3W2DA

Crystal structure of staphylococcal eenterotoxin b in complex with a novel neutralization monoclonal antibody fab fragment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Enterotoxin type B
publication title Structural basis for the neutralization and specificity of Staphylococcal enterotoxin B against its MHC Class II binding site.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 55
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3w2dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w2dA01
1AW7A 1AN8A 1LLRD 3DWQA 3GP7A 3W2DA 4RHRA 1B1ZA 1TS5A 2IPKD 4L63B 4OHJA 1KLUD 1LTGD 1D6EC 1I4HA 1HTLD 1PRTC 1S5DD 5FK9C 4DXGA 1XXGA 1D5XC 1UNSA 1L0YB 1KTKA 1ET6A 1S5BD 1SE2A 2NTSA 3TSSA 1I4GA 1PRTD 1JWMD 4BWGB 5ELFA 3BZDB 1EEID 1FD7D 2R61A 1KLGD 1PTOF 1RDPD 4RH6A 1JWUD 1EWCA 4ZYSA 1EU4A 1L0XB 3R8BA 1JWSD 1PTOC 1PRTB 3MC0B 3BYYB 1TS4A 1LTID 1PTOD 2QILA 1RD9D 2IJ0A 1F77A 4L6TB 1PTOH 1SJHD 1ET9A 5D3DA 1LT3D 1LTSD 1PTOB 1JCKB 1PZKD 1I4PA 4Z9CB 2AQ1B 4K6LA 1XTCD 1PRTF 1V1OA 5ELBA 1SJED 2J4XA 2Z8LA 2NTTA 4RCOA 3R2TA 1LT5D 1GOZA 3SEBA 1MD2D 2AQ3B 1S5FD 1SXTA 5TSSA 2XRSD 2G9HD 4RGTA 5ELEA 1M4VA 1S5ED 4NZLB 3CHBD 1SE4A 1FNVA 4RGOS 1I4XA 5I4DA 1PZJD 4O1NA 1RF2D 1CK1A 1FNUA 1UUPA 1LTBD 2TSSA 1G8ZD 1LTRD 1BCPC 2XNAC 1V1PA 2O2LD 2XRQD 3EFXD 2ICIA 4UDUC 1BCPD 1EU3A 1FNWA 3R2IA 4RGNA 2SEBD 5ELCA 3BVMA 1BCPB 1LO5D 2QEJC 1HQRD 1QILA 2XN9C 1D5MC 1EEFD 3URYA 5ELDA 3MFGA 1RCVD 5FKAC 2CHBD 2RDHA 1LT6D 1HXYD 1EFID 1CQVA 3DWAA 4C56C 1B44D 3DWPA 1D5ZC 1BCPF 1S5CD 4RFBA 1T5XD 1TS2A 1I4RA 1HA5A 4RHSA 1CT1D 1CHQD 1PYWD 1PZID 4DXFA 4TSSA 1ESFA 1SE3A 2AQ2B 3EA6A 1I4QA 1LTTD 1BXTA 1YN5A 1SBBB 1DJRD 1JR0D 1TY2A 5D3IB 4RGMA 3V05A 1YN3A 3OWEB 1V1PB 1SEBD 1YN4A 1STEA 3BVZA 3BVGA 3BYTB 2WV6D 3O13A 1TY0A 1LT4D 1ENFA 1FGBD 3KLSX 1DYQA 2RDGA 1JQYD 1TS3A 1CHPD 1LTAD
chains in the Genus database with same CATH superfamily
1XLOA 1LLRD 5JVG3 4FN2A 3RR5A 3W2DA 4JI0L 2K5PA 4L63B 4LTUA 5IOCA 3KWVA 1ASYA 3KF6B 1PHJA 1K8MA 2KDMA 1HJPA 3N20C 1VDZA 2A68D 5LMUL 1J7BA 1QVCA 1NVID 4QGUA 4A93B 2DYOA 1PGXA 1A0IA 1R9TB 2QSDA 3Q23A 3EFUA 4EZLA 3J81E 1PRTD 1Y14B 1STBA 3K0YA 3HKSA 2QA4A 2MA9B 3EJIA 1S1QB 2KMMA 3QK0A 2OJWA 3TP6A 3MC0B 1UE1A 1YHAA 4R9WA 1YX6B 4K2KA 1VQFA 1IKLA 2OCEA 2DAFA 3VH4B 1WIAA 1I50H 4BBRB 2N0SB 1BQQT 1SB3C 1P3QU 2MJEA 1GD7A 2B2WC 3I4LA 1NBFC 3IAS1 1X3FA 2PCFB 2WYQA 4JI4L 1YBYA 4IW0A 1A3TA 3GO5A 1KHIA 3NWTA 1UBQA 1V5TA 3I70A 2JT4B 2JEAI 2Z8LA 4L8JA 3J80E 2K5NA 4EOYA 3FDTA 4DV2Q 2MBEA 2WKCA 3QA8A 3M3YH 2L11A 4C3IG 4ANWA 3S17B 2ZJRA 2MJ3A 3DBHI 2WXKA 2O5JC 4X3TA 5C4XB 2I07B 4RMFA 2YU9H 3RNBC 2L9HA 4IUPA 5CR3A 3K5LA 4KHPQ 1UF0A 3SFDB 2E75C 4GOPB 4YL8A 3RT3B 3PTFC 1VQCA 1YITA 3P1MA 1SE9A 2B3AA 2VS1A 4ANUA 2N7JA 3PZ7A 5TR5A 4KKJA 1HNXL 4MH8A 4YXDB 2KJ6A 1WH3A 3EUB2 3DHGC 1XWEA 3WIMA 4E6IA 3OSOA 2DJGC 3N9YC 3M62B 5I6YA 2F0KA 5HGTA 3TL5A 3LWUA 3AFPA 3MA2B 3VR6A 3LDZE 1C4QA 4GMVA 1JROA 1C7YA 3NRZA 3F8TA 1R4MI 3BZCA 1L1OB 5JJKA 3CU7A 1P9DU 2L55A 4LWCA 4GNXC 2JA7G 2R7ZB 1JW9D 2A19A 3SFEB 2QW7A 1HQMC 4LUOA 4A3FG 1W2BA 4LDTD 4EGVA 1T5XD 4JI2L 5T1GA 3IT4B 1PZID 1WXVA 1PFBA 3NE5B 4F7XA 2LWPA 5IGFA 3CPWA 3CCJA 2BW2A 3NVWA 3D0FA 3RLOA 1DOKA 2BYFA 1TKWB 3HFZB 1ZOYB 2KLGA 5DM63 4K2LA 2V3PA 2M1MA 3DQVA 5A35A 1JJGA 1HFGA 1H95A 3PZ8A 3RULA 5GXGB 4B3RL 5CV4A 1JQ4A 2MQJA 3L4PA 3CCSA 2CJOA 2DZKA 3E0JA 1CK1A 1SNPA 1AW7A 2IGGA 4WAAA 1IL2A 3M7GA 3TEXA 2BVCA 4OO1I 4PS8A 1BKBA 2A6HC 3CMAA 2RSNA 4KHVA 2LD9A 5K36G 3KLSA 3RN9C 5CGKA 2DBYA 1FO4A 1PFSA 3TEZA 5JPMC 5C5LA 5L83A 5CV8A 2CR5A 4W9GA 2JA5G 3NG0A 1HUNA 2WS3B 3PUWA 1T6BX 1EQRA 2FUHB 1PTOF 4A3EG 1SR3A 2L8JA 1EIFA 1XQQA 5C0XI 3UDIA 4US9A 4ZK9B 4KD4A 1N32L 4B08A 3KOJA 2L3ZA 2KVMA 4LCDE 4S3SA 4BVUC 4A3CH 4ITKA 2N4FA 2FMCA 3K8AA 3E5SA 1WMHB 4K6DA 4NNJB 2KQ3A 3GTJB 4LFCQ 4HJ7A 1DOYA 2AYOB 1ENAA 4A93H 4DN4M 2MWSB 2EY5A 1R9TH 4GDKB 3L10B 2VQFQ 1GC7A 5IT9c 1Z7TA 2N8NA 2RMMA 1VQIA 3R7QA 1YJIA 1HA6A 1N62A 2GBNA 4MM3B 3HUIA 4GZYC 4XQJA 1Q5WB 2I0QA 3HOWG 2LHDA 2G4SA 5J39A 3BS1A 4OWWB 1EUVB 1WXSA 4KGSA 3CRLC 1TQOA 2NYZD 3AQQA 1E8XA 4BBRH 4NZLB 1M8AA 4IPGA 1N61A 5M5XB 1BBXC 1C79A 3DUZA 2XIWA 2NBUA 3HKZE 2G5DA 2F52A 2N9XA 3VHTC 1TWHH 1UUPA 4LF7Q 2LFIA 1AE3A 3GOEA 3S14B 2O2LD 1GUWA 5FO9B 1YNJC 3FKIG 3K80C 1BVSA 4XIGS 5C3JB 1MG4A 1T9HA 4NDXA 4BA2I 3S2DB 4QIWB 3CMEA 5C3EB 1S3SG 4PS7A 3I4MG 4DHZB 1TWCB 2WAQG 3Q3JA 4BKSD 2JA9A 1EY5A 1V86A 3P75A 1RHPA 4OEMB 5C4XH 4QMGA 1K73C 2KC2A 5IP7G 2QGQA 3TS0A 3VYSA 2BS3B 1EFID 4DAMA 4BBSB 2JXMB 5HG2A 4C56C 2HDMA 2OXPA 1SF0A 1YI2A 2B2VA 5C4ZA 3LWEA 3U9SA 3Q69A 1CUKA 3X23A 4AOFA 4ZAIA 1VQMA 1PH8A 2KDFB 3GQBA 2Z4IA 2KDIA 4W9IA 4A20A 1JOKA 2SAKA 4HPPA 3ML8A 4K3BA 2KACA 2AHOB 4RCNA 3KWLA 4DXFA 4P7IA 1GUGA 5JH5C 1WX9A 1GG3A 3FEWX 5EKIA 4PV1C 4JYAQ 1K50A 2B3GA 2R7FA 1OEYJ 5BMGA 1RKNA 1GM5A 4BOSC 4XYOA 4XQNA 1WTWA 3N1YC 3T56B 3V05A 5CTRC 2YEPF 5FR6A 3BVGA 3TBIB 1WTOA 1VQEA 2R7ZH 2EKEC 1UWMA 1YHBA 2DYBA 3IT6B 4RA8A 1XD3B 1TS3A 5E4XA 1KC8C 5GAHC 2L32A 2AMCB 3A7AB 3HOYH 4FA6A 3ETRA 1GUAB 4FDBA 2BOSA 4KKTA 2EYPA 1S72A 2QDBA 3T1YQ 3IKJA 3H3VH 4DV7Q 2WKDA 1LTGD 4N9F4 4NXNQ 2KX0A 2E76C 3BINA 1T5EA 5IYBG 1NI2A 2ZVNA 1U5KA 1WM3A 4E3CA 3GV3A 2VY3A 4DFAA 3EGRA 3PS6A 4JE3B 1BT0A 3ZDMC 2GRIA 1JWMD 2CH4A 1FXIA 4J6IA 2PW5A 2IYDB 3NENA 5M3MB 3U8ZA 5A2QL 4TRDA 4EEWA 4KN7C 3DBRB 2IBIB 1PRTB 3BYYB 3I9V1 1EWYC 2ENBA 3VR4A 4LW1A 3ZO5B 1TWGB 2WIIB 3S1RB 1SJHD 4JW0A 2KT7A 3DWGC 2CQOA 2F0TA 1Q7YC 1C1YB 1SSOA 4OONA 1I5FA 5C44H 2B2YC 4LFBL 4BZAA 1EWHA 2MHJA 4JLCA 3U7ZA 4IN3A 4FHKA 1BMLC 1XTCD 1F9RA 2B2TA 4O2DA 1UE6A 5IYDG 4A3GB 1E10A 2ZEQA 4LNIA 3MC8A 1WRIA 3WAPA 4ARCA 3N30A 4DAYA 3ABVB 3RUZA 2WWZA 2EYHA 4DV2L 4EQPA 2KBNA 3PZDA 3JW0X 3PGZA 1Q81C 2MW5A 1J9OA 3R66C 2PPBC 2D9UA 2WDTB 3JAME 1HZAA 1IXRA 4KHPL 4HPMB 4N59A 3VR8B 1QNUA 4GLAC 3GTJH 1WCMB 4S17A 1B3AA 2RR9A 1WGRA 4P6VF 3ND9A 2IO0B 4XDCA 3DMUA 3EFXD 1WFQA 2LMCA 3KK7A 3RI7C 1GPXA 1NMGA 1EU3A 1AFPA 1VQ5A 2R2OA 4FXCA 2ZCBA 3DDCB 4LNNA 4RM9A 2WNMA 4WWMA 2EYOA 2HUGA 5BO4B 4GKJQ 5KYIA 3A8KE 2N55A 3JC66 2K14A 3U4EG 1IW7C 1WD0A 3M3JA 2L12A 1RCVD 3HS0C 1Z2MA 5M5XH 2BF8B 1HXYD 2A6EC 1R4NI 1LACA 3C19A 4JPBW 2UUBQ 4HJ5A 2C60A 4C4VA 3QQ8B 4HTHA 1UGJA 4LF9Q 2YYZA 5H8YE 1B70B 1VD2A 2LZ6A 1F2MA 1W3SA 5LL6X 2L0TA 2IZVB 4OL7A 1J5EQ 3S14H 2BPSA 3CF5A 4USAA 3KH0A 4ULLA 3A8IE 3NUCA 3S2DH 1ESFA 2A5HA 3TCAA 1H8CA 1KH0A 2Z0DB 2QHOA 2C5CA 4LDTB 3V2TA 1TWCH 2DGYA 3PLUA 4BY7G 4G50A 1I6VC 4W9JA 3Q8CA 1U4PA 5GAEC 4TV3A 1Q0WB 1YEZA 2DX5B 2Z6KA 1TY2A 1I94Q 4DK0A 1MI0A 2F0IA 3AECB 1WXQA 4A3OA 4BBSH 2DNEA 3BDLA 4G0NB 3V6EB 1WM2A 4X3SA 2HJ1A 2M17A 1M90C 2UUCQ 4DK5A 4C3HG 1K28A 3M4YA 1EIHA 2KFKB 2BTEA 1BBUA 3Q22A 3RN2A 4B9XA 2NBFA 4MGYE 3MVVA 2EYLA 3W9CB 5DPWA 3S9WA 1KLVA 3GZNB 4XDDA 2BE5D 4MNOA 3ZTDA 1TR5A 2HDEA 4ALPA 5IYCG 1CZGA 5IE8A 4LNKA 3S2HB 1I4HA 2W3RA 3PV0A 4DV5Q 2LGSA 4A3KB 1RFKA 3H6NA 4HIKA 4K8JA 4HCSA 1SE2A 1A5RA 2VZKD 4PMWA 4N6EB 4RF1A 3H94A 1STHA 3MXNA 2R61A 3W5UB 2E2DC 1R4QB 1JWSD 2KVRA 1E5WA 2JQRB 1SN8A 2WB1E 2UXBQ 3SK5A 4HXDA 1TJEA 5I6WA 3PUVA 3I4NG 1AH9A 3P4PB 2N78A 4ZOHC 2W54A 1UZXB 2V0GA 4LFCL 1MVKA 3ZGZA 3KF8A 3FRPB 1F2YA 1SMYC 1BDOA 1V8QA 2Z0SA 1QKZA 2B29A 2N49A 4KSLC 1J8CA 1EYGA 2VQFL 1SJED 2EY1A 1L0WA 3IFWB 3J7YW 2OTLA 1MD2D 2PVOD 5KYLA 3LJ3A 3I5JC 3HOXB 1XLNA 2MRPA 1C3TA 4EX5A 5ELEA 4LK1C 2OT2A 1TWGH 2Z1CA 2R93B 2EQSA 2KOXA 5MPOA 4RGOS 1I4XA 4FF3A 1L7YA 3ICEA 1NJIC 2K01A 4LF7L 4ID6A 1PH9A 1ENCA 4DV4Q 4A3GH 2NN6I 3GD7A 3KW5B 3B0AA 2ICIA 4IWQA 3RUIB 4W9KA 4O42A 2CFMA 2ACZB 3RNEC 2B2TC 2KHJA 1QT9A 2ZPNA 2X6GA 3N1XC 4ASWC 5DM73 4R4OA 2PPHA 4K5XA 3H0GG 1VMCA 2HTHA 3AB9A 4DV1Q 3K9PB 2L4NA 4DK1A 1E8YA 1B9RA 4CGYB 3NBIA 1J7CA 4ZRJA 2EYJA 1MGSA 4DBGA 4P2CB 5FKAC 4IPDA 3NZUA 3H7PB 4ZHOA 3NPPA 3P1HA 4MJSA 1P16A 1WCMH 2BA0A 2V1CC 4OELB 3VQIA 1T0RC 3OW2A 4WJ4A 5EBDA 1KRSA 4AJWA 4RAUC 1HTPA 3OPOA 3FVQA 2KTRA 2LI5A 3AU7A 3QOLA 2IW3A 1HA5A 4WRDA 5FLMH 2KDEB 4GS3A 5AFWA 5J17A 3CXCA 3NZ3A 1I7HA 2EZVA 1DGJA 4MEMA 1LUZA 4TUUA 4JYAL 1HUMA 1SE8A 5C3WA 1ZYRC 2OEDA 1VZ7A 3AB5A 4B3SQ 1OXVA 4GOPA 3P63A 4WFN3 5JJLA 1YJ1A 1YN3A 4F87A 2RF4A 2A69D 4WJWA 1VMPA 4A3IB 4IC7B 4K3CA 3IL8A 2LVQA 4BOZB 2WV6D 1D8LA 2HIXA 4KD3A 1FGBD 2PZTA 1CA5A 4X66Q 1N63A 2EOTA 1QOAA 1SRUA 2IY5B 1KTKA 5FLXL 1IGCA 1GC6A 3Q24A 1KF6B 4US8A 5CORA 2KX3A 1QG7A 1SYFA 3T1YL 1NTGA 1PH3A 5IP9H 1L1OA 4DV7L 2XWJB 2KECA 1Y1WG 1AARA 2JYEA 1KLUD 3OW7A 4NXNL 1JMLA 2RDBC 3CD6A 2JA6H 3CCEA 1MI2A 5J1ZA 3PIP3 1MHHE 1XXGA 2JK8A 1KFYB 4PT5A 1L0YB 2YTXA 3VXWA 1EY0A 1Z9FA 3RMKC 3LB8C 4MIUA 1KD1C 1WX7A 2VH1A 3HKZB 2Q2UA 4MACA 2FCQA 4IUQA 3M9BA 2E2IB 4MSQB 4U673 4M0WA 3I3TB 4QB4A 4YCUA 3AE5B 4POFA 1RD9D 2ZCCA 2UUAQ 3E6ZX 3NTHA 4HIMA 2O4XA 3W5OA 3BU2A 3WAOA 4JX1C 2D0OA 4A3DG 4MTNA 3S2HH 4Z9CB 5EBCA 4ODGA 2N7EA 4A3BG 2ZNVB 2KCNA 4A3KH 2PIAA 1E2VA 5GMVA 4AQ7A 2KCCA 4G11A 4TQUS 4QUFA 1E9MA 1D3ZA 1LM8B 2A4ZA 3APCA 1VQJA 2ZM6Q 3PF5A 1EY8A 4B6WA 3EBEA 4W9LA 2Y0SG 5LXHA 1UWXA 4RWSC 3S16B 1DONA 1SYGA 2B2UA 4JI6Q 4JGHB 4GLXA 1NAPA 3CPFA 1QOFA 1CZPA 5EE9A 5JXVA 3A8JE 3CCRA 3PMFA 1X55A 2K32A 2F0MA 4IO9A 2IDYA 2LGXA 1G8ZD 1UAPA 2HCIA 4A3JG 1RM6C 3UGBB 1FFVA 3VTUA 2YLMA 1RWSA 4Q2JA 2P5ZX 1C9FA 1YZ6A 1FRDA 3H6MA 2MBHA 1TWFB 4C1NK 1HHVA 1WGGA 2L15A 1G91A 2L0FA 4GKJL 4MGKE 1U4RA 5ELCA 3HOXH 1WMHA 2F0JA 3S1NB 2BS2B 4GDLB 2SDFA 4ZQ3A 2LASA 1OXTA 5CHFA 4YTMB 2R93H 2EKIA 4IZ8A 1WZ0A 4WWPA 3V96A 3L54A 2ID0A 2VQEL 2NVTB 1PGBA 2UUBL 4KJNA 4LMQD 2JN4A 4LF9L 2CS4A 3FMCA 3EVQA 2WXLA 3TREA 5KNDA 2WXJA 2EYMA 1PMRA 1Y8NB 3C3LA 4MM3A 1J5EL 2F0OA 4WWOA 2VB3X 4JI5Q 5G5HA 2DY8A 1QWYA 2AWNA 2IY0B 1PYWD 3QX1A 4AIMA 3J81L 1STYA 3BK2A 1MKHA 5IY0A 1TYGB 3CC7A 1LABA 1C48A 5J3BA 1IBKQ 3QHTA 4II3B 4M00A 2A73B 4IM2A 1OQRA 1XF5L 2JUOA 4L5TA 1AYFA 1I94L 2CCZA 5D3IB 1STGA 4YY3Q 3V60A 2HJ8A 1YMHE 3PIO3 1ZP0B 1WJUA 3U52E 4JG2A 5I9OA 4K7UA 4HMIA 2UUCL 2CKZB 2RDGA 4GKKQ 1UD7A 4OVVA 3U58A 4OVZA 1V6EA 1NNXA 1XLPA 3A4RA 2KHSA 5M5WB 2ZTDA 3AFQA 3SGIA 5GADC 3OAWA 2K1FA 5JEAG 1TKYA 2IPKD 3J80L 1OQQA 2KQ4X 3AEEB 1O7ZA 3OLMD 3PRZA 4FP5D 3ITPA 4K8IA 4HIOA 4DXAB 4DV5L 4ZYNA 1Y1VB 4NP5A 2R7DA 4JOIC 1EYAA 5FK9C 1Q1OA 3DPDA 1UNSA 1Q8KA 1G2SA 1P98A 2ATWA 3AE1B 4FHJA 3A74A 4A3IH 2NR2A 5AUKA 4A3LH 5E1FA 4C3JH 4XYCA 1EWCA 3SDLC 3ZJTA 4OVUA 2R92B 1IYVA 1IPGA 2E2HH 4AYBB 4K7SA 3TN2A 2KOLA 1U4AA 2D11A 3DWMA 2UXBL 1WVLA 1FEHA 5G5GA 1DM0B 2WXPA 1EZ8A 2QILA 2XTIA 3U2SC 4J8QA 4BBNF 1SLJA 5D3DA 5T1IA 2INNE 4KY6A 1JB7A 2JJQA 3RNFC 3KUDB 3RNCC 1GAQB 5NUCA 3K0XA 2O2VB 3AH7A 4CDDC 2AQ1B 3QO2A 2BKFA 2QKIC 2JY6A 3AI5A 3LXFA 3MHZA 1GHJA 1VQ7A 4HROA 5KHOA 5KEEA 1C78A 4GN3B 1RL2A 5ISRA 2WXRA 2CWAA 4IPHA 1K8AC 3R2TA 3U4VA 1FIQA 1XCTL 2NMQA 4GB9A 1WYWB 1BNZA 3ZXRA 4R4TA 3VUWA 2INPE 2XK5B 2E2IH 2QDLA 4LF4Q 3GTPB 1OFFA 4N8FA 2K75A 4YCWA 1CJEA 3RNUA 1M4VA 1XMQQ 4C2MH 3P4RB 3R7RA 2V4DA 4G4KA 1MJDA 2F0LA 1VQ4A 2MHVA 2JA8G 3CSFA 2HE7A 2O6VB 1VQAA 2LFNA 1FJGQ 4DV4L 1LTRD 1KDAA 2XNAC 1L5PA 3AEAB 3E0EA 1TWHB 3HZXA 1E22A 2K7VA 1OXUA 4DWFA 1Y8PB 1MHXA 2OTJA 4ZRKA 2D3CA 3A5UA 1YNJD 4YSXB 2IT1A 3ZW3A 5KHQA 5D7GA 3T4AC 5HFYA 1SGHA 3BVMA 1ONLA 1SNOA 4DV1L 2K03A 5IODA 3DBLB 1CSQA 3PVLA 3S16H 3UDFA 3M85A 4TKOB 2PMZB 5JAVA 4AH6A 3HG9A 1C0AA 5F2DA 2BBCA 5J22A 2J0MA 4XGAB 3L16A 1PLFA 2D3AA 3OIQA 2C7NB 2PQAB 2EY2A 1IYJB 1BCPF 5G3LF 1F2ZA 1E7PB 1BUIC 2KHWB 1SYDA 3C2PA 4EZKA 1TWFH 4A3MB 1QUQB 2E6XA 3Q8AA 3KYDD 2ES2A 2E8GA 4JC0A 2I1JA 3L3OC 1LTLA 2X69A 1XLQA 2V4LA 3S1NH 4ZRZA 4IWPA 3H09A 3STBC 4B3SL 4W9FA 3T8MA 3UF8A 1FM0D 3PO3B 4NAWB 1DJRD 2WB1B 4RGMA 4MELA 4AQYQ 2L1AA 4IUNA 2NVTH 1G51A 3BYTB 3A7LA 4UAIA 1MSHA 1WJ6A 4H7BA 3IAM1 2FCSA 4X66L 1DYQA 1BF4A 3FP9A 5AJ3Q 2L52A 5L95C 2INCC 3VRAB 5ELFA 2ASQA 3RPFC 2MFIA 2FCMA 4GLSC 1CA6A 2IL8A 1B1ZA 4OHJA 4CJ1B 2F0VA 3HOYB 2JXXA 3IFDA 1F9SA 3K5MA 3S1MB 1HTOA 4TQ0A 2GI9A 1OO9B 1YHQA 5JJIA 1Q90A 3H7SA 4CJ0B 1WGKA 4KX6B 2WX0A 2BB5A 2KD0A 2KTFA 1PV4A 4BWGB 3PO0A 2JZZA 2EIFA 3TRZA 1JWUD 3ZYYX 4ZYSA 4A93G 2OOBB 2JX5A 4DGZA 4HDOA 4NKLA 4BKTA 1C4PA 1YJ9A 4RM8A 2ZJPA 1LTID 2KWUB 1B2TA 5M5WH 1F77A 1B50A 3SK4A 2UUAL 2AUJD 4B9KA 2HTME 2HHHQ 2M0XA 2UU9Q 1LTSD 1KAWA 1JICA 5IGGA 1T0SC 4C3IH 3AE4B 1Y1VH 4DUZQ 2LUEA 3H15A 1CTMA 1QZHA 5C44B 4UHVA 3VA5A 1E1TA 3MHBA 2KFKA 3PGEA 4IFDI 1YQ4B 2M19A 4IWOA 1B9NA 4P72A 1KXLA 1R4MB 3ZLZA 4HLEA 3BDOA 1G6JA 2ZM6L 3N1ZC 2R92H 2Y0SE 3W1GA 4YWGG 4RGTA 2GBMA 4A6QA 2WU5B 4JI6L 3L0WB 2NVXH 3KDFA 1QVFA 3OTOQ 2JRHA 1L2FA 1JRUA 4DR3Q 3DVNU 3R3MA 1XX8A 5CHWA 3VTWA 2KMAA 4MZ9A 1H4RA 3VDYA 3CC4A 2M0AA 5C4XG 2IY1B 1L4DB 4CYEA 1BCPC 1X3PA 2DY7A 2PW7A 4J15A 5L37A 5FJ8H 2PKOA 4M8MA 2XRQD 4LJZC 3ZDTA 1FNWA 3RZDH 1KJTA 2EMSA 3P20A 4JI8Q 4DPGA 4IPCA 1Q8IA 3OHXC 3J81j 3KFUA 5CBEE 3BZKA 2E5LQ 3GTPH 3ND8A 2HCCA 1ZW7A 2L7RA 1QJOA 3B1LX 4KGRA 4BS9A 2Q8RE 1HR0Q 1KABA 2CU1A 1IW7D 3VVWB 1OEYA 4ANXA 2G4DB 5JZEB 2VB2X 4JWSC 1CQVA 3I55A 1TKGA 1WYDA 2A74C 2A6ED 3RLNA 4WURA 3Q14C 3DWPA 1D5ZC 4B3MQ 4DUYL 3I7FA 1E2ZA 3FPPA 5E3FA 3QWZB 5LHY1 2D62A 4RKBA 4FXKC 2R7ZG 4K14A 4ZUIA 2K1BA 1TT2A 2NWGA 1IBKL 1VZ6A 4GNXB 2LXAA 4E74A 2KO3A 1GO3E 4IALA 1UEAB 4OZCA 1SNDA 4NAMA 1HEZE 4JV5Q 1GKHA 4X3UA 4NJCA 1YJJA 3CRKC 4KI0A 1F9PA 1E7UA 1QOBA 1WE7A 4YHHQ 2ZJDA 3E9SA 2RPVA 2FJ2A 2AX5A 3SE0A 4YY3L 3ERSX 5IN7A 4KKSA 1YN4A 1STEA 1Q86C 4LK0M 5EE3A 1V9JA 3RNGC 3VR3A 4L5QA 1JMCA 5COYA 5M3FB 4GKKL 2LHEA 2WXQA 1O7LA 1FVIA 4EQNA 3A1QA 3OIPA 3J7ZC 1H9SB 1WTQA 1X54A 2KZRA 2NUCA 4JCVE 2PO4A 4B0EA 4A3MH 4ZDVA 5EPKA 1F1HA 3NS1A 3HK0A 5I2YA 4CBVA 3EHVA 3H7PA 4LFAQ 2WXHA 4WJPA 4BKSA 1VQBA 1ZXIA 1S5DD 5IWAQ 3PO3H 1EWIA 3UQAA 4IM3A 5BN5A 3JAML 1PH1A 2CHXA 4KZ0A 4AUQC 3SD5A 1RDPD 3MC9A 1PA6A 2BH2A 3K59A 2K4KA 1N60A 2ZVOA 2GMIC 1PTOC 1RTOA 4DNTB 2JWZA 3TBLD 4D2KA 3G6JB 2GB1A 3K81C 4DR2Q 4LJOB 2KLCA 5K5PA 4R3DA 4XXEA 3AXCA 4IQZA 4XZ4A 2JU6X 3DBRI 1GUSA 2QDFA 4B9WA 4YCVA 2N9EB 1J0GA 2WDVB 2LSSA 1WGHA 3S1MH 4HEA1 2PZUA 3GE8C 3GB1A 3W1BA 1AZQA 3HOWH 2PYKA 4RG1A 2MO0A 1RYJA 2K9XA 3RZOB 2ASBA 1SMYD 2BQQA 3FILB 3TZDA 1P8LA 3PRMB 4IFDG 3SEBA 3OMGA 3NS8A 2XGTA 3CCUA 2NPTA 4LF4L 2K5HA 2WXIA 4FULA 2HT1A 1WTPA 3I8ZA 3GTMB 1XMQL 1WGDA 4KY5A 4HJKA 5LXIB 3UE0A 2JYOA 4IM0A 3QIAA 5IT9E 3F2UA 4IUUA 1EOTA 3I4MH 4IOIE 4DHJB 1FJGL 1C9OA 3I3CA 3PUXA 3GTLB 1UWVA 5E4WC 1PGAA 2VH2A 4R4QA 1E0ZA 3GTQB 2FINB 2AL3A 4KJOA 2EJMA 5KNBA 5DPRA 4I6PA 2MUYA 4G7HC 3V6CB 2IX0A 4C3HB 3UIPB 1DOLA 3H91A 4KHZA 4P74A 3NSWA 2EDGA 4BY1B 1XCQL 2Z59B 1WTVA 3KUCB 2ZJQA 5C3EG 3CQZB 3AMUA 1PH2A 1HZCA 2LJ5A 4KKIA 4J3OD 4AP4C 2DNFA 3FAHA 1JORA 1B44D 3KBGA 1XT9B 3EC8A 2AWOA 5EQ0A 4BBSG 1K3RA 4W9DA 1D7QA 4N9TA 3U9OA 1GJZA 1MIUA 1MPEA 1YNND 2FFKB 2D2CC 3G6EA 3A9KB 3D6CA 2C5LC 4YTPB 2RBMA 1WXAA 4GOCA 1CM9A 4AQYL 4PMCA 1EQQA 3OWEB 1EY6A 3MAQA 1V5OA 1P0RA 2AWTA 1J7AA 3AEVA 4OO1H 5BYQA 2KVZA 3N6RA 3VDZA 1ZPSA 3L7ZC 3I4OA 5IYBH 1S4ZA 2I38A 1O80A 4DU9A 2WGSA 1NR2A 3A4SC 4AJYB 4OGQC 3T1HQ 3EFCA 4GDLA 3RFZB 2XVSA 1M94A 1OXXK 2AL6A 5IAAC 4CQNA 1HPCA 1F0ZA 4OXPA 5C0XH 1WE6A 4PG3A 3MJ5A 1DOIA 1SFOB 3TDQA 5LNK1 1S5BD 4ZKBB 1EIYB 2NTSA 2JA6B 5BR8Q 1EFWA 3NVZA 4MT5A 3VTVA 3QJYA 1M1KC 3KQ4A 2W82A 3WA0A 1V8CA 5ELOA 3VAWA 2Q2IA 1V9PA 4HWIB 4PS3A 2QMTA 3U7DA 4K0KQ 3HHMA 5M3FH 1WR6E 3VFKA 2M00A 4GN5A 3U4ZA 4JL9A 3Q6BA 1NMFA 1HZBA 2FCNA 5M3MG 2NZHA 2KCTA 2JZPA 3P4SB 2HD3A 4KTAA 4JIOU 1ICWA 5CBAE 2HHHL 5HY6A 3NP8A 3HOUB 2E74C 4U68A 1FXTB 2UU9L 2B2VC 4DK6C 2UWQA 3W1SA 2DLBA 5D65A 4BA1I 1PYSB 1OGWA 1IHZA 3D6WA 3T51B 4DUZL 2LGDA 4KIKA 2LJIA 4G7ZC 4P71A 1EYDA 3CCMA 4J1MA 2NTTA 4EKUA 2N9PC 1JWBD 4TKNA 1SXTA 1R4NB 4KV6A 3EECA 1IBLQ 1SNQA 4A3GG 4FVMA 4CHTB 1SSNA 1ZDXA 2KJXA 2MH7A 3TZUA 4IG7B 2GVAA 4RNAA 4K7WA 3M4QA 3IBEA 1HFNA 4RKLA 2JRIB 4YWMA 1S5ED 3ERQA 3RZWC 1QCBD 3OTOL 1PZJD 1QNKA 4DR3L 1LV9A 2RHQB 3EIVA 3S2AA 1UELA 4JK1C 2AEHA 4O0AA 1HZ6A 1A3VA 2RDFA 1CZWA 2FAZA 1B4OA 2BA1A 1JC7A 1V1PA 3RZOH 1TWAB 2PEAA 1N36Q 4ACFA 3APFA 5IGDA 5I9PA 1YVCA 3NBHB 3SVMA 4JI8L 2NS5A 1WCMG 1ZKHA 2PLPA 4P1BC 4LNQA 2NZ1D 4RGNA 2E5LL 1JRPA 2F3VA 1A2TA 4IUVA 3Q8FA 1Z6HA 1WGYA 2PJHA 5FLMG 1HQRD 1QILA 1HR0L 2O2VA 3GTMH 3TP7A 3MFGA 3K5NA 2CHBD 3KF6A 2K25A 5KIXA 2IX1A 3AE7B 4M8NA 1J19A 1Y1WB 2BYEA 1PFDA 3VYUA 1SNMA 2O6VD 3E9HA 1DOMA 4BY7H 1VLBA 3MXPA 1YNTE 4B3ML 1PH6A 1XPUA 3V62A 4A8XC 3GTLH 3DXJC 4B95A 1BOSA 2OQKA 2YEPB 4QL5A 3FC4A 3ZNID 3GTQH 2DUDA 2DZIA 1EY9A 5JPNC 3CWIA 5CV5A 3UDGA 1E7ZA 3NUHB 5GQOA 4LNFA 1LTTD 5LMNQ 2D0PA 1F52A 4C3HH 4JV5L 2K0PA 3TP5A 2Z4HA 2VW9A 4PMBA 4BY1H 4XT1B 2WAQE 4YHHL 1N33Q 2O6VA 4HRSA 1BO0A 3CQZH 5IP9G 3VYTA 2RCNA 1A63A 2I2YA 1STAA 3NHHA 4PYUA 3CCLA 5E6OA 3TQYA 2I1KA 2MO1A 1VRAB 1H9MA 4ICVA 1FD6A 1XPOA 1XNQQ 4WJNA 2K5VA 2I46A 3UI3A 3L9AX 1HE8A 4PZ8A 2KQSA 2M2LA 2V3SA 5E6JA 4P75A 2JPHA 3OG5A 5C3XA 2WINB 3ZJUA 2N1WA 4LFAL 4IJLA 1V43A 4YWKA 3GDEA 3DVGY 2IO3B 5IWAL 1D5XC 1VF5C 3EQLC 2ALYB 4FF4A 4XQQA 1D2BA 1MFWA 3DM3A 1QVGA 1I4GA 2KUMA 3CIRB 1FCLA 3HOVB 1Q3LA 4X64Q 1KL9A 5CV6A 3G4SA 4I65A 1UGMA 2C9WB 2MSED 3DVNV 4HDQA 3CP0A 1KDCA 1EU4A 4J6HA 2CWPA 4L5RC 4PZ7A 1QUQA 2K22A 2N9KA 3L17A 4EQ5A 2PNRC 2UXCQ 1UEBA 3QG1A 1FL0A 4C3JB 3QAQA 5FLXc 5KRUA 4DR2L 1TS4A 1V1QA 2ZTCA 4DV3Q 1RTNA 1RRBA 1IUEA 1QQRA 4FO2A 3G7LA 2E2HB 1PTOH 1FRRA 4QAYA 5E6PA 3MTNB 2PZWA 2J7QB 1MJCA 4X6AH 1NE3A 1I4PA 3IG3A 2HQEA 1SFOH 4RMAA 2PI2A 2W55A 2KENA 4IDIA 2H1EA 3BK1A 1PH7A 2LY7A 2JYTA 3HP3A 2QCZA 4WIPA 2DNCA 3KYHC 1JJCB 4BXXG 4LF5Q 2IO2B 4ZRPA 2Z6KC 2QIEB 3HOZB 2WX1A 3HGBA 1Z47A 1GB1A 3QOJA 3ZNGC 2DZJA 1YNXA 2D3GA 4OWTB 2I5HA 5I4DA 3HOXG 1HZ9A 2F4VQ 4CKCA 3HOUH 1WJJA 4DNIA 4DR5Q 4C2MB 1OTRB 3P7JA 1WI5A 4BFRA 1TU2B 2LXJA 2R93G 4ZRQA 3AEBB 1XMOQ 1B7YB 1BBWA 1D1IA 3OYYA 3C46A 4DR7Q 4KMUC 3FKYA 4XDXA 3IAYA 4KGTA 4LLGM 3ER0A 2K3UA 3ONAB 1TVXA 2J52A 1DD2A 1NDDA 3B2FA 4XT3B 3PUYA 1HR0W 3KJOA 2VUMB 1V81A 4JVZA 1R4PB 2RKSA 4HJAA 2KAJA 4HMJA 3PQIA 4QIWE 1XTDA 1VQ6A 3URYA 2IHEA 3T53B 3P4QB 4ZRIA 2RDHA 2R6GA 4OX9Q 3PO2B 5JOBA 2CU3A 4MH0E 3AM9A 4IUMB 1NUCA 2QC8A 2B63G 2CW0C 1Y8RC 3A9JB 4KKUA 4R4IA 2OWOA 2B2WA 3SHLA 2L05A 1TWAH 5JHBA 1CT1D 3MEFA 1S3OA 5DEHA 1FR3A 2KC1A 1RFAA 1AZPA 1W6KA 1LYLA 1WWTA 4POGA 1U9RA 4Y7NH 1YN5A 4LUVA 1SBBB 2FE8A 4C80A 2ZXRA 1Q82C 2NVQB 5M5YB 1HRJA 2VXWA 3CW2C 1PFMA 1C4CA 1SEBD 4A3PA 1Y1WH 3CMMB 5G55A 5ELNA 2JSOA 1ENFA 1U0LA 1TBEA 4GDKA 2BKRB 1CSPA 3T1HL 3M95A 4A3LG 2J0KA 3J81c 2F3IA 3Q0AA 3R3OA 4C1NI 3MXUA 4YSZB 1Q46A 2O5IC 4UPAA 2ZXPA 2FNJB 4H13C 3PSEB 4X62Q 1E0BA 3HIZA 5DCNA 1PDQA 1D6EC 4DR6Q 5CX3A 1C4AA 2PQEA 4ME3A 4P73A 3VUXA 5BMIA 1HCZA 5BR8L 2GN5A 2JF5A 4R8NA 4OZBA 3BWUD 3BZDB 1EEID 4MN3A 2K50A 2L76A 1PFNA 1KLGD 1AEXA 4K0KL 1QZGA 2DWQA 1D4BA 4GNXA 2K5WA 2JP1A 2KA7A 2KN5A 4F8MA 2C7HA 3BDCA 3HKZG 1YIJA 2IJ0A 2MPMA 4L6TB 4NPSA 1YJNA 1DOXA 3J80c 2L00B 1A62A 4R4CA 2X38A 4YTNB 5EGTA 4MGIE 1MJEA 2MBOA 3ZJYC 5J18A 4NJ6A 1CKNB 1KNEA 4JI7Q 2A6HD 1JE5A 4C3IB 2J4XA 3FHWA 4M8AA 3HOVH 1E3PA 4NY0A 5HI1A 1H9SA 3S1QB 3GTKB 1GOZA 1XYIA 1IBXB 3X3MA 2H88B 1QF6A 2MP2B 1IBLL 3KUPA 4GOPC 1ZXHA 1NYQA 3TEHB 3CCQA 1JT8A 2Q2HA 2XRSD 2G9HD 2I5MX 2MX2A 1ZUD2 2KKCA 2NVYB 1AP0A 4G3XB 4I7AA 2K6AA 1JWAD 3T13A 3J81i 2NN6H 1OTCA 2BWES 5IA7A 2BH8A 4DK3C 1KRHA 2RQXA 2MBBB 2DZMA 2L5TA 4CO7A 4YWLA 3JSVB 3TMPB 3MXNB 2NVXB 2W9NA 1LTBD 1JE4A 1X32A 2TSSA 3AMZA 1N36L 2DHZA 3AULA 3PHWB 1GVPA 3AEFB 1BCPD 5G3LD 4X57B 1L1OC 5IOIA 4DDGD 3M63B 1EL0A 1WTXA 2A69C 2IWHA 3UE1A 1HNZQ 1KOTA 3RZDB 4XTCS 5HURA 3VR5A 1AE2A 4DF7A 5C0XJ 3HOZH 2UXDQ 2JA7B 1JALA 2ZPYA 5FO7B 4F8CB 4OIKA 2Q8TA 2KYWA 1LT6D 4A3FB 3J80i 4JI3Q 3DBLI 4DHJD 3KJPA 4X3KA 2KWVB 2ZW1A 2ZW0A 3H3VC 3FILA 5AZFA 1FFUA 3PIPA 4HPLB 4MTKA 1VQDA 1WRDB 5EDSA 3EROA 5FR3A 2ZZPB 1MG8A 3Q8EA 2EYFA 2VZAA 3A0JA 1ESRA 1XJVA 1TS2A 4JBWA 2W3SA 3HM3A 4XC2A 3W3AA 3BY4B 2WXGA 2K05A 1CHQD 2EJFC 2F0UA 3B9JA 4LUZA 4I6NB 2N9LA 1NEKB 1BR9A 2SNSA 3SK6A 2LVOA 2H89B 2VUMH 1QLBB 2M9VA 5LMNL 4QJFA 1PUTA 3PCOB 4FNFA 1AWDA 4GXBA 1N33L 5DPTA 4PYZA 2I5LX 3G48A 1JOOA 2B39A 3PO2H 5DNFA 5JEAH 3BVZA 2K52A 3N52A 4KDLB 3ZVVA 1GNUA 4JBJA 1LT4D 2J7ZA 1KNAA 3TUOA 5JJZA 2L0CA 1II3A 2PTLA 1XNQL 2B2UC 4JI1Q 1LFDA 4DQOC 3WWVA 1AN8A 4HSPA 5BN4A 1G6ZA 4H44C 4N9PA 4YIJA 2GA4B 5DLQE 4LFBQ 5J2RA 1RODA 3GS2A 3E3XA 4FYDA 1N5XA 3RN5A 2JA5B 2L83A 3ZJVA 3MZ5A 4K1RB 3LYYA 2KNBA 2ZT9C 4A3EB 3NQTA 4DXGA 4MJSB 5M5YH 3VA7A 2NVQH 1ISNA 3TSSA 2BT6A 1O7IA 2GLSA 1G291 4OWXB 2V4IB 5C5MA 4X64L 1ZEQX 2DJFC 3KLRA 1CKMA 1XPRA 3H3VI 2KTRB 4NJ7A 4RH6A 3BJUA 1Y1VG 2PW9A 3DOWA 1L0XB 2UXCL 4IKGA 2E2JB 3SHQA 1Y56A 3IXSA 1I6HB 2V9HA 3K7UC 4DV3L 1TXYA 1PTOD 1EF5A 2CKHB 5IGBA 3A9KA 3MTSA 4XYQA 2R92G 1VR9A 4GIVA 4B3TQ 4AYBG 1F2RC 4KN4C 4BBNC 2JEBI 2SNMA 1WF9A 1K83B 3PF4A 1H9JA 1W6JA 3ZTCA 1PRTF 2Y5BB 1V1OA 2ZTEA 5BMHA 1QE6A 2RCFA 4A3CG 2EVBA 3HOWB 4RCOA 2Z6BA 1EUJA 1JJ2A 2JA8H 2KEDA 1S5FD 2HQLA 3DBHB 4NQKE 3V61A 1EOVA 5FJ8G 4LF5L 2PVGC 4OW0A 1ILQA 3KVFB 4ZLTF 1Y8OB 4HCPB 5H92C 1STNA 3H9DA 4YSYB 1C76A 4ILWA 1UH6A 3I90A 4JBMA 1B3QA 2V1YA 1VQ8A 1SE4A 3HEJA 3SK8A 2F4VL 3MHSD 2L1BA 1ROEA 4HCNB 4DR5L 3FKIB 3APDA 3S15B 1NYRA 2LEKA 2WDRB 1XMOL 5D94A 1OQYA 1KDBA 4HR7B 3I4MB 4DR7L 2WAQB 2N1VA 3PIOA 4BBRG 3I56A 1X9NA 1EO6A 4M0WB 2H4OA 3S1QH 3GTKH 3WOFA 2DAJA 3F1ZA 3NHEB 3RMHA 2JE6I 5D14A 4CDEC 1V80A 4PK1A 2Y3AA 1B53A 5EJWA 2NVYH 1D5MC 1EEFD 3MWYW 3NWSA 1F2RI 4ICUA 4I7ZC 4OX9L 4XE0A 1VCBA 4DV6Q 1WOCA 1J6QA 1B9MA 2KHIA 4KSKC 3T3NA 2TMPA 1D1KA 3DWAA 2XSCA 1E24A 1ZKOA 1WXMA 3Q3NC 3TIXA 2B2YA 5GAGC 4EZJA 1PXUA 3J7A5 4IURA 2K33A 2MJ8A 1RAXA 1SIFA 1ZXTA 5LMNW 1GUTA 3GE3C 1A2UA 2RSOA 3CAMA 3TMEA 1L6UA 4DR1Q 1FMAD 3EA6A 1VQOA 4KVGB 2JA7H 4A3MG 1UBIA 2UU7A 1SYBA 1OXSC 5IGCA 4LF6Q 4H02A 4A3FH 3D3RA 2MLBA 2N88A 2Y5PA 2K28A 3NBHA 2HD5B 3PO3G 5HHDG 5C1ZA 2A1AA 2WB1G 1QOHA 1DZ1A 2F0WA 2J53A 2JSVX 5AUIA 3QWNA 3VH3B 2YV5A 3DHQA 4MDKE 5C23A 3DWQA 4C7ZA 2RGFA 1TS5A 4JI5L 2EPBA 2B76B 2A68C 2FXQA 3F2DA 3PSIA 1VQLA 4X62L 1B8AA 4IOCA 2R2QA 3PREA 1EYCA 4DR6L 3Q8DA 1Q1BA 1XNRQ 4PZ6A 1PRTC 1ML0D 3DCGA 4HKQA 2WHIA 2VNUD 2KQ7A 3HOYG 1UE7A 2RPQA 4HVBA 4H0LC 1WD1A 1PH4A 2IHFA 5DPSA 3MJWA 4DR4Q 2CVRA 5IT9L 4V190 1K52A 3UI2A 2GBKA 3AE9B 4DDID 4MSMB 2BB6A 2B8GA 4KLKA 3TS2A 3ZKJC 5K36H 1R7SA 3PRPB 4B0MA 2K39A 4APVA 3K58A 2FIDA 3LGJA 2KANA 1ZGUB 2C7MB 3S24A 3B08A 2JA5H 2KWCA 1TGZB 5KGUA 4ME5A 5IIFA 1ILPA 1YD8U 3WAMA 4A90A 1HH2P 4C7YA 4A3EH 3AU5A 4K6LA 3RLFA 2MGSA 2V3NA 4A55A 3JAMc 1A8VA 3B6YA 4FJVB 4JI7L 2F3WA 3UIOB 5ELBA 4DV0Q 3RD4A 1GJXA 1V49A 3N3KB 2PNHA 4N58A 1A15A 3K7AB 2LUMA 2QEXA 2AQ3B 2Z0EB 3S17H 5C44G 2EXDA 1WX8A 2E2JH 1CFMA 1WSPA 1X1MA 1HZ5A 2QCPX 1I6HH 5EKLA 2F0EA 2G1EA 5EE0A 4G7OC 4QQBX 1E7VA 1L0VB 5DAUA 2LGYA 2CH4W 1YQ3B 1BUVT 1P7FA 1EIGA 3I73A 1PVOA 2NBVB 1RIPA 1N34Q 3RD2A 3SR6A 1K83H 4GSWA 2K6QA 2KN4A 3R93A 3K57A 2N3SA 5FO8B 3NK9A 4IJHA 4ARIA 3ZNZB 1DXMA 1NCVA 3ZIMA 5CYUA 3QB3A 5EPLA 4UDUC 2MCNB 4N8X1 1VQ9A 2VRRB 5E7NA 3R2IA 3MEHA 2SEBD 1HNZL 2FUG1 3ZQ4A 2OHFA 4M1UB 2UXDL 1BCPB 2GOWA 1U4LA 2G9DA 2KJHB 3J9CA 3T9LA 1GB4A 2MEKA 3Q3OC 2K8BA 1H9RA 3P2BA 2C35B 4JI3L 3FKIH 3S15H 3F2CA 3U30A 3X0WA 4WWNA 4BAXA 3HVDA 1L6VA 3JAMi 3QIJA 4BY7B 1F9JA 3I2ZA 4OO1G 1GHKA 1L2NA 3D8GA 4JWUC 5E6NA 2PE6B 4WQOB 5KNCA 2K04A 3W1YA 3TP8A 2LRUA 4GLVB 1JOQA 1NY4A 2AQ2B 5IP7H 2XEWA 3VUYA 2LVPA 1K51A 1MBYA 3OJ3A 2M4NA 2LS01 3ULJA 4EQOA 1WR1A 2J42A 4ZKCB 1HNWQ 5JVH3 5AZHA 3RNAC 1JR0D 3NVYA 2DYMA 3ENEA 4DAPA 2XBBC 3ZRCA 1SNCA 1EF1A 3DM1A 3VR9B 5C4JB 1N9WA 1K8GA 5C0XG 2BGFA 2WXMA 4HIDA 4NXMQ 3BIID 3NVVA 1LXDA 1T0QC 2BDOA 1FCCC 1Q1EA 4XWTA 2KWDA 1JQYD 4JI1L 4W9CA 2WP9B 2VL6A 2F0FA 4HJ8A 4LJPB 3DEPA 4MHEA 3VR2A 2F0HA 4RHRA 3NQIA 4II2B 1QB5D 5M3FG 4Y52H 3ZXVA 1K8RB 4ZHPA 4FLHA 3KYCD 3GTOB 4W9HA 1J8IA 1QOGA 1K9MC 3QCAA 2JXTA 3A9JA 1ET6A 1RLFA 2CQAA 2DN8A 5EAYA 1T0YA 1YQBA 2KFJA 2WDQB 3D32A 2IGDA 5HKHA 3E9IA 3M4OB 1ZYRD 3SU8X 2G45B 4GN1A 2LKVA 3AE2B 4TQ1A 1ASZA 3I4NB 3ECIA 1Q12A 3DHHC 1IP9A 1GXDC 5FOBB 2PMVA 4CKEA 1IKMA 1XO3A 5AJ3L 2R3ZA 3D4WA 4ANVA 1ET9A 1UE5A 4A75A 4IFDH 4AYBE 4B3TL 1LT3D 1SDFA 2FIFA 1P7EA 4P1CC 2F0GA 4XX5A 3NY5A 1PTOB 1PZKD 1C77A 1EQVA 5AZGA 3L13A 1KAAA 4LF8Q 5CV7A 4A76A 1WJNA 2JWUA 3GZNI 3PHXB 4NMZA 3KUZA 1E6EB 3HVZA 4NB3A 2BYTA 3A54A 5C2TB 3AU4A 2MNAA 2WU2B 1PDXA 2K8HA 4HN7A 3OOCA 3BG3A 2VQEQ 4IOAA 3AYHB 2JZ3B 2D5GA 2QJLA 5M9OA 3V3XA 1HTQA 4L1BA 1MHWC 5IYDH 5A2QE 1SYEA 5JEAJ 3DBSA 5T8IA 1X3GA 1TTNA 3DHIC 1VS0A 1FNUA 5BYSA 3WCQA 2HIVA 2EJGC 5C3EH 3H0GB 3ONSA 4HKZE 3IHPC 2BDNA 4V0BA 3K7AH 3EN2A 2KMCA 1VZ8A 1PYBA 1FYCA 2D07B 1IYUA 2IGHA 4X65Q 1IBMQ 1NI3A 3UINB 3LNNA 5IP4D 4KY7A 1T3QA 2QEJC 1K3BC 2LXKA 4JBKA 1E90A 2XN9C 3SDZA 1WI0A 3C8YA 2EE1A 3TJPA 3Q3FA 1E2WA 3NXWA 1MSGA 1CKNA 4DV6L 2EXZA 1NR4A 2F0PA 5CV9A 3HRDD 4UP7A 4ZCKA 4OIJA 1X6OA 2PMZE 4BY1G 4NPNA 1IBXA 1L4ZB 3AE6B 3L08A 2OEOA 1ICFB 2MP2A 2PE9A 3UDXA 1VCIA 2CW0D 3AEGB 2KK8A 4EVOA 5LL6S 5EE1A 3RZFA 1KIXA 1CI3M 2KXJA 4E71A 1SE3A 4KZCA 2WXOA 4DR1L 5BYRA 3KDFB 1I4QA 2A8VA 2NZOA 3Q6SA 1K8OA 1WY8A 2NBWB 2AUKA 3JVZX 3JSVA 3H1UA 3ZRFA 4EUTA 3RYTA 4LF6L 4R8IA 4Y7NB 1A6XA 4L23A 1WTHA 4FXDA 1KQSA 4L5SA 1F2LA 2Q5WD 3PT2B 5C6AA 4Q0FA 2QF7A 4QY7A 4GN4B 1I35A 1I3QB 3PV1A 4H2AA 2PI2E 1CKOA 1FXAA 3MP9A 4JI0Q 4CDCC 2XK5A 1VQGA 4FF2A 2HDLA 2ON8A 5D2MB 1ZDVA 1VJKA 1JB3A 1FGUA 2SOBA 3DLLA 4HJ9A 3IVFA 4JPSA 2C9OA 4QCLA 5LMUQ 1XNRL 1HTLD 2J0TD 4HEDA 5M3MH 2K5QA 2KEEA 5C4JH 4DR4L 3KBXA 4QF4A 4RF0A 1WFYA 3J7AF 1XEEA 2X8XX 5HGQA 4HK2A 2F1MA 4WJOA 1EM7A 4C00A 2JA6G 4W9EA 1ZE3D 2ZNVC 3S1RH 5IYCH 4A3DB 4HSVA 5EKKA 4A3BB 4HJGE 4MGZE 2D2QA 2ICEC 1KRTA 3AE8B 4FADA 1Q10A 3NJTA 2CHZA 1SYCA 1F9QA 4R1JA 1GUNA 3GTOH 2G3QB 4WAFA 5D6JB 1VQNA 2OJRA 1I42A 2XWBB 2WQYB 3C0RB 3A55A 2J0JA 3G71A 4JI4Q 3HOUG 4DV0L 3GTGB 2Y0SB 3M7NA 3A1QB 3M4OH 4REZA 3C1EA 1K53A 4HCEA 2PQAA 4DKAC 2B63B 3I4NH 1E8ZA 4WORA 3D4DA 3M4PA 1K0RA 4UP8A 4NW2A 2IX3A 4A3KG 1TZOA 4KDIC 3OMCA 4L2YA 2LXCA 1N8RC 4F1SA 3QR8A 2IO1B 1FNVA 2EY6A 4A3JB 2A5UA 2KJRA 2UYZB 2OF1A 3WALA 1N34L 3A33B 4AWJA 4NAWA 2RVLA 5JHAA 1VF7A 1YNNC 2FMMA 3J7AV 3IRBA 5C4HA 4K5WA 2INDC 2M8SA 2MBQA 1NBWA 4JOIA 1HNXQ 1IYFA 5IO9A 1WTRA 2RD0A 4S0RA 1RJTA 3I72A 3H8HA 1E1OA 4CHKA 3L2PA 3Q3MC 1H9KA 3ZUNA 4F88A 3CC2A 2BS4B 1LO5D 3SR1A 1LGRA 2Y5CA 2WACA 4ABNA 3AE3B 3HM6X 5ELDA 3F2BA 1VQHA 3W5VB 2F0NA 4A4IA 3ZNHB 3NZSA 2WLBA 1G6PA 3PUZA 4M02A 4GU2A 5G2NA 1LQBA 2D5DA 2JQOA 3AN1A 1QZEA 2NPTB 1IZ6A 1V97A 4RFBA 1CMXB 4P16A 3H0GH 2BCOA 4JI2Q 3A5ZB 1I4RA 3LX0A 3W1SC 5BN3A 2ONQA 1VDVA 1YIWA 1V2YA 3I57A 3Q8BA 1NSNS 2D3BA 3QC8B 3VRBB 2YTVA 2Z9HA 3T16A 4TVAB 2RSUA 1EY7A 1BXTA 2KCMA 2GBJA 1LM0A 2RA4A 3CSTA 1SAPA 1HNWL 2MJDA 3VYRA 2OQ0A 3OWFA 2K8CA 4XWWA 1A70A 1VQKA 2GVBA 1IL8A 3RCZA 4JQWC 4NXML 3NELA 4DHZE 3O13A 4B3RQ 1DGSA 3D4RA 1Z5SB 2X6LA 3KLSX 3NOBA 1TKEA 3AV8A 3NEMA 5GROA 3JYUA 1O78A 3QARA 2JVCA 1LTAD 2BE5C 4I6LB 4EFOA 3CCVA 4DAYB 2D10A 3HRZC 3O65B 3TEYA 1I50B 4FXGC 3GP7A 1S40A 3MFYA 1ACCA 4WJ3M 1EZ6A 3ULPA 4FJZA 2MQHA 2M56B 1FPYA 3T3OA 2NB0A 4Q5VA 4PNYA 1DCZA 1EY4A 1Y69U 3Q2AC 3PLVA 4URKA 1P1AA 2N7DA 1FD7D 4K5VA 5I2XA 2F0SA 3STBD 4KK7A 4DAVA 3ML9A 4WQMA 1WZ3A 2CHWA 4WH4A 3R8BA 5LLIA 3M3YB 2B8FA 1I3QH 4IUTA 2LMCB 3HOVG 1N32Q 2F0QA 1YX5B 3U50C 1WJ4A 3B2GA 4KV2A 1E8WA 4UY8C 1K0SA 2LGIA 5AEKB 1TZ1A 4FBJB 3IFTA 4A3IG 1WYGA 2YU9B 1IGDA 4C3JG 1SIJA 4CJ2C 4BXXH 2DENB 2ZXOA 1JCKB 3K6OA 4A9AA 2NN6G 1A3UA 4F7ZA 4NQLB 3X3NA 5FLXE 1SROA 4LF8L 4C4VB 3N32A 3QJZA 1LT5D 1YJWA 5CHVC 4FF1A 2Q2TA 2YTYA 1TT5B 5TSSA 3UQBA 3K5OA 2CJNA 2JA8B 1KM7A 3I91A 3CF6E 3K9OB 1N5WA 4A3DH 4FJYA 2EMTA 3AEDB 4A3BH 3CHBD 2F4IA 1PH5A 2WP8J 4O1NA 2K6DB 1RF2D 1SMXA 1X65A 3GV6A 4DUYQ 5H1SE 5EPJA 3ULLA 4ZUJA 1VQPA 3HOZG 1CQFA 2BWFA 4G57A 2F0DA 5IGEA 4CKBA 1PQSA 3GTGH 3KLWA 1O7YA 4TMAB 2F03A 3WOEA 1N6ZA 2WFWA 2B63H 4X65L 1IBML 3WANA 1X56A 4YT0B 4LAAA 3ALBA 3OJ4B 5CMDA 3NTKA 2MP1A 5CC4A 4M01A 4HAEA 4DA2A 1EQTA 4KIKB 4CDFC 4A3JH 2VUMG 3A56A 3E56A 3D31A 3P42A 4WJQA 1YOVB 2LRWA 2H5XA 4PQXA 3DVGX 3C1FA 1G2TA 4K81A 3DEOA 4EE2A 4LNOA 1X3QA 3PO2G 1S5CD 1GUOA 2REXA 2FHTA 2GBRA 2FBWB 1U4MA 4OZAA 4QUCA 4RHSA 1NENB 2NCNA 2YVCA 1TIID 4TSSA 2AKWB 5IKCM 4IFDJ 1TIFA 2E3TA 2KDBA 2WXNA 3FPUB 4GGQA 3NTIA 4BKGA 2BYVE 3MXGA 3I63C 4AS1A 2K5DA 3SXHA 2WXFA 1V1PB 2NVUI 1X3EA 2VZKB 3KF8B 2EELA 3PPAA 2Q8IB 2RHSB 3TEWA 1TY0A 1C8CA 3WDNA 4DNRB 3CKIB 3L0OA 1CHPD 4UP9A
chains in the Genus database with same CATH topology
1XLOA 1LLRD 5JVG3 3W2DA 2K5PA 4L63B 4LTUA 5IOCA 3KWVA 1K8MA 2KDMA 1VDZA 2A68D 1J7BA 1NVID 4A93B 2DYOA 1PGXA 1R9TB 2QSDA 3Q23A 3J81E 1PRTD 1STBA 3K0YA 3EJIA 2KMMA 3TP6A 3MC0B 4R9WA 4K2KA 1IKLA 4BBRB 2N0SB 1BQQT 1SB3C 2MJEA 2B2WC 3I4LA 3IAS1 2PCFB 1A3TA 3GO5A 3NWTA 3I70A 2JEAI 2Z8LA 4L8JA 3J80E 3FDTA 2WKCA 2L11A 4C3IG 3S17B 2MJ3A 2WXKA 2O5JC 4X3TA 5C4XB 2I07B 2L9HA 4IUPA 5CR3A 3K5LA 3SFDB 2E75C 3P1MA 2N7JA 3PZ7A 4KKJA 4YXDB 4MH8A 3EUB2 1XWEA 4E6IA 3OSOA 3N9YC 5I6YA 2F0KA 5HGTA 3LWUA 3MA2B 3VR6A 1C4QA 1JROA 3NRZA 3CU7A 2L55A 2R7ZB 1JW9D 3SFEB 1HQMC 4EGVA 1T5XD 5T1GA 3IT4B 1PZID 1PFBA 3NE5B 4F7XA 5IGFA 2BW2A 3NVWA 1DOKA 1TKWB 1ZOYB 5DM63 4K2LA 2V3PA 5A35A 1HFGA 3PZ8A 5GXGB 5CV4A 1JQ4A 3L4PA 2CJOA 3E0JA 1SNPA 1CK1A 1AW7A 2IGGA 3M7GA 3TEXA 4OO1I 2A6HC 2RSNA 4KHVA 5K36G 3KLSA 5CGKA 2DBYA 1FO4A 3TEZA 5JPMC 5C5LA 5CV8A 1HUNA 2WS3B 3PUWA 1T6BX 1PTOF 4US9A 5C0XI 4ZK9B 4KD4A 4B08A 2KVMA 4S3SA 4ITKA 2FMCA 3E5SA 4K6DA 2KQ3A 3GTJB 1DOYA 1ENAA 4DN4M 2EY5A 4GDKB 1Z7TA 2RMMA 1YJIA 1HA6A 1N62A 4MM3B 3HUIA 4GZYC 4XQJA 2LHDA 4KGSA 5J39A 3BS1A 3CRLC 1TQOA 2NYZD 4NZLB 1M8AA 1N61A 5M5XB 1BBXC 1C79A 3DUZA 2XIWA 1UUPA 2LFIA 3S14B 2O2LD 1GUWA 5FO9B 1YNJC 5C3JB 4XIGS 4NDXA 4BA2I 3S2DB 4QIWB 5C3EB 1TWCB 1EY5A 3P75A 1RHPA 4QMGA 3VYSA 2BS3B 1EFID 4BBSB 5HG2A 2JXMB 4C56C 2HDMA 2OXPA 1SF0A 3Q69A 2B2VA 5C4ZA 3LWEA 3U9SA 4ZAIA 3GQBA 2Z4IA 1JOKA 2SAKA 2KACA 4RCNA 3KWLA 4DXFA 1GUGA 3FEWX 5EKIA 4PV1C 1K50A 5BMGA 1RKNA 4XYOA 4XQNA 1WTWA 3T56B 3V05A 2YEPF 3BVGA 3TBIB 1WTOA 1UWMA 3IT6B 4RA8A 1TS3A 5E4XA 2L32A 3A7AB 3ETRA 2BOSA 4KKTA 2EYPA 2QDBA 3IKJA 2WKDA 1LTGD 2E76C 1T5EA 3GV3A 3EGRA 4DFAA 4JE3B 2GRIA 1JWMD 1FXIA 2PW5A 5M3MB 5A2QL 4TRDA 4KN7C 1PRTB 3BYYB 3I9V1 1EWYC 2ENBA 3VR4A 1TWGB 2WIIB 3S1RB 1SJHD 3DWGC 2F0TA 1SSOA 2B2YC 1EWHA 3U7ZA 4IN3A 1BMLC 1XTCD 1F9RA 2B2TA 1E10A 4A3GB 1WRIA 4ARCA 4DAYA 3ABVB 3RUZA 2EYHA 4EQPA 1J9OA 2PPBC 2D9UA 3JAME 4N59A 3VR8B 1QNUA 1WCMB 1B3AA 4P6VF 3ND9A 4XDCA 1GPXA 3DMUA 3EFXD 2LMCA 3KK7A 1EU3A 1AFPA 4FXCA 4WWMA 2WNMA 2EYOA 2HUGA 5KYIA 3A8KE 2N55A 3U4EG 1IW7C 1WD0A 2L12A 1RCVD 3HS0C 1HXYD 2A6EC 1LACA 4HTHA 1UGJA 5H8YE 2YYZA 1F2MA 5LL6X 4OL7A 4USAA 4ULLA 3A8IE 3NUCA 1ESFA 2A5HA 1KH0A 2C5CA 3V2TA 1I6VC 3Q8CA 1U4PA 1MI0A 1TY2A 4DK0A 2F0IA 3AECB 1WXQA 2DNEA 3BDLA 4X3SA 4C3HG 3M4YA 1EIHA 2BTEA 3Q22A 3W9CB 4B9XA 2NBFA 3MVVA 2EYLA 3S9WA 4XDDA 2BE5D 1TR5A 2HDEA 1CZGA 3S2HB 1I4HA 2W3RA 3PV0A 4A3KB 1RFKA 4K8JA 4HCSA 1SE2A 2VZKD 4PMWA 4N6EB 4RF1A 3H94A 1STHA 3MXNA 2R61A 3W5UB 2E2DC 1R4QB 1JWSD 2JQRB 3SK5A 1TJEA 5I6WA 3PUVA 3P4PB 4ZOHC 2W54A 2V0GA 1MVKA 3ZGZA 3KF8A 3FRPB 1F2YA 1SMYC 1BDOA 1V8QA 1QKZA 1SJED 2EY1A 3J7YW 1MD2D 2PVOD 5KYLA 3HOXB 1XLNA 5ELEA 4LK1C 2OT2A 2R93B 2Z1CA 4RGOS 1I4XA 4FF3A 2K01A 4ID6A 1ENCA 2NN6I 3GD7A 2ICIA 4O42A 2ACZB 2B2TC 1QT9A 2X6GA 5DM73 4K5XA 1VMCA 3AB9A 2L4NA 4DK1A 1B9RA 4CGYB 3NBIA 1J7CA 2EYJA 1MGSA 4P2CB 5FKAC 4ZHOA 3NPPA 3P1HA 2BA0A 3VQIA 5EBDA 4RAUC 1HTPA 3OPOA 3FVQA 3AU7A 3QOLA 2IW3A 1HA5A 4WRDA 5AFWA 3NZ3A 1I7HA 2EZVA 1DGJA 1HUMA 5C3WA 1ZYRC 2OEDA 1VZ7A 3AB5A 1OXVA 3P63A 4WFN3 1YN3A 4F87A 2A69D 4WJWA 1VMPA 4A3IB 3IL8A 2WV6D 4KD3A 1FGBD 2PZTA 1CA5A 1N63A 2EOTA 1QOAA 1KTKA 5FLXL 1IGCA 3Q24A 1KF6B 4US8A 5CORA 1QG7A 1SYFA 2JYEA 2XWJB 2KECA 1KLUD 3OW7A 1JMLA 1MI2A 5J1ZA 3PIP3 1MHHE 1XXGA 1KFYB 4PT5A 1L0YB 1EY0A 3LB8C 4MIUA 3HKZB 4MACA 4IUQA 2E2IB 4U673 4M0WA 4QB4A 3AE5B 1RD9D 3E6ZX 3NTHA 2O4XA 4JX1C 4Z9CB 5EBCA 4ODGA 2KCNA 2PIAA 1E2VA 4AQ7A 2KCCA 4TQUS 4QUFA 1E9MA 1EY8A 1UWXA 4RWSC 3S16B 1DONA 1SYGA 2B2UA 1NAPA 1QOFA 1CZPA 5EE9A 5JXVA 3A8JE 3PMFA 2K32A 2IDYA 2F0MA 1G8ZD 1UAPA 2HCIA 1RM6C 1FFVA 1RWSA 4Q2JA 1C9FA 1FRDA 3H6MA 1TWFB 4C1NK 1HHVA 1G91A 1U4RA 5ELCA 4GDLB 2F0JA 3S1NB 2BS2B 2SDFA 4ZQ3A 4YTMB 1OXTA 2EKIA 4IZ8A 3V96A 2ID0A 2NVTB 1PGBA 4KJNA 4LMQD 2WXLA 3FMCA 3EVQA 2WXJA 5KNDA 2EYMA 1PMRA 1Y8NB 3C3LA 2F0OA 2VB3X 5G5HA 2DY8A 1QWYA 2AWNA 1PYWD 3J81L 1STYA 3BK2A 1TYGB 1LABA 1C48A 2A73B 1OQRA 1XF5L 1AYFA 5D3IB 1STGA 1YMHE 3PIO3 1ZP0B 3U52E 5I9OA 4HMIA 2RDGA 4OVZA 1XLPA 2KHSA 5M5WB 5JEAG 1TKYA 2IPKD 3J80L 1OQQA 2KQ4X 3AEEB 1O7ZA 4FP5D 3ITPA 4K8IA 1Y1VB 4NP5A 5FK9C 1EYAA 1UNSA 1G2SA 3AE1B 5AUKA 5E1FA 1EWCA 3ZJTA 2R92B 1IYVA 4AYBB 3TN2A 2KOLA 3DWMA 1WVLA 1FEHA 5G5GA 1DM0B 2WXPA 1EZ8A 2QILA 3U2SC 4J8QA 5D3DA 5T1IA 2INNE 4KY6A 1GAQB 5NUCA 3AH7A 3MHZA 2AQ1B 3QO2A 4HROA 2QKIC 3LXFA 1GHJA 5KEEA 1C78A 5ISRA 2WXRA 3R2TA 1FIQA 1XCTL 2NMQA 1BNZA 2INPE 3GTPB 1OFFA 1CJEA 1M4VA 3P4RB 2V4DA 4G4KA 2F0LA 2MHVA 2LFNA 1L5PA 1LTRD 1KDAA 2XNAC 3AEAB 1TWHB 3HZXA 2K7VA 1OXUA 1Y8PB 1MHXA 1YNJD 4YSXB 2IT1A 5D7GA 3T4AC 5HFYA 3BVMA 1ONLA 1SNOA 2K03A 5IODA 3M85A 4TKOB 2PMZB 5JAVA 3HG9A 5F2DA 2BBCA 5J22A 1PLFA 3OIQA 2EY2A 1BCPF 5G3LF 1F2ZA 1E7PB 1BUIC 1SYDA 3C2PA 4A3MB 2E6XA 3Q8AA 3L3OC 2X69A 1XLQA 5MPOA 4ZRZA 3H09A 1FM0D 3PO3B 4NAWB 1DJRD 2WB1B 4RGMA 2L1AA 4IUNA 4UAIA 3BYTB 3A7LA 3IAM1 1MSHA 4H7BA 1DYQA 1BF4A 2L52A 3VRAB 5ELFA 3RPFC 4GLSC 1CA6A 2IL8A 1B1ZA 4OHJA 4CJ1B 2F0VA 3HOYB 4TQ0A 3IFDA 1F9SA 3K5MA 3S1MB 2GI9A 1OO9B 1Q90A 4CJ0B 1WGKA 4KX6B 2BB5A 3PO0A 4BWGB 1JWUD 3ZYYX 4ZYSA 2JX5A 4DGZA 4NKLA 1C4PA 1LTID 1B2TA 1F77A 1B50A 3SK4A 2AUJD 2HTME 1LTSD 1JICA 5IGGA 3AE4B 1CTMA 5C44B 3VA5A 3MHBA 4IFDI 1YQ4B 2M19A 1B9NA 3BDOA 4YWGG 4RGTA 4A6QA 2WU5B 1XX8A 2M0AA 1L4DB 1BCPC 1X3PA 2DY7A 2PW7A 2PKOA 2XRQD 4LJZC 1FNWA 3P20A 1Q8IA 3OHXC 5CBEE 3ND8A 2HCCA 1QJOA 4KGRA 4BS9A 2Q8RE 1KABA 1IW7D 2VB2X 4JWSC 1CQVA 1TKGA 2A74C 2A6ED 4WURA 3DWPA 1D5ZC 5E3FA 1E2ZA 3FPPA 5LHY1 2D62A 4RKBA 4FXKC 4K14A 4ZUIA 2K1BA 1TT2A 2NWGA 1VZ6A 4IALA 1UEAB 4OZCA 1SNDA 4NAMA 1HEZE 4NJCA 4X3UA 1YJJA 3CRKC 4KI0A 1F9PA 1QOBA 3E9SA 2RPVA 2FJ2A 2AX5A 3SE0A 4KKSA 1YN4A 1STEA 5EE3A 4LK0M 3VR3A 5COYA 5M3FB 2LHEA 2WXQA 1O7LA 4EQNA 3OIPA 1H9SB 1WTQA 2NUCA 4B0EA 2PO4A 5EPKA 3NS1A 5I2YA 4CBVA 2WXHA 1ZXIA 1S5DD 5BN5A 3JAML 1RDPD 3K59A 1N60A 1PTOC 1RTOA 4DNTB 4D2KA 3G6JB 2GB1A 5K5PA 4R3DA 4XXEA 4IQZA 2JU6X 1GUSA 4B9WA 2WDVB 4HEA1 2PZUA 3GB1A 1AZQA 2PYKA 1RYJA 2K9XA 3RZOB 1SMYD 3FILB 3TZDA 4IFDG 3SEBA 3OMGA 2WXIA 1WTPA 3I8ZA 3GTMB 4KY5A 2JYOA 3QIAA 5IT9E 3F2UA 4IUUA 1EOTA 4IOIE 3I3CA 3PUXA 3GTLB 1PGAA 5E4WC 1E0ZA 3GTQB 2FINB 4KJOA 2EJMA 5KNBA 2MUYA 4G7HC 2IX0A 4C3HB 1DOLA 3H91A 4KHZA 4BY1B 3NSWA 2EDGA 1XCQL 1WTVA 3CQZB 3AMUA 4KKIA 4J3OD 3FAHA 1JORA 1B44D 3KBGA 2AWOA 5EQ0A 3U9OA 4N9TA 1MPEA 1YNND 2FFKB 2D2CC 3D6CA 4YTPB 2RBMA 1CM9A 4PMCA 3OWEB 1EY6A 3MAQA 1J7AA 4OO1H 5BYQA 3N6RA 1ZPSA 3L7ZC 1S4ZA 2I38A 4DU9A 1O80A 1NR2A 4OGQC 3RFZB 2XVSA 1OXXK 4CQNA 1HPCA 1F0ZA 5C0XH 3MJ5A 1DOIA 1SFOB 3TDQA 5LNK1 1S5BD 4ZKBB 2NTSA 2JA6B 3NVZA 4MT5A 3QJYA 3KQ4A 2W82A 1V8CA 2QMTA 2M00A 2JZPA 3P4SB 4KTAA 1ICWA 5CBAE 3NP8A 3HOUB 2E74C 4U68A 3W1SA 2B2VC 2DLBA 5D65A 4BA1I 4A8XC 1IHZA 3D6WA 3T51B 2LJIA 4G7ZC 1EYDA 4J1MA 2NTTA 1JWBD 1SXTA 4KV6A 2MH7A 1SNQA 4FVMA 4CHTB 1SSNA 1ZDXA 2KJXA 4RNAA 3TZUA 1HFNA 4RKLA 1S5ED 3ERQA 1QCBD 1PZJD 1QNKA 1LV9A 4JK1C 1HZ6A 1A3VA 2RDFA 1CZWA 1B4OA 2BA1A 1JC7A 1V1PA 1TWAB 5IGDA 5I9PA 3SVMA 2PLPA 2NZ1D 4RGNA 1JRPA 2F3VA 1A2TA 4IUVA 3Q8FA 1Z6HA 1HQRD 1QILA 3TP7A 3MFGA 3K5NA 2CHBD 3AE7B 5KIXA 2IX1A 1Y1WB 1PFDA 3VYUA 1SNMA 1DOMA 1VLBA 3MXPA 1YNTE 3DXJC 1BOSA 2YEPB 3FC4A 1EY9A 5JPNC 3CWIA 5CV5A 3NUHB 1LTTD 2K0PA 3TP5A 2Z4HA 4PMBA 4XT1B 4HRSA 1BO0A 3VYTA 2I2YA 1STAA 3NHHA 1VRAB 1H9MA 1FD6A 2I46A 3UI3A 3L9AX 2M2LA 5E6JA 5C3XA 2WINB 3ZJUA 1V43A 1D5XC 1VF5C 3EQLC 1D2BA 4FF4A 4XQQA 1FCLA 1I4GA 2KUMA 3CIRB 3HOVB 1Q3LA 5CV6A 4I65A 1KDCA 1EU4A 4J6HA 2K22A 2N9KA 2PNRC 3QG1A 4C3JB 5KRUA 1TS4A 1RTNA 1IUEA 1QQRA 4FO2A 3G7LA 2E2HB 1PTOH 1FRRA 2PZWA 1I4PA 2HQEA 2W55A 4IDIA 2H1EA 3BK1A 2LY7A 2JYTA 3HP3A 4WIPA 2DNCA 4ZRPA 2QIEB 3HOZB 3HGBA 1Z47A 1GB1A 3QOJA 5I4DA 4CKCA 4C2MB 3P7JA 1TU2B 4ZRQA 3AEBB 1D1IA 3C46A 4KMUC 4KGTA 4XDXA 3IAYA 4LLGM 2K3UA 3ONAB 1TVXA 2J52A 1DD2A 3B2FA 4XT3B 3PUYA 2VUMB 1R4PB 2RKSA 2KAJA 4HMJA 3URYA 3T53B 3P4QB 2RDHA 2R6GA 3PO2B 5JOBA 2CU3A 3AM9A 1NUCA 2CW0C 4KKUA 2B2WA 3SHLA 1CT1D 5DEHA 1FR3A 1AZPA 1W6KA 1WWTA 1U9RA 1YN5A 1SBBB 2FE8A 4C80A 2ZXRA 5M5YB 2NVQB 1HRJA 2VXWA 1PFMA 1C4CA 1SEBD 2JSOA 1ENFA 3Q0AA 3R3OA 4C1NI 3MXUA 4YSZB 2O5IC 2ZXPA 4H13C 1E0BA 1PDQA 1D6EC 1C4AA 2PQEA 5BMIA 1HCZA 4R8NA 3BWUD 3BZDB 1EEID 4MN3A 1PFNA 1KLGD 1AEXA 2DWQA 1D4BA 2K5WA 2JP1A 2KA7A 4F8MA 3BDCA 2IJ0A 2MPMA 4L6TB 1DOXA 2X38A 4YTNB 5EGTA 1KNEA 2A6HD 4C3IB 2J4XA 4M8AA 5HI1A 1H9SA 3S1QB 3GTKB 1GOZA 1XYIA 1IBXB 3X3MA 2H88B 1QF6A 3KUPA 1ZXHA 1NYQA 2XRSD 2G9HD 1ZUD2 2NVYB 1AP0A 2K6AA 1JWAD 3T13A 2NN6H 1KRHA 2RQXA 2L5TA 2NVXB 1LTBD 1JE4A 1X32A 2TSSA 3AMZA 3AEFB 1BCPD 5G3LD 1EL0A 1WTXA 2A69C 2IWHA 3RZDB 4XTCS 5HURA 3VR5A 1JALA 4DF7A 5C0XJ 2JA7B 5FO7B 4OIKA 2Q8TA 1LT6D 4A3FB 4X3KA 2ZW1A 2ZW0A 3H3VC 3FILA 1FFUA 5FR3A 3EROA 3Q8EA 2EYFA 1ESRA 2W3SA 1TS2A 4JBWA 3W3AA 2WXGA 2K05A 1CHQD 2EJFC 2F0UA 3B9JA 2N9LA 1NEKB 1BR9A 2SNSA 3SK6A 2H89B 1QLBB 2M9VA 1PUTA 1AWDA 4FNFA 1JOOA 2B39A 5DNFA 5JEAH 3BVZA 3N52A 1LT4D 2J7ZA 1KNAA 3TUOA 5JJZA 2L0CA 1II3A 2PTLA 2B2UC 4DQOC 1AN8A 5BN4A 4HSPA 1G6ZA 4H44C 4YIJA 4N9PA 2GA4B 1RODA 3GS2A 4FYDA 1N5XA 2JA5B 2L83A 3ZJVA 3MZ5A 3LYYA 2ZT9C 4A3EB 3NQTA 4DXGA 3VA7A 3TSSA 2BT6A 1G291 2V4IB 5C5MA 1ZEQX 3KLRA 4RH6A 2PW9A 1L0XB 4IKGA 2E2JB 1Y56A 3IXSA 1I6HB 1PTOD 5IGBA 3MTSA 4XYQA 1VR9A 1F2RC 4KN4C 2JEBI 2SNMA 1K83B 1H9JA 1W6JA 1PRTF 1V1OA 5BMHA 1QE6A 2EVBA 3HOWB 4RCOA 2KEDA 1S5FD 2PVGC 4OW0A 1ILQA 4ZLTF 1Y8OB 5H92C 1STNA 4YSYB 1C76A 4ILWA 3I90A 1SE4A 3HEJA 3SK8A 2L1BA 1ROEA 3FKIB 3S15B 1NYRA 2LEKA 2WDRB 1KDBA 4HR7B 3I4MB 2WAQB 2H4OA 3WOFA 3RMHA 2JE6I 5D14A 2Y3AA 1B53A 5EJWA 1D5MC 1EEFD 3MWYW 3NWSA 1F2RI 4I7ZC 4XE0A 1B9MA 3T3NA 2TMPA 1D1KA 3DWAA 2XSCA 1ZKOA 2B2YA 1PXUA 4IURA 2K33A 2MJ8A 1ZXTA 1GUTA 1A2UA 2RSOA 3TMEA 1L6UA 1FMAD 3EA6A 1SYBA 1OXSC 5IGCA 3D3RA 2N88A 2Y5PA 2K28A 3NBHA 5HHDG 1DZ1A 1QOHA 2F0WA 2J53A 2JSVX 5AUIA 3QWNA 3DHQA 4C7ZA 3DWQA 1TS5A 2B76B 2EPBA 2A68C 4OZBA 1EYCA 1Q1BA 1PRTC 1ML0D 4HKQA 2VNUD 4H0LC 1WD1A 2CVRA 5IT9L 4V190 1K52A 3UI2A 3AE9B 2BB6A 2B8GA 5K36H 1R7SA 4B0MA 3K58A 5KGUA 4ME5A 5IIFA 1ILPA 4A90A 4C7YA 4K6LA 3RLFA 2MGSA 2V3NA 4A55A 2F3WA 5ELBA 1GJXA 3RD4A 4N58A 1A15A 3K7AB 2LUMA 2AQ3B 1WSPA 1CFMA 1HZ5A 2QCPX 5EKLA 2F0EA 2G1EA 5EE0A 4G7OC 1L0VB 5DAUA 1YQ3B 1BUVT 1P7FA 1EIGA 3I73A 3SR6A 2KN4A 3R93A 3K57A 5FO8B 3NK9A 4ARIA 1DXMA 1NCVA 5CYUA 3QB3A 5EPLA 4UDUC 3R2IA 3MEHA 2SEBD 2FUG1 3ZQ4A 2OHFA 4M1UB 1BCPB 3J9CA 1U4LA 2G9DA 1GB4A 2MEKA 1H9RA 3HVDA 1L6VA 4BY7B 4OO1G 1GHKA 3D8GA 4JWUC 5KNCA 2K04A 3TP8A 1JOQA 2AQ2B 1K51A 1MBYA 2LS01 4EQOA 2J42A 4ZKCB 5JVH3 1JR0D 3NVYA 2DYMA 4DAPA 1SNCA 3DM1A 3VR9B 5C4JB 5C0XG 2WXMA 3BIID 3NVVA 2BDOA 1FCCC 1Q1EA 4XWTA 2KWDA 1JQYD 2WP9B 2F0FA 3DEPA 4MHEA 3VR2A 2F0HA 4RHRA 3NQIA 1QB5D 4ZHPA 3GTOB 1J8IA 1QOGA 2JXTA 1ET6A 2CQAA 2DN8A 2WDQB 2IGDA 3M4OB 1ZYRD 2LKVA 3AE2B 4TQ1A 3I4NB 1Q12A 1GXDC 5FOBB 2PMVA 4CKEA 1IKMA 1XO3A 2R3ZA 3D4WA 1ET9A 4IFDH 1LT3D 1SDFA 1P7EA 2F0GA 1PTOB 1PZKD 1C77A 1EQVA 1KAAA 5CV7A 2JWUA 4NMZA 1E6EB 3HVZA 2BYTA 3A54A 5C2TB 2WU2B 1PDXA 4HN7A 3OOCA 3BG3A 2D5GA 2QJLA 5M9OA 3V3XA 4L1BA 5A2QE 1SYEA 5JEAJ 5T8IA 1FNUA 5BYSA 3WCQA 2EJGC 3H0GB 4HKZE 2BDNA 4V0BA 1VZ8A 1FYCA 1IYUA 2IGHA 1NI3A 3LNNA 4KY7A 1T3QA 2QEJC 3C8YA 2XN9C 3SDZA 2EE1A 1E2WA 3NXWA 1MSGA 2EXZA 1NR4A 2F0PA 5CV9A 3HRDD 4OIJA 1IBXA 1L4ZB 3AE6B 2OEOA 1VCIA 2CW0D 3AEGB 4EVOA 5LL6S 5EE1A 1CI3M 1SE3A 2WXOA 5BYRA 1I4QA 3Q6SA 1K8OA 2AUKA 4R8IA 4Y7NB 1A6XA 4L23A 4FXDA 1F2LA 2Q5WD 5C6AA 4Q0FA 2QF7A 1I3QB 4H2AA 1FXAA 3MP9A 4FF2A 2HDLA 2ON8A 1ZDVA 1VJKA 1JB3A 2SOBA 4JPSA 2C9OA 4QCLA 1HTLD 2J0TD 4HEDA 2K5QA 2KEEA 3KBXA 4QF4A 4RF0A 3J7AF 1XEEA 2F1MA 1EM7A 1ZE3D 4A3DB 4HSVA 5EKKA 4A3BB 4HJGE 2ICEC 3AE8B 1Q10A 1SYCA 1F9QA 1GUNA 4WAFA 2XWBB 2WQYB 3A55A 3GTGB 2Y0SB 3M7NA 4REZA 3C1EA 1K53A 4HCEA 2B63B 4WORA 3D4DA 2IX3A 4NW2A 1TZOA 3OMCA 4L2YA 1FNVA 2EY6A 4A3JB 2OF1A 2RVLA 1VF7A 1YNNC 2FMMA 3J7AV 5C4HA 4K5WA 1WTRA 1RJTA 3I72A 3H8HA 1H9KA 4F88A 2BS4B 1LO5D 3SR1A 2Y5CA 2WACA 4ABNA 3AE3B 5ELDA 3W5VB 2F0NA 2WLBA 3PUZA 2D5DA 3AN1A 1V97A 4RFBA 4P16A 2BCOA 1I4RA 3LX0A 5BN3A 2ONQA 1VDVA 3I57A 3Q8BA 1NSNS 3VRBB 3T16A 1EY7A 1BXTA 2RA4A 1SAPA 2MJDA 3VYRA 3OWFA 4XWWA 1A70A 1IL8A 3O13A 3D4RA 2X6LA 3KLSX 1TKEA 3AV8A 1O78A 1LTAD 2BE5C 3HRZC 3TEYA 1I50B 4FXGC 3GP7A 3MFYA 1ACCA 1EZ6A 2M56B 3T3OA 2NB0A 4Q5VA 4PNYA 1DCZA 1EY4A 1Y69U 1FD7D 4K5VA 5I2XA 2F0SA 4KK7A 4DAVA 4WQMA 4WH4A 3R8BA 3M3YB 2B8FA 4IUTA 2LMCB 2F0QA 3B2GA 2LGIA 3IFTA 1WYGA 2YU9B 1IGDA 4C3JG 1SIJA 4CJ2C 2ZXOA 1JCKB 3K6OA 4A9AA 2NN6G 1A3UA 3X3NA 5FLXE 1LT5D 4FF1A 5TSSA 3K5OA 2CJNA 2JA8B 3I91A 1N5WA 3AEDB