3W2DA

Crystal structure of staphylococcal eenterotoxin b in complex with a novel neutralization monoclonal antibody fab fragment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the neutralization and specificity of Staphylococcal enterotoxin B against its MHC Class II binding site.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Enterotoxin type B
total genus 55
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3w2dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w2dA01
3W2DA 1ENFA 1TY2A 4DXGA 2CHBD 1EEFD 1DJRD 1EFID 1LTTD 4RGTA 1LTRD 1LT5D 3SEBA 2IJ0A 3MC0B 1RDPD 2ICIA 3DWAA 1JCKB 1YN3A 1ET9A 2QILA 4RHRA 1EEID 1V1OA 5ELFA 4O1NA 3TSSA 1EU3A 1S5DD 3BYYB 1AW7A 1RD9D 1S5CD 3R8BA 1BCPD 1PTOF 1HXYD 1BXTA 1PYWD 3BVMA 1I4HA 1T5XD 3CHBD 1PZJD 1XTCD 1PZID 1D5ZC 1XXGA 1BCPC 1KLGD 1CK1A 3GP7A 1PTOD 1CQVA 1BCPF 3O13A 4OHJA 1SE4A 1HA5A 1SBBB 1CT1D 1CHPD 1SJED 2TSSA 3EFXD 4RFBA 5FKAC 2IPKD 1KTKA 2G9HD 4RHSA 1LTSD 1LT4D 4RCOA 1TS2A 1RCVD 1D5MC 1SXTA 1LTID 2RDGA 3BYTB 4ZYSA 2XRSD 3V05A 3DWQA 1PRTF 5ELBA 1F77A 1TS3A 2XRQD 1GOZA 1PRTD 3R2TA 1CHQD 1HQRD 1TS5A 1I4GA 2XN9C 1JR0D 3DWPA 1B1ZA 1PRTC 1HTLD 1PTOH 2NTTA 1LLRD 1B44D 1I4RA 1UUPA 1I4XA 1SE2A 3MFGA 2Z8LA 1JWSD 4K6LA 4L63B 1LT6D 1L0XB 1TS4A 2RDHA 1KLUD 1FGBD 2AQ1B 3KLSX 1EWCA 1G8ZD 1SEBD 5D3IB 4DXFA 1SJHD 1D6EC 1V1PA 2AQ2B 1RF2D 1LT3D 1V1PB 5D3DA 1I4PA 2AQ3B 1PRTB 1LTBD 1TY0A 1L0YB 1JWMD 2SEBD 1YN4A 5I4DA 1JWUD 1FNVA 4RH6A 1EU4A 1PTOC 4Z9CB 1FNUA 1MD2D 5ELDA 1I4QA 5ELCA 4NZLB 3BVGA 1STEA 2R61A 1UNSA 5TSSA 1ESFA 4BWGB 1D5XC 2XNAC 1FD7D 5ELEA 4L6TB 1LTAD 1S5BD 2QEJC 3BZDB 3R2IA 1ET6A 3EA6A 3OWEB 4RGOS 1BCPB 2NTSA 1DYQA 1PTOB 5FK9C 1S5FD 1S5ED 1QILA 1JQYD 3BVZA 1LO5D 2WV6D 3URYA 1PZKD 1SE3A 1YN5A 1FNWA 1M4VA 1LTGD 2J4XA 2O2LD 4TSSA 4UDUC 1AN8A 4RGNA 4C56C 4RGMA
chains in the Genus database with same CATH superfamily
3QR8A 4D2KA 3FHWA 3QWNA 1HR0Q 4A6QA 1HNZL 1SFOH 2E8GA 4REZA 3FKIH 1EFID 1GPXA 4A3EB 3WAPA 4TVAB 2B2TC 5G55A 2VL6A 4JC0A 5G3LD 1Y1VB 2WXFA 4X64Q 1F0ZA 4C3JH 2QHOA 5IO9A 1YHQA 1RFAA 3I90A 2K6DB 4A3MG 2KK8A 4JOIC 3T9LA 2Z6KA 3AEEB 5IYDH 1WMHB 2J52A 3APCA 4LFAQ 3SE0A 2DAJA 2KOXA 3MWYW 4LMQD 3RD2A 3IT4B 3EROA 3SR1A 1HTPA 4NKLA 2IDYA 3AMZA 3DBHB 1F2LA 1E9MA 1V5TA 4M1UB 4P6VF 5L95C 3R3MA 1FIQA 4A3EG 3UGBB 5IGEA 4A76A 1V43A 2F0WA 5IYCG 5C0XH 3H09A 2JZZA 1KM7A 3ETRA 3PVLA 4KX6B 1HZBA 3FKYA 3RNUA 4A3DG 3A9JA 1HFGA 2HHHQ 2RF4A 4DV4L 1KTKA 2CH4W 2K5WA 3IG3A 1IBLL 1NR4A 4XDCA 1S3SG 4M8AA 3H6NA 4HMJA 2KDEB 4JI2L 4NXNQ 2BDNA 3SVMA 1OGWA 2PKOA 1QQRA 4II2B 4JWSC 2Z4HA 2YV5A 2RKSA 2JEBI 2GVBA 5JHAA 4XXEA 5M3MH 1Q7YC 1HNXQ 4C3IG 1L1OA 2FINB 3OSOA 2ASQA 2L55A 3DWGC 5EBDA 3VR4A 4IOAA 1JQ4A 1KOTA 2UU9L 2KMAA 3CIRB 1YJNA 1JALA 1MHWC 3MFGA 4WORA 4GKJL 2ALYB 1TS4A 3AB5A 4EE2A 1KLUD 1NNXA 3NY5A 1TWCH 1HE8A 1UWMA 2KN5A 5CV4A 1PVOA 1R7SA 4C80A 2MSED 3CQZH 2E75C 4C3HB 5D3DA 1HZ5A 3VVWB 2RGFA 1PRTB 3EBEA 4DR4Q 2QEXA 2SEBD 3GO5A 4GU2A 2RPQA 2A68C 1JRUA 1SIFA 2XGTA 1RODA 2JP1A 2NBFA 2WQYB 3PSEB 1LM0A 2NS5A 3N30A 1GD7A 5KRUA 5J39A 3WWVA 3H91A 4A3FH 1Y1WH 1SYFA 1BMLC 2CW0C 1RYJA 3K5NA 4NPSA 4BBNC 4FVMA 4II3B 3DBLI 4MH8A 1T0RC 1ESFA 4C2MB 4BKGA 4EQOA 2JA8H 2K0PA 2KWVB 3KWVA 4FJZA 1PDQA 1S5BD 2BBCA 1GJXA 2BYVE 2JYEA 3T1YQ 4DHJD 1U4RA 4WRDA 2PEAA 5M3FB 3MXPA 2N55A 2I38A 2B2TA 3AE3B 3CRKC 3ERQA 3I4MB 3S2HB 3H8HA 5IP4D 1BVSA 1K83H 3ZXRA 4LNKA 2EYJA 1MSGA 3MEFA 3BVZA 5L37A 5M5WH 4R4QA 4A3EH 3URYA 1KNEA 4IURA 4R8NA 1CM9A 1HPCA 4CDFC 1FNWA 4DV7L 3AU5A 3KQ4A 4BOSC 1QZHA 1T0SC 1CZWA 2ZPYA 2LGXA 1HNZQ 4WIPA 1RTNA 3PT2B 3CW2C 2ZVOA 1VZ6A 1G6ZA 2D2CC 1WYGA 3BZKA 4DAYB 2B8GA 4CBVA 2D0OA 2ZJQA 1FJGL 2L1BA 4M02A 3M4PA 4YL8A 4K5XA 3SEBA 1RDPD 1K8AC 1TR5A 5C5MA 3N6RA 1JMCA 4R9WA 5CBEE 4DHJB 3DM3A 3TL5A 1EU3A 4LJPB 4A8XC 2KFJA 4KMUC 4ALPA 2R7ZG 2K33A 2JVCA 1N60A 2WXKA 1DZ1A 4N9TA 2NVYH 1N36L 2MP2A 1N8RC 2X38A 4TV3A 1NR2A 4EQ5A 3DPDA 1AWDA 4ARIA 1F2YA 3TZUA 4EQPA 5BO4B 3DBRI 5CR3A 1JE5A 2EOTA 2OQ0A 1CA6A 4X3TA 3AE9B 5HG2A 1A6XA 4DDID 2WU5B 4KKIA 3GP7A 2F4VL 2K22A 4MEMA 4UHVA 1BCPF 2LSSA 2JN4A 4OHJA 3S17B 1MHXA 2HHHL 1VS0A 2F0MA 1V9PA 3EFXD 3SHLA 5M5YB 2B2UA 1WE6A 4YWGG 1GB4A 3RMHA 4B95A 1C79A 1TXYA 1STNA 4OONA 2CJOA 1CSPA 5CV8A 1WXVA 3VH3B 3PS6A 1SXTA 4LF7L 3VR6A 2NUCA 4RCNA 4DHZB 3HOXH 2O6VA 4X62Q 3AU4A 3UINB 4G11A 3P7JA 1OXTA 3R2TA 3I4LA 2RDFA 2F0QA 2DWQA 1FGUA 2F0SA 2RSNA 1YZ6A 2HIVA 3DWPA 2JT4B 1PTOH 5GAGC 2IO0B 4AJYB 1V5OA 1Q1OA 1KFYB 4PG3A 4IOCA 4IFDH 4I6NB 4KIKA 2NCNA 3I55A 4S3SA 1HEZE 1Z2MA 4W9KA 4DQOC 2N9KA 1GO3E 4GS3A 4A3JG 3WCQA 3MA2B 2JXTA 2KDIA 3HVZA 1UE6A 4GOPB 1IGCA 3CU7A 1IP9A 2JA6H 4WWMA 2F0UA 1PH6A 4DNTB 2EMTA 1WY8A 2IYDB 3WA0A 2AQ3B 4FADA 4JI1Q 2DN8A 1G51A 3DDCB 3IXSA 1DOIA 2KLGA 3ZJVA 4LWCA 1FNVA 3TEXA 2F3IA 1RHPA 2M17A 1DXMA 2KT7A 2LJIA 1FRRA 5EE0A 2XEWA 2WXPA 3V3XA 1EZ6A 1HCZA 3HRZC 3J80c 1MJDA 3TP5A 4CHTB 1WTVA 1HZ6A 2JX5A 2W9NA 4LK1C 3P1HA 4DV1L 4QUFA 1LTAD 1YNND 4LUVA 1TKGA 3H9DA 4TKNA 1W2BA 4OX9Q 4RGOS 1NI2A 1BCPB 1UWVA 2B3AA 3NXWA 5EPKA 1EM7A 1QLBB 1PTOB 1D7QA 3J81c 2VS1A 1PH8A 4A93G 4EOYA 2K6QA 3A9KA 4YWLA 4A3DB 3W3AA 4ID6A 3CMEA 2K8BA 1ZKOA 2F0KA 1ACCA 2KC2A 2KDBA 2KMMA 2L83A 2B3GA 1FXAA 1FXTB 1CKNB 5J18A 1AARA 3OOCA 1BDOA 1OFFA 3LNNA 4G7OC 5ISRA 3HOWG 1K0SA 1V1QA 3WAMA 2JXXA 1L1OC 4BY1B 5H92C 2N1WA 2PCFB 1NMFA 4EQNA 4NXMQ 3RCZA 2BOSA 2FIDA 2LHDA 1PGBA 1VQCA 1Y8PB 3H3VC 1N62A 2M19A 2PZWA 4IPGA 2ICIA 1UD7A 2BT6A 1YN3A 3RUIB 2JA5H 3NQIA 2KEEA 2YYZA 3GTJB 3KFUA 4L2YA 1JJCB 1KF6B 1GNUA 3RZOH 4J6IA 5CYUA 1CKNA 3PHXB 3HOVB 5D7GA 4IJLA 4X57B 1S5CD 1JJ2A 4DR5Q 2E5LL 3KUCB 5BYSA 1OXUA 1TIFA 1V49A 4DNIA 3TDQA 3FKIB 2HQEA 5AFWA 2DNFA 3ZNID 1T5XD 1SFOB 5C23A 5IN7A 5C3JB 2K50A 3AB9A 1XTCD 5M3FH 2BYFA 4HJGE 2Y3AA 4OVZA 3VUWA 5DM73 5IP9G 3OYYA 3PGZA 4OW0A 5I2YA 4KKSA 3CCQA 2Q2UA 4L5RC 2CHXA 1I50B 2PMVA 4PS8A 3TIXA 3S1MH 2Q8RE 3PMFA 4IUNA 2KACA 2Z0EB 3RMKC 4M8NA 5LL6X 3OHXC 2WKCA 3TP8A 2NPTA 4KGSA 5GAEC 4RCOA 3IFDA 2F1MA 4JI4Q 2DY8A 5IIFA 2EYPA 5JZEB 3D4RA 3D8GA 1G2TA 1J7BA 3QOJA 5BYRA 3FC4A 5JOBA 1V97A 2XTIA 2XRSD 3RN9C 2UXCL 1PRTF 2MBQA 4YCWA 5AJ3Q 2PVGC 2LRUA 2MBBB 2NVQB 3VXWA 3GV3A 4N58A 1A5RA 3IAYA 3W1GA 2PMZB 2BPSA 4NPNA 2NTTA 4CJ1B 1EIFA 1E3PA 4OO1G 3G7LA 1QVFA 4IQZA 1Z9FA 1WI0A 4HCEA 4DK1A 4A93H 1TVXA 2Q5WD 2W55A 4AWJA 2VZKB 1FD6A 1H95A 4DR1L 1TJEA 5IP7G 2KXJA 4QUCA 3LDZE 1HZCA 1PH5A 2F0DA 4XDXA 3ECIA 2ZJRA 3HOWH 1Q3LA 2L11A 4I6LB 2Z1CA 2AMCB 5EKLA 2EMSA 4LW1A 3IAM1 4K3BA 1ZDXA 3Q3MC 3ZNZB 2JA6B 1OO9B 3K81C 5ELCA 2KX3A 5C4HA 2L15A 2PYKA 4JG2A 1FEHA 1U9RA 4QMGA 2R7FA 3SK4A 3VR2A 4G57A 1X32A 3M3YH 2KD0A 4KV2A 3AU7A 4BOZB 2CQOA 1VZ7A 4XQNA 5KYLA 4G3XB 2QA4A 3KF6B 3HK0A 1PH4A 3JYUA 3MHSD 2B63H 4HPPA 2M4NA 4N9PA 1NY4A 5E6NA 3TS0A 2L9HA 2X8XX 4ACFA 2D0PA 3WALA 1BO0A 4TMAB 2JRHA 1K3BC 4OWXB 3RI7C 4YSYB 1DOLA 4P7IA 2D2QA 3S1RH 2MP2B 2AUKA 5G2NA 2AUJD 2O2LD 4GDKA 1GM5A 1VQBA 5DPRA 3S9WA 4DV2L 4JI0L 2AHOB 4EZKA 1IGDA 1PH1A 2ZCBA 5CMDA 1E22A 1PLFA 1QOBA 3DEOA 4YY3Q 4A55A 4Y52H 4B9KA 1GUOA 1EEFD 3I4NG 1WIAA 4YSZB 4MNOA 4M00A 1LT5D 3B9JA 3AEAB 2JY6A 1E0BA 2R2QA 2WDQB 3W5VB 1MG4A 5CTRC 1GHKA 4KHVA 3TEYA 4CKEA 2SDFA 3APDA 1Q12A 2A68D 1G2SA 5C4XB 3V96A 3L08A 4JBJA 3X3MA 1TU2B 2EJFC 4IDIA 5CHVC 4DHZE 4XYCA 4MN3A 3PUXA 3PIO3 1QCBD 1X1MA 4DR7Q 2LXCA 2AYOB 1PZJD 3NTKA 4B3SQ 5AUIA 3RLOA 2GA4B 4JOIA 5D65A 4FJVB 1Q0WB 4QB4A 4H0LC 2RHSB 4IKGA 1KJTA 3RNFC 1MBYA 1STHA 2J0MA 3VR8B 4ZAIA 3G71A 2K39A 4IUQA 4C3IH 5FO7B 1CFMA 2CWPA 4BXXG 3AECB 5CHFA 1YVCA 4MTKA 1TWFH 3AE8B 4FNFA 4JI7Q 1VD2A 4F7XA 3P20A 4MM3B 1TS2A 2D3CA 2EY2A 3KDFB 4ZKBB 1TWAH 2E2HH 1SNQA 4PMWA 2ACZB 1XD3B 1F9RA 2PPHA 2WFWA 3GE3C 3H15A 2N0SB 3DVGX 3DVNV 1KDCA 2XRQD 5EQ0A 3BWUD 3CPFA 1UGJA 4HIKA 1HUMA 1TYGB 3J81j 1MSHA 4Q5VA 2Q2HA 3L13A 3OLMD 2R7ZH 1C78A 4IUVA 1LLRD 3FRPB 2JYOA 3TQYA 1KDAA 5GQOA 2GRIA 4OVVA 3AEBB 4ARCA 4K6LA 4L63B 4QL5A 4BBSG 1SYBA 2WGSA 3LWUA 2HCCA 3K8AA 2IGGA 1HH2P 1WFYA 2D3BA 2F0NA 2LKVA 4E6IA 3MFYA 5C3EH 1F2RI 2HJ8A 1V1PA 2MBEA 2ZM6L 2KVMA 2B2UC 3PIPA 1YHAA 1ASYA 2AL3A 1I4PA 5IT9c 3E0EA 3W5UB 1TY0A 5E1FA 3RLNA 3C2PA 1WCMB 2L12A 3CD6A 2H1EA 1PDXA 2MW5A 3QCAA 3DWMA 1J0GA 1F9PA 2YTYA 1RKNA 1YJWA 1G6PA 3NWSA 2Q8IB 1ZE3D 4J3OD 1YJJA 3HOVG 4PK1A 2R61A 4DGZA 5TSSA 1V86A 4I7AA 1FD7D 2E6XA 1L6VA 4DKAC 2LVQA 2KCCA 2YTXA 3N52A 3CMMB 4LJZC 4BFRA 5ELOA 2V1CC 5K5PA 2F0JA 1GUAB 2J0KA 2KKCA 3STBD 2IY5B 4GN1A 1WSPA 3SU8X 5LXHA 2NTSA 3D4WA 3A7LA 4OELB 3IRBA 3S1NB 1WXAA 4EZLA 3GTQB 1HR0W 1X9NA 4WQOB 2F4IA 3W9CB 4KV6A 2L52A 3GTMH 1XLNA 3K7AH 1WMHA 1PZKD 2LS01 4FXCA 4IOIE 3A8JE 2K05A 3GTKH 5C4XH 5FO8B 2Y5CA 2C5CA 3CF5A 1WTRA 1JICA 4GLSC 4US8A 3HOYB 4YHHL 3VR5A 3NZUA 4KTAA 4IFDI 1PH7A 3AV8A 4ZHPA 2KO3A 3NSWA 1SR3A 1SYEA 2NVQH 4B0EA 2A69C 3NBHB 1JWBD 2G9DA 1PA6A 4AQYL 4KGRA 5C4JH 3DWAA 3Q6SA 2PNRC 4P74A 1Y8OB 4XYOA 5EPJA 1WGHA 4GMVA 3P1MA 3I73A 1HA6A 1B3AA 1XMQL 2WIIB 2WAQG 4BY7G 3HIZA 1P16A 3VYRA 4NJ6A 2I2YA 1AW7A 4KHPL 2Y0SB 1C48A 1STYA 2PIAA 1MI2A 2K3UA 2CVRA 4ITKA 1XEEA 1I5FA 2V4IB 4ZRQA 1XX8A 2OJWA 3GS2A 2L4NA 4KKJA 4IPCA 3UI3A 1VQ9A 3GOEA 2M00A 2RVLA 1UE5A 2EYMA 4PMCA 2IX1A 3EECA 2R2OA 2WXQA 1IBMQ 1YNNC 3L17A 2CHWA 3VTVA 3I8ZA 1DD2A 2ICEC 1YQ4B 3OG5A 1XWEA 4IWOA 4ANXA 2JSOA 3D3RA 5BR8Q 4LF9Q 4K8IA 3L16A 3NG0A 1VQKA 3P4QB 1EY0A 3T1HQ 3KF8A 4XQQA 3GQBA 3P75A 3A8IE 2EJMA 2L00B 4YWMA 5FO9B 2E2IH 3PO0A 4KSKC 4PMBA 1KRSA 2ASBA 2MJEA 1B70B 2UXCQ 2OJRA 1RLFA 2QCZA 4OIKA 4LF4Q 5M9OA 4LF5L 4A3GH 4W9JA 3BZCA 4LTUA 3L10B 4FA6A 2Z8LA 3V2TA 2CR5A 1KD1C 3PZDA 1VR9A 5DEHA 2VQFL 4GN4B 4JI3L 3J9CA 4FLHA 2RBMA 2KCNA 5C2TB 2J7QB 1N32Q 2PQAA 2K5HA 4AH6A 3KF8B 4APVA 3PV0A 3CCUA 4IWPA 4AYBB 4TQ1A 4JI8L 5EBCA 3A8KE 2JA9A 4F8CB 3HOUB 2A6EC 3HOZG 1LM8B 4Y7NB 2GB1A 1A15A 1YX6B 2ZXOA 3V6CB 1GUSA 2VZAA 4QQBX 1ZKHA 4A3BH 4RF0A 4YIJA 1A2UA 1CZPA 1Y14B 3NWTA 2ZTDA 1BUVT 5DNFA 1IW7C 4IPDA 1D5XC 3HKZG 1YIWA 3OIPA 2I1KA 5HI1A 4F88A 4JI6L 1MGSA 1V80A 3QQ8B 2KZRA 4IO9A 2KYWA 2OOBB 4OO1H 3U2SC 2WX0A 5H1SE 3N1YC 2IT1A 4YCVA 3J7A5 1JQYD 1VCIA 2XK5B 3KYHC 4C00A 1KLVA 3UQAA 3F2UA 1PH3A 5JJLA 3VYSA 3RZOB 2XWBB 3QARA 4IC7B 1NMGA 1Z7TA 4DAPA 3ZRFA 4YHHQ 3Q0AA 3F2DA 4JGHB 4L5SA 1E7VA 5IT9E 3U4ZA 3I4MH 3S2HH 1EFWA 1E1OA 1KQSA 3PRMB 1QNKA 5J2RA 2BWFA 3M95A 4P75A 2MA9B 1N6ZA 3VDZA 1XNRQ 1VQFA 5FR6A 3NJTA 2IJ0A 1HFNA 4BKTA 2CQAA 5C0XG 3ZGZA 4HN7A 1EEID 1CQFA 1V1OA 2EZVA 5JJKA 4LJOB 3TCAA 4O1NA 3TSSA 4JLCA 2IO2B 1L2FA 1MFWA 1WX9A 3SK8A 3GTPB 3T8MA 3B0AA 2JU6X 2PVOD 4A20A 5D14A 4HEA1 2KOLA 2MEKA 4ZK9B 3MTNB 3CHBD 1IYJB 4GDLB 4DK0A 1HR0L 3UDXA 3GV6A 4NAMA 1C7YA 3NBHA 1IUEA 1KAAA 2KUMA 2ZTEA 5JXVA 2F0EA 1RRBA 2WKDA 4HAEA 1HA5A 1S1QB 1WTOA 1EF1A 3T16A 2A6HD 2WB1B 3J7YW 1EWIA 3L0OA 1A2TA 1YQBA 3ZJTA 2PZTA 2DZJA 4A3PA 4DK3C 1RCVD 1IPGA 4JI7L 1K50A 4J8QA 2OT2A 1WYWB 2K04A 4A3MH 3MC9A 1I94Q 4H2AA 1FFVA 3KUPA 3ZTCA 1N9WA 1VQDA 1PQSA 4S17A 3Q2AC 4HVBA 5IYBG 3TREA 2MLBA 3GTQH 3K9OB 4LF8Q 2PE9A 4PYZA 1WCMG 3H94A 1E7ZA 1C4PA 4GOPA 4KGTA 4B6WA 2B63B 1I4RA 2JSVX 2JPHA 3NZSA 2WP8J 2A74C 1SE2A 1F2RC 4HKQA 1X6OA 4DV3L 2DUDA 1NYRA 4HKZE 3U7ZA 3UI2A 3KUZA 2KTRA 4N59A 4E74A 4ANVA 4WAAA 1IL8A 2ZZPB 2WNMA 3BINA 2MJ3A 1D6EC 2LGDA 3AM9A 2J7ZA 5EE1A 1RF2D 2K52A 1WFQA 1XLOA 4NDXA 2ZM6Q 3NBIA 5T1GA 1LTBD 2AWTA 2RA4A 4ZDVA 2QDBA 3WANA 2M8SA 4X6AH 5AEKB 3A7AB 3PSIA 1RJTA 4BVUC 3NZ3A 1EU4A 4IG7B 4BA1I 1FNUA 4HIDA 3MHZA 2O4XA 3GTGB 4F1SA 3E9SA 2YLMA 2W54A 4C3JB 1F2MA 1O7IA 1QZGA 2GN5A 1CMXB 3QIAA 4KI0A 2XIWA 1PH9A 2EELA 1SNDA 4GNXA 1GUNA 2B2WA 2WU2B 2SOBA 3A56A 3R2IA 1X3QA 2DYBA 1L2NA 1WX7A 4KK7A 4DR4L 3FPPA 2CFMA 1S5FD 2LEKA 4FF2A 2LD9A 1D1KA 2O2VA 1Q1BA 3BDOA 4IJHA 2L8JA 2A19A 3VA7A 4G7ZC 3I70A 1VQ4A 3K80C 3HKSA 5IAAC 5IGDA 1BQQT 5FJ8H 3C1EA 4KJNA 1P1AA 2INNE 2LJ5A 3ZVVA 2WXGA 4PYUA 4RGNA 4R4IA 4I65A 1CKOA 4A3JB 3HZXA 1WZ0A 4X66Q 2LVPA 5C44G 2WHIA 3B2GA 2K25A 1XNRL 1H9JA 2IY0B 4WJ4A 3NTHA 1NVID 1P7EA 1LTTD 1QKZA 4WWOA 2B8FA 3DHHC 1WGDA 3R3OA 1WF9A 2FCMA 3NVZA 4CO7A 5CV6A 1JT8A 1YNJC 3J80E 1GB1A 2YTVA 3H7PB 2CHZA 4A3FB 3RNCC 2HD3A 2K5VA 1TZ1A 2BB6A 2BWES 1S5DD 3BY4B 4DR5L 3Q3OC 3CRLC 4XX5A 1RD9D 3SDLC 1AP0A 3TMPB 2JA7G 3D31A 4ZUIA 1BCPD 2VH2A 1LQBA 2WWZA 1PTOF 5ELNA 5IP9H 3S2DH 1WZ3A 4DV5L 2LY7A 1GC7A 1TKYA 4TQ0A 4HJKA 4K5VA 3IT6B 1P98A 1XXGA 3PO2B 2OTJA 5AZFA 2KJHB 3BK1A 2MRPA 3MZ5A 1P0RA 1B2TA 1WJ6A 1OXSC 5GADC 3NENA 3Q8BA 3STBC 3O13A 2BDOA 1IBML 1IYUA 2Q8TA 2K5DA 4OO1I 1HJPA 1QOHA 4DU9A 4A3IB 1E1TA 4JI4L 3PREA 2YU9B 1K9MC 4NW2A 5BN3A 1LTSD 2KLCA 4CDDC 4JPSA 3DBRB 1Q81C 4UP8A 2VW9A 4NQLB 2KAJA 5M3MB 2LUEA 1LUZA 4POFA 5JJIA 4ZRIA 5J17A 3T53B 3AN1A 4LNOA 1DOXA 2LXJA 4BA2I 2LMCB 2MQHA 1R4MI 3ZO5B 2FMCA 2RCNA 2BE5D 3OAWA 2A69D 2EY5A 4XZ4A 4UPAA 2PI2E 4ZQ3A 3IHPC 5EPLA 2EJGC 3C8YA 1K8RB 2NVTH 4OEMB 4I7ZC 4JV5Q 1C77A 2BKFA 4YT0B 2UUAQ 2Z0SA 1Z5SB 3TJPA 1H9RA 3ULLA 3TZDA 1QG7A 1YJ1A 1L1OB 2I5HA 3JVZX 3OPOA 4HCPB 4C7ZA 1NENB 1Q8KA 1EOVA 2NPTB 1TWHB 3NHEB 1C8CA 3OMGA 3SR6A 2VUMB 5HKHA 2EKIA 3ZNGC 5I4DA 3UQBA 4CYEA 3S17H 3DCGA 3VFKA 2G4DB 2DX5B 4JI8Q 1BBWA 1VQGA 2FIFA 3VQIA 4Z9CB 1NE3A 2R3ZA 4CDEC 2MHVA 3GDEA 5I9PA 1I7HA 5AZHA 4OWTB 2NZHA 1EQRA 1EIYB 2PNHA 3GTOH 2RDBC 4RF1A 1V6EA 3DEPA 2HTHA 3QIJA 1B50A 2FAZA 3SFEB 3A9JB 3UE1A 1XYIA 4MGIE 3TN2A 4JI3Q 4NAWB 1KL9A 4QIWB 5ELEA 2DNCA 1CI3M 4DV0L 2NVYB 5EKKA 1N32L 1K52A 2IO3B 5CHWA 2LXAA 1HZ9A 5LMUQ 2H4OA 3M85A 2JZ3B 3CSTA 4IN3A 1DYQA 1WI5A 2NN6H 3G48A 3QO2A 4DR6L 1E8XA 4PS7A 3ZXVA 1C9FA 3OWFA 3GTKB 4A3OA 2OXPA 4FXGC 1QILA 1YNXA 4R4TA 1X3EA 1M1KC 2B2YA 4JI0Q 2GOWA 1NI3A 4DNRB 1Q46A 2V3NA 2PJHA 2N7JA 2WLBA 3K6OA 2ZNVB 5JHBA 3SDZA 3G6JB 2F0HA 4ME5A 3Q8FA 2HT1A 4A3BG 4BS9A 1NCVA 1FL0A 2E3TA 2K8CA 1XCQL 1JOKA 4OX9L 3RLFA 3GZNI 3PUYA 4RHRA 4H02A 2XK5A 4AS1A 4GDLA 1K0RA 1QE6A 1WM2A 2Q2IA 1NJIC 1I6HH 1SB3C 2D10A 2Y5PA 3RNBC 1DGJA 4WJNA 3ENEA 3GB1A 4WJWA 3QK0A 2D3GA 1MI0A 4WJ3M 4BZAA 2OEDA 1OXXK 4C2MH 4OIJA 3AFQA 2KWCA 1YJ9A 2E2DC 4JL9A 4LDTB 2A8VA 1MVKA 1G6JA 1S40A 4OZBA 4DN4M 2JA5B 1IKLA 1S4ZA 3R7RA 3I4MG 4A9AA 4J1MA 4HPLB 3NELA 3P63A 1O7ZA 3HEJA 2B63G 2BVCA 3MAQA 2MCNB 3LB8C 1ICWA 3AI5A 4WQMA 3U4VA 1PFBA 3G4SA 4A3KG 5KNDA 3PO3H 1SGHA 3EIVA 1XLPA 2J42A 4IM0A 3VR9B 4RHSA 2KCTA 3K0YA 1QUQA 1N34Q 5HGQA 4JBMA 3MHBA 1QOGA 2A4ZA 2GI9A 4XWTA 3M4QA 2Z0DB 3EHVA 2E5LQ 3A9KB 2F0LA 3C0RB 3N3KB 4B3MQ 1TS3A 4XTCS 1PRTD 1FR3A 1JE4A 1EYDA 4CHKA 2G45B 1TWAB 1X65A 1EY4A 2E2JB 4FF1A 1XPRA 1K83B 1NBWA 4QY7A 1GUWA 2FMMA 3EQLC 3HFZB 1SE8A 1IXRA 3AEVA 1E5WA 4HPMB 4LF8L 1SYDA 4LDTD 1TWFB 3OIQA 1IYVA 3NHHA 3ZDTA 2ID0A 3BS1A 3RN2A 1WGYA 3TEHB 4J15A 5KNBA 2Z4IA 3S1RB 2V3SA 2ZW0A 4AQ7A 1FGBD 2AQ1B 4F87A 1R4PB 4XQJA 1W6KA 3ZJYC 1ROEA 5D3IB 4DXFA 3ZTDA 1XMOL 1J7AA 2NVXH 1U4MA 2ZPNA 3Q3FA 4GSWA 1J5EL 2PE6B 1Q8IA 3K9PB 4MZ9A 2HUGA 2V0GA 2N3SA 2NVTB 2CU3A 4NJ7A 4RH6A 4L1BA 4ME3A 1B9NA 3QG1A 5IYBH 3CCEA 2JZPA 3QWZB 1I4QA 2ENBA 4BXXH 2X6LA 3CP0A 3VYUA 4MACA 4QF4A 4DV3Q 3CQZB 2FBWB 1STEA 1G91A 3IFWB 4ZRJA 3ZW3A 1GHJA 2JA7B 4BWGB 3R7QA 4PV1C 2IWHA 4HJ8A 2BYTA 1H4RA 2WDVB 1PFNA 1XJVA 2D11A 2C7NB 4FO2A 4H7BA 1PFDA 4HXDA 3S1QB 3ML9A 3M7GA 4K7WA 3OWEB 3U50C 2K4KA 4YTNB 3D0FA 2DJGC 1U5KA 4LFBQ 1SSOA 1E2ZA 2RQXA 2UUBL 1Y1VH 3FDTA 5JVH3 1PUTA 5C3WA 4M0WB 3IFTA 4A3IH 2IY1B 2KJRA 3A0JA 2LFIA 1VCBA 1KXLA 1LTGD 5IY0A 3MEHA 2QF7A 1QJOA 2C7MB 1QT9A 4HIOA 3SK5A 3W2DA 1ENFA 3Q8EA 1S3OA 2I5LX 4BBRB 3PLUA 4KDIC 1E6EB 1RWSA 5D6JB 1PYSB 1WGKA 2UWQA 3K7AB 4TKOB 4O0AA 5C6AA 1YD8U 2Z9HA 3S16H 2PW9A 4CKBA 2YEPB 2FE8A 1OQYA 3K7UC 3WOEA 3ZUNA 3H3VI 2VZKD 2R92G 2KHWB 5E4WC 2KFKA 2INCC 4K2LA 1MHHE 4GGQA 3PZ8A 4POGA 3S14H 4LF6Q 4KSLC 2K5NA 1Z47A 1QF6A 4YWKA 4UAIA 4PQXA 5FLXE 3FAHA 1J19A 5BMIA 3EUB2 3I72A 4W9FA 2JA8G 3PGEA 1IL2A 1HNXL 2UXBQ 5C44H 2VY3A 1L5PA 4FJYA 3JC66 4X3KA 4LLGM 1AYFA 3PCOB 5EE3A 2ES2A 4LF9L 4OVUA 1SJED 4RFBA 4K0KL 1L4ZB 2R92H 3Q3JA 1BT0A 1SNCA 2KQ7A 1EY5A 4MELA 3H0GB 2VXWA 3BYTB 3HKZB 1GVPA 4ZUJA 3MTSA 5JEAH 2AWOA 4BY1G 1I3QB 1AE2A 2LFNA 3GTLH 3DWQA 4M0WA 3RZDH 5C5LA 2MO0A 1CHQD 4XGAB 3ZDMC 1B3QA 4XC2A 2BH2A 4GLAC 1AFPA 1PV4A 2BH8A 2X6GA 3T51B 3MP9A 4DR2Q 2ZJPA 4FDBA 2IL8A 3DMUA 1EL0A 3QJYA 4ZRZA 4C4VA 1U4PA 1H9MA 1LT6D 1L0XB 2RDHA 4C7YA 5GXGB 1IBLQ 1ILQA 2OWOA 1G8ZD 2EYLA 1SEBD 1VQMA 4KD3A 4I6PA 4RAUC 4A3BB 3FKIG 1YMHE 3VA5A 4G7HC 4DAVA 5TR5A 3KDFA 1SMYD 5M3FG 4Y7NH 1Y8NB 2INPE 2EYHA 4RMAA 3I3CA 3CCMA 1RM6C 3R93A 1YN4A 4C3IB 2EDGA 1AZPA 1ZUD2 4DV7Q 5FLMH 4R8IA 4E3CA 2UU9Q 3EGRA 1B4OA 1JB3A 1LABA 4LNQA 2PTLA 3SHQA 4DFAA 4IPHA 5CX3A 1MJEA 4K14A 1O7YA 2NWGA 2XNAC 4JV5L 4WURA 3EFCA 1ZXHA 3VHTC 3ZQ4A 1SE9A 1YQ3B 1Y69U 2QEJC 4LK0M 4U673 2C60A 1Q90A 2G3QB 2FCQA 2N9PC 3HOXG 4HCNB 3W5OA 2I5MX 3W1BA 3Q8AA 4ZRKA 2JYTA 2V9HA 3T13A 3K58A 2IX0A 2CWAA 1SYGA 3DBHI 3KLSA 1SE3A 4MSMB 1M4VA 2J4XA 3KOJA 3P4SB 1VQAA 5BN5A 5KEEA 4MJSB 1EOTA 5EE9A 5C3XA 4A3LG 3CCSA 1ZEQX 3CKIB 4HSVA 1TWGH 2DYMA 3H6MA 1GJZA 1PFMA 1TY2A 1EZ8A 2GBMA 1LV9A 4L23A 2HD5B 2MWSB 2IW3A 4HWIB 2DENB 3MC0B 3HOXB 3L4PA 1E10A 2BB5A 3FILA 3HOUG 2QILA 2L0FA 4EUTA 5KHQA 4IUUA 4M8MA 4JW0A 2AEHA 1WD0A 3GTGH 2N9LA 2QDFA 3PRZA 1UBIA 2L76A 4BKSD 3RD4A 1EY9A 1WOCA 4A3KH 3PO3G 1UGMA 2ZNVC 3N9YC 3IVFA 2OF1A 2VB3X 3M4OB 1XMQQ 3KF6A 5I6YA 2O5JC 2ON8A 2H88B 4LF7Q 5LNK1 1IKMA 1WM3A 5CORA 2EVBA 3PLVA 1LGRA 4FHKA 2LI5A 2C35B 2ZEQA 2HTME 1ZPSA 3I3TB 4LUZA 1WTXA 5CV9A 1D5ZC 2KC1A 4NQKE 4B3RL 4W9DA 4MJSA 5C4JB 2Q2TA 1BUIC 3VUXA 4NB3A 4NNJB 3W1SC 2ZXPA 4KHZA 1STBA 4P1CC 2F3VA 2N8NA 1EYCA 3KH0A 3GTPH 4RM9A 2GBJA 2DJFC 2JWUA 1SAPA 2G9HD 1SIJA 1V8QA 2NYZD 2EE1A 3NTIA 2DHZA 4DUYQ 1I94L 3M62B 2O5IC 2IGHA 2AKWB 2QSDA 3V05A 3NQTA 5E6OA 3K59A 1GOZA 3T56B 1TIID 2FUG1 4P16A 1OEYJ 5CBAE 3H1UA 3VYTA 1C9OA 4JI1L 1TS5A 5M5XB 3HRDD 2MUYA 3CC7A 1I6VC 3SFDB 3H0GH 3OTOQ 3K5OA 1EO6A 4X65Q 2EKEC 4MGZE 1WTHA 1QB5D 2N78A 1JWSD 3RUZA 5BR8L 5G5GA 3W1SA 1KABA 3R66C 4LFCL 1DCZA 1VMCA 3T1HL 1JMLA 2VH1A 1IBXA 2N9XA 4RA8A 4ULLA 3QC8B 5LMNW 3KVFB 1HZAA 1K8OA 2INDC 1XMOQ 1ZP0B 3TEZA 4MSQB 4FBJB 5J3BA 3J81L 3NP8A 3B08A 5D94A 3M9BA 4BBNF 3T3OA 2CW0D 3F8TA 3Q23A 1JWUD 1LACA 1H9KA 4GKKL 1Q86C 2NZ1D 1Q5WB 3U9OA 5ELDA 4LF5Q 3CCVA 2BKRB 1WXMA 2BS2B 1UE1A 3C3LA 1KRHA 5G5HA 4IALA 4P1BC 5GMVA 2K9XA 3RZDB 4L6TB 1DOYA 1J9OA 2KA7A 1RIPA 4JVZA 2J0JA 3CPWA 4PZ8A 5IE8A 2F0PA 1ENCA 2KHJA 4KN4C 5DLQE 4UY8C 5CC4A 1Y1VG 1E2WA 2LHEA 2NB0A 5GAHC 2FCSA 3AULA 3ZYYX 4ICVA 1MKHA 4Q2JA 2QC8A 2R92B 2VRRB 4PS3A 4UDUC 5KGUA 3S15H 3HOZH 4WJQA 3UE0A 2NVXB 3FP9A 4HJAA 2UUCQ 1EUJA 2JK8A 2KX0A 3P2BA 2ZT9C 4W9GA 4GOCA 3VH4B 2PPBC 2GVAA 3QJZA 2B2YC 2ONQA 5E6JA 3H3VH 5IP7H 1C3TA 4JI5L 3SK6A 3W1YA 2B29A 1JCKB 1ET9A 2WACA 1B9MA 3RULA 2KDFB 1Y1WB 3L7ZC 1HQMC 3A5UA 5E3FA 2LASA 1N61A 3BDCA 3HKZE 2LVOA 3CCRA 4OZAA 3BYYB 4IZ8A 3TP7A 2VQEQ 2G4SA 2MPMA 5I6WA 5I9OA 4FULA 4LCDE 5JPNC 1R4NB 4N8FA 1HXYD 5AJ3L 2O2VB 3J7AF 3A33B 4C3HH 3KJPA 1PZID 2WAQE 3T3NA 2K14A 4JYAL 1VQHA 1SSNA 3J7ZC 3KYCD 2L32A 3QA8A 3RNEC 1WCMH 4HJ7A 3HGBA 3KBGA 1N33L 3NOBA 1WJJA 5FR3A 2SAKA 4DK5A 1C4QA 1Y1WG 4YCUA 5IGCA 3J7AV 1ONLA 3VR3A 3GTMB 1IW7D 3UDFA 1PFSA 4FYDA 3A1QB 4DUYL 2SNMA 2F0TA 3ER0A 1R9TH 2QMTA 3VUYA 4IW0A 1L4DB 4DR1Q 4XE0A 4QCLA 2E76C 1LTID 2H5XA 2RDGA 3I91A 3BU2A 3HOYG 2BW2A 1E2VA 2B2VC 1IBKQ 4UP7A 1FMAD 2XVSA 3L2PA 4MTNA 3U8ZA 5H8YE 4HROA 3U58A 4WWPA 2R6GA 3L3OC 4QGUA 4KIKB 4AOFA 4X65L 4W9EA 2UXBL 3JSVB 3E0JA 4EGVA 3KJOA 3VDYA 2KCMA 3OW7A 3UF8A 2E2HB 3KLSX 4Q0FA 2I46A 1CJEA 4CDCC 2G5DA 1HNWL 3UIPB 3VAWA 1UF0A 1XNQQ 4A3CG 3WIMA 1GXDC 2JWZA 1C4CA 2K6AA 2MFIA 4GLVB 2R93G 1ZDVA 2KWUB 3HG9A 2KQ4X 2RPVA 4RM8A 2MGSA 2QKIC 4IM3A 2IX3A 2AL6A 3DHIC 1Y56A 4KLKA 2L1AA 2I07B 2F0OA 3PUVA 2G1EA 3AXCA 3Q14C 2L0TA 3U7DA 2KTRB 2N7EA 2RHQB 3IKJA 4DV0Q 4LUOA 2LMCA 3N32A 3PHWB 4JE3B 1B9RA 3MXGA 1F2ZA 5L83A 5DM63 2CKHB 4US9A 2VNUD 1WTWA 3ND8A 4CGYB 4BBRH 2WB1E 4MHEA 4PNYA 3PIOA 4P72A 1H9SB 2CS4A 3WOFA 5FLXc 1UH6A 2RSUA 2UXDL 1RAXA 3OJ4B 4JX1C 4MM3A 4B0MA 1NSNS 2R93B 2A6HC 5FK9C 5M5XH 3EFUA 1GC6A 1VQ6A 1EWHA 5C4XG 2O6VD 4CJ0B 1SMXA 4DAMA 3PO3B 5FJ8G 4GZYC 1C4AA 1E7UA 2FCNA 4IFDG 1EYAA 2QDLA 3JAMi 3I5JC 4LFAL 1MIUA 1O7LA 4C56C 4A3LH 4DAYA 5AUKA 4J6HA 5DCNA 1HUNA 4DR7L 1XTDA 3VRAB 2K1FA 1VF5C 2V3PA 2QIEB 4USAA 1TKWB 2LUMA 4O2DA 4DXGA 1T0QC 2CHBD 2WS3B 1J6QA 4A3DH 5FLMG 2KQ3A 3HOUH 2HJ1A 2KHSA 3I56A 1F9SA 3N1XC 5EJWA 2RCFA 1FYCA 1GKHA 5BN4A 4BY7H 1N5XA 1ISNA 1RFKA 2GBNA 3H7PA 3I7FA 3M4YA 4O42A 1ESRA 4B9WA 1SNMA 1D3ZA 1E0ZA 5BMGA 1L7YA 3K5MA 4HCSA 5IODA 2IBIB 1FCCC 2Y5BB 2WXOA 4DV2Q 1PH2A 3RNAC 4GXBA 4AP4C 2LZ6A 5J1ZA 4X66L 1SNOA 2EIFA 3BDLA 2LGSA 3HM3A 3S1QH 1JORA 2IGDA 3KK7A 4XIGS 4W9IA 3I4NB 1U0LA 3N20C 3RZFA 1MJCA 2EXDA 4ZKCB 2GMIC 1X54A 3NRZA 3JAMc 4F8MA 2D62A 5HY6A 4EX5A 1UE7A 2K32A 5IYCH 1Q1EA 4X64L 4A75A 2Z6KC 4R3DA 4A90A 4JWUC 1SYCA 5LHY1 1EYGA 4NXNL 4JI2Q 1LT4D 1WR1A 2WX1A 3AQQA 3S2DB 1KNAA 5CV7A 4B3ML 5KYIA 2JUOA 4L5QA 1VQ7A 5JJZA 1TWCB 3E3XA 4GLXA 2KNBA 2KBNA 4QJFA 5ELBA 2B2VA 3BG3A 4NAWA 2MBHA 1STAA 5IGGA 3ICEA 1R4QB 5JH5C 3DOWA 2XN9C 3KWLA 3SGIA 1NEKB 3CCJA 2YVCA 4EFOA 4K6DA 3S24A 4KZ0A 4LAAA 4MIUA 1PXUA 4V190 1MG8A 2DZMA 4N9F4 3K5LA 1UUPA 3NE5B 5COYA 5FLXL 5I2XA 1EWYC 3U30A 1E7PB 3JAML 4EEWA 1O78A 5EDSA 2EYOA 3S14B 2EXZA 1OEYA 3DBLB 2JQRB 3E6ZX 3HOWB 3K57A 3NVVA 2BGFA 5IWAQ 3I4NH 3CAMA 3ML8A 3PF5A 3TBIB 2UUAL 3FMCA 5LMUL 4HJ5A 2E2JH 4KY5A 2BQQA 3U52E 4TUUA 1AZQA 3ZLZA 3QOLA 2NBVB 3CCLA 1A0IA 3IL8A 1L0YB 5KHOA 2QGQA 4DK6C 2JF5A 4P73A 4FXDA 3LWEA 1K53A 4A93B 2HE7A 1QOAA 3QX1A 1GG3A 1FVIA 3A5ZB 4ANWA 2A6ED 2F0VA 2K03A 5MPOA 1I6HB 1P7FA 2EYFA 3TS2A 3ND9A 5G3LF 4BBSB 1CTMA 4E71A 1VQEA 4MGKE 1IHZA 4CKCA 1EIGA 2F0FA 2HDMA 1UAPA 1T0YA 3BZDB 3D4DA 3PTFC 2MH7A 3WAOA 3AEFB 4MDKE 1EIHA 1QWYA 4AIMA 1HRJA 2W3SA 3APFA 4ZLTF 2L5TA 3Q8DA 2PQEA 4ICUA 2WXLA 1VQJA 4CQNA 2RD0A 3GZNB 1JC7A 4K81A 1YEZA 1A62A 1YN5A 4RKLA 5IOIA 4KHPQ 1WRIA 4K3CA 4DUZQ 2OQKA 3A54A 3ZJUA 3G6EA 2J0TD 5E4XA 2WXNA 3A4RA 3CSFA 4B3TQ 4LNIA 4K5WA 4MGYE 4BAXA 1K28A 4IUTA 4B9XA 1HTQA 2MNAA 2K7VA 1C1YB 2LXKA 4JBKA 5K36G 5JVG3 2K5PA 1XO3A 5EGTA 3L9AX 3IBEA 1EF5A 3TBLD 3CMAA 3CC4A 3ONAB 1WH3A 2LWPA 4JPBW 1VQ5A 1STGA 3LXFA 2K5QA 4GNXC 4FP5D 1WX8A 2N4FA 1N34L 3EJIA 2W82A 3FILB 1K8GA 4K8JA 4C3JG 5C3EG 2KJXA 4HSPA 1KC8C 1WGRA 1ICFB 4PZ6A 2KEDA 1CUKA 3PZ7A 1BXTA 1VQLA 5DAUA 5T1IA 1I4HA 2DBYA 4IM2A 3DM1A 4KKUA 2R7DA 5J22A 1VJKA 3TEWA 1JROA 1NTGA 1KLGD 1CK1A 4R1JA 1FJGQ 1PGXA 1XLQA 4HTHA 1OTCA 1CQVA 4JYAQ 1ZOYB 3ZIMA 5C0XJ 1A3TA 1ENAA 4AQYQ 4JIOU 4GN3B 4ASWC 4QIWE 1CT1D 1CHPD 1JOQA 1BR9A 5FKAC 1A3VA 3RYTA 2L0CA 1B7YB 2M0AA 2JA6G 2HDLA 3RFZB 2VQFQ 2KENA 1QOFA 1LTLA 4DV4Q 5A35A 1KHIA 3TMEA 1WTPA 5IGBA 2HDEA 2ATWA 4X62L 1J5EQ 3RR5A 2PW5A 4A3CH 2UYZB 4S0RA 1Y8RC 1IBKL 3DVGY 1WGGA 1HQRD 3PIP3 3PO2G 4C4VB 4DR2L 1M90C 1NYQA 1I42A 3DLLA 1B1ZA 1SF0A 1HTLD 2M2LA 1XT9B 2FUHB 3AE2B 2FHTA 5E7NA 1TZOA 2YEPF 1V81A 4A3MB 3V62A 1WWTA 3I9V1 1V8CA 2KWDA 1XPOA 2DZIA 4MH0E 5A2QE 3M63B 1EWCA 3VTUA 5IGFA 4EVOA 2PI2A 4BBSH 4M01A 2NZOA 1VRAB 2JRIB 3I2ZA 3CC2A 2KVRA 3ALBA 4IUMB 4XT1B 4NJCA 3VTWA 2NR2A 1WXSA 3DHQA 4PT5A 2WXHA 2FFKB 4GIVA 4UP9A 1BBXC 3IAS1 3AH7A 1JWMD 4FN2A 2BTEA 4C1NK 3OW2A 2LGIA 2KTFA 3PRPB 4LNNA 4ZOHC 2F3WA 3X3NA 1R9TB 4X3UA 2XSCA 3GTJH 4A3IG 3B1LX 3LYYA 1ZGUB 5DPWA 4DV6L 3PF4A 1F9QA 2YU9H 2I0QA 2ZJDA 1LYLA 4K7UA 4NZLB 4W9HA 4DV1Q 1S72A 5LMNL 4FF3A 1L0VB 3RT3B 3PQIA 2OTLA 4BY1H 1K51A 3J81i 4K2KA 1BBUA 3HM6X 2I1JA 1NAPA 1SROA 2VUMG 1DGSA 1ZXIA 3HOZB 3S15B 1X3FA 3TRZA 3GD7A 3KW5B 1IYFA 1E8ZA 3UIOB 4K7SA 2PMZE 4F7ZA 4B3TL 1EY6A 1II3A 2CJNA 4DDGD 5BMHA 4RGMA 4X3SA 5LLIA 3NEMA 3F1ZA 5EAYA 1OQQA 2B2WC 3A74A 1TKEA 2QCPX 3L54A 1LXDA 3K0XA 4ZRPA 2BA1A 4N8X1 4U68A 1ZXTA 2VUMH 4C1NI 4EZJA 1TWHH 1TTNA 2QW7A 5KIXA 4LFBL 1TGZB 1V9JA 3NUCA 4DPGA 1FCLA 2UUBQ 3EC8A 4AJWA 3AE4B 4YTPB 3PO2H 1WR6E 2AX5A 3U4EG 1YX5B 3S1MB 5M5YH 1H9SA 2FJ2A 2V4DA 2BYEA 4G0NB 4QAYA 1AE3A 2MQJA 3I4OA 1EQTA 1WD1A 1MPEA 2KN4A 3C46A 1J7CA 2JQOA 4B3RQ 3L0WB 3T4AC 1PMRA 1IZ6A 4IFDJ 1BKBA 4DXAB 2D3AA 2BF8B 1BCPC 1DONA 1QZEA 1M94A 2RMMA 2M56B 5IA7A 1PTOD 3EVQA 2MJ8A 2NN6G 2D5GA 1A8VA 2F4VQ 2N1VA 2Y0SE 1SBBB 1ZYRC 1SNPA 5M5WB 4DWFA 2DY7A 3D6WA 4OL7A 1OQRA 4A3GB 4WWNA 2ZW1A 4G4KA 1T3QA 1UBQA 4GDKB 5JEAG 2NBWB 3JAME 3AMUA 2DAFA 4LF6L 2C9OA 1SDFA 1GUTA 2F52A 5EKIA 3BIID 3HUIA 3MJWA 2NBUA 1F77A 1NDDA 1X56A 4KN7C 4JBWA 1I3QH 2RR9A 4DR3Q 3JW0X 4YSXB 2L7RA 3I63C 2R93H 3KUDB 3S16B 1JOOA 4KD4A 2DLBA 4RWSC 4DF7A 5C0XI 1KRTA 4JK1C 1B44D 4FF4A 1I35A 1YJIA 1IBXB 4LNFA 4K0KQ 5HGTA 3U9SA 4OZCA 3FEWX 2QJLA 4LFCQ 2BE5C 2WDTB 2ZXRA 1SN8A 1QVGA 4A3GG 2WYQA 4NY0A 4OGQC 2W3RA 4TQUS 2M1MA 2A73B 1SJHD 1X3GA 1ML0D 2AWNA 3GTOB 1WYDA 3F2CA 5JAVA 3C19A 3V61A 2KECA 2GBKA 5A2QL 2JA5G 3Q22A 4KVGB 1JWAD 2K1BA 5AZGA 4GN5A 1D1IA 5GROA 2ZTCA 3X23A 3M3JA 4A3KB 2KANA 2KQSA 3TP6A 5LMNQ 3DVNU 4XYQA 2MO1A 1P9DU 4AYBE 3CWIA 1K73C 4HRSA 2REXA 4IWQA 1C0AA 1KH0A 3AEDB 2E2IB 3MXUA 1VQNA 1F9JA 1VDVA 4CJ2C 3RNGC 3KYDD 2PZUA 1EUVB 3RZWC 1VZ8A 1KIXA 2WP9B 5DPTA 2GBRA 3MVVA 4RNAA 1NBFC 1GUGA 4A3FG 2WV6D 5CV5A 3B2FA 3J80L 3RPFC 2N49A 3QAQA 1T5EA 1A70A 1TT5B 2Y0SG 1EY7A 1L0WA 1YNTE 3DBSA 3E9HA 3S1NH 1N63A 3HVDA 3QB3A 2JEAI 4JI5Q 3P4PB 2N9EB 1SRUA 5K36H 1UEBA 4RGTA 1LTRD 1TQOA 2D5DA 3RN5A 1Q10A 3UDGA 3BK2A 4ODGA 4WH4A 1HTOA 2Z59B 2DYOA 1J8CA 1D4BA 5ELFA 4HIMA 1OTRB 3SD5A 1EY8A 4WFN3 3VRBB 4TRDA 4HK2A 4R4OA 2D07B 5JEAJ 2DZKA 2WXMA 2M9VA 4DUZL 2BCOA 5M3MG 1SMYC 3DHGC 1FFUA 4ABNA 1AH9A 5KNCA 2UU7A 5C44B 2OEOA 3M4OH 4YY3L 1DOKA 1WJ4A 3WDNA 2V4LA 3AE5B 1B8AA 3SXHA 4W9LA 3NVYA 1RL2A 1ZYRD 5HURA 1WXQA 2MHJA 3Q69A 1QVCA 2JJQA 1YITA 4GNXB 1WJNA 1VF7A 1SE4A 2ZCCA 1CKMA 4A4IA 2TSSA 1D2BA 1UELA 1CA5A 1XQQA 1JJGA 3NUHB 5HFYA 4H13C 1W3SA 1TWGB 3HHMA 3PV1A 1SLJA 4XT3B 1YHBA 3AFPA 1EQQA 2F0IA 1J8IA 4YTMB 1EQVA 1WJUA 2IO1B 2DGYA 1U4AA 4DV5Q 4AYBG 3OMCA 1LFDA 3Q6BA 4FHJA 3MXNB 1WRDB 3PUZA 1JR0D 2PQAB 1PRTC 1L6UA 4WAFA 3V6EB 4YXDB 1Q82C 4P71A 1VQIA 3JSVA 2JE6I 4HR7B 1BNZA 1K8MA 3OTOL 1JRPA 1R4MB 1CSQA 1V2YA 3AE7B 5LXIB 1NUCA 5T8IA 4ZHOA 4H44C 1XNQL 2TMPA 1H8CA 3Q3NC 1UZXB 2AQ2B 4L5TA 3T1YL 1V1PB 4N6EB 1OXVA 1Z6HA 5F2DA 3B6YA 1A63A 2JA8B 3D32A 3E5SA 2LRWA 4DR6Q 3FVQA 3NS8A 3A1QA 1VQOA 3MJ5A 2NN6I 1VQPA 4ANUA 3M7NA 1E8YA 1MD2D 1C76A 2WXJA 5BYQA 4HDQA 2NVUI 2UUCL 5NUCA 4MT5A 4EKUA 2EPBA 4DV6Q 3H0GG 1UNSA 2EQSA 3Q24A 1B53A 1FPYA 4FXKC 3ERSX 3GE8C 3V60A 2HIXA 1N5WA 2C5LC 1WE7A 3S2AA 3ONSA 1ET6A 2ZVNA 1A3UA 3D6CA 1E90A 1VDZA 3MXNA 2X69A 3NS1A 2PW7A 1QNUA 2CH4A 2K8HA 2N7DA 2H89B 4ZCKA 3A55A 5IOCA 1KDBA 1LO5D 1WVLA 3HS0C 2WB1G 2A5HA 4GKKQ 2EY6A 2KFKB 1F52A 2CCZA 2KVZA 2MX2A 4W9CA 1AN8A 2A1AA 1YOVB 3J81E 1ASZA 2B39A 1UEAB 3A4SC 3LJ3A 2P5ZX 4HJ9A 2MJDA 3Q8CA 4C3HG 2FNJB 3KLWA 2J53A 1DJRD 2F0GA 5IT9L 1YNJD 1HHVA 3ZKJC 3KBXA 1F1HA 3NVWA 3CF6E 4NP5A 3TUOA 2IHEA 2WINB 3ABVB 4KZCA 1FO4A 1N36Q 2C7HA 4HLEA 2IZVB 2SNSA 2BS4B 2CU1A 4BKSA 1TT2A 5FOBB 2RSOA 3R8BA 1T6BX 3DQVA 3E56A 2K01A 2VQEL 3MC8A 4JQWC 1PYWD 3BVMA 2EY1A 1XPUA 4HEDA 1ZW7A 2NMQA 1YBYA 3PPAA 2L05A 3F2BA 1ILPA 4B3SL 4LF4L 1M8AA 3E9IA 3P42A 3EN2A 2XWJB 5CGKA 3ZRCA 1PYBA 2XBBC 2PO4A 4G50A 4OXPA 1N33Q 4WJOA 2KHIA 3I57A 4URKA 2IPKD 2K75A 3J80i 3KLRA 4DA2A 4XDDA 3X0WA 1YI2A 1X55A 2R7ZB 2WXRA 3AE6B 3HOYH 1E8WA 3BJUA 1GAQB 1D5MC 1RTOA 1VMPA 4ZYSA 5C4ZA 2L3ZA 1O80A 4V0BA 2BA0A 1K3RA 3PUWA 4HMIA 1UWXA 1X3PA 1P8LA 4GOPC 2E74C 3M3YB 5JPMC 1KAWA 4XWWA 2FXQA 2KJ6A 1I4GA 4L8JA 3H7SA 2OCEA 2HCIA 4ZYNA 2CKZB 4DR3L 4P2CB 1E24A 2V1YA 1R4NI 1BOSA 4AUQC 3LX0A 3OJ3A 1I4XA 3ITPA 5LL6S 3N1ZC 4NMZA 1PGAA 2M0XA 3AE1B 4GKJQ 5IWAL 4OWWB 3GTLB 2MP1A 1D8LA 3P4RB 1PHJA 1DM0B 2JA7H 4JI6Q 3AEGB 5DPSA 4A3JH 2GLSA 2K28A 3C1FA 2WDRB 1LT3D 1G291 5IKCM 3DUZA 1YIJA 1HNWQ 3NK9A 1I50H 2B76B 2JXMB 2VB2X 2F03A 2DNEA 3O65B 1XCTL 3FPUB 4KY7A 2BS3B 5D2MB 1BF4A 1PTOC 2KMCA 4HDOA 1P3QU 2N88A 3CXCA 1CZGA 1VLBA 1QUQB 1WTQA 2LGYA 1TBEA 2WAQB 4BY7B 1DOMA 4WJPA 5HHDG 3BVGA 4RG1A 4RMFA 2HQLA 5C3EB 4KDLB 1FM0D 4JCVE 3AYHB 4KY6A 4RKBA 3HOVH 1FRDA 2O6VB 2D9UA 4BBRG 2A5UA 4NXML 1FXIA 3NPPA 2PLPA 5C1ZA 1W6JA 1JB7A 2WXIA 2C9WB 3EA6A 3QHTA 4K1RB 4PZ7A 4DBGA 3UDIA 2OHFA 2KDMA 2Z6BA 3ULPA 3ZNHB 4KJOA 4R4CA 2UXDQ 1S5ED 1VQ8A 4B08A 1JW9D 3DXJC 4KKTA 3ULJA 5E6PA 3LGJA 4TSSA 1AEXA 1XF5L 4IUPA 2IHFA 2MBOA 4ILWA 3HP3A 1T9HA 4GB9A 1U4LA 5IYDG
chains in the Genus database with same CATH topology
4D2KA 3QWNA 4A6QA 4REZA 1EFID 1GPXA 4A3EB 2B2TC 5G3LD 1Y1VB 2WXFA 1F0ZA 3I90A 3AEEB 2J52A 3SE0A 3MWYW 4LMQD 3IT4B 3EROA 3SR1A 1HTPA 4NKLA 2IDYA 3AMZA 4P6VF 1F2LA 1E9MA 4M1UB 1FIQA 5IGEA 4H2AA 1V43A 2F0WA 5C0XH 3ETRA 3H09A 4KX6B 1HFGA 1KTKA 2K5WA 1NR4A 4XDCA 4M8AA 4HMJA 2BDNA 3SVMA 4JWSC 2PKOA 1QQRA 2Z4HA 2RKSA 2JEBI 4XXEA 4C3IG 2FINB 3OSOA 3DWGC 2L55A 5EBDA 3VR4A 1JQ4A 3CIRB 1JALA 3MFGA 4WORA 1TS4A 3AB5A 4EE2A 1KLUD 1UWMA 5CV4A 1R7SA 4C80A 2E75C 4C3HB 5D3DA 1HZ5A 1PRTB 2SEBD 3GO5A 2A68C 1RODA 2JP1A 2NBFA 2WQYB 5KRUA 5J39A 3H91A 1RYJA 1SYFA 1BMLC 2CW0C 3K5NA 4FVMA 4MH8A 1ESFA 4C2MB 4EQOA 2K0PA 3KWVA 1PDQA 1S5BD 2BBCA 1GJXA 2JYEA 1U4RA 4WRDA 5M3FB 3MXPA 2N55A 2I38A 2B2TA 3AE3B 3CRKC 3ERQA 3I4MB 3S2HB 3H8HA 2EYJA 1MSGA 3BVZA 3URYA 1KNEA 4IURA 4R8NA 1CM9A 1HPCA 3KQ4A 1FNWA 1CZWA 4WIPA 1RTNA 1VZ6A 1G6ZA 2D2CC 1WYGA 2B8GA 4CBVA 2L1BA 4K5XA 3SEBA 1RDPD 1TR5A 5C5MA 3N6RA 4R9WA 5CBEE 1EU3A 4A8XC 4KMUC 2K33A 2WXKA 1N60A 1DZ1A 4N9TA 2X38A 1NR2A 4ARIA 1AWDA 1F2YA 3TZUA 4EQPA 5CR3A 2EOTA 1CA6A 4X3TA 3AE9B 5HG2A 1A6XA 2WU5B 4KKIA 3GP7A 2K22A 1BCPF 1MHXA 4OHJA 3S17B 2F0MA 3SHLA 3EFXD 5M5YB 2B2UA 4YWGG 1GB4A 3RMHA 1C79A 1STNA 2CJOA 5CV8A 1SXTA 3VR6A 2NUCA 4RCNA 3P7JA 1OXTA 3R2TA 3I4LA 2RDFA 2F0QA 2DWQA 2F0SA 2RSNA 3DWPA 1PTOH 1KFYB 4IFDH 4S3SA 1HEZE 4DQOC 2N9KA 3WCQA 3MA2B 2JXTA 3HVZA 1IGCA 3CU7A 4WWMA 2F0UA 4DNTB 2AQ3B 2DN8A 3IXSA 1DOIA 3ZJVA 1FNVA 3TEXA 1RHPA 1DXMA 5EE0A 2LJIA 1FRRA 2WXPA 3V3XA 1EZ6A 1HCZA 3HRZC 3TP5A 4CHTB 1WTVA 1HZ6A 2JX5A 4LK1C 3P1HA 4QUFA 1LTAD 1YNND 1TKGA 4RGOS 1BCPB 3NXWA 5EPKA 1EM7A 1QLBB 1PTOB 4A3DB 3W3AA 4ID6A 2L83A 1ZKOA 2F0KA 1ACCA 2KMMA 1FXAA 3OOCA 1BDOA 1OFFA 3LNNA 4G7OC 5ISRA 4BY1B 5H92C 2PCFB 4EQNA 2BOSA 2LHDA 1PGBA 1Y8PB 3H3VC 1N62A 2M19A 2PZWA 2BT6A 2ICIA 1YN3A 3NQIA 2KEEA 2YYZA 3GTJB 4L2YA 1KF6B 5CYUA 3HOVB 5D7GA 1S5CD 5BYSA 1OXUA 3TDQA 3FKIB 2HQEA 5AFWA 1T5XD 1SFOB 5C3JB 3AB9A 1XTCD 4HJGE 2Y3AA 4OVZA 5DM73 4OW0A 5I2YA 4KKSA 2PMVA 1I50B 2Q8RE 3PMFA 4IUNA 2KACA 5LL6X 3OHXC 2WKCA 3TP8A 4KGSA 4RCOA 3IFDA 2F1MA 2DY8A 5IIFA 2EYPA 3D4RA 3D8GA 1G2TA 1J7BA 3QOJA 5BYRA 3FC4A 5JOBA 1V97A 2XRSD 1PRTF 2PVGC 2NVQB 3GV3A 4N58A 3IAYA 2PMZB 2NTTA 4CJ1B 4OO1G 3G7LA 4IQZA 2Q5WD 4HCEA 4DK1A 2W55A 1TVXA 2VZKB 1FD6A 1TJEA 4QUCA 2F0DA 4XDXA 1Q3LA 2L11A 2Z1CA 5EKLA 3IAM1 1ZDXA 2JA6B 1OO9B 5ELCA 5C4HA 2PYKA 1FEHA 1U9RA 4QMGA 3SK4A 3VR2A 4G57A 1X32A 3AU7A 1VZ7A 4XQNA 5KYLA 4N9PA 2L9HA 1BO0A 4TMAB 4YSYB 1DOLA 2AUKA 2AUJD 2O2LD 3S9WA 1IGDA 5CMDA 1PLFA 1QOBA 3DEOA 4A55A 1GUOA 1EEFD 4YSZB 1LT5D 3B9JA 3AEAB 1E0BA 2WDQB 3W5VB 1GHKA 4KHVA 3TEYA 4CKEA 2SDFA 1Q12A 2A68D 1G2SA 5C4XB 3V96A 3X3MA 1TU2B 2EJFC 4IDIA 4MN3A 3PUXA 3PIO3 1QCBD 1PZJD 3NTKA 5AUIA 2GA4B 5D65A 4QB4A 4H0LC 4IKGA 3VR8B 1MBYA 1STHA 4ZAIA 4IUQA 5FO7B 1CFMA 3AECB 3AE8B 4FNFA 4F7XA 3P20A 4MM3B 1TS2A 2EY2A 4ZKBB 2ACZB 1SNQA 4PMWA 1F9RA 2N0SB 5EQ0A 1KDCA 2XRQD 3BWUD 1UGJA 1HUMA 1TYGB 1MSHA 4Q5VA 1C78A 4IUVA 1LLRD 3FRPB 2JYOA 1KDAA 2GRIA 3AEBB 4ARCA 4K6LA 4L63B 1SYBA 3LWUA 2HCCA 2IGGA 2F0NA 2LKVA 4E6IA 3MFYA 1F2RI 1V1PA 2KVMA 2B2UC 1I4PA 3W5UB 1TY0A 5E1FA 3C2PA 1WCMB 2L12A 2H1EA 1PDXA 3DWMA 1F9PA 4J3OD 1RKNA 3NWSA 2Q8IB 1ZE3D 1YJJA 2R61A 4DGZA 5TSSA 1FD7D 2E6XA 1L6VA 2KCCA 3N52A 4LJZC 5K5PA 2F0JA 1WSPA 2NTSA 3D4WA 3A7LA 3S1NB 3GTQB 2F4IA 3W9CB 4KV6A 2L52A 1XLNA 4FXCA 1PZKD 2LS01 4IOIE 3A8JE 2K05A 5FO8B 2Y5CA 2C5CA 1WTRA 1JICA 4GLSC 4US8A 3HOYB 3VR5A 4KTAA 4IFDI 3AV8A 4ZHPA 3NSWA 4B0EA 1SYEA 2A69C 4KGRA 1JWBD 2G9DA 3DWAA 3Q6SA 2PNRC 1Y8OB 4XYOA 5EPJA 3P1MA 3I73A 1HA6A 1B3AA 2WIIB 3VYRA 2I2YA 1AW7A 2Y0SB 1C48A 1STYA 2PIAA 1MI2A 2K3UA 2CVRA 4ITKA 1XEEA 2V4IB 4ZRQA 1XX8A 3GS2A 2L4NA 4KKJA 3UI3A 2M00A 2RVLA 2EYMA 4PMCA 2IX1A 2WXQA 1YNNC 3I8ZA 1DD2A 2ICEC 1YQ4B 1XWEA 2JSOA 3D3RA 4K8IA 3P4QB 1EY0A 3KF8A 4XQQA 3GQBA 3P75A 3A8IE 2EJMA 5FO9B 3PO0A 4PMBA 2MJEA 4OIKA 5M9OA 4LTUA 2Z8LA 3V2TA 1VR9A 5DEHA 3J9CA 2RBMA 2KCNA 5C2TB 3PV0A 4AYBB 4TQ1A 5EBCA 3A8KE 3HOUB 2A6EC 4Y7NB 2GB1A 1A15A 2ZXOA 1GUSA 4RF0A 4YIJA 1A2UA 1CZPA 3NWTA 1BUVT 5DNFA 1IW7C 1D5XC 3OIPA 5HI1A 4F88A 1MGSA 4OO1H 3U2SC 2IT1A 1JQYD 1VCIA 3F2UA 3VYSA 3RZOB 2XWBB 1Z7TA 4DAPA 3Q0AA 5IT9E 1QNKA 2IJ0A 1HFNA 2CQAA 5C0XG 3ZGZA 4HN7A 1EEID 1CQFA 1V1OA 2EZVA 4O1NA 3TSSA 3SK8A 3GTPB 2JU6X 2PVOD 5D14A 4HEA1 2KOLA 2MEKA 4ZK9B 3CHBD 4GDLB 4DK0A 3GV6A 4NAMA 3NBHA 1IUEA 1KAAA 2KUMA 5JXVA 2F0EA 2WKDA 4HAEA 1HA5A 1WTOA 3T16A 2A6HD 2WB1B 3J7YW 1A2TA 3ZJTA 2PZTA 1RCVD 1K50A 4J8QA 2OT2A 2K04A 1FFVA 3KUPA 3H94A 1C4PA 4KGTA 2B63B 1I4RA 2JSVX 2WP8J 2A74C 1SE2A 1F2RC 4HKQA 1NYRA 4HKZE 3U7ZA 3UI2A 4N59A 1IL8A 2WNMA 2MJ3A 1D6EC 3AM9A 2J7ZA 5EE1A 1RF2D 1XLOA 4NDXA 3NBIA 5T1GA 1LTBD 2RA4A 2QDBA 3A7AB 1RJTA 3NZ3A 1EU4A 4BA1I 1FNUA 3MHZA 2O4XA 3GTGB 3E9SA 2W54A 4C3JB 1F2MA 3QIAA 4KI0A 2XIWA 2EELA 1SNDA 1GUNA 2B2WA 2WU2B 2SOBA 3A56A 3R2IA 1X3QA 4KK7A 3FPPA 1S5FD 2LEKA 4FF2A 1D1KA 1Q1BA 3BDOA 3VA7A 4G7ZC 3I70A 5IGDA 1BQQT 3C1EA 4KJNA 2INNE 2WXGA 4RGNA 4I65A 4A3JB 3HZXA 3B2GA 1H9JA 3NTHA 1NVID 1P7EA 1LTTD 1QKZA 2B8FA 3R3OA 3NVZA 5CV6A 1YNJC 3J80E 1GB1A 4A3FB 2BB6A 1S5DD 3CRLC 1RD9D 1AP0A 3D31A 4ZUIA 1BCPD 1PTOF 2LY7A 1TKYA 4TQ0A 4K5VA 3IT6B 1XXGA 3PO2B 3BK1A 3MZ5A 1B2TA 1OXSC 3Q8BA 3O13A 2BDOA 1IYUA 2Q8TA 2K5DA 4OO1I 1QOHA 4DU9A 4A3IB 2YU9B 4NW2A 5BN3A 1LTSD 4JPSA 2KAJA 5M3MB 3T53B 3AN1A 1DOXA 4BA2I 2LMCB 2FMCA 2BE5D 2A69D 2EY5A 4ZQ3A 5EPLA 2EJGC 3C8YA 4I7ZC 4YT0B 1C77A 1H9RA 3TZDA 1QG7A 3OPOA 4C7ZA 1NENB 1TWHB 1C8CA 3OMGA 3SR6A 2VUMB 2EKIA 5I4DA 3VQIA 4Z9CB 2R3ZA 2MHVA 5I9PA 1I7HA 4RF1A 3DEPA 1B50A 3SFEB 1XYIA 3TN2A 4NAWB 4QIWB 5ELEA 1K52A 2DNCA 1CI3M 4A9AA 2NVYB 5EKKA 2H4OA 3M85A 4IN3A 1DYQA 2NN6H 3QO2A 1C9FA 3OWFA 3GTKB 2OXPA 4FXGC 1QILA 2B2YA 1NI3A 4DNRB 2V3NA 2N7JA 2WLBA 3K6OA 3SDZA 3G6JB 2F0HA 4ME5A 3Q8FA 4BS9A 1NCVA 2E3TA 1XCQL 1JOKA 3RLFA 3PUYA 4RHRA 4AS1A 1QE6A 1SB3C 2Y5PA 1DGJA 3GB1A 4WJWA 1MI0A 2OEDA 1OXXK 4OIJA 2E2DC 1MVKA 4OZBA 4DN4M 2JA5B 1IKLA 1S4ZA 4J1MA 3P63A 1O7ZA 3HEJA 3MAQA 3LB8C 1ICWA 4WQMA 1PFBA 2J42A 5KNDA 1XLPA 3VR9B 4RHSA 3K0YA 1QOGA 3MHBA 4XWTA 2GI9A 2F0LA 1TS3A 4XTCS 1PRTD 1FR3A 1JE4A 1EYDA 1TWAB 1EY4A 2E2JB 4FF1A 1K83B 1GUWA 2FMMA 3EQLC 1SYDA 1TWFB 3OIQA 1IYVA 3NHHA 2ID0A 3BS1A 5KNBA 2Z4IA 3S1RB 2ZW0A 4AQ7A 1FGBD 2AQ1B 4F87A 1R4PB 4XQJA 1W6KA 1ROEA 5D3IB 4DXFA 1J7AA 1U4MA 1Q8IA 2HUGA 2V0GA 2NVTB 2CU3A 4RH6A 4L1BA 1B9NA 3QG1A 2JZPA 1I4QA 2ENBA 2X6LA 3VYUA 4MACA 4QF4A 3CQZB 2FBWB 1STEA 1G91A 1GHJA 2JA7B 4BWGB 4PV1C 2IWHA 2BYTA 2WDVB 1PFNA 4FO2A 4H7BA 1PFDA 3S1QB 3M7GA 3OWEB 4YTNB 1SSOA 1E2ZA 2RQXA 5JVH3 3FDTA 1PUTA 5C3WA 3IFTA 2LFIA 1LTGD 3MEHA 2QF7A 1QJOA 1QT9A 3SK5A 3W2DA 1ENFA 3Q8EA 4BBRB 1E6EB 1RWSA 1WGKA 3K7AB 4TKOB 5C6AA 2PW9A 4CKBA 2YEPB 2FE8A 3WOEA 2VZKD 5E4WC 4K2LA 1MHHE 3PZ8A 1Z47A 1QF6A 4UAIA 4PQXA 5FLXE 3FAHA 5BMIA 3EUB2 3I72A 1L5PA 5EE3A 4X3KA 4LLGM 1AYFA 1SJED 4RFBA 1L4ZB 1SNCA 1EY5A 3H0GB 2VXWA 3BYTB 3HKZB 4ZUJA 5JEAH 3MTSA 2AWOA 4M0WA 1I3QB 2LFNA 3DWQA 5C5LA 1CHQD 1AFPA 2X6GA 3T51B 3MP9A 2IL8A 3DMUA 1EL0A 3QJYA 4ZRZA 1U4PA 1H9MA 1LT6D 1L0XB 2RDHA 4C7YA 5GXGB 1ILQA 1G8ZD 2EYLA 1SEBD 4KD3A 4RAUC 4A3BB 1YMHE 3VA5A 4G7HC 4DAVA 1SMYD 1Y8NB 2INPE 2EYHA 3I3CA 1RM6C 3R93A 1YN4A 4C3IB 2EDGA 1AZPA 1ZUD2 4R8IA 3EGRA 1B4OA 1JB3A 1LABA 2PTLA 4DFAA 4K14A 1O7YA 2NWGA 2XNAC 4WURA 1ZXHA 3ZQ4A 1YQ3B 1Y69U 2QEJC 4LK0M 4U673 1Q90A 3Q8AA 2JYTA 3T13A 3K58A 2IX0A 1SYGA 3KLSA 1SE3A 1M4VA 2J4XA 3P4SB 5BN5A 5KEEA 1EOTA 5EE9A 5C3XA 1ZEQX 3CKIB 4HSVA 2DYMA 3H6MA 1PFMA 1TY2A 1EZ8A 1LV9A 4L23A 2IW3A 3MC0B 3HOXB 3L4PA 1E10A 2BB5A 3FILA 2QILA 4IUUA 1WD0A 2N9LA 3RD4A 1EY9A 3N9YC 2OF1A 2VB3X 3M4OB 2O5JC 5I6YA 2ON8A 5LNK1 2H88B 1IKMA 5CORA 2EVBA 2HTME 1ZPSA 1WTXA 5CV9A 1D5ZC 5C4JB 1BUIC 2ZXPA 4KHZA 1STBA 2F3VA 1EYCA 2JWUA 1SAPA 2G9HD 1SIJA 1V8QA 2NYZD 2EE1A 3NTIA 2O5IC 2IGHA 2QSDA 3V05A 3NQTA 3K59A 1GOZA 3T56B 1TIID 2FUG1 4P16A 5CBAE 3VYTA 1TS5A 5M5XB 3HRDD 2MUYA 1I6VC 3SFDB 3K5OA 1QB5D 1JWSD 3RUZA 5G5GA 3W1SA 1KABA 1DCZA 1VMCA 1IBXA 1JMLA 4RA8A 4ULLA 1K8OA 1ZP0B 3TEZA 3J81L 3NP8A 3T3OA 2CW0D 3Q23A 1JWUD 1LACA 1H9KA 2NZ1D 3U9OA 5ELDA 2BS2B 3C3LA 1KRHA 5G5HA 4IALA 2K9XA 3RZDB 4L6TB 1DOYA 1J9OA 2KA7A 2F0PA 1ENCA 4KN4C 5CC4A 1E2WA 2LHEA 2NB0A 3ZYYX 4Q2JA 2R92B 4UDUC 5KGUA 2NVXB 2ZT9C 2PPBC 2B2YC 2ONQA 5E6JA 3SK6A 1JCKB 1ET9A 2WACA 1B9MA 1Y1WB 3L7ZC 1HQMC 5E3FA 1N61A 3BDCA 4OZAA 3BYYB 4IZ8A 3TP7A 2MPMA 5I6WA 5I9OA 5JPNC 1HXYD 3J7AF 1PZID 3T3NA 1SSNA 2L32A 3HGBA 3KBGA 5FR3A 2SAKA 1C4QA 3J7AV 5IGCA 3GTMB 1ONLA 3VR3A 1IW7D 4FYDA 2SNMA 2F0TA 2QMTA 1L4DB 4XE0A 4QCLA 2E76C 1LTID 2RDGA 3I91A 2BW2A 1E2VA 2B2VC 1FMAD 2XVSA 5H8YE 4HROA 2R6GA 3L3OC 3E0JA 4EGVA 3OW7A 2E2HB 3KLSX 4Q0FA 2I46A 1CJEA 1GXDC 1C4CA 2K6AA 1ZDVA 3HG9A 2KQ4X 2RPVA 2MGSA 2QKIC 2IX3A 1Y56A 2L1AA 2I07B 2F0OA 3PUVA 2G1EA 3IKJA 2LMCA 1B9RA 4JE3B 3MXGA 1F2ZA 5DM63 4US9A 2VNUD 1WTWA 3ND8A 4CGYB 4MHEA 4PNYA 1H9SB 3WOFA 4JX1C 4B0MA 1NSNS 2R93B 2A6HC 5FK9C 1EWHA 4CJ0B 3PO3B 4GZYC 1C4AA 4IFDG 1EYAA 4C56C 1O7LA 4DAYA 5AUKA 4J6HA 1HUNA 3VRAB 2V3PA 1VF5C 4USAA 2QIEB 1TKWB 2LUMA 4DXGA 2CHBD 2WS3B 2KQ3A 2KHSA 1F9SA 5EJWA 5BN4A 1FYCA 1N5XA 1RFKA 3M4YA 4O42A 1ESRA 4B9WA 1SNMA 1E0ZA 5BMGA 3K5MA 4HCSA 5IODA 1FCCC 2WXOA 5J1ZA 1SNOA 3BDLA 1JORA 2IGDA 3KK7A 4XIGS 3I4NB 4ZKCB 3NRZA 4F8MA 2D62A 2K32A 1Q1EA 4R3DA 4A90A 4JWUC 1SYCA 5LHY1 1LT4D 3S2DB 1KNAA 5CV7A 5KYIA 5JJZA 1TWCB 5ELBA 2B2VA 3BG3A 1STAA 5IGGA 1R4QB 2XN9C 3KWLA 1NEKB 4K6DA 4LAAA 4MIUA 4V190 1PXUA 3K5LA 1UUPA 3NE5B 5COYA 5FLXL 5I2XA 1EWYC 1E7PB 3JAML 1O78A 2EYOA 3S14B 2EXZA 2JQRB 3E6ZX 3HOWB 3K57A 3NVVA 3TBIB 3FMCA 3U52E 4KY5A 1AZQA 3QOLA 3IL8A 1L0YB 4FXDA 3LWEA 1K53A 4A93B 1QOAA 5MPOA 2A6ED 2F0VA 2K03A 1I6HB 1P7FA 2EYFA 3ND9A 5G3LF 4BBSB 1CTMA 1IHZA 4CKCA 1EIGA 2F0FA 2HDMA 1UAPA 3BZDB 3D4DA 2MH7A 3AEFB 1EIHA 1QWYA 1HRJA 2W3SA 4ZLTF 2L5TA 2PQEA 2WXLA 4CQNA 1JC7A 1YN5A 4RKLA 1WRIA 3A54A 3ZJUA 5E4XA 2J0TD 2WXNA 4K5WA 4IUTA 4B9XA 2K7VA 5K36G 5JVG3 2K5PA 1XO3A 5EGTA 3L9AX 3ONAB 1STGA 3LXFA 2K5QA 4FP5D 3EJIA 2W82A 3FILB 4K8JA 4C3JG 2KJXA 4HSPA 2KEDA 3PZ7A 1BXTA 5DAUA 5T1IA 1I4HA 2DBYA 3DM1A 4KKUA 5J22A 1VJKA 3TEWA 1JROA 1KLGD 1CK1A 1PGXA 1XLQA 4HTHA 1ZOYB 1CQVA 5C0XJ 1A3TA 1ENAA 1JOQA 1CT1D 1CHPD 1BR9A 5FKAC 1A3VA 2L0CA 2M0AA 2HDLA 3RFZB 1QOFA 5A35A 3TMEA 1WTPA 5IGBA 2HDEA 2PW5A 1HQRD 3PIP3 1NYQA 1B1ZA 1SF0A 1HTLD 2M2LA 3AE2B 2FHTA 1TZOA 2YEPF 4A3MB 1WWTA 3I9V1 1V8CA 2KWDA 5A2QE 1EWCA 5IGFA 4EVOA 4NJCA 1VRAB 4XT1B 3DHQA 4PT5A 2WXHA 2FFKB 1BBXC 3IAS1 3AH7A 1JWMD 2BTEA 4C1NK 2LGIA 4ZOHC 2F3WA 3X3NA 1R9TB 4X3UA 2XSCA 3LYYA 1F9QA 4NZLB 4FF3A 1L0VB 1K51A 4K2KA 1NAPA 1ZXIA 3HOZB 3S15B 3GD7A 1EY6A 1II3A 2CJNA 5BMHA 4RGMA 4X3SA 1OQQA 2B2WC 1TKEA 2QCPX 4ZRPA 2BA1A 4U68A 1ZXTA 4C1NI 5KIXA 3NUCA 1FCLA 3AE4B 4YTPB 2AX5A 3U4EG 3S1MB 1H9SA 2FJ2A 2V4DA 1EQTA 1WD1A 1MPEA 2KN4A 3C46A 1J7CA 3T4AC 1PMRA 4IFDJ 1BCPC 1DONA 2RMMA 2M56B 1PTOD 3EVQA 2MJ8A 2NN6G 2D5GA 1SBBB 1ZYRC 5M5WB 1SNPA 2DY7A 3D6WA 4OL7A 1OQRA 4A3GB 2ZW1A 4G4KA 1T3QA 4GDKB 5JEAG 3JAME 3AMUA 2C9OA 1SDFA 1GUTA 5EKIA 3BIID 3HUIA 1F77A 4KN7C 4JBWA 4YSXB 3S16B 1JOOA 4KD4A 2DLBA 4RWSC 4DF7A 5C0XI 2OHFA 4JK1C 1B44D 4FF4A 1YJIA 1IBXB 5HGTA 3U9SA 4OZCA 3FEWX 2QJLA 2BE5C 2ZXRA 4OGQC 2W3RA 4TQUS 2A73B 1SJHD 1ML0D 2AWNA 3GTOB 5JAVA 2KECA 5A2QL 3Q22A 1JWAD 2K1BA 1D1IA 4A3KB 3TP6A 4XYQA 3CWIA 4HRSA 1KH0A 3AEDB 2E2IB 3MXUA 1VDVA 4CJ2C 2PZUA 1VZ8A 2WP9B 3MVVA 4RNAA 1GUGA 2WV6D 5CV5A 3B2FA 3J80L 3RPFC 1T5EA 1A70A 1EY7A 1YNTE 1N63A 3HVDA 3QB3A 2JEAI 3P4PB 5K36H 4RGTA 1LTRD 1TQOA 2D5DA 1Q10A 3BK2A 4WH4A 4ODGA 2DYOA 1D4BA 5ELFA 1EY8A 4WFN3 3VRBB 4TRDA 5JEAJ 2WXMA 2M9VA 2BCOA 1SMYC 1FFUA 4ABNA 5KNCA 5C44B 2OEOA 1DOKA 3WDNA 3AE5B 3SXHA 3NVYA 1ZYRD 5HURA 1WXQA 3Q69A 1VF7A 1SE4A 2TSSA 1D2BA 1CA5A 3NUHB 5HFYA 4H13C 1TWGB 4XT3B 4YTMB 2F0IA 1J8IA 1EQVA 3OMCA 3PUZA 1JR0D 1PRTC 1L6UA 4WAFA 4YXDB 2JE6I 4HR7B 1BNZA 1K8MA 1JRPA 3AE7B 1NUCA 5T8IA 4ZHOA 4H44C 2TMPA 2AQ2B 4N6EB 1V1PB 1OXVA 1Z6HA 5F2DA 2JA8B 3E5SA 3FVQA 3MJ5A 2NN6I 3M7NA 1MD2D 1C76A 2WXJA 5BYQA 5NUCA 4MT5A 2EPBA 1UNSA 3Q24A 1B53A 4FXKC 1N5WA 1ET6A 1A3UA 3D6CA 1VDZA 3MXNA 2X69A 3NS1A 1QNUA 2PW7A 2H89B 3A55A 5IOCA 1KDBA 1LO5D 1WVLA 3HS0C 2A5HA 2EY6A 1AN8A 3J81E 2B39A 1UEAB 2MJDA 3Q8CA 4C3HG 2J53A 1DJRD 2F0GA 5IT9L 1YNJD 1HHVA 3KBXA 3NVWA 3TUOA 4NP5A 2WINB 3ABVB 1FO4A 2SNSA 2BS4B 1TT2A 5FOBB 2RSOA 3R8BA 1T6BX 3E56A 2K01A 1PYWD 3BVMA 2EY1A 4HEDA 2NMQA 1ILPA 1M8AA 3P42A 2XWJB 5CGKA 2PO4A 3I57A 2IPKD 3KLRA 4DA2A 4XDDA 2WXRA 2R7ZB 3AE6B 1GAQB 1D5MC 1RTOA 1VMPA 4ZYSA 5C4ZA 1O80A 4V0BA 2BA0A 3PUWA 4HMIA 1UWXA 1X3PA 2E74C 3M3YB 5JPMC 4XWWA 1I4GA 4L8JA