1L6UA

Nmr structure of oxidized adrenodoxin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6uA00
1XLNA 3B2FA 1I7HA 1WGKA 1N63A 1QOAA 2W55A 1FRRA 1ZOYB 2Y5CA 2EKIA 3LXFA 1RFKA 1L5PA 2L83A 1TKEA 3P1MA 4IDIA 2N0SB 4ZOHC 1AYFA 2AX5A 2M19A 3AEGB 3NVYA 4N6EB 3AMZA 1VLBA 4N59A 3AM9A 2MH7A 4C7ZA 4YSZB 1F0ZA 1SB3C 3CIRB 1L6UA 1L0VB 3AE9B 1TYGB 3W9CB 4ITKA 3AV8A 1L6VA 1QT9A 2WDQB 3HRDD 2CJOA 3HVZA 1E6EB 4LTUA 1YQ3B 4YTMB 4ZHOA 2KMMA 1CJEA 1VDVA 3VRAB 4ZHPA 1DOYA 1ROEA 1FFVA 1FXIA 3AEEB 1UWMA 3AN1A 3AEFB 1N61A 3P4QB 1E7PB 1KFYB 2PIAA 3AE7B 4JWSC 3FC4A 3WCQA 3ZYYX 4N58A 1OFFA 1GPXA 3ETRA 1E10A 1E9MA 1QOBA 3AECB 4JX1C 1DOIA 2WDRB 1EWYC 2BS2B 1YJJA 1JWBD 1V8CA 1YQ4B 3AEAB 3DWMA 3NVWA 2WU5B 2OHFA 1JQ4A 1N5XA 1PFDA 4YSYB 4YT0B 1RYJA 2MJEA 3AEDB 3AH7A 1NEKB 1QOFA 4HRSA 2FBWB 1FXAA 4JWUC 1CZPA 1GAQB 1NI3A 3AE5B 3P4SB 2HTME 5AUKA 1J7AA 1DOXA 1TJEA 5AUIA 3SFEB 2W3RA 5C3JB 2MJ3A 3SFDB 1WRIA 2WLBA 1FO4A 2LEKA 2B76B 2BS3B 1WXQA 2QIEB 2Q5WD 2WU2B 3AB5A 4P6VF 3ABVB 4C7YA 3DWGC 2CJNA 1QF6A 3RPFC 3HUIA 1XO3A 1RM6C 1FIQA 1NVID 1JW9D 4YTNB 1NYRA 5EE3A 3AE1B 1OQRA 2E3TA 3AE4B 1KF6B 5EE1A 1QLBB 1ZUD2 1ZP0B 4FXCA 5H92C 1AWDA 3VR8B 3VR9B 2DBYA 2KAJA 5G5HA 2BS4B 1IUEA 1FM0D 3AEBB 3NVVA 3W5VB 3CWIA 2WP9B 4C80A 1N62A 1XLQA 1JWAD 2W54A 1N5WA 3NRZA 2K5PA 1WWTA 1TKGA 2WQYB 4KX6B 1B9RA 1KRHA 3SR6A 1A70A 2G1EA 1YJIA 2BT6A 2K9XA 2MJDA 2M56B 1E0ZA 3AE8B 3P4RB 1XLPA 5MPOA 3KWLA 1NYQA 3W5UB 5G5GA 1SIJA 3AE3B 1JALA 3P63A 1ZXIA 1FRDA 3AE6B 1N60A 3LB8C 4WWMA 2PVGC 1WYGA 5EE9A 2JQRB 2WDVB 1JRPA 1JROA 1XLOA 3PO0A 1NENB 2W3SA 5GXGB 1V97A 2H89B 3EUB2 5EE0A 1J7CA 2QJLA 3VRBB 3P4PB 4A9AA 1PDXA 3B9JA 3AE2B 4US8A 1FFUA 2PVOD 2L52A 4HROA 4YSXB 1VJKA 2K22A 2JX5A 1QOGA 2H88B 3BIID 2DWQA 2PKOA 3B2GA 1TKYA 3L4PA 1OQQA 2ACZB 3FAHA 1RWSA 2WS3B 4US9A 4YTPB 5H8YE 5C2TB 4YXDB 2CU3A 1R7SA 1SF0A 1T3QA 1DGJA 3NVZA 4USAA 1FMAD 4WQMA 3NS1A 1PUTA 1J7BA
chains in the Genus database with same CATH superfamily
2V4LA 1QOAA 3LXFA 3N30A 4MGKE 4E71A 1KOTA 3RUIB 3AMZA 4N59A 2KJHB 3A9JA 5IA7A 1FEHA 4J3OD 4BKSD 2MX2A 4NJCA 2KDBA 3ZNID 1FXIA 3DVNU 4K3CA 4WJQA 3AEFB 3P2BA 3UI3A 2KX0A 1GPXA 4NQLB 4M00A 1YJ1A 2OJWA 3AECB 3KYCD 2QILA 2KWUB 1WGYA 3PHWB 1JQ4A 1Y8RC 5DPSA 1NEKB 3R2IA 3TJPA 2LVQA 1XQQA 3TEXA 5AUIA 2KWCA 3SFEB 3RD2A 2Y3AA 4NJ6A 2D3CA 3U8ZA 2KTRB 2KKCA 3PZDA 4KZ0A 3O13A 3TEYA 3VTVA 3WAPA 4TQ0A 4WWPA 3BVMA 3QCAA 3JSVB 2Z8LA 5BMHA 3QIJA 2HDEA 1F9JA 4LJPB 3PREA 2DAFA 3V05A 3TL5A 1KJTA 1FM0D 5DPRA 3LJ3A 4A20A 1B9RA 2G1EA 4MSQB 1MPEA 3SDLC 3A4RA 3AE8B 1TY0A 1NYQA 4S0RA 3TBLD 3AE3B 4ASWC 3MHZA 3I3TB 4WWMA 1N60A 1F77A 2OEDA 5JXVA 4O1NA 2D3GA 2K25A 3LDZE 1D4BA 1I4GA 2L76A 2BB5A 3B2GA 3WAMA 1V80A 2UU7A 2ZW0A 2ACZB 3E56A 1RWSA 1IPGA 1SF0A 3DHHC 3Q8EA 4E74A 5CHVC 2BWFA 4REZA 4A8XC 1N63A 2W55A 1P1AA 1WX7A 4ZOHC 3NVYA 3A4SC 2MHJA 3HIZA 2AL6A 1L0XB 1VDVA 5C1ZA 3UIOB 3AEEB 2ZVNA 3WCQA 4LJOB 4L23A 3N3KB 1V6EA 4K3BA 1EWYC 4G3XB 2K8HA 3KW5B 3MC8A 2VH2A 3DPDA 1MHHE 4XDDA 4C4VB 2KTFA 3B0AA 2KFJA 3AE5B 5AUKA 2BQQA 3DCGA 2XBBC 2IJ0A 3BVGA 5KHQA 3VTWA 2A5UA 2MRPA 4K7SA 2GBKA 4M01A 1P9DU 2KFKA 1JW9D 3DVNV 2MSED 4EZLA 3AE4B 4LK0M 1K52A 2QHOA 2JXTA 3VR8B 1SE4A 4GMVA 2KAJA 4HWIB 1S1QB 4L1BA 3W5VB 1UD7A 3NRZA 1RAXA 3ZLZA 2QMTA 4TMAB 2KVRA 2KLCA 1JCKB 1P0RA 2MA9B 3BINA 4J6IA 5IKCM 3KWLA 1WF9A 3AE6B 2ZW1A 2PVGC 4B95A 3PO0A 5D6JB 2INPE 1V1PA 1R4NB 4JLCA 2JPHA 2NBUA 4A9AA 1WGDA 1GNUA 4RH6A 1WZ3A 4HROA 1VJKA 4AUQC 1K53A 1T6BX 4BVUC 4MT5A 3ML8A 2WXMA 1IBXB 3DVGY 1MHXA 2C60A 1GB1A 3K9OB 3H6NA 1FMAD 3UINB 3HHMA 2WGSA 4XYCA 1WGKA 4EZJA 1ZOYB 1HQRD 2XEWA 3SHQA 4BKTA 1KLVA 4RCOA 3L13A 2EKEC 4A55A 2G4SA 5CX3A 1TYGB 4GU2A 3AV8A 2N9EB 2WXGA 4II2B 2G45B 4JWSC 2PIAA 2C7NB 1E9MA 1WYWB 3OJ4B 2KQ7A 3EFUA 1XEEA 1DOIA 3GZNB 1WXAA 1JWBD 2MW5A 3AEAB 2FCQA 1ZW7A 2WU5B 2K8CA 2WXQA 2WXOA 1ACCA 1PFDA 4NNJB 4HKZE 2K1FA 2DZJA 1SIFA 3D32A 4RM8A 1D5XC 2MJ3A 4A6QA 1Y56A 2ZVOA 2O6VA 1FNVA 3DVGX 1WMHB 3I5JC 5I4DA 4RGOS 4GGQA 3FKYA 3DWGC 1HA5A 2KMAA 2JWZA 2MBOA 3L08A 5J18A 3V62A 2RSUA 3WAOA 4MJSA 4FJYA 3C19A 5FR3A 1JWAD 1HZ6A 4IM3A 2JSVX 1I4XA 2LGYA 2KJRA 1XLPA 4EKUA 1GOZA 3DBLI 5BYRA 2KN4A 1UELA 3B1LX 4URKA 3EUB2 1D6EC 3BY4B 1WXSA 3KYDD 5TR5A 1FD6A 3L17A 5FK9C 3L4PA 3Q3JA 4JGHB 1TIFA 5BO4B 1E7UA 4YXDB 3VUWA 1T3QA 4MACA 3ZNZB 3PHXB 2EKIA 1UH6A 1TKEA 4GSWA 3RN9C 1YIWA 3DOWA 2N7DA 2N7EA 2OOBB 4YSZB 4UDUC 1UBQA 2ZNVB 2KACA 3K9PB 2K6QA 5J2RA 1PYWD 1X1MA 2D2QA 3HVZA 1CK1A 3VRAB 1WE7A 3P4QB 1P3QU 1RFAA 4HPMB 1OGWA 3EGRA 2C5LC 2M0AA 2KTRA 3VQIA 1QOFA 4HRSA 3PRZA 2KXJA 3V6EB 1D5MC 3NY5A 3EHVA 3JSVA 1PGBA 3HM6X 2RDHA 4MGIE 2ON8A 4OW0A 5DPTA 2LGSA 3X23A 1WH3A 1SE3A 3RPFC 3PZ8A 2V0GA 2BYTA 5BYSA 3DDCB 2WXJA 4YL8A 4EUTA 1LXDA 3Q3MC 1QLBB 2MQJA 2IO2B 2RMMA 5FR6A 3ZXVA 3R2TA 4RGMA 3ZVVA 3QA8A 2N1WA 2IO3B 1RLFA 3QK0A 2LRUA 3AXCA 1UGMA 3Q6BA 1WX8A 3RNCC 1SIJA 1M94A 2R2OA 1JRPA 3IT6B 1U4AA 4Q2JA 3M62B 2W9NA 4B0MA 3N1XC 4PT5A 3VRBB 5CHFA 2I1KA 3IAS1 2LI5A 4PYZA 4BAXA 4RFBA 4XC2A 1J0GA 1TKYA 1EU4A 4AP4C 2AQ2B 2WWZA 1ET6A 3NS1A 3PRMB 1E8WA 3Q69A 2BW2A 2C9WB 4AQ7A 2B3AA 5CTRC 3AU5A 2DZMA 4LNKA 4CYEA 3H8HA 3A9KB 2ZPNA 1CJEA 3MJWA 3TUOA 4FJVB 4NAWA 3FC4A 5FKAC 1MG8A 3KVFB 2Y5BB 1ET9A 4G50A 2JRIB 5G2NA 2DHZA 3AH7A 4ICVA 2LXAA 3RNEC 2ZCBA 4EE2A 2IBIB 3B08A 1WRIA 3SFDB 1TS2A 2LEKA 4IOIE 3H7SA 2RD0A 2L0TA 3KWVA 1EF1A 2V3PA 1C9FA 1FXTB 1OQRA 1CMXB 2KWVB 3CMMB 2N4FA 2CKHB 5C23A 2GI9A 3RCZA 3IT4B 1TKGA 3KUCB 4LNFA 5IOIA 3Q3FA 5D2MB 1FRDA 4OHJA 5EE9A 1IBXA 4FHKA 3MTNB 4KSKC 3PTFC 2O6VB 4M8NA 1HEZE 2L52A 4II3B 2LMCA 4H2AA 2PKOA 2Z0EB 5C2TB 4OZBA 1PGAA 4ZDVA 1WM3A 2PE9A 2X8XX 3B2FA 4K1RB 5E6OA 2MEKA 3ZRCA 1FRRA 1NBFC 1V5TA 3AEGB 4OVUA 1Q1OA 4GIVA 2WXFA 3U7DA 1ZKHA 3AM9A 1XT9B 2PTLA 1OQYA 1WGGA 5E6PA 2BYVE 4FLHA 1E6EB 1YQ3B 2AQ3B 4A3PA 1UWMA 4HEA1 4P7IA 3TEZA 1E10A 3ZTCA 3QARA 1I4HA 2WDRB 1V2YA 4W9KA 2L1AA 2LVOA 2L3ZA 1WMHA 4C56C 2LGDA 3ZJVA 2INCC 5C3JB 2C7MB 4IM0A 1V86A 1WXQA 2L00B 5JHBA 4IG7B 2ASQA 1YX6B 2M8SA 3ALBA 3T3NA 3N32A 2CU1A 1AARA 4YTNB 3TMPB 1L0YB 1H8CA 2KQ4X 2E3TA 4W9CA 2D5GA 3PT2B 2IPKD 4IM2A 2KQSA 5KHOA 1XLQA 4ZRPA 4P16A 1N5WA 4ZYNA 2Z0DB 1R4NI 3GE8C 2HJ1A 1WZ0A 3UQBA 1E90A 1UGJA 3PGEA 2IGHA 3C8YA 2J53A 4IWPA 2KO3A 2EMSA 4FN2A 4HLEA 5IP4D 2W3SA 2H89B 1JWSD 2PVOD 5HFYA 2YLMA 3OLMD 4IWQA 2KT7A 5IN7A 3GOEA 3IXSA 5L95C 3C0RB 3HM3A 2KDMA 4ZRKA 1QZEA 2QSDA 2WXHA 5TSSA 4LNIA 2IGDA 3AI5A 2GBRA 2INDC 1M4VA 4MSMB 2VZKD 3GZNI 1R4MB 2KDIA 4DQOC 3ENEA 3IVFA 2CHZA 1ZPSA 4ANVA 5IO9A 3Q8FA 5LNK1 2LD9A 2BF8B 3DBRB 1BXTA 3EA6A 4KGSA 2OHFA 3RNGC 1OTRB 3R66C 4BKSA 1QKZA 2AWTA 1FCLA 1WE6A 1EO6A 3NZ3A 4MELA 4F7ZA 2BKFA 4LNNA 1F2RI 4WQMA 2EMTA 1TS5A 2WU2B 2V1YA 2BYEA 3APCA 2CJNA 3W1SC 2Z59B 4FULA 4FA6A 3BYYB 2LHDA 1NVID 1YN4A 4W9FA 4C00A 2KANA 1I4RA 1LO5D 5HKHA 1ZUD2 2LUMA 3GB1A 4NAWB 2REXA 4KGTA 4WQOB 3N1ZC 1F1HA 1KLGD 4IWOA 3KH0A 3ECIA 3EFCA 4HKQA 2K9XA 3M3JA 1XF5L 1ZGUB 2KHWB 4OZCA 3APDA 4HVBA 3Q14C 4I6LB 4AWJA 1PDXA 1YMHE 5JHAA 2QEJC 2LASA 3M95A 2JT4B 2ZPYA 3UQAA 4OVZA 3BK2A 2ZZPB 3IAM1 4WAFA 1DGJA 4HXDA 3A9KA 1P7FA 2FUHB 2W82A 1J8CA 2FIFA 2WNMA 3GE3C 1WJ4A 5E6JA 1KM7A 1Z5SB 1E8YA 1DOYA 3AN1A 4DDID 1F0ZA 2WXRA 2LXCA 5JH5C 3UF8A 4W9GA 3ZYYX 4CO7A 3J9CA 1OFFA 5G55A 2J7QB 2N9KA 3PS6A 4PK1A 2DAJA 1YX5B 3DWMA 2GLSA 3RNAC 4DK5A 4XWWA 1N5XA 2MJEA 4GDLB 4KSLC 3I63C 3TEWA 1HE8A 2HTME 4PS7A 2WLBA 1FO4A 2JWUA 3AULA 2Q5WD 4LDTD 2JXXA 4KDLB 3ZGZA 1FIQA 2KZRA 3Q8AA 1NYRA 2MWSB 1D5ZC 3QAQA 1KF6B 2WHIA 5T8IA 3VR9B 2FCSA 3VTUA 2DBYA 2ZCCA 3RZFA 2LJIA 1C78A 2K5PA 2N9PC 2M1MA 2WQYB 2QC8A 1YJIA 4AS1A 2LUEA 3VDZA 3VXWA 4DWFA 2WYQA 1TY2A 2PJHA 2WDVB 2KVZA 3VFKA 1V97A 5EE0A 4MH0E 1GG3A 1ENFA 1EU3A 2KWDA 3RYTA 4NJ7A 1MVKA 2FIDA 3Q2AC 2CS4A 1Z2MA 2RGFA 2JX5A 1J19A 2DWQA 2EELA 4JIOU 3FAHA 4L2YA 3SU8X 1H4RA 2BGFA 4EZKA 4ANWA 3QHTA 2KN5A 1EM7A 4TUUA 3RNBC 2RDBC 2L83A 3NZSA 3P1MA 2D3BA 4M0WA 3ZKJC 4ITKA 2CJOA 2K6DB 3V61A 1WSPA 2LJ5A 3ONSA 4GB9A 4N58A 2YEPF 3CSFA 2NTSA 3I9V1 4EEWA 2J0JA 4CQNA 2BKRB 3KUZA 1I4QA 3AEDB 1SJHD 3PPAA 5E6NA 2KX3A 3ZRFA 3CF6E 4F8CB 2I2YA 3EC8A 1TS3A 3AB5A 2NR2A 5BMGA 1VZ8A 4AJWA 3H1UA 1XO3A 1WGRA 3V3XA 5H92C 2DYOA 1T5XD 3AEBB 2WP9B 2N1VA 3GP7A 3AU4A 2KDEB 1A70A 1WXVA 2CHWA 3N20C 1JWMD 1LQBA 1QQRA 3Q8CA 4S17A 1GC7A 2QJLA 4XZ4A 2G4DB 3B9JA 4JL9A 2K22A 4RGNA 4W9JA 1K50A 2FCNA 4KKJA 3NUHB 3NHEB 4XE0A 4USAA 2BWES 2JZZA 3ZTDA 3JVZX 1JRUA 4EFOA 3QJZA 1AYFA 3UGBB 4ANXA 2AQ1B 1XXGA 2IO1B 2BBCA 3WANA 2SAKA 3W9CB 3NS8A 5D94A 3O65B 1WRDB 3VHTC 4G0NB 3X0WA 5BYQA 1E7PB 4MM3B 2C7HA 1TZ1A 2NS5A 4WWOA 4KKIA 1TGZB 2K39A 4I6PA 2HE7A 1SXTA 4HPLB 1WI0A 4YT0B 1V5OA 2QDFA 4F1SA 2CHXA 2RPQA 1ISNA 2J52A 1YOVB 4P6VF 2N7JA 1HTQA 2VZKB 1ZDVA 1C79A 1DYQA 1UUPA 2R2QA 2WX1A 5EE1A 4RMAA 4DXAB 3NG0A 3ZJTA 3OG5A 2IO0B 2D10A 4A3OA 2JYEA 2JF5A 3SR6A 4LCDE 1TTNA 2WDTB 4NY0A 3W5UB 4XGAB 1XD3B 2NPTB 1ESFA 3QWZB 3HVDA 2J4XA 1F2RC 4TSSA 1TZOA 4BZAA 1SEBD 1C3TA 3NVZA 3FILB 1R4MI 1T0YA 1BMLC 1PUTA 1ZE3D 2KDFB 3LB8C 4LNOA 1I35A 2Y5PA 3R7QA 4ARCA 2FAZA 4GXBA 4ZRJA 1YN3A 2MH7A 1SB3C 3I57A 1EF5A 2GOWA 4GOCA 3AE9B 4DXFA 3DBRI 4HK2A 4GDLA 4K7WA 1ROEA 1UF0A 4RF0A 1E8ZA 3R7RA 1WFYA 3ETRA 5HHDG 1QOBA 4MDKE 2LGIA 2IY1B 1TT5B 1YJJA 2K0PA 4YSYB 1MI0A 1GAQB 3P4SB 2GBMA 3T8MA 1WXMA 5JZEB 5AEKB 2V3NA 5LXHA 2W3RA 1YNTE 2KMCA 2ZEQA 4ZRIA 3R8BA 3ZDMC 4OZAA 2QIEB 4X57B 2ZNVC 3PSEB 1WM2A 3Q8BA 4M0WB 3SD5A 2DENB 2E6XA 2UYZB 3WIMA 1WIAA 3VVWB 3MP9A 2ICIA 1T0QC 2DNFA 4LLGM 2PMVA 3APFA 4P1BC 4GDKA 3W2DA 2A4ZA 4ARIA 2INNE 4HCNB 4KIKB 1L7YA 2MJDA 3NOBA 1E8XA 3H7PB 3PVLA 3Q3OC 3A1QB 1GC6A 4LDTB 1WR1A 2O2VB 2KYWA 3E9SA 3JYUA 1AN8A 3UIPB 2HD5B 3ZNHB 1D3ZA 4W9HA 2MLBA 4RNAA 2L0FA 1R7SA 5HG2A 4DHJD 1IGCA 2XK5A 1HZ5A 2NMQA 2AX5A 2J0MA 4NAMA 1VLBA 4C7ZA 2IY0B 4B6WA 2UWQA 3CIRB 4B0EA 4M02A 4DHZB 1QT9A 4LTUA 2I38A 1JMLA 3MJ5A 3TCAA 4ZHPA 3DBHB 1N61A 1KFYB 1VRAB 2NBWB 5AZFA 4KDIC 2JYTA 1EWCA 2DX5B 1V8CA 4KVGB 1P7EA 3VUYA 3U30A 3V60A 2KC2A 4WAAA 4K81A 3VAWA 1P98A 3URYA 2B76B 1K8RB 3IG3A 4RF1A 3HUIA 1PGXA 4HJGE 1JWUD 3WALA 1IP9A 3ZIMA 3KUDB 1K51A 3DBSA 1UNSA 4DDGD 4BBNC 4XDCA 1C76A 1STEA 3RI7C 3ZW3A 3N1YC 4KV2A 1KRHA 1E0ZA 1FCCC 5MPOA 4QAYA 3QC8B 4WWNA 2OJRA 1WYGA 3SEBA 2NVUI 1TS4A 1JROA 1XLOA 3DHIC 1J7CA 4US8A 2X38A 4WJNA 4I6NB 2NCNA 3BIID 2PLPA 1OQQA 5D3DA 4M8MA 1GUAB 4PS8A 3LYYA 4US9A 4BOSC 2WXIA 4B9KA 4NPNA 1KH0A 1VD2A 1VCBA 3P4PB 1V1OA 1VR9A 1WY8A 1I7HA 3VUXA 1OEYJ 2Y5CA 4MM3A 1RFKA 1L5PA 2N9LA 2N0SB 1IYFA 2JRHA 3U2SC 2HJ8A 3L10B 4A90A 1L6VA 3HRDD 1A5RA 3DHGC 3ZNGC 5J17A 2BB6A 1FFVA 4HDQA 4WJOA 1SSNA 4BFRA 2O6VD 5L83A 1S3SG 3CSTA 4MH8A 2BS2B 1YQ4B 1SE2A 4G11A 1RYJA 3R3MA 3ZO5B 5CHWA 1GB4A 1J7AA 2MP2A 1V9JA 2ONQA 5BMIA 4DBGA 2KD0A 2LRWA 1NI2A 3U52E 2M0XA 1C1YB 5AZGA 2WXKA 1ZDXA 2L8JA 3BZDB 3ZDTA 1Q0WB 1L4ZB 2CR5A 2PEAA 2FNJB 2DYBA 2BS4B 1I4PA 1Q5WB 4C80A 3IFWB 3RFZB 2NPTA 2LHEA 3VH4B 1T0SC 3W1SA 2G3QB 2KNBA 4HPPA 2ZJDA 1JALA 3MC0B 1C77A 2FUG1 3FILA 3A33B 2G9HD 2I1JA 1FFUA 1FNWA 1XCTL 3ML9A 1QOGA 1YN5A 2V3SA 4TV3A 1XCQL 2WXLA 1V49A 2M17A 4FBJB 4YTPB 2AEHA 3VH3B 4IKGA 2M4NA 1XLNA 1T0RC 1MJDA 3RMKC 2YEPB 3MC9A 4GDKB 2BVCA 4IDIA 3L0WB 4DXGA 4BKGA 3WA0A 4N6EB 1EUVB 4HCPB 1L6UA 1L0VB 4HJKA 2WDQB 4YTMB 3ZQ4A 1WJNA 3U7ZA 4AOFA 3HK0A 2K3UA 2XN9C 3PZ7A 2DZKA 4BOZB 4JX1C 2VRRB 1WJUA 3A9JB 2KJ6A 3NVWA 1FPYA 2WXPA 2L7RA 1RRBA 1YD8U 2FBWB 2N9XA 1FXAA 1F52A 2KC1A 1CZPA 1NI3A 2D11A 3L54A 2BPSA 2XK5B 3TSSA 4JPSA 5D3IB 2YVCA 1E7VA 3L16A 2GBJA 2HTHA 2LWPA 3OJ3A 3TIXA 1OEYA 3GS2A 1QF6A 1RM6C 2L05A 2LFIA 4P1CC 4KIKA 4K7UA 5EE3A 3AE1B 1MFWA 1ZP0B 1AWDA 2AYOB 2PPHA 3N9YC 2J0KA 3JW0X 3H7PA 2V9HA 3A1QA 3QX1A 1AW7A 1WX9A 2O2VA 3KQ4A 5EDSA 4AJYB 1C4CA 5LXIB 4NQKE 1LGRA 1Q10A 3BWUD 4KX6B 4WH4A 2BT6A 1L4DB 3P4RB 2LGXA 2BYFA 5G5GA 1ZXIA 5GXGB 2JQRB 3IBEA 4NZLB 2RDGA 4IC7B 3OAWA 3V6CB 4OVVA 2AL3A 4JQWC 2IGGA 2WX0A 4PS3A 2MBQA 1GJZA 2MCNB 3M63B 2BS3B 3BVZA 2KLGA 2LVPA 4FJZA 4W9EA 4XWTA 2GB1A 2GMIC 3PLVA 2IYDB 1LM8B 2KMMA 4CHKA 4ZYSA 2SEBD 4ANUA 4DHZE 4ICUA 4ZRQA 3ZJUA 1NDDA 1BUIC 5IAAC 3NZUA 4W9DA 2RPVA 5AZHA 3BYTB 2PW9A 4DHJB 4JWUC 4FADA 3Q3NC 4WIPA 5LLIA 1G6JA 2V4IB 2MBEA 3ABVB 4C7YA 1C4AA 2JZ3B 4KGRA 1UZXB 2D07B 1SJED 4YWGG 1C4PA 2GBNA 4FXCA 3PV1A 4JE3B 4R3DA 3RULA 4GN1A 1SE9A 3NVVA 3CWIA 5HI1A 1N62A 1BT0A 1WR6E 2KFKB 1WGHA 4MEMA 4W9LA 3RT3B 5DPWA 4GLSC 2RR9A 2M56B 5GMVA 2BTEA 2VH1A 2MP2B 3MHSD 1NENB 1PQSA 3T3OA 4EOYA 2IZVB 2D3AA 4ACFA 4C4VA 4YSXB 2DYMA 3OWEB 1KTKA 2H88B 2TSSA 3DBLB 2NTTA 1VZ7A 3ZUNA 2WS3B 2CU3A 2QCZA 1V1PB 4WJPA 1L2NA 3RNFC 4TKNA 3DBHI 1WJ6A 2NBVB 3U4EG 3NJTA 2M19A 3IHPC 4PYUA 5D7GA 1CQVA 2MBHA 3H9DA 3S2AA 1V81A 4ZHOA 1QILA 4HDOA 4WURA 3AE7B 2J42A 3EECA 1LFDA 3T9LA 2FCMA 4XX5A 1SGHA 2PE6B 3ZXRA 1VZ6A 2JZPA 1UWXA 3RZWC 3MFGA 4RGTA 1E5WA 4TQ1A 1DOXA 1TJEA 2MBBB 2JVCA 3BK1A 4E3CA 4BBNF 2JUOA 2FE8A 1SBBB 3PRPB 4IUMB 2KK8A 4KZCA 1HTOA 3QQ8B 2KOXA 3DQVA 4D2KA 1MG4A 3KLSX 1IGDA 2LZ6A 5G5HA 1FNUA 1IUEA 2DZIA 4MGZE 2JU6X 4W9IA 2W54A 2JY6A 1WWTA 4MGYE 2R61A 2GRIA 2K8BA 2XNAC 2IDYA 5DCNA 3W1YA 2L32A 3P63A 4IW0A 4MJSB 1B1ZA 3P42A 1YQBA 1TBEA 4RM9A 2DLBA 1ZXHA 3AE2B 1KLUD 1N6ZA 2WXNA 1I42A 5H8YE 4FHJA 3PLUA 4N9F4 1HXYD 1J7BA 1UBIA
chains in the Genus database with same CATH topology
1VR9A 1I7HA 1QOAA 3LXFA 2Y5CA 1RFKA 1L5PA 2L83A 3Q69A 3P1MA 2N9LA 2N0SB 2BW2A 3AMZA 4N59A 3U2SC 4AQ7A 4M0WA 4A90A 3H8HA 4ITKA 1L6VA 3HRDD 1FEHA 2CJOA 4J3OD 4NJCA 1CJEA 2BB6A 3TUOA 1FFVA 1FXIA 1WSPA 3AEFB 3FC4A 1SSNA 3UI3A 4N58A 5FKAC 2YEPF 1GPXA 2NTSA 3AECB 4MH8A 3I9V1 2QILA 2BS2B 1ET9A 1YQ4B 1SE2A 1JQ4A 4CQNA 1I4QA 1RYJA 1SJHD 3AEDB 1NEKB 3AH7A 3R2IA 1GB4A 1J7AA 3TEXA 5AUIA 3SFEB 4EE2A 3SFDB 1WRIA 1TS2A 2I2YA 2LEKA 1TS3A 2Y3AA 4IOIE 2ONQA 3AB5A 5BMIA 3U52E 5BMGA 3O13A 1VZ8A 3TEYA 3KWVA 1XO3A 2V3PA 1C9FA 4TQ0A 3BVMA 2WXKA 1ZDXA 3V3XA 2Z8LA 5BMHA 1OQRA 2HDEA 3BZDB 5H92C 2DYOA 1L4ZB 1T5XD 3V05A 2GI9A 2BS4B 1I4PA 1FM0D 3AEBB 2WP9B 4C80A 3RFZB 3IT4B 2LHEA 1TKGA 3GP7A 1B9RA 3W1SA 1A70A 2G1EA 1MPEA 3AE8B 1TY0A 1NYQA 3AE3B 3MHZA 1JALA 1FRDA 1JWMD 1N60A 1F77A 3MC0B 4OHJA 4WWMA 1C77A 5EE9A 1IBXA 1QQRA 3Q8CA 2FUG1 2OEDA 5JXVA 3FILA 4O1NA 2QJLA 3P4PB 1HEZE 2G9HD 3B9JA 1FFUA 1FNWA 2L52A 1XCTL 1I4GA 1D4BA 2LMCA 2BB5A 2K22A 4RGNA 1QOGA 1YN5A 4H2AA 2PKOA 3B2GA 1XCQL 2WXLA 2ZW0A 1K50A 2ACZB 1RWSA 3E56A 4YTPB 4KKJA 5C2TB 4OZBA 3NUHB 1PGAA 4IKGA 1SF0A 4XE0A 1J7BA 4USAA 3Q8EA 1XLNA 3B2FA 4REZA 4A8XC 2MEKA 1N63A 2W55A 1FRRA 2YEPB 4GDKB 4IDIA 4ZOHC 1AYFA 3AEGB 4DXGA 3NVYA 4N6EB 2WXFA 3AM9A 2AQ1B 2PTLA 1XXGA 1L6UA 1L0VB 2BBCA 2SAKA 3W9CB 1L0XB 2WDQB 4YTMB 1E6EB 1YQ3B 3ZQ4A 2AQ3B 1VDVA 3AEEB 1UWMA 5BYQA 3U7ZA 1E7PB 4MM3B 4HEA1 3WCQA 2K3UA 2XN9C 4L23A 4KKIA 3TEZA 1E10A 3PZ7A 1I4HA 4JX1C 2WDRB 1EWYC 1SXTA 2L1AA 3NVWA 2WXPA 1MHHE 4XDDA 4YT0B 4C56C 2FBWB 1FXAA 3ZJVA 1CZPA 1NI3A 3AE5B 5AUKA 5C3JB 2J52A 2IJ0A 3BVGA 3TSSA 4JPSA 1WXQA 5D3IB 4P6VF 2N7JA 2VZKB 3GS2A 3T3NA 1QF6A 1ZDVA 1C79A 1RM6C 1DYQA 1UUPA 2LFIA 1JW9D 4YTNB 1L0YB 5EE3A 2KQ4X 2E3TA 3AE1B 3AE4B 5EE1A 2D5GA 1K52A 4LK0M 1ZP0B 2JXTA 1AWDA 3VR8B 1SE4A 3N9YC 2IPKD 2KAJA 4L1BA 3W5VB 3ZJTA 1AW7A 3KQ4A 1C4CA 1XLQA 4ZRPA 4P16A 1N5WA 3NRZA 2QMTA 1Q10A 3BWUD 4KX6B 4TMAB 2JYEA 4WH4A 1JCKB 3SR6A 1UGJA 2BT6A 1L4DB 3P4RB 2IGHA 3C8YA 2J53A 3KWLA 3W5UB 5G5GA 1ZXIA 3AE6B 2ZW1A 2PVGC 5GXGB 2JQRB 3PO0A 2W3SA 4YWGG 1ESFA 2H89B 2INPE 1V1PA 4NZLB 2RDGA 3HVDA 2J4XA 4A9AA 1JWSD 4RH6A 2PVOD 4HROA 1VJKA 1F2RC 1K53A 2IGGA 1T6BX 5HFYA 4TSSA 1TZOA 4MT5A 2WXMA 1IBXB 1SEBD 1GB1A 1MHXA 3IXSA 3NVZA 1FMAD 3FILB 1BMLC 1PUTA 1ZE3D 2BS3B 3BVZA 3LB8C 1WGKA 2KDMA 1ZOYB 1HQRD 2Y5PA 2QSDA 2WXHA 4RCOA 5TSSA 4ARCA 2IGDA 1YN3A 4XWTA 2MH7A 4A55A 1M4VA 1SB3C 3I57A 2GB1A 1TYGB 3AE9B 4DXFA 2VZKD 3AV8A 2WXGA 2KMMA 4DQOC 4ZYSA 1ROEA 2SEBD 4JWSC 2PIAA 4RF0A 1ZPSA 4ZRQA 3ZJUA 3Q8FA 3ETRA 5HHDG 5LNK1 1E9MA 1QOBA 1BUIC 2LGIA 1XEEA 1DOIA 1BXTA 1YJJA 1JWBD 3AEAB 2K0PA 3EA6A 2WU5B 4KGSA 2OHFA 2RPVA 2WXQA 2WXOA 1ACCA 1PFDA 3BYTB 1MI0A 4YSYB 4HKZE 2PW9A 4JWUC 1QKZA 1GAQB 3P4SB 1FCLA 2V3NA 3NZ3A 2W3RA 1YNTE 1D5XC 2MJ3A 4WIPA 4A6QA 1Y56A 3R8BA 1F2RI 4OZAA 4WQMA 1TS5A 1FNVA 2QIEB 2WU2B 2V4IB 5I4DA 4RGOS 3ABVB 4C7YA 3DWGC 3Q8BA 1HA5A 2CJNA 1C4AA 2E6XA 3BYYB 2LHDA 1NVID 1YN4A 4KGRA 1I4RA 1LO5D 1SJED 3MP9A 2ICIA 1ZUD2 1C4PA 2LUMA 3GB1A 4FXCA 4JE3B 4KGTA 4LLGM 2PMVA 4NAWB 4R3DA 3W2DA 3NVVA 5FR3A 3CWIA 5HI1A 1KLGD 4ARIA 1N62A 1JWAD 2INNE 1HZ6A 2JSVX 1I4XA 4HKQA 2MJDA 2K9XA 4GLSC 2M56B 2BTEA 1XF5L 1XLPA 1GOZA 5BYRA 2KN4A 4OZCA 1NENB 3EUB2 1D6EC 3T3OA 3E9SA 1AN8A 1PDXA 1YMHE 2QEJC 2DYMA 4YSXB 1FD6A 5FK9C 3OWEB 1KTKA 2H88B 3L4PA 2TSSA 2NTTA 4RNAA 1VZ7A 4OVZA 3BK2A 2WS3B 4YXDB 3IAM1 2CU3A 1R7SA 4WAFA 5HG2A 1T3QA 1DGJA 1V1PB 1P7FA 1IGCA 4MACA 1HZ5A 2W82A 2EKIA 2NMQA 1TKEA 2WNMA 3U4EG 2AX5A 2M19A 4NAMA 1VLBA 5D7GA 4C7ZA 1CQVA 4YSZB 4UDUC 5E6JA 2KACA 3CIRB 4B0EA 1QT9A 4LTUA 1PYWD 3HVZA 2I38A 1CK1A 4ZHOA 1QILA 1JMLA 3MJ5A 3VRAB 1DOYA 4ZHPA 3AN1A 1F0ZA 2WXRA 1N61A 3P4QB 1KFYB 3AE7B 1VRAB 2J42A 4WURA 3ZYYX 2JYTA 3J9CA 1OFFA 1EWCA 3EGRA 2N9KA 1V8CA 3DWMA 1P7EA 2M0AA 4XWWA 1N5XA 1VZ6A 2MJEA 4GDLB 2JZPA 3VQIA 1UWXA 1QOFA 4HRSA 3MFGA 4RGTA 3TEWA 2HTME 4TQ1A 1DOXA 1TJEA 1D5MC 1PGBA 2WLBA 3URYA 2RDHA 3BK1A 1FO4A 2JWUA 2B76B 2ON8A 4OW0A 2Q5WD 2FE8A 1SBBB 4RF1A 1SE3A 3RPFC 3HUIA 3ZGZA 1PGXA 3PZ8A 2V0GA 4HJGE 1JWUD 2BYTA 5BYSA 1FIQA 2WXJA 3Q8AA 1NYRA 1D5ZC 1K51A 1KF6B 1QLBB 4D2KA 1UNSA 5T8IA 3VR9B 2RMMA 3KLSX 2DBYA 4XDCA 1IGDA 5G5HA 1FNUA 1IUEA 1C76A 3R2TA 4RGMA 2LJIA 1C78A 2JU6X 2W54A 1STEA 2K5PA 1WWTA 2WQYB 2R61A 2GRIA 1KRHA 1YJIA 4AS1A 1E0ZA 2XNAC 1FCCC 2IDYA 5MPOA 1SIJA 2L32A 1TY2A 3P63A 1B1ZA 1WYGA 3SEBA 2WDVB 3P42A 1JRPA 1JROA 1TS4A 1XLOA 3IT6B 1V97A 4Q2JA 5EE0A 1ENFA 2DLBA 1ZXHA 4B0MA 1J7CA 1EU3A 4PT5A 2KWDA 3VRBB 3AE2B 4US8A 1MVKA 2X38A 1KLUD 3IAS1 4RFBA 2JX5A 3BIID 2DWQA 1TKYA 2PLPA 1OQQA 2EELA 5D3DA 3FAHA 4L2YA 2WXNA 3LYYA 4US9A 5H8YE 1EU4A 2WXIA 1HXYD 2AQ2B 1KH0A 1ET6A 3NS1A 1EM7A 1V1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLN A;  3B2F A;  1I7H A;  1WGK A;  1N63 A;  1QOA A;  2W55 A;  1FRR A;  1ZOY B;  2Y5C A;  2EKI A;  3LXF A;  1RFK A;  1L5P A;  2L83 A;  1TKE A;  3P1M A;  4IDI A;  2N0S B;  4ZOH C;  1AYF A;  2AX5 A;  2M19 A;  3AEG B;  3NVY A;  4N6E B;  3AMZ A;  1VLB A;  4N59 A;  3AM9 A;  2MH7 A;  4C7Z A;  4YSZ B;  1F0Z A;  1SB3 C;  3CIR B;  1L6U A;  1L0V B;  3AE9 B;  1TYG B;  3W9C B;  4ITK A;  3AV8 A;  1L6V A;  1QT9 A;  2WDQ B;  3HRD D;  2CJO A;  3HVZ A;  1E6E B;  4LTU A;  1YQ3 B;  4YTM B;  4ZHO A;  2KMM A;  1CJE A;  1VDV A;  3VRA B;  4ZHP A;  1DOY A;  1ROE A;  1FFV A;  1FXI A;  3AEE B;  1UWM A;  3AN1 A;  3AEF B;  1N61 A;  3P4Q B;  1E7P B;  1KFY B;  2PIA A;  3AE7 B;  4JWS C;  3FC4 A;  3WCQ A;  3ZYY X;  4N58 A;  1OFF A;  1GPX A;  3ETR A;  1E10 A;  1E9M A;  1QOB A;  3AEC B;  4JX1 C;  1DOI A;  2WDR B;  1EWY C;  2BS2 B;  1YJJ A;  1JWB D;  1V8C A;  1YQ4 B;  3AEA B;  3DWM A;  3NVW A;  2WU5 B;  2OHF A;  1JQ4 A;  1N5X A;  1PFD A;  4YSY B;  4YT0 B;  1RYJ A;  2MJE A;  3AED B;  3AH7 A;  1NEK B;  1QOF A;  4HRS A;  2FBW B;  1FXA A;  4JWU C;  1CZP A;  1GAQ B;  1NI3 A;  3AE5 B;  3P4S B;  2HTM E;  5AUK A;  1J7A A;  1DOX A;  1TJE A;  5AUI A;  3SFE B;  2W3R A;  5C3J B;  2MJ3 A;  3SFD B;  1WRI A;  2WLB A;  1FO4 A;  2LEK A;  2B76 B;  2BS3 B;  1WXQ A;  2QIE B;  2Q5W D;  2WU2 B;  3AB5 A;  4P6V F;  3ABV B;  4C7Y A;  3DWG C;  2CJN A;  1QF6 A;  3RPF C;  3HUI A;  1XO3 A;  1RM6 C;  1FIQ A;  1NVI D;  1JW9 D;  4YTN B;  1NYR A;  5EE3 A;  3AE1 B;  1OQR A;  2E3T A;  3AE4 B;  1KF6 B;  5EE1 A;  1QLB B;  1ZUD 2;  1ZP0 B;  4FXC A;  5H92 C;  1AWD A;  3VR8 B;  3VR9 B;  2DBY A;  2KAJ A;  5G5H A;  2BS4 B;  1IUE A;  1FM0 D;  3AEB B;  3NVV A;  3W5V B;  3CWI A;  2WP9 B;  4C80 A;  1N62 A;  1XLQ A;  1JWA D;  2W54 A;  1N5W A;  3NRZ A;  2K5P A;  1WWT A;  1TKG A;  2WQY B;  4KX6 B;  1B9R A;  1KRH A;  3SR6 A;  1A70 A;  2G1E A;  1YJI A;  2BT6 A;  2K9X A;  2MJD A;  2M56 B;  1E0Z A;  3AE8 B;  3P4R B;  1XLP A;  5MPO A;  3KWL A;  1NYQ A;  3W5U B;  5G5G A;  1SIJ A;  3AE3 B;  1JAL A;  3P63 A;  1ZXI A;  1FRD A;  3AE6 B;  1N60 A;  3LB8 C;  4WWM A;  2PVG C;  1WYG A;  5EE9 A;  2JQR B;  2WDV B;  1JRP A;  1JRO A;  1XLO A;  3PO0 A;  1NEN B;  2W3S A;  5GXG B;  1V97 A;  2H89 B;  3EUB 2;  5EE0 A;  1J7C A;  2QJL A;  3VRB B;  3P4P B;  4A9A A;  1PDX A;  3B9J A;  3AE2 B;  4US8 A;  1FFU A;  2PVO D;  2L52 A;  4HRO A;  4YSX B;  1VJK A;  2K22 A;  2JX5 A;  1QOG A;  2H88 B;  3BII D;  2DWQ A;  2PKO A;  3B2G A;  1TKY A;  3L4P A;  1OQQ A;  2ACZ B;  3FAH A;  1RWS A;  2WS3 B;  4US9 A;  4YTP B;  5H8Y E;  5C2T B;  4YXD B;  2CU3 A;  1R7S A;  1SF0 A;  1T3Q A;  1DGJ A;  3NVZ A;  4USA A;  1FMA D;  4WQM A;  3NS1 A;  1PUT A;  1J7B A; 
#chains in the Genus database with same CATH topology
 2V4L A;  1QOA A;  3LXF A;  3N30 A;  4MGK E;  4E71 A;  1KOT A;  3RUI B;  3AMZ A;  4N59 A;  2KJH B;  3A9J A;  5IA7 A;  1FEH A;  4J3O D;  4BKS D;  2MX2 A;  4NJC A;  2KDB A;  3ZNI D;  1FXI A;  3DVN U;  4K3C A;  4WJQ A;  3AEF B;  3P2B A;  3UI3 A;  2KX0 A;  1GPX A;  4NQL B;  4M00 A;  1YJ1 A;  2OJW A;  3AEC B;  3KYC D;  2QIL A;  2KWU B;  1WGY A;  3PHW B;  1JQ4 A;  1Y8R C;  5DPS A;  1NEK B;  3R2I A;  3TJP A;  2LVQ A;  1XQQ A;  3TEX A;  5AUI A;  2KWC A;  3SFE B;  3RD2 A;  2Y3A A;  4NJ6 A;  2D3C A;  3U8Z A;  2KTR B;  2KKC A;  3PZD A;  4KZ0 A;  3O13 A;  3TEY A;  3VTV A;  3WAP A;  4TQ0 A;  4WWP A;  3BVM A;  3QCA A;  3JSV B;  2Z8L A;  5BMH A;  3QIJ A;  2HDE A;  1F9J A;  4LJP B;  3PRE A;  2DAF A;  3V05 A;  3TL5 A;  1KJT A;  1FM0 D;  5DPR A;  3LJ3 A;  4A20 A;  1B9R A;  2G1E A;  4MSQ B;  1MPE A;  3SDL C;  3A4R A;  3AE8 B;  1TY0 A;  1NYQ A;  4S0R A;  3TBL D;  3AE3 B;  4ASW C;  3MHZ A;  3I3T B;  4WWM A;  1N60 A;  1F77 A;  2OED A;  5JXV A;  4O1N A;  2D3G A;  2K25 A;  3LDZ E;  1D4B A;  1I4G A;  2L76 A;  2BB5 A;  3B2G A;  3WAM A;  1V80 A;  2UU7 A;  2ZW0 A;  2ACZ B;  3E56 A;  1RWS A;  1IPG A;  1SF0 A;  3DHH C;  3Q8E A;  4E74 A;  5CHV C;  2BWF A;  4REZ A;  4A8X C;  1N63 A;  2W55 A;  1P1A A;  1WX7 A;  4ZOH C;  3NVY A;  3A4S C;  2MHJ A;  3HIZ A;  2AL6 A;  1L0X B;  1VDV A;  5C1Z A;  3UIO B;  3AEE B;  2ZVN A;  3WCQ A;  4LJO B;  4L23 A;  3N3K B;  1V6E A;  4K3B A;  1EWY C;  4G3X B;  2K8H A;  3KW5 B;  3MC8 A;  2VH2 A;  3DPD A;  1MHH E;  4XDD A;  4C4V B;  2KTF A;  3B0A A;  2KFJ A;  3AE5 B;  5AUK A;  2BQQ A;  3DCG A;  2XBB C;  2IJ0 A;  3BVG A;  5KHQ A;  3VTW A;  2A5U A;  2MRP A;  4K7S A;  2GBK A;  4M01 A;  1P9D U;  2KFK A;  1JW9 D;  3DVN V;  2MSE D;  4EZL A;  3AE4 B;  4LK0 M;  1K52 A;  2QHO A;  2JXT A;  3VR8 B;  1SE4 A;  4GMV A;  2KAJ A;  4HWI B;  1S1Q B;  4L1B A;  3W5V B;  1UD7 A;  3NRZ A;  1RAX A;  3ZLZ A;  2QMT A;  4TMA B;  2KVR A;  2KLC A;  1JCK B;  1P0R A;  2MA9 B;  3BIN A;  4J6I A;  5IKC M;  3KWL A;  1WF9 A;  3AE6 B;  2ZW1 A;  2PVG C;  4B95 A;  3PO0 A;  5D6J B;  2INP E;  1V1P A;  1R4N B;  4JLC A;  2JPH A;  2NBU A;  4A9A A;  1WGD A;  1GNU A;  4RH6 A;  1WZ3 A;  4HRO A;  1VJK A;  4AUQ C;  1K53 A;  1T6B X;  4BVU C;  4MT5 A;  3ML8 A;  2WXM A;  1IBX B;  3DVG Y;  1MHX A;  2C60 A;  1GB1 A;  3K9O B;  3H6N A;  1FMA D;  3UIN B;  3HHM A;  2WGS A;  4XYC A;  1WGK A;  4EZJ A;  1ZOY B;  1HQR D;  2XEW A;  3SHQ A;  4BKT A;  1KLV A;  4RCO A;  3L13 A;  2EKE C;  4A55 A;  2G4S A;  5CX3 A;  1TYG B;  4GU2 A;  3AV8 A;  2N9E B;  2WXG A;  4II2 B;  2G45 B;  4JWS C;  2PIA A;  2C7N B;  1E9M A;  1WYW B;  3OJ4 B;  2KQ7 A;  3EFU A;  1XEE A;  1DOI A;  3GZN B;  1WXA A;  1JWB D;  2MW5 A;  3AEA B;  2FCQ A;  1ZW7 A;  2WU5 B;  2K8C A;  2WXQ A;  2WXO A;  1ACC A;  1PFD A;  4NNJ B;  4HKZ E;  2K1F A;  2DZJ A;  1SIF A;  3D32 A;  4RM8 A;  1D5X C;  2MJ3 A;  4A6Q A;  1Y56 A;  2ZVO A;  2O6V A;  1FNV A;  3DVG X;  1WMH B;  3I5J C;  5I4D A;  4RGO S;  4GGQ A;  3FKY A;  3DWG C;  1HA5 A;  2KMA A;  2JWZ A;  2MBO A;  3L08 A;  5J18 A;  3V62 A;  2RSU A;  3WAO A;  4MJS A;  4FJY A;  3C19 A;  5FR3 A;  1JWA D;  1HZ6 A;  4IM3 A;  2JSV X;  1I4X A;  2LGY A;  2KJR A;  1XLP A;  4EKU A;  1GOZ A;  3DBL I;  5BYR A;  2KN4 A;  1UEL A;  3B1L X;  4URK A;  3EUB 2;  1D6E C;  3BY4 B;  1WXS A;  3KYD D;  5TR5 A;  1FD6 A;  3L17 A;  5FK9 C;  3L4P A;  3Q3J A;  4JGH B;  1TIF A;  5BO4 B;  1E7U A;  4YXD B;  3VUW A;  1T3Q A;  4MAC A;  3ZNZ B;  3PHX B;  2EKI A;  1UH6 A;  1TKE A;  4GSW A;  3RN9 C;  1YIW A;  3DOW A;  2N7D A;  2N7E A;  2OOB B;  4YSZ B;  4UDU C;  1UBQ A;  2ZNV B;  2KAC A;  3K9P B;  2K6Q A;  5J2R A;  1PYW D;  1X1M A;  2D2Q A;  3HVZ A;  1CK1 A;  3VRA B;  1WE7 A;  3P4Q B;  1P3Q U;  1RFA A;  4HPM B;  1OGW A;  3EGR A;  2C5L C;  2M0A A;  2KTR A;  3VQI A;  1QOF A;  4HRS A;  3PRZ A;  2KXJ A;  3V6E B;  1D5M C;  3NY5 A;  3EHV A;  3JSV A;  1PGB A;  3HM6 X;  2RDH A;  4MGI E;  2ON8 A;  4OW0 A;  5DPT A;  2LGS A;  3X23 A;  1WH3 A;  1SE3 A;  3RPF C;  3PZ8 A;  2V0G A;  2BYT A;  5BYS A;  3DDC B;  2WXJ A;  4YL8 A;  4EUT A;  1LXD A;  3Q3M C;  1QLB B;  2MQJ A;  2IO2 B;  2RMM A;  5FR6 A;  3ZXV A;  3R2T A;  4RGM A;  3ZVV A;  3QA8 A;  2N1W A;  2IO3 B;  1RLF A;  3QK0 A;  2LRU A;  3AXC A;  1UGM A;  3Q6B A;  1WX8 A;  3RNC C;  1SIJ A;  1M94 A;  2R2O A;  1JRP A;  3IT6 B;  1U4A A;  4Q2J A;  3M62 B;  2W9N A;  4B0M A;  3N1X C;  4PT5 A;  3VRB B;  5CHF A;  2I1K A;  3IAS 1;  2LI5 A;  4PYZ A;  4BAX A;  4RFB A;  4XC2 A;  1J0G A;  1TKY A;  1EU4 A;  4AP4 C;  2AQ2 B;  2WWZ A;  1ET6 A;  3NS1 A;  3PRM B;  1E8W A;  3Q69 A;  2BW2 A;  2C9W B;  4AQ7 A;  2B3A A;  5CTR C;  3AU5 A;  2DZM A;  4LNK A;  4CYE A;  3H8H A;  3A9K B;  2ZPN A;  1CJE A;  3MJW A;  3TUO A;  4FJV B;  4NAW A;  3FC4 A;  5FKA C;  1MG8 A;  3KVF B;  2Y5B B;  1ET9 A;  4G50 A;  2JRI B;  5G2N A;  2DHZ A;  3AH7 A;  4ICV A;  2LXA A;  3RNE C;  2ZCB A;  4EE2 A;  2IBI B;  3B08 A;  1WRI A;  3SFD B;  1TS2 A;  2LEK A;  4IOI E;  3H7S A;  2RD0 A;  2L0T A;  3KWV A;  1EF1 A;  2V3P A;  1C9F A;  1FXT B;  1OQR A;  1CMX B;  2KWV B;  3CMM B;  2N4F A;  2CKH B;  5C23 A;  2GI9 A;  3RCZ A;  3IT4 B;  1TKG A;  3KUC B;  4LNF A;  5IOI A;  3Q3F A;  5D2M B;  1FRD A;  4OHJ A;  5EE9 A;  1IBX A;  4FHK A;  3MTN B;  4KSK C;  3PTF C;  2O6V B;  4M8N A;  1HEZ E;  2L52 A;  4II3 B;  2LMC A;  4H2A A;  2PKO A;  2Z0E B;  5C2T B;  4OZB A;  1PGA A;  4ZDV A;  1WM3 A;  2PE9 A;  2X8X X;  3B2F A;  4K1R B;  5E6O A;  2MEK A;  3ZRC A;  1FRR A;  1NBF C;  1V5T A;  3AEG B;  4OVU A;  1Q1O A;  4GIV A;  2WXF A;  3U7D A;  1ZKH A;  3AM9 A;  1XT9 B;  2PTL A;  1OQY A;  1WGG A;  5E6P A;  2BYV E;  4FLH A;  1E6E B;  1YQ3 B;  2AQ3 B;  4A3P A;  1UWM A;  4HEA 1;  4P7I A;  3TEZ A;  1E10 A;  3ZTC A;  3QAR A;  1I4H A;  2WDR B;  1V2Y A;  4W9K A;  2L1A A;  2LVO A;  2L3Z A;  1WMH A;  4C56 C;  2LGD A;  3ZJV A;  2INC C;  5C3J B;  2C7M B;  4IM0 A;  1V86 A;  1WXQ A;  2L00 B;  5JHB A;  4IG7 B;  2ASQ A;  1YX6 B;  2M8S A;  3ALB A;  3T3N A;  3N32 A;  2CU1 A;  1AAR A;  4YTN B;  3TMP B;  1L0Y B;  1H8C A;  2KQ4 X;  2E3T A;  4W9C A;  2D5G A;  3PT2 B;  2IPK D;  4IM2 A;  2KQS A;  5KHO A;  1XLQ A;  4ZRP A;  4P16 A;  1N5W A;  4ZYN A;  2Z0D B;  1R4N I;  3GE8 C;  2HJ1 A;  1WZ0 A;  3UQB A;  1E90 A;  1UGJ A;  3PGE A;  2IGH A;  3C8Y A;  2J53 A;  4IWP A;  2KO3 A;  2EMS A;  4FN2 A;  4HLE A;  5IP4 D;  2W3S A;  2H89 B;  1JWS D;  2PVO D;  5HFY A;  2YLM A;  3OLM D;  4IWQ A;  2KT7 A;  5IN7 A;  3GOE A;  3IXS A;  5L95 C;  3C0R B;  3HM3 A;  2KDM A;  4ZRK A;  1QZE A;  2QSD A;  2WXH A;  5TSS A;  4LNI A;  2IGD A;  3AI5 A;  2GBR A;  2IND C;  1M4V A;  4MSM B;  2VZK D;  3GZN I;  1R4M B;  2KDI A;  4DQO C;  3ENE A;  3IVF A;  2CHZ A;  1ZPS A;  4ANV A;  5IO9 A;  3Q8F A;  5LNK 1;  2LD9 A;  2BF8 B;  3DBR B;  1BXT A;  3EA6 A;  4KGS A;  2OHF A;  3RNG C;  1OTR B;  3R66 C;  4BKS A;  1QKZ A;  2AWT A;  1FCL A;  1WE6 A;  1EO6 A;  3NZ3 A;  4MEL A;  4F7Z A;  2BKF A;  4LNN A;  1F2R I;  4WQM A;  2EMT A;  1TS5 A;  2WU2 B;  2V1Y A;  2BYE A;  3APC A;  2CJN A;  3W1S C;  2Z59 B;  4FUL A;  4FA6 A;  3BYY B;  2LHD A;  1NVI D;  1YN4 A;  4W9F A;  4C00 A;  2KAN A;  1I4R A;  1LO5 D;  5HKH A;  1ZUD 2;  2LUM A;  3GB1 A;  4NAW B;  2REX A;  4KGT A;  4WQO B;  3N1Z C;  1F1H A;  1KLG D;  4IWO A;  3KH0 A;  3ECI A;  3EFC A;  4HKQ A;  2K9X A;  3M3J A;  1XF5 L;  1ZGU B;  2KHW B;  4OZC A;  3APD A;  4HVB A;  3Q14 C;  4I6L B;  4AWJ A;  1PDX A;  1YMH E;  5JHA A;  2QEJ C;  2LAS A;  3M95 A;  2JT4 B;  2ZPY A;  3UQA A;  4OVZ A;  3BK2 A;  2ZZP B;  3IAM 1;  4WAF A;  1DGJ A;  4HXD A;  3A9K A;  1P7F A;  2FUH B;  2W82 A;  1J8C A;  2FIF A;  2WNM A;  3GE3 C;  1WJ4 A;  5E6J A;  1KM7 A;  1Z5S B;  1E8Y A;  1DOY A;  3AN1 A;  4DDI D;  1F0Z A;  2WXR A;  2LXC A;  5JH5 C;  3UF8 A;  4W9G A;  3ZYY X;  4CO7 A;  3J9C A;  1OFF A;  5G55 A;  2J7Q B;  2N9K A;  3PS6 A;  4PK1 A;  2DAJ A;  1YX5 B;  3DWM A;  2GLS A;  3RNA C;  4DK5 A;  4XWW A;  1N5X A;  2MJE A;  4GDL B;  4KSL C;  3I63 C;  3TEW A;  1HE8 A;  2HTM E;  4PS7 A;  2WLB A;  1FO4 A;  2JWU A;  3AUL A;  2Q5W D;  4LDT D;  2JXX A;  4KDL B;  3ZGZ A;  1FIQ A;  2KZR A;  3Q8A A;  1NYR A;  2MWS B;  1D5Z C;  3QAQ A;  1KF6 B;  2WHI A;  5T8I A;  3VR9 B;  2FCS A;  3VTU A;  2DBY A;  2ZCC A;  3RZF A;  2LJI A;  1C78 A;  2K5P A;  2N9P C;  2M1M A;  2WQY B;  2QC8 A;  1YJI A;  4AS1 A;  2LUE A;  3VDZ A;  3VXW A;  4DWF A;  2WYQ A;  1TY2 A;  2PJH A;  2WDV B;  2KVZ A;  3VFK A;  1V97 A;  5EE0 A;  4MH0 E;  1GG3 A;  1ENF A;  1EU3 A;  2KWD A;  3RYT A;  4NJ7 A;  1MVK A;  2FID A;  3Q2A C;  2CS4 A;  1Z2M A;  2RGF A;  2JX5 A;  1J19 A;  2DWQ A;  2EEL A;  4JIO U;  3FAH A;  4L2Y A;  3SU8 X;  1H4R A;  2BGF A;  4EZK A;  4ANW A;  3QHT A;  2KN5 A;  1EM7 A;  4TUU A;  3RNB C;  2RDB C;  2L83 A;  3NZS A;  3P1M A;  2D3B A;  4M0W A;  3ZKJ C;  4ITK A;  2CJO A;  2K6D B;  3V61 A;  1WSP A;  2LJ5 A;  3ONS A;  4GB9 A;  4N58 A;  2YEP F;  3CSF A;  2NTS A;  3I9V 1;  4EEW A;  2J0J A;  4CQN A;  2BKR B;  3KUZ A;  1I4Q A;  3AED B;  1SJH D;  3PPA A;  5E6N A;  2KX3 A;  3ZRF A;  3CF6 E;  4F8C B;  2I2Y A;  3EC8 A;  1TS3 A;  3AB5 A;  2NR2 A;  5BMG A;  1VZ8 A;  4AJW A;  3H1U A;  1XO3 A;  1WGR A;  3V3X A;  5H92 C;  2DYO A;  1T5X D;  3AEB B;  2WP9 B;  2N1V A;  3GP7 A;  3AU4 A;  2KDE B;  1A70 A;  1WXV A;  2CHW A;  3N20 C;  1JWM D;  1LQB A;  1QQR A;  3Q8C A;  4S17 A;  1GC7 A;  2QJL A;  4XZ4 A;  2G4D B;  3B9J A;  4JL9 A;  2K22 A;  4RGN A;  4W9J A;  1K50 A;  2FCN A;  4KKJ A;  3NUH B;  3NHE B;  4XE0 A;  4USA A;  2BWE S;  2JZZ A;  3ZTD A;  3JVZ X;  1JRU A;  4EFO A;  3QJZ A;  1AYF A;  3UGB B;  4ANX A;  2AQ1 B;  1XXG A;  2IO1 B;  2BBC A;  3WAN A;  2SAK A;  3W9C B;  3NS8 A;  5D94 A;  3O65 B;  1WRD B;  3VHT C;  4G0N B;  3X0W A;  5BYQ A;  1E7P B;  4MM3 B;  2C7H A;  1TZ1 A;  2NS5 A;  4WWO A;  4KKI A;  1TGZ B;  2K39 A;  4I6P A;  2HE7 A;  1SXT A;  4HPL B;  1WI0 A;  4YT0 B;  1V5O A;  2QDF A;  4F1S A;  2CHX A;  2RPQ A;  1ISN A;  2J52 A;  1YOV B;  4P6V F;  2N7J A;  1HTQ A;  2VZK B;  1ZDV A;  1C79 A;  1DYQ A;  1UUP A;  2R2Q A;  2WX1 A;  5EE1 A;  4RMA A;  4DXA B;  3NG0 A;  3ZJT A;  3OG5 A;  2IO0 B;  2D10 A;  4A3O A;  2JYE A;  2JF5 A;  3SR6 A;  4LCD E;  1TTN A;  2WDT B;  4NY0 A;  3W5U B;  4XGA B;  1XD3 B;  2NPT B;  1ESF A;  3QWZ B;  3HVD A;  2J4X A;  1F2R C;  4TSS A;  1TZO A;  4BZA A;  1SEB D;  1C3T A;  3NVZ A;  3FIL B;  1R4M I;  1T0Y A;  1BML C;  1PUT A;  1ZE3 D;  2KDF B;  3LB8 C;  4LNO A;  1I35 A;  2Y5P A;  3R7Q A;  4ARC A;  2FAZ A;  4GXB A;  4ZRJ A;  1YN3 A;  2MH7 A;  1SB3 C;  3I57 A;  1EF5 A;  2GOW A;  4GOC A;  3AE9 B;  4DXF A;  3DBR I;  4HK2 A;  4GDL A;  4K7W A;  1ROE A;  1UF0 A;  4RF0 A;  1E8Z A;  3R7R A;  1WFY A;  3ETR A;  5HHD G;  1QOB A;  4MDK E;  2LGI A;  2IY1 B;  1TT5 B;  1YJJ A;  2K0P A;  4YSY B;  1MI0 A;  1GAQ B;  3P4S B;  2GBM A;  3T8M A;  1WXM A;  5JZE B;  5AEK B;  2V3N A;  5LXH A;  2W3R A;  1YNT E;  2KMC A;  2ZEQ A;  4ZRI A;  3R8B A;  3ZDM C;  4OZA A;  2QIE B;  4X57 B;  2ZNV C;  3PSE B;  1WM2 A;  3Q8B A;  4M0W B;  3SD5 A;  2DEN B;  2E6X A;  2UYZ B;  3WIM A;  1WIA A;  3VVW B;  3MP9 A;  2ICI A;  1T0Q C;  2DNF A;  4LLG M;  2PMV A;  3APF A;  4P1B C;  4GDK A;  3W2D A;  2A4Z A;  4ARI A;  2INN E;  4HCN B;  4KIK B;  1L7Y A;  2MJD A;  3NOB A;  1E8X A;  3H7P B;  3PVL A;  3Q3O C;  3A1Q B;  1GC6 A;  4LDT B;  1WR1 A;  2O2V B;  2KYW A;  3E9S A;  3JYU A;  1AN8 A;  3UIP B;  2HD5 B;  3ZNH B;  1D3Z A;  4W9H A;  2MLB A;  4RNA A;  2L0F A;  1R7S A;  5HG2 A;  4DHJ D;  1IGC A;  2XK5 A;  1HZ5 A;  2NMQ A;  2AX5 A;  2J0M A;  4NAM A;  1VLB A;  4C7Z A;  2IY0 B;  4B6W A;  2UWQ A;  3CIR B;  4B0E A;  4M02 A;  4DHZ B;  1QT9 A;  4LTU A;  2I38 A;  1JML A;  3MJ5 A;  3TCA A;  4ZHP A;  3DBH B;  1N61 A;  1KFY B;  1VRA B;  2NBW B;  5AZF A;  4KDI C;  2JYT A;  1EWC A;  2DX5 B;  1V8C A;  4KVG B;  1P7E A;  3VUY A;  3U30 A;  3V60 A;  2KC2 A;  4WAA A;  4K81 A;  3VAW A;  1P98 A;  3URY A;  2B76 B;  1K8R B;  3IG3 A;  4RF1 A;  3HUI A;  1PGX A;  4HJG E;  1JWU D;  3WAL A;  1IP9 A;  3ZIM A;  3KUD B;  1K51 A;  3DBS A;  1UNS A;  4DDG D;  4BBN C;  4XDC A;  1C76 A;  1STE A;  3RI7 C;  3ZW3 A;  3N1Y C;  4KV2 A;  1KRH A;  1E0Z A;  1FCC C;  5MPO A;  4QAY A;  3QC8 B;  4WWN A;  2OJR A;  1WYG A;  3SEB A;  2NVU I;  1TS4 A;  1JRO A;  1XLO A;  3DHI C;  1J7C A;  4US8 A;  2X38 A;  4WJN A;  4I6N B;  2NCN A;  3BII D;  2PLP A;  1OQQ A;  5D3D A;  4M8M A;  1GUA B;  4PS8 A;  3LYY A;  4US9 A;  4BOS C;  2WXI A;  4B9K A;  4NPN A;  1KH0 A;  1VD2 A;  1VCB A;  3P4P B;  1V1O A;  1VR9 A;  1WY8 A;  1I7H A;  3VUX A;  1OEY J;  2Y5C A;  4MM3 A;  1RFK A;  1L5P A;  2N9L A;  2N0S B;  1IYF A;  2JRH A;  3U2S C;  2HJ8 A;  3L10 B;  4A90 A;  1L6V A;  3HRD D;  1A5R A;  3DHG C;  3ZNG C;  5J17 A;  2BB6 A;  1FFV A;  4HDQ A;  4WJO A;  1SSN A;  4BFR A;  2O6V D;  5L83 A;  1S3S G;  3CST A;  4MH8 A;  2BS2 B;  1YQ4 B;  1SE2 A;  4G11 A;  1RYJ A;  3R3M A;  3ZO5 B;  5CHW A;  1GB4 A;  1J7A A;  2MP2 A;  1V9J A;  2ONQ A;  5BMI A;  4DBG A;  2KD0 A;  2LRW A;  1NI2 A;  3U52 E;  2M0X A;  1C1Y B;  5AZG A;  2WXK A;  1ZDX A;  2L8J A;  3BZD B;  3ZDT A;  1Q0W B;  1L4Z B;  2CR5 A;  2PEA A;  2FNJ B;  2DYB A;  2BS4 B;  1I4P A;  1Q5W B;  4C80 A;  3IFW B;  3RFZ B;  2NPT A;  2LHE A;  3VH4 B;  1T0S C;  3W1S A;  2G3Q B;  2KNB A;  4HPP A;  2ZJD A;  1JAL A;  3MC0 B;  1C77 A;  2FUG 1;  3FIL A;  3A33 B;  2G9H D;  2I1J A;  1FFU A;  1FNW A;  1XCT L;  3ML9 A;  1QOG A;  1YN5 A;  2V3S A;  4TV3 A;  1XCQ L;  2WXL A;  1V49 A;  2M17 A;  4FBJ B;  4YTP B;  2AEH A;  3VH3 B;  4IKG A;  2M4N A;  1XLN A;  1T0R C;  1MJD A;  3RMK C;  2YEP B;  3MC9 A;  4GDK B;  2BVC A;  4IDI A;  3L0W B;  4DXG A;  4BKG A;  3WA0 A;  4N6E B;  1EUV B;  4HCP B;  1L6U A;  1L0V B;  4HJK A;  2WDQ B;  4YTM B;  3ZQ4 A;  1WJN A;  3U7Z A;  4AOF A;  3HK0 A;  2K3U A;  2XN9 C;  3PZ7 A;  2DZK A;  4BOZ B;  4JX1 C;  2VRR B;  1WJU A;  3A9J B;  2KJ6 A;  3NVW A;  1FPY A;  2WXP A;  2L7R A;  1RRB A;  1YD8 U;  2FBW B;  2N9X A;  1FXA A;  1F52 A;  2KC1 A;  1CZP A;  1NI3 A;  2D11 A;  3L54 A;  2BPS A;  2XK5 B;  3TSS A;  4JPS A;  5D3I B;  2YVC A;  1E7V A;  3L16 A;  2GBJ A;  2HTH A;  2LWP A;  3OJ3 A;  3TIX A;  1OEY A;  3GS2 A;  1QF6 A;  1RM6 C;  2L05 A;  2LFI A;  4P1C C;  4KIK A;  4K7U A;  5EE3 A;  3AE1 B;  1MFW A;  1ZP0 B;  1AWD A;  2AYO B;  2PPH A;  3N9Y C;  2J0K A;  3JW0 X;  3H7P A;  2V9H A;  3A1Q A;  3QX1 A;  1AW7 A;  1WX9 A;  2O2V A;  3KQ4 A;  5EDS A;  4AJY B;  1C4C A;  5LXI B;  4NQK E;  1LGR A;  1Q10 A;  3BWU D;  4KX6 B;  4WH4 A;  2BT6 A;  1L4D B;  3P4R B;  2LGX A;  2BYF A;  5G5G A;  1ZXI A;  5GXG B;  2JQR B;  3IBE A;  4NZL B;  2RDG A;  4IC7 B;  3OAW A;  3V6C B;  4OVV A;  2AL3 A;  4JQW C;  2IGG A;  2WX0 A;  4PS3 A;  2MBQ A;  1GJZ A;  2MCN B;  3M63 B;  2BS3 B;  3BVZ A;  2KLG A;  2LVP A;  4FJZ A;  4W9E A;  4XWT A;  2GB1 A;  2GMI C;  3PLV A;  2IYD B;  1LM8 B;  2KMM A;  4CHK A;  4ZYS A;  2SEB D;  4ANU A;  4DHZ E;  4ICU A;  4ZRQ A;  3ZJU A;  1NDD A;  1BUI C;  5IAA C;  3NZU A;  4W9D A;  2RPV A;  5AZH A;  3BYT B;  2PW9 A;  4DHJ B;  4JWU C;  4FAD A;  3Q3N C;  4WIP A;  5LLI A;  1G6J A;  2V4I B;  2MBE A;  3ABV B;  4C7Y A;  1C4A A;  2JZ3 B;  4KGR A;  1UZX B;  2D07 B;  1SJE D;  4YWG G;  1C4P A;  2GBN A;  4FXC A;  3PV1 A;  4JE3 B;  4R3D A;  3RUL A;  4GN1 A;  1SE9 A;  3NVV A;  3CWI A;  5HI1 A;  1N62 A;  1BT0 A;  1WR6 E;  2KFK B;  1WGH A;  4MEM A;  4W9L A;  3RT3 B;  5DPW A;  4GLS C;  2RR9 A;  2M56 B;  5GMV A;  2BTE A;  2VH1 A;  2MP2 B;  3MHS D;  1NEN B;  1PQS A;  3T3O A;  4EOY A;  2IZV B;  2D3A A;  4ACF A;  4C4V A;  4YSX B;  2DYM A;  3OWE B;  1KTK A;  2H88 B;  2TSS A;  3DBL B;  2NTT A;  1VZ7 A;  3ZUN A;  2WS3 B;  2CU3 A;  2QCZ A;  1V1P B;  4WJP A;  1L2N A;  3RNF C;  4TKN A;  3DBH I;  1WJ6 A;  2NBV B;  3U4E G;  3NJT A;  2M19 A;  3IHP C;  4PYU A;  5D7G A;  1CQV A;  2MBH A;  3H9D A;  3S2A A;  1V81 A;  4ZHO A;  1QIL A;  4HDO A;  4WUR A;  3AE7 B;  2J42 A;  3EEC A;  1LFD A;  3T9L A;  2FCM A;  4XX5 A;  1SGH A;  2PE6 B;  3ZXR A;  1VZ6 A;  2JZP A;  1UWX A;  3RZW C;  3MFG A;  4RGT A;  1E5W A;  4TQ1 A;  1DOX A;  1TJE A;  2MBB B;  2JVC A;  3BK1 A;  4E3C A;  4BBN F;  2JUO A;  2FE8 A;  1SBB B;  3PRP B;  4IUM B;  2KK8 A;  4KZC A;  1HTO A;  3QQ8 B;  2KOX A;  3DQV A;  4D2K A;  1MG4 A;  3KLS X;  1IGD A;  2LZ6 A;  5G5H A;  1FNU A;  1IUE A;  2DZI A;  4MGZ E;  2JU6 X;  4W9I A;  2W54 A;  2JY6 A;  1WWT A;  4MGY E;  2R61 A;  2GRI A;  2K8B A;  2XNA C;  2IDY A;  5DCN A;  3W1Y A;  2L32 A;  3P63 A;  4IW0 A;  4MJS B;  1B1Z A;  3P42 A;  1YQB A;  1TBE A;  4RM9 A;  2DLB A;  1ZXH A;  3AE2 B;  1KLU D;  1N6Z A;  2WXN A;  1I42 A;  5H8Y E;  4FHJ A;  3PLU A;  4N9F 4;  1HXY D;  1J7B A;  1UBI A; 
#chains in the Genus database with same CATH homology
 1VR9 A;  1I7H A;  1QOA A;  3LXF A;  2Y5C A;  1RFK A;  1L5P A;  2L83 A;  3Q69 A;  3P1M A;  2N9L A;  2N0S B;  2BW2 A;  3AMZ A;  4N59 A;  3U2S C;  4AQ7 A;  4M0W A;  4A90 A;  3H8H A;  4ITK A;  1L6V A;  3HRD D;  1FEH A;  2CJO A;  4J3O D;  4NJC A;  1CJE A;  2BB6 A;  3TUO A;  1FFV A;  1FXI A;  1WSP A;  3AEF B;  3FC4 A;  1SSN A;  3UI3 A;  4N58 A;  5FKA C;  2YEP F;  1GPX A;  2NTS A;  3AEC B;  4MH8 A;  3I9V 1;  2QIL A;  2BS2 B;  1ET9 A;  1YQ4 B;  1SE2 A;  1JQ4 A;  4CQN A;  1I4Q A;  1RYJ A;  1SJH D;  3AED B;  1NEK B;  3AH7 A;  3R2I A;  1GB4 A;  1J7A A;  3TEX A;  5AUI A;  3SFE B;  4EE2 A;  3SFD B;  1WRI A;  1TS2 A;  2I2Y A;  2LEK A;  1TS3 A;  2Y3A A;  4IOI E;  2ONQ A;  3AB5 A;  5BMI A;  3U52 E;  5BMG A;  3O13 A;  1VZ8 A;  3TEY A;  3KWV A;  1XO3 A;  2V3P A;  1C9F A;  4TQ0 A;  3BVM A;  2WXK A;  1ZDX A;  3V3X A;  2Z8L A;  5BMH A;  1OQR A;  2HDE A;  3BZD B;  5H92 C;  2DYO A;  1L4Z B;  1T5X D;  3V05 A;  2GI9 A;  2BS4 B;  1I4P A;  1FM0 D;  3AEB B;  2WP9 B;  4C80 A;  3RFZ B;  3IT4 B;  2LHE A;  1TKG A;  3GP7 A;  1B9R A;  3W1S A;  1A70 A;  2G1E A;  1MPE A;  3AE8 B;  1TY0 A;  1NYQ A;  3AE3 B;  3MHZ A;  1JAL A;  1FRD A;  1JWM D;  1N60 A;  1F77 A;  3MC0 B;  4OHJ A;  4WWM A;  1C77 A;  5EE9 A;  1IBX A;  1QQR A;  3Q8C A;  2FUG 1;  2OED A;  5JXV A;  3FIL A;  4O1N A;  2QJL A;  3P4P B;  1HEZ E;  2G9H D;  3B9J A;  1FFU A;  1FNW A;  2L52 A;  1XCT L;  1I4G A;  1D4B A;  2LMC A;  2BB5 A;  2K22 A;  4RGN A;  1QOG A;  1YN5 A;  4H2A A;  2PKO A;  3B2G A;  1XCQ L;  2WXL A;  2ZW0 A;  1K50 A;  2ACZ B;  1RWS A;  3E56 A;  4YTP B;  4KKJ A;  5C2T B;  4OZB A;  3NUH B;  1PGA A;  4IKG A;  1SF0 A;  4XE0 A;  1J7B A;  4USA A;  3Q8E A;  1XLN A;  3B2F A;  4REZ A;  4A8X C;  2MEK A;  1N63 A;  2W55 A;  1FRR A;  2YEP B;  4GDK B;  4IDI A;  4ZOH C;  1AYF A;  3AEG B;  4DXG A;  3NVY A;  4N6E B;  2WXF A;  3AM9 A;  2AQ1 B;  2PTL A;  1XXG A;  1L6U A;  1L0V B;  2BBC A;  2SAK A;  3W9C B;  1L0X B;  2WDQ B;  4YTM B;  1E6E B;  1YQ3 B;  3ZQ4 A;  2AQ3 B;  1VDV A;  3AEE B;  1UWM A;  5BYQ A;  3U7Z A;  1E7P B;  4MM3 B;  4HEA 1;  3WCQ A;  2K3U A;  2XN9 C;  4L23 A;  4KKI A;  3TEZ A;  1E10 A;  3PZ7 A;  1I4H A;  4JX1 C;  2WDR B;  1EWY C;  1SXT A;  2L1A A;  3NVW A;  2WXP A;  1MHH E;  4XDD A;  4YT0 B;  4C56 C;  2FBW B;  1FXA A;  3ZJV A;  1CZP A;  1NI3 A;  3AE5 B;  5AUK A;  5C3J B;  2J52 A;  2IJ0 A;  3BVG A;  3TSS A;  4JPS A;  1WXQ A;  5D3I B;  4P6V F;  2N7J A;  2VZK B;  3GS2 A;  3T3N A;  1QF6 A;  1ZDV A;  1C79 A;  1RM6 C;  1DYQ A;  1UUP A;  2LFI A;  1JW9 D;  4YTN B;  1L0Y B;  5EE3 A;  2KQ4 X;  2E3T A;  3AE1 B;  3AE4 B;  5EE1 A;  2D5G A;  1K52 A;  4LK0 M;  1ZP0 B;  2JXT A;  1AWD A;  3VR8 B;  1SE4 A;  3N9Y C;  2IPK D;  2KAJ A;  4L1B A;  3W5V B;  3ZJT A;  1AW7 A;  3KQ4 A;  1C4C A;  1XLQ A;  4ZRP A;  4P16 A;  1N5W A;  3NRZ A;  2QMT A;  1Q10 A;  3BWU D;  4KX6 B;  4TMA B;  2JYE A;  4WH4 A;  1JCK B;  3SR6 A;  1UGJ A;  2BT6 A;  1L4D B;  3P4R B;  2IGH A;  3C8Y A;  2J53 A;  3KWL A;  3W5U B;  5G5G A;  1ZXI A;  3AE6 B;  2ZW1 A;  2PVG C;  5GXG B;  2JQR B;  3PO0 A;  2W3S A;  4YWG G;  1ESF A;  2H89 B;  2INP E;  1V1P A;  4NZL B;  2RDG A;  3HVD A;  2J4X A;  4A9A A;  1JWS D;  4RH6 A;  2PVO D;  4HRO A;  1VJK A;  1F2R C;  1K53 A;  2IGG A;  1T6B X;  5HFY A;  4TSS A;  1TZO A;  4MT5 A;  2WXM A;  1IBX B;  1SEB D;  1GB1 A;  1MHX A;  3IXS A;  3NVZ A;  1FMA D;  3FIL B;  1BML C;  1PUT A;  1ZE3 D;  2BS3 B;  3BVZ A;  3LB8 C;  1WGK A;  2KDM A;  1ZOY B;  1HQR D;  2Y5P A;  2QSD A;  2WXH A;  4RCO A;  5TSS A;  4ARC A;  2IGD A;  1YN3 A;  4XWT A;  2MH7 A;  4A55 A;  1M4V A;  1SB3 C;  3I57 A;  2GB1 A;  1TYG B;  3AE9 B;  4DXF A;  2VZK D;  3AV8 A;  2WXG A;  2KMM A;  4DQO C;  4ZYS A;  1ROE A;  2SEB D;  4JWS C;  2PIA A;  4RF0 A;  1ZPS A;  4ZRQ A;  3ZJU A;  3Q8F A;  3ETR A;  5HHD G;  5LNK 1;  1E9M A;  1QOB A;  1BUI C;  2LGI A;  1XEE A;  1DOI A;  1BXT A;  1YJJ A;  1JWB D;  3AEA B;  2K0P A;  3EA6 A;  2WU5 B;  4KGS A;  2OHF A;  2RPV A;  2WXQ A;  2WXO A;  1ACC A;  1PFD A;  3BYT B;  1MI0 A;  4YSY B;  4HKZ E;  2PW9 A;  4JWU C;  1QKZ A;  1GAQ B;  3P4S B;  1FCL A;  2V3N A;  3NZ3 A;  2W3R A;  1YNT E;  1D5X C;  2MJ3 A;  4WIP A;  4A6Q A;  1Y56 A;  3R8B A;  1F2R I;  4OZA A;  4WQM A;  1TS5 A;  1FNV A;  2QIE B;  2WU2 B;  2V4I B;  5I4D A;  4RGO S;  3ABV B;  4C7Y A;  3DWG C;  3Q8B A;  1HA5 A;  2CJN A;  1C4A A;  2E6X A;  3BYY B;  2LHD A;  1NVI D;  1YN4 A;  4KGR A;  1I4R A;  1LO5 D;  1SJE D;  3MP9 A;  2ICI A;  1ZUD 2;  1C4P A;  2LUM A;  3GB1 A;  4FXC A;  4JE3 B;  4KGT A;  4LLG M;  2PMV A;  4NAW B;  4R3D A;  3W2D A;  3NVV A;  5FR3 A;  3CWI A;  5HI1 A;  1KLG D;  4ARI A;  1N62 A;  1JWA D;  2INN E;  1HZ6 A;  2JSV X;  1I4X A;  4HKQ A;  2MJD A;  2K9X A;  4GLS C;  2M56 B;  2BTE A;  1XF5 L;  1XLP A;  1GOZ A;  5BYR A;  2KN4 A;  4OZC A;  1NEN B;  3EUB 2;  1D6E C;  3T3O A;  3E9S A;  1AN8 A;  1PDX A;  1YMH E;  2QEJ C;  2DYM A;  4YSX B;  1FD6 A;  5FK9 C;  3OWE B;  1KTK A;  2H88 B;  3L4P A;  2TSS A;  2NTT A;  4RNA A;  1VZ7 A;  4OVZ A;  3BK2 A;  2WS3 B;  4YXD B;  3IAM 1;  2CU3 A;  1R7S A;  4WAF A;  5HG2 A;  1T3Q A;  1DGJ A;  1V1P B;  1P7F A;  1IGC A;  4MAC A;  1HZ5 A;  2W82 A;  2EKI A;  2NMQ A;  1TKE A;  2WNM A;  3U4E G;  2AX5 A;  2M19 A;  4NAM A;  1VLB A;  5D7G A;  4C7Z A;  1CQV A;  4YSZ B;  4UDU C;  5E6J A;  2KAC A;  3CIR B;  4B0E A;  1QT9 A;  4LTU A;  1PYW D;  3HVZ A;  2I38 A;  1CK1 A;  4ZHO A;  1QIL A;  1JML A;  3MJ5 A;  3VRA B;  1DOY A;  4ZHP A;  3AN1 A;  1F0Z A;  2WXR A;  1N61 A;  3P4Q B;  1KFY B;  3AE7 B;  1VRA B;  2J42 A;  4WUR A;  3ZYY X;  2JYT A;  3J9C A;  1OFF A;  1EWC A;  3EGR A;  2N9K A;  1V8C A;  3DWM A;  1P7E A;  2M0A A;  4XWW A;  1N5X A;  1VZ6 A;  2MJE A;  4GDL B;  2JZP A;  3VQI A;  1UWX A;  1QOF A;  4HRS A;  3MFG A;  4RGT A;  3TEW A;  2HTM E;  4TQ1 A;  1DOX A;  1TJE A;  1D5M C;  1PGB A;  2WLB A;  3URY A;  2RDH A;  3BK1 A;  1FO4 A;  2JWU A;  2B76 B;  2ON8 A;  4OW0 A;  2Q5W D;  2FE8 A;  1SBB B;  4RF1 A;  1SE3 A;  3RPF C;  3HUI A;  3ZGZ A;  1PGX A;  3PZ8 A;  2V0G A;  4HJG E;  1JWU D;  2BYT A;  5BYS A;  1FIQ A;  2WXJ A;  3Q8A A;  1NYR A;  1D5Z C;  1K51 A;  1KF6 B;  1QLB B;  4D2K A;  1UNS A;  5T8I A;  3VR9 B;  2RMM A;  3KLS X;  2DBY A;  4XDC A;  1IGD A;  5G5H A;  1FNU A;  1IUE A;  1C76 A;  3R2T A;  4RGM A;  2LJI A;  1C78 A;  2JU6 X;  2W54 A;  1STE A;  2K5P A;  1WWT A;  2WQY B;  2R61 A;  2GRI A;  1KRH A;  1YJI A;  4AS1 A;  1E0Z A;  2XNA C;  1FCC C;  2IDY A;  5MPO A;  1SIJ A;  2L32 A;  1TY2 A;  3P63 A;  1B1Z A;  1WYG A;  3SEB A;  2WDV B;  3P42 A;  1JRP A;  1JRO A;  1TS4 A;  1XLO A;  3IT6 B;  1V97 A;  4Q2J A;  5EE0 A;  1ENF A;  2DLB A;  1ZXH A;  4B0M A;  1J7C A;  1EU3 A;  4PT5 A;  2KWD A;  3VRB B;  3AE2 B;  4US8 A;  1MVK A;  2X38 A;  1KLU D;  3IAS 1;  4RFB A;  2JX5 A;  3BII D;  2DWQ A;  1TKY A;  2PLP A;  1OQQ A;  2EEL A;  5D3D A;  3FAH A;  4L2Y A;  2WXN A;  3LYY A;  4US9 A;  5H8Y E;  1EU4 A;  2WXI A;  1HXY D;  2AQ2 B;  1KH0 A;  1ET6 A;  3NS1 A;  1EM7 A;  1V1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...