2AL3A

Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
SAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords TUG long isoform
publication title Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11470 TUG-UBL1 TUG ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al3A00
1FXTB 1E8YA 4W9FA 4WWPA 1GG3A 4JLCA 2C9WB 4WWNA 2MP2B 2D07B 2KHWB 1EUVB 2O6VD 4WAAA 3DOWA 2NPTA 2KFJA 3A9KA 3PRPB 1WZ0A 2DX5B 2NBVB 3BY4B 4KDLB 4II2B 3EFUA 3VTUA 4I6PA 3T8MA 4GDLB 5JZEB 3S2AA 3U8ZA 3ZNZB 2D3GA 3VXWA 1E8WA 2J0KA 3KYCD 4HLEA 3DDCB 2BWFA 2CHZA 3L08A 3QHTA 3A4RA 3ECIA 3RUIB 2VRRB 2HJ8A 4G3XB 2ZPYA 4F1SA 2L05A 1BT0A 2PJHA 2ZEQA 2JWZA 4RM8A 2KD0A 1P98A 4CO7A 2K8BA 4G11A 3QARA 4JGHB 2KX3A 1ISNA 2K8HA 2G4SA 2ZCCA 3JVZX 1E8ZA 3KYDD 4GDLA 2JVCA 4M8NA 4DHJB 5HKHA 1P3QU 3PLUA 1V5TA 3OAWA 5J18A 2KDEB 2LVPA 2LUEA 3ZTCA 2CHXA 2OOBB 4CHKA 2DHZA 3EHVA 1D3ZA 1GUAB 2K8CA 2WX0A 3ALBA 3GOEA 2XEWA 2LWPA 2JXXA 5EDSA 1E90A 2EMSA 4AOFA 4AJYB 3QQ8B 5GMVA 2LRWA 1WJNA 4BBNF 2BKRB 3B08A 3A1QA 2CHWA 3P2BA 4JL9A 1MG8A 4BKTA 4A3OA 2DZMA 1VD2A 4IM2A 3UQBA 2KJHB 3H7PB 4IWPA 3VQIA 4IM0A 3IHPC 2RSUA 3VH4B 2CS4A 2RD0A 4MH0E 5IAAC 4KZ0A 5C1ZA 3CSFA 2FUHB 4IG7B 4PYUA 2ZNVC 2G3QB 3APDA 3CF6E 4TUUA 1I42A 3PREA 4W9GA 1L7YA 4KSKC 3DBSA 2O6VA 1V5OA 2WWZA 2KN5A 3HM6X 3OLMD 3U30A 1UELA 1WYWB 4W9CA 2JT4B 4PS3A 4GGQA 3WA0A 4URKA 3L17A 3HIZA 1JRUA 3QWZB 2KXJA 2NVUI 4GIVA 1EF1A 1XD3B 4ZDVA 2A5UA 2G4DB 4GMVA 2Y5BB 3N3KB 4BOSC 3WALA 4K7WA 1ZGUB 2AL6A 1YJ1A 4FADA 3DQVA 3DBHI 4DWFA 2KQSA 3EC8A 2M1MA 4W9LA 5DCNA 1IP9A 2MW5A 2JZZA 4WJOA 2LZ6A 3AU4A 3WAMA 1WE7A 4HDOA 4K81A 1U4AA 2MX2A 2OJRA 2KMAA 4K7SA 1WJ6A 3R3MA 2ZPNA 3AXCA 2N4FA 3NZSA 3ZO5B 2JZ3B 2YLMA 4KIKB 2KDBA 3N32A 4EKUA 3AI5A 1WF9A 1SE9A 2IYDB 4PS7A 2PE9A 3VH3B 4DBGA 2HTHA 1GC7A 2KKCA 2WX1A 4FHJA 4IWOA 1UBIA 4WJNA 3SDLC 3ZRFA 3NY5A 3IVFA 3UIPB 2V1YA 1G6JA 2NBUA 1XT9B 2UYZB 2MA9B 4ANUA 4ANXA 5LLIA 2KQ7A 2Z59B 1P0RA 4KVGB 2LASA 3ZTDA 4DHJD 4KIKA 1WFYA 5LXHA 3B0AA 1TTNA 3NOBA 1KOTA 5BO4B 1WM2A 3SHQA 2UWQA 4BFRA 1LQBA 5L83A 3VHTC 2I1JA 2JRIB 1V49A 1LM8B 4HWIB 1AARA 4TKNA 3R7QA 2KTRB 3L16A 1OEYA 3R7RA 3DPDA 3JW0X 5KHOA 4NQLB 1PQSA 2GBKA 3ZDTA 4IWQA 1V2YA 2KDIA 3AU5A 4LDTB 2NR2A 3CMMB 4W9KA 2IBIB 2WYQA 2KNBA 1Q1OA 3KUDB 3MTNB 4A3PA 2DZJA 4GDKA 3AULA 2IO2B 2ZNVB 2MWSB 3DBLI 4IUMB 4WQOB 2A4ZA 4NPNA 2BYFA 3Q3FA 1WMHB 3APFA 2ZZPB 5E6NA 2IO0B 2KFKB 1Z2MA 2MP2A 4EFOA 3QIJA 4NQKE 3WAPA 3KW5B 4BBNC 3HM3A 1WXSA 2K6DB 4HJKA 2GBNA 5D6JB 2KWUB 4YL8A 1WXMA 4TQ0A 1WIAA 3B1LX 2D11A 3GZNI 5DPRA 3RZWC 1GC6A 2KC1A 2FNJB 3W1SA 2EMTA 2IY0B 4GOCA 5CHWA 3O65B 3WAOA 4B6WA 1OEYJ 1WMHA 3A4SC 5G55A 2KFKA 2L0FA 1R4NI 3PPAA 4HK2A 2LGYA 1WZ3A 1OTRB 1J8CA 1NI2A 4I6NB 4XX5A 2RGFA 2ZVNA 1UD7A 4J6IA 2IZVB 1J19A 2MBHA 4E3CA 2CU1A 3MJWA 3JYUA 3TIXA 1GNUA 2MLBA 4ANVA 1UZXB 4MGZE 4AP4C 2YVCA 3PTFC 3VAWA 1OGWA 1NDDA 4ICVA 1SGHA 1WE6A 2N7EA 5KHQA 1V9JA 5AZFA 1S1QB 2KLCA 2ZVOA 3W1YA 2KX0A 4G0NB 2L00B 5CHFA 3RULA 3TCAA 3ML8A 2KANA 4BKGA 2LGDA 3IBEA 2V4LA 4MSMB 4PS8A 4DDID 1YX5B 4OVVA 2KWVB 1RRBA 1UH6A 4HDQA 5IA7A 2V3SA 2DZKA 3DVNU 3U7DA 2GMIC 4ZRKA 4OVUA 3APCA 1WR6E 3H7PA 2BYVE 2R2QA 4MDKE 3PZDA 2MQJA 2LXAA 3D32A 4TV3A 2JRHA 4FN2A 1LFDA 1WX8A 4KV2A 5AZHA 4MSQB 3T9LA 5AEKB 1YD8U 3EECA 4KSLC 1J0GA 2BPSA 3ENEA 2KC2A 3DVGX 3W1SC 2PE6B 3PVLA 2HD5B 2B3AA 3ZNHB 4E71A 3DBRI 1XQQA 5TR5A 2FCSA 2XK5B 4GN1A 3VTVA 2FCQA 3NHEB 2REXA 4IC7B 4ZYNA 4NNJB 4LDTD 5J17A 4DK5A 2RR9A 3PHWB 2J7QB 5D94A 2L3ZA 4EEWA 1WI0A 4EZJA 3L0WB 4HPLB 1WGHA 4FA6A 1TZ1A 3L54A 1Q5WB 4W9IA 1T0YA 3RCZA 3ML9A 3KH0A 5DPTA 2LVOA 4I6LB 4RM9A 4ASWC 2AYOB 3VFKA 2XK5A 3RYTA 2KWCA 1LXDA 3PS6A 4DXAB 2IO1B 3OJ3A 4CYEA 4MEMA 1WGYA 3VDZA 1ZW7A 2L8JA 4A20A 4B95A 3VUXA 4W9DA 3Q3JA 2KO3A 2C60A 4IW0A 4MM3A 2FAZA 3V62A 2RPQA 4GXBA 1E7UA 4N9F4 3RZFA 3NZUA 2HE7A 3L10B 2MSED 4WJQA 3ZVVA 4LJOB 3PRMB 2Z0DB 2KJ6A 1Y8RC 4ICUA 3ZKJC 3TMPB 1YIWA 3DCGA 3H1UA 4TQ1A 1OQYA 4X57B 1GJZA 1ZKHA 2LXCA 3VUWA 1WXVA 2FCMA 4DHZE 2C5LC 2KK8A 1I35A 4IM3A 3V6CB 4EZKA 2R2OA 5CHVC 1EO6A 2CKHB 2BF8B 1TGZB 4GB9A 2LGXA 1R4MI 5CX3A 1EF5A 2ASQA 1HE8A 2KTFA 2ZCBA 1RAXA 1H8CA 3SD5A 1KLVA 3PLVA 4RMAA 3TBLD 2N7DA 1WGRA 5J2RA 1RLFA 4BKSD 2NPTB 3UF8A 3PT2B 3A9KB 4HXDA 2L76A 3K9OB 4II3B 2GOWA 2KTRA 2QHOA 4LCDE 2LJ5A 3X0WA 4AJWA 5D2MB 3ONSA 1UBQA 3BINA 3NS8A 1KM7A 4HVBA 4FJVB 2N1VA 3QX1A 1IPGA 1IYFA 3QAQA 2AWTA 3M95A 4WJPA 5LXIB 1QZEA 1WX7A 4LJPB 1SIFA 2DYBA 4FBJB 2MBOA 1WJUA 4FHKA 2JUOA 3UGBB 1CMXB 2IY1B 3M3JA 3LJ3A 3H9DA 4EZLA 3QCAA 5JH5C 5DPSA 2W9NA 3VVWB 3DVNV 3H6NA 2PPHA 1UGMA 4F8CB 2JPHA 4HPMB 1WM3A 2L7RA 3LDZE 3R66C 2LRUA 2M4NA 2MCNB 1WR1A 4FLHA 1A5RA 2BWES 1YX6B 2DYOA 3RT3B 2J0MA 4FJYA 1C1YB 3WANA 2N1WA 2ZJDA 2N9PC 3M63B 4MGKE 1YQBA 3V6EB 3PRZA 1WRDB 2D2QA 3A1QB 4W9JA 2LD9A 2M8SA 4EUTA 2KDFB 3A9JB 2C7HA 3DVGY 4NAWB 4K7UA 4HCNB 4WWOA 2BGFA 5E6OA 2G45B 4JIOU 5G2NA 3TL5A 4BVUC 2NCNA 2CR5A 2MRPA 1WH3A 1WGDA 2GBRA 4B9KA 4XC2A 1V6EA 5DPWA 3ZNID 3IFWB 1V80A 4K1RB 4NJ7A 1L2NA 3X23A 2D10A 1P1AA 3ZDMC 3H7SA 5AZGA 2O6VB 2NBWB 3A9JA 3QK0A 4BKSA 2DAFA 3V61A 4NAWA 5FR6A 1WX9A 5C23A 1C3TA 3L13A 1WY8A 3RD2A 2C7NB 3ZW3A 3N30A 1F9JA 4F7ZA 1X1MA 4GSWA 2Z0EB 4ZRJA 2JY6A 1E5WA 4XZ4A 3WIMA 2EKEC 2FIFA 4NJ6A 2XBBC 1K8RB 2O2VB 4FJZA 3HHMA 1WJ4A 3ZNGC 2AEHA 4M8MA 1H4RA 4AWJA 2DZIA 3KUCB 3HK0A 4G50A 2FIDA 5JHAA 4AUQC 3QJZA 1V81A 3M62B 3VUYA 2KJRA 3OJ4B 5CTRC 1VCBA 2NS5A 2M17A 2KZRA 1WGGA 2AL3A 2DENB 4JQWC 3ZLZA 3JSVB 3ZUNA 4M0WB 2IO3B 4MJSB 2KMCA 2I1KA 2J0JA 2KVRA 2O2VA 4KDIC 3QA8A 2PEAA 3SU8X 4BOZB 1KJTA 3IG3A 2DYMA 3I3TB 4NY0A 3UQAA 1RFAA 4FULA 4HCPB 3K9PB 4P7IA 1S3SG 5E6PA 1P9DU 2M0XA 1Z5SB 4MGYE 2K39A 4W9EA 1M94A 2JF5A 2LVQA 4MGIE 3JSVA 3ZRCA 3CSTA 3PSEB 4MJSA 1TBEA 4E74A 5D7GA 5L95C 3KUZA 1E7VA 2FCNA 2MBBB 2L0TA 3PHXB 3A33B 2KLGA 5JHBA 2KOXA 3TJPA 4PYZA 4GU2A 4DHZB 3MHSD 1Q0WB 2MBEA 3KVFB 4ANWA 2K6QA 2K25A 3C0RB 4MELA 1E8XA 3ZIMA 1NBFC 2BYEA 4ZRIA 3V60A 3UIOB 1V86A 1WXAA 2WDTB 2GBMA 2DAJA 2BKFA 2N9XA 4KZCA 2K1FA 2N9EB 2C7MB 3PGEA 2MBQA 3QC8B 4W9HA 4GDKB 2LI5A 3UINB 2GBJA 4EOYA 3PV1A 4DDGD 3VTWA
chains in the Genus database with same CATH superfamily
1FXTB 2LHEA 4WWPA 4JLCA 4JX1C 1L5PA 3NZ3A 4WAAA 1EUVB 1TY2A 2KMMA 1EWYC 2PIAA 5HHDG 3MFGA 2DX5B 2DWQA 4I6PA 2KVZA 3S2AA 1TS2A 3GE3C 2D3CA 1E8WA 2J0KA 3VXWA 1ENFA 1E7PB 2VRRB 2ZPYA 2JWZA 4A90A 4H2AA 4P16A 2Q5WD 3QARA 2KX3A 1ISNA 3JVZX 2KT7A 2JVCA 4M8NA 3GB1A 3P4RB 3PLUA 3ZTCA 2OOBB 2XEWA 1UWMA 2JXXA 2BKRB 2J42A 1EWCA 3A1QA 2CHWA 3BVGA 3KLSX 3EA6A 3KWLA 1VD2A 3UQBA 2RMMA 1XO3A 1Q10A 4MH0E 4R3DA 2ZNVC 3CF6E 2MJEA 1L7YA 3R2TA 1V5OA 2WWZA 1F77A 3ZXRA 2KN5A 2BVCA 1D5XC 4PS3A 4URKA 3HIZA 2KXJA 4GIVA 5EE3A 2Y5BB 3B2GA 4FADA 2LHDA 1T5XD 2UU7A 2MW5A 4WJOA 1WE7A 4K81A 4A9AA 5IKCM 2KMAA 3Q6BA 4PT5A 2ZPNA 2N4FA 3ZO5B 1YJJA 4KIKB 1FNVA 4C56C 2KDBA 3N32A 4PS7A 2WX1A 4WJNA 2INCC 3UIPB 2WXNA 1XT9B 2UYZB 3MC9A 2KQ7A 3ZTDA 4KIKA 5LXHA 5JXVA 3NOBA 5E6JA 3SHQA 3NRZA 1IBXA 4HWIB 2PVGC 3R7RA 3IXSA 4NQLB 1V2YA 2IGDA 2NR2A 1J7CA 2WYQA 2KNBA 1Q1OA 5TSSA 2VZKD 2DZJA 3Q8BA 2ZNVB 1E10A 3DBLI 2A4ZA 4NPNA 3Q3FA 1DOYA 2MP2A 1Z2MA 4P6VF 2EKIA 4NQKE 3WAPA 4C4VA 1JCKB 4WWMA 2GBNA 5D6JB 4YSZB 1ACCA 2QMTA 1TY0A 3AE6B 4ARCA 4DXFA 2KC1A 2VH2A 2EMTA 1HQRD 4GOCA 5CHWA 3WAOA 2WHIA 2N9KA 4JPSA 2L0FA 1D4BA 2LEKA 3PPAA 4HK2A 2LGYA 1OTRB 4HRSA 3B2FA 2ICIA 2WS3B 3GZNB 3ZXVA 5HFYA 3MJWA 3EFCA 2MLBA 3TSSA 4RF0A 2AX5A 2WXRA 4AP4C 1WE6A 2KQ4X 2BBCA 3V05A 2KLCA 3TEYA 2L00B 2JZPA 2W82A 2LJIA 1YX5B 2KWVB 3U4EG 2DBYA 5IA7A 4LNNA 5I4DA 4OVUA 2BYVE 2R2QA 5BYRA 3PZDA 2MQJA 3D32A 3Q8CA 4KV2A 2QJLA 1YD8U 1MHXA 2BPSA 3ENEA 3W1SC 2QEJC 2AQ1B 2IPKD 2B3AA 3DBRI 1XQQA 3AE8B 4ZYNA 4LDTD 3VR8B 4DK5A 2RR9A 2J7QB 2L3ZA 4EEWA 3L0WB 3RNGC 3L54A 3MC8A 4W9IA 3ML9A 3FC4A 3KH0A 5DPTA 2K9XA 2AYOB 3VFKA 3RYTA 2KWCA 3PS6A 4DXAB 3OJ3A 2PMVA 1SBBB 5BMIA 4MEMA 1WGYA 3VDZA 3LB8C 4B95A 2KO3A 2RPQA 3RZFA 3NZUA 3V3XA 3L10B 4WJQA 3P42A 2D5GA 3AEAB 3TMPB 3H1UA 4TQ1A 1CQVA 1OQYA 2J53A 4X57B 3DHIC 2C5LC 1M4VA 3V6CB 4YTMB 4EZKA 1E0ZA 2CKHB 1R4MI 2ASQA 2WXJA 2G1EA 3SD5A 1GB1A 3TBLD 1VZ7A 1DOXA 1D6EC 2L76A 4LCDE 2GLSA 3ONSA 1N63A 4FJVB 2N1VA 1T0QC 3M95A 3WCQA 4LJPB 1FEHA 2X38A 2MJ3A 1I4RA 4FBJB 4EZLA 1CMXB 3LJ3A 1CJEA 3QCAA 5DPSA 3DVNV 2PPHA 2JPHA 2L7RA 1XLOA 2LRUA 1A5RA 2OHFA 3RI7C 2DYOA 3W5UB 3RT3B 3IT4B 3Q8EA 3RNFC 3V6EB 2LGSA 3PRZA 4HCNB 2BGFA 2RDBC 3RNBC 4NJ7A 4K1RB 4UDUC 1P1AA 1C76A 1TT5B 2O6VB 2WLBA 4S0RA 3V61A 1WX9A 2D3BA 2WXLA 3RD2A 3N30A 5T8IA 2Z0EB 4ZRJA 2JY6A 2X8XX 4XZ4A 1V1PA 3Q8AA 2DLBA 2O2VB 3HHMA 2AEHA 3HRDD 3KWVA 4G50A 1TS5A 3QJZA 3BWUD 2Z8LA 3VUYA 1VCBA 2NS5A 2M17A 2KZRA 2DENB 1ESFA 3ZLZA 3ZUNA 1QT9A 4KDIC 2I1KA 2O2VA 4KKIA 2OEDA 1KJTA 3UQAA 3URYA 4HCPB 4TSSA 2QSDA 2M0XA 3BK2A 1T3QA 2K22A 1FFUA 1ZOYB 1YNTE 4E74A 5D7GA 3PZ7A 3Q69A 1PFDA 1XEEA 3A33B 5HG2A 2INNE 4A55A 4GU2A 3W2DA 1Q0WB 4ANWA 2K25A 3AH7A 3IAS1 2BYEA 4ZRIA 5AUKA 2BB6A 2N9XA 3MC0B 3PGEA 4GDKB 2INPE 1E8YA 4W9FA 1UUPA 1L4DB 2KHWB 4JWUC 2WU5B 1SIJA 3PRPB 1WZ0A 4KDLB 3BY4B 3EFUA 1FD6A 4GDLB 5JZEB 1CK1A 3LXFA 3ZNZB 2I2YA 1XCTL 3KYCD 1UF0A 2K5PA 5D3IB 1SE3A 1YJIA 3ECIA 2HJ8A 4G3XB 3TEWA 4RM8A 2KD0A 2K8BA 4JGHB 3DBLB 4GDLA 4DHJB 1P3QU 2KDEB 4OZBA 2CHXA 2XN9C 3EHVA 1D3ZA 1KH0A 3ALBA 5HI1A 1C78A 4AOFA 4RCOA 4L23A 3E56A 1YN5A 3P2BA 1MG8A 1RYJA 3ZJTA 4IM2A 4IM0A 3BVZA 2CS4A 3W9CB 5IAAC 5C1ZA 2V3NA 4IG7B 4TUUA 3P4QB 1EM7A 2NTSA 3DBSA 1WYGA 2IDYA 3E9SA 3OLMD 4GLSC 3R8BA 3DWGC 3QWZB 1QF6A 2A5UA 1I7HA 3WALA 4K7WA 3DQVA 3FILB 4DWFA 1SB3C 2JQRB 2M1MA 1NVID 5DCNA 2LZ6A 4RGOS 4HDOA 1U4AA 2MX2A 1I4XA 2OJRA 4KGTA 4IOIE 3RFZB 4A8XC 3DBHB 3AI5A 3FILA 4DBGA 4FHJA 4IWOA 3SDLC 1JQ4A 2V1YA 4ANUA 2Z59B 2XNAC 1WFYA 3B0AA 4M01A 2GI9A 5BO4B 1NYQA 2I1JA 1LM8B 3R7QA 3L16A 1OEYA 1PUTA 2M0AA 4P1BC 2L83A 3DPDA 1VDVA 5KHOA 3ZDTA 2RPVA 3ZJUA 3AU5A 4W9KA 1KLUD 4YSYB 3CIRB 2MWSB 1JMLA 4IUMB 4OW0A 4WQOB 2BYFA 1WMHB 3APFA 2ZZPB 5E6NA 4XYCA 1STEA 2IO0B 5MPOA 2BW2A 4YWGG 3KW5B 4US8A 1WXSA 1ET9A 4TQ0A 3B1LX 2WXPA 1L6UA 5DPRA 1GC6A 1FRDA 4B6WA 1WMHA 4ACFA 1R4NI 1N5WA 3R2IA 1LO5D 1JW9D 4XX5A 4J6IA 1UD7A 1J19A 2MBHA 4E3CA 2CU1A 3JYUA 4C7YA 1FXAA 4ANVA 4MGZE 3VAWA 1NDDA 2N7EA 5AZFA 3W1YA 5CHFA 3RULA 2KANA 3IBEA 2V4LA 1YOVB 2WXOA 4WIPA 4DDID 4OVVA 4YT0B 1I4GA 2JXTA 2DZKA 4ZRKA 1YQ3B 2SAKA 1V97A 1MG4A 4TV3A 2JRHA 1LFDA 5AEKB 4J3OD 1J0GA 2TSSA 3DVGX 2N0SB 1ZPSA 2FCSA 1N6ZA 3VTVA 3NHEB 3N1XC 4KKJA 3PHWB 3GE8C 1WI0A 3NS1A 1TZ1A 4MM3B 3TEZA 3I5JC 2LVOA 4I6LB 1MVKA 1ZXHA 1QQRA 2WXHA 1J7AA 3ZJVA 1LXDA 3BZDB 3N1YC 4CYEA 1ZW7A 3RNCC 3VUXA 5EE9A 3Q3JA 4IW0A 4MM3A 1WSPA 2FAZA 4N9F4 2MSED 4LJOB 2Z0DB 4ICUA 1YIWA 1JWAD 1I4PA 1GJZA 4DHZE 2KK8A 1I35A 4IM3A 1OFFA 2AQ2B 1TGZB 2N9LA 2WXFA 1EF5A 2WDQB 1HE8A 1VZ8A 1H8CA 1B1ZA 4RNAA 2ON8A 2NPTB 3PT2B 3A9KB 3KQ4A 2LJ5A 1UBQA 3NS8A 3EGRA 3TUOA 1BUIC 3AV8A 1QZEA 1WX7A 2DYBA 1FCLA 3MJ5A 1NI3A 3AEDB 3N1ZC 5JH5C 2W9NA 3P63A 4F8CB 3RNAC 3LDZE 2M4NA 1WR1A 4FLHA 2JYEA 1VLBA 1GAQB 1C1YB 2Y5PA 2N1WA 3M63B 1AW7A 2M8SA 2I38A 2G45B 3TL5A 2GBRA 1WGDA 5DPWA 3IFWB 3ZDMC 5AZGA 1CZPA 3QK0A 4M02A 5FR6A 1FNWA 3L13A 4F7ZA 1X1MA 4GSWA 4YTPB 1E5WA 4O1NA 3NUHB 3AECB 2NMQA 2L1AA 2ACZB 2J4XA 2OJWA 4AWJA 2DZIA 1XLNA 3HK0A 2FIDA 1RM6C 2QDFA 1P7FA 4D2KA 3M62B 1B9RA 4XDDA 1KTKA 4YTNB 1YN3A 5FK9C 3JSVB 4NJCA 4MJSB 3W5VB 3RPFC 3T3NA 4BOZB 4K3BA 1RFAA 4FULA 1WGKA 3K9PB 4P7IA 4IKGA 1FPYA 1NENB 2K39A 1I4HA 2JF5A 2Y5CA 3JSVA 3ZRCA 3CSTA 4QAYA 4MJSA 2M56B 3N20C 1E7VA 2MBBB 3H8HA 1MJDA 4PYZA 1T0SC 3MHSD 2MBEA 1JROA 3C0RB 2W54A 3FAHA 3V60A 1V86A 3AE4B 2GBMA 4KZCA 2JU6X 2K1FA 2N9EB 2C7MB 2LI5A 1D5MC 2GBJA 2JX5A 4FXCA 3Q3MC 1GG3A 4WWNA 2MH7A 2O6VD 3DOWA 2H89B 4II2B 3VTUA 3GS2A 3T8MA 3ETRA 3EUB2 4BAXA 2CU3A 3T3OA 1FRRA 1TKGA 3AE9B 4HLEA 3DDCB 2CHZA 2RDGA 3L08A 3RUIB 1BT0A 4CO7A 5BYQA 1L6VA 2PTLA 2N7JA 2K8HA 2G4SA 2ZCCA 2L52A 3KYDD 4C7ZA 4HJGE 1HEZE 5HKHA 3OAWA 2LVPA 2LUEA 2VH1A 4DQOC 4CHKA 1GUAB 2K8CA 3GOEA 1AN8A 1E90A 2EMSA 3SFDB 4AJYB 1K52A 2WXMA 3QQ8B 5FR3A 1V8CA 2LRWA 4JL9A 2QILA 4BKTA 2WNMA 1R4NB 2DZMA 2YEPF 5IN7A 2KJHB 3H7PB 1HZ6A 4IWPA 3C19A 3Q2AC 3VQIA 1MHHE 2RSUA 3VH4B 4KZ0A 3CSFA 3Q14C 4PYUA 3APDA 1I42A 1N61A 2O6VA 1I4QA 3U30A 1UELA 3Q3NC 3WA0A 3L17A 5H92C 3U52E 2NVUI 3OG5A 4ZDVA 4ZHOA 2G4DB 1TKYA 4BOSC 2PLPA 4M00A 1SJHD 1ZGUB 4MACA 4XDCA 1SF0A 2KQSA 4WH4A 3I9V1 4W9LA 2KN4A 4KGSA 3AU4A 2L32A 4K7SA 3NZSA 2YLMA 1K53A 2WGSA 1PGXA 4EKUA 1WF9A 1SE9A 3AEFB 2IYDB 2KAJA 1FMAD 4AQ7A 1WXQA 2PE9A 2W3RA 3VH3B 2HTHA 2KKCA 1UBIA 4RGMA 3NY5A 1V1OA 1G6JA 2WU2B 4ANXA 4KVGB 4DHJD 1ZXIA 1WM2A 4BFRA 1LQBA 5L83A 3VHTC 1V49A 1ZP0B 1AARA 4TKNA 2KTRB 3JW0X 4MT5A 1TIFA 1PQSA 2GBKA 4HKZE 2WXIA 4IWQA 5IOIA 1C4AA 3CMMB 1SJED 4JWSC 3AMZA 3NVZA 1P7EA 4GDKA 2IO2B 1SEBD 4ITKA 3Q8FA 2BS4B 2J52A 3SR6A 2KWUB 4YL8A 1WIAA 2D11A 3GZNI 3P4SB 1VRAB 3O65B 1OEYJ 3A4SC 5G55A 1E6EB 3MHZA 4I6NB 2RGFA 2ZVNA 2IZVB 1T6BX 1HZ5A 1UZXB 3PTFC 1OGWA 4ICVA 4ZHPA 5KHQA 1V9JA 1ET6A 3SEBA 2ZVOA 3TCAA 3ML8A 2GRIA 2LGDA 2ZW1A 2BS3B 4MSMB 2V4IB 1RRBA 2V3SA 3APCA 2RDHA 1HTQA 1N60A 1FCCC 1ZUD2 3IT6B 1AWDA 2FBWB 2LXAA 5AZHA 1WX8A 3T9LA 4MSQB 3AE7B 3EECA 2KC2A 2PE6B 2HD5B 1F52A 2WXQA 4E71A 5TR5A 1SE2A 2XK5B 4GN1A 3DHHC 2LFIA 1F0ZA 2KWDA 5D94A 3IAM1 4HPLB 3AEGB 5H8YE 3DBRB 4HROA 4RM9A 1N62A 1SE4A 4REZA 2XK5A 2IO1B 1K50A 2E6XA 2L8JA 1KF6B 5D3DA 2MHJA 1C4PA 3V62A 2V9HA 2INDC 1XLQA 2HE7A 2V3PA 2IJ0A 1JWSD 3PRMB 4N59A 3ZKJC 4AS1A 1JWMD 3VUWA 3HUIA 2R2OA 5CHVC 4GB9A 1QOAA 5CX3A 1GOZA 4K3CA 2KTFA 2ZCBA 1RAXA 2BT6A 3PLVA 2QCZA 5J2RA 1RLFA 1JWUD 3UF8A 2WQYB 4HXDA 2GOWA 3AE5B 3X0WA 2QHOA 1R4MB 4AJWA 3BINA 1QILA 4HVBA 3QX1A 1IPGA 5LXIB 1UWXA 4MH8A 3B9JA 4RH6A 2MBOA 1WJUA 3UGBB 2IY1B 1MPEA 1AYFA 1WWTA 4RGNA 3VVWB 1UGMA 4HPMB 2HDEA 2BWES 2BTEA 3AN1A 1OQRA 3U7ZA 3WANA 4B0EA 4TMAB 2ZJDA 2B76B 2N9PC 1YQBA 2Y3AA 2D2QA 3A1QB 4W9JA 2LD9A 4EUTA 2KDFB 2C7HA 3DWMA 4NAWB 4K7UA 4WWOA 1UGJA 4JIOU 3BIID 4BVUC 4YXDB 2CR5A 2MRPA 4US9A 4B9KA 2K3UA 4XC2A 1L2NA 1A70A 4DXGA 4NAWA 5C23A 3HVZA 3SFEB 2C7NB 4RF1A 1SSNA 1PGBA 3WIMA 4LLGM 4XGAB 2D3AA 2EKEC 4NJ6A 2HTME 1K8RB 2E3TA 2PKOA 1IUEA 3ZNGC 1H4RA 4ZRPA 2SEBD 4AUQC 2FE8A 5AUIA 1V81A 1RFKA 2KJRA 1K51A 1C79A 3NVYA 4M0WB 1ZE3D 1PDXA 2IO3B 4OZAA 3QA8A 3SU8X 3CWIA 4KX6B 1NYRA 2BQQA 4BZAA 1S3SG 1P9DU 2WDVB 1Z5SB 4W9EA 4MGIE 4M0WA 1TBEA 5L95C 4RFBA 2FCNA 3C8YA 2KLGA 2KOXA 3TJPA 1IBXB 2MEKA 3AM9A 1MFWA 2BYTA 1QOGA 1E9MA 1D5ZC 3ZGZA 2MBQA 3QC8B 3VTWA 3UI3A 3OWEB 2C9WB 2FUG1 2D07B 1KFYB 2MP2B 4LNKA 4C4VB 1BMLC 2NPTA 2KFJA 3A9KA 2NBVB 2G9HD 1ZDVA 3U8ZA 2D3GA 1XXGA 3AB5A 4LTUA 2BWFA 4HKQA 3QHTA 3A4RA 3AE2B 4F1SA 2L05A 2PJHA 2ZEQA 5BMHA 1HA5A 1P98A 4ZRQA 4G11A 4JE3B 1VJKA 4PK1A 1E8ZA 5EE0A 5J18A 1V5TA 4LNIA 4OZCA 4OVZA 3AE3B 3GP7A 2DHZA 1QOFA 3I63C 2WX0A 2LWPA 4YSXB 5EDSA 3ABVB 1IGDA 3BK1A 5GMVA 3PO0A 1WJNA 4BBNF 3B08A 3MP9A 4A3OA 5C2TB 1DYQA 1UNSA 3P1MA 1VZ6A 3IHPC 2VZKB 3RN9C 2RD0A 3AEBB 2WXGA 2GB1A 2FUHB 1R7SA 2G3QB 5IO9A 3PREA 4W9GA 4KSKC 4WQMA 3HM6X 1WYWB 1FXIA 4W9CA 2JT4B 2JYTA 4GGQA 1JRUA 4XWTA 1EF1A 1XD3B 4GMVA 3N3KB 2QIEB 2AL6A 1KRHA 2PVOD 3VR9B 1YJ1A 3DBHI 3EC8A 1IP9A 2JZZA 1PGAA 3WAMA 3L4PA 1WJ6A 3R3MA 3AXCA 4N6EB 5C3JB 1JWBD 2JZ3B 4P1CC 1F2RI 1C9FA 1JRPA 1SXTA 4NZLB 1XLPA 1GC7A 3ZRFA 3IVFA 2NBUA 3RNEC 2MA9B 5LLIA 1P0RA 2LASA 4C80A 2QC8A 2PW9A 1TTNA 2V0GA 2IGHA 1KOTA 1KLGD 1C77A 1L0VB 2UWQA 1DGJA 2JRIB 4ZOHC 3AE1B 1QOBA 1TS4A 2BB5A 2ONQA 5GXGB 4LDTB 2KDIA 1L0YB 2WP9B 3I57A 4XWWA 2IBIB 1QLBB 3U2SC 4WURA 4B0MA 3KUDB 3MTNB 4A3PA 3AULA 3HVDA 4KGRA 5LNK1 2KFKB 4A6QA 3BYTB 4EFOA 3QIJA 1JALA 2LGIA 4BBNC 3HM3A 2K6DB 3NVVA 4HJKA 1C4CA 1DOIA 1WXMA 5G5GA 3RZWC 3W1SA 2FNJB 2IY0B 2KFKA 2ZW0A 1WZ3A 1FIQA 1J8CA 1NI2A 3LYYA 3TIXA 1GNUA 4ARIA 2YVCA 2JSVX 1SGHA 1OQQA 1S1QB 1LGRA 2KX0A 4G0NB 4BKGA 1N5XA 1MI0A 4PS8A 2R61A 1NEKB 4HPPA 1UH6A 4HEA1 4HDQA 1V1PB 1EU4A 3DVNU 4C00A 3U7DA 2GMIC 1FNUA 3H7PA 1WR6E 1T0RC 2K0PA 1F1HA 1YN4A 4MDKE 3ZYYX 4FN2A 3N9YC 1J7BA 4KSLC 3PVLA 2W3SA 3ZNHB 3PZ8A 2KYWA 1VR9A 2FCQA 2REXA 2CJOA 4IC7B 1Y56A 1HTOA 4NNJB 2KACA 5J17A 2H88B 4EZJA 4LNFA 1WGHA 4FA6A 1Q5WB 1T0YA 3RCZA 1TZOA 4ASWC 1WRIA 1RWSA 3VRAB 4A20A 1GPXA 4W9DA 2C60A 4GXBA 1E7UA 1ROEA 1FM0D 3ZVVA 2M19A 2KJ6A 1Y8RC 3DCGA 1ZKHA 2LXCA 1WXVA 1TKEA 2FCMA 1TYGB 1EO6A 2BF8B 5G5HA 2LGXA 4S17A 1XF5L 5BMGA 1KLVA 4RMAA 2N7DA 1WGRA 4BKSD 1L0XB 3K9OB 4II3B 2KTRA 5D2MB 3ZQ4A 1KM7A 3O13A 1IYFA 3NJTA 3QAQA 2AWTA 4WJPA 2BS2B 2LUMA 1SIFA 4FHKA 1ZDXA 2JUOA 3M3JA 3H9DA 4N58A 3BYYB 3H6NA 4LNOA 1WM3A 5FKAC 3R66C 2MCNB 3DHGC 1YX6B 2J0MA 4FJYA 4MGKE 2AQ3B 2DNFA 2HJ1A 1WRDB 3A9JB 3DVGY 1F2RC 1PYWD 5BYSA 5E6OA 5G2NA 1TJEA 4EE2A 2NCNA 1WH3A 4ZYSA 1V6EA 3NG0A 3ZNID 5IP4D 1V80A 3X23A 2D10A 3H7SA 1QKZA 2NTTA 4CQNA 2JWUA 2NBWB 3A9JA 4BKSA 2DAFA 1C3TA 1WY8A 2CJNA 3BVMA 3ZW3A 1F9JA 1BXTA 2EELA 1HXYD 2FIFA 3NVWA 2XBBC 3VRBB 4FJZA 1WJ4A 1EU3A 4M8MA 3AEEB 3KUCB 4IDIA 5JHAA 4Q2JA 3RMKC 1XCQL 2WDRB 4RGTA 3OJ4B 5CTRC 1WGGA 2AL3A 4JQWC 2KMCA 2J0JA 2KVRA 1GB4A 2PEAA 4LK0M 3IG3A 4NY0A 2DYMA 3I3TB 1IGCA 5E6PA 2YEPB 4MGYE 1FFVA 1M94A 2LMCA 4WAFA 2LVQA 3TEXA 3PSEB 4L2YA 3KUZA 3FKYA 2L0TA 4USAA 3PHXB 4L1BA 5JHBA 4DHZB 4OHJA 3KVFB 1YMHE 2K6QA 2KDMA 2WXKA 4MELA 1E8XA 2MJDA 3P4PB 3ZIMA 1NBFC 3UIOB 1FO4A 1L4ZB 1WXAA 2WDTB 4XE0A 2DAJA 2BKFA 1TS3A 2IGGA 2W55A 4NAMA 4W9HA 5EE1A 1YQ4B 3UINB 4EOYA 3PV1A 4DDGD 3J9CA 3Q3OC
chains in the Genus database with same CATH topology
1FXTB 1E8YA 4W9FA 4WWPA 1GG3A 4JLCA 2C9WB 4WWNA 2MP2B 2D07B 2KHWB 1EUVB 2O6VD 4WAAA 3DOWA 2NPTA 2KFJA 3A9KA 3PRPB 1WZ0A 2DX5B 2NBVB 3BY4B 4KDLB 4II2B 3EFUA 3VTUA 4I6PA 3T8MA 4GDLB 5JZEB 3S2AA 3U8ZA 3ZNZB 2D3GA 3VXWA 1E8WA 2J0KA 3KYCD 4HLEA 3DDCB 2BWFA 2CHZA 3L08A 3QHTA 3A4RA 3ECIA 3RUIB 2VRRB 2HJ8A 4G3XB 2ZPYA 4F1SA 2L05A 1BT0A 2PJHA 2ZEQA 2JWZA 4RM8A 2KD0A 1P98A 4CO7A 2K8BA 4G11A 3QARA 4JGHB 2KX3A 1ISNA 2K8HA 2G4SA 2ZCCA 3JVZX 1E8ZA 3KYDD 4GDLA 2JVCA 4M8NA 4DHJB 5HKHA 1P3QU 3PLUA 1V5TA 3OAWA 5J18A 2KDEB 2LVPA 2LUEA 3ZTCA 2CHXA 2OOBB 4CHKA 2DHZA 3EHVA 1D3ZA 1GUAB 2K8CA 2WX0A 3ALBA 3GOEA 2XEWA 2LWPA 2JXXA 5EDSA 1E90A 2EMSA 4AOFA 4AJYB 3QQ8B 5GMVA 2LRWA 1WJNA 4BBNF 2BKRB 3B08A 3A1QA 2CHWA 3P2BA 4JL9A 1MG8A 4BKTA 4A3OA 2DZMA 1VD2A 4IM2A 3UQBA 2KJHB 3H7PB 4IWPA 3VQIA 4IM0A 3IHPC 2RSUA 3VH4B 2CS4A 2RD0A 4MH0E 5IAAC 4KZ0A 5C1ZA 3CSFA 2FUHB 4IG7B 4PYUA 2ZNVC 2G3QB 3APDA 3CF6E 4TUUA 1I42A 3PREA 4W9GA 1L7YA 4KSKC 3DBSA 2O6VA 1V5OA 2WWZA 2KN5A 3HM6X 3OLMD 3U30A 1UELA 1WYWB 4W9CA 2JT4B 4PS3A 4GGQA 3WA0A 4URKA 3L17A 3HIZA 1JRUA 3QWZB 2KXJA 2NVUI 4GIVA 1EF1A 1XD3B 4ZDVA 2A5UA 2G4DB 4GMVA 2Y5BB 3N3KB 4BOSC 3WALA 4K7WA 1ZGUB 2AL6A 1YJ1A 4FADA 3DQVA 3DBHI 4DWFA 2KQSA 3EC8A 2M1MA 4W9LA 5DCNA 1IP9A 2MW5A 2JZZA 4WJOA 2LZ6A 3AU4A 3WAMA 1WE7A 4HDOA 4K81A 1U4AA 2MX2A 2OJRA 2KMAA 4K7SA 1WJ6A 3R3MA 2ZPNA 3AXCA 2N4FA 3NZSA 3ZO5B 2JZ3B 2YLMA 4KIKB 2KDBA 3N32A 4EKUA 3AI5A 1WF9A 1SE9A 2IYDB 4PS7A 2PE9A 3VH3B 4DBGA 2HTHA 1GC7A 2KKCA 2WX1A 4FHJA 4IWOA 1UBIA 4WJNA 3SDLC 3ZRFA 3NY5A 3IVFA 3UIPB 2V1YA 1G6JA 2NBUA 1XT9B 2UYZB 2MA9B 4ANUA 4ANXA 5LLIA 2KQ7A 2Z59B 1P0RA 4KVGB 2LASA 3ZTDA 4DHJD 4KIKA 1WFYA 5LXHA 3B0AA 1TTNA 3NOBA 1KOTA 5BO4B 1WM2A 3SHQA 2UWQA 4BFRA 1LQBA 5L83A 3VHTC 2I1JA 2JRIB 1V49A 1LM8B 4HWIB 1AARA 4TKNA 3R7QA 2KTRB 3L16A 1OEYA 3R7RA 3DPDA 3JW0X 5KHOA 4NQLB 1PQSA 2GBKA 3ZDTA 4IWQA 1V2YA 2KDIA 3AU5A 4LDTB 2NR2A 3CMMB 4W9KA 2IBIB 2WYQA 2KNBA 1Q1OA 3KUDB 3MTNB 4A3PA 2DZJA 4GDKA 3AULA 2IO2B 2ZNVB 2MWSB 3DBLI 4IUMB 4WQOB 2A4ZA 4NPNA 2BYFA 3Q3FA 1WMHB 3APFA 2ZZPB 5E6NA 2IO0B 2KFKB 1Z2MA 2MP2A 4EFOA 3QIJA 4NQKE 3WAPA 3KW5B 4BBNC 3HM3A 1WXSA 2K6DB 4HJKA 2GBNA 5D6JB 2KWUB 4YL8A 1WXMA 4TQ0A 1WIAA 3B1LX 2D11A 3GZNI 5DPRA 3RZWC 1GC6A 2KC1A 2FNJB 3W1SA 2EMTA 2IY0B 4GOCA 5CHWA 3O65B 3WAOA 4B6WA 1OEYJ 1WMHA 3A4SC 5G55A 2KFKA 2L0FA 1R4NI 3PPAA 4HK2A 2LGYA 1WZ3A 1OTRB 1J8CA 1NI2A 4I6NB 4XX5A 2RGFA 2ZVNA 1UD7A 4J6IA 2IZVB 1J19A 2MBHA 4E3CA 2CU1A 3MJWA 3JYUA 3TIXA 1GNUA 2MLBA 4ANVA 1UZXB 4MGZE 4AP4C 2YVCA 3PTFC 3VAWA 1OGWA 1NDDA 4ICVA 1SGHA 1WE6A 2N7EA 5KHQA 1V9JA 5AZFA 1S1QB 2KLCA 2ZVOA 3W1YA 2KX0A 4G0NB 2L00B 5CHFA 3RULA 3TCAA 3ML8A 2KANA 4BKGA 2LGDA 3IBEA 2V4LA 4MSMB 4PS8A 4DDID 1YX5B 4OVVA 2KWVB 1RRBA 1UH6A 4HDQA 5IA7A 2V3SA 2DZKA 3DVNU 3U7DA 2GMIC 4ZRKA 4OVUA 3APCA 1WR6E 3H7PA 2BYVE 2R2QA 4MDKE 3PZDA 2MQJA 2LXAA 3D32A 4TV3A 2JRHA 4FN2A 1LFDA 1WX8A 4KV2A 5AZHA 4MSQB 3T9LA 5AEKB 1YD8U 3EECA 4KSLC 1J0GA 2BPSA 3ENEA 2KC2A 3DVGX 3W1SC 2PE6B 3PVLA 2HD5B 2B3AA 3ZNHB 4E71A 3DBRI 1XQQA 5TR5A 2FCSA 2XK5B 4GN1A 3VTVA 2FCQA 3NHEB 2REXA 4IC7B 4ZYNA 4NNJB 4LDTD 5J17A 4DK5A 2RR9A 3PHWB 2J7QB 5D94A 2L3ZA 4EEWA 1WI0A 4EZJA 3L0WB 4HPLB 1WGHA 4FA6A 1TZ1A 3L54A 1Q5WB 4W9IA 1T0YA 3RCZA 3ML9A 3KH0A 5DPTA 2LVOA 4I6LB 4RM9A 4ASWC 2AYOB 3VFKA 2XK5A 3RYTA 2KWCA 1LXDA 3PS6A 4DXAB 2IO1B 3OJ3A 4CYEA 4MEMA 1WGYA 3VDZA 1ZW7A 2L8JA 4A20A 4B95A 3VUXA 4W9DA 3Q3JA 2KO3A 2C60A 4IW0A 4MM3A 2FAZA 3V62A 2RPQA 4GXBA 1E7UA 4N9F4 3RZFA 3NZUA 2HE7A 3L10B 2MSED 4WJQA 3ZVVA 4LJOB 3PRMB 2Z0DB 2KJ6A 1Y8RC 4ICUA 3ZKJC 3TMPB 1YIWA 3DCGA 3H1UA 4TQ1A 1OQYA 4X57B 1GJZA 1ZKHA 2LXCA 3VUWA 1WXVA 2FCMA 4DHZE 2C5LC 2KK8A 1I35A 4IM3A 3V6CB 4EZKA 2R2OA 5CHVC 1EO6A 2CKHB 2BF8B 1TGZB 4GB9A 2LGXA 1R4MI 5CX3A 1EF5A 2ASQA 1HE8A 2KTFA 2ZCBA 1RAXA 1H8CA 3SD5A 1KLVA 3PLVA 4RMAA 3TBLD 2N7DA 1WGRA 5J2RA 1RLFA 4BKSD 2NPTB 3UF8A 3PT2B 3A9KB 4HXDA 2L76A 3K9OB 4II3B 2GOWA 2KTRA 2QHOA 4LCDE 2LJ5A 3X0WA 4AJWA 5D2MB 3ONSA 1UBQA 3BINA 3NS8A 1KM7A 4HVBA 4FJVB 2N1VA 3QX1A 1IPGA 1IYFA 3QAQA 2AWTA 3M95A 4WJPA 5LXIB 1QZEA 1WX7A 4LJPB 1SIFA 2DYBA 4FBJB 2MBOA 1WJUA 4FHKA 2JUOA 3UGBB 1CMXB 2IY1B 3M3JA 3LJ3A 3H9DA 4EZLA 3QCAA 5JH5C 5DPSA 2W9NA 3VVWB 3DVNV 3H6NA 2PPHA 1UGMA 4F8CB 2JPHA 4HPMB 1WM3A 2L7RA 3LDZE 3R66C 2LRUA 2M4NA 2MCNB 1WR1A 4FLHA 1A5RA 2BWES 1YX6B 2DYOA 3RT3B 2J0MA 4FJYA 1C1YB 3WANA 2N1WA 2ZJDA 2N9PC 3M63B 4MGKE 1YQBA 3V6EB 3PRZA 1WRDB 2D2QA 3A1QB 4W9JA 2LD9A 2M8SA 4EUTA 2KDFB 3A9JB 2C7HA 3DVGY 4NAWB 4K7UA 4HCNB 4WWOA 2BGFA 5E6OA 2G45B 4JIOU 5G2NA 3TL5A 4BVUC 2NCNA 2CR5A 2MRPA 1WH3A 1WGDA 2GBRA 4B9KA 4XC2A 1V6EA 5DPWA 3ZNID 3IFWB 1V80A 4K1RB 4NJ7A 1L2NA 3X23A 2D10A 1P1AA 3ZDMC 3H7SA 5AZGA 2O6VB 2NBWB 3A9JA 3QK0A 4BKSA 2DAFA 3V61A 4NAWA 5FR6A 1WX9A 5C23A 1C3TA 3L13A 1WY8A 3RD2A 2C7NB 3ZW3A 3N30A 1F9JA 4F7ZA 1X1MA 4GSWA 2Z0EB 4ZRJA 2JY6A 1E5WA 4XZ4A 3WIMA 2EKEC 2FIFA 4NJ6A 2XBBC 1K8RB 2O2VB 4FJZA 3HHMA 1WJ4A 3ZNGC 2AEHA 4M8MA 1H4RA 4AWJA 2DZIA 3KUCB 3HK0A 4G50A 2FIDA 5JHAA 4AUQC 3QJZA 1V81A 3M62B 3VUYA 2KJRA 3OJ4B 5CTRC 1VCBA 2NS5A 2M17A 2KZRA 1WGGA 2AL3A 2DENB 4JQWC 3ZLZA 3JSVB 3ZUNA 4M0WB 2IO3B 4MJSB 2KMCA 2I1KA 2J0JA 2KVRA 2O2VA 4KDIC 3QA8A 2PEAA 3SU8X 4BOZB 1KJTA 3IG3A 2DYMA 3I3TB 4NY0A 3UQAA 1RFAA 4FULA 4HCPB 3K9PB 4P7IA 1S3SG 5E6PA 1P9DU 2M0XA 1Z5SB 4MGYE 2K39A 4W9EA 1M94A 2JF5A 2LVQA 4MGIE 3JSVA 3ZRCA 3CSTA 3PSEB 4MJSA 1TBEA 4E74A 5D7GA 5L95C 3KUZA 1E7VA 2FCNA 2MBBB 2L0TA 3PHXB 3A33B 2KLGA 5JHBA 2KOXA 3TJPA 4PYZA 4GU2A 4DHZB 3MHSD 1Q0WB 2MBEA 3KVFB 4ANWA 2K6QA 2K25A 3C0RB 4MELA 1E8XA 3ZIMA 1NBFC 2BYEA 4ZRIA 3V60A 3UIOB 1V86A 1WXAA 2WDTB 2GBMA 2DAJA 2BKFA 2N9XA 4KZCA 2K1FA 2N9EB 2C7MB 3PGEA 2MBQA 3QC8B 4W9HA 4GDKB 2LI5A 3UINB 2GBJA 4EOYA 3PV1A 4DDGD 3VTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXT B;  1E8Y A;  4W9F A;  4WWP A;  1GG3 A;  4JLC A;  2C9W B;  4WWN A;  2MP2 B;  2D07 B;  2KHW B;  1EUV B;  2O6V D;  4WAA A;  3DOW A;  2NPT A;  2KFJ A;  3A9K A;  3PRP B;  1WZ0 A;  2DX5 B;  2NBV B;  3BY4 B;  4KDL B;  4II2 B;  3EFU A;  3VTU A;  4I6P A;  3T8M A;  4GDL B;  5JZE B;  3S2A A;  3U8Z A;  3ZNZ B;  2D3G A;  3VXW A;  1E8W A;  2J0K A;  3KYC D;  4HLE A;  3DDC B;  2BWF A;  2CHZ A;  3L08 A;  3QHT A;  3A4R A;  3ECI A;  3RUI B;  2VRR B;  2HJ8 A;  4G3X B;  2ZPY A;  4F1S A;  2L05 A;  1BT0 A;  2PJH A;  2ZEQ A;  2JWZ A;  4RM8 A;  2KD0 A;  1P98 A;  4CO7 A;  2K8B A;  4G11 A;  3QAR A;  4JGH B;  2KX3 A;  1ISN A;  2K8H A;  2G4S A;  2ZCC A;  3JVZ X;  1E8Z A;  3KYD D;  4GDL A;  2JVC A;  4M8N A;  4DHJ B;  5HKH A;  1P3Q U;  3PLU A;  1V5T A;  3OAW A;  5J18 A;  2KDE B;  2LVP A;  2LUE A;  3ZTC A;  2CHX A;  2OOB B;  4CHK A;  2DHZ A;  3EHV A;  1D3Z A;  1GUA B;  2K8C A;  2WX0 A;  3ALB A;  3GOE A;  2XEW A;  2LWP A;  2JXX A;  5EDS A;  1E90 A;  2EMS A;  4AOF A;  4AJY B;  3QQ8 B;  5GMV A;  2LRW A;  1WJN A;  4BBN F;  2BKR B;  3B08 A;  3A1Q A;  2CHW A;  3P2B A;  4JL9 A;  1MG8 A;  4BKT A;  4A3O A;  2DZM A;  1VD2 A;  4IM2 A;  3UQB A;  2KJH B;  3H7P B;  4IWP A;  3VQI A;  4IM0 A;  3IHP C;  2RSU A;  3VH4 B;  2CS4 A;  2RD0 A;  4MH0 E;  5IAA C;  4KZ0 A;  5C1Z A;  3CSF A;  2FUH B;  4IG7 B;  4PYU A;  2ZNV C;  2G3Q B;  3APD A;  3CF6 E;  4TUU A;  1I42 A;  3PRE A;  4W9G A;  1L7Y A;  4KSK C;  3DBS A;  2O6V A;  1V5O A;  2WWZ A;  2KN5 A;  3HM6 X;  3OLM D;  3U30 A;  1UEL A;  1WYW B;  4W9C A;  2JT4 B;  4PS3 A;  4GGQ A;  3WA0 A;  4URK A;  3L17 A;  3HIZ A;  1JRU A;  3QWZ B;  2KXJ A;  2NVU I;  4GIV A;  1EF1 A;  1XD3 B;  4ZDV A;  2A5U A;  2G4D B;  4GMV A;  2Y5B B;  3N3K B;  4BOS C;  3WAL A;  4K7W A;  1ZGU B;  2AL6 A;  1YJ1 A;  4FAD A;  3DQV A;  3DBH I;  4DWF A;  2KQS A;  3EC8 A;  2M1M A;  4W9L A;  5DCN A;  1IP9 A;  2MW5 A;  2JZZ A;  4WJO A;  2LZ6 A;  3AU4 A;  3WAM A;  1WE7 A;  4HDO A;  4K81 A;  1U4A A;  2MX2 A;  2OJR A;  2KMA A;  4K7S A;  1WJ6 A;  3R3M A;  2ZPN A;  3AXC A;  2N4F A;  3NZS A;  3ZO5 B;  2JZ3 B;  2YLM A;  4KIK B;  2KDB A;  3N32 A;  4EKU A;  3AI5 A;  1WF9 A;  1SE9 A;  2IYD B;  4PS7 A;  2PE9 A;  3VH3 B;  4DBG A;  2HTH A;  1GC7 A;  2KKC A;  2WX1 A;  4FHJ A;  4IWO A;  1UBI A;  4WJN A;  3SDL C;  3ZRF A;  3NY5 A;  3IVF A;  3UIP B;  2V1Y A;  1G6J A;  2NBU A;  1XT9 B;  2UYZ B;  2MA9 B;  4ANU A;  4ANX A;  5LLI A;  2KQ7 A;  2Z59 B;  1P0R A;  4KVG B;  2LAS A;  3ZTD A;  4DHJ D;  4KIK A;  1WFY A;  5LXH A;  3B0A A;  1TTN A;  3NOB A;  1KOT A;  5BO4 B;  1WM2 A;  3SHQ A;  2UWQ A;  4BFR A;  1LQB A;  5L83 A;  3VHT C;  2I1J A;  2JRI B;  1V49 A;  1LM8 B;  4HWI B;  1AAR A;  4TKN A;  3R7Q A;  2KTR B;  3L16 A;  1OEY A;  3R7R A;  3DPD A;  3JW0 X;  5KHO A;  4NQL B;  1PQS A;  2GBK A;  3ZDT A;  4IWQ A;  1V2Y A;  2KDI A;  3AU5 A;  4LDT B;  2NR2 A;  3CMM B;  4W9K A;  2IBI B;  2WYQ A;  2KNB A;  1Q1O A;  3KUD B;  3MTN B;  4A3P A;  2DZJ A;  4GDK A;  3AUL A;  2IO2 B;  2ZNV B;  2MWS B;  3DBL I;  4IUM B;  4WQO B;  2A4Z A;  4NPN A;  2BYF A;  3Q3F A;  1WMH B;  3APF A;  2ZZP B;  5E6N A;  2IO0 B;  2KFK B;  1Z2M A;  2MP2 A;  4EFO A;  3QIJ A;  4NQK E;  3WAP A;  3KW5 B;  4BBN C;  3HM3 A;  1WXS A;  2K6D B;  4HJK A;  2GBN A;  5D6J B;  2KWU B;  4YL8 A;  1WXM A;  4TQ0 A;  1WIA A;  3B1L X;  2D11 A;  3GZN I;  5DPR A;  3RZW C;  1GC6 A;  2KC1 A;  2FNJ B;  3W1S A;  2EMT A;  2IY0 B;  4GOC A;  5CHW A;  3O65 B;  3WAO A;  4B6W A;  1OEY J;  1WMH A;  3A4S C;  5G55 A;  2KFK A;  2L0F A;  1R4N I;  3PPA A;  4HK2 A;  2LGY A;  1WZ3 A;  1OTR B;  1J8C A;  1NI2 A;  4I6N B;  4XX5 A;  2RGF A;  2ZVN A;  1UD7 A;  4J6I A;  2IZV B;  1J19 A;  2MBH A;  4E3C A;  2CU1 A;  3MJW A;  3JYU A;  3TIX A;  1GNU A;  2MLB A;  4ANV A;  1UZX B;  4MGZ E;  4AP4 C;  2YVC A;  3PTF C;  3VAW A;  1OGW A;  1NDD A;  4ICV A;  1SGH A;  1WE6 A;  2N7E A;  5KHQ A;  1V9J A;  5AZF A;  1S1Q B;  2KLC A;  2ZVO A;  3W1Y A;  2KX0 A;  4G0N B;  2L00 B;  5CHF A;  3RUL A;  3TCA A;  3ML8 A;  2KAN A;  4BKG A;  2LGD A;  3IBE A;  2V4L A;  4MSM B;  4PS8 A;  4DDI D;  1YX5 B;  4OVV A;  2KWV B;  1RRB A;  1UH6 A;  4HDQ A;  5IA7 A;  2V3S A;  2DZK A;  3DVN U;  3U7D A;  2GMI C;  4ZRK A;  4OVU A;  3APC A;  1WR6 E;  3H7P A;  2BYV E;  2R2Q A;  4MDK E;  3PZD A;  2MQJ A;  2LXA A;  3D32 A;  4TV3 A;  2JRH A;  4FN2 A;  1LFD A;  1WX8 A;  4KV2 A;  5AZH A;  4MSQ B;  3T9L A;  5AEK B;  1YD8 U;  3EEC A;  4KSL C;  1J0G A;  2BPS A;  3ENE A;  2KC2 A;  3DVG X;  3W1S C;  2PE6 B;  3PVL A;  2HD5 B;  2B3A A;  3ZNH B;  4E71 A;  3DBR I;  1XQQ A;  5TR5 A;  2FCS A;  2XK5 B;  4GN1 A;  3VTV A;  2FCQ A;  3NHE B;  2REX A;  4IC7 B;  4ZYN A;  4NNJ B;  4LDT D;  5J17 A;  4DK5 A;  2RR9 A;  3PHW B;  2J7Q B;  5D94 A;  2L3Z A;  4EEW A;  1WI0 A;  4EZJ A;  3L0W B;  4HPL B;  1WGH A;  4FA6 A;  1TZ1 A;  3L54 A;  1Q5W B;  4W9I A;  1T0Y A;  3RCZ A;  3ML9 A;  3KH0 A;  5DPT A;  2LVO A;  4I6L B;  4RM9 A;  4ASW C;  2AYO B;  3VFK A;  2XK5 A;  3RYT A;  2KWC A;  1LXD A;  3PS6 A;  4DXA B;  2IO1 B;  3OJ3 A;  4CYE A;  4MEM A;  1WGY A;  3VDZ A;  1ZW7 A;  2L8J A;  4A20 A;  4B95 A;  3VUX A;  4W9D A;  3Q3J A;  2KO3 A;  2C60 A;  4IW0 A;  4MM3 A;  2FAZ A;  3V62 A;  2RPQ A;  4GXB A;  1E7U A;  4N9F 4;  3RZF A;  3NZU A;  2HE7 A;  3L10 B;  2MSE D;  4WJQ A;  3ZVV A;  4LJO B;  3PRM B;  2Z0D B;  2KJ6 A;  1Y8R C;  4ICU A;  3ZKJ C;  3TMP B;  1YIW A;  3DCG A;  3H1U A;  4TQ1 A;  1OQY A;  4X57 B;  1GJZ A;  1ZKH A;  2LXC A;  3VUW A;  1WXV A;  2FCM A;  4DHZ E;  2C5L C;  2KK8 A;  1I35 A;  4IM3 A;  3V6C B;  4EZK A;  2R2O A;  5CHV C;  1EO6 A;  2CKH B;  2BF8 B;  1TGZ B;  4GB9 A;  2LGX A;  1R4M I;  5CX3 A;  1EF5 A;  2ASQ A;  1HE8 A;  2KTF A;  2ZCB A;  1RAX A;  1H8C A;  3SD5 A;  1KLV A;  3PLV A;  4RMA A;  3TBL D;  2N7D A;  1WGR A;  5J2R A;  1RLF A;  4BKS D;  2NPT B;  3UF8 A;  3PT2 B;  3A9K B;  4HXD A;  2L76 A;  3K9O B;  4II3 B;  2GOW A;  2KTR A;  2QHO A;  4LCD E;  2LJ5 A;  3X0W A;  4AJW A;  5D2M B;  3ONS A;  1UBQ A;  3BIN A;  3NS8 A;  1KM7 A;  4HVB A;  4FJV B;  2N1V A;  3QX1 A;  1IPG A;  1IYF A;  3QAQ A;  2AWT A;  3M95 A;  4WJP A;  5LXI B;  1QZE A;  1WX7 A;  4LJP B;  1SIF A;  2DYB A;  4FBJ B;  2MBO A;  1WJU A;  4FHK A;  2JUO A;  3UGB B;  1CMX B;  2IY1 B;  3M3J A;  3LJ3 A;  3H9D A;  4EZL A;  3QCA A;  5JH5 C;  5DPS A;  2W9N A;  3VVW B;  3DVN V;  3H6N A;  2PPH A;  1UGM A;  4F8C B;  2JPH A;  4HPM B;  1WM3 A;  2L7R A;  3LDZ E;  3R66 C;  2LRU A;  2M4N A;  2MCN B;  1WR1 A;  4FLH A;  1A5R A;  2BWE S;  1YX6 B;  2DYO A;  3RT3 B;  2J0M A;  4FJY A;  1C1Y B;  3WAN A;  2N1W A;  2ZJD A;  2N9P C;  3M63 B;  4MGK E;  1YQB A;  3V6E B;  3PRZ A;  1WRD B;  2D2Q A;  3A1Q B;  4W9J A;  2LD9 A;  2M8S A;  4EUT A;  2KDF B;  3A9J B;  2C7H A;  3DVG Y;  4NAW B;  4K7U A;  4HCN B;  4WWO A;  2BGF A;  5E6O A;  2G45 B;  4JIO U;  5G2N A;  3TL5 A;  4BVU C;  2NCN A;  2CR5 A;  2MRP A;  1WH3 A;  1WGD A;  2GBR A;  4B9K A;  4XC2 A;  1V6E A;  5DPW A;  3ZNI D;  3IFW B;  1V80 A;  4K1R B;  4NJ7 A;  1L2N A;  3X23 A;  2D10 A;  1P1A A;  3ZDM C;  3H7S A;  5AZG A;  2O6V B;  2NBW B;  3A9J A;  3QK0 A;  4BKS A;  2DAF A;  3V61 A;  4NAW A;  5FR6 A;  1WX9 A;  5C23 A;  1C3T A;  3L13 A;  1WY8 A;  3RD2 A;  2C7N B;  3ZW3 A;  3N30 A;  1F9J A;  4F7Z A;  1X1M A;  4GSW A;  2Z0E B;  4ZRJ A;  2JY6 A;  1E5W A;  4XZ4 A;  3WIM A;  2EKE C;  2FIF A;  4NJ6 A;  2XBB C;  1K8R B;  2O2V B;  4FJZ A;  3HHM A;  1WJ4 A;  3ZNG C;  2AEH A;  4M8M A;  1H4R A;  4AWJ A;  2DZI A;  3KUC B;  3HK0 A;  4G50 A;  2FID A;  5JHA A;  4AUQ C;  3QJZ A;  1V81 A;  3M62 B;  3VUY A;  2KJR A;  3OJ4 B;  5CTR C;  1VCB A;  2NS5 A;  2M17 A;  2KZR A;  1WGG A;  2AL3 A;  2DEN B;  4JQW C;  3ZLZ A;  3JSV B;  3ZUN A;  4M0W B;  2IO3 B;  4MJS B;  2KMC A;  2I1K A;  2J0J A;  2KVR A;  2O2V A;  4KDI C;  3QA8 A;  2PEA A;  3SU8 X;  4BOZ B;  1KJT A;  3IG3 A;  2DYM A;  3I3T B;  4NY0 A;  3UQA A;  1RFA A;  4FUL A;  4HCP B;  3K9P B;  4P7I A;  1S3S G;  5E6P A;  1P9D U;  2M0X A;  1Z5S B;  4MGY E;  2K39 A;  4W9E A;  1M94 A;  2JF5 A;  2LVQ A;  4MGI E;  3JSV A;  3ZRC A;  3CST A;  3PSE B;  4MJS A;  1TBE A;  4E74 A;  5D7G A;  5L95 C;  3KUZ A;  1E7V A;  2FCN A;  2MBB B;  2L0T A;  3PHX B;  3A33 B;  2KLG A;  5JHB A;  2KOX A;  3TJP A;  4PYZ A;  4GU2 A;  4DHZ B;  3MHS D;  1Q0W B;  2MBE A;  3KVF B;  4ANW A;  2K6Q A;  2K25 A;  3C0R B;  4MEL A;  1E8X A;  3ZIM A;  1NBF C;  2BYE A;  4ZRI A;  3V60 A;  3UIO B;  1V86 A;  1WXA A;  2WDT B;  2GBM A;  2DAJ A;  2BKF A;  2N9X A;  4KZC A;  2K1F A;  2N9E B;  2C7M B;  3PGE A;  2MBQ A;  3QC8 B;  4W9H A;  4GDK B;  2LI5 A;  3UIN B;  2GBJ A;  4EOY A;  3PV1 A;  4DDG D;  3VTW A; 
#chains in the Genus database with same CATH topology
 1FXT B;  2LHE A;  4WWP A;  4JLC A;  4JX1 C;  1L5P A;  3NZ3 A;  4WAA A;  1EUV B;  1TY2 A;  2KMM A;  1EWY C;  2PIA A;  5HHD G;  3MFG A;  2DX5 B;  2DWQ A;  4I6P A;  2KVZ A;  3S2A A;  1TS2 A;  3GE3 C;  2D3C A;  1E8W A;  2J0K A;  3VXW A;  1ENF A;  1E7P B;  2VRR B;  2ZPY A;  2JWZ A;  4A90 A;  4H2A A;  4P16 A;  2Q5W D;  3QAR A;  2KX3 A;  1ISN A;  3JVZ X;  2KT7 A;  2JVC A;  4M8N A;  3GB1 A;  3P4R B;  3PLU A;  3ZTC A;  2OOB B;  2XEW A;  1UWM A;  2JXX A;  2BKR B;  2J42 A;  1EWC A;  3A1Q A;  2CHW A;  3BVG A;  3KLS X;  3EA6 A;  3KWL A;  1VD2 A;  3UQB A;  2RMM A;  1XO3 A;  1Q10 A;  4MH0 E;  4R3D A;  2ZNV C;  3CF6 E;  2MJE A;  1L7Y A;  3R2T A;  1V5O A;  2WWZ A;  1F77 A;  3ZXR A;  2KN5 A;  2BVC A;  1D5X C;  4PS3 A;  4URK A;  3HIZ A;  2KXJ A;  4GIV A;  5EE3 A;  2Y5B B;  3B2G A;  4FAD A;  2LHD A;  1T5X D;  2UU7 A;  2MW5 A;  4WJO A;  1WE7 A;  4K81 A;  4A9A A;  5IKC M;  2KMA A;  3Q6B A;  4PT5 A;  2ZPN A;  2N4F A;  3ZO5 B;  1YJJ A;  4KIK B;  1FNV A;  4C56 C;  2KDB A;  3N32 A;  4PS7 A;  2WX1 A;  4WJN A;  2INC C;  3UIP B;  2WXN A;  1XT9 B;  2UYZ B;  3MC9 A;  2KQ7 A;  3ZTD A;  4KIK A;  5LXH A;  5JXV A;  3NOB A;  5E6J A;  3SHQ A;  3NRZ A;  1IBX A;  4HWI B;  2PVG C;  3R7R A;  3IXS A;  4NQL B;  1V2Y A;  2IGD A;  2NR2 A;  1J7C A;  2WYQ A;  2KNB A;  1Q1O A;  5TSS A;  2VZK D;  2DZJ A;  3Q8B A;  2ZNV B;  1E10 A;  3DBL I;  2A4Z A;  4NPN A;  3Q3F A;  1DOY A;  2MP2 A;  1Z2M A;  4P6V F;  2EKI A;  4NQK E;  3WAP A;  4C4V A;  1JCK B;  4WWM A;  2GBN A;  5D6J B;  4YSZ B;  1ACC A;  2QMT A;  1TY0 A;  3AE6 B;  4ARC A;  4DXF A;  2KC1 A;  2VH2 A;  2EMT A;  1HQR D;  4GOC A;  5CHW A;  3WAO A;  2WHI A;  2N9K A;  4JPS A;  2L0F A;  1D4B A;  2LEK A;  3PPA A;  4HK2 A;  2LGY A;  1OTR B;  4HRS A;  3B2F A;  2ICI A;  2WS3 B;  3GZN B;  3ZXV A;  5HFY A;  3MJW A;  3EFC A;  2MLB A;  3TSS A;  4RF0 A;  2AX5 A;  2WXR A;  4AP4 C;  1WE6 A;  2KQ4 X;  2BBC A;  3V05 A;  2KLC A;  3TEY A;  2L00 B;  2JZP A;  2W82 A;  2LJI A;  1YX5 B;  2KWV B;  3U4E G;  2DBY A;  5IA7 A;  4LNN A;  5I4D A;  4OVU A;  2BYV E;  2R2Q A;  5BYR A;  3PZD A;  2MQJ A;  3D32 A;  3Q8C A;  4KV2 A;  2QJL A;  1YD8 U;  1MHX A;  2BPS A;  3ENE A;  3W1S C;  2QEJ C;  2AQ1 B;  2IPK D;  2B3A A;  3DBR I;  1XQQ A;  3AE8 B;  4ZYN A;  4LDT D;  3VR8 B;  4DK5 A;  2RR9 A;  2J7Q B;  2L3Z A;  4EEW A;  3L0W B;  3RNG C;  3L54 A;  3MC8 A;  4W9I A;  3ML9 A;  3FC4 A;  3KH0 A;  5DPT A;  2K9X A;  2AYO B;  3VFK A;  3RYT A;  2KWC A;  3PS6 A;  4DXA B;  3OJ3 A;  2PMV A;  1SBB B;  5BMI A;  4MEM A;  1WGY A;  3VDZ A;  3LB8 C;  4B95 A;  2KO3 A;  2RPQ A;  3RZF A;  3NZU A;  3V3X A;  3L10 B;  4WJQ A;  3P42 A;  2D5G A;  3AEA B;  3TMP B;  3H1U A;  4TQ1 A;  1CQV A;  1OQY A;  2J53 A;  4X57 B;  3DHI C;  2C5L C;  1M4V A;  3V6C B;  4YTM B;  4EZK A;  1E0Z A;  2CKH B;  1R4M I;  2ASQ A;  2WXJ A;  2G1E A;  3SD5 A;  1GB1 A;  3TBL D;  1VZ7 A;  1DOX A;  1D6E C;  2L76 A;  4LCD E;  2GLS A;  3ONS A;  1N63 A;  4FJV B;  2N1V A;  1T0Q C;  3M95 A;  3WCQ A;  4LJP B;  1FEH A;  2X38 A;  2MJ3 A;  1I4R A;  4FBJ B;  4EZL A;  1CMX B;  3LJ3 A;  1CJE A;  3QCA A;  5DPS A;  3DVN V;  2PPH A;  2JPH A;  2L7R A;  1XLO A;  2LRU A;  1A5R A;  2OHF A;  3RI7 C;  2DYO A;  3W5U B;  3RT3 B;  3IT4 B;  3Q8E A;  3RNF C;  3V6E B;  2LGS A;  3PRZ A;  4HCN B;  2BGF A;  2RDB C;  3RNB C;  4NJ7 A;  4K1R B;  4UDU C;  1P1A A;  1C76 A;  1TT5 B;  2O6V B;  2WLB A;  4S0R A;  3V61 A;  1WX9 A;  2D3B A;  2WXL A;  3RD2 A;  3N30 A;  5T8I A;  2Z0E B;  4ZRJ A;  2JY6 A;  2X8X X;  4XZ4 A;  1V1P A;  3Q8A A;  2DLB A;  2O2V B;  3HHM A;  2AEH A;  3HRD D;  3KWV A;  4G50 A;  1TS5 A;  3QJZ A;  3BWU D;  2Z8L A;  3VUY A;  1VCB A;  2NS5 A;  2M17 A;  2KZR A;  2DEN B;  1ESF A;  3ZLZ A;  3ZUN A;  1QT9 A;  4KDI C;  2I1K A;  2O2V A;  4KKI A;  2OED A;  1KJT A;  3UQA A;  3URY A;  4HCP B;  4TSS A;  2QSD A;  2M0X A;  3BK2 A;  1T3Q A;  2K22 A;  1FFU A;  1ZOY B;  1YNT E;  4E74 A;  5D7G A;  3PZ7 A;  3Q69 A;  1PFD A;  1XEE A;  3A33 B;  5HG2 A;  2INN E;  4A55 A;  4GU2 A;  3W2D A;  1Q0W B;  4ANW A;  2K25 A;  3AH7 A;  3IAS 1;  2BYE A;  4ZRI A;  5AUK A;  2BB6 A;  2N9X A;  3MC0 B;  3PGE A;  4GDK B;  2INP E;  1E8Y A;  4W9F A;  1UUP A;  1L4D B;  2KHW B;  4JWU C;  2WU5 B;  1SIJ A;  3PRP B;  1WZ0 A;  4KDL B;  3BY4 B;  3EFU A;  1FD6 A;  4GDL B;  5JZE B;  1CK1 A;  3LXF A;  3ZNZ B;  2I2Y A;  1XCT L;  3KYC D;  1UF0 A;  2K5P A;  5D3I B;  1SE3 A;  1YJI A;  3ECI A;  2HJ8 A;  4G3X B;  3TEW A;  4RM8 A;  2KD0 A;  2K8B A;  4JGH B;  3DBL B;  4GDL A;  4DHJ B;  1P3Q U;  2KDE B;  4OZB A;  2CHX A;  2XN9 C;  3EHV A;  1D3Z A;  1KH0 A;  3ALB A;  5HI1 A;  1C78 A;  4AOF A;  4RCO A;  4L23 A;  3E56 A;  1YN5 A;  3P2B A;  1MG8 A;  1RYJ A;  3ZJT A;  4IM2 A;  4IM0 A;  3BVZ A;  2CS4 A;  3W9C B;  5IAA C;  5C1Z A;  2V3N A;  4IG7 B;  4TUU A;  3P4Q B;  1EM7 A;  2NTS A;  3DBS A;  1WYG A;  2IDY A;  3E9S A;  3OLM D;  4GLS C;  3R8B A;  3DWG C;  3QWZ B;  1QF6 A;  2A5U A;  1I7H A;  3WAL A;  4K7W A;  3DQV A;  3FIL B;  4DWF A;  1SB3 C;  2JQR B;  2M1M A;  1NVI D;  5DCN A;  2LZ6 A;  4RGO S;  4HDO A;  1U4A A;  2MX2 A;  1I4X A;  2OJR A;  4KGT A;  4IOI E;  3RFZ B;  4A8X C;  3DBH B;  3AI5 A;  3FIL A;  4DBG A;  4FHJ A;  4IWO A;  3SDL C;  1JQ4 A;  2V1Y A;  4ANU A;  2Z59 B;  2XNA C;  1WFY A;  3B0A A;  4M01 A;  2GI9 A;  5BO4 B;  1NYQ A;  2I1J A;  1LM8 B;  3R7Q A;  3L16 A;  1OEY A;  1PUT A;  2M0A A;  4P1B C;  2L83 A;  3DPD A;  1VDV A;  5KHO A;  3ZDT A;  2RPV A;  3ZJU A;  3AU5 A;  4W9K A;  1KLU D;  4YSY B;  3CIR B;  2MWS B;  1JML A;  4IUM B;  4OW0 A;  4WQO B;  2BYF A;  1WMH B;  3APF A;  2ZZP B;  5E6N A;  4XYC A;  1STE A;  2IO0 B;  5MPO A;  2BW2 A;  4YWG G;  3KW5 B;  4US8 A;  1WXS A;  1ET9 A;  4TQ0 A;  3B1L X;  2WXP A;  1L6U A;  5DPR A;  1GC6 A;  1FRD A;  4B6W A;  1WMH A;  4ACF A;  1R4N I;  1N5W A;  3R2I A;  1LO5 D;  1JW9 D;  4XX5 A;  4J6I A;  1UD7 A;  1J19 A;  2MBH A;  4E3C A;  2CU1 A;  3JYU A;  4C7Y A;  1FXA A;  4ANV A;  4MGZ E;  3VAW A;  1NDD A;  2N7E A;  5AZF A;  3W1Y A;  5CHF A;  3RUL A;  2KAN A;  3IBE A;  2V4L A;  1YOV B;  2WXO A;  4WIP A;  4DDI D;  4OVV A;  4YT0 B;  1I4G A;  2JXT A;  2DZK A;  4ZRK A;  1YQ3 B;  2SAK A;  1V97 A;  1MG4 A;  4TV3 A;  2JRH A;  1LFD A;  5AEK B;  4J3O D;  1J0G A;  2TSS A;  3DVG X;  2N0S B;  1ZPS A;  2FCS A;  1N6Z A;  3VTV A;  3NHE B;  3N1X C;  4KKJ A;  3PHW B;  3GE8 C;  1WI0 A;  3NS1 A;  1TZ1 A;  4MM3 B;  3TEZ A;  3I5J C;  2LVO A;  4I6L B;  1MVK A;  1ZXH A;  1QQR A;  2WXH A;  1J7A A;  3ZJV A;  1LXD A;  3BZD B;  3N1Y C;  4CYE A;  1ZW7 A;  3RNC C;  3VUX A;  5EE9 A;  3Q3J A;  4IW0 A;  4MM3 A;  1WSP A;  2FAZ A;  4N9F 4;  2MSE D;  4LJO B;  2Z0D B;  4ICU A;  1YIW A;  1JWA D;  1I4P A;  1GJZ A;  4DHZ E;  2KK8 A;  1I35 A;  4IM3 A;  1OFF A;  2AQ2 B;  1TGZ B;  2N9L A;  2WXF A;  1EF5 A;  2WDQ B;  1HE8 A;  1VZ8 A;  1H8C A;  1B1Z A;  4RNA A;  2ON8 A;  2NPT B;  3PT2 B;  3A9K B;  3KQ4 A;  2LJ5 A;  1UBQ A;  3NS8 A;  3EGR A;  3TUO A;  1BUI C;  3AV8 A;  1QZE A;  1WX7 A;  2DYB A;  1FCL A;  3MJ5 A;  1NI3 A;  3AED B;  3N1Z C;  5JH5 C;  2W9N A;  3P63 A;  4F8C B;  3RNA C;  3LDZ E;  2M4N A;  1WR1 A;  4FLH A;  2JYE A;  1VLB A;  1GAQ B;  1C1Y B;  2Y5P A;  2N1W A;  3M63 B;  1AW7 A;  2M8S A;  2I38 A;  2G45 B;  3TL5 A;  2GBR A;  1WGD A;  5DPW A;  3IFW B;  3ZDM C;  5AZG A;  1CZP A;  3QK0 A;  4M02 A;  5FR6 A;  1FNW A;  3L13 A;  4F7Z A;  1X1M A;  4GSW A;  4YTP B;  1E5W A;  4O1N A;  3NUH B;  3AEC B;  2NMQ A;  2L1A A;  2ACZ B;  2J4X A;  2OJW A;  4AWJ A;  2DZI A;  1XLN A;  3HK0 A;  2FID A;  1RM6 C;  2QDF A;  1P7F A;  4D2K A;  3M62 B;  1B9R A;  4XDD A;  1KTK A;  4YTN B;  1YN3 A;  5FK9 C;  3JSV B;  4NJC A;  4MJS B;  3W5V B;  3RPF C;  3T3N A;  4BOZ B;  4K3B A;  1RFA A;  4FUL A;  1WGK A;  3K9P B;  4P7I A;  4IKG A;  1FPY A;  1NEN B;  2K39 A;  1I4H A;  2JF5 A;  2Y5C A;  3JSV A;  3ZRC A;  3CST A;  4QAY A;  4MJS A;  2M56 B;  3N20 C;  1E7V A;  2MBB B;  3H8H A;  1MJD A;  4PYZ A;  1T0S C;  3MHS D;  2MBE A;  1JRO A;  3C0R B;  2W54 A;  3FAH A;  3V60 A;  1V86 A;  3AE4 B;  2GBM A;  4KZC A;  2JU6 X;  2K1F A;  2N9E B;  2C7M B;  2LI5 A;  1D5M C;  2GBJ A;  2JX5 A;  4FXC A;  3Q3M C;  1GG3 A;  4WWN A;  2MH7 A;  2O6V D;  3DOW A;  2H89 B;  4II2 B;  3VTU A;  3GS2 A;  3T8M A;  3ETR A;  3EUB 2;  4BAX A;  2CU3 A;  3T3O A;  1FRR A;  1TKG A;  3AE9 B;  4HLE A;  3DDC B;  2CHZ A;  2RDG A;  3L08 A;  3RUI B;  1BT0 A;  4CO7 A;  5BYQ A;  1L6V A;  2PTL A;  2N7J A;  2K8H A;  2G4S A;  2ZCC A;  2L52 A;  3KYD D;  4C7Z A;  4HJG E;  1HEZ E;  5HKH A;  3OAW A;  2LVP A;  2LUE A;  2VH1 A;  4DQO C;  4CHK A;  1GUA B;  2K8C A;  3GOE A;  1AN8 A;  1E90 A;  2EMS A;  3SFD B;  4AJY B;  1K52 A;  2WXM A;  3QQ8 B;  5FR3 A;  1V8C A;  2LRW A;  4JL9 A;  2QIL A;  4BKT A;  2WNM A;  1R4N B;  2DZM A;  2YEP F;  5IN7 A;  2KJH B;  3H7P B;  1HZ6 A;  4IWP A;  3C19 A;  3Q2A C;  3VQI A;  1MHH E;  2RSU A;  3VH4 B;  4KZ0 A;  3CSF A;  3Q14 C;  4PYU A;  3APD A;  1I42 A;  1N61 A;  2O6V A;  1I4Q A;  3U30 A;  1UEL A;  3Q3N C;  3WA0 A;  3L17 A;  5H92 C;  3U52 E;  2NVU I;  3OG5 A;  4ZDV A;  4ZHO A;  2G4D B;  1TKY A;  4BOS C;  2PLP A;  4M00 A;  1SJH D;  1ZGU B;  4MAC A;  4XDC A;  1SF0 A;  2KQS A;  4WH4 A;  3I9V 1;  4W9L A;  2KN4 A;  4KGS A;  3AU4 A;  2L32 A;  4K7S A;  3NZS A;  2YLM A;  1K53 A;  2WGS A;  1PGX A;  4EKU A;  1WF9 A;  1SE9 A;  3AEF B;  2IYD B;  2KAJ A;  1FMA D;  4AQ7 A;  1WXQ A;  2PE9 A;  2W3R A;  3VH3 B;  2HTH A;  2KKC A;  1UBI A;  4RGM A;  3NY5 A;  1V1O A;  1G6J A;  2WU2 B;  4ANX A;  4KVG B;  4DHJ D;  1ZXI A;  1WM2 A;  4BFR A;  1LQB A;  5L83 A;  3VHT C;  1V49 A;  1ZP0 B;  1AAR A;  4TKN A;  2KTR B;  3JW0 X;  4MT5 A;  1TIF A;  1PQS A;  2GBK A;  4HKZ E;  2WXI A;  4IWQ A;  5IOI A;  1C4A A;  3CMM B;  1SJE D;  4JWS C;  3AMZ A;  3NVZ A;  1P7E A;  4GDK A;  2IO2 B;  1SEB D;  4ITK A;  3Q8F A;  2BS4 B;  2J52 A;  3SR6 A;  2KWU B;  4YL8 A;  1WIA A;  2D11 A;  3GZN I;  3P4S B;  1VRA B;  3O65 B;  1OEY J;  3A4S C;  5G55 A;  1E6E B;  3MHZ A;  4I6N B;  2RGF A;  2ZVN A;  2IZV B;  1T6B X;  1HZ5 A;  1UZX B;  3PTF C;  1OGW A;  4ICV A;  4ZHP A;  5KHQ A;  1V9J A;  1ET6 A;  3SEB A;  2ZVO A;  3TCA A;  3ML8 A;  2GRI A;  2LGD A;  2ZW1 A;  2BS3 B;  4MSM B;  2V4I B;  1RRB A;  2V3S A;  3APC A;  2RDH A;  1HTQ A;  1N60 A;  1FCC C;  1ZUD 2;  3IT6 B;  1AWD A;  2FBW B;  2LXA A;  5AZH A;  1WX8 A;  3T9L A;  4MSQ B;  3AE7 B;  3EEC A;  2KC2 A;  2PE6 B;  2HD5 B;  1F52 A;  2WXQ A;  4E71 A;  5TR5 A;  1SE2 A;  2XK5 B;  4GN1 A;  3DHH C;  2LFI A;  1F0Z A;  2KWD A;  5D94 A;  3IAM 1;  4HPL B;  3AEG B;  5H8Y E;  3DBR B;  4HRO A;  4RM9 A;  1N62 A;  1SE4 A;  4REZ A;  2XK5 A;  2IO1 B;  1K50 A;  2E6X A;  2L8J A;  1KF6 B;  5D3D A;  2MHJ A;  1C4P A;  3V62 A;  2V9H A;  2IND C;  1XLQ A;  2HE7 A;  2V3P A;  2IJ0 A;  1JWS D;  3PRM B;  4N59 A;  3ZKJ C;  4AS1 A;  1JWM D;  3VUW A;  3HUI A;  2R2O A;  5CHV C;  4GB9 A;  1QOA A;  5CX3 A;  1GOZ A;  4K3C A;  2KTF A;  2ZCB A;  1RAX A;  2BT6 A;  3PLV A;  2QCZ A;  5J2R A;  1RLF A;  1JWU D;  3UF8 A;  2WQY B;  4HXD A;  2GOW A;  3AE5 B;  3X0W A;  2QHO A;  1R4M B;  4AJW A;  3BIN A;  1QIL A;  4HVB A;  3QX1 A;  1IPG A;  5LXI B;  1UWX A;  4MH8 A;  3B9J A;  4RH6 A;  2MBO A;  1WJU A;  3UGB B;  2IY1 B;  1MPE A;  1AYF A;  1WWT A;  4RGN A;  3VVW B;  1UGM A;  4HPM B;  2HDE A;  2BWE S;  2BTE A;  3AN1 A;  1OQR A;  3U7Z A;  3WAN A;  4B0E A;  4TMA B;  2ZJD A;  2B76 B;  2N9P C;  1YQB A;  2Y3A A;  2D2Q A;  3A1Q B;  4W9J A;  2LD9 A;  4EUT A;  2KDF B;  2C7H A;  3DWM A;  4NAW B;  4K7U A;  4WWO A;  1UGJ A;  4JIO U;  3BII D;  4BVU C;  4YXD B;  2CR5 A;  2MRP A;  4US9 A;  4B9K A;  2K3U A;  4XC2 A;  1L2N A;  1A70 A;  4DXG A;  4NAW A;  5C23 A;  3HVZ A;  3SFE B;  2C7N B;  4RF1 A;  1SSN A;  1PGB A;  3WIM A;  4LLG M;  4XGA B;  2D3A A;  2EKE C;  4NJ6 A;  2HTM E;  1K8R B;  2E3T A;  2PKO A;  1IUE A;  3ZNG C;  1H4R A;  4ZRP A;  2SEB D;  4AUQ C;  2FE8 A;  5AUI A;  1V81 A;  1RFK A;  2KJR A;  1K51 A;  1C79 A;  3NVY A;  4M0W B;  1ZE3 D;  1PDX A;  2IO3 B;  4OZA A;  3QA8 A;  3SU8 X;  3CWI A;  4KX6 B;  1NYR A;  2BQQ A;  4BZA A;  1S3S G;  1P9D U;  2WDV B;  1Z5S B;  4W9E A;  4MGI E;  4M0W A;  1TBE A;  5L95 C;  4RFB A;  2FCN A;  3C8Y A;  2KLG A;  2KOX A;  3TJP A;  1IBX B;  2MEK A;  3AM9 A;  1MFW A;  2BYT A;  1QOG A;  1E9M A;  1D5Z C;  3ZGZ A;  2MBQ A;  3QC8 B;  3VTW A;  3UI3 A;  3OWE B;  2C9W B;  2FUG 1;  2D07 B;  1KFY B;  2MP2 B;  4LNK A;  4C4V B;  1BML C;  2NPT A;  2KFJ A;  3A9K A;  2NBV B;  2G9H D;  1ZDV A;  3U8Z A;  2D3G A;  1XXG A;  3AB5 A;  4LTU A;  2BWF A;  4HKQ A;  3QHT A;  3A4R A;  3AE2 B;  4F1S A;  2L05 A;  2PJH A;  2ZEQ A;  5BMH A;  1HA5 A;  1P98 A;  4ZRQ A;  4G11 A;  4JE3 B;  1VJK A;  4PK1 A;  1E8Z A;  5EE0 A;  5J18 A;  1V5T A;  4LNI A;  4OZC A;  4OVZ A;  3AE3 B;  3GP7 A;  2DHZ A;  1QOF A;  3I63 C;  2WX0 A;  2LWP A;  4YSX B;  5EDS A;  3ABV B;  1IGD A;  3BK1 A;  5GMV A;  3PO0 A;  1WJN A;  4BBN F;  3B08 A;  3MP9 A;  4A3O A;  5C2T B;  1DYQ A;  1UNS A;  3P1M A;  1VZ6 A;  3IHP C;  2VZK B;  3RN9 C;  2RD0 A;  3AEB B;  2WXG A;  2GB1 A;  2FUH B;  1R7S A;  2G3Q B;  5IO9 A;  3PRE A;  4W9G A;  4KSK C;  4WQM A;  3HM6 X;  1WYW B;  1FXI A;  4W9C A;  2JT4 B;  2JYT A;  4GGQ A;  1JRU A;  4XWT A;  1EF1 A;  1XD3 B;  4GMV A;  3N3K B;  2QIE B;  2AL6 A;  1KRH A;  2PVO D;  3VR9 B;  1YJ1 A;  3DBH I;  3EC8 A;  1IP9 A;  2JZZ A;  1PGA A;  3WAM A;  3L4P A;  1WJ6 A;  3R3M A;  3AXC A;  4N6E B;  5C3J B;  1JWB D;  2JZ3 B;  4P1C C;  1F2R I;  1C9F A;  1JRP A;  1SXT A;  4NZL B;  1XLP A;  1GC7 A;  3ZRF A;  3IVF A;  2NBU A;  3RNE C;  2MA9 B;  5LLI A;  1P0R A;  2LAS A;  4C80 A;  2QC8 A;  2PW9 A;  1TTN A;  2V0G A;  2IGH A;  1KOT A;  1KLG D;  1C77 A;  1L0V B;  2UWQ A;  1DGJ A;  2JRI B;  4ZOH C;  3AE1 B;  1QOB A;  1TS4 A;  2BB5 A;  2ONQ A;  5GXG B;  4LDT B;  2KDI A;  1L0Y B;  2WP9 B;  3I57 A;  4XWW A;  2IBI B;  1QLB B;  3U2S C;  4WUR A;  4B0M A;  3KUD B;  3MTN B;  4A3P A;  3AUL A;  3HVD A;  4KGR A;  5LNK 1;  2KFK B;  4A6Q A;  3BYT B;  4EFO A;  3QIJ A;  1JAL A;  2LGI A;  4BBN C;  3HM3 A;  2K6D B;  3NVV A;  4HJK A;  1C4C A;  1DOI A;  1WXM A;  5G5G A;  3RZW C;  3W1S A;  2FNJ B;  2IY0 B;  2KFK A;  2ZW0 A;  1WZ3 A;  1FIQ A;  1J8C A;  1NI2 A;  3LYY A;  3TIX A;  1GNU A;  4ARI A;  2YVC A;  2JSV X;  1SGH A;  1OQQ A;  1S1Q B;  1LGR A;  2KX0 A;  4G0N B;  4BKG A;  1N5X A;  1MI0 A;  4PS8 A;  2R61 A;  1NEK B;  4HPP A;  1UH6 A;  4HEA 1;  4HDQ A;  1V1P B;  1EU4 A;  3DVN U;  4C00 A;  3U7D A;  2GMI C;  1FNU A;  3H7P A;  1WR6 E;  1T0R C;  2K0P A;  1F1H A;  1YN4 A;  4MDK E;  3ZYY X;  4FN2 A;  3N9Y C;  1J7B A;  4KSL C;  3PVL A;  2W3S A;  3ZNH B;  3PZ8 A;  2KYW A;  1VR9 A;  2FCQ A;  2REX A;  2CJO A;  4IC7 B;  1Y56 A;  1HTO A;  4NNJ B;  2KAC A;  5J17 A;  2H88 B;  4EZJ A;  4LNF A;  1WGH A;  4FA6 A;  1Q5W B;  1T0Y A;  3RCZ A;  1TZO A;  4ASW C;  1WRI A;  1RWS A;  3VRA B;  4A20 A;  1GPX A;  4W9D A;  2C60 A;  4GXB A;  1E7U A;  1ROE A;  1FM0 D;  3ZVV A;  2M19 A;  2KJ6 A;  1Y8R C;  3DCG A;  1ZKH A;  2LXC A;  1WXV A;  1TKE A;  2FCM A;  1TYG B;  1EO6 A;  2BF8 B;  5G5H A;  2LGX A;  4S17 A;  1XF5 L;  5BMG A;  1KLV A;  4RMA A;  2N7D A;  1WGR A;  4BKS D;  1L0X B;  3K9O B;  4II3 B;  2KTR A;  5D2M B;  3ZQ4 A;  1KM7 A;  3O13 A;  1IYF A;  3NJT A;  3QAQ A;  2AWT A;  4WJP A;  2BS2 B;  2LUM A;  1SIF A;  4FHK A;  1ZDX A;  2JUO A;  3M3J A;  3H9D A;  4N58 A;  3BYY B;  3H6N A;  4LNO A;  1WM3 A;  5FKA C;  3R66 C;  2MCN B;  3DHG C;  1YX6 B;  2J0M A;  4FJY A;  4MGK E;  2AQ3 B;  2DNF A;  2HJ1 A;  1WRD B;  3A9J B;  3DVG Y;  1F2R C;  1PYW D;  5BYS A;  5E6O A;  5G2N A;  1TJE A;  4EE2 A;  2NCN A;  1WH3 A;  4ZYS A;  1V6E A;  3NG0 A;  3ZNI D;  5IP4 D;  1V80 A;  3X23 A;  2D10 A;  3H7S A;  1QKZ A;  2NTT A;  4CQN A;  2JWU A;  2NBW B;  3A9J A;  4BKS A;  2DAF A;  1C3T A;  1WY8 A;  2CJN A;  3BVM A;  3ZW3 A;  1F9J A;  1BXT A;  2EEL A;  1HXY D;  2FIF A;  3NVW A;  2XBB C;  3VRB B;  4FJZ A;  1WJ4 A;  1EU3 A;  4M8M A;  3AEE B;  3KUC B;  4IDI A;  5JHA A;  4Q2J A;  3RMK C;  1XCQ L;  2WDR B;  4RGT A;  3OJ4 B;  5CTR C;  1WGG A;  2AL3 A;  4JQW C;  2KMC A;  2J0J A;  2KVR A;  1GB4 A;  2PEA A;  4LK0 M;  3IG3 A;  4NY0 A;  2DYM A;  3I3T B;  1IGC A;  5E6P A;  2YEP B;  4MGY E;  1FFV A;  1M94 A;  2LMC A;  4WAF A;  2LVQ A;  3TEX A;  3PSE B;  4L2Y A;  3KUZ A;  3FKY A;  2L0T A;  4USA A;  3PHX B;  4L1B A;  5JHB A;  4DHZ B;  4OHJ A;  3KVF B;  1YMH E;  2K6Q A;  2KDM A;  2WXK A;  4MEL A;  1E8X A;  2MJD A;  3P4P B;  3ZIM A;  1NBF C;  3UIO B;  1FO4 A;  1L4Z B;  1WXA A;  2WDT B;  4XE0 A;  2DAJ A;  2BKF A;  1TS3 A;  2IGG A;  2W55 A;  4NAM A;  4W9H A;  5EE1 A;  1YQ4 B;  3UIN B;  4EOY A;  3PV1 A;  4DDG D;  3J9C A;  3Q3O C; 
#chains in the Genus database with same CATH homology
 1FXT B;  1E8Y A;  4W9F A;  4WWP A;  1GG3 A;  4JLC A;  2C9W B;  4WWN A;  2MP2 B;  2D07 B;  2KHW B;  1EUV B;  2O6V D;  4WAA A;  3DOW A;  2NPT A;  2KFJ A;  3A9K A;  3PRP B;  1WZ0 A;  2DX5 B;  2NBV B;  3BY4 B;  4KDL B;  4II2 B;  3EFU A;  3VTU A;  4I6P A;  3T8M A;  4GDL B;  5JZE B;  3S2A A;  3U8Z A;  3ZNZ B;  2D3G A;  3VXW A;  1E8W A;  2J0K A;  3KYC D;  4HLE A;  3DDC B;  2BWF A;  2CHZ A;  3L08 A;  3QHT A;  3A4R A;  3ECI A;  3RUI B;  2VRR B;  2HJ8 A;  4G3X B;  2ZPY A;  4F1S A;  2L05 A;  1BT0 A;  2PJH A;  2ZEQ A;  2JWZ A;  4RM8 A;  2KD0 A;  1P98 A;  4CO7 A;  2K8B A;  4G11 A;  3QAR A;  4JGH B;  2KX3 A;  1ISN A;  2K8H A;  2G4S A;  2ZCC A;  3JVZ X;  1E8Z A;  3KYD D;  4GDL A;  2JVC A;  4M8N A;  4DHJ B;  5HKH A;  1P3Q U;  3PLU A;  1V5T A;  3OAW A;  5J18 A;  2KDE B;  2LVP A;  2LUE A;  3ZTC A;  2CHX A;  2OOB B;  4CHK A;  2DHZ A;  3EHV A;  1D3Z A;  1GUA B;  2K8C A;  2WX0 A;  3ALB A;  3GOE A;  2XEW A;  2LWP A;  2JXX A;  5EDS A;  1E90 A;  2EMS A;  4AOF A;  4AJY B;  3QQ8 B;  5GMV A;  2LRW A;  1WJN A;  4BBN F;  2BKR B;  3B08 A;  3A1Q A;  2CHW A;  3P2B A;  4JL9 A;  1MG8 A;  4BKT A;  4A3O A;  2DZM A;  1VD2 A;  4IM2 A;  3UQB A;  2KJH B;  3H7P B;  4IWP A;  3VQI A;  4IM0 A;  3IHP C;  2RSU A;  3VH4 B;  2CS4 A;  2RD0 A;  4MH0 E;  5IAA C;  4KZ0 A;  5C1Z A;  3CSF A;  2FUH B;  4IG7 B;  4PYU A;  2ZNV C;  2G3Q B;  3APD A;  3CF6 E;  4TUU A;  1I42 A;  3PRE A;  4W9G A;  1L7Y A;  4KSK C;  3DBS A;  2O6V A;  1V5O A;  2WWZ A;  2KN5 A;  3HM6 X;  3OLM D;  3U30 A;  1UEL A;  1WYW B;  4W9C A;  2JT4 B;  4PS3 A;  4GGQ A;  3WA0 A;  4URK A;  3L17 A;  3HIZ A;  1JRU A;  3QWZ B;  2KXJ A;  2NVU I;  4GIV A;  1EF1 A;  1XD3 B;  4ZDV A;  2A5U A;  2G4D B;  4GMV A;  2Y5B B;  3N3K B;  4BOS C;  3WAL A;  4K7W A;  1ZGU B;  2AL6 A;  1YJ1 A;  4FAD A;  3DQV A;  3DBH I;  4DWF A;  2KQS A;  3EC8 A;  2M1M A;  4W9L A;  5DCN A;  1IP9 A;  2MW5 A;  2JZZ A;  4WJO A;  2LZ6 A;  3AU4 A;  3WAM A;  1WE7 A;  4HDO A;  4K81 A;  1U4A A;  2MX2 A;  2OJR A;  2KMA A;  4K7S A;  1WJ6 A;  3R3M A;  2ZPN A;  3AXC A;  2N4F A;  3NZS A;  3ZO5 B;  2JZ3 B;  2YLM A;  4KIK B;  2KDB A;  3N32 A;  4EKU A;  3AI5 A;  1WF9 A;  1SE9 A;  2IYD B;  4PS7 A;  2PE9 A;  3VH3 B;  4DBG A;  2HTH A;  1GC7 A;  2KKC A;  2WX1 A;  4FHJ A;  4IWO A;  1UBI A;  4WJN A;  3SDL C;  3ZRF A;  3NY5 A;  3IVF A;  3UIP B;  2V1Y A;  1G6J A;  2NBU A;  1XT9 B;  2UYZ B;  2MA9 B;  4ANU A;  4ANX A;  5LLI A;  2KQ7 A;  2Z59 B;  1P0R A;  4KVG B;  2LAS A;  3ZTD A;  4DHJ D;  4KIK A;  1WFY A;  5LXH A;  3B0A A;  1TTN A;  3NOB A;  1KOT A;  5BO4 B;  1WM2 A;  3SHQ A;  2UWQ A;  4BFR A;  1LQB A;  5L83 A;  3VHT C;  2I1J A;  2JRI B;  1V49 A;  1LM8 B;  4HWI B;  1AAR A;  4TKN A;  3R7Q A;  2KTR B;  3L16 A;  1OEY A;  3R7R A;  3DPD A;  3JW0 X;  5KHO A;  4NQL B;  1PQS A;  2GBK A;  3ZDT A;  4IWQ A;  1V2Y A;  2KDI A;  3AU5 A;  4LDT B;  2NR2 A;  3CMM B;  4W9K A;  2IBI B;  2WYQ A;  2KNB A;  1Q1O A;  3KUD B;  3MTN B;  4A3P A;  2DZJ A;  4GDK A;  3AUL A;  2IO2 B;  2ZNV B;  2MWS B;  3DBL I;  4IUM B;  4WQO B;  2A4Z A;  4NPN A;  2BYF A;  3Q3F A;  1WMH B;  3APF A;  2ZZP B;  5E6N A;  2IO0 B;  2KFK B;  1Z2M A;  2MP2 A;  4EFO A;  3QIJ A;  4NQK E;  3WAP A;  3KW5 B;  4BBN C;  3HM3 A;  1WXS A;  2K6D B;  4HJK A;  2GBN A;  5D6J B;  2KWU B;  4YL8 A;  1WXM A;  4TQ0 A;  1WIA A;  3B1L X;  2D11 A;  3GZN I;  5DPR A;  3RZW C;  1GC6 A;  2KC1 A;  2FNJ B;  3W1S A;  2EMT A;  2IY0 B;  4GOC A;  5CHW A;  3O65 B;  3WAO A;  4B6W A;  1OEY J;  1WMH A;  3A4S C;  5G55 A;  2KFK A;  2L0F A;  1R4N I;  3PPA A;  4HK2 A;  2LGY A;  1WZ3 A;  1OTR B;  1J8C A;  1NI2 A;  4I6N B;  4XX5 A;  2RGF A;  2ZVN A;  1UD7 A;  4J6I A;  2IZV B;  1J19 A;  2MBH A;  4E3C A;  2CU1 A;  3MJW A;  3JYU A;  3TIX A;  1GNU A;  2MLB A;  4ANV A;  1UZX B;  4MGZ E;  4AP4 C;  2YVC A;  3PTF C;  3VAW A;  1OGW A;  1NDD A;  4ICV A;  1SGH A;  1WE6 A;  2N7E A;  5KHQ A;  1V9J A;  5AZF A;  1S1Q B;  2KLC A;  2ZVO A;  3W1Y A;  2KX0 A;  4G0N B;  2L00 B;  5CHF A;  3RUL A;  3TCA A;  3ML8 A;  2KAN A;  4BKG A;  2LGD A;  3IBE A;  2V4L A;  4MSM B;  4PS8 A;  4DDI D;  1YX5 B;  4OVV A;  2KWV B;  1RRB A;  1UH6 A;  4HDQ A;  5IA7 A;  2V3S A;  2DZK A;  3DVN U;  3U7D A;  2GMI C;  4ZRK A;  4OVU A;  3APC A;  1WR6 E;  3H7P A;  2BYV E;  2R2Q A;  4MDK E;  3PZD A;  2MQJ A;  2LXA A;  3D32 A;  4TV3 A;  2JRH A;  4FN2 A;  1LFD A;  1WX8 A;  4KV2 A;  5AZH A;  4MSQ B;  3T9L A;  5AEK B;  1YD8 U;  3EEC A;  4KSL C;  1J0G A;  2BPS A;  3ENE A;  2KC2 A;  3DVG X;  3W1S C;  2PE6 B;  3PVL A;  2HD5 B;  2B3A A;  3ZNH B;  4E71 A;  3DBR I;  1XQQ A;  5TR5 A;  2FCS A;  2XK5 B;  4GN1 A;  3VTV A;  2FCQ A;  3NHE B;  2REX A;  4IC7 B;  4ZYN A;  4NNJ B;  4LDT D;  5J17 A;  4DK5 A;  2RR9 A;  3PHW B;  2J7Q B;  5D94 A;  2L3Z A;  4EEW A;  1WI0 A;  4EZJ A;  3L0W B;  4HPL B;  1WGH A;  4FA6 A;  1TZ1 A;  3L54 A;  1Q5W B;  4W9I A;  1T0Y A;  3RCZ A;  3ML9 A;  3KH0 A;  5DPT A;  2LVO A;  4I6L B;  4RM9 A;  4ASW C;  2AYO B;  3VFK A;  2XK5 A;  3RYT A;  2KWC A;  1LXD A;  3PS6 A;  4DXA B;  2IO1 B;  3OJ3 A;  4CYE A;  4MEM A;  1WGY A;  3VDZ A;  1ZW7 A;  2L8J A;  4A20 A;  4B95 A;  3VUX A;  4W9D A;  3Q3J A;  2KO3 A;  2C60 A;  4IW0 A;  4MM3 A;  2FAZ A;  3V62 A;  2RPQ A;  4GXB A;  1E7U A;  4N9F 4;  3RZF A;  3NZU A;  2HE7 A;  3L10 B;  2MSE D;  4WJQ A;  3ZVV A;  4LJO B;  3PRM B;  2Z0D B;  2KJ6 A;  1Y8R C;  4ICU A;  3ZKJ C;  3TMP B;  1YIW A;  3DCG A;  3H1U A;  4TQ1 A;  1OQY A;  4X57 B;  1GJZ A;  1ZKH A;  2LXC A;  3VUW A;  1WXV A;  2FCM A;  4DHZ E;  2C5L C;  2KK8 A;  1I35 A;  4IM3 A;  3V6C B;  4EZK A;  2R2O A;  5CHV C;  1EO6 A;  2CKH B;  2BF8 B;  1TGZ B;  4GB9 A;  2LGX A;  1R4M I;  5CX3 A;  1EF5 A;  2ASQ A;  1HE8 A;  2KTF A;  2ZCB A;  1RAX A;  1H8C A;  3SD5 A;  1KLV A;  3PLV A;  4RMA A;  3TBL D;  2N7D A;  1WGR A;  5J2R A;  1RLF A;  4BKS D;  2NPT B;  3UF8 A;  3PT2 B;  3A9K B;  4HXD A;  2L76 A;  3K9O B;  4II3 B;  2GOW A;  2KTR A;  2QHO A;  4LCD E;  2LJ5 A;  3X0W A;  4AJW A;  5D2M B;  3ONS A;  1UBQ A;  3BIN A;  3NS8 A;  1KM7 A;  4HVB A;  4FJV B;  2N1V A;  3QX1 A;  1IPG A;  1IYF A;  3QAQ A;  2AWT A;  3M95 A;  4WJP A;  5LXI B;  1QZE A;  1WX7 A;  4LJP B;  1SIF A;  2DYB A;  4FBJ B;  2MBO A;  1WJU A;  4FHK A;  2JUO A;  3UGB B;  1CMX B;  2IY1 B;  3M3J A;  3LJ3 A;  3H9D A;  4EZL A;  3QCA A;  5JH5 C;  5DPS A;  2W9N A;  3VVW B;  3DVN V;  3H6N A;  2PPH A;  1UGM A;  4F8C B;  2JPH A;  4HPM B;  1WM3 A;  2L7R A;  3LDZ E;  3R66 C;  2LRU A;  2M4N A;  2MCN B;  1WR1 A;  4FLH A;  1A5R A;  2BWE S;  1YX6 B;  2DYO A;  3RT3 B;  2J0M A;  4FJY A;  1C1Y B;  3WAN A;  2N1W A;  2ZJD A;  2N9P C;  3M63 B;  4MGK E;  1YQB A;  3V6E B;  3PRZ A;  1WRD B;  2D2Q A;  3A1Q B;  4W9J A;  2LD9 A;  2M8S A;  4EUT A;  2KDF B;  3A9J B;  2C7H A;  3DVG Y;  4NAW B;  4K7U A;  4HCN B;  4WWO A;  2BGF A;  5E6O A;  2G45 B;  4JIO U;  5G2N A;  3TL5 A;  4BVU C;  2NCN A;  2CR5 A;  2MRP A;  1WH3 A;  1WGD A;  2GBR A;  4B9K A;  4XC2 A;  1V6E A;  5DPW A;  3ZNI D;  3IFW B;  1V80 A;  4K1R B;  4NJ7 A;  1L2N A;  3X23 A;  2D10 A;  1P1A A;  3ZDM C;  3H7S A;  5AZG A;  2O6V B;  2NBW B;  3A9J A;  3QK0 A;  4BKS A;  2DAF A;  3V61 A;  4NAW A;  5FR6 A;  1WX9 A;  5C23 A;  1C3T A;  3L13 A;  1WY8 A;  3RD2 A;  2C7N B;  3ZW3 A;  3N30 A;  1F9J A;  4F7Z A;  1X1M A;  4GSW A;  2Z0E B;  4ZRJ A;  2JY6 A;  1E5W A;  4XZ4 A;  3WIM A;  2EKE C;  2FIF A;  4NJ6 A;  2XBB C;  1K8R B;  2O2V B;  4FJZ A;  3HHM A;  1WJ4 A;  3ZNG C;  2AEH A;  4M8M A;  1H4R A;  4AWJ A;  2DZI A;  3KUC B;  3HK0 A;  4G50 A;  2FID A;  5JHA A;  4AUQ C;  3QJZ A;  1V81 A;  3M62 B;  3VUY A;  2KJR A;  3OJ4 B;  5CTR C;  1VCB A;  2NS5 A;  2M17 A;  2KZR A;  1WGG A;  2AL3 A;  2DEN B;  4JQW C;  3ZLZ A;  3JSV B;  3ZUN A;  4M0W B;  2IO3 B;  4MJS B;  2KMC A;  2I1K A;  2J0J A;  2KVR A;  2O2V A;  4KDI C;  3QA8 A;  2PEA A;  3SU8 X;  4BOZ B;  1KJT A;  3IG3 A;  2DYM A;  3I3T B;  4NY0 A;  3UQA A;  1RFA A;  4FUL A;  4HCP B;  3K9P B;  4P7I A;  1S3S G;  5E6P A;  1P9D U;  2M0X A;  1Z5S B;  4MGY E;  2K39 A;  4W9E A;  1M94 A;  2JF5 A;  2LVQ A;  4MGI E;  3JSV A;  3ZRC A;  3CST A;  3PSE B;  4MJS A;  1TBE A;  4E74 A;  5D7G A;  5L95 C;  3KUZ A;  1E7V A;  2FCN A;  2MBB B;  2L0T A;  3PHX B;  3A33 B;  2KLG A;  5JHB A;  2KOX A;  3TJP A;  4PYZ A;  4GU2 A;  4DHZ B;  3MHS D;  1Q0W B;  2MBE A;  3KVF B;  4ANW A;  2K6Q A;  2K25 A;  3C0R B;  4MEL A;  1E8X A;  3ZIM A;  1NBF C;  2BYE A;  4ZRI A;  3V60 A;  3UIO B;  1V86 A;  1WXA A;  2WDT B;  2GBM A;  2DAJ A;  2BKF A;  2N9X A;  4KZC A;  2K1F A;  2N9E B;  2C7M B;  3PGE A;  2MBQ A;  3QC8 B;  4W9H A;  4GDK B;  2LI5 A;  3UIN B;  2GBJ A;  4EOY A;  3PV1 A;  4DDG D;  3VTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...