  2WXI A;  3ALB A;  2D3A A;  1J7C A;  2C7N B;  1WSP A;  3SR6 A;  2C7M B;  1CMX B;  1ROE A;  4ZRI A;  1J7B A;  1UUP A;  1PYW D;  3HVD A;  3SEB A;  2YVC A;  4EFO A;  3AN1 A;  1AYF A;  2FAZ A;  1PDX A;  2ZNV B;  2EKI A;  3N20 C;  1KRH A;  1EU3 A;  3V60 A;  4L1B A;  5BO4 B;  1M94 A;  2LAS A;  3AMZ A;  3TJP A;  2EKE C;  1NVI D;  4TV3 A;  1QF6 A;  2MQJ A;  3EA6 A;  3TIX A;  1JW9 D;  3FIL B;  3SU8 X;  5JHA A;  3Q8F A;  2KAC A;  3R3M A;  4KZ0 A;  1FCL A;  1PFD A;  2YLM A;  2XK5 A;  2ZW0 A;  2M8S A;  4DXA B;  4LJP B;  2N9X A;  3QK0 A;  2K6Q A;  3NVV A;  4KVG B;  3S2A A;  3HUI A;  3T3O A;  2B76 B;  4C4V A;  1ZGU B;  2BPS A;  3U8Z A;  1PQS A;  4NAM A;  2PVG C;  1RRB A;  2C7H A;  1XT9 B;  2PPH A;  3IAS 1;  4MGK E;  1ACC A;  2QCZ A;  2VZK D;  3QAQ A;  4KSK C;  4WIP A;  4JPS A;  2N1W A;  4HEA 1;  1TIF A;  2L32 A;  2PIA A;  2L1A A;  3DVN V;  1FNV A;  4I6P A;  1N5W A;  4LNO A;  4PYU A;  1DYQ A;  2A4Z A;  5DPW A;  3DBR B;  1TKE A;  3CF6 E;  1UWX A;  2N9K A;  1I4P A;  1QIL A;  3PRP B;  1YN3 A;  1FRR A;  3OJ3 A;  2Z0E B;  1EF1 A;  3NVZ A;  3LJ3 A;  2WDV B;  1U4A A;  1T0Q C;  4YSY B;  2G4D B;  4HDO A;  5IAA C;  4ZYS A;  3NY5 A;  1WXM A;  5LXI B;  1XXG A;  2ZEQ A;  3L16 A;  1V97 A;  3ZLZ A;  2CJO A;  5KHQ A;  1F1H A;  1WYW B;  2V3P A;  4PS7 A;  1CQV A;  3RZF A;  3AED B;  2MBQ A;  3DVN U;  4WJN A;  3ZJU A;  5J18 A;  1LXD A;  2GBN A;  4K3C A;  5G5G A;  4ARI A;  3Q2A C;  2WP9 B;  2ZJD A;  2KQ4 X;  2L00 B;  3KYD D;  2WGS A;  4GN1 A;  2I2Y A;  1XQQ A;  1EWY C;  1KLU D;  4GLS C;  4P6V F;  1AAR A;  2K1F A;  4RF0 A;  3H7S A;  1C4P A;  4LDT B;  4WUR A;  4BBN F;  3LXF A;  4FHJ A;  4RF1 A;  4A6Q A;  1TT5 B;  4OVU A;  5E6J A;  1ISN A;  4HLE A;  1NBF C;  5T8I A;  3AV8 A;  2O2V B;  3RNB C;  1P9D U;  4BKG A;  5BMH A;  4AP4 C;  4HDQ A;  1V80 A;  5D94 A;  3H7P A;  1WM3 A;  2MJ3 A;  3HRD D;  2L7R A;  3WA0 A;  3RN9 C;  3R2T A;  2WNM A;  3I3T B;  4W9F A;  3JW0 X;  3SDL C;  2HDE A;  2W54 A;  3QX1 A;  2LGD A;  1ZXI A;  3P4P B;  5FK9 C;  4J6I A;  1KF6 B;  2IY1 B;  1OEY J;  1N5X A;  2N4F A;  3O65 B;  3M63 B;  2RDG A;  2R2O A;  2WXL A;  2HTH A;  2NPT B;  1WZ0 A;  5FR6 A;  2VZK B;  1WH3 A;  1UBI A;  2WDT B;  2XEW A;  2ICI A;  3B08 A;  3W1S C;  2JYE A;  4MGZ E;  1XCT L;  3VRA B;  2BQQ A;  1SXT A;  4MEL A;  2IND C;  4MEM A;  4ZOH C;  2XNA C;  1WX9 A;  1N6Z A;  1K53 A;  1K50 A;  2L0T A;  3Q3F A;  4PK1 A;  3CIR B;  4FXC A;  4GGQ A;  4ZDV A;  2ONQ A;  2LEK A;  3GE8 C;  3AE7 B;  5LLI A;  1IUE A;  3A9J A;  1WE6 A;  4REZ A;  4E74 A;  4RM9 A;  5H92 C;  5TSS A;  2RPV A;  3RNG C;  1P1A A;  1P98 A;  3R8B A;  4N6E B;  1I4G A;  1ZP0 B;  1ZDV A;  3HHM A;  1WE7 A;  2M4N A;  2MBE A;  2WYQ A;  2D2Q A;  1RFA A;  2V3S A;  3TMP B;  4Q2J A;  4NQL B;  5L95 C;  2NTS A;  3KUD B;  1E6E B;  1WXA A;  4W9C A;  2JSV X;  2V4I B;  1MG8 A;  3Q3M C;  3B2G A;  3HK0 A;  2LXA A;  3CST A;  4URK A;  3W5U B;  2KWD A;  1GB4 A;  3DHI C;  2ZPN A;  2LHD A;  1V1P A;  3FKY A;  1TGZ B;  4A20 A;  1QOA A;  1J0G A;  5D2M B;  3RCZ A;  2MJD A;  3PRM B;  4GOC A;  3JSV B;  1WI0 A;  1D5Z C;  1DOI A;  1WGD A;  4E71 A;  2KN4 A;  4KDL B;  1K52 A;  4W9J A;  1I4X A;  4DBG A;  4KZC A;  4M0W B;  3X23 A;  2CU3 A;  2R2Q A;  3V62 A;  1DOX A;  1Y56 A;  2L83 A;  4XZ4 A;  3GZN I;  4HK2 A;  2IGD A;  2FIF A;  3IT4 B;  4BOS C;  1XLP A;  4NJ7 A;  2LUE A;  4L2Y A;  2BS2 B;  3LDZ E;  4H2A A;  2DLB A;  2BKF A;  1V2Y A;  2PW9 A;  2ZVN A;  2KTR A;  3B1L X;  4GU2 A;  2EEL A;  3KVF B;  3KQ4 A;  4RGT A;  3BWU D;  4JX1 C;  1P3Q U;  3DOW A;  4RFB A;  3FIL A;  1BXT A;  2KQ7 A;  4IDI A;  2BYT A;  1T0R C;  5AZG A;  3ZJV A;  1FPY A;  2CR5 A;  2JWZ A;  4GDL A;  2BW2 A;  4ARC A;  2SEB D;  4IWO A;  4MSQ B;  2KMA A;  1F2R C;  1KLG D;  2JPH A;  3L0W B;  5D6J B;  3W2D A;  2FCN A;  1MFW A;  3SD5 A;  1Q1O A;  2E3T A;  1OQQ A;  3BY4 B;  2Y5P A;  4CQN A;  1TY2 A;  4BAX A;  4MM3 A;  2J52 A;  4DXG A;  1YJJ A;  2WS3 B;  3DHH C;  4GXB A;  4PS8 A;  3VUW A;  1C78 A;  1ZE3 D;  2KVR A;  1IGD A;  4WAA A;  4MSM B;  3KUC B;  1SBB B;  5HI1 A;  1T5X D;  4G0N B;  1QZE A;  3Q3J A;  1I4R A;  3BIN A;  3BYY B;  1D5X C;  3TEY A;  3VAW A;  3HM3 A;  2WWZ A;  2K39 A;  1F2R I;  4JE3 B;  5C23 A;  4US8 A;  2VH1 A;  4NAW B;  2WXJ A;  2FCM A;  1KM7 A;  3E9S A;  4MDK E;  4KX6 B;  2D07 B;  4WWM A;  4B95 A;  1J19 A;  1JWA D;  1SEB D;  4IM3 A;  2HTM E;  4II2 B;  1QT9 A;  3PRZ A;  1D5M C;  2PTL A;  4A9A A;  3U7Z A;  3L54 A;  1MPE A;  4M8N A;  2DYB A;  4EZL A;  5JH5 C;  1CK1 A;  1YX5 B;  1D4B A;  1SIF A;  1UH6 A;  2B3A A;  3P42 A;  4S17 A;  3VRB B;  2ZVO A;  3AU5 A;  1WGH A;  3PTF C;  3LB8 C;  1TS3 A;  3DVG X;  2QDF A;  1EUV B;  3A9K B;  1WY8 A;  3DDC B;  1J7A A;  2QHO A;  4MAC A;  1E8X A;  1VDV A;  2MHJ A;  2O6V B;  4PYZ A;  3I9V 1;  3W5V B;  1OFF A;  2MH7 A;  5AEK B;  1V5T A;  3MP9 A;  1WXV A;  1HEZ E;  2FUG 1;  2LD9 A;  2IY0 B;  3MTN B;  4LLG M;  2KQS A;  4IWQ A;  1YQ3 B;  2LJI A;  3VFK A;  4K7S A;  4YXD B;  1IPG A;  3V3X A;  4GDK A;  3R66 C;  1RWS A;  1UZX B;  4HKZ E;  2KHW B;  4E3C A;  4L23 A;  1SSN A;  1KLV A;  2LFI A;  5BYS A;  1H8C A;  1FRD A;  2BVC A;  2KDB A;  2KXJ A;  2W82 A;  1P7F A;  2K6D B;  3NJT A;  3ZGZ A;  4WWN A;  1YMH E;  3W9C B;  2WLB A;  3RPF C;  2FBW B;  1P0R A;  2LRU A;  2EMT A;  2BYF A;  5C2T B;  5CHV C;  3BYT B;  2Z59 B;  2KLG A;  2W9N A;  3ZNH B;  3GE3 C;  2J0K A;  5DPR A;  4K1R B;  3NRZ A;  2KDM A;  1YJI A;  3N1Z C;  2WXM A;  3AE8 B;  2DBY A;  2RDH A;  2V9H A;  1TZ1 A;  1HXY D;  1FO4 A;  2PEA A;  2QMT A;  4ICV A;  2FNJ B;  4MT5 A;  1I35 A;  1GUA B;  4G50 A;  3PRE A;  2WU5 B;  1HTO A;  1VZ7 A;  2Y5C A;  5LXH A;  3U30 A;  2I1K A;  1UNS A;  1KH0 A;  5G2N A;  2N7D A;  1WXS A;  1MJD A;  1UF0 A;  4XC2 A;  3ZYY X;  2NS5 A;  2MJE A;  3VH3 B;  3AXC A;  4CYE A;  4HPM B;  1FD6 A;  4NQK E;  4FA6 A;  3B2F A;  4OHJ A;  2C60 A;  2OHF A;  2K0P A;  5DPT A;  1MI0 A;  3U2S C;  1YOV B;  3KLS X;  4FJV B;  1NI3 A;  3NVW A;  1WGY A;  4JWS C;  3IBE A;  2KJR A;  5I4D A;  2GMI C;  4HCN B;  3DWG C;  3ZKJ C;  1GNU A;  1H4R A;  3I5J C;  1V49 A;  2KJ6 A;  3IG3 A;  4FJZ A;  1TS2 A;  1SE9 A;  4A90 A;  2IBI B;  1HZ5 A;  2JXT A;  2SAK A;  4HWI B;  2MLB A;  4W9E A;  1WMH A;  2CS4 A;  2WU2 B;  3IXS A;  2KZR A;  3APD A;  2GBK A;  2D5G A;  4BBN C;  3WAL A;  3EFU A;  4D2K A;  4BOZ B;  2IO3 B;  3M62 B;  3QIJ A;  3HIZ A;  3MC9 A;  4IM0 A;  2KMC A;  1E7V A;  1LM8 B;  2LRW A;  4WAF A;  1WR1 A;  1R4M B;  3TEX A;  2DYM A;  1HQR D;  1N60 A;  4IM2 A;  2DX5 B;  2WQY B;  4W9H A;  4FJY A;  1ZPS A;  3JSV A;  3AM9 A;  1TZO A;  5LNK 1;  1L2N A;  3N9Y C;  4TSS A;  2HJ8 A;  4DWF A;  1XLN A;  4LK0 M;  4KGR A;  2ZW1 A;  3PHW B;  5BMG A;  1YIW A;  5IKC M;  2AQ2 B;  5EE3 A;  3IHP C;  3QQ8 B;  2DWQ A;  4AUQ C;  4OVZ A;  3NVY A;  3MHZ A;  1K8R B;  3C19 A;  3IVF A;  1IBX B;  1KOT A;  2RGF A;  2KC2 A;  4ZRP A;  3RUI B;  4A3P A;  5JXV A;  3WAP A;  2H89 B;  2LGI A;  2QIL A;  2LGX A;  4KIK B;  1STE A;  5EDS A;  5CHW A;  2J42 A;  3EC8 A;  5G55 A;  5KHO A;  1V5O A;  2NBW B;  3UQA A;  4WH4 A;  4LCD E;  4YT0 B;  3ZVV A;  4TKN A;  5FR3 A;  1Y8R C;  1ET6 A;  3U7D A;  4MJS A;  2Z8L A;  2KNB A;  3NUH B;  3MFG A;  1ZW7 A;  3Q8E A;  4JLC A;  4XDC A;  1EU4 A;  5AZH A;  1GB1 A;  1SE4 A;  1C79 A;  2J4X A;  1BML C;  3EUB 2;  2N9L A;  3L13 A;  3AB5 A;  2IGG A;  1AWD A;  2KOX A;  1S1Q B;  2DZI A;  2PE9 A;  3URY A;  1T0Y A;  3EGR A;  1JWS D;  3WIM A;  1RM6 C;  2JT4 B;  4C56 C;  1ENF A;  4I6L B;  1PGX A;  1T6B X;  5FKA C;  2KFK A;  4DHJ D;  2G1E A;  1ZXH A;  1HZ6 A;  2N0S B;  1ZUD 2;  3VTU A;  2J0M A;  2R61 A;  5MPO A;  4I6N B;  3TL5 A;  3VXW A;  2KDE B;  2NVU I;  3B0A A;  1EO6 A;  1I7H A;  1QKZ A;  2NCN A;  1T3Q A;  2E6X A;  1S3S G;  4USA A;  4C4V B;  4HPP A;  3UQB A;  3RD2 A;  2CHZ A;  2NBU A;  4WJQ A;  3QJZ A;  1C1Y B;  4JL9 A;  1WX7 A;  3PHX B;  3A1Q B;  1TTN A;  2LUM A;  2N9E B;  4KKI A;  1GOZ A;  1WRI A;  4NAW A;  1EF5 A;  4JGH B;  1L7Y A;  3AI5 A;  1WJN A;  3A9J B;  3ZNI D;  2BS3 B;  5CX3 A;  2M0A A;  3K9P B;  1ET9 A;  2LJ5 A;  2JZP A;  1SE2 A;  2AYO B;  3ZW3 A;  2AL6 A;  3P4R B;  1G6J A;  1C4C A;  5BYR A;  3DCG A;  1WRD B;  1QLB B;  1V8C A;  2BF8 B;  1IGC A;  1P7E A;  2BBC A;  2KKC A;  3LYY A;  4XGA B;  2CU1 A;  2K5P A;  2OJW A;  5L83 A;  5CHF A;  1OEY A;  2KFJ A;  2DYO A;  4FLH A;  5EE9 A;  2M0X A;  3T9L A;  2DAJ A;  1WZ3 A;  4LJO B;  3U52 E;  5GXG B;  2NBV B;  2C9W B;  1F77 A;  2WX0 A;  2INP E;  5JZE B;  1FM0 D;  4XE0 A;  4DQO C;  1I4Q A;  3AEG B;  4W9K A;  1NYQ A;  1PGA A;  2INN E;  3Q3O C;  3WAO A;  1V81 A;  1GPX A;  3KWL A;  3OJ4 B;  1C76 A;  2BYE A;  1PUT A;  3C8Y A;  4WWO A;  5AUK A;  1E8Y A;  1R7S A;  3TSS A;  3A1Q A;  4FAD A;  3ENE A;  3ZIM A;  3RUL A;  1SJE D;  1L0Y B;  2UYZ B;  1JRP A;  2BKR B;  3AE4 B;  1FEH A;  1VZ8 A;  4KKJ A;  1L5P A;  4M01 A;  5GMV A;  2G4S A;  2DEN B;  4TQ1 A;  4YWG G;  1XEE A;  4GIV A;  3N1X C;  1E10 A;  5H8Y E;  3B9J A;  1QOF A;  1JML A;  1D3Z A;  5HG2 A;  1RFK A;  2WXG A;  4M0W A;  3AEE B;  1VJK A;  3ABV B;  5J2R A;  1SIJ A;  2QJL A;  2OED A;  1ZOY B;  1LGR A;  4N59 A;  3R2I A;  2V0G A;  4F8C B;  1R4N B;  2RMM A;  2WXN A;  5IP4 D;  3W1S A;  1JAL A;  3DBL B;  3NHE B;  1GJZ A;  4HVB A;  4LNI A;  1L6V A;  4HJG E;  2PKO A;  2JVC A;  1L6U A;  4EZJ A;  4C00 A;  2DNF A;  4TMA B;  1MVK A;  1KFY B;  1TJE A;  2L8J A;  2PMV A;  2BT6 A;  4M8M A;  3N30 A;  3PLU A;  4GMV A;  3BK1 A;  4F1S A;  3AH7 A;  3DBH B;  3AEC B;  3PT2 B;  2BS4 B;  2QIE B;  3V61 A;  4WJP A;  2D3G A;  4IOI E;  4EUT A;  1DGJ A;  3AE1 B;  1WM2 A;  3RNA C;  3ZNG C;  2OJR A;  4IC7 B;  3TBL D;  1K51 A;  2JXX A;  4KGS A;  3HVZ A;  2DZJ A;  4O1N A;  4FN2 A;  1WWT A;  1FXA A;  3H7P B;  4CO7 A;  3PPA A;  2FCQ A;  4ASW C;  3DPD A;  4YTN B;  4RGM A;  4N58 A;  1VZ6 A;  2W3R A;  4BKS D;  1IYF A;  1L0X B;  1WF9 A;  3AUL A;  2GB1 A;  2HD5 B;  3BK2 A;  1TYG B;  3RT3 B;  4EOY A;  3V6C B;  3M3J A;  3HM6 X;  3ZRF A;  4C7Y A;  2JZZ A;  1OGW A;  4RCO A;  1JWB D;  1WR6 E;  4HXD A;  2M17 A;  2JF5 A;  3DBR I;  3T8M A;  5IN7 A;  4RM8 A;  4ANW A;  4RNA A;  2ZPY A;  1LFD A;  4XWT A;  1FNU A;  1IBX A;  2FID A;  3UIN B;  2N7J A;  3MC0 B;  3UIO B;  3V05 A;  1GAQ B;  3Q8B A;  2MP2 A;  2W55 A;  3OWE B;  2G45 B;  1AN8 A;  1J8C A;  1TS4 A;  2Y5B B;  5DPS A;  2KDF B;  4DXF A;  1TKY A;  2AWT A;  2I38 A;  4P7I A;  1Z5S B;  2MSE D;  3GB1 A;  2RPQ A;  4ZRQ A;  3ZTC A;  5HFY A;  4K3B A;  4XWW A;  1NI2 A;  2MEK A;  1A5R A;  4JQW C;  3N1Y C;  3PV1 A;  1I4H A;  1VRA B;  1WJU A;  2LGS A;  3PS6 A;  1BT0 A;  3EEC A;  2L76 A;  1B1Z A;  2RSU A;  4UDU C;  1JCK B;  2IYD B;  4FHK A;  4WQM A;  4B6W A;  1FFV A;  1TY0 A;  1YNT E;  2KX3 A;  1NEK B;  2C5L C;  2Q5W D;  5DCN A;  3BVG A;  1GG3 A;  1JWM D;  1V1P B;  2KD0 A;  4AOF A;  3PGE A;  1E0Z A;  2NTT A;  3GZN B;  4G3X B;  1NEN B;  4B0E A;  1GC7 A;  2JU6 X;  3Q8C A;  4P16 A;  2J7Q B;  1JRU A;  2QSD A;  3N32 A;  4W9L A;  1Q0W B;  3OLM D;  4RH6 A;  5J17 A;  4MH8 A;  1SE3 A;  3VDZ A;  1XO3 A;  2CHW A;  1OQR A;  3ONS A;  2KO3 A;  3TEZ A;  4FBJ B;  2KFK B;  2MX2 A;  1XLO A;  4NJ6 A;  2MP2 B;  3I63 C;  2WDQ B;  4OZA A;  4PT5 A;  3Q69 A;  3P4Q B;  4M00 A;  2LWP A;  4ZRK A;  1FNW A;  3DBS A;  3NZU A;  3U4E G;  1RLF A;  2BWE S;  2ASQ A;  4OZC A;  2JUO A;  1T0S C;  2RDB C;  3FC4 A;  3IAM 1;  4W9G A;  3Q6B A;  5HKH A;  2KJH B;  3NOB A;  1WXQ A;  2LVP A;  3A33 B;  3MHS D;  3ZO5 B;  3DHG C;  1LO5 D;  3NS8 A;  5CTR C;  2K3U A;  1E7P B;  1Q5W B;  5D3D A;  3O13 A;  4YSZ B;  2MBO A;  1WMH B;  4M02 A;  3JVZ X;  2IZV B;  5HHD G;  3ZXV A;  1A70 A;  3Q14 C;  2XN9 C;  3P1M A;  2VRR B;  4HKQ A;  2DZM A;  2D3B A;  2MBB B;  2J0J A;  2K9X A;  1WFY A;  1E5W A;  2ON8 A;  1Z2M A;  1L4Z B;  2K8B A;  3MC8 A;  2PE6 B;  2M1M A;  3EHV A;  2NMQ A;  4IG7 B;  2G9H D;  3WAM A;  4DHZ E;  3H8H A;  2BYV E;  2KVZ A;  3P63 A;  2LVQ A;  3L4P A;  1VCB A;  3W1Y A;  1MHH E;  2LHE A;  2YEP F;  3ZXR A;  3R7Q A;  1SGH A;  3JYU A;  2JRI B;  4GDK B;  2WXF A;  4HJK A;  3QA8 A;  3RFZ B;  1OTR B;  3ZQ4 A;  3ECI A;  4KV2 A;  2JX5 A;  3NZS A;  4P1B C;  1R4M I;  1TS5 A;  3DBL I;  3WAN A;  2QEJ C;  3D32 A;  2M56 B;  4ITK A;  2D3C A;  2DHZ A;  3UGB B;  4RGN A;  5C3J B;  4DHZ B;  4GB9 A;  1F0Z A;  4G11 A;  1FIQ A;  2MBH A;  2IO0 B; 
#chains in the Genus database with same CATH homology
 2AYO B;  3ZW3 A;  1WJ6 A;  2AL6 A;  4GXB A;  4PS8 A;  1G6J A;  3VUW A;  3L08 A;  3DCG A;  1WRD B;  4NNJ B;  3X0W A;  3VUY A;  2BF8 B;  3ZDM C;  1C3T A;  2KVR A;  2V4L A;  2KLC A;  4NPN A;  2KKC A;  3PLV A;  3ZNZ B;  4WAA A;  2ZCB A;  3A4R A;  4MSM B;  4AWJ A;  3KUC B;  2CU1 A;  3GOE A;  3P2B A;  5L83 A;  4G0N B;  1QZE A;  3Q3J A;  3H6N A;  5CHF A;  3BIN A;  1OEY A;  2KFJ A;  2DYO A;  4FLH A;  2GBJ A;  2BGF A;  1LQB A;  2XK5 B;  1YQB A;  2M0X A;  2G3Q B;  3T9L A;  3TCA A;  3ML9 A;  3A9K A;  2DAJ A;  1V6E A;  2ZZP B;  1WZ3 A;  4LJO B;  3VAW A;  5JHB A;  3HM3 A;  2OOB B;  2NBV B;  2WWZ A;  4MJS B;  2C9W B;  2K39 A;  3VHT C;  2O6V A;  1HE8 A;  1UEL A;  2WX0 A;  1WGR A;  5C23 A;  3APC A;  1UGM A;  4NAW B;  5JZE B;  4AJW A;  2JY6 A;  2FCM A;  1KM7 A;  3KYC D;  4W9K A;  3WAO A;  1V81 A;  4W9I A;  2V1Y A;  4MDK E;  3ZTD A;  2D07 B;  3OJ4 B;  1F9J A;  4IWP A;  4B95 A;  1J19 A;  3ZDT A;  2BYE A;  2K25 A;  4WWO A;  4IM3 A;  3QHT A;  5E6P A;  1E8Y A;  4K81 A;  3A1Q A;  4II2 B;  4NY0 A;  4FAD A;  3PRZ A;  1VD2 A;  3RZW C;  3ENE A;  1UBQ A;  3ZIM A;  2AEH A;  3ALB A;  3L54 A;  3RUL A;  2C7N B;  4M8N A;  2DYB A;  2UYZ B;  4EZL A;  5JH5 C;  1YX5 B;  2BKR B;  2C7M B;  2FCS A;  1CMX B;  1SIF A;  4ZRI A;  1UH6 A;  2B3A A;  3CMM B;  5GMV A;  2G4S A;  2ZVO A;  3AU5 A;  2DEN B;  1WGH A;  1UD7 A;  2MW5 A;  4TQ1 A;  1RAX A;  3PTF C;  2YVC A;  4GIV A;  4EFO A;  3PVL A;  3C0R B;  3DVG X;  2KTR B;  2FAZ A;  2ZNV B;  1EUV B;  3A9K B;  3V60 A;  1WY8 A;  3DDC B;  5BO4 B;  1M94 A;  2LAS A;  3TJP A;  1D3Z A;  2EKE C;  5J2R A;  2QHO A;  4TV3 A;  1E8X A;  2O6V B;  2MQJ A;  4PYZ A;  4LDT D;  1GC6 A;  3TIX A;  1WJ4 A;  3SU8 X;  5JHA A;  2ZNV C;  3R3M A;  4KZ0 A;  5AEK B;  2YLM A;  2XK5 A;  4F8C B;  2M8S A;  1V5T A;  2LGY A;  1WXV A;  4DXA B;  3W1S A;  2LD9 A;  2IY0 B;  3CSF A;  3KW5 B;  3MTN B;  2N9X A;  4LJP B;  2KQS A;  2D10 A;  3QK0 A;  2K6Q A;  3NHE B;  4IWQ A;  1GJZ A;  4HVB A;  3VFK A;  4K7S A;  4KVG B;  3PZD A;  3S2A A;  3VQI A;  2JVC A;  1IPG A;  4GDK A;  4DK5 A;  4EZJ A;  3R66 C;  3L10 B;  1ZGU B;  3VVW B;  1UZX B;  2BPS A;  2KHW B;  4X57 B;  3U8Z A;  4HCP B;  4E3C A;  1KLV A;  1PQS A;  3VUX A;  4WQO B;  1H8C A;  1RRB A;  2KDB A;  2KXJ A;  2C7H A;  2ZCC A;  1XT9 B;  2L8J A;  2NPT A;  2PPH A;  4MGK E;  2K6D B;  4KSK C;  3QAQ A;  4M8M A;  4YL8 A;  2AL3 A;  3N30 A;  2HE7 A;  4XX5 A;  2KAN A;  2N1W A;  3PLU A;  2Z0D B;  4WWN A;  3IFW B;  4GMV A;  4F1S A;  1ZKH A;  2KTF A;  2O6V D;  4TQ0 A;  3DVN V;  2K8H A;  4I6P A;  2MWS B;  3PT2 B;  1P0R A;  2LRU A;  3L17 A;  3V61 A;  4WJP A;  2D3G A;  4PYU A;  2EMT A;  2IO2 B;  2BYF A;  4EUT A;  1WM2 A;  3KUZ A;  2A4Z A;  3ZNG C;  4PS3 A;  4BKT A;  5DPW A;  1V9J A;  1R4N I;  2OJR A;  4IC7 B;  1WGG A;  5CHV C;  5IA7 A;  2Z59 B;  3CF6 E;  2KLG A;  2W9N A;  2DAF A;  2DZK A;  3TBL D;  3ZNH B;  2J0K A;  4TUU A;  2JXX A;  3PRP B;  5DPR A;  4BKS A;  2O2V A;  4K1R B;  4KSL C;  3OJ3 A;  2BWF A;  4IW0 A;  2DZJ A;  2Z0E B;  4FN2 A;  1EF1 A;  4EKU A;  1XD3 B;  4DDG D;  3H7P B;  3LJ3 A;  1U4A A;  1WX8 A;  4RMA A;  3PPA A;  4CO7 A;  2FCQ A;  2EMS A;  2G4D B;  4HDO A;  1TZ1 A;  5IAA C;  3QC8 B;  4ASW C;  3DPD A;  3NY5 A;  4FUL A;  1WXM A;  2LXC A;  4DHJ B;  5LXI B;  2ZEQ A;  2PEA A;  3L16 A;  2FNJ B;  4ICV A;  3ZLZ A;  4BKS D;  1IYF A;  1GUA B;  5KHQ A;  2N9P C;  1I35 A;  4G50 A;  1WF9 A;  3PRE A;  3AUL A;  2HD5 B;  1WYW B;  3DBH I;  3RT3 B;  4EOY A;  4PS7 A;  3V6C B;  3RZF A;  5LXH A;  2MBQ A;  3DVN U;  3M3J A;  2I1K A;  3HM6 X;  4MGY E;  3U30 A;  4WJN A;  5G2N A;  3ZRF A;  4ZRJ A;  1LXD A;  2N7D A;  2L3Z A;  5J18 A;  2GBN A;  1WXS A;  2JZZ A;  4XC2 A;  2MCN B;  3VTW A;  1OGW A;  4ANU A;  2K8C A;  2NS5 A;  1WR6 E;  2KDI A;  4HXD A;  2M17 A;  2PJH A;  3AXC A;  3VH3 B;  2ZJD A;  3ML8 A;  3QCA A;  2JF5 A;  4CYE A;  4HPM B;  3DBR I;  4KIK A;  4NQK E;  3T8M A;  4RM8 A;  4FA6 A;  2L00 B;  3KYD D;  4ANW A;  2KWU B;  2ZPY A;  2C60 A;  1LFD A;  1FXT B;  4GN1 A;  3PSE B;  2FID A;  3UIN B;  5DPT A;  1XQQ A;  3UIO B;  1AAR A;  2GBM A;  3KH0 A;  2MP2 A;  2MRP A;  2K1F A;  2G45 B;  3N3K B;  1E8W A;  4FJV B;  2KK8 A;  3H7S A;  1J8C A;  2Y5B B;  1WGY A;  4LDT B;  4BBN F;  4FHJ A;  2GBR A;  1NDD A;  4K7W A;  5DPS A;  2KDF B;  2NR2 A;  3IBE A;  4OVU A;  1ISN A;  2AWT A;  4AJY B;  4P7I A;  4HLE A;  2KJR A;  2GMI C;  1NBF C;  4HCN B;  4MH0 E;  1Z5S B;  2MSE D;  2KX0 A;  3ZKJ C;  2O2V B;  2RPQ A;  1P9D U;  4BKG A;  1GNU A;  1H4R A;  3ZTC A;  4AP4 C;  4HDQ A;  1V80 A;  1V49 A;  2KJ6 A;  1YD8 U;  3IG3 A;  3DVG Y;  5D94 A;  3H7P A;  1WM3 A;  4ZYN A;  4FJZ A;  4A3O A;  2UWQ A;  1NI2 A;  1A5R A;  2L7R A;  1SE9 A;  3A4S C;  2IBI B;  3WA0 A;  4JQW C;  3I3T B;  4F7Z A;  3PV1 A;  4HWI B;  4W9F A;  3JW0 X;  2MLB A;  4W9E A;  3SDL C;  4ANV A;  1WJU A;  1WMH A;  2CS4 A;  3QX1 A;  1X1M A;  3PS6 A;  2LGD A;  1BT0 A;  3EEC A;  2L0F A;  2KZR A;  2L76 A;  2RSU A;  3MJW A;  3APD A;  4J6I A;  2GBK A;  2MA9 B;  3AU4 A;  2IYD B;  4FHK A;  4K7U A;  4BBN C;  2IY1 B;  3WAL A;  4B6W A;  3EFU A;  1OEY J;  2N4F A;  4BOZ B;  3O65 B;  2IO3 B;  3M63 B;  1YX6 B;  3M62 B;  2RD0 A;  3QIJ A;  3HIZ A;  2R2O A;  4IM0 A;  4DDI D;  2KX3 A;  2C5L C;  2HTH A;  2KMC A;  2NPT B;  4KDI C;  1E7V A;  1LM8 B;  5DCN A;  2LRW A;  3UF8 A;  1WR1 A;  1WZ0 A;  2KC1 A;  2DYM A;  1GG3 A;  5FR6 A;  2KD0 A;  4AOF A;  3PGE A;  1YJ1 A;  1WH3 A;  4IM2 A;  2DX5 B;  1E90 A;  1UBI A;  4G3X B;  2WDT B;  4W9H A;  2XEW A;  3B08 A;  4FJY A;  3W1S C;  3JSV A;  2LI5 A;  4MGZ E;  1GC7 A;  4EEW A;  1L2N A;  2HJ8 A;  4DWF A;  2REX A;  2J7Q B;  1JRU A;  3H9D A;  3N32 A;  4W9L A;  2CHX A;  3PHW B;  4MEL A;  4ANX A;  1Q0W B;  1YIW A;  4HPL B;  4MEM A;  4BFR A;  3OLM D;  5J17 A;  1WX9 A;  2L0T A;  3IHP C;  3VDZ A;  2CHW A;  3Q3F A;  4ICU A;  3QQ8 B;  4GGQ A;  3ONS A;  5E6N A;  4ZDV A;  2KO3 A;  4WWP A;  4AUQ C;  4FBJ B;  4GDL B;  5LLI A;  2KFK B;  2MX2 A;  3A9J A;  1WE6 A;  1K8R B;  4NJ6 A;  4E74 A;  1TBE A;  4RM9 A;  2MP2 B;  5C1Z A;  1P1A A;  3IVF A;  2XBB C;  1P98 A;  2L05 A;  1KOT A;  2RGF A;  2KC2 A;  3HHM A;  2LWP A;  4ZRK A;  3RUI B;  4A3P A;  5D7G A;  3WAP A;  1WE7 A;  2M4N A;  3DBS A;  2MBE A;  3NZU A;  2WYQ A;  2D2Q A;  1RFA A;  2V3S A;  3K9O B;  3TMP B;  4NQL B;  2BWE S;  2ASQ A;  2LGX A;  1OQY A;  3QWZ B;  4KIK B;  5L95 C;  2JUO A;  3VH4 B;  5EDS A;  3KUD B;  5CHW A;  4W9G A;  1WXA A;  4W9C A;  2JZ3 B;  3EC8 A;  3V6E B;  2KJH B;  3NOB A;  5HKH A;  1MG8 A;  5G55 A;  2IO1 B;  5KHO A;  2LVP A;  1V5O A;  2NBW B;  3A33 B;  3MHS D;  3ZO5 B;  3UQA A;  4LCD E;  3HK0 A;  2LXA A;  3CST A;  4N9F 4;  3ZVV A;  4TKN A;  4URK A;  3NS8 A;  5CTR C;  3QAR A;  1Y8R C;  1Q5W B;  3U7D A;  4MJS A;  2MBO A;  1WMH B;  2ZPN A;  1I42 A;  2KNB A;  2LZ6 A;  1TGZ B;  3JVZ X;  3OAW A;  4A20 A;  1ZW7 A;  3DQV A;  4JLC A;  1J0G A;  5D2M B;  2IZV B;  3RCZ A;  3PRM B;  5AZH A;  4GOC A;  3JSV B;  3ZUN A;  1WI0 A;  1WIA A;  3L13 A;  2JRH A;  2VRR B;  2KOX A;  1S1Q B;  2KWC A;  2DZI A;  2DZM A;  1WGD A;  4E71 A;  2MBB B;  2PE9 A;  2WX1 A;  1T0Y A;  2J0J A;  3SHQ A;  4B9K A;  1WFY A;  4KDL B;  1E5W A;  5E6O A;  3WIM A;  1Z2M A;  2JT4 B;  2KWV B;  2K8B A;  3M95 A;  5TR5 A;  4EZK A;  3H1U A;  4W9J A;  4I6L B;  2PE6 B;  4DBG A;  4KZC A;  4M0W B;  3X23 A;  2R2Q A;  2M1M A;  2KFK A;  3EHV A;  3V62 A;  4DHJ D;  4XZ4 A;  4IG7 B;  1E8Z A;  3GZN I;  4HK2 A;  2LVO A;  4CHK A;  2FIF A;  3WAM A;  2KN5 A;  4DHZ E;  2BYV E;  1E7U A;  4BOS C;  4NJ7 A;  3VTU A;  2LUE A;  3ZRC A;  4BVU C;  2J0M A;  2A5U A;  3LDZ E;  2LVQ A;  4I6N B;  2BKF A;  2CKH B;  4IUM B;  1V2Y A;  4MGI E;  4JIO U;  3TL5 A;  1VCB A;  2KDE B;  3VXW A;  3W1Y A;  2N1V A;  2ZVN A;  2KTR A;  2NVU I;  3B0A A;  3B1L X;  1EO6 A;  4GU2 A;  2FUH B;  4OVV A;  2NCN A;  3KVF B;  3R7Q A;  1S3S G;  3APF A;  1SGH A;  3JYU A;  2JRI B;  4GDK B;  3UQB A;  2I1J A;  3RD2 A;  2CHZ A;  4WJO A;  2NBU A;  4WJQ A;  3QJZ A;  3QA8 A;  4HJK A;  5AZF A;  1C1Y B;  4JL9 A;  1OTR B;  1P3Q U;  3DOW A;  3R7R A;  1WX7 A;  2KQ7 A;  3ECI A;  4GSW A;  4KV2 A;  2N7E A;  3PHX B;  3A1Q B;  3NZS A;  1TTN A;  5AZG A;  1KJT A;  1R4M I;  3UIP B;  2CR5 A;  2N9E B;  2JWZ A;  2RR9 A;  3DBL I;  4GDL A;  3WAN A;  4IWO A;  4MSQ B;  2KMA A;  1IP9 A;  3D32 A;  4NAW A;  1EF5 A;  2JPH A;  3L0W B;  4II3 B;  2DHZ A;  5D6J B;  1V86 A;  4JGH B;  3UGB B;  2FCN A;  3SD5 A;  4W9D A;  1L7Y A;  2D11 A;  3AI5 A;  1WJN A;  1Q1O A;  3A9J B;  2GOW A;  4DHZ B;  3ZNI D;  3VTV A;  4GB9 A;  3BY4 B;  5CX3 A;  3RYT A;  3K9P B;  4G11 A;  2LJ5 A;  4MM3 A;  1RLF A;  2MBH A;  2IO0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...