4A3PA

Structure of usp15 dusp-ubl deletion mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
214
structure length
210
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
total genus 59
structure length 210
sequence length 214
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3pA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3pA01
2N4FA 3ALBA 3L10B 3P2BA 4DBGA 4FLHA 1ZGUB 5DPRA 1WMHB 3R7RA 2VRRB 1V5OA 4CHKA 3BINA 2KO3A 1VCBA 3LDZE 1U4AA 2G3QB 3OAWA 5JHBA 3CMMB 3KYDD 4KDIC 5AZHA 3ZUNA 1JRUA 1XT9B 3QX1A 3UQBA 2L05A 3DOWA 3VUXA 3ZO5B 4GGQA 4ASWC 2CS4A 3W1SA 4XX5A 2ZNVC 5DPTA 3ZTCA 3ZNGC 2KX0A 3N32A 2AEHA 2LI5A 3X23A 4WWOA 1VD2A 4N9F4 5L95C 4F7ZA 1EO6A 2KDBA 4MJSA 5DPSA 4PYUA 2FCMA 4RM8A 3A9KA 3DVNV 1WX9A 5AEKB 2IZVB 2ZJDA 2KJHB 4JGHB 1E8YA 2KXJA 3KVFB 3R66C 1SIFA 1WE7A 1ISNA 4W9HA 3DBLI 2KMCA 3QK0A 4W9LA 5C1ZA 3DBHI 3OJ4B 4LJPB 1NDDA 1YX6B 4ICUA 3TBLD 2M1MA 1V5TA 4KV2A 4HPLB 3VTVA 5JHAA 1TTNA 2NBWB 2RPQA 4LJOB 1IPGA 4MEMA 2KK8A 5E6PA 5JH5C 4NNJB 4W9JA 3X0WA 2LASA 4EZJA 4W9EA 3TMPB 3DVGX 1NBFC 1WF9A 3BY4B 2BYEA 3H1UA 3KUZA 3L16A 3PLVA 4MGIE 5AZGA 3TJPA 3ZRCA 2FUHB 3RYTA 3RCZA 4DXAB 4TQ1A 1P0RA 2KDIA 4AJYB 2O2VB 2DZMA 2FCQA 4DHZB 2L3ZA 3OLMD 4MSMB 2HTHA 3HHMA 4M8NA 1WGHA 3ZDTA 4II3B 2PEAA 3RZWC 3VTWA 2JZ3B 3N30A 2M17A 4LDTD 3PS6A 4B9KA 2KLGA 4FADA 4LCDE 1XQQA 2NR2A 3U8ZA 1E7VA 1Z5SB 2IO1B 2LD9A 1GNUA 3RD2A 2K8HA 3DPDA 1H8CA 3VH3B 1E5WA 3A9JB 3V6EB 2V3SA 4WWNA 3IVFA 2GBKA 2CHZA 4MDKE 1J0GA 3L17A 1WGRA 2BYFA 3B0AA 2KMAA 4GIVA 4ANVA 5KHOA 3CF6E 3QCAA 2GOWA 1H4RA 3AU5A 4KZCA 4URKA 2J0MA 2O6VD 1LM8B 3V62A 4IC7B 2JXXA 2KJ6A 1WGDA 1ZKHA 3ZDMC 2Z59B 3B08A 2ZVNA 2LRWA 2N7DA 3WIMA 1EF1A 1WR1A 1WYWB 2Z0DB 5D94A 2NBUA 2KDFB 3APDA 1WJ6A 2KC2A 4LDTB 1C3TA 1P9DU 3VAWA 1GC7A 2MWSB 3K9OB 2JPHA 3UIOB 4BKSD 4WAAA 2MW5A 4YL8A 4NQKE 4GN1A 4WJQA 3RT3B 2J0KA 4IM0A 1C1YB 2KKCA 3MHSD 4JQWC 3W1YA 1WGGA 4BKTA 1TGZB 4MJSB 3HM3A 2IO3B 4X57B 2ZCCA 3VXWA 3JW0X 3QWZB 4BKGA 2MLBA 2N7EA 4ANXA 4CYEA 5JZEB 1WM2A 2KTRB 2IYDB 1WJUA 5AZFA 1UBQA 3KYCD 4IM2A 4PS7A 2A5UA 4GXBA 1UGMA 3ONSA 4NAWB 3DVNU 2IO2B 1X1MA 4DHJB 4GDLB 3UGBB 2R2OA 4HDQA 5EDSA 4AOFA 2KD0A 1A5RA 4IW0A 3L54A 1TBEA 3U30A 3D32A 1AARA 2M4NA 4MSQB 2HD5B 2JZZA 2AWTA 3WA0A 4DWFA 2NVUI 2CU1A 3A9KB 2MP2A 3NHEB 2CKHB 3UQAA 1WR6E 3M95A 3PGEA 4K7SA 3ZW3A 2KLCA 1E7UA 2LVPA 4KSLC 3EC8A 2KZRA 1WX7A 4GDKB 4WJNA 3GZNI 3PTFC 2ZCBA 4FN2A 5L83A 3H7PA 4GB9A 4W9FA 1GC6A 1R4NI 4NPNA 4XC2A 4ICVA 2BWFA 2L0FA 1V80A 4DDGD 5G2NA 2OJRA 2DX5B 3VDZA 4EZLA 4M8MA 1W6VA 2CHXA 3ZNHB 2LVQA 1WM3A 4CO7A 3ENEA 2C7HA 1WXSA 3SD5A 1L7YA 5KHQA 1GG3A 1LFDA 2WWZA 4KVGB 2KC1A 3WAOA 2D11A 2JVCA 1WJNA 4ZRKA 4F8CB 3DCGA 4K1RB 3JSVA 3ZRFA 2EMTA 4G11A 1FXTB 4B95A 1NI2A 4P7IA 4AUQC 3IG3A 4MGKE 4K7UA 3PREA 3UIPB 3ZNID 2LXCA 2D3GA 3UINB 2GBRA 4FJVB 2JF5A 4E3CA 2Y5BB 4FBJB 4GMVA 1UH6A 2R2QA 3PZDA 1LXDA 4A3OA 2NBVB 1UELA 1WZ0A 3L13A 4DHZE 2N1WA 2O6VA 2A4ZA 2I1KA 3QJZA 4MH0E 4RM9A 2LGDA 4BOZB 1E8ZA 3HM6X 4W9CA 3DQVA 2BPSA 3PRZA 2KVRA 4HK2A 2CHWA 3V61A 4WJPA 4OVUA 3H7SA 4FJYA 3WAMA 1V6EA 4FJZA 3T8MA 3A4RA 4II2B 3N3KB 3LJ3A 4JL9A 3ZLZA 5DPWA 1Z2MA 4OVVA 2KN5A 4W9IA 5LLIA 3T9LA 3U7DA 2DZIA 2WX0A 2LXAA 3HK0A 2K1FA 1SE9A 2REXA 3A1QA 5BO4B 5HKHA 1OGWA 3NZSA 1RRBA 3ML9A 1I42A 2K8CA 3ECIA 2N9XA 3QA8A 2K39A 3V60A 1IYFA 2BF8B 5FR6A 1OEYJ 4J6IA 4NJ6A 2FIDA 3A4SC 2ZZPB 4KDLB 2N9EB 4GOCA 5CX3A 5IAAC 4W9DA 1WY8A 1GUAB 3PPAA 2C9WB 3L0WB 1LQBA 3H7PB 4W9KA 2D07B 2MBEA 1F9JA 2RD0A 2ZEQA 4HPMB 3VVWB 3ZVVA 1SGHA 2EMSA 4ZYNA 4XZ4A 2DZJA 1K8RB 2MBBB 4MM3A 3EECA 4MGYE 2NPTA 4K7WA 1KM7A 2BWES 2ZPYA 3CSTA 3ZTDA 2AL3A 4DDID 3K9PB 4E71A 2RR9A 2FCSA 3CSFA 1WXVA 4ANUA 2G4DB 1YX5B 2JUOA 3Q3FA 2DAJA 2JRIB 2M8SA 3JSVB 3QC8B 1CMXB 5J18A 2W9NA 5J2RA 2PE6B 3OJ3A 2NS5A 2RGFA 4KSKC 3DBSA 5D6JB 1WX8A 3VQIA 4TKNA 3R3MA 3NS8A 3V6CB 4HJKA 1UD7A 2JWZA 1KLVA 2C60A 1WI0A 3GOEA 2M0XA 2NPTB 1QZEA 2XK5A 4EFOA 3VHTC 2IY0B 4EEWA 2KANA 3C0RB 1TZ1A 3AULA 3VUYA 1G6JA 1P3QU 4K81A 4KIKB 5LXIB 3KW5B 2DYMA 1V86A 3WANA 2V4LA 2RSUA 1WRDB 2KFJA 2LWPA 2AL6A 2YVCA 2LGXA 3I3TB 4I6PA 3R7QA 3VFKA 2K6QA 4BBNC 4ZDVA 4I6LB 2O2VA 4EZKA 4AJWA 3RULA 4HWIB 4FULA 1RAXA 3HIZA 2J0JA 2OOBB 1GJZA 3EHVA 4NAWA 2DENB 1ZW7A 2XEWA 2NCNA 3QIJA 4TUUA 4I6NB 1OQYA 2GBMA 3Q3JA 5DCNA 4RMAA 4AWJA 3PVLA 1WXMA 4ZRJA 1V2YA 2MCNB 4IWQA 2KHWB 1WGYA 2IBIB 1OTRB 2KWCA 2LUEA 2JY6A 3JYUA 4NY0A 1V81A 2D10A 1KOTA 2LGYA 2XBBC 2O6VB 4WQOB 2HE7A 3APCA 2DAFA 3UF8A 1IP9A 1E8WA 4PS3A 4HLEA 2LZ6A 3PLUA 1UBIA 3PT2B 1YD8U 2DZKA 3QAQA 3PV1A 2KQ7A 3DDCB 1J19A 2KWVB 2FNJB 1WE6A 2FIFA 1S1QB 3ZIMA 2WYQA 3RZFA 4MGZE 3M3JA 3DBRI 3SU8X 4HVBA 1WFYA 2MA9B 4KIKA 3ZNZB 2KNBA 2LJ5A 4BVUC 2PPHA 4EUTA 4HCPB 4TQ0A 5E6NA 1XD3B 2KQSA 2KX3A 4G50A 2ZNVB 4NQLB 3MJWA 2G45B 4W9GA 3SHQA 3O65B 4EOYA 1Q5WB 1WIAA 4KZ0A 2LVOA 1V49A 2MBOA 1MG8A 2CR5A 1KJTA 4GDKA 4B6WA 1EUVB 2KWUB 3TCAA 1WMHA 5D7GA 2LRUA 2N1VA 2WDTB 1R4MI 2KJRA 2Z0EB 3VUWA 4FHJA 1T0YA 2V1YA 3IBEA 2EKEC 3PRPB 1YJ1A 1P98A 2GMIC 5GMVA 3H9DA 3NOBA 3L08A 2BGFA 2JT4B 3IHPC 1J8CA 5G55A 4TV3A 2PJHA 4F1SA 4GU2A 5LXHA 2C7NB 5CHFA 2JRHA 2UWQA 4IG7B 4PYZA 3VH4B 3MTNB 2HJ8A 4GSWA 3KUCB 3PRMB 2QHOA 1YQBA 1EF5A 3VTUA 2UYZB 4GDLA 2MP2B 5CTRC 3S2AA 1WZ3A 4BOSC 1WXAA 3ML8A 3NY5A 1RLFA 1RFAA 4HCNB 1P1AA 2K6DB 3AXCA 1YIWA 2DYBA 5E6OA 2KTRA 3SDLC 3AU4A 2KDEB 4DHJD 5C23A 4EKUA 2KTFA 1Q1OA 2L76A 4FHKA 4IUMB 1M94A 3KUDB 1L2NA 3AI5A 4NJ7A 2GBJA 1PQSA 2MRPA 1I35A 2KFKA 4PS8A 1HE8A 1OEYA 3A1QB 4MELA 2FCNA 2MSED 2IY1B 4IWOA 2AYOB 2G4SA 2ZVOA 2KFKB 5IA7A 3JVZX 4AP4C 3APFA 2WX1A 3IFWB 2L0TA 4JIOU 5TR5A 2ASQA 2MBQA 2YLMA 3WALA 4ANWA 4ZRIA 3TL5A 3DVGY 1WJ4A 2C5LC 3QHTA 3B1LX 5CHWA 3EFUA 2MBHA 2D2QA 2L00B 4JLCA 3ZKJC 2C7MB 4E74A 4WWPA 5J17A 4G3XB 4BKSA 2ZPNA 2IO0B 3PHWB 3NZUA 1WH3A 1D3ZA 2DYOA 2N9PC 4IWPA 2B3AA 2MX2A 3QARA 5CHVC 5D2MB 3RUIB 4BBNF 4BFRA 4A3PA 3TIXA 2I1JA 3KH0A 2L7RA 4M0WB 1E8XA 1Q0WB 2K25A 3QQ8B 2BYVE 4HXDA 3WAPA 1Y8RC 2MQJA 3M62B 3W1SC 2GBNA 2J7QB 2FAZA 1S3SG 3A9JA 4WJOA 4A20A 3A33B 4HDOA 2KOXA 2XK5B 3PSEB 2BKRB 4G0NB 4DK5A 1BT0A 2K8BA 1E90A 4FA6A 2PE9A 3M63B 1UZXB 2DHZA 3PHXB 3LMNA 4IM3A 3H6NA 1V9JA 2L8JA 2BKFA
chains in the Genus database with same CATH superfamily
1V5OA 3RI7C 3OAWA 3CMMB 3AM9A 4KDIC 3ZUNA 1JRUA 1BXTA 2LHDA 3DOWA 3VUXA 4ASWC 1CK1A 2NTSA 1EO6A 2IPKD 2OJWA 4MJSA 2KT7A 4PYUA 4RM8A 1TJEA 2V0GA 1WE7A 4NAMA 2KMCA 2ACZB 2IGDA 1YX6B 2M1MA 4RF1A 1V5TA 5H92C 5JHAA 4CQNA 4MEMA 4W9JA 2D5GA 2PW9A 2LHEA 2M19A 2X8XX 3H1UA 2FUHB 2O2VB 3NS1A 2DZMA 2QSDA 4PK1A 1FM0D 4MSMB 2W82A 3ZDTA 1YNTE 4YXDB 4QAYA 1QOGA 3NVZA 2M17A 1HTQA 3PS6A 2CJOA 2IO1B 3N1ZC 2LD9A 1GNUA 4JX1C 2CU3A 1E5WA 2EELA 3B0AA 2KMAA 2WP9B 4GIVA 1HQRD 4S17A 1OQRA 3CF6E 3QCAA 4RCOA 2O6VD 2M56B 5FR3A 2INPE 2KJ6A 4J3OD 3B9JA 1NVID 2Z0DB 3WCQA 4A55A 1WJ6A 1L6UA 2K0PA 1P9DU 2LMCA 1C3TA 4BKSD 4WAAA 2I2YA 2MW5A 3NVWA 4YL8A 4WJQA 3RT3B 1C1YB 2KKCA 3W1YA 4BAXA 3HM3A 2IO3B 3VXWA 3JW0X 4ANXA 1WM2A 1ZDXA 5AZFA 2K9XA 1UGMA 4NAWB 3RFZB 2IO2B 5EDSA 2QMTA 2KD0A 4AOFA 1A5RA 3U30A 1T0SC 4B0EA 1AARA 2VZKD 2M4NA 2BBCA 4MSQB 4AS1A 2JZZA 4DWFA 3A9KB 4XYCA 2E6XA 4US8A 3ZW3A 1NEKB 4ACFA 5L83A 4GB9A 3RNFC 1R4NI 2BWFA 4DDGD 2OJRA 4P16A 1JW9D 2WXIA 3DHGC 1TKGA 3AN1A 3ZNHB 1WM3A 2C7HA 3SD5A 1L7YA 1GG3A 2KC1A 2D11A 3JSVA 3BK1A 1N61A 5BMIA 4KGTA 4G11A 1FXTB 4AUQC 3PREA 3UIPB 1T6BX 2D3GA 1T5XD 3UINB 4E3CA 1JCKB 4OZCA 4OHJA 1FFVA 1PFDA 2V4IB 3PZDA 3L13A 1TS3A 4N58A 1XF5L 4YTMB 4RM9A 4BOZB 1SIJA 2BPSA 2KVRA 2CHWA 4OVUA 3HVDA 2IGHA 4FXCA 3WAMA 4FJZA 1V1OA 4JWUC 3ZLZA 3LJ3A 1FCLA 5EE3A 1Z2MA 5LLIA 1MHXA 1ZPSA 2LXAA 3HK0A 4NZLB 1RRBA 1I42A 2Y5PA 5G5GA 1IYFA 1OEYJ 4J6IA 4KDLB 1WY8A 2C9WB 2MBEA 3ZVVA 1E7PB 3VVWB 1SE2A 2K22A 1WXQA 4HJGE 2JWUA 2FCSA 1WXVA 2G4DB 2DAJA 2NS5A 4AQ7A 3MP9A 1L6VA 2JWZA 4EFOA 1I4GA 3C0RB 3VUYA 1G6JA 1P3QU 1FFUA 2MHJA 3WANA 2V4LA 3Q8BA 3AMZA 2LWPA 3I3TB 2LGXA 2DLBA 4I6LB 2O2VA 3TUOA 3EHVA 3U7ZA 2NCNA 4TUUA 2GBMA 3AEDB 1XCQL 3DBLB 1SJED 1RM6C 3NJTA 4ZRJA 4WH4A 4IWQA 1SE3A 2IBIB 2GRIA 3Q3OC 1KLUD 2WXHA 4NY0A 1TT5B 1EU3A 5BYQA 4PS3A 2NTTA 2LZ6A 3PLUA 1UBIA 3PT2B 1UUPA 1YD8U 2DZKA 3NG0A 3QAQA 2FNJB 1WE6A 2FIFA 2MJ3A 3DBRI 1FO4A 2KNBA 4BVUC 1CZPA 4TQ0A 1XD3B 2KX3A 1SBBB 4W9GA 4C4VB 4MT5A 2LVOA 1C9FA 2PVGC 4B6WA 4M00A 3KLSX 1TY0A 1T0RC 2IDYA 1VDVA 4OVZA 4FHJA 2BS3B 3PRPB 1KF6B 5GMVA 3NOBA 2WXRA 3L08A 1YQ4B 1N5XA 3GZNB 3IHPC 4YSXB 4GU2A 1A70A 5CHFA 1XCTL 2L83A 1J7BA 1YN4A 4JE3B 3TEYA 1V1PA 1FNWA 3KUCB 5LNK1 2QHOA 1JWAD 3VTUA 4GDLA 3S2AA 1F0ZA 2Z8LA 1AYFA 1E6EB 1WXAA 4LK0M 1QT9A 1YIWA 3SR6A 2KTRA 3P4PB 5C23A 4IUMB 1ROEA 1TZOA 2GBJA 1MFWA 2KFKA 4PS8A 1OEYA 2AQ2B 2MSED 2IY1B 3GE8C 5IA7A 2XN9C 1RFKA 5TR5A 2MBQA 3W5UB 2N9LA 3RMKC 2MBHA 1WGKA 2L00B 1WWTA 2C7MB 1AN8A 2N0SB 1PGXA 3U52E 5J17A 3AEGB 4G3XB 4ITKA 1WH3A 1FMAD 3SFEB 4BBNF 3RUIB 5D2MB 4A3PA 2I1JA 4M0WB 3I9V1 1V97A 1Q0WB 1WYGA 2J52A 4JPSA 3W1SC 2DBYA 3BWUD 3A33B 2KOXA 1YN3A 4GLSC 4DK5A 4LNFA 2K8BA 3EGRA 2PE9A 2BB5A 2BKFA 3O13A 2BQQA 2N4FA 1K50A 1XLNA 3BVZA 1YMHE 4YTPB 1VCBA 3FAHA 2G3QB 1J7AA 3KYDD 4H2AA 1XT9B 2L05A 1MVKA 2BB6A 2ZNVC 2KX0A 1LGRA 2LI5A 4N9F4 5FKAC 1SE4A 5AEKB 2IZVB 1FXAA 2KJHB 2WXOA 4JGHB 1E8YA 2KXJA 3KVFB 1VZ8A 1ISNA 1NYRA 5IOIA 4ICUA 1N60A 3TBLD 3MFGA 4HPLB 4HEA1 3VTVA 1VZ7A 2RPQA 1IPGA 2KK8A 1QLBB 1HXYD 4EZJA 3DVGX 3KUZA 3BY4B 2BYEA 3GS2A 5AZGA 3ZRCA 2RPVA 3RYTA 3RCZA 2INCC 2KMMA 3Q2AC 2FCQA 4LNNA 5E6JA 4M8NA 1WGHA 1UGJA 4II3B 3VTWA 1JROA 2Y5CA 1HEZE 1SF0A 1C78A 4LCDE 1XQQA 1E7VA 3PO0A 2W3SA 4JWSC 3A9JB 4MDKE 2CHZA 3L17A 1WGRA 1N63A 2YEPB 5KHOA 3IAM1 4IC7B 1WGDA 1ZKHA 2MEKA 3WIMA 1C77A 3BVGA 4A8XC 2KDFB 2KVZA 1HTOA 1TYGB 1FEHA 3VAWA 1GC7A 2MWSB 2J42A 4IM0A 3MHSD 4MJSB 2ZCCA 4XGAB 3R2TA 1C4CA 3AE9B 4ZRPA 2IYDB 1WJUA 2PVOD 1UBQA 1QOFA 3KYCD 4PS7A 4IM2A 3IXSA 2A5UA 3ONSA 2J4XA 1X1MA 2R2OA 4IW0A 1TBEA 3V05A 3D32A 2HD5B 2AWTA 2WXKA 2NVUI 1VJKA 2CKHB 4N6EB 1WR6E 2KLCA 4LTUA 1E7UA 2LVPA 2W3RA 4WAFA 1WX7A 3TEWA 4ARIA 3GZNI 2ZCBA 5H8YE 2BS4B 1TS4A 4XC2A 1GC6A 4NPNA 1ZDVA 1VLBA 1D4BA 2DX5B 1W6VA 2CHXA 4LNKA 1FNVA 5KHQA 2BW2A 1KFYB 2WWZA 4KVGB 2JVCA 5C3JB 1WJNA 4ZRKA 3VRAB 4F8CB 4K3CA 3ZRFA 2L52A 2GLSA 1NENB 3ZNID 4FJVB 2JF5A 2WDRB 4ZRQA 2QIEB 4GMVA 4MACA 1UH6A 5BYRA 4C4VA 4DHZE 2O6VA 2I1KA 3P4SB 2MJEA 3QJZA 2LGDA 1E8ZA 3HM6X 3SFDB 1J7CA 3PRZA 4HK2A 4WJPA 3DWMA 4FJYA 1L0VB 3KQ4A 4JL9A 3AE1B 4OVVA 3T9LA 2LFIA 2WX0A 3LYYA 1CQVA 2K1FA 3AEBB 1OGWA 2K8CA 3ECIA 3QA8A 5G5HA 1IBXA 3A4SC 1BUIC 2WU5B 4W9DA 3RNEC 3T3OA 1DOYA 1F9JA 2EMSA 1V8CA 2MBBB 4MGYE 1R7SA 1KRHA 3K9PB 4E71A 3QC8B 2JRIB 3JSVB 1DYQA 3OWEB 2KAJA 2W9NA 5J2RA 3UI3A 2XNAC 1WX8A 3AH7A 2V9HA 3R3MA 3NS8A 1GPXA 4OZBA 3GOEA 2NPTB 3VHTC 4EEWA 2KANA 3Q8AA 2INDC 3KW5B 1V86A 2WDVB 1WRDB 2OEDA 4I6PA 2YVCA 4BBNC 4ZDVA 3VFKA 3RULA 1RAXA 2J0JA 3LXFA 2DENB 2IJ0A 1HZ5A 1ET9A 3QIJA 1D5MC 3PVLA 2WXPA 1JQ4A 1V2YA 1L4ZB 2V3PA 1K53A 3JYUA 2JY6A 4XE0A 1V81A 1JWMD 2XBBC 2O6VB 3UF8A 1E8WA 4HLEA 5C2TB 3PV1A 2KQ7A 3ZJVA 1J19A 3DHHC 2E3TA 2BTEA 3M3JA 1WFYA 3ZNZB 2BVCA 2RDBC 4G50A 3NZ3A 1YOVB 1FNUA 4KZ0A 1V49A 3ZJUA 3FILA 1JALA 1UWXA 4GDKA 1EUVB 2PLPA 1AWDA 5D7GA 2LRUA 3RNBC 2N1VA 2Z0EB 2V1YA 3IBEA 3AE2B 3H9DA 1KTKA 1FRRA 4RGTA 1Y56A 5LXHA 1TY2A 2JRHA 3RN9C 2H89B 4IG7B 3MTNB 1TIFA 1RYJA 4K3BA 3PRMB 1YQBA 3AEEB 3EA6A 1WZ3A 1RLFA 1T0QC 2K6DB 3AXCA 2DYBA 5E6OA 3SDLC 1FXIA 3W2DA 2DNFA 3NVYA 2QILA 4XDCA 1M94A 3KUDB 1L2NA 2MJDA 1AW7A 2MRPA 2KYWA 1I35A 1HE8A 4MELA 1N5WA 5BMHA 4AP4C 4EE2A 2ASQA 2YLMA 3TL5A 3QHTA 2D2QA 4JLCA 2N9KA 2B76B 4P1CC 2IO0B 3PHWB 4LNOA 2N9PC 2B3AA 5CHVC 3Q3NC 1ZP0B 4ZOHC 4D2KA 2KACA 1P7FA 2QC8A 3QQ8B 1UNSA 4BZAA 1C76A 1Y8RC 4A20A 2K5PA 1JWSD 2VH1A 2XK5B 5EE9A 4FA6A 2D3AA 1UZXB 3VR8B 4IM3A 1IGDA 2SAKA 2L8JA 2WU2B 3P2BA 4DBGA 1YJIA 1WMHB 3R7RA 3IAS1 2QCZA 2VH2A 3GP7A 3BINA 2KO3A 3LDZE 4C80A 1U4AA 3VRBB 2FUG1 3QX1A 3UQBA 4HROA 2WXFA 3URYA 3ZTCA 3ZQ4A 4LLGM 1D5ZC 4KGRA 1DOXA 4L1BA 2KDBA 4KKJA 4YSYB 5DPSA 3A9KA 1WX9A 2OHFA 3P4QB 3B2FA 4W9LA 3OJ4B 3MJ5A 4IKGA 1L5PA 3L4PA 4KV2A 1JMLA 1KLGD 1TTNA 4L2YA 5E6PA 3PZ8A 3X0WA 4RGMA 4C56C 5AUIA 3AECB 1NBFC 1WF9A 1YN5A 3TJPA 5T8IA 4DXAB 4TQ1A 1P0RA 5I4DA 4DHZB 2DWQA 1JWBD 1V1PB 2KN4A 3HHMA 4M01A 4ARCA 4XWTA 2W54A 4KKIA 4LDTD 3HUIA 2KLGA 4FADA 3Q14C 3U8ZA 3DPDA 2V3SA 4WWNA 3IVFA 2WXLA 1ZXIA 4ZHOA 4HKZE 1HA5A 3NRZA 1IGCA 3P42A 4ANVA 3U2SC 2WLBA 2G9HD 1H4RA 2GOWA 3AU5A 1I4XA 1TKEA 1Q10A 3E9SA 4KZCA 2SEBD 1LM8B 2J53A 3ZDMC 2Z59B 4HPPA 3B08A 3MC0B 2LRWA 1EF1A 1WYWB 5D94A 2NBUA 1UWMA 1FIQA 4M02A 1E9MA 1ET6A 4LDTB 1XO3A 3UIOB 2L1AA 1XXGA 4NQKE 5BYSA 2YEPF 4JQWC 1WGGA 1TGZB 4RH6A 4X57B 2MH7A 5JZEB 2KTRB 2JX5A 3DBRB 2IGGA 3J9CA 3Q8FA 3IT6B 2AQ3B 4GXBA 3FKYA 4GDLB 1WRIA 3ZXRA 1MG4A 3WA0A 2MP2A 3NHEB 3UQAA 3MC9A 3PGEA 2PTLA 4K7SA 2KDMA 2WXJA 1SSNA 4KSLC 2KZRA 1DOIA 4GDKB 3RNGC 1E10A 1SJHD 2PIAA 1F77A 4W9FA 4ICVA 3Q8EA 4L23A 2L0FA 3I5JC 1FPYA 2ON8A 2WNMA 1IUEA 2WHIA 1WXSA 2W55A 4XWWA 1LFDA 1C4PA 3WAOA 2EKIA 3Q69A 4K1RB 4O1NA 2WGSA 1NI2A 4MGKE 3FILB 2GBRA 1P7EA 4FBJB 3P1MA 2NBVB 1TKYA 1UELA 3VR9B 1WZ0A 3C8YA 3RPFC 2V3NA 2WDQB 2QJLA 4W9CA 3V61A 2WXGA 4A6QA 3H7SA 1V6EA 2HTME 3A4RA 3N3KB 4WIPA 4W9IA 2KN5A 3U7DA 2FBWB 4C00A 2REXA 3A1QA 5HKHA 3NZSA 3ML9A 2N9XA 3AE4B 1XLOA 2K39A 1VR9A 3V60A 5FR6A 4LNIA 2ZZPB 5IAAC 4GOCA 5CX3A 1ESFA 1GUAB 3PPAA 3L0WB 3OG5A 1PGBA 3H7PB 4W9KA 3RNAC 4HPMB 2RD0A 3AE7B 2UU7A 4XZ4A 1K8RB 4MM3A 3W5VB 1KM7A 2BWES 2ZPYA 3ZTDA 2AL3A 4DDID 3Q6BA 3CSFA 4ANUA 3Q3FA 2PE6B 3OJ3A 2RGFA 5D6JB 2H88B 4HJKA 1KLVA 1PUTA 2C60A 1GAQB 2M0XA 1QQRA 2XK5A 2IY0B 1TZ1A 4K81A 4KIKB 2DYMA 2RSUA 2KFJA 2AL6A 3R7QA 5IKCM 4EZKA 4AJWA 3HIZA 2OOBB 2JYEA 1GJZA 2GI9A 1JRPA 4NAWA 3AE5B 1ZW7A 4RGOS 4I6NB 1OQYA 3HRDD 5BMGA 3I57A 4RMAA 5DCNA 4AWJA 3GB1A 2MCNB 1WSPA 2KHWB 1OTRB 2LUEA 3ZYYX 2JXTA 2LGYA 1ZUD2 2HE7A 3APCA 1IP9A 2PMVA 2INNE 4TSSA 1I7HA 3DDCB 1S1QB 2WYQA 4US9A 4KIKA 2MA9B 1EM7A 1R4MB 1NI3A 3SEBA 2KQSA 2BS2B 4NQLB 3DWGC 4RNAA 4REZA 2RDGA 1Q5WB 2MBOA 1MG8A 1KJTA 2KWUB 1WMHA 2JU6X 3VUWA 4MM3B 1P98A 2JYTA 2JT4B 1XLQA 5G55A 4F1SA 1QOBA 3DHIC 1C4AA 4PYZA 2X38A 2HJ8A 2ZW0A 1SXTA 2WQYB 1EF5A 2MP2B 1I4PA 3H8HA 3ML8A 2GB1A 2WS3B 4TMAB 1RFAA 4HCNB 5JXVA 1P1AA 1D5XC 3Q8CA 2LJIA 4OZAA 4DHJD 4EKUA 2L76A 4FHKA 3AI5A 5D3DA 5MPOA 1KH0A 1PQSA 4DXFA 1D6EC 2M0AA 4IWOA 2R61A 4IOIE 2LUMA 3APFA 2WX1A 3IFWB 2L0TA 5IO9A 3BYTB 4ZRIA 3DVGY 2KWDA 3B1LX 5CHWA 1B1ZA 3EUB2 3ZKJC 4E74A 1GB4A 1PDXA 2ZPNA 4WURA 2N7JA 3NZUA 1D3ZA 2DYOA 3N20C 4IWPA 1JWUD 3CWIA 3TIXA 5GXGB 1YQ3B 2K25A 3C19A 1L0XB 4WWMA 3NVVA 4HXDA 2MQJA 3M62B 2GBNA 1CJEA 4HDOA 3PSEB 1PGAA 2Y3AA 1BT0A 1E90A 3B2GA 3M63B 2QEJC 3LMNA 4HKQA 3V3XA 3ALBA 3L10B 4FLHA 1ZGUB 5DPRA 2VRRB 4CHKA 1C79A 1QILA 5JHBA 3P4RB 1N6ZA 5AZHA 3ZO5B 4GGQA 2WXNA 2CS4A 3W1SA 4XX5A 5DPTA 3ZNGC 3N32A 2AEHA 3X23A 4WWOA 1VD2A 5L95C 4F7ZA 2HJ1A 1I4RA 2FCMA 2AQ1B 3DVNV 2ZJDA 3NUHB 3AEFB 3R66C 4A90A 1FCCC 1SIFA 3U4EG 4YT0B 4W9HA 3DBLI 5EE1A 3QK0A 5C1ZA 3DBHI 2TSSA 4LJPB 1NDDA 3AE8B 2ONQA 2WXQA 1QF6A 4KGSA 2NBWB 4LJOB 1OQQA 5JH5C 4NNJB 2LASA 4ZHPA 4W9EA 3TMPB 4MGIE 3L16A 1MPEA 3PLVA 2WXMA 5HHDG 2KDIA 4AJYB 4C7ZA 1L4DB 2L3ZA 3OLMD 4UDUC 2L32A 2HTHA 3TEXA 3RZWC 2PEAA 1XEEA 5D3IB 2JZ3B 3N30A 4B9KA 3AE6B 2NR2A 3GE3C 1Z5SB 1LO5D 2LGIA 1MJDA 2K8HA 3RD2A 3ETRA 1H8CA 1ENFA 3VH3B 3TSSA 3V6EB 1GB1A 2GBKA 5FK9C 1J0GA 1NYQA 1HZ6A 2BYFA 4RFBA 4URKA 2J0MA 5HI1A 3V62A 2JXXA 2ZVNA 1IBXB 2N7DA 2G1EA 1WR1A 4KX6B 4DXGA 1GOZA 3APDA 2KC2A 1E0ZA 3ZGZA 3K9OB 2JPHA 4GN1A 2J0KA 4BKTA 3FC4A 4N59A 1RWSA 3QWZB 4NJCA 4BKGA 1OFFA 2MLBA 2N7EA 4CYEA 3BZDB 3DVNU 4DHJB 3UGBB 4HDQA 3L54A 1MI0A 4IDIA 1T3QA 2NMQA 2CU1A 3R8BA 3M95A 4YTNB 5IP4D 2K3UA 3EC8A 1DGJA 4WJNA 1FD6A 3PTFC 4FN2A 1QOAA 3H7PA 1V80A 5G2NA 3BIID 3VDZA 4EZLA 2D3BA 4M8MA 1YJJA 2RDHA 2LVQA 4CO7A 3ENEA 1R4NB 4MH8A 1SB3C 3DCGA 4R3DA 3AE3B 2EMTA 3P63A 4B95A 4P7IA 3IG3A 4S0RA 4K7UA 4A9AA 2LXCA 3MHZA 2Y5BB 1VZ6A 3IT4B 2R2QA 1LXDA 4A3OA 1QKZA 2HDEA 2N1WA 2A4ZA 4ZYSA 5EE0A 4MH0E 1N62A 2JSVX 3DQVA 4XDDA 1EU4A 4OW0A 3T8MA 4II2B 1STEA 5DPWA 3DBHB 2DZIA 2KQ4X 4DQOC 3E56A 3BK2A 1SE9A 5BO4B 3BVMA 3W9CB 2LGSA 2BF8B 1L0YB 2RMMA 2FIDA 4NJ6A 2BYTA 1F2RI 2QDFA 2N9EB 3AEAB 1LQBA 2D07B 4WQMA 2ZEQA 1SGHA 4ZYNA 3N1YC 2DZJA 3EECA 2NPTA 3HVZA 4K7WA 3CSTA 2I38A 2RR9A 1M4VA 1YX5B 2JUOA 2M8SA 1CMXB 5J18A 4RGNA 4YWGG 4KSKC 3PZ7A 3VQIA 3DBSA 4TKNA 3V6CB 1UD7A 1WI0A 2BT6A 3I63C 1QZEA 3R2IA 3CIRB 1XLPA 3AULA 5LXIB 1F1HA 1I4QA 1K51A 1B9RA 2K6QA 5IN7A 4HWIB 1TS5A 3ABVB 4FULA 2XEWA 2AX5A 3N9YC 4B0MA 3Q3JA 5HFYA 1WXMA 1WGYA 2KWCA 2D10A 1KOTA 4WQOB 2DAFA 3ZJTA 2KWVB 3N1XC 3EFCA 3ZIMA 3RZFA 4MGZE 3ZXVA 3SU8X 4HVBA 3TEZA 2LJ5A 2PPHA 4EUTA 3KWVA 4HCPB 5E6NA 1ACCA 2ZNVB 2FE8A 3MJWA 2G45B 3SHQA 3O65B 4EOYA 1WIAA 1F2RC 2CR5A 1ZE3D 3LB8C 3TCAA 3T3NA 2Q5WD 2WDTB 1R4MI 2KJRA 1T0YA 2EKEC 1YJ1A 2GMIC 2BGFA 3KWLA 1I4HA 1J8CA 4TV3A 2PJHA 1MHHE 4YSZB 2C7NB 2ICIA 2ZW1A 2UWQA 1BMLC 3VH4B 5HG2A 4GSWA 4M0WA 3BYYB 1FRDA 2CJNA 2JQRB 2UYZB 5CTRC 4BOSC 3NY5A 3Q3MC 1ZXHA 3AU4A 4PT5A 2KDEB 5AUKA 2KTFA 1Q1OA 1EWYC 3MC8A 2VZKB 4HRSA 4NJ7A 4USAA 3AB5A 3A1QB 2FCNA 2AYOB 2G4SA 2ZVOA 2KFKB 1VRAB 3JVZX 1UF0A 4JIOU 3WALA 4ANWA 1SEBD 4Q2JA 1WJ4A 2C5LC 3EFUA 1F52A 3RNCC 3AV8A 2D3CA 1TS2A 4WWPA 4P1BC 4BKSA 2JZPA 4P6VF 4C7YA 1EWCA 2MX2A 3QARA 4BFRA 5TSSA 3KH0A 2L7RA 1E8XA 2BYVE 3WAPA 4RF0A 1K52A 1ZOYB 2J7QB 3A9JA 2FAZA 1S3SG 4WJOA 2BKRB 4G0NB 2LEKA 1PYWD 2DHZA 3PHXB 2PKOA 3H6NA 1V9JA
chains in the Genus database with same CATH topology
2N4FA 3ALBA 3L10B 3P2BA 4DBGA 4FLHA 1ZGUB 5DPRA 1WMHB 3R7RA 2VRRB 1V5OA 4CHKA 3BINA 2KO3A 1VCBA 3LDZE 1U4AA 2G3QB 3OAWA 5JHBA 3CMMB 3KYDD 4KDIC 5AZHA 3ZUNA 1JRUA 1XT9B 3QX1A 3UQBA 2L05A 3DOWA 3VUXA 3ZO5B 4GGQA 4ASWC 2CS4A 3W1SA 4XX5A 2ZNVC 5DPTA 3ZTCA 3ZNGC 2KX0A 3N32A 2AEHA 2LI5A 3X23A 4WWOA 1VD2A 4N9F4 5L95C 4F7ZA 1EO6A 2KDBA 4MJSA 5DPSA 4PYUA 2FCMA 4RM8A 3A9KA 3DVNV 1WX9A 5AEKB 2IZVB 2ZJDA 2KJHB 4JGHB 1E8YA 2KXJA 3KVFB 3R66C 1SIFA 1WE7A 1ISNA 4W9HA 3DBLI 2KMCA 3QK0A 4W9LA 5C1ZA 3DBHI 3OJ4B 4LJPB 1NDDA 1YX6B 4ICUA 3TBLD 2M1MA 1V5TA 4KV2A 4HPLB 3VTVA 5JHAA 1TTNA 2NBWB 2RPQA 4LJOB 1IPGA 4MEMA 2KK8A 5E6PA 5JH5C 4NNJB 4W9JA 3X0WA 2LASA 4EZJA 4W9EA 3TMPB 3DVGX 1NBFC 1WF9A 3BY4B 2BYEA 3H1UA 3KUZA 3L16A 3PLVA 4MGIE 5AZGA 3TJPA 3ZRCA 2FUHB 3RYTA 3RCZA 4DXAB 4TQ1A 1P0RA 2KDIA 4AJYB 2O2VB 2DZMA 2FCQA 4DHZB 2L3ZA 3OLMD 4MSMB 2HTHA 3HHMA 4M8NA 1WGHA 3ZDTA 4II3B 2PEAA 3RZWC 3VTWA 2JZ3B 3N30A 2M17A 4LDTD 3PS6A 4B9KA 2KLGA 4FADA 4LCDE 1XQQA 2NR2A 3U8ZA 1E7VA 1Z5SB 2IO1B 2LD9A 1GNUA 3RD2A 2K8HA 3DPDA 1H8CA 3VH3B 1E5WA 3A9JB 3V6EB 2V3SA 4WWNA 3IVFA 2GBKA 2CHZA 4MDKE 1J0GA 3L17A 1WGRA 2BYFA 3B0AA 2KMAA 4GIVA 4ANVA 5KHOA 3CF6E 3QCAA 2GOWA 1H4RA 3AU5A 4KZCA 4URKA 2J0MA 2O6VD 1LM8B 3V62A 4IC7B 2JXXA 2KJ6A 1WGDA 1ZKHA 3ZDMC 2Z59B 3B08A 2ZVNA 2LRWA 2N7DA 3WIMA 1EF1A 1WR1A 1WYWB 2Z0DB 5D94A 2NBUA 2KDFB 3APDA 1WJ6A 2KC2A 4LDTB 1C3TA 1P9DU 3VAWA 1GC7A 2MWSB 3K9OB 2JPHA 3UIOB 4BKSD 4WAAA 2MW5A 4YL8A 4NQKE 4GN1A 4WJQA 3RT3B 2J0KA 4IM0A 1C1YB 2KKCA 3MHSD 4JQWC 3W1YA 1WGGA 4BKTA 1TGZB 4MJSB 3HM3A 2IO3B 4X57B 2ZCCA 3VXWA 3JW0X 3QWZB 4BKGA 2MLBA 2N7EA 4ANXA 4CYEA 5JZEB 1WM2A 2KTRB 2IYDB 1WJUA 5AZFA 1UBQA 3KYCD 4IM2A 4PS7A 2A5UA 4GXBA 1UGMA 3ONSA 4NAWB 3DVNU 2IO2B 1X1MA 4DHJB 4GDLB 3UGBB 2R2OA 4HDQA 5EDSA 4AOFA 2KD0A 1A5RA 4IW0A 3L54A 1TBEA 3U30A 3D32A 1AARA 2M4NA 4MSQB 2HD5B 2JZZA 2AWTA 3WA0A 4DWFA 2NVUI 2CU1A 3A9KB 2MP2A 3NHEB 2CKHB 3UQAA 1WR6E 3M95A 3PGEA 4K7SA 3ZW3A 2KLCA 1E7UA 2LVPA 4KSLC 3EC8A 2KZRA 1WX7A 4GDKB 4WJNA 3GZNI 3PTFC 2ZCBA 4FN2A 5L83A 3H7PA 4GB9A 4W9FA 1GC6A 1R4NI 4NPNA 4XC2A 4ICVA 2BWFA 2L0FA 1V80A 4DDGD 5G2NA 2OJRA 2DX5B 3VDZA 4EZLA 4M8MA 1W6VA 2CHXA 3ZNHB 2LVQA 1WM3A 4CO7A 3ENEA 2C7HA 1WXSA 3SD5A 1L7YA 5KHQA 1GG3A 1LFDA 2WWZA 4KVGB 2KC1A 3WAOA 2D11A 2JVCA 1WJNA 4ZRKA 4F8CB 3DCGA 4K1RB 3JSVA 3ZRFA 2EMTA 4G11A 1FXTB 4B95A 1NI2A 4P7IA 4AUQC 3IG3A 4MGKE 4K7UA 3PREA 3UIPB 3ZNID 2LXCA 2D3GA 3UINB 2GBRA 4FJVB 2JF5A 4E3CA 2Y5BB 4FBJB 4GMVA 1UH6A 2R2QA 3PZDA 1LXDA 4A3OA 2NBVB 1UELA 1WZ0A 3L13A 4DHZE 2N1WA 2O6VA 2A4ZA 2I1KA 3QJZA 4MH0E 4RM9A 2LGDA 4BOZB 1E8ZA 3HM6X 4W9CA 3DQVA 2BPSA 3PRZA 2KVRA 4HK2A 2CHWA 3V61A 4WJPA 4OVUA 3H7SA 4FJYA 3WAMA 1V6EA 4FJZA 3T8MA 3A4RA 4II2B 3N3KB 3LJ3A 4JL9A 3ZLZA 5DPWA 1Z2MA 4OVVA 2KN5A 4W9IA 5LLIA 3T9LA 3U7DA 2DZIA 2WX0A 2LXAA 3HK0A 2K1FA 1SE9A 2REXA 3A1QA 5BO4B 5HKHA 1OGWA 3NZSA 1RRBA 3ML9A 1I42A 2K8CA 3ECIA 2N9XA 3QA8A 2K39A 3V60A 1IYFA 2BF8B 5FR6A 1OEYJ 4J6IA 4NJ6A 2FIDA 3A4SC 2ZZPB 4KDLB 2N9EB 4GOCA 5CX3A 5IAAC 4W9DA 1WY8A 1GUAB 3PPAA 2C9WB 3L0WB 1LQBA 3H7PB 4W9KA 2D07B 2MBEA 1F9JA 2RD0A 2ZEQA 4HPMB 3VVWB 3ZVVA 1SGHA 2EMSA 4ZYNA 4XZ4A 2DZJA 1K8RB 2MBBB 4MM3A 3EECA 4MGYE 2NPTA 4K7WA 1KM7A 2BWES 2ZPYA 3CSTA 3ZTDA 2AL3A 4DDID 3K9PB 4E71A 2RR9A 2FCSA 3CSFA 1WXVA 4ANUA 2G4DB 1YX5B 2JUOA 3Q3FA 2DAJA 2JRIB 2M8SA 3JSVB 3QC8B 1CMXB 5J18A 2W9NA 5J2RA 2PE6B 3OJ3A 2NS5A 2RGFA 4KSKC 3DBSA 5D6JB 1WX8A 3VQIA 4TKNA 3R3MA 3NS8A 3V6CB 4HJKA 1UD7A 2JWZA 1KLVA 2C60A 1WI0A 3GOEA 2M0XA 2NPTB 1QZEA 2XK5A 4EFOA 3VHTC 2IY0B 4EEWA 2KANA 3C0RB 1TZ1A 3AULA 3VUYA 1G6JA 1P3QU 4K81A 4KIKB 5LXIB 3KW5B 2DYMA 1V86A 3WANA 2V4LA 2RSUA 1WRDB 2KFJA 2LWPA 2AL6A 2YVCA 2LGXA 3I3TB 4I6PA 3R7QA 3VFKA 2K6QA 4BBNC 4ZDVA 4I6LB 2O2VA 4EZKA 4AJWA 3RULA 4HWIB 4FULA 1RAXA 3HIZA 2J0JA 2OOBB 1GJZA 3EHVA 4NAWA 2DENB 1ZW7A 2XEWA 2NCNA 3QIJA 4TUUA 4I6NB 1OQYA 2GBMA 3Q3JA 5DCNA 4RMAA 4AWJA 3PVLA 1WXMA 4ZRJA 1V2YA 2MCNB 4IWQA 2KHWB 1WGYA 2IBIB 1OTRB 2KWCA 2LUEA 2JY6A 3JYUA 4NY0A 1V81A 2D10A 1KOTA 2LGYA 2XBBC 2O6VB 4WQOB 2HE7A 3APCA 2DAFA 3UF8A 1IP9A 1E8WA 4PS3A 4HLEA 2LZ6A 3PLUA 1UBIA 3PT2B 1YD8U 2DZKA 3QAQA 3PV1A 2KQ7A 3DDCB 1J19A 2KWVB 2FNJB 1WE6A 2FIFA 1S1QB 3ZIMA 2WYQA 3RZFA 4MGZE 3M3JA 3DBRI 3SU8X 4HVBA 1WFYA 2MA9B 4KIKA 3ZNZB 2KNBA 2LJ5A 4BVUC 2PPHA 4EUTA 4HCPB 4TQ0A 5E6NA 1XD3B 2KQSA 2KX3A 4G50A 2ZNVB 4NQLB 3MJWA 2G45B 4W9GA 3SHQA 3O65B 4EOYA 1Q5WB 1WIAA 4KZ0A 2LVOA 1V49A 2MBOA 1MG8A 2CR5A 1KJTA 4GDKA 4B6WA 1EUVB 2KWUB 3TCAA 1WMHA 5D7GA 2LRUA 2N1VA 2WDTB 1R4MI 2KJRA 2Z0EB 3VUWA 4FHJA 1T0YA 2V1YA 3IBEA 2EKEC 3PRPB 1YJ1A 1P98A 2GMIC 5GMVA 3H9DA 3NOBA 3L08A 2BGFA 2JT4B 3IHPC 1J8CA 5G55A 4TV3A 2PJHA 4F1SA 4GU2A 5LXHA 2C7NB 5CHFA 2JRHA 2UWQA 4IG7B 4PYZA 3VH4B 3MTNB 2HJ8A 4GSWA 3KUCB 3PRMB 2QHOA 1YQBA 1EF5A 3VTUA 2UYZB 4GDLA 2MP2B 5CTRC 3S2AA 1WZ3A 4BOSC 1WXAA 3ML8A 3NY5A 1RLFA 1RFAA 4HCNB 1P1AA 2K6DB 3AXCA 1YIWA 2DYBA 5E6OA 2KTRA 3SDLC 3AU4A 2KDEB 4DHJD 5C23A 4EKUA 2KTFA 1Q1OA 2L76A 4FHKA 4IUMB 1M94A 3KUDB 1L2NA 3AI5A 4NJ7A 2GBJA 1PQSA 2MRPA 1I35A 2KFKA 4PS8A 1HE8A 1OEYA 3A1QB 4MELA 2FCNA 2MSED 2IY1B 4IWOA 2AYOB 2G4SA 2ZVOA 2KFKB 5IA7A 3JVZX 4AP4C 3APFA 2WX1A 3IFWB 2L0TA 4JIOU 5TR5A 2ASQA 2MBQA 2YLMA 3WALA 4ANWA 4ZRIA 3TL5A 3DVGY 1WJ4A 2C5LC 3QHTA 3B1LX 5CHWA 3EFUA 2MBHA 2D2QA 2L00B 4JLCA 3ZKJC 2C7MB 4E74A 4WWPA 5J17A 4G3XB 4BKSA 2ZPNA 2IO0B 3PHWB 3NZUA 1WH3A 1D3ZA 2DYOA 2N9PC 4IWPA 2B3AA 2MX2A 3QARA 5CHVC 5D2MB 3RUIB 4BBNF 4BFRA 4A3PA 3TIXA 2I1JA 3KH0A 2L7RA 4M0WB 1E8XA 1Q0WB 2K25A 3QQ8B 2BYVE 4HXDA 3WAPA 1Y8RC 2MQJA 3M62B 3W1SC 2GBNA 2J7QB 2FAZA 1S3SG 3A9JA 4WJOA 4A20A 3A33B 4HDOA 2KOXA 2XK5B 3PSEB 2BKRB 4G0NB 4DK5A 1BT0A 2K8BA 1E90A 4FA6A 2PE9A 3M63B 1UZXB 2DHZA 3PHXB 3LMNA 4IM3A 3H6NA 1V9JA 2L8JA 2BKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N4F A;  3ALB A;  3L10 B;  3P2B A;  4DBG A;  4FLH A;  1ZGU B;  5DPR A;  1WMH B;  3R7R A;  2VRR B;  1V5O A;  4CHK A;  3BIN A;  2KO3 A;  1VCB A;  3LDZ E;  1U4A A;  2G3Q B;  3OAW A;  5JHB A;  3CMM B;  3KYD D;  4KDI C;  5AZH A;  3ZUN A;  1JRU A;  1XT9 B;  3QX1 A;  3UQB A;  2L05 A;  3DOW A;  3VUX A;  3ZO5 B;  4GGQ A;  4ASW C;  2CS4 A;  3W1S A;  4XX5 A;  2ZNV C;  5DPT A;  3ZTC A;  3ZNG C;  2KX0 A;  3N32 A;  2AEH A;  2LI5 A;  3X23 A;  4WWO A;  1VD2 A;  4N9F 4;  5L95 C;  4F7Z A;  1EO6 A;  2KDB A;  4MJS A;  5DPS A;  4PYU A;  2FCM A;  4RM8 A;  3A9K A;  3DVN V;  1WX9 A;  5AEK B;  2IZV B;  2ZJD A;  2KJH B;  4JGH B;  1E8Y A;  2KXJ A;  3KVF B;  3R66 C;  1SIF A;  1WE7 A;  1ISN A;  4W9H A;  3DBL I;  2KMC A;  3QK0 A;  4W9L A;  5C1Z A;  3DBH I;  3OJ4 B;  4LJP B;  1NDD A;  1YX6 B;  4ICU A;  3TBL D;  2M1M A;  1V5T A;  4KV2 A;  4HPL B;  3VTV A;  5JHA A;  1TTN A;  2NBW B;  2RPQ A;  4LJO B;  1IPG A;  4MEM A;  2KK8 A;  5E6P A;  5JH5 C;  4NNJ B;  4W9J A;  3X0W A;  2LAS A;  4EZJ A;  4W9E A;  3TMP B;  3DVG X;  1NBF C;  1WF9 A;  3BY4 B;  2BYE A;  3H1U A;  3KUZ A;  3L16 A;  3PLV A;  4MGI E;  5AZG A;  3TJP A;  3ZRC A;  2FUH B;  3RYT A;  3RCZ A;  4DXA B;  4TQ1 A;  1P0R A;  2KDI A;  4AJY B;  2O2V B;  2DZM A;  2FCQ A;  4DHZ B;  2L3Z A;  3OLM D;  4MSM B;  2HTH A;  3HHM A;  4M8N A;  1WGH A;  3ZDT A;  4II3 B;  2PEA A;  3RZW C;  3VTW A;  2JZ3 B;  3N30 A;  2M17 A;  4LDT D;  3PS6 A;  4B9K A;  2KLG A;  4FAD A;  4LCD E;  1XQQ A;  2NR2 A;  3U8Z A;  1E7V A;  1Z5S B;  2IO1 B;  2LD9 A;  1GNU A;  3RD2 A;  2K8H A;  3DPD A;  1H8C A;  3VH3 B;  1E5W A;  3A9J B;  3V6E B;  2V3S A;  4WWN A;  3IVF A;  2GBK A;  2CHZ A;  4MDK E;  1J0G A;  3L17 A;  1WGR A;  2BYF A;  3B0A A;  2KMA A;  4GIV A;  4ANV A;  5KHO A;  3CF6 E;  3QCA A;  2GOW A;  1H4R A;  3AU5 A;  4KZC A;  4URK A;  2J0M A;  2O6V D;  1LM8 B;  3V62 A;  4IC7 B;  2JXX A;  2KJ6 A;  1WGD A;  1ZKH A;  3ZDM C;  2Z59 B;  3B08 A;  2ZVN A;  2LRW A;  2N7D A;  3WIM A;  1EF1 A;  1WR1 A;  1WYW B;  2Z0D B;  5D94 A;  2NBU A;  2KDF B;  3APD A;  1WJ6 A;  2KC2 A;  4LDT B;  1C3T A;  1P9D U;  3VAW A;  1GC7 A;  2MWS B;  3K9O B;  2JPH A;  3UIO B;  4BKS D;  4WAA A;  2MW5 A;  4YL8 A;  4NQK E;  4GN1 A;  4WJQ A;  3RT3 B;  2J0K A;  4IM0 A;  1C1Y B;  2KKC A;  3MHS D;  4JQW C;  3W1Y A;  1WGG A;  4BKT A;  1TGZ B;  4MJS B;  3HM3 A;  2IO3 B;  4X57 B;  2ZCC A;  3VXW A;  3JW0 X;  3QWZ B;  4BKG A;  2MLB A;  2N7E A;  4ANX A;  4CYE A;  5JZE B;  1WM2 A;  2KTR B;  2IYD B;  1WJU A;  5AZF A;  1UBQ A;  3KYC D;  4IM2 A;  4PS7 A;  2A5U A;  4GXB A;  1UGM A;  3ONS A;  4NAW B;  3DVN U;  2IO2 B;  1X1M A;  4DHJ B;  4GDL B;  3UGB B;  2R2O A;  4HDQ A;  5EDS A;  4AOF A;  2KD0 A;  1A5R A;  4IW0 A;  3L54 A;  1TBE A;  3U30 A;  3D32 A;  1AAR A;  2M4N A;  4MSQ B;  2HD5 B;  2JZZ A;  2AWT A;  3WA0 A;  4DWF A;  2NVU I;  2CU1 A;  3A9K B;  2MP2 A;  3NHE B;  2CKH B;  3UQA A;  1WR6 E;  3M95 A;  3PGE A;  4K7S A;  3ZW3 A;  2KLC A;  1E7U A;  2LVP A;  4KSL C;  3EC8 A;  2KZR A;  1WX7 A;  4GDK B;  4WJN A;  3GZN I;  3PTF C;  2ZCB A;  4FN2 A;  5L83 A;  3H7P A;  4GB9 A;  4W9F A;  1GC6 A;  1R4N I;  4NPN A;  4XC2 A;  4ICV A;  2BWF A;  2L0F A;  1V80 A;  4DDG D;  5G2N A;  2OJR A;  2DX5 B;  3VDZ A;  4EZL A;  4M8M A;  1W6V A;  2CHX A;  3ZNH B;  2LVQ A;  1WM3 A;  4CO7 A;  3ENE A;  2C7H A;  1WXS A;  3SD5 A;  1L7Y A;  5KHQ A;  1GG3 A;  1LFD A;  2WWZ A;  4KVG B;  2KC1 A;  3WAO A;  2D11 A;  2JVC A;  1WJN A;  4ZRK A;  4F8C B;  3DCG A;  4K1R B;  3JSV A;  3ZRF A;  2EMT A;  4G11 A;  1FXT B;  4B95 A;  1NI2 A;  4P7I A;  4AUQ C;  3IG3 A;  4MGK E;  4K7U A;  3PRE A;  3UIP B;  3ZNI D;  2LXC A;  2D3G A;  3UIN B;  2GBR A;  4FJV B;  2JF5 A;  4E3C A;  2Y5B B;  4FBJ B;  4GMV A;  1UH6 A;  2R2Q A;  3PZD A;  1LXD A;  4A3O A;  2NBV B;  1UEL A;  1WZ0 A;  3L13 A;  4DHZ E;  2N1W A;  2O6V A;  2A4Z A;  2I1K A;  3QJZ A;  4MH0 E;  4RM9 A;  2LGD A;  4BOZ B;  1E8Z A;  3HM6 X;  4W9C A;  3DQV A;  2BPS A;  3PRZ A;  2KVR A;  4HK2 A;  2CHW A;  3V61 A;  4WJP A;  4OVU A;  3H7S A;  4FJY A;  3WAM A;  1V6E A;  4FJZ A;  3T8M A;  3A4R A;  4II2 B;  3N3K B;  3LJ3 A;  4JL9 A;  3ZLZ A;  5DPW A;  1Z2M A;  4OVV A;  2KN5 A;  4W9I A;  5LLI A;  3T9L A;  3U7D A;  2DZI A;  2WX0 A;  2LXA A;  3HK0 A;  2K1F A;  1SE9 A;  2REX A;  3A1Q A;  5BO4 B;  5HKH A;  1OGW A;  3NZS A;  1RRB A;  3ML9 A;  1I42 A;  2K8C A;  3ECI A;  2N9X A;  3QA8 A;  2K39 A;  3V60 A;  1IYF A;  2BF8 B;  5FR6 A;  1OEY J;  4J6I A;  4NJ6 A;  2FID A;  3A4S C;  2ZZP B;  4KDL B;  2N9E B;  4GOC A;  5CX3 A;  5IAA C;  4W9D A;  1WY8 A;  1GUA B;  3PPA A;  2C9W B;  3L0W B;  1LQB A;  3H7P B;  4W9K A;  2D07 B;  2MBE A;  1F9J A;  2RD0 A;  2ZEQ A;  4HPM B;  3VVW B;  3ZVV A;  1SGH A;  2EMS A;  4ZYN A;  4XZ4 A;  2DZJ A;  1K8R B;  2MBB B;  4MM3 A;  3EEC A;  4MGY E;  2NPT A;  4K7W A;  1KM7 A;  2BWE S;  2ZPY A;  3CST A;  3ZTD A;  2AL3 A;  4DDI D;  3K9P B;  4E71 A;  2RR9 A;  2FCS A;  3CSF A;  1WXV A;  4ANU A;  2G4D B;  1YX5 B;  2JUO A;  3Q3F A;  2DAJ A;  2JRI B;  2M8S A;  3JSV B;  3QC8 B;  1CMX B;  5J18 A;  2W9N A;  5J2R A;  2PE6 B;  3OJ3 A;  2NS5 A;  2RGF A;  4KSK C;  3DBS A;  5D6J B;  1WX8 A;  3VQI A;  4TKN A;  3R3M A;  3NS8 A;  3V6C B;  4HJK A;  1UD7 A;  2JWZ A;  1KLV A;  2C60 A;  1WI0 A;  3GOE A;  2M0X A;  2NPT B;  1QZE A;  2XK5 A;  4EFO A;  3VHT C;  2IY0 B;  4EEW A;  2KAN A;  3C0R B;  1TZ1 A;  3AUL A;  3VUY A;  1G6J A;  1P3Q U;  4K81 A;  4KIK B;  5LXI B;  3KW5 B;  2DYM A;  1V86 A;  3WAN A;  2V4L A;  2RSU A;  1WRD B;  2KFJ A;  2LWP A;  2AL6 A;  2YVC A;  2LGX A;  3I3T B;  4I6P A;  3R7Q A;  3VFK A;  2K6Q A;  4BBN C;  4ZDV A;  4I6L B;  2O2V A;  4EZK A;  4AJW A;  3RUL A;  4HWI B;  4FUL A;  1RAX A;  3HIZ A;  2J0J A;  2OOB B;  1GJZ A;  3EHV A;  4NAW A;  2DEN B;  1ZW7 A;  2XEW A;  2NCN A;  3QIJ A;  4TUU A;  4I6N B;  1OQY A;  2GBM A;  3Q3J A;  5DCN A;  4RMA A;  4AWJ A;  3PVL A;  1WXM A;  4ZRJ A;  1V2Y A;  2MCN B;  4IWQ A;  2KHW B;  1WGY A;  2IBI B;  1OTR B;  2KWC A;  2LUE A;  2JY6 A;  3JYU A;  4NY0 A;  1V81 A;  2D10 A;  1KOT A;  2LGY A;  2XBB C;  2O6V B;  4WQO B;  2HE7 A;  3APC A;  2DAF A;  3UF8 A;  1IP9 A;  1E8W A;  4PS3 A;  4HLE A;  2LZ6 A;  3PLU A;  1UBI A;  3PT2 B;  1YD8 U;  2DZK A;  3QAQ A;  3PV1 A;  2KQ7 A;  3DDC B;  1J19 A;  2KWV B;  2FNJ B;  1WE6 A;  2FIF A;  1S1Q B;  3ZIM A;  2WYQ A;  3RZF A;  4MGZ E;  3M3J A;  3DBR I;  3SU8 X;  4HVB A;  1WFY A;  2MA9 B;  4KIK A;  3ZNZ B;  2KNB A;  2LJ5 A;  4BVU C;  2PPH A;  4EUT A;  4HCP B;  4TQ0 A;  5E6N A;  1XD3 B;  2KQS A;  2KX3 A;  4G50 A;  2ZNV B;  4NQL B;  3MJW A;  2G45 B;  4W9G A;  3SHQ A;  3O65 B;  4EOY A;  1Q5W B;  1WIA A;  4KZ0 A;  2LVO A;  1V49 A;  2MBO A;  1MG8 A;  2CR5 A;  1KJT A;  4GDK A;  4B6W A;  1EUV B;  2KWU B;  3TCA A;  1WMH A;  5D7G A;  2LRU A;  2N1V A;  2WDT B;  1R4M I;  2KJR A;  2Z0E B;  3VUW A;  4FHJ A;  1T0Y A;  2V1Y A;  3IBE A;  2EKE C;  3PRP B;  1YJ1 A;  1P98 A;  2GMI C;  5GMV A;  3H9D A;  3NOB A;  3L08 A;  2BGF A;  2JT4 B;  3IHP C;  1J8C A;  5G55 A;  4TV3 A;  2PJH A;  4F1S A;  4GU2 A;  5LXH A;  2C7N B;  5CHF A;  2JRH A;  2UWQ A;  4IG7 B;  4PYZ A;  3VH4 B;  3MTN B;  2HJ8 A;  4GSW A;  3KUC B;  3PRM B;  2QHO A;  1YQB A;  1EF5 A;  3VTU A;  2UYZ B;  4GDL A;  2MP2 B;  5CTR C;  3S2A A;  1WZ3 A;  4BOS C;  1WXA A;  3ML8 A;  3NY5 A;  1RLF A;  1RFA A;  4HCN B;  1P1A A;  2K6D B;  3AXC A;  1YIW A;  2DYB A;  5E6O A;  2KTR A;  3SDL C;  3AU4 A;  2KDE B;  4DHJ D;  5C23 A;  4EKU A;  2KTF A;  1Q1O A;  2L76 A;  4FHK A;  4IUM B;  1M94 A;  3KUD B;  1L2N A;  3AI5 A;  4NJ7 A;  2GBJ A;  1PQS A;  2MRP A;  1I35 A;  2KFK A;  4PS8 A;  1HE8 A;  1OEY A;  3A1Q B;  4MEL A;  2FCN A;  2MSE D;  2IY1 B;  4IWO A;  2AYO B;  2G4S A;  2ZVO A;  2KFK B;  5IA7 A;  3JVZ X;  4AP4 C;  3APF A;  2WX1 A;  3IFW B;  2L0T A;  4JIO U;  5TR5 A;  2ASQ A;  2MBQ A;  2YLM A;  3WAL A;  4ANW A;  4ZRI A;  3TL5 A;  3DVG Y;  1WJ4 A;  2C5L C;  3QHT A;  3B1L X;  5CHW A;  3EFU A;  2MBH A;  2D2Q A;  2L00 B;  4JLC A;  3ZKJ C;  2C7M B;  4E74 A;  4WWP A;  5J17 A;  4G3X B;  4BKS A;  2ZPN A;  2IO0 B;  3PHW B;  3NZU A;  1WH3 A;  1D3Z A;  2DYO A;  2N9P C;  4IWP A;  2B3A A;  2MX2 A;  3QAR A;  5CHV C;  5D2M B;  3RUI B;  4BBN F;  4BFR A;  4A3P A;  3TIX A;  2I1J A;  3KH0 A;  2L7R A;  4M0W B;  1E8X A;  1Q0W B;  2K25 A;  3QQ8 B;  2BYV E;  4HXD A;  3WAP A;  1Y8R C;  2MQJ A;  3M62 B;  3W1S C;  2GBN A;  2J7Q B;  2FAZ A;  1S3S G;  3A9J A;  4WJO A;  4A20 A;  3A33 B;  4HDO A;  2KOX A;  2XK5 B;  3PSE B;  2BKR B;  4G0N B;  4DK5 A;  1BT0 A;  2K8B A;  1E90 A;  4FA6 A;  2PE9 A;  3M63 B;  1UZX B;  2DHZ A;  3PHX B;  3LMN A;  4IM3 A;  3H6N A;  1V9J A;  2L8J A;  2BKF A; 
#chains in the Genus database with same CATH topology
 1V5O A;  3RI7 C;  3OAW A;  3CMM B;  3AM9 A;  4KDI C;  3ZUN A;  1JRU A;  1BXT A;  2LHD A;  3DOW A;  3VUX A;  4ASW C;  1CK1 A;  2NTS A;  1EO6 A;  2IPK D;  2OJW A;  4MJS A;  2KT7 A;  4PYU A;  4RM8 A;  1TJE A;  2V0G A;  1WE7 A;  4NAM A;  2KMC A;  2ACZ B;  2IGD A;  1YX6 B;  2M1M A;  4RF1 A;  1V5T A;  5H92 C;  5JHA A;  4CQN A;  4MEM A;  4W9J A;  2D5G A;  2PW9 A;  2LHE A;  2M19 A;  2X8X X;  3H1U A;  2FUH B;  2O2V B;  3NS1 A;  2DZM A;  2QSD A;  4PK1 A;  1FM0 D;  4MSM B;  2W82 A;  3ZDT A;  1YNT E;  4YXD B;  4QAY A;  1QOG A;  3NVZ A;  2M17 A;  1HTQ A;  3PS6 A;  2CJO A;  2IO1 B;  3N1Z C;  2LD9 A;  1GNU A;  4JX1 C;  2CU3 A;  1E5W A;  2EEL A;  3B0A A;  2KMA A;  2WP9 B;  4GIV A;  1HQR D;  4S17 A;  1OQR A;  3CF6 E;  3QCA A;  4RCO A;  2O6V D;  2M56 B;  5FR3 A;  2INP E;  2KJ6 A;  4J3O D;  3B9J A;  1NVI D;  2Z0D B;  3WCQ A;  4A55 A;  1WJ6 A;  1L6U A;  2K0P A;  1P9D U;  2LMC A;  1C3T A;  4BKS D;  4WAA A;  2I2Y A;  2MW5 A;  3NVW A;  4YL8 A;  4WJQ A;  3RT3 B;  1C1Y B;  2KKC A;  3W1Y A;  4BAX A;  3HM3 A;  2IO3 B;  3VXW A;  3JW0 X;  4ANX A;  1WM2 A;  1ZDX A;  5AZF A;  2K9X A;  1UGM A;  4NAW B;  3RFZ B;  2IO2 B;  5EDS A;  2QMT A;  2KD0 A;  4AOF A;  1A5R A;  3U30 A;  1T0S C;  4B0E A;  1AAR A;  2VZK D;  2M4N A;  2BBC A;  4MSQ B;  4AS1 A;  2JZZ A;  4DWF A;  3A9K B;  4XYC A;  2E6X A;  4US8 A;  3ZW3 A;  1NEK B;  4ACF A;  5L83 A;  4GB9 A;  3RNF C;  1R4N I;  2BWF A;  4DDG D;  2OJR A;  4P16 A;  1JW9 D;  2WXI A;  3DHG C;  1TKG A;  3AN1 A;  3ZNH B;  1WM3 A;  2C7H A;  3SD5 A;  1L7Y A;  1GG3 A;  2KC1 A;  2D11 A;  3JSV A;  3BK1 A;  1N61 A;  5BMI A;  4KGT A;  4G11 A;  1FXT B;  4AUQ C;  3PRE A;  3UIP B;  1T6B X;  2D3G A;  1T5X D;  3UIN B;  4E3C A;  1JCK B;  4OZC A;  4OHJ A;  1FFV A;  1PFD A;  2V4I B;  3PZD A;  3L13 A;  1TS3 A;  4N58 A;  1XF5 L;  4YTM B;  4RM9 A;  4BOZ B;  1SIJ A;  2BPS A;  2KVR A;  2CHW A;  4OVU A;  3HVD A;  2IGH A;  4FXC A;  3WAM A;  4FJZ A;  1V1O A;  4JWU C;  3ZLZ A;  3LJ3 A;  1FCL A;  5EE3 A;  1Z2M A;  5LLI A;  1MHX A;  1ZPS A;  2LXA A;  3HK0 A;  4NZL B;  1RRB A;  1I42 A;  2Y5P A;  5G5G A;  1IYF A;  1OEY J;  4J6I A;  4KDL B;  1WY8 A;  2C9W B;  2MBE A;  3ZVV A;  1E7P B;  3VVW B;  1SE2 A;  2K22 A;  1WXQ A;  4HJG E;  2JWU A;  2FCS A;  1WXV A;  2G4D B;  2DAJ A;  2NS5 A;  4AQ7 A;  3MP9 A;  1L6V A;  2JWZ A;  4EFO A;  1I4G A;  3C0R B;  3VUY A;  1G6J A;  1P3Q U;  1FFU A;  2MHJ A;  3WAN A;  2V4L A;  3Q8B A;  3AMZ A;  2LWP A;  3I3T B;  2LGX A;  2DLB A;  4I6L B;  2O2V A;  3TUO A;  3EHV A;  3U7Z A;  2NCN A;  4TUU A;  2GBM A;  3AED B;  1XCQ L;  3DBL B;  1SJE D;  1RM6 C;  3NJT A;  4ZRJ A;  4WH4 A;  4IWQ A;  1SE3 A;  2IBI B;  2GRI A;  3Q3O C;  1KLU D;  2WXH A;  4NY0 A;  1TT5 B;  1EU3 A;  5BYQ A;  4PS3 A;  2NTT A;  2LZ6 A;  3PLU A;  1UBI A;  3PT2 B;  1UUP A;  1YD8 U;  2DZK A;  3NG0 A;  3QAQ A;  2FNJ B;  1WE6 A;  2FIF A;  2MJ3 A;  3DBR I;  1FO4 A;  2KNB A;  4BVU C;  1CZP A;  4TQ0 A;  1XD3 B;  2KX3 A;  1SBB B;  4W9G A;  4C4V B;  4MT5 A;  2LVO A;  1C9F A;  2PVG C;  4B6W A;  4M00 A;  3KLS X;  1TY0 A;  1T0R C;  2IDY A;  1VDV A;  4OVZ A;  4FHJ A;  2BS3 B;  3PRP B;  1KF6 B;  5GMV A;  3NOB A;  2WXR A;  3L08 A;  1YQ4 B;  1N5X A;  3GZN B;  3IHP C;  4YSX B;  4GU2 A;  1A70 A;  5CHF A;  1XCT L;  2L83 A;  1J7B A;  1YN4 A;  4JE3 B;  3TEY A;  1V1P A;  1FNW A;  3KUC B;  5LNK 1;  2QHO A;  1JWA D;  3VTU A;  4GDL A;  3S2A A;  1F0Z A;  2Z8L A;  1AYF A;  1E6E B;  1WXA A;  4LK0 M;  1QT9 A;  1YIW A;  3SR6 A;  2KTR A;  3P4P B;  5C23 A;  4IUM B;  1ROE A;  1TZO A;  2GBJ A;  1MFW A;  2KFK A;  4PS8 A;  1OEY A;  2AQ2 B;  2MSE D;  2IY1 B;  3GE8 C;  5IA7 A;  2XN9 C;  1RFK A;  5TR5 A;  2MBQ A;  3W5U B;  2N9L A;  3RMK C;  2MBH A;  1WGK A;  2L00 B;  1WWT A;  2C7M B;  1AN8 A;  2N0S B;  1PGX A;  3U52 E;  5J17 A;  3AEG B;  4G3X B;  4ITK A;  1WH3 A;  1FMA D;  3SFE B;  4BBN F;  3RUI B;  5D2M B;  4A3P A;  2I1J A;  4M0W B;  3I9V 1;  1V97 A;  1Q0W B;  1WYG A;  2J52 A;  4JPS A;  3W1S C;  2DBY A;  3BWU D;  3A33 B;  2KOX A;  1YN3 A;  4GLS C;  4DK5 A;  4LNF A;  2K8B A;  3EGR A;  2PE9 A;  2BB5 A;  2BKF A;  3O13 A;  2BQQ A;  2N4F A;  1K50 A;  1XLN A;  3BVZ A;  1YMH E;  4YTP B;  1VCB A;  3FAH A;  2G3Q B;  1J7A A;  3KYD D;  4H2A A;  1XT9 B;  2L05 A;  1MVK A;  2BB6 A;  2ZNV C;  2KX0 A;  1LGR A;  2LI5 A;  4N9F 4;  5FKA C;  1SE4 A;  5AEK B;  2IZV B;  1FXA A;  2KJH B;  2WXO A;  4JGH B;  1E8Y A;  2KXJ A;  3KVF B;  1VZ8 A;  1ISN A;  1NYR A;  5IOI A;  4ICU A;  1N60 A;  3TBL D;  3MFG A;  4HPL B;  4HEA 1;  3VTV A;  1VZ7 A;  2RPQ A;  1IPG A;  2KK8 A;  1QLB B;  1HXY D;  4EZJ A;  3DVG X;  3KUZ A;  3BY4 B;  2BYE A;  3GS2 A;  5AZG A;  3ZRC A;  2RPV A;  3RYT A;  3RCZ A;  2INC C;  2KMM A;  3Q2A C;  2FCQ A;  4LNN A;  5E6J A;  4M8N A;  1WGH A;  1UGJ A;  4II3 B;  3VTW A;  1JRO A;  2Y5C A;  1HEZ E;  1SF0 A;  1C78 A;  4LCD E;  1XQQ A;  1E7V A;  3PO0 A;  2W3S A;  4JWS C;  3A9J B;  4MDK E;  2CHZ A;  3L17 A;  1WGR A;  1N63 A;  2YEP B;  5KHO A;  3IAM 1;  4IC7 B;  1WGD A;  1ZKH A;  2MEK A;  3WIM A;  1C77 A;  3BVG A;  4A8X C;  2KDF B;  2KVZ A;  1HTO A;  1TYG B;  1FEH A;  3VAW A;  1GC7 A;  2MWS B;  2J42 A;  4IM0 A;  3MHS D;  4MJS B;  2ZCC A;  4XGA B;  3R2T A;  1C4C A;  3AE9 B;  4ZRP A;  2IYD B;  1WJU A;  2PVO D;  1UBQ A;  1QOF A;  3KYC D;  4PS7 A;  4IM2 A;  3IXS A;  2A5U A;  3ONS A;  2J4X A;  1X1M A;  2R2O A;  4IW0 A;  1TBE A;  3V05 A;  3D32 A;  2HD5 B;  2AWT A;  2WXK A;  2NVU I;  1VJK A;  2CKH B;  4N6E B;  1WR6 E;  2KLC A;  4LTU A;  1E7U A;  2LVP A;  2W3R A;  4WAF A;  1WX7 A;  3TEW A;  4ARI A;  3GZN I;  2ZCB A;  5H8Y E;  2BS4 B;  1TS4 A;  4XC2 A;  1GC6 A;  4NPN A;  1ZDV A;  1VLB A;  1D4B A;  2DX5 B;  1W6V A;  2CHX A;  4LNK A;  1FNV A;  5KHQ A;  2BW2 A;  1KFY B;  2WWZ A;  4KVG B;  2JVC A;  5C3J B;  1WJN A;  4ZRK A;  3VRA B;  4F8C B;  4K3C A;  3ZRF A;  2L52 A;  2GLS A;  1NEN B;  3ZNI D;  4FJV B;  2JF5 A;  2WDR B;  4ZRQ A;  2QIE B;  4GMV A;  4MAC A;  1UH6 A;  5BYR A;  4C4V A;  4DHZ E;  2O6V A;  2I1K A;  3P4S B;  2MJE A;  3QJZ A;  2LGD A;  1E8Z A;  3HM6 X;  3SFD B;  1J7C A;  3PRZ A;  4HK2 A;  4WJP A;  3DWM A;  4FJY A;  1L0V B;  3KQ4 A;  4JL9 A;  3AE1 B;  4OVV A;  3T9L A;  2LFI A;  2WX0 A;  3LYY A;  1CQV A;  2K1F A;  3AEB B;  1OGW A;  2K8C A;  3ECI A;  3QA8 A;  5G5H A;  1IBX A;  3A4S C;  1BUI C;  2WU5 B;  4W9D A;  3RNE C;  3T3O A;  1DOY A;  1F9J A;  2EMS A;  1V8C A;  2MBB B;  4MGY E;  1R7S A;  1KRH A;  3K9P B;  4E71 A;  3QC8 B;  2JRI B;  3JSV B;  1DYQ A;  3OWE B;  2KAJ A;  2W9N A;  5J2R A;  3UI3 A;  2XNA C;  1WX8 A;  3AH7 A;  2V9H A;  3R3M A;  3NS8 A;  1GPX A;  4OZB A;  3GOE A;  2NPT B;  3VHT C;  4EEW A;  2KAN A;  3Q8A A;  2IND C;  3KW5 B;  1V86 A;  2WDV B;  1WRD B;  2OED A;  4I6P A;  2YVC A;  4BBN C;  4ZDV A;  3VFK A;  3RUL A;  1RAX A;  2J0J A;  3LXF A;  2DEN B;  2IJ0 A;  1HZ5 A;  1ET9 A;  3QIJ A;  1D5M C;  3PVL A;  2WXP A;  1JQ4 A;  1V2Y A;  1L4Z B;  2V3P A;  1K53 A;  3JYU A;  2JY6 A;  4XE0 A;  1V81 A;  1JWM D;  2XBB C;  2O6V B;  3UF8 A;  1E8W A;  4HLE A;  5C2T B;  3PV1 A;  2KQ7 A;  3ZJV A;  1J19 A;  3DHH C;  2E3T A;  2BTE A;  3M3J A;  1WFY A;  3ZNZ B;  2BVC A;  2RDB C;  4G50 A;  3NZ3 A;  1YOV B;  1FNU A;  4KZ0 A;  1V49 A;  3ZJU A;  3FIL A;  1JAL A;  1UWX A;  4GDK A;  1EUV B;  2PLP A;  1AWD A;  5D7G A;  2LRU A;  3RNB C;  2N1V A;  2Z0E B;  2V1Y A;  3IBE A;  3AE2 B;  3H9D A;  1KTK A;  1FRR A;  4RGT A;  1Y56 A;  5LXH A;  1TY2 A;  2JRH A;  3RN9 C;  2H89 B;  4IG7 B;  3MTN B;  1TIF A;  1RYJ A;  4K3B A;  3PRM B;  1YQB A;  3AEE B;  3EA6 A;  1WZ3 A;  1RLF A;  1T0Q C;  2K6D B;  3AXC A;  2DYB A;  5E6O A;  3SDL C;  1FXI A;  3W2D A;  2DNF A;  3NVY A;  2QIL A;  4XDC A;  1M94 A;  3KUD B;  1L2N A;  2MJD A;  1AW7 A;  2MRP A;  2KYW A;  1I35 A;  1HE8 A;  4MEL A;  1N5W A;  5BMH A;  4AP4 C;  4EE2 A;  2ASQ A;  2YLM A;  3TL5 A;  3QHT A;  2D2Q A;  4JLC A;  2N9K A;  2B76 B;  4P1C C;  2IO0 B;  3PHW B;  4LNO A;  2N9P C;  2B3A A;  5CHV C;  3Q3N C;  1ZP0 B;  4ZOH C;  4D2K A;  2KAC A;  1P7F A;  2QC8 A;  3QQ8 B;  1UNS A;  4BZA A;  1C76 A;  1Y8R C;  4A20 A;  2K5P A;  1JWS D;  2VH1 A;  2XK5 B;  5EE9 A;  4FA6 A;  2D3A A;  1UZX B;  3VR8 B;  4IM3 A;  1IGD A;  2SAK A;  2L8J A;  2WU2 B;  3P2B A;  4DBG A;  1YJI A;  1WMH B;  3R7R A;  3IAS 1;  2QCZ A;  2VH2 A;  3GP7 A;  3BIN A;  2KO3 A;  3LDZ E;  4C80 A;  1U4A A;  3VRB B;  2FUG 1;  3QX1 A;  3UQB A;  4HRO A;  2WXF A;  3URY A;  3ZTC A;  3ZQ4 A;  4LLG M;  1D5Z C;  4KGR A;  1DOX A;  4L1B A;  2KDB A;  4KKJ A;  4YSY B;  5DPS A;  3A9K A;  1WX9 A;  2OHF A;  3P4Q B;  3B2F A;  4W9L A;  3OJ4 B;  3MJ5 A;  4IKG A;  1L5P A;  3L4P A;  4KV2 A;  1JML A;  1KLG D;  1TTN A;  4L2Y A;  5E6P A;  3PZ8 A;  3X0W A;  4RGM A;  4C56 C;  5AUI A;  3AEC B;  1NBF C;  1WF9 A;  1YN5 A;  3TJP A;  5T8I A;  4DXA B;  4TQ1 A;  1P0R A;  5I4D A;  4DHZ B;  2DWQ A;  1JWB D;  1V1P B;  2KN4 A;  3HHM A;  4M01 A;  4ARC A;  4XWT A;  2W54 A;  4KKI A;  4LDT D;  3HUI A;  2KLG A;  4FAD A;  3Q14 C;  3U8Z A;  3DPD A;  2V3S A;  4WWN A;  3IVF A;  2WXL A;  1ZXI A;  4ZHO A;  4HKZ E;  1HA5 A;  3NRZ A;  1IGC A;  3P42 A;  4ANV A;  3U2S C;  2WLB A;  2G9H D;  1H4R A;  2GOW A;  3AU5 A;  1I4X A;  1TKE A;  1Q10 A;  3E9S A;  4KZC A;  2SEB D;  1LM8 B;  2J53 A;  3ZDM C;  2Z59 B;  4HPP A;  3B08 A;  3MC0 B;  2LRW A;  1EF1 A;  1WYW B;  5D94 A;  2NBU A;  1UWM A;  1FIQ A;  4M02 A;  1E9M A;  1ET6 A;  4LDT B;  1XO3 A;  3UIO B;  2L1A A;  1XXG A;  4NQK E;  5BYS A;  2YEP F;  4JQW C;  1WGG A;  1TGZ B;  4RH6 A;  4X57 B;  2MH7 A;  5JZE B;  2KTR B;  2JX5 A;  3DBR B;  2IGG A;  3J9C A;  3Q8F A;  3IT6 B;  2AQ3 B;  4GXB A;  3FKY A;  4GDL B;  1WRI A;  3ZXR A;  1MG4 A;  3WA0 A;  2MP2 A;  3NHE B;  3UQA A;  3MC9 A;  3PGE A;  2PTL A;  4K7S A;  2KDM A;  2WXJ A;  1SSN A;  4KSL C;  2KZR A;  1DOI A;  4GDK B;  3RNG C;  1E10 A;  1SJH D;  2PIA A;  1F77 A;  4W9F A;  4ICV A;  3Q8E A;  4L23 A;  2L0F A;  3I5J C;  1FPY A;  2ON8 A;  2WNM A;  1IUE A;  2WHI A;  1WXS A;  2W55 A;  4XWW A;  1LFD A;  1C4P A;  3WAO A;  2EKI A;  3Q69 A;  4K1R B;  4O1N A;  2WGS A;  1NI2 A;  4MGK E;  3FIL B;  2GBR A;  1P7E A;  4FBJ B;  3P1M A;  2NBV B;  1TKY A;  1UEL A;  3VR9 B;  1WZ0 A;  3C8Y A;  3RPF C;  2V3N A;  2WDQ B;  2QJL A;  4W9C A;  3V61 A;  2WXG A;  4A6Q A;  3H7S A;  1V6E A;  2HTM E;  3A4R A;  3N3K B;  4WIP A;  4W9I A;  2KN5 A;  3U7D A;  2FBW B;  4C00 A;  2REX A;  3A1Q A;  5HKH A;  3NZS A;  3ML9 A;  2N9X A;  3AE4 B;  1XLO A;  2K39 A;  1VR9 A;  3V60 A;  5FR6 A;  4LNI A;  2ZZP B;  5IAA C;  4GOC A;  5CX3 A;  1ESF A;  1GUA B;  3PPA A;  3L0W B;  3OG5 A;  1PGB A;  3H7P B;  4W9K A;  3RNA C;  4HPM B;  2RD0 A;  3AE7 B;  2UU7 A;  4XZ4 A;  1K8R B;  4MM3 A;  3W5V B;  1KM7 A;  2BWE S;  2ZPY A;  3ZTD A;  2AL3 A;  4DDI D;  3Q6B A;  3CSF A;  4ANU A;  3Q3F A;  2PE6 B;  3OJ3 A;  2RGF A;  5D6J B;  2H88 B;  4HJK A;  1KLV A;  1PUT A;  2C60 A;  1GAQ B;  2M0X A;  1QQR A;  2XK5 A;  2IY0 B;  1TZ1 A;  4K81 A;  4KIK B;  2DYM A;  2RSU A;  2KFJ A;  2AL6 A;  3R7Q A;  5IKC M;  4EZK A;  4AJW A;  3HIZ A;  2OOB B;  2JYE A;  1GJZ A;  2GI9 A;  1JRP A;  4NAW A;  3AE5 B;  1ZW7 A;  4RGO S;  4I6N B;  1OQY A;  3HRD D;  5BMG A;  3I57 A;  4RMA A;  5DCN A;  4AWJ A;  3GB1 A;  2MCN B;  1WSP A;  2KHW B;  1OTR B;  2LUE A;  3ZYY X;  2JXT A;  2LGY A;  1ZUD 2;  2HE7 A;  3APC A;  1IP9 A;  2PMV A;  2INN E;  4TSS A;  1I7H A;  3DDC B;  1S1Q B;  2WYQ A;  4US9 A;  4KIK A;  2MA9 B;  1EM7 A;  1R4M B;  1NI3 A;  3SEB A;  2KQS A;  2BS2 B;  4NQL B;  3DWG C;  4RNA A;  4REZ A;  2RDG A;  1Q5W B;  2MBO A;  1MG8 A;  1KJT A;  2KWU B;  1WMH A;  2JU6 X;  3VUW A;  4MM3 B;  1P98 A;  2JYT A;  2JT4 B;  1XLQ A;  5G55 A;  4F1S A;  1QOB A;  3DHI C;  1C4A A;  4PYZ A;  2X38 A;  2HJ8 A;  2ZW0 A;  1SXT A;  2WQY B;  1EF5 A;  2MP2 B;  1I4P A;  3H8H A;  3ML8 A;  2GB1 A;  2WS3 B;  4TMA B;  1RFA A;  4HCN B;  5JXV A;  1P1A A;  1D5X C;  3Q8C A;  2LJI A;  4OZA A;  4DHJ D;  4EKU A;  2L76 A;  4FHK A;  3AI5 A;  5D3D A;  5MPO A;  1KH0 A;  1PQS A;  4DXF A;  1D6E C;  2M0A A;  4IWO A;  2R61 A;  4IOI E;  2LUM A;  3APF A;  2WX1 A;  3IFW B;  2L0T A;  5IO9 A;  3BYT B;  4ZRI A;  3DVG Y;  2KWD A;  3B1L X;  5CHW A;  1B1Z A;  3EUB 2;  3ZKJ C;  4E74 A;  1GB4 A;  1PDX A;  2ZPN A;  4WUR A;  2N7J A;  3NZU A;  1D3Z A;  2DYO A;  3N20 C;  4IWP A;  1JWU D;  3CWI A;  3TIX A;  5GXG B;  1YQ3 B;  2K25 A;  3C19 A;  1L0X B;  4WWM A;  3NVV A;  4HXD A;  2MQJ A;  3M62 B;  2GBN A;  1CJE A;  4HDO A;  3PSE B;  1PGA A;  2Y3A A;  1BT0 A;  1E90 A;  3B2G A;  3M63 B;  2QEJ C;  3LMN A;  4HKQ A;  3V3X A;  3ALB A;  3L10 B;  4FLH A;  1ZGU B;  5DPR A;  2VRR B;  4CHK A;  1C79 A;  1QIL A;  5JHB A;  3P4R B;  1N6Z A;  5AZH A;  3ZO5 B;  4GGQ A;  2WXN A;  2CS4 A;  3W1S A;  4XX5 A;  5DPT A;  3ZNG C;  3N32 A;  2AEH A;  3X23 A;  4WWO A;  1VD2 A;  5L95 C;  4F7Z A;  2HJ1 A;  1I4R A;  2FCM A;  2AQ1 B;  3DVN V;  2ZJD A;  3NUH B;  3AEF B;  3R66 C;  4A90 A;  1FCC C;  1SIF A;  3U4E G;  4YT0 B;  4W9H A;  3DBL I;  5EE1 A;  3QK0 A;  5C1Z A;  3DBH I;  2TSS A;  4LJP B;  1NDD A;  3AE8 B;  2ONQ A;  2WXQ A;  1QF6 A;  4KGS A;  2NBW B;  4LJO B;  1OQQ A;  5JH5 C;  4NNJ B;  2LAS A;  4ZHP A;  4W9E A;  3TMP B;  4MGI E;  3L16 A;  1MPE A;  3PLV A;  2WXM A;  5HHD G;  2KDI A;  4AJY B;  4C7Z A;  1L4D B;  2L3Z A;  3OLM D;  4UDU C;  2L32 A;  2HTH A;  3TEX A;  3RZW C;  2PEA A;  1XEE A;  5D3I B;  2JZ3 B;  3N30 A;  4B9K A;  3AE6 B;  2NR2 A;  3GE3 C;  1Z5S B;  1LO5 D;  2LGI A;  1MJD A;  2K8H A;  3RD2 A;  3ETR A;  1H8C A;  1ENF A;  3VH3 B;  3TSS A;  3V6E B;  1GB1 A;  2GBK A;  5FK9 C;  1J0G A;  1NYQ A;  1HZ6 A;  2BYF A;  4RFB A;  4URK A;  2J0M A;  5HI1 A;  3V62 A;  2JXX A;  2ZVN A;  1IBX B;  2N7D A;  2G1E A;  1WR1 A;  4KX6 B;  4DXG A;  1GOZ A;  3APD A;  2KC2 A;  1E0Z A;  3ZGZ A;  3K9O B;  2JPH A;  4GN1 A;  2J0K A;  4BKT A;  3FC4 A;  4N59 A;  1RWS A;  3QWZ B;  4NJC A;  4BKG A;  1OFF A;  2MLB A;  2N7E A;  4CYE A;  3BZD B;  3DVN U;  4DHJ B;  3UGB B;  4HDQ A;  3L54 A;  1MI0 A;  4IDI A;  1T3Q A;  2NMQ A;  2CU1 A;  3R8B A;  3M95 A;  4YTN B;  5IP4 D;  2K3U A;  3EC8 A;  1DGJ A;  4WJN A;  1FD6 A;  3PTF C;  4FN2 A;  1QOA A;  3H7P A;  1V80 A;  5G2N A;  3BII D;  3VDZ A;  4EZL A;  2D3B A;  4M8M A;  1YJJ A;  2RDH A;  2LVQ A;  4CO7 A;  3ENE A;  1R4N B;  4MH8 A;  1SB3 C;  3DCG A;  4R3D A;  3AE3 B;  2EMT A;  3P63 A;  4B95 A;  4P7I A;  3IG3 A;  4S0R A;  4K7U A;  4A9A A;  2LXC A;  3MHZ A;  2Y5B B;  1VZ6 A;  3IT4 B;  2R2Q A;  1LXD A;  4A3O A;  1QKZ A;  2HDE A;  2N1W A;  2A4Z A;  4ZYS A;  5EE0 A;  4MH0 E;  1N62 A;  2JSV X;  3DQV A;  4XDD A;  1EU4 A;  4OW0 A;  3T8M A;  4II2 B;  1STE A;  5DPW A;  3DBH B;  2DZI A;  2KQ4 X;  4DQO C;  3E56 A;  3BK2 A;  1SE9 A;  5BO4 B;  3BVM A;  3W9C B;  2LGS A;  2BF8 B;  1L0Y B;  2RMM A;  2FID A;  4NJ6 A;  2BYT A;  1F2R I;  2QDF A;  2N9E B;  3AEA B;  1LQB A;  2D07 B;  4WQM A;  2ZEQ A;  1SGH A;  4ZYN A;  3N1Y C;  2DZJ A;  3EEC A;  2NPT A;  3HVZ A;  4K7W A;  3CST A;  2I38 A;  2RR9 A;  1M4V A;  1YX5 B;  2JUO A;  2M8S A;  1CMX B;  5J18 A;  4RGN A;  4YWG G;  4KSK C;  3PZ7 A;  3VQI A;  3DBS A;  4TKN A;  3V6C B;  1UD7 A;  1WI0 A;  2BT6 A;  3I63 C;  1QZE A;  3R2I A;  3CIR B;  1XLP A;  3AUL A;  5LXI B;  1F1H A;  1I4Q A;  1K51 A;  1B9R A;  2K6Q A;  5IN7 A;  4HWI B;  1TS5 A;  3ABV B;  4FUL A;  2XEW A;  2AX5 A;  3N9Y C;  4B0M A;  3Q3J A;  5HFY A;  1WXM A;  1WGY A;  2KWC A;  2D10 A;  1KOT A;  4WQO B;  2DAF A;  3ZJT A;  2KWV B;  3N1X C;  3EFC A;  3ZIM A;  3RZF A;  4MGZ E;  3ZXV A;  3SU8 X;  4HVB A;  3TEZ A;  2LJ5 A;  2PPH A;  4EUT A;  3KWV A;  4HCP B;  5E6N A;  1ACC A;  2ZNV B;  2FE8 A;  3MJW A;  2G45 B;  3SHQ A;  3O65 B;  4EOY A;  1WIA A;  1F2R C;  2CR5 A;  1ZE3 D;  3LB8 C;  3TCA A;  3T3N A;  2Q5W D;  2WDT B;  1R4M I;  2KJR A;  1T0Y A;  2EKE C;  1YJ1 A;  2GMI C;  2BGF A;  3KWL A;  1I4H A;  1J8C A;  4TV3 A;  2PJH A;  1MHH E;  4YSZ B;  2C7N B;  2ICI A;  2ZW1 A;  2UWQ A;  1BML C;  3VH4 B;  5HG2 A;  4GSW A;  4M0W A;  3BYY B;  1FRD A;  2CJN A;  2JQR B;  2UYZ B;  5CTR C;  4BOS C;  3NY5 A;  3Q3M C;  1ZXH A;  3AU4 A;  4PT5 A;  2KDE B;  5AUK A;  2KTF A;  1Q1O A;  1EWY C;  3MC8 A;  2VZK B;  4HRS A;  4NJ7 A;  4USA A;  3AB5 A;  3A1Q B;  2FCN A;  2AYO B;  2G4S A;  2ZVO A;  2KFK B;  1VRA B;  3JVZ X;  1UF0 A;  4JIO U;  3WAL A;  4ANW A;  1SEB D;  4Q2J A;  1WJ4 A;  2C5L C;  3EFU A;  1F52 A;  3RNC C;  3AV8 A;  2D3C A;  1TS2 A;  4WWP A;  4P1B C;  4BKS A;  2JZP A;  4P6V F;  4C7Y A;  1EWC A;  2MX2 A;  3QAR A;  4BFR A;  5TSS A;  3KH0 A;  2L7R A;  1E8X A;  2BYV E;  3WAP A;  4RF0 A;  1K52 A;  1ZOY B;  2J7Q B;  3A9J A;  2FAZ A;  1S3S G;  4WJO A;  2BKR B;  4G0N B;  2LEK A;  1PYW D;  2DHZ A;  3PHX B;  2PKO A;  3H6N A;  1V9J A; 
#chains in the Genus database with same CATH homology
 2N4F A;  3ALB A;  3L10 B;  3P2B A;  4DBG A;  4FLH A;  1ZGU B;  5DPR A;  1WMH B;  3R7R A;  2VRR B;  1V5O A;  4CHK A;  3BIN A;  2KO3 A;  1VCB A;  3LDZ E;  1U4A A;  2G3Q B;  3OAW A;  5JHB A;  3CMM B;  3KYD D;  4KDI C;  5AZH A;  3ZUN A;  1JRU A;  1XT9 B;  3QX1 A;  3UQB A;  2L05 A;  3DOW A;  3VUX A;  3ZO5 B;  4GGQ A;  4ASW C;  2CS4 A;  3W1S A;  4XX5 A;  2ZNV C;  5DPT A;  3ZTC A;  3ZNG C;  2KX0 A;  3N32 A;  2AEH A;  2LI5 A;  3X23 A;  4WWO A;  1VD2 A;  4N9F 4;  5L95 C;  4F7Z A;  1EO6 A;  2KDB A;  4MJS A;  5DPS A;  4PYU A;  2FCM A;  4RM8 A;  3A9K A;  3DVN V;  1WX9 A;  5AEK B;  2IZV B;  2ZJD A;  2KJH B;  4JGH B;  1E8Y A;  2KXJ A;  3KVF B;  3R66 C;  1SIF A;  1WE7 A;  1ISN A;  4W9H A;  3DBL I;  2KMC A;  3QK0 A;  4W9L A;  5C1Z A;  3DBH I;  3OJ4 B;  4LJP B;  1NDD A;  1YX6 B;  4ICU A;  3TBL D;  2M1M A;  1V5T A;  4KV2 A;  4HPL B;  3VTV A;  5JHA A;  1TTN A;  2NBW B;  2RPQ A;  4LJO B;  1IPG A;  4MEM A;  2KK8 A;  5E6P A;  5JH5 C;  4NNJ B;  4W9J A;  3X0W A;  2LAS A;  4EZJ A;  4W9E A;  3TMP B;  3DVG X;  1NBF C;  1WF9 A;  3BY4 B;  2BYE A;  3H1U A;  3KUZ A;  3L16 A;  3PLV A;  4MGI E;  5AZG A;  3TJP A;  3ZRC A;  2FUH B;  3RYT A;  3RCZ A;  4DXA B;  4TQ1 A;  1P0R A;  2KDI A;  4AJY B;  2O2V B;  2DZM A;  2FCQ A;  4DHZ B;  2L3Z A;  3OLM D;  4MSM B;  2HTH A;  3HHM A;  4M8N A;  1WGH A;  3ZDT A;  4II3 B;  2PEA A;  3RZW C;  3VTW A;  2JZ3 B;  3N30 A;  2M17 A;  4LDT D;  3PS6 A;  4B9K A;  2KLG A;  4FAD A;  4LCD E;  1XQQ A;  2NR2 A;  3U8Z A;  1E7V A;  1Z5S B;  2IO1 B;  2LD9 A;  1GNU A;  3RD2 A;  2K8H A;  3DPD A;  1H8C A;  3VH3 B;  1E5W A;  3A9J B;  3V6E B;  2V3S A;  4WWN A;  3IVF A;  2GBK A;  2CHZ A;  4MDK E;  1J0G A;  3L17 A;  1WGR A;  2BYF A;  3B0A A;  2KMA A;  4GIV A;  4ANV A;  5KHO A;  3CF6 E;  3QCA A;  2GOW A;  1H4R A;  3AU5 A;  4KZC A;  4URK A;  2J0M A;  2O6V D;  1LM8 B;  3V62 A;  4IC7 B;  2JXX A;  2KJ6 A;  1WGD A;  1ZKH A;  3ZDM C;  2Z59 B;  3B08 A;  2ZVN A;  2LRW A;  2N7D A;  3WIM A;  1EF1 A;  1WR1 A;  1WYW B;  2Z0D B;  5D94 A;  2NBU A;  2KDF B;  3APD A;  1WJ6 A;  2KC2 A;  4LDT B;  1C3T A;  1P9D U;  3VAW A;  1GC7 A;  2MWS B;  3K9O B;  2JPH A;  3UIO B;  4BKS D;  4WAA A;  2MW5 A;  4YL8 A;  4NQK E;  4GN1 A;  4WJQ A;  3RT3 B;  2J0K A;  4IM0 A;  1C1Y B;  2KKC A;  3MHS D;  4JQW C;  3W1Y A;  1WGG A;  4BKT A;  1TGZ B;  4MJS B;  3HM3 A;  2IO3 B;  4X57 B;  2ZCC A;  3VXW A;  3JW0 X;  3QWZ B;  4BKG A;  2MLB A;  2N7E A;  4ANX A;  4CYE A;  5JZE B;  1WM2 A;  2KTR B;  2IYD B;  1WJU A;  5AZF A;  1UBQ A;  3KYC D;  4IM2 A;  4PS7 A;  2A5U A;  4GXB A;  1UGM A;  3ONS A;  4NAW B;  3DVN U;  2IO2 B;  1X1M A;  4DHJ B;  4GDL B;  3UGB B;  2R2O A;  4HDQ A;  5EDS A;  4AOF A;  2KD0 A;  1A5R A;  4IW0 A;  3L54 A;  1TBE A;  3U30 A;  3D32 A;  1AAR A;  2M4N A;  4MSQ B;  2HD5 B;  2JZZ A;  2AWT A;  3WA0 A;  4DWF A;  2NVU I;  2CU1 A;  3A9K B;  2MP2 A;  3NHE B;  2CKH B;  3UQA A;  1WR6 E;  3M95 A;  3PGE A;  4K7S A;  3ZW3 A;  2KLC A;  1E7U A;  2LVP A;  4KSL C;  3EC8 A;  2KZR A;  1WX7 A;  4GDK B;  4WJN A;  3GZN I;  3PTF C;  2ZCB A;  4FN2 A;  5L83 A;  3H7P A;  4GB9 A;  4W9F A;  1GC6 A;  1R4N I;  4NPN A;  4XC2 A;  4ICV A;  2BWF A;  2L0F A;  1V80 A;  4DDG D;  5G2N A;  2OJR A;  2DX5 B;  3VDZ A;  4EZL A;  4M8M A;  1W6V A;  2CHX A;  3ZNH B;  2LVQ A;  1WM3 A;  4CO7 A;  3ENE A;  2C7H A;  1WXS A;  3SD5 A;  1L7Y A;  5KHQ A;  1GG3 A;  1LFD A;  2WWZ A;  4KVG B;  2KC1 A;  3WAO A;  2D11 A;  2JVC A;  1WJN A;  4ZRK A;  4F8C B;  3DCG A;  4K1R B;  3JSV A;  3ZRF A;  2EMT A;  4G11 A;  1FXT B;  4B95 A;  1NI2 A;  4P7I A;  4AUQ C;  3IG3 A;  4MGK E;  4K7U A;  3PRE A;  3UIP B;  3ZNI D;  2LXC A;  2D3G A;  3UIN B;  2GBR A;  4FJV B;  2JF5 A;  4E3C A;  2Y5B B;  4FBJ B;  4GMV A;  1UH6 A;  2R2Q A;  3PZD A;  1LXD A;  4A3O A;  2NBV B;  1UEL A;  1WZ0 A;  3L13 A;  4DHZ E;  2N1W A;  2O6V A;  2A4Z A;  2I1K A;  3QJZ A;  4MH0 E;  4RM9 A;  2LGD A;  4BOZ B;  1E8Z A;  3HM6 X;  4W9C A;  3DQV A;  2BPS A;  3PRZ A;  2KVR A;  4HK2 A;  2CHW A;  3V61 A;  4WJP A;  4OVU A;  3H7S A;  4FJY A;  3WAM A;  1V6E A;  4FJZ A;  3T8M A;  3A4R A;  4II2 B;  3N3K B;  3LJ3 A;  4JL9 A;  3ZLZ A;  5DPW A;  1Z2M A;  4OVV A;  2KN5 A;  4W9I A;  5LLI A;  3T9L A;  3U7D A;  2DZI A;  2WX0 A;  2LXA A;  3HK0 A;  2K1F A;  1SE9 A;  2REX A;  3A1Q A;  5BO4 B;  5HKH A;  1OGW A;  3NZS A;  1RRB A;  3ML9 A;  1I42 A;  2K8C A;  3ECI A;  2N9X A;  3QA8 A;  2K39 A;  3V60 A;  1IYF A;  2BF8 B;  5FR6 A;  1OEY J;  4J6I A;  4NJ6 A;  2FID A;  3A4S C;  2ZZP B;  4KDL B;  2N9E B;  4GOC A;  5CX3 A;  5IAA C;  4W9D A;  1WY8 A;  1GUA B;  3PPA A;  2C9W B;  3L0W B;  1LQB A;  3H7P B;  4W9K A;  2D07 B;  2MBE A;  1F9J A;  2RD0 A;  2ZEQ A;  4HPM B;  3VVW B;  3ZVV A;  1SGH A;  2EMS A;  4ZYN A;  4XZ4 A;  2DZJ A;  1K8R B;  2MBB B;  4MM3 A;  3EEC A;  4MGY E;  2NPT A;  4K7W A;  1KM7 A;  2BWE S;  2ZPY A;  3CST A;  3ZTD A;  2AL3 A;  4DDI D;  3K9P B;  4E71 A;  2RR9 A;  2FCS A;  3CSF A;  1WXV A;  4ANU A;  2G4D B;  1YX5 B;  2JUO A;  3Q3F A;  2DAJ A;  2JRI B;  2M8S A;  3JSV B;  3QC8 B;  1CMX B;  5J18 A;  2W9N A;  5J2R A;  2PE6 B;  3OJ3 A;  2NS5 A;  2RGF A;  4KSK C;  3DBS A;  5D6J B;  1WX8 A;  3VQI A;  4TKN A;  3R3M A;  3NS8 A;  3V6C B;  4HJK A;  1UD7 A;  2JWZ A;  1KLV A;  2C60 A;  1WI0 A;  3GOE A;  2M0X A;  2NPT B;  1QZE A;  2XK5 A;  4EFO A;  3VHT C;  2IY0 B;  4EEW A;  2KAN A;  3C0R B;  1TZ1 A;  3AUL A;  3VUY A;  1G6J A;  1P3Q U;  4K81 A;  4KIK B;  5LXI B;  3KW5 B;  2DYM A;  1V86 A;  3WAN A;  2V4L A;  2RSU A;  1WRD B;  2KFJ A;  2LWP A;  2AL6 A;  2YVC A;  2LGX A;  3I3T B;  4I6P A;  3R7Q A;  3VFK A;  2K6Q A;  4BBN C;  4ZDV A;  4I6L B;  2O2V A;  4EZK A;  4AJW A;  3RUL A;  4HWI B;  4FUL A;  1RAX A;  3HIZ A;  2J0J A;  2OOB B;  1GJZ A;  3EHV A;  4NAW A;  2DEN B;  1ZW7 A;  2XEW A;  2NCN A;  3QIJ A;  4TUU A;  4I6N B;  1OQY A;  2GBM A;  3Q3J A;  5DCN A;  4RMA A;  4AWJ A;  3PVL A;  1WXM A;  4ZRJ A;  1V2Y A;  2MCN B;  4IWQ A;  2KHW B;  1WGY A;  2IBI B;  1OTR B;  2KWC A;  2LUE A;  2JY6 A;  3JYU A;  4NY0 A;  1V81 A;  2D10 A;  1KOT A;  2LGY A;  2XBB C;  2O6V B;  4WQO B;  2HE7 A;  3APC A;  2DAF A;  3UF8 A;  1IP9 A;  1E8W A;  4PS3 A;  4HLE A;  2LZ6 A;  3PLU A;  1UBI A;  3PT2 B;  1YD8 U;  2DZK A;  3QAQ A;  3PV1 A;  2KQ7 A;  3DDC B;  1J19 A;  2KWV B;  2FNJ B;  1WE6 A;  2FIF A;  1S1Q B;  3ZIM A;  2WYQ A;  3RZF A;  4MGZ E;  3M3J A;  3DBR I;  3SU8 X;  4HVB A;  1WFY A;  2MA9 B;  4KIK A;  3ZNZ B;  2KNB A;  2LJ5 A;  4BVU C;  2PPH A;  4EUT A;  4HCP B;  4TQ0 A;  5E6N A;  1XD3 B;  2KQS A;  2KX3 A;  4G50 A;  2ZNV B;  4NQL B;  3MJW A;  2G45 B;  4W9G A;  3SHQ A;  3O65 B;  4EOY A;  1Q5W B;  1WIA A;  4KZ0 A;  2LVO A;  1V49 A;  2MBO A;  1MG8 A;  2CR5 A;  1KJT A;  4GDK A;  4B6W A;  1EUV B;  2KWU B;  3TCA A;  1WMH A;  5D7G A;  2LRU A;  2N1V A;  2WDT B;  1R4M I;  2KJR A;  2Z0E B;  3VUW A;  4FHJ A;  1T0Y A;  2V1Y A;  3IBE A;  2EKE C;  3PRP B;  1YJ1 A;  1P98 A;  2GMI C;  5GMV A;  3H9D A;  3NOB A;  3L08 A;  2BGF A;  2JT4 B;  3IHP C;  1J8C A;  5G55 A;  4TV3 A;  2PJH A;  4F1S A;  4GU2 A;  5LXH A;  2C7N B;  5CHF A;  2JRH A;  2UWQ A;  4IG7 B;  4PYZ A;  3VH4 B;  3MTN B;  2HJ8 A;  4GSW A;  3KUC B;  3PRM B;  2QHO A;  1YQB A;  1EF5 A;  3VTU A;  2UYZ B;  4GDL A;  2MP2 B;  5CTR C;  3S2A A;  1WZ3 A;  4BOS C;  1WXA A;  3ML8 A;  3NY5 A;  1RLF A;  1RFA A;  4HCN B;  1P1A A;  2K6D B;  3AXC A;  1YIW A;  2DYB A;  5E6O A;  2KTR A;  3SDL C;  3AU4 A;  2KDE B;  4DHJ D;  5C23 A;  4EKU A;  2KTF A;  1Q1O A;  2L76 A;  4FHK A;  4IUM B;  1M94 A;  3KUD B;  1L2N A;  3AI5 A;  4NJ7 A;  2GBJ A;  1PQS A;  2MRP A;  1I35 A;  2KFK A;  4PS8 A;  1HE8 A;  1OEY A;  3A1Q B;  4MEL A;  2FCN A;  2MSE D;  2IY1 B;  4IWO A;  2AYO B;  2G4S A;  2ZVO A;  2KFK B;  5IA7 A;  3JVZ X;  4AP4 C;  3APF A;  2WX1 A;  3IFW B;  2L0T A;  4JIO U;  5TR5 A;  2ASQ A;  2MBQ A;  2YLM A;  3WAL A;  4ANW A;  4ZRI A;  3TL5 A;  3DVG Y;  1WJ4 A;  2C5L C;  3QHT A;  3B1L X;  5CHW A;  3EFU A;  2MBH A;  2D2Q A;  2L00 B;  4JLC A;  3ZKJ C;  2C7M B;  4E74 A;  4WWP A;  5J17 A;  4G3X B;  4BKS A;  2ZPN A;  2IO0 B;  3PHW B;  3NZU A;  1WH3 A;  1D3Z A;  2DYO A;  2N9P C;  4IWP A;  2B3A A;  2MX2 A;  3QAR A;  5CHV C;  5D2M B;  3RUI B;  4BBN F;  4BFR A;  4A3P A;  3TIX A;  2I1J A;  3KH0 A;  2L7R A;  4M0W B;  1E8X A;  1Q0W B;  2K25 A;  3QQ8 B;  2BYV E;  4HXD A;  3WAP A;  1Y8R C;  2MQJ A;  3M62 B;  3W1S C;  2GBN A;  2J7Q B;  2FAZ A;  1S3S G;  3A9J A;  4WJO A;  4A20 A;  3A33 B;  4HDO A;  2KOX A;  2XK5 B;  3PSE B;  2BKR B;  4G0N B;  4DK5 A;  1BT0 A;  2K8B A;  1E90 A;  4FA6 A;  2PE9 A;  3M63 B;  1UZX B;  2DHZ A;  3PHX B;  3LMN A;  4IM3 A;  3H6N A;  1V9J A;  2L8J A;  2BKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...