2YEPB

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 76
structure length 212
sequence length 212
chains with identical sequence D, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepB01
2V4IB 1VZ6A 1VZ8A 2VZKD 2YEPB 1VRAB 2YEPF 3IT6B 3IT4B 1VZ7A 2VZKB
chains in the Genus database with same CATH superfamily
3E9SA 3PSEB 4DHZB 5AZHA 2K8BA 3W5UB 3WANA 4RF1A 1J19A 3U7DA 2RGFA 5AUKA 1LFDA 1KRHA 3JYUA 2J52A 4GGQA 1KLGD 2CU1A 3PTFC 4KSKC 4OHJA 2BS4B 1GC6A 2ZVNA 5EE1A 4F7ZA 2FCSA 1AW7A 2SAKA 2RMMA 2O6VA 1ISNA 2MA9B 3KUCB 4ZHPA 4RGOS 2RR9A 2QDFA 4RM8A 1WXVA 3BYTB 4C4VB 1KH0A 1IGCA 4XE0A 2V3SA 5DPSA 3QJZA 3DDCB 2EKEC 3ZRFA 2GOWA 4HDQA 4GN1A 2JVCA 1SEBD 4A6QA 2UYZB 4W9FA 1WE6A 3U7ZA 2BWFA 3ZLZA 3RNEC 2OHFA 3I63C 1VZ8A 5BMGA 1UBQA 3IHPC 4MJSA 3UQAA 4A3PA 1UD7A 2RPVA 3DHIC 3RZFA 4F8CB 2BKFA 1TKEA 1OEYA 2D3BA 3LXFA 3ZRCA 1F2RC 3SHQA 1YJIA 5TSSA 1EF5A 3N9YC 5C1ZA 4N6EB 2W9NA 2JUOA 2WXQA 4HKQA 1LXDA 2E6XA 4A3OA 4KIKB 3AH7A 4HCPB 1XLOA 1D4BA 4DWFA 3RUIB 2LFIA 3FILA 4E3CA 1SGHA 2KFKB 2EMTA 1OGWA 2NPTB 4WIPA 3ML8A 2BB6A 1BMLC 2EMSA 3Q8CA 5BYSA 4HDOA 3VTWA 1NI3A 1AWDA 1OQYA 1OQRA 2HTME 1MG8A 1B9RA 3VQIA 4LLGM 4XWWA 3N30A 4JLCA 4MGYE 4LTUA 2DNFA 1FM0D 2KN4A 3SR6A 1WXSA 4HPMB 2WMGA 1KLUD 3APCA 2VH1A 2JXTA 2KOXA 4JGHB 2MQJA 4X57B 2WXKA 4K81A 2LVOA 2LVPA 4EZLA 2J0KA 1V1PA 5FR6A 1WRDB 4OW0A 3KW5B 4TUUA 1XLQA 3U30A 2PJHA 4DQOC 2FAZA 3HUIA 3EC8A 3CWIA 2KWDA 3P2BA 2CS4A 4EE2A 1HQRD 1A5RA 4LNFA 4L1BA 1E7PB 5J17A 4UDUC 1JCKB 1YQ4B 1L4ZB 3R66C 1U4AA 3VTUA 1WH3A 2V1YA 2ZNVC 3DVNU 1MVKA 3ZNHB 3BK2A 3IBEA 2LWPA 1L2NA 1N5XA 4M8MA 4HPPA 1TY0A 2D3CA 1WMHB 3ONSA 4M0WA 1VDVA 2ZW0A 5LLIA 3MJWA 5EDSA 1XF5L 1BXTA 4FULA 2M8SA 2RPQA 3OAWA 4FXCA 3UQBA 2KAJA 4HK2A 2W3RA 1HZ6A 4EZKA 1SIJA 2HD5B 2OJRA 1VZ6A 4RH6A 1JWSD 4II2B 4LK0M 4DDID 4YSZB 4YSYB 1MHHE 1VRAB 2VH2A 2IZVB 1WE7A 1GPXA 3BYYB 2MP2B 2ICIA 2QJLA 3D32A 1YQBA 2YEPB 2N9LA 1XCQL 1PGXA 2L00B 1SE2A 3J9CA 1ZP0B 3NG0A 5BO4B 2NS5A 1Q5WB 4N58A 3IT4B 5D3DA 2KQ4X 3VR9B 4M8NA 4OVVA 3TIXA 5E6NA 2NCNA 2KLGA 1V80A 1WX9A 3VDZA 4HJKA 1P0RA 2WWZA 4BFRA 3M62B 3ZJUA 3VRBB 1N6ZA 2GBJA 3B1LX 4PS7A 1HA5A 4BKGA 2MJ3A 2JRIB 1NI2A 2QEJC 4GXBA 1YX6B 2BYVE 3I5JC 3IXSA 3IFWB 4ARIA 2WMJA 2WX0A 1ZXIA 3KH0A 1ESFA 1V1OA 2M1MA 1RFAA 3I9V1 1SE3A 4W9CA 1YNTE 1L6VA 2V9HA 3LB8C 2CR5A 1IYFA 4HROA 1WIAA 3B2FA 4YWGG 2BYEA 1ZXHA 1XO3A 4BKSA 4KV2A 3GS2A 2JZPA 1HTQA 2N9PC 4YL8A 4NAMA 1SXTA 1SIFA 2KX3A 2TSSA 5FKAC 4I6PA 4IKGA 5IA7A 3NY5A 2XK5A 1PQSA 2NVUI 3IAM1 4NQKE 2CKHB 2PVOD 5DPTA 3BWUD 2WMFA 1NEKB 4JIOU 1TZ1A 2M0XA 2KWUB 1HEZE 4K7WA 4BBNF 4KX6B 2VZKD 3H7PA 2OOBB 2QC8A 4GU2A 4N9F4 2PE6B 1E9MA 2HJ8A 3VFKA 3TEZA 1OFFA 3FKYA 1QF6A 4AQ7A 3U2SC 4EUTA 4ZYSA 1WGGA 3ZVVA 3NHEB 2KHWB 2GB1A 3Q8AA 1T5XD 2MJDA 3A9JB 4BOSC 4CQNA 1CQVA 2N0SB 1IBXA 1WRIA 2PIAA 3L54A 4LNNA 3UIPB 3QK0A 4YT0B 1VCBA 1X1MA 4EOYA 4FA6A 4NJ6A 4DXGA 2J4XA 1JWMD 3Q8FA 3M95A 2WXIA 1V5TA 4D6HA 2X8XX 2IO2B 1V5OA 2MW5A 2E3TA 3NRZA 2JF5A 1GAQB 4MM3B 3BIID 4BAXA 3U52E 5E6PA 1J7CA 1F9JA 3C0RB 2KTRA 1J7BA 3ZJTA 3VUYA 5G5HA 3JSVA 1J7AA 2CJOA 1MG4A 1NYQA 1UZXB 3AN1A 5BYQA 1FXTB 5E6JA 3BY4B 3VXWA 4D2KA 4ZYNA 1V8CA 2KDEB 4HCNB 1EM7A 2L52A 3QX1A 2ONQA 1V2YA 1V49A 1CZPA 1SF0A 3MFGA 1WX8A 2BKRB 2ACZB 5D6JB 3TCAA 3QAQA 4R3DA 5C23A 2ZCBA 3AECB 2Z8LA 1E7VA 1P3QU 2K1FA 3ZNID 3IVFA 3W1SA 2L7RA 2GBKA 2INCC 1F1HA 2N1VA 3A9KA 3HIZA 1FMAD 3RYTA 4USAA 5CHVC 4A55A 3N1YC 1YIWA 1P7FA 4IDIA 3BVZA 1UF0A 3R7QA 1I4GA 4ICVA 5EE9A 1HTOA 2C60A 3HM3A 3WALA 2J0MA 2FBWB 1JRUA 2MBOA 1MJDA 2MX2A 5GMVA 4A8XC 1I42A 5BMIA 3V3XA 4WWMA 2O2VB 3DHHC 1IP9A 3KLSX 1EU3A 3ZKJC 1SSNA 4W9HA 3C8YA 2K6DB 1C9FA 1N61A 3ZO5B 4C00A 2N7EA 3N32A 1GUAB 4B9KA 3PS6A 2AYOB 3KUZA 4W9GA 2DENB 2N9EB 1LQBA 4MH0E 1DYQA 2DZIA 2L8JA 4K1RB 1RYJA 3UF8A 3P4RB 3AULA 3T3OA 4D6IA 1K52A 1GB4A 4ARCA 4TKNA 5CHFA 1XCTL 3PLVA 3ZJVA 2LHDA 2D11A 4TV3A 2FCNA 4S17A 1DOIA 1IBXB 1YN5A 2PKOA 2IY1B 1RAXA 1WGYA 1YJJA 3PREA 4JWSC 1UNSA 1JQ4A 3X23A 3MC9A 2K6QA 2WHIA 2WXMA 4P1CC 2K22A 3R7RA 1Y56A 1ZDVA 2IGDA 1ZKHA 2D07B 1TJEA 3DBHI 2JPHA 2L83A 2WMIA 3PRMB 2KMCA 2MEKA 2Z59B 2NTSA 2W3SA 1V81A 4D6FA 2YVCA 4K3CA 2GBRA 3GZNI 2BPSA 2G4SA 4KDIC 3PO0A 2FIFA 1L0VB 3TUOA 1RWSA 1WY8A 3BINA 4BZAA 3TJPA 3TL5A 5KHOA 3BZDB 4L2YA 5D94A 5JHBA 3M3JA 2DAFA 4ICUA 4DHZE 1ZUD2 2WU2B 3AB5A 2QSDA 2UWQA 4II3B 2K0PA 3ETRA 1VR9A 2CHWA 4HVBA 1SE4A 3L10B 4AS1A 2EKIA 3RNGC 2G4DB 4PYUA 3PHXB 2RDGA 5AZGA 1ROEA 2N4FA 1CJEA 2KVRA 1LLQA 1SBBB 2KACA 1N62A 2L0TA 4I6LB 1E8XA 3Q8EA 3RNCC 1JMLA 3GOEA 4A9AA 1UWMA 4ANVA 1PGAA 2BT6A 3DBRI 2C7HA 1AYFA 3OJ4B 4DBGA 4KKJA 2B3AA 5J18A 1V97A 4GDKB 4JPSA 1TBEA 3M63B 3ABVB 4FJZA 5D3IB 3DPDA 3L4PA 3ZW3A 2LRWA 5IOIA 3WAPA 1HZ5A 4GOCA 4AWJA 3EUB2 1ACCA 5AZFA 1XQQA 4MSMB 2ZVOA 2UU7A 3Q3JA 3BVMA 4IW0A 4D6CA 3W5VB 4NPNA 2LXCA 3MHZA 2M4NA 3Q3OC 4WJOA 2INNE 3DBHB 1WZ3A 2KFJA 4G0NB 2BB5A 5IKCM 5CX3A 2MH7A 2VRRB 3ZGZA 2JYEA 2KTFA 3GE8C 4ZRQA 2WXFA 4JX1C 2BW2A 3QHTA 2CHZA 3GZNB 4B95A 4ZRJA 3PLUA 2KDFB 2JSVX 4D71A 1RLFA 4D6GA 1XLPA 2MWSB 2WXJA 2N7JA 1H8CA 4GB9A 2WXRA 2PMVA 3VR8B 1J0GA 2BVCA 5EE3A 3JVZX 2HTHA 1NYRA 4JL9A 5LXIB 2KNBA 2LMCA 4KGRA 3NJTA 1YX5B 4B0EA 3NVVA 1WGRA 2JY6A 1LGRA 2PE9A 3GB1A 1AARA 3L16A 1T3QA 1XT9B 1FRDA 3E56A 2Q5WD 1Q1OA 4HRSA 4M01A 3OLMD 1L0XB 2KYWA 1C3TA 3T9LA 5TR5A 4KVGB 2WXLA 1HXYD 1XXGA 2D3AA 2WMIB 3DBRB 2K9XA 1L6UA 2O6VB 3EECA 5HKHA 1QLBB 1N63A 1NDDA 1XD3B 4ANXA 2KMAA 3ENEA 2BS3B 1E7UA 1PFDA 2WU5B 3QC8B 2V3NA 3AEGB 3HVZA 2BGFA 2O6VD 2W54A 3O13A 3SU8X 3PPAA 3P4QB 1RM6C 3AE6B 1NBFC 3N20C 2FUG1 1D5MC 3O65B 1I4XA 2MBBB 3DBLI 2R2QA 1EF1A 1FIQA 1QOAA 2DYOA 3KYDD 4IM2A 2KVZA 1WYWB 3QIJA 4IG7B 1WXMA 3HHMA 4MJSB 1C1YB 1WJNA 3P4PB 3ZDMC 4D6DA 1PUTA 5C3JB 1I4PA 1T0RC 3B9JA 4OVZA 2RDBC 3U8ZA 2V4IB 3OJ3A 1T6BX 4KDLB 2KDIA 2ZZPB 3MJ5A 3PV1A 4LNIA 4NQLB 4TQ0A 2PLPA 3FILB 3N1ZC 1K51A 4E71A 4ZRKA 3QQ8B 3A1QA 2N9KA 1GOZA 3SEBA 1JALA 1ET6A 3VVWB 1C76A 2XEWA 3AU4A 2D5GA 3MP9A 1XLNA 3BK1A 2GRIA 2Y5PA 2KLCA 3URYA 2FUHB 2K3UA 1PDXA 2M17A 4OZAA 1E8WA 1WJUA 3VH3B 1WR6E 4ZOHC 3PVLA 3QCAA 2WMHA 4W9EA 3SDLC 4QAYA 1I4RA 4XDCA 4H2AA 1V1PB 1KLVA 1M94A 1P1AA 2BTEA 1C79A 1WSPA 4MGZE 4AUQC 1D6EC 1L5PA 3L0WB 1ENFA 3CMMB 1OQQA 4NAWA 4N59A 4DXAB 3ZXVA 2CJNA 2JWUA 5IP4D 3ALBA 1E8ZA 4GSWA 3RMKC 2HDEA 3ECIA 4FJVB 5IAAC 3DBLB 2JX5A 4M02A 3H9DA 2FIDA 4ITKA 3RD2A 1QOGA 4W9JA 4A90A 2DZKA 2L0FA 4MGIE 2QCZA 2J0JA 3RNAC 3DCGA 3W1YA 1WWTA 1I7HA 2I38A 2PTLA 2FNJB 3HRDD 4WJQA 3VAWA 2AWTA 3VUXA 4C56C 2X38A 1OTRB 3P4SB 4XGAB 4M0WB 1UGJA 1VZ7A 2KK8A 5FR3A 1QZEA 4JE3B 2M0AA 1KJTA 4IC7B 4DDGD 1WX7A 2EELA 1CMXB 3Q2AC 4P16A 1F0ZA 1M4VA 5GXGB 2LUEA 1YD8U 2MRPA 1N5WA 2K39A 2JYTA 1KF6B 2YEPF 3VRAB 4IOIE 2PEAA 2LI5A 3V05A 2BWES 2CHXA 4URKA 4EFOA 3DOWA 2GMIC 4XZ4A 4MELA 2KC2A 3MTNB 4XYCA 4JWUC 2WXHA 3APFA 3PRPB 3AE1B 1FCCC 2IY0B 4HWIB 3T3NA 2MBHA 4G50A 5MPOA 1BUIC 5HI1A 4KSLC 3N3KB 3TEWA 2C9WB 4W9IA 3RN9C 1TIFA 2NR2A 4W9LA 4WAFA 4WURA 1QKZA 5EE0A 3DVGY 4LNKA 3ZNZB 2CU3A 3SFDB 4C4VA 4M00A 5I4DA 2HJ1A 3OG5A 3DWGC 2V3PA 2KJHB 2KKCA 2PW9A 3DQVA 3MHSD 5DPWA 1DOXA 1STEA 1D5ZC 2D2QA 4CYEA 4FJYA 3ZIMA 2V0GA 5T8IA 3AE5B 2LGIA 3ZTCA 1L0YB 4WWPA 4OVUA 4XDDA 2C7MB 4PS3A 1J8CA 2DZJA 2JU6X 3NUHB 1TS2A 2JXXA 4IWOA 4PK1A 3OWEB 4AJWA 1R7SA 2FE8A 2G9HD 3AE9B 3AXCA 5HG2A 1JW9D 4NJ7A 3NVYA 3A4SC 3R3MA 2WXPA 4ANWA 5JZEB 3ZDTA 3UGBB 1F52A 3R2IA 1V9JA 2IGGA 2DZMA 2MJEA 3HK0A 5JXVA 3U4EG 4LJOB 1FXIA 3RNFC 4KIKA 1C77A 1VD2A 3S2AA 2DYMA 2KFKA 4YTMB 3Q3NC 4ANUA 2R2OA 2NPTA 2AQ3B 3PZDA 2LUMA 1YN4A 1ZOYB 4GLSC 4MSQB 5DCNA 3V61A 4HKZE 1TS5A 4BKSD 2QILA 3N1XC 4PT5A 3VUWA 2XK5B 3Q3MC 3TEYA 4TMAB 2PVGC 3AE4B 5BYRA 1FFVA 4K7UA 4NY0A 1TZOA 3H7PB 2RDHA 4FHJA 3H8HA 2KZRA 2LGXA 2ZPNA 1P9DU 2Y3AA 2KO3A 4LDTB 1FFUA 2IO0B 4RMAA 1VLBA 4KZ0A 3RT3B 3IT6B 4LDTD 1ZDXA 5DPRA 2LXAA 4HLEA 2LGYA 2NMQA 2J42A 4ZRIA 4XX5A 5AUIA 4GDLA 4MDKE 5JH5C 1P7EA 1T0QC 4Q2JA 4TQ1A 4BKTA 2WYQA 2K8CA 1ET9A 1AN8A 2FCMA 2ZNVB 4RCOA 3NZSA 4LNOA 3PGEA 3SD5A 2YLMA 3ZYYX 1XEEA 5D7GA 4IWPA 2KTRB 4MH8A 1WJ4A 2A4ZA 1A70A 3JSVB 1WMHA 3FAHA 3WA0A 3KUDB 1L4DB 3WIMA 3EFUA 4W9KA 3DHGC 3A33B 3PRZA 1YN3A 2BBCA 4RM9A 2KWVB 1GG3A 3AEBB 3GE3C 4K3BA 1FCLA 4XWTA 2NBVB 3ZXRA 1UGMA 1FD6A 1E90A 4TSSA 1ZPSA 1CK1A 1UBIA 3VH4B 3UI3A 4FN2A 2AQ2B 3Q14C 3AMZA 4KZCA 3R2TA 2MP2A 2WMKA 1P98A 4P7IA 3WAMA 2MBQA 1F77A 3RPFC 3NZUA 4RGTA 2J7QB 2WLBA 1YOVB 5H8YE 3A9KB 1L7YA 1T0YA 5G55A 4D6EA 2L76A 1V86A 2I1KA 1EO6A 3DVGX 2BS2B 2AEHA 1NVID 3ZNGC 2NTTA 3ZTDA 4EZJA 2XN9C 3V6EB 4WQMA 2JZZA 2ZW1A 4IM3A 1SB3C 2I2YA 1BT0A 1TS3A 3PHWB 1K50A 3AE7B 4AOFA 1TKYA 4OZCA 2INDC 2WXOA 3KQ4A 4K7SA 2WS3B 4PS8A 4KGSA 3HVDA 3NVZA 2WDQB 4C7YA 4AJYB 3K9OB 2Z0DB 2AL3A 2PPHA 3H1UA 4YSXB 1T0SC 2QIEB 2L1AA 2XNAC 4A20A 1SJHD 4US9A 4EKUA 4HXDA 4HPLB 1WI0A 2GBNA 5E6OA 4C80A 2B76B 3EFCA 1KFYB 1JRPA 1WXAA 2LEKA 1LM8B 1IPGA 4DHJB 5KHQA 1B1ZA 3P63A 5L83A 4YXDB 2OEDA 4RF0A 3RI7C 3I3TB 1HE8A 1GNUA 1WXQA 3DVNV 4C7ZA 1MHXA 1TS4A 4DHJD 2WXGA 2QMTA 1MFWA 1C4CA 2WDTB 3H7SA 2L05A 3QARA 3VHTC 4RGMA 1GJZA 4RGNA 3PZ8A 1WR1A 4ZDVA 2Y5BB 2JZ3B 5LNK1 2MCNB 4ACFA 4GDLB 2INPE 1WM2A 5FK9C 1JWBD 2LD9A 4IM0A 4FHKA 1WGKA 5JHAA 2W55A 1FXAA 5G2NA 2DHZA 3CF6E 1FEHA 1JWUD 2G1EA 2DLBA 4IWQA 4AP4C 4KGTA 2OJWA 1WFYA 2C7NB 2LJ5A 1H4RA 2WNMA 2JRHA 1JROA 3WCQA 3A9JA 1Z5SB 2IBIB 3TMPB 3L17A 4YTNB 1K53A 1IGDA 3I57A 3ZUNA 3CIRB 3NOBA 4G3XB 1R4NI 5CTRC 1WJ6A 3MC0B 3H6NA 1UELA 1D3ZA 4RFBA 2KXJA 3TBLD 2IGHA 4E74A 2LGSA 3W1SC 1MPEA 1YJ1A 4B0MA 3AE8B 4MM3A 3EHVA 3RCZA 2G45B 4S0RA 3HM6X 4I6NB 3X0WA 4WQOB 4XC2A 3DBSA 4WH4A 3RNBC 1WM3A 4LJPB 1I4QA 1S1QB 2R61A 2C5LC 1TYGB 2WX1A 2QHOA 4NNJB 5H92C 3AU5A 2DBYA 2K8HA 1QILA 1GC7A 2KJRA 2H88B 2KT7A 3L13A 1FPYA 3QWZB 2LRUA 4JQWC 4P1BC 2BYTA 1E10A 2LVQA 3APDA 2DWQA 1PYWD 2KJ6A 2D10A 1YMHE 1C78A 1DOYA 3Q6BA 1EUVB 4RNAA 2KC1A 4WJPA 5BMHA 3AEAB 3JW0X 3AEEB 2N7DA 1WZ0A 2LJIA 1SJED 2Z0EB 4YTPB 3P1MA 2LASA 4WWOA 4NJCA 1YQ3B 3KWLA 3Q3FA 1EU4A 2RD0A 3KVFB 3NZ3A 2JQRB 4F1SA 1OEYJ 1I4HA 4BVUC 1ZE3D 4MEMA 2XBBC 2NBUA 4WWNA 4MGKE 1I35A 1ZGUB 1MI0A 1WGDA 2KDMA 2KD0A 2Y5CA 2RSUA 1GB1A 2ZJDA 1K8RB 3L08A 3IAS1 2WP9B 2V4LA 4GIVA 1R4NB 3QA8A 1E8YA 3UIOB 4OZBA 1E6EB 2G3QB 1KTKA 2IO1B 3EA6A 1ZW7A 3WAOA 2O2VA 4FLHA 2A5UA 2KANA 2VZKB 1KM7A 1TT5B 2AL6A 4LCDE 2ON8A 1F2RI 3AE2B 2GBMA 3RZWC 2KX0A 4IUMB 1V6EA 3V60A 4L23A 1DGJA 2GLSA 3AEDB 3AE3B 4WJNA 2HE7A 3LYYA 2BF8B 3V6CB 2I1JA 4KKIA 4BBNC 2NBWB 1FO4A 3P42A 1Q10A 2K25A 3Q8BA 4D6JA 1SE9A 4HEA1 2BQQA 2MBEA 3T8MA 4REZA 2M56B 3R8BA 2MLBA 4ZRPA 3LDZE 3EGRA 1KOTA 1FNVA 1RRBA 2MHJA 2KMMA 2WDVB 4ZHOA 1E5WA 5IO9A 3Q69A 1FNUA 1IUEA 2DX5B 2DYBA 1EWYC 3LJ3A 1EWCA 3RFZB 2L32A 3PZ7A 2ZPYA 3MC8A 1NENB 4P6VF 5L95C 4WAAA 1D5XC 2N9XA 4BOZB 2DAJA 3KYCD 3NS1A 3CSFA 3UINB 1WF9A 4NZLB 3A1QB 2AQ1B 1R4MI 2IYDB 2KN5A 1VJKA 2WGSA 4J3OD 4HJGE 1E0ZA 3CSTA 3FC4A 2D3GA 3PT2B 1QOBA 5D2MB 2IDYA 5HHDG 3B08A 2MSED 2ZCCA 1WGHA 3AEFB 3BVGA 2KWCA 3NS8A 2WXNA 2KDBA 2LGDA 4J6IA 2IO3B 5IN7A 1QQRA 1G6JA 4O1NA 4US8A 2FCQA 2H89B 1RFKA 2SEBD 4FADA 5HFYA 4CHKA 1UUPA 1Y8RC 1C4AA 1WYGA 1UH6A 1TY2A 3K9PB 1FNWA 4DK5A 2WQYB 3TEXA 1N60A 3B2GA 5J2RA 3V62A 4GDKA 2IJ0A 3AV8A 3A4RA 4NAWB 3B0AA 2IPKD 1LO5D 3ZQ4A 3RULA 3DWMA 2W82A 5CHWA 2L3ZA 3W9CB 2J53A 3W2DA 3VTVA 4CO7A 4PYZA 4W9DA 3TSSA 2LZ6A 2KQSA 4G11A 2K5PA 2JT4B 1PGBA 3KWVA 2LHEA 1TGZB 5AEKB 3NVWA 1TTNA 3ML9A 1S3SG 4MT5A 2JWZA 1C4PA 1Q0WB 1UWXA 1Z2MA 2N1WA 1FRRA 3AM9A 2ASQA 5G5GA 2REXA 3SFEB 3AI5A 2BYFA 4FBJB 5C2TB 2ZEQA 2WDRB 1JWAD 2AX5A 2M19A 4EEWA 3C19A 1QOFA 4ASWC 1R4MB 1O0SA 5LXHA 2GI9A 4MACA 4DXFA 1TKGA 4B6WA 1QT9A 3IG3A 2KQ7A 4GMVA 4D72A 3GP7A
chains in the Genus database with same CATH topology
1XLNA 3E9SA 1SJHD 1J7CA 4US9A 3BK1A 2GRIA 2Y5PA 4C80A 1J7BA 3ZJTA 3W5UB 2B76B 1KFYB 4RF1A 3URYA 5G5HA 1JRPA 1J7AA 2LEKA 5AUKA 2CJOA 1NYQA 2K3UA 3AN1A 1PDXA 4OZAA 1B1ZA 1KRHA 3P63A 5BYQA 2J52A 5E6JA 1KLGD 4YXDB 4D2KA 4ZOHC 2OEDA 4RF0A 4OHJA 1V8CA 2BS4B 5EE1A 1EM7A 1WXQA 1AW7A 2L52A 2SAKA 2ONQA 4C7ZA 1I4RA 1MHXA 1TS4A 4XDCA 4H2AA 1V1PB 2QMTA 1CZPA 1SF0A 2RMMA 2WXGA 1C4CA 4ZHPA 4RGOS 3MFGA 2BTEA 2ACZB 1C79A 1WSPA 3BYTB 1KH0A 1IGCA 4XE0A 4R3DA 4RGMA 4RGNA 3PZ8A 1D6EC 1L5PA 5LNK1 3AECB 2INPE 2Z8LA 4GDLB 5FK9C 1ENFA 1JWBD 1OQQA 3W1SA 4N59A 1WGKA 2CJNA 2JWUA 2W55A 1FXAA 2HDEA 2JX5A 1FMAD 3U52E 4ITKA 4USAA 4A55A 1QOGA 1SEBD 4A90A 4A6QA 1P7FA 4IDIA 3BVZA 1FEHA 1I4GA 1JWUD 2G1EA 3U7ZA 2DLBA 2OHFA 5EE9A 4KGTA 1WWTA 1VZ8A 1I7HA 2WNMA 5BMGA 2I38A 2PTLA 1JROA 3WCQA 2FBWB 4YTNB 3HRDD 1K53A 2RPVA 1IGDA 1TKEA 3LXFA 4C56C 3I57A 2X38A 1F2RC 3CIRB 1YJIA 3P4SB 5TSSA 1UGJA 3N9YC 4A8XC 1VZ7A 5BMIA 3V3XA 4N6EB 4WWMA 5FR3A 3MC0B 4JE3B 2M0AA 2WXQA 3KLSX 4HKQA 1EU3A 2E6XA 1SSNA 4RFBA 2EELA 1F0ZA 3C8YA 4P16A 1M4VA 3AH7A 5GXGB 1C9FA 1N5WA 1XLOA 1N61A 1D4BA 2JYTA 2IGHA 1KF6B 2YEPF 3VRAB 2LFIA 3FILA 4IOIE 3V05A 1MPEA 4B0MA 4WIPA 3AE8B 2BB6A 1BMLC 3Q8CA 5BYSA 1NI3A 1AWDA 1OQRA 1DYQA 2HTME 1RYJA 1B9RA 3VQIA 4JWUC 4LLGM 4WH4A 2WXHA 4XWWA 3P4RB 3T3OA 1I4QA 3AE1B 1K52A 4LTUA 1GB4A 4ARCA 1FCCC 1FM0D 2R61A 2KN4A 1XCTL 3SR6A 1TYGB 3ZJVA 1KLUD 2LHDA 3T3NA 1DOIA 2JXTA 5MPOA 1IBXB 1YN5A 5H92C 2WXKA 2PKOA 1BUIC 2DBYA 5HI1A 3TEWA 1QILA 1YJJA 4JWSC 2H88B 1UNSA 1V1PA 1JQ4A 4OW0A 4WAFA 4WURA 1QKZA 2WXMA 5EE0A 1XLQA 2K22A 2BYTA 1E10A 4DQOC 2CU3A 3SFDB 2DWQA 1PYWD 5I4DA 3HUIA 1YMHE 1C78A 3DWGC 1DOYA 1Y56A 2V3PA 1ZDVA 2IGDA 4RNAA 2PW9A 5BMHA 1DOXA 1STEA 1TJEA 3AEAB 1D5ZC 2L83A 3CWIA 3AEEB 2KWDA 2V0GA 5T8IA 3AE5B 2LGIA 4EE2A 1HQRD 1L0YB 2MEKA 2LJIA 2NTSA 1SJED 2W3SA 4L1BA 4YTPB 3P1MA 4XDDA 1E7PB 4UDUC 1JCKB 1YQ4B 2JU6X 3NUHB 1TS2A 4NJCA 1L4ZB 3PO0A 1YQ3B 1L0VB 3KWLA 3TUOA 1EU4A 1RWSA 3NZ3A 2JQRB 3OWEB 1I4HA 1R7SA 1ZE3D 2FE8A 1MVKA 3BZDB 4L2YA 2G9HD 1MI0A 3AE9B 5HG2A 3BK2A 1JW9D 2KDMA 2Y5CA 3NVYA 1ZUD2 2WU2B 3AB5A 1GB1A 2QSDA 1N5XA 3IAS1 2WP9B 1TY0A 2K0PA 2WXPA 3ETRA 4OZBA 1E6EB 1VR9A 1SE4A 4M0WA 1KTKA 1VDVA 2ZW0A 2EKIA 3EA6A 2IGGA 3R2IA 4AS1A 2MJEA 2RDGA 2VZKB 5JXVA 1ROEA 3U4EG 1CJEA 1FXIA 1SBBB 1XF5L 1N62A 1BXTA 2KACA 1C77A 4FXCA 3Q8EA 2KAJA 2DYMA 2W3RA 4YTMB 1HZ6A 2ON8A 1JMLA 1SIJA 4A9AA 1UWMA 1F2RI 2AQ3B 1VZ6A 1YN4A 1ZOYB 2LUMA 3AE2B 4GLSC 4HKZE 1TS5A 1JWSD 4RH6A 1PGAA 2BT6A 4LK0M 2QILA 1AYFA 4YSZB 4KKJA 4PT5A 4YSYB 1MHHE 3TEYA 1VRAB 4TMAB 2PVGC 4L23A 1DGJA 1V97A 4GDKB 3AE4B 3BYYB 5BYRA 1GPXA 2QJLA 2ICIA 3AEDB 4JPSA 3AE3B 1FFVA 2YEPB 2N9LA 1XCQL 3ABVB 3LYYA 1PGXA 3J9CA 1SE2A 1TZOA 4KKIA 2RDHA 5D3IB 1ZP0B 1FO4A 3L4PA 3P42A 1Q10A 3H8HA 3Q8BA 1HZ5A 3EUB2 1ACCA 4HEA1 4REZA 2M56B 3BVMA 2Y3AA 4N58A 3R8BA 3IT4B 5D3DA 3W5VB 2KQ4X 3VR9B 3MHZA 4ZRPA 1FFUA 2INNE 3EGRA 1FNVA 2KMMA 2WDVB 1VLBA 4ZHOA 2BB5A 1FNUA 3Q69A 2MH7A 3ZJUA 3ZGZA 1IUEA 2JYEA 4ZRQA 3IT6B 2WXFA 4JX1C 2BW2A 1ZDXA 3VRBB 1EWYC 1EWCA 3RFZB 2L32A 1HA5A 3PZ7A 2NMQA 2J42A 2MJ3A 1NENB 4P6VF 2QEJC 5AUIA 1D5XC 2JSVX 1P7EA 1XLPA 2WXJA 3NS1A 4Q2JA 4TQ1A 2N7JA 4NZLB 1ET9A 1AN8A 2AQ1B 4RCOA 3IXSA 4ARIA 1VJKA 1ZXIA 4J3OD 2WXRA 4HJGE 2PMVA 3VR8B 1ESFA 1V1OA 1E0ZA 3FC4A 5EE3A 1NYRA 1QOBA 3ZYYX 2IDYA 3I9V1 1SE3A 2LMCA 4KGRA 1XEEA 5D7GA 5HHDG 4B0EA 1YNTE 4MH8A 3AEFB 3NVVA 3BVGA 1L6VA 3GB1A 1A70A 3LB8C 4HROA 2WXNA 3FAHA 1T3QA 3B2FA 1L4DB 4YWGG 1ZXHA 1FRDA 1QQRA 3E56A 2Q5WD 1XO3A 4HRSA 4O1NA 4US8A 1L0XB 2H89B 1YN3A 2BBCA 1RFKA 3GS2A 2SEBD 2JZPA 3AEBB 2WXLA 4NAMA 5HFYA 1HXYD 1XXGA 1FCLA 4XWTA 1SXTA 1FD6A 2K9XA 1L6UA 1UUPA 1QLBB 1N63A 4TSSA 2TSSA 1C4AA 1ZPSA 1CK1A 1WYGA 1TY2A 5FKAC 3UI3A 1FNWA 2WQYB 4IKGA 3TEXA 2AQ2B 1N60A 2BS3B 3B2GA 1PFDA 3AMZA 2WU5B 3R2TA 3IAM1 2IJ0A 2PVOD 2V3NA 3BWUD 1NEKB 3AEGB 3AV8A 3HVZA 4NAWB 2IPKD 1F77A 1HEZE 1LO5D 2W54A 3RPFC 3O13A 4KX6B 4RGTA 3ZQ4A 2VZKD 3P4QB 1RM6C 3AE6B 2WLBA 3DWMA 2W82A 2FUG1 1E9MA 3W9CB 1D5MC 2J53A 5H8YE 3TEZA 3W2DA 1OFFA 1I4XA 4AQ7A 1QF6A 3U2SC 4ZYSA 1FIQA 1QOAA 2DYOA 3TSSA 2K5PA 1PGBA 2BS2B 3KWVA 2LHEA 1NVID 2NTTA 2GB1A 3Q8AA 1T5XD 2MJDA 2XN9C 3NVWA 3P4PB 4CQNA 4MT5A 1CQVA 1C4PA 2N0SB 1IBXA 1PUTA 1UWXA 4WQMA 1WRIA 2PIAA 2ZW1A 5C3JB 1SB3C 2I2YA 1I4PA 1FRRA 1TS3A 3B9JA 3AM9A 4OVZA 4YT0B 5G5GA 3SFEB 1K50A 3AE7B 5C2TB 1TKYA 4DXGA 4OZCA 2V4IB 2J4XA 2WDRB 1JWAD 2WXOA 3KQ4A 1T6BX 2WS3B 1JWMD 2AX5A 3MJ5A 2M19A 3Q8FA 4KGSA 1QOFA 3HVDA 2PLPA 4TQ0A 2WXIA 3NVZA 2WDQB 3FILB 4C7YA 1K51A 2GI9A 4MACA 4DXFA 1TKGA 2N9KA 1GOZA 2E3TA 3NRZA 1QT9A 3SEBA 1GAQB 4MM3B 1JALA 1ET6A 3BIID 4YSXB 1C76A 2QIEB 2L1AA 2XNAC 2D5GA 3GP7A 3MP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4I B;  1VZ6 A;  1VZ8 A;  2VZK D;  2YEP B;  1VRA B;  2YEP F;  3IT6 B;  3IT4 B;  1VZ7 A;  2VZK B; 
#chains in the Genus database with same CATH topology
 3E9S A;  3PSE B;  4DHZ B;  5AZH A;  2K8B A;  3W5U B;  3WAN A;  4RF1 A;  1J19 A;  3U7D A;  2RGF A;  5AUK A;  1LFD A;  1KRH A;  3JYU A;  2J52 A;  4GGQ A;  1KLG D;  2CU1 A;  3PTF C;  4KSK C;  4OHJ A;  2BS4 B;  1GC6 A;  2ZVN A;  5EE1 A;  4F7Z A;  2FCS A;  1AW7 A;  2SAK A;  2RMM A;  2O6V A;  1ISN A;  2MA9 B;  3KUC B;  4ZHP A;  4RGO S;  2RR9 A;  2QDF A;  4RM8 A;  1WXV A;  3BYT B;  4C4V B;  1KH0 A;  1IGC A;  4XE0 A;  2V3S A;  5DPS A;  3QJZ A;  3DDC B;  2EKE C;  3ZRF A;  2GOW A;  4HDQ A;  4GN1 A;  2JVC A;  1SEB D;  4A6Q A;  2UYZ B;  4W9F A;  1WE6 A;  3U7Z A;  2BWF A;  3ZLZ A;  3RNE C;  2OHF A;  3I63 C;  1VZ8 A;  5BMG A;  1UBQ A;  3IHP C;  4MJS A;  3UQA A;  4A3P A;  1UD7 A;  2RPV A;  3DHI C;  3RZF A;  4F8C B;  2BKF A;  1TKE A;  1OEY A;  2D3B A;  3LXF A;  3ZRC A;  1F2R C;  3SHQ A;  1YJI A;  5TSS A;  1EF5 A;  3N9Y C;  5C1Z A;  4N6E B;  2W9N A;  2JUO A;  2WXQ A;  4HKQ A;  1LXD A;  2E6X A;  4A3O A;  4KIK B;  3AH7 A;  4HCP B;  1XLO A;  1D4B A;  4DWF A;  3RUI B;  2LFI A;  3FIL A;  4E3C A;  1SGH A;  2KFK B;  2EMT A;  1OGW A;  2NPT B;  4WIP A;  3ML8 A;  2BB6 A;  1BML C;  2EMS A;  3Q8C A;  5BYS A;  4HDO A;  3VTW A;  1NI3 A;  1AWD A;  1OQY A;  1OQR A;  2HTM E;  1MG8 A;  1B9R A;  3VQI A;  4LLG M;  4XWW A;  3N30 A;  4JLC A;  4MGY E;  4LTU A;  2DNF A;  1FM0 D;  2KN4 A;  3SR6 A;  1WXS A;  4HPM B;  2WMG A;  1KLU D;  3APC A;  2VH1 A;  2JXT A;  2KOX A;  4JGH B;  2MQJ A;  4X57 B;  2WXK A;  4K81 A;  2LVO A;  2LVP A;  4EZL A;  2J0K A;  1V1P A;  5FR6 A;  1WRD B;  4OW0 A;  3KW5 B;  4TUU A;  1XLQ A;  3U30 A;  2PJH A;  4DQO C;  2FAZ A;  3HUI A;  3EC8 A;  3CWI A;  2KWD A;  3P2B A;  2CS4 A;  4EE2 A;  1HQR D;  1A5R A;  4LNF A;  4L1B A;  1E7P B;  5J17 A;  4UDU C;  1JCK B;  1YQ4 B;  1L4Z B;  3R66 C;  1U4A A;  3VTU A;  1WH3 A;  2V1Y A;  2ZNV C;  3DVN U;  1MVK A;  3ZNH B;  3BK2 A;  3IBE A;  2LWP A;  1L2N A;  1N5X A;  4M8M A;  4HPP A;  1TY0 A;  2D3C A;  1WMH B;  3ONS A;  4M0W A;  1VDV A;  2ZW0 A;  5LLI A;  3MJW A;  5EDS A;  1XF5 L;  1BXT A;  4FUL A;  2M8S A;  2RPQ A;  3OAW A;  4FXC A;  3UQB A;  2KAJ A;  4HK2 A;  2W3R A;  1HZ6 A;  4EZK A;  1SIJ A;  2HD5 B;  2OJR A;  1VZ6 A;  4RH6 A;  1JWS D;  4II2 B;  4LK0 M;  4DDI D;  4YSZ B;  4YSY B;  1MHH E;  1VRA B;  2VH2 A;  2IZV B;  1WE7 A;  1GPX A;  3BYY B;  2MP2 B;  2ICI A;  2QJL A;  3D32 A;  1YQB A;  2YEP B;  2N9L A;  1XCQ L;  1PGX A;  2L00 B;  1SE2 A;  3J9C A;  1ZP0 B;  3NG0 A;  5BO4 B;  2NS5 A;  1Q5W B;  4N58 A;  3IT4 B;  5D3D A;  2KQ4 X;  3VR9 B;  4M8N A;  4OVV A;  3TIX A;  5E6N A;  2NCN A;  2KLG A;  1V80 A;  1WX9 A;  3VDZ A;  4HJK A;  1P0R A;  2WWZ A;  4BFR A;  3M62 B;  3ZJU A;  3VRB B;  1N6Z A;  2GBJ A;  3B1L X;  4PS7 A;  1HA5 A;  4BKG A;  2MJ3 A;  2JRI B;  1NI2 A;  2QEJ C;  4GXB A;  1YX6 B;  2BYV E;  3I5J C;  3IXS A;  3IFW B;  4ARI A;  2WMJ A;  2WX0 A;  1ZXI A;  3KH0 A;  1ESF A;  1V1O A;  2M1M A;  1RFA A;  3I9V 1;  1SE3 A;  4W9C A;  1YNT E;  1L6V A;  2V9H A;  3LB8 C;  2CR5 A;  1IYF A;  4HRO A;  1WIA A;  3B2F A;  4YWG G;  2BYE A;  1ZXH A;  1XO3 A;  4BKS A;  4KV2 A;  3GS2 A;  2JZP A;  1HTQ A;  2N9P C;  4YL8 A;  4NAM A;  1SXT A;  1SIF A;  2KX3 A;  2TSS A;  5FKA C;  4I6P A;  4IKG A;  5IA7 A;  3NY5 A;  2XK5 A;  1PQS A;  2NVU I;  3IAM 1;  4NQK E;  2CKH B;  2PVO D;  5DPT A;  3BWU D;  2WMF A;  1NEK B;  4JIO U;  1TZ1 A;  2M0X A;  2KWU B;  1HEZ E;  4K7W A;  4BBN F;  4KX6 B;  2VZK D;  3H7P A;  2OOB B;  2QC8 A;  4GU2 A;  4N9F 4;  2PE6 B;  1E9M A;  2HJ8 A;  3VFK A;  3TEZ A;  1OFF A;  3FKY A;  1QF6 A;  4AQ7 A;  3U2S C;  4EUT A;  4ZYS A;  1WGG A;  3ZVV A;  3NHE B;  2KHW B;  2GB1 A;  3Q8A A;  1T5X D;  2MJD A;  3A9J B;  4BOS C;  4CQN A;  1CQV A;  2N0S B;  1IBX A;  1WRI A;  2PIA A;  3L54 A;  4LNN A;  3UIP B;  3QK0 A;  4YT0 B;  1VCB A;  1X1M A;  4EOY A;  4FA6 A;  4NJ6 A;  4DXG A;  2J4X A;  1JWM D;  3Q8F A;  3M95 A;  2WXI A;  1V5T A;  4D6H A;  2X8X X;  2IO2 B;  1V5O A;  2MW5 A;  2E3T A;  3NRZ A;  2JF5 A;  1GAQ B;  4MM3 B;  3BII D;  4BAX A;  3U52 E;  5E6P A;  1J7C A;  1F9J A;  3C0R B;  2KTR A;  1J7B A;  3ZJT A;  3VUY A;  5G5H A;  3JSV A;  1J7A A;  2CJO A;  1MG4 A;  1NYQ A;  1UZX B;  3AN1 A;  5BYQ A;  1FXT B;  5E6J A;  3BY4 B;  3VXW A;  4D2K A;  4ZYN A;  1V8C A;  2KDE B;  4HCN B;  1EM7 A;  2L52 A;  3QX1 A;  2ONQ A;  1V2Y A;  1V49 A;  1CZP A;  1SF0 A;  3MFG A;  1WX8 A;  2BKR B;  2ACZ B;  5D6J B;  3TCA A;  3QAQ A;  4R3D A;  5C23 A;  2ZCB A;  3AEC B;  2Z8L A;  1E7V A;  1P3Q U;  2K1F A;  3ZNI D;  3IVF A;  3W1S A;  2L7R A;  2GBK A;  2INC C;  1F1H A;  2N1V A;  3A9K A;  3HIZ A;  1FMA D;  3RYT A;  4USA A;  5CHV C;  4A55 A;  3N1Y C;  1YIW A;  1P7F A;  4IDI A;  3BVZ A;  1UF0 A;  3R7Q A;  1I4G A;  4ICV A;  5EE9 A;  1HTO A;  2C60 A;  3HM3 A;  3WAL A;  2J0M A;  2FBW B;  1JRU A;  2MBO A;  1MJD A;  2MX2 A;  5GMV A;  4A8X C;  1I42 A;  5BMI A;  3V3X A;  4WWM A;  2O2V B;  3DHH C;  1IP9 A;  3KLS X;  1EU3 A;  3ZKJ C;  1SSN A;  4W9H A;  3C8Y A;  2K6D B;  1C9F A;  1N61 A;  3ZO5 B;  4C00 A;  2N7E A;  3N32 A;  1GUA B;  4B9K A;  3PS6 A;  2AYO B;  3KUZ A;  4W9G A;  2DEN B;  2N9E B;  1LQB A;  4MH0 E;  1DYQ A;  2DZI A;  2L8J A;  4K1R B;  1RYJ A;  3UF8 A;  3P4R B;  3AUL A;  3T3O A;  4D6I A;  1K52 A;  1GB4 A;  4ARC A;  4TKN A;  5CHF A;  1XCT L;  3PLV A;  3ZJV A;  2LHD A;  2D11 A;  4TV3 A;  2FCN A;  4S17 A;  1DOI A;  1IBX B;  1YN5 A;  2PKO A;  2IY1 B;  1RAX A;  1WGY A;  1YJJ A;  3PRE A;  4JWS C;  1UNS A;  1JQ4 A;  3X23 A;  3MC9 A;  2K6Q A;  2WHI A;  2WXM A;  4P1C C;  2K22 A;  3R7R A;  1Y56 A;  1ZDV A;  2IGD A;  1ZKH A;  2D07 B;  1TJE A;  3DBH I;  2JPH A;  2L83 A;  2WMI A;  3PRM B;  2KMC A;  2MEK A;  2Z59 B;  2NTS A;  2W3S A;  1V81 A;  4D6F A;  2YVC A;  4K3C A;  2GBR A;  3GZN I;  2BPS A;  2G4S A;  4KDI C;  3PO0 A;  2FIF A;  1L0V B;  3TUO A;  1RWS A;  1WY8 A;  3BIN A;  4BZA A;  3TJP A;  3TL5 A;  5KHO A;  3BZD B;  4L2Y A;  5D94 A;  5JHB A;  3M3J A;  2DAF A;  4ICU A;  4DHZ E;  1ZUD 2;  2WU2 B;  3AB5 A;  2QSD A;  2UWQ A;  4II3 B;  2K0P A;  3ETR A;  1VR9 A;  2CHW A;  4HVB A;  1SE4 A;  3L10 B;  4AS1 A;  2EKI A;  3RNG C;  2G4D B;  4PYU A;  3PHX B;  2RDG A;  5AZG A;  1ROE A;  2N4F A;  1CJE A;  2KVR A;  1LLQ A;  1SBB B;  2KAC A;  1N62 A;  2L0T A;  4I6L B;  1E8X A;  3Q8E A;  3RNC C;  1JML A;  3GOE A;  4A9A A;  1UWM A;  4ANV A;  1PGA A;  2BT6 A;  3DBR I;  2C7H A;  1AYF A;  3OJ4 B;  4DBG A;  4KKJ A;  2B3A A;  5J18 A;  1V97 A;  4GDK B;  4JPS A;  1TBE A;  3M63 B;  3ABV B;  4FJZ A;  5D3I B;  3DPD A;  3L4P A;  3ZW3 A;  2LRW A;  5IOI A;  3WAP A;  1HZ5 A;  4GOC A;  4AWJ A;  3EUB 2;  1ACC A;  5AZF A;  1XQQ A;  4MSM B;  2ZVO A;  2UU7 A;  3Q3J A;  3BVM A;  4IW0 A;  4D6C A;  3W5V B;  4NPN A;  2LXC A;  3MHZ A;  2M4N A;  3Q3O C;  4WJO A;  2INN E;  3DBH B;  1WZ3 A;  2KFJ A;  4G0N B;  2BB5 A;  5IKC M;  5CX3 A;  2MH7 A;  2VRR B;  3ZGZ A;  2JYE A;  2KTF A;  3GE8 C;  4ZRQ A;  2WXF A;  4JX1 C;  2BW2 A;  3QHT A;  2CHZ A;  3GZN B;  4B95 A;  4ZRJ A;  3PLU A;  2KDF B;  2JSV X;  4D71 A;  1RLF A;  4D6G A;  1XLP A;  2MWS B;  2WXJ A;  2N7J A;  1H8C A;  4GB9 A;  2WXR A;  2PMV A;  3VR8 B;  1J0G A;  2BVC A;  5EE3 A;  3JVZ X;  2HTH A;  1NYR A;  4JL9 A;  5LXI B;  2KNB A;  2LMC A;  4KGR A;  3NJT A;  1YX5 B;  4B0E A;  3NVV A;  1WGR A;  2JY6 A;  1LGR A;  2PE9 A;  3GB1 A;  1AAR A;  3L16 A;  1T3Q A;  1XT9 B;  1FRD A;  3E56 A;  2Q5W D;  1Q1O A;  4HRS A;  4M01 A;  3OLM D;  1L0X B;  2KYW A;  1C3T A;  3T9L A;  5TR5 A;  4KVG B;  2WXL A;  1HXY D;  1XXG A;  2D3A A;  2WMI B;  3DBR B;  2K9X A;  1L6U A;  2O6V B;  3EEC A;  5HKH A;  1QLB B;  1N63 A;  1NDD A;  1XD3 B;  4ANX A;  2KMA A;  3ENE A;  2BS3 B;  1E7U A;  1PFD A;  2WU5 B;  3QC8 B;  2V3N A;  3AEG B;  3HVZ A;  2BGF A;  2O6V D;  2W54 A;  3O13 A;  3SU8 X;  3PPA A;  3P4Q B;  1RM6 C;  3AE6 B;  1NBF C;  3N20 C;  2FUG 1;  1D5M C;  3O65 B;  1I4X A;  2MBB B;  3DBL I;  2R2Q A;  1EF1 A;  1FIQ A;  1QOA A;  2DYO A;  3KYD D;  4IM2 A;  2KVZ A;  1WYW B;  3QIJ A;  4IG7 B;  1WXM A;  3HHM A;  4MJS B;  1C1Y B;  1WJN A;  3P4P B;  3ZDM C;  4D6D A;  1PUT A;  5C3J B;  1I4P A;  1T0R C;  3B9J A;  4OVZ A;  2RDB C;  3U8Z A;  2V4I B;  3OJ3 A;  1T6B X;  4KDL B;  2KDI A;  2ZZP B;  3MJ5 A;  3PV1 A;  4LNI A;  4NQL B;  4TQ0 A;  2PLP A;  3FIL B;  3N1Z C;  1K51 A;  4E71 A;  4ZRK A;  3QQ8 B;  3A1Q A;  2N9K A;  1GOZ A;  3SEB A;  1JAL A;  1ET6 A;  3VVW B;  1C76 A;  2XEW A;  3AU4 A;  2D5G A;  3MP9 A;  1XLN A;  3BK1 A;  2GRI A;  2Y5P A;  2KLC A;  3URY A;  2FUH B;  2K3U A;  1PDX A;  2M17 A;  4OZA A;  1E8W A;  1WJU A;  3VH3 B;  1WR6 E;  4ZOH C;  3PVL A;  3QCA A;  2WMH A;  4W9E A;  3SDL C;  4QAY A;  1I4R A;  4XDC A;  4H2A A;  1V1P B;  1KLV A;  1M94 A;  1P1A A;  2BTE A;  1C79 A;  1WSP A;  4MGZ E;  4AUQ C;  1D6E C;  1L5P A;  3L0W B;  1ENF A;  3CMM B;  1OQQ A;  4NAW A;  4N59 A;  4DXA B;  3ZXV A;  2CJN A;  2JWU A;  5IP4 D;  3ALB A;  1E8Z A;  4GSW A;  3RMK C;  2HDE A;  3ECI A;  4FJV B;  5IAA C;  3DBL B;  2JX5 A;  4M02 A;  3H9D A;  2FID A;  4ITK A;  3RD2 A;  1QOG A;  4W9J A;  4A90 A;  2DZK A;  2L0F A;  4MGI E;  2QCZ A;  2J0J A;  3RNA C;  3DCG A;  3W1Y A;  1WWT A;  1I7H A;  2I38 A;  2PTL A;  2FNJ B;  3HRD D;  4WJQ A;  3VAW A;  2AWT A;  3VUX A;  4C56 C;  2X38 A;  1OTR B;  3P4S B;  4XGA B;  4M0W B;  1UGJ A;  1VZ7 A;  2KK8 A;  5FR3 A;  1QZE A;  4JE3 B;  2M0A A;  1KJT A;  4IC7 B;  4DDG D;  1WX7 A;  2EEL A;  1CMX B;  3Q2A C;  4P16 A;  1F0Z A;  1M4V A;  5GXG B;  2LUE A;  1YD8 U;  2MRP A;  1N5W A;  2K39 A;  2JYT A;  1KF6 B;  2YEP F;  3VRA B;  4IOI E;  2PEA A;  2LI5 A;  3V05 A;  2BWE S;  2CHX A;  4URK A;  4EFO A;  3DOW A;  2GMI C;  4XZ4 A;  4MEL A;  2KC2 A;  3MTN B;  4XYC A;  4JWU C;  2WXH A;  3APF A;  3PRP B;  3AE1 B;  1FCC C;  2IY0 B;  4HWI B;  3T3N A;  2MBH A;  4G50 A;  5MPO A;  1BUI C;  5HI1 A;  4KSL C;  3N3K B;  3TEW A;  2C9W B;  4W9I A;  3RN9 C;  1TIF A;  2NR2 A;  4W9L A;  4WAF A;  4WUR A;  1QKZ A;  5EE0 A;  3DVG Y;  4LNK A;  3ZNZ B;  2CU3 A;  3SFD B;  4C4V A;  4M00 A;  5I4D A;  2HJ1 A;  3OG5 A;  3DWG C;  2V3P A;  2KJH B;  2KKC A;  2PW9 A;  3DQV A;  3MHS D;  5DPW A;  1DOX A;  1STE A;  1D5Z C;  2D2Q A;  4CYE A;  4FJY A;  3ZIM A;  2V0G A;  5T8I A;  3AE5 B;  2LGI A;  3ZTC A;  1L0Y B;  4WWP A;  4OVU A;  4XDD A;  2C7M B;  4PS3 A;  1J8C A;  2DZJ A;  2JU6 X;  3NUH B;  1TS2 A;  2JXX A;  4IWO A;  4PK1 A;  3OWE B;  4AJW A;  1R7S A;  2FE8 A;  2G9H D;  3AE9 B;  3AXC A;  5HG2 A;  1JW9 D;  4NJ7 A;  3NVY A;  3A4S C;  3R3M A;  2WXP A;  4ANW A;  5JZE B;  3ZDT A;  3UGB B;  1F52 A;  3R2I A;  1V9J A;  2IGG A;  2DZM A;  2MJE A;  3HK0 A;  5JXV A;  3U4E G;  4LJO B;  1FXI A;  3RNF C;  4KIK A;  1C77 A;  1VD2 A;  3S2A A;  2DYM A;  2KFK A;  4YTM B;  3Q3N C;  4ANU A;  2R2O A;  2NPT A;  2AQ3 B;  3PZD A;  2LUM A;  1YN4 A;  1ZOY B;  4GLS C;  4MSQ B;  5DCN A;  3V61 A;  4HKZ E;  1TS5 A;  4BKS D;  2QIL A;  3N1X C;  4PT5 A;  3VUW A;  2XK5 B;  3Q3M C;  3TEY A;  4TMA B;  2PVG C;  3AE4 B;  5BYR A;  1FFV A;  4K7U A;  4NY0 A;  1TZO A;  3H7P B;  2RDH A;  4FHJ A;  3H8H A;  2KZR A;  2LGX A;  2ZPN A;  1P9D U;  2Y3A A;  2KO3 A;  4LDT B;  1FFU A;  2IO0 B;  4RMA A;  1VLB A;  4KZ0 A;  3RT3 B;  3IT6 B;  4LDT D;  1ZDX A;  5DPR A;  2LXA A;  4HLE A;  2LGY A;  2NMQ A;  2J42 A;  4ZRI A;  4XX5 A;  5AUI A;  4GDL A;  4MDK E;  5JH5 C;  1P7E A;  1T0Q C;  4Q2J A;  4TQ1 A;  4BKT A;  2WYQ A;  2K8C A;  1ET9 A;  1AN8 A;  2FCM A;  2ZNV B;  4RCO A;  3NZS A;  4LNO A;  3PGE A;  3SD5 A;  2YLM A;  3ZYY X;  1XEE A;  5D7G A;  4IWP A;  2KTR B;  4MH8 A;  1WJ4 A;  2A4Z A;  1A70 A;  3JSV B;  1WMH A;  3FAH A;  3WA0 A;  3KUD B;  1L4D B;  3WIM A;  3EFU A;  4W9K A;  3DHG C;  3A33 B;  3PRZ A;  1YN3 A;  2BBC A;  4RM9 A;  2KWV B;  1GG3 A;  3AEB B;  3GE3 C;  4K3B A;  1FCL A;  4XWT A;  2NBV B;  3ZXR A;  1UGM A;  1FD6 A;  1E90 A;  4TSS A;  1ZPS A;  1CK1 A;  1UBI A;  3VH4 B;  3UI3 A;  4FN2 A;  2AQ2 B;  3Q14 C;  3AMZ A;  4KZC A;  3R2T A;  2MP2 A;  2WMK A;  1P98 A;  4P7I A;  3WAM A;  2MBQ A;  1F77 A;  3RPF C;  3NZU A;  4RGT A;  2J7Q B;  2WLB A;  1YOV B;  5H8Y E;  3A9K B;  1L7Y A;  1T0Y A;  5G55 A;  4D6E A;  2L76 A;  1V86 A;  2I1K A;  1EO6 A;  3DVG X;  2BS2 B;  2AEH A;  1NVI D;  3ZNG C;  2NTT A;  3ZTD A;  4EZJ A;  2XN9 C;  3V6E B;  4WQM A;  2JZZ A;  2ZW1 A;  4IM3 A;  1SB3 C;  2I2Y A;  1BT0 A;  1TS3 A;  3PHW B;  1K50 A;  3AE7 B;  4AOF A;  1TKY A;  4OZC A;  2IND C;  2WXO A;  3KQ4 A;  4K7S A;  2WS3 B;  4PS8 A;  4KGS A;  3HVD A;  3NVZ A;  2WDQ B;  4C7Y A;  4AJY B;  3K9O B;  2Z0D B;  2AL3 A;  2PPH A;  3H1U A;  4YSX B;  1T0S C;  2QIE B;  2L1A A;  2XNA C;  4A20 A;  1SJH D;  4US9 A;  4EKU A;  4HXD A;  4HPL B;  1WI0 A;  2GBN A;  5E6O A;  4C80 A;  2B76 B;  3EFC A;  1KFY B;  1JRP A;  1WXA A;  2LEK A;  1LM8 B;  1IPG A;  4DHJ B;  5KHQ A;  1B1Z A;  3P63 A;  5L83 A;  4YXD B;  2OED A;  4RF0 A;  3RI7 C;  3I3T B;  1HE8 A;  1GNU A;  1WXQ A;  3DVN V;  4C7Z A;  1MHX A;  1TS4 A;  4DHJ D;  2WXG A;  2QMT A;  1MFW A;  1C4C A;  2WDT B;  3H7S A;  2L05 A;  3QAR A;  3VHT C;  4RGM A;  1GJZ A;  4RGN A;  3PZ8 A;  1WR1 A;  4ZDV A;  2Y5B B;  2JZ3 B;  5LNK 1;  2MCN B;  4ACF A;  4GDL B;  2INP E;  1WM2 A;  5FK9 C;  1JWB D;  2LD9 A;  4IM0 A;  4FHK A;  1WGK A;  5JHA A;  2W55 A;  1FXA A;  5G2N A;  2DHZ A;  3CF6 E;  1FEH A;  1JWU D;  2G1E A;  2DLB A;  4IWQ A;  4AP4 C;  4KGT A;  2OJW A;  1WFY A;  2C7N B;  2LJ5 A;  1H4R A;  2WNM A;  2JRH A;  1JRO A;  3WCQ A;  3A9J A;  1Z5S B;  2IBI B;  3TMP B;  3L17 A;  4YTN B;  1K53 A;  1IGD A;  3I57 A;  3ZUN A;  3CIR B;  3NOB A;  4G3X B;  1R4N I;  5CTR C;  1WJ6 A;  3MC0 B;  3H6N A;  1UEL A;  1D3Z A;  4RFB A;  2KXJ A;  3TBL D;  2IGH A;  4E74 A;  2LGS A;  3W1S C;  1MPE A;  1YJ1 A;  4B0M A;  3AE8 B;  4MM3 A;  3EHV A;  3RCZ A;  2G45 B;  4S0R A;  3HM6 X;  4I6N B;  3X0W A;  4WQO B;  4XC2 A;  3DBS A;  4WH4 A;  3RNB C;  1WM3 A;  4LJP B;  1I4Q A;  1S1Q B;  2R61 A;  2C5L C;  1TYG B;  2WX1 A;  2QHO A;  4NNJ B;  5H92 C;  3AU5 A;  2DBY A;  2K8H A;  1QIL A;  1GC7 A;  2KJR A;  2H88 B;  2KT7 A;  3L13 A;  1FPY A;  3QWZ B;  2LRU A;  4JQW C;  4P1B C;  2BYT A;  1E10 A;  2LVQ A;  3APD A;  2DWQ A;  1PYW D;  2KJ6 A;  2D10 A;  1YMH E;  1C78 A;  1DOY A;  3Q6B A;  1EUV B;  4RNA A;  2KC1 A;  4WJP A;  5BMH A;  3AEA B;  3JW0 X;  3AEE B;  2N7D A;  1WZ0 A;  2LJI A;  1SJE D;  2Z0E B;  4YTP B;  3P1M A;  2LAS A;  4WWO A;  4NJC A;  1YQ3 B;  3KWL A;  3Q3F A;  1EU4 A;  2RD0 A;  3KVF B;  3NZ3 A;  2JQR B;  4F1S A;  1OEY J;  1I4H A;  4BVU C;  1ZE3 D;  4MEM A;  2XBB C;  2NBU A;  4WWN A;  4MGK E;  1I35 A;  1ZGU B;  1MI0 A;  1WGD A;  2KDM A;  2KD0 A;  2Y5C A;  2RSU A;  1GB1 A;  2ZJD A;  1K8R B;  3L08 A;  3IAS 1;  2WP9 B;  2V4L A;  4GIV A;  1R4N B;  3QA8 A;  1E8Y A;  3UIO B;  4OZB A;  1E6E B;  2G3Q B;  1KTK A;  2IO1 B;  3EA6 A;  1ZW7 A;  3WAO A;  2O2V A;  4FLH A;  2A5U A;  2KAN A;  2VZK B;  1KM7 A;  1TT5 B;  2AL6 A;  4LCD E;  2ON8 A;  1F2R I;  3AE2 B;  2GBM A;  3RZW C;  2KX0 A;  4IUM B;  1V6E A;  3V60 A;  4L23 A;  1DGJ A;  2GLS A;  3AED B;  3AE3 B;  4WJN A;  2HE7 A;  3LYY A;  2BF8 B;  3V6C B;  2I1J A;  4KKI A;  4BBN C;  2NBW B;  1FO4 A;  3P42 A;  1Q10 A;  2K25 A;  3Q8B A;  4D6J A;  1SE9 A;  4HEA 1;  2BQQ A;  2MBE A;  3T8M A;  4REZ A;  2M56 B;  3R8B A;  2MLB A;  4ZRP A;  3LDZ E;  3EGR A;  1KOT A;  1FNV A;  1RRB A;  2MHJ A;  2KMM A;  2WDV B;  4ZHO A;  1E5W A;  5IO9 A;  3Q69 A;  1FNU A;  1IUE A;  2DX5 B;  2DYB A;  1EWY C;  3LJ3 A;  1EWC A;  3RFZ B;  2L32 A;  3PZ7 A;  2ZPY A;  3MC8 A;  1NEN B;  4P6V F;  5L95 C;  4WAA A;  1D5X C;  2N9X A;  4BOZ B;  2DAJ A;  3KYC D;  3NS1 A;  3CSF A;  3UIN B;  1WF9 A;  4NZL B;  3A1Q B;  2AQ1 B;  1R4M I;  2IYD B;  2KN5 A;  1VJK A;  2WGS A;  4J3O D;  4HJG E;  1E0Z A;  3CST A;  3FC4 A;  2D3G A;  3PT2 B;  1QOB A;  5D2M B;  2IDY A;  5HHD G;  3B08 A;  2MSE D;  2ZCC A;  1WGH A;  3AEF B;  3BVG A;  2KWC A;  3NS8 A;  2WXN A;  2KDB A;  2LGD A;  4J6I A;  2IO3 B;  5IN7 A;  1QQR A;  1G6J A;  4O1N A;  4US8 A;  2FCQ A;  2H89 B;  1RFK A;  2SEB D;  4FAD A;  5HFY A;  4CHK A;  1UUP A;  1Y8R C;  1C4A A;  1WYG A;  1UH6 A;  1TY2 A;  3K9P B;  1FNW A;  4DK5 A;  2WQY B;  3TEX A;  1N60 A;  3B2G A;  5J2R A;  3V62 A;  4GDK A;  2IJ0 A;  3AV8 A;  3A4R A;  4NAW B;  3B0A A;  2IPK D;  1LO5 D;  3ZQ4 A;  3RUL A;  3DWM A;  2W82 A;  5CHW A;  2L3Z A;  3W9C B;  2J53 A;  3W2D A;  3VTV A;  4CO7 A;  4PYZ A;  4W9D A;  3TSS A;  2LZ6 A;  2KQS A;  4G11 A;  2K5P A;  2JT4 B;  1PGB A;  3KWV A;  2LHE A;  1TGZ B;  5AEK B;  3NVW A;  1TTN A;  3ML9 A;  1S3S G;  4MT5 A;  2JWZ A;  1C4P A;  1Q0W B;  1UWX A;  1Z2M A;  2N1W A;  1FRR A;  3AM9 A;  2ASQ A;  5G5G A;  2REX A;  3SFE B;  3AI5 A;  2BYF A;  4FBJ B;  5C2T B;  2ZEQ A;  2WDR B;  1JWA D;  2AX5 A;  2M19 A;  4EEW A;  3C19 A;  1QOF A;  4ASW C;  1R4M B;  1O0S A;  5LXH A;  2GI9 A;  4MAC A;  4DXF A;  1TKG A;  4B6W A;  1QT9 A;  3IG3 A;  2KQ7 A;  4GMV A;  4D72 A;  3GP7 A; 
#chains in the Genus database with same CATH homology
 1XLN A;  3E9S A;  1SJH D;  1J7C A;  4US9 A;  3BK1 A;  2GRI A;  2Y5P A;  4C80 A;  1J7B A;  3ZJT A;  3W5U B;  2B76 B;  1KFY B;  4RF1 A;  3URY A;  5G5H A;  1JRP A;  1J7A A;  2LEK A;  5AUK A;  2CJO A;  1NYQ A;  2K3U A;  3AN1 A;  1PDX A;  4OZA A;  1B1Z A;  1KRH A;  3P63 A;  5BYQ A;  2J52 A;  5E6J A;  1KLG D;  4YXD B;  4D2K A;  4ZOH C;  2OED A;  4RF0 A;  4OHJ A;  1V8C A;  2BS4 B;  5EE1 A;  1EM7 A;  1WXQ A;  1AW7 A;  2L52 A;  2SAK A;  2ONQ A;  4C7Z A;  1I4R A;  1MHX A;  1TS4 A;  4XDC A;  4H2A A;  1V1P B;  2QMT A;  1CZP A;  1SF0 A;  2RMM A;  2WXG A;  1C4C A;  4ZHP A;  4RGO S;  3MFG A;  2BTE A;  2ACZ B;  1C79 A;  1WSP A;  3BYT B;  1KH0 A;  1IGC A;  4XE0 A;  4R3D A;  4RGM A;  4RGN A;  3PZ8 A;  1D6E C;  1L5P A;  5LNK 1;  3AEC B;  2INP E;  2Z8L A;  4GDL B;  5FK9 C;  1ENF A;  1JWB D;  1OQQ A;  3W1S A;  4N59 A;  1WGK A;  2CJN A;  2JWU A;  2W55 A;  1FXA A;  2HDE A;  2JX5 A;  1FMA D;  3U52 E;  4ITK A;  4USA A;  4A55 A;  1QOG A;  1SEB D;  4A90 A;  4A6Q A;  1P7F A;  4IDI A;  3BVZ A;  1FEH A;  1I4G A;  1JWU D;  2G1E A;  3U7Z A;  2DLB A;  2OHF A;  5EE9 A;  4KGT A;  1WWT A;  1VZ8 A;  1I7H A;  2WNM A;  5BMG A;  2I38 A;  2PTL A;  1JRO A;  3WCQ A;  2FBW B;  4YTN B;  3HRD D;  1K53 A;  2RPV A;  1IGD A;  1TKE A;  3LXF A;  4C56 C;  3I57 A;  2X38 A;  1F2R C;  3CIR B;  1YJI A;  3P4S B;  5TSS A;  1UGJ A;  3N9Y C;  4A8X C;  1VZ7 A;  5BMI A;  3V3X A;  4N6E B;  4WWM A;  5FR3 A;  3MC0 B;  4JE3 B;  2M0A A;  2WXQ A;  3KLS X;  4HKQ A;  1EU3 A;  2E6X A;  1SSN A;  4RFB A;  2EEL A;  1F0Z A;  3C8Y A;  4P16 A;  1M4V A;  3AH7 A;  5GXG B;  1C9F A;  1N5W A;  1XLO A;  1N61 A;  1D4B A;  2JYT A;  2IGH A;  1KF6 B;  2YEP F;  3VRA B;  2LFI A;  3FIL A;  4IOI E;  3V05 A;  1MPE A;  4B0M A;  4WIP A;  3AE8 B;  2BB6 A;  1BML C;  3Q8C A;  5BYS A;  1NI3 A;  1AWD A;  1OQR A;  1DYQ A;  2HTM E;  1RYJ A;  1B9R A;  3VQI A;  4JWU C;  4LLG M;  4WH4 A;  2WXH A;  4XWW A;  3P4R B;  3T3O A;  1I4Q A;  3AE1 B;  1K52 A;  4LTU A;  1GB4 A;  4ARC A;  1FCC C;  1FM0 D;  2R61 A;  2KN4 A;  1XCT L;  3SR6 A;  1TYG B;  3ZJV A;  1KLU D;  2LHD A;  3T3N A;  1DOI A;  2JXT A;  5MPO A;  1IBX B;  1YN5 A;  5H92 C;  2WXK A;  2PKO A;  1BUI C;  2DBY A;  5HI1 A;  3TEW A;  1QIL A;  1YJJ A;  4JWS C;  2H88 B;  1UNS A;  1V1P A;  1JQ4 A;  4OW0 A;  4WAF A;  4WUR A;  1QKZ A;  2WXM A;  5EE0 A;  1XLQ A;  2K22 A;  2BYT A;  1E10 A;  4DQO C;  2CU3 A;  3SFD B;  2DWQ A;  1PYW D;  5I4D A;  3HUI A;  1YMH E;  1C78 A;  3DWG C;  1DOY A;  1Y56 A;  2V3P A;  1ZDV A;  2IGD A;  4RNA A;  2PW9 A;  5BMH A;  1DOX A;  1STE A;  1TJE A;  3AEA B;  1D5Z C;  2L83 A;  3CWI A;  3AEE B;  2KWD A;  2V0G A;  5T8I A;  3AE5 B;  2LGI A;  4EE2 A;  1HQR D;  1L0Y B;  2MEK A;  2LJI A;  2NTS A;  1SJE D;  2W3S A;  4L1B A;  4YTP B;  3P1M A;  4XDD A;  1E7P B;  4UDU C;  1JCK B;  1YQ4 B;  2JU6 X;  3NUH B;  1TS2 A;  4NJC A;  1L4Z B;  3PO0 A;  1YQ3 B;  1L0V B;  3KWL A;  3TUO A;  1EU4 A;  1RWS A;  3NZ3 A;  2JQR B;  3OWE B;  1I4H A;  1R7S A;  1ZE3 D;  2FE8 A;  1MVK A;  3BZD B;  4L2Y A;  2G9H D;  1MI0 A;  3AE9 B;  5HG2 A;  3BK2 A;  1JW9 D;  2KDM A;  2Y5C A;  3NVY A;  1ZUD 2;  2WU2 B;  3AB5 A;  1GB1 A;  2QSD A;  1N5X A;  3IAS 1;  2WP9 B;  1TY0 A;  2K0P A;  2WXP A;  3ETR A;  4OZB A;  1E6E B;  1VR9 A;  1SE4 A;  4M0W A;  1KTK A;  1VDV A;  2ZW0 A;  2EKI A;  3EA6 A;  2IGG A;  3R2I A;  4AS1 A;  2MJE A;  2RDG A;  2VZK B;  5JXV A;  1ROE A;  3U4E G;  1CJE A;  1FXI A;  1SBB B;  1XF5 L;  1N62 A;  1BXT A;  2KAC A;  1C77 A;  4FXC A;  3Q8E A;  2KAJ A;  2DYM A;  2W3R A;  4YTM B;  1HZ6 A;  2ON8 A;  1JML A;  1SIJ A;  4A9A A;  1UWM A;  1F2R I;  2AQ3 B;  1VZ6 A;  1YN4 A;  1ZOY B;  2LUM A;  3AE2 B;  4GLS C;  4HKZ E;  1TS5 A;  1JWS D;  4RH6 A;  1PGA A;  2BT6 A;  4LK0 M;  2QIL A;  1AYF A;  4YSZ B;  4KKJ A;  4PT5 A;  4YSY B;  1MHH E;  3TEY A;  1VRA B;  4TMA B;  2PVG C;  4L23 A;  1DGJ A;  1V97 A;  4GDK B;  3AE4 B;  3BYY B;  5BYR A;  1GPX A;  2QJL A;  2ICI A;  3AED B;  4JPS A;  3AE3 B;  1FFV A;  2YEP B;  2N9L A;  1XCQ L;  3ABV B;  3LYY A;  1PGX A;  3J9C A;  1SE2 A;  1TZO A;  4KKI A;  2RDH A;  5D3I B;  1ZP0 B;  1FO4 A;  3L4P A;  3P42 A;  1Q10 A;  3H8H A;  3Q8B A;  1HZ5 A;  3EUB 2;  1ACC A;  4HEA 1;  4REZ A;  2M56 B;  3BVM A;  2Y3A A;  4N58 A;  3R8B A;  3IT4 B;  5D3D A;  3W5V B;  2KQ4 X;  3VR9 B;  3MHZ A;  4ZRP A;  1FFU A;  2INN E;  3EGR A;  1FNV A;  2KMM A;  2WDV B;  1VLB A;  4ZHO A;  2BB5 A;  1FNU A;  3Q69 A;  2MH7 A;  3ZJU A;  3ZGZ A;  1IUE A;  2JYE A;  4ZRQ A;  3IT6 B;  2WXF A;  4JX1 C;  2BW2 A;  1ZDX A;  3VRB B;  1EWY C;  1EWC A;  3RFZ B;  2L32 A;  1HA5 A;  3PZ7 A;  2NMQ A;  2J42 A;  2MJ3 A;  1NEN B;  4P6V F;  2QEJ C;  5AUI A;  1D5X C;  2JSV X;  1P7E A;  1XLP A;  2WXJ A;  3NS1 A;  4Q2J A;  4TQ1 A;  2N7J A;  4NZL B;  1ET9 A;  1AN8 A;  2AQ1 B;  4RCO A;  3IXS A;  4ARI A;  1VJK A;  1ZXI A;  4J3O D;  2WXR A;  4HJG E;  2PMV A;  3VR8 B;  1ESF A;  1V1O A;  1E0Z A;  3FC4 A;  5EE3 A;  1NYR A;  1QOB A;  3ZYY X;  2IDY A;  3I9V 1;  1SE3 A;  2LMC A;  4KGR A;  1XEE A;  5D7G A;  5HHD G;  4B0E A;  1YNT E;  4MH8 A;  3AEF B;  3NVV A;  3BVG A;  1L6V A;  3GB1 A;  1A70 A;  3LB8 C;  4HRO A;  2WXN A;  3FAH A;  1T3Q A;  3B2F A;  1L4D B;  4YWG G;  1ZXH A;  1FRD A;  1QQR A;  3E56 A;  2Q5W D;  1XO3 A;  4HRS A;  4O1N A;  4US8 A;  1L0X B;  2H89 B;  1YN3 A;  2BBC A;  1RFK A;  3GS2 A;  2SEB D;  2JZP A;  3AEB B;  2WXL A;  4NAM A;  5HFY A;  1HXY D;  1XXG A;  1FCL A;  4XWT A;  1SXT A;  1FD6 A;  2K9X A;  1L6U A;  1UUP A;  1QLB B;  1N63 A;  4TSS A;  2TSS A;  1C4A A;  1ZPS A;  1CK1 A;  1WYG A;  1TY2 A;  5FKA C;  3UI3 A;  1FNW A;  2WQY B;  4IKG A;  3TEX A;  2AQ2 B;  1N60 A;  2BS3 B;  3B2G A;  1PFD A;  3AMZ A;  2WU5 B;  3R2T A;  3IAM 1;  2IJ0 A;  2PVO D;  2V3N A;  3BWU D;  1NEK B;  3AEG B;  3AV8 A;  3HVZ A;  4NAW B;  2IPK D;  1F77 A;  1HEZ E;  1LO5 D;  2W54 A;  3RPF C;  3O13 A;  4KX6 B;  4RGT A;  3ZQ4 A;  2VZK D;  3P4Q B;  1RM6 C;  3AE6 B;  2WLB A;  3DWM A;  2W82 A;  2FUG 1;  1E9M A;  3W9C B;  1D5M C;  2J53 A;  5H8Y E;  3TEZ A;  3W2D A;  1OFF A;  1I4X A;  4AQ7 A;  1QF6 A;  3U2S C;  4ZYS A;  1FIQ A;  1QOA A;  2DYO A;  3TSS A;  2K5P A;  1PGB A;  2BS2 B;  3KWV A;  2LHE A;  1NVI D;  2NTT A;  2GB1 A;  3Q8A A;  1T5X D;  2MJD A;  2XN9 C;  3NVW A;  3P4P B;  4CQN A;  4MT5 A;  1CQV A;  1C4P A;  2N0S B;  1IBX A;  1PUT A;  1UWX A;  4WQM A;  1WRI A;  2PIA A;  2ZW1 A;  5C3J B;  1SB3 C;  2I2Y A;  1I4P A;  1FRR A;  1TS3 A;  3B9J A;  3AM9 A;  4OVZ A;  4YT0 B;  5G5G A;  3SFE B;  1K50 A;  3AE7 B;  5C2T B;  1TKY A;  4DXG A;  4OZC A;  2V4I B;  2J4X A;  2WDR B;  1JWA D;  2WXO A;  3KQ4 A;  1T6B X;  2WS3 B;  1JWM D;  2AX5 A;  3MJ5 A;  2M19 A;  3Q8F A;  4KGS A;  1QOF A;  3HVD A;  2PLP A;  4TQ0 A;  2WXI A;  3NVZ A;  2WDQ B;  3FIL B;  4C7Y A;  1K51 A;  2GI9 A;  4MAC A;  4DXF A;  1TKG A;  2N9K A;  1GOZ A;  2E3T A;  3NRZ A;  1QT9 A;  3SEB A;  1GAQ B;  4MM3 B;  1JAL A;  1ET6 A;  3BII D;  4YSX B;  1C76 A;  2QIE B;  2L1A A;  2XNA C;  2D5G A;  3GP7 A;  3MP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...