1L6UA

Nmr structure of oxidized adrenodoxin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords Adrenodoxin 1
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6uA00
3AE7B 2MJEA 2W55A 4YTNB 3EUB2 1DGJA 2W3RA 4C7YA 3B2GA 2Q5WD 1DOIA 3CIRB 1PFDA 3P4RB 2MJDA 3ETRA 3ZYYX 2KMMA 3AH7A 1NEKB 5AUIA 1XLOA 3HVZA 1RM6C 2WLBA 1ZP0B 3AEAB 1JROA 3AE6B 3AECB 1NYQA 2K5PA 1GAQB 3WCQA 1EWYC 3SFDB 1FFUA 3AE4B 1QOBA 3BIID 5H8YE 1FXAA 3KWLA 2H88B 1XLPA 1CJEA 2QJLA 1JWAD 1E10A 1QOGA 1E6EB 1KRHA 1WXQA 5EE0A 1I7HA 2WP9B 5C2TB 4YXDB 1DOYA 1KF6B 4C80A 3AE2B 3AEBB 1WRIA 1RWSA 4ITKA 5G5GA 1E7PB 1N63A 5EE9A 1JRPA 5EE3A 2N0SB 3L4PA 1YQ3B 1RFKA 4YT0B 1NYRA 1L6VA 1PDXA 3NVWA 3AV8A 3SR6A 2BT6A 2B76B 3W5VB 3AMZA 4ZHOA 1VJKA 2CJNA 3AN1A 3VR8B 4YTMB 3PO0A 1PUTA 2MJ3A 1E0ZA 1AYFA 1FIQA 1XLNA 2E3TA 3P4SB 3P4QB 4N59A 4WQMA 4ZHPA 1NENB 1E9MA 1KFYB 1ROEA 1V8CA 1N61A 2M19A 1N5XA 1J7AA 1JW9D 3AE1B 3AEEB 2JX5A 3NS1A 3AB5A 4IDIA 1GPXA 2G1EA 3P63A 2DWQA 1J7BA 1A70A 2FBWB 1JALA 2PKOA 2WDRB 3DWMA 2PVOD 2WDQB 2W54A 3NVVA 3FC4A 4FXCA 2K22A 2L52A 1FFVA 4ZOHC 3AEFB 3RPFC 1OQQA 3P4PB 4C7ZA 1TKEA 5EE1A 3W5UB 1AWDA 1V97A 3LXFA 1YJJA 5AUKA 3VRAB 2L83A 1CZPA 3FAHA 1FXIA 1R7SA 1QLBB 2AX5A 1ZXIA 4HROA 1XLQA 1SIJA 1JWBD 3NVYA 2WS3B 5GXGB 1WWTA 1OFFA 3W9CB 1WYGA 4A9AA 2WDVB 2KAJA 1YJIA 1FM0D 3LB8C 3NRZA 3B2FA 1SF0A 1VDVA 1UWMA 1L5PA 4N58A 5G5HA 4JX1C 4US8A 1IUEA 1FMAD 2WQYB 2WU2B 2BS4B 1N62A 2HTME 2OHFA 2MH7A 4P6VF 5H92C 3SFEB 3VR9B 4HRSA 3AE3B 1TJEA 2QIEB 1ZOYB 4WWMA 3NVZA 2LEKA 3VRBB 3AE8B 1F0ZA 2BS2B 5MPOA 1WGKA 1FRRA 2DBYA 2JQRB 4JWSC 1RYJA 1N5WA 5C3JB 1OQRA 3P1MA 1N60A 1TYGB 2Y5CA 4YSXB 1B9RA 3AM9A 3CWIA 4YSYB 4JWUC 1SB3C 3DWGC 4US9A 4KX6B 1QF6A 3AE5B 2PVGC 3AEDB 3HUIA 3ABVB 1J7CA 4USAA 1ZUD2 1FO4A 1TKYA 1DOXA 2W3SA 3AE9B 1VLBA 3AEGB 3HRDD 2BS3B 1XO3A 2ACZB 2K9XA 4LTUA 4YTPB 2H89B 2WU5B 1T3QA 3B9JA 1QOAA 4N6EB 2M56B 1QT9A 2CJOA 2CU3A 1QOFA 1FRDA 2EKIA 2PIAA 1JQ4A 1NVID 1YQ4B 1L0VB 1NI3A 1TKGA 4YSZB 1L6UA
chains in the Genus database with same CATH superfamily
3CSTA 3A9KB 4GXBA 3R8BA 3WA0A 2NR2A 2V3PA 1HA5A 1JROA 2INPE 2FIDA 3BIID 4ZRJA 4EOYA 2H88B 3PS6A 4YL8A 4UDUC 3URYA 5D94A 1U4AA 2LVOA 3B1LX 3V60A 2BBCA 3QX1A 5EE9A 1YQ3B 3N9YC 2B3AA 4BVUC 1PDXA 1DYQA 2GI9A 4DXAB 1VJKA 2WX1A 2JZPA 1PUTA 1D4BA 3RN9C 3P4SB 2ONQA 2RMMA 1EF5A 2JRIB 4HVBA 1C4CA 3MHSD 3SDLC 2DWQA 1J7BA 2K39A 1JALA 2WXPA 3IFWB 4II2B 4DHJB 1HZ5A 4FJVB 1Q5WB 5HG2A 1KLVA 4CYEA 1JWMD 1L4ZB 4YWGG 2KX3A 4MT5A 3ZXVA 3W9CB 3BK1A 2QILA 2WU2B 4NAWB 2KDEB 3C8YA 1SSNA 2D5GA 3NVZA 4LNNA 1F0ZA 4AJYB 4K1RB 5C3JB 1N5WA 1ZXHA 3P1MA 1BT0A 2C7MB 2PVGC 3PRZA 3M3JA 4XDCA 1FCCC 3TSSA 1JCKB 4N6EB 1TZ1A 4BOSC 3L17A 4HCPB 5CTRC 5IO9A 4TMAB 3PVLA 1HTOA 1LQBA 2A5UA 4C7YA 3ZYYX 1E8ZA 1WXSA 3ETRA 1NEKB 2GMIC 3BYYB 4BFRA 4GU2A 1SE3A 3AECB 3PLVA 1GAQB 3VUWA 1E7VA 1TBEA 2BQQA 2KACA 3EC8A 3AE2B 3CF6E 1WMHA 2KVZA 4ITKA 3WAPA 5EE3A 1VCBA 5L95C 4C56C 3R3MA 1IP9A 1H8CA 3KWVA 3N20C 1EUVB 1YMHE 5DCNA 2VZKD 4LNOA 4N59A 4A6QA 2LI5A 4ZYNA 3H7PB 4RM9A 1WX8A 3UGBB 4KKIA 4BZAA 3DVGX 2K22A 2KTRA 4WJPA 4C7ZA 4GB9A 4WJQA 1C4PA 3DBHB 1V80A 3EGRA 1R7SA 2R61A 2O6VB 3C0RB 2AYOB 2KVRA 2DZJA 3H8HA 3ZNID 2MW5A 1IBXB 2WXRA 4C4VA 3BWUD 1WJNA 4P6VF 1OEYA 4S17A 4B9KA 4ARCA 4O1NA 2IGHA 3VRBB 1UGJA 4CO7A 1N60A 1XT9B 4NNJB 3Q8EA 3BVGA 3ZNZB 4IOIE 3UINB 1WZ3A 1Q10A 2KTFA 1FO4A 1FEHA 2WXGA 2NTTA 3HRDD 1SE4A 1VZ7A 2FCNA 2INNE 2LGDA 2QMTA 2CS4A 1V1PB 2LRWA 2M4NA 4XDDA 1L6UA 1WGHA 4DXGA 1DGJA 4W9LA 3P4RB 4RF0A 4WJOA 4GDLB 2IDYA 3QAQA 2OJRA 2WXLA 3T3OA 4FJZA 5BYRA 3SHQA 1L2NA 3QIJA 4XYCA 5AZFA 5E6OA 3V61A 2YVCA 1FFUA 4J6IA 4URKA 4GOCA 1E6EB 2PMVA 1WXQA 4MDKE 1WRIA 1HXYD 3MJ5A 4ZRKA 5FR3A 1TS4A 1L6VA 3AV8A 3IAS1 2QHOA 2KJ6A 3I9V1 4YTMB 4JPSA 5HKHA 1BUIC 1L0XB 3KYCD 1N61A 4LNIA 2ZCBA 3Q8AA 3HM6X 1WF9A 3Q6BA 4TSSA 5J17A 4NJ6A 2HE7A 1SEBD 2A4ZA 2I1KA 5DPTA 3RNBC 4NQLB 3U7ZA 4NY0A 4RF1A 3RNEC 2KAJA 4EE2A 2J4XA 3BZDB 1VDVA 3HM3A 4DQOC 2KX0A 1LGRA 2KD0A 4KSLC 3T3NA 2YEPB 3VTVA 3VTUA 1RYJA 4BKGA 1K50A 2PPHA 3QK0A 1SJHD 1C4AA 2RDBC 3AEGB 3MC9A 1MI0A 3TL5A 2IBIB 2LHEA 4K7UA 2KQ4X 3NHEB 2ICIA 4KIKA 4YSZB 2Y5PA 1V49A 1ZDVA 4HPLB 5T8IA 3AU4A 2N7JA 1DOIA 3W1YA 3AH7A 3FKYA 3APDA 2KDFB 2HDEA 3WCQA 5LXIB 3N3KB 1V1PA 1C9FA 3VH3B 1QOGA 1GC7A 3V6EB 3A9JB 2QEJC 5C2TB 3SD5A 2PEAA 5G5GA 2ZEQA 1TZOA 1JRPA 1YN5A 3L54A 2JZ3B 2BT6A 1WFYA 2N1WA 2VH1A 2MQJA 3U8ZA 3W1SA 3AN1A 1AYFA 3TEXA 2O6VA 4H2AA 1JW9D 3KVFB 4WWOA 2L76A 2JXXA 2W54A 2JF5A 3APFA 3FC4A 4ZOHC 1E8XA 2LGXA 2GBNA 2QCZA 2AQ2B 5JH5C 1GNUA 4ASWC 1QLBB 1GJZA 1QZEA 1TS2A 2LGIA 1EM7A 2GBRA 2FAZA 3ZW3A 4MSMB 4TQ0A 2DNFA 2DHZA 5LLIA 4R3DA 1WX9A 3R2IA 4EZKA 3S2AA 4I6NB 5JXVA 1WJ6A 1UWXA 4DHZE 2IY1B 2C9WB 2K0PA 1V1OA 1NBFC 4W9IA 1QF6A 3GZNB 1YQBA 1I4HA 2RD0A 1EU3A 1LM8B 4M8NA 3B9JA 1QOAA 4ZRIA 2NPTA 4KKJA 5C1ZA 3BVZA 4XX5A 5CHFA 3U30A 2IO2B 3U4EG 4W9GA 1ZPSA 2C60A 1V2YA 3AEAB 4TQ1A 4DXFA 1NYQA 1HZ6A 2RGFA 3GP7A 4EFOA 1MPEA 3MHZA 3VUXA 1SE9A 1Q1OA 1FCLA 2K3UA 4C80A 1IGDA 4EKUA 2RSUA 1TS3A 3WIMA 1JWUD 2KTRB 2REXA 3NVWA 2LHDA 3JYUA 3P4QB 2FCQA 3AI5A 3RD2A 2OOBB 1CK1A 4HXDA 2WXNA 1XXGA 4NJCA 2JX5A 1SBBB 2L0TA 1VD2A 4MACA 2RPQA 1SE2A 3I57A 3DHGC 3PZ8A 4AUQC 1WZ0A 2GLSA 1YNTE 5EE1A 4HKQA 1V97A 4PK1A 1FXIA 4GLSC 4TV3A 2DENB 3AULA 2MBQA 4LDTD 1IYFA 3QWZB 4WURA 4DDGD 2ZW1A 2KJRA 1ZKHA 2BYFA 3B2FA 2KNBA 3TJPA 4EEWA 1K53A 1UWMA 2FCMA 1KOTA 1WJ4A 3DOWA 4EZLA 3AE3B 1C1YB 1LO5D 3ZNGC 2DZMA 1FRRA 1YIWA 3VDZA 2WXHA 3ZTCA 4GGQA 4NAMA 3AEDB 4GDKB 2D11A 2HD5B 4RFBA 4ZDVA 3U2SC 4LTUA 4YTPB 5J2RA 5BYSA 1P1AA 3JW0X 4HJKA 3DHHC 3DBLB 3WALA 2ZZPB 2KMAA 3A1QA 2KC1A 3A9JA 1EO6A 3EUB2 4M0WA 4IM2A 1Y56A 4C4VB 4CQNA 1WM3A 4KGRA 3GE3C 1EF1A 2WX0A 2QJLA 1E10A 1KRHA 1NDDA 2WP9B 5GMVA 3A4RA 1ESFA 2IO0B 2KO3A 3SR6A 3T8MA 2ZVOA 4FA6A 2IYDB 3PTFC 4W9KA 5CX3A 1J7AA 2DYMA 3W1SC 1IPGA 2KN4A 2NBWB 1V5TA 1ET9A 4QAYA 1UGMA 2JY6A 3Q8FA 3ZKJC 4LJPB 1C76A 1TT5B 1YN3A 4HJGE 1PGAA 2MHJA 4AQ7A 3ML8A 3PLUA 2JWZA 3Q14C 1MHHE 3LB8C 2LUEA 2V3NA 3VVWB 4LK0M 5I4DA 1JRUA 1IUEA 1FMAD 2D3BA 1XEEA 3FILA 4RNAA 3BINA 2OHFA 1N62A 2KQSA 2LXAA 2FUG1 3V62A 3AE8B 4DWFA 2M0XA 4XGAB 1WE6A 1OQRA 1PGXA 1TYGB 3DBRI 4NZLB 5G55A 2JRHA 4XWWA 2LXCA 1V86A 2MP2A 3ZVVA 4BKSD 4B0EA 1ET6A 2H89B 2C7NB 2Y3AA 5C23A 4E3CA 1NVID 5AZHA 1UF0A 2KQ7A 4D2KA 3L16A 2N9XA 2W55A 4LNKA 3B2GA 2M8SA 2ZVNA 2MEKA 1SXTA 5AUIA 1XLOA 1P7FA 3M63B 3MFGA 3J9CA 2L32A 3O65B 2LRUA 4WIPA 1XLPA 4HK2A 3Q69A 2R2QA 2CR5A 4ANXA 5TSSA 3AEBB 3IHPC 4YT0B 5BO4B 2J7QB 3KLSX 2X8XX 3UQBA 2XBBC 4ZHOA 4G0NB 4KSKC 1QQRA 2V4LA 5D3IB 3QHTA 2SAKA 3ALBA 1VZ8A 4ZHPA 4PT5A 4KIKB 1Q0WB 4OHJA 3JVZX 3TBLD 2PKOA 5KHOA 4KDLB 3NVVA 4E71A 3VHTC 3RPFC 3IBEA 1M4VA 2X38A 2JUOA 2J52A 4LCDE 3ZDTA 2KOXA 2L83A 4WAAA 2LZ6A 3ECIA 4DHJD 1SIJA 3NVYA 1GOZA 2MCNB 4I6LB 1C77A 2DYOA 1FD6A 3M95A 2FUHB 2BWFA 2L7RA 4I6PA 2MH7A 1WGRA 1YX5B 2NS5A 2LJ5A 2MBHA 4PYZA 3IVFA 4YSYB 1SB3C 2EMTA 2VH2A 4RGMA 3RYTA 4B95A 2MRPA 1R4MB 1PYWD 1R4NB 2K8HA 2KXJA 2EMSA 5D7GA 2KFKB 2AQ1B 4GMVA 5BMGA 1QOFA 1FRDA 3ML9A 2MX2A 3OG5A 1T0RC 1PGBA 1NI3A 2BYTA 3M62B 2PE6B 2LD9A 4HPMB 3EHVA 5J18A 2MP2B 1K51A 2BKRB 3HVZA 4ANVA 2WLBA 3OAWA 4NAWA 1EU4A 5LNK1 1RAXA 1ZGUB 5HHDG 1QOBA 4G11A 4MELA 2QC8A 4W9EA 1WRDB 4ACFA 1OQYA 1IBXA 3MP9A 3N1YC 2LWPA 1N6ZA 1WM2A 4MGZE 4WH4A 1FXTB 2K6QA 4DK5A 3BYTB 3NZSA 1FNUA 1T6BX 2NPTB 1L7YA 1NENB 3VUYA 1TGZB 3P63A 2WDRB 2WDQB 3QC8B 3FILB 2L52A 1FFVA 3AEFB 2ASQA 5AUKA 2XEWA 4BAXA 4A8XC 2WXOA 5JHAA 4OW0A 5AZGA 4IKGA 4IC7B 2N9LA 2FIFA 2WS3B 1L4DB 2BTEA 1QILA 3ZQ4A 4WWPA 1L5PA 3RMKC 2BS4B 2N9PC 3O13A 4HRSA 1TJEA 1ZOYB 4PYUA 3GE8C 2J0JA 3CMMB 4WWNA 4JWSC 1B9RA 4HCNB 4GN1A 1KJTA 4L2YA 4KV2A 2KLGA 4KX6B 1S3SG 4GDLA 2WWZA 2BYVE 2OEDA 3HVDA 1F2RI 3A33B 3UF8A 4BBNF 3TIXA 1V9JA 1YOVB 2KK8A 4JQWC 4P1BC 2N1VA 2KHWB 1C3TA 1F52A 2G9HD 1UUPA 1LXDA 3L10B 2J0MA 1P98A 4KVGB 1WXAA 1PQSA 3DBHI 2OJWA 3PHWB 3DCGA 1WXMA 5G2NA 2PE9A 2O2VA 4ICUA 5DPRA 3BVMA 1DOYA 2GB1A 1RWSA 5DPWA 1N63A 2KDMA 3RZFA 2BW2A 3ZDMC 2EELA 4OVUA 1XF5L 5E6PA 4AWJA 1FIQA 4WQMA 1X1MA 2I2YA 3PZDA 3ZLZA 5L83A 2DZKA 3Q3MC 4NQKE 3MC0B 2MWSB 1OQQA 4LLGM 1FPYA 4M8MA 1AWDA 3VH4B 4HROA 3TMPB 3WAMA 2KYWA 2WDVB 3PRPB 1F77A 4FADA 5LXHA 4N58A 4JX1C 2MBEA 2WDTB 2IPKD 3SFEB 3EECA 2JVCA 3UQAA 2PW9A 4WQOB 3PPAA 4MEMA 2LEKA 3NY5A 1F1HA 2JQRB 1I42A 1D5XC 2Y5CA 2VRRB 4A20A 4USAA 1MFWA 1DOXA 3HIZA 2R2OA 2RDGA 1WH3A 2CKHB 1XO3A 2WU5B 2CU3A 2KLCA 4HWIB 2I1JA 4M02A 2WXJA 1L0VB 4B6WA 2J53A 1KLUD 3B08A 2WXMA 4BBNC 2LJIA 1PFDA 1VRAB 3K9PB 3NOBA 3ZRCA 3TEWA 1P3QU 1UNSA 3VAWA 1GB4A 3QA8A 3MC8A 2WYQA 2AEHA 3AE4B 1FXAA 1JWAD 3Q8CA 1EWCA 2O6VD 2WHIA 2N0SB 2KDBA 3L4PA 3R7QA 1NYRA 3NG0A 4WJNA 1WY8A 2DLBA 3VR8B 2L3ZA 1E0ZA 2E3TA 3K9OB 2JZZA 4IM0A 1KFYB 2O2VB 3NJTA 1S1QB 1A70A 4A3PA 3Q3NC 4IWPA 3P4PB 4KGSA 1BMLC 2HJ8A 2ON8A 3DBLI 3VRAB 2ZJDA 1JMLA 4MGKE 1AARA 2MBBB 3PRMB 3RT3B 3LDZE 3RNCC 4KZ0A 1WGGA 4MH0E 5GXGB 1WWTA 2BVCA 3ZXRA 3TCAA 2PLPA 4A3OA 1MHXA 2C5LC 1I4QA 5CHVC 3X23A 2W82A 4CHKA 2L0FA 2NCNA 4JWUC 4MH8A 1OGWA 4US9A 3RULA 1CQVA 2BYEA 4TKNA 1D5MC 2W3SA 4JL9A 1I4RA 2AL6A 2Z8LA 3DBRB 4XWTA 3IT6B 4II3B 1P0RA 2L00B 3RFZB 1D5ZC 3H9DA 3LYYA 1H4RA 2RDHA 3H1UA 3UIOB 2GOWA 1WSPA 3CIRB 2MJDA 3B0AA 4MGIE 1V6EA 2XN9C 5E6JA 2N7DA 2ZPNA 1ZP0B 1ISNA 2J42A 2DZIA 3E9SA 1ENFA 3V6CB 4W9HA 2XNAC 1I7HA 4PS7A 1RRBA 2TSSA 4W9JA 4JE3B 1C79A 3PREA 5HI1A 2HJ1A 2LFIA 2L05A 2B76B 1D3ZA 3T9LA 4ANUA 5BMIA 2M19A 4RM8A 3KQ4A 4AJWA 2C7HA 3ZGZA 3H7SA 4HPPA 4KDIC 1RFAA 5BMHA 2D3CA 3N1XC 3UI3A 4B0MA 2KZRA 1YD8U 2G4DB 4C00A 5EDSA 1XCQL 3I5JC 2BGFA 3L08A 1XLQA 2ZPYA 3NRZA 1TY0A 1SF0A 1TS5A 2G4SA 2E6XA 3IXSA 2HTME 4NJ7A 4EZJA 3HHMA 1WGKA 4HDOA 2DBYA 2WXQA 4MJSB 2PTLA 4OZAA 1K52A 3OJ3A 1E7UA 1CMXB 4NPNA 2QSDA 2Z0EB 2NVUI 4RGOS 1XD3B 1QT9A 2PJHA 3C19A 4FHKA 1AW7A 2JPHA 1MVKA 3QCAA 4P1CC 4FJYA 1I35A 3MJWA 4P16A 2XK5A 5JZEB 2Q5WD 5E6NA 4AP4C 2KWUB 2AWTA 4DDID 4W9DA 1Z5SB 1T0QC 1E90A 1EWYC 4WAFA 4RMAA 3ZUNA 3OWEB 4L23A 2JYTA 3MTNB 2KANA 2D3GA 3NZUA 3PO0A 4BKSA 1XLNA 2KN5A 3CSFA 3U7DA 3AEEB 3NS1A 3AB5A 1I4PA 4HDQA 2WXFA 3UIPB 3JSVA 1NI2A 2PVOD 4OZCA 3DQVA 1WI0A 2BB6A 2KWVB 4HEA1 2AX5A 2INCC 2BPSA 1VR9A 1OFFA 1WYGA 1FM0D 3QQ8B 4RGNA 1OEYJ 3PHXB 2NTSA 4MM3A 1GB1A 3WANA 5IKCM 1UELA 2ZCCA 5D3DA 1MJDA 1UH6A 5D2MB 3DWGC 3KUCB 3R7RA 2G45B 1MG4A 1GC6A 1TY2A 5FK9C 1J7CA 3GB1A 2G3QB 1ZUD2 1VZ6A 3R2TA 3ZJTA 4ZRQA 1T3QA 3N30A 2D3AA 4XE0A 1JQ4A 1YQ4B 4MJSA 4M01A 1WXVA 2W3RA 3ONSA 1FNVA 1ACCA 1OTRB 3DDCB 4K81A 1UBIA 1C78A 1TIFA 4ICVA 1HQRD 1M94A 4EUTA 3KWLA 3RCZA 3X0WA 4LDTB 1T0YA 1SGHA 4BKTA 2M0AA 4GDKA 2JU6X 1E8WA 4IG7B 1G6JA 2HTHA 3KH0A 1P7EA 2IJ0A 3HK0A 3PZ7A 2DX5B 3IT4B 1E9MA 1E8YA 2YLMA 3AE1B 4IDIA 4G3XB 1TTNA 5FKAC 3KUZA 4BOZB 4FXCA 4IWOA 1T5XD 2LVQA 2K6DB 1HEZE 1WGYA 2ZNVC 3NUHB 1ZXIA 4XZ4A 1HTQA 2CHXA 3A9KA 4A90A 3JSVB 3LJ3A 5KHQA 1KM7A 1AN8A 4OZBA 3OLMD 2FE8A 1FNWA 2IZVB 4K7SA 5MPOA 4LJOB 3H6NA 3CWIA 1UBQA 4J3OD 3SU8X 3V05A 1WGDA 1TKYA 3ZTDA 3GZNI 2BS3B 3EA6A 1E5WA 1BXTA 2N9EB 4OVVA 3DVNU 3TUOA 3A4SC 3E56A 2EKEC 4N9F4 1SIFA 3VFKA 2GBJA 2MJEA 4ANWA 3P42A 2NBUA 1UZXB 3NZ3A 2N9KA 3ZRFA 3P2BA 2N7EA 3I3TB 2I38A 4FBJB 2WXIA 4AS1A 1YJ1A 2MLBA 2MBOA 5JHBA 3ENEA 2LGYA 3ZJUA 3N1ZC 2JXTA 1IGCA 4AOFA 3W5VB 3BY4B 2M17A 4HKZE 4W9FA 4XC2A 3DVGY 3L13A 2M1MA 1V8CA 5HFYA 3RZWC 1LFDA 2GBMA 1J8CA 1GPXA 2G1EA 1WX7A 4KZCA 4P7IA 5BYQA 2FBWB 3Q3JA 4MM3B 1F9JA 4F1SA 3Q8BA 1Z2MA 1B1ZA 1Y8RC 3W5UB 5IP4D 1YJJA 1WR1A 3OJ4B 2CHZA 3FAHA 3APCA 3Q3OC 2KT7A 3QARA 2GBKA 3RI7C 3V3XA 4IW0A 5IAAC 3KYDD 4A9AA 1YJIA 3I63C 2INDC 2RPVA 1K8RB 2Z59B 2DYBA 4TUUA 2KC2A 3AU5A 4US8A 2KFJA 4RCOA 4GIVA 3VR9B 1HE8A 2AL3A 4S0RA 3PGEA 3DHIC 4HLEA 2BS2B 2DAJA 1J0GA 3AM9A 1R4MI 4MSQB 2L1AA 2ZNVB 3KW5B 4JIOU 3KUDB 3AE5B 4JLCA 1R4NI 1WMHB 3RUIB 3QJZA 4RH6A 2D10A 2XK5B 5IN7A 3VQIA 2JSVX 3PSEB 2KJHB 3U52E 1VLBA 5IA7A 2UU7A 2WXKA 2NBVB 3GOEA 1XCTL 2WNMA 4FHJA 1WR6E 3TEYA 3DBSA 3AXCA 3VTWA 1V5OA 3H7PA 1TKGA 2WGSA 5AEKB 1SJED 2V3SA 5DPSA 1T0SC 2KDIA 4YTNB 4K3CA 2Y5BB 3ZNHB 2IO3B 4F8CB 2V1YA 1QKZA 2LVPA 1RM6C 2V0GA 3W2DA 2K5PA 3PV1A 3SFDB 5H8YE 4YXDB 1CJEA 3ZIMA 1WE7A 2JYEA 5TR5A 2IGGA 1MG8A 5FR6A 3L0WB 2K1FA 4W9CA 1ZW7A 2LUMA 2CJNA 3WAOA 1YN4A 2KFKA 2BB5A 2MJ3A 4Q2JA 1KTKA 4FLHA 5IOIA 1ROEA 3R66C 1N5XA 1UD7A 2LASA 2IGDA 3EFCA 4K3BA 3IG3A 2K8CA 3DWMA 4ZYSA 2KWDA 1TKEA 4FN2A 1CZPA 4ZRPA 2KWCA 3A1QB 4KGTA 2W9NA 5D6JB 4M0WB 1A5RA 2JWUA 3Q3FA 4G50A 1KLGD 4DHZB 2CU1A 4X57B 5CHWA 4OVZA 3GS2A 5H92C 4A55A 1KH0A 1I4GA 2D07B 3EFUA 1V81A 2ZW0A 4PS8A 2FNJB 4M00A 4PS3A 2NMQA 3ABVB 3NS8A 4REZA 2J0KA 3ZJVA 2N4FA 1JWSD 2KMCA 2M56B 2CJOA 2EKIA 2JT4B 2L8JA 2PIAA 3IAM1 4ARIA 4IWQA 1WIAA 1I4XA 2KKCA 3AE7B 1D6EC 4GSWA 2V9HA 2UWQA 2BWES 2KMMA 3SEBA 1STEA 2K25A 4LNFA 2AQ3B 3AE6B 3D32A 2MA9B 4RGTA 4E74A 5EE0A 2VZKB 1KF6B 1RLFA 2D2QA 1E7PB 1RFKA 3N32A 1J19A 4IUMB 3ZO5B 1F2RC 2UYZB 3AMZA 4K7WA 3DPDA 3DVNV 2IO1B 3RNAC 2BKFA 3RNGC 2Z0DB 4MGYE 2MSED 1GG3A 1ZDXA 2QDFA 2LGSA 4JGHB 3LXFA 2YEPF 1JWBD 1XQQA 4FULA 4L1BA 5G5HA 2LMCA 1GUAB 2WQYB 4IM3A 2QIEB 2K8BA 2V4IB 4WWMA 3Q2AC 1WJUA 3TEZA 3RNFC 4YSXB 2SEBD 2RR9A 1L0YB 2BF8B 3HUIA 2CHWA 2FCSA 1YX6B 3AE9B 3BK2A 4F7ZA 2ACZB 2K9XA 2DAFA 1WYWB 3PT2B 2IY0B 3VXWA 2GRIA 4DBGA 1ZE3D 1P9DU
chains in the Genus database with same CATH topology
2W3RA 1FNVA 2G9HD 1ACCA 1UUPA 3U4EG 3R8BA 1C78A 1ZPSA 2V3PA 1HA5A 3AEAB 1JROA 4TQ1A 1HQRD 2INPE 4DXFA 1NYQA 1HZ6A 3GP7A 3BIID 3KWLA 2H88B 1MPEA 3MHZA 4UDUC 3URYA 1FCLA 3BVMA 1DOYA 2GB1A 2K3UA 4C80A 1IGDA 2M0AA 2BBCA 1RWSA 1N63A 5EE9A 1TS3A 2JU6X 2KDMA 1YQ3B 3N9YC 1JWUD 1PDXA 3NVWA 2BW2A 1DYQA 2EELA 1P7EA 2GI9A 2LHDA 1VJKA 2JZPA 1XF5L 1PUTA 2IJ0A 1D4BA 3P4QB 1FIQA 3P4SB 4WQMA 2ONQA 3PZ7A 1CK1A 2RMMA 2WXNA 1XXGA 3IT4B 1E9MA 4NJCA 2I2YA 3AE1B 4IDIA 2JX5A 1SBBB 1C4CA 2DWQA 1J7BA 1JALA 4MACA 5FKAC 2WXPA 4FXCA 1SE2A 3I57A 1HZ5A 3PZ8A 1T5XD 3MC0B 5HG2A 1OQQA 4LLGM 1YNTE 5EE1A 4HKQA 1AWDA 1HEZE 1V97A 1JWMD 3NUHB 1FXIA 4GLSC 1L4ZB 4YWGG 1ZXIA 4HROA 4MT5A 3W9CB 2WDVB 3BK1A 4WURA 2ZW1A 1F77A 3B2FA 4A90A 1K53A 1UWMA 2QILA 4N58A 4JX1C 2WU2B 1AN8A 4NAWB 2IPKD 3C8YA 4OZBA 3SFEB 1SSNA 2FE8A 2PW9A 2D5GA 3AE3B 1FNWA 1LO5D 2LEKA 3NVZA 1F0ZA 5MPOA 1FRRA 2JQRB 5C3JB 1N5WA 1ZXHA 3P1MA 2WXHA 1D5XC 2Y5CA 3CWIA 4J3OD 4NAMA 3AEDB 2PVGC 4GDKB 4RFBA 3V05A 4USAA 1DOXA 1TKYA 2RDGA 4XDCA 1FCCC 3U2SC 3TSSA 2BS3B 1XO3A 3EA6A 4LTUA 4YTPB 1JCKB 2WU5B 4N6EB 5BYSA 1BXTA 2CU3A 3TUOA 3E56A 2WXJA 1L0VB 2J53A 4TMAB 1KLUD 2MJEA 3EUB2 3P42A 2WXMA 4M0WA 4C7YA 2LJIA 3ZYYX 1PFDA 1VRAB 2N9KA 3ETRA 3NZ3A 1Y56A 1NEKB 1UNSA 3TEWA 1GB4A 3BYYB 4CQNA 1SE3A 3AECB 4KGRA 1GAQB 2I38A 2WXIA 4AS1A 3AE4B 1FXAA 2QJLA 2KACA 1JWAD 1E10A 1KRHA 2WP9B 3Q8CA 1EWCA 3AE2B 4ITKA 1ESFA 5EE3A 2N0SB 3L4PA 3ZJUA 1NYRA 4C56C 2JXTA 3SR6A 1IGCA 3KWVA 3W5VB 2DLBA 1YMHE 3VR8B 4HKZE 1E0ZA 2E3TA 2VZKD 4N59A 4A6QA 1KFYB 1V8CA 1J7AA 2DYMA 5HFYA 1GPXA 2G1EA 2KN4A 5BYQA 1A70A 2FBWB 4MM3B 4KKIA 1ET9A 3Q8BA 2K22A 3Q8FA 1B1ZA 3P4PB 1C76A 4KGSA 4C7ZA 3W5UB 1BMLC 2ON8A 1YJJA 3VRAB 1C4PA 1YN3A 1JMLA 3FAHA 4HJGE 3EGRA 1R7SA 1PGAA 2R61A 4AQ7A 5GXGB 1WWTA 3V3XA 4A9AA 1MHHE 1YJIA 2V3NA 3H8HA 3LB8C 2RPVA 2PLPA 1IBXB 2WXRA 4LK0M 5I4DA 1MHXA 4US8A 1IUEA 1FMAD 3BWUD 1XEEA 3FILA 4RCOA 4RNAA 1I4QA 2OHFA 1N62A 4P6VF 3VR9B 4ARCA 2FUG1 4O1NA 2W82A 2IGHA 3AE8B 1UGJA 2BS2B 3VRBB 1OQRA 1N60A 1PGXA 1TYGB 4NZLB 3AM9A 2L1AA 4JWUC 4MH8A 4US9A 3Q8EA 4XWWA 3AE5B 3BVGA 4IOIE 1CQVA 4RH6A 1Q10A 1D5MC 2JSVX 3VQIA 1FO4A 2W3SA 3U52E 1VLBA 4B0EA 2WXKA 1FEHA 1I4RA 2NTTA 2WXGA 3HRDD 1XCTL 1ET6A 2H89B 1SE4A 1VZ7A 2WNMA 2Y3AA 2INNE 2Z8LA 2QMTA 1NVID 4XWTA 3TEYA 1V1PB 3IT6B 3RFZB 1TKGA 4XDDA 4D2KA 1L6UA 4DXGA 1SJED 1D5ZC 2W55A 3LYYA 4YTNB 1DGJA 2RDHA 1WSPA 3B2GA 3P4RB 4RF0A 3CIRB 2MEKA 1SXTA 2MJDA 4GDLB 2IDYA 1QKZA 2WXLA 2XN9C 5AUIA 1XLOA 3T3OA 5E6JA 1P7FA 1RM6C 5BYRA 2V0GA 1ZP0B 3MFGA 2J42A 3W2DA 3J9CA 2L32A 3E9SA 1ENFA 2K5PA 3SFDB 1FFUA 4WIPA 5H8YE 4YXDB 1XLPA 1CJEA 2XNAC 3Q69A 1E6EB 2PMVA 1WXQA 1I7HA 2JYEA 2IGGA 5TSSA 3AEBB 1WRIA 2TSSA 1HXYD 4JE3B 3MJ5A 1C79A 4YT0B 5FR3A 1TS4A 5HI1A 1L6VA 2LFIA 3AV8A 3IAS1 2B76B 3KLSX 2LUMA 3I9V1 2CJNA 4ZHOA 1YN4A 4YTMB 2BB5A 2MJ3A 1QQRA 4Q2JA 5D3IB 4JPSA 2SAKA 1KTKA 1VZ8A 1BUIC 1L0XB 4ZHPA 4PT5A 5BMIA 1ROEA 1N61A 2M19A 1N5XA 3KQ4A 3ZGZA 3Q8AA 2IGDA 4OHJA 2PKOA 5BMHA 3DWMA 4TSSA 3NVVA 4ZYSA 2KWDA 3RPFC 3UI3A 1M4VA 4B0MA 1SEBD 2X38A 1TKEA 2J52A 2L83A 1CZPA 1XCQL 4ZRPA 1XLQA 1SIJA 4KGTA 3NVYA 1GOZA 3U7ZA 4RF1A 2KAJA 3NRZA 4EE2A 2J4XA 1C77A 2DYOA 2JWUA 3BZDB 1FD6A 1TY0A 1SF0A 1TS5A 1VDVA 4DQOC 2E6XA 3IXSA 1KLGD 2HTME 3GS2A 4OVZA 2MH7A 5H92C 4A55A 3T3NA 1KH0A 2YEPB 1WGKA 2DBYA 1RYJA 1I4GA 2WXQA 2ZW0A 1K50A 2PTLA 4YSYB 1SB3C 4OZAA 2NMQA 1K52A 1SJHD 1C4AA 3ABVB 4RGMA 2QSDA 3AEGB 1PYWD 4REZA 1MI0A 4RGOS 3ZJVA 1JWSD 5D7GA 2AQ1B 5BMGA 2M56B 1QT9A 2CJOA 2EKIA 1QOFA 1FRDA 2LHEA 2PIAA 1AW7A 3IAM1 2KQ4X 1MVKA 4ARIA 2ICIA 1PGBA 1NI3A 2BYTA 4YSZB 1I4XA 2Y5PA 3AE7B 4P16A 1D6EC 1ZDVA 5T8IA 2N7JA 2Q5WD 1DOIA 2KMMA 3SEBA 1K51A 1STEA 3AH7A 3HVZA 2WLBA 2AQ3B 3AE6B 1EU4A 5LNK1 2HDEA 5HHDG 3WCQA 1EWYC 4RGTA 4WAFA 1QOBA 1V1PA 1C9FA 1QOGA 5EE0A 2VZKB 2QEJC 3OWEB 4L23A 5C2TB 1KF6B 1IBXA 2JYTA 3MP9A 5G5GA 1E7PB 1TZOA 1JRPA 1YN5A 1RFKA 4WH4A 2BT6A 1F2RC 3AMZA 3BYTB 3W1SA 3AN1A 1FNUA 3PO0A 1AYFA 1T6BX 1XLNA 3TEXA 1NENB 3AEEB 4H2AA 1JW9D 3NS1A 3AB5A 1I4PA 3P63A 2WXFA 1ZDXA 2WDRB 2PVOD 2WDQB 2W54A 3FC4A 3FILB 2L52A 1FFVA 4ZOHC 3AEFB 4OZCA 2BB6A 3LXFA 5AUKA 4A8XC 4HEA1 2AQ2B 2WXOA 2YEPF 4OW0A 1QLBB 2AX5A 4IKGA 1VR9A 1JWBD 2N9LA 2WS3B 1OFFA 1L4DB 2BTEA 1WYGA 1QILA 1FM0D 1TS2A 2LGIA 1EM7A 4RGNA 3ZQ4A 2NTSA 4L1BA 1L5PA 5G5HA 1GB1A 2LMCA 2WQYB 4TQ0A 2BS4B 3O13A 4HRSA 4R3DA 1TJEA 2QIEB 1ZOYB 2V4IB 3R2IA 4WWMA 5D3DA 4JWSC 5JXVA 3TEZA 1UWXA 4YSXB 2SEBD 1B9RA 2K0PA 4L2YA 3DWGC 1L0YB 1V1OA 4KX6B 1QF6A 3HUIA 1TY2A 5FK9C 1J7CA 3GB1A 1ZUD2 1VZ6A 1I4HA 3R2TA 3AE9B 2OEDA 3BK2A 3ZJTA 1EU3A 2ACZB 2K9XA 1F2RI 3HVDA 4ZRQA 1T3QA 3B9JA 1QOAA 4XE0A 1JQ4A 1YQ4B 2GRIA 4KKJA 3BVZA 1ZE3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE7 B;  2MJE A;  2W55 A;  4YTN B;  3EUB 2;  1DGJ A;  2W3R A;  4C7Y A;  3B2G A;  2Q5W D;  1DOI A;  3CIR B;  1PFD A;  3P4R B;  2MJD A;  3ETR A;  3ZYY X;  2KMM A;  3AH7 A;  1NEK B;  5AUI A;  1XLO A;  3HVZ A;  1RM6 C;  2WLB A;  1ZP0 B;  3AEA B;  1JRO A;  3AE6 B;  3AEC B;  1NYQ A;  2K5P A;  1GAQ B;  3WCQ A;  1EWY C;  3SFD B;  1FFU A;  3AE4 B;  1QOB A;  3BII D;  5H8Y E;  1FXA A;  3KWL A;  2H88 B;  1XLP A;  1CJE A;  2QJL A;  1JWA D;  1E10 A;  1QOG A;  1E6E B;  1KRH A;  1WXQ A;  5EE0 A;  1I7H A;  2WP9 B;  5C2T B;  4YXD B;  1DOY A;  1KF6 B;  4C80 A;  3AE2 B;  3AEB B;  1WRI A;  1RWS A;  4ITK A;  5G5G A;  1E7P B;  1N63 A;  5EE9 A;  1JRP A;  5EE3 A;  2N0S B;  3L4P A;  1YQ3 B;  1RFK A;  4YT0 B;  1NYR A;  1L6V A;  1PDX A;  3NVW A;  3AV8 A;  3SR6 A;  2BT6 A;  2B76 B;  3W5V B;  3AMZ A;  4ZHO A;  1VJK A;  2CJN A;  3AN1 A;  3VR8 B;  4YTM B;  3PO0 A;  1PUT A;  2MJ3 A;  1E0Z A;  1AYF A;  1FIQ A;  1XLN A;  2E3T A;  3P4S B;  3P4Q B;  4N59 A;  4WQM A;  4ZHP A;  1NEN B;  1E9M A;  1KFY B;  1ROE A;  1V8C A;  1N61 A;  2M19 A;  1N5X A;  1J7A A;  1JW9 D;  3AE1 B;  3AEE B;  2JX5 A;  3NS1 A;  3AB5 A;  4IDI A;  1GPX A;  2G1E A;  3P63 A;  2DWQ A;  1J7B A;  1A70 A;  2FBW B;  1JAL A;  2PKO A;  2WDR B;  3DWM A;  2PVO D;  2WDQ B;  2W54 A;  3NVV A;  3FC4 A;  4FXC A;  2K22 A;  2L52 A;  1FFV A;  4ZOH C;  3AEF B;  3RPF C;  1OQQ A;  3P4P B;  4C7Z A;  1TKE A;  5EE1 A;  3W5U B;  1AWD A;  1V97 A;  3LXF A;  1YJJ A;  5AUK A;  3VRA B;  2L83 A;  1CZP A;  3FAH A;  1FXI A;  1R7S A;  1QLB B;  2AX5 A;  1ZXI A;  4HRO A;  1XLQ A;  1SIJ A;  1JWB D;  3NVY A;  2WS3 B;  5GXG B;  1WWT A;  1OFF A;  3W9C B;  1WYG A;  4A9A A;  2WDV B;  2KAJ A;  1YJI A;  1FM0 D;  3LB8 C;  3NRZ A;  3B2F A;  1SF0 A;  1VDV A;  1UWM A;  1L5P A;  4N58 A;  5G5H A;  4JX1 C;  4US8 A;  1IUE A;  1FMA D;  2WQY B;  2WU2 B;  2BS4 B;  1N62 A;  2HTM E;  2OHF A;  2MH7 A;  4P6V F;  5H92 C;  3SFE B;  3VR9 B;  4HRS A;  3AE3 B;  1TJE A;  2QIE B;  1ZOY B;  4WWM A;  3NVZ A;  2LEK A;  3VRB B;  3AE8 B;  1F0Z A;  2BS2 B;  5MPO A;  1WGK A;  1FRR A;  2DBY A;  2JQR B;  4JWS C;  1RYJ A;  1N5W A;  5C3J B;  1OQR A;  3P1M A;  1N60 A;  1TYG B;  2Y5C A;  4YSX B;  1B9R A;  3AM9 A;  3CWI A;  4YSY B;  4JWU C;  1SB3 C;  3DWG C;  4US9 A;  4KX6 B;  1QF6 A;  3AE5 B;  2PVG C;  3AED B;  3HUI A;  3ABV B;  1J7C A;  4USA A;  1ZUD 2;  1FO4 A;  1TKY A;  1DOX A;  2W3S A;  3AE9 B;  1VLB A;  3AEG B;  3HRD D;  2BS3 B;  1XO3 A;  2ACZ B;  2K9X A;  4LTU A;  4YTP B;  2H89 B;  2WU5 B;  1T3Q A;  3B9J A;  1QOA A;  4N6E B;  2M56 B;  1QT9 A;  2CJO A;  2CU3 A;  1QOF A;  1FRD A;  2EKI A;  2PIA A;  1JQ4 A;  1NVI D;  1YQ4 B;  1L0V B;  1NI3 A;  1TKG A;  4YSZ B;  1L6U A; 
#chains in the Genus database with same CATH topology
 3CST A;  3A9K B;  4GXB A;  3R8B A;  3WA0 A;  2NR2 A;  2V3P A;  1HA5 A;  1JRO A;  2INP E;  2FID A;  3BII D;  4ZRJ A;  4EOY A;  2H88 B;  3PS6 A;  4YL8 A;  4UDU C;  3URY A;  5D94 A;  1U4A A;  2LVO A;  3B1L X;  3V60 A;  2BBC A;  3QX1 A;  5EE9 A;  1YQ3 B;  3N9Y C;  2B3A A;  4BVU C;  1PDX A;  1DYQ A;  2GI9 A;  4DXA B;  1VJK A;  2WX1 A;  2JZP A;  1PUT A;  1D4B A;  3RN9 C;  3P4S B;  2ONQ A;  2RMM A;  1EF5 A;  2JRI B;  4HVB A;  1C4C A;  3MHS D;  3SDL C;  2DWQ A;  1J7B A;  2K39 A;  1JAL A;  2WXP A;  3IFW B;  4II2 B;  4DHJ B;  1HZ5 A;  4FJV B;  1Q5W B;  5HG2 A;  1KLV A;  4CYE A;  1JWM D;  1L4Z B;  4YWG G;  2KX3 A;  4MT5 A;  3ZXV A;  3W9C B;  3BK1 A;  2QIL A;  2WU2 B;  4NAW B;  2KDE B;  3C8Y A;  1SSN A;  2D5G A;  3NVZ A;  4LNN A;  1F0Z A;  4AJY B;  4K1R B;  5C3J B;  1N5W A;  1ZXH A;  3P1M A;  1BT0 A;  2C7M B;  2PVG C;  3PRZ A;  3M3J A;  4XDC A;  1FCC C;  3TSS A;  1JCK B;  4N6E B;  1TZ1 A;  4BOS C;  3L17 A;  4HCP B;  5CTR C;  5IO9 A;  4TMA B;  3PVL A;  1HTO A;  1LQB A;  2A5U A;  4C7Y A;  3ZYY X;  1E8Z A;  1WXS A;  3ETR A;  1NEK B;  2GMI C;  3BYY B;  4BFR A;  4GU2 A;  1SE3 A;  3AEC B;  3PLV A;  1GAQ B;  3VUW A;  1E7V A;  1TBE A;  2BQQ A;  2KAC A;  3EC8 A;  3AE2 B;  3CF6 E;  1WMH A;  2KVZ A;  4ITK A;  3WAP A;  5EE3 A;  1VCB A;  5L95 C;  4C56 C;  3R3M A;  1IP9 A;  1H8C A;  3KWV A;  3N20 C;  1EUV B;  1YMH E;  5DCN A;  2VZK D;  4LNO A;  4N59 A;  4A6Q A;  2LI5 A;  4ZYN A;  3H7P B;  4RM9 A;  1WX8 A;  3UGB B;  4KKI A;  4BZA A;  3DVG X;  2K22 A;  2KTR A;  4WJP A;  4C7Z A;  4GB9 A;  4WJQ A;  1C4P A;  3DBH B;  1V80 A;  3EGR A;  1R7S A;  2R61 A;  2O6V B;  3C0R B;  2AYO B;  2KVR A;  2DZJ A;  3H8H A;  3ZNI D;  2MW5 A;  1IBX B;  2WXR A;  4C4V A;  3BWU D;  1WJN A;  4P6V F;  1OEY A;  4S17 A;  4B9K A;  4ARC A;  4O1N A;  2IGH A;  3VRB B;  1UGJ A;  4CO7 A;  1N60 A;  1XT9 B;  4NNJ B;  3Q8E A;  3BVG A;  3ZNZ B;  4IOI E;  3UIN B;  1WZ3 A;  1Q10 A;  2KTF A;  1FO4 A;  1FEH A;  2WXG A;  2NTT A;  3HRD D;  1SE4 A;  1VZ7 A;  2FCN A;  2INN E;  2LGD A;  2QMT A;  2CS4 A;  1V1P B;  2LRW A;  2M4N A;  4XDD A;  1L6U A;  1WGH A;  4DXG A;  1DGJ A;  4W9L A;  3P4R B;  4RF0 A;  4WJO A;  4GDL B;  2IDY A;  3QAQ A;  2OJR A;  2WXL A;  3T3O A;  4FJZ A;  5BYR A;  3SHQ A;  1L2N A;  3QIJ A;  4XYC A;  5AZF A;  5E6O A;  3V61 A;  2YVC A;  1FFU A;  4J6I A;  4URK A;  4GOC A;  1E6E B;  2PMV A;  1WXQ A;  4MDK E;  1WRI A;  1HXY D;  3MJ5 A;  4ZRK A;  5FR3 A;  1TS4 A;  1L6V A;  3AV8 A;  3IAS 1;  2QHO A;  2KJ6 A;  3I9V 1;  4YTM B;  4JPS A;  5HKH A;  1BUI C;  1L0X B;  3KYC D;  1N61 A;  4LNI A;  2ZCB A;  3Q8A A;  3HM6 X;  1WF9 A;  3Q6B A;  4TSS A;  5J17 A;  4NJ6 A;  2HE7 A;  1SEB D;  2A4Z A;  2I1K A;  5DPT A;  3RNB C;  4NQL B;  3U7Z A;  4NY0 A;  4RF1 A;  3RNE C;  2KAJ A;  4EE2 A;  2J4X A;  3BZD B;  1VDV A;  3HM3 A;  4DQO C;  2KX0 A;  1LGR A;  2KD0 A;  4KSL C;  3T3N A;  2YEP B;  3VTV A;  3VTU A;  1RYJ A;  4BKG A;  1K50 A;  2PPH A;  3QK0 A;  1SJH D;  1C4A A;  2RDB C;  3AEG B;  3MC9 A;  1MI0 A;  3TL5 A;  2IBI B;  2LHE A;  4K7U A;  2KQ4 X;  3NHE B;  2ICI A;  4KIK A;  4YSZ B;  2Y5P A;  1V49 A;  1ZDV A;  4HPL B;  5T8I A;  3AU4 A;  2N7J A;  1DOI A;  3W1Y A;  3AH7 A;  3FKY A;  3APD A;  2KDF B;  2HDE A;  3WCQ A;  5LXI B;  3N3K B;  1V1P A;  1C9F A;  3VH3 B;  1QOG A;  1GC7 A;  3V6E B;  3A9J B;  2QEJ C;  5C2T B;  3SD5 A;  2PEA A;  5G5G A;  2ZEQ A;  1TZO A;  1JRP A;  1YN5 A;  3L54 A;  2JZ3 B;  2BT6 A;  1WFY A;  2N1W A;  2VH1 A;  2MQJ A;  3U8Z A;  3W1S A;  3AN1 A;  1AYF A;  3TEX A;  2O6V A;  4H2A A;  1JW9 D;  3KVF B;  4WWO A;  2L76 A;  2JXX A;  2W54 A;  2JF5 A;  3APF A;  3FC4 A;  4ZOH C;  1E8X A;  2LGX A;  2GBN A;  2QCZ A;  2AQ2 B;  5JH5 C;  1GNU A;  4ASW C;  1QLB B;  1GJZ A;  1QZE A;  1TS2 A;  2LGI A;  1EM7 A;  2GBR A;  2FAZ A;  3ZW3 A;  4MSM B;  4TQ0 A;  2DNF A;  2DHZ A;  5LLI A;  4R3D A;  1WX9 A;  3R2I A;  4EZK A;  3S2A A;  4I6N B;  5JXV A;  1WJ6 A;  1UWX A;  4DHZ E;  2IY1 B;  2C9W B;  2K0P A;  1V1O A;  1NBF C;  4W9I A;  1QF6 A;  3GZN B;  1YQB A;  1I4H A;  2RD0 A;  1EU3 A;  1LM8 B;  4M8N A;  3B9J A;  1QOA A;  4ZRI A;  2NPT A;  4KKJ A;  5C1Z A;  3BVZ A;  4XX5 A;  5CHF A;  3U30 A;  2IO2 B;  3U4E G;  4W9G A;  1ZPS A;  2C60 A;  1V2Y A;  3AEA B;  4TQ1 A;  4DXF A;  1NYQ A;  1HZ6 A;  2RGF A;  3GP7 A;  4EFO A;  1MPE A;  3MHZ A;  3VUX A;  1SE9 A;  1Q1O A;  1FCL A;  2K3U A;  4C80 A;  1IGD A;  4EKU A;  2RSU A;  1TS3 A;  3WIM A;  1JWU D;  2KTR B;  2REX A;  3NVW A;  2LHD A;  3JYU A;  3P4Q B;  2FCQ A;  3AI5 A;  3RD2 A;  2OOB B;  1CK1 A;  4HXD A;  2WXN A;  1XXG A;  4NJC A;  2JX5 A;  1SBB B;  2L0T A;  1VD2 A;  4MAC A;  2RPQ A;  1SE2 A;  3I57 A;  3DHG C;  3PZ8 A;  4AUQ C;  1WZ0 A;  2GLS A;  1YNT E;  5EE1 A;  4HKQ A;  1V97 A;  4PK1 A;  1FXI A;  4GLS C;  4TV3 A;  2DEN B;  3AUL A;  2MBQ A;  4LDT D;  1IYF A;  3QWZ B;  4WUR A;  4DDG D;  2ZW1 A;  2KJR A;  1ZKH A;  2BYF A;  3B2F A;  2KNB A;  3TJP A;  4EEW A;  1K53 A;  1UWM A;  2FCM A;  1KOT A;  1WJ4 A;  3DOW A;  4EZL A;  3AE3 B;  1C1Y B;  1LO5 D;  3ZNG C;  2DZM A;  1FRR A;  1YIW A;  3VDZ A;  2WXH A;  3ZTC A;  4GGQ A;  4NAM A;  3AED B;  4GDK B;  2D11 A;  2HD5 B;  4RFB A;  4ZDV A;  3U2S C;  4LTU A;  4YTP B;  5J2R A;  5BYS A;  1P1A A;  3JW0 X;  4HJK A;  3DHH C;  3DBL B;  3WAL A;  2ZZP B;  2KMA A;  3A1Q A;  2KC1 A;  3A9J A;  1EO6 A;  3EUB 2;  4M0W A;  4IM2 A;  1Y56 A;  4C4V B;  4CQN A;  1WM3 A;  4KGR A;  3GE3 C;  1EF1 A;  2WX0 A;  2QJL A;  1E10 A;  1KRH A;  1NDD A;  2WP9 B;  5GMV A;  3A4R A;  1ESF A;  2IO0 B;  2KO3 A;  3SR6 A;  3T8M A;  2ZVO A;  4FA6 A;  2IYD B;  3PTF C;  4W9K A;  5CX3 A;  1J7A A;  2DYM A;  3W1S C;  1IPG A;  2KN4 A;  2NBW B;  1V5T A;  1ET9 A;  4QAY A;  1UGM A;  2JY6 A;  3Q8F A;  3ZKJ C;  4LJP B;  1C76 A;  1TT5 B;  1YN3 A;  4HJG E;  1PGA A;  2MHJ A;  4AQ7 A;  3ML8 A;  3PLU A;  2JWZ A;  3Q14 C;  1MHH E;  3LB8 C;  2LUE A;  2V3N A;  3VVW B;  4LK0 M;  5I4D A;  1JRU A;  1IUE A;  1FMA D;  2D3B A;  1XEE A;  3FIL A;  4RNA A;  3BIN A;  2OHF A;  1N62 A;  2KQS A;  2LXA A;  2FUG 1;  3V62 A;  3AE8 B;  4DWF A;  2M0X A;  4XGA B;  1WE6 A;  1OQR A;  1PGX A;  1TYG B;  3DBR I;  4NZL B;  5G55 A;  2JRH A;  4XWW A;  2LXC A;  1V86 A;  2MP2 A;  3ZVV A;  4BKS D;  4B0E A;  1ET6 A;  2H89 B;  2C7N B;  2Y3A A;  5C23 A;  4E3C A;  1NVI D;  5AZH A;  1UF0 A;  2KQ7 A;  4D2K A;  3L16 A;  2N9X A;  2W55 A;  4LNK A;  3B2G A;  2M8S A;  2ZVN A;  2MEK A;  1SXT A;  5AUI A;  1XLO A;  1P7F A;  3M63 B;  3MFG A;  3J9C A;  2L32 A;  3O65 B;  2LRU A;  4WIP A;  1XLP A;  4HK2 A;  3Q69 A;  2R2Q A;  2CR5 A;  4ANX A;  5TSS A;  3AEB B;  3IHP C;  4YT0 B;  5BO4 B;  2J7Q B;  3KLS X;  2X8X X;  3UQB A;  2XBB C;  4ZHO A;  4G0N B;  4KSK C;  1QQR A;  2V4L A;  5D3I B;  3QHT A;  2SAK A;  3ALB A;  1VZ8 A;  4ZHP A;  4PT5 A;  4KIK B;  1Q0W B;  4OHJ A;  3JVZ X;  3TBL D;  2PKO A;  5KHO A;  4KDL B;  3NVV A;  4E71 A;  3VHT C;  3RPF C;  3IBE A;  1M4V A;  2X38 A;  2JUO A;  2J52 A;  4LCD E;  3ZDT A;  2KOX A;  2L83 A;  4WAA A;  2LZ6 A;  3ECI A;  4DHJ D;  1SIJ A;  3NVY A;  1GOZ A;  2MCN B;  4I6L B;  1C77 A;  2DYO A;  1FD6 A;  3M95 A;  2FUH B;  2BWF A;  2L7R A;  4I6P A;  2MH7 A;  1WGR A;  1YX5 B;  2NS5 A;  2LJ5 A;  2MBH A;  4PYZ A;  3IVF A;  4YSY B;  1SB3 C;  2EMT A;  2VH2 A;  4RGM A;  3RYT A;  4B95 A;  2MRP A;  1R4M B;  1PYW D;  1R4N B;  2K8H A;  2KXJ A;  2EMS A;  5D7G A;  2KFK B;  2AQ1 B;  4GMV A;  5BMG A;  1QOF A;  1FRD A;  3ML9 A;  2MX2 A;  3OG5 A;  1T0R C;  1PGB A;  1NI3 A;  2BYT A;  3M62 B;  2PE6 B;  2LD9 A;  4HPM B;  3EHV A;  5J18 A;  2MP2 B;  1K51 A;  2BKR B;  3HVZ A;  4ANV A;  2WLB A;  3OAW A;  4NAW A;  1EU4 A;  5LNK 1;  1RAX A;  1ZGU B;  5HHD G;  1QOB A;  4G11 A;  4MEL A;  2QC8 A;  4W9E A;  1WRD B;  4ACF A;  1OQY A;  1IBX A;  3MP9 A;  3N1Y C;  2LWP A;  1N6Z A;  1WM2 A;  4MGZ E;  4WH4 A;  1FXT B;  2K6Q A;  4DK5 A;  3BYT B;  3NZS A;  1FNU A;  1T6B X;  2NPT B;  1L7Y A;  1NEN B;  3VUY A;  1TGZ B;  3P63 A;  2WDR B;  2WDQ B;  3QC8 B;  3FIL B;  2L52 A;  1FFV A;  3AEF B;  2ASQ A;  5AUK A;  2XEW A;  4BAX A;  4A8X C;  2WXO A;  5JHA A;  4OW0 A;  5AZG A;  4IKG A;  4IC7 B;  2N9L A;  2FIF A;  2WS3 B;  1L4D B;  2BTE A;  1QIL A;  3ZQ4 A;  4WWP A;  1L5P A;  3RMK C;  2BS4 B;  2N9P C;  3O13 A;  4HRS A;  1TJE A;  1ZOY B;  4PYU A;  3GE8 C;  2J0J A;  3CMM B;  4WWN A;  4JWS C;  1B9R A;  4HCN B;  4GN1 A;  1KJT A;  4L2Y A;  4KV2 A;  2KLG A;  4KX6 B;  1S3S G;  4GDL A;  2WWZ A;  2BYV E;  2OED A;  3HVD A;  1F2R I;  3A33 B;  3UF8 A;  4BBN F;  3TIX A;  1V9J A;  1YOV B;  2KK8 A;  4JQW C;  4P1B C;  2N1V A;  2KHW B;  1C3T A;  1F52 A;  2G9H D;  1UUP A;  1LXD A;  3L10 B;  2J0M A;  1P98 A;  4KVG B;  1WXA A;  1PQS A;  3DBH I;  2OJW A;  3PHW B;  3DCG A;  1WXM A;  5G2N A;  2PE9 A;  2O2V A;  4ICU A;  5DPR A;  3BVM A;  1DOY A;  2GB1 A;  1RWS A;  5DPW A;  1N63 A;  2KDM A;  3RZF A;  2BW2 A;  3ZDM C;  2EEL A;  4OVU A;  1XF5 L;  5E6P A;  4AWJ A;  1FIQ A;  4WQM A;  1X1M A;  2I2Y A;  3PZD A;  3ZLZ A;  5L83 A;  2DZK A;  3Q3M C;  4NQK E;  3MC0 B;  2MWS B;  1OQQ A;  4LLG M;  1FPY A;  4M8M A;  1AWD A;  3VH4 B;  4HRO A;  3TMP B;  3WAM A;  2KYW A;  2WDV B;  3PRP B;  1F77 A;  4FAD A;  5LXH A;  4N58 A;  4JX1 C;  2MBE A;  2WDT B;  2IPK D;  3SFE B;  3EEC A;  2JVC A;  3UQA A;  2PW9 A;  4WQO B;  3PPA A;  4MEM A;  2LEK A;  3NY5 A;  1F1H A;  2JQR B;  1I42 A;  1D5X C;  2Y5C A;  2VRR B;  4A20 A;  4USA A;  1MFW A;  1DOX A;  3HIZ A;  2R2O A;  2RDG A;  1WH3 A;  2CKH B;  1XO3 A;  2WU5 B;  2CU3 A;  2KLC A;  4HWI B;  2I1J A;  4M02 A;  2WXJ A;  1L0V B;  4B6W A;  2J53 A;  1KLU D;  3B08 A;  2WXM A;  4BBN C;  2LJI A;  1PFD A;  1VRA B;  3K9P B;  3NOB A;  3ZRC A;  3TEW A;  1P3Q U;  1UNS A;  3VAW A;  1GB4 A;  3QA8 A;  3MC8 A;  2WYQ A;  2AEH A;  3AE4 B;  1FXA A;  1JWA D;  3Q8C A;  1EWC A;  2O6V D;  2WHI A;  2N0S B;  2KDB A;  3L4P A;  3R7Q A;  1NYR A;  3NG0 A;  4WJN A;  1WY8 A;  2DLB A;  3VR8 B;  2L3Z A;  1E0Z A;  2E3T A;  3K9O B;  2JZZ A;  4IM0 A;  1KFY B;  2O2V B;  3NJT A;  1S1Q B;  1A70 A;  4A3P A;  3Q3N C;  4IWP A;  3P4P B;  4KGS A;  1BML C;  2HJ8 A;  2ON8 A;  3DBL I;  3VRA B;  2ZJD A;  1JML A;  4MGK E;  1AAR A;  2MBB B;  3PRM B;  3RT3 B;  3LDZ E;  3RNC C;  4KZ0 A;  1WGG A;  4MH0 E;  5GXG B;  1WWT A;  2BVC A;  3ZXR A;  3TCA A;  2PLP A;  4A3O A;  1MHX A;  2C5L C;  1I4Q A;  5CHV C;  3X23 A;  2W82 A;  4CHK A;  2L0F A;  2NCN A;  4JWU C;  4MH8 A;  1OGW A;  4US9 A;  3RUL A;  1CQV A;  2BYE A;  4TKN A;  1D5M C;  2W3S A;  4JL9 A;  1I4R A;  2AL6 A;  2Z8L A;  3DBR B;  4XWT A;  3IT6 B;  4II3 B;  1P0R A;  2L00 B;  3RFZ B;  1D5Z C;  3H9D A;  3LYY A;  1H4R A;  2RDH A;  3H1U A;  3UIO B;  2GOW A;  1WSP A;  3CIR B;  2MJD A;  3B0A A;  4MGI E;  1V6E A;  2XN9 C;  5E6J A;  2N7D A;  2ZPN A;  1ZP0 B;  1ISN A;  2J42 A;  2DZI A;  3E9S A;  1ENF A;  3V6C B;  4W9H A;  2XNA C;  1I7H A;  4PS7 A;  1RRB A;  2TSS A;  4W9J A;  4JE3 B;  1C79 A;  3PRE A;  5HI1 A;  2HJ1 A;  2LFI A;  2L05 A;  2B76 B;  1D3Z A;  3T9L A;  4ANU A;  5BMI A;  2M19 A;  4RM8 A;  3KQ4 A;  4AJW A;  2C7H A;  3ZGZ A;  3H7S A;  4HPP A;  4KDI C;  1RFA A;  5BMH A;  2D3C A;  3N1X C;  3UI3 A;  4B0M A;  2KZR A;  1YD8 U;  2G4D B;  4C00 A;  5EDS A;  1XCQ L;  3I5J C;  2BGF A;  3L08 A;  1XLQ A;  2ZPY A;  3NRZ A;  1TY0 A;  1SF0 A;  1TS5 A;  2G4S A;  2E6X A;  3IXS A;  2HTM E;  4NJ7 A;  4EZJ A;  3HHM A;  1WGK A;  4HDO A;  2DBY A;  2WXQ A;  4MJS B;  2PTL A;  4OZA A;  1K52 A;  3OJ3 A;  1E7U A;  1CMX B;  4NPN A;  2QSD A;  2Z0E B;  2NVU I;  4RGO S;  1XD3 B;  1QT9 A;  2PJH A;  3C19 A;  4FHK A;  1AW7 A;  2JPH A;  1MVK A;  3QCA A;  4P1C C;  4FJY A;  1I35 A;  3MJW A;  4P16 A;  2XK5 A;  5JZE B;  2Q5W D;  5E6N A;  4AP4 C;  2KWU B;  2AWT A;  4DDI D;  4W9D A;  1Z5S B;  1T0Q C;  1E90 A;  1EWY C;  4WAF A;  4RMA A;  3ZUN A;  3OWE B;  4L23 A;  2JYT A;  3MTN B;  2KAN A;  2D3G A;  3NZU A;  3PO0 A;  4BKS A;  1XLN A;  2KN5 A;  3CSF A;  3U7D A;  3AEE B;  3NS1 A;  3AB5 A;  1I4P A;  4HDQ A;  2WXF A;  3UIP B;  3JSV A;  1NI2 A;  2PVO D;  4OZC A;  3DQV A;  1WI0 A;  2BB6 A;  2KWV B;  4HEA 1;  2AX5 A;  2INC C;  2BPS A;  1VR9 A;  1OFF A;  1WYG A;  1FM0 D;  3QQ8 B;  4RGN A;  1OEY J;  3PHX B;  2NTS A;  4MM3 A;  1GB1 A;  3WAN A;  5IKC M;  1UEL A;  2ZCC A;  5D3D A;  1MJD A;  1UH6 A;  5D2M B;  3DWG C;  3KUC B;  3R7R A;  2G45 B;  1MG4 A;  1GC6 A;  1TY2 A;  5FK9 C;  1J7C A;  3GB1 A;  2G3Q B;  1ZUD 2;  1VZ6 A;  3R2T A;  3ZJT A;  4ZRQ A;  1T3Q A;  3N30 A;  2D3A A;  4XE0 A;  1JQ4 A;  1YQ4 B;  4MJS A;  4M01 A;  1WXV A;  2W3R A;  3ONS A;  1FNV A;  1ACC A;  1OTR B;  3DDC B;  4K81 A;  1UBI A;  1C78 A;  1TIF A;  4ICV A;  1HQR D;  1M94 A;  4EUT A;  3KWL A;  3RCZ A;  3X0W A;  4LDT B;  1T0Y A;  1SGH A;  4BKT A;  2M0A A;  4GDK A;  2JU6 X;  1E8W A;  4IG7 B;  1G6J A;  2HTH A;  3KH0 A;  1P7E A;  2IJ0 A;  3HK0 A;  3PZ7 A;  2DX5 B;  3IT4 B;  1E9M A;  1E8Y A;  2YLM A;  3AE1 B;  4IDI A;  4G3X B;  1TTN A;  5FKA C;  3KUZ A;  4BOZ B;  4FXC A;  4IWO A;  1T5X D;  2LVQ A;  2K6D B;  1HEZ E;  1WGY A;  2ZNV C;  3NUH B;  1ZXI A;  4XZ4 A;  1HTQ A;  2CHX A;  3A9K A;  4A90 A;  3JSV B;  3LJ3 A;  5KHQ A;  1KM7 A;  1AN8 A;  4OZB A;  3OLM D;  2FE8 A;  1FNW A;  2IZV B;  4K7S A;  5MPO A;  4LJO B;  3H6N A;  3CWI A;  1UBQ A;  4J3O D;  3SU8 X;  3V05 A;  1WGD A;  1TKY A;  3ZTD A;  3GZN I;  2BS3 B;  3EA6 A;  1E5W A;  1BXT A;  2N9E B;  4OVV A;  3DVN U;  3TUO A;  3A4S C;  3E56 A;  2EKE C;  4N9F 4;  1SIF A;  3VFK A;  2GBJ A;  2MJE A;  4ANW A;  3P42 A;  2NBU A;  1UZX B;  3NZ3 A;  2N9K A;  3ZRF A;  3P2B A;  2N7E A;  3I3T B;  2I38 A;  4FBJ B;  2WXI A;  4AS1 A;  1YJ1 A;  2MLB A;  2MBO A;  5JHB A;  3ENE A;  2LGY A;  3ZJU A;  3N1Z C;  2JXT A;  1IGC A;  4AOF A;  3W5V B;  3BY4 B;  2M17 A;  4HKZ E;  4W9F A;  4XC2 A;  3DVG Y;  3L13 A;  2M1M A;  1V8C A;  5HFY A;  3RZW C;  1LFD A;  2GBM A;  1J8C A;  1GPX A;  2G1E A;  1WX7 A;  4KZC A;  4P7I A;  5BYQ A;  2FBW B;  3Q3J A;  4MM3 B;  1F9J A;  4F1S A;  3Q8B A;  1Z2M A;  1B1Z A;  1Y8R C;  3W5U B;  5IP4 D;  1YJJ A;  1WR1 A;  3OJ4 B;  2CHZ A;  3FAH A;  3APC A;  3Q3O C;  2KT7 A;  3QAR A;  2GBK A;  3RI7 C;  3V3X A;  4IW0 A;  5IAA C;  3KYD D;  4A9A A;  1YJI A;  3I63 C;  2IND C;  2RPV A;  1K8R B;  2Z59 B;  2DYB A;  4TUU A;  2KC2 A;  3AU5 A;  4US8 A;  2KFJ A;  4RCO A;  4GIV A;  3VR9 B;  1HE8 A;  2AL3 A;  4S0R A;  3PGE A;  3DHI C;  4HLE A;  2BS2 B;  2DAJ A;  1J0G A;  3AM9 A;  1R4M I;  4MSQ B;  2L1A A;  2ZNV B;  3KW5 B;  4JIO U;  3KUD B;  3AE5 B;  4JLC A;  1R4N I;  1WMH B;  3RUI B;  3QJZ A;  4RH6 A;  2D10 A;  2XK5 B;  5IN7 A;  3VQI A;  2JSV X;  3PSE B;  2KJH B;  3U52 E;  1VLB A;  5IA7 A;  2UU7 A;  2WXK A;  2NBV B;  3GOE A;  1XCT L;  2WNM A;  4FHJ A;  1WR6 E;  3TEY A;  3DBS A;  3AXC A;  3VTW A;  1V5O A;  3H7P A;  1TKG A;  2WGS A;  5AEK B;  1SJE D;  2V3S A;  5DPS A;  1T0S C;  2KDI A;  4YTN B;  4K3C A;  2Y5B B;  3ZNH B;  2IO3 B;  4F8C B;  2V1Y A;  1QKZ A;  2LVP A;  1RM6 C;  2V0G A;  3W2D A;  2K5P A;  3PV1 A;  3SFD B;  5H8Y E;  4YXD B;  1CJE A;  3ZIM A;  1WE7 A;  2JYE A;  5TR5 A;  2IGG A;  1MG8 A;  5FR6 A;  3L0W B;  2K1F A;  4W9C A;  1ZW7 A;  2LUM A;  2CJN A;  3WAO A;  1YN4 A;  2KFK A;  2BB5 A;  2MJ3 A;  4Q2J A;  1KTK A;  4FLH A;  5IOI A;  1ROE A;  3R66 C;  1N5X A;  1UD7 A;  2LAS A;  2IGD A;  3EFC A;  4K3B A;  3IG3 A;  2K8C A;  3DWM A;  4ZYS A;  2KWD A;  1TKE A;  4FN2 A;  1CZP A;  4ZRP A;  2KWC A;  3A1Q B;  4KGT A;  2W9N A;  5D6J B;  4M0W B;  1A5R A;  2JWU A;  3Q3F A;  4G50 A;  1KLG D;  4DHZ B;  2CU1 A;  4X57 B;  5CHW A;  4OVZ A;  3GS2 A;  5H92 C;  4A55 A;  1KH0 A;  1I4G A;  2D07 B;  3EFU A;  1V81 A;  2ZW0 A;  4PS8 A;  2FNJ B;  4M00 A;  4PS3 A;  2NMQ A;  3ABV B;  3NS8 A;  4REZ A;  2J0K A;  3ZJV A;  2N4F A;  1JWS D;  2KMC A;  2M56 B;  2CJO A;  2EKI A;  2JT4 B;  2L8J A;  2PIA A;  3IAM 1;  4ARI A;  4IWQ A;  1WIA A;  1I4X A;  2KKC A;  3AE7 B;  1D6E C;  4GSW A;  2V9H A;  2UWQ A;  2BWE S;  2KMM A;  3SEB A;  1STE A;  2K25 A;  4LNF A;  2AQ3 B;  3AE6 B;  3D32 A;  2MA9 B;  4RGT A;  4E74 A;  5EE0 A;  2VZK B;  1KF6 B;  1RLF A;  2D2Q A;  1E7P B;  1RFK A;  3N32 A;  1J19 A;  4IUM B;  3ZO5 B;  1F2R C;  2UYZ B;  3AMZ A;  4K7W A;  3DPD A;  3DVN V;  2IO1 B;  3RNA C;  2BKF A;  3RNG C;  2Z0D B;  4MGY E;  2MSE D;  1GG3 A;  1ZDX A;  2QDF A;  2LGS A;  4JGH B;  3LXF A;  2YEP F;  1JWB D;  1XQQ A;  4FUL A;  4L1B A;  5G5H A;  2LMC A;  1GUA B;  2WQY B;  4IM3 A;  2QIE B;  2K8B A;  2V4I B;  4WWM A;  3Q2A C;  1WJU A;  3TEZ A;  3RNF C;  4YSX B;  2SEB D;  2RR9 A;  1L0Y B;  2BF8 B;  3HUI A;  2CHW A;  2FCS A;  1YX6 B;  3AE9 B;  3BK2 A;  4F7Z A;  2ACZ B;  2K9X A;  2DAF A;  1WYW B;  3PT2 B;  2IY0 B;  3VXW A;  2GRI A;  4DBG A;  1ZE3 D;  1P9D U; 
#chains in the Genus database with same CATH homology
 2W3R A;  1FNV A;  2G9H D;  1ACC A;  1UUP A;  3U4E G;  3R8B A;  1C78 A;  1ZPS A;  2V3P A;  1HA5 A;  3AEA B;  1JRO A;  4TQ1 A;  1HQR D;  2INP E;  4DXF A;  1NYQ A;  1HZ6 A;  3GP7 A;  3BII D;  3KWL A;  2H88 B;  1MPE A;  3MHZ A;  4UDU C;  3URY A;  1FCL A;  3BVM A;  1DOY A;  2GB1 A;  2K3U A;  4C80 A;  1IGD A;  2M0A A;  2BBC A;  1RWS A;  1N63 A;  5EE9 A;  1TS3 A;  2JU6 X;  2KDM A;  1YQ3 B;  3N9Y C;  1JWU D;  1PDX A;  3NVW A;  2BW2 A;  1DYQ A;  2EEL A;  1P7E A;  2GI9 A;  2LHD A;  1VJK A;  2JZP A;  1XF5 L;  1PUT A;  2IJ0 A;  1D4B A;  3P4Q B;  1FIQ A;  3P4S B;  4WQM A;  2ONQ A;  3PZ7 A;  1CK1 A;  2RMM A;  2WXN A;  1XXG A;  3IT4 B;  1E9M A;  4NJC A;  2I2Y A;  3AE1 B;  4IDI A;  2JX5 A;  1SBB B;  1C4C A;  2DWQ A;  1J7B A;  1JAL A;  4MAC A;  5FKA C;  2WXP A;  4FXC A;  1SE2 A;  3I57 A;  1HZ5 A;  3PZ8 A;  1T5X D;  3MC0 B;  5HG2 A;  1OQQ A;  4LLG M;  1YNT E;  5EE1 A;  4HKQ A;  1AWD A;  1HEZ E;  1V97 A;  1JWM D;  3NUH B;  1FXI A;  4GLS C;  1L4Z B;  4YWG G;  1ZXI A;  4HRO A;  4MT5 A;  3W9C B;  2WDV B;  3BK1 A;  4WUR A;  2ZW1 A;  1F77 A;  3B2F A;  4A90 A;  1K53 A;  1UWM A;  2QIL A;  4N58 A;  4JX1 C;  2WU2 B;  1AN8 A;  4NAW B;  2IPK D;  3C8Y A;  4OZB A;  3SFE B;  1SSN A;  2FE8 A;  2PW9 A;  2D5G A;  3AE3 B;  1FNW A;  1LO5 D;  2LEK A;  3NVZ A;  1F0Z A;  5MPO A;  1FRR A;  2JQR B;  5C3J B;  1N5W A;  1ZXH A;  3P1M A;  2WXH A;  1D5X C;  2Y5C A;  3CWI A;  4J3O D;  4NAM A;  3AED B;  2PVG C;  4GDK B;  4RFB A;  3V05 A;  4USA A;  1DOX A;  1TKY A;  2RDG A;  4XDC A;  1FCC C;  3U2S C;  3TSS A;  2BS3 B;  1XO3 A;  3EA6 A;  4LTU A;  4YTP B;  1JCK B;  2WU5 B;  4N6E B;  5BYS A;  1BXT A;  2CU3 A;  3TUO A;  3E56 A;  2WXJ A;  1L0V B;  2J53 A;  4TMA B;  1KLU D;  2MJE A;  3EUB 2;  3P42 A;  2WXM A;  4M0W A;  4C7Y A;  2LJI A;  3ZYY X;  1PFD A;  1VRA B;  2N9K A;  3ETR A;  3NZ3 A;  1Y56 A;  1NEK B;  1UNS A;  3TEW A;  1GB4 A;  3BYY B;  4CQN A;  1SE3 A;  3AEC B;  4KGR A;  1GAQ B;  2I38 A;  2WXI A;  4AS1 A;  3AE4 B;  1FXA A;  2QJL A;  2KAC A;  1JWA D;  1E10 A;  1KRH A;  2WP9 B;  3Q8C A;  1EWC A;  3AE2 B;  4ITK A;  1ESF A;  5EE3 A;  2N0S B;  3L4P A;  3ZJU A;  1NYR A;  4C56 C;  2JXT A;  3SR6 A;  1IGC A;  3KWV A;  3W5V B;  2DLB A;  1YMH E;  3VR8 B;  4HKZ E;  1E0Z A;  2E3T A;  2VZK D;  4N59 A;  4A6Q A;  1KFY B;  1V8C A;  1J7A A;  2DYM A;  5HFY A;  1GPX A;  2G1E A;  2KN4 A;  5BYQ A;  1A70 A;  2FBW B;  4MM3 B;  4KKI A;  1ET9 A;  3Q8B A;  2K22 A;  3Q8F A;  1B1Z A;  3P4P B;  1C76 A;  4KGS A;  4C7Z A;  3W5U B;  1BML C;  2ON8 A;  1YJJ A;  3VRA B;  1C4P A;  1YN3 A;  1JML A;  3FAH A;  4HJG E;  3EGR A;  1R7S A;  1PGA A;  2R61 A;  4AQ7 A;  5GXG B;  1WWT A;  3V3X A;  4A9A A;  1MHH E;  1YJI A;  2V3N A;  3H8H A;  3LB8 C;  2RPV A;  2PLP A;  1IBX B;  2WXR A;  4LK0 M;  5I4D A;  1MHX A;  4US8 A;  1IUE A;  1FMA D;  3BWU D;  1XEE A;  3FIL A;  4RCO A;  4RNA A;  1I4Q A;  2OHF A;  1N62 A;  4P6V F;  3VR9 B;  4ARC A;  2FUG 1;  4O1N A;  2W82 A;  2IGH A;  3AE8 B;  1UGJ A;  2BS2 B;  3VRB B;  1OQR A;  1N60 A;  1PGX A;  1TYG B;  4NZL B;  3AM9 A;  2L1A A;  4JWU C;  4MH8 A;  4US9 A;  3Q8E A;  4XWW A;  3AE5 B;  3BVG A;  4IOI E;  1CQV A;  4RH6 A;  1Q10 A;  1D5M C;  2JSV X;  3VQI A;  1FO4 A;  2W3S A;  3U52 E;  1VLB A;  4B0E A;  2WXK A;  1FEH A;  1I4R A;  2NTT A;  2WXG A;  3HRD D;  1XCT L;  1ET6 A;  2H89 B;  1SE4 A;  1VZ7 A;  2WNM A;  2Y3A A;  2INN E;  2Z8L A;  2QMT A;  1NVI D;  4XWT A;  3TEY A;  1V1P B;  3IT6 B;  3RFZ B;  1TKG A;  4XDD A;  4D2K A;  1L6U A;  4DXG A;  1SJE D;  1D5Z C;  2W55 A;  3LYY A;  4YTN B;  1DGJ A;  2RDH A;  1WSP A;  3B2G A;  3P4R B;  4RF0 A;  3CIR B;  2MEK A;  1SXT A;  2MJD A;  4GDL B;  2IDY A;  1QKZ A;  2WXL A;  2XN9 C;  5AUI A;  1XLO A;  3T3O A;  5E6J A;  1P7F A;  1RM6 C;  5BYR A;  2V0G A;  1ZP0 B;  3MFG A;  2J42 A;  3W2D A;  3J9C A;  2L32 A;  3E9S A;  1ENF A;  2K5P A;  3SFD B;  1FFU A;  4WIP A;  5H8Y E;  4YXD B;  1XLP A;  1CJE A;  2XNA C;  3Q69 A;  1E6E B;  2PMV A;  1WXQ A;  1I7H A;  2JYE A;  2IGG A;  5TSS A;  3AEB B;  1WRI A;  2TSS A;  1HXY D;  4JE3 B;  3MJ5 A;  1C79 A;  4YT0 B;  5FR3 A;  1TS4 A;  5HI1 A;  1L6V A;  2LFI A;  3AV8 A;  3IAS 1;  2B76 B;  3KLS X;  2LUM A;  3I9V 1;  2CJN A;  4ZHO A;  1YN4 A;  4YTM B;  2BB5 A;  2MJ3 A;  1QQR A;  4Q2J A;  5D3I B;  4JPS A;  2SAK A;  1KTK A;  1VZ8 A;  1BUI C;  1L0X B;  4ZHP A;  4PT5 A;  5BMI A;  1ROE A;  1N61 A;  2M19 A;  1N5X A;  3KQ4 A;  3ZGZ A;  3Q8A A;  2IGD A;  4OHJ A;  2PKO A;  5BMH A;  3DWM A;  4TSS A;  3NVV A;  4ZYS A;  2KWD A;  3RPF C;  3UI3 A;  1M4V A;  4B0M A;  1SEB D;  2X38 A;  1TKE A;  2J52 A;  2L83 A;  1CZP A;  1XCQ L;  4ZRP A;  1XLQ A;  1SIJ A;  4KGT A;  3NVY A;  1GOZ A;  3U7Z A;  4RF1 A;  2KAJ A;  3NRZ A;  4EE2 A;  2J4X A;  1C77 A;  2DYO A;  2JWU A;  3BZD B;  1FD6 A;  1TY0 A;  1SF0 A;  1TS5 A;  1VDV A;  4DQO C;  2E6X A;  3IXS A;  1KLG D;  2HTM E;  3GS2 A;  4OVZ A;  2MH7 A;  5H92 C;  4A55 A;  3T3N A;  1KH0 A;  2YEP B;  1WGK A;  2DBY A;  1RYJ A;  1I4G A;  2WXQ A;  2ZW0 A;  1K50 A;  2PTL A;  4YSY B;  1SB3 C;  4OZA A;  2NMQ A;  1K52 A;  1SJH D;  1C4A A;  3ABV B;  4RGM A;  2QSD A;  3AEG B;  1PYW D;  4REZ A;  1MI0 A;  4RGO S;  3ZJV A;  1JWS D;  5D7G A;  2AQ1 B;  5BMG A;  2M56 B;  1QT9 A;  2CJO A;  2EKI A;  1QOF A;  1FRD A;  2LHE A;  2PIA A;  1AW7 A;  3IAM 1;  2KQ4 X;  1MVK A;  4ARI A;  2ICI A;  1PGB A;  1NI3 A;  2BYT A;  4YSZ B;  1I4X A;  2Y5P A;  3AE7 B;  4P16 A;  1D6E C;  1ZDV A;  5T8I A;  2N7J A;  2Q5W D;  1DOI A;  2KMM A;  3SEB A;  1K51 A;  1STE A;  3AH7 A;  3HVZ A;  2WLB A;  2AQ3 B;  3AE6 B;  1EU4 A;  5LNK 1;  2HDE A;  5HHD G;  3WCQ A;  1EWY C;  4RGT A;  4WAF A;  1QOB A;  1V1P A;  1C9F A;  1QOG A;  5EE0 A;  2VZK B;  2QEJ C;  3OWE B;  4L23 A;  5C2T B;  1KF6 B;  1IBX A;  2JYT A;  3MP9 A;  5G5G A;  1E7P B;  1TZO A;  1JRP A;  1YN5 A;  1RFK A;  4WH4 A;  2BT6 A;  1F2R C;  3AMZ A;  3BYT B;  3W1S A;  3AN1 A;  1FNU A;  3PO0 A;  1AYF A;  1T6B X;  1XLN A;  3TEX A;  1NEN B;  3AEE B;  4H2A A;  1JW9 D;  3NS1 A;  3AB5 A;  1I4P A;  3P63 A;  2WXF A;  1ZDX A;  2WDR B;  2PVO D;  2WDQ B;  2W54 A;  3FC4 A;  3FIL B;  2L52 A;  1FFV A;  4ZOH C;  3AEF B;  4OZC A;  2BB6 A;  3LXF A;  5AUK A;  4A8X C;  4HEA 1;  2AQ2 B;  2WXO A;  2YEP F;  4OW0 A;  1QLB B;  2AX5 A;  4IKG A;  1VR9 A;  1JWB D;  2N9L A;  2WS3 B;  1OFF A;  1L4D B;  2BTE A;  1WYG A;  1QIL A;  1FM0 D;  1TS2 A;  2LGI A;  1EM7 A;  4RGN A;  3ZQ4 A;  2NTS A;  4L1B A;  1L5P A;  5G5H A;  1GB1 A;  2LMC A;  2WQY B;  4TQ0 A;  2BS4 B;  3O13 A;  4HRS A;  4R3D A;  1TJE A;  2QIE B;  1ZOY B;  2V4I B;  3R2I A;  4WWM A;  5D3D A;  4JWS C;  5JXV A;  3TEZ A;  1UWX A;  4YSX B;  2SEB D;  1B9R A;  2K0P A;  4L2Y A;  3DWG C;  1L0Y B;  1V1O A;  4KX6 B;  1QF6 A;  3HUI A;  1TY2 A;  5FK9 C;  1J7C A;  3GB1 A;  1ZUD 2;  1VZ6 A;  1I4H A;  3R2T A;  3AE9 B;  2OED A;  3BK2 A;  3ZJT A;  1EU3 A;  2ACZ B;  2K9X A;  1F2R I;  3HVD A;  4ZRQ A;  1T3Q A;  3B9J A;  1QOA A;  4XE0 A;  1JQ4 A;  1YQ4 B;  2GRI A;  4KKJ A;  3BVZ A;  1ZE3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...