3ZRCA

Pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zrcA00
3HM3A 3ECIA 3R66C 3K9PB 4B9KA 2KWUB 4PS3A 5AZFA 2N9PC 2R2QA 1WXAA 4A20A 4EFOA 1P98A 4E71A 4FBJB 3UIOB 2KDBA 1YQBA 1UELA 3SHQA 1UBQA 2KDFB 4NQLB 2GOWA 4DDID 2FUHB 1E5WA 3V6CB 4ANXA 5JH5C 3W1YA 3QWZB 4BVUC 4IG7B 1KM7A 4M8MA 4EEWA 2JT4B 1P1AA 4ZYNA 1LM8B 2KQSA 3NZSA 1WGHA 3KUCB 5JZEB 2O2VA 2M0XA 2NBVB 3PT2B 4G3XB 4AP4C 3L0WB 3ZDTA 2LWPA 2D07B 1WM2A 2JVCA 5L83A 3NHEB 1BT0A 3ZLZA 1WE7A 4WJNA 3W1SA 4ICUA 1T0YA 4PYUA 2BWES 4TV3A 3DVGX 1YX6B 4JGHB 2AEHA 2D11A 4HVBA 5J17A 4M0WB 4MM3A 5CHFA 1JRUA 4GB9A 2EKEC 3I3TB 3R7QA 2JY6A 4ASWC 2MBBB 2GBNA 2HJ8A 2LGXA 5CTRC 1PQSA 5D7GA 2KJ6A 4W9JA 3UQAA 2KFKB 5DPTA 1WFYA 2N4FA 4ZRJA 3GZNI 2NS5A 3LJ3A 4DHZE 2L76A 3ML8A 4ANWA 3DQVA 1UH6A 2L7RA 2WWZA 5L95C 2KFJA 2LRUA 3PSEB 4MGKE 2BYFA 2ZNVC 2PE9A 2CHZA 1A5RA 3SDLC 5AZHA 1WM3A 2IYDB 1WGYA 5IA7A 4K1RB 2KTRA 4BOZB 2VRRB 4HCPB 1EUVB 1XD3B 2JXXA 2ZCBA 1WX8A 2RSUA 5LLIA 3HHMA 4KSKC 2WX1A 3S2AA 3ML9A 2EMTA 2JF5A 2HTHA 3U30A 1V9JA 2JRHA 2KMAA 2KZRA 3R3MA 1AARA 2L3ZA 3X0WA 4IC7B 3PZDA 3WAOA 3ZNID 2O6VB 2KTFA 3X23A 1TTNA 3IG3A 2D3GA 2XEWA 3KUDB 4GDLB 1TBEA 1WMHA 1EO6A 2KX0A 2M17A 3L17A 1H4RA 2M4NA 3PS6A 4IM0A 3UF8A 1RFAA 4KDIC 4NAWB 3VTWA 4DHJD 1WX9A 4FJYA 1Z2MA 4HWIB 4MJSA 5LXIB 2KD0A 2N1VA 2V4LA 4ICVA 4FJZA 4RM8A 4CO7A 4W9CA 1U4AA 4GIVA 4LDTD 4KDLB 3UINB 5E6PA 1M94A 3A4RA 4GOCA 4WQOB 3DBSA 2Z0DB 2D10A 3WAMA 3RZFA 3OLMD 4LCDE 1E90A 4I6LB 3IBEA 4FULA 3KW5B 1YD8U 2MBHA 3VHTC 2KXJA 3QHTA 3UQBA 3OJ4B 1J8CA 4W9KA 4GXBA 3EC8A 4MGIE 5DPSA 4G0NB 4MGYE 4BFRA 4EKUA 4GU2A 2KVRA 1GUAB 2LUEA 3ENEA 3OAWA 3JVZX 2DZIA 4KIKB 2K8HA 4NJ7A 5AZGA 2MSED 2DX5B 4MSMB 4ZDVA 3L16A 3P2BA 3RCZA 3KVFB 4WJPA 4CYEA 2IO3B 2MP2B 2M1MA 3KYCD 2LJ5A 2K25A 2N7DA 3WIMA 1WY8A 3DCGA 1E8WA 2ZEQA 4WAAA 3VXWA 2IO1B 2MLBA 2OOBB 1SGHA 1IPGA 3IFWB 3A9KB 5D2MB 2XK5B 3JSVA 4KSLC 2IY0B 3MJWA 4GSWA 4FA6A 4P7IA 5CX3A 2LVQA 3B1LX 2OJRA 1ZW7A 3PVLA 4GGQA 4MELA 2AWTA 2Z59B 2GBJA 2GMIC 4JQWC 2KMCA 1C1YB 4LJPB 3H7PA 1R4MI 1NBFC 5DPRA 3TBLD 3ZUNA 3ZNGC 2NPTA 2L00B 3KH0A 2HE7A 4KZCA 2C60A 2BWFA 3M3JA 3DBRI 3APDA 1EF5A 2DYMA 4X57B 3DDCB 1WYWB 3N32A 3NZUA 1WH3A 1ZGUB 2MQJA 3KUZA 3QA8A 5G55A 2ZZPB 3KYDD 4MGZE 4WWPA 4GDKB 4XZ4A 2CR5A 2MX2A 3L13A 4PS7A 2O2VB 1I35A 4A3OA 1TZ1A 3HIZA 5DPWA 4II2B 2YLMA 4NPNA 1XT9B 1GC6A 2DYBA 3TCAA 5J18A 2FAZA 2GBRA 1V6EA 2WX0A 4ZRIA 2Z0EB 2MWSB 2R2OA 2KJRA 3VTUA 3ZW3A 2REXA 1WZ0A 3AULA 4K7UA 2LRWA 4DHJB 2J0JA 2JPHA 2LI5A 1RLFA 2DZMA 2KK8A 4EZJA 4W9HA 1MG8A 2B3AA 1GG3A 4BKGA 4LDTB 3PV1A 1P9DU 3RULA 3ZTDA 2K6QA 4DWFA 4W9DA 1WGDA 4ANVA 2FCNA 2MBQA 1X1MA 1KOTA 3ZNHB 3CSFA 3O65B 2LXAA 3PREA 3QCAA 2KLGA 2DENB 4AUQC 4DHZB 2L05A 1V81A 2CHWA 2DHZA 4W9EA 5LXHA 2XBBC 1G6JA 2FCSA 2KTRB 3VQIA 3QARA 1E8ZA 2LGDA 1WF9A 5AEKB 4WJQA 4K7SA 4FHJA 2KN5A 2LGYA 4URKA 2LXCA 1VCBA 4TUUA 1LXDA 2BKRB 2K8CA 1WJNA 5FR6A 1NDDA 1OEYA 2G45B 3AI5A 3TL5A 3WAPA 1LQBA 3JYUA 3PHWB 4WWNA 4HPLB 3ZRFA 4JLCA 1V49A 2NCNA 1WJUA 2IY1B 1IP9A 1K8RB 4I6NB 2CKHB 3QQ8B 5TR5A 2ZVOA 1WMHB 3DVNV 3WALA 2GBMA 4HCNB 3AU4A 4NNJB 2KHWB 1KJTA 4MJSB 2K1FA 4EZLA 3JW0X 2KWVB 2GBKA 3T8MA 3M95A 1OTRB 1OQYA 1P0RA 2BGFA 2BYEA 3NS8A 3PHXB 1IYFA 3PRZA 1WGGA 2KOXA 2KC1A 2JZ3B 2K6DB 4HK2A 3H7SA 3IVFA 3RD2A 3M63B 4E3CA 3B0AA 2BPSA 2AL6A 2DZKA 2NR2A 3PRMB 3PLUA 4W9IA 3RUIB 2RGFA 3Q3JA 4II3B 4NY0A 3WANA 1RRBA 4KV2A 1WI0A 3A9JB 3ZKJC 2MW5A 1V2YA 1YJ1A 3TJPA 1Z5SB 2JWZA 1E8YA 5D6JB 3A1QA 3V62A 4EZKA 2LD9A 3QK0A 3ZVVA 2FCMA 2KKCA 2ZPYA 3U8ZA 3NOBA 4F1SA 2KLCA 2Y5BB 4FADA 3A33B 1SE9A 2C5LC 4EUTA 1RAXA 4J6IA 3DVNU 3WA0A 2RPQA 2WDTB 4MSQB 3EFUA 2G4SA 1L2NA 3PRPB 2A5UA 2ZPNA 2J7QB 3SU8X 4GMVA 4W9LA 5G2NA 1NI2A 4BOSC 2M8SA 3IHPC 3JSVB 1GNUA 2FNJB 1WJ6A 3EECA 3TIXA 1CMXB 1KLVA 4YL8A 2DAFA 3LDZE 4KIKA 4IWQA 4XX5A 4F7ZA 1LFDA 4B95A 4IM3A 4BBNC 2CS4A 4HDQA 1V5TA 2ZCCA 1H8CA 1WGRA 3EHVA 2DZJA 3HM6X 4GN1A 3W1SC 2C9WB 2NPTB 4LJOB 2PE6B 1E7VA 1V86A 2MRPA 3QJZA 3AU5A 4NQKE 3DOWA 3DVGY 5BO4B 4MEMA 2V1YA 3A9KA 2XK5A 2I1KA 4HXDA 3VAWA 5JHBA 3ZTCA 2JRIB 2PEAA 3L10B 1J19A 1UD7A 1C3TA 3A4SC 4DDGD 2NBWB 2MBEA 1GC7A 3CF6E 1XQQA 2N9EB 1ZKHA 1WIAA 4TQ0A 1WR1A 3VH3B 2WYQA 3DBLI 4WWOA 2N9XA 3K9OB 4EOYA 2C7NB 5J2RA 3ZIMA 4AOFA 2AYOB 5IAAC 1Q0WB 2FIDA 4DXAB 5C1ZA 4GDKA 2ASQA 4K81A 2UYZB 5KHOA 3D32A 1EF1A 1V5OA 2V3SA 1UZXB 2KC2A 2G4DB 4MDKE 3HK0A 3VUYA 2CU1A 2ZVNA 4RMAA 4BBNF 4IWPA 2LASA 4F8CB 4B6WA 1YIWA 2LVPA 4I6PA 5E6NA 3VH4B 4HPMB 2KQ7A 3NY5A 3N3KB 4JIOU 5DCNA 1OEYJ 4A3PA 4AJWA 1D3ZA 3MTNB 2JUOA 3RYTA 3ZRCA 5E6OA 3VDZA 4IW0A 1Y8RC 5CHVC 1SIFA 4JL9A 1R4NI 3ZNZB 3SD5A 1S1QB 4IUMB 2IBIB 2KANA 1S3SG 2QHOA 3CMMB 2CHXA 3PTFC 4XC2A 3U7DA 2PPHA 3BY4B 2HD5B 2KO3A 2JZZA 2UWQA 3PGEA 4FN2A 2LVOA 2FIFA 1E7UA 3V6EB 2KFKA 4DK5A 2IO0B 2KNBA 3C0RB 2NBUA 3Q3FA 2KWCA 1HE8A 2N1WA 3ALBA 4G11A 4M8NA 1WXSA 4RM9A 4TQ1A 1ISNA 1Q1OA 2IZVB 2J0KA 4AWJA 3V60A 1YX5B 4MH0E 4G50A 2BKFA 2L0FA 3L08A 2PJHA 4BKSA 4PYZA 1TGZB 2BF8B 2KX3A 4K7WA 4W9FA 2DAJA 2K39A 4FJVB 5C23A 1FXTB 5D94A 4E74A 4TKNA 2LZ6A 1WX7A 4HDOA 1WXMA 3BINA 1J0GA 3R7RA 5HKHA 2YVCA 3OJ3A 4CHKA 3V61A 3PLVA 3QC8B 1L7YA 2KJHB 3B08A 2D2QA 2O6VA 4FLHA 3H1UA 1UBIA 2J0MA 2MA9B 3PPAA 2ZNVB 4GDLA 4KVGB 4FHKA 4IM2A 1VD2A 2IO2B 1WR6E 2KDEB 4NAWA 3VFKA 3ZDMC 2W9NA 3AXCA 3APFA 3A1QB 3QAQA 3APCA 3CSTA 5CHWA 2KDIA 3VUXA 2ZJDA 3QX1A 1P3QU 4HJKA 4NJ6A 2L8JA 2MBOA 4HLEA 1Q5WB 2NVUI 3DPDA 3QIJA 5GMVA 1WJ4A 4BKTA 2DYOA 4KZ0A 4W9GA 3UIPB 3GOEA 3L54A 2C7HA 3ONSA 3RZWC 3A9JA 3VUWA 4OVUA 2I1JA 2K8BA 3H9DA 3N30A 1E8XA 1QZEA 3M62B 4DBGA 2G3QB 2MCNB 4OVVA 1UGMA 3TMPB 1F9JA 1WXVA 4ANUA 3VVWB 5KHQA 1OGWA 4BKSD 1WE6A 5JHAA 2A4ZA 2RR9A 5EDSA 2EMSA 1V80A 2AL3A 3H7PB 3T9LA 1GJZA 2MP2A 4IWOA 1I42A 4N9F4 2C7MB 4AJYB 3VTVA 2O6VD 3RT3B 3UGBB 2N7EA 3H6NA 4PS8A 2BYVE 1WRDB 3MHSD 2FCQA 2RD0A 1WZ3A 4ZRKA 3ZO5B 3DBHI 2L0TA 4WJOA
chains in the Genus database with same CATH superfamily
3HM3A 4ARIA 3J9CA 3R66C 1RM6C 2V9HA 5AZFA 2N9PC 1P98A 4FBJB 1PGXA 3UIOB 1DOXA 1YQBA 1WRIA 4XYCA 4LNIA 4NQLB 2GOWA 2FUHB 4HJGE 2INDC 5AUIA 3QWZB 4BVUC 1KM7A 4EEWA 1P1AA 3BYYB 3EFCA 4P1BC 1WGHA 5JZEB 2G9HD 1KLGD 2M0XA 4AP4C 5IN7A 1ZDVA 1QOBA 3AEAB 4ICUA 2FUG1 3W9CB 4N6EB 4RGNA 1PYWD 2AEHA 1VDVA 2D11A 2QEJC 4HVBA 4M0WB 1JRUA 3I3TB 1I4PA 3R7QA 1SXTA 2MBBB 2GBNA 5CTRC 1PQSA 2J53A 4W9JA 1VZ6A 1WFYA 1TJEA 2N4FA 3R2IA 3LJ3A 3PSEB 2WDRB 3SDLC 5IA7A 1D5XC 4HCPB 2R61A 2PW9A 2E3TA 2QDFA 3HHMA 2GLSA 1SE3A 4ZYSA 4C4VB 2WP9B 1V9JA 2KMAA 3HVDA 4A6QA 4XDDA 4HEA1 1WWTA 1XCTL 5DPRA 5G5HA 3L17A 4IM0A 3UF8A 2V4LA 4ICVA 4GIVA 1R4NB 2VH2A 1MG4A 4P16A 3FAHA 4WQOB 2J4XA 1CK1A 2DLBA 4W9KA 4GXBA 3EC8A 4MGIE 1T5XD 3NVVA 2KVRA 4GU2A 2LUEA 1LGRA 2VZKD 5AZGA 1C77A 2BS3B 1YJIA 5T8IA 3KVFB 2XNAC 4CYEA 3KYCD 1P7EA 4WH4A 1SBBB 1E10A 1ZDXA 3AM9A 2Q5WD 4HKZE 2IJ0A 2CU3A 3AE4B 5FK9C 2LVQA 1ZW7A 4GGQA 3PO0A 1SB3C 2GBJA 4LJPB 4KX6B 1R4MI 1L4DB 1P7FA 3AE7B 1L5PA 1EF5A 3QA8A 4L2YA 2YLMA 1QOAA 1XT9B 2DYBA 2FAZA 1HTOA 2GBRA 2WX0A 2R2OA 2KJRA 3ZW3A 3AULA 4K7UA 1YQ4B 2DNFA 2DZMA 2BTEA 4LDTB 4RH6A 3ZNHB 1TS5A 3O65B 3PREA 4EE2A 1FEHA 4YT0B 2I2YA 3Q3NC 1WF9A 4K7SA 1N60A 4URKA 1FPYA 1ZUD2 3AI5A 3JYUA 4WWNA 2NCNA 4LK0M 3T3NA 2CKHB 3QQ8B 3DHHC 2ZVOA 1FCCC 4L1BA 4NNJB 2KACA 3P4PB 3JW0X 1HEZE 1OTRB 2BYEA 2I38A 2OHFA 2AQ3B 2KOXA 2HTME 2JZ3B 4OHJA 4MH8A 3DHIC 3FC4A 4W9IA 3PRMB 2J52A 3GS2A 2M0AA 1D5ZC 4JWUC 4YTPB 3WANA 1RRBA 1E9MA 4YTNB 1YJ1A 4XDCA 3TJPA 2HDEA 2W54A 3IT4B 3FKYA 3EUB2 4LNKA 4KKIA 3U8ZA 3IAS1 3NOBA 1D6EC 5EE0A 4EUTA 2C5LC 1RYJA 1RAXA 1ROEA 2RPQA 4M01A 3PRPB 1IGCA 4BOSC 1GNUA 2QCZA 3E9SA 3EECA 1YN4A 3H8HA 4F7ZA 4XX5A 1JQ4A 1LFDA 1NENB 4BBNC 2CS4A 4HDQA 2C9WB 2PE6B 2MRPA 2WQYB 4RF0A 5BO4B 4IKGA 1XF5L 2DWQA 1TT5B 4HXDA 3VAWA 2MH7A 4MACA 3BIID 2PEAA 1J19A 2INNE 5BYSA 1GC7A 2N9EB 1ZKHA 1WR1A 2WXKA 4J3OD 1MHHE 3K9OB 3V05A 3ZIMA 1N61A 5BMHA 3IT6B 2FIDA 2UYZB 5KHOA 2KC2A 2G4DB 4RMAA 4REZA 4BBNF 1BUIC 3W5UB 2LASA 2N9LA 3KQ4A 2LVPA 4I6PA 4JIOU 1OEYJ 2B76B 3RMKC 4JL9A 2KYWA 2WXHA 2IBIB 2KANA 1S3SG 3PTFC 2CHXA 2UWQA 1E7UA 2KFKA 2IO0B 1XCQL 3Q3FA 4ZOHC 3R8BA 2KAJA 4G11A 4M8NA 5IOIA 1STEA 1AYFA 3V60A 5EE3A 1XO3A 3L08A 5GXGB 2PJHA 4BKSA 3CIRB 4YTMB 5C23A 1FXTB 3RNGC 2LZ6A 1WX7A 4CQNA 2SAKA 5IP4D 3PLVA 2O6VA 3H1UA 2BT6A 4GDLA 4FHKA 1JW9D 4NAWA 2W9NA 3APFA 1FMAD 3CSTA 3BVMA 3VUXA 2WXGA 3GP7A 4NJ6A 2L8JA 2NVUI 1TKGA 3EGRA 3AE5B 1TY0A 1KRHA 4WAFA 3AE3B 2BQQA 3VUWA 1FCLA 2I1JA 3P42A 3AEEB 1IGDA 1E8XA 3TMPB 1F9JA 5KHQA 1OGWA 5BMGA 1JWBD 5EDSA 3MFGA 2AL3A 3H7PB 4IWOA 1M4VA 4ZHOA 3VTVA 2WXIA 1OQQA 4ZRKA 4WJOA 2WDVB 4BZAA 2K5PA 3K9PB 4B9KA 2BS2B 4M00A 1WXAA 4EFOA 1FNUA 3AEFB 3RN9C 1N5XA 1E5WA 5BYRA 4M8MA 1BMLC 3KUCB 3TEXA 1SE4A 3W2DA 3KWVA 3IAM1 4G3XB 3PT2B 1TKYA 1KFYB 1CJEA 2D07B 3AE1B 2JSVX 1FNVA 1ZXHA 1BT0A 1WE7A 4WJNA 3W1SA 1T0YA 3GE3C 2BWES 2PKOA 2N7JA 5CHFA 3Q3OC 4ASWC 4D2KA 3VR9B 1XLQA 5D7GA 3UQAA 2KFKB 5DPTA 4ZRJA 2EELA 2NS5A 4DHZE 2L76A 1UH6A 2L7RA 2KFJA 1XLPA 2CHZA 2PE9A 2RPVA 1WGYA 1EUVB 1XD3B 2OJWA 2RSUA 4KSKC 2WX1A 1J7AA 2VH1A 1V1PA 2EMTA 1PGBA 1VJKA 2AQ1B 2JF5A 2L1AA 2HTHA 1NI3A 2NTTA 2WS3B 1C78A 3X0WA 1FNWA 2O6VB 2D3GA 2W3SA 2XEWA 4GDLB 4K3CA 1WMHA 1EO6A 3VTWA 1RFAA 4KDIC 4NAWB 1WX9A 1Z2MA 2N1VA 4YSXB 4CO7A 1C4PA 3Q3MC 3RNBC 3UINB 2MHJA 3A4RA 4GOCA 3DBSA 1K53A 3RZFA 1C76A 3RPFC 1E90A 2KVZA 3RI7C 3QHTA 3OJ4B 2PIAA 4O1NA 1BXTA 1QQRA 4G0NB 4MGYE 4BFRA 2MJ3A 4Q2JA 5C2TB 1SJED 4KIKB 4NJ7A 4MSMB 1HTQA 4WWMA 1C4CA 2D5GA 1I7HA 2NTSA 2IO3B 1L6VA 2LJ5A 2K25A 2N7DA 3ZJVA 2WXNA 4A9AA 2IO1B 2MLBA 1SE2A 3ZYYX 3MC9A 1XLNA 3B1LX 2OJRA 3PVLA 2AWTA 2GMIC 4JQWC 1K50A 3TBLD 3ZUNA 3I57A 3KWLA 5FKAC 5EE1A 2HE7A 3M3JA 1Q10A 4X57B 3DDCB 1ZGUB 2GB1A 5G55A 3KYDD 4WWPA 4XZ4A 2CR5A 2MX2A 1PUTA 1TZ1A 2G1EA 3HIZA 5DPWA 4NPNA 1GC6A 3TCAA 5J18A 4MT5A 3AE2B 2LRWA 2JPHA 2LI5A 1ESFA 4NAMA 4IOIE 2LFIA 1ET9A 2YEPB 4HROA 1JWSD 2K6QA 3DBHB 4DWFA 2FCNA 2MBQA 2LXAA 4LLGM 1T0QC 5EE9A 3QCAA 2DENB 1V81A 2XBBC 3LB8C 2K0PA 5BYQA 1E8ZA 1EWCA 4WJQA 2KN5A 2LGYA 2VZKB 1V1PB 1LXDA 2BKRB 3TL5A 3WAPA 2N0SB 1V1OA 3RNCC 4HPLB 4RGOS 4WIPA 1WMHB 3WALA 3AU4A 2OEDA 2KHWB 1KJTA 4EZLA 3VRAB 2KWVB 2PMVA 3T8MA 2QJLA 1KTKA 3NS8A 1IYFA 1JALA 3PRZA 3TSSA 1Y56A 2KC1A 1V97A 3H7SA 3M63B 2NR2A 4KGRA 3A9JB 3ZKJC 2MW5A 2LHEA 2JWZA 1ET6A 3V62A 2W55A 3P1MA 1I4XA 2ZPYA 1ENFA 1K51A 1TZOA 2KLCA 2KDMA 4FADA 2KN4A 1TS4A 5BMIA 4J6IA 2WDTB 1QILA 1L2NA 2ZPNA 4QAYA 1NI2A 3B2GA 3P63A 3U2SC 3IHPC 2V4IB 2WXOA 2FNJB 1WJ6A 4N58A 4IM3A 4KGTA 1V5TA 2ZCCA 1QLBB 2DZJA 4GN1A 3W1SC 2JYTA 3NVWA 4P1CC 4NQKE 1FIQA 3DVGY 3FILA 1B1ZA 3A9KA 1JWUD 2XK5A 1T0RC 1C3TA 3R2TA 2NBWB 3Q2AC 2WGSA 3VH3B 3DBLI 3N1ZC 3O13A 2N9XA 1D4BA 2QILA 2C7NB 1L4ZB 2AYOB 5IAAC 3Q8BA 5C1ZA 4GDKA 2ASQA 3AECB 1CZPA 1UZXB 1JWMD 1V8CA 3HK0A 2CU1A 2ZVNA 2D3BA 1VLBA 3PZ7A 5E6JA 1YIWA 1VR9A 4HPMB 1R4MB 5DCNA 4A3PA 4AJWA 1RFKA 3MTNB 4HRSA 5CHVC 3TUOA 3SD5A 4IUMB 4OW0A 4XC2A 3U7DA 2YEPF 1ZXIA 4FN2A 2JZZA 2LVOA 4PT5A 2WXMA 4DK5A 2KWCA 3TEWA 3ALBA 1EU4A 4XWWA 4RM9A 1Q1OA 2J0KA 2IGGA 4AWJA 2L52A 4MH0E 4PYZA 2SEBD 2KX3A 2DAJA 4FJVB 3MC0B 3RNFC 3CWIA 4M02A 4CHKA 3V61A 1MHXA 3QC8B 3Q8EA 2MA9B 2ZNVB 1QKZA 1WR6E 2KDEB 3AE9B 3AXCA 3APCA 5CHWA 3Q6BA 3AV8A 1IUEA 2W82A 1Q5WB 3QIJA 2WNMA 3AEBB 2Z8LA 3UI3A 2C7HA 3RZWC 2K8BA 3H9DA 1D5MC 1F77A 1QZEA 2MCNB 1NYRA 1UGMA 4TMAB 5D3DA 3MC8A 3RNEC 5JHAA 2TSSA 4YWGG 1V80A 1GJZA 1L0YB 4N9F4 2C7MB 1N63A 3RT3B 3UGBB 2N7EA 3FILB 4A8XC 3ZXVA 2RD0A 2CJOA 1QT9A 3ZNID 3ECIA 2KWUB 2R2QA 1UELA 1UBQA 3I5JC 2KDFB 4KGSA 1EU3A 4DDID 1TY2A 3V6CB 5JH5C 3W1YA 4ZYNA 1LM8B 2INPE 2KQSA 3NZSA 1R7SA 2WXLA 4OVZA 4USAA 2O2VA 4DQOC 3RNAC 3ZDTA 2LWPA 3I9V1 1WM2A 1I4HA 3NHEB 2MEKA 3EA6A 3GE8C 4PYUA 4C80A 4TV3A 3DVGX 4B0EA 1YX6B 4JGHB 5J17A 4MM3A 2JY6A 2HJ8A 4DXFA 3ETRA 3GZNI 3OWEB 3P4SB 4RFBA 3ML8A 2WWZA 2LRUA 2ZNVC 1A5RA 3U52E 4K1RB 2KTRA 2IGDA 4BOZB 2VRRB 2WXPA 5LLIA 2BW2A 4C00A 3ML9A 1F2RI 1A70A 3U30A 3MP9A 2JRHA 3BZDB 3R3MA 3P4QB 2L3ZA 2LJIA 2KTFA 1TTNA 3IG3A 3KUDB 4ZRQA 1TBEA 2M17A 1H4RA 2M4NA 3PS6A 4DHJD 4FJYA 5LXIB 4FJZA 4W9CA 2QMTA 1VZ8A 5LNK1 5TSSA 2D3CA 3IBEA 2MBHA 1QF6A 2JU6X 1GOZA 4EKUA 2W3RA 3NG0A 1GUAB 4LNOA 3JVZX 2E6XA 3B9JA 3L16A 3P2BA 3RCZA 2CJNA 1KLUD 1PGAA 2ZEQA 4WAAA 1WXQA 3VXWA 2L32A 1AWDA 2OOBB 1SGHA 2JYEA 3IFWB 2BB5A 2GI9A 2WDQB 3SR6A 2IY0B 3MJWA 4GSWA 1DYQA 3N20C 3AH7A 2MJEA 4MELA 2Z59B 4RF1A 1XEEA 1NBFC 4YSYB 2RDBC 3KH0A 4KZCA 2C60A 2HJ1A 3DBRI 2DYMA 3N32A 1L0VB 3NZUA 1N5WA 2INCC 3KUZA 3L13A 4PS7A 2O2VB 4II2B 4PK1A 4ZRIA 2IDYA 1WSPA 2MWSB 2REXA 1WZ0A 3AMZA 2J0JA 1FO4A 1RLFA 2KK8A 3HUIA 4W9HA 1SIJA 1MG8A 2B3AA 2XN9C 4NZLB 1B9RA 1P9DU 4W9DA 1WGDA 2Y3AA 1NYQA 4ANVA 1X1MA 1YOVB 4WQMA 2QIEB 2LGIA 2K3UA 2DHZA 4W9EA 5LXHA 1XXGA 1G6JA 2KTRB 3VQIA 3B2FA 1AW7A 2MJDA 4M0WA 2RDGA 4TUUA 1WJNA 5FR6A 2G45B 1OEYA 5C3JB 1EM7A 3PHWB 3ZRFA 4JLCA 1WJUA 3Q8AA 2H88B 2IY1B 4IDIA 1K8RB 4I6NB 2Y5PA 3SFEB 4HCNB 2K1FA 2N9KA 2KT7A 2BGFA 1OQYA 1P0RA 2KQ4X 1JWAD 3BVGA 2PLPA 4HK2A 5HHDG 3Q8CA 4H2AA 2LGSA 4E3CA 3B0AA 3V3XA 2AL6A 3RUIB 3PLUA 1C79A 4ZHPA 3Q3JA 4II3B 1FFVA 4KV2A 1WI0A 1V2YA 1E8YA 5D6JB 2LUMA 3MHZA 2EKIA 3NRZA 3VRBB 4EZKA 3ZVVA 2FCMA 1HZ5A 3Q69A 4XE0A 2JWUA 2Y5BB 3A33B 1SE9A 2FE8A 3DVNU 1WGKA 3TEYA 1TS3A 3EFUA 2G4SA 2ON8A 1FFUA 2A5UA 2J7QB 4GMVA 4W9LA 5G2NA 4JX1C 5H92C 2KMMA 2ACZB 2DAFA 3LDZE 4IWQA 4B95A 1AN8A 1H8CA 3HM6X 3EHVA 4LJOB 1V86A 1E7VA 3QJZA 3AU5A 3DOWA 1E7PB 3N1XC 3C8YA 4TSSA 5HFYA 2I1KA 3LYYA 5JHBA 3DHGC 3ZTCA 2JRIB 3MJ5A 5G5GA 1UD7A 2ZW1A 2MBEA 1WIAA 4TQ0A 3AEDB 3PZ8A 2WYQA 4WWOA 1HQRD 1ACCA 2K22A 3NJTA 2BB6A 2WXJA 1T6BX 3D32A 2V3SA 4MDKE 1TYGB 3VUYA 4NJCA 2KQ7A 4JWSC 4DXGA 4AS1A 2GRIA 1T3QA 3ZJTA 1D3ZA 3ZRCA 4P6VF 5E6OA 2KWDA 4IW0A 1ZE3D 1SIFA 1R4NI 2QC8A 1S1QB 3ZNZB 3NS1A 3OG5A 2QHOA 2LEKA 2PPHA 2HD5B 2KO3A 4RGMA 2FIFA 1DOIA 3V6EB 2ONQA 3C0RB 2PTLA 2IPKD 3DWGC 2N1WA 1XLOA 2ZW0A 4TQ1A 1QOGA 2IZVB 2M56B 4HKQA 5D3IB 2L0FA 4RGTA 1TGZB 4K7WA 1I4RA 4K3BA 4US9A 4TKNA 3BINA 3KLSX 3R7RA 1J0GA 3OJ3A 1L7YA 4FLHA 2D2QA 1C4AA 3ZQ4A 1VD2A 3ZDMC 2FBWB 4OZCA 1GB1A 1F52A 3QAQA 2KDIA 2ZJDA 3QX1A 1P3QU 4HJKA 2MBOA 4HLEA 1CQVA 1WJ4A 4BKTA 3T3OA 2DBYA 2DYOA 4KZ0A 4W9GA 3UIPB 3GOEA 3L54A 4US8A 4OVUA 2LHDA 3N30A 3U7ZA 2JQRB 3M62B 2G3QB 3VVWB 3AEGB 2RR9A 2EMSA 1VZ7A 3T9LA 2RDHA 2MP2A 1I42A 2AX5A 4C56C 1LO5D 4PS8A 2BYVE 1WRDB 2FCQA 1WZ3A 3ZO5B 4RM8A 2L0TA 1MJDA 4PS3A 4A20A 4E71A 1NVID 2Y5CA 2KDBA 3SHQA 2PVGC 2RMMA 4ANXA 5HI1A 4IG7B 4C7ZA 4A55A 3GB1A 2JT4B 3NVYA 3N1YC 2NBVB 3L0WB 3Q14C 4R3DA 2JVCA 3URYA 5L83A 1NEKB 1HA5A 3ZLZA 1UUPA 4XWTA 4KKJA 1N62A 4N59A 4GB9A 2EKEC 2LGXA 2WU5B 3SFDB 2KJ6A 2LMCA 1ZPSA 4GLSC 4ANWA 3DQVA 5L95C 4MGKE 1KH0A 2BYFA 1L6UA 2L83A 5H8YE 5AZHA 1WM3A 2IYDB 3DBLB 4OZBA 2JXXA 2ZCBA 2WHIA 3BYTB 1WX8A 1FXIA 1FD6A 3BK2A 1J7CA 1L0XB 1JCKB 3S2AA 2KZRA 1F0ZA 1AARA 4IC7B 3PZDA 3WAOA 4HPPA 1DOYA 4L23A 3X23A 1JROA 2KX0A 4DHZB 4MJSA 4HWIB 1KF6B 2KD0A 1PDXA 1U4AA 4LDTD 4KDLB 4JPSA 2QSDA 5E6PA 1E0ZA 1M94A 3C19A 2Z0DB 2D10A 3WAMA 3OLMD 4LCDE 4I6LB 4LTUA 4FULA 1I4GA 1YD8U 3KW5B 1EWYC 3VHTC 4ITKA 2KXJA 1GAQB 3UQBA 1J8CA 5DPSA 3LXFA 3ENEA 3OAWA 2DZIA 2K8HA 2MSED 2DX5B 4ZDVA 4S17A 4WJPA 2MP2B 2M1MA 3WIMA 1MFWA 1WY8A 1E8WA 3DCGA 4ARCA 2BVCA 1IPGA 5D2MB 3A9KB 2X8XX 2XK5B 3JSVA 4KSLC 4FA6A 1JRPA 4P7IA 1OFFA 5CX3A 2KMCA 1C1YB 3H7PA 1SSNA 3ZNGC 2NPTA 2L00B 3ZGZA 2BWFA 3W5VB 3APDA 3NVZA 1IBXA 1YN3A 1WYWB 1WH3A 2MQJA 2ZZPB 4MGZE 3ZXRA 4GDKB 1I35A 3AE6B 4A3OA 1UGJA 5I4DA 2D3AA 3VR8B 1V6EA 2Z0EB 3P4RB 1YN5A 3VTUA 4ACFA 3AB5A 4DHJB 1MI0A 1UNSA 4EZJA 1YMHE 1GG3A 3I63C 4BKGA 4AQ7A 3PV1A 4S0RA 3RULA 5MPOA 3BVZA 3ZTDA 2JXTA 2V3PA 3Q8FA 1JMLA 3RFZB 1KOTA 4B0MA 3CSFA 2ICIA 2KLGA 2BYTA 1UWXA 4AUQC 2L05A 2CHWA 2FCSA 3QARA 2LGDA 1SF0A 5AEKB 3HVZA 4FHJA 4LNNA 2M19A 1FXAA 2LXCA 1VCBA 2K8CA 2WLBA 1NDDA 1LQBA 1V49A 1IP9A 5TR5A 1FRDA 2K9XA 4YSZB 3DVNV 2GBMA 4MJSB 2JX5A 2GBKA 3M95A 3PHXB 1WGGA 2H89B 3N9YC 1ZP0B 2K6DB 3IVFA 3RD2A 1K52A 1YJJA 2BPSA 2DZKA 2RGFA 3GZNB 4NY0A 3NZ3A 1Z5SB 1FM0D 3SEBA 3A1QA 3HRDD 1UWMA 1DGJA 2LD9A 3QK0A 3U4EG 5JXVA 2KKCA 4F1SA 3WA0A 4FXCA 4MSQB 3SU8X 2IGHA 2M8SA 3JSVB 3TIXA 1CMXB 1KLVA 4YL8A 1N6ZA 4KIKA 4BAXA 2V3NA 1I4QA 1GB4A 1WGRA 2NPTB 1RWSA 3ABVB 3L4PA 1IBXB 4MEMA 2V1YA 1HZ6A 4XGAB 3L10B 3A4SC 4DDGD 3CF6E 1XQQA 4LNFA 2PVOD 5HG2A 4EOYA 1TKEA 4RCOA 5J2RA 2BBCA 1VRAB 3BWUD 5AUKA 4AOFA 1Q0WB 4MM3B 4UDUC 4DXAB 4K81A 1SEBD 1EF1A 1V5OA 5IO9A 2BS4B 3IXSA 5IKCM 2WXRA 4IWPA 2WXFA 2V0GA 4F8CB 1TIFA 4B6WA 5E6NA 3VH4B 1WYGA 1ZOYB 3NY5A 1T0SC 3N3KB 2JUOA 3RYTA 1GPXA 2WXQA 3VDZA 1Y8RC 1J7BA 3AE8B 2JZPA 3DBRB 4DBGA 3CMMB 3BY4B 2UU7A 3PGEA 4OZAA 2KNBA 2NBUA 1HE8A 4C7YA 4A90A 1WXSA 1ISNA 1YX5B 3E56A 4G50A 2BKFA 3BK1A 4ZRPA 2BF8B 1HXYD 4W9FA 2K39A 1SJHD 5D94A 4E74A 1F2RC 4C4VA 4HDOA 1WXMA 3AN1A 1QOFA 5HKHA 2YVCA 1FRRA 1OQRA 3B08A 1YQ3B 2KJHB 1UBIA 2J0MA 3PPAA 4KVGB 4IM2A 3NUHB 1PFDA 3VFKA 2IO2B 2WU2B 3TEZA 3A1QB 1E6EB 1F1HA 2J42A 3DPDA 4YXDB 5GMVA 1MPEA 2NMQA 4RNAA 2AQ2B 3ONSA 3ZJUA 1TS2A 3A9JA 1MVKA 3WCQA 4OVVA 2X38A 1WXVA 4ANUA 3DWMA 4BKSD 1WE6A 5FR3A 2A4ZA 4JE3B 4WURA 1C9FA 1YNTE 4AJYB 2O6VD 3H6NA 3MHSD 1UF0A 3DBHI
chains in the Genus database with same CATH topology
3HM3A 3ECIA 3R66C 3K9PB 4B9KA 2KWUB 4PS3A 5AZFA 2N9PC 2R2QA 1WXAA 4A20A 4EFOA 1P98A 4E71A 4FBJB 3UIOB 2KDBA 1YQBA 1UELA 3SHQA 1UBQA 2KDFB 4NQLB 2GOWA 4DDID 2FUHB 1E5WA 3V6CB 4ANXA 5JH5C 3W1YA 3QWZB 4BVUC 4IG7B 1KM7A 4M8MA 4EEWA 2JT4B 1P1AA 4ZYNA 1LM8B 2KQSA 3NZSA 1WGHA 3KUCB 5JZEB 2O2VA 2M0XA 2NBVB 3PT2B 4G3XB 4AP4C 3L0WB 3ZDTA 2LWPA 2D07B 1WM2A 2JVCA 5L83A 3NHEB 1BT0A 3ZLZA 1WE7A 4WJNA 3W1SA 4ICUA 1T0YA 4PYUA 2BWES 4TV3A 3DVGX 1YX6B 4JGHB 2AEHA 2D11A 4HVBA 5J17A 4M0WB 4MM3A 5CHFA 1JRUA 4GB9A 2EKEC 3I3TB 3R7QA 2JY6A 4ASWC 2MBBB 2GBNA 2HJ8A 2LGXA 5CTRC 1PQSA 5D7GA 2KJ6A 4W9JA 3UQAA 2KFKB 5DPTA 1WFYA 2N4FA 4ZRJA 3GZNI 2NS5A 3LJ3A 4DHZE 2L76A 3ML8A 4ANWA 3DQVA 1UH6A 2L7RA 2WWZA 5L95C 2KFJA 2LRUA 3PSEB 4MGKE 2BYFA 2ZNVC 2PE9A 2CHZA 1A5RA 3SDLC 5AZHA 1WM3A 2IYDB 1WGYA 5IA7A 4K1RB 2KTRA 4BOZB 2VRRB 4HCPB 1EUVB 1XD3B 2JXXA 2ZCBA 1WX8A 2RSUA 5LLIA 3HHMA 4KSKC 2WX1A 3S2AA 3ML9A 2EMTA 2JF5A 2HTHA 3U30A 1V9JA 2JRHA 2KMAA 2KZRA 3R3MA 1AARA 2L3ZA 3X0WA 4IC7B 3PZDA 3WAOA 3ZNID 2O6VB 2KTFA 3X23A 1TTNA 3IG3A 2D3GA 2XEWA 3KUDB 4GDLB 1TBEA 1WMHA 1EO6A 2KX0A 2M17A 3L17A 1H4RA 2M4NA 3PS6A 4IM0A 3UF8A 1RFAA 4KDIC 4NAWB 3VTWA 4DHJD 1WX9A 4FJYA 1Z2MA 4HWIB 4MJSA 5LXIB 2KD0A 2N1VA 2V4LA 4ICVA 4FJZA 4RM8A 4CO7A 4W9CA 1U4AA 4GIVA 4LDTD 4KDLB 3UINB 5E6PA 1M94A 3A4RA 4GOCA 4WQOB 3DBSA 2Z0DB 2D10A 3WAMA 3RZFA 3OLMD 4LCDE 1E90A 4I6LB 3IBEA 4FULA 3KW5B 1YD8U 2MBHA 3VHTC 2KXJA 3QHTA 3UQBA 3OJ4B 1J8CA 4W9KA 4GXBA 3EC8A 4MGIE 5DPSA 4G0NB 4MGYE 4BFRA 4EKUA 4GU2A 2KVRA 1GUAB 2LUEA 3ENEA 3OAWA 3JVZX 2DZIA 4KIKB 2K8HA 4NJ7A 5AZGA 2MSED 2DX5B 4MSMB 4ZDVA 3L16A 3P2BA 3RCZA 3KVFB 4WJPA 4CYEA 2IO3B 2MP2B 2M1MA 3KYCD 2LJ5A 2K25A 2N7DA 3WIMA 1WY8A 3DCGA 1E8WA 2ZEQA 4WAAA 3VXWA 2IO1B 2MLBA 2OOBB 1SGHA 1IPGA 3IFWB 3A9KB 5D2MB 2XK5B 3JSVA 4KSLC 2IY0B 3MJWA 4GSWA 4FA6A 4P7IA 5CX3A 2LVQA 3B1LX 2OJRA 1ZW7A 3PVLA 4GGQA 4MELA 2AWTA 2Z59B 2GBJA 2GMIC 4JQWC 2KMCA 1C1YB 4LJPB 3H7PA 1R4MI 1NBFC 5DPRA 3TBLD 3ZUNA 3ZNGC 2NPTA 2L00B 3KH0A 2HE7A 4KZCA 2C60A 2BWFA 3M3JA 3DBRI 3APDA 1EF5A 2DYMA 4X57B 3DDCB 1WYWB 3N32A 3NZUA 1WH3A 1ZGUB 2MQJA 3KUZA 3QA8A 5G55A 2ZZPB 3KYDD 4MGZE 4WWPA 4GDKB 4XZ4A 2CR5A 2MX2A 3L13A 4PS7A 2O2VB 1I35A 4A3OA 1TZ1A 3HIZA 5DPWA 4II2B 2YLMA 4NPNA 1XT9B 1GC6A 2DYBA 3TCAA 5J18A 2FAZA 2GBRA 1V6EA 2WX0A 4ZRIA 2Z0EB 2MWSB 2R2OA 2KJRA 3VTUA 3ZW3A 2REXA 1WZ0A 3AULA 4K7UA 2LRWA 4DHJB 2J0JA 2JPHA 2LI5A 1RLFA 2DZMA 2KK8A 4EZJA 4W9HA 1MG8A 2B3AA 1GG3A 4BKGA 4LDTB 3PV1A 1P9DU 3RULA 3ZTDA 2K6QA 4DWFA 4W9DA 1WGDA 4ANVA 2FCNA 2MBQA 1X1MA 1KOTA 3ZNHB 3CSFA 3O65B 2LXAA 3PREA 3QCAA 2KLGA 2DENB 4AUQC 4DHZB 2L05A 1V81A 2CHWA 2DHZA 4W9EA 5LXHA 2XBBC 1G6JA 2FCSA 2KTRB 3VQIA 3QARA 1E8ZA 2LGDA 1WF9A 5AEKB 4WJQA 4K7SA 4FHJA 2KN5A 2LGYA 4URKA 2LXCA 1VCBA 4TUUA 1LXDA 2BKRB 2K8CA 1WJNA 5FR6A 1NDDA 1OEYA 2G45B 3AI5A 3TL5A 3WAPA 1LQBA 3JYUA 3PHWB 4WWNA 4HPLB 3ZRFA 4JLCA 1V49A 2NCNA 1WJUA 2IY1B 1IP9A 1K8RB 4I6NB 2CKHB 3QQ8B 5TR5A 2ZVOA 1WMHB 3DVNV 3WALA 2GBMA 4HCNB 3AU4A 4NNJB 2KHWB 1KJTA 4MJSB 2K1FA 4EZLA 3JW0X 2KWVB 2GBKA 3T8MA 3M95A 1OTRB 1OQYA 1P0RA 2BGFA 2BYEA 3NS8A 3PHXB 1IYFA 3PRZA 1WGGA 2KOXA 2KC1A 2JZ3B 2K6DB 4HK2A 3H7SA 3IVFA 3RD2A 3M63B 4E3CA 3B0AA 2BPSA 2AL6A 2DZKA 2NR2A 3PRMB 3PLUA 4W9IA 3RUIB 2RGFA 3Q3JA 4II3B 4NY0A 3WANA 1RRBA 4KV2A 1WI0A 3A9JB 3ZKJC 2MW5A 1V2YA 1YJ1A 3TJPA 1Z5SB 2JWZA 1E8YA 5D6JB 3A1QA 3V62A 4EZKA 2LD9A 3QK0A 3ZVVA 2FCMA 2KKCA 2ZPYA 3U8ZA 3NOBA 4F1SA 2KLCA 2Y5BB 4FADA 3A33B 1SE9A 2C5LC 4EUTA 1RAXA 4J6IA 3DVNU 3WA0A 2RPQA 2WDTB 4MSQB 3EFUA 2G4SA 1L2NA 3PRPB 2A5UA 2ZPNA 2J7QB 3SU8X 4GMVA 4W9LA 5G2NA 1NI2A 4BOSC 2M8SA 3IHPC 3JSVB 1GNUA 2FNJB 1WJ6A 3EECA 3TIXA 1CMXB 1KLVA 4YL8A 2DAFA 3LDZE 4KIKA 4IWQA 4XX5A 4F7ZA 1LFDA 4B95A 4IM3A 4BBNC 2CS4A 4HDQA 1V5TA 2ZCCA 1H8CA 1WGRA 3EHVA 2DZJA 3HM6X 4GN1A 3W1SC 2C9WB 2NPTB 4LJOB 2PE6B 1E7VA 1V86A 2MRPA 3QJZA 3AU5A 4NQKE 3DOWA 3DVGY 5BO4B 4MEMA 2V1YA 3A9KA 2XK5A 2I1KA 4HXDA 3VAWA 5JHBA 3ZTCA 2JRIB 2PEAA 3L10B 1J19A 1UD7A 1C3TA 3A4SC 4DDGD 2NBWB 2MBEA 1GC7A 3CF6E 1XQQA 2N9EB 1ZKHA 1WIAA 4TQ0A 1WR1A 3VH3B 2WYQA 3DBLI 4WWOA 2N9XA 3K9OB 4EOYA 2C7NB 5J2RA 3ZIMA 4AOFA 2AYOB 5IAAC 1Q0WB 2FIDA 4DXAB 5C1ZA 4GDKA 2ASQA 4K81A 2UYZB 5KHOA 3D32A 1EF1A 1V5OA 2V3SA 1UZXB 2KC2A 2G4DB 4MDKE 3HK0A 3VUYA 2CU1A 2ZVNA 4RMAA 4BBNF 4IWPA 2LASA 4F8CB 4B6WA 1YIWA 2LVPA 4I6PA 5E6NA 3VH4B 4HPMB 2KQ7A 3NY5A 3N3KB 4JIOU 5DCNA 1OEYJ 4A3PA 4AJWA 1D3ZA 3MTNB 2JUOA 3RYTA 3ZRCA 5E6OA 3VDZA 4IW0A 1Y8RC 5CHVC 1SIFA 4JL9A 1R4NI 3ZNZB 3SD5A 1S1QB 4IUMB 2IBIB 2KANA 1S3SG 2QHOA 3CMMB 2CHXA 3PTFC 4XC2A 3U7DA 2PPHA 3BY4B 2HD5B 2KO3A 2JZZA 2UWQA 3PGEA 4FN2A 2LVOA 2FIFA 1E7UA 3V6EB 2KFKA 4DK5A 2IO0B 2KNBA 3C0RB 2NBUA 3Q3FA 2KWCA 1HE8A 2N1WA 3ALBA 4G11A 4M8NA 1WXSA 4RM9A 4TQ1A 1ISNA 1Q1OA 2IZVB 2J0KA 4AWJA 3V60A 1YX5B 4MH0E 4G50A 2BKFA 2L0FA 3L08A 2PJHA 4BKSA 4PYZA 1TGZB 2BF8B 2KX3A 4K7WA 4W9FA 2DAJA 2K39A 4FJVB 5C23A 1FXTB 5D94A 4E74A 4TKNA 2LZ6A 1WX7A 4HDOA 1WXMA 3BINA 1J0GA 3R7RA 5HKHA 2YVCA 3OJ3A 4CHKA 3V61A 3PLVA 3QC8B 1L7YA 2KJHB 3B08A 2D2QA 2O6VA 4FLHA 3H1UA 1UBIA 2J0MA 2MA9B 3PPAA 2ZNVB 4GDLA 4KVGB 4FHKA 4IM2A 1VD2A 2IO2B 1WR6E 2KDEB 4NAWA 3VFKA 3ZDMC 2W9NA 3AXCA 3APFA 3A1QB 3QAQA 3APCA 3CSTA 5CHWA 2KDIA 3VUXA 2ZJDA 3QX1A 1P3QU 4HJKA 4NJ6A 2L8JA 2MBOA 4HLEA 1Q5WB 2NVUI 3DPDA 3QIJA 5GMVA 1WJ4A 4BKTA 2DYOA 4KZ0A 4W9GA 3UIPB 3GOEA 3L54A 2C7HA 3ONSA 3RZWC 3A9JA 3VUWA 4OVUA 2I1JA 2K8BA 3H9DA 3N30A 1E8XA 1QZEA 3M62B 4DBGA 2G3QB 2MCNB 4OVVA 1UGMA 3TMPB 1F9JA 1WXVA 4ANUA 3VVWB 5KHQA 1OGWA 4BKSD 1WE6A 5JHAA 2A4ZA 2RR9A 5EDSA 2EMSA 1V80A 2AL3A 3H7PB 3T9LA 1GJZA 2MP2A 4IWOA 1I42A 4N9F4 2C7MB 4AJYB 3VTVA 2O6VD 3RT3B 3UGBB 2N7EA 3H6NA 4PS8A 2BYVE 1WRDB 3MHSD 2FCQA 2RD0A 1WZ3A 4ZRKA 3ZO5B 3DBHI 2L0TA 4WJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HM3 A;  3ECI A;  3R66 C;  3K9P B;  4B9K A;  2KWU B;  4PS3 A;  5AZF A;  2N9P C;  2R2Q A;  1WXA A;  4A20 A;  4EFO A;  1P98 A;  4E71 A;  4FBJ B;  3UIO B;  2KDB A;  1YQB A;  1UEL A;  3SHQ A;  1UBQ A;  2KDF B;  4NQL B;  2GOW A;  4DDI D;  2FUH B;  1E5W A;  3V6C B;  4ANX A;  5JH5 C;  3W1Y A;  3QWZ B;  4BVU C;  4IG7 B;  1KM7 A;  4M8M A;  4EEW A;  2JT4 B;  1P1A A;  4ZYN A;  1LM8 B;  2KQS A;  3NZS A;  1WGH A;  3KUC B;  5JZE B;  2O2V A;  2M0X A;  2NBV B;  3PT2 B;  4G3X B;  4AP4 C;  3L0W B;  3ZDT A;  2LWP A;  2D07 B;  1WM2 A;  2JVC A;  5L83 A;  3NHE B;  1BT0 A;  3ZLZ A;  1WE7 A;  4WJN A;  3W1S A;  4ICU A;  1T0Y A;  4PYU A;  2BWE S;  4TV3 A;  3DVG X;  1YX6 B;  4JGH B;  2AEH A;  2D11 A;  4HVB A;  5J17 A;  4M0W B;  4MM3 A;  5CHF A;  1JRU A;  4GB9 A;  2EKE C;  3I3T B;  3R7Q A;  2JY6 A;  4ASW C;  2MBB B;  2GBN A;  2HJ8 A;  2LGX A;  5CTR C;  1PQS A;  5D7G A;  2KJ6 A;  4W9J A;  3UQA A;  2KFK B;  5DPT A;  1WFY A;  2N4F A;  4ZRJ A;  3GZN I;  2NS5 A;  3LJ3 A;  4DHZ E;  2L76 A;  3ML8 A;  4ANW A;  3DQV A;  1UH6 A;  2L7R A;  2WWZ A;  5L95 C;  2KFJ A;  2LRU A;  3PSE B;  4MGK E;  2BYF A;  2ZNV C;  2PE9 A;  2CHZ A;  1A5R A;  3SDL C;  5AZH A;  1WM3 A;  2IYD B;  1WGY A;  5IA7 A;  4K1R B;  2KTR A;  4BOZ B;  2VRR B;  4HCP B;  1EUV B;  1XD3 B;  2JXX A;  2ZCB A;  1WX8 A;  2RSU A;  5LLI A;  3HHM A;  4KSK C;  2WX1 A;  3S2A A;  3ML9 A;  2EMT A;  2JF5 A;  2HTH A;  3U30 A;  1V9J A;  2JRH A;  2KMA A;  2KZR A;  3R3M A;  1AAR A;  2L3Z A;  3X0W A;  4IC7 B;  3PZD A;  3WAO A;  3ZNI D;  2O6V B;  2KTF A;  3X23 A;  1TTN A;  3IG3 A;  2D3G A;  2XEW A;  3KUD B;  4GDL B;  1TBE A;  1WMH A;  1EO6 A;  2KX0 A;  2M17 A;  3L17 A;  1H4R A;  2M4N A;  3PS6 A;  4IM0 A;  3UF8 A;  1RFA A;  4KDI C;  4NAW B;  3VTW A;  4DHJ D;  1WX9 A;  4FJY A;  1Z2M A;  4HWI B;  4MJS A;  5LXI B;  2KD0 A;  2N1V A;  2V4L A;  4ICV A;  4FJZ A;  4RM8 A;  4CO7 A;  4W9C A;  1U4A A;  4GIV A;  4LDT D;  4KDL B;  3UIN B;  5E6P A;  1M94 A;  3A4R A;  4GOC A;  4WQO B;  3DBS A;  2Z0D B;  2D10 A;  3WAM A;  3RZF A;  3OLM D;  4LCD E;  1E90 A;  4I6L B;  3IBE A;  4FUL A;  3KW5 B;  1YD8 U;  2MBH A;  3VHT C;  2KXJ A;  3QHT A;  3UQB A;  3OJ4 B;  1J8C A;  4W9K A;  4GXB A;  3EC8 A;  4MGI E;  5DPS A;  4G0N B;  4MGY E;  4BFR A;  4EKU A;  4GU2 A;  2KVR A;  1GUA B;  2LUE A;  3ENE A;  3OAW A;  3JVZ X;  2DZI A;  4KIK B;  2K8H A;  4NJ7 A;  5AZG A;  2MSE D;  2DX5 B;  4MSM B;  4ZDV A;  3L16 A;  3P2B A;  3RCZ A;  3KVF B;  4WJP A;  4CYE A;  2IO3 B;  2MP2 B;  2M1M A;  3KYC D;  2LJ5 A;  2K25 A;  2N7D A;  3WIM A;  1WY8 A;  3DCG A;  1E8W A;  2ZEQ A;  4WAA A;  3VXW A;  2IO1 B;  2MLB A;  2OOB B;  1SGH A;  1IPG A;  3IFW B;  3A9K B;  5D2M B;  2XK5 B;  3JSV A;  4KSL C;  2IY0 B;  3MJW A;  4GSW A;  4FA6 A;  4P7I A;  5CX3 A;  2LVQ A;  3B1L X;  2OJR A;  1ZW7 A;  3PVL A;  4GGQ A;  4MEL A;  2AWT A;  2Z59 B;  2GBJ A;  2GMI C;  4JQW C;  2KMC A;  1C1Y B;  4LJP B;  3H7P A;  1R4M I;  1NBF C;  5DPR A;  3TBL D;  3ZUN A;  3ZNG C;  2NPT A;  2L00 B;  3KH0 A;  2HE7 A;  4KZC A;  2C60 A;  2BWF A;  3M3J A;  3DBR I;  3APD A;  1EF5 A;  2DYM A;  4X57 B;  3DDC B;  1WYW B;  3N32 A;  3NZU A;  1WH3 A;  1ZGU B;  2MQJ A;  3KUZ A;  3QA8 A;  5G55 A;  2ZZP B;  3KYD D;  4MGZ E;  4WWP A;  4GDK B;  4XZ4 A;  2CR5 A;  2MX2 A;  3L13 A;  4PS7 A;  2O2V B;  1I35 A;  4A3O A;  1TZ1 A;  3HIZ A;  5DPW A;  4II2 B;  2YLM A;  4NPN A;  1XT9 B;  1GC6 A;  2DYB A;  3TCA A;  5J18 A;  2FAZ A;  2GBR A;  1V6E A;  2WX0 A;  4ZRI A;  2Z0E B;  2MWS B;  2R2O A;  2KJR A;  3VTU A;  3ZW3 A;  2REX A;  1WZ0 A;  3AUL A;  4K7U A;  2LRW A;  4DHJ B;  2J0J A;  2JPH A;  2LI5 A;  1RLF A;  2DZM A;  2KK8 A;  4EZJ A;  4W9H A;  1MG8 A;  2B3A A;  1GG3 A;  4BKG A;  4LDT B;  3PV1 A;  1P9D U;  3RUL A;  3ZTD A;  2K6Q A;  4DWF A;  4W9D A;  1WGD A;  4ANV A;  2FCN A;  2MBQ A;  1X1M A;  1KOT A;  3ZNH B;  3CSF A;  3O65 B;  2LXA A;  3PRE A;  3QCA A;  2KLG A;  2DEN B;  4AUQ C;  4DHZ B;  2L05 A;  1V81 A;  2CHW A;  2DHZ A;  4W9E A;  5LXH A;  2XBB C;  1G6J A;  2FCS A;  2KTR B;  3VQI A;  3QAR A;  1E8Z A;  2LGD A;  1WF9 A;  5AEK B;  4WJQ A;  4K7S A;  4FHJ A;  2KN5 A;  2LGY A;  4URK A;  2LXC A;  1VCB A;  4TUU A;  1LXD A;  2BKR B;  2K8C A;  1WJN A;  5FR6 A;  1NDD A;  1OEY A;  2G45 B;  3AI5 A;  3TL5 A;  3WAP A;  1LQB A;  3JYU A;  3PHW B;  4WWN A;  4HPL B;  3ZRF A;  4JLC A;  1V49 A;  2NCN A;  1WJU A;  2IY1 B;  1IP9 A;  1K8R B;  4I6N B;  2CKH B;  3QQ8 B;  5TR5 A;  2ZVO A;  1WMH B;  3DVN V;  3WAL A;  2GBM A;  4HCN B;  3AU4 A;  4NNJ B;  2KHW B;  1KJT A;  4MJS B;  2K1F A;  4EZL A;  3JW0 X;  2KWV B;  2GBK A;  3T8M A;  3M95 A;  1OTR B;  1OQY A;  1P0R A;  2BGF A;  2BYE A;  3NS8 A;  3PHX B;  1IYF A;  3PRZ A;  1WGG A;  2KOX A;  2KC1 A;  2JZ3 B;  2K6D B;  4HK2 A;  3H7S A;  3IVF A;  3RD2 A;  3M63 B;  4E3C A;  3B0A A;  2BPS A;  2AL6 A;  2DZK A;  2NR2 A;  3PRM B;  3PLU A;  4W9I A;  3RUI B;  2RGF A;  3Q3J A;  4II3 B;  4NY0 A;  3WAN A;  1RRB A;  4KV2 A;  1WI0 A;  3A9J B;  3ZKJ C;  2MW5 A;  1V2Y A;  1YJ1 A;  3TJP A;  1Z5S B;  2JWZ A;  1E8Y A;  5D6J B;  3A1Q A;  3V62 A;  4EZK A;  2LD9 A;  3QK0 A;  3ZVV A;  2FCM A;  2KKC A;  2ZPY A;  3U8Z A;  3NOB A;  4F1S A;  2KLC A;  2Y5B B;  4FAD A;  3A33 B;  1SE9 A;  2C5L C;  4EUT A;  1RAX A;  4J6I A;  3DVN U;  3WA0 A;  2RPQ A;  2WDT B;  4MSQ B;  3EFU A;  2G4S A;  1L2N A;  3PRP B;  2A5U A;  2ZPN A;  2J7Q B;  3SU8 X;  4GMV A;  4W9L A;  5G2N A;  1NI2 A;  4BOS C;  2M8S A;  3IHP C;  3JSV B;  1GNU A;  2FNJ B;  1WJ6 A;  3EEC A;  3TIX A;  1CMX B;  1KLV A;  4YL8 A;  2DAF A;  3LDZ E;  4KIK A;  4IWQ A;  4XX5 A;  4F7Z A;  1LFD A;  4B95 A;  4IM3 A;  4BBN C;  2CS4 A;  4HDQ A;  1V5T A;  2ZCC A;  1H8C A;  1WGR A;  3EHV A;  2DZJ A;  3HM6 X;  4GN1 A;  3W1S C;  2C9W B;  2NPT B;  4LJO B;  2PE6 B;  1E7V A;  1V86 A;  2MRP A;  3QJZ A;  3AU5 A;  4NQK E;  3DOW A;  3DVG Y;  5BO4 B;  4MEM A;  2V1Y A;  3A9K A;  2XK5 A;  2I1K A;  4HXD A;  3VAW A;  5JHB A;  3ZTC A;  2JRI B;  2PEA A;  3L10 B;  1J19 A;  1UD7 A;  1C3T A;  3A4S C;  4DDG D;  2NBW B;  2MBE A;  1GC7 A;  3CF6 E;  1XQQ A;  2N9E B;  1ZKH A;  1WIA A;  4TQ0 A;  1WR1 A;  3VH3 B;  2WYQ A;  3DBL I;  4WWO A;  2N9X A;  3K9O B;  4EOY A;  2C7N B;  5J2R A;  3ZIM A;  4AOF A;  2AYO B;  5IAA C;  1Q0W B;  2FID A;  4DXA B;  5C1Z A;  4GDK A;  2ASQ A;  4K81 A;  2UYZ B;  5KHO A;  3D32 A;  1EF1 A;  1V5O A;  2V3S A;  1UZX B;  2KC2 A;  2G4D B;  4MDK E;  3HK0 A;  3VUY A;  2CU1 A;  2ZVN A;  4RMA A;  4BBN F;  4IWP A;  2LAS A;  4F8C B;  4B6W A;  1YIW A;  2LVP A;  4I6P A;  5E6N A;  3VH4 B;  4HPM B;  2KQ7 A;  3NY5 A;  3N3K B;  4JIO U;  5DCN A;  1OEY J;  4A3P A;  4AJW A;  1D3Z A;  3MTN B;  2JUO A;  3RYT A;  3ZRC A;  5E6O A;  3VDZ A;  4IW0 A;  1Y8R C;  5CHV C;  1SIF A;  4JL9 A;  1R4N I;  3ZNZ B;  3SD5 A;  1S1Q B;  4IUM B;  2IBI B;  2KAN A;  1S3S G;  2QHO A;  3CMM B;  2CHX A;  3PTF C;  4XC2 A;  3U7D A;  2PPH A;  3BY4 B;  2HD5 B;  2KO3 A;  2JZZ A;  2UWQ A;  3PGE A;  4FN2 A;  2LVO A;  2FIF A;  1E7U A;  3V6E B;  2KFK A;  4DK5 A;  2IO0 B;  2KNB A;  3C0R B;  2NBU A;  3Q3F A;  2KWC A;  1HE8 A;  2N1W A;  3ALB A;  4G11 A;  4M8N A;  1WXS A;  4RM9 A;  4TQ1 A;  1ISN A;  1Q1O A;  2IZV B;  2J0K A;  4AWJ A;  3V60 A;  1YX5 B;  4MH0 E;  4G50 A;  2BKF A;  2L0F A;  3L08 A;  2PJH A;  4BKS A;  4PYZ A;  1TGZ B;  2BF8 B;  2KX3 A;  4K7W A;  4W9F A;  2DAJ A;  2K39 A;  4FJV B;  5C23 A;  1FXT B;  5D94 A;  4E74 A;  4TKN A;  2LZ6 A;  1WX7 A;  4HDO A;  1WXM A;  3BIN A;  1J0G A;  3R7R A;  5HKH A;  2YVC A;  3OJ3 A;  4CHK A;  3V61 A;  3PLV A;  3QC8 B;  1L7Y A;  2KJH B;  3B08 A;  2D2Q A;  2O6V A;  4FLH A;  3H1U A;  1UBI A;  2J0M A;  2MA9 B;  3PPA A;  2ZNV B;  4GDL A;  4KVG B;  4FHK A;  4IM2 A;  1VD2 A;  2IO2 B;  1WR6 E;  2KDE B;  4NAW A;  3VFK A;  3ZDM C;  2W9N A;  3AXC A;  3APF A;  3A1Q B;  3QAQ A;  3APC A;  3CST A;  5CHW A;  2KDI A;  3VUX A;  2ZJD A;  3QX1 A;  1P3Q U;  4HJK A;  4NJ6 A;  2L8J A;  2MBO A;  4HLE A;  1Q5W B;  2NVU I;  3DPD A;  3QIJ A;  5GMV A;  1WJ4 A;  4BKT A;  2DYO A;  4KZ0 A;  4W9G A;  3UIP B;  3GOE A;  3L54 A;  2C7H A;  3ONS A;  3RZW C;  3A9J A;  3VUW A;  4OVU A;  2I1J A;  2K8B A;  3H9D A;  3N30 A;  1E8X A;  1QZE A;  3M62 B;  4DBG A;  2G3Q B;  2MCN B;  4OVV A;  1UGM A;  3TMP B;  1F9J A;  1WXV A;  4ANU A;  3VVW B;  5KHQ A;  1OGW A;  4BKS D;  1WE6 A;  5JHA A;  2A4Z A;  2RR9 A;  5EDS A;  2EMS A;  1V80 A;  2AL3 A;  3H7P B;  3T9L A;  1GJZ A;  2MP2 A;  4IWO A;  1I42 A;  4N9F 4;  2C7M B;  4AJY B;  3VTV A;  2O6V D;  3RT3 B;  3UGB B;  2N7E A;  3H6N A;  4PS8 A;  2BYV E;  1WRD B;  3MHS D;  2FCQ A;  2RD0 A;  1WZ3 A;  4ZRK A;  3ZO5 B;  3DBH I;  2L0T A;  4WJO A; 
#chains in the Genus database with same CATH topology
 3HM3 A;  4ARI A;  3J9C A;  3R66 C;  1RM6 C;  2V9H A;  5AZF A;  2N9P C;  1P98 A;  4FBJ B;  1PGX A;  3UIO B;  1DOX A;  1YQB A;  1WRI A;  4XYC A;  4LNI A;  4NQL B;  2GOW A;  2FUH B;  4HJG E;  2IND C;  5AUI A;  3QWZ B;  4BVU C;  1KM7 A;  4EEW A;  1P1A A;  3BYY B;  3EFC A;  4P1B C;  1WGH A;  5JZE B;  2G9H D;  1KLG D;  2M0X A;  4AP4 C;  5IN7 A;  1ZDV A;  1QOB A;  3AEA B;  4ICU A;  2FUG 1;  3W9C B;  4N6E B;  4RGN A;  1PYW D;  2AEH A;  1VDV A;  2D11 A;  2QEJ C;  4HVB A;  4M0W B;  1JRU A;  3I3T B;  1I4P A;  3R7Q A;  1SXT A;  2MBB B;  2GBN A;  5CTR C;  1PQS A;  2J53 A;  4W9J A;  1VZ6 A;  1WFY A;  1TJE A;  2N4F A;  3R2I A;  3LJ3 A;  3PSE B;  2WDR B;  3SDL C;  5IA7 A;  1D5X C;  4HCP B;  2R61 A;  2PW9 A;  2E3T A;  2QDF A;  3HHM A;  2GLS A;  1SE3 A;  4ZYS A;  4C4V B;  2WP9 B;  1V9J A;  2KMA A;  3HVD A;  4A6Q A;  4XDD A;  4HEA 1;  1WWT A;  1XCT L;  5DPR A;  5G5H A;  3L17 A;  4IM0 A;  3UF8 A;  2V4L A;  4ICV A;  4GIV A;  1R4N B;  2VH2 A;  1MG4 A;  4P16 A;  3FAH A;  4WQO B;  2J4X A;  1CK1 A;  2DLB A;  4W9K A;  4GXB A;  3EC8 A;  4MGI E;  1T5X D;  3NVV A;  2KVR A;  4GU2 A;  2LUE A;  1LGR A;  2VZK D;  5AZG A;  1C77 A;  2BS3 B;  1YJI A;  5T8I A;  3KVF B;  2XNA C;  4CYE A;  3KYC D;  1P7E A;  4WH4 A;  1SBB B;  1E10 A;  1ZDX A;  3AM9 A;  2Q5W D;  4HKZ E;  2IJ0 A;  2CU3 A;  3AE4 B;  5FK9 C;  2LVQ A;  1ZW7 A;  4GGQ A;  3PO0 A;  1SB3 C;  2GBJ A;  4LJP B;  4KX6 B;  1R4M I;  1L4D B;  1P7F A;  3AE7 B;  1L5P A;  1EF5 A;  3QA8 A;  4L2Y A;  2YLM A;  1QOA A;  1XT9 B;  2DYB A;  2FAZ A;  1HTO A;  2GBR A;  2WX0 A;  2R2O A;  2KJR A;  3ZW3 A;  3AUL A;  4K7U A;  1YQ4 B;  2DNF A;  2DZM A;  2BTE A;  4LDT B;  4RH6 A;  3ZNH B;  1TS5 A;  3O65 B;  3PRE A;  4EE2 A;  1FEH A;  4YT0 B;  2I2Y A;  3Q3N C;  1WF9 A;  4K7S A;  1N60 A;  4URK A;  1FPY A;  1ZUD 2;  3AI5 A;  3JYU A;  4WWN A;  2NCN A;  4LK0 M;  3T3N A;  2CKH B;  3QQ8 B;  3DHH C;  2ZVO A;  1FCC C;  4L1B A;  4NNJ B;  2KAC A;  3P4P B;  3JW0 X;  1HEZ E;  1OTR B;  2BYE A;  2I38 A;  2OHF A;  2AQ3 B;  2KOX A;  2HTM E;  2JZ3 B;  4OHJ A;  4MH8 A;  3DHI C;  3FC4 A;  4W9I A;  3PRM B;  2J52 A;  3GS2 A;  2M0A A;  1D5Z C;  4JWU C;  4YTP B;  3WAN A;  1RRB A;  1E9M A;  4YTN B;  1YJ1 A;  4XDC A;  3TJP A;  2HDE A;  2W54 A;  3IT4 B;  3FKY A;  3EUB 2;  4LNK A;  4KKI A;  3U8Z A;  3IAS 1;  3NOB A;  1D6E C;  5EE0 A;  4EUT A;  2C5L C;  1RYJ A;  1RAX A;  1ROE A;  2RPQ A;  4M01 A;  3PRP B;  1IGC A;  4BOS C;  1GNU A;  2QCZ A;  3E9S A;  3EEC A;  1YN4 A;  3H8H A;  4F7Z A;  4XX5 A;  1JQ4 A;  1LFD A;  1NEN B;  4BBN C;  2CS4 A;  4HDQ A;  2C9W B;  2PE6 B;  2MRP A;  2WQY B;  4RF0 A;  5BO4 B;  4IKG A;  1XF5 L;  2DWQ A;  1TT5 B;  4HXD A;  3VAW A;  2MH7 A;  4MAC A;  3BII D;  2PEA A;  1J19 A;  2INN E;  5BYS A;  1GC7 A;  2N9E B;  1ZKH A;  1WR1 A;  2WXK A;  4J3O D;  1MHH E;  3K9O B;  3V05 A;  3ZIM A;  1N61 A;  5BMH A;  3IT6 B;  2FID A;  2UYZ B;  5KHO A;  2KC2 A;  2G4D B;  4RMA A;  4REZ A;  4BBN F;  1BUI C;  3W5U B;  2LAS A;  2N9L A;  3KQ4 A;  2LVP A;  4I6P A;  4JIO U;  1OEY J;  2B76 B;  3RMK C;  4JL9 A;  2KYW A;  2WXH A;  2IBI B;  2KAN A;  1S3S G;  3PTF C;  2CHX A;  2UWQ A;  1E7U A;  2KFK A;  2IO0 B;  1XCQ L;  3Q3F A;  4ZOH C;  3R8B A;  2KAJ A;  4G11 A;  4M8N A;  5IOI A;  1STE A;  1AYF A;  3V60 A;  5EE3 A;  1XO3 A;  3L08 A;  5GXG B;  2PJH A;  4BKS A;  3CIR B;  4YTM B;  5C23 A;  1FXT B;  3RNG C;  2LZ6 A;  1WX7 A;  4CQN A;  2SAK A;  5IP4 D;  3PLV A;  2O6V A;  3H1U A;  2BT6 A;  4GDL A;  4FHK A;  1JW9 D;  4NAW A;  2W9N A;  3APF A;  1FMA D;  3CST A;  3BVM A;  3VUX A;  2WXG A;  3GP7 A;  4NJ6 A;  2L8J A;  2NVU I;  1TKG A;  3EGR A;  3AE5 B;  1TY0 A;  1KRH A;  4WAF A;  3AE3 B;  2BQQ A;  3VUW A;  1FCL A;  2I1J A;  3P42 A;  3AEE B;  1IGD A;  1E8X A;  3TMP B;  1F9J A;  5KHQ A;  1OGW A;  5BMG A;  1JWB D;  5EDS A;  3MFG A;  2AL3 A;  3H7P B;  4IWO A;  1M4V A;  4ZHO A;  3VTV A;  2WXI A;  1OQQ A;  4ZRK A;  4WJO A;  2WDV B;  4BZA A;  2K5P A;  3K9P B;  4B9K A;  2BS2 B;  4M00 A;  1WXA A;  4EFO A;  1FNU A;  3AEF B;  3RN9 C;  1N5X A;  1E5W A;  5BYR A;  4M8M A;  1BML C;  3KUC B;  3TEX A;  1SE4 A;  3W2D A;  3KWV A;  3IAM 1;  4G3X B;  3PT2 B;  1TKY A;  1KFY B;  1CJE A;  2D07 B;  3AE1 B;  2JSV X;  1FNV A;  1ZXH A;  1BT0 A;  1WE7 A;  4WJN A;  3W1S A;  1T0Y A;  3GE3 C;  2BWE S;  2PKO A;  2N7J A;  5CHF A;  3Q3O C;  4ASW C;  4D2K A;  3VR9 B;  1XLQ A;  5D7G A;  3UQA A;  2KFK B;  5DPT A;  4ZRJ A;  2EEL A;  2NS5 A;  4DHZ E;  2L76 A;  1UH6 A;  2L7R A;  2KFJ A;  1XLP A;  2CHZ A;  2PE9 A;  2RPV A;  1WGY A;  1EUV B;  1XD3 B;  2OJW A;  2RSU A;  4KSK C;  2WX1 A;  1J7A A;  2VH1 A;  1V1P A;  2EMT A;  1PGB A;  1VJK A;  2AQ1 B;  2JF5 A;  2L1A A;  2HTH A;  1NI3 A;  2NTT A;  2WS3 B;  1C78 A;  3X0W A;  1FNW A;  2O6V B;  2D3G A;  2W3S A;  2XEW A;  4GDL B;  4K3C A;  1WMH A;  1EO6 A;  3VTW A;  1RFA A;  4KDI C;  4NAW B;  1WX9 A;  1Z2M A;  2N1V A;  4YSX B;  4CO7 A;  1C4P A;  3Q3M C;  3RNB C;  3UIN B;  2MHJ A;  3A4R A;  4GOC A;  3DBS A;  1K53 A;  3RZF A;  1C76 A;  3RPF C;  1E90 A;  2KVZ A;  3RI7 C;  3QHT A;  3OJ4 B;  2PIA A;  4O1N A;  1BXT A;  1QQR A;  4G0N B;  4MGY E;  4BFR A;  2MJ3 A;  4Q2J A;  5C2T B;  1SJE D;  4KIK B;  4NJ7 A;  4MSM B;  1HTQ A;  4WWM A;  1C4C A;  2D5G A;  1I7H A;  2NTS A;  2IO3 B;  1L6V A;  2LJ5 A;  2K25 A;  2N7D A;  3ZJV A;  2WXN A;  4A9A A;  2IO1 B;  2MLB A;  1SE2 A;  3ZYY X;  3MC9 A;  1XLN A;  3B1L X;  2OJR A;  3PVL A;  2AWT A;  2GMI C;  4JQW C;  1K50 A;  3TBL D;  3ZUN A;  3I57 A;  3KWL A;  5FKA C;  5EE1 A;  2HE7 A;  3M3J A;  1Q10 A;  4X57 B;  3DDC B;  1ZGU B;  2GB1 A;  5G55 A;  3KYD D;  4WWP A;  4XZ4 A;  2CR5 A;  2MX2 A;  1PUT A;  1TZ1 A;  2G1E A;  3HIZ A;  5DPW A;  4NPN A;  1GC6 A;  3TCA A;  5J18 A;  4MT5 A;  3AE2 B;  2LRW A;  2JPH A;  2LI5 A;  1ESF A;  4NAM A;  4IOI E;  2LFI A;  1ET9 A;  2YEP B;  4HRO A;  1JWS D;  2K6Q A;  3DBH B;  4DWF A;  2FCN A;  2MBQ A;  2LXA A;  4LLG M;  1T0Q C;  5EE9 A;  3QCA A;  2DEN B;  1V81 A;  2XBB C;  3LB8 C;  2K0P A;  5BYQ A;  1E8Z A;  1EWC A;  4WJQ A;  2KN5 A;  2LGY A;  2VZK B;  1V1P B;  1LXD A;  2BKR B;  3TL5 A;  3WAP A;  2N0S B;  1V1O A;  3RNC C;  4HPL B;  4RGO S;  4WIP A;  1WMH B;  3WAL A;  3AU4 A;  2OED A;  2KHW B;  1KJT A;  4EZL A;  3VRA B;  2KWV B;  2PMV A;  3T8M A;  2QJL A;  1KTK A;  3NS8 A;  1IYF A;  1JAL A;  3PRZ A;  3TSS A;  1Y56 A;  2KC1 A;  1V97 A;  3H7S A;  3M63 B;  2NR2 A;  4KGR A;  3A9J B;  3ZKJ C;  2MW5 A;  2LHE A;  2JWZ A;  1ET6 A;  3V62 A;  2W55 A;  3P1M A;  1I4X A;  2ZPY A;  1ENF A;  1K51 A;  1TZO A;  2KLC A;  2KDM A;  4FAD A;  2KN4 A;  1TS4 A;  5BMI A;  4J6I A;  2WDT B;  1QIL A;  1L2N A;  2ZPN A;  4QAY A;  1NI2 A;  3B2G A;  3P63 A;  3U2S C;  3IHP C;  2V4I B;  2WXO A;  2FNJ B;  1WJ6 A;  4N58 A;  4IM3 A;  4KGT A;  1V5T A;  2ZCC A;  1QLB B;  2DZJ A;  4GN1 A;  3W1S C;  2JYT A;  3NVW A;  4P1C C;  4NQK E;  1FIQ A;  3DVG Y;  3FIL A;  1B1Z A;  3A9K A;  1JWU D;  2XK5 A;  1T0R C;  1C3T A;  3R2T A;  2NBW B;  3Q2A C;  2WGS A;  3VH3 B;  3DBL I;  3N1Z C;  3O13 A;  2N9X A;  1D4B A;  2QIL A;  2C7N B;  1L4Z B;  2AYO B;  5IAA C;  3Q8B A;  5C1Z A;  4GDK A;  2ASQ A;  3AEC B;  1CZP A;  1UZX B;  1JWM D;  1V8C A;  3HK0 A;  2CU1 A;  2ZVN A;  2D3B A;  1VLB A;  3PZ7 A;  5E6J A;  1YIW A;  1VR9 A;  4HPM B;  1R4M B;  5DCN A;  4A3P A;  4AJW A;  1RFK A;  3MTN B;  4HRS A;  5CHV C;  3TUO A;  3SD5 A;  4IUM B;  4OW0 A;  4XC2 A;  3U7D A;  2YEP F;  1ZXI A;  4FN2 A;  2JZZ A;  2LVO A;  4PT5 A;  2WXM A;  4DK5 A;  2KWC A;  3TEW A;  3ALB A;  1EU4 A;  4XWW A;  4RM9 A;  1Q1O A;  2J0K A;  2IGG A;  4AWJ A;  2L52 A;  4MH0 E;  4PYZ A;  2SEB D;  2KX3 A;  2DAJ A;  4FJV B;  3MC0 B;  3RNF C;  3CWI A;  4M02 A;  4CHK A;  3V61 A;  1MHX A;  3QC8 B;  3Q8E A;  2MA9 B;  2ZNV B;  1QKZ A;  1WR6 E;  2KDE B;  3AE9 B;  3AXC A;  3APC A;  5CHW A;  3Q6B A;  3AV8 A;  1IUE A;  2W82 A;  1Q5W B;  3QIJ A;  2WNM A;  3AEB B;  2Z8L A;  3UI3 A;  2C7H A;  3RZW C;  2K8B A;  3H9D A;  1D5M C;  1F77 A;  1QZE A;  2MCN B;  1NYR A;  1UGM A;  4TMA B;  5D3D A;  3MC8 A;  3RNE C;  5JHA A;  2TSS A;  4YWG G;  1V80 A;  1GJZ A;  1L0Y B;  4N9F 4;  2C7M B;  1N63 A;  3RT3 B;  3UGB B;  2N7E A;  3FIL B;  4A8X C;  3ZXV A;  2RD0 A;  2CJO A;  1QT9 A;  3ZNI D;  3ECI A;  2KWU B;  2R2Q A;  1UEL A;  1UBQ A;  3I5J C;  2KDF B;  4KGS A;  1EU3 A;  4DDI D;  1TY2 A;  3V6C B;  5JH5 C;  3W1Y A;  4ZYN A;  1LM8 B;  2INP E;  2KQS A;  3NZS A;  1R7S A;  2WXL A;  4OVZ A;  4USA A;  2O2V A;  4DQO C;  3RNA C;  3ZDT A;  2LWP A;  3I9V 1;  1WM2 A;  1I4H A;  3NHE B;  2MEK A;  3EA6 A;  3GE8 C;  4PYU A;  4C80 A;  4TV3 A;  3DVG X;  4B0E A;  1YX6 B;  4JGH B;  5J17 A;  4MM3 A;  2JY6 A;  2HJ8 A;  4DXF A;  3ETR A;  3GZN I;  3OWE B;  3P4S B;  4RFB A;  3ML8 A;  2WWZ A;  2LRU A;  2ZNV C;  1A5R A;  3U52 E;  4K1R B;  2KTR A;  2IGD A;  4BOZ B;  2VRR B;  2WXP A;  5LLI A;  2BW2 A;  4C00 A;  3ML9 A;  1F2R I;  1A70 A;  3U30 A;  3MP9 A;  2JRH A;  3BZD B;  3R3M A;  3P4Q B;  2L3Z A;  2LJI A;  2KTF A;  1TTN A;  3IG3 A;  3KUD B;  4ZRQ A;  1TBE A;  2M17 A;  1H4R A;  2M4N A;  3PS6 A;  4DHJ D;  4FJY A;  5LXI B;  4FJZ A;  4W9C A;  2QMT A;  1VZ8 A;  5LNK 1;  5TSS A;  2D3C A;  3IBE A;  2MBH A;  1QF6 A;  2JU6 X;  1GOZ A;  4EKU A;  2W3R A;  3NG0 A;  1GUA B;  4LNO A;  3JVZ X;  2E6X A;  3B9J A;  3L16 A;  3P2B A;  3RCZ A;  2CJN A;  1KLU D;  1PGA A;  2ZEQ A;  4WAA A;  1WXQ A;  3VXW A;  2L32 A;  1AWD A;  2OOB B;  1SGH A;  2JYE A;  3IFW B;  2BB5 A;  2GI9 A;  2WDQ B;  3SR6 A;  2IY0 B;  3MJW A;  4GSW A;  1DYQ A;  3N20 C;  3AH7 A;  2MJE A;  4MEL A;  2Z59 B;  4RF1 A;  1XEE A;  1NBF C;  4YSY B;  2RDB C;  3KH0 A;  4KZC A;  2C60 A;  2HJ1 A;  3DBR I;  2DYM A;  3N32 A;  1L0V B;  3NZU A;  1N5W A;  2INC C;  3KUZ A;  3L13 A;  4PS7 A;  2O2V B;  4II2 B;  4PK1 A;  4ZRI A;  2IDY A;  1WSP A;  2MWS B;  2REX A;  1WZ0 A;  3AMZ A;  2J0J A;  1FO4 A;  1RLF A;  2KK8 A;  3HUI A;  4W9H A;  1SIJ A;  1MG8 A;  2B3A A;  2XN9 C;  4NZL B;  1B9R A;  1P9D U;  4W9D A;  1WGD A;  2Y3A A;  1NYQ A;  4ANV A;  1X1M A;  1YOV B;  4WQM A;  2QIE B;  2LGI A;  2K3U A;  2DHZ A;  4W9E A;  5LXH A;  1XXG A;  1G6J A;  2KTR B;  3VQI A;  3B2F A;  1AW7 A;  2MJD A;  4M0W A;  2RDG A;  4TUU A;  1WJN A;  5FR6 A;  2G45 B;  1OEY A;  5C3J B;  1EM7 A;  3PHW B;  3ZRF A;  4JLC A;  1WJU A;  3Q8A A;  2H88 B;  2IY1 B;  4IDI A;  1K8R B;  4I6N B;  2Y5P A;  3SFE B;  4HCN B;  2K1F A;  2N9K A;  2KT7 A;  2BGF A;  1OQY A;  1P0R A;  2KQ4 X;  1JWA D;  3BVG A;  2PLP A;  4HK2 A;  5HHD G;  3Q8C A;  4H2A A;  2LGS A;  4E3C A;  3B0A A;  3V3X A;  2AL6 A;  3RUI B;  3PLU A;  1C79 A;  4ZHP A;  3Q3J A;  4II3 B;  1FFV A;  4KV2 A;  1WI0 A;  1V2Y A;  1E8Y A;  5D6J B;  2LUM A;  3MHZ A;  2EKI A;  3NRZ A;  3VRB B;  4EZK A;  3ZVV A;  2FCM A;  1HZ5 A;  3Q69 A;  4XE0 A;  2JWU A;  2Y5B B;  3A33 B;  1SE9 A;  2FE8 A;  3DVN U;  1WGK A;  3TEY A;  1TS3 A;  3EFU A;  2G4S A;  2ON8 A;  1FFU A;  2A5U A;  2J7Q B;  4GMV A;  4W9L A;  5G2N A;  4JX1 C;  5H92 C;  2KMM A;  2ACZ B;  2DAF A;  3LDZ E;  4IWQ A;  4B95 A;  1AN8 A;  1H8C A;  3HM6 X;  3EHV A;  4LJO B;  1V86 A;  1E7V A;  3QJZ A;  3AU5 A;  3DOW A;  1E7P B;  3N1X C;  3C8Y A;  4TSS A;  5HFY A;  2I1K A;  3LYY A;  5JHB A;  3DHG C;  3ZTC A;  2JRI B;  3MJ5 A;  5G5G A;  1UD7 A;  2ZW1 A;  2MBE A;  1WIA A;  4TQ0 A;  3AED B;  3PZ8 A;  2WYQ A;  4WWO A;  1HQR D;  1ACC A;  2K22 A;  3NJT A;  2BB6 A;  2WXJ A;  1T6B X;  3D32 A;  2V3S A;  4MDK E;  1TYG B;  3VUY A;  4NJC A;  2KQ7 A;  4JWS C;  4DXG A;  4AS1 A;  2GRI A;  1T3Q A;  3ZJT A;  1D3Z A;  3ZRC A;  4P6V F;  5E6O A;  2KWD A;  4IW0 A;  1ZE3 D;  1SIF A;  1R4N I;  2QC8 A;  1S1Q B;  3ZNZ B;  3NS1 A;  3OG5 A;  2QHO A;  2LEK A;  2PPH A;  2HD5 B;  2KO3 A;  4RGM A;  2FIF A;  1DOI A;  3V6E B;  2ONQ A;  3C0R B;  2PTL A;  2IPK D;  3DWG C;  2N1W A;  1XLO A;  2ZW0 A;  4TQ1 A;  1QOG A;  2IZV B;  2M56 B;  4HKQ A;  5D3I B;  2L0F A;  4RGT A;  1TGZ B;  4K7W A;  1I4R A;  4K3B A;  4US9 A;  4TKN A;  3BIN A;  3KLS X;  3R7R A;  1J0G A;  3OJ3 A;  1L7Y A;  4FLH A;  2D2Q A;  1C4A A;  3ZQ4 A;  1VD2 A;  3ZDM C;  2FBW B;  4OZC A;  1GB1 A;  1F52 A;  3QAQ A;  2KDI A;  2ZJD A;  3QX1 A;  1P3Q U;  4HJK A;  2MBO A;  4HLE A;  1CQV A;  1WJ4 A;  4BKT A;  3T3O A;  2DBY A;  2DYO A;  4KZ0 A;  4W9G A;  3UIP B;  3GOE A;  3L54 A;  4US8 A;  4OVU A;  2LHD A;  3N30 A;  3U7Z A;  2JQR B;  3M62 B;  2G3Q B;  3VVW B;  3AEG B;  2RR9 A;  2EMS A;  1VZ7 A;  3T9L A;  2RDH A;  2MP2 A;  1I42 A;  2AX5 A;  4C56 C;  1LO5 D;  4PS8 A;  2BYV E;  1WRD B;  2FCQ A;  1WZ3 A;  3ZO5 B;  4RM8 A;  2L0T A;  1MJD A;  4PS3 A;  4A20 A;  4E71 A;  1NVI D;  2Y5C A;  2KDB A;  3SHQ A;  2PVG C;  2RMM A;  4ANX A;  5HI1 A;  4IG7 B;  4C7Z A;  4A55 A;  3GB1 A;  2JT4 B;  3NVY A;  3N1Y C;  2NBV B;  3L0W B;  3Q14 C;  4R3D A;  2JVC A;  3URY A;  5L83 A;  1NEK B;  1HA5 A;  3ZLZ A;  1UUP A;  4XWT A;  4KKJ A;  1N62 A;  4N59 A;  4GB9 A;  2EKE C;  2LGX A;  2WU5 B;  3SFD B;  2KJ6 A;  2LMC A;  1ZPS A;  4GLS C;  4ANW A;  3DQV A;  5L95 C;  4MGK E;  1KH0 A;  2BYF A;  1L6U A;  2L83 A;  5H8Y E;  5AZH A;  1WM3 A;  2IYD B;  3DBL B;  4OZB A;  2JXX A;  2ZCB A;  2WHI A;  3BYT B;  1WX8 A;  1FXI A;  1FD6 A;  3BK2 A;  1J7C A;  1L0X B;  1JCK B;  3S2A A;  2KZR A;  1F0Z A;  1AAR A;  4IC7 B;  3PZD A;  3WAO A;  4HPP A;  1DOY A;  4L23 A;  3X23 A;  1JRO A;  2KX0 A;  4DHZ B;  4MJS A;  4HWI B;  1KF6 B;  2KD0 A;  1PDX A;  1U4A A;  4LDT D;  4KDL B;  4JPS A;  2QSD A;  5E6P A;  1E0Z A;  1M94 A;  3C19 A;  2Z0D B;  2D10 A;  3WAM A;  3OLM D;  4LCD E;  4I6L B;  4LTU A;  4FUL A;  1I4G A;  1YD8 U;  3KW5 B;  1EWY C;  3VHT C;  4ITK A;  2KXJ A;  1GAQ B;  3UQB A;  1J8C A;  5DPS A;  3LXF A;  3ENE A;  3OAW A;  2DZI A;  2K8H A;  2MSE D;  2DX5 B;  4ZDV A;  4S17 A;  4WJP A;  2MP2 B;  2M1M A;  3WIM A;  1MFW A;  1WY8 A;  1E8W A;  3DCG A;  4ARC A;  2BVC A;  1IPG A;  5D2M B;  3A9K B;  2X8X X;  2XK5 B;  3JSV A;  4KSL C;  4FA6 A;  1JRP A;  4P7I A;  1OFF A;  5CX3 A;  2KMC A;  1C1Y B;  3H7P A;  1SSN A;  3ZNG C;  2NPT A;  2L00 B;  3ZGZ A;  2BWF A;  3W5V B;  3APD A;  3NVZ A;  1IBX A;  1YN3 A;  1WYW B;  1WH3 A;  2MQJ A;  2ZZP B;  4MGZ E;  3ZXR A;  4GDK B;  1I35 A;  3AE6 B;  4A3O A;  1UGJ A;  5I4D A;  2D3A A;  3VR8 B;  1V6E A;  2Z0E B;  3P4R B;  1YN5 A;  3VTU A;  4ACF A;  3AB5 A;  4DHJ B;  1MI0 A;  1UNS A;  4EZJ A;  1YMH E;  1GG3 A;  3I63 C;  4BKG A;  4AQ7 A;  3PV1 A;  4S0R A;  3RUL A;  5MPO A;  3BVZ A;  3ZTD A;  2JXT A;  2V3P A;  3Q8F A;  1JML A;  3RFZ B;  1KOT A;  4B0M A;  3CSF A;  2ICI A;  2KLG A;  2BYT A;  1UWX A;  4AUQ C;  2L05 A;  2CHW A;  2FCS A;  3QAR A;  2LGD A;  1SF0 A;  5AEK B;  3HVZ A;  4FHJ A;  4LNN A;  2M19 A;  1FXA A;  2LXC A;  1VCB A;  2K8C A;  2WLB A;  1NDD A;  1LQB A;  1V49 A;  1IP9 A;  5TR5 A;  1FRD A;  2K9X A;  4YSZ B;  3DVN V;  2GBM A;  4MJS B;  2JX5 A;  2GBK A;  3M95 A;  3PHX B;  1WGG A;  2H89 B;  3N9Y C;  1ZP0 B;  2K6D B;  3IVF A;  3RD2 A;  1K52 A;  1YJJ A;  2BPS A;  2DZK A;  2RGF A;  3GZN B;  4NY0 A;  3NZ3 A;  1Z5S B;  1FM0 D;  3SEB A;  3A1Q A;  3HRD D;  1UWM A;  1DGJ A;  2LD9 A;  3QK0 A;  3U4E G;  5JXV A;  2KKC A;  4F1S A;  3WA0 A;  4FXC A;  4MSQ B;  3SU8 X;  2IGH A;  2M8S A;  3JSV B;  3TIX A;  1CMX B;  1KLV A;  4YL8 A;  1N6Z A;  4KIK A;  4BAX A;  2V3N A;  1I4Q A;  1GB4 A;  1WGR A;  2NPT B;  1RWS A;  3ABV B;  3L4P A;  1IBX B;  4MEM A;  2V1Y A;  1HZ6 A;  4XGA B;  3L10 B;  3A4S C;  4DDG D;  3CF6 E;  1XQQ A;  4LNF A;  2PVO D;  5HG2 A;  4EOY A;  1TKE A;  4RCO A;  5J2R A;  2BBC A;  1VRA B;  3BWU D;  5AUK A;  4AOF A;  1Q0W B;  4MM3 B;  4UDU C;  4DXA B;  4K81 A;  1SEB D;  1EF1 A;  1V5O A;  5IO9 A;  2BS4 B;  3IXS A;  5IKC M;  2WXR A;  4IWP A;  2WXF A;  2V0G A;  4F8C B;  1TIF A;  4B6W A;  5E6N A;  3VH4 B;  1WYG A;  1ZOY B;  3NY5 A;  1T0S C;  3N3K B;  2JUO A;  3RYT A;  1GPX A;  2WXQ A;  3VDZ A;  1Y8R C;  1J7B A;  3AE8 B;  2JZP A;  3DBR B;  4DBG A;  3CMM B;  3BY4 B;  2UU7 A;  3PGE A;  4OZA A;  2KNB A;  2NBU A;  1HE8 A;  4C7Y A;  4A90 A;  1WXS A;  1ISN A;  1YX5 B;  3E56 A;  4G50 A;  2BKF A;  3BK1 A;  4ZRP A;  2BF8 B;  1HXY D;  4W9F A;  2K39 A;  1SJH D;  5D94 A;  4E74 A;  1F2R C;  4C4V A;  4HDO A;  1WXM A;  3AN1 A;  1QOF A;  5HKH A;  2YVC A;  1FRR A;  1OQR A;  3B08 A;  1YQ3 B;  2KJH B;  1UBI A;  2J0M A;  3PPA A;  4KVG B;  4IM2 A;  3NUH B;  1PFD A;  3VFK A;  2IO2 B;  2WU2 B;  3TEZ A;  3A1Q B;  1E6E B;  1F1H A;  2J42 A;  3DPD A;  4YXD B;  5GMV A;  1MPE A;  2NMQ A;  4RNA A;  2AQ2 B;  3ONS A;  3ZJU A;  1TS2 A;  3A9J A;  1MVK A;  3WCQ A;  4OVV A;  2X38 A;  1WXV A;  4ANU A;  3DWM A;  4BKS D;  1WE6 A;  5FR3 A;  2A4Z A;  4JE3 B;  4WUR A;  1C9F A;  1YNT E;  4AJY B;  2O6V D;  3H6N A;  3MHS D;  1UF0 A;  3DBH I; 
#chains in the Genus database with same CATH homology
 3HM3 A;  3ECI A;  3R66 C;  3K9P B;  4B9K A;  2KWU B;  4PS3 A;  5AZF A;  2N9P C;  2R2Q A;  1WXA A;  4A20 A;  4EFO A;  1P98 A;  4E71 A;  4FBJ B;  3UIO B;  2KDB A;  1YQB A;  1UEL A;  3SHQ A;  1UBQ A;  2KDF B;  4NQL B;  2GOW A;  4DDI D;  2FUH B;  1E5W A;  3V6C B;  4ANX A;  5JH5 C;  3W1Y A;  3QWZ B;  4BVU C;  4IG7 B;  1KM7 A;  4M8M A;  4EEW A;  2JT4 B;  1P1A A;  4ZYN A;  1LM8 B;  2KQS A;  3NZS A;  1WGH A;  3KUC B;  5JZE B;  2O2V A;  2M0X A;  2NBV B;  3PT2 B;  4G3X B;  4AP4 C;  3L0W B;  3ZDT A;  2LWP A;  2D07 B;  1WM2 A;  2JVC A;  5L83 A;  3NHE B;  1BT0 A;  3ZLZ A;  1WE7 A;  4WJN A;  3W1S A;  4ICU A;  1T0Y A;  4PYU A;  2BWE S;  4TV3 A;  3DVG X;  1YX6 B;  4JGH B;  2AEH A;  2D11 A;  4HVB A;  5J17 A;  4M0W B;  4MM3 A;  5CHF A;  1JRU A;  4GB9 A;  2EKE C;  3I3T B;  3R7Q A;  2JY6 A;  4ASW C;  2MBB B;  2GBN A;  2HJ8 A;  2LGX A;  5CTR C;  1PQS A;  5D7G A;  2KJ6 A;  4W9J A;  3UQA A;  2KFK B;  5DPT A;  1WFY A;  2N4F A;  4ZRJ A;  3GZN I;  2NS5 A;  3LJ3 A;  4DHZ E;  2L76 A;  3ML8 A;  4ANW A;  3DQV A;  1UH6 A;  2L7R A;  2WWZ A;  5L95 C;  2KFJ A;  2LRU A;  3PSE B;  4MGK E;  2BYF A;  2ZNV C;  2PE9 A;  2CHZ A;  1A5R A;  3SDL C;  5AZH A;  1WM3 A;  2IYD B;  1WGY A;  5IA7 A;  4K1R B;  2KTR A;  4BOZ B;  2VRR B;  4HCP B;  1EUV B;  1XD3 B;  2JXX A;  2ZCB A;  1WX8 A;  2RSU A;  5LLI A;  3HHM A;  4KSK C;  2WX1 A;  3S2A A;  3ML9 A;  2EMT A;  2JF5 A;  2HTH A;  3U30 A;  1V9J A;  2JRH A;  2KMA A;  2KZR A;  3R3M A;  1AAR A;  2L3Z A;  3X0W A;  4IC7 B;  3PZD A;  3WAO A;  3ZNI D;  2O6V B;  2KTF A;  3X23 A;  1TTN A;  3IG3 A;  2D3G A;  2XEW A;  3KUD B;  4GDL B;  1TBE A;  1WMH A;  1EO6 A;  2KX0 A;  2M17 A;  3L17 A;  1H4R A;  2M4N A;  3PS6 A;  4IM0 A;  3UF8 A;  1RFA A;  4KDI C;  4NAW B;  3VTW A;  4DHJ D;  1WX9 A;  4FJY A;  1Z2M A;  4HWI B;  4MJS A;  5LXI B;  2KD0 A;  2N1V A;  2V4L A;  4ICV A;  4FJZ A;  4RM8 A;  4CO7 A;  4W9C A;  1U4A A;  4GIV A;  4LDT D;  4KDL B;  3UIN B;  5E6P A;  1M94 A;  3A4R A;  4GOC A;  4WQO B;  3DBS A;  2Z0D B;  2D10 A;  3WAM A;  3RZF A;  3OLM D;  4LCD E;  1E90 A;  4I6L B;  3IBE A;  4FUL A;  3KW5 B;  1YD8 U;  2MBH A;  3VHT C;  2KXJ A;  3QHT A;  3UQB A;  3OJ4 B;  1J8C A;  4W9K A;  4GXB A;  3EC8 A;  4MGI E;  5DPS A;  4G0N B;  4MGY E;  4BFR A;  4EKU A;  4GU2 A;  2KVR A;  1GUA B;  2LUE A;  3ENE A;  3OAW A;  3JVZ X;  2DZI A;  4KIK B;  2K8H A;  4NJ7 A;  5AZG A;  2MSE D;  2DX5 B;  4MSM B;  4ZDV A;  3L16 A;  3P2B A;  3RCZ A;  3KVF B;  4WJP A;  4CYE A;  2IO3 B;  2MP2 B;  2M1M A;  3KYC D;  2LJ5 A;  2K25 A;  2N7D A;  3WIM A;  1WY8 A;  3DCG A;  1E8W A;  2ZEQ A;  4WAA A;  3VXW A;  2IO1 B;  2MLB A;  2OOB B;  1SGH A;  1IPG A;  3IFW B;  3A9K B;  5D2M B;  2XK5 B;  3JSV A;  4KSL C;  2IY0 B;  3MJW A;  4GSW A;  4FA6 A;  4P7I A;  5CX3 A;  2LVQ A;  3B1L X;  2OJR A;  1ZW7 A;  3PVL A;  4GGQ A;  4MEL A;  2AWT A;  2Z59 B;  2GBJ A;  2GMI C;  4JQW C;  2KMC A;  1C1Y B;  4LJP B;  3H7P A;  1R4M I;  1NBF C;  5DPR A;  3TBL D;  3ZUN A;  3ZNG C;  2NPT A;  2L00 B;  3KH0 A;  2HE7 A;  4KZC A;  2C60 A;  2BWF A;  3M3J A;  3DBR I;  3APD A;  1EF5 A;  2DYM A;  4X57 B;  3DDC B;  1WYW B;  3N32 A;  3NZU A;  1WH3 A;  1ZGU B;  2MQJ A;  3KUZ A;  3QA8 A;  5G55 A;  2ZZP B;  3KYD D;  4MGZ E;  4WWP A;  4GDK B;  4XZ4 A;  2CR5 A;  2MX2 A;  3L13 A;  4PS7 A;  2O2V B;  1I35 A;  4A3O A;  1TZ1 A;  3HIZ A;  5DPW A;  4II2 B;  2YLM A;  4NPN A;  1XT9 B;  1GC6 A;  2DYB A;  3TCA A;  5J18 A;  2FAZ A;  2GBR A;  1V6E A;  2WX0 A;  4ZRI A;  2Z0E B;  2MWS B;  2R2O A;  2KJR A;  3VTU A;  3ZW3 A;  2REX A;  1WZ0 A;  3AUL A;  4K7U A;  2LRW A;  4DHJ B;  2J0J A;  2JPH A;  2LI5 A;  1RLF A;  2DZM A;  2KK8 A;  4EZJ A;  4W9H A;  1MG8 A;  2B3A A;  1GG3 A;  4BKG A;  4LDT B;  3PV1 A;  1P9D U;  3RUL A;  3ZTD A;  2K6Q A;  4DWF A;  4W9D A;  1WGD A;  4ANV A;  2FCN A;  2MBQ A;  1X1M A;  1KOT A;  3ZNH B;  3CSF A;  3O65 B;  2LXA A;  3PRE A;  3QCA A;  2KLG A;  2DEN B;  4AUQ C;  4DHZ B;  2L05 A;  1V81 A;  2CHW A;  2DHZ A;  4W9E A;  5LXH A;  2XBB C;  1G6J A;  2FCS A;  2KTR B;  3VQI A;  3QAR A;  1E8Z A;  2LGD A;  1WF9 A;  5AEK B;  4WJQ A;  4K7S A;  4FHJ A;  2KN5 A;  2LGY A;  4URK A;  2LXC A;  1VCB A;  4TUU A;  1LXD A;  2BKR B;  2K8C A;  1WJN A;  5FR6 A;  1NDD A;  1OEY A;  2G45 B;  3AI5 A;  3TL5 A;  3WAP A;  1LQB A;  3JYU A;  3PHW B;  4WWN A;  4HPL B;  3ZRF A;  4JLC A;  1V49 A;  2NCN A;  1WJU A;  2IY1 B;  1IP9 A;  1K8R B;  4I6N B;  2CKH B;  3QQ8 B;  5TR5 A;  2ZVO A;  1WMH B;  3DVN V;  3WAL A;  2GBM A;  4HCN B;  3AU4 A;  4NNJ B;  2KHW B;  1KJT A;  4MJS B;  2K1F A;  4EZL A;  3JW0 X;  2KWV B;  2GBK A;  3T8M A;  3M95 A;  1OTR B;  1OQY A;  1P0R A;  2BGF A;  2BYE A;  3NS8 A;  3PHX B;  1IYF A;  3PRZ A;  1WGG A;  2KOX A;  2KC1 A;  2JZ3 B;  2K6D B;  4HK2 A;  3H7S A;  3IVF A;  3RD2 A;  3M63 B;  4E3C A;  3B0A A;  2BPS A;  2AL6 A;  2DZK A;  2NR2 A;  3PRM B;  3PLU A;  4W9I A;  3RUI B;  2RGF A;  3Q3J A;  4II3 B;  4NY0 A;  3WAN A;  1RRB A;  4KV2 A;  1WI0 A;  3A9J B;  3ZKJ C;  2MW5 A;  1V2Y A;  1YJ1 A;  3TJP A;  1Z5S B;  2JWZ A;  1E8Y A;  5D6J B;  3A1Q A;  3V62 A;  4EZK A;  2LD9 A;  3QK0 A;  3ZVV A;  2FCM A;  2KKC A;  2ZPY A;  3U8Z A;  3NOB A;  4F1S A;  2KLC A;  2Y5B B;  4FAD A;  3A33 B;  1SE9 A;  2C5L C;  4EUT A;  1RAX A;  4J6I A;  3DVN U;  3WA0 A;  2RPQ A;  2WDT B;  4MSQ B;  3EFU A;  2G4S A;  1L2N A;  3PRP B;  2A5U A;  2ZPN A;  2J7Q B;  3SU8 X;  4GMV A;  4W9L A;  5G2N A;  1NI2 A;  4BOS C;  2M8S A;  3IHP C;  3JSV B;  1GNU A;  2FNJ B;  1WJ6 A;  3EEC A;  3TIX A;  1CMX B;  1KLV A;  4YL8 A;  2DAF A;  3LDZ E;  4KIK A;  4IWQ A;  4XX5 A;  4F7Z A;  1LFD A;  4B95 A;  4IM3 A;  4BBN C;  2CS4 A;  4HDQ A;  1V5T A;  2ZCC A;  1H8C A;  1WGR A;  3EHV A;  2DZJ A;  3HM6 X;  4GN1 A;  3W1S C;  2C9W B;  2NPT B;  4LJO B;  2PE6 B;  1E7V A;  1V86 A;  2MRP A;  3QJZ A;  3AU5 A;  4NQK E;  3DOW A;  3DVG Y;  5BO4 B;  4MEM A;  2V1Y A;  3A9K A;  2XK5 A;  2I1K A;  4HXD A;  3VAW A;  5JHB A;  3ZTC A;  2JRI B;  2PEA A;  3L10 B;  1J19 A;  1UD7 A;  1C3T A;  3A4S C;  4DDG D;  2NBW B;  2MBE A;  1GC7 A;  3CF6 E;  1XQQ A;  2N9E B;  1ZKH A;  1WIA A;  4TQ0 A;  1WR1 A;  3VH3 B;  2WYQ A;  3DBL I;  4WWO A;  2N9X A;  3K9O B;  4EOY A;  2C7N B;  5J2R A;  3ZIM A;  4AOF A;  2AYO B;  5IAA C;  1Q0W B;  2FID A;  4DXA B;  5C1Z A;  4GDK A;  2ASQ A;  4K81 A;  2UYZ B;  5KHO A;  3D32 A;  1EF1 A;  1V5O A;  2V3S A;  1UZX B;  2KC2 A;  2G4D B;  4MDK E;  3HK0 A;  3VUY A;  2CU1 A;  2ZVN A;  4RMA A;  4BBN F;  4IWP A;  2LAS A;  4F8C B;  4B6W A;  1YIW A;  2LVP A;  4I6P A;  5E6N A;  3VH4 B;  4HPM B;  2KQ7 A;  3NY5 A;  3N3K B;  4JIO U;  5DCN A;  1OEY J;  4A3P A;  4AJW A;  1D3Z A;  3MTN B;  2JUO A;  3RYT A;  3ZRC A;  5E6O A;  3VDZ A;  4IW0 A;  1Y8R C;  5CHV C;  1SIF A;  4JL9 A;  1R4N I;  3ZNZ B;  3SD5 A;  1S1Q B;  4IUM B;  2IBI B;  2KAN A;  1S3S G;  2QHO A;  3CMM B;  2CHX A;  3PTF C;  4XC2 A;  3U7D A;  2PPH A;  3BY4 B;  2HD5 B;  2KO3 A;  2JZZ A;  2UWQ A;  3PGE A;  4FN2 A;  2LVO A;  2FIF A;  1E7U A;  3V6E B;  2KFK A;  4DK5 A;  2IO0 B;  2KNB A;  3C0R B;  2NBU A;  3Q3F A;  2KWC A;  1HE8 A;  2N1W A;  3ALB A;  4G11 A;  4M8N A;  1WXS A;  4RM9 A;  4TQ1 A;  1ISN A;  1Q1O A;  2IZV B;  2J0K A;  4AWJ A;  3V60 A;  1YX5 B;  4MH0 E;  4G50 A;  2BKF A;  2L0F A;  3L08 A;  2PJH A;  4BKS A;  4PYZ A;  1TGZ B;  2BF8 B;  2KX3 A;  4K7W A;  4W9F A;  2DAJ A;  2K39 A;  4FJV B;  5C23 A;  1FXT B;  5D94 A;  4E74 A;  4TKN A;  2LZ6 A;  1WX7 A;  4HDO A;  1WXM A;  3BIN A;  1J0G A;  3R7R A;  5HKH A;  2YVC A;  3OJ3 A;  4CHK A;  3V61 A;  3PLV A;  3QC8 B;  1L7Y A;  2KJH B;  3B08 A;  2D2Q A;  2O6V A;  4FLH A;  3H1U A;  1UBI A;  2J0M A;  2MA9 B;  3PPA A;  2ZNV B;  4GDL A;  4KVG B;  4FHK A;  4IM2 A;  1VD2 A;  2IO2 B;  1WR6 E;  2KDE B;  4NAW A;  3VFK A;  3ZDM C;  2W9N A;  3AXC A;  3APF A;  3A1Q B;  3QAQ A;  3APC A;  3CST A;  5CHW A;  2KDI A;  3VUX A;  2ZJD A;  3QX1 A;  1P3Q U;  4HJK A;  4NJ6 A;  2L8J A;  2MBO A;  4HLE A;  1Q5W B;  2NVU I;  3DPD A;  3QIJ A;  5GMV A;  1WJ4 A;  4BKT A;  2DYO A;  4KZ0 A;  4W9G A;  3UIP B;  3GOE A;  3L54 A;  2C7H A;  3ONS A;  3RZW C;  3A9J A;  3VUW A;  4OVU A;  2I1J A;  2K8B A;  3H9D A;  3N30 A;  1E8X A;  1QZE A;  3M62 B;  4DBG A;  2G3Q B;  2MCN B;  4OVV A;  1UGM A;  3TMP B;  1F9J A;  1WXV A;  4ANU A;  3VVW B;  5KHQ A;  1OGW A;  4BKS D;  1WE6 A;  5JHA A;  2A4Z A;  2RR9 A;  5EDS A;  2EMS A;  1V80 A;  2AL3 A;  3H7P B;  3T9L A;  1GJZ A;  2MP2 A;  4IWO A;  1I42 A;  4N9F 4;  2C7M B;  4AJY B;  3VTV A;  2O6V D;  3RT3 B;  3UGB B;  2N7E A;  3H6N A;  4PS8 A;  2BYV E;  1WRD B;  3MHS D;  2FCQ A;  2RD0 A;  1WZ3 A;  4ZRK A;  3ZO5 B;  3DBH I;  2L0T A;  4WJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...