1WJUA

Solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
GSSGSSGDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords NEDD8 ultimate buster-1
publication title Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
rcsb
source organism Homo sapiens
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjuA00
3L10B 1IPGA 3NY5A 5CHWA 4NQKE 3D32A 2V1YA 1UBQA 4PYZA 4KDIC 4AWJA 1EO6A 4BKTA 2FCQA 2IO0B 3AXCA 3X0WA 3PT2B 1I35A 2MW5A 2JUOA 3OJ4B 5L83A 2D11A 3DBHI 3PZDA 4MGZE 2AEHA 5D2MB 4TKNA 3SDLC 2ZZPB 4JGHB 4GIVA 2MBEA 2NR2A 4G50A 1UGMA 4YL8A 1YIWA 4URKA 1S1QB 2KVRA 2M4NA 3IHPC 2KANA 2K8HA 3DVNV 2N1VA 1EF5A 3EHVA 3PRZA 3KYCD 3R7QA 3PTFC 4GOCA 3VTVA 4DHJB 2KXJA 5D6JB 3M3JA 2O6VD 3H6NA 3H9DA 2KMCA 4DDGD 2MBQA 3NS8A 2UWQA 3NZUA 4AJYB 5E6OA 2JZZA 3APDA 4MGIE 3VFKA 3ZNGC 4WJNA 1ZGUB 2LVQA 2BGFA 3WALA 5AZFA 1SIFA 2MSED 5CHFA 2BWFA 3KH0A 4AUQC 1WGGA 3VH4B 3DOWA 4FN2A 1WRDB 2DYOA 2EMTA 1E8YA 1S3SG 1E5WA 2JXXA 4MJSA 4MJSB 3AULA 4MGYE 1IP9A 3PLVA 4K81A 2NBWB 1WX7A 2PE6B 4DXAB 4WWNA 2LASA 4W9GA 3B08A 3NHEB 2BKFA 3TIXA 2R2OA 3ZNID 1KJTA 3TL5A 4AOFA 1R4MI 3M62B 1LQBA 4TV3A 5LXIB 3A9JA 2K1FA 2HJ8A 3PLUA 3A9JB 4IWQA 3JSVA 4IC7B 4KIKA 3JSVB 4W9HA 2GBJA 3I3TB 4KIKB 4PS7A 2WWZA 3L0WB 5DPTA 1WJ6A 2PJHA 5HKHA 1RLFA 1OEYJ 3LDZE 1WXVA 1WMHA 2NBUA 3KUDB 4M8NA 4DHJD 4FBJB 1WM2A 1RRBA 5TR5A 5AZGA 1UD7A 3B1LX 5D94A 2MLBA 1V86A 4B95A 2DENB 3ZDMC 1YJ1A 1E8ZA 2KTRB 3LJ3A 4XC2A 2MCNB 4II3B 4DK5A 3R66C 2LXCA 1EUVB 2D3GA 2KX3A 2M17A 3DPDA 3UF8A 3V6EB 1VD2A 2N4FA 1I42A 3UIOB 3WIMA 2LI5A 4ICVA 2AL6A 2LGXA 2FCMA 3DVGY 1A5RA 2NCNA 1P9DU 1WH3A 3AI5A 4E74A 3DBSA 2J7QB 4G11A 2C9WB 3HIZA 1HE8A 4JL9A 4BKGA 2N7EA 3EC8A 3X23A 4W9FA 4FHJA 4G0NB 1WXSA 4ZYNA 2RR9A 2RGFA 1WM3A 2AL3A 2L00B 2CS4A 1ZKHA 2KDEB 4GB9A 2DHZA 4W9IA 3WAMA 2C5LC 2NPTA 3DCGA 4W9KA 2GBKA 3ZNHB 1UH6A 1V49A 3BY4B 4EZJA 3OJ3A 4JIOU 4FHKA 3QHTA 4DDID 4IWOA 3RUIB 1P1AA 4EZKA 4ICUA 3MTNB 1WZ0A 3MJWA 5G55A 3KW5B 4FJZA 2KFJA 4NY0A 4RM9A 3RCZA 2CKHB 4GDLA 2I1KA 2A4ZA 2JZ3B 4WJOA 4FADA 2MP2A 4GU2A 4TQ0A 1J19A 2G4SA 3TCAA 2FCSA 3QAQA 3N3KB 2Z0EB 4LDTD 4K7WA 3SD5A 4ASWC 1WJUA 4HLEA 3ZIMA 1L7YA 2KWUB 1D3ZA 2AYOB 4F8CB 2DYBA 1OEYA 3QQ8B 4HXDA 5FR6A 3ZVVA 1E8XA 1UELA 2KO3A 3SHQA 3KYDD 4HK2A 1TBEA 4MH0E 3VTUA 3QIJA 2PE9A 1XD3B 5KHOA 4I6NB 4EUTA 1V6EA 4ZRIA 5AEKB 4A20A 2YLMA 2L0FA 1WGDA 4FA6A 2BYFA 2MBBB 4TQ1A 2BWES 5JHAA 2LVPA 2KJHB 2J0MA 2LWPA 2BYEA 3PV1A 3RT3B 4JQWC 2IO2B 1L2NA 2FCNA 5LXHA 1OTRB 1SGHA 1WGRA 2JPHA 4PS3A 3ZTCA 1K8RB 4NAWA 2KN5A 1FXTB 1LXDA 2KHWB 1M94A 3H7PA 2KDIA 4FJYA 2KFKA 3A4RA 3H7PB 2GMIC 2IO3B 1XT9B 2WYQA 3ML8A 2KFKB 3VUYA 3VHTC 2ZPYA 2OOBB 2K8CA 2K6DB 4B6WA 4K7SA 4W9CA 3U30A 1P98A 2XEWA 4M0WB 2KOXA 3A33B 4WAAA 5C1ZA 3VVWB 4BBNC 2N9EB 2FIFA 3ONSA 1YX6B 2C7MB 2DZMA 3ZKJC 5CX3A 3AU4A 4MEMA 2JVCA 2MX2A 4KSLC 2AWTA 2DZIA 1EF1A 1E8WA 2B3AA 3UQAA 2WX0A 3CSTA 3W1YA 2D2QA 2DZKA 1WY8A 3RZWC 2ZCBA 2K25A 4J6IA 2ASQA 4IUMB 3R3MA 1Q0WB 5LLIA 5AZHA 1GC7A 2KDFB 3K9PB 2BYVE 4FJVB 3AU5A 3A9KA 5KHQA 1GUAB 2G4DB 3A9KB 2NVUI 1JRUA 1WMHB 3DDCB 2EMSA 4NPNA 1XQQA 2G3QB 3SU8X 1Z5SB 2ZNVC 1Q1OA 3Q3JA 2LGDA 2MQJA 4RM8A 5E6PA 3PRPB 3VXWA 4CO7A 5CTRC 3ZLZA 2KNBA 4EKUA 5GMVA 2DX5B 2ZEQA 1TTNA 4LDTB 3GZNI 4HJKA 3WA0A 4ANVA 1WX9A 4I6LB 4EFOA 1V2YA 2IBIB 1WJ4A 4E3CA 1X1MA 5IA7A 2WX1A 4FLHA 2DAFA 2L05A 2LRUA 3UIPB 1NBFC 2DYMA 2R2QA 3CSFA 3WAPA 3U7DA 1WE6A 4XZ4A 4LCDE 5G2NA 4KSKC 4GMVA 5EDSA 2D10A 1PQSA 2LGYA 2ZVOA 1H4RA 3PGEA 4HPLB 3HHMA 1IYFA 3PHXB 3VUXA 3CF6E 3VUWA 2HTHA 3QARA 2KKCA 3W1SA 2QHOA 3N32A 2GOWA 1WJNA 2N1WA 4KZCA 4W9DA 3U8ZA 2NPTB 3IG3A 2KLCA 2DZJA 2LXAA 4KDLB 4DBGA 3UGBB 2A5UA 2PEAA 1UZXB 4LJOB 2V4LA 2GBRA 4ZRKA 2NBVB 2L8JA 1H8CA 2KD0A 1ISNA 1GC6A 1R4NI 4IM2A 5J18A 2CHWA 3TMPB 4AJWA 3HM6X 4HDOA 4HCNB 2LUEA 5DPWA 4ANXA 3QJZA 3ZTDA 4GGQA 3DQVA 3M63B 1KLVA 4ANUA 4GN1A 1WR6E 2L76A 2G45B 1YX5B 2OJRA 2Y5BB 4GDLB 2ZJDA 4WJQA 5CHVC 4A3OA 1TZ1A 3QC8B 2MP2B 3ZDTA 4EZLA 3V60A 5DPRA 3VTWA 4IW0A 2ZPNA 3H7SA 3IVFA 2C7NB 2EKEC 4IWPA 1TGZB 2BF8B 4MSQB 1OGWA 2KDBA 4P7IA 2XBBC 1WF9A 4OVUA 3BINA 4WQOB 3R7RA 1WGYA 2FIDA 1WZ3A 2KZRA 3K9OB 3APCA 4ZDVA 1GJZA 3HM3A 4IG7B 1LM8B 4GXBA 3QCAA 3WANA 3L13A 2IYDB 1Y8RC 4DHZE 2KWCA 2J0KA 1V80A 2D07B 2JY6A 3KUCB 4NNJB 2JRIB 1V81A 2KWVB 3IFWB 4M8MA 3PPAA 2N9XA 1F9JA 1C3TA 4I6PA 2PPHA 1AARA 3A4SC 2GBMA 3EFUA 4NAWB 4BVUC 3PREA 2FNJB 4IM3A 4KV2A 3RYTA 4WJPA 1P0RA 4XX5A 2BKRB 2IO1B 3JVZX 3RULA 1WIAA 3L17A 5L95C 4AP4C 3PS6A 1WE7A 1GG3A 2KX0A 4HDQA 3RZFA 4CYEA 2UYZB 3PRMB 5BO4B 3APFA 3HK0A 1WXMA 1C1YB 2C7HA 1UBIA 3MHSD 4G3XB 2ZNVB 1QZEA 1V9JA 1YQBA 2JF5A 1MG8A 2FAZA 3PVLA 4OVVA 1E7UA 2J0JA 3ZW3A 2LVOA 3DVNU 4NJ6A 3V61A 2LJ5A 1CMXB 2KMAA 2Z59B 3GOEA 3QWZB 4ANWA 2L7RA 1WI0A 4CHKA 4B9KA 3TJPA 4BBNF 2KQSA 2HD5B 2MBHA 5IAAC 2K6QA 2ZCCA 4HPMB 4N9F4 2KC2A 1VCBA 2HE7A 2W9NA 1P3QU 1T0YA 3V6CB 2CHXA 3M95A 1NI2A 1Z2MA 4MM3A 2JWZA 4PS8A 3S2AA 2RD0A 4HVBA 2I1JA 2KJ6A 3KVFB 3KUZA 3QA8A 4K7UA 1OQYA 3DBRI 4LJPB 4MELA 3B0AA 2C60A 3C0RB 4DWFA 1G6JA 2KJRA 4BFRA 2LZ6A 4BKSA 3UQBA 2BPSA 4W9LA 2KQ7A 2RPQA 2NS5A 1NDDA 2Z0DB 3L54A 5C23A 3PSEB 3ENEA 5JH5C 3ECIA 3JW0X 3QX1A 1E90A 4BOZB 4GDKA 3DBLI 3V62A 4GDKB 2LRWA 2N9PC 4IM0A 3WAOA 5J2RA 3O65B 1KM7A 3ZNZB 3VH3B 2YVCA 2LD9A 2FUHB 2M8SA 3RD2A 3QK0A 3NOBA 2CR5A 2XK5A 4RMAA 4ZRJA 4A3PA 1V5OA 1BT0A 2XK5B 5D7GA 2KK8A 3L16A 4MGKE 2IY0B 4WWOA 3ZRFA 2K8BA 3T9LA 2DAJA 2M1MA 2WDTB 2KTRA 4MSMB 1KOTA 4II2B 3T8MA 2GBNA 3L08A 4KVGB 2K39A 2VRRB 4F7ZA 1RFAA 2JT4B 2O2VA 1E7VA 2KTFA 4WWPA 2O2VB 3ML9A 4MDKE 1Q5WB 4TUUA 1WXAA 4X57B 4DHZB 4W9EA 2N7DA 4HWIB 4NQLB 4BOSC 4W9JA 2CU1A 3VAWA 1WR1A 1WFYA 4EOYA 3P2BA 2V3SA 3A1QA 1LFDA 2IZVB 3A1QB 4PYUA 5JZEB 3NZSA 5DCNA 2JRHA 3UINB 1RAXA 4EEWA 1ZW7A 2L3ZA 5JHBA 1V5TA 5J17A 2O6VA 4GSWA 3N30A 4KZ0A 1WGHA 4JLCA 4E71A 2O6VB 1J0GA 2L0TA 4BKSD 1J8CA 3H1UA 3ZUNA 2KLGA 3JYUA 3ALBA 3OAWA 3ZRCA 4HCPB 1WX8A 4K1RB 3W1SC 3OLMD 4FULA 2MRPA 2KC1A 2MBOA 2MA9B 3EECA 4F1SA 1GNUA 1SE9A 3CMMB 3TBLD 3Q3FA 1U4AA 5DPSA 4NJ7A 3VDZA 1WYWB 2MWSB 2CHZA 3PHWB 2IY1B 3IBEA 2M0XA 3DVGX 2REXA 1YD8U 2RSUA 3VQIA 2ZVNA 3ZO5B 5E6NA
chains in the Genus database with same CATH superfamily
2WXKA 4PYZA 2JYTA 3AE9B 3PT2B 2JUOA 1ESFA 3OJ4B 3PZDA 4MGZE 1N62A 3SDLC 4JGHB 4GIVA 2JU6X 3DBRB 2QC8A 1ZUD2 4DXFA 1YN3A 1UGMA 2N1VA 3EHVA 3PRZA 4DHJB 2KXJA 1QF6A 2I2YA 5E6OA 1QT9A 3MP9A 3U7ZA 4L23A 1HA5A 2RDGA 1SIFA 5CHFA 2MJ3A 3AEAB 2BWFA 3KH0A 4AUQC 2DYOA 4MM3B 4MGYE 2LHEA 1IP9A 3PLVA 3ZJTA 2MH7A 4K81A 2NBWB 2W54A 4WWNA 5FR3A 3GP7A 1JWAD 3TIXA 2QMTA 1FNUA 3M62B 3VRBB 4TV3A 5LXIB 2K1FA 4RGTA 3IT4B 3JSVA 4LK0M 3RNCC 3I3TB 3VR8B 4PS7A 3L0WB 1WXVA 2NBUA 3KUDB 4M8NA 3P4PB 3T3NA 2DENB 1YJ1A 2MCNB 4II3B 3R66C 4ITKA 3V6EB 2FCMA 2Y5PA 1WH3A 1UWXA 1VZ8A 4E74A 3DBSA 4C56C 4G11A 2X8XX 1ZXIA 1HE8A 3EC8A 2IPKD 1WXSA 3GS2A 2L00B 4LNIA 2DHZA 2WXHA 1SE2A 4W9IA 1AW7A 3HVZA 1C4CA 4JX1C 3AE2B 1I4GA 1VZ6A 3EUB2 4EZJA 1N5WA 4JIOU 2K5PA 2H89B 4ICUA 1TYGB 3NVWA 5G55A 1FFVA 2KT7A 3GB1A 4WJOA 2MP2A 4TQ0A 1J19A 2OEDA 4L2YA 4US9A 1QQRA 3DHHC 4ASWC 1L7YA 2AYOB 3QQ8B 2KO3A 1ZE3D 3VTUA 1XD3B 5KHOA 3R2TA 4I6NB 1V6EA 1WGDA 2MBBB 4WQMA 2TSSA 2LVPA 4JQWC 4C4VA 2FCNA 1C77A 1OTRB 1WGRA 3R8BA 2CU3A 2KN5A 4RCOA 1FXTB 3H7PA 4PT5A 2Z8LA 4YSYB 2R61A 5EE3A 4AQ7A 4K7SA 5D3DA 4M0WB 5HFYA 2BS2B 3VVWB 2C7MB 5D3IB 5C3JB 3AE5B 5CX3A 1XEEA 2JVCA 2WDRB 2B3AA 1E8WA 3UQAA 3CSTA 4OZCA 1L4DB 2PW9A 2V3PA 2WP9B 4NZLB 2KWDA 2ASQA 3TEWA 1TIFA 5AZHA 1GC7A 1I4PA 2KDFB 4FJVB 1GUAB 2NVUI 2LGSA 3FILB 5BYRA 4NPNA 2G3QB 2J52A 5AUIA 3PRPB 5GMVA 3WA0A 4ANVA 3GZNI 1KH0A 5FKAC 4BZAA 3I63C 1WJ4A 2WX1A 1NBFC 2DYMA 1N61A 3CSFA 2IJ0A 4RGMA 3WAPA 2ON8A 5G2NA 1TY2A 1YOVB 5FK9C 3H8HA 3VUWA 4P16A 2FE8A 3W1SA 2HTME 4KZCA 1HEZE 4P1BC 3IG3A 4S17A 2KLCA 2LXAA 1UZXB 1L6VA 2V4LA 2L8JA 1ISNA 3AB5A 4J3OD 1VJKA 4HCNB 4MACA 2K22A 3W5UB 3DQVA 1KLVA 1SB3C 4L1BA 2OJRA 2RPVA 4MH8A 2MP2B 1UGJA 4EZLA 3V60A 5IN7A 1GB4A 5DPRA 4IW0A 2ZPNA 3IVFA 4IWPA 4P7IA 4MSQB 1WF9A 4KKJA 3R7RA 1KF6B 3K9OB 2DWQA 3APCA 3QCAA 3L13A 2IYDB 4DHZE 2QSDA 2OHFA 2BTEA 4NNJB 3IFWB 4ACFA 3PPAA 1E6EB 3J9CA 2PPHA 4C4VB 4LTUA 1AARA 3CIRB 4D2KA 2HJ1A 2JYEA 3NUHB 1VR9A 1ENFA 3RYTA 4ZRPA 4XX5A 2IO1B 3RULA 3PS6A 2MEKA 3RZFA 2Y5CA 3AEFB 1SXTA 3APFA 1JWBD 1C1YB 2C7HA 2Q5WD 3MHSD 1QZEA 1YQBA 3ZW3A 2FAZA 1E7PB 1BUIC 2LJ5A 2KDMA 2Z59B 4B0MA 2KQSA 3EFCA 5IAAC 2HE7A 2PTLA 1P3QU 1ZP0B 3V6CB 4C80A 3M95A 2J53A 3KVFB 4K7UA 4MELA 1OQYA 3LXFA 2C60A 3C0RB 3VRAB 3GE8C 1QOBA 4XDDA 2KQ7A 1OQRA 1BXTA 3ENEA 3PSEB 1E90A 3V62A 4OW0A 4YSXB 4GDKB 3Q6BA 2INDC 3AH7A 4TMAB 2LD9A 1TZOA 3P42A 2XK5A 4RMAA 4ZRJA 4A3PA 1QOFA 3L16A 2N9LA 4MGKE 4WWOA 3ZRFA 1L4ZB 2VH2A 2M1MA 5I4DA 3L08A 1V1PA 1MVKA 1RFAA 1E7VA 4WWPA 1SJED 4QAYA 3ML9A 1Q5WB 4X57B 3NVZA 4BOSC 4W9JA 1WR1A 1CJEA 2PVOD 2V3SA 4XGAB 1I4XA 1LFDA 2UU7A 3A1QB 1HQRD 1RAXA 2O6VA 2OJWA 3N30A 4KZ0A 1WGHA 4E71A 2L0TA 2LUMA 1HXYD 2JZPA 3JYUA 1N63A 4K1RB 2G1EA 2KC1A 2MBOA 5BYQA 3I5JC 4F1SA 2NMQA 1GNUA 1AWDA 3TBLD 3Q3FA 2KVZA 3IBEA 3DVGX 1VZ7A 1F77A 1WGKA 3ZO5B 1NENB 1IPGA 5CHWA 4NQKE 3ETRA 1UBQA 4KDIC 4K3CA 4IOIE 4AWJA 2IO0B 3ZQ4A 3AXCA 3X0WA 2MHJA 5L83A 2D11A 3DBHI 5D2MB 1XXGA 3UI3A 2ZZPB 3KQ4A 1FO4A 2WXJA 4URKA 2KVRA 2M4NA 3IHPC 1HZ5A 3KYCD 4GOCA 2RDHA 5D6JB 2O6VD 3H9DA 4DDGD 3NS8A 2JZZA 3VFKA 3ZNGC 1JRPA 2WHIA 5AZFA 2WDVB 1FRDA 2KMMA 3VH4B 1WRDB 1B1ZA 1E5WA 2JXXA 4MJSB 3AULA 4A55A 2SAKA 1WX7A 5T8IA 4DXAB 1YMHE 2LASA 2E3TA 4C7YA 3PLUA 3A9JB 5IOIA 1JWSD 4W9HA 1JW9D 4KIKB 2IGGA 2WWZA 3LYYA 1WJ6A 1Q10A 4OVZA 1V97A 4DHJD 1WM2A 1KTKA 2BS4B 5D94A 2WXFA 2MLBA 1V86A 1E8ZA 3RNBC 2LXCA 1EUVB 3B2FA 2D3CA 2N4FA 4ICVA 2AL6A 2LGXA 3DVGY 2NCNA 1P9DU 1UF0A 3AI5A 1ET6A 2LMCA 1TT5B 1ET9A 3O13A 2C9WB 3DBHB 4BKGA 2WXLA 4FHJA 1UUPA 1NYRA 2AL3A 2CS4A 2KDEB 2D5GA 3WAMA 2C5LC 3SFEB 3DCGA 4WURA 1E0ZA 3E9SA 3ZNHB 3BY4B 4FHKA 3QHTA 1YN5A 3KWVA 2BYTA 4IWOA 2M56B 1XLNA 1WZ0A 5EE9A 2KFJA 4H2AA 4NY0A 4RM9A 2I1KA 4FADA 2SEBD 3N3KB 3Q14C 4LDTD 1WJUA 3BK1A 3RFZB 3ZIMA 4DQOC 3ZVVA 1OEYA 3IT6B 3KLSX 1BMLC 1PGBA 1CK1A 2AQ1B 2PE9A 4ZRIA 1JALA 5AEKB 4A20A 2BYFA 4HPPA 4HKZE 2MJEA 2KJHB 4PS3A 2NTSA 3ZTCA 1K8RB 4NAWA 4Q2JA 1R7SA 1SF0A 1M94A 2AQ2B 1I7HA 2IO3B 3ML8A 2KFKB 3VUYA 3VHTC 2ZPYA 2OOBB 4M0WA 4W9CA 3U30A 1XLPA 2XEWA 1FXAA 2KOXA 4WAAA 4BBNC 2FIFA 2BVCA 1OQQA 1T6BX 1D5MC 1MHHE 4MEMA 5JXVA 2AWTA 4M01A 1EF1A 1PFDA 2W3RA 2K25A 1EM7A 3C19A 2E6XA 5KHQA 1D4BA 3FILA 2QDFA 3SFDB 4GLSC 1XQQA 3NG0A 2ZNVC 2LGDA 4RM8A 1PUTA 4CO7A 2ICIA 2CJOA 1TTNA 4LDTB 4HJKA 4ZOHC 3TEYA 3AEDB 1STEA 4A8XC 2WXMA 4FLHA 2DAFA 2L05A 2RMMA 5IKCM 2R2QA 4HEA1 3U7DA 2YEPF 1MPEA 4GMVA 2LGYA 2ZVOA 1H4RA 3HHMA 3RNEC 3I9V1 3QARA 1C4AA 1RFKA 1TY0A 4RF0A 2GOWA 1VDVA 1WJNA 2N1WA 4FXCA 4WH4A 4KDLB 3UGBB 2A5UA 4LJOB 2KD0A 2N0SB 3AV8A 5J18A 2CHWA 3TMPB 3HVDA 3HM6X 5G5GA 2CJNA 4ANXA 3M63B 1WR6E 2N7JA 1YX5B 5CHVC 2Y5BB 2WNMA 4A3OA 1V8CA 4MT5A 3RI7C 3H7SA 2EKEC 1TGZB 1OGWA 3BINA 4WQOB 1WGYA 1KLGD 2I38A 1T5XD 1K50A 1WSPA 5MPOA 1AN8A 1DOYA 2QILA 1C9FA 2KWCA 2WU5B 2JRIB 1V81A 1F9JA 1C3TA 4I6PA 3EFUA 2GBMA 4NAWB 2V9HA 2VZKD 1WIAA 3L17A 1JWUD 3DBLB 1I4RA 2JX5A 2UYZB 4LNOA 3HK0A 3B2GA 1WXMA 1UBIA 2ZNVB 1V9JA 4OVVA 3PVLA 2J0JA 2LVOA 3DVNU 3V61A 1K51A 1CMXB 3QWZB 3GOEA 1WI0A 4B9KA 2AX5A 4OHJA 1F2RI 3BVZA 2K6QA 2KC2A 3CWIA 2W55A 1T0YA 3TEXA 1Z2MA 4YTNB 2DNFA 2JWZA 3S2AA 2I1JA 4HRSA 1JWMD 3KUZA 1TKGA 3B0AA 2KJRA 4BFRA 3MFGA 2ONQA 1HTOA 3UQBA 1YJJA 3N1ZC 1XF5L 3ECIA 3JW0X 4GDKA 2LRWA 2N9PC 4IM0A 5J2RA 3AEGB 2GLSA 2LJIA 2JWUA 3ZNZB 1UWMA 2YVCA 4ZRQA 2FUHB 2M8SA 3NOBA 2ZW0A 1MI0A 5D7GA 4XYCA 1XLOA 2IY0B 2GB1A 2K8BA 5IO9A 3AE3B 3RN9C 1PDXA 1KOTA 4II2B 4JWUC 3AECB 2KTFA 2O2VB 4N59A 4DHZB 4HWIB 4NQLB 2VZKB 3A1QA 2IGHA 3FKYA 5DCNA 4EEWA 2L3ZA 1NYQA 5J17A 5H8YE 4C7ZA 3AE1B 1J0GA 3N1YC 1J8CA 1IBXB 3OAWA 1JCKB 4HCPB 1FFUA 3W1SC 2BS3B 3OLMD 4FULA 3BIID 3EECA 2WXNA 4IKGA 2CHZA 2IY1B 4WWMA 2M0XA 1YD8U 1DOIA 2ZVNA 3TEZA 2L1AA 4RF1A 2INCC 3D32A 2V1YA 1EO6A 2FCQA 2Y3AA 3Q8FA 2MW5A 1V1OA 1SIJA 2L83A 1C4PA 2AEHA 4TKNA 3LB8C 1FXIA 4PK1A 2NR2A 4G50A 3PO0A 4YL8A 1YIWA 4ZHOA 2KANA 2K8HA 4YTPB 1KFYB 1N60A 1R4MB 3R7QA 3PTFC 3VTVA 4K3BA 3AMZA 3ZXRA 3ZJUA 2WU2B 2DLBA 3NZUA 2UWQA 3OWEB 3Q3NC 4AJYB 2WXQA 4MGIE 4WJNA 2AQ3B 5BYSA 1ZGUB 2BGFA 3WALA 2FBWB 3Q3OC 2LHDA 3DOWA 4FN2A 2EMTA 4MJSA 1E8YA 1S3SG 1NI3A 1GAQB 4M02A 1F0ZA 2PE6B 4W9GA 1F1HA 3B08A 1J7CA 3ZNID 1QKZA 3TL5A 2FUG1 2KYWA 3TSSA 3A9JA 1SBBB 3DHGC 4KIKA 4KGRA 4YXDB 2PJHA 5HKHA 1ZDXA 1RLFA 1OEYJ 1GOZA 2KQ4X 1YNTE 1WMHA 2NTTA 1RRBA 2PVGC 3B1LX 3R2IA 4B95A 3ZDMC 3LJ3A 4TSSA 4DK5A 2D3GA 2M17A 3UF8A 1VD2A 4O1NA 1M4VA 2WLBA 3HIZA 2N7EA 3X23A 4W9FA 3TUOA 4G0NB 4ZYNA 2RR9A 4ARCA 2RGFA 5EE0A 1ZKHA 4GB9A 3DHIC 2GBKA 4KGTA 4YTMB 1GB1A 1FIQA 1WWTA 1PGXA 3OJ3A 3ZJVA 2V4IB 3AE8B 2VH1A 3RUIB 4EZKA 3MTNB 1J7BA 3KW5B 3RCZA 2CKHB 3EGRA 2A4ZA 2JZ3B 3B9JA 4GU2A 2G4SA 1HZ6A 2FCSA 3QAQA 1K53A 4HLEA 2BB5A 1D3ZA 2DYBA 5FR6A 4HXDA 1E8XA 3KYDD 4HK2A 1TBEA 2LEKA 4MH0E 3QIJA 1GPXA 5HI1A 1T0RC 5EE1A 3PZ7A 2YLMA 2L0FA 3P1MA 3L4PA 2J0MA 2LWPA 1YN4A 3ABVB 2IO2B 5LXHA 1LXDA 2KHWB 2KFKA 1L0VB 2WYQA 1XT9B 1C76A 2K8CA 3MC9A 4B6WA 1P98A 3A33B 4KX6B 1SE3A 3V05A 3BWUD 2N9EB 3ONSA 1YX6B 1KLUD 1Y56A 3AU4A 4KSLC 1TS2A 1QOGA 1WXQA 2KAJA 2WX0A 3W1YA 2DZKA 2ZCBA 2H88B 2KN4A 5LLIA 2BYVE 1CZPA 2G4DB 3A9KB 3NJTA 1JRUA 4WIPA 1WMHB 4A90A 3DDCB 2EMSA 2W3SA 3SU8X 1Q1OA 2MQJA 3SR6A 3VXWA 3NVYA 2DX5B 2HDEA 2J42A 1QILA 1WX9A 2IBIB 1X1MA 1MJDA 3UIPB 2LRUA 4YT0B 1WE6A 2JXTA 4LCDE 5EDSA 2D10A 1PQSA 1IYFA 3PHXB 3VUXA 3CF6E 1ACCA 2KKCA 3BK2A 4LLGM 3U8ZA 2DZJA 4DBGA 2GBRA 1FNWA 1GC6A 1R4NI 3Q8BA 4C00A 1RYJA 1ZPSA 5DPWA 3ZTDA 4GN1A 2L76A 3Q8EA 2ZJDA 2BB6A 1HTQA 5E6JA 2IGDA 3ZDTA 4S0RA 2C7NB 2XNAC 2KDBA 2XBBC 3W2DA 1VLBA 1D5ZC 1J7AA 4US8A 1GJZA 2DBYA 4IG7B 4GXBA 1TS5A 1Y8RC 2WDQB 1V80A 4RGOS 2JY6A 3KUCB 3RNAC 2N9XA 3GE3C 5H92C 1FNVA 3RMKC 3PREA 3P4QB 5BMIA 2FNJB 1IGDA 1P0RA 4WJPA 1A70A 2BKRB 5BMHA 1GG3A 4CYEA 3PRMB 4JWSC 1ZDVA 1OFFA 2WXGA 4G3XB 2BQQA 4NJ6A 1FCLA 2L7RA 4BBNF 2HD5B 3NZ3A 3Q8CA 4HPMB 3Q69A 3C8YA 1VCBA 2W9NA 4P6VF 2CHXA 1NI2A 4PS8A 4JPSA 4HVBA 2KJ6A 3QA8A 2LZ6A 2BPSA 1R4NB 3L54A 5C23A 5JH5C 3QX1A 4BOZB 3DBLI 1YQ4B 2QEJC 4N58A 4ARIA 1JQ4A 3O65B 3U2SC 1KM7A 2WXIA 3QK0A 4B0EA 2CR5A 1EWCA 5LNK1 2KK8A 2DAJA 1JROA 2WDTB 2KTRA 2GBNA 4F7ZA 2VRRB 2O2VA 4TUUA 3P4SB 4W9EA 2N7DA 3PZ8A 2CU1A 3VAWA 3P2BA 1YQ3B 4PYUA 3NZSA 2JRHA 3UINB 5JHBA 1V5TA 4GSWA 4RFBA 1T0QC 2XN9C 1IBXA 3N20C 3H1UA 2IDYA 4KGSA 3ZUNA 2KLGA 3ALBA 2ZW1A 2MRPA 1L0XB 2ACZB 5DPSA 2K3UA 3VDZA 1WYWB 2MWSB 1SEBD 2RSUA 4N6EB 4RGNA 3VQIA 5E6NA 3L10B 1K52A 3NY5A 2BW2A 4BKTA 1P7FA 1SJHD 1I35A 3KWLA 1ZXHA 1FMAD 2MBEA 4HKQA 3BZDB 4LNFA 1XCQL 1S1QB 3DVNV 1EF5A 1F52A 3M3JA 1T0SC 1F2RC 5TSSA 4OZBA 3H6NA 2KMCA 2MBQA 4CQNA 3APDA 2LFIA 2WGSA 2LVQA 2MSED 1WGGA 3AM9A 1TKEA 3MC8A 1LO5D 3U4EG 1I4QA 2BBCA 3MHZA 5BMGA 1NVID 3NHEB 2BKFA 2R2OA 1KJTA 4AOFA 2V3NA 1R4MI 2PKOA 1LQBA 2HJ8A 2M19A 2INNE 2YEPB 4IWQA 2RDBC 4IC7B 3JSVB 2GBJA 4HROA 5DPTA 3LDZE 3BYTB 4FBJB 1T3QA 5TR5A 5AZGA 1UD7A 2B76B 1QLBB 2KTRB 4XC2A 2KX3A 3DPDA 2D3AA 3MJ5A 1I42A 3UIOB 3EA6A 3WIMA 2LI5A 2INPE 4XDCA 1A5RA 3W9CB 4JE3B 3NRZA 2J7QB 3DWGC 3E56A 4JL9A 4BAXA 1WM3A 1N6ZA 2NPTA 4W9KA 2GI9A 3Q2AC 1UH6A 1YJIA 2JQRB 4R3DA 2L52A 1V49A 4DDID 1TS4A 1P1AA 3MJWA 4FJZA 1KRHA 1EU4A 4AS1A 4GDLA 5GXGB 5C2TB 3ZYYX 2EELA 2L32A 3TCAA 2Z0EB 4K7WA 3SD5A 3Q8AA 2V0GA 1PGAA 2KWUB 1MFWA 4F8CB 1UELA 1SE4A 3SHQA 4YSZB 4XWWA 4EUTA 4FA6A 2WXOA 3NVVA 4KKIA 2G9HD 4TQ1A 1D6EC 2BWES 1EWYC 1L6UA 2X38A 5JHAA 2BYEA 3PV1A 3RT3B 1L2NA 1SGHA 2JPHA 3IXSA 2W82A 2KDIA 4FJYA 3A4RA 3H7PB 2GMIC 4LNKA 1C79A 4RH6A 2GRIA 1XCTL 2K6DB 1TS3A 1UNSA 1TJEA 3GZNB 2D3BA 5C1ZA 3I57A 1FRRA 2DZMA 1VRAB 3ZKJC 1P7EA 1N5XA 1B9RA 2MX2A 1DYQA 1MG4A 4UDUC 2DZIA 3BVGA 2WQYB 2D2QA 3P4RB 1WY8A 4RNAA 3RZWC 4WAFA 4J6IA 4IUMB 3R3MA 1Q0WB 3FAHA 3K9PB 3AU5A 3A9KA 3ZXVA 1FCCC 3RNGC 1Z5SB 3Q3JA 4M00A 1E10A 5E6PA 2QIEB 2MJDA 5CTRC 3ZLZA 2KNBA 4EKUA 3V3XA 4REZA 2ZEQA 4I6LB 4EFOA 1V2YA 4E3CA 5IA7A 4XWTA 3W5VB 3Q3MC 5HG2A 4OZAA 4XZ4A 4KSKC 4HPLB 3PGEA 1MHXA 2HTHA 4DXGA 2QHOA 3N32A 4W9DA 2NPTB 2PMVA 2PEAA 4ZRKA 2NBVB 1H8CA 4IM2A 4YWGG 5G5HA 4LNNA 4AJWA 4HDOA 2LUEA 4A6QA 1AYFA 3QJZA 4GGQA 3HRDD 4ANUA 2G45B 4GDLB 4WJQA 1TZ1A 3QC8B 3AN1A 1IUEA 1EU3A 3VTWA 4AP4C 3BVMA 4OVUA 2BF8B 3DWMA 1TKYA 1RWSA 2FIDA 3AE4B 1WZ3A 2PIAA 1FEHA 2KZRA 2M0AA 4ZDVA 1XO3A 3HM3A 1LM8B 4ZYSA 3WANA 2KACA 1D5XC 4A9AA 2J0KA 1WRIA 2D07B 2WXRA 3MC0B 1FM0D 4XE0A 2KWVB 3RNFC 4M8MA 1QOAA 2QJLA 3A4SC 3N1XC 1ZOYB 4EE2A 2K9XA 4BVUC 4IM3A 4KV2A 3URYA 3JVZX 1SSNA 5L95C 1WE7A 3AEEB 2KX0A 4HDQA 3IAM1 2N9KA 5BO4B 3TJPA 2JF5A 1FD6A 1MG8A 1E7UA 1DOXA 3N9YC 2J4XA 2KMAA 4CHKA 4ANWA 2LGIA 2MBHA 1IGCA 3NS1A 2PLPA 2ZCCA 4N9F4 3AEBB 3AE7B 4USAA 3RPFC 3SEBA 1LGRA 4MM3A 4IDIA 3VR9B 2RD0A 2JSVX 4LJPB 3DBRI 4DWFA 1G6JA 1NEKB 4BKSA 3OG5A 2BT6A 4W9LA 2RPQA 1C78A 2NS5A 1NDDA 2Z0DB 4P1CC 3T3OA 3AE6B 5AUKA 3WCQA 3WAOA 3U52E 3VH3B 3RD2A 1V5OA 1BT0A 2EKIA 1XLQA 2XK5B 5IP4D 2QCZA 1ROEA 4NJCA 3T9LA 4MSMB 3T8MA 4KVGB 2K39A 1E9MA 2JT4B 1V1PB 1PYWD 4MDKE 3HUIA 1WXAA 3IAS1 1FPYA 4HJGE 1RM6C 3P63A 1WFYA 4EOYA 4ZHPA 2IZVB 1L5PA 5JZEB 1WYGA 1ZW7A 1L0YB 3ZGZA 1JMLA 4JLCA 2O6VB 1DGJA 2WS3B 4BKSD 3ZRCA 3FC4A 1WX8A 5HHDG 2MA9B 2WXPA 3BYYB 1I4HA 1SE9A 1CQVA 3CMMB 1U4AA 4NJ7A 2K0PA 3PHWB 2REXA 4NAMA
chains in the Genus database with same CATH topology
3L10B 1IPGA 3NY5A 5CHWA 4NQKE 3D32A 2V1YA 1UBQA 4PYZA 4KDIC 4AWJA 1EO6A 4BKTA 2FCQA 2IO0B 3AXCA 3X0WA 3PT2B 1I35A 2MW5A 2JUOA 3OJ4B 5L83A 2D11A 3DBHI 3PZDA 4MGZE 2AEHA 5D2MB 4TKNA 3SDLC 2ZZPB 4JGHB 4GIVA 2MBEA 2NR2A 4G50A 1UGMA 4YL8A 1YIWA 4URKA 1S1QB 2KVRA 2M4NA 3IHPC 2KANA 2K8HA 3DVNV 2N1VA 1EF5A 3EHVA 3PRZA 3KYCD 3R7QA 3PTFC 4GOCA 3VTVA 4DHJB 2KXJA 5D6JB 3M3JA 2O6VD 3H6NA 3H9DA 2KMCA 4DDGD 2MBQA 3NS8A 2UWQA 3NZUA 4AJYB 5E6OA 2JZZA 3APDA 4MGIE 3VFKA 3ZNGC 4WJNA 1ZGUB 2LVQA 2BGFA 3WALA 5AZFA 1SIFA 2MSED 5CHFA 2BWFA 3KH0A 4AUQC 1WGGA 3VH4B 3DOWA 4FN2A 1WRDB 2DYOA 2EMTA 1E8YA 1S3SG 1E5WA 2JXXA 4MJSA 4MJSB 3AULA 4MGYE 1IP9A 3PLVA 4K81A 2NBWB 1WX7A 2PE6B 4DXAB 4WWNA 2LASA 4W9GA 3B08A 3NHEB 2BKFA 3TIXA 2R2OA 3ZNID 1KJTA 3TL5A 4AOFA 1R4MI 3M62B 1LQBA 4TV3A 5LXIB 3A9JA 2K1FA 2HJ8A 3PLUA 3A9JB 4IWQA 3JSVA 4IC7B 4KIKA 3JSVB 4W9HA 2GBJA 3I3TB 4KIKB 4PS7A 2WWZA 3L0WB 5DPTA 1WJ6A 2PJHA 5HKHA 1RLFA 1OEYJ 3LDZE 1WXVA 1WMHA 2NBUA 3KUDB 4M8NA 4DHJD 4FBJB 1WM2A 1RRBA 5TR5A 5AZGA 1UD7A 3B1LX 5D94A 2MLBA 1V86A 4B95A 2DENB 3ZDMC 1YJ1A 1E8ZA 2KTRB 3LJ3A 4XC2A 2MCNB 4II3B 4DK5A 3R66C 2LXCA 1EUVB 2D3GA 2KX3A 2M17A 3DPDA 3UF8A 3V6EB 1VD2A 2N4FA 1I42A 3UIOB 3WIMA 2LI5A 4ICVA 2AL6A 2LGXA 2FCMA 3DVGY 1A5RA 2NCNA 1P9DU 1WH3A 3AI5A 4E74A 3DBSA 2J7QB 4G11A 2C9WB 3HIZA 1HE8A 4JL9A 4BKGA 2N7EA 3EC8A 3X23A 4W9FA 4FHJA 4G0NB 1WXSA 4ZYNA 2RR9A 2RGFA 1WM3A 2AL3A 2L00B 2CS4A 1ZKHA 2KDEB 4GB9A 2DHZA 4W9IA 3WAMA 2C5LC 2NPTA 3DCGA 4W9KA 2GBKA 3ZNHB 1UH6A 1V49A 3BY4B 4EZJA 3OJ3A 4JIOU 4FHKA 3QHTA 4DDID 4IWOA 3RUIB 1P1AA 4EZKA 4ICUA 3MTNB 1WZ0A 3MJWA 5G55A 3KW5B 4FJZA 2KFJA 4NY0A 4RM9A 3RCZA 2CKHB 4GDLA 2I1KA 2A4ZA 2JZ3B 4WJOA 4FADA 2MP2A 4GU2A 4TQ0A 1J19A 2G4SA 3TCAA 2FCSA 3QAQA 3N3KB 2Z0EB 4LDTD 4K7WA 3SD5A 4ASWC 1WJUA 4HLEA 3ZIMA 1L7YA 2KWUB 1D3ZA 2AYOB 4F8CB 2DYBA 1OEYA 3QQ8B 4HXDA 5FR6A 3ZVVA 1E8XA 1UELA 2KO3A 3SHQA 3KYDD 4HK2A 1TBEA 4MH0E 3VTUA 3QIJA 2PE9A 1XD3B 5KHOA 4I6NB 4EUTA 1V6EA 4ZRIA 5AEKB 4A20A 2YLMA 2L0FA 1WGDA 4FA6A 2BYFA 2MBBB 4TQ1A 2BWES 5JHAA 2LVPA 2KJHB 2J0MA 2LWPA 2BYEA 3PV1A 3RT3B 4JQWC 2IO2B 1L2NA 2FCNA 5LXHA 1OTRB 1SGHA 1WGRA 2JPHA 4PS3A 3ZTCA 1K8RB 4NAWA 2KN5A 1FXTB 1LXDA 2KHWB 1M94A 3H7PA 2KDIA 4FJYA 2KFKA 3A4RA 3H7PB 2GMIC 2IO3B 1XT9B 2WYQA 3ML8A 2KFKB 3VUYA 3VHTC 2ZPYA 2OOBB 2K8CA 2K6DB 4B6WA 4K7SA 4W9CA 3U30A 1P98A 2XEWA 4M0WB 2KOXA 3A33B 4WAAA 5C1ZA 3VVWB 4BBNC 2N9EB 2FIFA 3ONSA 1YX6B 2C7MB 2DZMA 3ZKJC 5CX3A 3AU4A 4MEMA 2JVCA 2MX2A 4KSLC 2AWTA 2DZIA 1EF1A 1E8WA 2B3AA 3UQAA 2WX0A 3CSTA 3W1YA 2D2QA 2DZKA 1WY8A 3RZWC 2ZCBA 2K25A 4J6IA 2ASQA 4IUMB 3R3MA 1Q0WB 5LLIA 5AZHA 1GC7A 2KDFB 3K9PB 2BYVE 4FJVB 3AU5A 3A9KA 5KHQA 1GUAB 2G4DB 3A9KB 2NVUI 1JRUA 1WMHB 3DDCB 2EMSA 4NPNA 1XQQA 2G3QB 3SU8X 1Z5SB 2ZNVC 1Q1OA 3Q3JA 2LGDA 2MQJA 4RM8A 5E6PA 3PRPB 3VXWA 4CO7A 5CTRC 3ZLZA 2KNBA 4EKUA 5GMVA 2DX5B 2ZEQA 1TTNA 4LDTB 3GZNI 4HJKA 3WA0A 4ANVA 1WX9A 4I6LB 4EFOA 1V2YA 2IBIB 1WJ4A 4E3CA 1X1MA 5IA7A 2WX1A 4FLHA 2DAFA 2L05A 2LRUA 3UIPB 1NBFC 2DYMA 2R2QA 3CSFA 3WAPA 3U7DA 1WE6A 4XZ4A 4LCDE 5G2NA 4KSKC 4GMVA 5EDSA 2D10A 1PQSA 2LGYA 2ZVOA 1H4RA 3PGEA 4HPLB 3HHMA 1IYFA 3PHXB 3VUXA 3CF6E 3VUWA 2HTHA 3QARA 2KKCA 3W1SA 2QHOA 3N32A 2GOWA 1WJNA 2N1WA 4KZCA 4W9DA 3U8ZA 2NPTB 3IG3A 2KLCA 2DZJA 2LXAA 4KDLB 4DBGA 3UGBB 2A5UA 2PEAA 1UZXB 4LJOB 2V4LA 2GBRA 4ZRKA 2NBVB 2L8JA 1H8CA 2KD0A 1ISNA 1GC6A 1R4NI 4IM2A 5J18A 2CHWA 3TMPB 4AJWA 3HM6X 4HDOA 4HCNB 2LUEA 5DPWA 4ANXA 3QJZA 3ZTDA 4GGQA 3DQVA 3M63B 1KLVA 4ANUA 4GN1A 1WR6E 2L76A 2G45B 1YX5B 2OJRA 2Y5BB 4GDLB 2ZJDA 4WJQA 5CHVC 4A3OA 1TZ1A 3QC8B 2MP2B 3ZDTA 4EZLA 3V60A 5DPRA 3VTWA 4IW0A 2ZPNA 3H7SA 3IVFA 2C7NB 2EKEC 4IWPA 1TGZB 2BF8B 4MSQB 1OGWA 2KDBA 4P7IA 2XBBC 1WF9A 4OVUA 3BINA 4WQOB 3R7RA 1WGYA 2FIDA 1WZ3A 2KZRA 3K9OB 3APCA 4ZDVA 1GJZA 3HM3A 4IG7B 1LM8B 4GXBA 3QCAA 3WANA 3L13A 2IYDB 1Y8RC 4DHZE 2KWCA 2J0KA 1V80A 2D07B 2JY6A 3KUCB 4NNJB 2JRIB 1V81A 2KWVB 3IFWB 4M8MA 3PPAA 2N9XA 1F9JA 1C3TA 4I6PA 2PPHA 1AARA 3A4SC 2GBMA 3EFUA 4NAWB 4BVUC 3PREA 2FNJB 4IM3A 4KV2A 3RYTA 4WJPA 1P0RA 4XX5A 2BKRB 2IO1B 3JVZX 3RULA 1WIAA 3L17A 5L95C 4AP4C 3PS6A 1WE7A 1GG3A 2KX0A 4HDQA 3RZFA 4CYEA 2UYZB 3PRMB 5BO4B 3APFA 3HK0A 1WXMA 1C1YB 2C7HA 1UBIA 3MHSD 4G3XB 2ZNVB 1QZEA 1V9JA 1YQBA 2JF5A 1MG8A 2FAZA 3PVLA 4OVVA 1E7UA 2J0JA 3ZW3A 2LVOA 3DVNU 4NJ6A 3V61A 2LJ5A 1CMXB 2KMAA 2Z59B 3GOEA 3QWZB 4ANWA 2L7RA 1WI0A 4CHKA 4B9KA 3TJPA 4BBNF 2KQSA 2HD5B 2MBHA 5IAAC 2K6QA 2ZCCA 4HPMB 4N9F4 2KC2A 1VCBA 2HE7A 2W9NA 1P3QU 1T0YA 3V6CB 2CHXA 3M95A 1NI2A 1Z2MA 4MM3A 2JWZA 4PS8A 3S2AA 2RD0A 4HVBA 2I1JA 2KJ6A 3KVFB 3KUZA 3QA8A 4K7UA 1OQYA 3DBRI 4LJPB 4MELA 3B0AA 2C60A 3C0RB 4DWFA 1G6JA 2KJRA 4BFRA 2LZ6A 4BKSA 3UQBA 2BPSA 4W9LA 2KQ7A 2RPQA 2NS5A 1NDDA 2Z0DB 3L54A 5C23A 3PSEB 3ENEA 5JH5C 3ECIA 3JW0X 3QX1A 1E90A 4BOZB 4GDKA 3DBLI 3V62A 4GDKB 2LRWA 2N9PC 4IM0A 3WAOA 5J2RA 3O65B 1KM7A 3ZNZB 3VH3B 2YVCA 2LD9A 2FUHB 2M8SA 3RD2A 3QK0A 3NOBA 2CR5A 2XK5A 4RMAA 4ZRJA 4A3PA 1V5OA 1BT0A 2XK5B 5D7GA 2KK8A 3L16A 4MGKE 2IY0B 4WWOA 3ZRFA 2K8BA 3T9LA 2DAJA 2M1MA 2WDTB 2KTRA 4MSMB 1KOTA 4II2B 3T8MA 2GBNA 3L08A 4KVGB 2K39A 2VRRB 4F7ZA 1RFAA 2JT4B 2O2VA 1E7VA 2KTFA 4WWPA 2O2VB 3ML9A 4MDKE 1Q5WB 4TUUA 1WXAA 4X57B 4DHZB 4W9EA 2N7DA 4HWIB 4NQLB 4BOSC 4W9JA 2CU1A 3VAWA 1WR1A 1WFYA 4EOYA 3P2BA 2V3SA 3A1QA 1LFDA 2IZVB 3A1QB 4PYUA 5JZEB 3NZSA 5DCNA 2JRHA 3UINB 1RAXA 4EEWA 1ZW7A 2L3ZA 5JHBA 1V5TA 5J17A 2O6VA 4GSWA 3N30A 4KZ0A 1WGHA 4JLCA 4E71A 2O6VB 1J0GA 2L0TA 4BKSD 1J8CA 3H1UA 3ZUNA 2KLGA 3JYUA 3ALBA 3OAWA 3ZRCA 4HCPB 1WX8A 4K1RB 3W1SC 3OLMD 4FULA 2MRPA 2KC1A 2MBOA 2MA9B 3EECA 4F1SA 1GNUA 1SE9A 3CMMB 3TBLD 3Q3FA 1U4AA 5DPSA 4NJ7A 3VDZA 1WYWB 2MWSB 2CHZA 3PHWB 2IY1B 3IBEA 2M0XA 3DVGX 2REXA 1YD8U 2RSUA 3VQIA 2ZVNA 3ZO5B 5E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L10 B;  1IPG A;  3NY5 A;  5CHW A;  4NQK E;  3D32 A;  2V1Y A;  1UBQ A;  4PYZ A;  4KDI C;  4AWJ A;  1EO6 A;  4BKT A;  2FCQ A;  2IO0 B;  3AXC A;  3X0W A;  3PT2 B;  1I35 A;  2MW5 A;  2JUO A;  3OJ4 B;  5L83 A;  2D11 A;  3DBH I;  3PZD A;  4MGZ E;  2AEH A;  5D2M B;  4TKN A;  3SDL C;  2ZZP B;  4JGH B;  4GIV A;  2MBE A;  2NR2 A;  4G50 A;  1UGM A;  4YL8 A;  1YIW A;  4URK A;  1S1Q B;  2KVR A;  2M4N A;  3IHP C;  2KAN A;  2K8H A;  3DVN V;  2N1V A;  1EF5 A;  3EHV A;  3PRZ A;  3KYC D;  3R7Q A;  3PTF C;  4GOC A;  3VTV A;  4DHJ B;  2KXJ A;  5D6J B;  3M3J A;  2O6V D;  3H6N A;  3H9D A;  2KMC A;  4DDG D;  2MBQ A;  3NS8 A;  2UWQ A;  3NZU A;  4AJY B;  5E6O A;  2JZZ A;  3APD A;  4MGI E;  3VFK A;  3ZNG C;  4WJN A;  1ZGU B;  2LVQ A;  2BGF A;  3WAL A;  5AZF A;  1SIF A;  2MSE D;  5CHF A;  2BWF A;  3KH0 A;  4AUQ C;  1WGG A;  3VH4 B;  3DOW A;  4FN2 A;  1WRD B;  2DYO A;  2EMT A;  1E8Y A;  1S3S G;  1E5W A;  2JXX A;  4MJS A;  4MJS B;  3AUL A;  4MGY E;  1IP9 A;  3PLV A;  4K81 A;  2NBW B;  1WX7 A;  2PE6 B;  4DXA B;  4WWN A;  2LAS A;  4W9G A;  3B08 A;  3NHE B;  2BKF A;  3TIX A;  2R2O A;  3ZNI D;  1KJT A;  3TL5 A;  4AOF A;  1R4M I;  3M62 B;  1LQB A;  4TV3 A;  5LXI B;  3A9J A;  2K1F A;  2HJ8 A;  3PLU A;  3A9J B;  4IWQ A;  3JSV A;  4IC7 B;  4KIK A;  3JSV B;  4W9H A;  2GBJ A;  3I3T B;  4KIK B;  4PS7 A;  2WWZ A;  3L0W B;  5DPT A;  1WJ6 A;  2PJH A;  5HKH A;  1RLF A;  1OEY J;  3LDZ E;  1WXV A;  1WMH A;  2NBU A;  3KUD B;  4M8N A;  4DHJ D;  4FBJ B;  1WM2 A;  1RRB A;  5TR5 A;  5AZG A;  1UD7 A;  3B1L X;  5D94 A;  2MLB A;  1V86 A;  4B95 A;  2DEN B;  3ZDM C;  1YJ1 A;  1E8Z A;  2KTR B;  3LJ3 A;  4XC2 A;  2MCN B;  4II3 B;  4DK5 A;  3R66 C;  2LXC A;  1EUV B;  2D3G A;  2KX3 A;  2M17 A;  3DPD A;  3UF8 A;  3V6E B;  1VD2 A;  2N4F A;  1I42 A;  3UIO B;  3WIM A;  2LI5 A;  4ICV A;  2AL6 A;  2LGX A;  2FCM A;  3DVG Y;  1A5R A;  2NCN A;  1P9D U;  1WH3 A;  3AI5 A;  4E74 A;  3DBS A;  2J7Q B;  4G11 A;  2C9W B;  3HIZ A;  1HE8 A;  4JL9 A;  4BKG A;  2N7E A;  3EC8 A;  3X23 A;  4W9F A;  4FHJ A;  4G0N B;  1WXS A;  4ZYN A;  2RR9 A;  2RGF A;  1WM3 A;  2AL3 A;  2L00 B;  2CS4 A;  1ZKH A;  2KDE B;  4GB9 A;  2DHZ A;  4W9I A;  3WAM A;  2C5L C;  2NPT A;  3DCG A;  4W9K A;  2GBK A;  3ZNH B;  1UH6 A;  1V49 A;  3BY4 B;  4EZJ A;  3OJ3 A;  4JIO U;  4FHK A;  3QHT A;  4DDI D;  4IWO A;  3RUI B;  1P1A A;  4EZK A;  4ICU A;  3MTN B;  1WZ0 A;  3MJW A;  5G55 A;  3KW5 B;  4FJZ A;  2KFJ A;  4NY0 A;  4RM9 A;  3RCZ A;  2CKH B;  4GDL A;  2I1K A;  2A4Z A;  2JZ3 B;  4WJO A;  4FAD A;  2MP2 A;  4GU2 A;  4TQ0 A;  1J19 A;  2G4S A;  3TCA A;  2FCS A;  3QAQ A;  3N3K B;  2Z0E B;  4LDT D;  4K7W A;  3SD5 A;  4ASW C;  1WJU A;  4HLE A;  3ZIM A;  1L7Y A;  2KWU B;  1D3Z A;  2AYO B;  4F8C B;  2DYB A;  1OEY A;  3QQ8 B;  4HXD A;  5FR6 A;  3ZVV A;  1E8X A;  1UEL A;  2KO3 A;  3SHQ A;  3KYD D;  4HK2 A;  1TBE A;  4MH0 E;  3VTU A;  3QIJ A;  2PE9 A;  1XD3 B;  5KHO A;  4I6N B;  4EUT A;  1V6E A;  4ZRI A;  5AEK B;  4A20 A;  2YLM A;  2L0F A;  1WGD A;  4FA6 A;  2BYF A;  2MBB B;  4TQ1 A;  2BWE S;  5JHA A;  2LVP A;  2KJH B;  2J0M A;  2LWP A;  2BYE A;  3PV1 A;  3RT3 B;  4JQW C;  2IO2 B;  1L2N A;  2FCN A;  5LXH A;  1OTR B;  1SGH A;  1WGR A;  2JPH A;  4PS3 A;  3ZTC A;  1K8R B;  4NAW A;  2KN5 A;  1FXT B;  1LXD A;  2KHW B;  1M94 A;  3H7P A;  2KDI A;  4FJY A;  2KFK A;  3A4R A;  3H7P B;  2GMI C;  2IO3 B;  1XT9 B;  2WYQ A;  3ML8 A;  2KFK B;  3VUY A;  3VHT C;  2ZPY A;  2OOB B;  2K8C A;  2K6D B;  4B6W A;  4K7S A;  4W9C A;  3U30 A;  1P98 A;  2XEW A;  4M0W B;  2KOX A;  3A33 B;  4WAA A;  5C1Z A;  3VVW B;  4BBN C;  2N9E B;  2FIF A;  3ONS A;  1YX6 B;  2C7M B;  2DZM A;  3ZKJ C;  5CX3 A;  3AU4 A;  4MEM A;  2JVC A;  2MX2 A;  4KSL C;  2AWT A;  2DZI A;  1EF1 A;  1E8W A;  2B3A A;  3UQA A;  2WX0 A;  3CST A;  3W1Y A;  2D2Q A;  2DZK A;  1WY8 A;  3RZW C;  2ZCB A;  2K25 A;  4J6I A;  2ASQ A;  4IUM B;  3R3M A;  1Q0W B;  5LLI A;  5AZH A;  1GC7 A;  2KDF B;  3K9P B;  2BYV E;  4FJV B;  3AU5 A;  3A9K A;  5KHQ A;  1GUA B;  2G4D B;  3A9K B;  2NVU I;  1JRU A;  1WMH B;  3DDC B;  2EMS A;  4NPN A;  1XQQ A;  2G3Q B;  3SU8 X;  1Z5S B;  2ZNV C;  1Q1O A;  3Q3J A;  2LGD A;  2MQJ A;  4RM8 A;  5E6P A;  3PRP B;  3VXW A;  4CO7 A;  5CTR C;  3ZLZ A;  2KNB A;  4EKU A;  5GMV A;  2DX5 B;  2ZEQ A;  1TTN A;  4LDT B;  3GZN I;  4HJK A;  3WA0 A;  4ANV A;  1WX9 A;  4I6L B;  4EFO A;  1V2Y A;  2IBI B;  1WJ4 A;  4E3C A;  1X1M A;  5IA7 A;  2WX1 A;  4FLH A;  2DAF A;  2L05 A;  2LRU A;  3UIP B;  1NBF C;  2DYM A;  2R2Q A;  3CSF A;  3WAP A;  3U7D A;  1WE6 A;  4XZ4 A;  4LCD E;  5G2N A;  4KSK C;  4GMV A;  5EDS A;  2D10 A;  1PQS A;  2LGY A;  2ZVO A;  1H4R A;  3PGE A;  4HPL B;  3HHM A;  1IYF A;  3PHX B;  3VUX A;  3CF6 E;  3VUW A;  2HTH A;  3QAR A;  2KKC A;  3W1S A;  2QHO A;  3N32 A;  2GOW A;  1WJN A;  2N1W A;  4KZC A;  4W9D A;  3U8Z A;  2NPT B;  3IG3 A;  2KLC A;  2DZJ A;  2LXA A;  4KDL B;  4DBG A;  3UGB B;  2A5U A;  2PEA A;  1UZX B;  4LJO B;  2V4L A;  2GBR A;  4ZRK A;  2NBV B;  2L8J A;  1H8C A;  2KD0 A;  1ISN A;  1GC6 A;  1R4N I;  4IM2 A;  5J18 A;  2CHW A;  3TMP B;  4AJW A;  3HM6 X;  4HDO A;  4HCN B;  2LUE A;  5DPW A;  4ANX A;  3QJZ A;  3ZTD A;  4GGQ A;  3DQV A;  3M63 B;  1KLV A;  4ANU A;  4GN1 A;  1WR6 E;  2L76 A;  2G45 B;  1YX5 B;  2OJR A;  2Y5B B;  4GDL B;  2ZJD A;  4WJQ A;  5CHV C;  4A3O A;  1TZ1 A;  3QC8 B;  2MP2 B;  3ZDT A;  4EZL A;  3V60 A;  5DPR A;  3VTW A;  4IW0 A;  2ZPN A;  3H7S A;  3IVF A;  2C7N B;  2EKE C;  4IWP A;  1TGZ B;  2BF8 B;  4MSQ B;  1OGW A;  2KDB A;  4P7I A;  2XBB C;  1WF9 A;  4OVU A;  3BIN A;  4WQO B;  3R7R A;  1WGY A;  2FID A;  1WZ3 A;  2KZR A;  3K9O B;  3APC A;  4ZDV A;  1GJZ A;  3HM3 A;  4IG7 B;  1LM8 B;  4GXB A;  3QCA A;  3WAN A;  3L13 A;  2IYD B;  1Y8R C;  4DHZ E;  2KWC A;  2J0K A;  1V80 A;  2D07 B;  2JY6 A;  3KUC B;  4NNJ B;  2JRI B;  1V81 A;  2KWV B;  3IFW B;  4M8M A;  3PPA A;  2N9X A;  1F9J A;  1C3T A;  4I6P A;  2PPH A;  1AAR A;  3A4S C;  2GBM A;  3EFU A;  4NAW B;  4BVU C;  3PRE A;  2FNJ B;  4IM3 A;  4KV2 A;  3RYT A;  4WJP A;  1P0R A;  4XX5 A;  2BKR B;  2IO1 B;  3JVZ X;  3RUL A;  1WIA A;  3L17 A;  5L95 C;  4AP4 C;  3PS6 A;  1WE7 A;  1GG3 A;  2KX0 A;  4HDQ A;  3RZF A;  4CYE A;  2UYZ B;  3PRM B;  5BO4 B;  3APF A;  3HK0 A;  1WXM A;  1C1Y B;  2C7H A;  1UBI A;  3MHS D;  4G3X B;  2ZNV B;  1QZE A;  1V9J A;  1YQB A;  2JF5 A;  1MG8 A;  2FAZ A;  3PVL A;  4OVV A;  1E7U A;  2J0J A;  3ZW3 A;  2LVO A;  3DVN U;  4NJ6 A;  3V61 A;  2LJ5 A;  1CMX B;  2KMA A;  2Z59 B;  3GOE A;  3QWZ B;  4ANW A;  2L7R A;  1WI0 A;  4CHK A;  4B9K A;  3TJP A;  4BBN F;  2KQS A;  2HD5 B;  2MBH A;  5IAA C;  2K6Q A;  2ZCC A;  4HPM B;  4N9F 4;  2KC2 A;  1VCB A;  2HE7 A;  2W9N A;  1P3Q U;  1T0Y A;  3V6C B;  2CHX A;  3M95 A;  1NI2 A;  1Z2M A;  4MM3 A;  2JWZ A;  4PS8 A;  3S2A A;  2RD0 A;  4HVB A;  2I1J A;  2KJ6 A;  3KVF B;  3KUZ A;  3QA8 A;  4K7U A;  1OQY A;  3DBR I;  4LJP B;  4MEL A;  3B0A A;  2C60 A;  3C0R B;  4DWF A;  1G6J A;  2KJR A;  4BFR A;  2LZ6 A;  4BKS A;  3UQB A;  2BPS A;  4W9L A;  2KQ7 A;  2RPQ A;  2NS5 A;  1NDD A;  2Z0D B;  3L54 A;  5C23 A;  3PSE B;  3ENE A;  5JH5 C;  3ECI A;  3JW0 X;  3QX1 A;  1E90 A;  4BOZ B;  4GDK A;  3DBL I;  3V62 A;  4GDK B;  2LRW A;  2N9P C;  4IM0 A;  3WAO A;  5J2R A;  3O65 B;  1KM7 A;  3ZNZ B;  3VH3 B;  2YVC A;  2LD9 A;  2FUH B;  2M8S A;  3RD2 A;  3QK0 A;  3NOB A;  2CR5 A;  2XK5 A;  4RMA A;  4ZRJ A;  4A3P A;  1V5O A;  1BT0 A;  2XK5 B;  5D7G A;  2KK8 A;  3L16 A;  4MGK E;  2IY0 B;  4WWO A;  3ZRF A;  2K8B A;  3T9L A;  2DAJ A;  2M1M A;  2WDT B;  2KTR A;  4MSM B;  1KOT A;  4II2 B;  3T8M A;  2GBN A;  3L08 A;  4KVG B;  2K39 A;  2VRR B;  4F7Z A;  1RFA A;  2JT4 B;  2O2V A;  1E7V A;  2KTF A;  4WWP A;  2O2V B;  3ML9 A;  4MDK E;  1Q5W B;  4TUU A;  1WXA A;  4X57 B;  4DHZ B;  4W9E A;  2N7D A;  4HWI B;  4NQL B;  4BOS C;  4W9J A;  2CU1 A;  3VAW A;  1WR1 A;  1WFY A;  4EOY A;  3P2B A;  2V3S A;  3A1Q A;  1LFD A;  2IZV B;  3A1Q B;  4PYU A;  5JZE B;  3NZS A;  5DCN A;  2JRH A;  3UIN B;  1RAX A;  4EEW A;  1ZW7 A;  2L3Z A;  5JHB A;  1V5T A;  5J17 A;  2O6V A;  4GSW A;  3N30 A;  4KZ0 A;  1WGH A;  4JLC A;  4E71 A;  2O6V B;  1J0G A;  2L0T A;  4BKS D;  1J8C A;  3H1U A;  3ZUN A;  2KLG A;  3JYU A;  3ALB A;  3OAW A;  3ZRC A;  4HCP B;  1WX8 A;  4K1R B;  3W1S C;  3OLM D;  4FUL A;  2MRP A;  2KC1 A;  2MBO A;  2MA9 B;  3EEC A;  4F1S A;  1GNU A;  1SE9 A;  3CMM B;  3TBL D;  3Q3F A;  1U4A A;  5DPS A;  4NJ7 A;  3VDZ A;  1WYW B;  2MWS B;  2CHZ A;  3PHW B;  2IY1 B;  3IBE A;  2M0X A;  3DVG X;  2REX A;  1YD8 U;  2RSU A;  3VQI A;  2ZVN A;  3ZO5 B;  5E6N A; 
#chains in the Genus database with same CATH topology
 2WXK A;  4PYZ A;  2JYT A;  3AE9 B;  3PT2 B;  2JUO A;  1ESF A;  3OJ4 B;  3PZD A;  4MGZ E;  1N62 A;  3SDL C;  4JGH B;  4GIV A;  2JU6 X;  3DBR B;  2QC8 A;  1ZUD 2;  4DXF A;  1YN3 A;  1UGM A;  2N1V A;  3EHV A;  3PRZ A;  4DHJ B;  2KXJ A;  1QF6 A;  2I2Y A;  5E6O A;  1QT9 A;  3MP9 A;  3U7Z A;  4L23 A;  1HA5 A;  2RDG A;  1SIF A;  5CHF A;  2MJ3 A;  3AEA B;  2BWF A;  3KH0 A;  4AUQ C;  2DYO A;  4MM3 B;  4MGY E;  2LHE A;  1IP9 A;  3PLV A;  3ZJT A;  2MH7 A;  4K81 A;  2NBW B;  2W54 A;  4WWN A;  5FR3 A;  3GP7 A;  1JWA D;  3TIX A;  2QMT A;  1FNU A;  3M62 B;  3VRB B;  4TV3 A;  5LXI B;  2K1F A;  4RGT A;  3IT4 B;  3JSV A;  4LK0 M;  3RNC C;  3I3T B;  3VR8 B;  4PS7 A;  3L0W B;  1WXV A;  2NBU A;  3KUD B;  4M8N A;  3P4P B;  3T3N A;  2DEN B;  1YJ1 A;  2MCN B;  4II3 B;  3R66 C;  4ITK A;  3V6E B;  2FCM A;  2Y5P A;  1WH3 A;  1UWX A;  1VZ8 A;  4E74 A;  3DBS A;  4C56 C;  4G11 A;  2X8X X;  1ZXI A;  1HE8 A;  3EC8 A;  2IPK D;  1WXS A;  3GS2 A;  2L00 B;  4LNI A;  2DHZ A;  2WXH A;  1SE2 A;  4W9I A;  1AW7 A;  3HVZ A;  1C4C A;  4JX1 C;  3AE2 B;  1I4G A;  1VZ6 A;  3EUB 2;  4EZJ A;  1N5W A;  4JIO U;  2K5P A;  2H89 B;  4ICU A;  1TYG B;  3NVW A;  5G55 A;  1FFV A;  2KT7 A;  3GB1 A;  4WJO A;  2MP2 A;  4TQ0 A;  1J19 A;  2OED A;  4L2Y A;  4US9 A;  1QQR A;  3DHH C;  4ASW C;  1L7Y A;  2AYO B;  3QQ8 B;  2KO3 A;  1ZE3 D;  3VTU A;  1XD3 B;  5KHO A;  3R2T A;  4I6N B;  1V6E A;  1WGD A;  2MBB B;  4WQM A;  2TSS A;  2LVP A;  4JQW C;  4C4V A;  2FCN A;  1C77 A;  1OTR B;  1WGR A;  3R8B A;  2CU3 A;  2KN5 A;  4RCO A;  1FXT B;  3H7P A;  4PT5 A;  2Z8L A;  4YSY B;  2R61 A;  5EE3 A;  4AQ7 A;  4K7S A;  5D3D A;  4M0W B;  5HFY A;  2BS2 B;  3VVW B;  2C7M B;  5D3I B;  5C3J B;  3AE5 B;  5CX3 A;  1XEE A;  2JVC A;  2WDR B;  2B3A A;  1E8W A;  3UQA A;  3CST A;  4OZC A;  1L4D B;  2PW9 A;  2V3P A;  2WP9 B;  4NZL B;  2KWD A;  2ASQ A;  3TEW A;  1TIF A;  5AZH A;  1GC7 A;  1I4P A;  2KDF B;  4FJV B;  1GUA B;  2NVU I;  2LGS A;  3FIL B;  5BYR A;  4NPN A;  2G3Q B;  2J52 A;  5AUI A;  3PRP B;  5GMV A;  3WA0 A;  4ANV A;  3GZN I;  1KH0 A;  5FKA C;  4BZA A;  3I63 C;  1WJ4 A;  2WX1 A;  1NBF C;  2DYM A;  1N61 A;  3CSF A;  2IJ0 A;  4RGM A;  3WAP A;  2ON8 A;  5G2N A;  1TY2 A;  1YOV B;  5FK9 C;  3H8H A;  3VUW A;  4P16 A;  2FE8 A;  3W1S A;  2HTM E;  4KZC A;  1HEZ E;  4P1B C;  3IG3 A;  4S17 A;  2KLC A;  2LXA A;  1UZX B;  1L6V A;  2V4L A;  2L8J A;  1ISN A;  3AB5 A;  4J3O D;  1VJK A;  4HCN B;  4MAC A;  2K22 A;  3W5U B;  3DQV A;  1KLV A;  1SB3 C;  4L1B A;  2OJR A;  2RPV A;  4MH8 A;  2MP2 B;  1UGJ A;  4EZL A;  3V60 A;  5IN7 A;  1GB4 A;  5DPR A;  4IW0 A;  2ZPN A;  3IVF A;  4IWP A;  4P7I A;  4MSQ B;  1WF9 A;  4KKJ A;  3R7R A;  1KF6 B;  3K9O B;  2DWQ A;  3APC A;  3QCA A;  3L13 A;  2IYD B;  4DHZ E;  2QSD A;  2OHF A;  2BTE A;  4NNJ B;  3IFW B;  4ACF A;  3PPA A;  1E6E B;  3J9C A;  2PPH A;  4C4V B;  4LTU A;  1AAR A;  3CIR B;  4D2K A;  2HJ1 A;  2JYE A;  3NUH B;  1VR9 A;  1ENF A;  3RYT A;  4ZRP A;  4XX5 A;  2IO1 B;  3RUL A;  3PS6 A;  2MEK A;  3RZF A;  2Y5C A;  3AEF B;  1SXT A;  3APF A;  1JWB D;  1C1Y B;  2C7H A;  2Q5W D;  3MHS D;  1QZE A;  1YQB A;  3ZW3 A;  2FAZ A;  1E7P B;  1BUI C;  2LJ5 A;  2KDM A;  2Z59 B;  4B0M A;  2KQS A;  3EFC A;  5IAA C;  2HE7 A;  2PTL A;  1P3Q U;  1ZP0 B;  3V6C B;  4C80 A;  3M95 A;  2J53 A;  3KVF B;  4K7U A;  4MEL A;  1OQY A;  3LXF A;  2C60 A;  3C0R B;  3VRA B;  3GE8 C;  1QOB A;  4XDD A;  2KQ7 A;  1OQR A;  1BXT A;  3ENE A;  3PSE B;  1E90 A;  3V62 A;  4OW0 A;  4YSX B;  4GDK B;  3Q6B A;  2IND C;  3AH7 A;  4TMA B;  2LD9 A;  1TZO A;  3P42 A;  2XK5 A;  4RMA A;  4ZRJ A;  4A3P A;  1QOF A;  3L16 A;  2N9L A;  4MGK E;  4WWO A;  3ZRF A;  1L4Z B;  2VH2 A;  2M1M A;  5I4D A;  3L08 A;  1V1P A;  1MVK A;  1RFA A;  1E7V A;  4WWP A;  1SJE D;  4QAY A;  3ML9 A;  1Q5W B;  4X57 B;  3NVZ A;  4BOS C;  4W9J A;  1WR1 A;  1CJE A;  2PVO D;  2V3S A;  4XGA B;  1I4X A;  1LFD A;  2UU7 A;  3A1Q B;  1HQR D;  1RAX A;  2O6V A;  2OJW A;  3N30 A;  4KZ0 A;  1WGH A;  4E71 A;  2L0T A;  2LUM A;  1HXY D;  2JZP A;  3JYU A;  1N63 A;  4K1R B;  2G1E A;  2KC1 A;  2MBO A;  5BYQ A;  3I5J C;  4F1S A;  2NMQ A;  1GNU A;  1AWD A;  3TBL D;  3Q3F A;  2KVZ A;  3IBE A;  3DVG X;  1VZ7 A;  1F77 A;  1WGK A;  3ZO5 B;  1NEN B;  1IPG A;  5CHW A;  4NQK E;  3ETR A;  1UBQ A;  4KDI C;  4K3C A;  4IOI E;  4AWJ A;  2IO0 B;  3ZQ4 A;  3AXC A;  3X0W A;  2MHJ A;  5L83 A;  2D11 A;  3DBH I;  5D2M B;  1XXG A;  3UI3 A;  2ZZP B;  3KQ4 A;  1FO4 A;  2WXJ A;  4URK A;  2KVR A;  2M4N A;  3IHP C;  1HZ5 A;  3KYC D;  4GOC A;  2RDH A;  5D6J B;  2O6V D;  3H9D A;  4DDG D;  3NS8 A;  2JZZ A;  3VFK A;  3ZNG C;  1JRP A;  2WHI A;  5AZF A;  2WDV B;  1FRD A;  2KMM A;  3VH4 B;  1WRD B;  1B1Z A;  1E5W A;  2JXX A;  4MJS B;  3AUL A;  4A55 A;  2SAK A;  1WX7 A;  5T8I A;  4DXA B;  1YMH E;  2LAS A;  2E3T A;  4C7Y A;  3PLU A;  3A9J B;  5IOI A;  1JWS D;  4W9H A;  1JW9 D;  4KIK B;  2IGG A;  2WWZ A;  3LYY A;  1WJ6 A;  1Q10 A;  4OVZ A;  1V97 A;  4DHJ D;  1WM2 A;  1KTK A;  2BS4 B;  5D94 A;  2WXF A;  2MLB A;  1V86 A;  1E8Z A;  3RNB C;  2LXC A;  1EUV B;  3B2F A;  2D3C A;  2N4F A;  4ICV A;  2AL6 A;  2LGX A;  3DVG Y;  2NCN A;  1P9D U;  1UF0 A;  3AI5 A;  1ET6 A;  2LMC A;  1TT5 B;  1ET9 A;  3O13 A;  2C9W B;  3DBH B;  4BKG A;  2WXL A;  4FHJ A;  1UUP A;  1NYR A;  2AL3 A;  2CS4 A;  2KDE B;  2D5G A;  3WAM A;  2C5L C;  3SFE B;  3DCG A;  4WUR A;  1E0Z A;  3E9S A;  3ZNH B;  3BY4 B;  4FHK A;  3QHT A;  1YN5 A;  3KWV A;  2BYT A;  4IWO A;  2M56 B;  1XLN A;  1WZ0 A;  5EE9 A;  2KFJ A;  4H2A A;  4NY0 A;  4RM9 A;  2I1K A;  4FAD A;  2SEB D;  3N3K B;  3Q14 C;  4LDT D;  1WJU A;  3BK1 A;  3RFZ B;  3ZIM A;  4DQO C;  3ZVV A;  1OEY A;  3IT6 B;  3KLS X;  1BML C;  1PGB A;  1CK1 A;  2AQ1 B;  2PE9 A;  4ZRI A;  1JAL A;  5AEK B;  4A20 A;  2BYF A;  4HPP A;  4HKZ E;  2MJE A;  2KJH B;  4PS3 A;  2NTS A;  3ZTC A;  1K8R B;  4NAW A;  4Q2J A;  1R7S A;  1SF0 A;  1M94 A;  2AQ2 B;  1I7H A;  2IO3 B;  3ML8 A;  2KFK B;  3VUY A;  3VHT C;  2ZPY A;  2OOB B;  4M0W A;  4W9C A;  3U30 A;  1XLP A;  2XEW A;  1FXA A;  2KOX A;  4WAA A;  4BBN C;  2FIF A;  2BVC A;  1OQQ A;  1T6B X;  1D5M C;  1MHH E;  4MEM A;  5JXV A;  2AWT A;  4M01 A;  1EF1 A;  1PFD A;  2W3R A;  2K25 A;  1EM7 A;  3C19 A;  2E6X A;  5KHQ A;  1D4B A;  3FIL A;  2QDF A;  3SFD B;  4GLS C;  1XQQ A;  3NG0 A;  2ZNV C;  2LGD A;  4RM8 A;  1PUT A;  4CO7 A;  2ICI A;  2CJO A;  1TTN A;  4LDT B;  4HJK A;  4ZOH C;  3TEY A;  3AED B;  1STE A;  4A8X C;  2WXM A;  4FLH A;  2DAF A;  2L05 A;  2RMM A;  5IKC M;  2R2Q A;  4HEA 1;  3U7D A;  2YEP F;  1MPE A;  4GMV A;  2LGY A;  2ZVO A;  1H4R A;  3HHM A;  3RNE C;  3I9V 1;  3QAR A;  1C4A A;  1RFK A;  1TY0 A;  4RF0 A;  2GOW A;  1VDV A;  1WJN A;  2N1W A;  4FXC A;  4WH4 A;  4KDL B;  3UGB B;  2A5U A;  4LJO B;  2KD0 A;  2N0S B;  3AV8 A;  5J18 A;  2CHW A;  3TMP B;  3HVD A;  3HM6 X;  5G5G A;  2CJN A;  4ANX A;  3M63 B;  1WR6 E;  2N7J A;  1YX5 B;  5CHV C;  2Y5B B;  2WNM A;  4A3O A;  1V8C A;  4MT5 A;  3RI7 C;  3H7S A;  2EKE C;  1TGZ B;  1OGW A;  3BIN A;  4WQO B;  1WGY A;  1KLG D;  2I38 A;  1T5X D;  1K50 A;  1WSP A;  5MPO A;  1AN8 A;  1DOY A;  2QIL A;  1C9F A;  2KWC A;  2WU5 B;  2JRI B;  1V81 A;  1F9J A;  1C3T A;  4I6P A;  3EFU A;  2GBM A;  4NAW B;  2V9H A;  2VZK D;  1WIA A;  3L17 A;  1JWU D;  3DBL B;  1I4R A;  2JX5 A;  2UYZ B;  4LNO A;  3HK0 A;  3B2G A;  1WXM A;  1UBI A;  2ZNV B;  1V9J A;  4OVV A;  3PVL A;  2J0J A;  2LVO A;  3DVN U;  3V61 A;  1K51 A;  1CMX B;  3QWZ B;  3GOE A;  1WI0 A;  4B9K A;  2AX5 A;  4OHJ A;  1F2R I;  3BVZ A;  2K6Q A;  2KC2 A;  3CWI A;  2W55 A;  1T0Y A;  3TEX A;  1Z2M A;  4YTN B;  2DNF A;  2JWZ A;  3S2A A;  2I1J A;  4HRS A;  1JWM D;  3KUZ A;  1TKG A;  3B0A A;  2KJR A;  4BFR A;  3MFG A;  2ONQ A;  1HTO A;  3UQB A;  1YJJ A;  3N1Z C;  1XF5 L;  3ECI A;  3JW0 X;  4GDK A;  2LRW A;  2N9P C;  4IM0 A;  5J2R A;  3AEG B;  2GLS A;  2LJI A;  2JWU A;  3ZNZ B;  1UWM A;  2YVC A;  4ZRQ A;  2FUH B;  2M8S A;  3NOB A;  2ZW0 A;  1MI0 A;  5D7G A;  4XYC A;  1XLO A;  2IY0 B;  2GB1 A;  2K8B A;  5IO9 A;  3AE3 B;  3RN9 C;  1PDX A;  1KOT A;  4II2 B;  4JWU C;  3AEC B;  2KTF A;  2O2V B;  4N59 A;  4DHZ B;  4HWI B;  4NQL B;  2VZK B;  3A1Q A;  2IGH A;  3FKY A;  5DCN A;  4EEW A;  2L3Z A;  1NYQ A;  5J17 A;  5H8Y E;  4C7Z A;  3AE1 B;  1J0G A;  3N1Y C;  1J8C A;  1IBX B;  3OAW A;  1JCK B;  4HCP B;  1FFU A;  3W1S C;  2BS3 B;  3OLM D;  4FUL A;  3BII D;  3EEC A;  2WXN A;  4IKG A;  2CHZ A;  2IY1 B;  4WWM A;  2M0X A;  1YD8 U;  1DOI A;  2ZVN A;  3TEZ A;  2L1A A;  4RF1 A;  2INC C;  3D32 A;  2V1Y A;  1EO6 A;  2FCQ A;  2Y3A A;  3Q8F A;  2MW5 A;  1V1O A;  1SIJ A;  2L83 A;  1C4P A;  2AEH A;  4TKN A;  3LB8 C;  1FXI A;  4PK1 A;  2NR2 A;  4G50 A;  3PO0 A;  4YL8 A;  1YIW A;  4ZHO A;  2KAN A;  2K8H A;  4YTP B;  1KFY B;  1N60 A;  1R4M B;  3R7Q A;  3PTF C;  3VTV A;  4K3B A;  3AMZ A;  3ZXR A;  3ZJU A;  2WU2 B;  2DLB A;  3NZU A;  2UWQ A;  3OWE B;  3Q3N C;  4AJY B;  2WXQ A;  4MGI E;  4WJN A;  2AQ3 B;  5BYS A;  1ZGU B;  2BGF A;  3WAL A;  2FBW B;  3Q3O C;  2LHD A;  3DOW A;  4FN2 A;  2EMT A;  4MJS A;  1E8Y A;  1S3S G;  1NI3 A;  1GAQ B;  4M02 A;  1F0Z A;  2PE6 B;  4W9G A;  1F1H A;  3B08 A;  1J7C A;  3ZNI D;  1QKZ A;  3TL5 A;  2FUG 1;  2KYW A;  3TSS A;  3A9J A;  1SBB B;  3DHG C;  4KIK A;  4KGR A;  4YXD B;  2PJH A;  5HKH A;  1ZDX A;  1RLF A;  1OEY J;  1GOZ A;  2KQ4 X;  1YNT E;  1WMH A;  2NTT A;  1RRB A;  2PVG C;  3B1L X;  3R2I A;  4B95 A;  3ZDM C;  3LJ3 A;  4TSS A;  4DK5 A;  2D3G A;  2M17 A;  3UF8 A;  1VD2 A;  4O1N A;  1M4V A;  2WLB A;  3HIZ A;  2N7E A;  3X23 A;  4W9F A;  3TUO A;  4G0N B;  4ZYN A;  2RR9 A;  4ARC A;  2RGF A;  5EE0 A;  1ZKH A;  4GB9 A;  3DHI C;  2GBK A;  4KGT A;  4YTM B;  1GB1 A;  1FIQ A;  1WWT A;  1PGX A;  3OJ3 A;  3ZJV A;  2V4I B;  3AE8 B;  2VH1 A;  3RUI B;  4EZK A;  3MTN B;  1J7B A;  3KW5 B;  3RCZ A;  2CKH B;  3EGR A;  2A4Z A;  2JZ3 B;  3B9J A;  4GU2 A;  2G4S A;  1HZ6 A;  2FCS A;  3QAQ A;  1K53 A;  4HLE A;  2BB5 A;  1D3Z A;  2DYB A;  5FR6 A;  4HXD A;  1E8X A;  3KYD D;  4HK2 A;  1TBE A;  2LEK A;  4MH0 E;  3QIJ A;  1GPX A;  5HI1 A;  1T0R C;  5EE1 A;  3PZ7 A;  2YLM A;  2L0F A;  3P1M A;  3L4P A;  2J0M A;  2LWP A;  1YN4 A;  3ABV B;  2IO2 B;  5LXH A;  1LXD A;  2KHW B;  2KFK A;  1L0V B;  2WYQ A;  1XT9 B;  1C76 A;  2K8C A;  3MC9 A;  4B6W A;  1P98 A;  3A33 B;  4KX6 B;  1SE3 A;  3V05 A;  3BWU D;  2N9E B;  3ONS A;  1YX6 B;  1KLU D;  1Y56 A;  3AU4 A;  4KSL C;  1TS2 A;  1QOG A;  1WXQ A;  2KAJ A;  2WX0 A;  3W1Y A;  2DZK A;  2ZCB A;  2H88 B;  2KN4 A;  5LLI A;  2BYV E;  1CZP A;  2G4D B;  3A9K B;  3NJT A;  1JRU A;  4WIP A;  1WMH B;  4A90 A;  3DDC B;  2EMS A;  2W3S A;  3SU8 X;  1Q1O A;  2MQJ A;  3SR6 A;  3VXW A;  3NVY A;  2DX5 B;  2HDE A;  2J42 A;  1QIL A;  1WX9 A;  2IBI B;  1X1M A;  1MJD A;  3UIP B;  2LRU A;  4YT0 B;  1WE6 A;  2JXT A;  4LCD E;  5EDS A;  2D10 A;  1PQS A;  1IYF A;  3PHX B;  3VUX A;  3CF6 E;  1ACC A;  2KKC A;  3BK2 A;  4LLG M;  3U8Z A;  2DZJ A;  4DBG A;  2GBR A;  1FNW A;  1GC6 A;  1R4N I;  3Q8B A;  4C00 A;  1RYJ A;  1ZPS A;  5DPW A;  3ZTD A;  4GN1 A;  2L76 A;  3Q8E A;  2ZJD A;  2BB6 A;  1HTQ A;  5E6J A;  2IGD A;  3ZDT A;  4S0R A;  2C7N B;  2XNA C;  2KDB A;  2XBB C;  3W2D A;  1VLB A;  1D5Z C;  1J7A A;  4US8 A;  1GJZ A;  2DBY A;  4IG7 B;  4GXB A;  1TS5 A;  1Y8R C;  2WDQ B;  1V80 A;  4RGO S;  2JY6 A;  3KUC B;  3RNA C;  2N9X A;  3GE3 C;  5H92 C;  1FNV A;  3RMK C;  3PRE A;  3P4Q B;  5BMI A;  2FNJ B;  1IGD A;  1P0R A;  4WJP A;  1A70 A;  2BKR B;  5BMH A;  1GG3 A;  4CYE A;  3PRM B;  4JWS C;  1ZDV A;  1OFF A;  2WXG A;  4G3X B;  2BQQ A;  4NJ6 A;  1FCL A;  2L7R A;  4BBN F;  2HD5 B;  3NZ3 A;  3Q8C A;  4HPM B;  3Q69 A;  3C8Y A;  1VCB A;  2W9N A;  4P6V F;  2CHX A;  1NI2 A;  4PS8 A;  4JPS A;  4HVB A;  2KJ6 A;  3QA8 A;  2LZ6 A;  2BPS A;  1R4N B;  3L54 A;  5C23 A;  5JH5 C;  3QX1 A;  4BOZ B;  3DBL I;  1YQ4 B;  2QEJ C;  4N58 A;  4ARI A;  1JQ4 A;  3O65 B;  3U2S C;  1KM7 A;  2WXI A;  3QK0 A;  4B0E A;  2CR5 A;  1EWC A;  5LNK 1;  2KK8 A;  2DAJ A;  1JRO A;  2WDT B;  2KTR A;  2GBN A;  4F7Z A;  2VRR B;  2O2V A;  4TUU A;  3P4S B;  4W9E A;  2N7D A;  3PZ8 A;  2CU1 A;  3VAW A;  3P2B A;  1YQ3 B;  4PYU A;  3NZS A;  2JRH A;  3UIN B;  5JHB A;  1V5T A;  4GSW A;  4RFB A;  1T0Q C;  2XN9 C;  1IBX A;  3N20 C;  3H1U A;  2IDY A;  4KGS A;  3ZUN A;  2KLG A;  3ALB A;  2ZW1 A;  2MRP A;  1L0X B;  2ACZ B;  5DPS A;  2K3U A;  3VDZ A;  1WYW B;  2MWS B;  1SEB D;  2RSU A;  4N6E B;  4RGN A;  3VQI A;  5E6N A;  3L10 B;  1K52 A;  3NY5 A;  2BW2 A;  4BKT A;  1P7F A;  1SJH D;  1I35 A;  3KWL A;  1ZXH A;  1FMA D;  2MBE A;  4HKQ A;  3BZD B;  4LNF A;  1XCQ L;  1S1Q B;  3DVN V;  1EF5 A;  1F52 A;  3M3J A;  1T0S C;  1F2R C;  5TSS A;  4OZB A;  3H6N A;  2KMC A;  2MBQ A;  4CQN A;  3APD A;  2LFI A;  2WGS A;  2LVQ A;  2MSE D;  1WGG A;  3AM9 A;  1TKE A;  3MC8 A;  1LO5 D;  3U4E G;  1I4Q A;  2BBC A;  3MHZ A;  5BMG A;  1NVI D;  3NHE B;  2BKF A;  2R2O A;  1KJT A;  4AOF A;  2V3N A;  1R4M I;  2PKO A;  1LQB A;  2HJ8 A;  2M19 A;  2INN E;  2YEP B;  4IWQ A;  2RDB C;  4IC7 B;  3JSV B;  2GBJ A;  4HRO A;  5DPT A;  3LDZ E;  3BYT B;  4FBJ B;  1T3Q A;  5TR5 A;  5AZG A;  1UD7 A;  2B76 B;  1QLB B;  2KTR B;  4XC2 A;  2KX3 A;  3DPD A;  2D3A A;  3MJ5 A;  1I42 A;  3UIO B;  3EA6 A;  3WIM A;  2LI5 A;  2INP E;  4XDC A;  1A5R A;  3W9C B;  4JE3 B;  3NRZ A;  2J7Q B;  3DWG C;  3E56 A;  4JL9 A;  4BAX A;  1WM3 A;  1N6Z A;  2NPT A;  4W9K A;  2GI9 A;  3Q2A C;  1UH6 A;  1YJI A;  2JQR B;  4R3D A;  2L52 A;  1V49 A;  4DDI D;  1TS4 A;  1P1A A;  3MJW A;  4FJZ A;  1KRH A;  1EU4 A;  4AS1 A;  4GDL A;  5GXG B;  5C2T B;  3ZYY X;  2EEL A;  2L32 A;  3TCA A;  2Z0E B;  4K7W A;  3SD5 A;  3Q8A A;  2V0G A;  1PGA A;  2KWU B;  1MFW A;  4F8C B;  1UEL A;  1SE4 A;  3SHQ A;  4YSZ B;  4XWW A;  4EUT A;  4FA6 A;  2WXO A;  3NVV A;  4KKI A;  2G9H D;  4TQ1 A;  1D6E C;  2BWE S;  1EWY C;  1L6U A;  2X38 A;  5JHA A;  2BYE A;  3PV1 A;  3RT3 B;  1L2N A;  1SGH A;  2JPH A;  3IXS A;  2W82 A;  2KDI A;  4FJY A;  3A4R A;  3H7P B;  2GMI C;  4LNK A;  1C79 A;  4RH6 A;  2GRI A;  1XCT L;  2K6D B;  1TS3 A;  1UNS A;  1TJE A;  3GZN B;  2D3B A;  5C1Z A;  3I57 A;  1FRR A;  2DZM A;  1VRA B;  3ZKJ C;  1P7E A;  1N5X A;  1B9R A;  2MX2 A;  1DYQ A;  1MG4 A;  4UDU C;  2DZI A;  3BVG A;  2WQY B;  2D2Q A;  3P4R B;  1WY8 A;  4RNA A;  3RZW C;  4WAF A;  4J6I A;  4IUM B;  3R3M A;  1Q0W B;  3FAH A;  3K9P B;  3AU5 A;  3A9K A;  3ZXV A;  1FCC C;  3RNG C;  1Z5S B;  3Q3J A;  4M00 A;  1E10 A;  5E6P A;  2QIE B;  2MJD A;  5CTR C;  3ZLZ A;  2KNB A;  4EKU A;  3V3X A;  4REZ A;  2ZEQ A;  4I6L B;  4EFO A;  1V2Y A;  4E3C A;  5IA7 A;  4XWT A;  3W5V B;  3Q3M C;  5HG2 A;  4OZA A;  4XZ4 A;  4KSK C;  4HPL B;  3PGE A;  1MHX A;  2HTH A;  4DXG A;  2QHO A;  3N32 A;  4W9D A;  2NPT B;  2PMV A;  2PEA A;  4ZRK A;  2NBV B;  1H8C A;  4IM2 A;  4YWG G;  5G5H A;  4LNN A;  4AJW A;  4HDO A;  2LUE A;  4A6Q A;  1AYF A;  3QJZ A;  4GGQ A;  3HRD D;  4ANU A;  2G45 B;  4GDL B;  4WJQ A;  1TZ1 A;  3QC8 B;  3AN1 A;  1IUE A;  1EU3 A;  3VTW A;  4AP4 C;  3BVM A;  4OVU A;  2BF8 B;  3DWM A;  1TKY A;  1RWS A;  2FID A;  3AE4 B;  1WZ3 A;  2PIA A;  1FEH A;  2KZR A;  2M0A A;  4ZDV A;  1XO3 A;  3HM3 A;  1LM8 B;  4ZYS A;  3WAN A;  2KAC A;  1D5X C;  4A9A A;  2J0K A;  1WRI A;  2D07 B;  2WXR A;  3MC0 B;  1FM0 D;  4XE0 A;  2KWV B;  3RNF C;  4M8M A;  1QOA A;  2QJL A;  3A4S C;  3N1X C;  1ZOY B;  4EE2 A;  2K9X A;  4BVU C;  4IM3 A;  4KV2 A;  3URY A;  3JVZ X;  1SSN A;  5L95 C;  1WE7 A;  3AEE B;  2KX0 A;  4HDQ A;  3IAM 1;  2N9K A;  5BO4 B;  3TJP A;  2JF5 A;  1FD6 A;  1MG8 A;  1E7U A;  1DOX A;  3N9Y C;  2J4X A;  2KMA A;  4CHK A;  4ANW A;  2LGI A;  2MBH A;  1IGC A;  3NS1 A;  2PLP A;  2ZCC A;  4N9F 4;  3AEB B;  3AE7 B;  4USA A;  3RPF C;  3SEB A;  1LGR A;  4MM3 A;  4IDI A;  3VR9 B;  2RD0 A;  2JSV X;  4LJP B;  3DBR I;  4DWF A;  1G6J A;  1NEK B;  4BKS A;  3OG5 A;  2BT6 A;  4W9L A;  2RPQ A;  1C78 A;  2NS5 A;  1NDD A;  2Z0D B;  4P1C C;  3T3O A;  3AE6 B;  5AUK A;  3WCQ A;  3WAO A;  3U52 E;  3VH3 B;  3RD2 A;  1V5O A;  1BT0 A;  2EKI A;  1XLQ A;  2XK5 B;  5IP4 D;  2QCZ A;  1ROE A;  4NJC A;  3T9L A;  4MSM B;  3T8M A;  4KVG B;  2K39 A;  1E9M A;  2JT4 B;  1V1P B;  1PYW D;  4MDK E;  3HUI A;  1WXA A;  3IAS 1;  1FPY A;  4HJG E;  1RM6 C;  3P63 A;  1WFY A;  4EOY A;  4ZHP A;  2IZV B;  1L5P A;  5JZE B;  1WYG A;  1ZW7 A;  1L0Y B;  3ZGZ A;  1JML A;  4JLC A;  2O6V B;  1DGJ A;  2WS3 B;  4BKS D;  3ZRC A;  3FC4 A;  1WX8 A;  5HHD G;  2MA9 B;  2WXP A;  3BYY B;  1I4H A;  1SE9 A;  1CQV A;  3CMM B;  1U4A A;  4NJ7 A;  2K0P A;  3PHW B;  2REX A;  4NAM A; 
#chains in the Genus database with same CATH homology
 3L10 B;  1IPG A;  3NY5 A;  5CHW A;  4NQK E;  3D32 A;  2V1Y A;  1UBQ A;  4PYZ A;  4KDI C;  4AWJ A;  1EO6 A;  4BKT A;  2FCQ A;  2IO0 B;  3AXC A;  3X0W A;  3PT2 B;  1I35 A;  2MW5 A;  2JUO A;  3OJ4 B;  5L83 A;  2D11 A;  3DBH I;  3PZD A;  4MGZ E;  2AEH A;  5D2M B;  4TKN A;  3SDL C;  2ZZP B;  4JGH B;  4GIV A;  2MBE A;  2NR2 A;  4G50 A;  1UGM A;  4YL8 A;  1YIW A;  4URK A;  1S1Q B;  2KVR A;  2M4N A;  3IHP C;  2KAN A;  2K8H A;  3DVN V;  2N1V A;  1EF5 A;  3EHV A;  3PRZ A;  3KYC D;  3R7Q A;  3PTF C;  4GOC A;  3VTV A;  4DHJ B;  2KXJ A;  5D6J B;  3M3J A;  2O6V D;  3H6N A;  3H9D A;  2KMC A;  4DDG D;  2MBQ A;  3NS8 A;  2UWQ A;  3NZU A;  4AJY B;  5E6O A;  2JZZ A;  3APD A;  4MGI E;  3VFK A;  3ZNG C;  4WJN A;  1ZGU B;  2LVQ A;  2BGF A;  3WAL A;  5AZF A;  1SIF A;  2MSE D;  5CHF A;  2BWF A;  3KH0 A;  4AUQ C;  1WGG A;  3VH4 B;  3DOW A;  4FN2 A;  1WRD B;  2DYO A;  2EMT A;  1E8Y A;  1S3S G;  1E5W A;  2JXX A;  4MJS A;  4MJS B;  3AUL A;  4MGY E;  1IP9 A;  3PLV A;  4K81 A;  2NBW B;  1WX7 A;  2PE6 B;  4DXA B;  4WWN A;  2LAS A;  4W9G A;  3B08 A;  3NHE B;  2BKF A;  3TIX A;  2R2O A;  3ZNI D;  1KJT A;  3TL5 A;  4AOF A;  1R4M I;  3M62 B;  1LQB A;  4TV3 A;  5LXI B;  3A9J A;  2K1F A;  2HJ8 A;  3PLU A;  3A9J B;  4IWQ A;  3JSV A;  4IC7 B;  4KIK A;  3JSV B;  4W9H A;  2GBJ A;  3I3T B;  4KIK B;  4PS7 A;  2WWZ A;  3L0W B;  5DPT A;  1WJ6 A;  2PJH A;  5HKH A;  1RLF A;  1OEY J;  3LDZ E;  1WXV A;  1WMH A;  2NBU A;  3KUD B;  4M8N A;  4DHJ D;  4FBJ B;  1WM2 A;  1RRB A;  5TR5 A;  5AZG A;  1UD7 A;  3B1L X;  5D94 A;  2MLB A;  1V86 A;  4B95 A;  2DEN B;  3ZDM C;  1YJ1 A;  1E8Z A;  2KTR B;  3LJ3 A;  4XC2 A;  2MCN B;  4II3 B;  4DK5 A;  3R66 C;  2LXC A;  1EUV B;  2D3G A;  2KX3 A;  2M17 A;  3DPD A;  3UF8 A;  3V6E B;  1VD2 A;  2N4F A;  1I42 A;  3UIO B;  3WIM A;  2LI5 A;  4ICV A;  2AL6 A;  2LGX A;  2FCM A;  3DVG Y;  1A5R A;  2NCN A;  1P9D U;  1WH3 A;  3AI5 A;  4E74 A;  3DBS A;  2J7Q B;  4G11 A;  2C9W B;  3HIZ A;  1HE8 A;  4JL9 A;  4BKG A;  2N7E A;  3EC8 A;  3X23 A;  4W9F A;  4FHJ A;  4G0N B;  1WXS A;  4ZYN A;  2RR9 A;  2RGF A;  1WM3 A;  2AL3 A;  2L00 B;  2CS4 A;  1ZKH A;  2KDE B;  4GB9 A;  2DHZ A;  4W9I A;  3WAM A;  2C5L C;  2NPT A;  3DCG A;  4W9K A;  2GBK A;  3ZNH B;  1UH6 A;  1V49 A;  3BY4 B;  4EZJ A;  3OJ3 A;  4JIO U;  4FHK A;  3QHT A;  4DDI D;  4IWO A;  3RUI B;  1P1A A;  4EZK A;  4ICU A;  3MTN B;  1WZ0 A;  3MJW A;  5G55 A;  3KW5 B;  4FJZ A;  2KFJ A;  4NY0 A;  4RM9 A;  3RCZ A;  2CKH B;  4GDL A;  2I1K A;  2A4Z A;  2JZ3 B;  4WJO A;  4FAD A;  2MP2 A;  4GU2 A;  4TQ0 A;  1J19 A;  2G4S A;  3TCA A;  2FCS A;  3QAQ A;  3N3K B;  2Z0E B;  4LDT D;  4K7W A;  3SD5 A;  4ASW C;  1WJU A;  4HLE A;  3ZIM A;  1L7Y A;  2KWU B;  1D3Z A;  2AYO B;  4F8C B;  2DYB A;  1OEY A;  3QQ8 B;  4HXD A;  5FR6 A;  3ZVV A;  1E8X A;  1UEL A;  2KO3 A;  3SHQ A;  3KYD D;  4HK2 A;  1TBE A;  4MH0 E;  3VTU A;  3QIJ A;  2PE9 A;  1XD3 B;  5KHO A;  4I6N B;  4EUT A;  1V6E A;  4ZRI A;  5AEK B;  4A20 A;  2YLM A;  2L0F A;  1WGD A;  4FA6 A;  2BYF A;  2MBB B;  4TQ1 A;  2BWE S;  5JHA A;  2LVP A;  2KJH B;  2J0M A;  2LWP A;  2BYE A;  3PV1 A;  3RT3 B;  4JQW C;  2IO2 B;  1L2N A;  2FCN A;  5LXH A;  1OTR B;  1SGH A;  1WGR A;  2JPH A;  4PS3 A;  3ZTC A;  1K8R B;  4NAW A;  2KN5 A;  1FXT B;  1LXD A;  2KHW B;  1M94 A;  3H7P A;  2KDI A;  4FJY A;  2KFK A;  3A4R A;  3H7P B;  2GMI C;  2IO3 B;  1XT9 B;  2WYQ A;  3ML8 A;  2KFK B;  3VUY A;  3VHT C;  2ZPY A;  2OOB B;  2K8C A;  2K6D B;  4B6W A;  4K7S A;  4W9C A;  3U30 A;  1P98 A;  2XEW A;  4M0W B;  2KOX A;  3A33 B;  4WAA A;  5C1Z A;  3VVW B;  4BBN C;  2N9E B;  2FIF A;  3ONS A;  1YX6 B;  2C7M B;  2DZM A;  3ZKJ C;  5CX3 A;  3AU4 A;  4MEM A;  2JVC A;  2MX2 A;  4KSL C;  2AWT A;  2DZI A;  1EF1 A;  1E8W A;  2B3A A;  3UQA A;  2WX0 A;  3CST A;  3W1Y A;  2D2Q A;  2DZK A;  1WY8 A;  3RZW C;  2ZCB A;  2K25 A;  4J6I A;  2ASQ A;  4IUM B;  3R3M A;  1Q0W B;  5LLI A;  5AZH A;  1GC7 A;  2KDF B;  3K9P B;  2BYV E;  4FJV B;  3AU5 A;  3A9K A;  5KHQ A;  1GUA B;  2G4D B;  3A9K B;  2NVU I;  1JRU A;  1WMH B;  3DDC B;  2EMS A;  4NPN A;  1XQQ A;  2G3Q B;  3SU8 X;  1Z5S B;  2ZNV C;  1Q1O A;  3Q3J A;  2LGD A;  2MQJ A;  4RM8 A;  5E6P A;  3PRP B;  3VXW A;  4CO7 A;  5CTR C;  3ZLZ A;  2KNB A;  4EKU A;  5GMV A;  2DX5 B;  2ZEQ A;  1TTN A;  4LDT B;  3GZN I;  4HJK A;  3WA0 A;  4ANV A;  1WX9 A;  4I6L B;  4EFO A;  1V2Y A;  2IBI B;  1WJ4 A;  4E3C A;  1X1M A;  5IA7 A;  2WX1 A;  4FLH A;  2DAF A;  2L05 A;  2LRU A;  3UIP B;  1NBF C;  2DYM A;  2R2Q A;  3CSF A;  3WAP A;  3U7D A;  1WE6 A;  4XZ4 A;  4LCD E;  5G2N A;  4KSK C;  4GMV A;  5EDS A;  2D10 A;  1PQS A;  2LGY A;  2ZVO A;  1H4R A;  3PGE A;  4HPL B;  3HHM A;  1IYF A;  3PHX B;  3VUX A;  3CF6 E;  3VUW A;  2HTH A;  3QAR A;  2KKC A;  3W1S A;  2QHO A;  3N32 A;  2GOW A;  1WJN A;  2N1W A;  4KZC A;  4W9D A;  3U8Z A;  2NPT B;  3IG3 A;  2KLC A;  2DZJ A;  2LXA A;  4KDL B;  4DBG A;  3UGB B;  2A5U A;  2PEA A;  1UZX B;  4LJO B;  2V4L A;  2GBR A;  4ZRK A;  2NBV B;  2L8J A;  1H8C A;  2KD0 A;  1ISN A;  1GC6 A;  1R4N I;  4IM2 A;  5J18 A;  2CHW A;  3TMP B;  4AJW A;  3HM6 X;  4HDO A;  4HCN B;  2LUE A;  5DPW A;  4ANX A;  3QJZ A;  3ZTD A;  4GGQ A;  3DQV A;  3M63 B;  1KLV A;  4ANU A;  4GN1 A;  1WR6 E;  2L76 A;  2G45 B;  1YX5 B;  2OJR A;  2Y5B B;  4GDL B;  2ZJD A;  4WJQ A;  5CHV C;  4A3O A;  1TZ1 A;  3QC8 B;  2MP2 B;  3ZDT A;  4EZL A;  3V60 A;  5DPR A;  3VTW A;  4IW0 A;  2ZPN A;  3H7S A;  3IVF A;  2C7N B;  2EKE C;  4IWP A;  1TGZ B;  2BF8 B;  4MSQ B;  1OGW A;  2KDB A;  4P7I A;  2XBB C;  1WF9 A;  4OVU A;  3BIN A;  4WQO B;  3R7R A;  1WGY A;  2FID A;  1WZ3 A;  2KZR A;  3K9O B;  3APC A;  4ZDV A;  1GJZ A;  3HM3 A;  4IG7 B;  1LM8 B;  4GXB A;  3QCA A;  3WAN A;  3L13 A;  2IYD B;  1Y8R C;  4DHZ E;  2KWC A;  2J0K A;  1V80 A;  2D07 B;  2JY6 A;  3KUC B;  4NNJ B;  2JRI B;  1V81 A;  2KWV B;  3IFW B;  4M8M A;  3PPA A;  2N9X A;  1F9J A;  1C3T A;  4I6P A;  2PPH A;  1AAR A;  3A4S C;  2GBM A;  3EFU A;  4NAW B;  4BVU C;  3PRE A;  2FNJ B;  4IM3 A;  4KV2 A;  3RYT A;  4WJP A;  1P0R A;  4XX5 A;  2BKR B;  2IO1 B;  3JVZ X;  3RUL A;  1WIA A;  3L17 A;  5L95 C;  4AP4 C;  3PS6 A;  1WE7 A;  1GG3 A;  2KX0 A;  4HDQ A;  3RZF A;  4CYE A;  2UYZ B;  3PRM B;  5BO4 B;  3APF A;  3HK0 A;  1WXM A;  1C1Y B;  2C7H A;  1UBI A;  3MHS D;  4G3X B;  2ZNV B;  1QZE A;  1V9J A;  1YQB A;  2JF5 A;  1MG8 A;  2FAZ A;  3PVL A;  4OVV A;  1E7U A;  2J0J A;  3ZW3 A;  2LVO A;  3DVN U;  4NJ6 A;  3V61 A;  2LJ5 A;  1CMX B;  2KMA A;  2Z59 B;  3GOE A;  3QWZ B;  4ANW A;  2L7R A;  1WI0 A;  4CHK A;  4B9K A;  3TJP A;  4BBN F;  2KQS A;  2HD5 B;  2MBH A;  5IAA C;  2K6Q A;  2ZCC A;  4HPM B;  4N9F 4;  2KC2 A;  1VCB A;  2HE7 A;  2W9N A;  1P3Q U;  1T0Y A;  3V6C B;  2CHX A;  3M95 A;  1NI2 A;  1Z2M A;  4MM3 A;  2JWZ A;  4PS8 A;  3S2A A;  2RD0 A;  4HVB A;  2I1J A;  2KJ6 A;  3KVF B;  3KUZ A;  3QA8 A;  4K7U A;  1OQY A;  3DBR I;  4LJP B;  4MEL A;  3B0A A;  2C60 A;  3C0R B;  4DWF A;  1G6J A;  2KJR A;  4BFR A;  2LZ6 A;  4BKS A;  3UQB A;  2BPS A;  4W9L A;  2KQ7 A;  2RPQ A;  2NS5 A;  1NDD A;  2Z0D B;  3L54 A;  5C23 A;  3PSE B;  3ENE A;  5JH5 C;  3ECI A;  3JW0 X;  3QX1 A;  1E90 A;  4BOZ B;  4GDK A;  3DBL I;  3V62 A;  4GDK B;  2LRW A;  2N9P C;  4IM0 A;  3WAO A;  5J2R A;  3O65 B;  1KM7 A;  3ZNZ B;  3VH3 B;  2YVC A;  2LD9 A;  2FUH B;  2M8S A;  3RD2 A;  3QK0 A;  3NOB A;  2CR5 A;  2XK5 A;  4RMA A;  4ZRJ A;  4A3P A;  1V5O A;  1BT0 A;  2XK5 B;  5D7G A;  2KK8 A;  3L16 A;  4MGK E;  2IY0 B;  4WWO A;  3ZRF A;  2K8B A;  3T9L A;  2DAJ A;  2M1M A;  2WDT B;  2KTR A;  4MSM B;  1KOT A;  4II2 B;  3T8M A;  2GBN A;  3L08 A;  4KVG B;  2K39 A;  2VRR B;  4F7Z A;  1RFA A;  2JT4 B;  2O2V A;  1E7V A;  2KTF A;  4WWP A;  2O2V B;  3ML9 A;  4MDK E;  1Q5W B;  4TUU A;  1WXA A;  4X57 B;  4DHZ B;  4W9E A;  2N7D A;  4HWI B;  4NQL B;  4BOS C;  4W9J A;  2CU1 A;  3VAW A;  1WR1 A;  1WFY A;  4EOY A;  3P2B A;  2V3S A;  3A1Q A;  1LFD A;  2IZV B;  3A1Q B;  4PYU A;  5JZE B;  3NZS A;  5DCN A;  2JRH A;  3UIN B;  1RAX A;  4EEW A;  1ZW7 A;  2L3Z A;  5JHB A;  1V5T A;  5J17 A;  2O6V A;  4GSW A;  3N30 A;  4KZ0 A;  1WGH A;  4JLC A;  4E71 A;  2O6V B;  1J0G A;  2L0T A;  4BKS D;  1J8C A;  3H1U A;  3ZUN A;  2KLG A;  3JYU A;  3ALB A;  3OAW A;  3ZRC A;  4HCP B;  1WX8 A;  4K1R B;  3W1S C;  3OLM D;  4FUL A;  2MRP A;  2KC1 A;  2MBO A;  2MA9 B;  3EEC A;  4F1S A;  1GNU A;  1SE9 A;  3CMM B;  3TBL D;  3Q3F A;  1U4A A;  5DPS A;  4NJ7 A;  3VDZ A;  1WYW B;  2MWS B;  2CHZ A;  3PHW B;  2IY1 B;  3IBE A;  2M0X A;  3DVG X;  2REX A;  1YD8 U;  2RSU A;  3VQI A;  2ZVN A;  3ZO5 B;  5E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...