2YEPB

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence D, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepB01
1VZ8A 2VZKD 2YEPF 1VZ6A 1VZ7A 2YEPB 1VRAB 2VZKB 3IT4B 2V4IB 3IT6B
chains in the Genus database with same CATH superfamily
2KMCA 1S3SG 2ZVNA 2CJOA 3V6CB 1JCKB 1H4RA 4W9IA 3AU5A 2LGYA 4JGHB 3ZNGC 1XLQA 3WAPA 1L4ZB 2LGIA 1AYFA 2WXNA 2L00B 1QOGA 3B08A 1R4MB 3ZO5B 5C23A 2XK5A 3HM3A 3GZNB 3VR8B 4D6JA 3QK0A 3AE5B 1V80A 3KUDB 2G1EA 3ZIMA 4WWMA 5IKCM 1JW9D 3ENEA 2O2VB 3PV1A 2RD0A 1DYQA 1SIJA 2JXXA 2M17A 3KW5B 4B6WA 4TSSA 4P1CC 3RD2A 3AEDB 3EA6A 3RUIB 1V49A 1D4BA 3DHGC 5AUKA 4XWWA 2L8JA 2IYDB 3NS1A 3K9OB 1Q5WB 1TY0A 5DPTA 5IN7A 3BZDB 5JHAA 4W9DA 1D5ZC 5HKHA 3Q8FA 2VZKB 5AEKB 2PPHA 3O13A 4NAWA 1WWTA 5E6NA 1UZXB 2NTTA 3AE6B 4EUTA 2JT4B 2KXJA 4DK5A 5HHDG 2PIAA 3BYTB 2MA9B 4G11A 4RGOS 2JPHA 4KVGB 3R2TA 4NZLB 1V1OA 1TTNA 2RDBC 5D6JB 1VZ8A 2CHZA 2V3NA 5HI1A 1HTOA 3PLVA 2AL3A 2GI9A 3WAOA 3FKYA 3PTFC 2WYQA 1C9FA 1WXMA 2CJNA 4IUMB 2K6DB 2D3AA 2JRHA 1JROA 2A5UA 4B9KA 4KGSA 3BVMA 1BUIC 3V6EB 2LUEA 3IAS1 2HD5B 4CO7A 1V6EA 1C77A 3PRPB 2L32A 2TSSA 4RM9A 3RNBC 3UF8A 1GG3A 3TL5A 2KDIA 4BKTA 2R2OA 1NI3A 3BK1A 2AWTA 1KH0A 3N20C 4PS3A 3L16A 1U4AA 4IC7B 2WU5B 1ZDXA 2LGDA 1I4PA 3PLUA 3GOEA 1VRAB 4WWNA 1ZPSA 4RMAA 3ZTDA 3GE3C 3VRBB 3V62A 1C4AA 3SEBA 2H88B 4DDID 2WDTB 1YOVB 3OWEB 2JWUA 3KYDD 2AL6A 3PREA 5DPRA 4JPSA 5TSSA 5CHFA 3MJ5A 2HDEA 2AYOB 4A90A 2ICIA 3QARA 1FXIA 3A1QA 2B76B 1DOIA 1C3TA 1MHXA 2C7NB 3D32A 3GB1A 4AJYB 3DBSA 2CU3A 3RZFA 1TS3A 1WYGA 3AULA 4ZRPA 2KKCA 2NR2A 4GDKB 2QIEB 2V3SA 2CU1A 1GC6A 4E74A 1P7EA 2K8BA 4BOSC 3AECB 2RSUA 1V97A 4RH6A 1C76A 3Q8EA 2M0AA 3ML9A 4KX6B 1GOZA 2SEBD 3EFUA 4XX5A 2KWUB 2K3UA 3ZLZA 2KX0A 2FAZA 1CQVA 3N9YC 3C19A 1EO6A 1J7BA 2QILA 2NBUA 3QC8B 3DOWA 2HTME 2LRUA 1GAQB 3H1UA 2MX2A 4MSMB 2OEDA 2L7RA 2MQJA 2N9KA 3N3KB 4XGAB 4LTUA 1AWDA 4P16A 1JWMD 4W9JA 4YSYB 1QLBB 4IW0A 1LFDA 2WXGA 3QQ8B 1ZXHA 1HQRD 3V60A 4P1BC 2WMHA 4M02A 1FCCC 2RMMA 3VFKA 4JX1C 4BBNF 4L1BA 3AB5A 3Q3OC 1QT9A 2MBBB 2WXRA 3ECIA 2D3CA 3ZDTA 2J7QB 5BO4B 3W1SA 1SGHA 4MH8A 3U30A 1E8WA 5C1ZA 1FXTB 3MC9A 4GGQA 2ZVOA 4ANVA 1E8ZA 4WJNA 4PYUA 3AEBB 3Q3FA 1KLUD 2WMJA 2WX1A 3DQVA 4K7UA 2W3RA 4A3PA 4GIVA 3J9CA 3HM6X 3TBLD 1M94A 1WX7A 2IGGA 2K5PA 3VR9B 1T0QC 2KT7A 2WXPA 2ZW0A 1L0XB 2BTEA 2AQ2B 1C1YB 4ICUA 1HXYD 1OQYA 2VZKD 1XCTL 3AMZA 4HPMB 2GLSA 3LXFA 4LLGM 1WF9A 1V81A 1F1HA 2ZPYA 3BVZA 2PW9A 3VH3B 4CQNA 1NEKB 2K39A 4EEWA 4BKSD 4DHZB 4P7IA 3DDCB 1BMLC 2D3GA 4I6NB 5FK9C 5FR6A 2J4XA 3WAMA 1SJHD 2KDFB 2WDVB 5J18A 3NY5A 1YX6B 4JE3B 1AW7A 3U8ZA 4II2B 1QOAA 2OJRA 2MSED 3NG0A 4YWGG 3AEAB 4L2YA 3H9DA 3CMMB 1VLBA 2MRPA 4RCOA 2PVGC 4D6EA 2KJRA 1FNWA 1C4PA 1OEYJ 1E0ZA 3Q8BA 2J0JA 3I57A 4WJPA 3SR6A 1TIFA 1T6BX 2PJHA 5D3IB 4D6DA 2BS2B 4DWFA 1X1MA 3ML8A 4W9LA 1ZXIA 2O2VA 4EFOA 2AX5A 3ZRFA 4IWPA 3PRMB 3EHVA 2BS4B 1UD7A 2LVOA 4A8XC 4ZHOA 2NMQA 2KFJA 1WGDA 4GXBA 1D5MC 1N6ZA 3BWUD 3BVGA 4DXFA 3M63B 2WNMA 1ENFA 2MW5A 1PYWD 2IDYA 5BYSA 1T0RC 3X0WA 2V3PA 3DBLB 1WE6A 5AZGA 1GJZA 4X57B 4CYEA 1K52A 4TKNA 3LYYA 2N7EA 1NDDA 4XC2A 3IXSA 4BKSA 3UIPB 2FBWB 1J0GA 1QILA 3ZJUA 4ARIA 5D2MB 2MCNB 4GLSC 4A9AA 3KUCB 2IY1B 3QJZA 3EUB2 1KFYB 3RI7C 3BK2A 2LGXA 1IGDA 2D11A 1UELA 3VTUA 1OGWA 2I38A 2G4DB 2INNE 2KHWB 1WH3A 3HK0A 1YQBA 2MJ3A 2L76A 4XYCA 2LD9A 2OOBB 4G50A 2DX5B 4AS1A 3M62B 2HJ8A 2WHIA 2XBBC 3L4PA 3U4EG 2UU7A 3PVLA 4WAAA 4PYZA 1STEA 1MPEA 4KGRA 2ASQA 3P42A 3AE2B 2WMIA 1I35A 4LNKA 1UUPA 2DZJA 4EZJA 2PTLA 3H8HA 1UH6A 1C4CA 1MG4A 4ASWC 2KQ4X 1TBEA 2WMKA 4IM2A 1FFVA 4K7WA 4HKZE 4F8CB 3B2FA 2FNJB 1R4NB 3W2DA 5BMIA 1FRRA 1E7PB 1QKZA 2PMVA 2K8CA 1OFFA 1GB4A 1WJ6A 2V1YA 4RF0A 1OTRB 1J7AA 5FKAC 1F0ZA 4WWOA 2D07B 3K9PB 3DWMA 5G55A 3A9KB 2C60A 2ZCBA 3HUIA 1E5WA 1HZ6A 2XEWA 2DHZA 1SE9A 2KTRA 4HWIB 2W55A 2KTFA 1I4HA 4WIPA 1F2RC 4JWSC 3RNGC 1CZPA 1K53A 3V61A 3Q6BA 4K81A 3CSTA 3QWZB 2WWZA 2WXOA 1D5XC 1HE8A 1QOBA 4S0RA 2YEPF 2G9HD 4NNJB 1YJIA 1ZUD2 2N9LA 4AP4C 2IO3B 1R7SA 2JZZA 2W9NA 4BKGA 4JQWC 1WIAA 3DBHI 1TJEA 2UYZB 1PQSA 2KN4A 4A55A 3ABVB 1SF0A 2QSDA 2O6VB 3L10B 2I1KA 1V5OA 3AI5A 5DPSA 4TQ1A 5AZHA 2XNAC 4MGIE 1SXTA 3ETRA 4FJVB 2YVCA 2KD0A 1YX5B 2FUG1 4KKIA 3OJ3A 1L0VB 3WANA 3JYUA 1YQ3B 2HE7A 1LLQA 4XDCA 4YSXB 2VH2A 2K22A 4FN2A 5I4DA 1ROEA 4LNNA 4TMAB 2WXIA 3OG5A 1KJTA 3GE8C 2DBYA 1JWBD 1SSNA 3OAWA 1CMXB 2BWFA 4KIKB 2WXMA 1Q10A 1L4DB 1SEBD 3AU4A 2N9XA 2YEPB 2L05A 4HCPB 5D7GA 2H89B 3B0AA 3UI3A 3AH7A 1E90A 1AARA 4DHJB 2WMGA 2KX3A 3E56A 1FM0D 4DXAB 5DPWA 4TV3A 5EE3A 3APFA 1VJKA 3Q69A 2EKEC 5E6JA 4WH4A 1Q0WB 3L0WB 4NPNA 1LM8B 2FCNA 2PLPA 1ISNA 3EFCA 2LHEA 1GC7A 5T8IA 4P6VF 2WXLA 1JWSD 2CHXA 2G3QB 3NVWA 1QOFA 2INCC 1JWAD 3MHSD 5EE9A 4ANUA 3R7RA 3V05A 1SB3C 5G5GA 2W54A 4B0MA 2KQ7A 2VH1A 1TT5B 4RNAA 5TR5A 3WIMA 1IYFA 3R7QA 4OZCA 2REXA 2IBIB 1KTKA 2JYEA 1F2RI 3KQ4A 3Q3NC 2NTSA 2QDFA 4J3OD 2QMTA 1WR6E 4BVUC 1KM7A 2DAJA 2PKOA 2WMIB 5KHQA 1JRUA 4AJWA 2JWZA 2IO1B 3DBRI 3RNEC 1JQ4A 3IHPC 4YL8A 3P1MA 2DYMA 1WE7A 3LDZE 1BXTA 1J8CA 1P9DU 1E7UA 2DWQA 3KWLA 1UGMA 1FIQA 4GDLA 1XCQL 2KOXA 2GOWA 3UQAA 2KJHB 3C0RB 3ZYYX 1WM3A 1MVKA 1N5WA 1VZ7A 4JLCA 4WQOB 1NBFC 1TYGB 2BYVE 4UDUC 4TUUA 1VDVA 3W5UB 2LEKA 4ZRKA 2LGSA 2KTRB 4HROA 3KVFB 2ZNVB 3IG3A 3RZWC 3P63A 4E71A 1A70A 1XLOA 1WYWB 3VXWA 2JF5A 2C7MB 1OQRA 1L6UA 1P0RA 1M4VA 1DOXA 3NVVA 2KLCA 3VRAB 5C2TB 3S2AA 1WGRA 5L83A 2EELA 1GB1A 1L0YB 2RPVA 4IWQA 2CR5A 4OVVA 1C78A 2WP9B 1L5PA 3CSFA 2LXAA 2PEAA 3TEZA 1HEZE 4MDKE 1FNVA 1IP9A 3RT3B 2J0MA 4OW0A 3A4SC 4PS8A 1T3QA 1E9MA 1WMHB 1XF5L 2JZPA 2KJ6A 3CF6E 1I7HA 4IM0A 2MH7A 2V4IB 3ZUNA 2Y5BB 3ZXVA 2OHFA 2QCZA 1WJ4A 3B1LX 3B9JA 4KV2A 3DBHB 1TZOA 3P4RB 3VAWA 3RFZB 2O6VD 3HRDD 1L7YA 3VUWA 2BPSA 2KC1A 1QQRA 1GUAB 4ZDVA 1HA5A 2JU6X 2KMAA 4PS7A 2EMTA 1WFYA 3AV8A 1YQ4B 1ET9A 1RLFA 3EECA 1O0SA 3TMPB 1BT0A 3T3NA 3KWVA 3W1YA 1RAXA 1NVID 3WALA 4EZLA 3AXCA 5CX3A 4EOYA 1PDXA 3SD5A 1FFUA 4FJZA 3Q14C 4KKJA 4PK1A 2BT6A 1G6JA 3U7ZA 1JALA 4ANXA 4LNFA 3T9LA 3A9KA 3LB8C 2LJ5A 4TQ0A 1AN8A 2BB5A 1E7VA 3Q8AA 3VQIA 4LDTB 4YTNB 1RFAA 3ONSA 4DHJD 1V2YA 3JW0X 3AEGB 1L2NA 3TEWA 4JIOU 2IO0B 3IVFA 4YTMB 3SU8X 4K3CA 1IBXA 1RYJA 4YTPB 1FEHA 2I1JA 4NY0A 4XE0A 2AQ1B 4D6HA 1UGJA 2MBOA 4HJGE 1WY8A 1FCLA 2WX0A 4D6CA 1C79A 3SDLC 1P1AA 3LJ3A 5GMVA 1R4MI 2O6VA 1K51A 2N7JA 1UWMA 4PT5A 1Y56A 3GZNI 5LLIA 4OVZA 4W9CA 3VTWA 1PUTA 3DHIC 1XLPA 4L23A 2GMIC 3M3JA 1KLGD 3OJ4B 5MPOA 2GBKA 2IGDA 1D3ZA 2DZKA 4XDDA 5G5HA 4BZAA 1TS5A 2K1FA 4USAA 4KSKC 2MLBA 2ZW1A 3MFGA 2GRIA 3TSSA 4GDLB 2INDC 2C7HA 3UQBA 2AQ3B 3KUZA 2EMSA 2D2QA 3ZTCA 2MBQA 1FMAD 3DBRB 1FNUA 1OQQA 4KIKA 2QJLA 3NJTA 3VVWB 3AE4B 4MM3B 2D5GA 1DGJA 3W5VB 3MC0B 1TY2A 4EZKA 4MSQB 3TEXA 1WR1A 4FXCA 2M8SA 4FHJA 2FCMA 5BMGA 4KGTA 1XLNA 5C3JB 3H7SA 4DQOC 3AE8B 2N4FA 2WDQB 4GU2A 3N1XC 1WRDB 3BY4B 2BS3B 3NOBA 3A4RA 4JWUC 4M01A 4D6IA 3PSEB 4NAMA 2KMMA 2WXFA 2CKHB 4WAFA 3T8MA 5H8YE 3NZ3A 1LGRA 2B3AA 2J0KA 5EDSA 3Q8CA 2QHOA 4M8NA 1WXSA 4H2AA 5JHBA 1ZP0B 2FIDA 4N9F4 1TKGA 2W3SA 4ZYNA 3UINB 1E6EB 2K8HA 2GBMA 1JWUD 2ON8A 4IKGA 5DCNA 4WURA 4IM3A 2PVOD 2MJEA 4I6PA 2KQSA 1LO5D 5HFYA 2KFKB 1EUVB 2ZJDA 4RM8A 3Q3JA 4YSZB 3APCA 3OLMD 1WZ0A 4D72A 1SIFA 2MHJA 3I3TB 2XN9C 2DZMA 2Z8LA 2RDHA 2R61A 2V0GA 3VUYA 3BIID 4HKQA 2LHDA 4BBNC 4DBGA 3HVZA 1YN3A 2E6XA 3U52E 1NYQA 4RFBA 2V9HA 3AE3B 2MP2B 3IBEA 1GPXA 2IJ0A 2SAKA 1UBIA 4LK0M 4HVBA 1QF6A 4K1RB 2WU2B 3PO0A 4M8MA 1KOTA 4ZRIA 1V9JA 2LJIA 2WDRB 4MELA 4WQMA 4ACFA 3PRZA 3T3OA 1LXDA 1GNUA 4EKUA 2HTHA 4HPLB 2LWPA 5J2RA 5GXGB 4K7SA 1MG8A 1IBXB 3V3XA 5IP4D 4LJPB 3QIJA 3DHHC 2N1VA 2KN5A 4HDQA 4LJOB 1F77A 4LDTD 5L95C 2LZ6A 1XQQA 1N63A 4URKA 3ZRCA 2VRRB 1XT9B 1Q1OA 5E6PA 2W82A 5D3DA 3RNFC 1PGBA 3HIZA 1YD8U 1EU4A 1FPYA 3X23A 2J53A 1FO4A 1XO3A 2K6QA 4MGZE 4HLEA 2MBEA 2JQRB 3IAM1 1SJED 1SBBB 1UNSA 3PGEA 1UBQA 4RGTA 3I9V1 4D2KA 1PFDA 1WMHA 3C8YA 4ICVA 5AZFA 2WXHA 2NCNA 3NUHB 4KZCA 4MH0E 4LNIA 3RCZA 2FE8A 5G2NA 3PHWB 4HCNB 4WWPA 1J7CA 3QX1A 4REZA 4DXGA 4HK2A 3H7PB 4FLHA 2AEHA 5E6OA 5BYRA 2Z0DB 4B0EA 1SE2A 2G45B 3EC8A 4M00A 1KRHA 2KLGA 1L6VA 4MEMA 1UF0A 2JYTA 1IPGA 2K25A 3MHZA 3ZXRA 3P4PB 2KANA 2Z59B 4HDOA 1T5XD 1ZDVA 3DVGY 2IPKD 3NHEB 5J17A 3TUOA 1HTQA 4B95A 1S1QB 4FULA 1WSPA 2BKRB 4HXDA 3TEYA 2DYOA 4ITKA 4LNOA 2LVPA 3AE9B 3FC4A 2KDEB 5IOIA 1E10A 3AN1A 1PGAA 2BYEA 3BINA 1YIWA 1LQBA 2UWQA 3FILA 1RM6C 2JXTA 2ONQA 3A9JB 3GS2A 5CHWA 3I5JC 4M0WA 2DENB 2BYFA 1E8XA 1WRIA 2WLBA 2MBHA 4C4VA 2Z0EB 1NI2A 4MGKE 2NPTB 3N1ZC 4C00A 1D6EC 2CHWA 2BBCA 1XD3B 2FCQA 2BYTA 4FADA 5JH5C 3ZVVA 1ZKHA 2KWDA 3L13A 1WX9A 5JXVA 2JRIB 3W1SC 1E8YA 2R2QA 1YN5A 2BB6A 3H6NA 2INPE 3QA8A 4GMVA 5EE1A 2JSVX 2LI5A 2KAJA 4IDIA 3PT2B 3APDA 4W9FA 3RNCC 2JY6A 4ZHPA 1V1PB 3JSVA 3VH4B 4ZOHC 1WJNA 3CIRB 4I6LB 1ACCA 4OZBA 3UGBB 2GB1A 1TS2A 2BVCA 1ZOYB 4HEA1 1N60A 2HJ1A 1FXAA 1WGGA 2L0TA 3RULA 4A3OA 4OHJA 1TKYA 3HHMA 3QAQA 3NVYA 3ZNHB 1CK1A 2L0FA 4WJQA 2LXCA 2GBJA 4XZ4A 2KC2A 3CWIA 1TZ1A 3Q2AC 4GSWA 2IGHA 1SE4A 2KVRA 3RNAC 5H92C 2DAFA 1PGXA 1OEYA 4C80A 1QZEA 3RMKC 4D6FA 4A20A 1EWCA 4ARCA 3SFEB 3DBLI 4WJOA 2Q5WD 4N58A 3PHXB 4MM3A 2RGFA 1ZGUB 5CTRC 4KDIC 4YXDB 2DYBA 3ZNID 3KH0A 4KDLB 4MJSA 1WGHA 2LFIA 1T0SC 3Q3MC 1MHHE 4E3CA 2X8XX 1WX8A 1RRBA 3PZ8A 2YLMA 4BOZB 2EKIA 1H8CA 3N32A 4Q2JA 4FA6A 1YJJA 1WZ3A 2J52A 2WQYB 1FD6A 1NYRA 3NS8A 2FUHB 2LUMA 4AQ7A 3TIXA 4QAYA 5JZEB 2BQQA 2L3ZA 2X38A 1JRPA 1XXGA 5LXIB 3AE1B 2MEKA 2L1AA 1I4XA 3NZUA 1F9JA 1P98A 4OZAA 2QEJC 4RGMA 2G4SA 3ZNZB 4W9HA 3KYCD 2KO3A 3ALBA 2JX5A 3MTNB 1IUEA 2A4ZA 3DWGC 3AEEB 2RPQA 2XK5B 3RN9C 2E3TA 2WMFA 2JVCA 2WXJA 2N0SB 2KFKA 4FHKA 4D6GA 4W9EA 1ESFA 4AUQC 1WXVA 2FIFA 2IY0B 1R4NI 3L08A 1N5XA 3ZJTA 3N30A 2N9PC 4C56C 1WI0A 2ZEQA 3U2SC 3L54A 3RPFC 2ZPNA 4GN1A 2CS4A 3DVNV 3B2GA 4FJYA 2D10A 4F7ZA 3PZDA 3E9SA 2IZVB 4G3XB 3L17A 3U7DA 4ZRQA 4ZYSA 2MP2A 1HZ5A 4AWJA 3FILB 3P4SB 4IG7B 4M0WB 1DOYA 4NAWB 2GBNA 3MP9A 1MFWA 2RDGA 5AUIA 4C4VB 4C7YA 4S17A 2BWES 5KHOA 4A6QA 3VTVA 2I2YA 2NVUI 2M4NA 1UWXA 1I4GA 4BAXA 1WJUA 4DDGD 5IA7A 2BW2A 1KF6B 3QCAA 4D71A 2PE9A 3VUXA 1VR9A 4N59A 2Y5PA 2DNFA 2N1WA 2ZCCA 3PZ7A 2DZIA 3ZW3A 3TJPA 4RGNA 1IGCA 3JSVB 1N61A 4XWTA 4AOFA 4R3DA 5IO9A 1B1ZA 2LASA 2Y5CA 3BYYB 4RF1A 3IFWB 1YN4A 2JUOA 2MWSB 3NZSA 1K8RB 3ZDMC 2MJDA 4G0NB 2KDMA 4IOIE 3VHTC 2C5LC 2KWCA 3I63C 3GP7A 1MJDA 2WGSA 2N7DA 4OVUA 1VZ6A 3IT6B 1A5RA 3H7PA 2WS3B 2L52A 1RWSA 2ZNVC 2WXKA 2ACZB 3HVDA 1J19A 3VDZA 3R66C 2LVQA 3P4QB 5IAAC 3AEFB 1I42A 2K0PA 3JVZX 2LMCA 2KNBA 1JMLA 4EE2A 2M19A 4O1NA 3R3MA 5BMHA 4BFRA 1ZW7A 4MJSB 4FBJB 3R2IA 3PS6A 4ZRJA 4MT5A 1YJ1A 1V8CA 3AE7B 3A1QB 4MGYE 2OJWA 4JL9A 1EM7A 2BGFA 3EGRA 1I4RA 2J42A 4HRSA 3A9JA 4CHKA 2LRWA 4K3BA 1KLVA 4W9KA 2L83A 1VCBA 2KDBA 3M95A 3IT4B 4II3B 2NPTA 5CHVC 1EF5A 1RFKA 3AM9A 4HPPA 3WA0A 3UIOB 2K9XA 3MJWA 4LCDE 2KYWA 1TGZB 3O65B 1YMHE 4GOCA 3DVGX 3ZGZA 3TCAA 1Z5SB 2M1MA 4ANWA 1XEEA 2DLBA 3ZQ4A 2KK8A 2KWVB 1ZE3D 2D3BA 1V1PA 3MC8A 3NVZA 5LNK1 3ZJVA 1EWYC 3DCGA 3SFDB 1Z2MA 2WXQA 2NBVB 3FAHA 3A33B 1TS4A 4C7ZA 4NQKE 1T0YA 3N1YC 3NRZA 3ZKJC 4NQLB 1I4QA 3URYA 2KZRA 1WGYA 5LXHA 3DVNU 3KLSX 2C9WB 4NJCA 4F1SA 3SHQA 3QHTA 1VD2A 1P7FA 2FCSA 4GB9A 2KACA 1P3QU 1EU3A 2GBRA 1FRDA 4US8A 1NENB 3R8BA 4YT0B 1WXQA 1TKEA 2PE6B 4DHZE 2JZ3B 2M0XA 1Y8RC 2QC8A 4KZ0A 5FR3A 2RR9A 5D94A 3W9CB 1CJEA 1YNTE 4W9GA 5BYQA 5EE0A 4J6IA 1WXAA 1K50A 1SE3A 2IO2B 4NJ7A 4HJKA 3P2BA 2KVZA 2V4LA 4MACA 1MI0A 2M56B 2BKFA 3PPAA 4IWOA 1WGKA 3RYTA 4GDKA 1ET6A 5HG2A 2ZZPB 3WCQA 1EF1A 2Y3AA 4N6EB 2BF8B 2NBWB 2N9EB 4US9A 3DPDA 1V5TA 2NS5A 1V86A 1F52A 1N62A 1WM2A 4NJ6A 1B9RA 4KSLC
chains in the Genus database with same CATH topology
2FBWB 1FFUA 1QILA 1TKYA 3ZJUA 2CJOA 1JCKB 4ARIA 4KKJA 3NVYA 1CK1A 2BT6A 4GLSC 3U7ZA 1XLQA 1L4ZB 1JALA 4A9AA 2LGIA 1AYFA 2WXNA 3EUB2 1KFYB 3CWIA 3LB8C 4TQ0A 1AN8A 2BB5A 3BK2A 3Q8AA 1QOGA 3VQIA 1IGDA 2IGHA 1SE4A 5H92C 4YTNB 1PGXA 4C80A 2I38A 3VR8B 1EWCA 4ARCA 2INNE 3SFEB 2Q5WD 3AEGB 4N58A 3AE5B 3TEWA 2G1EA 2MJ3A 4WWMA 1JW9D 4YXDB 4YTMB 1IBXA 1RYJA 4YTPB 4AS1A 1FEHA 2LFIA 1DYQA 3L4PA 3U4EG 1MHHE 1SIJA 4TSSA 4XE0A 2AQ1B 1STEA 1MPEA 4KGRA 3AEDB 3EA6A 1D4BA 1UGJA 3P42A 4HJGE 1FCLA 3AE2B 5AUKA 4XWWA 1UUPA 2PTLA 3H8HA 3PZ8A 1C79A 1C4CA 3NS1A 2EKIA 1TY0A 4Q2JA 1YJJA 3BZDB 1D5ZC 1K51A 2N7JA 2KQ4X 2J52A 1UWMA 3Q8FA 2WQYB 1FD6A 1NYRA 2VZKB 1Y56A 4PT5A 4OVZA 1FFVA 1PUTA 2LUMA 1XLPA 4L23A 4AQ7A 3O13A 4HKZE 1WWTA 3B2FA 2NTTA 3AE6B 3W2DA 5BMIA 1FRRA 1E7PB 1KLGD 1QKZA 5MPOA 2PMVA 2IGDA 1OFFA 5HHDG 2PIAA 3BYTB 1GB4A 4RGOS 4XDDA 5G5HA 1TS5A 2X38A 4USAA 4RF0A 1JRPA 1XXGA 1J7AA 3R2TA 4NZLB 2ZW1A 2MEKA 3AE1B 5FKAC 2L1AA 3MFGA 1F0ZA 1I4XA 1V1OA 2GRIA 4OZAA 3TSSA 4GDLB 2QEJC 4RGMA 3DWMA 1VZ8A 2V3NA 3HUIA 1HZ6A 2AQ3B 2JX5A 5HI1A 1IUEA 3DWGC 3AEEB 1FMAD 1FNUA 1OQQA 2E3TA 2W55A 2WXJA 2N0SB 1I4HA 4WIPA 1F2RC 4JWSC 2GI9A 2QJLA 1ESFA 1C9FA 3AE4B 4MM3B 1CZPA 2D5GA 1N5XA 1DGJA 3ZJTA 1K53A 3W5VB 2CJNA 3MC0B 1JROA 4KGSA 3BVMA 4C56C 2WXOA 1TY2A 3U2SC 1D5XC 1BUIC 3RPFC 1QOBA 3TEXA 4FXCA 2YEPF 2G9HD 3IAS1 1YJIA 1ZUD2 2N9LA 3B2GA 5BMGA 1C77A 4KGTA 1R7SA 2L32A 1XLNA 5C3JB 2TSSA 4DQOC 3AE8B 1TJEA 2WDQB 2KN4A 4A55A 3ABVB 1SF0A 3E9SA 2QSDA 1NI3A 2BS3B 4TQ1A 2XNAC 4ZRQA 4ZYSA 1SXTA 1HZ5A 3BK1A 3ETRA 1KH0A 3FILB 4JWUC 2WU5B 4NAMA 1ZDXA 2KMMA 3P4SB 2WXFA 1I4PA 2FUG1 4WAFA 1DOYA 4KKIA 1VRAB 4NAWB 5H8YE 3MP9A 1L0VB 3NZ3A 1ZPSA 2RDGA 5AUIA 4C7YA 3VRBB 1YQ3B 1C4AA 4A6QA 4XDCA 3Q8CA 4YSXB 2K22A 3SEBA 2I2YA 2H88B 3OWEB 2JWUA 4H2AA 5I4DA 1ROEA 1UWXA 1ZP0B 4TMAB 1I4GA 4JPSA 5TSSA 1TKGA 2W3SA 2WXIA 3MJ5A 2HDEA 1E6EB 2DBYA 4A90A 2ICIA 1FXIA 1JWBD 2B76B 1DOIA 1JWUD 1KF6B 2BW2A 2ON8A 4IKGA 1MHXA 1SSNA 4WURA 1VR9A 3GB1A 2PVOD 4N59A 2MJEA 2CU3A 1TS3A 2Y5PA 1WYGA 2WXMA 4ZRPA 1Q10A 4GDKB 1L4DB 1LO5D 3PZ7A 1SEBD 2QIEB 4RGNA 5HFYA 2YEPB 1IGCA 1N61A 4XWTA 5D7GA 4YSZB 2H89B 4R3DA 1B1ZA 3UI3A 3AH7A 1P7EA 2Y5CA 3BYYB 4RF1A 1YN4A 3AECB 1V97A 4RH6A 1C76A 3Q8EA 2M0AA 2MJDA 3E56A 4KX6B 2XN9C 1FM0D 2KDMA 5EE3A 2Z8LA 1VJKA 4IOIE 2RDHA 3Q69A 1GOZA 2SEBD 5E6JA 4WH4A 3GP7A 2R61A 2V0GA 2K3UA 3BIID 4HKQA 2LHDA 2PLPA 1CQVA 1VZ6A 2LHEA 3N9YC 5T8IA 3HVZA 4P6VF 1J7BA 2QILA 3IT6B 1YN3A 2E6XA 2WS3B 3U52E 2HTME 1NYQA 1JWSD 1RWSA 2L52A 1GAQB 2WXLA 3NVWA 1QOFA 4RFBA 2WXKA 2ACZB 3HVDA 1JWAD 5EE9A 3AE3B 2OEDA 1GPXA 2IJ0A 2SAKA 2N9KA 3V05A 1SB3C 4LK0M 5G5GA 1QF6A 2W54A 4LTUA 4B0MA 1AWDA 2WU2B 1JWMD 3P4QB 3PO0A 4P16A 3AEFB 2LJIA 2WDRB 4WQMA 4YSYB 1QLBB 2K0PA 4RNAA 3T3OA 2WXGA 2LMCA 4OZCA 1ZXHA 1HQRD 1FCCC 1JMLA 2RMMA 5GXGB 4JX1C 4EE2A 1KTKA 2M19A 4L1BA 2JYEA 4O1NA 5BMHA 3AB5A 1F2RI 1IBXB 1QT9A 3V3XA 3KQ4A 3R2IA 2NTSA 2WXRA 4J3OD 4MT5A 1F77A 2QMTA 1V8CA 3W1SA 3AE7B 1N63A 4MH8A 1EM7A 2PKOA 3EGRA 1I4RA 2J42A 2W82A 5D3DA 4HRSA 1PGBA 3AEBB 1EU4A 2J53A 1FO4A 2L83A 1XO3A 1KLUD 2JQRB 3IAM1 1SJED 3IT4B 1JQ4A 1SBBB 1UNSA 4D2KA 3P1MA 4RGTA 3I9V1 2DYMA 1PFDA 1BXTA 2W3RA 3C8YA 2DWQA 2WXHA 3J9CA 1RFKA 3AM9A 3KWLA 3NUHB 2FE8A 2K9XA 2IGGA 1FIQA 2K5PA 3VR9B 1YMHE 1XCQL 2WXPA 2ZW0A 3ZGZA 1L0XB 1J7CA 2BTEA 3ZYYX 1MVKA 2AQ2B 4REZA 4DXGA 1N5WA 1VZ7A 1HXYD 2VZKD 1XCTL 1XEEA 2DLBA 3AMZA 3ZQ4A 3LXFA 4LLGM 5BYRA 1TYGB 4B0EA 1SE2A 1ZE3D 1KRHA 1V1PA 1VDVA 4UDUC 3BVZA 1L6VA 3NVZA 3W5UB 2LEKA 2JYTA 2PW9A 5LNK1 3ZJVA 4CQNA 1EWYC 1NEKB 3MHZA 3SFDB 3P4PB 2WXQA 4HROA 1T5XD 1BMLC 1ZDVA 2IPKD 5FK9C 2J4XA 3FAHA 1TS4A 4C7ZA 1SJHD 3P63A 1A70A 1XLOA 3TUOA 3NRZA 2WDVB 1I4QA 3URYA 1OQRA 1L6UA 1WSPA 4JE3B 1M4VA 1AW7A 3KLSX 1DOXA 3TEYA 1QOAA 2DYOA 3NVVA 4ITKA 4NJCA 3VRAB 4YWGG 3AEAB 5C2TB 4L2YA 3AE9B 3FC4A 2EELA 1GB1A 1L0YB 1VLBA 2RPVA 4RCOA 2PVGC 1E10A 1P7FA 1C78A 2WP9B 1PGAA 3AN1A 2KACA 3FILA 1L5PA 1RM6C 1FNWA 2JXTA 2ONQA 3GS2A 1C4PA 1EU3A 3TEZA 1E0ZA 3Q8BA 4M0WA 1HEZE 1FRDA 1FNVA 3I57A 4US8A 1WRIA 2WLBA 1NENB 3R8BA 1T6BX 3SR6A 4OW0A 4YT0B 1WXQA 5D3IB 1TKEA 2BS2B 1D6EC 1T3QA 1E9MA 1XF5L 2BBCA 2JZPA 1I7HA 2MH7A 2V4IB 5FR3A 1ZXIA 2BYTA 3W9CB 1CJEA 2AX5A 5JXVA 2KWDA 2OHFA 1YNTE 5BYQA 5EE0A 3B9JA 2BS4B 1K50A 1TZOA 1SE3A 3P4RB 1YN5A 3RFZB 2BB6A 4A8XC 2INPE 4ZHOA 5EE1A 2NMQA 2JSVX 3HRDD 1D5MC 2KAJA 4MACA 4IDIA 1MI0A 2M56B 3BWUD 1WGKA 3BVGA 4DXFA 1QQRA 1HA5A 2JU6X 1ET6A 2WNMA 1ENFA 5HG2A 4ZHPA 1V1PB 3WCQA 1PYWD 2IDYA 4ZOHC 3CIRB 5BYSA 2Y3AA 1ACCA 3AV8A 4OZBA 2GB1A 1YQ4B 1ET9A 4N6EB 2V3PA 1TS2A 3KWVA 4US9A 3T3NA 1ZOYB 4HEA1 1K52A 3LYYA 1NVID 1N60A 1N62A 1FXAA 3IXSA 1PDXA 1B9RA 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZ8 A;  2VZK D;  2YEP F;  1VZ6 A;  1VZ7 A;  2YEP B;  1VRA B;  2VZK B;  3IT4 B;  2V4I B;  3IT6 B; 
#chains in the Genus database with same CATH topology
 2KMC A;  1S3S G;  2ZVN A;  2CJO A;  3V6C B;  1JCK B;  1H4R A;  4W9I A;  3AU5 A;  2LGY A;  4JGH B;  3ZNG C;  1XLQ A;  3WAP A;  1L4Z B;  2LGI A;  1AYF A;  2WXN A;  2L00 B;  1QOG A;  3B08 A;  1R4M B;  3ZO5 B;  5C23 A;  2XK5 A;  3HM3 A;  3GZN B;  3VR8 B;  4D6J A;  3QK0 A;  3AE5 B;  1V80 A;  3KUD B;  2G1E A;  3ZIM A;  4WWM A;  5IKC M;  1JW9 D;  3ENE A;  2O2V B;  3PV1 A;  2RD0 A;  1DYQ A;  1SIJ A;  2JXX A;  2M17 A;  3KW5 B;  4B6W A;  4TSS A;  4P1C C;  3RD2 A;  3AED B;  3EA6 A;  3RUI B;  1V49 A;  1D4B A;  3DHG C;  5AUK A;  4XWW A;  2L8J A;  2IYD B;  3NS1 A;  3K9O B;  1Q5W B;  1TY0 A;  5DPT A;  5IN7 A;  3BZD B;  5JHA A;  4W9D A;  1D5Z C;  5HKH A;  3Q8F A;  2VZK B;  5AEK B;  2PPH A;  3O13 A;  4NAW A;  1WWT A;  5E6N A;  1UZX B;  2NTT A;  3AE6 B;  4EUT A;  2JT4 B;  2KXJ A;  4DK5 A;  5HHD G;  2PIA A;  3BYT B;  2MA9 B;  4G11 A;  4RGO S;  2JPH A;  4KVG B;  3R2T A;  4NZL B;  1V1O A;  1TTN A;  2RDB C;  5D6J B;  1VZ8 A;  2CHZ A;  2V3N A;  5HI1 A;  1HTO A;  3PLV A;  2AL3 A;  2GI9 A;  3WAO A;  3FKY A;  3PTF C;  2WYQ A;  1C9F A;  1WXM A;  2CJN A;  4IUM B;  2K6D B;  2D3A A;  2JRH A;  1JRO A;  2A5U A;  4B9K A;  4KGS A;  3BVM A;  1BUI C;  3V6E B;  2LUE A;  3IAS 1;  2HD5 B;  4CO7 A;  1V6E A;  1C77 A;  3PRP B;  2L32 A;  2TSS A;  4RM9 A;  3RNB C;  3UF8 A;  1GG3 A;  3TL5 A;  2KDI A;  4BKT A;  2R2O A;  1NI3 A;  3BK1 A;  2AWT A;  1KH0 A;  3N20 C;  4PS3 A;  3L16 A;  1U4A A;  4IC7 B;  2WU5 B;  1ZDX A;  2LGD A;  1I4P A;  3PLU A;  3GOE A;  1VRA B;  4WWN A;  1ZPS A;  4RMA A;  3ZTD A;  3GE3 C;  3VRB B;  3V62 A;  1C4A A;  3SEB A;  2H88 B;  4DDI D;  2WDT B;  1YOV B;  3OWE B;  2JWU A;  3KYD D;  2AL6 A;  3PRE A;  5DPR A;  4JPS A;  5TSS A;  5CHF A;  3MJ5 A;  2HDE A;  2AYO B;  4A90 A;  2ICI A;  3QAR A;  1FXI A;  3A1Q A;  2B76 B;  1DOI A;  1C3T A;  1MHX A;  2C7N B;  3D32 A;  3GB1 A;  4AJY B;  3DBS A;  2CU3 A;  3RZF A;  1TS3 A;  1WYG A;  3AUL A;  4ZRP A;  2KKC A;  2NR2 A;  4GDK B;  2QIE B;  2V3S A;  2CU1 A;  1GC6 A;  4E74 A;  1P7E A;  2K8B A;  4BOS C;  3AEC B;  2RSU A;  1V97 A;  4RH6 A;  1C76 A;  3Q8E A;  2M0A A;  3ML9 A;  4KX6 B;  1GOZ A;  2SEB D;  3EFU A;  4XX5 A;  2KWU B;  2K3U A;  3ZLZ A;  2KX0 A;  2FAZ A;  1CQV A;  3N9Y C;  3C19 A;  1EO6 A;  1J7B A;  2QIL A;  2NBU A;  3QC8 B;  3DOW A;  2HTM E;  2LRU A;  1GAQ B;  3H1U A;  2MX2 A;  4MSM B;  2OED A;  2L7R A;  2MQJ A;  2N9K A;  3N3K B;  4XGA B;  4LTU A;  1AWD A;  4P16 A;  1JWM D;  4W9J A;  4YSY B;  1QLB B;  4IW0 A;  1LFD A;  2WXG A;  3QQ8 B;  1ZXH A;  1HQR D;  3V60 A;  4P1B C;  2WMH A;  4M02 A;  1FCC C;  2RMM A;  3VFK A;  4JX1 C;  4BBN F;  4L1B A;  3AB5 A;  3Q3O C;  1QT9 A;  2MBB B;  2WXR A;  3ECI A;  2D3C A;  3ZDT A;  2J7Q B;  5BO4 B;  3W1S A;  1SGH A;  4MH8 A;  3U30 A;  1E8W A;  5C1Z A;  1FXT B;  3MC9 A;  4GGQ A;  2ZVO A;  4ANV A;  1E8Z A;  4WJN A;  4PYU A;  3AEB B;  3Q3F A;  1KLU D;  2WMJ A;  2WX1 A;  3DQV A;  4K7U A;  2W3R A;  4A3P A;  4GIV A;  3J9C A;  3HM6 X;  3TBL D;  1M94 A;  1WX7 A;  2IGG A;  2K5P A;  3VR9 B;  1T0Q C;  2KT7 A;  2WXP A;  2ZW0 A;  1L0X B;  2BTE A;  2AQ2 B;  1C1Y B;  4ICU A;  1HXY D;  1OQY A;  2VZK D;  1XCT L;  3AMZ A;  4HPM B;  2GLS A;  3LXF A;  4LLG M;  1WF9 A;  1V81 A;  1F1H A;  2ZPY A;  3BVZ A;  2PW9 A;  3VH3 B;  4CQN A;  1NEK B;  2K39 A;  4EEW A;  4BKS D;  4DHZ B;  4P7I A;  3DDC B;  1BML C;  2D3G A;  4I6N B;  5FK9 C;  5FR6 A;  2J4X A;  3WAM A;  1SJH D;  2KDF B;  2WDV B;  5J18 A;  3NY5 A;  1YX6 B;  4JE3 B;  1AW7 A;  3U8Z A;  4II2 B;  1QOA A;  2OJR A;  2MSE D;  3NG0 A;  4YWG G;  3AEA B;  4L2Y A;  3H9D A;  3CMM B;  1VLB A;  2MRP A;  4RCO A;  2PVG C;  4D6E A;  2KJR A;  1FNW A;  1C4P A;  1OEY J;  1E0Z A;  3Q8B A;  2J0J A;  3I57 A;  4WJP A;  3SR6 A;  1TIF A;  1T6B X;  2PJH A;  5D3I B;  4D6D A;  2BS2 B;  4DWF A;  1X1M A;  3ML8 A;  4W9L A;  1ZXI A;  2O2V A;  4EFO A;  2AX5 A;  3ZRF A;  4IWP A;  3PRM B;  3EHV A;  2BS4 B;  1UD7 A;  2LVO A;  4A8X C;  4ZHO A;  2NMQ A;  2KFJ A;  1WGD A;  4GXB A;  1D5M C;  1N6Z A;  3BWU D;  3BVG A;  4DXF A;  3M63 B;  2WNM A;  1ENF A;  2MW5 A;  1PYW D;  2IDY A;  5BYS A;  1T0R C;  3X0W A;  2V3P A;  3DBL B;  1WE6 A;  5AZG A;  1GJZ A;  4X57 B;  4CYE A;  1K52 A;  4TKN A;  3LYY A;  2N7E A;  1NDD A;  4XC2 A;  3IXS A;  4BKS A;  3UIP B;  2FBW B;  1J0G A;  1QIL A;  3ZJU A;  4ARI A;  5D2M B;  2MCN B;  4GLS C;  4A9A A;  3KUC B;  2IY1 B;  3QJZ A;  3EUB 2;  1KFY B;  3RI7 C;  3BK2 A;  2LGX A;  1IGD A;  2D11 A;  1UEL A;  3VTU A;  1OGW A;  2I38 A;  2G4D B;  2INN E;  2KHW B;  1WH3 A;  3HK0 A;  1YQB A;  2MJ3 A;  2L76 A;  4XYC A;  2LD9 A;  2OOB B;  4G50 A;  2DX5 B;  4AS1 A;  3M62 B;  2HJ8 A;  2WHI A;  2XBB C;  3L4P A;  3U4E G;  2UU7 A;  3PVL A;  4WAA A;  4PYZ A;  1STE A;  1MPE A;  4KGR A;  2ASQ A;  3P42 A;  3AE2 B;  2WMI A;  1I35 A;  4LNK A;  1UUP A;  2DZJ A;  4EZJ A;  2PTL A;  3H8H A;  1UH6 A;  1C4C A;  1MG4 A;  4ASW C;  2KQ4 X;  1TBE A;  2WMK A;  4IM2 A;  1FFV A;  4K7W A;  4HKZ E;  4F8C B;  3B2F A;  2FNJ B;  1R4N B;  3W2D A;  5BMI A;  1FRR A;  1E7P B;  1QKZ A;  2PMV A;  2K8C A;  1OFF A;  1GB4 A;  1WJ6 A;  2V1Y A;  4RF0 A;  1OTR B;  1J7A A;  5FKA C;  1F0Z A;  4WWO A;  2D07 B;  3K9P B;  3DWM A;  5G55 A;  3A9K B;  2C60 A;  2ZCB A;  3HUI A;  1E5W A;  1HZ6 A;  2XEW A;  2DHZ A;  1SE9 A;  2KTR A;  4HWI B;  2W55 A;  2KTF A;  1I4H A;  4WIP A;  1F2R C;  4JWS C;  3RNG C;  1CZP A;  1K53 A;  3V61 A;  3Q6B A;  4K81 A;  3CST A;  3QWZ B;  2WWZ A;  2WXO A;  1D5X C;  1HE8 A;  1QOB A;  4S0R A;  2YEP F;  2G9H D;  4NNJ B;  1YJI A;  1ZUD 2;  2N9L A;  4AP4 C;  2IO3 B;  1R7S A;  2JZZ A;  2W9N A;  4BKG A;  4JQW C;  1WIA A;  3DBH I;  1TJE A;  2UYZ B;  1PQS A;  2KN4 A;  4A55 A;  3ABV B;  1SF0 A;  2QSD A;  2O6V B;  3L10 B;  2I1K A;  1V5O A;  3AI5 A;  5DPS A;  4TQ1 A;  5AZH A;  2XNA C;  4MGI E;  1SXT A;  3ETR A;  4FJV B;  2YVC A;  2KD0 A;  1YX5 B;  2FUG 1;  4KKI A;  3OJ3 A;  1L0V B;  3WAN A;  3JYU A;  1YQ3 B;  2HE7 A;  1LLQ A;  4XDC A;  4YSX B;  2VH2 A;  2K22 A;  4FN2 A;  5I4D A;  1ROE A;  4LNN A;  4TMA B;  2WXI A;  3OG5 A;  1KJT A;  3GE8 C;  2DBY A;  1JWB D;  1SSN A;  3OAW A;  1CMX B;  2BWF A;  4KIK B;  2WXM A;  1Q10 A;  1L4D B;  1SEB D;  3AU4 A;  2N9X A;  2YEP B;  2L05 A;  4HCP B;  5D7G A;  2H89 B;  3B0A A;  3UI3 A;  3AH7 A;  1E90 A;  1AAR A;  4DHJ B;  2WMG A;  2KX3 A;  3E56 A;  1FM0 D;  4DXA B;  5DPW A;  4TV3 A;  5EE3 A;  3APF A;  1VJK A;  3Q69 A;  2EKE C;  5E6J A;  4WH4 A;  1Q0W B;  3L0W B;  4NPN A;  1LM8 B;  2FCN A;  2PLP A;  1ISN A;  3EFC A;  2LHE A;  1GC7 A;  5T8I A;  4P6V F;  2WXL A;  1JWS D;  2CHX A;  2G3Q B;  3NVW A;  1QOF A;  2INC C;  1JWA D;  3MHS D;  5EE9 A;  4ANU A;  3R7R A;  3V05 A;  1SB3 C;  5G5G A;  2W54 A;  4B0M A;  2KQ7 A;  2VH1 A;  1TT5 B;  4RNA A;  5TR5 A;  3WIM A;  1IYF A;  3R7Q A;  4OZC A;  2REX A;  2IBI B;  1KTK A;  2JYE A;  1F2R I;  3KQ4 A;  3Q3N C;  2NTS A;  2QDF A;  4J3O D;  2QMT A;  1WR6 E;  4BVU C;  1KM7 A;  2DAJ A;  2PKO A;  2WMI B;  5KHQ A;  1JRU A;  4AJW A;  2JWZ A;  2IO1 B;  3DBR I;  3RNE C;  1JQ4 A;  3IHP C;  4YL8 A;  3P1M A;  2DYM A;  1WE7 A;  3LDZ E;  1BXT A;  1J8C A;  1P9D U;  1E7U A;  2DWQ A;  3KWL A;  1UGM A;  1FIQ A;  4GDL A;  1XCQ L;  2KOX A;  2GOW A;  3UQA A;  2KJH B;  3C0R B;  3ZYY X;  1WM3 A;  1MVK A;  1N5W A;  1VZ7 A;  4JLC A;  4WQO B;  1NBF C;  1TYG B;  2BYV E;  4UDU C;  4TUU A;  1VDV A;  3W5U B;  2LEK A;  4ZRK A;  2LGS A;  2KTR B;  4HRO A;  3KVF B;  2ZNV B;  3IG3 A;  3RZW C;  3P63 A;  4E71 A;  1A70 A;  1XLO A;  1WYW B;  3VXW A;  2JF5 A;  2C7M B;  1OQR A;  1L6U A;  1P0R A;  1M4V A;  1DOX A;  3NVV A;  2KLC A;  3VRA B;  5C2T B;  3S2A A;  1WGR A;  5L83 A;  2EEL A;  1GB1 A;  1L0Y B;  2RPV A;  4IWQ A;  2CR5 A;  4OVV A;  1C78 A;  2WP9 B;  1L5P A;  3CSF A;  2LXA A;  2PEA A;  3TEZ A;  1HEZ E;  4MDK E;  1FNV A;  1IP9 A;  3RT3 B;  2J0M A;  4OW0 A;  3A4S C;  4PS8 A;  1T3Q A;  1E9M A;  1WMH B;  1XF5 L;  2JZP A;  2KJ6 A;  3CF6 E;  1I7H A;  4IM0 A;  2MH7 A;  2V4I B;  3ZUN A;  2Y5B B;  3ZXV A;  2OHF A;  2QCZ A;  1WJ4 A;  3B1L X;  3B9J A;  4KV2 A;  3DBH B;  1TZO A;  3P4R B;  3VAW A;  3RFZ B;  2O6V D;  3HRD D;  1L7Y A;  3VUW A;  2BPS A;  2KC1 A;  1QQR A;  1GUA B;  4ZDV A;  1HA5 A;  2JU6 X;  2KMA A;  4PS7 A;  2EMT A;  1WFY A;  3AV8 A;  1YQ4 B;  1ET9 A;  1RLF A;  3EEC A;  1O0S A;  3TMP B;  1BT0 A;  3T3N A;  3KWV A;  3W1Y A;  1RAX A;  1NVI D;  3WAL A;  4EZL A;  3AXC A;  5CX3 A;  4EOY A;  1PDX A;  3SD5 A;  1FFU A;  4FJZ A;  3Q14 C;  4KKJ A;  4PK1 A;  2BT6 A;  1G6J A;  3U7Z A;  1JAL A;  4ANX A;  4LNF A;  3T9L A;  3A9K A;  3LB8 C;  2LJ5 A;  4TQ0 A;  1AN8 A;  2BB5 A;  1E7V A;  3Q8A A;  3VQI A;  4LDT B;  4YTN B;  1RFA A;  3ONS A;  4DHJ D;  1V2Y A;  3JW0 X;  3AEG B;  1L2N A;  3TEW A;  4JIO U;  2IO0 B;  3IVF A;  4YTM B;  3SU8 X;  4K3C A;  1IBX A;  1RYJ A;  4YTP B;  1FEH A;  2I1J A;  4NY0 A;  4XE0 A;  2AQ1 B;  4D6H A;  1UGJ A;  2MBO A;  4HJG E;  1WY8 A;  1FCL A;  2WX0 A;  4D6C A;  1C79 A;  3SDL C;  1P1A A;  3LJ3 A;  5GMV A;  1R4M I;  2O6V A;  1K51 A;  2N7J A;  1UWM A;  4PT5 A;  1Y56 A;  3GZN I;  5LLI A;  4OVZ A;  4W9C A;  3VTW A;  1PUT A;  3DHI C;  1XLP A;  4L23 A;  2GMI C;  3M3J A;  1KLG D;  3OJ4 B;  5MPO A;  2GBK A;  2IGD A;  1D3Z A;  2DZK A;  4XDD A;  5G5H A;  4BZA A;  1TS5 A;  2K1F A;  4USA A;  4KSK C;  2MLB A;  2ZW1 A;  3MFG A;  2GRI A;  3TSS A;  4GDL B;  2IND C;  2C7H A;  3UQB A;  2AQ3 B;  3KUZ A;  2EMS A;  2D2Q A;  3ZTC A;  2MBQ A;  1FMA D;  3DBR B;  1FNU A;  1OQQ A;  4KIK A;  2QJL A;  3NJT A;  3VVW B;  3AE4 B;  4MM3 B;  2D5G A;  1DGJ A;  3W5V B;  3MC0 B;  1TY2 A;  4EZK A;  4MSQ B;  3TEX A;  1WR1 A;  4FXC A;  2M8S A;  4FHJ A;  2FCM A;  5BMG A;  4KGT A;  1XLN A;  5C3J B;  3H7S A;  4DQO C;  3AE8 B;  2N4F A;  2WDQ B;  4GU2 A;  3N1X C;  1WRD B;  3BY4 B;  2BS3 B;  3NOB A;  3A4R A;  4JWU C;  4M01 A;  4D6I A;  3PSE B;  4NAM A;  2KMM A;  2WXF A;  2CKH B;  4WAF A;  3T8M A;  5H8Y E;  3NZ3 A;  1LGR A;  2B3A A;  2J0K A;  5EDS A;  3Q8C A;  2QHO A;  4M8N A;  1WXS A;  4H2A A;  5JHB A;  1ZP0 B;  2FID A;  4N9F 4;  1TKG A;  2W3S A;  4ZYN A;  3UIN B;  1E6E B;  2K8H A;  2GBM A;  1JWU D;  2ON8 A;  4IKG A;  5DCN A;  4WUR A;  4IM3 A;  2PVO D;  2MJE A;  4I6P A;  2KQS A;  1LO5 D;  5HFY A;  2KFK B;  1EUV B;  2ZJD A;  4RM8 A;  3Q3J A;  4YSZ B;  3APC A;  3OLM D;  1WZ0 A;  4D72 A;  1SIF A;  2MHJ A;  3I3T B;  2XN9 C;  2DZM A;  2Z8L A;  2RDH A;  2R61 A;  2V0G A;  3VUY A;  3BII D;  4HKQ A;  2LHD A;  4BBN C;  4DBG A;  3HVZ A;  1YN3 A;  2E6X A;  3U52 E;  1NYQ A;  4RFB A;  2V9H A;  3AE3 B;  2MP2 B;  3IBE A;  1GPX A;  2IJ0 A;  2SAK A;  1UBI A;  4LK0 M;  4HVB A;  1QF6 A;  4K1R B;  2WU2 B;  3PO0 A;  4M8M A;  1KOT A;  4ZRI A;  1V9J A;  2LJI A;  2WDR B;  4MEL A;  4WQM A;  4ACF A;  3PRZ A;  3T3O A;  1LXD A;  1GNU A;  4EKU A;  2HTH A;  4HPL B;  2LWP A;  5J2R A;  5GXG B;  4K7S A;  1MG8 A;  1IBX B;  3V3X A;  5IP4 D;  4LJP B;  3QIJ A;  3DHH C;  2N1V A;  2KN5 A;  4HDQ A;  4LJO B;  1F77 A;  4LDT D;  5L95 C;  2LZ6 A;  1XQQ A;  1N63 A;  4URK A;  3ZRC A;  2VRR B;  1XT9 B;  1Q1O A;  5E6P A;  2W82 A;  5D3D A;  3RNF C;  1PGB A;  3HIZ A;  1YD8 U;  1EU4 A;  1FPY A;  3X23 A;  2J53 A;  1FO4 A;  1XO3 A;  2K6Q A;  4MGZ E;  4HLE A;  2MBE A;  2JQR B;  3IAM 1;  1SJE D;  1SBB B;  1UNS A;  3PGE A;  1UBQ A;  4RGT A;  3I9V 1;  4D2K A;  1PFD A;  1WMH A;  3C8Y A;  4ICV A;  5AZF A;  2WXH A;  2NCN A;  3NUH B;  4KZC A;  4MH0 E;  4LNI A;  3RCZ A;  2FE8 A;  5G2N A;  3PHW B;  4HCN B;  4WWP A;  1J7C A;  3QX1 A;  4REZ A;  4DXG A;  4HK2 A;  3H7P B;  4FLH A;  2AEH A;  5E6O A;  5BYR A;  2Z0D B;  4B0E A;  1SE2 A;  2G45 B;  3EC8 A;  4M00 A;  1KRH A;  2KLG A;  1L6V A;  4MEM A;  1UF0 A;  2JYT A;  1IPG A;  2K25 A;  3MHZ A;  3ZXR A;  3P4P B;  2KAN A;  2Z59 B;  4HDO A;  1T5X D;  1ZDV A;  3DVG Y;  2IPK D;  3NHE B;  5J17 A;  3TUO A;  1HTQ A;  4B95 A;  1S1Q B;  4FUL A;  1WSP A;  2BKR B;  4HXD A;  3TEY A;  2DYO A;  4ITK A;  4LNO A;  2LVP A;  3AE9 B;  3FC4 A;  2KDE B;  5IOI A;  1E10 A;  3AN1 A;  1PGA A;  2BYE A;  3BIN A;  1YIW A;  1LQB A;  2UWQ A;  3FIL A;  1RM6 C;  2JXT A;  2ONQ A;  3A9J B;  3GS2 A;  5CHW A;  3I5J C;  4M0W A;  2DEN B;  2BYF A;  1E8X A;  1WRI A;  2WLB A;  2MBH A;  4C4V A;  2Z0E B;  1NI2 A;  4MGK E;  2NPT B;  3N1Z C;  4C00 A;  1D6E C;  2CHW A;  2BBC A;  1XD3 B;  2FCQ A;  2BYT A;  4FAD A;  5JH5 C;  3ZVV A;  1ZKH A;  2KWD A;  3L13 A;  1WX9 A;  5JXV A;  2JRI B;  3W1S C;  1E8Y A;  2R2Q A;  1YN5 A;  2BB6 A;  3H6N A;  2INP E;  3QA8 A;  4GMV A;  5EE1 A;  2JSV X;  2LI5 A;  2KAJ A;  4IDI A;  3PT2 B;  3APD A;  4W9F A;  3RNC C;  2JY6 A;  4ZHP A;  1V1P B;  3JSV A;  3VH4 B;  4ZOH C;  1WJN A;  3CIR B;  4I6L B;  1ACC A;  4OZB A;  3UGB B;  2GB1 A;  1TS2 A;  2BVC A;  1ZOY B;  4HEA 1;  1N60 A;  2HJ1 A;  1FXA A;  1WGG A;  2L0T A;  3RUL A;  4A3O A;  4OHJ A;  1TKY A;  3HHM A;  3QAQ A;  3NVY A;  3ZNH B;  1CK1 A;  2L0F A;  4WJQ A;  2LXC A;  2GBJ A;  4XZ4 A;  2KC2 A;  3CWI A;  1TZ1 A;  3Q2A C;  4GSW A;  2IGH A;  1SE4 A;  2KVR A;  3RNA C;  5H92 C;  2DAF A;  1PGX A;  1OEY A;  4C80 A;  1QZE A;  3RMK C;  4D6F A;  4A20 A;  1EWC A;  4ARC A;  3SFE B;  3DBL I;  4WJO A;  2Q5W D;  4N58 A;  3PHX B;  4MM3 A;  2RGF A;  1ZGU B;  5CTR C;  4KDI C;  4YXD B;  2DYB A;  3ZNI D;  3KH0 A;  4KDL B;  4MJS A;  1WGH A;  2LFI A;  1T0S C;  3Q3M C;  1MHH E;  4E3C A;  2X8X X;  1WX8 A;  1RRB A;  3PZ8 A;  2YLM A;  4BOZ B;  2EKI A;  1H8C A;  3N32 A;  4Q2J A;  4FA6 A;  1YJJ A;  1WZ3 A;  2J52 A;  2WQY B;  1FD6 A;  1NYR A;  3NS8 A;  2FUH B;  2LUM A;  4AQ7 A;  3TIX A;  4QAY A;  5JZE B;  2BQQ A;  2L3Z A;  2X38 A;  1JRP A;  1XXG A;  5LXI B;  3AE1 B;  2MEK A;  2L1A A;  1I4X A;  3NZU A;  1F9J A;  1P98 A;  4OZA A;  2QEJ C;  4RGM A;  2G4S A;  3ZNZ B;  4W9H A;  3KYC D;  2KO3 A;  3ALB A;  2JX5 A;  3MTN B;  1IUE A;  2A4Z A;  3DWG C;  3AEE B;  2RPQ A;  2XK5 B;  3RN9 C;  2E3T A;  2WMF A;  2JVC A;  2WXJ A;  2N0S B;  2KFK A;  4FHK A;  4D6G A;  4W9E A;  1ESF A;  4AUQ C;  1WXV A;  2FIF A;  2IY0 B;  1R4N I;  3L08 A;  1N5X A;  3ZJT A;  3N30 A;  2N9P C;  4C56 C;  1WI0 A;  2ZEQ A;  3U2S C;  3L54 A;  3RPF C;  2ZPN A;  4GN1 A;  2CS4 A;  3DVN V;  3B2G A;  4FJY A;  2D10 A;  4F7Z A;  3PZD A;  3E9S A;  2IZV B;  4G3X B;  3L17 A;  3U7D A;  4ZRQ A;  4ZYS A;  2MP2 A;  1HZ5 A;  4AWJ A;  3FIL B;  3P4S B;  4IG7 B;  4M0W B;  1DOY A;  4NAW B;  2GBN A;  3MP9 A;  1MFW A;  2RDG A;  5AUI A;  4C4V B;  4C7Y A;  4S17 A;  2BWE S;  5KHO A;  4A6Q A;  3VTV A;  2I2Y A;  2NVU I;  2M4N A;  1UWX A;  1I4G A;  4BAX A;  1WJU A;  4DDG D;  5IA7 A;  2BW2 A;  1KF6 B;  3QCA A;  4D71 A;  2PE9 A;  3VUX A;  1VR9 A;  4N59 A;  2Y5P A;  2DNF A;  2N1W A;  2ZCC A;  3PZ7 A;  2DZI A;  3ZW3 A;  3TJP A;  4RGN A;  1IGC A;  3JSV B;  1N61 A;  4XWT A;  4AOF A;  4R3D A;  5IO9 A;  1B1Z A;  2LAS A;  2Y5C A;  3BYY B;  4RF1 A;  3IFW B;  1YN4 A;  2JUO A;  2MWS B;  3NZS A;  1K8R B;  3ZDM C;  2MJD A;  4G0N B;  2KDM A;  4IOI E;  3VHT C;  2C5L C;  2KWC A;  3I63 C;  3GP7 A;  1MJD A;  2WGS A;  2N7D A;  4OVU A;  1VZ6 A;  3IT6 B;  1A5R A;  3H7P A;  2WS3 B;  2L52 A;  1RWS A;  2ZNV C;  2WXK A;  2ACZ B;  3HVD A;  1J19 A;  3VDZ A;  3R66 C;  2LVQ A;  3P4Q B;  5IAA C;  3AEF B;  1I42 A;  2K0P A;  3JVZ X;  2LMC A;  2KNB A;  1JML A;  4EE2 A;  2M19 A;  4O1N A;  3R3M A;  5BMH A;  4BFR A;  1ZW7 A;  4MJS B;  4FBJ B;  3R2I A;  3PS6 A;  4ZRJ A;  4MT5 A;  1YJ1 A;  1V8C A;  3AE7 B;  3A1Q B;  4MGY E;  2OJW A;  4JL9 A;  1EM7 A;  2BGF A;  3EGR A;  1I4R A;  2J42 A;  4HRS A;  3A9J A;  4CHK A;  2LRW A;  4K3B A;  1KLV A;  4W9K A;  2L83 A;  1VCB A;  2KDB A;  3M95 A;  3IT4 B;  4II3 B;  2NPT A;  5CHV C;  1EF5 A;  1RFK A;  3AM9 A;  4HPP A;  3WA0 A;  3UIO B;  2K9X A;  3MJW A;  4LCD E;  2KYW A;  1TGZ B;  3O65 B;  1YMH E;  4GOC A;  3DVG X;  3ZGZ A;  3TCA A;  1Z5S B;  2M1M A;  4ANW A;  1XEE A;  2DLB A;  3ZQ4 A;  2KK8 A;  2KWV B;  1ZE3 D;  2D3B A;  1V1P A;  3MC8 A;  3NVZ A;  5LNK 1;  3ZJV A;  1EWY C;  3DCG A;  3SFD B;  1Z2M A;  2WXQ A;  2NBV B;  3FAH A;  3A33 B;  1TS4 A;  4C7Z A;  4NQK E;  1T0Y A;  3N1Y C;  3NRZ A;  3ZKJ C;  4NQL B;  1I4Q A;  3URY A;  2KZR A;  1WGY A;  5LXH A;  3DVN U;  3KLS X;  2C9W B;  4NJC A;  4F1S A;  3SHQ A;  3QHT A;  1VD2 A;  1P7F A;  2FCS A;  4GB9 A;  2KAC A;  1P3Q U;  1EU3 A;  2GBR A;  1FRD A;  4US8 A;  1NEN B;  3R8B A;  4YT0 B;  1WXQ A;  1TKE A;  2PE6 B;  4DHZ E;  2JZ3 B;  2M0X A;  1Y8R C;  2QC8 A;  4KZ0 A;  5FR3 A;  2RR9 A;  5D94 A;  3W9C B;  1CJE A;  1YNT E;  4W9G A;  5BYQ A;  5EE0 A;  4J6I A;  1WXA A;  1K50 A;  1SE3 A;  2IO2 B;  4NJ7 A;  4HJK A;  3P2B A;  2KVZ A;  2V4L A;  4MAC A;  1MI0 A;  2M56 B;  2BKF A;  3PPA A;  4IWO A;  1WGK A;  3RYT A;  4GDK A;  1ET6 A;  5HG2 A;  2ZZP B;  3WCQ A;  1EF1 A;  2Y3A A;  4N6E B;  2BF8 B;  2NBW B;  2N9E B;  4US9 A;  3DPD A;  1V5T A;  2NS5 A;  1V86 A;  1F52 A;  1N62 A;  1WM2 A;  4NJ6 A;  1B9R A;  4KSL C; 
#chains in the Genus database with same CATH homology
 2FBW B;  1FFU A;  1QIL A;  1TKY A;  3ZJU A;  2CJO A;  1JCK B;  4ARI A;  4KKJ A;  3NVY A;  1CK1 A;  2BT6 A;  4GLS C;  3U7Z A;  1XLQ A;  1L4Z B;  1JAL A;  4A9A A;  2LGI A;  1AYF A;  2WXN A;  3EUB 2;  1KFY B;  3CWI A;  3LB8 C;  4TQ0 A;  1AN8 A;  2BB5 A;  3BK2 A;  3Q8A A;  1QOG A;  3VQI A;  1IGD A;  2IGH A;  1SE4 A;  5H92 C;  4YTN B;  1PGX A;  4C80 A;  2I38 A;  3VR8 B;  1EWC A;  4ARC A;  2INN E;  3SFE B;  2Q5W D;  3AEG B;  4N58 A;  3AE5 B;  3TEW A;  2G1E A;  2MJ3 A;  4WWM A;  1JW9 D;  4YXD B;  4YTM B;  1IBX A;  1RYJ A;  4YTP B;  4AS1 A;  1FEH A;  2LFI A;  1DYQ A;  3L4P A;  3U4E G;  1MHH E;  1SIJ A;  4TSS A;  4XE0 A;  2AQ1 B;  1STE A;  1MPE A;  4KGR A;  3AED B;  3EA6 A;  1D4B A;  1UGJ A;  3P42 A;  4HJG E;  1FCL A;  3AE2 B;  5AUK A;  4XWW A;  1UUP A;  2PTL A;  3H8H A;  3PZ8 A;  1C79 A;  1C4C A;  3NS1 A;  2EKI A;  1TY0 A;  4Q2J A;  1YJJ A;  3BZD B;  1D5Z C;  1K51 A;  2N7J A;  2KQ4 X;  2J52 A;  1UWM A;  3Q8F A;  2WQY B;  1FD6 A;  1NYR A;  2VZK B;  1Y56 A;  4PT5 A;  4OVZ A;  1FFV A;  1PUT A;  2LUM A;  1XLP A;  4L23 A;  4AQ7 A;  3O13 A;  4HKZ E;  1WWT A;  3B2F A;  2NTT A;  3AE6 B;  3W2D A;  5BMI A;  1FRR A;  1E7P B;  1KLG D;  1QKZ A;  5MPO A;  2PMV A;  2IGD A;  1OFF A;  5HHD G;  2PIA A;  3BYT B;  1GB4 A;  4RGO S;  4XDD A;  5G5H A;  1TS5 A;  2X38 A;  4USA A;  4RF0 A;  1JRP A;  1XXG A;  1J7A A;  3R2T A;  4NZL B;  2ZW1 A;  2MEK A;  3AE1 B;  5FKA C;  2L1A A;  3MFG A;  1F0Z A;  1I4X A;  1V1O A;  2GRI A;  4OZA A;  3TSS A;  4GDL B;  2QEJ C;  4RGM A;  3DWM A;  1VZ8 A;  2V3N A;  3HUI A;  1HZ6 A;  2AQ3 B;  2JX5 A;  5HI1 A;  1IUE A;  3DWG C;  3AEE B;  1FMA D;  1FNU A;  1OQQ A;  2E3T A;  2W55 A;  2WXJ A;  2N0S B;  1I4H A;  4WIP A;  1F2R C;  4JWS C;  2GI9 A;  2QJL A;  1ESF A;  1C9F A;  3AE4 B;  4MM3 B;  1CZP A;  2D5G A;  1N5X A;  1DGJ A;  3ZJT A;  1K53 A;  3W5V B;  2CJN A;  3MC0 B;  1JRO A;  4KGS A;  3BVM A;  4C56 C;  2WXO A;  1TY2 A;  3U2S C;  1D5X C;  1BUI C;  3RPF C;  1QOB A;  3TEX A;  4FXC A;  2YEP F;  2G9H D;  3IAS 1;  1YJI A;  1ZUD 2;  2N9L A;  3B2G A;  5BMG A;  1C77 A;  4KGT A;  1R7S A;  2L32 A;  1XLN A;  5C3J B;  2TSS A;  4DQO C;  3AE8 B;  1TJE A;  2WDQ B;  2KN4 A;  4A55 A;  3ABV B;  1SF0 A;  3E9S A;  2QSD A;  1NI3 A;  2BS3 B;  4TQ1 A;  2XNA C;  4ZRQ A;  4ZYS A;  1SXT A;  1HZ5 A;  3BK1 A;  3ETR A;  1KH0 A;  3FIL B;  4JWU C;  2WU5 B;  4NAM A;  1ZDX A;  2KMM A;  3P4S B;  2WXF A;  1I4P A;  2FUG 1;  4WAF A;  1DOY A;  4KKI A;  1VRA B;  4NAW B;  5H8Y E;  3MP9 A;  1L0V B;  3NZ3 A;  1ZPS A;  2RDG A;  5AUI A;  4C7Y A;  3VRB B;  1YQ3 B;  1C4A A;  4A6Q A;  4XDC A;  3Q8C A;  4YSX B;  2K22 A;  3SEB A;  2I2Y A;  2H88 B;  3OWE B;  2JWU A;  4H2A A;  5I4D A;  1ROE A;  1UWX A;  1ZP0 B;  4TMA B;  1I4G A;  4JPS A;  5TSS A;  1TKG A;  2W3S A;  2WXI A;  3MJ5 A;  2HDE A;  1E6E B;  2DBY A;  4A90 A;  2ICI A;  1FXI A;  1JWB D;  2B76 B;  1DOI A;  1JWU D;  1KF6 B;  2BW2 A;  2ON8 A;  4IKG A;  1MHX A;  1SSN A;  4WUR A;  1VR9 A;  3GB1 A;  2PVO D;  4N59 A;  2MJE A;  2CU3 A;  1TS3 A;  2Y5P A;  1WYG A;  2WXM A;  4ZRP A;  1Q10 A;  4GDK B;  1L4D B;  1LO5 D;  3PZ7 A;  1SEB D;  2QIE B;  4RGN A;  5HFY A;  2YEP B;  1IGC A;  1N61 A;  4XWT A;  5D7G A;  4YSZ B;  2H89 B;  4R3D A;  1B1Z A;  3UI3 A;  3AH7 A;  1P7E A;  2Y5C A;  3BYY B;  4RF1 A;  1YN4 A;  3AEC B;  1V97 A;  4RH6 A;  1C76 A;  3Q8E A;  2M0A A;  2MJD A;  3E56 A;  4KX6 B;  2XN9 C;  1FM0 D;  2KDM A;  5EE3 A;  2Z8L A;  1VJK A;  4IOI E;  2RDH A;  3Q69 A;  1GOZ A;  2SEB D;  5E6J A;  4WH4 A;  3GP7 A;  2R61 A;  2V0G A;  2K3U A;  3BII D;  4HKQ A;  2LHD A;  2PLP A;  1CQV A;  1VZ6 A;  2LHE A;  3N9Y C;  5T8I A;  3HVZ A;  4P6V F;  1J7B A;  2QIL A;  3IT6 B;  1YN3 A;  2E6X A;  2WS3 B;  3U52 E;  2HTM E;  1NYQ A;  1JWS D;  1RWS A;  2L52 A;  1GAQ B;  2WXL A;  3NVW A;  1QOF A;  4RFB A;  2WXK A;  2ACZ B;  3HVD A;  1JWA D;  5EE9 A;  3AE3 B;  2OED A;  1GPX A;  2IJ0 A;  2SAK A;  2N9K A;  3V05 A;  1SB3 C;  4LK0 M;  5G5G A;  1QF6 A;  2W54 A;  4LTU A;  4B0M A;  1AWD A;  2WU2 B;  1JWM D;  3P4Q B;  3PO0 A;  4P16 A;  3AEF B;  2LJI A;  2WDR B;  4WQM A;  4YSY B;  1QLB B;  2K0P A;  4RNA A;  3T3O A;  2WXG A;  2LMC A;  4OZC A;  1ZXH A;  1HQR D;  1FCC C;  1JML A;  2RMM A;  5GXG B;  4JX1 C;  4EE2 A;  1KTK A;  2M19 A;  4L1B A;  2JYE A;  4O1N A;  5BMH A;  3AB5 A;  1F2R I;  1IBX B;  1QT9 A;  3V3X A;  3KQ4 A;  3R2I A;  2NTS A;  2WXR A;  4J3O D;  4MT5 A;  1F77 A;  2QMT A;  1V8C A;  3W1S A;  3AE7 B;  1N63 A;  4MH8 A;  1EM7 A;  2PKO A;  3EGR A;  1I4R A;  2J42 A;  2W82 A;  5D3D A;  4HRS A;  1PGB A;  3AEB B;  1EU4 A;  2J53 A;  1FO4 A;  2L83 A;  1XO3 A;  1KLU D;  2JQR B;  3IAM 1;  1SJE D;  3IT4 B;  1JQ4 A;  1SBB B;  1UNS A;  4D2K A;  3P1M A;  4RGT A;  3I9V 1;  2DYM A;  1PFD A;  1BXT A;  2W3R A;  3C8Y A;  2DWQ A;  2WXH A;  3J9C A;  1RFK A;  3AM9 A;  3KWL A;  3NUH B;  2FE8 A;  2K9X A;  2IGG A;  1FIQ A;  2K5P A;  3VR9 B;  1YMH E;  1XCQ L;  2WXP A;  2ZW0 A;  3ZGZ A;  1L0X B;  1J7C A;  2BTE A;  3ZYY X;  1MVK A;  2AQ2 B;  4REZ A;  4DXG A;  1N5W A;  1VZ7 A;  1HXY D;  2VZK D;  1XCT L;  1XEE A;  2DLB A;  3AMZ A;  3ZQ4 A;  3LXF A;  4LLG M;  5BYR A;  1TYG B;  4B0E A;  1SE2 A;  1ZE3 D;  1KRH A;  1V1P A;  1VDV A;  4UDU C;  3BVZ A;  1L6V A;  3NVZ A;  3W5U B;  2LEK A;  2JYT A;  2PW9 A;  5LNK 1;  3ZJV A;  4CQN A;  1EWY C;  1NEK B;  3MHZ A;  3SFD B;  3P4P B;  2WXQ A;  4HRO A;  1T5X D;  1BML C;  1ZDV A;  2IPK D;  5FK9 C;  2J4X A;  3FAH A;  1TS4 A;  4C7Z A;  1SJH D;  3P63 A;  1A70 A;  1XLO A;  3TUO A;  3NRZ A;  2WDV B;  1I4Q A;  3URY A;  1OQR A;  1L6U A;  1WSP A;  4JE3 B;  1M4V A;  1AW7 A;  3KLS X;  1DOX A;  3TEY A;  1QOA A;  2DYO A;  3NVV A;  4ITK A;  4NJC A;  3VRA B;  4YWG G;  3AEA B;  5C2T B;  4L2Y A;  3AE9 B;  3FC4 A;  2EEL A;  1GB1 A;  1L0Y B;  1VLB A;  2RPV A;  4RCO A;  2PVG C;  1E10 A;  1P7F A;  1C78 A;  2WP9 B;  1PGA A;  3AN1 A;  2KAC A;  3FIL A;  1L5P A;  1RM6 C;  1FNW A;  2JXT A;  2ONQ A;  3GS2 A;  1C4P A;  1EU3 A;  3TEZ A;  1E0Z A;  3Q8B A;  4M0W A;  1HEZ E;  1FRD A;  1FNV A;  3I57 A;  4US8 A;  1WRI A;  2WLB A;  1NEN B;  3R8B A;  1T6B X;  3SR6 A;  4OW0 A;  4YT0 B;  1WXQ A;  5D3I B;  1TKE A;  2BS2 B;  1D6E C;  1T3Q A;  1E9M A;  1XF5 L;  2BBC A;  2JZP A;  1I7H A;  2MH7 A;  2V4I B;  5FR3 A;  1ZXI A;  2BYT A;  3W9C B;  1CJE A;  2AX5 A;  5JXV A;  2KWD A;  2OHF A;  1YNT E;  5BYQ A;  5EE0 A;  3B9J A;  2BS4 B;  1K50 A;  1TZO A;  1SE3 A;  3P4R B;  1YN5 A;  3RFZ B;  2BB6 A;  4A8X C;  2INP E;  4ZHO A;  5EE1 A;  2NMQ A;  2JSV X;  3HRD D;  1D5M C;  2KAJ A;  4MAC A;  4IDI A;  1MI0 A;  2M56 B;  3BWU D;  1WGK A;  3BVG A;  4DXF A;  1QQR A;  1HA5 A;  2JU6 X;  1ET6 A;  2WNM A;  1ENF A;  5HG2 A;  4ZHP A;  1V1P B;  3WCQ A;  1PYW D;  2IDY A;  4ZOH C;  3CIR B;  5BYS A;  2Y3A A;  1ACC A;  3AV8 A;  4OZB A;  2GB1 A;  1YQ4 B;  1ET9 A;  4N6E B;  2V3P A;  1TS2 A;  3KWV A;  4US9 A;  3T3N A;  1ZOY B;  4HEA 1;  1K52 A;  3LYY A;  1NVI D;  1N60 A;  1N62 A;  1FXA A;  3IXS A;  1PDX A;  1B9R A;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...