1L6UA

Nmr structure of oxidized adrenodoxin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6uA00
2M19A 2AX5A 1IUEA 1YJJA 1VLBA 2MJ3A 5G5GA 4JWSC 2L52A 3P1MA 2BS2B 1V97A 4ZHPA 1FMAD 1J7CA 4YTPB 1I7HA 1A70A 1NI3A 2DBYA 2QJLA 5G5HA 1YJIA 3NRZA 1NVID 1QLBB 2WS3B 1SF0A 4WQMA 3W9CB 1AWDA 1ZXIA 2CJNA 4YTMB 1XLPA 1FFUA 2EKIA 1XLOA 2PVOD 3VR8B 2JX5A 3AE7B 4C80A 2JQRB 2WP9B 3NVWA 1N5XA 4YSZB 1R7SA 3HRDD 3LXFA 3L4PA 3HUIA 3W5VB 2MH7A 4YT0B 2N0SB 2QIEB 1PUTA 1FIQA 1NYQA 1EWYC 1VJKA 4US8A 4YSXB 1E10A 1V8CA 1ZP0B 4JX1C 3AE3B 1JRPA 2WDVB 1FRDA 3VRAB 1E0ZA 1WYGA 1N63A 2H88B 1KRHA 3FAHA 1QOGA 1XLQA 1DOYA 2W3RA 1XO3A 1XLNA 1YQ4B 3SFDB 1NYRA 1RYJA 3AB5A 3AE2B 3PO0A 2CU3A 1QT9A 3FC4A 2WDRB 2W55A 2K22A 1JW9D 1N60A 1N5WA 1QOFA 1WXQA 2PIAA 4P6VF 3ETRA 4JWUC 5C3JB 4YSYB 2WLBA 4YTNB 3P4SB 3B2FA 5H8YE 1JWBD 4FXCA 4N58A 2FBWB 4N59A 2W3SA 1QF6A 2G1EA 5AUKA 5C2TB 2CJOA 2KMMA 4ZHOA 1ROEA 3AE9B 3VRBB 1FXIA 1KFYB 2L83A 4N6EB 4USAA 1TKEA 3AEDB 4ITKA 3AN1A 1CZPA 1J7AA 3DWGC 3AEBB 1DGJA 2WQYB 4WWMA 3WCQA 3P4PB 1E7PB 1NEKB 1FRRA 3AMZA 3KWLA 2K9XA 3NVYA 2OHFA 3CIRB 1JALA 5EE3A 1TYGB 3DWMA 4YXDB 1WRIA 4C7ZA 4KX6B 1GPXA 1JROA 1E6EB 2W54A 2BS4B 4ZOHC 1T3QA 2PVGC 3AECB 3B9JA 2LEKA 2PKOA 3AM9A 4IDIA 1N61A 3AE5B 2K5PA 2ACZB 1QOBA 1L5PA 2MJEA 1TKGA 1FFVA 2E3TA 3EUB2 3W5UB 1B9RA 3LB8C 1JQ4A 1SIJA 2DWQA 1J7BA 3AE4B 5GXGB 1CJEA 4C7YA 1DOIA 3B2GA 3CWIA 1GAQB 5EE0A 1L6VA 1SB3C 1FM0D 2Y5CA 5H92C 1TKYA 3AEAB 1RWSA 2BT6A 1E9MA 3P4RB 5EE1A 3SR6A 1ZUD2 3SFEB 4A9AA 3NS1A 1AYFA 1OQRA 2BS3B 4HROA 3NVVA 3P63A 3RPFC 1RFKA 2WU2B 3ZYYX 1ZOYB 1RM6C 1UWMA 1NENB 1L6UA 3AE1B 3P4QB 3VR9B 1VDVA 3AV8A 1N62A 1OFFA 1WWTA 3HVZA 2KAJA 3NVZA 4LTUA 4US9A 1PFDA 1TJEA 1FXAA 2H89B 3AEFB 3ABVB 3AEEB 1PDXA 3AE8B 2Q5WD 1WGKA 1YQ3B 3AE6B 1KF6B 5EE9A 1F0ZA 1QOAA 3AH7A 3AEGB 1OQQA 2M56B 5MPOA 2WU5B 4HRSA 1DOXA 1JWAD 2B76B 1FO4A 1L0VB 3BIID 2HTME 2WDQB 2MJDA 5AUIA
chains in the Genus database with same CATH superfamily
2C7MB 3H7PA 4WQMA 1ISNA 2GOWA 2ZCCA 4FJZA 2XNAC 1N5XA 3GP7A 2MH7A 2D5GA 2UWQA 3Q69A 3HVDA 4LNKA 2GB1A 2DENB 1C1YB 4C4VA 3N1YC 2WDVB 3H8HA 2LGDA 5DPRA 1XLNA 2QHOA 2BB5A 2LVPA 2J0JA 3ZUNA 1YX5B 2JWZA 3TMPB 2KANA 4WWOA 2AYOB 1E7UA 1GC7A 4OVUA 2DYBA 3ZGZA 3X0WA 5G2NA 1D5XC 3JSVB 3ZTDA 3MHSD 1YX6B 1E7PB 1ET9A 1ET6A 3L13A 2BKRB 4MEMA 1UELA 3BVZA 2LGIA 2MBEA 3Q2AC 2KWDA 1X1MA 4RM8A 1FNUA 4WJOA 3HIZA 1HZ5A 2E3TA 3I5JC 1YJ1A 3WAPA 3DQVA 4FJYA 1WH3A 3Q8BA 2BW2A 4MGIE 2INDC 3BK1A 2KX3A 1WZ3A 4GDLA 2GLSA 5EE0A 3DDCB 2KC1A 2G4SA 1RWSA 4C00A 4HEA1 4F7ZA 2WU2B 4TQ0A 2WXNA 2KX0A 3ZKJC 1F2RI 1KH0A 3B0AA 3DBSA 3I57A 1R4NB 1F52A 3P2BA 4RGOS 3ZJTA 1ESFA 3DBRI 1WSPA 1WX9A 2PE9A 4RNAA 1BUIC 2MSED 3ZVVA 4W9IA 1L7YA 4ZRIA 4GLSC 2AX5A 3Q3JA 1NDDA 2LASA 4K7UA 2LHDA 4YTPB 5G5HA 3Q6BA 1DYQA 1NVID 4M8NA 1XCQL 4JQWC 3X23A 1EU4A 4MM3A 3T3NA 2EKIA 2ZJDA 2D3BA 3H1UA 2CHZA 4M02A 1GB1A 2MX2A 3MC8A 4XWTA 1E10A 1K8RB 1WXMA 2IO3B 2D3AA 3RCZA 3IT6B 3NJTA 3VRAB 2K25A 2KVRA 5TR5A 2KDEB 4J3OD 2WXHA 3CMMB 4LK0M 1OTRB 1WZ0A 2PIAA 4XYCA 2IGDA 2W9NA 4K3CA 5FK9C 3TEYA 2IO2B 3RT3B 2L00B 1I4HA 4HJGE 2VZKB 3R2IA 5G55A 3KYCD 2LWPA 3TL5A 3M95A 5EE3A 4X57B 1MG8A 2J42A 2FCQA 2D07B 1P1AA 2BWES 1VD2A 4DK5A 1OQYA 2QMTA 4CQNA 3A33B 2AQ1B 4LNFA 5BMGA 1Z2MA 3IT4B 3LB8C 4MGKE 2KDMA 5GXGB 3CWIA 1SB3C 2DZJA 2BYFA 3SFEB 1NI2A 4XE0A 1IYFA 3P63A 1CQVA 4K7WA 4HWIB 4REZA 4KGRA 5BO4B 2J53A 3PVLA 4IUMB 2XEWA 2LD9A 4DXFA 1QOAA 3APDA 5CHFA 1TTNA 1UZXB 2LVQA 2M0XA 2NPTA 3EECA 5BYQA 1KLVA 4H2AA 4MJSB 3PS6A 2MJ3A 3AULA 3DVGX 2JRIB 2BS2B 3VQIA 2K3UA 1I7HA 1E7VA 3RN9C 1STEA 1QLBB 2INNE 3DVNU 4YTMB 4EFOA 3DCGA 3UI3A 2XK5B 2WXJA 1WMHA 3GE8C 5HG2A 2MP2B 2MRPA 2N7DA 3VHTC 3T8MA 1XXGA 3DBHB 1P9DU 3FAHA 1UWXA 2NTTA 4IM3A 2AEHA 3VXWA 1PGBA 1JW9D 1QOFA 3PLUA 3VTUA 1I4RA 1V81A 1P0RA 3RFZB 5C2TB 4P16A 3PZ8A 3FILB 1HE8A 4N6EB 2WXMA 3MC9A 1CZPA 2WXKA 4AP4C 4DHZE 3A4SC 2KC2A 1UNSA 4OZBA 5GMVA 4FBJB 1JROA 4MJSA 4AWJA 4AUQC 3AE5B 2O2VA 2KJ6A 3ZNZB 2QCZA 1SE3A 1SXTA 1XEEA 5CTRC 3RD2A 3W1SC 4DBGA 2K39A 4ZYSA 1MHHE 3KUDB 2K8CA 1C4CA 1YMHE 5D7GA 2NVUI 1EM7A 3ZYYX 4PK1A 3H9DA 4E3CA 2RDHA 4GXBA 1F1HA 4KIKA 2ZNVC 5EE9A 1L4ZB 1KF6B 4NQKE 4LDTB 2IO0B 2WXFA 1RAXA 3V05A 1WY8A 4P7IA 3RNCC 2NR2A 1U4AA 2HJ1A 1V49A 2KHWB 3A9KA 3VR8B 1QKZA 1R7SA 1N6ZA 1JRUA 2JF5A 1KM7A 3ML9A 2DX5B 2N0SB 1FPYA 4US8A 2N9XA 2EELA 2MBQA 1JWSD 3PLVA 5JHBA 1XO3A 1IGDA 3QHTA 2KYWA 4L23A 1WJNA 4A55A 5J18A 1QILA 4FA6A 1EO6A 3WALA 2WXRA 1HA5A 2WWZA 1D6EC 2V4IB 5D2MB 2FUHB 4HDOA 1DGJA 2LFIA 4WWMA 3C0RB 1YN5A 1BMLC 3PSEB 3NVYA 3U4EG 3T3OA 2ZPYA 3DWMA 1WM2A 3RNBC 4RGTA 4XWWA 2W54A 1T3QA 4JLCA 3BZDB 3NY5A 5EDSA 1GC6A 2WX0A 1FD6A 2HTHA 3ZJVA 3DBLB 3Q8CA 4W9DA 2OEDA 1GUAB 1HTQA 3Q3OC 4KKJA 1PGXA 4DHJD 4F8CB 2AL6A 4BVUC 4MSQB 3JVZX 3P4QB 4IWQA 4RM9A 1V86A 2NBVB 1E5WA 1V1PB 4NNJB 2CHXA 2KDIA 3KW5B 1OQQA 4NAWB 2CU1A 2BF8B 3UGBB 4HRSA 1JWAD 2BVCA 1QQRA 2ZW1A 1L0VB 2UU7A 4FN2A 2HTME 5IA7A 3KYDD 3BYYB 1VLBA 3VUYA 3M62B 3PT2B 2ZW0A 2QJLA 3AI5A 3W9CB 3K9OB 2JQRB 2BB6A 1WJUA 4KKIA 2WDTB 3SD5A 2LXAA 2JY6A 3GE3C 4NJ6A 4YT0B 5CX3A 3V6EB 2ONQA 3EFUA 1I4QA 1KRHA 1XLQA 2W3RA 4HJKA 2D3CA 1Q0WB 3S2AA 4AJWA 3ONSA 4HPMB 4MSMB 4RH6A 5H8YE 2FBWB 2WGSA 1L0XB 2W3SA 2O6VB 2G1EA 5BMIA 4YWGG 3M63B 4GU2A 5D3DA 3OWEB 1T0SC 3EHVA 5E6NA 2JYEA 3U52E 4HPLB 1YN3A 4II2B 2C7HA 4A3OA 3ALBA 2L32A 4WJQA 3URYA 5I4DA 4IG7B 4KSLC 4TMAB 3VUXA 1WX7A 1TKGA 1WR1A 2NTSA 4MACA 2DWQA 5D94A 3B2GA 1GAQB 4HKZE 4XDCA 5IN7A 4AQ7A 2JXTA 1G6JA 1RLFA 2JU6X 4PS8A 1E8XA 2R2OA 2KQ7A 1IPGA 3PHWB 1HXYD 2V1YA 4HCPB 3QAQA 1OFFA 3NVZA 3PZDA 3Q3FA 4K3BA 1R4NI 3FKYA 2M56B 1T0YA 3U8ZA 1FO4A 2LZ6A 4LNOA 1BT0A 4BKGA 3LXFA 2I38A 3PTFC 2WS3B 1ZXIA 3AU4A 1FFUA 1OGWA 2V4LA 2Y5BB 2KLCA 5D6JB 5TSSA 4B0EA 2TSSA 4WWNA 4IKGA 3ZRFA 2J52A 2FE8A 5BYSA 2ZVNA 1D5ZC 2YEPB 1ENFA 2I1JA 3Q8EA 3N1XC 1J0GA 2K22A 1F2RC 1GJZA 1JWBD 4P1CC 2OJRA 1EWCA 3Q3NC 2CJOA 2LRUA 3ZDMC 1ZPSA 2FCSA 3BINA 5JZEB 2PJHA 2ZVOA 1Q1OA 2WYQA 4RGNA 3QA8A 2AL3A 5DCNA 2PVGC 4MH8A 5AEKB 4KSKC 2KLGA 1KOTA 3W5UB 1GG3A 3DHHC 5E6OA 1H8CA 2KN4A 1C4PA 1L6VA 2M17A 1AYFA 4LJOB 5L83A 3QQ8B 5DPSA 1NENB 2DAJA 1EF5A 3TEZA 2KWVB 2ICIA 3AV8A 3ZTCA 2LXCA 2OOBB 3KQ4A 3PZ7A 2MW5A 3QX1A 1PDXA 2IJ0A 4HCNB 3R7QA 2L0TA 2L1AA 3HHMA 3Q8FA 3PHXB 2WU5B 1XQQA 4W9GA 1XLOA 2HE7A 3IHPC 1B9RA 5AUIA 5LLIA 2KDFB 1T6BX 1V97A 3PPAA 1FMAD 2QDFA 1AWDA 2I1KA 4ACFA 3H6NA 3TEXA 4LNNA 1WGDA 2MBOA 2J4XA 2KTRB 4HKQA 2HJ8A 2QIEB 1FIQA 2FAZA 3NOBA 1V8CA 3M3JA 4OW0A 1E8WA 3DBHI 1NYRA 3CSFA 3JSVA 3RYTA 4M8MA 2WLBA 4N58A 4ZRQA 1MVKA 2NCNA 2MCNB 2L0FA 2PPHA 3LDZE 2KMMA 4EUTA 3VAWA 1LQBA 3SHQA 3ZIMA 2RDBC 1RRBA 2KKCA 3RULA 4BBNC 5JHAA 5DPWA 3P4PB 1JWMD 2OHFA 3V62A 2KN5A 3MFGA 4E71A 2GMIC 4UDUC 2ZEQA 3DHIC 4WWPA 4ZOHC 2QC8A 5FR6A 1VCBA 1SE4A 2IGGA 1YN4A 3BY4B 4CYEA 3I63C 1WXSA 1TKYA 2FCNA 2BKFA 3SR6A 1ZUD2 4HROA 2RPVA 3TIXA 4L2YA 3VR9B 2FIDA 2JZ3B 2PW9A 4G50A 5DPTA 3N20C 1XCTL 4B95A 2YEPF 1F0ZA 3DVNV 2B3AA 2INCC 2XBBC 3IG3A 4BZAA 3V3XA 2M8SA 3D32A 4IOIE 1E90A 2AWTA 4XX5A 1JWUD 1LGRA 3PGEA 4EZKA 1JCKB 1YJIA 3NRZA 4WJNA 1UD7A 5BMHA 3C8YA 4RMAA 2GBRA 3L0WB 4ZRJA 3ZNHB 4A6QA 5HI1A 3IAM1 2PTLA 4LJPB 1TS4A 2CU3A 4RFBA 2G9HD 1V9JA 4HDQA 4G0NB 4ANUA 3DOWA 4ZYNA 2VH2A 4Q2JA 3NZUA 3OG5A 3AN1A 3KWVA 1J7AA 1WF9A 4FJVB 2L05A 2DLBA 1TT5B 1WI0A 3MTNB 3AECB 4S0RA 2WXOA 2PKOA 1E8YA 2BQQA 1FFVA 2IYDB 3EFCA 2JRHA 1JQ4A 5J2RA 4NZLB 1Z5SB 3HM6X 2DYMA 4I6PA 5H92C 1PQSA 3DBLI 3PRMB 1RFKA 4LNIA 2KMAA 1LO5D 3GZNB 3AE1B 3V60A 4EEWA 4GDKB 3RNFC 1TBEA 2JPHA 4KDIC 1K53A 1WGKA 1YQ3B 1MG4A 4PYZA 3BWUD 3O13A 1DOXA 2XK5A 2B76B 4AS1A 5HHDG 2MP2A 1I4GA 4MELA 4OZAA 1ZDXA 2YLMA 1CMXB 1J7CA 4RCOA 4LLGM 3KUZA 4FHKA 1WYWB 2MA9B 2G45B 4W9FA 3AE7B 2RD0A 2D10A 1I42A 4MT5A 3NG0A 1NYQA 1EWYC 1HTOA 1IBXB 2DYOA 2GBMA 3L10B 1DOYA 3Q3MC 4XDDA 3FILA 1AARA 2G3QB 2IZVB 3PREA 4CO7A 3VH3B 1N60A 1H4RA 4YSYB 4W9EA 2KZRA 4MDKE 1GNUA 2C5LC 1VZ6A 2QEJC 1SSNA 3VTWA 3VRBB 2JT4B 4A20A 3TUOA 4MH0E 3H7SA 1C77A 2WQYB 2FIFA 3MC0B 1M94A 1NEKB 1FRRA 2DZKA 1TYGB 2VRRB 2NBUA 1J19A 1Q5WB 3RZFA 4GIVA 1ACCA 3VUWA 4NPNA 2MHJA 2ACZB 3VVWB 4TV3A 1D3ZA 4GSWA 3MHZA 2SAKA 3A9JB 2PE6B 1E9MA 4I6NB 1YNTE 2L3ZA 5D3IB 1OQRA 1YIWA 3R2TA 2HD5B 4TUUA 4S17A 1ZOYB 4M01A 4BOSC 1WM3A 1N62A 2DZIA 2N7EA 4TQ1A 3IFWB 3Q14C 2XN9C 2L8JA 3PRPB 3NUHB 3MJWA 2I2YA 1J7BA 3AXCA 5LXIB 3SU8X 3ZXVA 4ZHPA 2PEAA 3T9LA 2JX5A 3B08A 4IM0A 2IGHA 2LJ5A 4BKTA 4YSZB 2CS4A 1VRAB 1EUVB 1QZEA 4FHJA 1V2YA 4KVGB 3U7ZA 2UYZB 4M0WB 1JRPA 2LGXA 2IBIB 2Z0EB 4YL8A 3U7DA 4PS3A 1F77A 2GRIA 4EZLA 1NBFC 4DHJB 2BBCA 2WDRB 2W55A 1XF5L 3EGRA 2MBBB 3GOEA 4AJYB 4PS7A 3A1QB 2DNFA 1MPEA 4HPPA 2RPQA 2ASQA 4W9KA 1TKEA 1C76A 2EKEC 2OJWA 2MWSB 4WAFA 4DDID 3WCQA 2N9EB 1RFAA 4IM2A 2GI9A 1XD3B 2VH1A 3R8BA 1TY0A 2KVZA 1E6EB 2BS4B 1WGGA 2BYTA 2KFKB 2R61A 4ANVA 1C79A 1P3QU 1SIJA 1CJEA 5IP4D 4EOYA 5L95C 2Y5CA 1VZ7A 4ZRKA 3ZRCA 1V1PA 2BT6A 5EE1A 2D2QA 2BS3B 2IY1B 1A5RA 3AU5A 4NAWA 2JWUA 3TEWA 1VDVA 3HVZA 1WWTA 2LRWA 1WJ6A 2KAJA 3L08A 1MHXA 2KFJA 3QWZB 4DHZB 2GBNA 3A1QA 1WGHA 1TZ1A 1OEYJ 2CKHB 4HXDA 5G5GA 1JMLA 1YJJA 4XGAB 3Q8AA 4NQLB 1UF0A 1SE9A 1A70A 2GBJA 1SF0A 4C80A 2WNMA 2L76A 3NVWA 4I6LB 4NJCA 1HEZE 4B9KA 3H7PB 1TS5A 3UIOB 1N63A 4RF1A 2O6VA 3RZWC 4L1BA 1SIFA 4KZCA 1WXQA 4P6VF 3BK2A 3SEBA 1Y8RC 4C4VB 2ZNVB 2RGFA 1FCLA 2LVOA 1K51A 4ZHOA 1FCCC 2L83A 3QIJA 1R4MB 1C4AA 4YXDB 3CIRB 3WAMA 1WRIA 2JUOA 3EA6A 2PLPA 1YOVB 1C3TA 2CR5A 1L2NA 1L5PA 4F1SA 4EZJA 2WXPA 3OJ3A 1V80A 1I35A 1YD8U 4HK2A 3OAWA 5C23A 3AEAB 3P4RB 3K9PB 2Z0DB 2QSDA 4NJ7A 1RM6C 1I4PA 1K50A 1MI0A 2K6DB 4GDLB 4US9A 3L16A 3ABVB 3GB1A 2X38A 3JYUA 4JPSA 3QARA 4DWFA 1IUEA 3P42A 3BVMA 1NI3A 4DXGA 4B6WA 4W9CA 4WIPA 2PVOD 1ZKHA 2IY0B 2WP9B 4IW0A 3W2DA 1C9FA 3HRDD 4BOZB 1YQBA 1T5XD 3ZDTA 3UINB 1EU3A 3E56A 4BKSA 3AE3B 4MM3B 4W9HA 1UUPA 1WRDB 1Y56A 3PRZA 1QOGA 3UIPB 2KK8A 1IP9A 3AE2B 3FC4A 4A8XC 3R7RA 4W9LA 4OVVA 3QCAA 3P4SB 3IVFA 4FXCA 1SJHD 1LFDA 1KJTA 1FXIA 3AEDB 1KLGD 4IC7B 3AEBB 2D11A 4OZCA 2BPSA 3AMZA 2K9XA 3N30A 1GPXA 4GGQA 1F9JA 3B9JA 4NY0A 1XT9B 5T8IA 2JSVX 2MJEA 4GB9A 3KUCB 1AN8A 2MBHA 3ZXRA 1HZ6A 3AE4B 1GOZA 2NMQA 3DPDA 2MQJA 2LUMA 1FM0D 1C78A 3ZNID 1WX8A 2HDEA 1L0YB 4PYUA 2IPKD 3NVVA 3RPFC 3MP9A 2FNJB 4K7SA 3VDZA 1S3SG 4LTUA 2LUEA 3GZNI 1UBIA 1FXAA 2H89B 3AEFB 3J9CA 2DZMA 3AEEB 4TKNA 3AE8B 3NS8A 5J17A 2BWFA 3AH7A 3AEGB 2KDBA 4BAXA 2VZKD 4P1BC 2KTRA 5IOIA 4WURA 3IXSA 3NZSA 2L52A 2E6XA 2KJRA 2Y3AA 1WXAA 2DBYA 1EF1A 2FCMA 2N9KA 2NPTB 3UF8A 2WXQA 3L4PA 3W5VB 2K1FA 1KTKA 2LGYA 2K8BA 3KH0A 3ZNGC 4WJPA 4PT5A 1FNVA 2QILA 3KLSX 4AOFA 1FRDA 2KTFA 2H88B 5IAAC 1WMHB 2N4FA 2C9WB 4RF0A 3N32A 2PMVA 2ZCBA 2SEBD 2KWUB 2X8XX 1UH6A 2IO1B 1K52A 3B2FA 1SBBB 1M4VA 1E8ZA 3APCA 4XZ4A 4ICVA 3N3KB 5HKHA 1ZXHA 5E6JA 4LCDE 2M4NA 3TCAA 4JL9A 3KWLA 3U2SC 1JALA 3N9YC 4GMVA 3ML8A 2REXA 3WA0A 2RDGA 5IO9A 2ZZPB 1FNWA 3CF6E 3RNAC 2WXGA 4MGYE 2KT7A 2AQ3B 4IDIA 2W82A 2Z8LA 2C60A 2M1MA 1D4BA 2Y5PA 4CHKA 2ON8A 2O2VB 3NS1A 1SGHA 2KACA 2BYVE 2Z59B 1V5TA 5C1ZA 2N1WA 2KMCA 1BXTA 3R66C 3DVGY 1WIAA 3DBRB 1PFDA 1TJEA 2WX1A 2J0KA 3A4RA 2LMCA 3EC8A 3ZW3A 2WHIA 5KHOA 4KGTA 4WH4A 2CHWA 4JWSC 4ICUA 4IWPA 3QK0A 5KHQA 4KIKB 4D2KA 1J8CA 3BYTB 2J0MA 4ANWA 2BGFA 3LYYA 1I4XA 2V0GA 1V6EA 3RI7C 4FADA 2K0PA 1ZE3D 1ZP0B 4K1RB 1WR6E 4JX1C 1D5MC 3A9KB 1LXDA 1TIFA 2DAFA 4NAMA 2LGSA 3SFDB 1WFYA 4HVBA 3QJZA 3V6CB 3ZO5B 4DQOC 5BYRA 5C3JB 2BTEA 4YTNB 2JXXA 4TSSA 4GOCA 1WGYA 3RNGC 1WE6A 1P7EA 3WANA 1ROEA 3AE9B 4ITKA 2DHZA 3DWGC 2LHEA 2KD0A 2RMMA 3TSSA 2V3NA 4LDTD 1FXTB 4KX6B 1TZOA 2V3SA 4M00A 3ZLZA 1WXVA 4OHJA 2KWCA 1TGZB 1N61A 4XC2A 2KQSA 2N9PC 2GBKA 2JVCA 4B0MA 4QAYA 2L7RA 4GDKA 4FLHA 3E9SA 4ZDVA 4ANXA 3ZJUA 5LNK1 3GS2A 4A9AA 4URKA 3HK0A 3UQAA 1P7FA 2IDYA 1WGRA 1B1ZA 3OLMD 4IWOA 1MJDA 2JZPA 1P98A 2N7JA 2V3PA 1PGAA 4J6IA 1SE2A 5JH5C 4A3PA 3DHGC 4KV2A 2KJHB 3C19A 1ZDVA 3BIID 2MJDA 4OVZA 1UGMA 1T0QC 1KLUD 4C56C 3BVGA 2G4DB 1V1OA 2A5UA 1XLPA 3HM3A 1IBXA 1MFWA 2J7QB 3JW0X 3ECIA 4WQOB 4BFRA 2NBWB 3VTVA 2JZZA 1VJKA 3APFA 3KVFB 5IKCM 3MJ5A 4W9JA 4YSXB 2WXIA 3RUIB 4A90A 2BYEA 1WYGA 5AZFA 1TS2A 5E6PA 1WJ4A 1QT9A 2C7NB 4JGHB 1AW7A 2YVCA 4DDGD 4E74A 1TS3A 2MLBA 3TJPA 4JWUC 1Q10A 2FUG1 3IAS1 1QF6A 5AUKA 4RGMA 4JIOU 3WAOA 2AQ2B 4G3XB 4GN1A 4KZ0A 1V5OA 1R4MI 3ZQ4A 3R3MA 1UBQA 3A9JA 2LEKA 3AM9A 2K5PA 5FKAC 1UGJA 2MEKA 4O1NA 3L54A 4KDLB 5LXHA 1DOIA 3V61A 3ENEA 4II3B 3NHEB 4ZRPA 3UQBA 4FULA 3I9V1 1VZ8A 2INPE 4JE3B 4N9F4 3LJ3A 3O65B 4ARCA 3VH4B 4K81A 2K6QA 2LI5A 4KGSA 1OEYA 2R2QA 2O6VD 1SEBD 2V9HA 5MPOA 1S1QB 3WIMA 5FR3A 3AE6B 2WDQB 2M19A 3L17A 3P1MA 5AZGA 2JYTA 1L4DB 2KXJA 3VFKA 2ZPNA 5JXVA 4M0WA 2CJNA 2KO3A 5CHWA 2WXLA 3TBLD 3HUIA 3N1ZC 1HQRD 3SDLC 1PUTA 3I3TB 4MGZE 2KQ4X 1E0ZA 3NZ3A 2RR9A 1YQ4B 5CHVC 4WAAA 1RYJA 3AB5A 3PO0A 1T0RC 4HLEA 1GB4A 3RMKC 1N5WA 4R3DA 3ETRA 1ZW7A 1PYWD 4N59A 1FEHA 1KFYB 3QC8B 4USAA 2EMTA 2LJIA 2N9LA 3RNEC 5HFYA 2K8HA 1VR9A 2KNBA 2KFKA 1TY2A 4EKUA 4C7ZA 4BBNF 1CK1A 2N1VA 2NS5A 1QOBA 2KOXA 3EUB2 3W1YA 4C7YA 1SJED 2RSUA 4ASWC 1IGCA 3U30A 4G11A 4DXAB 2D3GA 1ZGUB 1UWMA 1L6UA 5AZHA 3B1LX 3CSTA 2M0AA 2A4ZA 4BKSD 3PV1A 2EMSA 4ARIA 2Q5WD 1LM8B 1WE7A 3W1SA 3IBEA 3OJ4B 4EE2A
chains in the Genus database with same CATH topology
5HHDG 3BYYB 4WURA 3IXSA 1VLBA 1I4GA 2L52A 4OZAA 1ZDXA 2E6XA 2Y3AA 1J7CA 2ZW0A 4RCOA 2DBYA 2QJLA 4LLGM 4WQMA 3W9CB 2N9KA 3AE7B 2JQRB 2BB6A 2XNAC 1N5XA 2WXQA 4KKIA 3L4PA 3W5VB 3GP7A 2MH7A 2D5GA 4MT5A 1KTKA 4YT0B 3Q69A 1NYQA 1EWYC 3HVDA 4PT5A 1FNVA 2GB1A 2QILA 2ONQA 3KLSX 2WDVB 3H8HA 1FRDA 1I4QA 1IBXB 2H88B 2DYOA 1KRHA 1XLQA 1DOYA 2W3RA 1XLNA 4RF0A 4XDDA 3FILA 2PMVA 2BB5A 2SEBD 1N60A 4RH6A 4YSYB 1K52A 3B2FA 5H8YE 2FBWB 1SBBB 1L0XB 2W3SA 2G1EA 1VZ6A 1M4VA 2QEJC 1SSNA 4YWGG 5BMIA 3ZGZA 5D3DA 3OWEB 3VRBB 1ZXHA 5E6JA 1D5XC 3TUOA 1C77A 2WQYB 2JYEA 3MC0B 1E7PB 1NEKB 1FRRA 3U52E 1ET9A 3KWLA 3U2SC 1JALA 1TYGB 1ET6A 1YN3A 3N9YC 2RDGA 2L32A 5I4DA 3URYA 3BVZA 2LGIA 1ACCA 1FNWA 2KWDA 2WXGA 4TMAB 2AQ3B 4IDIA 1FNUA 2ACZB 1TKGA 1HZ5A 2E3TA 2NTSA 2W82A 2Z8LA 3Q8BA 2BW2A 2DWQA 4MACA 3BK1A 3B2GA 1GAQB 5EE0A 4HKZE 1D4BA 2Y5PA 2ON8A 4XDCA 3MHZA 2SAKA 4AQ7A 1RWSA 2JXTA 1E9MA 1YNTE 3NS1A 2KACA 1OQRA 2JU6X 4HEA1 5D3IB 3R2TA 1BXTA 2WU2B 1ZOYB 2WXNA 4TQ0A 1F2RI 1HXYD 1KH0A 3I57A 1N62A 1OFFA 3NVZA 1PFDA 4RGOS 1TJEA 3ZJTA 1ESFA 1WSPA 4TQ1A 2LMCA 2XN9C 4RNAA 1BUIC 2M56B 3NUHB 4KGTA 1FO4A 2I2YA 1J7BA 4GLSC 3LXFA 4WH4A 2AX5A 4JWSC 4ZHPA 2LHDA 2I38A 4YTPB 5G5HA 1DYQA 1NVID 4D2KA 1XCQL 2WS3B 3BYTB 1ZXIA 1EU4A 3T3NA 1FFUA 2EKIA 2JX5A 2IGHA 4YSZB 3LYYA 1VRAB 1GB1A 1I4XA 2V0GA 4B0EA 5TSSA 2TSSA 4XWTA 1E10A 2K0PA 1ZE3D 1ZP0B 4IKGA 3U7ZA 3IT6B 4JX1C 2J52A 1JRPA 3VRAB 2FE8A 1D5MC 5BYSA 4NAMA 3SFDB 1F77A 2GRIA 4J3OD 1D5ZC 2WXHA 2YEPB 2BBCA 2WDRB 1ENFA 2W55A 4LK0M 1XF5L 3EGRA 3Q8EA 4DQOC 2K22A 5BYRA 2PIAA 5C3JB 2IGDA 2BTEA 4YTNB 1F2RC 5FK9C 1MPEA 1JWBD 4TSSA 1EWCA 1P7EA 2CJOA 1ROEA 3AE9B 3TEYA 4EE2A 1I4HA 1TKEA 4HJGE 2VZKB 3R2IA 1C76A 4ITKA 3DWGC 2LHEA 2RMMA 1ZPSA 2V3NA 3TSSA 4WAFA 3WCQA 5EE3A 2GI9A 2J42A 3R8BA 1TY0A 4KX6B 4RGNA 1E6EB 1TZOA 4OHJA 2BS4B 2PVGC 4MH8A 2BYTA 2QMTA 4CQNA 1N61A 2AQ1B 2R61A 5BMGA 1C79A 3W5UB 3IT4B 3LB8C 1SIJA 2KDMA 2KN4A 5GXGB 1CJEA 4B0MA 1C4PA 3CWIA 1L6VA 3E9SA 1SB3C 2Y5CA 1VZ7A 3ZJUA 1V1PA 2BT6A 5LNK1 5EE1A 3GS2A 4A9AA 3SFEB 1AYFA 4XE0A 2BS3B 1P7FA 2IDYA 3P63A 2JWUA 1CQVA 1NENB 1B1ZA 3TEWA 3TEZA 4REZA 4KGRA 2ICIA 1VDVA 2JZPA 1WWTA 3AV8A 3HVZA 2KAJA 2J53A 1MHXA 3KQ4A 3PZ7A 2N7JA 2V3PA 1PGAA 1PDXA 1SE2A 2IJ0A 2L1AA 3Q8FA 4DXFA 1QOAA 2WU5B 5BYQA 1ZDVA 1XLOA 4H2AA 3BIID 1B9RA 2MJDA 4OVZA 5AUIA 5G5GA 2MJ3A 1JMLA 1YJJA 3Q8AA 1KLUD 1T6BX 2BS2B 1V97A 3VQIA 2K3UA 1FMAD 4C56C 3BVGA 1I7HA 1A70A 1STEA 1QLBB 1V1OA 1SF0A 2INNE 4YTMB 1AWDA 1XLPA 1IBXA 4C80A 3UI3A 2WNMA 2WXJA 3TEXA 3NVWA 2J4XA 5HG2A 4NJCA 4HKQA 1HEZE 2QIEB 1FIQA 1VJKA 1XXGA 3MJ5A 4YSXB 1V8CA 1TS5A 2WXIA 4OW0A 4A90A 1WYGA 1N63A 3FAHA 4RF1A 1UWXA 1TS2A 2NTTA 1NYRA 1PGBA 4L1BA 1QT9A 1AW7A 1JW9D 1TS3A 1WXQA 1QOFA 3BK2A 4P6VF 3SEBA 4JWUC 2WLBA 1FCLA 1Q10A 1I4RA 2FUG1 4N58A 1MVKA 4ZRQA 1K51A 3IAS1 1QF6A 5AUKA 5C2TB 3RFZB 4P16A 2KMMA 4RGMA 4ZHOA 1FCCC 3PZ8A 3FILB 2L83A 4N6EB 2WXMA 2AQ2B 1CZPA 2WXKA 1C4AA 3P4PB 1UNSA 1JWMD 3ZQ4A 2OHFA 3CIRB 4YXDB 1WRIA 3EA6A 2PLPA 4OZBA 3MFGA 1JROA 4UDUC 4ZOHC 2LEKA 3AM9A 3AE5B 2K5PA 1L5PA 1SE4A 2WXPA 5FKAC 1UGJA 2MEKA 1SE3A 1SXTA 1XEEA 2IGGA 4O1NA 1YN4A 4ZYSA 1MHHE 1DOIA 4ZRPA 1TKYA 1C4CA 3AEAB 3P4RB 3SR6A 1ZUD2 1YMHE 5D7GA 3I9V1 4HROA 2RPVA 1EM7A 3ZYYX 1VZ8A 2INPE 2QSDA 4JE3B 1RM6C 1I4PA 4L2YA 1K50A 3VR9B 1MI0A 4GDLB 4US9A 4ARCA 2PW9A 2RDHA 3ABVB 1XCTL 4KGSA 3GB1A 2X38A 1L4ZB 1KF6B 5EE9A 2YEPF 1SEBD 1F0ZA 5MPOA 3V3XA 4JPSA 5FR3A 2WXFA 3AE6B 2WDQB 4IOIE 2M19A 1IUEA 3P42A 1JWUD 3P1MA 2JYTA 3BVMA 3V05A 1JCKB 1L4DB 1NI3A 1YJIA 3NRZA 4DXGA 5JXVA 4M0WA 2CJNA 5BMHA 3C8YA 4WIPA 2PVOD 3VR8B 1QKZA 2WP9B 2WXLA 3W2DA 1C9FA 1R7SA 3HRDD 3HUIA 1T5XD 1HQRD 2N0SB 1PUTA 4US8A 1EU3A 4A6QA 3E56A 2KQ4X 2EELA 5HI1A 3AE3B 3IAM1 1JWSD 4MM3B 1E0ZA 2PTLA 1UUPA 1Y56A 3NZ3A 1QOGA 1XO3A 1YQ4B 1IGDA 1RYJA 3AB5A 1TS4A 3AE2B 2CU3A 3FC4A 3PO0A 4A8XC 1GB4A 4L23A 4RFBA 4A55A 1N5WA 4R3DA 1QILA 3ETRA 2G9HD 1PYWD 3P4SB 4FXCA 4N59A 1SJHD 2WXRA 1HA5A 1D6EC 1FEHA 2V4IB 1FXIA 1KFYB 4USAA 2LJIA 3AEDB 2N9LA 1KLGD 4Q2JA 5HFYA 3AN1A 1VR9A 3KWVA 1J7AA 3AEBB 1DGJA 2LFIA 4WWMA 1TY2A 4OZCA 1YN5A 1BMLC 3AMZA 3NVYA 2K9XA 3U4EG 3T3OA 3DWMA 2DLBA 4C7ZA 1CK1A 1GPXA 4RGTA 4XWWA 2W54A 1T3QA 3AECB 2WXOA 3B9JA 3BZDB 2PKOA 5T8IA 1QOBA 2JSVX 2MJEA 1FFVA 3EUB2 1AN8A 1JQ4A 1HZ6A 3AE4B 1FD6A 4NZLB 4C7YA 1GOZA 3ZJVA 2NMQA 1SJED 3Q8CA 2DYMA 2LUMA 5H92C 1FM0D 2OEDA 1C78A 1IGCA 2HDEA 1L0YB 4KKJA 2IPKD 3NVVA 3RPFC 1RFKA 1PGXA 1LO5D 1UWMA 3MP9A 1L6UA 3AE1B 3P4QB 4LTUA 4GDKB 2M0AA 1FXAA 2H89B 3AEFB 3J9CA 1V1PB 3AEEB 3AE8B 4ARIA 1K53A 2Q5WD 1WGKA 1YQ3B 3AH7A 3AEGB 1OQQA 3BWUD 4NAWB 3O13A 4HRSA 3W1SA 1DOXA 1JWAD 2B76B 1QQRA 2ZW1A 1L0VB 4AS1A 2VZKD 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M19 A;  2AX5 A;  1IUE A;  1YJJ A;  1VLB A;  2MJ3 A;  5G5G A;  4JWS C;  2L52 A;  3P1M A;  2BS2 B;  1V97 A;  4ZHP A;  1FMA D;  1J7C A;  4YTP B;  1I7H A;  1A70 A;  1NI3 A;  2DBY A;  2QJL A;  5G5H A;  1YJI A;  3NRZ A;  1NVI D;  1QLB B;  2WS3 B;  1SF0 A;  4WQM A;  3W9C B;  1AWD A;  1ZXI A;  2CJN A;  4YTM B;  1XLP A;  1FFU A;  2EKI A;  1XLO A;  2PVO D;  3VR8 B;  2JX5 A;  3AE7 B;  4C80 A;  2JQR B;  2WP9 B;  3NVW A;  1N5X A;  4YSZ B;  1R7S A;  3HRD D;  3LXF A;  3L4P A;  3HUI A;  3W5V B;  2MH7 A;  4YT0 B;  2N0S B;  2QIE B;  1PUT A;  1FIQ A;  1NYQ A;  1EWY C;  1VJK A;  4US8 A;  4YSX B;  1E10 A;  1V8C A;  1ZP0 B;  4JX1 C;  3AE3 B;  1JRP A;  2WDV B;  1FRD A;  3VRA B;  1E0Z A;  1WYG A;  1N63 A;  2H88 B;  1KRH A;  3FAH A;  1QOG A;  1XLQ A;  1DOY A;  2W3R A;  1XO3 A;  1XLN A;  1YQ4 B;  3SFD B;  1NYR A;  1RYJ A;  3AB5 A;  3AE2 B;  3PO0 A;  2CU3 A;  1QT9 A;  3FC4 A;  2WDR B;  2W55 A;  2K22 A;  1JW9 D;  1N60 A;  1N5W A;  1QOF A;  1WXQ A;  2PIA A;  4P6V F;  3ETR A;  4JWU C;  5C3J B;  4YSY B;  2WLB A;  4YTN B;  3P4S B;  3B2F A;  5H8Y E;  1JWB D;  4FXC A;  4N58 A;  2FBW B;  4N59 A;  2W3S A;  1QF6 A;  2G1E A;  5AUK A;  5C2T B;  2CJO A;  2KMM A;  4ZHO A;  1ROE A;  3AE9 B;  3VRB B;  1FXI A;  1KFY B;  2L83 A;  4N6E B;  4USA A;  1TKE A;  3AED B;  4ITK A;  3AN1 A;  1CZP A;  1J7A A;  3DWG C;  3AEB B;  1DGJ A;  2WQY B;  4WWM A;  3WCQ A;  3P4P B;  1E7P B;  1NEK B;  1FRR A;  3AMZ A;  3KWL A;  2K9X A;  3NVY A;  2OHF A;  3CIR B;  1JAL A;  5EE3 A;  1TYG B;  3DWM A;  4YXD B;  1WRI A;  4C7Z A;  4KX6 B;  1GPX A;  1JRO A;  1E6E B;  2W54 A;  2BS4 B;  4ZOH C;  1T3Q A;  2PVG C;  3AEC B;  3B9J A;  2LEK A;  2PKO A;  3AM9 A;  4IDI A;  1N61 A;  3AE5 B;  2K5P A;  2ACZ B;  1QOB A;  1L5P A;  2MJE A;  1TKG A;  1FFV A;  2E3T A;  3EUB 2;  3W5U B;  1B9R A;  3LB8 C;  1JQ4 A;  1SIJ A;  2DWQ A;  1J7B A;  3AE4 B;  5GXG B;  1CJE A;  4C7Y A;  1DOI A;  3B2G A;  3CWI A;  1GAQ B;  5EE0 A;  1L6V A;  1SB3 C;  1FM0 D;  2Y5C A;  5H92 C;  1TKY A;  3AEA B;  1RWS A;  2BT6 A;  1E9M A;  3P4R B;  5EE1 A;  3SR6 A;  1ZUD 2;  3SFE B;  4A9A A;  3NS1 A;  1AYF A;  1OQR A;  2BS3 B;  4HRO A;  3NVV A;  3P63 A;  3RPF C;  1RFK A;  2WU2 B;  3ZYY X;  1ZOY B;  1RM6 C;  1UWM A;  1NEN B;  1L6U A;  3AE1 B;  3P4Q B;  3VR9 B;  1VDV A;  3AV8 A;  1N62 A;  1OFF A;  1WWT A;  3HVZ A;  2KAJ A;  3NVZ A;  4LTU A;  4US9 A;  1PFD A;  1TJE A;  1FXA A;  2H89 B;  3AEF B;  3ABV B;  3AEE B;  1PDX A;  3AE8 B;  2Q5W D;  1WGK A;  1YQ3 B;  3AE6 B;  1KF6 B;  5EE9 A;  1F0Z A;  1QOA A;  3AH7 A;  3AEG B;  1OQQ A;  2M56 B;  5MPO A;  2WU5 B;  4HRS A;  1DOX A;  1JWA D;  2B76 B;  1FO4 A;  1L0V B;  3BII D;  2HTM E;  2WDQ B;  2MJD A;  5AUI A; 
#chains in the Genus database with same CATH topology
 2C7M B;  3H7P A;  4WQM A;  1ISN A;  2GOW A;  2ZCC A;  4FJZ A;  2XNA C;  1N5X A;  3GP7 A;  2MH7 A;  2D5G A;  2UWQ A;  3Q69 A;  3HVD A;  4LNK A;  2GB1 A;  2DEN B;  1C1Y B;  4C4V A;  3N1Y C;  2WDV B;  3H8H A;  2LGD A;  5DPR A;  1XLN A;  2QHO A;  2BB5 A;  2LVP A;  2J0J A;  3ZUN A;  1YX5 B;  2JWZ A;  3TMP B;  2KAN A;  4WWO A;  2AYO B;  1E7U A;  1GC7 A;  4OVU A;  2DYB A;  3ZGZ A;  3X0W A;  5G2N A;  1D5X C;  3JSV B;  3ZTD A;  3MHS D;  1YX6 B;  1E7P B;  1ET9 A;  1ET6 A;  3L13 A;  2BKR B;  4MEM A;  1UEL A;  3BVZ A;  2LGI A;  2MBE A;  3Q2A C;  2KWD A;  1X1M A;  4RM8 A;  1FNU A;  4WJO A;  3HIZ A;  1HZ5 A;  2E3T A;  3I5J C;  1YJ1 A;  3WAP A;  3DQV A;  4FJY A;  1WH3 A;  3Q8B A;  2BW2 A;  4MGI E;  2IND C;  3BK1 A;  2KX3 A;  1WZ3 A;  4GDL A;  2GLS A;  5EE0 A;  3DDC B;  2KC1 A;  2G4S A;  1RWS A;  4C00 A;  4HEA 1;  4F7Z A;  2WU2 B;  4TQ0 A;  2WXN A;  2KX0 A;  3ZKJ C;  1F2R I;  1KH0 A;  3B0A A;  3DBS A;  3I57 A;  1R4N B;  1F52 A;  3P2B A;  4RGO S;  3ZJT A;  1ESF A;  3DBR I;  1WSP A;  1WX9 A;  2PE9 A;  4RNA A;  1BUI C;  2MSE D;  3ZVV A;  4W9I A;  1L7Y A;  4ZRI A;  4GLS C;  2AX5 A;  3Q3J A;  1NDD A;  2LAS A;  4K7U A;  2LHD A;  4YTP B;  5G5H A;  3Q6B A;  1DYQ A;  1NVI D;  4M8N A;  1XCQ L;  4JQW C;  3X23 A;  1EU4 A;  4MM3 A;  3T3N A;  2EKI A;  2ZJD A;  2D3B A;  3H1U A;  2CHZ A;  4M02 A;  1GB1 A;  2MX2 A;  3MC8 A;  4XWT A;  1E10 A;  1K8R B;  1WXM A;  2IO3 B;  2D3A A;  3RCZ A;  3IT6 B;  3NJT A;  3VRA B;  2K25 A;  2KVR A;  5TR5 A;  2KDE B;  4J3O D;  2WXH A;  3CMM B;  4LK0 M;  1OTR B;  1WZ0 A;  2PIA A;  4XYC A;  2IGD A;  2W9N A;  4K3C A;  5FK9 C;  3TEY A;  2IO2 B;  3RT3 B;  2L00 B;  1I4H A;  4HJG E;  2VZK B;  3R2I A;  5G55 A;  3KYC D;  2LWP A;  3TL5 A;  3M95 A;  5EE3 A;  4X57 B;  1MG8 A;  2J42 A;  2FCQ A;  2D07 B;  1P1A A;  2BWE S;  1VD2 A;  4DK5 A;  1OQY A;  2QMT A;  4CQN A;  3A33 B;  2AQ1 B;  4LNF A;  5BMG A;  1Z2M A;  3IT4 B;  3LB8 C;  4MGK E;  2KDM A;  5GXG B;  3CWI A;  1SB3 C;  2DZJ A;  2BYF A;  3SFE B;  1NI2 A;  4XE0 A;  1IYF A;  3P63 A;  1CQV A;  4K7W A;  4HWI B;  4REZ A;  4KGR A;  5BO4 B;  2J53 A;  3PVL A;  4IUM B;  2XEW A;  2LD9 A;  4DXF A;  1QOA A;  3APD A;  5CHF A;  1TTN A;  1UZX B;  2LVQ A;  2M0X A;  2NPT A;  3EEC A;  5BYQ A;  1KLV A;  4H2A A;  4MJS B;  3PS6 A;  2MJ3 A;  3AUL A;  3DVG X;  2JRI B;  2BS2 B;  3VQI A;  2K3U A;  1I7H A;  1E7V A;  3RN9 C;  1STE A;  1QLB B;  2INN E;  3DVN U;  4YTM B;  4EFO A;  3DCG A;  3UI3 A;  2XK5 B;  2WXJ A;  1WMH A;  3GE8 C;  5HG2 A;  2MP2 B;  2MRP A;  2N7D A;  3VHT C;  3T8M A;  1XXG A;  3DBH B;  1P9D U;  3FAH A;  1UWX A;  2NTT A;  4IM3 A;  2AEH A;  3VXW A;  1PGB A;  1JW9 D;  1QOF A;  3PLU A;  3VTU A;  1I4R A;  1V81 A;  1P0R A;  3RFZ B;  5C2T B;  4P16 A;  3PZ8 A;  3FIL B;  1HE8 A;  4N6E B;  2WXM A;  3MC9 A;  1CZP A;  2WXK A;  4AP4 C;  4DHZ E;  3A4S C;  2KC2 A;  1UNS A;  4OZB A;  5GMV A;  4FBJ B;  1JRO A;  4MJS A;  4AWJ A;  4AUQ C;  3AE5 B;  2O2V A;  2KJ6 A;  3ZNZ B;  2QCZ A;  1SE3 A;  1SXT A;  1XEE A;  5CTR C;  3RD2 A;  3W1S C;  4DBG A;  2K39 A;  4ZYS A;  1MHH E;  3KUD B;  2K8C A;  1C4C A;  1YMH E;  5D7G A;  2NVU I;  1EM7 A;  3ZYY X;  4PK1 A;  3H9D A;  4E3C A;  2RDH A;  4GXB A;  1F1H A;  4KIK A;  2ZNV C;  5EE9 A;  1L4Z B;  1KF6 B;  4NQK E;  4LDT B;  2IO0 B;  2WXF A;  1RAX A;  3V05 A;  1WY8 A;  4P7I A;  3RNC C;  2NR2 A;  1U4A A;  2HJ1 A;  1V49 A;  2KHW B;  3A9K A;  3VR8 B;  1QKZ A;  1R7S A;  1N6Z A;  1JRU A;  2JF5 A;  1KM7 A;  3ML9 A;  2DX5 B;  2N0S B;  1FPY A;  4US8 A;  2N9X A;  2EEL A;  2MBQ A;  1JWS D;  3PLV A;  5JHB A;  1XO3 A;  1IGD A;  3QHT A;  2KYW A;  4L23 A;  1WJN A;  4A55 A;  5J18 A;  1QIL A;  4FA6 A;  1EO6 A;  3WAL A;  2WXR A;  1HA5 A;  2WWZ A;  1D6E C;  2V4I B;  5D2M B;  2FUH B;  4HDO A;  1DGJ A;  2LFI A;  4WWM A;  3C0R B;  1YN5 A;  1BML C;  3PSE B;  3NVY A;  3U4E G;  3T3O A;  2ZPY A;  3DWM A;  1WM2 A;  3RNB C;  4RGT A;  4XWW A;  2W54 A;  1T3Q A;  4JLC A;  3BZD B;  3NY5 A;  5EDS A;  1GC6 A;  2WX0 A;  1FD6 A;  2HTH A;  3ZJV A;  3DBL B;  3Q8C A;  4W9D A;  2OED A;  1GUA B;  1HTQ A;  3Q3O C;  4KKJ A;  1PGX A;  4DHJ D;  4F8C B;  2AL6 A;  4BVU C;  4MSQ B;  3JVZ X;  3P4Q B;  4IWQ A;  4RM9 A;  1V86 A;  2NBV B;  1E5W A;  1V1P B;  4NNJ B;  2CHX A;  2KDI A;  3KW5 B;  1OQQ A;  4NAW B;  2CU1 A;  2BF8 B;  3UGB B;  4HRS A;  1JWA D;  2BVC A;  1QQR A;  2ZW1 A;  1L0V B;  2UU7 A;  4FN2 A;  2HTM E;  5IA7 A;  3KYD D;  3BYY B;  1VLB A;  3VUY A;  3M62 B;  3PT2 B;  2ZW0 A;  2QJL A;  3AI5 A;  3W9C B;  3K9O B;  2JQR B;  2BB6 A;  1WJU A;  4KKI A;  2WDT B;  3SD5 A;  2LXA A;  2JY6 A;  3GE3 C;  4NJ6 A;  4YT0 B;  5CX3 A;  3V6E B;  2ONQ A;  3EFU A;  1I4Q A;  1KRH A;  1XLQ A;  2W3R A;  4HJK A;  2D3C A;  1Q0W B;  3S2A A;  4AJW A;  3ONS A;  4HPM B;  4MSM B;  4RH6 A;  5H8Y E;  2FBW B;  2WGS A;  1L0X B;  2W3S A;  2O6V B;  2G1E A;  5BMI A;  4YWG G;  3M63 B;  4GU2 A;  5D3D A;  3OWE B;  1T0S C;  3EHV A;  5E6N A;  2JYE A;  3U52 E;  4HPL B;  1YN3 A;  4II2 B;  2C7H A;  4A3O A;  3ALB A;  2L32 A;  4WJQ A;  3URY A;  5I4D A;  4IG7 B;  4KSL C;  4TMA B;  3VUX A;  1WX7 A;  1TKG A;  1WR1 A;  2NTS A;  4MAC A;  2DWQ A;  5D94 A;  3B2G A;  1GAQ B;  4HKZ E;  4XDC A;  5IN7 A;  4AQ7 A;  2JXT A;  1G6J A;  1RLF A;  2JU6 X;  4PS8 A;  1E8X A;  2R2O A;  2KQ7 A;  1IPG A;  3PHW B;  1HXY D;  2V1Y A;  4HCP B;  3QAQ A;  1OFF A;  3NVZ A;  3PZD A;  3Q3F A;  4K3B A;  1R4N I;  3FKY A;  2M56 B;  1T0Y A;  3U8Z A;  1FO4 A;  2LZ6 A;  4LNO A;  1BT0 A;  4BKG A;  3LXF A;  2I38 A;  3PTF C;  2WS3 B;  1ZXI A;  3AU4 A;  1FFU A;  1OGW A;  2V4L A;  2Y5B B;  2KLC A;  5D6J B;  5TSS A;  4B0E A;  2TSS A;  4WWN A;  4IKG A;  3ZRF A;  2J52 A;  2FE8 A;  5BYS A;  2ZVN A;  1D5Z C;  2YEP B;  1ENF A;  2I1J A;  3Q8E A;  3N1X C;  1J0G A;  2K22 A;  1F2R C;  1GJZ A;  1JWB D;  4P1C C;  2OJR A;  1EWC A;  3Q3N C;  2CJO A;  2LRU A;  3ZDM C;  1ZPS A;  2FCS A;  3BIN A;  5JZE B;  2PJH A;  2ZVO A;  1Q1O A;  2WYQ A;  4RGN A;  3QA8 A;  2AL3 A;  5DCN A;  2PVG C;  4MH8 A;  5AEK B;  4KSK C;  2KLG A;  1KOT A;  3W5U B;  1GG3 A;  3DHH C;  5E6O A;  1H8C A;  2KN4 A;  1C4P A;  1L6V A;  2M17 A;  1AYF A;  4LJO B;  5L83 A;  3QQ8 B;  5DPS A;  1NEN B;  2DAJ A;  1EF5 A;  3TEZ A;  2KWV B;  2ICI A;  3AV8 A;  3ZTC A;  2LXC A;  2OOB B;  3KQ4 A;  3PZ7 A;  2MW5 A;  3QX1 A;  1PDX A;  2IJ0 A;  4HCN B;  3R7Q A;  2L0T A;  2L1A A;  3HHM A;  3Q8F A;  3PHX B;  2WU5 B;  1XQQ A;  4W9G A;  1XLO A;  2HE7 A;  3IHP C;  1B9R A;  5AUI A;  5LLI A;  2KDF B;  1T6B X;  1V97 A;  3PPA A;  1FMA D;  2QDF A;  1AWD A;  2I1K A;  4ACF A;  3H6N A;  3TEX A;  4LNN A;  1WGD A;  2MBO A;  2J4X A;  2KTR B;  4HKQ A;  2HJ8 A;  2QIE B;  1FIQ A;  2FAZ A;  3NOB A;  1V8C A;  3M3J A;  4OW0 A;  1E8W A;  3DBH I;  1NYR A;  3CSF A;  3JSV A;  3RYT A;  4M8M A;  2WLB A;  4N58 A;  4ZRQ A;  1MVK A;  2NCN A;  2MCN B;  2L0F A;  2PPH A;  3LDZ E;  2KMM A;  4EUT A;  3VAW A;  1LQB A;  3SHQ A;  3ZIM A;  2RDB C;  1RRB A;  2KKC A;  3RUL A;  4BBN C;  5JHA A;  5DPW A;  3P4P B;  1JWM D;  2OHF A;  3V62 A;  2KN5 A;  3MFG A;  4E71 A;  2GMI C;  4UDU C;  2ZEQ A;  3DHI C;  4WWP A;  4ZOH C;  2QC8 A;  5FR6 A;  1VCB A;  1SE4 A;  2IGG A;  1YN4 A;  3BY4 B;  4CYE A;  3I63 C;  1WXS A;  1TKY A;  2FCN A;  2BKF A;  3SR6 A;  1ZUD 2;  4HRO A;  2RPV A;  3TIX A;  4L2Y A;  3VR9 B;  2FID A;  2JZ3 B;  2PW9 A;  4G50 A;  5DPT A;  3N20 C;  1XCT L;  4B95 A;  2YEP F;  1F0Z A;  3DVN V;  2B3A A;  2INC C;  2XBB C;  3IG3 A;  4BZA A;  3V3X A;  2M8S A;  3D32 A;  4IOI E;  1E90 A;  2AWT A;  4XX5 A;  1JWU D;  1LGR A;  3PGE A;  4EZK A;  1JCK B;  1YJI A;  3NRZ A;  4WJN A;  1UD7 A;  5BMH A;  3C8Y A;  4RMA A;  2GBR A;  3L0W B;  4ZRJ A;  3ZNH B;  4A6Q A;  5HI1 A;  3IAM 1;  2PTL A;  4LJP B;  1TS4 A;  2CU3 A;  4RFB A;  2G9H D;  1V9J A;  4HDQ A;  4G0N B;  4ANU A;  3DOW A;  4ZYN A;  2VH2 A;  4Q2J A;  3NZU A;  3OG5 A;  3AN1 A;  3KWV A;  1J7A A;  1WF9 A;  4FJV B;  2L05 A;  2DLB A;  1TT5 B;  1WI0 A;  3MTN B;  3AEC B;  4S0R A;  2WXO A;  2PKO A;  1E8Y A;  2BQQ A;  1FFV A;  2IYD B;  3EFC A;  2JRH A;  1JQ4 A;  5J2R A;  4NZL B;  1Z5S B;  3HM6 X;  2DYM A;  4I6P A;  5H92 C;  1PQS A;  3DBL I;  3PRM B;  1RFK A;  4LNI A;  2KMA A;  1LO5 D;  3GZN B;  3AE1 B;  3V60 A;  4EEW A;  4GDK B;  3RNF C;  1TBE A;  2JPH A;  4KDI C;  1K53 A;  1WGK A;  1YQ3 B;  1MG4 A;  4PYZ A;  3BWU D;  3O13 A;  1DOX A;  2XK5 A;  2B76 B;  4AS1 A;  5HHD G;  2MP2 A;  1I4G A;  4MEL A;  4OZA A;  1ZDX A;  2YLM A;  1CMX B;  1J7C A;  4RCO A;  4LLG M;  3KUZ A;  4FHK A;  1WYW B;  2MA9 B;  2G45 B;  4W9F A;  3AE7 B;  2RD0 A;  2D10 A;  1I42 A;  4MT5 A;  3NG0 A;  1NYQ A;  1EWY C;  1HTO A;  1IBX B;  2DYO A;  2GBM A;  3L10 B;  1DOY A;  3Q3M C;  4XDD A;  3FIL A;  1AAR A;  2G3Q B;  2IZV B;  3PRE A;  4CO7 A;  3VH3 B;  1N60 A;  1H4R A;  4YSY B;  4W9E A;  2KZR A;  4MDK E;  1GNU A;  2C5L C;  1VZ6 A;  2QEJ C;  1SSN A;  3VTW A;  3VRB B;  2JT4 B;  4A20 A;  3TUO A;  4MH0 E;  3H7S A;  1C77 A;  2WQY B;  2FIF A;  3MC0 B;  1M94 A;  1NEK B;  1FRR A;  2DZK A;  1TYG B;  2VRR B;  2NBU A;  1J19 A;  1Q5W B;  3RZF A;  4GIV A;  1ACC A;  3VUW A;  4NPN A;  2MHJ A;  2ACZ B;  3VVW B;  4TV3 A;  1D3Z A;  4GSW A;  3MHZ A;  2SAK A;  3A9J B;  2PE6 B;  1E9M A;  4I6N B;  1YNT E;  2L3Z A;  5D3I B;  1OQR A;  1YIW A;  3R2T A;  2HD5 B;  4TUU A;  4S17 A;  1ZOY B;  4M01 A;  4BOS C;  1WM3 A;  1N62 A;  2DZI A;  2N7E A;  4TQ1 A;  3IFW B;  3Q14 C;  2XN9 C;  2L8J A;  3PRP B;  3NUH B;  3MJW A;  2I2Y A;  1J7B A;  3AXC A;  5LXI B;  3SU8 X;  3ZXV A;  4ZHP A;  2PEA A;  3T9L A;  2JX5 A;  3B08 A;  4IM0 A;  2IGH A;  2LJ5 A;  4BKT A;  4YSZ B;  2CS4 A;  1VRA B;  1EUV B;  1QZE A;  4FHJ A;  1V2Y A;  4KVG B;  3U7Z A;  2UYZ B;  4M0W B;  1JRP A;  2LGX A;  2IBI B;  2Z0E B;  4YL8 A;  3U7D A;  4PS3 A;  1F77 A;  2GRI A;  4EZL A;  1NBF C;  4DHJ B;  2BBC A;  2WDR B;  2W55 A;  1XF5 L;  3EGR A;  2MBB B;  3GOE A;  4AJY B;  4PS7 A;  3A1Q B;  2DNF A;  1MPE A;  4HPP A;  2RPQ A;  2ASQ A;  4W9K A;  1TKE A;  1C76 A;  2EKE C;  2OJW A;  2MWS B;  4WAF A;  4DDI D;  3WCQ A;  2N9E B;  1RFA A;  4IM2 A;  2GI9 A;  1XD3 B;  2VH1 A;  3R8B A;  1TY0 A;  2KVZ A;  1E6E B;  2BS4 B;  1WGG A;  2BYT A;  2KFK B;  2R61 A;  4ANV A;  1C79 A;  1P3Q U;  1SIJ A;  1CJE A;  5IP4 D;  4EOY A;  5L95 C;  2Y5C A;  1VZ7 A;  4ZRK A;  3ZRC A;  1V1P A;  2BT6 A;  5EE1 A;  2D2Q A;  2BS3 B;  2IY1 B;  1A5R A;  3AU5 A;  4NAW A;  2JWU A;  3TEW A;  1VDV A;  3HVZ A;  1WWT A;  2LRW A;  1WJ6 A;  2KAJ A;  3L08 A;  1MHX A;  2KFJ A;  3QWZ B;  4DHZ B;  2GBN A;  3A1Q A;  1WGH A;  1TZ1 A;  1OEY J;  2CKH B;  4HXD A;  5G5G A;  1JML A;  1YJJ A;  4XGA B;  3Q8A A;  4NQL B;  1UF0 A;  1SE9 A;  1A70 A;  2GBJ A;  1SF0 A;  4C80 A;  2WNM A;  2L76 A;  3NVW A;  4I6L B;  4NJC A;  1HEZ E;  4B9K A;  3H7P B;  1TS5 A;  3UIO B;  1N63 A;  4RF1 A;  2O6V A;  3RZW C;  4L1B A;  1SIF A;  4KZC A;  1WXQ A;  4P6V F;  3BK2 A;  3SEB A;  1Y8R C;  4C4V B;  2ZNV B;  2RGF A;  1FCL A;  2LVO A;  1K51 A;  4ZHO A;  1FCC C;  2L83 A;  3QIJ A;  1R4M B;  1C4A A;  4YXD B;  3CIR B;  3WAM A;  1WRI A;  2JUO A;  3EA6 A;  2PLP A;  1YOV B;  1C3T A;  2CR5 A;  1L2N A;  1L5P A;  4F1S A;  4EZJ A;  2WXP A;  3OJ3 A;  1V80 A;  1I35 A;  1YD8 U;  4HK2 A;  3OAW A;  5C23 A;  3AEA B;  3P4R B;  3K9P B;  2Z0D B;  2QSD A;  4NJ7 A;  1RM6 C;  1I4P A;  1K50 A;  1MI0 A;  2K6D B;  4GDL B;  4US9 A;  3L16 A;  3ABV B;  3GB1 A;  2X38 A;  3JYU A;  4JPS A;  3QAR A;  4DWF A;  1IUE A;  3P42 A;  3BVM A;  1NI3 A;  4DXG A;  4B6W A;  4W9C A;  4WIP A;  2PVO D;  1ZKH A;  2IY0 B;  2WP9 B;  4IW0 A;  3W2D A;  1C9F A;  3HRD D;  4BOZ B;  1YQB A;  1T5X D;  3ZDT A;  3UIN B;  1EU3 A;  3E56 A;  4BKS A;  3AE3 B;  4MM3 B;  4W9H A;  1UUP A;  1WRD B;  1Y56 A;  3PRZ A;  1QOG A;  3UIP B;  2KK8 A;  1IP9 A;  3AE2 B;  3FC4 A;  4A8X C;  3R7R A;  4W9L A;  4OVV A;  3QCA A;  3P4S B;  3IVF A;  4FXC A;  1SJH D;  1LFD A;  1KJT A;  1FXI A;  3AED B;  1KLG D;  4IC7 B;  3AEB B;  2D11 A;  4OZC A;  2BPS A;  3AMZ A;  2K9X A;  3N30 A;  1GPX A;  4GGQ A;  1F9J A;  3B9J A;  4NY0 A;  1XT9 B;  5T8I A;  2JSV X;  2MJE A;  4GB9 A;  3KUC B;  1AN8 A;  2MBH A;  3ZXR A;  1HZ6 A;  3AE4 B;  1GOZ A;  2NMQ A;  3DPD A;  2MQJ A;  2LUM A;  1FM0 D;  1C78 A;  3ZNI D;  1WX8 A;  2HDE A;  1L0Y B;  4PYU A;  2IPK D;  3NVV A;  3RPF C;  3MP9 A;  2FNJ B;  4K7S A;  3VDZ A;  1S3S G;  4LTU A;  2LUE A;  3GZN I;  1UBI A;  1FXA A;  2H89 B;  3AEF B;  3J9C A;  2DZM A;  3AEE B;  4TKN A;  3AE8 B;  3NS8 A;  5J17 A;  2BWF A;  3AH7 A;  3AEG B;  2KDB A;  4BAX A;  2VZK D;  4P1B C;  2KTR A;  5IOI A;  4WUR A;  3IXS A;  3NZS A;  2L52 A;  2E6X A;  2KJR A;  2Y3A A;  1WXA A;  2DBY A;  1EF1 A;  2FCM A;  2N9K A;  2NPT B;  3UF8 A;  2WXQ A;  3L4P A;  3W5V B;  2K1F A;  1KTK A;  2LGY A;  2K8B A;  3KH0 A;  3ZNG C;  4WJP A;  4PT5 A;  1FNV A;  2QIL A;  3KLS X;  4AOF A;  1FRD A;  2KTF A;  2H88 B;  5IAA C;  1WMH B;  2N4F A;  2C9W B;  4RF0 A;  3N32 A;  2PMV A;  2ZCB A;  2SEB D;  2KWU B;  2X8X X;  1UH6 A;  2IO1 B;  1K52 A;  3B2F A;  1SBB B;  1M4V A;  1E8Z A;  3APC A;  4XZ4 A;  4ICV A;  3N3K B;  5HKH A;  1ZXH A;  5E6J A;  4LCD E;  2M4N A;  3TCA A;  4JL9 A;  3KWL A;  3U2S C;  1JAL A;  3N9Y C;  4GMV A;  3ML8 A;  2REX A;  3WA0 A;  2RDG A;  5IO9 A;  2ZZP B;  1FNW A;  3CF6 E;  3RNA C;  2WXG A;  4MGY E;  2KT7 A;  2AQ3 B;  4IDI A;  2W82 A;  2Z8L A;  2C60 A;  2M1M A;  1D4B A;  2Y5P A;  4CHK A;  2ON8 A;  2O2V B;  3NS1 A;  1SGH A;  2KAC A;  2BYV E;  2Z59 B;  1V5T A;  5C1Z A;  2N1W A;  2KMC A;  1BXT A;  3R66 C;  3DVG Y;  1WIA A;  3DBR B;  1PFD A;  1TJE A;  2WX1 A;  2J0K A;  3A4R A;  2LMC A;  3EC8 A;  3ZW3 A;  2WHI A;  5KHO A;  4KGT A;  4WH4 A;  2CHW A;  4JWS C;  4ICU A;  4IWP A;  3QK0 A;  5KHQ A;  4KIK B;  4D2K A;  1J8C A;  3BYT B;  2J0M A;  4ANW A;  2BGF A;  3LYY A;  1I4X A;  2V0G A;  1V6E A;  3RI7 C;  4FAD A;  2K0P A;  1ZE3 D;  1ZP0 B;  4K1R B;  1WR6 E;  4JX1 C;  1D5M C;  3A9K B;  1LXD A;  1TIF A;  2DAF A;  4NAM A;  2LGS A;  3SFD B;  1WFY A;  4HVB A;  3QJZ A;  3V6C B;  3ZO5 B;  4DQO C;  5BYR A;  5C3J B;  2BTE A;  4YTN B;  2JXX A;  4TSS A;  4GOC A;  1WGY A;  3RNG C;  1WE6 A;  1P7E A;  3WAN A;  1ROE A;  3AE9 B;  4ITK A;  2DHZ A;  3DWG C;  2LHE A;  2KD0 A;  2RMM A;  3TSS A;  2V3N A;  4LDT D;  1FXT B;  4KX6 B;  1TZO A;  2V3S A;  4M00 A;  3ZLZ A;  1WXV A;  4OHJ A;  2KWC A;  1TGZ B;  1N61 A;  4XC2 A;  2KQS A;  2N9P C;  2GBK A;  2JVC A;  4B0M A;  4QAY A;  2L7R A;  4GDK A;  4FLH A;  3E9S A;  4ZDV A;  4ANX A;  3ZJU A;  5LNK 1;  3GS2 A;  4A9A A;  4URK A;  3HK0 A;  3UQA A;  1P7F A;  2IDY A;  1WGR A;  1B1Z A;  3OLM D;  4IWO A;  1MJD A;  2JZP A;  1P98 A;  2N7J A;  2V3P A;  1PGA A;  4J6I A;  1SE2 A;  5JH5 C;  4A3P A;  3DHG C;  4KV2 A;  2KJH B;  3C19 A;  1ZDV A;  3BII D;  2MJD A;  4OVZ A;  1UGM A;  1T0Q C;  1KLU D;  4C56 C;  3BVG A;  2G4D B;  1V1O A;  2A5U A;  1XLP A;  3HM3 A;  1IBX A;  1MFW A;  2J7Q B;  3JW0 X;  3ECI A;  4WQO B;  4BFR A;  2NBW B;  3VTV A;  2JZZ A;  1VJK A;  3APF A;  3KVF B;  5IKC M;  3MJ5 A;  4W9J A;  4YSX B;  2WXI A;  3RUI B;  4A90 A;  2BYE A;  1WYG A;  5AZF A;  1TS2 A;  5E6P A;  1WJ4 A;  1QT9 A;  2C7N B;  4JGH B;  1AW7 A;  2YVC A;  4DDG D;  4E74 A;  1TS3 A;  2MLB A;  3TJP A;  4JWU C;  1Q10 A;  2FUG 1;  3IAS 1;  1QF6 A;  5AUK A;  4RGM A;  4JIO U;  3WAO A;  2AQ2 B;  4G3X B;  4GN1 A;  4KZ0 A;  1V5O A;  1R4M I;  3ZQ4 A;  3R3M A;  1UBQ A;  3A9J A;  2LEK A;  3AM9 A;  2K5P A;  5FKA C;  1UGJ A;  2MEK A;  4O1N A;  3L54 A;  4KDL B;  5LXH A;  1DOI A;  3V61 A;  3ENE A;  4II3 B;  3NHE B;  4ZRP A;  3UQB A;  4FUL A;  3I9V 1;  1VZ8 A;  2INP E;  4JE3 B;  4N9F 4;  3LJ3 A;  3O65 B;  4ARC A;  3VH4 B;  4K81 A;  2K6Q A;  2LI5 A;  4KGS A;  1OEY A;  2R2Q A;  2O6V D;  1SEB D;  2V9H A;  5MPO A;  1S1Q B;  3WIM A;  5FR3 A;  3AE6 B;  2WDQ B;  2M19 A;  3L17 A;  3P1M A;  5AZG A;  2JYT A;  1L4D B;  2KXJ A;  3VFK A;  2ZPN A;  5JXV A;  4M0W A;  2CJN A;  2KO3 A;  5CHW A;  2WXL A;  3TBL D;  3HUI A;  3N1Z C;  1HQR D;  3SDL C;  1PUT A;  3I3T B;  4MGZ E;  2KQ4 X;  1E0Z A;  3NZ3 A;  2RR9 A;  1YQ4 B;  5CHV C;  4WAA A;  1RYJ A;  3AB5 A;  3PO0 A;  1T0R C;  4HLE A;  1GB4 A;  3RMK C;  1N5W A;  4R3D A;  3ETR A;  1ZW7 A;  1PYW D;  4N59 A;  1FEH A;  1KFY B;  3QC8 B;  4USA A;  2EMT A;  2LJI A;  2N9L A;  3RNE C;  5HFY A;  2K8H A;  1VR9 A;  2KNB A;  2KFK A;  1TY2 A;  4EKU A;  4C7Z A;  4BBN F;  1CK1 A;  2N1V A;  2NS5 A;  1QOB A;  2KOX A;  3EUB 2;  3W1Y A;  4C7Y A;  1SJE D;  2RSU A;  4ASW C;  1IGC A;  3U30 A;  4G11 A;  4DXA B;  2D3G A;  1ZGU B;  1UWM A;  1L6U A;  5AZH A;  3B1L X;  3CST A;  2M0A A;  2A4Z A;  4BKS D;  3PV1 A;  2EMS A;  4ARI A;  2Q5W D;  1LM8 B;  1WE7 A;  3W1S A;  3IBE A;  3OJ4 B;  4EE2 A; 
#chains in the Genus database with same CATH homology
 5HHD G;  3BYY B;  4WUR A;  3IXS A;  1VLB A;  1I4G A;  2L52 A;  4OZA A;  1ZDX A;  2E6X A;  2Y3A A;  1J7C A;  2ZW0 A;  4RCO A;  2DBY A;  2QJL A;  4LLG M;  4WQM A;  3W9C B;  2N9K A;  3AE7 B;  2JQR B;  2BB6 A;  2XNA C;  1N5X A;  2WXQ A;  4KKI A;  3L4P A;  3W5V B;  3GP7 A;  2MH7 A;  2D5G A;  4MT5 A;  1KTK A;  4YT0 B;  3Q69 A;  1NYQ A;  1EWY C;  3HVD A;  4PT5 A;  1FNV A;  2GB1 A;  2QIL A;  2ONQ A;  3KLS X;  2WDV B;  3H8H A;  1FRD A;  1I4Q A;  1IBX B;  2H88 B;  2DYO A;  1KRH A;  1XLQ A;  1DOY A;  2W3R A;  1XLN A;  4RF0 A;  4XDD A;  3FIL A;  2PMV A;  2BB5 A;  2SEB D;  1N60 A;  4RH6 A;  4YSY B;  1K52 A;  3B2F A;  5H8Y E;  2FBW B;  1SBB B;  1L0X B;  2W3S A;  2G1E A;  1VZ6 A;  1M4V A;  2QEJ C;  1SSN A;  4YWG G;  5BMI A;  3ZGZ A;  5D3D A;  3OWE B;  3VRB B;  1ZXH A;  5E6J A;  1D5X C;  3TUO A;  1C77 A;  2WQY B;  2JYE A;  3MC0 B;  1E7P B;  1NEK B;  1FRR A;  3U52 E;  1ET9 A;  3KWL A;  3U2S C;  1JAL A;  1TYG B;  1ET6 A;  1YN3 A;  3N9Y C;  2RDG A;  2L32 A;  5I4D A;  3URY A;  3BVZ A;  2LGI A;  1ACC A;  1FNW A;  2KWD A;  2WXG A;  4TMA B;  2AQ3 B;  4IDI A;  1FNU A;  2ACZ B;  1TKG A;  1HZ5 A;  2E3T A;  2NTS A;  2W82 A;  2Z8L A;  3Q8B A;  2BW2 A;  2DWQ A;  4MAC A;  3BK1 A;  3B2G A;  1GAQ B;  5EE0 A;  4HKZ E;  1D4B A;  2Y5P A;  2ON8 A;  4XDC A;  3MHZ A;  2SAK A;  4AQ7 A;  1RWS A;  2JXT A;  1E9M A;  1YNT E;  3NS1 A;  2KAC A;  1OQR A;  2JU6 X;  4HEA 1;  5D3I B;  3R2T A;  1BXT A;  2WU2 B;  1ZOY B;  2WXN A;  4TQ0 A;  1F2R I;  1HXY D;  1KH0 A;  3I57 A;  1N62 A;  1OFF A;  3NVZ A;  1PFD A;  4RGO S;  1TJE A;  3ZJT A;  1ESF A;  1WSP A;  4TQ1 A;  2LMC A;  2XN9 C;  4RNA A;  1BUI C;  2M56 B;  3NUH B;  4KGT A;  1FO4 A;  2I2Y A;  1J7B A;  4GLS C;  3LXF A;  4WH4 A;  2AX5 A;  4JWS C;  4ZHP A;  2LHD A;  2I38 A;  4YTP B;  5G5H A;  1DYQ A;  1NVI D;  4D2K A;  1XCQ L;  2WS3 B;  3BYT B;  1ZXI A;  1EU4 A;  3T3N A;  1FFU A;  2EKI A;  2JX5 A;  2IGH A;  4YSZ B;  3LYY A;  1VRA B;  1GB1 A;  1I4X A;  2V0G A;  4B0E A;  5TSS A;  2TSS A;  4XWT A;  1E10 A;  2K0P A;  1ZE3 D;  1ZP0 B;  4IKG A;  3U7Z A;  3IT6 B;  4JX1 C;  2J52 A;  1JRP A;  3VRA B;  2FE8 A;  1D5M C;  5BYS A;  4NAM A;  3SFD B;  1F77 A;  2GRI A;  4J3O D;  1D5Z C;  2WXH A;  2YEP B;  2BBC A;  2WDR B;  1ENF A;  2W55 A;  4LK0 M;  1XF5 L;  3EGR A;  3Q8E A;  4DQO C;  2K22 A;  5BYR A;  2PIA A;  5C3J B;  2IGD A;  2BTE A;  4YTN B;  1F2R C;  5FK9 C;  1MPE A;  1JWB D;  4TSS A;  1EWC A;  1P7E A;  2CJO A;  1ROE A;  3AE9 B;  3TEY A;  4EE2 A;  1I4H A;  1TKE A;  4HJG E;  2VZK B;  3R2I A;  1C76 A;  4ITK A;  3DWG C;  2LHE A;  2RMM A;  1ZPS A;  2V3N A;  3TSS A;  4WAF A;  3WCQ A;  5EE3 A;  2GI9 A;  2J42 A;  3R8B A;  1TY0 A;  4KX6 B;  4RGN A;  1E6E B;  1TZO A;  4OHJ A;  2BS4 B;  2PVG C;  4MH8 A;  2BYT A;  2QMT A;  4CQN A;  1N61 A;  2AQ1 B;  2R61 A;  5BMG A;  1C79 A;  3W5U B;  3IT4 B;  3LB8 C;  1SIJ A;  2KDM A;  2KN4 A;  5GXG B;  1CJE A;  4B0M A;  1C4P A;  3CWI A;  1L6V A;  3E9S A;  1SB3 C;  2Y5C A;  1VZ7 A;  3ZJU A;  1V1P A;  2BT6 A;  5LNK 1;  5EE1 A;  3GS2 A;  4A9A A;  3SFE B;  1AYF A;  4XE0 A;  2BS3 B;  1P7F A;  2IDY A;  3P63 A;  2JWU A;  1CQV A;  1NEN B;  1B1Z A;  3TEW A;  3TEZ A;  4REZ A;  4KGR A;  2ICI A;  1VDV A;  2JZP A;  1WWT A;  3AV8 A;  3HVZ A;  2KAJ A;  2J53 A;  1MHX A;  3KQ4 A;  3PZ7 A;  2N7J A;  2V3P A;  1PGA A;  1PDX A;  1SE2 A;  2IJ0 A;  2L1A A;  3Q8F A;  4DXF A;  1QOA A;  2WU5 B;  5BYQ A;  1ZDV A;  1XLO A;  4H2A A;  3BII D;  1B9R A;  2MJD A;  4OVZ A;  5AUI A;  5G5G A;  2MJ3 A;  1JML A;  1YJJ A;  3Q8A A;  1KLU D;  1T6B X;  2BS2 B;  1V97 A;  3VQI A;  2K3U A;  1FMA D;  4C56 C;  3BVG A;  1I7H A;  1A70 A;  1STE A;  1QLB B;  1V1O A;  1SF0 A;  2INN E;  4YTM B;  1AWD A;  1XLP A;  1IBX A;  4C80 A;  3UI3 A;  2WNM A;  2WXJ A;  3TEX A;  3NVW A;  2J4X A;  5HG2 A;  4NJC A;  4HKQ A;  1HEZ E;  2QIE B;  1FIQ A;  1VJK A;  1XXG A;  3MJ5 A;  4YSX B;  1V8C A;  1TS5 A;  2WXI A;  4OW0 A;  4A90 A;  1WYG A;  1N63 A;  3FAH A;  4RF1 A;  1UWX A;  1TS2 A;  2NTT A;  1NYR A;  1PGB A;  4L1B A;  1QT9 A;  1AW7 A;  1JW9 D;  1TS3 A;  1WXQ A;  1QOF A;  3BK2 A;  4P6V F;  3SEB A;  4JWU C;  2WLB A;  1FCL A;  1Q10 A;  1I4R A;  2FUG 1;  4N58 A;  1MVK A;  4ZRQ A;  1K51 A;  3IAS 1;  1QF6 A;  5AUK A;  5C2T B;  3RFZ B;  4P16 A;  2KMM A;  4RGM A;  4ZHO A;  1FCC C;  3PZ8 A;  3FIL B;  2L83 A;  4N6E B;  2WXM A;  2AQ2 B;  1CZP A;  2WXK A;  1C4A A;  3P4P B;  1UNS A;  1JWM D;  3ZQ4 A;  2OHF A;  3CIR B;  4YXD B;  1WRI A;  3EA6 A;  2PLP A;  4OZB A;  3MFG A;  1JRO A;  4UDU C;  4ZOH C;  2LEK A;  3AM9 A;  3AE5 B;  2K5P A;  1L5P A;  1SE4 A;  2WXP A;  5FKA C;  1UGJ A;  2MEK A;  1SE3 A;  1SXT A;  1XEE A;  2IGG A;  4O1N A;  1YN4 A;  4ZYS A;  1MHH E;  1DOI A;  4ZRP A;  1TKY A;  1C4C A;  3AEA B;  3P4R B;  3SR6 A;  1ZUD 2;  1YMH E;  5D7G A;  3I9V 1;  4HRO A;  2RPV A;  1EM7 A;  3ZYY X;  1VZ8 A;  2INP E;  2QSD A;  4JE3 B;  1RM6 C;  1I4P A;  4L2Y A;  1K50 A;  3VR9 B;  1MI0 A;  4GDL B;  4US9 A;  4ARC A;  2PW9 A;  2RDH A;  3ABV B;  1XCT L;  4KGS A;  3GB1 A;  2X38 A;  1L4Z B;  1KF6 B;  5EE9 A;  2YEP F;  1SEB D;  1F0Z A;  5MPO A;  3V3X A;  4JPS A;  5FR3 A;  2WXF A;  3AE6 B;  2WDQ B;  4IOI E;  2M19 A;  1IUE A;  3P42 A;  1JWU D;  3P1M A;  2JYT A;  3BVM A;  3V05 A;  1JCK B;  1L4D B;  1NI3 A;  1YJI A;  3NRZ A;  4DXG A;  5JXV A;  4M0W A;  2CJN A;  5BMH A;  3C8Y A;  4WIP A;  2PVO D;  3VR8 B;  1QKZ A;  2WP9 B;  2WXL A;  3W2D A;  1C9F A;  1R7S A;  3HRD D;  3HUI A;  1T5X D;  1HQR D;  2N0S B;  1PUT A;  4US8 A;  1EU3 A;  4A6Q A;  3E56 A;  2KQ4 X;  2EEL A;  5HI1 A;  3AE3 B;  3IAM 1;  1JWS D;  4MM3 B;  1E0Z A;  2PTL A;  1UUP A;  1Y56 A;  3NZ3 A;  1QOG A;  1XO3 A;  1YQ4 B;  1IGD A;  1RYJ A;  3AB5 A;  1TS4 A;  3AE2 B;  2CU3 A;  3FC4 A;  3PO0 A;  4A8X C;  1GB4 A;  4L23 A;  4RFB A;  4A55 A;  1N5W A;  4R3D A;  1QIL A;  3ETR A;  2G9H D;  1PYW D;  3P4S B;  4FXC A;  4N59 A;  1SJH D;  2WXR A;  1HA5 A;  1D6E C;  1FEH A;  2V4I B;  1FXI A;  1KFY B;  4USA A;  2LJI A;  3AED B;  2N9L A;  1KLG D;  4Q2J A;  5HFY A;  3AN1 A;  1VR9 A;  3KWV A;  1J7A A;  3AEB B;  1DGJ A;  2LFI A;  4WWM A;  1TY2 A;  4OZC A;  1YN5 A;  1BML C;  3AMZ A;  3NVY A;  2K9X A;  3U4E G;  3T3O A;  3DWM A;  2DLB A;  4C7Z A;  1CK1 A;  1GPX A;  4RGT A;  4XWW A;  2W54 A;  1T3Q A;  3AEC B;  2WXO A;  3B9J A;  3BZD B;  2PKO A;  5T8I A;  1QOB A;  2JSV X;  2MJE A;  1FFV A;  3EUB 2;  1AN8 A;  1JQ4 A;  1HZ6 A;  3AE4 B;  1FD6 A;  4NZL B;  4C7Y A;  1GOZ A;  3ZJV A;  2NMQ A;  1SJE D;  3Q8C A;  2DYM A;  2LUM A;  5H92 C;  1FM0 D;  2OED A;  1C78 A;  1IGC A;  2HDE A;  1L0Y B;  4KKJ A;  2IPK D;  3NVV A;  3RPF C;  1RFK A;  1PGX A;  1LO5 D;  1UWM A;  3MP9 A;  1L6U A;  3AE1 B;  3P4Q B;  4LTU A;  4GDK B;  2M0A A;  1FXA A;  2H89 B;  3AEF B;  3J9C A;  1V1P B;  3AEE B;  3AE8 B;  4ARI A;  1K53 A;  2Q5W D;  1WGK A;  1YQ3 B;  3AH7 A;  3AEG B;  1OQQ A;  3BWU D;  4NAW B;  3O13 A;  4HRS A;  3W1S A;  1DOX A;  1JWA D;  2B76 B;  1QQR A;  2ZW1 A;  1L0V B;  4AS1 A;  2VZK D;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...