4A3PA

Structure of usp15 dusp-ubl deletion mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
214
structure length
210
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 210
sequence length 214
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3pA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3pA01
2LI5A 2NBVB 5L95C 4K7SA 3UINB 1P9DU 2R2QA 3EECA 3ZIMA 5DCNA 3LDZE 3L54A 2O6VB 2KX3A 4I6PA 3PLVA 3VFKA 4GDLB 2MCNB 2BYVE 2C5LC 2JRHA 2KC2A 3DOWA 4MJSA 3AU5A 4AJWA 4ANUA 3MJWA 5G55A 3U8ZA 2B3AA 2KDEB 3N32A 3NZSA 2MA9B 3PRZA 2KWVB 4DWFA 2L76A 3AXCA 2L0FA 3TJPA 1WM2A 1RFAA 2A4ZA 3DBLI 4HCNB 3U30A 2MLBA 2BKFA 2DAFA 2MX2A 1XT9B 3ENEA 4XZ4A 3RZWC 4XX5A 2ZJDA 3TL5A 2NPTB 4YL8A 3KUDB 4TUUA 2LWPA 4EEWA 3R3MA 4DDID 3DVNU 2CU1A 2KWUB 3HK0A 1OGWA 4F1SA 1J19A 3AULA 1X1MA 4AOFA 4GMVA 3VH3B 1ZW7A 4KZCA 2KLGA 4E3CA 3JSVB 3H7PA 3VTUA 2ZPNA 4CO7A 2N1WA 5JHBA 5JZEB 2DAJA 4K7UA 4GN1A 1EUVB 2LD9A 1WYWB 4KIKB 4MJSB 3PZDA 2ZCBA 4HCPB 4IM0A 1NDDA 4JGHB 3B0AA 2KFJA 2FCSA 5D2MB 3S2AA 4LDTB 2I1KA 2WDTB 3C0RB 4FJVB 2XBBC 3ZVVA 2LRUA 1P1AA 2KTFA 1GJZA 4NJ6A 1UH6A 2I1JA 3PHXB 3DVGY 4I6LB 1WXSA 4EUTA 1E90A 3ZNID 4PS3A 1WGHA 1UBIA 3ZDTA 3ZO5B 4CHKA 4DXAB 1GC6A 4MEMA 4PYUA 3WAOA 3AU4A 1NBFC 2DYOA 4EZJA 2DZJA 4HLEA 3PT2B 2LZ6A 3AI5A 3UIPB 1GG3A 4TQ0A 3A1QA 4HPMB 2UWQA 1UZXB 1P0RA 1WMHB 4KSLC 2M4NA 2ZZPB 2KXJA 4FADA 3L10B 3LJ3A 2DZMA 2EMSA 1ZGUB 2NBUA 4ICUA 3V6EB 2KLCA 3A9JA 2XK5A 3ML9A 2C60A 3OJ4B 3DBHI 4MGKE 4TQ1A 1TGZB 1WJUA 2MBHA 2IY0B 3PV1A 4EZLA 2NCNA 1S3SG 2WX1A 3EHVA 2HJ8A 3IHPC 2PEAA 4BKSD 1G6JA 4IM3A 4W9JA 2N9EB 3R66C 2RSUA 4TV3A 2XEWA 2GBJA 3A9KB 4GGQA 3IFWB 3PVLA 1UELA 3ZKJC 2BWFA 4BVUC 4FHKA 5J18A 5L83A 1VCBA 2FIFA 4OVVA 2C7HA 2KK8A 2IY1B 4GXBA 1WGRA 4ASWC 2RPQA 1WGYA 1JRUA 2DX5B 2DZIA 4FHJA 2LXCA 2O6VA 4HDQA 3PTFC 4MDKE 3ZW3A 1OQYA 2DHZA 2L00B 4GDLA 3NZUA 1YX6B 1NI2A 3V6CB 3WAMA 1WF9A 1AARA 1WE7A 4NY0A 4K7WA 3RD2A 3JYUA 3SDLC 4GU2A 2IZVB 2N4FA 3B08A 2KJHB 1Y8RC 3KUCB 1YD8U 2OOBB 2NPTA 1YJ1A 3APFA 4EOYA 2IO2B 2LVOA 1VD2A 1Q1OA 4WWPA 2M8SA 2KDFB 4G0NB 1WGDA 2AL6A 3M3JA 3QIJA 3NHEB 3QAQA 4GDKA 2CR5A 4K1RB 1YIWA 3WAPA 2NVUI 4ANVA 2G3QB 5JHAA 2MBBB 4ZDVA 2KKCA 1OEYJ 3JSVA 2EKEC 2V1YA 4IM2A 2C7MB 4F7ZA 2JVCA 2KC1A 2ZVOA 2KQ7A 1H4RA 2KVRA 2O2VA 4W9CA 3ZNHB 2BYEA 2JUOA 4KSKC 4GSWA 4KIKA 5AZGA 1I35A 2N7EA 2OJRA 1U4AA 3JW0X 1TBEA 2LVPA 3EC8A 2L0TA 1E7VA 4A20A 2KJRA 1A5RA 1WZ3A 2GBKA 3PSEB 4MELA 2MBQA 3HIZA 2KO3A 2ZPYA 3ZTCA 5LXHA 2J0MA 4DK5A 3CSFA 5DPRA 3A4SC 1WI0A 1WZ0A 1ISNA 2Z0DB 1Q0WB 1PQSA 3VTWA 1EF5A 4E74A 1WH3A 3H7SA 1RAXA 4GDKB 3QWZB 4ZRKA 5E6PA 1J8CA 4W9GA 1RLFA 2RD0A 4JIOU 4LJPB 5DPTA 3V61A 3PREA 2K25A 5D6JB 2KNBA 4NNJB 2MRPA 2O2VB 3R7QA 1IPGA 2D07B 4JL9A 2JXXA 1WMHA 2D11A 4KV2A 2L05A 2YLMA 4I6NB 2L8JA 2J0JA 3PHWB 2KN5A 4G3XB 1KJTA 1T0YA 2KZRA 3O65B 3QX1A 4F8CB 4JQWC 5BO4B 4W9KA 4DHJB 3R7RA 2JPHA 4BFRA 4EZKA 3ALBA 3D32A 3JVZX 3QCAA 3ZUNA 3H6NA 3VQIA 3QQ8B 3TIXA 5J17A 2BGFA 2LASA 3A9KA 3ECIA 1SIFA 2ZVNA 4BOZB 3MTNB 4FJYA 2BF8B 3HM3A 2MSED 3QC8B 1YX5B 1WJNA 1V86A 2JRIB 3ZDMC 3CSTA 1WXAA 1WE6A 1K8RB 3VUXA 3W1SA 4GB9A 3WA0A 2LRWA 4ANWA 2Z0EB 3APCA 3PGEA 2KD0A 1V49A 3U7DA 1OEYA 1WIAA 4CYEA 3Q3FA 2CKHB 1F9JA 1M94A 3QA8A 3IBEA 2G4SA 3X0WA 1UBQA 3DBRI 1GUAB 2K39A 1GNUA 4FBJB 4XC2A 3A33B 2CHZA 4J6IA 3QARA 1V5OA 3IVFA 4MGZE 2O6VD 4HDOA 4KVGB 4IWPA 2KHWB 4URKA 5D94A 2MP2A 3GZNI 3N3KB 3DPDA 5LLIA 2G45B 4AJYB 3B1LX 3UQAA 4NPNA 4NQKE 2IO1B 3VDZA 5IA7A 1IP9A 1KM7A 2DZKA 3SD5A 4ZRIA 3RUIB 3M95A 1L7YA 3H1UA 1CMXB 4B6WA 2FCMA 3PS6A 3VUYA 1V5TA 1WFYA 4W9DA 3DBSA 5TR5A 3UIOB 3APDA 2JY6A 3KW5B 2PPHA 2RR9A 2Z59B 2K6QA 2V4LA 4WQOB 2FAZA 4G11A 3WALA 1WM3A 4IW0A 2BYFA 2FIDA 5C1ZA 3DVGX 1R4NI 1V80A 3K9PB 4BBNC 2LUEA 3RCZA 2MW5A 5DPWA 5E6NA 1TTNA 1WXVA 2N1VA 3VAWA 4FN2A 4M8NA 3BY4B 2MP2B 1SE9A 1E8YA 4JLCA 3SU8X 1WXMA 3Q3JA 3T9LA 2ZCCA 2LVQA 3ZNZB 1C1YB 3VH4B 3GOEA 5CHVC 2R2OA 1Z2MA 2CS4A 1E8ZA 1IYFA 4AUQC 3QK0A 3ONSA 2NR2A 3KYDD 1HE8A 4LDTD 4KDLB 3W1SC 5CTRC 4ICVA 2PJHA 2V3SA 4DHZB 2L7RA 4PS8A 2AL3A 5GMVA 2M0XA 3K9OB 1L2NA 3M63B 2KMCA 2K8BA 4K81A 2K8CA 3RT3B 1P98A 2EMTA 2FCQA 1LFDA 5IAAC 3VTVA 4FA6A 3BINA 2IBIB 4X57B 3V62A 4FJZA 2PE6B 1W6VA 3WIMA 4GOCA 1WRDB 2IO3B 4FLHA 2MQJA 3CMMB 3DQVA 3SHQA 1WR6E 3OAWA 4MSMB 3PRPB 2K6DB 3IG3A 4RM8A 4G50A 1P3QU 2WYQA 1ZKHA 3L16A 1BT0A 2JZ3B 4NAWA 2MBEA 2D3GA 2M1MA 3CF6E 3L17A 2J0KA 2HTHA 4WAAA 4MGYE 4WJPA 2GOWA 4OVUA 3KVFB 1Z5SB 3KH0A 4ZYNA 2REXA 5J2RA 3PRMB 4M0WB 4HK2A 1V2YA 2KQSA 4LJOB 4RM9A 4W9HA 4IG7B 2PE9A 4W9FA 3W1YA 2KOXA 2C7NB 2CHXA 3OLMD 4A3OA 3ZNGC 2ZNVB 3V60A 3NOBA 1R4MI 3QJZA 3T8MA 5LXIB 1E7UA 2K8HA 2DYMA 4HWIB 2NBWB 3LMNA 4WJNA 1WR1A 2N9XA 4MGIE 2FCNA 3UGBB 3N30A 4PYZA 4WJOA 3RYTA 4GIVA 1J0GA 4MSQB 2KJ6A 1XD3B 2KMAA 5FR6A 2D10A 1MG8A 3HM6X 2UYZB 1TZ1A 4KZ0A 2KWCA 1WJ4A 5AZHA 4NAWB 4BOSC 3ZRFA 1UGMA 3H9DA 3VVWB 3VXWA 4B95A 4HPLB 2KFKA 3TBLD 3VUWA 5HKHA 3UQBA 4W9EA 1GC7A 2MBOA 1EF1A 1UD7A 2JZZA 3ML8A 1C3TA 4N9F4 4MM3A 2J7QB 5D7GA 2WWZA 2ZNVC 5KHQA 1E8WA 1E5WA 5AZFA 4DDGD 2L3ZA 2LGXA 2QHOA 4IUMB 2K1FA 2D2QA 3EFUA 3DVNV 1V9JA 2M17A 3QHTA 4IWQA 5DPSA 4HJKA 1XQQA 3KYCD 4HVBA 4NQLB 2LXAA 3ZLZA 2HE7A 4HXDA 4DHZE 4EFOA 4P7IA 5KHOA 4ZRJA 1V6EA 3H7PB 3PLUA 3NY5A 2LJ5A 4BKGA 4DBGA 3I3TB 3DCGA 5CHFA 1V81A 1RRBA 1YQBA 2KFKB 4II2B 2DENB 1QZEA 3X23A 4E71A 1KLVA 1OTRB 3WANA 5EDSA 1D3ZA 2KTRA 5C23A 2FUHB 5CHWA 4TKNA 3KUZA 3P2BA 4IC7B 2FNJB 4A3PA 1WX7A 3M62B 1I42A 2GBNA 3OJ3A 2AYOB 4BBNF 5E6OA 4IWOA 2JF5A 2ASQA 4WWOA 2AWTA 2LGDA 2RGFA 2MWSB 2N7DA 4MH0E 4W9IA 2GBMA 3VHTC 3HHMA 1S1QB 2A5UA 1SGHA 4KDIC 3RULA 1WX8A 2C9WB 4LCDE 4EKUA 2CHWA 3L13A 2BKRB 1KOTA 2GMIC 2HD5B 2YVCA 3A1QB 2VRRB 3MHSD 1Q5WB 4PS7A 1WJ6A 5AEKB 4FULA 4AWJA 1FXTB 2W9NA 2KTRB 4WJQA 4BKSA 4NJ7A 4RMAA 2IYDB 2KANA 3A9JB 2XK5B 4B9KA 2ZEQA 1H8CA 4DHJD 1LXDA 1WY8A 4AP4C 3ZTDA 2KDBA 2LGYA 5CX3A 2KX0A 4W9LA 4WWNA 5G2NA 4M8MA 3L0WB 2KDIA 3L08A 1LM8B 5JH5C 1E8XA 1WGGA 2BPSA 1EO6A 2NS5A 3A4RA 2GBRA 4II3B 2BWES 1LQBA 3RZFA 1WX9A 2Y5BB 2DYBA 4BKTA 2JWZA 2WX0A 3DDCB 2JT4B 3NS8A 3UF8A 3TMPB 3ZRCA 2AEHA 2IO0B 3PPAA 2G4DB 3TCAA 2N9PC 4ANXA
chains in the Genus database with same CATH superfamily
2LI5A 1V1OA 3ZJUA 5L95C 2R2QA 5DCNA 1QQRA 2BYVE 4AJWA 2JRHA 4MJSA 4US9A 4LNKA 1ZXIA 5TSSA 2B3AA 1I7HA 3PRZA 4DWFA 2KQ4X 1SXTA 3TJPA 3IXSA 1L4DB 4J3OD 3RZWC 4KX6B 2NPTB 4YL8A 3KUDB 4TUUA 5HG2A 3R2IA 2KWUB 1OGWA 3N9YC 4F1SA 4XGAB 4AQ7A 1JWUD 4CQNA 3VTUA 2DAJA 3FC4A 2N0SB 1EUVB 2LD9A 1R7SA 1VJKA 2HTME 2WDTB 3FILA 2KTFA 1GJZA 1FD6A 4EUTA 1I4GA 2E6XA 3RNCC 1WGHA 1GC6A 3WAOA 1NBFC 2PMVA 1NVID 4EZJA 3ZYYX 3DHGC 4HPMB 1WMHB 2M4NA 2KXJA 3LJ3A 2DZMA 2KLCA 2XK5A 2M56B 2C60A 2WHIA 1WJUA 1CJEA 4EZLA 1JROA 1UF0A 1FRDA 2XNAC 1S3SG 2WX1A 3R66C 2XEWA 2GBJA 3A9KB 4GGQA 2WU5B 5L83A 4BVUC 4FHKA 2QILA 5BYSA 3KLSX 4D2KA 2RPQA 3Q2AC 1KLUD 4FHJA 2O6VA 2WXKA 4HDQA 3PTFC 1TT5B 2JYEA 2EKIA 2L00B 2PVOD 3WAMA 3NRZA 1AW7A 1WE7A 2MJEA 4K7WA 2Y5PA 3SEBA 3SDLC 1VZ6A 4GU2A 2N4FA 1N62A 4KKJA 2OOBB 3APFA 3Q8FA 1VD2A 1WGDA 2JX5A 1J7AA 3QIJA 3Q8EA 3B2FA 2NVUI 4ANVA 2G3QB 5JHAA 2KKCA 4JX1C 2C7MB 2JVCA 1I4QA 1H4RA 2O2VA 4W9CA 2BYEA 2JUOA 3AH7A 4GSWA 4PK1A 3H8HA 2ONQA 2N7EA 2KJRA 1FMAD 1PGXA 4WAFA 2KO3A 1JW9D 3CSFA 1Q0WB 1HZ5A 2G1EA 1JRPA 4GDKB 4HROA 5E6PA 2N9KA 2RD0A 2ZW1A 2KDMA 4JIOU 3R7QA 4JL9A 2D07B 2RDHA 2WXNA 2JXXA 2BYTA 4MT5A 2D11A 1R4NB 2YLMA 1ESFA 2L1AA 2J0JA 3PHWB 3P63A 4JQWC 5BO4B 4DHJB 3U2SC 1A70A 1L6UA 2B76B 3ALBA 3JVZX 3ZUNA 3QQ8B 3KWVA 2JYTA 1T3QA 1SIFA 2ZVNA 3NVZA 3HM3A 2BS2B 3IT4B 2KVZA 1V86A 3TUOA 3W1SA 3WA0A 4ANWA 4GB9A 1N6ZA 1FM0D 2WGSA 2CKHB 3NVVA 2ACZB 1M94A 2G4SA 1UBQA 2K39A 2ZW0A 4YSXB 4J6IA 4KGRA 4S17A 4WQMA 4HDOA 3NJTA 2D3BA 4RGOS 1XO3A 5IA7A 1KM7A 4ZRIA 3H1UA 4MM3B 1V5TA 1WFYA 5TR5A 3UIOB 3PZ7A 1NEKB 1FXAA 2BTEA 2PPHA 2V4LA 4WQOB 2WP9B 5C1ZA 2J53A 1R4NI 4A6QA 2GB1A 3K9PB 4BBNC 5E6JA 1NYRA 3BY4B 1E8YA 1JQ4A 3SU8X 3Q6BA 3DWMA 1TJEA 3VH4B 1L0YB 3AE7B 2CS4A 3QK0A 4LDTD 1HE8A 4K3CA 4ICVA 4PS8A 5GMVA 1ZXHA 2DBYA 2FCQA 5IAAC 4FA6A 1LFDA 2EELA 4FJZA 2PE6B 1W6VA 4MACA 4FLHA 3CMMB 3DQVA 1SE2A 1SE3A 3PO0A 3OAWA 1ZKHA 3L16A 1BT0A 1P7FA 2D3GA 3CF6E 2K3UA 2HTHA 2W3RA 2WXGA 4M0WB 2KQSA 4LJOB 3BIID 4IG7B 4W9HA 2KOXA 2C7NB 3OLMD 4HWIB 5FR3A 5EE9A 2N9XA 1HXYD 3IAM1 4PYZA 4GIVA 3ZXRA 2WNMA 4XWTA 3J9CA 2KJ6A 3B2GA 5FR6A 2UYZB 1TZ1A 2I2YA 4NZLB 1SBBB 3T3OA 1UGMA 1KLGD 3VUWA 4W9EA 3EUB2 1YJIA 1EF1A 4OZCA 4N9F4 5AZFA 4M02A 1QF6A 2LGXA 3AEDB 3HVZA 2PVGC 2M17A 4DQOC 4HJKA 4REZA 1ZPSA 4HXDA 4DHZE 2L32A 2V4IB 1MHHE 5KHOA 3AE9B 4DBGA 3NY5A 2LJ5A 1TY0A 1V81A 1RRBA 1KLVA 2L83A 2CJOA 5EDSA 1FFUA 1BUIC 1PDXA 5CHWA 1UNSA 2HJ1A 3KUZA 4IC7B 5FK9C 1I42A 2AYOB 3Q8AA 2KYWA 1WGKA 1QLBB 2GBMA 2FBWB 2IGHA 4IOIE 4JWSC 4XDCA 1ENFA 1Q5WB 4PS7A 1YN3A 4BAXA 5AEKB 4AWJA 1F2RI 5C2TB 5FKAC 2XK5B 2LGYA 4N6EB 1XLNA 2KX0A 4W9LA 5CX3A 3AE2B 3ZGZA 4YT0B 3UI3A 3HVDA 5JH5C 1WGGA 3Q69A 1ROEA 2BPSA 1HTQA 2NS5A 3GE8C 2GBRA 1XLQA 2WX0A 3DDCB 1PFDA 1K51A 3DWGC 3TMPB 2AEHA 2H88B 3BK1A 1TKGA 4K7SA 1P9DU 1SJED 3EECA 3ZIMA 2O6VB 3OG5A 3VFKA 3DOWA 4ANUA 3DBHB 5G55A 2KDEB 2MA9B 2KWVB 1FFVA 3AXCA 2L0FA 1C76A 2MLBA 2SAKA 3ENEA 1NENB 1L5PA 4USAA 2IPKD 4DDID 2RDGA 3AULA 4AOFA 4GMVA 1ZW7A 2KLGA 4E3CA 1D5XC 2WQYB 4CO7A 2N1WA 5JHBA 5JZEB 4K7UA 4GN1A 5GXGB 2KFJA 1TYGB 3S2AA 3IAS1 1UWXA 2WXMA 2I1KA 3C0RB 4FJVB 4ZHPA 4C00A 1P1AA 1ZDXA 4NJ6A 4I6LB 2I1JA 1ZDVA 4CHKA 1I4RA 3ZO5B 1IGCA 4DXAB 1F0ZA 3AU4A 2DYOA 2LZ6A 1V97A 1GG3A 2VZKD 1UZXB 4FADA 3L10B 2EMSA 4ICUA 1ZGUB 2NBUA 2PIAA 4MGKE 3DBHI 1KRHA 5H92C 4HKZE 2NCNA 2HJ8A 3IHPC 4BKSD 4IM3A 4MH8A 2Q5WD 3P4QB 1UELA 5J18A 1VCBA 3W9CB 2KK8A 2MHJA 2INCC 3W5UB 1WGYA 1FPYA 2DZIA 2LXCA 5EE1A 3P42A 1OQYA 4GDLA 2D3AA 3V6CB 1WF9A 1AARA 1DYQA 4NY0A 4XE0A 2LEKA 3T3NA 3RD2A 2W55A 4Q2JA 2KJHB 4LLGM 1YOVB 4ZYSA 4EOYA 1YJ1A 2IO2B 4JWUC 1Q1OA 4H2AA 3M3JA 3QAQA 2IJ0A 3N20C 3NHEB 1YIWA 3WAPA 1OEYJ 2V1YA 1MFWA 4PT5A 3BZDB 2QIEB 4ZRPA 2QSDA 1I35A 2OJRA 1I4PA 2LVPA 4XDDA 4A20A 1A5RA 1WZ3A 4MELA 2WXIA 2MBQA 3HIZA 1IUEA 2ZPYA 5LXHA 2J0MA 1WI0A 1ISNA 1FCLA 1PQSA 1GPXA 3I5JC 4E74A 1WH3A 3QWZB 1J8CA 2QJLA 5DPTA 1C78A 3NG0A 2MRPA 1IPGA 1T0QC 2WXRA 2L05A 2KN5A 1NI3A 3QX1A 5I4DA 3R7RA 4EZKA 2MJDA 3QCAA 3TIXA 5J17A 2LASA 4FJYA 2WDRB 2JRIB 1CQVA 2E3TA 1K8RB 1M4VA 1WIAA 1HA5A 1TY2A 1F9JA 3QA8A 3IBEA 3MP9A 3X0WA 1AN8A 1F1HA 1GNUA 4FBJB 3SFEB 1V5OA 4JPSA 4IWPA 2KHWB 4URKA 3NZ3A 4AJYB 3B1LX 1ZP0B 3UQAA 1KTKA 1D6EC 1ET6A 4R3DA 3SD5A 3M95A 2INPE 3VRBB 2CJNA 4B6WA 3PS6A 3VUYA 3DBSA 4ZHOA 3RNBC 2YEPB 3RPFC 3BYYB 1K52A 2FAZA 2DNFA 2FIDA 3DVGX 1JMLA 2BS4B 5E6NA 2AX5A 4FN2A 2MP2B 1SE9A 1KH0A 2ZCCA 3ZNZB 1E8ZA 4AUQC 3ONSA 3M63B 1UUPA 2K8CA 1PGAA 3BINA 4X57B 3WIMA 4GOCA 1RFKA 2IO3B 2MQJA 3EGRA 3SHQA 3ETRA 4MSMB 3IG3A 4RM8A 1JWMD 1VRAB 2MBEA 3KQ4A 2J0KA 4WJPA 2GLSA 3AEBB 2INDC 1V2YA 4RF1A 4W9FA 3W1YA 2CHXA 3NOBA 3QJZA 1E7UA 4M00A 3ZQ4A 2DYMA 3LMNA 2FCNA 4HJGE 1IBXA 1Q10A 4WJOA 3RYTA 1PYWD 1J0GA 1T0SC 1MG8A 3HM6X 4KZ0A 2DWQA 5AZHA 4A55A 4NAWB 1K50A 4RNAA 4RGNA 3ZRFA 3H9DA 4B95A 4HPLB 1JCKB 5HKHA 2OJWA 2MBOA 1UD7A 2JZZA 3ML8A 3VRAB 1E8WA 1JWBD 4IUMB 2K1FA 2D2QA 3EFUA 4IWQA 3KYCD 4HVBA 2HE7A 3RI7C 1AWDA 1E6EB 3FAHA 2GI9A 4QAYA 4ZRJA 3I3TB 3RNAC 2KFKB 3X23A 3WANA 1DOIA 2KTRA 3PZ8A 5C23A 2FUHB 4TKNA 3RNGC 1BXTA 1WX7A 2GBNA 4BBNF 2JF5A 3HUIA 3EA6A 2I38A 2AWTA 2MWSB 4MH0E 3I57A 4W9IA 4US8A 4TMAB 4HEA1 1N5WA 1MVKA 1S1QB 1FNVA 2V3PA 4KDIC 1WX8A 2C9WB 4LCDE 1T6BX 4HRSA 2BKRB 1FO4A 3U52E 1I4HA 2KN4A 1IGDA 5IOIA 1K53A 1RYJA 4B0MA 4WJQA 4RMAA 4XWWA 4B9KA 4DHJD 4AP4C 3ZTDA 2WXQA 4LK0M 5D3DA 2M19A 5G2NA 2W54A 2JXTA 2KDIA 1LM8B 4L1BA 1XLOA 4II3B 1ET9A 2J52A 4HKQA 2JT4B 4O1NA 3NS8A 3UF8A 3ZRCA 3P1MA 1I4XA 2IO0B 3PPAA 1PGBA 2NBVB 3UINB 1V8CA 1J7BA 3LDZE 3LXFA 2MH7A 3L54A 2JQRB 4RGTA 4OW0A 4GDLB 2MCNB 3Q8BA 1L4ZB 2GRIA 1QILA 2C5LC 2KC2A 2VH2A 1MJDA 3URYA 3N32A 3NZSA 3IT6B 1P7EA 1WM2A 5T8IA 2A4ZA 3U30A 2IDYA 3CIRB 5BYQA 3MC0B 3TL5A 4OVZA 4RGMA 2LWPA 4C4VA 4EEWA 2WXJA 1SE4A 1F52A 1J19A 3LYYA 3VH3B 4C80A 3H7PA 1D5ZC 5AUIA 4DXGA 1WYWB 4MJSB 3PZDA 3RFZB 4HCPB 1NDDA 3O13A 3B0AA 4JGHB 1J7CA 1OQQA 1SSNA 4YSYB 2XBBC 1UH6A 3ZNID 1UBIA 3ZDTA 3TEXA 1GAQB 3AE6B 4PYUA 2DZJA 4HLEA 3NS1A 2SEBD 4A9AA 3UIPB 1HZ6A 1F2RC 3BVGA 1P0RA 3AN1A 4KSLC 2ZZPB 3BWUD 3AMZA 3VR9B 1YQ3B 3OJ4B 4TQ1A 1YMHE 2VH1A 2MBHA 3FILB 3EHVA 1G6JA 2PEAA 2N9EB 4TV3A 1V1PA 2WXFA 1C4AA 3ZKJC 2BWFA 1LGRA 2X38A 4OVVA 2BT6A 2IY1B 4GXBA 1WGRA 4LNOA 3P4SB 4MDKE 3ZW3A 2DHZA 2JSVX 3NZUA 1YX6B 1NI2A 2H89B 3JYUA 2AQ3B 4ARCA 3B08A 1EM7A 4OHJA 1VLBA 3NVYA 3KUCB 2LVOA 1EWCA 4WWPA 4C56C 1TZOA 4G0NB 4WURA 1BMLC 3L4PA 4GDKA 4M01A 4K1RB 5JXVA 4A90A 2MBBB 4ZDVA 3AE8B 3JSVA 2EKEC 4F7ZA 2ZVOA 2KVRA 2MJ3A 4KIKA 1MHXA 3JW0X 3E56A 3EC8A 2L0TA 1E7VA 1C4PA 1YN5A 5BMGA 1XXGA 3GZNB 3ZTCA 3A4SC 2Z0DB 1B9RA 1EF5A 2D5GA 1RAXA 3VR8B 2D3CA 4W9GA 1RLFA 4LJPB 3PREA 5D6JB 2KNBA 2O2VB 5D3IB 2QEJC 2UU7A 1XF5L 1N60A 2DLBA 4G3XB 1KJTA 1T0YA 3O65B 2JU6X 1YQ4B 4W9KA 1E0ZA 2J42A 2JPHA 1VDVA 3AM9A 3EFCA 3ZJTA 2OEDA 3H6NA 2BGFA 2WDQB 4BOZB 2WDVB 3MTNB 2MSED 3ZDMC 2WXOA 3MC8A 3CSTA 1WXAA 1WE6A 3VUXA 2LRWA 1L0VB 1V49A 1GOZA 2K9XA 3W2DA 4CYEA 2K5PA 3Q3FA 2PKOA 2Y3AA 3Q3NC 3Q8CA 3P4PB 2Z8LA 4A8XC 3DBRI 1GUAB 2QCZA 4XC2A 2INNE 2CHZA 2KT7A 3IVFA 4MGZE 2KACA 2O6VD 3GZNI 3DPDA 1WXQA 4NPNA 1VR9A 5IN7A 1IP9A 2DZKA 3RUIB 1L7YA 1CMXB 4W9DA 1AYFA 3APDA 2JY6A 4RF0A 2RR9A 2K6QA 3GP7A 3C8YA 4IW0A 2BYFA 1XCTL 3RCZA 3VAWA 1YN4A 4JLCA 3Q3JA 4EE2A 3GOEA 1IYFA 2NR2A 3W1SC 5CTRC 2PJHA 1TS4A 4DHZB 2L7RA 2J4XA 1L2NA 4P1CC 2KMCA 2K8BA 4K81A 2G9HD 2AQ2B 3RT3B 2EMTA 1SF0A 1MPEA 4L23A 1L0XB 2IBIB 3R2TA 1WRDB 3AE5B 5C3JB 2V9HA 2WLBA 3PRPB 2K6DB 3MHZA 1P3QU 2K0PA 1OFFA 4WAAA 3NUHB 4UDUC 4P6VF 1Z5SB 3KH0A 3RNFC 4RM9A 2PE9A 4N58A 1OQRA 2ZNVB 3V60A 4NJCA 5LXIB 2K8HA 3OWEB 2OHFA 2N9LA 3AEGB 5LNK1 1L6VA 4MSQB 3C19A 4DXFA 2KWCA 5HFYA 1WJ4A 4ITKA 1N63A 1UWMA 4KKIA 2BB6A 3VXWA 2M0AA 1JWSD 1VZ8A 3TBLD 3UQBA 3ABVB 3FKYA 1FEHA 2WWZA 2ZNVC 3P4RB 1TS5A 3U7ZA 4AS1A 4B0EA 3DVNV 4P1BC 4C4VB 1YNTE 1V9JA 3QHTA 5DPSA 3NVWA 4NQLB 1E7PB 5EE0A 3ZLZA 4EFOA 3E9SA 1C79A 4P7IA 3H7PB 4NAMA 4BKGA 2KWDA 3HRDD 4II2B 1QZEA 1EU4A 5BMHA 1D3ZA 3BVZA 5AUKA 2LFIA 3P2BA 4IKGA 3DBLB 2FNJB 4A3PA 3M62B 1C4CA 5H8YE 4HPPA 4IWOA 2IGGA 3WCQA 2AQ1B 4P16A 2LGDA 2R61A 3I9V1 3MFGA 2LJIA 1T5XD 3VHTC 2L52A 2A5UA 4LNFA 4EKUA 3V3XA 2HD5B 3W5VB 3MHSD 1WJ6A 3AB5A 4FULA 2W9NA 4LNNA 2YEPF 2X8XX 4BKSA 4NJ7A 2KANA 1XLPA 1H8CA 1WY8A 2KDBA 3N1ZC 3DHIC 1LO5D 3L0WB 3MC9A 3L08A 1E8XA 1EO6A 5EE3A 4ZRQA 3GB1A 2PTLA 1LQBA 3RZFA 2V3NA 4BKTA 4WIPA 1V1PB 1CK1A 2G4DB 3N1YC 1Y56A 1XEEA 2IGDA 3GE3C 2BVCA 5HHDG 2KX3A 4I6PA 3PLVA 3RN9C 3AU5A 3MJWA 3U8ZA 4ZOHC 1N61A 2L76A 1WWTA 1RFAA 3DBLI 1E10A 4HCNB 1WYGA 3AE1B 2BKFA 2DAFA 2MX2A 1XT9B 4XZ4A 1N5XA 4XX5A 2ZJDA 1C9FA 1QOAA 3R3MA 3DVNU 2CU1A 1FNUA 3HK0A 1X1MA 1ACCA 3MJ5A 4S0RA 4KZCA 3JSVB 2ZPNA 1TIFA 1WRIA 1DGJA 4KIKB 2ZCBA 4IM0A 1EWYC 2FCSA 5D2MB 4LDTB 3ZVVA 3B9JA 2LRUA 3PHXB 2RPVA 3DVGY 1WXSA 5IKCM 2MEKA 1E90A 1F77A 4PS3A 1VZ7A 4MEMA 2JZPA 4L2YA 2KMMA 3PT2B 3AI5A 3Q3OC 3GS2A 4TQ0A 3A1QA 2UWQA 1D4BA 1SIJA 1ZOYB 3V6EB 4YTPB 1WSPA 3A9JA 3ML9A 2ICIA 1TGZB 4C7YA 2IY0B 3PV1A 3RMKC 4W9JA 1JWAD 2RSUA 3ZJVA 3IFWB 3PVLA 1MG4A 2FIFA 2C7HA 1XCQL 1D5MC 4ASWC 1JRUA 2DX5B 3I63C 1UGJA 4RH6A 1EU3A 1ZE3D 1RWSA 1C77A 4IDIA 2IZVB 1TKYA 1Y8RC 1YD8U 3AV8A 2NPTA 1SJHD 2M8SA 2KDFB 3ZXVA 2AL6A 2CR5A 1TS2A 2TSSA 4IM2A 2KC1A 2W3SA 2KQ7A 3ZNHB 4KSKC 2FUG1 5AZGA 3AEFB 1QKZA 1U4AA 1NYQA 4RFBA 1TBEA 2GBKA 2K22A 3PSEB 3R8BA 3BYTB 4DK5A 5DPRA 4C7ZA 2WXLA 1WZ0A 3KWLA 3VTWA 3H7SA 4ZRKA 4YTNB 3V61A 2K25A 4NNJB 2QDFA 1MI0A 1FCCC 2JWUA 1WMHA 2BBCA 5HI1A 4JE3B 4KV2A 1PUTA 3TSSA 4I6NB 2L8JA 5G5GA 2V0GA 2KZRA 4LTUA 4OZBA 4F8CB 4XYCA 1KF6B 4BFRA 1T0RC 3D32A 3VQIA 3LB8C 3A9KA 3ECIA 2BF8B 3QC8B 1YJJA 1YX5B 1WJNA 1QOBA 3AE3B 2Z0EB 3APCA 4LNIA 3PGEA 2KD0A 3U7DA 1OEYA 2Y5CA 4YWGG 3Q3MC 1QOFA 3N1XC 3A33B 2FE8A 3QARA 2PLPA 1FNWA 4KVGB 4KGTA 5D94A 2MP2A 3N3KB 5LLIA 2G45B 1DOXA 4TSSA 4NQKE 2IO1B 3VDZA 2RDBC 3AEEB 2FCMA 1R4MB 4KGSA 3KW5B 2Z59B 2WXPA 4G11A 2ON8A 3WALA 1WM3A 1E9MA 1V80A 2LUEA 2MW5A 3SR6A 5DPWA 4YXDB 4FXCA 1TTNA 1WXVA 2N1VA 4M8NA 2KAJA 3AE4B 1FXIA 1WXMA 3T9LA 2LVQA 1C1YB 5CHVC 2R2OA 1Z2MA 3KYDD 2LGSA 4KDLB 1HEZE 2V3SA 2AL3A 2M0XA 2HDEA 4OZAA 3K9OB 5MPOA 2N7JA 2RMMA 3AEAB 1P98A 1KFYB 3DBRB 3VTVA 2VZKB 3V62A 3AECB 1WR6E 4YTMB 4G50A 2WYQA 2JZ3B 4NAWA 2M1MA 1CZPA 3L17A 4MGYE 2GOWA 4OVUA 5BMIA 1TKEA 2QC8A 3KVFB 4ZYNA 2REXA 5J2RA 3PRMB 1QOGA 4HK2A 1STEA 4A3OA 1HTOA 2NTSA 3ZNGC 1SB3C 1R4MI 2NMQA 3T8MA 2NBWB 4WJNA 5IP4D 2PW9A 1WR1A 4MGIE 4YSZB 3UGBB 3DHHC 3N30A 2NTTA 4K3BA 2LGIA 1XD3B 2KMAA 2D10A 2WS3B 4BOSC 2LHEA 4RCOA 1HQRD 3VVWB 5G5HA 2KFKA 1GC7A 1JALA 1C3TA 4MM3A 2J7QB 2BS3B 5D7GA 5KHQA 3SFDB 1E5WA 4ARIA 4DDGD 2L3ZA 1GB4A 2QHOA 2BB5A 1IBXB 4BZAA 1FIQA 2XN9C 4N59A 2WXHA 1XQQA 2LXAA 3V05A 1QT9A 1FRRA 1GB1A 4ACFA 4GLSC 1V6EA 2CU3A 1ZUD2 3PLUA 3DCGA 5CHFA 1YQBA 4E71A 2DENB 3BVMA 1OTRB 1SEBD 3TEWA 2LUMA 4WH4A 3OJ3A 5E6OA 2ASQA 3RNEC 4WWOA 1B1ZA 2RGFA 3TEZA 2N7DA 3Q14C 5BYRA 1DOYA 2W82A 3HHMA 2WU2B 1SGHA 5IO9A 3RULA 3U4EG 2CHWA 2BQQA 3L13A 1KOTA 2GMIC 2YVCA 3A1QB 2VRRB 3TEYA 1FXTB 2KTRB 4M0WA 1RM6C 2LMCA 2IYDB 3A9JB 2ZEQA 1LXDA 2BW2A 2QMTA 4WWNA 4M8MA 1TS3A 2LHDA 4WWMA 3A4RA 3BK2A 2BWES 1WX9A 2Y5BB 2DYBA 2JWZA 4ANXA 3TCAA 2N9PC 3CWIA
chains in the Genus database with same CATH topology
2LI5A 2NBVB 5L95C 4K7SA 3UINB 1P9DU 2R2QA 3EECA 3ZIMA 5DCNA 3LDZE 3L54A 2O6VB 2KX3A 4I6PA 3PLVA 3VFKA 4GDLB 2MCNB 2BYVE 2C5LC 2JRHA 2KC2A 3DOWA 4MJSA 3AU5A 4AJWA 4ANUA 3MJWA 5G55A 3U8ZA 2B3AA 2KDEB 3N32A 3NZSA 2MA9B 3PRZA 2KWVB 4DWFA 2L76A 3AXCA 2L0FA 3TJPA 1WM2A 1RFAA 2A4ZA 3DBLI 4HCNB 3U30A 2MLBA 2BKFA 2DAFA 2MX2A 1XT9B 3ENEA 4XZ4A 3RZWC 4XX5A 2ZJDA 3TL5A 2NPTB 4YL8A 3KUDB 4TUUA 2LWPA 4EEWA 3R3MA 4DDID 3DVNU 2CU1A 2KWUB 3HK0A 1OGWA 4F1SA 1J19A 3AULA 1X1MA 4AOFA 4GMVA 3VH3B 1ZW7A 4KZCA 2KLGA 4E3CA 3JSVB 3H7PA 3VTUA 2ZPNA 4CO7A 2N1WA 5JHBA 5JZEB 2DAJA 4K7UA 4GN1A 1EUVB 2LD9A 1WYWB 4KIKB 4MJSB 3PZDA 2ZCBA 4HCPB 4IM0A 1NDDA 4JGHB 3B0AA 2KFJA 2FCSA 5D2MB 3S2AA 4LDTB 2I1KA 2WDTB 3C0RB 4FJVB 2XBBC 3ZVVA 2LRUA 1P1AA 2KTFA 1GJZA 4NJ6A 1UH6A 2I1JA 3PHXB 3DVGY 4I6LB 1WXSA 4EUTA 1E90A 3ZNID 4PS3A 1WGHA 1UBIA 3ZDTA 3ZO5B 4CHKA 4DXAB 1GC6A 4MEMA 4PYUA 3WAOA 3AU4A 1NBFC 2DYOA 4EZJA 2DZJA 4HLEA 3PT2B 2LZ6A 3AI5A 3UIPB 1GG3A 4TQ0A 3A1QA 4HPMB 2UWQA 1UZXB 1P0RA 1WMHB 4KSLC 2M4NA 2ZZPB 2KXJA 4FADA 3L10B 3LJ3A 2DZMA 2EMSA 1ZGUB 2NBUA 4ICUA 3V6EB 2KLCA 3A9JA 2XK5A 3ML9A 2C60A 3OJ4B 3DBHI 4MGKE 4TQ1A 1TGZB 1WJUA 2MBHA 2IY0B 3PV1A 4EZLA 2NCNA 1S3SG 2WX1A 3EHVA 2HJ8A 3IHPC 2PEAA 4BKSD 1G6JA 4IM3A 4W9JA 2N9EB 3R66C 2RSUA 4TV3A 2XEWA 2GBJA 3A9KB 4GGQA 3IFWB 3PVLA 1UELA 3ZKJC 2BWFA 4BVUC 4FHKA 5J18A 5L83A 1VCBA 2FIFA 4OVVA 2C7HA 2KK8A 2IY1B 4GXBA 1WGRA 4ASWC 2RPQA 1WGYA 1JRUA 2DX5B 2DZIA 4FHJA 2LXCA 2O6VA 4HDQA 3PTFC 4MDKE 3ZW3A 1OQYA 2DHZA 2L00B 4GDLA 3NZUA 1YX6B 1NI2A 3V6CB 3WAMA 1WF9A 1AARA 1WE7A 4NY0A 4K7WA 3RD2A 3JYUA 3SDLC 4GU2A 2IZVB 2N4FA 3B08A 2KJHB 1Y8RC 3KUCB 1YD8U 2OOBB 2NPTA 1YJ1A 3APFA 4EOYA 2IO2B 2LVOA 1VD2A 1Q1OA 4WWPA 2M8SA 2KDFB 4G0NB 1WGDA 2AL6A 3M3JA 3QIJA 3NHEB 3QAQA 4GDKA 2CR5A 4K1RB 1YIWA 3WAPA 2NVUI 4ANVA 2G3QB 5JHAA 2MBBB 4ZDVA 2KKCA 1OEYJ 3JSVA 2EKEC 2V1YA 4IM2A 2C7MB 4F7ZA 2JVCA 2KC1A 2ZVOA 2KQ7A 1H4RA 2KVRA 2O2VA 4W9CA 3ZNHB 2BYEA 2JUOA 4KSKC 4GSWA 4KIKA 5AZGA 1I35A 2N7EA 2OJRA 1U4AA 3JW0X 1TBEA 2LVPA 3EC8A 2L0TA 1E7VA 4A20A 2KJRA 1A5RA 1WZ3A 2GBKA 3PSEB 4MELA 2MBQA 3HIZA 2KO3A 2ZPYA 3ZTCA 5LXHA 2J0MA 4DK5A 3CSFA 5DPRA 3A4SC 1WI0A 1WZ0A 1ISNA 2Z0DB 1Q0WB 1PQSA 3VTWA 1EF5A 4E74A 1WH3A 3H7SA 1RAXA 4GDKB 3QWZB 4ZRKA 5E6PA 1J8CA 4W9GA 1RLFA 2RD0A 4JIOU 4LJPB 5DPTA 3V61A 3PREA 2K25A 5D6JB 2KNBA 4NNJB 2MRPA 2O2VB 3R7QA 1IPGA 2D07B 4JL9A 2JXXA 1WMHA 2D11A 4KV2A 2L05A 2YLMA 4I6NB 2L8JA 2J0JA 3PHWB 2KN5A 4G3XB 1KJTA 1T0YA 2KZRA 3O65B 3QX1A 4F8CB 4JQWC 5BO4B 4W9KA 4DHJB 3R7RA 2JPHA 4BFRA 4EZKA 3ALBA 3D32A 3JVZX 3QCAA 3ZUNA 3H6NA 3VQIA 3QQ8B 3TIXA 5J17A 2BGFA 2LASA 3A9KA 3ECIA 1SIFA 2ZVNA 4BOZB 3MTNB 4FJYA 2BF8B 3HM3A 2MSED 3QC8B 1YX5B 1WJNA 1V86A 2JRIB 3ZDMC 3CSTA 1WXAA 1WE6A 1K8RB 3VUXA 3W1SA 4GB9A 3WA0A 2LRWA 4ANWA 2Z0EB 3APCA 3PGEA 2KD0A 1V49A 3U7DA 1OEYA 1WIAA 4CYEA 3Q3FA 2CKHB 1F9JA 1M94A 3QA8A 3IBEA 2G4SA 3X0WA 1UBQA 3DBRI 1GUAB 2K39A 1GNUA 4FBJB 4XC2A 3A33B 2CHZA 4J6IA 3QARA 1V5OA 3IVFA 4MGZE 2O6VD 4HDOA 4KVGB 4IWPA 2KHWB 4URKA 5D94A 2MP2A 3GZNI 3N3KB 3DPDA 5LLIA 2G45B 4AJYB 3B1LX 3UQAA 4NPNA 4NQKE 2IO1B 3VDZA 5IA7A 1IP9A 1KM7A 2DZKA 3SD5A 4ZRIA 3RUIB 3M95A 1L7YA 3H1UA 1CMXB 4B6WA 2FCMA 3PS6A 3VUYA 1V5TA 1WFYA 4W9DA 3DBSA 5TR5A 3UIOB 3APDA 2JY6A 3KW5B 2PPHA 2RR9A 2Z59B 2K6QA 2V4LA 4WQOB 2FAZA 4G11A 3WALA 1WM3A 4IW0A 2BYFA 2FIDA 5C1ZA 3DVGX 1R4NI 1V80A 3K9PB 4BBNC 2LUEA 3RCZA 2MW5A 5DPWA 5E6NA 1TTNA 1WXVA 2N1VA 3VAWA 4FN2A 4M8NA 3BY4B 2MP2B 1SE9A 1E8YA 4JLCA 3SU8X 1WXMA 3Q3JA 3T9LA 2ZCCA 2LVQA 3ZNZB 1C1YB 3VH4B 3GOEA 5CHVC 2R2OA 1Z2MA 2CS4A 1E8ZA 1IYFA 4AUQC 3QK0A 3ONSA 2NR2A 3KYDD 1HE8A 4LDTD 4KDLB 3W1SC 5CTRC 4ICVA 2PJHA 2V3SA 4DHZB 2L7RA 4PS8A 2AL3A 5GMVA 2M0XA 3K9OB 1L2NA 3M63B 2KMCA 2K8BA 4K81A 2K8CA 3RT3B 1P98A 2EMTA 2FCQA 1LFDA 5IAAC 3VTVA 4FA6A 3BINA 2IBIB 4X57B 3V62A 4FJZA 2PE6B 1W6VA 3WIMA 4GOCA 1WRDB 2IO3B 4FLHA 2MQJA 3CMMB 3DQVA 3SHQA 1WR6E 3OAWA 4MSMB 3PRPB 2K6DB 3IG3A 4RM8A 4G50A 1P3QU 2WYQA 1ZKHA 3L16A 1BT0A 2JZ3B 4NAWA 2MBEA 2D3GA 2M1MA 3CF6E 3L17A 2J0KA 2HTHA 4WAAA 4MGYE 4WJPA 2GOWA 4OVUA 3KVFB 1Z5SB 3KH0A 4ZYNA 2REXA 5J2RA 3PRMB 4M0WB 4HK2A 1V2YA 2KQSA 4LJOB 4RM9A 4W9HA 4IG7B 2PE9A 4W9FA 3W1YA 2KOXA 2C7NB 2CHXA 3OLMD 4A3OA 3ZNGC 2ZNVB 3V60A 3NOBA 1R4MI 3QJZA 3T8MA 5LXIB 1E7UA 2K8HA 2DYMA 4HWIB 2NBWB 3LMNA 4WJNA 1WR1A 2N9XA 4MGIE 2FCNA 3UGBB 3N30A 4PYZA 4WJOA 3RYTA 4GIVA 1J0GA 4MSQB 2KJ6A 1XD3B 2KMAA 5FR6A 2D10A 1MG8A 3HM6X 2UYZB 1TZ1A 4KZ0A 2KWCA 1WJ4A 5AZHA 4NAWB 4BOSC 3ZRFA 1UGMA 3H9DA 3VVWB 3VXWA 4B95A 4HPLB 2KFKA 3TBLD 3VUWA 5HKHA 3UQBA 4W9EA 1GC7A 2MBOA 1EF1A 1UD7A 2JZZA 3ML8A 1C3TA 4N9F4 4MM3A 2J7QB 5D7GA 2WWZA 2ZNVC 5KHQA 1E8WA 1E5WA 5AZFA 4DDGD 2L3ZA 2LGXA 2QHOA 4IUMB 2K1FA 2D2QA 3EFUA 3DVNV 1V9JA 2M17A 3QHTA 4IWQA 5DPSA 4HJKA 1XQQA 3KYCD 4HVBA 4NQLB 2LXAA 3ZLZA 2HE7A 4HXDA 4DHZE 4EFOA 4P7IA 5KHOA 4ZRJA 1V6EA 3H7PB 3PLUA 3NY5A 2LJ5A 4BKGA 4DBGA 3I3TB 3DCGA 5CHFA 1V81A 1RRBA 1YQBA 2KFKB 4II2B 2DENB 1QZEA 3X23A 4E71A 1KLVA 1OTRB 3WANA 5EDSA 1D3ZA 2KTRA 5C23A 2FUHB 5CHWA 4TKNA 3KUZA 3P2BA 4IC7B 2FNJB 4A3PA 1WX7A 3M62B 1I42A 2GBNA 3OJ3A 2AYOB 4BBNF 5E6OA 4IWOA 2JF5A 2ASQA 4WWOA 2AWTA 2LGDA 2RGFA 2MWSB 2N7DA 4MH0E 4W9IA 2GBMA 3VHTC 3HHMA 1S1QB 2A5UA 1SGHA 4KDIC 3RULA 1WX8A 2C9WB 4LCDE 4EKUA 2CHWA 3L13A 2BKRB 1KOTA 2GMIC 2HD5B 2YVCA 3A1QB 2VRRB 3MHSD 1Q5WB 4PS7A 1WJ6A 5AEKB 4FULA 4AWJA 1FXTB 2W9NA 2KTRB 4WJQA 4BKSA 4NJ7A 4RMAA 2IYDB 2KANA 3A9JB 2XK5B 4B9KA 2ZEQA 1H8CA 4DHJD 1LXDA 1WY8A 4AP4C 3ZTDA 2KDBA 2LGYA 5CX3A 2KX0A 4W9LA 4WWNA 5G2NA 4M8MA 3L0WB 2KDIA 3L08A 1LM8B 5JH5C 1E8XA 1WGGA 2BPSA 1EO6A 2NS5A 3A4RA 2GBRA 4II3B 2BWES 1LQBA 3RZFA 1WX9A 2Y5BB 2DYBA 4BKTA 2JWZA 2WX0A 3DDCB 2JT4B 3NS8A 3UF8A 3TMPB 3ZRCA 2AEHA 2IO0B 3PPAA 2G4DB 3TCAA 2N9PC 4ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LI5 A;  2NBV B;  5L95 C;  4K7S A;  3UIN B;  1P9D U;  2R2Q A;  3EEC A;  3ZIM A;  5DCN A;  3LDZ E;  3L54 A;  2O6V B;  2KX3 A;  4I6P A;  3PLV A;  3VFK A;  4GDL B;  2MCN B;  2BYV E;  2C5L C;  2JRH A;  2KC2 A;  3DOW A;  4MJS A;  3AU5 A;  4AJW A;  4ANU A;  3MJW A;  5G55 A;  3U8Z A;  2B3A A;  2KDE B;  3N32 A;  3NZS A;  2MA9 B;  3PRZ A;  2KWV B;  4DWF A;  2L76 A;  3AXC A;  2L0F A;  3TJP A;  1WM2 A;  1RFA A;  2A4Z A;  3DBL I;  4HCN B;  3U30 A;  2MLB A;  2BKF A;  2DAF A;  2MX2 A;  1XT9 B;  3ENE A;  4XZ4 A;  3RZW C;  4XX5 A;  2ZJD A;  3TL5 A;  2NPT B;  4YL8 A;  3KUD B;  4TUU A;  2LWP A;  4EEW A;  3R3M A;  4DDI D;  3DVN U;  2CU1 A;  2KWU B;  3HK0 A;  1OGW A;  4F1S A;  1J19 A;  3AUL A;  1X1M A;  4AOF A;  4GMV A;  3VH3 B;  1ZW7 A;  4KZC A;  2KLG A;  4E3C A;  3JSV B;  3H7P A;  3VTU A;  2ZPN A;  4CO7 A;  2N1W A;  5JHB A;  5JZE B;  2DAJ A;  4K7U A;  4GN1 A;  1EUV B;  2LD9 A;  1WYW B;  4KIK B;  4MJS B;  3PZD A;  2ZCB A;  4HCP B;  4IM0 A;  1NDD A;  4JGH B;  3B0A A;  2KFJ A;  2FCS A;  5D2M B;  3S2A A;  4LDT B;  2I1K A;  2WDT B;  3C0R B;  4FJV B;  2XBB C;  3ZVV A;  2LRU A;  1P1A A;  2KTF A;  1GJZ A;  4NJ6 A;  1UH6 A;  2I1J A;  3PHX B;  3DVG Y;  4I6L B;  1WXS A;  4EUT A;  1E90 A;  3ZNI D;  4PS3 A;  1WGH A;  1UBI A;  3ZDT A;  3ZO5 B;  4CHK A;  4DXA B;  1GC6 A;  4MEM A;  4PYU A;  3WAO A;  3AU4 A;  1NBF C;  2DYO A;  4EZJ A;  2DZJ A;  4HLE A;  3PT2 B;  2LZ6 A;  3AI5 A;  3UIP B;  1GG3 A;  4TQ0 A;  3A1Q A;  4HPM B;  2UWQ A;  1UZX B;  1P0R A;  1WMH B;  4KSL C;  2M4N A;  2ZZP B;  2KXJ A;  4FAD A;  3L10 B;  3LJ3 A;  2DZM A;  2EMS A;  1ZGU B;  2NBU A;  4ICU A;  3V6E B;  2KLC A;  3A9J A;  2XK5 A;  3ML9 A;  2C60 A;  3OJ4 B;  3DBH I;  4MGK E;  4TQ1 A;  1TGZ B;  1WJU A;  2MBH A;  2IY0 B;  3PV1 A;  4EZL A;  2NCN A;  1S3S G;  2WX1 A;  3EHV A;  2HJ8 A;  3IHP C;  2PEA A;  4BKS D;  1G6J A;  4IM3 A;  4W9J A;  2N9E B;  3R66 C;  2RSU A;  4TV3 A;  2XEW A;  2GBJ A;  3A9K B;  4GGQ A;  3IFW B;  3PVL A;  1UEL A;  3ZKJ C;  2BWF A;  4BVU C;  4FHK A;  5J18 A;  5L83 A;  1VCB A;  2FIF A;  4OVV A;  2C7H A;  2KK8 A;  2IY1 B;  4GXB A;  1WGR A;  4ASW C;  2RPQ A;  1WGY A;  1JRU A;  2DX5 B;  2DZI A;  4FHJ A;  2LXC A;  2O6V A;  4HDQ A;  3PTF C;  4MDK E;  3ZW3 A;  1OQY A;  2DHZ A;  2L00 B;  4GDL A;  3NZU A;  1YX6 B;  1NI2 A;  3V6C B;  3WAM A;  1WF9 A;  1AAR A;  1WE7 A;  4NY0 A;  4K7W A;  3RD2 A;  3JYU A;  3SDL C;  4GU2 A;  2IZV B;  2N4F A;  3B08 A;  2KJH B;  1Y8R C;  3KUC B;  1YD8 U;  2OOB B;  2NPT A;  1YJ1 A;  3APF A;  4EOY A;  2IO2 B;  2LVO A;  1VD2 A;  1Q1O A;  4WWP A;  2M8S A;  2KDF B;  4G0N B;  1WGD A;  2AL6 A;  3M3J A;  3QIJ A;  3NHE B;  3QAQ A;  4GDK A;  2CR5 A;  4K1R B;  1YIW A;  3WAP A;  2NVU I;  4ANV A;  2G3Q B;  5JHA A;  2MBB B;  4ZDV A;  2KKC A;  1OEY J;  3JSV A;  2EKE C;  2V1Y A;  4IM2 A;  2C7M B;  4F7Z A;  2JVC A;  2KC1 A;  2ZVO A;  2KQ7 A;  1H4R A;  2KVR A;  2O2V A;  4W9C A;  3ZNH B;  2BYE A;  2JUO A;  4KSK C;  4GSW A;  4KIK A;  5AZG A;  1I35 A;  2N7E A;  2OJR A;  1U4A A;  3JW0 X;  1TBE A;  2LVP A;  3EC8 A;  2L0T A;  1E7V A;  4A20 A;  2KJR A;  1A5R A;  1WZ3 A;  2GBK A;  3PSE B;  4MEL A;  2MBQ A;  3HIZ A;  2KO3 A;  2ZPY A;  3ZTC A;  5LXH A;  2J0M A;  4DK5 A;  3CSF A;  5DPR A;  3A4S C;  1WI0 A;  1WZ0 A;  1ISN A;  2Z0D B;  1Q0W B;  1PQS A;  3VTW A;  1EF5 A;  4E74 A;  1WH3 A;  3H7S A;  1RAX A;  4GDK B;  3QWZ B;  4ZRK A;  5E6P A;  1J8C A;  4W9G A;  1RLF A;  2RD0 A;  4JIO U;  4LJP B;  5DPT A;  3V61 A;  3PRE A;  2K25 A;  5D6J B;  2KNB A;  4NNJ B;  2MRP A;  2O2V B;  3R7Q A;  1IPG A;  2D07 B;  4JL9 A;  2JXX A;  1WMH A;  2D11 A;  4KV2 A;  2L05 A;  2YLM A;  4I6N B;  2L8J A;  2J0J A;  3PHW B;  2KN5 A;  4G3X B;  1KJT A;  1T0Y A;  2KZR A;  3O65 B;  3QX1 A;  4F8C B;  4JQW C;  5BO4 B;  4W9K A;  4DHJ B;  3R7R A;  2JPH A;  4BFR A;  4EZK A;  3ALB A;  3D32 A;  3JVZ X;  3QCA A;  3ZUN A;  3H6N A;  3VQI A;  3QQ8 B;  3TIX A;  5J17 A;  2BGF A;  2LAS A;  3A9K A;  3ECI A;  1SIF A;  2ZVN A;  4BOZ B;  3MTN B;  4FJY A;  2BF8 B;  3HM3 A;  2MSE D;  3QC8 B;  1YX5 B;  1WJN A;  1V86 A;  2JRI B;  3ZDM C;  3CST A;  1WXA A;  1WE6 A;  1K8R B;  3VUX A;  3W1S A;  4GB9 A;  3WA0 A;  2LRW A;  4ANW A;  2Z0E B;  3APC A;  3PGE A;  2KD0 A;  1V49 A;  3U7D A;  1OEY A;  1WIA A;  4CYE A;  3Q3F A;  2CKH B;  1F9J A;  1M94 A;  3QA8 A;  3IBE A;  2G4S A;  3X0W A;  1UBQ A;  3DBR I;  1GUA B;  2K39 A;  1GNU A;  4FBJ B;  4XC2 A;  3A33 B;  2CHZ A;  4J6I A;  3QAR A;  1V5O A;  3IVF A;  4MGZ E;  2O6V D;  4HDO A;  4KVG B;  4IWP A;  2KHW B;  4URK A;  5D94 A;  2MP2 A;  3GZN I;  3N3K B;  3DPD A;  5LLI A;  2G45 B;  4AJY B;  3B1L X;  3UQA A;  4NPN A;  4NQK E;  2IO1 B;  3VDZ A;  5IA7 A;  1IP9 A;  1KM7 A;  2DZK A;  3SD5 A;  4ZRI A;  3RUI B;  3M95 A;  1L7Y A;  3H1U A;  1CMX B;  4B6W A;  2FCM A;  3PS6 A;  3VUY A;  1V5T A;  1WFY A;  4W9D A;  3DBS A;  5TR5 A;  3UIO B;  3APD A;  2JY6 A;  3KW5 B;  2PPH A;  2RR9 A;  2Z59 B;  2K6Q A;  2V4L A;  4WQO B;  2FAZ A;  4G11 A;  3WAL A;  1WM3 A;  4IW0 A;  2BYF A;  2FID A;  5C1Z A;  3DVG X;  1R4N I;  1V80 A;  3K9P B;  4BBN C;  2LUE A;  3RCZ A;  2MW5 A;  5DPW A;  5E6N A;  1TTN A;  1WXV A;  2N1V A;  3VAW A;  4FN2 A;  4M8N A;  3BY4 B;  2MP2 B;  1SE9 A;  1E8Y A;  4JLC A;  3SU8 X;  1WXM A;  3Q3J A;  3T9L A;  2ZCC A;  2LVQ A;  3ZNZ B;  1C1Y B;  3VH4 B;  3GOE A;  5CHV C;  2R2O A;  1Z2M A;  2CS4 A;  1E8Z A;  1IYF A;  4AUQ C;  3QK0 A;  3ONS A;  2NR2 A;  3KYD D;  1HE8 A;  4LDT D;  4KDL B;  3W1S C;  5CTR C;  4ICV A;  2PJH A;  2V3S A;  4DHZ B;  2L7R A;  4PS8 A;  2AL3 A;  5GMV A;  2M0X A;  3K9O B;  1L2N A;  3M63 B;  2KMC A;  2K8B A;  4K81 A;  2K8C A;  3RT3 B;  1P98 A;  2EMT A;  2FCQ A;  1LFD A;  5IAA C;  3VTV A;  4FA6 A;  3BIN A;  2IBI B;  4X57 B;  3V62 A;  4FJZ A;  2PE6 B;  1W6V A;  3WIM A;  4GOC A;  1WRD B;  2IO3 B;  4FLH A;  2MQJ A;  3CMM B;  3DQV A;  3SHQ A;  1WR6 E;  3OAW A;  4MSM B;  3PRP B;  2K6D B;  3IG3 A;  4RM8 A;  4G50 A;  1P3Q U;  2WYQ A;  1ZKH A;  3L16 A;  1BT0 A;  2JZ3 B;  4NAW A;  2MBE A;  2D3G A;  2M1M A;  3CF6 E;  3L17 A;  2J0K A;  2HTH A;  4WAA A;  4MGY E;  4WJP A;  2GOW A;  4OVU A;  3KVF B;  1Z5S B;  3KH0 A;  4ZYN A;  2REX A;  5J2R A;  3PRM B;  4M0W B;  4HK2 A;  1V2Y A;  2KQS A;  4LJO B;  4RM9 A;  4W9H A;  4IG7 B;  2PE9 A;  4W9F A;  3W1Y A;  2KOX A;  2C7N B;  2CHX A;  3OLM D;  4A3O A;  3ZNG C;  2ZNV B;  3V60 A;  3NOB A;  1R4M I;  3QJZ A;  3T8M A;  5LXI B;  1E7U A;  2K8H A;  2DYM A;  4HWI B;  2NBW B;  3LMN A;  4WJN A;  1WR1 A;  2N9X A;  4MGI E;  2FCN A;  3UGB B;  3N30 A;  4PYZ A;  4WJO A;  3RYT A;  4GIV A;  1J0G A;  4MSQ B;  2KJ6 A;  1XD3 B;  2KMA A;  5FR6 A;  2D10 A;  1MG8 A;  3HM6 X;  2UYZ B;  1TZ1 A;  4KZ0 A;  2KWC A;  1WJ4 A;  5AZH A;  4NAW B;  4BOS C;  3ZRF A;  1UGM A;  3H9D A;  3VVW B;  3VXW A;  4B95 A;  4HPL B;  2KFK A;  3TBL D;  3VUW A;  5HKH A;  3UQB A;  4W9E A;  1GC7 A;  2MBO A;  1EF1 A;  1UD7 A;  2JZZ A;  3ML8 A;  1C3T A;  4N9F 4;  4MM3 A;  2J7Q B;  5D7G A;  2WWZ A;  2ZNV C;  5KHQ A;  1E8W A;  1E5W A;  5AZF A;  4DDG D;  2L3Z A;  2LGX A;  2QHO A;  4IUM B;  2K1F A;  2D2Q A;  3EFU A;  3DVN V;  1V9J A;  2M17 A;  3QHT A;  4IWQ A;  5DPS A;  4HJK A;  1XQQ A;  3KYC D;  4HVB A;  4NQL B;  2LXA A;  3ZLZ A;  2HE7 A;  4HXD A;  4DHZ E;  4EFO A;  4P7I A;  5KHO A;  4ZRJ A;  1V6E A;  3H7P B;  3PLU A;  3NY5 A;  2LJ5 A;  4BKG A;  4DBG A;  3I3T B;  3DCG A;  5CHF A;  1V81 A;  1RRB A;  1YQB A;  2KFK B;  4II2 B;  2DEN B;  1QZE A;  3X23 A;  4E71 A;  1KLV A;  1OTR B;  3WAN A;  5EDS A;  1D3Z A;  2KTR A;  5C23 A;  2FUH B;  5CHW A;  4TKN A;  3KUZ A;  3P2B A;  4IC7 B;  2FNJ B;  4A3P A;  1WX7 A;  3M62 B;  1I42 A;  2GBN A;  3OJ3 A;  2AYO B;  4BBN F;  5E6O A;  4IWO A;  2JF5 A;  2ASQ A;  4WWO A;  2AWT A;  2LGD A;  2RGF A;  2MWS B;  2N7D A;  4MH0 E;  4W9I A;  2GBM A;  3VHT C;  3HHM A;  1S1Q B;  2A5U A;  1SGH A;  4KDI C;  3RUL A;  1WX8 A;  2C9W B;  4LCD E;  4EKU A;  2CHW A;  3L13 A;  2BKR B;  1KOT A;  2GMI C;  2HD5 B;  2YVC A;  3A1Q B;  2VRR B;  3MHS D;  1Q5W B;  4PS7 A;  1WJ6 A;  5AEK B;  4FUL A;  4AWJ A;  1FXT B;  2W9N A;  2KTR B;  4WJQ A;  4BKS A;  4NJ7 A;  4RMA A;  2IYD B;  2KAN A;  3A9J B;  2XK5 B;  4B9K A;  2ZEQ A;  1H8C A;  4DHJ D;  1LXD A;  1WY8 A;  4AP4 C;  3ZTD A;  2KDB A;  2LGY A;  5CX3 A;  2KX0 A;  4W9L A;  4WWN A;  5G2N A;  4M8M A;  3L0W B;  2KDI A;  3L08 A;  1LM8 B;  5JH5 C;  1E8X A;  1WGG A;  2BPS A;  1EO6 A;  2NS5 A;  3A4R A;  2GBR A;  4II3 B;  2BWE S;  1LQB A;  3RZF A;  1WX9 A;  2Y5B B;  2DYB A;  4BKT A;  2JWZ A;  2WX0 A;  3DDC B;  2JT4 B;  3NS8 A;  3UF8 A;  3TMP B;  3ZRC A;  2AEH A;  2IO0 B;  3PPA A;  2G4D B;  3TCA A;  2N9P C;  4ANX A; 
#chains in the Genus database with same CATH topology
 2LI5 A;  1V1O A;  3ZJU A;  5L95 C;  2R2Q A;  5DCN A;  1QQR A;  2BYV E;  4AJW A;  2JRH A;  4MJS A;  4US9 A;  4LNK A;  1ZXI A;  5TSS A;  2B3A A;  1I7H A;  3PRZ A;  4DWF A;  2KQ4 X;  1SXT A;  3TJP A;  3IXS A;  1L4D B;  4J3O D;  3RZW C;  4KX6 B;  2NPT B;  4YL8 A;  3KUD B;  4TUU A;  5HG2 A;  3R2I A;  2KWU B;  1OGW A;  3N9Y C;  4F1S A;  4XGA B;  4AQ7 A;  1JWU D;  4CQN A;  3VTU A;  2DAJ A;  3FC4 A;  2N0S B;  1EUV B;  2LD9 A;  1R7S A;  1VJK A;  2HTM E;  2WDT B;  3FIL A;  2KTF A;  1GJZ A;  1FD6 A;  4EUT A;  1I4G A;  2E6X A;  3RNC C;  1WGH A;  1GC6 A;  3WAO A;  1NBF C;  2PMV A;  1NVI D;  4EZJ A;  3ZYY X;  3DHG C;  4HPM B;  1WMH B;  2M4N A;  2KXJ A;  3LJ3 A;  2DZM A;  2KLC A;  2XK5 A;  2M56 B;  2C60 A;  2WHI A;  1WJU A;  1CJE A;  4EZL A;  1JRO A;  1UF0 A;  1FRD A;  2XNA C;  1S3S G;  2WX1 A;  3R66 C;  2XEW A;  2GBJ A;  3A9K B;  4GGQ A;  2WU5 B;  5L83 A;  4BVU C;  4FHK A;  2QIL A;  5BYS A;  3KLS X;  4D2K A;  2RPQ A;  3Q2A C;  1KLU D;  4FHJ A;  2O6V A;  2WXK A;  4HDQ A;  3PTF C;  1TT5 B;  2JYE A;  2EKI A;  2L00 B;  2PVO D;  3WAM A;  3NRZ A;  1AW7 A;  1WE7 A;  2MJE A;  4K7W A;  2Y5P A;  3SEB A;  3SDL C;  1VZ6 A;  4GU2 A;  2N4F A;  1N62 A;  4KKJ A;  2OOB B;  3APF A;  3Q8F A;  1VD2 A;  1WGD A;  2JX5 A;  1J7A A;  3QIJ A;  3Q8E A;  3B2F A;  2NVU I;  4ANV A;  2G3Q B;  5JHA A;  2KKC A;  4JX1 C;  2C7M B;  2JVC A;  1I4Q A;  1H4R A;  2O2V A;  4W9C A;  2BYE A;  2JUO A;  3AH7 A;  4GSW A;  4PK1 A;  3H8H A;  2ONQ A;  2N7E A;  2KJR A;  1FMA D;  1PGX A;  4WAF A;  2KO3 A;  1JW9 D;  3CSF A;  1Q0W B;  1HZ5 A;  2G1E A;  1JRP A;  4GDK B;  4HRO A;  5E6P A;  2N9K A;  2RD0 A;  2ZW1 A;  2KDM A;  4JIO U;  3R7Q A;  4JL9 A;  2D07 B;  2RDH A;  2WXN A;  2JXX A;  2BYT A;  4MT5 A;  2D11 A;  1R4N B;  2YLM A;  1ESF A;  2L1A A;  2J0J A;  3PHW B;  3P63 A;  4JQW C;  5BO4 B;  4DHJ B;  3U2S C;  1A70 A;  1L6U A;  2B76 B;  3ALB A;  3JVZ X;  3ZUN A;  3QQ8 B;  3KWV A;  2JYT A;  1T3Q A;  1SIF A;  2ZVN A;  3NVZ A;  3HM3 A;  2BS2 B;  3IT4 B;  2KVZ A;  1V86 A;  3TUO A;  3W1S A;  3WA0 A;  4ANW A;  4GB9 A;  1N6Z A;  1FM0 D;  2WGS A;  2CKH B;  3NVV A;  2ACZ B;  1M94 A;  2G4S A;  1UBQ A;  2K39 A;  2ZW0 A;  4YSX B;  4J6I A;  4KGR A;  4S17 A;  4WQM A;  4HDO A;  3NJT A;  2D3B A;  4RGO S;  1XO3 A;  5IA7 A;  1KM7 A;  4ZRI A;  3H1U A;  4MM3 B;  1V5T A;  1WFY A;  5TR5 A;  3UIO B;  3PZ7 A;  1NEK B;  1FXA A;  2BTE A;  2PPH A;  2V4L A;  4WQO B;  2WP9 B;  5C1Z A;  2J53 A;  1R4N I;  4A6Q A;  2GB1 A;  3K9P B;  4BBN C;  5E6J A;  1NYR A;  3BY4 B;  1E8Y A;  1JQ4 A;  3SU8 X;  3Q6B A;  3DWM A;  1TJE A;  3VH4 B;  1L0Y B;  3AE7 B;  2CS4 A;  3QK0 A;  4LDT D;  1HE8 A;  4K3C A;  4ICV A;  4PS8 A;  5GMV A;  1ZXH A;  2DBY A;  2FCQ A;  5IAA C;  4FA6 A;  1LFD A;  2EEL A;  4FJZ A;  2PE6 B;  1W6V A;  4MAC A;  4FLH A;  3CMM B;  3DQV A;  1SE2 A;  1SE3 A;  3PO0 A;  3OAW A;  1ZKH A;  3L16 A;  1BT0 A;  1P7F A;  2D3G A;  3CF6 E;  2K3U A;  2HTH A;  2W3R A;  2WXG A;  4M0W B;  2KQS A;  4LJO B;  3BII D;  4IG7 B;  4W9H A;  2KOX A;  2C7N B;  3OLM D;  4HWI B;  5FR3 A;  5EE9 A;  2N9X A;  1HXY D;  3IAM 1;  4PYZ A;  4GIV A;  3ZXR A;  2WNM A;  4XWT A;  3J9C A;  2KJ6 A;  3B2G A;  5FR6 A;  2UYZ B;  1TZ1 A;  2I2Y A;  4NZL B;  1SBB B;  3T3O A;  1UGM A;  1KLG D;  3VUW A;  4W9E A;  3EUB 2;  1YJI A;  1EF1 A;  4OZC A;  4N9F 4;  5AZF A;  4M02 A;  1QF6 A;  2LGX A;  3AED B;  3HVZ A;  2PVG C;  2M17 A;  4DQO C;  4HJK A;  4REZ A;  1ZPS A;  4HXD A;  4DHZ E;  2L32 A;  2V4I B;  1MHH E;  5KHO A;  3AE9 B;  4DBG A;  3NY5 A;  2LJ5 A;  1TY0 A;  1V81 A;  1RRB A;  1KLV A;  2L83 A;  2CJO A;  5EDS A;  1FFU A;  1BUI C;  1PDX A;  5CHW A;  1UNS A;  2HJ1 A;  3KUZ A;  4IC7 B;  5FK9 C;  1I42 A;  2AYO B;  3Q8A A;  2KYW A;  1WGK A;  1QLB B;  2GBM A;  2FBW B;  2IGH A;  4IOI E;  4JWS C;  4XDC A;  1ENF A;  1Q5W B;  4PS7 A;  1YN3 A;  4BAX A;  5AEK B;  4AWJ A;  1F2R I;  5C2T B;  5FKA C;  2XK5 B;  2LGY A;  4N6E B;  1XLN A;  2KX0 A;  4W9L A;  5CX3 A;  3AE2 B;  3ZGZ A;  4YT0 B;  3UI3 A;  3HVD A;  5JH5 C;  1WGG A;  3Q69 A;  1ROE A;  2BPS A;  1HTQ A;  2NS5 A;  3GE8 C;  2GBR A;  1XLQ A;  2WX0 A;  3DDC B;  1PFD A;  1K51 A;  3DWG C;  3TMP B;  2AEH A;  2H88 B;  3BK1 A;  1TKG A;  4K7S A;  1P9D U;  1SJE D;  3EEC A;  3ZIM A;  2O6V B;  3OG5 A;  3VFK A;  3DOW A;  4ANU A;  3DBH B;  5G55 A;  2KDE B;  2MA9 B;  2KWV B;  1FFV A;  3AXC A;  2L0F A;  1C76 A;  2MLB A;  2SAK A;  3ENE A;  1NEN B;  1L5P A;  4USA A;  2IPK D;  4DDI D;  2RDG A;  3AUL A;  4AOF A;  4GMV A;  1ZW7 A;  2KLG A;  4E3C A;  1D5X C;  2WQY B;  4CO7 A;  2N1W A;  5JHB A;  5JZE B;  4K7U A;  4GN1 A;  5GXG B;  2KFJ A;  1TYG B;  3S2A A;  3IAS 1;  1UWX A;  2WXM A;  2I1K A;  3C0R B;  4FJV B;  4ZHP A;  4C00 A;  1P1A A;  1ZDX A;  4NJ6 A;  4I6L B;  2I1J A;  1ZDV A;  4CHK A;  1I4R A;  3ZO5 B;  1IGC A;  4DXA B;  1F0Z A;  3AU4 A;  2DYO A;  2LZ6 A;  1V97 A;  1GG3 A;  2VZK D;  1UZX B;  4FAD A;  3L10 B;  2EMS A;  4ICU A;  1ZGU B;  2NBU A;  2PIA A;  4MGK E;  3DBH I;  1KRH A;  5H92 C;  4HKZ E;  2NCN A;  2HJ8 A;  3IHP C;  4BKS D;  4IM3 A;  4MH8 A;  2Q5W D;  3P4Q B;  1UEL A;  5J18 A;  1VCB A;  3W9C B;  2KK8 A;  2MHJ A;  2INC C;  3W5U B;  1WGY A;  1FPY A;  2DZI A;  2LXC A;  5EE1 A;  3P42 A;  1OQY A;  4GDL A;  2D3A A;  3V6C B;  1WF9 A;  1AAR A;  1DYQ A;  4NY0 A;  4XE0 A;  2LEK A;  3T3N A;  3RD2 A;  2W55 A;  4Q2J A;  2KJH B;  4LLG M;  1YOV B;  4ZYS A;  4EOY A;  1YJ1 A;  2IO2 B;  4JWU C;  1Q1O A;  4H2A A;  3M3J A;  3QAQ A;  2IJ0 A;  3N20 C;  3NHE B;  1YIW A;  3WAP A;  1OEY J;  2V1Y A;  1MFW A;  4PT5 A;  3BZD B;  2QIE B;  4ZRP A;  2QSD A;  1I35 A;  2OJR A;  1I4P A;  2LVP A;  4XDD A;  4A20 A;  1A5R A;  1WZ3 A;  4MEL A;  2WXI A;  2MBQ A;  3HIZ A;  1IUE A;  2ZPY A;  5LXH A;  2J0M A;  1WI0 A;  1ISN A;  1FCL A;  1PQS A;  1GPX A;  3I5J C;  4E74 A;  1WH3 A;  3QWZ B;  1J8C A;  2QJL A;  5DPT A;  1C78 A;  3NG0 A;  2MRP A;  1IPG A;  1T0Q C;  2WXR A;  2L05 A;  2KN5 A;  1NI3 A;  3QX1 A;  5I4D A;  3R7R A;  4EZK A;  2MJD A;  3QCA A;  3TIX A;  5J17 A;  2LAS A;  4FJY A;  2WDR B;  2JRI B;  1CQV A;  2E3T A;  1K8R B;  1M4V A;  1WIA A;  1HA5 A;  1TY2 A;  1F9J A;  3QA8 A;  3IBE A;  3MP9 A;  3X0W A;  1AN8 A;  1F1H A;  1GNU A;  4FBJ B;  3SFE B;  1V5O A;  4JPS A;  4IWP A;  2KHW B;  4URK A;  3NZ3 A;  4AJY B;  3B1L X;  1ZP0 B;  3UQA A;  1KTK A;  1D6E C;  1ET6 A;  4R3D A;  3SD5 A;  3M95 A;  2INP E;  3VRB B;  2CJN A;  4B6W A;  3PS6 A;  3VUY A;  3DBS A;  4ZHO A;  3RNB C;  2YEP B;  3RPF C;  3BYY B;  1K52 A;  2FAZ A;  2DNF A;  2FID A;  3DVG X;  1JML A;  2BS4 B;  5E6N A;  2AX5 A;  4FN2 A;  2MP2 B;  1SE9 A;  1KH0 A;  2ZCC A;  3ZNZ B;  1E8Z A;  4AUQ C;  3ONS A;  3M63 B;  1UUP A;  2K8C A;  1PGA A;  3BIN A;  4X57 B;  3WIM A;  4GOC A;  1RFK A;  2IO3 B;  2MQJ A;  3EGR A;  3SHQ A;  3ETR A;  4MSM B;  3IG3 A;  4RM8 A;  1JWM D;  1VRA B;  2MBE A;  3KQ4 A;  2J0K A;  4WJP A;  2GLS A;  3AEB B;  2IND C;  1V2Y A;  4RF1 A;  4W9F A;  3W1Y A;  2CHX A;  3NOB A;  3QJZ A;  1E7U A;  4M00 A;  3ZQ4 A;  2DYM A;  3LMN A;  2FCN A;  4HJG E;  1IBX A;  1Q10 A;  4WJO A;  3RYT A;  1PYW D;  1J0G A;  1T0S C;  1MG8 A;  3HM6 X;  4KZ0 A;  2DWQ A;  5AZH A;  4A55 A;  4NAW B;  1K50 A;  4RNA A;  4RGN A;  3ZRF A;  3H9D A;  4B95 A;  4HPL B;  1JCK B;  5HKH A;  2OJW A;  2MBO A;  1UD7 A;  2JZZ A;  3ML8 A;  3VRA B;  1E8W A;  1JWB D;  4IUM B;  2K1F A;  2D2Q A;  3EFU A;  4IWQ A;  3KYC D;  4HVB A;  2HE7 A;  3RI7 C;  1AWD A;  1E6E B;  3FAH A;  2GI9 A;  4QAY A;  4ZRJ A;  3I3T B;  3RNA C;  2KFK B;  3X23 A;  3WAN A;  1DOI A;  2KTR A;  3PZ8 A;  5C23 A;  2FUH B;  4TKN A;  3RNG C;  1BXT A;  1WX7 A;  2GBN A;  4BBN F;  2JF5 A;  3HUI A;  3EA6 A;  2I38 A;  2AWT A;  2MWS B;  4MH0 E;  3I57 A;  4W9I A;  4US8 A;  4TMA B;  4HEA 1;  1N5W A;  1MVK A;  1S1Q B;  1FNV A;  2V3P A;  4KDI C;  1WX8 A;  2C9W B;  4LCD E;  1T6B X;  4HRS A;  2BKR B;  1FO4 A;  3U52 E;  1I4H A;  2KN4 A;  1IGD A;  5IOI A;  1K53 A;  1RYJ A;  4B0M A;  4WJQ A;  4RMA A;  4XWW A;  4B9K A;  4DHJ D;  4AP4 C;  3ZTD A;  2WXQ A;  4LK0 M;  5D3D A;  2M19 A;  5G2N A;  2W54 A;  2JXT A;  2KDI A;  1LM8 B;  4L1B A;  1XLO A;  4II3 B;  1ET9 A;  2J52 A;  4HKQ A;  2JT4 B;  4O1N A;  3NS8 A;  3UF8 A;  3ZRC A;  3P1M A;  1I4X A;  2IO0 B;  3PPA A;  1PGB A;  2NBV B;  3UIN B;  1V8C A;  1J7B A;  3LDZ E;  3LXF A;  2MH7 A;  3L54 A;  2JQR B;  4RGT A;  4OW0 A;  4GDL B;  2MCN B;  3Q8B A;  1L4Z B;  2GRI A;  1QIL A;  2C5L C;  2KC2 A;  2VH2 A;  1MJD A;  3URY A;  3N32 A;  3NZS A;  3IT6 B;  1P7E A;  1WM2 A;  5T8I A;  2A4Z A;  3U30 A;  2IDY A;  3CIR B;  5BYQ A;  3MC0 B;  3TL5 A;  4OVZ A;  4RGM A;  2LWP A;  4C4V A;  4EEW A;  2WXJ A;  1SE4 A;  1F52 A;  1J19 A;  3LYY A;  3VH3 B;  4C80 A;  3H7P A;  1D5Z C;  5AUI A;  4DXG A;  1WYW B;  4MJS B;  3PZD A;  3RFZ B;  4HCP B;  1NDD A;  3O13 A;  3B0A A;  4JGH B;  1J7C A;  1OQQ A;  1SSN A;  4YSY B;  2XBB C;  1UH6 A;  3ZNI D;  1UBI A;  3ZDT A;  3TEX A;  1GAQ B;  3AE6 B;  4PYU A;  2DZJ A;  4HLE A;  3NS1 A;  2SEB D;  4A9A A;  3UIP B;  1HZ6 A;  1F2R C;  3BVG A;  1P0R A;  3AN1 A;  4KSL C;  2ZZP B;  3BWU D;  3AMZ A;  3VR9 B;  1YQ3 B;  3OJ4 B;  4TQ1 A;  1YMH E;  2VH1 A;  2MBH A;  3FIL B;  3EHV A;  1G6J A;  2PEA A;  2N9E B;  4TV3 A;  1V1P A;  2WXF A;  1C4A A;  3ZKJ C;  2BWF A;  1LGR A;  2X38 A;  4OVV A;  2BT6 A;  2IY1 B;  4GXB A;  1WGR A;  4LNO A;  3P4S B;  4MDK E;  3ZW3 A;  2DHZ A;  2JSV X;  3NZU A;  1YX6 B;  1NI2 A;  2H89 B;  3JYU A;  2AQ3 B;  4ARC A;  3B08 A;  1EM7 A;  4OHJ A;  1VLB A;  3NVY A;  3KUC B;  2LVO A;  1EWC A;  4WWP A;  4C56 C;  1TZO A;  4G0N B;  4WUR A;  1BML C;  3L4P A;  4GDK A;  4M01 A;  4K1R B;  5JXV A;  4A90 A;  2MBB B;  4ZDV A;  3AE8 B;  3JSV A;  2EKE C;  4F7Z A;  2ZVO A;  2KVR A;  2MJ3 A;  4KIK A;  1MHX A;  3JW0 X;  3E56 A;  3EC8 A;  2L0T A;  1E7V A;  1C4P A;  1YN5 A;  5BMG A;  1XXG A;  3GZN B;  3ZTC A;  3A4S C;  2Z0D B;  1B9R A;  1EF5 A;  2D5G A;  1RAX A;  3VR8 B;  2D3C A;  4W9G A;  1RLF A;  4LJP B;  3PRE A;  5D6J B;  2KNB A;  2O2V B;  5D3I B;  2QEJ C;  2UU7 A;  1XF5 L;  1N60 A;  2DLB A;  4G3X B;  1KJT A;  1T0Y A;  3O65 B;  2JU6 X;  1YQ4 B;  4W9K A;  1E0Z A;  2J42 A;  2JPH A;  1VDV A;  3AM9 A;  3EFC A;  3ZJT A;  2OED A;  3H6N A;  2BGF A;  2WDQ B;  4BOZ B;  2WDV B;  3MTN B;  2MSE D;  3ZDM C;  2WXO A;  3MC8 A;  3CST A;  1WXA A;  1WE6 A;  3VUX A;  2LRW A;  1L0V B;  1V49 A;  1GOZ A;  2K9X A;  3W2D A;  4CYE A;  2K5P A;  3Q3F A;  2PKO A;  2Y3A A;  3Q3N C;  3Q8C A;  3P4P B;  2Z8L A;  4A8X C;  3DBR I;  1GUA B;  2QCZ A;  4XC2 A;  2INN E;  2CHZ A;  2KT7 A;  3IVF A;  4MGZ E;  2KAC A;  2O6V D;  3GZN I;  3DPD A;  1WXQ A;  4NPN A;  1VR9 A;  5IN7 A;  1IP9 A;  2DZK A;  3RUI B;  1L7Y A;  1CMX B;  4W9D A;  1AYF A;  3APD A;  2JY6 A;  4RF0 A;  2RR9 A;  2K6Q A;  3GP7 A;  3C8Y A;  4IW0 A;  2BYF A;  1XCT L;  3RCZ A;  3VAW A;  1YN4 A;  4JLC A;  3Q3J A;  4EE2 A;  3GOE A;  1IYF A;  2NR2 A;  3W1S C;  5CTR C;  2PJH A;  1TS4 A;  4DHZ B;  2L7R A;  2J4X A;  1L2N A;  4P1C C;  2KMC A;  2K8B A;  4K81 A;  2G9H D;  2AQ2 B;  3RT3 B;  2EMT A;  1SF0 A;  1MPE A;  4L23 A;  1L0X B;  2IBI B;  3R2T A;  1WRD B;  3AE5 B;  5C3J B;  2V9H A;  2WLB A;  3PRP B;  2K6D B;  3MHZ A;  1P3Q U;  2K0P A;  1OFF A;  4WAA A;  3NUH B;  4UDU C;  4P6V F;  1Z5S B;  3KH0 A;  3RNF C;  4RM9 A;  2PE9 A;  4N58 A;  1OQR A;  2ZNV B;  3V60 A;  4NJC A;  5LXI B;  2K8H A;  3OWE B;  2OHF A;  2N9L A;  3AEG B;  5LNK 1;  1L6V A;  4MSQ B;  3C19 A;  4DXF A;  2KWC A;  5HFY A;  1WJ4 A;  4ITK A;  1N63 A;  1UWM A;  4KKI A;  2BB6 A;  3VXW A;  2M0A A;  1JWS D;  1VZ8 A;  3TBL D;  3UQB A;  3ABV B;  3FKY A;  1FEH A;  2WWZ A;  2ZNV C;  3P4R B;  1TS5 A;  3U7Z A;  4AS1 A;  4B0E A;  3DVN V;  4P1B C;  4C4V B;  1YNT E;  1V9J A;  3QHT A;  5DPS A;  3NVW A;  4NQL B;  1E7P B;  5EE0 A;  3ZLZ A;  4EFO A;  3E9S A;  1C79 A;  4P7I A;  3H7P B;  4NAM A;  4BKG A;  2KWD A;  3HRD D;  4II2 B;  1QZE A;  1EU4 A;  5BMH A;  1D3Z A;  3BVZ A;  5AUK A;  2LFI A;  3P2B A;  4IKG A;  3DBL B;  2FNJ B;  4A3P A;  3M62 B;  1C4C A;  5H8Y E;  4HPP A;  4IWO A;  2IGG A;  3WCQ A;  2AQ1 B;  4P16 A;  2LGD A;  2R61 A;  3I9V 1;  3MFG A;  2LJI A;  1T5X D;  3VHT C;  2L52 A;  2A5U A;  4LNF A;  4EKU A;  3V3X A;  2HD5 B;  3W5V B;  3MHS D;  1WJ6 A;  3AB5 A;  4FUL A;  2W9N A;  4LNN A;  2YEP F;  2X8X X;  4BKS A;  4NJ7 A;  2KAN A;  1XLP A;  1H8C A;  1WY8 A;  2KDB A;  3N1Z C;  3DHI C;  1LO5 D;  3L0W B;  3MC9 A;  3L08 A;  1E8X A;  1EO6 A;  5EE3 A;  4ZRQ A;  3GB1 A;  2PTL A;  1LQB A;  3RZF A;  2V3N A;  4BKT A;  4WIP A;  1V1P B;  1CK1 A;  2G4D B;  3N1Y C;  1Y56 A;  1XEE A;  2IGD A;  3GE3 C;  2BVC A;  5HHD G;  2KX3 A;  4I6P A;  3PLV A;  3RN9 C;  3AU5 A;  3MJW A;  3U8Z A;  4ZOH C;  1N61 A;  2L76 A;  1WWT A;  1RFA A;  3DBL I;  1E10 A;  4HCN B;  1WYG A;  3AE1 B;  2BKF A;  2DAF A;  2MX2 A;  1XT9 B;  4XZ4 A;  1N5X A;  4XX5 A;  2ZJD A;  1C9F A;  1QOA A;  3R3M A;  3DVN U;  2CU1 A;  1FNU A;  3HK0 A;  1X1M A;  1ACC A;  3MJ5 A;  4S0R A;  4KZC A;  3JSV B;  2ZPN A;  1TIF A;  1WRI A;  1DGJ A;  4KIK B;  2ZCB A;  4IM0 A;  1EWY C;  2FCS A;  5D2M B;  4LDT B;  3ZVV A;  3B9J A;  2LRU A;  3PHX B;  2RPV A;  3DVG Y;  1WXS A;  5IKC M;  2MEK A;  1E90 A;  1F77 A;  4PS3 A;  1VZ7 A;  4MEM A;  2JZP A;  4L2Y A;  2KMM A;  3PT2 B;  3AI5 A;  3Q3O C;  3GS2 A;  4TQ0 A;  3A1Q A;  2UWQ A;  1D4B A;  1SIJ A;  1ZOY B;  3V6E B;  4YTP B;  1WSP A;  3A9J A;  3ML9 A;  2ICI A;  1TGZ B;  4C7Y A;  2IY0 B;  3PV1 A;  3RMK C;  4W9J A;  1JWA D;  2RSU A;  3ZJV A;  3IFW B;  3PVL A;  1MG4 A;  2FIF A;  2C7H A;  1XCQ L;  1D5M C;  4ASW C;  1JRU A;  2DX5 B;  3I63 C;  1UGJ A;  4RH6 A;  1EU3 A;  1ZE3 D;  1RWS A;  1C77 A;  4IDI A;  2IZV B;  1TKY A;  1Y8R C;  1YD8 U;  3AV8 A;  2NPT A;  1SJH D;  2M8S A;  2KDF B;  3ZXV A;  2AL6 A;  2CR5 A;  1TS2 A;  2TSS A;  4IM2 A;  2KC1 A;  2W3S A;  2KQ7 A;  3ZNH B;  4KSK C;  2FUG 1;  5AZG A;  3AEF B;  1QKZ A;  1U4A A;  1NYQ A;  4RFB A;  1TBE A;  2GBK A;  2K22 A;  3PSE B;  3R8B A;  3BYT B;  4DK5 A;  5DPR A;  4C7Z A;  2WXL A;  1WZ0 A;  3KWL A;  3VTW A;  3H7S A;  4ZRK A;  4YTN B;  3V61 A;  2K25 A;  4NNJ B;  2QDF A;  1MI0 A;  1FCC C;  2JWU A;  1WMH A;  2BBC A;  5HI1 A;  4JE3 B;  4KV2 A;  1PUT A;  3TSS A;  4I6N B;  2L8J A;  5G5G A;  2V0G A;  2KZR A;  4LTU A;  4OZB A;  4F8C B;  4XYC A;  1KF6 B;  4BFR A;  1T0R C;  3D32 A;  3VQI A;  3LB8 C;  3A9K A;  3ECI A;  2BF8 B;  3QC8 B;  1YJJ A;  1YX5 B;  1WJN A;  1QOB A;  3AE3 B;  2Z0E B;  3APC A;  4LNI A;  3PGE A;  2KD0 A;  3U7D A;  1OEY A;  2Y5C A;  4YWG G;  3Q3M C;  1QOF A;  3N1X C;  3A33 B;  2FE8 A;  3QAR A;  2PLP A;  1FNW A;  4KVG B;  4KGT A;  5D94 A;  2MP2 A;  3N3K B;  5LLI A;  2G45 B;  1DOX A;  4TSS A;  4NQK E;  2IO1 B;  3VDZ A;  2RDB C;  3AEE B;  2FCM A;  1R4M B;  4KGS A;  3KW5 B;  2Z59 B;  2WXP A;  4G11 A;  2ON8 A;  3WAL A;  1WM3 A;  1E9M A;  1V80 A;  2LUE A;  2MW5 A;  3SR6 A;  5DPW A;  4YXD B;  4FXC A;  1TTN A;  1WXV A;  2N1V A;  4M8N A;  2KAJ A;  3AE4 B;  1FXI A;  1WXM A;  3T9L A;  2LVQ A;  1C1Y B;  5CHV C;  2R2O A;  1Z2M A;  3KYD D;  2LGS A;  4KDL B;  1HEZ E;  2V3S A;  2AL3 A;  2M0X A;  2HDE A;  4OZA A;  3K9O B;  5MPO A;  2N7J A;  2RMM A;  3AEA B;  1P98 A;  1KFY B;  3DBR B;  3VTV A;  2VZK B;  3V62 A;  3AEC B;  1WR6 E;  4YTM B;  4G50 A;  2WYQ A;  2JZ3 B;  4NAW A;  2M1M A;  1CZP A;  3L17 A;  4MGY E;  2GOW A;  4OVU A;  5BMI A;  1TKE A;  2QC8 A;  3KVF B;  4ZYN A;  2REX A;  5J2R A;  3PRM B;  1QOG A;  4HK2 A;  1STE A;  4A3O A;  1HTO A;  2NTS A;  3ZNG C;  1SB3 C;  1R4M I;  2NMQ A;  3T8M A;  2NBW B;  4WJN A;  5IP4 D;  2PW9 A;  1WR1 A;  4MGI E;  4YSZ B;  3UGB B;  3DHH C;  3N30 A;  2NTT A;  4K3B A;  2LGI A;  1XD3 B;  2KMA A;  2D10 A;  2WS3 B;  4BOS C;  2LHE A;  4RCO A;  1HQR D;  3VVW B;  5G5H A;  2KFK A;  1GC7 A;  1JAL A;  1C3T A;  4MM3 A;  2J7Q B;  2BS3 B;  5D7G A;  5KHQ A;  3SFD B;  1E5W A;  4ARI A;  4DDG D;  2L3Z A;  1GB4 A;  2QHO A;  2BB5 A;  1IBX B;  4BZA A;  1FIQ A;  2XN9 C;  4N59 A;  2WXH A;  1XQQ A;  2LXA A;  3V05 A;  1QT9 A;  1FRR A;  1GB1 A;  4ACF A;  4GLS C;  1V6E A;  2CU3 A;  1ZUD 2;  3PLU A;  3DCG A;  5CHF A;  1YQB A;  4E71 A;  2DEN B;  3BVM A;  1OTR B;  1SEB D;  3TEW A;  2LUM A;  4WH4 A;  3OJ3 A;  5E6O A;  2ASQ A;  3RNE C;  4WWO A;  1B1Z A;  2RGF A;  3TEZ A;  2N7D A;  3Q14 C;  5BYR A;  1DOY A;  2W82 A;  3HHM A;  2WU2 B;  1SGH A;  5IO9 A;  3RUL A;  3U4E G;  2CHW A;  2BQQ A;  3L13 A;  1KOT A;  2GMI C;  2YVC A;  3A1Q B;  2VRR B;  3TEY A;  1FXT B;  2KTR B;  4M0W A;  1RM6 C;  2LMC A;  2IYD B;  3A9J B;  2ZEQ A;  1LXD A;  2BW2 A;  2QMT A;  4WWN A;  4M8M A;  1TS3 A;  2LHD A;  4WWM A;  3A4R A;  3BK2 A;  2BWE S;  1WX9 A;  2Y5B B;  2DYB A;  2JWZ A;  4ANX A;  3TCA A;  2N9P C;  3CWI A; 
#chains in the Genus database with same CATH homology
 2LI5 A;  2NBV B;  5L95 C;  4K7S A;  3UIN B;  1P9D U;  2R2Q A;  3EEC A;  3ZIM A;  5DCN A;  3LDZ E;  3L54 A;  2O6V B;  2KX3 A;  4I6P A;  3PLV A;  3VFK A;  4GDL B;  2MCN B;  2BYV E;  2C5L C;  2JRH A;  2KC2 A;  3DOW A;  4MJS A;  3AU5 A;  4AJW A;  4ANU A;  3MJW A;  5G55 A;  3U8Z A;  2B3A A;  2KDE B;  3N32 A;  3NZS A;  2MA9 B;  3PRZ A;  2KWV B;  4DWF A;  2L76 A;  3AXC A;  2L0F A;  3TJP A;  1WM2 A;  1RFA A;  2A4Z A;  3DBL I;  4HCN B;  3U30 A;  2MLB A;  2BKF A;  2DAF A;  2MX2 A;  1XT9 B;  3ENE A;  4XZ4 A;  3RZW C;  4XX5 A;  2ZJD A;  3TL5 A;  2NPT B;  4YL8 A;  3KUD B;  4TUU A;  2LWP A;  4EEW A;  3R3M A;  4DDI D;  3DVN U;  2CU1 A;  2KWU B;  3HK0 A;  1OGW A;  4F1S A;  1J19 A;  3AUL A;  1X1M A;  4AOF A;  4GMV A;  3VH3 B;  1ZW7 A;  4KZC A;  2KLG A;  4E3C A;  3JSV B;  3H7P A;  3VTU A;  2ZPN A;  4CO7 A;  2N1W A;  5JHB A;  5JZE B;  2DAJ A;  4K7U A;  4GN1 A;  1EUV B;  2LD9 A;  1WYW B;  4KIK B;  4MJS B;  3PZD A;  2ZCB A;  4HCP B;  4IM0 A;  1NDD A;  4JGH B;  3B0A A;  2KFJ A;  2FCS A;  5D2M B;  3S2A A;  4LDT B;  2I1K A;  2WDT B;  3C0R B;  4FJV B;  2XBB C;  3ZVV A;  2LRU A;  1P1A A;  2KTF A;  1GJZ A;  4NJ6 A;  1UH6 A;  2I1J A;  3PHX B;  3DVG Y;  4I6L B;  1WXS A;  4EUT A;  1E90 A;  3ZNI D;  4PS3 A;  1WGH A;  1UBI A;  3ZDT A;  3ZO5 B;  4CHK A;  4DXA B;  1GC6 A;  4MEM A;  4PYU A;  3WAO A;  3AU4 A;  1NBF C;  2DYO A;  4EZJ A;  2DZJ A;  4HLE A;  3PT2 B;  2LZ6 A;  3AI5 A;  3UIP B;  1GG3 A;  4TQ0 A;  3A1Q A;  4HPM B;  2UWQ A;  1UZX B;  1P0R A;  1WMH B;  4KSL C;  2M4N A;  2ZZP B;  2KXJ A;  4FAD A;  3L10 B;  3LJ3 A;  2DZM A;  2EMS A;  1ZGU B;  2NBU A;  4ICU A;  3V6E B;  2KLC A;  3A9J A;  2XK5 A;  3ML9 A;  2C60 A;  3OJ4 B;  3DBH I;  4MGK E;  4TQ1 A;  1TGZ B;  1WJU A;  2MBH A;  2IY0 B;  3PV1 A;  4EZL A;  2NCN A;  1S3S G;  2WX1 A;  3EHV A;  2HJ8 A;  3IHP C;  2PEA A;  4BKS D;  1G6J A;  4IM3 A;  4W9J A;  2N9E B;  3R66 C;  2RSU A;  4TV3 A;  2XEW A;  2GBJ A;  3A9K B;  4GGQ A;  3IFW B;  3PVL A;  1UEL A;  3ZKJ C;  2BWF A;  4BVU C;  4FHK A;  5J18 A;  5L83 A;  1VCB A;  2FIF A;  4OVV A;  2C7H A;  2KK8 A;  2IY1 B;  4GXB A;  1WGR A;  4ASW C;  2RPQ A;  1WGY A;  1JRU A;  2DX5 B;  2DZI A;  4FHJ A;  2LXC A;  2O6V A;  4HDQ A;  3PTF C;  4MDK E;  3ZW3 A;  1OQY A;  2DHZ A;  2L00 B;  4GDL A;  3NZU A;  1YX6 B;  1NI2 A;  3V6C B;  3WAM A;  1WF9 A;  1AAR A;  1WE7 A;  4NY0 A;  4K7W A;  3RD2 A;  3JYU A;  3SDL C;  4GU2 A;  2IZV B;  2N4F A;  3B08 A;  2KJH B;  1Y8R C;  3KUC B;  1YD8 U;  2OOB B;  2NPT A;  1YJ1 A;  3APF A;  4EOY A;  2IO2 B;  2LVO A;  1VD2 A;  1Q1O A;  4WWP A;  2M8S A;  2KDF B;  4G0N B;  1WGD A;  2AL6 A;  3M3J A;  3QIJ A;  3NHE B;  3QAQ A;  4GDK A;  2CR5 A;  4K1R B;  1YIW A;  3WAP A;  2NVU I;  4ANV A;  2G3Q B;  5JHA A;  2MBB B;  4ZDV A;  2KKC A;  1OEY J;  3JSV A;  2EKE C;  2V1Y A;  4IM2 A;  2C7M B;  4F7Z A;  2JVC A;  2KC1 A;  2ZVO A;  2KQ7 A;  1H4R A;  2KVR A;  2O2V A;  4W9C A;  3ZNH B;  2BYE A;  2JUO A;  4KSK C;  4GSW A;  4KIK A;  5AZG A;  1I35 A;  2N7E A;  2OJR A;  1U4A A;  3JW0 X;  1TBE A;  2LVP A;  3EC8 A;  2L0T A;  1E7V A;  4A20 A;  2KJR A;  1A5R A;  1WZ3 A;  2GBK A;  3PSE B;  4MEL A;  2MBQ A;  3HIZ A;  2KO3 A;  2ZPY A;  3ZTC A;  5LXH A;  2J0M A;  4DK5 A;  3CSF A;  5DPR A;  3A4S C;  1WI0 A;  1WZ0 A;  1ISN A;  2Z0D B;  1Q0W B;  1PQS A;  3VTW A;  1EF5 A;  4E74 A;  1WH3 A;  3H7S A;  1RAX A;  4GDK B;  3QWZ B;  4ZRK A;  5E6P A;  1J8C A;  4W9G A;  1RLF A;  2RD0 A;  4JIO U;  4LJP B;  5DPT A;  3V61 A;  3PRE A;  2K25 A;  5D6J B;  2KNB A;  4NNJ B;  2MRP A;  2O2V B;  3R7Q A;  1IPG A;  2D07 B;  4JL9 A;  2JXX A;  1WMH A;  2D11 A;  4KV2 A;  2L05 A;  2YLM A;  4I6N B;  2L8J A;  2J0J A;  3PHW B;  2KN5 A;  4G3X B;  1KJT A;  1T0Y A;  2KZR A;  3O65 B;  3QX1 A;  4F8C B;  4JQW C;  5BO4 B;  4W9K A;  4DHJ B;  3R7R A;  2JPH A;  4BFR A;  4EZK A;  3ALB A;  3D32 A;  3JVZ X;  3QCA A;  3ZUN A;  3H6N A;  3VQI A;  3QQ8 B;  3TIX A;  5J17 A;  2BGF A;  2LAS A;  3A9K A;  3ECI A;  1SIF A;  2ZVN A;  4BOZ B;  3MTN B;  4FJY A;  2BF8 B;  3HM3 A;  2MSE D;  3QC8 B;  1YX5 B;  1WJN A;  1V86 A;  2JRI B;  3ZDM C;  3CST A;  1WXA A;  1WE6 A;  1K8R B;  3VUX A;  3W1S A;  4GB9 A;  3WA0 A;  2LRW A;  4ANW A;  2Z0E B;  3APC A;  3PGE A;  2KD0 A;  1V49 A;  3U7D A;  1OEY A;  1WIA A;  4CYE A;  3Q3F A;  2CKH B;  1F9J A;  1M94 A;  3QA8 A;  3IBE A;  2G4S A;  3X0W A;  1UBQ A;  3DBR I;  1GUA B;  2K39 A;  1GNU A;  4FBJ B;  4XC2 A;  3A33 B;  2CHZ A;  4J6I A;  3QAR A;  1V5O A;  3IVF A;  4MGZ E;  2O6V D;  4HDO A;  4KVG B;  4IWP A;  2KHW B;  4URK A;  5D94 A;  2MP2 A;  3GZN I;  3N3K B;  3DPD A;  5LLI A;  2G45 B;  4AJY B;  3B1L X;  3UQA A;  4NPN A;  4NQK E;  2IO1 B;  3VDZ A;  5IA7 A;  1IP9 A;  1KM7 A;  2DZK A;  3SD5 A;  4ZRI A;  3RUI B;  3M95 A;  1L7Y A;  3H1U A;  1CMX B;  4B6W A;  2FCM A;  3PS6 A;  3VUY A;  1V5T A;  1WFY A;  4W9D A;  3DBS A;  5TR5 A;  3UIO B;  3APD A;  2JY6 A;  3KW5 B;  2PPH A;  2RR9 A;  2Z59 B;  2K6Q A;  2V4L A;  4WQO B;  2FAZ A;  4G11 A;  3WAL A;  1WM3 A;  4IW0 A;  2BYF A;  2FID A;  5C1Z A;  3DVG X;  1R4N I;  1V80 A;  3K9P B;  4BBN C;  2LUE A;  3RCZ A;  2MW5 A;  5DPW A;  5E6N A;  1TTN A;  1WXV A;  2N1V A;  3VAW A;  4FN2 A;  4M8N A;  3BY4 B;  2MP2 B;  1SE9 A;  1E8Y A;  4JLC A;  3SU8 X;  1WXM A;  3Q3J A;  3T9L A;  2ZCC A;  2LVQ A;  3ZNZ B;  1C1Y B;  3VH4 B;  3GOE A;  5CHV C;  2R2O A;  1Z2M A;  2CS4 A;  1E8Z A;  1IYF A;  4AUQ C;  3QK0 A;  3ONS A;  2NR2 A;  3KYD D;  1HE8 A;  4LDT D;  4KDL B;  3W1S C;  5CTR C;  4ICV A;  2PJH A;  2V3S A;  4DHZ B;  2L7R A;  4PS8 A;  2AL3 A;  5GMV A;  2M0X A;  3K9O B;  1L2N A;  3M63 B;  2KMC A;  2K8B A;  4K81 A;  2K8C A;  3RT3 B;  1P98 A;  2EMT A;  2FCQ A;  1LFD A;  5IAA C;  3VTV A;  4FA6 A;  3BIN A;  2IBI B;  4X57 B;  3V62 A;  4FJZ A;  2PE6 B;  1W6V A;  3WIM A;  4GOC A;  1WRD B;  2IO3 B;  4FLH A;  2MQJ A;  3CMM B;  3DQV A;  3SHQ A;  1WR6 E;  3OAW A;  4MSM B;  3PRP B;  2K6D B;  3IG3 A;  4RM8 A;  4G50 A;  1P3Q U;  2WYQ A;  1ZKH A;  3L16 A;  1BT0 A;  2JZ3 B;  4NAW A;  2MBE A;  2D3G A;  2M1M A;  3CF6 E;  3L17 A;  2J0K A;  2HTH A;  4WAA A;  4MGY E;  4WJP A;  2GOW A;  4OVU A;  3KVF B;  1Z5S B;  3KH0 A;  4ZYN A;  2REX A;  5J2R A;  3PRM B;  4M0W B;  4HK2 A;  1V2Y A;  2KQS A;  4LJO B;  4RM9 A;  4W9H A;  4IG7 B;  2PE9 A;  4W9F A;  3W1Y A;  2KOX A;  2C7N B;  2CHX A;  3OLM D;  4A3O A;  3ZNG C;  2ZNV B;  3V60 A;  3NOB A;  1R4M I;  3QJZ A;  3T8M A;  5LXI B;  1E7U A;  2K8H A;  2DYM A;  4HWI B;  2NBW B;  3LMN A;  4WJN A;  1WR1 A;  2N9X A;  4MGI E;  2FCN A;  3UGB B;  3N30 A;  4PYZ A;  4WJO A;  3RYT A;  4GIV A;  1J0G A;  4MSQ B;  2KJ6 A;  1XD3 B;  2KMA A;  5FR6 A;  2D10 A;  1MG8 A;  3HM6 X;  2UYZ B;  1TZ1 A;  4KZ0 A;  2KWC A;  1WJ4 A;  5AZH A;  4NAW B;  4BOS C;  3ZRF A;  1UGM A;  3H9D A;  3VVW B;  3VXW A;  4B95 A;  4HPL B;  2KFK A;  3TBL D;  3VUW A;  5HKH A;  3UQB A;  4W9E A;  1GC7 A;  2MBO A;  1EF1 A;  1UD7 A;  2JZZ A;  3ML8 A;  1C3T A;  4N9F 4;  4MM3 A;  2J7Q B;  5D7G A;  2WWZ A;  2ZNV C;  5KHQ A;  1E8W A;  1E5W A;  5AZF A;  4DDG D;  2L3Z A;  2LGX A;  2QHO A;  4IUM B;  2K1F A;  2D2Q A;  3EFU A;  3DVN V;  1V9J A;  2M17 A;  3QHT A;  4IWQ A;  5DPS A;  4HJK A;  1XQQ A;  3KYC D;  4HVB A;  4NQL B;  2LXA A;  3ZLZ A;  2HE7 A;  4HXD A;  4DHZ E;  4EFO A;  4P7I A;  5KHO A;  4ZRJ A;  1V6E A;  3H7P B;  3PLU A;  3NY5 A;  2LJ5 A;  4BKG A;  4DBG A;  3I3T B;  3DCG A;  5CHF A;  1V81 A;  1RRB A;  1YQB A;  2KFK B;  4II2 B;  2DEN B;  1QZE A;  3X23 A;  4E71 A;  1KLV A;  1OTR B;  3WAN A;  5EDS A;  1D3Z A;  2KTR A;  5C23 A;  2FUH B;  5CHW A;  4TKN A;  3KUZ A;  3P2B A;  4IC7 B;  2FNJ B;  4A3P A;  1WX7 A;  3M62 B;  1I42 A;  2GBN A;  3OJ3 A;  2AYO B;  4BBN F;  5E6O A;  4IWO A;  2JF5 A;  2ASQ A;  4WWO A;  2AWT A;  2LGD A;  2RGF A;  2MWS B;  2N7D A;  4MH0 E;  4W9I A;  2GBM A;  3VHT C;  3HHM A;  1S1Q B;  2A5U A;  1SGH A;  4KDI C;  3RUL A;  1WX8 A;  2C9W B;  4LCD E;  4EKU A;  2CHW A;  3L13 A;  2BKR B;  1KOT A;  2GMI C;  2HD5 B;  2YVC A;  3A1Q B;  2VRR B;  3MHS D;  1Q5W B;  4PS7 A;  1WJ6 A;  5AEK B;  4FUL A;  4AWJ A;  1FXT B;  2W9N A;  2KTR B;  4WJQ A;  4BKS A;  4NJ7 A;  4RMA A;  2IYD B;  2KAN A;  3A9J B;  2XK5 B;  4B9K A;  2ZEQ A;  1H8C A;  4DHJ D;  1LXD A;  1WY8 A;  4AP4 C;  3ZTD A;  2KDB A;  2LGY A;  5CX3 A;  2KX0 A;  4W9L A;  4WWN A;  5G2N A;  4M8M A;  3L0W B;  2KDI A;  3L08 A;  1LM8 B;  5JH5 C;  1E8X A;  1WGG A;  2BPS A;  1EO6 A;  2NS5 A;  3A4R A;  2GBR A;  4II3 B;  2BWE S;  1LQB A;  3RZF A;  1WX9 A;  2Y5B B;  2DYB A;  4BKT A;  2JWZ A;  2WX0 A;  3DDC B;  2JT4 B;  3NS8 A;  3UF8 A;  3TMP B;  3ZRC A;  2AEH A;  2IO0 B;  3PPA A;  2G4D B;  3TCA A;  2N9P C;  4ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...