2YEPB

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
b'LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence D, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepB01
2VZKB 1VZ6A 2YEPB 2V4IB 1VRAB 2YEPF 2VZKD 3IT6B 1VZ8A 1VZ7A 3IT4B
chains in the Genus database with same CATH superfamily
1MHHE 4GU2A 3ABVB 2A5UA 3ZO5B 4KDIC 3AB5A 4FHKA 4CYEA 3IFWB 1IPGA 3VXWA 3ZDTA 4J3OD 2LI5A 4DXAB 5KHQA 2KVZA 3BYTB 4IM2A 4BZAA 2KTRB 2WLBA 3PREA 2ZW0A 3QWZB 2BWES 4W9HA 1TS4A 1TKGA 3N32A 1DYQA 1B9RA 2BB6A 2WXPA 1MVKA 1AW7A 1R4NI 2KX0A 4NNJB 1L4ZB 5AUKA 2JXTA 5IO9A 1KLVA 5E6OA 1JWAD 2R2OA 3MP9A 3AXCA 5DPRA 2M4NA 4NAWB 1XQQA 4JIOU 3TEWA 3C0RB 3RN9C 1IBXB 1C9FA 4WJNA 2KDEB 2K3UA 3ONSA 1GUAB 4AWJA 3HRDD 1MPEA 4W9DA 4ZHPA 2IDYA 1L6VA 3W5UB 3L4PA 4K7WA 2W55A 1YIWA 2FUHB 2BF8B 3RUIB 2G4SA 1DOIA 3ECIA 4I6PA 5BMGA 4P1BC 1FXIA 4L1BA 4HEA1 2LMCA 4NZLB 3AE9B 2OJRA 2UWQA 3H1UA 4IWQA 2V3NA 2JRIB 1MFWA 4KSLC 1M4VA 1K51A 3KLSX 3AE5B 2OOBB 1ZXHA 2AQ3B 3N3KB 4KX6B 2OEDA 1ZKHA 2BQQA 2LEKA 1YN5A 4P1CC 2I2YA 4FBJB 4GGQA 4A8XC 3PHXB 2KACA 5BMIA 2AL3A 1J8CA 4D6IA 2BBCA 2W82A 3AV8A 1F52A 4EUTA 3NZUA 5CHFA 1J19A 3ZTCA 3KVFB 1L5PA 4URKA 1O0SA 2BWFA 1H8CA 3B1LX 1ENFA 1N5XA 4IC7B 1K53A 3HVZA 4MM3A 3JVZX 2K8HA 4US9A 1XCTL 3AEEB 1ISNA 1KTKA 1T6BX 3WAMA 4HCPB 2VZKB 1NEKB 1S3SG 3QC8B 4F8CB 4ANXA 2RSUA 3AM9A 1UBQA 3VRBB 3P4QB 4XDCA 1V1OA 2J0JA 3ZJUA 3R7RA 5E6NA 3PO0A 2L7RA 2GRIA 1Z2MA 2JZZA 2WXHA 2WHIA 1R7SA 4GDKA 3I3TB 2INDC 1SJED 4A90A 2M8SA 2A4ZA 1JWSD 3AE2B 4GDLB 1PDXA 2Z0EB 3GZNB 1OEYA 5BO4B 2LGXA 3W2DA 2KMCA 2K0PA 3TBLD 5IA7A 3DPDA 2EKEC 2JSVX 4OVZA 4PYZA 2K1FA 1J7BA 4D6HA 3GP7A 3NVYA 3GOEA 2RDGA 1HTOA 1LQBA 2JZ3B 1WE7A 2JWZA 1ROEA 2BT6A 1I7HA 4ICVA 1SJHD 3N1YC 3FILB 1P0RA 4B0MA 3AMZA 4DHJB 2C7HA 4JLCA 4MJSA 3ZLZA 3Q8BA 2PPHA 3WALA 1T5XD 4D6FA 1C79A 3Q14C 2MW5A 1EWCA 2MCNB 4TKNA 5BMHA 3IT4B 1FO4A 3UQBA 1P9DU 3VRAB 3VQIA 2HJ8A 5CHWA 2BYEA 4HPLB 1V5OA 1WM2A 2FCNA 3K9OB 3DCGA 3PLVA 4FJZA 1TS5A 2KFJA 2IO2B 4MACA 1V97A 2IO3B 1GG3A 3AI5A 1SSNA 3VTWA 2AL6A 3T3OA 2HE7A 2KO3A 1IP9A 3SHQA 2MJEA 3U30A 1GC7A 2FCSA 2M56B 1D6EC 1ZUD2 1CJEA 2WDQB 2GBKA 2KKCA 3NJTA 1E0ZA 4RH6A 2RD0A 2KYWA 2JQRB 4LCDE 5CHVC 4ZRKA 3V62A 2L05A 2BGFA 2PE9A 3CF6E 4CQNA 3W1SA 2WDVB 2FNJB 4S0RA 2D10A 4KGTA 2VRRB 3SDLC 1RYJA 1FD6A 4C00A 2JT4B 2CU3A 2DENB 2CU1A 2LRUA 1HXYD 2N4FA 2Y3AA 2LHEA 4WJPA 1WGDA 4WWOA 2ZW1A 3EHVA 3HHMA 2JPHA 4A6QA 5C1ZA 4LNKA 4AOFA 4RCOA 1V49A 3EFCA 4KV2A 4C56C 1WYGA 3WAOA 4R3DA 2BTEA 1DOYA 2QHOA 2KTRA 1E7PB 1WMHB 4IUMB 1E7UA 3ZYYX 2DZIA 1FXAA 4M02A 1QQRA 5JH5C 3NS8A 3U7ZA 3IVFA 3Q3FA 3RNFC 1UD7A 4W9EA 3VFKA 4YTPB 2KN4A 3BVZA 2FCQA 2WMJA 2D3BA 2VZKD 4EZLA 3L10B 2WYQA 2JU6X 1I4RA 4WIPA 4JQWC 1ZPSA 2Z0DB 4TSSA 4NAWA 2DNFA 1KF6B 4G3XB 3L13A 2WNMA 4MM3B 5FK9C 4LNIA 1BUIC 2L0FA 3Q8CA 1KH0A 4RF1A 4B95A 3R66C 4MH0E 2ZPNA 2IY0B 2IO0B 1Y56A 4HKZE 1LFDA 4RF0A 2W3SA 2D3AA 3AE7B 2LVPA 4HLEA 4IKGA 3UGBB 1E9MA 5IKCM 1YNTE 2ZZPB 4HDOA 1TZOA 2AEHA 2W54A 2KWUB 2WX1A 1TYGB 3RNAC 4BKTA 2LD9A 2KDBA 4GN1A 2N1WA 1MHXA 1TIFA 3KQ4A 3RT3B 4WWMA 1LO5D 4RM8A 5EE0A 4HROA 2J53A 3LB8C 3ZTDA 2LUMA 4DHJD 3AE6B 5E6PA 2W3RA 5AEKB 3NG0A 1EO6A 1LM8B 4KSKC 4MT5A 4W9GA 4MEMA 3WCQA 3LXFA 4YL8A 1OFFA 3W1YA 3WA0A 1Q0WB 1ZE3D 2L8JA 4TQ0A 1HQRD 2KNBA 4C4VB 3DBHB 2ZCBA 1XCQL 3W1SC 1L0YB 4TQ1A 1B1ZA 1TY2A 1VRAB 2Y5PA 2YEPF 4XYCA 3PZ7A 4P16A 3QAQA 2PW9A 4IOIE 3Q2AC 1H4RA 2G4DB 4ZRPA 4XWWA 2N9LA 4XE0A 5JXVA 3AU4A 1OQQA 3PZDA 2M19A 2ZVOA 3TSSA 2WXLA 5KHOA 2KJ6A 3NY5A 1WYWB 2VH2A 2K8CA 5LXHA 4TMAB 3DBLI 4WAAA 1N61A 1FM0D 2BKRB 4NQLB 4JWSC 2I1JA 3D32A 1HTQA 3HM6X 4HPPA 4FLHA 1C3TA 2V9HA 1VZ8A 4XWTA 2ZEQA 4K3CA 1I4QA 4BVUC 3LYYA 1L4DB 4M8MA 1FNVA 2LASA 1WJNA 3JSVB 2KJHB 2WDTB 2BS4B 4WJQA 3Q3OC 3DBSA 3NRZA 4GB9A 3OJ3A 2NS5A 4AUQC 1L0VB 1ET6A 2L83A 2R2QA 3HK0A 1UELA 3KYCD 2L32A 4DWFA 3W5VB 4GDLA 2CR5A 3ZNGC 4S17A 4YXDB 2FCMA 5DPTA 5JZEB 4HDQA 1EU3A 2R61A 4LTUA 1TTNA 3BVGA 4HXDA 5HKHA 1Z5SB 2WU5B 1FRDA 2KD0A 1GJZA 2GLSA 1KLUD 5BYSA 2JX5A 1PYWD 3FILA 3P1MA 1PQSA 3U4EG 2J0KA 2GBJA 1SXTA 2EMTA 2J7QB 4IG7B 1K8RB 2X8XX 1WXAA 1WFYA 3TMPB 4FHJA 1EWYC 3SFDB 5IP4D 3KWLA 2WMKA 3T8MA 1WR6E 1D4BA 1I4XA 4E74A 2FBWB 4GOCA 2N1VA 1QOAA 4EKUA 3NVWA 4II3B 4ZHOA 3ZQ4A 1C4PA 4DDGD 1EUVB 1YJJA 1JALA 2BS2B 2AYOB 3GB1A 3AN1A 3DHHC 2K25A 2DX5B 1PUTA 1AWDA 5AZFA 1KM7A 2WXQA 4BAXA 2LJ5A 1LGRA 4YSZB 2SEBD 2H89B 2FIFA 3TIXA 2X38A 5I4DA 2RPQA 2QJLA 4RGTA 4D6CA 2WXIA 5JHAA 1V2YA 4W9JA 2PVOD 2Z59B 3QHTA 2MQJA 5H8YE 3BINA 1JWBD 1WF9A 1SE4A 2D3CA 3KUDB 2KT7A 4OZBA 4HPMB 3N20C 1CQVA 4MELA 2KDIA 4A9AA 4AJWA 4DXGA 1WIAA 4BKSD 2WP9B 2WXGA 4GIVA 3UQAA 3QK0A 2QMTA 2RGFA 3Q3MC 3NS1A 3R7QA 2K6DB 4N58A 5IOIA 2VH1A 3KYDD 3EECA 1FPYA 2NBUA 3BVMA 2HJ1A 2MJ3A 2KX3A 2MHJA 3NVZA 1FCCC 5BYQA 2WX0A 1WE6A 2K22A 3DVGY 3KWVA 4ANUA 1XO3A 3PRMB 1JCKB 2FUG1 4MGZE 2V1YA 3QCAA 4ZRQA 4KIKB 3RCZA 2G9HD 1WMHA 3E9SA 4OW0A 1LLQA 1GPXA 1FMAD 4JPSA 3WANA 4ZOHC 3HVDA 1WXSA 2FIDA 5D94A 3DBRB 4D6EA 2Y5BB 2KMAA 4NPNA 1UZXB 1HZ5A 3VR8B 5L95C 3V3XA 1E8WA 4KVGB 3Q69A 2KDMA 2O2VB 1E10A 2GBNA 4X57B 2O6VA 3B2GA 4DBGA 3WIMA 1TS2A 2PIAA 4KKIA 4BKGA 1I4HA 2RPVA 1E6EB 3CIRB 3NZ3A 4RGMA 4OVUA 4IW0A 1TGZB 2KOXA 2ONQA 4ARCA 4FJYA 4OZCA 2J52A 1J7AA 2CHXA 3PSEB 2G1EA 3M3JA 4EEWA 3R8BA 2RDHA 2LGIA 3M95A 2M17A 4GMVA 1R4MB 4KKJA 4RM9A 4NQKE 5D7GA 3FAHA 1F77A 2UU7A 4N9F4 2QC8A 3L17A 5LNK1 3PV1A 4BKSA 1VDVA 2KVRA 2KQ7A 4D6JA 2N9PC 4P7IA 3ZJVA 2GBMA 1NENB 2KLGA 3ML9A 3BK2A 5EE1A 3ZNHB 4MGYE 2J0MA 1SE2A 1T0YA 3GE3C 5D3IB 2XNAC 4A3PA 1WM3A 4FXCA 1SEBD 3URYA 3L16A 4C4VA 3M62B 4WAFA 2MEKA 3H6NA 1WI0A 1EM7A 1KJTA 4G11A 4IDIA 2JY6A 3C19A 2ZPYA 4ZRIA 3EC8A 2RMMA 2WXJA 2INPE 3LDZE 4D6DA 3VTVA 3APCA 2E6XA 2IJ0A 4H2AA 3R2TA 3OWEB 1V81A 1K52A 1E8XA 1PFDA 1JMLA 4K81A 3MFGA 2BPSA 2MWSB 1P7EA 2NBWB 4MGIE 1P98A 4B6WA 3PHWB 1L2NA 4ANVA 3KH0A 3AEFB 1RLFA 1T3QA 1LXDA 2W9NA 4MGKE 1HZ6A 3DVNU 3VDZA 1FCLA 2J4XA 3IT6B 4XDDA 2V4LA 3AE8B 3JSVA 2WXNA 3QIJA 3B0AA 1TBEA 4OHJA 1WRDB 3ZJTA 3HIZA 1YQ3B 1GOZA 2H88B 1PGAA 3GZNI 1BXTA 5LXIB 1WXMA 1EF1A 1UWXA 2LZ6A 2OJWA 3ETRA 3AEGB 1X1MA 2DYOA 3ZW3A 3M63B 1HEZE 3VUWA 5HHDG 2KHWB 2WMHA 2K8BA 2LVQA 1TZ1A 4YTNB 4C80A 2JVCA 2WMIB 2QCZA 1YMHE 2ZVNA 3ML8A 4FA6A 1WX7A 3ZNZB 2K9XA 2DZMA 2MLBA 4L23A 4HJGE 4WQOB 1JW9D 4HVBA 3DVGX 4XGAB 2XK5B 4ICUA 2LXAA 1AYFA 2ZNVB 3MC0B 1V9JA 3O13A 2NMQA 1VZ7A 2BYVE 3TJPA 5AZGA 5TSSA 2ASQA 2D11A 5JHBA 3ZVVA 1VR9A 1P3QU 1C4AA 4EZKA 1C1YB 4D6GA 2CHWA 4LDTB 3SU8X 2GB1A 2JYTA 3A4RA 2N9EB 2KFKB 4JX1C 4I6NB 4F1SA 2KWDA 4G50A 1JWMD 4IM3A 4LNNA 5C2TB 4PT5A 1QOFA 4ACFA 4YSXB 4RGOS 4A3OA 3I5JC 5L83A 2JWUA 3A1QB 4MDKE 2NBVB 4RGNA 2OHFA 2O6VB 4LNFA 1JROA 1F0ZA 2DBYA 3X23A 1NYQA 3RPFC 4DDID 1T0RC 4USAA 3AE4B 3Q3JA 3QX1A 1G6JA 1IGCA 4AQ7A 2JXXA 4XX5A 2MX2A 4K3BA 1C4CA 3T3NA 1WJ6A 2BYTA 3W9CB 3NVVA 1SIFA 2MJDA 4M0WB 3PVLA 4KZCA 1WGKA 2L76A 3R3MA 1UGJA 3A4SC 5FR6A 2N7DA 2LFIA 1WX9A 3UF8A 1N60A 3ZUNA 3AEBB 3L0WB 3ZRCA 3T9LA 2KTFA 3ZXVA 1XEEA 2N0SB 4ZDVA 3EA6A 4B9KA 4AS1A 2KMMA 1GNUA 4WWNA 1J0GA 3PT2B 1JWUD 3RZWC 1WZ0A 2LJIA 2BB5A 4KIKA 4BOZB 4L2YA 3J9CA 5J17A 1JQ4A 4G0NB 1RRBA 5G5GA 1SBBB 1Q5WB 1SB3C 2IYDB 3B08A 3AECB 5J18A 4EE2A 1T0SC 3CSTA 4ZYSA 2Y5CA 4KZ0A 1C76A 1ZDVA 4F7ZA 2D3GA 2V3PA 4N59A 1YX5B 1HA5A 2IGDA 3JYUA 1FNUA 4HCNB 4O1NA 4ARIA 4M01A 2WQYB 2V0GA 2LXCA 2HD5B 4W9FA 1UNSA 2O2VA 1WGHA 4JWUC 1WXVA 1SE9A 1WH3A 1Q10A 2G3QB 2KXJA 4OVVA 3RD2A 3VH4B 4EZJA 2AX5A 1ESFA 2CHZA 4LNOA 2C7MB 5EE9A 2HTME 3SR6A 2KC2A 2MBBB 1YQ4B 1Q1OA 4I6LB 4WURA 4HK2A 4ZRJA 1VLBA 1A5RA 3H7PB 2ZJDA 1V6EA 4M00A 3RNBC 5CTRC 4ZYNA 1U4AA 1V1PB 1NI2A 2NCNA 2SAKA 2GMIC 4D71A 2WGSA 1YJIA 2PLPA 1OQRA 4HJKA 3UIOB 3VUXA 1R4NB 2NPTB 1XLPA 1D5MC 2MP2A 1K50A 1TT5B 3DBHI 4B0EA 1TKEA 2L00B 3OAWA 4M8NA 1TJEA 4W9KA 3ALBA 2MA9B 1XT9B 1F1HA 2WDRB 5T8IA 4C7ZA 5D6JB 1D3ZA 1QF6A 3U7DA 2KWCA 3A9JB 4RFBA 1IGDA 2LGDA 2DZKA 4IWPA 1MG8A 4DXFA 3RYTA 4A20A 3RZFA 3LJ3A 3O65B 1C78A 3MC8A 4LLGM 1QZEA 3RI7C 3VHTC 2MH7A 4PK1A 1L0XB 4FJVB 3EGRA 1NBFC 2KN5A 3QJZA 4AJYB 3DQVA 2INNE 2DYBA 2O6VD 3PGEA 2MRPA 2C9WB 2N9XA 3AU5A 2PEAA 1UGMA 3Q8FA 4E3CA 2NVUI 1EU4A 2XEWA 4FADA 5FR3A 4KGRA 2PJHA 1V8CA 2D2QA 2WXMA 1PGXA 3P4PB 1RWSA 2D07B 2YLMA 1E7VA 2G45B 3R2IA 2C5LC 3A9KB 4MSQB 4NY0A 1MI0A 3PRZA 2L0TA 3UIPB 4DHZB 2QEJC 1YN4A 2XN9C 3DVNV 1OQYA 2JF5A 1IYFA 3FC4A 3BIID 2NTTA 4Q2JA 2WMGA 1WGYA 1V5TA 1PGBA 1XLQA 4QAYA 2KLCA 2WMIA 1E5WA 2JYEA 2BKFA 1WY8A 2QSDA 2LHDA 1FIQA 4YTMB 1WWTA 3MJWA 4WJOA 4FULA 1NYRA 2XK5A 4A55A 2CJNA 2HTHA 3QARA 3S2AA 2JZPA 2ICIA 1SE3A 2WXFA 3BZDB 2N7EA 2C60A 1XD3B 2K6QA 4JE3B 2TSSA 3DHIC 3BWUD 2WXRA 2IO1B 3IG3A 3PPAA 1T0QC 5J2RA 2KFKA 2NTSA 1KLGD 2DHZA 2KK8A 2CS4A 3KW5B 2REXA 1CZPA 1OEYJ 1ZDXA 5BYRA 3I9V1 4XC2A 1MJDA 3IXSA 1GC6A 2EKIA 1V86A 4BBNF 4TV3A 1ZP0B 4XZ4A 3BK1A 1RFAA 3U8ZA 5G55A 3TL5A 3A1QA 1WSPA 3HUIA 3I57A 3VH3B 5AZHA 4D72A 5D2MB 3RMKC 3U2SC 1BT0A 5CX3A 1M94A 5HFYA 3AE3B 2KQSA 1N62A 4LJPB 2RR9A 3P42A 3NOBA 1YD8U 3I63C 5IAAC 3KUCB 3AEDB 3N30A 3DOWA 2EELA 4M0WA 3P4RB 4WQMA 1DGJA 1S1QB 1ZW7A 3ZNID 3V05A 2CKHB 1I35A 2I38A 1YJ1A 1DOXA 2I1KA 2FE8A 2KZRA 2JRHA 2MBHA 3RNGC 1P1AA 4ASWC 3TUOA 3TEYA 2YEPB 1SF0A 2LWPA 1WR1A 2DWQA 3ZGZA 1AN8A 2MP2B 2IBIB 3VVWB 4CHKA 1TY0A 1TS3A 5D3DA 4LK0M 1YQBA 3QA8A 3RULA 3RFZB 1BMLC 1XXGA 1F2RC 3DBRI 3IAM1 3MC9A 4N6EB 2C7NB 1FRRA 1L7YA 1UF0A 1WZ3A 1FFUA 3DWMA 4RNAA 2QDFA 2QIEB 1YX6B 4RMAA 2WMFA 4K7UA 4P6VF 2PVGC 2ACZB 3JW0X 2CJOA 3V60A 1WJUA 2KDFB 3RNEC 3MTNB 1ZOYB 2AQ1B 4GLSC 2DLBA 2K39A 2K5PA 2L1AA 2ZNVC 4AP4C 1J7CA 3VUYA 1WRIA 4W9CA 2IZVB 2LGSA 1STEA 3H9DA 4EFOA 4NJCA 3K9PB 4BOSC 2KAJA 5GXGB 1R4MI 1GB4A 1C77A 5H92C 4HRSA 3H7PA 3PS6A 5DPSA 3SEBA 1NDDA 2M0XA 4D2KA 3UINB 1SIJA 4ITKA 4US8A 1V1PA 5AUIA 1QOBA 1CMXB 1UWMA 2ON8A 2V4IB 1E8YA 3AULA 4GXBA 4DK5A 4YT0B 1JRPA 4J6IA 4IWOA 2WU2B 1GB1A 1ACCA 1N6ZA 4REZA 2MBQA 2DZJA 4OZAA 3DWGC 2NPTA 5DPWA 1N5WA 1VD2A 2L3ZA 1Y8RC 2BVCA 2DAFA 1XF5L 1VJKA 3UI3A 1OTRB 2GI9A 3NZSA 4YWGG 4DHZE 1RAXA 2AWTA 3EUB2 4WH4A 2HDEA 5MPOA 3QQ8B 2ZCCA 5FKAC 5LLIA 5EE3A 1I4GA 2WXKA 3A9JA 2RDBC 4NJ6A 3V6CB 4PS8A 1D5ZC 4KGSA 3CSFA 1A70A 4BBNC 4W9LA 2MBEA 2LVOA 1TKYA 1QLBB 2B3AA 5C3JB 5TR5A 5G2NA 3SD5A 4GSWA 3MHSD 3V6EB 3IAS1 3N9YC 3ZIMA 3U52E 3X0WA 2EMSA 1WGRA 2BYFA 1VZ6A 2INCC 3OLMD 4FN2A 1YOVB 1UH6A 3ZRFA 2LGYA 3VR9B 4E71A 1YN3A 3BYYB 3WAPA 5E6JA 3V61A 3AEAB 3N1XC 2WWZA 3N1ZC 3E56A 1XLOA 1ZXIA 3CWIA 2WXOA 3A9KA 1F2RI 1FEHA 3VTUA 2LUEA 3A33B 2N9KA 5HG2A 5DCNA 1NVID 2NR2A 3DHGC 1KOTA 4LJOB 2KC1A 1WXQA 4PS7A 4K1RB 3NHEB 3FKYA 2LRWA 5C23A 2BW2A 3GE8C 1NI3A 1IBXA 2IGGA 3ZKJC 3P63A 3Q6BA 4K7SA 1WJ4A 3HM3A 2KWVB 2DYMA 4MH8A 3DBLB 1ZGUB 2IGHA 2MBOA 1EF5A 2XBBC 3PZ8A 4II2B 2QILA 3ZXRA 3B9JA 2DAJA 2FAZA 2JUOA 3BY4B 1MG4A 1FXTB 3ZDMC 3Q3NC 4TUUA 2PKOA 3Q8AA 4BFRA 3VAWA 3AH7A 4GDKB 1OGWA 1QOGA 3H8HA 4ANWA 4PS3A 1WX8A 5HI1A 3TEZA 3P4SB 1QKZA 1I42A 1D5XC 2BS3B 2GBRA 3PTFC 2IY1B 4PYUA 1VCBA 5GMVA 2UYZB 4JL9A 4MSMB 3Q8EA 1V80A 2Q5WD 2AQ2B 4DQOC 3MHZA 2KANA 4C7YA 2E3TA 1RFKA 4HWIB 2KJRA 1I4PA 2M0AA 2Z8LA 2M1MA 4MJSB 3P2BA 1AARA 1GAQB 1CK1A 3ENEA 2IPKD 3RNCC 4JGHB 1FFVA 1N63A 1L6UA 2V3SA 1FNWA 3IHPC 1E90A 2PE6B 2KQ4X 3SFEB 3IBEA 1KRHA 4EOYA 3OG5A 3L54A 3MJ5A 4IM0A 3C8YA 3PLUA 4CO7A 1XLNA 1WGGA 2GOWA 4WWPA 3TEXA 1E8ZA 3KUZA 1P7FA 1IUEA 2L52A 3H7SA 3DDCB 3L08A 4UDUC 3APDA 1JRUA 3PRPB 1F9JA 3APFA 3TCAA 4HKQA 5IN7A 1KFYB 2J42A 1HE8A 1UUPA 5EDSA 1SGHA 1QILA 4KDLB 1RM6C 4NJ7A 1QT9A 4YSYB 4W9IA 2WS3B 2B76B 2D5GA 3EFUA 4NAMA 3B2FA 4LDTD 3GS2A 3NUHB 2MSED 2N7JA 2YVCA 3AE1B 1ET9A 5G5HA 1UBIA 2PMVA 3CMMB 3OJ4B 2PTLA
chains in the Genus database with same CATH topology
3BK1A 2H88B 1MHXA 1MHHE 1PGAA 1WSPA 3HUIA 3I57A 3ABVB 3KQ4A 1BXTA 4WWMA 1LO5D 1UWXA 5EE0A 4HROA 2J53A 3LB8C 3AB5A 2LUMA 3AE6B 3ETRA 2W3RA 3AEGB 3U2SC 2DYOA 4MT5A 3WCQA 1HEZE 5HFYA 3LXFA 3AE3B 1N62A 1OFFA 5HHDG 4J3OD 1ZE3D 4TQ0A 1HQRD 3BYTB 4YTNB 3P42A 4C80A 2WLBA 2ZW0A 3AEDB 1XCQL 1YMHE 1L0YB 4TQ1A 2EELA 1B1ZA 4M0WA 3P4RB 4WQMA 2K9XA 1TS4A 1TY2A 1TKGA 1DGJA 1DYQA 4L23A 3V05A 1VRAB 2Y5PA 2YEPF 4HJGE 2BB6A 2WXPA 1B9RA 1MVKA 1AW7A 2I38A 3PZ7A 4P16A 1JW9D 1DOXA 2FE8A 2PW9A 4IOIE 4XWWA 4ZRPA 3TUOA 1L4ZB 5AUKA 2N9LA 3TEYA 2YEPB 1SF0A 4XE0A 5JXVA 2JXTA 1OQQA 2DWQA 3ZGZA 2M19A 1AN8A 1AYFA 1JWAD 3TSSA 2WXLA 3MC0B 3O13A 3MP9A 2NMQA 4NAWB 1TY0A 3TEWA 1TS3A 1VZ7A 5D3DA 4LK0M 4TMAB 5TSSA 3RFZB 1IBXB 1BMLC 1VR9A 1N61A 1XXGA 1C9FA 1FM0D 1F2RC 1C4AA 2K3UA 4JWSC 3IAM1 4N6EB 2GB1A 2JYTA 1FRRA 1VZ8A 3HRDD 4XWTA 1MPEA 1I4QA 4JX1C 1FFUA 3DWMA 1L4DB 3LYYA 4ZHPA 4RNAA 1FNVA 2KWDA 2QIEB 2IDYA 1L6VA 1JWMD 5C2TB 4PT5A 1QOFA 4YSXB 3W5UB 4RGOS 2BS4B 4P6VF 3L4PA 2PVGC 2W55A 2ACZB 3NRZA 2JWUA 2CJOA 1L0VB 1ET6A 1DOIA 2L83A 1ZOYB 4RGNA 2OHFA 2L32A 2AQ1B 4GLSC 5BMGA 1JROA 2DLBA 1FXIA 4L1BA 4HEA1 3W5VB 1F0ZA 2DBYA 2LMCA 2K5PA 2L1AA 3AE9B 1NYQA 4NZLB 3RPFC 2V3NA 1J7CA 4USAA 1WRIA 3AE4B 4YXDB 1IGCA 4AQ7A 1M4VA 1K51A 1STEA 3KLSX 1EU3A 3AE5B 4NJCA 1C4CA 3T3NA 2R61A 2KAJA 5GXGB 4LTUA 1ZXHA 2AQ3B 2BYTA 3W9CB 3NVVA 1GB4A 1C77A 4KX6B 5H92C 2OEDA 3BVGA 4HRSA 2MJDA 2WU5B 1FRDA 2LEKA 3SEBA 1YN5A 2I2YA 1KLUD 5BYSA 2JX5A 1PYWD 4A8XC 4D2KA 2KACA 1SIJA 3FILA 4ITKA 5BMIA 1WGKA 3P1MA 4US8A 3U4EG 1UGJA 1V1PA 5AUIA 2BBCA 1QOBA 1UWMA 2W82A 2LFIA 3AV8A 2ON8A 2V4IB 1SXTA 1N60A 3AEBB 1JRPA 4YT0B 2WU2B 1XEEA 2N0SB 1L5PA 3EA6A 1ACCA 1GB1A 4REZA 1EWYC 4OZAA 3DWGC 4AS1A 3SFDB 1N5WA 2KMMA 3KWLA 1ENFA 1N5XA 1JWUD 1D4BA 1XF5L 1I4XA 1VJKA 3UI3A 2GI9A 1K53A 2LJIA 3HVZA 2BB5A 4YWGG 4L2YA 3EUB2 3J9CA 1JQ4A 2FBWB 1QOAA 4US9A 4WH4A 1XCTL 3AEEB 2HDEA 5MPOA 3NVWA 1KTKA 1T6BX 5G5GA 1SBBB 4ZHOA 3ZQ4A 1C4PA 1SB3C 5FKAC 3AECB 1YJJA 2VZKB 4EE2A 5EE3A 1JALA 1NEKB 1I4GA 2BS2B 3GB1A 3AM9A 3AN1A 4ZYSA 2WXKA 2Y5CA 3VRBB 3P4QB 1PUTA 1C76A 1ZDVA 4XDCA 1AWDA 1V1OA 2V3PA 3ZJUA 2WXQA 1D5ZC 4KGSA 4N59A 1A70A 1HA5A 2IGDA 3PO0A 2GRIA 1FNUA 4O1NA 4ARIA 4YSZB 2WXHA 2SEBD 2H89B 2WQYB 2X38A 1R7SA 5I4DA 2V0GA 2QJLA 4RGTA 1TKYA 1QLBB 2WXIA 1UNSA 4A90A 1SJED 4JWUC 5C3JB 2PVOD 1Q10A 1JWSD 5H8YE 3AE2B 1JWBD 4GDLB 1PDXA 1SE4A 2AX5A 3IAS1 4OZBA 3W2DA 1ESFA 2K0PA 3N9YC 3U52E 5EE9A 2HTME 3SR6A 1VZ6A 1CQVA 2JSVX 1YQ4B 4OVZA 4A9AA 4DXGA 4WURA 1J7BA 2WP9B 3GP7A 3NVYA 1VLBA 2RDGA 2WXGA 3VR9B 1YN3A 2QMTA 3BYYB 1ROEA 3NS1A 2BT6A 1I7HA 4N58A 5E6JA 1SJHD 3FILB 4B0MA 3AEAB 3AMZA 1V1PB 2SAKA 3BVMA 3E56A 2MJ3A 1XLOA 1ZXIA 3CWIA 3NVZA 2WXOA 1FCCC 5BYQA 1F2RI 1YJIA 1FEHA 2PLPA 2N9KA 5HG2A 1OQRA 3Q8BA 1NVID 2K22A 1T5XD 3KWVA 1XLPA 1C79A 1WXQA 1D5MC 1K50A 4B0EA 1EWCA 1XO3A 1JCKB 2FUG1 1TKEA 5BMHA 4ZRQA 1TJEA 3IT4B 1FO4A 2G9HD 3E9SA 2BW2A 1NI3A 4OW0A 2IGGA 3VRAB 1IBXA 3P63A 3VQIA 1GPXA 1FMAD 4JPSA 2WDRB 5T8IA 4ZOHC 4C7ZA 3HVDA 2DYMA 4MH8A 2IGHA 1QF6A 1TS5A 3PZ8A 2QILA 3B9JA 4RFBA 1IGDA 4DXFA 4MACA 1V97A 1HZ5A 3VR8B 1SSNA 2PKOA 3V3XA 3Q8AA 1C78A 4LLGM 3T3OA 3Q69A 3AH7A 2MH7A 1L0XB 4GDKB 2KDMA 1E10A 1QOGA 3EGRA 2MJEA 3H8HA 2M56B 3B2GA 1D6EC 1ZUD2 5HI1A 3TEZA 3P4SB 1TS2A 1CJEA 2PIAA 2WDQB 4KKIA 1QKZA 2INNE 1I4HA 1E0ZA 2RPVA 1E6EB 3CIRB 3NZ3A 4RH6A 4RGMA 1D5XC 2JQRB 2ONQA 4ARCA 2BS3B 4CQNA 4OZCA 2J52A 3Q8FA 1J7AA 3W1SA 2WDVB 2G1EA 4KGTA 3R8BA 1EU4A 2RDHA 1RYJA 2LGIA 1FD6A 5FR3A 4KGRA 3Q8EA 2CU3A 1V8CA 2Q5WD 2WXMA 1HXYD 1PGXA 2AQ2B 3P4PB 1RWSA 4KKJA 4DQOC 2Y3AA 3MHZA 5D7GA 2LHEA 3FAHA 4C7YA 1F77A 2E3TA 3R2IA 1RFKA 1I4PA 2M0AA 2ZW1A 5LNK1 2Z8LA 4A6QA 1MI0A 4RCOA 2QEJC 1YN4A 1VDVA 2XN9C 1GAQB 1CK1A 1WYGA 4C56C 2IPKD 4R3DA 2BTEA 3ZJVA 1NENB 3BK2A 5EE1A 1FFVA 1N63A 1L6UA 3FC4A 1DOYA 1FNWA 1SE2A 3BIID 5D3IB 2XNAC 2NTTA 4Q2JA 4FXCA 1E7PB 1SEBD 3URYA 2KQ4X 4WAFA 1PGBA 3ZYYX 2MEKA 3SFEB 1XLQA 1KRHA 1EM7A 1FXAA 3MJ5A 2JYEA 4IDIA 1QQRA 3U7ZA 3C8YA 2QSDA 2LHDA 1FIQA 2RMMA 2WXJA 4YTPB 2INPE 2KN4A 3BVZA 4YTMB 1XLNA 1WWTA 2E6XA 3TEXA 2VZKD 2IJ0A 1P7FA 1IUEA 1NYRA 2L52A 3R2TA 4H2AA 3OWEB 4A55A 1K52A 2JU6X 1I4RA 1PFDA 2CJNA 4UDUC 4WIPA 1JMLA 1ZPSA 2JZPA 2ICIA 4HKQA 1SE3A 2WXFA 3MFGA 1KFYB 3BZDB 4TSSA 1P7EA 1KF6B 2J42A 4JE3B 1UUPA 2TSSA 2WNMA 4MM3B 5FK9C 1BUIC 3BWUD 1QILA 3Q8CA 1RM6C 2WXRA 1KH0A 3AEFB 1QT9A 1T3QA 4RF1A 4YSYB 1HZ6A 2WS3B 1Y56A 4HKZE 2B76B 2D5GA 4RF0A 1FCLA 2J4XA 3IT6B 2NTSA 1KLGD 2W3SA 4NAMA 4XDDA 3B2FA 1CZPA 3AE7B 3GS2A 1ZDXA 3AE8B 5BYRA 3I9V1 3NUHB 2WXNA 2N7JA 4IKGA 1E9MA 3AE1B 1YNTE 3IXSA 1ET9A 1TZOA 2W54A 2EKIA 1TYGB 4OHJA 5G5HA 3ZJTA 1YQ3B 2PMVA 1ZP0B 1GOZA 2PTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZK B;  1VZ6 A;  2YEP B;  2V4I B;  1VRA B;  2YEP F;  2VZK D;  3IT6 B;  1VZ8 A;  1VZ7 A;  3IT4 B; 
#chains in the Genus database with same CATH topology
 1MHH E;  4GU2 A;  3ABV B;  2A5U A;  3ZO5 B;  4KDI C;  3AB5 A;  4FHK A;  4CYE A;  3IFW B;  1IPG A;  3VXW A;  3ZDT A;  4J3O D;  2LI5 A;  4DXA B;  5KHQ A;  2KVZ A;  3BYT B;  4IM2 A;  4BZA A;  2KTR B;  2WLB A;  3PRE A;  2ZW0 A;  3QWZ B;  2BWE S;  4W9H A;  1TS4 A;  1TKG A;  3N32 A;  1DYQ A;  1B9R A;  2BB6 A;  2WXP A;  1MVK A;  1AW7 A;  1R4N I;  2KX0 A;  4NNJ B;  1L4Z B;  5AUK A;  2JXT A;  5IO9 A;  1KLV A;  5E6O A;  1JWA D;  2R2O A;  3MP9 A;  3AXC A;  5DPR A;  2M4N A;  4NAW B;  1XQQ A;  4JIO U;  3TEW A;  3C0R B;  3RN9 C;  1IBX B;  1C9F A;  4WJN A;  2KDE B;  2K3U A;  3ONS A;  1GUA B;  4AWJ A;  3HRD D;  1MPE A;  4W9D A;  4ZHP A;  2IDY A;  1L6V A;  3W5U B;  3L4P A;  4K7W A;  2W55 A;  1YIW A;  2FUH B;  2BF8 B;  3RUI B;  2G4S A;  1DOI A;  3ECI A;  4I6P A;  5BMG A;  4P1B C;  1FXI A;  4L1B A;  4HEA 1;  2LMC A;  4NZL B;  3AE9 B;  2OJR A;  2UWQ A;  3H1U A;  4IWQ A;  2V3N A;  2JRI B;  1MFW A;  4KSL C;  1M4V A;  1K51 A;  3KLS X;  3AE5 B;  2OOB B;  1ZXH A;  2AQ3 B;  3N3K B;  4KX6 B;  2OED A;  1ZKH A;  2BQQ A;  2LEK A;  1YN5 A;  4P1C C;  2I2Y A;  4FBJ B;  4GGQ A;  4A8X C;  3PHX B;  2KAC A;  5BMI A;  2AL3 A;  1J8C A;  4D6I A;  2BBC A;  2W82 A;  3AV8 A;  1F52 A;  4EUT A;  3NZU A;  5CHF A;  1J19 A;  3ZTC A;  3KVF B;  1L5P A;  4URK A;  1O0S A;  2BWF A;  1H8C A;  3B1L X;  1ENF A;  1N5X A;  4IC7 B;  1K53 A;  3HVZ A;  4MM3 A;  3JVZ X;  2K8H A;  4US9 A;  1XCT L;  3AEE B;  1ISN A;  1KTK A;  1T6B X;  3WAM A;  4HCP B;  2VZK B;  1NEK B;  1S3S G;  3QC8 B;  4F8C B;  4ANX A;  2RSU A;  3AM9 A;  1UBQ A;  3VRB B;  3P4Q B;  4XDC A;  1V1O A;  2J0J A;  3ZJU A;  3R7R A;  5E6N A;  3PO0 A;  2L7R A;  2GRI A;  1Z2M A;  2JZZ A;  2WXH A;  2WHI A;  1R7S A;  4GDK A;  3I3T B;  2IND C;  1SJE D;  4A90 A;  2M8S A;  2A4Z A;  1JWS D;  3AE2 B;  4GDL B;  1PDX A;  2Z0E B;  3GZN B;  1OEY A;  5BO4 B;  2LGX A;  3W2D A;  2KMC A;  2K0P A;  3TBL D;  5IA7 A;  3DPD A;  2EKE C;  2JSV X;  4OVZ A;  4PYZ A;  2K1F A;  1J7B A;  4D6H A;  3GP7 A;  3NVY A;  3GOE A;  2RDG A;  1HTO A;  1LQB A;  2JZ3 B;  1WE7 A;  2JWZ A;  1ROE A;  2BT6 A;  1I7H A;  4ICV A;  1SJH D;  3N1Y C;  3FIL B;  1P0R A;  4B0M A;  3AMZ A;  4DHJ B;  2C7H A;  4JLC A;  4MJS A;  3ZLZ A;  3Q8B A;  2PPH A;  3WAL A;  1T5X D;  4D6F A;  1C79 A;  3Q14 C;  2MW5 A;  1EWC A;  2MCN B;  4TKN A;  5BMH A;  3IT4 B;  1FO4 A;  3UQB A;  1P9D U;  3VRA B;  3VQI A;  2HJ8 A;  5CHW A;  2BYE A;  4HPL B;  1V5O A;  1WM2 A;  2FCN A;  3K9O B;  3DCG A;  3PLV A;  4FJZ A;  1TS5 A;  2KFJ A;  2IO2 B;  4MAC A;  1V97 A;  2IO3 B;  1GG3 A;  3AI5 A;  1SSN A;  3VTW A;  2AL6 A;  3T3O A;  2HE7 A;  2KO3 A;  1IP9 A;  3SHQ A;  2MJE A;  3U30 A;  1GC7 A;  2FCS A;  2M56 B;  1D6E C;  1ZUD 2;  1CJE A;  2WDQ B;  2GBK A;  2KKC A;  3NJT A;  1E0Z A;  4RH6 A;  2RD0 A;  2KYW A;  2JQR B;  4LCD E;  5CHV C;  4ZRK A;  3V62 A;  2L05 A;  2BGF A;  2PE9 A;  3CF6 E;  4CQN A;  3W1S A;  2WDV B;  2FNJ B;  4S0R A;  2D10 A;  4KGT A;  2VRR B;  3SDL C;  1RYJ A;  1FD6 A;  4C00 A;  2JT4 B;  2CU3 A;  2DEN B;  2CU1 A;  2LRU A;  1HXY D;  2N4F A;  2Y3A A;  2LHE A;  4WJP A;  1WGD A;  4WWO A;  2ZW1 A;  3EHV A;  3HHM A;  2JPH A;  4A6Q A;  5C1Z A;  4LNK A;  4AOF A;  4RCO A;  1V49 A;  3EFC A;  4KV2 A;  4C56 C;  1WYG A;  3WAO A;  4R3D A;  2BTE A;  1DOY A;  2QHO A;  2KTR A;  1E7P B;  1WMH B;  4IUM B;  1E7U A;  3ZYY X;  2DZI A;  1FXA A;  4M02 A;  1QQR A;  5JH5 C;  3NS8 A;  3U7Z A;  3IVF A;  3Q3F A;  3RNF C;  1UD7 A;  4W9E A;  3VFK A;  4YTP B;  2KN4 A;  3BVZ A;  2FCQ A;  2WMJ A;  2D3B A;  2VZK D;  4EZL A;  3L10 B;  2WYQ A;  2JU6 X;  1I4R A;  4WIP A;  4JQW C;  1ZPS A;  2Z0D B;  4TSS A;  4NAW A;  2DNF A;  1KF6 B;  4G3X B;  3L13 A;  2WNM A;  4MM3 B;  5FK9 C;  4LNI A;  1BUI C;  2L0F A;  3Q8C A;  1KH0 A;  4RF1 A;  4B95 A;  3R66 C;  4MH0 E;  2ZPN A;  2IY0 B;  2IO0 B;  1Y56 A;  4HKZ E;  1LFD A;  4RF0 A;  2W3S A;  2D3A A;  3AE7 B;  2LVP A;  4HLE A;  4IKG A;  3UGB B;  1E9M A;  5IKC M;  1YNT E;  2ZZP B;  4HDO A;  1TZO A;  2AEH A;  2W54 A;  2KWU B;  2WX1 A;  1TYG B;  3RNA C;  4BKT A;  2LD9 A;  2KDB A;  4GN1 A;  2N1W A;  1MHX A;  1TIF A;  3KQ4 A;  3RT3 B;  4WWM A;  1LO5 D;  4RM8 A;  5EE0 A;  4HRO A;  2J53 A;  3LB8 C;  3ZTD A;  2LUM A;  4DHJ D;  3AE6 B;  5E6P A;  2W3R A;  5AEK B;  3NG0 A;  1EO6 A;  1LM8 B;  4KSK C;  4MT5 A;  4W9G A;  4MEM A;  3WCQ A;  3LXF A;  4YL8 A;  1OFF A;  3W1Y A;  3WA0 A;  1Q0W B;  1ZE3 D;  2L8J A;  4TQ0 A;  1HQR D;  2KNB A;  4C4V B;  3DBH B;  2ZCB A;  1XCQ L;  3W1S C;  1L0Y B;  4TQ1 A;  1B1Z A;  1TY2 A;  1VRA B;  2Y5P A;  2YEP F;  4XYC A;  3PZ7 A;  4P16 A;  3QAQ A;  2PW9 A;  4IOI E;  3Q2A C;  1H4R A;  2G4D B;  4ZRP A;  4XWW A;  2N9L A;  4XE0 A;  5JXV A;  3AU4 A;  1OQQ A;  3PZD A;  2M19 A;  2ZVO A;  3TSS A;  2WXL A;  5KHO A;  2KJ6 A;  3NY5 A;  1WYW B;  2VH2 A;  2K8C A;  5LXH A;  4TMA B;  3DBL I;  4WAA A;  1N61 A;  1FM0 D;  2BKR B;  4NQL B;  4JWS C;  2I1J A;  3D32 A;  1HTQ A;  3HM6 X;  4HPP A;  4FLH A;  1C3T A;  2V9H A;  1VZ8 A;  4XWT A;  2ZEQ A;  4K3C A;  1I4Q A;  4BVU C;  3LYY A;  1L4D B;  4M8M A;  1FNV A;  2LAS A;  1WJN A;  3JSV B;  2KJH B;  2WDT B;  2BS4 B;  4WJQ A;  3Q3O C;  3DBS A;  3NRZ A;  4GB9 A;  3OJ3 A;  2NS5 A;  4AUQ C;  1L0V B;  1ET6 A;  2L83 A;  2R2Q A;  3HK0 A;  1UEL A;  3KYC D;  2L32 A;  4DWF A;  3W5V B;  4GDL A;  2CR5 A;  3ZNG C;  4S17 A;  4YXD B;  2FCM A;  5DPT A;  5JZE B;  4HDQ A;  1EU3 A;  2R61 A;  4LTU A;  1TTN A;  3BVG A;  4HXD A;  5HKH A;  1Z5S B;  2WU5 B;  1FRD A;  2KD0 A;  1GJZ A;  2GLS A;  1KLU D;  5BYS A;  2JX5 A;  1PYW D;  3FIL A;  3P1M A;  1PQS A;  3U4E G;  2J0K A;  2GBJ A;  1SXT A;  2EMT A;  2J7Q B;  4IG7 B;  1K8R B;  2X8X X;  1WXA A;  1WFY A;  3TMP B;  4FHJ A;  1EWY C;  3SFD B;  5IP4 D;  3KWL A;  2WMK A;  3T8M A;  1WR6 E;  1D4B A;  1I4X A;  4E74 A;  2FBW B;  4GOC A;  2N1V A;  1QOA A;  4EKU A;  3NVW A;  4II3 B;  4ZHO A;  3ZQ4 A;  1C4P A;  4DDG D;  1EUV B;  1YJJ A;  1JAL A;  2BS2 B;  2AYO B;  3GB1 A;  3AN1 A;  3DHH C;  2K25 A;  2DX5 B;  1PUT A;  1AWD A;  5AZF A;  1KM7 A;  2WXQ A;  4BAX A;  2LJ5 A;  1LGR A;  4YSZ B;  2SEB D;  2H89 B;  2FIF A;  3TIX A;  2X38 A;  5I4D A;  2RPQ A;  2QJL A;  4RGT A;  4D6C A;  2WXI A;  5JHA A;  1V2Y A;  4W9J A;  2PVO D;  2Z59 B;  3QHT A;  2MQJ A;  5H8Y E;  3BIN A;  1JWB D;  1WF9 A;  1SE4 A;  2D3C A;  3KUD B;  2KT7 A;  4OZB A;  4HPM B;  3N20 C;  1CQV A;  4MEL A;  2KDI A;  4A9A A;  4AJW A;  4DXG A;  1WIA A;  4BKS D;  2WP9 B;  2WXG A;  4GIV A;  3UQA A;  3QK0 A;  2QMT A;  2RGF A;  3Q3M C;  3NS1 A;  3R7Q A;  2K6D B;  4N58 A;  5IOI A;  2VH1 A;  3KYD D;  3EEC A;  1FPY A;  2NBU A;  3BVM A;  2HJ1 A;  2MJ3 A;  2KX3 A;  2MHJ A;  3NVZ A;  1FCC C;  5BYQ A;  2WX0 A;  1WE6 A;  2K22 A;  3DVG Y;  3KWV A;  4ANU A;  1XO3 A;  3PRM B;  1JCK B;  2FUG 1;  4MGZ E;  2V1Y A;  3QCA A;  4ZRQ A;  4KIK B;  3RCZ A;  2G9H D;  1WMH A;  3E9S A;  4OW0 A;  1LLQ A;  1GPX A;  1FMA D;  4JPS A;  3WAN A;  4ZOH C;  3HVD A;  1WXS A;  2FID A;  5D94 A;  3DBR B;  4D6E A;  2Y5B B;  2KMA A;  4NPN A;  1UZX B;  1HZ5 A;  3VR8 B;  5L95 C;  3V3X A;  1E8W A;  4KVG B;  3Q69 A;  2KDM A;  2O2V B;  1E10 A;  2GBN A;  4X57 B;  2O6V A;  3B2G A;  4DBG A;  3WIM A;  1TS2 A;  2PIA A;  4KKI A;  4BKG A;  1I4H A;  2RPV A;  1E6E B;  3CIR B;  3NZ3 A;  4RGM A;  4OVU A;  4IW0 A;  1TGZ B;  2KOX A;  2ONQ A;  4ARC A;  4FJY A;  4OZC A;  2J52 A;  1J7A A;  2CHX A;  3PSE B;  2G1E A;  3M3J A;  4EEW A;  3R8B A;  2RDH A;  2LGI A;  3M95 A;  2M17 A;  4GMV A;  1R4M B;  4KKJ A;  4RM9 A;  4NQK E;  5D7G A;  3FAH A;  1F77 A;  2UU7 A;  4N9F 4;  2QC8 A;  3L17 A;  5LNK 1;  3PV1 A;  4BKS A;  1VDV A;  2KVR A;  2KQ7 A;  4D6J A;  2N9P C;  4P7I A;  3ZJV A;  2GBM A;  1NEN B;  2KLG A;  3ML9 A;  3BK2 A;  5EE1 A;  3ZNH B;  4MGY E;  2J0M A;  1SE2 A;  1T0Y A;  3GE3 C;  5D3I B;  2XNA C;  4A3P A;  1WM3 A;  4FXC A;  1SEB D;  3URY A;  3L16 A;  4C4V A;  3M62 B;  4WAF A;  2MEK A;  3H6N A;  1WI0 A;  1EM7 A;  1KJT A;  4G11 A;  4IDI A;  2JY6 A;  3C19 A;  2ZPY A;  4ZRI A;  3EC8 A;  2RMM A;  2WXJ A;  2INP E;  3LDZ E;  4D6D A;  3VTV A;  3APC A;  2E6X A;  2IJ0 A;  4H2A A;  3R2T A;  3OWE B;  1V81 A;  1K52 A;  1E8X A;  1PFD A;  1JML A;  4K81 A;  3MFG A;  2BPS A;  2MWS B;  1P7E A;  2NBW B;  4MGI E;  1P98 A;  4B6W A;  3PHW B;  1L2N A;  4ANV A;  3KH0 A;  3AEF B;  1RLF A;  1T3Q A;  1LXD A;  2W9N A;  4MGK E;  1HZ6 A;  3DVN U;  3VDZ A;  1FCL A;  2J4X A;  3IT6 B;  4XDD A;  2V4L A;  3AE8 B;  3JSV A;  2WXN A;  3QIJ A;  3B0A A;  1TBE A;  4OHJ A;  1WRD B;  3ZJT A;  3HIZ A;  1YQ3 B;  1GOZ A;  2H88 B;  1PGA A;  3GZN I;  1BXT A;  5LXI B;  1WXM A;  1EF1 A;  1UWX A;  2LZ6 A;  2OJW A;  3ETR A;  3AEG B;  1X1M A;  2DYO A;  3ZW3 A;  3M63 B;  1HEZ E;  3VUW A;  5HHD G;  2KHW B;  2WMH A;  2K8B A;  2LVQ A;  1TZ1 A;  4YTN B;  4C80 A;  2JVC A;  2WMI B;  2QCZ A;  1YMH E;  2ZVN A;  3ML8 A;  4FA6 A;  1WX7 A;  3ZNZ B;  2K9X A;  2DZM A;  2MLB A;  4L23 A;  4HJG E;  4WQO B;  1JW9 D;  4HVB A;  3DVG X;  4XGA B;  2XK5 B;  4ICU A;  2LXA A;  1AYF A;  2ZNV B;  3MC0 B;  1V9J A;  3O13 A;  2NMQ A;  1VZ7 A;  2BYV E;  3TJP A;  5AZG A;  5TSS A;  2ASQ A;  2D11 A;  5JHB A;  3ZVV A;  1VR9 A;  1P3Q U;  1C4A A;  4EZK A;  1C1Y B;  4D6G A;  2CHW A;  4LDT B;  3SU8 X;  2GB1 A;  2JYT A;  3A4R A;  2N9E B;  2KFK B;  4JX1 C;  4I6N B;  4F1S A;  2KWD A;  4G50 A;  1JWM D;  4IM3 A;  4LNN A;  5C2T B;  4PT5 A;  1QOF A;  4ACF A;  4YSX B;  4RGO S;  4A3O A;  3I5J C;  5L83 A;  2JWU A;  3A1Q B;  4MDK E;  2NBV B;  4RGN A;  2OHF A;  2O6V B;  4LNF A;  1JRO A;  1F0Z A;  2DBY A;  3X23 A;  1NYQ A;  3RPF C;  4DDI D;  1T0R C;  4USA A;  3AE4 B;  3Q3J A;  3QX1 A;  1G6J A;  1IGC A;  4AQ7 A;  2JXX A;  4XX5 A;  2MX2 A;  4K3B A;  1C4C A;  3T3N A;  1WJ6 A;  2BYT A;  3W9C B;  3NVV A;  1SIF A;  2MJD A;  4M0W B;  3PVL A;  4KZC A;  1WGK A;  2L76 A;  3R3M A;  1UGJ A;  3A4S C;  5FR6 A;  2N7D A;  2LFI A;  1WX9 A;  3UF8 A;  1N60 A;  3ZUN A;  3AEB B;  3L0W B;  3ZRC A;  3T9L A;  2KTF A;  3ZXV A;  1XEE A;  2N0S B;  4ZDV A;  3EA6 A;  4B9K A;  4AS1 A;  2KMM A;  1GNU A;  4WWN A;  1J0G A;  3PT2 B;  1JWU D;  3RZW C;  1WZ0 A;  2LJI A;  2BB5 A;  4KIK A;  4BOZ B;  4L2Y A;  3J9C A;  5J17 A;  1JQ4 A;  4G0N B;  1RRB A;  5G5G A;  1SBB B;  1Q5W B;  1SB3 C;  2IYD B;  3B08 A;  3AEC B;  5J18 A;  4EE2 A;  1T0S C;  3CST A;  4ZYS A;  2Y5C A;  4KZ0 A;  1C76 A;  1ZDV A;  4F7Z A;  2D3G A;  2V3P A;  4N59 A;  1YX5 B;  1HA5 A;  2IGD A;  3JYU A;  1FNU A;  4HCN B;  4O1N A;  4ARI A;  4M01 A;  2WQY B;  2V0G A;  2LXC A;  2HD5 B;  4W9F A;  1UNS A;  2O2V A;  1WGH A;  4JWU C;  1WXV A;  1SE9 A;  1WH3 A;  1Q10 A;  2G3Q B;  2KXJ A;  4OVV A;  3RD2 A;  3VH4 B;  4EZJ A;  2AX5 A;  1ESF A;  2CHZ A;  4LNO A;  2C7M B;  5EE9 A;  2HTM E;  3SR6 A;  2KC2 A;  2MBB B;  1YQ4 B;  1Q1O A;  4I6L B;  4WUR A;  4HK2 A;  4ZRJ A;  1VLB A;  1A5R A;  3H7P B;  2ZJD A;  1V6E A;  4M00 A;  3RNB C;  5CTR C;  4ZYN A;  1U4A A;  1V1P B;  1NI2 A;  2NCN A;  2SAK A;  2GMI C;  4D71 A;  2WGS A;  1YJI A;  2PLP A;  1OQR A;  4HJK A;  3UIO B;  3VUX A;  1R4N B;  2NPT B;  1XLP A;  1D5M C;  2MP2 A;  1K50 A;  1TT5 B;  3DBH I;  4B0E A;  1TKE A;  2L00 B;  3OAW A;  4M8N A;  1TJE A;  4W9K A;  3ALB A;  2MA9 B;  1XT9 B;  1F1H A;  2WDR B;  5T8I A;  4C7Z A;  5D6J B;  1D3Z A;  1QF6 A;  3U7D A;  2KWC A;  3A9J B;  4RFB A;  1IGD A;  2LGD A;  2DZK A;  4IWP A;  1MG8 A;  4DXF A;  3RYT A;  4A20 A;  3RZF A;  3LJ3 A;  3O65 B;  1C78 A;  3MC8 A;  4LLG M;  1QZE A;  3RI7 C;  3VHT C;  2MH7 A;  4PK1 A;  1L0X B;  4FJV B;  3EGR A;  1NBF C;  2KN5 A;  3QJZ A;  4AJY B;  3DQV A;  2INN E;  2DYB A;  2O6V D;  3PGE A;  2MRP A;  2C9W B;  2N9X A;  3AU5 A;  2PEA A;  1UGM A;  3Q8F A;  4E3C A;  2NVU I;  1EU4 A;  2XEW A;  4FAD A;  5FR3 A;  4KGR A;  2PJH A;  1V8C A;  2D2Q A;  2WXM A;  1PGX A;  3P4P B;  1RWS A;  2D07 B;  2YLM A;  1E7V A;  2G45 B;  3R2I A;  2C5L C;  3A9K B;  4MSQ B;  4NY0 A;  1MI0 A;  3PRZ A;  2L0T A;  3UIP B;  4DHZ B;  2QEJ C;  1YN4 A;  2XN9 C;  3DVN V;  1OQY A;  2JF5 A;  1IYF A;  3FC4 A;  3BII D;  2NTT A;  4Q2J A;  2WMG A;  1WGY A;  1V5T A;  1PGB A;  1XLQ A;  4QAY A;  2KLC A;  2WMI A;  1E5W A;  2JYE A;  2BKF A;  1WY8 A;  2QSD A;  2LHD A;  1FIQ A;  4YTM B;  1WWT A;  3MJW A;  4WJO A;  4FUL A;  1NYR A;  2XK5 A;  4A55 A;  2CJN A;  2HTH A;  3QAR A;  3S2A A;  2JZP A;  2ICI A;  1SE3 A;  2WXF A;  3BZD B;  2N7E A;  2C60 A;  1XD3 B;  2K6Q A;  4JE3 B;  2TSS A;  3DHI C;  3BWU D;  2WXR A;  2IO1 B;  3IG3 A;  3PPA A;  1T0Q C;  5J2R A;  2KFK A;  2NTS A;  1KLG D;  2DHZ A;  2KK8 A;  2CS4 A;  3KW5 B;  2REX A;  1CZP A;  1OEY J;  1ZDX A;  5BYR A;  3I9V 1;  4XC2 A;  1MJD A;  3IXS A;  1GC6 A;  2EKI A;  1V86 A;  4BBN F;  4TV3 A;  1ZP0 B;  4XZ4 A;  3BK1 A;  1RFA A;  3U8Z A;  5G55 A;  3TL5 A;  3A1Q A;  1WSP A;  3HUI A;  3I57 A;  3VH3 B;  5AZH A;  4D72 A;  5D2M B;  3RMK C;  3U2S C;  1BT0 A;  5CX3 A;  1M94 A;  5HFY A;  3AE3 B;  2KQS A;  1N62 A;  4LJP B;  2RR9 A;  3P42 A;  3NOB A;  1YD8 U;  3I63 C;  5IAA C;  3KUC B;  3AED B;  3N30 A;  3DOW A;  2EEL A;  4M0W A;  3P4R B;  4WQM A;  1DGJ A;  1S1Q B;  1ZW7 A;  3ZNI D;  3V05 A;  2CKH B;  1I35 A;  2I38 A;  1YJ1 A;  1DOX A;  2I1K A;  2FE8 A;  2KZR A;  2JRH A;  2MBH A;  3RNG C;  1P1A A;  4ASW C;  3TUO A;  3TEY A;  2YEP B;  1SF0 A;  2LWP A;  1WR1 A;  2DWQ A;  3ZGZ A;  1AN8 A;  2MP2 B;  2IBI B;  3VVW B;  4CHK A;  1TY0 A;  1TS3 A;  5D3D A;  4LK0 M;  1YQB A;  3QA8 A;  3RUL A;  3RFZ B;  1BML C;  1XXG A;  1F2R C;  3DBR I;  3IAM 1;  3MC9 A;  4N6E B;  2C7N B;  1FRR A;  1L7Y A;  1UF0 A;  1WZ3 A;  1FFU A;  3DWM A;  4RNA A;  2QDF A;  2QIE B;  1YX6 B;  4RMA A;  2WMF A;  4K7U A;  4P6V F;  2PVG C;  2ACZ B;  3JW0 X;  2CJO A;  3V60 A;  1WJU A;  2KDF B;  3RNE C;  3MTN B;  1ZOY B;  2AQ1 B;  4GLS C;  2DLB A;  2K39 A;  2K5P A;  2L1A A;  2ZNV C;  4AP4 C;  1J7C A;  3VUY A;  1WRI A;  4W9C A;  2IZV B;  2LGS A;  1STE A;  3H9D A;  4EFO A;  4NJC A;  3K9P B;  4BOS C;  2KAJ A;  5GXG B;  1R4M I;  1GB4 A;  1C77 A;  5H92 C;  4HRS A;  3H7P A;  3PS6 A;  5DPS A;  3SEB A;  1NDD A;  2M0X A;  4D2K A;  3UIN B;  1SIJ A;  4ITK A;  4US8 A;  1V1P A;  5AUI A;  1QOB A;  1CMX B;  1UWM A;  2ON8 A;  2V4I B;  1E8Y A;  3AUL A;  4GXB A;  4DK5 A;  4YT0 B;  1JRP A;  4J6I A;  4IWO A;  2WU2 B;  1GB1 A;  1ACC A;  1N6Z A;  4REZ A;  2MBQ A;  2DZJ A;  4OZA A;  3DWG C;  2NPT A;  5DPW A;  1N5W A;  1VD2 A;  2L3Z A;  1Y8R C;  2BVC A;  2DAF A;  1XF5 L;  1VJK A;  3UI3 A;  1OTR B;  2GI9 A;  3NZS A;  4YWG G;  4DHZ E;  1RAX A;  2AWT A;  3EUB 2;  4WH4 A;  2HDE A;  5MPO A;  3QQ8 B;  2ZCC A;  5FKA C;  5LLI A;  5EE3 A;  1I4G A;  2WXK A;  3A9J A;  2RDB C;  4NJ6 A;  3V6C B;  4PS8 A;  1D5Z C;  4KGS A;  3CSF A;  1A70 A;  4BBN C;  4W9L A;  2MBE A;  2LVO A;  1TKY A;  1QLB B;  2B3A A;  5C3J B;  5TR5 A;  5G2N A;  3SD5 A;  4GSW A;  3MHS D;  3V6E B;  3IAS 1;  3N9Y C;  3ZIM A;  3U52 E;  3X0W A;  2EMS A;  1WGR A;  2BYF A;  1VZ6 A;  2INC C;  3OLM D;  4FN2 A;  1YOV B;  1UH6 A;  3ZRF A;  2LGY A;  3VR9 B;  4E71 A;  1YN3 A;  3BYY B;  3WAP A;  5E6J A;  3V61 A;  3AEA B;  3N1X C;  2WWZ A;  3N1Z C;  3E56 A;  1XLO A;  1ZXI A;  3CWI A;  2WXO A;  3A9K A;  1F2R I;  1FEH A;  3VTU A;  2LUE A;  3A33 B;  2N9K A;  5HG2 A;  5DCN A;  1NVI D;  2NR2 A;  3DHG C;  1KOT A;  4LJO B;  2KC1 A;  1WXQ A;  4PS7 A;  4K1R B;  3NHE B;  3FKY A;  2LRW A;  5C23 A;  2BW2 A;  3GE8 C;  1NI3 A;  1IBX A;  2IGG A;  3ZKJ C;  3P63 A;  3Q6B A;  4K7S A;  1WJ4 A;  3HM3 A;  2KWV B;  2DYM A;  4MH8 A;  3DBL B;  1ZGU B;  2IGH A;  2MBO A;  1EF5 A;  2XBB C;  3PZ8 A;  4II2 B;  2QIL A;  3ZXR A;  3B9J A;  2DAJ A;  2FAZ A;  2JUO A;  3BY4 B;  1MG4 A;  1FXT B;  3ZDM C;  3Q3N C;  4TUU A;  2PKO A;  3Q8A A;  4BFR A;  3VAW A;  3AH7 A;  4GDK B;  1OGW A;  1QOG A;  3H8H A;  4ANW A;  4PS3 A;  1WX8 A;  5HI1 A;  3TEZ A;  3P4S B;  1QKZ A;  1I42 A;  1D5X C;  2BS3 B;  2GBR A;  3PTF C;  2IY1 B;  4PYU A;  1VCB A;  5GMV A;  2UYZ B;  4JL9 A;  4MSM B;  3Q8E A;  1V80 A;  2Q5W D;  2AQ2 B;  4DQO C;  3MHZ A;  2KAN A;  4C7Y A;  2E3T A;  1RFK A;  4HWI B;  2KJR A;  1I4P A;  2M0A A;  2Z8L A;  2M1M A;  4MJS B;  3P2B A;  1AAR A;  1GAQ B;  1CK1 A;  3ENE A;  2IPK D;  3RNC C;  4JGH B;  1FFV A;  1N63 A;  1L6U A;  2V3S A;  1FNW A;  3IHP C;  1E90 A;  2PE6 B;  2KQ4 X;  3SFE B;  3IBE A;  1KRH A;  4EOY A;  3OG5 A;  3L54 A;  3MJ5 A;  4IM0 A;  3C8Y A;  3PLU A;  4CO7 A;  1XLN A;  1WGG A;  2GOW A;  4WWP A;  3TEX A;  1E8Z A;  3KUZ A;  1P7F A;  1IUE A;  2L52 A;  3H7S A;  3DDC B;  3L08 A;  4UDU C;  3APD A;  1JRU A;  3PRP B;  1F9J A;  3APF A;  3TCA A;  4HKQ A;  5IN7 A;  1KFY B;  2J42 A;  1HE8 A;  1UUP A;  5EDS A;  1SGH A;  1QIL A;  4KDL B;  1RM6 C;  4NJ7 A;  1QT9 A;  4YSY B;  4W9I A;  2WS3 B;  2B76 B;  2D5G A;  3EFU A;  4NAM A;  3B2F A;  4LDT D;  3GS2 A;  3NUH B;  2MSE D;  2N7J A;  2YVC A;  3AE1 B;  1ET9 A;  5G5H A;  1UBI A;  2PMV A;  3CMM B;  3OJ4 B;  2PTL A; 
#chains in the Genus database with same CATH homology
 3BK1 A;  2H88 B;  1MHX A;  1MHH E;  1PGA A;  1WSP A;  3HUI A;  3I57 A;  3ABV B;  3KQ4 A;  1BXT A;  4WWM A;  1LO5 D;  1UWX A;  5EE0 A;  4HRO A;  2J53 A;  3LB8 C;  3AB5 A;  2LUM A;  3AE6 B;  3ETR A;  2W3R A;  3AEG B;  3U2S C;  2DYO A;  4MT5 A;  3WCQ A;  1HEZ E;  5HFY A;  3LXF A;  3AE3 B;  1N62 A;  1OFF A;  5HHD G;  4J3O D;  1ZE3 D;  4TQ0 A;  1HQR D;  3BYT B;  4YTN B;  3P42 A;  4C80 A;  2WLB A;  2ZW0 A;  3AED B;  1XCQ L;  1YMH E;  1L0Y B;  4TQ1 A;  2EEL A;  1B1Z A;  4M0W A;  3P4R B;  4WQM A;  2K9X A;  1TS4 A;  1TY2 A;  1TKG A;  1DGJ A;  1DYQ A;  4L23 A;  3V05 A;  1VRA B;  2Y5P A;  2YEP F;  4HJG E;  2BB6 A;  2WXP A;  1B9R A;  1MVK A;  1AW7 A;  2I38 A;  3PZ7 A;  4P16 A;  1JW9 D;  1DOX A;  2FE8 A;  2PW9 A;  4IOI E;  4XWW A;  4ZRP A;  3TUO A;  1L4Z B;  5AUK A;  2N9L A;  3TEY A;  2YEP B;  1SF0 A;  4XE0 A;  5JXV A;  2JXT A;  1OQQ A;  2DWQ A;  3ZGZ A;  2M19 A;  1AN8 A;  1AYF A;  1JWA D;  3TSS A;  2WXL A;  3MC0 B;  3O13 A;  3MP9 A;  2NMQ A;  4NAW B;  1TY0 A;  3TEW A;  1TS3 A;  1VZ7 A;  5D3D A;  4LK0 M;  4TMA B;  5TSS A;  3RFZ B;  1IBX B;  1BML C;  1VR9 A;  1N61 A;  1XXG A;  1C9F A;  1FM0 D;  1F2R C;  1C4A A;  2K3U A;  4JWS C;  3IAM 1;  4N6E B;  2GB1 A;  2JYT A;  1FRR A;  1VZ8 A;  3HRD D;  4XWT A;  1MPE A;  1I4Q A;  4JX1 C;  1FFU A;  3DWM A;  1L4D B;  3LYY A;  4ZHP A;  4RNA A;  1FNV A;  2KWD A;  2QIE B;  2IDY A;  1L6V A;  1JWM D;  5C2T B;  4PT5 A;  1QOF A;  4YSX B;  3W5U B;  4RGO S;  2BS4 B;  4P6V F;  3L4P A;  2PVG C;  2W55 A;  2ACZ B;  3NRZ A;  2JWU A;  2CJO A;  1L0V B;  1ET6 A;  1DOI A;  2L83 A;  1ZOY B;  4RGN A;  2OHF A;  2L32 A;  2AQ1 B;  4GLS C;  5BMG A;  1JRO A;  2DLB A;  1FXI A;  4L1B A;  4HEA 1;  3W5V B;  1F0Z A;  2DBY A;  2LMC A;  2K5P A;  2L1A A;  3AE9 B;  1NYQ A;  4NZL B;  3RPF C;  2V3N A;  1J7C A;  4USA A;  1WRI A;  3AE4 B;  4YXD B;  1IGC A;  4AQ7 A;  1M4V A;  1K51 A;  1STE A;  3KLS X;  1EU3 A;  3AE5 B;  4NJC A;  1C4C A;  3T3N A;  2R61 A;  2KAJ A;  5GXG B;  4LTU A;  1ZXH A;  2AQ3 B;  2BYT A;  3W9C B;  3NVV A;  1GB4 A;  1C77 A;  4KX6 B;  5H92 C;  2OED A;  3BVG A;  4HRS A;  2MJD A;  2WU5 B;  1FRD A;  2LEK A;  3SEB A;  1YN5 A;  2I2Y A;  1KLU D;  5BYS A;  2JX5 A;  1PYW D;  4A8X C;  4D2K A;  2KAC A;  1SIJ A;  3FIL A;  4ITK A;  5BMI A;  1WGK A;  3P1M A;  4US8 A;  3U4E G;  1UGJ A;  1V1P A;  5AUI A;  2BBC A;  1QOB A;  1UWM A;  2W82 A;  2LFI A;  3AV8 A;  2ON8 A;  2V4I B;  1SXT A;  1N60 A;  3AEB B;  1JRP A;  4YT0 B;  2WU2 B;  1XEE A;  2N0S B;  1L5P A;  3EA6 A;  1ACC A;  1GB1 A;  4REZ A;  1EWY C;  4OZA A;  3DWG C;  4AS1 A;  3SFD B;  1N5W A;  2KMM A;  3KWL A;  1ENF A;  1N5X A;  1JWU D;  1D4B A;  1XF5 L;  1I4X A;  1VJK A;  3UI3 A;  2GI9 A;  1K53 A;  2LJI A;  3HVZ A;  2BB5 A;  4YWG G;  4L2Y A;  3EUB 2;  3J9C A;  1JQ4 A;  2FBW B;  1QOA A;  4US9 A;  4WH4 A;  1XCT L;  3AEE B;  2HDE A;  5MPO A;  3NVW A;  1KTK A;  1T6B X;  5G5G A;  1SBB B;  4ZHO A;  3ZQ4 A;  1C4P A;  1SB3 C;  5FKA C;  3AEC B;  1YJJ A;  2VZK B;  4EE2 A;  5EE3 A;  1JAL A;  1NEK B;  1I4G A;  2BS2 B;  3GB1 A;  3AM9 A;  3AN1 A;  4ZYS A;  2WXK A;  2Y5C A;  3VRB B;  3P4Q B;  1PUT A;  1C76 A;  1ZDV A;  4XDC A;  1AWD A;  1V1O A;  2V3P A;  3ZJU A;  2WXQ A;  1D5Z C;  4KGS A;  4N59 A;  1A70 A;  1HA5 A;  2IGD A;  3PO0 A;  2GRI A;  1FNU A;  4O1N A;  4ARI A;  4YSZ B;  2WXH A;  2SEB D;  2H89 B;  2WQY B;  2X38 A;  1R7S A;  5I4D A;  2V0G A;  2QJL A;  4RGT A;  1TKY A;  1QLB B;  2WXI A;  1UNS A;  4A90 A;  1SJE D;  4JWU C;  5C3J B;  2PVO D;  1Q10 A;  1JWS D;  5H8Y E;  3AE2 B;  1JWB D;  4GDL B;  1PDX A;  1SE4 A;  2AX5 A;  3IAS 1;  4OZB A;  3W2D A;  1ESF A;  2K0P A;  3N9Y C;  3U52 E;  5EE9 A;  2HTM E;  3SR6 A;  1VZ6 A;  1CQV A;  2JSV X;  1YQ4 B;  4OVZ A;  4A9A A;  4DXG A;  4WUR A;  1J7B A;  2WP9 B;  3GP7 A;  3NVY A;  1VLB A;  2RDG A;  2WXG A;  3VR9 B;  1YN3 A;  2QMT A;  3BYY B;  1ROE A;  3NS1 A;  2BT6 A;  1I7H A;  4N58 A;  5E6J A;  1SJH D;  3FIL B;  4B0M A;  3AEA B;  3AMZ A;  1V1P B;  2SAK A;  3BVM A;  3E56 A;  2MJ3 A;  1XLO A;  1ZXI A;  3CWI A;  3NVZ A;  2WXO A;  1FCC C;  5BYQ A;  1F2R I;  1YJI A;  1FEH A;  2PLP A;  2N9K A;  5HG2 A;  1OQR A;  3Q8B A;  1NVI D;  2K22 A;  1T5X D;  3KWV A;  1XLP A;  1C79 A;  1WXQ A;  1D5M C;  1K50 A;  4B0E A;  1EWC A;  1XO3 A;  1JCK B;  2FUG 1;  1TKE A;  5BMH A;  4ZRQ A;  1TJE A;  3IT4 B;  1FO4 A;  2G9H D;  3E9S A;  2BW2 A;  1NI3 A;  4OW0 A;  2IGG A;  3VRA B;  1IBX A;  3P63 A;  3VQI A;  1GPX A;  1FMA D;  4JPS A;  2WDR B;  5T8I A;  4ZOH C;  4C7Z A;  3HVD A;  2DYM A;  4MH8 A;  2IGH A;  1QF6 A;  1TS5 A;  3PZ8 A;  2QIL A;  3B9J A;  4RFB A;  1IGD A;  4DXF A;  4MAC A;  1V97 A;  1HZ5 A;  3VR8 B;  1SSN A;  2PKO A;  3V3X A;  3Q8A A;  1C78 A;  4LLG M;  3T3O A;  3Q69 A;  3AH7 A;  2MH7 A;  1L0X B;  4GDK B;  2KDM A;  1E10 A;  1QOG A;  3EGR A;  2MJE A;  3H8H A;  2M56 B;  3B2G A;  1D6E C;  1ZUD 2;  5HI1 A;  3TEZ A;  3P4S B;  1TS2 A;  1CJE A;  2PIA A;  2WDQ B;  4KKI A;  1QKZ A;  2INN E;  1I4H A;  1E0Z A;  2RPV A;  1E6E B;  3CIR B;  3NZ3 A;  4RH6 A;  4RGM A;  1D5X C;  2JQR B;  2ONQ A;  4ARC A;  2BS3 B;  4CQN A;  4OZC A;  2J52 A;  3Q8F A;  1J7A A;  3W1S A;  2WDV B;  2G1E A;  4KGT A;  3R8B A;  1EU4 A;  2RDH A;  1RYJ A;  2LGI A;  1FD6 A;  5FR3 A;  4KGR A;  3Q8E A;  2CU3 A;  1V8C A;  2Q5W D;  2WXM A;  1HXY D;  1PGX A;  2AQ2 B;  3P4P B;  1RWS A;  4KKJ A;  4DQO C;  2Y3A A;  3MHZ A;  5D7G A;  2LHE A;  3FAH A;  4C7Y A;  1F77 A;  2E3T A;  3R2I A;  1RFK A;  1I4P A;  2M0A A;  2ZW1 A;  5LNK 1;  2Z8L A;  4A6Q A;  1MI0 A;  4RCO A;  2QEJ C;  1YN4 A;  1VDV A;  2XN9 C;  1GAQ B;  1CK1 A;  1WYG A;  4C56 C;  2IPK D;  4R3D A;  2BTE A;  3ZJV A;  1NEN B;  3BK2 A;  5EE1 A;  1FFV A;  1N63 A;  1L6U A;  3FC4 A;  1DOY A;  1FNW A;  1SE2 A;  3BII D;  5D3I B;  2XNA C;  2NTT A;  4Q2J A;  4FXC A;  1E7P B;  1SEB D;  3URY A;  2KQ4 X;  4WAF A;  1PGB A;  3ZYY X;  2MEK A;  3SFE B;  1XLQ A;  1KRH A;  1EM7 A;  1FXA A;  3MJ5 A;  2JYE A;  4IDI A;  1QQR A;  3U7Z A;  3C8Y A;  2QSD A;  2LHD A;  1FIQ A;  2RMM A;  2WXJ A;  4YTP B;  2INP E;  2KN4 A;  3BVZ A;  4YTM B;  1XLN A;  1WWT A;  2E6X A;  3TEX A;  2VZK D;  2IJ0 A;  1P7F A;  1IUE A;  1NYR A;  2L52 A;  3R2T A;  4H2A A;  3OWE B;  4A55 A;  1K52 A;  2JU6 X;  1I4R A;  1PFD A;  2CJN A;  4UDU C;  4WIP A;  1JML A;  1ZPS A;  2JZP A;  2ICI A;  4HKQ A;  1SE3 A;  2WXF A;  3MFG A;  1KFY B;  3BZD B;  4TSS A;  1P7E A;  1KF6 B;  2J42 A;  4JE3 B;  1UUP A;  2TSS A;  2WNM A;  4MM3 B;  5FK9 C;  1BUI C;  3BWU D;  1QIL A;  3Q8C A;  1RM6 C;  2WXR A;  1KH0 A;  3AEF B;  1QT9 A;  1T3Q A;  4RF1 A;  4YSY B;  1HZ6 A;  2WS3 B;  1Y56 A;  4HKZ E;  2B76 B;  2D5G A;  4RF0 A;  1FCL A;  2J4X A;  3IT6 B;  2NTS A;  1KLG D;  2W3S A;  4NAM A;  4XDD A;  3B2F A;  1CZP A;  3AE7 B;  3GS2 A;  1ZDX A;  3AE8 B;  5BYR A;  3I9V 1;  3NUH B;  2WXN A;  2N7J A;  4IKG A;  1E9M A;  3AE1 B;  1YNT E;  3IXS A;  1ET9 A;  1TZO A;  2W54 A;  2EKI A;  1TYG B;  4OHJ A;  5G5H A;  3ZJT A;  1YQ3 B;  2PMV A;  1ZP0 B;  1GOZ A;  2PTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...