1WJUA

Solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'GSSGSSGDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8 ultimate buster-1
publication title Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjuA00
4NNJB 4KIKA 2WDTB 4PYZA 2GBRA 2N4FA 1V6EA 4IC7B 3KW5B 1WGYA 1WX7A 1RLFA 3WA0A 2BF8B 4P7IA 3ZNHB 1VCBA 2LRWA 3L54A 1E7VA 2C9WB 3PZDA 3VDZA 2DYBA 3IG3A 4MGIE 4WAAA 2DZIA 2KMCA 3UF8A 4AP4C 2M0XA 3WAOA 2FCSA 2IO3B 4BVUC 2C60A 3EECA 4JLCA 3X23A 2BWFA 1ZGUB 1OGWA 4GN1A 2WWZA 4F1SA 1RRBA 2LXCA 4ZYNA 4EKUA 3UGBB 5AZHA 2L76A 2L05A 2XK5B 5E6OA 4I6PA 3DVGX 4EZKA 4PS3A 3W1SA 5D6JB 3RUIB 1WR6E 4G0NB 3S2AA 4TQ0A 4EZJA 5J18A 3V6EB 4DDID 4W9KA 2DZJA 1PQSA 1IP9A 4N9F4 3JSVB 3PRZA 3QARA 1JRUA 2KJRA 1SIFA 1VD2A 4K7WA 1X1MA 1E8WA 4HDQA 2ZVNA 4HWIB 4FA6A 1NDDA 3SU8X 1P3QU 2CKHB 5IA7A 3B08A 2LXAA 3U8ZA 4WWOA 2KQ7A 4IW0A 5KHOA 2RGFA 5DPSA 1KOTA 3CMMB 3U7DA 4XX5A 2IY1B 2O6VB 3JYUA 2XBBC 4LJPB 5C1ZA 1WIAA 3JSVA 1KM7A 1WGHA 3VXWA 4W9LA 1P0RA 2KNBA 2JPHA 2KTRB 5AZGA 2DYMA 3IFWB 4ZDVA 5JHBA 2G4SA 3T9LA 1UELA 1WGGA 2HTHA 4RM9A 4BKTA 2ZCCA 4BKGA 4GDKB 2JUOA 1YX6B 4M8MA 2ZPNA 5BO4B 4DXAB 4W9FA 2XEWA 2Z0DB 2K6QA 3UQBA 2C7MB 2KTRA 4KDLB 2L0FA 3UIPB 1WRDB 1WMHA 2KK8A 2CU1A 4IG7B 2RSUA 4IM0A 1P1AA 2DZMA 4ANVA 1XT9B 4HLEA 3VTUA 5J2RA 3W1SC 1UD7A 4HCNB 3ZW3A 2K8HA 1I35A 2MP2A 3TL5A 4FJYA 2BGFA 3BY4B 3VH4B 4OVUA 2GBJA 3APFA 1YX5B 1M94A 1F9JA 2GBMA 4FJVB 4W9CA 3ZKJC 2ZZPB 2KD0A 2UWQA 1WJ6A 1Q0WB 2FCQA 2AL3A 4CHKA 3HM3A 1Y8RC 4ANWA 3V62A 1WE7A 2R2OA 3D32A 4NAWA 1WR1A 2K1FA 2O2VA 5L83A 2KTFA 2KXJA 1V49A 2C7HA 5LXIB 3JVZX 3PRMB 3P2BA 2IO1B 2NPTB 3DBRI 5J17A 5AEKB 1WGDA 2LRUA 2NCNA 4E3CA 5IAAC 2KDFB 4OVVA 4GGQA 3PHXB 2KFKB 3SD5A 2LZ6A 1WX8A 2KVRA 3ZDMC 1YQBA 2K39A 3H7PB 2JZ3B 4TQ1A 3K9OB 1C3TA 4DWFA 2CS4A 2DYOA 4MSMB 1GG3A 1S3SG 1Z2MA 5G2NA 3A1QB 2NBWB 1BT0A 3WAPA 4IM2A 2BKFA 3AU4A 4I6NB 4MH0E 3M62B 2LVOA 3B0AA 3ECIA 5GMVA 3RZWC 4MM3A 2I1JA 2BYFA 4WWPA 2CR5A 4PYUA 5CX3A 3VUWA 4BKSD 3H7PA 5FR6A 2KO3A 2NVUI 3IBEA 3UIOB 2G45B 3DCGA 2ZJDA 3KUDB 2L8JA 4ZRIA 3Q3FA 4KSLC 2D11A 3RT3B 3QHTA 2PE6B 2K8CA 1H8CA 4FN2A 4RMAA 4KDIC 1CMXB 2FCMA 2Z0EB 1GC7A 3N30A 4EEWA 1J19A 1WGRA 2C5LC 2KHWB 2LGXA 2OOBB 4TUUA 4W9DA 3PHWB 5TR5A 4A20A 1V2YA 5LLIA 3K9PB 3L10B 3RZFA 2HJ8A 4HK2A 4E74A 4F7ZA 3OJ3A 1R4MI 1T0YA 1V81A 3V6CB 3VHTC 3ZDTA 4EUTA 2D10A 4WJOA 2DZKA 3QC8B 4HCPB 3PS6A 2IO2B 2KFJA 3N3KB 2KOXA 1YJ1A 2MBHA 4K81A 2PJHA 3C0RB 4FULA 3NHEB 3WALA 2GBNA 4W9IA 3APDA 5E6PA 3MHSD 4KV2A 4ICVA 5JH5C 2XK5A 2FCNA 1IYFA 4XC2A 3DVGY 2PEAA 5DPRA 4DHZE 2V1YA 1OEYA 1WE6A 3KUZA 4BFRA 2ZNVB 2DX5B 3AI5A 1LXDA 2WYQA 2FAZA 2MWSB 5L95C 2AWTA 3UQAA 2AYOB 3OJ4B 3CSTA 4IWPA 3RD2A 4M8NA 2ZEQA 3ZNGC 4MJSB 1A5RA 2OJRA 4CYEA 2HD5B 3TIXA 3RCZA 4B95A 2DAFA 2AL6A 2FIFA 4A3OA 2A5UA 1OEYJ 1SGHA 3QCAA 4K7SA 2KDBA 1WJUA 2O6VA 3R7QA 2ASQA 2NBUA 1GJZA 1ZKHA 2D07B 1V5TA 5LXHA 4AJWA 2M8SA 3IVFA 3L17A 3O65B 3PVLA 4YL8A 3MTNB 1C1YB 1TTNA 1E8YA 1TBEA 3ML8A 5DCNA 1EF1A 2M4NA 3ZLZA 4HJKA 3QX1A 2V3SA 4GDKA 1E90A 2K25A 4LJOB 3AULA 4LCDE 3NZSA 4MELA 3PPAA 1WF9A 4ANUA 3B1LX 2KWVB 2LVPA 1GC6A 4ASWC 2KX3A 4G11A 3V61A 1V80A 3NS8A 2LWPA 2M1MA 3ZRFA 2KJHB 3AXCA 1ZW7A 5DPWA 2JRIB 3PSEB 2IO0B 3R66C 5D2MB 2KANA 3QAQA 2BPSA 2K8BA 2Z59B 2KQSA 1Z5SB 2YLMA 1P9DU 4KVGB 3OLMD 4W9HA 4NPNA 3PT2B 1E5WA 4BBNF 1L2NA 1UGMA 1R4NI 2N9PC 3DVNV 4JIOU 1E8ZA 2KWCA 2LASA 4JL9A 4NQKE 1WJ4A 1Q1OA 2NR2A 3JW0X 2J0MA 2BKRB 4ICUA 1ISNA 3TMPB 1J0GA 4XZ4A 4KSKC 2L7RA 4TV3A 2MBQA 3HK0A 1U4AA 2FIDA 1TGZB 1WXVA 3WANA 4HVBA 4URKA 1EO6A 2MLBA 2NPTA 3VH3B 1OQYA 2ZNVC 2BYEA 2NBVB 4MEMA 1G6JA 4BOZB 2W9NA 4DHJD 3PREA 3T8MA 2MBEA 3ZTCA 4AUQC 3M63B 5CHFA 2KDEB 2KFKA 1LFDA 4JGHB 2JVCA 3TJPA 1E8XA 4FLHA 3M3JA 1KLVA 1V86A 1WH3A 4IWQA 4JQWC 3A1QA 3CSFA 2DHZA 3PGEA 3QK0A 2D3GA 3NZUA 3KH0A 2IY0B 2LGDA 3X0WA 2M17A 2BYVE 1FXTB 3A9KB 3HHMA 5CHVC 4NJ6A 4G50A 3SDLC 4EFOA 3AU5A 2JZZA 2N1WA 4GOCA 2FNJB 4RM8A 2KLGA 3HIZA 5JZEB 2J7QB 2N7DA 1RFAA 2A4ZA 2WX1A 1WZ3A 2KN5A 5AZFA 3ONSA 3PLVA 4BBNC 1J8CA 4FBJB 4NJ7A 3VAWA 2N9XA 3WIMA 3QJZA 1L7YA 1AARA 3ZRCA 4AJYB 2R2QA 1UBIA 2UYZB 3A9KA 1WZ0A 2AEHA 4NQLB 1GUAB 3GZNI 4E71A 3H6NA 3VFKA 4X57B 3PTFC 4NY0A 2FUHB 4FADA 3ZO5B 3I3TB 2RPQA 3KYDD 3L16A 3VUYA 3GOEA 2G4DB 2L00B 2MSED 4B6WA 1WJNA 3ALBA 3N32A 3ZUNA 1XD3B 3PV1A 3ML9A 4J6IA 3RULA 3A4SC 2IZVB 4BKSA 2MW5A 2QHOA 5G55A 4FHKA 3VUXA 1V9JA 1HE8A 2ZCBA 3NY5A 1LM8B 4GSWA 4GXBA 2KKCA 1MG8A 3CF6E 2O6VD 2LD9A 3DOWA 3KYCD 3H9DA 3QWZB 4M0WB 3SHQA 3TBLD 3VQIA 4GMVA 1WXSA 2WX0A 3OAWA 3M95A 2DENB 4K1RB 4W9GA 1QZEA 4IWOA 4HPMB 4KZCA 4MDKE 2DAJA 4GIVA 3U30A 4EZLA 4DHZB 4K7UA 4LDTD 3ZIMA 2JWZA 3R3MA 2YVCA 4FHJA 2KDIA 4F8CB 2KX0A 3DPDA 3H1UA 2REXA 2L0TA 2D2QA 1E7UA 2I1KA 2NS5A 3RYTA 2V4LA 4MGZE 1WFYA 3MJWA 3NOBA 2LGYA 5D7GA 1IPGA 2EKEC 4II2B 4IM3A 4ZRKA 2BWES 2J0JA 5EDSA 3VTWA 1WXMA 2B3AA 2JRHA 2C7NB 1H4RA 1XQQA 4MJSA 5D94A 2MA9B 3ZNZB 2MRPA 2ZPYA 2N1VA 3APCA 3DQVA 3PRPB 4G3XB 1RAXA 3EFUA 2KJ6A 2IYDB 1LQBA 2LI5A 3DBHI 4WWNA 3V60A 2PE9A 3IHPC 2KC2A 3EHVA 3A9JB 1WY8A 4WJQA 4FJZA 4LDTB 1WMHB 3DDCB 3Q3JA 4MSQB 2MX2A 4GDLB 5KHQA 1UH6A 1S1QB 4DBGA 4WJNA 4KZ0A 3QIJA 2RD0A 3R7RA 2MP2B 1WM2A 1SE9A 2N9EB 2GBKA 3DBSA 1UZXB 1WYWB 3A9JA 1P98A 2LJ5A 3L0WB 4HDOA 4W9EA 2KC1A 2KLCA 4GB9A 1KJTA 4A3PA 5CHWA 2Y5BB 1UBQA 4GDLA 3ZVVA 2CHWA 3HM6X 1GNUA 1NI2A 5E6NA 3W1YA 1D3ZA 3TCAA 4PS7A 2LVQA 3QQ8B 2G3QB 2J0KA 2MQJA 3H7SA 4NAWB 2O2VB 2JF5A 2LUEA 3L08A 4HXDA 4MGYE 5CTRC 2MCNB 4DK5A 1WM3A 2KWUB 2JXXA 1EUVB 3LJ3A 1WX9A 4IUMB 2K6DB 2L3ZA 2RR9A 5JHAA 1I42A 3VTVA 1OTRB 1WXAA 3LDZE 3ZTDA 1EF5A 1V5OA 2VRRB 4WJPA 2ZVOA 3ENEA 4WQOB 4AWJA 4BOSC 3KVFB 2HE7A 4PS8A 4MGKE 1NBFC 3A33B 3EC8A 3QA8A 4ANXA 2KMAA 2JY6A 2PPHA 1Q5WB 3BINA 4I6LB 2JT4B 3PLUA 4CO7A 2CHXA 3DVNU 5HKHA 4DDGD 1TZ1A 2GOWA 4GU2A 5DPTA 2MBOA 1YD8U 2N7EA 3L13A 4II3B 4HPLB 1K8RB 4KIKB 3ZNID 3VVWB 4TKNA 1WI0A 2IBIB 4ZRJA 2GMIC 4AOFA 1YIWA 3A4RA 2MBBB 3UINB 5C23A 2EMTA 4W9JA 2EMSA 3WAMA 4DHJB 2CHZA 4EOYA 4B9KA 3DBLI 3KUCB 2KZRA
chains in the Genus database with same CATH superfamily
4NNJB 4KIKA 1JRPA 3W9CB 1V6EA 3ZNHB 5EE9A 5BMIA 3PZDA 3ZJVA 4WAAA 2HDEA 3NVVA 2M0XA 2WWZA 4ZYNA 4EKUA 2MJEA 1PGAA 1FIQA 1CJEA 3RUIB 5J18A 2M56B 3E56A 2FE8A 4ARIA 2RDGA 3PRZA 3QARA 1RYJA 1SIFA 4HJGE 4K7WA 1X1MA 1EU4A 4HWIB 4FA6A 1P3QU 2CKHB 1YMHE 5D3DA 2LXAA 2AX5A 5C1ZA 1KM7A 1FRDA 2KNBA 2GB1A 2DYMA 1SE2A 5JHBA 3T9LA 1VDVA 4MH8A 4M00A 3P4PB 4GDKB 2JUOA 1ZE3D 5IP4D 2PIAA 4A8XC 2XEWA 3UQBA 2E3TA 2V9HA 2BVCA 3U4EG 2L0FA 3Q8EA 5BMHA 1WRDB 1WMHA 2PKOA 4ANVA 1PYWD 3AECB 1YJJA 1HTQA 4MACA 3W1SC 4HRSA 2MP2A 2M19A 3TL5A 2J52A 4OVUA 4BZAA 2GBMA 2ZZPB 4CHKA 2AL3A 1YJIA 1WE7A 2R2OA 3D32A 3KWLA 2K1FA 1V49A 5AUKA 3JVZX 2D5GA 2IO1B 2NPTB 3DBRI 5AEKB 2NCNA 5IAAC 4MM3B 3PHXB 2KFKB 3ZDMC 2K39A 3K9OB 1C3TA 1S3SG 1BT0A 2BKFA 4MH0E 3J9CA 2LVOA 5GMVA 3RZWC 4MM3A 3N9YC 1MPEA 1C76A 2KO3A 2NVUI 3IBEA 3U7ZA 3UIOB 1EWCA 2WQYB 3DHIC 2L8JA 3Q3FA 4B0EA 2PE6B 4KDIC 1JQ4A 2Z0EB 4TUUA 3PHWB 5LLIA 2L83A 3L10B 3RZFA 2HJ8A 2IGHA 2LMCA 5D3IB 4HK2A 1R4MI 3V6CB 3VHTC 2D10A 4EE2A 4DXGA 1EWYC 4HCPB 2IO2B 1NEKB 4LLGM 4RGTA 4C56C 3W5UB 4W9IA 1Y56A 2Q5WD 1SE3A 1E9MA 2CJOA 4KGRA 1OEYA 3KUZA 2DX5B 3AI5A 4MT5A 2WXKA 1LXDA 2FAZA 5L95C 2AYOB 2XN9C 4KGTA 3CSTA 4IWPA 3RD2A 2OJRA 2HD5B 3DHGC 1FPYA 4WH4A 4XDDA 1VZ8A 1VZ7A 1WJUA 2ASQA 1GJZA 3RPFC 2D07B 4L23A 3PVLA 1C4CA 4YL8A 1E8YA 1EF1A 4HJKA 3BYYB 2N9LA 2WXMA 1KH0A 1C9FA 2JQRB 3BVZA 1GC6A 4G11A 1N60A 3V61A 3FKYA 3NS8A 1ESFA 2KJHB 2OHFA 3NVWA 3R66C 5D2MB 1T3QA 2KANA 2H89B 5FR3A 2LGSA 1MVKA 1Z5SB 4KVGB 4W9HA 3IAS1 4NPNA 3PT2B 1E5WA 1UGMA 1R4NI 4YTMB 3JW0X 2NR2A 2H88B 3TMPB 1UWMA 1J0GA 1YQ3B 2L7RA 2MBQA 3HK0A 1U4AA 1TGZB 4URKA 1EO6A 2MLBA 1DGJA 1OQYA 2ZNVC 4MEMA 1L4DB 4YSYB 2MBEA 2LEKA 2PMVA 5CHFA 2KDEB 4L1BA 1F1HA 3PO0A 4JQWC 3PGEA 2D3GA 3NZUA 2IY0B 1N63A 3HHMA 3SDLC 4EFOA 4GOCA 1JW9D 2YEPB 4YT0B 2N7DA 1FO4A 5AZFA 3PLVA 4BBNC 1J8CA 1TS3A 3LYYA 4NJ7A 3QJZA 4OZBA 3ZRCA 3CIRB 3ZXVA 1HZ6A 3GZNI 4E71A 4JPSA 1F52A 3PTFC 4NY0A 2FUHB 3I3TB 1C78A 3GOEA 2YEPF 1RFKA 1XD3B 1VZ6A 4H2AA 2IZVB 1ET9A 1XLOA 3NVYA 3VUXA 4GSWA 3CF6E 4GMVA 3AH7A 3M95A 3NJTA 1XEEA 5HHDG 4K7UA 2YVCA 5HI1A 4C7ZA 4F8CB 3IT4B 2L0TA 2WXHA 3RYTA 4MGZE 1C4AA 1TS2A 2PW9A 3N20C 4ZRKA 2BWES 1JMLA 2B3AA 2X38A 1PGXA 4MJSA 4G3XB 2MRPA 4FXCA 2KJ6A 2IYDB 4KGSA 3V60A 1GOZA 2JU6X 1TKEA 3DDCB 1AW7A 1UH6A 2W55A 1C4PA 1N6ZA 1WYWB 3L0WB 4W9EA 1V8CA 2KC1A 4GB9A 5CHWA 2WXPA 2Y5BB 4LNFA 1NI2A 3TCAA 2J0KA 2O2VB 3Q8FA 3BIID 4MGYE 4ZRQA 2KWUB 4RFBA 1EUVB 3LJ3A 2DWQA 2GI9A 1LGRA 2K6DB 4OVZA 2QJLA 5JHAA 3VTVA 1OTRB 1TY2A 3LDZE 1V5OA 4OHJA 4AWJA 1T5XD 3KVFB 1NBFC 3QA8A 3Q3OC 2PPHA 3BINA 3RNFC 3R2IA 4DDGD 1T6BX 2J4XA 2MBOA 2N7EA 3VRAB 1IBXB 3ZNID 4P1CC 1SXTA 3I5JC 2IBIB 3UINB 1K51A 1VLBA 2JX5A 4W9JA 3WAMA 3KLSX 2CHZA 3DBLI 4RF1A 4KKJA 2WDTB 1J7BA 4JE3B 2GBRA 2N4FA 2BB6A 4YSZB 1WX7A 3C8YA 2BS2B 4N6EB 2I2YA 3L54A 1E7VA 2DYBA 1ENFA 3IG3A 1YN3A 2K9XA 2I38A 2FCSA 2C60A 3EECA 3X23A 1ZGUB 4GN1A 4F1SA 1RRBA 3UGBB 1ROEA 3W1SA 3C19A 4G0NB 3S2AA 3SFEB 4EZJA 3V6EB 1P7FA 1F2RI 2SEBD 3AEEB 4DDID 4W9KA 2DZJA 3ZGZA 4KX6B 2QIEB 4M0WA 1JRUA 2KJRA 2ZVNA 1NDDA 2D3AA 2KQ7A 2KQ4X 2WU2B 5DPSA 3CMMB 2IY1B 1ZOYB 2O6VB 1XCQL 4YXDB 1BXTA 3VXWA 1P0RA 3OG5A 4ZDVA 1WGGA 4TSSA 1YX6B 4M8MA 5BO4B 1FFVA 4DXAB 2WHIA 2KK8A 2CU1A 4IG7B 1SJHD 2RSUA 1P1AA 1XT9B 4HLEA 3VTUA 2OEDA 1ACCA 1JWMD 4M01A 1UD7A 3PZ8A 4HCNB 3BY4B 1XF5L 1SJED 2MJDA 3APFA 2ZW0A 1M94A 2INPE 2IPKD 1D5MC 4WWMA 2FCQA 2K5PA 4ANWA 2KAJA 1GB1A 5L83A 4CQNA 2KTFA 5T8IA 2KXJA 2WXLA 4OW0A 1CZPA 5J17A 2LRUA 1UNSA 2KDFB 3GE3C 3AEDB 2WNMA 1BUIC 2LZ6A 2WXFA 2KVRA 4TQ1A 4MSMB 1GG3A 3WAPA 4IM2A 1SF0A 2BYFA 4WWPA 1FXIA 2TSSA 5FR6A 4Q2JA 4WURA 5MPOA 2G45B 2ZJDA 4LK0M 3U52E 4ZRIA 3QHTA 1H8CA 2K8CA 2IGGA 4RMAA 2IDYA 1CMXB 1GC7A 2EELA 5TR5A 3K9PB 4HPPA 1T0YA 1V81A 4EUTA 4WJOA 2JYEA 1B1ZA 1VRAB 2KOXA 2MBHA 4RGNA 1DYQA 4K81A 2PJHA 1L4ZB 4YTNB 3NHEB 2GBNA 5E6PA 1GAQB 4XC2A 3BVGA 1K52A 2ZNVB 2WYQA 2MWSB 3UQAA 3BZDB 2ZEQA 2VH2A 4CYEA 2X8XX 4B95A 2DAFA 1KF6B 1OEYJ 4HEA1 2FBWB 1ZKHA 1V1PB 1TTNA 1TBEA 3ML8A 3RMKC 3TUOA 3ZLZA 4GDKA 1E90A 2K25A 4LJOB 2UU7A 4MELA 3DBHB 2KWVB 1QKZA 4ASWC 1V80A 3I63C 1KLGD 3ZRFA 2KN4A 2JRIB 1D5ZC 2Z59B 1T0SC 1P9DU 5I4DA 1IUEA 1L2NA 3AEBB 2DNFA 4BBNF 1GPXA 3GP7A 2KWCA 4NQKE 4ZRPA 2J0MA 2BKRB 4ICUA 4YWGG 1WXVA 2CU3A 2N9KA 2NPTA 3HVDA 2NBVB 1G6JA 5C3JB 3PREA 4RCOA 1XLQA 2KFKA 1JWSD 1LFDA 1M4VA 3Q3MC 2JVCA 2QEJC 1KLVA 5HFYA 3AM9A 4IWQA 3P4SB 3QK0A 4XWWA 2LGDA 1HQRD 2M17A 4NJ6A 3AU5A 3MP9A 2KLGA 3HIZA 5JZEB 2ZW1A 2WX1A 1WZ3A 1SB3C 2LHDA 2NTTA 3FC4A 3VAWA 3WIMA 1L7YA 2UYZB 4NQLB 3P4RB 3H6NA 3VFKA 1I4RA 1L0XB 3ZO5B 3VUYA 2Y5PA 3PV1A 4J6IA 1YN4A 2WDQB 2PTLA 3A4SC 4C4VB 2MW5A 4FHKA 1TZOA 1HE8A 1HA5A 2LJIA 1TT5B 4GXBA 3VR8B 2O6VD 3KYCD 3NVZA 2FUG1 3SHQA 4B0MA 1WYGA 3MFGA 2DENB 4W9GA 4IWOA 4HPMB 4KZCA 2KDMA 4MDKE 2DAJA 4EZLA 4LDTD 4L2YA 3ABVB 2RMMA 2KT7A 3DPDA 2REXA 2D2QA 1E7UA 2NS5A 1EM7A 5LNK1 1IPGA 3VTWA 2C7NB 3I9V1 4P6VF 1XQQA 5D94A 3DQVA 2IGDA 1TY0A 1RAXA 1LQBA 4WWNA 2PE9A 2D3BA 4O1NA 3IHPC 2KC2A 3EHVA 1WY8A 2QDFA 4WJQA 3H8HA 1E10A 5KHQA 1S1QB 3QIJA 2RD0A 4A90A 2ACZB 1PUTA 2WXJA 1WM2A 3TBLD 3AE7B 1HZ5A 1KJTA 5EE3A 4JWSC 2J42A 1I4PA 5E6NA 1D3ZA 2J53A 4NAWB 2MQJA 4KKIA 2JF5A 3BYTB 2JXXA 3EA6A 2RR9A 2SAKA 1FMAD 2NTSA 3HVZA 1WXQA 2VZKD 2ZVOA 4REZA 4MGKE 3A33B 4ANXA 3Q8CA 4CO7A 2CHXA 1YN5A 2WXQA 3L13A 4HPLB 1K8RB 5H92C 4C80A 3ETRA 4ZRJA 5AUIA 1YIWA 2NMQA 1EU3A 1SSNA 2EMTA 4DHJB 4BAXA 4EOYA 3IAM1 2KMMA 4PYZA 4IC7B 3R2TA 3FILB 3KW5B 1RLFA 3I57A 1R7SA 5G5HA 3DWMA 2LRWA 2C9WB 3VDZA 4MGIE 1I4XA 2DZIA 2Y5CA 3RNCC 4BVUC 2IO3B 3TEWA 3FILA 4JLCA 2BWFA 3NS1A 5HG2A 2L76A 2L05A 1L0VB 2XK5B 5E6OA 1AWDA 4PS3A 1L5PA 1WR6E 3AN1A 1PQSA 4XWTA 3RNEC 1N62A 2D3CA 4RGMA 3W5VB 1V1OA 1VD2A 4HDQA 3ZJTA 3GE8C 1HXYD 3SU8X 3RN9C 4WWOA 2WU5B 3AE9B 2V3NA 5KHOA 4A55A 4XX5A 4LJPB 2XBBC 1STEA 3FAHA 4XYCA 1WIAA 2M0AA 1K53A 2KTRB 5AZGA 3IFWB 1ZXHA 2G4SA 4RM9A 4BKTA 3V3XA 4BKGA 1JALA 2ZPNA 2BBCA 4LNKA 2C7MB 2KTRA 4KDLB 2WP9B 3ZJUA 4LNNA 2ICIA 5G5GA 1FXAA 3MC0B 2DZMA 1B9RA 5J2RA 3IT6B 1SIJA 3ZW3A 4NZLB 1A70A 1VJKA 2GBJA 1E0ZA 1YX5B 4WQMA 2E6XA 3ZKJC 2AQ1B 1DOIA 2KD0A 2UWQA 1WJ6A 1Q0WB 1OQQA 2L32A 4AQ7A 2WXRA 1F0ZA 1WR1A 2O2VA 3NZ3A 2MJ3A 1ZDVA 3OWEB 2C7HA 2JWUA 2WXOA 3PRMB 5LXIB 3AE4B 1OFFA 4E3CA 2MHJA 4OVVA 4GGQA 2V0GA 3GS2A 2JZ3B 4DWFA 2CS4A 1KLUD 2DYOA 1Z2MA 5G2NA 3A1QB 2NBWB 1UWXA 3B0AA 1TJEA 2CR5A 5GXGB 5CX3A 3T3NA 4JWUC 5IOIA 4C00A 3DCGA 2VH1A 3KUDB 1IBXA 3RT3B 4YTPB 4FN2A 4NAMA 5TSSA 4N58A 1JROA 3N30A 1Q10A 4EEWA 1J19A 1WGRA 2C5LC 2KHWB 2LGXA 2OOBB 4W9DA 2OJWA 3IXSA 3OJ3A 3ZDTA 3QC8B 3PS6A 1D5XC 2W54A 2WDVB 1YJ1A 5BMGA 1XXGA 1I4GA 5FK9C 3C0RB 1MFWA 3WALA 3APDA 4DQOC 4PT5A 2FCNA 3AE1B 3WCQA 4ZHOA 5DPRA 2PEAA 2V1YA 4HKQA 2AWTA 3OJ4B 3AE8B 3BWUD 4M8NA 3ZNGC 1AYFA 2IJ0A 3RCZA 2FIFA 2A5UA 1SGHA 4ITKA 4K7SA 2KACA 3TEXA 1C79A 2LUMA 2Y3AA 2O6VA 3R7QA 4RGOS 2NBUA 5LXHA 3UI3A 2M8SA 1C1YB 3LXFA 1IGCA 1KFYB 1NYQA 3AULA 3L4PA 1WF9A 4ANUA 3B1LX 2KX3A 3CWIA 2M1MA 1ZW7A 5DPWA 3PSEB 2IO0B 3T3OA 2KVZA 1WRIA 3QAQA 2K8BA 2KQSA 1FD6A 3OLMD 1FCCC 4JIOU 3N1XC 1Q1OA 5BYQA 2JYTA 1ISNA 4XZ4A 4TV3A 2FIDA 3VH3B 4BOZB 3EGRA 4DHJD 5JXVA 4AUQC 3M63B 1ZXIA 4JGHB 3TJPA 4FLHA 3M3JA 1V86A 1YQ4B 1WH3A 1GB4A 3CSFA 3KH0A 2W3SA 2BYVE 5CHVC 3A9KB 1C77A 2JZZA 1RFAA 2A4ZA 2RDHA 3AE6B 4FBJB 4ZYSA 1AARA 1FM0D 4AJYB 3AV8A 1UBIA 1V97A 3A9KA 4A6QA 4QAYA 4X57B 4FADA 3TEZA 2JXTA 2EKIA 1FNWA 3AEGB 3L16A 2BS3B 2L00B 2MSED 4B6WA 3ZUNA 4BKSA 1N5WA 3AEAB 2QCZA 1V9JA 2ZCBA 1LM8B 2KKCA 3QWZB 2LD9A 1WXSA 3B9JA 3OAWA 4K1RB 3P4QB 4DHZB 3R3MA 4FHJA 2KDIA 2KX0A 2RPVA 3ZQ4A 3Q69A 2BYTA 2V4LA 4XGAB 2LGYA 1WGKA 5D7GA 4II2B 2EKEC 1IGDA 2J0JA 3AB5A 2AQ2B 2JRHA 1H4RA 1N61A 3ZNZB 3EFUA 3DBHI 2HJ1A 2LI5A 1XLNA 3DWGC 3PZ7A 1L6VA 3VR9B 4FJZA 1WMHB 3Q3JA 3EFCA 3Q14C 1QOAA 1HEZE 1V1PA 1ET6A 1WSPA 5IKCM 4LNOA 3R7RA 3GB1A 2MP2B 1SE9A 2N9EB 2GBKA 1JWUD 1UZXB 1P98A 2LJ5A 4A3PA 1VR9A 1UBQA 3ZVVA 1GNUA 2MEKA 1UF0A 2PVGC 3NUHB 4RH6A 1FCLA 1JWBD 1YNTE 2LUEA 4HROA 4HXDA 4RNAA 5CTRC 4DK5A 1WM3A 2RDBC 1UGJA 3NG0A 4OZCA 4IUMB 2L3ZA 3P42A 1I42A 3ZTDA 1EF5A 1KRHA 1MHHE 2VRRB 3KQ4A 2K22A 3EC8A 4US9A 1F2RC 2JY6A 3DBRB 1Q5WB 4J3OD 1D6EC 2JT4B 3DVNU 3TEYA 2GOWA 4GU2A 5DPTA 1YD8U 4II3B 3VVWB 4TKNA 4AOFA 5EE1A 3E9SA 1T0RC 5C23A 3P63A 4US8A 2EMSA 3KUCB 1BMLC 4USAA 1WGYA 3MC9A 3WA0A 2BF8B 5BYSA 4P7IA 1VCBA 1TS4A 1N5XA 2KMCA 3UF8A 4AP4C 3MC8A 3WAOA 2B76B 1OGWA 2LXCA 3N1ZC 1CK1A 3W2DA 5AZHA 1R4MB 4I6PA 3DVGX 4EZKA 5D6JB 4C4VA 4TQ0A 5BYRA 2QILA 2WDRB 3HRDD 1IP9A 4N9F4 1MHXA 3JSVB 2R61A 2G1EA 1E8WA 5IA7A 3B08A 3U8ZA 4IW0A 2V3PA 2RGFA 1KOTA 1L0YB 1NENB 4S0RA 3U7DA 3JYUA 1L6UA 3JSVA 4LNIA 1QILA 1WGHA 3EUB2 4W9LA 2WXIA 2INCC 2JPHA 3ZXRA 3RFZB 1UELA 1ZUD2 2HTHA 2ZCCA 2WS3B 4W9FA 2Z0DB 2K6QA 4AS1A 1FFUA 2QMTA 3UIPB 4IM0A 3N1YC 4N59A 4P1BC 4NJCA 2K8HA 1I35A 4FJYA 2BGFA 3VH4B 4TMAB 4ARCA 2XNAC 2MH7A 1I7HA 1F9JA 1FNUA 4FJVB 1LO5D 4W9CA 1FRRA 3HM3A 1Y8RC 3V62A 4NAWA 1QLBB 3LB8C 3SEBA 1OQRA 3P2BA 2HTME 1WGDA 4DXFA 1R4NB 2ON8A 2N0SB 3SD5A 2BQQA 1WX8A 3URYA 1YQBA 3H7PB 4ZOHC 4R3DA 3AU4A 4I6NB 3M62B 3MHZA 3P1MA 3ECIA 2I1JA 1SE4A 3SR6A 4PYUA 3VUWA 2BTEA 4UDUC 3H7PA 4K3CA 4BKSD 1UUPA 4KSLC 2D11A 3AE5B 2FCMA 2GRIA 2K3UA 4A20A 1V2YA 4XDCA 4E74A 4F7ZA 1XLPA 3SFDB 3ZYYX 1K50A 2K0PA 2DZKA 2KFJA 3N3KB 3GZNB 4IDIA 4K3BA 1PDXA 3HUIA 4FULA 1PFDA 3MHSD 3U2SC 4KV2A 1QF6A 4ICVA 5JH5C 2XK5A 1IYFA 3DVGY 4DHZE 1FEHA 4BFRA 1I4HA 1WE6A 3B2FA 4ZHPA 4GLSC 5FKAC 4MJSB 1A5RA 1NVID 3TIXA 2AL6A 4A3OA 1TS5A 3QCAA 2KDBA 2L1AA 1FNVA 5H8YE 1QOBA 1V5TA 4AJWA 4WIPA 3IVFA 3L17A 3O65B 3MTNB 1YOVB 5DCNA 1E6EB 2M4NA 3RNBC 3QX1A 2V3SA 4LCDE 3NZSA 3PPAA 2INDC 2LVPA 5IN7A 3B2GA 2JZPA 1TKYA 1NI3A 1XO3A 2LWPA 2PVOD 3AXCA 2DBYA 2WXNA 4ACFA 2BPSA 4M02A 3BK1A 2YLMA 2N9PC 3DVNV 4PK1A 1E8ZA 1I4QA 2LASA 4JL9A 1WJ4A 3TSSA 4LTUA 2GLSA 1JWAD 2WXGA 5EE0A 4KSKC 3V05A 3RNGC 1ZDXA 3WANA 4HVBA 1D4BA 2AQ3B 2BYEA 4OZAA 2W9NA 4IOIE 4HKZE 3T8MA 3ZTCA 1E8XA 1QOGA 4XE0A 1QT9A 3A1QA 2DHZA 5IO9A 3X0WA 1FXTB 2LHEA 4G50A 2N1WA 1RWSA 2FNJB 4RM8A 1QOFA 1PGBA 3R8BA 2J7QB 3Q8BA 2LFIA 2KN5A 3ONSA 1HTOA 2N9XA 2BB5A 2DLBA 2R2QA 2Z8LA 2W3RA 1WZ0A 2AEHA 1GUAB 3Q2AC 2G9HD 3DBLB 3Q6BA 2RPQA 4YSXB 3KYDD 2G4DB 1WJNA 3ALBA 3N32A 3RULA 3ML9A 1DOYA 5E6JA 1P7EA 2QHOA 5G55A 3O13A 3NY5A 1E7PB 3KWVA 1MG8A 1SBBB 3DOWA 3VQIA 4IKGA 4M0WB 3H9DA 2WX0A 1AN8A 3Q8AA 1QZEA 3AEFB 1TYGB 1CQVA 1JCKB 1RM6C 4GIVA 3U30A 2INNE 3ZIMA 2JWZA 1QQRA 2KYWA 3H1UA 2I1KA 2BS4B 4S17A 1WFYA 3MJ5A 3MJWA 3NOBA 3RNAC 3VRBB 4P16A 4IM3A 1ZPSA 5EDSA 2LGIA 1WXMA 1XCTL 2MA9B 2ZPYA 2N1VA 3APCA 3PRPB 3AE2B 1F77A 4JX1C 1MI0A 1TKGA 3A9JB 2BW2A 4LDTB 4MSQB 2N7JA 2MX2A 2QSDA 3AMZA 4GDLB 1KTKA 4DBGA 4WJNA 4KZ0A 1MJDA 3BK2A 3DBSA 2WGSA 3A9JA 4HDOA 4A9AA 2KLCA 4GDLA 2CHWA 3HM6X 3W1YA 4PS7A 2W82A 2LVQA 3QQ8B 3RI7C 2G3QB 3H7SA 3L08A 3AE3B 1NYRA 2MCNB 4C7YA 1J7CA 2WLBA 5C2TB 1WX9A 2QC8A 1T0QC 1WXAA 1WWTA 4WJPA 3ENEA 4WQOB 4BOSC 2ONQA 2HE7A 4PS8A 4WAFA 2L52A 1DOXA 2KMAA 2BT6A 4I6LB 2JSVX 4D2KA 1ZP0B 3PLUA 5HKHA 2V4IB 4RF0A 1TZ1A 1J7AA 4KIKB 2PLPA 1TIFA 1MG4A 1WI0A 3NRZA 2GMIC 3Q3NC 3A4RA 2MBBB 3BVMA 1SEBD 2KWDA 3DHHC 2CJNA 4B9KA 2KZRA 2VZKB
chains in the Genus database with same CATH topology
4NNJB 4KIKA 2WDTB 4PYZA 2GBRA 2N4FA 1V6EA 4IC7B 3KW5B 1WGYA 1WX7A 1RLFA 3WA0A 2BF8B 4P7IA 3ZNHB 1VCBA 2LRWA 3L54A 1E7VA 2C9WB 3PZDA 3VDZA 2DYBA 3IG3A 4MGIE 4WAAA 2DZIA 2KMCA 3UF8A 4AP4C 2M0XA 3WAOA 2FCSA 2IO3B 4BVUC 2C60A 3EECA 4JLCA 3X23A 2BWFA 1ZGUB 1OGWA 4GN1A 2WWZA 4F1SA 1RRBA 2LXCA 4ZYNA 4EKUA 3UGBB 5AZHA 2L76A 2L05A 2XK5B 5E6OA 4I6PA 3DVGX 4EZKA 4PS3A 3W1SA 5D6JB 3RUIB 1WR6E 4G0NB 3S2AA 4TQ0A 4EZJA 5J18A 3V6EB 4DDID 4W9KA 2DZJA 1PQSA 1IP9A 4N9F4 3JSVB 3PRZA 3QARA 1JRUA 2KJRA 1SIFA 1VD2A 4K7WA 1X1MA 1E8WA 4HDQA 2ZVNA 4HWIB 4FA6A 1NDDA 3SU8X 1P3QU 2CKHB 5IA7A 3B08A 2LXAA 3U8ZA 4WWOA 2KQ7A 4IW0A 5KHOA 2RGFA 5DPSA 1KOTA 3CMMB 3U7DA 4XX5A 2IY1B 2O6VB 3JYUA 2XBBC 4LJPB 5C1ZA 1WIAA 3JSVA 1KM7A 1WGHA 3VXWA 4W9LA 1P0RA 2KNBA 2JPHA 2KTRB 5AZGA 2DYMA 3IFWB 4ZDVA 5JHBA 2G4SA 3T9LA 1UELA 1WGGA 2HTHA 4RM9A 4BKTA 2ZCCA 4BKGA 4GDKB 2JUOA 1YX6B 4M8MA 2ZPNA 5BO4B 4DXAB 4W9FA 2XEWA 2Z0DB 2K6QA 3UQBA 2C7MB 2KTRA 4KDLB 2L0FA 3UIPB 1WRDB 1WMHA 2KK8A 2CU1A 4IG7B 2RSUA 4IM0A 1P1AA 2DZMA 4ANVA 1XT9B 4HLEA 3VTUA 5J2RA 3W1SC 1UD7A 4HCNB 3ZW3A 2K8HA 1I35A 2MP2A 3TL5A 4FJYA 2BGFA 3BY4B 3VH4B 4OVUA 2GBJA 3APFA 1YX5B 1M94A 1F9JA 2GBMA 4FJVB 4W9CA 3ZKJC 2ZZPB 2KD0A 2UWQA 1WJ6A 1Q0WB 2FCQA 2AL3A 4CHKA 3HM3A 1Y8RC 4ANWA 3V62A 1WE7A 2R2OA 3D32A 4NAWA 1WR1A 2K1FA 2O2VA 5L83A 2KTFA 2KXJA 1V49A 2C7HA 5LXIB 3JVZX 3PRMB 3P2BA 2IO1B 2NPTB 3DBRI 5J17A 5AEKB 1WGDA 2LRUA 2NCNA 4E3CA 5IAAC 2KDFB 4OVVA 4GGQA 3PHXB 2KFKB 3SD5A 2LZ6A 1WX8A 2KVRA 3ZDMC 1YQBA 2K39A 3H7PB 2JZ3B 4TQ1A 3K9OB 1C3TA 4DWFA 2CS4A 2DYOA 4MSMB 1GG3A 1S3SG 1Z2MA 5G2NA 3A1QB 2NBWB 1BT0A 3WAPA 4IM2A 2BKFA 3AU4A 4I6NB 4MH0E 3M62B 2LVOA 3B0AA 3ECIA 5GMVA 3RZWC 4MM3A 2I1JA 2BYFA 4WWPA 2CR5A 4PYUA 5CX3A 3VUWA 4BKSD 3H7PA 5FR6A 2KO3A 2NVUI 3IBEA 3UIOB 2G45B 3DCGA 2ZJDA 3KUDB 2L8JA 4ZRIA 3Q3FA 4KSLC 2D11A 3RT3B 3QHTA 2PE6B 2K8CA 1H8CA 4FN2A 4RMAA 4KDIC 1CMXB 2FCMA 2Z0EB 1GC7A 3N30A 4EEWA 1J19A 1WGRA 2C5LC 2KHWB 2LGXA 2OOBB 4TUUA 4W9DA 3PHWB 5TR5A 4A20A 1V2YA 5LLIA 3K9PB 3L10B 3RZFA 2HJ8A 4HK2A 4E74A 4F7ZA 3OJ3A 1R4MI 1T0YA 1V81A 3V6CB 3VHTC 3ZDTA 4EUTA 2D10A 4WJOA 2DZKA 3QC8B 4HCPB 3PS6A 2IO2B 2KFJA 3N3KB 2KOXA 1YJ1A 2MBHA 4K81A 2PJHA 3C0RB 4FULA 3NHEB 3WALA 2GBNA 4W9IA 3APDA 5E6PA 3MHSD 4KV2A 4ICVA 5JH5C 2XK5A 2FCNA 1IYFA 4XC2A 3DVGY 2PEAA 5DPRA 4DHZE 2V1YA 1OEYA 1WE6A 3KUZA 4BFRA 2ZNVB 2DX5B 3AI5A 1LXDA 2WYQA 2FAZA 2MWSB 5L95C 2AWTA 3UQAA 2AYOB 3OJ4B 3CSTA 4IWPA 3RD2A 4M8NA 2ZEQA 3ZNGC 4MJSB 1A5RA 2OJRA 4CYEA 2HD5B 3TIXA 3RCZA 4B95A 2DAFA 2AL6A 2FIFA 4A3OA 2A5UA 1OEYJ 1SGHA 3QCAA 4K7SA 2KDBA 1WJUA 2O6VA 3R7QA 2ASQA 2NBUA 1GJZA 1ZKHA 2D07B 1V5TA 5LXHA 4AJWA 2M8SA 3IVFA 3L17A 3O65B 3PVLA 4YL8A 3MTNB 1C1YB 1TTNA 1E8YA 1TBEA 3ML8A 5DCNA 1EF1A 2M4NA 3ZLZA 4HJKA 3QX1A 2V3SA 4GDKA 1E90A 2K25A 4LJOB 3AULA 4LCDE 3NZSA 4MELA 3PPAA 1WF9A 4ANUA 3B1LX 2KWVB 2LVPA 1GC6A 4ASWC 2KX3A 4G11A 3V61A 1V80A 3NS8A 2LWPA 2M1MA 3ZRFA 2KJHB 3AXCA 1ZW7A 5DPWA 2JRIB 3PSEB 2IO0B 3R66C 5D2MB 2KANA 3QAQA 2BPSA 2K8BA 2Z59B 2KQSA 1Z5SB 2YLMA 1P9DU 4KVGB 3OLMD 4W9HA 4NPNA 3PT2B 1E5WA 4BBNF 1L2NA 1UGMA 1R4NI 2N9PC 3DVNV 4JIOU 1E8ZA 2KWCA 2LASA 4JL9A 4NQKE 1WJ4A 1Q1OA 2NR2A 3JW0X 2J0MA 2BKRB 4ICUA 1ISNA 3TMPB 1J0GA 4XZ4A 4KSKC 2L7RA 4TV3A 2MBQA 3HK0A 1U4AA 2FIDA 1TGZB 1WXVA 3WANA 4HVBA 4URKA 1EO6A 2MLBA 2NPTA 3VH3B 1OQYA 2ZNVC 2BYEA 2NBVB 4MEMA 1G6JA 4BOZB 2W9NA 4DHJD 3PREA 3T8MA 2MBEA 3ZTCA 4AUQC 3M63B 5CHFA 2KDEB 2KFKA 1LFDA 4JGHB 2JVCA 3TJPA 1E8XA 4FLHA 3M3JA 1KLVA 1V86A 1WH3A 4IWQA 4JQWC 3A1QA 3CSFA 2DHZA 3PGEA 3QK0A 2D3GA 3NZUA 3KH0A 2IY0B 2LGDA 3X0WA 2M17A 2BYVE 1FXTB 3A9KB 3HHMA 5CHVC 4NJ6A 4G50A 3SDLC 4EFOA 3AU5A 2JZZA 2N1WA 4GOCA 2FNJB 4RM8A 2KLGA 3HIZA 5JZEB 2J7QB 2N7DA 1RFAA 2A4ZA 2WX1A 1WZ3A 2KN5A 5AZFA 3ONSA 3PLVA 4BBNC 1J8CA 4FBJB 4NJ7A 3VAWA 2N9XA 3WIMA 3QJZA 1L7YA 1AARA 3ZRCA 4AJYB 2R2QA 1UBIA 2UYZB 3A9KA 1WZ0A 2AEHA 4NQLB 1GUAB 3GZNI 4E71A 3H6NA 3VFKA 4X57B 3PTFC 4NY0A 2FUHB 4FADA 3ZO5B 3I3TB 2RPQA 3KYDD 3L16A 3VUYA 3GOEA 2G4DB 2L00B 2MSED 4B6WA 1WJNA 3ALBA 3N32A 3ZUNA 1XD3B 3PV1A 3ML9A 4J6IA 3RULA 3A4SC 2IZVB 4BKSA 2MW5A 2QHOA 5G55A 4FHKA 3VUXA 1V9JA 1HE8A 2ZCBA 3NY5A 1LM8B 4GSWA 4GXBA 2KKCA 1MG8A 3CF6E 2O6VD 2LD9A 3DOWA 3KYCD 3H9DA 3QWZB 4M0WB 3SHQA 3TBLD 3VQIA 4GMVA 1WXSA 2WX0A 3OAWA 3M95A 2DENB 4K1RB 4W9GA 1QZEA 4IWOA 4HPMB 4KZCA 4MDKE 2DAJA 4GIVA 3U30A 4EZLA 4DHZB 4K7UA 4LDTD 3ZIMA 2JWZA 3R3MA 2YVCA 4FHJA 2KDIA 4F8CB 2KX0A 3DPDA 3H1UA 2REXA 2L0TA 2D2QA 1E7UA 2I1KA 2NS5A 3RYTA 2V4LA 4MGZE 1WFYA 3MJWA 3NOBA 2LGYA 5D7GA 1IPGA 2EKEC 4II2B 4IM3A 4ZRKA 2BWES 2J0JA 5EDSA 3VTWA 1WXMA 2B3AA 2JRHA 2C7NB 1H4RA 1XQQA 4MJSA 5D94A 2MA9B 3ZNZB 2MRPA 2ZPYA 2N1VA 3APCA 3DQVA 3PRPB 4G3XB 1RAXA 3EFUA 2KJ6A 2IYDB 1LQBA 2LI5A 3DBHI 4WWNA 3V60A 2PE9A 3IHPC 2KC2A 3EHVA 3A9JB 1WY8A 4WJQA 4FJZA 4LDTB 1WMHB 3DDCB 3Q3JA 4MSQB 2MX2A 4GDLB 5KHQA 1UH6A 1S1QB 4DBGA 4WJNA 4KZ0A 3QIJA 2RD0A 3R7RA 2MP2B 1WM2A 1SE9A 2N9EB 2GBKA 3DBSA 1UZXB 1WYWB 3A9JA 1P98A 2LJ5A 3L0WB 4HDOA 4W9EA 2KC1A 2KLCA 4GB9A 1KJTA 4A3PA 5CHWA 2Y5BB 1UBQA 4GDLA 3ZVVA 2CHWA 3HM6X 1GNUA 1NI2A 5E6NA 3W1YA 1D3ZA 3TCAA 4PS7A 2LVQA 3QQ8B 2G3QB 2J0KA 2MQJA 3H7SA 4NAWB 2O2VB 2JF5A 2LUEA 3L08A 4HXDA 4MGYE 5CTRC 2MCNB 4DK5A 1WM3A 2KWUB 2JXXA 1EUVB 3LJ3A 1WX9A 4IUMB 2K6DB 2L3ZA 2RR9A 5JHAA 1I42A 3VTVA 1OTRB 1WXAA 3LDZE 3ZTDA 1EF5A 1V5OA 2VRRB 4WJPA 2ZVOA 3ENEA 4WQOB 4AWJA 4BOSC 3KVFB 2HE7A 4PS8A 4MGKE 1NBFC 3A33B 3EC8A 3QA8A 4ANXA 2KMAA 2JY6A 2PPHA 1Q5WB 3BINA 4I6LB 2JT4B 3PLUA 4CO7A 2CHXA 3DVNU 5HKHA 4DDGD 1TZ1A 2GOWA 4GU2A 5DPTA 2MBOA 1YD8U 2N7EA 3L13A 4II3B 4HPLB 1K8RB 4KIKB 3ZNID 3VVWB 4TKNA 1WI0A 2IBIB 4ZRJA 2GMIC 4AOFA 1YIWA 3A4RA 2MBBB 3UINB 5C23A 2EMTA 4W9JA 2EMSA 3WAMA 4DHJB 2CHZA 4EOYA 4B9KA 3DBLI 3KUCB 2KZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNJ B;  4KIK A;  2WDT B;  4PYZ A;  2GBR A;  2N4F A;  1V6E A;  4IC7 B;  3KW5 B;  1WGY A;  1WX7 A;  1RLF A;  3WA0 A;  2BF8 B;  4P7I A;  3ZNH B;  1VCB A;  2LRW A;  3L54 A;  1E7V A;  2C9W B;  3PZD A;  3VDZ A;  2DYB A;  3IG3 A;  4MGI E;  4WAA A;  2DZI A;  2KMC A;  3UF8 A;  4AP4 C;  2M0X A;  3WAO A;  2FCS A;  2IO3 B;  4BVU C;  2C60 A;  3EEC A;  4JLC A;  3X23 A;  2BWF A;  1ZGU B;  1OGW A;  4GN1 A;  2WWZ A;  4F1S A;  1RRB A;  2LXC A;  4ZYN A;  4EKU A;  3UGB B;  5AZH A;  2L76 A;  2L05 A;  2XK5 B;  5E6O A;  4I6P A;  3DVG X;  4EZK A;  4PS3 A;  3W1S A;  5D6J B;  3RUI B;  1WR6 E;  4G0N B;  3S2A A;  4TQ0 A;  4EZJ A;  5J18 A;  3V6E B;  4DDI D;  4W9K A;  2DZJ A;  1PQS A;  1IP9 A;  4N9F 4;  3JSV B;  3PRZ A;  3QAR A;  1JRU A;  2KJR A;  1SIF A;  1VD2 A;  4K7W A;  1X1M A;  1E8W A;  4HDQ A;  2ZVN A;  4HWI B;  4FA6 A;  1NDD A;  3SU8 X;  1P3Q U;  2CKH B;  5IA7 A;  3B08 A;  2LXA A;  3U8Z A;  4WWO A;  2KQ7 A;  4IW0 A;  5KHO A;  2RGF A;  5DPS A;  1KOT A;  3CMM B;  3U7D A;  4XX5 A;  2IY1 B;  2O6V B;  3JYU A;  2XBB C;  4LJP B;  5C1Z A;  1WIA A;  3JSV A;  1KM7 A;  1WGH A;  3VXW A;  4W9L A;  1P0R A;  2KNB A;  2JPH A;  2KTR B;  5AZG A;  2DYM A;  3IFW B;  4ZDV A;  5JHB A;  2G4S A;  3T9L A;  1UEL A;  1WGG A;  2HTH A;  4RM9 A;  4BKT A;  2ZCC A;  4BKG A;  4GDK B;  2JUO A;  1YX6 B;  4M8M A;  2ZPN A;  5BO4 B;  4DXA B;  4W9F A;  2XEW A;  2Z0D B;  2K6Q A;  3UQB A;  2C7M B;  2KTR A;  4KDL B;  2L0F A;  3UIP B;  1WRD B;  1WMH A;  2KK8 A;  2CU1 A;  4IG7 B;  2RSU A;  4IM0 A;  1P1A A;  2DZM A;  4ANV A;  1XT9 B;  4HLE A;  3VTU A;  5J2R A;  3W1S C;  1UD7 A;  4HCN B;  3ZW3 A;  2K8H A;  1I35 A;  2MP2 A;  3TL5 A;  4FJY A;  2BGF A;  3BY4 B;  3VH4 B;  4OVU A;  2GBJ A;  3APF A;  1YX5 B;  1M94 A;  1F9J A;  2GBM A;  4FJV B;  4W9C A;  3ZKJ C;  2ZZP B;  2KD0 A;  2UWQ A;  1WJ6 A;  1Q0W B;  2FCQ A;  2AL3 A;  4CHK A;  3HM3 A;  1Y8R C;  4ANW A;  3V62 A;  1WE7 A;  2R2O A;  3D32 A;  4NAW A;  1WR1 A;  2K1F A;  2O2V A;  5L83 A;  2KTF A;  2KXJ A;  1V49 A;  2C7H A;  5LXI B;  3JVZ X;  3PRM B;  3P2B A;  2IO1 B;  2NPT B;  3DBR I;  5J17 A;  5AEK B;  1WGD A;  2LRU A;  2NCN A;  4E3C A;  5IAA C;  2KDF B;  4OVV A;  4GGQ A;  3PHX B;  2KFK B;  3SD5 A;  2LZ6 A;  1WX8 A;  2KVR A;  3ZDM C;  1YQB A;  2K39 A;  3H7P B;  2JZ3 B;  4TQ1 A;  3K9O B;  1C3T A;  4DWF A;  2CS4 A;  2DYO A;  4MSM B;  1GG3 A;  1S3S G;  1Z2M A;  5G2N A;  3A1Q B;  2NBW B;  1BT0 A;  3WAP A;  4IM2 A;  2BKF A;  3AU4 A;  4I6N B;  4MH0 E;  3M62 B;  2LVO A;  3B0A A;  3ECI A;  5GMV A;  3RZW C;  4MM3 A;  2I1J A;  2BYF A;  4WWP A;  2CR5 A;  4PYU A;  5CX3 A;  3VUW A;  4BKS D;  3H7P A;  5FR6 A;  2KO3 A;  2NVU I;  3IBE A;  3UIO B;  2G45 B;  3DCG A;  2ZJD A;  3KUD B;  2L8J A;  4ZRI A;  3Q3F A;  4KSL C;  2D11 A;  3RT3 B;  3QHT A;  2PE6 B;  2K8C A;  1H8C A;  4FN2 A;  4RMA A;  4KDI C;  1CMX B;  2FCM A;  2Z0E B;  1GC7 A;  3N30 A;  4EEW A;  1J19 A;  1WGR A;  2C5L C;  2KHW B;  2LGX A;  2OOB B;  4TUU A;  4W9D A;  3PHW B;  5TR5 A;  4A20 A;  1V2Y A;  5LLI A;  3K9P B;  3L10 B;  3RZF A;  2HJ8 A;  4HK2 A;  4E74 A;  4F7Z A;  3OJ3 A;  1R4M I;  1T0Y A;  1V81 A;  3V6C B;  3VHT C;  3ZDT A;  4EUT A;  2D10 A;  4WJO A;  2DZK A;  3QC8 B;  4HCP B;  3PS6 A;  2IO2 B;  2KFJ A;  3N3K B;  2KOX A;  1YJ1 A;  2MBH A;  4K81 A;  2PJH A;  3C0R B;  4FUL A;  3NHE B;  3WAL A;  2GBN A;  4W9I A;  3APD A;  5E6P A;  3MHS D;  4KV2 A;  4ICV A;  5JH5 C;  2XK5 A;  2FCN A;  1IYF A;  4XC2 A;  3DVG Y;  2PEA A;  5DPR A;  4DHZ E;  2V1Y A;  1OEY A;  1WE6 A;  3KUZ A;  4BFR A;  2ZNV B;  2DX5 B;  3AI5 A;  1LXD A;  2WYQ A;  2FAZ A;  2MWS B;  5L95 C;  2AWT A;  3UQA A;  2AYO B;  3OJ4 B;  3CST A;  4IWP A;  3RD2 A;  4M8N A;  2ZEQ A;  3ZNG C;  4MJS B;  1A5R A;  2OJR A;  4CYE A;  2HD5 B;  3TIX A;  3RCZ A;  4B95 A;  2DAF A;  2AL6 A;  2FIF A;  4A3O A;  2A5U A;  1OEY J;  1SGH A;  3QCA A;  4K7S A;  2KDB A;  1WJU A;  2O6V A;  3R7Q A;  2ASQ A;  2NBU A;  1GJZ A;  1ZKH A;  2D07 B;  1V5T A;  5LXH A;  4AJW A;  2M8S A;  3IVF A;  3L17 A;  3O65 B;  3PVL A;  4YL8 A;  3MTN B;  1C1Y B;  1TTN A;  1E8Y A;  1TBE A;  3ML8 A;  5DCN A;  1EF1 A;  2M4N A;  3ZLZ A;  4HJK A;  3QX1 A;  2V3S A;  4GDK A;  1E90 A;  2K25 A;  4LJO B;  3AUL A;  4LCD E;  3NZS A;  4MEL A;  3PPA A;  1WF9 A;  4ANU A;  3B1L X;  2KWV B;  2LVP A;  1GC6 A;  4ASW C;  2KX3 A;  4G11 A;  3V61 A;  1V80 A;  3NS8 A;  2LWP A;  2M1M A;  3ZRF A;  2KJH B;  3AXC A;  1ZW7 A;  5DPW A;  2JRI B;  3PSE B;  2IO0 B;  3R66 C;  5D2M B;  2KAN A;  3QAQ A;  2BPS A;  2K8B A;  2Z59 B;  2KQS A;  1Z5S B;  2YLM A;  1P9D U;  4KVG B;  3OLM D;  4W9H A;  4NPN A;  3PT2 B;  1E5W A;  4BBN F;  1L2N A;  1UGM A;  1R4N I;  2N9P C;  3DVN V;  4JIO U;  1E8Z A;  2KWC A;  2LAS A;  4JL9 A;  4NQK E;  1WJ4 A;  1Q1O A;  2NR2 A;  3JW0 X;  2J0M A;  2BKR B;  4ICU A;  1ISN A;  3TMP B;  1J0G A;  4XZ4 A;  4KSK C;  2L7R A;  4TV3 A;  2MBQ A;  3HK0 A;  1U4A A;  2FID A;  1TGZ B;  1WXV A;  3WAN A;  4HVB A;  4URK A;  1EO6 A;  2MLB A;  2NPT A;  3VH3 B;  1OQY A;  2ZNV C;  2BYE A;  2NBV B;  4MEM A;  1G6J A;  4BOZ B;  2W9N A;  4DHJ D;  3PRE A;  3T8M A;  2MBE A;  3ZTC A;  4AUQ C;  3M63 B;  5CHF A;  2KDE B;  2KFK A;  1LFD A;  4JGH B;  2JVC A;  3TJP A;  1E8X A;  4FLH A;  3M3J A;  1KLV A;  1V86 A;  1WH3 A;  4IWQ A;  4JQW C;  3A1Q A;  3CSF A;  2DHZ A;  3PGE A;  3QK0 A;  2D3G A;  3NZU A;  3KH0 A;  2IY0 B;  2LGD A;  3X0W A;  2M17 A;  2BYV E;  1FXT B;  3A9K B;  3HHM A;  5CHV C;  4NJ6 A;  4G50 A;  3SDL C;  4EFO A;  3AU5 A;  2JZZ A;  2N1W A;  4GOC A;  2FNJ B;  4RM8 A;  2KLG A;  3HIZ A;  5JZE B;  2J7Q B;  2N7D A;  1RFA A;  2A4Z A;  2WX1 A;  1WZ3 A;  2KN5 A;  5AZF A;  3ONS A;  3PLV A;  4BBN C;  1J8C A;  4FBJ B;  4NJ7 A;  3VAW A;  2N9X A;  3WIM A;  3QJZ A;  1L7Y A;  1AAR A;  3ZRC A;  4AJY B;  2R2Q A;  1UBI A;  2UYZ B;  3A9K A;  1WZ0 A;  2AEH A;  4NQL B;  1GUA B;  3GZN I;  4E71 A;  3H6N A;  3VFK A;  4X57 B;  3PTF C;  4NY0 A;  2FUH B;  4FAD A;  3ZO5 B;  3I3T B;  2RPQ A;  3KYD D;  3L16 A;  3VUY A;  3GOE A;  2G4D B;  2L00 B;  2MSE D;  4B6W A;  1WJN A;  3ALB A;  3N32 A;  3ZUN A;  1XD3 B;  3PV1 A;  3ML9 A;  4J6I A;  3RUL A;  3A4S C;  2IZV B;  4BKS A;  2MW5 A;  2QHO A;  5G55 A;  4FHK A;  3VUX A;  1V9J A;  1HE8 A;  2ZCB A;  3NY5 A;  1LM8 B;  4GSW A;  4GXB A;  2KKC A;  1MG8 A;  3CF6 E;  2O6V D;  2LD9 A;  3DOW A;  3KYC D;  3H9D A;  3QWZ B;  4M0W B;  3SHQ A;  3TBL D;  3VQI A;  4GMV A;  1WXS A;  2WX0 A;  3OAW A;  3M95 A;  2DEN B;  4K1R B;  4W9G A;  1QZE A;  4IWO A;  4HPM B;  4KZC A;  4MDK E;  2DAJ A;  4GIV A;  3U30 A;  4EZL A;  4DHZ B;  4K7U A;  4LDT D;  3ZIM A;  2JWZ A;  3R3M A;  2YVC A;  4FHJ A;  2KDI A;  4F8C B;  2KX0 A;  3DPD A;  3H1U A;  2REX A;  2L0T A;  2D2Q A;  1E7U A;  2I1K A;  2NS5 A;  3RYT A;  2V4L A;  4MGZ E;  1WFY A;  3MJW A;  3NOB A;  2LGY A;  5D7G A;  1IPG A;  2EKE C;  4II2 B;  4IM3 A;  4ZRK A;  2BWE S;  2J0J A;  5EDS A;  3VTW A;  1WXM A;  2B3A A;  2JRH A;  2C7N B;  1H4R A;  1XQQ A;  4MJS A;  5D94 A;  2MA9 B;  3ZNZ B;  2MRP A;  2ZPY A;  2N1V A;  3APC A;  3DQV A;  3PRP B;  4G3X B;  1RAX A;  3EFU A;  2KJ6 A;  2IYD B;  1LQB A;  2LI5 A;  3DBH I;  4WWN A;  3V60 A;  2PE9 A;  3IHP C;  2KC2 A;  3EHV A;  3A9J B;  1WY8 A;  4WJQ A;  4FJZ A;  4LDT B;  1WMH B;  3DDC B;  3Q3J A;  4MSQ B;  2MX2 A;  4GDL B;  5KHQ A;  1UH6 A;  1S1Q B;  4DBG A;  4WJN A;  4KZ0 A;  3QIJ A;  2RD0 A;  3R7R A;  2MP2 B;  1WM2 A;  1SE9 A;  2N9E B;  2GBK A;  3DBS A;  1UZX B;  1WYW B;  3A9J A;  1P98 A;  2LJ5 A;  3L0W B;  4HDO A;  4W9E A;  2KC1 A;  2KLC A;  4GB9 A;  1KJT A;  4A3P A;  5CHW A;  2Y5B B;  1UBQ A;  4GDL A;  3ZVV A;  2CHW A;  3HM6 X;  1GNU A;  1NI2 A;  5E6N A;  3W1Y A;  1D3Z A;  3TCA A;  4PS7 A;  2LVQ A;  3QQ8 B;  2G3Q B;  2J0K A;  2MQJ A;  3H7S A;  4NAW B;  2O2V B;  2JF5 A;  2LUE A;  3L08 A;  4HXD A;  4MGY E;  5CTR C;  2MCN B;  4DK5 A;  1WM3 A;  2KWU B;  2JXX A;  1EUV B;  3LJ3 A;  1WX9 A;  4IUM B;  2K6D B;  2L3Z A;  2RR9 A;  5JHA A;  1I42 A;  3VTV A;  1OTR B;  1WXA A;  3LDZ E;  3ZTD A;  1EF5 A;  1V5O A;  2VRR B;  4WJP A;  2ZVO A;  3ENE A;  4WQO B;  4AWJ A;  4BOS C;  3KVF B;  2HE7 A;  4PS8 A;  4MGK E;  1NBF C;  3A33 B;  3EC8 A;  3QA8 A;  4ANX A;  2KMA A;  2JY6 A;  2PPH A;  1Q5W B;  3BIN A;  4I6L B;  2JT4 B;  3PLU A;  4CO7 A;  2CHX A;  3DVN U;  5HKH A;  4DDG D;  1TZ1 A;  2GOW A;  4GU2 A;  5DPT A;  2MBO A;  1YD8 U;  2N7E A;  3L13 A;  4II3 B;  4HPL B;  1K8R B;  4KIK B;  3ZNI D;  3VVW B;  4TKN A;  1WI0 A;  2IBI B;  4ZRJ A;  2GMI C;  4AOF A;  1YIW A;  3A4R A;  2MBB B;  3UIN B;  5C23 A;  2EMT A;  4W9J A;  2EMS A;  3WAM A;  4DHJ B;  2CHZ A;  4EOY A;  4B9K A;  3DBL I;  3KUC B;  2KZR A; 
#chains in the Genus database with same CATH topology
 4NNJ B;  4KIK A;  1JRP A;  3W9C B;  1V6E A;  3ZNH B;  5EE9 A;  5BMI A;  3PZD A;  3ZJV A;  4WAA A;  2HDE A;  3NVV A;  2M0X A;  2WWZ A;  4ZYN A;  4EKU A;  2MJE A;  1PGA A;  1FIQ A;  1CJE A;  3RUI B;  5J18 A;  2M56 B;  3E56 A;  2FE8 A;  4ARI A;  2RDG A;  3PRZ A;  3QAR A;  1RYJ A;  1SIF A;  4HJG E;  4K7W A;  1X1M A;  1EU4 A;  4HWI B;  4FA6 A;  1P3Q U;  2CKH B;  1YMH E;  5D3D A;  2LXA A;  2AX5 A;  5C1Z A;  1KM7 A;  1FRD A;  2KNB A;  2GB1 A;  2DYM A;  1SE2 A;  5JHB A;  3T9L A;  1VDV A;  4MH8 A;  4M00 A;  3P4P B;  4GDK B;  2JUO A;  1ZE3 D;  5IP4 D;  2PIA A;  4A8X C;  2XEW A;  3UQB A;  2E3T A;  2V9H A;  2BVC A;  3U4E G;  2L0F A;  3Q8E A;  5BMH A;  1WRD B;  1WMH A;  2PKO A;  4ANV A;  1PYW D;  3AEC B;  1YJJ A;  1HTQ A;  4MAC A;  3W1S C;  4HRS A;  2MP2 A;  2M19 A;  3TL5 A;  2J52 A;  4OVU A;  4BZA A;  2GBM A;  2ZZP B;  4CHK A;  2AL3 A;  1YJI A;  1WE7 A;  2R2O A;  3D32 A;  3KWL A;  2K1F A;  1V49 A;  5AUK A;  3JVZ X;  2D5G A;  2IO1 B;  2NPT B;  3DBR I;  5AEK B;  2NCN A;  5IAA C;  4MM3 B;  3PHX B;  2KFK B;  3ZDM C;  2K39 A;  3K9O B;  1C3T A;  1S3S G;  1BT0 A;  2BKF A;  4MH0 E;  3J9C A;  2LVO A;  5GMV A;  3RZW C;  4MM3 A;  3N9Y C;  1MPE A;  1C76 A;  2KO3 A;  2NVU I;  3IBE A;  3U7Z A;  3UIO B;  1EWC A;  2WQY B;  3DHI C;  2L8J A;  3Q3F A;  4B0E A;  2PE6 B;  4KDI C;  1JQ4 A;  2Z0E B;  4TUU A;  3PHW B;  5LLI A;  2L83 A;  3L10 B;  3RZF A;  2HJ8 A;  2IGH A;  2LMC A;  5D3I B;  4HK2 A;  1R4M I;  3V6C B;  3VHT C;  2D10 A;  4EE2 A;  4DXG A;  1EWY C;  4HCP B;  2IO2 B;  1NEK B;  4LLG M;  4RGT A;  4C56 C;  3W5U B;  4W9I A;  1Y56 A;  2Q5W D;  1SE3 A;  1E9M A;  2CJO A;  4KGR A;  1OEY A;  3KUZ A;  2DX5 B;  3AI5 A;  4MT5 A;  2WXK A;  1LXD A;  2FAZ A;  5L95 C;  2AYO B;  2XN9 C;  4KGT A;  3CST A;  4IWP A;  3RD2 A;  2OJR A;  2HD5 B;  3DHG C;  1FPY A;  4WH4 A;  4XDD A;  1VZ8 A;  1VZ7 A;  1WJU A;  2ASQ A;  1GJZ A;  3RPF C;  2D07 B;  4L23 A;  3PVL A;  1C4C A;  4YL8 A;  1E8Y A;  1EF1 A;  4HJK A;  3BYY B;  2N9L A;  2WXM A;  1KH0 A;  1C9F A;  2JQR B;  3BVZ A;  1GC6 A;  4G11 A;  1N60 A;  3V61 A;  3FKY A;  3NS8 A;  1ESF A;  2KJH B;  2OHF A;  3NVW A;  3R66 C;  5D2M B;  1T3Q A;  2KAN A;  2H89 B;  5FR3 A;  2LGS A;  1MVK A;  1Z5S B;  4KVG B;  4W9H A;  3IAS 1;  4NPN A;  3PT2 B;  1E5W A;  1UGM A;  1R4N I;  4YTM B;  3JW0 X;  2NR2 A;  2H88 B;  3TMP B;  1UWM A;  1J0G A;  1YQ3 B;  2L7R A;  2MBQ A;  3HK0 A;  1U4A A;  1TGZ B;  4URK A;  1EO6 A;  2MLB A;  1DGJ A;  1OQY A;  2ZNV C;  4MEM A;  1L4D B;  4YSY B;  2MBE A;  2LEK A;  2PMV A;  5CHF A;  2KDE B;  4L1B A;  1F1H A;  3PO0 A;  4JQW C;  3PGE A;  2D3G A;  3NZU A;  2IY0 B;  1N63 A;  3HHM A;  3SDL C;  4EFO A;  4GOC A;  1JW9 D;  2YEP B;  4YT0 B;  2N7D A;  1FO4 A;  5AZF A;  3PLV A;  4BBN C;  1J8C A;  1TS3 A;  3LYY A;  4NJ7 A;  3QJZ A;  4OZB A;  3ZRC A;  3CIR B;  3ZXV A;  1HZ6 A;  3GZN I;  4E71 A;  4JPS A;  1F52 A;  3PTF C;  4NY0 A;  2FUH B;  3I3T B;  1C78 A;  3GOE A;  2YEP F;  1RFK A;  1XD3 B;  1VZ6 A;  4H2A A;  2IZV B;  1ET9 A;  1XLO A;  3NVY A;  3VUX A;  4GSW A;  3CF6 E;  4GMV A;  3AH7 A;  3M95 A;  3NJT A;  1XEE A;  5HHD G;  4K7U A;  2YVC A;  5HI1 A;  4C7Z A;  4F8C B;  3IT4 B;  2L0T A;  2WXH A;  3RYT A;  4MGZ E;  1C4A A;  1TS2 A;  2PW9 A;  3N20 C;  4ZRK A;  2BWE S;  1JML A;  2B3A A;  2X38 A;  1PGX A;  4MJS A;  4G3X B;  2MRP A;  4FXC A;  2KJ6 A;  2IYD B;  4KGS A;  3V60 A;  1GOZ A;  2JU6 X;  1TKE A;  3DDC B;  1AW7 A;  1UH6 A;  2W55 A;  1C4P A;  1N6Z A;  1WYW B;  3L0W B;  4W9E A;  1V8C A;  2KC1 A;  4GB9 A;  5CHW A;  2WXP A;  2Y5B B;  4LNF A;  1NI2 A;  3TCA A;  2J0K A;  2O2V B;  3Q8F A;  3BII D;  4MGY E;  4ZRQ A;  2KWU B;  4RFB A;  1EUV B;  3LJ3 A;  2DWQ A;  2GI9 A;  1LGR A;  2K6D B;  4OVZ A;  2QJL A;  5JHA A;  3VTV A;  1OTR B;  1TY2 A;  3LDZ E;  1V5O A;  4OHJ A;  4AWJ A;  1T5X D;  3KVF B;  1NBF C;  3QA8 A;  3Q3O C;  2PPH A;  3BIN A;  3RNF C;  3R2I A;  4DDG D;  1T6B X;  2J4X A;  2MBO A;  2N7E A;  3VRA B;  1IBX B;  3ZNI D;  4P1C C;  1SXT A;  3I5J C;  2IBI B;  3UIN B;  1K51 A;  1VLB A;  2JX5 A;  4W9J A;  3WAM A;  3KLS X;  2CHZ A;  3DBL I;  4RF1 A;  4KKJ A;  2WDT B;  1J7B A;  4JE3 B;  2GBR A;  2N4F A;  2BB6 A;  4YSZ B;  1WX7 A;  3C8Y A;  2BS2 B;  4N6E B;  2I2Y A;  3L54 A;  1E7V A;  2DYB A;  1ENF A;  3IG3 A;  1YN3 A;  2K9X A;  2I38 A;  2FCS A;  2C60 A;  3EEC A;  3X23 A;  1ZGU B;  4GN1 A;  4F1S A;  1RRB A;  3UGB B;  1ROE A;  3W1S A;  3C19 A;  4G0N B;  3S2A A;  3SFE B;  4EZJ A;  3V6E B;  1P7F A;  1F2R I;  2SEB D;  3AEE B;  4DDI D;  4W9K A;  2DZJ A;  3ZGZ A;  4KX6 B;  2QIE B;  4M0W A;  1JRU A;  2KJR A;  2ZVN A;  1NDD A;  2D3A A;  2KQ7 A;  2KQ4 X;  2WU2 B;  5DPS A;  3CMM B;  2IY1 B;  1ZOY B;  2O6V B;  1XCQ L;  4YXD B;  1BXT A;  3VXW A;  1P0R A;  3OG5 A;  4ZDV A;  1WGG A;  4TSS A;  1YX6 B;  4M8M A;  5BO4 B;  1FFV A;  4DXA B;  2WHI A;  2KK8 A;  2CU1 A;  4IG7 B;  1SJH D;  2RSU A;  1P1A A;  1XT9 B;  4HLE A;  3VTU A;  2OED A;  1ACC A;  1JWM D;  4M01 A;  1UD7 A;  3PZ8 A;  4HCN B;  3BY4 B;  1XF5 L;  1SJE D;  2MJD A;  3APF A;  2ZW0 A;  1M94 A;  2INP E;  2IPK D;  1D5M C;  4WWM A;  2FCQ A;  2K5P A;  4ANW A;  2KAJ A;  1GB1 A;  5L83 A;  4CQN A;  2KTF A;  5T8I A;  2KXJ A;  2WXL A;  4OW0 A;  1CZP A;  5J17 A;  2LRU A;  1UNS A;  2KDF B;  3GE3 C;  3AED B;  2WNM A;  1BUI C;  2LZ6 A;  2WXF A;  2KVR A;  4TQ1 A;  4MSM B;  1GG3 A;  3WAP A;  4IM2 A;  1SF0 A;  2BYF A;  4WWP A;  1FXI A;  2TSS A;  5FR6 A;  4Q2J A;  4WUR A;  5MPO A;  2G45 B;  2ZJD A;  4LK0 M;  3U52 E;  4ZRI A;  3QHT A;  1H8C A;  2K8C A;  2IGG A;  4RMA A;  2IDY A;  1CMX B;  1GC7 A;  2EEL A;  5TR5 A;  3K9P B;  4HPP A;  1T0Y A;  1V81 A;  4EUT A;  4WJO A;  2JYE A;  1B1Z A;  1VRA B;  2KOX A;  2MBH A;  4RGN A;  1DYQ A;  4K81 A;  2PJH A;  1L4Z B;  4YTN B;  3NHE B;  2GBN A;  5E6P A;  1GAQ B;  4XC2 A;  3BVG A;  1K52 A;  2ZNV B;  2WYQ A;  2MWS B;  3UQA A;  3BZD B;  2ZEQ A;  2VH2 A;  4CYE A;  2X8X X;  4B95 A;  2DAF A;  1KF6 B;  1OEY J;  4HEA 1;  2FBW B;  1ZKH A;  1V1P B;  1TTN A;  1TBE A;  3ML8 A;  3RMK C;  3TUO A;  3ZLZ A;  4GDK A;  1E90 A;  2K25 A;  4LJO B;  2UU7 A;  4MEL A;  3DBH B;  2KWV B;  1QKZ A;  4ASW C;  1V80 A;  3I63 C;  1KLG D;  3ZRF A;  2KN4 A;  2JRI B;  1D5Z C;  2Z59 B;  1T0S C;  1P9D U;  5I4D A;  1IUE A;  1L2N A;  3AEB B;  2DNF A;  4BBN F;  1GPX A;  3GP7 A;  2KWC A;  4NQK E;  4ZRP A;  2J0M A;  2BKR B;  4ICU A;  4YWG G;  1WXV A;  2CU3 A;  2N9K A;  2NPT A;  3HVD A;  2NBV B;  1G6J A;  5C3J B;  3PRE A;  4RCO A;  1XLQ A;  2KFK A;  1JWS D;  1LFD A;  1M4V A;  3Q3M C;  2JVC A;  2QEJ C;  1KLV A;  5HFY A;  3AM9 A;  4IWQ A;  3P4S B;  3QK0 A;  4XWW A;  2LGD A;  1HQR D;  2M17 A;  4NJ6 A;  3AU5 A;  3MP9 A;  2KLG A;  3HIZ A;  5JZE B;  2ZW1 A;  2WX1 A;  1WZ3 A;  1SB3 C;  2LHD A;  2NTT A;  3FC4 A;  3VAW A;  3WIM A;  1L7Y A;  2UYZ B;  4NQL B;  3P4R B;  3H6N A;  3VFK A;  1I4R A;  1L0X B;  3ZO5 B;  3VUY A;  2Y5P A;  3PV1 A;  4J6I A;  1YN4 A;  2WDQ B;  2PTL A;  3A4S C;  4C4V B;  2MW5 A;  4FHK A;  1TZO A;  1HE8 A;  1HA5 A;  2LJI A;  1TT5 B;  4GXB A;  3VR8 B;  2O6V D;  3KYC D;  3NVZ A;  2FUG 1;  3SHQ A;  4B0M A;  1WYG A;  3MFG A;  2DEN B;  4W9G A;  4IWO A;  4HPM B;  4KZC A;  2KDM A;  4MDK E;  2DAJ A;  4EZL A;  4LDT D;  4L2Y A;  3ABV B;  2RMM A;  2KT7 A;  3DPD A;  2REX A;  2D2Q A;  1E7U A;  2NS5 A;  1EM7 A;  5LNK 1;  1IPG A;  3VTW A;  2C7N B;  3I9V 1;  4P6V F;  1XQQ A;  5D94 A;  3DQV A;  2IGD A;  1TY0 A;  1RAX A;  1LQB A;  4WWN A;  2PE9 A;  2D3B A;  4O1N A;  3IHP C;  2KC2 A;  3EHV A;  1WY8 A;  2QDF A;  4WJQ A;  3H8H A;  1E10 A;  5KHQ A;  1S1Q B;  3QIJ A;  2RD0 A;  4A90 A;  2ACZ B;  1PUT A;  2WXJ A;  1WM2 A;  3TBL D;  3AE7 B;  1HZ5 A;  1KJT A;  5EE3 A;  4JWS C;  2J42 A;  1I4P A;  5E6N A;  1D3Z A;  2J53 A;  4NAW B;  2MQJ A;  4KKI A;  2JF5 A;  3BYT B;  2JXX A;  3EA6 A;  2RR9 A;  2SAK A;  1FMA D;  2NTS A;  3HVZ A;  1WXQ A;  2VZK D;  2ZVO A;  4REZ A;  4MGK E;  3A33 B;  4ANX A;  3Q8C A;  4CO7 A;  2CHX A;  1YN5 A;  2WXQ A;  3L13 A;  4HPL B;  1K8R B;  5H92 C;  4C80 A;  3ETR A;  4ZRJ A;  5AUI A;  1YIW A;  2NMQ A;  1EU3 A;  1SSN A;  2EMT A;  4DHJ B;  4BAX A;  4EOY A;  3IAM 1;  2KMM A;  4PYZ A;  4IC7 B;  3R2T A;  3FIL B;  3KW5 B;  1RLF A;  3I57 A;  1R7S A;  5G5H A;  3DWM A;  2LRW A;  2C9W B;  3VDZ A;  4MGI E;  1I4X A;  2DZI A;  2Y5C A;  3RNC C;  4BVU C;  2IO3 B;  3TEW A;  3FIL A;  4JLC A;  2BWF A;  3NS1 A;  5HG2 A;  2L76 A;  2L05 A;  1L0V B;  2XK5 B;  5E6O A;  1AWD A;  4PS3 A;  1L5P A;  1WR6 E;  3AN1 A;  1PQS A;  4XWT A;  3RNE C;  1N62 A;  2D3C A;  4RGM A;  3W5V B;  1V1O A;  1VD2 A;  4HDQ A;  3ZJT A;  3GE8 C;  1HXY D;  3SU8 X;  3RN9 C;  4WWO A;  2WU5 B;  3AE9 B;  2V3N A;  5KHO A;  4A55 A;  4XX5 A;  4LJP B;  2XBB C;  1STE A;  3FAH A;  4XYC A;  1WIA A;  2M0A A;  1K53 A;  2KTR B;  5AZG A;  3IFW B;  1ZXH A;  2G4S A;  4RM9 A;  4BKT A;  3V3X A;  4BKG A;  1JAL A;  2ZPN A;  2BBC A;  4LNK A;  2C7M B;  2KTR A;  4KDL B;  2WP9 B;  3ZJU A;  4LNN A;  2ICI A;  5G5G A;  1FXA A;  3MC0 B;  2DZM A;  1B9R A;  5J2R A;  3IT6 B;  1SIJ A;  3ZW3 A;  4NZL B;  1A70 A;  1VJK A;  2GBJ A;  1E0Z A;  1YX5 B;  4WQM A;  2E6X A;  3ZKJ C;  2AQ1 B;  1DOI A;  2KD0 A;  2UWQ A;  1WJ6 A;  1Q0W B;  1OQQ A;  2L32 A;  4AQ7 A;  2WXR A;  1F0Z A;  1WR1 A;  2O2V A;  3NZ3 A;  2MJ3 A;  1ZDV A;  3OWE B;  2C7H A;  2JWU A;  2WXO A;  3PRM B;  5LXI B;  3AE4 B;  1OFF A;  4E3C A;  2MHJ A;  4OVV A;  4GGQ A;  2V0G A;  3GS2 A;  2JZ3 B;  4DWF A;  2CS4 A;  1KLU D;  2DYO A;  1Z2M A;  5G2N A;  3A1Q B;  2NBW B;  1UWX A;  3B0A A;  1TJE A;  2CR5 A;  5GXG B;  5CX3 A;  3T3N A;  4JWU C;  5IOI A;  4C00 A;  3DCG A;  2VH1 A;  3KUD B;  1IBX A;  3RT3 B;  4YTP B;  4FN2 A;  4NAM A;  5TSS A;  4N58 A;  1JRO A;  3N30 A;  1Q10 A;  4EEW A;  1J19 A;  1WGR A;  2C5L C;  2KHW B;  2LGX A;  2OOB B;  4W9D A;  2OJW A;  3IXS A;  3OJ3 A;  3ZDT A;  3QC8 B;  3PS6 A;  1D5X C;  2W54 A;  2WDV B;  1YJ1 A;  5BMG A;  1XXG A;  1I4G A;  5FK9 C;  3C0R B;  1MFW A;  3WAL A;  3APD A;  4DQO C;  4PT5 A;  2FCN A;  3AE1 B;  3WCQ A;  4ZHO A;  5DPR A;  2PEA A;  2V1Y A;  4HKQ A;  2AWT A;  3OJ4 B;  3AE8 B;  3BWU D;  4M8N A;  3ZNG C;  1AYF A;  2IJ0 A;  3RCZ A;  2FIF A;  2A5U A;  1SGH A;  4ITK A;  4K7S A;  2KAC A;  3TEX A;  1C79 A;  2LUM A;  2Y3A A;  2O6V A;  3R7Q A;  4RGO S;  2NBU A;  5LXH A;  3UI3 A;  2M8S A;  1C1Y B;  3LXF A;  1IGC A;  1KFY B;  1NYQ A;  3AUL A;  3L4P A;  1WF9 A;  4ANU A;  3B1L X;  2KX3 A;  3CWI A;  2M1M A;  1ZW7 A;  5DPW A;  3PSE B;  2IO0 B;  3T3O A;  2KVZ A;  1WRI A;  3QAQ A;  2K8B A;  2KQS A;  1FD6 A;  3OLM D;  1FCC C;  4JIO U;  3N1X C;  1Q1O A;  5BYQ A;  2JYT A;  1ISN A;  4XZ4 A;  4TV3 A;  2FID A;  3VH3 B;  4BOZ B;  3EGR A;  4DHJ D;  5JXV A;  4AUQ C;  3M63 B;  1ZXI A;  4JGH B;  3TJP A;  4FLH A;  3M3J A;  1V86 A;  1YQ4 B;  1WH3 A;  1GB4 A;  3CSF A;  3KH0 A;  2W3S A;  2BYV E;  5CHV C;  3A9K B;  1C77 A;  2JZZ A;  1RFA A;  2A4Z A;  2RDH A;  3AE6 B;  4FBJ B;  4ZYS A;  1AAR A;  1FM0 D;  4AJY B;  3AV8 A;  1UBI A;  1V97 A;  3A9K A;  4A6Q A;  4QAY A;  4X57 B;  4FAD A;  3TEZ A;  2JXT A;  2EKI A;  1FNW A;  3AEG B;  3L16 A;  2BS3 B;  2L00 B;  2MSE D;  4B6W A;  3ZUN A;  4BKS A;  1N5W A;  3AEA B;  2QCZ A;  1V9J A;  2ZCB A;  1LM8 B;  2KKC A;  3QWZ B;  2LD9 A;  1WXS A;  3B9J A;  3OAW A;  4K1R B;  3P4Q B;  4DHZ B;  3R3M A;  4FHJ A;  2KDI A;  2KX0 A;  2RPV A;  3ZQ4 A;  3Q69 A;  2BYT A;  2V4L A;  4XGA B;  2LGY A;  1WGK A;  5D7G A;  4II2 B;  2EKE C;  1IGD A;  2J0J A;  3AB5 A;  2AQ2 B;  2JRH A;  1H4R A;  1N61 A;  3ZNZ B;  3EFU A;  3DBH I;  2HJ1 A;  2LI5 A;  1XLN A;  3DWG C;  3PZ7 A;  1L6V A;  3VR9 B;  4FJZ A;  1WMH B;  3Q3J A;  3EFC A;  3Q14 C;  1QOA A;  1HEZ E;  1V1P A;  1ET6 A;  1WSP A;  5IKC M;  4LNO A;  3R7R A;  3GB1 A;  2MP2 B;  1SE9 A;  2N9E B;  2GBK A;  1JWU D;  1UZX B;  1P98 A;  2LJ5 A;  4A3P A;  1VR9 A;  1UBQ A;  3ZVV A;  1GNU A;  2MEK A;  1UF0 A;  2PVG C;  3NUH B;  4RH6 A;  1FCL A;  1JWB D;  1YNT E;  2LUE A;  4HRO A;  4HXD A;  4RNA A;  5CTR C;  4DK5 A;  1WM3 A;  2RDB C;  1UGJ A;  3NG0 A;  4OZC A;  4IUM B;  2L3Z A;  3P42 A;  1I42 A;  3ZTD A;  1EF5 A;  1KRH A;  1MHH E;  2VRR B;  3KQ4 A;  2K22 A;  3EC8 A;  4US9 A;  1F2R C;  2JY6 A;  3DBR B;  1Q5W B;  4J3O D;  1D6E C;  2JT4 B;  3DVN U;  3TEY A;  2GOW A;  4GU2 A;  5DPT A;  1YD8 U;  4II3 B;  3VVW B;  4TKN A;  4AOF A;  5EE1 A;  3E9S A;  1T0R C;  5C23 A;  3P63 A;  4US8 A;  2EMS A;  3KUC B;  1BML C;  4USA A;  1WGY A;  3MC9 A;  3WA0 A;  2BF8 B;  5BYS A;  4P7I A;  1VCB A;  1TS4 A;  1N5X A;  2KMC A;  3UF8 A;  4AP4 C;  3MC8 A;  3WAO A;  2B76 B;  1OGW A;  2LXC A;  3N1Z C;  1CK1 A;  3W2D A;  5AZH A;  1R4M B;  4I6P A;  3DVG X;  4EZK A;  5D6J B;  4C4V A;  4TQ0 A;  5BYR A;  2QIL A;  2WDR B;  3HRD D;  1IP9 A;  4N9F 4;  1MHX A;  3JSV B;  2R61 A;  2G1E A;  1E8W A;  5IA7 A;  3B08 A;  3U8Z A;  4IW0 A;  2V3P A;  2RGF A;  1KOT A;  1L0Y B;  1NEN B;  4S0R A;  3U7D A;  3JYU A;  1L6U A;  3JSV A;  4LNI A;  1QIL A;  1WGH A;  3EUB 2;  4W9L A;  2WXI A;  2INC C;  2JPH A;  3ZXR A;  3RFZ B;  1UEL A;  1ZUD 2;  2HTH A;  2ZCC A;  2WS3 B;  4W9F A;  2Z0D B;  2K6Q A;  4AS1 A;  1FFU A;  2QMT A;  3UIP B;  4IM0 A;  3N1Y C;  4N59 A;  4P1B C;  4NJC A;  2K8H A;  1I35 A;  4FJY A;  2BGF A;  3VH4 B;  4TMA B;  4ARC A;  2XNA C;  2MH7 A;  1I7H A;  1F9J A;  1FNU A;  4FJV B;  1LO5 D;  4W9C A;  1FRR A;  3HM3 A;  1Y8R C;  3V62 A;  4NAW A;  1QLB B;  3LB8 C;  3SEB A;  1OQR A;  3P2B A;  2HTM E;  1WGD A;  4DXF A;  1R4N B;  2ON8 A;  2N0S B;  3SD5 A;  2BQQ A;  1WX8 A;  3URY A;  1YQB A;  3H7P B;  4ZOH C;  4R3D A;  3AU4 A;  4I6N B;  3M62 B;  3MHZ A;  3P1M A;  3ECI A;  2I1J A;  1SE4 A;  3SR6 A;  4PYU A;  3VUW A;  2BTE A;  4UDU C;  3H7P A;  4K3C A;  4BKS D;  1UUP A;  4KSL C;  2D11 A;  3AE5 B;  2FCM A;  2GRI A;  2K3U A;  4A20 A;  1V2Y A;  4XDC A;  4E74 A;  4F7Z A;  1XLP A;  3SFD B;  3ZYY X;  1K50 A;  2K0P A;  2DZK A;  2KFJ A;  3N3K B;  3GZN B;  4IDI A;  4K3B A;  1PDX A;  3HUI A;  4FUL A;  1PFD A;  3MHS D;  3U2S C;  4KV2 A;  1QF6 A;  4ICV A;  5JH5 C;  2XK5 A;  1IYF A;  3DVG Y;  4DHZ E;  1FEH A;  4BFR A;  1I4H A;  1WE6 A;  3B2F A;  4ZHP A;  4GLS C;  5FKA C;  4MJS B;  1A5R A;  1NVI D;  3TIX A;  2AL6 A;  4A3O A;  1TS5 A;  3QCA A;  2KDB A;  2L1A A;  1FNV A;  5H8Y E;  1QOB A;  1V5T A;  4AJW A;  4WIP A;  3IVF A;  3L17 A;  3O65 B;  3MTN B;  1YOV B;  5DCN A;  1E6E B;  2M4N A;  3RNB C;  3QX1 A;  2V3S A;  4LCD E;  3NZS A;  3PPA A;  2IND C;  2LVP A;  5IN7 A;  3B2G A;  2JZP A;  1TKY A;  1NI3 A;  1XO3 A;  2LWP A;  2PVO D;  3AXC A;  2DBY A;  2WXN A;  4ACF A;  2BPS A;  4M02 A;  3BK1 A;  2YLM A;  2N9P C;  3DVN V;  4PK1 A;  1E8Z A;  1I4Q A;  2LAS A;  4JL9 A;  1WJ4 A;  3TSS A;  4LTU A;  2GLS A;  1JWA D;  2WXG A;  5EE0 A;  4KSK C;  3V05 A;  3RNG C;  1ZDX A;  3WAN A;  4HVB A;  1D4B A;  2AQ3 B;  2BYE A;  4OZA A;  2W9N A;  4IOI E;  4HKZ E;  3T8M A;  3ZTC A;  1E8X A;  1QOG A;  4XE0 A;  1QT9 A;  3A1Q A;  2DHZ A;  5IO9 A;  3X0W A;  1FXT B;  2LHE A;  4G50 A;  2N1W A;  1RWS A;  2FNJ B;  4RM8 A;  1QOF A;  1PGB A;  3R8B A;  2J7Q B;  3Q8B A;  2LFI A;  2KN5 A;  3ONS A;  1HTO A;  2N9X A;  2BB5 A;  2DLB A;  2R2Q A;  2Z8L A;  2W3R A;  1WZ0 A;  2AEH A;  1GUA B;  3Q2A C;  2G9H D;  3DBL B;  3Q6B A;  2RPQ A;  4YSX B;  3KYD D;  2G4D B;  1WJN A;  3ALB A;  3N32 A;  3RUL A;  3ML9 A;  1DOY A;  5E6J A;  1P7E A;  2QHO A;  5G55 A;  3O13 A;  3NY5 A;  1E7P B;  3KWV A;  1MG8 A;  1SBB B;  3DOW A;  3VQI A;  4IKG A;  4M0W B;  3H9D A;  2WX0 A;  1AN8 A;  3Q8A A;  1QZE A;  3AEF B;  1TYG B;  1CQV A;  1JCK B;  1RM6 C;  4GIV A;  3U30 A;  2INN E;  3ZIM A;  2JWZ A;  1QQR A;  2KYW A;  3H1U A;  2I1K A;  2BS4 B;  4S17 A;  1WFY A;  3MJ5 A;  3MJW A;  3NOB A;  3RNA C;  3VRB B;  4P16 A;  4IM3 A;  1ZPS A;  5EDS A;  2LGI A;  1WXM A;  1XCT L;  2MA9 B;  2ZPY A;  2N1V A;  3APC A;  3PRP B;  3AE2 B;  1F77 A;  4JX1 C;  1MI0 A;  1TKG A;  3A9J B;  2BW2 A;  4LDT B;  4MSQ B;  2N7J A;  2MX2 A;  2QSD A;  3AMZ A;  4GDL B;  1KTK A;  4DBG A;  4WJN A;  4KZ0 A;  1MJD A;  3BK2 A;  3DBS A;  2WGS A;  3A9J A;  4HDO A;  4A9A A;  2KLC A;  4GDL A;  2CHW A;  3HM6 X;  3W1Y A;  4PS7 A;  2W82 A;  2LVQ A;  3QQ8 B;  3RI7 C;  2G3Q B;  3H7S A;  3L08 A;  3AE3 B;  1NYR A;  2MCN B;  4C7Y A;  1J7C A;  2WLB A;  5C2T B;  1WX9 A;  2QC8 A;  1T0Q C;  1WXA A;  1WWT A;  4WJP A;  3ENE A;  4WQO B;  4BOS C;  2ONQ A;  2HE7 A;  4PS8 A;  4WAF A;  2L52 A;  1DOX A;  2KMA A;  2BT6 A;  4I6L B;  2JSV X;  4D2K A;  1ZP0 B;  3PLU A;  5HKH A;  2V4I B;  4RF0 A;  1TZ1 A;  1J7A A;  4KIK B;  2PLP A;  1TIF A;  1MG4 A;  1WI0 A;  3NRZ A;  2GMI C;  3Q3N C;  3A4R A;  2MBB B;  3BVM A;  1SEB D;  2KWD A;  3DHH C;  2CJN A;  4B9K A;  2KZR A;  2VZK B; 
#chains in the Genus database with same CATH homology
 4NNJ B;  4KIK A;  2WDT B;  4PYZ A;  2GBR A;  2N4F A;  1V6E A;  4IC7 B;  3KW5 B;  1WGY A;  1WX7 A;  1RLF A;  3WA0 A;  2BF8 B;  4P7I A;  3ZNH B;  1VCB A;  2LRW A;  3L54 A;  1E7V A;  2C9W B;  3PZD A;  3VDZ A;  2DYB A;  3IG3 A;  4MGI E;  4WAA A;  2DZI A;  2KMC A;  3UF8 A;  4AP4 C;  2M0X A;  3WAO A;  2FCS A;  2IO3 B;  4BVU C;  2C60 A;  3EEC A;  4JLC A;  3X23 A;  2BWF A;  1ZGU B;  1OGW A;  4GN1 A;  2WWZ A;  4F1S A;  1RRB A;  2LXC A;  4ZYN A;  4EKU A;  3UGB B;  5AZH A;  2L76 A;  2L05 A;  2XK5 B;  5E6O A;  4I6P A;  3DVG X;  4EZK A;  4PS3 A;  3W1S A;  5D6J B;  3RUI B;  1WR6 E;  4G0N B;  3S2A A;  4TQ0 A;  4EZJ A;  5J18 A;  3V6E B;  4DDI D;  4W9K A;  2DZJ A;  1PQS A;  1IP9 A;  4N9F 4;  3JSV B;  3PRZ A;  3QAR A;  1JRU A;  2KJR A;  1SIF A;  1VD2 A;  4K7W A;  1X1M A;  1E8W A;  4HDQ A;  2ZVN A;  4HWI B;  4FA6 A;  1NDD A;  3SU8 X;  1P3Q U;  2CKH B;  5IA7 A;  3B08 A;  2LXA A;  3U8Z A;  4WWO A;  2KQ7 A;  4IW0 A;  5KHO A;  2RGF A;  5DPS A;  1KOT A;  3CMM B;  3U7D A;  4XX5 A;  2IY1 B;  2O6V B;  3JYU A;  2XBB C;  4LJP B;  5C1Z A;  1WIA A;  3JSV A;  1KM7 A;  1WGH A;  3VXW A;  4W9L A;  1P0R A;  2KNB A;  2JPH A;  2KTR B;  5AZG A;  2DYM A;  3IFW B;  4ZDV A;  5JHB A;  2G4S A;  3T9L A;  1UEL A;  1WGG A;  2HTH A;  4RM9 A;  4BKT A;  2ZCC A;  4BKG A;  4GDK B;  2JUO A;  1YX6 B;  4M8M A;  2ZPN A;  5BO4 B;  4DXA B;  4W9F A;  2XEW A;  2Z0D B;  2K6Q A;  3UQB A;  2C7M B;  2KTR A;  4KDL B;  2L0F A;  3UIP B;  1WRD B;  1WMH A;  2KK8 A;  2CU1 A;  4IG7 B;  2RSU A;  4IM0 A;  1P1A A;  2DZM A;  4ANV A;  1XT9 B;  4HLE A;  3VTU A;  5J2R A;  3W1S C;  1UD7 A;  4HCN B;  3ZW3 A;  2K8H A;  1I35 A;  2MP2 A;  3TL5 A;  4FJY A;  2BGF A;  3BY4 B;  3VH4 B;  4OVU A;  2GBJ A;  3APF A;  1YX5 B;  1M94 A;  1F9J A;  2GBM A;  4FJV B;  4W9C A;  3ZKJ C;  2ZZP B;  2KD0 A;  2UWQ A;  1WJ6 A;  1Q0W B;  2FCQ A;  2AL3 A;  4CHK A;  3HM3 A;  1Y8R C;  4ANW A;  3V62 A;  1WE7 A;  2R2O A;  3D32 A;  4NAW A;  1WR1 A;  2K1F A;  2O2V A;  5L83 A;  2KTF A;  2KXJ A;  1V49 A;  2C7H A;  5LXI B;  3JVZ X;  3PRM B;  3P2B A;  2IO1 B;  2NPT B;  3DBR I;  5J17 A;  5AEK B;  1WGD A;  2LRU A;  2NCN A;  4E3C A;  5IAA C;  2KDF B;  4OVV A;  4GGQ A;  3PHX B;  2KFK B;  3SD5 A;  2LZ6 A;  1WX8 A;  2KVR A;  3ZDM C;  1YQB A;  2K39 A;  3H7P B;  2JZ3 B;  4TQ1 A;  3K9O B;  1C3T A;  4DWF A;  2CS4 A;  2DYO A;  4MSM B;  1GG3 A;  1S3S G;  1Z2M A;  5G2N A;  3A1Q B;  2NBW B;  1BT0 A;  3WAP A;  4IM2 A;  2BKF A;  3AU4 A;  4I6N B;  4MH0 E;  3M62 B;  2LVO A;  3B0A A;  3ECI A;  5GMV A;  3RZW C;  4MM3 A;  2I1J A;  2BYF A;  4WWP A;  2CR5 A;  4PYU A;  5CX3 A;  3VUW A;  4BKS D;  3H7P A;  5FR6 A;  2KO3 A;  2NVU I;  3IBE A;  3UIO B;  2G45 B;  3DCG A;  2ZJD A;  3KUD B;  2L8J A;  4ZRI A;  3Q3F A;  4KSL C;  2D11 A;  3RT3 B;  3QHT A;  2PE6 B;  2K8C A;  1H8C A;  4FN2 A;  4RMA A;  4KDI C;  1CMX B;  2FCM A;  2Z0E B;  1GC7 A;  3N30 A;  4EEW A;  1J19 A;  1WGR A;  2C5L C;  2KHW B;  2LGX A;  2OOB B;  4TUU A;  4W9D A;  3PHW B;  5TR5 A;  4A20 A;  1V2Y A;  5LLI A;  3K9P B;  3L10 B;  3RZF A;  2HJ8 A;  4HK2 A;  4E74 A;  4F7Z A;  3OJ3 A;  1R4M I;  1T0Y A;  1V81 A;  3V6C B;  3VHT C;  3ZDT A;  4EUT A;  2D10 A;  4WJO A;  2DZK A;  3QC8 B;  4HCP B;  3PS6 A;  2IO2 B;  2KFJ A;  3N3K B;  2KOX A;  1YJ1 A;  2MBH A;  4K81 A;  2PJH A;  3C0R B;  4FUL A;  3NHE B;  3WAL A;  2GBN A;  4W9I A;  3APD A;  5E6P A;  3MHS D;  4KV2 A;  4ICV A;  5JH5 C;  2XK5 A;  2FCN A;  1IYF A;  4XC2 A;  3DVG Y;  2PEA A;  5DPR A;  4DHZ E;  2V1Y A;  1OEY A;  1WE6 A;  3KUZ A;  4BFR A;  2ZNV B;  2DX5 B;  3AI5 A;  1LXD A;  2WYQ A;  2FAZ A;  2MWS B;  5L95 C;  2AWT A;  3UQA A;  2AYO B;  3OJ4 B;  3CST A;  4IWP A;  3RD2 A;  4M8N A;  2ZEQ A;  3ZNG C;  4MJS B;  1A5R A;  2OJR A;  4CYE A;  2HD5 B;  3TIX A;  3RCZ A;  4B95 A;  2DAF A;  2AL6 A;  2FIF A;  4A3O A;  2A5U A;  1OEY J;  1SGH A;  3QCA A;  4K7S A;  2KDB A;  1WJU A;  2O6V A;  3R7Q A;  2ASQ A;  2NBU A;  1GJZ A;  1ZKH A;  2D07 B;  1V5T A;  5LXH A;  4AJW A;  2M8S A;  3IVF A;  3L17 A;  3O65 B;  3PVL A;  4YL8 A;  3MTN B;  1C1Y B;  1TTN A;  1E8Y A;  1TBE A;  3ML8 A;  5DCN A;  1EF1 A;  2M4N A;  3ZLZ A;  4HJK A;  3QX1 A;  2V3S A;  4GDK A;  1E90 A;  2K25 A;  4LJO B;  3AUL A;  4LCD E;  3NZS A;  4MEL A;  3PPA A;  1WF9 A;  4ANU A;  3B1L X;  2KWV B;  2LVP A;  1GC6 A;  4ASW C;  2KX3 A;  4G11 A;  3V61 A;  1V80 A;  3NS8 A;  2LWP A;  2M1M A;  3ZRF A;  2KJH B;  3AXC A;  1ZW7 A;  5DPW A;  2JRI B;  3PSE B;  2IO0 B;  3R66 C;  5D2M B;  2KAN A;  3QAQ A;  2BPS A;  2K8B A;  2Z59 B;  2KQS A;  1Z5S B;  2YLM A;  1P9D U;  4KVG B;  3OLM D;  4W9H A;  4NPN A;  3PT2 B;  1E5W A;  4BBN F;  1L2N A;  1UGM A;  1R4N I;  2N9P C;  3DVN V;  4JIO U;  1E8Z A;  2KWC A;  2LAS A;  4JL9 A;  4NQK E;  1WJ4 A;  1Q1O A;  2NR2 A;  3JW0 X;  2J0M A;  2BKR B;  4ICU A;  1ISN A;  3TMP B;  1J0G A;  4XZ4 A;  4KSK C;  2L7R A;  4TV3 A;  2MBQ A;  3HK0 A;  1U4A A;  2FID A;  1TGZ B;  1WXV A;  3WAN A;  4HVB A;  4URK A;  1EO6 A;  2MLB A;  2NPT A;  3VH3 B;  1OQY A;  2ZNV C;  2BYE A;  2NBV B;  4MEM A;  1G6J A;  4BOZ B;  2W9N A;  4DHJ D;  3PRE A;  3T8M A;  2MBE A;  3ZTC A;  4AUQ C;  3M63 B;  5CHF A;  2KDE B;  2KFK A;  1LFD A;  4JGH B;  2JVC A;  3TJP A;  1E8X A;  4FLH A;  3M3J A;  1KLV A;  1V86 A;  1WH3 A;  4IWQ A;  4JQW C;  3A1Q A;  3CSF A;  2DHZ A;  3PGE A;  3QK0 A;  2D3G A;  3NZU A;  3KH0 A;  2IY0 B;  2LGD A;  3X0W A;  2M17 A;  2BYV E;  1FXT B;  3A9K B;  3HHM A;  5CHV C;  4NJ6 A;  4G50 A;  3SDL C;  4EFO A;  3AU5 A;  2JZZ A;  2N1W A;  4GOC A;  2FNJ B;  4RM8 A;  2KLG A;  3HIZ A;  5JZE B;  2J7Q B;  2N7D A;  1RFA A;  2A4Z A;  2WX1 A;  1WZ3 A;  2KN5 A;  5AZF A;  3ONS A;  3PLV A;  4BBN C;  1J8C A;  4FBJ B;  4NJ7 A;  3VAW A;  2N9X A;  3WIM A;  3QJZ A;  1L7Y A;  1AAR A;  3ZRC A;  4AJY B;  2R2Q A;  1UBI A;  2UYZ B;  3A9K A;  1WZ0 A;  2AEH A;  4NQL B;  1GUA B;  3GZN I;  4E71 A;  3H6N A;  3VFK A;  4X57 B;  3PTF C;  4NY0 A;  2FUH B;  4FAD A;  3ZO5 B;  3I3T B;  2RPQ A;  3KYD D;  3L16 A;  3VUY A;  3GOE A;  2G4D B;  2L00 B;  2MSE D;  4B6W A;  1WJN A;  3ALB A;  3N32 A;  3ZUN A;  1XD3 B;  3PV1 A;  3ML9 A;  4J6I A;  3RUL A;  3A4S C;  2IZV B;  4BKS A;  2MW5 A;  2QHO A;  5G55 A;  4FHK A;  3VUX A;  1V9J A;  1HE8 A;  2ZCB A;  3NY5 A;  1LM8 B;  4GSW A;  4GXB A;  2KKC A;  1MG8 A;  3CF6 E;  2O6V D;  2LD9 A;  3DOW A;  3KYC D;  3H9D A;  3QWZ B;  4M0W B;  3SHQ A;  3TBL D;  3VQI A;  4GMV A;  1WXS A;  2WX0 A;  3OAW A;  3M95 A;  2DEN B;  4K1R B;  4W9G A;  1QZE A;  4IWO A;  4HPM B;  4KZC A;  4MDK E;  2DAJ A;  4GIV A;  3U30 A;  4EZL A;  4DHZ B;  4K7U A;  4LDT D;  3ZIM A;  2JWZ A;  3R3M A;  2YVC A;  4FHJ A;  2KDI A;  4F8C B;  2KX0 A;  3DPD A;  3H1U A;  2REX A;  2L0T A;  2D2Q A;  1E7U A;  2I1K A;  2NS5 A;  3RYT A;  2V4L A;  4MGZ E;  1WFY A;  3MJW A;  3NOB A;  2LGY A;  5D7G A;  1IPG A;  2EKE C;  4II2 B;  4IM3 A;  4ZRK A;  2BWE S;  2J0J A;  5EDS A;  3VTW A;  1WXM A;  2B3A A;  2JRH A;  2C7N B;  1H4R A;  1XQQ A;  4MJS A;  5D94 A;  2MA9 B;  3ZNZ B;  2MRP A;  2ZPY A;  2N1V A;  3APC A;  3DQV A;  3PRP B;  4G3X B;  1RAX A;  3EFU A;  2KJ6 A;  2IYD B;  1LQB A;  2LI5 A;  3DBH I;  4WWN A;  3V60 A;  2PE9 A;  3IHP C;  2KC2 A;  3EHV A;  3A9J B;  1WY8 A;  4WJQ A;  4FJZ A;  4LDT B;  1WMH B;  3DDC B;  3Q3J A;  4MSQ B;  2MX2 A;  4GDL B;  5KHQ A;  1UH6 A;  1S1Q B;  4DBG A;  4WJN A;  4KZ0 A;  3QIJ A;  2RD0 A;  3R7R A;  2MP2 B;  1WM2 A;  1SE9 A;  2N9E B;  2GBK A;  3DBS A;  1UZX B;  1WYW B;  3A9J A;  1P98 A;  2LJ5 A;  3L0W B;  4HDO A;  4W9E A;  2KC1 A;  2KLC A;  4GB9 A;  1KJT A;  4A3P A;  5CHW A;  2Y5B B;  1UBQ A;  4GDL A;  3ZVV A;  2CHW A;  3HM6 X;  1GNU A;  1NI2 A;  5E6N A;  3W1Y A;  1D3Z A;  3TCA A;  4PS7 A;  2LVQ A;  3QQ8 B;  2G3Q B;  2J0K A;  2MQJ A;  3H7S A;  4NAW B;  2O2V B;  2JF5 A;  2LUE A;  3L08 A;  4HXD A;  4MGY E;  5CTR C;  2MCN B;  4DK5 A;  1WM3 A;  2KWU B;  2JXX A;  1EUV B;  3LJ3 A;  1WX9 A;  4IUM B;  2K6D B;  2L3Z A;  2RR9 A;  5JHA A;  1I42 A;  3VTV A;  1OTR B;  1WXA A;  3LDZ E;  3ZTD A;  1EF5 A;  1V5O A;  2VRR B;  4WJP A;  2ZVO A;  3ENE A;  4WQO B;  4AWJ A;  4BOS C;  3KVF B;  2HE7 A;  4PS8 A;  4MGK E;  1NBF C;  3A33 B;  3EC8 A;  3QA8 A;  4ANX A;  2KMA A;  2JY6 A;  2PPH A;  1Q5W B;  3BIN A;  4I6L B;  2JT4 B;  3PLU A;  4CO7 A;  2CHX A;  3DVN U;  5HKH A;  4DDG D;  1TZ1 A;  2GOW A;  4GU2 A;  5DPT A;  2MBO A;  1YD8 U;  2N7E A;  3L13 A;  4II3 B;  4HPL B;  1K8R B;  4KIK B;  3ZNI D;  3VVW B;  4TKN A;  1WI0 A;  2IBI B;  4ZRJ A;  2GMI C;  4AOF A;  1YIW A;  3A4R A;  2MBB B;  3UIN B;  5C23 A;  2EMT A;  4W9J A;  2EMS A;  3WAM A;  4DHJ B;  2CHZ A;  4EOY A;  4B9K A;  3DBL I;  3KUC B;  2KZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...