4A3PA

Structure of usp15 dusp-ubl deletion mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
214
structure length
210
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 210
sequence length 214
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3pA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3pA01
5HKHA 1GG3A 2JZ3B 2KK8A 4W9DA 3QX1A 4EZJA 5AZGA 2K25A 4HCNB 4K1RB 2LVPA 1P3QU 2FIDA 4AWJA 2FCQA 5D2MB 3EECA 4GIVA 4FLHA 3L17A 2BKRB 4ANUA 5E6NA 3T8MA 1MG8A 2K8CA 4LDTB 3WANA 1G6JA 1V49A 2D10A 4I6PA 5DPWA 3B08A 3A9KA 2OOBB 3H9DA 3KUZA 4KSKC 4ZRKA 1WF9A 4NY0A 2CHXA 2GBJA 2KHWB 2W9NA 3DBSA 1WH3A 3JSVA 2CHWA 4KZ0A 1V5TA 4DXAB 2KD0A 3KUDB 1XD3B 3D32A 4HCPB 2IYDB 4EOYA 2IY1B 5JZEB 3KW5B 2JXXA 2LVQA 1U4AA 4GB9A 5G55A 4DWFA 4ANVA 5CTRC 2A4ZA 4BFRA 4BKSD 4W9KA 2CR5A 3VHTC 2LWPA 2IZVB 1YX5B 3LDZE 4ZRIA 1K8RB 2ZNVB 4FBJB 3GOEA 4GDKB 3DBLI 3DBRI 2DX5B 3DVGX 1OTRB 2ZCBA 5CHWA 3M63B 2L3ZA 2Y5BB 1WX9A 1WE7A 1WGYA 4NQLB 3UQAA 2BYVE 2KO3A 1I42A 3AI5A 2PE6B 1E7UA 2KJHB 2ASQA 4HPMB 1YQBA 4G11A 4ZDVA 3O65B 3PT2B 3DDCB 4MSQB 1NDDA 4BOZB 2DYOA 4JL9A 4KV2A 3VQIA 3ZRFA 1XQQA 4ZYNA 3ZIMA 3M62B 3PTFC 1A5RA 2RD0A 3OJ4B 3DVNU 1KLVA 2JPHA 3L16A 3L54A 1WX7A 4MH0E 2BWES 4RM9A 3JSVB 4X57B 2KJRA 2N7EA 3RCZA 4PS8A 3AXCA 4KSLC 5DPSA 1E8XA 3OAWA 2CHZA 4PS7A 4GN1A 4RMAA 3ZTDA 2YLMA 2KMAA 2J0JA 3QA8A 4IWPA 4P7IA 3OLMD 2GBMA 3B0AA 2MWSB 4JLCA 1V86A 4GU2A 1P98A 2I1JA 2K8BA 3H6NA 3EC8A 3V60A 5J2RA 3M3JA 2MW5A 1WY8A 5G2NA 2M1MA 1WR1A 2EKEC 3B1LX 2NBUA 3PRPB 2IBIB 2JRIB 2O6VA 2XEWA 3QJZA 1GNUA 2J0MA 2MBHA 1X1MA 2K1FA 3PHWB 1WIAA 3U30A 2CU1A 3CSFA 4G0NB 3EFUA 3RULA 3NS8A 4MGIE 2UYZB 3ZO5B 1NBFC 4MELA 3VUXA 4LCDE 2M8SA 5GMVA 4MJSA 2AWTA 2ZEQA 5FR6A 4B6WA 2L7RA 1KJTA 3L10B 3ML8A 2MSED 3ZUNA 2JT4B 1L2NA 2N9PC 3ONSA 4IWOA 3QQ8B 5IA7A 2L76A 3TBLD 4BVUC 4I6LB 2C5LC 4OVVA 2FUHB 4CYEA 4HDOA 4DDGD 4IM2A 2K39A 3APDA 1P9DU 1UH6A 1WRDB 5D94A 3TL5A 2MA9B 1ISNA 2G4DB 1FXTB 2KVRA 3TMPB 2BWFA 2NVUI 3ZVVA 3R7RA 3NHEB 2JF5A 2DYMA 1WZ3A 3TCAA 1VD2A 2KLGA 1VCBA 1TGZB 1R4NI 2LXCA 2FCMA 3H1UA 3NZUA 1UBIA 4W9LA 4FADA 3IG3A 2AYOB 2JRHA 1GC7A 2O6VB 3DOWA 1SIFA 2D3GA 2ZJDA 1TZ1A 2DZMA 4TKNA 4WJPA 3ZTCA 2MRPA 3KYCD 2C60A 3U8ZA 3NZSA 3ALBA 2J7QB 2O2VA 2DZKA 5C1ZA 2EMTA 4EUTA 3PV1A 4A3OA 4BKSA 3K9PB 1WM2A 4DDID 2I1KA 1UBQA 3WAOA 1V6EA 2MBBB 4II2B 1IYFA 2KKCA 4W9JA 4MJSB 4IUMB 5IAAC 4MGYE 3SU8X 3VVWB 4AOFA 3AU4A 2LZ6A 4K7UA 2N7DA 4A3PA 1AARA 1SE9A 4WWPA 2FAZA 3RYTA 2LD9A 3W1SA 3BY4B 2IO0B 3SDLC 3ZNGC 3H7PA 5DCNA 1WXVA 1ZKHA 3ZKJC 4PS3A 4LJPB 3KVFB 5CHVC 3HK0A 3QAQA 4AUQC 4NJ7A 4MEMA 2XBBC 3RD2A 4F1SA 2DENB 1WXSA 2G4SA 1BT0A 1V2YA 2L0TA 2KNBA 2MP2A 2KTRA 4GDLA 3U7DA 3OJ3A 1WI0A 5LXIB 3ZNZB 3VXWA 2YVCA 3ZNHB 5LLIA 4FN2A 3QCAA 4II3B 3EHVA 1GC6A 1I35A 3VUWA 1WFYA 2RR9A 4MDKE 4PYZA 4WQOB 2NCNA 3DVGY 4ASWC 4DK5A 4WJOA 3V61A 2O2VB 5J18A 4YL8A 1LQBA 1WM3A 3N3KB 4M8MA 2J0KA 4W9IA 1OEYA 2MQJA 3JYUA 2KXJA 4W9CA 3A9KB 4FJZA 5E6OA 2NS5A 4HJKA 4KIKA 2KX3A 1YX6B 2EMSA 2LGDA 3IHPC 4EKUA 3CSTA 1EUVB 1F9JA 1KM7A 3IFWB 4B9KA 4MGZE 2DYBA 1EF5A 1XT9B 2DZIA 3H7PB 3KH0A 3L13A 5JHAA 3QK0A 2KOXA 4N9F4 4ANWA 4HDQA 3PSEB 2WX0A 5L83A 3PPAA 1D3ZA 5DPTA 3PVLA 4W9FA 3V6CB 1OGWA 1SGHA 2HTHA 1IPGA 2KLCA 1RAXA 2DZJA 2GBNA 5JH5C 3MTNB 4IM3A 2HE7A 3A4RA 3VAWA 2M0XA 3VTWA 4DBGA 4NJ6A 2G45B 4LJOB 2C9WB 2KTRB 2M4NA 2MP2B 4GDLB 1E7VA 2M17A 2OJRA 4FHKA 4CHKA 2D11A 2V1YA 3PHXB 4DHJD 4EZLA 2JVCA 3HIZA 1Z5SB 3VFKA 2KFJA 4M8NA 3QARA 2KDFB 2Z0EB 2JWZA 3PLVA 1YD8U 2PEAA 4TQ0A 4G50A 4ICVA 2KC1A 2BPSA 3CF6E 4KDLB 4KDIC 1ZW7A 1GUAB 3NY5A 4GGQA 4HPLB 3N30A 2RGFA 3R66C 1KOTA 2A5UA 1LM8B 5TR5A 3I3TB 4IM0A 4JIOU 3MHSD 4DHJB 4K7WA 3CMMB 1YIWA 4W9GA 2WX1A 4TQ1A 3X0WA 3V6EB 3RZFA 2ZCCA 2KDBA 2KX0A 4JQWC 4K81A 3PREA 2CKHB 2KWVB 1T0YA 2R2OA 2N1WA 1H4RA 3M95A 2LI5A 3UGBB 4I6NB 3RUIB 1WGGA 2LRWA 4E74A 1P1AA 3KUCB 4BBNC 4XC2A 4FHJA 2REXA 3JW0X 5JHBA 3ZDTA 2LJ5A 5BO4B 1E90A 1Q1OA 3QHTA 4BOSC 3DBHI 4J6IA 2R2QA 1WJUA 2NR2A 2IO2B 1YJ1A 3QIJA 4NPNA 3S2AA 2LUEA 3Q3FA 2DHZA 3DVNV 2C7HA 1WE6A 3WAMA 3IBEA 5D7GA 3ML9A 1WGHA 2ZNVC 3Q3JA 4GOCA 2GMIC 2IY0B 1WJNA 1RLFA 1TBEA 4HLEA 2N9XA 3W1YA 3HM6X 1OEYJ 3JVZX 5AEKB 3APFA 1J19A 2KDEB 5LXHA 4E3CA 3SD5A 1UELA 2LGYA 1CMXB 2MBEA 3UF8A 4WAAA 1Z2MA 4NQKE 3VUYA 3HM3A 1H8CA 1PQSA 1WJ4A 4W9EA 4B95A 4HVBA 2JY6A 2WYQA 2KANA 4MSMB 2KMCA 1Q5WB 1OQYA 3N32A 3PRZA 3R7QA 2BGFA 4IWQA 2K8HA 5E6PA 3IVFA 2ZPYA 3VTVA 3SHQA 3R3MA 4URKA 4G3XB 4HXDA 1Y8RC 2NBVB 1S1QB 1W6VA 2MBOA 1EO6A 2FIFA 2RPQA 2L0FA 5KHQA 2CS4A 2FCSA 4BKGA 1WZ0A 2WWZA 3W1SC 2V3SA 2BKFA 3A1QA 1J8CA 4ICUA 4GSWA 2DAJA 1WX8A 4TUUA 2IO3B 1J0GA 3DQVA 2LXAA 1E8ZA 2C7MB 3PLUA 2B3AA 1E5WA 2LGXA 4MM3A 4GXBA 4NAWA 3UINB 1JRUA 4E71A 5AZHA 3KYDD 3PS6A 5AZFA 2MCNB 3UQBA 3WA0A 5EDSA 2KZRA 2JUOA 3NOBA 3PZDA 1V81A 3ZNID 3LMNA 2BF8B 2ZVOA 2PPHA 5D6JB 1Q0WB 1RRBA 2MBQA 5C23A 2LRUA 4DHZE 4JGHB 2HJ8A 4DHZB 2GBKA 1UD7A 2MLBA 2FCNA 4W9HA 3V62A 2VRRB 1LFDA 4EFOA 1WMHA 4A20A 3WAPA 4XX5A 3LJ3A 3VTUA 1WR6E 2D07B 3A4SC 1HE8A 1NI2A 1TTNA 2KJ6A 4FJVB 2V4LA 4AJWA 4RM8A 3RZWC 2GOWA 4WWNA 2NPTA 3VDZA 4F8CB 2IO1B 2PJHA 3VH3B 3ECIA 2NBWB 3MJWA 3TIXA 4EEWA 1WGDA 2PE9A 2Z0DB 2ZZPB 5CX3A 4EZKA 4NNJB 1WJ6A 1R4MI 3A1QB 4HWIB 3WALA 4F7ZA 2XK5A 2KTFA 3X23A 2GBRA 2KDIA 1LXDA 1S3SG 2ZPNA 3UIPB 3A9JA 1E8YA 4AJYB 3UIOB 3BINA 2KWCA 4WWOA 1V5OA 3DPDA 4NAWB 4FJYA 2KFKA 2N1VA 4HK2A 5L95C 2KN5A 3L08A 3PGEA 1C3TA 2LASA 4IC7B 4IG7B 3WIMA 2L8JA 1C1YB 4IW0A 2KWUB 2JZZA 2D2QA 4KIKB 4XZ4A 2G3QB 2WDTB 3P2BA 4ZRJA 3AULA 3ZLZA 4FULA 2Z59B 4TV3A 2FNJB 1L7YA 2L00B 3H7SA 4GMVA 5CHFA 5J17A 1M94A 3TJPA 3GZNI 4ANXA 1EF1A 1P0RA 4M0WB 1WGRA 2DAFA 3A33B 2N9EB 2ZVNA 2K6QA 1WMHB 3L0WB 1V9JA 2KQ7A 4PYUA 2HD5B 3RT3B 2AL6A 3ZDMC 2BYFA 3DCGA 4MGKE 1E8WA 5KHOA 4WJNA 1IP9A 2KC2A 1RFAA 2NPTB 1QZEA 3PRMB 4WJQA 4BKTA 2L05A 3ZRCA 2AEHA 1V80A 2O6VD 2RSUA 1WXMA 3K9OB 2QHOA 1UZXB 4BBNF 3AU5A 3APCA 2AL3A 2C7NB 1WYWB 3QC8B 3T9LA 2N4FA 2XK5B 4CO7A 2MX2A 3C0RB 4KVGB 1ZGUB 1GJZA 5DPRA 3VH4B 3A9JB 4LDTD 3ZW3A 3HHMA 4AP4C 2K6DB 1UGMA 2KQSA 2LVOA 2UWQA 3ENEA 2KFKB 3QWZB 4KZCA 4OVUA 4FA6A 1WXAA 4K7SA 4GDKA 2BYEA
chains in the Genus database with same CATH superfamily
4XDDA 2KK8A 3QX1A 4HCNB 4TMAB 3Q8EA 2ON8A 4ANUA 1WWTA 1A70A 2K8CA 1G6JA 1P7FA 3AEFB 2WXOA 4I6PA 3A9KA 2OOBB 3RNGC 3T3OA 1WF9A 1SJHD 2EKIA 4JWSC 1I4HA 1KH0A 1WH3A 4KZ0A 4DXAB 2KD0A 1FFVA 1K52A 1UUPA 1GB1A 4HKQA 2A4ZA 1ZP0B 4ZRIA 1K8RB 4GDKB 3KQ4A 3DBLI 3DBRI 3ABVB 3RI7C 1N63A 2ZCBA 2Y5BB 1WX9A 2KMMA 1WGYA 3UQAA 2BYVE 4EE2A 1FM0D 3AI5A 1I4RA 1JRPA 4HPPA 5HHDG 1YQBA 4YSZB 2J42A 4PT5A 3PT2B 4KX6B 1KTKA 4LNIA 3EUB2 2WXQA 1MHHE 3ZRFA 1TS2A 4ZYNA 5IN7A 5BMIA 2BWES 4X57B 2KJRA 2BS2B 2DNFA 4KSLC 4LK0M 1C78A 4AQ7A 4GN1A 2KMAA 5EE3A 1ENFA 2GBMA 3TEYA 2MWSB 3Q14C 1V97A 1XEEA 3M3JA 2CU3A 3U30A 3PHWB 5C3JB 5TSSA 3ZO5B 3BIID 2M8SA 4MJSA 1WSPA 3LB8C 2MSED 3ZUNA 3NVWA 2N9PC 3ONSA 3QQ8B 3SR6A 3DBRB 4CYEA 4ZYSA 1FRDA 2K39A 3APDA 1YOVB 2INNE 1SE4A 1ISNA 2G4DB 3SFEB 1T3QA 3NVVA 5D3DA 2KLGA 1VCBA 2LXCA 3NZUA 2WU2B 2WXFA 4W9LA 4FADA 2IGHA 2O6VB 2DBYA 2D3AA 2ZJDA 1TZ1A 1N62A 4WJPA 3BVMA 4USAA 3ALBA 2O2VA 2EMTA 2BTEA 3PV1A 2J4XA 1WM2A 4DDID 1V6EA 3IAM1 4W9JA 3N20C 5IAAC 4MGYE 3SU8X 2LZ6A 1J7BA 1SE9A 2LD9A 3SDLC 5DCNA 1WXVA 4KKJA 3ZKJC 4A9AA 1NENB 5CHVC 3QAQA 4C4VA 4MEMA 1EWCA 3B2GA 2SAKA 1WXSA 3DWMA 1K50A 1CQVA 2PKOA 5LXIB 1WI0A 3VXWA 3URYA 3SEBA 1GC6A 3W2DA 3RN9C 4JE3B 3VR8B 2RR9A 1I4PA 3V61A 5J18A 4YL8A 3N3KB 4H2AA 1N5WA 2QSDA 4C56C 5D3IB 1L0VB 3A9KB 4FJZA 2FE8A 2KX3A 2EMSA 1L6VA 2LGDA 4XDCA 2DYBA 1XT9B 3KH0A 3L13A 1F2RC 2KOXA 4N9F4 4HDQA 2H88B 2HTHA 3VR9B 1AN8A 1RAXA 2DZJA 4IM3A 5LNK1 1YJIA 4DBGA 3BZDB 3DHIC 2M17A 3GB1A 1T0RC 4DHJD 3AE9B 2IPKD 3BK2A 3QARA 4GLSC 3AMZA 4G50A 4ICVA 4KDLB 1V1PA 3PO0A 2IGGA 2RGFA 5TR5A 2YEPF 3I3TB 2PMVA 4IM0A 4RGTA 3SFDB 3CMMB 1NYRA 1YN4A 3N1XC 2QMTA 4TQ1A 1PFDA 2KDBA 2Q5WD 4K81A 5BYRA 2QDFA 3M95A 1H4RA 1FIQA 3R8BA 4E74A 1P1AA 4XC2A 4FHJA 3AH7A 2ONQA 4O1NA 4J6IA 1T0SC 2DHZA 1WE6A 4GOCA 2GMIC 1HTOA 1WJNA 1TBEA 4HLEA 2N9XA 3W1YA 4L2YA 4YWGG 3FILB 5AEKB 1E0ZA 4YSYB 1UELA 2KDMA 2MBEA 4WAAA 1NI3A 1Z2MA 1PQSA 2KANA 1Q5WB 1OQYA 3VTVA 4HJGE 4IWQA 2GI9A 2W55A 3SHQA 2WXNA 3R3MA 4URKA 4G3XB 4HXDA 2NBVB 1S1QB 2FCSA 3U52E 4BKGA 1V1OA 1WZ0A 4HRSA 3A1QA 1J8CA 1E10A 1WRIA 1WX8A 4TUUA 1DOYA 1E8ZA 2RDBC 2C7MB 3PLUA 2B3AA 1E5WA 3UINB 2BB5A 3PS6A 3KWLA 5FK9C 3AE4B 1C9FA 2JUOA 3NOBA 2BF8B 2BS3B 2WDVB 4XWTA 4A8XC 4ZOHC 1R4NB 4DXFA 4DHZE 4DHZB 2HJ8A 2GBKA 3AB5A 3V62A 2VRRB 1LFDA 1WMHA 4A20A 4XX5A 3LJ3A 4B0MA 1TTNA 4RM8A 3RZWC 2GOWA 4F8CB 2NBWB 3MJWA 3NS1A 3TIXA 4EEWA 2N9KA 1XCTL 4EZKA 1R4MI 4F7ZA 2XK5A 2KDIA 1S3SG 2ZPNA 2V0GA 3KWVA 3A9JA 4AJYB 1M4VA 3VRBB 4WWOA 1V5OA 2BW2A 2WXPA 3W5UB 2KN5A 1F0ZA 3NZ3A 2D2QA 3P2BA 4AS1A 4OW0A 2ICIA 4TV3A 2L00B 3MJ5A 3Q3MC 2L1AA 2N9EB 4MACA 2IJ0A 3FAHA 3U4EG 1ZXIA 1B1ZA 1OFFA 1IP9A 3PRMB 4BZAA 3ZRCA 2AEHA 1V80A 3K9OB 3QC8B 2LFIA 1C4PA 3U2SC 5DPRA 1OQQA 3AE2B 2K6DB 1KFYB 3ENEA 4KZCA 1VZ7A 4OVUA 2KFKB 5H8YE 1WXQA 4K7SA 5HFYA 4GDKA 2JZPA 1T5XD 2E6XA 3P4SB 5AZGA 2FCQA 3EECA 4GIVA 4FLHA 5E6NA 1R4MB 4LDTB 1ZDXA 5DPWA 3AE5B 1TIFA 4NY0A 2CHXA 3U7ZA 1F77A 2GBJA 4WWMA 3DBSA 1QKZA 1DOXA 2CHWA 4ACFA 1ZOYB 4EOYA 1XD3B 4HCPB 5JZEB 2JXXA 4UDUC 2LVQA 4DWFA 4ANVA 5CTRC 3AE6B 2D5GA 1MI0A 4BFRA 2CR5A 4RGNA 1YX5B 1FO4A 2W54A 2J52A 1YQ3B 3TEZA 4NQLB 2PVGC 4DQOC 1I42A 4XE0A 2PE6B 2Y3AA 2M56B 4G11A 1JROA 1RYJA 3O65B 1DGJA 3DDCB 1NDDA 1QOFA 1SSNA 1ZUD2 3ZIMA 3M62B 3OJ4B 4JPSA 4C7ZA 1XXGA 3L16A 4MH0E 4WURA 2JWUA 1YN3A 3JSVB 2Y5CA 1ACCA 5DPSA 3OAWA 2YLMA 2W3SA 3B0AA 1V86A 4GU2A 1P98A 2KQ4X 3EC8A 5G2NA 5IOIA 1WR1A 2EKEC 3B1LX 3PRPB 2IBIB 2JRIB 2O6VA 2XEWA 1X1MA 2K1FA 2BVCA 2QEJC 5MPOA 4MGIE 4YTMB 1EWYC 1E7PB 4MELA 5GMVA 2AWTA 2G1EA 2ZEQA 5FR6A 4B6WA 1KJTA 3ML8A 1L2NA 4BAXA 1HEZE 3LXFA 2C5LC 3IAS1 1MPEA 2DLBA 1P9DU 1UH6A 3TL5A 3TMPB 1QILA 2BWFA 4YT0B 2HTME 3NHEB 2DYMA 3H1UA 1TGZB 1UBIA 2K3UA 3MFGA 4K3CA 3DOWA 4ZHPA 4TKNA 2DZMA 3EGRA 3ZTCA 1MVKA 2C60A 2DZKA 5C1ZA 4EUTA 1RM6C 4BKSA 3WAOA 2LHEA 2KKCA 1FXAA 3VVWB 3UI3A 2K22A 2BYTA 2N7DA 1AARA 4WWPA 1BUIC 2OHFA 3TEWA 3ZNGC 4PS3A 3HK0A 1VDVA 1IUEA 1HXYD 3MHZA 2DENB 1ET9A 2QJLA 1UWMA 2G4SA 1TYGB 1WGKA 1BT0A 2BBCA 2KNBA 2HJ1A 3OJ3A 2IDYA 5C2TB 5LLIA 4II3B 1DOIA 2WLBA 1WFYA 2NCNA 3DVGY 1F2RI 2RDGA 4DK5A 2L83A 2RMMA 2ZW1A 4W9IA 1OEYA 2INPE 5IKCM 5T8IA 2KXJA 5E6JA 5E6OA 1D5MC 2NS5A 4LNKA 3CSTA 4YTPB 4MGZE 1XLPA 1EF5A 3FC4A 3H7PB 5JHAA 1EU4A 2W3RA 2H89B 1I7HA 3NVZA 3PSEB 2WX0A 1D3ZA 1L0XB 4W9FA 1CJEA 3V6CB 3MTNB 2HE7A 2C9WB 2KTRB 2M4NA 2MP2B 2OJRA 3PHXB 3HIZA 3AEGB 2KYWA 2INDC 1QOBA 1HQRD 3RNEC 3IT6B 3ZXVA 2BPSA 2IGDA 3FILA 4RGMA 3NY5A 1LM8B 4WH4A 3RNBC 4JIOU 3DBLB 1FMAD 4DHJB 1YIWA 1XLNA 4L23A 2LHDA 3RZFA 1I4QA 2KX0A 1UNSA 2CKHB 2KWVB 5I4DA 2R2OA 2N1WA 3KUCB 3ZJTA 5FR3A 3ZDTA 5BO4B 1WJUA 3QIJA 1YJ1A 2LUEA 3Q3FA 3DVNV 3ML9A 3Q3JA 2G9HD 1RLFA 2LEKA 2EELA 2INCC 3HM6X 2AQ3B 3JVZX 3APFA 3IXSA 3SD5A 2LGYA 1CMXB 3MC8A 3N1YC 4NQKE 3VUYA 2WDQB 1H8CA 4MSMB 3Q2AC 1F52A 3IVFA 2GRIA 1MHXA 4LNFA 2MH7A 1PUTA 1Y8RC 1W6VA 1EO6A 2DWQA 2FIFA 2L0FA 2RPQA 5EE1A 2KT7A 2VZKB 4OZAA 3BVZA 1P7EA 1VJKA 4NJCA 1PGAA 2BKFA 2TSSA 2V3SA 4LNOA 1J0GA 3DQVA 2LXAA 2LGXA 3FKYA 1JRUA 5AZHA 4RGOS 3KYDD 5EDSA 2KZRA 3LMNA 2PPHA 4A90A 3AEEB 4KGRA 2KAJA 4ZHOA 1UD7A 2Y5PA 1UF0A 1MG4A 4W9HA 4IDIA 4EFOA 3V3XA 3WAPA 4RFBA 2E3TA 1NI2A 2KJ6A 1JCKB 3EFCA 2QC8A 4WWNA 3VDZA 3VH3B 3ZYYX 2MJ3A 2WXLA 3ECIA 3AE1B 1IBXB 2ZZPB 2X38A 3WALA 3UIPB 2MHJA 3UIOB 2KFKA 2N1VA 5L95C 4OZCA 3PGEA 3PZ8A 4IC7B 1C1YB 4IW0A 2JZZA 4XZ4A 2G3QB 1QLBB 3ZLZA 1FEHA 5CHFA 3H7SA 1QQRA 1M94A 3GZNI 4M0WB 1VZ8A 1WGRA 1IGDA 1GB4A 2BYFA 4MGKE 1E8WA 1TZOA 5KHOA 3DWGC 5GXGB 4PK1A 2KC2A 1QZEA 2WP9B 1XLOA 2O6VD 1L0YB 2RSUA 1WXMA 4BBNF 1UZXB 1D6EC 3AU5A 2AL3A 3T9LA 2N4FA 2WNMA 1GJZA 3TSSA 2JYTA 4C80A 3HHMA 2Z8LA 3QWZB 4FA6A 4B0EA 3PLVA 2JZ3B 1TT5B 2LVPA 4AWJA 1FNUA 5D2MB 1YQ4B 2BKRB 3L17A 3T8MA 3NJTA 1J7AA 3AEBB 4N58A 5EE9A 5AUKA 2W82A 2WXHA 1WYGA 3KUZA 4ZRKA 1KF6B 3L4PA 1J7CA 2BQQA 2W9NA 3JSVA 3Q69A 2RPVA 1KLGD 2IYDB 2IY1B 3KW5B 1U4AA 5G5HA 3TUOA 4BKSD 1I4XA 4W9KA 3GZNB 1SXTA 2IZVB 3LDZE 4P1BC 2ZNVB 4FBJB 1CK1A 3GOEA 1KLUD 1UGJA 2DX5B 3DVGX 2L3ZA 2GB1A 2WS3B 3AE7B 2L32A 3RFZB 2KO3A 4J3OD 2NTSA 1E7UA 4HPMB 2ASQA 3W9CB 4ZDVA 1JQ4A 3OWEB 4MSQB 2DYOA 4P1CC 2N7JA 3VQIA 1SBBB 1A5RA 2RD0A 3DVNU 4JWUC 1KLVA 3L54A 1UWXA 1WX7A 3CIRB 4RM9A 2N7EA 3RCZA 1E8XA 4PS7A 2CHZA 4RMAA 3ZTDA 1ZE3D 1ZDVA 4JLCA 2PW9A 2VH1A 1B9RA 3V60A 2I2YA 5J2RA 1L4ZB 2MW5A 3I5JC 4MT5A 1LGRA 2MBHA 1WIAA 2LMCA 3HUIA 2CU1A 4US9A 4ARCA 1V8CA 3BVGA 4L1BA 1NBFC 1AW7A 1ESFA 4NZLB 3NG0A 3L10B 2JT4B 2XNAC 4IWOA 2L76A 3VRAB 4BVUC 4I6LB 2FUHB 3I9V1 1TKYA 2PTLA 2AQ1B 2NVUI 4NAMA 1D4BA 3R7RA 2JF5A 1WZ3A 4QAYA 1JALA 1QF6A 3IG3A 2AYOB 2JRHA 1GC7A 5FKAC 3RNFC 2MRPA 3KYCD 3U8ZA 3NZSA 1QOGA 1MJDA 2PIAA 3K9PB 2JXTA 2MBBB 5BYSA 2MJDA 1JWMD 4KGTA 4AOFA 3Q8AA 5BYQA 3BY4B 2IO0B 3H7PA 4NJ7A 3IT4B 4D2KA 2MP2A 2KTRA 3U7DA 3ZNZB 3ZNHB 2YVCA 3QCAA 3EHVA 1YNTE 3ZGZA 1I35A 2CJOA 4P6VF 4MDKE 4PYZA 4WQOB 1AYFA 3V05A 1SE3A 4WQMA 4WJOA 5JXVA 2RDHA 1WM3A 2J0KA 1JWUD 3PZ7A 3JYUA 1C4AA 4LNNA 2JQRB 4TSSA 4EKUA 1EUVB 1F9JA 4B9KA 1PDXA 2DZIA 4HEA1 1JMLA 1D5ZC 3QK0A 2BS4B 1FRRA 5L83A 3PPAA 1OGWA 1IPGA 5JH5C 2GBNA 2N9LA 1FNVA 4C00A 2M0XA 4WAFA 1TKGA 4LJOB 4NJ6A 2KN4A 4GDLB 1E7VA 4CHKA 1SF0A 2JVCA 2JYEA 1N61A 2WXIA 3Q8CA 1HZ5A 3VFKA 2KFJA 2WXGA 2KDFB 2Z0EB 1YD8U 2PEAA 4TQ0A 2KC1A 1R7SA 1AWDA 3Q8BA 1ZW7A 1FD6A 1JWBD 4GGQA 4HPLB 3N30A 2WXKA 4LTUA 1KOTA 1FPYA 2KWDA 2AX5A 1E9MA 2V3NA 1XLQA 2K9XA 3MHSD 4A55A 4W9GA 2WX1A 3X0WA 2UU7A 2ZCCA 2OEDA 2QCZA 4JQWC 1PGXA 3PREA 5BMHA 1T0YA 3UGBB 4I6NB 3RUIB 1SJED 2GLSA 1IGCA 3JW0X 2ZW0A 3E56A 2LJ5A 1Q1OA 3QHTA 4P16A 3HRDD 4BOSC 3DBHI 1E6EB 2R2QA 1K53A 3S2AA 3Q3OC 1JWAD 1WGHA 1OEYJ 3DHHC 2KDEB 5LXHA 4E3CA 3HVZA 1NVID 3HM3A 1TY2A 1WJ4A 3B9JA 4B95A 4HVBA 3N32A 3PRZA 3R7QA 3TEXA 4A6QA 3AV8A 2MBOA 4OHJA 5KHQA 3GE3C 1IBXA 2WWZA 3W1SC 4IKGA 4ICUA 4GSWA 1L5PA 2IO3B 1NEKB 3H8HA 2JX5A 4E71A 2M0AA 4YXDB 5AZFA 3UQBA 5BMGA 4N59A 1V81A 4C7YA 5D6JB 1Q0WB 3Q6BA 1RRBA 5C23A 2LRUA 4R3DA 4JGHB 4M0WA 1C79A 1TS3A 1QOAA 2FBWB 3DBHB 4M02A 1HE8A 4AJWA 2IO1B 1WGDA 2PE9A 2Z0DB 5CX3A 4NNJB 2X8XX 3N9YC 1WJ6A 4HWIB 3LYYA 2KTFA 4KGSA 3X23A 2GBRA 2FUG1 3ZJUA 1E8YA 3BINA 2BB6A 1VZ6A 2KWCA 1ET6A 4MM3B 3DPDA 4NAWB 1C3TA 2L8JA 2NMQA 2KWUB 2WXJA 2WDTB 3HVDA 2B76B 4FULA 2Z59B 3MP9A 1L7YA 5J17A 1ZPSA 3TJPA 1EF1A 1I4GA 3BK1A 3L0WB 1V9JA 3RT3B 2HD5B 1NYQA 3Q3NC 3DCGA 4RF1A 1T6BX 4LLGM 4BKTA 2NPTB 2I38A 4JX1C 4XWWA 2L05A 2J53A 2QHOA 3APCA 2MX2A 4KVGB 1ZGUB 3ZW3A 4FXCA 2UWQA 1WXAA 2BYEA 1STEA 5HKHA 1GG3A 1DYQA 4XYCA 4W9DA 4EZJA 2K25A 4K1RB 1P3QU 2FIDA 2D3BA 1MG8A 3WANA 1V49A 2D10A 2V9HA 4REZA 1JW9D 3B08A 4KKIA 4KSKC 3H9DA 3RMKC 3AEAB 3WCQA 4RF0A 2KHWB 3P1MA 1V5TA 2JU6X 3KUDB 3D32A 4GB9A 5G5GA 5G55A 2ACZB 3RPFC 3VHTC 2LWPA 3OG5A 3R2TA 1OTRB 1FXIA 5CHWA 3M63B 3P42A 2QILA 1WE7A 1BMLC 3BWUD 2KJHB 4BOZB 1QT9A 2SEBD 4JL9A 4KV2A 3R2IA 2QIEB 1N60A 4XGAB 1XQQA 3PTFC 3ZQ4A 1Y56A 2WGSA 3KLSX 2JPHA 2WU5B 4PS8A 3AXCA 4RNAA 3T3NA 1ZXHA 1FCLA 2J0JA 3QA8A 4IWPA 4P7IA 3OLMD 2K8BA 2I1JA 3H6NA 1K51A 1PGBA 2WHIA 1GPXA 1WY8A 2M1MA 2NBUA 3QJZA 1GNUA 1XO3A 2J0MA 3I63C 4HKZE 4YTNB 4M01A 3CSFA 4G0NB 4RCOA 3EFUA 3RULA 3P4PB 2NTTA 3BYTB 3NS8A 1SEBD 2UYZB 2LUMA 3VUXA 2N0SB 4LCDE 3RNCC 2M19A 2L7RA 5IA7A 3C8YA 3GS2A 3TBLD 4OVVA 2LJIA 3MC9A 4HDOA 4DDGD 4IM2A 5D94A 1WRDB 2MA9B 2KVRA 1FXTB 2V3PA 3ZVVA 1ROEA 3TCAA 1VD2A 1R4NI 2FCMA 3P4RB 1C77A 3AEDB 3W5VB 1SIFA 2D3GA 5AUIA 2L52A 2J7QB 1JWSD 1SIJA 1VR9A 4A3OA 1TKEA 2I1KA 1UBQA 4II2B 1IYFA 1GOZA 5H92C 4MJSB 4IUMB 2VZKD 4K3BA 3AU4A 4K7UA 4IOIE 3P4QB 4A3PA 2YEPB 2FAZA 3RYTA 3W1SA 1ZKHA 4LJPB 3KVFB 2V4IB 1C76A 4Q2JA 4AUQC 1HTQA 1TY0A 2XBBC 3RD2A 4F1SA 1V2YA 2L0TA 4GDLA 1SB3C 1FCCC 4FN2A 3VUWA 3P63A 4ASWC 2O2VB 1LQBA 4M8MA 2MQJA 4W9CA 1N6ZA 4HJKA 4KIKA 1YX6B 4OVZA 3IHPC 1KM7A 3IFWB 2WDRB 2WQYB 3I57A 4HROA 4ANWA 4C4VB 1XF5L 5DPTA 3PVLA 1SGHA 1SE2A 2BT6A 2KLCA 3A4RA 2LGSA 2K5PA 3VAWA 3VTWA 2G45B 2PLPA 4FHKA 2D11A 2V1YA 4EZLA 3AE3B 3J9CA 1VRAB 1Z5SB 5HI1A 4M8NA 4S17A 2JWZA 4ITKA 1C4CA 3BYYB 3CF6E 4KDIC 1T0QC 1GUAB 4M00A 3ETRA 1D5XC 3R66C 2XN9C 2A5UA 4K7WA 3NVYA 1MFWA 4ARIA 3Q8FA 3GP7A 3V6EB 1F1HA 2LI5A 1PYWD 1WGGA 1GAQB 2LRWA 4BBNC 2REXA 4WIPA 5JHBA 1XCQL 1E90A 2NR2A 2IO2B 1HA5A 3MC0B 1EU3A 4NPNA 3WAMA 2C7HA 2R61A 3AN1A 4S0RA 3IBEA 5D7GA 2ZNVC 2CJNA 1L6UA 2IY0B 2K0PA 3ZJVA 1V1PB 1J19A 4ZRPA 1HZ6A 2OJWA 3UF8A 4N6EB 2AQ2B 1L4DB 4W9EA 2JY6A 2WYQA 2KMCA 2BGFA 2K8HA 5E6PA 2ZPYA 1RWSA 1YJJA 2KVZA 2CS4A 1LO5D 1YMHE 5EE0A 1FFUA 1Q10A 2DAJA 3O13A 1TJEA 2LGIA 3E9SA 5IO9A 4DXGA 4MM3A 4NAWA 4GXBA 3AECB 2MCNB 3ZXRA 3B2FA 1FNWA 1CZPA 3WA0A 3PZDA 3ZNID 2ZVOA 2MBQA 1YN5A 2MLBA 2FCNA 1TS5A 3AE8B 2PVOD 3RNAC 1TS4A 5HG2A 3VTUA 1WR6E 2KACA 2D07B 1KRHA 3A4SC 4FJVB 2V4LA 4OZBA 4MH8A 2NPTA 2PJHA 5IP4D 3A1QB 1VLBA 1LXDA 3C19A 4US8A 4FJYA 3NRZA 4HK2A 3L08A 3GE8C 2LASA 3NUHB 4IG7B 4ZRQA 3WIMA 4KIKB 4CQNA 1N5XA 4ZRJA 3AULA 1EM7A 2FNJB 4GMVA 2MEKA 2D3CA 4ANXA 1P0RA 1RFKA 2DAFA 3A33B 2VH2A 2ZVNA 2K6QA 1WMHB 2KQ7A 2JSVX 4PYUA 3N1ZC 2AL6A 3ZDMC 1BXTA 4WJNA 1RFAA 4WJQA 3DHGC 2WXRA 3EA6A 2C7NB 1WYWB 2XK5B 4YSXB 4CO7A 3C0RB 3VH4B 3A9JB 1OQRA 3CWIA 4LDTD 2HDEA 4AP4C 2MJEA 1UGMA 2KQSA 2LVOA 4RH6A 2WXMA 3AM9A
chains in the Genus database with same CATH topology
5HKHA 1GG3A 2JZ3B 2KK8A 4W9DA 3QX1A 4EZJA 5AZGA 2K25A 4HCNB 4K1RB 2LVPA 1P3QU 2FIDA 4AWJA 2FCQA 5D2MB 3EECA 4GIVA 4FLHA 3L17A 2BKRB 4ANUA 5E6NA 3T8MA 1MG8A 2K8CA 4LDTB 3WANA 1G6JA 1V49A 2D10A 4I6PA 5DPWA 3B08A 3A9KA 2OOBB 3H9DA 3KUZA 4KSKC 4ZRKA 1WF9A 4NY0A 2CHXA 2GBJA 2KHWB 2W9NA 3DBSA 1WH3A 3JSVA 2CHWA 4KZ0A 1V5TA 4DXAB 2KD0A 3KUDB 1XD3B 3D32A 4HCPB 2IYDB 4EOYA 2IY1B 5JZEB 3KW5B 2JXXA 2LVQA 1U4AA 4GB9A 5G55A 4DWFA 4ANVA 5CTRC 2A4ZA 4BFRA 4BKSD 4W9KA 2CR5A 3VHTC 2LWPA 2IZVB 1YX5B 3LDZE 4ZRIA 1K8RB 2ZNVB 4FBJB 3GOEA 4GDKB 3DBLI 3DBRI 2DX5B 3DVGX 1OTRB 2ZCBA 5CHWA 3M63B 2L3ZA 2Y5BB 1WX9A 1WE7A 1WGYA 4NQLB 3UQAA 2BYVE 2KO3A 1I42A 3AI5A 2PE6B 1E7UA 2KJHB 2ASQA 4HPMB 1YQBA 4G11A 4ZDVA 3O65B 3PT2B 3DDCB 4MSQB 1NDDA 4BOZB 2DYOA 4JL9A 4KV2A 3VQIA 3ZRFA 1XQQA 4ZYNA 3ZIMA 3M62B 3PTFC 1A5RA 2RD0A 3OJ4B 3DVNU 1KLVA 2JPHA 3L16A 3L54A 1WX7A 4MH0E 2BWES 4RM9A 3JSVB 4X57B 2KJRA 2N7EA 3RCZA 4PS8A 3AXCA 4KSLC 5DPSA 1E8XA 3OAWA 2CHZA 4PS7A 4GN1A 4RMAA 3ZTDA 2YLMA 2KMAA 2J0JA 3QA8A 4IWPA 4P7IA 3OLMD 2GBMA 3B0AA 2MWSB 4JLCA 1V86A 4GU2A 1P98A 2I1JA 2K8BA 3H6NA 3EC8A 3V60A 5J2RA 3M3JA 2MW5A 1WY8A 5G2NA 2M1MA 1WR1A 2EKEC 3B1LX 2NBUA 3PRPB 2IBIB 2JRIB 2O6VA 2XEWA 3QJZA 1GNUA 2J0MA 2MBHA 1X1MA 2K1FA 3PHWB 1WIAA 3U30A 2CU1A 3CSFA 4G0NB 3EFUA 3RULA 3NS8A 4MGIE 2UYZB 3ZO5B 1NBFC 4MELA 3VUXA 4LCDE 2M8SA 5GMVA 4MJSA 2AWTA 2ZEQA 5FR6A 4B6WA 2L7RA 1KJTA 3L10B 3ML8A 2MSED 3ZUNA 2JT4B 1L2NA 2N9PC 3ONSA 4IWOA 3QQ8B 5IA7A 2L76A 3TBLD 4BVUC 4I6LB 2C5LC 4OVVA 2FUHB 4CYEA 4HDOA 4DDGD 4IM2A 2K39A 3APDA 1P9DU 1UH6A 1WRDB 5D94A 3TL5A 2MA9B 1ISNA 2G4DB 1FXTB 2KVRA 3TMPB 2BWFA 2NVUI 3ZVVA 3R7RA 3NHEB 2JF5A 2DYMA 1WZ3A 3TCAA 1VD2A 2KLGA 1VCBA 1TGZB 1R4NI 2LXCA 2FCMA 3H1UA 3NZUA 1UBIA 4W9LA 4FADA 3IG3A 2AYOB 2JRHA 1GC7A 2O6VB 3DOWA 1SIFA 2D3GA 2ZJDA 1TZ1A 2DZMA 4TKNA 4WJPA 3ZTCA 2MRPA 3KYCD 2C60A 3U8ZA 3NZSA 3ALBA 2J7QB 2O2VA 2DZKA 5C1ZA 2EMTA 4EUTA 3PV1A 4A3OA 4BKSA 3K9PB 1WM2A 4DDID 2I1KA 1UBQA 3WAOA 1V6EA 2MBBB 4II2B 1IYFA 2KKCA 4W9JA 4MJSB 4IUMB 5IAAC 4MGYE 3SU8X 3VVWB 4AOFA 3AU4A 2LZ6A 4K7UA 2N7DA 4A3PA 1AARA 1SE9A 4WWPA 2FAZA 3RYTA 2LD9A 3W1SA 3BY4B 2IO0B 3SDLC 3ZNGC 3H7PA 5DCNA 1WXVA 1ZKHA 3ZKJC 4PS3A 4LJPB 3KVFB 5CHVC 3HK0A 3QAQA 4AUQC 4NJ7A 4MEMA 2XBBC 3RD2A 4F1SA 2DENB 1WXSA 2G4SA 1BT0A 1V2YA 2L0TA 2KNBA 2MP2A 2KTRA 4GDLA 3U7DA 3OJ3A 1WI0A 5LXIB 3ZNZB 3VXWA 2YVCA 3ZNHB 5LLIA 4FN2A 3QCAA 4II3B 3EHVA 1GC6A 1I35A 3VUWA 1WFYA 2RR9A 4MDKE 4PYZA 4WQOB 2NCNA 3DVGY 4ASWC 4DK5A 4WJOA 3V61A 2O2VB 5J18A 4YL8A 1LQBA 1WM3A 3N3KB 4M8MA 2J0KA 4W9IA 1OEYA 2MQJA 3JYUA 2KXJA 4W9CA 3A9KB 4FJZA 5E6OA 2NS5A 4HJKA 4KIKA 2KX3A 1YX6B 2EMSA 2LGDA 3IHPC 4EKUA 3CSTA 1EUVB 1F9JA 1KM7A 3IFWB 4B9KA 4MGZE 2DYBA 1EF5A 1XT9B 2DZIA 3H7PB 3KH0A 3L13A 5JHAA 3QK0A 2KOXA 4N9F4 4ANWA 4HDQA 3PSEB 2WX0A 5L83A 3PPAA 1D3ZA 5DPTA 3PVLA 4W9FA 3V6CB 1OGWA 1SGHA 2HTHA 1IPGA 2KLCA 1RAXA 2DZJA 2GBNA 5JH5C 3MTNB 4IM3A 2HE7A 3A4RA 3VAWA 2M0XA 3VTWA 4DBGA 4NJ6A 2G45B 4LJOB 2C9WB 2KTRB 2M4NA 2MP2B 4GDLB 1E7VA 2M17A 2OJRA 4FHKA 4CHKA 2D11A 2V1YA 3PHXB 4DHJD 4EZLA 2JVCA 3HIZA 1Z5SB 3VFKA 2KFJA 4M8NA 3QARA 2KDFB 2Z0EB 2JWZA 3PLVA 1YD8U 2PEAA 4TQ0A 4G50A 4ICVA 2KC1A 2BPSA 3CF6E 4KDLB 4KDIC 1ZW7A 1GUAB 3NY5A 4GGQA 4HPLB 3N30A 2RGFA 3R66C 1KOTA 2A5UA 1LM8B 5TR5A 3I3TB 4IM0A 4JIOU 3MHSD 4DHJB 4K7WA 3CMMB 1YIWA 4W9GA 2WX1A 4TQ1A 3X0WA 3V6EB 3RZFA 2ZCCA 2KDBA 2KX0A 4JQWC 4K81A 3PREA 2CKHB 2KWVB 1T0YA 2R2OA 2N1WA 1H4RA 3M95A 2LI5A 3UGBB 4I6NB 3RUIB 1WGGA 2LRWA 4E74A 1P1AA 3KUCB 4BBNC 4XC2A 4FHJA 2REXA 3JW0X 5JHBA 3ZDTA 2LJ5A 5BO4B 1E90A 1Q1OA 3QHTA 4BOSC 3DBHI 4J6IA 2R2QA 1WJUA 2NR2A 2IO2B 1YJ1A 3QIJA 4NPNA 3S2AA 2LUEA 3Q3FA 2DHZA 3DVNV 2C7HA 1WE6A 3WAMA 3IBEA 5D7GA 3ML9A 1WGHA 2ZNVC 3Q3JA 4GOCA 2GMIC 2IY0B 1WJNA 1RLFA 1TBEA 4HLEA 2N9XA 3W1YA 3HM6X 1OEYJ 3JVZX 5AEKB 3APFA 1J19A 2KDEB 5LXHA 4E3CA 3SD5A 1UELA 2LGYA 1CMXB 2MBEA 3UF8A 4WAAA 1Z2MA 4NQKE 3VUYA 3HM3A 1H8CA 1PQSA 1WJ4A 4W9EA 4B95A 4HVBA 2JY6A 2WYQA 2KANA 4MSMB 2KMCA 1Q5WB 1OQYA 3N32A 3PRZA 3R7QA 2BGFA 4IWQA 2K8HA 5E6PA 3IVFA 2ZPYA 3VTVA 3SHQA 3R3MA 4URKA 4G3XB 4HXDA 1Y8RC 2NBVB 1S1QB 1W6VA 2MBOA 1EO6A 2FIFA 2RPQA 2L0FA 5KHQA 2CS4A 2FCSA 4BKGA 1WZ0A 2WWZA 3W1SC 2V3SA 2BKFA 3A1QA 1J8CA 4ICUA 4GSWA 2DAJA 1WX8A 4TUUA 2IO3B 1J0GA 3DQVA 2LXAA 1E8ZA 2C7MB 3PLUA 2B3AA 1E5WA 2LGXA 4MM3A 4GXBA 4NAWA 3UINB 1JRUA 4E71A 5AZHA 3KYDD 3PS6A 5AZFA 2MCNB 3UQBA 3WA0A 5EDSA 2KZRA 2JUOA 3NOBA 3PZDA 1V81A 3ZNID 3LMNA 2BF8B 2ZVOA 2PPHA 5D6JB 1Q0WB 1RRBA 2MBQA 5C23A 2LRUA 4DHZE 4JGHB 2HJ8A 4DHZB 2GBKA 1UD7A 2MLBA 2FCNA 4W9HA 3V62A 2VRRB 1LFDA 4EFOA 1WMHA 4A20A 3WAPA 4XX5A 3LJ3A 3VTUA 1WR6E 2D07B 3A4SC 1HE8A 1NI2A 1TTNA 2KJ6A 4FJVB 2V4LA 4AJWA 4RM8A 3RZWC 2GOWA 4WWNA 2NPTA 3VDZA 4F8CB 2IO1B 2PJHA 3VH3B 3ECIA 2NBWB 3MJWA 3TIXA 4EEWA 1WGDA 2PE9A 2Z0DB 2ZZPB 5CX3A 4EZKA 4NNJB 1WJ6A 1R4MI 3A1QB 4HWIB 3WALA 4F7ZA 2XK5A 2KTFA 3X23A 2GBRA 2KDIA 1LXDA 1S3SG 2ZPNA 3UIPB 3A9JA 1E8YA 4AJYB 3UIOB 3BINA 2KWCA 4WWOA 1V5OA 3DPDA 4NAWB 4FJYA 2KFKA 2N1VA 4HK2A 5L95C 2KN5A 3L08A 3PGEA 1C3TA 2LASA 4IC7B 4IG7B 3WIMA 2L8JA 1C1YB 4IW0A 2KWUB 2JZZA 2D2QA 4KIKB 4XZ4A 2G3QB 2WDTB 3P2BA 4ZRJA 3AULA 3ZLZA 4FULA 2Z59B 4TV3A 2FNJB 1L7YA 2L00B 3H7SA 4GMVA 5CHFA 5J17A 1M94A 3TJPA 3GZNI 4ANXA 1EF1A 1P0RA 4M0WB 1WGRA 2DAFA 3A33B 2N9EB 2ZVNA 2K6QA 1WMHB 3L0WB 1V9JA 2KQ7A 4PYUA 2HD5B 3RT3B 2AL6A 3ZDMC 2BYFA 3DCGA 4MGKE 1E8WA 5KHOA 4WJNA 1IP9A 2KC2A 1RFAA 2NPTB 1QZEA 3PRMB 4WJQA 4BKTA 2L05A 3ZRCA 2AEHA 1V80A 2O6VD 2RSUA 1WXMA 3K9OB 2QHOA 1UZXB 4BBNF 3AU5A 3APCA 2AL3A 2C7NB 1WYWB 3QC8B 3T9LA 2N4FA 2XK5B 4CO7A 2MX2A 3C0RB 4KVGB 1ZGUB 1GJZA 5DPRA 3VH4B 3A9JB 4LDTD 3ZW3A 3HHMA 4AP4C 2K6DB 1UGMA 2KQSA 2LVOA 2UWQA 3ENEA 2KFKB 3QWZB 4KZCA 4OVUA 4FA6A 1WXAA 4K7SA 4GDKA 2BYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKH A;  1GG3 A;  2JZ3 B;  2KK8 A;  4W9D A;  3QX1 A;  4EZJ A;  5AZG A;  2K25 A;  4HCN B;  4K1R B;  2LVP A;  1P3Q U;  2FID A;  4AWJ A;  2FCQ A;  5D2M B;  3EEC A;  4GIV A;  4FLH A;  3L17 A;  2BKR B;  4ANU A;  5E6N A;  3T8M A;  1MG8 A;  2K8C A;  4LDT B;  3WAN A;  1G6J A;  1V49 A;  2D10 A;  4I6P A;  5DPW A;  3B08 A;  3A9K A;  2OOB B;  3H9D A;  3KUZ A;  4KSK C;  4ZRK A;  1WF9 A;  4NY0 A;  2CHX A;  2GBJ A;  2KHW B;  2W9N A;  3DBS A;  1WH3 A;  3JSV A;  2CHW A;  4KZ0 A;  1V5T A;  4DXA B;  2KD0 A;  3KUD B;  1XD3 B;  3D32 A;  4HCP B;  2IYD B;  4EOY A;  2IY1 B;  5JZE B;  3KW5 B;  2JXX A;  2LVQ A;  1U4A A;  4GB9 A;  5G55 A;  4DWF A;  4ANV A;  5CTR C;  2A4Z A;  4BFR A;  4BKS D;  4W9K A;  2CR5 A;  3VHT C;  2LWP A;  2IZV B;  1YX5 B;  3LDZ E;  4ZRI A;  1K8R B;  2ZNV B;  4FBJ B;  3GOE A;  4GDK B;  3DBL I;  3DBR I;  2DX5 B;  3DVG X;  1OTR B;  2ZCB A;  5CHW A;  3M63 B;  2L3Z A;  2Y5B B;  1WX9 A;  1WE7 A;  1WGY A;  4NQL B;  3UQA A;  2BYV E;  2KO3 A;  1I42 A;  3AI5 A;  2PE6 B;  1E7U A;  2KJH B;  2ASQ A;  4HPM B;  1YQB A;  4G11 A;  4ZDV A;  3O65 B;  3PT2 B;  3DDC B;  4MSQ B;  1NDD A;  4BOZ B;  2DYO A;  4JL9 A;  4KV2 A;  3VQI A;  3ZRF A;  1XQQ A;  4ZYN A;  3ZIM A;  3M62 B;  3PTF C;  1A5R A;  2RD0 A;  3OJ4 B;  3DVN U;  1KLV A;  2JPH A;  3L16 A;  3L54 A;  1WX7 A;  4MH0 E;  2BWE S;  4RM9 A;  3JSV B;  4X57 B;  2KJR A;  2N7E A;  3RCZ A;  4PS8 A;  3AXC A;  4KSL C;  5DPS A;  1E8X A;  3OAW A;  2CHZ A;  4PS7 A;  4GN1 A;  4RMA A;  3ZTD A;  2YLM A;  2KMA A;  2J0J A;  3QA8 A;  4IWP A;  4P7I A;  3OLM D;  2GBM A;  3B0A A;  2MWS B;  4JLC A;  1V86 A;  4GU2 A;  1P98 A;  2I1J A;  2K8B A;  3H6N A;  3EC8 A;  3V60 A;  5J2R A;  3M3J A;  2MW5 A;  1WY8 A;  5G2N A;  2M1M A;  1WR1 A;  2EKE C;  3B1L X;  2NBU A;  3PRP B;  2IBI B;  2JRI B;  2O6V A;  2XEW A;  3QJZ A;  1GNU A;  2J0M A;  2MBH A;  1X1M A;  2K1F A;  3PHW B;  1WIA A;  3U30 A;  2CU1 A;  3CSF A;  4G0N B;  3EFU A;  3RUL A;  3NS8 A;  4MGI E;  2UYZ B;  3ZO5 B;  1NBF C;  4MEL A;  3VUX A;  4LCD E;  2M8S A;  5GMV A;  4MJS A;  2AWT A;  2ZEQ A;  5FR6 A;  4B6W A;  2L7R A;  1KJT A;  3L10 B;  3ML8 A;  2MSE D;  3ZUN A;  2JT4 B;  1L2N A;  2N9P C;  3ONS A;  4IWO A;  3QQ8 B;  5IA7 A;  2L76 A;  3TBL D;  4BVU C;  4I6L B;  2C5L C;  4OVV A;  2FUH B;  4CYE A;  4HDO A;  4DDG D;  4IM2 A;  2K39 A;  3APD A;  1P9D U;  1UH6 A;  1WRD B;  5D94 A;  3TL5 A;  2MA9 B;  1ISN A;  2G4D B;  1FXT B;  2KVR A;  3TMP B;  2BWF A;  2NVU I;  3ZVV A;  3R7R A;  3NHE B;  2JF5 A;  2DYM A;  1WZ3 A;  3TCA A;  1VD2 A;  2KLG A;  1VCB A;  1TGZ B;  1R4N I;  2LXC A;  2FCM A;  3H1U A;  3NZU A;  1UBI A;  4W9L A;  4FAD A;  3IG3 A;  2AYO B;  2JRH A;  1GC7 A;  2O6V B;  3DOW A;  1SIF A;  2D3G A;  2ZJD A;  1TZ1 A;  2DZM A;  4TKN A;  4WJP A;  3ZTC A;  2MRP A;  3KYC D;  2C60 A;  3U8Z A;  3NZS A;  3ALB A;  2J7Q B;  2O2V A;  2DZK A;  5C1Z A;  2EMT A;  4EUT A;  3PV1 A;  4A3O A;  4BKS A;  3K9P B;  1WM2 A;  4DDI D;  2I1K A;  1UBQ A;  3WAO A;  1V6E A;  2MBB B;  4II2 B;  1IYF A;  2KKC A;  4W9J A;  4MJS B;  4IUM B;  5IAA C;  4MGY E;  3SU8 X;  3VVW B;  4AOF A;  3AU4 A;  2LZ6 A;  4K7U A;  2N7D A;  4A3P A;  1AAR A;  1SE9 A;  4WWP A;  2FAZ A;  3RYT A;  2LD9 A;  3W1S A;  3BY4 B;  2IO0 B;  3SDL C;  3ZNG C;  3H7P A;  5DCN A;  1WXV A;  1ZKH A;  3ZKJ C;  4PS3 A;  4LJP B;  3KVF B;  5CHV C;  3HK0 A;  3QAQ A;  4AUQ C;  4NJ7 A;  4MEM A;  2XBB C;  3RD2 A;  4F1S A;  2DEN B;  1WXS A;  2G4S A;  1BT0 A;  1V2Y A;  2L0T A;  2KNB A;  2MP2 A;  2KTR A;  4GDL A;  3U7D A;  3OJ3 A;  1WI0 A;  5LXI B;  3ZNZ B;  3VXW A;  2YVC A;  3ZNH B;  5LLI A;  4FN2 A;  3QCA A;  4II3 B;  3EHV A;  1GC6 A;  1I35 A;  3VUW A;  1WFY A;  2RR9 A;  4MDK E;  4PYZ A;  4WQO B;  2NCN A;  3DVG Y;  4ASW C;  4DK5 A;  4WJO A;  3V61 A;  2O2V B;  5J18 A;  4YL8 A;  1LQB A;  1WM3 A;  3N3K B;  4M8M A;  2J0K A;  4W9I A;  1OEY A;  2MQJ A;  3JYU A;  2KXJ A;  4W9C A;  3A9K B;  4FJZ A;  5E6O A;  2NS5 A;  4HJK A;  4KIK A;  2KX3 A;  1YX6 B;  2EMS A;  2LGD A;  3IHP C;  4EKU A;  3CST A;  1EUV B;  1F9J A;  1KM7 A;  3IFW B;  4B9K A;  4MGZ E;  2DYB A;  1EF5 A;  1XT9 B;  2DZI A;  3H7P B;  3KH0 A;  3L13 A;  5JHA A;  3QK0 A;  2KOX A;  4N9F 4;  4ANW A;  4HDQ A;  3PSE B;  2WX0 A;  5L83 A;  3PPA A;  1D3Z A;  5DPT A;  3PVL A;  4W9F A;  3V6C B;  1OGW A;  1SGH A;  2HTH A;  1IPG A;  2KLC A;  1RAX A;  2DZJ A;  2GBN A;  5JH5 C;  3MTN B;  4IM3 A;  2HE7 A;  3A4R A;  3VAW A;  2M0X A;  3VTW A;  4DBG A;  4NJ6 A;  2G45 B;  4LJO B;  2C9W B;  2KTR B;  2M4N A;  2MP2 B;  4GDL B;  1E7V A;  2M17 A;  2OJR A;  4FHK A;  4CHK A;  2D11 A;  2V1Y A;  3PHX B;  4DHJ D;  4EZL A;  2JVC A;  3HIZ A;  1Z5S B;  3VFK A;  2KFJ A;  4M8N A;  3QAR A;  2KDF B;  2Z0E B;  2JWZ A;  3PLV A;  1YD8 U;  2PEA A;  4TQ0 A;  4G50 A;  4ICV A;  2KC1 A;  2BPS A;  3CF6 E;  4KDL B;  4KDI C;  1ZW7 A;  1GUA B;  3NY5 A;  4GGQ A;  4HPL B;  3N30 A;  2RGF A;  3R66 C;  1KOT A;  2A5U A;  1LM8 B;  5TR5 A;  3I3T B;  4IM0 A;  4JIO U;  3MHS D;  4DHJ B;  4K7W A;  3CMM B;  1YIW A;  4W9G A;  2WX1 A;  4TQ1 A;  3X0W A;  3V6E B;  3RZF A;  2ZCC A;  2KDB A;  2KX0 A;  4JQW C;  4K81 A;  3PRE A;  2CKH B;  2KWV B;  1T0Y A;  2R2O A;  2N1W A;  1H4R A;  3M95 A;  2LI5 A;  3UGB B;  4I6N B;  3RUI B;  1WGG A;  2LRW A;  4E74 A;  1P1A A;  3KUC B;  4BBN C;  4XC2 A;  4FHJ A;  2REX A;  3JW0 X;  5JHB A;  3ZDT A;  2LJ5 A;  5BO4 B;  1E90 A;  1Q1O A;  3QHT A;  4BOS C;  3DBH I;  4J6I A;  2R2Q A;  1WJU A;  2NR2 A;  2IO2 B;  1YJ1 A;  3QIJ A;  4NPN A;  3S2A A;  2LUE A;  3Q3F A;  2DHZ A;  3DVN V;  2C7H A;  1WE6 A;  3WAM A;  3IBE A;  5D7G A;  3ML9 A;  1WGH A;  2ZNV C;  3Q3J A;  4GOC A;  2GMI C;  2IY0 B;  1WJN A;  1RLF A;  1TBE A;  4HLE A;  2N9X A;  3W1Y A;  3HM6 X;  1OEY J;  3JVZ X;  5AEK B;  3APF A;  1J19 A;  2KDE B;  5LXH A;  4E3C A;  3SD5 A;  1UEL A;  2LGY A;  1CMX B;  2MBE A;  3UF8 A;  4WAA A;  1Z2M A;  4NQK E;  3VUY A;  3HM3 A;  1H8C A;  1PQS A;  1WJ4 A;  4W9E A;  4B95 A;  4HVB A;  2JY6 A;  2WYQ A;  2KAN A;  4MSM B;  2KMC A;  1Q5W B;  1OQY A;  3N32 A;  3PRZ A;  3R7Q A;  2BGF A;  4IWQ A;  2K8H A;  5E6P A;  3IVF A;  2ZPY A;  3VTV A;  3SHQ A;  3R3M A;  4URK A;  4G3X B;  4HXD A;  1Y8R C;  2NBV B;  1S1Q B;  1W6V A;  2MBO A;  1EO6 A;  2FIF A;  2RPQ A;  2L0F A;  5KHQ A;  2CS4 A;  2FCS A;  4BKG A;  1WZ0 A;  2WWZ A;  3W1S C;  2V3S A;  2BKF A;  3A1Q A;  1J8C A;  4ICU A;  4GSW A;  2DAJ A;  1WX8 A;  4TUU A;  2IO3 B;  1J0G A;  3DQV A;  2LXA A;  1E8Z A;  2C7M B;  3PLU A;  2B3A A;  1E5W A;  2LGX A;  4MM3 A;  4GXB A;  4NAW A;  3UIN B;  1JRU A;  4E71 A;  5AZH A;  3KYD D;  3PS6 A;  5AZF A;  2MCN B;  3UQB A;  3WA0 A;  5EDS A;  2KZR A;  2JUO A;  3NOB A;  3PZD A;  1V81 A;  3ZNI D;  3LMN A;  2BF8 B;  2ZVO A;  2PPH A;  5D6J B;  1Q0W B;  1RRB A;  2MBQ A;  5C23 A;  2LRU A;  4DHZ E;  4JGH B;  2HJ8 A;  4DHZ B;  2GBK A;  1UD7 A;  2MLB A;  2FCN A;  4W9H A;  3V62 A;  2VRR B;  1LFD A;  4EFO A;  1WMH A;  4A20 A;  3WAP A;  4XX5 A;  3LJ3 A;  3VTU A;  1WR6 E;  2D07 B;  3A4S C;  1HE8 A;  1NI2 A;  1TTN A;  2KJ6 A;  4FJV B;  2V4L A;  4AJW A;  4RM8 A;  3RZW C;  2GOW A;  4WWN A;  2NPT A;  3VDZ A;  4F8C B;  2IO1 B;  2PJH A;  3VH3 B;  3ECI A;  2NBW B;  3MJW A;  3TIX A;  4EEW A;  1WGD A;  2PE9 A;  2Z0D B;  2ZZP B;  5CX3 A;  4EZK A;  4NNJ B;  1WJ6 A;  1R4M I;  3A1Q B;  4HWI B;  3WAL A;  4F7Z A;  2XK5 A;  2KTF A;  3X23 A;  2GBR A;  2KDI A;  1LXD A;  1S3S G;  2ZPN A;  3UIP B;  3A9J A;  1E8Y A;  4AJY B;  3UIO B;  3BIN A;  2KWC A;  4WWO A;  1V5O A;  3DPD A;  4NAW B;  4FJY A;  2KFK A;  2N1V A;  4HK2 A;  5L95 C;  2KN5 A;  3L08 A;  3PGE A;  1C3T A;  2LAS A;  4IC7 B;  4IG7 B;  3WIM A;  2L8J A;  1C1Y B;  4IW0 A;  2KWU B;  2JZZ A;  2D2Q A;  4KIK B;  4XZ4 A;  2G3Q B;  2WDT B;  3P2B A;  4ZRJ A;  3AUL A;  3ZLZ A;  4FUL A;  2Z59 B;  4TV3 A;  2FNJ B;  1L7Y A;  2L00 B;  3H7S A;  4GMV A;  5CHF A;  5J17 A;  1M94 A;  3TJP A;  3GZN I;  4ANX A;  1EF1 A;  1P0R A;  4M0W B;  1WGR A;  2DAF A;  3A33 B;  2N9E B;  2ZVN A;  2K6Q A;  1WMH B;  3L0W B;  1V9J A;  2KQ7 A;  4PYU A;  2HD5 B;  3RT3 B;  2AL6 A;  3ZDM C;  2BYF A;  3DCG A;  4MGK E;  1E8W A;  5KHO A;  4WJN A;  1IP9 A;  2KC2 A;  1RFA A;  2NPT B;  1QZE A;  3PRM B;  4WJQ A;  4BKT A;  2L05 A;  3ZRC A;  2AEH A;  1V80 A;  2O6V D;  2RSU A;  1WXM A;  3K9O B;  2QHO A;  1UZX B;  4BBN F;  3AU5 A;  3APC A;  2AL3 A;  2C7N B;  1WYW B;  3QC8 B;  3T9L A;  2N4F A;  2XK5 B;  4CO7 A;  2MX2 A;  3C0R B;  4KVG B;  1ZGU B;  1GJZ A;  5DPR A;  3VH4 B;  3A9J B;  4LDT D;  3ZW3 A;  3HHM A;  4AP4 C;  2K6D B;  1UGM A;  2KQS A;  2LVO A;  2UWQ A;  3ENE A;  2KFK B;  3QWZ B;  4KZC A;  4OVU A;  4FA6 A;  1WXA A;  4K7S A;  4GDK A;  2BYE A; 
#chains in the Genus database with same CATH topology
 4XDD A;  2KK8 A;  3QX1 A;  4HCN B;  4TMA B;  3Q8E A;  2ON8 A;  4ANU A;  1WWT A;  1A70 A;  2K8C A;  1G6J A;  1P7F A;  3AEF B;  2WXO A;  4I6P A;  3A9K A;  2OOB B;  3RNG C;  3T3O A;  1WF9 A;  1SJH D;  2EKI A;  4JWS C;  1I4H A;  1KH0 A;  1WH3 A;  4KZ0 A;  4DXA B;  2KD0 A;  1FFV A;  1K52 A;  1UUP A;  1GB1 A;  4HKQ A;  2A4Z A;  1ZP0 B;  4ZRI A;  1K8R B;  4GDK B;  3KQ4 A;  3DBL I;  3DBR I;  3ABV B;  3RI7 C;  1N63 A;  2ZCB A;  2Y5B B;  1WX9 A;  2KMM A;  1WGY A;  3UQA A;  2BYV E;  4EE2 A;  1FM0 D;  3AI5 A;  1I4R A;  1JRP A;  4HPP A;  5HHD G;  1YQB A;  4YSZ B;  2J42 A;  4PT5 A;  3PT2 B;  4KX6 B;  1KTK A;  4LNI A;  3EUB 2;  2WXQ A;  1MHH E;  3ZRF A;  1TS2 A;  4ZYN A;  5IN7 A;  5BMI A;  2BWE S;  4X57 B;  2KJR A;  2BS2 B;  2DNF A;  4KSL C;  4LK0 M;  1C78 A;  4AQ7 A;  4GN1 A;  2KMA A;  5EE3 A;  1ENF A;  2GBM A;  3TEY A;  2MWS B;  3Q14 C;  1V97 A;  1XEE A;  3M3J A;  2CU3 A;  3U30 A;  3PHW B;  5C3J B;  5TSS A;  3ZO5 B;  3BII D;  2M8S A;  4MJS A;  1WSP A;  3LB8 C;  2MSE D;  3ZUN A;  3NVW A;  2N9P C;  3ONS A;  3QQ8 B;  3SR6 A;  3DBR B;  4CYE A;  4ZYS A;  1FRD A;  2K39 A;  3APD A;  1YOV B;  2INN E;  1SE4 A;  1ISN A;  2G4D B;  3SFE B;  1T3Q A;  3NVV A;  5D3D A;  2KLG A;  1VCB A;  2LXC A;  3NZU A;  2WU2 B;  2WXF A;  4W9L A;  4FAD A;  2IGH A;  2O6V B;  2DBY A;  2D3A A;  2ZJD A;  1TZ1 A;  1N62 A;  4WJP A;  3BVM A;  4USA A;  3ALB A;  2O2V A;  2EMT A;  2BTE A;  3PV1 A;  2J4X A;  1WM2 A;  4DDI D;  1V6E A;  3IAM 1;  4W9J A;  3N20 C;  5IAA C;  4MGY E;  3SU8 X;  2LZ6 A;  1J7B A;  1SE9 A;  2LD9 A;  3SDL C;  5DCN A;  1WXV A;  4KKJ A;  3ZKJ C;  4A9A A;  1NEN B;  5CHV C;  3QAQ A;  4C4V A;  4MEM A;  1EWC A;  3B2G A;  2SAK A;  1WXS A;  3DWM A;  1K50 A;  1CQV A;  2PKO A;  5LXI B;  1WI0 A;  3VXW A;  3URY A;  3SEB A;  1GC6 A;  3W2D A;  3RN9 C;  4JE3 B;  3VR8 B;  2RR9 A;  1I4P A;  3V61 A;  5J18 A;  4YL8 A;  3N3K B;  4H2A A;  1N5W A;  2QSD A;  4C56 C;  5D3I B;  1L0V B;  3A9K B;  4FJZ A;  2FE8 A;  2KX3 A;  2EMS A;  1L6V A;  2LGD A;  4XDC A;  2DYB A;  1XT9 B;  3KH0 A;  3L13 A;  1F2R C;  2KOX A;  4N9F 4;  4HDQ A;  2H88 B;  2HTH A;  3VR9 B;  1AN8 A;  1RAX A;  2DZJ A;  4IM3 A;  5LNK 1;  1YJI A;  4DBG A;  3BZD B;  3DHI C;  2M17 A;  3GB1 A;  1T0R C;  4DHJ D;  3AE9 B;  2IPK D;  3BK2 A;  3QAR A;  4GLS C;  3AMZ A;  4G50 A;  4ICV A;  4KDL B;  1V1P A;  3PO0 A;  2IGG A;  2RGF A;  5TR5 A;  2YEP F;  3I3T B;  2PMV A;  4IM0 A;  4RGT A;  3SFD B;  3CMM B;  1NYR A;  1YN4 A;  3N1X C;  2QMT A;  4TQ1 A;  1PFD A;  2KDB A;  2Q5W D;  4K81 A;  5BYR A;  2QDF A;  3M95 A;  1H4R A;  1FIQ A;  3R8B A;  4E74 A;  1P1A A;  4XC2 A;  4FHJ A;  3AH7 A;  2ONQ A;  4O1N A;  4J6I A;  1T0S C;  2DHZ A;  1WE6 A;  4GOC A;  2GMI C;  1HTO A;  1WJN A;  1TBE A;  4HLE A;  2N9X A;  3W1Y A;  4L2Y A;  4YWG G;  3FIL B;  5AEK B;  1E0Z A;  4YSY B;  1UEL A;  2KDM A;  2MBE A;  4WAA A;  1NI3 A;  1Z2M A;  1PQS A;  2KAN A;  1Q5W B;  1OQY A;  3VTV A;  4HJG E;  4IWQ A;  2GI9 A;  2W55 A;  3SHQ A;  2WXN A;  3R3M A;  4URK A;  4G3X B;  4HXD A;  2NBV B;  1S1Q B;  2FCS A;  3U52 E;  4BKG A;  1V1O A;  1WZ0 A;  4HRS A;  3A1Q A;  1J8C A;  1E10 A;  1WRI A;  1WX8 A;  4TUU A;  1DOY A;  1E8Z A;  2RDB C;  2C7M B;  3PLU A;  2B3A A;  1E5W A;  3UIN B;  2BB5 A;  3PS6 A;  3KWL A;  5FK9 C;  3AE4 B;  1C9F A;  2JUO A;  3NOB A;  2BF8 B;  2BS3 B;  2WDV B;  4XWT A;  4A8X C;  4ZOH C;  1R4N B;  4DXF A;  4DHZ E;  4DHZ B;  2HJ8 A;  2GBK A;  3AB5 A;  3V62 A;  2VRR B;  1LFD A;  1WMH A;  4A20 A;  4XX5 A;  3LJ3 A;  4B0M A;  1TTN A;  4RM8 A;  3RZW C;  2GOW A;  4F8C B;  2NBW B;  3MJW A;  3NS1 A;  3TIX A;  4EEW A;  2N9K A;  1XCT L;  4EZK A;  1R4M I;  4F7Z A;  2XK5 A;  2KDI A;  1S3S G;  2ZPN A;  2V0G A;  3KWV A;  3A9J A;  4AJY B;  1M4V A;  3VRB B;  4WWO A;  1V5O A;  2BW2 A;  2WXP A;  3W5U B;  2KN5 A;  1F0Z A;  3NZ3 A;  2D2Q A;  3P2B A;  4AS1 A;  4OW0 A;  2ICI A;  4TV3 A;  2L00 B;  3MJ5 A;  3Q3M C;  2L1A A;  2N9E B;  4MAC A;  2IJ0 A;  3FAH A;  3U4E G;  1ZXI A;  1B1Z A;  1OFF A;  1IP9 A;  3PRM B;  4BZA A;  3ZRC A;  2AEH A;  1V80 A;  3K9O B;  3QC8 B;  2LFI A;  1C4P A;  3U2S C;  5DPR A;  1OQQ A;  3AE2 B;  2K6D B;  1KFY B;  3ENE A;  4KZC A;  1VZ7 A;  4OVU A;  2KFK B;  5H8Y E;  1WXQ A;  4K7S A;  5HFY A;  4GDK A;  2JZP A;  1T5X D;  2E6X A;  3P4S B;  5AZG A;  2FCQ A;  3EEC A;  4GIV A;  4FLH A;  5E6N A;  1R4M B;  4LDT B;  1ZDX A;  5DPW A;  3AE5 B;  1TIF A;  4NY0 A;  2CHX A;  3U7Z A;  1F77 A;  2GBJ A;  4WWM A;  3DBS A;  1QKZ A;  1DOX A;  2CHW A;  4ACF A;  1ZOY B;  4EOY A;  1XD3 B;  4HCP B;  5JZE B;  2JXX A;  4UDU C;  2LVQ A;  4DWF A;  4ANV A;  5CTR C;  3AE6 B;  2D5G A;  1MI0 A;  4BFR A;  2CR5 A;  4RGN A;  1YX5 B;  1FO4 A;  2W54 A;  2J52 A;  1YQ3 B;  3TEZ A;  4NQL B;  2PVG C;  4DQO C;  1I42 A;  4XE0 A;  2PE6 B;  2Y3A A;  2M56 B;  4G11 A;  1JRO A;  1RYJ A;  3O65 B;  1DGJ A;  3DDC B;  1NDD A;  1QOF A;  1SSN A;  1ZUD 2;  3ZIM A;  3M62 B;  3OJ4 B;  4JPS A;  4C7Z A;  1XXG A;  3L16 A;  4MH0 E;  4WUR A;  2JWU A;  1YN3 A;  3JSV B;  2Y5C A;  1ACC A;  5DPS A;  3OAW A;  2YLM A;  2W3S A;  3B0A A;  1V86 A;  4GU2 A;  1P98 A;  2KQ4 X;  3EC8 A;  5G2N A;  5IOI A;  1WR1 A;  2EKE C;  3B1L X;  3PRP B;  2IBI B;  2JRI B;  2O6V A;  2XEW A;  1X1M A;  2K1F A;  2BVC A;  2QEJ C;  5MPO A;  4MGI E;  4YTM B;  1EWY C;  1E7P B;  4MEL A;  5GMV A;  2AWT A;  2G1E A;  2ZEQ A;  5FR6 A;  4B6W A;  1KJT A;  3ML8 A;  1L2N A;  4BAX A;  1HEZ E;  3LXF A;  2C5L C;  3IAS 1;  1MPE A;  2DLB A;  1P9D U;  1UH6 A;  3TL5 A;  3TMP B;  1QIL A;  2BWF A;  4YT0 B;  2HTM E;  3NHE B;  2DYM A;  3H1U A;  1TGZ B;  1UBI A;  2K3U A;  3MFG A;  4K3C A;  3DOW A;  4ZHP A;  4TKN A;  2DZM A;  3EGR A;  3ZTC A;  1MVK A;  2C60 A;  2DZK A;  5C1Z A;  4EUT A;  1RM6 C;  4BKS A;  3WAO A;  2LHE A;  2KKC A;  1FXA A;  3VVW B;  3UI3 A;  2K22 A;  2BYT A;  2N7D A;  1AAR A;  4WWP A;  1BUI C;  2OHF A;  3TEW A;  3ZNG C;  4PS3 A;  3HK0 A;  1VDV A;  1IUE A;  1HXY D;  3MHZ A;  2DEN B;  1ET9 A;  2QJL A;  1UWM A;  2G4S A;  1TYG B;  1WGK A;  1BT0 A;  2BBC A;  2KNB A;  2HJ1 A;  3OJ3 A;  2IDY A;  5C2T B;  5LLI A;  4II3 B;  1DOI A;  2WLB A;  1WFY A;  2NCN A;  3DVG Y;  1F2R I;  2RDG A;  4DK5 A;  2L83 A;  2RMM A;  2ZW1 A;  4W9I A;  1OEY A;  2INP E;  5IKC M;  5T8I A;  2KXJ A;  5E6J A;  5E6O A;  1D5M C;  2NS5 A;  4LNK A;  3CST A;  4YTP B;  4MGZ E;  1XLP A;  1EF5 A;  3FC4 A;  3H7P B;  5JHA A;  1EU4 A;  2W3R A;  2H89 B;  1I7H A;  3NVZ A;  3PSE B;  2WX0 A;  1D3Z A;  1L0X B;  4W9F A;  1CJE A;  3V6C B;  3MTN B;  2HE7 A;  2C9W B;  2KTR B;  2M4N A;  2MP2 B;  2OJR A;  3PHX B;  3HIZ A;  3AEG B;  2KYW A;  2IND C;  1QOB A;  1HQR D;  3RNE C;  3IT6 B;  3ZXV A;  2BPS A;  2IGD A;  3FIL A;  4RGM A;  3NY5 A;  1LM8 B;  4WH4 A;  3RNB C;  4JIO U;  3DBL B;  1FMA D;  4DHJ B;  1YIW A;  1XLN A;  4L23 A;  2LHD A;  3RZF A;  1I4Q A;  2KX0 A;  1UNS A;  2CKH B;  2KWV B;  5I4D A;  2R2O A;  2N1W A;  3KUC B;  3ZJT A;  5FR3 A;  3ZDT A;  5BO4 B;  1WJU A;  3QIJ A;  1YJ1 A;  2LUE A;  3Q3F A;  3DVN V;  3ML9 A;  3Q3J A;  2G9H D;  1RLF A;  2LEK A;  2EEL A;  2INC C;  3HM6 X;  2AQ3 B;  3JVZ X;  3APF A;  3IXS A;  3SD5 A;  2LGY A;  1CMX B;  3MC8 A;  3N1Y C;  4NQK E;  3VUY A;  2WDQ B;  1H8C A;  4MSM B;  3Q2A C;  1F52 A;  3IVF A;  2GRI A;  1MHX A;  4LNF A;  2MH7 A;  1PUT A;  1Y8R C;  1W6V A;  1EO6 A;  2DWQ A;  2FIF A;  2L0F A;  2RPQ A;  5EE1 A;  2KT7 A;  2VZK B;  4OZA A;  3BVZ A;  1P7E A;  1VJK A;  4NJC A;  1PGA A;  2BKF A;  2TSS A;  2V3S A;  4LNO A;  1J0G A;  3DQV A;  2LXA A;  2LGX A;  3FKY A;  1JRU A;  5AZH A;  4RGO S;  3KYD D;  5EDS A;  2KZR A;  3LMN A;  2PPH A;  4A90 A;  3AEE B;  4KGR A;  2KAJ A;  4ZHO A;  1UD7 A;  2Y5P A;  1UF0 A;  1MG4 A;  4W9H A;  4IDI A;  4EFO A;  3V3X A;  3WAP A;  4RFB A;  2E3T A;  1NI2 A;  2KJ6 A;  1JCK B;  3EFC A;  2QC8 A;  4WWN A;  3VDZ A;  3VH3 B;  3ZYY X;  2MJ3 A;  2WXL A;  3ECI A;  3AE1 B;  1IBX B;  2ZZP B;  2X38 A;  3WAL A;  3UIP B;  2MHJ A;  3UIO B;  2KFK A;  2N1V A;  5L95 C;  4OZC A;  3PGE A;  3PZ8 A;  4IC7 B;  1C1Y B;  4IW0 A;  2JZZ A;  4XZ4 A;  2G3Q B;  1QLB B;  3ZLZ A;  1FEH A;  5CHF A;  3H7S A;  1QQR A;  1M94 A;  3GZN I;  4M0W B;  1VZ8 A;  1WGR A;  1IGD A;  1GB4 A;  2BYF A;  4MGK E;  1E8W A;  1TZO A;  5KHO A;  3DWG C;  5GXG B;  4PK1 A;  2KC2 A;  1QZE A;  2WP9 B;  1XLO A;  2O6V D;  1L0Y B;  2RSU A;  1WXM A;  4BBN F;  1UZX B;  1D6E C;  3AU5 A;  2AL3 A;  3T9L A;  2N4F A;  2WNM A;  1GJZ A;  3TSS A;  2JYT A;  4C80 A;  3HHM A;  2Z8L A;  3QWZ B;  4FA6 A;  4B0E A;  3PLV A;  2JZ3 B;  1TT5 B;  2LVP A;  4AWJ A;  1FNU A;  5D2M B;  1YQ4 B;  2BKR B;  3L17 A;  3T8M A;  3NJT A;  1J7A A;  3AEB B;  4N58 A;  5EE9 A;  5AUK A;  2W82 A;  2WXH A;  1WYG A;  3KUZ A;  4ZRK A;  1KF6 B;  3L4P A;  1J7C A;  2BQQ A;  2W9N A;  3JSV A;  3Q69 A;  2RPV A;  1KLG D;  2IYD B;  2IY1 B;  3KW5 B;  1U4A A;  5G5H A;  3TUO A;  4BKS D;  1I4X A;  4W9K A;  3GZN B;  1SXT A;  2IZV B;  3LDZ E;  4P1B C;  2ZNV B;  4FBJ B;  1CK1 A;  3GOE A;  1KLU D;  1UGJ A;  2DX5 B;  3DVG X;  2L3Z A;  2GB1 A;  2WS3 B;  3AE7 B;  2L32 A;  3RFZ B;  2KO3 A;  4J3O D;  2NTS A;  1E7U A;  4HPM B;  2ASQ A;  3W9C B;  4ZDV A;  1JQ4 A;  3OWE B;  4MSQ B;  2DYO A;  4P1C C;  2N7J A;  3VQI A;  1SBB B;  1A5R A;  2RD0 A;  3DVN U;  4JWU C;  1KLV A;  3L54 A;  1UWX A;  1WX7 A;  3CIR B;  4RM9 A;  2N7E A;  3RCZ A;  1E8X A;  4PS7 A;  2CHZ A;  4RMA A;  3ZTD A;  1ZE3 D;  1ZDV A;  4JLC A;  2PW9 A;  2VH1 A;  1B9R A;  3V60 A;  2I2Y A;  5J2R A;  1L4Z B;  2MW5 A;  3I5J C;  4MT5 A;  1LGR A;  2MBH A;  1WIA A;  2LMC A;  3HUI A;  2CU1 A;  4US9 A;  4ARC A;  1V8C A;  3BVG A;  4L1B A;  1NBF C;  1AW7 A;  1ESF A;  4NZL B;  3NG0 A;  3L10 B;  2JT4 B;  2XNA C;  4IWO A;  2L76 A;  3VRA B;  4BVU C;  4I6L B;  2FUH B;  3I9V 1;  1TKY A;  2PTL A;  2AQ1 B;  2NVU I;  4NAM A;  1D4B A;  3R7R A;  2JF5 A;  1WZ3 A;  4QAY A;  1JAL A;  1QF6 A;  3IG3 A;  2AYO B;  2JRH A;  1GC7 A;  5FKA C;  3RNF C;  2MRP A;  3KYC D;  3U8Z A;  3NZS A;  1QOG A;  1MJD A;  2PIA A;  3K9P B;  2JXT A;  2MBB B;  5BYS A;  2MJD A;  1JWM D;  4KGT A;  4AOF A;  3Q8A A;  5BYQ A;  3BY4 B;  2IO0 B;  3H7P A;  4NJ7 A;  3IT4 B;  4D2K A;  2MP2 A;  2KTR A;  3U7D A;  3ZNZ B;  3ZNH B;  2YVC A;  3QCA A;  3EHV A;  1YNT E;  3ZGZ A;  1I35 A;  2CJO A;  4P6V F;  4MDK E;  4PYZ A;  4WQO B;  1AYF A;  3V05 A;  1SE3 A;  4WQM A;  4WJO A;  5JXV A;  2RDH A;  1WM3 A;  2J0K A;  1JWU D;  3PZ7 A;  3JYU A;  1C4A A;  4LNN A;  2JQR B;  4TSS A;  4EKU A;  1EUV B;  1F9J A;  4B9K A;  1PDX A;  2DZI A;  4HEA 1;  1JML A;  1D5Z C;  3QK0 A;  2BS4 B;  1FRR A;  5L83 A;  3PPA A;  1OGW A;  1IPG A;  5JH5 C;  2GBN A;  2N9L A;  1FNV A;  4C00 A;  2M0X A;  4WAF A;  1TKG A;  4LJO B;  4NJ6 A;  2KN4 A;  4GDL B;  1E7V A;  4CHK A;  1SF0 A;  2JVC A;  2JYE A;  1N61 A;  2WXI A;  3Q8C A;  1HZ5 A;  3VFK A;  2KFJ A;  2WXG A;  2KDF B;  2Z0E B;  1YD8 U;  2PEA A;  4TQ0 A;  2KC1 A;  1R7S A;  1AWD A;  3Q8B A;  1ZW7 A;  1FD6 A;  1JWB D;  4GGQ A;  4HPL B;  3N30 A;  2WXK A;  4LTU A;  1KOT A;  1FPY A;  2KWD A;  2AX5 A;  1E9M A;  2V3N A;  1XLQ A;  2K9X A;  3MHS D;  4A55 A;  4W9G A;  2WX1 A;  3X0W A;  2UU7 A;  2ZCC A;  2OED A;  2QCZ A;  4JQW C;  1PGX A;  3PRE A;  5BMH A;  1T0Y A;  3UGB B;  4I6N B;  3RUI B;  1SJE D;  2GLS A;  1IGC A;  3JW0 X;  2ZW0 A;  3E56 A;  2LJ5 A;  1Q1O A;  3QHT A;  4P16 A;  3HRD D;  4BOS C;  3DBH I;  1E6E B;  2R2Q A;  1K53 A;  3S2A A;  3Q3O C;  1JWA D;  1WGH A;  1OEY J;  3DHH C;  2KDE B;  5LXH A;  4E3C A;  3HVZ A;  1NVI D;  3HM3 A;  1TY2 A;  1WJ4 A;  3B9J A;  4B95 A;  4HVB A;  3N32 A;  3PRZ A;  3R7Q A;  3TEX A;  4A6Q A;  3AV8 A;  2MBO A;  4OHJ A;  5KHQ A;  3GE3 C;  1IBX A;  2WWZ A;  3W1S C;  4IKG A;  4ICU A;  4GSW A;  1L5P A;  2IO3 B;  1NEK B;  3H8H A;  2JX5 A;  4E71 A;  2M0A A;  4YXD B;  5AZF A;  3UQB A;  5BMG A;  4N59 A;  1V81 A;  4C7Y A;  5D6J B;  1Q0W B;  3Q6B A;  1RRB A;  5C23 A;  2LRU A;  4R3D A;  4JGH B;  4M0W A;  1C79 A;  1TS3 A;  1QOA A;  2FBW B;  3DBH B;  4M02 A;  1HE8 A;  4AJW A;  2IO1 B;  1WGD A;  2PE9 A;  2Z0D B;  5CX3 A;  4NNJ B;  2X8X X;  3N9Y C;  1WJ6 A;  4HWI B;  3LYY A;  2KTF A;  4KGS A;  3X23 A;  2GBR A;  2FUG 1;  3ZJU A;  1E8Y A;  3BIN A;  2BB6 A;  1VZ6 A;  2KWC A;  1ET6 A;  4MM3 B;  3DPD A;  4NAW B;  1C3T A;  2L8J A;  2NMQ A;  2KWU B;  2WXJ A;  2WDT B;  3HVD A;  2B76 B;  4FUL A;  2Z59 B;  3MP9 A;  1L7Y A;  5J17 A;  1ZPS A;  3TJP A;  1EF1 A;  1I4G A;  3BK1 A;  3L0W B;  1V9J A;  3RT3 B;  2HD5 B;  1NYQ A;  3Q3N C;  3DCG A;  4RF1 A;  1T6B X;  4LLG M;  4BKT A;  2NPT B;  2I38 A;  4JX1 C;  4XWW A;  2L05 A;  2J53 A;  2QHO A;  3APC A;  2MX2 A;  4KVG B;  1ZGU B;  3ZW3 A;  4FXC A;  2UWQ A;  1WXA A;  2BYE A;  1STE A;  5HKH A;  1GG3 A;  1DYQ A;  4XYC A;  4W9D A;  4EZJ A;  2K25 A;  4K1R B;  1P3Q U;  2FID A;  2D3B A;  1MG8 A;  3WAN A;  1V49 A;  2D10 A;  2V9H A;  4REZ A;  1JW9 D;  3B08 A;  4KKI A;  4KSK C;  3H9D A;  3RMK C;  3AEA B;  3WCQ A;  4RF0 A;  2KHW B;  3P1M A;  1V5T A;  2JU6 X;  3KUD B;  3D32 A;  4GB9 A;  5G5G A;  5G55 A;  2ACZ B;  3RPF C;  3VHT C;  2LWP A;  3OG5 A;  3R2T A;  1OTR B;  1FXI A;  5CHW A;  3M63 B;  3P42 A;  2QIL A;  1WE7 A;  1BML C;  3BWU D;  2KJH B;  4BOZ B;  1QT9 A;  2SEB D;  4JL9 A;  4KV2 A;  3R2I A;  2QIE B;  1N60 A;  4XGA B;  1XQQ A;  3PTF C;  3ZQ4 A;  1Y56 A;  2WGS A;  3KLS X;  2JPH A;  2WU5 B;  4PS8 A;  3AXC A;  4RNA A;  3T3N A;  1ZXH A;  1FCL A;  2J0J A;  3QA8 A;  4IWP A;  4P7I A;  3OLM D;  2K8B A;  2I1J A;  3H6N A;  1K51 A;  1PGB A;  2WHI A;  1GPX A;  1WY8 A;  2M1M A;  2NBU A;  3QJZ A;  1GNU A;  1XO3 A;  2J0M A;  3I63 C;  4HKZ E;  4YTN B;  4M01 A;  3CSF A;  4G0N B;  4RCO A;  3EFU A;  3RUL A;  3P4P B;  2NTT A;  3BYT B;  3NS8 A;  1SEB D;  2UYZ B;  2LUM A;  3VUX A;  2N0S B;  4LCD E;  3RNC C;  2M19 A;  2L7R A;  5IA7 A;  3C8Y A;  3GS2 A;  3TBL D;  4OVV A;  2LJI A;  3MC9 A;  4HDO A;  4DDG D;  4IM2 A;  5D94 A;  1WRD B;  2MA9 B;  2KVR A;  1FXT B;  2V3P A;  3ZVV A;  1ROE A;  3TCA A;  1VD2 A;  1R4N I;  2FCM A;  3P4R B;  1C77 A;  3AED B;  3W5V B;  1SIF A;  2D3G A;  5AUI A;  2L52 A;  2J7Q B;  1JWS D;  1SIJ A;  1VR9 A;  4A3O A;  1TKE A;  2I1K A;  1UBQ A;  4II2 B;  1IYF A;  1GOZ A;  5H92 C;  4MJS B;  4IUM B;  2VZK D;  4K3B A;  3AU4 A;  4K7U A;  4IOI E;  3P4Q B;  4A3P A;  2YEP B;  2FAZ A;  3RYT A;  3W1S A;  1ZKH A;  4LJP B;  3KVF B;  2V4I B;  1C76 A;  4Q2J A;  4AUQ C;  1HTQ A;  1TY0 A;  2XBB C;  3RD2 A;  4F1S A;  1V2Y A;  2L0T A;  4GDL A;  1SB3 C;  1FCC C;  4FN2 A;  3VUW A;  3P63 A;  4ASW C;  2O2V B;  1LQB A;  4M8M A;  2MQJ A;  4W9C A;  1N6Z A;  4HJK A;  4KIK A;  1YX6 B;  4OVZ A;  3IHP C;  1KM7 A;  3IFW B;  2WDR B;  2WQY B;  3I57 A;  4HRO A;  4ANW A;  4C4V B;  1XF5 L;  5DPT A;  3PVL A;  1SGH A;  1SE2 A;  2BT6 A;  2KLC A;  3A4R A;  2LGS A;  2K5P A;  3VAW A;  3VTW A;  2G45 B;  2PLP A;  4FHK A;  2D11 A;  2V1Y A;  4EZL A;  3AE3 B;  3J9C A;  1VRA B;  1Z5S B;  5HI1 A;  4M8N A;  4S17 A;  2JWZ A;  4ITK A;  1C4C A;  3BYY B;  3CF6 E;  4KDI C;  1T0Q C;  1GUA B;  4M00 A;  3ETR A;  1D5X C;  3R66 C;  2XN9 C;  2A5U A;  4K7W A;  3NVY A;  1MFW A;  4ARI A;  3Q8F A;  3GP7 A;  3V6E B;  1F1H A;  2LI5 A;  1PYW D;  1WGG A;  1GAQ B;  2LRW A;  4BBN C;  2REX A;  4WIP A;  5JHB A;  1XCQ L;  1E90 A;  2NR2 A;  2IO2 B;  1HA5 A;  3MC0 B;  1EU3 A;  4NPN A;  3WAM A;  2C7H A;  2R61 A;  3AN1 A;  4S0R A;  3IBE A;  5D7G A;  2ZNV C;  2CJN A;  1L6U A;  2IY0 B;  2K0P A;  3ZJV A;  1V1P B;  1J19 A;  4ZRP A;  1HZ6 A;  2OJW A;  3UF8 A;  4N6E B;  2AQ2 B;  1L4D B;  4W9E A;  2JY6 A;  2WYQ A;  2KMC A;  2BGF A;  2K8H A;  5E6P A;  2ZPY A;  1RWS A;  1YJJ A;  2KVZ A;  2CS4 A;  1LO5 D;  1YMH E;  5EE0 A;  1FFU A;  1Q10 A;  2DAJ A;  3O13 A;  1TJE A;  2LGI A;  3E9S A;  5IO9 A;  4DXG A;  4MM3 A;  4NAW A;  4GXB A;  3AEC B;  2MCN B;  3ZXR A;  3B2F A;  1FNW A;  1CZP A;  3WA0 A;  3PZD A;  3ZNI D;  2ZVO A;  2MBQ A;  1YN5 A;  2MLB A;  2FCN A;  1TS5 A;  3AE8 B;  2PVO D;  3RNA C;  1TS4 A;  5HG2 A;  3VTU A;  1WR6 E;  2KAC A;  2D07 B;  1KRH A;  3A4S C;  4FJV B;  2V4L A;  4OZB A;  4MH8 A;  2NPT A;  2PJH A;  5IP4 D;  3A1Q B;  1VLB A;  1LXD A;  3C19 A;  4US8 A;  4FJY A;  3NRZ A;  4HK2 A;  3L08 A;  3GE8 C;  2LAS A;  3NUH B;  4IG7 B;  4ZRQ A;  3WIM A;  4KIK B;  4CQN A;  1N5X A;  4ZRJ A;  3AUL A;  1EM7 A;  2FNJ B;  4GMV A;  2MEK A;  2D3C A;  4ANX A;  1P0R A;  1RFK A;  2DAF A;  3A33 B;  2VH2 A;  2ZVN A;  2K6Q A;  1WMH B;  2KQ7 A;  2JSV X;  4PYU A;  3N1Z C;  2AL6 A;  3ZDM C;  1BXT A;  4WJN A;  1RFA A;  4WJQ A;  3DHG C;  2WXR A;  3EA6 A;  2C7N B;  1WYW B;  2XK5 B;  4YSX B;  4CO7 A;  3C0R B;  3VH4 B;  3A9J B;  1OQR A;  3CWI A;  4LDT D;  2HDE A;  4AP4 C;  2MJE A;  1UGM A;  2KQS A;  2LVO A;  4RH6 A;  2WXM A;  3AM9 A; 
#chains in the Genus database with same CATH homology
 5HKH A;  1GG3 A;  2JZ3 B;  2KK8 A;  4W9D A;  3QX1 A;  4EZJ A;  5AZG A;  2K25 A;  4HCN B;  4K1R B;  2LVP A;  1P3Q U;  2FID A;  4AWJ A;  2FCQ A;  5D2M B;  3EEC A;  4GIV A;  4FLH A;  3L17 A;  2BKR B;  4ANU A;  5E6N A;  3T8M A;  1MG8 A;  2K8C A;  4LDT B;  3WAN A;  1G6J A;  1V49 A;  2D10 A;  4I6P A;  5DPW A;  3B08 A;  3A9K A;  2OOB B;  3H9D A;  3KUZ A;  4KSK C;  4ZRK A;  1WF9 A;  4NY0 A;  2CHX A;  2GBJ A;  2KHW B;  2W9N A;  3DBS A;  1WH3 A;  3JSV A;  2CHW A;  4KZ0 A;  1V5T A;  4DXA B;  2KD0 A;  3KUD B;  1XD3 B;  3D32 A;  4HCP B;  2IYD B;  4EOY A;  2IY1 B;  5JZE B;  3KW5 B;  2JXX A;  2LVQ A;  1U4A A;  4GB9 A;  5G55 A;  4DWF A;  4ANV A;  5CTR C;  2A4Z A;  4BFR A;  4BKS D;  4W9K A;  2CR5 A;  3VHT C;  2LWP A;  2IZV B;  1YX5 B;  3LDZ E;  4ZRI A;  1K8R B;  2ZNV B;  4FBJ B;  3GOE A;  4GDK B;  3DBL I;  3DBR I;  2DX5 B;  3DVG X;  1OTR B;  2ZCB A;  5CHW A;  3M63 B;  2L3Z A;  2Y5B B;  1WX9 A;  1WE7 A;  1WGY A;  4NQL B;  3UQA A;  2BYV E;  2KO3 A;  1I42 A;  3AI5 A;  2PE6 B;  1E7U A;  2KJH B;  2ASQ A;  4HPM B;  1YQB A;  4G11 A;  4ZDV A;  3O65 B;  3PT2 B;  3DDC B;  4MSQ B;  1NDD A;  4BOZ B;  2DYO A;  4JL9 A;  4KV2 A;  3VQI A;  3ZRF A;  1XQQ A;  4ZYN A;  3ZIM A;  3M62 B;  3PTF C;  1A5R A;  2RD0 A;  3OJ4 B;  3DVN U;  1KLV A;  2JPH A;  3L16 A;  3L54 A;  1WX7 A;  4MH0 E;  2BWE S;  4RM9 A;  3JSV B;  4X57 B;  2KJR A;  2N7E A;  3RCZ A;  4PS8 A;  3AXC A;  4KSL C;  5DPS A;  1E8X A;  3OAW A;  2CHZ A;  4PS7 A;  4GN1 A;  4RMA A;  3ZTD A;  2YLM A;  2KMA A;  2J0J A;  3QA8 A;  4IWP A;  4P7I A;  3OLM D;  2GBM A;  3B0A A;  2MWS B;  4JLC A;  1V86 A;  4GU2 A;  1P98 A;  2I1J A;  2K8B A;  3H6N A;  3EC8 A;  3V60 A;  5J2R A;  3M3J A;  2MW5 A;  1WY8 A;  5G2N A;  2M1M A;  1WR1 A;  2EKE C;  3B1L X;  2NBU A;  3PRP B;  2IBI B;  2JRI B;  2O6V A;  2XEW A;  3QJZ A;  1GNU A;  2J0M A;  2MBH A;  1X1M A;  2K1F A;  3PHW B;  1WIA A;  3U30 A;  2CU1 A;  3CSF A;  4G0N B;  3EFU A;  3RUL A;  3NS8 A;  4MGI E;  2UYZ B;  3ZO5 B;  1NBF C;  4MEL A;  3VUX A;  4LCD E;  2M8S A;  5GMV A;  4MJS A;  2AWT A;  2ZEQ A;  5FR6 A;  4B6W A;  2L7R A;  1KJT A;  3L10 B;  3ML8 A;  2MSE D;  3ZUN A;  2JT4 B;  1L2N A;  2N9P C;  3ONS A;  4IWO A;  3QQ8 B;  5IA7 A;  2L76 A;  3TBL D;  4BVU C;  4I6L B;  2C5L C;  4OVV A;  2FUH B;  4CYE A;  4HDO A;  4DDG D;  4IM2 A;  2K39 A;  3APD A;  1P9D U;  1UH6 A;  1WRD B;  5D94 A;  3TL5 A;  2MA9 B;  1ISN A;  2G4D B;  1FXT B;  2KVR A;  3TMP B;  2BWF A;  2NVU I;  3ZVV A;  3R7R A;  3NHE B;  2JF5 A;  2DYM A;  1WZ3 A;  3TCA A;  1VD2 A;  2KLG A;  1VCB A;  1TGZ B;  1R4N I;  2LXC A;  2FCM A;  3H1U A;  3NZU A;  1UBI A;  4W9L A;  4FAD A;  3IG3 A;  2AYO B;  2JRH A;  1GC7 A;  2O6V B;  3DOW A;  1SIF A;  2D3G A;  2ZJD A;  1TZ1 A;  2DZM A;  4TKN A;  4WJP A;  3ZTC A;  2MRP A;  3KYC D;  2C60 A;  3U8Z A;  3NZS A;  3ALB A;  2J7Q B;  2O2V A;  2DZK A;  5C1Z A;  2EMT A;  4EUT A;  3PV1 A;  4A3O A;  4BKS A;  3K9P B;  1WM2 A;  4DDI D;  2I1K A;  1UBQ A;  3WAO A;  1V6E A;  2MBB B;  4II2 B;  1IYF A;  2KKC A;  4W9J A;  4MJS B;  4IUM B;  5IAA C;  4MGY E;  3SU8 X;  3VVW B;  4AOF A;  3AU4 A;  2LZ6 A;  4K7U A;  2N7D A;  4A3P A;  1AAR A;  1SE9 A;  4WWP A;  2FAZ A;  3RYT A;  2LD9 A;  3W1S A;  3BY4 B;  2IO0 B;  3SDL C;  3ZNG C;  3H7P A;  5DCN A;  1WXV A;  1ZKH A;  3ZKJ C;  4PS3 A;  4LJP B;  3KVF B;  5CHV C;  3HK0 A;  3QAQ A;  4AUQ C;  4NJ7 A;  4MEM A;  2XBB C;  3RD2 A;  4F1S A;  2DEN B;  1WXS A;  2G4S A;  1BT0 A;  1V2Y A;  2L0T A;  2KNB A;  2MP2 A;  2KTR A;  4GDL A;  3U7D A;  3OJ3 A;  1WI0 A;  5LXI B;  3ZNZ B;  3VXW A;  2YVC A;  3ZNH B;  5LLI A;  4FN2 A;  3QCA A;  4II3 B;  3EHV A;  1GC6 A;  1I35 A;  3VUW A;  1WFY A;  2RR9 A;  4MDK E;  4PYZ A;  4WQO B;  2NCN A;  3DVG Y;  4ASW C;  4DK5 A;  4WJO A;  3V61 A;  2O2V B;  5J18 A;  4YL8 A;  1LQB A;  1WM3 A;  3N3K B;  4M8M A;  2J0K A;  4W9I A;  1OEY A;  2MQJ A;  3JYU A;  2KXJ A;  4W9C A;  3A9K B;  4FJZ A;  5E6O A;  2NS5 A;  4HJK A;  4KIK A;  2KX3 A;  1YX6 B;  2EMS A;  2LGD A;  3IHP C;  4EKU A;  3CST A;  1EUV B;  1F9J A;  1KM7 A;  3IFW B;  4B9K A;  4MGZ E;  2DYB A;  1EF5 A;  1XT9 B;  2DZI A;  3H7P B;  3KH0 A;  3L13 A;  5JHA A;  3QK0 A;  2KOX A;  4N9F 4;  4ANW A;  4HDQ A;  3PSE B;  2WX0 A;  5L83 A;  3PPA A;  1D3Z A;  5DPT A;  3PVL A;  4W9F A;  3V6C B;  1OGW A;  1SGH A;  2HTH A;  1IPG A;  2KLC A;  1RAX A;  2DZJ A;  2GBN A;  5JH5 C;  3MTN B;  4IM3 A;  2HE7 A;  3A4R A;  3VAW A;  2M0X A;  3VTW A;  4DBG A;  4NJ6 A;  2G45 B;  4LJO B;  2C9W B;  2KTR B;  2M4N A;  2MP2 B;  4GDL B;  1E7V A;  2M17 A;  2OJR A;  4FHK A;  4CHK A;  2D11 A;  2V1Y A;  3PHX B;  4DHJ D;  4EZL A;  2JVC A;  3HIZ A;  1Z5S B;  3VFK A;  2KFJ A;  4M8N A;  3QAR A;  2KDF B;  2Z0E B;  2JWZ A;  3PLV A;  1YD8 U;  2PEA A;  4TQ0 A;  4G50 A;  4ICV A;  2KC1 A;  2BPS A;  3CF6 E;  4KDL B;  4KDI C;  1ZW7 A;  1GUA B;  3NY5 A;  4GGQ A;  4HPL B;  3N30 A;  2RGF A;  3R66 C;  1KOT A;  2A5U A;  1LM8 B;  5TR5 A;  3I3T B;  4IM0 A;  4JIO U;  3MHS D;  4DHJ B;  4K7W A;  3CMM B;  1YIW A;  4W9G A;  2WX1 A;  4TQ1 A;  3X0W A;  3V6E B;  3RZF A;  2ZCC A;  2KDB A;  2KX0 A;  4JQW C;  4K81 A;  3PRE A;  2CKH B;  2KWV B;  1T0Y A;  2R2O A;  2N1W A;  1H4R A;  3M95 A;  2LI5 A;  3UGB B;  4I6N B;  3RUI B;  1WGG A;  2LRW A;  4E74 A;  1P1A A;  3KUC B;  4BBN C;  4XC2 A;  4FHJ A;  2REX A;  3JW0 X;  5JHB A;  3ZDT A;  2LJ5 A;  5BO4 B;  1E90 A;  1Q1O A;  3QHT A;  4BOS C;  3DBH I;  4J6I A;  2R2Q A;  1WJU A;  2NR2 A;  2IO2 B;  1YJ1 A;  3QIJ A;  4NPN A;  3S2A A;  2LUE A;  3Q3F A;  2DHZ A;  3DVN V;  2C7H A;  1WE6 A;  3WAM A;  3IBE A;  5D7G A;  3ML9 A;  1WGH A;  2ZNV C;  3Q3J A;  4GOC A;  2GMI C;  2IY0 B;  1WJN A;  1RLF A;  1TBE A;  4HLE A;  2N9X A;  3W1Y A;  3HM6 X;  1OEY J;  3JVZ X;  5AEK B;  3APF A;  1J19 A;  2KDE B;  5LXH A;  4E3C A;  3SD5 A;  1UEL A;  2LGY A;  1CMX B;  2MBE A;  3UF8 A;  4WAA A;  1Z2M A;  4NQK E;  3VUY A;  3HM3 A;  1H8C A;  1PQS A;  1WJ4 A;  4W9E A;  4B95 A;  4HVB A;  2JY6 A;  2WYQ A;  2KAN A;  4MSM B;  2KMC A;  1Q5W B;  1OQY A;  3N32 A;  3PRZ A;  3R7Q A;  2BGF A;  4IWQ A;  2K8H A;  5E6P A;  3IVF A;  2ZPY A;  3VTV A;  3SHQ A;  3R3M A;  4URK A;  4G3X B;  4HXD A;  1Y8R C;  2NBV B;  1S1Q B;  1W6V A;  2MBO A;  1EO6 A;  2FIF A;  2RPQ A;  2L0F A;  5KHQ A;  2CS4 A;  2FCS A;  4BKG A;  1WZ0 A;  2WWZ A;  3W1S C;  2V3S A;  2BKF A;  3A1Q A;  1J8C A;  4ICU A;  4GSW A;  2DAJ A;  1WX8 A;  4TUU A;  2IO3 B;  1J0G A;  3DQV A;  2LXA A;  1E8Z A;  2C7M B;  3PLU A;  2B3A A;  1E5W A;  2LGX A;  4MM3 A;  4GXB A;  4NAW A;  3UIN B;  1JRU A;  4E71 A;  5AZH A;  3KYD D;  3PS6 A;  5AZF A;  2MCN B;  3UQB A;  3WA0 A;  5EDS A;  2KZR A;  2JUO A;  3NOB A;  3PZD A;  1V81 A;  3ZNI D;  3LMN A;  2BF8 B;  2ZVO A;  2PPH A;  5D6J B;  1Q0W B;  1RRB A;  2MBQ A;  5C23 A;  2LRU A;  4DHZ E;  4JGH B;  2HJ8 A;  4DHZ B;  2GBK A;  1UD7 A;  2MLB A;  2FCN A;  4W9H A;  3V62 A;  2VRR B;  1LFD A;  4EFO A;  1WMH A;  4A20 A;  3WAP A;  4XX5 A;  3LJ3 A;  3VTU A;  1WR6 E;  2D07 B;  3A4S C;  1HE8 A;  1NI2 A;  1TTN A;  2KJ6 A;  4FJV B;  2V4L A;  4AJW A;  4RM8 A;  3RZW C;  2GOW A;  4WWN A;  2NPT A;  3VDZ A;  4F8C B;  2IO1 B;  2PJH A;  3VH3 B;  3ECI A;  2NBW B;  3MJW A;  3TIX A;  4EEW A;  1WGD A;  2PE9 A;  2Z0D B;  2ZZP B;  5CX3 A;  4EZK A;  4NNJ B;  1WJ6 A;  1R4M I;  3A1Q B;  4HWI B;  3WAL A;  4F7Z A;  2XK5 A;  2KTF A;  3X23 A;  2GBR A;  2KDI A;  1LXD A;  1S3S G;  2ZPN A;  3UIP B;  3A9J A;  1E8Y A;  4AJY B;  3UIO B;  3BIN A;  2KWC A;  4WWO A;  1V5O A;  3DPD A;  4NAW B;  4FJY A;  2KFK A;  2N1V A;  4HK2 A;  5L95 C;  2KN5 A;  3L08 A;  3PGE A;  1C3T A;  2LAS A;  4IC7 B;  4IG7 B;  3WIM A;  2L8J A;  1C1Y B;  4IW0 A;  2KWU B;  2JZZ A;  2D2Q A;  4KIK B;  4XZ4 A;  2G3Q B;  2WDT B;  3P2B A;  4ZRJ A;  3AUL A;  3ZLZ A;  4FUL A;  2Z59 B;  4TV3 A;  2FNJ B;  1L7Y A;  2L00 B;  3H7S A;  4GMV A;  5CHF A;  5J17 A;  1M94 A;  3TJP A;  3GZN I;  4ANX A;  1EF1 A;  1P0R A;  4M0W B;  1WGR A;  2DAF A;  3A33 B;  2N9E B;  2ZVN A;  2K6Q A;  1WMH B;  3L0W B;  1V9J A;  2KQ7 A;  4PYU A;  2HD5 B;  3RT3 B;  2AL6 A;  3ZDM C;  2BYF A;  3DCG A;  4MGK E;  1E8W A;  5KHO A;  4WJN A;  1IP9 A;  2KC2 A;  1RFA A;  2NPT B;  1QZE A;  3PRM B;  4WJQ A;  4BKT A;  2L05 A;  3ZRC A;  2AEH A;  1V80 A;  2O6V D;  2RSU A;  1WXM A;  3K9O B;  2QHO A;  1UZX B;  4BBN F;  3AU5 A;  3APC A;  2AL3 A;  2C7N B;  1WYW B;  3QC8 B;  3T9L A;  2N4F A;  2XK5 B;  4CO7 A;  2MX2 A;  3C0R B;  4KVG B;  1ZGU B;  1GJZ A;  5DPR A;  3VH4 B;  3A9J B;  4LDT D;  3ZW3 A;  3HHM A;  4AP4 C;  2K6D B;  1UGM A;  2KQS A;  2LVO A;  2UWQ A;  3ENE A;  2KFK B;  3QWZ B;  4KZC A;  4OVU A;  4FA6 A;  1WXA A;  4K7S A;  4GDK A;  2BYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...