2YEPB

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence D, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepB01
2YEPF 2VZKB 1VZ6A 3IT6B 3IT4B 1VZ8A 2YEPB 1VZ7A 2VZKD 2V4IB 1VRAB
chains in the Genus database with same CATH superfamily
4XDDA 4XYCA 2DWQA 2V3NA 2KJ6A 3DVGY 2M0AA 4E71A 4DHJB 2LHEA 3NY5A 1TS5A 4GMVA 1SGHA 1ZOYB 2PKOA 4EKUA 4ZYNA 4P7IA 4TUUA 3PHWB 2ZEQA 2Z8LA 1EO6A 2CU3A 4N6EB 4HXDA 1N5XA 3Q8EA 1XXGA 3RZWC 2G3QB 3KYDD 2W55A 2IY0B 3APFA 4BBNC 3HUIA 3AI5A 2OHFA 1QILA 3MTNB 3QAQA 4DDGD 1YN4A 1FEHA 2XEWA 1PGAA 2K8BA 1RRBA 2WMFA 3QCAA 2MP2B 3RPFC 1VJKA 3J9CA 5LLIA 3NG0A 4LCDE 1UH6A 2V3PA 2KOXA 4WQMA 4FBJB 4RGMA 3LDZE 2CJOA 2DAFA 3Q3NC 1WJ4A 4JIOU 2KANA 2QILA 4HKZE 4W9HA 2KQSA 3SDLC 1ZXIA 1P9DU 4XZ4A 2DX5B 1D5ZC 1FCCC 1L6UA 3A1QB 2DAJA 3IAM1 3ONSA 3ETRA 2GBRA 1DYQA 4LNNA 2A4ZA 3WCQA 1KTKA 2JF5A 2K6QA 3E9SA 3BY4B 1KJTA 1F1HA 3BVGA 2X8XX 4AP4C 3UIOB 4IW0A 1I35A 3Q8BA 4OVVA 5G2NA 1SE9A 4LTUA 2XN9C 3AV8A 3IFWB 4LK0M 2INPE 2JX5A 1HEZE 3U8ZA 2LRWA 1UWXA 3EHVA 4OVUA 2XNAC 3T3NA 3DOWA 1L7YA 3I57A 1B9RA 1YX6B 2INNE 4I6PA 2NTSA 2K8CA 3AE7B 1FRDA 1WR6E 3U4EG 4HCNB 2RR9A 2C7NB 5BMHA 3ML9A 4GDKA 5FR6A 3WAMA 2GBKA 2KWDA 3VVWB 4XWWA 1SE2A 5JH5C 2INDC 3URYA 3A9KB 2V4LA 2WXIA 1YN3A 2MCNB 3NZ3A 2PLPA 4A3OA 3I5JC 1R7SA 2KACA 2QHOA 4B9KA 4EZJA 3TIXA 4C80A 3LXFA 4HK2A 4RF1A 3U7DA 1XF5L 4HRSA 1V97A 2W54A 2LGXA 2NR2A 3EA6A 1L6VA 1YMHE 1VRAB 2BYFA 1O0SA 2N9PC 3P4RB 4K3CA 3BYYB 4RMAA 4AQ7A 2KT7A 4G11A 2O6VB 4FULA 5E6JA 1RFKA 2JSVX 4QAYA 4NAWB 5L95C 5CHWA 3R3MA 3R8BA 2IO0B 2JPHA 1E7PB 1EWCA 3RT3B 3SD5A 5J18A 1YX5B 2D11A 3PRZA 3RYTA 3OJ3A 2KX0A 2J42A 4E74A 4ARCA 3AE4B 2DNFA 1WE6A 1WR1A 3PLVA 4K3BA 2JXXA 1OEYA 4GLSC 2IO1B 4CYEA 1NI3A 1WMHA 2G4SA 2NBVB 1JWMD 3P4QB 5CHVC 3PZ7A 4WJPA 3KUDB 3TJPA 4AOFA 3VH4B 2LVQA 4A3PA 1BT0A 4D6EA 3RNCC 3SHQA 3H7SA 1Q10A 3OLMD 2M56B 3LB8C 1F77A 2VZKD 2W82A 1ET6A 1T0YA 1PGXA 2L83A 4C4VB 1Q1OA 3ZDMC 3CSFA 3BZDB 2QDFA 4HDOA 1SIJA 2N9XA 4M02A 2QMTA 4HKQA 5JXVA 1YJJA 4KDIC 3JSVB 2SEBD 2INCC 1TS2A 3ZRFA 1V5TA 4KZ0A 3KW5B 4D71A 1MG8A 3ZQ4A 3CSTA 1B1ZA 1ZKHA 2LXCA 2FCMA 2E6XA 2ZPNA 2NMQA 3MC8A 1QF6A 3O13A 2NVUI 3W1SC 2BB5A 2KMMA 4KSLC 4DHJD 4JX1C 4GSWA 3W2DA 4DHZE 2K5PA 2KX3A 3BWUD 2D3BA 3KUCB 3OAWA 4L1BA 1WGKA 1V81A 2BS4B 1TYGB 2HTME 2I1KA 2CHZA 4NY0A 5DPWA 1JALA 2WXMA 2ZCCA 2N1WA 5DPTA 1IYFA 1TKGA 2JRHA 4YTNB 4FLHA 2N1VA 3GZNI 3RUIB 2KMCA 1WM2A 1V1PA 3V6EB 1WXSA 1H4RA 2N9EB 3KWVA 3KWLA 4N59A 4BKGA 4JWSC 4YWGG 3ZNGC 3NUHB 1WH3A 1V8CA 3S2AA 4G3XB 3MC0B 5IO9A 5H92C 1LFDA 3ZXRA 3BVZA 2RDBC 4YTPB 1T0QC 2BKFA 2WMHA 3ZJTA 3JVZX 3ALBA 4RM9A 1NYRA 2NBUA 3ENEA 2J52A 1HA5A 1YIWA 1ZGUB 3ZW3A 2WMJA 2WQYB 2MEKA 1OQRA 3VUXA 3L10B 1IUEA 4KGSA 2X38A 2CJNA 1VZ6A 4AWJA 4DK5A 1JMLA 4D2KA 1EWYC 3RZFA 3C0RB 1LGRA 4ZOHC 1N62A 3BIID 3AMZA 2EKEC 1YNTE 5BMIA 1MPEA 2C9WB 1LM8B 2L0FA 1A5RA 4NNJB 4MM3B 4OHJA 3UINB 5CX3A 2NCNA 3AE1B 2MQJA 3UQBA 3VH3B 2KMAA 4EE2A 4BFRA 3PZDA 2L05A 3ZRCA 1PGBA 1HQRD 2L00B 3KLSX 2ZZPB 1WI0A 1SBBB 3TEZA 3DHHC 2LD9A 1CQVA 3SU8X 1NEKB 3ZDTA 4NQKE 3MHSD 2WWZA 4WURA 2AX5A 2IPKD 4K1RB 4JL9A 5HI1A 2Y3AA 2JT4B 4KZCA 1J7BA 2LFIA 1P3QU 4WWMA 1HE8A 3DVNU 1V2YA 2I1JA 3CIRB 1GNUA 1XCQL 3W1SA 3QK0A 1IGDA 2EMSA 2K9XA 3AH7A 2O6VD 3DDCB 4F8CB 5AEKB 4ACFA 3TEXA 1JWAD 5L83A 3R66C 4FXCA 4ANXA 3HVZA 3LYYA 1D6EC 2MBOA 3VFKA 1BMLC 1WGYA 2ZPYA 4A8XC 2MA9B 1LQBA 1TY0A 1P98A 2KKCA 3ZLZA 1XLOA 4YSZB 1JWSD 1TKYA 4TKNA 3P4SB 3HM6X 4IWPA 1T0RC 1OGWA 3AE3B 2BYVE 3C19A 1C9FA 1TTNA 1C4CA 4E3CA 3VTUA 4DXGA 1VZ8A 1XCTL 2BF8B 4XX5A 3V62A 2N9KA 5D3IB 1S3SG 3ZO5B 3N3KB 3AN1A 1WJUA 1C76A 2PE6B 3QWZB 1PUTA 2YEPB 4WJQA 1BXTA 1LO5D 1KLVA 3RI7C 2D2QA 3ZXVA 1FMAD 3N32A 3SR6A 3OWEB 4FJYA 3AXCA 3QARA 3KYCD 3Q3OC 4YT0B 5AUIA 1EM7A 1ZDXA 3HVDA 2RDHA 3BK2A 4IDIA 1V86A 2GLSA 2BBCA 1NDDA 1L5PA 3CMMB 3NVVA 1RYJA 3AU5A 2L7RA 1XD3B 3FKYA 2JWUA 1T3QA 2GOWA 1V1OA 2AEHA 1GUAB 3IG3A 3VUWA 1L4ZB 4KIKB 2M19A 1K50A 1KLUD 4LDTB 1RM6C 2L8JA 2CHWA 3EECA 3R2IA 3AECB 2FCQA 1TT5B 2D3AA 4ZRPA 4BKSD 1TKEA 4N58A 2KC2A 4WAFA 3FILA 2DYBA 2KHWB 4HVBA 2YEPF 4MH8A 1IBXB 4I6NB 3VR8B 4M01A 3KUZA 2WLBA 2N9LA 1FXTB 4RGNA 1MHXA 3L17A 1R4NI 2N4FA 3W1YA 1CK1A 1MVKA 2NPTB 5IN7A 1TBEA 1PDXA 3H9DA 2KTRB 3VTWA 4IWOA 4M0WB 4D6DA 1E8ZA 2OEDA 2MLBA 4O1NA 1C79A 2N7EA 3ZTDA 4MSMB 1P7EA 1AWDA 3AE5B 3CF6E 3MJWA 1K52A 1KFYB 2QIEB 1FM0D 5FR3A 4W9EA 4HWIB 5TR5A 4B6WA 4MGKE 2VH2A 2KTFA 3A9JB 3DBRI 4HPMB 1RLFA 1K51A 1VZ7A 5HFYA 3WA0A 2Z59B 2B3AA 2JYTA 3IT6B 2WXLA 3VHTC 1L0VB 3AE9B 3KH0A 4GXBA 4WWOA 2BVCA 2KXJA 2ZCBA 2IGDA 3PREA 1N5WA 1ZUD2 4NJCA 1MJDA 1D3ZA 1I4PA 3HIZA 1J19A 4ARIA 1KH0A 4ANWA 3R2TA 1F0ZA 4PS8A 3P2BA 3AM9A 3VR9B 4XE0A 1TJEA 2WU2B 2JUOA 1FPYA 2DZMA 1N61A 3SEBA 1QOFA 3QIJA 4OW0A 3T9LA 1WWTA 1Q0WB 2WX0A 1JQ4A 4GU2A 4MEMA 2ZW0A 1XO3A 1PYWD 4JE3B 4IOIE 3ZUNA 4FHJA 2LASA 3BK1A 2WMKA 2L76A 4USAA 1KLGD 3AU4A 2C7HA 2GMIC 4HLEA 2WDQB 3V6CB 3PZ8A 3AEAB 1R4MB 1TZOA 3EFUA 2MP2A 2BW2A 2KNBA 1J0GA 1YQ3B 2M17A 4HPLB 3TCAA 1WXQA 1OQQA 4TV3A 4W9LA 2KWUB 1J8CA 3DBHB 1Z5SB 1L0XB 4DHZB 2BB6A 2G1EA 1OTRB 3QA8A 1QT9A 1WGRA 4S17A 4EOYA 2BS3B 2WXHA 4YXDB 5EE1A 4NPNA 4W9GA 2WMIB 5AZFA 1RWSA 4RGTA 3NHEB 2MRPA 3H7PB 2KQ7A 4Q2JA 2MW5A 3A1QA 4WWNA 4GN1A 4RFBA 5MPOA 4GDLB 1T6BX 2QCZA 1STEA 1YJIA 4ZYSA 2MH7A 3R7RA 2BWFA 3DQVA 3HM3A 2LVOA 5G5GA 1IP9A 4ZDVA 2UYZB 4MT5A 1WJNA 3KQ4A 2ACZB 1UUPA 2D07B 1PFDA 4IM0A 5BYSA 1GC7A 2K0PA 4K7UA 4R3DA 1SF0A 1M94A 3Q8FA 2PTLA 3ABVB 3IAS1 1WJ6A 3TL5A 4PS3A 4MDKE 5E6PA 1MFWA 3ZJUA 4D72A 1V9JA 1P7FA 5JHBA 3APDA 4IKGA 2KN4A 2WP9B 3MJ5A 4DWFA 1UGJA 2V1YA 1SSNA 1WXMA 1JWUD 4NQLB 1MHHE 1S1QB 3DHIC 1NENB 4KV2A 4XWTA 2BYTA 1RAXA 3A9KA 2DYMA 3GB1A 2V4IB 1E9MA 1FO4A 3P4PB 3NVWA 3Q6BA 2BKRB 2WXPA 4K7SA 1ZXHA 1C3TA 2JQRB 4YL8A 2J7QB 3AEBB 3OJ4B 3UGBB 2TSSA 5EE9A 5JZEB 2K6DB 2PPHA 2JYEA 4JGHB 4DXFA 2N7JA 3Q3MC 4LDTD 2O6VA 2KK8A 1UZXB 3VXWA 2IGHA 2XK5B 2KC1A 2Q5WD 1QZEA 2MJ3A 4NAWA 3PSEB 4US9A 2K25A 2BPSA 3PLUA 4XDCA 1KF6B 1NVID 2DZKA 2D5GA 2A5UA 3H1UA 4AJYB 1F9JA 4B95A 1WGGA 1TGZB 1VD2A 2ZJDA 2O2VB 1VLBA 2LUMA 3IT4B 4ZRKA 4ANUA 2W3RA 4J3OD 1WE7A 4MJSB 4US8A 2QEJC 1UF0A 1AARA 2Z0DB 4XC2A 1I4HA 1QOAA 2G4DB 1XLQA 1XLNA 4BAXA 4I6LB 3P42A 1AN8A 1HTQA 4C4VA 2HE7A 2N0SB 1FNWA 1YD8U 2BQQA 4FJZA 2AL6A 4A9AA 2HJ8A 1IGCA 2L32A 2WHIA 1YQBA 2WXFA 3GE3C 2LXAA 3A4RA 1GB4A 3AE8B 2PVGC 3JSVA 3DVNV 4KX6B 4KKIA 2EELA 4X57B 4ZRQA 1TS3A 2BT6A 2C7MB 1WYWB 3PO0A 2KVRA 1QOBA 5D3DA 2CS4A 1Y8RC 3AULA 3B08A 1I42A 3ZYYX 2KFJA 4ZHPA 2ZNVB 1AYFA 2IDYA 3Q69A 2QSDA 4RCOA 3RULA 4D6CA 1V49A 3M95A 1I7HA 5AZGA 1I4RA 1E8YA 3IBEA 3VRAB 3MFGA 2MBHA 5LXHA 4BKSA 4WQOB 2W3SA 3B2FA 3NVYA 5EE0A 2CHXA 3DBLB 1ISNA 4OZCA 4CHKA 3UIPB 3ZJVA 4HJKA 2PVOD 3D32A 4JLCA 1MI0A 2CU1A 3RMKC 5H8YE 3DVGX 1C4PA 1SXTA 4A90A 2FUHB 2LVPA 3PVLA 4CO7A 5IP4D 5LNK1 2ZVNA 5E6OA 1GC6A 3ML8A 5G5HA 3GE8C 3O65B 3EC8A 3IHPC 4BZAA 2RMMA 3RFZB 1SJHD 1SB3C 2KDEB 1Y56A 3V05A 4ZHOA 3T3OA 2LEKA 2EKIA 2PIAA 1FFUA 5E6NA 4LNFA 3CWIA 2OJWA 4EUTA 3N1XC 4D6IA 4B0MA 2RD0A 4PYUA 2LI5A 3E56A 3GP7A 2DZIA 4GIVA 4REZA 3P63A 4MSQB 1J7AA 2LJIA 2MBBB 2M8SA 1FCLA 2AQ2B 2AQ1B 2REXA 3HK0A 2WMGA 4NJ6A 1C1YB 4ITKA 4PYZA 2JU6X 1XEEA 2LGIA 3BVMA 1KOTA 4WJOA 1SIFA 3RNAC 1K8RB 4B0EA 2DHZA 3SFEB 5KHQA 2HD5B 2KDIA 2LMCA 5DCNA 3LJ3A 1WYGA 1DOXA 1FFVA 3N1ZC 1UNSA 4TMAB 3DPDA 4MM3A 1UBIA 4OVZA 2DYOA 5DPRA 2ASQA 3ZTCA 2LGDA 1KM7A 2WS3B 3PPAA 4KVGB 3TMPB 2R2OA 1WGHA 2MJDA 4ICUA 3H6NA 2GBNA 1C78A 2KWVB 1HXYD 5TSSA 3VDZA 1QQRA 5KHOA 4YTMB 4EEWA 3QC8B 5GXGB 3QX1A 1DOIA 1YN5A 4MGYE 2GBJA 1GAQB 4JQWC 1NBFC 2ZVOA 1WXVA 2GRIA 4HCPB 2Z0EB 3ZNID 2J0MA 2JY6A 1WZ3A 2B76B 4AJWA 3T8MA 2UWQA 1H8CA 2N7DA 2KJHB 2J53A 3N20C 4FADA 2WX1A 3Q8CA 4GGQA 4HPPA 4PS7A 2BYEA 1ACCA 3BYTB 1GG3A 4ANVA 4ZRJA 3GOEA 2KFKB 1E8XA 4GDKB 2IZVB 2M4NA 1RFAA 4MACA 1VDVA 4A55A 4BKTA 4WIPA 3NS8A 2KDMA 2OJRA 3L08A 3PRPB 4A20A 1UBQA 3N9YC 3VTVA 4II3B 2W9NA 4W9FA 1F2RC 3WAPA 1YJ1A 4PK1A 1GJZA 2NBWB 3AB5A 1FD6A 3APCA 1WXAA 1LLQA 1N6ZA 5C1ZA 1WGDA 4JPSA 4EZLA 3B1LX 3PS6A 4MH0E 1GB1A 5J2RA 2KDBA 1Z2MA 2K8HA 1E7VA 3KVFB 4RH6A 3AEEB 4D6FA 3L16A 2ZW1A 3AE2B 3R7QA 1Q5WB 1C77A 2JZZA 2AL3A 3W9CB 3PRMB 3RN9C 2IY1B 3ZNHB 3DCGA 4KDLB 2NS5A 3U52E 1I4QA 1OFFA 4AUQC 3V60A 2IO2B 2DLBA 1ROEA 5CHFA 4P16A 3ZKJC 4KKJA 3DWMA 5IA7A 1FNUA 4WWPA 1G6JA 1WIAA 2K39A 2YLMA 3IXSA 1V80A 5HHDG 4LNOA 1EF5A 4ICVA 4WH4A 4AS1A 3EUB2 3AEDB 4MELA 2PMVA 1WMHB 3DWGC 3VAWA 1SE4A 4J6IA 2MSED 3W5VB 4KIKA 2KO3A 3QQ8B 4RGOS 4NAMA 3TSSA 1L4DB 2FE8A 4TSSA 2QJLA 2JXTA 4N9F4 3QJZA 3FAHA 1N63A 2FCNA 3MP9A 2J4XA 2FCSA 1E90A 4TQ0A 1X1MA 1N60A 5CTRC 1XLPA 2D3CA 2NTTA 2PW9A 2KFKA 2KLCA 1K53A 2RSUA 4M8NA 4BBNF 2PE9A 1IBXA 1ENFA 3B0AA 2IYDB 2KN5A 2L0TA 3OG5A 2QC8A 4HROA 3TUOA 2GI9A 4LJPB 3ZGZA 4OZBA 1GPXA 4FHKA 4RF0A 1SJED 2Y5BB 4WAAA 2L52A 2VRRB 3C8YA 2WGSA 3K9PB 4OZAA 1OEYJ 1JW9D 4W9KA 3PV1A 2GBMA 2NPTA 3AEFB 3EFCA 1T5XD 1WRDB 4P1CC 1D5MC 2KTRA 5BMGA 2WU5B 4F7ZA 2MX2A 2WXNA 4RNAA 5I4DA 4BOZB 3HRDD 3PT2B 4M0WA 4WJNA 5J17A 2MHJA 1CMXB 1E5WA 1M4VA 4M8MA 1JRUA 3VUYA 2K1FA 3GZNB 5C3JB 1YQ4B 2J0JA 3NVZA 1E0ZA 2DBYA 1TZ1A 2OOBB 4GB9A 2LRUA 3A9JA 4MGZE 2KAJA 3FC4A 4DDID 4HEA1 3X23A 1V1PB 1EUVB 1F2RI 3V3XA 1CZPA 4NJ7A 2C5LC 2G45B 1XT9B 4W9JA 1I4GA 4L2YA 1DOYA 4ASWC 2FNJB 4W9IA 4ZRIA 5GMVA 4H2AA 1WX9A 2BGFA 1VR9A 3U2SC 5D6JB 2IO3B 3Q3JA 1TIFA 5JHAA 2I2YA 1QLBB 2C60A 2FIDA 2K22A 2DENB 4RM8A 2KDFB 4D6GA 3JYUA 3WIMA 3WAOA 2DZJA 1P1AA 2JRIB 4M00A 3RNBC 4KSKC 3PHXB 5BO4B 3M63B 3ZNZB 1L2NA 2WDTB 3M62B 3Q2AC 4HDQA 2HDEA 3L4PA 4K81A 4LNIA 2FAZA 5BYQA 1ZP0B 2RDGA 2LWPA 3QHTA 2R61A 1E10A 1WRIA 2WXRA 4IWQA 4KGTA 2LHDA 3I63C 4URKA 1E8WA 4S0RA 4IM2A 1WY8A 2BS2B 1WSPA 2V9HA 1F52A 3X0WA 2L1AA 3GS2A 2WXKA 3ZIMA 3ECIA 2ON8A 2LJ5A 2VH1A 3L0WB 1J7CA 1WZ0A 4BOSC 1FXIA 3NZUA 1R4MI 2LGSA 4CQNA 2YVCA 1HTOA 3RNEC 2LZ6A 1UGMA 1V6EA 3ZVVA 3AE6B 5FKAC 2HTHA 3DBHI 5HKHA 2WMIA 2R2QA 4C7YA 3B9JA 3TEWA 2MWSB 5BYRA 3H7PA 1E7UA 2BTEA 3UF8A 4IUMB 2Y5CA 2WXOA 1HZ5A 4YSYB 4LJOB 4G0NB 3WALA 5G55A 2KVZA 4GDLA 2Y5PA 2CKHB 2LUEA 4IG7B 2KLGA 1SEBD 1E6EB 2WNMA 2WXJA 4MGIE 1T0SC 3MHZA 1MG4A 1EU4A 2M1MA 1FIQA 3DHGC 1D4BA 3AEGB 4C7ZA 2ZNVC 2HJ1A 1DGJA 1LXDA 3V61A 1I4XA 4W9CA 4P1BC 1FNVA 1IPGA 2H88B 1UWMA 3TBLD 1TY2A 3K9OB 3NJTA 2L3ZA 4G50A 1GOZA 2D10A 4L23A 1WFYA 3EGRA 3B2GA 2FUG1 2D3GA 2M0XA 2V0GA 2E3TA 1WF9A 4UDUC 3RNFC 1VCBA 2KQ4X 1PQSA 3L13A 3HHMA 3DBSA 5C2TB 2WXGA 4A6QA 2KYWA 1ZW7A 1ZE3D 3NOBA 1FRRA 1WM3A 3NS1A 1ZDVA 2EMTA 4DQOC 2BWES 2ICIA 1SE3A 3U30A 1U4AA 3JW0X 2CR5A 2IJ0A 5AZHA 1QKZA 5DPSA 1L0YB 2UU7A 1P0RA 3A4SC 5D2MB 1UD7A 3UQAA 1CJEA 4DBGA 4D6JA 1FXAA 3TEYA 2XK5A 2K3UA 4JWUC 1TS4A 5HG2A 3M3JA 4YSXB 5C23A 3RNGC 1EF1A 2J0KA 4DXAB 3I9V1 3VRBB 3N30A 2G9HD 5IKCM 4D6HA 1UELA 3W5UB 1JROA 2WDRB 3IVFA 2O2VA 3Q3FA 4F1SA 2FBWB 3A33B 3UI3A 2I38A 1XQQA 3N1YC 2AWTA 4MJSA 5T8IA 4HJGE 4BVUC 3RCZA 3NRZA 5IAAC 2MBQA 1KRHA 3FILB 4EFOA 5D7GA 2GB1A 1ESFA 2H89B 2ONQA 2PJHA 5LXIB 1JRPA 4LNKA 5D94A 1A70A 1R4NB 5AUKA 2WXQA 1ET9A 3BINA 5EE3A 2JVCA 4FN2A 2XBBC 4C00A 5IOIA 2FIFA 4W9DA 3I3TB 2MJEA 3NZSA 4XGAB 3SFDB 3U7ZA 4NZLB 1JWBD 2AQ3B 3VQIA 4PT5A 4FA6A 2PEAA 1NI2A 3P1MA 5FK9C 2V3SA 2WDVB 3L54A 3PTFC 1EU3A 2MBEA 2JZ3B 2IGGA 1NYQA 2SAKA 3H8HA 2KJRA 4P6VF 5EDSA 3RD2A 1V5OA 1ZPSA 1YOVB 2VZKB 1JCKB 4KGRA 2LGYA 3PGEA 3Q8AA 2KD0A 3DBRB 2RGFA 1HZ6A 2IBIB 2JWZA 2KZRA 4C56C 1WX8A 4K7WA 4II2B 3WANA 1D5XC 4IM3A 4EZKA 2KWCA 4TQ1A 1QOGA 2WYQA 2RPVA 4GOCA 1OQYA 2RPQA 4IC7B 4FJVB 1C4AA 3MC9A 1BUIC 3DBLI 3Q14C 1AW7A 4LLGM 2AYOB 1WX7A 2JZPA
chains in the Genus database with same CATH topology
4XDDA 2JQRB 3AEBB 1XLPA 2DWQA 2NTTA 2V3NA 2PW9A 2TSSA 4EE2A 5EE9A 1K53A 2M0AA 1PGBA 1HQRD 1IBXA 3KLSX 1ENFA 2LHEA 2JYEA 1SBBB 4DXFA 3TEZA 2N7JA 1TS5A 1CQVA 1ZOYB 4HROA 2PKOA 3TUOA 2GI9A 1NEKB 3ZGZA 4OZBA 1GPXA 4RF0A 2IGHA 1SJED 4WURA 2Q5WD 2L52A 2AX5A 2IPKD 2MJ3A 2Z8LA 3C8YA 4OZAA 4US9A 2CU3A 4XDCA 5HI1A 2Y3AA 1JW9D 4N6EB 1KF6B 1N5XA 3Q8EA 1XXGA 1J7BA 2LFIA 2W55A 3AEFB 4WWMA 1NVID 3CIRB 1T5XD 2D5GA 1XCQL 1D5MC 3W1SA 5BMGA 2WU5B 3HUIA 2WXNA 2OHFA 4RNAA 1IGDA 1QILA 5I4DA 2K9XA 3AH7A 1YN4A 1FEHA 3HRDD 1PGAA 4M0WA 3RPFC 3TEXA 1VLBA 1JWAD 2LUMA 3IT4B 1M4VA 1VJKA 3J9CA 4FXCA 3HVZA 3LYYA 2V3PA 2W3RA 4J3OD 1D6EC 5C3JB 1YQ4B 2QEJC 4US8A 4WQMA 3NVZA 1BMLC 2DBYA 4RGMA 1E0ZA 2CJOA 4A8XC 1I4HA 1TY0A 2KAJA 3FC4A 2QILA 1QOAA 4HEA1 1V1PB 4HKZE 1XLQA 1XLNA 1ZXIA 1F2RI 3V3XA 1XLOA 4YSZB 1JWSD 1TKYA 1CZPA 3P42A 3P4SB 1D5ZC 1AN8A 1FCCC 1I4GA 1L6UA 4L2YA 3AE3B 3IAM1 1DOYA 2N0SB 1FNWA 1C9FA 3ETRA 4H2AA 1VR9A 1DYQA 1C4CA 3U2SC 4A9AA 4DXGA 1IGCA 2L32A 2I2YA 3WCQA 1QLBB 2WXFA 1KTKA 1VZ8A 1GB4A 1XCTL 3AE8B 3E9SA 2K22A 2PVGC 2N9KA 4KKIA 2EELA 3BVGA 4KX6B 5D3IB 4ZRQA 1TS3A 2BT6A 3AN1A 3Q8BA 1C76A 4LTUA 3PO0A 2XN9C 1PUTA 3AV8A 2YEPB 1QOBA 1BXTA 5D3DA 1LO5D 3ZYYX 4ZHPA 1FMAD 3SR6A 1AYFA 4LK0M 2IDYA 3OWEB 2HDEA 2INPE 4YT0B 3L4PA 3Q69A 2JX5A 1HEZE 2QSDA 4RCOA 5AUIA 1EM7A 1ZDXA 3HVDA 5BYQA 2RDHA 3BK2A 1I7HA 1ZP0B 1UWXA 2RDGA 4IDIA 1I4RA 2BBCA 2XNAC 1L5PA 2R61A 1WRIA 2WXRA 4KGTA 3VRAB 3T3NA 3I57A 1B9RA 3MFGA 2LHDA 2INNE 1RYJA 3NVVA 2NTSA 3AE7B 1FRDA 3U4EG 2BS2B 1WSPA 5BMHA 2W3SA 2JWUA 3B2FA 1T3QA 1V1OA 2L1AA 3NVYA 3GS2A 2WXKA 2KWDA 5EE0A 2ON8A 4XWWA 1L4ZB 2M19A 1K50A 1J7CA 1SE2A 3URYA 4OZCA 1FXIA 1KLUD 2WXIA 1YN3A 1RM6C 3ZJVA 2PVOD 1MI0A 3NZ3A 2PLPA 4CQNA 5H8YE 3R2IA 1R7SA 1C4PA 2KACA 1SXTA 3AECB 4A90A 4ZRPA 3AE6B 1TKEA 4C80A 5FKAC 4N58A 3LXFA 4WAFA 5LNK1 3FILA 4RF1A 4C7YA 3B9JA 1XF5L 3TEWA 4HRSA 1V97A 2W54A 2YEPF 5BYRA 5G5HA 4MH8A 2BTEA 3EA6A 1L6VA 1IBXB 1YMHE 1VRAB 2WXOA 2Y5CA 1HZ5A 4YSYB 3VR8B 2RMMA 3RFZB 1SJHD 1SB3C 3V05A 1Y56A 4ZHOA 3P4RB 3T3OA 3BYYB 2LEKA 2WLBA 4AQ7A 2EKIA 2N9LA 2Y5PA 5E6JA 1RFKA 2PIAA 4RGNA 1MHXA 1FFUA 1SEBD 1E6EB 2JSVX 3CWIA 1CK1A 4NAWB 1MVKA 2WNMA 3R8BA 2WXJA 3MHZA 1E7PB 1EWCA 1EU4A 4B0MA 1FIQA 3E56A 3GP7A 1PDXA 1D4BA 3AEGB 4C7ZA 4REZA 1DGJA 1I4XA 3P63A 1E10A 1J7AA 2LJIA 2J42A 4ARCA 1FNVA 1FCLA 3AE4B 2H88B 2AQ2B 1UWMA 2AQ1B 1TY2A 2OEDA 1GOZA 1C79A 3AE1B 4O1NA 4L23A 1P7EA 4GLSC 1AWDA 3AE5B 4ITKA 1NI3A 3EGRA 1K52A 3B2GA 3P4QB 1JWMD 1KFYB 2QIEB 2JU6X 1XEEA 1FM0D 2LGIA 3BVMA 3PZ7A 5FR3A 2FUG1 1K51A 1VZ7A 4B0EA 5HFYA 1Q10A 2V0GA 2E3TA 2JYTA 2M56B 3IT6B 3LB8C 1F77A 3SFEB 2WXLA 4UDUC 2LMCA 1L0VB 2VZKD 2W82A 3AE9B 1ET6A 2KQ4X 1WYGA 1DOXA 5C2TB 1FFVA 1PGXA 2L83A 2WXGA 4A6QA 1UNSA 2IGDA 4TMAB 1N5WA 1ZE3D 1ZUD2 1FRRA 3BZDB 3NS1A 4OVZA 1ZDVA 2DYOA 4NJCA 1I4PA 4DQOC 1SIJA 4ARIA 2ICIA 1KH0A 1SE3A 3R2TA 1F0ZA 2WS3B 2QMTA 3AM9A 3VR9B 4HKQA 4XE0A 2MJDA 5JXVA 1YJJA 1C78A 1TJEA 1HXYD 2SEBD 2IJ0A 2WU2B 5TSSA 1QQRA 4YTMB 1TS2A 1QKZA 5GXGB 1L0YB 1DOIA 1N61A 3SEBA 1YN5A 1QOFA 4OW0A 1WWTA 1GAQB 1JQ4A 1CJEA 2GRIA 3ZQ4A 1FXAA 3TEYA 2ZW0A 1XO3A 1PYWD 2K3UA 1B1ZA 4JE3B 2B76B 4JWUC 4IOIE 1TS4A 5HG2A 4YSXB 2E6XA 3BK1A 2J53A 2NMQA 1QF6A 3O13A 3Q8CA 4USAA 1KLGD 2BB5A 1ACCA 2KMMA 3BYTB 3I9V1 3VRBB 2WDQB 2G9HD 4JX1C 4GDKB 3W2DA 3PZ8A 3AEAB 2K5PA 3W5UB 1JROA 2WDRB 1TZOA 3BWUD 4MACA 2BW2A 1VDVA 4L1BA 4A55A 1YQ3B 1WGKA 4WIPA 2BS4B 1TYGB 2HTME 1WXQA 2KDMA 1OQQA 2FBWB 3N9YC 3UI3A 1JALA 2I38A 2WXMA 1L0XB 5T8IA 1F2RC 2BB6A 2G1EA 4HJGE 3NRZA 1QT9A 1TKGA 2BS3B 2WXHA 3AB5A 4YTNB 1FD6A 4YXDB 5EE1A 1KRHA 1V1PA 3FILB 1RWSA 5D7GA 4RGTA 2GB1A 1ESFA 3KWVA 3KWLA 4N59A 2H89B 2ONQA 4JPSA 4Q2JA 4JWSC 4YWGG 1JRPA 3NUHB 1A70A 5AUKA 2WXQA 1V8CA 1GB1A 1ET9A 4RFBA 5MPOA 5EE3A 4GDLB 3MC0B 1T6BX 5H92C 4RH6A 1STEA 3AEEB 1YJIA 2MJEA 3SFDB 3U7ZA 4ZYSA 4NZLB 1JWBD 2ZW1A 2MH7A 3AE2B 2AQ3B 3VQIA 4PT5A 3BVZA 1C77A 3P1MA 5FK9C 2WDVB 4YTPB 5G5GA 3W9CB 1EU3A 2IGGA 1NYQA 2SAKA 3H8HA 4MT5A 3U52E 4P6VF 3KQ4A 3ZJTA 1I4QA 1ZPSA 2ACZB 1OFFA 1UUPA 1PFDA 1NYRA 5BYSA 2K0PA 1JCKB 2J52A 2VZKB 4KGRA 2DLBA 1HA5A 4R3DA 1SF0A 1ROEA 3Q8FA 2PTLA 3ABVB 4P16A 4KKJA 3DWMA 2WQYB 3Q8AA 2MEKA 3IAS1 1FNUA 1OQRA 3IXSA 5HHDG 4WH4A 1HZ6A 4AS1A 1IUEA 3EUB2 2X38A 4KGSA 2CJNA 3AEDB 1VZ6A 4C56C 2PMVA 3DWGC 3ZJUA 1JMLA 4D2KA 1EWYC 1P7FA 1SE4A 1D5XC 4IKGA 2KN4A 2WP9B 3MJ5A 4TQ1A 1UGJA 3W5VB 1SSNA 1QOGA 4ZOHC 1JWUD 1N62A 2RPVA 4RGOS 4NAMA 3TSSA 1L4DB 1MHHE 3BIID 1NENB 3AMZA 2FE8A 4TSSA 1YNTE 4XWTA 2BYTA 2QJLA 5BMIA 1MPEA 2JXTA 3FAHA 1N63A 2DYMA 1C4AA 3GB1A 2V4IB 3MP9A 1E9MA 1BUIC 2J4XA 4MM3B 1FO4A 3P4PB 4OHJA 3NVWA 4TQ0A 1AW7A 4LLGM 2WXPA 1ZXHA 1N60A 2JZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEP F;  2VZK B;  1VZ6 A;  3IT6 B;  3IT4 B;  1VZ8 A;  2YEP B;  1VZ7 A;  2VZK D;  2V4I B;  1VRA B; 
#chains in the Genus database with same CATH topology
 4XDD A;  4XYC A;  2DWQ A;  2V3N A;  2KJ6 A;  3DVG Y;  2M0A A;  4E71 A;  4DHJ B;  2LHE A;  3NY5 A;  1TS5 A;  4GMV A;  1SGH A;  1ZOY B;  2PKO A;  4EKU A;  4ZYN A;  4P7I A;  4TUU A;  3PHW B;  2ZEQ A;  2Z8L A;  1EO6 A;  2CU3 A;  4N6E B;  4HXD A;  1N5X A;  3Q8E A;  1XXG A;  3RZW C;  2G3Q B;  3KYD D;  2W55 A;  2IY0 B;  3APF A;  4BBN C;  3HUI A;  3AI5 A;  2OHF A;  1QIL A;  3MTN B;  3QAQ A;  4DDG D;  1YN4 A;  1FEH A;  2XEW A;  1PGA A;  2K8B A;  1RRB A;  2WMF A;  3QCA A;  2MP2 B;  3RPF C;  1VJK A;  3J9C A;  5LLI A;  3NG0 A;  4LCD E;  1UH6 A;  2V3P A;  2KOX A;  4WQM A;  4FBJ B;  4RGM A;  3LDZ E;  2CJO A;  2DAF A;  3Q3N C;  1WJ4 A;  4JIO U;  2KAN A;  2QIL A;  4HKZ E;  4W9H A;  2KQS A;  3SDL C;  1ZXI A;  1P9D U;  4XZ4 A;  2DX5 B;  1D5Z C;  1FCC C;  1L6U A;  3A1Q B;  2DAJ A;  3IAM 1;  3ONS A;  3ETR A;  2GBR A;  1DYQ A;  4LNN A;  2A4Z A;  3WCQ A;  1KTK A;  2JF5 A;  2K6Q A;  3E9S A;  3BY4 B;  1KJT A;  1F1H A;  3BVG A;  2X8X X;  4AP4 C;  3UIO B;  4IW0 A;  1I35 A;  3Q8B A;  4OVV A;  5G2N A;  1SE9 A;  4LTU A;  2XN9 C;  3AV8 A;  3IFW B;  4LK0 M;  2INP E;  2JX5 A;  1HEZ E;  3U8Z A;  2LRW A;  1UWX A;  3EHV A;  4OVU A;  2XNA C;  3T3N A;  3DOW A;  1L7Y A;  3I57 A;  1B9R A;  1YX6 B;  2INN E;  4I6P A;  2NTS A;  2K8C A;  3AE7 B;  1FRD A;  1WR6 E;  3U4E G;  4HCN B;  2RR9 A;  2C7N B;  5BMH A;  3ML9 A;  4GDK A;  5FR6 A;  3WAM A;  2GBK A;  2KWD A;  3VVW B;  4XWW A;  1SE2 A;  5JH5 C;  2IND C;  3URY A;  3A9K B;  2V4L A;  2WXI A;  1YN3 A;  2MCN B;  3NZ3 A;  2PLP A;  4A3O A;  3I5J C;  1R7S A;  2KAC A;  2QHO A;  4B9K A;  4EZJ A;  3TIX A;  4C80 A;  3LXF A;  4HK2 A;  4RF1 A;  3U7D A;  1XF5 L;  4HRS A;  1V97 A;  2W54 A;  2LGX A;  2NR2 A;  3EA6 A;  1L6V A;  1YMH E;  1VRA B;  2BYF A;  1O0S A;  2N9P C;  3P4R B;  4K3C A;  3BYY B;  4RMA A;  4AQ7 A;  2KT7 A;  4G11 A;  2O6V B;  4FUL A;  5E6J A;  1RFK A;  2JSV X;  4QAY A;  4NAW B;  5L95 C;  5CHW A;  3R3M A;  3R8B A;  2IO0 B;  2JPH A;  1E7P B;  1EWC A;  3RT3 B;  3SD5 A;  5J18 A;  1YX5 B;  2D11 A;  3PRZ A;  3RYT A;  3OJ3 A;  2KX0 A;  2J42 A;  4E74 A;  4ARC A;  3AE4 B;  2DNF A;  1WE6 A;  1WR1 A;  3PLV A;  4K3B A;  2JXX A;  1OEY A;  4GLS C;  2IO1 B;  4CYE A;  1NI3 A;  1WMH A;  2G4S A;  2NBV B;  1JWM D;  3P4Q B;  5CHV C;  3PZ7 A;  4WJP A;  3KUD B;  3TJP A;  4AOF A;  3VH4 B;  2LVQ A;  4A3P A;  1BT0 A;  4D6E A;  3RNC C;  3SHQ A;  3H7S A;  1Q10 A;  3OLM D;  2M56 B;  3LB8 C;  1F77 A;  2VZK D;  2W82 A;  1ET6 A;  1T0Y A;  1PGX A;  2L83 A;  4C4V B;  1Q1O A;  3ZDM C;  3CSF A;  3BZD B;  2QDF A;  4HDO A;  1SIJ A;  2N9X A;  4M02 A;  2QMT A;  4HKQ A;  5JXV A;  1YJJ A;  4KDI C;  3JSV B;  2SEB D;  2INC C;  1TS2 A;  3ZRF A;  1V5T A;  4KZ0 A;  3KW5 B;  4D71 A;  1MG8 A;  3ZQ4 A;  3CST A;  1B1Z A;  1ZKH A;  2LXC A;  2FCM A;  2E6X A;  2ZPN A;  2NMQ A;  3MC8 A;  1QF6 A;  3O13 A;  2NVU I;  3W1S C;  2BB5 A;  2KMM A;  4KSL C;  4DHJ D;  4JX1 C;  4GSW A;  3W2D A;  4DHZ E;  2K5P A;  2KX3 A;  3BWU D;  2D3B A;  3KUC B;  3OAW A;  4L1B A;  1WGK A;  1V81 A;  2BS4 B;  1TYG B;  2HTM E;  2I1K A;  2CHZ A;  4NY0 A;  5DPW A;  1JAL A;  2WXM A;  2ZCC A;  2N1W A;  5DPT A;  1IYF A;  1TKG A;  2JRH A;  4YTN B;  4FLH A;  2N1V A;  3GZN I;  3RUI B;  2KMC A;  1WM2 A;  1V1P A;  3V6E B;  1WXS A;  1H4R A;  2N9E B;  3KWV A;  3KWL A;  4N59 A;  4BKG A;  4JWS C;  4YWG G;  3ZNG C;  3NUH B;  1WH3 A;  1V8C A;  3S2A A;  4G3X B;  3MC0 B;  5IO9 A;  5H92 C;  1LFD A;  3ZXR A;  3BVZ A;  2RDB C;  4YTP B;  1T0Q C;  2BKF A;  2WMH A;  3ZJT A;  3JVZ X;  3ALB A;  4RM9 A;  1NYR A;  2NBU A;  3ENE A;  2J52 A;  1HA5 A;  1YIW A;  1ZGU B;  3ZW3 A;  2WMJ A;  2WQY B;  2MEK A;  1OQR A;  3VUX A;  3L10 B;  1IUE A;  4KGS A;  2X38 A;  2CJN A;  1VZ6 A;  4AWJ A;  4DK5 A;  1JML A;  4D2K A;  1EWY C;  3RZF A;  3C0R B;  1LGR A;  4ZOH C;  1N62 A;  3BII D;  3AMZ A;  2EKE C;  1YNT E;  5BMI A;  1MPE A;  2C9W B;  1LM8 B;  2L0F A;  1A5R A;  4NNJ B;  4MM3 B;  4OHJ A;  3UIN B;  5CX3 A;  2NCN A;  3AE1 B;  2MQJ A;  3UQB A;  3VH3 B;  2KMA A;  4EE2 A;  4BFR A;  3PZD A;  2L05 A;  3ZRC A;  1PGB A;  1HQR D;  2L00 B;  3KLS X;  2ZZP B;  1WI0 A;  1SBB B;  3TEZ A;  3DHH C;  2LD9 A;  1CQV A;  3SU8 X;  1NEK B;  3ZDT A;  4NQK E;  3MHS D;  2WWZ A;  4WUR A;  2AX5 A;  2IPK D;  4K1R B;  4JL9 A;  5HI1 A;  2Y3A A;  2JT4 B;  4KZC A;  1J7B A;  2LFI A;  1P3Q U;  4WWM A;  1HE8 A;  3DVN U;  1V2Y A;  2I1J A;  3CIR B;  1GNU A;  1XCQ L;  3W1S A;  3QK0 A;  1IGD A;  2EMS A;  2K9X A;  3AH7 A;  2O6V D;  3DDC B;  4F8C B;  5AEK B;  4ACF A;  3TEX A;  1JWA D;  5L83 A;  3R66 C;  4FXC A;  4ANX A;  3HVZ A;  3LYY A;  1D6E C;  2MBO A;  3VFK A;  1BML C;  1WGY A;  2ZPY A;  4A8X C;  2MA9 B;  1LQB A;  1TY0 A;  1P98 A;  2KKC A;  3ZLZ A;  1XLO A;  4YSZ B;  1JWS D;  1TKY A;  4TKN A;  3P4S B;  3HM6 X;  4IWP A;  1T0R C;  1OGW A;  3AE3 B;  2BYV E;  3C19 A;  1C9F A;  1TTN A;  1C4C A;  4E3C A;  3VTU A;  4DXG A;  1VZ8 A;  1XCT L;  2BF8 B;  4XX5 A;  3V62 A;  2N9K A;  5D3I B;  1S3S G;  3ZO5 B;  3N3K B;  3AN1 A;  1WJU A;  1C76 A;  2PE6 B;  3QWZ B;  1PUT A;  2YEP B;  4WJQ A;  1BXT A;  1LO5 D;  1KLV A;  3RI7 C;  2D2Q A;  3ZXV A;  1FMA D;  3N32 A;  3SR6 A;  3OWE B;  4FJY A;  3AXC A;  3QAR A;  3KYC D;  3Q3O C;  4YT0 B;  5AUI A;  1EM7 A;  1ZDX A;  3HVD A;  2RDH A;  3BK2 A;  4IDI A;  1V86 A;  2GLS A;  2BBC A;  1NDD A;  1L5P A;  3CMM B;  3NVV A;  1RYJ A;  3AU5 A;  2L7R A;  1XD3 B;  3FKY A;  2JWU A;  1T3Q A;  2GOW A;  1V1O A;  2AEH A;  1GUA B;  3IG3 A;  3VUW A;  1L4Z B;  4KIK B;  2M19 A;  1K50 A;  1KLU D;  4LDT B;  1RM6 C;  2L8J A;  2CHW A;  3EEC A;  3R2I A;  3AEC B;  2FCQ A;  1TT5 B;  2D3A A;  4ZRP A;  4BKS D;  1TKE A;  4N58 A;  2KC2 A;  4WAF A;  3FIL A;  2DYB A;  2KHW B;  4HVB A;  2YEP F;  4MH8 A;  1IBX B;  4I6N B;  3VR8 B;  4M01 A;  3KUZ A;  2WLB A;  2N9L A;  1FXT B;  4RGN A;  1MHX A;  3L17 A;  1R4N I;  2N4F A;  3W1Y A;  1CK1 A;  1MVK A;  2NPT B;  5IN7 A;  1TBE A;  1PDX A;  3H9D A;  2KTR B;  3VTW A;  4IWO A;  4M0W B;  4D6D A;  1E8Z A;  2OED A;  2MLB A;  4O1N A;  1C79 A;  2N7E A;  3ZTD A;  4MSM B;  1P7E A;  1AWD A;  3AE5 B;  3CF6 E;  3MJW A;  1K52 A;  1KFY B;  2QIE B;  1FM0 D;  5FR3 A;  4W9E A;  4HWI B;  5TR5 A;  4B6W A;  4MGK E;  2VH2 A;  2KTF A;  3A9J B;  3DBR I;  4HPM B;  1RLF A;  1K51 A;  1VZ7 A;  5HFY A;  3WA0 A;  2Z59 B;  2B3A A;  2JYT A;  3IT6 B;  2WXL A;  3VHT C;  1L0V B;  3AE9 B;  3KH0 A;  4GXB A;  4WWO A;  2BVC A;  2KXJ A;  2ZCB A;  2IGD A;  3PRE A;  1N5W A;  1ZUD 2;  4NJC A;  1MJD A;  1D3Z A;  1I4P A;  3HIZ A;  1J19 A;  4ARI A;  1KH0 A;  4ANW A;  3R2T A;  1F0Z A;  4PS8 A;  3P2B A;  3AM9 A;  3VR9 B;  4XE0 A;  1TJE A;  2WU2 B;  2JUO A;  1FPY A;  2DZM A;  1N61 A;  3SEB A;  1QOF A;  3QIJ A;  4OW0 A;  3T9L A;  1WWT A;  1Q0W B;  2WX0 A;  1JQ4 A;  4GU2 A;  4MEM A;  2ZW0 A;  1XO3 A;  1PYW D;  4JE3 B;  4IOI E;  3ZUN A;  4FHJ A;  2LAS A;  3BK1 A;  2WMK A;  2L76 A;  4USA A;  1KLG D;  3AU4 A;  2C7H A;  2GMI C;  4HLE A;  2WDQ B;  3V6C B;  3PZ8 A;  3AEA B;  1R4M B;  1TZO A;  3EFU A;  2MP2 A;  2BW2 A;  2KNB A;  1J0G A;  1YQ3 B;  2M17 A;  4HPL B;  3TCA A;  1WXQ A;  1OQQ A;  4TV3 A;  4W9L A;  2KWU B;  1J8C A;  3DBH B;  1Z5S B;  1L0X B;  4DHZ B;  2BB6 A;  2G1E A;  1OTR B;  3QA8 A;  1QT9 A;  1WGR A;  4S17 A;  4EOY A;  2BS3 B;  2WXH A;  4YXD B;  5EE1 A;  4NPN A;  4W9G A;  2WMI B;  5AZF A;  1RWS A;  4RGT A;  3NHE B;  2MRP A;  3H7P B;  2KQ7 A;  4Q2J A;  2MW5 A;  3A1Q A;  4WWN A;  4GN1 A;  4RFB A;  5MPO A;  4GDL B;  1T6B X;  2QCZ A;  1STE A;  1YJI A;  4ZYS A;  2MH7 A;  3R7R A;  2BWF A;  3DQV A;  3HM3 A;  2LVO A;  5G5G A;  1IP9 A;  4ZDV A;  2UYZ B;  4MT5 A;  1WJN A;  3KQ4 A;  2ACZ B;  1UUP A;  2D07 B;  1PFD A;  4IM0 A;  5BYS A;  1GC7 A;  2K0P A;  4K7U A;  4R3D A;  1SF0 A;  1M94 A;  3Q8F A;  2PTL A;  3ABV B;  3IAS 1;  1WJ6 A;  3TL5 A;  4PS3 A;  4MDK E;  5E6P A;  1MFW A;  3ZJU A;  4D72 A;  1V9J A;  1P7F A;  5JHB A;  3APD A;  4IKG A;  2KN4 A;  2WP9 B;  3MJ5 A;  4DWF A;  1UGJ A;  2V1Y A;  1SSN A;  1WXM A;  1JWU D;  4NQL B;  1MHH E;  1S1Q B;  3DHI C;  1NEN B;  4KV2 A;  4XWT A;  2BYT A;  1RAX A;  3A9K A;  2DYM A;  3GB1 A;  2V4I B;  1E9M A;  1FO4 A;  3P4P B;  3NVW A;  3Q6B A;  2BKR B;  2WXP A;  4K7S A;  1ZXH A;  1C3T A;  2JQR B;  4YL8 A;  2J7Q B;  3AEB B;  3OJ4 B;  3UGB B;  2TSS A;  5EE9 A;  5JZE B;  2K6D B;  2PPH A;  2JYE A;  4JGH B;  4DXF A;  2N7J A;  3Q3M C;  4LDT D;  2O6V A;  2KK8 A;  1UZX B;  3VXW A;  2IGH A;  2XK5 B;  2KC1 A;  2Q5W D;  1QZE A;  2MJ3 A;  4NAW A;  3PSE B;  4US9 A;  2K25 A;  2BPS A;  3PLU A;  4XDC A;  1KF6 B;  1NVI D;  2DZK A;  2D5G A;  2A5U A;  3H1U A;  4AJY B;  1F9J A;  4B95 A;  1WGG A;  1TGZ B;  1VD2 A;  2ZJD A;  2O2V B;  1VLB A;  2LUM A;  3IT4 B;  4ZRK A;  4ANU A;  2W3R A;  4J3O D;  1WE7 A;  4MJS B;  4US8 A;  2QEJ C;  1UF0 A;  1AAR A;  2Z0D B;  4XC2 A;  1I4H A;  1QOA A;  2G4D B;  1XLQ A;  1XLN A;  4BAX A;  4I6L B;  3P42 A;  1AN8 A;  1HTQ A;  4C4V A;  2HE7 A;  2N0S B;  1FNW A;  1YD8 U;  2BQQ A;  4FJZ A;  2AL6 A;  4A9A A;  2HJ8 A;  1IGC A;  2L32 A;  2WHI A;  1YQB A;  2WXF A;  3GE3 C;  2LXA A;  3A4R A;  1GB4 A;  3AE8 B;  2PVG C;  3JSV A;  3DVN V;  4KX6 B;  4KKI A;  2EEL A;  4X57 B;  4ZRQ A;  1TS3 A;  2BT6 A;  2C7M B;  1WYW B;  3PO0 A;  2KVR A;  1QOB A;  5D3D A;  2CS4 A;  1Y8R C;  3AUL A;  3B08 A;  1I42 A;  3ZYY X;  2KFJ A;  4ZHP A;  2ZNV B;  1AYF A;  2IDY A;  3Q69 A;  2QSD A;  4RCO A;  3RUL A;  4D6C A;  1V49 A;  3M95 A;  1I7H A;  5AZG A;  1I4R A;  1E8Y A;  3IBE A;  3VRA B;  3MFG A;  2MBH A;  5LXH A;  4BKS A;  4WQO B;  2W3S A;  3B2F A;  3NVY A;  5EE0 A;  2CHX A;  3DBL B;  1ISN A;  4OZC A;  4CHK A;  3UIP B;  3ZJV A;  4HJK A;  2PVO D;  3D32 A;  4JLC A;  1MI0 A;  2CU1 A;  3RMK C;  5H8Y E;  3DVG X;  1C4P A;  1SXT A;  4A90 A;  2FUH B;  2LVP A;  3PVL A;  4CO7 A;  5IP4 D;  5LNK 1;  2ZVN A;  5E6O A;  1GC6 A;  3ML8 A;  5G5H A;  3GE8 C;  3O65 B;  3EC8 A;  3IHP C;  4BZA A;  2RMM A;  3RFZ B;  1SJH D;  1SB3 C;  2KDE B;  1Y56 A;  3V05 A;  4ZHO A;  3T3O A;  2LEK A;  2EKI A;  2PIA A;  1FFU A;  5E6N A;  4LNF A;  3CWI A;  2OJW A;  4EUT A;  3N1X C;  4D6I A;  4B0M A;  2RD0 A;  4PYU A;  2LI5 A;  3E56 A;  3GP7 A;  2DZI A;  4GIV A;  4REZ A;  3P63 A;  4MSQ B;  1J7A A;  2LJI A;  2MBB B;  2M8S A;  1FCL A;  2AQ2 B;  2AQ1 B;  2REX A;  3HK0 A;  2WMG A;  4NJ6 A;  1C1Y B;  4ITK A;  4PYZ A;  2JU6 X;  1XEE A;  2LGI A;  3BVM A;  1KOT A;  4WJO A;  1SIF A;  3RNA C;  1K8R B;  4B0E A;  2DHZ A;  3SFE B;  5KHQ A;  2HD5 B;  2KDI A;  2LMC A;  5DCN A;  3LJ3 A;  1WYG A;  1DOX A;  1FFV A;  3N1Z C;  1UNS A;  4TMA B;  3DPD A;  4MM3 A;  1UBI A;  4OVZ A;  2DYO A;  5DPR A;  2ASQ A;  3ZTC A;  2LGD A;  1KM7 A;  2WS3 B;  3PPA A;  4KVG B;  3TMP B;  2R2O A;  1WGH A;  2MJD A;  4ICU A;  3H6N A;  2GBN A;  1C78 A;  2KWV B;  1HXY D;  5TSS A;  3VDZ A;  1QQR A;  5KHO A;  4YTM B;  4EEW A;  3QC8 B;  5GXG B;  3QX1 A;  1DOI A;  1YN5 A;  4MGY E;  2GBJ A;  1GAQ B;  4JQW C;  1NBF C;  2ZVO A;  1WXV A;  2GRI A;  4HCP B;  2Z0E B;  3ZNI D;  2J0M A;  2JY6 A;  1WZ3 A;  2B76 B;  4AJW A;  3T8M A;  2UWQ A;  1H8C A;  2N7D A;  2KJH B;  2J53 A;  3N20 C;  4FAD A;  2WX1 A;  3Q8C A;  4GGQ A;  4HPP A;  4PS7 A;  2BYE A;  1ACC A;  3BYT B;  1GG3 A;  4ANV A;  4ZRJ A;  3GOE A;  2KFK B;  1E8X A;  4GDK B;  2IZV B;  2M4N A;  1RFA A;  4MAC A;  1VDV A;  4A55 A;  4BKT A;  4WIP A;  3NS8 A;  2KDM A;  2OJR A;  3L08 A;  3PRP B;  4A20 A;  1UBQ A;  3N9Y C;  3VTV A;  4II3 B;  2W9N A;  4W9F A;  1F2R C;  3WAP A;  1YJ1 A;  4PK1 A;  1GJZ A;  2NBW B;  3AB5 A;  1FD6 A;  3APC A;  1WXA A;  1LLQ A;  1N6Z A;  5C1Z A;  1WGD A;  4JPS A;  4EZL A;  3B1L X;  3PS6 A;  4MH0 E;  1GB1 A;  5J2R A;  2KDB A;  1Z2M A;  2K8H A;  1E7V A;  3KVF B;  4RH6 A;  3AEE B;  4D6F A;  3L16 A;  2ZW1 A;  3AE2 B;  3R7Q A;  1Q5W B;  1C77 A;  2JZZ A;  2AL3 A;  3W9C B;  3PRM B;  3RN9 C;  2IY1 B;  3ZNH B;  3DCG A;  4KDL B;  2NS5 A;  3U52 E;  1I4Q A;  1OFF A;  4AUQ C;  3V60 A;  2IO2 B;  2DLB A;  1ROE A;  5CHF A;  4P16 A;  3ZKJ C;  4KKJ A;  3DWM A;  5IA7 A;  1FNU A;  4WWP A;  1G6J A;  1WIA A;  2K39 A;  2YLM A;  3IXS A;  1V80 A;  5HHD G;  4LNO A;  1EF5 A;  4ICV A;  4WH4 A;  4AS1 A;  3EUB 2;  3AED B;  4MEL A;  2PMV A;  1WMH B;  3DWG C;  3VAW A;  1SE4 A;  4J6I A;  2MSE D;  3W5V B;  4KIK A;  2KO3 A;  3QQ8 B;  4RGO S;  4NAM A;  3TSS A;  1L4D B;  2FE8 A;  4TSS A;  2QJL A;  2JXT A;  4N9F 4;  3QJZ A;  3FAH A;  1N63 A;  2FCN A;  3MP9 A;  2J4X A;  2FCS A;  1E90 A;  4TQ0 A;  1X1M A;  1N60 A;  5CTR C;  1XLP A;  2D3C A;  2NTT A;  2PW9 A;  2KFK A;  2KLC A;  1K53 A;  2RSU A;  4M8N A;  4BBN F;  2PE9 A;  1IBX A;  1ENF A;  3B0A A;  2IYD B;  2KN5 A;  2L0T A;  3OG5 A;  2QC8 A;  4HRO A;  3TUO A;  2GI9 A;  4LJP B;  3ZGZ A;  4OZB A;  1GPX A;  4FHK A;  4RF0 A;  1SJE D;  2Y5B B;  4WAA A;  2L52 A;  2VRR B;  3C8Y A;  2WGS A;  3K9P B;  4OZA A;  1OEY J;  1JW9 D;  4W9K A;  3PV1 A;  2GBM A;  2NPT A;  3AEF B;  3EFC A;  1T5X D;  1WRD B;  4P1C C;  1D5M C;  2KTR A;  5BMG A;  2WU5 B;  4F7Z A;  2MX2 A;  2WXN A;  4RNA A;  5I4D A;  4BOZ B;  3HRD D;  3PT2 B;  4M0W A;  4WJN A;  5J17 A;  2MHJ A;  1CMX B;  1E5W A;  1M4V A;  4M8M A;  1JRU A;  3VUY A;  2K1F A;  3GZN B;  5C3J B;  1YQ4 B;  2J0J A;  3NVZ A;  1E0Z A;  2DBY A;  1TZ1 A;  2OOB B;  4GB9 A;  2LRU A;  3A9J A;  4MGZ E;  2KAJ A;  3FC4 A;  4DDI D;  4HEA 1;  3X23 A;  1V1P B;  1EUV B;  1F2R I;  3V3X A;  1CZP A;  4NJ7 A;  2C5L C;  2G45 B;  1XT9 B;  4W9J A;  1I4G A;  4L2Y A;  1DOY A;  4ASW C;  2FNJ B;  4W9I A;  4ZRI A;  5GMV A;  4H2A A;  1WX9 A;  2BGF A;  1VR9 A;  3U2S C;  5D6J B;  2IO3 B;  3Q3J A;  1TIF A;  5JHA A;  2I2Y A;  1QLB B;  2C60 A;  2FID A;  2K22 A;  2DEN B;  4RM8 A;  2KDF B;  4D6G A;  3JYU A;  3WIM A;  3WAO A;  2DZJ A;  1P1A A;  2JRI B;  4M00 A;  3RNB C;  4KSK C;  3PHX B;  5BO4 B;  3M63 B;  3ZNZ B;  1L2N A;  2WDT B;  3M62 B;  3Q2A C;  4HDQ A;  2HDE A;  3L4P A;  4K81 A;  4LNI A;  2FAZ A;  5BYQ A;  1ZP0 B;  2RDG A;  2LWP A;  3QHT A;  2R61 A;  1E10 A;  1WRI A;  2WXR A;  4IWQ A;  4KGT A;  2LHD A;  3I63 C;  4URK A;  1E8W A;  4S0R A;  4IM2 A;  1WY8 A;  2BS2 B;  1WSP A;  2V9H A;  1F52 A;  3X0W A;  2L1A A;  3GS2 A;  2WXK A;  3ZIM A;  3ECI A;  2ON8 A;  2LJ5 A;  2VH1 A;  3L0W B;  1J7C A;  1WZ0 A;  4BOS C;  1FXI A;  3NZU A;  1R4M I;  2LGS A;  4CQN A;  2YVC A;  1HTO A;  3RNE C;  2LZ6 A;  1UGM A;  1V6E A;  3ZVV A;  3AE6 B;  5FKA C;  2HTH A;  3DBH I;  5HKH A;  2WMI A;  2R2Q A;  4C7Y A;  3B9J A;  3TEW A;  2MWS B;  5BYR A;  3H7P A;  1E7U A;  2BTE A;  3UF8 A;  4IUM B;  2Y5C A;  2WXO A;  1HZ5 A;  4YSY B;  4LJO B;  4G0N B;  3WAL A;  5G55 A;  2KVZ A;  4GDL A;  2Y5P A;  2CKH B;  2LUE A;  4IG7 B;  2KLG A;  1SEB D;  1E6E B;  2WNM A;  2WXJ A;  4MGI E;  1T0S C;  3MHZ A;  1MG4 A;  1EU4 A;  2M1M A;  1FIQ A;  3DHG C;  1D4B A;  3AEG B;  4C7Z A;  2ZNV C;  2HJ1 A;  1DGJ A;  1LXD A;  3V61 A;  1I4X A;  4W9C A;  4P1B C;  1FNV A;  1IPG A;  2H88 B;  1UWM A;  3TBL D;  1TY2 A;  3K9O B;  3NJT A;  2L3Z A;  4G50 A;  1GOZ A;  2D10 A;  4L23 A;  1WFY A;  3EGR A;  3B2G A;  2FUG 1;  2D3G A;  2M0X A;  2V0G A;  2E3T A;  1WF9 A;  4UDU C;  3RNF C;  1VCB A;  2KQ4 X;  1PQS A;  3L13 A;  3HHM A;  3DBS A;  5C2T B;  2WXG A;  4A6Q A;  2KYW A;  1ZW7 A;  1ZE3 D;  3NOB A;  1FRR A;  1WM3 A;  3NS1 A;  1ZDV A;  2EMT A;  4DQO C;  2BWE S;  2ICI A;  1SE3 A;  3U30 A;  1U4A A;  3JW0 X;  2CR5 A;  2IJ0 A;  5AZH A;  1QKZ A;  5DPS A;  1L0Y B;  2UU7 A;  1P0R A;  3A4S C;  5D2M B;  1UD7 A;  3UQA A;  1CJE A;  4DBG A;  4D6J A;  1FXA A;  3TEY A;  2XK5 A;  2K3U A;  4JWU C;  1TS4 A;  5HG2 A;  3M3J A;  4YSX B;  5C23 A;  3RNG C;  1EF1 A;  2J0K A;  4DXA B;  3I9V 1;  3VRB B;  3N30 A;  2G9H D;  5IKC M;  4D6H A;  1UEL A;  3W5U B;  1JRO A;  2WDR B;  3IVF A;  2O2V A;  3Q3F A;  4F1S A;  2FBW B;  3A33 B;  3UI3 A;  2I38 A;  1XQQ A;  3N1Y C;  2AWT A;  4MJS A;  5T8I A;  4HJG E;  4BVU C;  3RCZ A;  3NRZ A;  5IAA C;  2MBQ A;  1KRH A;  3FIL B;  4EFO A;  5D7G A;  2GB1 A;  1ESF A;  2H89 B;  2ONQ A;  2PJH A;  5LXI B;  1JRP A;  4LNK A;  5D94 A;  1A70 A;  1R4N B;  5AUK A;  2WXQ A;  1ET9 A;  3BIN A;  5EE3 A;  2JVC A;  4FN2 A;  2XBB C;  4C00 A;  5IOI A;  2FIF A;  4W9D A;  3I3T B;  2MJE A;  3NZS A;  4XGA B;  3SFD B;  3U7Z A;  4NZL B;  1JWB D;  2AQ3 B;  3VQI A;  4PT5 A;  4FA6 A;  2PEA A;  1NI2 A;  3P1M A;  5FK9 C;  2V3S A;  2WDV B;  3L54 A;  3PTF C;  1EU3 A;  2MBE A;  2JZ3 B;  2IGG A;  1NYQ A;  2SAK A;  3H8H A;  2KJR A;  4P6V F;  5EDS A;  3RD2 A;  1V5O A;  1ZPS A;  1YOV B;  2VZK B;  1JCK B;  4KGR A;  2LGY A;  3PGE A;  3Q8A A;  2KD0 A;  3DBR B;  2RGF A;  1HZ6 A;  2IBI B;  2JWZ A;  2KZR A;  4C56 C;  1WX8 A;  4K7W A;  4II2 B;  3WAN A;  1D5X C;  4IM3 A;  4EZK A;  2KWC A;  4TQ1 A;  1QOG A;  2WYQ A;  2RPV A;  4GOC A;  1OQY A;  2RPQ A;  4IC7 B;  4FJV B;  1C4A A;  3MC9 A;  1BUI C;  3DBL I;  3Q14 C;  1AW7 A;  4LLG M;  2AYO B;  1WX7 A;  2JZP A; 
#chains in the Genus database with same CATH homology
 4XDD A;  2JQR B;  3AEB B;  1XLP A;  2DWQ A;  2NTT A;  2V3N A;  2PW9 A;  2TSS A;  4EE2 A;  5EE9 A;  1K53 A;  2M0A A;  1PGB A;  1HQR D;  1IBX A;  3KLS X;  1ENF A;  2LHE A;  2JYE A;  1SBB B;  4DXF A;  3TEZ A;  2N7J A;  1TS5 A;  1CQV A;  1ZOY B;  4HRO A;  2PKO A;  3TUO A;  2GI9 A;  1NEK B;  3ZGZ A;  4OZB A;  1GPX A;  4RF0 A;  2IGH A;  1SJE D;  4WUR A;  2Q5W D;  2L52 A;  2AX5 A;  2IPK D;  2MJ3 A;  2Z8L A;  3C8Y A;  4OZA A;  4US9 A;  2CU3 A;  4XDC A;  5HI1 A;  2Y3A A;  1JW9 D;  4N6E B;  1KF6 B;  1N5X A;  3Q8E A;  1XXG A;  1J7B A;  2LFI A;  2W55 A;  3AEF B;  4WWM A;  1NVI D;  3CIR B;  1T5X D;  2D5G A;  1XCQ L;  1D5M C;  3W1S A;  5BMG A;  2WU5 B;  3HUI A;  2WXN A;  2OHF A;  4RNA A;  1IGD A;  1QIL A;  5I4D A;  2K9X A;  3AH7 A;  1YN4 A;  1FEH A;  3HRD D;  1PGA A;  4M0W A;  3RPF C;  3TEX A;  1VLB A;  1JWA D;  2LUM A;  3IT4 B;  1M4V A;  1VJK A;  3J9C A;  4FXC A;  3HVZ A;  3LYY A;  2V3P A;  2W3R A;  4J3O D;  1D6E C;  5C3J B;  1YQ4 B;  2QEJ C;  4US8 A;  4WQM A;  3NVZ A;  1BML C;  2DBY A;  4RGM A;  1E0Z A;  2CJO A;  4A8X C;  1I4H A;  1TY0 A;  2KAJ A;  3FC4 A;  2QIL A;  1QOA A;  4HEA 1;  1V1P B;  4HKZ E;  1XLQ A;  1XLN A;  1ZXI A;  1F2R I;  3V3X A;  1XLO A;  4YSZ B;  1JWS D;  1TKY A;  1CZP A;  3P42 A;  3P4S B;  1D5Z C;  1AN8 A;  1FCC C;  1I4G A;  1L6U A;  4L2Y A;  3AE3 B;  3IAM 1;  1DOY A;  2N0S B;  1FNW A;  1C9F A;  3ETR A;  4H2A A;  1VR9 A;  1DYQ A;  1C4C A;  3U2S C;  4A9A A;  4DXG A;  1IGC A;  2L32 A;  2I2Y A;  3WCQ A;  1QLB B;  2WXF A;  1KTK A;  1VZ8 A;  1GB4 A;  1XCT L;  3AE8 B;  3E9S A;  2K22 A;  2PVG C;  2N9K A;  4KKI A;  2EEL A;  3BVG A;  4KX6 B;  5D3I B;  4ZRQ A;  1TS3 A;  2BT6 A;  3AN1 A;  3Q8B A;  1C76 A;  4LTU A;  3PO0 A;  2XN9 C;  1PUT A;  3AV8 A;  2YEP B;  1QOB A;  1BXT A;  5D3D A;  1LO5 D;  3ZYY X;  4ZHP A;  1FMA D;  3SR6 A;  1AYF A;  4LK0 M;  2IDY A;  3OWE B;  2HDE A;  2INP E;  4YT0 B;  3L4P A;  3Q69 A;  2JX5 A;  1HEZ E;  2QSD A;  4RCO A;  5AUI A;  1EM7 A;  1ZDX A;  3HVD A;  5BYQ A;  2RDH A;  3BK2 A;  1I7H A;  1ZP0 B;  1UWX A;  2RDG A;  4IDI A;  1I4R A;  2BBC A;  2XNA C;  1L5P A;  2R61 A;  1WRI A;  2WXR A;  4KGT A;  3VRA B;  3T3N A;  3I57 A;  1B9R A;  3MFG A;  2LHD A;  2INN E;  1RYJ A;  3NVV A;  2NTS A;  3AE7 B;  1FRD A;  3U4E G;  2BS2 B;  1WSP A;  5BMH A;  2W3S A;  2JWU A;  3B2F A;  1T3Q A;  1V1O A;  2L1A A;  3NVY A;  3GS2 A;  2WXK A;  2KWD A;  5EE0 A;  2ON8 A;  4XWW A;  1L4Z B;  2M19 A;  1K50 A;  1J7C A;  1SE2 A;  3URY A;  4OZC A;  1FXI A;  1KLU D;  2WXI A;  1YN3 A;  1RM6 C;  3ZJV A;  2PVO D;  1MI0 A;  3NZ3 A;  2PLP A;  4CQN A;  5H8Y E;  3R2I A;  1R7S A;  1C4P A;  2KAC A;  1SXT A;  3AEC B;  4A90 A;  4ZRP A;  3AE6 B;  1TKE A;  4C80 A;  5FKA C;  4N58 A;  3LXF A;  4WAF A;  5LNK 1;  3FIL A;  4RF1 A;  4C7Y A;  3B9J A;  1XF5 L;  3TEW A;  4HRS A;  1V97 A;  2W54 A;  2YEP F;  5BYR A;  5G5H A;  4MH8 A;  2BTE A;  3EA6 A;  1L6V A;  1IBX B;  1YMH E;  1VRA B;  2WXO A;  2Y5C A;  1HZ5 A;  4YSY B;  3VR8 B;  2RMM A;  3RFZ B;  1SJH D;  1SB3 C;  3V05 A;  1Y56 A;  4ZHO A;  3P4R B;  3T3O A;  3BYY B;  2LEK A;  2WLB A;  4AQ7 A;  2EKI A;  2N9L A;  2Y5P A;  5E6J A;  1RFK A;  2PIA A;  4RGN A;  1MHX A;  1FFU A;  1SEB D;  1E6E B;  2JSV X;  3CWI A;  1CK1 A;  4NAW B;  1MVK A;  2WNM A;  3R8B A;  2WXJ A;  3MHZ A;  1E7P B;  1EWC A;  1EU4 A;  4B0M A;  1FIQ A;  3E56 A;  3GP7 A;  1PDX A;  1D4B A;  3AEG B;  4C7Z A;  4REZ A;  1DGJ A;  1I4X A;  3P63 A;  1E10 A;  1J7A A;  2LJI A;  2J42 A;  4ARC A;  1FNV A;  1FCL A;  3AE4 B;  2H88 B;  2AQ2 B;  1UWM A;  2AQ1 B;  1TY2 A;  2OED A;  1GOZ A;  1C79 A;  3AE1 B;  4O1N A;  4L23 A;  1P7E A;  4GLS C;  1AWD A;  3AE5 B;  4ITK A;  1NI3 A;  3EGR A;  1K52 A;  3B2G A;  3P4Q B;  1JWM D;  1KFY B;  2QIE B;  2JU6 X;  1XEE A;  1FM0 D;  2LGI A;  3BVM A;  3PZ7 A;  5FR3 A;  2FUG 1;  1K51 A;  1VZ7 A;  4B0E A;  5HFY A;  1Q10 A;  2V0G A;  2E3T A;  2JYT A;  2M56 B;  3IT6 B;  3LB8 C;  1F77 A;  3SFE B;  2WXL A;  4UDU C;  2LMC A;  1L0V B;  2VZK D;  2W82 A;  3AE9 B;  1ET6 A;  2KQ4 X;  1WYG A;  1DOX A;  5C2T B;  1FFV A;  1PGX A;  2L83 A;  2WXG A;  4A6Q A;  1UNS A;  2IGD A;  4TMA B;  1N5W A;  1ZE3 D;  1ZUD 2;  1FRR A;  3BZD B;  3NS1 A;  4OVZ A;  1ZDV A;  2DYO A;  4NJC A;  1I4P A;  4DQO C;  1SIJ A;  4ARI A;  2ICI A;  1KH0 A;  1SE3 A;  3R2T A;  1F0Z A;  2WS3 B;  2QMT A;  3AM9 A;  3VR9 B;  4HKQ A;  4XE0 A;  2MJD A;  5JXV A;  1YJJ A;  1C78 A;  1TJE A;  1HXY D;  2SEB D;  2IJ0 A;  2WU2 B;  5TSS A;  1QQR A;  4YTM B;  1TS2 A;  1QKZ A;  5GXG B;  1L0Y B;  1DOI A;  1N61 A;  3SEB A;  1YN5 A;  1QOF A;  4OW0 A;  1WWT A;  1GAQ B;  1JQ4 A;  1CJE A;  2GRI A;  3ZQ4 A;  1FXA A;  3TEY A;  2ZW0 A;  1XO3 A;  1PYW D;  2K3U A;  1B1Z A;  4JE3 B;  2B76 B;  4JWU C;  4IOI E;  1TS4 A;  5HG2 A;  4YSX B;  2E6X A;  3BK1 A;  2J53 A;  2NMQ A;  1QF6 A;  3O13 A;  3Q8C A;  4USA A;  1KLG D;  2BB5 A;  1ACC A;  2KMM A;  3BYT B;  3I9V 1;  3VRB B;  2WDQ B;  2G9H D;  4JX1 C;  4GDK B;  3W2D A;  3PZ8 A;  3AEA B;  2K5P A;  3W5U B;  1JRO A;  2WDR B;  1TZO A;  3BWU D;  4MAC A;  2BW2 A;  1VDV A;  4L1B A;  4A55 A;  1YQ3 B;  1WGK A;  4WIP A;  2BS4 B;  1TYG B;  2HTM E;  1WXQ A;  2KDM A;  1OQQ A;  2FBW B;  3N9Y C;  3UI3 A;  1JAL A;  2I38 A;  2WXM A;  1L0X B;  5T8I A;  1F2R C;  2BB6 A;  2G1E A;  4HJG E;  3NRZ A;  1QT9 A;  1TKG A;  2BS3 B;  2WXH A;  3AB5 A;  4YTN B;  1FD6 A;  4YXD B;  5EE1 A;  1KRH A;  1V1P A;  3FIL B;  1RWS A;  5D7G A;  4RGT A;  2GB1 A;  1ESF A;  3KWV A;  3KWL A;  4N59 A;  2H89 B;  2ONQ A;  4JPS A;  4Q2J A;  4JWS C;  4YWG G;  1JRP A;  3NUH B;  1A70 A;  5AUK A;  2WXQ A;  1V8C A;  1GB1 A;  1ET9 A;  4RFB A;  5MPO A;  5EE3 A;  4GDL B;  3MC0 B;  1T6B X;  5H92 C;  4RH6 A;  1STE A;  3AEE B;  1YJI A;  2MJE A;  3SFD B;  3U7Z A;  4ZYS A;  4NZL B;  1JWB D;  2ZW1 A;  2MH7 A;  3AE2 B;  2AQ3 B;  3VQI A;  4PT5 A;  3BVZ A;  1C77 A;  3P1M A;  5FK9 C;  2WDV B;  4YTP B;  5G5G A;  3W9C B;  1EU3 A;  2IGG A;  1NYQ A;  2SAK A;  3H8H A;  4MT5 A;  3U52 E;  4P6V F;  3KQ4 A;  3ZJT A;  1I4Q A;  1ZPS A;  2ACZ B;  1OFF A;  1UUP A;  1PFD A;  1NYR A;  5BYS A;  2K0P A;  1JCK B;  2J52 A;  2VZK B;  4KGR A;  2DLB A;  1HA5 A;  4R3D A;  1SF0 A;  1ROE A;  3Q8F A;  2PTL A;  3ABV B;  4P16 A;  4KKJ A;  3DWM A;  2WQY B;  3Q8A A;  2MEK A;  3IAS 1;  1FNU A;  1OQR A;  3IXS A;  5HHD G;  4WH4 A;  1HZ6 A;  4AS1 A;  1IUE A;  3EUB 2;  2X38 A;  4KGS A;  2CJN A;  3AED B;  1VZ6 A;  4C56 C;  2PMV A;  3DWG C;  3ZJU A;  1JML A;  4D2K A;  1EWY C;  1P7F A;  1SE4 A;  1D5X C;  4IKG A;  2KN4 A;  2WP9 B;  3MJ5 A;  4TQ1 A;  1UGJ A;  3W5V B;  1SSN A;  1QOG A;  4ZOH C;  1JWU D;  1N62 A;  2RPV A;  4RGO S;  4NAM A;  3TSS A;  1L4D B;  1MHH E;  3BII D;  1NEN B;  3AMZ A;  2FE8 A;  4TSS A;  1YNT E;  4XWT A;  2BYT A;  2QJL A;  5BMI A;  1MPE A;  2JXT A;  3FAH A;  1N63 A;  2DYM A;  1C4A A;  3GB1 A;  2V4I B;  3MP9 A;  1E9M A;  1BUI C;  2J4X A;  4MM3 B;  1FO4 A;  3P4P B;  4OHJ A;  3NVW A;  4TQ0 A;  1AW7 A;  4LLG M;  2WXP A;  1ZXH A;  1N60 A;  2JZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...