2AL3A

Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
SAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUG long isoform
publication title Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11470 TUG-UBL1 TUG ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al3A00
1GUAB 3TCAA 3R7RA 2NPTA 4ANVA 2KC1A 4ZDVA 4EUTA 1I35A 2KWUB 3QARA 4G3XB 4GN1A 1WM3A 1VD2A 4GDKB 3B0AA 3VVWB 3ZKJC 1WJ6A 4NAWA 4PYZA 1WGYA 4KIKB 5J17A 4LDTB 3NZUA 3MJWA 3GOEA 3H6NA 2KQSA 1WI0A 2K8BA 3U7DA 3ONSA 3H9DA 4NJ7A 4EZLA 2KC2A 3DPDA 3WANA 3WALA 1IP9A 2OJRA 1WZ3A 4BBNF 3QK0A 2I1JA 3QJZA 3UF8A 2R2OA 4A3OA 4FJVB 4MGYE 3NOBA 1L2NA 2GBMA 1TZ1A 1YD8U 1ZW7A 4KZCA 1WXAA 3TBLD 2J0JA 2PPHA 4DHJB 3Q3JA 1HE8A 1BT0A 2L3ZA 3DVNV 3H7PA 1WXVA 2BYVE 1I42A 2NPTB 1IYFA 2KDBA 4GB9A 4ASWC 2IYDB 2MW5A 5BO4B 3PHXB 1E7VA 2WX0A 4NAWB 4IM0A 4URKA 3N30A 3CSFA 4JLCA 2MWSB 2FCMA 4W9FA 5D94A 3WAOA 1GNUA 2MBEA 2L00B 2LWPA 3NZSA 4GIVA 3K9OB 2IO3B 3H7SA 3V6CB 2G45B 4BOSC 1UD7A 2L76A 5LXIB 4JIOU 4A3PA 2FAZA 3KH0A 3L16A 1R4NI 3IHPC 3W1SA 3HK0A 2IO0B 3RUIB 2RSUA 1EO6A 3P2BA 2DX5B 1NBFC 4F7ZA 1J8CA 2CS4A 2L0TA 2AL3A 3LDZE 4EOYA 4ZRJA 2LXAA 4W9DA 3H7PB 3ML8A 5E6OA 1OEYJ 4AJWA 4E71A 4LDTD 1TGZB 4I6NB 4WJOA 2Z0DB 3B08A 4IG7B 1OGWA 4GGQA 3I3TB 4JQWC 2BPSA 5D2MB 2JT4B 2M0XA 1P0RA 2LD9A 1YJ1A 2GBJA 2LZ6A 2UWQA 2NVUI 2ZCBA 3KYCD 4DBGA 1G6JA 1WGGA 2YLMA 4YL8A 3VFKA 1UZXB 4TQ1A 3PHWB 3SD5A 3ZNID 1H8CA 4M8NA 3OJ4B 4A20A 3VQIA 2AL6A 2GMIC 4CHKA 4DHJD 1V80A 1NI2A 3VUWA 3CMMB 2C7HA 4F8CB 4WQOB 2ZJDA 3HHMA 2KJHB 2JVCA 1KJTA 2BWES 5E6PA 2K25A 3OLMD 1WE6A 4MDKE 2PE6B 4KV2A 2MBOA 2ASQA 2KHWB 1YIWA 2KZRA 2GOWA 2M17A 3RULA 5IA7A 1UH6A 1SGHA 3R7QA 4FULA 2WX1A 3L08A 4KDLB 1RFAA 1P98A 3PREA 3DBHI 3AI5A 3IBEA 1Z5SB 3PRZA 2DAFA 5CX3A 3ZTCA 2KX3A 4BKGA 2KDIA 2AEHA 2O2VA 3A4RA 3APCA 4XC2A 2KNBA 4CO7A 5L95C 1VCBA 2KJ6A 4FLHA 3MTNB 4IUMB 1WM2A 3U30A 3R3MA 1WJNA 2ZZPB 2R2QA 3H1UA 1LM8B 4FJYA 4W9GA 2O6VA 4XX5A 4ZRKA 1KOTA 3N32A 1EF1A 4X57B 2KLCA 3KUZA 5G55A 2EKEC 2KTFA 3ML9A 3TL5A 3VDZA 2W9NA 4GMVA 4J6IA 2M1MA 1Q0WB 1NDDA 3L10B 3DBRI 4NQLB 4KZ0A 3HM6X 5KHQA 3DBSA 5JHBA 2K8CA 5G2NA 3QX1A 4MGZE 2PE9A 1ISNA 2VRRB 2MBQA 2RPQA 2DZMA 2KO3A 4W9KA 1GC6A 4M0WB 3ZVVA 3ZTDA 2MBBB 2O2VB 2MBHA 2DZIA 2DAJA 5DPTA 1WMHA 4ZYNA 5IAAC 2BKRB 2D11A 2DZJA 2OOBB 3APDA 2RGFA 2KK8A 3TMPB 2G4DB 2V1YA 2FCNA 3M3JA 2GBKA 3EC8A 4G11A 3ENEA 2LI5A 3PRMB 4MJSA 5D7GA 4WJNA 2O6VB 2ZVOA 3PS6A 2EMTA 1UELA 4AJYB 3UINB 5E6NA 1WJ4A 2N9PC 3IVFA 1WX9A 2BYEA 3NHEB 3EHVA 3Q3FA 3U8ZA 1TBEA 1WR1A 2N9XA 2K1FA 1Y8RC 2LVPA 1WIAA 3S2AA 2CR5A 4NPNA 4EZKA 3L54A 3QHTA 2LGDA 5EDSA 1A5RA 4IWOA 2DYBA 2Z0EB 4W9EA 5DPSA 1KLVA 4HPMB 4MEMA 5DPRA 4NNJB 4WAAA 1U4AA 1SIFA 3W1SC 2JUOA 2MRPA 2KX0A 3ZRCA 1TTNA 2J0KA 4RM8A 4M8MA 1E7UA 3RT3B 1WMHB 4NY0A 3EFUA 3PV1A 5JHAA 1V6EA 5JZEB 2CHWA 4MJSB 1SE9A 2CKHB 2IO1B 3APFA 4NQKE 4LCDE 4DXAB 1WE7A 1J19A 3NY5A 3ZRFA 4K1RB 3VTUA 3VUXA 4LJOB 3A1QA 3M95A 1WZ0A 3TJPA 1GJZA 1V9JA 4HCNB 3WA0A 3NS8A 2CHXA 3KW5B 2KKCA 3PSEB 4HJKA 1P9DU 4CYEA 2D10A 2LUEA 2N7DA 4N9F4 4B95A 3PRPB 3PZDA 4HXDA 3QIJA 1V86A 4HPLB 2K39A 5D6JB 3A9KA 3N3KB 2XK5A 1MG8A 3L17A 3ZIMA 2K6DB 4HWIB 4BOZB 1GC7A 1WY8A 2O6VD 1Q1OA 3PTFC 5GMVA 4B9KA 3D32A 2BWFA 1F9JA 1EF5A 2HE7A 2LJ5A 1OQYA 1E8YA 2GBNA 1V49A 4IC7B 3MHSD 2N9EB 2DYOA 4ICVA 4BKTA 1ZGUB 3A1QB 4ICUA 5AZFA 3WAMA 2PJHA 1LFDA 3SU8X 3UQAA 2MX2A 1YX5B 2ZCCA 2KLGA 3V60A 2MSED 3KVFB 4JL9A 2FIFA 1UGMA 4OVVA 2DENB 2L05A 4PS8A 1UBQA 1ZKHA 2I1KA 2KVRA 3DOWA 3ECIA 1E5WA 4LJPB 5CHWA 2ZNVB 4FA6A 4WJQA 1XT9B 3UQBA 2C7MB 3A9KB 1H4RA 2XK5B 4HLEA 4FBJB 4GXBA 3VTVA 2BF8B 1E90A 2G4SA 4W9CA 3PLVA 2LVQA 2RR9A 3VH3B 4IWQA 3ZO5B 3ZUNA 5L83A 3AXCA 3QWZB 4TUUA 4G50A 2XEWA 2JF5A 2LRWA 4JGHB 3VAWA 3X23A 4KSKC 4NJ6A 4KVGB 2JXXA 4MGKE 4I6PA 1S3SG 3RZFA 4F1SA 5AEKB 4HDOA 1V5TA 5JH5C 4ANXA 2L8JA 2BKFA 1PQSA 1C3TA 2MP2A 4KSLC 4WWOA 3WIMA 1Q5WB 1X1MA 1WF9A 2KWCA 4XZ4A 4K7SA 4W9IA 2JRIB 1WR6E 3VXWA 2L0FA 1AARA 3KUCB 3DBLI 3KUDB 2V4LA 4MSMB 4FHKA 3W1YA 1WGRA 2KOXA 1S1QB 2C60A 4MH0E 5LXHA 2N1VA 4OVUA 3M62B 2AWTA 5C1ZA 3QQ8B 3K9PB 3B1LX 2IY1B 2IY0B 4K7UA 3X0WA 2EMSA 3L13A 2KANA 2BYFA 1WGDA 3HM3A 4MSQB 4ANUA 4TV3A 5HKHA 2RD0A 3DCGA 4IM2A 2N7EA 2JRHA 4BKSA 1YQBA 3ZNGC 3IG3A 2XBBC 3M63B 3ZNHB 2CHZA 3BY4B 2KWVB 4IW0A 1P1AA 2ZPNA 2IBIB 4K81A 2KJRA 1QZEA 1JRUA 2MLBA 2LASA 2ZVNA 2MP2B 1E8XA 2K6QA 2A5UA 4GDLA 1WXSA 5TR5A 1GG3A 4DDID 4KDIC 4FADA 3OJ3A 4G0NB 3T9LA 4AUQC 4TQ0A 1EUVB 1R4MI 2JY6A 3OAWA 2WYQA 2HD5B 2ZPYA 4PS3A 2KTRA 4TKNA 3TIXA 3VH4B 1M94A 3IFWB 3ALBA 2MA9B 2LXCA 2REXA 4AP4C 2FUHB 1E8ZA 2D2QA 3L0WB 1V5OA 1L7YA 2G3QB 2NBWB 2KMAA 4FN2A 3O65B 4GSWA 3HIZA 2J0MA 1E8WA 2NBVB 3EECA 3BINA 3QAQA 4P7IA 2C7NB 4WWNA 2AYOB 3LJ3A 2Y5BB 3JYUA 2JZ3B 4E3CA 2NCNA 2FNJB 1WYWB 2ZNVC 2DZKA 4GDLB 3GZNI 2KMCA 5CHFA 1XD3B 4ZRIA 3AU5A 2KFJA 3DVGY 3RCZA 2JPHA 2M4NA 2IZVB 3JSVA 1C1YB 4PS7A 1T0YA 1IPGA 3JW0X 5J18A 3ZDMC 4IWPA 1LQBA 3RYTA 2JWZA 2KTRB 4HK2A 4WWPA 1UBIA 2C9WB 2BGFA 1KM7A 3A33B 1WXMA 3DDCB 3CSTA 4FJZA 1WJUA 3QC8B 2KFKA 4WJPA 4IM3A 1K8RB 3V6EB 2KXJA 4FHJA 3V61A 4DK5A 3A4SC 3UIPB 3KYDD 5DCNA 3PT2B 4PYUA 1XQQA 3UGBB 3CF6E 4BVUC 5FR6A 3R66C 1FXTB 1WX8A 4AOFA 2KDEB 2MQJA 2IO2B 2MCNB 3PGEA 4BFRA 4B6WA 2L7RA 5AZHA 2M8SA 4RMAA 4II3B 3PLUA 4HCPB 3ZDTA 1V2YA 2FCSA 2K8HA 2KQ7A 2YVCA 4ANWA 5J2RA 1WFYA 3ZLZA 1D3ZA 1WX7A 2DYMA 3A9JA 3PVLA 3JSVB 4BBNC 4DWFA 2HJ8A 2N1WA 2KD0A 2Z59B 3AULA 2D3GA 3DVNU 2DHZA 3SHQA 2NBUA 1OEYA 4AWJA 5CHVC 2N4FA 2WDTB 2NR2A 3PPAA 4BKSD 3RZWC 2KFKB 1OTRB 3QA8A 4HDQA 4W9JA 3QCAA 3VUYA 2LVOA 2B3AA 3SDLC 2ZEQA 1J0GA 1WH3A 2A4ZA 5CTRC 4I6LB 2HTHA 2D07B 4DDGD 3ZNZB 1V81A 2CU1A 4MGIE 4GU2A 4E74A 3VHTC 1CMXB 4EKUA 4EFOA 5KHOA 4W9HA 2GBRA 4EEWA 3AU4A 2WWZA 3DVGX 5C23A 3A9JB 3DQVA 2PEAA 4GDKA 3ZW3A 2KN5A 2V3SA 2KDFB 4KIKA 2LRUA 1LXDA 4II2B 2FIDA 4MELA 2NS5A 3WAPA 1RAXA 2C5LC 4DHZB 3RD2A 3UIOB 3C0RB 4K7WA 1P3QU 4GOCA 4W9LA 5LLIA 3V62A 3JVZX 2J7QB 2UYZB 1RLFA 2LGYA 1Z2MA 2FCQA 3VTWA 2LGXA 4RM9A 5DPWA 1YX6B 4DHZE 2QHOA 1WGHA 5AZGA 4MM3A 4EZJA 2JZZA 3T8MA 4HVBA 1RRBA 1WRDB
chains in the Genus database with same CATH superfamily
2J53A 3W5UB 1XLNA 1HZ6A 4M02A 2GRIA 4GDKB 5H8YE 4NAWA 4AQ7A 3NZUA 2KQSA 2K8BA 3U7DA 3ONSA 4KGSA 4NJ7A 3WANA 3ZQ4A 3WALA 3RPFC 3UF8A 2M0AA 1KLUD 1YD8U 3TBLD 3R2IA 1LO5D 2L3ZA 1D5MC 3DVNV 4MM3B 3MC9A 5D3IB 2BYVE 1FXIA 4ASWC 1KFYB 2KYWA 2MW5A 2WXQA 3BWUD 4IM0A 1F2RC 4W9FA 3VRBB 5MPOA 5IN7A 1QKZA 2N7JA 3AH7A 1QF6A 1XXGA 2UU7A 4BOSC 1UD7A 1C9FA 1PDXA 1XCQL 2FAZA 5AUIA 3L4PA 2IO0B 3RUIB 3P2BA 2DX5B 3HVZA 4ZRJA 1YJJA 4AS1A 1L4ZB 4ITKA 1T0RC 5D3DA 2M0XA 1P0RA 1I4XA 1YJ1A 2GBJA 2FUG1 3H8HA 3GZNB 4WH4A 1PGBA 3VQIA 2AL6A 2GMIC 1GAQB 1ET6A 4WQOB 4YSXB 2JVCA 2WP9B 3GP7A 4LNIA 5IA7A 1JWMD 4KDLB 1RFAA 1E7PB 3DBHI 2WXHA 1NVID 3PRZA 1M4VA 2KX3A 2KDIA 4C4VB 2O2VA 1C4AA 2J4XA 2WDRB 4CO7A 3SR6A 1PGXA 1WM2A 4B0EA 2VZKD 1WJNA 2LFIA 3R3MA 3LXFA 3H1UA 4X57B 3AE2B 3KUZA 5G55A 3TL5A 4ARCA 4J6IA 2M1MA 1NDDA 3DBRI 3VRAB 3GE8C 4LNFA 3IXSA 2K8CA 2PE9A 1ISNA 2DZMA 1GC6A 4M0WB 5G5HA 3ZTDA 2WDVB 2MBHA 2DAJA 1QOGA 2K3UA 3ENEA 5D7GA 3R2TA 2O6VB 2WXRA 1J7BA 4AJYB 2X8XX 2N9PC 2WHIA 3EHVA 3Q3FA 3U8ZA 1TBEA 1WR1A 5IOIA 3NZ3A 2LVPA 1GB4A 4NPNA 3ABVB 1A5RA 5EDSA 2KAJA 1QOBA 4MEMA 4NNJB 4WAAA 4OW0A 2MRPA 3ZRCA 3AE5B 1WMHB 1VZ6A 3AV8A 3PV1A 2CHWA 5EE1A 2ICIA 3IT4B 4LCDE 1VJKA 5FR3A 4LNNA 3A1QA 1GJZA 1V9JA 4HCNB 3WA0A 4XWWA 1T5XD 1L6VA 3KW5B 3PSEB 2JSVX 1JWBD 3DHHC 4HJKA 4CYEA 1HTQA 2DWQA 2N7DA 2LUEA 4B95A 4HPLB 3BYYB 5D6JB 1YJIA 4XE0A 1MG8A 3RNGC 2NMQA 3L17A 2K6DB 2DNFA 1YQ3B 4DXFA 2BWFA 2CJOA 2HE7A 1V49A 4HEA1 2IGDA 4BKTA 5AZFA 1E10A 3SU8X 2MX2A 1YX5B 2ZCCA 3CWIA 1V1PA 2FIFA 2LJIA 2BBCA 2G9HD 4FA6A 2GI9A 4WJQA 1JWAD 3P4RB 3VTVA 1I4HA 3PLVA 3ZO5B 2RMMA 3QWZB 4RGOS 2LRWA 4KSKC 2JXXA 4MGKE 1JQ4A 3AE3B 1V5TA 1I4PA 1ZP0B 4WWOA 4C00A 1RM6C 1WF9A 1X1MA 3TEYA 2JRIB 2JYEA 3N9YC 4RF0A 1AARA 3DBLI 1FXAA 3KUDB 1DYQA 1IGCA 4MSMB 5FKAC 4ZYSA 5BMGA 4MH0E 4ZOHC 2GB1A 4OVUA 5C1ZA 3X0WA 4K7UA 2EMSA 1FNWA 4JWSC 1WGDA 4ANUA 2RD0A 3DCGA 2N7EA 4BKSA 4ARIA 2BQQA 2KWVB 4GDLA 2MP2B 1E8XA 1WXSA 1GG3A 4HKZE 4FADA 1EU3A 3T9LA 1EUVB 1SJHD 2JY6A 2WYQA 3IAS1 2DBYA 2ZPYA 4PS3A 2KTRA 1TS3A 1JWSD 2D2QA 1L7YA 2G3QB 4FN2A 1K53A 3EECA 1T0SC 2X38A 2Y5BB 3JYUA 3GB1A 2JZ3B 1WYWB 2ZNVC 1FNVA 2DZKA 3GZNI 3DWMA 4ZRIA 2KN4A 2M4NA 2IZVB 2NTSA 1WSPA 1C1YB 4PS7A 1NEKB 2WQYB 1MHHE 2BGFA 1WXMA 3TUOA 3DDCB 1YMHE 1WJUA 1UNSA 2KFKA 4IM3A 1K8RB 3V61A 3KYDD 3PT2B 4PYUA 4QAYA 3UGBB 3CF6E 5FR6A 3R66C 1FXTB 2KDEB 2MQJA 2M8SA 3PLUA 1V2YA 1QOAA 4N6EB 5J2RA 1WX7A 2DYMA 1YOVB 2J52A 1RFKA 3T3NA 1PYWD 2KD0A 2BS3B 2Z59B 4N59A 4P6VF 4RGMA 1OEYA 1TJEA 5CHVC 2NR2A 1TS4A 1TY0A 2M56B 3PPAA 3BVZA 3RZWC 1ZUD2 3QA8A 2ZEQA 1J0GA 2E6XA 1ZXIA 3AEEB 2CU1A 4E74A 4EKUA 2PIAA 2GBRA 1HTOA 1NENB 1V1PB 2PEAA 4KX6B 4GDKA 2WNMA 1MI0A 4XYCA 1D6EC 3WAPA 4DHZB 2K9XA 4W9LA 1Z2MA 3DBHB 2W3RA 2LGXA 4RM9A 5DPWA 4L2YA 1PGAA 2L1AA 1B1ZA 3U7ZA 2D3CA 5AZGA 4EE2A 2J42A 4MM3A 4EZJA 2JZZA 2KMMA 3VVWB 3TCAA 3R7RA 4ANVA 4HRSA 4A55A 1TS5A 2KWUB 3QARA 2I38A 3RNBC 1FD6A 1WJ6A 5J17A 4KIKB 2AQ3B 3H9DA 1T3QA 1TZOA 2TSSA 3ZXVA 3DBRB 2ZW0A 2Z8LA 3QK0A 3QJZA 1L4DB 2N9KA 4FJVB 3EUB2 1TZ1A 2J0JA 1CK1A 2PPHA 3BYTB 4HKQA 2LMCA 5IKCM 5BYRA 1WXVA 4RGTA 3ZYYX 4C56C 1A70A 4CQNA 4JPSA 2R61A 1F0ZA 5BO4B 2WX0A 2JX5A 1FFUA 4JLCA 3WAOA 1J7AA 2LWPA 1JW9D 1R7SA 1UWMA 1FO4A 5LXIB 4Q2JA 3NVWA 4A3PA 1R4MB 1R4NI 3IHPC 4UDUC 3W1SA 3Q14C 3Q8FA 2RSUA 1EO6A 1J8CA 4YXDB 2AL3A 2I2YA 3H7PB 2PLPA 4LDTD 3ZJTA 2YEPB 2Z0DB 3B08A 3MP9A 1J7CA 2KWDA 2BS2B 4JQWC 2JT4B 4NAMA 3BK2A 2JZPA 2MJDA 1G6JA 4DBGA 2YLMA 1UZXB 1H8CA 1QQRA 2PKOA 1T6BX 4C4VA 4DHJD 3VUWA 5E6JA 5FK9C 2KT7A 2JYTA 3HHMA 2KJHB 2L83A 5E6PA 3OLMD 4YSZB 2PE6B 4KV2A 2MBOA 2KHWB 2KZRA 2GOWA 1UH6A 1SGHA 3R7QA 1TY2A 1FRRA 1FNUA 5GXGB 3ZTCA 4BKGA 5BYSA 1VZ7A 3A4RA 1XLPA 5L95C 1TT5B 4IUMB 2O6VA 4XX5A 1EF1A 2MHJA 2KTFA 3ML9A 1LGRA 4GMVA 1Q0WB 5EE0A 1GPXA 3L10B 3HM6X 3BVMA 5JHBA 5G2NA 3QX1A 4S0RA 1AW7A 4O1NA 2CJNA 5DPTA 1WMHA 3APDA 2RGFA 1HA5A 1IBXB 3EC8A 3Q3OC 3I63C 2LI5A 3PRMB 2OEDA 3DBLB 3DHGC 2ZVOA 2EMTA 1WXQA 1MHXA 5E6NA 1TIFA 3IVFA 3NHEB 2W3SA 4RNAA 2W55A 1Y8RC 1WIAA 4ZHOA 2CR5A 3AEFB 4EZKA 3QHTA 1XCTL 3EFCA 3URYA 5DPSA 2ZW1A 3U52E 4YT0B 2B76B 3FAHA 2JUOA 2KX0A 2J0KA 1N5XA 4M8MA 1E7UA 3EFUA 2K22A 5JHAA 2W82A 1V6EA 2QSDA 4MJSB 1SE9A 2CKHB 2IO1B 4A90A 4DXAB 1J19A 3VUXA 4LJOB 3E56A 3NS8A 2CHXA 2KKCA 1P9DU 3AE9B 3PZDA 1F2RI 1HQRD 4HXDA 3QIJA 1V86A 2K39A 3ZXRA 1D5ZC 4RH6A 5AUKA 1GC7A 1WY8A 5GMVA 3Q69A 3D32A 1E8YA 5BMHA 3MHSD 2LEKA 1ZGUB 2PJHA 1LFDA 3UQAA 5TSSA 3V60A 1I4GA 1HXYD 4JL9A 1UGMA 4OVVA 2L05A 3ZJVA 2KVRA 1SB3C 4LJPB 5CHWA 2ZNVB 1C4PA 1XT9B 2C7MB 4HLEA 2G1EA 2WXPA 3I57A 4FBJB 2BYTA 2INCC 1Y56A 1E90A 3LYYA 5L83A 4TUUA 1F52A 4JX1C 4JGHB 3X23A 2BTEA 3RNEC 4KVGB 1S3SG 3TEWA 4F1SA 1HEZE 3RNFC 5AEKB 5IP4D 1EU4A 1DOXA 3KLSX 1P7FA 4ANXA 1PQSA 2QMTA 2MP2A 1CQVA 4XZ4A 4K7SA 1WR6E 1SE4A 3AM9A 3KUCB 4FHKA 1WGRA 2KOXA 1S1QB 5LXHA 3MC0B 3M62B 2VH1A 3FILB 2WDQB 3RNCC 2KANA 2ONQA 1C79A 3I5JC 2JRHA 4J3OD 4XDCA 4JE3B 2CHZA 1P1AA 2ZPNA 1QZEA 2LASA 4GLSC 2K6QA 1R4MI 1QILA 4KKIA 3OAWA 4RFBA 3Q8EA 3VH4B 3IFWB 3C8YA 4MACA 2MA9B 3BK1A 1E8ZA 1V5OA 2NBWB 3KQ4A 4P7IA 1ET9A 2AYOB 1XLOA 4M00A 3P1MA 2NCNA 2CU3A 2KMCA 1XD3B 1E9MA 2HJ1A 1T0YA 2KVZA 3VR8B 5J18A 3ZDMC 4HK2A 2C9WB 3CSTA 4FJZA 2EKIA 3QC8B 1UF0A 2WXGA 5DCNA 1XQQA 1VRAB 1SJED 3EA6A 4AOFA 1HZ5A 4B6WA 4REZA 5AZHA 4II3B 1YN3A 2FCSA 2K8HA 1R4NB 3PVLA 1ROEA 4DWFA 2HJ8A 3OG5A 4C80A 3RMKC 3AULA 3DVNU 2NBUA 3U4EG 1KH0A 2WDTB 4LTUA 3E9SA 3V3XA 4BKSD 1OTRB 4HDQA 3B9JA 2B3AA 2WXJA 1FMAD 4DDGD 1YN5A 4MGIE 4YSYB 1XLQA 3U2SC 4W9HA 1OQQA 4EEWA 2WWZA 1V8CA 5C23A 3R8BA 1UGJA 3DQVA 3ZW3A 1C76A 4KIKA 5EE9A 2LRUA 3BZDB 3SFEB 4II2B 4MELA 2NS5A 4H2AA 1D4BA 2C5LC 1P3QU 1KRHA 1ZE3D 3N1ZC 4GOCA 5LLIA 1SIJA 3NJTA 4HPPA 2J7QB 2LGYA 1CJEA 5C3JB 4DHZE 1ZXHA 3DHIC 1WGHA 1MJDA 3T8MA 1DOIA 2EELA 1L0YB 1CZPA 2ON8A 4EUTA 1I35A 4G3XB 4GN1A 1WM3A 1VD2A 3H6NA 1WI0A 2K5PA 3P63A 2M19A 2KC2A 3DPDA 1IP9A 2OJRA 2SEBD 1WZ3A 2D5GA 3NOBA 1KF6B 1L2NA 1ZW7A 4KZCA 1WXAA 1TYGB 3Q3JA 1HE8A 1BT0A 3H7PA 1MPEA 1I42A 2NPTB 2V9HA 2KDBA 4GB9A 2HTME 1E7VA 3AEBB 4URKA 3N30A 3CSFA 2MJEA 2MWSB 2FCMA 1OQRA 1GNUA 2MBEA 3NZSA 3H7SA 3PO0A 3V6CB 4HROA 1YN4A 2JQRB 2G45B 2L76A 1ZDXA 3MHZA 3HK0A 1NBFC 2L0TA 1JWUD 4W9DA 3ML8A 1OEYJ 2VZKB 1VZ8A 2WXMA 4WJOA 3VR9B 4IG7B 3WCQA 3ETRA 2BPSA 2LD9A 2LZ6A 2NVUI 2ZCBA 1WGGA 4YL8A 3VFKA 3SD5A 3ZNID 3OJ4B 1SSNA 3B2GA 4WWMA 3CMMB 2C7HA 4F8CB 2ZJDA 1TKGA 3PZ8A 1L5PA 2BWES 1V97A 2K25A 1JALA 1MFWA 1WE6A 4MDKE 2H88B 4S17A 2ASQA 2M17A 1I4RA 3L08A 2IGGA 1NYQA 1GOZA 3AI5A 4A8XC 4KKJA 3MJ5A 1YNTE 5C2TB 5CX3A 1D5XC 2AEHA 1L0VB 3APCA 2KNBA 1VCBA 2KJ6A 4FLHA 3MTNB 1N62A 1FFVA 1IBXA 1LM8B 3N32A 1C4CA 1L6UA 3VDZA 2W9NA 4NQLB 1L0XB 4KGRA 4MT5A 2MBQA 2RPQA 4W9KA 1JMLA 3ZVVA 1P7EA 2MBBB 4PT5A 2DZIA 1T0QC 2Q5WD 4ZYNA 2DZJA 5IAAC 3TMPB 2V1YA 1N61A 2WGSA 2QCZA 4MJSA 4WJNA 3PS6A 2OHFA 1UELA 2PMVA 2Y3AA 1ESFA 3N20C 1WJ4A 3MFGA 1WX9A 2BYEA 2N9XA 2LGDA 4IWOA 2Z0EB 4L1BA 5I4DA 2GLSA 3C19A 5DPRA 1SIFA 1FRDA 5JZEB 3APFA 2OJWA 4NQKE 1SBBB 1WE7A 3NY5A 4US9A 1WZ0A 3TJPA 2KQ4X 3Q2AC 2D10A 1STEA 2LHEA 2MJ3A 3AEGB 2JU6X 3N3KB 4XDDA 3ZIMA 3Q3NC 4HWIB 5G5GA 2O6VD 1Q1OA 1UUPA 1EF5A 2LJ5A 4ACFA 1OQYA 3RN9C 1FPYA 2SAKA 4NJCA 2N9EB 2DYOA 4ICUA 3WAMA 2RPVA 2KLGA 4RGNA 4FXCA 2MSED 3KVFB 2V4IB 1UWXA 3T3OA 1UBQA 1ZKHA 2I1KA 2LGSA 3DOWA 1E5WA 3UQBA 3A9KB 1H4RA 2XK5B 4A9AA 2G4SA 4W9CA 2LVQA 2RR9A 3VH3B 4IWQA 3FILA 3AXCA 2KACA 2V3PA 1ENFA 1XO3A 4HDOA 5JH5C 2ACZB 2INNE 2BKFA 4KSLC 3WIMA 2KWCA 3VXWA 2L0FA 2V0GA 4ZHPA 2V4LA 4B0MA 2C60A 1TKYA 3NG0A 1WWTA 2AWTA 3K9PB 2IY1B 2IY0B 3L13A 3RFZB 2BYFA 1WYGA 4US8A 3AE4B 5HKHA 4TV3A 4IM2A 1WGKA 1YQBA 4JWUC 3IG3A 2XBBC 2IBIB 4DQOC 2KJRA 2ZVNA 4DDID 4KDIC 4G0NB 1IUEA 4AUQC 4TKNA 3HVDA 3TIXA 3ALBA 1ACCA 2LXCA 2REXA 4AP4C 2FUHB 2QILA 2LGIA 2WLBA 3O65B 3B2FA 4GSWA 2QDFA 1E8WA 1EWYC 2J0MA 3OWEB 4L23A 4WWNA 3LJ3A 3NUHB 4WIPA 2FNJB 5T8IA 5CHFA 1PFDA 3AU5A 4P1BC 3NVVA 2KFJA 3DVGY 2LUMA 2WXIA 1RWSA 1IPGA 4IWPA 1LQBA 2K0PA 4WWPA 1UBIA 4IOIE 1GB1A 3A33B 4LLGM 2WU2B 2JXTA 2IJ0A 4ZRQA 4WJPA 3V6EB 2KXJA 4FHJA 4BVUC 3Q6BA 1WX8A 4WQMA 2IO2B 2MCNB 3PGEA 3GE3C 2DLBA 2BB6A 2YVCA 1WFYA 1D3ZA 4TSSA 1BMLC 3JSVB 1Q10A 1RYJA 1ZDVA 3TSSA 1F77A 3TEXA 2V3NA 4W9JA 2LVOA 3SDLC 4YWGG 1WRIA 4I6LB 2HTHA 2D07B 3J9CA 1E0ZA 4GU2A 4HJGE 1EWCA 3AMZA 4EFOA 5KHOA 4NZLB 2Y5CA 3DVGX 2IPKD 3A9JB 3NS1A 2V3SA 2KDFB 4N58A 5H92C 2FIDA 1RAXA 2HDEA 3UIOB 3C0RB 2PVOD 2PTLA 3JVZX 3Q3MC 3V62A 2XN9C 2UYZB 2FCQA 1K51A 3VTWA 1YX6B 2WXKA 2QHOA 1SF0A 2XNAC 1WRDB 1GUAB 2NPTA 2KC1A 5HG2A 4ZDVA 4K3BA 3B0AA 3ZKJC 4PYZA 1WGYA 4LDTB 3MJWA 3GOEA 2PW9A 3RI7C 4EZLA 3CIRB 4BZAA 4BBNF 4XGAB 2I1JA 2R2OA 4A3OA 4MGYE 2GBMA 5BMIA 4DHJB 1FM0D 3N1XC 3BIID 2D3BA 1IYFA 2IYDB 3PHXB 4NAWB 5D94A 4ZRPA 2L00B 3TEZA 4GIVA 3K9OB 2IO3B 3Q8AA 5BYQA 1I7HA 4JIOU 3KH0A 1EM7A 3L16A 4F7ZA 2L32A 2N9LA 2AQ2B 2CS4A 3LDZE 4EOYA 3AE1B 4PK1A 2LXAA 1SE2A 5E6OA 4AJWA 1FCCC 4E71A 1TGZB 4I6NB 2WXOA 1AWDA 1OGWA 4GGQA 3I3TB 4WAFA 1JROA 5D2MB 1FEHA 2NTTA 2UWQA 3KYCD 4TQ1A 3PHWB 4M8NA 4A20A 3KWLA 1TKEA 4CHKA 1V80A 1NI2A 2FE8A 1N6ZA 2KDMA 3AECB 2MH7A 1KJTA 4OZBA 2WXLA 1JCKB 4LNKA 3NVZA 3P4SB 1YIWA 3RULA 4FULA 2WX1A 1E6EB 1P98A 3PREA 2FBWB 2WU5B 3AE7B 1PUTA 2BVCA 3NRZA 3IBEA 2AX5A 1Z5SB 3AE8B 2DAFA 1XF5L 4YTMB 1VR9A 4XC2A 1DOYA 4LK0M 3U30A 4WURA 2ZZPB 2R2QA 4FJYA 4W9GA 1KOTA 4ZRKA 2BB5A 2RDHA 2KLCA 2EKEC 2IGHA 3ZJUA 1NI3A 3GS2A 4KZ0A 1YQ4B 3W2DA 5KHQA 3DBSA 5EE3A 3P4PB 1FCLA 4MGZE 2VRRB 2KO3A 2O2VB 2BKRB 2D11A 2OOBB 2KK8A 2G4DB 2D3AA 2BT6A 3AEAB 3Q8BA 2FCNA 3M3JA 3W5VB 2GBKA 4G11A 3W9CB 2JWUA 3UINB 3IT6B 4C7ZA 2K1FA 2QEJC 1B9RA 3S2AA 3L54A 2DYBA 4W9EA 1QOFA 1KLVA 4HPMB 1U4AA 1KTKA 3AN1A 3W1SC 1TTNA 4RM8A 3RT3B 4NY0A 1ZOYB 4D2KA 5LNK1 3ZRFA 4K1RB 3VTUA 3M95A 1C78A 4OHJA 1BXTA 4N9F4 3PRPB 2RDGA 1BUIC 3A9KA 2XK5A 2PVGC 4XWTA 4BOZB 3PTFC 4USAA 4K3CA 4B9KA 2RDBC 1F9JA 3IAM1 4M01A 2GBNA 1SEBD 3AEDB 4IC7B 4ICVA 3A1QB 1ZPSA 2QIEB 3PZ7A 3FC4A 4LNOA 2YEPF 2DENB 4PS8A 4OVZA 2N0SB 3ECIA 1SXTA 1C77A 4GXBA 2BF8B 5HI1A 3NVYA 3ZUNA 4OZCA 1I4QA 2VH2A 4G50A 2XEWA 2JF5A 3VAWA 4NJ6A 2QJLA 4I6PA 3RZFA 4KGTA 3AE6B 2WXNA 1DGJA 5HHDG 4C7YA 2L8JA 1C3TA 5IO9A 2QC8A 1K50A 1Q5WB 4W9IA 2IDYA 3MC8A 2INPE 1IGDA 3W1YA 3O13A 2N1VA 2BW2A 3QQ8B 3B1LX 2W54A 3HM3A 4MSQB 1AN8A 2LHDA 3ZNGC 2WXFA 4YTPB 4IKGA 3M63B 3ZNHB 3BY4B 4IW0A 4K81A 1JRUA 2MLBA 4A6QA 2A5UA 5TR5A 2H89B 3OJ3A 4TQ0A 2HD5B 3LB8C 1TS2A 3KWVA 1OFFA 1M94A 3AB5A 1N63A 3L0WB 1F1HA 2KMAA 3ZGZA 1VDVA 3HIZA 1N5WA 2NBVB 3QAQA 3BINA 4OZAA 2C7NB 4E3CA 4YTNB 1SE3A 3I9V1 4GDLB 3UI3A 2MEKA 3HUIA 3Q8CA 3RCZA 2JPHA 3JSVA 1FIQA 2L52A 3JW0X 3RYTA 2JWZA 2KTRB 4RCOA 3P42A 1KM7A 4TMAB 1MVKA 2Y5PA 2AQ1B 4P1CC 4DK5A 4BAXA 3A4SC 3UIPB 4MH8A 3SEBA 4BFRA 2L7RA 4RMAA 4RF1A 1QLBB 2BS4B 4HCPB 3ZDTA 2KQ7A 1JRPA 4ANWA 3DWGC 3ZLZA 3A9JA 1KLGD 3P4QB 4BBNC 3EGRA 2N1WA 3RNAC 3FKYA 2D3GA 2DHZA 3SHQA 1V1OA 4AWJA 2N4FA 5JXVA 2KFKB 4P16A 2WS3B 3QCAA 3VUYA 1NYRA 3BVGA 1WH3A 2A4ZA 5CTRC 3ZNZB 1V81A 4DXGA 3SFDB 3VHTC 1CMXB 2INDC 1XEEA 3V05A 3AU4A 3HRDD 1AYFA 2KN5A 4IDIA 4M0WA 1LXDA 1K52A 1MG4A 1QT9A 1N60A 3RD2A 3N1YC 4K7WA 4R3DA 2E3TA 1RLFA 1VLBA 4HVBA 1RRBA 5HFYA
chains in the Genus database with same CATH topology
1GUAB 3TCAA 3R7RA 2NPTA 4ANVA 2KC1A 4ZDVA 4EUTA 1I35A 2KWUB 3QARA 4G3XB 4GN1A 1WM3A 1VD2A 4GDKB 3B0AA 3VVWB 3ZKJC 1WJ6A 4NAWA 4PYZA 1WGYA 4KIKB 5J17A 4LDTB 3NZUA 3MJWA 3GOEA 3H6NA 2KQSA 1WI0A 2K8BA 3U7DA 3ONSA 3H9DA 4NJ7A 4EZLA 2KC2A 3DPDA 3WANA 3WALA 1IP9A 2OJRA 1WZ3A 4BBNF 3QK0A 2I1JA 3QJZA 3UF8A 2R2OA 4A3OA 4FJVB 4MGYE 3NOBA 1L2NA 2GBMA 1TZ1A 1YD8U 1ZW7A 4KZCA 1WXAA 3TBLD 2J0JA 2PPHA 4DHJB 3Q3JA 1HE8A 1BT0A 2L3ZA 3DVNV 3H7PA 1WXVA 2BYVE 1I42A 2NPTB 1IYFA 2KDBA 4GB9A 4ASWC 2IYDB 2MW5A 5BO4B 3PHXB 1E7VA 2WX0A 4NAWB 4IM0A 4URKA 3N30A 3CSFA 4JLCA 2MWSB 2FCMA 4W9FA 5D94A 3WAOA 1GNUA 2MBEA 2L00B 2LWPA 3NZSA 4GIVA 3K9OB 2IO3B 3H7SA 3V6CB 2G45B 4BOSC 1UD7A 2L76A 5LXIB 4JIOU 4A3PA 2FAZA 3KH0A 3L16A 1R4NI 3IHPC 3W1SA 3HK0A 2IO0B 3RUIB 2RSUA 1EO6A 3P2BA 2DX5B 1NBFC 4F7ZA 1J8CA 2CS4A 2L0TA 2AL3A 3LDZE 4EOYA 4ZRJA 2LXAA 4W9DA 3H7PB 3ML8A 5E6OA 1OEYJ 4AJWA 4E71A 4LDTD 1TGZB 4I6NB 4WJOA 2Z0DB 3B08A 4IG7B 1OGWA 4GGQA 3I3TB 4JQWC 2BPSA 5D2MB 2JT4B 2M0XA 1P0RA 2LD9A 1YJ1A 2GBJA 2LZ6A 2UWQA 2NVUI 2ZCBA 3KYCD 4DBGA 1G6JA 1WGGA 2YLMA 4YL8A 3VFKA 1UZXB 4TQ1A 3PHWB 3SD5A 3ZNID 1H8CA 4M8NA 3OJ4B 4A20A 3VQIA 2AL6A 2GMIC 4CHKA 4DHJD 1V80A 1NI2A 3VUWA 3CMMB 2C7HA 4F8CB 4WQOB 2ZJDA 3HHMA 2KJHB 2JVCA 1KJTA 2BWES 5E6PA 2K25A 3OLMD 1WE6A 4MDKE 2PE6B 4KV2A 2MBOA 2ASQA 2KHWB 1YIWA 2KZRA 2GOWA 2M17A 3RULA 5IA7A 1UH6A 1SGHA 3R7QA 4FULA 2WX1A 3L08A 4KDLB 1RFAA 1P98A 3PREA 3DBHI 3AI5A 3IBEA 1Z5SB 3PRZA 2DAFA 5CX3A 3ZTCA 2KX3A 4BKGA 2KDIA 2AEHA 2O2VA 3A4RA 3APCA 4XC2A 2KNBA 4CO7A 5L95C 1VCBA 2KJ6A 4FLHA 3MTNB 4IUMB 1WM2A 3U30A 3R3MA 1WJNA 2ZZPB 2R2QA 3H1UA 1LM8B 4FJYA 4W9GA 2O6VA 4XX5A 4ZRKA 1KOTA 3N32A 1EF1A 4X57B 2KLCA 3KUZA 5G55A 2EKEC 2KTFA 3ML9A 3TL5A 3VDZA 2W9NA 4GMVA 4J6IA 2M1MA 1Q0WB 1NDDA 3L10B 3DBRI 4NQLB 4KZ0A 3HM6X 5KHQA 3DBSA 5JHBA 2K8CA 5G2NA 3QX1A 4MGZE 2PE9A 1ISNA 2VRRB 2MBQA 2RPQA 2DZMA 2KO3A 4W9KA 1GC6A 4M0WB 3ZVVA 3ZTDA 2MBBB 2O2VB 2MBHA 2DZIA 2DAJA 5DPTA 1WMHA 4ZYNA 5IAAC 2BKRB 2D11A 2DZJA 2OOBB 3APDA 2RGFA 2KK8A 3TMPB 2G4DB 2V1YA 2FCNA 3M3JA 2GBKA 3EC8A 4G11A 3ENEA 2LI5A 3PRMB 4MJSA 5D7GA 4WJNA 2O6VB 2ZVOA 3PS6A 2EMTA 1UELA 4AJYB 3UINB 5E6NA 1WJ4A 2N9PC 3IVFA 1WX9A 2BYEA 3NHEB 3EHVA 3Q3FA 3U8ZA 1TBEA 1WR1A 2N9XA 2K1FA 1Y8RC 2LVPA 1WIAA 3S2AA 2CR5A 4NPNA 4EZKA 3L54A 3QHTA 2LGDA 5EDSA 1A5RA 4IWOA 2DYBA 2Z0EB 4W9EA 5DPSA 1KLVA 4HPMB 4MEMA 5DPRA 4NNJB 4WAAA 1U4AA 1SIFA 3W1SC 2JUOA 2MRPA 2KX0A 3ZRCA 1TTNA 2J0KA 4RM8A 4M8MA 1E7UA 3RT3B 1WMHB 4NY0A 3EFUA 3PV1A 5JHAA 1V6EA 5JZEB 2CHWA 4MJSB 1SE9A 2CKHB 2IO1B 3APFA 4NQKE 4LCDE 4DXAB 1WE7A 1J19A 3NY5A 3ZRFA 4K1RB 3VTUA 3VUXA 4LJOB 3A1QA 3M95A 1WZ0A 3TJPA 1GJZA 1V9JA 4HCNB 3WA0A 3NS8A 2CHXA 3KW5B 2KKCA 3PSEB 4HJKA 1P9DU 4CYEA 2D10A 2LUEA 2N7DA 4N9F4 4B95A 3PRPB 3PZDA 4HXDA 3QIJA 1V86A 4HPLB 2K39A 5D6JB 3A9KA 3N3KB 2XK5A 1MG8A 3L17A 3ZIMA 2K6DB 4HWIB 4BOZB 1GC7A 1WY8A 2O6VD 1Q1OA 3PTFC 5GMVA 4B9KA 3D32A 2BWFA 1F9JA 1EF5A 2HE7A 2LJ5A 1OQYA 1E8YA 2GBNA 1V49A 4IC7B 3MHSD 2N9EB 2DYOA 4ICVA 4BKTA 1ZGUB 3A1QB 4ICUA 5AZFA 3WAMA 2PJHA 1LFDA 3SU8X 3UQAA 2MX2A 1YX5B 2ZCCA 2KLGA 3V60A 2MSED 3KVFB 4JL9A 2FIFA 1UGMA 4OVVA 2DENB 2L05A 4PS8A 1UBQA 1ZKHA 2I1KA 2KVRA 3DOWA 3ECIA 1E5WA 4LJPB 5CHWA 2ZNVB 4FA6A 4WJQA 1XT9B 3UQBA 2C7MB 3A9KB 1H4RA 2XK5B 4HLEA 4FBJB 4GXBA 3VTVA 2BF8B 1E90A 2G4SA 4W9CA 3PLVA 2LVQA 2RR9A 3VH3B 4IWQA 3ZO5B 3ZUNA 5L83A 3AXCA 3QWZB 4TUUA 4G50A 2XEWA 2JF5A 2LRWA 4JGHB 3VAWA 3X23A 4KSKC 4NJ6A 4KVGB 2JXXA 4MGKE 4I6PA 1S3SG 3RZFA 4F1SA 5AEKB 4HDOA 1V5TA 5JH5C 4ANXA 2L8JA 2BKFA 1PQSA 1C3TA 2MP2A 4KSLC 4WWOA 3WIMA 1Q5WB 1X1MA 1WF9A 2KWCA 4XZ4A 4K7SA 4W9IA 2JRIB 1WR6E 3VXWA 2L0FA 1AARA 3KUCB 3DBLI 3KUDB 2V4LA 4MSMB 4FHKA 3W1YA 1WGRA 2KOXA 1S1QB 2C60A 4MH0E 5LXHA 2N1VA 4OVUA 3M62B 2AWTA 5C1ZA 3QQ8B 3K9PB 3B1LX 2IY1B 2IY0B 4K7UA 3X0WA 2EMSA 3L13A 2KANA 2BYFA 1WGDA 3HM3A 4MSQB 4ANUA 4TV3A 5HKHA 2RD0A 3DCGA 4IM2A 2N7EA 2JRHA 4BKSA 1YQBA 3ZNGC 3IG3A 2XBBC 3M63B 3ZNHB 2CHZA 3BY4B 2KWVB 4IW0A 1P1AA 2ZPNA 2IBIB 4K81A 2KJRA 1QZEA 1JRUA 2MLBA 2LASA 2ZVNA 2MP2B 1E8XA 2K6QA 2A5UA 4GDLA 1WXSA 5TR5A 1GG3A 4DDID 4KDIC 4FADA 3OJ3A 4G0NB 3T9LA 4AUQC 4TQ0A 1EUVB 1R4MI 2JY6A 3OAWA 2WYQA 2HD5B 2ZPYA 4PS3A 2KTRA 4TKNA 3TIXA 3VH4B 1M94A 3IFWB 3ALBA 2MA9B 2LXCA 2REXA 4AP4C 2FUHB 1E8ZA 2D2QA 3L0WB 1V5OA 1L7YA 2G3QB 2NBWB 2KMAA 4FN2A 3O65B 4GSWA 3HIZA 2J0MA 1E8WA 2NBVB 3EECA 3BINA 3QAQA 4P7IA 2C7NB 4WWNA 2AYOB 3LJ3A 2Y5BB 3JYUA 2JZ3B 4E3CA 2NCNA 2FNJB 1WYWB 2ZNVC 2DZKA 4GDLB 3GZNI 2KMCA 5CHFA 1XD3B 4ZRIA 3AU5A 2KFJA 3DVGY 3RCZA 2JPHA 2M4NA 2IZVB 3JSVA 1C1YB 4PS7A 1T0YA 1IPGA 3JW0X 5J18A 3ZDMC 4IWPA 1LQBA 3RYTA 2JWZA 2KTRB 4HK2A 4WWPA 1UBIA 2C9WB 2BGFA 1KM7A 3A33B 1WXMA 3DDCB 3CSTA 4FJZA 1WJUA 3QC8B 2KFKA 4WJPA 4IM3A 1K8RB 3V6EB 2KXJA 4FHJA 3V61A 4DK5A 3A4SC 3UIPB 3KYDD 5DCNA 3PT2B 4PYUA 1XQQA 3UGBB 3CF6E 4BVUC 5FR6A 3R66C 1FXTB 1WX8A 4AOFA 2KDEB 2MQJA 2IO2B 2MCNB 3PGEA 4BFRA 4B6WA 2L7RA 5AZHA 2M8SA 4RMAA 4II3B 3PLUA 4HCPB 3ZDTA 1V2YA 2FCSA 2K8HA 2KQ7A 2YVCA 4ANWA 5J2RA 1WFYA 3ZLZA 1D3ZA 1WX7A 2DYMA 3A9JA 3PVLA 3JSVB 4BBNC 4DWFA 2HJ8A 2N1WA 2KD0A 2Z59B 3AULA 2D3GA 3DVNU 2DHZA 3SHQA 2NBUA 1OEYA 4AWJA 5CHVC 2N4FA 2WDTB 2NR2A 3PPAA 4BKSD 3RZWC 2KFKB 1OTRB 3QA8A 4HDQA 4W9JA 3QCAA 3VUYA 2LVOA 2B3AA 3SDLC 2ZEQA 1J0GA 1WH3A 2A4ZA 5CTRC 4I6LB 2HTHA 2D07B 4DDGD 3ZNZB 1V81A 2CU1A 4MGIE 4GU2A 4E74A 3VHTC 1CMXB 4EKUA 4EFOA 5KHOA 4W9HA 2GBRA 4EEWA 3AU4A 2WWZA 3DVGX 5C23A 3A9JB 3DQVA 2PEAA 4GDKA 3ZW3A 2KN5A 2V3SA 2KDFB 4KIKA 2LRUA 1LXDA 4II2B 2FIDA 4MELA 2NS5A 3WAPA 1RAXA 2C5LC 4DHZB 3RD2A 3UIOB 3C0RB 4K7WA 1P3QU 4GOCA 4W9LA 5LLIA 3V62A 3JVZX 2J7QB 2UYZB 1RLFA 2LGYA 1Z2MA 2FCQA 3VTWA 2LGXA 4RM9A 5DPWA 1YX6B 4DHZE 2QHOA 1WGHA 5AZGA 4MM3A 4EZJA 2JZZA 3T8MA 4HVBA 1RRBA 1WRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUA B;  3TCA A;  3R7R A;  2NPT A;  4ANV A;  2KC1 A;  4ZDV A;  4EUT A;  1I35 A;  2KWU B;  3QAR A;  4G3X B;  4GN1 A;  1WM3 A;  1VD2 A;  4GDK B;  3B0A A;  3VVW B;  3ZKJ C;  1WJ6 A;  4NAW A;  4PYZ A;  1WGY A;  4KIK B;  5J17 A;  4LDT B;  3NZU A;  3MJW A;  3GOE A;  3H6N A;  2KQS A;  1WI0 A;  2K8B A;  3U7D A;  3ONS A;  3H9D A;  4NJ7 A;  4EZL A;  2KC2 A;  3DPD A;  3WAN A;  3WAL A;  1IP9 A;  2OJR A;  1WZ3 A;  4BBN F;  3QK0 A;  2I1J A;  3QJZ A;  3UF8 A;  2R2O A;  4A3O A;  4FJV B;  4MGY E;  3NOB A;  1L2N A;  2GBM A;  1TZ1 A;  1YD8 U;  1ZW7 A;  4KZC A;  1WXA A;  3TBL D;  2J0J A;  2PPH A;  4DHJ B;  3Q3J A;  1HE8 A;  1BT0 A;  2L3Z A;  3DVN V;  3H7P A;  1WXV A;  2BYV E;  1I42 A;  2NPT B;  1IYF A;  2KDB A;  4GB9 A;  4ASW C;  2IYD B;  2MW5 A;  5BO4 B;  3PHX B;  1E7V A;  2WX0 A;  4NAW B;  4IM0 A;  4URK A;  3N30 A;  3CSF A;  4JLC A;  2MWS B;  2FCM A;  4W9F A;  5D94 A;  3WAO A;  1GNU A;  2MBE A;  2L00 B;  2LWP A;  3NZS A;  4GIV A;  3K9O B;  2IO3 B;  3H7S A;  3V6C B;  2G45 B;  4BOS C;  1UD7 A;  2L76 A;  5LXI B;  4JIO U;  4A3P A;  2FAZ A;  3KH0 A;  3L16 A;  1R4N I;  3IHP C;  3W1S A;  3HK0 A;  2IO0 B;  3RUI B;  2RSU A;  1EO6 A;  3P2B A;  2DX5 B;  1NBF C;  4F7Z A;  1J8C A;  2CS4 A;  2L0T A;  2AL3 A;  3LDZ E;  4EOY A;  4ZRJ A;  2LXA A;  4W9D A;  3H7P B;  3ML8 A;  5E6O A;  1OEY J;  4AJW A;  4E71 A;  4LDT D;  1TGZ B;  4I6N B;  4WJO A;  2Z0D B;  3B08 A;  4IG7 B;  1OGW A;  4GGQ A;  3I3T B;  4JQW C;  2BPS A;  5D2M B;  2JT4 B;  2M0X A;  1P0R A;  2LD9 A;  1YJ1 A;  2GBJ A;  2LZ6 A;  2UWQ A;  2NVU I;  2ZCB A;  3KYC D;  4DBG A;  1G6J A;  1WGG A;  2YLM A;  4YL8 A;  3VFK A;  1UZX B;  4TQ1 A;  3PHW B;  3SD5 A;  3ZNI D;  1H8C A;  4M8N A;  3OJ4 B;  4A20 A;  3VQI A;  2AL6 A;  2GMI C;  4CHK A;  4DHJ D;  1V80 A;  1NI2 A;  3VUW A;  3CMM B;  2C7H A;  4F8C B;  4WQO B;  2ZJD A;  3HHM A;  2KJH B;  2JVC A;  1KJT A;  2BWE S;  5E6P A;  2K25 A;  3OLM D;  1WE6 A;  4MDK E;  2PE6 B;  4KV2 A;  2MBO A;  2ASQ A;  2KHW B;  1YIW A;  2KZR A;  2GOW A;  2M17 A;  3RUL A;  5IA7 A;  1UH6 A;  1SGH A;  3R7Q A;  4FUL A;  2WX1 A;  3L08 A;  4KDL B;  1RFA A;  1P98 A;  3PRE A;  3DBH I;  3AI5 A;  3IBE A;  1Z5S B;  3PRZ A;  2DAF A;  5CX3 A;  3ZTC A;  2KX3 A;  4BKG A;  2KDI A;  2AEH A;  2O2V A;  3A4R A;  3APC A;  4XC2 A;  2KNB A;  4CO7 A;  5L95 C;  1VCB A;  2KJ6 A;  4FLH A;  3MTN B;  4IUM B;  1WM2 A;  3U30 A;  3R3M A;  1WJN A;  2ZZP B;  2R2Q A;  3H1U A;  1LM8 B;  4FJY A;  4W9G A;  2O6V A;  4XX5 A;  4ZRK A;  1KOT A;  3N32 A;  1EF1 A;  4X57 B;  2KLC A;  3KUZ A;  5G55 A;  2EKE C;  2KTF A;  3ML9 A;  3TL5 A;  3VDZ A;  2W9N A;  4GMV A;  4J6I A;  2M1M A;  1Q0W B;  1NDD A;  3L10 B;  3DBR I;  4NQL B;  4KZ0 A;  3HM6 X;  5KHQ A;  3DBS A;  5JHB A;  2K8C A;  5G2N A;  3QX1 A;  4MGZ E;  2PE9 A;  1ISN A;  2VRR B;  2MBQ A;  2RPQ A;  2DZM A;  2KO3 A;  4W9K A;  1GC6 A;  4M0W B;  3ZVV A;  3ZTD A;  2MBB B;  2O2V B;  2MBH A;  2DZI A;  2DAJ A;  5DPT A;  1WMH A;  4ZYN A;  5IAA C;  2BKR B;  2D11 A;  2DZJ A;  2OOB B;  3APD A;  2RGF A;  2KK8 A;  3TMP B;  2G4D B;  2V1Y A;  2FCN A;  3M3J A;  2GBK A;  3EC8 A;  4G11 A;  3ENE A;  2LI5 A;  3PRM B;  4MJS A;  5D7G A;  4WJN A;  2O6V B;  2ZVO A;  3PS6 A;  2EMT A;  1UEL A;  4AJY B;  3UIN B;  5E6N A;  1WJ4 A;  2N9P C;  3IVF A;  1WX9 A;  2BYE A;  3NHE B;  3EHV A;  3Q3F A;  3U8Z A;  1TBE A;  1WR1 A;  2N9X A;  2K1F A;  1Y8R C;  2LVP A;  1WIA A;  3S2A A;  2CR5 A;  4NPN A;  4EZK A;  3L54 A;  3QHT A;  2LGD A;  5EDS A;  1A5R A;  4IWO A;  2DYB A;  2Z0E B;  4W9E A;  5DPS A;  1KLV A;  4HPM B;  4MEM A;  5DPR A;  4NNJ B;  4WAA A;  1U4A A;  1SIF A;  3W1S C;  2JUO A;  2MRP A;  2KX0 A;  3ZRC A;  1TTN A;  2J0K A;  4RM8 A;  4M8M A;  1E7U A;  3RT3 B;  1WMH B;  4NY0 A;  3EFU A;  3PV1 A;  5JHA A;  1V6E A;  5JZE B;  2CHW A;  4MJS B;  1SE9 A;  2CKH B;  2IO1 B;  3APF A;  4NQK E;  4LCD E;  4DXA B;  1WE7 A;  1J19 A;  3NY5 A;  3ZRF A;  4K1R B;  3VTU A;  3VUX A;  4LJO B;  3A1Q A;  3M95 A;  1WZ0 A;  3TJP A;  1GJZ A;  1V9J A;  4HCN B;  3WA0 A;  3NS8 A;  2CHX A;  3KW5 B;  2KKC A;  3PSE B;  4HJK A;  1P9D U;  4CYE A;  2D10 A;  2LUE A;  2N7D A;  4N9F 4;  4B95 A;  3PRP B;  3PZD A;  4HXD A;  3QIJ A;  1V86 A;  4HPL B;  2K39 A;  5D6J B;  3A9K A;  3N3K B;  2XK5 A;  1MG8 A;  3L17 A;  3ZIM A;  2K6D B;  4HWI B;  4BOZ B;  1GC7 A;  1WY8 A;  2O6V D;  1Q1O A;  3PTF C;  5GMV A;  4B9K A;  3D32 A;  2BWF A;  1F9J A;  1EF5 A;  2HE7 A;  2LJ5 A;  1OQY A;  1E8Y A;  2GBN A;  1V49 A;  4IC7 B;  3MHS D;  2N9E B;  2DYO A;  4ICV A;  4BKT A;  1ZGU B;  3A1Q B;  4ICU A;  5AZF A;  3WAM A;  2PJH A;  1LFD A;  3SU8 X;  3UQA A;  2MX2 A;  1YX5 B;  2ZCC A;  2KLG A;  3V60 A;  2MSE D;  3KVF B;  4JL9 A;  2FIF A;  1UGM A;  4OVV A;  2DEN B;  2L05 A;  4PS8 A;  1UBQ A;  1ZKH A;  2I1K A;  2KVR A;  3DOW A;  3ECI A;  1E5W A;  4LJP B;  5CHW A;  2ZNV B;  4FA6 A;  4WJQ A;  1XT9 B;  3UQB A;  2C7M B;  3A9K B;  1H4R A;  2XK5 B;  4HLE A;  4FBJ B;  4GXB A;  3VTV A;  2BF8 B;  1E90 A;  2G4S A;  4W9C A;  3PLV A;  2LVQ A;  2RR9 A;  3VH3 B;  4IWQ A;  3ZO5 B;  3ZUN A;  5L83 A;  3AXC A;  3QWZ B;  4TUU A;  4G50 A;  2XEW A;  2JF5 A;  2LRW A;  4JGH B;  3VAW A;  3X23 A;  4KSK C;  4NJ6 A;  4KVG B;  2JXX A;  4MGK E;  4I6P A;  1S3S G;  3RZF A;  4F1S A;  5AEK B;  4HDO A;  1V5T A;  5JH5 C;  4ANX A;  2L8J A;  2BKF A;  1PQS A;  1C3T A;  2MP2 A;  4KSL C;  4WWO A;  3WIM A;  1Q5W B;  1X1M A;  1WF9 A;  2KWC A;  4XZ4 A;  4K7S A;  4W9I A;  2JRI B;  1WR6 E;  3VXW A;  2L0F A;  1AAR A;  3KUC B;  3DBL I;  3KUD B;  2V4L A;  4MSM B;  4FHK A;  3W1Y A;  1WGR A;  2KOX A;  1S1Q B;  2C60 A;  4MH0 E;  5LXH A;  2N1V A;  4OVU A;  3M62 B;  2AWT A;  5C1Z A;  3QQ8 B;  3K9P B;  3B1L X;  2IY1 B;  2IY0 B;  4K7U A;  3X0W A;  2EMS A;  3L13 A;  2KAN A;  2BYF A;  1WGD A;  3HM3 A;  4MSQ B;  4ANU A;  4TV3 A;  5HKH A;  2RD0 A;  3DCG A;  4IM2 A;  2N7E A;  2JRH A;  4BKS A;  1YQB A;  3ZNG C;  3IG3 A;  2XBB C;  3M63 B;  3ZNH B;  2CHZ A;  3BY4 B;  2KWV B;  4IW0 A;  1P1A A;  2ZPN A;  2IBI B;  4K81 A;  2KJR A;  1QZE A;  1JRU A;  2MLB A;  2LAS A;  2ZVN A;  2MP2 B;  1E8X A;  2K6Q A;  2A5U A;  4GDL A;  1WXS A;  5TR5 A;  1GG3 A;  4DDI D;  4KDI C;  4FAD A;  3OJ3 A;  4G0N B;  3T9L A;  4AUQ C;  4TQ0 A;  1EUV B;  1R4M I;  2JY6 A;  3OAW A;  2WYQ A;  2HD5 B;  2ZPY A;  4PS3 A;  2KTR A;  4TKN A;  3TIX A;  3VH4 B;  1M94 A;  3IFW B;  3ALB A;  2MA9 B;  2LXC A;  2REX A;  4AP4 C;  2FUH B;  1E8Z A;  2D2Q A;  3L0W B;  1V5O A;  1L7Y A;  2G3Q B;  2NBW B;  2KMA A;  4FN2 A;  3O65 B;  4GSW A;  3HIZ A;  2J0M A;  1E8W A;  2NBV B;  3EEC A;  3BIN A;  3QAQ A;  4P7I A;  2C7N B;  4WWN A;  2AYO B;  3LJ3 A;  2Y5B B;  3JYU A;  2JZ3 B;  4E3C A;  2NCN A;  2FNJ B;  1WYW B;  2ZNV C;  2DZK A;  4GDL B;  3GZN I;  2KMC A;  5CHF A;  1XD3 B;  4ZRI A;  3AU5 A;  2KFJ A;  3DVG Y;  3RCZ A;  2JPH A;  2M4N A;  2IZV B;  3JSV A;  1C1Y B;  4PS7 A;  1T0Y A;  1IPG A;  3JW0 X;  5J18 A;  3ZDM C;  4IWP A;  1LQB A;  3RYT A;  2JWZ A;  2KTR B;  4HK2 A;  4WWP A;  1UBI A;  2C9W B;  2BGF A;  1KM7 A;  3A33 B;  1WXM A;  3DDC B;  3CST A;  4FJZ A;  1WJU A;  3QC8 B;  2KFK A;  4WJP A;  4IM3 A;  1K8R B;  3V6E B;  2KXJ A;  4FHJ A;  3V61 A;  4DK5 A;  3A4S C;  3UIP B;  3KYD D;  5DCN A;  3PT2 B;  4PYU A;  1XQQ A;  3UGB B;  3CF6 E;  4BVU C;  5FR6 A;  3R66 C;  1FXT B;  1WX8 A;  4AOF A;  2KDE B;  2MQJ A;  2IO2 B;  2MCN B;  3PGE A;  4BFR A;  4B6W A;  2L7R A;  5AZH A;  2M8S A;  4RMA A;  4II3 B;  3PLU A;  4HCP B;  3ZDT A;  1V2Y A;  2FCS A;  2K8H A;  2KQ7 A;  2YVC A;  4ANW A;  5J2R A;  1WFY A;  3ZLZ A;  1D3Z A;  1WX7 A;  2DYM A;  3A9J A;  3PVL A;  3JSV B;  4BBN C;  4DWF A;  2HJ8 A;  2N1W A;  2KD0 A;  2Z59 B;  3AUL A;  2D3G A;  3DVN U;  2DHZ A;  3SHQ A;  2NBU A;  1OEY A;  4AWJ A;  5CHV C;  2N4F A;  2WDT B;  2NR2 A;  3PPA A;  4BKS D;  3RZW C;  2KFK B;  1OTR B;  3QA8 A;  4HDQ A;  4W9J A;  3QCA A;  3VUY A;  2LVO A;  2B3A A;  3SDL C;  2ZEQ A;  1J0G A;  1WH3 A;  2A4Z A;  5CTR C;  4I6L B;  2HTH A;  2D07 B;  4DDG D;  3ZNZ B;  1V81 A;  2CU1 A;  4MGI E;  4GU2 A;  4E74 A;  3VHT C;  1CMX B;  4EKU A;  4EFO A;  5KHO A;  4W9H A;  2GBR A;  4EEW A;  3AU4 A;  2WWZ A;  3DVG X;  5C23 A;  3A9J B;  3DQV A;  2PEA A;  4GDK A;  3ZW3 A;  2KN5 A;  2V3S A;  2KDF B;  4KIK A;  2LRU A;  1LXD A;  4II2 B;  2FID A;  4MEL A;  2NS5 A;  3WAP A;  1RAX A;  2C5L C;  4DHZ B;  3RD2 A;  3UIO B;  3C0R B;  4K7W A;  1P3Q U;  4GOC A;  4W9L A;  5LLI A;  3V62 A;  3JVZ X;  2J7Q B;  2UYZ B;  1RLF A;  2LGY A;  1Z2M A;  2FCQ A;  3VTW A;  2LGX A;  4RM9 A;  5DPW A;  1YX6 B;  4DHZ E;  2QHO A;  1WGH A;  5AZG A;  4MM3 A;  4EZJ A;  2JZZ A;  3T8M A;  4HVB A;  1RRB A;  1WRD B; 
#chains in the Genus database with same CATH topology
 2J53 A;  3W5U B;  1XLN A;  1HZ6 A;  4M02 A;  2GRI A;  4GDK B;  5H8Y E;  4NAW A;  4AQ7 A;  3NZU A;  2KQS A;  2K8B A;  3U7D A;  3ONS A;  4KGS A;  4NJ7 A;  3WAN A;  3ZQ4 A;  3WAL A;  3RPF C;  3UF8 A;  2M0A A;  1KLU D;  1YD8 U;  3TBL D;  3R2I A;  1LO5 D;  2L3Z A;  1D5M C;  3DVN V;  4MM3 B;  3MC9 A;  5D3I B;  2BYV E;  1FXI A;  4ASW C;  1KFY B;  2KYW A;  2MW5 A;  2WXQ A;  3BWU D;  4IM0 A;  1F2R C;  4W9F A;  3VRB B;  5MPO A;  5IN7 A;  1QKZ A;  2N7J A;  3AH7 A;  1QF6 A;  1XXG A;  2UU7 A;  4BOS C;  1UD7 A;  1C9F A;  1PDX A;  1XCQ L;  2FAZ A;  5AUI A;  3L4P A;  2IO0 B;  3RUI B;  3P2B A;  2DX5 B;  3HVZ A;  4ZRJ A;  1YJJ A;  4AS1 A;  1L4Z B;  4ITK A;  1T0R C;  5D3D A;  2M0X A;  1P0R A;  1I4X A;  1YJ1 A;  2GBJ A;  2FUG 1;  3H8H A;  3GZN B;  4WH4 A;  1PGB A;  3VQI A;  2AL6 A;  2GMI C;  1GAQ B;  1ET6 A;  4WQO B;  4YSX B;  2JVC A;  2WP9 B;  3GP7 A;  4LNI A;  5IA7 A;  1JWM D;  4KDL B;  1RFA A;  1E7P B;  3DBH I;  2WXH A;  1NVI D;  3PRZ A;  1M4V A;  2KX3 A;  2KDI A;  4C4V B;  2O2V A;  1C4A A;  2J4X A;  2WDR B;  4CO7 A;  3SR6 A;  1PGX A;  1WM2 A;  4B0E A;  2VZK D;  1WJN A;  2LFI A;  3R3M A;  3LXF A;  3H1U A;  4X57 B;  3AE2 B;  3KUZ A;  5G55 A;  3TL5 A;  4ARC A;  4J6I A;  2M1M A;  1NDD A;  3DBR I;  3VRA B;  3GE8 C;  4LNF A;  3IXS A;  2K8C A;  2PE9 A;  1ISN A;  2DZM A;  1GC6 A;  4M0W B;  5G5H A;  3ZTD A;  2WDV B;  2MBH A;  2DAJ A;  1QOG A;  2K3U A;  3ENE A;  5D7G A;  3R2T A;  2O6V B;  2WXR A;  1J7B A;  4AJY B;  2X8X X;  2N9P C;  2WHI A;  3EHV A;  3Q3F A;  3U8Z A;  1TBE A;  1WR1 A;  5IOI A;  3NZ3 A;  2LVP A;  1GB4 A;  4NPN A;  3ABV B;  1A5R A;  5EDS A;  2KAJ A;  1QOB A;  4MEM A;  4NNJ B;  4WAA A;  4OW0 A;  2MRP A;  3ZRC A;  3AE5 B;  1WMH B;  1VZ6 A;  3AV8 A;  3PV1 A;  2CHW A;  5EE1 A;  2ICI A;  3IT4 B;  4LCD E;  1VJK A;  5FR3 A;  4LNN A;  3A1Q A;  1GJZ A;  1V9J A;  4HCN B;  3WA0 A;  4XWW A;  1T5X D;  1L6V A;  3KW5 B;  3PSE B;  2JSV X;  1JWB D;  3DHH C;  4HJK A;  4CYE A;  1HTQ A;  2DWQ A;  2N7D A;  2LUE A;  4B95 A;  4HPL B;  3BYY B;  5D6J B;  1YJI A;  4XE0 A;  1MG8 A;  3RNG C;  2NMQ A;  3L17 A;  2K6D B;  2DNF A;  1YQ3 B;  4DXF A;  2BWF A;  2CJO A;  2HE7 A;  1V49 A;  4HEA 1;  2IGD A;  4BKT A;  5AZF A;  1E10 A;  3SU8 X;  2MX2 A;  1YX5 B;  2ZCC A;  3CWI A;  1V1P A;  2FIF A;  2LJI A;  2BBC A;  2G9H D;  4FA6 A;  2GI9 A;  4WJQ A;  1JWA D;  3P4R B;  3VTV A;  1I4H A;  3PLV A;  3ZO5 B;  2RMM A;  3QWZ B;  4RGO S;  2LRW A;  4KSK C;  2JXX A;  4MGK E;  1JQ4 A;  3AE3 B;  1V5T A;  1I4P A;  1ZP0 B;  4WWO A;  4C00 A;  1RM6 C;  1WF9 A;  1X1M A;  3TEY A;  2JRI B;  2JYE A;  3N9Y C;  4RF0 A;  1AAR A;  3DBL I;  1FXA A;  3KUD B;  1DYQ A;  1IGC A;  4MSM B;  5FKA C;  4ZYS A;  5BMG A;  4MH0 E;  4ZOH C;  2GB1 A;  4OVU A;  5C1Z A;  3X0W A;  4K7U A;  2EMS A;  1FNW A;  4JWS C;  1WGD A;  4ANU A;  2RD0 A;  3DCG A;  2N7E A;  4BKS A;  4ARI A;  2BQQ A;  2KWV B;  4GDL A;  2MP2 B;  1E8X A;  1WXS A;  1GG3 A;  4HKZ E;  4FAD A;  1EU3 A;  3T9L A;  1EUV B;  1SJH D;  2JY6 A;  2WYQ A;  3IAS 1;  2DBY A;  2ZPY A;  4PS3 A;  2KTR A;  1TS3 A;  1JWS D;  2D2Q A;  1L7Y A;  2G3Q B;  4FN2 A;  1K53 A;  3EEC A;  1T0S C;  2X38 A;  2Y5B B;  3JYU A;  3GB1 A;  2JZ3 B;  1WYW B;  2ZNV C;  1FNV A;  2DZK A;  3GZN I;  3DWM A;  4ZRI A;  2KN4 A;  2M4N A;  2IZV B;  2NTS A;  1WSP A;  1C1Y B;  4PS7 A;  1NEK B;  2WQY B;  1MHH E;  2BGF A;  1WXM A;  3TUO A;  3DDC B;  1YMH E;  1WJU A;  1UNS A;  2KFK A;  4IM3 A;  1K8R B;  3V61 A;  3KYD D;  3PT2 B;  4PYU A;  4QAY A;  3UGB B;  3CF6 E;  5FR6 A;  3R66 C;  1FXT B;  2KDE B;  2MQJ A;  2M8S A;  3PLU A;  1V2Y A;  1QOA A;  4N6E B;  5J2R A;  1WX7 A;  2DYM A;  1YOV B;  2J52 A;  1RFK A;  3T3N A;  1PYW D;  2KD0 A;  2BS3 B;  2Z59 B;  4N59 A;  4P6V F;  4RGM A;  1OEY A;  1TJE A;  5CHV C;  2NR2 A;  1TS4 A;  1TY0 A;  2M56 B;  3PPA A;  3BVZ A;  3RZW C;  1ZUD 2;  3QA8 A;  2ZEQ A;  1J0G A;  2E6X A;  1ZXI A;  3AEE B;  2CU1 A;  4E74 A;  4EKU A;  2PIA A;  2GBR A;  1HTO A;  1NEN B;  1V1P B;  2PEA A;  4KX6 B;  4GDK A;  2WNM A;  1MI0 A;  4XYC A;  1D6E C;  3WAP A;  4DHZ B;  2K9X A;  4W9L A;  1Z2M A;  3DBH B;  2W3R A;  2LGX A;  4RM9 A;  5DPW A;  4L2Y A;  1PGA A;  2L1A A;  1B1Z A;  3U7Z A;  2D3C A;  5AZG A;  4EE2 A;  2J42 A;  4MM3 A;  4EZJ A;  2JZZ A;  2KMM A;  3VVW B;  3TCA A;  3R7R A;  4ANV A;  4HRS A;  4A55 A;  1TS5 A;  2KWU B;  3QAR A;  2I38 A;  3RNB C;  1FD6 A;  1WJ6 A;  5J17 A;  4KIK B;  2AQ3 B;  3H9D A;  1T3Q A;  1TZO A;  2TSS A;  3ZXV A;  3DBR B;  2ZW0 A;  2Z8L A;  3QK0 A;  3QJZ A;  1L4D B;  2N9K A;  4FJV B;  3EUB 2;  1TZ1 A;  2J0J A;  1CK1 A;  2PPH A;  3BYT B;  4HKQ A;  2LMC A;  5IKC M;  5BYR A;  1WXV A;  4RGT A;  3ZYY X;  4C56 C;  1A70 A;  4CQN A;  4JPS A;  2R61 A;  1F0Z A;  5BO4 B;  2WX0 A;  2JX5 A;  1FFU A;  4JLC A;  3WAO A;  1J7A A;  2LWP A;  1JW9 D;  1R7S A;  1UWM A;  1FO4 A;  5LXI B;  4Q2J A;  3NVW A;  4A3P A;  1R4M B;  1R4N I;  3IHP C;  4UDU C;  3W1S A;  3Q14 C;  3Q8F A;  2RSU A;  1EO6 A;  1J8C A;  4YXD B;  2AL3 A;  2I2Y A;  3H7P B;  2PLP A;  4LDT D;  3ZJT A;  2YEP B;  2Z0D B;  3B08 A;  3MP9 A;  1J7C A;  2KWD A;  2BS2 B;  4JQW C;  2JT4 B;  4NAM A;  3BK2 A;  2JZP A;  2MJD A;  1G6J A;  4DBG A;  2YLM A;  1UZX B;  1H8C A;  1QQR A;  2PKO A;  1T6B X;  4C4V A;  4DHJ D;  3VUW A;  5E6J A;  5FK9 C;  2KT7 A;  2JYT A;  3HHM A;  2KJH B;  2L83 A;  5E6P A;  3OLM D;  4YSZ B;  2PE6 B;  4KV2 A;  2MBO A;  2KHW B;  2KZR A;  2GOW A;  1UH6 A;  1SGH A;  3R7Q A;  1TY2 A;  1FRR A;  1FNU A;  5GXG B;  3ZTC A;  4BKG A;  5BYS A;  1VZ7 A;  3A4R A;  1XLP A;  5L95 C;  1TT5 B;  4IUM B;  2O6V A;  4XX5 A;  1EF1 A;  2MHJ A;  2KTF A;  3ML9 A;  1LGR A;  4GMV A;  1Q0W B;  5EE0 A;  1GPX A;  3L10 B;  3HM6 X;  3BVM A;  5JHB A;  5G2N A;  3QX1 A;  4S0R A;  1AW7 A;  4O1N A;  2CJN A;  5DPT A;  1WMH A;  3APD A;  2RGF A;  1HA5 A;  1IBX B;  3EC8 A;  3Q3O C;  3I63 C;  2LI5 A;  3PRM B;  2OED A;  3DBL B;  3DHG C;  2ZVO A;  2EMT A;  1WXQ A;  1MHX A;  5E6N A;  1TIF A;  3IVF A;  3NHE B;  2W3S A;  4RNA A;  2W55 A;  1Y8R C;  1WIA A;  4ZHO A;  2CR5 A;  3AEF B;  4EZK A;  3QHT A;  1XCT L;  3EFC A;  3URY A;  5DPS A;  2ZW1 A;  3U52 E;  4YT0 B;  2B76 B;  3FAH A;  2JUO A;  2KX0 A;  2J0K A;  1N5X A;  4M8M A;  1E7U A;  3EFU A;  2K22 A;  5JHA A;  2W82 A;  1V6E A;  2QSD A;  4MJS B;  1SE9 A;  2CKH B;  2IO1 B;  4A90 A;  4DXA B;  1J19 A;  3VUX A;  4LJO B;  3E56 A;  3NS8 A;  2CHX A;  2KKC A;  1P9D U;  3AE9 B;  3PZD A;  1F2R I;  1HQR D;  4HXD A;  3QIJ A;  1V86 A;  2K39 A;  3ZXR A;  1D5Z C;  4RH6 A;  5AUK A;  1GC7 A;  1WY8 A;  5GMV A;  3Q69 A;  3D32 A;  1E8Y A;  5BMH A;  3MHS D;  2LEK A;  1ZGU B;  2PJH A;  1LFD A;  3UQA A;  5TSS A;  3V60 A;  1I4G A;  1HXY D;  4JL9 A;  1UGM A;  4OVV A;  2L05 A;  3ZJV A;  2KVR A;  1SB3 C;  4LJP B;  5CHW A;  2ZNV B;  1C4P A;  1XT9 B;  2C7M B;  4HLE A;  2G1E A;  2WXP A;  3I57 A;  4FBJ B;  2BYT A;  2INC C;  1Y56 A;  1E90 A;  3LYY A;  5L83 A;  4TUU A;  1F52 A;  4JX1 C;  4JGH B;  3X23 A;  2BTE A;  3RNE C;  4KVG B;  1S3S G;  3TEW A;  4F1S A;  1HEZ E;  3RNF C;  5AEK B;  5IP4 D;  1EU4 A;  1DOX A;  3KLS X;  1P7F A;  4ANX A;  1PQS A;  2QMT A;  2MP2 A;  1CQV A;  4XZ4 A;  4K7S A;  1WR6 E;  1SE4 A;  3AM9 A;  3KUC B;  4FHK A;  1WGR A;  2KOX A;  1S1Q B;  5LXH A;  3MC0 B;  3M62 B;  2VH1 A;  3FIL B;  2WDQ B;  3RNC C;  2KAN A;  2ONQ A;  1C79 A;  3I5J C;  2JRH A;  4J3O D;  4XDC A;  4JE3 B;  2CHZ A;  1P1A A;  2ZPN A;  1QZE A;  2LAS A;  4GLS C;  2K6Q A;  1R4M I;  1QIL A;  4KKI A;  3OAW A;  4RFB A;  3Q8E A;  3VH4 B;  3IFW B;  3C8Y A;  4MAC A;  2MA9 B;  3BK1 A;  1E8Z A;  1V5O A;  2NBW B;  3KQ4 A;  4P7I A;  1ET9 A;  2AYO B;  1XLO A;  4M00 A;  3P1M A;  2NCN A;  2CU3 A;  2KMC A;  1XD3 B;  1E9M A;  2HJ1 A;  1T0Y A;  2KVZ A;  3VR8 B;  5J18 A;  3ZDM C;  4HK2 A;  2C9W B;  3CST A;  4FJZ A;  2EKI A;  3QC8 B;  1UF0 A;  2WXG A;  5DCN A;  1XQQ A;  1VRA B;  1SJE D;  3EA6 A;  4AOF A;  1HZ5 A;  4B6W A;  4REZ A;  5AZH A;  4II3 B;  1YN3 A;  2FCS A;  2K8H A;  1R4N B;  3PVL A;  1ROE A;  4DWF A;  2HJ8 A;  3OG5 A;  4C80 A;  3RMK C;  3AUL A;  3DVN U;  2NBU A;  3U4E G;  1KH0 A;  2WDT B;  4LTU A;  3E9S A;  3V3X A;  4BKS D;  1OTR B;  4HDQ A;  3B9J A;  2B3A A;  2WXJ A;  1FMA D;  4DDG D;  1YN5 A;  4MGI E;  4YSY B;  1XLQ A;  3U2S C;  4W9H A;  1OQQ A;  4EEW A;  2WWZ A;  1V8C A;  5C23 A;  3R8B A;  1UGJ A;  3DQV A;  3ZW3 A;  1C76 A;  4KIK A;  5EE9 A;  2LRU A;  3BZD B;  3SFE B;  4II2 B;  4MEL A;  2NS5 A;  4H2A A;  1D4B A;  2C5L C;  1P3Q U;  1KRH A;  1ZE3 D;  3N1Z C;  4GOC A;  5LLI A;  1SIJ A;  3NJT A;  4HPP A;  2J7Q B;  2LGY A;  1CJE A;  5C3J B;  4DHZ E;  1ZXH A;  3DHI C;  1WGH A;  1MJD A;  3T8M A;  1DOI A;  2EEL A;  1L0Y B;  1CZP A;  2ON8 A;  4EUT A;  1I35 A;  4G3X B;  4GN1 A;  1WM3 A;  1VD2 A;  3H6N A;  1WI0 A;  2K5P A;  3P63 A;  2M19 A;  2KC2 A;  3DPD A;  1IP9 A;  2OJR A;  2SEB D;  1WZ3 A;  2D5G A;  3NOB A;  1KF6 B;  1L2N A;  1ZW7 A;  4KZC A;  1WXA A;  1TYG B;  3Q3J A;  1HE8 A;  1BT0 A;  3H7P A;  1MPE A;  1I42 A;  2NPT B;  2V9H A;  2KDB A;  4GB9 A;  2HTM E;  1E7V A;  3AEB B;  4URK A;  3N30 A;  3CSF A;  2MJE A;  2MWS B;  2FCM A;  1OQR A;  1GNU A;  2MBE A;  3NZS A;  3H7S A;  3PO0 A;  3V6C B;  4HRO A;  1YN4 A;  2JQR B;  2G45 B;  2L76 A;  1ZDX A;  3MHZ A;  3HK0 A;  1NBF C;  2L0T A;  1JWU D;  4W9D A;  3ML8 A;  1OEY J;  2VZK B;  1VZ8 A;  2WXM A;  4WJO A;  3VR9 B;  4IG7 B;  3WCQ A;  3ETR A;  2BPS A;  2LD9 A;  2LZ6 A;  2NVU I;  2ZCB A;  1WGG A;  4YL8 A;  3VFK A;  3SD5 A;  3ZNI D;  3OJ4 B;  1SSN A;  3B2G A;  4WWM A;  3CMM B;  2C7H A;  4F8C B;  2ZJD A;  1TKG A;  3PZ8 A;  1L5P A;  2BWE S;  1V97 A;  2K25 A;  1JAL A;  1MFW A;  1WE6 A;  4MDK E;  2H88 B;  4S17 A;  2ASQ A;  2M17 A;  1I4R A;  3L08 A;  2IGG A;  1NYQ A;  1GOZ A;  3AI5 A;  4A8X C;  4KKJ A;  3MJ5 A;  1YNT E;  5C2T B;  5CX3 A;  1D5X C;  2AEH A;  1L0V B;  3APC A;  2KNB A;  1VCB A;  2KJ6 A;  4FLH A;  3MTN B;  1N62 A;  1FFV A;  1IBX A;  1LM8 B;  3N32 A;  1C4C A;  1L6U A;  3VDZ A;  2W9N A;  4NQL B;  1L0X B;  4KGR A;  4MT5 A;  2MBQ A;  2RPQ A;  4W9K A;  1JML A;  3ZVV A;  1P7E A;  2MBB B;  4PT5 A;  2DZI A;  1T0Q C;  2Q5W D;  4ZYN A;  2DZJ A;  5IAA C;  3TMP B;  2V1Y A;  1N61 A;  2WGS A;  2QCZ A;  4MJS A;  4WJN A;  3PS6 A;  2OHF A;  1UEL A;  2PMV A;  2Y3A A;  1ESF A;  3N20 C;  1WJ4 A;  3MFG A;  1WX9 A;  2BYE A;  2N9X A;  2LGD A;  4IWO A;  2Z0E B;  4L1B A;  5I4D A;  2GLS A;  3C19 A;  5DPR A;  1SIF A;  1FRD A;  5JZE B;  3APF A;  2OJW A;  4NQK E;  1SBB B;  1WE7 A;  3NY5 A;  4US9 A;  1WZ0 A;  3TJP A;  2KQ4 X;  3Q2A C;  2D10 A;  1STE A;  2LHE A;  2MJ3 A;  3AEG B;  2JU6 X;  3N3K B;  4XDD A;  3ZIM A;  3Q3N C;  4HWI B;  5G5G A;  2O6V D;  1Q1O A;  1UUP A;  1EF5 A;  2LJ5 A;  4ACF A;  1OQY A;  3RN9 C;  1FPY A;  2SAK A;  4NJC A;  2N9E B;  2DYO A;  4ICU A;  3WAM A;  2RPV A;  2KLG A;  4RGN A;  4FXC A;  2MSE D;  3KVF B;  2V4I B;  1UWX A;  3T3O A;  1UBQ A;  1ZKH A;  2I1K A;  2LGS A;  3DOW A;  1E5W A;  3UQB A;  3A9K B;  1H4R A;  2XK5 B;  4A9A A;  2G4S A;  4W9C A;  2LVQ A;  2RR9 A;  3VH3 B;  4IWQ A;  3FIL A;  3AXC A;  2KAC A;  2V3P A;  1ENF A;  1XO3 A;  4HDO A;  5JH5 C;  2ACZ B;  2INN E;  2BKF A;  4KSL C;  3WIM A;  2KWC A;  3VXW A;  2L0F A;  2V0G A;  4ZHP A;  2V4L A;  4B0M A;  2C60 A;  1TKY A;  3NG0 A;  1WWT A;  2AWT A;  3K9P B;  2IY1 B;  2IY0 B;  3L13 A;  3RFZ B;  2BYF A;  1WYG A;  4US8 A;  3AE4 B;  5HKH A;  4TV3 A;  4IM2 A;  1WGK A;  1YQB A;  4JWU C;  3IG3 A;  2XBB C;  2IBI B;  4DQO C;  2KJR A;  2ZVN A;  4DDI D;  4KDI C;  4G0N B;  1IUE A;  4AUQ C;  4TKN A;  3HVD A;  3TIX A;  3ALB A;  1ACC A;  2LXC A;  2REX A;  4AP4 C;  2FUH B;  2QIL A;  2LGI A;  2WLB A;  3O65 B;  3B2F A;  4GSW A;  2QDF A;  1E8W A;  1EWY C;  2J0M A;  3OWE B;  4L23 A;  4WWN A;  3LJ3 A;  3NUH B;  4WIP A;  2FNJ B;  5T8I A;  5CHF A;  1PFD A;  3AU5 A;  4P1B C;  3NVV A;  2KFJ A;  3DVG Y;  2LUM A;  2WXI A;  1RWS A;  1IPG A;  4IWP A;  1LQB A;  2K0P A;  4WWP A;  1UBI A;  4IOI E;  1GB1 A;  3A33 B;  4LLG M;  2WU2 B;  2JXT A;  2IJ0 A;  4ZRQ A;  4WJP A;  3V6E B;  2KXJ A;  4FHJ A;  4BVU C;  3Q6B A;  1WX8 A;  4WQM A;  2IO2 B;  2MCN B;  3PGE A;  3GE3 C;  2DLB A;  2BB6 A;  2YVC A;  1WFY A;  1D3Z A;  4TSS A;  1BML C;  3JSV B;  1Q10 A;  1RYJ A;  1ZDV A;  3TSS A;  1F77 A;  3TEX A;  2V3N A;  4W9J A;  2LVO A;  3SDL C;  4YWG G;  1WRI A;  4I6L B;  2HTH A;  2D07 B;  3J9C A;  1E0Z A;  4GU2 A;  4HJG E;  1EWC A;  3AMZ A;  4EFO A;  5KHO A;  4NZL B;  2Y5C A;  3DVG X;  2IPK D;  3A9J B;  3NS1 A;  2V3S A;  2KDF B;  4N58 A;  5H92 C;  2FID A;  1RAX A;  2HDE A;  3UIO B;  3C0R B;  2PVO D;  2PTL A;  3JVZ X;  3Q3M C;  3V62 A;  2XN9 C;  2UYZ B;  2FCQ A;  1K51 A;  3VTW A;  1YX6 B;  2WXK A;  2QHO A;  1SF0 A;  2XNA C;  1WRD B;  1GUA B;  2NPT A;  2KC1 A;  5HG2 A;  4ZDV A;  4K3B A;  3B0A A;  3ZKJ C;  4PYZ A;  1WGY A;  4LDT B;  3MJW A;  3GOE A;  2PW9 A;  3RI7 C;  4EZL A;  3CIR B;  4BZA A;  4BBN F;  4XGA B;  2I1J A;  2R2O A;  4A3O A;  4MGY E;  2GBM A;  5BMI A;  4DHJ B;  1FM0 D;  3N1X C;  3BII D;  2D3B A;  1IYF A;  2IYD B;  3PHX B;  4NAW B;  5D94 A;  4ZRP A;  2L00 B;  3TEZ A;  4GIV A;  3K9O B;  2IO3 B;  3Q8A A;  5BYQ A;  1I7H A;  4JIO U;  3KH0 A;  1EM7 A;  3L16 A;  4F7Z A;  2L32 A;  2N9L A;  2AQ2 B;  2CS4 A;  3LDZ E;  4EOY A;  3AE1 B;  4PK1 A;  2LXA A;  1SE2 A;  5E6O A;  4AJW A;  1FCC C;  4E71 A;  1TGZ B;  4I6N B;  2WXO A;  1AWD A;  1OGW A;  4GGQ A;  3I3T B;  4WAF A;  1JRO A;  5D2M B;  1FEH A;  2NTT A;  2UWQ A;  3KYC D;  4TQ1 A;  3PHW B;  4M8N A;  4A20 A;  3KWL A;  1TKE A;  4CHK A;  1V80 A;  1NI2 A;  2FE8 A;  1N6Z A;  2KDM A;  3AEC B;  2MH7 A;  1KJT A;  4OZB A;  2WXL A;  1JCK B;  4LNK A;  3NVZ A;  3P4S B;  1YIW A;  3RUL A;  4FUL A;  2WX1 A;  1E6E B;  1P98 A;  3PRE A;  2FBW B;  2WU5 B;  3AE7 B;  1PUT A;  2BVC A;  3NRZ A;  3IBE A;  2AX5 A;  1Z5S B;  3AE8 B;  2DAF A;  1XF5 L;  4YTM B;  1VR9 A;  4XC2 A;  1DOY A;  4LK0 M;  3U30 A;  4WUR A;  2ZZP B;  2R2Q A;  4FJY A;  4W9G A;  1KOT A;  4ZRK A;  2BB5 A;  2RDH A;  2KLC A;  2EKE C;  2IGH A;  3ZJU A;  1NI3 A;  3GS2 A;  4KZ0 A;  1YQ4 B;  3W2D A;  5KHQ A;  3DBS A;  5EE3 A;  3P4P B;  1FCL A;  4MGZ E;  2VRR B;  2KO3 A;  2O2V B;  2BKR B;  2D11 A;  2OOB B;  2KK8 A;  2G4D B;  2D3A A;  2BT6 A;  3AEA B;  3Q8B A;  2FCN A;  3M3J A;  3W5V B;  2GBK A;  4G11 A;  3W9C B;  2JWU A;  3UIN B;  3IT6 B;  4C7Z A;  2K1F A;  2QEJ C;  1B9R A;  3S2A A;  3L54 A;  2DYB A;  4W9E A;  1QOF A;  1KLV A;  4HPM B;  1U4A A;  1KTK A;  3AN1 A;  3W1S C;  1TTN A;  4RM8 A;  3RT3 B;  4NY0 A;  1ZOY B;  4D2K A;  5LNK 1;  3ZRF A;  4K1R B;  3VTU A;  3M95 A;  1C78 A;  4OHJ A;  1BXT A;  4N9F 4;  3PRP B;  2RDG A;  1BUI C;  3A9K A;  2XK5 A;  2PVG C;  4XWT A;  4BOZ B;  3PTF C;  4USA A;  4K3C A;  4B9K A;  2RDB C;  1F9J A;  3IAM 1;  4M01 A;  2GBN A;  1SEB D;  3AED B;  4IC7 B;  4ICV A;  3A1Q B;  1ZPS A;  2QIE B;  3PZ7 A;  3FC4 A;  4LNO A;  2YEP F;  2DEN B;  4PS8 A;  4OVZ A;  2N0S B;  3ECI A;  1SXT A;  1C77 A;  4GXB A;  2BF8 B;  5HI1 A;  3NVY A;  3ZUN A;  4OZC A;  1I4Q A;  2VH2 A;  4G50 A;  2XEW A;  2JF5 A;  3VAW A;  4NJ6 A;  2QJL A;  4I6P A;  3RZF A;  4KGT A;  3AE6 B;  2WXN A;  1DGJ A;  5HHD G;  4C7Y A;  2L8J A;  1C3T A;  5IO9 A;  2QC8 A;  1K50 A;  1Q5W B;  4W9I A;  2IDY A;  3MC8 A;  2INP E;  1IGD A;  3W1Y A;  3O13 A;  2N1V A;  2BW2 A;  3QQ8 B;  3B1L X;  2W54 A;  3HM3 A;  4MSQ B;  1AN8 A;  2LHD A;  3ZNG C;  2WXF A;  4YTP B;  4IKG A;  3M63 B;  3ZNH B;  3BY4 B;  4IW0 A;  4K81 A;  1JRU A;  2MLB A;  4A6Q A;  2A5U A;  5TR5 A;  2H89 B;  3OJ3 A;  4TQ0 A;  2HD5 B;  3LB8 C;  1TS2 A;  3KWV A;  1OFF A;  1M94 A;  3AB5 A;  1N63 A;  3L0W B;  1F1H A;  2KMA A;  3ZGZ A;  1VDV A;  3HIZ A;  1N5W A;  2NBV B;  3QAQ A;  3BIN A;  4OZA A;  2C7N B;  4E3C A;  4YTN B;  1SE3 A;  3I9V 1;  4GDL B;  3UI3 A;  2MEK A;  3HUI A;  3Q8C A;  3RCZ A;  2JPH A;  3JSV A;  1FIQ A;  2L52 A;  3JW0 X;  3RYT A;  2JWZ A;  2KTR B;  4RCO A;  3P42 A;  1KM7 A;  4TMA B;  1MVK A;  2Y5P A;  2AQ1 B;  4P1C C;  4DK5 A;  4BAX A;  3A4S C;  3UIP B;  4MH8 A;  3SEB A;  4BFR A;  2L7R A;  4RMA A;  4RF1 A;  1QLB B;  2BS4 B;  4HCP B;  3ZDT A;  2KQ7 A;  1JRP A;  4ANW A;  3DWG C;  3ZLZ A;  3A9J A;  1KLG D;  3P4Q B;  4BBN C;  3EGR A;  2N1W A;  3RNA C;  3FKY A;  2D3G A;  2DHZ A;  3SHQ A;  1V1O A;  4AWJ A;  2N4F A;  5JXV A;  2KFK B;  4P16 A;  2WS3 B;  3QCA A;  3VUY A;  1NYR A;  3BVG A;  1WH3 A;  2A4Z A;  5CTR C;  3ZNZ B;  1V81 A;  4DXG A;  3SFD B;  3VHT C;  1CMX B;  2IND C;  1XEE A;  3V05 A;  3AU4 A;  3HRD D;  1AYF A;  2KN5 A;  4IDI A;  4M0W A;  1LXD A;  1K52 A;  1MG4 A;  1QT9 A;  1N60 A;  3RD2 A;  3N1Y C;  4K7W A;  4R3D A;  2E3T A;  1RLF A;  1VLB A;  4HVB A;  1RRB A;  5HFY A; 
#chains in the Genus database with same CATH homology
 1GUA B;  3TCA A;  3R7R A;  2NPT A;  4ANV A;  2KC1 A;  4ZDV A;  4EUT A;  1I35 A;  2KWU B;  3QAR A;  4G3X B;  4GN1 A;  1WM3 A;  1VD2 A;  4GDK B;  3B0A A;  3VVW B;  3ZKJ C;  1WJ6 A;  4NAW A;  4PYZ A;  1WGY A;  4KIK B;  5J17 A;  4LDT B;  3NZU A;  3MJW A;  3GOE A;  3H6N A;  2KQS A;  1WI0 A;  2K8B A;  3U7D A;  3ONS A;  3H9D A;  4NJ7 A;  4EZL A;  2KC2 A;  3DPD A;  3WAN A;  3WAL A;  1IP9 A;  2OJR A;  1WZ3 A;  4BBN F;  3QK0 A;  2I1J A;  3QJZ A;  3UF8 A;  2R2O A;  4A3O A;  4FJV B;  4MGY E;  3NOB A;  1L2N A;  2GBM A;  1TZ1 A;  1YD8 U;  1ZW7 A;  4KZC A;  1WXA A;  3TBL D;  2J0J A;  2PPH A;  4DHJ B;  3Q3J A;  1HE8 A;  1BT0 A;  2L3Z A;  3DVN V;  3H7P A;  1WXV A;  2BYV E;  1I42 A;  2NPT B;  1IYF A;  2KDB A;  4GB9 A;  4ASW C;  2IYD B;  2MW5 A;  5BO4 B;  3PHX B;  1E7V A;  2WX0 A;  4NAW B;  4IM0 A;  4URK A;  3N30 A;  3CSF A;  4JLC A;  2MWS B;  2FCM A;  4W9F A;  5D94 A;  3WAO A;  1GNU A;  2MBE A;  2L00 B;  2LWP A;  3NZS A;  4GIV A;  3K9O B;  2IO3 B;  3H7S A;  3V6C B;  2G45 B;  4BOS C;  1UD7 A;  2L76 A;  5LXI B;  4JIO U;  4A3P A;  2FAZ A;  3KH0 A;  3L16 A;  1R4N I;  3IHP C;  3W1S A;  3HK0 A;  2IO0 B;  3RUI B;  2RSU A;  1EO6 A;  3P2B A;  2DX5 B;  1NBF C;  4F7Z A;  1J8C A;  2CS4 A;  2L0T A;  2AL3 A;  3LDZ E;  4EOY A;  4ZRJ A;  2LXA A;  4W9D A;  3H7P B;  3ML8 A;  5E6O A;  1OEY J;  4AJW A;  4E71 A;  4LDT D;  1TGZ B;  4I6N B;  4WJO A;  2Z0D B;  3B08 A;  4IG7 B;  1OGW A;  4GGQ A;  3I3T B;  4JQW C;  2BPS A;  5D2M B;  2JT4 B;  2M0X A;  1P0R A;  2LD9 A;  1YJ1 A;  2GBJ A;  2LZ6 A;  2UWQ A;  2NVU I;  2ZCB A;  3KYC D;  4DBG A;  1G6J A;  1WGG A;  2YLM A;  4YL8 A;  3VFK A;  1UZX B;  4TQ1 A;  3PHW B;  3SD5 A;  3ZNI D;  1H8C A;  4M8N A;  3OJ4 B;  4A20 A;  3VQI A;  2AL6 A;  2GMI C;  4CHK A;  4DHJ D;  1V80 A;  1NI2 A;  3VUW A;  3CMM B;  2C7H A;  4F8C B;  4WQO B;  2ZJD A;  3HHM A;  2KJH B;  2JVC A;  1KJT A;  2BWE S;  5E6P A;  2K25 A;  3OLM D;  1WE6 A;  4MDK E;  2PE6 B;  4KV2 A;  2MBO A;  2ASQ A;  2KHW B;  1YIW A;  2KZR A;  2GOW A;  2M17 A;  3RUL A;  5IA7 A;  1UH6 A;  1SGH A;  3R7Q A;  4FUL A;  2WX1 A;  3L08 A;  4KDL B;  1RFA A;  1P98 A;  3PRE A;  3DBH I;  3AI5 A;  3IBE A;  1Z5S B;  3PRZ A;  2DAF A;  5CX3 A;  3ZTC A;  2KX3 A;  4BKG A;  2KDI A;  2AEH A;  2O2V A;  3A4R A;  3APC A;  4XC2 A;  2KNB A;  4CO7 A;  5L95 C;  1VCB A;  2KJ6 A;  4FLH A;  3MTN B;  4IUM B;  1WM2 A;  3U30 A;  3R3M A;  1WJN A;  2ZZP B;  2R2Q A;  3H1U A;  1LM8 B;  4FJY A;  4W9G A;  2O6V A;  4XX5 A;  4ZRK A;  1KOT A;  3N32 A;  1EF1 A;  4X57 B;  2KLC A;  3KUZ A;  5G55 A;  2EKE C;  2KTF A;  3ML9 A;  3TL5 A;  3VDZ A;  2W9N A;  4GMV A;  4J6I A;  2M1M A;  1Q0W B;  1NDD A;  3L10 B;  3DBR I;  4NQL B;  4KZ0 A;  3HM6 X;  5KHQ A;  3DBS A;  5JHB A;  2K8C A;  5G2N A;  3QX1 A;  4MGZ E;  2PE9 A;  1ISN A;  2VRR B;  2MBQ A;  2RPQ A;  2DZM A;  2KO3 A;  4W9K A;  1GC6 A;  4M0W B;  3ZVV A;  3ZTD A;  2MBB B;  2O2V B;  2MBH A;  2DZI A;  2DAJ A;  5DPT A;  1WMH A;  4ZYN A;  5IAA C;  2BKR B;  2D11 A;  2DZJ A;  2OOB B;  3APD A;  2RGF A;  2KK8 A;  3TMP B;  2G4D B;  2V1Y A;  2FCN A;  3M3J A;  2GBK A;  3EC8 A;  4G11 A;  3ENE A;  2LI5 A;  3PRM B;  4MJS A;  5D7G A;  4WJN A;  2O6V B;  2ZVO A;  3PS6 A;  2EMT A;  1UEL A;  4AJY B;  3UIN B;  5E6N A;  1WJ4 A;  2N9P C;  3IVF A;  1WX9 A;  2BYE A;  3NHE B;  3EHV A;  3Q3F A;  3U8Z A;  1TBE A;  1WR1 A;  2N9X A;  2K1F A;  1Y8R C;  2LVP A;  1WIA A;  3S2A A;  2CR5 A;  4NPN A;  4EZK A;  3L54 A;  3QHT A;  2LGD A;  5EDS A;  1A5R A;  4IWO A;  2DYB A;  2Z0E B;  4W9E A;  5DPS A;  1KLV A;  4HPM B;  4MEM A;  5DPR A;  4NNJ B;  4WAA A;  1U4A A;  1SIF A;  3W1S C;  2JUO A;  2MRP A;  2KX0 A;  3ZRC A;  1TTN A;  2J0K A;  4RM8 A;  4M8M A;  1E7U A;  3RT3 B;  1WMH B;  4NY0 A;  3EFU A;  3PV1 A;  5JHA A;  1V6E A;  5JZE B;  2CHW A;  4MJS B;  1SE9 A;  2CKH B;  2IO1 B;  3APF A;  4NQK E;  4LCD E;  4DXA B;  1WE7 A;  1J19 A;  3NY5 A;  3ZRF A;  4K1R B;  3VTU A;  3VUX A;  4LJO B;  3A1Q A;  3M95 A;  1WZ0 A;  3TJP A;  1GJZ A;  1V9J A;  4HCN B;  3WA0 A;  3NS8 A;  2CHX A;  3KW5 B;  2KKC A;  3PSE B;  4HJK A;  1P9D U;  4CYE A;  2D10 A;  2LUE A;  2N7D A;  4N9F 4;  4B95 A;  3PRP B;  3PZD A;  4HXD A;  3QIJ A;  1V86 A;  4HPL B;  2K39 A;  5D6J B;  3A9K A;  3N3K B;  2XK5 A;  1MG8 A;  3L17 A;  3ZIM A;  2K6D B;  4HWI B;  4BOZ B;  1GC7 A;  1WY8 A;  2O6V D;  1Q1O A;  3PTF C;  5GMV A;  4B9K A;  3D32 A;  2BWF A;  1F9J A;  1EF5 A;  2HE7 A;  2LJ5 A;  1OQY A;  1E8Y A;  2GBN A;  1V49 A;  4IC7 B;  3MHS D;  2N9E B;  2DYO A;  4ICV A;  4BKT A;  1ZGU B;  3A1Q B;  4ICU A;  5AZF A;  3WAM A;  2PJH A;  1LFD A;  3SU8 X;  3UQA A;  2MX2 A;  1YX5 B;  2ZCC A;  2KLG A;  3V60 A;  2MSE D;  3KVF B;  4JL9 A;  2FIF A;  1UGM A;  4OVV A;  2DEN B;  2L05 A;  4PS8 A;  1UBQ A;  1ZKH A;  2I1K A;  2KVR A;  3DOW A;  3ECI A;  1E5W A;  4LJP B;  5CHW A;  2ZNV B;  4FA6 A;  4WJQ A;  1XT9 B;  3UQB A;  2C7M B;  3A9K B;  1H4R A;  2XK5 B;  4HLE A;  4FBJ B;  4GXB A;  3VTV A;  2BF8 B;  1E90 A;  2G4S A;  4W9C A;  3PLV A;  2LVQ A;  2RR9 A;  3VH3 B;  4IWQ A;  3ZO5 B;  3ZUN A;  5L83 A;  3AXC A;  3QWZ B;  4TUU A;  4G50 A;  2XEW A;  2JF5 A;  2LRW A;  4JGH B;  3VAW A;  3X23 A;  4KSK C;  4NJ6 A;  4KVG B;  2JXX A;  4MGK E;  4I6P A;  1S3S G;  3RZF A;  4F1S A;  5AEK B;  4HDO A;  1V5T A;  5JH5 C;  4ANX A;  2L8J A;  2BKF A;  1PQS A;  1C3T A;  2MP2 A;  4KSL C;  4WWO A;  3WIM A;  1Q5W B;  1X1M A;  1WF9 A;  2KWC A;  4XZ4 A;  4K7S A;  4W9I A;  2JRI B;  1WR6 E;  3VXW A;  2L0F A;  1AAR A;  3KUC B;  3DBL I;  3KUD B;  2V4L A;  4MSM B;  4FHK A;  3W1Y A;  1WGR A;  2KOX A;  1S1Q B;  2C60 A;  4MH0 E;  5LXH A;  2N1V A;  4OVU A;  3M62 B;  2AWT A;  5C1Z A;  3QQ8 B;  3K9P B;  3B1L X;  2IY1 B;  2IY0 B;  4K7U A;  3X0W A;  2EMS A;  3L13 A;  2KAN A;  2BYF A;  1WGD A;  3HM3 A;  4MSQ B;  4ANU A;  4TV3 A;  5HKH A;  2RD0 A;  3DCG A;  4IM2 A;  2N7E A;  2JRH A;  4BKS A;  1YQB A;  3ZNG C;  3IG3 A;  2XBB C;  3M63 B;  3ZNH B;  2CHZ A;  3BY4 B;  2KWV B;  4IW0 A;  1P1A A;  2ZPN A;  2IBI B;  4K81 A;  2KJR A;  1QZE A;  1JRU A;  2MLB A;  2LAS A;  2ZVN A;  2MP2 B;  1E8X A;  2K6Q A;  2A5U A;  4GDL A;  1WXS A;  5TR5 A;  1GG3 A;  4DDI D;  4KDI C;  4FAD A;  3OJ3 A;  4G0N B;  3T9L A;  4AUQ C;  4TQ0 A;  1EUV B;  1R4M I;  2JY6 A;  3OAW A;  2WYQ A;  2HD5 B;  2ZPY A;  4PS3 A;  2KTR A;  4TKN A;  3TIX A;  3VH4 B;  1M94 A;  3IFW B;  3ALB A;  2MA9 B;  2LXC A;  2REX A;  4AP4 C;  2FUH B;  1E8Z A;  2D2Q A;  3L0W B;  1V5O A;  1L7Y A;  2G3Q B;  2NBW B;  2KMA A;  4FN2 A;  3O65 B;  4GSW A;  3HIZ A;  2J0M A;  1E8W A;  2NBV B;  3EEC A;  3BIN A;  3QAQ A;  4P7I A;  2C7N B;  4WWN A;  2AYO B;  3LJ3 A;  2Y5B B;  3JYU A;  2JZ3 B;  4E3C A;  2NCN A;  2FNJ B;  1WYW B;  2ZNV C;  2DZK A;  4GDL B;  3GZN I;  2KMC A;  5CHF A;  1XD3 B;  4ZRI A;  3AU5 A;  2KFJ A;  3DVG Y;  3RCZ A;  2JPH A;  2M4N A;  2IZV B;  3JSV A;  1C1Y B;  4PS7 A;  1T0Y A;  1IPG A;  3JW0 X;  5J18 A;  3ZDM C;  4IWP A;  1LQB A;  3RYT A;  2JWZ A;  2KTR B;  4HK2 A;  4WWP A;  1UBI A;  2C9W B;  2BGF A;  1KM7 A;  3A33 B;  1WXM A;  3DDC B;  3CST A;  4FJZ A;  1WJU A;  3QC8 B;  2KFK A;  4WJP A;  4IM3 A;  1K8R B;  3V6E B;  2KXJ A;  4FHJ A;  3V61 A;  4DK5 A;  3A4S C;  3UIP B;  3KYD D;  5DCN A;  3PT2 B;  4PYU A;  1XQQ A;  3UGB B;  3CF6 E;  4BVU C;  5FR6 A;  3R66 C;  1FXT B;  1WX8 A;  4AOF A;  2KDE B;  2MQJ A;  2IO2 B;  2MCN B;  3PGE A;  4BFR A;  4B6W A;  2L7R A;  5AZH A;  2M8S A;  4RMA A;  4II3 B;  3PLU A;  4HCP B;  3ZDT A;  1V2Y A;  2FCS A;  2K8H A;  2KQ7 A;  2YVC A;  4ANW A;  5J2R A;  1WFY A;  3ZLZ A;  1D3Z A;  1WX7 A;  2DYM A;  3A9J A;  3PVL A;  3JSV B;  4BBN C;  4DWF A;  2HJ8 A;  2N1W A;  2KD0 A;  2Z59 B;  3AUL A;  2D3G A;  3DVN U;  2DHZ A;  3SHQ A;  2NBU A;  1OEY A;  4AWJ A;  5CHV C;  2N4F A;  2WDT B;  2NR2 A;  3PPA A;  4BKS D;  3RZW C;  2KFK B;  1OTR B;  3QA8 A;  4HDQ A;  4W9J A;  3QCA A;  3VUY A;  2LVO A;  2B3A A;  3SDL C;  2ZEQ A;  1J0G A;  1WH3 A;  2A4Z A;  5CTR C;  4I6L B;  2HTH A;  2D07 B;  4DDG D;  3ZNZ B;  1V81 A;  2CU1 A;  4MGI E;  4GU2 A;  4E74 A;  3VHT C;  1CMX B;  4EKU A;  4EFO A;  5KHO A;  4W9H A;  2GBR A;  4EEW A;  3AU4 A;  2WWZ A;  3DVG X;  5C23 A;  3A9J B;  3DQV A;  2PEA A;  4GDK A;  3ZW3 A;  2KN5 A;  2V3S A;  2KDF B;  4KIK A;  2LRU A;  1LXD A;  4II2 B;  2FID A;  4MEL A;  2NS5 A;  3WAP A;  1RAX A;  2C5L C;  4DHZ B;  3RD2 A;  3UIO B;  3C0R B;  4K7W A;  1P3Q U;  4GOC A;  4W9L A;  5LLI A;  3V62 A;  3JVZ X;  2J7Q B;  2UYZ B;  1RLF A;  2LGY A;  1Z2M A;  2FCQ A;  3VTW A;  2LGX A;  4RM9 A;  5DPW A;  1YX6 B;  4DHZ E;  2QHO A;  1WGH A;  5AZG A;  4MM3 A;  4EZJ A;  2JZZ A;  3T8M A;  4HVB A;  1RRB A;  1WRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...