1L6UA

Nmr structure of oxidized adrenodoxin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords Adrenodoxin 1
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6uA00
2KMMA 1ROEA 3DWGC 1NYRA 1QOFA 1DOIA 4N58A 1QLBB 1WYGA 2N0SB 3FC4A 1NEKB 2H89B 4KX6B 2W54A 3AE4B 1TKYA 2B76B 1FM0D 4ZHOA 1WRIA 4IDIA 1UWMA 1FRRA 4ITKA 3LB8C 4WQMA 3AV8A 1WWTA 1KRHA 3AEFB 3FAHA 1ZXIA 5EE1A 1RFKA 2WDRB 3AE7B 3BIID 1JQ4A 1ZUD2 3NVWA 1CZPA 1KFYB 2BT6A 1NVID 3NRZA 4JX1C 2WP9B 1E7PB 1TKGA 1J7CA 4C80A 2G1EA 1FMAD 2WDQB 2WU5B 4US8A 3SR6A 1AYFA 2BS4B 5EE0A 2EKIA 3AE8B 1DGJA 5AUKA 4YTPB 4YSXB 1VLBA 3ABVB 5G5HA 3RPFC 4ZHPA 1E9MA 1JWAD 1QOAA 3AE3B 2K22A 3VRBB 2PKOA 4N6EB 2PVGC 3SFDB 3B2FA 2MJ3A 1N5WA 1E6EB 2LEKA 2QJLA 1YQ4B 3ETRA 3VRAB 1FO4A 2H88B 1XLOA 3AE5B 1N63A 1NENB 1FRDA 2JX5A 2W55A 4FXCA 3AEEB 4JWSC 1OFFA 2HTME 1WGKA 3AMZA 4HROA 1JW9D 1N61A 5GXGB 5C2TB 1FXAA 5H92C 1IUEA 5AUIA 1YQ3B 1R7SA 3NVVA 1GAQB 4YT0B 1VDVA 5H8YE 1T3QA 1XO3A 1RM6C 1RYJA 1XLPA 2CU3A 1L5PA 3AE9B 1V8CA 1WXQA 1TJEA 1VJKA 1L6UA 1YJJA 2W3RA 3AM9A 4ZOHC 1L6VA 2ACZB 2WLBA 1AWDA 3W9CB 3NS1A 4YXDB 1JWBD 1NYQA 2K5PA 2MJDA 3CWIA 3AH7A 3AE1B 3B9JA 1F0ZA 1FXIA 4YSYB 1GPXA 2K9XA 5G5GA 1NI3A 2WDVB 1XLQA 3PO0A 1PFDA 1QOGA 4C7YA 5C3JB 3DWMA 4LTUA 1KF6B 1PUTA 2WS3B 1OQQA 2MH7A 3L4PA 2Y5CA 4US9A 3P4RB 3W5UB 1OQRA 1SIJA 3KWLA 3AECB 1DOXA 1E0ZA 2BS3B 4C7ZA 1PDXA 3B2GA 3NVYA 3HUIA 3VR8B 3EUB2 1A70A 2KAJA 4YTMB 2MJEA 1XLNA 2Q5WD 4P6VF 1B9RA 3P63A 1L0VB 1QT9A 1FIQA 4YSZB 3ZYYX 1E10A 2DWQA 3CIRB 1JROA 1SF0A 1CJEA 1J7AA 1ZP0B 2PIAA 3AB5A 4YTNB 5EE9A 4A9AA 5MPOA 1EWYC 1N60A 1I7HA 2PVOD 1JRPA 4N59A 2W3SA 2JQRB 1TYGB 3HRDD 1V97A 3P4QB 1QF6A 3P4SB 2L83A 3AEDB 3AEGB 3AEAB 3AE2B 2BS2B 2CJOA 2M56B 1N5XA 3NVZA 1J7BA 4JWUC 3VR9B 2WU2B 3P1MA 3P4PB 2E3TA 1QOBA 2CJNA 2M19A 1FFUA 1TKEA 1YJIA 2AX5A 3AE6B 3AEBB 1N62A 2WQYB 3AN1A 3LXFA 1DOYA 4HRSA 2L52A 2OHFA 1FFVA 4WWMA 3W5VB 3HVZA 2FBWB 2QIEB 1SB3C 1ZOYB 2DBYA 3SFEB 3WCQA 1JALA 5EE3A 4USAA 1RWSA
chains in the Genus database with same CATH superfamily
4IG7B 4JE3B 4IWPA 3O13A 2Z0DB 1VCBA 1NEKB 4ZHOA 2I1KA 2KQ7A 4JGHB 1J8CA 1D3ZA 3RN9C 2WDQB 2HJ1A 2WU5B 4JQWC 4ANWA 4EEWA 3K9OB 3MJ5A 4OZBA 3DBRI 2C60A 4AQ7A 4PS8A 4RGNA 3VRBB 4DDID 2WHIA 4A20A 1KJTA 1UWXA 1WY8A 3R7RA 2REXA 3ZGZA 1V2YA 4HDOA 4O1NA 1XLOA 4FXCA 2WDTB 5J18A 4DK5A 3RFZB 2KHWB 4MGIE 2L05A 4YT0B 1XO3A 3W1SA 3BYTB 3NZSA 3FILA 4GU2A 3NS1A 4FADA 2R61A 1FXIA 3CSFA 2DZMA 2LHEA 4MM3A 3RNCC 4BBNF 4KDLB 1PUTA 2N9XA 1I35A 3MJWA 2DZIA 2KT7A 2JY6A 3MHZA 3JSVA 2JXTA 5D94A 1TS5A 2GBJA 5TSSA 3ALBA 2MP2A 4MH0E 4DHJB 3J9CA 4HCPB 3AEDB 3IAS1 4E3CA 3VR9B 3IVFA 4WIPA 2WXPA 1DOYA 1EO6A 3PHWB 1EF5A 2M8SA 1FFVA 3QARA 4GGQA 1ROEA 1UGMA 3DWGC 2J7QB 3UIOB 1LFDA 1GG3A 2J0MA 1E7UA 4IKGA 1WMHA 2J53A 2WXQA 3VQIA 1Q0WB 2KDIA 4LLGM 1U4AA 1P7FA 1J7CA 2LHDA 4RGTA 2KJ6A 3PZDA 1RLFA 3P42A 1QOAA 4C4VB 2UYZB 5G2NA 3DVGY 3PGEA 1T0SC 2DZJA 3SEBA 1UUPA 1SGHA 3DHGC 3BINA 3WANA 2LI5A 1YQ3B 2NBWB 1VDVA 2G4DB 4NJ7A 2LGDA 3V61A 3A33B 2ACZB 1IBXB 3V3XA 3AH7A 5KHQA 4KSLC 4C7YA 2XBBC 3R2IA 1OQQA 2EMSA 1STEA 1V5OA 4YTMB 1F1HA 4IWOA 2RPQA 2M4NA 2DWQA 1JROA 3ZTCA 1TZ1A 3EFUA 3VH3B 3ZW3A 1N60A 1TGZB 3Q3FA 3OAWA 1WGDA 1JWSD 2C5LC 1QF6A 3AE2B 3GE8C 4FJZA 4JWUC 5AZHA 2BB6A 3P4PB 1GC7A 4FJYA 3C19A 3TBLD 2M19A 1KLVA 3AN1A 1HA5A 2JWUA 2BPSA 2HDEA 3ZRFA 3MP9A 2KC1A 3DHHC 4RMAA 2QC8A 3X23A 1K8RB 3ZNHB 1JCKB 3Q8FA 4MSQB 3APDA 3AV8A 2LXCA 4XWWA 1C79A 4KGSA 4YL8A 3NVWA 2BT6A 3NRZA 2WP9B 2G1EA 2X8XX 2KO3A 2BS4B 2XEWA 1B1ZA 3VHTC 1WXAA 3EFCA 3NS8A 4H2AA 4S0RA 2SEBD 4CYEA 2LEKA 1MHHE 4KV2A 2NBVB 1TT5B 4LNOA 1N63A 3V60A 3AEEB 2HTME 1JW9D 4KIKB 4NNJB 2J4XA 5CHVC 5GXGB 3WAPA 4ZRJA 3ONSA 4MDKE 1RM6C 1R4NB 3QAQA 3AE9B 3GOEA 3NZ3A 5IAAC 1ZE3D 3BVZA 2MBOA 3RNEC 2JZZA 3RD2A 1GJZA 4RCOA 2ASQA 2D2QA 1I4PA 3PLUA 1UD7A 1L0XB 2WDVB 4CQNA 4W9GA 3W1SC 2IBIB 3W5UB 2ZVOA 4ZRQA 2FIDA 3H7PA 2Y5PA 3WAMA 1VZ8A 1L0VB 2FUHB 2KN4A 2AYOB 3RZFA 2ONQA 1C1YB 1TYGB 2K8BA 3KYCD 2BYVE 1V81A 1N5XA 5BYSA 1J7BA 3DBHB 1D6EC 3UI3A 4LNNA 4NQLB 4A55A 2N7EA 1XT9B 1L2NA 2EKEC 3A1QA 4DQOC 2IPKD 3NOBA 4GDKB 1WJ4A 2HJ8A 3DPDA 5KHOA 2J52A 1J19A 1V49A 4WJPA 2W82A 2KFKB 5AUKA 4YSXB 2L00B 3A4SC 3KUDB 2QSDA 3PREA 1VR9A 2RDGA 4TSSA 4A6QA 1FO4A 3GS2A 2SAKA 1YMHE 2D5GA 3U7DA 1EWCA 2IYDB 3SU8X 4BKTA 1BUIC 3DBLI 2W3RA 1M4VA 1ZPSA 4W9EA 1L6VA 2QDFA 2AL3A 1NYQA 2MJDA 4HVBA 3M63B 3AU5A 4NQKE 1ZGUB 2LVQA 2IGHA 1E7VA 1SIJA 1MG4A 2VZKB 2N4FA 2YVCA 3EUB2 3WA0A 2BYTA 2M0XA 4WWNA 3TL5A 1MI0A 4PYZA 2GRIA 3C0RB 1V9JA 2IO3B 4L2YA 1PGAA 4HWIB 1ET9A 5BMHA 1ENFA 2CU1A 3P4QB 1TS3A 3QC8B 4EZJA 5E6JA 1MVKA 3IFWB 3NUHB 1V5TA 2WXLA 4MM3B 4JX1C 4TV3A 2OJRA 3BK1A 2QIEB 4WWPA 1QZEA 4W9DA 3L10B 4M0WB 4S17A 3RNGC 1WR6E 1UGJA 3ZNID 2Z0EB 1UWMA 4WQMA 2KDFB 4WJQA 2Y3AA 4RF1A 3QQ8B 4GB9A 1NVID 1FMAD 1JWUD 3PTFC 5DCNA 1AYFA 3ENEA 5EE0A 2IGDA 2N9LA 3URYA 2LUEA 1LQBA 1UBQA 3RT3B 2L8JA 3KH0A 4RH6A 1DYQA 1RRBA 5HKHA 3RULA 4TUUA 2ZZPB 3M95A 2JX5A 3N1XC 1T0QC 5C2TB 1C3TA 1F77A 3TCAA 4ARCA 3D32A 1TS2A 4F8CB 1S3SG 1E8ZA 2CU3A 1SE3A 3EA6A 1L5PA 2M1MA 3ZJVA 2KQ4X 1AWDA 2O2VB 4RM9A 2R2OA 3DBLB 1V6EA 3ZKJC 2K8HA 2WGSA 3B9JA 2INPE 5G5GA 2KWUB 1WZ0A 1PFDA 3PO0A 3DWMA 4FHJA 3WALA 3L4PA 4FHKA 2LMCA 1OQRA 5CHWA 3WIMA 1V86A 3B2GA 1I4HA 2MJEA 1WMHB 1H8CA 5DPTA 2BVCA 4OVUA 4MACA 3CIRB 1CJEA 1J7AA 2PEAA 5MPOA 2JSVX 4HKZE 2W3SA 2L1AA 3L54A 3Q3OC 2I38A 1OEYJ 1SBBB 2BGFA 2J0JA 3P1MA 2GBKA 2WXRA 1H4RA 3DBHI 5I4DA 2WQYB 2O2VA 2L52A 2KFKA 1G6JA 4WQOB 3PT2B 2LGYA 2ZW1A 2CS4A 2PTLA 3QCAA 3KUCB 1AARA 1KLGD 4HK2A 4A90A 1QLBB 3PLVA 2WXJA 1WRIA 3H8HA 4OZCA 5EE1A 2K6QA 2YEPF 3R2TA 4B0MA 1ZUD2 2ZNVC 3EHVA 5LXHA 1C78A 4L23A 1I4XA 1WYWB 1K50A 3TEYA 1D5ZC 2PKOA 2PVGC 4UDUC 3UF8A 2MJ3A 4W9FA 4HEA1 3U8ZA 1R4MI 1TY2A 3OJ3A 1WGKA 4HROA 2K3UA 4ICVA 4ZRKA 3E9SA 5AUIA 3NVVA 4TKNA 4W9KA 2JT4B 1IP9A 1C4PA 2NTSA 1VJKA 2K1FA 1XEEA 5BO4B 2KZRA 3L0WB 1IYFA 3QWZB 1BXTA 5FK9C 1C9FA 1I4RA 1XF5L 2BS3B 4K7SA 3A9KA 4AJWA 1YN4A 3HK0A 2JRHA 3H7SA 4P6VF 4AS1A 4BKSA 1FNWA 4RGOS 3S2AA 1E10A 2L76A 1HTOA 2IY1B 4N59A 1V97A 2BYEA 4BAXA 2L83A 1ZW7A 2KXJA 1WJ6A 5BMIA 5D7GA 4REZA 1Y8RC 2KKCA 1JRUA 4KIKA 3HVZA 4USAA 4RF0A 1P0RA 2RDHA 1T6BX 2DX5B 3DHIC 2KANA 2KMCA 3Q6BA 5J17A 1UZXB 4GXBA 3T8MA 2M0AA 3VUWA 3PRMB 3DOWA 1J0GA 1QILA 3PZ8A 2FE8A 2WDRB 3L17A 4HCNB 1ZDVA 1KFYB 1L7YA 4LK0M 3SR6A 1L4DB 1WX9A 2INNE 4LJPB 5AZFA 4G0NB 4YTPB 1JWAD 1EUVB 4WJNA 3C8YA 4GMVA 2JU6X 4ARIA 2GBMA 4HLEA 2PLPA 2PJHA 3AE5B 1FRDA 3AMZA 1ISNA 2ZEQA 2MBHA 3PZ7A 2MW5A 3ZTDA 2QEJC 5H8YE 4AP4C 2KVRA 4J6IA 1C4CA 5FR6A 4NAWA 4W9JA 4NPNA 2MEKA 3W9CB 2D07B 2DNFA 4E74A 1GPXA 4WH4A 3WAOA 2G3QB 2KQSA 2JWZA 1E8WA 4GN1A 5D3DA 2DHZA 2RGFA 4WAFA 4WWOA 5DPSA 2HTHA 2BB5A 2WYQA 4F7ZA 3DVNU 2D3GA 5EDSA 3AB5A 4BBNC 2WXGA 2KJHB 1I7HA 3OLMD 2MWSB 3I57A 3I9V1 1VZ6A 3N32A 2GMIC 4AUQC 2E3TA 4NAMA 4MT5A 4JL9A 2UU7A 2DAJA 4HJGE 3Q3NC 3QA8A 2LRUA 2AEHA 3ML9A 1TTNA 2JZ3B 1UBIA 3IG3A 3PVLA 2FCSA 2G9HD 1YX5B 2BKFA 3LYYA 4FN2A 2VH1A 4DBGA 1FM0D 1C77A 3BIID 5HFYA 2LFIA 2KYWA 2WX1A 2RSUA 3FKYA 5D3IB 3ZLZA 2FUG1 4EZLA 1VLBA 1E9MA 1TBEA 3VXWA 2BBCA 4AWJA 2L7RA 2QJLA 1E5WA 2NVUI 4GLSC 1OQYA 5JH5C 5IA7A 2WXNA 3AI5A 4M00A 4MH8A 1GAQB 1WJNA 2LGXA 3AM9A 2MCNB 3NHEB 1PYWD 2WLBA 4HJKA 3DQVA 1JWBD 3P2BA 1YIWA 2KNBA 4KGTA 3AE1B 1XQQA 4IW0A 4XC2A 3R3MA 4YWGG 5FKAC 4MSMB 3EC8A 1CQVA 3M62B 2KAJA 1I42A 4P1CC 1WGGA 4OVZA 1FIQA 1I4QA 3ZVVA 3SD5A 1E90A 4A9AA 1P1AA 1JRPA 4GSWA 4K81A 2K0PA 4G11A 2BS2B 1K53A 4KSKC 1NI2A 3H6NA 3U7ZA 1F52A 4M0WA 4FJVB 2TSSA 5G55A 3TEXA 1SB3C 1ZOYB 2D3CA 4IM0A 3GE3C 2MHJA 4BOSC 2GB1A 2CKHB 4KZ0A 3MC9A 2Z8LA 2CHZA 2OOBB 3KVFB 2C7MB 2KC2A 4IC7B 1TKGA 1I4GA 4M01A 4A8XC 1DGJA 4RGMA 1ACCA 1WM3A 4ZHPA 3HIZA 4N6EB 2C7NB 3ECIA 4ANXA 2N1WA 1E6EB 2KLCA 2FCQA 2KDBA 4MJSB 4ZDVA 4DXGA 2C7HA 3KW5B 2MBBB 1R7SA 1ZXHA 2L3ZA 1VZ7A 3Q3JA 4EZKA 2N7JA 2KTRB 3VTVA 2V4IB 3HM3A 2NR2A 2X38A 1MPEA 4DHZB 4HPPA 4XWTA 2JRIB 2V3SA 4XX5A 1HE8A 1SE9A 2MH7A 2FCNA 2IO1B 2NS5A 2QILA 1E0ZA 4BFRA 2O6VB 1A70A 2Q5WD 4MGKE 1WI0A 3UGBB 1ET6A 1QT9A 3HHMA 4MGZE 1SF0A 3EGRA 1EU4A 1MFWA 3SDLC 1SXTA 2Y5BB 4B9KA 1P9DU 2O6VA 4LDTB 2Z59B 3B1LX 2DYMA 3GB1A 4JPSA 2LJIA 3KWVA 4FLHA 4OVVA 5IOIA 2BQQA 2ZW0A 3CMMB 2OHFA 3HVDA 4GDLB 3MC8A 3V62A 3VTUA 2JYEA 5T8IA 1OEYA 2LJ5A 3KQ4A 2BWFA 2N0SB 2QCZA 3IAM1 1FCCC 3JW0X 1C76A 2W54A 1TKYA 2WX0A 4ITKA 1WGYA 3R8BA 3LB8C 3FAHA 3QHTA 4K3BA 3RNBC 3JYUA 2MSED 3KLSX 4CHKA 1UF0A 3RNFC 2CHXA 3ABVB 4II2B 2RDBC 3A9KB 4B6WA 4M02A 3NZUA 3PSEB 3TIXA 3ZRCA 2IJ0A 1N61A 2KWVB 5H92C 4TQ0A 3ZQ4A 3UQBA 2N9KA 5HHDG 1TJEA 1EU3A 3GZNB 4AJYB 4K3CA 3ZO5B 3DBRB 3CWIA 4XZ4A 4DWFA 1NBFC 2HD5B 2J42A 4L1BA 3H9DA 2RR9A 1T5XD 3Q8BA 2D3AA 4I6LB 3M3JA 1YNTE 2K8CA 2NPTA 1B9RA 1T0YA 1V80A 3P63A 1TS4A 1LGRA 1KM7A 4RM8A 3NG0A 4C56C 2KD0A 2XK5A 2JF5A 3P4SB 2AQ3B 3AEAB 2JZPA 2CJOA 3SHQA 4LCDE 4IOIE 2DYBA 2WXFA 4HRSA 1PGXA 4WWMA 3WCQA 4BVUC 2LUMA 3SFEB 1XXGA 1QOFA 3OWEB 4P16A 2V3NA 1IPGA 3N9YC 1L4ZB 2RPVA 2I1JA 4K1RB 2GLSA 2LGIA 2IDYA 3AEFB 2IO2B 1ZXIA 3X0WA 4FBJB 3BZDB 4C80A 4KZCA 3T3OA 1WXSA 2EKIA 5G5HA 3RPFC 3QJZA 5HG2A 4RNAA 2KLGA 3B2FA 3UIPB 4I6PA 2ICIA 2H88B 5EE3A 2W55A 1OFFA 1TZOA 4W9IA 3VUXA 3MFGA 4XGAB 5LXIB 1RYJA 2ZPYA 3L13A 3ZJTA 4FULA 2W9NA 3BVMA 3RYTA 2LVOA 5IP4D 4X57B 3CF6E 2ZCCA 2V9HA 1HTQA 4M8NA 3MHSD 4B0EA 1S1QB 4EUTA 1QOGA 5IO9A 2V3PA 4LDTD 2Y5CA 1DOXA 3VVWB 1PDXA 5D6JB 4HKQA 3VTWA 1L0YB 2N1VA 3V05A 2PE9A 1T0RC 1WXMA 2M17A 5L95C 4YTNB 2XNAC 1ZP0B 1V1OA 2KVZA 4EOYA 3GZNI 1EWYC 2NTTA 3KYDD 3IBEA 2JQRB 3VUYA 3AEGB 3EECA 5JHBA 2GBRA 4GDKA 5E6NA 1ZKHA 4JIOU 2BTEA 3ZIMA 4TQ1A 2WU2B 1QOBA 2CJNA 3TJPA 2PW9A 2AX5A 3Q2AC 2FBWB 4HPMB 2DBYA 1JALA 1F9JA 1NYRA 3RNAC 4N58A 2A4ZA 1WX7A 1WYGA 4DHJD 2WWZA 4EFOA 1PQSA 4KX6B 2N9PC 3IHPC 4ANUA 3U4EG 1HZ5A 1HZ6A 2QMTA 1EF1A 5D2MB 4JLCA 2DENB 4EE2A 1K52A 4BOZB 2QHOA 3RZWC 4DHZE 2I2YA 1P7EA 2KWDA 3BWUD 3I63C 2ZVNA 2K22A 1SE4A 3O65B 4BKSD 2LGSA 3VRAB 1YQ4B 1Q10A 2WXKA 4E71A 4C4VA 2KK8A 1WX8A 2AQ1B 2ZNVB 4YSYB 1F0ZA 2KWCA 2LZ6A 1XCQL 4PS3A 4R3DA 1OGWA 2G4SA 5JXVA 1T3QA 4OW0A 1L6UA 1YJJA 4ZOHC 1SSNA 3KUZA 3ML8A 2K9XA 2LRWA 2KDEB 4URKA 3ZJUA 1HQRD 3TMPB 2WS3B 1AN8A 4US9A 2HE7A 2D3BA 2R2QA 4M8MA 3ZDMC 5FR3A 3RMKC 3RI7C 4ZYNA 2BW2A 3ZNGC 3QIJA 2V0GA 1WGRA 2GBNA 1Z2MA 4NJCA 5L83A 3TSSA 4G50A 4W9CA 2EMTA 1WIAA 4RFBA 4OHJA 3Q3MC 2VZKD 4P1BC 1TKEA 3OJ4B 1YJIA 1N62A 3K9PB 3N1ZC 3PRPB 2MBEA 4J3OD 3AULA 2GOWA 3ZXVA 2A5UA 2KMMA 2VH2A 4PK1A 1DOIA 5CTRC 2AL6A 2FIFA 2K6DB 1CK1A 1Y56A 5E6PA 1KRHA 3AE7B 4MJSA 5AZGA 4LNFA 1E7PB 4KKIA 1XD3B 2OEDA 3MC0B 2D11A 1YD8U 3AE3B 4C00A 3SFDB 5CX3A 3OG5A 1N5WA 4QAYA 1RAXA 3ETRA 3IXSA 3W1YA 3VDZA 1NENB 5DPWA 3N1YC 4NZLB 2AWTA 1IBXA 4ANVA 2PE6B 4IM3A 1P3QU 3ZXRA 4II3B 3NY5A 4IUMB 1GB4A 2N7DA 3VAWA 2DZKA 4KKJA 4YXDB 1FCLA 1FXTB 4IWQA 2EELA 2WXIA 1QKZA 1NI3A 4ZRPA 1P98A 3R7QA 1R4NI 2MX2A 1UNSA 1QQRA 2D10A 3VR8B 1MHXA 3DVGX 2MBQA 1SJHD 4K7UA 1M94A 4CO7A 3FILB 2NMQA 4YSZB 1FEHA 1BMLC 1E8YA 4XE0A 3QX1A 2FAZA 4ACFA 2YLMA 3CSTA 1LM8B 3N3KB 2XN9C 1XCTL 5LLIA 4DXAB 1ZDXA 3Q8CA 2O6VD 1LXDA 2KFJA 3AE6B 2MRPA 2PMVA 2BYFA 1KTKA 3U52E 2C9WB 1V1PA 2VRRB 3FC4A 4WAAA 1HEZE 3AE4B 1FRRA 1WWTA 1D5MC 2RMMA 3DVNV 3JSVB 1F2RI 4D2KA 5JHAA 4XDDA 4NY0A 3BYYB 3APCA 3A1QB 2V1YA 2IGGA 3NJTA 1VD2A 2E6XA 1WRDB 4I6NB 4JWSC 5C23A 4KGRA 2KTRA 3BVGA 2IO0B 1WZ3A 3R66C 1SE2A 5TR5A 3BK2A 3DCGA 1V8CA 3Q14C 1SEBD 4WJOA 4FA6A 2NCNA 3LJ3A 2GI9A 2G45B 1XLQA 4ASWC 3L08A 2WXOA 3TEZA 2CR5A 1LO5D 4LTUA 2NBUA 3QK0A 1WSPA 2AQ2B 5JZEB 4P7IA 3P4RB 1FNVA 3RUIB 2V4LA 2N9EB 3NVYA 1EM7A 1C4AA 1XLNA 4MEMA 5HI1A 4G3XB 3N20C 3HM6X 5DPRA 4F1SA 3UINB 5EE9A 2PVOD 2WXHA 4PS7A 2DAFA 4LNKA 3HRDD 3T3NA 3A9JA 2YEPB 4KDIC 5LNK1 1YX6B 1TIFA 3PPAA 3DDCB 4GOCA 2XK5B 1WFYA 2WNMA 5BYRA 4DDGD 1FFUA 3LXFA 4XYCA 2LXAA 3JVZX 3VH4B 3W5VB 2NPTB 1RWSA 3H7PB 2KOXA 2J0KA 3VFKA 4DXFA 4K7WA 3GP7A 4IDIA 4PYUA 3PV1A 1CMXB 1RFKA 1OTRB 4ZYSA 3Q8EA 1JWMD 2WXMA 1YN5A 2LASA 3AE8B 1GNUA 1WH3A 3V6CB 1WE7A 3U30A 1JMLA 4WURA 3V6EB 5BYQA 1FD6A 3N30A 4LNIA 1MG8A 3ZDTA 2CHWA 1FXAA 1IUEA 2KTFA 1BT0A 2BWES 1YN3A 2JUOA 4PT5A 1FNUA 1WGHA 3L16A 4ICUA 1WM2A 2RD0A 1SIFA 1YOVB 3PRZA 3Q69A 1WXQA 4ZRIA 2B3AA 1D5XC 2K5PA 3IT6B 2ZPNA 2BF8B 1MJDA 1NDDA 4MELA 1HXYD 4N9F4 1YJ1A 3KWLA 3AECB 3LDZE 1GC6A 2ZCBA 2BKRB 4NAWB 1UH6A 2LD9A 1VRAB 4A3PA 4AOFA 2KACA 4GDLA 3ZYYX 2MP2B 4C7ZA 2KX3A 1KLUD 2DLBA 4TMAB 2MQJA 1IGDA 3APFA 3ZNZB 2FCMA 3DBSA 3RCZA 3U2SC 1KOTA 1SJED 4EKUA 2KN5A 5IN7A 4OZAA 4NJ6A 4XDCA 3W2DA 1V1PB 2M56B 1WE6A 5AEKB 4BKGA 3AEBB 3A4RA 2PPHA 2JVCA 4KVGB 2KJRA 2L32A 2K25A 2L0FA 1X1MA 2LWPA 2IZVB 1F2RC 3MTNB 2H89B 2INCC 2B76B 3AU4A 1JQ4A 3PS6A 4LJOB 1CZPA 3AXCA 3Q8AA 4HXDA 3I3TB 3E56A 2INDC 3IT4B 2UWQA 3I5JC 4HPLB 3ZUNA 2KX0A 1TY0A 1AW7A 3TEWA 5J2RA 5GMVA 2LVPA 2MLBA 4US8A 1UELA 3TUOA 3A9JB 1XLPA 4Q2JA 3PHXB 1IGCA 3UQAA 1RFAA 2JYTA 4BZAA 4MGYE 2DYOA 2FNJB 1Q1OA 2ZJDA 1Q5WB 1R4MB 1KH0A 1N6ZA 5C3JB 1KF6B 1A5RA 5IKCM 3T9LA 3HUIA 2OJWA 5CHFA 1E8XA 4W9LA 1GB1A 4IM2A 3B08A 1D4BA 1FPYA 2KDMA 1GOZA 4HDQA 1GUAB 1ESFA 2PIAA 1K51A 2K39A 1YQBA 5C1ZA 1WJUA 3H1UA 4A3OA 1PGBA 1WXVA 1WF9A 1WR1A 4W9HA 2JXXA 2JPHA 3NVZA 4B95A 5BMGA 3B0AA 2KMAA 2MA9B 2IY0B 1Z5SB 2ON8A 2L0TA 4GIVA 5E6OA 3BY4B
chains in the Genus database with same CATH topology
4JE3B 2KMMA 1DOIA 3O13A 1UGJA 1NEKB 4ZHOA 1CK1A 1UWMA 2GB1A 1Y56A 4WQMA 2Z8LA 1KRHA 2Y3AA 4RF1A 3AE7B 1NVID 1E7PB 1TKGA 2WDQB 1FMAD 4KKIA 1I4GA 1JWUD 2OEDA 2WU5B 3MC0B 1AYFA 4A8XC 5EE0A 2IGDA 1DGJA 2N9LA 3MJ5A 4RGMA 3URYA 1ACCA 4OZBA 4ZHPA 4AQ7A 4RGNA 3AE3B 3VRBB 4N6EB 3SFDB 4RH6A 1DYQA 1UWXA 3ZGZA 1N5WA 1E6EB 3IXSA 3ETRA 4O1NA 1XLOA 4FXCA 3RFZB 1NENB 2JX5A 5C2TB 1F77A 4DXGA 4ARCA 4NZLB 1IBXA 1TS2A 1R7SA 1ZXHA 4YT0B 1XO3A 2CU3A 1SE3A 1VZ7A 3W1SA 3EA6A 1L5PA 2N7JA 3BYTB 1GB4A 2V4IB 3ZJVA 2KQ4X 3FILA 1AWDA 3NS1A 2X38A 4KKJA 4YXDB 1MPEA 1FCLA 2R61A 4XWTA 3B9JA 1FXIA 2EELA 2INPE 5G5GA 2LHEA 1QKZA 2WXIA 1NI3A 3PO0A 1PFDA 4ZRPA 3DWMA 1PUTA 2MH7A 1UNSA 3L4PA 1QQRA 2LMCA 1OQRA 2QILA 1E0ZA 3B2GA 3VR8B 1MHXA 1I4HA 1A70A 2MJEA 2Q5WD 1SJHD 1ET6A 3MHZA 1QT9A 2NMQA 3FILB 4YSZB 1FEHA 4MACA 2JXTA 3CIRB 1CJEA 1BMLC 1J7AA 1SF0A 1TS5A 1EU4A 3EGRA 5MPOA 2JSVX 4XE0A 4HKZE 2W3SA 2L1AA 5TSSA 1SXTA 3J9CA 3AEDB 3IAS1 2XN9C 2I38A 1XCTL 3VR9B 1SBBB 1ZDXA 2DYMA 3GB1A 3P1MA 3Q8CA 4JPSA 4WIPA 2WXPA 2WXRA 2LJIA 3KWVA 3AE6B 5I4DA 2WQYB 1DOYA 2ZW0A 2L52A 2OHFA 1FFVA 3HVDA 4GDLB 2JYEA 2ZW1A 5T8IA 2PMVA 1ROEA 3DWGC 3KQ4A 1KTKA 2PTLA 3U52E 4A90A 1KLGD 1QLBB 2N0SB 3IAM1 1V1PA 1FCCC 3FC4A 1C76A 1HEZE 2W54A 3AE4B 1TKYA 2WXJA 4IKGA 1WRIA 3H8HA 4ITKA 1FRRA 4OZCA 3R8BA 3LB8C 5EE1A 1WWTA 2J53A 1D5MC 3FAHA 2WXQA 2YEPF 2RMMA 3R2TA 3VQIA 4B0MA 1ZUD2 4LLGM 1F2RI 1P7FA 4D2KA 1J7CA 4XDDA 3KLSX 1C78A 2LHDA 4RGTA 3BYYB 4L23A 1I4XA 3P42A 3ABVB 1K50A 3TEYA 1QOAA 1D5ZC 2PKOA 2PVGC 2IGGA 4UDUC 2E6XA 2MJ3A 4HEA1 2IJ0A 1TY2A 3SEBA 1UUPA 4JWSC 4KGRA 3BVGA 1WGKA 4HROA 2K3UA 1N61A 5H92C 3E9SA 5AUIA 1YQ3B 3NVVA 4TQ0A 1SE2A 1VDVA 3ZQ4A 3BK2A 2N9KA 1V8CA 1C4PA 1SEBD 2NTSA 5HHDG 1TJEA 1VJKA 1EU3A 1XEEA 2ACZB 1IBXB 3CWIA 3V3XA 3AH7A 2GI9A 1XLQA 2J42A 2WXOA 3TEZA 4C7YA 1LO5D 1BXTA 4LTUA 4L1BA 1WSPA 2AQ2B 1OQQA 3R2IA 3P4RB 1FNVA 1T5XD 3Q8BA 5FK9C 1C9FA 1I4RA 1XF5L 2BS3B 1STEA 3NVYA 1EM7A 4YTMB 1YN4A 1C4AA 1XLNA 5HI1A 1YNTE 4P6VF 1B9RA 3P63A 4AS1A 1TS4A 1FNWA 4RGOS 1E10A 2DWQA 1JROA 5EE9A 1N60A 2PVOD 2WXHA 4C56C 4N59A 3HRDD 3T3NA 1V97A 2YEPB 5LNK1 1JWSD 3P4SB 1QF6A 2L83A 2AQ3B 3AEAB 2JZPA 3AE2B 2CJOA 4JWUC 2WNMA 5BMIA 2BB6A 3P4PB 5D7GA 4IOIE 4REZA 5BYRA 2M19A 1FFUA 3LXFA 3AN1A 2WXFA 4HRSA 1PGXA 4WWMA 3W5VB 1HA5A 3HVZA 2JWUA 3WCQA 2LUMA 3SFEB 4USAA 1RWSA 2HDEA 4RF0A 1XXGA 3MP9A 2RDHA 1QOFA 1T6BX 3OWEB 4P16A 4DXFA 3GP7A 2V3NA 3N9YC 1L4ZB 2RPVA 1JCKB 3Q8FA 2M0AA 4IDIA 2LGIA 2IDYA 3AV8A 3AEFB 4XWWA 1C79A 1ZXIA 1QILA 1RFKA 3PZ8A 2FE8A 2WDRB 3Q8EA 4KGSA 4ZYSA 1JWMD 3NVWA 3BZDB 1ZDVA 2WXMA 1KFYB 2BT6A 1YN5A 3NRZA 2WP9B 4C80A 2G1EA 4LK0M 3SR6A 2BS4B 3T3OA 1L4DB 2INNE 2EKIA 3AE8B 4YTPB 1B1ZA 5G5HA 3RPFC 1JWAD 4H2AA 5HG2A 4RNAA 2SEBD 3B2FA 1JMLA 3C8YA 2JU6X 4WURA 5BYQA 4ARIA 1FD6A 2LEKA 1MHHE 2ICIA 2PLPA 2H88B 3AE5B 5EE3A 1N63A 1FRDA 2W55A 3AEEB 1OFFA 2HTME 3AMZA 1JW9D 1TZOA 5GXGB 2J4XA 1FXAA 1IUEA 3PZ7A 3MFGA 1YN3A 2QEJC 5H8YE 4PT5A 1FNUA 1RM6C 1RYJA 3AE9B 3ZJTA 3NZ3A 1ZE3D 1C4CA 3Q69A 1WXQA 3BVZA 3BVMA 2MEKA 1D5XC 3W9CB 2K5PA 4RCOA 4B0EA 1I4PA 1GPXA 4WH4A 1L0XB 2WDVB 3IT6B 1QOGA 5D3DA 1HXYD 2V3PA 4CQNA 4WAFA 2Y5CA 3W5UB 3KWLA 3AECB 1DOXA 4ZRQA 1PDXA 4NAWB 4HKQA 2BB5A 1L0YB 1VRAB 2Y5PA 2KACA 3V05A 1VZ8A 1L0VB 3ZYYX 4C7ZA 2KN4A 3AB5A 1KLUD 1ZP0B 2XNAC 4YTNB 1V1OA 2DLBA 2WXGA 4TMAB 1EWYC 1IGDA 1I7HA 2NTTA 2ONQA 2JQRB 1TYGB 3U2SC 1SJED 3I57A 3I9V1 3AEGB 4OZAA 4XDCA 3W2DA 1VZ6A 1V1PB 2M56B 1N5XA 5BYSA 1J7BA 2BTEA 1D6EC 3UI3A 4TQ1A 2WU2B 2E3TA 1QOBA 2CJNA 2PW9A 2AX5A 3AEBB 4A55A 4NAMA 4MT5A 4HJGE 2FBWB 2DBYA 2L32A 1JALA 4DQOC 2IPKD 1NYRA 4N58A 2G9HD 1WYGA 4GDKB 1F2RC 3LYYA 2H89B 4KX6B 2B76B 1FM0D 3U4EG 1HZ5A 1HZ6A 1C77A 2QMTA 2J52A 3BIID 4EE2A 1JQ4A 1K52A 5HFYA 1CZPA 2LFIA 2W82A 3Q8AA 5D3IB 2I2YA 1P7EA 2FUG1 3E56A 2KWDA 5AUKA 4YSXB 3BWUD 1VLBA 3IT4B 1E9MA 2K22A 1SE4A 2BBCA 2QSDA 1VR9A 1TY0A 2QJLA 1YQ4B 1Q10A 1AW7A 2RDGA 4TSSA 3VRAB 2WXKA 4A6QA 4GLSC 1FO4A 3TEWA 3GS2A 2SAKA 1YMHE 2AQ1B 4YSYB 4US8A 1F0ZA 2D5GA 1XCQL 2WXNA 4R3DA 4MH8A 1EWCA 3TUOA 1GAQB 5JXVA 1T3QA 1XLPA 4Q2JA 1BUIC 3AM9A 1IGCA 1L6UA 1YJJA 2W3RA 4OW0A 4ZOHC 1M4VA 1PYWD 1SSNA 1ZPSA 1L6VA 2WLBA 1JWBD 1NYQA 2MJDA 2JYTA 4KGTA 2DYOA 3AE1B 2K9XA 1KH0A 5C3JB 3ZJUA 1HQRD 1KF6B 2WS3B 1AN8A 2IGHA 4US9A 1SIJA 4YWGG 5FKAC 1CQVA 2VZKB 3HUIA 3EUB2 2KAJA 1GB1A 2BYTA 5FR3A 1D4BA 4OVZA 1MI0A 1FIQA 1GOZA 2BW2A 2KDMA 1I4QA 2GRIA 2V0GA 1ESFA 2PIAA 4A9AA 1K51A 4L2YA 4NJCA 1PGAA 1JRPA 3TSSA 1ET9A 5BMHA 1ENFA 1PGBA 2K0PA 3P4QB 1TS3A 4RFBA 2BS2B 1MVKA 4OHJA 3NUHB 5E6JA 1K53A 2WXLA 3NVZA 4MM3B 2VZKD 5BMGA 4JX1C 3U7ZA 1TKEA 1YJIA 4M0WA 1N62A 3BK1A 2TSSA 3TEXA 2ON8A 2QIEB 1SB3C 1ZOYB 4J3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMM A;  1ROE A;  3DWG C;  1NYR A;  1QOF A;  1DOI A;  4N58 A;  1QLB B;  1WYG A;  2N0S B;  3FC4 A;  1NEK B;  2H89 B;  4KX6 B;  2W54 A;  3AE4 B;  1TKY A;  2B76 B;  1FM0 D;  4ZHO A;  1WRI A;  4IDI A;  1UWM A;  1FRR A;  4ITK A;  3LB8 C;  4WQM A;  3AV8 A;  1WWT A;  1KRH A;  3AEF B;  3FAH A;  1ZXI A;  5EE1 A;  1RFK A;  2WDR B;  3AE7 B;  3BII D;  1JQ4 A;  1ZUD 2;  3NVW A;  1CZP A;  1KFY B;  2BT6 A;  1NVI D;  3NRZ A;  4JX1 C;  2WP9 B;  1E7P B;  1TKG A;  1J7C A;  4C80 A;  2G1E A;  1FMA D;  2WDQ B;  2WU5 B;  4US8 A;  3SR6 A;  1AYF A;  2BS4 B;  5EE0 A;  2EKI A;  3AE8 B;  1DGJ A;  5AUK A;  4YTP B;  4YSX B;  1VLB A;  3ABV B;  5G5H A;  3RPF C;  4ZHP A;  1E9M A;  1JWA D;  1QOA A;  3AE3 B;  2K22 A;  3VRB B;  2PKO A;  4N6E B;  2PVG C;  3SFD B;  3B2F A;  2MJ3 A;  1N5W A;  1E6E B;  2LEK A;  2QJL A;  1YQ4 B;  3ETR A;  3VRA B;  1FO4 A;  2H88 B;  1XLO A;  3AE5 B;  1N63 A;  1NEN B;  1FRD A;  2JX5 A;  2W55 A;  4FXC A;  3AEE B;  4JWS C;  1OFF A;  2HTM E;  1WGK A;  3AMZ A;  4HRO A;  1JW9 D;  1N61 A;  5GXG B;  5C2T B;  1FXA A;  5H92 C;  1IUE A;  5AUI A;  1YQ3 B;  1R7S A;  3NVV A;  1GAQ B;  4YT0 B;  1VDV A;  5H8Y E;  1T3Q A;  1XO3 A;  1RM6 C;  1RYJ A;  1XLP A;  2CU3 A;  1L5P A;  3AE9 B;  1V8C A;  1WXQ A;  1TJE A;  1VJK A;  1L6U A;  1YJJ A;  2W3R A;  3AM9 A;  4ZOH C;  1L6V A;  2ACZ B;  2WLB A;  1AWD A;  3W9C B;  3NS1 A;  4YXD B;  1JWB D;  1NYQ A;  2K5P A;  2MJD A;  3CWI A;  3AH7 A;  3AE1 B;  3B9J A;  1F0Z A;  1FXI A;  4YSY B;  1GPX A;  2K9X A;  5G5G A;  1NI3 A;  2WDV B;  1XLQ A;  3PO0 A;  1PFD A;  1QOG A;  4C7Y A;  5C3J B;  3DWM A;  4LTU A;  1KF6 B;  1PUT A;  2WS3 B;  1OQQ A;  2MH7 A;  3L4P A;  2Y5C A;  4US9 A;  3P4R B;  3W5U B;  1OQR A;  1SIJ A;  3KWL A;  3AEC B;  1DOX A;  1E0Z A;  2BS3 B;  4C7Z A;  1PDX A;  3B2G A;  3NVY A;  3HUI A;  3VR8 B;  3EUB 2;  1A70 A;  2KAJ A;  4YTM B;  2MJE A;  1XLN A;  2Q5W D;  4P6V F;  1B9R A;  3P63 A;  1L0V B;  1QT9 A;  1FIQ A;  4YSZ B;  3ZYY X;  1E10 A;  2DWQ A;  3CIR B;  1JRO A;  1SF0 A;  1CJE A;  1J7A A;  1ZP0 B;  2PIA A;  3AB5 A;  4YTN B;  5EE9 A;  4A9A A;  5MPO A;  1EWY C;  1N60 A;  1I7H A;  2PVO D;  1JRP A;  4N59 A;  2W3S A;  2JQR B;  1TYG B;  3HRD D;  1V97 A;  3P4Q B;  1QF6 A;  3P4S B;  2L83 A;  3AED B;  3AEG B;  3AEA B;  3AE2 B;  2BS2 B;  2CJO A;  2M56 B;  1N5X A;  3NVZ A;  1J7B A;  4JWU C;  3VR9 B;  2WU2 B;  3P1M A;  3P4P B;  2E3T A;  1QOB A;  2CJN A;  2M19 A;  1FFU A;  1TKE A;  1YJI A;  2AX5 A;  3AE6 B;  3AEB B;  1N62 A;  2WQY B;  3AN1 A;  3LXF A;  1DOY A;  4HRS A;  2L52 A;  2OHF A;  1FFV A;  4WWM A;  3W5V B;  3HVZ A;  2FBW B;  2QIE B;  1SB3 C;  1ZOY B;  2DBY A;  3SFE B;  3WCQ A;  1JAL A;  5EE3 A;  4USA A;  1RWS A; 
#chains in the Genus database with same CATH topology
 4IG7 B;  4JE3 B;  4IWP A;  3O13 A;  2Z0D B;  1VCB A;  1NEK B;  4ZHO A;  2I1K A;  2KQ7 A;  4JGH B;  1J8C A;  1D3Z A;  3RN9 C;  2WDQ B;  2HJ1 A;  2WU5 B;  4JQW C;  4ANW A;  4EEW A;  3K9O B;  3MJ5 A;  4OZB A;  3DBR I;  2C60 A;  4AQ7 A;  4PS8 A;  4RGN A;  3VRB B;  4DDI D;  2WHI A;  4A20 A;  1KJT A;  1UWX A;  1WY8 A;  3R7R A;  2REX A;  3ZGZ A;  1V2Y A;  4HDO A;  4O1N A;  1XLO A;  4FXC A;  2WDT B;  5J18 A;  4DK5 A;  3RFZ B;  2KHW B;  4MGI E;  2L05 A;  4YT0 B;  1XO3 A;  3W1S A;  3BYT B;  3NZS A;  3FIL A;  4GU2 A;  3NS1 A;  4FAD A;  2R61 A;  1FXI A;  3CSF A;  2DZM A;  2LHE A;  4MM3 A;  3RNC C;  4BBN F;  4KDL B;  1PUT A;  2N9X A;  1I35 A;  3MJW A;  2DZI A;  2KT7 A;  2JY6 A;  3MHZ A;  3JSV A;  2JXT A;  5D94 A;  1TS5 A;  2GBJ A;  5TSS A;  3ALB A;  2MP2 A;  4MH0 E;  4DHJ B;  3J9C A;  4HCP B;  3AED B;  3IAS 1;  4E3C A;  3VR9 B;  3IVF A;  4WIP A;  2WXP A;  1DOY A;  1EO6 A;  3PHW B;  1EF5 A;  2M8S A;  1FFV A;  3QAR A;  4GGQ A;  1ROE A;  1UGM A;  3DWG C;  2J7Q B;  3UIO B;  1LFD A;  1GG3 A;  2J0M A;  1E7U A;  4IKG A;  1WMH A;  2J53 A;  2WXQ A;  3VQI A;  1Q0W B;  2KDI A;  4LLG M;  1U4A A;  1P7F A;  1J7C A;  2LHD A;  4RGT A;  2KJ6 A;  3PZD A;  1RLF A;  3P42 A;  1QOA A;  4C4V B;  2UYZ B;  5G2N A;  3DVG Y;  3PGE A;  1T0S C;  2DZJ A;  3SEB A;  1UUP A;  1SGH A;  3DHG C;  3BIN A;  3WAN A;  2LI5 A;  1YQ3 B;  2NBW B;  1VDV A;  2G4D B;  4NJ7 A;  2LGD A;  3V61 A;  3A33 B;  2ACZ B;  1IBX B;  3V3X A;  3AH7 A;  5KHQ A;  4KSL C;  4C7Y A;  2XBB C;  3R2I A;  1OQQ A;  2EMS A;  1STE A;  1V5O A;  4YTM B;  1F1H A;  4IWO A;  2RPQ A;  2M4N A;  2DWQ A;  1JRO A;  3ZTC A;  1TZ1 A;  3EFU A;  3VH3 B;  3ZW3 A;  1N60 A;  1TGZ B;  3Q3F A;  3OAW A;  1WGD A;  1JWS D;  2C5L C;  1QF6 A;  3AE2 B;  3GE8 C;  4FJZ A;  4JWU C;  5AZH A;  2BB6 A;  3P4P B;  1GC7 A;  4FJY A;  3C19 A;  3TBL D;  2M19 A;  1KLV A;  3AN1 A;  1HA5 A;  2JWU A;  2BPS A;  2HDE A;  3ZRF A;  3MP9 A;  2KC1 A;  3DHH C;  4RMA A;  2QC8 A;  3X23 A;  1K8R B;  3ZNH B;  1JCK B;  3Q8F A;  4MSQ B;  3APD A;  3AV8 A;  2LXC A;  4XWW A;  1C79 A;  4KGS A;  4YL8 A;  3NVW A;  2BT6 A;  3NRZ A;  2WP9 B;  2G1E A;  2X8X X;  2KO3 A;  2BS4 B;  2XEW A;  1B1Z A;  3VHT C;  1WXA A;  3EFC A;  3NS8 A;  4H2A A;  4S0R A;  2SEB D;  4CYE A;  2LEK A;  1MHH E;  4KV2 A;  2NBV B;  1TT5 B;  4LNO A;  1N63 A;  3V60 A;  3AEE B;  2HTM E;  1JW9 D;  4KIK B;  4NNJ B;  2J4X A;  5CHV C;  5GXG B;  3WAP A;  4ZRJ A;  3ONS A;  4MDK E;  1RM6 C;  1R4N B;  3QAQ A;  3AE9 B;  3GOE A;  3NZ3 A;  5IAA C;  1ZE3 D;  3BVZ A;  2MBO A;  3RNE C;  2JZZ A;  3RD2 A;  1GJZ A;  4RCO A;  2ASQ A;  2D2Q A;  1I4P A;  3PLU A;  1UD7 A;  1L0X B;  2WDV B;  4CQN A;  4W9G A;  3W1S C;  2IBI B;  3W5U B;  2ZVO A;  4ZRQ A;  2FID A;  3H7P A;  2Y5P A;  3WAM A;  1VZ8 A;  1L0V B;  2FUH B;  2KN4 A;  2AYO B;  3RZF A;  2ONQ A;  1C1Y B;  1TYG B;  2K8B A;  3KYC D;  2BYV E;  1V81 A;  1N5X A;  5BYS A;  1J7B A;  3DBH B;  1D6E C;  3UI3 A;  4LNN A;  4NQL B;  4A55 A;  2N7E A;  1XT9 B;  1L2N A;  2EKE C;  3A1Q A;  4DQO C;  2IPK D;  3NOB A;  4GDK B;  1WJ4 A;  2HJ8 A;  3DPD A;  5KHO A;  2J52 A;  1J19 A;  1V49 A;  4WJP A;  2W82 A;  2KFK B;  5AUK A;  4YSX B;  2L00 B;  3A4S C;  3KUD B;  2QSD A;  3PRE A;  1VR9 A;  2RDG A;  4TSS A;  4A6Q A;  1FO4 A;  3GS2 A;  2SAK A;  1YMH E;  2D5G A;  3U7D A;  1EWC A;  2IYD B;  3SU8 X;  4BKT A;  1BUI C;  3DBL I;  2W3R A;  1M4V A;  1ZPS A;  4W9E A;  1L6V A;  2QDF A;  2AL3 A;  1NYQ A;  2MJD A;  4HVB A;  3M63 B;  3AU5 A;  4NQK E;  1ZGU B;  2LVQ A;  2IGH A;  1E7V A;  1SIJ A;  1MG4 A;  2VZK B;  2N4F A;  2YVC A;  3EUB 2;  3WA0 A;  2BYT A;  2M0X A;  4WWN A;  3TL5 A;  1MI0 A;  4PYZ A;  2GRI A;  3C0R B;  1V9J A;  2IO3 B;  4L2Y A;  1PGA A;  4HWI B;  1ET9 A;  5BMH A;  1ENF A;  2CU1 A;  3P4Q B;  1TS3 A;  3QC8 B;  4EZJ A;  5E6J A;  1MVK A;  3IFW B;  3NUH B;  1V5T A;  2WXL A;  4MM3 B;  4JX1 C;  4TV3 A;  2OJR A;  3BK1 A;  2QIE B;  4WWP A;  1QZE A;  4W9D A;  3L10 B;  4M0W B;  4S17 A;  3RNG C;  1WR6 E;  1UGJ A;  3ZNI D;  2Z0E B;  1UWM A;  4WQM A;  2KDF B;  4WJQ A;  2Y3A A;  4RF1 A;  3QQ8 B;  4GB9 A;  1NVI D;  1FMA D;  1JWU D;  3PTF C;  5DCN A;  1AYF A;  3ENE A;  5EE0 A;  2IGD A;  2N9L A;  3URY A;  2LUE A;  1LQB A;  1UBQ A;  3RT3 B;  2L8J A;  3KH0 A;  4RH6 A;  1DYQ A;  1RRB A;  5HKH A;  3RUL A;  4TUU A;  2ZZP B;  3M95 A;  2JX5 A;  3N1X C;  1T0Q C;  5C2T B;  1C3T A;  1F77 A;  3TCA A;  4ARC A;  3D32 A;  1TS2 A;  4F8C B;  1S3S G;  1E8Z A;  2CU3 A;  1SE3 A;  3EA6 A;  1L5P A;  2M1M A;  3ZJV A;  2KQ4 X;  1AWD A;  2O2V B;  4RM9 A;  2R2O A;  3DBL B;  1V6E A;  3ZKJ C;  2K8H A;  2WGS A;  3B9J A;  2INP E;  5G5G A;  2KWU B;  1WZ0 A;  1PFD A;  3PO0 A;  3DWM A;  4FHJ A;  3WAL A;  3L4P A;  4FHK A;  2LMC A;  1OQR A;  5CHW A;  3WIM A;  1V86 A;  3B2G A;  1I4H A;  2MJE A;  1WMH B;  1H8C A;  5DPT A;  2BVC A;  4OVU A;  4MAC A;  3CIR B;  1CJE A;  1J7A A;  2PEA A;  5MPO A;  2JSV X;  4HKZ E;  2W3S A;  2L1A A;  3L54 A;  3Q3O C;  2I38 A;  1OEY J;  1SBB B;  2BGF A;  2J0J A;  3P1M A;  2GBK A;  2WXR A;  1H4R A;  3DBH I;  5I4D A;  2WQY B;  2O2V A;  2L52 A;  2KFK A;  1G6J A;  4WQO B;  3PT2 B;  2LGY A;  2ZW1 A;  2CS4 A;  2PTL A;  3QCA A;  3KUC B;  1AAR A;  1KLG D;  4HK2 A;  4A90 A;  1QLB B;  3PLV A;  2WXJ A;  1WRI A;  3H8H A;  4OZC A;  5EE1 A;  2K6Q A;  2YEP F;  3R2T A;  4B0M A;  1ZUD 2;  2ZNV C;  3EHV A;  5LXH A;  1C78 A;  4L23 A;  1I4X A;  1WYW B;  1K50 A;  3TEY A;  1D5Z C;  2PKO A;  2PVG C;  4UDU C;  3UF8 A;  2MJ3 A;  4W9F A;  4HEA 1;  3U8Z A;  1R4M I;  1TY2 A;  3OJ3 A;  1WGK A;  4HRO A;  2K3U A;  4ICV A;  4ZRK A;  3E9S A;  5AUI A;  3NVV A;  4TKN A;  4W9K A;  2JT4 B;  1IP9 A;  1C4P A;  2NTS A;  1VJK A;  2K1F A;  1XEE A;  5BO4 B;  2KZR A;  3L0W B;  1IYF A;  3QWZ B;  1BXT A;  5FK9 C;  1C9F A;  1I4R A;  1XF5 L;  2BS3 B;  4K7S A;  3A9K A;  4AJW A;  1YN4 A;  3HK0 A;  2JRH A;  3H7S A;  4P6V F;  4AS1 A;  4BKS A;  1FNW A;  4RGO S;  3S2A A;  1E10 A;  2L76 A;  1HTO A;  2IY1 B;  4N59 A;  1V97 A;  2BYE A;  4BAX A;  2L83 A;  1ZW7 A;  2KXJ A;  1WJ6 A;  5BMI A;  5D7G A;  4REZ A;  1Y8R C;  2KKC A;  1JRU A;  4KIK A;  3HVZ A;  4USA A;  4RF0 A;  1P0R A;  2RDH A;  1T6B X;  2DX5 B;  3DHI C;  2KAN A;  2KMC A;  3Q6B A;  5J17 A;  1UZX B;  4GXB A;  3T8M A;  2M0A A;  3VUW A;  3PRM B;  3DOW A;  1J0G A;  1QIL A;  3PZ8 A;  2FE8 A;  2WDR B;  3L17 A;  4HCN B;  1ZDV A;  1KFY B;  1L7Y A;  4LK0 M;  3SR6 A;  1L4D B;  1WX9 A;  2INN E;  4LJP B;  5AZF A;  4G0N B;  4YTP B;  1JWA D;  1EUV B;  4WJN A;  3C8Y A;  4GMV A;  2JU6 X;  4ARI A;  2GBM A;  4HLE A;  2PLP A;  2PJH A;  3AE5 B;  1FRD A;  3AMZ A;  1ISN A;  2ZEQ A;  2MBH A;  3PZ7 A;  2MW5 A;  3ZTD A;  2QEJ C;  5H8Y E;  4AP4 C;  2KVR A;  4J6I A;  1C4C A;  5FR6 A;  4NAW A;  4W9J A;  4NPN A;  2MEK A;  3W9C B;  2D07 B;  2DNF A;  4E74 A;  1GPX A;  4WH4 A;  3WAO A;  2G3Q B;  2KQS A;  2JWZ A;  1E8W A;  4GN1 A;  5D3D A;  2DHZ A;  2RGF A;  4WAF A;  4WWO A;  5DPS A;  2HTH A;  2BB5 A;  2WYQ A;  4F7Z A;  3DVN U;  2D3G A;  5EDS A;  3AB5 A;  4BBN C;  2WXG A;  2KJH B;  1I7H A;  3OLM D;  2MWS B;  3I57 A;  3I9V 1;  1VZ6 A;  3N32 A;  2GMI C;  4AUQ C;  2E3T A;  4NAM A;  4MT5 A;  4JL9 A;  2UU7 A;  2DAJ A;  4HJG E;  3Q3N C;  3QA8 A;  2LRU A;  2AEH A;  3ML9 A;  1TTN A;  2JZ3 B;  1UBI A;  3IG3 A;  3PVL A;  2FCS A;  2G9H D;  1YX5 B;  2BKF A;  3LYY A;  4FN2 A;  2VH1 A;  4DBG A;  1FM0 D;  1C77 A;  3BII D;  5HFY A;  2LFI A;  2KYW A;  2WX1 A;  2RSU A;  3FKY A;  5D3I B;  3ZLZ A;  2FUG 1;  4EZL A;  1VLB A;  1E9M A;  1TBE A;  3VXW A;  2BBC A;  4AWJ A;  2L7R A;  2QJL A;  1E5W A;  2NVU I;  4GLS C;  1OQY A;  5JH5 C;  5IA7 A;  2WXN A;  3AI5 A;  4M00 A;  4MH8 A;  1GAQ B;  1WJN A;  2LGX A;  3AM9 A;  2MCN B;  3NHE B;  1PYW D;  2WLB A;  4HJK A;  3DQV A;  1JWB D;  3P2B A;  1YIW A;  2KNB A;  4KGT A;  3AE1 B;  1XQQ A;  4IW0 A;  4XC2 A;  3R3M A;  4YWG G;  5FKA C;  4MSM B;  3EC8 A;  1CQV A;  3M62 B;  2KAJ A;  1I42 A;  4P1C C;  1WGG A;  4OVZ A;  1FIQ A;  1I4Q A;  3ZVV A;  3SD5 A;  1E90 A;  4A9A A;  1P1A A;  1JRP A;  4GSW A;  4K81 A;  2K0P A;  4G11 A;  2BS2 B;  1K53 A;  4KSK C;  1NI2 A;  3H6N A;  3U7Z A;  1F52 A;  4M0W A;  4FJV B;  2TSS A;  5G55 A;  3TEX A;  1SB3 C;  1ZOY B;  2D3C A;  4IM0 A;  3GE3 C;  2MHJ A;  4BOS C;  2GB1 A;  2CKH B;  4KZ0 A;  3MC9 A;  2Z8L A;  2CHZ A;  2OOB B;  3KVF B;  2C7M B;  2KC2 A;  4IC7 B;  1TKG A;  1I4G A;  4M01 A;  4A8X C;  1DGJ A;  4RGM A;  1ACC A;  1WM3 A;  4ZHP A;  3HIZ A;  4N6E B;  2C7N B;  3ECI A;  4ANX A;  2N1W A;  1E6E B;  2KLC A;  2FCQ A;  2KDB A;  4MJS B;  4ZDV A;  4DXG A;  2C7H A;  3KW5 B;  2MBB B;  1R7S A;  1ZXH A;  2L3Z A;  1VZ7 A;  3Q3J A;  4EZK A;  2N7J A;  2KTR B;  3VTV A;  2V4I B;  3HM3 A;  2NR2 A;  2X38 A;  1MPE A;  4DHZ B;  4HPP A;  4XWT A;  2JRI B;  2V3S A;  4XX5 A;  1HE8 A;  1SE9 A;  2MH7 A;  2FCN A;  2IO1 B;  2NS5 A;  2QIL A;  1E0Z A;  4BFR A;  2O6V B;  1A70 A;  2Q5W D;  4MGK E;  1WI0 A;  3UGB B;  1ET6 A;  1QT9 A;  3HHM A;  4MGZ E;  1SF0 A;  3EGR A;  1EU4 A;  1MFW A;  3SDL C;  1SXT A;  2Y5B B;  4B9K A;  1P9D U;  2O6V A;  4LDT B;  2Z59 B;  3B1L X;  2DYM A;  3GB1 A;  4JPS A;  2LJI A;  3KWV A;  4FLH A;  4OVV A;  5IOI A;  2BQQ A;  2ZW0 A;  3CMM B;  2OHF A;  3HVD A;  4GDL B;  3MC8 A;  3V62 A;  3VTU A;  2JYE A;  5T8I A;  1OEY A;  2LJ5 A;  3KQ4 A;  2BWF A;  2N0S B;  2QCZ A;  3IAM 1;  1FCC C;  3JW0 X;  1C76 A;  2W54 A;  1TKY A;  2WX0 A;  4ITK A;  1WGY A;  3R8B A;  3LB8 C;  3FAH A;  3QHT A;  4K3B A;  3RNB C;  3JYU A;  2MSE D;  3KLS X;  4CHK A;  1UF0 A;  3RNF C;  2CHX A;  3ABV B;  4II2 B;  2RDB C;  3A9K B;  4B6W A;  4M02 A;  3NZU A;  3PSE B;  3TIX A;  3ZRC A;  2IJ0 A;  1N61 A;  2KWV B;  5H92 C;  4TQ0 A;  3ZQ4 A;  3UQB A;  2N9K A;  5HHD G;  1TJE A;  1EU3 A;  3GZN B;  4AJY B;  4K3C A;  3ZO5 B;  3DBR B;  3CWI A;  4XZ4 A;  4DWF A;  1NBF C;  2HD5 B;  2J42 A;  4L1B A;  3H9D A;  2RR9 A;  1T5X D;  3Q8B A;  2D3A A;  4I6L B;  3M3J A;  1YNT E;  2K8C A;  2NPT A;  1B9R A;  1T0Y A;  1V80 A;  3P63 A;  1TS4 A;  1LGR A;  1KM7 A;  4RM8 A;  3NG0 A;  4C56 C;  2KD0 A;  2XK5 A;  2JF5 A;  3P4S B;  2AQ3 B;  3AEA B;  2JZP A;  2CJO A;  3SHQ A;  4LCD E;  4IOI E;  2DYB A;  2WXF A;  4HRS A;  1PGX A;  4WWM A;  3WCQ A;  4BVU C;  2LUM A;  3SFE B;  1XXG A;  1QOF A;  3OWE B;  4P16 A;  2V3N A;  1IPG A;  3N9Y C;  1L4Z B;  2RPV A;  2I1J A;  4K1R B;  2GLS A;  2LGI A;  2IDY A;  3AEF B;  2IO2 B;  1ZXI A;  3X0W A;  4FBJ B;  3BZD B;  4C80 A;  4KZC A;  3T3O A;  1WXS A;  2EKI A;  5G5H A;  3RPF C;  3QJZ A;  5HG2 A;  4RNA A;  2KLG A;  3B2F A;  3UIP B;  4I6P A;  2ICI A;  2H88 B;  5EE3 A;  2W55 A;  1OFF A;  1TZO A;  4W9I A;  3VUX A;  3MFG A;  4XGA B;  5LXI B;  1RYJ A;  2ZPY A;  3L13 A;  3ZJT A;  4FUL A;  2W9N A;  3BVM A;  3RYT A;  2LVO A;  5IP4 D;  4X57 B;  3CF6 E;  2ZCC A;  2V9H A;  1HTQ A;  4M8N A;  3MHS D;  4B0E A;  1S1Q B;  4EUT A;  1QOG A;  5IO9 A;  2V3P A;  4LDT D;  2Y5C A;  1DOX A;  3VVW B;  1PDX A;  5D6J B;  4HKQ A;  3VTW A;  1L0Y B;  2N1V A;  3V05 A;  2PE9 A;  1T0R C;  1WXM A;  2M17 A;  5L95 C;  4YTN B;  2XNA C;  1ZP0 B;  1V1O A;  2KVZ A;  4EOY A;  3GZN I;  1EWY C;  2NTT A;  3KYD D;  3IBE A;  2JQR B;  3VUY A;  3AEG B;  3EEC A;  5JHB A;  2GBR A;  4GDK A;  5E6N A;  1ZKH A;  4JIO U;  2BTE A;  3ZIM A;  4TQ1 A;  2WU2 B;  1QOB A;  2CJN A;  3TJP A;  2PW9 A;  2AX5 A;  3Q2A C;  2FBW B;  4HPM B;  2DBY A;  1JAL A;  1F9J A;  1NYR A;  3RNA C;  4N58 A;  2A4Z A;  1WX7 A;  1WYG A;  4DHJ D;  2WWZ A;  4EFO A;  1PQS A;  4KX6 B;  2N9P C;  3IHP C;  4ANU A;  3U4E G;  1HZ5 A;  1HZ6 A;  2QMT A;  1EF1 A;  5D2M B;  4JLC A;  2DEN B;  4EE2 A;  1K52 A;  4BOZ B;  2QHO A;  3RZW C;  4DHZ E;  2I2Y A;  1P7E A;  2KWD A;  3BWU D;  3I63 C;  2ZVN A;  2K22 A;  1SE4 A;  3O65 B;  4BKS D;  2LGS A;  3VRA B;  1YQ4 B;  1Q10 A;  2WXK A;  4E71 A;  4C4V A;  2KK8 A;  1WX8 A;  2AQ1 B;  2ZNV B;  4YSY B;  1F0Z A;  2KWC A;  2LZ6 A;  1XCQ L;  4PS3 A;  4R3D A;  1OGW A;  2G4S A;  5JXV A;  1T3Q A;  4OW0 A;  1L6U A;  1YJJ A;  4ZOH C;  1SSN A;  3KUZ A;  3ML8 A;  2K9X A;  2LRW A;  2KDE B;  4URK A;  3ZJU A;  1HQR D;  3TMP B;  2WS3 B;  1AN8 A;  4US9 A;  2HE7 A;  2D3B A;  2R2Q A;  4M8M A;  3ZDM C;  5FR3 A;  3RMK C;  3RI7 C;  4ZYN A;  2BW2 A;  3ZNG C;  3QIJ A;  2V0G A;  1WGR A;  2GBN A;  1Z2M A;  4NJC A;  5L83 A;  3TSS A;  4G50 A;  4W9C A;  2EMT A;  1WIA A;  4RFB A;  4OHJ A;  3Q3M C;  2VZK D;  4P1B C;  1TKE A;  3OJ4 B;  1YJI A;  1N62 A;  3K9P B;  3N1Z C;  3PRP B;  2MBE A;  4J3O D;  3AUL A;  2GOW A;  3ZXV A;  2A5U A;  2KMM A;  2VH2 A;  4PK1 A;  1DOI A;  5CTR C;  2AL6 A;  2FIF A;  2K6D B;  1CK1 A;  1Y56 A;  5E6P A;  1KRH A;  3AE7 B;  4MJS A;  5AZG A;  4LNF A;  1E7P B;  4KKI A;  1XD3 B;  2OED A;  3MC0 B;  2D11 A;  1YD8 U;  3AE3 B;  4C00 A;  3SFD B;  5CX3 A;  3OG5 A;  1N5W A;  4QAY A;  1RAX A;  3ETR A;  3IXS A;  3W1Y A;  3VDZ A;  1NEN B;  5DPW A;  3N1Y C;  4NZL B;  2AWT A;  1IBX A;  4ANV A;  2PE6 B;  4IM3 A;  1P3Q U;  3ZXR A;  4II3 B;  3NY5 A;  4IUM B;  1GB4 A;  2N7D A;  3VAW A;  2DZK A;  4KKJ A;  4YXD B;  1FCL A;  1FXT B;  4IWQ A;  2EEL A;  2WXI A;  1QKZ A;  1NI3 A;  4ZRP A;  1P98 A;  3R7Q A;  1R4N I;  2MX2 A;  1UNS A;  1QQR A;  2D10 A;  3VR8 B;  1MHX A;  3DVG X;  2MBQ A;  1SJH D;  4K7U A;  1M94 A;  4CO7 A;  3FIL B;  2NMQ A;  4YSZ B;  1FEH A;  1BML C;  1E8Y A;  4XE0 A;  3QX1 A;  2FAZ A;  4ACF A;  2YLM A;  3CST A;  1LM8 B;  3N3K B;  2XN9 C;  1XCT L;  5LLI A;  4DXA B;  1ZDX A;  3Q8C A;  2O6V D;  1LXD A;  2KFJ A;  3AE6 B;  2MRP A;  2PMV A;  2BYF A;  1KTK A;  3U52 E;  2C9W B;  1V1P A;  2VRR B;  3FC4 A;  4WAA A;  1HEZ E;  3AE4 B;  1FRR A;  1WWT A;  1D5M C;  2RMM A;  3DVN V;  3JSV B;  1F2R I;  4D2K A;  5JHA A;  4XDD A;  4NY0 A;  3BYY B;  3APC A;  3A1Q B;  2V1Y A;  2IGG A;  3NJT A;  1VD2 A;  2E6X A;  1WRD B;  4I6N B;  4JWS C;  5C23 A;  4KGR A;  2KTR A;  3BVG A;  2IO0 B;  1WZ3 A;  3R66 C;  1SE2 A;  5TR5 A;  3BK2 A;  3DCG A;  1V8C A;  3Q14 C;  1SEB D;  4WJO A;  4FA6 A;  2NCN A;  3LJ3 A;  2GI9 A;  2G45 B;  1XLQ A;  4ASW C;  3L08 A;  2WXO A;  3TEZ A;  2CR5 A;  1LO5 D;  4LTU A;  2NBU A;  3QK0 A;  1WSP A;  2AQ2 B;  5JZE B;  4P7I A;  3P4R B;  1FNV A;  3RUI B;  2V4L A;  2N9E B;  3NVY A;  1EM7 A;  1C4A A;  1XLN A;  4MEM A;  5HI1 A;  4G3X B;  3N20 C;  3HM6 X;  5DPR A;  4F1S A;  3UIN B;  5EE9 A;  2PVO D;  2WXH A;  4PS7 A;  2DAF A;  4LNK A;  3HRD D;  3T3N A;  3A9J A;  2YEP B;  4KDI C;  5LNK 1;  1YX6 B;  1TIF A;  3PPA A;  3DDC B;  4GOC A;  2XK5 B;  1WFY A;  2WNM A;  5BYR A;  4DDG D;  1FFU A;  3LXF A;  4XYC A;  2LXA A;  3JVZ X;  3VH4 B;  3W5V B;  2NPT B;  1RWS A;  3H7P B;  2KOX A;  2J0K A;  3VFK A;  4DXF A;  4K7W A;  3GP7 A;  4IDI A;  4PYU A;  3PV1 A;  1CMX B;  1RFK A;  1OTR B;  4ZYS A;  3Q8E A;  1JWM D;  2WXM A;  1YN5 A;  2LAS A;  3AE8 B;  1GNU A;  1WH3 A;  3V6C B;  1WE7 A;  3U30 A;  1JML A;  4WUR A;  3V6E B;  5BYQ A;  1FD6 A;  3N30 A;  4LNI A;  1MG8 A;  3ZDT A;  2CHW A;  1FXA A;  1IUE A;  2KTF A;  1BT0 A;  2BWE S;  1YN3 A;  2JUO A;  4PT5 A;  1FNU A;  1WGH A;  3L16 A;  4ICU A;  1WM2 A;  2RD0 A;  1SIF A;  1YOV B;  3PRZ A;  3Q69 A;  1WXQ A;  4ZRI A;  2B3A A;  1D5X C;  2K5P A;  3IT6 B;  2ZPN A;  2BF8 B;  1MJD A;  1NDD A;  4MEL A;  1HXY D;  4N9F 4;  1YJ1 A;  3KWL A;  3AEC B;  3LDZ E;  1GC6 A;  2ZCB A;  2BKR B;  4NAW B;  1UH6 A;  2LD9 A;  1VRA B;  4A3P A;  4AOF A;  2KAC A;  4GDL A;  3ZYY X;  2MP2 B;  4C7Z A;  2KX3 A;  1KLU D;  2DLB A;  4TMA B;  2MQJ A;  1IGD A;  3APF A;  3ZNZ B;  2FCM A;  3DBS A;  3RCZ A;  3U2S C;  1KOT A;  1SJE D;  4EKU A;  2KN5 A;  5IN7 A;  4OZA A;  4NJ6 A;  4XDC A;  3W2D A;  1V1P B;  2M56 B;  1WE6 A;  5AEK B;  4BKG A;  3AEB B;  3A4R A;  2PPH A;  2JVC A;  4KVG B;  2KJR A;  2L32 A;  2K25 A;  2L0F A;  1X1M A;  2LWP A;  2IZV B;  1F2R C;  3MTN B;  2H89 B;  2INC C;  2B76 B;  3AU4 A;  1JQ4 A;  3PS6 A;  4LJO B;  1CZP A;  3AXC A;  3Q8A A;  4HXD A;  3I3T B;  3E56 A;  2IND C;  3IT4 B;  2UWQ A;  3I5J C;  4HPL B;  3ZUN A;  2KX0 A;  1TY0 A;  1AW7 A;  3TEW A;  5J2R A;  5GMV A;  2LVP A;  2MLB A;  4US8 A;  1UEL A;  3TUO A;  3A9J B;  1XLP A;  4Q2J A;  3PHX B;  1IGC A;  3UQA A;  1RFA A;  2JYT A;  4BZA A;  4MGY E;  2DYO A;  2FNJ B;  1Q1O A;  2ZJD A;  1Q5W B;  1R4M B;  1KH0 A;  1N6Z A;  5C3J B;  1KF6 B;  1A5R A;  5IKC M;  3T9L A;  3HUI A;  2OJW A;  5CHF A;  1E8X A;  4W9L A;  1GB1 A;  4IM2 A;  3B08 A;  1D4B A;  1FPY A;  2KDM A;  1GOZ A;  4HDQ A;  1GUA B;  1ESF A;  2PIA A;  1K51 A;  2K39 A;  1YQB A;  5C1Z A;  1WJU A;  3H1U A;  4A3O A;  1PGB A;  1WXV A;  1WF9 A;  1WR1 A;  4W9H A;  2JXX A;  2JPH A;  3NVZ A;  4B95 A;  5BMG A;  3B0A A;  2KMA A;  2MA9 B;  2IY0 B;  1Z5S B;  2ON8 A;  2L0T A;  4GIV A;  5E6O A;  3BY4 B; 
#chains in the Genus database with same CATH homology
 4JE3 B;  2KMM A;  1DOI A;  3O13 A;  1UGJ A;  1NEK B;  4ZHO A;  1CK1 A;  1UWM A;  2GB1 A;  1Y56 A;  4WQM A;  2Z8L A;  1KRH A;  2Y3A A;  4RF1 A;  3AE7 B;  1NVI D;  1E7P B;  1TKG A;  2WDQ B;  1FMA D;  4KKI A;  1I4G A;  1JWU D;  2OED A;  2WU5 B;  3MC0 B;  1AYF A;  4A8X C;  5EE0 A;  2IGD A;  1DGJ A;  2N9L A;  3MJ5 A;  4RGM A;  3URY A;  1ACC A;  4OZB A;  4ZHP A;  4AQ7 A;  4RGN A;  3AE3 B;  3VRB B;  4N6E B;  3SFD B;  4RH6 A;  1DYQ A;  1UWX A;  3ZGZ A;  1N5W A;  1E6E B;  3IXS A;  3ETR A;  4O1N A;  1XLO A;  4FXC A;  3RFZ B;  1NEN B;  2JX5 A;  5C2T B;  1F77 A;  4DXG A;  4ARC A;  4NZL B;  1IBX A;  1TS2 A;  1R7S A;  1ZXH A;  4YT0 B;  1XO3 A;  2CU3 A;  1SE3 A;  1VZ7 A;  3W1S A;  3EA6 A;  1L5P A;  2N7J A;  3BYT B;  1GB4 A;  2V4I B;  3ZJV A;  2KQ4 X;  3FIL A;  1AWD A;  3NS1 A;  2X38 A;  4KKJ A;  4YXD B;  1MPE A;  1FCL A;  2R61 A;  4XWT A;  3B9J A;  1FXI A;  2EEL A;  2INP E;  5G5G A;  2LHE A;  1QKZ A;  2WXI A;  1NI3 A;  3PO0 A;  1PFD A;  4ZRP A;  3DWM A;  1PUT A;  2MH7 A;  1UNS A;  3L4P A;  1QQR A;  2LMC A;  1OQR A;  2QIL A;  1E0Z A;  3B2G A;  3VR8 B;  1MHX A;  1I4H A;  1A70 A;  2MJE A;  2Q5W D;  1SJH D;  1ET6 A;  3MHZ A;  1QT9 A;  2NMQ A;  3FIL B;  4YSZ B;  1FEH A;  4MAC A;  2JXT A;  3CIR B;  1CJE A;  1BML C;  1J7A A;  1SF0 A;  1TS5 A;  1EU4 A;  3EGR A;  5MPO A;  2JSV X;  4XE0 A;  4HKZ E;  2W3S A;  2L1A A;  5TSS A;  1SXT A;  3J9C A;  3AED B;  3IAS 1;  2XN9 C;  2I38 A;  1XCT L;  3VR9 B;  1SBB B;  1ZDX A;  2DYM A;  3GB1 A;  3P1M A;  3Q8C A;  4JPS A;  4WIP A;  2WXP A;  2WXR A;  2LJI A;  3KWV A;  3AE6 B;  5I4D A;  2WQY B;  1DOY A;  2ZW0 A;  2L52 A;  2OHF A;  1FFV A;  3HVD A;  4GDL B;  2JYE A;  2ZW1 A;  5T8I A;  2PMV A;  1ROE A;  3DWG C;  3KQ4 A;  1KTK A;  2PTL A;  3U52 E;  4A90 A;  1KLG D;  1QLB B;  2N0S B;  3IAM 1;  1V1P A;  1FCC C;  3FC4 A;  1C76 A;  1HEZ E;  2W54 A;  3AE4 B;  1TKY A;  2WXJ A;  4IKG A;  1WRI A;  3H8H A;  4ITK A;  1FRR A;  4OZC A;  3R8B A;  3LB8 C;  5EE1 A;  1WWT A;  2J53 A;  1D5M C;  3FAH A;  2WXQ A;  2YEP F;  2RMM A;  3R2T A;  3VQI A;  4B0M A;  1ZUD 2;  4LLG M;  1F2R I;  1P7F A;  4D2K A;  1J7C A;  4XDD A;  3KLS X;  1C78 A;  2LHD A;  4RGT A;  3BYY B;  4L23 A;  1I4X A;  3P42 A;  3ABV B;  1K50 A;  3TEY A;  1QOA A;  1D5Z C;  2PKO A;  2PVG C;  2IGG A;  4UDU C;  2E6X A;  2MJ3 A;  4HEA 1;  2IJ0 A;  1TY2 A;  3SEB A;  1UUP A;  4JWS C;  4KGR A;  3BVG A;  1WGK A;  4HRO A;  2K3U A;  1N61 A;  5H92 C;  3E9S A;  5AUI A;  1YQ3 B;  3NVV A;  4TQ0 A;  1SE2 A;  1VDV A;  3ZQ4 A;  3BK2 A;  2N9K A;  1V8C A;  1C4P A;  1SEB D;  2NTS A;  5HHD G;  1TJE A;  1VJK A;  1EU3 A;  1XEE A;  2ACZ B;  1IBX B;  3CWI A;  3V3X A;  3AH7 A;  2GI9 A;  1XLQ A;  2J42 A;  2WXO A;  3TEZ A;  4C7Y A;  1LO5 D;  1BXT A;  4LTU A;  4L1B A;  1WSP A;  2AQ2 B;  1OQQ A;  3R2I A;  3P4R B;  1FNV A;  1T5X D;  3Q8B A;  5FK9 C;  1C9F A;  1I4R A;  1XF5 L;  2BS3 B;  1STE A;  3NVY A;  1EM7 A;  4YTM B;  1YN4 A;  1C4A A;  1XLN A;  5HI1 A;  1YNT E;  4P6V F;  1B9R A;  3P63 A;  4AS1 A;  1TS4 A;  1FNW A;  4RGO S;  1E10 A;  2DWQ A;  1JRO A;  5EE9 A;  1N60 A;  2PVO D;  2WXH A;  4C56 C;  4N59 A;  3HRD D;  3T3N A;  1V97 A;  2YEP B;  5LNK 1;  1JWS D;  3P4S B;  1QF6 A;  2L83 A;  2AQ3 B;  3AEA B;  2JZP A;  3AE2 B;  2CJO A;  4JWU C;  2WNM A;  5BMI A;  2BB6 A;  3P4P B;  5D7G A;  4IOI E;  4REZ A;  5BYR A;  2M19 A;  1FFU A;  3LXF A;  3AN1 A;  2WXF A;  4HRS A;  1PGX A;  4WWM A;  3W5V B;  1HA5 A;  3HVZ A;  2JWU A;  3WCQ A;  2LUM A;  3SFE B;  4USA A;  1RWS A;  2HDE A;  4RF0 A;  1XXG A;  3MP9 A;  2RDH A;  1QOF A;  1T6B X;  3OWE B;  4P16 A;  4DXF A;  3GP7 A;  2V3N A;  3N9Y C;  1L4Z B;  2RPV A;  1JCK B;  3Q8F A;  2M0A A;  4IDI A;  2LGI A;  2IDY A;  3AV8 A;  3AEF B;  4XWW A;  1C79 A;  1ZXI A;  1QIL A;  1RFK A;  3PZ8 A;  2FE8 A;  2WDR B;  3Q8E A;  4KGS A;  4ZYS A;  1JWM D;  3NVW A;  3BZD B;  1ZDV A;  2WXM A;  1KFY B;  2BT6 A;  1YN5 A;  3NRZ A;  2WP9 B;  4C80 A;  2G1E A;  4LK0 M;  3SR6 A;  2BS4 B;  3T3O A;  1L4D B;  2INN E;  2EKI A;  3AE8 B;  4YTP B;  1B1Z A;  5G5H A;  3RPF C;  1JWA D;  4H2A A;  5HG2 A;  4RNA A;  2SEB D;  3B2F A;  1JML A;  3C8Y A;  2JU6 X;  4WUR A;  5BYQ A;  4ARI A;  1FD6 A;  2LEK A;  1MHH E;  2ICI A;  2PLP A;  2H88 B;  3AE5 B;  5EE3 A;  1N63 A;  1FRD A;  2W55 A;  3AEE B;  1OFF A;  2HTM E;  3AMZ A;  1JW9 D;  1TZO A;  5GXG B;  2J4X A;  1FXA A;  1IUE A;  3PZ7 A;  3MFG A;  1YN3 A;  2QEJ C;  5H8Y E;  4PT5 A;  1FNU A;  1RM6 C;  1RYJ A;  3AE9 B;  3ZJT A;  3NZ3 A;  1ZE3 D;  1C4C A;  3Q69 A;  1WXQ A;  3BVZ A;  3BVM A;  2MEK A;  1D5X C;  3W9C B;  2K5P A;  4RCO A;  4B0E A;  1I4P A;  1GPX A;  4WH4 A;  1L0X B;  2WDV B;  3IT6 B;  1QOG A;  5D3D A;  1HXY D;  2V3P A;  4CQN A;  4WAF A;  2Y5C A;  3W5U B;  3KWL A;  3AEC B;  1DOX A;  4ZRQ A;  1PDX A;  4NAW B;  4HKQ A;  2BB5 A;  1L0Y B;  1VRA B;  2Y5P A;  2KAC A;  3V05 A;  1VZ8 A;  1L0V B;  3ZYY X;  4C7Z A;  2KN4 A;  3AB5 A;  1KLU D;  1ZP0 B;  2XNA C;  4YTN B;  1V1O A;  2DLB A;  2WXG A;  4TMA B;  1EWY C;  1IGD A;  1I7H A;  2NTT A;  2ONQ A;  2JQR B;  1TYG B;  3U2S C;  1SJE D;  3I57 A;  3I9V 1;  3AEG B;  4OZA A;  4XDC A;  3W2D A;  1VZ6 A;  1V1P B;  2M56 B;  1N5X A;  5BYS A;  1J7B A;  2BTE A;  1D6E C;  3UI3 A;  4TQ1 A;  2WU2 B;  2E3T A;  1QOB A;  2CJN A;  2PW9 A;  2AX5 A;  3AEB B;  4A55 A;  4NAM A;  4MT5 A;  4HJG E;  2FBW B;  2DBY A;  2L32 A;  1JAL A;  4DQO C;  2IPK D;  1NYR A;  4N58 A;  2G9H D;  1WYG A;  4GDK B;  1F2R C;  3LYY A;  2H89 B;  4KX6 B;  2B76 B;  1FM0 D;  3U4E G;  1HZ5 A;  1HZ6 A;  1C77 A;  2QMT A;  2J52 A;  3BII D;  4EE2 A;  1JQ4 A;  1K52 A;  5HFY A;  1CZP A;  2LFI A;  2W82 A;  3Q8A A;  5D3I B;  2I2Y A;  1P7E A;  2FUG 1;  3E56 A;  2KWD A;  5AUK A;  4YSX B;  3BWU D;  1VLB A;  3IT4 B;  1E9M A;  2K22 A;  1SE4 A;  2BBC A;  2QSD A;  1VR9 A;  1TY0 A;  2QJL A;  1YQ4 B;  1Q10 A;  1AW7 A;  2RDG A;  4TSS A;  3VRA B;  2WXK A;  4A6Q A;  4GLS C;  1FO4 A;  3TEW A;  3GS2 A;  2SAK A;  1YMH E;  2AQ1 B;  4YSY B;  4US8 A;  1F0Z A;  2D5G A;  1XCQ L;  2WXN A;  4R3D A;  4MH8 A;  1EWC A;  3TUO A;  1GAQ B;  5JXV A;  1T3Q A;  1XLP A;  4Q2J A;  1BUI C;  3AM9 A;  1IGC A;  1L6U A;  1YJJ A;  2W3R A;  4OW0 A;  4ZOH C;  1M4V A;  1PYW D;  1SSN A;  1ZPS A;  1L6V A;  2WLB A;  1JWB D;  1NYQ A;  2MJD A;  2JYT A;  4KGT A;  2DYO A;  3AE1 B;  2K9X A;  1KH0 A;  5C3J B;  3ZJU A;  1HQR D;  1KF6 B;  2WS3 B;  1AN8 A;  2IGH A;  4US9 A;  1SIJ A;  4YWG G;  5FKA C;  1CQV A;  2VZK B;  3HUI A;  3EUB 2;  2KAJ A;  1GB1 A;  2BYT A;  5FR3 A;  1D4B A;  4OVZ A;  1MI0 A;  1FIQ A;  1GOZ A;  2BW2 A;  2KDM A;  1I4Q A;  2GRI A;  2V0G A;  1ESF A;  2PIA A;  4A9A A;  1K51 A;  4L2Y A;  4NJC A;  1PGA A;  1JRP A;  3TSS A;  1ET9 A;  5BMH A;  1ENF A;  1PGB A;  2K0P A;  3P4Q B;  1TS3 A;  4RFB A;  2BS2 B;  1MVK A;  4OHJ A;  3NUH B;  5E6J A;  1K53 A;  2WXL A;  3NVZ A;  4MM3 B;  2VZK D;  5BMG A;  4JX1 C;  3U7Z A;  1TKE A;  1YJI A;  4M0W A;  1N62 A;  3BK1 A;  2TSS A;  3TEX A;  2ON8 A;  2QIE B;  1SB3 C;  1ZOY B;  4J3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...