3W2DA

Crystal structure of staphylococcal eenterotoxin b in complex with a novel neutralization monoclonal antibody fab fragment
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Structural basis for the neutralization and specificity of Staphylococcal enterotoxin B against its MHC Class II binding site.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 55
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3w2dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w2dA01
5ELEA 2RDGA 2G9HD 1I4QA 1T5XD 4C56C 2WV6D 1STEA 1SE2A 4UDUC 1L0YB 1TS5A 1PRTB 1LTRD 3TSSA 1HA5A 1I4HA 1V1PA 1S5FD 5D3IB 1SXTA 1EWCA 1JWSD 5ELFA 2IPKD 2IJ0A 4K6LA 1PTOC 3KLSX 1JCKB 2NTSA 1LTBD 1CHQD 1ESFA 1L0XB 4OHJA 4RGNA 3BZDB 1EEFD 1CT1D 1YN5A 2R61A 1EFID 1LT6D 2XRSD 1ET6A 5FK9C 3OWEB 4L6TB 4RGTA 1TS3A 3R2IA 1SE4A 3V05A 1V1OA 4DXGA 3W2DA 1FGBD 2QILA 1I4PA 2Z8LA 4O1NA 1B1ZA 1BCPB 2ICIA 4TSSA 1D5XC 1LTAD 1UNSA 1PTOF 5FKAC 1XTCD 1M4VA 1LT4D 1AW7A 3DWPA 4RHRA 1SE3A 3CHBD 1EEID 1S5BD 2NTTA 1PZJD 1BCPD 4RGMA 1D5ZC 4ZYSA 1PRTD 1XXGA 1BXTA 3MC0B 2QEJC 2AQ2B 1S5CD 2XRQD 1LTTD 3BYYB 4L63B 1MD2D 1ET9A 1S5DD 3O13A 1HXYD 3BVGA 1KLUD 5ELCA 5I4DA 1YN4A 3R2TA 2SEBD 3R8BA 1I4GA 1DYQA 3URYA 1LO5D 1KLGD 1I4XA 4RGOS 2XNAC 1TS4A 1LLRD 4NZLB 5ELBA 1SJHD 3EA6A 1LT3D 3BVMA 3DWQA 1ENFA 1B44D 1SEBD 1UUPA 1JWUD 1KTKA 1PTOB 1LT5D 1TS2A 1JR0D 2RDHA 1FNWA 1RD9D 1F77A 1G8ZD 1RCVD 3BVZA 3EFXD 4DXFA 4RHSA 4BWGB 1V1PB 1PTOD 3DWAA 4RH6A 1JQYD 1LTSD 1LTGD 1FNUA 1LTID 1D6EC 1RDPD 2AQ1B 1BCPC 3BYTB 5ELDA 1CK1A 1PRTC 2AQ3B 2CHBD 3SEBA 1SJED 1PZKD 1PTOH 1D5MC 1DJRD 1S5ED 1TY2A 1I4RA 1HQRD 1SBBB 1PYWD 2O2LD 3GP7A 1CQVA 2TSSA 3MFGA 5D3DA 1EU4A 5TSSA 1CHPD 1RF2D 1PZID 1EU3A 1FNVA 2J4XA 1AN8A 1TY0A 1FD7D 1BCPF 1QILA 4RFBA 1YN3A 4RCOA 1JWMD 4Z9CB 1PRTF 2XN9C 1GOZA 1HTLD
chains in the Genus database with same CATH superfamily
1FMAD 1C8CA 1UAPA 5DPRA 1Y8OB 2K5VA 1KF6B 3R7RA 1YNND 1C9FA 1VZ8A 2LHDA 2XSCA 1I4HA 3ITPA 4NW2A 5C3XA 3K58A 1WFYA 3RD2A 2IY5B 1SXTA 4LFBQ 2O2VB 3AE8B 1QNKA 3TZUA 2PVGC 4ZCKA 3U7ZA 3RNBC 4KHVA 5CV7A 4IUMB 4GZYC 2NTSA 1LTBD 1ZXIA 2E74C 3V61A 2PIAA 4FXCA 1VQKA 2BTEA 4NDXA 4Q2JA 4PS8A 1KRSA 4C4VA 3WWVA 1TWHH 4DK6C 5E3FA 1XCQL 4KDLB 1WOCA 1I3QB 4RGTA 3D8GA 4J6HA 3C19A 5G55A 2F0HA 3AB9A 1C4AA 3ERQA 4G7OC 2UUAL 2WDVB 3UDIA 2FNJB 3P4PB 4M00A 4BA1I 5M5YH 3PIO3 5JAVA 3RD4A 3DCGA 1PTOF 4BY1H 4FXGC 2BW2A 3AE5B 1AW7A 4TQUS 5GAGC 3IFTA 4RHRA 1GB4A 5AZFA 2J0TD 1R4NB 4BVUC 2OCEA 4QJFA 1SSNA 2MP2A 4YCUA 4HPLB 3VR8B 1WZ0A 5JOBA 1TXYA 3BYYB 1PVOA 2GBNA 2K5WA 3PUVA 1PV4A 3O13A 1HXYD 1YX5B 3CMEA 2B3GA 2R7ZB 5IYCH 3DUZA 1JRUA 4NQLB 1STBA 5DCNA 4A20A 3S16B 3A74A 4ZQ3A 2WGSA 2LVPA 4OVZA 2HUGA 2JU6X 2NVTH 4G0NB 3T1YL 2B2VA 1BF4A 1DOIA 3ZNHB 2F0OA 2K6AA 2AWTA 1QB5D 2RCNA 2INDC 2LSSA 2MFIA 1QZEA 2CWPA 2L55A 1FFUA 1OQQA 1EY6A 4HROA 4WJQA 1XPUA 3GTMB 2D3BA 1NMGA 3A54A 3BK2A 1B44D 2LGDA 3KWVA 1HJPA 4N9PA 1TVXA 1JC7A 3NUCA 2LJ5A 3UDXA 2V4IB 3RMKC 1G8ZD 1RLFA 3ULPA 2B2UC 3EECA 3N3KB 1XWEA 3PF5A 1CSPA 1EY5A 4YWKA 4RH6A 3MXPA 3M3YH 2M56B 2X6GA 2XWJB 3NWSA 4A3CH 4I7ZC 3GV3A 4A3LG 2NVXH 2XTIA 4ZKCB 4HLEA 1NI3A 2MHVA 1N62A 4LF5L 1CK1A 1SNOA 1E2ZA 4FYDA 1ZDVA 4B9KA 2H5XA 4OX9L 4A93B 1VQOA 2F4VQ 4DDGD 1PZKD 3VA7A 2ZJDA 1IYUA 3JVZX 3KYHC 3ND8A 1PXUA 3DBLB 4OVUA 2ZTDA 4IJHA 2ZXRA 3PRZA 5KYLA 1Q8KA 2TSSA 3HOYG 1EU4A 3TEWA 1B50A 3DLLA 5EE9A 3J81i 3TEXA 3S1QB 1SNMA 1BBWA 1H9KA 3LWUA 1DGJA 4WJOA 3UINB 1YHAA 2BH8A 4IPGA 1XJVA 3GTGB 1PGXA 1IKMA 4DR4Q 5BYRA 4LNNA 1C0AA 4IPDA 5C44G 3FAHA 2NPTB 3QK0A 1IYVA 4B3RQ 4RM9A 2CS4A 5M5XH 1SYBA 3KLRA 1G2SA 1KIXA 3BIID 1V1PA 1SLJA 1T5EA 4XT3B 3HUIA 5D3IB 4CJ0B 2WYQA 4K8JA 4KTAA 5LHY1 4LJPB 1L6VA 3PMFA 4NXML 1KD1C 1EWCA 4XE0A 5CMDA 2XGTA 2E8GA 2KHSA 2PW7A 1XYIA 4LFCQ 3MHBA 1KRHA 5HKHA 1HNZL 3PZ8A 4QF4A 2F3WA 4KD3A 3UE0A 3DVGY 4A90A 1V43A 4XDXA 1WTRA 1N6ZA 4YSXB 3AQQA 2HQLA 4JOIC 4KGTA 2V4DA 1YIJA 4GMVA 1JE5A 1N61A 4ILWA 2ASQA 3PS6A 1FIQA 3VYSA 3M63B 3FKIB 1E7PB 5C4ZA 2FIDA 4A3LH 2MUYA 5COYA 1HZ6A 2L4NA 1Z5SB 2KQ4X 1JMLA 1GPXA 1P98A 3D3RA 1VQCA 3KF6B 1QVCA 1C1YB 5HG2A 1Q5WB 1NE3A 2ZEQA 4C1NK 3QOJA 5M3MB 3CHBD 1GJXA 2Z9HA 1Q0WB 3M4YA 4UP8A 1YJJA 2QIEB 4GOPA 1PH7A 3HOYH 3KYDD 4JIOU 3SD5A 4NPNA 1Y1WB 3A9KA 4LF8L 5C0XG 2HHHQ 1IBLQ 4OELB 4E3CA 2VB2X 2SNSA 3ONSA 4ICVA 1DM0B 3N9YC 1UEAB 4YL8A 4IFDJ 1KAWA 1OEYJ 4OW0A 3AEAB 1TIID 4GNXA 4I6PA 1QUQB 3CRKC 4C3JB 5C4HA 1SROA 3U4EG 1MFWA 2WHIA 1SMYC 1HNXQ 3S1MH 3QQ8B 2B2YA 1UH6A 1JMCA 3R8BA 3KF8A 2WB1G 3WOFA 3T56B 3V3XA 3J81c 2MWSB 4HJ5A 2JA5H 4GKKQ 1CZWA 2OOBB 1LABA 2QCZA 3R7QA 4R3DA 1ASYA 3I8ZA 1EIHA 3VRAB 3NZSA 1KTKA 2WFWA 2K50A 2B63B 2UUBL 4A3IH 1YIWA 5KRUA 2W3RA 3CCEA 5CV6A 1RHPA 3RZWC 5LMNW 2KECA 4ARIA 1WCMB 3OSOA 1GNUA 1RWSA 1SN8A 4P1CC 2X38A 2MNAA 1N34L 4MM3A 3A7LA 2PQEA 4R4QA 3S1RB 3H3VI 2UXCQ 1FRRA 2WU5B 1OGWA 3DBRI 3AE1B 1CJEA 3T1HL 1Y8RC 5C5LA 3VR2A 2E2IB 4FXDA 1YOVB 4J6IA 1PRTC 2XVSA 4C4VB 3TQYA 2WXFA 2WIIB 1HR0Q 2WINB 4MTNA 4DR7L 3JAMi 2WKCA 3ZTDA 5IP9H 1V49A 1L1OA 2I5MX 4IJLA 1MI0A 2D2QA 2N9XA 2M2LA 2DY7A 1WJUA 1ZGUB 4HXDA 1K8AC 2K14A 5C4XB 1AE2A 2KAJA 2K03A 1RF2D 3NELA 4UPAA 4X62L 1K8MA 3CMAA 3CCVA 4PS3A 1CKOA 1IUEA 1U5KA 4IWOA 2K52A 3TMEA 3PIPA 1BBXC 2HJ1A 2DENB 1OXVA 5KHQA 3UGBB 4TKNA 2MP2B 3W1GA 2A6HD 3SFDB 2KZRA 1SE2A 1I6HB 5GAEC 1WI0A 4EUTA 5E6PA 2C35B 2KXJA 1JOOA 3VXWA 4QIWB 1N32Q 2R92B 5I2YA 3VYTA 2KCNA 5C3WA 5ISRA 3CAMA 4MELA 4DGZA 2PEAA 4BY7G 4C3HB 1CHQD 2FAZA 3MWYW 1CUKA 5JEAG 3AH7A 4JE3B 3GTQH 2MJ3A 2EQSA 4DNTB 5M5WB 4XYCA 4ALPA 3G7LA 4C2MB 4OWWB 3OTOL 2GVAA 3S17H 3J81L 2XK5A 3CKIB 4QMGA 5I6WA 4A3KH 4IUQA 3KUDB 1GM5A 1C79A 3VAWA 3U50C 2R3ZA 1FXTB 4LDTB 5KGUA 2JP1A 4IWQA 3H1UA 1Q81C 3AULA 1PDXA 3RR5A 1X9NA 1SFOH 1T0SC 2KMAA 2WAQB 2ZW0A 3MC8A 2LMCA 1S5BD 4RGMA 4W9FA 4B0MA 2F1MA 2D0OA 3LX0A 4ZYSA 1TIFA 1D8LA 3AEEB 2EIFA 2H4OA 5EPKA 2ON8A 3HK0A 4CHKA 4CDDC 2E75C 4CBVA 3CD6A 2JUOA 1I42A 3PUZA 1X56A 1JE4A 4BBSB 2QF7A 4DXAB 3N1ZC 1M94A 5ELCA 4YY3L 2M0XA 5LLIA 1ZP0B 3HOZH 1Q8IA 5EKKA 4QUFA 3N1YC 2PW9A 3VYUA 3R3MA 4KJOA 4KMUC 2GB1A 4EX5A 3K0YA 3J7YW 1TKYA 1XLOA 2NN6G 4HCSA 1SNDA 3K9PB 4ZDVA 1HTQA 2HIVA 1CA5A 2CU1A 3AEBB 3AECB 4QL5A 3WA0A 1TS4A 2EXDA 4ANVA 5CYUA 2IZVB 5IGDA 1STYA 2V3PA 5G2NA 1J5EL 1TT5B 3HKZB 1R4MI 1GHKA 4BY7H 5IGFA 5EE1A 1J7BA 2FUG1 5JEAH 4EKUA 1UEBA 1V1PB 2PMZB 1XQQA 5FJ8G 2WDQB 1ESRA 1KDBA 5L95C 2ZNVC 1D1IA 2DNCA 2K33A 1EYDA 1FNUA 1SNCA 3I56A 2IX1A 1MJDA 4WAFA 3S1NB 4GLVB 2E6XA 2KVZA 2REXA 3V62A 1WI5A 1CZGA 2DZMA 3TP8A 2AUKA 4IOAA 4B08A 2QSDA 2BA0A 1MKHA 3NVZA 4YSZB 3HVDA 4GLAC 1E10A 4GS3A 4DR5L 5H92C 1XNRQ 3RNAC 2K4KA 3GP7A 2WXGA 1PLFA 1CQVA 5D3DA 4HPMB 3VTVA 2BYTA 1HEZE 3DHIC 3SK4A 3M85A 4IUVA 2K8BA 1EU3A 1SGHA 3UE1A 2RA4A 3NVVA 4AJWA 3PT2B 1P3QU 4BBRH 2KDEB 3KQ4A 1C4QA 4QGUA 4B3SQ 2J0MA 2J7QB 2LVQA 3Q0AA 2MGSA 4ZUIA 4ZUJA 3W5VB 3A9KB 3AEGB 4ZAIA 4XTCS 3SK6A 3K57A 4DV1Q 4HDOA 4ZRPA 5JJKA 5DLQE 1AWDA 4GXBA 3RPFC 1JORA 3A0JA 4GNXB 2GVBA 2Q2UA 1WGHA 3GZNI 4XC2A 3KLSX 1FEHA 3KF8B 4KHPL 1PFNA 3ZUNA 3JAML 1DGSA 1CT1D 4MN3A 4W9GA 1EY0A 2R61A 1Q46A 1MHXA 3L9AX 2KWUB 5FJ8H 2N0SB 2WXMA 1V5OA 2DAFA 1A3TA 4DV5Q 4EZJA 2KWCA 4TQ0A 2KQ7A 2I5HA 4LMQD 1I4PA 5CV8A 2O5JC 4AS1A 1JQ4A 1UGMA 1PH4A 5LL6X 1EUVB 2ZZPB 1QOBA 2KN5A 4K7SA 4JI8L 1I35A 5IOCA 3TN2A 5D94A 4MM3B 1FVIA 2VW9A 2MBQA 2WB1E 3H91A 3PHWB 4CYEA 5JJZA 3L13A 1SMXA 1PH6A 1ZYRD 2JEAI 3I4NB 5JXVA 1VMPA 3PGZA 4JV5Q 2MP1A 2R93G 5JJIA 3KVFB 4L63B 4DV4L 2KJHB 2RVLA 2K5NA 4LF7Q 4N9F4 5BN5A 1L1OB 2IY1B 2CWAA 3ZJYC 3B0AA 1JW9D 3M62B 3FPPA 2BVCA 4OZBA 3A1QA 5E6NA 1Y1VG 4A3BG 3PUXA 4C00A 2J52A 1EWIA 1BOSA 3H3VC 3M9BA 3A9JA 1VQDA 2KLGA 1BBUA 2JA9A 3ER0A 2F52A 2Q2HA 5ELOA 3GTJH 2QA4A 3HHMA 4WAAA 2Z6BA 3SDLC 1R9TH 4LFBL 4KKIA 1SDFA 1U9RA 2ONQA 1PTOB 1GUWA 1K52A 4ME5A 4CKCA 5FLXE 3PLVA 2A74C 4NP5A 1KAAA 4PMWA 3GTOH 3HOWB 2B76B 2BB5A 2RSOA 3IAS1 3S2AA 2KMCA 2CKZB 1GXDC 3DWAA 5LMNQ 1WGRA 2SAKA 1PFMA 4LFAQ 4REZA 3ZRCA 2WX0A 1YX6B 4DNIA 1S3OA 3OLMD 1F9SA 1V6EA 2ZT9C 4FHKA 2EJFC 2K32A 2JSVX 2J53A 4HIDA 2NB0A 2INNE 4YCVA 3AE2B 1J9OA 2NZ1D 1PH8A 2XEWA 1S5ED 2XK5B 1QT9A 1L4ZB 1HQRD 3J80E 3AMZA 4L1BA 3S2HB 2QCPX 4GDLA 2JJQA 5AFWA 2G45B 1X3EA 3B1LX 2R93H 1C9OA 3X3MA 3NVWA 2JA7G 2J4XA 3NBHA 5CHFA 2K5HA 3UQAA 4RFBA 4PYUA 2LMCB 1A8VA 2CU3A 1QCBD 2E3TA 1V1QA 1STHA 1Y1VH 4HEA1 4A3BH 4JI0Q 2HCCA 4MHEA 1OTRB 1ZOYB 3HRDD 1P0RA 5GMVA 4BOZB 3SXHA 3Q22A 3U58A 1CI3M 1KH0A 2YYZA 4DDID 5C23A 5CBEE 1SNQA 1ZKOA 2BKRB 4IOIE 4W9DA 1D1KA 4GKJQ 4CKBA 3NOBA 1KNAA 3SK8A 1T0QC 1YJIA 1HPCA 1LTLA 1JCKB 4TRDA 4L5SA 3S14H 2M1MA 4A3FB 2MCNB 2OJWA 4FHJA 4KV6A 4RGNA 1DOXA 3BDOA 4R4CA 5IODA 2NCNA 4LNFA 2VZAA 1VF5C 1VRAB 2EMTA 4YCWA 2I1KA 1IZ6A 3ICEA 1P8LA 1V5TA 2DAJA 3L54A 4X65Q 4KVGB 1RAXA 2CH4W 2QEXA 4AWJA 1A2UA 3I2ZA 3VHTC 2PI2E 4A3JH 1HZCA 4HAEA 5FKAC 3RZFA 2E2HB 2EYJA 2BS2B 3N32A 3QA8A 4USAA 1J7AA 1H9RA 1K3RA 3DEOA 3DEPA 2KQSA 1B4OA 3CPFA 4WQOB 1VQNA 2F4VL 2N55A 2JRHA 1AE3A 1FYCA 2Y0SE 5DAUA 4X66Q 2BDOA 3LNNA 4C80A 1RIPA 4OONA 3HOXG 4EOYA 3P1HA 1B9NA 2AWNA 3ZTCA 1E0ZA 1ENCA 2K01A 4K2KA 1E2WA 4A3PA 1ICFB 4JVZA 1TWCH 1ONLA 4DR4L 4QB4A 3AV8A 3AI5A 2KC2A 1F2MA 4A3MG 3DBLI 4WWOA 1FD6A 4GOCA 1E24A 2BH2A 4B3RL 1WYGA 3EC8A 4NB3A 1MHWC 1V80A 3EVQA 1LLRD 2EYFA 1OEYA 2CQOA 1KM7A 3AU4A 3CSTA 2D2CC 1E8ZA 4IFDI 3TRZA 2OWOA 4K0KQ 4JI6Q 1JWUD 4LFCL 2NPTA 1JR0D 2N78A 1MHHE 4P16A 1FNWA 2NS5A 4KDIC 3EFXD 2OXPA 4K5XA 4TV3A 2ES2A 4P73A 1V86A 2MHJA 3VFKA 2RCFA 1GAQB 4F8MA 2NZHA 4V190 4IOCA 4PK1A 4A3EG 1FO4A 1JJGA 3NK9A 5ELDA 2RPQA 4C7ZA 4QCLA 1B9RA 4QUCA 2ICEC 3QAQA 3I7FA 1HA6A 2NBVB 3VQIA 2LGSA 1TWFH 4DK1A 1GVPA 4RWSC 2G3QB 1TYGB 3K0XA 3EIVA 3NVYA 2Z0SA 2IL8A 1NY4A 2CW0D 3HOXH 2IX0A 4HIMA 2N7JA 1MPEA 1YMHE 2B2TA 3U4VA 3P20A 2HHHL 2VH2A 2MO0A 3KF6A 1IBLL 2WS3B 3FKYA 1J8IA 4JWUC 4H44C 2K1BA 3I90A 3A8JE 3NS8A 1Q1EA 1X3PA 4OIJA 4HIKA 3AN1A 3DBHB 4WWNA 3VH3B 1I4QA 4HJ9A 4FVMA 2YVCA 5C44B 1HNXL 3ZQ4A 2Y5PA 2PZTA 4A3OA 1ROEA 5I9PA 1IHZA 4B3TQ 4LF9Q 1HA5A 5EE0A 2F0JA 2FINB 2OTJA 1BO0A 2K04A 1F9JA 1YZ6A 4BY1G 1XLNA 2ZM6Q 1VQFA 3DVGX 3IAYA 2BYEA 4AUQC 4GKKL 5EKIA 2J42A 4K6DA 5IN7A 3EFUA 3A1QB 3EUB2 1RODA 4IZ8A 3U2SC 2QDLA 3K8AA 1YN5A 3MAQA 5HURA 2K39A 4IUUA 4DPGA 1G2TA 1U4LA 3GTLH 3A9JB 2J0JA 4GB9A 2UU9Q 1YNJD 4PS7A 1WTWA 2EJMA 2LGIA 5IYCG 3I5JC 1YNXA 2A68C 3R2IA 2B2WA 3V05A 4A3EH 4LLGM 1WTVA 3LXFA 2ALYB 3MXGA 4XYOA 2UXCL 2OJRA 3ZLZA 4DN4M 4HPPA 3H3VH 1GJZA 2K1FA 4TSSA 1XX8A 3HIZA 5EBCA 1K28A 3VA5A 2KN4A 4TUUA 2OQ0A 4AP4C 2K8CA 1HR0L 1BCPD 4LTUA 4IWPA 5D2MB 2BOSA 1NBFC 2KX3A 1WXQA 3H9DA 2KO3A 2D62A 3PO3G 3PREA 4RM8A 1QWYA 4P71A 4IC7B 1T0RC 3C0RB 1ET9A 1S5DD 3J7AV 3L08A 2V1YA 2IWHA 2L7RA 2I46A 2M17A 4P1BC 3AE3B 1WYDA 1PUTA 3RNFC 5IYDG 4A8XC 3MFYA 4WJNA 4GDLB 5J17A 2VUMG 1RYJA 2N9EB 4A3CG 2I2YA 1KLGD 2CH4A 2KDFB 4DBGA 2XIWA 3NBHB 4B3MQ 3M4PA 3A56A 1TWAB 2H89B 2R2OA 3V2TA 2F0LA 4DUZQ 2JY6A 1N32L 4LF6Q 4XQNA 1SYGA 2FCNA 3UDFA 3CWIA 5EAYA 4Y7NB 3CMMB 4DA2A 3QWZB 1P1AA 1AYFA 1AZPA 1LM8B 2R2QA 2WXRA 2PE9A 4KV2A 1X65A 4BWGB 4NAMA 5CHWA 5IO9A 1TZOA 3RCZA 3GTQB 3OHXC 5JHAA 1TQOA 5I2XA 2KQ3A 3L7ZC 3OMGA 3RNCC 1B2TA 4GDKA 4DHJB 1VJKA 2RD0A 5HGTA 4NY0A 4DV6Q 1J7CA 5L83A 4PZ6A 3CC7A 4JBKA 3APFA 3ND9A 4ICUA 1TU2B 2F0TA 5IT9E 1XPRA 4X6AH 4C3IB 3RZDH 2K28A 1A15A 1KNEA 2KT7A 3ML9A 3Q3JA 3Q8BA 3L10B 1HTPA 1Q82C 3PO3H 1WTQA 3NSWA 1YJ9A 2ZVNA 3A4SC 2UWQA 4W9EA 1FCLA 2JF5A 3NZ3A 4ANWA 5C0XJ 1TY0A 3K6OA 1BCPF 3SK5A 4J15A 4NAWA 4Z9CB 1IW7D 2MQHA 2KCTA 1PH3A 5IYDH 3KBGA 1EYAA 5CV4A 2RDGA 4JI1Q 1RRBA 4N6EB 1CM9A 2VUMH 4OO1I 4RMAA 4C56C 2E2JB 3EFCA 4FJZA 1HFNA 1T3QA 1I50H 3A55A 1Y69U 2OEOA 3STBD 1GC7A 4KSLC 3E3XA 4S3SA 4M0WA 2KUMA 1RTNA 4IPCA 3M7GA 2BS4B 3EHVA 3CQZH 1KLVA 3K5LA 2KVRA 3RNUA 3DMUA 4OHJA 5M3FB 1PHJA 3Q2AC 2MJDA 2BPSA 5E6JA 1B9MA 5JPNC 4Q0FA 4HEDA 3CCJA 1B3AA 2PNRC 2BWES 4GIVA 4BA2I 1WXSA 1SE4A 1IBKQ 1WR6E 3HOVB 1E6EB 1WJ6A 2K7VA 1LTAD 3X0WA 1AFPA 2PO4A 4DV2Q 1XT9B 2N9PC 4XQJA 1VQPA 3Q6BA 2K6DB 1Q90A 1YEZA 3K59A 2JA5G 4YXDB 2WLBA 3RFZB 1OO9B 4DK5A 5AJ3Q 3J7A5 5CR3A 1ZXHA 1XNRL 1RKNA 1SSOA 4HKZE 2KACA 3SFEB 2JWUA 3KW5B 2CJOA 4A3IG 2BQQA 2F0GA 1KDCA 1SIFA 4A3GB 4JI3Q 2L32A 2PVOD 2BYFA 3NEMA 2MBHA 2KHIA 3KDFA 1WX7A 4K3BA 1E7ZA 2VNUD 4NNJB 4B3SL 3AXCA 2NBFA 3NRZA 2MPMA 1XO3A 3MXNA 3EJIA 3CCLA 2XNAC 2NVYB 1JALA 1VQ6A 2YTYA 4DV1L 3PO0A 3SR6A 2LXJA 2NVQB 1N36Q 4PYZA 4ZKBB 3U9OA 2VXWA 3C1FA 1O7YA 4JBWA 3B2FA 3GE8C 1LT3D 2EXZA 5C4JH 3DWQA 3WIMA 3Q3NC 5IP9G 4POGA 1K8RB 4LNKA 3G4SA 1EY9A 4B0EA 2RDFA 3S15B 1P7EA 4RHSA 3TREA 3JYUA 2BA1A 1TKGA 4OZAA 3DM1A 4WWPA 2QMTA 1U4PA 4G11A 3E9HA 1FJGQ 3BZCA 4DUYQ 3J9CA 5KNBA 3W1SA 1BUIC 1V97A 2F3IA 4DAPA 1Y8NB 1KHIA 2A69D 1GUSA 2UXBQ 3J81j 3FC4A 3KYCD 3U30A 4PZ7A 2KVMA 1WE7A 4BKGA 2DX5B 4FN2A 1D4BA 4UP9A 2JZZA 5EDSA 3I4MH 1WF9A 4ODGA 2AX5A 3RZOB 3Q14C 4LCDE 3Q8DA 4HCNB 3H0GH 3OWFA 3Q24A 2JEBI 2A6EC 4H0LC 4N8FA 4NJ7A 1YJNA 2PPHA 3F2CA 2MW5A 3G6JB 1ML0D 3ZGZA 4JV5L 1S40A 4FJYA 1K3BC 1PH2A 1EF5A 1G91A 5CX3A 5ELEA 4LF7L 2Y5BB 3ZJUA 3PRMB 1I6VC 2RDBC 4A3DH 5MPOA 4A3KG 1WIAA 3T16A 1B53A 2WWZA 1TS5A 1PRTB 1WY8A 3PZ7A 5T1GA 4DHZE 5HY6A 2WDTB 2QDBA 3FP9A 3GB1A 4DHJD 2Q8IB 1WTOA 3T3NA 5IOIA 4DWFA 1BQQT 1TWGB 1U4MA 3VR4A 5J3BA 3KH0A 4EEWA 2PNHA 1LACA 2J7ZA 4PNYA 2B3AA 4M8NA 2WP9B 1UF0A 4XGAB 3OW2A 1N9WA 4KZCA 4W9KA 3KLSA 5E1FA 3D6CA 3R93A 5J1ZA 3QR8A 4C1NI 1PA6A 4JI5Q 2R7ZG 4W9CA 3M4OH 5JZEB 4QQBX 3OWEB 2IGGA 4X3UA 3O65B 1JRPA 5LMNL 1IL2A 3HOZG 4KY5A 4C7YA 1TT2A 3MP9A 3W2DA 3ENEA 4O1NA 4K14A 2RMMA 1B1ZA 4NMZA 4YTMB 3PQIA 2JSOA 3ML8A 2KOXA 2M9VA 4ME3A 2RHQB 4QAYA 1X3FA 1LT4D 2L12A 4JBJA 3QIJA 4D2KA 2LXCA 3BDCA 1JB3A 3SGIA 3VTWA 2EE1A 3J80i 2JK8A 2AYOB 4GDKB 2DLBA 3S24A 1JOKA 3MC0B 3K7AB 3KFUA 3DXJC 1I3QH 3NXWA 4K8IA 3TIXA 1Z6HA 4EQPA 4XX5A 2R93B 1K50A 3MTNB 1STAA 3I70A 4HJ8A 2F0EA 1VDVA 2JN4A 1HFGA 2PPBC 1WMHA 5T8IA 4LAAA 3D4RA 4LWCA 4YSYB 4E74A 1LO5D 4WORA 1Y1VB 4JI0L 3PO2B 4A3BB 1TZ1A 1WRDB 2KC1A 3DBSA 1ZYRC 1F52A 3N1XC 3VR3A 1Z7TA 2SDFA 4NAWB 1DOMA 4DV0Q 5A35A 2V0GA 4H02A 3FHWA 1J6QA 3SVMA 2MQJA 2WNMA 2B2VC 4YHHQ 4W9LA 2R7ZH 4FO2A 3D32A 3PIOA 3S16H 3BVZA 3S14B 3H7SA 5FO8B 2JA6B 4KZ0A 4US8A 3FILA 1IL8A 3TP5A 4X3SA 1KFYB 4M0WB 3IT6B 1SE8A 3IVFA 2M0AA 4BBRG 5CTRC 3OMCA 3WANA 3HS0C 3JAMc 4KLKA 1E90A 1C4PA 1IYFA 4MJSA 3CRLC 4OXPA 3VH4B 2WXLA 5KYIA 2Y0SG 4X65L 4Q5VA 1H9SA 1IGCA 2EPBA 4O0AA 5CORA 2DUDA 1O7ZA 3F2UA 5EQ0A 5C3EB 3GTMH 3VDYA 2FUHB 2INPE 4N58A 4OZCA 3D6WA 1GD7A 2UUCQ 1WX9A 3L0OA 1HNWQ 2C7NB 2IYDB 5TR5A 2F0NA 1I4RA 1TKWB 4IM3A 1RFAA 1FXAA 1XMOQ 1HH2P 1YBYA 5EPJA 1E8YA 3GO5A 2M8SA 1DOKA 4X66L 3I4LA 1ZE3D 3RNEC 4JYAQ 5C1ZA 3R66C 1AN8A 1OXUA 1XLPA 3TBLD 2JA7B 1U0LA 3A8IE 1SRUA 5KNCA 2AEHA 2F0KA 1J0GA 1IYJB 2BKFA 2E5LQ 4NXNQ 1YHBA 4JI2Q 1UD7A 4HR7B 3AFQA 3IHPC 2VQEQ 4AYBE 4A93H 4UDUC 3DQVA 1AP0A 3TBIB 3VRBB 1QOGA 3B2GA 3E0JA 1CZPA 1GO3E 2L1BA 1SMYD 1WSPA 1W6JA 4O2DA 3KDFB 2F3VA 1S1QB 5FOBB 3S1QH 5BN4A 3J81E 5BMHA 4IFDH 1X32A 4K0KL 4LF4Q 3GTGH 3MXNB 4JI6L 5C3JB 3TP6A 1DOYA 2W9NA 2D3GA 1JWAD 2ZW1A 4BKTA 4KK7A 1OXSC 2BBCA 1O78A 3Q8AA 1WGKA 3K5MA 1ET6A 2JA8B 4JI4Q 4K7UA 4DXGA 4AQYQ 2V3SA 1B3QA 1UWVA 3H09A 2C9WB 2A1AA 4RCNA 3BS1A 1QG7A 1K83H 1BVSA 4KJNA 4NXMQ 3SE0A 5IGEA 4ITKA 2ZCCA 3AEDB 3DWPA 2WXQA 4GN5A 5IGGA 1B7YB 2D9UA 3T53B 1EEID 3OW7A 2Z4IA 3HOUG 2AL6A 2HD5B 2AHOB 3CSFA 3N30A 4H7BA 4JWSC 1TWFB 1PRTD 1BNZA 1BXTA 1IP9A 5LXHA 3P4RB 2EYLA 3S2DB 2K6QA 3PCOB 1WCMG 2AQ2B 2WXHA 2KENA 2X69A 4JC0A 1ZUD2 2N49A 2X8XX 4BBNC 1WR1A 4CO7A 4DR6Q 2WXIA 2K75A 2LXKA 1UE7A 3HOXB 3QJZA 3FKIH 4CDCC 5K5PA 3P63A 4WWMA 4ANXA 1VQ9A 1F2RI 1S3SG 1YN4A 3OPOA 3VR6A 3Q23A 4GOPC 4IUTA 3VR5A 1ASZA 5D65A 2MJ8A 3AU5A 2RQXA 4J3OD 2AMCB 3TUOA 3IT4B 2JZ3B 2L5TA 2HDEA 4JX1C 5M3MH 4A3MB 1WGYA 4ZOHC 4DAYA 1O7IA 4JCVE 1Q1OA 4B3TL 3GOEA 4GNXC 1WD1A 4W9JA 4U673 1M8AA 2K5DA 3DVNV 1Y1WH 5E7NA 4AH6A 1G51A 4CQNA 3N52A 4WFN3 2B2YC 2P5ZX 2ZM6L 2JE6I 5C4XG 3L17A 3GTPB 1SEBD 1L4DB 4ARCA 4KN7C 2A8VA 1H95A 1R4QB 1Q1BA 1XTDA 3BZKA 4V0BA 1VQ8A 3DBHI 4DF7A 1UWMA 3A4RA 4C3JH 4EZLA 1GHJA 2FHTA 3RYTA 1A3VA 1CKMA 1GC6A 2L0CA 3JC66 2UU9L 4JW0A 1LUZA 3PSIA 2UU7A 2BYVE 2K5PA 2H88B 2D3CA 4ZHOA 3G48A 4G3XB 2BDNA 2Z6KC 1GUNA 5NUCA 4A3EB 1YQBA 1I5FA 4ULLA 3H7PA 2L3ZA 2R92G 2L9HA 2FXQA 3NHEB 3ZW3A 2C7MB 3HOUH 1XF5L 1MSHA 1SIJA 2B63H 3PPAA 1JOQA 1Q7YC 2EYMA 1IBMQ 2LI5A 4AOFA 4EFOA 2CHWA 5DM63 5BMGA 1WCMH 3IXSA 3V96A 4JPSA 2R7DA 1CHPD 4LNQA 4KSKC 4YWLA 2AL3A 2EY5A 1FNVA 4URKA 2PYKA 3S1RH 4JQWC 1FD7D 1QILA 2KJ6A 1NCVA 1K0SA 1PGBA 1YN3A 4RCOA 1JWMD 2KLCA 1PRTF 1G6JA 1TWHB 3V6CB 1HTLD 3BU2A 2IT1A 3D31A 5M9OA 4WRDA 4GN4B 3DDCB 2EDGA 3PRPB 2CVRA 2EZVA 4OO1G 5A2QL 2FCSA 4A75A 1X1MA 3N20C 4M01A 2ATWA 1HZBA 4B6WA 1S5FD 2ZXPA 3JAME 2BE5C 4A3JG 5M5YB 2MX2A 3CC2A 3PF4A 4WJ3M 3PGEA 4ZRJA 2RSNA 4B3ML 5C0XI 5ELFA 2H1EA 4P75A 3QO2A 5C4XH 4BY1B 2IBIB 2K9XA 2KNBA 1PTOC 2Z4HA 3A5UA 4BFRA 3RULA 1WMHB 4BBSG 4DUZL 1FPYA 1KOTA 5H1SE 1M90C 2QJLA 4XYQA 4LF6L 1QOAA 1XD3B 1ESFA 3GV6A 4F8CB 1EEFD 3Q3OC 1SYEA 3H15A 1LGRA 2KWDA 2D10A 1KL9A 1G6ZA 2HQEA 4LJZC 4UP7A 1WTHA 3CC4A 2MLBA 4MSQB 1I6HH 1H8CA 4I6LB 3I4OA 3R3OA 1EWYC 5IYBH 2JVCA 4HIOA 5E4XA 1MSGA 3KJPA 2Q8TA 1E3PA 2NYZD 1BCPB 1R4NI 1QF6A 4DV6L 2R92H 1I94Q 3L3OC 2NVTB 3F8TA 2MSED 4R9WA 3FILB 3HKZG 2E76C 1EQQA 2F0MA 4BS9A 1ZXTA 4DR3Q 1SE3A 3I3CA 1XNQQ 4C3HH 4KY7A 5JH5C 1SF0A 2I38A 4MJSB 2Y3AA 1PH5A 2PMVA 1S4ZA 3MEHA 4DV3Q 2PZWA 3ONAB 1E1TA 1H9SB 2Q2IA 4C2MH 3GTKH 1D2BA 2IDYA 3PO3B 3HGBA 2L1AA 2LS01 3AFPA 3MJ5A 1BT0A 3J7AF 3QC8B 1YNNC 2EVBA 1E5WA 5I4DA 3R2TA 3C46A 1QVFA 1UBQA 1YD8U 4N59A 3U8ZA 1EOVA 1FXIA 4R1JA 1PGAA 3ABVB 1A62A 3QCAA 3M3YB 4JPBW 4JI1L 2K0PA 4OO1H 3HFZB 4RGOS 1V2YA 3FEWX 2DGYA 2D11A 4A9AA 1L2FA 2NVXB 1I50B 4CHTB 2I5LX 1AH9A 2B8FA 1YNTE 1WM3A 2B2UA 3P4SB 1GKHA 1SJHD 3QJYA 4YTPB 2EY2A 4A4IA 4BBSH 1HRJA 1CTMA 1KABA 2L0FA 4YT0B 3VVWB 4POFA 1RD9D 2DBYA 3UDGA 4FNFA 2F0VA 3OJ4B 3E56A 4IM0A 1V9JA 2UYZB 3NBIA 2VZKB 1VF7A 1N33Q 3CCUA 1V9PA 1LTID 4CJ1B 1D6EC 2X6LA 1HUNA 2HE7A 5C2TB 1IBKL 3KUPA 1OQYA 4FXKC 2CHBD 1M1KC 4AIMA 5M5XB 4DV2L 4DK0A 2JXXA 3T13A 2GLSA 4JK1C 4LUVA 4L5RC 4L5TA 3W5OA 4WIPA 4K81A 2K3UA 3MJWA 2ZJPA 4HCPB 2RHSB 1EYCA 3B6YA 2AKWB 3LJ3A 3TS2A 1C7YA 4LJOB 4JI3L 1WTXA 4OL7A 2JQOA 1AEXA 3PLUA 5IA7A 1T5XD 3Q3MC 1JJCB 2R7FA 1NJIC 5L37A 2TMPA 4N8X1 4XZ4A 5IGCA 4DR5Q 1UELA 5ELNA 4ID6A 4LK1C 4JOIA 2ASBA 3CCQA 2PI2A 2M19A 1N36L 4PZ8A 2IPKD 1VQGA 2IJ0A 1GB1A 3IL8A 1JJ2A 1C48A 3IBEA 3K9OB 3V6EB 1FGUA 4PMCA 4UAIA 4CJ2C 3HOYB 1H9JA 1CKNA 1G291 4DAYB 4ZHPA 4GN3B 2JRIB 3EROA 2HD3A 2N7DA 1EQTA 3STBC 2NN6I 3AE4B 3AEFB 4FJVB 3ZNGC 2EOTA 4JG2A 4L5QA 2DYMA 4HCEA 2O5IC 4HJAA 4DFAA 1EIGA 2B39A 2DN8A 2HDLA 3QWNA 1F2RC 1LQBA 1ACCA 1VQHA 1FJGL 4DUYL 3U7DA 3DHQA 3S1MB 1A2TA 2WACA 2O6VA 2D0PA 4FF2A 2GA4B 3P7JA 3MEFA 4HKQA 3K81C 4YWMA 5BR8Q 4DAVA 2UXBL 5F2DA 3X3NA 2N3SA 4DQOC 4W9IA 4B9WA 2JA5B 2WXKA 4HK2A 3IRBA 3HOWG 1Z47A 2K8HA 3WAMA 1B70B 1E22A 2XRQD 2FE8A 1O7LA 1O80A 3G6EA 3H7PB 1P16A 1PFSA 4F7ZA 5JVG3 4II3B 5DPWA 4A3IB 4MTKA 3ETRA 4KKUA 4IN3A 2ZTCA 1EOTA 3NQTA 1WXMA 5T1IA 1R4PB 1EM7A 3CCRA 4GSWA 2KD0A 1A70A 5BYQA 4MZ9A 5IWAQ 1LYLA 4IURA 3KJOA 2MRPA 3APCA 4P2CB 3EBEA 1E7VA 5LNK1 4NZLB 2G4DB 2IO2B 3E6ZX 2HJ8A 4JI7Q 4I65A 4JL9A 1ENFA 4HJ7A 2N1VA 3VTUA 1VCIA 1RJTA 5HGQA 3Q8EA 2D07B 1TS2A 2RDHA 3NS1A 4QIWE 1TTNA 1F77A 3JSVA 3QX1A 2Z59B 4IKGA 2QW7A 2GMIC 3PHXB 2F0QA 1OXXK 4I7AA 4JI5L 2OTLA 1RM6C 4P74A 2K05A 3DHGC 4K7WA 5CBAE 5KHOA 2WXPA 3P4QB 2BWFA 5AUIA 2AQ1B 4FULA 1Y56A 1J8CA 5FO9B 1MG8A 4PMBA 2YV5A 4MT5A 3F2BA 1Q12A 2WB1B 1VQJA 3TEHB 2EYHA 3P75A 3ULJA 3KOJA 3SEBA 2C7HA 4NQKE 2WXJA 4ZRZA 1PTOH 4K3CA 2L52A 2V9HA 3DPDA 2Q2TA 5K36G 3VDZA 5E4WC 1G6PA 1L0WA 1QZGA 4A3FG 3HOWH 2O2LD 3CU7A 1JT8A 3I57A 1NYRA 4FF1A 2WAQE 1HCZA 2G1EA 2VH1A 2C60A 1PZID 3LDZE 3RMHA 2SNMA 2BF8B 3PV1A 4R8IA 1K0RA 2W3SA 2N7EA 2A69C 1E7UA 5BO4B 2PQAA 4DAMA 2PTLA 3RUIB 1BDOA 2KWVB 3S17B 4M8AA 1HQMC 2ZJQA 1YVCA 2VZKD 1K51A 4K2LA 4A3KB 1C77A 1TJEA 3S2HH 2M4NA 1L6UA 1SYFA 1JWSD 1SFOB 4DV0L 4DR1Q 3PUYA 1UGJA 1XCTL 1YI2A 2IO0B 2QGQA 4A55A 3IFDA 4YHHL 1VLBA 2F0IA 3HKZE 1F9RA 1GUGA 2B29A 4IALA 1LT6D 5CV9A 1F2YA 3S9WA 1K73C 1WXAA 2IO1B 5GROA 2JT4B 3CCMA 4L6TB 5JPMC 1GUOA 3U9SA 1FFVA 4R8NA 2EKEC 2WKDA 2K5QA 1SB3C 3Q69A 3I72A 3KUCB 4FADA 2EY6A 4L23A 2CHZA 1ICWA 2PMZE 3HOZB 2KTRA 1F9QA 1ZEQX 4NJCA 2G4SA 1FM0D 2EJGC 2KMMA 2N1WA 5FLMG 4ZRIA 4RMFA 1HZAA 3A7AB 3EQLC 4B9XA 2IHFA 3T4AC 2KOLA 4DV7Q 1EY8A 1W3SA 2KEEA 5K36H 1L2NA 2Z0DB 3Q6SA 4A3FH 2UUCL 4XDDA 1HNWL 1EYGA 3BG3A 4XXEA 4GLXA 1XMOL 4OVVA 1EZ6A 4TQ1A 4KX6B 4CDEC 1E8XA 2A6HC 4AYBG 1GG3A 3TS0A 4BY7B 1PFDA 1V81A 2LHEA 4BOSC 5IAAC 4JYAL 2YU9H 2GBJA 3HVZA 1NNXA 4PG3A 3L2PA 4UY8C 3HM3A 2N9LA 3TEZA 2L11A 3EN2A 1QE6A 2E5LL 4MACA 4NXNL 1I4GA 2EMSA 5AZHA 2E2HH 1DYQA 4JI2L 5HI1A 3RN9C 2F4IA 1EIYB 2VQEL 4KGSA 1UZXB 1XMQQ 2BGFA 1A63A 1A3UA 3ZO5B 1RFKA 2PW5A 3D4WA 3ZRFA 2Z0EB 3A5ZB 3MA2B 2IW3A 5C6AA 1UUPA 3UQBA 3I4MG 5E6OA 1EZ8A 3W1BA 1IXRA 1PYBA 3OOCA 3NJTA 3H0GG 4KHZA 4DR2Q 2KBNA 5LMUQ 4JBMA 3D0FA 2KDBA 2MBBB 3BWUD 4LF4L 5CC4A 4R4IA 1VQMA 3UIOB 4F1SA 2IGHA 4OWTB 1BR9A 3SHQA 4OWXB 3ZIMA 4M02A 2C5LC 2IY0B 3BDLA 2CFMA 2UXDQ 4BBRB 1UWXA 4JI4L 5D6JB 1STNA 5H8YE 4AQYL 4IQZA 1QVGA 5FLMH 3M7NA 2AQ3B 4A3DG 4ZK9B 2Y0SB 4ZYNA 1A0IA 1CKNB 1FL0A 2A68D 4ASWC 1K83B 4F7XA 1I7HA 4EVOA 2F0WA 1CMXB 1D5MC 1NUCA 1MIUA 2HT1A 1WE6A 3G71A 5BMIA 2JXTA 4YWGG 1NENB 3ERSX 4P6VF 2KDMA 1ILQA 1VQBA 4MGYE 4RF0A 3NWTA 4IUPA 2A73B 1VS0A 3UIPB 5C5MA 3APDA 3K5OA 1XLQA 2O6VB 1NR2A 1WFQA 5D14A 4FF3A 4DR6L 3KK7A 3MZ5A 4KN4C 2I1JA 4F87A 1DXMA 2DHZA 5JEAJ 3JW0X 2WDRB 4WQMA 2G9HD 2V4LA 3NENA 5GAHC 3I9V1 3F1ZA 1VZ7A 3IG3A 5EBDA 3ZJTA 1HE8A 1SYDA 3E9IA 4DV5L 2WV6D 1E9MA 2BB6A 3LYYA 1C3TA 2B2TC 3M95A 3TSSA 2L83A 2QC8A 3NUHB 5G3LD 2LGXA 4EQNA 2VB3X 1VZ6A 1RL2A 4K6LA 2QKIC 5BN3A 3A33B 3ZXVA 3NTHA 2GI9A 1L0XB 4NJ6A 1KC8C 3BZDB 1Y8PB 2HDMA 2ID0A 2DZIA 4MGKE 1EFID 4HJKA 2WXNA 1C78A 1HZ9A 3KBXA 3HM6X 5C44H 1LV9A 2XWBB 2GRIA 3TCAA 1V1OA 1LXDA 1ZPSA 3ALBA 3FDTA 2RR9A 5IY0A 4FF4A 1OQRA 4RNAA 3RLNA 2N8NA 3E5SA 2ICIA 1D5XC 1VQAA 2ZTEA 3RUZA 4HMIA 1UNSA 3OYYA 5I6YA 3JSVB 4X64Q 1WX8A 2DWQA 2GN5A 1IBXA 4WJPA 2NTTA 3B08A 2B2WC 2LUEA 1QQRA 4EE2A 1UE1A 4PQXA 3ULLA 1D5ZC 2OT2A 3HOUB 2OQKA 3HG9A 1IBML 1PFBA 3GTJB 3F2DA 2Z6KA 2F03A 2RSUA 4TVAB 1R9TB 2KHJA 5HFYA 4KKJA 2KCMA 1MD2D 2VQFQ 4BKSA 1X3QA 3GTOB 1TBEA 2AWOA 4OIKA 2YEPF 2F0DA 1ZW7A 2DYBA 1X6OA 1F2ZA 4U68A 3V60A 2DZJA 4LFAL 4I6NB 1X55A 2I0QA 4C3IG 4K1RB 2W82A 3TDQA 5DPTA 1VQ4A 1TGZB 3QG1A 1NYQA 1CSQA 2LASA 1PH1A 3IAM1 4E71A 3TJPA 3WOEA 1NR4A 3BINA 3T3OA 2F0PA 2PQAB 2GBKA 3FRPB 5DM73 5C0XH 2MJEA 3MXUA 2IO3B 4N9TA 5G3LF 5KEEA 3PTFC 4KGRA 5D7GA 1MJEA 1VQLA 4XWWA 4ACFA 3DWMA 3T8MA 1ZDXA 5EGTA 5JHBA 3P2BA 2A5HA 3C2PA 4F88A 3WALA 4RF1A 1LTSD 3W5UB 2UUAQ 4HSPA 1HUMA 3CPWA 2CHXA 4XWTA 1A5RA 4RKLA 5J2RA 1P9DU 1RTOA 1IGDA 2V1CC 3NHHA 1TWAH 5J18A 1NDDA 3KUZA 4A93G 1KRTA 2CJNA 4WJWA 4MGIE 2YTXA 5CV5A 1N63A 4IPHA 1I94L 1SJED 4Y7NH 1DJRD 1OTCA 1HZ5A 3MC9A 4DR3L 2VS1A 5IP7G 1XNQL 5M3FG 3ECIA 1AARA 5JVH3 2KTRB 4W9HA 4GKJL 4MGZE 4XIGS 4IFDG 4J8QA 4BXXG 4DV3L 3CIRB 3GTKB 1WM2A 2ZJRA 1V8CA 1WH3A 3HP3A 4RG1A 5EPLA 2A5UA 3GE3C 4KIKA 3TMPB 2LZ6A 3HOVG 1N60A 2WXOA 3M3JA 4L8JA 2ZVOA 4NPSA 3H6MA 3T1YQ 2NZOA 1FRDA 1WRIA 3FMCA 3K80C 4C3IH 1L0YB 4IO9A 2DNFA 3D4DA 1NAPA 3AE6B 1QOHA 5FLXc 2I07B 4DNRB 4GGQA 1U4RA 2EY1A 1XPOA 1N5WA 2KFJA 5AZGA 3IFWB 1CA6A 1W2BA 4A3JB 1JROA 3AB5A 4KKTA 1UE5A 3QHTA 4P7IA 3AE7B 1N8RC 4R4TA 4A3GG 3HRZC 2DJFC 2LRWA 1EY4A 3DHHC 4ZRQA 1DOLA 4MDKE 1GUAB 1WGGA 5LL6S 5GADC 4MEMA 1VR9A 4MH0E 5FK9C 3FKIG 4AQ7A 2E2JH 1SAPA 2ZXOA 4TKOB 5AEKB 3TZDA 1EFWA 1N33L 2ZNVB 2O6VD 4LF5Q 3J80c 1QLBB 3QARA 1F9PA 2ZCBA 1TWCB 5AUKA 4WJ4A 1EL0A 3MTSA 4KI0A 4OX9Q 1IPGA 2KTFA 2M00A 5M3MG 4L2YA 1M4VA 4RA8A 5CHVC 1L0VB 1DZ1A 3TL5A 1SNPA 1BUVT 2GBRA 5IP7H 4G57A 5M3FH 3RN2A 1Y1WG 2QDFA 5EJWA 1U4AA 1NTGA 3E9SA 3VR9B 1FCCC 1NSNS 1MJCA 3ZYYX 2LJIA 1S5CD 2FBWB 4US9A 4BXXH 1A6XA 1LTTD 1EQRA 3BVGA 2NBUA 3OIQA 4A6QA 4C3JG 5BYSA 5KIXA 5G5HA 3RN5A 2RKSA 1KDAA 3HOVH 1TR5A 2A6ED 4TMAB 2IX3A 1EUJA 3LWEA 1ZKHA 3VUYA 5IIFA 3K7UC 3URYA 1Q86C 1QZHA 1I4XA 2EYOA 2MBOA 3NZUA 3SDZA 2R6GA 4DU9A 1EIFA 3AEVA 3T51B 2LUMA 4CKEA 2D3AA 2C5CA 3MHZA 1DONA 1CFMA 2DY8A 1HNZQ 3EA6A 1PDQA 2CCZA 5IGBA 3ZJVA 2B63G 1F2LA 4XT1B 2BCOA 4LUOA 1LT5D 4A3GH 4EGVA 1K53A 4OEMB 2YTVA 3NE5B 1K9MC 1W6KA 1RCVD 3TEYA 4UHVA 4FBJB 1EQVA 3QB3A 3EGRA 3WCQA 3P1MA 1STGA 4IUNA 4KY6A 5FLXL 4GOPB 4MIUA 2BT6A 1SE9A 2NVYH 2LFNA 2NN6H 2Q5WD 2RF4A 4O42A 2NVQH 1YQ3B 3PUWA 3NY5A 2C9OA 2CQAA 5GXGB 3RLOA 5KNDA 2VRRB 2WP8J 2A4ZA 2CKHB 2KYWA 4LF9L 2FCMA 4HJGE 1SBBB 1QNUA 1II3A 5BR8L 1T0YA 4LF8Q 3S15H 2N9KA 2XBBC 4K5VA 4J1MA 3TP7A 1JICA 2JYOA 5JJLA 3GQBA 5TSSA 2NWGA 1N5XA 3W1SC 1HHVA 3DVNU 3RI7C 1WWTA 4HRSA 1YJ1A 3J80L 3E0EA 1J19A 3CW2C 1T9HA 1Q3LA 1IBXB 4S17A 3WAOA 1R7SA 1CQFA 4HSVA 3WDNA 3GTLB 3LGJA 1VDZA 5EE3A 2JYTA 5IKCM 5IYBG 1STEA 2DJGC 3OAWA 1SYCA 2FFKB 4JLCA 1LTRD 2LWPA 1MGSA 5IWAL 3RZOH 4ZRKA 4X3KA 2N4FA 2Q8RE 3DBRB 1F0ZA 2FMCA 3NPPA 2DYOA 4M8MA 1NVID 2GOWA 2FCQA 5LXIB 4ABNA 1K8OA 2GBMA 1JB7A 2UUBQ 4C3HG 4JI7L 2IGDA 2IHEA 1NMFA 2INCC 1GUTA 1PQSA 2B8GA 3CCSA 3Q8CA 3Q3FA 1YQ4B 3I3TB 4IM2A 3RLFA 2KFKA 4H13C 4P72A 2XRSD 1N34Q 3FPUB 2CR5A 1VD2A 4IG7B 1HTOA 3MVVA 1L1OC 2EKIA 4HWIB 3T1HQ 2E2IH 3ZDTA 3PO2G 1WJ4A 5G5GA 4EQOA 4FLHA 2PCFB 2LEKA 1PYSB 4OGQC 1TWGH 3PSEB 1IKLA 4WURA 2WAQG 4DR7Q 1OXTA 2J0KA 2CW0C 5IE8A 4HN7A 3LB8C 4LUZA 4LDTD 2JWZA 1PZJD 3BY4B 3OG5A 2E2DC 2MA9B 3OJ3A 3N6RA 1PH9A 4X62Q 3QIAA 2JA6G 3GS2A 2QEJC 1WD0A 3VYRA 1TKEA 3U4ZA 4MSMB 1QKZA 4PT5A 3ZNZB 1UBIA 2RGFA 4CDFC 3PZDA 1MI2A 2JZPA 3I91A 3ZXRA 4HVBA 2O2VA 2SEBD 1S72A 4DHZB 3SHLA 5GQOA 2SOBA 2WX1A 5C3EG 3HEJA 2LRUA 3FVQA 4GN1A 4QY7A 4NKLA 2KANA 1OFFA 3AE9B 4EZKA 1WZ3A 4RAUC 5FR6A 3ZDMC 1D7QA 2F0FA 2JPHA 2K25A 1EO6A 4KIKB 2VY3A 3PV0A 1WGDA 3K7AH 5ELBA 3P42A 2F0SA 2G5DA 4XQQA 3BVMA 1AZQA 5DPSA 1YNJC 4K5WA 2MO1A 3RZDB 3J7ZC 4DR1L 1DCZA 5M5WH 1YHQA 1Z9FA 4DXFA 4R4OA 3OTOQ 1E8WA 4BZAA 2FMMA 3C3LA 3VUWA 5FR3A 1QJOA 4CGYB 5IP4D 3ZNID 1JQYD 5DNFA 1WYWB 4FP5D 3PO2H 1LTGD 2ZPYA 4XDCA 1BCPC 1PMRA 3BYTB 4HTHA 1L7YA 4II2B 3RT3B 2KJXA 2JXMB 2VL6A 3I73A 2VUMB 3HZXA 2KJRA 5EKLA 2NR2A 3DOWA 3SR1A 2KA7A 5J22A 2LD9A 1TY2A 3AMUA 2F0UA 4DV7L 2N88A 2EELA 4LK0M 3MFGA 3UF8A 2JA6H 5CGKA 1D3ZA 3DM3A 3AU7A 2G9DA 4LNIA 2ACZB 4YY3Q 3CQZB 2JA8G 1L5PA 2ENBA 3PVLA 4LNOA 1R4MB 2Y5CA 4H2AA 1KJTA 3W3AA 5A2QE 1MVKA 3I55A 2YU9B 3UI3A 3C8YA 2JX5A 3HKSA 5C3EH 1P7FA 2V3NA 4G50A 4X3TA 3K5NA 4HMJA 2HCIA 3CP0A 2FIFA 4GU2A 4BAXA 1C4CA 1LFDA 4YTNB 1J5EQ 1ENAA 1WJNA 1XMQL 1VQ7A 3M4QA 2KK8A 4AJYB 1YJWA 5DEHA 4S0RA 3T9LA 2L76A 2L00B 3NP8A 3U52E 2MEKA 3CF5A 5J39A 2JA7H 4RKBA 4G4KA 5AJ3L 1EF1A 3WAPA 1UE6A 5I9OA 4FA6A 3QOLA 4KKSA 4DR2L 2PJHA 5LMUL 1WJJA 2Z1CA 3H94A 2PZUA 2D5DA 1E1OA 3KLWA 1TS3A 5IT9c 2L05A 4PV1C 3S1NH 1F1HA 2WQYB 2NVUI 1FGBD 1B8AA 2QILA 2NBWB 2O4XA 2LXAA 3X23A 2Z8LA 2UXDL 4EQ5A 4G7ZC 2KEDA 1YITA 2OHFA 2JYEA 3RNGC 2KDIA 1XTCD 2MH7A 1SR3A 4WH4A 2L0TA 3H8HA 2JQRB 1XEEA 1NBWA 3L16A 2PLPA 3ZVVA 1XXGA 2MBEA 3I4NG 1ILPA 4A76A 1IW7C 2W55A 4BKSD 1Q10A 2KCCA 5C4JB 1MG4A 2WU2B 4B95A 3OIPA 1VCBA 3IKJA 3NTKA 2JA8H 2LGYA 3GZNB 1BKBA 1KLUD 2OF1A 4AYBB 3BK1A 2AUJD 4LW1A 1T6BX 2A19A 2HTME 4X57B 1E0BA 3ZKJC 4ANUA 4APVA 1Z2MA 2QHOA 1DD2A 2ZPNA 2KX0A 2HTHA 3H6NA 2NUCA 3L4PA 4YIJA 4DK3C 2EYPA 4MH8A 1E2VA 3NTIA 1VQIA 2K22A 4GLSC 3NG0A 3W1YA 3SU8X 4BBNF 1FR3A 3S2DH 3NQIA 3CXCA 4KHPQ 3VUXA 4M1UB 2HIXA 1H9MA 3GD7A 1KQSA 3I4MB 3L0WB 2BE5D 1C76A 2FJ2A 1H4RA 1WXVA 3H0GB 4KD4A 4ZLTF 1BMLC 1NEKB 3W9CB 1X54A 1MBYA 3GDEA 3Q8FA 4E6IA 3UI2A 1PTOD 4Y52H 1NI2A 2KKCA 2DZKA 1EY7A 2NMQA 2OEDA 1EWHA 1Y14B 2LKVA 3BJUA 3B9JA 5HHDG 4A3MH 4DKAC 1VQEA 2RBMA 1RDPD 1KXLA 2W54A 1VQ5A 3C1EA 2LVOA 2YEPB 4FDBA 1HR0W 2BS3B 2KFKB 4IDIA 3I63C 4A3DB 4JI8Q 2KHWB 2L15A 4IW0A 3GTPH 2D5GA 3AYHB 4X64L 1WVLA 3PIP3 1QUQA 3A8KE 4G7HC 2PKOA 3KWLA 3CF6E 1PYWD 1WTPA 3I4NH 1QOFA 2DNEA 1ISNA 3AM9A 2RPVA 2LFIA 1V8QA 5IT9L 2PE6B 4DV4Q 2YLMA 4HDQA 1K8GA 1LM0A 2LY7A 3MHSD 5FO7B 4MNOA 1X3GA 1JWBD 2L8JA 3DWGC 4JGHB 2VQFL 1VMCA 2XN9C 1GOZA 3M4OB
chains in the Genus database with same CATH topology
1FMAD 1C8CA 1UAPA 1Y8OB 1KF6B 1YNND 1C9FA 1VZ8A 2LHDA 2XSCA 1I4HA 3ITPA 4NW2A 5C3XA 3K58A 1SXTA 3AE8B 1QNKA 3TZUA 2PVGC 3U7ZA 4KHVA 5CV7A 4GZYC 2NTSA 1LTBD 1ZXIA 2E74C 2PIAA 4FXCA 2BTEA 4NDXA 4Q2JA 5E3FA 1XCQL 1I3QB 4RGTA 3D8GA 4J6HA 2F0HA 3AB9A 1C4AA 3ERQA 4G7OC 2WDVB 3P4PB 4BA1I 3PIO3 5JAVA 3RD4A 1PTOF 4FXGC 2BW2A 3AE5B 1AW7A 4TQUS 3IFTA 4RHRA 1GB4A 2J0TD 1SSNA 3VR8B 5JOBA 3BYYB 2K5WA 3PUVA 3O13A 1HXYD 2R7ZB 3DUZA 1STBA 3S16B 4ZQ3A 4OVZA 2HUGA 2JU6X 2B2VA 1BF4A 1DOIA 2F0OA 2K6AA 1QB5D 2L55A 1FFUA 1OQQA 1EY6A 4HROA 3GTMB 3A54A 3BK2A 1B44D 3KWVA 4N9PA 1TVXA 1JC7A 3NUCA 2V4IB 1G8ZD 2B2UC 1XWEA 1EY5A 4RH6A 3MXPA 2M56B 2X6GA 2XWJB 3NWSA 4I7ZC 3GV3A 4ZKCB 1NI3A 2MHVA 1N62A 1CK1A 1SNOA 1E2ZA 4FYDA 1ZDVA 4A93B 1PZKD 3VA7A 1IYUA 3ND8A 1PXUA 2ZXRA 5KYLA 2TSSA 3TEWA 1EU4A 1B50A 5EE9A 3TEXA 3S1QB 1SNMA 3LWUA 1H9KA 1DGJA 3GTGB 1PGXA 1IKMA 5BYRA 3FAHA 1IYVA 1SYBA 3KLRA 1G2SA 3BIID 1V1PA 1T5EA 4XT3B 3HUIA 1FCLA 5D3IB 4CJ0B 4K8JA 4KTAA 5LHY1 1L6VA 3PMFA 1EWCA 4XE0A 5CMDA 1KRHA 2KHSA 2PW7A 1XYIA 3MHBA 3PZ8A 4QF4A 2F3WA 4KD3A 4A90A 1V43A 4XDXA 1WTRA 4YSXB 4KGTA 2V4DA 1N61A 4ILWA 1FIQA 3VYSA 3FKIB 1E7PB 5C4ZA 2MUYA 5COYA 1HZ6A 2L4NA 2KQ4X 1JMLA 1GPXA 3D3RA 5HG2A 4C1NK 3QOJA 5M3MB 3CHBD 1GJXA 3M4YA 1YJJA 2QIEB 1Y1WB 5C0XG 2VB2X 2SNSA 1DM0B 3N9YC 1UEAB 4IFDJ 4OW0A 3AEAB 1TIID 4C3JB 3CRKC 5C4HA 3U4EG 1SMYC 2B2YA 3R8BA 3KF8A 3WOFA 3T56B 3V3XA 1CZWA 1LABA 4R3DA 3I8ZA 1EIHA 3VRAB 1KTKA 2B63B 2W3RA 5KRUA 5CV6A 1RHPA 2KECA 4ARIA 1WCMB 3OSOA 1RWSA 2X38A 3A7LA 2PQEA 3S1RB 1FRRA 2WU5B 3AE1B 1CJEA 5C5LA 3VR2A 2E2IB 4FXDA 1PRTC 2XVSA 2WXFA 2WIIB 2WINB 2WKCA 1MI0A 2M2LA 2DY7A 5C4XB 2KAJA 2K03A 1RF2D 1K8MA 1IUEA 3TMEA 1BBXC 1OXVA 2A6HD 3SFDB 1SE2A 1I6HB 1JOOA 4QIWB 2R92B 5I2YA 3VYTA 2KCNA 5C3WA 5ISRA 4DGZA 4C3HB 1CHQD 3MWYW 5JEAG 3AH7A 4JE3B 2MJ3A 4DNTB 5M5WB 3G7LA 4C2MB 3J81L 3CKIB 4QMGA 5I6WA 4IUQA 1C79A 2R3ZA 5KGUA 2JP1A 1PDXA 2WAQB 2ZW0A 2LMCA 1S5BD 4RGMA 4B0MA 2F1MA 3AEEB 3LX0A 4ZYSA 2H4OA 5EPKA 2ON8A 2E75C 4CBVA 3PUZA 1JE4A 4BBSB 2QF7A 5ELCA 1ZP0B 1Q8IA 5EKKA 4QUFA 2PW9A 3VYUA 4KJOA 4KMUC 2GB1A 3K0YA 3J7YW 1TKYA 1XLOA 2NN6G 4HCSA 1SNDA 1CA5A 3AEBB 3AECB 1TS4A 5CYUA 5IGDA 1STYA 2V3PA 3HKZB 1GHKA 5IGFA 5EE1A 1J7BA 2FUG1 5JEAH 1V1PB 2PMZB 2WDQB 1ESRA 1KDBA 1D1IA 2DNCA 2K33A 1EYDA 1FNUA 1SNCA 2IX1A 4WAFA 3S1NB 2E6XA 1CZGA 3TP8A 2AUKA 4B08A 2QSDA 2BA0A 3NVZA 4YSZB 3HVDA 1E10A 5H92C 3GP7A 2WXGA 1PLFA 1CQVA 5D3DA 2BYTA 1HEZE 3SK4A 3M85A 4IUVA 1EU3A 2RA4A 3NVVA 3KQ4A 1C4QA 3Q0AA 2MGSA 4ZUIA 4ZUJA 3W5VB 3AEGB 4ZAIA 4XTCS 3SK6A 3K57A 4ZRPA 1AWDA 3RPFC 1JORA 3KLSX 1FEHA 1PFNA 3JAML 1CT1D 4MN3A 1EY0A 2R61A 1MHXA 3L9AX 2N0SB 2WXMA 1A3TA 4TQ0A 4LMQD 1I4PA 5CV8A 2O5JC 4AS1A 1JQ4A 5LL6X 1QOBA 5IOCA 3TN2A 4MM3B 3H91A 5JJZA 2JEAI 1ZYRD 3I4NB 5JXVA 1VMPA 2MP1A 4L63B 2RVLA 5BN5A 1JW9D 3FPPA 4OZBA 3PUXA 2J52A 1BOSA 3H3VC 4KKIA 1SDFA 1U9RA 2ONQA 1PTOB 1GUWA 1K52A 4ME5A 4CKCA 5FLXE 2A74C 4NP5A 1KAAA 4PMWA 2B76B 3HOWB 2BB5A 2RSOA 3IAS1 1GXDC 3DWAA 2SAKA 1PFMA 4REZA 1F9SA 2ZT9C 2EJFC 2K32A 2JSVX 2J53A 2NB0A 2INNE 3AE2B 1J9OA 2NZ1D 1S5ED 1QT9A 1L4ZB 1HQRD 3J80E 3AMZA 4L1BA 3S2HB 2QCPX 5AFWA 3X3MA 3NVWA 2J4XA 3NBHA 4RFBA 2LMCB 2CU3A 1QCBD 2E3TA 1STHA 4HEA1 2HCCA 4MHEA 1ZOYB 3HRDD 3SXHA 3Q22A 1KH0A 1CI3M 2YYZA 5CBEE 1SNQA 1ZKOA 4IOIE 1D1KA 4CKBA 1KNAA 3SK8A 1YJIA 1HPCA 4TRDA 1JCKB 4A3FB 4KV6A 4RGNA 1DOXA 3BDOA 5IODA 1VF5C 1VRAB 1A2UA 4HAEA 5FKAC 2E2HB 2EYJA 2BS2B 4USAA 1J7AA 1H9RA 3DEOA 3DEPA 1B4OA 2N55A 1FYCA 5DAUA 2BDOA 3LNNA 4C80A 3P1HA 1B9NA 2AWNA 1E0ZA 1ENCA 2K01A 4K2KA 1E2WA 1ONLA 4QB4A 3AV8A 1F2MA 1FD6A 1WYGA 3EVQA 1LLRD 2EYFA 2D2CC 4IFDI 1JWUD 1JR0D 1MHHE 4P16A 1FNWA 3EFXD 2OXPA 4K5XA 1GAQB 4F8MA 4V190 1FO4A 3NK9A 5ELDA 4C7ZA 4QCLA 1B9RA 4QUCA 2ICEC 1HA6A 3VQIA 4DK1A 4RWSC 1TYGB 3NVYA 2IL8A 2CW0D 2IX0A 2N7JA 1MPEA 1YMHE 2B2TA 3P20A 2WS3B 1J8IA 4JWUC 4H44C 2K1BA 3I90A 3A8JE 1Q1EA 1X3PA 4OIJA 3AN1A 1I4QA 4FVMA 5C44B 3ZQ4A 2Y5PA 2PZTA 1ROEA 5I9PA 1IHZA 5EE0A 1HA5A 2F0JA 2FINB 1BO0A 2K04A 1XLNA 3IAYA 5EKIA 2J42A 4K6DA 3EUB2 1RODA 4IZ8A 3U2SC 1YN5A 3MAQA 5HURA 4IUUA 1G2TA 1U4LA 1YNJD 1WTWA 2EJMA 2LGIA 2A68C 3R2IA 2B2WA 3V05A 4LLGM 1WTVA 3LXFA 3MXGA 4XYOA 4DN4M 4TSSA 1XX8A 5EBCA 3VA5A 2KN4A 4LTUA 1BCPD 2BOSA 1WXQA 2D62A 1QWYA 1ET9A 1S5DD 3J7AV 2IWHA 2I46A 3AE3B 1PUTA 4A8XC 3MFYA 4GDLB 1RYJA 2I2YA 1KLGD 2XIWA 3A56A 1TWAB 2H89B 3V2TA 2F0LA 4XQNA 1SYGA 3CWIA 4Y7NB 4DA2A 1AYFA 1AZPA 2WXRA 4BWGB 4NAMA 1TZOA 3GTQB 3OHXC 1TQOA 5I2XA 2KQ3A 3L7ZC 3OMGA 1B2TA 1VJKA 5HGTA 1J7CA 3ND9A 1TU2B 2F0TA 5IT9E 4C3IB 2K28A 1A15A 1KNEA 3Q8BA 1HTPA 1WTQA 3NSWA 3NZ3A 5C0XJ 1TY0A 3K6OA 1BCPF 3SK5A 4Z9CB 1IW7D 4N6EB 3KBGA 1EYAA 5CV4A 2RDGA 1CM9A 4OO1I 4C56C 2E2JB 1HFNA 1T3QA 3A55A 1Y69U 2OEOA 4S3SA 4M0WA 2KUMA 1RTNA 2BS4B 3M7GA 3K5LA 3DMUA 4OHJA 5M3FB 2MJDA 5E6JA 1B9MA 5JPNC 4Q0FA 4HEDA 1B3AA 2PNRC 4BA2I 1SE4A 3HOVB 1E6EB 2K7VA 1LTAD 1AFPA 2PO4A 4XQJA 4YXDB 1Q90A 3K59A 3RFZB 2WLBA 1OO9B 5CR3A 1ZXHA 1RKNA 1SSOA 4HKZE 2KACA 3SFEB 2JWUA 2CJOA 2F0GA 1KDCA 4A3GB 2L32A 2PVOD 2VNUD 2NBFA 3NRZA 2MPMA 1XO3A 3MXNA 3EJIA 2XNAC 2NVYB 1JALA 3PO0A 3SR6A 2NVQB 4ZKBB 3U9OA 2VXWA 3C1FA 1O7YA 4JBWA 3B2FA 1LT3D 2EXZA 3DWQA 1EY9A 4B0EA 2RDFA 3S15B 1P7EA 4RHSA 2BA1A 1TKGA 4OZAA 3DM1A 2QMTA 1U4PA 3J9CA 5KNBA 3W1SA 1BUIC 1V97A 4DAPA 1Y8NB 2A69D 1GUSA 3FC4A 2KVMA 1D4BA 2AX5A 4ODGA 3RZOB 3OWFA 3Q24A 2JEBI 2A6EC 4H0LC 3G6JB 1ML0D 3ZGZA 1G91A 5ELEA 3ZJUA 1I6VC 5MPOA 3T16A 1B53A 1TS5A 1PRTB 3PZ7A 5T1GA 2QDBA 3GB1A 2Q8IB 1WTOA 3T3NA 1BQQT 1TWGB 1U4MA 3VR4A 1LACA 2J7ZA 4PNYA 2WP9B 3KLSA 5E1FA 3D6CA 3R93A 5J1ZA 4C1NI 3OWEB 2IGGA 4X3UA 1JRPA 4KY5A 4C7YA 1TT2A 3MP9A 3W2DA 4O1NA 4K14A 2RMMA 1B1ZA 4NMZA 4YTMB 2JSOA 2M9VA 1LT4D 2L12A 4D2KA 3BDCA 1JB3A 2EE1A 4GDKB 2DLBA 1JOKA 3MC0B 3K7AB 3DXJC 4K8IA 3NXWA 1Z6HA 4EQPA 2R93B 1K50A 1STAA 3I70A 2F0EA 1VDVA 1HFGA 2PPBC 5T8IA 4LAAA 3D4RA 4YSYB 1LO5D 4WORA 1Y1VB 3PO2B 4A3BB 1ZYRC 3VR3A 1Z7TA 2SDFA 4NAWB 1DOMA 5A35A 2V0GA 3SVMA 2WNMA 2B2VC 4FO2A 3BVZA 3S14B 5FO8B 2JA6B 4US8A 3FILA 1IL8A 3TP5A 4X3SA 1KFYB 3IT6B 2M0AA 3OMCA 3HS0C 1C4PA 3CRLC 2WXLA 5KYIA 4Q5VA 1H9SA 1IGCA 2EPBA 5CORA 1O7ZA 3F2UA 5EQ0A 5C3EB 2INPE 4N58A 4OZCA 3D6WA 2F0NA 1I4RA 1TKWB 1FXAA 5EPJA 3GO5A 1DOKA 3I4LA 1ZE3D 1AN8A 1OXUA 1XLPA 2JA7B 3A8IE 5KNCA 2F0KA 4HR7B 4UDUC 1AP0A 3TBIB 3VRBB 1QOGA 3B2GA 3E0JA 1CZPA 2L1BA 1SMYD 1WSPA 1W6JA 2F3VA 5FOBB 5BN4A 3J81E 5BMHA 4IFDH 1X32A 1DOYA 5C3JB 3TP6A 1JWAD 2ZW1A 4KK7A 1OXSC 2BBCA 1O78A 3Q8AA 1WGKA 3K5MA 1ET6A 2JA8B 4DXGA 3H09A 4RCNA 3BS1A 1QG7A 4KJNA 3SE0A 5IGEA 4ITKA 3AEDB 3DWPA 2WXQA 5IGGA 2D9UA 3T53B 1EEID 3OW7A 2Z4IA 4H7BA 4JWSC 1TWFB 1PRTD 1BNZA 1BXTA 3P4RB 2EYLA 3S2DB 2AQ2B 2WXHA 2X69A 1ZUD2 2WXIA 4WWMA 3HOXB 3P63A 5K5PA 1F2RI 1YN4A 3OPOA 3VR6A 3Q23A 4IUTA 3VR5A 5D65A 2MJ8A 2RQXA 4J3OD 3TUOA 3IT4B 4JX1C 2L5TA 2HDEA 4A3MB 4ZOHC 4DAYA 1WD1A 4U673 1M8AA 2K5DA 4CQNA 3N52A 4WFN3 2B2YC 2JE6I 3GTPB 1SEBD 1L4DB 4ARCA 4KN7C 1R4QB 1Q1BA 4V0BA 4DF7A 1UWMA 1GHJA 2FHTA 1A3VA 2L0CA 2K5PA 2H88B 4ZHOA 2BDNA 5NUCA 1GUNA 4A3EB 4ULLA 2L9HA 1XF5L 1MSHA 1SIJA 1JOQA 2EYMA 5DM63 5BMGA 3IXSA 3V96A 4JPSA 1CHPD 2EY5A 1FNVA 2PYKA 1FD7D 1QILA 1NCVA 1PGBA 1YN3A 4RCOA 1JWMD 1PRTF 1TWHB 1HTLD 2IT1A 3D31A 5M9OA 4WRDA 2EDGA 2CVRA 2EZVA 4OO1G 5A2QL 1S5FD 2ZXPA 3JAME 2BE5C 5M5YB 2RSNA 5C0XI 5ELFA 2H1EA 4BY1B 3QO2A 2K9XA 1PTOC 2Z4HA 2QJLA 4XYQA 1QOAA 1ESFA 3GV6A 1EEFD 1SYEA 2KWDA 1G6ZA 2HQEA 4LJZC 3R3OA 1EWYC 5E4XA 1MSGA 2Q8TA 2NYZD 1BCPB 1QF6A 3L3OC 2NVTB 4R9WA 3FILB 2E76C 2F0MA 4BS9A 1ZXTA 1SE3A 3I3CA 4KY7A 1SF0A 2I38A 2Y3AA 2PMVA 1S4ZA 3MEHA 2PZWA 3ONAB 1H9SB 1D2BA 2L1AA 2IDYA 3MJ5A 3PO3B 3HGBA 2LS01 3J7AF 1YNNC 2EVBA 5I4DA 3R2TA 3C46A 4N59A 1FXIA 1PGAA 3ABVB 3M3YB 2K0PA 4OO1H 4RGOS 4A9AA 3FEWX 2NVXB 1I50B 4CHTB 2B8FA 1YNTE 2B2UA 3P4SB 1SJHD 3QJYA 4YTPB 2EY2A 1HRJA 1CTMA 1KABA 4YT0B 1RD9D 2DBYA 4FNFA 2F0VA 3E56A 3NBIA 2VZKB 1VF7A 1LTID 4CJ1B 1D6EC 2X6LA 1HUNA 5C2TB 3KUPA 4FXKC 2CHBD 5M5XB 4DK0A 3T13A 4JK1C 4WIPA 2K3UA 1EYCA 1WTXA 4OL7A 1AEXA 1T5XD 2TMPA 5IGCA 4ID6A 4LK1C 2M19A 2IPKD 2IJ0A 1GB1A 3IL8A 1C48A 4PMCA 4UAIA 4CJ2C 3HOYB 1H9JA 1G291 4ZHPA 3EROA 1EQTA 2NN6I 3AE4B 3AEFB 2EOTA 2DYMA 4HCEA 2O5IC 4DFAA 1EIGA 2B39A 2DN8A 2HDLA 3QWNA 1F2RC 1ACCA 3DHQA 3S1MB 1A2TA 2WACA 4FF2A 2GA4B 3P7JA 4HKQA 4DAVA 5F2DA 3X3NA 4DQOC 4B9WA 2JA5B 2WXKA 1Z47A 2XRQD 2FE8A 1O7LA 1O80A 5JVG3 4A3IB 3ETRA 4KKUA 4IN3A 1EOTA 3NQTA 5T1IA 1R4PB 1EM7A 1A70A 5BYQA 4IURA 4P2CB 5LNK1 4NZLB 3E6ZX 4I65A 1ENFA 1VCIA 1RJTA 3Q8EA 1TS2A 2RDHA 3NS1A 1F77A 4IKGA 2F0QA 1OXXK 1RM6C 2K05A 5CBAE 2WXPA 3P4QB 5AUIA 2AQ1B 1Y56A 5FO9B 4PMBA 4MT5A 1Q12A 2WB1B 2EYHA 3P75A 3SEBA 2WXJA 4ZRZA 1PTOH 2L52A 5K36G 5E4WC 2O2LD 3CU7A 3I57A 1NYRA 4FF1A 1HCZA 2G1EA 1PZID 3RMHA 2SNMA 4R8IA 2W3SA 2A69C 2PTLA 1BDOA 3S17B 4M8AA 1HQMC 2VZKD 1K51A 4K2LA 4A3KB 1C77A 1TJEA 1L6UA 1SYFA 1JWSD 1SFOB 1UGJA 3PUYA 1XCTL 4A55A 3IFDA 1VLBA 2F0IA 3S9WA 1F9RA 1GUGA 4IALA 1LT6D 5CV9A 1F2YA 4L6TB 5JPMC 1GUOA 3U9SA 1FFVA 4R8NA 2WKDA 2K5QA 1SB3C 3Q69A 3I72A 2EY6A 4L23A 1ICWA 3HOZB 4NJCA 1F9QA 1ZEQX 1FM0D 2EJGC 2KMMA 3A7AB 3EQLC 4B9XA 3T4AC 2KOLA 1EY8A 2KEEA 5K36H 3Q6SA 4XDDA 3BG3A 4XXEA 1EZ6A 4TQ1A 4KX6B 2LHEA 2A6HC 1PFDA 4BY7B 3HVZA 2N9LA 3TEZA 2L11A 1QE6A 4MACA 1I4GA 5HI1A 1DYQA 2F4IA 4KGSA 1A3UA 1RFKA 2PW5A 3D4WA 3MA2B 2IW3A 5C6AA 1UUPA 1EZ8A 3OOCA 4KHZA 3BWUD 5CC4A 2IGHA 1BR9A 3BDLA 4BBRB 1UWXA 5H8YE 1STNA 4IQZA 3M7NA 2AQ3B 4ZK9B 2Y0SB 2A68D 1K83B 4F7XA 1I7HA 4EVOA 2F0WA 1D5MC 1NUCA 5BMIA 2JXTA 4YWGG 1NENB 4P6VF 2KDMA 1ILQA 4RF0A 3NWTA 4IUPA 2A73B 5C5MA 3K5OA 1XLQA 1NR2A 5D14A 4FF3A 3KK7A 3MZ5A 4KN4C 4F87A 1DXMA 5JEAJ 2WDRB 4WQMA 2G9HD 3I9V1 3ZJTA 1VZ7A 5EBDA 1SYDA 1E9MA 2WV6D 3LYYA 2BB6A 2B2TC 3TSSA 2L83A 3NUHB 5G3LD 4EQNA 2VB3X 1VZ6A 4K6LA 2QKIC 5BN3A 3NTHA 2GI9A 1L0XB 3BZDB 1Y8PB 2HDMA 2ID0A 1EFID 2WXNA 1C78A 3KBXA 1LV9A 2XWBB 2GRIA 1V1OA 1ZPSA 3FDTA 4FF4A 1OQRA 4RNAA 3E5SA 2ICIA 1D5XC 5I6YA 3RUZA 4HMIA 1UNSA 2DWQA 1IBXA 2NTTA 2B2WC 4EE2A 1QQRA 4PQXA 1D5ZC 2OT2A 3HOUB 3HG9A 1PFBA 3GTJB 2F03A 1R9TB 5HFYA 4KKJA 1MD2D 1X3QA 3GTOB 2AWOA 4OIKA 2YEPF 2F0DA 1F2ZA 4U68A 4C3IG 2W82A 3TDQA 3QG1A 1NYQA 3IAM1 3WOEA 1NR4A 3T3OA 2F0PA 3FRPB 5DM73 5C0XH 2MJEA 3MXUA 4N9TA 5G3LF 5KEEA 4KGRA 5D7GA 4XWWA 3DWMA 1ZDXA 5EGTA 2A5HA 3C2PA 4F88A 4RF1A 1LTSD 3W5UB 4HSPA 1HUMA 4XWTA 4RKLA 1RTOA 1IGDA 3NHHA 2CJNA 4WJWA 5CV5A 1N63A 1SJED 1DJRD 1HZ5A 5JVH3 4XIGS 4IFDG 4J8QA 3CIRB 3GTKB 1V8CA 3HP3A 5EPLA 1N60A 2WXOA 4L8JA 3H6MA 1FRDA 1WRIA 3FMCA 1L0YB 3D4DA 1NAPA 3AE6B 1QOHA 2I07B 4DNRB 1U4RA 2EY1A 1N5WA 1CA6A 4A3JB 1JROA 3AB5A 4KKTA 3AE7B 3HRZC 1EY4A 4ZRQA 1DOLA 5LL6S 1VR9A 5FK9C 4AQ7A 1SAPA 2ZXOA 4TKOB 3TZDA 1QLBB 1F9PA 1TWCB 5AUKA 1EL0A 3MTSA 4KI0A 2M00A 4L2YA 1M4VA 4RA8A 1L0VB 1DZ1A 1SNPA 1BUVT 4G57A 5EJWA 3VR9B 3E9SA 1FCCC 1NSNS 3ZYYX 2LJIA 1S5CD 2FBWB 4US9A 1A6XA 1LTTD 3BVGA 3OIQA 4A6QA 4C3JG 5BYSA 5KIXA 5G5HA 2RKSA 1KDAA 1TR5A 2A6ED 4TMAB 2IX3A 3LWEA 5IIFA 3URYA 1I4XA 2EYOA 3SDZA 2R6GA 4DU9A 3T51B 2LUMA 4CKEA 2C5CA 3MHZA 1DONA 1CFMA 2DY8A 3EA6A 1PDQA 5IGBA 3ZJVA 1F2LA 4XT1B 2BCOA 1LT5D 4EGVA 1K53A 3NE5B 1W6KA 1RCVD 3TEYA 1EQVA 3QB3A 3EGRA 3WCQA 3P1MA 1STGA 4IUNA 4KY6A 5FLXL 4MIUA 2BT6A 2LFNA 2NN6H 2Q5WD 4O42A 1YQ3B 3PUWA 5GXGB 2C9OA 2CQAA 5KNDA 2WP8J 4HJGE 1SBBB 1QNUA 1II3A 2N9KA 4K5VA 4J1MA 3TP7A 1JICA 2JYOA 3GQBA 5TSSA 2NWGA 1N5XA 1HHVA 1WWTA 4HRSA 3J80L 1Q3LA 1IBXB 1R7SA 1CQFA 4HSVA 3WDNA 3GTLB 1VDZA 5EE3A 2JYTA 1STEA 1SYCA 2FFKB 1LTRD 1MGSA 4X3KA 2Q8RE 1F0ZA 2FMCA 3NPPA 2DYOA 1NVID 4ABNA 1K8OA 2IGDA 4C3HG 1GUTA 2B8GA 3Q8CA 1YQ4B 3RLFA 4H13C 2XRSD 3FPUB 3MVVA 2EKIA 5G5GA 4EQOA 2PCFB 2LEKA 4OGQC 1IKLA 4WURA 1OXTA 2CW0C 4HN7A 3LB8C 1PZJD 2E2DC 3N6RA 3QIAA 3GS2A 2QEJC 1WD0A 3VYRA 1TKEA 1QKZA 4PT5A 1MI2A 2JZPA 3I91A 2SEBD 3SHLA 2SOBA 3HEJA 3FVQA 4NKLA 1OFFA 3AE9B 4RAUC 2F0FA 3PV0A 3P42A 5ELBA 2F0SA 4XQQA 3BVMA 1AZQA 1YNJC 4K5WA 3RZDB 1DCZA 4DXFA 2FMMA 3C3LA 5FR3A 1QJOA 4CGYB 1JQYD 5DNFA 4FP5D 1LTGD 4XDCA 1BCPC 1PMRA 3BYTB 4HTHA 2KJXA 2JXMB 2VUMB 3I73A 3HZXA 5EKLA 3SR1A 2KA7A 5J22A 1TY2A 3AMUA 2F0UA 2N88A 2EELA 4LK0M 3MFGA 5CGKA 3AU7A 2G9DA 2ACZB 3CQZB 1L5PA 2ENBA 4H2AA 2Y5CA 3W3AA 5A2QE 1MVKA 2YU9B 3UI3A 3C8YA 2JX5A 1P7FA 2V3NA 4X3TA 3K5NA 4HMJA 2HCIA 1C4CA 4YTNB 1ENAA 5DEHA 3NP8A 3U52E 2MEKA 5J39A 4RKBA 4G4KA 5I9OA 3QOLA 4KKSA 2Z1CA 3H94A 2PZUA 2D5DA 1TS3A 4PV1C 2WQYB 1FGBD 2QILA 2O4XA 2Z8LA 4G7ZC 2KEDA 2OHFA 2JYEA 1XTCD 2MH7A 4WH4A 3H8HA 2JQRB 1XEEA 2PLPA 1XXGA 1ILPA 1IW7C 2W55A 1Q10A 2KCCA 5C4JB 2WU2B 3OIPA 3IKJA 3NTKA 1KLUD 2OF1A 4AYBB 3BK1A 2AUJD 1T6BX 2HTME 1E0BA 1DD2A