3ZRCA

Pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zrcA00
3TMPB 4FHKA 4MJSA 4IWQA 4ANUA 2FCNA 3TJPA 3V60A 2GOWA 1E8WA 2KDIA 4KZCA 2IO2B 3VH4B 3I3TB 2FCSA 4GSWA 3LDZE 2LVQA 3N32A 3PREA 2K6DB 2M1MA 4HK2A 1TGZB 2B3AA 4W9DA 4HDQA 3AI5A 2O6VB 2GBRA 1WH3A 4LDTB 5LLIA 1YQBA 3DOWA 3TCAA 3EECA 5EDSA 5JZEB 1P3QU 2RD0A 4K1RB 2DX5B 1GNUA 3RD2A 2ZEQA 1KLVA 2IO3B 2KLCA 3VXWA 4IC7B 4GDLB 4IUMB 4G0NB 2KJRA 2KWUB 2I1KA 4JL9A 3U7DA 1PQSA 2EMSA 2KDBA 1WI0A 2KDEB 5G2NA 4BKTA 1OTRB 4ANXA 4EZJA 2KTFA 1V80A 4K7SA 3TBLD 3ZKJC 2LRWA 3PLVA 4NAWA 1P1AA 2PE6B 4DDGD 2BGFA 3VUYA 4K81A 3PS6A 5J2RA 3K9OB 2CHWA 1WXMA 2N9EB 2DZIA 4PYUA 1RRBA 3UF8A 2DZJA 1FXTB 2LWPA 2WX1A 2RSUA 2ZVOA 2G45B 3OJ3A 3QIJA 4GU2A 1E8XA 4RM8A 5TR5A 4DDID 2GMIC 5IA7A 5JHBA 1K8RB 3UIOB 3PLUA 3DVGX 2KJHB 1Q1OA 2NCNA 2V1YA 2KFKB 2M17A 2L00B 3L10B 4JGHB 2A5UA 3WAPA 1WGGA 3HM6X 2JRHA 4F1SA 1E7VA 3AU4A 3ZUNA 4FLHA 2N9XA 1SIFA 4I6NB 2JPHA 2DYBA 2YLMA 4BBNC 3AXCA 2ASQA 3BINA 3HHMA 4X57B 2KX0A 3UINB 3IHPC 1GUAB 2LVPA 1G6JA 1WJ6A 5KHOA 2KLGA 2ZPNA 3A4SC 4A20A 1OGWA 1I35A 1Q5WB 4NPNA 5CHFA 4II2B 3KYCD 4K7UA 2ZCBA 1WY8A 2LI5A 2IYDB 4FN2A 3UGBB 4CYEA 2AL6A 3CSFA 3L54A 4GOCA 3T8MA 3IBEA 3JYUA 3NY5A 2KDFB 2WYQA 2V3SA 2WWZA 1SGHA 3K9PB 2BKFA 2KFKA 3ZRFA 3DVNV 5BO4B 3L13A 3GZNI 2RR9A 2XEWA 2LVOA 4WJOA 5C23A 4G50A 2FIFA 2KN5A 1H8CA 1TBEA 3ZO5B 4EEWA 4HPLB 1A5RA 2A4ZA 5JH5C 2L8JA 3W1SA 2MP2B 4KDLB 5AZHA 3VFKA 2LGXA 4BOSC 1R4MI 1C1YB 1NI2A 2NBVB 1GG3A 3R7QA 3PTFC 4W9KA 3KYDD 4NJ6A 3ONSA 5AZFA 2EMTA 2MWSB 4ASWC 5E6OA 3A4RA 2KANA 2LGYA 3A1QB 3DBLI 3ALBA 3PRPB 3PV1A 3IFWB 4DHJD 1WYWB 4EZKA 2BF8B 2MBEA 3AULA 3CSTA 4II3B 3VUWA 2KC2A 3PSEB 2K8BA 2MLBA 4W9GA 3UQAA 4NJ7A 3L16A 1VD2A 4ICVA 2VRRB 4GB9A 4I6LB 4NQLB 5DCNA 2NBWB 1UH6A 2L05A 3WAOA 1UELA 3KW5B 1UGMA 2JF5A 4KV2A 2KOXA 2G4SA 4BBNF 4HLEA 1J0GA 1WZ3A 1WJUA 3RYTA 2CR5A 4OVUA 3PT2B 2L7RA 1JRUA 3DPDA 2XBBC 2MCNB 3ZNZB 1ZW7A 3N30A 1RLFA 3ML8A 4XX5A 4F8CB 3S2AA 2JUOA 1T0YA 2JT4B 4G3XB 3VTUA 2JVCA 1WGRA 2FIDA 4BKGA 1WM3A 4LCDE 1WM2A 4DHZE 4GMVA 3U8ZA 1XQQA 2AEHA 4NNJB 3X0WA 4AOFA 1SE9A 2NPTA 4W9HA 1WZ0A 2JZZA 3WALA 2DYMA 3Q3FA 4K7WA 3QCAA 4W9CA 4URKA 1WF9A 3TL5A 3IG3A 1F9JA 2KZRA 4MDKE 3QARA 4GDKB 3DVGY 1S3SG 4GGQA 1WR1A 2KKCA 3B0AA 4MGYE 3A9JB 4F7ZA 3PHXB 3HK0A 2KD0A 3TIXA 1E90A 3ENEA 2KTRB 2LGDA 4IG7B 1V49A 3DQVA 2D2QA 3D32A 3UIPB 3H7PB 3VTVA 3DCGA 1UBIA 4TKNA 5CHVC 4BKSA 1KJTA 2Z0DB 3MTNB 2IBIB 2GBNA 4FJVB 1KM7A 1VCBA 1Z5SB 2ZCCA 1NBFC 3W1YA 2D10A 2O6VA 3N3KB 4A3PA 2KMAA 2NVUI 3AU5A 1YX6B 3VH3B 2Z0EB 3NZUA 3QQ8B 2V4LA 3ZRCA 1TZ1A 4JLCA 1ISNA 4W9IA 4DBGA 2KVRA 4GDKA 3DVNU 1WRDB 2R2OA 3A9JA 3KH0A 1S1QB 2KWVB 4AJWA 2I1JA 4GDLA 1E8ZA 4FULA 4KDIC 3MJWA 2KTRA 3ZTCA 3H6NA 3V61A 1I42A 4MSQB 2DZKA 2BWES 2LUEA 4HXDA 3ZNGC 2DENB 3H7PA 4BOZB 2HJ8A 4CHKA 4TQ0A 4IWPA 1WIAA 1WE7A 1WXVA 2K6QA 2KC1A 1WX8A 2O2VB 2IO1B 4TUUA 5IAAC 4AWJA 1X1MA 4EZLA 2L76A 1WJNA 4MGKE 2DAJA 4HJKA 2IZVB 1WMHB 2GBJA 1D3ZA 2JZ3B 2DYOA 2CKHB 3NS8A 4G11A 4GN1A 4EUTA 1EUVB 4IM2A 4MELA 3JW0X 2N4FA 1TTNA 4B6WA 3HM3A 2C7MB 2C5LC 3PVLA 3JVZX 3CMMB 2LXCA 1V86A 2DAFA 4IM0A 3MHSD 2MRPA 3Q3JA 5D94A 2DHZA 2MW5A 1YX5B 2NS5A 2REXA 4RM9A 4NQKE 4B9KA 2FNJB 3U30A 4W9LA 2MBBB 4FA6A 2AYOB 2IY0B 2BYEA 2MBHA 3BY4B 2BYFA 4DXAB 2J0MA 4MEMA 2KFJA 1EF5A 4W9FA 4KIKB 3ECIA 4HWIB 2LRUA 1WGHA 1XT9B 1YD8U 2UYZB 4AP4C 2QHOA 1WXAA 4MGZE 4DWFA 2WDTB 4IWOA 3NHEB 4BKSD 4FBJB 5D2MB 2HTHA 2KO3A 3M3JA 2JXXA 3QWZB 4LJPB 4N9F4 3SU8X 4AUQC 2MX2A 2N9PC 1V6EA 1LXDA 1V5OA 4KVGB 4GXBA 2FCMA 3UQBA 3GOEA 5G55A 4EFOA 1V5TA 4WJPA 2O6VD 3RZWC 2HE7A 2ZJDA 5E6NA 2K8CA 3VDZA 2J7QB 3SHQA 4LDTD 2KXJA 2KK8A 4ZYNA 3WIMA 4EKUA 2JWZA 1Y8RC 3OLMD 4JQWC 1P0RA 2ZNVC 1UD7A 1Z2MA 2MP2A 2C7HA 3PRMB 3V6EB 3OJ4B 4XC2A 2BKRB 4HCPB 3QAQA 2EKEC 2PE9A 2AWTA 2KMCA 1WX7A 2C9WB 2KJ6A 2N1WA 3QHTA 1OEYJ 5J17A 3RT3B 1P9DU 1IYFA 2ZZPB 3T9LA 3A1QA 4HVBA 2K1FA 2GBKA 4AJYB 4W9EA 3WANA 3APFA 3M63B 5L95C 3VVWB 5JHAA 1WXSA 3ZVVA 3P2BA 4PYZA 4GIVA 4FJZA 1GC7A 5CHWA 4WJNA 2IY1B 2PPHA 2JRIB 2WX0A 3H9DA 1AARA 3O65B 1NDDA 4LJOB 4PS3A 4TQ1A 2LASA 2R2QA 4WAAA 3VHTC 2RPQA 3ZNID 4B95A 3QX1A 3L0WB 4P7IA 3NOBA 3KVFB 2MA9B 5D7GA 2RGFA 3R7RA 1BT0A 1WE6A 3V62A 4NAWB 1CMXB 3A33B 1IP9A 2KQSA 4PS7A 2M8SA 4DHJB 3R66C 1L7YA 2N7EA 3PPAA 3VQIA 4ANVA 2AL3A 2MSED 1GJZA 2C7NB 2UWQA 1KOTA 5C1ZA 4KZ0A 5KHQA 3SD5A 2XK5B 4JIOU 3ZDTA 1J8CA 4WJQA 3ML9A 1WGYA 5DPTA 2CU1A 5HKHA 3APDA 4J6IA 2CHXA 3RULA 3VAWA 5AZGA 4EOYA 3DDCB 3QJZA 3PHWB 1WGDA 2FCQA 2G4DB 2N1VA 4HCNB 1V9JA 1H4RA 3RUIB 2N7DA 4MM3A 4WWPA 4BFRA 2KWCA 3EHVA 1YJ1A 1P98A 4FJYA 4M0WB 2MQJA 3VUXA 3RCZA 5DPWA 3C0RB 3KUZA 3L08A 1E8YA 5DPSA 2D11A 2G3QB 1WX9A 4OVVA 2MBQA 4PS8A 1IPGA 1WR6E 3DBRI 5CTRC 1C3TA 2FUHB 2L0FA 4ZRIA 4DK5A 3WAMA 2XK5A 3M62B 3PZDA 2HD5B 3KUCB 4MH0E 3HIZA 1J19A 3PRZA 4KSLC 2M0XA 2IO0B 1RAXA 2K39A 2OJRA 4MSMB 1MG8A 1WFYA 3EFUA 4YL8A 2CHZA 3APCA 4NY0A 3B1LX 4XZ4A 3B08A 4WQOB 4TV3A 4FHJA 5LXHA 1R4NI 4M8NA 4IW0A 2YVCA 4KSKC 3ZIMA 1E5WA 2NBUA 3ZDMC 3PGEA 2BPSA 3RZFA 3NZSA 1L2NA 2NR2A 4ZRJA 2LD9A 4E3CA 3QA8A 2O2VA 5DPRA 5L83A 3WA0A 4CO7A 1YIWA 3DBSA 3JSVB 4E71A 2K25A 3OAWA 1XD3B 3ZTDA 2JY6A 1UZXB 2LZ6A 4E74A 3A9KB 1WMHA 1HE8A 5J18A 2KHWB 2KX3A 3QC8B 2D3GA 3EC8A 1LM8B 2Y5BB 4HDOA 3W1SC 4ANWA 1V2YA 2FAZA 3M95A 2ZNVB 4IM3A 3SDLC 3ZLZA 1U4AA 5D6JB 2LJ5A 5CX3A 4MGIE 1EF1A 1WJ4A 2L3ZA 2LXAA 4WWOA 2C60A 3QK0A 3VTWA 3ZW3A 3LJ3A 1Q0WB 3IVFA 5AEKB 1UBQA 2M4NA 2MBOA 2ZVNA 3H1UA 5GMVA 3X23A 3R3MA 2L0TA 4W9JA 4M8MA 3JSVA 4KIKA 4RMAA 4BVUC 3ZNHB 3CF6E 1ZKHA 2DZMA 4MJSB 3A9KA 4DHZB 4HPMB 5FR6A 2ZPYA 2KQ7A 2J0JA 1OQYA 3L17A 1RFAA 2PEAA 1LFDA 4WWNA 5E6PA 2BWFA 2GBMA 3DBHI 2J0KA 3H7SA 4ZRKA 2CS4A 2BYVE 2NPTB 4FADA 1EO6A 4A3OA 1E7UA 4I6PA 4ICUA 1GC6A 2OOBB 2W9NA 1LQBA 3V6CB 2D07B 1QZEA 4ZDVA 2K8HA 2Z59B 1M94A 2KNBA 5LXIB 1V81A 3KUDB 1OEYA 1ZGUB 2PJHA
chains in the Genus database with same CATH superfamily
3TMPB 5IP4D 4IWQA 1FFVA 4ANUA 2FCNA 3VR8B 1E8WA 2BQQA 3LDZE 1QKZA 1HQRD 4N6EB 1YN4A 1TGZB 5H92C 4HDQA 3AI5A 2KN4A 3ABVB 2VH1A 4JPSA 5LLIA 3TCAA 2BYTA 3RD2A 4R3DA 3VXWA 3EFCA 2KJRA 3B2FA 2I1KA 4FXCA 4EZJA 4ANXA 2D3BA 1OTRB 3BZDB 4OVZA 1PFDA 2B76B 4NAWA 1P1AA 3RI7C 1KLUD 1JALA 4C7ZA 1P7FA 2CHWA 1AWDA 2DZJA 1FXTB 2WX1A 2RSUA 4GU2A 1FRDA 1E8XA 2J53A 4ZOHC 3UIOB 3DVGX 5D3DA 4YXDB 2KFKB 3WAPA 3HM6X 2JWUA 3PO0A 4FLHA 3ZUNA 2N9XA 4I6NB 3Q8EA 3AXCA 2ASQA 3HHMA 3NG0A 1SXTA 3IHPC 5KHOA 2KLGA 3MFGA 1K53A 4A20A 1OGWA 1Q5WB 4NPNA 4II2B 3KYCD 1N5XA 2ZCBA 5IO9A 4CYEA 2AL6A 1FEHA 2WYQA 2V3SA 2WXNA 3AE8B 3K9PB 2BKFA 5I4DA 4YSYB 3GZNI 3Q8CA 1TKGA 3IXSA 5EE0A 2KN5A 1H8CA 1F2RC 3UI3A 5HFYA 2JYTA 2A4ZA 5JH5C 2L8JA 5TSSA 1QOAA 4KKIA 2H88B 2M0AA 1GG3A 3PTFC 2DLBA 5E6OA 3A4RA 3A1QB 1E10A 3CSTA 3VUWA 3ZJTA 2G1EA 2KWDA 1DOYA 1GOZA 3L16A 4WQMA 2JYEA 2JX5A 1UELA 3KW5B 2YEPF 2JF5A 4KV2A 2KOXA 1WZ3A 2L32A 2CR5A 1JRUA 3T3NA 2XBBC 2WXLA 3N30A 1OQQA 3VTUA 1QLBB 2JVCA 1WGRA 4BKGA 1WM3A 4OW0A 4LCDE 3OG5A 1V97A 3Q14C 1L4ZB 4ZRPA 4AOFA 2Y3AA 3WALA 3Q3FA 2WS3B 1L6VA 1WF9A 2HTME 2KZRA 1IUEA 2FUG1 1WR1A 2KKCA 3B0AA 4MGYE 3RNCC 2KD0A 4MM3B 1E90A 2KTRB 3B9JA 3DQVA 1NI3A 3DCGA 4BKSA 1QQRA 1VCBA 3R2IA 3W1YA 2NVUI 3VH3B 4C4VA 4YTNB 2LUMA 3QQ8B 1CQVA 4GDKA 4GLSC 1L0VB 1K52A 3BVMA 3GZNB 1T0SC 1E8ZA 4FULA 1QOFA 3MJWA 1ZPSA 2E3TA 3H6NA 2BWES 2DENB 2HJ8A 3GE8C 2K6QA 2O2VB 1WX8A 4XDDA 2IO1B 3TEXA 4XE0A 4AWJA 4EZLA 5FK9C 2L76A 5HI1A 2D3CA 1YJIA 4HJKA 2JZ3B 4GN1A 1J7AA 2N7JA 2C7MB 1TKEA 3CMMB 2XN9C 2DAFA 3SR6A 1N60A 2REXA 4B9KA 4RF1A 5BYSA 1ET9A 3U30A 2QEJC 2MBHA 2PTLA 4DXAB 4MEMA 5IOIA 2LRUA 1WGHA 1YD8U 4DWFA 2WDTB 3NHEB 3AECB 2KO3A 5H8YE 2JXXA 3U4EG 3SU8X 3H8HA 4KVGB 1N63A 5G55A 1SJED 4EFOA 2O6VD 3RZWC 1IBXA 2ZJDA 3SHQA 2MJDA 2KK8A 2FE8A 4WH4A 3OLMD 2ZNVC 1Z2MA 3V6EB 2BKRB 1F0ZA 2KMCA 3DWGC 2N1WA 1PGAA 5J17A 3RT3B 2ZZPB 3T9LA 3A1QA 4HVBA 3MP9A 2GBKA 3RNGC 1MVKA 4W9EA 2PVGC 1I7HA 1HTOA 3VVWB 2M56B 1WXSA 3AE5B 1XLOA 4PYZA 4FJZA 2BS2B 1T0RC 5AUIA 4LJOB 4TQ1A 4WAAA 2WXPA 4C56C 4DQOC 2WXMA 3R7RA 1BT0A 1AN8A 4MT5A 4LNOA 1RYJA 3V62A 2XNAC 3A33B 3DBRB 2KQSA 4PS7A 3EUB2 4HKQA 3VQIA 2SAKA 4ANVA 1NEKB 2IDYA 4N59A 1KOTA 4WWMA 1R7SA 2XK5B 4JIOU 1TJEA 4LLGM 5HKHA 3WCQA 2KACA 1XLQA 1HXYD 3BK1A 2G4DB 2N1VA 1TS4A 1VZ7A 3RUIB 4MM3A 1DOXA 4WWPA 1P98A 4FJYA 2RMMA 2MJ3A 1FM0D 5DPWA 3Q8AA 1E8YA 1WX9A 1WR6E 1QOBA 1NYQA 1J7BA 1I4GA 3RNEC 3AMZA 3HIZA 3PRZA 3RNFC 1JMLA 1EU3A 1JRPA 4XDCA 2CHZA 3APCA 4NY0A 3B08A 4FHJA 3NVWA 1R4NI 2CU3A 3ZIMA 1ZXHA 1L2NA 1EWCA 4ZRJA 2LEKA 2WQYB 2O2VA 2RDHA 3WA0A 3DBSA 2W54A 1UZXB 1FPYA 1JWUD 3R8BA 4ARIA 5J18A 1N61A 3EC8A 2UU7A 3SDLC 2BT6A 2LJ5A 2ZW1A 2N0SB 1I4XA 2LHDA 2L52A 3Q8BA 3AE1B 3H1UA 5GMVA 3E56A 1TKYA 2DZMA 2ZPYA 1PGXA 1RFAA 1LGRA 3HVZA 1SB3C 2GBMA 2IGHA 1BXTA 1VLBA 2OEDA 4FADA 1E7UA 1QOGA 1SSNA 2D07B 2K8HA 2Z59B 4WIPA 2KNBA 1OEYA 1ZGUB 4FHKA 2KDIA 1F77A 4KGSA 1MJDA 1FMAD 3FC4A 4HK2A 3AE6B 1ZP0B 5HG2A 1RFKA 5FKAC 3BIID 1KLVA 2KLCA 4YTMB 3W5UB 4G0NB 3P4SB 2LMCA 1YJJA 3U7DA 1TS2A 1DYQA 2EMSA 1WI0A 1R4NB 4A8XC 2AQ3B 3NVYA 2KTFA 1V80A 2WXHA 3TBLD 3NS1A 2QJLA 2LRWA 1HEZE 4DDGD 1YMHE 4K81A 1SIJA 3KQ4A 3N20C 1WXMA 2N9EB 4RGMA 3QIJA 5TR5A 1DOIA 3I9V1 2INNE 5JHBA 2NCNA 2VZKD 2L00B 3L10B 2A5UA 4F1SA 1SIFA 1YN3A 2JPHA 1TS3A 3VR9B 3AEBB 4BBNC 3BINA 1R4MB 4LK0M 1GUAB 2M19A 1WJ6A 2JQRB 2ZPNA 5C3JB 4B0MA 1L6UA 5D3IB 1B9RA 4FN2A 1WXQA 3L54A 3ZQ4A 1WGKA 4RNAA 1HZ5A 3DVNV 5BO4B 3L13A 4M01A 5C23A 2K22A 4P1CC 2K5PA 3W1SA 2MP2B 2GB1A 3SFEB 1HA5A 2NBVB 1FNVA 4NJ6A 2MWSB 4ASWC 2LGYA 3RNBC 4LTUA 2BF8B 2MBEA 1ROEA 4II3B 2KC2A 2K8BA 2MLBA 3UQAA 3EA6A 1D5ZC 4NJ7A 1VD2A 3DHGC 5DCNA 3WAOA 5BMGA 2GI9A 2DBYA 4HLEA 4OVUA 4DXGA 3ML8A 4F8CB 4LNIA 4L23A 3Q8FA 4G3XB 1Q10A 4C7YA 1WM2A 4LNNA 3RMKC 4GMVA 1NENB 1WZ0A 2DYMA 1PGBA 4K7WA 4XWWA 1YN5A 1QT9A 2DWQA 3NRZA 4C4VB 3IG3A 3HRDD 5EE9A 3Q3MC 4MDKE 4GDKB 3DVGY 4GGQA 3HK0A 1K50A 3BVGA 2LGDA 3UIPB 3EGRA 1UBIA 4TKNA 2DNFA 1KJTA 3MTNB 1B1ZA 2WDQB 1KFYB 1A70A 2BB6A 2GBNA 4FJVB 4IDIA 4JWUC 3N3KB 3U52E 2Z0EB 5AUKA 4W9IA 3A9JA 2KWVB 2I1JA 4MSQB 4HXDA 2SEBD 3H7PA 4BOZB 4TQ0A 2KQ4X 1WXVA 2V0GA 2PW9A 1D3ZA 2GBJA 2AX5A 2DYOA 1SJHD 4MELA 2N4FA 1TTNA 4B6WA 3HM3A 2L1AA 2C5LC 2OHFA 3PVLA 1V86A 3P63A 1IBXB 4IM0A 2QC8A 3Q3JA 1E7PB 2DHZA 2MW5A 4NQKE 4O1NA 4FA6A 2IJ0A 3P4PB 4KIKB 4HWIB 2QHOA 1WXAA 1XXGA 2W82A 4IWOA 5D2MB 3M3JA 4N9F4 3QWZB 4LJPB 1V6EA 1C78A 4JX1C 4ITKA 2FCMA 3UQBA 1V5TA 3ZJUA 3IAS1 2J7QB 4LDTD 2KXJA 3R2TA 1TY0A 4DXFA 4JQWC 2MP2A 4TMAB 4YT0B 1C9FA 1WX7A 2KJ6A 2INDC 1OEYJ 1P9DU 4AJYB 3WANA 3APFA 4US9A 5G5GA 2Y5CA 2N9LA 3AEFB 1IGCA 5E6JA 2K3UA 3M63B 5G5HA 3J9CA 1GC7A 1OFFA 1TT5B 2IY1B 2PPHA 2JRIB 2WX0A 2LASA 2R2QA 3TEWA 3KWLA 3NVVA 2MA9B 5D7GA 1UWXA 1WE6A 1CMXB 5EE1A 1IP9A 3R66C 1GJZA 1J8CA 1WGYA 2D5GA 2CU1A 2MH7A 1OQRA 3HUIA 4AQ7A 2FCQA 4BFRA 4HEA1 3EHVA 4ZRQA 1YJ1A 1MHXA 2MQJA 3RCZA 4C80A 4OVVA 5CTRC 3DBRI 2FUHB 4B0EA 3BYYB 3WAMA 1JWAD 4A55A 3T3OA 4KSLC 2JSVX 3KWVA 2BTEA 3SFDB 1VR9A 2IO0B 2K39A 1VZ8A 1WFYA 4YL8A 1DGJA 2D3AA 2MJEA 3B1LX 4KSKC 1E5WA 3ZDMC 3PGEA 3AE2B 3MC9A 1YIWA 2PLPA 4E71A 2K25A 3OAWA 2LZ6A 2V4IB 4NJCA 2KX3A 3CWIA 1V8CA 1LM8B 2Y5BB 3DBHB 3MHZA 4ANWA 2FAZA 1U4AA 1EF1A 1WJ4A 3QK0A 4A9AA 3LJ3A 4J3OD 3IVFA 2JU6X 2M4NA 2MBOA 2ZVNA 4S17A 3R3MA 4M8MA 4KIKA 4RMAA 3ZNHB 2INPE 1TIFA 1ZKHA 1E6EB 3A9KA 3FAHA 4HPMB 3L17A 2PEAA 4WWNA 3U7ZA 3AB5A 5E6PA 2J0KA 2CS4A 2NPTB 3P1MA 5BYRA 1EO6A 2BB5A 4A3OA 4I6PA 4ICUA 1GC6A 3ETRA 1LQBA 2VH2A 1XLPA 3AEGB 1M94A 5LXIB 3PZ7A 3Q69A 2BW2A 2WXGA 2WGSA 1FD6A 4OHJA 1KF6B 4MJSA 4K3CA 2WDRB 5HHDG 1P7EA 4KZCA 2IO2B 3VH4B 4XGAB 3Q3NC 3AEAB 4M00A 2LVQA 3N32A 1I4RA 1L5PA 1SBBB 2B3AA 4W9DA 2O6VB 2X8XX 4KX6B 1PYWD 4LNFA 3EECA 2RD0A 4K1RB 1GNUA 1L0XB 1ZXIA 2IO3B 4IC7B 2KDBA 4BKTA 1FCLA 3ZJVA 1UF0A 2R61A 2RDBC 3VUYA 4OZCA 3PS6A 5J2RA 3K9OB 2DZIA 4PYUA 1RRBA 3UF8A 4NZLB 3MJ5A 3OJ3A 2G45B 1TYGB 3GP7A 2GMIC 5IA7A 3PLUA 1Q1OA 2V1YA 2M17A 4JGHB 1JROA 1E7VA 3AU4A 1TY2A 2DYBA 2YLMA 2I38A 2KX0A 2E6XA 3N1XC 3UINB 2LVPA 4C00A 1G6JA 2WU5B 4XYCA 1GB4A 2LGSA 5CHFA 1SE2A 2W3RA 1WY8A 3CIRB 1VZ6A 2LI5A 3RPFC 3UGBB 3N1YC 3CSFA 4GOCA 5C2TB 2OJWA 2LJIA 2WWZA 1HZ6A 3KLSX 1BMLC 3ZRFA 4OZBA 3Q2AC 1GB1A 4WJOA 1UNSA 4G50A 3ZO5B 3DHHC 4KDLB 1GAQB 2LGXA 1R4MI 1C1YB 1NI2A 2TSSA 1T5XD 3R7QA 4W9KA 2RPVA 3KYDD 3ONSA 3DBLI 4A6QA 3ALBA 4DHJD 1IGDA 1F2RI 4NAMA 2Z8LA 1ZUD2 4ICVA 1FFUA 2VRRB 4GB9A 4I6LB 4NQLB 1UH6A 2L05A 3P4RB 2WU2B 3V3XA 2G4SA 1J0GA 3RYTA 3IT6B 2J52A 3DPDA 2WXKA 3ZNZB 4EE2A 3W5VB 1RLFA 1XF5L 2JUOA 2JT4B 1JQ4A 1EU4A 4DHZE 2IGGA 2AEHA 4NNJB 2MHJA 1SE9A 2NPTA 1LO5D 2WXJA 4W9CA 3V05A 3P4QB 1F9JA 2BVCA 3URYA 3A9JB 3N1ZC 1TZOA 2PKOA 3PHXB 3TIXA 4YSZB 3ENEA 4IG7B 1V49A 3BWUD 3H7PB 2W55A 2CJOA 3IT4B 1ZE3D 2Z0DB 1NYRA 1Z5SB 2ZCCA 1NBFC 2GRIA 4JE3B 3RFZB 2O6VA 3AE9B 3AU5A 4RGOS 3AE3B 3NZUA 3TUOA 1VRAB 1TZ1A 4JLCA 1ISNA 4DBGA 1KH0A 4L1BA 3KH0A 1WRDB 2R2OA 4KDIC 3ZTCA 2QDFA 2DZKA 2LUEA 1ESFA 1E0ZA 1WE7A 2KC1A 4TUUA 2NMQA 1X1MA 1C79A 1M4VA 4MH8A 2IZVB 1WMHB 1WYGA 3DBLB 2CKHB 3NS8A 2J42A 4HRSA 4EUTA 1EUVB 4IM2A 1KTKA 3C19A 3JW0X 3ZYYX 3JVZX 2LXCA 5D94A 4RM9A 1YX5B 3LYYA 3I57A 1FNWA 2ICIA 2J0MA 3ECIA 2MEKA 1XT9B 1STEA 3W9CB 4BKSD 1T6BX 2HTHA 4AUQC 4TSSA 2N9PC 1LXDA 4GXBA 3SEBA 3GOEA 4WJPA 3NVZA 1MPEA 2VZKB 3VDZA 2K8CA 2IGDA 1XCTL 1F52A 2JWZA 1Y8RC 2EELA 1P0RA 3OJ4B 5BMHA 4HCPB 2AWTA 2N9KA 2C9WB 3QHTA 1XLNA 4JWSC 1IYFA 1C4PA 5L95C 1L4DB 5JHAA 3P2BA 3ZGZA 1V1PA 5JXVA 4BAXA 3H9DA 1NDDA 4PS3A 3VHTC 4ZHPA 1RWSA 4P7IA 2WLBA 3NOBA 3KVFB 2AQ1B 2WXQA 1D5MC 4CQNA 4A90A 2GLSA 1FIQA 1SEBD 1L7YA 1T3QA 1BUIC 2AL3A 2MSED 5GXGB 4KZ0A 3ZXVA 3SD5A 2G9HD 4HJGE 3MC0B 1ZOYB 4KGRA 2CHXA 3VAWA 2NTTA 3DDCB 3QJZA 1WGDA 1PUTA 1WSPA 4HCNB 1V9JA 1H4RA 4P6VF 2N7DA 2KWCA 1N5WA 4M0WB 3C0RB 3KUZA 3L08A 3OWEB 5DPSA 4PS8A 2MBQA 1IPGA 4DK5A 1XCQL 3M62B 3PZDA 1VJKA 2HD5B 2ON8A 3KUCB 1RAXA 5BYQA 4MSMB 3BK2A 3EFUA 1AYFA 4WQOB 4TV3A 4YSXB 5LXHA 2QIEB 4IW0A 2YVCA 1C77A 2NBUA 4RCOA 3I63C 1FO4A 3NZSA 2LD9A 4E3CA 3QA8A 5DPRA 1XD3B 2JY6A 3A9KB 1WMHA 4RH6A 2KMMA 4HDOA 2KHWB 2D3GA 1FXIA 1F1HA 3M95A 2ZNVB 1D4BA 1MFWA 4MGIE 2QMTA 4S0RA 2BS3B 4MACA 4Q2JA 1MHHE 4WWOA 3U2SC 2FBWB 1CK1A 2H89B 1CJEA 5AEKB 2RDGA 3X23A 2JXTA 2L0TA 3BYTB 3JSVA 3CF6E 4MJSB 1FCCC 3LXFA 4P16A 2WP9B 2KQ7A 4KGTA 3VRBB 3DBHI 3H7SA 4ZRKA 2EKIA 1QZEA 4ZDVA 1JWMD 1XO3A 1VDVA 2WXOA 3KUDB 2PJHA 4RFBA 1UGJA 3TJPA 3V60A 2GOWA 1K51A 3I3TB 1D6EC 2FCSA 4GSWA 3PREA 2K6DB 1SF0A 3MC8A 2M1MA 2GBRA 4YTPB 1WH3A 4LDTB 1YQBA 3DOWA 5EDSA 2WHIA 5JZEB 1P3QU 2QILA 2DX5B 2ZEQA 4GDLB 4IUMB 1EM7A 2HDEA 2KWUB 4JL9A 1PQSA 5G2NA 2KDEB 1NVID 4K7SA 3ZKJC 3PLVA 2PE6B 2ACZB 2BGFA 4P1BC 2WXFA 2YEPB 2LWPA 3TEZA 2I2YA 2ZVOA 4RM8A 1JWSD 3GS2A 1K8RB 2KJHB 3AEDB 2ONQA 2QSDA 1WGGA 4RGTA 2JRHA 4PK1A 4M0WA 4X57B 1I4HA 1YNTE 3NZ3A 3W2DA 3A4SC 2V3NA 1I35A 2K9XA 4K7UA 2IYDB 3T8MA 5IKCM 3IBEA 3B2GA 3JYUA 2KDFB 3NY5A 4RF0A 1SGHA 1AW7A 1XEEA 1J7CA 2KFKA 2J4XA 4YWGG 2RR9A 2XEWA 2LVOA 1WWTA 3L4PA 1N62A 1ET6A 4N58A 2FIFA 2V3PA 3NUHB 1JWBD 1TBEA 4EEWA 4HPLB 4KKJA 2X38A 1A5RA 1SE3A 4IKGA 5AZHA 3VFKA 4BOSC 1QILA 3DWMA 5AZFA 2EMTA 2KANA 3PRPB 3PV1A 2V9HA 3IFWB 4WURA 1WYWB 4EZKA 3AULA 3RNAC 3PSEB 4W9GA 3GB1A 2W3SA 3FILB 2NBWB 1UGMA 4M02A 4BBNF 1WJUA 4HROA 4ACFA 3PT2B 2L7RA 2MCNB 1ZDVA 1MG4A 1ZW7A 4XX5A 3S2AA 4RGNA 1T0YA 1YOVB 3P42A 2WXRA 2FIDA 1FRRA 3U8ZA 1XQQA 3X0WA 2NTSA 1ENFA 3GE3C 3C8YA 2WDVB 4W9HA 2JZZA 5FR3A 3QCAA 4URKA 1MI0A 2KT7A 3TL5A 3AV8A 2ZW0A 1SE4A 3QARA 1S3SG 2WNMA 4F7ZA 2D2QA 1Y56A 3D32A 3VTVA 5CHVC 2IBIB 1KM7A 2JZPA 4UDUC 2D10A 1C4CA 4A3PA 2KMAA 1YX6B 3AH7A 2V4LA 2LGIA 3ZRCA 2KVRA 3DVNU 4XWTA 5LNK1 4AJWA 1S1QB 4GDLA 3AE4B 2KTRA 1N6ZA 5BMIA 3V61A 1I42A 3ZNGC 2CJNA 5IN7A 3AEEB 4CHKA 4IWPA 1WIAA 3AM9A 5IAAC 4PT5A 3IAM1 3DHIC 4WAFA 1WJNA 4MGKE 2DAJA 1GPXA 4G11A 4IOIE 4US8A 1UWMA 3MHSD 2MRPA 4REZA 2NS5A 2FNJB 4W9LA 2MBBB 2AYOB 2IY0B 2BYEA 3BY4B 3O13A 2BYFA 2PMVA 2KFJA 4ZYSA 1EF5A 2HJ1A 4W9FA 1T0QC 2PVOD 2UYZB 3FKYA 4AP4C 4MGZE 4FBJB 3AE7B 2MX2A 1V5OA 2BS4B 5MPOA 2HE7A 5E6NA 1V1PB 2BBCA 4ZYNA 3WIMA 4EKUA 1E9MA 4HKZE 1UD7A 2C7HA 4XC2A 3QAQA 2EKEC 2PE9A 1WRIA 2IPKD 3Q3OC 1YQ3B 2LFIA 2K1FA 2KAJA 3RN9C 1KRHA 1FNUA 3ZVVA 4GIVA 3FILA 4OZAA 5CHWA 4WJNA 4D2KA 4HPPA 3HVDA 1AARA 3O65B 4B95A 2RPQA 3ZNID 3QX1A 3L0WB 1EWYC 2RGFA 1CZPA 4NAWB 2AQ2B 2M8SA 4DHJB 2N7EA 3N9YC 3PPAA 1PDXA 2C7NB 2UWQA 5C1ZA 5KHQA 3ZDTA 4WJQA 3ML9A 5DPTA 3APDA 3TEYA 4J6IA 2K0PA 3RULA 2L83A 5AZGA 4EOYA 3NJTA 3PHWB 1JCKB 2KVZA 1JW9D 3TSSA 3VUXA 2INCC 2D11A 2G3QB 1C3TA 1RM6C 2L0FA 4ZRIA 2XK5A 4K3BA 4MH0E 1L0YB 1J19A 1I4QA 2M0XA 4L2YA 4USAA 1I4PA 1UUPA 2OJRA 3AN1A 4QAYA 2Y5PA 1MG8A 4XZ4A 3LB8C 4M8NA 1D5XC 4LNKA 1FXAA 4ARCA 2BPSA 3RZFA 2NR2A 5L83A 3VRAB 4BZAA 4CO7A 3JSVB 2KYWA 3ZTDA 2KDMA 4E74A 1HE8A 5EE3A 3QC8B 1YQ4B 3W1SC 1V2YA 3E9SA 3Q6BA 4IM3A 3ZLZA 1ZDXA 5D6JB 5CX3A 1C4AA 2QCZA 1ACCA 2L3ZA 2LXAA 1TS5A 2C60A 3VTWA 3ZW3A 1Q0WB 1C76A 5T8IA 1UBQA 4AS1A 1KLGD 2PIAA 4W9JA 4H2AA 4BVUC 4DHZB 5FR6A 2J0JA 1OQYA 1LFDA 3PZ8A 2BWFA 2BYVE 1HTQA 3I5JC 2LHEA 2OOBB 1V1OA 2W9NA 1QF6A 3V6CB 2WXIA 3ZXRA 4ZHOA 3BVZA 1V81A 2Q5WD 4DDID 3PRMB
chains in the Genus database with same CATH topology
3TMPB 4FHKA 4MJSA 4IWQA 4ANUA 2FCNA 3TJPA 3V60A 2GOWA 1E8WA 2KDIA 4KZCA 2IO2B 3VH4B 3I3TB 2FCSA 4GSWA 3LDZE 2LVQA 3N32A 3PREA 2K6DB 2M1MA 4HK2A 1TGZB 2B3AA 4W9DA 4HDQA 3AI5A 2O6VB 2GBRA 1WH3A 4LDTB 5LLIA 1YQBA 3DOWA 3TCAA 3EECA 5EDSA 5JZEB 1P3QU 2RD0A 4K1RB 2DX5B 1GNUA 3RD2A 2ZEQA 1KLVA 2IO3B 2KLCA 3VXWA 4IC7B 4GDLB 4IUMB 4G0NB 2KJRA 2KWUB 2I1KA 4JL9A 3U7DA 1PQSA 2EMSA 2KDBA 1WI0A 2KDEB 5G2NA 4BKTA 1OTRB 4ANXA 4EZJA 2KTFA 1V80A 4K7SA 3TBLD 3ZKJC 2LRWA 3PLVA 4NAWA 1P1AA 2PE6B 4DDGD 2BGFA 3VUYA 4K81A 3PS6A 5J2RA 3K9OB 2CHWA 1WXMA 2N9EB 2DZIA 4PYUA 1RRBA 3UF8A 2DZJA 1FXTB 2LWPA 2WX1A 2RSUA 2ZVOA 2G45B 3OJ3A 3QIJA 4GU2A 1E8XA 4RM8A 5TR5A 4DDID 2GMIC 5IA7A 5JHBA 1K8RB 3UIOB 3PLUA 3DVGX 2KJHB 1Q1OA 2NCNA 2V1YA 2KFKB 2M17A 2L00B 3L10B 4JGHB 2A5UA 3WAPA 1WGGA 3HM6X 2JRHA 4F1SA 1E7VA 3AU4A 3ZUNA 4FLHA 2N9XA 1SIFA 4I6NB 2JPHA 2DYBA 2YLMA 4BBNC 3AXCA 2ASQA 3BINA 3HHMA 4X57B 2KX0A 3UINB 3IHPC 1GUAB 2LVPA 1G6JA 1WJ6A 5KHOA 2KLGA 2ZPNA 3A4SC 4A20A 1OGWA 1I35A 1Q5WB 4NPNA 5CHFA 4II2B 3KYCD 4K7UA 2ZCBA 1WY8A 2LI5A 2IYDB 4FN2A 3UGBB 4CYEA 2AL6A 3CSFA 3L54A 4GOCA 3T8MA 3IBEA 3JYUA 3NY5A 2KDFB 2WYQA 2V3SA 2WWZA 1SGHA 3K9PB 2BKFA 2KFKA 3ZRFA 3DVNV 5BO4B 3L13A 3GZNI 2RR9A 2XEWA 2LVOA 4WJOA 5C23A 4G50A 2FIFA 2KN5A 1H8CA 1TBEA 3ZO5B 4EEWA 4HPLB 1A5RA 2A4ZA 5JH5C 2L8JA 3W1SA 2MP2B 4KDLB 5AZHA 3VFKA 2LGXA 4BOSC 1R4MI 1C1YB 1NI2A 2NBVB 1GG3A 3R7QA 3PTFC 4W9KA 3KYDD 4NJ6A 3ONSA 5AZFA 2EMTA 2MWSB 4ASWC 5E6OA 3A4RA 2KANA 2LGYA 3A1QB 3DBLI 3ALBA 3PRPB 3PV1A 3IFWB 4DHJD 1WYWB 4EZKA 2BF8B 2MBEA 3AULA 3CSTA 4II3B 3VUWA 2KC2A 3PSEB 2K8BA 2MLBA 4W9GA 3UQAA 4NJ7A 3L16A 1VD2A 4ICVA 2VRRB 4GB9A 4I6LB 4NQLB 5DCNA 2NBWB 1UH6A 2L05A 3WAOA 1UELA 3KW5B 1UGMA 2JF5A 4KV2A 2KOXA 2G4SA 4BBNF 4HLEA 1J0GA 1WZ3A 1WJUA 3RYTA 2CR5A 4OVUA 3PT2B 2L7RA 1JRUA 3DPDA 2XBBC 2MCNB 3ZNZB 1ZW7A 3N30A 1RLFA 3ML8A 4XX5A 4F8CB 3S2AA 2JUOA 1T0YA 2JT4B 4G3XB 3VTUA 2JVCA 1WGRA 2FIDA 4BKGA 1WM3A 4LCDE 1WM2A 4DHZE 4GMVA 3U8ZA 1XQQA 2AEHA 4NNJB 3X0WA 4AOFA 1SE9A 2NPTA 4W9HA 1WZ0A 2JZZA 3WALA 2DYMA 3Q3FA 4K7WA 3QCAA 4W9CA 4URKA 1WF9A 3TL5A 3IG3A 1F9JA 2KZRA 4MDKE 3QARA 4GDKB 3DVGY 1S3SG 4GGQA 1WR1A 2KKCA 3B0AA 4MGYE 3A9JB 4F7ZA 3PHXB 3HK0A 2KD0A 3TIXA 1E90A 3ENEA 2KTRB 2LGDA 4IG7B 1V49A 3DQVA 2D2QA 3D32A 3UIPB 3H7PB 3VTVA 3DCGA 1UBIA 4TKNA 5CHVC 4BKSA 1KJTA 2Z0DB 3MTNB 2IBIB 2GBNA 4FJVB 1KM7A 1VCBA 1Z5SB 2ZCCA 1NBFC 3W1YA 2D10A 2O6VA 3N3KB 4A3PA 2KMAA 2NVUI 3AU5A 1YX6B 3VH3B 2Z0EB 3NZUA 3QQ8B 2V4LA 3ZRCA 1TZ1A 4JLCA 1ISNA 4W9IA 4DBGA 2KVRA 4GDKA 3DVNU 1WRDB 2R2OA 3A9JA 3KH0A 1S1QB 2KWVB 4AJWA 2I1JA 4GDLA 1E8ZA 4FULA 4KDIC 3MJWA 2KTRA 3ZTCA 3H6NA 3V61A 1I42A 4MSQB 2DZKA 2BWES 2LUEA 4HXDA 3ZNGC 2DENB 3H7PA 4BOZB 2HJ8A 4CHKA 4TQ0A 4IWPA 1WIAA 1WE7A 1WXVA 2K6QA 2KC1A 1WX8A 2O2VB 2IO1B 4TUUA 5IAAC 4AWJA 1X1MA 4EZLA 2L76A 1WJNA 4MGKE 2DAJA 4HJKA 2IZVB 1WMHB 2GBJA 1D3ZA 2JZ3B 2DYOA 2CKHB 3NS8A 4G11A 4GN1A 4EUTA 1EUVB 4IM2A 4MELA 3JW0X 2N4FA 1TTNA 4B6WA 3HM3A 2C7MB 2C5LC 3PVLA 3JVZX 3CMMB 2LXCA 1V86A 2DAFA 4IM0A 3MHSD 2MRPA 3Q3JA 5D94A 2DHZA 2MW5A 1YX5B 2NS5A 2REXA 4RM9A 4NQKE 4B9KA 2FNJB 3U30A 4W9LA 2MBBB 4FA6A 2AYOB 2IY0B 2BYEA 2MBHA 3BY4B 2BYFA 4DXAB 2J0MA 4MEMA 2KFJA 1EF5A 4W9FA 4KIKB 3ECIA 4HWIB 2LRUA 1WGHA 1XT9B 1YD8U 2UYZB 4AP4C 2QHOA 1WXAA 4MGZE 4DWFA 2WDTB 4IWOA 3NHEB 4BKSD 4FBJB 5D2MB 2HTHA 2KO3A 3M3JA 2JXXA 3QWZB 4LJPB 4N9F4 3SU8X 4AUQC 2MX2A 2N9PC 1V6EA 1LXDA 1V5OA 4KVGB 4GXBA 2FCMA 3UQBA 3GOEA 5G55A 4EFOA 1V5TA 4WJPA 2O6VD 3RZWC 2HE7A 2ZJDA 5E6NA 2K8CA 3VDZA 2J7QB 3SHQA 4LDTD 2KXJA 2KK8A 4ZYNA 3WIMA 4EKUA 2JWZA 1Y8RC 3OLMD 4JQWC 1P0RA 2ZNVC 1UD7A 1Z2MA 2MP2A 2C7HA 3PRMB 3V6EB 3OJ4B 4XC2A 2BKRB 4HCPB 3QAQA 2EKEC 2PE9A 2AWTA 2KMCA 1WX7A 2C9WB 2KJ6A 2N1WA 3QHTA 1OEYJ 5J17A 3RT3B 1P9DU 1IYFA 2ZZPB 3T9LA 3A1QA 4HVBA 2K1FA 2GBKA 4AJYB 4W9EA 3WANA 3APFA 3M63B 5L95C 3VVWB 5JHAA 1WXSA 3ZVVA 3P2BA 4PYZA 4GIVA 4FJZA 1GC7A 5CHWA 4WJNA 2IY1B 2PPHA 2JRIB 2WX0A 3H9DA 1AARA 3O65B 1NDDA 4LJOB 4PS3A 4TQ1A 2LASA 2R2QA 4WAAA 3VHTC 2RPQA 3ZNID 4B95A 3QX1A 3L0WB 4P7IA 3NOBA 3KVFB 2MA9B 5D7GA 2RGFA 3R7RA 1BT0A 1WE6A 3V62A 4NAWB 1CMXB 3A33B 1IP9A 2KQSA 4PS7A 2M8SA 4DHJB 3R66C 1L7YA 2N7EA 3PPAA 3VQIA 4ANVA 2AL3A 2MSED 1GJZA 2C7NB 2UWQA 1KOTA 5C1ZA 4KZ0A 5KHQA 3SD5A 2XK5B 4JIOU 3ZDTA 1J8CA 4WJQA 3ML9A 1WGYA 5DPTA 2CU1A 5HKHA 3APDA 4J6IA 2CHXA 3RULA 3VAWA 5AZGA 4EOYA 3DDCB 3QJZA 3PHWB 1WGDA 2FCQA 2G4DB 2N1VA 4HCNB 1V9JA 1H4RA 3RUIB 2N7DA 4MM3A 4WWPA 4BFRA 2KWCA 3EHVA 1YJ1A 1P98A 4FJYA 4M0WB 2MQJA 3VUXA 3RCZA 5DPWA 3C0RB 3KUZA 3L08A 1E8YA 5DPSA 2D11A 2G3QB 1WX9A 4OVVA 2MBQA 4PS8A 1IPGA 1WR6E 3DBRI 5CTRC 1C3TA 2FUHB 2L0FA 4ZRIA 4DK5A 3WAMA 2XK5A 3M62B 3PZDA 2HD5B 3KUCB 4MH0E 3HIZA 1J19A 3PRZA 4KSLC 2M0XA 2IO0B 1RAXA 2K39A 2OJRA 4MSMB 1MG8A 1WFYA 3EFUA 4YL8A 2CHZA 3APCA 4NY0A 3B1LX 4XZ4A 3B08A 4WQOB 4TV3A 4FHJA 5LXHA 1R4NI 4M8NA 4IW0A 2YVCA 4KSKC 3ZIMA 1E5WA 2NBUA 3ZDMC 3PGEA 2BPSA 3RZFA 3NZSA 1L2NA 2NR2A 4ZRJA 2LD9A 4E3CA 3QA8A 2O2VA 5DPRA 5L83A 3WA0A 4CO7A 1YIWA 3DBSA 3JSVB 4E71A 2K25A 3OAWA 1XD3B 3ZTDA 2JY6A 1UZXB 2LZ6A 4E74A 3A9KB 1WMHA 1HE8A 5J18A 2KHWB 2KX3A 3QC8B 2D3GA 3EC8A 1LM8B 2Y5BB 4HDOA 3W1SC 4ANWA 1V2YA 2FAZA 3M95A 2ZNVB 4IM3A 3SDLC 3ZLZA 1U4AA 5D6JB 2LJ5A 5CX3A 4MGIE 1EF1A 1WJ4A 2L3ZA 2LXAA 4WWOA 2C60A 3QK0A 3VTWA 3ZW3A 3LJ3A 1Q0WB 3IVFA 5AEKB 1UBQA 2M4NA 2MBOA 2ZVNA 3H1UA 5GMVA 3X23A 3R3MA 2L0TA 4W9JA 4M8MA 3JSVA 4KIKA 4RMAA 4BVUC 3ZNHB 3CF6E 1ZKHA 2DZMA 4MJSB 3A9KA 4DHZB 4HPMB 5FR6A 2ZPYA 2KQ7A 2J0JA 1OQYA 3L17A 1RFAA 2PEAA 1LFDA 4WWNA 5E6PA 2BWFA 2GBMA 3DBHI 2J0KA 3H7SA 4ZRKA 2CS4A 2BYVE 2NPTB 4FADA 1EO6A 4A3OA 1E7UA 4I6PA 4ICUA 1GC6A 2OOBB 2W9NA 1LQBA 3V6CB 2D07B 1QZEA 4ZDVA 2K8HA 2Z59B 1M94A 2KNBA 5LXIB 1V81A 3KUDB 1OEYA 1ZGUB 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMP B;  4FHK A;  4MJS A;  4IWQ A;  4ANU A;  2FCN A;  3TJP A;  3V60 A;  2GOW A;  1E8W A;  2KDI A;  4KZC A;  2IO2 B;  3VH4 B;  3I3T B;  2FCS A;  4GSW A;  3LDZ E;  2LVQ A;  3N32 A;  3PRE A;  2K6D B;  2M1M A;  4HK2 A;  1TGZ B;  2B3A A;  4W9D A;  4HDQ A;  3AI5 A;  2O6V B;  2GBR A;  1WH3 A;  4LDT B;  5LLI A;  1YQB A;  3DOW A;  3TCA A;  3EEC A;  5EDS A;  5JZE B;  1P3Q U;  2RD0 A;  4K1R B;  2DX5 B;  1GNU A;  3RD2 A;  2ZEQ A;  1KLV A;  2IO3 B;  2KLC A;  3VXW A;  4IC7 B;  4GDL B;  4IUM B;  4G0N B;  2KJR A;  2KWU B;  2I1K A;  4JL9 A;  3U7D A;  1PQS A;  2EMS A;  2KDB A;  1WI0 A;  2KDE B;  5G2N A;  4BKT A;  1OTR B;  4ANX A;  4EZJ A;  2KTF A;  1V80 A;  4K7S A;  3TBL D;  3ZKJ C;  2LRW A;  3PLV A;  4NAW A;  1P1A A;  2PE6 B;  4DDG D;  2BGF A;  3VUY A;  4K81 A;  3PS6 A;  5J2R A;  3K9O B;  2CHW A;  1WXM A;  2N9E B;  2DZI A;  4PYU A;  1RRB A;  3UF8 A;  2DZJ A;  1FXT B;  2LWP A;  2WX1 A;  2RSU A;  2ZVO A;  2G45 B;  3OJ3 A;  3QIJ A;  4GU2 A;  1E8X A;  4RM8 A;  5TR5 A;  4DDI D;  2GMI C;  5IA7 A;  5JHB A;  1K8R B;  3UIO B;  3PLU A;  3DVG X;  2KJH B;  1Q1O A;  2NCN A;  2V1Y A;  2KFK B;  2M17 A;  2L00 B;  3L10 B;  4JGH B;  2A5U A;  3WAP A;  1WGG A;  3HM6 X;  2JRH A;  4F1S A;  1E7V A;  3AU4 A;  3ZUN A;  4FLH A;  2N9X A;  1SIF A;  4I6N B;  2JPH A;  2DYB A;  2YLM A;  4BBN C;  3AXC A;  2ASQ A;  3BIN A;  3HHM A;  4X57 B;  2KX0 A;  3UIN B;  3IHP C;  1GUA B;  2LVP A;  1G6J A;  1WJ6 A;  5KHO A;  2KLG A;  2ZPN A;  3A4S C;  4A20 A;  1OGW A;  1I35 A;  1Q5W B;  4NPN A;  5CHF A;  4II2 B;  3KYC D;  4K7U A;  2ZCB A;  1WY8 A;  2LI5 A;  2IYD B;  4FN2 A;  3UGB B;  4CYE A;  2AL6 A;  3CSF A;  3L54 A;  4GOC A;  3T8M A;  3IBE A;  3JYU A;  3NY5 A;  2KDF B;  2WYQ A;  2V3S A;  2WWZ A;  1SGH A;  3K9P B;  2BKF A;  2KFK A;  3ZRF A;  3DVN V;  5BO4 B;  3L13 A;  3GZN I;  2RR9 A;  2XEW A;  2LVO A;  4WJO A;  5C23 A;  4G50 A;  2FIF A;  2KN5 A;  1H8C A;  1TBE A;  3ZO5 B;  4EEW A;  4HPL B;  1A5R A;  2A4Z A;  5JH5 C;  2L8J A;  3W1S A;  2MP2 B;  4KDL B;  5AZH A;  3VFK A;  2LGX A;  4BOS C;  1R4M I;  1C1Y B;  1NI2 A;  2NBV B;  1GG3 A;  3R7Q A;  3PTF C;  4W9K A;  3KYD D;  4NJ6 A;  3ONS A;  5AZF A;  2EMT A;  2MWS B;  4ASW C;  5E6O A;  3A4R A;  2KAN A;  2LGY A;  3A1Q B;  3DBL I;  3ALB A;  3PRP B;  3PV1 A;  3IFW B;  4DHJ D;  1WYW B;  4EZK A;  2BF8 B;  2MBE A;  3AUL A;  3CST A;  4II3 B;  3VUW A;  2KC2 A;  3PSE B;  2K8B A;  2MLB A;  4W9G A;  3UQA A;  4NJ7 A;  3L16 A;  1VD2 A;  4ICV A;  2VRR B;  4GB9 A;  4I6L B;  4NQL B;  5DCN A;  2NBW B;  1UH6 A;  2L05 A;  3WAO A;  1UEL A;  3KW5 B;  1UGM A;  2JF5 A;  4KV2 A;  2KOX A;  2G4S A;  4BBN F;  4HLE A;  1J0G A;  1WZ3 A;  1WJU A;  3RYT A;  2CR5 A;  4OVU A;  3PT2 B;  2L7R A;  1JRU A;  3DPD A;  2XBB C;  2MCN B;  3ZNZ B;  1ZW7 A;  3N30 A;  1RLF A;  3ML8 A;  4XX5 A;  4F8C B;  3S2A A;  2JUO A;  1T0Y A;  2JT4 B;  4G3X B;  3VTU A;  2JVC A;  1WGR A;  2FID A;  4BKG A;  1WM3 A;  4LCD E;  1WM2 A;  4DHZ E;  4GMV A;  3U8Z A;  1XQQ A;  2AEH A;  4NNJ B;  3X0W A;  4AOF A;  1SE9 A;  2NPT A;  4W9H A;  1WZ0 A;  2JZZ A;  3WAL A;  2DYM A;  3Q3F A;  4K7W A;  3QCA A;  4W9C A;  4URK A;  1WF9 A;  3TL5 A;  3IG3 A;  1F9J A;  2KZR A;  4MDK E;  3QAR A;  4GDK B;  3DVG Y;  1S3S G;  4GGQ A;  1WR1 A;  2KKC A;  3B0A A;  4MGY E;  3A9J B;  4F7Z A;  3PHX B;  3HK0 A;  2KD0 A;  3TIX A;  1E90 A;  3ENE A;  2KTR B;  2LGD A;  4IG7 B;  1V49 A;  3DQV A;  2D2Q A;  3D32 A;  3UIP B;  3H7P B;  3VTV A;  3DCG A;  1UBI A;  4TKN A;  5CHV C;  4BKS A;  1KJT A;  2Z0D B;  3MTN B;  2IBI B;  2GBN A;  4FJV B;  1KM7 A;  1VCB A;  1Z5S B;  2ZCC A;  1NBF C;  3W1Y A;  2D10 A;  2O6V A;  3N3K B;  4A3P A;  2KMA A;  2NVU I;  3AU5 A;  1YX6 B;  3VH3 B;  2Z0E B;  3NZU A;  3QQ8 B;  2V4L A;  3ZRC A;  1TZ1 A;  4JLC A;  1ISN A;  4W9I A;  4DBG A;  2KVR A;  4GDK A;  3DVN U;  1WRD B;  2R2O A;  3A9J A;  3KH0 A;  1S1Q B;  2KWV B;  4AJW A;  2I1J A;  4GDL A;  1E8Z A;  4FUL A;  4KDI C;  3MJW A;  2KTR A;  3ZTC A;  3H6N A;  3V61 A;  1I42 A;  4MSQ B;  2DZK A;  2BWE S;  2LUE A;  4HXD A;  3ZNG C;  2DEN B;  3H7P A;  4BOZ B;  2HJ8 A;  4CHK A;  4TQ0 A;  4IWP A;  1WIA A;  1WE7 A;  1WXV A;  2K6Q A;  2KC1 A;  1WX8 A;  2O2V B;  2IO1 B;  4TUU A;  5IAA C;  4AWJ A;  1X1M A;  4EZL A;  2L76 A;  1WJN A;  4MGK E;  2DAJ A;  4HJK A;  2IZV B;  1WMH B;  2GBJ A;  1D3Z A;  2JZ3 B;  2DYO A;  2CKH B;  3NS8 A;  4G11 A;  4GN1 A;  4EUT A;  1EUV B;  4IM2 A;  4MEL A;  3JW0 X;  2N4F A;  1TTN A;  4B6W A;  3HM3 A;  2C7M B;  2C5L C;  3PVL A;  3JVZ X;  3CMM B;  2LXC A;  1V86 A;  2DAF A;  4IM0 A;  3MHS D;  2MRP A;  3Q3J A;  5D94 A;  2DHZ A;  2MW5 A;  1YX5 B;  2NS5 A;  2REX A;  4RM9 A;  4NQK E;  4B9K A;  2FNJ B;  3U30 A;  4W9L A;  2MBB B;  4FA6 A;  2AYO B;  2IY0 B;  2BYE A;  2MBH A;  3BY4 B;  2BYF A;  4DXA B;  2J0M A;  4MEM A;  2KFJ A;  1EF5 A;  4W9F A;  4KIK B;  3ECI A;  4HWI B;  2LRU A;  1WGH A;  1XT9 B;  1YD8 U;  2UYZ B;  4AP4 C;  2QHO A;  1WXA A;  4MGZ E;  4DWF A;  2WDT B;  4IWO A;  3NHE B;  4BKS D;  4FBJ B;  5D2M B;  2HTH A;  2KO3 A;  3M3J A;  2JXX A;  3QWZ B;  4LJP B;  4N9F 4;  3SU8 X;  4AUQ C;  2MX2 A;  2N9P C;  1V6E A;  1LXD A;  1V5O A;  4KVG B;  4GXB A;  2FCM A;  3UQB A;  3GOE A;  5G55 A;  4EFO A;  1V5T A;  4WJP A;  2O6V D;  3RZW C;  2HE7 A;  2ZJD A;  5E6N A;  2K8C A;  3VDZ A;  2J7Q B;  3SHQ A;  4LDT D;  2KXJ A;  2KK8 A;  4ZYN A;  3WIM A;  4EKU A;  2JWZ A;  1Y8R C;  3OLM D;  4JQW C;  1P0R A;  2ZNV C;  1UD7 A;  1Z2M A;  2MP2 A;  2C7H A;  3PRM B;  3V6E B;  3OJ4 B;  4XC2 A;  2BKR B;  4HCP B;  3QAQ A;  2EKE C;  2PE9 A;  2AWT A;  2KMC A;  1WX7 A;  2C9W B;  2KJ6 A;  2N1W A;  3QHT A;  1OEY J;  5J17 A;  3RT3 B;  1P9D U;  1IYF A;  2ZZP B;  3T9L A;  3A1Q A;  4HVB A;  2K1F A;  2GBK A;  4AJY B;  4W9E A;  3WAN A;  3APF A;  3M63 B;  5L95 C;  3VVW B;  5JHA A;  1WXS A;  3ZVV A;  3P2B A;  4PYZ A;  4GIV A;  4FJZ A;  1GC7 A;  5CHW A;  4WJN A;  2IY1 B;  2PPH A;  2JRI B;  2WX0 A;  3H9D A;  1AAR A;  3O65 B;  1NDD A;  4LJO B;  4PS3 A;  4TQ1 A;  2LAS A;  2R2Q A;  4WAA A;  3VHT C;  2RPQ A;  3ZNI D;  4B95 A;  3QX1 A;  3L0W B;  4P7I A;  3NOB A;  3KVF B;  2MA9 B;  5D7G A;  2RGF A;  3R7R A;  1BT0 A;  1WE6 A;  3V62 A;  4NAW B;  1CMX B;  3A33 B;  1IP9 A;  2KQS A;  4PS7 A;  2M8S A;  4DHJ B;  3R66 C;  1L7Y A;  2N7E A;  3PPA A;  3VQI A;  4ANV A;  2AL3 A;  2MSE D;  1GJZ A;  2C7N B;  2UWQ A;  1KOT A;  5C1Z A;  4KZ0 A;  5KHQ A;  3SD5 A;  2XK5 B;  4JIO U;  3ZDT A;  1J8C A;  4WJQ A;  3ML9 A;  1WGY A;  5DPT A;  2CU1 A;  5HKH A;  3APD A;  4J6I A;  2CHX A;  3RUL A;  3VAW A;  5AZG A;  4EOY A;  3DDC B;  3QJZ A;  3PHW B;  1WGD A;  2FCQ A;  2G4D B;  2N1V A;  4HCN B;  1V9J A;  1H4R A;  3RUI B;  2N7D A;  4MM3 A;  4WWP A;  4BFR A;  2KWC A;  3EHV A;  1YJ1 A;  1P98 A;  4FJY A;  4M0W B;  2MQJ A;  3VUX A;  3RCZ A;  5DPW A;  3C0R B;  3KUZ A;  3L08 A;  1E8Y A;  5DPS A;  2D11 A;  2G3Q B;  1WX9 A;  4OVV A;  2MBQ A;  4PS8 A;  1IPG A;  1WR6 E;  3DBR I;  5CTR C;  1C3T A;  2FUH B;  2L0F A;  4ZRI A;  4DK5 A;  3WAM A;  2XK5 A;  3M62 B;  3PZD A;  2HD5 B;  3KUC B;  4MH0 E;  3HIZ A;  1J19 A;  3PRZ A;  4KSL C;  2M0X A;  2IO0 B;  1RAX A;  2K39 A;  2OJR A;  4MSM B;  1MG8 A;  1WFY A;  3EFU A;  4YL8 A;  2CHZ A;  3APC A;  4NY0 A;  3B1L X;  4XZ4 A;  3B08 A;  4WQO B;  4TV3 A;  4FHJ A;  5LXH A;  1R4N I;  4M8N A;  4IW0 A;  2YVC A;  4KSK C;  3ZIM A;  1E5W A;  2NBU A;  3ZDM C;  3PGE A;  2BPS A;  3RZF A;  3NZS A;  1L2N A;  2NR2 A;  4ZRJ A;  2LD9 A;  4E3C A;  3QA8 A;  2O2V A;  5DPR A;  5L83 A;  3WA0 A;  4CO7 A;  1YIW A;  3DBS A;  3JSV B;  4E71 A;  2K25 A;  3OAW A;  1XD3 B;  3ZTD A;  2JY6 A;  1UZX B;  2LZ6 A;  4E74 A;  3A9K B;  1WMH A;  1HE8 A;  5J18 A;  2KHW B;  2KX3 A;  3QC8 B;  2D3G A;  3EC8 A;  1LM8 B;  2Y5B B;  4HDO A;  3W1S C;  4ANW A;  1V2Y A;  2FAZ A;  3M95 A;  2ZNV B;  4IM3 A;  3SDL C;  3ZLZ A;  1U4A A;  5D6J B;  2LJ5 A;  5CX3 A;  4MGI E;  1EF1 A;  1WJ4 A;  2L3Z A;  2LXA A;  4WWO A;  2C60 A;  3QK0 A;  3VTW A;  3ZW3 A;  3LJ3 A;  1Q0W B;  3IVF A;  5AEK B;  1UBQ A;  2M4N A;  2MBO A;  2ZVN A;  3H1U A;  5GMV A;  3X23 A;  3R3M A;  2L0T A;  4W9J A;  4M8M A;  3JSV A;  4KIK A;  4RMA A;  4BVU C;  3ZNH B;  3CF6 E;  1ZKH A;  2DZM A;  4MJS B;  3A9K A;  4DHZ B;  4HPM B;  5FR6 A;  2ZPY A;  2KQ7 A;  2J0J A;  1OQY A;  3L17 A;  1RFA A;  2PEA A;  1LFD A;  4WWN A;  5E6P A;  2BWF A;  2GBM A;  3DBH I;  2J0K A;  3H7S A;  4ZRK A;  2CS4 A;  2BYV E;  2NPT B;  4FAD A;  1EO6 A;  4A3O A;  1E7U A;  4I6P A;  4ICU A;  1GC6 A;  2OOB B;  2W9N A;  1LQB A;  3V6C B;  2D07 B;  1QZE A;  4ZDV A;  2K8H A;  2Z59 B;  1M94 A;  2KNB A;  5LXI B;  1V81 A;  3KUD B;  1OEY A;  1ZGU B;  2PJH A; 
#chains in the Genus database with same CATH topology
 3TMP B;  5IP4 D;  4IWQ A;  1FFV A;  4ANU A;  2FCN A;  3VR8 B;  1E8W A;  2BQQ A;  3LDZ E;  1QKZ A;  1HQR D;  4N6E B;  1YN4 A;  1TGZ B;  5H92 C;  4HDQ A;  3AI5 A;  2KN4 A;  3ABV B;  2VH1 A;  4JPS A;  5LLI A;  3TCA A;  2BYT A;  3RD2 A;  4R3D A;  3VXW A;  3EFC A;  2KJR A;  3B2F A;  2I1K A;  4FXC A;  4EZJ A;  4ANX A;  2D3B A;  1OTR B;  3BZD B;  4OVZ A;  1PFD A;  2B76 B;  4NAW A;  1P1A A;  3RI7 C;  1KLU D;  1JAL A;  4C7Z A;  1P7F A;  2CHW A;  1AWD A;  2DZJ A;  1FXT B;  2WX1 A;  2RSU A;  4GU2 A;  1FRD A;  1E8X A;  2J53 A;  4ZOH C;  3UIO B;  3DVG X;  5D3D A;  4YXD B;  2KFK B;  3WAP A;  3HM6 X;  2JWU A;  3PO0 A;  4FLH A;  3ZUN A;  2N9X A;  4I6N B;  3Q8E A;  3AXC A;  2ASQ A;  3HHM A;  3NG0 A;  1SXT A;  3IHP C;  5KHO A;  2KLG A;  3MFG A;  1K53 A;  4A20 A;  1OGW A;  1Q5W B;  4NPN A;  4II2 B;  3KYC D;  1N5X A;  2ZCB A;  5IO9 A;  4CYE A;  2AL6 A;  1FEH A;  2WYQ A;  2V3S A;  2WXN A;  3AE8 B;  3K9P B;  2BKF A;  5I4D A;  4YSY B;  3GZN I;  3Q8C A;  1TKG A;  3IXS A;  5EE0 A;  2KN5 A;  1H8C A;  1F2R C;  3UI3 A;  5HFY A;  2JYT A;  2A4Z A;  5JH5 C;  2L8J A;  5TSS A;  1QOA A;  4KKI A;  2H88 B;  2M0A A;  1GG3 A;  3PTF C;  2DLB A;  5E6O A;  3A4R A;  3A1Q B;  1E10 A;  3CST A;  3VUW A;  3ZJT A;  2G1E A;  2KWD A;  1DOY A;  1GOZ A;  3L16 A;  4WQM A;  2JYE A;  2JX5 A;  1UEL A;  3KW5 B;  2YEP F;  2JF5 A;  4KV2 A;  2KOX A;  1WZ3 A;  2L32 A;  2CR5 A;  1JRU A;  3T3N A;  2XBB C;  2WXL A;  3N30 A;  1OQQ A;  3VTU A;  1QLB B;  2JVC A;  1WGR A;  4BKG A;  1WM3 A;  4OW0 A;  4LCD E;  3OG5 A;  1V97 A;  3Q14 C;  1L4Z B;  4ZRP A;  4AOF A;  2Y3A A;  3WAL A;  3Q3F A;  2WS3 B;  1L6V A;  1WF9 A;  2HTM E;  2KZR A;  1IUE A;  2FUG 1;  1WR1 A;  2KKC A;  3B0A A;  4MGY E;  3RNC C;  2KD0 A;  4MM3 B;  1E90 A;  2KTR B;  3B9J A;  3DQV A;  1NI3 A;  3DCG A;  4BKS A;  1QQR A;  1VCB A;  3R2I A;  3W1Y A;  2NVU I;  3VH3 B;  4C4V A;  4YTN B;  2LUM A;  3QQ8 B;  1CQV A;  4GDK A;  4GLS C;  1L0V B;  1K52 A;  3BVM A;  3GZN B;  1T0S C;  1E8Z A;  4FUL A;  1QOF A;  3MJW A;  1ZPS A;  2E3T A;  3H6N A;  2BWE S;  2DEN B;  2HJ8 A;  3GE8 C;  2K6Q A;  2O2V B;  1WX8 A;  4XDD A;  2IO1 B;  3TEX A;  4XE0 A;  4AWJ A;  4EZL A;  5FK9 C;  2L76 A;  5HI1 A;  2D3C A;  1YJI A;  4HJK A;  2JZ3 B;  4GN1 A;  1J7A A;  2N7J A;  2C7M B;  1TKE A;  3CMM B;  2XN9 C;  2DAF A;  3SR6 A;  1N60 A;  2REX A;  4B9K A;  4RF1 A;  5BYS A;  1ET9 A;  3U30 A;  2QEJ C;  2MBH A;  2PTL A;  4DXA B;  4MEM A;  5IOI A;  2LRU A;  1WGH A;  1YD8 U;  4DWF A;  2WDT B;  3NHE B;  3AEC B;  2KO3 A;  5H8Y E;  2JXX A;  3U4E G;  3SU8 X;  3H8H A;  4KVG B;  1N63 A;  5G55 A;  1SJE D;  4EFO A;  2O6V D;  3RZW C;  1IBX A;  2ZJD A;  3SHQ A;  2MJD A;  2KK8 A;  2FE8 A;  4WH4 A;  3OLM D;  2ZNV C;  1Z2M A;  3V6E B;  2BKR B;  1F0Z A;  2KMC A;  3DWG C;  2N1W A;  1PGA A;  5J17 A;  3RT3 B;  2ZZP B;  3T9L A;  3A1Q A;  4HVB A;  3MP9 A;  2GBK A;  3RNG C;  1MVK A;  4W9E A;  2PVG C;  1I7H A;  1HTO A;  3VVW B;  2M56 B;  1WXS A;  3AE5 B;  1XLO A;  4PYZ A;  4FJZ A;  2BS2 B;  1T0R C;  5AUI A;  4LJO B;  4TQ1 A;  4WAA A;  2WXP A;  4C56 C;  4DQO C;  2WXM A;  3R7R A;  1BT0 A;  1AN8 A;  4MT5 A;  4LNO A;  1RYJ A;  3V62 A;  2XNA C;  3A33 B;  3DBR B;  2KQS A;  4PS7 A;  3EUB 2;  4HKQ A;  3VQI A;  2SAK A;  4ANV A;  1NEK B;  2IDY A;  4N59 A;  1KOT A;  4WWM A;  1R7S A;  2XK5 B;  4JIO U;  1TJE A;  4LLG M;  5HKH A;  3WCQ A;  2KAC A;  1XLQ A;  1HXY D;  3BK1 A;  2G4D B;  2N1V A;  1TS4 A;  1VZ7 A;  3RUI B;  4MM3 A;  1DOX A;  4WWP A;  1P98 A;  4FJY A;  2RMM A;  2MJ3 A;  1FM0 D;  5DPW A;  3Q8A A;  1E8Y A;  1WX9 A;  1WR6 E;  1QOB A;  1NYQ A;  1J7B A;  1I4G A;  3RNE C;  3AMZ A;  3HIZ A;  3PRZ A;  3RNF C;  1JML A;  1EU3 A;  1JRP A;  4XDC A;  2CHZ A;  3APC A;  4NY0 A;  3B08 A;  4FHJ A;  3NVW A;  1R4N I;  2CU3 A;  3ZIM A;  1ZXH A;  1L2N A;  1EWC A;  4ZRJ A;  2LEK A;  2WQY B;  2O2V A;  2RDH A;  3WA0 A;  3DBS A;  2W54 A;  1UZX B;  1FPY A;  1JWU D;  3R8B A;  4ARI A;  5J18 A;  1N61 A;  3EC8 A;  2UU7 A;  3SDL C;  2BT6 A;  2LJ5 A;  2ZW1 A;  2N0S B;  1I4X A;  2LHD A;  2L52 A;  3Q8B A;  3AE1 B;  3H1U A;  5GMV A;  3E56 A;  1TKY A;  2DZM A;  2ZPY A;  1PGX A;  1RFA A;  1LGR A;  3HVZ A;  1SB3 C;  2GBM A;  2IGH A;  1BXT A;  1VLB A;  2OED A;  4FAD A;  1E7U A;  1QOG A;  1SSN A;  2D07 B;  2K8H A;  2Z59 B;  4WIP A;  2KNB A;  1OEY A;  1ZGU B;  4FHK A;  2KDI A;  1F77 A;  4KGS A;  1MJD A;  1FMA D;  3FC4 A;  4HK2 A;  3AE6 B;  1ZP0 B;  5HG2 A;  1RFK A;  5FKA C;  3BII D;  1KLV A;  2KLC A;  4YTM B;  3W5U B;  4G0N B;  3P4S B;  2LMC A;  1YJJ A;  3U7D A;  1TS2 A;  1DYQ A;  2EMS A;  1WI0 A;  1R4N B;  4A8X C;  2AQ3 B;  3NVY A;  2KTF A;  1V80 A;  2WXH A;  3TBL D;  3NS1 A;  2QJL A;  2LRW A;  1HEZ E;  4DDG D;  1YMH E;  4K81 A;  1SIJ A;  3KQ4 A;  3N20 C;  1WXM A;  2N9E B;  4RGM A;  3QIJ A;  5TR5 A;  1DOI A;  3I9V 1;  2INN E;  5JHB A;  2NCN A;  2VZK D;  2L00 B;  3L10 B;  2A5U A;  4F1S A;  1SIF A;  1YN3 A;  2JPH A;  1TS3 A;  3VR9 B;  3AEB B;  4BBN C;  3BIN A;  1R4M B;  4LK0 M;  1GUA B;  2M19 A;  1WJ6 A;  2JQR B;  2ZPN A;  5C3J B;  4B0M A;  1L6U A;  5D3I B;  1B9R A;  4FN2 A;  1WXQ A;  3L54 A;  3ZQ4 A;  1WGK A;  4RNA A;  1HZ5 A;  3DVN V;  5BO4 B;  3L13 A;  4M01 A;  5C23 A;  2K22 A;  4P1C C;  2K5P A;  3W1S A;  2MP2 B;  2GB1 A;  3SFE B;  1HA5 A;  2NBV B;  1FNV A;  4NJ6 A;  2MWS B;  4ASW C;  2LGY A;  3RNB C;  4LTU A;  2BF8 B;  2MBE A;  1ROE A;  4II3 B;  2KC2 A;  2K8B A;  2MLB A;  3UQA A;  3EA6 A;  1D5Z C;  4NJ7 A;  1VD2 A;  3DHG C;  5DCN A;  3WAO A;  5BMG A;  2GI9 A;  2DBY A;  4HLE A;  4OVU A;  4DXG A;  3ML8 A;  4F8C B;  4LNI A;  4L23 A;  3Q8F A;  4G3X B;  1Q10 A;  4C7Y A;  1WM2 A;  4LNN A;  3RMK C;  4GMV A;  1NEN B;  1WZ0 A;  2DYM A;  1PGB A;  4K7W A;  4XWW A;  1YN5 A;  1QT9 A;  2DWQ A;  3NRZ A;  4C4V B;  3IG3 A;  3HRD D;  5EE9 A;  3Q3M C;  4MDK E;  4GDK B;  3DVG Y;  4GGQ A;  3HK0 A;  1K50 A;  3BVG A;  2LGD A;  3UIP B;  3EGR A;  1UBI A;  4TKN A;  2DNF A;  1KJT A;  3MTN B;  1B1Z A;  2WDQ B;  1KFY B;  1A70 A;  2BB6 A;  2GBN A;  4FJV B;  4IDI A;  4JWU C;  3N3K B;  3U52 E;  2Z0E B;  5AUK A;  4W9I A;  3A9J A;  2KWV B;  2I1J A;  4MSQ B;  4HXD A;  2SEB D;  3H7P A;  4BOZ B;  4TQ0 A;  2KQ4 X;  1WXV A;  2V0G A;  2PW9 A;  1D3Z A;  2GBJ A;  2AX5 A;  2DYO A;  1SJH D;  4MEL A;  2N4F A;  1TTN A;  4B6W A;  3HM3 A;  2L1A A;  2C5L C;  2OHF A;  3PVL A;  1V86 A;  3P63 A;  1IBX B;  4IM0 A;  2QC8 A;  3Q3J A;  1E7P B;  2DHZ A;  2MW5 A;  4NQK E;  4O1N A;  4FA6 A;  2IJ0 A;  3P4P B;  4KIK B;  4HWI B;  2QHO A;  1WXA A;  1XXG A;  2W82 A;  4IWO A;  5D2M B;  3M3J A;  4N9F 4;  3QWZ B;  4LJP B;  1V6E A;  1C78 A;  4JX1 C;  4ITK A;  2FCM A;  3UQB A;  1V5T A;  3ZJU A;  3IAS 1;  2J7Q B;  4LDT D;  2KXJ A;  3R2T A;  1TY0 A;  4DXF A;  4JQW C;  2MP2 A;  4TMA B;  4YT0 B;  1C9F A;  1WX7 A;  2KJ6 A;  2IND C;  1OEY J;  1P9D U;  4AJY B;  3WAN A;  3APF A;  4US9 A;  5G5G A;  2Y5C A;  2N9L A;  3AEF B;  1IGC A;  5E6J A;  2K3U A;  3M63 B;  5G5H A;  3J9C A;  1GC7 A;  1OFF A;  1TT5 B;  2IY1 B;  2PPH A;  2JRI B;  2WX0 A;  2LAS A;  2R2Q A;  3TEW A;  3KWL A;  3NVV A;  2MA9 B;  5D7G A;  1UWX A;  1WE6 A;  1CMX B;  5EE1 A;  1IP9 A;  3R66 C;  1GJZ A;  1J8C A;  1WGY A;  2D5G A;  2CU1 A;  2MH7 A;  1OQR A;  3HUI A;  4AQ7 A;  2FCQ A;  4BFR A;  4HEA 1;  3EHV A;  4ZRQ A;  1YJ1 A;  1MHX A;  2MQJ A;  3RCZ A;  4C80 A;  4OVV A;  5CTR C;  3DBR I;  2FUH B;  4B0E A;  3BYY B;  3WAM A;  1JWA D;  4A55 A;  3T3O A;  4KSL C;  2JSV X;  3KWV A;  2BTE A;  3SFD B;  1VR9 A;  2IO0 B;  2K39 A;  1VZ8 A;  1WFY A;  4YL8 A;  1DGJ A;  2D3A A;  2MJE A;  3B1L X;  4KSK C;  1E5W A;  3ZDM C;  3PGE A;  3AE2 B;  3MC9 A;  1YIW A;  2PLP A;  4E71 A;  2K25 A;  3OAW A;  2LZ6 A;  2V4I B;  4NJC A;  2KX3 A;  3CWI A;  1V8C A;  1LM8 B;  2Y5B B;  3DBH B;  3MHZ A;  4ANW A;  2FAZ A;  1U4A A;  1EF1 A;  1WJ4 A;  3QK0 A;  4A9A A;  3LJ3 A;  4J3O D;  3IVF A;  2JU6 X;  2M4N A;  2MBO A;  2ZVN A;  4S17 A;  3R3M A;  4M8M A;  4KIK A;  4RMA A;  3ZNH B;  2INP E;  1TIF A;  1ZKH A;  1E6E B;  3A9K A;  3FAH A;  4HPM B;  3L17 A;  2PEA A;  4WWN A;  3U7Z A;  3AB5 A;  5E6P A;  2J0K A;  2CS4 A;  2NPT B;  3P1M A;  5BYR A;  1EO6 A;  2BB5 A;  4A3O A;  4I6P A;  4ICU A;  1GC6 A;  3ETR A;  1LQB A;  2VH2 A;  1XLP A;  3AEG B;  1M94 A;  5LXI B;  3PZ7 A;  3Q69 A;  2BW2 A;  2WXG A;  2WGS A;  1FD6 A;  4OHJ A;  1KF6 B;  4MJS A;  4K3C A;  2WDR B;  5HHD G;  1P7E A;  4KZC A;  2IO2 B;  3VH4 B;  4XGA B;  3Q3N C;  3AEA B;  4M00 A;  2LVQ A;  3N32 A;  1I4R A;  1L5P A;  1SBB B;  2B3A A;  4W9D A;  2O6V B;  2X8X X;  4KX6 B;  1PYW D;  4LNF A;  3EEC A;  2RD0 A;  4K1R B;  1GNU A;  1L0X B;  1ZXI A;  2IO3 B;  4IC7 B;  2KDB A;  4BKT A;  1FCL A;  3ZJV A;  1UF0 A;  2R61 A;  2RDB C;  3VUY A;  4OZC A;  3PS6 A;  5J2R A;  3K9O B;  2DZI A;  4PYU A;  1RRB A;  3UF8 A;  4NZL B;  3MJ5 A;  3OJ3 A;  2G45 B;  1TYG B;  3GP7 A;  2GMI C;  5IA7 A;  3PLU A;  1Q1O A;  2V1Y A;  2M17 A;  4JGH B;  1JRO A;  1E7V A;  3AU4 A;  1TY2 A;  2DYB A;  2YLM A;  2I38 A;  2KX0 A;  2E6X A;  3N1X C;  3UIN B;  2LVP A;  4C00 A;  1G6J A;  2WU5 B;  4XYC A;  1GB4 A;  2LGS A;  5CHF A;  1SE2 A;  2W3R A;  1WY8 A;  3CIR B;  1VZ6 A;  2LI5 A;  3RPF C;  3UGB B;  3N1Y C;  3CSF A;  4GOC A;  5C2T B;  2OJW A;  2LJI A;  2WWZ A;  1HZ6 A;  3KLS X;  1BML C;  3ZRF A;  4OZB A;  3Q2A C;  1GB1 A;  4WJO A;  1UNS A;  4G50 A;  3ZO5 B;  3DHH C;  4KDL B;  1GAQ B;  2LGX A;  1R4M I;  1C1Y B;  1NI2 A;  2TSS A;  1T5X D;  3R7Q A;  4W9K A;  2RPV A;  3KYD D;  3ONS A;  3DBL I;  4A6Q A;  3ALB A;  4DHJ D;  1IGD A;  1F2R I;  4NAM A;  2Z8L A;  1ZUD 2;  4ICV A;  1FFU A;  2VRR B;  4GB9 A;  4I6L B;  4NQL B;  1UH6 A;  2L05 A;  3P4R B;  2WU2 B;  3V3X A;  2G4S A;  1J0G A;  3RYT A;  3IT6 B;  2J52 A;  3DPD A;  2WXK A;  3ZNZ B;  4EE2 A;  3W5V B;  1RLF A;  1XF5 L;  2JUO A;  2JT4 B;  1JQ4 A;  1EU4 A;  4DHZ E;  2IGG A;  2AEH A;  4NNJ B;  2MHJ A;  1SE9 A;  2NPT A;  1LO5 D;  2WXJ A;  4W9C A;  3V05 A;  3P4Q B;  1F9J A;  2BVC A;  3URY A;  3A9J B;  3N1Z C;  1TZO A;  2PKO A;  3PHX B;  3TIX A;  4YSZ B;  3ENE A;  4IG7 B;  1V49 A;  3BWU D;  3H7P B;  2W55 A;  2CJO A;  3IT4 B;  1ZE3 D;  2Z0D B;  1NYR A;  1Z5S B;  2ZCC A;  1NBF C;  2GRI A;  4JE3 B;  3RFZ B;  2O6V A;  3AE9 B;  3AU5 A;  4RGO S;  3AE3 B;  3NZU A;  3TUO A;  1VRA B;  1TZ1 A;  4JLC A;  1ISN A;  4DBG A;  1KH0 A;  4L1B A;  3KH0 A;  1WRD B;  2R2O A;  4KDI C;  3ZTC A;  2QDF A;  2DZK A;  2LUE A;  1ESF A;  1E0Z A;  1WE7 A;  2KC1 A;  4TUU A;  2NMQ A;  1X1M A;  1C79 A;  1M4V A;  4MH8 A;  2IZV B;  1WMH B;  1WYG A;  3DBL B;  2CKH B;  3NS8 A;  2J42 A;  4HRS A;  4EUT A;  1EUV B;  4IM2 A;  1KTK A;  3C19 A;  3JW0 X;  3ZYY X;  3JVZ X;  2LXC A;  5D94 A;  4RM9 A;  1YX5 B;  3LYY A;  3I57 A;  1FNW A;  2ICI A;  2J0M A;  3ECI A;  2MEK A;  1XT9 B;  1STE A;  3W9C B;  4BKS D;  1T6B X;  2HTH A;  4AUQ C;  4TSS A;  2N9P C;  1LXD A;  4GXB A;  3SEB A;  3GOE A;  4WJP A;  3NVZ A;  1MPE A;  2VZK B;  3VDZ A;  2K8C A;  2IGD A;  1XCT L;  1F52 A;  2JWZ A;  1Y8R C;  2EEL A;  1P0R A;  3OJ4 B;  5BMH A;  4HCP B;  2AWT A;  2N9K A;  2C9W B;  3QHT A;  1XLN A;  4JWS C;  1IYF A;  1C4P A;  5L95 C;  1L4D B;  5JHA A;  3P2B A;  3ZGZ A;  1V1P A;  5JXV A;  4BAX A;  3H9D A;  1NDD A;  4PS3 A;  3VHT C;  4ZHP A;  1RWS A;  4P7I A;  2WLB A;  3NOB A;  3KVF B;  2AQ1 B;  2WXQ A;  1D5M C;  4CQN A;  4A90 A;  2GLS A;  1FIQ A;  1SEB D;  1L7Y A;  1T3Q A;  1BUI C;  2AL3 A;  2MSE D;  5GXG B;  4KZ0 A;  3ZXV A;  3SD5 A;  2G9H D;  4HJG E;  3MC0 B;  1ZOY B;  4KGR A;  2CHX A;  3VAW A;  2NTT A;  3DDC B;  3QJZ A;  1WGD A;  1PUT A;  1WSP A;  4HCN B;  1V9J A;  1H4R A;  4P6V F;  2N7D A;  2KWC A;  1N5W A;  4M0W B;  3C0R B;  3KUZ A;  3L08 A;  3OWE B;  5DPS A;  4PS8 A;  2MBQ A;  1IPG A;  4DK5 A;  1XCQ L;  3M62 B;  3PZD A;  1VJK A;  2HD5 B;  2ON8 A;  3KUC B;  1RAX A;  5BYQ A;  4MSM B;  3BK2 A;  3EFU A;  1AYF A;  4WQO B;  4TV3 A;  4YSX B;  5LXH A;  2QIE B;  4IW0 A;  2YVC A;  1C77 A;  2NBU A;  4RCO A;  3I63 C;  1FO4 A;  3NZS A;  2LD9 A;  4E3C A;  3QA8 A;  5DPR A;  1XD3 B;  2JY6 A;  3A9K B;  1WMH A;  4RH6 A;  2KMM A;  4HDO A;  2KHW B;  2D3G A;  1FXI A;  1F1H A;  3M95 A;  2ZNV B;  1D4B A;  1MFW A;  4MGI E;  2QMT A;  4S0R A;  2BS3 B;  4MAC A;  4Q2J A;  1MHH E;  4WWO A;  3U2S C;  2FBW B;  1CK1 A;  2H89 B;  1CJE A;  5AEK B;  2RDG A;  3X23 A;  2JXT A;  2L0T A;  3BYT B;  3JSV A;  3CF6 E;  4MJS B;  1FCC C;  3LXF A;  4P16 A;  2WP9 B;  2KQ7 A;  4KGT A;  3VRB B;  3DBH I;  3H7S A;  4ZRK A;  2EKI A;  1QZE A;  4ZDV A;  1JWM D;  1XO3 A;  1VDV A;  2WXO A;  3KUD B;  2PJH A;  4RFB A;  1UGJ A;  3TJP A;  3V60 A;  2GOW A;  1K51 A;  3I3T B;  1D6E C;  2FCS A;  4GSW A;  3PRE A;  2K6D B;  1SF0 A;  3MC8 A;  2M1M A;  2GBR A;  4YTP B;  1WH3 A;  4LDT B;  1YQB A;  3DOW A;  5EDS A;  2WHI A;  5JZE B;  1P3Q U;  2QIL A;  2DX5 B;  2ZEQ A;  4GDL B;  4IUM B;  1EM7 A;  2HDE A;  2KWU B;  4JL9 A;  1PQS A;  5G2N A;  2KDE B;  1NVI D;  4K7S A;  3ZKJ C;  3PLV A;  2PE6 B;  2ACZ B;  2BGF A;  4P1B C;  2WXF A;  2YEP B;  2LWP A;  3TEZ A;  2I2Y A;  2ZVO A;  4RM8 A;  1JWS D;  3GS2 A;  1K8R B;  2KJH B;  3AED B;  2ONQ A;  2QSD A;  1WGG A;  4RGT A;  2JRH A;  4PK1 A;  4M0W A;  4X57 B;  1I4H A;  1YNT E;  3NZ3 A;  3W2D A;  3A4S C;  2V3N A;  1I35 A;  2K9X A;  4K7U A;  2IYD B;  3T8M A;  5IKC M;  3IBE A;  3B2G A;  3JYU A;  2KDF B;  3NY5 A;  4RF0 A;  1SGH A;  1AW7 A;  1XEE A;  1J7C A;  2KFK A;  2J4X A;  4YWG G;  2RR9 A;  2XEW A;  2LVO A;  1WWT A;  3L4P A;  1N62 A;  1ET6 A;  4N58 A;  2FIF A;  2V3P A;  3NUH B;  1JWB D;  1TBE A;  4EEW A;  4HPL B;  4KKJ A;  2X38 A;  1A5R A;  1SE3 A;  4IKG A;  5AZH A;  3VFK A;  4BOS C;  1QIL A;  3DWM A;  5AZF A;  2EMT A;  2KAN A;  3PRP B;  3PV1 A;  2V9H A;  3IFW B;  4WUR A;  1WYW B;  4EZK A;  3AUL A;  3RNA C;  3PSE B;  4W9G A;  3GB1 A;  2W3S A;  3FIL B;  2NBW B;  1UGM A;  4M02 A;  4BBN F;  1WJU A;  4HRO A;  4ACF A;  3PT2 B;  2L7R A;  2MCN B;  1ZDV A;  1MG4 A;  1ZW7 A;  4XX5 A;  3S2A A;  4RGN A;  1T0Y A;  1YOV B;  3P42 A;  2WXR A;  2FID A;  1FRR A;  3U8Z A;  1XQQ A;  3X0W A;  2NTS A;  1ENF A;  3GE3 C;  3C8Y A;  2WDV B;  4W9H A;  2JZZ A;  5FR3 A;  3QCA A;  4URK A;  1MI0 A;  2KT7 A;  3TL5 A;  3AV8 A;  2ZW0 A;  1SE4 A;  3QAR A;  1S3S G;  2WNM A;  4F7Z A;  2D2Q A;  1Y56 A;  3D32 A;  3VTV A;  5CHV C;  2IBI B;  1KM7 A;  2JZP A;  4UDU C;  2D10 A;  1C4C A;  4A3P A;  2KMA A;  1YX6 B;  3AH7 A;  2V4L A;  2LGI A;  3ZRC A;  2KVR A;  3DVN U;  4XWT A;  5LNK 1;  4AJW A;  1S1Q B;  4GDL A;  3AE4 B;  2KTR A;  1N6Z A;  5BMI A;  3V61 A;  1I42 A;  3ZNG C;  2CJN A;  5IN7 A;  3AEE B;  4CHK A;  4IWP A;  1WIA A;  3AM9 A;  5IAA C;  4PT5 A;  3IAM 1;  3DHI C;  4WAF A;  1WJN A;  4MGK E;  2DAJ A;  1GPX A;  4G11 A;  4IOI E;  4US8 A;  1UWM A;  3MHS D;  2MRP A;  4REZ A;  2NS5 A;  2FNJ B;  4W9L A;  2MBB B;  2AYO B;  2IY0 B;  2BYE A;  3BY4 B;  3O13 A;  2BYF A;  2PMV A;  2KFJ A;  4ZYS A;  1EF5 A;  2HJ1 A;  4W9F A;  1T0Q C;  2PVO D;  2UYZ B;  3FKY A;  4AP4 C;  4MGZ E;  4FBJ B;  3AE7 B;  2MX2 A;  1V5O A;  2BS4 B;  5MPO A;  2HE7 A;  5E6N A;  1V1P B;  2BBC A;  4ZYN A;  3WIM A;  4EKU A;  1E9M A;  4HKZ E;  1UD7 A;  2C7H A;  4XC2 A;  3QAQ A;  2EKE C;  2PE9 A;  1WRI A;  2IPK D;  3Q3O C;  1YQ3 B;  2LFI A;  2K1F A;  2KAJ A;  3RN9 C;  1KRH A;  1FNU A;  3ZVV A;  4GIV A;  3FIL A;  4OZA A;  5CHW A;  4WJN A;  4D2K A;  4HPP A;  3HVD A;  1AAR A;  3O65 B;  4B95 A;  2RPQ A;  3ZNI D;  3QX1 A;  3L0W B;  1EWY C;  2RGF A;  1CZP A;  4NAW B;  2AQ2 B;  2M8S A;  4DHJ B;  2N7E A;  3N9Y C;  3PPA A;  1PDX A;  2C7N B;  2UWQ A;  5C1Z A;  5KHQ A;  3ZDT A;  4WJQ A;  3ML9 A;  5DPT A;  3APD A;  3TEY A;  4J6I A;  2K0P A;  3RUL A;  2L83 A;  5AZG A;  4EOY A;  3NJT A;  3PHW B;  1JCK B;  2KVZ A;  1JW9 D;  3TSS A;  3VUX A;  2INC C;  2D11 A;  2G3Q B;  1C3T A;  1RM6 C;  2L0F A;  4ZRI A;  2XK5 A;  4K3B A;  4MH0 E;  1L0Y B;  1J19 A;  1I4Q A;  2M0X A;  4L2Y A;  4USA A;  1I4P A;  1UUP A;  2OJR A;  3AN1 A;  4QAY A;  2Y5P A;  1MG8 A;  4XZ4 A;  3LB8 C;  4M8N A;  1D5X C;  4LNK A;  1FXA A;  4ARC A;  2BPS A;  3RZF A;  2NR2 A;  5L83 A;  3VRA B;  4BZA A;  4CO7 A;  3JSV B;  2KYW A;  3ZTD A;  2KDM A;  4E74 A;  1HE8 A;  5EE3 A;  3QC8 B;  1YQ4 B;  3W1S C;  1V2Y A;  3E9S A;  3Q6B A;  4IM3 A;  3ZLZ A;  1ZDX A;  5D6J B;  5CX3 A;  1C4A A;  2QCZ A;  1ACC A;  2L3Z A;  2LXA A;  1TS5 A;  2C60 A;  3VTW A;  3ZW3 A;  1Q0W B;  1C76 A;  5T8I A;  1UBQ A;  4AS1 A;  1KLG D;  2PIA A;  4W9J A;  4H2A A;  4BVU C;  4DHZ B;  5FR6 A;  2J0J A;  1OQY A;  1LFD A;  3PZ8 A;  2BWF A;  2BYV E;  1HTQ A;  3I5J C;  2LHE A;  2OOB B;  1V1O A;  2W9N A;  1QF6 A;  3V6C B;  2WXI A;  3ZXR A;  4ZHO A;  3BVZ A;  1V81 A;  2Q5W D;  4DDI D;  3PRM B; 
#chains in the Genus database with same CATH homology
 3TMP B;  4FHK A;  4MJS A;  4IWQ A;  4ANU A;  2FCN A;  3TJP A;  3V60 A;  2GOW A;  1E8W A;  2KDI A;  4KZC A;  2IO2 B;  3VH4 B;  3I3T B;  2FCS A;  4GSW A;  3LDZ E;  2LVQ A;  3N32 A;  3PRE A;  2K6D B;  2M1M A;  4HK2 A;  1TGZ B;  2B3A A;  4W9D A;  4HDQ A;  3AI5 A;  2O6V B;  2GBR A;  1WH3 A;  4LDT B;  5LLI A;  1YQB A;  3DOW A;  3TCA A;  3EEC A;  5EDS A;  5JZE B;  1P3Q U;  2RD0 A;  4K1R B;  2DX5 B;  1GNU A;  3RD2 A;  2ZEQ A;  1KLV A;  2IO3 B;  2KLC A;  3VXW A;  4IC7 B;  4GDL B;  4IUM B;  4G0N B;  2KJR A;  2KWU B;  2I1K A;  4JL9 A;  3U7D A;  1PQS A;  2EMS A;  2KDB A;  1WI0 A;  2KDE B;  5G2N A;  4BKT A;  1OTR B;  4ANX A;  4EZJ A;  2KTF A;  1V80 A;  4K7S A;  3TBL D;  3ZKJ C;  2LRW A;  3PLV A;  4NAW A;  1P1A A;  2PE6 B;  4DDG D;  2BGF A;  3VUY A;  4K81 A;  3PS6 A;  5J2R A;  3K9O B;  2CHW A;  1WXM A;  2N9E B;  2DZI A;  4PYU A;  1RRB A;  3UF8 A;  2DZJ A;  1FXT B;  2LWP A;  2WX1 A;  2RSU A;  2ZVO A;  2G45 B;  3OJ3 A;  3QIJ A;  4GU2 A;  1E8X A;  4RM8 A;  5TR5 A;  4DDI D;  2GMI C;  5IA7 A;  5JHB A;  1K8R B;  3UIO B;  3PLU A;  3DVG X;  2KJH B;  1Q1O A;  2NCN A;  2V1Y A;  2KFK B;  2M17 A;  2L00 B;  3L10 B;  4JGH B;  2A5U A;  3WAP A;  1WGG A;  3HM6 X;  2JRH A;  4F1S A;  1E7V A;  3AU4 A;  3ZUN A;  4FLH A;  2N9X A;  1SIF A;  4I6N B;  2JPH A;  2DYB A;  2YLM A;  4BBN C;  3AXC A;  2ASQ A;  3BIN A;  3HHM A;  4X57 B;  2KX0 A;  3UIN B;  3IHP C;  1GUA B;  2LVP A;  1G6J A;  1WJ6 A;  5KHO A;  2KLG A;  2ZPN A;  3A4S C;  4A20 A;  1OGW A;  1I35 A;  1Q5W B;  4NPN A;  5CHF A;  4II2 B;  3KYC D;  4K7U A;  2ZCB A;  1WY8 A;  2LI5 A;  2IYD B;  4FN2 A;  3UGB B;  4CYE A;  2AL6 A;  3CSF A;  3L54 A;  4GOC A;  3T8M A;  3IBE A;  3JYU A;  3NY5 A;  2KDF B;  2WYQ A;  2V3S A;  2WWZ A;  1SGH A;  3K9P B;  2BKF A;  2KFK A;  3ZRF A;  3DVN V;  5BO4 B;  3L13 A;  3GZN I;  2RR9 A;  2XEW A;  2LVO A;  4WJO A;  5C23 A;  4G50 A;  2FIF A;  2KN5 A;  1H8C A;  1TBE A;  3ZO5 B;  4EEW A;  4HPL B;  1A5R A;  2A4Z A;  5JH5 C;  2L8J A;  3W1S A;  2MP2 B;  4KDL B;  5AZH A;  3VFK A;  2LGX A;  4BOS C;  1R4M I;  1C1Y B;  1NI2 A;  2NBV B;  1GG3 A;  3R7Q A;  3PTF C;  4W9K A;  3KYD D;  4NJ6 A;  3ONS A;  5AZF A;  2EMT A;  2MWS B;  4ASW C;  5E6O A;  3A4R A;  2KAN A;  2LGY A;  3A1Q B;  3DBL I;  3ALB A;  3PRP B;  3PV1 A;  3IFW B;  4DHJ D;  1WYW B;  4EZK A;  2BF8 B;  2MBE A;  3AUL A;  3CST A;  4II3 B;  3VUW A;  2KC2 A;  3PSE B;  2K8B A;  2MLB A;  4W9G A;  3UQA A;  4NJ7 A;  3L16 A;  1VD2 A;  4ICV A;  2VRR B;  4GB9 A;  4I6L B;  4NQL B;  5DCN A;  2NBW B;  1UH6 A;  2L05 A;  3WAO A;  1UEL A;  3KW5 B;  1UGM A;  2JF5 A;  4KV2 A;  2KOX A;  2G4S A;  4BBN F;  4HLE A;  1J0G A;  1WZ3 A;  1WJU A;  3RYT A;  2CR5 A;  4OVU A;  3PT2 B;  2L7R A;  1JRU A;  3DPD A;  2XBB C;  2MCN B;  3ZNZ B;  1ZW7 A;  3N30 A;  1RLF A;  3ML8 A;  4XX5 A;  4F8C B;  3S2A A;  2JUO A;  1T0Y A;  2JT4 B;  4G3X B;  3VTU A;  2JVC A;  1WGR A;  2FID A;  4BKG A;  1WM3 A;  4LCD E;  1WM2 A;  4DHZ E;  4GMV A;  3U8Z A;  1XQQ A;  2AEH A;  4NNJ B;  3X0W A;  4AOF A;  1SE9 A;  2NPT A;  4W9H A;  1WZ0 A;  2JZZ A;  3WAL A;  2DYM A;  3Q3F A;  4K7W A;  3QCA A;  4W9C A;  4URK A;  1WF9 A;  3TL5 A;  3IG3 A;  1F9J A;  2KZR A;  4MDK E;  3QAR A;  4GDK B;  3DVG Y;  1S3S G;  4GGQ A;  1WR1 A;  2KKC A;  3B0A A;  4MGY E;  3A9J B;  4F7Z A;  3PHX B;  3HK0 A;  2KD0 A;  3TIX A;  1E90 A;  3ENE A;  2KTR B;  2LGD A;  4IG7 B;  1V49 A;  3DQV A;  2D2Q A;  3D32 A;  3UIP B;  3H7P B;  3VTV A;  3DCG A;  1UBI A;  4TKN A;  5CHV C;  4BKS A;  1KJT A;  2Z0D B;  3MTN B;  2IBI B;  2GBN A;  4FJV B;  1KM7 A;  1VCB A;  1Z5S B;  2ZCC A;  1NBF C;  3W1Y A;  2D10 A;  2O6V A;  3N3K B;  4A3P A;  2KMA A;  2NVU I;  3AU5 A;  1YX6 B;  3VH3 B;  2Z0E B;  3NZU A;  3QQ8 B;  2V4L A;  3ZRC A;  1TZ1 A;  4JLC A;  1ISN A;  4W9I A;  4DBG A;  2KVR A;  4GDK A;  3DVN U;  1WRD B;  2R2O A;  3A9J A;  3KH0 A;  1S1Q B;  2KWV B;  4AJW A;  2I1J A;  4GDL A;  1E8Z A;  4FUL A;  4KDI C;  3MJW A;  2KTR A;  3ZTC A;  3H6N A;  3V61 A;  1I42 A;  4MSQ B;  2DZK A;  2BWE S;  2LUE A;  4HXD A;  3ZNG C;  2DEN B;  3H7P A;  4BOZ B;  2HJ8 A;  4CHK A;  4TQ0 A;  4IWP A;  1WIA A;  1WE7 A;  1WXV A;  2K6Q A;  2KC1 A;  1WX8 A;  2O2V B;  2IO1 B;  4TUU A;  5IAA C;  4AWJ A;  1X1M A;  4EZL A;  2L76 A;  1WJN A;  4MGK E;  2DAJ A;  4HJK A;  2IZV B;  1WMH B;  2GBJ A;  1D3Z A;  2JZ3 B;  2DYO A;  2CKH B;  3NS8 A;  4G11 A;  4GN1 A;  4EUT A;  1EUV B;  4IM2 A;  4MEL A;  3JW0 X;  2N4F A;  1TTN A;  4B6W A;  3HM3 A;  2C7M B;  2C5L C;  3PVL A;  3JVZ X;  3CMM B;  2LXC A;  1V86 A;  2DAF A;  4IM0 A;  3MHS D;  2MRP A;  3Q3J A;  5D94 A;  2DHZ A;  2MW5 A;  1YX5 B;  2NS5 A;  2REX A;  4RM9 A;  4NQK E;  4B9K A;  2FNJ B;  3U30 A;  4W9L A;  2MBB B;  4FA6 A;  2AYO B;  2IY0 B;  2BYE A;  2MBH A;  3BY4 B;  2BYF A;  4DXA B;  2J0M A;  4MEM A;  2KFJ A;  1EF5 A;  4W9F A;  4KIK B;  3ECI A;  4HWI B;  2LRU A;  1WGH A;  1XT9 B;  1YD8 U;  2UYZ B;  4AP4 C;  2QHO A;  1WXA A;  4MGZ E;  4DWF A;  2WDT B;  4IWO A;  3NHE B;  4BKS D;  4FBJ B;  5D2M B;  2HTH A;  2KO3 A;  3M3J A;  2JXX A;  3QWZ B;  4LJP B;  4N9F 4;  3SU8 X;  4AUQ C;  2MX2 A;  2N9P C;  1V6E A;  1LXD A;  1V5O A;  4KVG B;  4GXB A;  2FCM A;  3UQB A;  3GOE A;  5G55 A;  4EFO A;  1V5T A;  4WJP A;  2O6V D;  3RZW C;  2HE7 A;  2ZJD A;  5E6N A;  2K8C A;  3VDZ A;  2J7Q B;  3SHQ A;  4LDT D;  2KXJ A;  2KK8 A;  4ZYN A;  3WIM A;  4EKU A;  2JWZ A;  1Y8R C;  3OLM D;  4JQW C;  1P0R A;  2ZNV C;  1UD7 A;  1Z2M A;  2MP2 A;  2C7H A;  3PRM B;  3V6E B;  3OJ4 B;  4XC2 A;  2BKR B;  4HCP B;  3QAQ A;  2EKE C;  2PE9 A;  2AWT A;  2KMC A;  1WX7 A;  2C9W B;  2KJ6 A;  2N1W A;  3QHT A;  1OEY J;  5J17 A;  3RT3 B;  1P9D U;  1IYF A;  2ZZP B;  3T9L A;  3A1Q A;  4HVB A;  2K1F A;  2GBK A;  4AJY B;  4W9E A;  3WAN A;  3APF A;  3M63 B;  5L95 C;  3VVW B;  5JHA A;  1WXS A;  3ZVV A;  3P2B A;  4PYZ A;  4GIV A;  4FJZ A;  1GC7 A;  5CHW A;  4WJN A;  2IY1 B;  2PPH A;  2JRI B;  2WX0 A;  3H9D A;  1AAR A;  3O65 B;  1NDD A;  4LJO B;  4PS3 A;  4TQ1 A;  2LAS A;  2R2Q A;  4WAA A;  3VHT C;  2RPQ A;  3ZNI D;  4B95 A;  3QX1 A;  3L0W B;  4P7I A;  3NOB A;  3KVF B;  2MA9 B;  5D7G A;  2RGF A;  3R7R A;  1BT0 A;  1WE6 A;  3V62 A;  4NAW B;  1CMX B;  3A33 B;  1IP9 A;  2KQS A;  4PS7 A;  2M8S A;  4DHJ B;  3R66 C;  1L7Y A;  2N7E A;  3PPA A;  3VQI A;  4ANV A;  2AL3 A;  2MSE D;  1GJZ A;  2C7N B;  2UWQ A;  1KOT A;  5C1Z A;  4KZ0 A;  5KHQ A;  3SD5 A;  2XK5 B;  4JIO U;  3ZDT A;  1J8C A;  4WJQ A;  3ML9 A;  1WGY A;  5DPT A;  2CU1 A;  5HKH A;  3APD A;  4J6I A;  2CHX A;  3RUL A;  3VAW A;  5AZG A;  4EOY A;  3DDC B;  3QJZ A;  3PHW B;  1WGD A;  2FCQ A;  2G4D B;  2N1V A;  4HCN B;  1V9J A;  1H4R A;  3RUI B;  2N7D A;  4MM3 A;  4WWP A;  4BFR A;  2KWC A;  3EHV A;  1YJ1 A;  1P98 A;  4FJY A;  4M0W B;  2MQJ A;  3VUX A;  3RCZ A;  5DPW A;  3C0R B;  3KUZ A;  3L08 A;  1E8Y A;  5DPS A;  2D11 A;  2G3Q B;  1WX9 A;  4OVV A;  2MBQ A;  4PS8 A;  1IPG A;  1WR6 E;  3DBR I;  5CTR C;  1C3T A;  2FUH B;  2L0F A;  4ZRI A;  4DK5 A;  3WAM A;  2XK5 A;  3M62 B;  3PZD A;  2HD5 B;  3KUC B;  4MH0 E;  3HIZ A;  1J19 A;  3PRZ A;  4KSL C;  2M0X A;  2IO0 B;  1RAX A;  2K39 A;  2OJR A;  4MSM B;  1MG8 A;  1WFY A;  3EFU A;  4YL8 A;  2CHZ A;  3APC A;  4NY0 A;  3B1L X;  4XZ4 A;  3B08 A;  4WQO B;  4TV3 A;  4FHJ A;  5LXH A;  1R4N I;  4M8N A;  4IW0 A;  2YVC A;  4KSK C;  3ZIM A;  1E5W A;  2NBU A;  3ZDM C;  3PGE A;  2BPS A;  3RZF A;  3NZS A;  1L2N A;  2NR2 A;  4ZRJ A;  2LD9 A;  4E3C A;  3QA8 A;  2O2V A;  5DPR A;  5L83 A;  3WA0 A;  4CO7 A;  1YIW A;  3DBS A;  3JSV B;  4E71 A;  2K25 A;  3OAW A;  1XD3 B;  3ZTD A;  2JY6 A;  1UZX B;  2LZ6 A;  4E74 A;  3A9K B;  1WMH A;  1HE8 A;  5J18 A;  2KHW B;  2KX3 A;  3QC8 B;  2D3G A;  3EC8 A;  1LM8 B;  2Y5B B;  4HDO A;  3W1S C;  4ANW A;  1V2Y A;  2FAZ A;  3M95 A;  2ZNV B;  4IM3 A;  3SDL C;  3ZLZ A;  1U4A A;  5D6J B;  2LJ5 A;  5CX3 A;  4MGI E;  1EF1 A;  1WJ4 A;  2L3Z A;  2LXA A;  4WWO A;  2C60 A;  3QK0 A;  3VTW A;  3ZW3 A;  3LJ3 A;  1Q0W B;  3IVF A;  5AEK B;  1UBQ A;  2M4N A;  2MBO A;  2ZVN A;  3H1U A;  5GMV A;  3X23 A;  3R3M A;  2L0T A;  4W9J A;  4M8M A;  3JSV A;  4KIK A;  4RMA A;  4BVU C;  3ZNH B;  3CF6 E;  1ZKH A;  2DZM A;  4MJS B;  3A9K A;  4DHZ B;  4HPM B;  5FR6 A;  2ZPY A;  2KQ7 A;  2J0J A;  1OQY A;  3L17 A;  1RFA A;  2PEA A;  1LFD A;  4WWN A;  5E6P A;  2BWF A;  2GBM A;  3DBH I;  2J0K A;  3H7S A;  4ZRK A;  2CS4 A;  2BYV E;  2NPT B;  4FAD A;  1EO6 A;  4A3O A;  1E7U A;  4I6P A;  4ICU A;  1GC6 A;  2OOB B;  2W9N A;  1LQB A;  3V6C B;  2D07 B;  1QZE A;  4ZDV A;  2K8H A;  2Z59 B;  1M94 A;  2KNB A;  5LXI B;  1V81 A;  3KUD B;  1OEY A;  1ZGU B;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...