2AL3A

Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
SAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords TUG long isoform
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11470 TUG-UBL1 TUG ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al3A00
4BBNF 1HE8A 1LQBA 4IM2A 2L3ZA 2DYBA 2DAJA 2LD9A 2WWZA 3QC8B 4NPNA 3ZDMC 2DENB 4A3OA 2IO2B 2CHZA 3HK0A 2DYMA 2NPTA 3M63B 1WJNA 3DOWA 3L54A 1WY8A 1V5TA 4W9JA 4EOYA 2C5LC 1T0YA 3R66C 3VQIA 2MP2B 3N3KB 2Z0EB 3VTWA 4LJOB 4CO7A 5EDSA 1V6EA 4IG7B 4G0NB 4J6IA 2L05A 4FHKA 4NQKE 4KIKB 2AEHA 1M94A 2IBIB 3M3JA 2KJ6A 4MGZE 3ZNHB 2GBKA 3PV1A 1NI2A 3NZUA 3VTUA 2NR2A 1SE9A 2DZJA 2JUOA 4A20A 4EKUA 1WZ3A 2JXXA 1UD7A 2K1FA 2KFKB 3PGEA 4IWQA 1TZ1A 2L7RA 3RULA 4M8MA 1V81A 4PYZA 4B9KA 2G3QB 2FIFA 4F1SA 1E5WA 4IWOA 1E8WA 2CHWA 4GXBA 2KD0A 3RT3B 3DBSA 1KOTA 3B08A 2C9WB 3GOEA 2HE7A 3DVGX 1P0RA 1YJ1A 3CSFA 4KVGB 1IYFA 2LGXA 4AP4C 4HVBA 3HHMA 3LDZE 3VFKA 3PRMB 4II3B 1SIFA 1OGWA 2LRWA 2KTRB 3PLVA 3LJ3A 4LDTB 3C0RB 4GDKA 3QAQA 4GMVA 4HPMB 2L8JA 2PE9A 2GOWA 4ASWC 2LASA 3PRPB 4WAAA 2N1WA 1WF9A 4NAWB 3ECIA 3OJ4B 4WJQA 2KTRA 2Y5BB 3WIMA 2JWZA 2IY0B 3KYCD 3VAWA 2CHXA 4K7UA 3IHPC 3TBLD 2O6VB 2MX2A 3UQBA 1K8RB 1YX6B 4AJWA 4MDKE 2LXAA 4I6LB 3H1UA 3AI5A 3PHWB 3DPDA 1Q5WB 4TKNA 3ZKJC 5IAAC 2RR9A 2A4ZA 2K6QA 2KWVB 2ZNVC 2KFKA 2J0JA 3EHVA 2KWCA 1ZKHA 2GMIC 2LRUA 3P2BA 2IO3B 2KXJA 2XK5B 3SU8X 3T8MA 4FJYA 1WE7A 1WR6E 2UWQA 3AU5A 3MJWA 3WAMA 3QX1A 3A1QB 3EFUA 5IA7A 2KMCA 5AZGA 2KJHB 2MA9B 2IY1B 2JRIB 2DHZA 1WX9A 2BWES 4MM3A 1ZGUB 4FN2A 2KX0A 4FULA 3RYTA 2KWUB 1FXTB 1U4AA 3ZRCA 4F7ZA 3NY5A 4DHZB 2N7DA 1WR1A 3S2AA 4G11A 4WWPA 3L13A 5KHOA 2KKCA 4RMAA 2K8CA 2K8HA 1E7VA 4MGYE 3DVNU 4ZDVA 1GUAB 3UGBB 4JL9A 1WGDA 2V3SA 2ZPNA 4EEWA 4EZLA 2KTFA 3D32A 4IM3A 1F9JA 1UELA 2XBBC 2KLGA 3A9JA 4HJKA 2L0FA 1GJZA 4HPLB 4IM0A 2N9EB 4NAWA 1CMXB 2N1VA 5G55A 1YX5B 3RD2A 2N4FA 4CYEA 2WX1A 1WJ4A 3JVZX 3OAWA 3TIXA 3PT2B 5DPTA 3VH3B 4TQ0A 4WWOA 4KZ0A 4HK2A 1XD3B 2LGDA 3KUZA 2KANA 2JVCA 5CTRC 3AU4A 5BO4B 4RM9A 1EF1A 1E8ZA 1S1QB 1D3ZA 3CSTA 4GDLA 2PJHA 2VRRB 1WGGA 1ISNA 4PS8A 2REXA 3ZO5B 4DHJB 5L83A 3UQAA 3HIZA 2DZMA 3W1YA 3QHTA 2EMSA 1WXAA 5DPWA 3A1QA 3QWZB 2L76A 3ZUNA 1XQQA 3Q3JA 2BYEA 3VTVA 3WANA 2DZKA 2MBBB 2MBEA 3L17A 4W9IA 1P98A 3JSVA 1TTNA 2KX3A 2KK8A 2RSUA 1WMHA 1E8YA 1V49A 3NOBA 1J0GA 3ZLZA 4EFOA 5AZHA 1SGHA 4BBNC 3KYDD 1YIWA 5G2NA 2KQ7A 3B1LX 3A33B 5LXIB 2MLBA 1MG8A 1X1MA 3QK0A 4B95A 3PRZA 4BKSA 2MP2A 3UINB 2N7EA 3VH4B 4II2B 4DXAB 1KLVA 4BOZB 3VXWA 1L7YA 4HXDA 4ANVA 2C60A 3VVWB 1JRUA 1WIAA 1WE6A 2ZZPB 2ZPYA 3PREA 3RZWC 1TBEA 3MTNB 3A9KA 4I6NB 4LJPB 3SDLC 2FCQA 3N30A 4MSMB 4FJVB 2FIDA 2KJRA 2PPHA 3NZSA 3H7PB 4DWFA 2KNBA 2J7QB 2ZEQA 3VUWA 1RAXA 3APCA 4K81A 5CHFA 3JYUA 4TV3A 3WAPA 1UBQA 1YQBA 5DPRA 4TUUA 3A4RA 5KHQA 3PLUA 1NDDA 5JH5C 5FR6A 4ICVA 4RM8A 4M0WB 3TMPB 3DBLI 2LXCA 2MRPA 5AZFA 2KDFB 3T9LA 1EO6A 2J0KA 4N9F4 3V6EB 4BKSD 2CU1A 4E71A 3PVLA 5C23A 4FBJB 2C7NB 5LXHA 1WGHA 2AWTA 2JRHA 3ZIMA 3VUYA 3TJPA 3VDZA 1S3SG 4WJOA 4W9KA 1UGMA 2FCNA 2JZZA 4DDGD 3QCAA 3R7QA 2KC1A 2KZRA 3QA8A 3CMMB 4PYUA 2ZJDA 5DPSA 1LFDA 3NHEB 2BKRB 1AARA 5D2MB 4AOFA 5E6NA 1WFYA 2FUHB 3ZTDA 2R2QA 2MCNB 3APFA 2V1YA 3A9KB 2JY6A 3PZDA 4MH0E 5JHBA 4E74A 2LZ6A 2KQSA 1H4RA 3HM6X 2ZVOA 3MHSD 2ZCCA 2D2QA 4MJSA 1EUVB 2EMTA 2MW5A 4KIKA 4P7IA 2OJRA 2OOBB 2DAFA 2R2OA 3ML9A 4PS3A 4EZJA 4IW0A 4FADA 3V61A 2FCMA 2LWPA 1OEYA 3PTFC 1NBFC 2CR5A 2FNJB 2C7HA 3KH0A 4IUMB 3R3MA 2JT4B 3BY4B 2WYQA 3A4SC 4MEMA 1WRDB 2IO0B 1WXMA 4DBGA 2JZ3B 5L95C 4GB9A 3H7SA 5E6OA 2I1JA 2KDBA 4GN1A 3PPAA 4W9DA 1EF5A 4AUQC 3V62A 4BKTA 2K25A 2BF8B 4HCPB 2KVRA 4W9LA 1E7UA 3ZW3A 4IC7B 3WA0A 4URKA 3L08A 1WGRA 2GBRA 1TGZB 4GSWA 4OVVA 4ZYNA 1Q0WB 3M62B 1WGYA 4ANWA 2I1KA 1WJ6A 1WMHB 5LLIA 2M17A 4YL8A 3A9JB 1E8XA 3AXCA 2G4DB 2GBJA 2LJ5A 3NS8A 3U7DA 2IO1B 1WJUA 4IWPA 3K9OB 1VD2A 5CX3A 3ZNID 4W9CA 3UIPB 1WM2A 3IG3A 5C1ZA 3OJ3A 2KO3A 4KDLB 2MQJA 1LXDA 5E6PA 4NNJB 3EC8A 1WX8A 1PQSA 4KV2A 2A5UA 1UBIA 4TQ1A 2NS5A 1R4MI 2O6VD 4FHJA 4BVUC 1C3TA 2D11A 2RD0A 4W9GA 1I42A 1YD8U 4EUTA 1QZEA 5D7GA 2JF5A 3SHQA 3AULA 4DK5A 2AL3A 1ZW7A 4FLHA 4MSQB 4W9HA 5GMVA 4NQLB 2M0XA 2XEWA 2WX0A 4KSLC 4K7WA 1P9DU 2GBNA 2LI5A 2KLCA 4G3XB 4MELA 4DDID 1V86A 3V60A 2BPSA 4HLEA 3ALBA 3BINA 2XK5A 3B0AA 2MBOA 3ML8A 4GU2A 2LVQA 2NCNA 4OVUA 5TR5A 4XZ4A 1V2YA 4HDQA 1KJTA 4GIVA 3I3TB 3TCAA 2DX5B 3R7RA 2DYOA 3JW0X 1WZ0A 2NBWB 2GBMA 3JSVB 1WYWB 2IYDB 2QHOA 3EECA 3QJZA 4JLCA 2ZVNA 3OLMD 3QARA 4AJYB 4K1RB 2O2VA 1RRBA 2NPTB 2AYOB 2KOXA 3V6CB 3N32A 1UZXB 2KDEB 4ZRKA 2KFJA 1WXVA 2NBVB 5DCNA 2LGYA 2O6VA 4JIOU 4NJ6A 1P1AA 2ZNVB 4W9FA 4WWNA 2BKFA 3ZVVA 4HWIB 3UF8A 3ZNGC 2NVUI 2HJ8A 4ICUA 1WXSA 2CS4A 2PE6B 1GC7A 4GDKB 4KSKC 1OQYA 2MWSB 3KUDB 2MBQA 1XT9B 4GOCA 1WM3A 3SD5A 1RFAA 2M1MA 2CKHB 2RGFA 3IFWB 2LVOA 4ZRIA 2DZIA 3DCGA 2BWFA 2UYZB 1BT0A 3RUIB 4LDTD 2G4SA 2RPQA 1V80A 1WI0A 4PS7A 1GG3A 3O65B 1Q1OA 4M8NA 4CHKA 3K9PB 1WX7A 2WDTB 2HTHA 2LUEA 2MSED 4DHZE 2BGFA 3H6NA 2B3AA 3H9DA 2D3GA 4EZKA 4K7SA 4NJ7A 1C1YB 3UIOB 2FCSA 2YVCA 3U30A 3M95A 4NY0A 3RCZA 2NBUA 2K39A 2AL6A 1LM8B 3ZRFA 4AWJA 1VCBA 3CF6E 3KUCB 4F8CB 2N9XA 2K6DB 4KZCA 4BFRA 3ZNZB 3VUXA 5JZEB 1V5OA 5CHWA 1R4NI 1J19A 3HM3A 2YLMA 4A3PA 4E3CA 2G45B 1GNUA 2MBHA 3APDA 1A5RA 2BYFA 2M4NA 4JGHB 2EKEC 4BKGA 5J2RA 3DVGY 5D6JB 3L10B 5J18A 3QQ8B 1IPGA 2D10A 3KVFB 3PS6A 4ZRJA 3WAOA 1WH3A 4WJPA 3X0WA 4XC2A 1OEYJ 3DQVA 3IVFA 4FA6A 2N9PC 3ONSA 2L00B 2J0MA 1P3QU 3PSEB 3ZTCA 4XX5A 2FAZA 4MJSB 3ENEA 5JHAA 3DBHI 4I6PA 3WALA 2V4LA 1E90A 1UH6A 2W9NA 5HKHA 2C7MB 2KN5A 5J17A 4DHJD 2KDIA 3DBRI 4FJZA 4ANUA 4B6WA 1H8CA 3IBEA 3L0WB 2KMAA 3X23A 3GZNI 4ANXA 3TL5A 4LCDE 3QIJA 3PHXB 1L2NA 3DDCB 2KHWB 3U8ZA 2KC2A 3W1SC 1RLFA 1GC6A 3ZDTA 5AEKB 2IZVB 3H7PA 2ZCBA 1I35A 2PEAA 2BYVE 3DVNV 1IP9A 2ASQA 4GDLB 4MGKE 1OTRB 2JPHA 3W1SA 1Z5SB 1Y8RC 3KW5B 1G6JA 2Z0DB 4HDOA 3RZFA 2HD5B 1Z2MA 4KDIC 5D94A 4W9EA 1V9JA 2D07B 3Q3FA 4MGIE 4X57B 2LVPA 3VHTC 5CHVC 2O2VB 3L16A 4G50A 4WJNA 2Z59B 4BOSC 4GGQA 2L0TA 2K8BA 4WQOB 4JQWC 2M8SA 1KM7A 1J8CA 4HCNB
chains in the Genus database with same CATH superfamily
4BBNF 3FILA 1QOGA 4IM2A 4Q2JA 2DYBA 3ZDMC 2DENB 4A3OA 3OG5A 2WDQB 2NPTA 3IXSA 2LGIA 2MJEA 2C5LC 1T0YA 3KQ4A 4NQKE 2PVOD 2KJ6A 3PV1A 3TEYA 1SE9A 2DZJA 4A20A 1UWXA 2R61A 1F0ZA 2KFKB 4BAXA 3P4SB 3TEWA 1E5WA 1E8WA 2KD0A 1YJ1A 1IYFA 3HHMA 3LDZE 2KTRB 3Q14C 4ZHPA 3C0RB 1V97A 3URYA 2PIAA 1UWMA 3PRPB 3I9V1 1GB1A 2N1WA 2D5GA 2V9HA 3ECIA 3NVVA 1FNWA 2Y5BB 2JWZA 3I57A 1BXTA 1YMHE 4AJWA 4MDKE 1UNSA 3H1UA 3PHWB 3I63C 2N7JA 1Q5WB 1I7HA 2K6QA 2ZNVC 2J0JA 2KWCA 2UWQA 1WR6E 1EWYC 3EFUA 1FNUA 5IA7A 2KMCA 4KGTA 2KJHB 1SJED 2MA9B 1L4ZB 3NUHB 1ZGUB 2KX0A 4FULA 3RYTA 2KWUB 1N61A 3S2AA 3HVZA 4ZDVA 1ZUD2 1I4HA 4JL9A 1GOZA 3AE8B 3D32A 4BZAA 1SE3A 2KLGA 2MJDA 2N9EB 2UU7A 4NAWA 4RFBA 2G1EA 2WX1A 4TQ0A 3B2GA 2WQYB 4HK2A 1XD3B 1E7PB 2Y5PA 4DQOC 4AQ7A 2VRRB 3I5JC 1WGGA 1HZ6A 5L83A 4WAFA 1JW9D 2DZMA 1AW7A 3R2IA 3A1QA 3UI3A 3QWZB 2BYEA 1N62A 3VTVA 1GB4A 2MBEA 3OWEB 5D3IB 1TTNA 2RSUA 3Q8AA 3AE6B 3N20C 1E8YA 5H8YE 5AZHA 4BBNC 3VRBB 3B1LX 5LXIB 2MLBA 1MG8A 3TEXA 1FIQA 2DWQA 3UINB 1NVID 2MEKA 3Q6BA 2JZPA 1WIAA 2ZZPB 1EWCA 4LJPB 1HEZE 2KJRA 2J7QB 1C4CA 3VUWA 4K81A 1Q10A 2OEDA 5KHQA 1NDDA 5BMHA 1EO6A 2Y5CA 2IDYA 3LXFA 4ZRQA 4LNOA 4OZBA 4W9KA 1UGMA 2FCNA 4WJOA 1FFUA 4DDGD 3DHIC 2ZJDA 1FRRA 2BKRB 5D2MB 4ZOHC 3ZTDA 2R2QA 3A9KB 2CJOA 4E74A 4A55A 3VR8B 2KQSA 1H4RA 3MHSD 2ZVOA 2W54A 2ZCCA 1EUVB 2EMTA 4KIKA 3SFDB 2OJRA 3BWUD 4WQMA 4A90A 4PS3A 4EZJA 4IW0A 4FADA 3PTFC 4IUMB 3BVGA 3R3MA 1ZDXA 1ZE3D 2IGDA 2WYQA 3ZJVA 1WXMA 3H7SA 2D3CA 1VZ6A 1P7EA 1JROA 4M02A 2PTLA 2DNFA 1TKEA 2BF8B 5MPOA 4IC7B 4JE3B 2LHEA 4OVVA 5HFYA 4ZYNA 1Q0WB 2I2YA 1C78A 1J7CA 1MPEA 1E8XA 4M01A 3MC8A 4P16A 5HG2A 4IWPA 3K9OB 5CX3A 3BVZA 3UIPB 1TT5B 1YNTE 2K9XA 3AV8A 1LXDA 5E6PA 4NNJB 4DXFA 1UBIA 1R4MI 2O6VD 1C3TA 3WCQA 2RD0A 2JWUA 5D7GA 1SEBD 2MHJA 1F1HA 3SHQA 3RNBC 3Q3OC 2M0XA 1C76A 1TJEA 2ONQA 2GBNA 4MELA 2KWDA 2W82A 4C7YA 4GU2A 2QCZA 2J4XA 1V2YA 3TCAA 2DX5B 1M4VA 4XYCA 3IAS1 4OHJA 2LMCA 1JCKB 3OLMD 3MJ5A 2BS3B 3DHGC 2AYOB 1WXVA 4OZAA 2Q5WD 3VRAB 3UF8A 2NVUI 3IT4B 3DBRB 2CS4A 1OQYA 2MWSB 5FK9C 2MBQA 3J9CA 4GOCA 2CKHB 2RGFA 2BWFA 1BT0A 1MHXA 3RUIB 3FKYA 4CHKA 4M8NA 1KFYB 2HTHA 2MSED 4EZKA 3H6NA 2D3GA 3BYTB 4K7SA 4NJ7A 3UIOB 1PGXA 4RGOS 3SR6A 1VLBA 2CU3A 3U30A 3M95A 1K51A 2PKOA 1FCLA 2I38A 5EE1A 3CF6E 4HJGE 3P4RB 3ZNZB 1R4NI 1J19A 3APDA 5J18A 1IPGA 3PS6A 3U4EG 1WH3A 4XC2A 2KQ4X 3MC0B 2N9PC 3ZTCA 2L00B 4XX5A 3FAHA 3ENEA 4I6PA 1GPXA 2W9NA 2MJ3A 2C7MB 2KN5A 5J17A 4DHJD 1WGKA 2J42A 2KMAA 4ANXA 2BT6A 4ARIA 3PHXB 3U8ZA 4C7ZA 2N0SB 5JXVA 3W1SC 5AEKB 2IZVB 2ZCBA 2V3NA 3KWVA 1HTQA 4D2KA 3KW5B 1G6JA 2EELA 2WXHA 3RZFA 5D94A 4KDIC 4X57B 1VR9A 2L32A 4WJNA 4L2YA 2FBWB 2M8SA 2WNMA 3RI7C 1HE8A 3KLSX 3AE7B 2H88B 3QC8B 2IO2B 1XEEA 1WY8A 1V5TA 4EOYA 1TS3A 3R66C 2MP2B 3N3KB 5IKCM 5EDSA 4IG7B 4G0NB 4KIKB 2L83A 2AEHA 1TKYA 2Z8LA 2GBKA 1NI2A 1N5XA 5HI1A 2JUOA 2CJNA 4EKUA 2K1FA 1V81A 2G3QB 1FCCC 4NZLB 5E6JA 2X38A 3RT3B 3DBSA 3VR9B 1KOTA 2C9WB 2LGXA 4HVBA 3VFKA 3PRMB 4II3B 3PLVA 2LRWA 3LJ3A 4LDTB 1BMLC 4US8A 2L8JA 2PE9A 4CQNA 4ASWC 1ZXHA 2LASA 3TEZA 4WAAA 1WF9A 4WJQA 2IY0B 4YSZB 1CJEA 4RNAA 2O6VB 4REZA 2MX2A 1K8RB 1ZOYB 3DPDA 1I4QA 2IPKD 3ZKJC 2RR9A 2A4ZA 3EHVA 2LRUA 2GMIC 3SU8X 2KXJA 3MJWA 2E3TA 3AU5A 3PO0A 4JX1C 3W2DA 2INNE 2IY1B 1L4DB 1WX9A 2BWES 4MM3A 1XLOA 1FXTB 4O1NA 2N7DA 1QQRA 1D4BA 3L13A 5KHOA 4RMAA 1ZDVA 3EGRA 3RMKC 2KMMA 3BZDB 1QLBB 5G5HA 1WGDA 4EEWA 2BB6A 4OW0A 2KTFA 3P63A 2Y3AA 1GJZA 4HPLB 4IM0A 1AWDA 3RD2A 5G55A 3OAWA 3VH3B 3PT2B 4IDIA 3RNFC 1R4MB 2KANA 4GDLA 2JXTA 3GS2A 1ISNA 2REXA 4DHJB 3HIZA 2KYWA 1WXAA 1SXTA 3R2TA 1ENFA 2LFIA 4JPSA 1C4PA 1L0VB 3AEGB 1B1ZA 1KTKA 3ZLZA 4HKQA 1N5WA 3GE3C 3KYDD 1YIWA 3AE5B 1V1PA 3PZ7A 2N7EA 3VH4B 3HRDD 4BOZB 1RYJA 4WWMA 1KF6B 1L7YA 2WXMA 3VVWB 5IP4D 4HPPA 3A9KA 2FCQA 4FJVB 2FIDA 4B0EA 2KNBA 3AE1B 1RAXA 5CHFA 5DPRA 1T0QC 4ICVA 4RM8A 3Q3NC 4M0WB 1Y56A 1XLNA 5C2TB 1ET6A 1T3QA 2JRHA 3VDZA 1S3SG 1VDVA 2JZZA 3R7QA 2KC1A 1IBXA 2PVGC 4N59A 1E10A 1CQVA 4AOFA 4XWTA 3NVZA 4C4VA 3Q8FA 5IOIA 3PZDA 5JHBA 2JY6A 2BW2A 4RF0A 4HKZE 2LZ6A 3HM6X 2JYEA 2OOBB 1XLPA 3DHHC 4XE0A 1L6UA 4US9A 2FCMA 3BYYB 2ZW0A 1C77A 4MEMA 4R3DA 3A4SC 1WRDB 2JYTA 4YSXB 5IN7A 3AB5A 4DBGA 1OFFA 2ICIA 1FO4A 4W9DA 1T0RC 2K5PA 1EF5A 3V62A 5EE0A 5FKAC 4URKA 4GSWA 3CWIA 4OVZA 1L5PA 4ACFA 2PW9A 3M62B 1I4GA 1ESFA 3A9JB 2WXRA 2GBJA 3NS8A 1JWSD 3LB8C 1E0ZA 4RGMA 1XLQA 2KO3A 4QAYA 2DBYA 1MG4A 2A5UA 4W9GA 4L1BA 1QZEA 3AULA 4MSQB 4W9HA 1ZW7A 3ZGZA 2KAJA 4K7WA 2QEJC 1F77A 1AN8A 1CZPA 4G3XB 4DDID 4HLEA 3ALBA 3BINA 2XK5A 3B0AA 2AX5A 2LVQA 2NCNA 2W3SA 1KJTA 3AE2B 3RNAC 1ZPSA 4HROA 2XN9C 1WYWB 3EECA 4JLCA 1N6ZA 1GAQB 4AJYB 2O2VA 1STEA 2W55A 3V6CB 1FXAA 3Q8CA 2KFJA 2NBVB 4FXCA 4LNFA 1JRPA 3FILB 1P1AA 3GZNB 3NRZA 2BKFA 4HWIB 2HJ8A 1WXSA 2PE6B 1GC7A 3NS1A 2M0AA 3KUDB 5D3DA 1WM3A 2M1MA 1EM7A 3DCGA 4JWUC 1CK1A 1JWAD 1WI0A 1SSNA 3AE3B 4DHZE 2BGFA 1SJHD 4M0WA 2FCSA 2YVCA 4B0MA 2K39A 1R4NB 2AL6A 3ZRFA 4AWJA 1VCBA 3KUCB 4F8CB 4KZCA 1BUIC 1FM0D 1QOBA 3HM3A 1XCQL 2YLMA 1KRHA 2MBHA 3RNEC 1DYQA 2BYFA 1NI3A 2M4NA 2EKEC 5D6JB 3L10B 3QQ8B 3W9CB 4RF1A 1P3QU 2XNAC 1QOFA 3P4QB 5JHAA 3DBHI 3WALA 1SBBB 4FJZA 4B6WA 3FC4A 3MC9A 1H8CA 3IBEA 2WXJA 3L0WB 3AE4B 3H8HA 3L4PA 1HZ5A 1N60A 1RFKA 1GC6A 4A8XC 1I35A 3AECB 2BYVE 2J53A 1Z2MA 1V9JA 3C19A 2LVPA 5CHVC 4BOSC 2K8BA 4JQWC 1J8CA 4HCNB 2L3ZA 2DAJA 2LD9A 1P7FA 3M63B 2DYMA 3DOWA 3L54A 3R8BA 2WGSA 3IAM1 1QOAA 1D6EC 3EA6A 4FHKA 1LGRA 2WXLA 1M94A 2IBIB 2YEPF 4MGZE 2M56B 3NZUA 4YXDB 2NR2A 4ZRPA 1QKZA 2N9LA 2D3BA 1UD7A 3PGEA 4IWQA 4YT0B 2L7RA 1QT9A 4F1SA 5BYQA 3MHZA 4GXBA 1DOYA 2KVZA 3PZ8A 3GOEA 2HE7A 3DVGX 3CSFA 2SAKA 4AP4C 2VZKD 3E9SA 4XWWA 1OGWA 1SIFA 2VH2A 3C8YA 2VH1A 3AEFB 4GDKA 4GMVA 4HPMB 5I4DA 2GOWA 3CIRB 2WXKA 4A6QA 4NAWB 2JU6X 3OJ4B 2KTRA 1K52A 1C9FA 4NAMA 2HTME 1YX6B 2LXAA 4I6LB 3AI5A 2KWVB 2GB1A 1ZKHA 2IO3B 4MACA 1WE7A 3WAMA 3QX1A 3A1QB 4A9AA 1WSPA 4KX6B 4LNKA 2DHZA 4FN2A 3ZRCA 1U4AA 1I4PA 3NY5A 4DHZB 1WR1A 1ACCA 1SE2A 4G11A 4WWPA 2BYTA 1HXYD 3Q8EA 2TSSA 2KKCA 2K8HA 3DVNU 3DWGC 1SIJA 4IM3A 1UELA 4HJKA 3AM9A 3NVWA 1TYGB 1CMXB 1PUTA 2N1VA 1YX5B 2MH7A 2N4FA 3JVZX 3TIXA 4WURA 2LGDA 3KUZA 1KLUD 3AU4A 3SFEB 5BO4B 2QJLA 3TSSA 2M19A 1EF1A 1E8ZA 1S1QB 3CSTA 2PJHA 1JWBD 4PS8A 1HTOA 3W1YA 2EMSA 2L76A 1ROEA 3ZUNA 1R7SA 1XQQA 3Q3JA 4RH6A 3WANA 1RWSA 3L17A 4W9IA 1PYWD 4C00A 4IOIE 2KK8A 3NOBA 1J0GA 1YJJA 5LNK1 3NJTA 5G2NA 2KQ7A 4B95A 2V4IB 3PRZA 4BKSA 4DXAB 4LLGM 5BYSA 3VXWA 2FE8A 5AUIA 4ANVA 2C60A 1JRUA 3ABVB 3RZWC 4P6VF 2QILA 2AQ3B 3N30A 1IGDA 1FNVA 3NZSA 4MT5A 3H7PB 1YQ4B 4N58A 4DWFA 1F2RI 2WXOA 4YTNB 3APCA 4TV3A 1UBQA 2K3UA 1YQBA 4TUUA 3PLUA 5JH5C 5FR6A 5BMIA 2LXCA 5C3JB 3T9LA 3HUIA 2J0KA 4N9F4 4BKSD 4FBJB 3PVLA 4PT5A 2OHFA 1WGHA 2AWTA 3QCAA 2WU2B 1YN5A 3QA8A 3CMMB 4PYUA 3NHEB 1AARA 5E6NA 1V1PB 1JALA 1WFYA 4KKIA 3B9JA 3RNCC 1L6VA 2VZKB 2INCC 2D2QA 5BYRA 2MW5A 4P7IA 2DAFA 2INPE 3ML9A 2NMQA 1OEYA 1L0XB 1N63A 1NBFC 3ZYYX 1XF5L 3BY4B 3AH7A 2IO0B 2JZ3B 5L95C 2I1JA 1YN3A 4GN1A 1YJIA 3PPAA 2SEBD 4AUQC 4LK0M 4BKTA 2KVRA 4W9LA 3L08A 2GBRA 1TGZB 1TS4A 1WGYA 1D5ZC 2K0PA 3BIID 1WJ6A 1WMHB 1JMLA 4RGNA 3AXCA 1FEHA 2G4DB 2LJ5A 3U7DA 1K50A 5C1ZA 3OJ3A 4USAA 4C80A 2B76B 2MQJA 2X8XX 3U7ZA 4TQ1A 1WWTA 3BVMA 4BVUC 2D11A 1I42A 1MHHE 1YD8U 2WU5B 4EUTA 2JF5A 4DK5A 2AL3A 2K22A 5GMVA 2LGSA 3MFGA 2XEWA 4KSLC 2FUG1 2WXQA 2LI5A 3BK2A 3MP9A 2WP9B 1EU4A 2MBOA 5TR5A 4HDQA 2KACA 3I3TB 3T3NA 3JW0X 1WZ0A 2AQ1B 2NBWB 2GBMA 3GE8C 2HJ1A 1YOVB 2NPTB 1QF6A 1UZXB 2KDEB 4ZRKA 4H2AA 3AEEB 2PMVA 1V8CA 2WDVB 2LGYA 2O6VA 4NJ6A 4KGSA 2ZNVB 4RCOA 1FMAD 4WWNA 3U52E 3ZVVA 3AEBB 3E56A 4KSKC 1NYQA 1XT9B 3SD5A 3DBHB 4TMAB 1L0YB 2LVOA 1SF0A 2WS3B 2DZIA 2UYZB 5G5GA 4LDTD 1V80A 3GP7A 3O65B 3SEBA 4AS1A 1WX7A 2WDTB 2LUEA 2B3AA 3ZJTA 3B2FA 1ZP0B 2RPVA 4YSYB 2BS4B 4NY0A 3RCZA 1LM8B 4S17A 4HRSA 2N9XA 2K6DB 4BFRA 5JZEB 2WXPA 1WXQA 1V5OA 3IT6B 4MH8A 5CHWA 4LNNA 4E3CA 2G45B 1GNUA 4ARCA 5J2RA 2HDEA 1T0SC 1SB3C 1MJDA 1FRDA 2D10A 2LHDA 4WJPA 3Q69A 3X0WA 1OEYJ 3DQVA 3IVFA 3ONSA 2J0MA 2FAZA 1FD6A 1LO5D 1JQ4A 1UH6A 4WIPA 4XDDA 5HKHA 2KDIA 3DBRI 4ANUA 2JQRB 4NJCA 1OQRA 3TL5A 3QIJA 1L2NA 3DWMA 2KC2A 1RLFA 3ZDTA 2D3AA 3H7PA 2PEAA 3DVNV 4GDLB 1OTRB 3P1MA 1Z5SB 1Y8RC 2Z0DB 4HDOA 2D07B 4MGIE 3VHTC 1TS2A 3TUOA 3L16A 5T8IA 1J7BA 4GGQA 1C79A 3AMZA 2H89B 1KM7A 2YEPB 2IGHA 1LQBA 1YN4A 2WWZA 4NPNA 3AEDB 2CHZA 3HK0A 1WJNA 4W9JA 1KLGD 3VQIA 3ETRA 4YTMB 2Z0EB 3VTWA 1E6EB 4LJOB 4CO7A 1V6EA 2L52A 4J6IA 2L05A 3P42A 3M3JA 3ZNHB 4S0RA 1E9MA 1FFVA 3VTUA 2IGGA 1WZ3A 1D5XC 2JXXA 1TZ1A 3RULA 4M8MA 4PYZA 4B9KA 2FIFA 4IWOA 2CHWA 4C4VB 3B08A 2JSVX 4XDCA 1P0RA 3T3OA 4KVGB 1FPYA 2NTTA 2QIEB 4LTUA 3NVYA 3QAQA 1MFWA 1NEKB 3EUB2 3WIMA 1TS5A 3KYCD 3VAWA 2CHXA 2KDMA 3IHPC 4K7UA 3TBLD 3KWLA 2EKIA 5GXGB 3UQBA 1A70A 3W5VB 4TKNA 5IAAC 2LJIA 2KFKA 4IKGA 3DBLB 2WHIA 3P2BA 3T8MA 2XK5B 5H92C 4FJYA 1QILA 2BB5A 5AZGA 3N1YC 2JRIB 2PLPA 4F7ZA 1PDXA 2WLBA 4MM3B 2K8CA 1E7VA 4MGYE 1GUAB 3UGBB 2V3SA 2ZPNA 5EE9A 4EZLA 4KKJA 1F9JA 2XBBC 3RN9C 1ZXIA 3A9JA 2L0FA 4CYEA 4N6EB 1IGCA 1WJ4A 5DPTA 4WWOA 4KZ0A 2BTEA 1DGJA 1F52A 1UF0A 2V3PA 2JVCA 5CTRC 4RM9A 3AEAB 1D3ZA 3RPFC 3W5UB 2RDBC 1V1OA 2WDRB 3ZO5B 1I4RA 3UQAA 3QHTA 5DPWA 4EE2A 2DZKA 2MBBB 3ZQ4A 1P98A 3JSVA 1TY0A 2KX3A 1WMHA 1OQQA 1KH0A 1V49A 1VRAB 4M00A 4EFOA 1SGHA 3N1ZC 3A33B 4J3OD 1X1MA 1D5MC 3QK0A 2INDC 1XO3A 2MP2A 1KLVA 4II2B 5EE3A 2N9KA 4RGTA 2WXFA 2ACZB 4HXDA 3HVDA 3PREA 1WE6A 2ZPYA 2ON8A 1J7AA 1TBEA 3MTNB 4I6NB 3SDLC 3N1XC 4MSMB 2QMTA 2PPHA 1C4AA 5IO9A 2ZEQA 3ZXVA 3JYUA 3WAPA 2WXIA 3A4RA 3TMPB 3DBLI 2MRPA 5AZFA 3V05A 2L1AA 2KDFB 2GLSA 3V6EB 2CU1A 4JWSC 3V3XA 2QDFA 5C23A 4E71A 2C7NB 5LXHA 4C56C 3RNGC 1XXGA 2RDGA 3TJPA 3VUYA 3ZIMA 2KZRA 3LYYA 1JWMD 5DPSA 1LFDA 2RDHA 1K53A 2FUHB 2MCNB 3APFA 2V1YA 4MH0E 4YWGG 3Q2AC 4MJSA 1DOXA 4P1BC 2R2OA 3GB1A 1VJKA 5BMGA 1ET9A 2JX5A 3V61A 2LWPA 2CR5A 2FNJB 2C7HA 3KH0A 4DXGA 4K3BA 4HEA1 2JT4B 3N9YC 1TIFA 1JWUD 4GB9A 1MVKA 5E6OA 2G9HD 2KDBA 4TSSA 2QC8A 2DLBA 5TSSA 2K25A 3NG0A 4HCPB 1E7UA 3ZW3A 3WA0A 1WGRA 1F2RC 1WYGA 2BBCA 3AE9B 4ANWA 2I1KA 5AUKA 2NTSA 4OZCA 5LLIA 2M17A 4YL8A 2IO1B 1WJUA 1VD2A 3ZNID 4W9CA 1WM2A 3IG3A 4P1CC 4XGAB 4KGRA 2E6XA 4KDLB 3EC8A 3ZXRA 1WX8A 1PQSA 4KV2A 1NYRA 2NS5A 1DOIA 4FHJA 1MI0A 4L23A 2RMMA 4ITKA 1HQRD 4UDUC 4FLHA 1I4XA 2BS2B 4NQLB 3Q3MC 2WX0A 1P9DU 2KLCA 1XCTL 4YTPB 1V86A 3V60A 2BPSA 4K3CA 3BK1A 3Q8BA 3ML8A 4OVUA 4XZ4A 3U2SC 4GIVA 4ZYSA 3R7RA 2V0GA 1HA5A 4ZHOA 1B9RA 2DYOA 1AYFA 1TY2A 3JSVB 1FXIA 1VZ8A 2IYDB 2QHOA 3QJZA 3P4PB 2ZVNA 3QARA 2LUMA 4K1RB 1RRBA 2GRIA 2IJ0A 1PGBA 2OJWA 4WH4A 2KOXA 3N32A 5DCNA 4JIOU 2BQQA 4W9FA 3ZNGC 2KN4A 4ICUA 4GDKB 1RFAA 3IFWB 4ZRIA 3RFZB 2AQ2B 2G4SA 2RPQA 2W3RA 4PS7A 1GG3A 5FR3A 1Q1OA 1NENB 3K9PB 3H9DA 1C1YB 3NZ3A 1T5XD 1UGJA 1SE4A 1YQ3B 2NBUA 3O13A 1PGAA 2GI9A 3VUXA 4LNIA 1IUEA 4A3PA 1EU3A 5HHDG 4GLSC 1A5RA 4JGHB 2WXNA 4BKGA 3DVGY 4ZRJA 3WAOA 3KVFB 1PFDA 1VZ7A 1RM6C 1IBXB 4FA6A 3PSEB 2KT7A 1TZOA 4PK1A 1UUPA 4MJSB 2V4LA 1E90A 2J52A 2WXGA 3X23A 3GZNI 1T6BX 4LCDE 3DDCB 2KHWB 2ZW1A 3ZJUA 1TKGA 1IP9A 2ASQA 4MGKE 2JPHA 2LEKA 3W1SA 2HD5B 1WRIA 4W9EA 3Q3FA 2BVCA 3EFCA 2O2VB 4G50A 2QSDA 2Z59B 2L0TA 3AN1A 4WQOB
chains in the Genus database with same CATH topology
4BBNF 1HE8A 1LQBA 4IM2A 2L3ZA 2DYBA 2DAJA 2LD9A 2WWZA 3QC8B 4NPNA 3ZDMC 2DENB 4A3OA 2IO2B 2CHZA 3HK0A 2DYMA 2NPTA 3M63B 1WJNA 3DOWA 3L54A 1WY8A 1V5TA 4W9JA 4EOYA 2C5LC 1T0YA 3R66C 3VQIA 2MP2B 3N3KB 2Z0EB 3VTWA 4LJOB 4CO7A 5EDSA 1V6EA 4IG7B 4G0NB 4J6IA 2L05A 4FHKA 4NQKE 4KIKB 2AEHA 1M94A 2IBIB 3M3JA 2KJ6A 4MGZE 3ZNHB 2GBKA 3PV1A 1NI2A 3NZUA 3VTUA 2NR2A 1SE9A 2DZJA 2JUOA 4A20A 4EKUA 1WZ3A 2JXXA 1UD7A 2K1FA 2KFKB 3PGEA 4IWQA 1TZ1A 2L7RA 3RULA 4M8MA 1V81A 4PYZA 4B9KA 2G3QB 2FIFA 4F1SA 1E5WA 4IWOA 1E8WA 2CHWA 4GXBA 2KD0A 3RT3B 3DBSA 1KOTA 3B08A 2C9WB 3GOEA 2HE7A 3DVGX 1P0RA 1YJ1A 3CSFA 4KVGB 1IYFA 2LGXA 4AP4C 4HVBA 3HHMA 3LDZE 3VFKA 3PRMB 4II3B 1SIFA 1OGWA 2LRWA 2KTRB 3PLVA 3LJ3A 4LDTB 3C0RB 4GDKA 3QAQA 4GMVA 4HPMB 2L8JA 2PE9A 2GOWA 4ASWC 2LASA 3PRPB 4WAAA 2N1WA 1WF9A 4NAWB 3ECIA 3OJ4B 4WJQA 2KTRA 2Y5BB 3WIMA 2JWZA 2IY0B 3KYCD 3VAWA 2CHXA 4K7UA 3IHPC 3TBLD 2O6VB 2MX2A 3UQBA 1K8RB 1YX6B 4AJWA 4MDKE 2LXAA 4I6LB 3H1UA 3AI5A 3PHWB 3DPDA 1Q5WB 4TKNA 3ZKJC 5IAAC 2RR9A 2A4ZA 2K6QA 2KWVB 2ZNVC 2KFKA 2J0JA 3EHVA 2KWCA 1ZKHA 2GMIC 2LRUA 3P2BA 2IO3B 2KXJA 2XK5B 3SU8X 3T8MA 4FJYA 1WE7A 1WR6E 2UWQA 3AU5A 3MJWA 3WAMA 3QX1A 3A1QB 3EFUA 5IA7A 2KMCA 5AZGA 2KJHB 2MA9B 2IY1B 2JRIB 2DHZA 1WX9A 2BWES 4MM3A 1ZGUB 4FN2A 2KX0A 4FULA 3RYTA 2KWUB 1FXTB 1U4AA 3ZRCA 4F7ZA 3NY5A 4DHZB 2N7DA 1WR1A 3S2AA 4G11A 4WWPA 3L13A 5KHOA 2KKCA 4RMAA 2K8CA 2K8HA 1E7VA 4MGYE 3DVNU 4ZDVA 1GUAB 3UGBB 4JL9A 1WGDA 2V3SA 2ZPNA 4EEWA 4EZLA 2KTFA 3D32A 4IM3A 1F9JA 1UELA 2XBBC 2KLGA 3A9JA 4HJKA 2L0FA 1GJZA 4HPLB 4IM0A 2N9EB 4NAWA 1CMXB 2N1VA 5G55A 1YX5B 3RD2A 2N4FA 4CYEA 2WX1A 1WJ4A 3JVZX 3OAWA 3TIXA 3PT2B 5DPTA 3VH3B 4TQ0A 4WWOA 4KZ0A 4HK2A 1XD3B 2LGDA 3KUZA 2KANA 2JVCA 5CTRC 3AU4A 5BO4B 4RM9A 1EF1A 1E8ZA 1S1QB 1D3ZA 3CSTA 4GDLA 2PJHA 2VRRB 1WGGA 1ISNA 4PS8A 2REXA 3ZO5B 4DHJB 5L83A 3UQAA 3HIZA 2DZMA 3W1YA 3QHTA 2EMSA 1WXAA 5DPWA 3A1QA 3QWZB 2L76A 3ZUNA 1XQQA 3Q3JA 2BYEA 3VTVA 3WANA 2DZKA 2MBBB 2MBEA 3L17A 4W9IA 1P98A 3JSVA 1TTNA 2KX3A 2KK8A 2RSUA 1WMHA 1E8YA 1V49A 3NOBA 1J0GA 3ZLZA 4EFOA 5AZHA 1SGHA 4BBNC 3KYDD 1YIWA 5G2NA 2KQ7A 3B1LX 3A33B 5LXIB 2MLBA 1MG8A 1X1MA 3QK0A 4B95A 3PRZA 4BKSA 2MP2A 3UINB 2N7EA 3VH4B 4II2B 4DXAB 1KLVA 4BOZB 3VXWA 1L7YA 4HXDA 4ANVA 2C60A 3VVWB 1JRUA 1WIAA 1WE6A 2ZZPB 2ZPYA 3PREA 3RZWC 1TBEA 3MTNB 3A9KA 4I6NB 4LJPB 3SDLC 2FCQA 3N30A 4MSMB 4FJVB 2FIDA 2KJRA 2PPHA 3NZSA 3H7PB 4DWFA 2KNBA 2J7QB 2ZEQA 3VUWA 1RAXA 3APCA 4K81A 5CHFA 3JYUA 4TV3A 3WAPA 1UBQA 1YQBA 5DPRA 4TUUA 3A4RA 5KHQA 3PLUA 1NDDA 5JH5C 5FR6A 4ICVA 4RM8A 4M0WB 3TMPB 3DBLI 2LXCA 2MRPA 5AZFA 2KDFB 3T9LA 1EO6A 2J0KA 4N9F4 3V6EB 4BKSD 2CU1A 4E71A 3PVLA 5C23A 4FBJB 2C7NB 5LXHA 1WGHA 2AWTA 2JRHA 3ZIMA 3VUYA 3TJPA 3VDZA 1S3SG 4WJOA 4W9KA 1UGMA 2FCNA 2JZZA 4DDGD 3QCAA 3R7QA 2KC1A 2KZRA 3QA8A 3CMMB 4PYUA 2ZJDA 5DPSA 1LFDA 3NHEB 2BKRB 1AARA 5D2MB 4AOFA 5E6NA 1WFYA 2FUHB 3ZTDA 2R2QA 2MCNB 3APFA 2V1YA 3A9KB 2JY6A 3PZDA 4MH0E 5JHBA 4E74A 2LZ6A 2KQSA 1H4RA 3HM6X 2ZVOA 3MHSD 2ZCCA 2D2QA 4MJSA 1EUVB 2EMTA 2MW5A 4KIKA 4P7IA 2OJRA 2OOBB 2DAFA 2R2OA 3ML9A 4PS3A 4EZJA 4IW0A 4FADA 3V61A 2FCMA 2LWPA 1OEYA 3PTFC 1NBFC 2CR5A 2FNJB 2C7HA 3KH0A 4IUMB 3R3MA 2JT4B 3BY4B 2WYQA 3A4SC 4MEMA 1WRDB 2IO0B 1WXMA 4DBGA 2JZ3B 5L95C 4GB9A 3H7SA 5E6OA 2I1JA 2KDBA 4GN1A 3PPAA 4W9DA 1EF5A 4AUQC 3V62A 4BKTA 2K25A 2BF8B 4HCPB 2KVRA 4W9LA 1E7UA 3ZW3A 4IC7B 3WA0A 4URKA 3L08A 1WGRA 2GBRA 1TGZB 4GSWA 4OVVA 4ZYNA 1Q0WB 3M62B 1WGYA 4ANWA 2I1KA 1WJ6A 1WMHB 5LLIA 2M17A 4YL8A 3A9JB 1E8XA 3AXCA 2G4DB 2GBJA 2LJ5A 3NS8A 3U7DA 2IO1B 1WJUA 4IWPA 3K9OB 1VD2A 5CX3A 3ZNID 4W9CA 3UIPB 1WM2A 3IG3A 5C1ZA 3OJ3A 2KO3A 4KDLB 2MQJA 1LXDA 5E6PA 4NNJB 3EC8A 1WX8A 1PQSA 4KV2A 2A5UA 1UBIA 4TQ1A 2NS5A 1R4MI 2O6VD 4FHJA 4BVUC 1C3TA 2D11A 2RD0A 4W9GA 1I42A 1YD8U 4EUTA 1QZEA 5D7GA 2JF5A 3SHQA 3AULA 4DK5A 2AL3A 1ZW7A 4FLHA 4MSQB 4W9HA 5GMVA 4NQLB 2M0XA 2XEWA 2WX0A 4KSLC 4K7WA 1P9DU 2GBNA 2LI5A 2KLCA 4G3XB 4MELA 4DDID 1V86A 3V60A 2BPSA 4HLEA 3ALBA 3BINA 2XK5A 3B0AA 2MBOA 3ML8A 4GU2A 2LVQA 2NCNA 4OVUA 5TR5A 4XZ4A 1V2YA 4HDQA 1KJTA 4GIVA 3I3TB 3TCAA 2DX5B 3R7RA 2DYOA 3JW0X 1WZ0A 2NBWB 2GBMA 3JSVB 1WYWB 2IYDB 2QHOA 3EECA 3QJZA 4JLCA 2ZVNA 3OLMD 3QARA 4AJYB 4K1RB 2O2VA 1RRBA 2NPTB 2AYOB 2KOXA 3V6CB 3N32A 1UZXB 2KDEB 4ZRKA 2KFJA 1WXVA 2NBVB 5DCNA 2LGYA 2O6VA 4JIOU 4NJ6A 1P1AA 2ZNVB 4W9FA 4WWNA 2BKFA 3ZVVA 4HWIB 3UF8A 3ZNGC 2NVUI 2HJ8A 4ICUA 1WXSA 2CS4A 2PE6B 1GC7A 4GDKB 4KSKC 1OQYA 2MWSB 3KUDB 2MBQA 1XT9B 4GOCA 1WM3A 3SD5A 1RFAA 2M1MA 2CKHB 2RGFA 3IFWB 2LVOA 4ZRIA 2DZIA 3DCGA 2BWFA 2UYZB 1BT0A 3RUIB 4LDTD 2G4SA 2RPQA 1V80A 1WI0A 4PS7A 1GG3A 3O65B 1Q1OA 4M8NA 4CHKA 3K9PB 1WX7A 2WDTB 2HTHA 2LUEA 2MSED 4DHZE 2BGFA 3H6NA 2B3AA 3H9DA 2D3GA 4EZKA 4K7SA 4NJ7A 1C1YB 3UIOB 2FCSA 2YVCA 3U30A 3M95A 4NY0A 3RCZA 2NBUA 2K39A 2AL6A 1LM8B 3ZRFA 4AWJA 1VCBA 3CF6E 3KUCB 4F8CB 2N9XA 2K6DB 4KZCA 4BFRA 3ZNZB 3VUXA 5JZEB 1V5OA 5CHWA 1R4NI 1J19A 3HM3A 2YLMA 4A3PA 4E3CA 2G45B 1GNUA 2MBHA 3APDA 1A5RA 2BYFA 2M4NA 4JGHB 2EKEC 4BKGA 5J2RA 3DVGY 5D6JB 3L10B 5J18A 3QQ8B 1IPGA 2D10A 3KVFB 3PS6A 4ZRJA 3WAOA 1WH3A 4WJPA 3X0WA 4XC2A 1OEYJ 3DQVA 3IVFA 4FA6A 2N9PC 3ONSA 2L00B 2J0MA 1P3QU 3PSEB 3ZTCA 4XX5A 2FAZA 4MJSB 3ENEA 5JHAA 3DBHI 4I6PA 3WALA 2V4LA 1E90A 1UH6A 2W9NA 5HKHA 2C7MB 2KN5A 5J17A 4DHJD 2KDIA 3DBRI 4FJZA 4ANUA 4B6WA 1H8CA 3IBEA 3L0WB 2KMAA 3X23A 3GZNI 4ANXA 3TL5A 4LCDE 3QIJA 3PHXB 1L2NA 3DDCB 2KHWB 3U8ZA 2KC2A 3W1SC 1RLFA 1GC6A 3ZDTA 5AEKB 2IZVB 3H7PA 2ZCBA 1I35A 2PEAA 2BYVE 3DVNV 1IP9A 2ASQA 4GDLB 4MGKE 1OTRB 2JPHA 3W1SA 1Z5SB 1Y8RC 3KW5B 1G6JA 2Z0DB 4HDOA 3RZFA 2HD5B 1Z2MA 4KDIC 5D94A 4W9EA 1V9JA 2D07B 3Q3FA 4MGIE 4X57B 2LVPA 3VHTC 5CHVC 2O2VB 3L16A 4G50A 4WJNA 2Z59B 4BOSC 4GGQA 2L0TA 2K8BA 4WQOB 4JQWC 2M8SA 1KM7A 1J8CA 4HCNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBN F;  1HE8 A;  1LQB A;  4IM2 A;  2L3Z A;  2DYB A;  2DAJ A;  2LD9 A;  2WWZ A;  3QC8 B;  4NPN A;  3ZDM C;  2DEN B;  4A3O A;  2IO2 B;  2CHZ A;  3HK0 A;  2DYM A;  2NPT A;  3M63 B;  1WJN A;  3DOW A;  3L54 A;  1WY8 A;  1V5T A;  4W9J A;  4EOY A;  2C5L C;  1T0Y A;  3R66 C;  3VQI A;  2MP2 B;  3N3K B;  2Z0E B;  3VTW A;  4LJO B;  4CO7 A;  5EDS A;  1V6E A;  4IG7 B;  4G0N B;  4J6I A;  2L05 A;  4FHK A;  4NQK E;  4KIK B;  2AEH A;  1M94 A;  2IBI B;  3M3J A;  2KJ6 A;  4MGZ E;  3ZNH B;  2GBK A;  3PV1 A;  1NI2 A;  3NZU A;  3VTU A;  2NR2 A;  1SE9 A;  2DZJ A;  2JUO A;  4A20 A;  4EKU A;  1WZ3 A;  2JXX A;  1UD7 A;  2K1F A;  2KFK B;  3PGE A;  4IWQ A;  1TZ1 A;  2L7R A;  3RUL A;  4M8M A;  1V81 A;  4PYZ A;  4B9K A;  2G3Q B;  2FIF A;  4F1S A;  1E5W A;  4IWO A;  1E8W A;  2CHW A;  4GXB A;  2KD0 A;  3RT3 B;  3DBS A;  1KOT A;  3B08 A;  2C9W B;  3GOE A;  2HE7 A;  3DVG X;  1P0R A;  1YJ1 A;  3CSF A;  4KVG B;  1IYF A;  2LGX A;  4AP4 C;  4HVB A;  3HHM A;  3LDZ E;  3VFK A;  3PRM B;  4II3 B;  1SIF A;  1OGW A;  2LRW A;  2KTR B;  3PLV A;  3LJ3 A;  4LDT B;  3C0R B;  4GDK A;  3QAQ A;  4GMV A;  4HPM B;  2L8J A;  2PE9 A;  2GOW A;  4ASW C;  2LAS A;  3PRP B;  4WAA A;  2N1W A;  1WF9 A;  4NAW B;  3ECI A;  3OJ4 B;  4WJQ A;  2KTR A;  2Y5B B;  3WIM A;  2JWZ A;  2IY0 B;  3KYC D;  3VAW A;  2CHX A;  4K7U A;  3IHP C;  3TBL D;  2O6V B;  2MX2 A;  3UQB A;  1K8R B;  1YX6 B;  4AJW A;  4MDK E;  2LXA A;  4I6L B;  3H1U A;  3AI5 A;  3PHW B;  3DPD A;  1Q5W B;  4TKN A;  3ZKJ C;  5IAA C;  2RR9 A;  2A4Z A;  2K6Q A;  2KWV B;  2ZNV C;  2KFK A;  2J0J A;  3EHV A;  2KWC A;  1ZKH A;  2GMI C;  2LRU A;  3P2B A;  2IO3 B;  2KXJ A;  2XK5 B;  3SU8 X;  3T8M A;  4FJY A;  1WE7 A;  1WR6 E;  2UWQ A;  3AU5 A;  3MJW A;  3WAM A;  3QX1 A;  3A1Q B;  3EFU A;  5IA7 A;  2KMC A;  5AZG A;  2KJH B;  2MA9 B;  2IY1 B;  2JRI B;  2DHZ A;  1WX9 A;  2BWE S;  4MM3 A;  1ZGU B;  4FN2 A;  2KX0 A;  4FUL A;  3RYT A;  2KWU B;  1FXT B;  1U4A A;  3ZRC A;  4F7Z A;  3NY5 A;  4DHZ B;  2N7D A;  1WR1 A;  3S2A A;  4G11 A;  4WWP A;  3L13 A;  5KHO A;  2KKC A;  4RMA A;  2K8C A;  2K8H A;  1E7V A;  4MGY E;  3DVN U;  4ZDV A;  1GUA B;  3UGB B;  4JL9 A;  1WGD A;  2V3S A;  2ZPN A;  4EEW A;  4EZL A;  2KTF A;  3D32 A;  4IM3 A;  1F9J A;  1UEL A;  2XBB C;  2KLG A;  3A9J A;  4HJK A;  2L0F A;  1GJZ A;  4HPL B;  4IM0 A;  2N9E B;  4NAW A;  1CMX B;  2N1V A;  5G55 A;  1YX5 B;  3RD2 A;  2N4F A;  4CYE A;  2WX1 A;  1WJ4 A;  3JVZ X;  3OAW A;  3TIX A;  3PT2 B;  5DPT A;  3VH3 B;  4TQ0 A;  4WWO A;  4KZ0 A;  4HK2 A;  1XD3 B;  2LGD A;  3KUZ A;  2KAN A;  2JVC A;  5CTR C;  3AU4 A;  5BO4 B;  4RM9 A;  1EF1 A;  1E8Z A;  1S1Q B;  1D3Z A;  3CST A;  4GDL A;  2PJH A;  2VRR B;  1WGG A;  1ISN A;  4PS8 A;  2REX A;  3ZO5 B;  4DHJ B;  5L83 A;  3UQA A;  3HIZ A;  2DZM A;  3W1Y A;  3QHT A;  2EMS A;  1WXA A;  5DPW A;  3A1Q A;  3QWZ B;  2L76 A;  3ZUN A;  1XQQ A;  3Q3J A;  2BYE A;  3VTV A;  3WAN A;  2DZK A;  2MBB B;  2MBE A;  3L17 A;  4W9I A;  1P98 A;  3JSV A;  1TTN A;  2KX3 A;  2KK8 A;  2RSU A;  1WMH A;  1E8Y A;  1V49 A;  3NOB A;  1J0G A;  3ZLZ A;  4EFO A;  5AZH A;  1SGH A;  4BBN C;  3KYD D;  1YIW A;  5G2N A;  2KQ7 A;  3B1L X;  3A33 B;  5LXI B;  2MLB A;  1MG8 A;  1X1M A;  3QK0 A;  4B95 A;  3PRZ A;  4BKS A;  2MP2 A;  3UIN B;  2N7E A;  3VH4 B;  4II2 B;  4DXA B;  1KLV A;  4BOZ B;  3VXW A;  1L7Y A;  4HXD A;  4ANV A;  2C60 A;  3VVW B;  1JRU A;  1WIA A;  1WE6 A;  2ZZP B;  2ZPY A;  3PRE A;  3RZW C;  1TBE A;  3MTN B;  3A9K A;  4I6N B;  4LJP B;  3SDL C;  2FCQ A;  3N30 A;  4MSM B;  4FJV B;  2FID A;  2KJR A;  2PPH A;  3NZS A;  3H7P B;  4DWF A;  2KNB A;  2J7Q B;  2ZEQ A;  3VUW A;  1RAX A;  3APC A;  4K81 A;  5CHF A;  3JYU A;  4TV3 A;  3WAP A;  1UBQ A;  1YQB A;  5DPR A;  4TUU A;  3A4R A;  5KHQ A;  3PLU A;  1NDD A;  5JH5 C;  5FR6 A;  4ICV A;  4RM8 A;  4M0W B;  3TMP B;  3DBL I;  2LXC A;  2MRP A;  5AZF A;  2KDF B;  3T9L A;  1EO6 A;  2J0K A;  4N9F 4;  3V6E B;  4BKS D;  2CU1 A;  4E71 A;  3PVL A;  5C23 A;  4FBJ B;  2C7N B;  5LXH A;  1WGH A;  2AWT A;  2JRH A;  3ZIM A;  3VUY A;  3TJP A;  3VDZ A;  1S3S G;  4WJO A;  4W9K A;  1UGM A;  2FCN A;  2JZZ A;  4DDG D;  3QCA A;  3R7Q A;  2KC1 A;  2KZR A;  3QA8 A;  3CMM B;  4PYU A;  2ZJD A;  5DPS A;  1LFD A;  3NHE B;  2BKR B;  1AAR A;  5D2M B;  4AOF A;  5E6N A;  1WFY A;  2FUH B;  3ZTD A;  2R2Q A;  2MCN B;  3APF A;  2V1Y A;  3A9K B;  2JY6 A;  3PZD A;  4MH0 E;  5JHB A;  4E74 A;  2LZ6 A;  2KQS A;  1H4R A;  3HM6 X;  2ZVO A;  3MHS D;  2ZCC A;  2D2Q A;  4MJS A;  1EUV B;  2EMT A;  2MW5 A;  4KIK A;  4P7I A;  2OJR A;  2OOB B;  2DAF A;  2R2O A;  3ML9 A;  4PS3 A;  4EZJ A;  4IW0 A;  4FAD A;  3V61 A;  2FCM A;  2LWP A;  1OEY A;  3PTF C;  1NBF C;  2CR5 A;  2FNJ B;  2C7H A;  3KH0 A;  4IUM B;  3R3M A;  2JT4 B;  3BY4 B;  2WYQ A;  3A4S C;  4MEM A;  1WRD B;  2IO0 B;  1WXM A;  4DBG A;  2JZ3 B;  5L95 C;  4GB9 A;  3H7S A;  5E6O A;  2I1J A;  2KDB A;  4GN1 A;  3PPA A;  4W9D A;  1EF5 A;  4AUQ C;  3V62 A;  4BKT A;  2K25 A;  2BF8 B;  4HCP B;  2KVR A;  4W9L A;  1E7U A;  3ZW3 A;  4IC7 B;  3WA0 A;  4URK A;  3L08 A;  1WGR A;  2GBR A;  1TGZ B;  4GSW A;  4OVV A;  4ZYN A;  1Q0W B;  3M62 B;  1WGY A;  4ANW A;  2I1K A;  1WJ6 A;  1WMH B;  5LLI A;  2M17 A;  4YL8 A;  3A9J B;  1E8X A;  3AXC A;  2G4D B;  2GBJ A;  2LJ5 A;  3NS8 A;  3U7D A;  2IO1 B;  1WJU A;  4IWP A;  3K9O B;  1VD2 A;  5CX3 A;  3ZNI D;  4W9C A;  3UIP B;  1WM2 A;  3IG3 A;  5C1Z A;  3OJ3 A;  2KO3 A;  4KDL B;  2MQJ A;  1LXD A;  5E6P A;  4NNJ B;  3EC8 A;  1WX8 A;  1PQS A;  4KV2 A;  2A5U A;  1UBI A;  4TQ1 A;  2NS5 A;  1R4M I;  2O6V D;  4FHJ A;  4BVU C;  1C3T A;  2D11 A;  2RD0 A;  4W9G A;  1I42 A;  1YD8 U;  4EUT A;  1QZE A;  5D7G A;  2JF5 A;  3SHQ A;  3AUL A;  4DK5 A;  2AL3 A;  1ZW7 A;  4FLH A;  4MSQ B;  4W9H A;  5GMV A;  4NQL B;  2M0X A;  2XEW A;  2WX0 A;  4KSL C;  4K7W A;  1P9D U;  2GBN A;  2LI5 A;  2KLC A;  4G3X B;  4MEL A;  4DDI D;  1V86 A;  3V60 A;  2BPS A;  4HLE A;  3ALB A;  3BIN A;  2XK5 A;  3B0A A;  2MBO A;  3ML8 A;  4GU2 A;  2LVQ A;  2NCN A;  4OVU A;  5TR5 A;  4XZ4 A;  1V2Y A;  4HDQ A;  1KJT A;  4GIV A;  3I3T B;  3TCA A;  2DX5 B;  3R7R A;  2DYO A;  3JW0 X;  1WZ0 A;  2NBW B;  2GBM A;  3JSV B;  1WYW B;  2IYD B;  2QHO A;  3EEC A;  3QJZ A;  4JLC A;  2ZVN A;  3OLM D;  3QAR A;  4AJY B;  4K1R B;  2O2V A;  1RRB A;  2NPT B;  2AYO B;  2KOX A;  3V6C B;  3N32 A;  1UZX B;  2KDE B;  4ZRK A;  2KFJ A;  1WXV A;  2NBV B;  5DCN A;  2LGY A;  2O6V A;  4JIO U;  4NJ6 A;  1P1A A;  2ZNV B;  4W9F A;  4WWN A;  2BKF A;  3ZVV A;  4HWI B;  3UF8 A;  3ZNG C;  2NVU I;  2HJ8 A;  4ICU A;  1WXS A;  2CS4 A;  2PE6 B;  1GC7 A;  4GDK B;  4KSK C;  1OQY A;  2MWS B;  3KUD B;  2MBQ A;  1XT9 B;  4GOC A;  1WM3 A;  3SD5 A;  1RFA A;  2M1M A;  2CKH B;  2RGF A;  3IFW B;  2LVO A;  4ZRI A;  2DZI A;  3DCG A;  2BWF A;  2UYZ B;  1BT0 A;  3RUI B;  4LDT D;  2G4S A;  2RPQ A;  1V80 A;  1WI0 A;  4PS7 A;  1GG3 A;  3O65 B;  1Q1O A;  4M8N A;  4CHK A;  3K9P B;  1WX7 A;  2WDT B;  2HTH A;  2LUE A;  2MSE D;  4DHZ E;  2BGF A;  3H6N A;  2B3A A;  3H9D A;  2D3G A;  4EZK A;  4K7S A;  4NJ7 A;  1C1Y B;  3UIO B;  2FCS A;  2YVC A;  3U30 A;  3M95 A;  4NY0 A;  3RCZ A;  2NBU A;  2K39 A;  2AL6 A;  1LM8 B;  3ZRF A;  4AWJ A;  1VCB A;  3CF6 E;  3KUC B;  4F8C B;  2N9X A;  2K6D B;  4KZC A;  4BFR A;  3ZNZ B;  3VUX A;  5JZE B;  1V5O A;  5CHW A;  1R4N I;  1J19 A;  3HM3 A;  2YLM A;  4A3P A;  4E3C A;  2G45 B;  1GNU A;  2MBH A;  3APD A;  1A5R A;  2BYF A;  2M4N A;  4JGH B;  2EKE C;  4BKG A;  5J2R A;  3DVG Y;  5D6J B;  3L10 B;  5J18 A;  3QQ8 B;  1IPG A;  2D10 A;  3KVF B;  3PS6 A;  4ZRJ A;  3WAO A;  1WH3 A;  4WJP A;  3X0W A;  4XC2 A;  1OEY J;  3DQV A;  3IVF A;  4FA6 A;  2N9P C;  3ONS A;  2L00 B;  2J0M A;  1P3Q U;  3PSE B;  3ZTC A;  4XX5 A;  2FAZ A;  4MJS B;  3ENE A;  5JHA A;  3DBH I;  4I6P A;  3WAL A;  2V4L A;  1E90 A;  1UH6 A;  2W9N A;  5HKH A;  2C7M B;  2KN5 A;  5J17 A;  4DHJ D;  2KDI A;  3DBR I;  4FJZ A;  4ANU A;  4B6W A;  1H8C A;  3IBE A;  3L0W B;  2KMA A;  3X23 A;  3GZN I;  4ANX A;  3TL5 A;  4LCD E;  3QIJ A;  3PHX B;  1L2N A;  3DDC B;  2KHW B;  3U8Z A;  2KC2 A;  3W1S C;  1RLF A;  1GC6 A;  3ZDT A;  5AEK B;  2IZV B;  3H7P A;  2ZCB A;  1I35 A;  2PEA A;  2BYV E;  3DVN V;  1IP9 A;  2ASQ A;  4GDL B;  4MGK E;  1OTR B;  2JPH A;  3W1S A;  1Z5S B;  1Y8R C;  3KW5 B;  1G6J A;  2Z0D B;  4HDO A;  3RZF A;  2HD5 B;  1Z2M A;  4KDI C;  5D94 A;  4W9E A;  1V9J A;  2D07 B;  3Q3F A;  4MGI E;  4X57 B;  2LVP A;  3VHT C;  5CHV C;  2O2V B;  3L16 A;  4G50 A;  4WJN A;  2Z59 B;  4BOS C;  4GGQ A;  2L0T A;  2K8B A;  4WQO B;  4JQW C;  2M8S A;  1KM7 A;  1J8C A;  4HCN B; 
#chains in the Genus database with same CATH topology
 4BBN F;  3FIL A;  1QOG A;  4IM2 A;  4Q2J A;  2DYB A;  3ZDM C;  2DEN B;  4A3O A;  3OG5 A;  2WDQ B;  2NPT A;  3IXS A;  2LGI A;  2MJE A;  2C5L C;  1T0Y A;  3KQ4 A;  4NQK E;  2PVO D;  2KJ6 A;  3PV1 A;  3TEY A;  1SE9 A;  2DZJ A;  4A20 A;  1UWX A;  2R61 A;  1F0Z A;  2KFK B;  4BAX A;  3P4S B;  3TEW A;  1E5W A;  1E8W A;  2KD0 A;  1YJ1 A;  1IYF A;  3HHM A;  3LDZ E;  2KTR B;  3Q14 C;  4ZHP A;  3C0R B;  1V97 A;  3URY A;  2PIA A;  1UWM A;  3PRP B;  3I9V 1;  1GB1 A;  2N1W A;  2D5G A;  2V9H A;  3ECI A;  3NVV A;  1FNW A;  2Y5B B;  2JWZ A;  3I57 A;  1BXT A;  1YMH E;  4AJW A;  4MDK E;  1UNS A;  3H1U A;  3PHW B;  3I63 C;  2N7J A;  1Q5W B;  1I7H A;  2K6Q A;  2ZNV C;  2J0J A;  2KWC A;  2UWQ A;  1WR6 E;  1EWY C;  3EFU A;  1FNU A;  5IA7 A;  2KMC A;  4KGT A;  2KJH B;  1SJE D;  2MA9 B;  1L4Z B;  3NUH B;  1ZGU B;  2KX0 A;  4FUL A;  3RYT A;  2KWU B;  1N61 A;  3S2A A;  3HVZ A;  4ZDV A;  1ZUD 2;  1I4H A;  4JL9 A;  1GOZ A;  3AE8 B;  3D32 A;  4BZA A;  1SE3 A;  2KLG A;  2MJD A;  2N9E B;  2UU7 A;  4NAW A;  4RFB A;  2G1E A;  2WX1 A;  4TQ0 A;  3B2G A;  2WQY B;  4HK2 A;  1XD3 B;  1E7P B;  2Y5P A;  4DQO C;  4AQ7 A;  2VRR B;  3I5J C;  1WGG A;  1HZ6 A;  5L83 A;  4WAF A;  1JW9 D;  2DZM A;  1AW7 A;  3R2I A;  3A1Q A;  3UI3 A;  3QWZ B;  2BYE A;  1N62 A;  3VTV A;  1GB4 A;  2MBE A;  3OWE B;  5D3I B;  1TTN A;  2RSU A;  3Q8A A;  3AE6 B;  3N20 C;  1E8Y A;  5H8Y E;  5AZH A;  4BBN C;  3VRB B;  3B1L X;  5LXI B;  2MLB A;  1MG8 A;  3TEX A;  1FIQ A;  2DWQ A;  3UIN B;  1NVI D;  2MEK A;  3Q6B A;  2JZP A;  1WIA A;  2ZZP B;  1EWC A;  4LJP B;  1HEZ E;  2KJR A;  2J7Q B;  1C4C A;  3VUW A;  4K81 A;  1Q10 A;  2OED A;  5KHQ A;  1NDD A;  5BMH A;  1EO6 A;  2Y5C A;  2IDY A;  3LXF A;  4ZRQ A;  4LNO A;  4OZB A;  4W9K A;  1UGM A;  2FCN A;  4WJO A;  1FFU A;  4DDG D;  3DHI C;  2ZJD A;  1FRR A;  2BKR B;  5D2M B;  4ZOH C;  3ZTD A;  2R2Q A;  3A9K B;  2CJO A;  4E74 A;  4A55 A;  3VR8 B;  2KQS A;  1H4R A;  3MHS D;  2ZVO A;  2W54 A;  2ZCC A;  1EUV B;  2EMT A;  4KIK A;  3SFD B;  2OJR A;  3BWU D;  4WQM A;  4A90 A;  4PS3 A;  4EZJ A;  4IW0 A;  4FAD A;  3PTF C;  4IUM B;  3BVG A;  3R3M A;  1ZDX A;  1ZE3 D;  2IGD A;  2WYQ A;  3ZJV A;  1WXM A;  3H7S A;  2D3C A;  1VZ6 A;  1P7E A;  1JRO A;  4M02 A;  2PTL A;  2DNF A;  1TKE A;  2BF8 B;  5MPO A;  4IC7 B;  4JE3 B;  2LHE A;  4OVV A;  5HFY A;  4ZYN A;  1Q0W B;  2I2Y A;  1C78 A;  1J7C A;  1MPE A;  1E8X A;  4M01 A;  3MC8 A;  4P16 A;  5HG2 A;  4IWP A;  3K9O B;  5CX3 A;  3BVZ A;  3UIP B;  1TT5 B;  1YNT E;  2K9X A;  3AV8 A;  1LXD A;  5E6P A;  4NNJ B;  4DXF A;  1UBI A;  1R4M I;  2O6V D;  1C3T A;  3WCQ A;  2RD0 A;  2JWU A;  5D7G A;  1SEB D;  2MHJ A;  1F1H A;  3SHQ A;  3RNB C;  3Q3O C;  2M0X A;  1C76 A;  1TJE A;  2ONQ A;  2GBN A;  4MEL A;  2KWD A;  2W82 A;  4C7Y A;  4GU2 A;  2QCZ A;  2J4X A;  1V2Y A;  3TCA A;  2DX5 B;  1M4V A;  4XYC A;  3IAS 1;  4OHJ A;  2LMC A;  1JCK B;  3OLM D;  3MJ5 A;  2BS3 B;  3DHG C;  2AYO B;  1WXV A;  4OZA A;  2Q5W D;  3VRA B;  3UF8 A;  2NVU I;  3IT4 B;  3DBR B;  2CS4 A;  1OQY A;  2MWS B;  5FK9 C;  2MBQ A;  3J9C A;  4GOC A;  2CKH B;  2RGF A;  2BWF A;  1BT0 A;  1MHX A;  3RUI B;  3FKY A;  4CHK A;  4M8N A;  1KFY B;  2HTH A;  2MSE D;  4EZK A;  3H6N A;  2D3G A;  3BYT B;  4K7S A;  4NJ7 A;  3UIO B;  1PGX A;  4RGO S;  3SR6 A;  1VLB A;  2CU3 A;  3U30 A;  3M95 A;  1K51 A;  2PKO A;  1FCL A;  2I38 A;  5EE1 A;  3CF6 E;  4HJG E;  3P4R B;  3ZNZ B;  1R4N I;  1J19 A;  3APD A;  5J18 A;  1IPG A;  3PS6 A;  3U4E G;  1WH3 A;  4XC2 A;  2KQ4 X;  3MC0 B;  2N9P C;  3ZTC A;  2L00 B;  4XX5 A;  3FAH A;  3ENE A;  4I6P A;  1GPX A;  2W9N A;  2MJ3 A;  2C7M B;  2KN5 A;  5J17 A;  4DHJ D;  1WGK A;  2J42 A;  2KMA A;  4ANX A;  2BT6 A;  4ARI A;  3PHX B;  3U8Z A;  4C7Z A;  2N0S B;  5JXV A;  3W1S C;  5AEK B;  2IZV B;  2ZCB A;  2V3N A;  3KWV A;  1HTQ A;  4D2K A;  3KW5 B;  1G6J A;  2EEL A;  2WXH A;  3RZF A;  5D94 A;  4KDI C;  4X57 B;  1VR9 A;  2L32 A;  4WJN A;  4L2Y A;  2FBW B;  2M8S A;  2WNM A;  3RI7 C;  1HE8 A;  3KLS X;  3AE7 B;  2H88 B;  3QC8 B;  2IO2 B;  1XEE A;  1WY8 A;  1V5T A;  4EOY A;  1TS3 A;  3R66 C;  2MP2 B;  3N3K B;  5IKC M;  5EDS A;  4IG7 B;  4G0N B;  4KIK B;  2L83 A;  2AEH A;  1TKY A;  2Z8L A;  2GBK A;  1NI2 A;  1N5X A;  5HI1 A;  2JUO A;  2CJN A;  4EKU A;  2K1F A;  1V81 A;  2G3Q B;  1FCC C;  4NZL B;  5E6J A;  2X38 A;  3RT3 B;  3DBS A;  3VR9 B;  1KOT A;  2C9W B;  2LGX A;  4HVB A;  3VFK A;  3PRM B;  4II3 B;  3PLV A;  2LRW A;  3LJ3 A;  4LDT B;  1BML C;  4US8 A;  2L8J A;  2PE9 A;  4CQN A;  4ASW C;  1ZXH A;  2LAS A;  3TEZ A;  4WAA A;  1WF9 A;  4WJQ A;  2IY0 B;  4YSZ B;  1CJE A;  4RNA A;  2O6V B;  4REZ A;  2MX2 A;  1K8R B;  1ZOY B;  3DPD A;  1I4Q A;  2IPK D;  3ZKJ C;  2RR9 A;  2A4Z A;  3EHV A;  2LRU A;  2GMI C;  3SU8 X;  2KXJ A;  3MJW A;  2E3T A;  3AU5 A;  3PO0 A;  4JX1 C;  3W2D A;  2INN E;  2IY1 B;  1L4D B;  1WX9 A;  2BWE S;  4MM3 A;  1XLO A;  1FXT B;  4O1N A;  2N7D A;  1QQR A;  1D4B A;  3L13 A;  5KHO A;  4RMA A;  1ZDV A;  3EGR A;  3RMK C;  2KMM A;  3BZD B;  1QLB B;  5G5H A;  1WGD A;  4EEW A;  2BB6 A;  4OW0 A;  2KTF A;  3P63 A;  2Y3A A;  1GJZ A;  4HPL B;  4IM0 A;  1AWD A;  3RD2 A;  5G55 A;  3OAW A;  3VH3 B;  3PT2 B;  4IDI A;  3RNF C;  1R4M B;  2KAN A;  4GDL A;  2JXT A;  3GS2 A;  1ISN A;  2REX A;  4DHJ B;  3HIZ A;  2KYW A;  1WXA A;  1SXT A;  3R2T A;  1ENF A;  2LFI A;  4JPS A;  1C4P A;  1L0V B;  3AEG B;  1B1Z A;  1KTK A;  3ZLZ A;  4HKQ A;  1N5W A;  3GE3 C;  3KYD D;  1YIW A;  3AE5 B;  1V1P A;  3PZ7 A;  2N7E A;  3VH4 B;  3HRD D;  4BOZ B;  1RYJ A;  4WWM A;  1KF6 B;  1L7Y A;  2WXM A;  3VVW B;  5IP4 D;  4HPP A;  3A9K A;  2FCQ A;  4FJV B;  2FID A;  4B0E A;  2KNB A;  3AE1 B;  1RAX A;  5CHF A;  5DPR A;  1T0Q C;  4ICV A;  4RM8 A;  3Q3N C;  4M0W B;  1Y56 A;  1XLN A;  5C2T B;  1ET6 A;  1T3Q A;  2JRH A;  3VDZ A;  1S3S G;  1VDV A;  2JZZ A;  3R7Q A;  2KC1 A;  1IBX A;  2PVG C;  4N59 A;  1E10 A;  1CQV A;  4AOF A;  4XWT A;  3NVZ A;  4C4V A;  3Q8F A;  5IOI A;  3PZD A;  5JHB A;  2JY6 A;  2BW2 A;  4RF0 A;  4HKZ E;  2LZ6 A;  3HM6 X;  2JYE A;  2OOB B;  1XLP A;  3DHH C;  4XE0 A;  1L6U A;  4US9 A;  2FCM A;  3BYY B;  2ZW0 A;  1C77 A;  4MEM A;  4R3D A;  3A4S C;  1WRD B;  2JYT A;  4YSX B;  5IN7 A;  3AB5 A;  4DBG A;  1OFF A;  2ICI A;  1FO4 A;  4W9D A;  1T0R C;  2K5P A;  1EF5 A;  3V62 A;  5EE0 A;  5FKA C;  4URK A;  4GSW A;  3CWI A;  4OVZ A;  1L5P A;  4ACF A;  2PW9 A;  3M62 B;  1I4G A;  1ESF A;  3A9J B;  2WXR A;  2GBJ A;  3NS8 A;  1JWS D;  3LB8 C;  1E0Z A;  4RGM A;  1XLQ A;  2KO3 A;  4QAY A;  2DBY A;  1MG4 A;  2A5U A;  4W9G A;  4L1B A;  1QZE A;  3AUL A;  4MSQ B;  4W9H A;  1ZW7 A;  3ZGZ A;  2KAJ A;  4K7W A;  2QEJ C;  1F77 A;  1AN8 A;  1CZP A;  4G3X B;  4DDI D;  4HLE A;  3ALB A;  3BIN A;  2XK5 A;  3B0A A;  2AX5 A;  2LVQ A;  2NCN A;  2W3S A;  1KJT A;  3AE2 B;  3RNA C;  1ZPS A;  4HRO A;  2XN9 C;  1WYW B;  3EEC A;  4JLC A;  1N6Z A;  1GAQ B;  4AJY B;  2O2V A;  1STE A;  2W55 A;  3V6C B;  1FXA A;  3Q8C A;  2KFJ A;  2NBV B;  4FXC A;  4LNF A;  1JRP A;  3FIL B;  1P1A A;  3GZN B;  3NRZ A;  2BKF A;  4HWI B;  2HJ8 A;  1WXS A;  2PE6 B;  1GC7 A;  3NS1 A;  2M0A A;  3KUD B;  5D3D A;  1WM3 A;  2M1M A;  1EM7 A;  3DCG A;  4JWU C;  1CK1 A;  1JWA D;  1WI0 A;  1SSN A;  3AE3 B;  4DHZ E;  2BGF A;  1SJH D;  4M0W A;  2FCS A;  2YVC A;  4B0M A;  2K39 A;  1R4N B;  2AL6 A;  3ZRF A;  4AWJ A;  1VCB A;  3KUC B;  4F8C B;  4KZC A;  1BUI C;  1FM0 D;  1QOB A;  3HM3 A;  1XCQ L;  2YLM A;  1KRH A;  2MBH A;  3RNE C;  1DYQ A;  2BYF A;  1NI3 A;  2M4N A;  2EKE C;  5D6J B;  3L10 B;  3QQ8 B;  3W9C B;  4RF1 A;  1P3Q U;  2XNA C;  1QOF A;  3P4Q B;  5JHA A;  3DBH I;  3WAL A;  1SBB B;  4FJZ A;  4B6W A;  3FC4 A;  3MC9 A;  1H8C A;  3IBE A;  2WXJ A;  3L0W B;  3AE4 B;  3H8H A;  3L4P A;  1HZ5 A;  1N60 A;  1RFK A;  1GC6 A;  4A8X C;  1I35 A;  3AEC B;  2BYV E;  2J53 A;  1Z2M A;  1V9J A;  3C19 A;  2LVP A;  5CHV C;  4BOS C;  2K8B A;  4JQW C;  1J8C A;  4HCN B;  2L3Z A;  2DAJ A;  2LD9 A;  1P7F A;  3M63 B;  2DYM A;  3DOW A;  3L54 A;  3R8B A;  2WGS A;  3IAM 1;  1QOA A;  1D6E C;  3EA6 A;  4FHK A;  1LGR A;  2WXL A;  1M94 A;  2IBI B;  2YEP F;  4MGZ E;  2M56 B;  3NZU A;  4YXD B;  2NR2 A;  4ZRP A;  1QKZ A;  2N9L A;  2D3B A;  1UD7 A;  3PGE A;  4IWQ A;  4YT0 B;  2L7R A;  1QT9 A;  4F1S A;  5BYQ A;  3MHZ A;  4GXB A;  1DOY A;  2KVZ A;  3PZ8 A;  3GOE A;  2HE7 A;  3DVG X;  3CSF A;  2SAK A;  4AP4 C;  2VZK D;  3E9S A;  4XWW A;  1OGW A;  1SIF A;  2VH2 A;  3C8Y A;  2VH1 A;  3AEF B;  4GDK A;  4GMV A;  4HPM B;  5I4D A;  2GOW A;  3CIR B;  2WXK A;  4A6Q A;  4NAW B;  2JU6 X;  3OJ4 B;  2KTR A;  1K52 A;  1C9F A;  4NAM A;  2HTM E;  1YX6 B;  2LXA A;  4I6L B;  3AI5 A;  2KWV B;  2GB1 A;  1ZKH A;  2IO3 B;  4MAC A;  1WE7 A;  3WAM A;  3QX1 A;  3A1Q B;  4A9A A;  1WSP A;  4KX6 B;  4LNK A;  2DHZ A;  4FN2 A;  3ZRC A;  1U4A A;  1I4P A;  3NY5 A;  4DHZ B;  1WR1 A;  1ACC A;  1SE2 A;  4G11 A;  4WWP A;  2BYT A;  1HXY D;  3Q8E A;  2TSS A;  2KKC A;  2K8H A;  3DVN U;  3DWG C;  1SIJ A;  4IM3 A;  1UEL A;  4HJK A;  3AM9 A;  3NVW A;  1TYG B;  1CMX B;  1PUT A;  2N1V A;  1YX5 B;  2MH7 A;  2N4F A;  3JVZ X;  3TIX A;  4WUR A;  2LGD A;  3KUZ A;  1KLU D;  3AU4 A;  3SFE B;  5BO4 B;  2QJL A;  3TSS A;  2M19 A;  1EF1 A;  1E8Z A;  1S1Q B;  3CST A;  2PJH A;  1JWB D;  4PS8 A;  1HTO A;  3W1Y A;  2EMS A;  2L76 A;  1ROE A;  3ZUN A;  1R7S A;  1XQQ A;  3Q3J A;  4RH6 A;  3WAN A;  1RWS A;  3L17 A;  4W9I A;  1PYW D;  4C00 A;  4IOI E;  2KK8 A;  3NOB A;  1J0G A;  1YJJ A;  5LNK 1;  3NJT A;  5G2N A;  2KQ7 A;  4B95 A;  2V4I B;  3PRZ A;  4BKS A;  4DXA B;  4LLG M;  5BYS A;  3VXW A;  2FE8 A;  5AUI A;  4ANV A;  2C60 A;  1JRU A;  3ABV B;  3RZW C;  4P6V F;  2QIL A;  2AQ3 B;  3N30 A;  1IGD A;  1FNV A;  3NZS A;  4MT5 A;  3H7P B;  1YQ4 B;  4N58 A;  4DWF A;  1F2R I;  2WXO A;  4YTN B;  3APC A;  4TV3 A;  1UBQ A;  2K3U A;  1YQB A;  4TUU A;  3PLU A;  5JH5 C;  5FR6 A;  5BMI A;  2LXC A;  5C3J B;  3T9L A;  3HUI A;  2J0K A;  4N9F 4;  4BKS D;  4FBJ B;  3PVL A;  4PT5 A;  2OHF A;  1WGH A;  2AWT A;  3QCA A;  2WU2 B;  1YN5 A;  3QA8 A;  3CMM B;  4PYU A;  3NHE B;  1AAR A;  5E6N A;  1V1P B;  1JAL A;  1WFY A;  4KKI A;  3B9J A;  3RNC C;  1L6V A;  2VZK B;  2INC C;  2D2Q A;  5BYR A;  2MW5 A;  4P7I A;  2DAF A;  2INP E;  3ML9 A;  2NMQ A;  1OEY A;  1L0X B;  1N63 A;  1NBF C;  3ZYY X;  1XF5 L;  3BY4 B;  3AH7 A;  2IO0 B;  2JZ3 B;  5L95 C;  2I1J A;  1YN3 A;  4GN1 A;  1YJI A;  3PPA A;  2SEB D;  4AUQ C;  4LK0 M;  4BKT A;  2KVR A;  4W9L A;  3L08 A;  2GBR A;  1TGZ B;  1TS4 A;  1WGY A;  1D5Z C;  2K0P A;  3BII D;  1WJ6 A;  1WMH B;  1JML A;  4RGN A;  3AXC A;  1FEH A;  2G4D B;  2LJ5 A;  3U7D A;  1K50 A;  5C1Z A;  3OJ3 A;  4USA A;  4C80 A;  2B76 B;  2MQJ A;  2X8X X;  3U7Z A;  4TQ1 A;  1WWT A;  3BVM A;  4BVU C;  2D11 A;  1I42 A;  1MHH E;  1YD8 U;  2WU5 B;  4EUT A;  2JF5 A;  4DK5 A;  2AL3 A;  2K22 A;  5GMV A;  2LGS A;  3MFG A;  2XEW A;  4KSL C;  2FUG 1;  2WXQ A;  2LI5 A;  3BK2 A;  3MP9 A;  2WP9 B;  1EU4 A;  2MBO A;  5TR5 A;  4HDQ A;  2KAC A;  3I3T B;  3T3N A;  3JW0 X;  1WZ0 A;  2AQ1 B;  2NBW B;  2GBM A;  3GE8 C;  2HJ1 A;  1YOV B;  2NPT B;  1QF6 A;  1UZX B;  2KDE B;  4ZRK A;  4H2A A;  3AEE B;  2PMV A;  1V8C A;  2WDV B;  2LGY A;  2O6V A;  4NJ6 A;  4KGS A;  2ZNV B;  4RCO A;  1FMA D;  4WWN A;  3U52 E;  3ZVV A;  3AEB B;  3E56 A;  4KSK C;  1NYQ A;  1XT9 B;  3SD5 A;  3DBH B;  4TMA B;  1L0Y B;  2LVO A;  1SF0 A;  2WS3 B;  2DZI A;  2UYZ B;  5G5G A;  4LDT D;  1V80 A;  3GP7 A;  3O65 B;  3SEB A;  4AS1 A;  1WX7 A;  2WDT B;  2LUE A;  2B3A A;  3ZJT A;  3B2F A;  1ZP0 B;  2RPV A;  4YSY B;  2BS4 B;  4NY0 A;  3RCZ A;  1LM8 B;  4S17 A;  4HRS A;  2N9X A;  2K6D B;  4BFR A;  5JZE B;  2WXP A;  1WXQ A;  1V5O A;  3IT6 B;  4MH8 A;  5CHW A;  4LNN A;  4E3C A;  2G45 B;  1GNU A;  4ARC A;  5J2R A;  2HDE A;  1T0S C;  1SB3 C;  1MJD A;  1FRD A;  2D10 A;  2LHD A;  4WJP A;  3Q69 A;  3X0W A;  1OEY J;  3DQV A;  3IVF A;  3ONS A;  2J0M A;  2FAZ A;  1FD6 A;  1LO5 D;  1JQ4 A;  1UH6 A;  4WIP A;  4XDD A;  5HKH A;  2KDI A;  3DBR I;  4ANU A;  2JQR B;  4NJC A;  1OQR A;  3TL5 A;  3QIJ A;  1L2N A;  3DWM A;  2KC2 A;  1RLF A;  3ZDT A;  2D3A A;  3H7P A;  2PEA A;  3DVN V;  4GDL B;  1OTR B;  3P1M A;  1Z5S B;  1Y8R C;  2Z0D B;  4HDO A;  2D07 B;  4MGI E;  3VHT C;  1TS2 A;  3TUO A;  3L16 A;  5T8I A;  1J7B A;  4GGQ A;  1C79 A;  3AMZ A;  2H89 B;  1KM7 A;  2YEP B;  2IGH A;  1LQB A;  1YN4 A;  2WWZ A;  4NPN A;  3AED B;  2CHZ A;  3HK0 A;  1WJN A;  4W9J A;  1KLG D;  3VQI A;  3ETR A;  4YTM B;  2Z0E B;  3VTW A;  1E6E B;  4LJO B;  4CO7 A;  1V6E A;  2L52 A;  4J6I A;  2L05 A;  3P42 A;  3M3J A;  3ZNH B;  4S0R A;  1E9M A;  1FFV A;  3VTU A;  2IGG A;  1WZ3 A;  1D5X C;  2JXX A;  1TZ1 A;  3RUL A;  4M8M A;  4PYZ A;  4B9K A;  2FIF A;  4IWO A;  2CHW A;  4C4V B;  3B08 A;  2JSV X;  4XDC A;  1P0R A;  3T3O A;  4KVG B;  1FPY A;  2NTT A;  2QIE B;  4LTU A;  3NVY A;  3QAQ A;  1MFW A;  1NEK B;  3EUB 2;  3WIM A;  1TS5 A;  3KYC D;  3VAW A;  2CHX A;  2KDM A;  3IHP C;  4K7U A;  3TBL D;  3KWL A;  2EKI A;  5GXG B;  3UQB A;  1A70 A;  3W5V B;  4TKN A;  5IAA C;  2LJI A;  2KFK A;  4IKG A;  3DBL B;  2WHI A;  3P2B A;  3T8M A;  2XK5 B;  5H92 C;  4FJY A;  1QIL A;  2BB5 A;  5AZG A;  3N1Y C;  2JRI B;  2PLP A;  4F7Z A;  1PDX A;  2WLB A;  4MM3 B;  2K8C A;  1E7V A;  4MGY E;  1GUA B;  3UGB B;  2V3S A;  2ZPN A;  5EE9 A;  4EZL A;  4KKJ A;  1F9J A;  2XBB C;  3RN9 C;  1ZXI A;  3A9J A;  2L0F A;  4CYE A;  4N6E B;  1IGC A;  1WJ4 A;  5DPT A;  4WWO A;  4KZ0 A;  2BTE A;  1DGJ A;  1F52 A;  1UF0 A;  2V3P A;  2JVC A;  5CTR C;  4RM9 A;  3AEA B;  1D3Z A;  3RPF C;  3W5U B;  2RDB C;  1V1O A;  2WDR B;  3ZO5 B;  1I4R A;  3UQA A;  3QHT A;  5DPW A;  4EE2 A;  2DZK A;  2MBB B;  3ZQ4 A;  1P98 A;  3JSV A;  1TY0 A;  2KX3 A;  1WMH A;  1OQQ A;  1KH0 A;  1V49 A;  1VRA B;  4M00 A;  4EFO A;  1SGH A;  3N1Z C;  3A33 B;  4J3O D;  1X1M A;  1D5M C;  3QK0 A;  2IND C;  1XO3 A;  2MP2 A;  1KLV A;  4II2 B;  5EE3 A;  2N9K A;  4RGT A;  2WXF A;  2ACZ B;  4HXD A;  3HVD A;  3PRE A;  1WE6 A;  2ZPY A;  2ON8 A;  1J7A A;  1TBE A;  3MTN B;  4I6N B;  3SDL C;  3N1X C;  4MSM B;  2QMT A;  2PPH A;  1C4A A;  5IO9 A;  2ZEQ A;  3ZXV A;  3JYU A;  3WAP A;  2WXI A;  3A4R A;  3TMP B;  3DBL I;  2MRP A;  5AZF A;  3V05 A;  2L1A A;  2KDF B;  2GLS A;  3V6E B;  2CU1 A;  4JWS C;  3V3X A;  2QDF A;  5C23 A;  4E71 A;  2C7N B;  5LXH A;  4C56 C;  3RNG C;  1XXG A;  2RDG A;  3TJP A;  3VUY A;  3ZIM A;  2KZR A;  3LYY A;  1JWM D;  5DPS A;  1LFD A;  2RDH A;  1K53 A;  2FUH B;  2MCN B;  3APF A;  2V1Y A;  4MH0 E;  4YWG G;  3Q2A C;  4MJS A;  1DOX A;  4P1B C;  2R2O A;  3GB1 A;  1VJK A;  5BMG A;  1ET9 A;  2JX5 A;  3V61 A;  2LWP A;  2CR5 A;  2FNJ B;  2C7H A;  3KH0 A;  4DXG A;  4K3B A;  4HEA 1;  2JT4 B;  3N9Y C;  1TIF A;  1JWU D;  4GB9 A;  1MVK A;  5E6O A;  2G9H D;  2KDB A;  4TSS A;  2QC8 A;  2DLB A;  5TSS A;  2K25 A;  3NG0 A;  4HCP B;  1E7U A;  3ZW3 A;  3WA0 A;  1WGR A;  1F2R C;  1WYG A;  2BBC A;  3AE9 B;  4ANW A;  2I1K A;  5AUK A;  2NTS A;  4OZC A;  5LLI A;  2M17 A;  4YL8 A;  2IO1 B;  1WJU A;  1VD2 A;  3ZNI D;  4W9C A;  1WM2 A;  3IG3 A;  4P1C C;  4XGA B;  4KGR A;  2E6X A;  4KDL B;  3EC8 A;  3ZXR A;  1WX8 A;  1PQS A;  4KV2 A;  1NYR A;  2NS5 A;  1DOI A;  4FHJ A;  1MI0 A;  4L23 A;  2RMM A;  4ITK A;  1HQR D;  4UDU C;  4FLH A;  1I4X A;  2BS2 B;  4NQL B;  3Q3M C;  2WX0 A;  1P9D U;  2KLC A;  1XCT L;  4YTP B;  1V86 A;  3V60 A;  2BPS A;  4K3C A;  3BK1 A;  3Q8B A;  3ML8 A;  4OVU A;  4XZ4 A;  3U2S C;  4GIV A;  4ZYS A;  3R7R A;  2V0G A;  1HA5 A;  4ZHO A;  1B9R A;  2DYO A;  1AYF A;  1TY2 A;  3JSV B;  1FXI A;  1VZ8 A;  2IYD B;  2QHO A;  3QJZ A;  3P4P B;  2ZVN A;  3QAR A;  2LUM A;  4K1R B;  1RRB A;  2GRI A;  2IJ0 A;  1PGB A;  2OJW A;  4WH4 A;  2KOX A;  3N32 A;  5DCN A;  4JIO U;  2BQQ A;  4W9F A;  3ZNG C;  2KN4 A;  4ICU A;  4GDK B;  1RFA A;  3IFW B;  4ZRI A;  3RFZ B;  2AQ2 B;  2G4S A;  2RPQ A;  2W3R A;  4PS7 A;  1GG3 A;  5FR3 A;  1Q1O A;  1NEN B;  3K9P B;  3H9D A;  1C1Y B;  3NZ3 A;  1T5X D;  1UGJ A;  1SE4 A;  1YQ3 B;  2NBU A;  3O13 A;  1PGA A;  2GI9 A;  3VUX A;  4LNI A;  1IUE A;  4A3P A;  1EU3 A;  5HHD G;  4GLS C;  1A5R A;  4JGH B;  2WXN A;  4BKG A;  3DVG Y;  4ZRJ A;  3WAO A;  3KVF B;  1PFD A;  1VZ7 A;  1RM6 C;  1IBX B;  4FA6 A;  3PSE B;  2KT7 A;  1TZO A;  4PK1 A;  1UUP A;  4MJS B;  2V4L A;  1E90 A;  2J52 A;  2WXG A;  3X23 A;  3GZN I;  1T6B X;  4LCD E;  3DDC B;  2KHW B;  2ZW1 A;  3ZJU A;  1TKG A;  1IP9 A;  2ASQ A;  4MGK E;  2JPH A;  2LEK A;  3W1S A;  2HD5 B;  1WRI A;  4W9E A;  3Q3F A;  2BVC A;  3EFC A;  2O2V B;  4G50 A;  2QSD A;  2Z59 B;  2L0T A;  3AN1 A;  4WQO B; 
#chains in the Genus database with same CATH homology
 4BBN F;  1HE8 A;  1LQB A;  4IM2 A;  2L3Z A;  2DYB A;  2DAJ A;  2LD9 A;  2WWZ A;  3QC8 B;  4NPN A;  3ZDM C;  2DEN B;  4A3O A;  2IO2 B;  2CHZ A;  3HK0 A;  2DYM A;  2NPT A;  3M63 B;  1WJN A;  3DOW A;  3L54 A;  1WY8 A;  1V5T A;  4W9J A;  4EOY A;  2C5L C;  1T0Y A;  3R66 C;  3VQI A;  2MP2 B;  3N3K B;  2Z0E B;  3VTW A;  4LJO B;  4CO7 A;  5EDS A;  1V6E A;  4IG7 B;  4G0N B;  4J6I A;  2L05 A;  4FHK A;  4NQK E;  4KIK B;  2AEH A;  1M94 A;  2IBI B;  3M3J A;  2KJ6 A;  4MGZ E;  3ZNH B;  2GBK A;  3PV1 A;  1NI2 A;  3NZU A;  3VTU A;  2NR2 A;  1SE9 A;  2DZJ A;  2JUO A;  4A20 A;  4EKU A;  1WZ3 A;  2JXX A;  1UD7 A;  2K1F A;  2KFK B;  3PGE A;  4IWQ A;  1TZ1 A;  2L7R A;  3RUL A;  4M8M A;  1V81 A;  4PYZ A;  4B9K A;  2G3Q B;  2FIF A;  4F1S A;  1E5W A;  4IWO A;  1E8W A;  2CHW A;  4GXB A;  2KD0 A;  3RT3 B;  3DBS A;  1KOT A;  3B08 A;  2C9W B;  3GOE A;  2HE7 A;  3DVG X;  1P0R A;  1YJ1 A;  3CSF A;  4KVG B;  1IYF A;  2LGX A;  4AP4 C;  4HVB A;  3HHM A;  3LDZ E;  3VFK A;  3PRM B;  4II3 B;  1SIF A;  1OGW A;  2LRW A;  2KTR B;  3PLV A;  3LJ3 A;  4LDT B;  3C0R B;  4GDK A;  3QAQ A;  4GMV A;  4HPM B;  2L8J A;  2PE9 A;  2GOW A;  4ASW C;  2LAS A;  3PRP B;  4WAA A;  2N1W A;  1WF9 A;  4NAW B;  3ECI A;  3OJ4 B;  4WJQ A;  2KTR A;  2Y5B B;  3WIM A;  2JWZ A;  2IY0 B;  3KYC D;  3VAW A;  2CHX A;  4K7U A;  3IHP C;  3TBL D;  2O6V B;  2MX2 A;  3UQB A;  1K8R B;  1YX6 B;  4AJW A;  4MDK E;  2LXA A;  4I6L B;  3H1U A;  3AI5 A;  3PHW B;  3DPD A;  1Q5W B;  4TKN A;  3ZKJ C;  5IAA C;  2RR9 A;  2A4Z A;  2K6Q A;  2KWV B;  2ZNV C;  2KFK A;  2J0J A;  3EHV A;  2KWC A;  1ZKH A;  2GMI C;  2LRU A;  3P2B A;  2IO3 B;  2KXJ A;  2XK5 B;  3SU8 X;  3T8M A;  4FJY A;  1WE7 A;  1WR6 E;  2UWQ A;  3AU5 A;  3MJW A;  3WAM A;  3QX1 A;  3A1Q B;  3EFU A;  5IA7 A;  2KMC A;  5AZG A;  2KJH B;  2MA9 B;  2IY1 B;  2JRI B;  2DHZ A;  1WX9 A;  2BWE S;  4MM3 A;  1ZGU B;  4FN2 A;  2KX0 A;  4FUL A;  3RYT A;  2KWU B;  1FXT B;  1U4A A;  3ZRC A;  4F7Z A;  3NY5 A;  4DHZ B;  2N7D A;  1WR1 A;  3S2A A;  4G11 A;  4WWP A;  3L13 A;  5KHO A;  2KKC A;  4RMA A;  2K8C A;  2K8H A;  1E7V A;  4MGY E;  3DVN U;  4ZDV A;  1GUA B;  3UGB B;  4JL9 A;  1WGD A;  2V3S A;  2ZPN A;  4EEW A;  4EZL A;  2KTF A;  3D32 A;  4IM3 A;  1F9J A;  1UEL A;  2XBB C;  2KLG A;  3A9J A;  4HJK A;  2L0F A;  1GJZ A;  4HPL B;  4IM0 A;  2N9E B;  4NAW A;  1CMX B;  2N1V A;  5G55 A;  1YX5 B;  3RD2 A;  2N4F A;  4CYE A;  2WX1 A;  1WJ4 A;  3JVZ X;  3OAW A;  3TIX A;  3PT2 B;  5DPT A;  3VH3 B;  4TQ0 A;  4WWO A;  4KZ0 A;  4HK2 A;  1XD3 B;  2LGD A;  3KUZ A;  2KAN A;  2JVC A;  5CTR C;  3AU4 A;  5BO4 B;  4RM9 A;  1EF1 A;  1E8Z A;  1S1Q B;  1D3Z A;  3CST A;  4GDL A;  2PJH A;  2VRR B;  1WGG A;  1ISN A;  4PS8 A;  2REX A;  3ZO5 B;  4DHJ B;  5L83 A;  3UQA A;  3HIZ A;  2DZM A;  3W1Y A;  3QHT A;  2EMS A;  1WXA A;  5DPW A;  3A1Q A;  3QWZ B;  2L76 A;  3ZUN A;  1XQQ A;  3Q3J A;  2BYE A;  3VTV A;  3WAN A;  2DZK A;  2MBB B;  2MBE A;  3L17 A;  4W9I A;  1P98 A;  3JSV A;  1TTN A;  2KX3 A;  2KK8 A;  2RSU A;  1WMH A;  1E8Y A;  1V49 A;  3NOB A;  1J0G A;  3ZLZ A;  4EFO A;  5AZH A;  1SGH A;  4BBN C;  3KYD D;  1YIW A;  5G2N A;  2KQ7 A;  3B1L X;  3A33 B;  5LXI B;  2MLB A;  1MG8 A;  1X1M A;  3QK0 A;  4B95 A;  3PRZ A;  4BKS A;  2MP2 A;  3UIN B;  2N7E A;  3VH4 B;  4II2 B;  4DXA B;  1KLV A;  4BOZ B;  3VXW A;  1L7Y A;  4HXD A;  4ANV A;  2C60 A;  3VVW B;  1JRU A;  1WIA A;  1WE6 A;  2ZZP B;  2ZPY A;  3PRE A;  3RZW C;  1TBE A;  3MTN B;  3A9K A;  4I6N B;  4LJP B;  3SDL C;  2FCQ A;  3N30 A;  4MSM B;  4FJV B;  2FID A;  2KJR A;  2PPH A;  3NZS A;  3H7P B;  4DWF A;  2KNB A;  2J7Q B;  2ZEQ A;  3VUW A;  1RAX A;  3APC A;  4K81 A;  5CHF A;  3JYU A;  4TV3 A;  3WAP A;  1UBQ A;  1YQB A;  5DPR A;  4TUU A;  3A4R A;  5KHQ A;  3PLU A;  1NDD A;  5JH5 C;  5FR6 A;  4ICV A;  4RM8 A;  4M0W B;  3TMP B;  3DBL I;  2LXC A;  2MRP A;  5AZF A;  2KDF B;  3T9L A;  1EO6 A;  2J0K A;  4N9F 4;  3V6E B;  4BKS D;  2CU1 A;  4E71 A;  3PVL A;  5C23 A;  4FBJ B;  2C7N B;  5LXH A;  1WGH A;  2AWT A;  2JRH A;  3ZIM A;  3VUY A;  3TJP A;  3VDZ A;  1S3S G;  4WJO A;  4W9K A;  1UGM A;  2FCN A;  2JZZ A;  4DDG D;  3QCA A;  3R7Q A;  2KC1 A;  2KZR A;  3QA8 A;  3CMM B;  4PYU A;  2ZJD A;  5DPS A;  1LFD A;  3NHE B;  2BKR B;  1AAR A;  5D2M B;  4AOF A;  5E6N A;  1WFY A;  2FUH B;  3ZTD A;  2R2Q A;  2MCN B;  3APF A;  2V1Y A;  3A9K B;  2JY6 A;  3PZD A;  4MH0 E;  5JHB A;  4E74 A;  2LZ6 A;  2KQS A;  1H4R A;  3HM6 X;  2ZVO A;  3MHS D;  2ZCC A;  2D2Q A;  4MJS A;  1EUV B;  2EMT A;  2MW5 A;  4KIK A;  4P7I A;  2OJR A;  2OOB B;  2DAF A;  2R2O A;  3ML9 A;  4PS3 A;  4EZJ A;  4IW0 A;  4FAD A;  3V61 A;  2FCM A;  2LWP A;  1OEY A;  3PTF C;  1NBF C;  2CR5 A;  2FNJ B;  2C7H A;  3KH0 A;  4IUM B;  3R3M A;  2JT4 B;  3BY4 B;  2WYQ A;  3A4S C;  4MEM A;  1WRD B;  2IO0 B;  1WXM A;  4DBG A;  2JZ3 B;  5L95 C;  4GB9 A;  3H7S A;  5E6O A;  2I1J A;  2KDB A;  4GN1 A;  3PPA A;  4W9D A;  1EF5 A;  4AUQ C;  3V62 A;  4BKT A;  2K25 A;  2BF8 B;  4HCP B;  2KVR A;  4W9L A;  1E7U A;  3ZW3 A;  4IC7 B;  3WA0 A;  4URK A;  3L08 A;  1WGR A;  2GBR A;  1TGZ B;  4GSW A;  4OVV A;  4ZYN A;  1Q0W B;  3M62 B;  1WGY A;  4ANW A;  2I1K A;  1WJ6 A;  1WMH B;  5LLI A;  2M17 A;  4YL8 A;  3A9J B;  1E8X A;  3AXC A;  2G4D B;  2GBJ A;  2LJ5 A;  3NS8 A;  3U7D A;  2IO1 B;  1WJU A;  4IWP A;  3K9O B;  1VD2 A;  5CX3 A;  3ZNI D;  4W9C A;  3UIP B;  1WM2 A;  3IG3 A;  5C1Z A;  3OJ3 A;  2KO3 A;  4KDL B;  2MQJ A;  1LXD A;  5E6P A;  4NNJ B;  3EC8 A;  1WX8 A;  1PQS A;  4KV2 A;  2A5U A;  1UBI A;  4TQ1 A;  2NS5 A;  1R4M I;  2O6V D;  4FHJ A;  4BVU C;  1C3T A;  2D11 A;  2RD0 A;  4W9G A;  1I42 A;  1YD8 U;  4EUT A;  1QZE A;  5D7G A;  2JF5 A;  3SHQ A;  3AUL A;  4DK5 A;  2AL3 A;  1ZW7 A;  4FLH A;  4MSQ B;  4W9H A;  5GMV A;  4NQL B;  2M0X A;  2XEW A;  2WX0 A;  4KSL C;  4K7W A;  1P9D U;  2GBN A;  2LI5 A;  2KLC A;  4G3X B;  4MEL A;  4DDI D;  1V86 A;  3V60 A;  2BPS A;  4HLE A;  3ALB A;  3BIN A;  2XK5 A;  3B0A A;  2MBO A;  3ML8 A;  4GU2 A;  2LVQ A;  2NCN A;  4OVU A;  5TR5 A;  4XZ4 A;  1V2Y A;  4HDQ A;  1KJT A;  4GIV A;  3I3T B;  3TCA A;  2DX5 B;  3R7R A;  2DYO A;  3JW0 X;  1WZ0 A;  2NBW B;  2GBM A;  3JSV B;  1WYW B;  2IYD B;  2QHO A;  3EEC A;  3QJZ A;  4JLC A;  2ZVN A;  3OLM D;  3QAR A;  4AJY B;  4K1R B;  2O2V A;  1RRB A;  2NPT B;  2AYO B;  2KOX A;  3V6C B;  3N32 A;  1UZX B;  2KDE B;  4ZRK A;  2KFJ A;  1WXV A;  2NBV B;  5DCN A;  2LGY A;  2O6V A;  4JIO U;  4NJ6 A;  1P1A A;  2ZNV B;  4W9F A;  4WWN A;  2BKF A;  3ZVV A;  4HWI B;  3UF8 A;  3ZNG C;  2NVU I;  2HJ8 A;  4ICU A;  1WXS A;  2CS4 A;  2PE6 B;  1GC7 A;  4GDK B;  4KSK C;  1OQY A;  2MWS B;  3KUD B;  2MBQ A;  1XT9 B;  4GOC A;  1WM3 A;  3SD5 A;  1RFA A;  2M1M A;  2CKH B;  2RGF A;  3IFW B;  2LVO A;  4ZRI A;  2DZI A;  3DCG A;  2BWF A;  2UYZ B;  1BT0 A;  3RUI B;  4LDT D;  2G4S A;  2RPQ A;  1V80 A;  1WI0 A;  4PS7 A;  1GG3 A;  3O65 B;  1Q1O A;  4M8N A;  4CHK A;  3K9P B;  1WX7 A;  2WDT B;  2HTH A;  2LUE A;  2MSE D;  4DHZ E;  2BGF A;  3H6N A;  2B3A A;  3H9D A;  2D3G A;  4EZK A;  4K7S A;  4NJ7 A;  1C1Y B;  3UIO B;  2FCS A;  2YVC A;  3U30 A;  3M95 A;  4NY0 A;  3RCZ A;  2NBU A;  2K39 A;  2AL6 A;  1LM8 B;  3ZRF A;  4AWJ A;  1VCB A;  3CF6 E;  3KUC B;  4F8C B;  2N9X A;  2K6D B;  4KZC A;  4BFR A;  3ZNZ B;  3VUX A;  5JZE B;  1V5O A;  5CHW A;  1R4N I;  1J19 A;  3HM3 A;  2YLM A;  4A3P A;  4E3C A;  2G45 B;  1GNU A;  2MBH A;  3APD A;  1A5R A;  2BYF A;  2M4N A;  4JGH B;  2EKE C;  4BKG A;  5J2R A;  3DVG Y;  5D6J B;  3L10 B;  5J18 A;  3QQ8 B;  1IPG A;  2D10 A;  3KVF B;  3PS6 A;  4ZRJ A;  3WAO A;  1WH3 A;  4WJP A;  3X0W A;  4XC2 A;  1OEY J;  3DQV A;  3IVF A;  4FA6 A;  2N9P C;  3ONS A;  2L00 B;  2J0M A;  1P3Q U;  3PSE B;  3ZTC A;  4XX5 A;  2FAZ A;  4MJS B;  3ENE A;  5JHA A;  3DBH I;  4I6P A;  3WAL A;  2V4L A;  1E90 A;  1UH6 A;  2W9N A;  5HKH A;  2C7M B;  2KN5 A;  5J17 A;  4DHJ D;  2KDI A;  3DBR I;  4FJZ A;  4ANU A;  4B6W A;  1H8C A;  3IBE A;  3L0W B;  2KMA A;  3X23 A;  3GZN I;  4ANX A;  3TL5 A;  4LCD E;  3QIJ A;  3PHX B;  1L2N A;  3DDC B;  2KHW B;  3U8Z A;  2KC2 A;  3W1S C;  1RLF A;  1GC6 A;  3ZDT A;  5AEK B;  2IZV B;  3H7P A;  2ZCB A;  1I35 A;  2PEA A;  2BYV E;  3DVN V;  1IP9 A;  2ASQ A;  4GDL B;  4MGK E;  1OTR B;  2JPH A;  3W1S A;  1Z5S B;  1Y8R C;  3KW5 B;  1G6J A;  2Z0D B;  4HDO A;  3RZF A;  2HD5 B;  1Z2M A;  4KDI C;  5D94 A;  4W9E A;  1V9J A;  2D07 B;  3Q3F A;  4MGI E;  4X57 B;  2LVP A;  3VHT C;  5CHV C;  2O2V B;  3L16 A;  4G50 A;  4WJN A;  2Z59 B;  4BOS C;  4GGQ A;  2L0T A;  2K8B A;  4WQO B;  4JQW C;  2M8S A;  1KM7 A;  1J8C A;  4HCN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...