3ZRCA

Pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zrcA00
2PPHA 4G3XB 1E8XA 2DX5B 4AOFA 2PE6B 2MBQA 4RM8A 2YLMA 3ZNHB 1WIAA 4FADA 2JZ3B 2KJ6A 2O2VA 2JXXA 1Q0WB 2RSUA 3PV1A 2XK5B 2XBBC 3A9KA 2LZ6A 4II3B 2DZIA 4W9JA 5G55A 2RPQA 3CSFA 2BKRB 3TJPA 4MSMB 2ZNVC 2MWSB 2IZVB 2NBVB 2KX0A 1IP9A 2KQ7A 1WZ3A 3VUYA 2L0TA 4KV2A 3NY5A 4OVVA 4DBGA 1RRBA 3NS8A 4FHKA 5IAAC 4GIVA 2J7QB 1E5WA 3UQBA 3CMMB 2NCNA 4IM2A 3PT2B 4PYUA 1IPGA 1RFAA 4P7IA 2LUEA 1UGMA 2KANA 2O6VA 3L0WB 2KOXA 5FR6A 3GOEA 4XX5A 2KVRA 2D07B 3PGEA 4W9GA 3HIZA 4B9KA 4GSWA 1E7VA 1YQBA 4IM3A 4HCNB 4HJKA 1V5TA 3ZRCA 3R7QA 2GBKA 4WJNA 1E8ZA 1YJ1A 4NJ7A 3QQ8B 4KZ0A 2LVOA 4II2B 4AWJA 1WXVA 3PVLA 2ZCBA 4TV3A 5DPRA 3V6CB 2ZNVB 1RAXA 1NI2A 1WM2A 2ZPYA 4K1RB 4NY0A 1WRDB 1ZKHA 1WJUA 4HVBA 5AZHA 4AJWA 3EECA 3K9PB 1WYWB 4ICUA 3MJWA 1P98A 4DHJB 4FLHA 2L3ZA 4MJSA 2EMSA 4XZ4A 1UBIA 4W9KA 3ZNID 3A9KB 2D2QA 3UGBB 2LJ5A 5CHWA 3S2AA 3SDLC 3R66C 3VUXA 2KX3A 1TGZB 2G3QB 1WGHA 2WWZA 3VUWA 2ZPNA 1YD8U 2BWES 3IVFA 2W9NA 4DHZB 4B6WA 2L8JA 1P0RA 4ZRJA 2I1JA 3A33B 3A1QB 4HPMB 3VTWA 4WQOB 2MBHA 4IUMB 4PYZA 3BY4B 2O6VB 2UYZB 2HE7A 2JUOA 3Q3FA 1OGWA 4LJPB 4ZRKA 3QK0A 2KD0A 1WE7A 3R3MA 2GBMA 1SIFA 3VDZA 3AI5A 3AU4A 4MGIE 5C1ZA 2KC2A 2LVPA 3EC8A 1YIWA 4FJZA 2MSED 2M8SA 2ZZPB 3GZNI 3JSVA 3LJ3A 3JW0X 4WAAA 1WX7A 3PHXB 5KHOA 3I3TB 2BWFA 2V3SA 3TL5A 1FXTB 2FUHB 5DPTA 4ZYNA 3VH3B 1WR1A 1WY8A 3DVNV 3UF8A 3ZLZA 2GMIC 2C5LC 3L10B 5JH5C 2KC1A 4HWIB 2FIFA 2DZKA 4DHZE 2DAJA 2PE9A 1G6JA 2K8HA 5CTRC 2N4FA 3ZTCA 4DK5A 4MDKE 5LXHA 1C1YB 2GBNA 3ML8A 4HPLB 4NJ6A 3KH0A 1EF5A 2MBEA 3X0WA 3ZIMA 2Z0DB 4W9CA 4TKNA 4G11A 3V61A 3VHTC 3W1SA 4EEWA 3T9LA 1WX8A 3H7PA 2FAZA 3UIOB 5E6PA 2HTHA 4E71A 2B3AA 2C7HA 2KTRA 4GOCA 3CF6E 2I1KA 4GN1A 2HJ8A 3NZSA 4F8CB 2KHWB 2GOWA 4BKTA 4KIKA 1WF9A 5E6OA 3SU8X 4GDKB 1UELA 4A3OA 3TCAA 3CSTA 3L17A 3QX1A 3PHWB 3JSVB 4CYEA 2LGYA 2REXA 3KUDB 2LASA 2LGDA 4HDQA 2G4DB 1UD7A 4BKGA 2IBIB 3N32A 3ZVVA 2Y5BB 1TTNA 1X1MA 3HHMA 1WGDA 4I6NB 3T8MA 2BYEA 1P1AA 2MRPA 2ZEQA 2NPTB 1WZ0A 1BT0A 2N1WA 2DYOA 3PS6A 1KM7A 3H6NA 2KLCA 4KDLB 2IO1B 3B08A 4W9EA 1Q5WB 2KK8A 1EUVB 2LWPA 4W9DA 4HCPB 3VXWA 4ANUA 1V9JA 2KKCA 2FIDA 5L95C 2K8CA 2KFKA 1GUAB 2DAFA 4WWPA 2LI5A 2DZJA 2CU1A 4HK2A 4URKA 2FNJB 4G50A 3RZFA 3ZKJC 3APFA 4W9FA 1KLVA 2N7DA 3K9OB 1IYFA 4WJOA 4EZJA 3VQIA 2XEWA 3H7PB 5CHVC 1NDDA 2ZVOA 4DDID 5DCNA 1P3QU 2C60A 2KTRB 4NAWA 3KYDD 3V6EB 4GDLB 2DENB 1XT9B 2RD0A 4KSLC 1UH6A 1WGRA 3KVFB 3QAQA 4FA6A 2CHXA 2J0JA 3ENEA 3L54A 3PLUA 4FHJA 3VFKA 5EDSA 1GC7A 1A5RA 4B95A 4DXAB 4KZCA 3PREA 5JZEB 4ICVA 2C7NB 2JT4B 2O2VB 3HM3A 4OVUA 4W9HA 4A20A 4I6PA 4WJPA 5D2MB 1S1QB 3MHSD 3OAWA 2NBWB 5DPSA 2NVUI 4KVGB 2MA9B 2CR5A 4MSQB 4IWPA 3V62A 4DWFA 1ZGUB 3ALBA 1L7YA 3ZUNA 3NOBA 2BYVE 1C3TA 4ANVA 4FJVB 2PJHA 3X23A 2ZJDA 4WWNA 2K6QA 1ISNA 4BBNC 3ZTDA 4RMAA 3U7DA 2K6DB 2JPHA 1OEYA 1WGGA 1WJ6A 3WALA 2FCQA 2L7RA 3LDZE 2CHWA 3D32A 4FN2A 4MGYE 4E74A 3W1YA 1KOTA 2L0FA 4PS3A 1EO6A 2JRHA 2KMCA 3N30A 3WAPA 5KHQA 1P9DU 2MBOA 3PSEB 1E7UA 3QA8A 1I42A 5D94A 3UQAA 5AZFA 3IFWB 3VTVA 4K81A 1V2YA 1WI0A 4KDIC 3ONSA 1LFDA 2L05A 3N3KB 5LLIA 1V5OA 4NAWB 4M8MA 5C23A 2C9WB 2IY1B 5IA7A 1H8CA 2AL6A 2KXJA 4LCDE 5BO4B 2AEHA 4AJYB 3RULA 3VH4B 1U4AA 2KN5A 3DQVA 4LJOB 2BYFA 1V6EA 4EOYA 1V81A 1ZW7A 2KFJA 4MJSB 1Z2MA 3ZW3A 1AARA 1OQYA 1SGHA 1WMHA 2G45B 2NBUA 3EFUA 3TBLD 4MGKE 3PRPB 2EKEC 3OJ4B 2IO2B 1XQQA 2G4SA 2ASQA 1WR6E 3RUIB 1M94A 2YVCA 4BKSA 2J0KA 3C0RB 3ZDTA 4EKUA 4ZDVA 2N9PC 3UINB 3RZWC 1UBQA 3KW5B 2BF8B 3PRZA 1I35A 1J19A 3ZNGC 4MH0E 2WX1A 3U30A 4LDTD 5G2NA 3WIMA 4JQWC 2Z59B 1GNUA 4CHKA 2K1FA 4M8NA 1K8RB 1Z5SB 3RD2A 3M62B 3SHQA 4JL9A 2DHZA 2MBBB 4GB9A 3UIPB 4ANXA 3DVGX 4GU2A 4NNJB 4EFOA 1Y8RC 2K25A 2K39A 1KJTA 2KJRA 2D10A 4N9F4 3H7SA 1J8CA 3OLMD 3W1SC 4JGHB 2KTFA 5D6JB 4FJYA 1V86A 2IO3B 3O65B 3QIJA 4E3CA 3L16A 1F9JA 2J0MA 2QHOA 4ASWC 3APDA 1WJNA 2KNBA 3DBSA 1E90A 1VD2A 4IC7B 3RYTA 5AEKB 2JVCA 2VRRB 3RCZA 2CKHB 2KLGA 3NZUA 2RR9A 4MELA 4W9IA 3ZNZB 2OJRA 1WXSA 2AWTA 3JYUA 1UZXB 2ZCCA 2Z0EB 2PEAA 5HKHA 2R2OA 4CO7A 4YL8A 2KWCA 4BVUC 3VVWB 4EZLA 1WMHB 2GBRA 2IY0B 3QWZB 5LXIB 3PRMB 5D7GA 4HXDA 4I6LB 1SE9A 4JIOU 2KMAA 3A4RA 1WGYA 2MW5A 2M4NA 1LXDA 3B0AA 3KUZA 3ZRFA 2LRUA 2M0XA 3ECIA 3U8ZA 3RT3B 2OOBB 4ANWA 4ZRIA 2ZVNA 3VAWA 4A3PA 4NQKE 1L2NA 4BFRA 4BOSC 2N9EB 2DZMA 3QJZA 1EF1A 3DVGY 4IG7B 2KWUB 5JHAA 2A5UA 5DPWA 2JRIB 2IYDB 3ML9A 3BINA 3PLVA 2MX2A 3PTFC 3A1QA 4F1SA 1WXAA 5J2RA 2MP2A 3AULA 4AP4C 2DYBA 2K8BA 3EHVA 4KIKB 3TIXA 3ZDMC 1D3ZA 3IBEA 4K7UA 4M0WB 3SD5A 3IG3A 2V1YA 1R4NI 3HM6X 3Q3JA 3DVNU 4EUTA 4RM9A 1VCBA 5CX3A 3A9JA 2BPSA 2R2QA 2KJHB 3MTNB 5GMVA 4BBNF 2AYOB 3M3JA 1Q1OA 3HK0A 4BKSD 2M1MA 2D3GA 2M17A 2N1VA 3DBRI 3AXCA 2GBJA 4MM3A 2WX0A 1TZ1A 2RGFA 4FBJB 1WFYA 4IM0A 1H4RA 1T0YA 1LQBA 2LGXA 2LXAA 4PS8A 2KFKB 2N7EA 4DDGD 1YX6B 2FCNA 4TQ0A 2MQJA 2V4LA 3QHTA 4MGZE 4XC2A 5TR5A 3TMPB 3WA0A 4K7WA 3H1UA 4GXBA 2AL3A 2KDIA 1GG3A 1RLFA 3DOWA 3A4SC 3V60A 5J18A 5JHBA 1J0GA 3AU5A 2LRWA 4LDTB 4X57B 1E8YA 3WAOA 4G0NB 3PPAA 4HDOA 4WWOA 2WDTB 2N9XA 1GJZA 2MP2B 4JLCA 5E6NA 3M95A 4BOZB 2FCMA 4NQLB 2C7MB 4TUUA 3H9DA 2L76A 5L83A 1WX9A 4WJQA 4K7SA 4PS7A 1V80A 1V49A 4GDKA 1E8WA 3QARA 4EZKA 1WE6A 4DHJD 4J6IA 3KYCD 3L13A 2KDFB 4F7ZA 4IWQA 2MCNB 3A9JB 1NBFC 4TQ1A 4FULA 2HD5B 4GGQA 1YX5B 2XK5A 3DDCB 3OJ3A 3WAMA 3DBHI 2WYQA 1XD3B 2KZRA 3L08A 5J17A 2KWVB 3DPDA 2BKFA 4NPNA 4KSKC 2JZZA 2NPTA 1LM8B 1QZEA 1TBEA 1WM3A 2NR2A 2JWZA 2KQSA 4IWOA 4MEMA 4AUQC 3R7RA 2DYMA 2JF5A 3PZDA 2IO0B 2LD9A 3QC8B 1GC6A 2LVQA 3IHPC 2L00B 1WH3A 3JVZX 1WJ4A 1WXMA 2EMTA 3P2BA 3KUCB 3QCAA 2NS5A 2KDBA 2D11A 2O6VD 1R4MI 5CHFA 1S3SG 3WANA 1PQSA 2FCSA 1OEYJ 2KO3A 2JY6A 3B1LX 3NHEB 4W9LA 3DCGA 1MG8A 3ZO5B 3VTUA 2MLBA 4GMVA 2CHZA 2LXCA 4IW0A 2CS4A 2UWQA 3M63B 3DBLI 4HLEA 1HE8A 1CMXB 2A4ZA 5AZGA 3APCA 4GDLA 2KDEB 2BGFA 1JRUA 1OTRB
chains in the Genus database with same CATH superfamily
5IO9A 1N62A 4OZBA 4YSZB 4RM8A 3ZNHB 2I2YA 2BB6A 5LNK1 2O2VA 2JXXA 1Q0WB 2VH2A 2XK5B 1SE3A 4AQ7A 3RPFC 4MSMB 5C2TB 3VUYA 5EE1A 1IGDA 3NY5A 1RRBA 3NS8A 5IAAC 3UQBA 1N60A 4USAA 3EGRA 1WSPA 2Y3AA 1UGMA 2WXOA 2Y5PA 2KOXA 3DWMA 2K9XA 4GSWA 4NAMA 1YQBA 4HCNB 1V5TA 1E8ZA 4KKJA 3SFEB 3PVLA 4TV3A 5DPRA 4J3OD 5H8YE 1NI2A 3ZYYX 1WRDB 1ZXHA 2KVZA 4P6VF 1CK1A 2PMVA 1UBIA 3ZNID 3DBLB 2IGHA 4WURA 2D2QA 1TKGA 2LJ5A 3SDLC 1EWCA 1MJDA 1WGHA 1ZDVA 2D5GA 3VUWA 2Z8LA 3N1ZC 2BWES 3IVFA 4DHZB 1HXYD 2W54A 3A1QB 1IBXA 4TSSA 2UYZB 2JUOA 3QK0A 1WE7A 3H8HA 2KC2A 1YIWA 2MSED 3LJ3A 3JSVA 4B0MA 3TL5A 1AWDA 3IXSA 1GB4A 5DPTA 2YEPB 4OHJA 1DOYA 4MM3B 1WR1A 2WHIA 3DVNV 5I4DA 1IGCA 2C5LC 3L10B 4HWIB 2PE9A 4P1BC 1FCLA 2FE8A 4K3CA 2GBNA 3ML8A 2Z0DB 4TKNA 4G11A 2WXNA 5FKAC 1F77A 1WGKA 1TS5A 1PDXA 1GB1A 2H89B 4BKTA 4KIKA 1WF9A 2WXQA 3SU8X 5HI1A 4M0WA 3QX1A 3JSVB 3PZ8A 4CYEA 2QILA 3TEZA 2G1EA 3N32A 3ZVVA 2Y5BB 2VZKD 1WGDA 4US8A 3BWUD 2ZEQA 2NPTB 2N1WA 1EUVB 2OHFA 1V9JA 1JCKB 3L4PA 1XLOA 2K8CA 1STEA 1QKZA 1M4VA 4KX6B 2N9KA 4RGNA 3APFA 4W9FA 2N7DA 1IYFA 4WJOA 2MEKA 3VQIA 1UNSA 1NDDA 1F0ZA 5DCNA 2C60A 1I4QA 1PGXA 2WQYB 3UI3A 3L54A 3PLUA 4FHJA 2GLSA 4OW0A 4KZCA 3HM3A 2WDRB 5G5HA 4W9HA 2BB5A 4WJPA 4LNFA 4RGOS 5DPSA 1L0XB 4MSQB 3IAS1 1ZGUB 3P4PB 3ZUNA 3NOBA 2BYVE 3SR6A 1E6EB 2PJHA 2WXGA 3U7DA 2K6DB 1OEYA 2JPHA 3AN1A 2FUG1 1EU4A 2QCZA 3LDZE 2WXPA 3BVZA 1P7FA 4E74A 3EFCA 2KMCA 1QT9A 2MBOA 3PSEB 5D94A 3AEDB 3UQAA 4K81A 4KDIC 2L05A 5LLIA 5C23A 2IY1B 5IA7A 1H8CA 2AL6A 2AEHA 3VH4B 2KN5A 2E6XA 3DQVA 2BYFA 1V81A 2IGGA 1Z2MA 2WXKA 2NBUA 3TBLD 3PRPB 2VZKB 2BVCA 2ASQA 1WR6E 1M94A 2YVCA 3ZDTA 2N9PC 3RZWC 4XWTA 1C77A 1J19A 3ZNGC 4MH0E 1QILA 3WIMA 2Z59B 3VRAB 3DVGX 4NNJB 1Y8RC 1VRAB 3W2DA 2D10A 4XDCA 4NZLB 1HTQA 3DBSA 1E90A 2HDEA 2M56B 2UU7A 3RCZA 2CKHB 3MC9A 3AV8A 2ZCCA 4YL8A 4BVUC 3VVWB 1J7CA 2IY0B 4RF0A 3AM9A 3QWZB 5D7GA 1SE9A 3GP7A 4JIOU 3A4RA 3KUZA 2LRUA 3U8ZA 4UDUC 4ANWA 2OJWA 2ZVNA 3VAWA 5EE3A 4BFRA 1NVID 3DHHC 3Q3OC 4N59A 2A5UA 3ML9A 3BINA 3PLVA 3PTFC 1JQ4A 4A90A 4F1SA 2RPVA 1N5WA 4AP4C 3U7ZA 2WXFA 1AN8A 3CIRB 3BZDB 3Q3JA 1VCBA 2AX5A 5GMVA 2AQ1B 1YJIA 1D5MC 3M3JA 1Q1OA 3NVVA 4BKSD 3Q8BA 2M1MA 4C80A 4HKZE 2M17A 3DBRI 2GBJA 1TZ1A 1T0YA 1YMHE 2LGXA 2LXAA 2K5PA 2KFKB 2JXTA 4DDGD 1YX6B 3R8BA 4LNNA 3QHTA 1SB3C 4XC2A 3WA0A 1VLBA 3RN9C 4B0EA 2MHJA 1YOVB 3AE9B 4GXBA 2KDIA 1JWMD 4WH4A 4KGSA 1E8YA 3W5UB 3WAOA 3PPAA 4WWOA 5E6NA 4BAXA 4TUUA 2L76A 5L83A 4PT5A 3GE8C 1V80A 1QF6A 3ZXRA 1YQ3B 4DHJD 3T3OA 2MCNB 1T0QC 2HD5B 2INPE 1Q10A 2WYQA 3L08A 2L52A 2BKFA 1YN5A 1LM8B 1TBEA 1WM3A 4MEMA 3QC8B 2LVQA 2V3NA 2NS5A 2D11A 1R4MI 3DBRB 2KO3A 2W55A 1OEYJ 3B1LX 4BZAA 3DCGA 1MG8A 2HTME 4MACA 3GS2A 4GMVA 3M63B 3R2IA 5AZGA 3APCA 2BGFA 1JRUA 2PE6B 2YLMA 1WIAA 4FADA 1YNTE 1V1OA 2RSUA 5IOIA 1ENFA 3A9KA 2DZIA 5G55A 2RPQA 3CSFA 1JMLA 2ZNVC 2NBVB 2IZVB 3RNBC 1TIFA 2L0TA 1YN3A 2MJEA 1IPGA 4RCOA 3IT4B 4FXCA 2LUEA 5IKCM 3MFGA 1P7EA 3PGEA 4B9KA 3R2TA 4YSXB 1FEHA 3ZRCA 3R7QA 2GBKA 4NJ7A 4KZ0A 4II2B 1D6EC 1D5ZC 2ZNVB 1TS2A 3DWGC 2ZPYA 1XLNA 1ZKHA 4HVBA 4ITKA 5AZHA 3EECA 1R4MB 1T0SC 4LNKA 5GXGB 1WYWB 3MJWA 1P98A 4DHJB 4DXGA 2EMSA 1N6ZA 2HJ1A 3A9KB 3BK2A 4HEA1 3S2AA 3VUXA 2EELA 2WNMA 3TEWA 2QEJC 1T0RC 2DLBA 1F1HA 1P0RA 4C7ZA 1ZUD2 3VTWA 3Q6BA 1FMAD 2MBHA 3BY4B 1MFWA 1C78A 1UGJA 1SIFA 3AI5A 5C1ZA 4MGIE 5IN7A 1I4XA 3EC8A 2ZZPB 1L6VA 3GZNI 5G5GA 2EKIA 4KGRA 3PHXB 5KHOA 2BWFA 1FXTB 2PVOD 2BT6A 4ZYNA 2J42A 5HG2A 3ZLZA 2GMIC 5JH5C 2KC1A 1R4NB 1I4HA 1ZE3D 4DHZE 1G6JA 4D2KA 2K8HA 5CTRC 3AEFB 3ZTCA 1TYGB 4DK5A 3X0WA 4C56C 3Q2AC 3V61A 4EEWA 3LXFA 2WXMA 5E6PA 4GOCA 1QOBA 1TKYA 4GN1A 1ZPSA 2HJ8A 3NZSA 2E3TA 2KHWB 3P4RB 2QJLA 2PIAA 2M0AA 5E6OA 1FCCC 1UELA 4GDKB 4ZHOA 1L6UA 3C8YA 3C19A 2LASA 4HDQA 1FFVA 1UD7A 3B9JA 2K0PA 1TTNA 1X1MA 1SE4A 2BYEA 1WZ0A 4L1BA 1NYQA 3TEYA 2M19A 4S0RA 2LWPA 4HCPB 3GZNB 1ZP0B 5T8IA 1GUAB 3KQ4A 2DAFA 3DBHB 2LI5A 2SAKA 2QMTA 4URKA 2FNJB 4G50A 3RZFA 1RM6C 4EZJA 1GOZA 5CHVC 2ZVOA 4DDID 4RGTA 3V6EB 4S17A 3BYYB 2WXJA 2RD0A 2KN4A 3RMKC 3KVFB 4FA6A 2CHXA 2WU5B 3VFKA 1GC7A 2FBWB 2YEPF 4L2YA 4B95A 1QLBB 3PREA 4ZRQA 3PO0A 2O2VB 2D3CA 3U2SC 5D2MB 3MHSD 4KVGB 2CR5A 1TS4A 2KYWA 2INNE 3V62A 1KFYB 1C3TA 3NUHB 3TEXA 2ZJDA 4RMAA 1CZPA 1WGGA 1C79A 3D32A 4FN2A 1R7SA 1KOTA 5KHQA 3VTVA 3IFWB 2V0GA 3N3KB 4AJYB 3Q14C 4LJOB 2KDMA 4L23A 1OQYA 1WMHA 2G45B 3RNCC 1PUTA 4MGKE 1XLQA 2IO2B 4ZHPA 1ZDXA 2G4SA 3RUIB 3I57A 4ZDVA 2LUMA 1I35A 1SF0A 4M01A 2WX1A 1GNUA 1IBXB 1K8RB 1Z5SB 1AYFA 3M62B 3RD2A 3SHQA 3NJTA 2JQRB 4EFOA 1I4PA 1KJTA 1I4GA 1HZ6A 1PGAA 4N9F4 1ROEA 3OLMD 2KTFA 5EE9A 1TJEA 2I38A 1HQRD 3ZXVA 3EUB2 1FIQA 2JYEA 2KNBA 1SXTA 5E6JA 1VD2A 3RYTA 5AEKB 3RFZB 2RR9A 2OJRA 2AWTA 3JYUA 3KWLA 1UZXB 2R2OA 1WMHB 2GBRA 3PRMB 1FNWA 4I6LB 1F2RI 3FC4A 4OZAA 1WGYA 2MW5A 3FKYA 3RNGC 2M0XA 1SSNA 3ECIA 4ZRIA 4ACFA 4P1CC 1NEKB 2DZMA 2PLPA 2RMMA 4EE2A 2KT7A 2JRIB 2IYDB 2BBCA 3TIXA 4KIKB 1D3ZA 1RFKA 3N20C 4M0WB 3MC0B 2V1YA 3HM6X 3DVNU 3AB5A 1K52A 5CX3A 3A9JA 2R2QA 2AYOB 5BYRA 1N61A 4R3DA 1YN4A 2AQ3B 4RFBA 3AXCA 2RGFA 4FBJB 1WFYA 1H4RA 1LQBA 1ET6A 2AQ2B 2ONQA 1SE2A 4TQ0A 1XO3A 5TR5A 1NYRA 1MHHE 3H1UA 2AL3A 1UWMA 5BYSA 5J18A 3A4SC 4H2AA 2LRWA 4X57B 3EA6A 1PYWD 1TZOA 3HVDA 4HDOA 4BOZB 2C7MB 1BMLC 3AH7A 1FXIA 2ICIA 3BK1A 3QARA 2H88B 2L1AA 3A9JB 3HRDD 4TQ1A 1YX5B 1SBBB 1C76A 1XD3B 2KZRA 5J17A 2QC8A 2KAJA 3N1XC 4KSKC 1QZEA 2NR2A 3V3XA 2JWZA 4IWOA 1FXAA 3PZ7A 3PZDA 2IO0B 1WH3A 5JXVA 2EMTA 2WXRA 3B2GA 5CHFA 3WANA 1PQSA 3NHEB 3MHZA 5H92C 2BYTA 1FFUA 1L5PA 4IW0A 2WXHA 4HLEA 4WQMA 2WDQB 1ESFA 4GDLA 2PPHA 1E8XA 2DX5B 1A70A 2WDVB 1PFDA 2B76B 4WAFA 1BXTA 1FNVA 4M00A 1MG4A 2XBBC 4W9JA 2LZ6A 1I4RA 2BKRB 3TJPA 2LMCA 2KX0A 1XF5L 2KQ7A 1WZ3A 4HRSA 4KV2A 1SEBD 3BYTB 4GIVA 2J7QB 2GI9A 2D3BA 1RFAA 3T3NA 3L0WB 5FR6A 1T5XD 1V97A 1RYJA 2WU2B 4HJKA 1YJ1A 2LVOA 1WXVA 2ZCBA 3RNEC 3V6CB 1RAXA 4K1RB 4NY0A 3TUOA 4LTUA 3K9PB 3TSSA 1IUEA 4FLHA 2CJNA 4MJSA 4XZ4A 4Q2JA 2N0SB 3R66C 3FILA 1TGZB 3E56A 3E9SA 3P63A 2ZPNA 4B6WA 2L8JA 5TSSA 3A33B 4WQOB 4IUMB 4PYZA 2QSDA 3I5JC 1TT5B 2L83A 4KKIA 3Q3FA 1OGWA 4ZRKA 3ZQ4A 1VR9A 2JWUA 2GBMA 1SIJA 3VDZA 1TY2A 1FD6A 4FJZA 3JW0X 4WAAA 4A9AA 2KACA 1QOAA 3I3TB 2V3SA 1FRDA 2FUHB 1V1PA 4M02A 1KF6B 1WY8A 3UF8A 3AE1B 2FIFA 3GE3C 2DAJA 5LXHA 1C1YB 4NJ6A 4HPLB 1EF5A 2MBEA 3OG5A 3ZIMA 4W9CA 4O1NA 3VHTC 3W1SA 2J53A 1XXGA 1WX8A 4YXDB 3H7PA 2FAZA 1L0YB 2HTHA 4E71A 1WRIA 3CF6E 2SEBD 4F8CB 2X38A 2V3PA 2GOWA 4ARIA 4LNOA 3PHWB 2LGYA 3KUDB 2LGDA 2IBIB 1ET9A 1OQQA 3HHMA 1T6BX 4I6NB 2NTTA 1P1AA 2MRPA 4A8XC 1HA5A 2DYOA 4KDLB 4IDIA 2QDFA 2IO1B 1CQVA 3B08A 4W9EA 4W9DA 2KK8A 4ANUA 3VXWA 2FIDA 1C4PA 5L95C 1D5XC 1GPXA 4WWPA 2BS2B 1V8CA 2WGSA 4ZYSA 2BS4B 1UUPA 3ZKJC 1D4BA 2XEWA 3H7PB 3VR9B 1P3QU 1WWTA 4NAWA 3KYDD 1NENB 3HVZA 1XT9B 1E0ZA 4KSLC 1UH6A 3QAQA 2J0JA 3ENEA 5EDSA 2JZPA 4KGTA 5JZEB 1WXQA 3NVYA 4ICVA 4OVUA 5D3DA 1S1QB 1XLPA 3OAWA 2NBWB 4DWFA 4RGMA 1L7YA 2GRIA 3HUIA 1MI0A 3AEGB 2WLBA 3WCQA 4FJVB 4WWNA 1B1ZA 1ISNA 4BBNC 3ZTDA 3NZ3A 4HROA 1WJ6A 3WALA 2FCQA 2ZW0A 2CHWA 3W1YA 2JRHA 1KTKA 1I7HA 1LO5D 1P9DU 4A55A 3QA8A 5AZFA 1HTOA 1OQRA 3Q3MC 1V2YA 1WI0A 3ONSA 1JWUD 4NAWB 4M8MA 4XE0A 2C9WB 2KXJA 4LCDE 2WXIA 2JYTA 1U4AA 1L0VB 1ZW7A 1J7BA 5C3JB 1AARA 1SGHA 1L4DB 2CJOA 2JSVX 1JWBD 2OEDA 2N9LA 2KQ4X 2J0KA 2XN9C 3C0RB 4LLGM 1DOXA 3KW5B 2BF8B 3PRZA 4XWWA 4ARCA 3U52E 3Q8EA 3U30A 4LDTD 4JQWC 2VH1A 2K1FA 4M8NA 4ANXA 2DHZA 2MBBB 4GB9A 1ZOYB 2K25A 3GB1A 2K39A 2KJRA 2Q5WD 3H7SA 1J8CA 4JGHB 5D6JB 2IO3B 3QIJA 3IT6B 3L16A 2J0MA 2QHOA 4ASWC 3APDA 1WJNA 3Q8FA 1CJEA 4IC7B 2JVCA 3P4QB 2VRRB 2KLGA 3NZUA 4MELA 4REZA 2JU6X 1WXSA 4CO7A 3NS1A 4EZLA 2LEKA 5LXIB 4TMAB 3P1MA 3RI7C 1L4ZB 1L2NA 4BOSC 2N9EB 3QJZA 1EF1A 3DVGY 4IG7B 1FNUA 2KWUB 1PGBA 5DPWA 2L32A 2RDHA 2MX2A 3A1QA 5J2RA 1WXAA 3DHGC 3EHVA 3ZDMC 4WWMA 3AE4B 2ON8A 3SD5A 4EUTA 2KJHB 3MTNB 2LJIA 3AEBB 3I9V1 1YQ4B 5FR3A 2PKOA 2D3GA 1T3QA 4MM3A 3MC8A 2G9HD 1QOFA 2BQQA 4PS8A 1FO4A 1C4AA 1HZ5A 2RDGA 3KLSX 2FCNA 2MQJA 2V4LA 3TMPB 1C4CA 4K7WA 4JWSC 1EU3A 1RLFA 1JWAD 1TKEA 5JHBA 1J0GA 4LDTB 1ZXIA 3NRZA 4PK1A 2W82A 3ZJUA 4GLSC 4C4VA 2WDTB 1GJZA 2FCMA 4NQLB 1N5XA 3H9DA 4WJQA 4DQOC 1MHXA 4PS7A 2NMQA 1V49A 3AEAB 1E8WA 1WE6A 4IWQA 1NBFC 5AUKA 4FULA 3VRBB 4GGQA 1SJED 3WAMA 4N6EB 4NPNA 2JZZA 2NPTA 1RWSA 2NTSA 4AUQC 1YJJA 4RH6A 4YTPB 2DYMA 2JF5A 2MJDA 4JPSA 2L00B 3JVZX 1WXMA 5BMGA 3MP9A 5BYQA 2O6VD 2KDBA 3W9CB 1S3SG 4W9LA 2FCSA 3ZO5B 2CHZA 3MJ5A 4US9A 1HE8A 4C4VB 4CQNA 2KDEB 1VJKA 1OTRB 2INDC 3LB8C 4G3XB 3V05A 4AOFA 2MBQA 2JZ3B 2KJ6A 3Q69A 3PV1A 4II3B 1FM0D 4AS1A 2V4IB 2MWSB 1IP9A 4OVVA 4DBGA 2GB1A 2BS3B 1FRRA 4FHKA 5HHDG 1E5WA 3N9YC 3CMMB 2NCNA 3B2FA 3ETRA 3PT2B 4IM2A 4PYUA 4P7IA 3RNFC 2KANA 2O6VA 5MPOA 3GOEA 4XX5A 1UWXA 1Y56A 2KVRA 2D07B 4W9GA 3HIZA 1E7VA 4IM3A 1HEZE 1WYGA 4WJNA 3QQ8B 4AWJA 1F2RC 1WM2A 1WJUA 2D3AA 4AJWA 4ICUA 3BVMA 2L3ZA 3AE3B 4W9KA 2MH7A 4YTMB 4WIPA 3UGBB 5CHWA 2KX3A 4ZRPA 2G3QB 2Y5CA 3BIID 1FPYA 2ACZB 2WWZA 1YD8U 4K3BA 4JE3B 2W9NA 4ZRJA 1DOIA 2I1JA 4HPMB 1N63A 2O6VB 2HE7A 3Q8CA 4LJPB 2KD0A 3R3MA 3AU4A 2LVPA 2M8SA 3DHIC 1WX7A 3ABVB 2INCC 2LHEA 1DGJA 3VH3B 3ZJVA 2K3UA 3VR8B 4N58A 2JX5A 2DZKA 3BVGA 2N4FA 4MDKE 2TSSA 3KH0A 3P4SB 2IGDA 3T9LA 3UIOB 2B3AA 2C7HA 3NVWA 2KTRA 4HPPA 2I1KA 1C9FA 1TS3A 4DXFA 4IKGA 1E7PB 4A3OA 3TCAA 4IOIE 3CSTA 1VDVA 3L17A 1XEEA 4QAYA 2REXA 2G4DB 1AW7A 4BKGA 4NJCA 3T8MA 1BT0A 3PS6A 1KM7A 1SJHD 2KLCA 3H6NA 1Q5WB 2KKCA 1JW9D 2LGIA 2KWDA 2KFKA 3FAHA 2DZJA 2CU1A 4HK2A 1KRHA 1EWYC 3OWEB 2CU3A 1KLVA 3K9OB 1VZ6A 1EM7A 2KTRB 4GDLB 2DENB 4OZCA 1WGRA 2W3SA 3AE2B 3SFDB 1A5RA 1QOGA 4DXAB 3AE8B 4C00A 1VZ7A 2LFIA 1F52A 2ZW1A 1VZ8A 5FK9C 2C7NB 2JT4B 4A20A 4I6PA 5EE0A 2NVUI 2MA9B 4IWPA 4XGAB 2J52A 3ALBA 3ZJTA 2PTLA 4ANVA 2DNFA 3I63C 3LYYA 3X23A 1J7AA 4OVZA 2K6QA 3U4EG 4MH8A 4A6QA 1KH0A 2L7RA 4MGYE 2L0FA 4JWUC 1EO6A 4PS3A 3N30A 3WAPA 4YT0B 1E7UA 1I42A 2PW9A 1LFDA 1V5OA 5D3IB 2W3RA 5BO4B 4ZOHC 3IAM1 3RULA 2WS3B 1K53A 1V6EA 4EOYA 5HFYA 2KFJA 4MJSB 3ZW3A 1QQRA 3EFUA 2DWQA 2EKEC 3OJ4B 3Q3NC 1XQQA 3CWIA 1LGRA 3FILB 3AE7B 1JRPA 4BKSA 4EKUA 3UINB 1UBQA 2V9HA 2QIEB 2IJ0A 2X8XX 3AMZA 5G2NA 3URYA 4YSYB 4CHKA 4HKQA 4JL9A 4P16A 3O13A 3UIPB 4GU2A 1XCQL 2DBYA 2MJ3A 3W1SC 4FJYA 1V86A 4E3CA 3O65B 3Q8AA 1F9JA 1K51A 1V1PB 1B9RA 1UF0A 4W9IA 4RF1A 3ZNZB 1KLGD 2Z0EB 2PEAA 5HKHA 2IDYA 2KWCA 2WP9B 3AE5B 3W5VB 4HXDA 2KMAA 5BMIA 1OFFA 3J9CA 2M4NA 1LXDA 3B0AA 5IP4D 3ZRFA 2N7JA 3RT3B 2OOBB 3N1YC 4A3PA 4NQKE 1XCTL 1ACCA 4XYCA 5JHAA 1JROA 4MT5A 1E9MA 2MP2A 3AULA 2DYBA 2K8BA 2XNAC 1MPEA 2BW2A 3IBEA 4K7UA 3AEEB 3IG3A 1R4NI 4RM9A 1BUIC 2BPSA 4YTNB 4BBNF 3HK0A 4JX1C 2LHDA 2N1VA 2WXLA 5BMHA 2WX0A 4IM0A 1JALA 3AECB 3RNAC 4XDDA 2N7EA 2BTEA 4MGZE 1GG3A 3DOWA 3V60A 3P42A 3AU5A 4G0NB 1MVKA 4RNAA 2N9XA 2MP2B 4JLCA 3M95A 2LGSA 1WX9A 4K7SA 2IPKD 4GDKA 4EZKA 1DYQA 3KWVA 4J6IA 3KYCD 1NI3A 2KDFB 3L13A 4F7ZA 2R61A 2XK5A 3DDCB 3OJ3A 3DBHI 3SEBA 2KWVB 3DPDA 4LNIA 4LK0M 2KQSA 1K50A 3R7RA 4HJGE 2LD9A 3NG0A 3AE6B 1GC6A 3IHPC 1WJ4A 3P2BA 3KUCB 3QCAA 2KMMA 1TY0A 4C7YA 5AUIA 1KLUD 1GAQB 2JY6A 1JWSD 2RDBC 3VTUA 2MLBA 2J4XA 2LXCA 1E10A 2CS4A 2UWQA 3ZGZA 3DBLI 4YWGG 1CMXB 2A4ZA 3NVZA 2K22A 2PVGC
chains in the Genus database with same CATH topology
2PPHA 4G3XB 1E8XA 2DX5B 4AOFA 2PE6B 2MBQA 4RM8A 2YLMA 3ZNHB 1WIAA 4FADA 2JZ3B 2KJ6A 2O2VA 2JXXA 1Q0WB 2RSUA 3PV1A 2XK5B 2XBBC 3A9KA 2LZ6A 4II3B 2DZIA 4W9JA 5G55A 2RPQA 3CSFA 2BKRB 3TJPA 4MSMB 2ZNVC 2MWSB 2IZVB 2NBVB 2KX0A 1IP9A 2KQ7A 1WZ3A 3VUYA 2L0TA 4KV2A 3NY5A 4OVVA 4DBGA 1RRBA 3NS8A 4FHKA 5IAAC 4GIVA 2J7QB 1E5WA 3UQBA 3CMMB 2NCNA 4IM2A 3PT2B 4PYUA 1IPGA 1RFAA 4P7IA 2LUEA 1UGMA 2KANA 2O6VA 3L0WB 2KOXA 5FR6A 3GOEA 4XX5A 2KVRA 2D07B 3PGEA 4W9GA 3HIZA 4B9KA 4GSWA 1E7VA 1YQBA 4IM3A 4HCNB 4HJKA 1V5TA 3ZRCA 3R7QA 2GBKA 4WJNA 1E8ZA 1YJ1A 4NJ7A 3QQ8B 4KZ0A 2LVOA 4II2B 4AWJA 1WXVA 3PVLA 2ZCBA 4TV3A 5DPRA 3V6CB 2ZNVB 1RAXA 1NI2A 1WM2A 2ZPYA 4K1RB 4NY0A 1WRDB 1ZKHA 1WJUA 4HVBA 5AZHA 4AJWA 3EECA 3K9PB 1WYWB 4ICUA 3MJWA 1P98A 4DHJB 4FLHA 2L3ZA 4MJSA 2EMSA 4XZ4A 1UBIA 4W9KA 3ZNID 3A9KB 2D2QA 3UGBB 2LJ5A 5CHWA 3S2AA 3SDLC 3R66C 3VUXA 2KX3A 1TGZB 2G3QB 1WGHA 2WWZA 3VUWA 2ZPNA 1YD8U 2BWES 3IVFA 2W9NA 4DHZB 4B6WA 2L8JA 1P0RA 4ZRJA 2I1JA 3A33B 3A1QB 4HPMB 3VTWA 4WQOB 2MBHA 4IUMB 4PYZA 3BY4B 2O6VB 2UYZB 2HE7A 2JUOA 3Q3FA 1OGWA 4LJPB 4ZRKA 3QK0A 2KD0A 1WE7A 3R3MA 2GBMA 1SIFA 3VDZA 3AI5A 3AU4A 4MGIE 5C1ZA 2KC2A 2LVPA 3EC8A 1YIWA 4FJZA 2MSED 2M8SA 2ZZPB 3GZNI 3JSVA 3LJ3A 3JW0X 4WAAA 1WX7A 3PHXB 5KHOA 3I3TB 2BWFA 2V3SA 3TL5A 1FXTB 2FUHB 5DPTA 4ZYNA 3VH3B 1WR1A 1WY8A 3DVNV 3UF8A 3ZLZA 2GMIC 2C5LC 3L10B 5JH5C 2KC1A 4HWIB 2FIFA 2DZKA 4DHZE 2DAJA 2PE9A 1G6JA 2K8HA 5CTRC 2N4FA 3ZTCA 4DK5A 4MDKE 5LXHA 1C1YB 2GBNA 3ML8A 4HPLB 4NJ6A 3KH0A 1EF5A 2MBEA 3X0WA 3ZIMA 2Z0DB 4W9CA 4TKNA 4G11A 3V61A 3VHTC 3W1SA 4EEWA 3T9LA 1WX8A 3H7PA 2FAZA 3UIOB 5E6PA 2HTHA 4E71A 2B3AA 2C7HA 2KTRA 4GOCA 3CF6E 2I1KA 4GN1A 2HJ8A 3NZSA 4F8CB 2KHWB 2GOWA 4BKTA 4KIKA 1WF9A 5E6OA 3SU8X 4GDKB 1UELA 4A3OA 3TCAA 3CSTA 3L17A 3QX1A 3PHWB 3JSVB 4CYEA 2LGYA 2REXA 3KUDB 2LASA 2LGDA 4HDQA 2G4DB 1UD7A 4BKGA 2IBIB 3N32A 3ZVVA 2Y5BB 1TTNA 1X1MA 3HHMA 1WGDA 4I6NB 3T8MA 2BYEA 1P1AA 2MRPA 2ZEQA 2NPTB 1WZ0A 1BT0A 2N1WA 2DYOA 3PS6A 1KM7A 3H6NA 2KLCA 4KDLB 2IO1B 3B08A 4W9EA 1Q5WB 2KK8A 1EUVB 2LWPA 4W9DA 4HCPB 3VXWA 4ANUA 1V9JA 2KKCA 2FIDA 5L95C 2K8CA 2KFKA 1GUAB 2DAFA 4WWPA 2LI5A 2DZJA 2CU1A 4HK2A 4URKA 2FNJB 4G50A 3RZFA 3ZKJC 3APFA 4W9FA 1KLVA 2N7DA 3K9OB 1IYFA 4WJOA 4EZJA 3VQIA 2XEWA 3H7PB 5CHVC 1NDDA 2ZVOA 4DDID 5DCNA 1P3QU 2C60A 2KTRB 4NAWA 3KYDD 3V6EB 4GDLB 2DENB 1XT9B 2RD0A 4KSLC 1UH6A 1WGRA 3KVFB 3QAQA 4FA6A 2CHXA 2J0JA 3ENEA 3L54A 3PLUA 4FHJA 3VFKA 5EDSA 1GC7A 1A5RA 4B95A 4DXAB 4KZCA 3PREA 5JZEB 4ICVA 2C7NB 2JT4B 2O2VB 3HM3A 4OVUA 4W9HA 4A20A 4I6PA 4WJPA 5D2MB 1S1QB 3MHSD 3OAWA 2NBWB 5DPSA 2NVUI 4KVGB 2MA9B 2CR5A 4MSQB 4IWPA 3V62A 4DWFA 1ZGUB 3ALBA 1L7YA 3ZUNA 3NOBA 2BYVE 1C3TA 4ANVA 4FJVB 2PJHA 3X23A 2ZJDA 4WWNA 2K6QA 1ISNA 4BBNC 3ZTDA 4RMAA 3U7DA 2K6DB 2JPHA 1OEYA 1WGGA 1WJ6A 3WALA 2FCQA 2L7RA 3LDZE 2CHWA 3D32A 4FN2A 4MGYE 4E74A 3W1YA 1KOTA 2L0FA 4PS3A 1EO6A 2JRHA 2KMCA 3N30A 3WAPA 5KHQA 1P9DU 2MBOA 3PSEB 1E7UA 3QA8A 1I42A 5D94A 3UQAA 5AZFA 3IFWB 3VTVA 4K81A 1V2YA 1WI0A 4KDIC 3ONSA 1LFDA 2L05A 3N3KB 5LLIA 1V5OA 4NAWB 4M8MA 5C23A 2C9WB 2IY1B 5IA7A 1H8CA 2AL6A 2KXJA 4LCDE 5BO4B 2AEHA 4AJYB 3RULA 3VH4B 1U4AA 2KN5A 3DQVA 4LJOB 2BYFA 1V6EA 4EOYA 1V81A 1ZW7A 2KFJA 4MJSB 1Z2MA 3ZW3A 1AARA 1OQYA 1SGHA 1WMHA 2G45B 2NBUA 3EFUA 3TBLD 4MGKE 3PRPB 2EKEC 3OJ4B 2IO2B 1XQQA 2G4SA 2ASQA 1WR6E 3RUIB 1M94A 2YVCA 4BKSA 2J0KA 3C0RB 3ZDTA 4EKUA 4ZDVA 2N9PC 3UINB 3RZWC 1UBQA 3KW5B 2BF8B 3PRZA 1I35A 1J19A 3ZNGC 4MH0E 2WX1A 3U30A 4LDTD 5G2NA 3WIMA 4JQWC 2Z59B 1GNUA 4CHKA 2K1FA 4M8NA 1K8RB 1Z5SB 3RD2A 3M62B 3SHQA 4JL9A 2DHZA 2MBBB 4GB9A 3UIPB 4ANXA 3DVGX 4GU2A 4NNJB 4EFOA 1Y8RC 2K25A 2K39A 1KJTA 2KJRA 2D10A 4N9F4 3H7SA 1J8CA 3OLMD 3W1SC 4JGHB 2KTFA 5D6JB 4FJYA 1V86A 2IO3B 3O65B 3QIJA 4E3CA 3L16A 1F9JA 2J0MA 2QHOA 4ASWC 3APDA 1WJNA 2KNBA 3DBSA 1E90A 1VD2A 4IC7B 3RYTA 5AEKB 2JVCA 2VRRB 3RCZA 2CKHB 2KLGA 3NZUA 2RR9A 4MELA 4W9IA 3ZNZB 2OJRA 1WXSA 2AWTA 3JYUA 1UZXB 2ZCCA 2Z0EB 2PEAA 5HKHA 2R2OA 4CO7A 4YL8A 2KWCA 4BVUC 3VVWB 4EZLA 1WMHB 2GBRA 2IY0B 3QWZB 5LXIB 3PRMB 5D7GA 4HXDA 4I6LB 1SE9A 4JIOU 2KMAA 3A4RA 1WGYA 2MW5A 2M4NA 1LXDA 3B0AA 3KUZA 3ZRFA 2LRUA 2M0XA 3ECIA 3U8ZA 3RT3B 2OOBB 4ANWA 4ZRIA 2ZVNA 3VAWA 4A3PA 4NQKE 1L2NA 4BFRA 4BOSC 2N9EB 2DZMA 3QJZA 1EF1A 3DVGY 4IG7B 2KWUB 5JHAA 2A5UA 5DPWA 2JRIB 2IYDB 3ML9A 3BINA 3PLVA 2MX2A 3PTFC 3A1QA 4F1SA 1WXAA 5J2RA 2MP2A 3AULA 4AP4C 2DYBA 2K8BA 3EHVA 4KIKB 3TIXA 3ZDMC 1D3ZA 3IBEA 4K7UA 4M0WB 3SD5A 3IG3A 2V1YA 1R4NI 3HM6X 3Q3JA 3DVNU 4EUTA 4RM9A 1VCBA 5CX3A 3A9JA 2BPSA 2R2QA 2KJHB 3MTNB 5GMVA 4BBNF 2AYOB 3M3JA 1Q1OA 3HK0A 4BKSD 2M1MA 2D3GA 2M17A 2N1VA 3DBRI 3AXCA 2GBJA 4MM3A 2WX0A 1TZ1A 2RGFA 4FBJB 1WFYA 4IM0A 1H4RA 1T0YA 1LQBA 2LGXA 2LXAA 4PS8A 2KFKB 2N7EA 4DDGD 1YX6B 2FCNA 4TQ0A 2MQJA 2V4LA 3QHTA 4MGZE 4XC2A 5TR5A 3TMPB 3WA0A 4K7WA 3H1UA 4GXBA 2AL3A 2KDIA 1GG3A 1RLFA 3DOWA 3A4SC 3V60A 5J18A 5JHBA 1J0GA 3AU5A 2LRWA 4LDTB 4X57B 1E8YA 3WAOA 4G0NB 3PPAA 4HDOA 4WWOA 2WDTB 2N9XA 1GJZA 2MP2B 4JLCA 5E6NA 3M95A 4BOZB 2FCMA 4NQLB 2C7MB 4TUUA 3H9DA 2L76A 5L83A 1WX9A 4WJQA 4K7SA 4PS7A 1V80A 1V49A 4GDKA 1E8WA 3QARA 4EZKA 1WE6A 4DHJD 4J6IA 3KYCD 3L13A 2KDFB 4F7ZA 4IWQA 2MCNB 3A9JB 1NBFC 4TQ1A 4FULA 2HD5B 4GGQA 1YX5B 2XK5A 3DDCB 3OJ3A 3WAMA 3DBHI 2WYQA 1XD3B 2KZRA 3L08A 5J17A 2KWVB 3DPDA 2BKFA 4NPNA 4KSKC 2JZZA 2NPTA 1LM8B 1QZEA 1TBEA 1WM3A 2NR2A 2JWZA 2KQSA 4IWOA 4MEMA 4AUQC 3R7RA 2DYMA 2JF5A 3PZDA 2IO0B 2LD9A 3QC8B 1GC6A 2LVQA 3IHPC 2L00B 1WH3A 3JVZX 1WJ4A 1WXMA 2EMTA 3P2BA 3KUCB 3QCAA 2NS5A 2KDBA 2D11A 2O6VD 1R4MI 5CHFA 1S3SG 3WANA 1PQSA 2FCSA 1OEYJ 2KO3A 2JY6A 3B1LX 3NHEB 4W9LA 3DCGA 1MG8A 3ZO5B 3VTUA 2MLBA 4GMVA 2CHZA 2LXCA 4IW0A 2CS4A 2UWQA 3M63B 3DBLI 4HLEA 1HE8A 1CMXB 2A4ZA 5AZGA 3APCA 4GDLA 2KDEB 2BGFA 1JRUA 1OTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPH A;  4G3X B;  1E8X A;  2DX5 B;  4AOF A;  2PE6 B;  2MBQ A;  4RM8 A;  2YLM A;  3ZNH B;  1WIA A;  4FAD A;  2JZ3 B;  2KJ6 A;  2O2V A;  2JXX A;  1Q0W B;  2RSU A;  3PV1 A;  2XK5 B;  2XBB C;  3A9K A;  2LZ6 A;  4II3 B;  2DZI A;  4W9J A;  5G55 A;  2RPQ A;  3CSF A;  2BKR B;  3TJP A;  4MSM B;  2ZNV C;  2MWS B;  2IZV B;  2NBV B;  2KX0 A;  1IP9 A;  2KQ7 A;  1WZ3 A;  3VUY A;  2L0T A;  4KV2 A;  3NY5 A;  4OVV A;  4DBG A;  1RRB A;  3NS8 A;  4FHK A;  5IAA C;  4GIV A;  2J7Q B;  1E5W A;  3UQB A;  3CMM B;  2NCN A;  4IM2 A;  3PT2 B;  4PYU A;  1IPG A;  1RFA A;  4P7I A;  2LUE A;  1UGM A;  2KAN A;  2O6V A;  3L0W B;  2KOX A;  5FR6 A;  3GOE A;  4XX5 A;  2KVR A;  2D07 B;  3PGE A;  4W9G A;  3HIZ A;  4B9K A;  4GSW A;  1E7V A;  1YQB A;  4IM3 A;  4HCN B;  4HJK A;  1V5T A;  3ZRC A;  3R7Q A;  2GBK A;  4WJN A;  1E8Z A;  1YJ1 A;  4NJ7 A;  3QQ8 B;  4KZ0 A;  2LVO A;  4II2 B;  4AWJ A;  1WXV A;  3PVL A;  2ZCB A;  4TV3 A;  5DPR A;  3V6C B;  2ZNV B;  1RAX A;  1NI2 A;  1WM2 A;  2ZPY A;  4K1R B;  4NY0 A;  1WRD B;  1ZKH A;  1WJU A;  4HVB A;  5AZH A;  4AJW A;  3EEC A;  3K9P B;  1WYW B;  4ICU A;  3MJW A;  1P98 A;  4DHJ B;  4FLH A;  2L3Z A;  4MJS A;  2EMS A;  4XZ4 A;  1UBI A;  4W9K A;  3ZNI D;  3A9K B;  2D2Q A;  3UGB B;  2LJ5 A;  5CHW A;  3S2A A;  3SDL C;  3R66 C;  3VUX A;  2KX3 A;  1TGZ B;  2G3Q B;  1WGH A;  2WWZ A;  3VUW A;  2ZPN A;  1YD8 U;  2BWE S;  3IVF A;  2W9N A;  4DHZ B;  4B6W A;  2L8J A;  1P0R A;  4ZRJ A;  2I1J A;  3A33 B;  3A1Q B;  4HPM B;  3VTW A;  4WQO B;  2MBH A;  4IUM B;  4PYZ A;  3BY4 B;  2O6V B;  2UYZ B;  2HE7 A;  2JUO A;  3Q3F A;  1OGW A;  4LJP B;  4ZRK A;  3QK0 A;  2KD0 A;  1WE7 A;  3R3M A;  2GBM A;  1SIF A;  3VDZ A;  3AI5 A;  3AU4 A;  4MGI E;  5C1Z A;  2KC2 A;  2LVP A;  3EC8 A;  1YIW A;  4FJZ A;  2MSE D;  2M8S A;  2ZZP B;  3GZN I;  3JSV A;  3LJ3 A;  3JW0 X;  4WAA A;  1WX7 A;  3PHX B;  5KHO A;  3I3T B;  2BWF A;  2V3S A;  3TL5 A;  1FXT B;  2FUH B;  5DPT A;  4ZYN A;  3VH3 B;  1WR1 A;  1WY8 A;  3DVN V;  3UF8 A;  3ZLZ A;  2GMI C;  2C5L C;  3L10 B;  5JH5 C;  2KC1 A;  4HWI B;  2FIF A;  2DZK A;  4DHZ E;  2DAJ A;  2PE9 A;  1G6J A;  2K8H A;  5CTR C;  2N4F A;  3ZTC A;  4DK5 A;  4MDK E;  5LXH A;  1C1Y B;  2GBN A;  3ML8 A;  4HPL B;  4NJ6 A;  3KH0 A;  1EF5 A;  2MBE A;  3X0W A;  3ZIM A;  2Z0D B;  4W9C A;  4TKN A;  4G11 A;  3V61 A;  3VHT C;  3W1S A;  4EEW A;  3T9L A;  1WX8 A;  3H7P A;  2FAZ A;  3UIO B;  5E6P A;  2HTH A;  4E71 A;  2B3A A;  2C7H A;  2KTR A;  4GOC A;  3CF6 E;  2I1K A;  4GN1 A;  2HJ8 A;  3NZS A;  4F8C B;  2KHW B;  2GOW A;  4BKT A;  4KIK A;  1WF9 A;  5E6O A;  3SU8 X;  4GDK B;  1UEL A;  4A3O A;  3TCA A;  3CST A;  3L17 A;  3QX1 A;  3PHW B;  3JSV B;  4CYE A;  2LGY A;  2REX A;  3KUD B;  2LAS A;  2LGD A;  4HDQ A;  2G4D B;  1UD7 A;  4BKG A;  2IBI B;  3N32 A;  3ZVV A;  2Y5B B;  1TTN A;  1X1M A;  3HHM A;  1WGD A;  4I6N B;  3T8M A;  2BYE A;  1P1A A;  2MRP A;  2ZEQ A;  2NPT B;  1WZ0 A;  1BT0 A;  2N1W A;  2DYO A;  3PS6 A;  1KM7 A;  3H6N A;  2KLC A;  4KDL B;  2IO1 B;  3B08 A;  4W9E A;  1Q5W B;  2KK8 A;  1EUV B;  2LWP A;  4W9D A;  4HCP B;  3VXW A;  4ANU A;  1V9J A;  2KKC A;  2FID A;  5L95 C;  2K8C A;  2KFK A;  1GUA B;  2DAF A;  4WWP A;  2LI5 A;  2DZJ A;  2CU1 A;  4HK2 A;  4URK A;  2FNJ B;  4G50 A;  3RZF A;  3ZKJ C;  3APF A;  4W9F A;  1KLV A;  2N7D A;  3K9O B;  1IYF A;  4WJO A;  4EZJ A;  3VQI A;  2XEW A;  3H7P B;  5CHV C;  1NDD A;  2ZVO A;  4DDI D;  5DCN A;  1P3Q U;  2C60 A;  2KTR B;  4NAW A;  3KYD D;  3V6E B;  4GDL B;  2DEN B;  1XT9 B;  2RD0 A;  4KSL C;  1UH6 A;  1WGR A;  3KVF B;  3QAQ A;  4FA6 A;  2CHX A;  2J0J A;  3ENE A;  3L54 A;  3PLU A;  4FHJ A;  3VFK A;  5EDS A;  1GC7 A;  1A5R A;  4B95 A;  4DXA B;  4KZC A;  3PRE A;  5JZE B;  4ICV A;  2C7N B;  2JT4 B;  2O2V B;  3HM3 A;  4OVU A;  4W9H A;  4A20 A;  4I6P A;  4WJP A;  5D2M B;  1S1Q B;  3MHS D;  3OAW A;  2NBW B;  5DPS A;  2NVU I;  4KVG B;  2MA9 B;  2CR5 A;  4MSQ B;  4IWP A;  3V62 A;  4DWF A;  1ZGU B;  3ALB A;  1L7Y A;  3ZUN A;  3NOB A;  2BYV E;  1C3T A;  4ANV A;  4FJV B;  2PJH A;  3X23 A;  2ZJD A;  4WWN A;  2K6Q A;  1ISN A;  4BBN C;  3ZTD A;  4RMA A;  3U7D A;  2K6D B;  2JPH A;  1OEY A;  1WGG A;  1WJ6 A;  3WAL A;  2FCQ A;  2L7R A;  3LDZ E;  2CHW A;  3D32 A;  4FN2 A;  4MGY E;  4E74 A;  3W1Y A;  1KOT A;  2L0F A;  4PS3 A;  1EO6 A;  2JRH A;  2KMC A;  3N30 A;  3WAP A;  5KHQ A;  1P9D U;  2MBO A;  3PSE B;  1E7U A;  3QA8 A;  1I42 A;  5D94 A;  3UQA A;  5AZF A;  3IFW B;  3VTV A;  4K81 A;  1V2Y A;  1WI0 A;  4KDI C;  3ONS A;  1LFD A;  2L05 A;  3N3K B;  5LLI A;  1V5O A;  4NAW B;  4M8M A;  5C23 A;  2C9W B;  2IY1 B;  5IA7 A;  1H8C A;  2AL6 A;  2KXJ A;  4LCD E;  5BO4 B;  2AEH A;  4AJY B;  3RUL A;  3VH4 B;  1U4A A;  2KN5 A;  3DQV A;  4LJO B;  2BYF A;  1V6E A;  4EOY A;  1V81 A;  1ZW7 A;  2KFJ A;  4MJS B;  1Z2M A;  3ZW3 A;  1AAR A;  1OQY A;  1SGH A;  1WMH A;  2G45 B;  2NBU A;  3EFU A;  3TBL D;  4MGK E;  3PRP B;  2EKE C;  3OJ4 B;  2IO2 B;  1XQQ A;  2G4S A;  2ASQ A;  1WR6 E;  3RUI B;  1M94 A;  2YVC A;  4BKS A;  2J0K A;  3C0R B;  3ZDT A;  4EKU A;  4ZDV A;  2N9P C;  3UIN B;  3RZW C;  1UBQ A;  3KW5 B;  2BF8 B;  3PRZ A;  1I35 A;  1J19 A;  3ZNG C;  4MH0 E;  2WX1 A;  3U30 A;  4LDT D;  5G2N A;  3WIM A;  4JQW C;  2Z59 B;  1GNU A;  4CHK A;  2K1F A;  4M8N A;  1K8R B;  1Z5S B;  3RD2 A;  3M62 B;  3SHQ A;  4JL9 A;  2DHZ A;  2MBB B;  4GB9 A;  3UIP B;  4ANX A;  3DVG X;  4GU2 A;  4NNJ B;  4EFO A;  1Y8R C;  2K25 A;  2K39 A;  1KJT A;  2KJR A;  2D10 A;  4N9F 4;  3H7S A;  1J8C A;  3OLM D;  3W1S C;  4JGH B;  2KTF A;  5D6J B;  4FJY A;  1V86 A;  2IO3 B;  3O65 B;  3QIJ A;  4E3C A;  3L16 A;  1F9J A;  2J0M A;  2QHO A;  4ASW C;  3APD A;  1WJN A;  2KNB A;  3DBS A;  1E90 A;  1VD2 A;  4IC7 B;  3RYT A;  5AEK B;  2JVC A;  2VRR B;  3RCZ A;  2CKH B;  2KLG A;  3NZU A;  2RR9 A;  4MEL A;  4W9I A;  3ZNZ B;  2OJR A;  1WXS A;  2AWT A;  3JYU A;  1UZX B;  2ZCC A;  2Z0E B;  2PEA A;  5HKH A;  2R2O A;  4CO7 A;  4YL8 A;  2KWC A;  4BVU C;  3VVW B;  4EZL A;  1WMH B;  2GBR A;  2IY0 B;  3QWZ B;  5LXI B;  3PRM B;  5D7G A;  4HXD A;  4I6L B;  1SE9 A;  4JIO U;  2KMA A;  3A4R A;  1WGY A;  2MW5 A;  2M4N A;  1LXD A;  3B0A A;  3KUZ A;  3ZRF A;  2LRU A;  2M0X A;  3ECI A;  3U8Z A;  3RT3 B;  2OOB B;  4ANW A;  4ZRI A;  2ZVN A;  3VAW A;  4A3P A;  4NQK E;  1L2N A;  4BFR A;  4BOS C;  2N9E B;  2DZM A;  3QJZ A;  1EF1 A;  3DVG Y;  4IG7 B;  2KWU B;  5JHA A;  2A5U A;  5DPW A;  2JRI B;  2IYD B;  3ML9 A;  3BIN A;  3PLV A;  2MX2 A;  3PTF C;  3A1Q A;  4F1S A;  1WXA A;  5J2R A;  2MP2 A;  3AUL A;  4AP4 C;  2DYB A;  2K8B A;  3EHV A;  4KIK B;  3TIX A;  3ZDM C;  1D3Z A;  3IBE A;  4K7U A;  4M0W B;  3SD5 A;  3IG3 A;  2V1Y A;  1R4N I;  3HM6 X;  3Q3J A;  3DVN U;  4EUT A;  4RM9 A;  1VCB A;  5CX3 A;  3A9J A;  2BPS A;  2R2Q A;  2KJH B;  3MTN B;  5GMV A;  4BBN F;  2AYO B;  3M3J A;  1Q1O A;  3HK0 A;  4BKS D;  2M1M A;  2D3G A;  2M17 A;  2N1V A;  3DBR I;  3AXC A;  2GBJ A;  4MM3 A;  2WX0 A;  1TZ1 A;  2RGF A;  4FBJ B;  1WFY A;  4IM0 A;  1H4R A;  1T0Y A;  1LQB A;  2LGX A;  2LXA A;  4PS8 A;  2KFK B;  2N7E A;  4DDG D;  1YX6 B;  2FCN A;  4TQ0 A;  2MQJ A;  2V4L A;  3QHT A;  4MGZ E;  4XC2 A;  5TR5 A;  3TMP B;  3WA0 A;  4K7W A;  3H1U A;  4GXB A;  2AL3 A;  2KDI A;  1GG3 A;  1RLF A;  3DOW A;  3A4S C;  3V60 A;  5J18 A;  5JHB A;  1J0G A;  3AU5 A;  2LRW A;  4LDT B;  4X57 B;  1E8Y A;  3WAO A;  4G0N B;  3PPA A;  4HDO A;  4WWO A;  2WDT B;  2N9X A;  1GJZ A;  2MP2 B;  4JLC A;  5E6N A;  3M95 A;  4BOZ B;  2FCM A;  4NQL B;  2C7M B;  4TUU A;  3H9D A;  2L76 A;  5L83 A;  1WX9 A;  4WJQ A;  4K7S A;  4PS7 A;  1V80 A;  1V49 A;  4GDK A;  1E8W A;  3QAR A;  4EZK A;  1WE6 A;  4DHJ D;  4J6I A;  3KYC D;  3L13 A;  2KDF B;  4F7Z A;  4IWQ A;  2MCN B;  3A9J B;  1NBF C;  4TQ1 A;  4FUL A;  2HD5 B;  4GGQ A;  1YX5 B;  2XK5 A;  3DDC B;  3OJ3 A;  3WAM A;  3DBH I;  2WYQ A;  1XD3 B;  2KZR A;  3L08 A;  5J17 A;  2KWV B;  3DPD A;  2BKF A;  4NPN A;  4KSK C;  2JZZ A;  2NPT A;  1LM8 B;  1QZE A;  1TBE A;  1WM3 A;  2NR2 A;  2JWZ A;  2KQS A;  4IWO A;  4MEM A;  4AUQ C;  3R7R A;  2DYM A;  2JF5 A;  3PZD A;  2IO0 B;  2LD9 A;  3QC8 B;  1GC6 A;  2LVQ A;  3IHP C;  2L00 B;  1WH3 A;  3JVZ X;  1WJ4 A;  1WXM A;  2EMT A;  3P2B A;  3KUC B;  3QCA A;  2NS5 A;  2KDB A;  2D11 A;  2O6V D;  1R4M I;  5CHF A;  1S3S G;  3WAN A;  1PQS A;  2FCS A;  1OEY J;  2KO3 A;  2JY6 A;  3B1L X;  3NHE B;  4W9L A;  3DCG A;  1MG8 A;  3ZO5 B;  3VTU A;  2MLB A;  4GMV A;  2CHZ A;  2LXC A;  4IW0 A;  2CS4 A;  2UWQ A;  3M63 B;  3DBL I;  4HLE A;  1HE8 A;  1CMX B;  2A4Z A;  5AZG A;  3APC A;  4GDL A;  2KDE B;  2BGF A;  1JRU A;  1OTR B; 
#chains in the Genus database with same CATH topology
 5IO9 A;  1N62 A;  4OZB A;  4YSZ B;  4RM8 A;  3ZNH B;  2I2Y A;  2BB6 A;  5LNK 1;  2O2V A;  2JXX A;  1Q0W B;  2VH2 A;  2XK5 B;  1SE3 A;  4AQ7 A;  3RPF C;  4MSM B;  5C2T B;  3VUY A;  5EE1 A;  1IGD A;  3NY5 A;  1RRB A;  3NS8 A;  5IAA C;  3UQB A;  1N60 A;  4USA A;  3EGR A;  1WSP A;  2Y3A A;  1UGM A;  2WXO A;  2Y5P A;  2KOX A;  3DWM A;  2K9X A;  4GSW A;  4NAM A;  1YQB A;  4HCN B;  1V5T A;  1E8Z A;  4KKJ A;  3SFE B;  3PVL A;  4TV3 A;  5DPR A;  4J3O D;  5H8Y E;  1NI2 A;  3ZYY X;  1WRD B;  1ZXH A;  2KVZ A;  4P6V F;  1CK1 A;  2PMV A;  1UBI A;  3ZNI D;  3DBL B;  2IGH A;  4WUR A;  2D2Q A;  1TKG A;  2LJ5 A;  3SDL C;  1EWC A;  1MJD A;  1WGH A;  1ZDV A;  2D5G A;  3VUW A;  2Z8L A;  3N1Z C;  2BWE S;  3IVF A;  4DHZ B;  1HXY D;  2W54 A;  3A1Q B;  1IBX A;  4TSS A;  2UYZ B;  2JUO A;  3QK0 A;  1WE7 A;  3H8H A;  2KC2 A;  1YIW A;  2MSE D;  3LJ3 A;  3JSV A;  4B0M A;  3TL5 A;  1AWD A;  3IXS A;  1GB4 A;  5DPT A;  2YEP B;  4OHJ A;  1DOY A;  4MM3 B;  1WR1 A;  2WHI A;  3DVN V;  5I4D A;  1IGC A;  2C5L C;  3L10 B;  4HWI B;  2PE9 A;  4P1B C;  1FCL A;  2FE8 A;  4K3C A;  2GBN A;  3ML8 A;  2Z0D B;  4TKN A;  4G11 A;  2WXN A;  5FKA C;  1F77 A;  1WGK A;  1TS5 A;  1PDX A;  1GB1 A;  2H89 B;  4BKT A;  4KIK A;  1WF9 A;  2WXQ A;  3SU8 X;  5HI1 A;  4M0W A;  3QX1 A;  3JSV B;  3PZ8 A;  4CYE A;  2QIL A;  3TEZ A;  2G1E A;  3N32 A;  3ZVV A;  2Y5B B;  2VZK D;  1WGD A;  4US8 A;  3BWU D;  2ZEQ A;  2NPT B;  2N1W A;  1EUV B;  2OHF A;  1V9J A;  1JCK B;  3L4P A;  1XLO A;  2K8C A;  1STE A;  1QKZ A;  1M4V A;  4KX6 B;  2N9K A;  4RGN A;  3APF A;  4W9F A;  2N7D A;  1IYF A;  4WJO A;  2MEK A;  3VQI A;  1UNS A;  1NDD A;  1F0Z A;  5DCN A;  2C60 A;  1I4Q A;  1PGX A;  2WQY B;  3UI3 A;  3L54 A;  3PLU A;  4FHJ A;  2GLS A;  4OW0 A;  4KZC A;  3HM3 A;  2WDR B;  5G5H A;  4W9H A;  2BB5 A;  4WJP A;  4LNF A;  4RGO S;  5DPS A;  1L0X B;  4MSQ B;  3IAS 1;  1ZGU B;  3P4P B;  3ZUN A;  3NOB A;  2BYV E;  3SR6 A;  1E6E B;  2PJH A;  2WXG A;  3U7D A;  2K6D B;  1OEY A;  2JPH A;  3AN1 A;  2FUG 1;  1EU4 A;  2QCZ A;  3LDZ E;  2WXP A;  3BVZ A;  1P7F A;  4E74 A;  3EFC A;  2KMC A;  1QT9 A;  2MBO A;  3PSE B;  5D94 A;  3AED B;  3UQA A;  4K81 A;  4KDI C;  2L05 A;  5LLI A;  5C23 A;  2IY1 B;  5IA7 A;  1H8C A;  2AL6 A;  2AEH A;  3VH4 B;  2KN5 A;  2E6X A;  3DQV A;  2BYF A;  1V81 A;  2IGG A;  1Z2M A;  2WXK A;  2NBU A;  3TBL D;  3PRP B;  2VZK B;  2BVC A;  2ASQ A;  1WR6 E;  1M94 A;  2YVC A;  3ZDT A;  2N9P C;  3RZW C;  4XWT A;  1C77 A;  1J19 A;  3ZNG C;  4MH0 E;  1QIL A;  3WIM A;  2Z59 B;  3VRA B;  3DVG X;  4NNJ B;  1Y8R C;  1VRA B;  3W2D A;  2D10 A;  4XDC A;  4NZL B;  1HTQ A;  3DBS A;  1E90 A;  2HDE A;  2M56 B;  2UU7 A;  3RCZ A;  2CKH B;  3MC9 A;  3AV8 A;  2ZCC A;  4YL8 A;  4BVU C;  3VVW B;  1J7C A;  2IY0 B;  4RF0 A;  3AM9 A;  3QWZ B;  5D7G A;  1SE9 A;  3GP7 A;  4JIO U;  3A4R A;  3KUZ A;  2LRU A;  3U8Z A;  4UDU C;  4ANW A;  2OJW A;  2ZVN A;  3VAW A;  5EE3 A;  4BFR A;  1NVI D;  3DHH C;  3Q3O C;  4N59 A;  2A5U A;  3ML9 A;  3BIN A;  3PLV A;  3PTF C;  1JQ4 A;  4A90 A;  4F1S A;  2RPV A;  1N5W A;  4AP4 C;  3U7Z A;  2WXF A;  1AN8 A;  3CIR B;  3BZD B;  3Q3J A;  1VCB A;  2AX5 A;  5GMV A;  2AQ1 B;  1YJI A;  1D5M C;  3M3J A;  1Q1O A;  3NVV A;  4BKS D;  3Q8B A;  2M1M A;  4C80 A;  4HKZ E;  2M17 A;  3DBR I;  2GBJ A;  1TZ1 A;  1T0Y A;  1YMH E;  2LGX A;  2LXA A;  2K5P A;  2KFK B;  2JXT A;  4DDG D;  1YX6 B;  3R8B A;  4LNN A;  3QHT A;  1SB3 C;  4XC2 A;  3WA0 A;  1VLB A;  3RN9 C;  4B0E A;  2MHJ A;  1YOV B;  3AE9 B;  4GXB A;  2KDI A;  1JWM D;  4WH4 A;  4KGS A;  1E8Y A;  3W5U B;  3WAO A;  3PPA A;  4WWO A;  5E6N A;  4BAX A;  4TUU A;  2L76 A;  5L83 A;  4PT5 A;  3GE8 C;  1V80 A;  1QF6 A;  3ZXR A;  1YQ3 B;  4DHJ D;  3T3O A;  2MCN B;  1T0Q C;  2HD5 B;  2INP E;  1Q10 A;  2WYQ A;  3L08 A;  2L52 A;  2BKF A;  1YN5 A;  1LM8 B;  1TBE A;  1WM3 A;  4MEM A;  3QC8 B;  2LVQ A;  2V3N A;  2NS5 A;  2D11 A;  1R4M I;  3DBR B;  2KO3 A;  2W55 A;  1OEY J;  3B1L X;  4BZA A;  3DCG A;  1MG8 A;  2HTM E;  4MAC A;  3GS2 A;  4GMV A;  3M63 B;  3R2I A;  5AZG A;  3APC A;  2BGF A;  1JRU A;  2PE6 B;  2YLM A;  1WIA A;  4FAD A;  1YNT E;  1V1O A;  2RSU A;  5IOI A;  1ENF A;  3A9K A;  2DZI A;  5G55 A;  2RPQ A;  3CSF A;  1JML A;  2ZNV C;  2NBV B;  2IZV B;  3RNB C;  1TIF A;  2L0T A;  1YN3 A;  2MJE A;  1IPG A;  4RCO A;  3IT4 B;  4FXC A;  2LUE A;  5IKC M;  3MFG A;  1P7E A;  3PGE A;  4B9K A;  3R2T A;  4YSX B;  1FEH A;  3ZRC A;  3R7Q A;  2GBK A;  4NJ7 A;  4KZ0 A;  4II2 B;  1D6E C;  1D5Z C;  2ZNV B;  1TS2 A;  3DWG C;  2ZPY A;  1XLN A;  1ZKH A;  4HVB A;  4ITK A;  5AZH A;  3EEC A;  1R4M B;  1T0S C;  4LNK A;  5GXG B;  1WYW B;  3MJW A;  1P98 A;  4DHJ B;  4DXG A;  2EMS A;  1N6Z A;  2HJ1 A;  3A9K B;  3BK2 A;  4HEA 1;  3S2A A;  3VUX A;  2EEL A;  2WNM A;  3TEW A;  2QEJ C;  1T0R C;  2DLB A;  1F1H A;  1P0R A;  4C7Z A;  1ZUD 2;  3VTW A;  3Q6B A;  1FMA D;  2MBH A;  3BY4 B;  1MFW A;  1C78 A;  1UGJ A;  1SIF A;  3AI5 A;  5C1Z A;  4MGI E;  5IN7 A;  1I4X A;  3EC8 A;  2ZZP B;  1L6V A;  3GZN I;  5G5G A;  2EKI A;  4KGR A;  3PHX B;  5KHO A;  2BWF A;  1FXT B;  2PVO D;  2BT6 A;  4ZYN A;  2J42 A;  5HG2 A;  3ZLZ A;  2GMI C;  5JH5 C;  2KC1 A;  1R4N B;  1I4H A;  1ZE3 D;  4DHZ E;  1G6J A;  4D2K A;  2K8H A;  5CTR C;  3AEF B;  3ZTC A;  1TYG B;  4DK5 A;  3X0W A;  4C56 C;  3Q2A C;  3V61 A;  4EEW A;  3LXF A;  2WXM A;  5E6P A;  4GOC A;  1QOB A;  1TKY A;  4GN1 A;  1ZPS A;  2HJ8 A;  3NZS A;  2E3T A;  2KHW B;  3P4R B;  2QJL A;  2PIA A;  2M0A A;  5E6O A;  1FCC C;  1UEL A;  4GDK B;  4ZHO A;  1L6U A;  3C8Y A;  3C19 A;  2LAS A;  4HDQ A;  1FFV A;  1UD7 A;  3B9J A;  2K0P A;  1TTN A;  1X1M A;  1SE4 A;  2BYE A;  1WZ0 A;  4L1B A;  1NYQ A;  3TEY A;  2M19 A;  4S0R A;  2LWP A;  4HCP B;  3GZN B;  1ZP0 B;  5T8I A;  1GUA B;  3KQ4 A;  2DAF A;  3DBH B;  2LI5 A;  2SAK A;  2QMT A;  4URK A;  2FNJ B;  4G50 A;  3RZF A;  1RM6 C;  4EZJ A;  1GOZ A;  5CHV C;  2ZVO A;  4DDI D;  4RGT A;  3V6E B;  4S17 A;  3BYY B;  2WXJ A;  2RD0 A;  2KN4 A;  3RMK C;  3KVF B;  4FA6 A;  2CHX A;  2WU5 B;  3VFK A;  1GC7 A;  2FBW B;  2YEP F;  4L2Y A;  4B95 A;  1QLB B;  3PRE A;  4ZRQ A;  3PO0 A;  2O2V B;  2D3C A;  3U2S C;  5D2M B;  3MHS D;  4KVG B;  2CR5 A;  1TS4 A;  2KYW A;  2INN E;  3V62 A;  1KFY B;  1C3T A;  3NUH B;  3TEX A;  2ZJD A;  4RMA A;  1CZP A;  1WGG A;  1C79 A;  3D32 A;  4FN2 A;  1R7S A;  1KOT A;  5KHQ A;  3VTV A;  3IFW B;  2V0G A;  3N3K B;  4AJY B;  3Q14 C;  4LJO B;  2KDM A;  4L23 A;  1OQY A;  1WMH A;  2G45 B;  3RNC C;  1PUT A;  4MGK E;  1XLQ A;  2IO2 B;  4ZHP A;  1ZDX A;  2G4S A;  3RUI B;  3I57 A;  4ZDV A;  2LUM A;  1I35 A;  1SF0 A;  4M01 A;  2WX1 A;  1GNU A;  1IBX B;  1K8R B;  1Z5S B;  1AYF A;  3M62 B;  3RD2 A;  3SHQ A;  3NJT A;  2JQR B;  4EFO A;  1I4P A;  1KJT A;  1I4G A;  1HZ6 A;  1PGA A;  4N9F 4;  1ROE A;  3OLM D;  2KTF A;  5EE9 A;  1TJE A;  2I38 A;  1HQR D;  3ZXV A;  3EUB 2;  1FIQ A;  2JYE A;  2KNB A;  1SXT A;  5E6J A;  1VD2 A;  3RYT A;  5AEK B;  3RFZ B;  2RR9 A;  2OJR A;  2AWT A;  3JYU A;  3KWL A;  1UZX B;  2R2O A;  1WMH B;  2GBR A;  3PRM B;  1FNW A;  4I6L B;  1F2R I;  3FC4 A;  4OZA A;  1WGY A;  2MW5 A;  3FKY A;  3RNG C;  2M0X A;  1SSN A;  3ECI A;  4ZRI A;  4ACF A;  4P1C C;  1NEK B;  2DZM A;  2PLP A;  2RMM A;  4EE2 A;  2KT7 A;  2JRI B;  2IYD B;  2BBC A;  3TIX A;  4KIK B;  1D3Z A;  1RFK A;  3N20 C;  4M0W B;  3MC0 B;  2V1Y A;  3HM6 X;  3DVN U;  3AB5 A;  1K52 A;  5CX3 A;  3A9J A;  2R2Q A;  2AYO B;  5BYR A;  1N61 A;  4R3D A;  1YN4 A;  2AQ3 B;  4RFB A;  3AXC A;  2RGF A;  4FBJ B;  1WFY A;  1H4R A;  1LQB A;  1ET6 A;  2AQ2 B;  2ONQ A;  1SE2 A;  4TQ0 A;  1XO3 A;  5TR5 A;  1NYR A;  1MHH E;  3H1U A;  2AL3 A;  1UWM A;  5BYS A;  5J18 A;  3A4S C;  4H2A A;  2LRW A;  4X57 B;  3EA6 A;  1PYW D;  1TZO A;  3HVD A;  4HDO A;  4BOZ B;  2C7M B;  1BML C;  3AH7 A;  1FXI A;  2ICI A;  3BK1 A;  3QAR A;  2H88 B;  2L1A A;  3A9J B;  3HRD D;  4TQ1 A;  1YX5 B;  1SBB B;  1C76 A;  1XD3 B;  2KZR A;  5J17 A;  2QC8 A;  2KAJ A;  3N1X C;  4KSK C;  1QZE A;  2NR2 A;  3V3X A;  2JWZ A;  4IWO A;  1FXA A;  3PZ7 A;  3PZD A;  2IO0 B;  1WH3 A;  5JXV A;  2EMT A;  2WXR A;  3B2G A;  5CHF A;  3WAN A;  1PQS A;  3NHE B;  3MHZ A;  5H92 C;  2BYT A;  1FFU A;  1L5P A;  4IW0 A;  2WXH A;  4HLE A;  4WQM A;  2WDQ B;  1ESF A;  4GDL A;  2PPH A;  1E8X A;  2DX5 B;  1A70 A;  2WDV B;  1PFD A;  2B76 B;  4WAF A;  1BXT A;  1FNV A;  4M00 A;  1MG4 A;  2XBB C;  4W9J A;  2LZ6 A;  1I4R A;  2BKR B;  3TJP A;  2LMC A;  2KX0 A;  1XF5 L;  2KQ7 A;  1WZ3 A;  4HRS A;  4KV2 A;  1SEB D;  3BYT B;  4GIV A;  2J7Q B;  2GI9 A;  2D3B A;  1RFA A;  3T3N A;  3L0W B;  5FR6 A;  1T5X D;  1V97 A;  1RYJ A;  2WU2 B;  4HJK A;  1YJ1 A;  2LVO A;  1WXV A;  2ZCB A;  3RNE C;  3V6C B;  1RAX A;  4K1R B;  4NY0 A;  3TUO A;  4LTU A;  3K9P B;  3TSS A;  1IUE A;  4FLH A;  2CJN A;  4MJS A;  4XZ4 A;  4Q2J A;  2N0S B;  3R66 C;  3FIL A;  1TGZ B;  3E56 A;  3E9S A;  3P63 A;  2ZPN A;  4B6W A;  2L8J A;  5TSS A;  3A33 B;  4WQO B;  4IUM B;  4PYZ A;  2QSD A;  3I5J C;  1TT5 B;  2L83 A;  4KKI A;  3Q3F A;  1OGW A;  4ZRK A;  3ZQ4 A;  1VR9 A;  2JWU A;  2GBM A;  1SIJ A;  3VDZ A;  1TY2 A;  1FD6 A;  4FJZ A;  3JW0 X;  4WAA A;  4A9A A;  2KAC A;  1QOA A;  3I3T B;  2V3S A;  1FRD A;  2FUH B;  1V1P A;  4M02 A;  1KF6 B;  1WY8 A;  3UF8 A;  3AE1 B;  2FIF A;  3GE3 C;  2DAJ A;  5LXH A;  1C1Y B;  4NJ6 A;  4HPL B;  1EF5 A;  2MBE A;  3OG5 A;  3ZIM A;  4W9C A;  4O1N A;  3VHT C;  3W1S A;  2J53 A;  1XXG A;  1WX8 A;  4YXD B;  3H7P A;  2FAZ A;  1L0Y B;  2HTH A;  4E71 A;  1WRI A;  3CF6 E;  2SEB D;  4F8C B;  2X38 A;  2V3P A;  2GOW A;  4ARI A;  4LNO A;  3PHW B;  2LGY A;  3KUD B;  2LGD A;  2IBI B;  1ET9 A;  1OQQ A;  3HHM A;  1T6B X;  4I6N B;  2NTT A;  1P1A A;  2MRP A;  4A8X C;  1HA5 A;  2DYO A;  4KDL B;  4IDI A;  2QDF A;  2IO1 B;  1CQV A;  3B08 A;  4W9E A;  4W9D A;  2KK8 A;  4ANU A;  3VXW A;  2FID A;  1C4P A;  5L95 C;  1D5X C;  1GPX A;  4WWP A;  2BS2 B;  1V8C A;  2WGS A;  4ZYS A;  2BS4 B;  1UUP A;  3ZKJ C;  1D4B A;  2XEW A;  3H7P B;  3VR9 B;  1P3Q U;  1WWT A;  4NAW A;  3KYD D;  1NEN B;  3HVZ A;  1XT9 B;  1E0Z A;  4KSL C;  1UH6 A;  3QAQ A;  2J0J A;  3ENE A;  5EDS A;  2JZP A;  4KGT A;  5JZE B;  1WXQ A;  3NVY A;  4ICV A;  4OVU A;  5D3D A;  1S1Q B;  1XLP A;  3OAW A;  2NBW B;  4DWF A;  4RGM A;  1L7Y A;  2GRI A;  3HUI A;  1MI0 A;  3AEG B;  2WLB A;  3WCQ A;  4FJV B;  4WWN A;  1B1Z A;  1ISN A;  4BBN C;  3ZTD A;  3NZ3 A;  4HRO A;  1WJ6 A;  3WAL A;  2FCQ A;  2ZW0 A;  2CHW A;  3W1Y A;  2JRH A;  1KTK A;  1I7H A;  1LO5 D;  1P9D U;  4A55 A;  3QA8 A;  5AZF A;  1HTO A;  1OQR A;  3Q3M C;  1V2Y A;  1WI0 A;  3ONS A;  1JWU D;  4NAW B;  4M8M A;  4XE0 A;  2C9W B;  2KXJ A;  4LCD E;  2WXI A;  2JYT A;  1U4A A;  1L0V B;  1ZW7 A;  1J7B A;  5C3J B;  1AAR A;  1SGH A;  1L4D B;  2CJO A;  2JSV X;  1JWB D;  2OED A;  2N9L A;  2KQ4 X;  2J0K A;  2XN9 C;  3C0R B;  4LLG M;  1DOX A;  3KW5 B;  2BF8 B;  3PRZ A;  4XWW A;  4ARC A;  3U52 E;  3Q8E A;  3U30 A;  4LDT D;  4JQW C;  2VH1 A;  2K1F A;  4M8N A;  4ANX A;  2DHZ A;  2MBB B;  4GB9 A;  1ZOY B;  2K25 A;  3GB1 A;  2K39 A;  2KJR A;  2Q5W D;  3H7S A;  1J8C A;  4JGH B;  5D6J B;  2IO3 B;  3QIJ A;  3IT6 B;  3L16 A;  2J0M A;  2QHO A;  4ASW C;  3APD A;  1WJN A;  3Q8F A;  1CJE A;  4IC7 B;  2JVC A;  3P4Q B;  2VRR B;  2KLG A;  3NZU A;  4MEL A;  4REZ A;  2JU6 X;  1WXS A;  4CO7 A;  3NS1 A;  4EZL A;  2LEK A;  5LXI B;  4TMA B;  3P1M A;  3RI7 C;  1L4Z B;  1L2N A;  4BOS C;  2N9E B;  3QJZ A;  1EF1 A;  3DVG Y;  4IG7 B;  1FNU A;  2KWU B;  1PGB A;  5DPW A;  2L32 A;  2RDH A;  2MX2 A;  3A1Q A;  5J2R A;  1WXA A;  3DHG C;  3EHV A;  3ZDM C;  4WWM A;  3AE4 B;  2ON8 A;  3SD5 A;  4EUT A;  2KJH B;  3MTN B;  2LJI A;  3AEB B;  3I9V 1;  1YQ4 B;  5FR3 A;  2PKO A;  2D3G A;  1T3Q A;  4MM3 A;  3MC8 A;  2G9H D;  1QOF A;  2BQQ A;  4PS8 A;  1FO4 A;  1C4A A;  1HZ5 A;  2RDG A;  3KLS X;  2FCN A;  2MQJ A;  2V4L A;  3TMP B;  1C4C A;  4K7W A;  4JWS C;  1EU3 A;  1RLF A;  1JWA D;  1TKE A;  5JHB A;  1J0G A;  4LDT B;  1ZXI A;  3NRZ A;  4PK1 A;  2W82 A;  3ZJU A;  4GLS C;  4C4V A;  2WDT B;  1GJZ A;  2FCM A;  4NQL B;  1N5X A;  3H9D A;  4WJQ A;  4DQO C;  1MHX A;  4PS7 A;  2NMQ A;  1V49 A;  3AEA B;  1E8W A;  1WE6 A;  4IWQ A;  1NBF C;  5AUK A;  4FUL A;  3VRB B;  4GGQ A;  1SJE D;  3WAM A;  4N6E B;  4NPN A;  2JZZ A;  2NPT A;  1RWS A;  2NTS A;  4AUQ C;  1YJJ A;  4RH6 A;  4YTP B;  2DYM A;  2JF5 A;  2MJD A;  4JPS A;  2L00 B;  3JVZ X;  1WXM A;  5BMG A;  3MP9 A;  5BYQ A;  2O6V D;  2KDB A;  3W9C B;  1S3S G;  4W9L A;  2FCS A;  3ZO5 B;  2CHZ A;  3MJ5 A;  4US9 A;  1HE8 A;  4C4V B;  4CQN A;  2KDE B;  1VJK A;  1OTR B;  2IND C;  3LB8 C;  4G3X B;  3V05 A;  4AOF A;  2MBQ A;  2JZ3 B;  2KJ6 A;  3Q69 A;  3PV1 A;  4II3 B;  1FM0 D;  4AS1 A;  2V4I B;  2MWS B;  1IP9 A;  4OVV A;  4DBG A;  2GB1 A;  2BS3 B;  1FRR A;  4FHK A;  5HHD G;  1E5W A;  3N9Y C;  3CMM B;  2NCN A;  3B2F A;  3ETR A;  3PT2 B;  4IM2 A;  4PYU A;  4P7I A;  3RNF C;  2KAN A;  2O6V A;  5MPO A;  3GOE A;  4XX5 A;  1UWX A;  1Y56 A;  2KVR A;  2D07 B;  4W9G A;  3HIZ A;  1E7V A;  4IM3 A;  1HEZ E;  1WYG A;  4WJN A;  3QQ8 B;  4AWJ A;  1F2R C;  1WM2 A;  1WJU A;  2D3A A;  4AJW A;  4ICU A;  3BVM A;  2L3Z A;  3AE3 B;  4W9K A;  2MH7 A;  4YTM B;  4WIP A;  3UGB B;  5CHW A;  2KX3 A;  4ZRP A;  2G3Q B;  2Y5C A;  3BII D;  1FPY A;  2ACZ B;  2WWZ A;  1YD8 U;  4K3B A;  4JE3 B;  2W9N A;  4ZRJ A;  1DOI A;  2I1J A;  4HPM B;  1N63 A;  2O6V B;  2HE7 A;  3Q8C A;  4LJP B;  2KD0 A;  3R3M A;  3AU4 A;  2LVP A;  2M8S A;  3DHI C;  1WX7 A;  3ABV B;  2INC C;  2LHE A;  1DGJ A;  3VH3 B;  3ZJV A;  2K3U A;  3VR8 B;  4N58 A;  2JX5 A;  2DZK A;  3BVG A;  2N4F A;  4MDK E;  2TSS A;  3KH0 A;  3P4S B;  2IGD A;  3T9L A;  3UIO B;  2B3A A;  2C7H A;  3NVW A;  2KTR A;  4HPP A;  2I1K A;  1C9F A;  1TS3 A;  4DXF A;  4IKG A;  1E7P B;  4A3O A;  3TCA A;  4IOI E;  3CST A;  1VDV A;  3L17 A;  1XEE A;  4QAY A;  2REX A;  2G4D B;  1AW7 A;  4BKG A;  4NJC A;  3T8M A;  1BT0 A;  3PS6 A;  1KM7 A;  1SJH D;  2KLC A;  3H6N A;  1Q5W B;  2KKC A;  1JW9 D;  2LGI A;  2KWD A;  2KFK A;  3FAH A;  2DZJ A;  2CU1 A;  4HK2 A;  1KRH A;  1EWY C;  3OWE B;  2CU3 A;  1KLV A;  3K9O B;  1VZ6 A;  1EM7 A;  2KTR B;  4GDL B;  2DEN B;  4OZC A;  1WGR A;  2W3S A;  3AE2 B;  3SFD B;  1A5R A;  1QOG A;  4DXA B;  3AE8 B;  4C00 A;  1VZ7 A;  2LFI A;  1F52 A;  2ZW1 A;  1VZ8 A;  5FK9 C;  2C7N B;  2JT4 B;  4A20 A;  4I6P A;  5EE0 A;  2NVU I;  2MA9 B;  4IWP A;  4XGA B;  2J52 A;  3ALB A;  3ZJT A;  2PTL A;  4ANV A;  2DNF A;  3I63 C;  3LYY A;  3X23 A;  1J7A A;  4OVZ A;  2K6Q A;  3U4E G;  4MH8 A;  4A6Q A;  1KH0 A;  2L7R A;  4MGY E;  2L0F A;  4JWU C;  1EO6 A;  4PS3 A;  3N30 A;  3WAP A;  4YT0 B;  1E7U A;  1I42 A;  2PW9 A;  1LFD A;  1V5O A;  5D3I B;  2W3R A;  5BO4 B;  4ZOH C;  3IAM 1;  3RUL A;  2WS3 B;  1K53 A;  1V6E A;  4EOY A;  5HFY A;  2KFJ A;  4MJS B;  3ZW3 A;  1QQR A;  3EFU A;  2DWQ A;  2EKE C;  3OJ4 B;  3Q3N C;  1XQQ A;  3CWI A;  1LGR A;  3FIL B;  3AE7 B;  1JRP A;  4BKS A;  4EKU A;  3UIN B;  1UBQ A;  2V9H A;  2QIE B;  2IJ0 A;  2X8X X;  3AMZ A;  5G2N A;  3URY A;  4YSY B;  4CHK A;  4HKQ A;  4JL9 A;  4P16 A;  3O13 A;  3UIP B;  4GU2 A;  1XCQ L;  2DBY A;  2MJ3 A;  3W1S C;  4FJY A;  1V86 A;  4E3C A;  3O65 B;  3Q8A A;  1F9J A;  1K51 A;  1V1P B;  1B9R A;  1UF0 A;  4W9I A;  4RF1 A;  3ZNZ B;  1KLG D;  2Z0E B;  2PEA A;  5HKH A;  2IDY A;  2KWC A;  2WP9 B;  3AE5 B;  3W5V B;  4HXD A;  2KMA A;  5BMI A;  1OFF A;  3J9C A;  2M4N A;  1LXD A;  3B0A A;  5IP4 D;  3ZRF A;  2N7J A;  3RT3 B;  2OOB B;  3N1Y C;  4A3P A;  4NQK E;  1XCT L;  1ACC A;  4XYC A;  5JHA A;  1JRO A;  4MT5 A;  1E9M A;  2MP2 A;  3AUL A;  2DYB A;  2K8B A;  2XNA C;  1MPE A;  2BW2 A;  3IBE A;  4K7U A;  3AEE B;  3IG3 A;  1R4N I;  4RM9 A;  1BUI C;  2BPS A;  4YTN B;  4BBN F;  3HK0 A;  4JX1 C;  2LHD A;  2N1V A;  2WXL A;  5BMH A;  2WX0 A;  4IM0 A;  1JAL A;  3AEC B;  3RNA C;  4XDD A;  2N7E A;  2BTE A;  4MGZ E;  1GG3 A;  3DOW A;  3V60 A;  3P42 A;  3AU5 A;  4G0N B;  1MVK A;  4RNA A;  2N9X A;  2MP2 B;  4JLC A;  3M95 A;  2LGS A;  1WX9 A;  4K7S A;  2IPK D;  4GDK A;  4EZK A;  1DYQ A;  3KWV A;  4J6I A;  3KYC D;  1NI3 A;  2KDF B;  3L13 A;  4F7Z A;  2R61 A;  2XK5 A;  3DDC B;  3OJ3 A;  3DBH I;  3SEB A;  2KWV B;  3DPD A;  4LNI A;  4LK0 M;  2KQS A;  1K50 A;  3R7R A;  4HJG E;  2LD9 A;  3NG0 A;  3AE6 B;  1GC6 A;  3IHP C;  1WJ4 A;  3P2B A;  3KUC B;  3QCA A;  2KMM A;  1TY0 A;  4C7Y A;  5AUI A;  1KLU D;  1GAQ B;  2JY6 A;  1JWS D;  2RDB C;  3VTU A;  2MLB A;  2J4X A;  2LXC A;  1E10 A;  2CS4 A;  2UWQ A;  3ZGZ A;  3DBL I;  4YWG G;  1CMX B;  2A4Z A;  3NVZ A;  2K22 A;  2PVG C; 
#chains in the Genus database with same CATH homology
 2PPH A;  4G3X B;  1E8X A;  2DX5 B;  4AOF A;  2PE6 B;  2MBQ A;  4RM8 A;  2YLM A;  3ZNH B;  1WIA A;  4FAD A;  2JZ3 B;  2KJ6 A;  2O2V A;  2JXX A;  1Q0W B;  2RSU A;  3PV1 A;  2XK5 B;  2XBB C;  3A9K A;  2LZ6 A;  4II3 B;  2DZI A;  4W9J A;  5G55 A;  2RPQ A;  3CSF A;  2BKR B;  3TJP A;  4MSM B;  2ZNV C;  2MWS B;  2IZV B;  2NBV B;  2KX0 A;  1IP9 A;  2KQ7 A;  1WZ3 A;  3VUY A;  2L0T A;  4KV2 A;  3NY5 A;  4OVV A;  4DBG A;  1RRB A;  3NS8 A;  4FHK A;  5IAA C;  4GIV A;  2J7Q B;  1E5W A;  3UQB A;  3CMM B;  2NCN A;  4IM2 A;  3PT2 B;  4PYU A;  1IPG A;  1RFA A;  4P7I A;  2LUE A;  1UGM A;  2KAN A;  2O6V A;  3L0W B;  2KOX A;  5FR6 A;  3GOE A;  4XX5 A;  2KVR A;  2D07 B;  3PGE A;  4W9G A;  3HIZ A;  4B9K A;  4GSW A;  1E7V A;  1YQB A;  4IM3 A;  4HCN B;  4HJK A;  1V5T A;  3ZRC A;  3R7Q A;  2GBK A;  4WJN A;  1E8Z A;  1YJ1 A;  4NJ7 A;  3QQ8 B;  4KZ0 A;  2LVO A;  4II2 B;  4AWJ A;  1WXV A;  3PVL A;  2ZCB A;  4TV3 A;  5DPR A;  3V6C B;  2ZNV B;  1RAX A;  1NI2 A;  1WM2 A;  2ZPY A;  4K1R B;  4NY0 A;  1WRD B;  1ZKH A;  1WJU A;  4HVB A;  5AZH A;  4AJW A;  3EEC A;  3K9P B;  1WYW B;  4ICU A;  3MJW A;  1P98 A;  4DHJ B;  4FLH A;  2L3Z A;  4MJS A;  2EMS A;  4XZ4 A;  1UBI A;  4W9K A;  3ZNI D;  3A9K B;  2D2Q A;  3UGB B;  2LJ5 A;  5CHW A;  3S2A A;  3SDL C;  3R66 C;  3VUX A;  2KX3 A;  1TGZ B;  2G3Q B;  1WGH A;  2WWZ A;  3VUW A;  2ZPN A;  1YD8 U;  2BWE S;  3IVF A;  2W9N A;  4DHZ B;  4B6W A;  2L8J A;  1P0R A;  4ZRJ A;  2I1J A;  3A33 B;  3A1Q B;  4HPM B;  3VTW A;  4WQO B;  2MBH A;  4IUM B;  4PYZ A;  3BY4 B;  2O6V B;  2UYZ B;  2HE7 A;  2JUO A;  3Q3F A;  1OGW A;  4LJP B;  4ZRK A;  3QK0 A;  2KD0 A;  1WE7 A;  3R3M A;  2GBM A;  1SIF A;  3VDZ A;  3AI5 A;  3AU4 A;  4MGI E;  5C1Z A;  2KC2 A;  2LVP A;  3EC8 A;  1YIW A;  4FJZ A;  2MSE D;  2M8S A;  2ZZP B;  3GZN I;  3JSV A;  3LJ3 A;  3JW0 X;  4WAA A;  1WX7 A;  3PHX B;  5KHO A;  3I3T B;  2BWF A;  2V3S A;  3TL5 A;  1FXT B;  2FUH B;  5DPT A;  4ZYN A;  3VH3 B;  1WR1 A;  1WY8 A;  3DVN V;  3UF8 A;  3ZLZ A;  2GMI C;  2C5L C;  3L10 B;  5JH5 C;  2KC1 A;  4HWI B;  2FIF A;  2DZK A;  4DHZ E;  2DAJ A;  2PE9 A;  1G6J A;  2K8H A;  5CTR C;  2N4F A;  3ZTC A;  4DK5 A;  4MDK E;  5LXH A;  1C1Y B;  2GBN A;  3ML8 A;  4HPL B;  4NJ6 A;  3KH0 A;  1EF5 A;  2MBE A;  3X0W A;  3ZIM A;  2Z0D B;  4W9C A;  4TKN A;  4G11 A;  3V61 A;  3VHT C;  3W1S A;  4EEW A;  3T9L A;  1WX8 A;  3H7P A;  2FAZ A;  3UIO B;  5E6P A;  2HTH A;  4E71 A;  2B3A A;  2C7H A;  2KTR A;  4GOC A;  3CF6 E;  2I1K A;  4GN1 A;  2HJ8 A;  3NZS A;  4F8C B;  2KHW B;  2GOW A;  4BKT A;  4KIK A;  1WF9 A;  5E6O A;  3SU8 X;  4GDK B;  1UEL A;  4A3O A;  3TCA A;  3CST A;  3L17 A;  3QX1 A;  3PHW B;  3JSV B;  4CYE A;  2LGY A;  2REX A;  3KUD B;  2LAS A;  2LGD A;  4HDQ A;  2G4D B;  1UD7 A;  4BKG A;  2IBI B;  3N32 A;  3ZVV A;  2Y5B B;  1TTN A;  1X1M A;  3HHM A;  1WGD A;  4I6N B;  3T8M A;  2BYE A;  1P1A A;  2MRP A;  2ZEQ A;  2NPT B;  1WZ0 A;  1BT0 A;  2N1W A;  2DYO A;  3PS6 A;  1KM7 A;  3H6N A;  2KLC A;  4KDL B;  2IO1 B;  3B08 A;  4W9E A;  1Q5W B;  2KK8 A;  1EUV B;  2LWP A;  4W9D A;  4HCP B;  3VXW A;  4ANU A;  1V9J A;  2KKC A;  2FID A;  5L95 C;  2K8C A;  2KFK A;  1GUA B;  2DAF A;  4WWP A;  2LI5 A;  2DZJ A;  2CU1 A;  4HK2 A;  4URK A;  2FNJ B;  4G50 A;  3RZF A;  3ZKJ C;  3APF A;  4W9F A;  1KLV A;  2N7D A;  3K9O B;  1IYF A;  4WJO A;  4EZJ A;  3VQI A;  2XEW A;  3H7P B;  5CHV C;  1NDD A;  2ZVO A;  4DDI D;  5DCN A;  1P3Q U;  2C60 A;  2KTR B;  4NAW A;  3KYD D;  3V6E B;  4GDL B;  2DEN B;  1XT9 B;  2RD0 A;  4KSL C;  1UH6 A;  1WGR A;  3KVF B;  3QAQ A;  4FA6 A;  2CHX A;  2J0J A;  3ENE A;  3L54 A;  3PLU A;  4FHJ A;  3VFK A;  5EDS A;  1GC7 A;  1A5R A;  4B95 A;  4DXA B;  4KZC A;  3PRE A;  5JZE B;  4ICV A;  2C7N B;  2JT4 B;  2O2V B;  3HM3 A;  4OVU A;  4W9H A;  4A20 A;  4I6P A;  4WJP A;  5D2M B;  1S1Q B;  3MHS D;  3OAW A;  2NBW B;  5DPS A;  2NVU I;  4KVG B;  2MA9 B;  2CR5 A;  4MSQ B;  4IWP A;  3V62 A;  4DWF A;  1ZGU B;  3ALB A;  1L7Y A;  3ZUN A;  3NOB A;  2BYV E;  1C3T A;  4ANV A;  4FJV B;  2PJH A;  3X23 A;  2ZJD A;  4WWN A;  2K6Q A;  1ISN A;  4BBN C;  3ZTD A;  4RMA A;  3U7D A;  2K6D B;  2JPH A;  1OEY A;  1WGG A;  1WJ6 A;  3WAL A;  2FCQ A;  2L7R A;  3LDZ E;  2CHW A;  3D32 A;  4FN2 A;  4MGY E;  4E74 A;  3W1Y A;  1KOT A;  2L0F A;  4PS3 A;  1EO6 A;  2JRH A;  2KMC A;  3N30 A;  3WAP A;  5KHQ A;  1P9D U;  2MBO A;  3PSE B;  1E7U A;  3QA8 A;  1I42 A;  5D94 A;  3UQA A;  5AZF A;  3IFW B;  3VTV A;  4K81 A;  1V2Y A;  1WI0 A;  4KDI C;  3ONS A;  1LFD A;  2L05 A;  3N3K B;  5LLI A;  1V5O A;  4NAW B;  4M8M A;  5C23 A;  2C9W B;  2IY1 B;  5IA7 A;  1H8C A;  2AL6 A;  2KXJ A;  4LCD E;  5BO4 B;  2AEH A;  4AJY B;  3RUL A;  3VH4 B;  1U4A A;  2KN5 A;  3DQV A;  4LJO B;  2BYF A;  1V6E A;  4EOY A;  1V81 A;  1ZW7 A;  2KFJ A;  4MJS B;  1Z2M A;  3ZW3 A;  1AAR A;  1OQY A;  1SGH A;  1WMH A;  2G45 B;  2NBU A;  3EFU A;  3TBL D;  4MGK E;  3PRP B;  2EKE C;  3OJ4 B;  2IO2 B;  1XQQ A;  2G4S A;  2ASQ A;  1WR6 E;  3RUI B;  1M94 A;  2YVC A;  4BKS A;  2J0K A;  3C0R B;  3ZDT A;  4EKU A;  4ZDV A;  2N9P C;  3UIN B;  3RZW C;  1UBQ A;  3KW5 B;  2BF8 B;  3PRZ A;  1I35 A;  1J19 A;  3ZNG C;  4MH0 E;  2WX1 A;  3U30 A;  4LDT D;  5G2N A;  3WIM A;  4JQW C;  2Z59 B;  1GNU A;  4CHK A;  2K1F A;  4M8N A;  1K8R B;  1Z5S B;  3RD2 A;  3M62 B;  3SHQ A;  4JL9 A;  2DHZ A;  2MBB B;  4GB9 A;  3UIP B;  4ANX A;  3DVG X;  4GU2 A;  4NNJ B;  4EFO A;  1Y8R C;  2K25 A;  2K39 A;  1KJT A;  2KJR A;  2D10 A;  4N9F 4;  3H7S A;  1J8C A;  3OLM D;  3W1S C;  4JGH B;  2KTF A;  5D6J B;  4FJY A;  1V86 A;  2IO3 B;  3O65 B;  3QIJ A;  4E3C A;  3L16 A;  1F9J A;  2J0M A;  2QHO A;  4ASW C;  3APD A;  1WJN A;  2KNB A;  3DBS A;  1E90 A;  1VD2 A;  4IC7 B;  3RYT A;  5AEK B;  2JVC A;  2VRR B;  3RCZ A;  2CKH B;  2KLG A;  3NZU A;  2RR9 A;  4MEL A;  4W9I A;  3ZNZ B;  2OJR A;  1WXS A;  2AWT A;  3JYU A;  1UZX B;  2ZCC A;  2Z0E B;  2PEA A;  5HKH A;  2R2O A;  4CO7 A;  4YL8 A;  2KWC A;  4BVU C;  3VVW B;  4EZL A;  1WMH B;  2GBR A;  2IY0 B;  3QWZ B;  5LXI B;  3PRM B;  5D7G A;  4HXD A;  4I6L B;  1SE9 A;  4JIO U;  2KMA A;  3A4R A;  1WGY A;  2MW5 A;  2M4N A;  1LXD A;  3B0A A;  3KUZ A;  3ZRF A;  2LRU A;  2M0X A;  3ECI A;  3U8Z A;  3RT3 B;  2OOB B;  4ANW A;  4ZRI A;  2ZVN A;  3VAW A;  4A3P A;  4NQK E;  1L2N A;  4BFR A;  4BOS C;  2N9E B;  2DZM A;  3QJZ A;  1EF1 A;  3DVG Y;  4IG7 B;  2KWU B;  5JHA A;  2A5U A;  5DPW A;  2JRI B;  2IYD B;  3ML9 A;  3BIN A;  3PLV A;  2MX2 A;  3PTF C;  3A1Q A;  4F1S A;  1WXA A;  5J2R A;  2MP2 A;  3AUL A;  4AP4 C;  2DYB A;  2K8B A;  3EHV A;  4KIK B;  3TIX A;  3ZDM C;  1D3Z A;  3IBE A;  4K7U A;  4M0W B;  3SD5 A;  3IG3 A;  2V1Y A;  1R4N I;  3HM6 X;  3Q3J A;  3DVN U;  4EUT A;  4RM9 A;  1VCB A;  5CX3 A;  3A9J A;  2BPS A;  2R2Q A;  2KJH B;  3MTN B;  5GMV A;  4BBN F;  2AYO B;  3M3J A;  1Q1O A;  3HK0 A;  4BKS D;  2M1M A;  2D3G A;  2M17 A;  2N1V A;  3DBR I;  3AXC A;  2GBJ A;  4MM3 A;  2WX0 A;  1TZ1 A;  2RGF A;  4FBJ B;  1WFY A;  4IM0 A;  1H4R A;  1T0Y A;  1LQB A;  2LGX A;  2LXA A;  4PS8 A;  2KFK B;  2N7E A;  4DDG D;  1YX6 B;  2FCN A;  4TQ0 A;  2MQJ A;  2V4L A;  3QHT A;  4MGZ E;  4XC2 A;  5TR5 A;  3TMP B;  3WA0 A;  4K7W A;  3H1U A;  4GXB A;  2AL3 A;  2KDI A;  1GG3 A;  1RLF A;  3DOW A;  3A4S C;  3V60 A;  5J18 A;  5JHB A;  1J0G A;  3AU5 A;  2LRW A;  4LDT B;  4X57 B;  1E8Y A;  3WAO A;  4G0N B;  3PPA A;  4HDO A;  4WWO A;  2WDT B;  2N9X A;  1GJZ A;  2MP2 B;  4JLC A;  5E6N A;  3M95 A;  4BOZ B;  2FCM A;  4NQL B;  2C7M B;  4TUU A;  3H9D A;  2L76 A;  5L83 A;  1WX9 A;  4WJQ A;  4K7S A;  4PS7 A;  1V80 A;  1V49 A;  4GDK A;  1E8W A;  3QAR A;  4EZK A;  1WE6 A;  4DHJ D;  4J6I A;  3KYC D;  3L13 A;  2KDF B;  4F7Z A;  4IWQ A;  2MCN B;  3A9J B;  1NBF C;  4TQ1 A;  4FUL A;  2HD5 B;  4GGQ A;  1YX5 B;  2XK5 A;  3DDC B;  3OJ3 A;  3WAM A;  3DBH I;  2WYQ A;  1XD3 B;  2KZR A;  3L08 A;  5J17 A;  2KWV B;  3DPD A;  2BKF A;  4NPN A;  4KSK C;  2JZZ A;  2NPT A;  1LM8 B;  1QZE A;  1TBE A;  1WM3 A;  2NR2 A;  2JWZ A;  2KQS A;  4IWO A;  4MEM A;  4AUQ C;  3R7R A;  2DYM A;  2JF5 A;  3PZD A;  2IO0 B;  2LD9 A;  3QC8 B;  1GC6 A;  2LVQ A;  3IHP C;  2L00 B;  1WH3 A;  3JVZ X;  1WJ4 A;  1WXM A;  2EMT A;  3P2B A;  3KUC B;  3QCA A;  2NS5 A;  2KDB A;  2D11 A;  2O6V D;  1R4M I;  5CHF A;  1S3S G;  3WAN A;  1PQS A;  2FCS A;  1OEY J;  2KO3 A;  2JY6 A;  3B1L X;  3NHE B;  4W9L A;  3DCG A;  1MG8 A;  3ZO5 B;  3VTU A;  2MLB A;  4GMV A;  2CHZ A;  2LXC A;  4IW0 A;  2CS4 A;  2UWQ A;  3M63 B;  3DBL I;  4HLE A;  1HE8 A;  1CMX B;  2A4Z A;  5AZG A;  3APC A;  4GDL A;  2KDE B;  2BGF A;  1JRU A;  1OTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...