2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Exotoxin 3
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
1CHPD 1ESFA 3R2IA 1TS5A 1RDPD 1S5BD 1UNSA 1I4XA 1PZJD 1V1PB 1BCPF 4DXGA 5ELCA 1LT6D 1HA5A 3BVGA 4RGOS 2IJ0A 4RHSA 1M4VA 2RDHA 3OWEB 1S5FD 1CK1A 1KLGD 1LT5D 1EU4A 1B44D 2NTSA 3BVMA 2XNAC 1FD7D 1HTLD 1V1OA 4RFBA 1PRTF 2ICIA 3CHBD 1TS3A 2TSSA 4RH6A 1HQRD 1L0XB 2AQ3B 1TS4A 3MFGA 1EEID 2RDGA 5ELDA 1XXGA 1DJRD 1G8ZD 1SE2A 1I4RA 1HXYD 2QEJC 3EFXD 1S5DD 3V05A 3TSSA 1UUPA 2SEBD 1RF2D 4L63B 4ZYSA 1BXTA 1T5XD 2Z8LA 1JWUD 1LT3D 1B1ZA 2AQ1B 1S5ED 1LTRD 5FK9C 5D3DA 3URYA 1SXTA 1LLRD 1LT4D 1DYQA 3W2DA 4O1NA 1EEFD 5TSSA 1EU3A 1I4QA 1YN4A 1SEBD 1YN3A 1PTOD 2R61A 1GOZA 1JQYD 1LO5D 1D5ZC 1XTCD 4NZLB 1PZID 1LTID 1LTSD 2XRSD 3O13A 3EA6A 1ET6A 2O2LD 4RGTA 1BCPB 1SJHD 1STEA 3BYTB 1YN5A 1F77A 1SJED 1RCVD 1L0YB 1MD2D 1FNWA 1JWSD 1AW7A 2XN9C 3BZDB 1PRTC 3R2TA 2CHBD 5FKAC 1BCPC 3KLSX 4OHJA 1I4GA 1FNVA 1CQVA 3GP7A 1ENFA 4UDUC 4Z9CB 4RGMA 1LTAD 1PRTB 1D6EC 1PRTD 4RGNA 1FNUA 1KTKA 3DWQA 5I4DA 3BVZA 3SEBA 1SE3A 2G9HD 1AN8A 1EWCA 1RD9D 1JWMD 5D3IB 4L6TB 1SBBB 1PYWD 1TY0A 2AQ2B 4BWGB 1D5XC 3DWPA 1PTOC 1CHQD 1LTBD 2J4XA 2WV6D 5ELFA 1V1PA 4K6LA 3BYYB 1PTOH 2QILA 1I4PA 1QILA 1S5CD 1FGBD 5ELEA 1LTGD 1PTOB 1ET9A 2IPKD 1PTOF 1LTTD 1D5MC 4RHRA 3DWAA 1SE4A 4TSSA 3MC0B 4C56C 1I4HA 1JR0D 5ELBA 1CT1D 1JCKB 1TY2A 1PZKD 1BCPD 2XRQD 2NTTA 1TS2A 4DXFA 4RCOA 1KLUD 3R8BA 1EFID
chains in the Genus database with same CATH superfamily
5DPSA 1SNCA 2LWPA 1FPYA 3KK7A 3CF6E 2XSCA 2IDYA 1BCPF 1GJZA 1PH4A 4F88A 1F0ZA 3I7FA 2O6VB 4IPHA 4P72A 1ENAA 1YI2A 1XNQL 3RZFA 1KRHA 1ISNA 2HTHA 2BE5D 4JVZA 1ZXHA 4LNQA 3JW0X 4OZCA 3ZJUA 5FJ8G 4BXXG 1I7HA 1B53A 3RNGC 2PJHA 1EWYC 2ZW1A 1BBUA 4B3TL 2Z1CA 3QOJA 2JEAI 4QF4A 1PRTF 4EX5A 3HM6X 1E1OA 2AL6A 4RH6A 3J81i 4K8JA 5ELDA 1CJEA 4QAYA 3B2FA 4ZYNA 1SE2A 3Q6BA 4JV5Q 4K7UA 2C9WB 2LGSA 1GD7A 2L12A 1Q82C 2Z4IA 4UP8A 5C4XH 4J8QA 4K6DA 3NBIA 4K0KQ 2G5DA 3DMUA 5IP7H 2KX0A 2QHOA 5M5YH 1L1OB 2CKHB 1B1ZA 2F3VA 2AQ1B 3MEFA 4MGZE 2W3RA 3C19A 5IE8A 1VQ5A 4GZYC 3URYA 1SXTA 4PZ8A 4P16A 1QKZA 3IT6B 3HOWG 4GKJQ 1WGYA 2MJDA 1TQOA 4DR3L 3S2DH 3EN2A 3VHTC 1N36L 1MSGA 1XNRL 2DYBA 3L0WB 5JJLA 3RCZA 4E74A 4JI0L 2IWHA 5I9OA 1LO5D 2H88B 1RHPA 1K3RA 3HOXB 1WMHB 4PZ7A 5JEAH 3S24A 2ZVNA 1UE1A 1WR1A 1HNXL 3Q8AA 4DV5Q 4IZ8A 3BS1A 3ENEA 1GPXA 3M4QA 2MFIA 4JI8Q 1AWDA 1RYJA 1YN5A 1W3SA 1FXAA 3EHVA 1PH6A 4G3XB 2YYZA 3SGIA 5D7GA 2A68D 2H1EA 1YEZA 5A2QL 1TIID 1WCMH 3PUXA 2I5LX 4DK0A 2UXCQ 1WJNA 2MSED 3QCAA 1HZCA 4MM3A 2KQ4X 4IJHA 1BUIC 5IGGA 4JI3Q 2L5TA 4AYBB 1JMCA 3GQBA 3BDCA 4YCVA 5HI1A 2F0TA 1K8OA 3P4PB 2MCNB 4BS9A 4CJ1B 2YVCA 3BK1A 1HJPA 3I2ZA 1SE3A 1HUNA 5FR6A 2E2IH 4K0KL 1LACA 2O5JC 1XF5L 1JWMD 3ZDMC 1PDXA 3TS2A 1YX6B 4A3DH 2VUMH 4OVVA 2KDIA 1WTQA 3EGRA 2WXRA 2FXQA 4XYOA 4OGQC 4DV0L 4A3JG 2KJ6A 5FR3A 3Q0AA 3AE1B 1PTOH 2QILA 2F0NA 1GNUA 3A4RA 3MJ5A 1F2YA 2PE9A 4RWSC 2KCCA 3CIRB 4HKZE 3K81C 3EROA 3RZOH 1PTOF 3PGEA 3VVWB 4A3IG 1HZAA 1F52A 3PUZA 1K0RA 4GS3A 2N1WA 2PVOD 1P16A 4XT1B 1L6VA 3P75A 2KD0A 2MQJA 2M00A 4X3KA 3CU7A 2NBFA 3VR4A 1CKNA 1IBKL 2M1MA 5BMIA 2VH1A 2LVQA 3HRDD 2KCTA 3I70A 4JI2Q 3I90A 3R8BA 2LUEA 1SE8A 2JZPA 3AE2B 2JJQA 2EYOA 3DWMA 3QAQA 4A20A 2K9XA 4WAFA 4GOPB 1HA5A 1R4MI 3VQIA 1BBXC 4RGOS 1ZKHA 1PHJA 2BB6A 3T53B 5C4HA 1E6EB 3TIXA 4RM8A 1TT2A 4GSWA 2HD3A 4A3BG 1LT5D 4IOCA 3NHEB 2A6EC 2R7ZH 1P9DU 2Q8TA 3S1MB 1F9SA 1NYQA 4XXEA 1E0BA 4GN3B 3VH4B 1A70A 4LUZA 1U4MA 2KYWA 1R7SA 3GDEA 4LFCQ 3M4YA 2FNJB 2CH4A 4PYUA 5D14A 3VUYA 2BS3B 3AE8B 2JSVX 3QX1A 4MEMA 5KNCA 2IL8A 3FP9A 3HKZB 2B2VC 3LGJA 4DV6Q 1K53A 1UE5A 1XT9B 3Q6SA 2FBWB 2NN6H 4W9IA 4LAAA 4LF4Q 2KTFA 5L83A 1KOTA 3W2DA 4PT5A 4C7YA 1H9SB 3I56A 1Y1WH 3R93A 1HE8A 2KQSA 3KUZA 3QK0A 4C7ZA 4IJLA 1U4LA 4ME3A 4QMGA 4JIOU 1SYDA 3R3OA 5CORA 2N55A 1VQ9A 5IOIA 3A55A 3S1RH 1GOZA 3LJ3A 4C3IH 3FPPA 1WMHA 2M56B 1HNZL 4IKGA 1GUOA 5CHWA 2DZKA 3IVFA 4HIKA 3GO5A 2N0SB 1EIGA 1IYFA 5HHDG 3QOLA 1ILQA 3MP9A 3I72A 2LVPA 1GUGA 3FKIG 3V61A 3DEPA 4FJYA 2NUCA 5JEAG 1N5XA 4JWUC 3RD2A 1J7CA 2J52A 4II2B 1XPRA 1ZGUB 1XO3A 3KLSX 5IT9c 1RJTA 3S2DB 4UDUC 3W1GA 5JPNC 5CMDA 2R92B 4RGMA 1UGJA 1IGDA 2FUG1 4OW0A 3PUWA 2E6XA 3RPFC 2E5LQ 5IP9G 3VYRA 2DYMA 2KOXA 2NVXH 5AUKA 3MXNA 4C4VB 1EY8A 2WXQA 3FMCA 4OWWB 3QR8A 3NG0A 2NCNA 1MI2A 3SEBA 3SK5A 1RD9D 3PCOB 4USAA 1HFNA 2QA4A 5IKCM 2O4XA 1BNZA 3APDA 1PYWD 5I6YA 1XD3B 3JYUA 4MJSA 4YWGG 4YTMB 4W9DA 3A9JB 3U30A 4NXML 3K9OB 1FEHA 3NRZA 2EMTA 3D31A 3DBSA 5C4ZA 3NQTA 3NVZA 1G2SA 1S5CD 1VZ6A 4EFOA 5KYIA 3P2BA 2GN5A 2KDEB 5IY0A 1NTGA 1J0GA 3S16H 1J19A 1W6KA 5IOCA 3J7AV 4KSLC 2KVMA 2DNCA 1HNZQ 2Z59B 3Q2AC 2ICEC 3M85A 1FFVA 3N6RA 4NXNQ 1WFYA 4MN3A 3Q14C 5EQ0A 3Q8EA 2WDVB 2K05A 2ZTCA 1NSNS 4DR7L 3DOWA 3UE0A 2PTLA 1J9OA 2KWCA 4G11A 1V1QA 2LI5A 3J81j 4A3FH 3I4MH 2A74C 2DZJA 3GTPH 2E74C 2JX5A 2IJ0A 2VL6A 2ZTEA 1PH8A 2Z4HA 5CV5A 2MP2A 2E2IB 2JWUA 3AE5B 3ER0A 1VQCA 1IHZA 3FC4A 3AMUA 4M8NA 2VB2X 2GB1A 2HDMA 2ZJDA 3N1XC 2DX5B 2NN6I 1XCQL 1EIFA 3ZDTA 1IP9A 2QDLA 4POGA 3KUCB 1V1OA 2KVRA 3CXCA 3PO3G 1WJ4A 1TS3A 2PW7A 2KDBA 3T51B 4B3RL 4LFBQ 1QOFA 1EEID 1IYJB 5HGTA 4LNFA 1MKHA 4DWFA 4MSMB 2KHSA 2QKIC 3ONSA 3H6MA 3IBEA 5DPRA 3M4PA 1GB1A 4CGYB 2LS01 3VTWA 4XQJA 4U68A 1OQQA 4J1MA 2SEBD 3I55A 1QUQB 1V8QA 1A5RA 1FGUA 1ZYRD 1CM9A 2JA6H 3MEHA 5CX3A 5M5WH 1P8LA 5IA7A 4C3HH 1ZDVA 2K6QA 2YTVA 1RFKA 3PSEB 3PSIA 4DV3L 5C2TB 4A3OA 4DQOC 3RMKC 3FILB 1VQ6A 3G6EA 3L9AX 3K58A 3S2HH 4OELB 5LLIA 1SB3C 1R9TB 4FHJA 1N5WA 5G3LD 2LGXA 3Q3JA 3PHXB 4NAMA 3K7AH 3DBHB 1VR9A 4JI4L 1ROEA 4F8MA 4MGYE 2HCIA 4JI1L 3TQYA 3Q8DA 4A3KG 1MG4A 4IW0A 4CHKA 5C5LA 2NPTB 4IFDH 2HJ1A 1DD2A 1SJHD 2B2VA 1IBLL 1DZ1A 2GBNA 2KNBA 1WF9A 1XEEA 3HVZA 3H09A 4KSKC 3AEEB 1J5EL 3RYTA 1ZW7A 4NPNA 2IHFA 4K3BA 2CHBD 1DOXA 1E8ZA 5FKAC 4DUZL 1GHJA 2WXOA 1RKNA 4KJOA 3I3TB 3NZ3A 1VD2A 3DDCB 5LL6X 5BR8L 3AM9A 5L37A 2W82A 4J3OD 3RNBC 2F0QA 1LTAD 5HURA 2ZJRA 1OEYJ 2CKZB 4TMAB 2MHJA 4RG1A 4K7WA 2ZTDA 1VS0A 1WE7A 1A15A 3SHQA 1KTKA 4MTKA 1GUWA 2JEBI 3F2DA 4PMBA 4ASWC 1G51A 3CQZH 3I73A 1XPOA 4JE3B 3TEWA 3N9YC 1VZ8A 4XQQA 5M3FB 2K5VA 1FIQA 4LTUA 1T5EA 2DNEA 4GOPA 1WXVA 4YY3L 2ID0A 1WD0A 3VR5A 2ZXRA 1OXVA 4KKTA 3T1YQ 4KV6A 5CHFA 3MTSA 4IM2A 4I6PA 1PMRA 2EJMA 1L7YA 1L0VB 1JB3A 2HDLA 2DGYA 1ZDXA 2C7MB 1Y1VB 2V9HA 1JR0D 3RZOB 3I4NB 1N62A 2DAFA 1GKHA 3S14B 3M63B 4PS7A 3HZXA 2E2HB 3JAMc 4DR1Q 3UGBB 5DEHA 3WANA 4NAWA 2LEKA 3NUHB 3RN9C 1VQMA 3M4OH 4BBRH 3PO2G 1TS5A 4FP5D 3E3XA 5EPKA 2W55A 4A3BB 3GTQB 1MIUA 5EKIA 4E71A 1O7YA 3A9JA 2IZVB 3RT3B 3T56B 5FLXE 1X55A 4GN4B 4MSQB 3NEMA 3AH7A 2N9KA 3KQ4A 2JF5A 5IT9E 4XYCA 3MXUA 2OQ0A 3P1HA 1VQEA 2L1AA 3ERSX 1BQQT 2Q2HA 1OTCA 1BO0A 1I50H 1Q12A 2HQLA 4ZCKA 4A3FG 3I4MG 1TT5B 2YV5A 4S3SA 3CC7A 5GROA 3D32A 4GLVB 1P1AA 1EQTA 3DHGC 3DPDA 4R3DA 4AH6A 2I0QA 4GMVA 3I5JC 3CCMA 4JI4Q 2A19A 2PO4A 2WXFA 4O0AA 4A3GG 3UE1A 5JZEB 2AMCB 2JZZA 2K1FA 4A93G 3FKIB 3S17B 1Q90A 3CMMB 1RWSA 3K5OA 5C3XA 2INCC 2BYTA 3NP8A 1QE6A 1LT3D 3A56A 4AQYQ 1T9HA 2V4DA 4F87A 4JI0Q 2AUJD 3G7LA 3WA0A 2JA5G 2KC2A 3IAYA 2PVGC 1II3A 2KOLA 4KY5A 4R1JA 1XCTL 4A90A 3PZ8A 4ZQ3A 1CQFA 2V1YA 3HOZG 3Q3FA 4IUUA 3JSVB 4G0NB 4LCDE 1XTCD 2LMCB 2Z0EB 3L17A 3UINB 3ZTDA 3N1YC 3RNAC 5EKLA 3PHWB 1JQ4A 1ML0D 4ABNA 1K52A 1KLVA 1CKOA 4Y52H 2BGFA 3N20C 3BYTB 2SAKA 2R92G 1OQRA 1SJED 2Q2TA 4A3DB 1R4PB 2WP8J 4FF3A 1RFAA 1JWSD 2NB0A 2MJ8A 1A3UA 3NQIA 4P71A 1IXRA 2CFMA 2K28A 4C3JB 4WFN3 2K4KA 1S3OA 1YQ3B 2RHSB 1WXAA 2XVSA 1XMQL 4ZRKA 3J80c 1WXQA 3QO2A 2OEDA 5J1ZA 3U9SA 1PRTD 4BBSG 2ZNVB 5LXHA 3WAMA 3GD7A 1FRRA 2KDFB 4APVA 4ODGA 4E6IA 1ASYA 5JJIA 3N52A 3DEOA 4L6TB 3VDZA 2CW0C 2EXZA 2I5MX 1B70B 3PRMB 3A7AB 4ULLA 3TS0A 3DWPA 5I6WA 3RFZB 1R9TH 3UDIA 4XQNA 2UU9Q 4C1NK 1F9PA 1JJGA 1LTBD 2DBYA 3BYYB 3KYCD 1U0LA 2E8GA 1AP0A 2LASA 2LD9A 1H9KA 3B0AA 1WTOA 5ELEA 1ET9A 5G3LF 1UGMA 1LUZA 1I6VC 5IYBH 1L6UA 2ENBA 1VRAB 4M00A 4M1UB 2QDBA 2L0CA 2XWJB 3I3CA 3EQLC 2YEPF 4TKOB 3E6ZX 1BF4A 1WJJA 3H9DA 5JH5C 2OQKA 3PV0A 2K01A 3UQBA 3HOXG 4A75A 1KL9A 2WINB 4PG3A 3KBXA 4DV1L 4IFDI 4EOYA 3UDGA 1C77A 2UYZB 4GLSC 2MBEA 5F2DA 2MJEA 1A3TA 4L5QA 1LM0A 2Q2UA 1IPGA 3ZNHB 4JQWC 4BY7H 3AV8A 1FJGL 4US9A 3OWEB 3E56A 3DCGA 4QUCA 2PNRC 2DLBA 4BA1I 2WU2B 1JW9D 1K73C 1E2WA 1WZ3A 1X1MA 1WYDA 3R7QA 1BMLC 3RNEC 2D2CC 4R9WA 2PZTA 1CA6A 1NBFC 3TRZA 2F1MA 2OWOA 3PREA 1CKMA 4XT3B 5T8IA 3VTUA 4FA6A 3CHBD 4LJOB 2QCPX 4HLEA 4WJPA 4IUPA 4DR5L 1XTDA 2JRIB 4L23A 4CBVA 4R4TA 3K9PB 3UF8A 2H5XA 4A3CH 3P4QB 5C44G 2KHIA 4UP7A 4F7XA 5FO9B 1AFPA 1IKMA 1HXYD 2B3AA 3L3OC 2LVOA 1X3EA 4ZUIA 4XX5A 3A8JE 3KYDD 3V05A 2UXDL 4K14A 4JPSA 2P5ZX 4GN5A 4ZYSA 5KNDA 4LF6Q 1BXTA 1T5XD 3RI7C 4YSYB 2HHHQ 1S3SG 1B2TA 4JOIC 1QZGA 1P7EA 2JVCA 1P3QU 4GOCA 3R7RA 2PNHA 4AIMA 4A3GB 5CC4A 2VQFQ 3V60A 2VXWA 1UBQA 1EEFD 1EU3A 4DV5L 2K33A 3TBIB 4A93H 2NZHA 3CD6A 4MT5A 3LYYA 3VR9B 1ICWA 2QC8A 3DBRI 4WJ4A 3AE4B 1JQYD 4ZKCB 3K6OA 2BOSA 4F8CB 2WWZA 2L83A 1WTRA 3PO3H 3N1ZC 3K80C 2NR2A 3NS8A 3QQ8B 4N6EB 3NWSA 4OO1H 1YIWA 3M3JA 2I07B 2AX5A 1OXUA 1GUNA 2AL3A 3GTKB 3VA5A 1JOKA 4CDFC 3J81E 4IN3A 1ZE3D 3M95A 1E2VA 4R8NA 3IRBA 2NZOA 1HTPA 4LF7L 2HDEA 3TZDA 4KN7C 3AEFB 3JAML 1E3PA 1K8GA 5BR8Q 5M3FG 4YTNB 3U7ZA 3VRBB 2KEEA 1WFQA 3MA2B 1Z9FA 3AB9A 5H8YE 4RGNA 2OEOA 1TYGB 3L10B 3V62A 1DGSA 2N8NA 3CKIB 1WD1A 3PUVA 3GTPB 1Z47A 4JL9A 3N30A 5GAEC 4NJCA 4DV1Q 4LF6L 4A3EH 2FCQA 4LF9Q 3OSOA 1WRIA 5JAVA 1F2RC 1EYDA 3DUZA 2JT4B 1L1OA 3CSFA 3PRPB 2VW9A 2EVBA 2VQEL 1VQNA 2KVZA 3UI3A 4A6QA 1DOLA 3BDLA 1E2ZA 3FEWX 5IT9L 3SVMA 1AARA 2L8JA 3SD5A 2YTYA 4YY3Q 4YXDB 1Q1BA 2E2JB 3KJOA 1WOCA 4W9GA 2BS4B 1D4BA 2CWPA 4K2KA 2KN4A 2K6DB 4AS1A 3MXNB 4DR3Q 3HS0C 3MC0B 5CBAE 1VCBA 2KFKA 4W9EA 4WWPA 2G1EA 4YSZB 1CT1D 2N7EA 3A4SC 5EDSA 4X62Q 2LXJA 5JJZA 4JI6Q 1XQQA 5AZFA 3KOJA 4KKJA 3TCAA 2G9DA 2F3IA 1NENB 4OONA 1YBYA 1GM5A 2INPE 1FL0A 4YL8A 1YHQA 1KLUD 1ZP0B 1NUCA 1YNJC 3A5UA 1CHPD 2JXXA 2D3GA 3R2IA 2M0XA 3ZKJC 2BF8B 1V1PB 2OJRA 2Q5WD 3BZCA 1N8RC 1R4NI 5C0XH 1DOMA 2WXMA 5CHVC 5LMUQ 2F4VQ 3NSWA 3U4ZA 3N32A 4FF1A 1UWXA 1FFUA 1HPCA 1MHXA 2A6HD 1DXMA 3I8ZA 4RA8A 4V0BA 4WRDA 4HR7B 2MNAA 4B3RQ 2BH2A 3AI5A 4B6WA 2VZKB 2D0PA 5JHAA 1EU4A 4IUVA 5FLMH 1WR6E 4JI3L 2WHIA 3DM3A 3TBLD 1HTLD 2VRRB 1NNXA 3AEBB 4BAXA 3ZUNA 2KA7A 1VDZA 1AYFA 4R4OA 3BK2A 2F0GA 4JBJA 5IYDG 2AQ3B 1C4CA 4ICUA 3B1LX 1LXDA 2HD5B 4P1BC 2Q8IB 1B7YB 2CJOA 1D2BA 1MJCA 1FRDA 3CCUA 3HK0A 4O42A 4C4VA 1H4RA 2KJRA 2QEJC 2D3BA 1BKBA 2K1BA 1FVIA 4IPGA 4AYBE 4HSVA 3TSSA 2KMMA 4KD3A 4JBKA 1KRTA 1YHAA 4ZAIA 3Q3OC 2BB5A 5ELOA 1QOGA 3T8MA 3DM1A 3VDYA 4A3CG 2RPVA 4DKAC 5CV9A 4OX9Q 2C5LC 3IT4B 3W9CB 2M4NA 4REZA 4ANWA 2D10A 1I6HH 3F8TA 4JBMA 3D6WA 1DYQA 3HVDA 5IN7A 4LF5Q 4O1NA 1F1HA 1EYGA 2GBJA 5HY6A 4IM0A 3ERQA 1ZPSA 4KV2A 4RF1A 1H9RA 1GVPA 4HAEA 5ISRA 1C78A 4XIGS 1I3QB 1PTOD 4ZOHC 4EVOA 5LMNL 2JU6X 5KRUA 2K8BA 3QJZA 1KDBA 3PGZA 4C3JG 2XBBC 4NZLB 4HKQA 4DR6L 1XLOA 2MBQA 2CHZA 3QIJA 2BT6A 3T16A 1XWEA 1QLBB 2JA7H 4W9FA 1F77A 3ZJYC 1QZHA 1C8CA 3L4PA 4BBNF 4OEMB 1C76A 1STAA 5EPLA 3M3YH 3BWUD 1X3PA 3PVLA 1DGJA 2N78A 3A5ZB 1ZXIA 2WNMA 1K51A 2KHWB 1I4GA 1FNVA 1EYCA 3HGBA 1CZGA 4HTHA 2JPHA 3P4RB 3Q69A 2D62A 4QIWE 3GTQH 5C0XJ 1PH5A 5JVG3 4A3JB 1B9RA 1RTNA 3DBHI 4C3IB 1SF0A 2WXKA 3A7LA 3PPAA 1RTOA 3H0GH 4PV1C 4DV4Q 1QOHA 2FFKB 1PH3A 2KMAA 2V3NA 4DGZA 3GTGH 1D5XC 3HOYB 1V80A 3HEJA 4HROA 1EO6A 1CUKA 1CHQD 1K83B 4K7SA 5JOBA 2NYZD 2R6GA 4K6LA 1NR2A 1TWHB 2XIWA 2PIAA 3A9KB 3ABVB 5GAHC 4GN1A 1HZ5A 4Q0FA 1FGBD 3KLWA 5KNBA 4QGUA 2F0JA 2EJGC 1L2FA 1ZUD2 1N60A 1SYFA 4IQZA 4RNAA 5EGTA 2F3WA 4LLGM 1PZKD 3LDZE 1Z7TA 3KUPA 3WOFA 4KN4C 1EZ6A 1SLJA 2K32A 3X3NA 1F9RA 4LK0M 3GP7A 5EE3A 4B9WA 3SFEB 3GTLB 2N7DA 3T1YL 1EF1A 1K9MC 1OFFA 3A9KA 1KIXA 3RR5A 2R7ZG 2CH4W 2WAQB 4A3BH 2N49A 2EMSA 2B2UA 4JK1C 1WI0A 3S15H 2I1KA 2CR5A 4UAIA 3OWFA 1TWFB 2KQ3A 1VCIA 1QVGA 4ZRPA 5ELNA 4LFAL 4P74A 2I1JA 2JUOA 4PQXA 4CKBA 2FCNA 3AU5A 5HKHA 1WTVA 2QSDA 4ZRZA 3I91A 5CV8A 1UF0A 2DWQA 2KX3A 3DVGY 5GMVA 1VQKA 2AYOB 1FD7D 3FVQA 3W1BA 2PCFB 4QUFA 2G4SA 2TSSA 2E75C 1J6QA 1T0QC 3HUIA 2JE6I 2J53A 1HQRD 5IGBA 2K50A 3BZKA 5FO8B 2KWUB 3W1SC 3HRZC 4A3PA 2OT2A 1ZOYB 4M0WB 4PS8A 1T3QA 4KY6A 2F0HA 1YHBA 2MBOA 1Q10A 5K36G 3RMHA 2JA5H 4X64L 3Q22A 2JWZA 3AE6B 3BINA 2WAQG 2L76A 1FM0D 2Z8LA 2HCCA 1JWUD 3H91A 4A3GH 1S5ED 4CHTB 1VQ8A 2NVQH 1Q1EA 1H95A 2X8XX 4GNXB 3OLMD 4PS3A 2JYOA 5IWAL 1PH1A 4BKSD 2EY2A 3D6CA 3D3RA 4A76A 4HRSA 4FBJB 3G4SA 4A3DG 4FULA 2F0SA 2L3ZA 3WIMA 3KF8A 1PH2A 1N32L 4BOZB 4OX9L 3GTOH 1KHIA 3FKIH 3S17H 4W9CA 3E5SA 3HIZA 4DV4L 5A35A 2IY0B 1KM7A 5KIXA 5M3MB 1FCLA 2RR9A 4OIKA 1BUVT 1X65A 2NZ1D 3AFPA 1GHKA 2KENA 1STGA 4FJVB 3W1SA 4JG2A 4NJ6A 2B8GA 4CKEA 1STHA 2QW7A 2N9LA 4BY1G 4QJFA 3EFCA 3ZYYX 4K3CA 4K5VA 4RMAA 1YJJA 2R92H 4OL7A 1WYWB 4ANUA 2PYKA 4H02A 1VJKA 1FD6A 3PIP3 1HR0Q 1P0RA 4CYEA 3U4VA 3Q3NC 1SNPA 4KGRA 4MZ9A 4OIJA 2IY5B 3KDFB 1FNUA 3AEDB 4XDXA 3H0GB 4WH4A 3HOUG 2WKCA 4FDBA 5NUCA 5C3JB 3UIPB 1O7LA 3UDFA 3P7JA 1VF5C 2KACA 3PLVA 1SFOH 1GXDC 3F2BA 1I3QH 3KF6A 1Y8PB 2WXNA 2KZRA 1K8AC 1FCCC 1WGGA 2Y5PA 4X65Q 4JGHB 2EYHA 3LB8C 4M02A 2IYDB 4TSSA 5DAUA 1I4HA 3KF8B 2OOBB 4ANVA 1YOVB 3CCQA 2JY6A 5JEAJ 1X3FA 2EYFA 4P75A 2A8VA 2PZUA 4UPAA 3Q24A 1WTWA 2FIFA 2YTXA 4A8XC 5J3BA 2B3GA 3T1HL 4IOAA 3MHZA 1EOVA 3J7YW 4K1RB 5M3FH 4GB9A 4C00A 4DR2L 5HGQA 1G291 2JA8H 2IT1A 2ON8A 1JJ2A 1FMAD 3NVVA 4BKGA 2EY5A 3J80E 4S17A 2G4DB 1TU2B 1NI3A 1HR0L 4W9KA 2G3QB 3Q8BA 4BZAA 2WX0A 3A1QB 3D8GA 2R93H 2QEXA 5CR3A 3E0EA 2KQ7A 1B44D 2NTSA 3EC8A 2GOWA 1G6JA 1JOOA 1I94L 3MJWA 3DVNV 3P42A 1NMFA 3VR8B 2SDFA 2H4OA 1WTHA 3VR3A 1YQBA 1IUEA 4BY7B 3RZDB 2BBCA 2K5NA 1IL2A 4M8MA 3NBHB 2JZ3B 1E24A 3S1NH 3S1QB 2MH7A 3NVYA 3KWLA 3KWVA 4KIKB 2GBMA 2V1CC 2JA5B 3FAHA 3J81L 3SXHA 1TZ1A 1I5FA 4B9XA 2WFWA 3SR6A 5KYLA 3AXCA 1TXYA 2INNE 1AEXA 4JI2L 1KH0A 4KVGB 4LJZC 2B2TC 3T3OA 1GC7A 3V6CB 2UU9L 2JXTA 4YCUA 3L54A 2LHEA 4WIPA 3T1HQ 2WX1A 3CCVA 1P7FA 1VQJA 3FDTA 2XK5A 4ZUJA 4HJ9A 3M62B 4DV7Q 2D2QA 3SK6A 2PW5A 2ZM6L 4FF2A 4DAPA 1TGZB 2JA7B 4G4KA 1LTID 2SNMA 1MSHA 3WDNA 1CI3M 3NENA 3HG9A 1JOQA 1E8WA 1Z2MA 3EA6A 4H44C 2KMCA 5CV6A 4LF7Q 5BN3A 1Z5SB 2RSNA 1F9JA 5C6AA 3S1MH 3OIQA 1L0YB 4OZBA 4ZRQA 3TL5A 1FNWA 3QWZB 2K5HA 3T9LA 4H2AA 3T13A 1A62A 4DA2A 3ZNGC 1L0WA 4IFDG 1BCPC 2IGDA 5M9OA 1STBA 3VFKA 2HIVA 5I9PA 4DNIA 1SRUA 3IG3A 4CDCC 2GVBA 3FRPB 1C1YB 2JA6B 2C5CA 1NI2A 1YX5B 1TJEA 4HCPB 3T3NA 2E5LL 3DWQA 1KDAA 4DK6C 3HHMA 1C9OA 4HCSA 3A33B 3NWTA 4DR4Q 1K8RB 3NPPA 1LM8B 4BWGB 1C3TA 5M5XH 4A3IH 4HN7A 1XYIA 1IZ6A 1N63A 1QOAA 3QC8B 3GTGB 2WDRB 5BN5A 4NQKE 5DCNA 3VA7A 5D6JB 1Y1WB 1SSNA 2BA0A 3IXSA 3PIOA 2H89B 3QA8A 4HVBA 2UXBQ 1LGRA 4MNOA 4GOPC 2Z0DB 1NEKB 4WJ3M 2LY7A 2X6GA 3IAS1 4GGQA 4NKLA 1TY2A 3DHQA 5KEEA 4B3ML 2R7ZB 4ARCA 3GE3C 2WP9B 2PQEA 2C7NB 4H13C 2LJ5A 2WU5B 3EECA 3MVVA 3DBLB 3ZGZA 3DVGX 4MJSB 3U58A 3GS2A 1DOIA 5L95C 2MX2A 2N9XA 1L4DB 3K57A 1CSPA 3WAOA 3L13A 1KRSA 4A3LH 4OWTB 3RNFC 4BBSH 4CJ2C 2M0AA 3OW2A 4HPMB 3DBRB 4HEDA 3ICEA 1LT6D 2MGSA 4QCLA 1WGDA 5IYCG 2O6VD 3MXPA 1B50A 2RDHA 2MBHA 1SR3A 4KD4A 4YCWA 4CJ0B 2NVXB 3PTFC 2F0DA 4DHZB 3RULA 3H3VH 3CPWA 2PMZB 5C44B 1KLGD 4U673 2RQXA 4DAVA 4NXMQ 4WQMA 2F0MA 4IC7B 3A8KE 1JT8A 2JP1A 3I57A 3I63C 1E1TA 1M90C 3ZQ4A 4A93B 1KXLA 2FHTA 4J6IA 2ZM6Q 1PV4A 3QARA 1YMHE 2Y0SE 4GDKA 1HUMA 4C1NI 1PVOA 4WJQA 4IM3A 4A3KB 1G2TA 4DV2Q 2CHWA 1QNUA 1A6XA 2NBVB 2WXJA 2J0MA 1CFMA 2A1AA 4B3TQ 5G2NA 4NPSA 4LF5L 1PXUA 1U4PA 2GMIC 4X6AH 2K3UA 2UUCQ 4L63B 2EY1A 1SMXA 3KH0A 2BYVE 3QWNA 2RA4A 3PQIA 2KLCA 3ZXVA 5C4JB 2BCOA 1AZPA 1O7ZA 2F0KA 4JPBW 3TDQA 1NMGA 1TVXA 2JSOA 2IO1B 3WAPA 1V97A 1B8AA 5DLQE 1F2RI 2KCMA 2CS4A 4IWOA 1UWVA 2HJ8A 4BOSC 4FYDA 2I38A 4PK1A 1EY7A 1HCZA 1VMPA 2R7DA 3CPFA 3HKZG 2MBBB 4BY1H 4JI7Q 2CU1A 4A55A 4XC2A 1DONA 2PMVA 5E6PA 2LXKA 5LHY1 1PZID 3F2UA 1WJUA 3OTOL 1NCVA 4FXKC 3G71A 4OO1G 4KMUC 3Q8CA 4HPPA 4KHZA 3G6JB 5AZGA 1XX8A 4ALPA 4HMIA 3UDXA 5C4XB 4LNOA 2X6LA 1UEAB 1BR9A 4PMWA 3NK9A 2JXMB 3CRLC 5M3MH 1SNQA 4N59A 4WJNA 3TP6A 3OJ4B 2EYPA 1XPUA 2FAZA 2QCZA 4IWPA 4KJNA 2VS1A 1GUSA 1ZEQX 2L15A 2JA7G 1H9JA 3HKZE 3VRAB 4G7ZC 4ZRIA 2WB1E 5DPWA 2WYQA 2VY3A 3KFUA 1EUJA 4JYAL 4KHPL 3IFWB 4EE2A 1D6EC 3D4RA 1HA6A 4F7ZA 1EY4A 3JAME 2MO1A 1V86A 3NY5A 1OTRB 3SFDB 2G9HD 4YTPB 1NE3A 3ZRFA 3C3LA 5EPJA 2RPQA 1A8VA 1WM3A 3NE5B 4HJ5A 1K3BC 3AU7A 4LMQD 5IYBG 1M94A 2Y5CA 5T1IA 2ZEQA 2WV6D 3JC66 3RUZA 4GDLB 1KNEA 2AKWB 3H0GG 2A69C 2BPSA 2NS5A 1VQDA 2DY7A 3W5OA 4HCNB 2JK8A 5KGUA 1PFMA 2Y0SG 2X69A 1LTGD 2BWES 1TWCH 3BIID 5IYDH 4DV6L 3TZUA 1D5MC 3SDLC 5IP4D 5KHQA 4I7AA 2ZXOA 2Q2IA 3MZ5A 4EGVA 2F0LA 1R4NB 2G45B 4Q2JA 4LF8Q 4NY0A 3NZSA 1E5WA 2AWNA 5LMUL 2F4VL 4EUTA 1VDVA 2KCNA 3CAMA 3M7GA 1L4ZB 1T6BX 1Y8NB 4RCOA 4WWNA 2DJFC 3DBLI 2WXLA 1GC6A 5CV4A 5FLMG 1ESFA 4XWWA 1WSPA 1RDPD 5AJ3L 3SK4A 1E10A 2E2DC 5LMNQ 4RF0A 3TP8A 3P4SB 4C80A 5I2XA 4HDQA 3BVGA 4DR6Q 4UHVA 3N3KB 2M9VA 2R93B 1DCZA 1M4VA 3J7AF 3A1QA 1S5FD 4MM3B 3AULA 2MEKA 4MACA 1J8CA 3KVFB 1JALA 1JJCB 4BBRG 3PO2H 3PIO3 1Q3LA 1I6HB 4AUQC 2KFKB 3ZW3A 3RN2A 1XJVA 5J18A 2XNAC 4RFBA 1N6ZA 2SOBA 4HWIB 2ICIA 5GXGB 3ULLA 3L0OA 1L0XB 2ASBA 3MAQA 3AMZA 4B0MA 3NBHA 1Q86C 4LF9L 3OW7A 4POFA 2WGSA 3APCA 1LQBA 4KDIC 4EKUA 5IGCA 4HIMA 1Z6HA 5IWAQ 2HTME 1WXSA 1B9MA 3KYHC 4L2YA 1A63A 3K5NA 2WDQB 4EZJA 1DM0B 2FMMA 1VQLA 2IBIB 1Y14B 4R4CA 5AFWA 3MC8A 1ESRA 2YLMA 1E90A 2RBMA 3HOVG 1E7PB 2K0PA 1GAQB 2XTIA 2K75A 1I4QA 3V3XA 1YN3A 3C1FA 4G7OC 1V2YA 1PQSA 4GDKB 2BE5C 3P1MA 2M2LA 4IUTA 4LF4L 3B9JA 1L1OC 2PI2E 4JCVE 1V43A 1RLFA 3X3MA 4K8IA 1BCPB 3K59A 2D9UA 3RNUA 3VYUA 4X66Q 2JRHA 2K52A 1O78A 2ZCCA 1RCVD 3TN2A 4FJZA 2LJIA 1SNOA 4RM9A 3ONAB 1AW7A 3BZDB 3FHWA 2WACA 3MXGA 3VR6A 4YSXB 2CVRA 4C3JH 2CCZA 4C2MB 2J0JA 3DLLA 3E9SA 3PZ7A 1EF5A 4WAAA 4N58A 3BY4B 1ENFA 4Z9CB 2B76B 5E6JA 2MRPA 3UIOB 2KC1A 2F4IA 2A69D 4XTCS 1EM7A 1KAWA 2KDMA 3F2CA 1QWYA 5C4JH 2D5DA 4EQNA 2HE7A 2PQAA 4BY7G 1FJGQ 3DHIC 4BBNC 4LW1A 2WDTB 1YNJD 4DR4L 2QIEB 5BYSA 4MH8A 1UAPA 4CO7A 4ICVA 2NVUI 1QQRA 3WOEA 2J4XA 4GXBA 3EBEA 1R4QB 3AEVA 2N9PC 4A3EG 3GTJB 1CZPA 2A4ZA 1QILA 4NXNL 4DR5Q 4LUVA 4R8IA 4FXGC 4NMZA 1A0IA 3HP3A 2L11A 1LTLA 5LL6S 4B95A 1WX7A 5EBDA 1WH3A 2KT7A 2IX0A 4A3JH 2EKIA 2WXHA 2WXPA 2ZW0A 3J9CA 3NZUA 4EZKA 1IL8A 1K8MA 1WE6A 3SDZA 4DXFA 2KLGA 4II3B 4M0WA 4KHVA 4V190 4TKNA 4NP5A 1SYBA 1EQRA 1JICA 1BOSA 1EOTA 2UUBL 1C48A 1YJ1A 1AZQA 1EIYB 4KX6B 3ZJVA 2B2TA 4TRDA 4A9AA 4H0LC 1HZBA 3VH3B 3T4AC 1IYUA 4EQPA 3PO2B 1TKGA 4FNFA 4I65A 2LRWA 2RVLA 1V5OA 3J7ZC 2YU9B 5IAAC 1HTQA 2J7ZA 3FILA 2MUYA 2L0TA 5BN4A 3MWYW 1BBWA 1HNXQ 4FXDA 5IODA 5IP7G 1SFOB 3WCQA 1W2BA 5FO7B 5C3WA 4GKKL 3A54A 3HOUB 3ALBA 2RHQB 2JN4A 2K8HA 4M01A 3S1QH 3S1NB 4HPLB 1JRUA 1X9NA 1HZ6A 1PGAA 3TEHB 2WXGA 4DHJD 3LX0A 4N9PA 3ML9A 1E22A 3NUCA 3OMGA 2NPTA 3Q3MC 2M8SA 3VUXA 2BS2B 3HOZH 1TTNA 1BT0A 1N32Q 1PH7A 2IW3A 2LZ6A 4A4IA 2RGFA 1LLRD 3OPOA 1PYBA 3WWVA 3KW5B 1NAPA 4E3CA 1HHVA 5J39A 2VQFL 2YEPB 1VQHA 2F03A 2V4IB 4KIKA 5IGFA 2VQEQ 1SEBD 1SAPA 1T0SC 3EIVA 3J81c 2UUBQ 2R61A 3CCLA 2HQEA 1TZOA 2F52A 2M17A 4DR7Q 2CWAA 2JA9A 1LTSD 3STBC 1Y69U 2UUAL 1U9RA 2LUMA 2R2QA 4IWQA 2ZNVC 2F0EA 2DUDA 2ZZPB 3AB5A 2GLSA 2MLBA 1MHWC 4NQLB 1NR4A 2GVAA 1MD2D 1VMCA 2EDGA 1O80A 2K8CA 4ZDVA 4C3IG 1WTXA 4WURA 1WX9A 1BDOA 4KTAA 4LUOA 5BO4B 3ZTCA 4XDDA 5JPMC 4F1SA 1Q0WB 2V0GA 1Y1VH 5FOBB 2L00B 2KUMA 2XEWA 4ME5A 1WI5A 2OTJA 4TV3A 2ZT9C 4HJ8A 5C0XG 3K7AB 3MHSD 4D2KA 4ZHOA 2B8FA 2KJXA 3EUB2 1MJDA 4FN2A 1YD8U 3HOWH 4FHKA 1F2MA 2VUMB 2CQAA 2N3SA 4BFRA 1IBXA 1I94Q 2J42A 4K81A 1QUQA 3BJUA 1R4MB 4DK5A 1OGWA 4FADA 1HNWQ 1C4PA 4HK2A 2XGTA 3VYTA 5LXIB 2EOTA 5GQOA 1VQPA 2LXAA 2CW0D 4BBSB 1JWAD 3U8ZA 1ONLA 4HIOA 1CA5A 1V9JA 1N9WA 2EXDA 3NXWA 3PRZA 1PTOB 2IPKD 4DK3C 4IOIE 1MFWA 3SK8A 4TQ1A 2W3SA 4DR2Q 1ZYRC 2GA4B 5FLXc 3C8YA 1JCKB 2QMTA 2Z6BA 3R3MA 1RL2A 5G5HA 3U4EG 3HOZB 1EYAA 1TS2A 4DAYB 4HJ7A 2R93G 3I9V1 4ZRJA 4ZK9B 3W1YA 2L1BA 1C0AA 3TEYA 4DNRB 4LFBL 2ASQA 1E8XA 3TUOA 4TQUS 2WXIA 2OTLA 4JBWA 2FJ2A 2IY1B 3HOUH 1TIFA 3HFZB 2FE8A 1EFWA 1NJIC 2NBWB 4XZ4A 1Q81C 2QGQA 4JWSC 2ES2A 4P6VF 4MTNA 4KZCA 2REXA 3DHHC 1Q8KA 4KGTA 4AJYB 2MA9B 3RN5A 3ITPA 2O2VB 1VQFA 4LNIA 4WJOA 1K83H 2R3ZA 3BVMA 4JX1C 3I4OA 4I6LB 3VYSA 3W5VB 2QF7A 2JA8G 2FUHB 1V81A 3MFYA 2MQHA 4BXXH 2DNFA 2K39A 3H7PA 3MFGA 1I35A 2JYEA 4AWJA 2EELA 3EVQA 5A2QE 3H3VC 4KZ0A 3ZNZB 2LXCA 3X0WA 2EJFC 2D3AA 3X23A 4US8A 1IBKQ 5C5MA 3AQQA 4OXPA 4JI1Q 2DENB 1RF2D 2WB1B 2JQRB 5BMGA 4IURA 1JORA 5AZHA 3K0XA 5EE1A 1QVCA 1U5KA 4PYZA 2KHJA 1YVCA 1JWBD 2MWSB 1FYCA 2GBKA 5C4XG 3C1EA 4A3MG 2A68C 2BYEA 1SDFA 2AHOB 4KKSA 4EQ5A 4L5RC 1EIHA 2QJLA 5BYQA 3V6EB 4N9F4 1HZ9A 2SNSA 4YWKA 2KAJA 4MGKE 4IO9A 1ILPA 3HOVB 3WALA 4MDKE 2UUCL 3HM3A 4ACFA 1D3ZA 2KTRA 1N34Q 2KXJA 1NBWA 2HHHL 4LNKA 3F1ZA 2RCNA 1ZKOA 1B3AA 3ZO5B 2WKDA 3JAMi 3OHXC 2WB1G 4CDEC 4IG7B 1J8IA 3G48A 3GTKH 1V8CA 1L2NA 1LV9A 3Q8FA 1C9FA 2EPBA 2B63H 4XWTA 1K50A 3EFUA 1H9SA 3AEGB 1WZ0A 1PRTB 3CCSA 3PO3B 4A3LG 2R7FA 4DN4M 1N36Q 1E7ZA 3R66C 3L08A 1PGBA 1HQMC 1PFNA 2LKVA 3K7UC 2OHFA 2K7VA 1B9NA 2MO0A 5CTRC 2AEHA 2L9HA 4KDLB 5D3IB 1SE9A 3D0FA 4AYBG 4P1CC 2BA1A 4B3MQ 3GTOB 4GLAC 1ASZA 2PMZE 1LFDA 2EYLA 1TBEA 4EEWA 5IIFA 2VUMG 1Q46A 3GTJH 2B2UC 1OXXK 5LMNW 2UXCL 4RHRA 5CBEE 4N8X1 2HIXA 1SE4A 3K5LA 2NVTB 2EY6A 4I7ZC 3A0JA 3ND9A 5ELBA 4HJGE 3V96A 5K5PA 1IW7D 1T0YA 1HFGA 3V2TA 1ENCA 3BU2A 4GNXA 4B3SQ 5K36H 2NTTA 1N34L 2UU7A 4XDCA 1KC8C 2KKCA 1XLQA 1XLNA 1EFID 5JHBA 1SGHA 4PNYA 4X57B 5DPTA 1S5BD 5M5XB 4A3IB 1C4AA 1QF6A 2EYJA 2IO2B 1HRJA 5AEKB 4PMCA 2MW5A 1O7IA 5E4XA 1MG8A 4DV0Q 5JJKA 3OTOQ 4NNJB 3RNCC 1UELA 3CCJA 4FF4A 2CU3A 4J15A 4YIJA 1IYVA 1WXMA 4JI6L 4LFAQ 2LHDA 2B29A 3S14H 1G6ZA 2RDBC 4AQYL 3MC9A 1QZEA 3QG1A 1G6PA 4DUYQ 1CMXB 1E0ZA 3IHPC 4DDID 1JE4A 1WWTA 3SHLA 2K5WA 3S2AA 2RDGA 3SU8X 3ZXRA 1DJRD 1TWHH 1NYRA 3KDFA 3RZWC 2XWBB 1HH2P 4GDLA 1C7YA 4WORA 5C3EG 1JE5A 1DOKA 2MHVA 4DF7A 2WQYB 2E3TA 1RM6C 4ID6A 4PZ6A 1WJ6A 3PF5A 1A3VA 4C3HB 3Q23A 1TR5A 1SYGA 2RF4A 1WGRA 3PMFA 1CSQA 1QG7A 1LTRD 1K28A 4LDTB 3ZNID 3CC4A 1LT4D 3NVWA 1S40A 4LWCA 2IO3B 4HMJA 1BVSA 4RKBA 4HJAA 4HXDA 4K2LA 1VQOA 2BVCA 3H8HA 1QNKA 1S4ZA 4FVMA 4X62L 1UD7A 4W9JA 1GUTA 5FJ8H 2R2OA 4ARIA 1NDDA 3ND8A 2FIDA 2A6HC 4IPDA 4YT0B 2Z6KA 1XNQQ 1H9MA 1KF6B 3OIPA 1G91A 3GV6A 1SIJA 2O2LD 5COYA 1STEA 1SMYD 2F0PA 4CKCA 3VAWA 1J5EQ 5DM73 5BMHA 3NTIA 3AE9B 1PFSA 3CF5A 2LGDA 3J7A5 4DU9A 2W54A 3LNNA 3R2TA 2OJWA 1X54A 1YZ6A 2F0IA 1WM2A 1QCBD 4S0RA 2ZJQA 3FKYA 4OHJA 1CQVA 4RKLA 4TVAB 2A5HA 2B2WA 3CCEA 5JXVA 2Z6KC 3D4DA 2J0TD 4EQOA 1M8AA 4O2DA 4HDOA 2KTRB 3BVZA 4B08A 3UI2A 2PKOA 1AN8A 1GO3E 1OXTA 5E4WC 2V3SA 4W9LA 1STYA 2I46A 2NVYB 1TY0A 1VF7A 2F0VA 4LDTD 4AP4C 5LNK1 1Q1OA 1V6EA 1PTOC 3PS6A 3CMEA 2EKEC 1HNWL 4M8AA 5C23A 4LF8L 1WY8A 1KAAA 1WTPA 1XLPA 1I4PA 4R4QA 2PLPA 1PUTA 3PUYA 2BDNA 1SROA 2EE1A 4KY7A 3S1RB 3BG3A 2NWGA 2PE6B 4XGAB 1JC7A 1LTTD 4OVUA 3HOYG 4KK7A 1W6JA 2E2HH 2K25A 1VQAA 3H1UA 3PV1A 2D0OA 3KJPA 2DHZA 4WQOB 3K0YA 1E9MA 1RRBA 3NELA 3SE0A 2BKFA 2XRQD 1CZWA 4DAYA 5IYCH 3TREA 4DV2L 4EZLA 4HCEA 1EZ8A 3JSVA 1I4XA 3GTLH 4DXGA 1B3QA 4BBRB 1YJWA 1N33Q 3H7PB 5E3FA 5IGDA 1KQSA 3ULJA 1IBMQ 1OXSC 1SYEA 2HT1A 2KN5A 1UE6A 2IO0B 2V3PA 4RHSA 3HOXH 1MBYA 1WGHA 2DY8A 1WIAA 1FR3A 4GKKQ 2K04A 4G57A 5D94A 5HG2A 4ZKBB 5M5WB 4ZHPA 2EQSA 2L05A 1Y8OB 2KEDA 4K5WA 2N7JA 2I5HA 1PYSB 4X3TA 5H92C 1B4OA 3KLRA 4QQBX 4OO1I 4JI7L 1AE2A 1C4QA 1VQGA 1TS4A 4GNXC 1UH6A 4KKUA 2NN6G 1XNRQ 3GTMB 1G8ZD 4DHZE 3DQVA 2L7RA 4BKSA 5J17A 1VLBA 3DWGC 3IAM1 2DAJA 3PT2B 3TP7A 3STBD 1S5DD 1YNTE 3RLOA 5C0XI 1UWMA 4IUMB 4W9HA 2RD0A 3OAWA 2A5UA 4YWLA 3VTVA 1EY6A 4MGIE 1Q8IA 1MJEA 2FCSA 5C44H 2ONQA 2WS3B 4P7IA 4Y7NB 3D4WA 1ICFB 3CCRA 3PIPA 2N9EB 5D3DA 1MI0A 2DYOA 1VQIA 1PA6A 5MPOA 4JYAQ 2JA6G 2A6ED 3PF4A 1EY9A 4RMFA 3OMCA 2RSUA 2Q8RE 3W3AA 4J6HA 1E8YA 2Y5BB 2RCFA 1ZXTA 2J7QB 1PLFA 1AH9A 1D5ZC 5AJ3Q 1EQVA 1X56A 3ZLZA 3H94A 3B08A 4DAMA 3O13A 5G5GA 1MGSA 1KFYB 4NAWB 4TQ0A 1TWGH 2F0FA 2I2YA 3QIAA 4DNTB 2L52A 2ZPNA 2F0UA 2K5DA 4B0EA 3NHHA 1PRTC 4A3KH 1JMLA 3DXJC 4G50A 2CHXA 1YJ9A 2KK8A 2M19A 5M3MG 3AFQA 3TP5A 3ETRA 1EWIA 3GV3A 3CMAA 2NBUA 1Y56A 1I42A 4LFCL 4K5XA 1VQ7A 2XK5B 1KNAA 3EJIA 4A3EB 3W5UB 2E76C 4L8JA 3CW2C 5GADC 2WIIB 5CV7A 4H7BA 2Y0SB 1EWCA 3I4LA 4X3UA 4G7HC 1YJIA 1CKNB 2AQ2B 5EE9A 3AN1A 3DVNU 4DV7L 2OXPA 4UY8C 2LSSA 1WVLA 1I50B 2KWVB 3KUDB 3E9IA 3L7ZC 1F2ZA 1UBIA 3GB1A 3O65B 5KHOA 3ULPA 2DJGC 5CYUA 1QT9A 2L32A 3ZIMA 4AOFA 3RZDH 2UXBL 2V4LA 3DWAA 4YHHQ 4C56C 3NOBA 2AWTA 2WAQE 4JLCA 2DZIA 4HEA1 2D3CA 4A3MB 1YITA 2UXDQ 5E1FA 2KJHB 1V49A 4B3SL 2B63G 3AEAB 3TJPA 4AQ7A 3M4OB 3MHBA 3UQAA 3GZNI 4P73A 1PZJD 1FXIA 1RIPA 3I4NG 2C7HA 2KWDA 2GBRA 3H15A 2L0FA 3C0RB 3LXFA 4DPGA 2JA8B 1YNNC 1EQQA 3CP0A 1WRDB 3ECIA 1OO9B 2MP2B 2ZPYA 1GB4A 3S16B 1CK1A 1KD1C 4DUZQ 1UE7A 1MPEA 2EZVA 2NVQB 3GE8C 2HUGA 1QB5D 2E2JH 4KI0A 1STNA 4FO2A 4X64Q 1S72A 1D1KA 1SNMA 3OYYA 3NJTA 1SYCA 1YNND 2RSOA 1WX8A 2LMCA 4BVUC 4C3HG 5DM63 1XXGA 4JV5L 3KBGA 3NTHA 1QVFA 1IKLA 4ITKA 1I4RA 1SMYC 1HR0W 4JW0A 1X3QA 1HEZE 2FMCA 3EFXD 3VXWA 3S15B 3CSTA 4X3SA 3HOVH 3TMEA 1KJTA 2JQOA 1IGCA 2D07B 3QHTA 2O6VA 3U9OA 4OZAA 1TWAH 3SR1A 1XMOL 4TUUA 1SN8A 1Y1WG 4Y7NH 4NB3A 2NVYH 2IX1A 2KANA 2QDFA 5FK9C 3IKJA 3B2GA 1E7VA 4OVZA 5C3EB 1TKYA 2RKSA 5I2YA 3J80L 2RDFA 2IGHA 3U7DA 2BKRB 4CDDC 2CJNA 2BW2A 4KGSA 3TEZA 1LABA 4JI5Q 1YN4A 3AU4A 3PO0A 3GTMH 2IGGA 2PPHA 1TWCB 3E9HA 1NY4A 1S1QB 2B2WC 2ZCBA 1PFBA 1A2UA 4L5TA 3NTKA 4YWMA 4BY1B 3HOWB 2F0OA 3AECB 1ET6A 3PLUA 4RGTA 5TR5A 4A3MH 1UZXB 2LRUA 2UWQA 4NJ7A 5IP9H 1PFDA 3RUIB 4JC0A 2XN9C 2NMQA 2O2VA 1D1IA 2LFNA 1JRPA 5IO9A 3E0JA 4AJWA 2FINB 3LWUA 1GG3A 1GUAB 3IFTA 1OQYA 2X38A 1P98A 3NS1A 5D2MB 3U2SC 1PH9A 2PW9A 2N88A 2PI2A 2JYTA 5T1GA 1K0SA 3GOEA 3P63A 2B2YA 2NVTH 4DHJB 5E6OA 4QB4A 1QOBA 2BYFA 3ZVVA 2PPBC 2LGIA 2PQAB 2MP1A 3QJYA 1WCMG 5EKKA 3HOYH 3AE7B 4N8FA 3AE3B 2LFIA 4DDGD 2KECA 2INDC 1F2LA 1Q5WB 5EAYA 3FPUB 3VR2A 3CWIA 5EE0A 5ELFA 4GLXA 1V1PA 1J7BA 5IGEA 1FO4A 2ALYB 2OF1A 4GU2A 2O5IC 3H3VI 4JI5L 2ATWA 4UP9A 5EJWA 4DFAA 3JVZX 1VQBA 2AUKA 2K5QA 5C1ZA 1V9PA 1U4AA 2EYMA 4QY7A 3M3YB 2VB3X 4XYQA 1BCPD 1EY0A 3S9WA 2IHEA 4RCNA 4IFDJ 2DN8A 4RAUC 2UUAQ 4IPCA 2N4FA 3OG5A 4WJWA 1Y1VG 4HJKA 1YIJA 1UNSA 1WCMB 5H1SE 4KHPQ 1VZ7A 2ACZB 3TEXA 4IUNA 5ELCA 5DNFA 3RLNA 1TWFH 2FCMA 4N9TA 1X3GA 4LNNA 2K22A 5E7NA 1YJNA 4DXAB 4B9KA 1EY5A 1X32A 4GIVA 1A2TA 1EWHA 1PGXA 3C2PA 2N1VA 3P20A 1H8CA 4KLKA 2D5GA 2ZJPA 2K6AA 1Y8RC 1IW7C 3I4NH 2ZVOA 3RLFA 1C79A 3C46A 1T0RC 1SNDA 5CGKA 1HTOA 2KBNA 2BQQA 1AE3A 4X66L 2KO3A 2W9NA 3VUWA 4C2MH 2MJ3A 2D11A 3PZDA 5HFYA 2EIFA 4DK1A 4CQNA 2VH2A 4KKIA 4OWXB 5JVH3 2MPMA 5J2RA 5EBCA 2A73B 4A3FB 3I4MB 2Y3AA 3AYHB 4URKA 1D8LA 1V5TA 1M1KC 4WWOA 1UUPA 1QJOA 2OCEA 2DZMA 5GAGC 4X65L 2BTEA 4NDXA 5D65A 1IBLQ 1F9QA 3U50C 1JROA 1N61A 4L5SA 1TKWB 1UEBA 2AWOA 5C3EH 2ZXPA 1EL0A 2GRIA 5G55A 1EUVB 2PEAA 5J22A 3K5MA 5TSSA 1U4RA 3ZJTA 2F0WA 5E6NA 3B6YA 3J80i 4MIUA 1XMOQ 2VZAA 1L5PA 1MHHE 4XE0A 3HKSA 2L4NA 4P2CB 1IBXB 3L2PA 3CC2A 2J0KA 1WGKA 2GI9A 1CTMA 2BWFA 2YU9H 3L16A 2BDOA 1TWGB 3IL8A 3APFA 1TKEA 4I6NB 4DV3Q 5M5YB 3LWEA 2IX3A 2XRSD 4R4IA 4Q5VA 4BKTA 2VZKD 2K03A 2K14A 3BDOA 2TMPA 4JOIA 3MTNB 4FLHA 1FXTB 1LYLA 1SIFA 1RAXA 2B2YC 2Z9HA 2C9OA 2L55A 2PZWA 2K5PA 3H7SA 4MH0E 4IDIA 3S2HB 5FLXL 1YNXA 1ACCA 1TWAB 3CRKC 1MVKA 4QIWB 3OJ3A 3KLSA 4IALA 3A74A 3TMPB 1JB7A 1OEYA 4DBGA 4QL5A 5I4DA 2WLBA 4NW2A 3K8AA 3CQZB 3ML8A 1YQ4B 3GZNB 4ANXA 4ZLTF 1RODA 5BYRA 4DR1L 4DUYL 1SBBB 2Z0SA 1PDQA 2RMMA 1SSOA 1XMQQ 4WWMA 1KDCA 3M7NA 3RD4A 3U52E 4JI8L 2C35B 4ILWA 3KF6B 1Q7YC 2CQOA 2LGYA 4FXCA 2BH8A 4HSPA 4L1BA 4MHEA 1WYGA 2KFJA 1D7QA 4IUQA 4MELA 1VQ4A 1GJXA 4LJPB 1X6OA 2B39A 1J7AA 1KABA 2B63B 1DOYA 4HIDA 4LK1C 3A8IE 1N33L 2C60A 3IFDA 3M9BA 4YHHL 3ZRCA 1IBML 5AUIA 3QB3A 4BA2I 1E7UA 3OOCA 2VNUD 3H6NA 4GKJL 1NVID
chains in the Genus database with same CATH topology
1SNCA 3KK7A 2XSCA 2IDYA 1BCPF 4F88A 1F0ZA 1ENAA 1KRHA 2BE5D 1ZXHA 4OZCA 3ZJUA 1I7HA 1B53A 1EWYC 2ZW1A 2Z1CA 3QOJA 2JEAI 4QF4A 1PRTF 4RH6A 4K8JA 5ELDA 1CJEA 3B2FA 1SE2A 2L12A 2Z4IA 4J8QA 4K6DA 3NBIA 3DMUA 1B1ZA 2F3VA 2AQ1B 2W3RA 4GZYC 3URYA 1SXTA 4P16A 1QKZA 3IT6B 2MJDA 1TQOA 1MSGA 2IWHA 5I9OA 1LO5D 2H88B 1RHPA 3HOXB 5JEAH 1GPXA 3Q8AA 4IZ8A 3BS1A 1RYJA 1AWDA 1YN5A 1FXAA 2YYZA 5D7GA 2A68D 2H1EA 5A2QL 1TIID 3PUXA 4DK0A 2KQ4X 1BUIC 5IGGA 2L5TA 4AYBB 3GQBA 3BDCA 5HI1A 2F0TA 1K8OA 3P4PB 4BS9A 4CJ1B 3BK1A 1HUNA 1SE3A 1LACA 2O5JC 1XF5L 1JWMD 1PDXA 1WTQA 3EGRA 2WXRA 4XYOA 4OGQC 5FR3A 3Q0AA 3AE1B 1PTOH 2QILA 2F0NA 3MJ5A 1F2YA 4RWSC 2KCCA 3CIRB 4HKZE 3EROA 1PTOF 3PUZA 2PVOD 4XT1B 1L6VA 3P75A 2M00A 4X3KA 3CU7A 2NBFA 3VR4A 5BMIA 3HRDD 3I70A 3R8BA 3I90A 2JZPA 3AE2B 3DWMA 2EYOA 2K9XA 4WAFA 1HA5A 3VQIA 1BBXC 4RGOS 2BB6A 3T53B 5C4HA 1E6EB 1TT2A 1LT5D 2A6EC 2Q8TA 3S1MB 1F9SA 1NYQA 4XXEA 1E0BA 1A70A 1U4MA 1R7SA 3M4YA 5D14A 2BS3B 3AE8B 2JSVX 5KNCA 2IL8A 3HKZB 2B2VC 1K53A 2FBWB 3Q6SA 2NN6H 4LAAA 3W2DA 4PT5A 4C7YA 1H9SB 4C7ZA 3R93A 1U4LA 4QMGA 1SYDA 3R3OA 5CORA 2N55A 3A55A 1GOZA 3FPPA 2M56B 4IKGA 1GUOA 3GO5A 2N0SB 1EIGA 5HHDG 3QOLA 1ILQA 3MP9A 3I72A 1GUGA 3DEPA 2NUCA 5JEAG 1N5XA 4JWUC 1J7CA 2J52A 1XO3A 3KLSX 1RJTA 3S2DB 4UDUC 1UGJA 5JPNC 5CMDA 2R92B 4RGMA 2FUG1 1IGDA 4OW0A 3RPFC 3PUWA 2E6XA 3VYRA 2DYMA 5AUKA 3MXNA 1EY8A 2WXQA 3FMCA 1MI2A 3SEBA 3SK5A 1RD9D 4USAA 1HFNA 2O4XA 1BNZA 4YTMB 1PYWD 5I6YA 4YWGG 1FEHA 3NRZA 3D31A 5C4ZA 3NQTA 3NVZA 1G2SA 1S5CD 1VZ6A 5KYIA 1W6KA 5IOCA 3J7AV 2KVMA 2DNCA 2ICEC 3M85A 1FFVA 3N6RA 4MN3A 5EQ0A 3Q8EA 2WDVB 2K05A 1NSNS 2PTLA 1J9OA 2A74C 2JX5A 2E74C 2IJ0A 2Z4HA 5CV5A 2E2IB 2JWUA 3AE5B 1IHZA 3FC4A 3AMUA 2VB2X 2GB1A 2HDMA 2NN6I 1XCQL 1V1OA 1TS3A 2PW7A 3T51B 1QOFA 1EEID 5HGTA 2KHSA 2QKIC 3H6MA 1GB1A 4CGYB 2LS01 4XQJA 4U68A 1OQQA 4J1MA 2SEBD 1V8QA 1ZYRD 1CM9A 3MEHA 1ZDVA 5C2TB 1RFKA 4DQOC 3FILB 3L9AX 3K58A 1SB3C 1R9TB 1N5WA 5G3LD 4NAMA 1VR9A 1ROEA 4F8MA 2HCIA 5C5LA 4IFDH 1DD2A 1SJHD 2B2VA 1DZ1A 1XEEA 3HVZA 3H09A 3AEEB 1DOXA 2CHBD 5FKAC 1GHJA 2WXOA 1RKNA 4KJOA 3NZ3A 3AM9A 5LL6X 4J3OD 2W82A 2F0QA 1LTAD 5HURA 4TMAB 1A15A 1KTKA 1GUWA 2JEBI 4PMBA 3TEWA 3I73A 4JE3B 3N9YC 1VZ8A 4XQQA 5M3FB 4LTUA 1FIQA 1T5EA 2DNEA 1WD0A 2ID0A 3VR5A 2ZXRA 1OXVA 4KKTA 4KV6A 3MTSA 1PMRA 2EJMA 1L0VB 1JB3A 2HDLA 1ZDXA 1Y1VB 1JR0D 3RZOB 3I4NB 1N62A 3S14B 3HZXA 2E2HB 5DEHA 2LEKA 3NUHB 1TS5A 4FP5D 5EPKA 2W55A 4A3BB 3GTQB 5EKIA 1O7YA 3T56B 5FLXE 3AH7A 2N9KA 3KQ4A 5IT9E 3MXUA 3P1HA 2L1AA 1BQQT 1BO0A 1Q12A 4S3SA 1EQTA 4R3DA 2PO4A 2WXFA 3FKIB 3S17B 1Q90A 1RWSA 3K5OA 5C3XA 2BYTA 3NP8A 1QE6A 1LT3D 3A56A 4F87A 2V4DA 2AUJD 3G7LA 3IAYA 2PVGC 1II3A 2KOLA 4KY5A 1XCTL 4A90A 3PZ8A 4ZQ3A 1CQFA 4IUUA 1XTCD 2LMCB 5EKLA 1JQ4A 1ML0D 4ABNA 1K52A 3BYTB 2SAKA 1OQRA 1SJED 4A3DB 1R4PB 2WP8J 4FF3A 4C3JB 1JWSD 2NB0A 2MJ8A 1A3UA 3NQIA 4OO1H 2K28A 4WFN3 1YQ3B 2XVSA 1WXQA 3QO2A 2OEDA 5J1ZA 3U9SA 1PRTD 3GD7A 1FRRA 4ODGA 4E6IA 3N52A 3DEOA 4L6TB 2CW0C 2EXZA 3A7AB 4ULLA 3DWPA 5I6WA 3RFZB 4XQNA 4C1NK 1F9PA 1LTBD 2DBYA 3BYYB 1AP0A 1H9KA 1WTOA 5ELEA 1ET9A 5G3LF 1I6VC 1L6UA 2ENBA 1VRAB 4M1UB 2QDBA 2L0CA 2XWJB 3I3CA 3EQLC 2YEPF 4TKOB 3E6ZX 1BF4A 3PV0A 2K01A 2WINB 3KBXA 4IFDI 1C77A 4GLSC 5F2DA 2MJEA 1A3TA 3AV8A 4US9A 3OWEB 3E56A 4QUCA 2PNRC 2DLBA 4BA1I 2WU2B 1JW9D 1E2WA 1BMLC 2D2CC 4R9WA 2PZTA 1CA6A 2F1MA 4XT3B 5T8IA 3CHBD 2QCPX 4IUPA 4L23A 4CBVA 3P4QB 4F7XA 5FO9B 1AFPA 1IKMA 1HXYD 3L3OC 4ZUIA 3A8JE 3V05A 4K14A 4JPSA 4ZYSA 5KNDA 1BXTA 1T5XD 4YSYB 1B2TA 1P7EA 4A3GB 5CC4A 2VXWA 1EEFD 1EU3A 2K33A 3TBIB 3VR9B 4MT5A 3LYYA 1ICWA 3AE4B 1JQYD 4ZKCB 3K6OA 2BOSA 2L83A 1WTRA 4N6EB 3NWSA 2I07B 2AX5A 1OXUA 1GUNA 3GTKB 3VA5A 1JOKA 3J81E 4IN3A 1ZE3D 1E2VA 4R8NA 2HDEA 1HTPA 3AEFB 3TZDA 4KN7C 3JAML 4YTNB 3U7ZA 3VRBB 2KEEA 3MA2B 3AB9A 5H8YE 4RGNA 2OEOA 1TYGB 3CKIB 1WD1A 3GTPB 3PUVA 1Z47A 4NJCA 3OSOA 1WRIA 5JAVA 1F2RC 1EYDA 3DUZA 4H2AA 3UI3A 4A6QA 2EVBA 1DOLA 3BDLA 1E2ZA 3FEWX 5IT9L 3SVMA 4YXDB 1Q1BA 2E2JB 2BS4B 1D4BA 4K2KA 2KN4A 4AS1A 3HS0C 3MC0B 5CBAE 4YSZB 2G1EA 1CT1D 5JJZA 4KKJA 2G9DA 1NENB 2INPE 1KLUD 1ZP0B 1NUCA 1YNJC 1CHPD 3R2IA 1V1PB 2Q5WD 5C0XH 1DOMA 2WXMA 3NSWA 4FF1A 1UWXA 1FFUA 1HPCA 1MHXA 2A6HD 1DXMA 3I8ZA 4RA8A 4V0BA 4WRDA 4HR7B 2VZKB 1EU4A 4IUVA 1HTLD 3AEBB 2KA7A 1VDZA 1AYFA 3BK2A 2F0GA 1C4CA 2AQ3B 2Q8IB 2CJOA 1D2BA 1FRDA 4O42A 2QEJC 2K1BA 4HSVA 3TSSA 2KMMA 4KD3A 4ZAIA 2BB5A 1QOGA 3DM1A 2RPVA 5CV9A 3IT4B 3W9CB 4REZA 3D6WA 1DYQA 3HVDA 4O1NA 4RF1A 3ERQA 1ZPSA 1H9RA 4HAEA 5ISRA 1C78A 4XIGS 1I3QB 1PTOD 4ZOHC 4EVOA 2JU6X 5KRUA 4NZLB 1KDBA 4C3JG 4HKQA 1XLOA 2BT6A 3T16A 1XWEA 1QLBB 1F77A 3L4PA 1C8CA 1C76A 1STAA 5EPLA 3BWUD 1X3PA 1DGJA 1ZXIA 2WNMA 1K51A 1I4GA 1FNVA 1EYCA 3HGBA 1CZGA 4HTHA 3P4RB 3Q69A 2D62A 5C0XJ 5JVG3 4A3JB 1B9RA 1RTNA 4C3IB 1SF0A 2WXKA 3A7LA 1RTOA 4PV1C 1QOHA 2FFKB 2V3NA 4DGZA 1D5XC 3HOYB 3HEJA 4HROA 1CHQD 1K83B 5JOBA 2NYZD 2R6GA 1NR2A 1TWHB 2XIWA 4K6LA 2PIAA 3ABVB 1HZ5A 4Q0FA 1FGBD 5KNBA 2F0JA 2EJGC 1ZUD2 1N60A 1SYFA 4IQZA 4RNAA 5EGTA 2F3WA 4LLGM 1PZKD 1Z7TA 3KUPA 3WOFA 4KN4C 1EZ6A 2K32A 3X3NA 4LK0M 1F9RA 5EE3A 3GP7A 4B9WA 3SFEB 3GTLB 1OFFA 2WAQB 2B2UA 4JK1C 4UAIA 3OWFA 1TWFB 2KQ3A 1VCIA 4ZRPA 4PQXA 4CKBA 1WTVA 2QSDA 4ZRZA 3I91A 5CV8A 2DWQA 1FD7D 3FVQA 2PCFB 4QUFA 2E75C 2TSSA 3HUIA 2JE6I 2J53A 1HQRD 5IGBA 5FO8B 3HRZC 2OT2A 1ZOYB 1T3QA 4KY6A 2F0HA 1Q10A 5K36G 3RMHA 3Q22A 3AE6B 1FM0D 2Z8LA 2HCCA 1JWUD 3H91A 1S5ED 4CHTB 1Q1EA 2JYOA 2EY2A 3D6CA 3D3RA 4HRSA 2F0SA 3KF8A 3E5SA 5A35A 5KIXA 5M3MB 1FCLA 4OIKA 1BUVT 2NZ1D 1GHKA 1STGA 3W1SA 2B8GA 4CKEA 1STHA 2N9LA 3ZYYX 4K5VA 1YJJA 4OL7A 2PYKA 1VJKA 1FD6A 3PIP3 1SNPA 4KGRA 4OIJA 3AEDB 1FNUA 4XDXA 3H0GB 4WH4A 2WKCA 5NUCA 5C3JB 1O7LA 3P7JA 1VF5C 2KACA 1GXDC 1Y8PB 2WXNA 1FCCC 2Y5PA 2EYHA 3LB8C 4TSSA 5DAUA 1I4HA 5JEAJ 1IBXB 2EYFA 2PZUA 3Q24A 1WTWA 4A8XC 3MHZA 3J7YW 1G291 2IT1A 2ON8A 1FMAD 3NVVA 2EY5A 3J80E 1TU2B 1NI3A 3Q8BA 3D8GA 5CR3A 1B44D 2NTSA 1JOOA 3P42A 3VR8B 2SDFA 2H4OA 3VR3A 1IUEA 4BY7B 3RZDB 2BBCA 3NVYA 3S1QB 2MH7A 3KWLA 3KWVA 2JA5B 3FAHA 3J81L 3SXHA 4B9XA 3SR6A 5KYLA 2INNE 1AEXA 1KH0A 4LJZC 2B2TC 3T3OA 2JXTA 2LHEA 4WIPA 1P7FA 3FDTA 4ZUJA 3SK6A 2PW5A 4FF2A 4DAPA 2JA7B 3WDNA 1LTID 2SNMA 1MSHA 4G4KA 1CI3M 1JOQA 3HG9A 4YTPB 3EA6A 4H44C 5CV6A 5BN3A 2RSNA 5C6AA 3OIQA 1L0YB 4OZBA 4ZRQA 1FNWA 3T13A 4DA2A 4IFDG 1BCPC 2IGDA 5M9OA 1STBA 5I9PA 3FRPB 2JA6B 2C5CA 3T3NA 1TJEA 3DWQA 1KDAA 4HCSA 3NWTA 3NPPA 4BWGB 1XYIA 4HN7A 1N63A 1QOAA 3GTGB 2WDRB 5BN5A 3VA7A 1Y1WB 1SSNA 2BA0A 3IXSA 2H89B 1NEKB 2LY7A 2X6GA 3IAS1 4NKLA 1TY2A 3DHQA 5KEEA 2R7ZB 4ARCA 2WP9B 2PQEA 4H13C 2WU5B 3ZGZA 3MVVA 3GS2A 1DOIA 1L4DB 3K57A 2M0AA 4CJ2C 4HEDA 1LT6D 2MGSA 4QCLA 3MXPA 1B50A 2RDHA 4CJ0B 4KD4A 2NVXB 2F0DA 2PMZB 5C44B 1KLGD 4U673 2RQXA 4DAVA 4WQMA 2F0MA 3A8KE 2JP1A 3I57A 3ZQ4A 4A93B 2FHTA 1YMHE 1HUMA 4C1NI 4A3KB 1G2TA 1QNUA 1A6XA 2WXJA 1CFMA 1PXUA 1U4PA 2K3UA 4L63B 2EY1A 3QWNA 2RA4A 5C4JB 2BCOA 1AZPA 1O7ZA 2F0KA 3TDQA 1TVXA 2JSOA 1V97A 1F2RI 4FYDA 2I38A 1EY7A 1HCZA 1VMPA 4A55A 1DONA 2PMVA 5LHY1 1PZID 3F2UA 1NCVA 4FXKC 4OO1G 4KMUC 3Q8CA 4KHZA 3G6JB 1XX8A 4HMIA 5C4XB 2X6LA 1UEAB 1BR9A 4PMWA 3NK9A 2JXMB 3CRLC 4N59A 1SNQA 3TP6A 2EYPA 4KJNA 1GUSA 1ZEQX 1H9JA 3VRAB 4G7ZC 4EE2A 1D6EC 3D4RA 1HA6A 1EY4A 3JAME 3SFDB 2G9HD 3C3LA 5EPJA 3NE5B 3AU7A 4LMQD 2Y5CA 5T1IA 2WV6D 3RUZA 4GDLB 1KNEA 2A69C 2DY7A 5KGUA 1PFMA 2X69A 1LTGD 3BIID 3TZUA 1D5MC 2ZXOA 3MZ5A 4EGVA 2F0LA 4Q2JA 2AWNA 1VDVA 2KCNA 3M7GA 1L4ZB 1T6BX 1Y8NB 4RCOA 2WXLA 5CV4A 1ESFA 4XWWA 1WSPA 1RDPD 3SK4A 1E10A 2E2DC 4RF0A 3TP8A 3P4SB 4C80A 5I2XA 3BVGA 2M9VA 2R93B 1DCZA 1M4VA 3J7AF 4MM3B 1S5FD 2MEKA 4MACA 1JALA 3PIO3 1Q3LA 1I6HB 2XNAC 4RFBA 2SOBA 2ICIA 5GXGB 1L0XB 3MAQA 3AMZA 4B0MA 3NBHA 3OW7A 5IGCA 1Z6HA 2HTME 1B9MA 4L2YA 3K5NA 2WDQB 1DM0B 2FMMA 5AFWA 1ESRA 2RBMA 1E7PB 2K0PA 1GAQB 1I4QA 3V3XA 1YN3A 3C1FA 4G7OC 4GDKB 2BE5C 3P1MA 2M2LA 4IUTA 3B9JA 1V43A 3X3MA 3K59A 4K8IA 1BCPB 2D9UA 3VYUA 1O78A 1RCVD 3TN2A 2LJIA 1SNOA 1AW7A 3BZDB 3ONAB 2WACA 3MXGA 3VR6A 4YSXB 2CVRA 4C2MB 3E9SA 3PZ7A 4N58A 1ENFA 4Z9CB 2B76B 5E6JA 2F4IA 2A69D 4XTCS 1EM7A 2KDMA 1QWYA 2D5DA 4EQNA 1YNJD 2QIEB 5BYSA 4MH8A 1UAPA 1QQRA 3WOEA 2J4XA 1R4QB 3GTJB 1CZPA 1QILA 4R8IA 4FXGC 4NMZA 3HP3A 2L11A 5LL6S 5EBDA 2WXPA 2IX0A 2EKIA 2ZW0A 2WXHA 3J9CA 1IL8A 1K8MA 3SDZA 4DXFA 4M0WA 4KHVA 4V190 4NP5A 1SYBA 1JICA 1BOSA 1EOTA 1C48A 1AZQA 4KX6B 3ZJVA 2B2TA 4TRDA 4A9AA 4H0LC 3T4AC 1IYUA 4EQPA 3PO2B 1TKGA 4FNFA 4I65A 2RVLA 2YU9B 2J7ZA 3FILA 2MUYA 5BN4A 3MWYW 4FXDA 5IODA 1SFOB 3WCQA 5FO7B 5C3WA 3A54A 3HOUB 3S1NB 1PGAA 1HZ6A 2WXGA 3LX0A 4N9PA 3NUCA 3OMGA 2BS2B 2IW3A 1LLRD 3OPOA 1NAPA 1HHVA 5J39A 2YEPB 2F03A 2V4IB 5IGFA 1SEBD 1SAPA 1TZOA 2R61A 2HQEA 1Y69U 1LTSD 1U9RA 2LUMA 2F0EA 3AB5A 1NR4A 1MD2D 1VMCA 2EDGA 1O80A 1WTXA 4C3IG 4WURA 1BDOA 4KTAA 5JPMC 2V0GA 5FOBB 2KUMA 4ME5A 2ZT9C 4ZHOA 5C0XG 3K7AB 4D2KA 2B8FA 2KJXA 3EUB2 1F2MA 2VUMB 2CQAA 1IBXA 2J42A 1C4PA 3VYTA 2EOTA 2CW0D 4BBSB 1JWAD 1ONLA 1CA5A 3NXWA 1PTOB 2IPKD 4IOIE 3SK8A 4TQ1A 2W3SA 1ZYRC 2GA4B 3C8YA 1JCKB 2QMTA 5G5HA 3U4EG 3HOZB 1EYAA 1TS2A 3I9V1 4ZK9B 2L1BA 3TEYA 4DNRB 3TUOA 4TQUS 2WXIA 4JBWA 2FJ2A 2FE8A 4JWSC 4P6VF 4KGTA 3ITPA 2R3ZA 3BVMA 4JX1C 3VYSA 3W5VB 2QF7A 3MFYA 3MFGA 2JYEA 2EELA 3EVQA 5A2QE 3H3VC 2EJFC 4US8A 5C5MA 1RF2D 2WB1B 2JQRB 5BMGA 4IURA 1JORA 5EE1A 1JWBD 1FYCA 3C1EA 2A68C 1SDFA 4KKSA 1EIHA 2QJLA 5BYQA 2SNSA 2KAJA 1ILPA 3HOVB 1ZKOA 1B3AA 2WKDA 3OHXC 1J8IA 1V8CA 1LV9A 3Q8FA 1C9FA 2EPBA 4XWTA 1K50A 1H9SA 3AEGB 1PRTB 3PO3B 4DN4M 1PGBA 1HQMC 1PFNA 2LKVA 2OHFA 2K7VA 1B9NA 2L9HA 5D3IB 2BA1A 3GTOB 2EYLA 5IIFA 2B2UC 1OXXK 4RHRA 5CBEE 3K5LA 2NVTB 1SE4A 2EY6A 4I7ZC 3ND9A 5ELBA 4HJGE 3V96A 5K5PA 1IW7D 1HFGA 3V2TA 1ENCA 5K36H 2NTTA 4XDCA 1XLQA 1XLNA 1EFID 4PNYA 1S5BD 5M5XB 4A3IB 1C4AA 1QF6A 2EYJA 1HRJA 4PMCA 5E4XA 4FF4A 2CU3A 4YIJA 1IYVA 2LHDA 1G6ZA 3QG1A 1E0ZA 1JE4A 1WWTA 3SHLA 2K5WA 2RDGA 1DJRD 1NYRA 2XWBB 4WORA 1DOKA 2MHVA 4DF7A 2WQYB 2E3TA 1RM6C 4ID6A 1A3VA 4C3HB 3Q23A 1TR5A 1SYGA 3PMFA 1QG7A 1LTRD 1LT4D 3NVWA 4HMJA 4RKBA 4K2LA 3H8HA 1QNKA 1S4ZA 4FVMA 4ARIA 1GUTA 3ND8A 2A6HC 4YT0B 1H9MA 1KF6B 3OIPA 1G91A 3GV6A 1SIJA 2O2LD 5COYA 1STEA 4CKCA 1SMYD 2F0PA 5DM73 5BMHA 3NTIA 3AE9B 4DU9A 2W54A 3LNNA 3R2TA 2F0IA 1QCBD 4OHJA 1CQVA 4RKLA 2A5HA 2B2WA 5JXVA 3D4DA 2J0TD 4EQOA 1M8AA 3BVZA 4B08A 3UI2A 2PKOA 1AN8A 1OXTA 5E4WC 1STYA 2I46A 2NVYB 1TY0A 1VF7A 2F0VA 5LNK1 1PTOC 4M8AA 1KAAA 1WTPA 1XLPA 1I4PA 2PLPA 1PUTA 3PUYA 2BDNA 2EE1A 3S1RB 4KY7A 3BG3A 2NWGA 1JC7A 1LTTD 4KK7A 1W6JA 3K0YA 1E9MA 3SE0A 2XRQD 1CZWA 4DAYA 4HCEA 1EZ8A 1I4XA 4DXGA 4BBRB 5E3FA 5IGDA 1OXSC 1SYEA 2V3PA 4RHSA 1MBYA 2DY8A 1FR3A 2K04A 4G57A 5HG2A 4ZKBB 5M5WB 4ZHPA 1Y8OB 2KEDA 4K5WA 2N7JA 4X3TA 5H92C 1B4OA 3KLRA 4OO1I 1C4QA 1TS4A 4KKUA 2NN6G 3GTMB 1G8ZD 1VLBA 3DWGC 3IAM1 3TP7A 1YNTE 1S5DD 5C0XI 1UWMA 1EY6A 1Q8IA 2ONQA 2WS3B 4Y7NB 3D4WA 5D3DA 1MI0A 2DYOA 5MPOA 2A6ED 1EY9A 3OMCA 2Q8RE 3W3AA 4J6HA 1ZXTA 1PLFA 1D5ZC 1EQVA 3H94A 3O13A 5G5GA 1MGSA 1KFYB 4NAWB 4TQ0A 2F0FA 2I2YA 3QIAA 4DNTB 2L52A 2F0UA 2K5DA 4B0EA 3NHHA 1PRTC 1JMLA 3DXJC 2M19A 3ETRA 3TP5A 3GV3A 1Y56A 4K5XA 1KNAA 3EJIA 4A3EB 3W5UB 2E76C 4L8JA 4XDDA 2WIIB 5CV7A 2Y0SB 4H7BA 1EWCA 3I4LA 4X3UA 4G7HC 1YJIA 2AQ2B 5EE9A 3AN1A 2OXPA 1WVLA 1I50B 3L7ZC 1F2ZA 3GB1A 5CYUA 2L32A 1QT9A 3DWAA 4C56C 4HEA1 4A3MB 5E1FA 3AEAB 4AQ7A 3M4OB 3MHBA 1PZJD 1FXIA 2KWDA 3LXFA 2JA8B 1YNNC 1OO9B 1GB4A 3S16B 1CK1A 1MPEA 2EZVA 2NVQB 2HUGA 1QB5D 4KI0A 1STNA 4FO2A 1D1KA 1SNMA 1SYCA 1YNND 2RSOA 2LMCA 4C3HG 5DM63 1XXGA 3KBGA 3NTHA 1IKLA 4ITKA 1I4RA 1SMYC 1X3QA 1HEZE 2FMCA 3EFXD 3S15B 4X3SA 3TMEA 1IGCA 4OZAA 3U9OA 3SR1A 2IX1A 5FK9C 3IKJA 3B2GA 4OVZA 5C3EB 1TKYA 2RKSA 5I2YA 3J80L 2RDFA 2IGHA 4KGSA 2CJNA 2BW2A 3TEZA 1LABA 3PO0A 1YN4A 2IGGA 1TWCB 2B2WC 1A2UA 1PFBA 3NTKA 4BY1B 3HOWB 2F0OA 3AECB 1ET6A 4RGTA 1PFDA 2XN9C 2NMQA 1D1IA 2LFNA 1JRPA 3E0JA 2FINB 3LWUA 2X38A 3NS1A 3IFTA 3U2SC 2PW9A 2N88A 2JYTA 5T1GA 3P63A 2B2YA 4QB4A 1QOBA 2PPBC 2LGIA 2MP1A 3QJYA 5EKKA 3AE7B 3AE3B 2LFIA 2KECA 1F2LA 3FPUB 3VR2A 3CWIA 5EE0A 5ELFA 1J7BA 1V1PA 5IGEA 1FO4A 2OF1A 2O5IC 5EJWA 4DFAA 2AUKA 2K5QA 2EYMA 3M3YB 2VB3X 4XYQA 1BCPD 1EY0A 3S9WA 4RCNA 4IFDJ 2DN8A 4RAUC 4WJWA 1UNSA 1WCMB 1VZ7A 2ACZB 3TEXA 4IUNA 5ELCA 5DNFA 4N9TA 2K22A 1EY5A 1X32A 1A2TA 1EWHA 1PGXA 3C2PA 3P20A 2D5GA 2K6AA 1IW7C 3RLFA 1C79A 3C46A 1SNDA 5CGKA 2MJ3A 5HFYA 4DK1A 4CQNA 4KKIA 5JVH3 2MPMA 5EBCA 2A73B 4A3FB 3I4MB 2Y3AA 1UUPA 1QJOA 2BTEA 5D65A 4NDXA 1N61A 1F9QA 1JROA 1TKWB 2AWOA 2ZXPA 1EL0A 2GRIA 5J22A 3K5MA 5TSSA 1U4RA 3ZJTA 2F0WA 4MIUA 1L5PA 1MHHE 4XE0A 2L4NA 4P2CB 1WGKA 2GI9A