1L6UA

Nmr structure of oxidized adrenodoxin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
b'SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6uA00
1KRHA 3ETRA 1XLNA 2WQYB 3AE4B 1TYGB 3W5VB 1NI3A 3AEGB 4C7ZA 3DWMA 1DOXA 3NVVA 3B9JA 1GAQB 1JWAD 3NVYA 4FXCA 4JWSC 4YTNB 4JWUC 2WLBA 3P4PB 1ZP0B 1KFYB 1RM6C 1N61A 1AWDA 4ZHOA 1SB3C 1XLQA 1ROEA 1XO3A 3B2FA 1EWYC 3FAHA 3L4PA 2MJ3A 1RWSA 3NVWA 4P6VF 5AUKA 1ZUD2 1CJEA 1NENB 2K22A 2QJLA 1L6VA 4KX6B 2CJNA 3W9CB 3WCQA 1YQ3B 5C3JB 3B2GA 3CIRB 1FFVA 3P63A 4HRSA 5H8YE 1JWBD 1VJKA 1XLPA 4USAA 3AE9B 1L0VB 3PO0A 2M19A 2DBYA 4US9A 4YSZB 1JW9D 4ITKA 3CWIA 5AUIA 1TKGA 3P1MA 3VRAB 1NYRA 3AN1A 4WQMA 2CU3A 4US8A 2OHFA 1WRIA 1PDXA 1JRPA 2PKOA 3AEBB 3FC4A 1J7CA 5MPOA 1E10A 2B76B 4N58A 2EKIA 1FRRA 1L5PA 4A9AA 4ZHPA 3AV8A 3LXFA 2BS2B 2KAJA 3P4QB 1N60A 2PVOD 2MJDA 1N62A 1OFFA 2H88B 3NRZA 1A70A 1YJJA 1RFKA 4C80A 1IUEA 3SFDB 3AEDB 1E6EB 1SIJA 5G5GA 1QOFA 1AYFA 1FXAA 1R7SA 3AE5B 3KWLA 2L52A 4HROA 4ZOHC 1TJEA 3W5UB 1FO4A 3AE3B 1V8CA 4YXDB 1E7PB 1FRDA 3HUIA 2QIEB 5EE3A 5EE1A 3AE6B 3P4RB 1WGKA 2PVGC 1QLBB 2MH7A 1CZPA 2BS4B 1DOYA 2WS3B 1WXQA 4N59A 1VDVA 3AEAB 2WDQB 3AB5A 1JQ4A 5G5HA 1JALA 1RYJA 1XLOA 1UWMA 1QT9A 1QF6A 4YTPB 3AEFB 2WDVB 1E0ZA 1FXIA 1FM0D 1YJIA 1OQQA 3AM9A 1SF0A 2W3SA 3AE8B 1FMAD 3BIID 1NYQA 3VR9B 3SFEB 3EUB2 4YTMB 1TKEA 2WDRB 4YT0B 1N5XA 3ZYYX 3AE2B 3LB8C 2W3RA 3DWGC 1PUTA 3P4SB 1T3QA 2K5PA 2JX5A 1QOAA 2CJOA 3AECB 1WYGA 2WU5B 1F0ZA 2Y5CA 1WWTA 1N63A 3AMZA 2ACZB 1YQ4B 1DGJA 1JROA 2AX5A 2DWQA 1I7HA 1N5WA 1ZXIA 3HVZA 4C7YA 1FIQA 1VLBA 1L6UA 2WU2B 2LEKA 5C2TB 3VRBB 3AEEB 2FBWB 4JX1C 1NEKB 4LTUA 1KF6B 2K9XA 1FFUA 2HTME 2JQRB 2KMMA 1QOBA 2M56B 2E3TA 3ABVB 3AE7B 3AH7A 2L83A 4N6EB 3HRDD 1ZOYB 1V97A 3VR8B 3SR6A 2W54A 3NS1A 5H92C 5EE9A 2BT6A 2N0SB 1J7AA 2BS3B 5EE0A 5GXGB 2WP9B 3RPFC 1GPXA 1OQRA 2H89B 3AE1B 2Q5WD 2MJEA 2G1EA 1TKYA 2PIAA 4WWMA 1PFDA 4IDIA 2W55A 4YSXB 1NVID 1B9RA 1J7BA 1QOGA 3NVZA 1E9MA 4YSYB 1DOIA
chains in the Genus database with same CATH superfamily
2FUG1 2RD0A 3ETRA 1ACCA 2K0PA 1LFDA 2RDHA 3TCAA 3NVVA 4WJOA 3UF8A 3H7SA 5IN7A 3KH0A 3PREA 1IGCA 3W9CB 3OJ3A 4K3CA 2X8XX 4XC2A 2V0GA 2WXOA 4HRSA 2N4FA 2LD9A 3I3TB 4KVGB 2PKOA 3Q8BA 3HM3A 1F52A 2DHZA 2B76B 1XCQL 3QK0A 1L5PA 2EELA 4KKJA 2I38A 1ENFA 2PVOD 1ZGUB 2BTEA 2NR2A 3CMMB 1L4DB 5HHDG 2IDYA 4NJ7A 1BMLC 1UELA 1FXAA 1C79A 2L52A 2NBVB 2ZJDA 2QDFA 2KKCA 3VTUA 3GE3C 4DXAB 3SHQA 3P4RB 2IO3B 2J0KA 4IW0A 2W82A 2RSUA 3ZDTA 2A4ZA 2JPHA 1FPYA 5BMIA 2ZCBA 3U8ZA 2QILA 2XNAC 2YEPF 3VR9B 2DX5B 3PZ7A 4EE2A 2KLCA 3FKYA 5GMVA 4DHJB 1WFYA 3P4SB 3AECB 4RGNA 5G2NA 2Y5CA 1ZW7A 3Q3FA 2ZCCA 1T0SC 1C4PA 2AX5A 2AQ2B 4WJQA 4W9FA 4FJYA 4C4VB 4BFRA 3ZJTA 3KUCB 2CR5A 2BB5A 3NS1A 1LQBA 4DWFA 4KIKA 5E6PA 4B95A 1E90A 1QQRA 4WWMA 2O6VD 4YSYB 2SAKA 5JXVA 3ZJUA 1I42A 3EA6A 2QMTA 5BYRA 4LCDE 3APFA 4JQWC 2WLBA 1MJDA 1GOZA 3NZSA 1N61A 2KWDA 3IAM1 3L13A 4EKUA 1BXTA 1TIFA 4W9EA 4P6VF 3EECA 1ZUD2 2K22A 2NS5A 2J0MA 2QEJC 3W1SA 1XLPA 3LYYA 4REZA 2DBYA 4LNOA 3SEBA 2OOBB 1TKGA 3H9DA 1RLFA 2LJIA 3Q14C 2LVQA 3DHGC 4BOSC 3Q69A 2EKIA 2M4NA 4EEWA 1WE7A 2KDEB 3L10B 5C23A 1RFKA 2EMTA 1SIJA 2LVPA 1FO4A 4YXDB 2KFKA 2Z0EB 1F77A 4P1BC 2AL6A 2WS3B 2Y5BB 4XYCA 3AEAB 3ZRFA 4J6IA 3HK0A 2KQ4X 4FLHA 3OLMD 1HTQA 3DBHB 2L76A 4W9HA 3Q8AA 3B1LX 3EUB2 3Q2AC 2GB1A 2BBCA 1WJ4A 2JX5A 3N3KB 2FCSA 2INPE 3DBLB 4BBNC 2RGFA 4XDDA 2L7RA 1WI0A 1UH6A 3N32A 2FBWB 4JX1C 1QOBA 4PT5A 3DHHC 5H92C 1YN4A 2BT6A 1HTOA 1GPXA 2MLBA 4S0RA 4OW0A 1QILA 4IDIA 3AE6B 1LM8B 2D3CA 4GU2A 4LNIA 2KWVB 5DPSA 3OJ4B 2NVUI 1JWSD 3N20C 1FXTB 3P4PB 4URKA 5D2MB 3EHVA 4TQ0A 2J42A 4II3B 4M0WA 3ZDMC 3WCQA 5I4DA 4OVZA 3B2GA 3PTFC 1WJNA 2QSDA 2M19A 2AQ1B 1P1AA 1NYRA 4MGZE 2CU3A 2LGDA 1SE4A 4ICUA 1ZXHA 3WAPA 4FN2A 2K6QA 1XD3B 1C78A 4C80A 1XEEA 1QOFA 2N9PC 3L54A 4FHJA 4HROA 3AE3B 1WRDB 4BOZB 5EE1A 3SU8X 3TJPA 3RNCC 1C76A 4HVBA 1DYQA 1WGHA 5FKAC 3DBHI 1EF1A 1OEYJ 3R2TA 3AU4A 4MH8A 1HA5A 4YTMB 3JW0X 1WR6E 1V1PB 2JWUA 4YWGG 1WYWB 3KYDD 1T3QA 3VH3B 3DBLI 2DYOA 4MM3A 1K8RB 1HQRD 1K51A 3QIJA 3ZQ4A 1N5WA 1SIFA 2WU2B 1RRBA 1Q1OA 3AEEB 1C4AA 4MEMA 4L1BA 3ZJVA 1AN8A 1HXYD 2W54A 3E9SA 1WGYA 3VTWA 2N0SB 2BB6A 2JT4B 2H89B 2HJ8A 3QHTA 3Q8CA 4JGHB 1XXGA 2KYWA 3I63C 3P2BA 2UU7A 2GBNA 3DWMA 1ZKHA 3VXWA 1MPEA 2JZPA 5AEKB 3PHWB 1RWSA 3A4RA 2RR9A 2V1YA 2R61A 4HXDA 2BPSA 1T0RC 2KJRA 2O6VB 2KACA 3AE9B 5JHBA 4DHZE 4A55A 1HZ6A 5AUIA 2RDGA 4KSKC 2O2VB 4GXBA 2MQJA 1VRAB 4HPMB 3RNFC 1KLGD 3FC4A 5MPOA 4M8MA 5D6JB 3UIOB 2WXFA 5EDSA 2YVCA 2MJDA 1WR1A 1OFFA 1YJJA 1E6EB 1GNUA 2MP2B 2B3AA 5CX3A 1LXDA 1V86A 2GBJA 2N9EB 3FILB 3BK2A 1UD7A 1SE9A 1JQ4A 1CMXB 1OEYA 2MX2A 2PLPA 3QWZB 2WDVB 1E8XA 3C8YA 2OJWA 1F2RI 1YQBA 1FMAD 1L4ZB 2FIDA 1TKEA 4YT0B 2FUHB 4WWOA 4OVUA 1PGBA 1L0XB 1D5XC 1N6ZA 1BT0A 4E74A 4A90A 2K5PA 2KTRB 1QOAA 2KN5A 4II2B 4WQOB 4NJ6A 5LXHA 3A1QA 4GLSC 2ACZB 2XEWA 1V5OA 2L3ZA 3VRBB 2IYDB 1TS4A 2WXMA 4N6EB 3U7ZA 5IP4D 2L83A 1V97A 1E8ZA 3M95A 3ZNID 2HTHA 5DPTA 2BVCA 4RF0A 1J7BA 3K9PB 3U4EG 2KK8A 3QA8A 1EU4A 4A3OA 2OJRA 1UF0A 3VFKA 3KQ4A 1SB3C 2LGYA 3B2FA 3FAHA 4FADA 1HEZE 3JSVA 1B1ZA 4KX6B 2G45B 3AULA 2BKFA 2JZZA 1WX8A 3RUIB 4K1RB 4ITKA 1T0YA 1WF9A 3PHXB 2WXJA 2Y5PA 2L00B 4NJCA 2NBUA 2J53A 1KJTA 4DDID 1AW7A 3AV8A 2BS2B 3N1XC 4K7UA 1A70A 4WAFA 5L95C 4B0MA 1V8CA 2ZEQA 5EE3A 4ASWC 5G5HA 2NTTA 1KLVA 2FCNA 2DYMA 2ZVNA 3OWEB 3VVWB 4HCNB 3AE8B 5LNK1 1GB4A 2J0JA 2WXGA 3GOEA 3RI7C 2ASQA 1Q5WB 2KOXA 4OZCA 4A6QA 4MJSB 1WWTA 4GDLA 4MH0E 2KTFA 1FIQA 5TR5A 1UNSA 2SEBD 1H4RA 4RGMA 1WXSA 3PPAA 4OHJA 1FNVA 2MA9B 5CTRC 3L0WB 3AE1B 4IKGA 4B9KA 1WXAA 4TSSA 2ZPYA 1ET6A 2WQYB 2BYEA 1UGJA 2R2OA 3TEZA 1FD6A 3KYCD 2C60A 3Q3JA 3RNGC 3WAMA 5BMGA 2I1JA 1ROEA 1L0YB 1EWCA 3UIPB 3O65B 1YQ3B 5BYQA 1JWBD 4DXGA 1WY8A 1L0VB 2I1KA 4A20A 3VRAB 2MCNB 2VZKD 5DPWA 1WJUA 1EU3A 3B0AA 1WRIA 3RNEC 5DCNA 1VZ8A 5E6OA 1FRRA 4A9AA 3MC0B 2LGSA 2H88B 3AEDB 3NS8A 5HG2A 2QCZA 3V3XA 3HUIA 2PMVA 4MACA 2ZPNA 1L2NA 2LGIA 4P1CC 2BS4B 4N59A 2L8JA 2JVCA 4I6PA 3WIMA 1RYJA 1QT9A 3ZLZA 4JE3B 2PPHA 2BWES 2DZJA 3QJZA 1YN3A 2XN9C 5IAAC 1WM3A 3AU5A 3H7PB 1N63A 1JROA 3EFUA 3HVZA 3JVZX 4PYUA 5JHAA 1D3ZA 3RN9C 3SFDB 3UI3A 2GBMA 3HIZA 1MVKA 3MFGA 5CHVC 2GRIA 3QX1A 2WDTB 4ANVA 4YSXB 3C19A 2M8SA 1B9RA 4IUMB 4HEA1 4RGTA 1KRHA 3BVZA 4IWQA 3PLUA 2VRRB 4FXCA 3D32A 2WX1A 4F1SA 4XDCA 2BKRB 3M63B 3KVFB 4ZHOA 2KC1A 4HLEA 5C3JB 3AI5A 4MT5A 1I35A 3VDZA 3P1MA 1YIWA 4AUQC 2JRHA 1JRPA 2LZ6A 1J7CA 1GC6A 3R2IA 2HE7A 2KNBA 4AOFA 5LXIB 2JYEA 1PGAA 4ZHPA 3LXFA 1LO5D 3DQVA 4GIVA 5HKHA 1XQQA 1SGHA 4ZRQA 1PYWD 4JPSA 3W5UB 4BVUC 4M01A 4PS3A 2RDBC 4TKNA 3ENEA 2G3QB 1JALA 2MW5A 4YTPB 4S17A 1OQYA 4I6LB 1YJ1A 3ZNGC 4IM0A 1OQQA 3R7RA 1D5ZC 4HPPA 2WDRB 3ZGZA 4WURA 3DWGC 3DVNU 5J17A 1VR9A 1J19A 1WGRA 2JSVX 4B6WA 3ECIA 4N9F4 1I4GA 3IT6B 2LRWA 3ZUNA 4TQ1A 2KMAA 3VUWA 2J4XA 3DOWA 2BYTA 3ZTCA 1TS3A 4TMAB 1ISNA 2JQRB 3AH7A 3I5JC 1ZOYB 2KHWB 3PGEA 3NJTA 3CSFA 2JXXA 3M62B 1KM7A 2MJEA 2IGGA 2KZRA 4W9KA 2QHOA 2W55A 2KXJA 3PT2B 1VCBA 4NQKE 2KX3A 3QARA 1GAQB 2GBKA 4G11A 2KQ7A 2JYTA 3AXCA 2NCNA 1Q0WB 2G4DB 3L4PA 3TL5A 2WGSA 2K39A 1L6VA 4ZRIA 2LHEA 2IO0B 4XWTA 3VH4B 2ZW1A 2KFKB 3KW5B 4W9IA 2WXIA 2K6DB 4PS7A 4GOCA 4KGRA 2C7NB 3TIXA 2IGDA 2KJHB 3NRZA 5BMHA 3WA0A 3PZDA 2BYVE 2EKEC 2M17A 2INCC 4ZDVA 2DAJA 3BYYB 4GB9A 1CZPA 1DOYA 2MBBB 3P42A 1TZ1A 3DCGA 4WJPA 1P7EA 1V5TA 2C7MB 3NZUA 3GZNB 3IFWB 1FXIA 4NY0A 3BIID 3SFEB 3RZWC 3ALBA 4K7WA 3ZYYX 4X57B 1VZ7A 1WSPA 4NAMA 2DENB 2C5LC 5D94A 2WU5B 1U4AA 4IOIE 1WZ0A 3ZIMA 1Z5SB 2LHDA 2DWQA 1L6UA 5L83A 2GI9A 5C2TB 2V9HA 3ABVB 2M56B 2PW9A 5FR6A 2NPTB 3HRDD 3VR8B 3JYUA 2XK5A 4RCOA 4HWIB 3K9OB 3RYTA 3V60A 4M0WB 1IBXB 5EE0A 3RPFC 1NVID 4XZ4A 2LWPA 4TV3A 4HPLB 4YTNB 2LUMA 3VHTC 2CHWA 1C1YB 3ZO5B 1XO3A 4XWWA 1J8CA 5BO4B 1MFWA 3RFZB 2MJ3A 3OAWA 3PZ8A 2ZNVB 2BGFA 2O6VA 2GLSA 2CU1A 2MBOA 3CIRB 3QAQA 4USAA 1UZXB 3ONSA 3BWUD 4ZRPA 2O2VA 1S3SG 4ZYSA 4W9DA 4WJNA 2AL3A 4P16A 4R3DA 3GP7A 3RZFA 3W1YA 1N60A 3PSEB 3CF6E 3BVMA 1I4HA 1T0QC 3MC8A 4FJVB 2NMQA 3FILA 3APCA 1KLUD 1F9JA 2M0AA 2KN4A 3BVGA 3ZXRA 2VZKB 4MM3B 3R7QA 3GZNI 4GGQA 3AEFB 3R8BA 1I4QA 2PJHA 2KTRA 3IXSA 5E6NA 4E3CA 3T9LA 2LI5A 4H2AA 2CJOA 4FULA 2D3GA 4G50A 4K81A 2KO3A 2HTME 2KMMA 3MP9A 2KQSA 4MELA 4M00A 3X23A 1DOIA 2JZ3B 1FCLA 1D6EC 4RM9A 5IO9A 1WZ3A 2AQ3B 1NI3A 2W9NA 3AEGB 4C7ZA 5FR3A 1WM2A 2C9WB 3A9KA 4DXFA 4ANXA 2KFJA 4NAWA 2JUOA 3H8HA 1XLQA 1CJEA 4BAXA 3IT4B 1V6EA 2K1FA 4KZ0A 4RF1A 2LUEA 1VJKA 2D3BA 2CKHB 2I2YA 2E6XA 1JW9D 3N30A 1SE2A 2OEDA 1Y8RC 4C56C 2IJ0A 3TMPB 1C3TA 3NOBA 3OG5A 2KJ6A 3MJ5A 2WXNA 3WAOA 1D5MC 1EUVB 4CHKA 1I4RA 5G5GA 3AE5B 1WX7A 2ZW0A 2K25A 1KH0A 3NZ3A 1QLBB 2MH7A 2WXKA 3ZNHB 1V49A 2LXCA 3A1QB 2PE9A 3MHSD 1WMHA 1MG8A 5J2RA 2WXRA 1FM0D 4GDKA 3RNBC 2W3SA 4DHZB 1V81A 3A9JB 1V9JA 3A33B 4MJSA 1STEA 1V2YA 3DHIC 2L1AA 2YLMA 3PRPB 2AYOB 2NTSA 1YQ4B 2DZIA 3GB1A 4HJGE 1VLBA 3L17A 4NPNA 3TSSA 2BW2A 3ZRCA 3AE7B 4W9JA 1JCKB 1FNWA 3PRZA 2AWTA 2BS3B 4LLGM 5IOIA 5IKCM 4KGTA 4MGYE 1F2RC 3JSVB 2V3PA 3SDLC 4LDTD 4NQLB 3BINA 2KLGA 3W2DA 4BZAA 1DOXA 3LJ3A 4FA6A 1EF5A 3HM6X 3T8MA 1XT9B 1AWDA 4AJWA 4HK2A 1C77A 1FFVA 5H8YE 4CYEA 2LRUA 4NZLB 4A8XC 2BQQA 2J7QB 4LNNA 5G55A 2CHXA 3EC8A 4M02A 2K8HA 1SJED 4KZCA 1TGZB 1TY2A 3ZNZB 1N62A 3UQBA 2JF5A 4RM8A 1E7PB 1Q10A 4HKZE 1OTRB 5IA7A 4IC7B 2UWQA 4PK1A 4OZAA 5D3IB 2LASA 4KDLB 3U7DA 3NY5A 4LNKA 1E0ZA 3M3JA 1ET9A 3ZKJC 4FBJB 3AM9A 1SF0A 1NYQA 2ICIA 3WANA 2K3UA 4IM2A 4Q2JA 2RPQA 2INNE 1SBBB 1WYGA 1G6JA 3PS6A 4IM3A 3QQ8B 1WXVA 1ZE3D 2GOWA 4KDIC 4C7YA 5D7GA 5JZEB 4GSWA 4A3PA 1V80A 1YD8U 5HI1A 1IYFA 2ZZPB 2TSSA 1L7YA 3QCAA 2FAZA 2WXQA 3CSTA 5TSSA 1PGXA 4MSMB 3N9YC 4C4VA 2MEKA 4AJYB 2V4IB 1UGMA 2Y3AA 3Q3NC 3VAWA 1D4BA 2BF8B 1SSNA 4JWUC 1KFYB 3TEXA 1I4XA 3V6CB 4JLCA 2FCQA 4O1NA 2QC8A 2L32A 1T5XD 2N7DA 2AEHA 2QJLA 1UUPA 3TBLD 5AZFA 1WGGA 3P63A 1WXMA 2J52A 3PO0A 3EFCA 2R2QA 3RMKC 4GMVA 4YSZB 1PQSA 1TBEA 4WQMA 3PVLA 1PDXA 3QC8B 1E10A 2KC2A 3MTNB 2JRIB 2ONQA 2Z59B 1KTKA 1XCTL 2L0FA 3SD5A 3RT3B 1IUEA 5BYSA 2JWZA 5AZGA 2D2QA 5T8IA 2FE8A 1JWMD 1SEBD 3TUOA 3R66C 1HZ5A 4RGOS 4XGAB 1ZDVA 2DYBA 1P0RA 3KLSX 3AE2B 2KDBA 1GG3A 4EFOA 1K53A 1PUTA 3DVGX 1YMHE 4AS1A 1C4CA 1M4VA 3I57A 3RCZA 1Z2MA 3U30A 1GUAB 4AP4C 2MBEA 2IY0B 3ZVVA 1S1QB 2E3TA 1RFAA 4ANUA 3APDA 5E6JA 1CK1A 2PEAA 1BUIC 4W9GA 2G1EA 2IPKD 2CHZA 4KIKB 2N1WA 2RMMA 3W5VB 1K52A 2WXLA 3TEWA 1YN5A 4IWOA 1IGDA 3NVYA 5C1ZA 1IPGA 1SJHD 1TS5A 1ZP0B 1RM6C 2KVZA 4M8NA 1J0GA 1EWYC 3UQAA 5AUKA 5AZHA 4DDGD 4D2KA 2IO2B 2D11A 3IG3A 4US9A 4EZJA 2ON8A 2G9HD 3N1ZC 2D10A 2V3NA 4US8A 4L2YA 1TS2A 2L05A 3DDCB 2WWZA 3U2SC 1R4NB 2N9LA 3Q3OC 5KHOA 3VQIA 1E7VA 2KAJA 4WAAA 3NUHB 3H6NA 3VUXA 4J3OD 3TEYA 1AYFA 4TUUA 2KDFB 2X38A 1WIAA 1EM7A 1FRDA 2QIEB 2N7JA 1WGKA 2PVGC 4AWJA 1VDVA 3B08A 3ML8A 2UYZB 4OZBA 4WIPA 4ZRKA 2K8CA 1WJ6A 1UWMA 3HVDA 1YX5B 3DVGY 2Z8LA 2MBQA 4ZYNA 5D3DA 2NBWB 2N9XA 1NBFC 1YX6B 4ACFA 2D3AA 1E8WA 2M1MA 1I7HA 1ZXIA 4CO7A 2NPTA 4NNJB 3NG0A 1NEKB 2K9XA 1V1PA 1H8CA 1IBXA 4HDQA 1WGDA 4LJPB 4BKSA 2G4SA 4ANWA 1J7AA 2LXAA 4EOYA 2WP9B 4L23A 1OQRA 2N1VA 3EGRA 3HHMA 4LK0M 1M94A 2RPVA 3DBRB 3VUYA 1T6BX 1QOGA 3NVZA 4ARCA 1K50A 2HD5B 2LMCA 4DK5A 1VD2A 4JWSC 1XF5L 1LGRA 2WHIA 2LVOA 5FK9C 3KUDB 2MWSB 4KV2A 1TT5B 1C9FA 1UWXA 4LDTB 3A4SC 3RD2A 2KWCA 1R4NI 2OHFA 3AEBB 4KSLC 3V6EB 4HDOA 3GS2A 4N58A 2IO1B 3BZDB 4RNAA 2KDMA 3IAS1 1P3QU 4ZOHC 1Y56A 4DHJD 3L16A 4LJOB 4EZLA 2BWFA 3KUZA 1GC7A 1SXTA 4LNFA 5DPRA 2YEPB 4E71A 2V3SA 1ESFA 1E5WA 2K8BA 4BBNF 4AQ7A 2FCMA 2KANA 3BY4B 3E56A 4G3XB 3VTVA 1YJIA 2MP2A 3URYA 2XK5B 3LB8C 2W3RA 1AARA 2A5UA 1ZDXA 2BYFA 2DNFA 2WXPA 1FEHA 3R3MA 5CHFA 2GBRA 3X0WA 3AMZA 1DGJA 2HDEA 2KVRA 3KWVA 4KGSA 3S2AA 4FJZA 4MGKE 4PYZA 3DVNV 4ZRJA 3SR6A 4OVVA 1FNUA 2INDC 5EE9A 1JWUD 2IGHA 5GXGB 3DBRI 1TKYA 2PIAA 1MHHE 1EO6A 3AE4B 1TYGB 4B0EA 3H1UA 3DBSA 1TTNA 2JY6A 3ML9A 4MSQB 1GB1A 5CHWA 3B9JA 2M0XA 1ZPSA 2LJ5A 1JWAD 2KMCA 3UGBB 1E7UA 4F7ZA 4K3BA 3NHEB 1SE3A 1OGWA 2CJNA 4MDKE 1RAXA 2KT7A 4W9LA 2DAFA 4RMAA 5J18A 3W1SC 2MSED 3AN1A 4BKTA 3V61A 2LGXA 2PE6B 2N9KA 3T3OA 4KKIA 2WNMA 1V1OA 5HFYA 4IG7B 3KWLA 1TJEA 1R4MB 2JU6X 3MJWA 3DPDA 3N1YC 1JMLA 2MRPA 1XLOA 1KOTA 1I4PA 4FHKA 1QKZA 3A9JA 1YOVB 1CQVA 1VZ6A 3PLVA 2KD0A 4WWNA 3GE8C 4ARIA 3MHZA 1WX9A 1F0ZA 2MBHA 3LDZE 1MG4A 3O13A 1UBIA 3BYTB 3J9CA 2C7HA 2DZMA 1KF6B 1FFUA 3A9KB 3V62A 5JH5C 3U52E 3Q3MC 4NAWB 3ZXVA 3PV1A 1TY0A 3L08A 4K7SA 1A5RA 2V4LA 2WX0A 4XX5A 4JIOU 1E9MA 1JRUA 4ICVA 4RH6A 4XE0A 1XLNA 1E8YA 3I9V1 4F8CB 1NDDA 2DLBA 1F1HA 2VH1A 4DBGA 2EMSA 2FIFA 4YL8A 4EZKA 3NVWA 1IP9A 1NENB 4HCPB 3RULA 2MHJA 1QZEA 5KHQA 1FCCC 2WXHA 2XBBC 1UBQA 4IWPA 2N7EA 2D5GA 1NI2A 2KDIA 3CWIA 2LFIA 3IBEA 3MC9A 3PRMB 1P98A 4I6NB 1HE8A 2DZKA 3ZTDA 1WMHB 3UINB 3P4QB 2CS4A 2IY1B 3IVFA 4HKQA 4GDKB 1WH3A 4MGIE 2GMIC 2KX0A 1MI0A 1R4MI 1MHXA 3Q6BA 1R7SA 3V05A 5LLIA 2KWUB 4BKSD 2Z0DB 4CQNA 2ZNVC 3BK1A 4WH4A 4PS8A 1P9DU 2FNJB 4WWPA 1WXQA 2WDQB 3AB5A 4QAYA 3Q8EA 1QF6A 3WALA 1TZOA 2REXA 4GN1A 4UDUC 2HJ1A 4W9CA 2VH2A 1N5XA 4RFBA 1YNTE 4C00A 3C0RB 2IZVB 3RNAC 2L0TA 4G0NB 2IBIB 3T3NA 2WYQA 4GDLB 1P7FA 2ZVOA 2LEKA 4EUTA 4LTUA 3ZW3A 2JXTA 3Q8FA 4P7IA 1X1MA 4DQOC 1WE6A 4BKGA 2Q5WD 1PFDA 3H7PA 1GJZA 2PTLA 4HJKA 2D07B 3IHPC 4JL9A
chains in the Genus database with same CATH topology
2FUG1 2RMMA 3ETRA 3W5VB 1K52A 1ACCA 2K0PA 2WXLA 3U4EG 3TEWA 1YN5A 2RDHA 1IGDA 3NVVA 1EU4A 3NVYA 4YTNB 1SJHD 2LUMA 1TS5A 1ZP0B 1RM6C 3KQ4A 1SB3C 1XO3A 4XWWA 3B2FA 1EWYC 3FAHA 3RFZB 2MJ3A 5AUKA 1HEZE 3PZ8A 1IGCA 3W9CB 1B1ZA 4KX6B 2V0GA 2WXOA 3CIRB 4HRSA 4D2KA 4USAA 4ZRPA 3BWUD 4US9A 2ON8A 4ITKA 4ZYSA 2G9HD 2V3NA 4US8A 4L2YA 1TS2A 2WXJA 2PKOA 2Y5PA 3Q8BA 4P16A 3GP7A 4NJCA 4R3DA 2B76B 3U2SC 1XCQL 2N9LA 2J53A 1L5PA 2EELA 4KKJA 2I38A 1ENFA 3VQIA 1AW7A 3AV8A 2BS2B 2KAJA 1N60A 2PVOD 2BTEA 3BVMA 1I4HA 1A70A 1L4DB 3NUHB 4WAFA 2IDYA 5HHDG 1BMLC 4B0MA 4J3OD 3TEYA 1AYFA 1FXAA 1C79A 2L52A 2X38A 1V8CA 2NMQA 1EM7A 3FILA 1FRDA 2QIEB 1KLUD 2N7JA 5EE3A 3P4RB 1WGKA 2PVGC 2M0AA 2KN4A 3BVGA 2VZKB 4MM3B 1VDVA 4OZBA 4WIPA 2W82A 5G5HA 2NTTA 1UWMA 3HVDA 2DYMA 5BMIA 3AEFB 3R8BA 3OWEB 2Z8LA 2QILA 1I4QA 3AE8B 2XNAC 2YEPF 5D3DA 3VR9B 5LNK1 1GB4A 2WXGA 3IXSA 3PZ7A 4EE2A 3P4SB 4H2AA 4OZCA 2CJOA 3AECB 4RGNA 4A6QA 2Y5CA 1WWTA 1C4PA 2AX5A 1I7HA 2AQ2B 1ZXIA 1FIQA 1UNSA 1NEKB 2K9XA 2HTME 3ZJTA 2KMMA 3MP9A 2SEBD 1V1PA 1IBXA 4RGMA 2BB5A 3NS1A 4OHJA 1J7AA 1FNVA 2WP9B 4L23A 1OQRA 3AE1B 3EGRA 1QQRA 4IKGA 4LK0M 4WWMA 2RPVA 1T6BX 1QOGA 3NVZA 4YSYB 1DOIA 4TSSA 4ARCA 1FCLA 1ET6A 2WQYB 1D6EC 2SAKA 1UGJA 5JXVA 3TEZA 2AQ3B 1NI3A 1K50A 3ZJUA 3AEGB 4C7ZA 2LMCA 1FD6A 5FR3A 3EA6A 2QMTA 5BYRA 4JWSC 4DXFA 1XF5L 2WLBA 1GOZA 1N61A 2KWDA 3IAM1 5BMGA 3H8HA 1XLQA 1BXTA 1ROEA 4P6VF 5FK9C 1ZUD2 1CJEA 1L0YB 2K22A 1EWCA 3IT4B 4RF1A 1YQ3B 5BYQA 2QEJC 3W1SA 1C9FA 1JWBD 1UWXA 1VJKA 4DXGA 1XLPA 3LYYA 1L0VB 4REZA 2DBYA 2I2YA 2E6XA 1JW9D 3SEBA 3VRAB 1SE2A 1TKGA 2VZKD 1EU3A 2LJIA 1WRIA 2OEDA 2OHFA 3AEBB 4C56C 2IJ0A 3Q69A 1VZ8A 3GS2A 4N58A 2EKIA 1FRRA 4A9AA 3BZDB 3MC0B 4RNAA 3MJ5A 2WXNA 2H88B 1D5MC 1RFKA 1I4RA 3AEDB 1SIJA 2KDMA 3IAS1 5G5GA 3AE5B 4ZOHC 1Y56A 1FO4A 5HG2A 4YXDB 3V3XA 3HUIA 2PMVA 4MACA 1SXTA 2ZW0A 1KH0A 2LGIA 3NZ3A 1QLBB 2MH7A 1F77A 2WXKA 2BS4B 2YEPB 2WS3B 4N59A 3AEAB 1ESFA 2KQ4X 1RYJA 1QT9A 4JE3B 2WXRA 4AQ7A 3E56A 3Q8AA 1FM0D 1YJIA 2W3SA 1YN3A 2XN9C 3EUB2 2GB1A 2BBCA 3URYA 3LB8C 2W3RA 1ZDXA 2JX5A 1STEA 2WXPA 1FEHA 2INPE 2L1AA 1N63A 3AMZA 2NTSA 1YQ4B 1DGJA 1JROA 4XDDA 3GB1A 3HVZA 4HJGE 1VLBA 2HDEA 3KWVA 4KGSA 2FBWB 4JX1C 3TSSA 2BW2A 3SFDB 1QOBA 3UI3A 3AE7B 4PT5A 3SR6A 1JCKB 1MVKA 3MFGA 5H92C 1FNWA 1YN4A 1FNUA 5EE9A 1JWUD 2BT6A 2IGHA 2BS3B 4LLGM 5GXGB 2GRIA 1GPXA 4KGTA 4OW0A 1F2RC 1TKYA 1QILA 2PIAA 2V3PA 4IDIA 4YSXB 1MHHE 1B9RA 3AE6B 4HEA1 4RGTA 1KRHA 3BVZA 3AE4B 1TYGB 4B0EA 3W2DA 1DOXA 1GB1A 3B9JA 1ZPSA 1JWAD 4FXCA 1JWSD 3P4PB 4XDCA 1AWDA 4ZHOA 4TQ0A 2J42A 4M0WA 1SE3A 1C77A 3WCQA 5I4DA 2CJNA 4OVZA 5C3JB 3B2GA 1FFVA 5H8YE 4MT5A 2QSDA 2M19A 2AQ1B 4NZLB 4A8XC 3P1MA 1NYRA 3AN1A 2CU3A 1SE4A 1JRPA 1J7CA 3R2IA 2JYEA 1ZXHA 1PGAA 1SJED 4ZHPA 3LXFA 2N9KA 1LO5D 1TY2A 3T3OA 1C78A 1N62A 4KKIA 2WNMA 4C80A 1V1OA 4ZRQA 1XEEA 5HFYA 1PYWD 1QOFA 3KWLA 4JPSA 3W5UB 4HROA 1TJEA 3AE3B 2JU6X 1E7PB 1Q10A 5EE1A 4HKZE 1C76A 1DYQA 1JMLA 5FKAC 4OZAA 1JALA 1XLOA 5D3IB 4YTPB 1I4PA 1E0ZA 1ET9A 3R2TA 1QKZA 1OQQA 3AM9A 1SF0A 4MH8A 1HA5A 1NYQA 2ICIA 4YTMB 1V1PB 1D5ZC 2K3UA 2JWUA 1CQVA 1VZ6A 2WDRB 4WURA 4YWGG 3ZGZA 4Q2JA 3DWGC 1T3QA 1VR9A 2INNE 4ARIA 1SBBB 3MHZA 2DYOA 1WYGA 1F0ZA 2JSVX 1HQRD 1I4GA 3IT6B 3O13A 1ZE3D 1K51A 3BYTB 4TQ1A 3ZQ4A 1N5WA 2J4XA 4C7YA 2WU2B 3J9CA 2BYTA 1TS3A 3AEEB 4TMAB 1C4AA 5D7GA 1KF6B 4L1BA 1FFUA 2JQRB 3AH7A 3ZJVA 1ZOYB 3U52E 1HXYD 1AN8A 2W54A 3E9SA 4NAWB 5HI1A 2N0SB 1TY0A 2BB6A 2TSSA 2H89B 2WXQA 2MJEA 2IGGA 3Q8CA 2W55A 1XXGA 1E9MA 4RH6A 4XE0A 5TSSA 1XLNA 1PGXA 3I9V1 3N9YC 3DWMA 2MEKA 1GAQB 2V4IB 2DLBA 2Y3AA 2JYTA 1D4BA 4JWUC 1SSNA 1KFYB 3TEXA 1I4XA 1MPEA 4O1NA 2JZPA 2L32A 3L4PA 3NVWA 1RWSA 1T5XD 1NENB 2QJLA 1L6VA 1UUPA 2R61A 3P63A 1FCCC 2J52A 2WXHA 2LHEA 2KACA 3AE9B 3PO0A 4XWTA 2D5GA 2ZW1A 4A55A 4YSZB 1HZ6A 3CWIA 5AUIA 2LFIA 2WXIA 2RDGA 1VRAB 4WQMA 1KLGD 1PDXA 1E10A 3FC4A 5MPOA 4KGRA 2WXFA 2ONQA 2IGDA 3P4QB 2MJDA 4HKQA 1OFFA 1KTKA 1XCTL 1YJJA 3NRZA 4GDKB 5BMHA 1IUEA 1MI0A 1E6EB 1MHXA 5BYSA 1R7SA 3V05A 4CQNA 3BK1A 3BYYB 4WH4A 5T8IA 2FE8A 1CZPA 3FILB 1DOYA 1WXQA 3P42A 3BK2A 2WDQB 3AB5A 1JQ4A 1JWMD 1SEBD 2PLPA 1P7EA 3Q8EA 1QF6A 2WDVB 3TUOA 3C8YA 1FXIA 1TZOA 1HZ5A 4RGOS 4UDUC 1F2RI 3BIID 1FMAD 3SFEB 1L4ZB 1ZDVA 1TKEA 4YT0B 1N5XA 3ZYYX 3KLSX 1PGBA 3AE2B 1L0XB 1D5XC 1VZ7A 4RFBA 1WSPA 4NAMA 1K53A 1PUTA 1YNTE 2K5PA 4A90A 1QOAA 1YMHE 4AS1A 2WU5B 4IOIE 4GLSC 1C4CA 1M4VA 2ACZB 3I57A 3T3NA 2LHDA 2DWQA 4GDLB 1P7FA 1L6UA 2LEKA 2GI9A 5C2TB 3VRBB 4LTUA 3ABVB 2M56B 1TS4A 2PW9A 2E3TA 2WXMA 4N6EB 3U7ZA 2L83A 2JXTA 3HRDD 3VR8B 1V97A 4RCOA 3Q8FA 5E6JA 1IBXB 1CK1A 5EE0A 1BUIC 4DQOC 3RPFC 2Q5WD 2G1EA 2IPKD 1PFDA 4RF0A 2PTLA 1NVID 1J7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  3ETR A;  1XLN A;  2WQY B;  3AE4 B;  1TYG B;  3W5V B;  1NI3 A;  3AEG B;  4C7Z A;  3DWM A;  1DOX A;  3NVV A;  3B9J A;  1GAQ B;  1JWA D;  3NVY A;  4FXC A;  4JWS C;  4YTN B;  4JWU C;  2WLB A;  3P4P B;  1ZP0 B;  1KFY B;  1RM6 C;  1N61 A;  1AWD A;  4ZHO A;  1SB3 C;  1XLQ A;  1ROE A;  1XO3 A;  3B2F A;  1EWY C;  3FAH A;  3L4P A;  2MJ3 A;  1RWS A;  3NVW A;  4P6V F;  5AUK A;  1ZUD 2;  1CJE A;  1NEN B;  2K22 A;  2QJL A;  1L6V A;  4KX6 B;  2CJN A;  3W9C B;  3WCQ A;  1YQ3 B;  5C3J B;  3B2G A;  3CIR B;  1FFV A;  3P63 A;  4HRS A;  5H8Y E;  1JWB D;  1VJK A;  1XLP A;  4USA A;  3AE9 B;  1L0V B;  3PO0 A;  2M19 A;  2DBY A;  4US9 A;  4YSZ B;  1JW9 D;  4ITK A;  3CWI A;  5AUI A;  1TKG A;  3P1M A;  3VRA B;  1NYR A;  3AN1 A;  4WQM A;  2CU3 A;  4US8 A;  2OHF A;  1WRI A;  1PDX A;  1JRP A;  2PKO A;  3AEB B;  3FC4 A;  1J7C A;  5MPO A;  1E10 A;  2B76 B;  4N58 A;  2EKI A;  1FRR A;  1L5P A;  4A9A A;  4ZHP A;  3AV8 A;  3LXF A;  2BS2 B;  2KAJ A;  3P4Q B;  1N60 A;  2PVO D;  2MJD A;  1N62 A;  1OFF A;  2H88 B;  3NRZ A;  1A70 A;  1YJJ A;  1RFK A;  4C80 A;  1IUE A;  3SFD B;  3AED B;  1E6E B;  1SIJ A;  5G5G A;  1QOF A;  1AYF A;  1FXA A;  1R7S A;  3AE5 B;  3KWL A;  2L52 A;  4HRO A;  4ZOH C;  1TJE A;  3W5U B;  1FO4 A;  3AE3 B;  1V8C A;  4YXD B;  1E7P B;  1FRD A;  3HUI A;  2QIE B;  5EE3 A;  5EE1 A;  3AE6 B;  3P4R B;  1WGK A;  2PVG C;  1QLB B;  2MH7 A;  1CZP A;  2BS4 B;  1DOY A;  2WS3 B;  1WXQ A;  4N59 A;  1VDV A;  3AEA B;  2WDQ B;  3AB5 A;  1JQ4 A;  5G5H A;  1JAL A;  1RYJ A;  1XLO A;  1UWM A;  1QT9 A;  1QF6 A;  4YTP B;  3AEF B;  2WDV B;  1E0Z A;  1FXI A;  1FM0 D;  1YJI A;  1OQQ A;  3AM9 A;  1SF0 A;  2W3S A;  3AE8 B;  1FMA D;  3BII D;  1NYQ A;  3VR9 B;  3SFE B;  3EUB 2;  4YTM B;  1TKE A;  2WDR B;  4YT0 B;  1N5X A;  3ZYY X;  3AE2 B;  3LB8 C;  2W3R A;  3DWG C;  1PUT A;  3P4S B;  1T3Q A;  2K5P A;  2JX5 A;  1QOA A;  2CJO A;  3AEC B;  1WYG A;  2WU5 B;  1F0Z A;  2Y5C A;  1WWT A;  1N63 A;  3AMZ A;  2ACZ B;  1YQ4 B;  1DGJ A;  1JRO A;  2AX5 A;  2DWQ A;  1I7H A;  1N5W A;  1ZXI A;  3HVZ A;  4C7Y A;  1FIQ A;  1VLB A;  1L6U A;  2WU2 B;  2LEK A;  5C2T B;  3VRB B;  3AEE B;  2FBW B;  4JX1 C;  1NEK B;  4LTU A;  1KF6 B;  2K9X A;  1FFU A;  2HTM E;  2JQR B;  2KMM A;  1QOB A;  2M56 B;  2E3T A;  3ABV B;  3AE7 B;  3AH7 A;  2L83 A;  4N6E B;  3HRD D;  1ZOY B;  1V97 A;  3VR8 B;  3SR6 A;  2W54 A;  3NS1 A;  5H92 C;  5EE9 A;  2BT6 A;  2N0S B;  1J7A A;  2BS3 B;  5EE0 A;  5GXG B;  2WP9 B;  3RPF C;  1GPX A;  1OQR A;  2H89 B;  3AE1 B;  2Q5W D;  2MJE A;  2G1E A;  1TKY A;  2PIA A;  4WWM A;  1PFD A;  4IDI A;  2W55 A;  4YSX B;  1NVI D;  1B9R A;  1J7B A;  1QOG A;  3NVZ A;  1E9M A;  4YSY B;  1DOI A; 
#chains in the Genus database with same CATH topology
 2FUG 1;  2RD0 A;  3ETR A;  1ACC A;  2K0P A;  1LFD A;  2RDH A;  3TCA A;  3NVV A;  4WJO A;  3UF8 A;  3H7S A;  5IN7 A;  3KH0 A;  3PRE A;  1IGC A;  3W9C B;  3OJ3 A;  4K3C A;  2X8X X;  4XC2 A;  2V0G A;  2WXO A;  4HRS A;  2N4F A;  2LD9 A;  3I3T B;  4KVG B;  2PKO A;  3Q8B A;  3HM3 A;  1F52 A;  2DHZ A;  2B76 B;  1XCQ L;  3QK0 A;  1L5P A;  2EEL A;  4KKJ A;  2I38 A;  1ENF A;  2PVO D;  1ZGU B;  2BTE A;  2NR2 A;  3CMM B;  1L4D B;  5HHD G;  2IDY A;  4NJ7 A;  1BML C;  1UEL A;  1FXA A;  1C79 A;  2L52 A;  2NBV B;  2ZJD A;  2QDF A;  2KKC A;  3VTU A;  3GE3 C;  4DXA B;  3SHQ A;  3P4R B;  2IO3 B;  2J0K A;  4IW0 A;  2W82 A;  2RSU A;  3ZDT A;  2A4Z A;  2JPH A;  1FPY A;  5BMI A;  2ZCB A;  3U8Z A;  2QIL A;  2XNA C;  2YEP F;  3VR9 B;  2DX5 B;  3PZ7 A;  4EE2 A;  2KLC A;  3FKY A;  5GMV A;  4DHJ B;  1WFY A;  3P4S B;  3AEC B;  4RGN A;  5G2N A;  2Y5C A;  1ZW7 A;  3Q3F A;  2ZCC A;  1T0S C;  1C4P A;  2AX5 A;  2AQ2 B;  4WJQ A;  4W9F A;  4FJY A;  4C4V B;  4BFR A;  3ZJT A;  3KUC B;  2CR5 A;  2BB5 A;  3NS1 A;  1LQB A;  4DWF A;  4KIK A;  5E6P A;  4B95 A;  1E90 A;  1QQR A;  4WWM A;  2O6V D;  4YSY B;  2SAK A;  5JXV A;  3ZJU A;  1I42 A;  3EA6 A;  2QMT A;  5BYR A;  4LCD E;  3APF A;  4JQW C;  2WLB A;  1MJD A;  1GOZ A;  3NZS A;  1N61 A;  2KWD A;  3IAM 1;  3L13 A;  4EKU A;  1BXT A;  1TIF A;  4W9E A;  4P6V F;  3EEC A;  1ZUD 2;  2K22 A;  2NS5 A;  2J0M A;  2QEJ C;  3W1S A;  1XLP A;  3LYY A;  4REZ A;  2DBY A;  4LNO A;  3SEB A;  2OOB B;  1TKG A;  3H9D A;  1RLF A;  2LJI A;  3Q14 C;  2LVQ A;  3DHG C;  4BOS C;  3Q69 A;  2EKI A;  2M4N A;  4EEW A;  1WE7 A;  2KDE B;  3L10 B;  5C23 A;  1RFK A;  2EMT A;  1SIJ A;  2LVP A;  1FO4 A;  4YXD B;  2KFK A;  2Z0E B;  1F77 A;  4P1B C;  2AL6 A;  2WS3 B;  2Y5B B;  4XYC A;  3AEA B;  3ZRF A;  4J6I A;  3HK0 A;  2KQ4 X;  4FLH A;  3OLM D;  1HTQ A;  3DBH B;  2L76 A;  4W9H A;  3Q8A A;  3B1L X;  3EUB 2;  3Q2A C;  2GB1 A;  2BBC A;  1WJ4 A;  2JX5 A;  3N3K B;  2FCS A;  2INP E;  3DBL B;  4BBN C;  2RGF A;  4XDD A;  2L7R A;  1WI0 A;  1UH6 A;  3N32 A;  2FBW B;  4JX1 C;  1QOB A;  4PT5 A;  3DHH C;  5H92 C;  1YN4 A;  2BT6 A;  1HTO A;  1GPX A;  2MLB A;  4S0R A;  4OW0 A;  1QIL A;  4IDI A;  3AE6 B;  1LM8 B;  2D3C A;  4GU2 A;  4LNI A;  2KWV B;  5DPS A;  3OJ4 B;  2NVU I;  1JWS D;  3N20 C;  1FXT B;  3P4P B;  4URK A;  5D2M B;  3EHV A;  4TQ0 A;  2J42 A;  4II3 B;  4M0W A;  3ZDM C;  3WCQ A;  5I4D A;  4OVZ A;  3B2G A;  3PTF C;  1WJN A;  2QSD A;  2M19 A;  2AQ1 B;  1P1A A;  1NYR A;  4MGZ E;  2CU3 A;  2LGD A;  1SE4 A;  4ICU A;  1ZXH A;  3WAP A;  4FN2 A;  2K6Q A;  1XD3 B;  1C78 A;  4C80 A;  1XEE A;  1QOF A;  2N9P C;  3L54 A;  4FHJ A;  4HRO A;  3AE3 B;  1WRD B;  4BOZ B;  5EE1 A;  3SU8 X;  3TJP A;  3RNC C;  1C76 A;  4HVB A;  1DYQ A;  1WGH A;  5FKA C;  3DBH I;  1EF1 A;  1OEY J;  3R2T A;  3AU4 A;  4MH8 A;  1HA5 A;  4YTM B;  3JW0 X;  1WR6 E;  1V1P B;  2JWU A;  4YWG G;  1WYW B;  3KYD D;  1T3Q A;  3VH3 B;  3DBL I;  2DYO A;  4MM3 A;  1K8R B;  1HQR D;  1K51 A;  3QIJ A;  3ZQ4 A;  1N5W A;  1SIF A;  2WU2 B;  1RRB A;  1Q1O A;  3AEE B;  1C4A A;  4MEM A;  4L1B A;  3ZJV A;  1AN8 A;  1HXY D;  2W54 A;  3E9S A;  1WGY A;  3VTW A;  2N0S B;  2BB6 A;  2JT4 B;  2H89 B;  2HJ8 A;  3QHT A;  3Q8C A;  4JGH B;  1XXG A;  2KYW A;  3I63 C;  3P2B A;  2UU7 A;  2GBN A;  3DWM A;  1ZKH A;  3VXW A;  1MPE A;  2JZP A;  5AEK B;  3PHW B;  1RWS A;  3A4R A;  2RR9 A;  2V1Y A;  2R61 A;  4HXD A;  2BPS A;  1T0R C;  2KJR A;  2O6V B;  2KAC A;  3AE9 B;  5JHB A;  4DHZ E;  4A55 A;  1HZ6 A;  5AUI A;  2RDG A;  4KSK C;  2O2V B;  4GXB A;  2MQJ A;  1VRA B;  4HPM B;  3RNF C;  1KLG D;  3FC4 A;  5MPO A;  4M8M A;  5D6J B;  3UIO B;  2WXF A;  5EDS A;  2YVC A;  2MJD A;  1WR1 A;  1OFF A;  1YJJ A;  1E6E B;  1GNU A;  2MP2 B;  2B3A A;  5CX3 A;  1LXD A;  1V86 A;  2GBJ A;  2N9E B;  3FIL B;  3BK2 A;  1UD7 A;  1SE9 A;  1JQ4 A;  1CMX B;  1OEY A;  2MX2 A;  2PLP A;  3QWZ B;  2WDV B;  1E8X A;  3C8Y A;  2OJW A;  1F2R I;  1YQB A;  1FMA D;  1L4Z B;  2FID A;  1TKE A;  4YT0 B;  2FUH B;  4WWO A;  4OVU A;  1PGB A;  1L0X B;  1D5X C;  1N6Z A;  1BT0 A;  4E74 A;  4A90 A;  2K5P A;  2KTR B;  1QOA A;  2KN5 A;  4II2 B;  4WQO B;  4NJ6 A;  5LXH A;  3A1Q A;  4GLS C;  2ACZ B;  2XEW A;  1V5O A;  2L3Z A;  3VRB B;  2IYD B;  1TS4 A;  2WXM A;  4N6E B;  3U7Z A;  5IP4 D;  2L83 A;  1V97 A;  1E8Z A;  3M95 A;  3ZNI D;  2HTH A;  5DPT A;  2BVC A;  4RF0 A;  1J7B A;  3K9P B;  3U4E G;  2KK8 A;  3QA8 A;  1EU4 A;  4A3O A;  2OJR A;  1UF0 A;  3VFK A;  3KQ4 A;  1SB3 C;  2LGY A;  3B2F A;  3FAH A;  4FAD A;  1HEZ E;  3JSV A;  1B1Z A;  4KX6 B;  2G45 B;  3AUL A;  2BKF A;  2JZZ A;  1WX8 A;  3RUI B;  4K1R B;  4ITK A;  1T0Y A;  1WF9 A;  3PHX B;  2WXJ A;  2Y5P A;  2L00 B;  4NJC A;  2NBU A;  2J53 A;  1KJT A;  4DDI D;  1AW7 A;  3AV8 A;  2BS2 B;  3N1X C;  4K7U A;  1A70 A;  4WAF A;  5L95 C;  4B0M A;  1V8C A;  2ZEQ A;  5EE3 A;  4ASW C;  5G5H A;  2NTT A;  1KLV A;  2FCN A;  2DYM A;  2ZVN A;  3OWE B;  3VVW B;  4HCN B;  3AE8 B;  5LNK 1;  1GB4 A;  2J0J A;  2WXG A;  3GOE A;  3RI7 C;  2ASQ A;  1Q5W B;  2KOX A;  4OZC A;  4A6Q A;  4MJS B;  1WWT A;  4GDL A;  4MH0 E;  2KTF A;  1FIQ A;  5TR5 A;  1UNS A;  2SEB D;  1H4R A;  4RGM A;  1WXS A;  3PPA A;  4OHJ A;  1FNV A;  2MA9 B;  5CTR C;  3L0W B;  3AE1 B;  4IKG A;  4B9K A;  1WXA A;  4TSS A;  2ZPY A;  1ET6 A;  2WQY B;  2BYE A;  1UGJ A;  2R2O A;  3TEZ A;  1FD6 A;  3KYC D;  2C60 A;  3Q3J A;  3RNG C;  3WAM A;  5BMG A;  2I1J A;  1ROE A;  1L0Y B;  1EWC A;  3UIP B;  3O65 B;  1YQ3 B;  5BYQ A;  1JWB D;  4DXG A;  1WY8 A;  1L0V B;  2I1K A;  4A20 A;  3VRA B;  2MCN B;  2VZK D;  5DPW A;  1WJU A;  1EU3 A;  3B0A A;  1WRI A;  3RNE C;  5DCN A;  1VZ8 A;  5E6O A;  1FRR A;  4A9A A;  3MC0 B;  2LGS A;  2H88 B;  3AED B;  3NS8 A;  5HG2 A;  2QCZ A;  3V3X A;  3HUI A;  2PMV A;  4MAC A;  2ZPN A;  1L2N A;  2LGI A;  4P1C C;  2BS4 B;  4N59 A;  2L8J A;  2JVC A;  4I6P A;  3WIM A;  1RYJ A;  1QT9 A;  3ZLZ A;  4JE3 B;  2PPH A;  2BWE S;  2DZJ A;  3QJZ A;  1YN3 A;  2XN9 C;  5IAA C;  1WM3 A;  3AU5 A;  3H7P B;  1N63 A;  1JRO A;  3EFU A;  3HVZ A;  3JVZ X;  4PYU A;  5JHA A;  1D3Z A;  3RN9 C;  3SFD B;  3UI3 A;  2GBM A;  3HIZ A;  1MVK A;  3MFG A;  5CHV C;  2GRI A;  3QX1 A;  2WDT B;  4ANV A;  4YSX B;  3C19 A;  2M8S A;  1B9R A;  4IUM B;  4HEA 1;  4RGT A;  1KRH A;  3BVZ A;  4IWQ A;  3PLU A;  2VRR B;  4FXC A;  3D32 A;  2WX1 A;  4F1S A;  4XDC A;  2BKR B;  3M63 B;  3KVF B;  4ZHO A;  2KC1 A;  4HLE A;  5C3J B;  3AI5 A;  4MT5 A;  1I35 A;  3VDZ A;  3P1M A;  1YIW A;  4AUQ C;  2JRH A;  1JRP A;  2LZ6 A;  1J7C A;  1GC6 A;  3R2I A;  2HE7 A;  2KNB A;  4AOF A;  5LXI B;  2JYE A;  1PGA A;  4ZHP A;  3LXF A;  1LO5 D;  3DQV A;  4GIV A;  5HKH A;  1XQQ A;  1SGH A;  4ZRQ A;  1PYW D;  4JPS A;  3W5U B;  4BVU C;  4M01 A;  4PS3 A;  2RDB C;  4TKN A;  3ENE A;  2G3Q B;  1JAL A;  2MW5 A;  4YTP B;  4S17 A;  1OQY A;  4I6L B;  1YJ1 A;  3ZNG C;  4IM0 A;  1OQQ A;  3R7R A;  1D5Z C;  4HPP A;  2WDR B;  3ZGZ A;  4WUR A;  3DWG C;  3DVN U;  5J17 A;  1VR9 A;  1J19 A;  1WGR A;  2JSV X;  4B6W A;  3ECI A;  4N9F 4;  1I4G A;  3IT6 B;  2LRW A;  3ZUN A;  4TQ1 A;  2KMA A;  3VUW A;  2J4X A;  3DOW A;  2BYT A;  3ZTC A;  1TS3 A;  4TMA B;  1ISN A;  2JQR B;  3AH7 A;  3I5J C;  1ZOY B;  2KHW B;  3PGE A;  3NJT A;  3CSF A;  2JXX A;  3M62 B;  1KM7 A;  2MJE A;  2IGG A;  2KZR A;  4W9K A;  2QHO A;  2W55 A;  2KXJ A;  3PT2 B;  1VCB A;  4NQK E;  2KX3 A;  3QAR A;  1GAQ B;  2GBK A;  4G11 A;  2KQ7 A;  2JYT A;  3AXC A;  2NCN A;  1Q0W B;  2G4D B;  3L4P A;  3TL5 A;  2WGS A;  2K39 A;  1L6V A;  4ZRI A;  2LHE A;  2IO0 B;  4XWT A;  3VH4 B;  2ZW1 A;  2KFK B;  3KW5 B;  4W9I A;  2WXI A;  2K6D B;  4PS7 A;  4GOC A;  4KGR A;  2C7N B;  3TIX A;  2IGD A;  2KJH B;  3NRZ A;  5BMH A;  3WA0 A;  3PZD A;  2BYV E;  2EKE C;  2M17 A;  2INC C;  4ZDV A;  2DAJ A;  3BYY B;  4GB9 A;  1CZP A;  1DOY A;  2MBB B;  3P42 A;  1TZ1 A;  3DCG A;  4WJP A;  1P7E A;  1V5T A;  2C7M B;  3NZU A;  3GZN B;  3IFW B;  1FXI A;  4NY0 A;  3BII D;  3SFE B;  3RZW C;  3ALB A;  4K7W A;  3ZYY X;  4X57 B;  1VZ7 A;  1WSP A;  4NAM A;  2DEN B;  2C5L C;  5D94 A;  2WU5 B;  1U4A A;  4IOI E;  1WZ0 A;  3ZIM A;  1Z5S B;  2LHD A;  2DWQ A;  1L6U A;  5L83 A;  2GI9 A;  5C2T B;  2V9H A;  3ABV B;  2M56 B;  2PW9 A;  5FR6 A;  2NPT B;  3HRD D;  3VR8 B;  3JYU A;  2XK5 A;  4RCO A;  4HWI B;  3K9O B;  3RYT A;  3V60 A;  4M0W B;  1IBX B;  5EE0 A;  3RPF C;  1NVI D;  4XZ4 A;  2LWP A;  4TV3 A;  4HPL B;  4YTN B;  2LUM A;  3VHT C;  2CHW A;  1C1Y B;  3ZO5 B;  1XO3 A;  4XWW A;  1J8C A;  5BO4 B;  1MFW A;  3RFZ B;  2MJ3 A;  3OAW A;  3PZ8 A;  2ZNV B;  2BGF A;  2O6V A;  2GLS A;  2CU1 A;  2MBO A;  3CIR B;  3QAQ A;  4USA A;  1UZX B;  3ONS A;  3BWU D;  4ZRP A;  2O2V A;  1S3S G;  4ZYS A;  4W9D A;  4WJN A;  2AL3 A;  4P16 A;  4R3D A;  3GP7 A;  3RZF A;  3W1Y A;  1N60 A;  3PSE B;  3CF6 E;  3BVM A;  1I4H A;  1T0Q C;  3MC8 A;  4FJV B;  2NMQ A;  3FIL A;  3APC A;  1KLU D;  1F9J A;  2M0A A;  2KN4 A;  3BVG A;  3ZXR A;  2VZK B;  4MM3 B;  3R7Q A;  3GZN I;  4GGQ A;  3AEF B;  3R8B A;  1I4Q A;  2PJH A;  2KTR A;  3IXS A;  5E6N A;  4E3C A;  3T9L A;  2LI5 A;  4H2A A;  2CJO A;  4FUL A;  2D3G A;  4G50 A;  4K81 A;  2KO3 A;  2HTM E;  2KMM A;  3MP9 A;  2KQS A;  4MEL A;  4M00 A;  3X23 A;  1DOI A;  2JZ3 B;  1FCL A;  1D6E C;  4RM9 A;  5IO9 A;  1WZ3 A;  2AQ3 B;  1NI3 A;  2W9N A;  3AEG B;  4C7Z A;  5FR3 A;  1WM2 A;  2C9W B;  3A9K A;  4DXF A;  4ANX A;  2KFJ A;  4NAW A;  2JUO A;  3H8H A;  1XLQ A;  1CJE A;  4BAX A;  3IT4 B;  1V6E A;  2K1F A;  4KZ0 A;  4RF1 A;  2LUE A;  1VJK A;  2D3B A;  2CKH B;  2I2Y A;  2E6X A;  1JW9 D;  3N30 A;  1SE2 A;  2OED A;  1Y8R C;  4C56 C;  2IJ0 A;  3TMP B;  1C3T A;  3NOB A;  3OG5 A;  2KJ6 A;  3MJ5 A;  2WXN A;  3WAO A;  1D5M C;  1EUV B;  4CHK A;  1I4R A;  5G5G A;  3AE5 B;  1WX7 A;  2ZW0 A;  2K25 A;  1KH0 A;  3NZ3 A;  1QLB B;  2MH7 A;  2WXK A;  3ZNH B;  1V49 A;  2LXC A;  3A1Q B;  2PE9 A;  3MHS D;  1WMH A;  1MG8 A;  5J2R A;  2WXR A;  1FM0 D;  4GDK A;  3RNB C;  2W3S A;  4DHZ B;  1V81 A;  3A9J B;  1V9J A;  3A33 B;  4MJS A;  1STE A;  1V2Y A;  3DHI C;  2L1A A;  2YLM A;  3PRP B;  2AYO B;  2NTS A;  1YQ4 B;  2DZI A;  3GB1 A;  4HJG E;  1VLB A;  3L17 A;  4NPN A;  3TSS A;  2BW2 A;  3ZRC A;  3AE7 B;  4W9J A;  1JCK B;  1FNW A;  3PRZ A;  2AWT A;  2BS3 B;  4LLG M;  5IOI A;  5IKC M;  4KGT A;  4MGY E;  1F2R C;  3JSV B;  2V3P A;  3SDL C;  4LDT D;  4NQL B;  3BIN A;  2KLG A;  3W2D A;  4BZA A;  1DOX A;  3LJ3 A;  4FA6 A;  1EF5 A;  3HM6 X;  3T8M A;  1XT9 B;  1AWD A;  4AJW A;  4HK2 A;  1C77 A;  1FFV A;  5H8Y E;  4CYE A;  2LRU A;  4NZL B;  4A8X C;  2BQQ A;  2J7Q B;  4LNN A;  5G55 A;  2CHX A;  3EC8 A;  4M02 A;  2K8H A;  1SJE D;  4KZC A;  1TGZ B;  1TY2 A;  3ZNZ B;  1N62 A;  3UQB A;  2JF5 A;  4RM8 A;  1E7P B;  1Q10 A;  4HKZ E;  1OTR B;  5IA7 A;  4IC7 B;  2UWQ A;  4PK1 A;  4OZA A;  5D3I B;  2LAS A;  4KDL B;  3U7D A;  3NY5 A;  4LNK A;  1E0Z A;  3M3J A;  1ET9 A;  3ZKJ C;  4FBJ B;  3AM9 A;  1SF0 A;  1NYQ A;  2ICI A;  3WAN A;  2K3U A;  4IM2 A;  4Q2J A;  2RPQ A;  2INN E;  1SBB B;  1WYG A;  1G6J A;  3PS6 A;  4IM3 A;  3QQ8 B;  1WXV A;  1ZE3 D;  2GOW A;  4KDI C;  4C7Y A;  5D7G A;  5JZE B;  4GSW A;  4A3P A;  1V80 A;  1YD8 U;  5HI1 A;  1IYF A;  2ZZP B;  2TSS A;  1L7Y A;  3QCA A;  2FAZ A;  2WXQ A;  3CST A;  5TSS A;  1PGX A;  4MSM B;  3N9Y C;  4C4V A;  2MEK A;  4AJY B;  2V4I B;  1UGM A;  2Y3A A;  3Q3N C;  3VAW A;  1D4B A;  2BF8 B;  1SSN A;  4JWU C;  1KFY B;  3TEX A;  1I4X A;  3V6C B;  4JLC A;  2FCQ A;  4O1N A;  2QC8 A;  2L32 A;  1T5X D;  2N7D A;  2AEH A;  2QJL A;  1UUP A;  3TBL D;  5AZF A;  1WGG A;  3P63 A;  1WXM A;  2J52 A;  3PO0 A;  3EFC A;  2R2Q A;  3RMK C;  4GMV A;  4YSZ B;  1PQS A;  1TBE A;  4WQM A;  3PVL A;  1PDX A;  3QC8 B;  1E10 A;  2KC2 A;  3MTN B;  2JRI B;  2ONQ A;  2Z59 B;  1KTK A;  1XCT L;  2L0F A;  3SD5 A;  3RT3 B;  1IUE A;  5BYS A;  2JWZ A;  5AZG A;  2D2Q A;  5T8I A;  2FE8 A;  1JWM D;  1SEB D;  3TUO A;  3R66 C;  1HZ5 A;  4RGO S;  4XGA B;  1ZDV A;  2DYB A;  1P0R A;  3KLS X;  3AE2 B;  2KDB A;  1GG3 A;  4EFO A;  1K53 A;  1PUT A;  3DVG X;  1YMH E;  4AS1 A;  1C4C A;  1M4V A;  3I57 A;  3RCZ A;  1Z2M A;  3U30 A;  1GUA B;  4AP4 C;  2MBE A;  2IY0 B;  3ZVV A;  1S1Q B;  2E3T A;  1RFA A;  4ANU A;  3APD A;  5E6J A;  1CK1 A;  2PEA A;  1BUI C;  4W9G A;  2G1E A;  2IPK D;  2CHZ A;  4KIK B;  2N1W A;  2RMM A;  3W5V B;  1K52 A;  2WXL A;  3TEW A;  1YN5 A;  4IWO A;  1IGD A;  3NVY A;  5C1Z A;  1IPG A;  1SJH D;  1TS5 A;  1ZP0 B;  1RM6 C;  2KVZ A;  4M8N A;  1J0G A;  1EWY C;  3UQA A;  5AUK A;  5AZH A;  4DDG D;  4D2K A;  2IO2 B;  2D11 A;  3IG3 A;  4US9 A;  4EZJ A;  2ON8 A;  2G9H D;  3N1Z C;  2D10 A;  2V3N A;  4US8 A;  4L2Y A;  1TS2 A;  2L05 A;  3DDC B;  2WWZ A;  3U2S C;  1R4N B;  2N9L A;  3Q3O C;  5KHO A;  3VQI A;  1E7V A;  2KAJ A;  4WAA A;  3NUH B;  3H6N A;  3VUX A;  4J3O D;  3TEY A;  1AYF A;  4TUU A;  2KDF B;  2X38 A;  1WIA A;  1EM7 A;  1FRD A;  2QIE B;  2N7J A;  1WGK A;  2PVG C;  4AWJ A;  1VDV A;  3B08 A;  3ML8 A;  2UYZ B;  4OZB A;  4WIP A;  4ZRK A;  2K8C A;  1WJ6 A;  1UWM A;  3HVD A;  1YX5 B;  3DVG Y;  2Z8L A;  2MBQ A;  4ZYN A;  5D3D A;  2NBW B;  2N9X A;  1NBF C;  1YX6 B;  4ACF A;  2D3A A;  1E8W A;  2M1M A;  1I7H A;  1ZXI A;  4CO7 A;  2NPT A;  4NNJ B;  3NG0 A;  1NEK B;  2K9X A;  1V1P A;  1H8C A;  1IBX A;  4HDQ A;  1WGD A;  4LJP B;  4BKS A;  2G4S A;  4ANW A;  1J7A A;  2LXA A;  4EOY A;  2WP9 B;  4L23 A;  1OQR A;  2N1V A;  3EGR A;  3HHM A;  4LK0 M;  1M94 A;  2RPV A;  3DBR B;  3VUY A;  1T6B X;  1QOG A;  3NVZ A;  4ARC A;  1K50 A;  2HD5 B;  2LMC A;  4DK5 A;  1VD2 A;  4JWS C;  1XF5 L;  1LGR A;  2WHI A;  2LVO A;  5FK9 C;  3KUD B;  2MWS B;  4KV2 A;  1TT5 B;  1C9F A;  1UWX A;  4LDT B;  3A4S C;  3RD2 A;  2KWC A;  1R4N I;  2OHF A;  3AEB B;  4KSL C;  3V6E B;  4HDO A;  3GS2 A;  4N58 A;  2IO1 B;  3BZD B;  4RNA A;  2KDM A;  3IAS 1;  1P3Q U;  4ZOH C;  1Y56 A;  4DHJ D;  3L16 A;  4LJO B;  4EZL A;  2BWF A;  3KUZ A;  1GC7 A;  1SXT A;  4LNF A;  5DPR A;  2YEP B;  4E71 A;  2V3S A;  1ESF A;  1E5W A;  2K8B A;  4BBN F;  4AQ7 A;  2FCM A;  2KAN A;  3BY4 B;  3E56 A;  4G3X B;  3VTV A;  1YJI A;  2MP2 A;  3URY A;  2XK5 B;  3LB8 C;  2W3R A;  1AAR A;  2A5U A;  1ZDX A;  2BYF A;  2DNF A;  2WXP A;  1FEH A;  3R3M A;  5CHF A;  2GBR A;  3X0W A;  3AMZ A;  1DGJ A;  2HDE A;  2KVR A;  3KWV A;  4KGS A;  3S2A A;  4FJZ A;  4MGK E;  4PYZ A;  3DVN V;  4ZRJ A;  3SR6 A;  4OVV A;  1FNU A;  2IND C;  5EE9 A;  1JWU D;  2IGH A;  5GXG B;  3DBR I;  1TKY A;  2PIA A;  1MHH E;  1EO6 A;  3AE4 B;  1TYG B;  4B0E A;  3H1U A;  3DBS A;  1TTN A;  2JY6 A;  3ML9 A;  4MSQ B;  1GB1 A;  5CHW A;  3B9J A;  2M0X A;  1ZPS A;  2LJ5 A;  1JWA D;  2KMC A;  3UGB B;  1E7U A;  4F7Z A;  4K3B A;  3NHE B;  1SE3 A;  1OGW A;  2CJN A;  4MDK E;  1RAX A;  2KT7 A;  4W9L A;  2DAF A;  4RMA A;  5J18 A;  3W1S C;  2MSE D;  3AN1 A;  4BKT A;  3V61 A;  2LGX A;  2PE6 B;  2N9K A;  3T3O A;  4KKI A;  2WNM A;  1V1O A;  5HFY A;  4IG7 B;  3KWL A;  1TJE A;  1R4M B;  2JU6 X;  3MJW A;  3DPD A;  3N1Y C;  1JML A;  2MRP A;  1XLO A;  1KOT A;  1I4P A;  4FHK A;  1QKZ A;  3A9J A;  1YOV B;  1CQV A;  1VZ6 A;  3PLV A;  2KD0 A;  4WWN A;  3GE8 C;  4ARI A;  3MHZ A;  1WX9 A;  1F0Z A;  2MBH A;  3LDZ E;  1MG4 A;  3O13 A;  1UBI A;  3BYT B;  3J9C A;  2C7H A;  2DZM A;  1KF6 B;  1FFU A;  3A9K B;  3V62 A;  5JH5 C;  3U52 E;  3Q3M C;  4NAW B;  3ZXV A;  3PV1 A;  1TY0 A;  3L08 A;  4K7S A;  1A5R A;  2V4L A;  2WX0 A;  4XX5 A;  4JIO U;  1E9M A;  1JRU A;  4ICV A;  4RH6 A;  4XE0 A;  1XLN A;  1E8Y A;  3I9V 1;  4F8C B;  1NDD A;  2DLB A;  1F1H A;  2VH1 A;  4DBG A;  2EMS A;  2FIF A;  4YL8 A;  4EZK A;  3NVW A;  1IP9 A;  1NEN B;  4HCP B;  3RUL A;  2MHJ A;  1QZE A;  5KHQ A;  1FCC C;  2WXH A;  2XBB C;  1UBQ A;  4IWP A;  2N7E A;  2D5G A;  1NI2 A;  2KDI A;  3CWI A;  2LFI A;  3IBE A;  3MC9 A;  3PRM B;  1P98 A;  4I6N B;  1HE8 A;  2DZK A;  3ZTD A;  1WMH B;  3UIN B;  3P4Q B;  2CS4 A;  2IY1 B;  3IVF A;  4HKQ A;  4GDK B;  1WH3 A;  4MGI E;  2GMI C;  2KX0 A;  1MI0 A;  1R4M I;  1MHX A;  3Q6B A;  1R7S A;  3V05 A;  5LLI A;  2KWU B;  4BKS D;  2Z0D B;  4CQN A;  2ZNV C;  3BK1 A;  4WH4 A;  4PS8 A;  1P9D U;  2FNJ B;  4WWP A;  1WXQ A;  2WDQ B;  3AB5 A;  4QAY A;  3Q8E A;  1QF6 A;  3WAL A;  1TZO A;  2REX A;  4GN1 A;  4UDU C;  2HJ1 A;  4W9C A;  2VH2 A;  1N5X A;  4RFB A;  1YNT E;  4C00 A;  3C0R B;  2IZV B;  3RNA C;  2L0T A;  4G0N B;  2IBI B;  3T3N A;  2WYQ A;  4GDL B;  1P7F A;  2ZVO A;  2LEK A;  4EUT A;  4LTU A;  3ZW3 A;  2JXT A;  3Q8F A;  4P7I A;  1X1M A;  4DQO C;  1WE6 A;  4BKG A;  2Q5W D;  1PFD A;  3H7P A;  1GJZ A;  2PTL A;  4HJK A;  2D07 B;  3IHP C;  4JL9 A; 
#chains in the Genus database with same CATH homology
 2FUG 1;  2RMM A;  3ETR A;  3W5V B;  1K52 A;  1ACC A;  2K0P A;  2WXL A;  3U4E G;  3TEW A;  1YN5 A;  2RDH A;  1IGD A;  3NVV A;  1EU4 A;  3NVY A;  4YTN B;  1SJH D;  2LUM A;  1TS5 A;  1ZP0 B;  1RM6 C;  3KQ4 A;  1SB3 C;  1XO3 A;  4XWW A;  3B2F A;  1EWY C;  3FAH A;  3RFZ B;  2MJ3 A;  5AUK A;  1HEZ E;  3PZ8 A;  1IGC A;  3W9C B;  1B1Z A;  4KX6 B;  2V0G A;  2WXO A;  3CIR B;  4HRS A;  4D2K A;  4USA A;  4ZRP A;  3BWU D;  4US9 A;  2ON8 A;  4ITK A;  4ZYS A;  2G9H D;  2V3N A;  4US8 A;  4L2Y A;  1TS2 A;  2WXJ A;  2PKO A;  2Y5P A;  3Q8B A;  4P16 A;  3GP7 A;  4NJC A;  4R3D A;  2B76 B;  3U2S C;  1XCQ L;  2N9L A;  2J53 A;  1L5P A;  2EEL A;  4KKJ A;  2I38 A;  1ENF A;  3VQI A;  1AW7 A;  3AV8 A;  2BS2 B;  2KAJ A;  1N60 A;  2PVO D;  2BTE A;  3BVM A;  1I4H A;  1A70 A;  1L4D B;  3NUH B;  4WAF A;  2IDY A;  5HHD G;  1BML C;  4B0M A;  4J3O D;  3TEY A;  1AYF A;  1FXA A;  1C79 A;  2L52 A;  2X38 A;  1V8C A;  2NMQ A;  1EM7 A;  3FIL A;  1FRD A;  2QIE B;  1KLU D;  2N7J A;  5EE3 A;  3P4R B;  1WGK A;  2PVG C;  2M0A A;  2KN4 A;  3BVG A;  2VZK B;  4MM3 B;  1VDV A;  4OZB A;  4WIP A;  2W82 A;  5G5H A;  2NTT A;  1UWM A;  3HVD A;  2DYM A;  5BMI A;  3AEF B;  3R8B A;  3OWE B;  2Z8L A;  2QIL A;  1I4Q A;  3AE8 B;  2XNA C;  2YEP F;  5D3D A;  3VR9 B;  5LNK 1;  1GB4 A;  2WXG A;  3IXS A;  3PZ7 A;  4EE2 A;  3P4S B;  4H2A A;  4OZC A;  2CJO A;  3AEC B;  4RGN A;  4A6Q A;  2Y5C A;  1WWT A;  1C4P A;  2AX5 A;  1I7H A;  2AQ2 B;  1ZXI A;  1FIQ A;  1UNS A;  1NEK B;  2K9X A;  2HTM E;  3ZJT A;  2KMM A;  3MP9 A;  2SEB D;  1V1P A;  1IBX A;  4RGM A;  2BB5 A;  3NS1 A;  4OHJ A;  1J7A A;  1FNV A;  2WP9 B;  4L23 A;  1OQR A;  3AE1 B;  3EGR A;  1QQR A;  4IKG A;  4LK0 M;  4WWM A;  2RPV A;  1T6B X;  1QOG A;  3NVZ A;  4YSY B;  1DOI A;  4TSS A;  4ARC A;  1FCL A;  1ET6 A;  2WQY B;  1D6E C;  2SAK A;  1UGJ A;  5JXV A;  3TEZ A;  2AQ3 B;  1NI3 A;  1K50 A;  3ZJU A;  3AEG B;  4C7Z A;  2LMC A;  1FD6 A;  5FR3 A;  3EA6 A;  2QMT A;  5BYR A;  4JWS C;  4DXF A;  1XF5 L;  2WLB A;  1GOZ A;  1N61 A;  2KWD A;  3IAM 1;  5BMG A;  3H8H A;  1XLQ A;  1BXT A;  1ROE A;  4P6V F;  5FK9 C;  1ZUD 2;  1CJE A;  1L0Y B;  2K22 A;  1EWC A;  3IT4 B;  4RF1 A;  1YQ3 B;  5BYQ A;  2QEJ C;  3W1S A;  1C9F A;  1JWB D;  1UWX A;  1VJK A;  4DXG A;  1XLP A;  3LYY A;  1L0V B;  4REZ A;  2DBY A;  2I2Y A;  2E6X A;  1JW9 D;  3SEB A;  3VRA B;  1SE2 A;  1TKG A;  2VZK D;  1EU3 A;  2LJI A;  1WRI A;  2OED A;  2OHF A;  3AEB B;  4C56 C;  2IJ0 A;  3Q69 A;  1VZ8 A;  3GS2 A;  4N58 A;  2EKI A;  1FRR A;  4A9A A;  3BZD B;  3MC0 B;  4RNA A;  3MJ5 A;  2WXN A;  2H88 B;  1D5M C;  1RFK A;  1I4R A;  3AED B;  1SIJ A;  2KDM A;  3IAS 1;  5G5G A;  3AE5 B;  4ZOH C;  1Y56 A;  1FO4 A;  5HG2 A;  4YXD B;  3V3X A;  3HUI A;  2PMV A;  4MAC A;  1SXT A;  2ZW0 A;  1KH0 A;  2LGI A;  3NZ3 A;  1QLB B;  2MH7 A;  1F77 A;  2WXK A;  2BS4 B;  2YEP B;  2WS3 B;  4N59 A;  3AEA B;  1ESF A;  2KQ4 X;  1RYJ A;  1QT9 A;  4JE3 B;  2WXR A;  4AQ7 A;  3E56 A;  3Q8A A;  1FM0 D;  1YJI A;  2W3S A;  1YN3 A;  2XN9 C;  3EUB 2;  2GB1 A;  2BBC A;  3URY A;  3LB8 C;  2W3R A;  1ZDX A;  2JX5 A;  1STE A;  2WXP A;  1FEH A;  2INP E;  2L1A A;  1N63 A;  3AMZ A;  2NTS A;  1YQ4 B;  1DGJ A;  1JRO A;  4XDD A;  3GB1 A;  3HVZ A;  4HJG E;  1VLB A;  2HDE A;  3KWV A;  4KGS A;  2FBW B;  4JX1 C;  3TSS A;  2BW2 A;  3SFD B;  1QOB A;  3UI3 A;  3AE7 B;  4PT5 A;  3SR6 A;  1JCK B;  1MVK A;  3MFG A;  5H92 C;  1FNW A;  1YN4 A;  1FNU A;  5EE9 A;  1JWU D;  2BT6 A;  2IGH A;  2BS3 B;  4LLG M;  5GXG B;  2GRI A;  1GPX A;  4KGT A;  4OW0 A;  1F2R C;  1TKY A;  1QIL A;  2PIA A;  2V3P A;  4IDI A;  4YSX B;  1MHH E;  1B9R A;  3AE6 B;  4HEA 1;  4RGT A;  1KRH A;  3BVZ A;  3AE4 B;  1TYG B;  4B0E A;  3W2D A;  1DOX A;  1GB1 A;  3B9J A;  1ZPS A;  1JWA D;  4FXC A;  1JWS D;  3P4P B;  4XDC A;  1AWD A;  4ZHO A;  4TQ0 A;  2J42 A;  4M0W A;  1SE3 A;  1C77 A;  3WCQ A;  5I4D A;  2CJN A;  4OVZ A;  5C3J B;  3B2G A;  1FFV A;  5H8Y E;  4MT5 A;  2QSD A;  2M19 A;  2AQ1 B;  4NZL B;  4A8X C;  3P1M A;  1NYR A;  3AN1 A;  2CU3 A;  1SE4 A;  1JRP A;  1J7C A;  3R2I A;  2JYE A;  1ZXH A;  1PGA A;  1SJE D;  4ZHP A;  3LXF A;  2N9K A;  1LO5 D;  1TY2 A;  3T3O A;  1C78 A;  1N62 A;  4KKI A;  2WNM A;  4C80 A;  1V1O A;  4ZRQ A;  1XEE A;  5HFY A;  1PYW D;  1QOF A;  3KWL A;  4JPS A;  3W5U B;  4HRO A;  1TJE A;  3AE3 B;  2JU6 X;  1E7P B;  1Q10 A;  5EE1 A;  4HKZ E;  1C76 A;  1DYQ A;  1JML A;  5FKA C;  4OZA A;  1JAL A;  1XLO A;  5D3I B;  4YTP B;  1I4P A;  1E0Z A;  1ET9 A;  3R2T A;  1QKZ A;  1OQQ A;  3AM9 A;  1SF0 A;  4MH8 A;  1HA5 A;  1NYQ A;  2ICI A;  4YTM B;  1V1P B;  1D5Z C;  2K3U A;  2JWU A;  1CQV A;  1VZ6 A;  2WDR B;  4WUR A;  4YWG G;  3ZGZ A;  4Q2J A;  3DWG C;  1T3Q A;  1VR9 A;  2INN E;  4ARI A;  1SBB B;  3MHZ A;  2DYO A;  1WYG A;  1F0Z A;  2JSV X;  1HQR D;  1I4G A;  3IT6 B;  3O13 A;  1ZE3 D;  1K51 A;  3BYT B;  4TQ1 A;  3ZQ4 A;  1N5W A;  2J4X A;  4C7Y A;  2WU2 B;  3J9C A;  2BYT A;  1TS3 A;  3AEE B;  4TMA B;  1C4A A;  5D7G A;  1KF6 B;  4L1B A;  1FFU A;  2JQR B;  3AH7 A;  3ZJV A;  1ZOY B;  3U52 E;  1HXY D;  1AN8 A;  2W54 A;  3E9S A;  4NAW B;  5HI1 A;  2N0S B;  1TY0 A;  2BB6 A;  2TSS A;  2H89 B;  2WXQ A;  2MJE A;  2IGG A;  3Q8C A;  2W55 A;  1XXG A;  1E9M A;  4RH6 A;  4XE0 A;  5TSS A;  1XLN A;  1PGX A;  3I9V 1;  3N9Y C;  3DWM A;  2MEK A;  1GAQ B;  2V4I B;  2DLB A;  2Y3A A;  2JYT A;  1D4B A;  4JWU C;  1SSN A;  1KFY B;  3TEX A;  1I4X A;  1MPE A;  4O1N A;  2JZP A;  2L32 A;  3L4P A;  3NVW A;  1RWS A;  1T5X D;  1NEN B;  2QJL A;  1L6V A;  1UUP A;  2R61 A;  3P63 A;  1FCC C;  2J52 A;  2WXH A;  2LHE A;  2KAC A;  3AE9 B;  3PO0 A;  4XWT A;  2D5G A;  2ZW1 A;  4A55 A;  4YSZ B;  1HZ6 A;  3CWI A;  5AUI A;  2LFI A;  2WXI A;  2RDG A;  1VRA B;  4WQM A;  1KLG D;  1PDX A;  1E10 A;  3FC4 A;  5MPO A;  4KGR A;  2WXF A;  2ONQ A;  2IGD A;  3P4Q B;  2MJD A;  4HKQ A;  1OFF A;  1KTK A;  1XCT L;  1YJJ A;  3NRZ A;  4GDK B;  5BMH A;  1IUE A;  1MI0 A;  1E6E B;  1MHX A;  5BYS A;  1R7S A;  3V05 A;  4CQN A;  3BK1 A;  3BYY B;  4WH4 A;  5T8I A;  2FE8 A;  1CZP A;  3FIL B;  1DOY A;  1WXQ A;  3P42 A;  3BK2 A;  2WDQ B;  3AB5 A;  1JQ4 A;  1JWM D;  1SEB D;  2PLP A;  1P7E A;  3Q8E A;  1QF6 A;  2WDV B;  3TUO A;  3C8Y A;  1FXI A;  1TZO A;  1HZ5 A;  4RGO S;  4UDU C;  1F2R I;  3BII D;  1FMA D;  3SFE B;  1L4Z B;  1ZDV A;  1TKE A;  4YT0 B;  1N5X A;  3ZYY X;  3KLS X;  1PGB A;  3AE2 B;  1L0X B;  1D5X C;  1VZ7 A;  4RFB A;  1WSP A;  4NAM A;  1K53 A;  1PUT A;  1YNT E;  2K5P A;  4A90 A;  1QOA A;  1YMH E;  4AS1 A;  2WU5 B;  4IOI E;  4GLS C;  1C4C A;  1M4V A;  2ACZ B;  3I57 A;  3T3N A;  2LHD A;  2DWQ A;  4GDL B;  1P7F A;  1L6U A;  2LEK A;  2GI9 A;  5C2T B;  3VRB B;  4LTU A;  3ABV B;  2M56 B;  1TS4 A;  2PW9 A;  2E3T A;  2WXM A;  4N6E B;  3U7Z A;  2L83 A;  2JXT A;  3HRD D;  3VR8 B;  1V97 A;  4RCO A;  3Q8F A;  5E6J A;  1IBX B;  1CK1 A;  5EE0 A;  1BUI C;  4DQO C;  3RPF C;  2Q5W D;  2G1E A;  2IPK D;  1PFD A;  4RF0 A;  2PTL A;  1NVI D;  1J7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...