1WJUA

Solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
GSSGSSGDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords NEDD8 ultimate buster-1
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjuA00
1UD7A 3APFA 4KDIC 3QHTA 4M8MA 3WIMA 3PHWB 2O6VA 3UGBB 3TL5A 2NR2A 2LZ6A 2O6VD 4LDTB 4XX5A 2ZPYA 3DBSA 4EKUA 1WGRA 2K25A 1E5WA 3UQAA 4FLHA 2YVCA 1WF9A 3ONSA 5C23A 3ZDTA 2M4NA 1D3ZA 1WGGA 1WR1A 4NNJB 3VUWA 3M95A 3S2AA 4A3PA 1GNUA 2EMTA 1J0GA 2LJ5A 4WJQA 4WJNA 2MBEA 3QK0A 3IBEA 4GMVA 3ZRCA 1TBEA 2KDEB 3P2BA 4K81A 1AARA 3QC8B 2DAFA 1WX8A 4BVUC 2GMIC 2M8SA 2O6VB 2GBNA 1MG8A 1WE6A 4BKSA 3EC8A 4CO7A 1VD2A 2L05A 3AULA 3DVNU 3QIJA 4MELA 3KVFB 2DAJA 1QZEA 2DENB 2CHXA 3HHMA 2K8CA 4HK2A 3QA8A 2KFKA 3SDLC 3VFKA 4DK5A 4HCPB 4MJSB 4ASWC 2MBQA 2C60A 3PSEB 4IW0A 5HKHA 3ZLZA 2LXCA 2DZIA 1UZXB 2D11A 3M62B 3W1YA 1P0RA 2LUEA 3RCZA 3HIZA 4RM8A 1OQYA 2MLBA 4KZCA 3QAQA 3V6CB 1WZ0A 2N7EA 3A9JB 4GSWA 2IZVB 3PRZA 2J0KA 4ICVA 3TIXA 2CKHB 4HDQA 3UIOB 1WGDA 2AL3A 4GN1A 2MQJA 2KWCA 2K6DB 1YQBA 1WRDB 2MCNB 2FCQA 2KLCA 2K6QA 3KW5B 1WX9A 1V80A 2MBBB 1TZ1A 4DWFA 3VAWA 4MM3A 1M94A 2G3QB 1P3QU 1LXDA 2KDIA 3L54A 1WY8A 2JRIB 2RPQA 4OVVA 3W1SC 1F9JA 3NOBA 2UWQA 1OEYJ 4CYEA 4F1SA 3UF8A 3ZTCA 5DPTA 1WMHA 2FCNA 2NVUI 3PHXB 2RGFA 1E8WA 2MX2A 4KVGB 1SE9A 2C9WB 2KFJA 3QX1A 3H7SA 1I35A 4K7WA 2KLGA 2OOBB 4ZRJA 2RR9A 3OAWA 1Z2MA 3H9DA 2CHWA 1RFAA 1V49A 2IO1B 2KFKB 2IY0B 4W9FA 4XZ4A 2R2OA 3UINB 4GDLA 4MJSA 1SGHA 2LD9A 3H7PB 4AP4C 3PT2B 2JWZA 4EZJA 4TV3A 4ANXA 2GBRA 5JH5C 2C7NB 2N9EB 2FNJB 2MWSB 1ZW7A 3K9OB 4EEWA 2LWPA 1JRUA 4PYZA 3KYCD 3WANA 3TMPB 2L0FA 1TTNA 3JVZX 2YLMA 3DBRI 4W9IA 1WXVA 3WALA 2ZNVB 4NAWB 1V86A 1Y8RC 2KC1A 4WWOA 3RZWC 4DHZB 1XT9B 2LXAA 5IAAC 3CMMB 2KZRA 3ZRFA 2ZNVC 3PV1A 2LGDA 2XEWA 4ANUA 1OEYA 4BBNF 2ASQA 2BF8B 4W9HA 2KOXA 4EZLA 2C5LC 2I1JA 2KTFA 2DZMA 2NPTB 3GZNI 1YD8U 2JRHA 2N7DA 2ZCBA 3JSVB 1GJZA 4WQOB 4ICUA 3ZVVA 1GUAB 2KD0A 3NHEB 5CTRC 4MGYE 4A20A 1IYFA 2CHZA 2JY6A 3PLVA 4NQLB 4IM3A 5EDSA 2FCSA 2FCMA 4GGQA 2IYDB 1KJTA 4DXAB 2KDBA 4EUTA 1H4RA 2EMSA 4HDOA 1NBFC 3V61A 3R7QA 1KLVA 4KV2A 4MGZE 5D7GA 1WIAA 2KVRA 3KH0A 4BKSD 3RULA 4I6NB 2KDFB 2EKEC 2DZKA 4HXDA 4TUUA 2IO2B 2L8JA 4W9DA 4JL9A 2V3SA 1EUVB 2VRRB 4DHJB 2AL6A 4GDLB 3GOEA 3A4SC 1U4AA 1IP9A 1LM8B 3X0WA 3N3KB 3U7DA 1P98A 4GIVA 3NZSA 2REXA 2NPTA 3HM3A 3DDCB 4PYUA 2HTHA 4HWIB 1LFDA 2KO3A 2MRPA 2ZVOA 2KWUB 4W9CA 4TQ1A 3EHVA 4IG7B 4ZRKA 2LI5A 4K1RB 4AJWA 3L16A 4P7IA 3MTNB 3VUYA 4GXBA 2J7QB 4KSLC 1IPGA 4OVUA 1UBIA 2M0XA 4NJ6A 2N1VA 3OJ3A 3PZDA 4IUMB 4JLCA 3L13A 2BPSA 3QARA 4G11A 4NPNA 5D94A 1WJ6A 4F8CB 1KOTA 4IWQA 4WWPA 3RZFA 2RSUA 3A9KB 4MGIE 3CSTA 2N9PC 3ZNZB 4ANWA 3KUCB 4DDID 3EFUA 4AJYB 3B1LX 4NQKE 3B08A 3T8MA 1GC7A 4DBGA 2FIFA 3DVGX 3JSVA 3WAMA 2PE6B 3N32A 4KDLB 3PREA 1V5TA 2BKFA 1E8ZA 3W1SA 2B3AA 3KYDD 3R66C 2R2QA 1E8XA 1WXAA 1WR6E 3APCA 3ECIA 3HM6X 3ENEA 1UELA 3PGEA 4WWNA 2KWVB 5KHQA 1P1AA 2K1FA 2AYOB 2KKCA 4NJ7A 3K9PB 5CHWA 1V81A 4W9GA 5J18A 2JZ3B 3U8ZA 2ZZPB 5JZEB 2GBJA 3WAOA 3VVWB 2NCNA 1XQQA 2WDTB 4EOYA 1UBQA 4TQ0A 2BWES 1V9JA 3OJ4B 2M17A 2N4FA 4YL8A 1G6JA 1NDDA 5C1ZA 1WX7A 1WM2A 3V60A 5JHBA 4FHJA 2PE9A 4G3XB 1OGWA 3DVNV 3DVGY 2KN5A 3IVFA 1S1QB 4I6PA 1ISNA 2LVPA 1WGYA 2W9NA 4URKA 3PRMB 4GDKB 3B0AA 3BINA 4IWPA 2J0JA 2BKRB 1SIFA 2A5UA 3RD2A 3ZTDA 3PRPB 1E8YA 3O65B 5J2RA 4HCNB 1S3SG 4HPLB 1T0YA 2J0MA 4HJKA 1V6EA 2JUOA 2KX3A 3L10B 4ZRIA 4MSMB 2MBOA 2O2VA 3L0WB 4B9KA 2L00B 2KMAA 4RMAA 2NBVB 3EECA 3TJPA 2LRWA 5LXHA 2CS4A 2L0TA 3ZNHB 4CHKA 2GOWA 1EF1A 4E71A 4W9KA 4IC7B 2LGXA 2G4SA 1I42A 2GBKA 2PPHA 1ZKHA 3X23A 4FADA 3KUDB 2XK5A 4MSQB 1OTRB 4LDTD 1Q0WB 3ZNID 5AEKB 2HD5B 3Q3FA 4W9LA 2ZJDA 3VH3B 4X57B 4LCDE 1WFYA 2KHWB 4N9F4 2DYMA 5DPSA 2NS5A 3ML9A 2NBWB 4M8NA 5DPRA 4FHKA 3RT3B 3ZUNA 2MP2A 3A33B 2KJHB 1V2YA 2KJ6A 4WJOA 3MJWA 5CX3A 3VDZA 3APDA 4MDKE 1WI0A 4W9EA 1K8RB 3V6EB 3L08A 3VTWA 2NBUA 5TR5A 3H6NA 2DYOA 2WYQA 3CF6E 1NI2A 3T9LA 1YX6B 1PQSA 2D07B 2KJRA 2ZEQA 1UGMA 4WJPA 4DHZE 1ZGUB 2KXJA 4GDKA 1UH6A 1YX5B 5DPWA 3UIPB 1J19A 2BYVE 2UYZB 4FJZA 4KZ0A 5E6NA 1WJUA 2L76A 1GC6A 3DQVA 4G50A 5JHAA 2G4DB 1E7UA 4FJVB 3H7PA 4LJOB 4NY0A 5DCNA 1CMXB 2C7HA 5CHFA 3DOWA 2MP2B 2DYBA 3IG3A 3SD5A 4B6WA 2XBBC 4JQWC 2DZJA 3R7RA 3LDZE 4AWJA 2KC2A 4TKNA 2QHOA 2WX0A 4J6IA 2JZZA 1VCBA 1BT0A 1WGHA 1RAXA 2MA9B 1J8CA 1L7YA 3WAPA 1LQBA 5G55A 3A9JA 3QQ8B 4PS3A 3LJ3A 4IM0A 2D10A 3CSFA 2BWFA 3SU8X 2M1MA 1E7VA 2LRUA 2C7MB 2KTRB 1Z5SB 4FJYA 1Q1OA 4IM2A 3VTUA 1R4NI 5IA7A 3NS8A 2KANA 4JIOU 3HK0A 5AZFA 2JT4B 5E6OA 3D32A 4DDGD 3TBLD 4KSKC 1X1MA 1C1YB 5G2NA 2JF5A 3ZNGC 3A1QB 1WJ4A 2JXXA 2KQ7A 2LVOA 4B95A 3JYUA 2ZCCA 1L2NA 3NY5A 2JPHA 2ZVNA 3OLMD 4FULA 5L83A 1R4MI 1WMHB 3ALBA 4BOSC 4GU2A 3VHTC 5AZGA 1HE8A 4PS7A 3VTVA 1KM7A 2IY1B 2G45B 2Y5BB 2O2VB 4M0WB 3IHPC 3MHSD 2WX1A 3C0RB 2IBIB 4WAAA 1WZ3A 2I1KA 4PS8A 2KNBA 2PEAA 3U30A 2AEHA 3M63B 5LLIA 2V1YA 3PVLA 2FAZA 3AU4A 3PLUA 4BBNC 2XK5B 4RM9A 3A4RA 2MBHA 2KX0A 3H1UA 2LASA 2FIDA 4GB9A 4I6LB 4K7SA 1XD3B 4E3CA 4II3B 4W9JA 2CU1A 2LGYA 2GBMA 4MEMA 3VH4B 4EZKA 4IWOA 1WJNA 5CHVC 2N9XA 1FXTB 2MW5A 3NZUA 4K7UA 3AU5A 4F7ZA 4FBJB 1EF5A 1A5RA 2DHZA 4BKTA 3SHQA 2KK8A 2D2QA 2Z0EB 3QWZB 3ZIMA 1EO6A 2BYFA 2KTRA 4FN2A 4HVBA 2MSED 5GMVA 4ANVA 3L17A 4G0NB 1WH3A 1H8CA 4A3OA 4E74A 4ZDVA 1WXSA 4BKGA 2K8HA 2L3ZA 4BFRA 3AXCA 4MH0E 1C3TA 3WA0A 3DBHI 3QJZA 3KUZA 1P9DU 1RRBA 5D6JB 3VUXA 1RLFA 3Q3JA 2V4LA 5E6PA 3VQIA 5L95C 3PPAA 1WE7A 2L7RA 3BY4B 4LJPB 3ZW3A 3QCAA 3TCAA 3ZO5B 3PS6A 2K39A 2Z0DB 3DBLI 5BO4B 2JVCA 4GOCA 4NAWA 2BGFA 2D3GA 1TGZB 2DX5B 3V62A 2HE7A 2A4ZA 2IO0B 2KQSA 3M3JA 2AWTA 4FA6A 3AI5A 4AOFA 1YJ1A 4II2B 2BYEA 4MGKE 5LXIB 2IO3B 1GG3A 5J17A 4KIKB 5FR6A 4AUQC 2K8BA 2LVQA 3N30A 4EFOA 2N1WA 4ZYNA 3R3MA 4HPMB 3UQBA 3DPDA 2PJHA 5KHOA 5AZHA 3VXWA 3DCGA 1Q5WB 4JGHB 2RD0A 3PTFC 2Z59B 3ZDMC 1WM3A 3ML8A 1WYWB 1WXMA 3A1QA 4XC2A 2WWZA 1YIWA 1E90A 2OJRA 5D2MB 2FUHB 4DHJD 3I3TB 3ZKJC 3RYTA 3A9KA 1V5OA 2ZPNA 2KMCA 2HJ8A 2CR5A 3IFWB 3JW0X 4KIKA 4BOZB 4HLEA 3RUIB
chains in the Genus database with same CATH superfamily
4MACA 3B2GA 4M8MA 1QOAA 3NUHB 3PHWB 2O6VA 4KKIA 1N63A 4XX5A 1T0SC 2K25A 3UQAA 1N61A 1WF9A 2M0AA 2NMQA 1F52A 4NNJB 1CQVA 3VUWA 1FD6A 1KF6B 1GNUA 4WJQA 1N62A 4WJNA 4WIPA 4GMVA 2KDEB 4K81A 2E3TA 3LYYA 2BQQA 2GMIC 1MG8A 4CO7A 4AQ7A 3EC8A 5TSSA 4MELA 1JRPA 2DAJA 3HHMA 2GB1A 4LNOA 3VFKA 3MC8A 4MJSB 2K22A 4HJGE 3RNFC 3N1XC 3ZLZA 2DZIA 2D11A 3NS1A 2ACZB 3M62B 3W1YA 4DQOC 4ITKA 1V1PA 1JALA 1C4PA 3RCZA 4KZCA 3V6CB 4Q2JA 1JWUD 2J0KA 4ICVA 2KMMA 2K3UA 1F1HA 5IN7A 1N6ZA 3FILA 1WRDB 3N1ZC 1IUEA 2FCQA 2KLCA 5H92C 4MM3A 1M94A 4WH4A 2WXNA 3FILB 4WAFA 1FEHA 5IP4D 1DOYA 5DPTA 4MM3B 2RGFA 2C9WB 3H7SA 2Y5CA 1ET9A 4K7WA 2KLGA 2RR9A 3OAWA 2HTME 3C8YA 4XZ4A 4W9FA 4NJCA 2IY0B 1ESFA 3H7PB 2QDFA 3URYA 2FNJB 3K9OB 2LWPA 4PYZA 3KYCD 3WANA 3TMPB 2L0FA 1VLBA 3JVZX 2QILA 3DBRI 1V86A 2BVCA 5IAAC 2LXAA 3FC4A 3CMMB 1OEYA 3CIRB 4USAA 2NPTB 4WQOB 3ZVVA 3NHEB 4A20A 3MC0B 1SE4A 1L0XB 2EMSA 3AE9B 3EFCA 2WP9B 1WIAA 3KH0A 3RULA 2EKEC 4W9DA 5G5GA 2AL6A 2V3NA 1C77A 3CWIA 4A8XC 1LM8B 1FCLA 1P98A 3NZSA 1T3QA 2REXA 3NRZA 3MFGA 2GRIA 2HTHA 4HWIB 1LFDA 2KO3A 2ZVOA 2KACA 3AE3B 1FMAD 2LI5A 4K1RB 3L16A 3MTNB 3VUYA 4OVUA 1ACCA 4IUMB 3L13A 2K0PA 4F8CB 4WWPA 3A9KB 3CSTA 3ZNZB 4DDID 1FRDA 3DBLB 4NQKE 2PE6B 3N32A 3PREA 1V5TA 2BKFA 4C7YA 2D3AA 2B3AA 3IXSA 4N6EB 4OW0A 3HM6X 1PGBA 3AEEB 2AYOB 3AEDB 2JYTA 4ZHOA 3K9PB 1WYGA 2J53A 2JZ3B 3VVWB 4LNKA 4XWTA 4YL8A 2N4FA 3U52E 2KWDA 5C1ZA 1WX7A 3I9V1 3V60A 1IBXA 1OGWA 1HZ5A 1VJKA 3BVGA 4A90A 3OWEB 2ON8A 5BMHA 4I6PA 1D5ZC 4GDKB 1YQ3B 3BINA 2PKOA 2BKRB 3RD2A 3ZTDA 1E8YA 5J2RA 4HCNB 4HPLB 1FXIA 4HJKA 1V6EA 3VRAB 3L10B 2MBOA 1R4MB 3EECA 3TJPA 1GB1A 2CS4A 2WNMA 2GOWA 2N9LA 2GBKA 2PPHA 3DHGC 3KUDB 2XK5A 3VR8B 4LDTD 5AEKB 2HD5B 4W9LA 1RWSA 4LCDE 3P4RB 4RH6A 4N9F4 4P1CC 3TUOA 4FHKA 4RFBA 3ZUNA 1PDXA 4WJOA 4XDDA 3MJWA 3VDZA 2WXJA 2DYOA 2WYQA 3TEYA 1PQSA 2ZEQA 1R7SA 1UGMA 2JU6X 1YX5B 1WJUA 2L76A 4NZLB 3RNCC 2WXIA 3ZYYX 1E7UA 4RGNA 4OHJA 4CQNA 1HTQA 5DCNA 2J4XA 4P16A 3NVVA 2MJ3A 3LDZE 1JWAD 4AWJA 1ZE3D 4J6IA 1VCBA 2W54A 1J8CA 4HRSA 1LQBA 4PS3A 5FR3A 3SU8X 1E7VA 2KTRB 4YTPB 2RMMA 4BAXA 3NS8A 1P7FA 4JIOU 3L4PA 1Y56A 3D32A 4ZOHC 4KSKC 5G2NA 3DBRB 4EE2A 3ZNGC 2LVOA 2ZCCA 4C7ZA 2JPHA 2ZVNA 3OLMD 2KYWA 4GU2A 4ARCA 4PS7A 3VTVA 4M0WB 3IHPC 1ZXIA 3MHSD 2PEAA 2FAZA 3PLUA 2XK5B 5BYRA 3A4RA 1GOZA 2LASA 4I6LB 3NG0A 1XD3B 4R3DA 2LGYA 2GBMA 3VH4B 5CHVC 1FXTB 2KK8A 2LHDA 2PMVA 4FN2A 4G0NB 4ZDVA 2EELA 2K8HA 4MH0E 1C3TA 3KUZA 1RRBA 3VUXA 3PZ8A 5E6PA 3PPAA 2K39A 3GE3C 1I4GA 2D3GA 2DX5B 1FCCC 3V62A 2IDYA 1L5PA 2HE7A 2LHEA 2J52A 2GLSA 4MGKE 2LMCA 1TS4A 1PYWD 2LVQA 1I4PA 2N0SB 3R3MA 1T0RC 2MJEA 4GLSC 2H89B 3DCGA 4YSXB 2L83A 1MI0A 2Z59B 1JCKB 2WWZA 1YIWA 2Y3AA 4LNFA 1WWTA 3ZKJC 3A9KA 2ZPNA 4REZA 2CR5A 1TJEA 4KX6B 4KIKA 4YWGG 1UD7A 3APFA 4KDIC 3U7ZA 4B0MA 2IGDA 3QHTA 3BYYB 1SXTA 2JSVX 3WIMA 1TIFA 3GZNB 2NR2A 2L1AA 2O6VD 1I4HA 4JPSA 3DBSA 1WGRA 3ZDTA 3ZXVA 1WR1A 3M95A 3S2AA 1BUIC 1J0GA 1T0QC 1PGXA 3BIID 3QK0A 1XEEA 1UGJA 3IBEA 2FE8A 3P2BA 1HXYD 4L23A 2DAFA 1WX8A 2VH1A 1ZDVA 2L05A 3AULA 3KVFB 2CHXA 1KRHA 3QA8A 2KFKA 4HCPB 1UZXB 1OFFA 1P0RA 2LUEA 3ETRA 4RM8A 1D4BA 3QAQA 1WZ0A 1J7AA 3A9JB 3P4QB 4GSWA 2BB6A 3UIOB 3RFZB 1YQBA 4YXDB 2K6QA 1SIJA 4C4VA 1V80A 4YTMB 3NZ3A 3V3XA 1P3QU 1LXDA 3W1SC 1WY8A 1E7PB 1F9JA 3NOBA 4CYEA 3UF8A 3ZTCA 3BK1A 2NVUI 2MX2A 2KFJA 2WXFA 1KLGD 4ZRJA 5BYQA 2CHWA 1V49A 4MJSA 1SGHA 3PT2B 2Y5PA 4YTNB 4ANXA 2C7NB 3ZGZA 2MWSB 2X38A 1CK1A 2W3RA 3Q3OC 1OQQA 4NAWB 2EKIA 4DHZB 1L4DB 3ZRFA 2ZNVC 3AE7B 2ASQA 2BF8B 3BK2A 4W9HA 1AYFA 3KWLA 2KTFA 5LNK1 2N7DA 2ZCBA 3JSVB 1GJZA 1MFWA 4MGYE 1IYFA 2KVZA 4GGQA 1KJTA 5BMGA 4EUTA 1H4RA 4RCOA 3V61A 1KLVA 4LTUA 2IO2B 2VZKB 2RDHA 2MHJA 1MHXA 3A4SC 1ZP0B 4L1BA 1B9RA 2KWUB 3EHVA 4P7IA 1N5XA 4GXBA 1NENB 4HPPA 1UBIA 2M0XA 1TT5B 4NJ6A 2M56B 4JLCA 2BPSA 4NPNA 1WJ6A 1KOTA 4IWQA 1YQ4B 2RSUA 4MGIE 3EFUA 2CU3A 3T3OA 3IAS1 3GE8C 4DBGA 1GC7A 2BS3B 5FK9C 2FIFA 3DWGC 5HG2A 3SEBA 2QJLA 2BS4B 2FUG1 1E8ZA 3W1SA 3R66C 3DBHB 1WXAA 4H2AA 3ECIA 1UELA 1MVKA 2KWVB 1J7CA 3OG5A 3P4SB 1P1AA 5BMIA 2KKCA 4NJ7A 1HEZE 1FRRA 4TMAB 1M4VA 1N60A 3ZJVA 1NI3A 2WDTB 2BWES 1V9JA 1SE3A 3OJ4B 1G6JA 1NDDA 1I4RA 5JXVA 5JHBA 3P63A 3DWMA 2LVPA 4OVZA 1SIFA 3AE2B 4S0RA 3PRPB 3Q3MC 1NYRA 1MG4A 1EWCA 3Q69A 4MSMB 4B9KA 2L00B 2KMAA 4RMAA 1JW9D 4E71A 2CJNA 1STEA 2LGXA 3X23A 4FADA 1TYGB 2LFIA 3Q8CA 2QEJC 3VH3B 1FNVA 1VZ7A 2KHWB 1UWXA 5H8YE 2NS5A 4M8NA 2QMTA 2KJHB 3HVZA 2GI9A 3RN9C 3H6NA 5E6JA 3RNGC 3T9LA 2KXJA 4GDKA 1SE2A 2UYZB 4KZ0A 4G50A 5JHAA 5EE9A 4FJVB 2NTSA 4YSZB 2XBBC 4JQWC 1YN4A 2WX0A 3TEWA 2KQ4X 2JWUA 1WGHA 1TS5A 2MA9B 3WAPA 5G55A 3A9JA 3QQ8B 3AV8A 4IM0A 2BBCA 1HZ6A 2LRUA 3VTUA 4IM2A 5IA7A 2WQYB 2Z8LA 1T5XD 2WXOA 3RPFC 3AEFB 2JT4B 5E6OA 4DDGD 3C19A 2WXKA 1X1MA 1C1YB 3P4PB 2MEKA 3W9CB 1VDVA 2BT6A 1WJ4A 4DXFA 2VZKD 2W82A 1L2NA 1VZ8A 2OHFA 1QOFA 2TSSA 2M19A 1KH0A 1KM7A 2IY1B 4ARIA 2WX1A 3EGRA 3AB5A 2WS3B 2I1KA 2KNBA 3U30A 2V1YA 1XLPA 3AU4A 5C2TB 4BBNC 4RM9A 2INDC 4OZBA 3U4EG 4GB9A 1WRIA 4L2YA 2IPKD 1ZXHA 4EZKA 4F7ZA 2MW5A 2WDVB 4BKTA 1DOIA 4HKZE 2Z0EB 3SFEB 1EO6A 2BW2A 2KTRA 3EUB2 4RF1A 1YN5A 3L17A 5GMVA 1XF5L 4E74A 1LO5D 1WXSA 4C80A 4BKGA 4BFRA 3WA0A 3DBHI 3QJZA 1P9DU 5D6JB 1RLFA 2V9HA 2WU2B 3KWVA 3KQ4A 5L95C 3VQIA 1JWBD 1WE7A 2RDBC 4LJPB 3ZW3A 3ZO5B 3PS6A 2Z0DB 2JVCA 2BGFA 2L32A 4M0WA 2IO0B 3M3JA 4AOFA 1YJ1A 1YN3A 2BYEA 2MH7A 5LXIB 2IO3B 3RNBC 4KIKB 1FXAA 2QCZA 4EFOA 2YEPF 2N1WA 4ZYNA 4HPMB 5I4DA 1ZUD2 4C56C 4RGMA 3R2IA 2PJHA 5KHOA 5AZHA 1ENFA 1Q5WB 2RPVA 2RDGA 2RD0A 4JGHB 3ZDMC 1WXMA 4XDCA 2FUHB 1FNUA 3I3TB 1K53A 4OZAA 3RYTA 4US8A 3JW0X 4BOZB 4HLEA 1SJED 1Q10A 4US9A 1ZPSA 1F2RC 4EKUA 4ZHPA 2YVCA 3ONSA 1FPYA 1ROEA 2M4NA 1ET6A 1WGGA 4HKQA 1TKYA 1TKGA 2XN9C 2EMTA 2LJ5A 2AQ3B 2MBEA 3ZRCA 4XE0A 1AARA 2WLBA 2M8SA 1DYQA 4N59A 1WE6A 1VD2A 2WXGA 1QZEA 2JX5A 2K8CA 3HVDA 1V97A 3SDLC 1UF0A 1L6VA 1UNSA 2MBQA 3ZQ4A 2LXCA 1F2RI 1OQYA 2D3BA 1PUTA 5HHDG 4HDQA 3DHIC 1XLQA 1WGDA 2G1EA 3J9CA 2MQJA 2MCNB 3KW5B 2B76B 2KDMA 1TZ1A 4DWFA 2I38A 5AUIA 3IT4B 2KDIA 4OVVA 2JRIB 2RPQA 2R61A 3Q2AC 2UWQA 1OEYJ 5D3DA 1AN8A 4WWMA 2WDRB 1LGRA 2FCNA 3PHXB 1E8WA 4C00A 2BTEA 1SE9A 3QX1A 1I35A 3R8BA 2WXMA 3PO0A 1Z2MA 1L6UA 1RFAA 2IO1B 2KFKB 2X8XX 2R2OA 4GDLA 2LD9A 2JWZA 4TV3A 5MPOA 3B9JA 2N9EB 1D5XC 1JRUA 2ICIA 1TTNA 1E6EB 1WXVA 3WALA 1Y8RC 2KC1A 2PIAA 3RZWC 3E56A 1I4QA 3NVWA 3PV1A 2LGDA 4ANUA 1P7EA 4BBNF 1R4NB 2KOXA 2I1JA 3Q3NC 1YD8U 2PW9A 4UDUC 2ZW0A 1F0ZA 2CHZA 1TY2A 4NQLB 2LUMA 5EDSA 2IYDB 4DXAB 4HDOA 1HTOA 4A9AA 3AM9A 1T6BX 3R7QA 4MGZE 5D7GA 1XO3A 4BKSD 2KDFB 4HXDA 4TUUA 2L8JA 4JL9A 1SEBD 3W5VB 1QKZA 3X0WA 3N3KB 4M02A 1DOXA 1VRAB 4PYUA 1JQ4A 2MRPA 4W9CA 4IG7B 3AE5B 4ZRKA 4AJWA 1JWMD 3RMKC 3AEGB 2J7QB 4KSLC 1YJJA 1EU4A 2N1VA 4XYCA 3OJ3A 3PZDA 3QARA 1L0VB 1GAQB 2N9PC 4ANWA 3KUCB 4AJYB 3B1LX 3B08A 4IDIA 1VZ6A 3JSVA 4KDLB 1QILA 2LJIA 2QSDA 2LGSA 1GPXA 2JZPA 4K3CA 3ENEA 4WWNA 3MP9A 2HJ1A 5KHQA 2K1FA 1EU3A 3SFDB 5CHWA 1V81A 4W9GA 5J18A 3U8ZA 1SB3C 2ZZPB 2GBJA 3WAOA 2NCNA 1XQQA 1ZOYB 1RFKA 1WM2A 4P6VF 2PE9A 5EE0A 3DVNV 3DVGY 1YMHE 3IVFA 1S1QB 1WGYA 3PRMB 3B0AA 2J0JA 3O65B 2IGGA 1S3SG 2J0MA 3TSSA 4ZRIA 1FNWA 3N20C 5LXHA 2L0TA 2KN4A 2INCC 3ZNHB 1EF1A 1RYJA 3LXFA 4IC7B 2G4SA 5BYSA 4MSQB 1OTRB 4OZCA 1Q0WB 3ZNID 1MJDA 3Q3FA 2ZJDA 3AN1A 5EE1A 4M01A 1WFYA 2DYMA 5DPSA 2NBWB 5DPRA 3RT3B 2V0GA 3W5UB 3A33B 1V2YA 2KJ6A 1WI0A 3ZJUA 3L08A 3VTWA 1B1ZA 2NBUA 2JYEA 2CJOA 2BS2B 2D07B 4DXGA 1FO4A 4WJPA 4DHZE 1ZGUB 2J42A 1UH6A 3UIPB 5GXGB 2QC8A 2BYVE 4FJZA 1V1PB 1GC6A 1MPEA 1K51A 2XNAC 2G4DB 3I5JC 2INPE 2W55A 2C7HA 3DOWA 2MP2B 2DYBA 2IJ0A 1A70A 3R7RA 4HROA 4TKNA 1F77A 3HRDD 2WXPA 1XLNA 2NTTA 2I2YA 3GS2A 2M1MA 2BYTA 2C7MB 1Q1OA 1R4NI 1TKEA 1D6EC 3HK0A 4LLGM 1L0YB 2AQ2B 4RGTA 4S17A 2WU5B 3SR6A 2IGHA 3AEAB 2JF5A 3V05A 3A1QB 2KQ7A 3JYUA 3NY5A 4FXCA 5L83A 3VHTC 5AZGA 1HE8A 4PK1A 2G45B 2Y5BB 2ZW1A 4WAAA 1IBXB 4LNNA 4PS8A 2AEHA 3M63B 1PFDA 3Q14C 2AQ1B 3PVLA 2MBHA 1ZDXA 4XWWA 1KTKA 4K7SA 2BB5A 3HUIA 4II3B 4PT5A 2WGSA 2H88B 4MEMA 5IOIA 1WJNA 2N9XA 4K7UA 1A5RA 3AU5A 1EF5A 2D2QA 3QWZB 3Q8FA 2OJWA 2BYFA 4ANVA 1E10A 1WH3A 4A3OA 3I63C 3AXCA 3TEXA 1V8CA 3E9SA 3Q3JA 1K52A 3BY4B 3TCAA 1JROA 3DBLI 1OQRA 3Q8EA 4GOCA 1WGKA 4RNAA 3MC9A 2A4ZA 2KQSA 4II2B 3AH7A 1AWDA 2FBWB 5J17A 1QQRA 5FR6A 3U2SC 4AUQC 4JX1C 2K8BA 3N30A 4MH8A 2L52A 4KGSA 3VXWA 3WCQA 1WM3A 1WYWB 1TS3A 3A1QA 1E90A 1QLBB 2WXHA 5G5HA 2LEKA 4WQMA 3IFWB 4IM3A 1QF6A 3MJ5A 2YEPB 3UGBB 1MHHE 3TL5A 3IT6B 2LZ6A 1EM7A 3BYTB 4LDTB 2ZPYA 1E5WA 1TY0A 4FLHA 5C23A 1D3ZA 5T8IA 4JWSC 1IGDA 4YSYB 4MT5A 4JWUC 3BVZA 4A3PA 1TBEA 3N9YC 3Q8AA 1QOBA 3QC8B 2PVGC 5AUKA 4BVUC 2DNFA 2O6VB 2GBNA 4BKSA 3QIJA 3DVNU 1KLUD 3I57A 1XCTL 2DENB 2DWQA 4J3OD 4HK2A 1FIQA 4DK5A 4ASWC 2C60A 3PSEB 4IW0A 5HKHA 2N7JA 1SSNA 4BZAA 2Q5WD 3HIZA 1C79A 2MLBA 1SJHD 1N5WA 2N7EA 3ZXRA 1UWMA 2IZVB 3PRZA 3TIXA 2CKHB 2AL3A 4GN1A 2KWCA 2K6DB 3AEBB 1WX9A 3H8HA 4ZRQA 2MBBB 3VAWA 2LGIA 2G3QB 2V4IB 1V1OA 3L54A 1TS2A 2G9HD 4F1SA 3AE4B 1UUPA 1WMHA 4IKGA 4KVGB 3AMZA 5HI1A 5C3JB 2OOBB 3H9DA 3UINB 4AP4C 3NVZA 1VR9A 4EZJA 2GBRA 3P1MA 5JH5C 2DLBA 1ZW7A 4EEWA 4D2KA 2YLMA 4W9IA 2ZNVB 1SBBB 4WWOA 1K50A 1XT9B 2KZRA 1FFUA 2SAKA 2XEWA 3VR9B 4EZLA 2C5LC 1XCQL 2DZMA 3GZNI 1AW7A 1D5MC 2JRHA 3IAM1 1I7HA 4ICUA 1GUAB 2KD0A 2K9XA 5CTRC 2PTLA 2JY6A 3PLVA 4TSSA 2FCSA 2FCMA 2KDBA 1QOGA 1HA5A 1NBFC 4KGRA 3RNAC 4KV2A 4M00A 2KVRA 2PVOD 3BWUD 4XGAB 4I6NB 2DZKA 4DHJB 3TEZA 2V3SA 1EUVB 2VRRB 3AE1B 4GDLB 4NAMA 3GOEA 1U4AA 1IP9A 3U7DA 4GIVA 2NPTA 3HM3A 3DDCB 1C4AA 3ZJTA 3AE8B 3FKYA 4TQ1A 4P1BC 1CZPA 1IPGA 1JMLA 3MHZA 3VRBB 3P42A 3Q8BA 4B0EA 2UU7A 5D94A 4G11A 4LK0M 1WSPA 3RZFA 4RGOS 3B2FA 3T8MA 1GB4A 3DVGX 3WAMA 2WDQB 1FM0D 2D3CA 4AS1A 1YOVB 4C4VB 3KYDD 5IO9A 2R2QA 1E8XA 3APCA 1WR6E 3PGEA 4WURA 2DBYA 3GB1A 5JZEB 1PGAA 4EOYA 1UBQA 4TQ0A 2M17A 2W3SA 2PLPA 4RF0A 4FHJA 4G3XB 4K3BA 2KN5A 1ISNA 4URKA 2W9NA 4ZRPA 4IWPA 3T3NA 1SF0A 2V3PA 2A5UA 4JE3B 1T0YA 2JUOA 2KAJA 2KX3A 2O2VA 3L0WB 2NBVB 2HDEA 2OEDA 2LRWA 1C78A 4LNIA 3GP7A 4CHKA 4W9KA 1I42A 4QAYA 1ZKHA 1IGCA 3UI3A 1E0ZA 5IKCM 4X57B 4N58A 4ACFA 1C4CA 4HEA1 3ML9A 2MP2A 2MJDA 1KFYB 5CX3A 1BXTA 3APDA 4MDKE 4W9EA 3V6EB 1K8RB 5TR5A 3CF6E 1NI2A 1YX6B 3R2TA 2KJRA 1C9FA 5DPWA 1J19A 5E6NA 2E6XA 3DQVA 3DHHC 2SEBD 3H7PA 2JQRB 4LJOB 4NY0A 1CMXB 1QT9A 1C76A 5CHFA 1E9MA 3IG3A 3SD5A 4B6WA 4ZYSA 2DZJA 2KC2A 2QHOA 2WHIA 2JZZA 2WXLA 1BT0A 1RAXA 1L7YA 3LJ3A 2D10A 3CSFA 2BWFA 1Z5SB 4FJYA 1CJEA 4KKJA 2INNE 2VH2A 2KANA 3N1YC 1L4ZB 5AZFA 3NVYA 3TBLD 2QIEB 2JXXA 4B95A 4IOIE 1NYQA 4FULA 3FAHA 1R4MI 1WMHB 3ALBA 4BOSC 1I4XA 5EE3A 3LB8C 3Q6BA 2O2VB 1DGJA 3C0RB 2IBIB 3AECB 1WZ3A 3KLSX 5LLIA 2KX0A 3H1UA 2FIDA 2WXQA 5D3IB 2KT7A 3BZDB 4E3CA 4W9JA 2CU1A 3O13A 1FFVA 4IWOA 3AE6B 3NZUA 4FBJB 2DHZA 3SHQA 1TZOA 3ZIMA 4HVBA 1NEKB 2MSED 1RM6C 1YJIA 1H8CA 3RNEC 2L3ZA 1HQRD 2AX5A 2V4LA 1XLOA 1J7BA 2L7RA 3QCAA 3ABVB 5BO4B 4NAWA 1TGZB 2WXRA 2AWTA 4FA6A 1WXQA 3AI5A 1YNTE 3EA6A 1GG3A 4YT0B 1JWSD 4KGTA 3UQBA 2K5PA 3DPDA 2N9KA 5HFYA 3PZ7A 3W2DA 4A55A 1BMLC 1EWYC 2ONQA 1NVID 3PTFC 3ML8A 3RI7C 3NJTA 2JXTA 1XXGA 4XC2A 3BVMA 2OJRA 5D2MB 4DHJD 4O1NA 1V5OA 2D5GA 2KMCA 4A6QA 2HJ8A 5FKAC 3RUIB
chains in the Genus database with same CATH topology
1UD7A 3APFA 4KDIC 3QHTA 4M8MA 3WIMA 3PHWB 2O6VA 3UGBB 3TL5A 2NR2A 2LZ6A 2O6VD 4LDTB 4XX5A 2ZPYA 3DBSA 4EKUA 1WGRA 2K25A 1E5WA 3UQAA 4FLHA 2YVCA 1WF9A 3ONSA 5C23A 3ZDTA 2M4NA 1D3ZA 1WGGA 1WR1A 4NNJB 3VUWA 3M95A 3S2AA 4A3PA 1GNUA 2EMTA 1J0GA 2LJ5A 4WJQA 4WJNA 2MBEA 3QK0A 3IBEA 4GMVA 3ZRCA 1TBEA 2KDEB 3P2BA 4K81A 1AARA 3QC8B 2DAFA 1WX8A 4BVUC 2GMIC 2M8SA 2O6VB 2GBNA 1MG8A 1WE6A 4BKSA 3EC8A 4CO7A 1VD2A 2L05A 3AULA 3DVNU 3QIJA 4MELA 3KVFB 2DAJA 1QZEA 2DENB 2CHXA 3HHMA 2K8CA 4HK2A 3QA8A 2KFKA 3SDLC 3VFKA 4DK5A 4HCPB 4MJSB 4ASWC 2MBQA 2C60A 3PSEB 4IW0A 5HKHA 3ZLZA 2LXCA 2DZIA 1UZXB 2D11A 3M62B 3W1YA 1P0RA 2LUEA 3RCZA 3HIZA 4RM8A 1OQYA 2MLBA 4KZCA 3QAQA 3V6CB 1WZ0A 2N7EA 3A9JB 4GSWA 2IZVB 3PRZA 2J0KA 4ICVA 3TIXA 2CKHB 4HDQA 3UIOB 1WGDA 2AL3A 4GN1A 2MQJA 2KWCA 2K6DB 1YQBA 1WRDB 2MCNB 2FCQA 2KLCA 2K6QA 3KW5B 1WX9A 1V80A 2MBBB 1TZ1A 4DWFA 3VAWA 4MM3A 1M94A 2G3QB 1P3QU 1LXDA 2KDIA 3L54A 1WY8A 2JRIB 2RPQA 4OVVA 3W1SC 1F9JA 3NOBA 2UWQA 1OEYJ 4CYEA 4F1SA 3UF8A 3ZTCA 5DPTA 1WMHA 2FCNA 2NVUI 3PHXB 2RGFA 1E8WA 2MX2A 4KVGB 1SE9A 2C9WB 2KFJA 3QX1A 3H7SA 1I35A 4K7WA 2KLGA 2OOBB 4ZRJA 2RR9A 3OAWA 1Z2MA 3H9DA 2CHWA 1RFAA 1V49A 2IO1B 2KFKB 2IY0B 4W9FA 4XZ4A 2R2OA 3UINB 4GDLA 4MJSA 1SGHA 2LD9A 3H7PB 4AP4C 3PT2B 2JWZA 4EZJA 4TV3A 4ANXA 2GBRA 5JH5C 2C7NB 2N9EB 2FNJB 2MWSB 1ZW7A 3K9OB 4EEWA 2LWPA 1JRUA 4PYZA 3KYCD 3WANA 3TMPB 2L0FA 1TTNA 3JVZX 2YLMA 3DBRI 4W9IA 1WXVA 3WALA 2ZNVB 4NAWB 1V86A 1Y8RC 2KC1A 4WWOA 3RZWC 4DHZB 1XT9B 2LXAA 5IAAC 3CMMB 2KZRA 3ZRFA 2ZNVC 3PV1A 2LGDA 2XEWA 4ANUA 1OEYA 4BBNF 2ASQA 2BF8B 4W9HA 2KOXA 4EZLA 2C5LC 2I1JA 2KTFA 2DZMA 2NPTB 3GZNI 1YD8U 2JRHA 2N7DA 2ZCBA 3JSVB 1GJZA 4WQOB 4ICUA 3ZVVA 1GUAB 2KD0A 3NHEB 5CTRC 4MGYE 4A20A 1IYFA 2CHZA 2JY6A 3PLVA 4NQLB 4IM3A 5EDSA 2FCSA 2FCMA 4GGQA 2IYDB 1KJTA 4DXAB 2KDBA 4EUTA 1H4RA 2EMSA 4HDOA 1NBFC 3V61A 3R7QA 1KLVA 4KV2A 4MGZE 5D7GA 1WIAA 2KVRA 3KH0A 4BKSD 3RULA 4I6NB 2KDFB 2EKEC 2DZKA 4HXDA 4TUUA 2IO2B 2L8JA 4W9DA 4JL9A 2V3SA 1EUVB 2VRRB 4DHJB 2AL6A 4GDLB 3GOEA 3A4SC 1U4AA 1IP9A 1LM8B 3X0WA 3N3KB 3U7DA 1P98A 4GIVA 3NZSA 2REXA 2NPTA 3HM3A 3DDCB 4PYUA 2HTHA 4HWIB 1LFDA 2KO3A 2MRPA 2ZVOA 2KWUB 4W9CA 4TQ1A 3EHVA 4IG7B 4ZRKA 2LI5A 4K1RB 4AJWA 3L16A 4P7IA 3MTNB 3VUYA 4GXBA 2J7QB 4KSLC 1IPGA 4OVUA 1UBIA 2M0XA 4NJ6A 2N1VA 3OJ3A 3PZDA 4IUMB 4JLCA 3L13A 2BPSA 3QARA 4G11A 4NPNA 5D94A 1WJ6A 4F8CB 1KOTA 4IWQA 4WWPA 3RZFA 2RSUA 3A9KB 4MGIE 3CSTA 2N9PC 3ZNZB 4ANWA 3KUCB 4DDID 3EFUA 4AJYB 3B1LX 4NQKE 3B08A 3T8MA 1GC7A 4DBGA 2FIFA 3DVGX 3JSVA 3WAMA 2PE6B 3N32A 4KDLB 3PREA 1V5TA 2BKFA 1E8ZA 3W1SA 2B3AA 3KYDD 3R66C 2R2QA 1E8XA 1WXAA 1WR6E 3APCA 3ECIA 3HM6X 3ENEA 1UELA 3PGEA 4WWNA 2KWVB 5KHQA 1P1AA 2K1FA 2AYOB 2KKCA 4NJ7A 3K9PB 5CHWA 1V81A 4W9GA 5J18A 2JZ3B 3U8ZA 2ZZPB 5JZEB 2GBJA 3WAOA 3VVWB 2NCNA 1XQQA 2WDTB 4EOYA 1UBQA 4TQ0A 2BWES 1V9JA 3OJ4B 2M17A 2N4FA 4YL8A 1G6JA 1NDDA 5C1ZA 1WX7A 1WM2A 3V60A 5JHBA 4FHJA 2PE9A 4G3XB 1OGWA 3DVNV 3DVGY 2KN5A 3IVFA 1S1QB 4I6PA 1ISNA 2LVPA 1WGYA 2W9NA 4URKA 3PRMB 4GDKB 3B0AA 3BINA 4IWPA 2J0JA 2BKRB 1SIFA 2A5UA 3RD2A 3ZTDA 3PRPB 1E8YA 3O65B 5J2RA 4HCNB 1S3SG 4HPLB 1T0YA 2J0MA 4HJKA 1V6EA 2JUOA 2KX3A 3L10B 4ZRIA 4MSMB 2MBOA 2O2VA 3L0WB 4B9KA 2L00B 2KMAA 4RMAA 2NBVB 3EECA 3TJPA 2LRWA 5LXHA 2CS4A 2L0TA 3ZNHB 4CHKA 2GOWA 1EF1A 4E71A 4W9KA 4IC7B 2LGXA 2G4SA 1I42A 2GBKA 2PPHA 1ZKHA 3X23A 4FADA 3KUDB 2XK5A 4MSQB 1OTRB 4LDTD 1Q0WB 3ZNID 5AEKB 2HD5B 3Q3FA 4W9LA 2ZJDA 3VH3B 4X57B 4LCDE 1WFYA 2KHWB 4N9F4 2DYMA 5DPSA 2NS5A 3ML9A 2NBWB 4M8NA 5DPRA 4FHKA 3RT3B 3ZUNA 2MP2A 3A33B 2KJHB 1V2YA 2KJ6A 4WJOA 3MJWA 5CX3A 3VDZA 3APDA 4MDKE 1WI0A 4W9EA 1K8RB 3V6EB 3L08A 3VTWA 2NBUA 5TR5A 3H6NA 2DYOA 2WYQA 3CF6E 1NI2A 3T9LA 1YX6B 1PQSA 2D07B 2KJRA 2ZEQA 1UGMA 4WJPA 4DHZE 1ZGUB 2KXJA 4GDKA 1UH6A 1YX5B 5DPWA 3UIPB 1J19A 2BYVE 2UYZB 4FJZA 4KZ0A 5E6NA 1WJUA 2L76A 1GC6A 3DQVA 4G50A 5JHAA 2G4DB 1E7UA 4FJVB 3H7PA 4LJOB 4NY0A 5DCNA 1CMXB 2C7HA 5CHFA 3DOWA 2MP2B 2DYBA 3IG3A 3SD5A 4B6WA 2XBBC 4JQWC 2DZJA 3R7RA 3LDZE 4AWJA 2KC2A 4TKNA 2QHOA 2WX0A 4J6IA 2JZZA 1VCBA 1BT0A 1WGHA 1RAXA 2MA9B 1J8CA 1L7YA 3WAPA 1LQBA 5G55A 3A9JA 3QQ8B 4PS3A 3LJ3A 4IM0A 2D10A 3CSFA 2BWFA 3SU8X 2M1MA 1E7VA 2LRUA 2C7MB 2KTRB 1Z5SB 4FJYA 1Q1OA 4IM2A 3VTUA 1R4NI 5IA7A 3NS8A 2KANA 4JIOU 3HK0A 5AZFA 2JT4B 5E6OA 3D32A 4DDGD 3TBLD 4KSKC 1X1MA 1C1YB 5G2NA 2JF5A 3ZNGC 3A1QB 1WJ4A 2JXXA 2KQ7A 2LVOA 4B95A 3JYUA 2ZCCA 1L2NA 3NY5A 2JPHA 2ZVNA 3OLMD 4FULA 5L83A 1R4MI 1WMHB 3ALBA 4BOSC 4GU2A 3VHTC 5AZGA 1HE8A 4PS7A 3VTVA 1KM7A 2IY1B 2G45B 2Y5BB 2O2VB 4M0WB 3IHPC 3MHSD 2WX1A 3C0RB 2IBIB 4WAAA 1WZ3A 2I1KA 4PS8A 2KNBA 2PEAA 3U30A 2AEHA 3M63B 5LLIA 2V1YA 3PVLA 2FAZA 3AU4A 3PLUA 4BBNC 2XK5B 4RM9A 3A4RA 2MBHA 2KX0A 3H1UA 2LASA 2FIDA 4GB9A 4I6LB 4K7SA 1XD3B 4E3CA 4II3B 4W9JA 2CU1A 2LGYA 2GBMA 4MEMA 3VH4B 4EZKA 4IWOA 1WJNA 5CHVC 2N9XA 1FXTB 2MW5A 3NZUA 4K7UA 3AU5A 4F7ZA 4FBJB 1EF5A 1A5RA 2DHZA 4BKTA 3SHQA 2KK8A 2D2QA 2Z0EB 3QWZB 3ZIMA 1EO6A 2BYFA 2KTRA 4FN2A 4HVBA 2MSED 5GMVA 4ANVA 3L17A 4G0NB 1WH3A 1H8CA 4A3OA 4E74A 4ZDVA 1WXSA 4BKGA 2K8HA 2L3ZA 4BFRA 3AXCA 4MH0E 1C3TA 3WA0A 3DBHI 3QJZA 3KUZA 1P9DU 1RRBA 5D6JB 3VUXA 1RLFA 3Q3JA 2V4LA 5E6PA 3VQIA 5L95C 3PPAA 1WE7A 2L7RA 3BY4B 4LJPB 3ZW3A 3QCAA 3TCAA 3ZO5B 3PS6A 2K39A 2Z0DB 3DBLI 5BO4B 2JVCA 4GOCA 4NAWA 2BGFA 2D3GA 1TGZB 2DX5B 3V62A 2HE7A 2A4ZA 2IO0B 2KQSA 3M3JA 2AWTA 4FA6A 3AI5A 4AOFA 1YJ1A 4II2B 2BYEA 4MGKE 5LXIB 2IO3B 1GG3A 5J17A 4KIKB 5FR6A 4AUQC 2K8BA 2LVQA 3N30A 4EFOA 2N1WA 4ZYNA 3R3MA 4HPMB 3UQBA 3DPDA 2PJHA 5KHOA 5AZHA 3VXWA 3DCGA 1Q5WB 4JGHB 2RD0A 3PTFC 2Z59B 3ZDMC 1WM3A 3ML8A 1WYWB 1WXMA 3A1QA 4XC2A 2WWZA 1YIWA 1E90A 2OJRA 5D2MB 2FUHB 4DHJD 3I3TB 3ZKJC 3RYTA 3A9KA 1V5OA 2ZPNA 2KMCA 2HJ8A 2CR5A 3IFWB 3JW0X 4KIKA 4BOZB 4HLEA 3RUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UD7 A;  3APF A;  4KDI C;  3QHT A;  4M8M A;  3WIM A;  3PHW B;  2O6V A;  3UGB B;  3TL5 A;  2NR2 A;  2LZ6 A;  2O6V D;  4LDT B;  4XX5 A;  2ZPY A;  3DBS A;  4EKU A;  1WGR A;  2K25 A;  1E5W A;  3UQA A;  4FLH A;  2YVC A;  1WF9 A;  3ONS A;  5C23 A;  3ZDT A;  2M4N A;  1D3Z A;  1WGG A;  1WR1 A;  4NNJ B;  3VUW A;  3M95 A;  3S2A A;  4A3P A;  1GNU A;  2EMT A;  1J0G A;  2LJ5 A;  4WJQ A;  4WJN A;  2MBE A;  3QK0 A;  3IBE A;  4GMV A;  3ZRC A;  1TBE A;  2KDE B;  3P2B A;  4K81 A;  1AAR A;  3QC8 B;  2DAF A;  1WX8 A;  4BVU C;  2GMI C;  2M8S A;  2O6V B;  2GBN A;  1MG8 A;  1WE6 A;  4BKS A;  3EC8 A;  4CO7 A;  1VD2 A;  2L05 A;  3AUL A;  3DVN U;  3QIJ A;  4MEL A;  3KVF B;  2DAJ A;  1QZE A;  2DEN B;  2CHX A;  3HHM A;  2K8C A;  4HK2 A;  3QA8 A;  2KFK A;  3SDL C;  3VFK A;  4DK5 A;  4HCP B;  4MJS B;  4ASW C;  2MBQ A;  2C60 A;  3PSE B;  4IW0 A;  5HKH A;  3ZLZ A;  2LXC A;  2DZI A;  1UZX B;  2D11 A;  3M62 B;  3W1Y A;  1P0R A;  2LUE A;  3RCZ A;  3HIZ A;  4RM8 A;  1OQY A;  2MLB A;  4KZC A;  3QAQ A;  3V6C B;  1WZ0 A;  2N7E A;  3A9J B;  4GSW A;  2IZV B;  3PRZ A;  2J0K A;  4ICV A;  3TIX A;  2CKH B;  4HDQ A;  3UIO B;  1WGD A;  2AL3 A;  4GN1 A;  2MQJ A;  2KWC A;  2K6D B;  1YQB A;  1WRD B;  2MCN B;  2FCQ A;  2KLC A;  2K6Q A;  3KW5 B;  1WX9 A;  1V80 A;  2MBB B;  1TZ1 A;  4DWF A;  3VAW A;  4MM3 A;  1M94 A;  2G3Q B;  1P3Q U;  1LXD A;  2KDI A;  3L54 A;  1WY8 A;  2JRI B;  2RPQ A;  4OVV A;  3W1S C;  1F9J A;  3NOB A;  2UWQ A;  1OEY J;  4CYE A;  4F1S A;  3UF8 A;  3ZTC A;  5DPT A;  1WMH A;  2FCN A;  2NVU I;  3PHX B;  2RGF A;  1E8W A;  2MX2 A;  4KVG B;  1SE9 A;  2C9W B;  2KFJ A;  3QX1 A;  3H7S A;  1I35 A;  4K7W A;  2KLG A;  2OOB B;  4ZRJ A;  2RR9 A;  3OAW A;  1Z2M A;  3H9D A;  2CHW A;  1RFA A;  1V49 A;  2IO1 B;  2KFK B;  2IY0 B;  4W9F A;  4XZ4 A;  2R2O A;  3UIN B;  4GDL A;  4MJS A;  1SGH A;  2LD9 A;  3H7P B;  4AP4 C;  3PT2 B;  2JWZ A;  4EZJ A;  4TV3 A;  4ANX A;  2GBR A;  5JH5 C;  2C7N B;  2N9E B;  2FNJ B;  2MWS B;  1ZW7 A;  3K9O B;  4EEW A;  2LWP A;  1JRU A;  4PYZ A;  3KYC D;  3WAN A;  3TMP B;  2L0F A;  1TTN A;  3JVZ X;  2YLM A;  3DBR I;  4W9I A;  1WXV A;  3WAL A;  2ZNV B;  4NAW B;  1V86 A;  1Y8R C;  2KC1 A;  4WWO A;  3RZW C;  4DHZ B;  1XT9 B;  2LXA A;  5IAA C;  3CMM B;  2KZR A;  3ZRF A;  2ZNV C;  3PV1 A;  2LGD A;  2XEW A;  4ANU A;  1OEY A;  4BBN F;  2ASQ A;  2BF8 B;  4W9H A;  2KOX A;  4EZL A;  2C5L C;  2I1J A;  2KTF A;  2DZM A;  2NPT B;  3GZN I;  1YD8 U;  2JRH A;  2N7D A;  2ZCB A;  3JSV B;  1GJZ A;  4WQO B;  4ICU A;  3ZVV A;  1GUA B;  2KD0 A;  3NHE B;  5CTR C;  4MGY E;  4A20 A;  1IYF A;  2CHZ A;  2JY6 A;  3PLV A;  4NQL B;  4IM3 A;  5EDS A;  2FCS A;  2FCM A;  4GGQ A;  2IYD B;  1KJT A;  4DXA B;  2KDB A;  4EUT A;  1H4R A;  2EMS A;  4HDO A;  1NBF C;  3V61 A;  3R7Q A;  1KLV A;  4KV2 A;  4MGZ E;  5D7G A;  1WIA A;  2KVR A;  3KH0 A;  4BKS D;  3RUL A;  4I6N B;  2KDF B;  2EKE C;  2DZK A;  4HXD A;  4TUU A;  2IO2 B;  2L8J A;  4W9D A;  4JL9 A;  2V3S A;  1EUV B;  2VRR B;  4DHJ B;  2AL6 A;  4GDL B;  3GOE A;  3A4S C;  1U4A A;  1IP9 A;  1LM8 B;  3X0W A;  3N3K B;  3U7D A;  1P98 A;  4GIV A;  3NZS A;  2REX A;  2NPT A;  3HM3 A;  3DDC B;  4PYU A;  2HTH A;  4HWI B;  1LFD A;  2KO3 A;  2MRP A;  2ZVO A;  2KWU B;  4W9C A;  4TQ1 A;  3EHV A;  4IG7 B;  4ZRK A;  2LI5 A;  4K1R B;  4AJW A;  3L16 A;  4P7I A;  3MTN B;  3VUY A;  4GXB A;  2J7Q B;  4KSL C;  1IPG A;  4OVU A;  1UBI A;  2M0X A;  4NJ6 A;  2N1V A;  3OJ3 A;  3PZD A;  4IUM B;  4JLC A;  3L13 A;  2BPS A;  3QAR A;  4G11 A;  4NPN A;  5D94 A;  1WJ6 A;  4F8C B;  1KOT A;  4IWQ A;  4WWP A;  3RZF A;  2RSU A;  3A9K B;  4MGI E;  3CST A;  2N9P C;  3ZNZ B;  4ANW A;  3KUC B;  4DDI D;  3EFU A;  4AJY B;  3B1L X;  4NQK E;  3B08 A;  3T8M A;  1GC7 A;  4DBG A;  2FIF A;  3DVG X;  3JSV A;  3WAM A;  2PE6 B;  3N32 A;  4KDL B;  3PRE A;  1V5T A;  2BKF A;  1E8Z A;  3W1S A;  2B3A A;  3KYD D;  3R66 C;  2R2Q A;  1E8X A;  1WXA A;  1WR6 E;  3APC A;  3ECI A;  3HM6 X;  3ENE A;  1UEL A;  3PGE A;  4WWN A;  2KWV B;  5KHQ A;  1P1A A;  2K1F A;  2AYO B;  2KKC A;  4NJ7 A;  3K9P B;  5CHW A;  1V81 A;  4W9G A;  5J18 A;  2JZ3 B;  3U8Z A;  2ZZP B;  5JZE B;  2GBJ A;  3WAO A;  3VVW B;  2NCN A;  1XQQ A;  2WDT B;  4EOY A;  1UBQ A;  4TQ0 A;  2BWE S;  1V9J A;  3OJ4 B;  2M17 A;  2N4F A;  4YL8 A;  1G6J A;  1NDD A;  5C1Z A;  1WX7 A;  1WM2 A;  3V60 A;  5JHB A;  4FHJ A;  2PE9 A;  4G3X B;  1OGW A;  3DVN V;  3DVG Y;  2KN5 A;  3IVF A;  1S1Q B;  4I6P A;  1ISN A;  2LVP A;  1WGY A;  2W9N A;  4URK A;  3PRM B;  4GDK B;  3B0A A;  3BIN A;  4IWP A;  2J0J A;  2BKR B;  1SIF A;  2A5U A;  3RD2 A;  3ZTD A;  3PRP B;  1E8Y A;  3O65 B;  5J2R A;  4HCN B;  1S3S G;  4HPL B;  1T0Y A;  2J0M A;  4HJK A;  1V6E A;  2JUO A;  2KX3 A;  3L10 B;  4ZRI A;  4MSM B;  2MBO A;  2O2V A;  3L0W B;  4B9K A;  2L00 B;  2KMA A;  4RMA A;  2NBV B;  3EEC A;  3TJP A;  2LRW A;  5LXH A;  2CS4 A;  2L0T A;  3ZNH B;  4CHK A;  2GOW A;  1EF1 A;  4E71 A;  4W9K A;  4IC7 B;  2LGX A;  2G4S A;  1I42 A;  2GBK A;  2PPH A;  1ZKH A;  3X23 A;  4FAD A;  3KUD B;  2XK5 A;  4MSQ B;  1OTR B;  4LDT D;  1Q0W B;  3ZNI D;  5AEK B;  2HD5 B;  3Q3F A;  4W9L A;  2ZJD A;  3VH3 B;  4X57 B;  4LCD E;  1WFY A;  2KHW B;  4N9F 4;  2DYM A;  5DPS A;  2NS5 A;  3ML9 A;  2NBW B;  4M8N A;  5DPR A;  4FHK A;  3RT3 B;  3ZUN A;  2MP2 A;  3A33 B;  2KJH B;  1V2Y A;  2KJ6 A;  4WJO A;  3MJW A;  5CX3 A;  3VDZ A;  3APD A;  4MDK E;  1WI0 A;  4W9E A;  1K8R B;  3V6E B;  3L08 A;  3VTW A;  2NBU A;  5TR5 A;  3H6N A;  2DYO A;  2WYQ A;  3CF6 E;  1NI2 A;  3T9L A;  1YX6 B;  1PQS A;  2D07 B;  2KJR A;  2ZEQ A;  1UGM A;  4WJP A;  4DHZ E;  1ZGU B;  2KXJ A;  4GDK A;  1UH6 A;  1YX5 B;  5DPW A;  3UIP B;  1J19 A;  2BYV E;  2UYZ B;  4FJZ A;  4KZ0 A;  5E6N A;  1WJU A;  2L76 A;  1GC6 A;  3DQV A;  4G50 A;  5JHA A;  2G4D B;  1E7U A;  4FJV B;  3H7P A;  4LJO B;  4NY0 A;  5DCN A;  1CMX B;  2C7H A;  5CHF A;  3DOW A;  2MP2 B;  2DYB A;  3IG3 A;  3SD5 A;  4B6W A;  2XBB C;  4JQW C;  2DZJ A;  3R7R A;  3LDZ E;  4AWJ A;  2KC2 A;  4TKN A;  2QHO A;  2WX0 A;  4J6I A;  2JZZ A;  1VCB A;  1BT0 A;  1WGH A;  1RAX A;  2MA9 B;  1J8C A;  1L7Y A;  3WAP A;  1LQB A;  5G55 A;  3A9J A;  3QQ8 B;  4PS3 A;  3LJ3 A;  4IM0 A;  2D10 A;  3CSF A;  2BWF A;  3SU8 X;  2M1M A;  1E7V A;  2LRU A;  2C7M B;  2KTR B;  1Z5S B;  4FJY A;  1Q1O A;  4IM2 A;  3VTU A;  1R4N I;  5IA7 A;  3NS8 A;  2KAN A;  4JIO U;  3HK0 A;  5AZF A;  2JT4 B;  5E6O A;  3D32 A;  4DDG D;  3TBL D;  4KSK C;  1X1M A;  1C1Y B;  5G2N A;  2JF5 A;  3ZNG C;  3A1Q B;  1WJ4 A;  2JXX A;  2KQ7 A;  2LVO A;  4B95 A;  3JYU A;  2ZCC A;  1L2N A;  3NY5 A;  2JPH A;  2ZVN A;  3OLM D;  4FUL A;  5L83 A;  1R4M I;  1WMH B;  3ALB A;  4BOS C;  4GU2 A;  3VHT C;  5AZG A;  1HE8 A;  4PS7 A;  3VTV A;  1KM7 A;  2IY1 B;  2G45 B;  2Y5B B;  2O2V B;  4M0W B;  3IHP C;  3MHS D;  2WX1 A;  3C0R B;  2IBI B;  4WAA A;  1WZ3 A;  2I1K A;  4PS8 A;  2KNB A;  2PEA A;  3U30 A;  2AEH A;  3M63 B;  5LLI A;  2V1Y A;  3PVL A;  2FAZ A;  3AU4 A;  3PLU A;  4BBN C;  2XK5 B;  4RM9 A;  3A4R A;  2MBH A;  2KX0 A;  3H1U A;  2LAS A;  2FID A;  4GB9 A;  4I6L B;  4K7S A;  1XD3 B;  4E3C A;  4II3 B;  4W9J A;  2CU1 A;  2LGY A;  2GBM A;  4MEM A;  3VH4 B;  4EZK A;  4IWO A;  1WJN A;  5CHV C;  2N9X A;  1FXT B;  2MW5 A;  3NZU A;  4K7U A;  3AU5 A;  4F7Z A;  4FBJ B;  1EF5 A;  1A5R A;  2DHZ A;  4BKT A;  3SHQ A;  2KK8 A;  2D2Q A;  2Z0E B;  3QWZ B;  3ZIM A;  1EO6 A;  2BYF A;  2KTR A;  4FN2 A;  4HVB A;  2MSE D;  5GMV A;  4ANV A;  3L17 A;  4G0N B;  1WH3 A;  1H8C A;  4A3O A;  4E74 A;  4ZDV A;  1WXS A;  4BKG A;  2K8H A;  2L3Z A;  4BFR A;  3AXC A;  4MH0 E;  1C3T A;  3WA0 A;  3DBH I;  3QJZ A;  3KUZ A;  1P9D U;  1RRB A;  5D6J B;  3VUX A;  1RLF A;  3Q3J A;  2V4L A;  5E6P A;  3VQI A;  5L95 C;  3PPA A;  1WE7 A;  2L7R A;  3BY4 B;  4LJP B;  3ZW3 A;  3QCA A;  3TCA A;  3ZO5 B;  3PS6 A;  2K39 A;  2Z0D B;  3DBL I;  5BO4 B;  2JVC A;  4GOC A;  4NAW A;  2BGF A;  2D3G A;  1TGZ B;  2DX5 B;  3V62 A;  2HE7 A;  2A4Z A;  2IO0 B;  2KQS A;  3M3J A;  2AWT A;  4FA6 A;  3AI5 A;  4AOF A;  1YJ1 A;  4II2 B;  2BYE A;  4MGK E;  5LXI B;  2IO3 B;  1GG3 A;  5J17 A;  4KIK B;  5FR6 A;  4AUQ C;  2K8B A;  2LVQ A;  3N30 A;  4EFO A;  2N1W A;  4ZYN A;  3R3M A;  4HPM B;  3UQB A;  3DPD A;  2PJH A;  5KHO A;  5AZH A;  3VXW A;  3DCG A;  1Q5W B;  4JGH B;  2RD0 A;  3PTF C;  2Z59 B;  3ZDM C;  1WM3 A;  3ML8 A;  1WYW B;  1WXM A;  3A1Q A;  4XC2 A;  2WWZ A;  1YIW A;  1E90 A;  2OJR A;  5D2M B;  2FUH B;  4DHJ D;  3I3T B;  3ZKJ C;  3RYT A;  3A9K A;  1V5O A;  2ZPN A;  2KMC A;  2HJ8 A;  2CR5 A;  3IFW B;  3JW0 X;  4KIK A;  4BOZ B;  4HLE A;  3RUI B; 
#chains in the Genus database with same CATH topology
 4MAC A;  3B2G A;  4M8M A;  1QOA A;  3NUH B;  3PHW B;  2O6V A;  4KKI A;  1N63 A;  4XX5 A;  1T0S C;  2K25 A;  3UQA A;  1N61 A;  1WF9 A;  2M0A A;  2NMQ A;  1F52 A;  4NNJ B;  1CQV A;  3VUW A;  1FD6 A;  1KF6 B;  1GNU A;  4WJQ A;  1N62 A;  4WJN A;  4WIP A;  4GMV A;  2KDE B;  4K81 A;  2E3T A;  3LYY A;  2BQQ A;  2GMI C;  1MG8 A;  4CO7 A;  4AQ7 A;  3EC8 A;  5TSS A;  4MEL A;  1JRP A;  2DAJ A;  3HHM A;  2GB1 A;  4LNO A;  3VFK A;  3MC8 A;  4MJS B;  2K22 A;  4HJG E;  3RNF C;  3N1X C;  3ZLZ A;  2DZI A;  2D11 A;  3NS1 A;  2ACZ B;  3M62 B;  3W1Y A;  4DQO C;  4ITK A;  1V1P A;  1JAL A;  1C4P A;  3RCZ A;  4KZC A;  3V6C B;  4Q2J A;  1JWU D;  2J0K A;  4ICV A;  2KMM A;  2K3U A;  1F1H A;  5IN7 A;  1N6Z A;  3FIL A;  1WRD B;  3N1Z C;  1IUE A;  2FCQ A;  2KLC A;  5H92 C;  4MM3 A;  1M94 A;  4WH4 A;  2WXN A;  3FIL B;  4WAF A;  1FEH A;  5IP4 D;  1DOY A;  5DPT A;  4MM3 B;  2RGF A;  2C9W B;  3H7S A;  2Y5C A;  1ET9 A;  4K7W A;  2KLG A;  2RR9 A;  3OAW A;  2HTM E;  3C8Y A;  4XZ4 A;  4W9F A;  4NJC A;  2IY0 B;  1ESF A;  3H7P B;  2QDF A;  3URY A;  2FNJ B;  3K9O B;  2LWP A;  4PYZ A;  3KYC D;  3WAN A;  3TMP B;  2L0F A;  1VLB A;  3JVZ X;  2QIL A;  3DBR I;  1V86 A;  2BVC A;  5IAA C;  2LXA A;  3FC4 A;  3CMM B;  1OEY A;  3CIR B;  4USA A;  2NPT B;  4WQO B;  3ZVV A;  3NHE B;  4A20 A;  3MC0 B;  1SE4 A;  1L0X B;  2EMS A;  3AE9 B;  3EFC A;  2WP9 B;  1WIA A;  3KH0 A;  3RUL A;  2EKE C;  4W9D A;  5G5G A;  2AL6 A;  2V3N A;  1C77 A;  3CWI A;  4A8X C;  1LM8 B;  1FCL A;  1P98 A;  3NZS A;  1T3Q A;  2REX A;  3NRZ A;  3MFG A;  2GRI A;  2HTH A;  4HWI B;  1LFD A;  2KO3 A;  2ZVO A;  2KAC A;  3AE3 B;  1FMA D;  2LI5 A;  4K1R B;  3L16 A;  3MTN B;  3VUY A;  4OVU A;  1ACC A;  4IUM B;  3L13 A;  2K0P A;  4F8C B;  4WWP A;  3A9K B;  3CST A;  3ZNZ B;  4DDI D;  1FRD A;  3DBL B;  4NQK E;  2PE6 B;  3N32 A;  3PRE A;  1V5T A;  2BKF A;  4C7Y A;  2D3A A;  2B3A A;  3IXS A;  4N6E B;  4OW0 A;  3HM6 X;  1PGB A;  3AEE B;  2AYO B;  3AED B;  2JYT A;  4ZHO A;  3K9P B;  1WYG A;  2J53 A;  2JZ3 B;  3VVW B;  4LNK A;  4XWT A;  4YL8 A;  2N4F A;  3U52 E;  2KWD A;  5C1Z A;  1WX7 A;  3I9V 1;  3V60 A;  1IBX A;  1OGW A;  1HZ5 A;  1VJK A;  3BVG A;  4A90 A;  3OWE B;  2ON8 A;  5BMH A;  4I6P A;  1D5Z C;  4GDK B;  1YQ3 B;  3BIN A;  2PKO A;  2BKR B;  3RD2 A;  3ZTD A;  1E8Y A;  5J2R A;  4HCN B;  4HPL B;  1FXI A;  4HJK A;  1V6E A;  3VRA B;  3L10 B;  2MBO A;  1R4M B;  3EEC A;  3TJP A;  1GB1 A;  2CS4 A;  2WNM A;  2GOW A;  2N9L A;  2GBK A;  2PPH A;  3DHG C;  3KUD B;  2XK5 A;  3VR8 B;  4LDT D;  5AEK B;  2HD5 B;  4W9L A;  1RWS A;  4LCD E;  3P4R B;  4RH6 A;  4N9F 4;  4P1C C;  3TUO A;  4FHK A;  4RFB A;  3ZUN A;  1PDX A;  4WJO A;  4XDD A;  3MJW A;  3VDZ A;  2WXJ A;  2DYO A;  2WYQ A;  3TEY A;  1PQS A;  2ZEQ A;  1R7S A;  1UGM A;  2JU6 X;  1YX5 B;  1WJU A;  2L76 A;  4NZL B;  3RNC C;  2WXI A;  3ZYY X;  1E7U A;  4RGN A;  4OHJ A;  4CQN A;  1HTQ A;  5DCN A;  2J4X A;  4P16 A;  3NVV A;  2MJ3 A;  3LDZ E;  1JWA D;  4AWJ A;  1ZE3 D;  4J6I A;  1VCB A;  2W54 A;  1J8C A;  4HRS A;  1LQB A;  4PS3 A;  5FR3 A;  3SU8 X;  1E7V A;  2KTR B;  4YTP B;  2RMM A;  4BAX A;  3NS8 A;  1P7F A;  4JIO U;  3L4P A;  1Y56 A;  3D32 A;  4ZOH C;  4KSK C;  5G2N A;  3DBR B;  4EE2 A;  3ZNG C;  2LVO A;  2ZCC A;  4C7Z A;  2JPH A;  2ZVN A;  3OLM D;  2KYW A;  4GU2 A;  4ARC A;  4PS7 A;  3VTV A;  4M0W B;  3IHP C;  1ZXI A;  3MHS D;  2PEA A;  2FAZ A;  3PLU A;  2XK5 B;  5BYR A;  3A4R A;  1GOZ A;  2LAS A;  4I6L B;  3NG0 A;  1XD3 B;  4R3D A;  2LGY A;  2GBM A;  3VH4 B;  5CHV C;  1FXT B;  2KK8 A;  2LHD A;  2PMV A;  4FN2 A;  4G0N B;  4ZDV A;  2EEL A;  2K8H A;  4MH0 E;  1C3T A;  3KUZ A;  1RRB A;  3VUX A;  3PZ8 A;  5E6P A;  3PPA A;  2K39 A;  3GE3 C;  1I4G A;  2D3G A;  2DX5 B;  1FCC C;  3V62 A;  2IDY A;  1L5P A;  2HE7 A;  2LHE A;  2J52 A;  2GLS A;  4MGK E;  2LMC A;  1TS4 A;  1PYW D;  2LVQ A;  1I4P A;  2N0S B;  3R3M A;  1T0R C;  2MJE A;  4GLS C;  2H89 B;  3DCG A;  4YSX B;  2L83 A;  1MI0 A;  2Z59 B;  1JCK B;  2WWZ A;  1YIW A;  2Y3A A;  4LNF A;  1WWT A;  3ZKJ C;  3A9K A;  2ZPN A;  4REZ A;  2CR5 A;  1TJE A;  4KX6 B;  4KIK A;  4YWG G;  1UD7 A;  3APF A;  4KDI C;  3U7Z A;  4B0M A;  2IGD A;  3QHT A;  3BYY B;  1SXT A;  2JSV X;  3WIM A;  1TIF A;  3GZN B;  2NR2 A;  2L1A A;  2O6V D;  1I4H A;  4JPS A;  3DBS A;  1WGR A;  3ZDT A;  3ZXV A;  1WR1 A;  3M95 A;  3S2A A;  1BUI C;  1J0G A;  1T0Q C;  1PGX A;  3BII D;  3QK0 A;  1XEE A;  1UGJ A;  3IBE A;  2FE8 A;  3P2B A;  1HXY D;  4L23 A;  2DAF A;  1WX8 A;  2VH1 A;  1ZDV A;  2L05 A;  3AUL A;  3KVF B;  2CHX A;  1KRH A;  3QA8 A;  2KFK A;  4HCP B;  1UZX B;  1OFF A;  1P0R A;  2LUE A;  3ETR A;  4RM8 A;  1D4B A;  3QAQ A;  1WZ0 A;  1J7A A;  3A9J B;  3P4Q B;  4GSW A;  2BB6 A;  3UIO B;  3RFZ B;  1YQB A;  4YXD B;  2K6Q A;  1SIJ A;  4C4V A;  1V80 A;  4YTM B;  3NZ3 A;  3V3X A;  1P3Q U;  1LXD A;  3W1S C;  1WY8 A;  1E7P B;  1F9J A;  3NOB A;  4CYE A;  3UF8 A;  3ZTC A;  3BK1 A;  2NVU I;  2MX2 A;  2KFJ A;  2WXF A;  1KLG D;  4ZRJ A;  5BYQ A;  2CHW A;  1V49 A;  4MJS A;  1SGH A;  3PT2 B;  2Y5P A;  4YTN B;  4ANX A;  2C7N B;  3ZGZ A;  2MWS B;  2X38 A;  1CK1 A;  2W3R A;  3Q3O C;  1OQQ A;  4NAW B;  2EKI A;  4DHZ B;  1L4D B;  3ZRF A;  2ZNV C;  3AE7 B;  2ASQ A;  2BF8 B;  3BK2 A;  4W9H A;  1AYF A;  3KWL A;  2KTF A;  5LNK 1;  2N7D A;  2ZCB A;  3JSV B;  1GJZ A;  1MFW A;  4MGY E;  1IYF A;  2KVZ A;  4GGQ A;  1KJT A;  5BMG A;  4EUT A;  1H4R A;  4RCO A;  3V61 A;  1KLV A;  4LTU A;  2IO2 B;  2VZK B;  2RDH A;  2MHJ A;  1MHX A;  3A4S C;  1ZP0 B;  4L1B A;  1B9R A;  2KWU B;  3EHV A;  4P7I A;  1N5X A;  4GXB A;  1NEN B;  4HPP A;  1UBI A;  2M0X A;  1TT5 B;  4NJ6 A;  2M56 B;  4JLC A;  2BPS A;  4NPN A;  1WJ6 A;  1KOT A;  4IWQ A;  1YQ4 B;  2RSU A;  4MGI E;  3EFU A;  2CU3 A;  3T3O A;  3IAS 1;  3GE8 C;  4DBG A;  1GC7 A;  2BS3 B;  5FK9 C;  2FIF A;  3DWG C;  5HG2 A;  3SEB A;  2QJL A;  2BS4 B;  2FUG 1;  1E8Z A;  3W1S A;  3R66 C;  3DBH B;  1WXA A;  4H2A A;  3ECI A;  1UEL A;  1MVK A;  2KWV B;  1J7C A;  3OG5 A;  3P4S B;  1P1A A;  5BMI A;  2KKC A;  4NJ7 A;  1HEZ E;  1FRR A;  4TMA B;  1M4V A;  1N60 A;  3ZJV A;  1NI3 A;  2WDT B;  2BWE S;  1V9J A;  1SE3 A;  3OJ4 B;  1G6J A;  1NDD A;  1I4R A;  5JXV A;  5JHB A;  3P63 A;  3DWM A;  2LVP A;  4OVZ A;  1SIF A;  3AE2 B;  4S0R A;  3PRP B;  3Q3M C;  1NYR A;  1MG4 A;  1EWC A;  3Q69 A;  4MSM B;  4B9K A;  2L00 B;  2KMA A;  4RMA A;  1JW9 D;  4E71 A;  2CJN A;  1STE A;  2LGX A;  3X23 A;  4FAD A;  1TYG B;  2LFI A;  3Q8C A;  2QEJ C;  3VH3 B;  1FNV A;  1VZ7 A;  2KHW B;  1UWX A;  5H8Y E;  2NS5 A;  4M8N A;  2QMT A;  2KJH B;  3HVZ A;  2GI9 A;  3RN9 C;  3H6N A;  5E6J A;  3RNG C;  3T9L A;  2KXJ A;  4GDK A;  1SE2 A;  2UYZ B;  4KZ0 A;  4G50 A;  5JHA A;  5EE9 A;  4FJV B;  2NTS A;  4YSZ B;  2XBB C;  4JQW C;  1YN4 A;  2WX0 A;  3TEW A;  2KQ4 X;  2JWU A;  1WGH A;  1TS5 A;  2MA9 B;  3WAP A;  5G55 A;  3A9J A;  3QQ8 B;  3AV8 A;  4IM0 A;  2BBC A;  1HZ6 A;  2LRU A;  3VTU A;  4IM2 A;  5IA7 A;  2WQY B;  2Z8L A;  1T5X D;  2WXO A;  3RPF C;  3AEF B;  2JT4 B;  5E6O A;  4DDG D;  3C19 A;  2WXK A;  1X1M A;  1C1Y B;  3P4P B;  2MEK A;  3W9C B;  1VDV A;  2BT6 A;  1WJ4 A;  4DXF A;  2VZK D;  2W82 A;  1L2N A;  1VZ8 A;  2OHF A;  1QOF A;  2TSS A;  2M19 A;  1KH0 A;  1KM7 A;  2IY1 B;  4ARI A;  2WX1 A;  3EGR A;  3AB5 A;  2WS3 B;  2I1K A;  2KNB A;  3U30 A;  2V1Y A;  1XLP A;  3AU4 A;  5C2T B;  4BBN C;  4RM9 A;  2IND C;  4OZB A;  3U4E G;  4GB9 A;  1WRI A;  4L2Y A;  2IPK D;  1ZXH A;  4EZK A;  4F7Z A;  2MW5 A;  2WDV B;  4BKT A;  1DOI A;  4HKZ E;  2Z0E B;  3SFE B;  1EO6 A;  2BW2 A;  2KTR A;  3EUB 2;  4RF1 A;  1YN5 A;  3L17 A;  5GMV A;  1XF5 L;  4E74 A;  1LO5 D;  1WXS A;  4C80 A;  4BKG A;  4BFR A;  3WA0 A;  3DBH I;  3QJZ A;  1P9D U;  5D6J B;  1RLF A;  2V9H A;  2WU2 B;  3KWV A;  3KQ4 A;  5L95 C;  3VQI A;  1JWB D;  1WE7 A;  2RDB C;  4LJP B;  3ZW3 A;  3ZO5 B;  3PS6 A;  2Z0D B;  2JVC A;  2BGF A;  2L32 A;  4M0W A;  2IO0 B;  3M3J A;  4AOF A;  1YJ1 A;  1YN3 A;  2BYE A;  2MH7 A;  5LXI B;  2IO3 B;  3RNB C;  4KIK B;  1FXA A;  2QCZ A;  4EFO A;  2YEP F;  2N1W A;  4ZYN A;  4HPM B;  5I4D A;  1ZUD 2;  4C56 C;  4RGM A;  3R2I A;  2PJH A;  5KHO A;  5AZH A;  1ENF A;  1Q5W B;  2RPV A;  2RDG A;  2RD0 A;  4JGH B;  3ZDM C;  1WXM A;  4XDC A;  2FUH B;  1FNU A;  3I3T B;  1K53 A;  4OZA A;  3RYT A;  4US8 A;  3JW0 X;  4BOZ B;  4HLE A;  1SJE D;  1Q10 A;  4US9 A;  1ZPS A;  1F2R C;  4EKU A;  4ZHP A;  2YVC A;  3ONS A;  1FPY A;  1ROE A;  2M4N A;  1ET6 A;  1WGG A;  4HKQ A;  1TKY A;  1TKG A;  2XN9 C;  2EMT A;  2LJ5 A;  2AQ3 B;  2MBE A;  3ZRC A;  4XE0 A;  1AAR A;  2WLB A;  2M8S A;  1DYQ A;  4N59 A;  1WE6 A;  1VD2 A;  2WXG A;  1QZE A;  2JX5 A;  2K8C A;  3HVD A;  1V97 A;  3SDL C;  1UF0 A;  1L6V A;  1UNS A;  2MBQ A;  3ZQ4 A;  2LXC A;  1F2R I;  1OQY A;  2D3B A;  1PUT A;  5HHD G;  4HDQ A;  3DHI C;  1XLQ A;  1WGD A;  2G1E A;  3J9C A;  2MQJ A;  2MCN B;  3KW5 B;  2B76 B;  2KDM A;  1TZ1 A;  4DWF A;  2I38 A;  5AUI A;  3IT4 B;  2KDI A;  4OVV A;  2JRI B;  2RPQ A;  2R61 A;  3Q2A C;  2UWQ A;  1OEY J;  5D3D A;  1AN8 A;  4WWM A;  2WDR B;  1LGR A;  2FCN A;  3PHX B;  1E8W A;  4C00 A;  2BTE A;  1SE9 A;  3QX1 A;  1I35 A;  3R8B A;  2WXM A;  3PO0 A;  1Z2M A;  1L6U A;  1RFA A;  2IO1 B;  2KFK B;  2X8X X;  2R2O A;  4GDL A;  2LD9 A;  2JWZ A;  4TV3 A;  5MPO A;  3B9J A;  2N9E B;  1D5X C;  1JRU A;  2ICI A;  1TTN A;  1E6E B;  1WXV A;  3WAL A;  1Y8R C;  2KC1 A;  2PIA A;  3RZW C;  3E56 A;  1I4Q A;  3NVW A;  3PV1 A;  2LGD A;  4ANU A;  1P7E A;  4BBN F;  1R4N B;  2KOX A;  2I1J A;  3Q3N C;  1YD8 U;  2PW9 A;  4UDU C;  2ZW0 A;  1F0Z A;  2CHZ A;  1TY2 A;  4NQL B;  2LUM A;  5EDS A;  2IYD B;  4DXA B;  4HDO A;  1HTO A;  4A9A A;  3AM9 A;  1T6B X;  3R7Q A;  4MGZ E;  5D7G A;  1XO3 A;  4BKS D;  2KDF B;  4HXD A;  4TUU A;  2L8J A;  4JL9 A;  1SEB D;  3W5V B;  1QKZ A;  3X0W A;  3N3K B;  4M02 A;  1DOX A;  1VRA B;  4PYU A;  1JQ4 A;  2MRP A;  4W9C A;  4IG7 B;  3AE5 B;  4ZRK A;  4AJW A;  1JWM D;  3RMK C;  3AEG B;  2J7Q B;  4KSL C;  1YJJ A;  1EU4 A;  2N1V A;  4XYC A;  3OJ3 A;  3PZD A;  3QAR A;  1L0V B;  1GAQ B;  2N9P C;  4ANW A;  3KUC B;  4AJY B;  3B1L X;  3B08 A;  4IDI A;  1VZ6 A;  3JSV A;  4KDL B;  1QIL A;  2LJI A;  2QSD A;  2LGS A;  1GPX A;  2JZP A;  4K3C A;  3ENE A;  4WWN A;  3MP9 A;  2HJ1 A;  5KHQ A;  2K1F A;  1EU3 A;  3SFD B;  5CHW A;  1V81 A;  4W9G A;  5J18 A;  3U8Z A;  1SB3 C;  2ZZP B;  2GBJ A;  3WAO A;  2NCN A;  1XQQ A;  1ZOY B;  1RFK A;  1WM2 A;  4P6V F;  2PE9 A;  5EE0 A;  3DVN V;  3DVG Y;  1YMH E;  3IVF A;  1S1Q B;  1WGY A;  3PRM B;  3B0A A;  2J0J A;  3O65 B;  2IGG A;  1S3S G;  2J0M A;  3TSS A;  4ZRI A;  1FNW A;  3N20 C;  5LXH A;  2L0T A;  2KN4 A;  2INC C;  3ZNH B;  1EF1 A;  1RYJ A;  3LXF A;  4IC7 B;  2G4S A;  5BYS A;  4MSQ B;  1OTR B;  4OZC A;  1Q0W B;  3ZNI D;  1MJD A;  3Q3F A;  2ZJD A;  3AN1 A;  5EE1 A;  4M01 A;  1WFY A;  2DYM A;  5DPS A;  2NBW B;  5DPR A;  3RT3 B;  2V0G A;  3W5U B;  3A33 B;  1V2Y A;  2KJ6 A;  1WI0 A;  3ZJU A;  3L08 A;  3VTW A;  1B1Z A;  2NBU A;  2JYE A;  2CJO A;  2BS2 B;  2D07 B;  4DXG A;  1FO4 A;  4WJP A;  4DHZ E;  1ZGU B;  2J42 A;  1UH6 A;  3UIP B;  5GXG B;  2QC8 A;  2BYV E;  4FJZ A;  1V1P B;  1GC6 A;  1MPE A;  1K51 A;  2XNA C;  2G4D B;  3I5J C;  2INP E;  2W55 A;  2C7H A;  3DOW A;  2MP2 B;  2DYB A;  2IJ0 A;  1A70 A;  3R7R A;  4HRO A;  4TKN A;  1F77 A;  3HRD D;  2WXP A;  1XLN A;  2NTT A;  2I2Y A;  3GS2 A;  2M1M A;  2BYT A;  2C7M B;  1Q1O A;  1R4N I;  1TKE A;  1D6E C;  3HK0 A;  4LLG M;  1L0Y B;  2AQ2 B;  4RGT A;  4S17 A;  2WU5 B;  3SR6 A;  2IGH A;  3AEA B;  2JF5 A;  3V05 A;  3A1Q B;  2KQ7 A;  3JYU A;  3NY5 A;  4FXC A;  5L83 A;  3VHT C;  5AZG A;  1HE8 A;  4PK1 A;  2G45 B;  2Y5B B;  2ZW1 A;  4WAA A;  1IBX B;  4LNN A;  4PS8 A;  2AEH A;  3M63 B;  1PFD A;  3Q14 C;  2AQ1 B;  3PVL A;  2MBH A;  1ZDX A;  4XWW A;  1KTK A;  4K7S A;  2BB5 A;  3HUI A;  4II3 B;  4PT5 A;  2WGS A;  2H88 B;  4MEM A;  5IOI A;  1WJN A;  2N9X A;  4K7U A;  1A5R A;  3AU5 A;  1EF5 A;  2D2Q A;  3QWZ B;  3Q8F A;  2OJW A;  2BYF A;  4ANV A;  1E10 A;  1WH3 A;  4A3O A;  3I63 C;  3AXC A;  3TEX A;  1V8C A;  3E9S A;  3Q3J A;  1K52 A;  3BY4 B;  3TCA A;  1JRO A;  3DBL I;  1OQR A;  3Q8E A;  4GOC A;  1WGK A;  4RNA A;  3MC9 A;  2A4Z A;  2KQS A;  4II2 B;  3AH7 A;  1AWD A;  2FBW B;  5J17 A;  1QQR A;  5FR6 A;  3U2S C;  4AUQ C;  4JX1 C;  2K8B A;  3N30 A;  4MH8 A;  2L52 A;  4KGS A;  3VXW A;  3WCQ A;  1WM3 A;  1WYW B;  1TS3 A;  3A1Q A;  1E90 A;  1QLB B;  2WXH A;  5G5H A;  2LEK A;  4WQM A;  3IFW B;  4IM3 A;  1QF6 A;  3MJ5 A;  2YEP B;  3UGB B;  1MHH E;  3TL5 A;  3IT6 B;  2LZ6 A;  1EM7 A;  3BYT B;  4LDT B;  2ZPY A;  1E5W A;  1TY0 A;  4FLH A;  5C23 A;  1D3Z A;  5T8I A;  4JWS C;  1IGD A;  4YSY B;  4MT5 A;  4JWU C;  3BVZ A;  4A3P A;  1TBE A;  3N9Y C;  3Q8A A;  1QOB A;  3QC8 B;  2PVG C;  5AUK A;  4BVU C;  2DNF A;  2O6V B;  2GBN A;  4BKS A;  3QIJ A;  3DVN U;  1KLU D;  3I57 A;  1XCT L;  2DEN B;  2DWQ A;  4J3O D;  4HK2 A;  1FIQ A;  4DK5 A;  4ASW C;  2C60 A;  3PSE B;  4IW0 A;  5HKH A;  2N7J A;  1SSN A;  4BZA A;  2Q5W D;  3HIZ A;  1C79 A;  2MLB A;  1SJH D;  1N5W A;  2N7E A;  3ZXR A;  1UWM A;  2IZV B;  3PRZ A;  3TIX A;  2CKH B;  2AL3 A;  4GN1 A;  2KWC A;  2K6D B;  3AEB B;  1WX9 A;  3H8H A;  4ZRQ A;  2MBB B;  3VAW A;  2LGI A;  2G3Q B;  2V4I B;  1V1O A;  3L54 A;  1TS2 A;  2G9H D;  4F1S A;  3AE4 B;  1UUP A;  1WMH A;  4IKG A;  4KVG B;  3AMZ A;  5HI1 A;  5C3J B;  2OOB B;  3H9D A;  3UIN B;  4AP4 C;  3NVZ A;  1VR9 A;  4EZJ A;  2GBR A;  3P1M A;  5JH5 C;  2DLB A;  1ZW7 A;  4EEW A;  4D2K A;  2YLM A;  4W9I A;  2ZNV B;  1SBB B;  4WWO A;  1K50 A;  1XT9 B;  2KZR A;  1FFU A;  2SAK A;  2XEW A;  3VR9 B;  4EZL A;  2C5L C;  1XCQ L;  2DZM A;  3GZN I;  1AW7 A;  1D5M C;  2JRH A;  3IAM 1;  1I7H A;  4ICU A;  1GUA B;  2KD0 A;  2K9X A;  5CTR C;  2PTL A;  2JY6 A;  3PLV A;  4TSS A;  2FCS A;  2FCM A;  2KDB A;  1QOG A;  1HA5 A;  1NBF C;  4KGR A;  3RNA C;  4KV2 A;  4M00 A;  2KVR A;  2PVO D;  3BWU D;  4XGA B;  4I6N B;  2DZK A;  4DHJ B;  3TEZ A;  2V3S A;  1EUV B;  2VRR B;  3AE1 B;  4GDL B;  4NAM A;  3GOE A;  1U4A A;  1IP9 A;  3U7D A;  4GIV A;  2NPT A;  3HM3 A;  3DDC B;  1C4A A;  3ZJT A;  3AE8 B;  3FKY A;  4TQ1 A;  4P1B C;  1CZP A;  1IPG A;  1JML A;  3MHZ A;  3VRB B;  3P42 A;  3Q8B A;  4B0E A;  2UU7 A;  5D94 A;  4G11 A;  4LK0 M;  1WSP A;  3RZF A;  4RGO S;  3B2F A;  3T8M A;  1GB4 A;  3DVG X;  3WAM A;  2WDQ B;  1FM0 D;  2D3C A;  4AS1 A;  1YOV B;  4C4V B;  3KYD D;  5IO9 A;  2R2Q A;  1E8X A;  3APC A;  1WR6 E;  3PGE A;  4WUR A;  2DBY A;  3GB1 A;  5JZE B;  1PGA A;  4EOY A;  1UBQ A;  4TQ0 A;  2M17 A;  2W3S A;  2PLP A;  4RF0 A;  4FHJ A;  4G3X B;  4K3B A;  2KN5 A;  1ISN A;  4URK A;  2W9N A;  4ZRP A;  4IWP A;  3T3N A;  1SF0 A;  2V3P A;  2A5U A;  4JE3 B;  1T0Y A;  2JUO A;  2KAJ A;  2KX3 A;  2O2V A;  3L0W B;  2NBV B;  2HDE A;  2OED A;  2LRW A;  1C78 A;  4LNI A;  3GP7 A;  4CHK A;  4W9K A;  1I42 A;  4QAY A;  1ZKH A;  1IGC A;  3UI3 A;  1E0Z A;  5IKC M;  4X57 B;  4N58 A;  4ACF A;  1C4C A;  4HEA 1;  3ML9 A;  2MP2 A;  2MJD A;  1KFY B;  5CX3 A;  1BXT A;  3APD A;  4MDK E;  4W9E A;  3V6E B;  1K8R B;  5TR5 A;  3CF6 E;  1NI2 A;  1YX6 B;  3R2T A;  2KJR A;  1C9F A;  5DPW A;  1J19 A;  5E6N A;  2E6X A;  3DQV A;  3DHH C;  2SEB D;  3H7P A;  2JQR B;  4LJO B;  4NY0 A;  1CMX B;  1QT9 A;  1C76 A;  5CHF A;  1E9M A;  3IG3 A;  3SD5 A;  4B6W A;  4ZYS A;  2DZJ A;  2KC2 A;  2QHO A;  2WHI A;  2JZZ A;  2WXL A;  1BT0 A;  1RAX A;  1L7Y A;  3LJ3 A;  2D10 A;  3CSF A;  2BWF A;  1Z5S B;  4FJY A;  1CJE A;  4KKJ A;  2INN E;  2VH2 A;  2KAN A;  3N1Y C;  1L4Z B;  5AZF A;  3NVY A;  3TBL D;  2QIE B;  2JXX A;  4B95 A;  4IOI E;  1NYQ A;  4FUL A;  3FAH A;  1R4M I;  1WMH B;  3ALB A;  4BOS C;  1I4X A;  5EE3 A;  3LB8 C;  3Q6B A;  2O2V B;  1DGJ A;  3C0R B;  2IBI B;  3AEC B;  1WZ3 A;  3KLS X;  5LLI A;  2KX0 A;  3H1U A;  2FID A;  2WXQ A;  5D3I B;  2KT7 A;  3BZD B;  4E3C A;  4W9J A;  2CU1 A;  3O13 A;  1FFV A;  4IWO A;  3AE6 B;  3NZU A;  4FBJ B;  2DHZ A;  3SHQ A;  1TZO A;  3ZIM A;  4HVB A;  1NEK B;  2MSE D;  1RM6 C;  1YJI A;  1H8C A;  3RNE C;  2L3Z A;  1HQR D;  2AX5 A;  2V4L A;  1XLO A;  1J7B A;  2L7R A;  3QCA A;  3ABV B;  5BO4 B;  4NAW A;  1TGZ B;  2WXR A;  2AWT A;  4FA6 A;  1WXQ A;  3AI5 A;  1YNT E;  3EA6 A;  1GG3 A;  4YT0 B;  1JWS D;  4KGT A;  3UQB A;  2K5P A;  3DPD A;  2N9K A;  5HFY A;  3PZ7 A;  3W2D A;  4A55 A;  1BML C;  1EWY C;  2ONQ A;  1NVI D;  3PTF C;  3ML8 A;  3RI7 C;  3NJT A;  2JXT A;  1XXG A;  4XC2 A;  3BVM A;  2OJR A;  5D2M B;  4DHJ D;  4O1N A;  1V5O A;  2D5G A;  2KMC A;  4A6Q A;  2HJ8 A;  5FKA C;  3RUI B; 
#chains in the Genus database with same CATH homology
 1UD7 A;  3APF A;  4KDI C;  3QHT A;  4M8M A;  3WIM A;  3PHW B;  2O6V A;  3UGB B;  3TL5 A;  2NR2 A;  2LZ6 A;  2O6V D;  4LDT B;  4XX5 A;  2ZPY A;  3DBS A;  4EKU A;  1WGR A;  2K25 A;  1E5W A;  3UQA A;  4FLH A;  2YVC A;  1WF9 A;  3ONS A;  5C23 A;  3ZDT A;  2M4N A;  1D3Z A;  1WGG A;  1WR1 A;  4NNJ B;  3VUW A;  3M95 A;  3S2A A;  4A3P A;  1GNU A;  2EMT A;  1J0G A;  2LJ5 A;  4WJQ A;  4WJN A;  2MBE A;  3QK0 A;  3IBE A;  4GMV A;  3ZRC A;  1TBE A;  2KDE B;  3P2B A;  4K81 A;  1AAR A;  3QC8 B;  2DAF A;  1WX8 A;  4BVU C;  2GMI C;  2M8S A;  2O6V B;  2GBN A;  1MG8 A;  1WE6 A;  4BKS A;  3EC8 A;  4CO7 A;  1VD2 A;  2L05 A;  3AUL A;  3DVN U;  3QIJ A;  4MEL A;  3KVF B;  2DAJ A;  1QZE A;  2DEN B;  2CHX A;  3HHM A;  2K8C A;  4HK2 A;  3QA8 A;  2KFK A;  3SDL C;  3VFK A;  4DK5 A;  4HCP B;  4MJS B;  4ASW C;  2MBQ A;  2C60 A;  3PSE B;  4IW0 A;  5HKH A;  3ZLZ A;  2LXC A;  2DZI A;  1UZX B;  2D11 A;  3M62 B;  3W1Y A;  1P0R A;  2LUE A;  3RCZ A;  3HIZ A;  4RM8 A;  1OQY A;  2MLB A;  4KZC A;  3QAQ A;  3V6C B;  1WZ0 A;  2N7E A;  3A9J B;  4GSW A;  2IZV B;  3PRZ A;  2J0K A;  4ICV A;  3TIX A;  2CKH B;  4HDQ A;  3UIO B;  1WGD A;  2AL3 A;  4GN1 A;  2MQJ A;  2KWC A;  2K6D B;  1YQB A;  1WRD B;  2MCN B;  2FCQ A;  2KLC A;  2K6Q A;  3KW5 B;  1WX9 A;  1V80 A;  2MBB B;  1TZ1 A;  4DWF A;  3VAW A;  4MM3 A;  1M94 A;  2G3Q B;  1P3Q U;  1LXD A;  2KDI A;  3L54 A;  1WY8 A;  2JRI B;  2RPQ A;  4OVV A;  3W1S C;  1F9J A;  3NOB A;  2UWQ A;  1OEY J;  4CYE A;  4F1S A;  3UF8 A;  3ZTC A;  5DPT A;  1WMH A;  2FCN A;  2NVU I;  3PHX B;  2RGF A;  1E8W A;  2MX2 A;  4KVG B;  1SE9 A;  2C9W B;  2KFJ A;  3QX1 A;  3H7S A;  1I35 A;  4K7W A;  2KLG A;  2OOB B;  4ZRJ A;  2RR9 A;  3OAW A;  1Z2M A;  3H9D A;  2CHW A;  1RFA A;  1V49 A;  2IO1 B;  2KFK B;  2IY0 B;  4W9F A;  4XZ4 A;  2R2O A;  3UIN B;  4GDL A;  4MJS A;  1SGH A;  2LD9 A;  3H7P B;  4AP4 C;  3PT2 B;  2JWZ A;  4EZJ A;  4TV3 A;  4ANX A;  2GBR A;  5JH5 C;  2C7N B;  2N9E B;  2FNJ B;  2MWS B;  1ZW7 A;  3K9O B;  4EEW A;  2LWP A;  1JRU A;  4PYZ A;  3KYC D;  3WAN A;  3TMP B;  2L0F A;  1TTN A;  3JVZ X;  2YLM A;  3DBR I;  4W9I A;  1WXV A;  3WAL A;  2ZNV B;  4NAW B;  1V86 A;  1Y8R C;  2KC1 A;  4WWO A;  3RZW C;  4DHZ B;  1XT9 B;  2LXA A;  5IAA C;  3CMM B;  2KZR A;  3ZRF A;  2ZNV C;  3PV1 A;  2LGD A;  2XEW A;  4ANU A;  1OEY A;  4BBN F;  2ASQ A;  2BF8 B;  4W9H A;  2KOX A;  4EZL A;  2C5L C;  2I1J A;  2KTF A;  2DZM A;  2NPT B;  3GZN I;  1YD8 U;  2JRH A;  2N7D A;  2ZCB A;  3JSV B;  1GJZ A;  4WQO B;  4ICU A;  3ZVV A;  1GUA B;  2KD0 A;  3NHE B;  5CTR C;  4MGY E;  4A20 A;  1IYF A;  2CHZ A;  2JY6 A;  3PLV A;  4NQL B;  4IM3 A;  5EDS A;  2FCS A;  2FCM A;  4GGQ A;  2IYD B;  1KJT A;  4DXA B;  2KDB A;  4EUT A;  1H4R A;  2EMS A;  4HDO A;  1NBF C;  3V61 A;  3R7Q A;  1KLV A;  4KV2 A;  4MGZ E;  5D7G A;  1WIA A;  2KVR A;  3KH0 A;  4BKS D;  3RUL A;  4I6N B;  2KDF B;  2EKE C;  2DZK A;  4HXD A;  4TUU A;  2IO2 B;  2L8J A;  4W9D A;  4JL9 A;  2V3S A;  1EUV B;  2VRR B;  4DHJ B;  2AL6 A;  4GDL B;  3GOE A;  3A4S C;  1U4A A;  1IP9 A;  1LM8 B;  3X0W A;  3N3K B;  3U7D A;  1P98 A;  4GIV A;  3NZS A;  2REX A;  2NPT A;  3HM3 A;  3DDC B;  4PYU A;  2HTH A;  4HWI B;  1LFD A;  2KO3 A;  2MRP A;  2ZVO A;  2KWU B;  4W9C A;  4TQ1 A;  3EHV A;  4IG7 B;  4ZRK A;  2LI5 A;  4K1R B;  4AJW A;  3L16 A;  4P7I A;  3MTN B;  3VUY A;  4GXB A;  2J7Q B;  4KSL C;  1IPG A;  4OVU A;  1UBI A;  2M0X A;  4NJ6 A;  2N1V A;  3OJ3 A;  3PZD A;  4IUM B;  4JLC A;  3L13 A;  2BPS A;  3QAR A;  4G11 A;  4NPN A;  5D94 A;  1WJ6 A;  4F8C B;  1KOT A;  4IWQ A;  4WWP A;  3RZF A;  2RSU A;  3A9K B;  4MGI E;  3CST A;  2N9P C;  3ZNZ B;  4ANW A;  3KUC B;  4DDI D;  3EFU A;  4AJY B;  3B1L X;  4NQK E;  3B08 A;  3T8M A;  1GC7 A;  4DBG A;  2FIF A;  3DVG X;  3JSV A;  3WAM A;  2PE6 B;  3N32 A;  4KDL B;  3PRE A;  1V5T A;  2BKF A;  1E8Z A;  3W1S A;  2B3A A;  3KYD D;  3R66 C;  2R2Q A;  1E8X A;  1WXA A;  1WR6 E;  3APC A;  3ECI A;  3HM6 X;  3ENE A;  1UEL A;  3PGE A;  4WWN A;  2KWV B;  5KHQ A;  1P1A A;  2K1F A;  2AYO B;  2KKC A;  4NJ7 A;  3K9P B;  5CHW A;  1V81 A;  4W9G A;  5J18 A;  2JZ3 B;  3U8Z A;  2ZZP B;  5JZE B;  2GBJ A;  3WAO A;  3VVW B;  2NCN A;  1XQQ A;  2WDT B;  4EOY A;  1UBQ A;  4TQ0 A;  2BWE S;  1V9J A;  3OJ4 B;  2M17 A;  2N4F A;  4YL8 A;  1G6J A;  1NDD A;  5C1Z A;  1WX7 A;  1WM2 A;  3V60 A;  5JHB A;  4FHJ A;  2PE9 A;  4G3X B;  1OGW A;  3DVN V;  3DVG Y;  2KN5 A;  3IVF A;  1S1Q B;  4I6P A;  1ISN A;  2LVP A;  1WGY A;  2W9N A;  4URK A;  3PRM B;  4GDK B;  3B0A A;  3BIN A;  4IWP A;  2J0J A;  2BKR B;  1SIF A;  2A5U A;  3RD2 A;  3ZTD A;  3PRP B;  1E8Y A;  3O65 B;  5J2R A;  4HCN B;  1S3S G;  4HPL B;  1T0Y A;  2J0M A;  4HJK A;  1V6E A;  2JUO A;  2KX3 A;  3L10 B;  4ZRI A;  4MSM B;  2MBO A;  2O2V A;  3L0W B;  4B9K A;  2L00 B;  2KMA A;  4RMA A;  2NBV B;  3EEC A;  3TJP A;  2LRW A;  5LXH A;  2CS4 A;  2L0T A;  3ZNH B;  4CHK A;  2GOW A;  1EF1 A;  4E71 A;  4W9K A;  4IC7 B;  2LGX A;  2G4S A;  1I42 A;  2GBK A;  2PPH A;  1ZKH A;  3X23 A;  4FAD A;  3KUD B;  2XK5 A;  4MSQ B;  1OTR B;  4LDT D;  1Q0W B;  3ZNI D;  5AEK B;  2HD5 B;  3Q3F A;  4W9L A;  2ZJD A;  3VH3 B;  4X57 B;  4LCD E;  1WFY A;  2KHW B;  4N9F 4;  2DYM A;  5DPS A;  2NS5 A;  3ML9 A;  2NBW B;  4M8N A;  5DPR A;  4FHK A;  3RT3 B;  3ZUN A;  2MP2 A;  3A33 B;  2KJH B;  1V2Y A;  2KJ6 A;  4WJO A;  3MJW A;  5CX3 A;  3VDZ A;  3APD A;  4MDK E;  1WI0 A;  4W9E A;  1K8R B;  3V6E B;  3L08 A;  3VTW A;  2NBU A;  5TR5 A;  3H6N A;  2DYO A;  2WYQ A;  3CF6 E;  1NI2 A;  3T9L A;  1YX6 B;  1PQS A;  2D07 B;  2KJR A;  2ZEQ A;  1UGM A;  4WJP A;  4DHZ E;  1ZGU B;  2KXJ A;  4GDK A;  1UH6 A;  1YX5 B;  5DPW A;  3UIP B;  1J19 A;  2BYV E;  2UYZ B;  4FJZ A;  4KZ0 A;  5E6N A;  1WJU A;  2L76 A;  1GC6 A;  3DQV A;  4G50 A;  5JHA A;  2G4D B;  1E7U A;  4FJV B;  3H7P A;  4LJO B;  4NY0 A;  5DCN A;  1CMX B;  2C7H A;  5CHF A;  3DOW A;  2MP2 B;  2DYB A;  3IG3 A;  3SD5 A;  4B6W A;  2XBB C;  4JQW C;  2DZJ A;  3R7R A;  3LDZ E;  4AWJ A;  2KC2 A;  4TKN A;  2QHO A;  2WX0 A;  4J6I A;  2JZZ A;  1VCB A;  1BT0 A;  1WGH A;  1RAX A;  2MA9 B;  1J8C A;  1L7Y A;  3WAP A;  1LQB A;  5G55 A;  3A9J A;  3QQ8 B;  4PS3 A;  3LJ3 A;  4IM0 A;  2D10 A;  3CSF A;  2BWF A;  3SU8 X;  2M1M A;  1E7V A;  2LRU A;  2C7M B;  2KTR B;  1Z5S B;  4FJY A;  1Q1O A;  4IM2 A;  3VTU A;  1R4N I;  5IA7 A;  3NS8 A;  2KAN A;  4JIO U;  3HK0 A;  5AZF A;  2JT4 B;  5E6O A;  3D32 A;  4DDG D;  3TBL D;  4KSK C;  1X1M A;  1C1Y B;  5G2N A;  2JF5 A;  3ZNG C;  3A1Q B;  1WJ4 A;  2JXX A;  2KQ7 A;  2LVO A;  4B95 A;  3JYU A;  2ZCC A;  1L2N A;  3NY5 A;  2JPH A;  2ZVN A;  3OLM D;  4FUL A;  5L83 A;  1R4M I;  1WMH B;  3ALB A;  4BOS C;  4GU2 A;  3VHT C;  5AZG A;  1HE8 A;  4PS7 A;  3VTV A;  1KM7 A;  2IY1 B;  2G45 B;  2Y5B B;  2O2V B;  4M0W B;  3IHP C;  3MHS D;  2WX1 A;  3C0R B;  2IBI B;  4WAA A;  1WZ3 A;  2I1K A;  4PS8 A;  2KNB A;  2PEA A;  3U30 A;  2AEH A;  3M63 B;  5LLI A;  2V1Y A;  3PVL A;  2FAZ A;  3AU4 A;  3PLU A;  4BBN C;  2XK5 B;  4RM9 A;  3A4R A;  2MBH A;  2KX0 A;  3H1U A;  2LAS A;  2FID A;  4GB9 A;  4I6L B;  4K7S A;  1XD3 B;  4E3C A;  4II3 B;  4W9J A;  2CU1 A;  2LGY A;  2GBM A;  4MEM A;  3VH4 B;  4EZK A;  4IWO A;  1WJN A;  5CHV C;  2N9X A;  1FXT B;  2MW5 A;  3NZU A;  4K7U A;  3AU5 A;  4F7Z A;  4FBJ B;  1EF5 A;  1A5R A;  2DHZ A;  4BKT A;  3SHQ A;  2KK8 A;  2D2Q A;  2Z0E B;  3QWZ B;  3ZIM A;  1EO6 A;  2BYF A;  2KTR A;  4FN2 A;  4HVB A;  2MSE D;  5GMV A;  4ANV A;  3L17 A;  4G0N B;  1WH3 A;  1H8C A;  4A3O A;  4E74 A;  4ZDV A;  1WXS A;  4BKG A;  2K8H A;  2L3Z A;  4BFR A;  3AXC A;  4MH0 E;  1C3T A;  3WA0 A;  3DBH I;  3QJZ A;  3KUZ A;  1P9D U;  1RRB A;  5D6J B;  3VUX A;  1RLF A;  3Q3J A;  2V4L A;  5E6P A;  3VQI A;  5L95 C;  3PPA A;  1WE7 A;  2L7R A;  3BY4 B;  4LJP B;  3ZW3 A;  3QCA A;  3TCA A;  3ZO5 B;  3PS6 A;  2K39 A;  2Z0D B;  3DBL I;  5BO4 B;  2JVC A;  4GOC A;  4NAW A;  2BGF A;  2D3G A;  1TGZ B;  2DX5 B;  3V62 A;  2HE7 A;  2A4Z A;  2IO0 B;  2KQS A;  3M3J A;  2AWT A;  4FA6 A;  3AI5 A;  4AOF A;  1YJ1 A;  4II2 B;  2BYE A;  4MGK E;  5LXI B;  2IO3 B;  1GG3 A;  5J17 A;  4KIK B;  5FR6 A;  4AUQ C;  2K8B A;  2LVQ A;  3N30 A;  4EFO A;  2N1W A;  4ZYN A;  3R3M A;  4HPM B;  3UQB A;  3DPD A;  2PJH A;  5KHO A;  5AZH A;  3VXW A;  3DCG A;  1Q5W B;  4JGH B;  2RD0 A;  3PTF C;  2Z59 B;  3ZDM C;  1WM3 A;  3ML8 A;  1WYW B;  1WXM A;  3A1Q A;  4XC2 A;  2WWZ A;  1YIW A;  1E90 A;  2OJR A;  5D2M B;  2FUH B;  4DHJ D;  3I3T B;  3ZKJ C;  3RYT A;  3A9K A;  1V5O A;  2ZPN A;  2KMC A;  2HJ8 A;  2CR5 A;  3IFW B;  3JW0 X;  4KIK A;  4BOZ B;  4HLE A;  3RUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...