2AL3A

Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
SAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords TUG long isoform
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11470 TUG-UBL1 TUG ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al3A00
1WXAA 2GBRA 2IBIB 2LWPA 1WI0A 3DQVA 4JIOU 3Q3JA 1J19A 1GUAB 3RD2A 4OVVA 2CU1A 5D7GA 1F9JA 3A9JA 3VDZA 4A3PA 4E74A 4HDOA 1KOTA 2GMIC 2HE7A 4FN2A 2KDEB 2C9WB 3L10B 3OLMD 3HM6X 4GN1A 2ZZPB 2ZVOA 3CSTA 4KZCA 4WJOA 2DZJA 3RT3B 1E8YA 4WJPA 3DPDA 5E6PA 5E6OA 2CHWA 2UYZB 3LJ3A 4IM0A 1NI2A 3QCAA 1E7UA 2CS4A 4ZDVA 4ZYNA 1H8CA 3V60A 3APFA 5DPSA 1P9DU 1S1QB 4EOYA 1UD7A 4PYZA 2NBWB 3A4RA 3A4SC 2JUOA 2R2QA 1V5TA 2L7RA 3OJ4B 4W9KA 4BOSC 2MBHA 1WFYA 2MQJA 3DBLI 1OQYA 4AP4C 2KNBA 2WWZA 4XC2A 2CHZA 3H6NA 3GOEA 4MM3A 2YVCA 2NBUA 3CMMB 1JRUA 4K7UA 2JVCA 4GDLB 1I35A 4TQ0A 3BY4B 2DYMA 4HWIB 5IAAC 2N9PC 2FCMA 4WWNA 3V6CB 2AEHA 3OAWA 2D10A 5L83A 3ENEA 3EFUA 2CR5A 1P0RA 2ZNVC 4NNJB 4K1RB 1J8CA 2ZVNA 3NY5A 2KD0A 4B95A 2Z0EB 4EFOA 2BPSA 3VFKA 5KHOA 3KUDB 3ZO5B 5DPRA 2IO3B 2V3SA 2ZNVB 3K9PB 4W9FA 3VAWA 2KFJA 1V86A 3VVWB 1XQQA 2FNJB 1EO6A 2C60A 2JY6A 4HDQA 2KO3A 2LXAA 1TGZB 4KZ0A 2MLBA 5JZEB 4MJSB 2G4SA 4W9LA 3DVGX 3UINB 1SE9A 4E71A 4NJ7A 3ML9A 4GB9A 2WX0A 1E8XA 4M8NA 2NR2A 2LGYA 4PS8A 2L8JA 4ANWA 1ISNA 5IA7A 1P98A 2MBQA 3WALA 1UELA 2DENB 4JQWC 2LGXA 2K6QA 3L17A 1WX7A 4HCPB 5AZFA 4GIVA 2GBNA 1H4RA 2EMTA 4LDTD 1IP9A 3H7PA 3EHVA 2AL6A 3APCA 4K7SA 5J17A 4HJKA 3ZKJC 3I3TB 3ECIA 2VRRB 2V1YA 2RPQA 3VH4B 3ZNID 1U4AA 3L54A 5C23A 2Z0DB 1V81A 3NHEB 4FULA 4A20A 2KFKA 1OGWA 3VUYA 2J0KA 4KDLB 2D2QA 3PRMB 4BBNC 2JPHA 2L0FA 1WXSA 2OOBB 2GBMA 3H1UA 2LXCA 4IW0A 4NJ6A 3L16A 2MBEA 1NDDA 4PS7A 1SIFA 4AJYB 2DZIA 2M1MA 3QHTA 1YIWA 3WAOA 4IM2A 3JVZX 3MJWA 1RFAA 2HTHA 4JL9A 3DDCB 2N1WA 4BOZB 3HIZA 2O2VB 1Z5SB 1WF9A 1Y8RC 2J0MA 4XZ4A 2KK8A 1XD3B 4W9EA 2ZJDA 3KUZA 4W9IA 4ZRJA 1WZ3A 2N1VA 1UBQA 2LVPA 2WDTB 2JWZA 3KVFB 3WANA 1L2NA 1ZGUB 4F1SA 2KWVB 4MGIE 2M4NA 1ZW7A 1GG3A 1WM2A 2LASA 4NQLB 3HHMA 4EZJA 5J2RA 4IG7B 2ZCCA 2N9XA 2FIFA 2KQ7A 2OJRA 3A1QA 3ZLZA 2MP2B 3WIMA 1A5RA 5D94A 4GDLA 4NAWB 4WJQA 3UF8A 4BKGA 1V80A 2LJ5A 2IYDB 3PRPB 3QC8B 1V9JA 1WH3A 4TQ1A 4I6PA 5G2NA 4DHJB 1GJZA 2BKRB 2WYQA 3V6EB 4FJVB 4II2B 1WRDB 1WYWB 2I1KA 4N9F4 2HJ8A 3SDLC 1Q5WB 2O6VD 2KTFA 2O6VB 2NBVB 2D07B 4URKA 4W9HA 4DK5A 3W1YA 2LVOA 2XK5B 3GZNI 3D32A 3KW5B 1Q1OA 2V4LA 3PLVA 3KYDD 4EUTA 1I42A 4BKTA 3A33B 4DDID 2KJRA 3CF6E 3IHPC 4FJYA 4ZRIA 4OVUA 4M0WB 3QWZB 2L3ZA 2MP2A 3A9JB 3MHSD 3A1QB 5EDSA 1WJUA 2D3GA 4HXDA 1FXTB 3UIOB 4ASWC 1WJ6A 3ZTCA 4EZKA 2MBBB 2GBKA 3V62A 2Z59B 2MA9B 3L08A 3KUCB 2KN5A 3L13A 3QARA 2W9NA 4W9DA 4A3OA 2JZ3B 1WM3A 2O2VA 4EZLA 2KJHB 4MDKE 4TUUA 3ZUNA 1P3QU 4NQKE 1V49A 1WXMA 2N9EB 3DVNV 2IZVB 3JW0X 4LJPB 1WIAA 3A9KA 3CSFA 2KTRB 4MSMB 3DBSA 1OEYJ 1YD8U 4MELA 5G55A 1YX5B 5HKHA 2I1JA 4TV3A 2L0TA 2G3QB 2K39A 2KQSA 3K9OB 3TL5A 4ICVA 3T8MA 2DX5B 4FJZA 1RRBA 1TZ1A 2NCNA 3KYCD 3UIPB 3VTVA 1BT0A 2LRUA 3M3JA 4RM9A 4ZRKA 5JHAA 1WR1A 4GDKB 4P7IA 4BFRA 1YX6B 3R66C 4G50A 2DZKA 2J7QB 1V2YA 4FLHA 4IUMB 1EF5A 3T9LA 2KC1A 1OEYA 3B08A 3PLUA 4NPNA 4EKUA 1GC6A 2MSED 3JYUA 1WJNA 3H7PB 3WAMA 4WAAA 1IYFA 4CHKA 4KVGB 4DHZE 3ZNGC 4LDTB 2BKFA 5AEKB 4G0NB 3NZUA 4GXBA 4LJOB 1MG8A 4KV2A 3SU8X 3W1SC 4F7ZA 2KDIA 3O65B 3TBLD 1VD2A 3JSVB 1ZKHA 4FHKA 2N4FA 4HLEA 2ZPNA 4FBJB 1EUVB 3QJZA 4ICUA 3V61A 3AULA 2A5UA 2L76A 2K1FA 4AOFA 2GOWA 1G6JA 4JLCA 4M8MA 3QA8A 1E7VA 1TBEA 2QHOA 2REXA 3DBRI 5TR5A 2EMSA 2KJ6A 4KIKB 3PVLA 2AWTA 3TJPA 2KLGA 4X57B 2KANA 5CTRC 3PV1A 1E8WA 4II3B 2KC2A 3M62B 3H9DA 3N30A 3VTWA 2UWQA 2ZCBA 3NS8A 3ML8A 2IY1B 2M0XA 3VXWA 2LZ6A 2CKHB 4DWFA 4GMVA 3UQBA 2MW5A 5FR6A 4WQOB 2IO2B 3BINA 3QAQA 2BGFA 4I6LB 2LI5A 3S2AA 5KHQA 1LFDA 1C3TA 3W1SA 1R4MI 1WY8A 3TCAA 2R2OA 3PRZA 4XX5A 1S3SG 2KHWB 3PPAA 1R4NI 2FCNA 1QZEA 2AL3A 1AARA 2MX2A 3RYTA 3ALBA 4K7WA 3AU5A 4NAWA 4F8CB 4MGZE 2RR9A 2BYVE 3DOWA 3AXCA 2NVUI 3SD5A 1T0YA 4WWOA 5LXIB 2BYEA 1WE7A 4WWPA 1WGGA 3ZNHB 2LVQA 2PJHA 3R7QA 3RUIB 2FIDA 3ZDMC 2L05A 3L0WB 2C7HA 1WGYA 2BWES 4CO7A 2RSUA 1CMXB 4MGYE 3ZRCA 4FA6A 4RMAA 2D11A 3RCZA 4ANUA 4HK2A 2C5LC 1K8RB 3QX1A 4GOCA 5LXHA 3PHWB 3OJ3A 5J18A 3PHXB 1GC7A 3ZDTA 1SGHA 1LM8B 1L7YA 3TMPB 2KZRA 5GMVA 2KXJA 1D3ZA 3APDA 2JF5A 3RZFA 4DHJD 1UZXB 2K8BA 2K8CA 5D2MB 3B1LX 2RD0A 2XBBC 4YL8A 3QK0A 3IVFA 2C7MB 4W9JA 2KDBA 3HK0A 3WA0A 2HD5B 4LCDE 5DPTA 2M8SA 4BKSA 2DAJA 4KIKA 3VQIA 2KFKB 3KH0A 1YQBA 3PTFC 5BO4B 2WX1A 4HCNB 3WAPA 5LLIA 4DXAB 2ASQA 3IFWB 2KLCA 1P1AA 4HPLB 2NPTA 4JGHB 2PE6B 2XK5A 4B9KA 3U8ZA 2ZEQA 1EF1A 1TTNA 3N32A 2G4DB 2KWUB 3PS6A 1WXVA 2IY0B 4IWPA 1WMHA 4DBGA 5AZGA 3SHQA 1M94A 2DYBA 1YJ1A 4I6NB 3ONSA 4AWJA 4W9CA 3M63B 2MCNB 2MBOA 4KSKC 3DVNU 3NOBA 2KWCA 1WMHB 4NY0A 4IM3A 2JZZA 3ZIMA 2EKEC 1VCBA 4E3CA 5CX3A 2NS5A 2LGDA 1XT9B 3R3MA 4PYUA 4DDGD 2JRIB 4MJSA 5JH5C 2G45B 4BBNF 4GDKA 1WGDA 4KSLC 3HM3A 1X1MA 4PS3A 1UBIA 3UQAA 2FCQA 3PGEA 4AUQC 2K25A 2BF8B 3EC8A 3EECA 1KJTA 3DCGA 1WE6A 2C7NB 3Q3FA 2XEWA 5DCNA 2DHZA 2KTRA 1WGHA 2LUEA 2IO0B 3VH3B 5CHFA 2K8HA 1LXDA 3X23A 3ZRFA 4TKNA 1PQSA 4HPMB 4MEMA 4WJNA 1E8ZA 4HVBA 4K81A 2PEAA 3ZVVA 3ZTDA 3ZW3A 3M95A 2IO1B 2KX3A 2PE9A 1LQBA 3PSEB 5JHBA 4FHJA 4EEWA 1RAXA 2JXXA 3VUXA 4FADA 1E90A 4B6WA 1GNUA 4G11A 1Q0WB 2YLMA 3ZNZB 2LRWA 3RZWC 1E5WA 1RLFA 3B0AA 3C0RB 4IWQA 3VTUA 2FAZA 3X0WA 5L95C 2DAFA 2L00B 3PT2B 5AZHA 4ANXA 2RGFA 3R7RA 4J6IA 1WR6E 1C1YB 2JT4B 2K6DB 4MSQB 2BYFA 4IWOA 3DBHI 3LDZE 2JRHA 4IC7B 2N7EA 2O6VA 2A4ZA 3IG3A 3P2BA 3VHTC 4GSWA 2N7DA 2PPHA 5CHWA 4MGKE 3H7SA 1UH6A 2GBJA 3NZSA 1KLVA 2FUHB 4RM8A 2BWFA 2M17A 1NBFC 3PREA 4W9GA 3QQ8B 1UGMA 1V5OA 3U30A 2J0JA 2KMAA 5D6JB 4BKSD 5DPWA 3RULA 4BVUC 2ZPYA 2LD9A 4KDIC 2KX0A 4G3XB 3DVGY 5C1ZA 4GU2A 3AI5A 4MH0E 3JSVA 2AYOB 1IPGA 1KM7A 3UGBB 1OTRB 5CHVC 4DHZB 2KDFB 3A9KB 2DYOA 1WX8A 3AU4A 1WZ0A 2KOXA 2Y5BB 3TIXA 1WGRA 3IBEA 3MTNB 4AJWA 2B3AA 1V6EA 3PZDA 4CYEA 1J0GA 2DZMA 3VUWA 3N3KB 1WJ4A 2KMCA 2MWSB 1WX9A 1Z2MA 5E6NA 2NPTB 4GGQA 2KVRA 2FCSA 1HE8A 2MRPA 3QIJA 3U7DA 4ANVA 2KKCA 2CHXA
chains in the Genus database with same CATH superfamily
2QDFA 1WSPA 2GBRA 2LWPA 1KRHA 4JIOU 3H8HA 3RD2A 4OZAA 1F52A 3A9JA 3HVDA 2HE7A 4FN2A 4GN1A 2C9WB 3L10B 5EE3A 2ZVOA 2GI9A 5G5GA 3T3NA 3DPDA 3P4SB 1E7UA 2CS4A 3RPFC 4ZYNA 3V60A 1F0ZA 4C80A 1NEKB 2R2QA 4W9KA 2AX5A 1WFYA 2OEDA 2WWZA 1F1HA 3GOEA 3AE8B 2YVCA 4K7UA 4GDLB 4L23A 2CJOA 3BY4B 4TQ0A 2J52A 1IUEA 2AEHA 3OAWA 3DBRB 1TKEA 4DQOC 3EFUA 2CR5A 3AE6B 4NNJB 1J8CA 1L0VB 4HRSA 2CU3A 4B95A 3VFKA 5KHOA 4W9FA 3VAWA 1KFYB 1TYGB 1QOAA 2C60A 4LNNA 4C00A 1EWYC 1TGZB 2MLBA 2G4SA 4LTUA 3DVGX 2GB1A 4E71A 4GB9A 1E6EB 2NR2A 2LGYA 5IA7A 4A55A 2PLPA 1WX7A 5AZFA 2D3BA 3H7PA 1I7HA 1IGCA 3EHVA 5J17A 3ZKJC 3I3TB 3ECIA 2RPQA 3ZNID 1QKZA 3L54A 5BYSA 4FULA 3AEAB 3ZGZA 2JPHA 1WXSA 3Q8EA 4YTNB 4NJ6A 1ZDVA 1NDDA 2DZIA 2IPKD 2HJ1A 3RNBC 3NVWA 4JL9A 4XYCA 2N1WA 1Z5SB 1WF9A 3Q14C 3KVFB 2WDTB 3WANA 3DBHB 3DHGC 4IG7B 2IJ0A 2FIFA 2OJRA 3ZLZA 3RN9C 1Q10A 2X8XX 4BKGA 3PRPB 1I4QA 2BKRB 2DLBA 4MT5A 1WYWB 2MJ3A 2V9HA 2WDVB 3SFEB 1WYGA 2O6VD 2Y5CA 2D07B 3P42A 3W5VB 5H92C 3KW5B 3D32A 2V4LA 5HI1A 1PGXA 3KYDD 4EUTA 2PTLA 1TT5B 3IHPC 4FJYA 1XLPA 4OVUA 2L3ZA 2I38A 3Q8CA 3RI7C 2D3GA 4HXDA 1YN4A 1WJ6A 1TY0A 2BT6A 2MEKA 2KN5A 1K50A 2BS4B 2W9NA 2JZ3B 1HXYD 2WXFA 4NQKE 1YNTE 4OZBA 2IZVB 2KTRB 3DBSA 1YD8U 3CWIA 3ABVB 4K3CA 4NZLB 4TV3A 2KQSA 3K9OB 4O1NA 2DX5B 4FJZA 1L0YB 1TZ1A 3VR8B 3VTVA 3ZXRA 3M3JA 5JHAA 4ZRKA 3VR9B 4P7IA 1FCLA 2FUG1 1YQ3B 1QOFA 4LK0M 3H7PB 2WXMA 4REZA 1UUPA 4KVGB 4WH4A 3C8YA 5AEKB 2WHIA 3BYTB 4KV2A 4YT0B 3TBLD 1VD2A 1JROA 4FHKA 4ICUA 3AULA 2A5UA 2K1FA 4JLCA 4M8MA 3QA8A 2REXA 3NVYA 2PVGC 3PVLA 1TKGA 4HKZE 2UWQA 2M0XA 3VXWA 2CKHB 1C78A 3UQBA 2IO2B 5KHQA 3W1SA 3I9V1 3HUIA 1Y56A 4K7WA 2XNAC 3SD5A 1T0YA 3RMKC 5LXIB 2Y3AA 4JPSA 2J53A 1WGGA 4HPPA 4WWPA 2LVQA 1PUTA 2WXPA 1WGYA 3I5JC 1XCTL 4RMAA 5AUKA 4ANUA 4ACFA 3GP7A 4GOCA 3J9CA 3OJ3A 5J18A 2X38A 2KZRA 1ZUD2 2KXJA 2H89B 3APDA 2WDQB 3BVGA 2EELA 2H88B 3RZFA 4DHJD 5D2MB 3AE5B 2XBBC 4YL8A 1TS3A 2JWUA 3NS1A 4BKSA 4KIKA 2Z8LA 1YQBA 2QILA 4DXAB 4RCOA 2KLCA 5MPOA 4HPLB 2V3PA 2KWUB 5IO9A 3KWVA 1WMHA 2JYTA 3R2TA 4W9CA 3M63B 3NOBA 4LNFA 2NMQA 1I4GA 2JZZA 1E7PB 1VCBA 4HROA 3BK2A 1XT9B 3IAS1 4XWWA 3MHZA 5IOIA 2JRIB 1OQQA 5JH5C 4D2KA 1AYFA 3AM9A 1N60A 3PGEA 2K25A 4PK1A 1KJTA 1JMLA 1WE6A 2C7NB 1VDVA 3PO0A 1WGHA 3X23A 3ZRFA 4HPMB 4MEMA 1DOYA 4HVBA 4K81A 1ROEA 3ZW3A 1SF0A 2KX3A 3PSEB 5JHBA 4EEWA 3OWEB 2INCC 1N6ZA 4B6WA 1WWTA 4G11A 4JWUC 3ZNZB 3RZWC 1E5WA 1RLFA 1FO4A 3C0RB 3VTUA 3ZJTA 5AZHA 4ANXA 3R7RA 2KQ4X 2K6DB 3LDZE 2K22A 4IC7B 2O6VA 1EM7A 3VHTC 5CHWA 2GBJA 1CZPA 1KLVA 1C4PA 4RM8A 3R2IA 3NUHB 2M17A 2MH7A 1HTOA 3DBLB 3QQ8B 1V5OA 2KMAA 2WXGA 4KDIC 1C4CA 4LNIA 3DVGY 5EE0A 1IPGA 1MHXA 1OTRB 5CHVC 3A9KB 4ZHOA 1WGRA 1GOZA 1MI0A 2KMCA 3DHIC 3HRDD 2NPTB 3KLSX 2KVRA 3U7DA 2DWQA 2CHXA 1FNWA 3GS2A 1J7BA 1WXAA 2IBIB 1WI0A 3TUOA 2ZW1A 1J19A 2ON8A 5D7GA 2M56B 2V4IB 1E10A 4ITKA 2GRIA 3OLMD 2WXLA 1SE3A 4KZCA 4IOIE 2HTME 1SXTA 5E6PA 1XXGA 1N63A 1NI2A 3HVZA 1TZOA 2BS3B 4IDIA 4WURA 3DHHC 3A4SC 2JUOA 1V5TA 2L7RA 2WXQA 3DBLI 2MQJA 3Q8BA 4AP4C 1MPEA 1TY2A 2NBUA 3BIID 2DYMA 1ZXIA 3O13A 2VH2A 3V6CB 1N61A 2KDMA 4XE0A 3GB1A 2VH1A 2Z0EB 4EFOA 2BPSA 1SE4A 2ZNVB 2KFJA 1V86A 3VVWB 3Q2AC 2JY6A 2KO3A 2LXAA 2WQYB 4W9LA 1WXQA 1SE9A 3B9JA 3W2DA 2L8JA 3WALA 1UELA 4JQWC 4HCPB 3RNAC 4GIVA 1KF6B 2EMTA 1IP9A 2VRRB 2V1YA 1RFKA 4HJGE 1T0SC 1VZ7A 3VUYA 2J0KA 2D2QA 4AQ7A 3PRMB 2L0FA 1QT9A 2KWDA 1ZOYB 2M1MA 3AEDB 4IM2A 2W55A 4BOZB 2O2VB 3AECB 4XZ4A 2ZJDA 3KUZA 1WZ3A 2LVPA 1L2NA 1SSNA 2M4NA 4NQLB 1ZW7A 1J7AA 1GG3A 2LASA 3HHMA 3V3XA 2N9XA 2KQ7A 5G5HA 3A1QA 1A5RA 3UF8A 1V80A 3I57A 1UWMA 1V9JA 2RPVA 1OFFA 2EKIA 4MH8A 4M00A 2ZW0A 3KWLA 4OHJA 2LFIA 2HJ8A 1Q5WB 2O6VB 4URKA 4W9HA 4DK5A 3W1YA 2LVOA 1L4DB 4KGRA 1R4MB 3PLVA 1FRDA 3A33B 3CF6E 4ZRIA 4M0WB 2MP2A 1GB4A 5EDSA 1WJUA 1FXTB 4ASWC 2SEBD 4YSXB 4EZKA 1DOIA 3PZ8A 3V62A 2Z59B 2MA9B 2MJEA 4W9DA 1WM3A 1FD6A 4MDKE 4TUUA 2ACZB 1WXMA 1SJHD 1WIAA 1V1OA 3N1ZC 1YX5B 2IDYA 2LMCA 2L0TA 2WU2B 2K39A 1TJEA 4ICVA 5GXGB 3B2GA 2NCNA 3KYCD 1GPXA 1D6EC 1BT0A 2LRUA 3GE8C 1YX6B 1JW9D 1ZE3D 1EF5A 2G9HD 1OEYA 1JQ4A 3B08A 3PLUA 3JYUA 1WJNA 4WAAA 1E0ZA 2R61A 4DHZE 4F7ZA 3SU8X 1MG8A 2W54A 5TSSA 4ZHPA 2GLSA 2N4FA 4HLEA 4H2AA 4WAFA 1EUVB 2L76A 2GOWA 1BMLC 1E7VA 1PFDA 2QHOA 3DBRI 2EMSA 1R4NB 2KJ6A 4KIKB 4EE2A 3Q6BA 1E8WA 1VR9A 3M62B 3H9DA 3N30A 3T3OA 1FNVA 3NS8A 3ML8A 5FR6A 2N0SB 3W5UB 3QAQA 1JWAD 4I6LB 2LI5A 1LFDA 1R4MI 3ZQ4A 1UGJA 2JZPA 3PRZA 1FIQA 2PW9A 1R4NI 4RGMA 2AL3A 3AU5A 4F8CB 1QILA 4MGZE 4USAA 2BYVE 1T0QC 2INPE 4BAXA 1ACCA 2BYEA 4IKGA 1SBBB 3RUIB 3L0WB 1N62A 2WXIA 4CO7A 2RSUA 1D5XC 3ZRCA 2D11A 1P7FA 4HK2A 1K8RB 3QX1A 5LXHA 1L0XB 2QEJC 3N1YC 3PHWB 1YQ4B 1I4RA 3PHXB 1GC7A 3AEBB 3ZDTA 1UWXA 2JF5A 4XDCA 2G1EA 3QK0A 3NJTA 1YMHE 1SEBD 3RNGC 2BB5A 2M0AA 2XN9C 1B1ZA 3PTFC 3IFWB 1PGBA 2PVOD 1P1AA 1F77A 4JGHB 4B9KA 3U8ZA 1EF1A 3N32A 4DBGA 5AZGA 3SHQA 1M94A 1YJ1A 4AWJA 2MCNB 4KSKC 1ET9A 4IM3A 2EKEC 4E3CA 4KKIA 1BXTA 1FRRA 4BBNF 4KSLC 3VRBB 3BYYB 3HM3A 4PS3A 3UQAA 4QAYA 1OQRA 4AUQC 2BF8B 1VZ6A 1AWDA 3Q3FA 3BVMA 2XEWA 5DCNA 2DHZA 2KTRA 3VH3B 2LUEA 2L32A 1EU3A 2LJIA 1VZ8A 4KGSA 5D3IB 4K3BA 4ZRPA 1LQBA 4FHJA 4FADA 4AS1A 1NENB 2LRWA 3X0WA 5L95C 1LO5D 2AQ2B 2RGFA 1C1YB 2JT4B 4MSQB 2BYFA 3IG3A 3P2BA 2A4ZA 2PIAA 4GSWA 1QOBA 3MJ5A 5T8IA 1XLQA 3H7SA 1TS4A 3TEZA 2AQ3B 3LB8C 1I4PA 3DWMA 1ENFA 1UGMA 5I4DA 2ZPYA 2WLBA 1SIJA 2CJNA 4XGAB 4DXGA 2KX0A 4G3XB 2D5GA 1HTQA 1GAQB 2RDGA 1RYJA 4MH0E 2BQQA 2AYOB 2KDFB 2DYOA 1WX8A 3TIXA 2Y5PA 3RFZB 1V6EA 4CYEA 3N3KB 2MWSB 3NG0A 1WX9A 4GGQA 1MHHE 3N1XC 2FCSA 2MRPA 3TEWA 2JX5A 2N9LA 4OVVA 3VDZA 4A3PA 2GMIC 2KDEB 2WNMA 3BZDB 2ZZPB 1MJDA 3CSTA 4WJOA 2W3SA 2WDRB 3NVZA 2B76B 2CHWA 2UYZB 3LJ3A 4US8A 4ZDVA 3Q3OC 5DPSA 1P9DU 1S1QB 4BOSC 2I2YA 1OQYA 4XC2A 3H6NA 4MM3A 2INNE 1YN3A 1JRUA 2JVCA 4M0WA 1MVKA 5IAAC 1VLBA 2N9PC 2FCMA 3IT6B 2RMMA 3SEBA 3ENEA 1NI3A 4C4VB 3LYYA 2ZVNA 2KD0A 3ZJVA 2E3TA 2K5PA 3KUDB 2V0GA 5DPRA 2V3SA 4C56C 4XDDA 1EO6A 5BYQA 1VJKA 4KX6B 5JZEB 4MJSB 3UINB 3ML9A 2VZKD 4M8NA 4PS8A 4ANWA 1ISNA 2LGIA 3PZ7A 2LGXA 4L2YA 2AL6A 3APCA 4K7SA 4HJKA 3I63C 3U2SC 1HA5A 1U4AA 5FR3A 4RFBA 4A90A 3E9SA 3L4PA 4BBNC 2OOBB 2GBMA 3H1UA 4PT5A 2LXCA 3L16A 2MBEA 3P4PB 4PS7A 1SIFA 3QHTA 3URYA 3JVZX 1PYWD 4L1BA 3DDCB 1Y8RC 2J0MA 4W9EA 2WS3B 1UBQA 2JWZA 1A70A 1WM2A 4EZJA 2ZCCA 4C7ZA 4P6VF 1CJEA 4JX1C 5D3DA 2LJ5A 3U7ZA 5G2NA 3QC8B 4DHJB 1JWUD 2WYQA 3V6EB 4FJVB 4II2B 1KLUD 1ET6A 2I1KA 4N9F4 4ZRQA 3SDLC 1MFWA 4YWGG 1XO3A 1T5XD 1Q1OA 2PKOA 1I42A 2KVZA 3CIRB 3IAM1 4BKTA 4DDID 1HZ6A 3E56A 3QWZB 3AE7B 3C19A 3UIOB 4B0EA 3ZTCA 2MBBB 1QLBB 2MJDA 2GBKA 5JXVA 3L08A 2JYEA 3KUCB 1LGRA 3L13A 4EZLA 1P3QU 1V49A 2N9EB 3JW0X 4LJPB 3A9KA 4MSMB 3CSFA 4MELA 5HKHA 2I1JA 1XLNA 5E6JA 2N7JA 1RRBA 3R66C 1NYRA 3UI3A 2DZKA 4FLHA 4IUMB 1D5ZC 1T0RC 4NJCA 1XLOA 4FXCA 2MSED 2LHDA 1IYFA 4CHKA 3ZNGC 4LDTB 2BKFA 4G0NB 2KDIA 3O65B 2NTTA 4ARCA 1ZKHA 4FBJB 2YEPB 3QJZA 3V61A 3NRZA 4AOFA 1G6JA 1SJED 2RDBC 5TR5A 3ETRA 1AW7A 2QJLA 2AWTA 3TJPA 4X57B 2KANA 1STEA 4II3B 2KC2A 1C76A 3VTWA 4YXDB 1K53A 2KMMA 2IY1B 3BINA 1HEZE 4C4VA 2WU5B 2R2OA 4XX5A 5HG2A 1NYQA 2KHWB 3PPAA 2FCNA 3RYTA 4NAWA 2RR9A 3AXCA 1V1PB 3P1MA 4TMAB 2L1AA 1TKYA 2JQRB 3ZDMC 2FIDA 2L05A 2C7HA 2BWES 3AE2B 4S17A 1CMXB 4RGNA 3U4EG 2C5LC 1AN8A 1LM8B 3TMPB 3AN1A 2YEPF 5GMVA 1D3ZA 1TIFA 1HQRD 3B1LX 2RD0A 4W9JA 3HK0A 3WA0A 5DPTA 4JE3B 2KFKB 3KH0A 5BO4B 1FNUA 2ASQA 3P4QB 4RF0A 1F2RC 2ZEQA 1TTNA 2G4DB 4N6EB 1WXVA 4M01A 2JU6X 3ZYYX 3ONSA 3BWUD 3DVNU 1WMHB 2INDC 3ZIMA 5AUIA 4UDUC 5CX3A 2NS5A 3VRAB 3Q8FA 3R3MA 4PYUA 4DDGD 2G45B 1CQVA 4GDKA 1X1MA 2LUMA 1T3QA 1N5WA 1N5XA 2JXTA 5BYRA 2K9XA 3Q69A 2KACA 2AQ1B 2QC8A 1R7SA 1FFVA 2IO0B 1JWMD 3FILB 3ZJUA 1E8ZA 1VRAB 4WQMA 2PEAA 3WCQA 4B0MA 3TEXA 2IO1B 2PE9A 2BVCA 2JXXA 1GNUA 4RGTA 1Q0WB 1FCCC 1L4ZB 3B0AA 2FAZA 4WIPA 2L00B 3PT2B 2N9KA 5EE1A 4IWOA 2KAJA 4WWMA 1SE2A 2JRHA 2N7EA 4RF1A 1DOXA 2PPHA 1UH6A 3NZSA 4RH6A 1EWCA 1NBFC 3MC0B 1V8CA 3W9CB 3U30A 4J3OD 4P16A 4BKSD 5DPWA 5EE9A 2TSSA 4XWTA 2M19A 3OG5A 2K3UA 5C1ZA 2LGSA 1FPYA 3AI5A 1KM7A 3AU4A 1WZ0A 3Q3NC 2KOXA 2Y5BB 4AJWA 3PZDA 4ARIA 3VUWA 1T6BX 2QIEB 1Z2MA 5E6NA 2Q5WD 4LNOA 1HE8A 3QIJA 4A6QA 3DQVA 2KT7A 3Q3JA 1GUAB 3SFDB 2CU1A 1F9JA 4E74A 4HDOA 4BZAA 1KOTA 2D3CA 3HM6X 3RNFC 3AMZA 3EA6A 2DZJA 3RT3B 1E8YA 4WJPA 5E6OA 4IM0A 4M02A 3QCAA 1H8CA 3APFA 4EOYA 4C7YA 1UD7A 4PYZA 2NBWB 3A4RA 1KTKA 3OJ4B 2MBHA 3TSSA 2KNBA 1JWBD 1ZP0B 2CHZA 3MC8A 3EUB2 3CMMB 1I35A 4HWIB 2BTEA 4WWNA 2D10A 1J7CA 5L83A 4R3DA 1P0RA 2IGHA 2OJWA 2ZNVC 1YOVB 4K1RB 3FILA 3NY5A 4YSYB 3ZO5B 2IO3B 3K9PB 1XEEA 3U52E 4YTMB 1XQQA 5BMHA 2FNJB 1WRIA 1C9FA 5LNK1 3AEGB 4YTPB 4HDQA 4JWSC 4KZ0A 3MC9A 1PGAA 1FXIA 4NJ7A 1JCKB 1FXAA 1E8XA 2PMVA 2WX0A 1L5PA 1P98A 2MBQA 2DENB 2K6QA 3L17A 2BYTA 1YN5A 2WXNA 2GBNA 1H4RA 4LDTD 4OW0A 4Q2JA 2QMTA 3VH4B 3LXFA 5C23A 5FKAC 1KLGD 2Z0DB 1V81A 3NHEB 5HHDG 3R8BA 2KFKA 4A20A 1OGWA 5C3JB 1WGKA 4KDLB 1DYQA 4N59A 2VZKB 5FK9C 2WXRA 4IW0A 4AJYB 1YIWA 3WAOA 2IGGA 3MJWA 1RFAA 2HTHA 3HIZA 1SB3C 2KK8A 1XD3B 2V3NA 4ZRJA 4W9IA 3TEYA 2N1VA 4YSZB 1ZGUB 4F1SA 2E6XA 2KWVB 3ZXVA 4MGIE 1FFUA 4LLGM 3AB5A 5J2RA 3Q3MC 2WXOA 1KH0A 1TS5A 2MP2B 3WIMA 1B9RA 5D94A 4GDLA 3FKYA 4NAWB 4WJQA 4US9A 1PDXA 3RNCC 2IYDB 2UU7A 1WH3A 4TQ1A 3NZ3A 4I6PA 3GE3C 2KN4A 1GJZA 2D3AA 1WRDB 1CK1A 2SAKA 1I4XA 1D5MC 1RM6C 2NTSA 2KYWA 3MP9A 2KTFA 2NBVB 2MHJA 1GB1A 2XK5B 3GZNI 2FE8A 3FAHA 4RNAA 1ZDXA 2BS2B 1P7EA 3EFCA 5IN7A 2KJRA 3KQ4A 1IBXB 3MHSD 3A9JB 3A1QB 5BMGA 1L6VA 3AE4B 3AEEB 1YJJA 3QARA 4A3OA 4P1BC 1HZ5A 2O2VA 2KJHB 3ZUNA 1JWSD 3DVNV 1OEYJ 1JALA 5G55A 2G3QB 3TL5A 3T8MA 1TS2A 3UIPB 4RM9A 4KGTA 1WR1A 4GDKB 4BFRA 1M4VA 2ONQA 4G50A 1MG4A 2J7QB 1V2YA 2DNFA 3T9LA 5IKCM 5H8YE 2KC1A 2HDEA 4NPNA 4EKUA 1GC6A 3WAMA 1BUIC 2QCZA 2FBWB 3NZUA 3N20C 4GXBA 4LJOB 5C2TB 3W1SC 1E9MA 3JSVB 2ZPNA 4MACA 1TBEA 3N9YC 1FEHA 2KLGA 1ZPSA 1DGJA 3PV1A 5CTRC 2ICIA 4GLSC 2ZCBA 1EU4A 4DWFA 2LZ6A 4GMVA 2MW5A 4WQOB 2BGFA 3S2AA 1K52A 1C3TA 1WY8A 3TCAA 1C79A 1S3SG 1NVID 1QZEA 1AARA 2MX2A 3ALBA 2J4XA 3V05A 3DOWA 2NVUI 4WWOA 1WE7A 3ZNHB 3R7QA 2PJHA 3MFGA 1V1PA 2LHEA 2WP9B 4OZCA 2QSDA 4MGYE 4FA6A 1UF0A 1YJIA 3RCZA 4ZYSA 2DBYA 2LEKA 2W82A 5BMIA 2IGDA 1SGHA 1L7YA 1RWSA 1F2RI 3P63A 2WGSA 4A8XC 2WXKA 1UZXB 2K8BA 2K8CA 4RGOS 4HKQA 3IVFA 2C7MB 2KDBA 1IBXA 2BBCA 1ZXHA 2HD5B 3BK1A 4LCDE 2M8SA 1QOGA 2DAJA 3VQIA 1ESFA 3AE9B 3WAPA 2WX1A 4HCNB 2RDHA 5LLIA 1XF5L 2NPTA 2L52A 2PE6B 2XK5A 1I4HA 3GZNB 3PS6A 1C4AA 2IY0B 4IWPA 2DYBA 4I6NB 2MBOA 4NY0A 2KWCA 3B2FA 2K0PA 2LGDA 4N58A 4MJSA 3RNEC 1WGDA 2J42A 4MM3B 1UBIA 1XCQL 2FCQA 1C77A 2WXHA 5HFYA 3EC8A 3EECA 3DCGA 1IGDA 5CHFA 2K8HA 1LXDA 4TKNA 4S0RA 3FC4A 1PQSA 1K51A 3NVVA 5IP4D 4WJNA 2L83A 3P4RB 1JRPA 1QQRA 3ZVVA 3ZTDA 3M95A 4OVZA 1RAXA 3AH7A 2W3RA 3VUXA 1L6UA 1E90A 2YLMA 4DXFA 2JSVX 3EGRA 4IWQA 4A9AA 2DAFA 4J6IA 1WR6E 4KKJA 1V97A 4LNKA 3DBHI 2OHFA 2BB6A 4HEA1 3BVZA 1FMAD 3SR6A 2N7DA 4CQNA 4MGKE 2WXJA 2FUHB 2BWFA 1FM0D 4W9GA 3PREA 2J0JA 5D6JB 3RULA 4ZOHC 4BVUC 2LD9A 3Q8AA 2BW2A 1UNSA 3IXSA 4GU2A 3JSVA 4NAMA 3UGBB 1D4BA 4DHZB 3AV8A 3IBEA 3MTNB 2B3AA 1J0GA 2DZMA 3AE1B 3DWGC 1WJ4A 3AE3B 4TSSA 3AEFB 3IT4B 4P1CC 1QF6A 4ANVA 2KKCA
chains in the Genus database with same CATH topology
1WXAA 2GBRA 2IBIB 2LWPA 1WI0A 3DQVA 4JIOU 3Q3JA 1J19A 1GUAB 3RD2A 4OVVA 2CU1A 5D7GA 1F9JA 3A9JA 3VDZA 4A3PA 4E74A 4HDOA 1KOTA 2GMIC 2HE7A 4FN2A 2KDEB 2C9WB 3L10B 3OLMD 3HM6X 4GN1A 2ZZPB 2ZVOA 3CSTA 4KZCA 4WJOA 2DZJA 3RT3B 1E8YA 4WJPA 3DPDA 5E6PA 5E6OA 2CHWA 2UYZB 3LJ3A 4IM0A 1NI2A 3QCAA 1E7UA 2CS4A 4ZDVA 4ZYNA 1H8CA 3V60A 3APFA 5DPSA 1P9DU 1S1QB 4EOYA 1UD7A 4PYZA 2NBWB 3A4RA 3A4SC 2JUOA 2R2QA 1V5TA 2L7RA 3OJ4B 4W9KA 4BOSC 2MBHA 1WFYA 2MQJA 3DBLI 1OQYA 4AP4C 2KNBA 2WWZA 4XC2A 2CHZA 3H6NA 3GOEA 4MM3A 2YVCA 2NBUA 3CMMB 1JRUA 4K7UA 2JVCA 4GDLB 1I35A 4TQ0A 3BY4B 2DYMA 4HWIB 5IAAC 2N9PC 2FCMA 4WWNA 3V6CB 2AEHA 3OAWA 2D10A 5L83A 3ENEA 3EFUA 2CR5A 1P0RA 2ZNVC 4NNJB 4K1RB 1J8CA 2ZVNA 3NY5A 2KD0A 4B95A 2Z0EB 4EFOA 2BPSA 3VFKA 5KHOA 3KUDB 3ZO5B 5DPRA 2IO3B 2V3SA 2ZNVB 3K9PB 4W9FA 3VAWA 2KFJA 1V86A 3VVWB 1XQQA 2FNJB 1EO6A 2C60A 2JY6A 4HDQA 2KO3A 2LXAA 1TGZB 4KZ0A 2MLBA 5JZEB 4MJSB 2G4SA 4W9LA 3DVGX 3UINB 1SE9A 4E71A 4NJ7A 3ML9A 4GB9A 2WX0A 1E8XA 4M8NA 2NR2A 2LGYA 4PS8A 2L8JA 4ANWA 1ISNA 5IA7A 1P98A 2MBQA 3WALA 1UELA 2DENB 4JQWC 2LGXA 2K6QA 3L17A 1WX7A 4HCPB 5AZFA 4GIVA 2GBNA 1H4RA 2EMTA 4LDTD 1IP9A 3H7PA 3EHVA 2AL6A 3APCA 4K7SA 5J17A 4HJKA 3ZKJC 3I3TB 3ECIA 2VRRB 2V1YA 2RPQA 3VH4B 3ZNID 1U4AA 3L54A 5C23A 2Z0DB 1V81A 3NHEB 4FULA 4A20A 2KFKA 1OGWA 3VUYA 2J0KA 4KDLB 2D2QA 3PRMB 4BBNC 2JPHA 2L0FA 1WXSA 2OOBB 2GBMA 3H1UA 2LXCA 4IW0A 4NJ6A 3L16A 2MBEA 1NDDA 4PS7A 1SIFA 4AJYB 2DZIA 2M1MA 3QHTA 1YIWA 3WAOA 4IM2A 3JVZX 3MJWA 1RFAA 2HTHA 4JL9A 3DDCB 2N1WA 4BOZB 3HIZA 2O2VB 1Z5SB 1WF9A 1Y8RC 2J0MA 4XZ4A 2KK8A 1XD3B 4W9EA 2ZJDA 3KUZA 4W9IA 4ZRJA 1WZ3A 2N1VA 1UBQA 2LVPA 2WDTB 2JWZA 3KVFB 3WANA 1L2NA 1ZGUB 4F1SA 2KWVB 4MGIE 2M4NA 1ZW7A 1GG3A 1WM2A 2LASA 4NQLB 3HHMA 4EZJA 5J2RA 4IG7B 2ZCCA 2N9XA 2FIFA 2KQ7A 2OJRA 3A1QA 3ZLZA 2MP2B 3WIMA 1A5RA 5D94A 4GDLA 4NAWB 4WJQA 3UF8A 4BKGA 1V80A 2LJ5A 2IYDB 3PRPB 3QC8B 1V9JA 1WH3A 4TQ1A 4I6PA 5G2NA 4DHJB 1GJZA 2BKRB 2WYQA 3V6EB 4FJVB 4II2B 1WRDB 1WYWB 2I1KA 4N9F4 2HJ8A 3SDLC 1Q5WB 2O6VD 2KTFA 2O6VB 2NBVB 2D07B 4URKA 4W9HA 4DK5A 3W1YA 2LVOA 2XK5B 3GZNI 3D32A 3KW5B 1Q1OA 2V4LA 3PLVA 3KYDD 4EUTA 1I42A 4BKTA 3A33B 4DDID 2KJRA 3CF6E 3IHPC 4FJYA 4ZRIA 4OVUA 4M0WB 3QWZB 2L3ZA 2MP2A 3A9JB 3MHSD 3A1QB 5EDSA 1WJUA 2D3GA 4HXDA 1FXTB 3UIOB 4ASWC 1WJ6A 3ZTCA 4EZKA 2MBBB 2GBKA 3V62A 2Z59B 2MA9B 3L08A 3KUCB 2KN5A 3L13A 3QARA 2W9NA 4W9DA 4A3OA 2JZ3B 1WM3A 2O2VA 4EZLA 2KJHB 4MDKE 4TUUA 3ZUNA 1P3QU 4NQKE 1V49A 1WXMA 2N9EB 3DVNV 2IZVB 3JW0X 4LJPB 1WIAA 3A9KA 3CSFA 2KTRB 4MSMB 3DBSA 1OEYJ 1YD8U 4MELA 5G55A 1YX5B 5HKHA 2I1JA 4TV3A 2L0TA 2G3QB 2K39A 2KQSA 3K9OB 3TL5A 4ICVA 3T8MA 2DX5B 4FJZA 1RRBA 1TZ1A 2NCNA 3KYCD 3UIPB 3VTVA 1BT0A 2LRUA 3M3JA 4RM9A 4ZRKA 5JHAA 1WR1A 4GDKB 4P7IA 4BFRA 1YX6B 3R66C 4G50A 2DZKA 2J7QB 1V2YA 4FLHA 4IUMB 1EF5A 3T9LA 2KC1A 1OEYA 3B08A 3PLUA 4NPNA 4EKUA 1GC6A 2MSED 3JYUA 1WJNA 3H7PB 3WAMA 4WAAA 1IYFA 4CHKA 4KVGB 4DHZE 3ZNGC 4LDTB 2BKFA 5AEKB 4G0NB 3NZUA 4GXBA 4LJOB 1MG8A 4KV2A 3SU8X 3W1SC 4F7ZA 2KDIA 3O65B 3TBLD 1VD2A 3JSVB 1ZKHA 4FHKA 2N4FA 4HLEA 2ZPNA 4FBJB 1EUVB 3QJZA 4ICUA 3V61A 3AULA 2A5UA 2L76A 2K1FA 4AOFA 2GOWA 1G6JA 4JLCA 4M8MA 3QA8A 1E7VA 1TBEA 2QHOA 2REXA 3DBRI 5TR5A 2EMSA 2KJ6A 4KIKB 3PVLA 2AWTA 3TJPA 2KLGA 4X57B 2KANA 5CTRC 3PV1A 1E8WA 4II3B 2KC2A 3M62B 3H9DA 3N30A 3VTWA 2UWQA 2ZCBA 3NS8A 3ML8A 2IY1B 2M0XA 3VXWA 2LZ6A 2CKHB 4DWFA 4GMVA 3UQBA 2MW5A 5FR6A 4WQOB 2IO2B 3BINA 3QAQA 2BGFA 4I6LB 2LI5A 3S2AA 5KHQA 1LFDA 1C3TA 3W1SA 1R4MI 1WY8A 3TCAA 2R2OA 3PRZA 4XX5A 1S3SG 2KHWB 3PPAA 1R4NI 2FCNA 1QZEA 2AL3A 1AARA 2MX2A 3RYTA 3ALBA 4K7WA 3AU5A 4NAWA 4F8CB 4MGZE 2RR9A 2BYVE 3DOWA 3AXCA 2NVUI 3SD5A 1T0YA 4WWOA 5LXIB 2BYEA 1WE7A 4WWPA 1WGGA 3ZNHB 2LVQA 2PJHA 3R7QA 3RUIB 2FIDA 3ZDMC 2L05A 3L0WB 2C7HA 1WGYA 2BWES 4CO7A 2RSUA 1CMXB 4MGYE 3ZRCA 4FA6A 4RMAA 2D11A 3RCZA 4ANUA 4HK2A 2C5LC 1K8RB 3QX1A 4GOCA 5LXHA 3PHWB 3OJ3A 5J18A 3PHXB 1GC7A 3ZDTA 1SGHA 1LM8B 1L7YA 3TMPB 2KZRA 5GMVA 2KXJA 1D3ZA 3APDA 2JF5A 3RZFA 4DHJD 1UZXB 2K8BA 2K8CA 5D2MB 3B1LX 2RD0A 2XBBC 4YL8A 3QK0A 3IVFA 2C7MB 4W9JA 2KDBA 3HK0A 3WA0A 2HD5B 4LCDE 5DPTA 2M8SA 4BKSA 2DAJA 4KIKA 3VQIA 2KFKB 3KH0A 1YQBA 3PTFC 5BO4B 2WX1A 4HCNB 3WAPA 5LLIA 4DXAB 2ASQA 3IFWB 2KLCA 1P1AA 4HPLB 2NPTA 4JGHB 2PE6B 2XK5A 4B9KA 3U8ZA 2ZEQA 1EF1A 1TTNA 3N32A 2G4DB 2KWUB 3PS6A 1WXVA 2IY0B 4IWPA 1WMHA 4DBGA 5AZGA 3SHQA 1M94A 2DYBA 1YJ1A 4I6NB 3ONSA 4AWJA 4W9CA 3M63B 2MCNB 2MBOA 4KSKC 3DVNU 3NOBA 2KWCA 1WMHB 4NY0A 4IM3A 2JZZA 3ZIMA 2EKEC 1VCBA 4E3CA 5CX3A 2NS5A 2LGDA 1XT9B 3R3MA 4PYUA 4DDGD 2JRIB 4MJSA 5JH5C 2G45B 4BBNF 4GDKA 1WGDA 4KSLC 3HM3A 1X1MA 4PS3A 1UBIA 3UQAA 2FCQA 3PGEA 4AUQC 2K25A 2BF8B 3EC8A 3EECA 1KJTA 3DCGA 1WE6A 2C7NB 3Q3FA 2XEWA 5DCNA 2DHZA 2KTRA 1WGHA 2LUEA 2IO0B 3VH3B 5CHFA 2K8HA 1LXDA 3X23A 3ZRFA 4TKNA 1PQSA 4HPMB 4MEMA 4WJNA 1E8ZA 4HVBA 4K81A 2PEAA 3ZVVA 3ZTDA 3ZW3A 3M95A 2IO1B 2KX3A 2PE9A 1LQBA 3PSEB 5JHBA 4FHJA 4EEWA 1RAXA 2JXXA 3VUXA 4FADA 1E90A 4B6WA 1GNUA 4G11A 1Q0WB 2YLMA 3ZNZB 2LRWA 3RZWC 1E5WA 1RLFA 3B0AA 3C0RB 4IWQA 3VTUA 2FAZA 3X0WA 5L95C 2DAFA 2L00B 3PT2B 5AZHA 4ANXA 2RGFA 3R7RA 4J6IA 1WR6E 1C1YB 2JT4B 2K6DB 4MSQB 2BYFA 4IWOA 3DBHI 3LDZE 2JRHA 4IC7B 2N7EA 2O6VA 2A4ZA 3IG3A 3P2BA 3VHTC 4GSWA 2N7DA 2PPHA 5CHWA 4MGKE 3H7SA 1UH6A 2GBJA 3NZSA 1KLVA 2FUHB 4RM8A 2BWFA 2M17A 1NBFC 3PREA 4W9GA 3QQ8B 1UGMA 1V5OA 3U30A 2J0JA 2KMAA 5D6JB 4BKSD 5DPWA 3RULA 4BVUC 2ZPYA 2LD9A 4KDIC 2KX0A 4G3XB 3DVGY 5C1ZA 4GU2A 3AI5A 4MH0E 3JSVA 2AYOB 1IPGA 1KM7A 3UGBB 1OTRB 5CHVC 4DHZB 2KDFB 3A9KB 2DYOA 1WX8A 3AU4A 1WZ0A 2KOXA 2Y5BB 3TIXA 1WGRA 3IBEA 3MTNB 4AJWA 2B3AA 1V6EA 3PZDA 4CYEA 1J0GA 2DZMA 3VUWA 3N3KB 1WJ4A 2KMCA 2MWSB 1WX9A 1Z2MA 5E6NA 2NPTB 4GGQA 2KVRA 2FCSA 1HE8A 2MRPA 3QIJA 3U7DA 4ANVA 2KKCA 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXA A;  2GBR A;  2IBI B;  2LWP A;  1WI0 A;  3DQV A;  4JIO U;  3Q3J A;  1J19 A;  1GUA B;  3RD2 A;  4OVV A;  2CU1 A;  5D7G A;  1F9J A;  3A9J A;  3VDZ A;  4A3P A;  4E74 A;  4HDO A;  1KOT A;  2GMI C;  2HE7 A;  4FN2 A;  2KDE B;  2C9W B;  3L10 B;  3OLM D;  3HM6 X;  4GN1 A;  2ZZP B;  2ZVO A;  3CST A;  4KZC A;  4WJO A;  2DZJ A;  3RT3 B;  1E8Y A;  4WJP A;  3DPD A;  5E6P A;  5E6O A;  2CHW A;  2UYZ B;  3LJ3 A;  4IM0 A;  1NI2 A;  3QCA A;  1E7U A;  2CS4 A;  4ZDV A;  4ZYN A;  1H8C A;  3V60 A;  3APF A;  5DPS A;  1P9D U;  1S1Q B;  4EOY A;  1UD7 A;  4PYZ A;  2NBW B;  3A4R A;  3A4S C;  2JUO A;  2R2Q A;  1V5T A;  2L7R A;  3OJ4 B;  4W9K A;  4BOS C;  2MBH A;  1WFY A;  2MQJ A;  3DBL I;  1OQY A;  4AP4 C;  2KNB A;  2WWZ A;  4XC2 A;  2CHZ A;  3H6N A;  3GOE A;  4MM3 A;  2YVC A;  2NBU A;  3CMM B;  1JRU A;  4K7U A;  2JVC A;  4GDL B;  1I35 A;  4TQ0 A;  3BY4 B;  2DYM A;  4HWI B;  5IAA C;  2N9P C;  2FCM A;  4WWN A;  3V6C B;  2AEH A;  3OAW A;  2D10 A;  5L83 A;  3ENE A;  3EFU A;  2CR5 A;  1P0R A;  2ZNV C;  4NNJ B;  4K1R B;  1J8C A;  2ZVN A;  3NY5 A;  2KD0 A;  4B95 A;  2Z0E B;  4EFO A;  2BPS A;  3VFK A;  5KHO A;  3KUD B;  3ZO5 B;  5DPR A;  2IO3 B;  2V3S A;  2ZNV B;  3K9P B;  4W9F A;  3VAW A;  2KFJ A;  1V86 A;  3VVW B;  1XQQ A;  2FNJ B;  1EO6 A;  2C60 A;  2JY6 A;  4HDQ A;  2KO3 A;  2LXA A;  1TGZ B;  4KZ0 A;  2MLB A;  5JZE B;  4MJS B;  2G4S A;  4W9L A;  3DVG X;  3UIN B;  1SE9 A;  4E71 A;  4NJ7 A;  3ML9 A;  4GB9 A;  2WX0 A;  1E8X A;  4M8N A;  2NR2 A;  2LGY A;  4PS8 A;  2L8J A;  4ANW A;  1ISN A;  5IA7 A;  1P98 A;  2MBQ A;  3WAL A;  1UEL A;  2DEN B;  4JQW C;  2LGX A;  2K6Q A;  3L17 A;  1WX7 A;  4HCP B;  5AZF A;  4GIV A;  2GBN A;  1H4R A;  2EMT A;  4LDT D;  1IP9 A;  3H7P A;  3EHV A;  2AL6 A;  3APC A;  4K7S A;  5J17 A;  4HJK A;  3ZKJ C;  3I3T B;  3ECI A;  2VRR B;  2V1Y A;  2RPQ A;  3VH4 B;  3ZNI D;  1U4A A;  3L54 A;  5C23 A;  2Z0D B;  1V81 A;  3NHE B;  4FUL A;  4A20 A;  2KFK A;  1OGW A;  3VUY A;  2J0K A;  4KDL B;  2D2Q A;  3PRM B;  4BBN C;  2JPH A;  2L0F A;  1WXS A;  2OOB B;  2GBM A;  3H1U A;  2LXC A;  4IW0 A;  4NJ6 A;  3L16 A;  2MBE A;  1NDD A;  4PS7 A;  1SIF A;  4AJY B;  2DZI A;  2M1M A;  3QHT A;  1YIW A;  3WAO A;  4IM2 A;  3JVZ X;  3MJW A;  1RFA A;  2HTH A;  4JL9 A;  3DDC B;  2N1W A;  4BOZ B;  3HIZ A;  2O2V B;  1Z5S B;  1WF9 A;  1Y8R C;  2J0M A;  4XZ4 A;  2KK8 A;  1XD3 B;  4W9E A;  2ZJD A;  3KUZ A;  4W9I A;  4ZRJ A;  1WZ3 A;  2N1V A;  1UBQ A;  2LVP A;  2WDT B;  2JWZ A;  3KVF B;  3WAN A;  1L2N A;  1ZGU B;  4F1S A;  2KWV B;  4MGI E;  2M4N A;  1ZW7 A;  1GG3 A;  1WM2 A;  2LAS A;  4NQL B;  3HHM A;  4EZJ A;  5J2R A;  4IG7 B;  2ZCC A;  2N9X A;  2FIF A;  2KQ7 A;  2OJR A;  3A1Q A;  3ZLZ A;  2MP2 B;  3WIM A;  1A5R A;  5D94 A;  4GDL A;  4NAW B;  4WJQ A;  3UF8 A;  4BKG A;  1V80 A;  2LJ5 A;  2IYD B;  3PRP B;  3QC8 B;  1V9J A;  1WH3 A;  4TQ1 A;  4I6P A;  5G2N A;  4DHJ B;  1GJZ A;  2BKR B;  2WYQ A;  3V6E B;  4FJV B;  4II2 B;  1WRD B;  1WYW B;  2I1K A;  4N9F 4;  2HJ8 A;  3SDL C;  1Q5W B;  2O6V D;  2KTF A;  2O6V B;  2NBV B;  2D07 B;  4URK A;  4W9H A;  4DK5 A;  3W1Y A;  2LVO A;  2XK5 B;  3GZN I;  3D32 A;  3KW5 B;  1Q1O A;  2V4L A;  3PLV A;  3KYD D;  4EUT A;  1I42 A;  4BKT A;  3A33 B;  4DDI D;  2KJR A;  3CF6 E;  3IHP C;  4FJY A;  4ZRI A;  4OVU A;  4M0W B;  3QWZ B;  2L3Z A;  2MP2 A;  3A9J B;  3MHS D;  3A1Q B;  5EDS A;  1WJU A;  2D3G A;  4HXD A;  1FXT B;  3UIO B;  4ASW C;  1WJ6 A;  3ZTC A;  4EZK A;  2MBB B;  2GBK A;  3V62 A;  2Z59 B;  2MA9 B;  3L08 A;  3KUC B;  2KN5 A;  3L13 A;  3QAR A;  2W9N A;  4W9D A;  4A3O A;  2JZ3 B;  1WM3 A;  2O2V A;  4EZL A;  2KJH B;  4MDK E;  4TUU A;  3ZUN A;  1P3Q U;  4NQK E;  1V49 A;  1WXM A;  2N9E B;  3DVN V;  2IZV B;  3JW0 X;  4LJP B;  1WIA A;  3A9K A;  3CSF A;  2KTR B;  4MSM B;  3DBS A;  1OEY J;  1YD8 U;  4MEL A;  5G55 A;  1YX5 B;  5HKH A;  2I1J A;  4TV3 A;  2L0T A;  2G3Q B;  2K39 A;  2KQS A;  3K9O B;  3TL5 A;  4ICV A;  3T8M A;  2DX5 B;  4FJZ A;  1RRB A;  1TZ1 A;  2NCN A;  3KYC D;  3UIP B;  3VTV A;  1BT0 A;  2LRU A;  3M3J A;  4RM9 A;  4ZRK A;  5JHA A;  1WR1 A;  4GDK B;  4P7I A;  4BFR A;  1YX6 B;  3R66 C;  4G50 A;  2DZK A;  2J7Q B;  1V2Y A;  4FLH A;  4IUM B;  1EF5 A;  3T9L A;  2KC1 A;  1OEY A;  3B08 A;  3PLU A;  4NPN A;  4EKU A;  1GC6 A;  2MSE D;  3JYU A;  1WJN A;  3H7P B;  3WAM A;  4WAA A;  1IYF A;  4CHK A;  4KVG B;  4DHZ E;  3ZNG C;  4LDT B;  2BKF A;  5AEK B;  4G0N B;  3NZU A;  4GXB A;  4LJO B;  1MG8 A;  4KV2 A;  3SU8 X;  3W1S C;  4F7Z A;  2KDI A;  3O65 B;  3TBL D;  1VD2 A;  3JSV B;  1ZKH A;  4FHK A;  2N4F A;  4HLE A;  2ZPN A;  4FBJ B;  1EUV B;  3QJZ A;  4ICU A;  3V61 A;  3AUL A;  2A5U A;  2L76 A;  2K1F A;  4AOF A;  2GOW A;  1G6J A;  4JLC A;  4M8M A;  3QA8 A;  1E7V A;  1TBE A;  2QHO A;  2REX A;  3DBR I;  5TR5 A;  2EMS A;  2KJ6 A;  4KIK B;  3PVL A;  2AWT A;  3TJP A;  2KLG A;  4X57 B;  2KAN A;  5CTR C;  3PV1 A;  1E8W A;  4II3 B;  2KC2 A;  3M62 B;  3H9D A;  3N30 A;  3VTW A;  2UWQ A;  2ZCB A;  3NS8 A;  3ML8 A;  2IY1 B;  2M0X A;  3VXW A;  2LZ6 A;  2CKH B;  4DWF A;  4GMV A;  3UQB A;  2MW5 A;  5FR6 A;  4WQO B;  2IO2 B;  3BIN A;  3QAQ A;  2BGF A;  4I6L B;  2LI5 A;  3S2A A;  5KHQ A;  1LFD A;  1C3T A;  3W1S A;  1R4M I;  1WY8 A;  3TCA A;  2R2O A;  3PRZ A;  4XX5 A;  1S3S G;  2KHW B;  3PPA A;  1R4N I;  2FCN A;  1QZE A;  2AL3 A;  1AAR A;  2MX2 A;  3RYT A;  3ALB A;  4K7W A;  3AU5 A;  4NAW A;  4F8C B;  4MGZ E;  2RR9 A;  2BYV E;  3DOW A;  3AXC A;  2NVU I;  3SD5 A;  1T0Y A;  4WWO A;  5LXI B;  2BYE A;  1WE7 A;  4WWP A;  1WGG A;  3ZNH B;  2LVQ A;  2PJH A;  3R7Q A;  3RUI B;  2FID A;  3ZDM C;  2L05 A;  3L0W B;  2C7H A;  1WGY A;  2BWE S;  4CO7 A;  2RSU A;  1CMX B;  4MGY E;  3ZRC A;  4FA6 A;  4RMA A;  2D11 A;  3RCZ A;  4ANU A;  4HK2 A;  2C5L C;  1K8R B;  3QX1 A;  4GOC A;  5LXH A;  3PHW B;  3OJ3 A;  5J18 A;  3PHX B;  1GC7 A;  3ZDT A;  1SGH A;  1LM8 B;  1L7Y A;  3TMP B;  2KZR A;  5GMV A;  2KXJ A;  1D3Z A;  3APD A;  2JF5 A;  3RZF A;  4DHJ D;  1UZX B;  2K8B A;  2K8C A;  5D2M B;  3B1L X;  2RD0 A;  2XBB C;  4YL8 A;  3QK0 A;  3IVF A;  2C7M B;  4W9J A;  2KDB A;  3HK0 A;  3WA0 A;  2HD5 B;  4LCD E;  5DPT A;  2M8S A;  4BKS A;  2DAJ A;  4KIK A;  3VQI A;  2KFK B;  3KH0 A;  1YQB A;  3PTF C;  5BO4 B;  2WX1 A;  4HCN B;  3WAP A;  5LLI A;  4DXA B;  2ASQ A;  3IFW B;  2KLC A;  1P1A A;  4HPL B;  2NPT A;  4JGH B;  2PE6 B;  2XK5 A;  4B9K A;  3U8Z A;  2ZEQ A;  1EF1 A;  1TTN A;  3N32 A;  2G4D B;  2KWU B;  3PS6 A;  1WXV A;  2IY0 B;  4IWP A;  1WMH A;  4DBG A;  5AZG A;  3SHQ A;  1M94 A;  2DYB A;  1YJ1 A;  4I6N B;  3ONS A;  4AWJ A;  4W9C A;  3M63 B;  2MCN B;  2MBO A;  4KSK C;  3DVN U;  3NOB A;  2KWC A;  1WMH B;  4NY0 A;  4IM3 A;  2JZZ A;  3ZIM A;  2EKE C;  1VCB A;  4E3C A;  5CX3 A;  2NS5 A;  2LGD A;  1XT9 B;  3R3M A;  4PYU A;  4DDG D;  2JRI B;  4MJS A;  5JH5 C;  2G45 B;  4BBN F;  4GDK A;  1WGD A;  4KSL C;  3HM3 A;  1X1M A;  4PS3 A;  1UBI A;  3UQA A;  2FCQ A;  3PGE A;  4AUQ C;  2K25 A;  2BF8 B;  3EC8 A;  3EEC A;  1KJT A;  3DCG A;  1WE6 A;  2C7N B;  3Q3F A;  2XEW A;  5DCN A;  2DHZ A;  2KTR A;  1WGH A;  2LUE A;  2IO0 B;  3VH3 B;  5CHF A;  2K8H A;  1LXD A;  3X23 A;  3ZRF A;  4TKN A;  1PQS A;  4HPM B;  4MEM A;  4WJN A;  1E8Z A;  4HVB A;  4K81 A;  2PEA A;  3ZVV A;  3ZTD A;  3ZW3 A;  3M95 A;  2IO1 B;  2KX3 A;  2PE9 A;  1LQB A;  3PSE B;  5JHB A;  4FHJ A;  4EEW A;  1RAX A;  2JXX A;  3VUX A;  4FAD A;  1E90 A;  4B6W A;  1GNU A;  4G11 A;  1Q0W B;  2YLM A;  3ZNZ B;  2LRW A;  3RZW C;  1E5W A;  1RLF A;  3B0A A;  3C0R B;  4IWQ A;  3VTU A;  2FAZ A;  3X0W A;  5L95 C;  2DAF A;  2L00 B;  3PT2 B;  5AZH A;  4ANX A;  2RGF A;  3R7R A;  4J6I A;  1WR6 E;  1C1Y B;  2JT4 B;  2K6D B;  4MSQ B;  2BYF A;  4IWO A;  3DBH I;  3LDZ E;  2JRH A;  4IC7 B;  2N7E A;  2O6V A;  2A4Z A;  3IG3 A;  3P2B A;  3VHT C;  4GSW A;  2N7D A;  2PPH A;  5CHW A;  4MGK E;  3H7S A;  1UH6 A;  2GBJ A;  3NZS A;  1KLV A;  2FUH B;  4RM8 A;  2BWF A;  2M17 A;  1NBF C;  3PRE A;  4W9G A;  3QQ8 B;  1UGM A;  1V5O A;  3U30 A;  2J0J A;  2KMA A;  5D6J B;  4BKS D;  5DPW A;  3RUL A;  4BVU C;  2ZPY A;  2LD9 A;  4KDI C;  2KX0 A;  4G3X B;  3DVG Y;  5C1Z A;  4GU2 A;  3AI5 A;  4MH0 E;  3JSV A;  2AYO B;  1IPG A;  1KM7 A;  3UGB B;  1OTR B;  5CHV C;  4DHZ B;  2KDF B;  3A9K B;  2DYO A;  1WX8 A;  3AU4 A;  1WZ0 A;  2KOX A;  2Y5B B;  3TIX A;  1WGR A;  3IBE A;  3MTN B;  4AJW A;  2B3A A;  1V6E A;  3PZD A;  4CYE A;  1J0G A;  2DZM A;  3VUW A;  3N3K B;  1WJ4 A;  2KMC A;  2MWS B;  1WX9 A;  1Z2M A;  5E6N A;  2NPT B;  4GGQ A;  2KVR A;  2FCS A;  1HE8 A;  2MRP A;  3QIJ A;  3U7D A;  4ANV A;  2KKC A;  2CHX A; 
#chains in the Genus database with same CATH topology
 2QDF A;  1WSP A;  2GBR A;  2LWP A;  1KRH A;  4JIO U;  3H8H A;  3RD2 A;  4OZA A;  1F52 A;  3A9J A;  3HVD A;  2HE7 A;  4FN2 A;  4GN1 A;  2C9W B;  3L10 B;  5EE3 A;  2ZVO A;  2GI9 A;  5G5G A;  3T3N A;  3DPD A;  3P4S B;  1E7U A;  2CS4 A;  3RPF C;  4ZYN A;  3V60 A;  1F0Z A;  4C80 A;  1NEK B;  2R2Q A;  4W9K A;  2AX5 A;  1WFY A;  2OED A;  2WWZ A;  1F1H A;  3GOE A;  3AE8 B;  2YVC A;  4K7U A;  4GDL B;  4L23 A;  2CJO A;  3BY4 B;  4TQ0 A;  2J52 A;  1IUE A;  2AEH A;  3OAW A;  3DBR B;  1TKE A;  4DQO C;  3EFU A;  2CR5 A;  3AE6 B;  4NNJ B;  1J8C A;  1L0V B;  4HRS A;  2CU3 A;  4B95 A;  3VFK A;  5KHO A;  4W9F A;  3VAW A;  1KFY B;  1TYG B;  1QOA A;  2C60 A;  4LNN A;  4C00 A;  1EWY C;  1TGZ B;  2MLB A;  2G4S A;  4LTU A;  3DVG X;  2GB1 A;  4E71 A;  4GB9 A;  1E6E B;  2NR2 A;  2LGY A;  5IA7 A;  4A55 A;  2PLP A;  1WX7 A;  5AZF A;  2D3B A;  3H7P A;  1I7H A;  1IGC A;  3EHV A;  5J17 A;  3ZKJ C;  3I3T B;  3ECI A;  2RPQ A;  3ZNI D;  1QKZ A;  3L54 A;  5BYS A;  4FUL A;  3AEA B;  3ZGZ A;  2JPH A;  1WXS A;  3Q8E A;  4YTN B;  4NJ6 A;  1ZDV A;  1NDD A;  2DZI A;  2IPK D;  2HJ1 A;  3RNB C;  3NVW A;  4JL9 A;  4XYC A;  2N1W A;  1Z5S B;  1WF9 A;  3Q14 C;  3KVF B;  2WDT B;  3WAN A;  3DBH B;  3DHG C;  4IG7 B;  2IJ0 A;  2FIF A;  2OJR A;  3ZLZ A;  3RN9 C;  1Q10 A;  2X8X X;  4BKG A;  3PRP B;  1I4Q A;  2BKR B;  2DLB A;  4MT5 A;  1WYW B;  2MJ3 A;  2V9H A;  2WDV B;  3SFE B;  1WYG A;  2O6V D;  2Y5C A;  2D07 B;  3P42 A;  3W5V B;  5H92 C;  3KW5 B;  3D32 A;  2V4L A;  5HI1 A;  1PGX A;  3KYD D;  4EUT A;  2PTL A;  1TT5 B;  3IHP C;  4FJY A;  1XLP A;  4OVU A;  2L3Z A;  2I38 A;  3Q8C A;  3RI7 C;  2D3G A;  4HXD A;  1YN4 A;  1WJ6 A;  1TY0 A;  2BT6 A;  2MEK A;  2KN5 A;  1K50 A;  2BS4 B;  2W9N A;  2JZ3 B;  1HXY D;  2WXF A;  4NQK E;  1YNT E;  4OZB A;  2IZV B;  2KTR B;  3DBS A;  1YD8 U;  3CWI A;  3ABV B;  4K3C A;  4NZL B;  4TV3 A;  2KQS A;  3K9O B;  4O1N A;  2DX5 B;  4FJZ A;  1L0Y B;  1TZ1 A;  3VR8 B;  3VTV A;  3ZXR A;  3M3J A;  5JHA A;  4ZRK A;  3VR9 B;  4P7I A;  1FCL A;  2FUG 1;  1YQ3 B;  1QOF A;  4LK0 M;  3H7P B;  2WXM A;  4REZ A;  1UUP A;  4KVG B;  4WH4 A;  3C8Y A;  5AEK B;  2WHI A;  3BYT B;  4KV2 A;  4YT0 B;  3TBL D;  1VD2 A;  1JRO A;  4FHK A;  4ICU A;  3AUL A;  2A5U A;  2K1F A;  4JLC A;  4M8M A;  3QA8 A;  2REX A;  3NVY A;  2PVG C;  3PVL A;  1TKG A;  4HKZ E;  2UWQ A;  2M0X A;  3VXW A;  2CKH B;  1C78 A;  3UQB A;  2IO2 B;  5KHQ A;  3W1S A;  3I9V 1;  3HUI A;  1Y56 A;  4K7W A;  2XNA C;  3SD5 A;  1T0Y A;  3RMK C;  5LXI B;  2Y3A A;  4JPS A;  2J53 A;  1WGG A;  4HPP A;  4WWP A;  2LVQ A;  1PUT A;  2WXP A;  1WGY A;  3I5J C;  1XCT L;  4RMA A;  5AUK A;  4ANU A;  4ACF A;  3GP7 A;  4GOC A;  3J9C A;  3OJ3 A;  5J18 A;  2X38 A;  2KZR A;  1ZUD 2;  2KXJ A;  2H89 B;  3APD A;  2WDQ B;  3BVG A;  2EEL A;  2H88 B;  3RZF A;  4DHJ D;  5D2M B;  3AE5 B;  2XBB C;  4YL8 A;  1TS3 A;  2JWU A;  3NS1 A;  4BKS A;  4KIK A;  2Z8L A;  1YQB A;  2QIL A;  4DXA B;  4RCO A;  2KLC A;  5MPO A;  4HPL B;  2V3P A;  2KWU B;  5IO9 A;  3KWV A;  1WMH A;  2JYT A;  3R2T A;  4W9C A;  3M63 B;  3NOB A;  4LNF A;  2NMQ A;  1I4G A;  2JZZ A;  1E7P B;  1VCB A;  4HRO A;  3BK2 A;  1XT9 B;  3IAS 1;  4XWW A;  3MHZ A;  5IOI A;  2JRI B;  1OQQ A;  5JH5 C;  4D2K A;  1AYF A;  3AM9 A;  1N60 A;  3PGE A;  2K25 A;  4PK1 A;  1KJT A;  1JML A;  1WE6 A;  2C7N B;  1VDV A;  3PO0 A;  1WGH A;  3X23 A;  3ZRF A;  4HPM B;  4MEM A;  1DOY A;  4HVB A;  4K81 A;  1ROE A;  3ZW3 A;  1SF0 A;  2KX3 A;  3PSE B;  5JHB A;  4EEW A;  3OWE B;  2INC C;  1N6Z A;  4B6W A;  1WWT A;  4G11 A;  4JWU C;  3ZNZ B;  3RZW C;  1E5W A;  1RLF A;  1FO4 A;  3C0R B;  3VTU A;  3ZJT A;  5AZH A;  4ANX A;  3R7R A;  2KQ4 X;  2K6D B;  3LDZ E;  2K22 A;  4IC7 B;  2O6V A;  1EM7 A;  3VHT C;  5CHW A;  2GBJ A;  1CZP A;  1KLV A;  1C4P A;  4RM8 A;  3R2I A;  3NUH B;  2M17 A;  2MH7 A;  1HTO A;  3DBL B;  3QQ8 B;  1V5O A;  2KMA A;  2WXG A;  4KDI C;  1C4C A;  4LNI A;  3DVG Y;  5EE0 A;  1IPG A;  1MHX A;  1OTR B;  5CHV C;  3A9K B;  4ZHO A;  1WGR A;  1GOZ A;  1MI0 A;  2KMC A;  3DHI C;  3HRD D;  2NPT B;  3KLS X;  2KVR A;  3U7D A;  2DWQ A;  2CHX A;  1FNW A;  3GS2 A;  1J7B A;  1WXA A;  2IBI B;  1WI0 A;  3TUO A;  2ZW1 A;  1J19 A;  2ON8 A;  5D7G A;  2M56 B;  2V4I B;  1E10 A;  4ITK A;  2GRI A;  3OLM D;  2WXL A;  1SE3 A;  4KZC A;  4IOI E;  2HTM E;  1SXT A;  5E6P A;  1XXG A;  1N63 A;  1NI2 A;  3HVZ A;  1TZO A;  2BS3 B;  4IDI A;  4WUR A;  3DHH C;  3A4S C;  2JUO A;  1V5T A;  2L7R A;  2WXQ A;  3DBL I;  2MQJ A;  3Q8B A;  4AP4 C;  1MPE A;  1TY2 A;  2NBU A;  3BII D;  2DYM A;  1ZXI A;  3O13 A;  2VH2 A;  3V6C B;  1N61 A;  2KDM A;  4XE0 A;  3GB1 A;  2VH1 A;  2Z0E B;  4EFO A;  2BPS A;  1SE4 A;  2ZNV B;  2KFJ A;  1V86 A;  3VVW B;  3Q2A C;  2JY6 A;  2KO3 A;  2LXA A;  2WQY B;  4W9L A;  1WXQ A;  1SE9 A;  3B9J A;  3W2D A;  2L8J A;  3WAL A;  1UEL A;  4JQW C;  4HCP B;  3RNA C;  4GIV A;  1KF6 B;  2EMT A;  1IP9 A;  2VRR B;  2V1Y A;  1RFK A;  4HJG E;  1T0S C;  1VZ7 A;  3VUY A;  2J0K A;  2D2Q A;  4AQ7 A;  3PRM B;  2L0F A;  1QT9 A;  2KWD A;  1ZOY B;  2M1M A;  3AED B;  4IM2 A;  2W55 A;  4BOZ B;  2O2V B;  3AEC B;  4XZ4 A;  2ZJD A;  3KUZ A;  1WZ3 A;  2LVP A;  1L2N A;  1SSN A;  2M4N A;  4NQL B;  1ZW7 A;  1J7A A;  1GG3 A;  2LAS A;  3HHM A;  3V3X A;  2N9X A;  2KQ7 A;  5G5H A;  3A1Q A;  1A5R A;  3UF8 A;  1V80 A;  3I57 A;  1UWM A;  1V9J A;  2RPV A;  1OFF A;  2EKI A;  4MH8 A;  4M00 A;  2ZW0 A;  3KWL A;  4OHJ A;  2LFI A;  2HJ8 A;  1Q5W B;  2O6V B;  4URK A;  4W9H A;  4DK5 A;  3W1Y A;  2LVO A;  1L4D B;  4KGR A;  1R4M B;  3PLV A;  1FRD A;  3A33 B;  3CF6 E;  4ZRI A;  4M0W B;  2MP2 A;  1GB4 A;  5EDS A;  1WJU A;  1FXT B;  4ASW C;  2SEB D;  4YSX B;  4EZK A;  1DOI A;  3PZ8 A;  3V62 A;  2Z59 B;  2MA9 B;  2MJE A;  4W9D A;  1WM3 A;  1FD6 A;  4MDK E;  4TUU A;  2ACZ B;  1WXM A;  1SJH D;  1WIA A;  1V1O A;  3N1Z C;  1YX5 B;  2IDY A;  2LMC A;  2L0T A;  2WU2 B;  2K39 A;  1TJE A;  4ICV A;  5GXG B;  3B2G A;  2NCN A;  3KYC D;  1GPX A;  1D6E C;  1BT0 A;  2LRU A;  3GE8 C;  1YX6 B;  1JW9 D;  1ZE3 D;  1EF5 A;  2G9H D;  1OEY A;  1JQ4 A;  3B08 A;  3PLU A;  3JYU A;  1WJN A;  4WAA A;  1E0Z A;  2R61 A;  4DHZ E;  4F7Z A;  3SU8 X;  1MG8 A;  2W54 A;  5TSS A;  4ZHP A;  2GLS A;  2N4F A;  4HLE A;  4H2A A;  4WAF A;  1EUV B;  2L76 A;  2GOW A;  1BML C;  1E7V A;  1PFD A;  2QHO A;  3DBR I;  2EMS A;  1R4N B;  2KJ6 A;  4KIK B;  4EE2 A;  3Q6B A;  1E8W A;  1VR9 A;  3M62 B;  3H9D A;  3N30 A;  3T3O A;  1FNV A;  3NS8 A;  3ML8 A;  5FR6 A;  2N0S B;  3W5U B;  3QAQ A;  1JWA D;  4I6L B;  2LI5 A;  1LFD A;  1R4M I;  3ZQ4 A;  1UGJ A;  2JZP A;  3PRZ A;  1FIQ A;  2PW9 A;  1R4N I;  4RGM A;  2AL3 A;  3AU5 A;  4F8C B;  1QIL A;  4MGZ E;  4USA A;  2BYV E;  1T0Q C;  2INP E;  4BAX A;  1ACC A;  2BYE A;  4IKG A;  1SBB B;  3RUI B;  3L0W B;  1N62 A;  2WXI A;  4CO7 A;  2RSU A;  1D5X C;  3ZRC A;  2D11 A;  1P7F A;  4HK2 A;  1K8R B;  3QX1 A;  5LXH A;  1L0X B;  2QEJ C;  3N1Y C;  3PHW B;  1YQ4 B;  1I4R A;  3PHX B;  1GC7 A;  3AEB B;  3ZDT A;  1UWX A;  2JF5 A;  4XDC A;  2G1E A;  3QK0 A;  3NJT A;  1YMH E;  1SEB D;  3RNG C;  2BB5 A;  2M0A A;  2XN9 C;  1B1Z A;  3PTF C;  3IFW B;  1PGB A;  2PVO D;  1P1A A;  1F77 A;  4JGH B;  4B9K A;  3U8Z A;  1EF1 A;  3N32 A;  4DBG A;  5AZG A;  3SHQ A;  1M94 A;  1YJ1 A;  4AWJ A;  2MCN B;  4KSK C;  1ET9 A;  4IM3 A;  2EKE C;  4E3C A;  4KKI A;  1BXT A;  1FRR A;  4BBN F;  4KSL C;  3VRB B;  3BYY B;  3HM3 A;  4PS3 A;  3UQA A;  4QAY A;  1OQR A;  4AUQ C;  2BF8 B;  1VZ6 A;  1AWD A;  3Q3F A;  3BVM A;  2XEW A;  5DCN A;  2DHZ A;  2KTR A;  3VH3 B;  2LUE A;  2L32 A;  1EU3 A;  2LJI A;  1VZ8 A;  4KGS A;  5D3I B;  4K3B A;  4ZRP A;  1LQB A;  4FHJ A;  4FAD A;  4AS1 A;  1NEN B;  2LRW A;  3X0W A;  5L95 C;  1LO5 D;  2AQ2 B;  2RGF A;  1C1Y B;  2JT4 B;  4MSQ B;  2BYF A;  3IG3 A;  3P2B A;  2A4Z A;  2PIA A;  4GSW A;  1QOB A;  3MJ5 A;  5T8I A;  1XLQ A;  3H7S A;  1TS4 A;  3TEZ A;  2AQ3 B;  3LB8 C;  1I4P A;  3DWM A;  1ENF A;  1UGM A;  5I4D A;  2ZPY A;  2WLB A;  1SIJ A;  2CJN A;  4XGA B;  4DXG A;  2KX0 A;  4G3X B;  2D5G A;  1HTQ A;  1GAQ B;  2RDG A;  1RYJ A;  4MH0 E;  2BQQ A;  2AYO B;  2KDF B;  2DYO A;  1WX8 A;  3TIX A;  2Y5P A;  3RFZ B;  1V6E A;  4CYE A;  3N3K B;  2MWS B;  3NG0 A;  1WX9 A;  4GGQ A;  1MHH E;  3N1X C;  2FCS A;  2MRP A;  3TEW A;  2JX5 A;  2N9L A;  4OVV A;  3VDZ A;  4A3P A;  2GMI C;  2KDE B;  2WNM A;  3BZD B;  2ZZP B;  1MJD A;  3CST A;  4WJO A;  2W3S A;  2WDR B;  3NVZ A;  2B76 B;  2CHW A;  2UYZ B;  3LJ3 A;  4US8 A;  4ZDV A;  3Q3O C;  5DPS A;  1P9D U;  1S1Q B;  4BOS C;  2I2Y A;  1OQY A;  4XC2 A;  3H6N A;  4MM3 A;  2INN E;  1YN3 A;  1JRU A;  2JVC A;  4M0W A;  1MVK A;  5IAA C;  1VLB A;  2N9P C;  2FCM A;  3IT6 B;  2RMM A;  3SEB A;  3ENE A;  1NI3 A;  4C4V B;  3LYY A;  2ZVN A;  2KD0 A;  3ZJV A;  2E3T A;  2K5P A;  3KUD B;  2V0G A;  5DPR A;  2V3S A;  4C56 C;  4XDD A;  1EO6 A;  5BYQ A;  1VJK A;  4KX6 B;  5JZE B;  4MJS B;  3UIN B;  3ML9 A;  2VZK D;  4M8N A;  4PS8 A;  4ANW A;  1ISN A;  2LGI A;  3PZ7 A;  2LGX A;  4L2Y A;  2AL6 A;  3APC A;  4K7S A;  4HJK A;  3I63 C;  3U2S C;  1HA5 A;  1U4A A;  5FR3 A;  4RFB A;  4A90 A;  3E9S A;  3L4P A;  4BBN C;  2OOB B;  2GBM A;  3H1U A;  4PT5 A;  2LXC A;  3L16 A;  2MBE A;  3P4P B;  4PS7 A;  1SIF A;  3QHT A;  3URY A;  3JVZ X;  1PYW D;  4L1B A;  3DDC B;  1Y8R C;  2J0M A;  4W9E A;  2WS3 B;  1UBQ A;  2JWZ A;  1A70 A;  1WM2 A;  4EZJ A;  2ZCC A;  4C7Z A;  4P6V F;  1CJE A;  4JX1 C;  5D3D A;  2LJ5 A;  3U7Z A;  5G2N A;  3QC8 B;  4DHJ B;  1JWU D;  2WYQ A;  3V6E B;  4FJV B;  4II2 B;  1KLU D;  1ET6 A;  2I1K A;  4N9F 4;  4ZRQ A;  3SDL C;  1MFW A;  4YWG G;  1XO3 A;  1T5X D;  1Q1O A;  2PKO A;  1I42 A;  2KVZ A;  3CIR B;  3IAM 1;  4BKT A;  4DDI D;  1HZ6 A;  3E56 A;  3QWZ B;  3AE7 B;  3C19 A;  3UIO B;  4B0E A;  3ZTC A;  2MBB B;  1QLB B;  2MJD A;  2GBK A;  5JXV A;  3L08 A;  2JYE A;  3KUC B;  1LGR A;  3L13 A;  4EZL A;  1P3Q U;  1V49 A;  2N9E B;  3JW0 X;  4LJP B;  3A9K A;  4MSM B;  3CSF A;  4MEL A;  5HKH A;  2I1J A;  1XLN A;  5E6J A;  2N7J A;  1RRB A;  3R66 C;  1NYR A;  3UI3 A;  2DZK A;  4FLH A;  4IUM B;  1D5Z C;  1T0R C;  4NJC A;  1XLO A;  4FXC A;  2MSE D;  2LHD A;  1IYF A;  4CHK A;  3ZNG C;  4LDT B;  2BKF A;  4G0N B;  2KDI A;  3O65 B;  2NTT A;  4ARC A;  1ZKH A;  4FBJ B;  2YEP B;  3QJZ A;  3V61 A;  3NRZ A;  4AOF A;  1G6J A;  1SJE D;  2RDB C;  5TR5 A;  3ETR A;  1AW7 A;  2QJL A;  2AWT A;  3TJP A;  4X57 B;  2KAN A;  1STE A;  4II3 B;  2KC2 A;  1C76 A;  3VTW A;  4YXD B;  1K53 A;  2KMM A;  2IY1 B;  3BIN A;  1HEZ E;  4C4V A;  2WU5 B;  2R2O A;  4XX5 A;  5HG2 A;  1NYQ A;  2KHW B;  3PPA A;  2FCN A;  3RYT A;  4NAW A;  2RR9 A;  3AXC A;  1V1P B;  3P1M A;  4TMA B;  2L1A A;  1TKY A;  2JQR B;  3ZDM C;  2FID A;  2L05 A;  2C7H A;  2BWE S;  3AE2 B;  4S17 A;  1CMX B;  4RGN A;  3U4E G;  2C5L C;  1AN8 A;  1LM8 B;  3TMP B;  3AN1 A;  2YEP F;  5GMV A;  1D3Z A;  1TIF A;  1HQR D;  3B1L X;  2RD0 A;  4W9J A;  3HK0 A;  3WA0 A;  5DPT A;  4JE3 B;  2KFK B;  3KH0 A;  5BO4 B;  1FNU A;  2ASQ A;  3P4Q B;  4RF0 A;  1F2R C;  2ZEQ A;  1TTN A;  2G4D B;  4N6E B;  1WXV A;  4M01 A;  2JU6 X;  3ZYY X;  3ONS A;  3BWU D;  3DVN U;  1WMH B;  2IND C;  3ZIM A;  5AUI A;  4UDU C;  5CX3 A;  2NS5 A;  3VRA B;  3Q8F A;  3R3M A;  4PYU A;  4DDG D;  2G45 B;  1CQV A;  4GDK A;  1X1M A;  2LUM A;  1T3Q A;  1N5W A;  1N5X A;  2JXT A;  5BYR A;  2K9X A;  3Q69 A;  2KAC A;  2AQ1 B;  2QC8 A;  1R7S A;  1FFV A;  2IO0 B;  1JWM D;  3FIL B;  3ZJU A;  1E8Z A;  1VRA B;  4WQM A;  2PEA A;  3WCQ A;  4B0M A;  3TEX A;  2IO1 B;  2PE9 A;  2BVC A;  2JXX A;  1GNU A;  4RGT A;  1Q0W B;  1FCC C;  1L4Z B;  3B0A A;  2FAZ A;  4WIP A;  2L00 B;  3PT2 B;  2N9K A;  5EE1 A;  4IWO A;  2KAJ A;  4WWM A;  1SE2 A;  2JRH A;  2N7E A;  4RF1 A;  1DOX A;  2PPH A;  1UH6 A;  3NZS A;  4RH6 A;  1EWC A;  1NBF C;  3MC0 B;  1V8C A;  3W9C B;  3U30 A;  4J3O D;  4P16 A;  4BKS D;  5DPW A;  5EE9 A;  2TSS A;  4XWT A;  2M19 A;  3OG5 A;  2K3U A;  5C1Z A;  2LGS A;  1FPY A;  3AI5 A;  1KM7 A;  3AU4 A;  1WZ0 A;  3Q3N C;  2KOX A;  2Y5B B;  4AJW A;  3PZD A;  4ARI A;  3VUW A;  1T6B X;  2QIE B;  1Z2M A;  5E6N A;  2Q5W D;  4LNO A;  1HE8 A;  3QIJ A;  4A6Q A;  3DQV A;  2KT7 A;  3Q3J A;  1GUA B;  3SFD B;  2CU1 A;  1F9J A;  4E74 A;  4HDO A;  4BZA A;  1KOT A;  2D3C A;  3HM6 X;  3RNF C;  3AMZ A;  3EA6 A;  2DZJ A;  3RT3 B;  1E8Y A;  4WJP A;  5E6O A;  4IM0 A;  4M02 A;  3QCA A;  1H8C A;  3APF A;  4EOY A;  4C7Y A;  1UD7 A;  4PYZ A;  2NBW B;  3A4R A;  1KTK A;  3OJ4 B;  2MBH A;  3TSS A;  2KNB A;  1JWB D;  1ZP0 B;  2CHZ A;  3MC8 A;  3EUB 2;  3CMM B;  1I35 A;  4HWI B;  2BTE A;  4WWN A;  2D10 A;  1J7C A;  5L83 A;  4R3D A;  1P0R A;  2IGH A;  2OJW A;  2ZNV C;  1YOV B;  4K1R B;  3FIL A;  3NY5 A;  4YSY B;  3ZO5 B;  2IO3 B;  3K9P B;  1XEE A;  3U52 E;  4YTM B;  1XQQ A;  5BMH A;  2FNJ B;  1WRI A;  1C9F A;  5LNK 1;  3AEG B;  4YTP B;  4HDQ A;  4JWS C;  4KZ0 A;  3MC9 A;  1PGA A;  1FXI A;  4NJ7 A;  1JCK B;  1FXA A;  1E8X A;  2PMV A;  2WX0 A;  1L5P A;  1P98 A;  2MBQ A;  2DEN B;  2K6Q A;  3L17 A;  2BYT A;  1YN5 A;  2WXN A;  2GBN A;  1H4R A;  4LDT D;  4OW0 A;  4Q2J A;  2QMT A;  3VH4 B;  3LXF A;  5C23 A;  5FKA C;  1KLG D;  2Z0D B;  1V81 A;  3NHE B;  5HHD G;  3R8B A;  2KFK A;  4A20 A;  1OGW A;  5C3J B;  1WGK A;  4KDL B;  1DYQ A;  4N59 A;  2VZK B;  5FK9 C;  2WXR A;  4IW0 A;  4AJY B;  1YIW A;  3WAO A;  2IGG A;  3MJW A;  1RFA A;  2HTH A;  3HIZ A;  1SB3 C;  2KK8 A;  1XD3 B;  2V3N A;  4ZRJ A;  4W9I A;  3TEY A;  2N1V A;  4YSZ B;  1ZGU B;  4F1S A;  2E6X A;  2KWV B;  3ZXV A;  4MGI E;  1FFU A;  4LLG M;  3AB5 A;  5J2R A;  3Q3M C;  2WXO A;  1KH0 A;  1TS5 A;  2MP2 B;  3WIM A;  1B9R A;  5D94 A;  4GDL A;  3FKY A;  4NAW B;  4WJQ A;  4US9 A;  1PDX A;  3RNC C;  2IYD B;  2UU7 A;  1WH3 A;  4TQ1 A;  3NZ3 A;  4I6P A;  3GE3 C;  2KN4 A;  1GJZ A;  2D3A A;  1WRD B;  1CK1 A;  2SAK A;  1I4X A;  1D5M C;  1RM6 C;  2NTS A;  2KYW A;  3MP9 A;  2KTF A;  2NBV B;  2MHJ A;  1GB1 A;  2XK5 B;  3GZN I;  2FE8 A;  3FAH A;  4RNA A;  1ZDX A;  2BS2 B;  1P7E A;  3EFC A;  5IN7 A;  2KJR A;  3KQ4 A;  1IBX B;  3MHS D;  3A9J B;  3A1Q B;  5BMG A;  1L6V A;  3AE4 B;  3AEE B;  1YJJ A;  3QAR A;  4A3O A;  4P1B C;  1HZ5 A;  2O2V A;  2KJH B;  3ZUN A;  1JWS D;  3DVN V;  1OEY J;  1JAL A;  5G55 A;  2G3Q B;  3TL5 A;  3T8M A;  1TS2 A;  3UIP B;  4RM9 A;  4KGT A;  1WR1 A;  4GDK B;  4BFR A;  1M4V A;  2ONQ A;  4G50 A;  1MG4 A;  2J7Q B;  1V2Y A;  2DNF A;  3T9L A;  5IKC M;  5H8Y E;  2KC1 A;  2HDE A;  4NPN A;  4EKU A;  1GC6 A;  3WAM A;  1BUI C;  2QCZ A;  2FBW B;  3NZU A;  3N20 C;  4GXB A;  4LJO B;  5C2T B;  3W1S C;  1E9M A;  3JSV B;  2ZPN A;  4MAC A;  1TBE A;  3N9Y C;  1FEH A;  2KLG A;  1ZPS A;  1DGJ A;  3PV1 A;  5CTR C;  2ICI A;  4GLS C;  2ZCB A;  1EU4 A;  4DWF A;  2LZ6 A;  4GMV A;  2MW5 A;  4WQO B;  2BGF A;  3S2A A;  1K52 A;  1C3T A;  1WY8 A;  3TCA A;  1C79 A;  1S3S G;  1NVI D;  1QZE A;  1AAR A;  2MX2 A;  3ALB A;  2J4X A;  3V05 A;  3DOW A;  2NVU I;  4WWO A;  1WE7 A;  3ZNH B;  3R7Q A;  2PJH A;  3MFG A;  1V1P A;  2LHE A;  2WP9 B;  4OZC A;  2QSD A;  4MGY E;  4FA6 A;  1UF0 A;  1YJI A;  3RCZ A;  4ZYS A;  2DBY A;  2LEK A;  2W82 A;  5BMI A;  2IGD A;  1SGH A;  1L7Y A;  1RWS A;  1F2R I;  3P63 A;  2WGS A;  4A8X C;  2WXK A;  1UZX B;  2K8B A;  2K8C A;  4RGO S;  4HKQ A;  3IVF A;  2C7M B;  2KDB A;  1IBX A;  2BBC A;  1ZXH A;  2HD5 B;  3BK1 A;  4LCD E;  2M8S A;  1QOG A;  2DAJ A;  3VQI A;  1ESF A;  3AE9 B;  3WAP A;  2WX1 A;  4HCN B;  2RDH A;  5LLI A;  1XF5 L;  2NPT A;  2L52 A;  2PE6 B;  2XK5 A;  1I4H A;  3GZN B;  3PS6 A;  1C4A A;  2IY0 B;  4IWP A;  2DYB A;  4I6N B;  2MBO A;  4NY0 A;  2KWC A;  3B2F A;  2K0P A;  2LGD A;  4N58 A;  4MJS A;  3RNE C;  1WGD A;  2J42 A;  4MM3 B;  1UBI A;  1XCQ L;  2FCQ A;  1C77 A;  2WXH A;  5HFY A;  3EC8 A;  3EEC A;  3DCG A;  1IGD A;  5CHF A;  2K8H A;  1LXD A;  4TKN A;  4S0R A;  3FC4 A;  1PQS A;  1K51 A;  3NVV A;  5IP4 D;  4WJN A;  2L83 A;  3P4R B;  1JRP A;  1QQR A;  3ZVV A;  3ZTD A;  3M95 A;  4OVZ A;  1RAX A;  3AH7 A;  2W3R A;  3VUX A;  1L6U A;  1E90 A;  2YLM A;  4DXF A;  2JSV X;  3EGR A;  4IWQ A;  4A9A A;  2DAF A;  4J6I A;  1WR6 E;  4KKJ A;  1V97 A;  4LNK A;  3DBH I;  2OHF A;  2BB6 A;  4HEA 1;  3BVZ A;  1FMA D;  3SR6 A;  2N7D A;  4CQN A;  4MGK E;  2WXJ A;  2FUH B;  2BWF A;  1FM0 D;  4W9G A;  3PRE A;  2J0J A;  5D6J B;  3RUL A;  4ZOH C;  4BVU C;  2LD9 A;  3Q8A A;  2BW2 A;  1UNS A;  3IXS A;  4GU2 A;  3JSV A;  4NAM A;  3UGB B;  1D4B A;  4DHZ B;  3AV8 A;  3IBE A;  3MTN B;  2B3A A;  1J0G A;  2DZM A;  3AE1 B;  3DWG C;  1WJ4 A;  3AE3 B;  4TSS A;  3AEF B;  3IT4 B;  4P1C C;  1QF6 A;  4ANV A;  2KKC A; 
#chains in the Genus database with same CATH homology
 1WXA A;  2GBR A;  2IBI B;  2LWP A;  1WI0 A;  3DQV A;  4JIO U;  3Q3J A;  1J19 A;  1GUA B;  3RD2 A;  4OVV A;  2CU1 A;  5D7G A;  1F9J A;  3A9J A;  3VDZ A;  4A3P A;  4E74 A;  4HDO A;  1KOT A;  2GMI C;  2HE7 A;  4FN2 A;  2KDE B;  2C9W B;  3L10 B;  3OLM D;  3HM6 X;  4GN1 A;  2ZZP B;  2ZVO A;  3CST A;  4KZC A;  4WJO A;  2DZJ A;  3RT3 B;  1E8Y A;  4WJP A;  3DPD A;  5E6P A;  5E6O A;  2CHW A;  2UYZ B;  3LJ3 A;  4IM0 A;  1NI2 A;  3QCA A;  1E7U A;  2CS4 A;  4ZDV A;  4ZYN A;  1H8C A;  3V60 A;  3APF A;  5DPS A;  1P9D U;  1S1Q B;  4EOY A;  1UD7 A;  4PYZ A;  2NBW B;  3A4R A;  3A4S C;  2JUO A;  2R2Q A;  1V5T A;  2L7R A;  3OJ4 B;  4W9K A;  4BOS C;  2MBH A;  1WFY A;  2MQJ A;  3DBL I;  1OQY A;  4AP4 C;  2KNB A;  2WWZ A;  4XC2 A;  2CHZ A;  3H6N A;  3GOE A;  4MM3 A;  2YVC A;  2NBU A;  3CMM B;  1JRU A;  4K7U A;  2JVC A;  4GDL B;  1I35 A;  4TQ0 A;  3BY4 B;  2DYM A;  4HWI B;  5IAA C;  2N9P C;  2FCM A;  4WWN A;  3V6C B;  2AEH A;  3OAW A;  2D10 A;  5L83 A;  3ENE A;  3EFU A;  2CR5 A;  1P0R A;  2ZNV C;  4NNJ B;  4K1R B;  1J8C A;  2ZVN A;  3NY5 A;  2KD0 A;  4B95 A;  2Z0E B;  4EFO A;  2BPS A;  3VFK A;  5KHO A;  3KUD B;  3ZO5 B;  5DPR A;  2IO3 B;  2V3S A;  2ZNV B;  3K9P B;  4W9F A;  3VAW A;  2KFJ A;  1V86 A;  3VVW B;  1XQQ A;  2FNJ B;  1EO6 A;  2C60 A;  2JY6 A;  4HDQ A;  2KO3 A;  2LXA A;  1TGZ B;  4KZ0 A;  2MLB A;  5JZE B;  4MJS B;  2G4S A;  4W9L A;  3DVG X;  3UIN B;  1SE9 A;  4E71 A;  4NJ7 A;  3ML9 A;  4GB9 A;  2WX0 A;  1E8X A;  4M8N A;  2NR2 A;  2LGY A;  4PS8 A;  2L8J A;  4ANW A;  1ISN A;  5IA7 A;  1P98 A;  2MBQ A;  3WAL A;  1UEL A;  2DEN B;  4JQW C;  2LGX A;  2K6Q A;  3L17 A;  1WX7 A;  4HCP B;  5AZF A;  4GIV A;  2GBN A;  1H4R A;  2EMT A;  4LDT D;  1IP9 A;  3H7P A;  3EHV A;  2AL6 A;  3APC A;  4K7S A;  5J17 A;  4HJK A;  3ZKJ C;  3I3T B;  3ECI A;  2VRR B;  2V1Y A;  2RPQ A;  3VH4 B;  3ZNI D;  1U4A A;  3L54 A;  5C23 A;  2Z0D B;  1V81 A;  3NHE B;  4FUL A;  4A20 A;  2KFK A;  1OGW A;  3VUY A;  2J0K A;  4KDL B;  2D2Q A;  3PRM B;  4BBN C;  2JPH A;  2L0F A;  1WXS A;  2OOB B;  2GBM A;  3H1U A;  2LXC A;  4IW0 A;  4NJ6 A;  3L16 A;  2MBE A;  1NDD A;  4PS7 A;  1SIF A;  4AJY B;  2DZI A;  2M1M A;  3QHT A;  1YIW A;  3WAO A;  4IM2 A;  3JVZ X;  3MJW A;  1RFA A;  2HTH A;  4JL9 A;  3DDC B;  2N1W A;  4BOZ B;  3HIZ A;  2O2V B;  1Z5S B;  1WF9 A;  1Y8R C;  2J0M A;  4XZ4 A;  2KK8 A;  1XD3 B;  4W9E A;  2ZJD A;  3KUZ A;  4W9I A;  4ZRJ A;  1WZ3 A;  2N1V A;  1UBQ A;  2LVP A;  2WDT B;  2JWZ A;  3KVF B;  3WAN A;  1L2N A;  1ZGU B;  4F1S A;  2KWV B;  4MGI E;  2M4N A;  1ZW7 A;  1GG3 A;  1WM2 A;  2LAS A;  4NQL B;  3HHM A;  4EZJ A;  5J2R A;  4IG7 B;  2ZCC A;  2N9X A;  2FIF A;  2KQ7 A;  2OJR A;  3A1Q A;  3ZLZ A;  2MP2 B;  3WIM A;  1A5R A;  5D94 A;  4GDL A;  4NAW B;  4WJQ A;  3UF8 A;  4BKG A;  1V80 A;  2LJ5 A;  2IYD B;  3PRP B;  3QC8 B;  1V9J A;  1WH3 A;  4TQ1 A;  4I6P A;  5G2N A;  4DHJ B;  1GJZ A;  2BKR B;  2WYQ A;  3V6E B;  4FJV B;  4II2 B;  1WRD B;  1WYW B;  2I1K A;  4N9F 4;  2HJ8 A;  3SDL C;  1Q5W B;  2O6V D;  2KTF A;  2O6V B;  2NBV B;  2D07 B;  4URK A;  4W9H A;  4DK5 A;  3W1Y A;  2LVO A;  2XK5 B;  3GZN I;  3D32 A;  3KW5 B;  1Q1O A;  2V4L A;  3PLV A;  3KYD D;  4EUT A;  1I42 A;  4BKT A;  3A33 B;  4DDI D;  2KJR A;  3CF6 E;  3IHP C;  4FJY A;  4ZRI A;  4OVU A;  4M0W B;  3QWZ B;  2L3Z A;  2MP2 A;  3A9J B;  3MHS D;  3A1Q B;  5EDS A;  1WJU A;  2D3G A;  4HXD A;  1FXT B;  3UIO B;  4ASW C;  1WJ6 A;  3ZTC A;  4EZK A;  2MBB B;  2GBK A;  3V62 A;  2Z59 B;  2MA9 B;  3L08 A;  3KUC B;  2KN5 A;  3L13 A;  3QAR A;  2W9N A;  4W9D A;  4A3O A;  2JZ3 B;  1WM3 A;  2O2V A;  4EZL A;  2KJH B;  4MDK E;  4TUU A;  3ZUN A;  1P3Q U;  4NQK E;  1V49 A;  1WXM A;  2N9E B;  3DVN V;  2IZV B;  3JW0 X;  4LJP B;  1WIA A;  3A9K A;  3CSF A;  2KTR B;  4MSM B;  3DBS A;  1OEY J;  1YD8 U;  4MEL A;  5G55 A;  1YX5 B;  5HKH A;  2I1J A;  4TV3 A;  2L0T A;  2G3Q B;  2K39 A;  2KQS A;  3K9O B;  3TL5 A;  4ICV A;  3T8M A;  2DX5 B;  4FJZ A;  1RRB A;  1TZ1 A;  2NCN A;  3KYC D;  3UIP B;  3VTV A;  1BT0 A;  2LRU A;  3M3J A;  4RM9 A;  4ZRK A;  5JHA A;  1WR1 A;  4GDK B;  4P7I A;  4BFR A;  1YX6 B;  3R66 C;  4G50 A;  2DZK A;  2J7Q B;  1V2Y A;  4FLH A;  4IUM B;  1EF5 A;  3T9L A;  2KC1 A;  1OEY A;  3B08 A;  3PLU A;  4NPN A;  4EKU A;  1GC6 A;  2MSE D;  3JYU A;  1WJN A;  3H7P B;  3WAM A;  4WAA A;  1IYF A;  4CHK A;  4KVG B;  4DHZ E;  3ZNG C;  4LDT B;  2BKF A;  5AEK B;  4G0N B;  3NZU A;  4GXB A;  4LJO B;  1MG8 A;  4KV2 A;  3SU8 X;  3W1S C;  4F7Z A;  2KDI A;  3O65 B;  3TBL D;  1VD2 A;  3JSV B;  1ZKH A;  4FHK A;  2N4F A;  4HLE A;  2ZPN A;  4FBJ B;  1EUV B;  3QJZ A;  4ICU A;  3V61 A;  3AUL A;  2A5U A;  2L76 A;  2K1F A;  4AOF A;  2GOW A;  1G6J A;  4JLC A;  4M8M A;  3QA8 A;  1E7V A;  1TBE A;  2QHO A;  2REX A;  3DBR I;  5TR5 A;  2EMS A;  2KJ6 A;  4KIK B;  3PVL A;  2AWT A;  3TJP A;  2KLG A;  4X57 B;  2KAN A;  5CTR C;  3PV1 A;  1E8W A;  4II3 B;  2KC2 A;  3M62 B;  3H9D A;  3N30 A;  3VTW A;  2UWQ A;  2ZCB A;  3NS8 A;  3ML8 A;  2IY1 B;  2M0X A;  3VXW A;  2LZ6 A;  2CKH B;  4DWF A;  4GMV A;  3UQB A;  2MW5 A;  5FR6 A;  4WQO B;  2IO2 B;  3BIN A;  3QAQ A;  2BGF A;  4I6L B;  2LI5 A;  3S2A A;  5KHQ A;  1LFD A;  1C3T A;  3W1S A;  1R4M I;  1WY8 A;  3TCA A;  2R2O A;  3PRZ A;  4XX5 A;  1S3S G;  2KHW B;  3PPA A;  1R4N I;  2FCN A;  1QZE A;  2AL3 A;  1AAR A;  2MX2 A;  3RYT A;  3ALB A;  4K7W A;  3AU5 A;  4NAW A;  4F8C B;  4MGZ E;  2RR9 A;  2BYV E;  3DOW A;  3AXC A;  2NVU I;  3SD5 A;  1T0Y A;  4WWO A;  5LXI B;  2BYE A;  1WE7 A;  4WWP A;  1WGG A;  3ZNH B;  2LVQ A;  2PJH A;  3R7Q A;  3RUI B;  2FID A;  3ZDM C;  2L05 A;  3L0W B;  2C7H A;  1WGY A;  2BWE S;  4CO7 A;  2RSU A;  1CMX B;  4MGY E;  3ZRC A;  4FA6 A;  4RMA A;  2D11 A;  3RCZ A;  4ANU A;  4HK2 A;  2C5L C;  1K8R B;  3QX1 A;  4GOC A;  5LXH A;  3PHW B;  3OJ3 A;  5J18 A;  3PHX B;  1GC7 A;  3ZDT A;  1SGH A;  1LM8 B;  1L7Y A;  3TMP B;  2KZR A;  5GMV A;  2KXJ A;  1D3Z A;  3APD A;  2JF5 A;  3RZF A;  4DHJ D;  1UZX B;  2K8B A;  2K8C A;  5D2M B;  3B1L X;  2RD0 A;  2XBB C;  4YL8 A;  3QK0 A;  3IVF A;  2C7M B;  4W9J A;  2KDB A;  3HK0 A;  3WA0 A;  2HD5 B;  4LCD E;  5DPT A;  2M8S A;  4BKS A;  2DAJ A;  4KIK A;  3VQI A;  2KFK B;  3KH0 A;  1YQB A;  3PTF C;  5BO4 B;  2WX1 A;  4HCN B;  3WAP A;  5LLI A;  4DXA B;  2ASQ A;  3IFW B;  2KLC A;  1P1A A;  4HPL B;  2NPT A;  4JGH B;  2PE6 B;  2XK5 A;  4B9K A;  3U8Z A;  2ZEQ A;  1EF1 A;  1TTN A;  3N32 A;  2G4D B;  2KWU B;  3PS6 A;  1WXV A;  2IY0 B;  4IWP A;  1WMH A;  4DBG A;  5AZG A;  3SHQ A;  1M94 A;  2DYB A;  1YJ1 A;  4I6N B;  3ONS A;  4AWJ A;  4W9C A;  3M63 B;  2MCN B;  2MBO A;  4KSK C;  3DVN U;  3NOB A;  2KWC A;  1WMH B;  4NY0 A;  4IM3 A;  2JZZ A;  3ZIM A;  2EKE C;  1VCB A;  4E3C A;  5CX3 A;  2NS5 A;  2LGD A;  1XT9 B;  3R3M A;  4PYU A;  4DDG D;  2JRI B;  4MJS A;  5JH5 C;  2G45 B;  4BBN F;  4GDK A;  1WGD A;  4KSL C;  3HM3 A;  1X1M A;  4PS3 A;  1UBI A;  3UQA A;  2FCQ A;  3PGE A;  4AUQ C;  2K25 A;  2BF8 B;  3EC8 A;  3EEC A;  1KJT A;  3DCG A;  1WE6 A;  2C7N B;  3Q3F A;  2XEW A;  5DCN A;  2DHZ A;  2KTR A;  1WGH A;  2LUE A;  2IO0 B;  3VH3 B;  5CHF A;  2K8H A;  1LXD A;  3X23 A;  3ZRF A;  4TKN A;  1PQS A;  4HPM B;  4MEM A;  4WJN A;  1E8Z A;  4HVB A;  4K81 A;  2PEA A;  3ZVV A;  3ZTD A;  3ZW3 A;  3M95 A;  2IO1 B;  2KX3 A;  2PE9 A;  1LQB A;  3PSE B;  5JHB A;  4FHJ A;  4EEW A;  1RAX A;  2JXX A;  3VUX A;  4FAD A;  1E90 A;  4B6W A;  1GNU A;  4G11 A;  1Q0W B;  2YLM A;  3ZNZ B;  2LRW A;  3RZW C;  1E5W A;  1RLF A;  3B0A A;  3C0R B;  4IWQ A;  3VTU A;  2FAZ A;  3X0W A;  5L95 C;  2DAF A;  2L00 B;  3PT2 B;  5AZH A;  4ANX A;  2RGF A;  3R7R A;  4J6I A;  1WR6 E;  1C1Y B;  2JT4 B;  2K6D B;  4MSQ B;  2BYF A;  4IWO A;  3DBH I;  3LDZ E;  2JRH A;  4IC7 B;  2N7E A;  2O6V A;  2A4Z A;  3IG3 A;  3P2B A;  3VHT C;  4GSW A;  2N7D A;  2PPH A;  5CHW A;  4MGK E;  3H7S A;  1UH6 A;  2GBJ A;  3NZS A;  1KLV A;  2FUH B;  4RM8 A;  2BWF A;  2M17 A;  1NBF C;  3PRE A;  4W9G A;  3QQ8 B;  1UGM A;  1V5O A;  3U30 A;  2J0J A;  2KMA A;  5D6J B;  4BKS D;  5DPW A;  3RUL A;  4BVU C;  2ZPY A;  2LD9 A;  4KDI C;  2KX0 A;  4G3X B;  3DVG Y;  5C1Z A;  4GU2 A;  3AI5 A;  4MH0 E;  3JSV A;  2AYO B;  1IPG A;  1KM7 A;  3UGB B;  1OTR B;  5CHV C;  4DHZ B;  2KDF B;  3A9K B;  2DYO A;  1WX8 A;  3AU4 A;  1WZ0 A;  2KOX A;  2Y5B B;  3TIX A;  1WGR A;  3IBE A;  3MTN B;  4AJW A;  2B3A A;  1V6E A;  3PZD A;  4CYE A;  1J0G A;  2DZM A;  3VUW A;  3N3K B;  1WJ4 A;  2KMC A;  2MWS B;  1WX9 A;  1Z2M A;  5E6N A;  2NPT B;  4GGQ A;  2KVR A;  2FCS A;  1HE8 A;  2MRP A;  3QIJ A;  3U7D A;  4ANV A;  2KKC A;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...