1WJUA

Solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
GSSGSSGDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8 ultimate buster-1
publication title Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjuA00
3DDCB 4XC2A 4HLEA 2MX2A 2DYMA 4EOYA 5AZHA 3QA8A 4KV2A 3ZNZB 2O6VA 4A3PA 4NQKE 2DAFA 5CHVC 5D2MB 3ZRFA 4LDTD 3V6EB 4A3OA 3PRZA 3ZLZA 1YX6B 4HPLB 4ANWA 3DBLI 2N9EB 2M4NA 2GBNA 2NCNA 2O6VB 3L17A 5D6JB 1GJZA 3NS8A 2K8BA 5DPTA 1TGZB 4E74A 2ZJDA 4RMAA 1WR6E 3WANA 4MSMB 2KTRA 1WY8A 1IYFA 3UIPB 1FXTB 4HPMB 3W1YA 2UYZB 4NPNA 3R66C 4A20A 4W9KA 3QAQA 3SHQA 2KWVB 3U8ZA 1WIAA 2XK5A 4MELA 3ZTCA 2M8SA 1EUVB 3OLMD 1WJ6A 1KLVA 4LJOB 4IM0A 1I42A 3L54A 4MGZE 2EMTA 4FULA 5G55A 2IO2B 2KQ7A 2MWSB 3DBRI 4W9JA 3ZDTA 3PHXB 4PS7A 2XK5B 1EO6A 3JVZX 5IA7A 3SDLC 3T9LA 3EECA 2NR2A 1TTNA 4GMVA 3L0WB 2DYBA 2KC2A 3V6CB 4ASWC 4BOZB 2K6QA 2DYOA 5BO4B 4E71A 3M63B 1ZW7A 1BT0A 3P2BA 2R2QA 3V60A 4G0NB 3B1LX 2L00B 4W9DA 3SU8X 3TIXA 4IUMB 1NBFC 1P1AA 1LM8B 2FCMA 4M0WB 2L7RA 4K1RB 1H4RA 3U7DA 2R2OA 1WX9A 3KVFB 1UH6A 2CHXA 3X0WA 1E8ZA 3ZNGC 2Y5BB 4EEWA 2BGFA 4ZRJA 2KLGA 2KZRA 4TQ0A 1UGMA 2ASQA 2KDEB 2LXAA 2N1WA 3UGBB 3PS6A 1P9DU 2ZNVB 1ZKHA 2KK8A 2NBUA 2V3SA 3QK0A 5GMVA 3ZDMC 4DHJB 1NDDA 4FN2A 4AWJA 1C1YB 1WMHB 1WGGA 1R4NI 1CMXB 1AARA 3IFWB 1WX7A 4ICVA 2CKHB 4DK5A 4ANUA 1V9JA 3GOEA 4MJSA 3ALBA 2BYVE 2KN5A 3ONSA 5CX3A 5AZGA 3WAMA 2ZVOA 2LXCA 2J7QB 2WWZA 3M3JA 2W9NA 3DOWA 3WIMA 2KD0A 4I6PA 3VTWA 3DBHI 1J0GA 1Q1OA 3DPDA 1UBIA 4W9CA 1UD7A 1WJNA 2D07B 2J0KA 2GBRA 1J8CA 2KDBA 3QX1A 1WJ4A 3A33B 3VUXA 5E6NA 4ZRIA 3VXWA 4DHJD 3RCZA 1UBQA 2ZZPB 2I1JA 3HIZA 3L16A 4E3CA 2JPHA 3PGEA 2C60A 3A4SC 4XZ4A 1WGHA 3N30A 4AUQC 2HE7A 2CS4A 5J2RA 3UINB 1U4AA 3VTVA 3A9KB 2KDFB 3AULA 3PZDA 1TBEA 2DZIA 3OAWA 2I1KA 3BINA 4CHKA 2UWQA 2JZ3B 3PHWB 1E8XA 4BKSA 4IWOA 3M62B 3IHPC 2L05A 2PJHA 3KW5B 2RPQA 3NY5A 2LJ5A 1V49A 2J0MA 3ML8A 4GIVA 1WJUA 4JGHB 4JL9A 4IC7B 4N9F4 1WGDA 3L13A 3QARA 4WWPA 2AL3A 2KFKA 3QJZA 1SIFA 2C5LC 2DZKA 1V5OA 2IY1B 2BKFA 4BKGA 3RD2A 1WZ3A 1GC6A 2JXXA 4EFOA 2FCNA 2YVCA 4DXAB 2KXJA 2JWZA 2KFKB 4HWIB 5AEKB 3PVLA 3ENEA 2O2VA 1J19A 1OQYA 3CSTA 4HCPB 2ZEQA 3DBSA 4JQWC 4FBJB 1WYWB 3VTUA 4IM3A 3CSFA 2V4LA 3MTNB 3R3MA 4IG7B 3QQ8B 4MGYE 1Y8RC 3C0RB 2GBMA 3APFA 3HM6X 5LLIA 2O2VB 3KYDD 2G4SA 1WM2A 4KDIC 5IAAC 4BOSC 5G2NA 2JZZA 3ECIA 3PREA 2KNBA 2KTRB 3UF8A 2FUHB 4K7SA 2JVCA 2RSUA 1E8YA 3AI5A 2ZPNA 2G3QB 5DPRA 3DVGX 4G3XB 3R7RA 1WXAA 1WRDB 3K9OB 1WZ0A 3DQVA 1ZGUB 3RULA 2VRRB 4B6WA 2A5UA 2O6VD 4FHJA 4MGKE 2D3GA 5CTRC 1OGWA 4HVBA 3PLUA 4BFRA 3VHTC 3VH3B 2L76A 1NI2A 1Z2MA 4M8MA 4W9EA 4WJQA 4ZDVA 4HK2A 2RD0A 2KOXA 3HK0A 3S2AA 3UQBA 3ZO5B 3B08A 1YQBA 1WR1A 3QIJA 2L3ZA 1IPGA 4JIOU 2FIDA 1RFAA 4LCDE 4B95A 1E90A 4IW0A 2MLBA 2DHZA 3RZWC 2B3AA 3EC8A 5J18A 2GBKA 1E7VA 2JY6A 2GMIC 2IO3B 2LASA 3PTFC 4K7WA 4PS3A 3WALA 3ZIMA 2IYDB 1L2NA 1M94A 4GN1A 5C23A 2Z0EB 4HDQA 1OTRB 3QWZB 5HKHA 1E7UA 2L0FA 4TQ1A 3JSVA 2KJHB 4X57B 4AOFA 2KJRA 3PRMB 4DBGA 3B0AA 1IP9A 3ZKJC 1WXSA 1S3SG 2BYFA 2KMAA 1YIWA 4NJ7A 3ZVVA 4P7IA 3T8MA 3I3TB 1S1QB 4GXBA 4I6LB 2HD5B 4NJ6A 1L7YA 4WJNA 5FR6A 2DZJA 3VH4B 2D2QA 2MP2A 4MM3A 2N9PC 4EKUA 4YL8A 2AL6A 2G45B 2ZVNA 3N3KB 3L08A 1YJ1A 4W9HA 1T0YA 4M8NA 1EF1A 3TJPA 2C7NB 4GGQA 4URKA 4W9FA 2JRHA 2KVRA 4LJPB 4MJSB 4FJYA 1XD3B 2KKCA 3DVNU 4IM2A 2FCSA 2ZCCA 3QC8B 2DX5B 2MBHA 4J6IA 4AJYB 4EZLA 4FHKA 2MW5A 2K1FA 3CMMB 3RYTA 2KC1A 2IO1B 1UELA 1KM7A 3OJ3A 2K25A 3A4RA 5EDSA 1WE6A 4FJZA 4KIKA 5CHFA 3VUWA 4NNJB 3PSEB 1I35A 3ZTDA 3VVWB 3TBLD 2DZMA 3AU4A 4II2B 2LRUA 2D10A 3W1SC 1A5RA 4W9LA 3JW0X 1YD8U 2N7DA 1VD2A 3MHSD 4KSLC 2WX1A 4CO7A 4K81A 2N7EA 2C7HA 2IO0B 2NPTA 2DAJA 2AEHA 4EUTA 3NHEB 2OOBB 4GOCA 3U30A 4W9IA 3TL5A 1YX5B 2C9WB 2FNJB 4EZKA 3OJ4B 2L8JA 2PE6B 2K6DB 2MBEA 2BWFA 4TV3A 2LGDA 2LVQA 4GU2A 1Q5WB 3EFUA 5CHWA 4F1SA 1KOTA 1WX8A 2AYOB 3MJWA 1V86A 4ANXA 2PE9A 3AU5A 3V62A 2BYEA 3APDA 3SD5A 1WFYA 4RM9A 4GB9A 3WA0A 2LGYA 3KUCB 1H8CA 3ZRCA 4MDKE 2NVUI 2PEAA 2NS5A 4WQOB 5L83A 2MBOA 3PV1A 4EZJA 1QZEA 2CR5A 2XBBC 3PPAA 1G6JA 3H9DA 1GG3A 2NBWB 1SGHA 3IVFA 2KDIA 2M0XA 1GUAB 5JHAA 4KDLB 4G11A 5LXIB 1SE9A 5E6OA 2L0TA 1TZ1A 2JT4B 4NY0A 1VCBA 4F7ZA 5D94A 4ICUA 2MBQA 4BKSD 1P0RA 1OEYJ 3WAOA 3VAWA 1PQSA 2GOWA 3HM3A 2LRWA 1X1MA 4AP4C 5L95C 4KZCA 2LGXA 3A9JA 4HCNB 3RZFA 2MA9B 2HTHA 4ZYNA 2KLCA 4B9KA 5J17A 4WJPA 2LI5A 4BKTA 1Z5SB 1V6EA 4F8CB 3DCGA 3APCA 5DPWA 4XX5A 3PRPB 2CHZA 4BVUC 4ZRKA 4FADA 3A9JB 4FJVB 2KQSA 2RR9A 4DWFA 3VFKA 4WJOA 1WI0A 3WAPA 3TCAA 3VDZA 1OEYA 1XQQA 2RGFA 2BF8B 3CF6E 4IWQA 3X23A 4MH0E 5LXHA 5AZFA 2JRIB 2KX3A 3A1QA 3QHTA 2GBJA 3BY4B 5KHQA 1LQBA 4K7UA 4GSWA 4KZ0A 4WWOA 4DDGD 1V5TA 3PLVA 2MQJA 4IWPA 3EHVA 1R4MI 2KFJA 2K8HA 2KWUB 2J0JA 3NZUA 3A1QB 1P98A 4MSQB 4BBNF 2IY0B 4MGIE 4OVVA 3JYUA 2WYQA 2LWPA 2KMCA 1KJTA 3H7PA 1RLFA 3H1UA 3ZW3A 4RM8A 2LVOA 3ZNHB 2AWTA 2ZPYA 2QHOA 2IZVB 2N1VA 1UZXB 1E8WA 3IG3A 1RAXA 4FA6A 2KX0A 3H7PB 4DHZB 3JSVB 4WAAA 3R7QA 4NQLB 1WGRA 2ZCBA 3H7SA 1LXDA 2Z59B 3UQAA 4TKNA 2EMSA 2MRPA 3K9PB 1HE8A 4HJKA 3KH0A 1C3TA 1WXMA 1P3QU 3Q3JA 1WMHA 4FLHA 2EKEC 1ISNA 1V81A 4WWNA 2MP2B 4PS8A 5KHOA 1EF5A 4GDKA 3NOBA 2ZNVC 2MBBB 1WE7A 1XT9B 4KSKC 4JLCA 3V61A 3IBEA 2KWCA 3GZNI 2LVPA 2MSED 2FCQA 2REXA 2IBIB 2LZ6A 3TMPB 1WGYA 2LD9A 2LUEA 2XEWA 2KTFA 3Q3FA 2KHWB 4GDKB 3W1SA 4NAWA 3AXCA 4PYZA 2M17A 3H6NA 1Q0WB 3KUZA 2BKRB 2M1MA 5JHBA 2HJ8A 1D3ZA 3M95A 4II3B 2YLMA 5JZEB 1V2YA 3LJ3A 3UIOB 4NAWB 3ML9A 3RT3B 5C1ZA 3O65B 2PPHA 2CU1A 2A4ZA 2BWES 2N9XA 3PT2B 4KIKB 2Z0DB 3KUDB 2K39A 4GDLA 1JRUA 3N32A 2WDTB 2FAZA 1GC7A 4AJWA 1F9JA 2KJ6A 1WM3A 2V1YA 5DCNA 3ZUNA 4CYEA 1WXVA 3KYCD 1RRBA 4HDOA 4BBNC 3QCAA 4DHZE 3A9KA 5JH5C 3RUIB 2NBVB 1V80A 2C7MB 2JF5A 2NPTB 4HXDA 3HHMA 4GDLB 4LDTB 4DDID 4ANVA 2MCNB 4KVGB 2G4DB 3LDZE 5E6PA 3D32A 2K8CA 4W9GA 1LFDA 4PYUA 5TR5A 3DVGY 2DENB 1K8RB 5DPSA 2CHWA 2WX0A 3NZSA 3ZNID 1E5WA 2JUOA 2KANA 2KO3A 2BPSA 3DVNV 4I6NB 3VQIA 2D11A 1GNUA 3L10B 4OVUA 2N4FA 4G50A 2OJRA 4TUUA 1WF9A 4MEMA 1WH3A 1MG8A 3VUYA 2FIFA 5D7GA
chains in the Genus database with same CATH superfamily
2DYMA 4KV2A 4YSZB 2DAFA 1MI0A 1XCQL 3PRZA 4YWGG 1FD6A 3DBLI 2V3NA 1JQ4A 2GBNA 3L17A 1GJZA 5D6JB 4YTNB 5DPTA 4E74A 2ZJDA 4RMAA 2JX5A 2WXMA 1QKZA 2WNMA 3RN9C 1ZXHA 3IT6B 2VZKD 1YJJA 1WIAA 2XK5A 3ZTCA 1KLVA 1N61A 2QILA 2EMTA 1FFVA 1IBXA 3HVDA 2IO2B 3SFEB 2JWUA 2LUMA 2Y3AA 2K3UA 4DXGA 4PS7A 5IA7A 3VR9B 3ZYYX 2V3PA 4ASWC 2K6QA 4M0WA 1BT0A 3CWIA 3V60A 3DHGC 4ZHPA 2L00B 4MACA 4IUMB 1P1AA 2UU7A 1LM8B 1TZOA 2FCMA 2L7RA 3KVFB 1UH6A 1GOZA 2BGFA 2WXLA 1B9RA 2KDEB 3UGBB 2IPKD 4BZAA 3NZ3A 1ZKHA 2XN9C 3QK0A 5GMVA 1AWDA 3DBLB 2ZW1A 3R2IA 1AARA 3IFWB 1WX7A 2WXHA 3ALBA 3HRDD 4GLSC 5CX3A 5AZGA 2ZVOA 4L23A 3KWVA 3M3JA 2W9NA 1ZE3D 3AE2B 2WGSA 1FXAA 1J0GA 4P6VF 5HFYA 1WRIA 2J0KA 2GBRA 2KDBA 3QX1A 3BZDB 3TSSA 5E6NA 3VUXA 4MT5A 3P4SB 2FBWB 4OW0A 2I38A 2C60A 1WGHA 3N30A 4AUQC 1UGJA 2HE7A 3J9CA 3VTVA 3A9KB 3AULA 2DZIA 3OAWA 1E10A 1BUIC 4CHKA 2JZ3B 2L32A 2E6XA 3M62B 2PJHA 2RPQA 5FR3A 4GIVA 4JGHB 2AL3A 3ETRA 1ROEA 2JU6X 1SF0A 2IY1B 1WZ3A 3MC0B 2FCNA 4P1CC 2KWDA 3PVLA 3ENEA 2O2VA 1OQYA 1IUEA 3CSTA 3ZXVA 3DBSA 4FBJB 1C76A 2X8XX 3CSFA 3MTNB 4MGYE 1Y8RC 4FXCA 2QEJC 3C0RB 1KF6B 5HHDG 3URYA 2KQ4X 3P1MA 4HPPA 3ECIA 2KTRB 4BAXA 4YTPB 2RSUA 1HA5A 3R7RA 1WXAA 1WRDB 1FNWA 3DQVA 4B6WA 1RWSA 2A5UA 4FHJA 5EE3A 2D3GA 4HVBA 1OGWA 4IKGA 3VH3B 1DGJA 4R3DA 1AYFA 4M8MA 4WURA 5BYQA 5IKCM 3ZO5B 2K5PA 1VZ6A 1RFAA 3DWMA 1YQ3B 1E90A 3AE5B 4HJGE 1TKGA 2BT6A 2GBKA 3WALA 2GMIC 2LASA 1YQ4B 3NUHB 2IYDB 1L2NA 4GN1A 2K22A 2Z0EB 3RNEC 3QWZB 5HKHA 3FAHA 2D3BA 2BS3B 3AM9A 3BK2A 4H2AA 3PRMB 1IP9A 4ACFA 2JYTA 1C4PA 2WS3B 1SSNA 3I3TB 3DHIC 1EWCA 1UF0A 2G9HD 1K51A 2MP2A 4MM3A 1MHXA 4EKUA 1Y56A 1L4ZB 1YJ1A 5LNK1 2LGSA 4O1NA 1EF1A 3TJPA 3AE3B 1WYGA 4LJPB 4MJSB 4M01A 2BB5A 2KKCA 2VH2A 3DVNU 4IM2A 3Q3MC 2FCSA 1XLQA 2DX5B 2MBHA 3P4PB 2J4XA 4J6IA 2MW5A 3R8BA 3RYTA 2KC1A 1UELA 3PO0A 1RFKA 3A4RA 5EDSA 4XE0A 2FE8A 1VJKA 4II2B 2LRUA 2D10A 3JW0X 4KSLC 2Q5WD 2WX1A 2N7EA 1FRDA 2C7HA 1UNSA 2AEHA 2ZW0A 4W9IA 1YX5B 2C9WB 2FNJB 4EZKA 3IXSA 2LVQA 1TJEA 1V86A 1F1HA 1WFYA 2WU2B 2SEBD 4GB9A 3KUCB 4YSYB 1R4NB 1XLOA 2NS5A 4WQOB 3ZJTA 3PV1A 2QMTA 1UUPA 1QZEA 2CR5A 3HVZA 4PK1A 2XBBC 1HEZE 3LXFA 4G11A 5LXIB 4A55A 4D2KA 2IGGA 3FILB 3NRZA 1TS5A 2BS2B 1PQSA 1NEKB 2GOWA 2LGXA 4HCNB 2M0AA 2HTHA 4ZYNA 2V4IB 4OZAA 1T5XD 4WJPA 2LI5A 1Z5SB 1V6EA 4F8CB 3DCGA 3PRPB 5JXVA 3V05A 4DWFA 1WI0A 3WAPA 4YSXB 2INCC 2RGFA 2BF8B 4LTUA 4IWQA 1SE2A 3GE8C 1TY2A 3Q8CA 1P7EA 3VR8B 5T8IA 1VLBA 4K7UA 1AW7A 1V5TA 2KWUB 2K8HA 1P98A 3JYUA 2WYQA 1N63A 1RLFA 3H1UA 2HDEA 2LVOA 4YTMB 2QHOA 2IZVB 2N1VA 1UZXB 2H89B 1E8WA 3N9YC 1E7PB 1RAXA 4L2YA 2Z59B 2EMSA 2MRPA 3AV8A 1HE8A 4RH6A 4IOIE 1YJIA 1EU3A 2N9LA 4PS8A 5KHOA 1EF5A 4GDKA 2ZNVC 1XT9B 1T0SC 2G1EA 2MSED 2IBIB 4XYCA 1NYQA 4JWSC 2MH7A 2IJ0A 5FK9C 2BKRB 3RI7C 5JHBA 2HJ8A 2YLMA 2YEPB 3RNGC 5JZEB 5C1ZA 3O65B 2PPHA 3PT2B 2A4ZA 4N59A 4KIKB 3KUDB 2K39A 2J52A 2WDTB 1F9JA 2KJ6A 2K0PA 2V1YA 4J3OD 3QCAA 1V80A 2NPTB 3HHMA 4B0MA 2OEDA 3AEBB 4LNKA 2W3RA 3LDZE 4W9GA 3KLSX 4PYUA 1XCTL 2GRIA 5DPSA 2WX0A 2KANA 1EU4A 3DVNV 4I6NB 2D11A 1C4AA 1WF9A 4NJCA 3VUYA 4XC2A 2J42A 4XDCA 4HLEA 2X38A 5AZHA 2O6VA 3SEBA 4A3PA 4JE3B 4KX6B 5CHVC 1PUTA 5D2MB 3ZRFA 1JWUD 3ZLZA 1K52A 2NCNA 2J53A 2K8BA 1N6ZA 2JZPA 2L52A 4LNOA 1J7AA 1WY8A 3U2SC 3TUOA 1VR9A 4XWTA 3AE8B 3AEGB 2UYZB 1TKYA 1QQRA 2DBYA 3ZQ4A 4W9KA 2KMMA 3I57A 1ZP0B 2KT7A 2V9HA 2M8SA 1EUVB 1WJ6A 1I42A 4IM0A 3L54A 4MGZE 4FULA 5G55A 2KQ7A 3DBRI 3ZDTA 2NTTA 1JCKB 2XK5B 2EELA 1TS4A 2AQ2B 4GMVA 1F52A 1IBXB 2KC2A 3BWUD 4HEA1 5H8YE 5BO4B 4C00A 3M63B 4E71A 1ZW7A 2R2QA 2LEKA 4W9DA 4M0WB 1KRHA 2W3SA 1H4RA 3U7DA 1XEEA 3X0WA 3ZNGC 3BVZA 2ASQA 2KK8A 4AWJA 2WP9B 1C1YB 2QJLA 3FC4A 4LLGM 1ZXIA 1C9FA 1Q10A 2CKHB 4DK5A 4A8XC 1HZ5A 3GOEA 2BYVE 2KN5A 3MC9A 1L5PA 3WAMA 2WWZA 2J7QB 5C2TB 3WIMA 2PVGC 3VTWA 1Q1OA 3Q8AA 1UD7A 1MFWA 2BBCA 3DBRB 2JXTA 4HKQA 2SAKA 3L16A 4E3CA 5TSSA 3A4SC 3Q69A 4Q2JA 2CS4A 3UINB 3N1ZC 1TBEA 1YN4A 3PHWB 1E8XA 4BKSA 3NY5A 4JL9A 3L13A 3QARA 3T3OA 2KFKA 3QJZA 2C5LC 2GB1A 1T0RC 1TY0A 3RD2A 4EFOA 2JXXA 2KXJA 2D3AA 2L83A 4JQWC 4HCPB 1WYWB 2QDFA 4TSSA 2V4LA 3R3MA 4IG7B 3B9JA 1BXTA 2MJEA 2O2VB 5IAAC 4BOSC 4OHJA 3UF8A 4K7SA 3EGRA 2G3QB 4QAYA 3U7ZA 3DVGX 2RDGA 1WZ0A 4ZRQA 4RFBA 3L4PA 4BFRA 3VHTC 1Z2MA 4ZDVA 4LNFA 4W9EA 4WJQA 2RD0A 3B08A 1WR1A 4C7YA 2L3ZA 1ZDXA 1QLBB 3BYTB 3NVYA 1QOFA 1TYGB 1AN8A 2MLBA 3RZWC 2KYWA 1SE3A 2JY6A 2IO3B 3ZIMA 1M94A 5C23A 4TQ1A 4X57B 2KJRA 4LNNA 1WXSA 2KMAA 3T8MA 4GXBA 1S1QB 2HJ1A 4WJNA 3VH4B 3BIID 2AL6A 2ZVNA 3N3KB 1L6UA 4M8NA 1CZPA 2C7NB 4URKA 1PGAA 4MM3B 1XD3B 3PZ8A 3QC8B 4AJYB 3CMMB 3RNCC 1WE6A 4FJZA 3VVWB 5GXGB 1A5RA 3MHSD 2FUG1 4CO7A 4K81A 2DAJA 1IGDA 3NHEB 3TL5A 3I5JC 2MHJA 5BMHA 1B1ZA 5G5GA 4TV3A 1Q5WB 3B2GA 1CJEA 3AU5A 2BYEA 1KLUD 4RM9A 3WA0A 2PEAA 5L83A 1JWAD 1RYJA 4EZJA 2NBWB 1SGHA 2KDIA 3AH7A 5JHAA 4ZOHC 2WDRB 1I4GA 1TZ1A 4F7ZA 2PLPA 5D94A 4K3CA 4XDDA 3HM3A 1X1MA 5L95C 3A9JA 3MP9A 2I2YA 1F2RC 5DPWA 4XX5A 3NG0A 2BS4B 4ZRKA 4FADA 4FJVB 2LMCA 1DYQA 4WJOA 3Q3NC 3VDZA 2QCZA 1XQQA 3BYYB 5AZFA 2JQRB 3A1QA 3AECB 3QHTA 3ZXRA 2GBJA 1LQBA 1JW9D 3NVVA 3PLVA 1R4MI 2KFJA 4BBNF 2IY0B 1VZ8A 4CQNA 5FKAC 3ZW3A 4RM8A 3EFCA 3ZNHB 2ZPYA 4NAMA 3IG3A 4FA6A 1C79A 2KX0A 3JSVB 1I7HA 4WAAA 1WGRA 4XGAB 3ZGZA 3K9PB 1QILA 3N1XC 2EKEC 3P42A 1JWMD 2INDC 1EWYC 4KSKC 5IN7A 3EA6A 2WXNA 2LVPA 1ZUD2 2N0SB 2REXA 2LZ6A 2HTME 2LUEA 3E9SA 4GDKB 4NAWA 2AX5A 2ONQA 2M17A 3KUZA 1Q0WB 4WH4A 1FNVA 1SBBB 3M95A 1V2YA 2CU1A 2BWES 2N9XA 4GDLA 3OG5A 3ZJUA 2W82A 4JPSA 4BBNC 5JH5C 4DHZE 3A9KA 3Q14C 4HXDA 2C7MB 4UDUC 1R4MB 2JF5A 1GB4A 3AN1A 2MCNB 1FFUA 2GI9A 1VZ7A 2CHWA 3NZSA 1C4CA 1FO4A 1FIQA 3VQIA 2K9XA 4RGTA 3E56A 3IAM1 2N4FA 4TUUA 4MEMA 3N20C 1WH3A 4ZRJA 2FIFA 4EOYA 3AE9B 3QA8A 3AE6B 1KFYB 1YNTE 3W5VB 4NQKE 1QOAA 3SR6A 4HPLB 2N9EB 2M4NA 1DOIA 2O6VB 2WXGA 3NS8A 2KACA 5EE1A 4RGNA 2AQ1B 1TGZB 2WXRA 1WR6E 4MSMB 2KTRA 3LB8C 2ICIA 1ZOYB 1IYFA 3UIPB 4ZYSA 1EM7A 4HPMB 3W1YA 3C19A 4LNIA 3QAQA 2KWVB 3U8ZA 3KWLA 3TEXA 2H88B 2MWSB 4W9JA 3PHXB 3EECA 4RF0A 1K50A 3Q2AC 1TTNA 2QIEB 3L0WB 3V6CB 4BOZB 4N6EB 1PFDA 2DYOA 2RDBC 2ON8A 3B1LX 3SU8X 2RDHA 1P7FA 1WX9A 1E8ZA 3UI3A 2Y5BB 3CIRB 2JYEA 1UGMA 2LXAA 1NVID 1P9DU 2ZNVB 3OWEB 5HG2A 2NBUA 2KDMA 2V3SA 3ZDMC 1NDDA 4FN2A 1WMHB 1CMXB 3EUB2 4ANUA 1V9JA 4MJSA 1C78A 2LXCA 2WXOA 4A6QA 4RNAA 3DOWA 3O13A 4EE2A 2KD0A 3RNFC 1K53A 3DBHI 2E3TA 1UBIA 4W9CA 1WJNA 2QC8A 3TEWA 1J8CA 1WJ4A 2IDYA 4ZRIA 3RCZA 2ZZPB 3HIZA 2JPHA 4RCOA 4XZ4A 5MPOA 2I1KA 3BINA 2UWQA 1V1PB 4IWOA 3KW5B 2L05A 2LJ5A 1V49A 1CK1A 2J0MA 5I4DA 1SEBD 1NENB 4M00A 1WGDA 4WWPA 3AE4B 2DZKA 2V0GA 4BKGA 1ZPSA 1HZ6A 4C4VA 1GC6A 2YVCA 2JWZA 2KFKB 2W55A 1D6EC 5AEKB 4ZHOA 1ACCA 1J19A 5IO9A 4DQOC 1NYRA 3QQ8B 4MH8A 3APFA 3HM6X 5LLIA 4OVZA 2G4SA 4WWMA 3PREA 2KNBA 4A9AA 1LGRA 2WDVB 1E8YA 1OQRA 2ZPNA 2WXKA 4ZRPA 1ZGUB 1GB1A 1FCLA 4KGSA 2OJWA 1NI2A 5D3IB 1C77A 1I4HA 2KOXA 3S2AA 3UQBA 3QIJA 4JIOU 1D5ZC 3PZ7A 2WQYB 4LCDE 1YN3A 3I63C 4IW0A 2DHZA 3EC8A 5J18A 2AQ3B 4K7WA 4RGOS 4HDQA 1E7UA 2L0FA 2KJHB 2BW2A 3B0AA 2WXFA 1S3SG 2BYFA 1YIWA 4NJ7A 4P7IA 4I6LB 2HD5B 4NJ6A 1L7YA 3KQ4A 2DZJA 2N9PC 4YL8A 4W9HA 1T0YA 3ZJVA 2MJDA 2KVRA 4FJYA 2L1AA 2ZCCA 1KTKA 4FHKA 1T0QC 1HXYD 1XO3A 4US9A 4HROA 3U4EG 4KIKA 2NMQA 1HQRD 1I4RA 3PSEB 1I35A 1SIJA 2KVZA 3TBLD 4US8A 3AU4A 3NS1A 1YD8U 1VD2A 1STEA 1SXTA 3TEZA 1KH0A 2IO0B 2NPTA 4EUTA 2OOBB 4GOCA 1PGBA 4B0EA 1UWMA 2K6DB 2MBEA 2PE6B 4GU2A 5CHWA 1KOTA 2AYOB 2WDQB 3MJWA 4ANXA 2PE9A 3V62A 1L6VA 3NVWA 4HKZE 3Q8EA 2Y5CA 3ZRCA 4L1BA 4MDKE 1PYWD 2NVUI 1IGCA 2VZKB 2R61A 3H9DA 1GG3A 4KDLB 1SE4A 2L0TA 4NY0A 2JT4B 4WIPA 2VH1A 2MBQA 2DLBA 2Z8LA 4S17A 3WAOA 2LRWA 5E6JA 4KKIA 4KZCA 3RZFA 2MA9B 1JWBD 4BKTA 1FXIA 4NZLB 2EKIA 3APCA 2CHZA 4BVUC 3A9JB 2KQSA 2RR9A 3VFKA 3W5UB 3AEAB 2KX3A 5KHQA 1D4BA 1FPYA 2CJNA 5D3DA 4DDGD 2MQJA 4IWPA 3A1QB 4MSQB 1HTQA 1N5XA 2LWPA 2KMCA 3H7PA 2W54A 3IT4B 4OZCA 3AMZA 4C7ZA 4DHZB 2N7JA 2MJ3A 4NQLB 3H7SA 3I9V1 2WLBA 3ABVB 3KH0A 1C3TA 1P3QU 3Q3JA 4FLHA 4ITKA 2MP2B 1WE7A 3AE1B 3V61A 4JLCA 4YXDB 4P1BC 3GZNI 2WHIA 3TMPB 1WGYA 2KHWB 3AXCA 1F2RI 3W9CB 1OFFA 1NI3A 1D3ZA 1WXQA 3UIOB 4NAWB 3ML9A 4WAFA 1OQQA 3RT3B 2PTLA 1QOBA 4USAA 1E0ZA 2FAZA 1GC7A 5IOIA 5DCNA 3B2FA 4CYEA 4AQ7A 3KYCD 1RRBA 1XLNA 2NBVB 4P16A 2OHFA 4GDLB 1HTOA 3WCQA 4LDTB 2WXPA 4DDID 4KVGB 3SFDB 1SJED 5E6PA 2K8CA 1LFDA 4M02A 2LGIA 3DVGY 2DENB 5EE0A 3ZNID 1E5WA 2M19A 1ESFA 2OJRA 5D7GA 4KGTA 3DDCB 2MX2A 3ZNZB 1R7SA 4LDTD 3V6EB 4A3OA 1YX6B 3GZNB 4ANWA 1FNUA 1F0ZA 3WANA 3MFGA 1JALA 1FXTB 2Y5PA 4A20A 4NPNA 3R66C 3AEFB 1QOGA 1ET9A 3SHQA 3VRAB 4MELA 3OLMD 4LJOB 2WU5B 3Q8FA 2DNFA 3IAS1 1EO6A 3JVZX 3SDLC 3T9LA 4XWWA 1MJDA 1MPEA 1RM6C 2NR2A 1L0VB 2DYBA 1N60A 1WGKA 4YT0B 3P2BA 4LK0M 4G0NB 3W2DA 3TIXA 1XLPA 1JRPA 3C8YA 1NBFC 1FCCC 4K1RB 1J7BA 2R2OA 1L0XB 2CHXA 2BTEA 4EEWA 5EE9A 2KLGA 2KZRA 4TQ0A 2N1WA 3PS6A 1WSPA 1MG4A 4DHJB 1WGGA 1R4NI 4ICVA 4RF1A 1XF5L 3P63A 2BB6A 1L4DB 3ONSA 2TSSA 3V3XA 4DXFA 2PVOD 4I6PA 1JWSD 1YN5A 1TT5B 3DPDA 1CQVA 1DOYA 3AEEB 2D07B 1L0YB 3BVGA 3A33B 3VXWA 4DHJD 1UBQA 2I1JA 1JMLA 4K3BA 3PGEA 5J2RA 1U4AA 1FM0D 2KDFB 3PZDA 3AE7B 4HRSA 4REZA 3IHPC 2QSDA 1E9MA 3ML8A 3Q6BA 1WJUA 3MC8A 4IC7B 4N9F4 1KLGD 1SIFA 3HUIA 1V5OA 2BKFA 2XNAC 4OZBA 4DXAB 2D3CA 2IGHA 2INNE 4HWIB 2PIAA 2ZEQA 1YMHE 1ZDVA 4C4VB 3VTUA 4IM3A 1D5XC 5H92C 2GBMA 3KYDD 1VDVA 1WM2A 4KDIC 4ARCA 5G2NA 2JZZA 1F77A 1XXGA 3VRBB 2IGDA 3N1YC 2FUHB 4KGRA 1FEHA 4WQMA 2JVCA 2CU3A 3AI5A 3RMKC 3TEYA 5DPRA 4G3XB 1GPXA 3K9OB 2DWQA 1FMAD 1I4PA 1V8CA 3RULA 2VRRB 2O6VD 1MVKA 5CTRC 4MGKE 3PLUA 2L76A 3GS2A 4HK2A 5BMGA 3HK0A 1TS2A 3RPFC 1YQBA 2YEPF 5BYRA 2PKOA 1IPGA 2FIDA 2PW9A 3H8HA 4B95A 2B3AA 4PS3A 1E7VA 3PTFC 1OTRB 1TKEA 2RMMA 5BMIA 3JSVA 4AOFA 3GE3C 4DBGA 3ZKJC 3LYYA 3ZVVA 2CJOA 4TMAB 3RNBC 5FR6A 2D2QA 1QF6A 2G45B 3L08A 4GGQA 4W9FA 2JRHA 1VRAB 4EZLA 2K1FA 3FKYA 3P4RB 4C56C 2IO1B 1ET6A 1KM7A 3P4QB 1T6BX 2LHDA 2K25A 3OJ3A 1MHHE 5CHFA 3VUWA 4NNJB 3ZTDA 2DZMA 3W1SC 4W9LA 2N7DA 4RGMA 2WXIA 2NTSA 2N9KA 3U30A 5HI1A 3OJ4B 1A70A 2L8JA 1FRRA 1GAQB 2BWFA 3Q3OC 2LGDA 1M4VA 3EFUA 4F1SA 4C80A 1WX8A 2RPVA 1J7CA 3APDA 3SD5A 2LJIA 2LGYA 4JX1C 1H8CA 3BVMA 1UWXA 2MBOA 3FILA 4N58A 3DWGC 4KKJA 3PPAA 1G6JA 4AS1A 3IVFA 2M0XA 1GUAB 2ACZB 1TS3A 5G5HA 1SE9A 5E6OA 1VCBA 2LHEA 4ICUA 4BKSD 3DBHB 1P0RA 2PMVA 1OEYJ 3VAWA 4AP4C 2KLCA 4IDIA 4B9KA 5J17A 2JSVX 2BYTA 2M56B 1T3QA 3TCAA 2MEKA 1OEYA 2BQQA 3CF6E 3X23A 4MH0E 5LXHA 2JRIB 3NJTA 3T3NA 1TIFA 3BY4B 2INPE 4GSWA 2KAJA 5AUKA 4KZ0A 4WWOA 2WXQA 3EHVA 2J0JA 3NZUA 4MGIE 4OVVA 1D5MC 1KJTA 3BK1A 2WXJA 2KN4A 2AWTA 3H7PB 1E6EB 1I4QA 3R7QA 3MHZA 2LFIA 2ZCBA 3R2TA 1LXDA 3RNAC 3UQAA 4TKNA 1BMLC 3NVZA 3Q8BA 4HJKA 4PT5A 1WXMA 1WMHA 2GLSA 3AEDB 1ISNA 1I4XA 1V81A 4WWNA 1ENFA 1SB3C 3NOBA 2MBBB 1YOVB 3IBEA 2KWCA 3GP7A 2FCQA 3U52E 2LD9A 2XEWA 2KTFA 3Q3FA 3W1SA 4S0RA 4PYZA 3H6NA 1QT9A 1N62A 2M1MA 5IP4D 4II3B 3LJ3A 4JWUC 2BVCA 2Z0DB 2D5GA 4A90A 1SJHD 1JRUA 3N32A 4AJWA 1WM3A 3ZUNA 1WXVA 4HDOA 1N5WA 3RUIB 1LO5D 1PGXA 1V1OA 1V97A 4ANVA 1V1PA 2B76B 2G4DB 3D32A 4ARIA 5TR5A 3DHHC 1K8RB 5BYSA 2JUOA 1DOXA 2KO3A 2BPSA 1GNUA 3L10B 5AUIA 1WWTA 3GB1A 3RFZB 3AB5A 5C3JB 4OVUA 1JROA 4G50A 1PDXA 1MG8A 3MJ5A
chains in the Genus database with same CATH topology
3DDCB 4XC2A 4HLEA 2MX2A 2DYMA 4EOYA 5AZHA 3QA8A 4KV2A 3ZNZB 2O6VA 4A3PA 4NQKE 2DAFA 5CHVC 5D2MB 3ZRFA 4LDTD 3V6EB 4A3OA 3PRZA 3ZLZA 1YX6B 4HPLB 4ANWA 3DBLI 2N9EB 2M4NA 2GBNA 2NCNA 2O6VB 3L17A 5D6JB 1GJZA 3NS8A 2K8BA 5DPTA 1TGZB 4E74A 2ZJDA 4RMAA 1WR6E 3WANA 4MSMB 2KTRA 1WY8A 1IYFA 3UIPB 1FXTB 4HPMB 3W1YA 2UYZB 4NPNA 3R66C 4A20A 4W9KA 3QAQA 3SHQA 2KWVB 3U8ZA 1WIAA 2XK5A 4MELA 3ZTCA 2M8SA 1EUVB 3OLMD 1WJ6A 1KLVA 4LJOB 4IM0A 1I42A 3L54A 4MGZE 2EMTA 4FULA 5G55A 2IO2B 2KQ7A 2MWSB 3DBRI 4W9JA 3ZDTA 3PHXB 4PS7A 2XK5B 1EO6A 3JVZX 5IA7A 3SDLC 3T9LA 3EECA 2NR2A 1TTNA 4GMVA 3L0WB 2DYBA 2KC2A 3V6CB 4ASWC 4BOZB 2K6QA 2DYOA 5BO4B 4E71A 3M63B 1ZW7A 1BT0A 3P2BA 2R2QA 3V60A 4G0NB 3B1LX 2L00B 4W9DA 3SU8X 3TIXA 4IUMB 1NBFC 1P1AA 1LM8B 2FCMA 4M0WB 2L7RA 4K1RB 1H4RA 3U7DA 2R2OA 1WX9A 3KVFB 1UH6A 2CHXA 3X0WA 1E8ZA 3ZNGC 2Y5BB 4EEWA 2BGFA 4ZRJA 2KLGA 2KZRA 4TQ0A 1UGMA 2ASQA 2KDEB 2LXAA 2N1WA 3UGBB 3PS6A 1P9DU 2ZNVB 1ZKHA 2KK8A 2NBUA 2V3SA 3QK0A 5GMVA 3ZDMC 4DHJB 1NDDA 4FN2A 4AWJA 1C1YB 1WMHB 1WGGA 1R4NI 1CMXB 1AARA 3IFWB 1WX7A 4ICVA 2CKHB 4DK5A 4ANUA 1V9JA 3GOEA 4MJSA 3ALBA 2BYVE 2KN5A 3ONSA 5CX3A 5AZGA 3WAMA 2ZVOA 2LXCA 2J7QB 2WWZA 3M3JA 2W9NA 3DOWA 3WIMA 2KD0A 4I6PA 3VTWA 3DBHI 1J0GA 1Q1OA 3DPDA 1UBIA 4W9CA 1UD7A 1WJNA 2D07B 2J0KA 2GBRA 1J8CA 2KDBA 3QX1A 1WJ4A 3A33B 3VUXA 5E6NA 4ZRIA 3VXWA 4DHJD 3RCZA 1UBQA 2ZZPB 2I1JA 3HIZA 3L16A 4E3CA 2JPHA 3PGEA 2C60A 3A4SC 4XZ4A 1WGHA 3N30A 4AUQC 2HE7A 2CS4A 5J2RA 3UINB 1U4AA 3VTVA 3A9KB 2KDFB 3AULA 3PZDA 1TBEA 2DZIA 3OAWA 2I1KA 3BINA 4CHKA 2UWQA 2JZ3B 3PHWB 1E8XA 4BKSA 4IWOA 3M62B 3IHPC 2L05A 2PJHA 3KW5B 2RPQA 3NY5A 2LJ5A 1V49A 2J0MA 3ML8A 4GIVA 1WJUA 4JGHB 4JL9A 4IC7B 4N9F4 1WGDA 3L13A 3QARA 4WWPA 2AL3A 2KFKA 3QJZA 1SIFA 2C5LC 2DZKA 1V5OA 2IY1B 2BKFA 4BKGA 3RD2A 1WZ3A 1GC6A 2JXXA 4EFOA 2FCNA 2YVCA 4DXAB 2KXJA 2JWZA 2KFKB 4HWIB 5AEKB 3PVLA 3ENEA 2O2VA 1J19A 1OQYA 3CSTA 4HCPB 2ZEQA 3DBSA 4JQWC 4FBJB 1WYWB 3VTUA 4IM3A 3CSFA 2V4LA 3MTNB 3R3MA 4IG7B 3QQ8B 4MGYE 1Y8RC 3C0RB 2GBMA 3APFA 3HM6X 5LLIA 2O2VB 3KYDD 2G4SA 1WM2A 4KDIC 5IAAC 4BOSC 5G2NA 2JZZA 3ECIA 3PREA 2KNBA 2KTRB 3UF8A 2FUHB 4K7SA 2JVCA 2RSUA 1E8YA 3AI5A 2ZPNA 2G3QB 5DPRA 3DVGX 4G3XB 3R7RA 1WXAA 1WRDB 3K9OB 1WZ0A 3DQVA 1ZGUB 3RULA 2VRRB 4B6WA 2A5UA 2O6VD 4FHJA 4MGKE 2D3GA 5CTRC 1OGWA 4HVBA 3PLUA 4BFRA 3VHTC 3VH3B 2L76A 1NI2A 1Z2MA 4M8MA 4W9EA 4WJQA 4ZDVA 4HK2A 2RD0A 2KOXA 3HK0A 3S2AA 3UQBA 3ZO5B 3B08A 1YQBA 1WR1A 3QIJA 2L3ZA 1IPGA 4JIOU 2FIDA 1RFAA 4LCDE 4B95A 1E90A 4IW0A 2MLBA 2DHZA 3RZWC 2B3AA 3EC8A 5J18A 2GBKA 1E7VA 2JY6A 2GMIC 2IO3B 2LASA 3PTFC 4K7WA 4PS3A 3WALA 3ZIMA 2IYDB 1L2NA 1M94A 4GN1A 5C23A 2Z0EB 4HDQA 1OTRB 3QWZB 5HKHA 1E7UA 2L0FA 4TQ1A 3JSVA 2KJHB 4X57B 4AOFA 2KJRA 3PRMB 4DBGA 3B0AA 1IP9A 3ZKJC 1WXSA 1S3SG 2BYFA 2KMAA 1YIWA 4NJ7A 3ZVVA 4P7IA 3T8MA 3I3TB 1S1QB 4GXBA 4I6LB 2HD5B 4NJ6A 1L7YA 4WJNA 5FR6A 2DZJA 3VH4B 2D2QA 2MP2A 4MM3A 2N9PC 4EKUA 4YL8A 2AL6A 2G45B 2ZVNA 3N3KB 3L08A 1YJ1A 4W9HA 1T0YA 4M8NA 1EF1A 3TJPA 2C7NB 4GGQA 4URKA 4W9FA 2JRHA 2KVRA 4LJPB 4MJSB 4FJYA 1XD3B 2KKCA 3DVNU 4IM2A 2FCSA 2ZCCA 3QC8B 2DX5B 2MBHA 4J6IA 4AJYB 4EZLA 4FHKA 2MW5A 2K1FA 3CMMB 3RYTA 2KC1A 2IO1B 1UELA 1KM7A 3OJ3A 2K25A 3A4RA 5EDSA 1WE6A 4FJZA 4KIKA 5CHFA 3VUWA 4NNJB 3PSEB 1I35A 3ZTDA 3VVWB 3TBLD 2DZMA 3AU4A 4II2B 2LRUA 2D10A 3W1SC 1A5RA 4W9LA 3JW0X 1YD8U 2N7DA 1VD2A 3MHSD 4KSLC 2WX1A 4CO7A 4K81A 2N7EA 2C7HA 2IO0B 2NPTA 2DAJA 2AEHA 4EUTA 3NHEB 2OOBB 4GOCA 3U30A 4W9IA 3TL5A 1YX5B 2C9WB 2FNJB 4EZKA 3OJ4B 2L8JA 2PE6B 2K6DB 2MBEA 2BWFA 4TV3A 2LGDA 2LVQA 4GU2A 1Q5WB 3EFUA 5CHWA 4F1SA 1KOTA 1WX8A 2AYOB 3MJWA 1V86A 4ANXA 2PE9A 3AU5A 3V62A 2BYEA 3APDA 3SD5A 1WFYA 4RM9A 4GB9A 3WA0A 2LGYA 3KUCB 1H8CA 3ZRCA 4MDKE 2NVUI 2PEAA 2NS5A 4WQOB 5L83A 2MBOA 3PV1A 4EZJA 1QZEA 2CR5A 2XBBC 3PPAA 1G6JA 3H9DA 1GG3A 2NBWB 1SGHA 3IVFA 2KDIA 2M0XA 1GUAB 5JHAA 4KDLB 4G11A 5LXIB 1SE9A 5E6OA 2L0TA 1TZ1A 2JT4B 4NY0A 1VCBA 4F7ZA 5D94A 4ICUA 2MBQA 4BKSD 1P0RA 1OEYJ 3WAOA 3VAWA 1PQSA 2GOWA 3HM3A 2LRWA 1X1MA 4AP4C 5L95C 4KZCA 2LGXA 3A9JA 4HCNB 3RZFA 2MA9B 2HTHA 4ZYNA 2KLCA 4B9KA 5J17A 4WJPA 2LI5A 4BKTA 1Z5SB 1V6EA 4F8CB 3DCGA 3APCA 5DPWA 4XX5A 3PRPB 2CHZA 4BVUC 4ZRKA 4FADA 3A9JB 4FJVB 2KQSA 2RR9A 4DWFA 3VFKA 4WJOA 1WI0A 3WAPA 3TCAA 3VDZA 1OEYA 1XQQA 2RGFA 2BF8B 3CF6E 4IWQA 3X23A 4MH0E 5LXHA 5AZFA 2JRIB 2KX3A 3A1QA 3QHTA 2GBJA 3BY4B 5KHQA 1LQBA 4K7UA 4GSWA 4KZ0A 4WWOA 4DDGD 1V5TA 3PLVA 2MQJA 4IWPA 3EHVA 1R4MI 2KFJA 2K8HA 2KWUB 2J0JA 3NZUA 3A1QB 1P98A 4MSQB 4BBNF 2IY0B 4MGIE 4OVVA 3JYUA 2WYQA 2LWPA 2KMCA 1KJTA 3H7PA 1RLFA 3H1UA 3ZW3A 4RM8A 2LVOA 3ZNHB 2AWTA 2ZPYA 2QHOA 2IZVB 2N1VA 1UZXB 1E8WA 3IG3A 1RAXA 4FA6A 2KX0A 3H7PB 4DHZB 3JSVB 4WAAA 3R7QA 4NQLB 1WGRA 2ZCBA 3H7SA 1LXDA 2Z59B 3UQAA 4TKNA 2EMSA 2MRPA 3K9PB 1HE8A 4HJKA 3KH0A 1C3TA 1WXMA 1P3QU 3Q3JA 1WMHA 4FLHA 2EKEC 1ISNA 1V81A 4WWNA 2MP2B 4PS8A 5KHOA 1EF5A 4GDKA 3NOBA 2ZNVC 2MBBB 1WE7A 1XT9B 4KSKC 4JLCA 3V61A 3IBEA 2KWCA 3GZNI 2LVPA 2MSED 2FCQA 2REXA 2IBIB 2LZ6A 3TMPB 1WGYA 2LD9A 2LUEA 2XEWA 2KTFA 3Q3FA 2KHWB 4GDKB 3W1SA 4NAWA 3AXCA 4PYZA 2M17A 3H6NA 1Q0WB 3KUZA 2BKRB 2M1MA 5JHBA 2HJ8A 1D3ZA 3M95A 4II3B 2YLMA 5JZEB 1V2YA 3LJ3A 3UIOB 4NAWB 3ML9A 3RT3B 5C1ZA 3O65B 2PPHA 2CU1A 2A4ZA 2BWES 2N9XA 3PT2B 4KIKB 2Z0DB 3KUDB 2K39A 4GDLA 1JRUA 3N32A 2WDTB 2FAZA 1GC7A 4AJWA 1F9JA 2KJ6A 1WM3A 2V1YA 5DCNA 3ZUNA 4CYEA 1WXVA 3KYCD 1RRBA 4HDOA 4BBNC 3QCAA 4DHZE 3A9KA 5JH5C 3RUIB 2NBVB 1V80A 2C7MB 2JF5A 2NPTB 4HXDA 3HHMA 4GDLB 4LDTB 4DDID 4ANVA 2MCNB 4KVGB 2G4DB 3LDZE 5E6PA 3D32A 2K8CA 4W9GA 1LFDA 4PYUA 5TR5A 3DVGY 2DENB 1K8RB 5DPSA 2CHWA 2WX0A 3NZSA 3ZNID 1E5WA 2JUOA 2KANA 2KO3A 2BPSA 3DVNV 4I6NB 3VQIA 2D11A 1GNUA 3L10B 4OVUA 2N4FA 4G50A 2OJRA 4TUUA 1WF9A 4MEMA 1WH3A 1MG8A 3VUYA 2FIFA 5D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDC B;  4XC2 A;  4HLE A;  2MX2 A;  2DYM A;  4EOY A;  5AZH A;  3QA8 A;  4KV2 A;  3ZNZ B;  2O6V A;  4A3P A;  4NQK E;  2DAF A;  5CHV C;  5D2M B;  3ZRF A;  4LDT D;  3V6E B;  4A3O A;  3PRZ A;  3ZLZ A;  1YX6 B;  4HPL B;  4ANW A;  3DBL I;  2N9E B;  2M4N A;  2GBN A;  2NCN A;  2O6V B;  3L17 A;  5D6J B;  1GJZ A;  3NS8 A;  2K8B A;  5DPT A;  1TGZ B;  4E74 A;  2ZJD A;  4RMA A;  1WR6 E;  3WAN A;  4MSM B;  2KTR A;  1WY8 A;  1IYF A;  3UIP B;  1FXT B;  4HPM B;  3W1Y A;  2UYZ B;  4NPN A;  3R66 C;  4A20 A;  4W9K A;  3QAQ A;  3SHQ A;  2KWV B;  3U8Z A;  1WIA A;  2XK5 A;  4MEL A;  3ZTC A;  2M8S A;  1EUV B;  3OLM D;  1WJ6 A;  1KLV A;  4LJO B;  4IM0 A;  1I42 A;  3L54 A;  4MGZ E;  2EMT A;  4FUL A;  5G55 A;  2IO2 B;  2KQ7 A;  2MWS B;  3DBR I;  4W9J A;  3ZDT A;  3PHX B;  4PS7 A;  2XK5 B;  1EO6 A;  3JVZ X;  5IA7 A;  3SDL C;  3T9L A;  3EEC A;  2NR2 A;  1TTN A;  4GMV A;  3L0W B;  2DYB A;  2KC2 A;  3V6C B;  4ASW C;  4BOZ B;  2K6Q A;  2DYO A;  5BO4 B;  4E71 A;  3M63 B;  1ZW7 A;  1BT0 A;  3P2B A;  2R2Q A;  3V60 A;  4G0N B;  3B1L X;  2L00 B;  4W9D A;  3SU8 X;  3TIX A;  4IUM B;  1NBF C;  1P1A A;  1LM8 B;  2FCM A;  4M0W B;  2L7R A;  4K1R B;  1H4R A;  3U7D A;  2R2O A;  1WX9 A;  3KVF B;  1UH6 A;  2CHX A;  3X0W A;  1E8Z A;  3ZNG C;  2Y5B B;  4EEW A;  2BGF A;  4ZRJ A;  2KLG A;  2KZR A;  4TQ0 A;  1UGM A;  2ASQ A;  2KDE B;  2LXA A;  2N1W A;  3UGB B;  3PS6 A;  1P9D U;  2ZNV B;  1ZKH A;  2KK8 A;  2NBU A;  2V3S A;  3QK0 A;  5GMV A;  3ZDM C;  4DHJ B;  1NDD A;  4FN2 A;  4AWJ A;  1C1Y B;  1WMH B;  1WGG A;  1R4N I;  1CMX B;  1AAR A;  3IFW B;  1WX7 A;  4ICV A;  2CKH B;  4DK5 A;  4ANU A;  1V9J A;  3GOE A;  4MJS A;  3ALB A;  2BYV E;  2KN5 A;  3ONS A;  5CX3 A;  5AZG A;  3WAM A;  2ZVO A;  2LXC A;  2J7Q B;  2WWZ A;  3M3J A;  2W9N A;  3DOW A;  3WIM A;  2KD0 A;  4I6P A;  3VTW A;  3DBH I;  1J0G A;  1Q1O A;  3DPD A;  1UBI A;  4W9C A;  1UD7 A;  1WJN A;  2D07 B;  2J0K A;  2GBR A;  1J8C A;  2KDB A;  3QX1 A;  1WJ4 A;  3A33 B;  3VUX A;  5E6N A;  4ZRI A;  3VXW A;  4DHJ D;  3RCZ A;  1UBQ A;  2ZZP B;  2I1J A;  3HIZ A;  3L16 A;  4E3C A;  2JPH A;  3PGE A;  2C60 A;  3A4S C;  4XZ4 A;  1WGH A;  3N30 A;  4AUQ C;  2HE7 A;  2CS4 A;  5J2R A;  3UIN B;  1U4A A;  3VTV A;  3A9K B;  2KDF B;  3AUL A;  3PZD A;  1TBE A;  2DZI A;  3OAW A;  2I1K A;  3BIN A;  4CHK A;  2UWQ A;  2JZ3 B;  3PHW B;  1E8X A;  4BKS A;  4IWO A;  3M62 B;  3IHP C;  2L05 A;  2PJH A;  3KW5 B;  2RPQ A;  3NY5 A;  2LJ5 A;  1V49 A;  2J0M A;  3ML8 A;  4GIV A;  1WJU A;  4JGH B;  4JL9 A;  4IC7 B;  4N9F 4;  1WGD A;  3L13 A;  3QAR A;  4WWP A;  2AL3 A;  2KFK A;  3QJZ A;  1SIF A;  2C5L C;  2DZK A;  1V5O A;  2IY1 B;  2BKF A;  4BKG A;  3RD2 A;  1WZ3 A;  1GC6 A;  2JXX A;  4EFO A;  2FCN A;  2YVC A;  4DXA B;  2KXJ A;  2JWZ A;  2KFK B;  4HWI B;  5AEK B;  3PVL A;  3ENE A;  2O2V A;  1J19 A;  1OQY A;  3CST A;  4HCP B;  2ZEQ A;  3DBS A;  4JQW C;  4FBJ B;  1WYW B;  3VTU A;  4IM3 A;  3CSF A;  2V4L A;  3MTN B;  3R3M A;  4IG7 B;  3QQ8 B;  4MGY E;  1Y8R C;  3C0R B;  2GBM A;  3APF A;  3HM6 X;  5LLI A;  2O2V B;  3KYD D;  2G4S A;  1WM2 A;  4KDI C;  5IAA C;  4BOS C;  5G2N A;  2JZZ A;  3ECI A;  3PRE A;  2KNB A;  2KTR B;  3UF8 A;  2FUH B;  4K7S A;  2JVC A;  2RSU A;  1E8Y A;  3AI5 A;  2ZPN A;  2G3Q B;  5DPR A;  3DVG X;  4G3X B;  3R7R A;  1WXA A;  1WRD B;  3K9O B;  1WZ0 A;  3DQV A;  1ZGU B;  3RUL A;  2VRR B;  4B6W A;  2A5U A;  2O6V D;  4FHJ A;  4MGK E;  2D3G A;  5CTR C;  1OGW A;  4HVB A;  3PLU A;  4BFR A;  3VHT C;  3VH3 B;  2L76 A;  1NI2 A;  1Z2M A;  4M8M A;  4W9E A;  4WJQ A;  4ZDV A;  4HK2 A;  2RD0 A;  2KOX A;  3HK0 A;  3S2A A;  3UQB A;  3ZO5 B;  3B08 A;  1YQB A;  1WR1 A;  3QIJ A;  2L3Z A;  1IPG A;  4JIO U;  2FID A;  1RFA A;  4LCD E;  4B95 A;  1E90 A;  4IW0 A;  2MLB A;  2DHZ A;  3RZW C;  2B3A A;  3EC8 A;  5J18 A;  2GBK A;  1E7V A;  2JY6 A;  2GMI C;  2IO3 B;  2LAS A;  3PTF C;  4K7W A;  4PS3 A;  3WAL A;  3ZIM A;  2IYD B;  1L2N A;  1M94 A;  4GN1 A;  5C23 A;  2Z0E B;  4HDQ A;  1OTR B;  3QWZ B;  5HKH A;  1E7U A;  2L0F A;  4TQ1 A;  3JSV A;  2KJH B;  4X57 B;  4AOF A;  2KJR A;  3PRM B;  4DBG A;  3B0A A;  1IP9 A;  3ZKJ C;  1WXS A;  1S3S G;  2BYF A;  2KMA A;  1YIW A;  4NJ7 A;  3ZVV A;  4P7I A;  3T8M A;  3I3T B;  1S1Q B;  4GXB A;  4I6L B;  2HD5 B;  4NJ6 A;  1L7Y A;  4WJN A;  5FR6 A;  2DZJ A;  3VH4 B;  2D2Q A;  2MP2 A;  4MM3 A;  2N9P C;  4EKU A;  4YL8 A;  2AL6 A;  2G45 B;  2ZVN A;  3N3K B;  3L08 A;  1YJ1 A;  4W9H A;  1T0Y A;  4M8N A;  1EF1 A;  3TJP A;  2C7N B;  4GGQ A;  4URK A;  4W9F A;  2JRH A;  2KVR A;  4LJP B;  4MJS B;  4FJY A;  1XD3 B;  2KKC A;  3DVN U;  4IM2 A;  2FCS A;  2ZCC A;  3QC8 B;  2DX5 B;  2MBH A;  4J6I A;  4AJY B;  4EZL A;  4FHK A;  2MW5 A;  2K1F A;  3CMM B;  3RYT A;  2KC1 A;  2IO1 B;  1UEL A;  1KM7 A;  3OJ3 A;  2K25 A;  3A4R A;  5EDS A;  1WE6 A;  4FJZ A;  4KIK A;  5CHF A;  3VUW A;  4NNJ B;  3PSE B;  1I35 A;  3ZTD A;  3VVW B;  3TBL D;  2DZM A;  3AU4 A;  4II2 B;  2LRU A;  2D10 A;  3W1S C;  1A5R A;  4W9L A;  3JW0 X;  1YD8 U;  2N7D A;  1VD2 A;  3MHS D;  4KSL C;  2WX1 A;  4CO7 A;  4K81 A;  2N7E A;  2C7H A;  2IO0 B;  2NPT A;  2DAJ A;  2AEH A;  4EUT A;  3NHE B;  2OOB B;  4GOC A;  3U30 A;  4W9I A;  3TL5 A;  1YX5 B;  2C9W B;  2FNJ B;  4EZK A;  3OJ4 B;  2L8J A;  2PE6 B;  2K6D B;  2MBE A;  2BWF A;  4TV3 A;  2LGD A;  2LVQ A;  4GU2 A;  1Q5W B;  3EFU A;  5CHW A;  4F1S A;  1KOT A;  1WX8 A;  2AYO B;  3MJW A;  1V86 A;  4ANX A;  2PE9 A;  3AU5 A;  3V62 A;  2BYE A;  3APD A;  3SD5 A;  1WFY A;  4RM9 A;  4GB9 A;  3WA0 A;  2LGY A;  3KUC B;  1H8C A;  3ZRC A;  4MDK E;  2NVU I;  2PEA A;  2NS5 A;  4WQO B;  5L83 A;  2MBO A;  3PV1 A;  4EZJ A;  1QZE A;  2CR5 A;  2XBB C;  3PPA A;  1G6J A;  3H9D A;  1GG3 A;  2NBW B;  1SGH A;  3IVF A;  2KDI A;  2M0X A;  1GUA B;  5JHA A;  4KDL B;  4G11 A;  5LXI B;  1SE9 A;  5E6O A;  2L0T A;  1TZ1 A;  2JT4 B;  4NY0 A;  1VCB A;  4F7Z A;  5D94 A;  4ICU A;  2MBQ A;  4BKS D;  1P0R A;  1OEY J;  3WAO A;  3VAW A;  1PQS A;  2GOW A;  3HM3 A;  2LRW A;  1X1M A;  4AP4 C;  5L95 C;  4KZC A;  2LGX A;  3A9J A;  4HCN B;  3RZF A;  2MA9 B;  2HTH A;  4ZYN A;  2KLC A;  4B9K A;  5J17 A;  4WJP A;  2LI5 A;  4BKT A;  1Z5S B;  1V6E A;  4F8C B;  3DCG A;  3APC A;  5DPW A;  4XX5 A;  3PRP B;  2CHZ A;  4BVU C;  4ZRK A;  4FAD A;  3A9J B;  4FJV B;  2KQS A;  2RR9 A;  4DWF A;  3VFK A;  4WJO A;  1WI0 A;  3WAP A;  3TCA A;  3VDZ A;  1OEY A;  1XQQ A;  2RGF A;  2BF8 B;  3CF6 E;  4IWQ A;  3X23 A;  4MH0 E;  5LXH A;  5AZF A;  2JRI B;  2KX3 A;  3A1Q A;  3QHT A;  2GBJ A;  3BY4 B;  5KHQ A;  1LQB A;  4K7U A;  4GSW A;  4KZ0 A;  4WWO A;  4DDG D;  1V5T A;  3PLV A;  2MQJ A;  4IWP A;  3EHV A;  1R4M I;  2KFJ A;  2K8H A;  2KWU B;  2J0J A;  3NZU A;  3A1Q B;  1P98 A;  4MSQ B;  4BBN F;  2IY0 B;  4MGI E;  4OVV A;  3JYU A;  2WYQ A;  2LWP A;  2KMC A;  1KJT A;  3H7P A;  1RLF A;  3H1U A;  3ZW3 A;  4RM8 A;  2LVO A;  3ZNH B;  2AWT A;  2ZPY A;  2QHO A;  2IZV B;  2N1V A;  1UZX B;  1E8W A;  3IG3 A;  1RAX A;  4FA6 A;  2KX0 A;  3H7P B;  4DHZ B;  3JSV B;  4WAA A;  3R7Q A;  4NQL B;  1WGR A;  2ZCB A;  3H7S A;  1LXD A;  2Z59 B;  3UQA A;  4TKN A;  2EMS A;  2MRP A;  3K9P B;  1HE8 A;  4HJK A;  3KH0 A;  1C3T A;  1WXM A;  1P3Q U;  3Q3J A;  1WMH A;  4FLH A;  2EKE C;  1ISN A;  1V81 A;  4WWN A;  2MP2 B;  4PS8 A;  5KHO A;  1EF5 A;  4GDK A;  3NOB A;  2ZNV C;  2MBB B;  1WE7 A;  1XT9 B;  4KSK C;  4JLC A;  3V61 A;  3IBE A;  2KWC A;  3GZN I;  2LVP A;  2MSE D;  2FCQ A;  2REX A;  2IBI B;  2LZ6 A;  3TMP B;  1WGY A;  2LD9 A;  2LUE A;  2XEW A;  2KTF A;  3Q3F A;  2KHW B;  4GDK B;  3W1S A;  4NAW A;  3AXC A;  4PYZ A;  2M17 A;  3H6N A;  1Q0W B;  3KUZ A;  2BKR B;  2M1M A;  5JHB A;  2HJ8 A;  1D3Z A;  3M95 A;  4II3 B;  2YLM A;  5JZE B;  1V2Y A;  3LJ3 A;  3UIO B;  4NAW B;  3ML9 A;  3RT3 B;  5C1Z A;  3O65 B;  2PPH A;  2CU1 A;  2A4Z A;  2BWE S;  2N9X A;  3PT2 B;  4KIK B;  2Z0D B;  3KUD B;  2K39 A;  4GDL A;  1JRU A;  3N32 A;  2WDT B;  2FAZ A;  1GC7 A;  4AJW A;  1F9J A;  2KJ6 A;  1WM3 A;  2V1Y A;  5DCN A;  3ZUN A;  4CYE A;  1WXV A;  3KYC D;  1RRB A;  4HDO A;  4BBN C;  3QCA A;  4DHZ E;  3A9K A;  5JH5 C;  3RUI B;  2NBV B;  1V80 A;  2C7M B;  2JF5 A;  2NPT B;  4HXD A;  3HHM A;  4GDL B;  4LDT B;  4DDI D;  4ANV A;  2MCN B;  4KVG B;  2G4D B;  3LDZ E;  5E6P A;  3D32 A;  2K8C A;  4W9G A;  1LFD A;  4PYU A;  5TR5 A;  3DVG Y;  2DEN B;  1K8R B;  5DPS A;  2CHW A;  2WX0 A;  3NZS A;  3ZNI D;  1E5W A;  2JUO A;  2KAN A;  2KO3 A;  2BPS A;  3DVN V;  4I6N B;  3VQI A;  2D11 A;  1GNU A;  3L10 B;  4OVU A;  2N4F A;  4G50 A;  2OJR A;  4TUU A;  1WF9 A;  4MEM A;  1WH3 A;  1MG8 A;  3VUY A;  2FIF A;  5D7G A; 
#chains in the Genus database with same CATH topology
 2DYM A;  4KV2 A;  4YSZ B;  2DAF A;  1MI0 A;  1XCQ L;  3PRZ A;  4YWG G;  1FD6 A;  3DBL I;  2V3N A;  1JQ4 A;  2GBN A;  3L17 A;  1GJZ A;  5D6J B;  4YTN B;  5DPT A;  4E74 A;  2ZJD A;  4RMA A;  2JX5 A;  2WXM A;  1QKZ A;  2WNM A;  3RN9 C;  1ZXH A;  3IT6 B;  2VZK D;  1YJJ A;  1WIA A;  2XK5 A;  3ZTC A;  1KLV A;  1N61 A;  2QIL A;  2EMT A;  1FFV A;  1IBX A;  3HVD A;  2IO2 B;  3SFE B;  2JWU A;  2LUM A;  2Y3A A;  2K3U A;  4DXG A;  4PS7 A;  5IA7 A;  3VR9 B;  3ZYY X;  2V3P A;  4ASW C;  2K6Q A;  4M0W A;  1BT0 A;  3CWI A;  3V60 A;  3DHG C;  4ZHP A;  2L00 B;  4MAC A;  4IUM B;  1P1A A;  2UU7 A;  1LM8 B;  1TZO A;  2FCM A;  2L7R A;  3KVF B;  1UH6 A;  1GOZ A;  2BGF A;  2WXL A;  1B9R A;  2KDE B;  3UGB B;  2IPK D;  4BZA A;  3NZ3 A;  1ZKH A;  2XN9 C;  3QK0 A;  5GMV A;  1AWD A;  3DBL B;  2ZW1 A;  3R2I A;  1AAR A;  3IFW B;  1WX7 A;  2WXH A;  3ALB A;  3HRD D;  4GLS C;  5CX3 A;  5AZG A;  2ZVO A;  4L23 A;  3KWV A;  3M3J A;  2W9N A;  1ZE3 D;  3AE2 B;  2WGS A;  1FXA A;  1J0G A;  4P6V F;  5HFY A;  1WRI A;  2J0K A;  2GBR A;  2KDB A;  3QX1 A;  3BZD B;  3TSS A;  5E6N A;  3VUX A;  4MT5 A;  3P4S B;  2FBW B;  4OW0 A;  2I38 A;  2C60 A;  1WGH A;  3N30 A;  4AUQ C;  1UGJ A;  2HE7 A;  3J9C A;  3VTV A;  3A9K B;  3AUL A;  2DZI A;  3OAW A;  1E10 A;  1BUI C;  4CHK A;  2JZ3 B;  2L32 A;  2E6X A;  3M62 B;  2PJH A;  2RPQ A;  5FR3 A;  4GIV A;  4JGH B;  2AL3 A;  3ETR A;  1ROE A;  2JU6 X;  1SF0 A;  2IY1 B;  1WZ3 A;  3MC0 B;  2FCN A;  4P1C C;  2KWD A;  3PVL A;  3ENE A;  2O2V A;  1OQY A;  1IUE A;  3CST A;  3ZXV A;  3DBS A;  4FBJ B;  1C76 A;  2X8X X;  3CSF A;  3MTN B;  4MGY E;  1Y8R C;  4FXC A;  2QEJ C;  3C0R B;  1KF6 B;  5HHD G;  3URY A;  2KQ4 X;  3P1M A;  4HPP A;  3ECI A;  2KTR B;  4BAX A;  4YTP B;  2RSU A;  1HA5 A;  3R7R A;  1WXA A;  1WRD B;  1FNW A;  3DQV A;  4B6W A;  1RWS A;  2A5U A;  4FHJ A;  5EE3 A;  2D3G A;  4HVB A;  1OGW A;  4IKG A;  3VH3 B;  1DGJ A;  4R3D A;  1AYF A;  4M8M A;  4WUR A;  5BYQ A;  5IKC M;  3ZO5 B;  2K5P A;  1VZ6 A;  1RFA A;  3DWM A;  1YQ3 B;  1E90 A;  3AE5 B;  4HJG E;  1TKG A;  2BT6 A;  2GBK A;  3WAL A;  2GMI C;  2LAS A;  1YQ4 B;  3NUH B;  2IYD B;  1L2N A;  4GN1 A;  2K22 A;  2Z0E B;  3RNE C;  3QWZ B;  5HKH A;  3FAH A;  2D3B A;  2BS3 B;  3AM9 A;  3BK2 A;  4H2A A;  3PRM B;  1IP9 A;  4ACF A;  2JYT A;  1C4P A;  2WS3 B;  1SSN A;  3I3T B;  3DHI C;  1EWC A;  1UF0 A;  2G9H D;  1K51 A;  2MP2 A;  4MM3 A;  1MHX A;  4EKU A;  1Y56 A;  1L4Z B;  1YJ1 A;  5LNK 1;  2LGS A;  4O1N A;  1EF1 A;  3TJP A;  3AE3 B;  1WYG A;  4LJP B;  4MJS B;  4M01 A;  2BB5 A;  2KKC A;  2VH2 A;  3DVN U;  4IM2 A;  3Q3M C;  2FCS A;  1XLQ A;  2DX5 B;  2MBH A;  3P4P B;  2J4X A;  4J6I A;  2MW5 A;  3R8B A;  3RYT A;  2KC1 A;  1UEL A;  3PO0 A;  1RFK A;  3A4R A;  5EDS A;  4XE0 A;  2FE8 A;  1VJK A;  4II2 B;  2LRU A;  2D10 A;  3JW0 X;  4KSL C;  2Q5W D;  2WX1 A;  2N7E A;  1FRD A;  2C7H A;  1UNS A;  2AEH A;  2ZW0 A;  4W9I A;  1YX5 B;  2C9W B;  2FNJ B;  4EZK A;  3IXS A;  2LVQ A;  1TJE A;  1V86 A;  1F1H A;  1WFY A;  2WU2 B;  2SEB D;  4GB9 A;  3KUC B;  4YSY B;  1R4N B;  1XLO A;  2NS5 A;  4WQO B;  3ZJT A;  3PV1 A;  2QMT A;  1UUP A;  1QZE A;  2CR5 A;  3HVZ A;  4PK1 A;  2XBB C;  1HEZ E;  3LXF A;  4G11 A;  5LXI B;  4A55 A;  4D2K A;  2IGG A;  3FIL B;  3NRZ A;  1TS5 A;  2BS2 B;  1PQS A;  1NEK B;  2GOW A;  2LGX A;  4HCN B;  2M0A A;  2HTH A;  4ZYN A;  2V4I B;  4OZA A;  1T5X D;  4WJP A;  2LI5 A;  1Z5S B;  1V6E A;  4F8C B;  3DCG A;  3PRP B;  5JXV A;  3V05 A;  4DWF A;  1WI0 A;  3WAP A;  4YSX B;  2INC C;  2RGF A;  2BF8 B;  4LTU A;  4IWQ A;  1SE2 A;  3GE8 C;  1TY2 A;  3Q8C A;  1P7E A;  3VR8 B;  5T8I A;  1VLB A;  4K7U A;  1AW7 A;  1V5T A;  2KWU B;  2K8H A;  1P98 A;  3JYU A;  2WYQ A;  1N63 A;  1RLF A;  3H1U A;  2HDE A;  2LVO A;  4YTM B;  2QHO A;  2IZV B;  2N1V A;  1UZX B;  2H89 B;  1E8W A;  3N9Y C;  1E7P B;  1RAX A;  4L2Y A;  2Z59 B;  2EMS A;  2MRP A;  3AV8 A;  1HE8 A;  4RH6 A;  4IOI E;  1YJI A;  1EU3 A;  2N9L A;  4PS8 A;  5KHO A;  1EF5 A;  4GDK A;  2ZNV C;  1XT9 B;  1T0S C;  2G1E A;  2MSE D;  2IBI B;  4XYC A;  1NYQ A;  4JWS C;  2MH7 A;  2IJ0 A;  5FK9 C;  2BKR B;  3RI7 C;  5JHB A;  2HJ8 A;  2YLM A;  2YEP B;  3RNG C;  5JZE B;  5C1Z A;  3O65 B;  2PPH A;  3PT2 B;  2A4Z A;  4N59 A;  4KIK B;  3KUD B;  2K39 A;  2J52 A;  2WDT B;  1F9J A;  2KJ6 A;  2K0P A;  2V1Y A;  4J3O D;  3QCA A;  1V80 A;  2NPT B;  3HHM A;  4B0M A;  2OED A;  3AEB B;  4LNK A;  2W3R A;  3LDZ E;  4W9G A;  3KLS X;  4PYU A;  1XCT L;  2GRI A;  5DPS A;  2WX0 A;  2KAN A;  1EU4 A;  3DVN V;  4I6N B;  2D11 A;  1C4A A;  1WF9 A;  4NJC A;  3VUY A;  4XC2 A;  2J42 A;  4XDC A;  4HLE A;  2X38 A;  5AZH A;  2O6V A;  3SEB A;  4A3P A;  4JE3 B;  4KX6 B;  5CHV C;  1PUT A;  5D2M B;  3ZRF A;  1JWU D;  3ZLZ A;  1K52 A;  2NCN A;  2J53 A;  2K8B A;  1N6Z A;  2JZP A;  2L52 A;  4LNO A;  1J7A A;  1WY8 A;  3U2S C;  3TUO A;  1VR9 A;  4XWT A;  3AE8 B;  3AEG B;  2UYZ B;  1TKY A;  1QQR A;  2DBY A;  3ZQ4 A;  4W9K A;  2KMM A;  3I57 A;  1ZP0 B;  2KT7 A;  2V9H A;  2M8S A;  1EUV B;  1WJ6 A;  1I42 A;  4IM0 A;  3L54 A;  4MGZ E;  4FUL A;  5G55 A;  2KQ7 A;  3DBR I;  3ZDT A;  2NTT A;  1JCK B;  2XK5 B;  2EEL A;  1TS4 A;  2AQ2 B;  4GMV A;  1F52 A;  1IBX B;  2KC2 A;  3BWU D;  4HEA 1;  5H8Y E;  5BO4 B;  4C00 A;  3M63 B;  4E71 A;  1ZW7 A;  2R2Q A;  2LEK A;  4W9D A;  4M0W B;  1KRH A;  2W3S A;  1H4R A;  3U7D A;  1XEE A;  3X0W A;  3ZNG C;  3BVZ A;  2ASQ A;  2KK8 A;  4AWJ A;  2WP9 B;  1C1Y B;  2QJL A;  3FC4 A;  4LLG M;  1ZXI A;  1C9F A;  1Q10 A;  2CKH B;  4DK5 A;  4A8X C;  1HZ5 A;  3GOE A;  2BYV E;  2KN5 A;  3MC9 A;  1L5P A;  3WAM A;  2WWZ A;  2J7Q B;  5C2T B;  3WIM A;  2PVG C;  3VTW A;  1Q1O A;  3Q8A A;  1UD7 A;  1MFW A;  2BBC A;  3DBR B;  2JXT A;  4HKQ A;  2SAK A;  3L16 A;  4E3C A;  5TSS A;  3A4S C;  3Q69 A;  4Q2J A;  2CS4 A;  3UIN B;  3N1Z C;  1TBE A;  1YN4 A;  3PHW B;  1E8X A;  4BKS A;  3NY5 A;  4JL9 A;  3L13 A;  3QAR A;  3T3O A;  2KFK A;  3QJZ A;  2C5L C;  2GB1 A;  1T0R C;  1TY0 A;  3RD2 A;  4EFO A;  2JXX A;  2KXJ A;  2D3A A;  2L83 A;  4JQW C;  4HCP B;  1WYW B;  2QDF A;  4TSS A;  2V4L A;  3R3M A;  4IG7 B;  3B9J A;  1BXT A;  2MJE A;  2O2V B;  5IAA C;  4BOS C;  4OHJ A;  3UF8 A;  4K7S A;  3EGR A;  2G3Q B;  4QAY A;  3U7Z A;  3DVG X;  2RDG A;  1WZ0 A;  4ZRQ A;  4RFB A;  3L4P A;  4BFR A;  3VHT C;  1Z2M A;  4ZDV A;  4LNF A;  4W9E A;  4WJQ A;  2RD0 A;  3B08 A;  1WR1 A;  4C7Y A;  2L3Z A;  1ZDX A;  1QLB B;  3BYT B;  3NVY A;  1QOF A;  1TYG B;  1AN8 A;  2MLB A;  3RZW C;  2KYW A;  1SE3 A;  2JY6 A;  2IO3 B;  3ZIM A;  1M94 A;  5C23 A;  4TQ1 A;  4X57 B;  2KJR A;  4LNN A;  1WXS A;  2KMA A;  3T8M A;  4GXB A;  1S1Q B;  2HJ1 A;  4WJN A;  3VH4 B;  3BII D;  2AL6 A;  2ZVN A;  3N3K B;  1L6U A;  4M8N A;  1CZP A;  2C7N B;  4URK A;  1PGA A;  4MM3 B;  1XD3 B;  3PZ8 A;  3QC8 B;  4AJY B;  3CMM B;  3RNC C;  1WE6 A;  4FJZ A;  3VVW B;  5GXG B;  1A5R A;  3MHS D;  2FUG 1;  4CO7 A;  4K81 A;  2DAJ A;  1IGD A;  3NHE B;  3TL5 A;  3I5J C;  2MHJ A;  5BMH A;  1B1Z A;  5G5G A;  4TV3 A;  1Q5W B;  3B2G A;  1CJE A;  3AU5 A;  2BYE A;  1KLU D;  4RM9 A;  3WA0 A;  2PEA A;  5L83 A;  1JWA D;  1RYJ A;  4EZJ A;  2NBW B;  1SGH A;  2KDI A;  3AH7 A;  5JHA A;  4ZOH C;  2WDR B;  1I4G A;  1TZ1 A;  4F7Z A;  2PLP A;  5D94 A;  4K3C A;  4XDD A;  3HM3 A;  1X1M A;  5L95 C;  3A9J A;  3MP9 A;  2I2Y A;  1F2R C;  5DPW A;  4XX5 A;  3NG0 A;  2BS4 B;  4ZRK A;  4FAD A;  4FJV B;  2LMC A;  1DYQ A;  4WJO A;  3Q3N C;  3VDZ A;  2QCZ A;  1XQQ A;  3BYY B;  5AZF A;  2JQR B;  3A1Q A;  3AEC B;  3QHT A;  3ZXR A;  2GBJ A;  1LQB A;  1JW9 D;  3NVV A;  3PLV A;  1R4M I;  2KFJ A;  4BBN F;  2IY0 B;  1VZ8 A;  4CQN A;  5FKA C;  3ZW3 A;  4RM8 A;  3EFC A;  3ZNH B;  2ZPY A;  4NAM A;  3IG3 A;  4FA6 A;  1C79 A;  2KX0 A;  3JSV B;  1I7H A;  4WAA A;  1WGR A;  4XGA B;  3ZGZ A;  3K9P B;  1QIL A;  3N1X C;  2EKE C;  3P42 A;  1JWM D;  2IND C;  1EWY C;  4KSK C;  5IN7 A;  3EA6 A;  2WXN A;  2LVP A;  1ZUD 2;  2N0S B;  2REX A;  2LZ6 A;  2HTM E;  2LUE A;  3E9S A;  4GDK B;  4NAW A;  2AX5 A;  2ONQ A;  2M17 A;  3KUZ A;  1Q0W B;  4WH4 A;  1FNV A;  1SBB B;  3M95 A;  1V2Y A;  2CU1 A;  2BWE S;  2N9X A;  4GDL A;  3OG5 A;  3ZJU A;  2W82 A;  4JPS A;  4BBN C;  5JH5 C;  4DHZ E;  3A9K A;  3Q14 C;  4HXD A;  2C7M B;  4UDU C;  1R4M B;  2JF5 A;  1GB4 A;  3AN1 A;  2MCN B;  1FFU A;  2GI9 A;  1VZ7 A;  2CHW A;  3NZS A;  1C4C A;  1FO4 A;  1FIQ A;  3VQI A;  2K9X A;  4RGT A;  3E56 A;  3IAM 1;  2N4F A;  4TUU A;  4MEM A;  3N20 C;  1WH3 A;  4ZRJ A;  2FIF A;  4EOY A;  3AE9 B;  3QA8 A;  3AE6 B;  1KFY B;  1YNT E;  3W5V B;  4NQK E;  1QOA A;  3SR6 A;  4HPL B;  2N9E B;  2M4N A;  1DOI A;  2O6V B;  2WXG A;  3NS8 A;  2KAC A;  5EE1 A;  4RGN A;  2AQ1 B;  1TGZ B;  2WXR A;  1WR6 E;  4MSM B;  2KTR A;  3LB8 C;  2ICI A;  1ZOY B;  1IYF A;  3UIP B;  4ZYS A;  1EM7 A;  4HPM B;  3W1Y A;  3C19 A;  4LNI A;  3QAQ A;  2KWV B;  3U8Z A;  3KWL A;  3TEX A;  2H88 B;  2MWS B;  4W9J A;  3PHX B;  3EEC A;  4RF0 A;  1K50 A;  3Q2A C;  1TTN A;  2QIE B;  3L0W B;  3V6C B;  4BOZ B;  4N6E B;  1PFD A;  2DYO A;  2RDB C;  2ON8 A;  3B1L X;  3SU8 X;  2RDH A;  1P7F A;  1WX9 A;  1E8Z A;  3UI3 A;  2Y5B B;  3CIR B;  2JYE A;  1UGM A;  2LXA A;  1NVI D;  1P9D U;  2ZNV B;  3OWE B;  5HG2 A;  2NBU A;  2KDM A;  2V3S A;  3ZDM C;  1NDD A;  4FN2 A;  1WMH B;  1CMX B;  3EUB 2;  4ANU A;  1V9J A;  4MJS A;  1C78 A;  2LXC A;  2WXO A;  4A6Q A;  4RNA A;  3DOW A;  3O13 A;  4EE2 A;  2KD0 A;  3RNF C;  1K53 A;  3DBH I;  2E3T A;  1UBI A;  4W9C A;  1WJN A;  2QC8 A;  3TEW A;  1J8C A;  1WJ4 A;  2IDY A;  4ZRI A;  3RCZ A;  2ZZP B;  3HIZ A;  2JPH A;  4RCO A;  4XZ4 A;  5MPO A;  2I1K A;  3BIN A;  2UWQ A;  1V1P B;  4IWO A;  3KW5 B;  2L05 A;  2LJ5 A;  1V49 A;  1CK1 A;  2J0M A;  5I4D A;  1SEB D;  1NEN B;  4M00 A;  1WGD A;  4WWP A;  3AE4 B;  2DZK A;  2V0G A;  4BKG A;  1ZPS A;  1HZ6 A;  4C4V A;  1GC6 A;  2YVC A;  2JWZ A;  2KFK B;  2W55 A;  1D6E C;  5AEK B;  4ZHO A;  1ACC A;  1J19 A;  5IO9 A;  4DQO C;  1NYR A;  3QQ8 B;  4MH8 A;  3APF A;  3HM6 X;  5LLI A;  4OVZ A;  2G4S A;  4WWM A;  3PRE A;  2KNB A;  4A9A A;  1LGR A;  2WDV B;  1E8Y A;  1OQR A;  2ZPN A;  2WXK A;  4ZRP A;  1ZGU B;  1GB1 A;  1FCL A;  4KGS A;  2OJW A;  1NI2 A;  5D3I B;  1C77 A;  1I4H A;  2KOX A;  3S2A A;  3UQB A;  3QIJ A;  4JIO U;  1D5Z C;  3PZ7 A;  2WQY B;  4LCD E;  1YN3 A;  3I63 C;  4IW0 A;  2DHZ A;  3EC8 A;  5J18 A;  2AQ3 B;  4K7W A;  4RGO S;  4HDQ A;  1E7U A;  2L0F A;  2KJH B;  2BW2 A;  3B0A A;  2WXF A;  1S3S G;  2BYF A;  1YIW A;  4NJ7 A;  4P7I A;  4I6L B;  2HD5 B;  4NJ6 A;  1L7Y A;  3KQ4 A;  2DZJ A;  2N9P C;  4YL8 A;  4W9H A;  1T0Y A;  3ZJV A;  2MJD A;  2KVR A;  4FJY A;  2L1A A;  2ZCC A;  1KTK A;  4FHK A;  1T0Q C;  1HXY D;  1XO3 A;  4US9 A;  4HRO A;  3U4E G;  4KIK A;  2NMQ A;  1HQR D;  1I4R A;  3PSE B;  1I35 A;  1SIJ A;  2KVZ A;  3TBL D;  4US8 A;  3AU4 A;  3NS1 A;  1YD8 U;  1VD2 A;  1STE A;  1SXT A;  3TEZ A;  1KH0 A;  2IO0 B;  2NPT A;  4EUT A;  2OOB B;  4GOC A;  1PGB A;  4B0E A;  1UWM A;  2K6D B;  2MBE A;  2PE6 B;  4GU2 A;  5CHW A;  1KOT A;  2AYO B;  2WDQ B;  3MJW A;  4ANX A;  2PE9 A;  3V62 A;  1L6V A;  3NVW A;  4HKZ E;  3Q8E A;  2Y5C A;  3ZRC A;  4L1B A;  4MDK E;  1PYW D;  2NVU I;  1IGC A;  2VZK B;  2R61 A;  3H9D A;  1GG3 A;  4KDL B;  1SE4 A;  2L0T A;  4NY0 A;  2JT4 B;  4WIP A;  2VH1 A;  2MBQ A;  2DLB A;  2Z8L A;  4S17 A;  3WAO A;  2LRW A;  5E6J A;  4KKI A;  4KZC A;  3RZF A;  2MA9 B;  1JWB D;  4BKT A;  1FXI A;  4NZL B;  2EKI A;  3APC A;  2CHZ A;  4BVU C;  3A9J B;  2KQS A;  2RR9 A;  3VFK A;  3W5U B;  3AEA B;  2KX3 A;  5KHQ A;  1D4B A;  1FPY A;  2CJN A;  5D3D A;  4DDG D;  2MQJ A;  4IWP A;  3A1Q B;  4MSQ B;  1HTQ A;  1N5X A;  2LWP A;  2KMC A;  3H7P A;  2W54 A;  3IT4 B;  4OZC A;  3AMZ A;  4C7Z A;  4DHZ B;  2N7J A;  2MJ3 A;  4NQL B;  3H7S A;  3I9V 1;  2WLB A;  3ABV B;  3KH0 A;  1C3T A;  1P3Q U;  3Q3J A;  4FLH A;  4ITK A;  2MP2 B;  1WE7 A;  3AE1 B;  3V61 A;  4JLC A;  4YXD B;  4P1B C;  3GZN I;  2WHI A;  3TMP B;  1WGY A;  2KHW B;  3AXC A;  1F2R I;  3W9C B;  1OFF A;  1NI3 A;  1D3Z A;  1WXQ A;  3UIO B;  4NAW B;  3ML9 A;  4WAF A;  1OQQ A;  3RT3 B;  2PTL A;  1QOB A;  4USA A;  1E0Z A;  2FAZ A;  1GC7 A;  5IOI A;  5DCN A;  3B2F A;  4CYE A;  4AQ7 A;  3KYC D;  1RRB A;  1XLN A;  2NBV B;  4P16 A;  2OHF A;  4GDL B;  1HTO A;  3WCQ A;  4LDT B;  2WXP A;  4DDI D;  4KVG B;  3SFD B;  1SJE D;  5E6P A;  2K8C A;  1LFD A;  4M02 A;  2LGI A;  3DVG Y;  2DEN B;  5EE0 A;  3ZNI D;  1E5W A;  2M19 A;  1ESF A;  2OJR A;  5D7G A;  4KGT A;  3DDC B;  2MX2 A;  3ZNZ B;  1R7S A;  4LDT D;  3V6E B;  4A3O A;  1YX6 B;  3GZN B;  4ANW A;  1FNU A;  1F0Z A;  3WAN A;  3MFG A;  1JAL A;  1FXT B;  2Y5P A;  4A20 A;  4NPN A;  3R66 C;  3AEF B;  1QOG A;  1ET9 A;  3SHQ A;  3VRA B;  4MEL A;  3OLM D;  4LJO B;  2WU5 B;  3Q8F A;  2DNF A;  3IAS 1;  1EO6 A;  3JVZ X;  3SDL C;  3T9L A;  4XWW A;  1MJD A;  1MPE A;  1RM6 C;  2NR2 A;  1L0V B;  2DYB A;  1N60 A;  1WGK A;  4YT0 B;  3P2B A;  4LK0 M;  4G0N B;  3W2D A;  3TIX A;  1XLP A;  1JRP A;  3C8Y A;  1NBF C;  1FCC C;  4K1R B;  1J7B A;  2R2O A;  1L0X B;  2CHX A;  2BTE A;  4EEW A;  5EE9 A;  2KLG A;  2KZR A;  4TQ0 A;  2N1W A;  3PS6 A;  1WSP A;  1MG4 A;  4DHJ B;  1WGG A;  1R4N I;  4ICV A;  4RF1 A;  1XF5 L;  3P63 A;  2BB6 A;  1L4D B;  3ONS A;  2TSS A;  3V3X A;  4DXF A;  2PVO D;  4I6P A;  1JWS D;  1YN5 A;  1TT5 B;  3DPD A;  1CQV A;  1DOY A;  3AEE B;  2D07 B;  1L0Y B;  3BVG A;  3A33 B;  3VXW A;  4DHJ D;  1UBQ A;  2I1J A;  1JML A;  4K3B A;  3PGE A;  5J2R A;  1U4A A;  1FM0 D;  2KDF B;  3PZD A;  3AE7 B;  4HRS A;  4REZ A;  3IHP C;  2QSD A;  1E9M A;  3ML8 A;  3Q6B A;  1WJU A;  3MC8 A;  4IC7 B;  4N9F 4;  1KLG D;  1SIF A;  3HUI A;  1V5O A;  2BKF A;  2XNA C;  4OZB A;  4DXA B;  2D3C A;  2IGH A;  2INN E;  4HWI B;  2PIA A;  2ZEQ A;  1YMH E;  1ZDV A;  4C4V B;  3VTU A;  4IM3 A;  1D5X C;  5H92 C;  2GBM A;  3KYD D;  1VDV A;  1WM2 A;  4KDI C;  4ARC A;  5G2N A;  2JZZ A;  1F77 A;  1XXG A;  3VRB B;  2IGD A;  3N1Y C;  2FUH B;  4KGR A;  1FEH A;  4WQM A;  2JVC A;  2CU3 A;  3AI5 A;  3RMK C;  3TEY A;  5DPR A;  4G3X B;  1GPX A;  3K9O B;  2DWQ A;  1FMA D;  1I4P A;  1V8C A;  3RUL A;  2VRR B;  2O6V D;  1MVK A;  5CTR C;  4MGK E;  3PLU A;  2L76 A;  3GS2 A;  4HK2 A;  5BMG A;  3HK0 A;  1TS2 A;  3RPF C;  1YQB A;  2YEP F;  5BYR A;  2PKO A;  1IPG A;  2FID A;  2PW9 A;  3H8H A;  4B95 A;  2B3A A;  4PS3 A;  1E7V A;  3PTF C;  1OTR B;  1TKE A;  2RMM A;  5BMI A;  3JSV A;  4AOF A;  3GE3 C;  4DBG A;  3ZKJ C;  3LYY A;  3ZVV A;  2CJO A;  4TMA B;  3RNB C;  5FR6 A;  2D2Q A;  1QF6 A;  2G45 B;  3L08 A;  4GGQ A;  4W9F A;  2JRH A;  1VRA B;  4EZL A;  2K1F A;  3FKY A;  3P4R B;  4C56 C;  2IO1 B;  1ET6 A;  1KM7 A;  3P4Q B;  1T6B X;  2LHD A;  2K25 A;  3OJ3 A;  1MHH E;  5CHF A;  3VUW A;  4NNJ B;  3ZTD A;  2DZM A;  3W1S C;  4W9L A;  2N7D A;  4RGM A;  2WXI A;  2NTS A;  2N9K A;  3U30 A;  5HI1 A;  3OJ4 B;  1A70 A;  2L8J A;  1FRR A;  1GAQ B;  2BWF A;  3Q3O C;  2LGD A;  1M4V A;  3EFU A;  4F1S A;  4C80 A;  1WX8 A;  2RPV A;  1J7C A;  3APD A;  3SD5 A;  2LJI A;  2LGY A;  4JX1 C;  1H8C A;  3BVM A;  1UWX A;  2MBO A;  3FIL A;  4N58 A;  3DWG C;  4KKJ A;  3PPA A;  1G6J A;  4AS1 A;  3IVF A;  2M0X A;  1GUA B;  2ACZ B;  1TS3 A;  5G5H A;  1SE9 A;  5E6O A;  1VCB A;  2LHE A;  4ICU A;  4BKS D;  3DBH B;  1P0R A;  2PMV A;  1OEY J;  3VAW A;  4AP4 C;  2KLC A;  4IDI A;  4B9K A;  5J17 A;  2JSV X;  2BYT A;  2M56 B;  1T3Q A;  3TCA A;  2MEK A;  1OEY A;  2BQQ A;  3CF6 E;  3X23 A;  4MH0 E;  5LXH A;  2JRI B;  3NJT A;  3T3N A;  1TIF A;  3BY4 B;  2INP E;  4GSW A;  2KAJ A;  5AUK A;  4KZ0 A;  4WWO A;  2WXQ A;  3EHV A;  2J0J A;  3NZU A;  4MGI E;  4OVV A;  1D5M C;  1KJT A;  3BK1 A;  2WXJ A;  2KN4 A;  2AWT A;  3H7P B;  1E6E B;  1I4Q A;  3R7Q A;  3MHZ A;  2LFI A;  2ZCB A;  3R2T A;  1LXD A;  3RNA C;  3UQA A;  4TKN A;  1BML C;  3NVZ A;  3Q8B A;  4HJK A;  4PT5 A;  1WXM A;  1WMH A;  2GLS A;  3AED B;  1ISN A;  1I4X A;  1V81 A;  4WWN A;  1ENF A;  1SB3 C;  3NOB A;  2MBB B;  1YOV B;  3IBE A;  2KWC A;  3GP7 A;  2FCQ A;  3U52 E;  2LD9 A;  2XEW A;  2KTF A;  3Q3F A;  3W1S A;  4S0R A;  4PYZ A;  3H6N A;  1QT9 A;  1N62 A;  2M1M A;  5IP4 D;  4II3 B;  3LJ3 A;  4JWU C;  2BVC A;  2Z0D B;  2D5G A;  4A90 A;  1SJH D;  1JRU A;  3N32 A;  4AJW A;  1WM3 A;  3ZUN A;  1WXV A;  4HDO A;  1N5W A;  3RUI B;  1LO5 D;  1PGX A;  1V1O A;  1V97 A;  4ANV A;  1V1P A;  2B76 B;  2G4D B;  3D32 A;  4ARI A;  5TR5 A;  3DHH C;  1K8R B;  5BYS A;  2JUO A;  1DOX A;  2KO3 A;  2BPS A;  1GNU A;  3L10 B;  5AUI A;  1WWT A;  3GB1 A;  3RFZ B;  3AB5 A;  5C3J B;  4OVU A;  1JRO A;  4G50 A;  1PDX A;  1MG8 A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 3DDC B;  4XC2 A;  4HLE A;  2MX2 A;  2DYM A;  4EOY A;  5AZH A;  3QA8 A;  4KV2 A;  3ZNZ B;  2O6V A;  4A3P A;  4NQK E;  2DAF A;  5CHV C;  5D2M B;  3ZRF A;  4LDT D;  3V6E B;  4A3O A;  3PRZ A;  3ZLZ A;  1YX6 B;  4HPL B;  4ANW A;  3DBL I;  2N9E B;  2M4N A;  2GBN A;  2NCN A;  2O6V B;  3L17 A;  5D6J B;  1GJZ A;  3NS8 A;  2K8B A;  5DPT A;  1TGZ B;  4E74 A;  2ZJD A;  4RMA A;  1WR6 E;  3WAN A;  4MSM B;  2KTR A;  1WY8 A;  1IYF A;  3UIP B;  1FXT B;  4HPM B;  3W1Y A;  2UYZ B;  4NPN A;  3R66 C;  4A20 A;  4W9K A;  3QAQ A;  3SHQ A;  2KWV B;  3U8Z A;  1WIA A;  2XK5 A;  4MEL A;  3ZTC A;  2M8S A;  1EUV B;  3OLM D;  1WJ6 A;  1KLV A;  4LJO B;  4IM0 A;  1I42 A;  3L54 A;  4MGZ E;  2EMT A;  4FUL A;  5G55 A;  2IO2 B;  2KQ7 A;  2MWS B;  3DBR I;  4W9J A;  3ZDT A;  3PHX B;  4PS7 A;  2XK5 B;  1EO6 A;  3JVZ X;  5IA7 A;  3SDL C;  3T9L A;  3EEC A;  2NR2 A;  1TTN A;  4GMV A;  3L0W B;  2DYB A;  2KC2 A;  3V6C B;  4ASW C;  4BOZ B;  2K6Q A;  2DYO A;  5BO4 B;  4E71 A;  3M63 B;  1ZW7 A;  1BT0 A;  3P2B A;  2R2Q A;  3V60 A;  4G0N B;  3B1L X;  2L00 B;  4W9D A;  3SU8 X;  3TIX A;  4IUM B;  1NBF C;  1P1A A;  1LM8 B;  2FCM A;  4M0W B;  2L7R A;  4K1R B;  1H4R A;  3U7D A;  2R2O A;  1WX9 A;  3KVF B;  1UH6 A;  2CHX A;  3X0W A;  1E8Z A;  3ZNG C;  2Y5B B;  4EEW A;  2BGF A;  4ZRJ A;  2KLG A;  2KZR A;  4TQ0 A;  1UGM A;  2ASQ A;  2KDE B;  2LXA A;  2N1W A;  3UGB B;  3PS6 A;  1P9D U;  2ZNV B;  1ZKH A;  2KK8 A;  2NBU A;  2V3S A;  3QK0 A;  5GMV A;  3ZDM C;  4DHJ B;  1NDD A;  4FN2 A;  4AWJ A;  1C1Y B;  1WMH B;  1WGG A;  1R4N I;  1CMX B;  1AAR A;  3IFW B;  1WX7 A;  4ICV A;  2CKH B;  4DK5 A;  4ANU A;  1V9J A;  3GOE A;  4MJS A;  3ALB A;  2BYV E;  2KN5 A;  3ONS A;  5CX3 A;  5AZG A;  3WAM A;  2ZVO A;  2LXC A;  2J7Q B;  2WWZ A;  3M3J A;  2W9N A;  3DOW A;  3WIM A;  2KD0 A;  4I6P A;  3VTW A;  3DBH I;  1J0G A;  1Q1O A;  3DPD A;  1UBI A;  4W9C A;  1UD7 A;  1WJN A;  2D07 B;  2J0K A;  2GBR A;  1J8C A;  2KDB A;  3QX1 A;  1WJ4 A;  3A33 B;  3VUX A;  5E6N A;  4ZRI A;  3VXW A;  4DHJ D;  3RCZ A;  1UBQ A;  2ZZP B;  2I1J A;  3HIZ A;  3L16 A;  4E3C A;  2JPH A;  3PGE A;  2C60 A;  3A4S C;  4XZ4 A;  1WGH A;  3N30 A;  4AUQ C;  2HE7 A;  2CS4 A;  5J2R A;  3UIN B;  1U4A A;  3VTV A;  3A9K B;  2KDF B;  3AUL A;  3PZD A;  1TBE A;  2DZI A;  3OAW A;  2I1K A;  3BIN A;  4CHK A;  2UWQ A;  2JZ3 B;  3PHW B;  1E8X A;  4BKS A;  4IWO A;  3M62 B;  3IHP C;  2L05 A;  2PJH A;  3KW5 B;  2RPQ A;  3NY5 A;  2LJ5 A;  1V49 A;  2J0M A;  3ML8 A;  4GIV A;  1WJU A;  4JGH B;  4JL9 A;  4IC7 B;  4N9F 4;  1WGD A;  3L13 A;  3QAR A;  4WWP A;  2AL3 A;  2KFK A;  3QJZ A;  1SIF A;  2C5L C;  2DZK A;  1V5O A;  2IY1 B;  2BKF A;  4BKG A;  3RD2 A;  1WZ3 A;  1GC6 A;  2JXX A;  4EFO A;  2FCN A;  2YVC A;  4DXA B;  2KXJ A;  2JWZ A;  2KFK B;  4HWI B;  5AEK B;  3PVL A;  3ENE A;  2O2V A;  1J19 A;  1OQY A;  3CST A;  4HCP B;  2ZEQ A;  3DBS A;  4JQW C;  4FBJ B;  1WYW B;  3VTU A;  4IM3 A;  3CSF A;  2V4L A;  3MTN B;  3R3M A;  4IG7 B;  3QQ8 B;  4MGY E;  1Y8R C;  3C0R B;  2GBM A;  3APF A;  3HM6 X;  5LLI A;  2O2V B;  3KYD D;  2G4S A;  1WM2 A;  4KDI C;  5IAA C;  4BOS C;  5G2N A;  2JZZ A;  3ECI A;  3PRE A;  2KNB A;  2KTR B;  3UF8 A;  2FUH B;  4K7S A;  2JVC A;  2RSU A;  1E8Y A;  3AI5 A;  2ZPN A;  2G3Q B;  5DPR A;  3DVG X;  4G3X B;  3R7R A;  1WXA A;  1WRD B;  3K9O B;  1WZ0 A;  3DQV A;  1ZGU B;  3RUL A;  2VRR B;  4B6W A;  2A5U A;  2O6V D;  4FHJ A;  4MGK E;  2D3G A;  5CTR C;  1OGW A;  4HVB A;  3PLU A;  4BFR A;  3VHT C;  3VH3 B;  2L76 A;  1NI2 A;  1Z2M A;  4M8M A;  4W9E A;  4WJQ A;  4ZDV A;  4HK2 A;  2RD0 A;  2KOX A;  3HK0 A;  3S2A A;  3UQB A;  3ZO5 B;  3B08 A;  1YQB A;  1WR1 A;  3QIJ A;  2L3Z A;  1IPG A;  4JIO U;  2FID A;  1RFA A;  4LCD E;  4B95 A;  1E90 A;  4IW0 A;  2MLB A;  2DHZ A;  3RZW C;  2B3A A;  3EC8 A;  5J18 A;  2GBK A;  1E7V A;  2JY6 A;  2GMI C;  2IO3 B;  2LAS A;  3PTF C;  4K7W A;  4PS3 A;  3WAL A;  3ZIM A;  2IYD B;  1L2N A;  1M94 A;  4GN1 A;  5C23 A;  2Z0E B;  4HDQ A;  1OTR B;  3QWZ B;  5HKH A;  1E7U A;  2L0F A;  4TQ1 A;  3JSV A;  2KJH B;  4X57 B;  4AOF A;  2KJR A;  3PRM B;  4DBG A;  3B0A A;  1IP9 A;  3ZKJ C;  1WXS A;  1S3S G;  2BYF A;  2KMA A;  1YIW A;  4NJ7 A;  3ZVV A;  4P7I A;  3T8M A;  3I3T B;  1S1Q B;  4GXB A;  4I6L B;  2HD5 B;  4NJ6 A;  1L7Y A;  4WJN A;  5FR6 A;  2DZJ A;  3VH4 B;  2D2Q A;  2MP2 A;  4MM3 A;  2N9P C;  4EKU A;  4YL8 A;  2AL6 A;  2G45 B;  2ZVN A;  3N3K B;  3L08 A;  1YJ1 A;  4W9H A;  1T0Y A;  4M8N A;  1EF1 A;  3TJP A;  2C7N B;  4GGQ A;  4URK A;  4W9F A;  2JRH A;  2KVR A;  4LJP B;  4MJS B;  4FJY A;  1XD3 B;  2KKC A;  3DVN U;  4IM2 A;  2FCS A;  2ZCC A;  3QC8 B;  2DX5 B;  2MBH A;  4J6I A;  4AJY B;  4EZL A;  4FHK A;  2MW5 A;  2K1F A;  3CMM B;  3RYT A;  2KC1 A;  2IO1 B;  1UEL A;  1KM7 A;  3OJ3 A;  2K25 A;  3A4R A;  5EDS A;  1WE6 A;  4FJZ A;  4KIK A;  5CHF A;  3VUW A;  4NNJ B;  3PSE B;  1I35 A;  3ZTD A;  3VVW B;  3TBL D;  2DZM A;  3AU4 A;  4II2 B;  2LRU A;  2D10 A;  3W1S C;  1A5R A;  4W9L A;  3JW0 X;  1YD8 U;  2N7D A;  1VD2 A;  3MHS D;  4KSL C;  2WX1 A;  4CO7 A;  4K81 A;  2N7E A;  2C7H A;  2IO0 B;  2NPT A;  2DAJ A;  2AEH A;  4EUT A;  3NHE B;  2OOB B;  4GOC A;  3U30 A;  4W9I A;  3TL5 A;  1YX5 B;  2C9W B;  2FNJ B;  4EZK A;  3OJ4 B;  2L8J A;  2PE6 B;  2K6D B;  2MBE A;  2BWF A;  4TV3 A;  2LGD A;  2LVQ A;  4GU2 A;  1Q5W B;  3EFU A;  5CHW A;  4F1S A;  1KOT A;  1WX8 A;  2AYO B;  3MJW A;  1V86 A;  4ANX A;  2PE9 A;  3AU5 A;  3V62 A;  2BYE A;  3APD A;  3SD5 A;  1WFY A;  4RM9 A;  4GB9 A;  3WA0 A;  2LGY A;  3KUC B;  1H8C A;  3ZRC A;  4MDK E;  2NVU I;  2PEA A;  2NS5 A;  4WQO B;  5L83 A;  2MBO A;  3PV1 A;  4EZJ A;  1QZE A;  2CR5 A;  2XBB C;  3PPA A;  1G6J A;  3H9D A;  1GG3 A;  2NBW B;  1SGH A;  3IVF A;  2KDI A;  2M0X A;  1GUA B;  5JHA A;  4KDL B;  4G11 A;  5LXI B;  1SE9 A;  5E6O A;  2L0T A;  1TZ1 A;  2JT4 B;  4NY0 A;  1VCB A;  4F7Z A;  5D94 A;  4ICU A;  2MBQ A;  4BKS D;  1P0R A;  1OEY J;  3WAO A;  3VAW A;  1PQS A;  2GOW A;  3HM3 A;  2LRW A;  1X1M A;  4AP4 C;  5L95 C;  4KZC A;  2LGX A;  3A9J A;  4HCN B;  3RZF A;  2MA9 B;  2HTH A;  4ZYN A;  2KLC A;  4B9K A;  5J17 A;  4WJP A;  2LI5 A;  4BKT A;  1Z5S B;  1V6E A;  4F8C B;  3DCG A;  3APC A;  5DPW A;  4XX5 A;  3PRP B;  2CHZ A;  4BVU C;  4ZRK A;  4FAD A;  3A9J B;  4FJV B;  2KQS A;  2RR9 A;  4DWF A;  3VFK A;  4WJO A;  1WI0 A;  3WAP A;  3TCA A;  3VDZ A;  1OEY A;  1XQQ A;  2RGF A;  2BF8 B;  3CF6 E;  4IWQ A;  3X23 A;  4MH0 E;  5LXH A;  5AZF A;  2JRI B;  2KX3 A;  3A1Q A;  3QHT A;  2GBJ A;  3BY4 B;  5KHQ A;  1LQB A;  4K7U A;  4GSW A;  4KZ0 A;  4WWO A;  4DDG D;  1V5T A;  3PLV A;  2MQJ A;  4IWP A;  3EHV A;  1R4M I;  2KFJ A;  2K8H A;  2KWU B;  2J0J A;  3NZU A;  3A1Q B;  1P98 A;  4MSQ B;  4BBN F;  2IY0 B;  4MGI E;  4OVV A;  3JYU A;  2WYQ A;  2LWP A;  2KMC A;  1KJT A;  3H7P A;  1RLF A;  3H1U A;  3ZW3 A;  4RM8 A;  2LVO A;  3ZNH B;  2AWT A;  2ZPY A;  2QHO A;  2IZV B;  2N1V A;  1UZX B;  1E8W A;  3IG3 A;  1RAX A;  4FA6 A;  2KX0 A;  3H7P B;  4DHZ B;  3JSV B;  4WAA A;  3R7Q A;  4NQL B;  1WGR A;  2ZCB A;  3H7S A;  1LXD A;  2Z59 B;  3UQA A;  4TKN A;  2EMS A;  2MRP A;  3K9P B;  1HE8 A;  4HJK A;  3KH0 A;  1C3T A;  1WXM A;  1P3Q U;  3Q3J A;  1WMH A;  4FLH A;  2EKE C;  1ISN A;  1V81 A;  4WWN A;  2MP2 B;  4PS8 A;  5KHO A;  1EF5 A;  4GDK A;  3NOB A;  2ZNV C;  2MBB B;  1WE7 A;  1XT9 B;  4KSK C;  4JLC A;  3V61 A;  3IBE A;  2KWC A;  3GZN I;  2LVP A;  2MSE D;  2FCQ A;  2REX A;  2IBI B;  2LZ6 A;  3TMP B;  1WGY A;  2LD9 A;  2LUE A;  2XEW A;  2KTF A;  3Q3F A;  2KHW B;  4GDK B;  3W1S A;  4NAW A;  3AXC A;  4PYZ A;  2M17 A;  3H6N A;  1Q0W B;  3KUZ A;  2BKR B;  2M1M A;  5JHB A;  2HJ8 A;  1D3Z A;  3M95 A;  4II3 B;  2YLM A;  5JZE B;  1V2Y A;  3LJ3 A;  3UIO B;  4NAW B;  3ML9 A;  3RT3 B;  5C1Z A;  3O65 B;  2PPH A;  2CU1 A;  2A4Z A;  2BWE S;  2N9X A;  3PT2 B;  4KIK B;  2Z0D B;  3KUD B;  2K39 A;  4GDL A;  1JRU A;  3N32 A;  2WDT B;  2FAZ A;  1GC7 A;  4AJW A;  1F9J A;  2KJ6 A;  1WM3 A;  2V1Y A;  5DCN A;  3ZUN A;  4CYE A;  1WXV A;  3KYC D;  1RRB A;  4HDO A;  4BBN C;  3QCA A;  4DHZ E;  3A9K A;  5JH5 C;  3RUI B;  2NBV B;  1V80 A;  2C7M B;  2JF5 A;  2NPT B;  4HXD A;  3HHM A;  4GDL B;  4LDT B;  4DDI D;  4ANV A;  2MCN B;  4KVG B;  2G4D B;  3LDZ E;  5E6P A;  3D32 A;  2K8C A;  4W9G A;  1LFD A;  4PYU A;  5TR5 A;  3DVG Y;  2DEN B;  1K8R B;  5DPS A;  2CHW A;  2WX0 A;  3NZS A;  3ZNI D;  1E5W A;  2JUO A;  2KAN A;  2KO3 A;  2BPS A;  3DVN V;  4I6N B;  3VQI A;  2D11 A;  1GNU A;  3L10 B;  4OVU A;  2N4F A;  4G50 A;  2OJR A;  4TUU A;  1WF9 A;  4MEM A;  1WH3 A;  1MG8 A;  3VUY A;  2FIF A;  5D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...