3ZRCA

Pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zrcA00
1WJUA 5LXIB 3VTVA 2NBVB 4WAAA 1ZW7A 2MBEA 2XEWA 3T9LA 3A4RA 3X0WA 3W1SA 1XT9B 1EUVB 4MJSA 5J18A 3M62B 2RGFA 1WI0A 4MH0E 4DHZB 3HM6X 4GB9A 1E8ZA 1E8WA 1I42A 3GOEA 4HJKA 4AJWA 3DBLI 3DVGY 4ZDVA 1LM8B 2K6QA 3KH0A 4DDID 4EFOA 2KWUB 4HPLB 4I6PA 2BGFA 4HWIB 5C23A 1CMXB 1KM7A 5AEKB 2D2QA 4HXDA 3VQIA 1V86A 3IVFA 4TQ1A 1WIAA 1ZKHA 2YLMA 5E6NA 3RCZA 1MG8A 4MM3A 1V80A 2LGXA 2LRWA 5JHBA 3N3KB 4WJOA 3JYUA 5J17A 2AL6A 2RPQA 2KFJA 2MRPA 2A5UA 4W9IA 4EZKA 4FADA 2J7QB 4W9GA 1RFAA 4M8NA 1J0GA 3AULA 4NJ7A 1NDDA 2DZKA 3M63B 2FCNA 2A4ZA 3R3MA 1G6JA 2GBRA 2V1YA 3OJ3A 2BF8B 2MP2A 3QA8A 4DDGD 2LZ6A 3WAMA 1YX5B 2ZCBA 4ANVA 3VDZA 1SIFA 1F9JA 4WQOB 1WXMA 3WALA 1LXDA 1V2YA 3DBSA 4YL8A 1WF9A 3PT2B 4RM8A 2NBUA 5TR5A 2IO2B 2MBQA 2YVCA 2NS5A 2FIFA 3UIPB 4A3OA 5CTRC 2NR2A 3ZKJC 3UQBA 4FN2A 1KLVA 2MWSB 3EHVA 4ZRJA 4LDTB 1HE8A 3OAWA 3PSEB 2KJRA 4IWOA 5E6PA 4EOYA 1OQYA 2EMTA 2IYDB 3L16A 2GBMA 2KVRA 3V61A 1C3TA 4W9HA 1PQSA 4EZLA 3V6CB 3TL5A 3RZFA 3SD5A 3QWZB 3HHMA 2JPHA 3NS8A 2M17A 4NNJB 3I3TB 1WYWB 1V49A 3U7DA 5LXHA 4W9KA 4X57B 1TTNA 1TBEA 2AWTA 1WH3A 3H1UA 2FNJB 2BKFA 2JRIB 1GJZA 3DVGX 1GC7A 2KTRA 1WE7A 3CSTA 3WAPA 5GMVA 1Z2MA 2KWCA 2ZPNA 1V81A 4IWPA 2K6DB 2C5LC 2LWPA 1J8CA 2CR5A 4ZRKA 4W9LA 4G3XB 1WJ6A 2GBNA 2CKHB 1WMHA 5D94A 4MGKE 2KO3A 2ZNVB 3H7PB 1EF5A 3PHWB 2CS4A 2O6VA 2B3AA 2RR9A 4FJYA 4WWNA 4MGZE 5DPTA 2HD5B 4J6IA 2K39A 4IG7B 4IUMB 2M0XA 3N30A 3U30A 3ZIMA 1V5TA 4HCPB 3EECA 1E7UA 2EMSA 4MGIE 3H6NA 1VCBA 2ASQA 1GC6A 2L05A 1E90A 1WGYA 4OVUA 2BYVE 2N7EA 4K7UA 3V62A 2M8SA 2G45B 4M8MA 2AYOB 5D2MB 1EF1A 3NY5A 4DK5A 4EUTA 2ZJDA 2D3GA 3PLUA 3RZWC 4AP4C 1WJNA 5DPRA 4HVBA 2M1MA 3UIOB 3R7QA 3ZO5B 4DBGA 4JLCA 4PS7A 1IP9A 3ZRCA 4E3CA 2MCNB 2CU1A 2Z0DB 3KYDD 4IM3A 1YD8U 2C7NB 2J0MA 1NBFC 5BO4B 4A3PA 3KUDB 3S2AA 3WIMA 2BYEA 4GDLA 3PTFC 3ML9A 4AUQC 1H4RA 3WAOA 1LQBA 2MA9B 1X1MA 1YJ1A 1V6EA 2O6VB 3IHPC 4GXBA 2KFKA 2LRUA 4F7ZA 5E6OA 2KJHB 1ZGUB 3KW5B 3JSVB 1M94A 3ONSA 2DX5B 2NBWB 3VUXA 3L17A 3APDA 2KC2A 3EC8A 1Q1OA 2CHZA 4DHJD 1T0YA 2BWFA 2GOWA 3K9OB 3QJZA 2K8HA 5DPSA 1WJ4A 3JW0X 4GGQA 4ANUA 3QARA 5AZHA 2KMAA 1WGRA 4BBNF 3TJPA 2L0TA 4NQLB 5KHQA 5G2NA 3N32A 4TUUA 3EFUA 1FXTB 4KDIC 4NAWA 2NPTA 1E7VA 4BBNC 2G4DB 3C0RB 4GDKB 4XC2A 2DAJA 2MSED 3AXCA 4FHJA 4DXAB 3OJ4B 4WJQA 2KDFB 3DPDA 3P2BA 3QK0A 4FBJB 3ENEA 2NVUI 4KIKA 4K1RB 1AARA 1UGMA 1P1AA 4I6LB 4BKSD 4IM2A 3ZVVA 2G4SA 2K8BA 1GUAB 3CSFA 4MJSB 1NI2A 3D32A 2EKEC 4RMAA 4GMVA 4A20A 2WWZA 1WRDB 3SDLC 3PS6A 2JF5A 2K25A 4TQ0A 1SGHA 3NZUA 3OLMD 1UZXB 4G50A 2DAFA 3PGEA 4TKNA 4B95A 4IWQA 3L54A 3A4SC 3ZLZA 5JHAA 3CF6E 1WY8A 4HK2A 4NY0A 1R4NI 4KZCA 1ISNA 2N9EB 4RM9A 4W9DA 1U4AA 3QX1A 2DENB 2J0JA 3ZW3A 2BKRB 3VVWB 5D6JB 4URKA 3ML8A 3DBRI 1E5WA 4W9FA 2KMCA 2NPTB 4NAWB 3UF8A 3A9JA 4KSKC 4DWFA 3BY4B 2L0FA 4WJNA 1S1QB 1YQBA 4IM0A 3PLVA 2MLBA 3VUYA 2KHWB 3PZDA 5FR6A 2I1JA 2MP2B 2FIDA 2N7DA 2IO1B 3U8ZA 1WGDA 4TV3A 5AZGA 4GSWA 4PYZA 1Q0WB 2N4FA 3DQVA 4ZYNA 5L83A 2LXCA 2HTHA 5IAAC 2G3QB 2XK5A 3PHXB 4NQKE 2ZZPB 4ANXA 3H9DA 1Z5SB 1VD2A 2QHOA 4MDKE 1P0RA 1QZEA 3WA0A 4BKGA 3NZSA 1YIWA 4N9F4 4BKSA 1K8RB 3TIXA 3MTNB 4AWJA 3BINA 1I35A 1RLFA 2KJ6A 2KN5A 2JZ3B 3APCA 2GBJA 2LXAA 2MBOA 1RRBA 1UBQA 2PJHA 3PPAA 2LGYA 3V6EB 3KYCD 2KLCA 2N9PC 1IPGA 3B0AA 1H8CA 1A5RA 2MW5A 1UELA 3GZNI 2N9XA 5CHFA 2KQ7A 2JY6A 3QAQA 1WZ0A 3RYTA 3NHEB 1LFDA 2LVQA 4ICUA 3CMMB 3A9JB 2LGDA 2O2VA 2KD0A 3SHQA 3X23A 3W1YA 3TMPB 3AU4A 1WZ3A 4II2B 2RSUA 4B9KA 5HKHA 3ZDTA 4CHKA 5JZEB 2L76A 4JIOU 1RAXA 1JRUA 2KTRB 3PRPB 2MBBB 4LDTD 2GBKA 4PYUA 3ZUNA 2MBHA 2ZCCA 3LDZE 2JWZA 3JVZX 2D07B 2L3ZA 2PE9A 3L13A 4WWPA 2KTFA 3RD2A 4LJPB 2N1WA 2WYQA 3MHSD 3ZNZB 1WGHA 4LJOB 3ZRFA 2Z0EB 1WR1A 1WMHB 3B1LX 4WWOA 3RULA 1WX7A 1TZ1A 2LJ5A 3L0WB 3UINB 3DBHI 1WXSA 4BKTA 5AZFA 5L95C 4E74A 2RD0A 3A33B 3VFKA 2V3SA 1GNUA 2C60A 2UWQA 2LASA 5JH5C 3LJ3A 3UGBB 3VUWA 3ECIA 4GU2A 4MELA 3M3JA 2FAZA 4II3B 3DCGA 2KOXA 3VTUA 3VAWA 1L2NA 4KVGB 2VRRB 1OTRB 2AEHA 4BOZB 3HM3A 2KQSA 3KVFB 4ZRIA 1OEYA 3AI5A 1P9DU 2C9WB 1IYFA 3O65B 2JXXA 2CHWA 4F8CB 2DYMA 3RUIB 1D3ZA 2W9NA 3DOWA 3RT3B 2LI5A 3KUCB 2JRHA 3DVNV 2DHZA 3VHTC 3W1SC 4BFRA 3ZTCA 2M4NA 3UQAA 2J0KA 4FJZA 4NPNA 1L7YA 3PREA 2IO0B 2JT4B 2REXA 4W9EA 5D7GA 4HDOA 5G55A 1UBIA 4GDLB 2K1FA 4KZ0A 3KUZA 4K7SA 2DYBA 3ZNHB 2C7HA 3K9PB 2ZPYA 4HCNB 2L8JA 4GIVA 2KFKB 2KDEB 1WXAA 1UH6A 2KZRA 4GOCA 1C1YB 2Y5BB 4FULA 1E8XA 3WANA 2LUEA 4HPMB 3PRZA 4FLHA 3ZNID 2BYFA 2HJ8A 4NJ6A 2L7RA 3Q3JA 4G11A 4AOFA 1WX9A 2IO3B 2OJRA 3IFWB 2HE7A 2KX0A 4JQWC 1EO6A 3NOBA 4JGHB 4E71A 2KK8A 2O6VD 2D10A 2KX3A 2JVCA 2WX1A 1OEYJ 4IW0A 4FJVB 1BT0A 2KWVB 2D11A 2JZZA 3B08A 2DZMA 2PE6B 2FCQA 3APFA 2WDTB 4ANWA 4JL9A 4OVVA 1WXVA 1SE9A 4K7WA 3H7PA 1E8YA 4KDLB 2ZNVC 2AL3A 5LLIA 4FHKA 5EDSA 4KIKB 2PPHA 2WX0A 4PS3A 3QCAA 1KOTA 2KANA 3DVNU 4EZJA 4XX5A 2FUHB 3HIZA 2UYZB 3A1QA 2I1KA 1OGWA 1TGZB 4EKUA 5KHOA 2MQJA 5CHWA 1UD7A 4XZ4A 3HK0A 1XQQA 4G0NB 3MJWA 3Q3FA 2Z59B 5C1ZA 3AU5A 1GG3A 2LD9A 2IZVB 5J2RA 2R2QA 2CHXA 1P3QU 1WFYA 1WGGA 1J19A 2GMIC 2IY0B 2LVOA 2ZEQA 4HLEA 3M95A 2L00B 5IA7A 4AJYB 5DPWA 2BWES 4FA6A 2DZJA 4ICVA 2N1VA 4DHJB 3A9KA 3R66C 3VTWA 1S3SG 3PRMB 1WM3A 2FCSA 1V9JA 1WM2A 2V4LA 1V5OA 2NCNA 4HDQA 5DCNA 3L10B 4KSLC 4P7IA 3TCAA 3ZDMC 3PV1A 4BVUC 4W9JA 3VH3B 2DYOA 3SU8X 2DZIA 4MEMA 3JSVA 3TBLD 1P98A 1WE6A 4I6NB 3IBEA 3VH4B 2LVPA 4K81A 4EEWA 2FCMA 3R7RA 2KDIA 1R4MI 3A1QB 2XBBC 3VXWA 1YX6B 4PS8A 2XK5B 1WR6E 2BPSA 3IG3A 1Q5WB 4DHZE 2IBIB 3QQ8B 4ASWC 2OOBB 4M0WB 3QIJA 4LCDE 2KDBA 2IY1B 2KXJA 2MX2A 2PEAA 4CO7A 2JUOA 3DDCB 4MGYE 3ALBA 4W9CA 3PVLA 4MSMB 3ZTDA 4MSQB 4IC7B 3ZNGC 2KNBA 2ZVNA 4F1SA 2KKCA 3QHTA 3V60A 2KC1A 4WJPA 5CX3A 4GDKA 5CHVC 3L08A 1XD3B 3A9KB 4CYEA 2K8CA 2R2OA 2ZVOA 4GN1A 4KV2A 1WX8A 3T8MA 2KLGA 3QC8B 1KJTA 2O2VB 4BOSC 3H7SA 4B6WA 1Y8RC 2C7MB
chains in the Genus database with same CATH superfamily
1WJUA 2NMQA 4LK0M 1D5XC 3GE3C 3KWLA 1ZXIA 4MJSA 2B76B 5J18A 1NI3A 5G5HA 1E8ZA 3DBLI 2K6QA 4DDID 2KWUB 4I6PA 2BGFA 4HWIB 1CMXB 3VQIA 4TQ1A 5E6NA 4MM3A 2LRWA 4WJOA 2RPQA 2KFJA 4W9IA 1R4MB 1VZ6A 4EZKA 1EWCA 1P7FA 3W9CB 4ZYSA 2BB5A 4M8NA 3BYTB 2V0GA 2MP2A 2RDGA 3QA8A 4DDGD 4BZAA 2INDC 4M02A 4WQOB 3WALA 1LXDA 1SE3A 1OFFA 1XO3A 1UUPA 3Q2AC 2NR2A 3GE8C 4LDTB 1K50A 2KJRA 4IWOA 1MHHE 3V61A 3V6CB 3RNAC 3SR6A 3HHMA 3AE2B 3DBLB 4NNJB 1FNVA 3E56A 1WYWB 4S17A 3NZ3A 1TBEA 1I4PA 1GJZA 3DVGX 3R8BA 1Z2MA 2KWCA 1C77A 1V81A 1ZDVA 2CR5A 4OZBA 2D3AA 4BAXA 1WMHA 5D94A 4MGKE 2KO3A 2ZNVB 3H7PB 4WWNA 2AQ1B 4IG7B 4HRSA 3ZIMA 1E7UA 3BVMA 3Q3OC 1TS4A 4WQMA 5D2MB 1EF1A 2L32A 3RZWC 4AP4C 4C00A 2M1MA 1C4AA 1DOXA 4A8XC 2Z0DB 4ARCA 1YD8U 2RDBC 2KWDA 4HKZE 4IKGA 3KUDB 3WIMA 3EA6A 3MFGA 4AUQC 1LQBA 2W3RA 1HTQA 4RFBA 3IHPC 2LRUA 4F7ZA 1L5PA 3JSVB 3ONSA 2NBWB 3EC8A 3NUHB 2R61A 3E9SA 1TJEA 2FE8A 4DXGA 4ANUA 3Q3MC 3QARA 1WGRA 4BBNF 2WXKA 3AH7A 1MVKA 4NQLB 3SFEB 1FXTB 1TKYA 1KLUD 2KDFB 3DPDA 3QK0A 2NVUI 4KKJA 1C76A 1UGMA 4IM2A 2AQ3B 2K8BA 3CSFA 4MJSB 2WXOA 1JCKB 1IUEA 3AE5B 3SDLC 3NZUA 3OLMD 4WWMA 3PGEA 3L54A 3A4SC 3ZJUA 1WY8A 1YN5A 3N1YC 4KZCA 2KMMA 3L4PA 2DENB 4URKA 1E5WA 2NPTB 2L0FA 1S1QB 3VUYA 4B0MA 1BMLC 2MP2B 1KTKA 3T3OA 3GS2A 1L0VB 1PYWD 4PYZA 4ZYNA 5L83A 2G3QB 3P1MA 4ANXA 1VD2A 1SXTA 4MDKE 3NZSA 1K8RB 2J52A 2JXTA 2WGSA 2MBOA 1DGJA 3VR9B 4XWTA 3GZNI 4ZHOA 2ZW1A 2NTTA 1WZ0A 3A9JB 2JYEA 3TMPB 4OVZA 2RSUA 2BS4B 3ZYYX 4CHKA 3AE1B 4JIOU 3SEBA 2LHDA 4XDCA 4WWPA 4LNIA 4LJPB 4LJOB 4US9A 1WMHB 4WWOA 1ACCA 1L6VA 1ENFA 1SEBD 4BKTA 2DBYA 2RD0A 3VFKA 3ETRA 1DOYA 2QDFA 1Q10A 5JH5C 3UGBB 1Y56A 2BS3B 1OTRB 2Z8LA 3KVFB 4EE2A 1FXIA 3O65B 4C4VB 2W9NA 2LI5A 2DHZA 3VHTC 3W1SC 2WDRB 3UQAA 1TS2A 1JALA 3GZNB 2NTSA 4LNOA 2OEDA 3KUZA 4K7SA 3AMZA 2C7HA 2WXFA 1UH6A 2ZW0A 2KZRA 1JW9D 1E8XA 1JMLA 2IDYA 3Q3JA 4G11A 4AOFA 1WX9A 3P4RB 2BS2B 2HE7A 2XN9C 1EO6A 3NOBA 2QCZA 3NVWA 2O6VD 2D10A 2QMTA 1RWSA 2PE6B 4JL9A 1T5XD 3NJTA 4XWWA 1E8YA 1ET9A 1XLNA 2WX0A 3FC4A 2FUHB 1T3QA 3A1QA 4FXCA 3HK0A 1CZPA 3MJWA 2KT7A 1MI0A 1TY2A 5C1ZA 1MJDA 4KX6B 2IZVB 3URYA 4N59A 4YTMB 1WFYA 3ZQ4A 2CJOA 1WGGA 1J19A 1VJKA 2GMIC 5AUIA 4N6EB 2PVOD 4FA6A 1HXYD 3R66C 2Y3AA 1S3SG 3PRMB 2VZKD 3TEZA 4AQ7A 1WM2A 2LHEA 3ABVB 1V5OA 2NCNA 3V05A 2IGDA 4MEMA 3GP7A 3TBLD 3IBEA 1R4NB 4K81A 2XBBC 1YX6B 1UGJA 3RNCC 4ASWC 4DQOC 3QIJA 1T6BX 4LNNA 4YXDB 1YOVB 2KXJA 2JUOA 2WU5B 3BIID 3ALBA 2BQQA 1C4PA 4OZCA 5CHVC 2MJEA 3A9KB 2K8CA 4GN1A 2KLGA 4B6WA 3GOEA 2C7MB 2XEWA 3BWUD 4OW0A 2HTME 1WXQA 1E8WA 4N58A 3MC8A 1LM8B 4L23A 4HPLB 5BYRA 5C23A 3Q14C 2J53A 4HXDA 1V86A 3PZ7A 1WIAA 1ZKHA 2WXIA 2YLMA 3FILB 1MG8A 1EWYC 4H2AA 3N3KB 5J17A 4C80A 1BXTA 2MRPA 1IBXA 2X38A 4W9GA 1RFAA 3AULA 4NJ7A 3M63B 1G6JA 2WXMA 1YX5B 2ZCBA 2BB6A 4ZHPA 1SIFA 1F0ZA 3DBSA 4ACFA 4YL8A 1WF9A 2NBUA 1JWUD 2K22A 3VRBB 2FIFA 3UIPB 4A3OA 3ZKJC 1XLOA 4FN2A 3KLSX 4ZRJA 3N1XC 4DXFA 3L16A 1FIQA 2PKOA 2KVRA 1FFVA 1C3TA 1PQSA 3RZFA 3QWZB 1ZUD2 4HPPA 3NS8A 4K3BA 3I3TB 1GOZA 1B1ZA 3U7DA 5LXHA 4X57B 3RNFC 2AWTA 1WH3A 3H1UA 3ZXVA 2BKFA 2JRIB 2KTRA 1WE7A 3CSTA 1JQ4A 3WAPA 1CQVA 2JYTA 2C5LC 4ZRKA 3OG5A 1L0YB 4W9LA 1XCTL 2GBNA 4L2YA 3Q3NC 1EF5A 2KACA 4FJYA 4MGZE 5DPTA 4J6IA 2K39A 3P42A 4P6VF 3U30A 3AE4B 4HCPB 2EMSA 1VCBA 2ASQA 1N61A 1WGYA 2L05A 4K7UA 2WDVB 2WXRA 5BMGA 2G45B 2H88B 2D3CA 1EU3A 2IPKD 3TSSA 3PLUA 5DPRA 4HVBA 3R7QA 4ZRPA 4PS7A 2CU1A 4IM3A 2C7NB 1NBFC 1D5ZC 3ML9A 2MA9B 1X1MA 1V6EA 2M0AA 1MFWA 1FCCC 4MACA 1EM7A 4RF1A 1N5XA 1M94A 3VUXA 2V4IB 1Q1OA 5D3DA 4DHJD 2BWFA 2GOWA 3MHZA 3TUOA 3K9OB 3QJZA 3P4SB 2WU2B 4ITKA 1WJ4A 4GGQA 4RGOS 2PMVA 4D2KA 2UU7A 3N32A 4TUUA 1DYQA 2NPTA 4BBNC 2G4DB 3BYYB 1BUIC 1WSPA 4WJQA 3AEEB 2L52A 4KIKA 3ZVVA 2G4SA 1NEKB 5TSSA 2FUG1 1HEZE 1V1PA 1ZE3D 4UDUC 1WGKA 2JF5A 2HDEA 2DAFA 4TKNA 1HQRD 4B95A 3ZLZA 2G1EA 4NY0A 1ISNA 4RM9A 3OWEB 4RNAA 3QX1A 1I4HA 2J0JA 2BKRB 2K9XA 2WP9B 1IBXB 4TMAB 2KMCA 4NAWB 3A9JA 1YN4A 3PZ8A 4IM0A 2MLBA 2FIDA 2N7DA 4TV3A 2LFIA 3DQVA 2LXCA 5IAAC 2LUMA 4CQNA 2XK5A 2ZZPB 1NYRA 2Y5PA 3H9DA 1DOIA 1Z5SB 4M0WA 4N9F4 1YIWA 2QEJC 3TIXA 1EU4A 1A70A 4AWJA 3AEGB 1RRBA 1UBQA 2DLBA 1IPGA 2MW5A 2N9XA 2JX5A 1VZ7A 1LFDA 2LVQA 4NJCA 1K52A 4C4VA 4KGTA 2FBWB 1YNTE 2L76A 5FKAC 3GB1A 1RAXA 2KTRB 2GBKA 1C78A 2D07B 2L3ZA 2KTFA 2N1WA 1ZPSA 3AM9A 4LNKA 1I4GA 2LMCA 1UWXA 3RULA 3DBHI 5AZFA 5L95C 2MJDA 3ZXRA 2LASA 3T3NA 4II3B 2KOXA 3VTUA 1L2NA 1JWMD 2AEHA 4C7ZA 3AI5A 2QC8A 1IYFA 2WXGA 3RNBC 3RUIB 2WHIA 4REZA 3ZTCA 2M4NA 1L7YA 3PREA 2REXA 4RH6A 5D7GA 4W9EA 1UNSA 2ZPYA 3MC9A 2L8JA 2KDEB 1WXAA 5HI1A 4FULA 3WANA 2BYFA 2HJ8A 4NJ6A 2L7RA 1KH0A 2IO3B 2OJRA 1L6UA 2KX0A 3AE9B 3P4QB 1FFUA 2KX3A 2JVCA 4IW0A 4LTUA 3EFCA 2MH7A 1NVID 2FCQA 3APFA 1ZOYB 5H92C 3FAHA 1SE9A 3IAM1 5LLIA 1FMAD 2EKIA 2PIAA 4KIKB 1KOTA 2KANA 3DVNU 2UYZB 1V1PB 2ONQA 2WXNA 2MQJA 2JWUA 5CHWA 1UD7A 2RDHA 1ESFA 3TEWA 3BK2A 1PDXA 3Q3FA 3W5VB 5FK9C 3IT6B 2CHXA 2MEKA 1ZDXA 2SEBD 4AJYB 2BWES 2N1VA 3A9KA 1QKZA 5DCNA 3N20C 4KSLC 3ZDMC 1XEEA 3PV1A 4WH4A 3RN9C 4W9JA 3DWMA 2DZIA 1P98A 4I6NB 3VH4B 2E3TA 2LVPA 2XK5B 3AEAB 3IG3A 4XE0A 4DHZE 2OOBB 4M0WB 2KDBA 2IY1B 3FILA 2MX2A 3DDCB 4W9CA 3PVLA 4A90A 4IC7B 1GPXA 1F2RC 2PW9A 2KNBA 2ZVNA 1MG4A 3V60A 4WJPA 3RI7C 1XD3B 4KV2A 3AN1A 3AEBB 1M4VA 1KJTA 1V1OA 3H7SA 1Y8RC 2NBVB 4WAAA 2MBEA 3A4RA 3X0WA 3W1SA 2RGFA 1WI0A 4DHZB 1N60A 3HM6X 4GB9A 4AJWA 3DVGY 4ZDVA 3KH0A 1FXAA 1RYJA 3BVZA 1KM7A 3LB8C 5AEKB 1KFYB 5I4DA 5LNK1 3JYUA 2A5UA 1GAQB 2J7QB 1ZXHA 4M01A 2BBCA 2PLPA 1NDDA 2A4ZA 4P16A 2GBRA 2BF8B 4RCOA 1QOGA 3WAMA 3MP9A 2AX5A 3VDZA 1F9JA 1V2YA 1HZ6A 4RM8A 3B9JA 2J42A 2N0SB 5CTRC 5GXGB 3UQBA 2I38A 2MWSB 3EHVA 1QF6A 3AE3B 3AB5A 3UI3A 5E6PA 3PSEB 4EOYA 1OQYA 2EMTA 1SE4A 1TIFA 4W9HA 3TL5A 5C2TB 1XLPA 2M17A 1ET6A 1V49A 1TTNA 2XNAC 2WQYB 4MH8A 5GMVA 3ZJVA 4IWPA 2LWPA 1J8CA 1QQRA 1D5MC 2SAKA 1J7AA 4G3XB 2CKHB 1VLBA 2OJWA 2RR9A 4P1BC 2HD5B 2M0XA 3N30A 1F2RI 5BYSA 4OZAA 3Q8CA 1E90A 2BYVE 2N7EA 4WAFA 5IN7A 2M8SA 4RGMA 4M8MA 4ARIA 2AYOB 2WS3B 4AS1A 2CU3A 3ZGZA 1WJNA 3NVVA 2KN4A 1F52A 3UIOB 4DBGA 3ZO5B 2BYTA 3ZRCA 4E3CA 2MCNB 4MT5A 3KYDD 4O1NA 1WRIA 3S2AA 3HVDA 4GDLA 3RNGC 3PTFC 4TSSA 3WAOA 1NYQA 2O6VB 2JZPA 3NRZA 1D6EC 2KJHB 3B2FA 1ZGUB 3KW5B 2ON8A 2DX5B 4HROA 3APDA 1HA5A 1VDVA 4JX1C 1E0ZA 1C9FA 2JSVX 2MHJA 1SJED 3LYYA 3JW0X 4NAMA 4B0EA 1SF0A 2KMAA 3U7ZA 5EE9A 1YQ3B 1P7EA 3EFUA 4NAWA 1E7VA 2MSED 1YJJA 4FHJA 3P2BA 5IO9A 3ENEA 2GLSA 4BKSD 1E7PB 2N9KA 5H8YE 1NI2A 4RGNA 4YSXB 2IJ0A 3WCQA 3AE8B 3EUB2 4A20A 3BVGA 1WRDB 2AQ2B 1UZXB 1C79A 4G50A 2KAJA 5JHAA 4HK2A 1FEHA 2N9EB 4W9DA 1FRRA 2YEPF 5D6JB 2L83A 3ML8A 4W9FA 3UF8A 2OHFA 1TZOA 4IDIA 1YQBA 2HJ1A 1SIJA 3PLVA 2KHWB 3PZDA 5FR6A 2TSSA 2I1JA 2IO1B 1WGDA 1SJHD 1Q0WB 2N4FA 2HTHA 4NQKE 2WXPA 2QHOA 4WIPA 1P0RA 1IGDA 1QZEA 2GI9A 1I35A 1RLFA 1JWBD 2KJ6A 2KN5A 1F1HA 2JZ3B 3APCA 2GBJA 2LXAA 3PPAA 3Q8EA 2PJHA 4A9AA 2LGYA 2KLCA 5E6JA 3B0AA 1H8CA 2GB1A 1TYGB 1UELA 1ZP0B 2JY6A 3HUIA 3CMMB 2LGDA 2KD0A 3SHQA 5HKHA 1QOAA 1WZ3A 1E9MA 3AU4A 4II2B 2INNE 3AEFB 1JRUA 3PRPB 4LDTD 2MBBB 3RPFC 2MBHA 3IXSA 3N1ZC 3LDZE 3DHGC 3RD2A 1KLGD 1FO4A 3MHSD 1T0RC 3ZRFA 4XYCA 1WR1A 1WX7A 2INCC 1TZ1A 4PT5A 2LJ5A 3KWVA 4E74A 1JWSD 2V3SA 2C60A 2UWQA 1PGXA 3LJ3A 5C3JB 3ECIA 3PO0A 2V3PA 2FAZA 2VRRB 4BOZB 3HM3A 4LNFA 1P9DU 2JQRB 2CHWA 5BMIA 4USAA 3RT3B 2JRHA 3DVNV 3RMKC 4BFRA 1GB4A 2J0KA 2WXHA 2ICIA 1YMHE 5G55A 1UBIA 4GDLB 4KZ0A 2BT6A 4HCNB 1FRDA 4GIVA 4A6QA 1AYFA 4GOCA 4IOIE 4GLSC 3PRZA 4FLHA 4KGSA 3ZNID 2W3SA 3TEXA 1RFKA 3IFWB 4JGHB 4E71A 2KK8A 1QOBA 1WYGA 3I5JC 2WDQB 4FJVB 1BT0A 3NS1A 2D11A 2K3UA 4ANWA 1TY0A 2QIEB 4K7WA 4KDLB 1TS3A 1FNUA 2AL3A 2INPE 5EDSA 2PPHA 2ACZB 2KYWA 4ZOHC 4EZJA 4XX5A 1QOFA 4JE3B 2CJNA 1SSNA 3HIZA 2WXLA 2I1KA 1TGZB 4EKUA 5KHOA 4JPSA 1JROA 3HVZA 1XQQA 1I4XA 2Z59B 4YTNB 2LEKA 1P3QU 2I2YA 2IY0B 2LVOA 2ZEQA 1VR9A 5IA7A 2L00B 4DHJB 4OHJA 1PFDA 4M00A 1WM3A 1V9JA 2V4LA 4HDQA 2BVCA 3L10B 4P7IA 3TCAA 4BVUC 3FKYA 4EEWA 2FCMA 2KDIA 1JRPA 3VXWA 1WR6E 2BPSA 2QJLA 2V9HA 4J3OD 3IT4B 4CO7A 2PEAA 4YTPB 4JWUC 4R3DA 4A55A 3ZTDA 3MJ5A 3ZNGC 3P4PB 4F1SA 3QHTA 3BK1A 4GDKA 3L08A 3W5UB 5BMHA 2R2OA 3T8MA 3QC8B 4B9KA 5LXIB 4RF0A 3VTVA 3W2DA 1ZW7A 3T9LA 2DWQA 1XT9B 1EUVB 1XXGA 2RMMA 3M62B 4MH0E 1AWDA 1I42A 4HJKA 1XF5L 5EE0A 4EFOA 4P1CC 2D2QA 1SBBB 3IVFA 1SB3C 3RCZA 3CIRB 1V80A 4YWGG 1FD6A 2LGXA 5JHBA 2AL6A 1TT5B 1GB1A 4FADA 3NVZA 1CK1A 1J0GA 2K0PA 1C4CA 2DZKA 2FCNA 3R3MA 1YQ4B 2V1YA 3DBHB 2W54A 3OJ3A 2V3NA 2LZ6A 2IGGA 5IP4D 4ANVA 1WXMA 1D4BA 2L1AA 1K51A 3EGRA 2DNFA 3PT2B 5TR5A 2IO2B 2MBQA 2YVCA 2NS5A 2WNMA 3AE7B 1QILA 2M19A 2WXQA 1KLVA 1HE8A 4HJGE 3OAWA 5EE1A 4MM3B 1WWTA 2IYDB 1N6ZA 2GBMA 5G5GA 4EZLA 3SD5A 2JPHA 1R7SA 3TEYA 2PTLA 3H8HA 4W9KA 1N63A 1N5WA 2FNJB 1GC7A 2W82A 1AN8A 2ZPNA 2K6DB 1WJ6A 3DWGC 1ROEA 4Q2JA 3PHWB 3MC0B 1OQRA 2CS4A 2O6VA 3VRAB 2B3AA 4ZRQA 4IUMB 4C56C 3AECB 1V5TA 3EECA 4MGIE 3H6NA 3DHIC 1GC6A 4OVUA 3V62A 2MJ3A 4K3CA 3IAS1 4DK5A 3NY5A 4EUTA 2N7JA 2D3GA 2ZJDA 1L4ZB 1CJEA 4JLCA 1IP9A 2W55A 4LLGM 2J0MA 5BO4B 4A3PA 3AEDB 3LXFA 2BYEA 1OQQA 5HFYA 4QAYA 2BTEA 3RFZB 1H4RA 2D3BA 1YJ1A 4GXBA 2RPVA 2KFKA 1HTOA 3RNEC 3NG0A 5E6OA 1KF6B 5HG2A 1IGCA 3L17A 3U52E 2KC2A 2QSDA 2LJIA 2CHZA 5T8IA 1T0YA 2K8HA 5DPSA 4XDDA 3R2IA 5AZHA 1UF0A 3TJPA 2L0TA 1J7CA 5KHQA 5G2NA 4KDIC 5MPOA 4GDKB 3C0RB 4XC2A 4DXAB 2DAJA 3AXCA 5AUKA 3OJ4B 4FBJB 4K1RB 1AARA 2LGSA 1P1AA 4I6LB 4US8A 1GUAB 1JWAD 5D3IB 3D32A 1E6EB 2EKEC 1T0SC 3Q69A 4RMAA 4GMVA 2WWZA 1I4QA 3U4EG 3PS6A 4TQ0A 2K25A 2VH2A 1SGHA 1PGAA 4IWQA 2E6XA 1SE2A 3CF6E 1R4NI 1TKEA 1U4AA 4PK1A 3ZW3A 1NENB 3VVWB 3DBRI 1MPEA 4KSKC 4DWFA 4JWSC 3BY4B 4WJNA 1VZ8A 3U8ZA 3SFDB 4KGRA 5AZGA 4GSWA 1FCLA 1FNWA 1N62A 4C7YA 3PHXB 1J7BA 3NVYA 2D5GA 3WA0A 4BKGA 4BKSA 2EELA 3MTNB 1K53A 3BINA 3P63A 3V6EB 1T0QC 3KYCD 2N9PC 2PVGC 1A5RA 5CHFA 1V8CA 2KQ7A 3QAQA 3RYTA 3NHEB 4ICUA 4XGAB 1LGRA 1I7HA 2O2VA 3X23A 3W1YA 1F77A 1XLQA 5JZEB 3ZDTA 4PYUA 2Q5WD 3ZUNA 2ZCCA 3C8YA 3HRDD 3AV8A 2JWZA 3JVZX 2PE9A 3L13A 3N9YC 3U2SC 3V3XA 2WYQA 3ZNZB 1WGHA 2Z0EB 3DBRB 3B1LX 3L0WB 3UINB 2KDMA 1WXSA 3VR8B 3A33B 1XCQL 1GNUA 2QILA 3I57A 3VUWA 4GU2A 4MELA 3M3JA 4KKIA 3DCGA 3VAWA 4KVGB 2KQSA 4ZRIA 1OEYA 3ZJTA 2KQ4X 2C9WB 2VH1A 5EE3A 2JXXA 4F8CB 2DYMA 1YN3A 5IOIA 4WURA 1D3ZA 3DOWA 3KUCB 1RM6C 1VRAB 5FR3A 2WXJA 4FJZA 4NPNA 2IO0B 2JT4B 1L0XB 4HDOA 1FPYA 2K1FA 2X8XX 1L4DB 2DYBA 2LGIA 3ZNHB 3K9PB 1PGBA 2KFKB 2Y5CA 3Q8AA 3BZDB 5HHDG 1C1YB 2Y5BB 2LUEA 4HPMB 1E10A 3I63C 1HZ5A 2VZKB 4YSYB 4JQWC 1QT9A 2WX1A 1B9RA 1OEYJ 2KWVB 2JZZA 3B08A 4YT0B 2DZMA 4RGTA 2WDTB 4OVVA 1WXVA 1KRHA 5IKCM 3DHHC 1PUTA 3H7PA 2ZNVC 4L1BA 1LO5D 3AE6B 2G9HD 4FHKA 3Q8BA 4PS3A 1TKGA 3QCAA 3Q6BA 2JU6X 3J9CA 1OGWA 5JXVA 4XZ4A 4G0NB 2IGHA 3AU5A 1GG3A 2LD9A 1YJIA 2M56B 5J2RA 2R2QA 2KVZA 4HEA1 1V97A 3M95A 4HLEA 5DPWA 2DZJA 4ICVA 2J4XA 2N9LA 3VTWA 2YEPB 2FCSA 5BYQA 3VH3B 2DYOA 3SU8X 3I9V1 3JSVA 3Q8FA 1WE6A 2BW2A 3O13A 3R2TA 1R4MI 3A1QB 3R7RA 3CWIA 4HKQA 4PS8A 1Q5WB 2K5PA 2IBIB 3QQ8B 3C19A 2GRIA 4LCDE 1STEA 3B2GA 2WLBA 1UWMA 4MGYE 3KQ4A 4MSMB 4MSQB 2H89B 4S0RA 1AW7A 1MHXA 4YSZB 2KKCA 2KC1A 1TS5A 5CX3A 1QLBB 4CYEA 2ZVOA 1FM0D 1WX8A 1I4RA 2O2VB 4BOSC 4NZLB
chains in the Genus database with same CATH topology
1WJUA 5LXIB 3VTVA 2NBVB 4WAAA 1ZW7A 2MBEA 2XEWA 3T9LA 3A4RA 3X0WA 3W1SA 1XT9B 1EUVB 4MJSA 5J18A 3M62B 2RGFA 1WI0A 4MH0E 4DHZB 3HM6X 4GB9A 1E8ZA 1E8WA 1I42A 3GOEA 4HJKA 4AJWA 3DBLI 3DVGY 4ZDVA 1LM8B 2K6QA 3KH0A 4DDID 4EFOA 2KWUB 4HPLB 4I6PA 2BGFA 4HWIB 5C23A 1CMXB 1KM7A 5AEKB 2D2QA 4HXDA 3VQIA 1V86A 3IVFA 4TQ1A 1WIAA 1ZKHA 2YLMA 5E6NA 3RCZA 1MG8A 4MM3A 1V80A 2LGXA 2LRWA 5JHBA 3N3KB 4WJOA 3JYUA 5J17A 2AL6A 2RPQA 2KFJA 2MRPA 2A5UA 4W9IA 4EZKA 4FADA 2J7QB 4W9GA 1RFAA 4M8NA 1J0GA 3AULA 4NJ7A 1NDDA 2DZKA 3M63B 2FCNA 2A4ZA 3R3MA 1G6JA 2GBRA 2V1YA 3OJ3A 2BF8B 2MP2A 3QA8A 4DDGD 2LZ6A 3WAMA 1YX5B 2ZCBA 4ANVA 3VDZA 1SIFA 1F9JA 4WQOB 1WXMA 3WALA 1LXDA 1V2YA 3DBSA 4YL8A 1WF9A 3PT2B 4RM8A 2NBUA 5TR5A 2IO2B 2MBQA 2YVCA 2NS5A 2FIFA 3UIPB 4A3OA 5CTRC 2NR2A 3ZKJC 3UQBA 4FN2A 1KLVA 2MWSB 3EHVA 4ZRJA 4LDTB 1HE8A 3OAWA 3PSEB 2KJRA 4IWOA 5E6PA 4EOYA 1OQYA 2EMTA 2IYDB 3L16A 2GBMA 2KVRA 3V61A 1C3TA 4W9HA 1PQSA 4EZLA 3V6CB 3TL5A 3RZFA 3SD5A 3QWZB 3HHMA 2JPHA 3NS8A 2M17A 4NNJB 3I3TB 1WYWB 1V49A 3U7DA 5LXHA 4W9KA 4X57B 1TTNA 1TBEA 2AWTA 1WH3A 3H1UA 2FNJB 2BKFA 2JRIB 1GJZA 3DVGX 1GC7A 2KTRA 1WE7A 3CSTA 3WAPA 5GMVA 1Z2MA 2KWCA 2ZPNA 1V81A 4IWPA 2K6DB 2C5LC 2LWPA 1J8CA 2CR5A 4ZRKA 4W9LA 4G3XB 1WJ6A 2GBNA 2CKHB 1WMHA 5D94A 4MGKE 2KO3A 2ZNVB 3H7PB 1EF5A 3PHWB 2CS4A 2O6VA 2B3AA 2RR9A 4FJYA 4WWNA 4MGZE 5DPTA 2HD5B 4J6IA 2K39A 4IG7B 4IUMB 2M0XA 3N30A 3U30A 3ZIMA 1V5TA 4HCPB 3EECA 1E7UA 2EMSA 4MGIE 3H6NA 1VCBA 2ASQA 1GC6A 2L05A 1E90A 1WGYA 4OVUA 2BYVE 2N7EA 4K7UA 3V62A 2M8SA 2G45B 4M8MA 2AYOB 5D2MB 1EF1A 3NY5A 4DK5A 4EUTA 2ZJDA 2D3GA 3PLUA 3RZWC 4AP4C 1WJNA 5DPRA 4HVBA 2M1MA 3UIOB 3R7QA 3ZO5B 4DBGA 4JLCA 4PS7A 1IP9A 3ZRCA 4E3CA 2MCNB 2CU1A 2Z0DB 3KYDD 4IM3A 1YD8U 2C7NB 2J0MA 1NBFC 5BO4B 4A3PA 3KUDB 3S2AA 3WIMA 2BYEA 4GDLA 3PTFC 3ML9A 4AUQC 1H4RA 3WAOA 1LQBA 2MA9B 1X1MA 1YJ1A 1V6EA 2O6VB 3IHPC 4GXBA 2KFKA 2LRUA 4F7ZA 5E6OA 2KJHB 1ZGUB 3KW5B 3JSVB 1M94A 3ONSA 2DX5B 2NBWB 3VUXA 3L17A 3APDA 2KC2A 3EC8A 1Q1OA 2CHZA 4DHJD 1T0YA 2BWFA 2GOWA 3K9OB 3QJZA 2K8HA 5DPSA 1WJ4A 3JW0X 4GGQA 4ANUA 3QARA 5AZHA 2KMAA 1WGRA 4BBNF 3TJPA 2L0TA 4NQLB 5KHQA 5G2NA 3N32A 4TUUA 3EFUA 1FXTB 4KDIC 4NAWA 2NPTA 1E7VA 4BBNC 2G4DB 3C0RB 4GDKB 4XC2A 2DAJA 2MSED 3AXCA 4FHJA 4DXAB 3OJ4B 4WJQA 2KDFB 3DPDA 3P2BA 3QK0A 4FBJB 3ENEA 2NVUI 4KIKA 4K1RB 1AARA 1UGMA 1P1AA 4I6LB 4BKSD 4IM2A 3ZVVA 2G4SA 2K8BA 1GUAB 3CSFA 4MJSB 1NI2A 3D32A 2EKEC 4RMAA 4GMVA 4A20A 2WWZA 1WRDB 3SDLC 3PS6A 2JF5A 2K25A 4TQ0A 1SGHA 3NZUA 3OLMD 1UZXB 4G50A 2DAFA 3PGEA 4TKNA 4B95A 4IWQA 3L54A 3A4SC 3ZLZA 5JHAA 3CF6E 1WY8A 4HK2A 4NY0A 1R4NI 4KZCA 1ISNA 2N9EB 4RM9A 4W9DA 1U4AA 3QX1A 2DENB 2J0JA 3ZW3A 2BKRB 3VVWB 5D6JB 4URKA 3ML8A 3DBRI 1E5WA 4W9FA 2KMCA 2NPTB 4NAWB 3UF8A 3A9JA 4KSKC 4DWFA 3BY4B 2L0FA 4WJNA 1S1QB 1YQBA 4IM0A 3PLVA 2MLBA 3VUYA 2KHWB 3PZDA 5FR6A 2I1JA 2MP2B 2FIDA 2N7DA 2IO1B 3U8ZA 1WGDA 4TV3A 5AZGA 4GSWA 4PYZA 1Q0WB 2N4FA 3DQVA 4ZYNA 5L83A 2LXCA 2HTHA 5IAAC 2G3QB 2XK5A 3PHXB 4NQKE 2ZZPB 4ANXA 3H9DA 1Z5SB 1VD2A 2QHOA 4MDKE 1P0RA 1QZEA 3WA0A 4BKGA 3NZSA 1YIWA 4N9F4 4BKSA 1K8RB 3TIXA 3MTNB 4AWJA 3BINA 1I35A 1RLFA 2KJ6A 2KN5A 2JZ3B 3APCA 2GBJA 2LXAA 2MBOA 1RRBA 1UBQA 2PJHA 3PPAA 2LGYA 3V6EB 3KYCD 2KLCA 2N9PC 1IPGA 3B0AA 1H8CA 1A5RA 2MW5A 1UELA 3GZNI 2N9XA 5CHFA 2KQ7A 2JY6A 3QAQA 1WZ0A 3RYTA 3NHEB 1LFDA 2LVQA 4ICUA 3CMMB 3A9JB 2LGDA 2O2VA 2KD0A 3SHQA 3X23A 3W1YA 3TMPB 3AU4A 1WZ3A 4II2B 2RSUA 4B9KA 5HKHA 3ZDTA 4CHKA 5JZEB 2L76A 4JIOU 1RAXA 1JRUA 2KTRB 3PRPB 2MBBB 4LDTD 2GBKA 4PYUA 3ZUNA 2MBHA 2ZCCA 3LDZE 2JWZA 3JVZX 2D07B 2L3ZA 2PE9A 3L13A 4WWPA 2KTFA 3RD2A 4LJPB 2N1WA 2WYQA 3MHSD 3ZNZB 1WGHA 4LJOB 3ZRFA 2Z0EB 1WR1A 1WMHB 3B1LX 4WWOA 3RULA 1WX7A 1TZ1A 2LJ5A 3L0WB 3UINB 3DBHI 1WXSA 4BKTA 5AZFA 5L95C 4E74A 2RD0A 3A33B 3VFKA 2V3SA 1GNUA 2C60A 2UWQA 2LASA 5JH5C 3LJ3A 3UGBB 3VUWA 3ECIA 4GU2A 4MELA 3M3JA 2FAZA 4II3B 3DCGA 2KOXA 3VTUA 3VAWA 1L2NA 4KVGB 2VRRB 1OTRB 2AEHA 4BOZB 3HM3A 2KQSA 3KVFB 4ZRIA 1OEYA 3AI5A 1P9DU 2C9WB 1IYFA 3O65B 2JXXA 2CHWA 4F8CB 2DYMA 3RUIB 1D3ZA 2W9NA 3DOWA 3RT3B 2LI5A 3KUCB 2JRHA 3DVNV 2DHZA 3VHTC 3W1SC 4BFRA 3ZTCA 2M4NA 3UQAA 2J0KA 4FJZA 4NPNA 1L7YA 3PREA 2IO0B 2JT4B 2REXA 4W9EA 5D7GA 4HDOA 5G55A 1UBIA 4GDLB 2K1FA 4KZ0A 3KUZA 4K7SA 2DYBA 3ZNHB 2C7HA 3K9PB 2ZPYA 4HCNB 2L8JA 4GIVA 2KFKB 2KDEB 1WXAA 1UH6A 2KZRA 4GOCA 1C1YB 2Y5BB 4FULA 1E8XA 3WANA 2LUEA 4HPMB 3PRZA 4FLHA 3ZNID 2BYFA 2HJ8A 4NJ6A 2L7RA 3Q3JA 4G11A 4AOFA 1WX9A 2IO3B 2OJRA 3IFWB 2HE7A 2KX0A 4JQWC 1EO6A 3NOBA 4JGHB 4E71A 2KK8A 2O6VD 2D10A 2KX3A 2JVCA 2WX1A 1OEYJ 4IW0A 4FJVB 1BT0A 2KWVB 2D11A 2JZZA 3B08A 2DZMA 2PE6B 2FCQA 3APFA 2WDTB 4ANWA 4JL9A 4OVVA 1WXVA 1SE9A 4K7WA 3H7PA 1E8YA 4KDLB 2ZNVC 2AL3A 5LLIA 4FHKA 5EDSA 4KIKB 2PPHA 2WX0A 4PS3A 3QCAA 1KOTA 2KANA 3DVNU 4EZJA 4XX5A 2FUHB 3HIZA 2UYZB 3A1QA 2I1KA 1OGWA 1TGZB 4EKUA 5KHOA 2MQJA 5CHWA 1UD7A 4XZ4A 3HK0A 1XQQA 4G0NB 3MJWA 3Q3FA 2Z59B 5C1ZA 3AU5A 1GG3A 2LD9A 2IZVB 5J2RA 2R2QA 2CHXA 1P3QU 1WFYA 1WGGA 1J19A 2GMIC 2IY0B 2LVOA 2ZEQA 4HLEA 3M95A 2L00B 5IA7A 4AJYB 5DPWA 2BWES 4FA6A 2DZJA 4ICVA 2N1VA 4DHJB 3A9KA 3R66C 3VTWA 1S3SG 3PRMB 1WM3A 2FCSA 1V9JA 1WM2A 2V4LA 1V5OA 2NCNA 4HDQA 5DCNA 3L10B 4KSLC 4P7IA 3TCAA 3ZDMC 3PV1A 4BVUC 4W9JA 3VH3B 2DYOA 3SU8X 2DZIA 4MEMA 3JSVA 3TBLD 1P98A 1WE6A 4I6NB 3IBEA 3VH4B 2LVPA 4K81A 4EEWA 2FCMA 3R7RA 2KDIA 1R4MI 3A1QB 2XBBC 3VXWA 1YX6B 4PS8A 2XK5B 1WR6E 2BPSA 3IG3A 1Q5WB 4DHZE 2IBIB 3QQ8B 4ASWC 2OOBB 4M0WB 3QIJA 4LCDE 2KDBA 2IY1B 2KXJA 2MX2A 2PEAA 4CO7A 2JUOA 3DDCB 4MGYE 3ALBA 4W9CA 3PVLA 4MSMB 3ZTDA 4MSQB 4IC7B 3ZNGC 2KNBA 2ZVNA 4F1SA 2KKCA 3QHTA 3V60A 2KC1A 4WJPA 5CX3A 4GDKA 5CHVC 3L08A 1XD3B 3A9KB 4CYEA 2K8CA 2R2OA 2ZVOA 4GN1A 4KV2A 1WX8A 3T8MA 2KLGA 3QC8B 1KJTA 2O2VB 4BOSC 3H7SA 4B6WA 1Y8RC 2C7MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJU A;  5LXI B;  3VTV A;  2NBV B;  4WAA A;  1ZW7 A;  2MBE A;  2XEW A;  3T9L A;  3A4R A;  3X0W A;  3W1S A;  1XT9 B;  1EUV B;  4MJS A;  5J18 A;  3M62 B;  2RGF A;  1WI0 A;  4MH0 E;  4DHZ B;  3HM6 X;  4GB9 A;  1E8Z A;  1E8W A;  1I42 A;  3GOE A;  4HJK A;  4AJW A;  3DBL I;  3DVG Y;  4ZDV A;  1LM8 B;  2K6Q A;  3KH0 A;  4DDI D;  4EFO A;  2KWU B;  4HPL B;  4I6P A;  2BGF A;  4HWI B;  5C23 A;  1CMX B;  1KM7 A;  5AEK B;  2D2Q A;  4HXD A;  3VQI A;  1V86 A;  3IVF A;  4TQ1 A;  1WIA A;  1ZKH A;  2YLM A;  5E6N A;  3RCZ A;  1MG8 A;  4MM3 A;  1V80 A;  2LGX A;  2LRW A;  5JHB A;  3N3K B;  4WJO A;  3JYU A;  5J17 A;  2AL6 A;  2RPQ A;  2KFJ A;  2MRP A;  2A5U A;  4W9I A;  4EZK A;  4FAD A;  2J7Q B;  4W9G A;  1RFA A;  4M8N A;  1J0G A;  3AUL A;  4NJ7 A;  1NDD A;  2DZK A;  3M63 B;  2FCN A;  2A4Z A;  3R3M A;  1G6J A;  2GBR A;  2V1Y A;  3OJ3 A;  2BF8 B;  2MP2 A;  3QA8 A;  4DDG D;  2LZ6 A;  3WAM A;  1YX5 B;  2ZCB A;  4ANV A;  3VDZ A;  1SIF A;  1F9J A;  4WQO B;  1WXM A;  3WAL A;  1LXD A;  1V2Y A;  3DBS A;  4YL8 A;  1WF9 A;  3PT2 B;  4RM8 A;  2NBU A;  5TR5 A;  2IO2 B;  2MBQ A;  2YVC A;  2NS5 A;  2FIF A;  3UIP B;  4A3O A;  5CTR C;  2NR2 A;  3ZKJ C;  3UQB A;  4FN2 A;  1KLV A;  2MWS B;  3EHV A;  4ZRJ A;  4LDT B;  1HE8 A;  3OAW A;  3PSE B;  2KJR A;  4IWO A;  5E6P A;  4EOY A;  1OQY A;  2EMT A;  2IYD B;  3L16 A;  2GBM A;  2KVR A;  3V61 A;  1C3T A;  4W9H A;  1PQS A;  4EZL A;  3V6C B;  3TL5 A;  3RZF A;  3SD5 A;  3QWZ B;  3HHM A;  2JPH A;  3NS8 A;  2M17 A;  4NNJ B;  3I3T B;  1WYW B;  1V49 A;  3U7D A;  5LXH A;  4W9K A;  4X57 B;  1TTN A;  1TBE A;  2AWT A;  1WH3 A;  3H1U A;  2FNJ B;  2BKF A;  2JRI B;  1GJZ A;  3DVG X;  1GC7 A;  2KTR A;  1WE7 A;  3CST A;  3WAP A;  5GMV A;  1Z2M A;  2KWC A;  2ZPN A;  1V81 A;  4IWP A;  2K6D B;  2C5L C;  2LWP A;  1J8C A;  2CR5 A;  4ZRK A;  4W9L A;  4G3X B;  1WJ6 A;  2GBN A;  2CKH B;  1WMH A;  5D94 A;  4MGK E;  2KO3 A;  2ZNV B;  3H7P B;  1EF5 A;  3PHW B;  2CS4 A;  2O6V A;  2B3A A;  2RR9 A;  4FJY A;  4WWN A;  4MGZ E;  5DPT A;  2HD5 B;  4J6I A;  2K39 A;  4IG7 B;  4IUM B;  2M0X A;  3N30 A;  3U30 A;  3ZIM A;  1V5T A;  4HCP B;  3EEC A;  1E7U A;  2EMS A;  4MGI E;  3H6N A;  1VCB A;  2ASQ A;  1GC6 A;  2L05 A;  1E90 A;  1WGY A;  4OVU A;  2BYV E;  2N7E A;  4K7U A;  3V62 A;  2M8S A;  2G45 B;  4M8M A;  2AYO B;  5D2M B;  1EF1 A;  3NY5 A;  4DK5 A;  4EUT A;  2ZJD A;  2D3G A;  3PLU A;  3RZW C;  4AP4 C;  1WJN A;  5DPR A;  4HVB A;  2M1M A;  3UIO B;  3R7Q A;  3ZO5 B;  4DBG A;  4JLC A;  4PS7 A;  1IP9 A;  3ZRC A;  4E3C A;  2MCN B;  2CU1 A;  2Z0D B;  3KYD D;  4IM3 A;  1YD8 U;  2C7N B;  2J0M A;  1NBF C;  5BO4 B;  4A3P A;  3KUD B;  3S2A A;  3WIM A;  2BYE A;  4GDL A;  3PTF C;  3ML9 A;  4AUQ C;  1H4R A;  3WAO A;  1LQB A;  2MA9 B;  1X1M A;  1YJ1 A;  1V6E A;  2O6V B;  3IHP C;  4GXB A;  2KFK A;  2LRU A;  4F7Z A;  5E6O A;  2KJH B;  1ZGU B;  3KW5 B;  3JSV B;  1M94 A;  3ONS A;  2DX5 B;  2NBW B;  3VUX A;  3L17 A;  3APD A;  2KC2 A;  3EC8 A;  1Q1O A;  2CHZ A;  4DHJ D;  1T0Y A;  2BWF A;  2GOW A;  3K9O B;  3QJZ A;  2K8H A;  5DPS A;  1WJ4 A;  3JW0 X;  4GGQ A;  4ANU A;  3QAR A;  5AZH A;  2KMA A;  1WGR A;  4BBN F;  3TJP A;  2L0T A;  4NQL B;  5KHQ A;  5G2N A;  3N32 A;  4TUU A;  3EFU A;  1FXT B;  4KDI C;  4NAW A;  2NPT A;  1E7V A;  4BBN C;  2G4D B;  3C0R B;  4GDK B;  4XC2 A;  2DAJ A;  2MSE D;  3AXC A;  4FHJ A;  4DXA B;  3OJ4 B;  4WJQ A;  2KDF B;  3DPD A;  3P2B A;  3QK0 A;  4FBJ B;  3ENE A;  2NVU I;  4KIK A;  4K1R B;  1AAR A;  1UGM A;  1P1A A;  4I6L B;  4BKS D;  4IM2 A;  3ZVV A;  2G4S A;  2K8B A;  1GUA B;  3CSF A;  4MJS B;  1NI2 A;  3D32 A;  2EKE C;  4RMA A;  4GMV A;  4A20 A;  2WWZ A;  1WRD B;  3SDL C;  3PS6 A;  2JF5 A;  2K25 A;  4TQ0 A;  1SGH A;  3NZU A;  3OLM D;  1UZX B;  4G50 A;  2DAF A;  3PGE A;  4TKN A;  4B95 A;  4IWQ A;  3L54 A;  3A4S C;  3ZLZ A;  5JHA A;  3CF6 E;  1WY8 A;  4HK2 A;  4NY0 A;  1R4N I;  4KZC A;  1ISN A;  2N9E B;  4RM9 A;  4W9D A;  1U4A A;  3QX1 A;  2DEN B;  2J0J A;  3ZW3 A;  2BKR B;  3VVW B;  5D6J B;  4URK A;  3ML8 A;  3DBR I;  1E5W A;  4W9F A;  2KMC A;  2NPT B;  4NAW B;  3UF8 A;  3A9J A;  4KSK C;  4DWF A;  3BY4 B;  2L0F A;  4WJN A;  1S1Q B;  1YQB A;  4IM0 A;  3PLV A;  2MLB A;  3VUY A;  2KHW B;  3PZD A;  5FR6 A;  2I1J A;  2MP2 B;  2FID A;  2N7D A;  2IO1 B;  3U8Z A;  1WGD A;  4TV3 A;  5AZG A;  4GSW A;  4PYZ A;  1Q0W B;  2N4F A;  3DQV A;  4ZYN A;  5L83 A;  2LXC A;  2HTH A;  5IAA C;  2G3Q B;  2XK5 A;  3PHX B;  4NQK E;  2ZZP B;  4ANX A;  3H9D A;  1Z5S B;  1VD2 A;  2QHO A;  4MDK E;  1P0R A;  1QZE A;  3WA0 A;  4BKG A;  3NZS A;  1YIW A;  4N9F 4;  4BKS A;  1K8R B;  3TIX A;  3MTN B;  4AWJ A;  3BIN A;  1I35 A;  1RLF A;  2KJ6 A;  2KN5 A;  2JZ3 B;  3APC A;  2GBJ A;  2LXA A;  2MBO A;  1RRB A;  1UBQ A;  2PJH A;  3PPA A;  2LGY A;  3V6E B;  3KYC D;  2KLC A;  2N9P C;  1IPG A;  3B0A A;  1H8C A;  1A5R A;  2MW5 A;  1UEL A;  3GZN I;  2N9X A;  5CHF A;  2KQ7 A;  2JY6 A;  3QAQ A;  1WZ0 A;  3RYT A;  3NHE B;  1LFD A;  2LVQ A;  4ICU A;  3CMM B;  3A9J B;  2LGD A;  2O2V A;  2KD0 A;  3SHQ A;  3X23 A;  3W1Y A;  3TMP B;  3AU4 A;  1WZ3 A;  4II2 B;  2RSU A;  4B9K A;  5HKH A;  3ZDT A;  4CHK A;  5JZE B;  2L76 A;  4JIO U;  1RAX A;  1JRU A;  2KTR B;  3PRP B;  2MBB B;  4LDT D;  2GBK A;  4PYU A;  3ZUN A;  2MBH A;  2ZCC A;  3LDZ E;  2JWZ A;  3JVZ X;  2D07 B;  2L3Z A;  2PE9 A;  3L13 A;  4WWP A;  2KTF A;  3RD2 A;  4LJP B;  2N1W A;  2WYQ A;  3MHS D;  3ZNZ B;  1WGH A;  4LJO B;  3ZRF A;  2Z0E B;  1WR1 A;  1WMH B;  3B1L X;  4WWO A;  3RUL A;  1WX7 A;  1TZ1 A;  2LJ5 A;  3L0W B;  3UIN B;  3DBH I;  1WXS A;  4BKT A;  5AZF A;  5L95 C;  4E74 A;  2RD0 A;  3A33 B;  3VFK A;  2V3S A;  1GNU A;  2C60 A;  2UWQ A;  2LAS A;  5JH5 C;  3LJ3 A;  3UGB B;  3VUW A;  3ECI A;  4GU2 A;  4MEL A;  3M3J A;  2FAZ A;  4II3 B;  3DCG A;  2KOX A;  3VTU A;  3VAW A;  1L2N A;  4KVG B;  2VRR B;  1OTR B;  2AEH A;  4BOZ B;  3HM3 A;  2KQS A;  3KVF B;  4ZRI A;  1OEY A;  3AI5 A;  1P9D U;  2C9W B;  1IYF A;  3O65 B;  2JXX A;  2CHW A;  4F8C B;  2DYM A;  3RUI B;  1D3Z A;  2W9N A;  3DOW A;  3RT3 B;  2LI5 A;  3KUC B;  2JRH A;  3DVN V;  2DHZ A;  3VHT C;  3W1S C;  4BFR A;  3ZTC A;  2M4N A;  3UQA A;  2J0K A;  4FJZ A;  4NPN A;  1L7Y A;  3PRE A;  2IO0 B;  2JT4 B;  2REX A;  4W9E A;  5D7G A;  4HDO A;  5G55 A;  1UBI A;  4GDL B;  2K1F A;  4KZ0 A;  3KUZ A;  4K7S A;  2DYB A;  3ZNH B;  2C7H A;  3K9P B;  2ZPY A;  4HCN B;  2L8J A;  4GIV A;  2KFK B;  2KDE B;  1WXA A;  1UH6 A;  2KZR A;  4GOC A;  1C1Y B;  2Y5B B;  4FUL A;  1E8X A;  3WAN A;  2LUE A;  4HPM B;  3PRZ A;  4FLH A;  3ZNI D;  2BYF A;  2HJ8 A;  4NJ6 A;  2L7R A;  3Q3J A;  4G11 A;  4AOF A;  1WX9 A;  2IO3 B;  2OJR A;  3IFW B;  2HE7 A;  2KX0 A;  4JQW C;  1EO6 A;  3NOB A;  4JGH B;  4E71 A;  2KK8 A;  2O6V D;  2D10 A;  2KX3 A;  2JVC A;  2WX1 A;  1OEY J;  4IW0 A;  4FJV B;  1BT0 A;  2KWV B;  2D11 A;  2JZZ A;  3B08 A;  2DZM A;  2PE6 B;  2FCQ A;  3APF A;  2WDT B;  4ANW A;  4JL9 A;  4OVV A;  1WXV A;  1SE9 A;  4K7W A;  3H7P A;  1E8Y A;  4KDL B;  2ZNV C;  2AL3 A;  5LLI A;  4FHK A;  5EDS A;  4KIK B;  2PPH A;  2WX0 A;  4PS3 A;  3QCA A;  1KOT A;  2KAN A;  3DVN U;  4EZJ A;  4XX5 A;  2FUH B;  3HIZ A;  2UYZ B;  3A1Q A;  2I1K A;  1OGW A;  1TGZ B;  4EKU A;  5KHO A;  2MQJ A;  5CHW A;  1UD7 A;  4XZ4 A;  3HK0 A;  1XQQ A;  4G0N B;  3MJW A;  3Q3F A;  2Z59 B;  5C1Z A;  3AU5 A;  1GG3 A;  2LD9 A;  2IZV B;  5J2R A;  2R2Q A;  2CHX A;  1P3Q U;  1WFY A;  1WGG A;  1J19 A;  2GMI C;  2IY0 B;  2LVO A;  2ZEQ A;  4HLE A;  3M95 A;  2L00 B;  5IA7 A;  4AJY B;  5DPW A;  2BWE S;  4FA6 A;  2DZJ A;  4ICV A;  2N1V A;  4DHJ B;  3A9K A;  3R66 C;  3VTW A;  1S3S G;  3PRM B;  1WM3 A;  2FCS A;  1V9J A;  1WM2 A;  2V4L A;  1V5O A;  2NCN A;  4HDQ A;  5DCN A;  3L10 B;  4KSL C;  4P7I A;  3TCA A;  3ZDM C;  3PV1 A;  4BVU C;  4W9J A;  3VH3 B;  2DYO A;  3SU8 X;  2DZI A;  4MEM A;  3JSV A;  3TBL D;  1P98 A;  1WE6 A;  4I6N B;  3IBE A;  3VH4 B;  2LVP A;  4K81 A;  4EEW A;  2FCM A;  3R7R A;  2KDI A;  1R4M I;  3A1Q B;  2XBB C;  3VXW A;  1YX6 B;  4PS8 A;  2XK5 B;  1WR6 E;  2BPS A;  3IG3 A;  1Q5W B;  4DHZ E;  2IBI B;  3QQ8 B;  4ASW C;  2OOB B;  4M0W B;  3QIJ A;  4LCD E;  2KDB A;  2IY1 B;  2KXJ A;  2MX2 A;  2PEA A;  4CO7 A;  2JUO A;  3DDC B;  4MGY E;  3ALB A;  4W9C A;  3PVL A;  4MSM B;  3ZTD A;  4MSQ B;  4IC7 B;  3ZNG C;  2KNB A;  2ZVN A;  4F1S A;  2KKC A;  3QHT A;  3V60 A;  2KC1 A;  4WJP A;  5CX3 A;  4GDK A;  5CHV C;  3L08 A;  1XD3 B;  3A9K B;  4CYE A;  2K8C A;  2R2O A;  2ZVO A;  4GN1 A;  4KV2 A;  1WX8 A;  3T8M A;  2KLG A;  3QC8 B;  1KJT A;  2O2V B;  4BOS C;  3H7S A;  4B6W A;  1Y8R C;  2C7M B; 
#chains in the Genus database with same CATH topology
 1WJU A;  2NMQ A;  4LK0 M;  1D5X C;  3GE3 C;  3KWL A;  1ZXI A;  4MJS A;  2B76 B;  5J18 A;  1NI3 A;  5G5H A;  1E8Z A;  3DBL I;  2K6Q A;  4DDI D;  2KWU B;  4I6P A;  2BGF A;  4HWI B;  1CMX B;  3VQI A;  4TQ1 A;  5E6N A;  4MM3 A;  2LRW A;  4WJO A;  2RPQ A;  2KFJ A;  4W9I A;  1R4M B;  1VZ6 A;  4EZK A;  1EWC A;  1P7F A;  3W9C B;  4ZYS A;  2BB5 A;  4M8N A;  3BYT B;  2V0G A;  2MP2 A;  2RDG A;  3QA8 A;  4DDG D;  4BZA A;  2IND C;  4M02 A;  4WQO B;  3WAL A;  1LXD A;  1SE3 A;  1OFF A;  1XO3 A;  1UUP A;  3Q2A C;  2NR2 A;  3GE8 C;  4LDT B;  1K50 A;  2KJR A;  4IWO A;  1MHH E;  3V61 A;  3V6C B;  3RNA C;  3SR6 A;  3HHM A;  3AE2 B;  3DBL B;  4NNJ B;  1FNV A;  3E56 A;  1WYW B;  4S17 A;  3NZ3 A;  1TBE A;  1I4P A;  1GJZ A;  3DVG X;  3R8B A;  1Z2M A;  2KWC A;  1C77 A;  1V81 A;  1ZDV A;  2CR5 A;  4OZB A;  2D3A A;  4BAX A;  1WMH A;  5D94 A;  4MGK E;  2KO3 A;  2ZNV B;  3H7P B;  4WWN A;  2AQ1 B;  4IG7 B;  4HRS A;  3ZIM A;  1E7U A;  3BVM A;  3Q3O C;  1TS4 A;  4WQM A;  5D2M B;  1EF1 A;  2L32 A;  3RZW C;  4AP4 C;  4C00 A;  2M1M A;  1C4A A;  1DOX A;  4A8X C;  2Z0D B;  4ARC A;  1YD8 U;  2RDB C;  2KWD A;  4HKZ E;  4IKG A;  3KUD B;  3WIM A;  3EA6 A;  3MFG A;  4AUQ C;  1LQB A;  2W3R A;  1HTQ A;  4RFB A;  3IHP C;  2LRU A;  4F7Z A;  1L5P A;  3JSV B;  3ONS A;  2NBW B;  3EC8 A;  3NUH B;  2R61 A;  3E9S A;  1TJE A;  2FE8 A;  4DXG A;  4ANU A;  3Q3M C;  3QAR A;  1WGR A;  4BBN F;  2WXK A;  3AH7 A;  1MVK A;  4NQL B;  3SFE B;  1FXT B;  1TKY A;  1KLU D;  2KDF B;  3DPD A;  3QK0 A;  2NVU I;  4KKJ A;  1C76 A;  1UGM A;  4IM2 A;  2AQ3 B;  2K8B A;  3CSF A;  4MJS B;  2WXO A;  1JCK B;  1IUE A;  3AE5 B;  3SDL C;  3NZU A;  3OLM D;  4WWM A;  3PGE A;  3L54 A;  3A4S C;  3ZJU A;  1WY8 A;  1YN5 A;  3N1Y C;  4KZC A;  2KMM A;  3L4P A;  2DEN B;  4URK A;  1E5W A;  2NPT B;  2L0F A;  1S1Q B;  3VUY A;  4B0M A;  1BML C;  2MP2 B;  1KTK A;  3T3O A;  3GS2 A;  1L0V B;  1PYW D;  4PYZ A;  4ZYN A;  5L83 A;  2G3Q B;  3P1M A;  4ANX A;  1VD2 A;  1SXT A;  4MDK E;  3NZS A;  1K8R B;  2J52 A;  2JXT A;  2WGS A;  2MBO A;  1DGJ A;  3VR9 B;  4XWT A;  3GZN I;  4ZHO A;  2ZW1 A;  2NTT A;  1WZ0 A;  3A9J B;  2JYE A;  3TMP B;  4OVZ A;  2RSU A;  2BS4 B;  3ZYY X;  4CHK A;  3AE1 B;  4JIO U;  3SEB A;  2LHD A;  4XDC A;  4WWP A;  4LNI A;  4LJP B;  4LJO B;  4US9 A;  1WMH B;  4WWO A;  1ACC A;  1L6V A;  1ENF A;  1SEB D;  4BKT A;  2DBY A;  2RD0 A;  3VFK A;  3ETR A;  1DOY A;  2QDF A;  1Q10 A;  5JH5 C;  3UGB B;  1Y56 A;  2BS3 B;  1OTR B;  2Z8L A;  3KVF B;  4EE2 A;  1FXI A;  3O65 B;  4C4V B;  2W9N A;  2LI5 A;  2DHZ A;  3VHT C;  3W1S C;  2WDR B;  3UQA A;  1TS2 A;  1JAL A;  3GZN B;  2NTS A;  4LNO A;  2OED A;  3KUZ A;  4K7S A;  3AMZ A;  2C7H A;  2WXF A;  1UH6 A;  2ZW0 A;  2KZR A;  1JW9 D;  1E8X A;  1JML A;  2IDY A;  3Q3J A;  4G11 A;  4AOF A;  1WX9 A;  3P4R B;  2BS2 B;  2HE7 A;  2XN9 C;  1EO6 A;  3NOB A;  2QCZ A;  3NVW A;  2O6V D;  2D10 A;  2QMT A;  1RWS A;  2PE6 B;  4JL9 A;  1T5X D;  3NJT A;  4XWW A;  1E8Y A;  1ET9 A;  1XLN A;  2WX0 A;  3FC4 A;  2FUH B;  1T3Q A;  3A1Q A;  4FXC A;  3HK0 A;  1CZP A;  3MJW A;  2KT7 A;  1MI0 A;  1TY2 A;  5C1Z A;  1MJD A;  4KX6 B;  2IZV B;  3URY A;  4N59 A;  4YTM B;  1WFY A;  3ZQ4 A;  2CJO A;  1WGG A;  1J19 A;  1VJK A;  2GMI C;  5AUI A;  4N6E B;  2PVO D;  4FA6 A;  1HXY D;  3R66 C;  2Y3A A;  1S3S G;  3PRM B;  2VZK D;  3TEZ A;  4AQ7 A;  1WM2 A;  2LHE A;  3ABV B;  1V5O A;  2NCN A;  3V05 A;  2IGD A;  4MEM A;  3GP7 A;  3TBL D;  3IBE A;  1R4N B;  4K81 A;  2XBB C;  1YX6 B;  1UGJ A;  3RNC C;  4ASW C;  4DQO C;  3QIJ A;  1T6B X;  4LNN A;  4YXD B;  1YOV B;  2KXJ A;  2JUO A;  2WU5 B;  3BII D;  3ALB A;  2BQQ A;  1C4P A;  4OZC A;  5CHV C;  2MJE A;  3A9K B;  2K8C A;  4GN1 A;  2KLG A;  4B6W A;  3GOE A;  2C7M B;  2XEW A;  3BWU D;  4OW0 A;  2HTM E;  1WXQ A;  1E8W A;  4N58 A;  3MC8 A;  1LM8 B;  4L23 A;  4HPL B;  5BYR A;  5C23 A;  3Q14 C;  2J53 A;  4HXD A;  1V86 A;  3PZ7 A;  1WIA A;  1ZKH A;  2WXI A;  2YLM A;  3FIL B;  1MG8 A;  1EWY C;  4H2A A;  3N3K B;  5J17 A;  4C80 A;  1BXT A;  2MRP A;  1IBX A;  2X38 A;  4W9G A;  1RFA A;  3AUL A;  4NJ7 A;  3M63 B;  1G6J A;  2WXM A;  1YX5 B;  2ZCB A;  2BB6 A;  4ZHP A;  1SIF A;  1F0Z A;  3DBS A;  4ACF A;  4YL8 A;  1WF9 A;  2NBU A;  1JWU D;  2K22 A;  3VRB B;  2FIF A;  3UIP B;  4A3O A;  3ZKJ C;  1XLO A;  4FN2 A;  3KLS X;  4ZRJ A;  3N1X C;  4DXF A;  3L16 A;  1FIQ A;  2PKO A;  2KVR A;  1FFV A;  1C3T A;  1PQS A;  3RZF A;  3QWZ B;  1ZUD 2;  4HPP A;  3NS8 A;  4K3B A;  3I3T B;  1GOZ A;  1B1Z A;  3U7D A;  5LXH A;  4X57 B;  3RNF C;  2AWT A;  1WH3 A;  3H1U A;  3ZXV A;  2BKF A;  2JRI B;  2KTR A;  1WE7 A;  3CST A;  1JQ4 A;  3WAP A;  1CQV A;  2JYT A;  2C5L C;  4ZRK A;  3OG5 A;  1L0Y B;  4W9L A;  1XCT L;  2GBN A;  4L2Y A;  3Q3N C;  1EF5 A;  2KAC A;  4FJY A;  4MGZ E;  5DPT A;  4J6I A;  2K39 A;  3P42 A;  4P6V F;  3U30 A;  3AE4 B;  4HCP B;  2EMS A;  1VCB A;  2ASQ A;  1N61 A;  1WGY A;  2L05 A;  4K7U A;  2WDV B;  2WXR A;  5BMG A;  2G45 B;  2H88 B;  2D3C A;  1EU3 A;  2IPK D;  3TSS A;  3PLU A;  5DPR A;  4HVB A;  3R7Q A;  4ZRP A;  4PS7 A;  2CU1 A;  4IM3 A;  2C7N B;  1NBF C;  1D5Z C;  3ML9 A;  2MA9 B;  1X1M A;  1V6E A;  2M0A A;  1MFW A;  1FCC C;  4MAC A;  1EM7 A;  4RF1 A;  1N5X A;  1M94 A;  3VUX A;  2V4I B;  1Q1O A;  5D3D A;  4DHJ D;  2BWF A;  2GOW A;  3MHZ A;  3TUO A;  3K9O B;  3QJZ A;  3P4S B;  2WU2 B;  4ITK A;  1WJ4 A;  4GGQ A;  4RGO S;  2PMV A;  4D2K A;  2UU7 A;  3N32 A;  4TUU A;  1DYQ A;  2NPT A;  4BBN C;  2G4D B;  3BYY B;  1BUI C;  1WSP A;  4WJQ A;  3AEE B;  2L52 A;  4KIK A;  3ZVV A;  2G4S A;  1NEK B;  5TSS A;  2FUG 1;  1HEZ E;  1V1P A;  1ZE3 D;  4UDU C;  1WGK A;  2JF5 A;  2HDE A;  2DAF A;  4TKN A;  1HQR D;  4B95 A;  3ZLZ A;  2G1E A;  4NY0 A;  1ISN A;  4RM9 A;  3OWE B;  4RNA A;  3QX1 A;  1I4H A;  2J0J A;  2BKR B;  2K9X A;  2WP9 B;  1IBX B;  4TMA B;  2KMC A;  4NAW B;  3A9J A;  1YN4 A;  3PZ8 A;  4IM0 A;  2MLB A;  2FID A;  2N7D A;  4TV3 A;  2LFI A;  3DQV A;  2LXC A;  5IAA C;  2LUM A;  4CQN A;  2XK5 A;  2ZZP B;  1NYR A;  2Y5P A;  3H9D A;  1DOI A;  1Z5S B;  4M0W A;  4N9F 4;  1YIW A;  2QEJ C;  3TIX A;  1EU4 A;  1A70 A;  4AWJ A;  3AEG B;  1RRB A;  1UBQ A;  2DLB A;  1IPG A;  2MW5 A;  2N9X A;  2JX5 A;  1VZ7 A;  1LFD A;  2LVQ A;  4NJC A;  1K52 A;  4C4V A;  4KGT A;  2FBW B;  1YNT E;  2L76 A;  5FKA C;  3GB1 A;  1RAX A;  2KTR B;  2GBK A;  1C78 A;  2D07 B;  2L3Z A;  2KTF A;  2N1W A;  1ZPS A;  3AM9 A;  4LNK A;  1I4G A;  2LMC A;  1UWX A;  3RUL A;  3DBH I;  5AZF A;  5L95 C;  2MJD A;  3ZXR A;  2LAS A;  3T3N A;  4II3 B;  2KOX A;  3VTU A;  1L2N A;  1JWM D;  2AEH A;  4C7Z A;  3AI5 A;  2QC8 A;  1IYF A;  2WXG A;  3RNB C;  3RUI B;  2WHI A;  4REZ A;  3ZTC A;  2M4N A;  1L7Y A;  3PRE A;  2REX A;  4RH6 A;  5D7G A;  4W9E A;  1UNS A;  2ZPY A;  3MC9 A;  2L8J A;  2KDE B;  1WXA A;  5HI1 A;  4FUL A;  3WAN A;  2BYF A;  2HJ8 A;  4NJ6 A;  2L7R A;  1KH0 A;  2IO3 B;  2OJR A;  1L6U A;  2KX0 A;  3AE9 B;  3P4Q B;  1FFU A;  2KX3 A;  2JVC A;  4IW0 A;  4LTU A;  3EFC A;  2MH7 A;  1NVI D;  2FCQ A;  3APF A;  1ZOY B;  5H92 C;  3FAH A;  1SE9 A;  3IAM 1;  5LLI A;  1FMA D;  2EKI A;  2PIA A;  4KIK B;  1KOT A;  2KAN A;  3DVN U;  2UYZ B;  1V1P B;  2ONQ A;  2WXN A;  2MQJ A;  2JWU A;  5CHW A;  1UD7 A;  2RDH A;  1ESF A;  3TEW A;  3BK2 A;  1PDX A;  3Q3F A;  3W5V B;  5FK9 C;  3IT6 B;  2CHX A;  2MEK A;  1ZDX A;  2SEB D;  4AJY B;  2BWE S;  2N1V A;  3A9K A;  1QKZ A;  5DCN A;  3N20 C;  4KSL C;  3ZDM C;  1XEE A;  3PV1 A;  4WH4 A;  3RN9 C;  4W9J A;  3DWM A;  2DZI A;  1P98 A;  4I6N B;  3VH4 B;  2E3T A;  2LVP A;  2XK5 B;  3AEA B;  3IG3 A;  4XE0 A;  4DHZ E;  2OOB B;  4M0W B;  2KDB A;  2IY1 B;  3FIL A;  2MX2 A;  3DDC B;  4W9C A;  3PVL A;  4A90 A;  4IC7 B;  1GPX A;  1F2R C;  2PW9 A;  2KNB A;  2ZVN A;  1MG4 A;  3V60 A;  4WJP A;  3RI7 C;  1XD3 B;  4KV2 A;  3AN1 A;  3AEB B;  1M4V A;  1KJT A;  1V1O A;  3H7S A;  1Y8R C;  2NBV B;  4WAA A;  2MBE A;  3A4R A;  3X0W A;  3W1S A;  2RGF A;  1WI0 A;  4DHZ B;  1N60 A;  3HM6 X;  4GB9 A;  4AJW A;  3DVG Y;  4ZDV A;  3KH0 A;  1FXA A;  1RYJ A;  3BVZ A;  1KM7 A;  3LB8 C;  5AEK B;  1KFY B;  5I4D A;  5LNK 1;  3JYU A;  2A5U A;  1GAQ B;  2J7Q B;  1ZXH A;  4M01 A;  2BBC A;  2PLP A;  1NDD A;  2A4Z A;  4P16 A;  2GBR A;  2BF8 B;  4RCO A;  1QOG A;  3WAM A;  3MP9 A;  2AX5 A;  3VDZ A;  1F9J A;  1V2Y A;  1HZ6 A;  4RM8 A;  3B9J A;  2J42 A;  2N0S B;  5CTR C;  5GXG B;  3UQB A;  2I38 A;  2MWS B;  3EHV A;  1QF6 A;  3AE3 B;  3AB5 A;  3UI3 A;  5E6P A;  3PSE B;  4EOY A;  1OQY A;  2EMT A;  1SE4 A;  1TIF A;  4W9H A;  3TL5 A;  5C2T B;  1XLP A;  2M17 A;  1ET6 A;  1V49 A;  1TTN A;  2XNA C;  2WQY B;  4MH8 A;  5GMV A;  3ZJV A;  4IWP A;  2LWP A;  1J8C A;  1QQR A;  1D5M C;  2SAK A;  1J7A A;  4G3X B;  2CKH B;  1VLB A;  2OJW A;  2RR9 A;  4P1B C;  2HD5 B;  2M0X A;  3N30 A;  1F2R I;  5BYS A;  4OZA A;  3Q8C A;  1E90 A;  2BYV E;  2N7E A;  4WAF A;  5IN7 A;  2M8S A;  4RGM A;  4M8M A;  4ARI A;  2AYO B;  2WS3 B;  4AS1 A;  2CU3 A;  3ZGZ A;  1WJN A;  3NVV A;  2KN4 A;  1F52 A;  3UIO B;  4DBG A;  3ZO5 B;  2BYT A;  3ZRC A;  4E3C A;  2MCN B;  4MT5 A;  3KYD D;  4O1N A;  1WRI A;  3S2A A;  3HVD A;  4GDL A;  3RNG C;  3PTF C;  4TSS A;  3WAO A;  1NYQ A;  2O6V B;  2JZP A;  3NRZ A;  1D6E C;  2KJH B;  3B2F A;  1ZGU B;  3KW5 B;  2ON8 A;  2DX5 B;  4HRO A;  3APD A;  1HA5 A;  1VDV A;  4JX1 C;  1E0Z A;  1C9F A;  2JSV X;  2MHJ A;  1SJE D;  3LYY A;  3JW0 X;  4NAM A;  4B0E A;  1SF0 A;  2KMA A;  3U7Z A;  5EE9 A;  1YQ3 B;  1P7E A;  3EFU A;  4NAW A;  1E7V A;  2MSE D;  1YJJ A;  4FHJ A;  3P2B A;  5IO9 A;  3ENE A;  2GLS A;  4BKS D;  1E7P B;  2N9K A;  5H8Y E;  1NI2 A;  4RGN A;  4YSX B;  2IJ0 A;  3WCQ A;  3AE8 B;  3EUB 2;  4A20 A;  3BVG A;  1WRD B;  2AQ2 B;  1UZX B;  1C79 A;  4G50 A;  2KAJ A;  5JHA A;  4HK2 A;  1FEH A;  2N9E B;  4W9D A;  1FRR A;  2YEP F;  5D6J B;  2L83 A;  3ML8 A;  4W9F A;  3UF8 A;  2OHF A;  1TZO A;  4IDI A;  1YQB A;  2HJ1 A;  1SIJ A;  3PLV A;  2KHW B;  3PZD A;  5FR6 A;  2TSS A;  2I1J A;  2IO1 B;  1WGD A;  1SJH D;  1Q0W B;  2N4F A;  2HTH A;  4NQK E;  2WXP A;  2QHO A;  4WIP A;  1P0R A;  1IGD A;  1QZE A;  2GI9 A;  1I35 A;  1RLF A;  1JWB D;  2KJ6 A;  2KN5 A;  1F1H A;  2JZ3 B;  3APC A;  2GBJ A;  2LXA A;  3PPA A;  3Q8E A;  2PJH A;  4A9A A;  2LGY A;  2KLC A;  5E6J A;  3B0A A;  1H8C A;  2GB1 A;  1TYG B;  1UEL A;  1ZP0 B;  2JY6 A;  3HUI A;  3CMM B;  2LGD A;  2KD0 A;  3SHQ A;  5HKH A;  1QOA A;  1WZ3 A;  1E9M A;  3AU4 A;  4II2 B;  2INN E;  3AEF B;  1JRU A;  3PRP B;  4LDT D;  2MBB B;  3RPF C;  2MBH A;  3IXS A;  3N1Z C;  3LDZ E;  3DHG C;  3RD2 A;  1KLG D;  1FO4 A;  3MHS D;  1T0R C;  3ZRF A;  4XYC A;  1WR1 A;  1WX7 A;  2INC C;  1TZ1 A;  4PT5 A;  2LJ5 A;  3KWV A;  4E74 A;  1JWS D;  2V3S A;  2C60 A;  2UWQ A;  1PGX A;  3LJ3 A;  5C3J B;  3ECI A;  3PO0 A;  2V3P A;  2FAZ A;  2VRR B;  4BOZ B;  3HM3 A;  4LNF A;  1P9D U;  2JQR B;  2CHW A;  5BMI A;  4USA A;  3RT3 B;  2JRH A;  3DVN V;  3RMK C;  4BFR A;  1GB4 A;  2J0K A;  2WXH A;  2ICI A;  1YMH E;  5G55 A;  1UBI A;  4GDL B;  4KZ0 A;  2BT6 A;  4HCN B;  1FRD A;  4GIV A;  4A6Q A;  1AYF A;  4GOC A;  4IOI E;  4GLS C;  3PRZ A;  4FLH A;  4KGS A;  3ZNI D;  2W3S A;  3TEX A;  1RFK A;  3IFW B;  4JGH B;  4E71 A;  2KK8 A;  1QOB A;  1WYG A;  3I5J C;  2WDQ B;  4FJV B;  1BT0 A;  3NS1 A;  2D11 A;  2K3U A;  4ANW A;  1TY0 A;  2QIE B;  4K7W A;  4KDL B;  1TS3 A;  1FNU A;  2AL3 A;  2INP E;  5EDS A;  2PPH A;  2ACZ B;  2KYW A;  4ZOH C;  4EZJ A;  4XX5 A;  1QOF A;  4JE3 B;  2CJN A;  1SSN A;  3HIZ A;  2WXL A;  2I1K A;  1TGZ B;  4EKU A;  5KHO A;  4JPS A;  1JRO A;  3HVZ A;  1XQQ A;  1I4X A;  2Z59 B;  4YTN B;  2LEK A;  1P3Q U;  2I2Y A;  2IY0 B;  2LVO A;  2ZEQ A;  1VR9 A;  5IA7 A;  2L00 B;  4DHJ B;  4OHJ A;  1PFD A;  4M00 A;  1WM3 A;  1V9J A;  2V4L A;  4HDQ A;  2BVC A;  3L10 B;  4P7I A;  3TCA A;  4BVU C;  3FKY A;  4EEW A;  2FCM A;  2KDI A;  1JRP A;  3VXW A;  1WR6 E;  2BPS A;  2QJL A;  2V9H A;  4J3O D;  3IT4 B;  4CO7 A;  2PEA A;  4YTP B;  4JWU C;  4R3D A;  4A55 A;  3ZTD A;  3MJ5 A;  3ZNG C;  3P4P B;  4F1S A;  3QHT A;  3BK1 A;  4GDK A;  3L08 A;  3W5U B;  5BMH A;  2R2O A;  3T8M A;  3QC8 B;  4B9K A;  5LXI B;  4RF0 A;  3VTV A;  3W2D A;  1ZW7 A;  3T9L A;  2DWQ A;  1XT9 B;  1EUV B;  1XXG A;  2RMM A;  3M62 B;  4MH0 E;  1AWD A;  1I42 A;  4HJK A;  1XF5 L;  5EE0 A;  4EFO A;  4P1C C;  2D2Q A;  1SBB B;  3IVF A;  1SB3 C;  3RCZ A;  3CIR B;  1V80 A;  4YWG G;  1FD6 A;  2LGX A;  5JHB A;  2AL6 A;  1TT5 B;  1GB1 A;  4FAD A;  3NVZ A;  1CK1 A;  1J0G A;  2K0P A;  1C4C A;  2DZK A;  2FCN A;  3R3M A;  1YQ4 B;  2V1Y A;  3DBH B;  2W54 A;  3OJ3 A;  2V3N A;  2LZ6 A;  2IGG A;  5IP4 D;  4ANV A;  1WXM A;  1D4B A;  2L1A A;  1K51 A;  3EGR A;  2DNF A;  3PT2 B;  5TR5 A;  2IO2 B;  2MBQ A;  2YVC A;  2NS5 A;  2WNM A;  3AE7 B;  1QIL A;  2M19 A;  2WXQ A;  1KLV A;  1HE8 A;  4HJG E;  3OAW A;  5EE1 A;  4MM3 B;  1WWT A;  2IYD B;  1N6Z A;  2GBM A;  5G5G A;  4EZL A;  3SD5 A;  2JPH A;  1R7S A;  3TEY A;  2PTL A;  3H8H A;  4W9K A;  1N63 A;  1N5W A;  2FNJ B;  1GC7 A;  2W82 A;  1AN8 A;  2ZPN A;  2K6D B;  1WJ6 A;  3DWG C;  1ROE A;  4Q2J A;  3PHW B;  3MC0 B;  1OQR A;  2CS4 A;  2O6V A;  3VRA B;  2B3A A;  4ZRQ A;  4IUM B;  4C56 C;  3AEC B;  1V5T A;  3EEC A;  4MGI E;  3H6N A;  3DHI C;  1GC6 A;  4OVU A;  3V62 A;  2MJ3 A;  4K3C A;  3IAS 1;  4DK5 A;  3NY5 A;  4EUT A;  2N7J A;  2D3G A;  2ZJD A;  1L4Z B;  1CJE A;  4JLC A;  1IP9 A;  2W55 A;  4LLG M;  2J0M A;  5BO4 B;  4A3P A;  3AED B;  3LXF A;  2BYE A;  1OQQ A;  5HFY A;  4QAY A;  2BTE A;  3RFZ B;  1H4R A;  2D3B A;  1YJ1 A;  4GXB A;  2RPV A;  2KFK A;  1HTO A;  3RNE C;  3NG0 A;  5E6O A;  1KF6 B;  5HG2 A;  1IGC A;  3L17 A;  3U52 E;  2KC2 A;  2QSD A;  2LJI A;  2CHZ A;  5T8I A;  1T0Y A;  2K8H A;  5DPS A;  4XDD A;  3R2I A;  5AZH A;  1UF0 A;  3TJP A;  2L0T A;  1J7C A;  5KHQ A;  5G2N A;  4KDI C;  5MPO A;  4GDK B;  3C0R B;  4XC2 A;  4DXA B;  2DAJ A;  3AXC A;  5AUK A;  3OJ4 B;  4FBJ B;  4K1R B;  1AAR A;  2LGS A;  1P1A A;  4I6L B;  4US8 A;  1GUA B;  1JWA D;  5D3I B;  3D32 A;  1E6E B;  2EKE C;  1T0S C;  3Q69 A;  4RMA A;  4GMV A;  2WWZ A;  1I4Q A;  3U4E G;  3PS6 A;  4TQ0 A;  2K25 A;  2VH2 A;  1SGH A;  1PGA A;  4IWQ A;  2E6X A;  1SE2 A;  3CF6 E;  1R4N I;  1TKE A;  1U4A A;  4PK1 A;  3ZW3 A;  1NEN B;  3VVW B;  3DBR I;  1MPE A;  4KSK C;  4DWF A;  4JWS C;  3BY4 B;  4WJN A;  1VZ8 A;  3U8Z A;  3SFD B;  4KGR A;  5AZG A;  4GSW A;  1FCL A;  1FNW A;  1N62 A;  4C7Y A;  3PHX B;  1J7B A;  3NVY A;  2D5G A;  3WA0 A;  4BKG A;  4BKS A;  2EEL A;  3MTN B;  1K53 A;  3BIN A;  3P63 A;  3V6E B;  1T0Q C;  3KYC D;  2N9P C;  2PVG C;  1A5R A;  5CHF A;  1V8C A;  2KQ7 A;  3QAQ A;  3RYT A;  3NHE B;  4ICU A;  4XGA B;  1LGR A;  1I7H A;  2O2V A;  3X23 A;  3W1Y A;  1F77 A;  1XLQ A;  5JZE B;  3ZDT A;  4PYU A;  2Q5W D;  3ZUN A;  2ZCC A;  3C8Y A;  3HRD D;  3AV8 A;  2JWZ A;  3JVZ X;  2PE9 A;  3L13 A;  3N9Y C;  3U2S C;  3V3X A;  2WYQ A;  3ZNZ B;  1WGH A;  2Z0E B;  3DBR B;  3B1L X;  3L0W B;  3UIN B;  2KDM A;  1WXS A;  3VR8 B;  3A33 B;  1XCQ L;  1GNU A;  2QIL A;  3I57 A;  3VUW A;  4GU2 A;  4MEL A;  3M3J A;  4KKI A;  3DCG A;  3VAW A;  4KVG B;  2KQS A;  4ZRI A;  1OEY A;  3ZJT A;  2KQ4 X;  2C9W B;  2VH1 A;  5EE3 A;  2JXX A;  4F8C B;  2DYM A;  1YN3 A;  5IOI A;  4WUR A;  1D3Z A;  3DOW A;  3KUC B;  1RM6 C;  1VRA B;  5FR3 A;  2WXJ A;  4FJZ A;  4NPN A;  2IO0 B;  2JT4 B;  1L0X B;  4HDO A;  1FPY A;  2K1F A;  2X8X X;  1L4D B;  2DYB A;  2LGI A;  3ZNH B;  3K9P B;  1PGB A;  2KFK B;  2Y5C A;  3Q8A A;  3BZD B;  5HHD G;  1C1Y B;  2Y5B B;  2LUE A;  4HPM B;  1E10 A;  3I63 C;  1HZ5 A;  2VZK B;  4YSY B;  4JQW C;  1QT9 A;  2WX1 A;  1B9R A;  1OEY J;  2KWV B;  2JZZ A;  3B08 A;  4YT0 B;  2DZM A;  4RGT A;  2WDT B;  4OVV A;  1WXV A;  1KRH A;  5IKC M;  3DHH C;  1PUT A;  3H7P A;  2ZNV C;  4L1B A;  1LO5 D;  3AE6 B;  2G9H D;  4FHK A;  3Q8B A;  4PS3 A;  1TKG A;  3QCA A;  3Q6B A;  2JU6 X;  3J9C A;  1OGW A;  5JXV A;  4XZ4 A;  4G0N B;  2IGH A;  3AU5 A;  1GG3 A;  2LD9 A;  1YJI A;  2M56 B;  5J2R A;  2R2Q A;  2KVZ A;  4HEA 1;  1V97 A;  3M95 A;  4HLE A;  5DPW A;  2DZJ A;  4ICV A;  2J4X A;  2N9L A;  3VTW A;  2YEP B;  2FCS A;  5BYQ A;  3VH3 B;  2DYO A;  3SU8 X;  3I9V 1;  3JSV A;  3Q8F A;  1WE6 A;  2BW2 A;  3O13 A;  3R2T A;  1R4M I;  3A1Q B;  3R7R A;  3CWI A;  4HKQ A;  4PS8 A;  1Q5W B;  2K5P A;  2IBI B;  3QQ8 B;  3C19 A;  2GRI A;  4LCD E;  1STE A;  3B2G A;  2WLB A;  1UWM A;  4MGY E;  3KQ4 A;  4MSM B;  4MSQ B;  2H89 B;  4S0R A;  1AW7 A;  1MHX A;  4YSZ B;  2KKC A;  2KC1 A;  1TS5 A;  5CX3 A;  1QLB B;  4CYE A;  2ZVO A;  1FM0 D;  1WX8 A;  1I4R A;  2O2V B;  4BOS C;  4NZL B; 
#chains in the Genus database with same CATH homology
 1WJU A;  5LXI B;  3VTV A;  2NBV B;  4WAA A;  1ZW7 A;  2MBE A;  2XEW A;  3T9L A;  3A4R A;  3X0W A;  3W1S A;  1XT9 B;  1EUV B;  4MJS A;  5J18 A;  3M62 B;  2RGF A;  1WI0 A;  4MH0 E;  4DHZ B;  3HM6 X;  4GB9 A;  1E8Z A;  1E8W A;  1I42 A;  3GOE A;  4HJK A;  4AJW A;  3DBL I;  3DVG Y;  4ZDV A;  1LM8 B;  2K6Q A;  3KH0 A;  4DDI D;  4EFO A;  2KWU B;  4HPL B;  4I6P A;  2BGF A;  4HWI B;  5C23 A;  1CMX B;  1KM7 A;  5AEK B;  2D2Q A;  4HXD A;  3VQI A;  1V86 A;  3IVF A;  4TQ1 A;  1WIA A;  1ZKH A;  2YLM A;  5E6N A;  3RCZ A;  1MG8 A;  4MM3 A;  1V80 A;  2LGX A;  2LRW A;  5JHB A;  3N3K B;  4WJO A;  3JYU A;  5J17 A;  2AL6 A;  2RPQ A;  2KFJ A;  2MRP A;  2A5U A;  4W9I A;  4EZK A;  4FAD A;  2J7Q B;  4W9G A;  1RFA A;  4M8N A;  1J0G A;  3AUL A;  4NJ7 A;  1NDD A;  2DZK A;  3M63 B;  2FCN A;  2A4Z A;  3R3M A;  1G6J A;  2GBR A;  2V1Y A;  3OJ3 A;  2BF8 B;  2MP2 A;  3QA8 A;  4DDG D;  2LZ6 A;  3WAM A;  1YX5 B;  2ZCB A;  4ANV A;  3VDZ A;  1SIF A;  1F9J A;  4WQO B;  1WXM A;  3WAL A;  1LXD A;  1V2Y A;  3DBS A;  4YL8 A;  1WF9 A;  3PT2 B;  4RM8 A;  2NBU A;  5TR5 A;  2IO2 B;  2MBQ A;  2YVC A;  2NS5 A;  2FIF A;  3UIP B;  4A3O A;  5CTR C;  2NR2 A;  3ZKJ C;  3UQB A;  4FN2 A;  1KLV A;  2MWS B;  3EHV A;  4ZRJ A;  4LDT B;  1HE8 A;  3OAW A;  3PSE B;  2KJR A;  4IWO A;  5E6P A;  4EOY A;  1OQY A;  2EMT A;  2IYD B;  3L16 A;  2GBM A;  2KVR A;  3V61 A;  1C3T A;  4W9H A;  1PQS A;  4EZL A;  3V6C B;  3TL5 A;  3RZF A;  3SD5 A;  3QWZ B;  3HHM A;  2JPH A;  3NS8 A;  2M17 A;  4NNJ B;  3I3T B;  1WYW B;  1V49 A;  3U7D A;  5LXH A;  4W9K A;  4X57 B;  1TTN A;  1TBE A;  2AWT A;  1WH3 A;  3H1U A;  2FNJ B;  2BKF A;  2JRI B;  1GJZ A;  3DVG X;  1GC7 A;  2KTR A;  1WE7 A;  3CST A;  3WAP A;  5GMV A;  1Z2M A;  2KWC A;  2ZPN A;  1V81 A;  4IWP A;  2K6D B;  2C5L C;  2LWP A;  1J8C A;  2CR5 A;  4ZRK A;  4W9L A;  4G3X B;  1WJ6 A;  2GBN A;  2CKH B;  1WMH A;  5D94 A;  4MGK E;  2KO3 A;  2ZNV B;  3H7P B;  1EF5 A;  3PHW B;  2CS4 A;  2O6V A;  2B3A A;  2RR9 A;  4FJY A;  4WWN A;  4MGZ E;  5DPT A;  2HD5 B;  4J6I A;  2K39 A;  4IG7 B;  4IUM B;  2M0X A;  3N30 A;  3U30 A;  3ZIM A;  1V5T A;  4HCP B;  3EEC A;  1E7U A;  2EMS A;  4MGI E;  3H6N A;  1VCB A;  2ASQ A;  1GC6 A;  2L05 A;  1E90 A;  1WGY A;  4OVU A;  2BYV E;  2N7E A;  4K7U A;  3V62 A;  2M8S A;  2G45 B;  4M8M A;  2AYO B;  5D2M B;  1EF1 A;  3NY5 A;  4DK5 A;  4EUT A;  2ZJD A;  2D3G A;  3PLU A;  3RZW C;  4AP4 C;  1WJN A;  5DPR A;  4HVB A;  2M1M A;  3UIO B;  3R7Q A;  3ZO5 B;  4DBG A;  4JLC A;  4PS7 A;  1IP9 A;  3ZRC A;  4E3C A;  2MCN B;  2CU1 A;  2Z0D B;  3KYD D;  4IM3 A;  1YD8 U;  2C7N B;  2J0M A;  1NBF C;  5BO4 B;  4A3P A;  3KUD B;  3S2A A;  3WIM A;  2BYE A;  4GDL A;  3PTF C;  3ML9 A;  4AUQ C;  1H4R A;  3WAO A;  1LQB A;  2MA9 B;  1X1M A;  1YJ1 A;  1V6E A;  2O6V B;  3IHP C;  4GXB A;  2KFK A;  2LRU A;  4F7Z A;  5E6O A;  2KJH B;  1ZGU B;  3KW5 B;  3JSV B;  1M94 A;  3ONS A;  2DX5 B;  2NBW B;  3VUX A;  3L17 A;  3APD A;  2KC2 A;  3EC8 A;  1Q1O A;  2CHZ A;  4DHJ D;  1T0Y A;  2BWF A;  2GOW A;  3K9O B;  3QJZ A;  2K8H A;  5DPS A;  1WJ4 A;  3JW0 X;  4GGQ A;  4ANU A;  3QAR A;  5AZH A;  2KMA A;  1WGR A;  4BBN F;  3TJP A;  2L0T A;  4NQL B;  5KHQ A;  5G2N A;  3N32 A;  4TUU A;  3EFU A;  1FXT B;  4KDI C;  4NAW A;  2NPT A;  1E7V A;  4BBN C;  2G4D B;  3C0R B;  4GDK B;  4XC2 A;  2DAJ A;  2MSE D;  3AXC A;  4FHJ A;  4DXA B;  3OJ4 B;  4WJQ A;  2KDF B;  3DPD A;  3P2B A;  3QK0 A;  4FBJ B;  3ENE A;  2NVU I;  4KIK A;  4K1R B;  1AAR A;  1UGM A;  1P1A A;  4I6L B;  4BKS D;  4IM2 A;  3ZVV A;  2G4S A;  2K8B A;  1GUA B;  3CSF A;  4MJS B;  1NI2 A;  3D32 A;  2EKE C;  4RMA A;  4GMV A;  4A20 A;  2WWZ A;  1WRD B;  3SDL C;  3PS6 A;  2JF5 A;  2K25 A;  4TQ0 A;  1SGH A;  3NZU A;  3OLM D;  1UZX B;  4G50 A;  2DAF A;  3PGE A;  4TKN A;  4B95 A;  4IWQ A;  3L54 A;  3A4S C;  3ZLZ A;  5JHA A;  3CF6 E;  1WY8 A;  4HK2 A;  4NY0 A;  1R4N I;  4KZC A;  1ISN A;  2N9E B;  4RM9 A;  4W9D A;  1U4A A;  3QX1 A;  2DEN B;  2J0J A;  3ZW3 A;  2BKR B;  3VVW B;  5D6J B;  4URK A;  3ML8 A;  3DBR I;  1E5W A;  4W9F A;  2KMC A;  2NPT B;  4NAW B;  3UF8 A;  3A9J A;  4KSK C;  4DWF A;  3BY4 B;  2L0F A;  4WJN A;  1S1Q B;  1YQB A;  4IM0 A;  3PLV A;  2MLB A;  3VUY A;  2KHW B;  3PZD A;  5FR6 A;  2I1J A;  2MP2 B;  2FID A;  2N7D A;  2IO1 B;  3U8Z A;  1WGD A;  4TV3 A;  5AZG A;  4GSW A;  4PYZ A;  1Q0W B;  2N4F A;  3DQV A;  4ZYN A;  5L83 A;  2LXC A;  2HTH A;  5IAA C;  2G3Q B;  2XK5 A;  3PHX B;  4NQK E;  2ZZP B;  4ANX A;  3H9D A;  1Z5S B;  1VD2 A;  2QHO A;  4MDK E;  1P0R A;  1QZE A;  3WA0 A;  4BKG A;  3NZS A;  1YIW A;  4N9F 4;  4BKS A;  1K8R B;  3TIX A;  3MTN B;  4AWJ A;  3BIN A;  1I35 A;  1RLF A;  2KJ6 A;  2KN5 A;  2JZ3 B;  3APC A;  2GBJ A;  2LXA A;  2MBO A;  1RRB A;  1UBQ A;  2PJH A;  3PPA A;  2LGY A;  3V6E B;  3KYC D;  2KLC A;  2N9P C;  1IPG A;  3B0A A;  1H8C A;  1A5R A;  2MW5 A;  1UEL A;  3GZN I;  2N9X A;  5CHF A;  2KQ7 A;  2JY6 A;  3QAQ A;  1WZ0 A;  3RYT A;  3NHE B;  1LFD A;  2LVQ A;  4ICU A;  3CMM B;  3A9J B;  2LGD A;  2O2V A;  2KD0 A;  3SHQ A;  3X23 A;  3W1Y A;  3TMP B;  3AU4 A;  1WZ3 A;  4II2 B;  2RSU A;  4B9K A;  5HKH A;  3ZDT A;  4CHK A;  5JZE B;  2L76 A;  4JIO U;  1RAX A;  1JRU A;  2KTR B;  3PRP B;  2MBB B;  4LDT D;  2GBK A;  4PYU A;  3ZUN A;  2MBH A;  2ZCC A;  3LDZ E;  2JWZ A;  3JVZ X;  2D07 B;  2L3Z A;  2PE9 A;  3L13 A;  4WWP A;  2KTF A;  3RD2 A;  4LJP B;  2N1W A;  2WYQ A;  3MHS D;  3ZNZ B;  1WGH A;  4LJO B;  3ZRF A;  2Z0E B;  1WR1 A;  1WMH B;  3B1L X;  4WWO A;  3RUL A;  1WX7 A;  1TZ1 A;  2LJ5 A;  3L0W B;  3UIN B;  3DBH I;  1WXS A;  4BKT A;  5AZF A;  5L95 C;  4E74 A;  2RD0 A;  3A33 B;  3VFK A;  2V3S A;  1GNU A;  2C60 A;  2UWQ A;  2LAS A;  5JH5 C;  3LJ3 A;  3UGB B;  3VUW A;  3ECI A;  4GU2 A;  4MEL A;  3M3J A;  2FAZ A;  4II3 B;  3DCG A;  2KOX A;  3VTU A;  3VAW A;  1L2N A;  4KVG B;  2VRR B;  1OTR B;  2AEH A;  4BOZ B;  3HM3 A;  2KQS A;  3KVF B;  4ZRI A;  1OEY A;  3AI5 A;  1P9D U;  2C9W B;  1IYF A;  3O65 B;  2JXX A;  2CHW A;  4F8C B;  2DYM A;  3RUI B;  1D3Z A;  2W9N A;  3DOW A;  3RT3 B;  2LI5 A;  3KUC B;  2JRH A;  3DVN V;  2DHZ A;  3VHT C;  3W1S C;  4BFR A;  3ZTC A;  2M4N A;  3UQA A;  2J0K A;  4FJZ A;  4NPN A;  1L7Y A;  3PRE A;  2IO0 B;  2JT4 B;  2REX A;  4W9E A;  5D7G A;  4HDO A;  5G55 A;  1UBI A;  4GDL B;  2K1F A;  4KZ0 A;  3KUZ A;  4K7S A;  2DYB A;  3ZNH B;  2C7H A;  3K9P B;  2ZPY A;  4HCN B;  2L8J A;  4GIV A;  2KFK B;  2KDE B;  1WXA A;  1UH6 A;  2KZR A;  4GOC A;  1C1Y B;  2Y5B B;  4FUL A;  1E8X A;  3WAN A;  2LUE A;  4HPM B;  3PRZ A;  4FLH A;  3ZNI D;  2BYF A;  2HJ8 A;  4NJ6 A;  2L7R A;  3Q3J A;  4G11 A;  4AOF A;  1WX9 A;  2IO3 B;  2OJR A;  3IFW B;  2HE7 A;  2KX0 A;  4JQW C;  1EO6 A;  3NOB A;  4JGH B;  4E71 A;  2KK8 A;  2O6V D;  2D10 A;  2KX3 A;  2JVC A;  2WX1 A;  1OEY J;  4IW0 A;  4FJV B;  1BT0 A;  2KWV B;  2D11 A;  2JZZ A;  3B08 A;  2DZM A;  2PE6 B;  2FCQ A;  3APF A;  2WDT B;  4ANW A;  4JL9 A;  4OVV A;  1WXV A;  1SE9 A;  4K7W A;  3H7P A;  1E8Y A;  4KDL B;  2ZNV C;  2AL3 A;  5LLI A;  4FHK A;  5EDS A;  4KIK B;  2PPH A;  2WX0 A;  4PS3 A;  3QCA A;  1KOT A;  2KAN A;  3DVN U;  4EZJ A;  4XX5 A;  2FUH B;  3HIZ A;  2UYZ B;  3A1Q A;  2I1K A;  1OGW A;  1TGZ B;  4EKU A;  5KHO A;  2MQJ A;  5CHW A;  1UD7 A;  4XZ4 A;  3HK0 A;  1XQQ A;  4G0N B;  3MJW A;  3Q3F A;  2Z59 B;  5C1Z A;  3AU5 A;  1GG3 A;  2LD9 A;  2IZV B;  5J2R A;  2R2Q A;  2CHX A;  1P3Q U;  1WFY A;  1WGG A;  1J19 A;  2GMI C;  2IY0 B;  2LVO A;  2ZEQ A;  4HLE A;  3M95 A;  2L00 B;  5IA7 A;  4AJY B;  5DPW A;  2BWE S;  4FA6 A;  2DZJ A;  4ICV A;  2N1V A;  4DHJ B;  3A9K A;  3R66 C;  3VTW A;  1S3S G;  3PRM B;  1WM3 A;  2FCS A;  1V9J A;  1WM2 A;  2V4L A;  1V5O A;  2NCN A;  4HDQ A;  5DCN A;  3L10 B;  4KSL C;  4P7I A;  3TCA A;  3ZDM C;  3PV1 A;  4BVU C;  4W9J A;  3VH3 B;  2DYO A;  3SU8 X;  2DZI A;  4MEM A;  3JSV A;  3TBL D;  1P98 A;  1WE6 A;  4I6N B;  3IBE A;  3VH4 B;  2LVP A;  4K81 A;  4EEW A;  2FCM A;  3R7R A;  2KDI A;  1R4M I;  3A1Q B;  2XBB C;  3VXW A;  1YX6 B;  4PS8 A;  2XK5 B;  1WR6 E;  2BPS A;  3IG3 A;  1Q5W B;  4DHZ E;  2IBI B;  3QQ8 B;  4ASW C;  2OOB B;  4M0W B;  3QIJ A;  4LCD E;  2KDB A;  2IY1 B;  2KXJ A;  2MX2 A;  2PEA A;  4CO7 A;  2JUO A;  3DDC B;  4MGY E;  3ALB A;  4W9C A;  3PVL A;  4MSM B;  3ZTD A;  4MSQ B;  4IC7 B;  3ZNG C;  2KNB A;  2ZVN A;  4F1S A;  2KKC A;  3QHT A;  3V60 A;  2KC1 A;  4WJP A;  5CX3 A;  4GDK A;  5CHV C;  3L08 A;  1XD3 B;  3A9K B;  4CYE A;  2K8C A;  2R2O A;  2ZVO A;  4GN1 A;  4KV2 A;  1WX8 A;  3T8M A;  2KLG A;  3QC8 B;  1KJT A;  2O2V B;  4BOS C;  3H7S A;  4B6W A;  1Y8R C;  2C7M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...