2YEPB

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
total genus 76
structure length 212
sequence length 212
chains with identical sequence D, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepB01
3IT4B 1VZ6A 3IT6B 2YEPF 2YEPB 2VZKB 2VZKD 1VZ7A 1VRAB 1VZ8A 2V4IB
chains in the Genus database with same CATH superfamily
1PQSA 1V1PB 4LNNA 5GMVA 4XC2A 3ABVB 3P42A 4OZCA 1DYQA 2NVUI 2WMFA 4NNJB 2PJHA 2FNJB 4S0RA 4PS7A 4M02A 1QT9A 1FIQA 4F8CB 1ZKHA 3L54A 3T9LA 3MJWA 2KN5A 4ZOHC 4RF0A 4AJWA 2GBKA 2K22A 5AZFA 3ZJUA 1WY8A 2L32A 4HRSA 1H8CA 3IT4B 2CS4A 2LZ6A 4ZRIA 1T0SC 2IGHA 1N61A 2EMSA 4YL8A 2INCC 2L76A 2JYEA 1WIAA 4D2KA 5CX3A 2QHOA 4DXAB 3DWGC 5D7GA 3TEYA 4HJGE 2BTEA 1GB4A 1STEA 2LHDA 1F52A 5J2RA 1V1PA 4B95A 1UD7A 3SFEB 2O6VD 4HROA 1ET6A 3DBRI 4LNFA 3V6EB 2KTRA 1FCCC 3PV1A 4M8MA 1YX6B 1L0XB 2KWVB 4WQMA 2KQ7A 2BB5A 3B2FA 4GDLA 5IAAC 3TCAA 1JW9D 4EE2A 3BIID 4JWSC 3Q14C 2K0PA 1DOIA 1N6ZA 4C80A 4NQLB 3KQ4A 1UWXA 4WWNA 5EE9A 4XDDA 4LNIA 3CSFA 4BOSC 5D6JB 4C7YA 5GXGB 3NUHB 2RR9A 4JL9A 4EOYA 4II3B 4IWQA 2CJOA 3N1XC 2MJEA 1P98A 1F77A 3EHVA 3WANA 3TUOA 4ZRQA 3ZJTA 1Z5SB 4DQOC 3AE2B 1HTOA 1AN8A 5DPSA 4BKGA 2JSVX 1E9MA 4ZHPA 3DHHC 2C60A 1E6EB 1ZXIA 3N30A 4A55A 3AM9A 3WAOA 1C1YB 2M17A 3FILA 3DVNU 2LVPA 4GXBA 2AQ3B 4B0EA 1UGMA 1F0ZA 3V3XA 1NVID 1TS3A 3M95A 3OJ3A 4RGOS 3OG5A 5FR6A 2KN4A 1C4AA 2KVZA 2K8CA 4KIKB 2L7RA 4OVUA 3ECIA 5BYQA 1IUEA 2N1WA 4HPMB 1VLBA 2KWCA 3Q8CA 1PFDA 5IA7A 3D32A 4ANWA 2G1EA 4BFRA 1GPXA 2NBVB 3Q2AC 4NAMA 4RM8A 1D5ZC 3VTWA 1V49A 2WDVB 2ZVNA 2WX0A 4GB9A 1PYWD 1SJHD 3KUDB 2JXTA 4PS3A 4RGMA 1WF9A 1V97A 1VR9A 3AULA 1L5PA 2XN9C 3AH7A 4IOIE 3N1ZC 3HRDD 1CQVA 2RPVA 5FR3A 3GZNB 1BUIC 4EUTA 2BB6A 4ZRKA 1C78A 1WYWB 4KX6B 2Q5WD 2WX1A 4GOCA 3AV8A 2DAJA 1YQ4B 2RD0A 3PZ8A 4NJ7A 3P4PB 1MFWA 2DYBA 3GS2A 5HHDG 3ZGZA 3AI5A 2V1YA 4FJVB 4MGKE 1S1QB 2ZCCA 3NVYA 4JGHB 1M94A 2LVOA 4A20A 1E7VA 2CHZA 4EKUA 3JVZX 3L08A 4UDUC 2Z0EB 4KIKA 4W9EA 3DBLB 1SE4A 2KDMA 1J7BA 2OOBB 3GB1A 5IOIA 3L4PA 2OHFA 1JRUA 4L23A 3RPFC 4KGTA 5D2MB 4J6IA 1C79A 2G3QB 1N5WA 1MHHE 2ZEQA 2JXXA 4IWPA 2YVCA 2N9XA 3LJ3A 4D72A 1ZE3D 2XEWA 3RZWC 4WURA 1FRDA 1XLNA 3RYTA 4MGZE 4ASWC 4EZLA 1MHXA 4GDKB 4P7IA 4I6LB 4DHZE 2CHXA 3HM3A 1T3QA 4OW0A 4OZBA 3OLMD 3PHXB 1I4QA 4ANVA 1Q0WB 3BWUD 1WX8A 3J9CA 3PS6A 2B3AA 4GGQA 1D4BA 4J3OD 4US8A 5IN7A 3WAPA 1TZ1A 3A33B 2Z59B 2W55A 1JMLA 2IJ0A 4HWIB 2INPE 5BMGA 4P16A 1L4ZB 2FCMA 2E6XA 2WYQA 1KF6B 1GB1A 1XD3B 3P4QB 3E9SA 2Z0DB 3W2DA 5BO4B 1P1AA 1RFAA 4KKIA 2XK5A 4A3PA 1QF6A 1NYQA 4AWJA 2JF5A 1DOXA 1HE8A 4MACA 4K7SA 2PEAA 2K6QA 3UIPB 1N5XA 4HK2A 1V81A 1Q1OA 3VFKA 1XCTL 3RT3B 3RNEC 4ZYSA 1TY2A 3AU5A 2IGGA 3TJPA 4B9KA 2K39A 2K6DB 2O2VA 4IC7B 3DPDA 4LJPB 3MC9A 1WM3A 3NS1A 3URYA 1P7FA 1WX7A 2DNFA 2XNAC 1ENFA 4RH6A 3QARA 1WSPA 4FULA 2LJIA 1BT0A 4M8NA 3EA6A 3NY5A 2ACZB 1EWYC 1E5WA 1J7AA 1KJTA 2M0XA 2LGSA 2WXOA 4K3CA 3ZKJC 1SB3C 2ASQA 1F9JA 3RFZB 2VZKB 4USAA 4IM3A 3BVGA 4GMVA 3QA8A 2VZKD 1IBXA 1E8WA 1L6VA 4A6QA 1YQ3B 1P0RA 3KYCD 1ESFA 4JLCA 3ZRFA 3IVFA 3AE4B 2ZW1A 1JROA 3HHMA 1QOAA 3ZQ4A 5J18A 2SAKA 1JQ4A 1GUAB 1YIWA 1JWMD 4ACFA 2HTHA 1VZ7A 1WR1A 5KHQA 3APDA 1L0VB 1SE3A 2RDGA 1LM8B 2MCNB 4EEWA 1ZOYB 2R2OA 3AE7B 1CK1A 4RMAA 1T0YA 1F2RI 2BWFA 2MP2A 4JX1C 4PK1A 2PVGC 4KDLB 1TKGA 1TJEA 2NS5A 1OQRA 4BBNF 4GSWA 4N9F4 4A9AA 1V9JA 2R2QA 1FFUA 2G4SA 1WZ3A 2L1AA 2INNE 3SR6A 1FNUA 1GG3A 2MWSB 4HVBA 3SHQA 1UBIA 2C7MB 2L83A 1IGDA 1WXSA 4E3CA 4XWTA 3EGRA 1XEEA 2IPKD 2M8SA 3PZ7A 3ZXVA 4L2YA 5TR5A 3BK1A 1M4VA 2G4DB 3PRZA 4NAWB 4HKQA 2M4NA 1RFKA 1P3QU 3U2SC 1T5XD 3SU8X 4C4VA 2FCSA 2KVRA 4TV3A 2GOWA 3ZUNA 1GOZA 2GBMA 4MELA 1LXDA 4KSLC 1X1MA 5DCNA 2KDFB 3H7SA 4LDTD 1ZPSA 4IW0A 3A9JB 3L0WB 3NJTA 4MH0E 4LLGM 4BZAA 4A90A 1Q5WB 2V3PA 4DXGA 2MBBB 3L16A 3T8MA 3GE3C 1WJ6A 2JPHA 3VRAB 5C2TB 2L3ZA 2R61A 3UQBA 2MHJA 2JX5A 4D6HA 5T8IA 1V5OA 2K3UA 2AX5A 1IYFA 2W3RA 3OJ4B 1XLPA 1R4MI 1FO4A 1U4AA 4URKA 1V86A 4YWGG 3QCAA 1FNWA 4G3XB 1EF5A 2KX3A 3VH4B 2D3GA 2LUMA 4GDLB 3H7PA 4JIOU 3BINA 4KZ0A 2FAZA 2WS3B 1IP9A 1L4DB 2PVOD 2V9HA 4ICVA 3P2BA 3RNAC 5AUKA 1ZXHA 2K1FA 5HKHA 2JZ3B 3QHTA 2HTME 4YSXB 4WJOA 1T0RC 3A9JA 3L13A 4IG7B 2N7DA 2LASA 2HJ1A 1UUPA 1WJ4A 1YQBA 2WNMA 2KNBA 2AWTA 3VUYA 1WI0A 4GU2A 1BMLC 1P9DU 2ZJDA 2I1KA 2RDBC 5KHOA 4I6PA 2IO0B 5IO9A 4HJKA 3NOBA 4YTPB 1MPEA 1WJUA 2YEPB 5FKAC 1N60A 2WXLA 1E90A 2WXIA 3N3KB 4W9DA 2NBUA 1TGZB 2KQ4X 3O13A 5EDSA 2JWUA 3DCGA 3GP7A 2FUG1 3DVGX 3FKYA 3EFCA 4GDKA 4MGIE 2J52A 4G11A 5J17A 1YN3A 3CMMB 2KDBA 2ZVOA 2DZJA 1IPGA 1VJKA 1D6EC 3W5UB 5JXVA 3N1YC 3C0RB 2IYDB 3X0WA 1V6EA 2KXJA 2V4IB 4RGNA 3PRPB 4DDGD 4DXFA 4W9CA 1ZGUB 5IP4D 1KLGD 4P1CC 1LQBA 2N7EA 2BT6A 2Y3AA 2MH7A 4LK0M 1ISNA 3VHTC 4LJOB 5G55A 2A4ZA 3EFUA 4NY0A 4W9IA 2CU1A 2VH1A 1VZ8A 3Q8BA 2IY1B 3HIZA 3N20C 5BMHA 1TTNA 4FXCA 1QQRA 1WXVA 2D3AA 3CIRB 1KTKA 3P1MA 1YJ1A 1ZDXA 3AB5A 2KX0A 3BYTB 4HPPA 5JHBA 3JSVA 2INDC 3JYUA 1QILA 3MJ5A 3ZNZB 3TL5A 1SE2A 3ETRA 2LRWA 3R7QA 2KQSA 1N62A 2G9HD 5D3IB 2DWQA 2J4XA 3KLSX 3NG0A 4CYEA 2PMVA 4WH4A 4HLEA 3ZNHB 3I9V1 2NPTB 5G5GA 4NJCA 1CZPA 4FHJA 1SE9A 3NHEB 3RNFC 2KAJA 2K25A 4MSMB 3P4RB 1A5RA 4WJNA 2MA9B 4M00A 3VUWA 2BQQA 2BYFA 2JU6X 2LJ5A 4YSZB 2MW5A 3AEDB 1D3ZA 1WGRA 1LGRA 4TUUA 4KVGB 4AJYB 2DYMA 5CHFA 3VUXA 4BKSD 4AS1A 3DBHI 1HXYD 2N9PC 1TT5B 4D6EA 2JUOA 3C8YA 3TEXA 3IT6B 3RN9C 4PYUA 1YD8U 1ZP0B 1SGHA 5IKCM 3Q6BA 4A8XC 1FRRA 3OWEB 2BYVE 1SJED 4C56C 1G6JA 1XT9B 3QQ8B 1PGAA 1I42A 2LD9A 3H7PB 2BF8B 3KW5B 3AMZA 2KACA 3U52E 2MX2A 2JZZA 1K8RB 2PTLA 1WWTA 3RNBC 2KTFA 4JPSA 2N9KA 3H8HA 4OVVA 2L52A 2QSDA 2J0MA 3DWMA 3SD5A 2E3TA 1ZDVA 3AEAB 3MP9A 2BKRB 4N59A 3AXCA 2DX5B 3EC8A 2LGIA 2K5PA 5HG2A 4EZJA 2KLCA 2VH2A 4D6GA 1K52A 3U7DA 3KUZA 2O2VB 3ZNGC 2JWZA 2WXFA 3A9KA 3VR9B 4CHKA 2FBWB 4MM3A 2BPSA 2EKIA 3U4EG 3MFGA 4LNKA 4AQ7A 3VDZA 4OHJA 4WWPA 4WAAA 1FMAD 1WRIA 2O6VA 5HFYA 2SEBD 2FUHB 3AE1B 2LVQA 1N63A 2X38A 1WGYA 2GLSA 3LDZE 2IGDA 1HZ5A 2ON8A 1D5MC 2W54A 4LNOA 1R7SA 2LFIA 3ENEA 1KRHA 4XZ4A 3Q8FA 2J0JA 3VTUA 4WWMA 4TMAB 2WMGA 2WMHA 4DBGA 1D5XC 2ZCBA 4DDID 1XO3A 1PDXA 2MSED 3W9CB 3A9KB 1TBEA 2ZPYA 3A4SC 1GAQB 2MRPA 1WH3A 3ALBA 3SFDB 3V60A 3VH3B 3IBEA 5JZEB 3O65B 4G0NB 4YTNB 1OTRB 3ZYYX 3V62A 3MHZA 1RWSA 4RFBA 3L17A 2LI5A 4YSYB 5HI1A 3H1UA 2KWDA 2JRIB 2KK8A 2FE8A 2NR2A 4P1BC 2NBWB 3AEBB 4K7WA 3QC8B 2MBOA 3HVZA 2BYTA 2BVCA 3QX1A 2ZPNA 1WGDA 2B76B 3RULA 1CJEA 2D07B 1VD2A 1HZ6A 3ONSA 3B08A 2BS4B 3HUIA 3IAS1 4IM2A 3TEZA 3CSTA 2NPTA 1PUTA 1AARA 4RNAA 1HTQA 4ZHOA 2BS3B 1QOGA 4CQNA 3BYYB 3LXFA 2KMCA 3R2IA 2GI9A 3UQAA 1UH6A 4BAXA 3BVMA 2QMTA 4KZCA 2WXGA 1RM6C 3K9OB 5AZHA 3QIJA 1TIFA 4HXDA 3IFWB 1RYJA 2HJ8A 4US9A 1T0QC 3P63A 2D3CA 4LDTB 1SBBB 4D6JA 2WDTB 1SSNA 1MI0A 1UGJA 3CF6E 3PVLA 1SIJA 4DHZB 1OEYA 3ZRCA 3A1QB 1J8CA 1QLBB 4ZRPA 1YJJA 5L95C 1R4NB 1BXTA 3Q3OC 3M3JA 4RM9A 3NRZA 4IKGA 3ZLZA 4MT5A 1YNTE 4BOZB 2KD0A 3MTNB 3AE5B 4GLSC 3NVZA 2WXQA 4AOFA 3QAQA 4QAYA 1YN4A 3NVWA 2ZW0A 1NI2A 1FFVA 5LNK1 2PKOA 2GBRA 1XLQA 4KSKC 4I6NB 1KLVA 2N0SB 2KT7A 4D6CA 2PLPA 4PYZA 1MG8A 2LUEA 1OEYJ 3PTFC 2YEPF 1HEZE 1EWCA 2DLBA 4IDIA 5I4DA 5JHAA 2WMIA 1WGGA 1FXIA 5D3DA 4ICUA 4MJSA 4RGTA 4NPNA 1P7EA 1V8CA 2RSUA 3HVDA 3DBSA 1UWMA 4DK5A 3AE8B 3W1SA 2MBEA 3KWLA 4LTUA 5CHWA 1AWDA 4WAFA 1VCBA 1AYFA 1IBXB 2WHIA 2H88B 1SXTA 1C9FA 4ZDVA 2QC8A 1RLFA 1HQRD 1A70A 2EMTA 2KHWB 2KMMA 2LXAA 2IO1B 4BVUC 4NAWA 2TSSA 3V6CB 2OJRA 1UBQA 1GNUA 4M0WB 2LWPA 3T3NA 1C4PA 1V1OA 1I7HA 4FA6A 1TYGB 1FXAA 1KOTA 1JWUD 2PPHA 3ZVVA 3U30A 2JT4B 2NMQA 2L05A 1FNVA 3WALA 4XWWA 2KANA 1TZOA 1KM7A 3RNGC 2AL6A 1EM7A 2L8JA 4C4VB 4DHJB 1PGXA 2W3SA 3APCA 1PGBA 1K51A 2X8XX 3IG3A 3L10B 3A4RA 2CR5A 2RDHA 3GZNI 3ML8A 1V5TA 5C23A 3FAHA 2BYEA 1EU3A 2WU2B 2I2YA 3AEEB 4W9JA 3TSSA 3V61A 2QCZA 2KJRA 3H6NA 5LLIA 3VXWA 4N58A 5EE1A 2XBBC 4W9LA 1Z2MA 3RZFA 2BGFA 5CHVC 3PPAA 1OQQA 3PSEB 2M56B 3BY4B 2C7NB 2JYTA 5E6PA 1KFYB 2DZKA 1C3TA 2MJDA 3DDCB 1R4NI 2MBHA 2ONQA 3AE3B 2KOXA 2REXA 1C76A 3PGEA 2AQ2B 3SDLC 2KDIA 3B9JA 2V0GA 2IO2B 4W9FA 2JY6A 4XYCA 4ZRJA 1AW7A 2QILA 4YT0B 2JRHA 2WXKA 2OJWA 3KH0A 5FK9C 3BK2A 4XE0A 2KTRB 3GOEA 3BVZA 3SEBA 1L6UA 1T6BX 2BWES 2IDYA 2FIFA 5C3JB 3MC8A 1E7PB 2WLBA 3AEGB 3ZDMC 1E8ZA 2I38A 3AU4A 4WQOB 3R7RA 1KH0A 2J42A 3M63B 1V2YA 4MGYE 2BKFA 3K9PB 4KDIC 5JH5C 4F7ZA 4NQKE 3QWZB 1FM0D 4JQWC 3Q3FA 2D2QA 5AEKB 4B0MA 4MDKE 2L00B 1WRDB 3JSVB 2KYWA 1NI3A 2ZZPB 3EUB2 3NVVA 2LXCA 1NEKB 4BBNC 2KC1A 1WXAA 1WYGA 3RMKC 4WJQA 1GJZA 1JCKB 1E7UA 4IM0A 4KKJA 2QJLA 2MBQA 2VRRB 2IY0B 1L2NA 2WDRB 2C7HA 3I57A 2QEJC 3HM6X 2KFKB 1WE6A 1H4RA 1IGCA 4M01A 1ZW7A 2EKEC 4N6EB 3B1LX 1NDDA 5TSSA 4H2AA 3WA0A 1ZUD2 2WMJA 3TBLD 4ZYNA 4C00A 3UIOB 2PW9A 4F1SA 3ZW3A 2KDEB 4L1BA 3LB8C 4KGSA 1YN5A 3Q3NC 3N9YC 4D71A 5DPTA 1TS5A 1WMHA 2WXMA 1Y8RC 4MEMA 2WWZA 3C19A 1WGKA 3P4SB 4ANUA 5G2NA 4II2B 1L0YB 4K1RB 2IZVB 3KVFB 1F2RC 3RD2A 5EE3A 1EO6A 1EUVB 2ZNVC 4P6VF 1RRBA 1QOFA 4A3OA 4KV2A 4WJPA 5E6OA 3KUCB 4FADA 3IXSA 4D6FA 2KFKA 3ZDTA 2FCQA 4ITKA 1VRAB 2Z8LA 3VTVA 3UINB 2CU3A 1FPYA 1J7CA 1WGHA 3DHIC 2LMCA 2NTTA 5BYRA 1ET9A 3PLVA 2M19A 1TS2A 1NBFC 3Q8AA 2BBCA 3RUIB 2JVCA 3PHWB 3ZJVA 3KYDD 3Q8EA 3WAMA 4HDQA 1UELA 1WXMA 1TS4A 3IHPC 2PE9A 3DOWA 3H9DA 4W9KA 4GN1A 4E74A 3R3MA 2DAFA 4B6WA 1NENB 5AZGA 1WFYA 1J0GA 4MSQB 3ZO5B 3T3OA 1XCQL 2XK5B 3CWIA 2H89B 1OGWA 1EF1A 1V80A 1ACCA 1C77A 1ROEA 2KJHB 1E8YA 4XGAB 1FXTB 4Q2JA 2CJNA 2N9LA 1JALA 1VDVA 3N32A 4FLHA 5G5HA 1K53A 1R4MB 1F1HA 5BYSA 2Y5PA 1JRPA 3DVGY 1E8XA 1XXGA 4YXDB 3VQIA 3UGBB 2GBNA 2KLGA 2GB1A 1UNSA 4HEA1 3S2AA 3DBRB 2N1VA 1XLOA 5LXIB 3OAWA 4WIPA 1WE7A 2PIAA 3TMPB 3R66C 2WU5B 4TKNA 1I4PA 1JWAD 1UF0A 4PS8A 4AUQC 2O6VB 1I4GA 1WZ0A 4LCDE 2CHWA 3PREA 4XDCA 1SIFA 2CKHB 4K3BA 4ARIA 4BKTA 1E0ZA 1GC6A 3VAWA 4S17A 3DHGC 3QJZA 1Y56A 2WGSA 2AL3A 1TKEA 1YX5B 1YJIA 4DWFA 4JWUC 4KGRA 2LGXA 3NS8A 1WR6E 2Y5BB 2N9EB 2M1MA 2A5UA 2ZNVB 4C7ZA 4XX5A 3RI7C 4G50A 1MJDA 3AE9B 1J19A 1FEHA 3ZNID 2J53A 4NJ6A 5H8YE 2DZIA 4K7UA 3AEFB 2W82A 2AYOB 1DOYA 4MH8A 3TEWA 4D6DA 2WXNA 4R3DA 3ML9A 2GRIA 2IO3B 1QKZA 5D94A 5DPRA 2V3SA 2LEKA 2WMKA 3GE8C 3LYYA 4RF1A 2L0FA 2MEKA 3DBLI 1L7YA 1I4XA 2KKCA 4FHKA 3APFA 3Q3MC 2I1JA 5L83A 4OZAA 2LGYA 2OEDA 4YTMB 4ARCA 2K8BA 2HDEA 3NZSA 2LHEA 1EU4A 1WM2A 2HD5B 2KFJA 1MVKA 2WXJA 2LRUA 3V05A 1LFDA 2KZRA 4M0WA 1NYRA 2IBIB 1KLUD 2DYOA 1I35A 3RCZA 3I3TB 3W1YA 3ZTDA 4WWOA 2UU7A 2J0KA 3FC4A 4MM3B 3PT2B 3U8ZA 5BMIA 2DBYA 4FN2A 3ZTCA 4TSSA 2GMIC 3VR8B 2UYZB 2D5GA 3UF8A 4NZLB 1TY0A 4TQ0A 4O1NA 3B0AA 2QDFA 4DHJD 3E56A 1FD6A 3DQVA 3WIMA 2YLMA 1HA5A 1LO5D 2N7JA 3MC0B 1JWSD 3NZUA 2PE6B 3PZDA 1RAXA 1WX9A 3M62B 1OQYA 1SEBD 1XQQA 4E71A 4HCNB 1WJNA 1O0SA 1SF0A 3I63C 2EELA 3ZXRA 2V4LA 1B9RA 3W1SC 1UZXB 2ICIA 1DGJA 2V3NA 3Q69A 3DBHB 4PT5A 1YMHE 3VRBB 1I4RA 2KC2A 4OVZA 2MP2B 2RMMA 3I5JC 2K8HA 5E6JA 4JE3B 5H92C 2DZMA 2KMAA 3AE6B 1K50A 2JQRB 2NTSA 2AEHA 3U7ZA 4GIVA 4HDOA 4W9HA 2WXHA 2HE7A 5CTRC 3JW0X 3R2TA 4FJZA 2LGDA 1XF5L 1JWBD 2BS2B 3MHSD 2FIDA 3UI3A 1OFFA 1WMHB 2WDQB 2K9XA 2RPQA 5MPOA 2WMIB 2J7QB 4D6IA 4K81A 1TKYA 2QIEB 4BKSA 3PRMB 3DVNV 2MLBA 4FJYA 3EECA 3R8BA 2NCNA 1LLQA 5DPWA 2AQ1B 2BW2A 1I4HA 5C1ZA 3IAM1 4AP4C 4X57B 3KWVA 4EZKA 1S3SG 1B1ZA 5EE0A 4REZA 1QOBA 2D11A 2MJ3A 3AN1A 1VZ6A 1QZEA 1MG4A 3TIXA 3B2GA 2D10A 4HCPB 3Q3JA 2WP9B 5LXHA 4EFOA 3PO0A 4MJSB 2WXPA 1CMXB 3ZIMA 4TQ1A 3QK0A 3A1QA 2MQJA 1WXQA 3PLUA 4FBJB 4ANXA 2WQYB 1C4CA 2RGFA 1Q10A 1FCLA 2W9NA 2WXRA 5AUIA 2KJ6A 4IUMB 2KO3A 2UWQA 2DENB 2D3BA 1GC7A 2FCNA 2L0TA 2GBJA 2JZPA 3NZ3A 2KWUB 3W5VB 3BZDB 2C5LC 4IWOA 4RCOA 2M0AA 2N4FA 2DHZA 2G45B 4HPLB 3FILB 3WCQA 1YOVB 3AECB 4W9GA 4CO7A 3VVWB 5E6NA 3RNCC 4HKZE 2C9WB 3X23A 3HK0A 2Y5CA 1E10A
chains in the Genus database with same CATH topology
1QOAA 3ZQ4A 1V1PB 1F2RC 1D5MC 2ON8A 5EE3A 2W54A 2SAKA 1R7SA 2LFIA 3ABVB 3P42A 1JQ4A 4OZCA 1KRHA 1DYQA 3Q8FA 1JWMD 4P6VF 4WWMA 1JROA 4TMAB 1QOFA 1D5XC 1XO3A 1PDXA 1VZ7A 3W9CB 1QT9A 1L0VB 1SE3A 1FIQA 1GAQB 2RDGA 1ZOYB 3AE7B 3SFDB 3IXSA 1CK1A 1F2RI 4ITKA 4ZOHC 4JX1C 1VRAB 4RF0A 2Z8LA 2PVGC 1TKGA 1TJEA 4YTNB 3ZYYX 1OQRA 1RWSA 3MHZA 2K22A 4RFBA 3ZJUA 4A9AA 2L32A 2CU3A 4HRSA 4YSYB 5HI1A 1J7CA 1FFUA 2L1AA 2LMCA 2NTTA 1ET9A 3IT4B 5BYRA 2KWDA 2INNE 1TS2A 2M19A 3SR6A 2IGHA 1FNUA 1N61A 2FE8A 3Q8AA 2BBCA 3AEBB 2JYEA 2L83A 3ZJVA 3Q8EA 4D2KA 3HVZA 2BYTA 1IGDA 3DWGC 1TS4A 3EGRA 4XWTA 2B76B 5D7GA 3TEYA 1XEEA 4HJGE 1CJEA 2IPKD 3PZ7A 2BTEA 1GB4A 1HZ6A 4L2YA 1STEA 2LHDA 2BS4B 1NENB 3HUIA 1V1PA 3BK1A 3IAS1 3TEZA 1M4VA 3SFEB 1PUTA 4HROA 1ET6A 4NAWB 4HKQA 3T3OA 1RFKA 1XCQL 3CWIA 4RNAA 2H89B 1FCCC 3U2SC 1ACCA 1T5XD 1C77A 1ROEA 4ZHOA 2BS3B 1QOGA 4CQNA 4WQMA 1L0XB 2BB5A 3BYYB 3LXFA 3B2FA 3R2IA 2GI9A 1JW9D 4EE2A 3BIID 1GOZA 4JWSC 2K0PA 1DOIA 3BVMA 4C80A 2QMTA 4Q2JA 2WXGA 2CJNA 1RM6C 3KQ4A 2N9LA 1UWXA 1JALA 5EE9A 4XDDA 1VDVA 5G5HA 1K53A 1ZPSA 5BYSA 2Y5PA 4C7YA 5GXGB 1JRPA 3NUHB 1RYJA 1XXGA 4YXDB 4US9A 3VQIA 4LLGM 3P63A 2GB1A 4A90A 2CJOA 1SBBB 1UNSA 2V3PA 4DXGA 4HEA1 2MJEA 1F77A 1XLOA 4ZRQA 1SSNA 1MI0A 3TUOA 1UGJA 3ZJTA 1SIJA 4WIPA 4DQOC 3AE2B 1AN8A 3VRAB 5C2TB 1QLBB 4ZRPA 1YJJA 2JSVX 1E9MA 1BXTA 4ZHPA 2R61A 2PIAA 3NRZA 4IKGA 4MT5A 1E6EB 1ZXIA 1YNTE 2WU5B 4A55A 2JX5A 1I4PA 1JWAD 3AM9A 5T8IA 2K3UA 2AX5A 3AE5B 1I4GA 2W3RA 4GLSC 3FILA 3NVZA 1XLPA 1FO4A 2WXQA 4YWGG 2AQ3B 1YN4A 3NVWA 4XDCA 4B0EA 2ZW0A 1FNWA 1FFVA 5LNK1 2PKOA 4ARIA 1E0ZA 1XLQA 1F0ZA 3V3XA 1NVID 1TS3A 1Y56A 4RGOS 2LUMA 4GDLB 1TKEA 1YJIA 2KN4A 4JWUC 4KGRA 2N0SB 1C4AA 2WS3B 2PLPA 4C7ZA 5BYQA 1L4DB 2PVOD 1IUEA 5AUKA 1ZXHA 1VLBA 2HTME 2YEPF 4YSXB 1HEZE 3Q8CA 1EWCA 1PFDA 2DLBA 4IDIA 5I4DA 3AE9B 2G1EA 1FEHA 1FXIA 5D3DA 1GPXA 1UUPA 4RGTA 2J53A 1P7EA 1V8CA 2WNMA 4NAMA 3HVDA 1D5ZC 1UWMA 5H8YE 3AE8B 3W1SA 1BMLC 3AEFB 3KWLA 2W82A 4LTUA 1DOYA 4MH8A 1AWDA 4WAFA 3TEWA 2WDVB 2WXNA 4R3DA 1AYFA 2GRIA 1IBXB 1QKZA 1PYWD 1SJHD 2LEKA 4YTPB 2H88B 1MPEA 1SXTA 2YEPB 5FKAC 1N60A 2JXTA 1C9FA 2WXLA 3LYYA 4RF1A 4RGMA 2WXIA 1HQRD 2MEKA 1V97A 1VR9A 1L5PA 2KQ4X 3O13A 1A70A 1I4XA 2XN9C 3AH7A 2JWUA 2KMMA 3GP7A 4IOIE 2FUG1 3HRDD 1CQVA 4OZAA 2TSSA 2OEDA 4YTMB 2RPVA 5FR3A 1BUIC 4ARCA 2BB6A 2HDEA 1C78A 2J52A 4KX6B 2LHEA 3T3NA 2Q5WD 1YN3A 1C4PA 1EU4A 1V1OA 1I7HA 1TYGB 1FXAA 1MVKA 3AV8A 2WXJA 1JWUD 3V05A 1YQ4B 3PZ8A 1VJKA 1D6EC 2NMQA 3P4PB 1FNVA 3W5UB 3GS2A 4XWWA 4M0WA 5HHDG 5JXVA 3ZGZA 1NYRA 1TZOA 1KLUD 1EM7A 1PGXA 2W3SA 2DYOA 3NVYA 1PGBA 1K51A 2V4IB 4RGNA 2RDHA 4DXFA 3FC4A 3FAHA 4MM3B 4UDUC 1EU3A 5BMIA 2WU2B 2I2YA 3AEEB 3TSSA 2DBYA 1KLGD 4N58A 4TSSA 5EE1A 3VR8B 2D5GA 2BT6A 2Y3AA 4NZLB 2MH7A 1TY0A 4LK0M 1SE4A 4TQ0A 2KDMA 1J7BA 4O1NA 3GB1A 3E56A 1FD6A 3L4PA 2OHFA 1OQQA 2M56B 4L23A 1VZ8A 3Q8BA 3RPFC 4KGTA 1HA5A 1LO5D 5BMHA 2N7JA 3MC0B 1JWSD 4FXCA 2JYTA 1KFYB 1QQRA 1C79A 1N5WA 3CIRB 1KTKA 3P1MA 2MJDA 1SEBD 1MHHE 1ZDXA 3AB5A 2ONQA 3BYTB 1SF0A 3AE3B 2EELA 1B9RA 1C76A 2AQ2B 1QILA 2ICIA 1DGJA 2V3NA 1ZE3D 3MJ5A 3Q69A 4PT5A 1SE2A 1YMHE 4WURA 3ETRA 1FRDA 1XLNA 3B9JA 3VRBB 1I4RA 1N62A 2V0GA 2G9HD 5D3IB 1MHXA 4GDKB 2DWQA 2J4XA 3KLSX 1HZ5A 1AW7A 4OVZA 2PMVA 4WH4A 2QILA 2RMMA 3I9V1 4YT0B 5G5GA 1T3QA 4OW0A 5E6JA 2WXKA 4OZBA 4JE3B 4NJCA 1CZPA 5H92C 1I4QA 5FK9C 3BK2A 4XE0A 3BWUD 3AE6B 3J9CA 2KAJA 1K50A 2JQRB 3BVZA 3P4RB 2NTSA 3SEBA 1L6UA 1T6BX 2IDYA 3U7ZA 1D4BA 4J3OD 4US8A 2JU6X 4YSZB 3AEDB 5C3JB 2WXHA 2W55A 1JMLA 2IJ0A 2INPE 5BMGA 4P16A 1E7PB 1L4ZB 2DYMA 4AS1A 2WLBA 3AEGB 3R2TA 2E6XA 2I38A 1HXYD 1XF5L 1JWBD 2BS2B 3UI3A 1KH0A 1OFFA 1KF6B 1GB1A 2J42A 2WDQB 3C8YA 2K9XA 3TEXA 3IT6B 5MPOA 1TKYA 1ZP0B 2QIEB 1FM0D 3P4QB 3E9SA 3R8BA 3W2DA 4A8XC 4KKIA 1FRRA 4B0MA 2AQ1B 1QF6A 3OWEB 2BW2A 1I4HA 3IAM1 1NYQA 1NI3A 1SJED 3EUB2 4C56C 3NVVA 1PGAA 1NEKB 3KWVA 1DOXA 1WYGA 4MACA 1JCKB 3AMZA 2KACA 3U52E 1B1ZA 5EE0A 4KKJA 4REZA 1N5XA 2PTLA 1QOBA 2QJLA 2MJ3A 3AN1A 1VZ6A 1XCTL 1WWTA 4ZYSA 1TY2A 4JPSA 2WDRB 3I57A 3B2GA 2N9KA 3H8HA 2WP9B 2QEJC 2L52A 2QSDA 2IGGA 3DWMA 3PO0A 2E3TA 1IGCA 1ZDVA 3AEAB 3MP9A 2WXPA 4TQ1A 4N6EB 3NS1A 4N59A 3URYA 1P7FA 5TSSA 4H2AA 1WXQA 2LGIA 1ZUD2 2WQYB 2XNAC 1C4CA 1ENFA 2K5PA 4RH6A 5HG2A 1Q10A 1FCLA 1WSPA 2PW9A 2LJIA 2WXRA 5AUIA 1K52A 3EA6A 4L1BA 2WXFA 3VR9B 2FBWB 3LB8C 2JZPA 2ACZB 3NZ3A 1EWYC 3W5VB 1J7AA 2EKIA 2WXOA 4KGSA 3BZDB 3U4EG 3MFGA 4RCOA 2M0AA 1SB3C 1YN5A 4AQ7A 4OHJA 3N9YC 3RFZB 1FMAD 2VZKB 4USAA 1WRIA 1TS5A 3BVGA 2VZKD 2WXMA 3FILB 5HFYA 3WCQA 1IBXA 3AECB 2SEBD 1L6VA 3AE1B 1WGKA 3P4SB 4A6QA 1YQ3B 4HKZE 1N63A 1ESFA 2X38A 1L0YB 2Y5CA 3AE4B 1E10A 2ZW1A 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IT4 B;  1VZ6 A;  3IT6 B;  2YEP F;  2YEP B;  2VZK B;  2VZK D;  1VZ7 A;  1VRA B;  1VZ8 A;  2V4I B; 
#chains in the Genus database with same CATH topology
 1PQS A;  1V1P B;  4LNN A;  5GMV A;  4XC2 A;  3ABV B;  3P42 A;  4OZC A;  1DYQ A;  2NVU I;  2WMF A;  4NNJ B;  2PJH A;  2FNJ B;  4S0R A;  4PS7 A;  4M02 A;  1QT9 A;  1FIQ A;  4F8C B;  1ZKH A;  3L54 A;  3T9L A;  3MJW A;  2KN5 A;  4ZOH C;  4RF0 A;  4AJW A;  2GBK A;  2K22 A;  5AZF A;  3ZJU A;  1WY8 A;  2L32 A;  4HRS A;  1H8C A;  3IT4 B;  2CS4 A;  2LZ6 A;  4ZRI A;  1T0S C;  2IGH A;  1N61 A;  2EMS A;  4YL8 A;  2INC C;  2L76 A;  2JYE A;  1WIA A;  4D2K A;  5CX3 A;  2QHO A;  4DXA B;  3DWG C;  5D7G A;  3TEY A;  4HJG E;  2BTE A;  1GB4 A;  1STE A;  2LHD A;  1F52 A;  5J2R A;  1V1P A;  4B95 A;  1UD7 A;  3SFE B;  2O6V D;  4HRO A;  1ET6 A;  3DBR I;  4LNF A;  3V6E B;  2KTR A;  1FCC C;  3PV1 A;  4M8M A;  1YX6 B;  1L0X B;  2KWV B;  4WQM A;  2KQ7 A;  2BB5 A;  3B2F A;  4GDL A;  5IAA C;  3TCA A;  1JW9 D;  4EE2 A;  3BII D;  4JWS C;  3Q14 C;  2K0P A;  1DOI A;  1N6Z A;  4C80 A;  4NQL B;  3KQ4 A;  1UWX A;  4WWN A;  5EE9 A;  4XDD A;  4LNI A;  3CSF A;  4BOS C;  5D6J B;  4C7Y A;  5GXG B;  3NUH B;  2RR9 A;  4JL9 A;  4EOY A;  4II3 B;  4IWQ A;  2CJO A;  3N1X C;  2MJE A;  1P98 A;  1F77 A;  3EHV A;  3WAN A;  3TUO A;  4ZRQ A;  3ZJT A;  1Z5S B;  4DQO C;  3AE2 B;  1HTO A;  1AN8 A;  5DPS A;  4BKG A;  2JSV X;  1E9M A;  4ZHP A;  3DHH C;  2C60 A;  1E6E B;  1ZXI A;  3N30 A;  4A55 A;  3AM9 A;  3WAO A;  1C1Y B;  2M17 A;  3FIL A;  3DVN U;  2LVP A;  4GXB A;  2AQ3 B;  4B0E A;  1UGM A;  1F0Z A;  3V3X A;  1NVI D;  1TS3 A;  3M95 A;  3OJ3 A;  4RGO S;  3OG5 A;  5FR6 A;  2KN4 A;  1C4A A;  2KVZ A;  2K8C A;  4KIK B;  2L7R A;  4OVU A;  3ECI A;  5BYQ A;  1IUE A;  2N1W A;  4HPM B;  1VLB A;  2KWC A;  3Q8C A;  1PFD A;  5IA7 A;  3D32 A;  4ANW A;  2G1E A;  4BFR A;  1GPX A;  2NBV B;  3Q2A C;  4NAM A;  4RM8 A;  1D5Z C;  3VTW A;  1V49 A;  2WDV B;  2ZVN A;  2WX0 A;  4GB9 A;  1PYW D;  1SJH D;  3KUD B;  2JXT A;  4PS3 A;  4RGM A;  1WF9 A;  1V97 A;  1VR9 A;  3AUL A;  1L5P A;  2XN9 C;  3AH7 A;  4IOI E;  3N1Z C;  3HRD D;  1CQV A;  2RPV A;  5FR3 A;  3GZN B;  1BUI C;  4EUT A;  2BB6 A;  4ZRK A;  1C78 A;  1WYW B;  4KX6 B;  2Q5W D;  2WX1 A;  4GOC A;  3AV8 A;  2DAJ A;  1YQ4 B;  2RD0 A;  3PZ8 A;  4NJ7 A;  3P4P B;  1MFW A;  2DYB A;  3GS2 A;  5HHD G;  3ZGZ A;  3AI5 A;  2V1Y A;  4FJV B;  4MGK E;  1S1Q B;  2ZCC A;  3NVY A;  4JGH B;  1M94 A;  2LVO A;  4A20 A;  1E7V A;  2CHZ A;  4EKU A;  3JVZ X;  3L08 A;  4UDU C;  2Z0E B;  4KIK A;  4W9E A;  3DBL B;  1SE4 A;  2KDM A;  1J7B A;  2OOB B;  3GB1 A;  5IOI A;  3L4P A;  2OHF A;  1JRU A;  4L23 A;  3RPF C;  4KGT A;  5D2M B;  4J6I A;  1C79 A;  2G3Q B;  1N5W A;  1MHH E;  2ZEQ A;  2JXX A;  4IWP A;  2YVC A;  2N9X A;  3LJ3 A;  4D72 A;  1ZE3 D;  2XEW A;  3RZW C;  4WUR A;  1FRD A;  1XLN A;  3RYT A;  4MGZ E;  4ASW C;  4EZL A;  1MHX A;  4GDK B;  4P7I A;  4I6L B;  4DHZ E;  2CHX A;  3HM3 A;  1T3Q A;  4OW0 A;  4OZB A;  3OLM D;  3PHX B;  1I4Q A;  4ANV A;  1Q0W B;  3BWU D;  1WX8 A;  3J9C A;  3PS6 A;  2B3A A;  4GGQ A;  1D4B A;  4J3O D;  4US8 A;  5IN7 A;  3WAP A;  1TZ1 A;  3A33 B;  2Z59 B;  2W55 A;  1JML A;  2IJ0 A;  4HWI B;  2INP E;  5BMG A;  4P16 A;  1L4Z B;  2FCM A;  2E6X A;  2WYQ A;  1KF6 B;  1GB1 A;  1XD3 B;  3P4Q B;  3E9S A;  2Z0D B;  3W2D A;  5BO4 B;  1P1A A;  1RFA A;  4KKI A;  2XK5 A;  4A3P A;  1QF6 A;  1NYQ A;  4AWJ A;  2JF5 A;  1DOX A;  1HE8 A;  4MAC A;  4K7S A;  2PEA A;  2K6Q A;  3UIP B;  1N5X A;  4HK2 A;  1V81 A;  1Q1O A;  3VFK A;  1XCT L;  3RT3 B;  3RNE C;  4ZYS A;  1TY2 A;  3AU5 A;  2IGG A;  3TJP A;  4B9K A;  2K39 A;  2K6D B;  2O2V A;  4IC7 B;  3DPD A;  4LJP B;  3MC9 A;  1WM3 A;  3NS1 A;  3URY A;  1P7F A;  1WX7 A;  2DNF A;  2XNA C;  1ENF A;  4RH6 A;  3QAR A;  1WSP A;  4FUL A;  2LJI A;  1BT0 A;  4M8N A;  3EA6 A;  3NY5 A;  2ACZ B;  1EWY C;  1E5W A;  1J7A A;  1KJT A;  2M0X A;  2LGS A;  2WXO A;  4K3C A;  3ZKJ C;  1SB3 C;  2ASQ A;  1F9J A;  3RFZ B;  2VZK B;  4USA A;  4IM3 A;  3BVG A;  4GMV A;  3QA8 A;  2VZK D;  1IBX A;  1E8W A;  1L6V A;  4A6Q A;  1YQ3 B;  1P0R A;  3KYC D;  1ESF A;  4JLC A;  3ZRF A;  3IVF A;  3AE4 B;  2ZW1 A;  1JRO A;  3HHM A;  1QOA A;  3ZQ4 A;  5J18 A;  2SAK A;  1JQ4 A;  1GUA B;  1YIW A;  1JWM D;  4ACF A;  2HTH A;  1VZ7 A;  1WR1 A;  5KHQ A;  3APD A;  1L0V B;  1SE3 A;  2RDG A;  1LM8 B;  2MCN B;  4EEW A;  1ZOY B;  2R2O A;  3AE7 B;  1CK1 A;  4RMA A;  1T0Y A;  1F2R I;  2BWF A;  2MP2 A;  4JX1 C;  4PK1 A;  2PVG C;  4KDL B;  1TKG A;  1TJE A;  2NS5 A;  1OQR A;  4BBN F;  4GSW A;  4N9F 4;  4A9A A;  1V9J A;  2R2Q A;  1FFU A;  2G4S A;  1WZ3 A;  2L1A A;  2INN E;  3SR6 A;  1FNU A;  1GG3 A;  2MWS B;  4HVB A;  3SHQ A;  1UBI A;  2C7M B;  2L83 A;  1IGD A;  1WXS A;  4E3C A;  4XWT A;  3EGR A;  1XEE A;  2IPK D;  2M8S A;  3PZ7 A;  3ZXV A;  4L2Y A;  5TR5 A;  3BK1 A;  1M4V A;  2G4D B;  3PRZ A;  4NAW B;  4HKQ A;  2M4N A;  1RFK A;  1P3Q U;  3U2S C;  1T5X D;  3SU8 X;  4C4V A;  2FCS A;  2KVR A;  4TV3 A;  2GOW A;  3ZUN A;  1GOZ A;  2GBM A;  4MEL A;  1LXD A;  4KSL C;  1X1M A;  5DCN A;  2KDF B;  3H7S A;  4LDT D;  1ZPS A;  4IW0 A;  3A9J B;  3L0W B;  3NJT A;  4MH0 E;  4LLG M;  4BZA A;  4A90 A;  1Q5W B;  2V3P A;  4DXG A;  2MBB B;  3L16 A;  3T8M A;  3GE3 C;  1WJ6 A;  2JPH A;  3VRA B;  5C2T B;  2L3Z A;  2R61 A;  3UQB A;  2MHJ A;  2JX5 A;  4D6H A;  5T8I A;  1V5O A;  2K3U A;  2AX5 A;  1IYF A;  2W3R A;  3OJ4 B;  1XLP A;  1R4M I;  1FO4 A;  1U4A A;  4URK A;  1V86 A;  4YWG G;  3QCA A;  1FNW A;  4G3X B;  1EF5 A;  2KX3 A;  3VH4 B;  2D3G A;  2LUM A;  4GDL B;  3H7P A;  4JIO U;  3BIN A;  4KZ0 A;  2FAZ A;  2WS3 B;  1IP9 A;  1L4D B;  2PVO D;  2V9H A;  4ICV A;  3P2B A;  3RNA C;  5AUK A;  1ZXH A;  2K1F A;  5HKH A;  2JZ3 B;  3QHT A;  2HTM E;  4YSX B;  4WJO A;  1T0R C;  3A9J A;  3L13 A;  4IG7 B;  2N7D A;  2LAS A;  2HJ1 A;  1UUP A;  1WJ4 A;  1YQB A;  2WNM A;  2KNB A;  2AWT A;  3VUY A;  1WI0 A;  4GU2 A;  1BML C;  1P9D U;  2ZJD A;  2I1K A;  2RDB C;  5KHO A;  4I6P A;  2IO0 B;  5IO9 A;  4HJK A;  3NOB A;  4YTP B;  1MPE A;  1WJU A;  2YEP B;  5FKA C;  1N60 A;  2WXL A;  1E90 A;  2WXI A;  3N3K B;  4W9D A;  2NBU A;  1TGZ B;  2KQ4 X;  3O13 A;  5EDS A;  2JWU A;  3DCG A;  3GP7 A;  2FUG 1;  3DVG X;  3FKY A;  3EFC A;  4GDK A;  4MGI E;  2J52 A;  4G11 A;  5J17 A;  1YN3 A;  3CMM B;  2KDB A;  2ZVO A;  2DZJ A;  1IPG A;  1VJK A;  1D6E C;  3W5U B;  5JXV A;  3N1Y C;  3C0R B;  2IYD B;  3X0W A;  1V6E A;  2KXJ A;  2V4I B;  4RGN A;  3PRP B;  4DDG D;  4DXF A;  4W9C A;  1ZGU B;  5IP4 D;  1KLG D;  4P1C C;  1LQB A;  2N7E A;  2BT6 A;  2Y3A A;  2MH7 A;  4LK0 M;  1ISN A;  3VHT C;  4LJO B;  5G55 A;  2A4Z A;  3EFU A;  4NY0 A;  4W9I A;  2CU1 A;  2VH1 A;  1VZ8 A;  3Q8B A;  2IY1 B;  3HIZ A;  3N20 C;  5BMH A;  1TTN A;  4FXC A;  1QQR A;  1WXV A;  2D3A A;  3CIR B;  1KTK A;  3P1M A;  1YJ1 A;  1ZDX A;  3AB5 A;  2KX0 A;  3BYT B;  4HPP A;  5JHB A;  3JSV A;  2IND C;  3JYU A;  1QIL A;  3MJ5 A;  3ZNZ B;  3TL5 A;  1SE2 A;  3ETR A;  2LRW A;  3R7Q A;  2KQS A;  1N62 A;  2G9H D;  5D3I B;  2DWQ A;  2J4X A;  3KLS X;  3NG0 A;  4CYE A;  2PMV A;  4WH4 A;  4HLE A;  3ZNH B;  3I9V 1;  2NPT B;  5G5G A;  4NJC A;  1CZP A;  4FHJ A;  1SE9 A;  3NHE B;  3RNF C;  2KAJ A;  2K25 A;  4MSM B;  3P4R B;  1A5R A;  4WJN A;  2MA9 B;  4M00 A;  3VUW A;  2BQQ A;  2BYF A;  2JU6 X;  2LJ5 A;  4YSZ B;  2MW5 A;  3AED B;  1D3Z A;  1WGR A;  1LGR A;  4TUU A;  4KVG B;  4AJY B;  2DYM A;  5CHF A;  3VUX A;  4BKS D;  4AS1 A;  3DBH I;  1HXY D;  2N9P C;  1TT5 B;  4D6E A;  2JUO A;  3C8Y A;  3TEX A;  3IT6 B;  3RN9 C;  4PYU A;  1YD8 U;  1ZP0 B;  1SGH A;  5IKC M;  3Q6B A;  4A8X C;  1FRR A;  3OWE B;  2BYV E;  1SJE D;  4C56 C;  1G6J A;  1XT9 B;  3QQ8 B;  1PGA A;  1I42 A;  2LD9 A;  3H7P B;  2BF8 B;  3KW5 B;  3AMZ A;  2KAC A;  3U52 E;  2MX2 A;  2JZZ A;  1K8R B;  2PTL A;  1WWT A;  3RNB C;  2KTF A;  4JPS A;  2N9K A;  3H8H A;  4OVV A;  2L52 A;  2QSD A;  2J0M A;  3DWM A;  3SD5 A;  2E3T A;  1ZDV A;  3AEA B;  3MP9 A;  2BKR B;  4N59 A;  3AXC A;  2DX5 B;  3EC8 A;  2LGI A;  2K5P A;  5HG2 A;  4EZJ A;  2KLC A;  2VH2 A;  4D6G A;  1K52 A;  3U7D A;  3KUZ A;  2O2V B;  3ZNG C;  2JWZ A;  2WXF A;  3A9K A;  3VR9 B;  4CHK A;  2FBW B;  4MM3 A;  2BPS A;  2EKI A;  3U4E G;  3MFG A;  4LNK A;  4AQ7 A;  3VDZ A;  4OHJ A;  4WWP A;  4WAA A;  1FMA D;  1WRI A;  2O6V A;  5HFY A;  2SEB D;  2FUH B;  3AE1 B;  2LVQ A;  1N63 A;  2X38 A;  1WGY A;  2GLS A;  3LDZ E;  2IGD A;  1HZ5 A;  2ON8 A;  1D5M C;  2W54 A;  4LNO A;  1R7S A;  2LFI A;  3ENE A;  1KRH A;  4XZ4 A;  3Q8F A;  2J0J A;  3VTU A;  4WWM A;  4TMA B;  2WMG A;  2WMH A;  4DBG A;  1D5X C;  2ZCB A;  4DDI D;  1XO3 A;  1PDX A;  2MSE D;  3W9C B;  3A9K B;  1TBE A;  2ZPY A;  3A4S C;  1GAQ B;  2MRP A;  1WH3 A;  3ALB A;  3SFD B;  3V60 A;  3VH3 B;  3IBE A;  5JZE B;  3O65 B;  4G0N B;  4YTN B;  1OTR B;  3ZYY X;  3V62 A;  3MHZ A;  1RWS A;  4RFB A;  3L17 A;  2LI5 A;  4YSY B;  5HI1 A;  3H1U A;  2KWD A;  2JRI B;  2KK8 A;  2FE8 A;  2NR2 A;  4P1B C;  2NBW B;  3AEB B;  4K7W A;  3QC8 B;  2MBO A;  3HVZ A;  2BYT A;  2BVC A;  3QX1 A;  2ZPN A;  1WGD A;  2B76 B;  3RUL A;  1CJE A;  2D07 B;  1VD2 A;  1HZ6 A;  3ONS A;  3B08 A;  2BS4 B;  3HUI A;  3IAS 1;  4IM2 A;  3TEZ A;  3CST A;  2NPT A;  1PUT A;  1AAR A;  4RNA A;  1HTQ A;  4ZHO A;  2BS3 B;  1QOG A;  4CQN A;  3BYY B;  3LXF A;  2KMC A;  3R2I A;  2GI9 A;  3UQA A;  1UH6 A;  4BAX A;  3BVM A;  2QMT A;  4KZC A;  2WXG A;  1RM6 C;  3K9O B;  5AZH A;  3QIJ A;  1TIF A;  4HXD A;  3IFW B;  1RYJ A;  2HJ8 A;  4US9 A;  1T0Q C;  3P63 A;  2D3C A;  4LDT B;  1SBB B;  4D6J A;  2WDT B;  1SSN A;  1MI0 A;  1UGJ A;  3CF6 E;  3PVL A;  1SIJ A;  4DHZ B;  1OEY A;  3ZRC A;  3A1Q B;  1J8C A;  1QLB B;  4ZRP A;  1YJJ A;  5L95 C;  1R4N B;  1BXT A;  3Q3O C;  3M3J A;  4RM9 A;  3NRZ A;  4IKG A;  3ZLZ A;  4MT5 A;  1YNT E;  4BOZ B;  2KD0 A;  3MTN B;  3AE5 B;  4GLS C;  3NVZ A;  2WXQ A;  4AOF A;  3QAQ A;  4QAY A;  1YN4 A;  3NVW A;  2ZW0 A;  1NI2 A;  1FFV A;  5LNK 1;  2PKO A;  2GBR A;  1XLQ A;  4KSK C;  4I6N B;  1KLV A;  2N0S B;  2KT7 A;  4D6C A;  2PLP A;  4PYZ A;  1MG8 A;  2LUE A;  1OEY J;  3PTF C;  2YEP F;  1HEZ E;  1EWC A;  2DLB A;  4IDI A;  5I4D A;  5JHA A;  2WMI A;  1WGG A;  1FXI A;  5D3D A;  4ICU A;  4MJS A;  4RGT A;  4NPN A;  1P7E A;  1V8C A;  2RSU A;  3HVD A;  3DBS A;  1UWM A;  4DK5 A;  3AE8 B;  3W1S A;  2MBE A;  3KWL A;  4LTU A;  5CHW A;  1AWD A;  4WAF A;  1VCB A;  1AYF A;  1IBX B;  2WHI A;  2H88 B;  1SXT A;  1C9F A;  4ZDV A;  2QC8 A;  1RLF A;  1HQR D;  1A70 A;  2EMT A;  2KHW B;  2KMM A;  2LXA A;  2IO1 B;  4BVU C;  4NAW A;  2TSS A;  3V6C B;  2OJR A;  1UBQ A;  1GNU A;  4M0W B;  2LWP A;  3T3N A;  1C4P A;  1V1O A;  1I7H A;  4FA6 A;  1TYG B;  1FXA A;  1KOT A;  1JWU D;  2PPH A;  3ZVV A;  3U30 A;  2JT4 B;  2NMQ A;  2L05 A;  1FNV A;  3WAL A;  4XWW A;  2KAN A;  1TZO A;  1KM7 A;  3RNG C;  2AL6 A;  1EM7 A;  2L8J A;  4C4V B;  4DHJ B;  1PGX A;  2W3S A;  3APC A;  1PGB A;  1K51 A;  2X8X X;  3IG3 A;  3L10 B;  3A4R A;  2CR5 A;  2RDH A;  3GZN I;  3ML8 A;  1V5T A;  5C23 A;  3FAH A;  2BYE A;  1EU3 A;  2WU2 B;  2I2Y A;  3AEE B;  4W9J A;  3TSS A;  3V61 A;  2QCZ A;  2KJR A;  3H6N A;  5LLI A;  3VXW A;  4N58 A;  5EE1 A;  2XBB C;  4W9L A;  1Z2M A;  3RZF A;  2BGF A;  5CHV C;  3PPA A;  1OQQ A;  3PSE B;  2M56 B;  3BY4 B;  2C7N B;  2JYT A;  5E6P A;  1KFY B;  2DZK A;  1C3T A;  2MJD A;  3DDC B;  1R4N I;  2MBH A;  2ONQ A;  3AE3 B;  2KOX A;  2REX A;  1C76 A;  3PGE A;  2AQ2 B;  3SDL C;  2KDI A;  3B9J A;  2V0G A;  2IO2 B;  4W9F A;  2JY6 A;  4XYC A;  4ZRJ A;  1AW7 A;  2QIL A;  4YT0 B;  2JRH A;  2WXK A;  2OJW A;  3KH0 A;  5FK9 C;  3BK2 A;  4XE0 A;  2KTR B;  3GOE A;  3BVZ A;  3SEB A;  1L6U A;  1T6B X;  2BWE S;  2IDY A;  2FIF A;  5C3J B;  3MC8 A;  1E7P B;  2WLB A;  3AEG B;  3ZDM C;  1E8Z A;  2I38 A;  3AU4 A;  4WQO B;  3R7R A;  1KH0 A;  2J42 A;  3M63 B;  1V2Y A;  4MGY E;  2BKF A;  3K9P B;  4KDI C;  5JH5 C;  4F7Z A;  4NQK E;  3QWZ B;  1FM0 D;  4JQW C;  3Q3F A;  2D2Q A;  5AEK B;  4B0M A;  4MDK E;  2L00 B;  1WRD B;  3JSV B;  2KYW A;  1NI3 A;  2ZZP B;  3EUB 2;  3NVV A;  2LXC A;  1NEK B;  4BBN C;  2KC1 A;  1WXA A;  1WYG A;  3RMK C;  4WJQ A;  1GJZ A;  1JCK B;  1E7U A;  4IM0 A;  4KKJ A;  2QJL A;  2MBQ A;  2VRR B;  2IY0 B;  1L2N A;  2WDR B;  2C7H A;  3I57 A;  2QEJ C;  3HM6 X;  2KFK B;  1WE6 A;  1H4R A;  1IGC A;  4M01 A;  1ZW7 A;  2EKE C;  4N6E B;  3B1L X;  1NDD A;  5TSS A;  4H2A A;  3WA0 A;  1ZUD 2;  2WMJ A;  3TBL D;  4ZYN A;  4C00 A;  3UIO B;  2PW9 A;  4F1S A;  3ZW3 A;  2KDE B;  4L1B A;  3LB8 C;  4KGS A;  1YN5 A;  3Q3N C;  3N9Y C;  4D71 A;  5DPT A;  1TS5 A;  1WMH A;  2WXM A;  1Y8R C;  4MEM A;  2WWZ A;  3C19 A;  1WGK A;  3P4S B;  4ANU A;  5G2N A;  4II2 B;  1L0Y B;  4K1R B;  2IZV B;  3KVF B;  1F2R C;  3RD2 A;  5EE3 A;  1EO6 A;  1EUV B;  2ZNV C;  4P6V F;  1RRB A;  1QOF A;  4A3O A;  4KV2 A;  4WJP A;  5E6O A;  3KUC B;  4FAD A;  3IXS A;  4D6F A;  2KFK A;  3ZDT A;  2FCQ A;  4ITK A;  1VRA B;  2Z8L A;  3VTV A;  3UIN B;  2CU3 A;  1FPY A;  1J7C A;  1WGH A;  3DHI C;  2LMC A;  2NTT A;  5BYR A;  1ET9 A;  3PLV A;  2M19 A;  1TS2 A;  1NBF C;  3Q8A A;  2BBC A;  3RUI B;  2JVC A;  3PHW B;  3ZJV A;  3KYD D;  3Q8E A;  3WAM A;  4HDQ A;  1UEL A;  1WXM A;  1TS4 A;  3IHP C;  2PE9 A;  3DOW A;  3H9D A;  4W9K A;  4GN1 A;  4E74 A;  3R3M A;  2DAF A;  4B6W A;  1NEN B;  5AZG A;  1WFY A;  1J0G A;  4MSQ B;  3ZO5 B;  3T3O A;  1XCQ L;  2XK5 B;  3CWI A;  2H89 B;  1OGW A;  1EF1 A;  1V80 A;  1ACC A;  1C77 A;  1ROE A;  2KJH B;  1E8Y A;  4XGA B;  1FXT B;  4Q2J A;  2CJN A;  2N9L A;  1JAL A;  1VDV A;  3N32 A;  4FLH A;  5G5H A;  1K53 A;  1R4M B;  1F1H A;  5BYS A;  2Y5P A;  1JRP A;  3DVG Y;  1E8X A;  1XXG A;  4YXD B;  3VQI A;  3UGB B;  2GBN A;  2KLG A;  2GB1 A;  1UNS A;  4HEA 1;  3S2A A;  3DBR B;  2N1V A;  1XLO A;  5LXI B;  3OAW A;  4WIP A;  1WE7 A;  2PIA A;  3TMP B;  3R66 C;  2WU5 B;  4TKN A;  1I4P A;  1JWA D;  1UF0 A;  4PS8 A;  4AUQ C;  2O6V B;  1I4G A;  1WZ0 A;  4LCD E;  2CHW A;  3PRE A;  4XDC A;  1SIF A;  2CKH B;  4K3B A;  4ARI A;  4BKT A;  1E0Z A;  1GC6 A;  3VAW A;  4S17 A;  3DHG C;  3QJZ A;  1Y56 A;  2WGS A;  2AL3 A;  1TKE A;  1YX5 B;  1YJI A;  4DWF A;  4JWU C;  4KGR A;  2LGX A;  3NS8 A;  1WR6 E;  2Y5B B;  2N9E B;  2M1M A;  2A5U A;  2ZNV B;  4C7Z A;  4XX5 A;  3RI7 C;  4G50 A;  1MJD A;  3AE9 B;  1J19 A;  1FEH A;  3ZNI D;  2J53 A;  4NJ6 A;  5H8Y E;  2DZI A;  4K7U A;  3AEF B;  2W82 A;  2AYO B;  1DOY A;  4MH8 A;  3TEW A;  4D6D A;  2WXN A;  4R3D A;  3ML9 A;  2GRI A;  2IO3 B;  1QKZ A;  5D94 A;  5DPR A;  2V3S A;  2LEK A;  2WMK A;  3GE8 C;  3LYY A;  4RF1 A;  2L0F A;  2MEK A;  3DBL I;  1L7Y A;  1I4X A;  2KKC A;  4FHK A;  3APF A;  3Q3M C;  2I1J A;  5L83 A;  4OZA A;  2LGY A;  2OED A;  4YTM B;  4ARC A;  2K8B A;  2HDE A;  3NZS A;  2LHE A;  1EU4 A;  1WM2 A;  2HD5 B;  2KFJ A;  1MVK A;  2WXJ A;  2LRU A;  3V05 A;  1LFD A;  2KZR A;  4M0W A;  1NYR A;  2IBI B;  1KLU D;  2DYO A;  1I35 A;  3RCZ A;  3I3T B;  3W1Y A;  3ZTD A;  4WWO A;  2UU7 A;  2J0K A;  3FC4 A;  4MM3 B;  3PT2 B;  3U8Z A;  5BMI A;  2DBY A;  4FN2 A;  3ZTC A;  4TSS A;  2GMI C;  3VR8 B;  2UYZ B;  2D5G A;  3UF8 A;  4NZL B;  1TY0 A;  4TQ0 A;  4O1N A;  3B0A A;  2QDF A;  4DHJ D;  3E56 A;  1FD6 A;  3DQV A;  3WIM A;  2YLM A;  1HA5 A;  1LO5 D;  2N7J A;  3MC0 B;  1JWS D;  3NZU A;  2PE6 B;  3PZD A;  1RAX A;  1WX9 A;  3M62 B;  1OQY A;  1SEB D;  1XQQ A;  4E71 A;  4HCN B;  1WJN A;  1O0S A;  1SF0 A;  3I63 C;  2EEL A;  3ZXR A;  2V4L A;  1B9R A;  3W1S C;  1UZX B;  2ICI A;  1DGJ A;  2V3N A;  3Q69 A;  3DBH B;  4PT5 A;  1YMH E;  3VRB B;  1I4R A;  2KC2 A;  4OVZ A;  2MP2 B;  2RMM A;  3I5J C;  2K8H A;  5E6J A;  4JE3 B;  5H92 C;  2DZM A;  2KMA A;  3AE6 B;  1K50 A;  2JQR B;  2NTS A;  2AEH A;  3U7Z A;  4GIV A;  4HDO A;  4W9H A;  2WXH A;  2HE7 A;  5CTR C;  3JW0 X;  3R2T A;  4FJZ A;  2LGD A;  1XF5 L;  1JWB D;  2BS2 B;  3MHS D;  2FID A;  3UI3 A;  1OFF A;  1WMH B;  2WDQ B;  2K9X A;  2RPQ A;  5MPO A;  2WMI B;  2J7Q B;  4D6I A;  4K81 A;  1TKY A;  2QIE B;  4BKS A;  3PRM B;  3DVN V;  2MLB A;  4FJY A;  3EEC A;  3R8B A;  2NCN A;  1LLQ A;  5DPW A;  2AQ1 B;  2BW2 A;  1I4H A;  5C1Z A;  3IAM 1;  4AP4 C;  4X57 B;  3KWV A;  4EZK A;  1S3S G;  1B1Z A;  5EE0 A;  4REZ A;  1QOB A;  2D11 A;  2MJ3 A;  3AN1 A;  1VZ6 A;  1QZE A;  1MG4 A;  3TIX A;  3B2G A;  2D10 A;  4HCP B;  3Q3J A;  2WP9 B;  5LXH A;  4EFO A;  3PO0 A;  4MJS B;  2WXP A;  1CMX B;  3ZIM A;  4TQ1 A;  3QK0 A;  3A1Q A;  2MQJ A;  1WXQ A;  3PLU A;  4FBJ B;  4ANX A;  2WQY B;  1C4C A;  2RGF A;  1Q10 A;  1FCL A;  2W9N A;  2WXR A;  5AUI A;  2KJ6 A;  4IUM B;  2KO3 A;  2UWQ A;  2DEN B;  2D3B A;  1GC7 A;  2FCN A;  2L0T A;  2GBJ A;  2JZP A;  3NZ3 A;  2KWU B;  3W5V B;  3BZD B;  2C5L C;  4IWO A;  4RCO A;  2M0A A;  2N4F A;  2DHZ A;  2G45 B;  4HPL B;  3FIL B;  3WCQ A;  1YOV B;  3AEC B;  4W9G A;  4CO7 A;  3VVW B;  5E6N A;  3RNC C;  4HKZ E;  2C9W B;  3X23 A;  3HK0 A;  2Y5C A;  1E10 A; 
#chains in the Genus database with same CATH homology
 1QOA A;  3ZQ4 A;  1V1P B;  1F2R C;  1D5M C;  2ON8 A;  5EE3 A;  2W54 A;  2SAK A;  1R7S A;  2LFI A;  3ABV B;  3P42 A;  1JQ4 A;  4OZC A;  1KRH A;  1DYQ A;  3Q8F A;  1JWM D;  4P6V F;  4WWM A;  1JRO A;  4TMA B;  1QOF A;  1D5X C;  1XO3 A;  1PDX A;  1VZ7 A;  3W9C B;  1QT9 A;  1L0V B;  1SE3 A;  1FIQ A;  1GAQ B;  2RDG A;  1ZOY B;  3AE7 B;  3SFD B;  3IXS A;  1CK1 A;  1F2R I;  4ITK A;  4ZOH C;  4JX1 C;  1VRA B;  4RF0 A;  2Z8L A;  2PVG C;  1TKG A;  1TJE A;  4YTN B;  3ZYY X;  1OQR A;  1RWS A;  3MHZ A;  2K22 A;  4RFB A;  3ZJU A;  4A9A A;  2L32 A;  2CU3 A;  4HRS A;  4YSY B;  5HI1 A;  1J7C A;  1FFU A;  2L1A A;  2LMC A;  2NTT A;  1ET9 A;  3IT4 B;  5BYR A;  2KWD A;  2INN E;  1TS2 A;  2M19 A;  3SR6 A;  2IGH A;  1FNU A;  1N61 A;  2FE8 A;  3Q8A A;  2BBC A;  3AEB B;  2JYE A;  2L83 A;  3ZJV A;  3Q8E A;  4D2K A;  3HVZ A;  2BYT A;  1IGD A;  3DWG C;  1TS4 A;  3EGR A;  4XWT A;  2B76 B;  5D7G A;  3TEY A;  1XEE A;  4HJG E;  1CJE A;  2IPK D;  3PZ7 A;  2BTE A;  1GB4 A;  1HZ6 A;  4L2Y A;  1STE A;  2LHD A;  2BS4 B;  1NEN B;  3HUI A;  1V1P A;  3BK1 A;  3IAS 1;  3TEZ A;  1M4V A;  3SFE B;  1PUT A;  4HRO A;  1ET6 A;  4NAW B;  4HKQ A;  3T3O A;  1RFK A;  1XCQ L;  3CWI A;  4RNA A;  2H89 B;  1FCC C;  3U2S C;  1ACC A;  1T5X D;  1C77 A;  1ROE A;  4ZHO A;  2BS3 B;  1QOG A;  4CQN A;  4WQM A;  1L0X B;  2BB5 A;  3BYY B;  3LXF A;  3B2F A;  3R2I A;  2GI9 A;  1JW9 D;  4EE2 A;  3BII D;  1GOZ A;  4JWS C;  2K0P A;  1DOI A;  3BVM A;  4C80 A;  2QMT A;  4Q2J A;  2WXG A;  2CJN A;  1RM6 C;  3KQ4 A;  2N9L A;  1UWX A;  1JAL A;  5EE9 A;  4XDD A;  1VDV A;  5G5H A;  1K53 A;  1ZPS A;  5BYS A;  2Y5P A;  4C7Y A;  5GXG B;  1JRP A;  3NUH B;  1RYJ A;  1XXG A;  4YXD B;  4US9 A;  3VQI A;  4LLG M;  3P63 A;  2GB1 A;  4A90 A;  2CJO A;  1SBB B;  1UNS A;  2V3P A;  4DXG A;  4HEA 1;  2MJE A;  1F77 A;  1XLO A;  4ZRQ A;  1SSN A;  1MI0 A;  3TUO A;  1UGJ A;  3ZJT A;  1SIJ A;  4WIP A;  4DQO C;  3AE2 B;  1AN8 A;  3VRA B;  5C2T B;  1QLB B;  4ZRP A;  1YJJ A;  2JSV X;  1E9M A;  1BXT A;  4ZHP A;  2R61 A;  2PIA A;  3NRZ A;  4IKG A;  4MT5 A;  1E6E B;  1ZXI A;  1YNT E;  2WU5 B;  4A55 A;  2JX5 A;  1I4P A;  1JWA D;  3AM9 A;  5T8I A;  2K3U A;  2AX5 A;  3AE5 B;  1I4G A;  2W3R A;  4GLS C;  3FIL A;  3NVZ A;  1XLP A;  1FO4 A;  2WXQ A;  4YWG G;  2AQ3 B;  1YN4 A;  3NVW A;  4XDC A;  4B0E A;  2ZW0 A;  1FNW A;  1FFV A;  5LNK 1;  2PKO A;  4ARI A;  1E0Z A;  1XLQ A;  1F0Z A;  3V3X A;  1NVI D;  1TS3 A;  1Y56 A;  4RGO S;  2LUM A;  4GDL B;  1TKE A;  1YJI A;  2KN4 A;  4JWU C;  4KGR A;  2N0S B;  1C4A A;  2WS3 B;  2PLP A;  4C7Z A;  5BYQ A;  1L4D B;  2PVO D;  1IUE A;  5AUK A;  1ZXH A;  1VLB A;  2HTM E;  2YEP F;  4YSX B;  1HEZ E;  3Q8C A;  1EWC A;  1PFD A;  2DLB A;  4IDI A;  5I4D A;  3AE9 B;  2G1E A;  1FEH A;  1FXI A;  5D3D A;  1GPX A;  1UUP A;  4RGT A;  2J53 A;  1P7E A;  1V8C A;  2WNM A;  4NAM A;  3HVD A;  1D5Z C;  1UWM A;  5H8Y E;  3AE8 B;  3W1S A;  1BML C;  3AEF B;  3KWL A;  2W82 A;  4LTU A;  1DOY A;  4MH8 A;  1AWD A;  4WAF A;  3TEW A;  2WDV B;  2WXN A;  4R3D A;  1AYF A;  2GRI A;  1IBX B;  1QKZ A;  1PYW D;  1SJH D;  2LEK A;  4YTP B;  2H88 B;  1MPE A;  1SXT A;  2YEP B;  5FKA C;  1N60 A;  2JXT A;  1C9F A;  2WXL A;  3LYY A;  4RF1 A;  4RGM A;  2WXI A;  1HQR D;  2MEK A;  1V97 A;  1VR9 A;  1L5P A;  2KQ4 X;  3O13 A;  1A70 A;  1I4X A;  2XN9 C;  3AH7 A;  2JWU A;  2KMM A;  3GP7 A;  4IOI E;  2FUG 1;  3HRD D;  1CQV A;  4OZA A;  2TSS A;  2OED A;  4YTM B;  2RPV A;  5FR3 A;  1BUI C;  4ARC A;  2BB6 A;  2HDE A;  1C78 A;  2J52 A;  4KX6 B;  2LHE A;  3T3N A;  2Q5W D;  1YN3 A;  1C4P A;  1EU4 A;  1V1O A;  1I7H A;  1TYG B;  1FXA A;  1MVK A;  3AV8 A;  2WXJ A;  1JWU D;  3V05 A;  1YQ4 B;  3PZ8 A;  1VJK A;  1D6E C;  2NMQ A;  3P4P B;  1FNV A;  3W5U B;  3GS2 A;  4XWW A;  4M0W A;  5HHD G;  5JXV A;  3ZGZ A;  1NYR A;  1TZO A;  1KLU D;  1EM7 A;  1PGX A;  2W3S A;  2DYO A;  3NVY A;  1PGB A;  1K51 A;  2V4I B;  4RGN A;  2RDH A;  4DXF A;  3FC4 A;  3FAH A;  4MM3 B;  4UDU C;  1EU3 A;  5BMI A;  2WU2 B;  2I2Y A;  3AEE B;  3TSS A;  2DBY A;  1KLG D;  4N58 A;  4TSS A;  5EE1 A;  3VR8 B;  2D5G A;  2BT6 A;  2Y3A A;  4NZL B;  2MH7 A;  1TY0 A;  4LK0 M;  1SE4 A;  4TQ0 A;  2KDM A;  1J7B A;  4O1N A;  3GB1 A;  3E56 A;  1FD6 A;  3L4P A;  2OHF A;  1OQQ A;  2M56 B;  4L23 A;  1VZ8 A;  3Q8B A;  3RPF C;  4KGT A;  1HA5 A;  1LO5 D;  5BMH A;  2N7J A;  3MC0 B;  1JWS D;  4FXC A;  2JYT A;  1KFY B;  1QQR A;  1C79 A;  1N5W A;  3CIR B;  1KTK A;  3P1M A;  2MJD A;  1SEB D;  1MHH E;  1ZDX A;  3AB5 A;  2ONQ A;  3BYT B;  1SF0 A;  3AE3 B;  2EEL A;  1B9R A;  1C76 A;  2AQ2 B;  1QIL A;  2ICI A;  1DGJ A;  2V3N A;  1ZE3 D;  3MJ5 A;  3Q69 A;  4PT5 A;  1SE2 A;  1YMH E;  4WUR A;  3ETR A;  1FRD A;  1XLN A;  3B9J A;  3VRB B;  1I4R A;  1N62 A;  2V0G A;  2G9H D;  5D3I B;  1MHX A;  4GDK B;  2DWQ A;  2J4X A;  3KLS X;  1HZ5 A;  1AW7 A;  4OVZ A;  2PMV A;  4WH4 A;  2QIL A;  2RMM A;  3I9V 1;  4YT0 B;  5G5G A;  1T3Q A;  4OW0 A;  5E6J A;  2WXK A;  4OZB A;  4JE3 B;  4NJC A;  1CZP A;  5H92 C;  1I4Q A;  5FK9 C;  3BK2 A;  4XE0 A;  3BWU D;  3AE6 B;  3J9C A;  2KAJ A;  1K50 A;  2JQR B;  3BVZ A;  3P4R B;  2NTS A;  3SEB A;  1L6U A;  1T6B X;  2IDY A;  3U7Z A;  1D4B A;  4J3O D;  4US8 A;  2JU6 X;  4YSZ B;  3AED B;  5C3J B;  2WXH A;  2W55 A;  1JML A;  2IJ0 A;  2INP E;  5BMG A;  4P16 A;  1E7P B;  1L4Z B;  2DYM A;  4AS1 A;  2WLB A;  3AEG B;  3R2T A;  2E6X A;  2I38 A;  1HXY D;  1XF5 L;  1JWB D;  2BS2 B;  3UI3 A;  1KH0 A;  1OFF A;  1KF6 B;  1GB1 A;  2J42 A;  2WDQ B;  3C8Y A;  2K9X A;  3TEX A;  3IT6 B;  5MPO A;  1TKY A;  1ZP0 B;  2QIE B;  1FM0 D;  3P4Q B;  3E9S A;  3R8B A;  3W2D A;  4A8X C;  4KKI A;  1FRR A;  4B0M A;  2AQ1 B;  1QF6 A;  3OWE B;  2BW2 A;  1I4H A;  3IAM 1;  1NYQ A;  1NI3 A;  1SJE D;  3EUB 2;  4C56 C;  3NVV A;  1PGA A;  1NEK B;  3KWV A;  1DOX A;  1WYG A;  4MAC A;  1JCK B;  3AMZ A;  2KAC A;  3U52 E;  1B1Z A;  5EE0 A;  4KKJ A;  4REZ A;  1N5X A;  2PTL A;  1QOB A;  2QJL A;  2MJ3 A;  3AN1 A;  1VZ6 A;  1XCT L;  1WWT A;  4ZYS A;  1TY2 A;  4JPS A;  2WDR B;  3I57 A;  3B2G A;  2N9K A;  3H8H A;  2WP9 B;  2QEJ C;  2L52 A;  2QSD A;  2IGG A;  3DWM A;  3PO0 A;  2E3T A;  1IGC A;  1ZDV A;  3AEA B;  3MP9 A;  2WXP A;  4TQ1 A;  4N6E B;  3NS1 A;  4N59 A;  3URY A;  1P7F A;  5TSS A;  4H2A A;  1WXQ A;  2LGI A;  1ZUD 2;  2WQY B;  2XNA C;  1C4C A;  1ENF A;  2K5P A;  4RH6 A;  5HG2 A;  1Q10 A;  1FCL A;  1WSP A;  2PW9 A;  2LJI A;  2WXR A;  5AUI A;  1K52 A;  3EA6 A;  4L1B A;  2WXF A;  3VR9 B;  2FBW B;  3LB8 C;  2JZP A;  2ACZ B;  3NZ3 A;  1EWY C;  3W5V B;  1J7A A;  2EKI A;  2WXO A;  4KGS A;  3BZD B;  3U4E G;  3MFG A;  4RCO A;  2M0A A;  1SB3 C;  1YN5 A;  4AQ7 A;  4OHJ A;  3N9Y C;  3RFZ B;  1FMA D;  2VZK B;  4USA A;  1WRI A;  1TS5 A;  3BVG A;  2VZK D;  2WXM A;  3FIL B;  5HFY A;  3WCQ A;  1IBX A;  3AEC B;  2SEB D;  1L6V A;  3AE1 B;  1WGK A;  3P4S B;  4A6Q A;  1YQ3 B;  4HKZ E;  1N63 A;  1ESF A;  2X38 A;  1L0Y B;  2Y5C A;  3AE4 B;  1E10 A;  2ZW1 A;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...