4A3PA

Structure of usp15 dusp-ubl deletion mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
214
structure length
210
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 210
sequence length 214
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3pA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3pA01
3PRPB 2N9XA 3DBRI 4GOCA 4IM3A 1IPGA 2L7RA 2R2QA 2NPTA 3EECA 2CHWA 4NAWA 1BT0A 1AARA 2IYDB 1WXMA 3WANA 2JVCA 4TQ1A 2A4ZA 4HXDA 4TV3A 4ANUA 4WJQA 5KHQA 3R66C 2A5UA 3KW5B 3SD5A 3JSVB 3A9JA 1RLFA 1NDDA 3L17A 3PVLA 2KFJA 4K7SA 2IO0B 1E7UA 2MQJA 3A9JB 2EMTA 2FIFA 3CSFA 3KUCB 3UIPB 4IWOA 2ZPNA 3SU8X 2KWUB 5IAAC 3A1QB 1YIWA 1OEYJ 3K9PB 5JZEB 5LXIB 3BY4B 2RR9A 3MTNB 4II2B 4PS7A 2ZCCA 1P3QU 3AULA 2FAZA 4JQWC 3CSTA 2KOXA 1UZXB 1V9JA 1NI2A 2N9EB 2MBOA 2WX0A 3ML9A 1V5TA 3CMMB 3OJ4B 4EKUA 4DK5A 3WALA 1OTRB 2L8JA 2K1FA 2NBVB 3A9KA 3C0RB 2J0MA 1P9DU 2DAFA 1EO6A 4EOYA 4MSMB 2WWZA 3LMNA 5GMVA 3TMPB 2RGFA 1V81A 4YL8A 4HVBA 1WZ0A 4MEMA 4B95A 2JY6A 1UELA 2EKEC 4WWNA 3PHWB 2BKFA 1GC6A 1R4MI 1Q5WB 1XD3B 4XX5A 4F7ZA 3UQAA 1S1QB 4PS3A 4FHKA 4DBGA 4XZ4A 1WGDA 2V3SA 1WZ3A 3MHSD 3N3KB 5D94A 3VUWA 4FULA 1WXSA 2KJRA 1S3SG 2KHWB 4WJNA 1J0GA 4E74A 1GNUA 3ML8A 5DPTA 1Q0WB 4HPLB 4GDKA 3VAWA 2ZZPB 4NQLB 1OQYA 3M3JA 5E6OA 1G6JA 1WJ4A 4M8MA 3ECIA 4AOFA 4GDLA 4ANWA 2KN5A 1WJ6A 3W1SA 2J7QB 3NS8A 1UBQA 5C1ZA 1P98A 3ZW3A 2XBBC 2ZVNA 1LM8B 2MP2B 4ZRKA 2AWTA 1WMHB 4WQOB 3ZIMA 5C23A 4TUUA 3IFWB 3QJZA 3QQ8B 2GMIC 3ZTCA 2KWVB 4ANXA 4GXBA 2JPHA 4ZRJA 2C9WB 2JZZA 1ZW7A 1VD2A 3U8ZA 1E5WA 1WIAA 1NBFC 3EFUA 4ANVA 3LJ3A 1KOTA 1I42A 1EUVB 2GOWA 2NVUI 2JRHA 2DZJA 3QAQA 4ZRIA 1SE9A 3RYTA 4HCNB 4MJSB 4PS8A 3N30A 2LI5A 1T0YA 4HK2A 4HPMB 3PREA 4KSKC 1WI0A 3ONSA 3L54A 1C1YB 1GC7A 2KDEB 3PTFC 5DCNA 3R7RA 2KLGA 2IY1B 4NJ7A 4HDOA 4I6NB 4K81A 4MDKE 4LJPB 2LVPA 5DPSA 4B6WA 4BKGA 4WWOA 2KNBA 3TL5A 2REXA 4G11A 3SHQA 3PLVA 2LXCA 2KJ6A 2N1WA 4MGZE 3ZNHB 1HE8A 2GBKA 1WRDB 2LUEA 3DPDA 3L13A 3APCA 3R3MA 2KDBA 4AUQC 3AU4A 5J17A 4HWIB 2NBWB 2VRRB 3BINA 4GU2A 4JL9A 1YQBA 2HTHA 1LQBA 4PYUA 5CHWA 3UGBB 3RZWC 4EEWA 1V6EA 2C7NB 2GBNA 3DVGY 3OAWA 3H7PB 3HM3A 3OJ3A 1CMXB 1GG3A 3UINB 1YX5B 2IY0B 1WYWB 2AYOB 4CYEA 4EZLA 3NY5A 4BOSC 1L7YA 1I35A 4MGKE 2L0TA 1V2YA 3L0WB 5D7GA 2LXAA 2Z59B 3H9DA 4G3XB 2WDTB 3B08A 4IWPA 4MSQB 2KQSA 3U7DA 2LVQA 4W9EA 2MLBA 3IVFA 3O65B 3JSVA 1OGWA 4W9JA 3VH3B 2V1YA 1WM2A 3PSEB 4LJOB 2B3AA 5CHFA 3RD2A 1WFYA 3A1QA 3VQIA 3HIZA 4II3B 2MCNB 1YD8U 4FBJB 1KJTA 4P7IA 2KTRB 3KVFB 1YJ1A 2LASA 3DVGX 5JHBA 3VVWB 2C5LC 2BKRB 1MG8A 2D3GA 1Z2MA 3IHPC 4IWQA 4FADA 3HM6X 3W1YA 3A4RA 4KIKA 3VTUA 3ZRCA 4DXAB 2LRUA 4KIKB 2FCMA 2O6VB 4WJOA 4TQ0A 4EFOA 2FCSA 2PEAA 4ZYNA 1LFDA 5E6NA 2R2OA 2YLMA 1WE6A 4WJPA 4N9F4 3PS6A 2JZ3B 5EDSA 2K8BA 1GUAB 3QC8B 3VXWA 3VUXA 2KC1A 3DVNV 3L10B 4RM8A 3K9OB 3JVZX 4RMAA 4K7WA 4E71A 4ASWC 2L76A 4MM3A 3RUIB 4NPNA 3B1LX 2AL6A 2LRWA 4W9IA 3ZTDA 2MRPA 3TJPA 3KYCD 3QX1A 4HDQA 4LCDE 4FN2A 4OVVA 1X1MA 2KD0A 4W9KA 4DHJB 3NOBA 3L16A 4E3CA 1TZ1A 1K8RB 4MGIE 1VCBA 2YVCA 3AXCA 5LXHA 4ICUA 2PE9A 1ZGUB 4HLEA 4A3OA 2BGFA 5AZHA 1KLVA 2KFKB 1J8CA 2KDFB 2KWCA 4DHZB 2G45B 3ZDTA 4NJ6A 3DOWA 4GMVA 2KMCA 5CTRC 4JGHB 5JHAA 2FCNA 4BKSA 4IUMB 1XQQA 3B0AA 3PHXB 3X23A 2OOBB 2CU1A 2MP2A 1TGZB 1WJUA 1WMHA 3LDZE 3VFKA 2L3ZA 2MBHA 2MBEA 4W9LA 1J19A 4ZDVA 2C7MB 3WAMA 5G55A 4GGQA 1WY8A 5D6JB 3ZNID 1TBEA 5J18A 1RRBA 2M17A 2G4DB 2KKCA 3ENEA 3NZUA 3ZVVA 4EZJA 2LJ5A 2MW5A 2M8SA 4KV2A 3V61A 1V49A 4FA6A 5J2RA 5BO4B 2NCNA 1E8XA 1WX7A 2Y5BB 2KO3A 3WIMA 2KVRA 2K8CA 1UD7A 3DDCB 4MJSA 3DVNU 4AJYB 4FLHA 5IA7A 3HK0A 4NQKE 3QK0A 4MELA 3L08A 2C60A 1IYFA 4WWPA 3ZNGC 2PJHA 1WGRA 1V80A 5AZFA 3QWZB 2NR2A 1UBIA 4W9DA 5LLIA 3V62A 4KDIC 3PGEA 5AEKB 3PT2B 5DPRA 4IM0A 4IW0A 4BBNC 4W9FA 4BBNF 2DZIA 5D2MB 2KJHB 3KYDD 3A33B 2FIDA 3DBHI 2JXXA 1WE7A 1A5RA 1V5OA 2G3QB 4BOZB 2ZEQA 4MH0E 3HHMA 3PRZA 5E6PA 5L83A 1M94A 1KM7A 2BF8B 1WH3A 3M95A 1WF9A 2RSUA 2XK5B 4BVUC 2O2VB 2ZNVC 2JT4B 2LVOA 3H1UA 2LWPA 2AEHA 2RD0A 2ZNVB 3H7PA 4DHZE 2BWFA 4XC2A 2DAJA 3EHVA 4F8CB 2DYBA 3DBSA 2CKHB 2KX0A 2PPHA 4BKSD 2LD9A 3APFA 3UIOB 2KLCA 1H8CA 4FJYA 2LGYA 1E90A 1YX6B 3QARA 2HD5B 2J0JA 2W9NA 3WAOA 3I3TB 2N4FA 3RT3B 3V60A 1QZEA 2DHZA 3ZO5B 1R4NI 2DYMA 1L2NA 3M62B 2K8HA 4IM2A 2DZMA 4K1RB 3RULA 2D11A 4F1SA 1E8WA 4ICVA 3AU5A 1E8YA 4HCPB 4MGYE 4CHKA 2CS4A 1P1AA 4CO7A 4FJZA 4KZ0A 2JWZA 2MA9B 2V4LA 2KDIA 4BKTA 3WAPA 1XT9B 5DPWA 2NPTB 3ALBA 3APDA 3DQVA 2KTRA 4NAWB 5G2NA 1WGYA 1EF5A 4JIOU 4W9CA 5KHOA 2FCQA 4M8NA 1UH6A 1LXDA 4EZKA 3P2BA 2IZVB 4FHJA 2OJRA 3JYUA 3QHTA 4LDTB 2UWQA 1WGHA 1UGMA 2O6VA 5CX3A 2IO2B 3WA0A 3H7SA 2MBQA 2L00B 3T9LA 2FUHB 2M4NA 2K6DB 3ZKJC 2KC2A 3JW0X 2PE6B 3VUYA 3VHTC 2BYVE 4DWFA 3UQBA 2NBUA 4W9HA 2I1KA 2JF5A 4I6PA 3S2AA 2IO3B 2N1VA 3Q3JA 1WGGA 2KANA 3ZRFA 1E7VA 3UF8A 2WX1A 3VTVA 4KSLC 2LGDA 2HJ8A 1D3ZA 2L05A 2ZVOA 5FR6A 2KQ7A 2ZJDA 2D2QA 4OVUA 1IP9A 3A9KB 2G4SA 1Q1OA 3QA8A 2DYOA 2LZ6A 4PYZA 5CHVC 4G0NB 1GJZA 2QHOA 3TBLD 3VH4B 1OEYA 2KFKA 3KUZA 3RCZA 2BPSA 4J6IA 1PQSA 1WR1A 5L95C 3DCGA 1H4RA 5AZGA 3Q3FA 3ZNZB 3CF6E 4DDID 4AJWA 2GBJA 2BYFA 4KZCA 3ZUNA 3H6NA 4GB9A 4I6LB 4NY0A 4BFRA 1Z5SB 1ISNA 2MBBB 2KZRA 1FXTB 2N7DA 2MWSB 2KMAA 2BYEA 2N9PC 4JLCA 1Y8RC 4RM9A 1RAXA 2DX5B 4HJKA 2I1JA 2HE7A 1SGHA 2KK8A 2KXJA 2M0XA 1WX8A 2IO1B 4KDLB 2N7EA 2M1MA 4W9GA 4GDKB 3N32A 4IG7B 2NS5A 4AWJA 4IC7B 1WR6E 1TTNA 2KX3A 2MX2A 3IBEA 3QCAA 4LDTD 4A3PA 3QIJA 4EUTA 1WM3A 3W1SC 4GDLB 3V6EB 2O6VD 3GZNI 3PV1A 3KH0A 4G50A 3ZLZA 4A20A 3VTWA 4KVGB 1ZKHA 2MSED 4GSWA 2K6QA 4GIVA 4M0WB 1E8ZA 2LGXA 3KUDB 1F9JA 3NHEB 3T8MA 1W6VA 2EMSA 2IBIB 4K7UA 3U30A 1V86A 2K39A 3NZSA 3MJWA 3V6CB 1WJNA 2K25A 1EF1A 2D10A 3M63B 2CHZA 2JRIB 4NNJB 4TKNA 5HKHA 2ASQA 4URKA 3OLMD 4DHJD 2CHXA 1WXAA 2C7HA 2XEWA 1U4AA 3R7QA 3PZDA 3TIXA 4AP4C 4DDGD 1JRUA 2CR5A 2DZKA 4FJVB 3GOEA 2DENB 4X57B 1P0RA 2XK5A 4GN1A 2O2VA 3PPAA 3TCAA 1SIFA 2GBMA 3SDLC 2KTFA 2J0KA 2Z0EB 4B9KA 3IG3A 3D32A 5TR5A 3ZDMC 1WX9A 2UYZB 3VDZA 3A4SC 2BWES 3DBLI 2ZCBA 3X0WA 3EC8A 2FNJB 2D07B 3PLUA 2WYQA 2AL3A 2ZPYA 3PRMB 5JH5C 1C3TA 2JUOA 2Z0DB 2GBRA 3AI5A 3RZFA 1RFAA 4WAAA 1WXVA 2L0FA 2RPQA
chains in the Genus database with same CATH superfamily
3PRPB 1L4DB 2W54A 3EECA 2W3RA 3BYTB 1BT0A 2W55A 1AARA 4MH8A 2V4IB 3WANA 2ZW0A 4TV3A 3R8BA 2WP9B 4WJQA 5KHQA 4WQMA 3SD5A 1N5XA 3PVLA 2IO0B 3FC4A 4ZRPA 1YQ4B 4YSZB 2ZPNA 3A1QB 4OHJA 3Q2AC 2J4XA 2RR9A 3MTNB 3Q8BA 4II2B 4ITKA 2ZCCA 3AE6B 2FAZA 3CSTA 1UZXB 5FK9C 4OZAA 2N9EB 3VRBB 3ML9A 1V5TA 4EKUA 1OTRB 1L0XB 2WXGA 4USAA 2DAFA 4HKZE 1F0ZA 3LMNA 5GMVA 2RGFA 1V81A 3NVVA 4MACA 2EKEC 4WWNA 2BKFA 1R4MI 1XD3B 1GB1A 1S1QB 3Q6BA 1WRIA 1Y56A 4A55A 4XZ4A 3VUWA 2WNMA 4RFBA 1J0GA 1GNUA 5DPTA 4XWWA 1V97A 1N6ZA 4NQLB 5E6OA 4M8MA 4YWGG 1R4MB 4ANWA 1C4AA 2J7QB 3NS8A 5C1ZA 1C76A 3DHGC 1PFDA 2MP2B 2AWTA 1WMHB 2WU5B 2G1EA 3ZIMA 4TUUA 1I4HA 3IFWB 3MC9A 3QJZA 2JPHA 4B0MA 4ZRJA 1WIAA 2E6XA 3Q3MC 1XO3A 2GOWA 4L2YA 2JRHA 4CQNA 3I63C 1YN4A 1VZ7A 3N30A 5BYSA 4HK2A 3NG0A 4KKJA 1WI0A 4YT0B 4TMAB 3NVYA 4NJ7A 4LJPB 5DPSA 2KNBA 4KX6B 2REXA 3N1XC 3RNBC 2KJ6A 1PGXA 2QC8A 3AMZA 3DPDA 4N6EB 4RCOA 2ACZB 1SB3C 4DQOC 3HM3A 1GG3A 3HUIA 1YX5B 2IY0B 2AYOB 3NY5A 4BOSC 1L7YA 2WS3B 4MGKE 5D7GA 1CK1A 2WDTB 4MSQB 2KQSA 4DXGA 1SBBB 2MLBA 3FILB 3IVFA 3O65B 3RNFC 1KLUD 2L32A 3W9CB 1FNWA 4AQ7A 3LYYA 2B3AA 3A1QA 2MCNB 1YD8U 5MPOA 4KGRA 4NAMA 5BYQA 1FFUA 2BKRB 2D3GA 1JRPA 4IWQA 2YEPB 3Q3OC 4OZBA 3HVZA 3BYYB 4DXAB 2Y3AA 4WJOA 4TQ0A 2K22A 4ZYNA 5E6NA 3Q69A 2R2OA 3QC8B 2WDRB 1K51A 2KC1A 3DVNV 3L10B 4ASWC 2L76A 3P4QB 2AL6A 2Q5WD 3TJPA 3MP9A 4W9KA 1X1MA 2KD0A 3R2TA 3AXCA 5LXHA 4ICUA 5EE1A 2PE9A 4A3OA 5AZHA 2IPKD 1J8CA 3KWLA 4NJ6A 1TYGB 4GMVA 2FBWB 5JHAA 4BKSA 1ZOYB 1XEEA 1XQQA 3B0AA 3X23A 2V0GA 2OOBB 3AEGB 2MP2A 3VRAB 1I4RA 1WMHA 1XLNA 1XLOA 1N62A 4P16A 4ZDVA 5G55A 3ZNID 5J18A 2G4DB 4FXCA 4ZYSA 1HZ5A 5J2RA 5BO4B 1V1OA 3WIMA 1MJDA 2KVRA 1LO5D 1UD7A 2NTTA 1DYQA 3ZGZA 4MELA 2BB5A 1I4PA 1V80A 5AZFA 4W9DA 3V62A 1UBIA 3PGEA 1EU4A 1EWCA 3A33B 1A5RA 1V5OA 2G3QB 2TSSA 2DLBA 2LJIA 3HHMA 4YTNB 5E6PA 5L83A 2BF8B 1WH3A 1ESFA 2LWPA 2ZNVB 4NZLB 4F8CB 4YSXB 2DYBA 2LGYA 1YX6B 2W9NA 2N4FA 3V60A 5LNK1 1L2NA 3FILA 4KGSA 2K8HA 4C4VB 1ACCA 4US8A 4F1SA 5G5GA 2K3UA 3AU5A 4MGYE 1QT9A 1FMAD 1P1AA 1HEZE 1N5WA 5IOIA 5LXIB 5G2NA 4EE2A 1EM7A 3P2BA 2IZVB 4A90A 1PDXA 1QQRA 3AM9A 2HDEA 1KLGD 2FUHB 3VHTC 3IAS1 1L0VB 4I6PA 2N1VA 2PMVA 3ZXRA 1SJHD 1JWSD 2MJEA 3VTVA 2JZPA 2HJ8A 1D3ZA 2L05A 5FR6A 3A9KB 5FKAC 1N61A 2DYOA 3VH4B 1QOFA 3TBLD 3SEBA 1WR1A 3DCGA 1F2RI 2V3PA 3I5JC 2JU6X 3ZNZB 4LNFA 4DDID 1R7SA 3H6NA 4C7ZA 1PUTA 2KMAA 4XGAB 4RM9A 1D5MC 2DX5B 4HJKA 1SGHA 3H8HA 1FEHA 2J53A 2IO1B 3KQ4A 4KDLB 2N7EA 2M1MA 4W9GA 4LLGM 2KX3A 4A3PA 4EUTA 3V6EB 3GZNI 4WURA 4G50A 4A20A 3VTWA 2MSED 2WDVB 1XCQL 1E8ZA 2LGXA 5IN7A 3NHEB 1W6VA 2IBIB 1V86A 3V6CB 1EF1A 4PT5A 2JRIB 3BVGA 4DHJD 1MI0A 3GZNB 3R7QA 2QCZA 1JRUA 3TEXA 3AE2B 1XF5L 1P0RA 2BB6A 1KRHA 1JWBD 2J0KA 1QKZA 2N9KA 2BWES 2FUG1 3NJTA 2AL3A 5JH5C 4K3CA 2WXPA 3GS2A 3RZFA 1RFAA 2BBCA 4ZRQA 1WXVA 2JSVX 4QAYA 2RPQA 3GP7A 2VZKB 3DBRI 1L6VA 5T8IA 2E3TA 2L7RA 1I7HA 2R2QA 4S17A 5HFYA 1MHXA 1WXMA 2WXKA 1T0RC 2A4ZA 3W5UB 3DBRB 1ROEA 3R66C 1ZXHA 3KW5B 3JSVB 3A9JA 4K7SA 3CSFA 1E7UA 1HTQA 1TKYA 2WXOA 3Q8AA 1YIWA 3K9PB 4PS7A 2BW2A 3ETRA 3AULA 2KOXA 3BK1A 2MBOA 1XLQA 2YEPF 3OJ4B 3RNCC 1K50A 1DOXA 2L8JA 2K1FA 2M19A 3A9KA 3C0RB 2J0MA 4EOYA 4MSMB 1IBXB 1MG4A 1FXAA 3NVZA 4IOIE 1UELA 2BS2B 1L5PA 4F7ZA 1WYGA 4YTMB 1TY0A 4FHKA 3TUOA 4DBGA 2V3SA 5D94A 2LHEA 2MH7A 4XWTA 1CQVA 3ECIA 1WJ6A 3W1SA 1JCKB 2KACA 2KAJA 3ZW3A 2XBBC 2KVZA 4C00A 2ZVNA 5I4DA 1TJEA 2LMCA 3ZJTA 1JQ4A 4C80A 1E6EB 1C4CA 2KWVB 4ANXA 5G5HA 1E5WA 2JQRB 2RDHA 1T0YA 3L54A 3PO0A 1GC7A 1FRDA 2KDEB 3PTFC 2KLGA 2IY1B 3C8YA 4I6NB 2LVPA 2WXIA 2OJWA 2D3CA 3SHQA 1GOZA 3W5VB 2N1WA 3NUHB 4BFRA 1WRDB 2LUEA 1AWDA 3APCA 4JL9A 2HTHA 4UDUC 3RZWC 1EWYC 2MJDA 3OAWA 3H7PB 1JWAD 4RGTA 3P63A 3UINB 1WYWB 4CYEA 1V2YA 4G3XB 3B08A 3U7DA 3IAM1 1FD6A 1FPYA 1T3QA 3JSVA 1OGWA 3VH3B 2V1YA 5CHFA 1WFYA 2K5PA 3VQIA 3ZJVA 2L83A 4LNKA 2PTLA 2KT7A 1RYJA 1JW9D 2LASA 3RFZB 1TZOA 1MG8A 4P1BC 3HM6X 3ZQ4A 2N7JA 2FCMA 5E6JA 1IBXA 1LFDA 3AE4B 2INPE 1XCTL 1UWXA 3VXWA 4RM8A 3K9OB 3JVZX 1IGCA 5H8YE 4MM3A 3RUIB 4NPNA 3BVMA 4YXDB 2MRPA 4HDQA 4E3CA 3NOBA 3L16A 2YVCA 3DHHC 4Q2JA 1UWMA 2GB1A 3U52E 1KLVA 2KFKB 2KDFB 2G45B 3ZDTA 2SAKA 5CTRC 1HTOA 4BZAA 2UU7A 2BS3B 1DOYA 2BTEA 3PHXB 2CU1A 1N63A 3AE7B 2IJ0A 3U4EG 2BYTA 1NVID 3VFKA 3FKYA 2MBEA 2PVOD 1F2RC 3B2GA 4W9LA 1WY8A 1HXYD 4HPPA 3NZUA 1E7PB 4EZJA 1NENB 3AE5B 2KN4A 4FA6A 1MPEA 2LGSA 4IKGA 2Y5BB 2AQ2B 2KO3A 2K8CA 3DDCB 2D5GA 5IA7A 2Z8LA 5AUIA 1BXTA 2IGDA 5LLIA 1JMLA 2AX5A 2JX5A 4IM0A 4IW0A 4W9FA 3R2IA 3V3XA 4BOZB 1QOGA 4NJCA 1WF9A 2XK5B 3O13A 2PW9A 1PGBA 1TS3A 2JT4B 4M00A 2WXHA 3H7PA 5D3IB 4DHZE 3DBSA 4BKSD 2KX0A 2VH1A 3AEAB 1T5XD 3UIOB 2J0JA 3I3TB 1BUIC 2RPVA 3RT3B 4HEA1 3ZO5B 2DYMA 2QEJC 4TSSA 2MHJA 3M62B 4IM2A 2D11A 1E8YA 2M56B 4CHKA 3Q8FA 4CO7A 4KZ0A 2MA9B 2WDQB 4BKTA 5DPWA 1FCCC 4NAWB 4JIOU 4M8NA 1C79A 1ZE3D 1LXDA 3P4SB 3QHTA 3LXFA 3KWVA 2UWQA 3B9JA 2WXQA 2WXJA 4LNOA 2MBQA 4K3BA 3T9LA 2M4NA 2K6DB 3JW0X 4C56C 3VUYA 2SEBD 2I1KA 2J42A 2PLPA 2IO3B 1WGGA 2KANA 3TEYA 2EKIA 1E7VA 3UF8A 1P7FA 2J52A 5JXVA 1FO4A 2LGDA 2ZJDA 1IP9A 1Q1OA 3QA8A 2BQQA 3TSSA 5AUKA 3RNEC 2QHOA 1OEYA 2KFKA 3AEDB 4J6IA 1H4RA 1SSNA 3SR6A 4ZHOA 1PYWD 2GBJA 4KZCA 4GB9A 1QLBB 3B2FA 1J7AA 2KZRA 2N7DA 2N9PC 1RAXA 5IP4D 3P4PB 4GDKB 3N32A 4IG7B 1TTNA 3QCAA 1ENFA 1UNSA 3HRDD 1HA5A 2Y5PA 4GDLB 4RNAA 3ZLZA 5HG2A 3OWEB 4KVGB 3MFGA 1F9JA 3LB8C 2EMSA 4K7UA 2K39A 3MC8A 2D10A 4H2AA 2ASQA 2C7HA 2XEWA 1U4AA 3TIXA 2CR5A 2WGSA 2DENB 1KTKA 2XK5A 2WU2B 4RH6A 3ZDMC 3VDZA 1DGJA 1ZUD2 4AS1A 3EC8A 2D07B 1UF0A 2WXLA 3RI7C 3PRMB 3P1MA 3AI5A 3N20C 4WAAA 1VDVA 1FNVA 1NYQA 3IT6B 2MJ3A 2L0FA 4GOCA 4IM3A 1IPGA 3FAHA 2V9HA 2CJOA 1E9MA 4NAWA 4C7YA 2A5UA 1NDDA 3L17A 2MQJA 2WXNA 3A9JB 1T0SC 3KUCB 2FIFA 4XE0A 3UIPB 2WXRA 3AEFB 4IWOA 3SU8X 4ACFA 1OEYJ 2LGIA 3ZJUA 4US9A 1B1ZA 3BY4B 1P3QU 2KMMA 2WX0A 4YTPB 1CJEA 3WALA 4DK5A 2GRIA 2QIEB 1I4QA 2WWZA 1F77A 3TMPB 2QJLA 4KKIA 2LFIA 1WZ0A 3AEEB 3N1ZC 4MEMA 4ARIA 1TKGA 2OHFA 5C2TB 3PHWB 4GLSC 2JYTA 4XX5A 3UQAA 2D3BA 3CIRB 4PS3A 1WZ3A 1C9FA 1WXSA 3BWUD 3ML8A 1Q0WB 4HPLB 4GDKA 2KDMA 2ZZPB 3M3JA 2V3NA 1WJ4A 4GDLA 1IUEA 1T0QC 1UBQA 2IGHA 4ZRKA 1TIFA 3DWGC 1YQ3B 1XLPA 5C23A 3AE3B 2KYWA 3MC0B 4GXBA 1D4BA 3EGRA 2D3AA 1VD2A 1NBFC 3EFUA 4ANVA 1A70A 1KOTA 1I42A 1EUVB 2NVUI 4ZRIA 3QAQA 1SE9A 1F1HA 2LI5A 4HPMB 1KF6B 4KSKC 1C1YB 5DCNA 4MDKE 4RGNA 3TEZA 3PLVA 2LXCA 1CZPA 1V8CA 1EU3A 1AYFA 4MGZE 1HE8A 3R3MA 3L13A 3I9V1 4HWIB 2NBWB 4GU2A 3BINA 1FCLA 3AH7A 1YQBA 5CHWA 3UGBB 1M4VA 4EEWA 1V6EA 3MJ5A 3DVGY 1CMXB 4JX1C 1I35A 3L0WB 2LXAA 2Z59B 2LVQA 3NZ3A 1VJKA 3NRZA 4MT5A 1KH0A 4LJOB 5HHDG 4JPSA 3RD2A 3HIZA 4II3B 4P7IA 3DVGX 3VVWB 1TY2A 1Z2MA 3IHPC 1RFKA 3A4RA 4KIKA 3VTUA 3ZRCA 2LRUA 2O6VB 4EFOA 2FCSA 3VR8B 4L23A 1MHHE 4N9F4 3PS6A 2JZ3B 1GUAB 1TS5A 3VUXA 4D2KA 3BZDB 1WXQA 2VZKD 4RMAA 4K7WA 4E71A 5GXGB 1OQQA 4MM3B 2LRWA 4PK1A 1D5ZC 3KYCD 4FN2A 2X8XX 1TZ1A 1K8RB 4MGIE 1VCBA 1FIQA 1SE2A 1L6UA 4HLEA 1VZ8A 2KMCA 4JGHB 1WWTA 2FCNA 1ZDXA 2NMQA 2K0PA 2JWUA 1QF6A 2RDBC 4WH4A 1TGZB 3OG5A 2L3ZA 1YN3A 1J19A 1D6EC 5D6JB 1VRAB 2M17A 3ZVVA 2LJ5A 1FM0D 2M8SA 3V61A 3ZYYX 2NCNA 1E8XA 3DVNU 3BK2A 1JALA 4NQKE 3L08A 1IYFA 5H92C 4WWPA 3ZNGC 3QWZB 2NR2A 3PT2B 5DPRA 4BBNC 4BBNF 2DZIA 3UI3A 2KJHB 3KYDD 5BMHA 4MH0E 3PRZA 2W82A 1M94A 1KM7A 3M95A 3RPFC 3N1YC 5FR3A 2RMMA 2ZNVC 2LVOA 1TS2A 2RD0A 4WWMA 3PZ7A 2HTME 2PIAA 3ZXVA 2BWFA 2QMTA 3HVDA 2CKHB 2LD9A 3P42A 4FJYA 1E90A 4IDIA 3WAOA 1QZEA 1R4NI 1QOBA 4N58A 4K1RB 3RULA 2AQ1B 2CS4A 4FJZA 1SEBD 2KDIA 2MEKA 1Q10A 3WAPA 1VZ6A 1XT9B 3DQVA 2ICIA 2NPTB 5KHOA 1EF5A 3E56A 1R4NB 2B76B 1NI3A 4FHJA 2OJRA 3JYUA 4LDTB 1UGMA 2O6VA 3WA0A 4J3OD 3H7SA 2KC2A 2PE6B 4BAXA 2BYVE 4DWFA 1HQRD 3UQBA 2NBUA 3URYA 3NS1A 4A6QA 3Q3JA 4XYCA 3ZRFA 1F52A 4RGMA 1I4XA 5IKCM 1ZDVA 3I57A 2KQ7A 2D2QA 4OVUA 4PYZA 5CHVC 1GJZA 3W2DA 3RCZA 2BPSA 1PQSA 5L95C 4LNNA 5AZGA 4P6VF 3CF6E 3CWIA 3ZUNA 2XNAC 1JWMD 1Z5SB 2MBBB 1C77A 2NTSA 4JLCA 1Y8RC 2HE7A 2KXJA 1WX8A 3E9SA 1B9RA 5BMGA 2NS5A 4AWJA 1WR6E 2MX2A 4LDTD 1OQRA 2KQ4X 3KLSX 3W1SC 3N9YC 1TS4A 3KH0A 1WGKA 4A8XC 1ZKHA 4GSWA 4M0WA 2K6QA 1N60A 4ZOHC 3U30A 4FBJB 1WJNA 1NYRA 3RMKC 4NNJB 4TKNA 5HKHA 1SF0A 4URKA 3OLMD 2CHXA 2PVGC 1TKEA 1WXAA 4JE3B 3PZDA 4AP4C 1V1PA 4DDGD 1BMLC 4FJVB 3C19A 2M0AA 3TCAA 1SIFA 2GBMA 3SDLC 2QSDA 3IG3A 3D32A 5TR5A 2UYZB 1ET9A 3V05A 1J7CA 3DBLI 2ZCBA 3X0WA 2I2YA 5BYRA 3PLUA 3T3NA 2ZPYA 2Z0DB 2GBRA 3T3OA 2ON8A 3AV8A 2N9XA 3EUB2 4DXFA 3DBLB 2NPTA 2CHWA 5TSSA 2IYDB 2WXFA 3BIID 2JVCA 4TQ1A 4HXDA 4ANUA 1RLFA 2H89B 2KFJA 2EMTA 1NEKB 3NVWA 2KWUB 5IAAC 1KFYB 5JZEB 1YJJA 1GB4A 1VR9A 3P4RB 4JQWC 1V9JA 1NI2A 1JWUD 3CMMB 2NBVB 4XDDA 3AB5A 3BVZA 2H88B 2INDC 1P9DU 1E10A 5EE0A 1EO6A 3WCQA 4HRSA 4YL8A 4HVBA 1MFWA 4RF1A 4B95A 2JY6A 1GC6A 1LGRA 1OFFA 1Q5WB 2WHIA 3EA6A 4M01A 1WGDA 3MHSD 1VLBA 3N3KB 4FULA 2KJRA 1S3SG 3Q3NC 1QILA 2KHWB 4WJNA 4E74A 2KWDA 3VAWA 1OQYA 3ABVB 1G6JA 4AOFA 1FXIA 2KN5A 1ZPSA 3Q8EA 1P98A 2ONQA 1FRRA 1LM8B 1SIJA 4RGOS 2N9LA 3GE8C 4WQOB 1XXGA 4HJGE 1E0ZA 3QQ8B 2GMIC 3VR9B 3ZTCA 1MVKA 2JXTA 1C78A 2C9WB 2JZZA 3AECB 1ZW7A 4LK0M 3U8ZA 4ZHPA 3LJ3A 4M02A 2DZJA 3RYTA 4HCNB 4MJSB 4PS8A 3MHZA 4OW0A 4OVZA 3PREA 3ONSA 4YSYB 3R7RA 5C3JB 4O1NA 4HDOA 4K81A 4B6WA 4BKGA 4WWOA 3TL5A 1IGDA 4G11A 3ZNHB 2BS4B 4JWUC 2GBKA 5J17A 2KDBA 4AUQC 3AU4A 2VRRB 4PYUA 1LQBA 2IDYA 3TEWA 1SE4A 2C7NB 2GBNA 3OJ3A 1WSPA 4EZLA 2L0TA 3H9DA 4IWPA 4W9EA 1HZ6A 4W9JA 5EE9A 1WM2A 3PSEB 4ARCA 1KJTA 2Y5CA 2KTRB 3KVFB 1YJ1A 5JHBA 2C5LC 3Q14C 4S0RA 4FADA 3W1YA 1PGAA 1YOVB 4KIKB 4OZCA 1SJED 2DBYA 2PEAA 3DHIC 4WJPA 2YLMA 1WE6A 5EDSA 2K8BA 1K52A 1I4GA 2L1AA 1K53A 2GLSA 3B1LX 2INNE 4W9IA 3ZTDA 3QX1A 4LCDE 4OVVA 4DHJB 3RN9C 1ZGUB 2QILA 2BGFA 2KWCA 4DHZB 3DOWA 2DWQA 1SE3A 1YJIA 4P1CC 4JWSC 1QOAA 3IT4B 4IUMB 4XDCA 1WJUA 1C4PA 2EELA 1TT5B 2RDGA 3LDZE 2R61A 2MBHA 3RNGC 4L1BA 2C7MB 3WAMA 2GI9A 4GGQA 1TBEA 1RRBA 3ENEA 2KKCA 2MW5A 4KV2A 1V49A 4KGTA 2AQ3B 1WX7A 2PKOA 1RWSA 4MJSA 4AJYB 4FLHA 3HK0A 2FE8A 3GE3C 3QK0A 2C60A 2PJHA 1WGRA 4KDIC 2OEDA 5AEKB 2INCC 3J9CA 5D2MB 2FIDA 3DBHI 2XN9C 2JXXA 1WE7A 2ZEQA 1UGJA 4RF0A 2RSUA 4BVUC 2O2VB 1YMHE 3IXSA 1P7EA 3H1UA 2AEHA 1YN5A 2BT6A 4XC2A 3AE1B 4A9AA 2DAJA 3EHVA 2PPHA 1ZP0B 3APFA 3DBHB 2KLCA 1H8CA 2LEKA 3QARA 2HD5B 4HKQA 1L4ZB 2DHZA 4C4VA 1AW7A 3Q8CA 2DZMA 2W3SA 4WAFA 1E8WA 4ICVA 4HCPB 1L0YB 1DOIA 2CJNA 2JWZA 4HROA 2V4LA 3ALBA 1UUPA 3APDA 5D3DA 2KTRA 1WGYA 2BVCA 4W9CA 2FCQA 1UH6A 4EZKA 1SXTA 1WGHA 5CX3A 2IO2B 2L00B 3ZKJC 2DNFA 4N59A 4W9HA 2JF5A 3S2AA 3PZ8A 5IO9A 2I38A 2WX1A 4KSLC 2ZVOA 1ZXIA 2G4SA 2LZ6A 1ET6A 4G0NB 2CU3A 3AEBB 2HJ1A 3KUZA 2L52A 2VH2A 3Q3FA 1AN8A 1T6BX 4AJWA 2BYFA 4I6LB 4NY0A 1GAQB 1ISNA 1FXTB 2MWSB 2BYEA 2LUMA 2QDFA 2I1JA 2WLBA 3DWMA 2KK8A 2M0XA 4IC7B 3IBEA 3QIJA 1STEA 1WM3A 2O6VD 4LNIA 2LHDA 3U2SC 3PV1A 2IGGA 1FFVA 4REZA 2ZW1A 4GIVA 4LTUA 4M0WB 3KUDB 3T8MA 1J7BA 2JYEA 3NZSA 3MJWA 3AN1A 2K25A 2G9HD 3M63B 2CHZA 2N0SB 3AE9B 3U7ZA 2WQYB 5EE3A 3SFEB 5HI1A 2DZKA 1V1PB 5BMIA 3GOEA 1YNTE 4X57B 4GN1A 2O2VA 3PPAA 2K9XA 2KTFA 2Z0EB 4B9KA 3SFDB 4R3DA 3RNAC 3EFCA 1WX9A 4B0EA 3A4SC 3L4PA 3AE8B 1GPXA 2FNJB 1RM6C 1JROA 1FNUA 2WYQA 1C3TA 2JUOA 3GB1A 4WIPA 1D5XC 2X38A 2WXMA
chains in the Genus database with same CATH topology
3PRPB 2N9XA 3DBRI 4GOCA 4IM3A 1IPGA 2L7RA 2R2QA 2NPTA 3EECA 2CHWA 4NAWA 1BT0A 1AARA 2IYDB 1WXMA 3WANA 2JVCA 4TQ1A 2A4ZA 4HXDA 4TV3A 4ANUA 4WJQA 5KHQA 3R66C 2A5UA 3KW5B 3SD5A 3JSVB 3A9JA 1RLFA 1NDDA 3L17A 3PVLA 2KFJA 4K7SA 2IO0B 1E7UA 2MQJA 3A9JB 2EMTA 2FIFA 3CSFA 3KUCB 3UIPB 4IWOA 2ZPNA 3SU8X 2KWUB 5IAAC 3A1QB 1YIWA 1OEYJ 3K9PB 5JZEB 5LXIB 3BY4B 2RR9A 3MTNB 4II2B 4PS7A 2ZCCA 1P3QU 3AULA 2FAZA 4JQWC 3CSTA 2KOXA 1UZXB 1V9JA 1NI2A 2N9EB 2MBOA 2WX0A 3ML9A 1V5TA 3CMMB 3OJ4B 4EKUA 4DK5A 3WALA 1OTRB 2L8JA 2K1FA 2NBVB 3A9KA 3C0RB 2J0MA 1P9DU 2DAFA 1EO6A 4EOYA 4MSMB 2WWZA 3LMNA 5GMVA 3TMPB 2RGFA 1V81A 4YL8A 4HVBA 1WZ0A 4MEMA 4B95A 2JY6A 1UELA 2EKEC 4WWNA 3PHWB 2BKFA 1GC6A 1R4MI 1Q5WB 1XD3B 4XX5A 4F7ZA 3UQAA 1S1QB 4PS3A 4FHKA 4DBGA 4XZ4A 1WGDA 2V3SA 1WZ3A 3MHSD 3N3KB 5D94A 3VUWA 4FULA 1WXSA 2KJRA 1S3SG 2KHWB 4WJNA 1J0GA 4E74A 1GNUA 3ML8A 5DPTA 1Q0WB 4HPLB 4GDKA 3VAWA 2ZZPB 4NQLB 1OQYA 3M3JA 5E6OA 1G6JA 1WJ4A 4M8MA 3ECIA 4AOFA 4GDLA 4ANWA 2KN5A 1WJ6A 3W1SA 2J7QB 3NS8A 1UBQA 5C1ZA 1P98A 3ZW3A 2XBBC 2ZVNA 1LM8B 2MP2B 4ZRKA 2AWTA 1WMHB 4WQOB 3ZIMA 5C23A 4TUUA 3IFWB 3QJZA 3QQ8B 2GMIC 3ZTCA 2KWVB 4ANXA 4GXBA 2JPHA 4ZRJA 2C9WB 2JZZA 1ZW7A 1VD2A 3U8ZA 1E5WA 1WIAA 1NBFC 3EFUA 4ANVA 3LJ3A 1KOTA 1I42A 1EUVB 2GOWA 2NVUI 2JRHA 2DZJA 3QAQA 4ZRIA 1SE9A 3RYTA 4HCNB 4MJSB 4PS8A 3N30A 2LI5A 1T0YA 4HK2A 4HPMB 3PREA 4KSKC 1WI0A 3ONSA 3L54A 1C1YB 1GC7A 2KDEB 3PTFC 5DCNA 3R7RA 2KLGA 2IY1B 4NJ7A 4HDOA 4I6NB 4K81A 4MDKE 4LJPB 2LVPA 5DPSA 4B6WA 4BKGA 4WWOA 2KNBA 3TL5A 2REXA 4G11A 3SHQA 3PLVA 2LXCA 2KJ6A 2N1WA 4MGZE 3ZNHB 1HE8A 2GBKA 1WRDB 2LUEA 3DPDA 3L13A 3APCA 3R3MA 2KDBA 4AUQC 3AU4A 5J17A 4HWIB 2NBWB 2VRRB 3BINA 4GU2A 4JL9A 1YQBA 2HTHA 1LQBA 4PYUA 5CHWA 3UGBB 3RZWC 4EEWA 1V6EA 2C7NB 2GBNA 3DVGY 3OAWA 3H7PB 3HM3A 3OJ3A 1CMXB 1GG3A 3UINB 1YX5B 2IY0B 1WYWB 2AYOB 4CYEA 4EZLA 3NY5A 4BOSC 1L7YA 1I35A 4MGKE 2L0TA 1V2YA 3L0WB 5D7GA 2LXAA 2Z59B 3H9DA 4G3XB 2WDTB 3B08A 4IWPA 4MSQB 2KQSA 3U7DA 2LVQA 4W9EA 2MLBA 3IVFA 3O65B 3JSVA 1OGWA 4W9JA 3VH3B 2V1YA 1WM2A 3PSEB 4LJOB 2B3AA 5CHFA 3RD2A 1WFYA 3A1QA 3VQIA 3HIZA 4II3B 2MCNB 1YD8U 4FBJB 1KJTA 4P7IA 2KTRB 3KVFB 1YJ1A 2LASA 3DVGX 5JHBA 3VVWB 2C5LC 2BKRB 1MG8A 2D3GA 1Z2MA 3IHPC 4IWQA 4FADA 3HM6X 3W1YA 3A4RA 4KIKA 3VTUA 3ZRCA 4DXAB 2LRUA 4KIKB 2FCMA 2O6VB 4WJOA 4TQ0A 4EFOA 2FCSA 2PEAA 4ZYNA 1LFDA 5E6NA 2R2OA 2YLMA 1WE6A 4WJPA 4N9F4 3PS6A 2JZ3B 5EDSA 2K8BA 1GUAB 3QC8B 3VXWA 3VUXA 2KC1A 3DVNV 3L10B 4RM8A 3K9OB 3JVZX 4RMAA 4K7WA 4E71A 4ASWC 2L76A 4MM3A 3RUIB 4NPNA 3B1LX 2AL6A 2LRWA 4W9IA 3ZTDA 2MRPA 3TJPA 3KYCD 3QX1A 4HDQA 4LCDE 4FN2A 4OVVA 1X1MA 2KD0A 4W9KA 4DHJB 3NOBA 3L16A 4E3CA 1TZ1A 1K8RB 4MGIE 1VCBA 2YVCA 3AXCA 5LXHA 4ICUA 2PE9A 1ZGUB 4HLEA 4A3OA 2BGFA 5AZHA 1KLVA 2KFKB 1J8CA 2KDFB 2KWCA 4DHZB 2G45B 3ZDTA 4NJ6A 3DOWA 4GMVA 2KMCA 5CTRC 4JGHB 5JHAA 2FCNA 4BKSA 4IUMB 1XQQA 3B0AA 3PHXB 3X23A 2OOBB 2CU1A 2MP2A 1TGZB 1WJUA 1WMHA 3LDZE 3VFKA 2L3ZA 2MBHA 2MBEA 4W9LA 1J19A 4ZDVA 2C7MB 3WAMA 5G55A 4GGQA 1WY8A 5D6JB 3ZNID 1TBEA 5J18A 1RRBA 2M17A 2G4DB 2KKCA 3ENEA 3NZUA 3ZVVA 4EZJA 2LJ5A 2MW5A 2M8SA 4KV2A 3V61A 1V49A 4FA6A 5J2RA 5BO4B 2NCNA 1E8XA 1WX7A 2Y5BB 2KO3A 3WIMA 2KVRA 2K8CA 1UD7A 3DDCB 4MJSA 3DVNU 4AJYB 4FLHA 5IA7A 3HK0A 4NQKE 3QK0A 4MELA 3L08A 2C60A 1IYFA 4WWPA 3ZNGC 2PJHA 1WGRA 1V80A 5AZFA 3QWZB 2NR2A 1UBIA 4W9DA 5LLIA 3V62A 4KDIC 3PGEA 5AEKB 3PT2B 5DPRA 4IM0A 4IW0A 4BBNC 4W9FA 4BBNF 2DZIA 5D2MB 2KJHB 3KYDD 3A33B 2FIDA 3DBHI 2JXXA 1WE7A 1A5RA 1V5OA 2G3QB 4BOZB 2ZEQA 4MH0E 3HHMA 3PRZA 5E6PA 5L83A 1M94A 1KM7A 2BF8B 1WH3A 3M95A 1WF9A 2RSUA 2XK5B 4BVUC 2O2VB 2ZNVC 2JT4B 2LVOA 3H1UA 2LWPA 2AEHA 2RD0A 2ZNVB 3H7PA 4DHZE 2BWFA 4XC2A 2DAJA 3EHVA 4F8CB 2DYBA 3DBSA 2CKHB 2KX0A 2PPHA 4BKSD 2LD9A 3APFA 3UIOB 2KLCA 1H8CA 4FJYA 2LGYA 1E90A 1YX6B 3QARA 2HD5B 2J0JA 2W9NA 3WAOA 3I3TB 2N4FA 3RT3B 3V60A 1QZEA 2DHZA 3ZO5B 1R4NI 2DYMA 1L2NA 3M62B 2K8HA 4IM2A 2DZMA 4K1RB 3RULA 2D11A 4F1SA 1E8WA 4ICVA 3AU5A 1E8YA 4HCPB 4MGYE 4CHKA 2CS4A 1P1AA 4CO7A 4FJZA 4KZ0A 2JWZA 2MA9B 2V4LA 2KDIA 4BKTA 3WAPA 1XT9B 5DPWA 2NPTB 3ALBA 3APDA 3DQVA 2KTRA 4NAWB 5G2NA 1WGYA 1EF5A 4JIOU 4W9CA 5KHOA 2FCQA 4M8NA 1UH6A 1LXDA 4EZKA 3P2BA 2IZVB 4FHJA 2OJRA 3JYUA 3QHTA 4LDTB 2UWQA 1WGHA 1UGMA 2O6VA 5CX3A 2IO2B 3WA0A 3H7SA 2MBQA 2L00B 3T9LA 2FUHB 2M4NA 2K6DB 3ZKJC 2KC2A 3JW0X 2PE6B 3VUYA 3VHTC 2BYVE 4DWFA 3UQBA 2NBUA 4W9HA 2I1KA 2JF5A 4I6PA 3S2AA 2IO3B 2N1VA 3Q3JA 1WGGA 2KANA 3ZRFA 1E7VA 3UF8A 2WX1A 3VTVA 4KSLC 2LGDA 2HJ8A 1D3ZA 2L05A 2ZVOA 5FR6A 2KQ7A 2ZJDA 2D2QA 4OVUA 1IP9A 3A9KB 2G4SA 1Q1OA 3QA8A 2DYOA 2LZ6A 4PYZA 5CHVC 4G0NB 1GJZA 2QHOA 3TBLD 3VH4B 1OEYA 2KFKA 3KUZA 3RCZA 2BPSA 4J6IA 1PQSA 1WR1A 5L95C 3DCGA 1H4RA 5AZGA 3Q3FA 3ZNZB 3CF6E 4DDID 4AJWA 2GBJA 2BYFA 4KZCA 3ZUNA 3H6NA 4GB9A 4I6LB 4NY0A 4BFRA 1Z5SB 1ISNA 2MBBB 2KZRA 1FXTB 2N7DA 2MWSB 2KMAA 2BYEA 2N9PC 4JLCA 1Y8RC 4RM9A 1RAXA 2DX5B 4HJKA 2I1JA 2HE7A 1SGHA 2KK8A 2KXJA 2M0XA 1WX8A 2IO1B 4KDLB 2N7EA 2M1MA 4W9GA 4GDKB 3N32A 4IG7B 2NS5A 4AWJA 4IC7B 1WR6E 1TTNA 2KX3A 2MX2A 3IBEA 3QCAA 4LDTD 4A3PA 3QIJA 4EUTA 1WM3A 3W1SC 4GDLB 3V6EB 2O6VD 3GZNI 3PV1A 3KH0A 4G50A 3ZLZA 4A20A 3VTWA 4KVGB 1ZKHA 2MSED 4GSWA 2K6QA 4GIVA 4M0WB 1E8ZA 2LGXA 3KUDB 1F9JA 3NHEB 3T8MA 1W6VA 2EMSA 2IBIB 4K7UA 3U30A 1V86A 2K39A 3NZSA 3MJWA 3V6CB 1WJNA 2K25A 1EF1A 2D10A 3M63B 2CHZA 2JRIB 4NNJB 4TKNA 5HKHA 2ASQA 4URKA 3OLMD 4DHJD 2CHXA 1WXAA 2C7HA 2XEWA 1U4AA 3R7QA 3PZDA 3TIXA 4AP4C 4DDGD 1JRUA 2CR5A 2DZKA 4FJVB 3GOEA 2DENB 4X57B 1P0RA 2XK5A 4GN1A 2O2VA 3PPAA 3TCAA 1SIFA 2GBMA 3SDLC 2KTFA 2J0KA 2Z0EB 4B9KA 3IG3A 3D32A 5TR5A 3ZDMC 1WX9A 2UYZB 3VDZA 3A4SC 2BWES 3DBLI 2ZCBA 3X0WA 3EC8A 2FNJB 2D07B 3PLUA 2WYQA 2AL3A 2ZPYA 3PRMB 5JH5C 1C3TA 2JUOA 2Z0DB 2GBRA 3AI5A 3RZFA 1RFAA 4WAAA 1WXVA 2L0FA 2RPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP B;  2N9X A;  3DBR I;  4GOC A;  4IM3 A;  1IPG A;  2L7R A;  2R2Q A;  2NPT A;  3EEC A;  2CHW A;  4NAW A;  1BT0 A;  1AAR A;  2IYD B;  1WXM A;  3WAN A;  2JVC A;  4TQ1 A;  2A4Z A;  4HXD A;  4TV3 A;  4ANU A;  4WJQ A;  5KHQ A;  3R66 C;  2A5U A;  3KW5 B;  3SD5 A;  3JSV B;  3A9J A;  1RLF A;  1NDD A;  3L17 A;  3PVL A;  2KFJ A;  4K7S A;  2IO0 B;  1E7U A;  2MQJ A;  3A9J B;  2EMT A;  2FIF A;  3CSF A;  3KUC B;  3UIP B;  4IWO A;  2ZPN A;  3SU8 X;  2KWU B;  5IAA C;  3A1Q B;  1YIW A;  1OEY J;  3K9P B;  5JZE B;  5LXI B;  3BY4 B;  2RR9 A;  3MTN B;  4II2 B;  4PS7 A;  2ZCC A;  1P3Q U;  3AUL A;  2FAZ A;  4JQW C;  3CST A;  2KOX A;  1UZX B;  1V9J A;  1NI2 A;  2N9E B;  2MBO A;  2WX0 A;  3ML9 A;  1V5T A;  3CMM B;  3OJ4 B;  4EKU A;  4DK5 A;  3WAL A;  1OTR B;  2L8J A;  2K1F A;  2NBV B;  3A9K A;  3C0R B;  2J0M A;  1P9D U;  2DAF A;  1EO6 A;  4EOY A;  4MSM B;  2WWZ A;  3LMN A;  5GMV A;  3TMP B;  2RGF A;  1V81 A;  4YL8 A;  4HVB A;  1WZ0 A;  4MEM A;  4B95 A;  2JY6 A;  1UEL A;  2EKE C;  4WWN A;  3PHW B;  2BKF A;  1GC6 A;  1R4M I;  1Q5W B;  1XD3 B;  4XX5 A;  4F7Z A;  3UQA A;  1S1Q B;  4PS3 A;  4FHK A;  4DBG A;  4XZ4 A;  1WGD A;  2V3S A;  1WZ3 A;  3MHS D;  3N3K B;  5D94 A;  3VUW A;  4FUL A;  1WXS A;  2KJR A;  1S3S G;  2KHW B;  4WJN A;  1J0G A;  4E74 A;  1GNU A;  3ML8 A;  5DPT A;  1Q0W B;  4HPL B;  4GDK A;  3VAW A;  2ZZP B;  4NQL B;  1OQY A;  3M3J A;  5E6O A;  1G6J A;  1WJ4 A;  4M8M A;  3ECI A;  4AOF A;  4GDL A;  4ANW A;  2KN5 A;  1WJ6 A;  3W1S A;  2J7Q B;  3NS8 A;  1UBQ A;  5C1Z A;  1P98 A;  3ZW3 A;  2XBB C;  2ZVN A;  1LM8 B;  2MP2 B;  4ZRK A;  2AWT A;  1WMH B;  4WQO B;  3ZIM A;  5C23 A;  4TUU A;  3IFW B;  3QJZ A;  3QQ8 B;  2GMI C;  3ZTC A;  2KWV B;  4ANX A;  4GXB A;  2JPH A;  4ZRJ A;  2C9W B;  2JZZ A;  1ZW7 A;  1VD2 A;  3U8Z A;  1E5W A;  1WIA A;  1NBF C;  3EFU A;  4ANV A;  3LJ3 A;  1KOT A;  1I42 A;  1EUV B;  2GOW A;  2NVU I;  2JRH A;  2DZJ A;  3QAQ A;  4ZRI A;  1SE9 A;  3RYT A;  4HCN B;  4MJS B;  4PS8 A;  3N30 A;  2LI5 A;  1T0Y A;  4HK2 A;  4HPM B;  3PRE A;  4KSK C;  1WI0 A;  3ONS A;  3L54 A;  1C1Y B;  1GC7 A;  2KDE B;  3PTF C;  5DCN A;  3R7R A;  2KLG A;  2IY1 B;  4NJ7 A;  4HDO A;  4I6N B;  4K81 A;  4MDK E;  4LJP B;  2LVP A;  5DPS A;  4B6W A;  4BKG A;  4WWO A;  2KNB A;  3TL5 A;  2REX A;  4G11 A;  3SHQ A;  3PLV A;  2LXC A;  2KJ6 A;  2N1W A;  4MGZ E;  3ZNH B;  1HE8 A;  2GBK A;  1WRD B;  2LUE A;  3DPD A;  3L13 A;  3APC A;  3R3M A;  2KDB A;  4AUQ C;  3AU4 A;  5J17 A;  4HWI B;  2NBW B;  2VRR B;  3BIN A;  4GU2 A;  4JL9 A;  1YQB A;  2HTH A;  1LQB A;  4PYU A;  5CHW A;  3UGB B;  3RZW C;  4EEW A;  1V6E A;  2C7N B;  2GBN A;  3DVG Y;  3OAW A;  3H7P B;  3HM3 A;  3OJ3 A;  1CMX B;  1GG3 A;  3UIN B;  1YX5 B;  2IY0 B;  1WYW B;  2AYO B;  4CYE A;  4EZL A;  3NY5 A;  4BOS C;  1L7Y A;  1I35 A;  4MGK E;  2L0T A;  1V2Y A;  3L0W B;  5D7G A;  2LXA A;  2Z59 B;  3H9D A;  4G3X B;  2WDT B;  3B08 A;  4IWP A;  4MSQ B;  2KQS A;  3U7D A;  2LVQ A;  4W9E A;  2MLB A;  3IVF A;  3O65 B;  3JSV A;  1OGW A;  4W9J A;  3VH3 B;  2V1Y A;  1WM2 A;  3PSE B;  4LJO B;  2B3A A;  5CHF A;  3RD2 A;  1WFY A;  3A1Q A;  3VQI A;  3HIZ A;  4II3 B;  2MCN B;  1YD8 U;  4FBJ B;  1KJT A;  4P7I A;  2KTR B;  3KVF B;  1YJ1 A;  2LAS A;  3DVG X;  5JHB A;  3VVW B;  2C5L C;  2BKR B;  1MG8 A;  2D3G A;  1Z2M A;  3IHP C;  4IWQ A;  4FAD A;  3HM6 X;  3W1Y A;  3A4R A;  4KIK A;  3VTU A;  3ZRC A;  4DXA B;  2LRU A;  4KIK B;  2FCM A;  2O6V B;  4WJO A;  4TQ0 A;  4EFO A;  2FCS A;  2PEA A;  4ZYN A;  1LFD A;  5E6N A;  2R2O A;  2YLM A;  1WE6 A;  4WJP A;  4N9F 4;  3PS6 A;  2JZ3 B;  5EDS A;  2K8B A;  1GUA B;  3QC8 B;  3VXW A;  3VUX A;  2KC1 A;  3DVN V;  3L10 B;  4RM8 A;  3K9O B;  3JVZ X;  4RMA A;  4K7W A;  4E71 A;  4ASW C;  2L76 A;  4MM3 A;  3RUI B;  4NPN A;  3B1L X;  2AL6 A;  2LRW A;  4W9I A;  3ZTD A;  2MRP A;  3TJP A;  3KYC D;  3QX1 A;  4HDQ A;  4LCD E;  4FN2 A;  4OVV A;  1X1M A;  2KD0 A;  4W9K A;  4DHJ B;  3NOB A;  3L16 A;  4E3C A;  1TZ1 A;  1K8R B;  4MGI E;  1VCB A;  2YVC A;  3AXC A;  5LXH A;  4ICU A;  2PE9 A;  1ZGU B;  4HLE A;  4A3O A;  2BGF A;  5AZH A;  1KLV A;  2KFK B;  1J8C A;  2KDF B;  2KWC A;  4DHZ B;  2G45 B;  3ZDT A;  4NJ6 A;  3DOW A;  4GMV A;  2KMC A;  5CTR C;  4JGH B;  5JHA A;  2FCN A;  4BKS A;  4IUM B;  1XQQ A;  3B0A A;  3PHX B;  3X23 A;  2OOB B;  2CU1 A;  2MP2 A;  1TGZ B;  1WJU A;  1WMH A;  3LDZ E;  3VFK A;  2L3Z A;  2MBH A;  2MBE A;  4W9L A;  1J19 A;  4ZDV A;  2C7M B;  3WAM A;  5G55 A;  4GGQ A;  1WY8 A;  5D6J B;  3ZNI D;  1TBE A;  5J18 A;  1RRB A;  2M17 A;  2G4D B;  2KKC A;  3ENE A;  3NZU A;  3ZVV A;  4EZJ A;  2LJ5 A;  2MW5 A;  2M8S A;  4KV2 A;  3V61 A;  1V49 A;  4FA6 A;  5J2R A;  5BO4 B;  2NCN A;  1E8X A;  1WX7 A;  2Y5B B;  2KO3 A;  3WIM A;  2KVR A;  2K8C A;  1UD7 A;  3DDC B;  4MJS A;  3DVN U;  4AJY B;  4FLH A;  5IA7 A;  3HK0 A;  4NQK E;  3QK0 A;  4MEL A;  3L08 A;  2C60 A;  1IYF A;  4WWP A;  3ZNG C;  2PJH A;  1WGR A;  1V80 A;  5AZF A;  3QWZ B;  2NR2 A;  1UBI A;  4W9D A;  5LLI A;  3V62 A;  4KDI C;  3PGE A;  5AEK B;  3PT2 B;  5DPR A;  4IM0 A;  4IW0 A;  4BBN C;  4W9F A;  4BBN F;  2DZI A;  5D2M B;  2KJH B;  3KYD D;  3A33 B;  2FID A;  3DBH I;  2JXX A;  1WE7 A;  1A5R A;  1V5O A;  2G3Q B;  4BOZ B;  2ZEQ A;  4MH0 E;  3HHM A;  3PRZ A;  5E6P A;  5L83 A;  1M94 A;  1KM7 A;  2BF8 B;  1WH3 A;  3M95 A;  1WF9 A;  2RSU A;  2XK5 B;  4BVU C;  2O2V B;  2ZNV C;  2JT4 B;  2LVO A;  3H1U A;  2LWP A;  2AEH A;  2RD0 A;  2ZNV B;  3H7P A;  4DHZ E;  2BWF A;  4XC2 A;  2DAJ A;  3EHV A;  4F8C B;  2DYB A;  3DBS A;  2CKH B;  2KX0 A;  2PPH A;  4BKS D;  2LD9 A;  3APF A;  3UIO B;  2KLC A;  1H8C A;  4FJY A;  2LGY A;  1E90 A;  1YX6 B;  3QAR A;  2HD5 B;  2J0J A;  2W9N A;  3WAO A;  3I3T B;  2N4F A;  3RT3 B;  3V60 A;  1QZE A;  2DHZ A;  3ZO5 B;  1R4N I;  2DYM A;  1L2N A;  3M62 B;  2K8H A;  4IM2 A;  2DZM A;  4K1R B;  3RUL A;  2D11 A;  4F1S A;  1E8W A;  4ICV A;  3AU5 A;  1E8Y A;  4HCP B;  4MGY E;  4CHK A;  2CS4 A;  1P1A A;  4CO7 A;  4FJZ A;  4KZ0 A;  2JWZ A;  2MA9 B;  2V4L A;  2KDI A;  4BKT A;  3WAP A;  1XT9 B;  5DPW A;  2NPT B;  3ALB A;  3APD A;  3DQV A;  2KTR A;  4NAW B;  5G2N A;  1WGY A;  1EF5 A;  4JIO U;  4W9C A;  5KHO A;  2FCQ A;  4M8N A;  1UH6 A;  1LXD A;  4EZK A;  3P2B A;  2IZV B;  4FHJ A;  2OJR A;  3JYU A;  3QHT A;  4LDT B;  2UWQ A;  1WGH A;  1UGM A;  2O6V A;  5CX3 A;  2IO2 B;  3WA0 A;  3H7S A;  2MBQ A;  2L00 B;  3T9L A;  2FUH B;  2M4N A;  2K6D B;  3ZKJ C;  2KC2 A;  3JW0 X;  2PE6 B;  3VUY A;  3VHT C;  2BYV E;  4DWF A;  3UQB A;  2NBU A;  4W9H A;  2I1K A;  2JF5 A;  4I6P A;  3S2A A;  2IO3 B;  2N1V A;  3Q3J A;  1WGG A;  2KAN A;  3ZRF A;  1E7V A;  3UF8 A;  2WX1 A;  3VTV A;  4KSL C;  2LGD A;  2HJ8 A;  1D3Z A;  2L05 A;  2ZVO A;  5FR6 A;  2KQ7 A;  2ZJD A;  2D2Q A;  4OVU A;  1IP9 A;  3A9K B;  2G4S A;  1Q1O A;  3QA8 A;  2DYO A;  2LZ6 A;  4PYZ A;  5CHV C;  4G0N B;  1GJZ A;  2QHO A;  3TBL D;  3VH4 B;  1OEY A;  2KFK A;  3KUZ A;  3RCZ A;  2BPS A;  4J6I A;  1PQS A;  1WR1 A;  5L95 C;  3DCG A;  1H4R A;  5AZG A;  3Q3F A;  3ZNZ B;  3CF6 E;  4DDI D;  4AJW A;  2GBJ A;  2BYF A;  4KZC A;  3ZUN A;  3H6N A;  4GB9 A;  4I6L B;  4NY0 A;  4BFR A;  1Z5S B;  1ISN A;  2MBB B;  2KZR A;  1FXT B;  2N7D A;  2MWS B;  2KMA A;  2BYE A;  2N9P C;  4JLC A;  1Y8R C;  4RM9 A;  1RAX A;  2DX5 B;  4HJK A;  2I1J A;  2HE7 A;  1SGH A;  2KK8 A;  2KXJ A;  2M0X A;  1WX8 A;  2IO1 B;  4KDL B;  2N7E A;  2M1M A;  4W9G A;  4GDK B;  3N32 A;  4IG7 B;  2NS5 A;  4AWJ A;  4IC7 B;  1WR6 E;  1TTN A;  2KX3 A;  2MX2 A;  3IBE A;  3QCA A;  4LDT D;  4A3P A;  3QIJ A;  4EUT A;  1WM3 A;  3W1S C;  4GDL B;  3V6E B;  2O6V D;  3GZN I;  3PV1 A;  3KH0 A;  4G50 A;  3ZLZ A;  4A20 A;  3VTW A;  4KVG B;  1ZKH A;  2MSE D;  4GSW A;  2K6Q A;  4GIV A;  4M0W B;  1E8Z A;  2LGX A;  3KUD B;  1F9J A;  3NHE B;  3T8M A;  1W6V A;  2EMS A;  2IBI B;  4K7U A;  3U30 A;  1V86 A;  2K39 A;  3NZS A;  3MJW A;  3V6C B;  1WJN A;  2K25 A;  1EF1 A;  2D10 A;  3M63 B;  2CHZ A;  2JRI B;  4NNJ B;  4TKN A;  5HKH A;  2ASQ A;  4URK A;  3OLM D;  4DHJ D;  2CHX A;  1WXA A;  2C7H A;  2XEW A;  1U4A A;  3R7Q A;  3PZD A;  3TIX A;  4AP4 C;  4DDG D;  1JRU A;  2CR5 A;  2DZK A;  4FJV B;  3GOE A;  2DEN B;  4X57 B;  1P0R A;  2XK5 A;  4GN1 A;  2O2V A;  3PPA A;  3TCA A;  1SIF A;  2GBM A;  3SDL C;  2KTF A;  2J0K A;  2Z0E B;  4B9K A;  3IG3 A;  3D32 A;  5TR5 A;  3ZDM C;  1WX9 A;  2UYZ B;  3VDZ A;  3A4S C;  2BWE S;  3DBL I;  2ZCB A;  3X0W A;  3EC8 A;  2FNJ B;  2D07 B;  3PLU A;  2WYQ A;  2AL3 A;  2ZPY A;  3PRM B;  5JH5 C;  1C3T A;  2JUO A;  2Z0D B;  2GBR A;  3AI5 A;  3RZF A;  1RFA A;  4WAA A;  1WXV A;  2L0F A;  2RPQ A; 
#chains in the Genus database with same CATH topology
 3PRP B;  1L4D B;  2W54 A;  3EEC A;  2W3R A;  3BYT B;  1BT0 A;  2W55 A;  1AAR A;  4MH8 A;  2V4I B;  3WAN A;  2ZW0 A;  4TV3 A;  3R8B A;  2WP9 B;  4WJQ A;  5KHQ A;  4WQM A;  3SD5 A;  1N5X A;  3PVL A;  2IO0 B;  3FC4 A;  4ZRP A;  1YQ4 B;  4YSZ B;  2ZPN A;  3A1Q B;  4OHJ A;  3Q2A C;  2J4X A;  2RR9 A;  3MTN B;  3Q8B A;  4II2 B;  4ITK A;  2ZCC A;  3AE6 B;  2FAZ A;  3CST A;  1UZX B;  5FK9 C;  4OZA A;  2N9E B;  3VRB B;  3ML9 A;  1V5T A;  4EKU A;  1OTR B;  1L0X B;  2WXG A;  4USA A;  2DAF A;  4HKZ E;  1F0Z A;  3LMN A;  5GMV A;  2RGF A;  1V81 A;  3NVV A;  4MAC A;  2EKE C;  4WWN A;  2BKF A;  1R4M I;  1XD3 B;  1GB1 A;  1S1Q B;  3Q6B A;  1WRI A;  1Y56 A;  4A55 A;  4XZ4 A;  3VUW A;  2WNM A;  4RFB A;  1J0G A;  1GNU A;  5DPT A;  4XWW A;  1V97 A;  1N6Z A;  4NQL B;  5E6O A;  4M8M A;  4YWG G;  1R4M B;  4ANW A;  1C4A A;  2J7Q B;  3NS8 A;  5C1Z A;  1C76 A;  3DHG C;  1PFD A;  2MP2 B;  2AWT A;  1WMH B;  2WU5 B;  2G1E A;  3ZIM A;  4TUU A;  1I4H A;  3IFW B;  3MC9 A;  3QJZ A;  2JPH A;  4B0M A;  4ZRJ A;  1WIA A;  2E6X A;  3Q3M C;  1XO3 A;  2GOW A;  4L2Y A;  2JRH A;  4CQN A;  3I63 C;  1YN4 A;  1VZ7 A;  3N30 A;  5BYS A;  4HK2 A;  3NG0 A;  4KKJ A;  1WI0 A;  4YT0 B;  4TMA B;  3NVY A;  4NJ7 A;  4LJP B;  5DPS A;  2KNB A;  4KX6 B;  2REX A;  3N1X C;  3RNB C;  2KJ6 A;  1PGX A;  2QC8 A;  3AMZ A;  3DPD A;  4N6E B;  4RCO A;  2ACZ B;  1SB3 C;  4DQO C;  3HM3 A;  1GG3 A;  3HUI A;  1YX5 B;  2IY0 B;  2AYO B;  3NY5 A;  4BOS C;  1L7Y A;  2WS3 B;  4MGK E;  5D7G A;  1CK1 A;  2WDT B;  4MSQ B;  2KQS A;  4DXG A;  1SBB B;  2MLB A;  3FIL B;  3IVF A;  3O65 B;  3RNF C;  1KLU D;  2L32 A;  3W9C B;  1FNW A;  4AQ7 A;  3LYY A;  2B3A A;  3A1Q A;  2MCN B;  1YD8 U;  5MPO A;  4KGR A;  4NAM A;  5BYQ A;  1FFU A;  2BKR B;  2D3G A;  1JRP A;  4IWQ A;  2YEP B;  3Q3O C;  4OZB A;  3HVZ A;  3BYY B;  4DXA B;  2Y3A A;  4WJO A;  4TQ0 A;  2K22 A;  4ZYN A;  5E6N A;  3Q69 A;  2R2O A;  3QC8 B;  2WDR B;  1K51 A;  2KC1 A;  3DVN V;  3L10 B;  4ASW C;  2L76 A;  3P4Q B;  2AL6 A;  2Q5W D;  3TJP A;  3MP9 A;  4W9K A;  1X1M A;  2KD0 A;  3R2T A;  3AXC A;  5LXH A;  4ICU A;  5EE1 A;  2PE9 A;  4A3O A;  5AZH A;  2IPK D;  1J8C A;  3KWL A;  4NJ6 A;  1TYG B;  4GMV A;  2FBW B;  5JHA A;  4BKS A;  1ZOY B;  1XEE A;  1XQQ A;  3B0A A;  3X23 A;  2V0G A;  2OOB B;  3AEG B;  2MP2 A;  3VRA B;  1I4R A;  1WMH A;  1XLN A;  1XLO A;  1N62 A;  4P16 A;  4ZDV A;  5G55 A;  3ZNI D;  5J18 A;  2G4D B;  4FXC A;  4ZYS A;  1HZ5 A;  5J2R A;  5BO4 B;  1V1O A;  3WIM A;  1MJD A;  2KVR A;  1LO5 D;  1UD7 A;  2NTT A;  1DYQ A;  3ZGZ A;  4MEL A;  2BB5 A;  1I4P A;  1V80 A;  5AZF A;  4W9D A;  3V62 A;  1UBI A;  3PGE A;  1EU4 A;  1EWC A;  3A33 B;  1A5R A;  1V5O A;  2G3Q B;  2TSS A;  2DLB A;  2LJI A;  3HHM A;  4YTN B;  5E6P A;  5L83 A;  2BF8 B;  1WH3 A;  1ESF A;  2LWP A;  2ZNV B;  4NZL B;  4F8C B;  4YSX B;  2DYB A;  2LGY A;  1YX6 B;  2W9N A;  2N4F A;  3V60 A;  5LNK 1;  1L2N A;  3FIL A;  4KGS A;  2K8H A;  4C4V B;  1ACC A;  4US8 A;  4F1S A;  5G5G A;  2K3U A;  3AU5 A;  4MGY E;  1QT9 A;  1FMA D;  1P1A A;  1HEZ E;  1N5W A;  5IOI A;  5LXI B;  5G2N A;  4EE2 A;  1EM7 A;  3P2B A;  2IZV B;  4A90 A;  1PDX A;  1QQR A;  3AM9 A;  2HDE A;  1KLG D;  2FUH B;  3VHT C;  3IAS 1;  1L0V B;  4I6P A;  2N1V A;  2PMV A;  3ZXR A;  1SJH D;  1JWS D;  2MJE A;  3VTV A;  2JZP A;  2HJ8 A;  1D3Z A;  2L05 A;  5FR6 A;  3A9K B;  5FKA C;  1N61 A;  2DYO A;  3VH4 B;  1QOF A;  3TBL D;  3SEB A;  1WR1 A;  3DCG A;  1F2R I;  2V3P A;  3I5J C;  2JU6 X;  3ZNZ B;  4LNF A;  4DDI D;  1R7S A;  3H6N A;  4C7Z A;  1PUT A;  2KMA A;  4XGA B;  4RM9 A;  1D5M C;  2DX5 B;  4HJK A;  1SGH A;  3H8H A;  1FEH A;  2J53 A;  2IO1 B;  3KQ4 A;  4KDL B;  2N7E A;  2M1M A;  4W9G A;  4LLG M;  2KX3 A;  4A3P A;  4EUT A;  3V6E B;  3GZN I;  4WUR A;  4G50 A;  4A20 A;  3VTW A;  2MSE D;  2WDV B;  1XCQ L;  1E8Z A;  2LGX A;  5IN7 A;  3NHE B;  1W6V A;  2IBI B;  1V86 A;  3V6C B;  1EF1 A;  4PT5 A;  2JRI B;  3BVG A;  4DHJ D;  1MI0 A;  3GZN B;  3R7Q A;  2QCZ A;  1JRU A;  3TEX A;  3AE2 B;  1XF5 L;  1P0R A;  2BB6 A;  1KRH A;  1JWB D;  2J0K A;  1QKZ A;  2N9K A;  2BWE S;  2FUG 1;  3NJT A;  2AL3 A;  5JH5 C;  4K3C A;  2WXP A;  3GS2 A;  3RZF A;  1RFA A;  2BBC A;  4ZRQ A;  1WXV A;  2JSV X;  4QAY A;  2RPQ A;  3GP7 A;  2VZK B;  3DBR I;  1L6V A;  5T8I A;  2E3T A;  2L7R A;  1I7H A;  2R2Q A;  4S17 A;  5HFY A;  1MHX A;  1WXM A;  2WXK A;  1T0R C;  2A4Z A;  3W5U B;  3DBR B;  1ROE A;  3R66 C;  1ZXH A;  3KW5 B;  3JSV B;  3A9J A;  4K7S A;  3CSF A;  1E7U A;  1HTQ A;  1TKY A;  2WXO A;  3Q8A A;  1YIW A;  3K9P B;  4PS7 A;  2BW2 A;  3ETR A;  3AUL A;  2KOX A;  3BK1 A;  2MBO A;  1XLQ A;  2YEP F;  3OJ4 B;  3RNC C;  1K50 A;  1DOX A;  2L8J A;  2K1F A;  2M19 A;  3A9K A;  3C0R B;  2J0M A;  4EOY A;  4MSM B;  1IBX B;  1MG4 A;  1FXA A;  3NVZ A;  4IOI E;  1UEL A;  2BS2 B;  1L5P A;  4F7Z A;  1WYG A;  4YTM B;  1TY0 A;  4FHK A;  3TUO A;  4DBG A;  2V3S A;  5D94 A;  2LHE A;  2MH7 A;  4XWT A;  1CQV A;  3ECI A;  1WJ6 A;  3W1S A;  1JCK B;  2KAC A;  2KAJ A;  3ZW3 A;  2XBB C;  2KVZ A;  4C00 A;  2ZVN A;  5I4D A;  1TJE A;  2LMC A;  3ZJT A;  1JQ4 A;  4C80 A;  1E6E B;  1C4C A;  2KWV B;  4ANX A;  5G5H A;  1E5W A;  2JQR B;  2RDH A;  1T0Y A;  3L54 A;  3PO0 A;  1GC7 A;  1FRD A;  2KDE B;  3PTF C;  2KLG A;  2IY1 B;  3C8Y A;  4I6N B;  2LVP A;  2WXI A;  2OJW A;  2D3C A;  3SHQ A;  1GOZ A;  3W5V B;  2N1W A;  3NUH B;  4BFR A;  1WRD B;  2LUE A;  1AWD A;  3APC A;  4JL9 A;  2HTH A;  4UDU C;  3RZW C;  1EWY C;  2MJD A;  3OAW A;  3H7P B;  1JWA D;  4RGT A;  3P63 A;  3UIN B;  1WYW B;  4CYE A;  1V2Y A;  4G3X B;  3B08 A;  3U7D A;  3IAM 1;  1FD6 A;  1FPY A;  1T3Q A;  3JSV A;  1OGW A;  3VH3 B;  2V1Y A;  5CHF A;  1WFY A;  2K5P A;  3VQI A;  3ZJV A;  2L83 A;  4LNK A;  2PTL A;  2KT7 A;  1RYJ A;  1JW9 D;  2LAS A;  3RFZ B;  1TZO A;  1MG8 A;  4P1B C;  3HM6 X;  3ZQ4 A;  2N7J A;  2FCM A;  5E6J A;  1IBX A;  1LFD A;  3AE4 B;  2INP E;  1XCT L;  1UWX A;  3VXW A;  4RM8 A;  3K9O B;  3JVZ X;  1IGC A;  5H8Y E;  4MM3 A;  3RUI B;  4NPN A;  3BVM A;  4YXD B;  2MRP A;  4HDQ A;  4E3C A;  3NOB A;  3L16 A;  2YVC A;  3DHH C;  4Q2J A;  1UWM A;  2GB1 A;  3U52 E;  1KLV A;  2KFK B;  2KDF B;  2G45 B;  3ZDT A;  2SAK A;  5CTR C;  1HTO A;  4BZA A;  2UU7 A;  2BS3 B;  1DOY A;  2BTE A;  3PHX B;  2CU1 A;  1N63 A;  3AE7 B;  2IJ0 A;  3U4E G;  2BYT A;  1NVI D;  3VFK A;  3FKY A;  2MBE A;  2PVO D;  1F2R C;  3B2G A;  4W9L A;  1WY8 A;  1HXY D;  4HPP A;  3NZU A;  1E7P B;  4EZJ A;  1NEN B;  3AE5 B;  2KN4 A;  4FA6 A;  1MPE A;  2LGS A;  4IKG A;  2Y5B B;  2AQ2 B;  2KO3 A;  2K8C A;  3DDC B;  2D5G A;  5IA7 A;  2Z8L A;  5AUI A;  1BXT A;  2IGD A;  5LLI A;  1JML A;  2AX5 A;  2JX5 A;  4IM0 A;  4IW0 A;  4W9F A;  3R2I A;  3V3X A;  4BOZ B;  1QOG A;  4NJC A;  1WF9 A;  2XK5 B;  3O13 A;  2PW9 A;  1PGB A;  1TS3 A;  2JT4 B;  4M00 A;  2WXH A;  3H7P A;  5D3I B;  4DHZ E;  3DBS A;  4BKS D;  2KX0 A;  2VH1 A;  3AEA B;  1T5X D;  3UIO B;  2J0J A;  3I3T B;  1BUI C;  2RPV A;  3RT3 B;  4HEA 1;  3ZO5 B;  2DYM A;  2QEJ C;  4TSS A;  2MHJ A;  3M62 B;  4IM2 A;  2D11 A;  1E8Y A;  2M56 B;  4CHK A;  3Q8F A;  4CO7 A;  4KZ0 A;  2MA9 B;  2WDQ B;  4BKT A;  5DPW A;  1FCC C;  4NAW B;  4JIO U;  4M8N A;  1C79 A;  1ZE3 D;  1LXD A;  3P4S B;  3QHT A;  3LXF A;  3KWV A;  2UWQ A;  3B9J A;  2WXQ A;  2WXJ A;  4LNO A;  2MBQ A;  4K3B A;  3T9L A;  2M4N A;  2K6D B;  3JW0 X;  4C56 C;  3VUY A;  2SEB D;  2I1K A;  2J42 A;  2PLP A;  2IO3 B;  1WGG A;  2KAN A;  3TEY A;  2EKI A;  1E7V A;  3UF8 A;  1P7F A;  2J52 A;  5JXV A;  1FO4 A;  2LGD A;  2ZJD A;  1IP9 A;  1Q1O A;  3QA8 A;  2BQQ A;  3TSS A;  5AUK A;  3RNE C;  2QHO A;  1OEY A;  2KFK A;  3AED B;  4J6I A;  1H4R A;  1SSN A;  3SR6 A;  4ZHO A;  1PYW D;  2GBJ A;  4KZC A;  4GB9 A;  1QLB B;  3B2F A;  1J7A A;  2KZR A;  2N7D A;  2N9P C;  1RAX A;  5IP4 D;  3P4P B;  4GDK B;  3N32 A;  4IG7 B;  1TTN A;  3QCA A;  1ENF A;  1UNS A;  3HRD D;  1HA5 A;  2Y5P A;  4GDL B;  4RNA A;  3ZLZ A;  5HG2 A;  3OWE B;  4KVG B;  3MFG A;  1F9J A;  3LB8 C;  2EMS A;  4K7U A;  2K39 A;  3MC8 A;  2D10 A;  4H2A A;  2ASQ A;  2C7H A;  2XEW A;  1U4A A;  3TIX A;  2CR5 A;  2WGS A;  2DEN B;  1KTK A;  2XK5 A;  2WU2 B;  4RH6 A;  3ZDM C;  3VDZ A;  1DGJ A;  1ZUD 2;  4AS1 A;  3EC8 A;  2D07 B;  1UF0 A;  2WXL A;  3RI7 C;  3PRM B;  3P1M A;  3AI5 A;  3N20 C;  4WAA A;  1VDV A;  1FNV A;  1NYQ A;  3IT6 B;  2MJ3 A;  2L0F A;  4GOC A;  4IM3 A;  1IPG A;  3FAH A;  2V9H A;  2CJO A;  1E9M A;  4NAW A;  4C7Y A;  2A5U A;  1NDD A;  3L17 A;  2MQJ A;  2WXN A;  3A9J B;  1T0S C;  3KUC B;  2FIF A;  4XE0 A;  3UIP B;  2WXR A;  3AEF B;  4IWO A;  3SU8 X;  4ACF A;  1OEY J;  2LGI A;  3ZJU A;  4US9 A;  1B1Z A;  3BY4 B;  1P3Q U;  2KMM A;  2WX0 A;  4YTP B;  1CJE A;  3WAL A;  4DK5 A;  2GRI A;  2QIE B;  1I4Q A;  2WWZ A;  1F77 A;  3TMP B;  2QJL A;  4KKI A;  2LFI A;  1WZ0 A;  3AEE B;  3N1Z C;  4MEM A;  4ARI A;  1TKG A;  2OHF A;  5C2T B;  3PHW B;  4GLS C;  2JYT A;  4XX5 A;  3UQA A;  2D3B A;  3CIR B;  4PS3 A;  1WZ3 A;  1C9F A;  1WXS A;  3BWU D;  3ML8 A;  1Q0W B;  4HPL B;  4GDK A;  2KDM A;  2ZZP B;  3M3J A;  2V3N A;  1WJ4 A;  4GDL A;  1IUE A;  1T0Q C;  1UBQ A;  2IGH A;  4ZRK A;  1TIF A;  3DWG C;  1YQ3 B;  1XLP A;  5C23 A;  3AE3 B;  2KYW A;  3MC0 B;  4GXB A;  1D4B A;  3EGR A;  2D3A A;  1VD2 A;  1NBF C;  3EFU A;  4ANV A;  1A70 A;  1KOT A;  1I42 A;  1EUV B;  2NVU I;  4ZRI A;  3QAQ A;  1SE9 A;  1F1H A;  2LI5 A;  4HPM B;  1KF6 B;  4KSK C;  1C1Y B;  5DCN A;  4MDK E;  4RGN A;  3TEZ A;  3PLV A;  2LXC A;  1CZP A;  1V8C A;  1EU3 A;  1AYF A;  4MGZ E;  1HE8 A;  3R3M A;  3L13 A;  3I9V 1;  4HWI B;  2NBW B;  4GU2 A;  3BIN A;  1FCL A;  3AH7 A;  1YQB A;  5CHW A;  3UGB B;  1M4V A;  4EEW A;  1V6E A;  3MJ5 A;  3DVG Y;  1CMX B;  4JX1 C;  1I35 A;  3L0W B;  2LXA A;  2Z59 B;  2LVQ A;  3NZ3 A;  1VJK A;  3NRZ A;  4MT5 A;  1KH0 A;  4LJO B;  5HHD G;  4JPS A;  3RD2 A;  3HIZ A;  4II3 B;  4P7I A;  3DVG X;  3VVW B;  1TY2 A;  1Z2M A;  3IHP C;  1RFK A;  3A4R A;  4KIK A;  3VTU A;  3ZRC A;  2LRU A;  2O6V B;  4EFO A;  2FCS A;  3VR8 B;  4L23 A;  1MHH E;  4N9F 4;  3PS6 A;  2JZ3 B;  1GUA B;  1TS5 A;  3VUX A;  4D2K A;  3BZD B;  1WXQ A;  2VZK D;  4RMA A;  4K7W A;  4E71 A;  5GXG B;  1OQQ A;  4MM3 B;  2LRW A;  4PK1 A;  1D5Z C;  3KYC D;  4FN2 A;  2X8X X;  1TZ1 A;  1K8R B;  4MGI E;  1VCB A;  1FIQ A;  1SE2 A;  1L6U A;  4HLE A;  1VZ8 A;  2KMC A;  4JGH B;  1WWT A;  2FCN A;  1ZDX A;  2NMQ A;  2K0P A;  2JWU A;  1QF6 A;  2RDB C;  4WH4 A;  1TGZ B;  3OG5 A;  2L3Z A;  1YN3 A;  1J19 A;  1D6E C;  5D6J B;  1VRA B;  2M17 A;  3ZVV A;  2LJ5 A;  1FM0 D;  2M8S A;  3V61 A;  3ZYY X;  2NCN A;  1E8X A;  3DVN U;  3BK2 A;  1JAL A;  4NQK E;  3L08 A;  1IYF A;  5H92 C;  4WWP A;  3ZNG C;  3QWZ B;  2NR2 A;  3PT2 B;  5DPR A;  4BBN C;  4BBN F;  2DZI A;  3UI3 A;  2KJH B;  3KYD D;  5BMH A;  4MH0 E;  3PRZ A;  2W82 A;  1M94 A;  1KM7 A;  3M95 A;  3RPF C;  3N1Y C;  5FR3 A;  2RMM A;  2ZNV C;  2LVO A;  1TS2 A;  2RD0 A;  4WWM A;  3PZ7 A;  2HTM E;  2PIA A;  3ZXV A;  2BWF A;  2QMT A;  3HVD A;  2CKH B;  2LD9 A;  3P42 A;  4FJY A;  1E90 A;  4IDI A;  3WAO A;  1QZE A;  1R4N I;  1QOB A;  4N58 A;  4K1R B;  3RUL A;  2AQ1 B;  2CS4 A;  4FJZ A;  1SEB D;  2KDI A;  2MEK A;  1Q10 A;  3WAP A;  1VZ6 A;  1XT9 B;  3DQV A;  2ICI A;  2NPT B;  5KHO A;  1EF5 A;  3E56 A;  1R4N B;  2B76 B;  1NI3 A;  4FHJ A;  2OJR A;  3JYU A;  4LDT B;  1UGM A;  2O6V A;  3WA0 A;  4J3O D;  3H7S A;  2KC2 A;  2PE6 B;  4BAX A;  2BYV E;  4DWF A;  1HQR D;  3UQB A;  2NBU A;  3URY A;  3NS1 A;  4A6Q A;  3Q3J A;  4XYC A;  3ZRF A;  1F52 A;  4RGM A;  1I4X A;  5IKC M;  1ZDV A;  3I57 A;  2KQ7 A;  2D2Q A;  4OVU A;  4PYZ A;  5CHV C;  1GJZ A;  3W2D A;  3RCZ A;  2BPS A;  1PQS A;  5L95 C;  4LNN A;  5AZG A;  4P6V F;  3CF6 E;  3CWI A;  3ZUN A;  2XNA C;  1JWM D;  1Z5S B;  2MBB B;  1C77 A;  2NTS A;  4JLC A;  1Y8R C;  2HE7 A;  2KXJ A;  1WX8 A;  3E9S A;  1B9R A;  5BMG A;  2NS5 A;  4AWJ A;  1WR6 E;  2MX2 A;  4LDT D;  1OQR A;  2KQ4 X;  3KLS X;  3W1S C;  3N9Y C;  1TS4 A;  3KH0 A;  1WGK A;  4A8X C;  1ZKH A;  4GSW A;  4M0W A;  2K6Q A;  1N60 A;  4ZOH C;  3U30 A;  4FBJ B;  1WJN A;  1NYR A;  3RMK C;  4NNJ B;  4TKN A;  5HKH A;  1SF0 A;  4URK A;  3OLM D;  2CHX A;  2PVG C;  1TKE A;  1WXA A;  4JE3 B;  3PZD A;  4AP4 C;  1V1P A;  4DDG D;  1BML C;  4FJV B;  3C19 A;  2M0A A;  3TCA A;  1SIF A;  2GBM A;  3SDL C;  2QSD A;  3IG3 A;  3D32 A;  5TR5 A;  2UYZ B;  1ET9 A;  3V05 A;  1J7C A;  3DBL I;  2ZCB A;  3X0W A;  2I2Y A;  5BYR A;  3PLU A;  3T3N A;  2ZPY A;  2Z0D B;  2GBR A;  3T3O A;  2ON8 A;  3AV8 A;  2N9X A;  3EUB 2;  4DXF A;  3DBL B;  2NPT A;  2CHW A;  5TSS A;  2IYD B;  2WXF A;  3BII D;  2JVC A;  4TQ1 A;  4HXD A;  4ANU A;  1RLF A;  2H89 B;  2KFJ A;  2EMT A;  1NEK B;  3NVW A;  2KWU B;  5IAA C;  1KFY B;  5JZE B;  1YJJ A;  1GB4 A;  1VR9 A;  3P4R B;  4JQW C;  1V9J A;  1NI2 A;  1JWU D;  3CMM B;  2NBV B;  4XDD A;  3AB5 A;  3BVZ A;  2H88 B;  2IND C;  1P9D U;  1E10 A;  5EE0 A;  1EO6 A;  3WCQ A;  4HRS A;  4YL8 A;  4HVB A;  1MFW A;  4RF1 A;  4B95 A;  2JY6 A;  1GC6 A;  1LGR A;  1OFF A;  1Q5W B;  2WHI A;  3EA6 A;  4M01 A;  1WGD A;  3MHS D;  1VLB A;  3N3K B;  4FUL A;  2KJR A;  1S3S G;  3Q3N C;  1QIL A;  2KHW B;  4WJN A;  4E74 A;  2KWD A;  3VAW A;  1OQY A;  3ABV B;  1G6J A;  4AOF A;  1FXI A;  2KN5 A;  1ZPS A;  3Q8E A;  1P98 A;  2ONQ A;  1FRR A;  1LM8 B;  1SIJ A;  4RGO S;  2N9L A;  3GE8 C;  4WQO B;  1XXG A;  4HJG E;  1E0Z A;  3QQ8 B;  2GMI C;  3VR9 B;  3ZTC A;  1MVK A;  2JXT A;  1C78 A;  2C9W B;  2JZZ A;  3AEC B;  1ZW7 A;  4LK0 M;  3U8Z A;  4ZHP A;  3LJ3 A;  4M02 A;  2DZJ A;  3RYT A;  4HCN B;  4MJS B;  4PS8 A;  3MHZ A;  4OW0 A;  4OVZ A;  3PRE A;  3ONS A;  4YSY B;  3R7R A;  5C3J B;  4O1N A;  4HDO A;  4K81 A;  4B6W A;  4BKG A;  4WWO A;  3TL5 A;  1IGD A;  4G11 A;  3ZNH B;  2BS4 B;  4JWU C;  2GBK A;  5J17 A;  2KDB A;  4AUQ C;  3AU4 A;  2VRR B;  4PYU A;  1LQB A;  2IDY A;  3TEW A;  1SE4 A;  2C7N B;  2GBN A;  3OJ3 A;  1WSP A;  4EZL A;  2L0T A;  3H9D A;  4IWP A;  4W9E A;  1HZ6 A;  4W9J A;  5EE9 A;  1WM2 A;  3PSE B;  4ARC A;  1KJT A;  2Y5C A;  2KTR B;  3KVF B;  1YJ1 A;  5JHB A;  2C5L C;  3Q14 C;  4S0R A;  4FAD A;  3W1Y A;  1PGA A;  1YOV B;  4KIK B;  4OZC A;  1SJE D;  2DBY A;  2PEA A;  3DHI C;  4WJP A;  2YLM A;  1WE6 A;  5EDS A;  2K8B A;  1K52 A;  1I4G A;  2L1A A;  1K53 A;  2GLS A;  3B1L X;  2INN E;  4W9I A;  3ZTD A;  3QX1 A;  4LCD E;  4OVV A;  4DHJ B;  3RN9 C;  1ZGU B;  2QIL A;  2BGF A;  2KWC A;  4DHZ B;  3DOW A;  2DWQ A;  1SE3 A;  1YJI A;  4P1C C;  4JWS C;  1QOA A;  3IT4 B;  4IUM B;  4XDC A;  1WJU A;  1C4P A;  2EEL A;  1TT5 B;  2RDG A;  3LDZ E;  2R61 A;  2MBH A;  3RNG C;  4L1B A;  2C7M B;  3WAM A;  2GI9 A;  4GGQ A;  1TBE A;  1RRB A;  3ENE A;  2KKC A;  2MW5 A;  4KV2 A;  1V49 A;  4KGT A;  2AQ3 B;  1WX7 A;  2PKO A;  1RWS A;  4MJS A;  4AJY B;  4FLH A;  3HK0 A;  2FE8 A;  3GE3 C;  3QK0 A;  2C60 A;  2PJH A;  1WGR A;  4KDI C;  2OED A;  5AEK B;  2INC C;  3J9C A;  5D2M B;  2FID A;  3DBH I;  2XN9 C;  2JXX A;  1WE7 A;  2ZEQ A;  1UGJ A;  4RF0 A;  2RSU A;  4BVU C;  2O2V B;  1YMH E;  3IXS A;  1P7E A;  3H1U A;  2AEH A;  1YN5 A;  2BT6 A;  4XC2 A;  3AE1 B;  4A9A A;  2DAJ A;  3EHV A;  2PPH A;  1ZP0 B;  3APF A;  3DBH B;  2KLC A;  1H8C A;  2LEK A;  3QAR A;  2HD5 B;  4HKQ A;  1L4Z B;  2DHZ A;  4C4V A;  1AW7 A;  3Q8C A;  2DZM A;  2W3S A;  4WAF A;  1E8W A;  4ICV A;  4HCP B;  1L0Y B;  1DOI A;  2CJN A;  2JWZ A;  4HRO A;  2V4L A;  3ALB A;  1UUP A;  3APD A;  5D3D A;  2KTR A;  1WGY A;  2BVC A;  4W9C A;  2FCQ A;  1UH6 A;  4EZK A;  1SXT A;  1WGH A;  5CX3 A;  2IO2 B;  2L00 B;  3ZKJ C;  2DNF A;  4N59 A;  4W9H A;  2JF5 A;  3S2A A;  3PZ8 A;  5IO9 A;  2I38 A;  2WX1 A;  4KSL C;  2ZVO A;  1ZXI A;  2G4S A;  2LZ6 A;  1ET6 A;  4G0N B;  2CU3 A;  3AEB B;  2HJ1 A;  3KUZ A;  2L52 A;  2VH2 A;  3Q3F A;  1AN8 A;  1T6B X;  4AJW A;  2BYF A;  4I6L B;  4NY0 A;  1GAQ B;  1ISN A;  1FXT B;  2MWS B;  2BYE A;  2LUM A;  2QDF A;  2I1J A;  2WLB A;  3DWM A;  2KK8 A;  2M0X A;  4IC7 B;  3IBE A;  3QIJ A;  1STE A;  1WM3 A;  2O6V D;  4LNI A;  2LHD A;  3U2S C;  3PV1 A;  2IGG A;  1FFV A;  4REZ A;  2ZW1 A;  4GIV A;  4LTU A;  4M0W B;  3KUD B;  3T8M A;  1J7B A;  2JYE A;  3NZS A;  3MJW A;  3AN1 A;  2K25 A;  2G9H D;  3M63 B;  2CHZ A;  2N0S B;  3AE9 B;  3U7Z A;  2WQY B;  5EE3 A;  3SFE B;  5HI1 A;  2DZK A;  1V1P B;  5BMI A;  3GOE A;  1YNT E;  4X57 B;  4GN1 A;  2O2V A;  3PPA A;  2K9X A;  2KTF A;  2Z0E B;  4B9K A;  3SFD B;  4R3D A;  3RNA C;  3EFC A;  1WX9 A;  4B0E A;  3A4S C;  3L4P A;  3AE8 B;  1GPX A;  2FNJ B;  1RM6 C;  1JRO A;  1FNU A;  2WYQ A;  1C3T A;  2JUO A;  3GB1 A;  4WIP A;  1D5X C;  2X38 A;  2WXM A; 
#chains in the Genus database with same CATH homology
 3PRP B;  2N9X A;  3DBR I;  4GOC A;  4IM3 A;  1IPG A;  2L7R A;  2R2Q A;  2NPT A;  3EEC A;  2CHW A;  4NAW A;  1BT0 A;  1AAR A;  2IYD B;  1WXM A;  3WAN A;  2JVC A;  4TQ1 A;  2A4Z A;  4HXD A;  4TV3 A;  4ANU A;  4WJQ A;  5KHQ A;  3R66 C;  2A5U A;  3KW5 B;  3SD5 A;  3JSV B;  3A9J A;  1RLF A;  1NDD A;  3L17 A;  3PVL A;  2KFJ A;  4K7S A;  2IO0 B;  1E7U A;  2MQJ A;  3A9J B;  2EMT A;  2FIF A;  3CSF A;  3KUC B;  3UIP B;  4IWO A;  2ZPN A;  3SU8 X;  2KWU B;  5IAA C;  3A1Q B;  1YIW A;  1OEY J;  3K9P B;  5JZE B;  5LXI B;  3BY4 B;  2RR9 A;  3MTN B;  4II2 B;  4PS7 A;  2ZCC A;  1P3Q U;  3AUL A;  2FAZ A;  4JQW C;  3CST A;  2KOX A;  1UZX B;  1V9J A;  1NI2 A;  2N9E B;  2MBO A;  2WX0 A;  3ML9 A;  1V5T A;  3CMM B;  3OJ4 B;  4EKU A;  4DK5 A;  3WAL A;  1OTR B;  2L8J A;  2K1F A;  2NBV B;  3A9K A;  3C0R B;  2J0M A;  1P9D U;  2DAF A;  1EO6 A;  4EOY A;  4MSM B;  2WWZ A;  3LMN A;  5GMV A;  3TMP B;  2RGF A;  1V81 A;  4YL8 A;  4HVB A;  1WZ0 A;  4MEM A;  4B95 A;  2JY6 A;  1UEL A;  2EKE C;  4WWN A;  3PHW B;  2BKF A;  1GC6 A;  1R4M I;  1Q5W B;  1XD3 B;  4XX5 A;  4F7Z A;  3UQA A;  1S1Q B;  4PS3 A;  4FHK A;  4DBG A;  4XZ4 A;  1WGD A;  2V3S A;  1WZ3 A;  3MHS D;  3N3K B;  5D94 A;  3VUW A;  4FUL A;  1WXS A;  2KJR A;  1S3S G;  2KHW B;  4WJN A;  1J0G A;  4E74 A;  1GNU A;  3ML8 A;  5DPT A;  1Q0W B;  4HPL B;  4GDK A;  3VAW A;  2ZZP B;  4NQL B;  1OQY A;  3M3J A;  5E6O A;  1G6J A;  1WJ4 A;  4M8M A;  3ECI A;  4AOF A;  4GDL A;  4ANW A;  2KN5 A;  1WJ6 A;  3W1S A;  2J7Q B;  3NS8 A;  1UBQ A;  5C1Z A;  1P98 A;  3ZW3 A;  2XBB C;  2ZVN A;  1LM8 B;  2MP2 B;  4ZRK A;  2AWT A;  1WMH B;  4WQO B;  3ZIM A;  5C23 A;  4TUU A;  3IFW B;  3QJZ A;  3QQ8 B;  2GMI C;  3ZTC A;  2KWV B;  4ANX A;  4GXB A;  2JPH A;  4ZRJ A;  2C9W B;  2JZZ A;  1ZW7 A;  1VD2 A;  3U8Z A;  1E5W A;  1WIA A;  1NBF C;  3EFU A;  4ANV A;  3LJ3 A;  1KOT A;  1I42 A;  1EUV B;  2GOW A;  2NVU I;  2JRH A;  2DZJ A;  3QAQ A;  4ZRI A;  1SE9 A;  3RYT A;  4HCN B;  4MJS B;  4PS8 A;  3N30 A;  2LI5 A;  1T0Y A;  4HK2 A;  4HPM B;  3PRE A;  4KSK C;  1WI0 A;  3ONS A;  3L54 A;  1C1Y B;  1GC7 A;  2KDE B;  3PTF C;  5DCN A;  3R7R A;  2KLG A;  2IY1 B;  4NJ7 A;  4HDO A;  4I6N B;  4K81 A;  4MDK E;  4LJP B;  2LVP A;  5DPS A;  4B6W A;  4BKG A;  4WWO A;  2KNB A;  3TL5 A;  2REX A;  4G11 A;  3SHQ A;  3PLV A;  2LXC A;  2KJ6 A;  2N1W A;  4MGZ E;  3ZNH B;  1HE8 A;  2GBK A;  1WRD B;  2LUE A;  3DPD A;  3L13 A;  3APC A;  3R3M A;  2KDB A;  4AUQ C;  3AU4 A;  5J17 A;  4HWI B;  2NBW B;  2VRR B;  3BIN A;  4GU2 A;  4JL9 A;  1YQB A;  2HTH A;  1LQB A;  4PYU A;  5CHW A;  3UGB B;  3RZW C;  4EEW A;  1V6E A;  2C7N B;  2GBN A;  3DVG Y;  3OAW A;  3H7P B;  3HM3 A;  3OJ3 A;  1CMX B;  1GG3 A;  3UIN B;  1YX5 B;  2IY0 B;  1WYW B;  2AYO B;  4CYE A;  4EZL A;  3NY5 A;  4BOS C;  1L7Y A;  1I35 A;  4MGK E;  2L0T A;  1V2Y A;  3L0W B;  5D7G A;  2LXA A;  2Z59 B;  3H9D A;  4G3X B;  2WDT B;  3B08 A;  4IWP A;  4MSQ B;  2KQS A;  3U7D A;  2LVQ A;  4W9E A;  2MLB A;  3IVF A;  3O65 B;  3JSV A;  1OGW A;  4W9J A;  3VH3 B;  2V1Y A;  1WM2 A;  3PSE B;  4LJO B;  2B3A A;  5CHF A;  3RD2 A;  1WFY A;  3A1Q A;  3VQI A;  3HIZ A;  4II3 B;  2MCN B;  1YD8 U;  4FBJ B;  1KJT A;  4P7I A;  2KTR B;  3KVF B;  1YJ1 A;  2LAS A;  3DVG X;  5JHB A;  3VVW B;  2C5L C;  2BKR B;  1MG8 A;  2D3G A;  1Z2M A;  3IHP C;  4IWQ A;  4FAD A;  3HM6 X;  3W1Y A;  3A4R A;  4KIK A;  3VTU A;  3ZRC A;  4DXA B;  2LRU A;  4KIK B;  2FCM A;  2O6V B;  4WJO A;  4TQ0 A;  4EFO A;  2FCS A;  2PEA A;  4ZYN A;  1LFD A;  5E6N A;  2R2O A;  2YLM A;  1WE6 A;  4WJP A;  4N9F 4;  3PS6 A;  2JZ3 B;  5EDS A;  2K8B A;  1GUA B;  3QC8 B;  3VXW A;  3VUX A;  2KC1 A;  3DVN V;  3L10 B;  4RM8 A;  3K9O B;  3JVZ X;  4RMA A;  4K7W A;  4E71 A;  4ASW C;  2L76 A;  4MM3 A;  3RUI B;  4NPN A;  3B1L X;  2AL6 A;  2LRW A;  4W9I A;  3ZTD A;  2MRP A;  3TJP A;  3KYC D;  3QX1 A;  4HDQ A;  4LCD E;  4FN2 A;  4OVV A;  1X1M A;  2KD0 A;  4W9K A;  4DHJ B;  3NOB A;  3L16 A;  4E3C A;  1TZ1 A;  1K8R B;  4MGI E;  1VCB A;  2YVC A;  3AXC A;  5LXH A;  4ICU A;  2PE9 A;  1ZGU B;  4HLE A;  4A3O A;  2BGF A;  5AZH A;  1KLV A;  2KFK B;  1J8C A;  2KDF B;  2KWC A;  4DHZ B;  2G45 B;  3ZDT A;  4NJ6 A;  3DOW A;  4GMV A;  2KMC A;  5CTR C;  4JGH B;  5JHA A;  2FCN A;  4BKS A;  4IUM B;  1XQQ A;  3B0A A;  3PHX B;  3X23 A;  2OOB B;  2CU1 A;  2MP2 A;  1TGZ B;  1WJU A;  1WMH A;  3LDZ E;  3VFK A;  2L3Z A;  2MBH A;  2MBE A;  4W9L A;  1J19 A;  4ZDV A;  2C7M B;  3WAM A;  5G55 A;  4GGQ A;  1WY8 A;  5D6J B;  3ZNI D;  1TBE A;  5J18 A;  1RRB A;  2M17 A;  2G4D B;  2KKC A;  3ENE A;  3NZU A;  3ZVV A;  4EZJ A;  2LJ5 A;  2MW5 A;  2M8S A;  4KV2 A;  3V61 A;  1V49 A;  4FA6 A;  5J2R A;  5BO4 B;  2NCN A;  1E8X A;  1WX7 A;  2Y5B B;  2KO3 A;  3WIM A;  2KVR A;  2K8C A;  1UD7 A;  3DDC B;  4MJS A;  3DVN U;  4AJY B;  4FLH A;  5IA7 A;  3HK0 A;  4NQK E;  3QK0 A;  4MEL A;  3L08 A;  2C60 A;  1IYF A;  4WWP A;  3ZNG C;  2PJH A;  1WGR A;  1V80 A;  5AZF A;  3QWZ B;  2NR2 A;  1UBI A;  4W9D A;  5LLI A;  3V62 A;  4KDI C;  3PGE A;  5AEK B;  3PT2 B;  5DPR A;  4IM0 A;  4IW0 A;  4BBN C;  4W9F A;  4BBN F;  2DZI A;  5D2M B;  2KJH B;  3KYD D;  3A33 B;  2FID A;  3DBH I;  2JXX A;  1WE7 A;  1A5R A;  1V5O A;  2G3Q B;  4BOZ B;  2ZEQ A;  4MH0 E;  3HHM A;  3PRZ A;  5E6P A;  5L83 A;  1M94 A;  1KM7 A;  2BF8 B;  1WH3 A;  3M95 A;  1WF9 A;  2RSU A;  2XK5 B;  4BVU C;  2O2V B;  2ZNV C;  2JT4 B;  2LVO A;  3H1U A;  2LWP A;  2AEH A;  2RD0 A;  2ZNV B;  3H7P A;  4DHZ E;  2BWF A;  4XC2 A;  2DAJ A;  3EHV A;  4F8C B;  2DYB A;  3DBS A;  2CKH B;  2KX0 A;  2PPH A;  4BKS D;  2LD9 A;  3APF A;  3UIO B;  2KLC A;  1H8C A;  4FJY A;  2LGY A;  1E90 A;  1YX6 B;  3QAR A;  2HD5 B;  2J0J A;  2W9N A;  3WAO A;  3I3T B;  2N4F A;  3RT3 B;  3V60 A;  1QZE A;  2DHZ A;  3ZO5 B;  1R4N I;  2DYM A;  1L2N A;  3M62 B;  2K8H A;  4IM2 A;  2DZM A;  4K1R B;  3RUL A;  2D11 A;  4F1S A;  1E8W A;  4ICV A;  3AU5 A;  1E8Y A;  4HCP B;  4MGY E;  4CHK A;  2CS4 A;  1P1A A;  4CO7 A;  4FJZ A;  4KZ0 A;  2JWZ A;  2MA9 B;  2V4L A;  2KDI A;  4BKT A;  3WAP A;  1XT9 B;  5DPW A;  2NPT B;  3ALB A;  3APD A;  3DQV A;  2KTR A;  4NAW B;  5G2N A;  1WGY A;  1EF5 A;  4JIO U;  4W9C A;  5KHO A;  2FCQ A;  4M8N A;  1UH6 A;  1LXD A;  4EZK A;  3P2B A;  2IZV B;  4FHJ A;  2OJR A;  3JYU A;  3QHT A;  4LDT B;  2UWQ A;  1WGH A;  1UGM A;  2O6V A;  5CX3 A;  2IO2 B;  3WA0 A;  3H7S A;  2MBQ A;  2L00 B;  3T9L A;  2FUH B;  2M4N A;  2K6D B;  3ZKJ C;  2KC2 A;  3JW0 X;  2PE6 B;  3VUY A;  3VHT C;  2BYV E;  4DWF A;  3UQB A;  2NBU A;  4W9H A;  2I1K A;  2JF5 A;  4I6P A;  3S2A A;  2IO3 B;  2N1V A;  3Q3J A;  1WGG A;  2KAN A;  3ZRF A;  1E7V A;  3UF8 A;  2WX1 A;  3VTV A;  4KSL C;  2LGD A;  2HJ8 A;  1D3Z A;  2L05 A;  2ZVO A;  5FR6 A;  2KQ7 A;  2ZJD A;  2D2Q A;  4OVU A;  1IP9 A;  3A9K B;  2G4S A;  1Q1O A;  3QA8 A;  2DYO A;  2LZ6 A;  4PYZ A;  5CHV C;  4G0N B;  1GJZ A;  2QHO A;  3TBL D;  3VH4 B;  1OEY A;  2KFK A;  3KUZ A;  3RCZ A;  2BPS A;  4J6I A;  1PQS A;  1WR1 A;  5L95 C;  3DCG A;  1H4R A;  5AZG A;  3Q3F A;  3ZNZ B;  3CF6 E;  4DDI D;  4AJW A;  2GBJ A;  2BYF A;  4KZC A;  3ZUN A;  3H6N A;  4GB9 A;  4I6L B;  4NY0 A;  4BFR A;  1Z5S B;  1ISN A;  2MBB B;  2KZR A;  1FXT B;  2N7D A;  2MWS B;  2KMA A;  2BYE A;  2N9P C;  4JLC A;  1Y8R C;  4RM9 A;  1RAX A;  2DX5 B;  4HJK A;  2I1J A;  2HE7 A;  1SGH A;  2KK8 A;  2KXJ A;  2M0X A;  1WX8 A;  2IO1 B;  4KDL B;  2N7E A;  2M1M A;  4W9G A;  4GDK B;  3N32 A;  4IG7 B;  2NS5 A;  4AWJ A;  4IC7 B;  1WR6 E;  1TTN A;  2KX3 A;  2MX2 A;  3IBE A;  3QCA A;  4LDT D;  4A3P A;  3QIJ A;  4EUT A;  1WM3 A;  3W1S C;  4GDL B;  3V6E B;  2O6V D;  3GZN I;  3PV1 A;  3KH0 A;  4G50 A;  3ZLZ A;  4A20 A;  3VTW A;  4KVG B;  1ZKH A;  2MSE D;  4GSW A;  2K6Q A;  4GIV A;  4M0W B;  1E8Z A;  2LGX A;  3KUD B;  1F9J A;  3NHE B;  3T8M A;  1W6V A;  2EMS A;  2IBI B;  4K7U A;  3U30 A;  1V86 A;  2K39 A;  3NZS A;  3MJW A;  3V6C B;  1WJN A;  2K25 A;  1EF1 A;  2D10 A;  3M63 B;  2CHZ A;  2JRI B;  4NNJ B;  4TKN A;  5HKH A;  2ASQ A;  4URK A;  3OLM D;  4DHJ D;  2CHX A;  1WXA A;  2C7H A;  2XEW A;  1U4A A;  3R7Q A;  3PZD A;  3TIX A;  4AP4 C;  4DDG D;  1JRU A;  2CR5 A;  2DZK A;  4FJV B;  3GOE A;  2DEN B;  4X57 B;  1P0R A;  2XK5 A;  4GN1 A;  2O2V A;  3PPA A;  3TCA A;  1SIF A;  2GBM A;  3SDL C;  2KTF A;  2J0K A;  2Z0E B;  4B9K A;  3IG3 A;  3D32 A;  5TR5 A;  3ZDM C;  1WX9 A;  2UYZ B;  3VDZ A;  3A4S C;  2BWE S;  3DBL I;  2ZCB A;  3X0W A;  3EC8 A;  2FNJ B;  2D07 B;  3PLU A;  2WYQ A;  2AL3 A;  2ZPY A;  3PRM B;  5JH5 C;  1C3T A;  2JUO A;  2Z0D B;  2GBR A;  3AI5 A;  3RZF A;  1RFA A;  4WAA A;  1WXV A;  2L0F A;  2RPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...