2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
2Z8LA 3BYYB 1JQYD 2QILA 1AN8A 3R2IA 3OWEB 1BCPD 1FNUA 1I4PA 1YN4A 3R8BA 1PTOF 3BVMA 2G9HD 3URYA 1B44D 4NZLB 1PTOH 4O1NA 4DXFA 1AW7A 2IJ0A 2TSSA 1PRTD 3BVZA 5TSSA 1T5XD 2IPKD 1EEID 1UUPA 5ELEA 1XTCD 3MFGA 1M4VA 2XRQD 3GP7A 2WV6D 4DXGA 1LLRD 1LT5D 1TS4A 4RH6A 1V1PA 2AQ1B 2NTSA 1DJRD 1ESFA 2AQ3B 1BCPC 1TS3A 5ELDA 5D3DA 1SEBD 1EU4A 1ET9A 2SEBD 1I4QA 1BCPB 1RD9D 3SEBA 1PTOB 1DYQA 1UNSA 4RGNA 3BYTB 1KTKA 1D5XC 1PRTC 1V1OA 3BZDB 1S5FD 5FK9C 1KLUD 1YN3A 5ELBA 4K6LA 1PRTB 4RFBA 1PTOD 1SXTA 1SJED 4ZYSA 1LT4D 2ICIA 3KLSX 1G8ZD 4OHJA 1CHQD 1ET6A 1JWMD 4TSSA 1S5ED 3DWAA 3V05A 1EWCA 1HTLD 2XN9C 1EEFD 1KLGD 1EU3A 1PZJD 2R61A 4RHSA 2CHBD 1I4RA 1JR0D 4UDUC 1S5CD 5ELCA 1S5DD 1EFID 1PTOC 2XNAC 3TSSA 1TS5A 1PZID 3R2TA 4RHRA 2QEJC 4L63B 1PZKD 3O13A 1LO5D 1SE2A 1F77A 5FKAC 1JWSD 1L0YB 1D6EC 3DWPA 4RGMA 1RF2D 1TS2A 1HQRD 1LT6D 1GOZA 1ENFA 1LTID 3EA6A 3EFXD 1JCKB 3DWQA 1D5ZC 1I4GA 1TY2A 2NTTA 4RGTA 1PYWD 1I4HA 1RCVD 1LTSD 1CT1D 1SBBB 1JWUD 1FD7D 1S5BD 2AQ2B 1D5MC 1QILA 3BVGA 3MC0B 1FNVA 1LTAD 1LTGD 1BCPF 1SJHD 1V1PB 1FNWA 1CQVA 1RDPD 1CK1A 1I4XA 5D3IB 1BXTA 4BWGB 1XXGA 2XRSD 4RCOA 1HXYD 1PRTF 1STEA 2RDGA 1LTTD 1SE3A 1MD2D 1LT3D 1L0XB 2RDHA 1LTRD 2O2LD 5ELFA 1LTBD 4L6TB 1FGBD 3CHBD 1HA5A 4Z9CB 1YN5A 1SE4A 4RGOS 5I4DA 1TY0A 3W2DA 1B1ZA 2J4XA 4C56C 1CHPD
chains in the Genus database with same CATH superfamily
2ZJRA 4FXCA 1JALA 4K81A 3OG5A 2YTYA 3ML9A 4C80A 2LGIA 4X3KA 2CQAA 3W5OA 2I07B 4LF5Q 4P72A 1YN4A 3BVMA 4WJ3M 1CKMA 5IGCA 2LXJA 5M3FH 3DVGY 1UWMA 4DUZL 3BS1A 2AWNA 1PRTD 4GLSC 2I5LX 2IHEA 2W3SA 2WACA 4OXPA 3OJ3A 4DPGA 4X3UA 4P74A 1ZDVA 1H9MA 2KBNA 2F3IA 1F2MA 1SFOH 5E4WC 1NI2A 3TP6A 2Z4HA 1TS4A 1VQ5A 4XWWA 3ALBA 2BH8A 1SGHA 1DJRD 5FLXL 2AQ3B 2BWES 1BCPC 5ELDA 2PTLA 4C3IG 4IJHA 1I4QA 3RMHA 2KFKA 3HOWH 1RL2A 2B2YC 5M3FB 5E6OA 2L4NA 4PV1C 4IZ8A 1WGYA 2L9HA 2FE8A 2KXJA 4XE0A 2GMIC 1PRTB 3PVLA 1OFFA 3HVZA 5G55A 1MJEA 1V1QA 1DOXA 2DN8A 3WWVA 4RMAA 4MT5A 1KOTA 5J17A 3OW2A 5D14A 1CHQD 2ONQA 2ZTEA 1YHBA 5J2RA 1FR3A 2YV5A 1I5FA 4JCVE 1QT9A 1JORA 1ZXIA 4KGSA 1GUTA 3W5VB 4DK3C 3HP3A 4DUYQ 2B39A 1Q81C 4JV5Q 3HGBA 4JBKA 4PNYA 3I7FA 2CHZA 1H8CA 2CHBD 2CR5A 1SDFA 1Y14B 4A3GG 4LUVA 3K80C 5LNK1 1PTOC 2VH2A 2M8SA 2KHJA 5E1FA 4A6QA 3HOXG 4W9GA 3A9JA 2UXCL 3BINA 3VYSA 3J80i 1F2RI 1NVID 2WYQA 3LXFA 4HLEA 1GJZA 3DVNV 4EZLA 4FF3A 4KDLB 2EJFC 3AE1B 3VR9B 2K14A 4GDLB 2A1AA 5IGDA 2M19A 2V4IB 2N9EB 1C48A 2WINB 4M1UB 4J1MA 3FILA 1SIFA 2N4FA 3VR4A 4DR6L 2OEDA 1TWAH 4HJKA 1Y8OB 3ZDMC 4QF4A 3J81E 4YCWA 1JWUD 1CKOA 4DNRB 5LLIA 2LEKA 4ILWA 1TWCB 4MH0E 2A69C 1Q3LA 3RZOH 1QNUA 3TP5A 4DNTB 3VR3A 2EY5A 5AJ3L 1FNVA 1PH4A 2ES2A 2LD9A 3AE9B 5AZHA 2L0CA 2K5QA 1P16A 2JZZA 4BBSH 2WXGA 3D8GA 3A74A 4QIWE 5D3IB 3TEHB 1IGCA 1GUAB 2NS5A 4PT5A 5DPRA 3N1XC 3NWSA 3MXPA 1Q8KA 4UAIA 2RDGA 4G7HC 1VQOA 4H44C 1UE5A 1Q90A 2D62A 2I5MX 1OQQA 1WGGA 2FCMA 3PF4A 4XZ4A 5FO9B 4JOIC 2IX0A 1TWAB 4WAAA 4PS8A 4HJGE 1DM0B 1SAPA 1WXMA 4KI0A 3Q3NC 4AQYL 2JA5B 1RFAA 4K7WA 3MHZA 3Q3OC 2IL8A 5E6JA 2KN5A 1TY0A 2MEKA 2UU7A 2EYJA 2RD0A 1VQHA 4KLKA 2J0TD 2Z8LA 2L7RA 3FKYA 4BBSB 1N60A 3OWFA 2A73B 4ZRZA 1S1QB 1L1OC 4QL5A 2M0AA 1RFKA 4RF0A 4IG7B 2BVCA 1SNDA 2YTXA 2F1MA 2KMMA 1AW7A 2TSSA 1B70B 3ZUNA 2PNRC 1VQ9A 1TYGB 3NK9A 5ELEA 5KHOA 1YJNA 4UPAA 4C3HG 3NQIA 2XRQD 1DOYA 1PV4A 2K52A 3UDGA 1HZ6A 4S17A 1JW9D 4X3TA 4NAWA 2ICEC 1SR3A 4BXXH 3PSEB 3AMZA 3ZJYC 5DPSA 3FPUB 2GBRA 1HTQA 3QX1A 2ZJQA 2MWSB 1ESFA 1STHA 2KEDA 5BN5A 2ZM6Q 2GRIA 3I5JC 1SEBD 4L23A 4DV2Q 5IT9E 5EBCA 1VJKA 3N9YC 3VUXA 3P20A 1HRJA 1SF0A 1NBFC 3P4SB 5IGBA 2Q2TA 3FMCA 2I1JA 2KO3A 3DUZA 4JE3B 3PS6A 1GKHA 2XIWA 4DU9A 1QUQB 3H3VH 3I57A 3VTUA 1J0GA 4CJ2C 1RWSA 2B29A 3CCJA 3GDEA 2LRWA 4WIPA 1IP9A 3QQ8B 2F0WA 4WORA 3HOUG 4JI0L 1JWMD 3F2DA 1B50A 2KJXA 1EY5A 4H7BA 1EYDA 1V8QA 1S5ED 1HTLD 2JSOA 4DUZQ 2G5DA 3I4MG 4BVUC 1QOHA 3TP7A 2R93G 2F4IA 4Y7NB 1VQKA 1L6UA 4UDUC 4QGUA 5G3LD 5E6NA 2E6XA 2KOXA 1KM7A 2IDYA 1TXYA 1TS5A 4HR7B 1ISNA 2GN5A 4JLCA 3GE3C 3JSVA 5C44G 4V190 1UGMA 1WXAA 2DENB 3JC66 2VUMG 2VH1A 2K6QA 2MHJA 4JI4L 2EY6A 4B9WA 2EXDA 2X69A 1J8IA 2KJHB 3NTHA 1RKNA 3H3VI 1UZXB 1XT9B 1K52A 4OL7A 4C3JH 1TKWB 2NVXH 3BY4B 3KH0A 3KWVA 1I4GA 1VDZA 2MP1A 1KIXA 1HFNA 1EZ8A 2OQ0A 1ONLA 1CSPA 3MXUA 1RCVD 4LTUA 4NQLB 1EFWA 1DZ1A 2KDEB 3A54A 1FD7D 3KBXA 3S1MB 3P63A 3BZKA 3CKIB 2AMCB 4EFOA 3W1BA 1BKBA 3UDFA 1BVSA 4A93G 1P7EA 4HDQA 1AE3A 3MC0B 1A5RA 3ETRA 3ZVVA 1T5EA 1YMHE 1T3QA 3GQBA 1YI2A 1XQQA 1CQVA 4A3IG 4OZCA 2XRSD 1B7YB 4RCOA 4C3JB 5FOBB 5IYBG 1JJGA 4JI2Q 1O7YA 3S1RB 2ZW1A 4WJ4A 4FLHA 3L17A 2K5WA 3OYYA 1I7HA 3S2DH 1WIAA 3E56A 2UXCQ 1H95A 5C2TB 2HD3A 3SK5A 2QMTA 1GB1A 3BK1A 2F4VL 2WXPA 1FFVA 1EQVA 1YX5B 1CHPD 4USAA 2NMQA 4ABNA 1AN8A 3F8TA 4DR6Q 2EIFA 2VB3X 1N63A 4ZRJA 1UWVA 1FXAA 2K39A 4EEWA 2WX1A 4CYEA 3PF5A 1PTOH 2NPTA 2VZKD 3S2DB 3S15H 2RMMA 1Q1OA 4A3DB 4R9WA 4RF1A 5TSSA 1YJIA 2F0VA 2IPKD 2JPHA 3ZJTA 1W6KA 1C76A 3UDIA 3I4NG 4AYBB 3STBD 2B63G 2EYMA 2NBUA 1WZ3A 3WCQA 4KKSA 4RH6A 4A3EH 4BY7G 4BBRG 1EYGA 5CTRC 2C35B 1TS3A 1SMYD 3ZYYX 2KTRA 2D3AA 3DBRB 2B2UA 2J7ZA 2KENA 5C5LA 4AQYQ 2CWPA 1PTOB 1V5TA 2CJNA 2NZOA 2RF4A 4NMZA 1Y56A 1RLFA 2KYWA 2W54A 1D5XC 5CX3A 5CGKA 2BF8B 2A69D 1VD2A 1K3BC 3R3OA 2ZXPA 4M02A 2MGSA 4BKGA 4OZAA 3ZJUA 5IA7A 4N8FA 2RDBC 2NBFA 4KV6A 4JPSA 4MDKE 2A6ED 1L0WA 4NNJB 2L8JA 2JSVX 3I3CA 5AUKA 1PGXA 3DHIC 1K53A 4B0MA 3N1YC 2AHOB 4C1NK 2JA7H 4OO1G 1U5KA 5DEHA 1V6EA 1RIPA 3WANA 3QWZB 1N61A 2CU1A 5C3EH 1MPEA 2DHZA 3BIID 5KHQA 4IPGA 5EKIA 3T1YL 4MGIE 4OZBA 4DHJD 4YTMB 1WE6A 4K14A 1I94L 1LABA 2Z9HA 1VZ8A 1SE2A 2BH2A 1XD3B 5CBAE 1NY4A 3PUYA 4AWJA 1RM6C 1YIWA 5F2DA 3RUIB 4RA8A 3CSFA 3RZFA 2QC8A 1YNJD 1RF2D 3PO0A 4WQMA 1HQRD 2M17A 2M4NA 1M1KC 3KUZA 4TMAB 1KDCA 2IO2B 4B3SQ 4M8AA 2BYTA 2DAFA 1II3A 2JA7B 3RD4A 4YTPB 2OHFA 5E7NA 1WH3A 1LQBA 2NBWB 1TKYA 4OVZA 4A3JG 2DBYA 3KYCD 4BKSD 3IG3A 4DHJB 4ALPA 5DAUA 3H94A 2A4ZA 3V6EB 4OVVA 2QEXA 2L55A 1BCPF 3RNEC 1Y1VH 4CKEA 1H9RA 4HCEA 1SNMA 4R4OA 1ZXHA 2PE9A 3EIVA 1T0SC 3CRLC 1SYEA 3MTSA 1ZPSA 2Q2UA 4MZ9A 1E0BA 2JA8G 1PDXA 5DCNA 4XYOA 2ZJDA 3NOBA 1TWGB 3RNCC 3U52E 1L2FA 1YNNC 3J81L 1PYSB 2JYEA 1RHPA 5JAVA 3J81i 1T9HA 2LI5A 4K0KL 2NZ1D 1SE4A 1PVOA 4JI4Q 1NTGA 2PZTA 4CO7A 3BYYB 1J7BA 4FHJA 1CQFA 1FD6A 1Y1VB 3MJWA 4DXAB 4ZUIA 1EF1A 4W9EA 5M5YH 3C0RB 1ICWA 1E2ZA 1JOQA 2ZPYA 2B3GA 4FHKA 1TVXA 4BFRA 1PTOF 3LWUA 2PVGC 4PG3A 1EM7A 2BTEA 2XSCA 4HIDA 4YSYB 3QAQA 3HZXA 1IHZA 1R4NB 4JIOU 1CM9A 3GTQB 2LGSA 1F2LA 1SYDA 3TREA 1LM0A 4XT3B 3HOZB 1D3ZA 2JN4A 1CUKA 2N49A 2N55A 2C7HA 4ZKCB 2MBBB 1N5WA 5M5YB 4KKJA 5H8YE 2FBWB 3OLMD 3M62B 1R4NI 2WHIA 2I2YA 2KACA 2H1EA 1RD9D 2IGGA 4L2YA 3TMEA 2Q8IB 4DR2Q 1VQNA 3TS2A 3VRAB 2K28A 1HNWQ 5FK9C 2F4VQ 2IY5B 3EECA 2DYMA 3T1HL 1FMAD 3W1SA 4FNFA 4ZCKA 1JB7A 1G91A 2N0SB 4WJNA 1WJ6A 1HNXL 1G8ZD 1NYRA 1JRPA 4ME3A 3DLLA 1WE7A 2WWZA 1HCZA 1Y8PB 1PFSA 3GO5A 5IN7A 1YJJA 5EE0A 1SNPA 3Q8EA 4C4VB 3H9DA 3I73A 5IT9L 1N34L 2DYOA 5C4XH 1MI0A 5IGFA 1XLOA 4NXNL 1E10A 4H0LC 5EKLA 4N9PA 3H1UA 2K5DA 2KLCA 1B3QA 1YX6B 3FILB 3NBIA 2R7ZB 2IYDB 1LO5D 3PRPB 2ZCCA 3HKZB 3EC8A 5FKAC 4XC2A 3RNFC 3RT3B 3NXWA 1IL2A 1HUMA 2KHIA 3EUB2 1X3EA 2HHHL 4IOAA 2D10A 4GNXC 1UGJA 4KJOA 2JRIB 3J80E 5GMVA 5IE8A 4BA2I 4LNIA 3P1HA 3LJ3A 1STNA 4KHPL 4DR1L 5C4XB 2IW3A 4U68A 3GB1A 4HROA 5DPWA 1TY2A 2RR9A 5IWAL 5M3FG 1RTOA 4MM3B 1L4ZB 3GTOH 2DNCA 3E9SA 4IUMB 1LUZA 5J22A 1QUQA 2PCFB 2DNEA 5C5MA 4NB3A 2EOTA 2PYKA 1KABA 3SK8A 1AFPA 1BO0A 5C0XH 1WF9A 2WDQB 4K7UA 4TQ1A 2NN6H 3LGJA 3K5NA 2VW9A 3IKJA 1A6XA 1A3TA 3L3OC 3QOLA 2E2JB 2F0EA 3RLFA 5IGGA 3APCA 1ASZA 2CW0C 1BT0A 4IC7B 5ISRA 1STEA 3AE5B 2UXDL 1GJXA 2E2HB 4YWKA 1LTRD 1B9NA 3I8ZA 2K5NA 1I94Q 1SROA 5EPLA 3GTOB 1SLJA 2C5CA 4P71A 1VCBA 4P7IA 2LUMA 4WJOA 1HPCA 3K5OA 1XTDA 4F1SA 3A4SC 2K7VA 2B2WA 1CA6A 3JAME 1XMQQ 1FM0D 3UDXA 2EYHA 3X3MA 2Q2IA 2BA0A 4EOYA 2HJ8A 5ELOA 2KCTA 1EIFA 1BUIC 4IW0A 2ZJPA 4NAWB 4RKBA 2CS4A 3M85A 2IO0B 4WJPA 1TT5B 1U4LA 3RNAC 3URYA 5C0XI 4NZLB 3UI2A 2NN6I 3X3NA 1I6HH 2MRPA 1NE3A 2MA9B 3RNGC 4AJYB 2LGDA 2B3AA 3OOCA 2GVAA 1UBIA 1MG4A 3SXHA 1R9TB 4ANXA 3K7UC 3ZRCA 4HWIB 4AOFA 5CORA 3QB3A 2BKRB 1V9PA 2DLBA 3AV8A 2KWDA 3CC4A 1GHKA 3DM3A 4HSPA 3T9LA 2GBMA 1IW7C 2JUOA 3ZNID 1BOSA 5K5PA 3NTIA 3T3OA 3ECIA 2OQKA 1R4MB 2IHFA 4GN5A 5LMUL 4X66L 4A9AA 4A3LH 3AH7A 2SEBD 1ZW7A 2FAZA 2ZVNA 4AUQC 4A90A 2C9OA 4K0KQ 2FMMA 2X6GA 1I6HB 1VLBA 3BYTB 2JWUA 2OJRA 2E2IH 3NZ3A 4JGHB 5C3XA 2O5IC 1K0SA 3OHXC 1TT2A 2BA1A 3V96A 1MFWA 3Q6SA 3ZTCA 1U0LA 1K8OA 2JA5G 1WRIA 2Q5WD 1DD2A 4ZHPA 3RZWC 2K01A 4XYCA 1V86A 4LF9Q 2AL6A 3NTKA 2WDVB 3PRMB 3M7GA 4RAUC 1ILQA 1X3QA 4BBSG 3KVFB 1HR0L 2XN9C 3AXCA 5K36H 2B2YA 3E3XA 2Z6KC 4JI6L 1YNND 3J9CA 5IOCA 3K5MA 4X64Q 1ZE3D 4WH4A 1U4RA 2FUG1 1Q1BA 1FVIA 1NENB 3HHMA 4HPMB 1EOTA 2MH7A 1NMFA 2ZPNA 2KUMA 3NP8A 1PFMA 4LNKA 4J8QA 3DWGC 3NQTA 3TL5A 2PEAA 4KX6B 2KWCA 1U4AA 4IWPA 3ITPA 4PQXA 4EQPA 1NDDA 2WXFA 3TCAA 2K6AA 1PH9A 3U30A 3SR1A 2OT2A 4N59A 1QKZA 2V9HA 3EA6A 4UP8A 4JQWC 2QHOA 2A74C 5FR3A 2PQEA 3T1HQ 3EFXD 4F8MA 1AEXA 4YHHL 4B08A 4XDXA 3NUCA 3GTKH 2NTTA 1TQOA 1HNXQ 1WY8A 2NZHA 1KRHA 2WKCA 3KJOA 1WJUA 1X1MA 3CQZH 1E8WA 1D5MC 4ME5A 1T0RC 2VB2X 1N36L 2MQJA 2Y5CA 5IYDH 1SB3C 2BYEA 2KOLA 4LF8Q 1LACA 3VYUA 3I63C 1WYWB 3ZQ4A 1N34Q 2X6LA 3FPPA 1QVCA 2WAQB 4KK7A 3T4AC 4TKNA 3RUZA 4NXNQ 2PZWA 1KHIA 4MGZE 4GSWA 3T51B 2NBVB 1WTQA 2BBCA 1L6VA 2B2VA 4CJ1B 4IUVA 2HIVA 4DFAA 4OX9L 3L13A 1TZOA 1K28A 1WI5A 2F0DA 5C4HA 2HHHQ 2BWFA 2WGSA 4HEA1 1E2WA 2KQ3A 4U673 1GUWA 1B1ZA 4NJ7A 4RGMA 4C56C 4A4IA 3AB9A 2C7MB 4KHPQ 4DR1Q 1Y8RC 4EGVA 4KHVA 2KDFB 2LJ5A 4G11A 2F3VA 1DOLA 5IWAQ 5BMIA 2JZ3B 3M95A 4WAFA 1DOKA 1C4QA 5CV7A 1YJ9A 3R8BA 1M90C 3ZDTA 1S72A 1Z2MA 3SVMA 1TR5A 3OSOA 1MHWC 4DXFA 3CXCA 3GTGH 2KTRB 4FBJB 1PLFA 2GOWA 1BF4A 2KN4A 1EY7A 2D2QA 3E0JA 1C0AA 3NSWA 3IAM1 1EQTA 3FAHA 3MP9A 4DHZE 2K1BA 4X3SA 1YVCA 4B3ML 2DY7A 1SN8A 3RLOA 2WDTB 4BAXA 2H88B 2PJHA 2YEPB 1VF7A 3V60A 1O7IA 1WCMH 5C3JB 4CKCA 2NTSA 5BN4A 2CU3A 2NVQH 4L8JA 3AE4B 3A8IE 3PV0A 4C3JG 3N6RA 5GAEC 2F03A 1STYA 2KC1A 2KVMA 2AEHA 4NJ6A 3VFKA 3GTGB 5G5HA 3VYTA 3KWLA 3R7QA 1VQJA 1EIHA 4MH8A 2WXRA 1IKLA 1JWAD 1UAPA 1FGUA 3MXGA 2IO3B 3KLSX 4A3FH 4GLXA 2A5HA 3AE2B 4NP5A 5IT9c 3QR8A 3H7SA 1OXUA 1F2YA 3KLRA 4A3BH 2LWPA 3V05A 2NVQB 1HTPA 1IXRA 2OF1A 3AYHB 3F2UA 1HHVA 4DK5A 5FJ8G 4FA6A 1QOBA 3CPFA 4A76A 2F0TA 3DVNU 1M94A 2A19A 1VZ7A 2ASQA 4K7SA 2BCOA 3ZTDA 3I4OA 4IOCA 2WXNA 1STGA 4JI7L 2XNAC 4A3DG 3I3TB 4ANUA 4ARCA 3EQLC 1WGRA 2N9XA 3SHQA 5A2QE 4R8IA 3CCMA 4GKJL 5IYCH 1N5XA 4A3FB 1KLVA 4PS7A 1RTNA 5LMUQ 4K8JA 4X66Q 1PH2A 4WURA 4AYBG 3DXJC 5BN3A 3DDCB 4LF4L 5M9OA 2JK8A 4C00A 2RDFA 5BMHA 1LT6D 2NYZD 1SFOB 3DWMA 1WFQA 4JBJA 1NSNS 2J52A 3PO2H 1FJGQ 2ZT9C 2L76A 3C46A 1JCKB 3A1QB 3UQAA 3OTOL 2LS01 1VQ7A 4L5QA 4NKLA 2I5HA 1KXLA 1XPOA 4GN3B 2N8NA 4YWMA 3HOWB 1VQ6A 2AQ2B 2FFKB 3QG1A 1TKGA 2IY0B 2L3ZA 3RCZA 1C9FA 1QOGA 4A3OA 3TN2A 4GKKQ 1HR0Q 1WGKA 1QILA 2ATWA 1E3PA 3CW2C 3VA7A 5BYRA 2AYOB 1VQMA 3VR6A 3QWNA 4JI6Q 1HTOA 1L7YA 4MGKE 4QCLA 1BXTA 2F0QA 1XXGA 1IYJB 4I65A 1VQLA 4IKGA 5CV8A 3J80L 4KZCA 5G2NA 1HXYD 3PO2B 1ZXTA 3A7AB 4DKAC 1IYVA 1BBUA 4C4VA 1MJCA 1E22A 4PMCA 3TBLD 4H13C 1XLNA 4OIJA 3NJTA 2EYPA 1X6OA 3RZDH 5CHWA 2ASBA 2D11A 2WFWA 2RSUA 3DHGC 3TEYA 4G7OC 1HA5A 3CF6E 3U9SA 4US9A 1T0QC 4ZAIA 4W9KA 2BB5A 3W2DA 3KUPA 4ZK9B 1V5OA 4O0AA 1Q12A 4MJSB 4HDOA 4LF6L 3K9PB 2LXKA 4A3MH 1EO6A 2YEPF 4JI3L 3MHSD 4POFA 1D4BA 3B6YA 2KJRA 2KA7A 5IODA 2EJMA 1E7UA 5MPOA 5DM73 2RKSA 2WXIA 4I6LB 5JJZA 1F2ZA 4P1BC 1XMOL 1IBML 3Q24A 2JA7G 1JT8A 1N36Q 3RZDB 2UUAL 2N7JA 4ITKA 4MM3A 3K81C 1O80A 3DEOA 3EFCA 5EPJA 3SD5A 4CJ0B 2F0OA 4LJZC 1F9PA 1KFYB 1LLRD 1LT5D 3A8JE 2JEAI 3NS1A 4A3MB 4WQOB 3M63B 3JAML 4KVGB 3KDFB 4RCNA 3JAMi 2JF5A 4HIOA 3RZOB 1E7ZA 1T6BX 1MHHE 2PW9A 1ZYRC 2JYTA 1V97A 3RR5A 5D65A 1XNQL 1Z5SB 1NJIC 3QARA 4CDFC 4OX9Q 4OELB 1NBWA 5KYLA 4IDIA 1XPUA 1UNSA 2FCQA 2L12A 2VL6A 3A7LA 3ZW3A 1GPXA 4HPPA 4TV3A 1B9RA 1SXTA 4MSQB 1S40A 4XX5A 3JVZX 5EE9A 4FDBA 4LLGM 2N9PC 3UINB 2J53A 3CD6A 2LXAA 4AP4C 4OHJA 1VQ8A 2KCCA 2JYOA 4DAYB 2K6DB 1Y1VG 5HGQA 1AZQA 1GC6A 1JROA 2WXLA 4FO2A 1V80A 1EEFD 2WQYB 1Y1WH 5G5GA 4IFDJ 1MSGA 1EL0A 1OXVA 1D8LA 4XTCS 2SAKA 4KN4C 1B2TA 1Q7YC 1O78A 3VQIA 2K9XA 1S5DD 2HJ1A 2FXQA 2VZAA 3NEMA 4B3MQ 1EIYB 4PMBA 4W9LA 4A8XC 1XEEA 1S3SG 2Y3AA 4GN1A 3HKSA 5NUCA 2K33A 5LMNL 4KY7A 5J1ZA 4JBMA 1GNUA 1V8CA 4D2KA 4C7YA 5CYUA 3HOZG 2A5UA 1GO3E 3A56A 2YYZA 3M9BA 2D0PA 1Z7TA 5CC4A 3GTJH 2KHWB 4B3RL 4S3SA 1ZKHA 1GD7A 1E0ZA 4IOIE 1ENFA 1LTID 1YJWA 4DF7A 4JPBW 1LYLA 3D32A 3LX0A 1B4OA 3U4EG 3CF5A 5E4XA 3H8HA 1WD0A 4RGTA 2BDOA 4L5SA 3KBGA 3L0OA 2NVTH 2PI2E 4AYBE 2MNAA 3HOYH 2E3TA 3K5LA 1FFUA 1XF5L 2BB6A 1NCVA 4MEMA 2EELA 2IO1B 4UY8C 3AEEB 4MGYE 2OWOA 3P4RB 3CCQA 2DZMA 5M3MH 1VRAB 1K8MA 4E74A 2K50A 1GUOA 5BR8L 3KQ4A 4JK1C 1PGBA 1IGDA 2MPMA 3LWEA 2NVTB 1OTCA 4L6TB 3Q8DA 3M4PA 4B95A 4CHKA 4LF4Q 3HOYB 1PFBA 4RGOS 2KAJA 4KKIA 2R7ZG 2Y0SB 3WDNA 2G4SA 4FADA 3HKZG 2UWQA 4C7ZA 1VQIA 1UEAB 2C7NB 5DLQE 2G1EA 2KECA 2OCEA 4QIWB 3BK2A 1JB3A 3OTOQ 3IXSA 4P1CC 2FCNA 3K0YA 1WTOA 3R2IA 3U7ZA 5JEAH 2UUBL 4ICUA 1BCPD 5JHAA 2EJGC 5JHBA 5JJKA 2G9HD 2K5PA 3M4OH 4ZKBB 2WB1B 1GXDC 4DK6C 3U4VA 3SHLA 5COYA 4NPNA 3B2GA 2NVXB 4M00A 2MUYA 1J9OA 4HN7A 1Y8NB 4RG1A 1G6PA 3AN1A 3CP0A 4PK1A 1ROEA 2RBMA 4F88A 2WV6D 4TQUS 3U4ZA 1WYDA 4P73A 3B2FA 2E76C 2D2CC 2D07B 1HZ5A 3HRDD 2AQ1B 2QIEB 3ZO5B 1KQSA 4L5RC 1G6JA 3KYDD 3MZ5A 2IBIB 1BCPB 3KOJA 4K3BA 3PUVA 3M4OB 2B2TA 1K8AC 2KK8A 3JW0X 4KKTA 5C0XJ 2BW2A 1EWHA 4XDCA 2VQEL 4DR5L 2DUDA 4RM9A 1PTOD 4LF6Q 4FP5D 3OMCA 4JYAL 4JI3Q 1LXDA 3GE8C 3RN9C 1WR1A 3DCGA 4X62L 2L52A 4ANWA 4BBNC 3R93A 4WFN3 2O4XA 2INCC 5AJ3Q 4C3IH 4IUPA 1CFMA 2QA4A 2UXBL 1SYFA 2KNBA 5FLXc 1XMOQ 4O2DA 1IBMQ 5E6PA 3DBHI 4HVBA 3E0EA 2XEWA 2KX3A 3KLWA 3CWIA 5FO8B 2ZTDA 5I2XA 2YLMA 4BOSC 1E8ZA 1S5CD 2IWHA 2JX5A 1VMPA 5D6JB 5BYQA 4RWSC 4FF1A 2L83A 4GOPC 3C3LA 4K3CA 1EQRA 3L0WB 1BBXC 3S15B 2PE6B 4ZRQA 4XT1B 4LNFA 2E2DC 4II3B 3HFZB 4HPLB 1XNQQ 3P7JA 4R8NA 1FXIA 3QHTA 5BYSA 2TMPA 5C3WA 2WLBA 2I0QA 4AJWA 4A3GH 3WA0A 1YQ4B 2CH4A 2HDMA 4MN3A 4BY1G 2PZUA 1D5ZC 4A3EB 2GB1A 2OEOA 2GI9A 4JL9A 3HOXH 4RNAA 1PYWD 2L1BA 2PPBC 3U58A 4DV4L 2YVCA 3VVWB 1I50H 4URKA 3V62A 5KNBA 5A2QL 1QG7A 3P42A 1SNCA 1G6ZA 3J80c 2M00A 1DCZA 3Q8CA 4PYZA 1UELA 3UIOB 2XBBC 5LXHA 4GNXA 1V1PB 3KK7A 2KQ4X 3U7DA 3TP8A 2VQFL 2KVRA 3VR2A 1C7YA 3PO3H 5IP7H 4A3LG 2RPVA 3HM3A 4G0NB 3QIJA 2JU6X 2O6VB 2ALYB 4WJQA 4GS3A 5LMNQ 2O2LD 1K8RB 2QF7A 1IBKL 3BU2A 5HGTA 2R3ZA 4ZRIA 1ML0D 1HZBA 1YHAA 3N32A 5C23A 4IM3A 4HJ7A 4B3RQ 1L0VB 1Z9FA 3AECB 2L0FA 5C3EB 4HTHA 4JI0Q 3D4WA 1X3FA 4IJLA 4IPCA 4RKLA 5D2MB 4EE2A 2OXPA 4ZUJA 4WWMA 3FEWX 2N88A 1CZGA 3PO3B 3AEGB 3PREA 3OWEB 4REZA 1I4PA 1L1OB 2H5XA 3A1QA 1JMLA 4N9TA 4O1NA 3AU4A 1YNTE 1MIUA 3BVZA 4EQOA 1C4PA 3U2SC 1ICFB 1HZCA 1YZ6A 3VYRA 2GA4B 4WRDA 1A0IA 4HEDA 1T0YA 4W9DA 2H89B 3IT4B 3OIPA 2OTJA 3L08A 3L4PA 3N1ZC 3PSIA 4IFDH 5J3BA 5BR8Q 2DZIA 3NWTA 4DV0L 4QAYA 2AUJD 1F9SA 1NUCA 2JWZA 1C8CA 1RJTA 1F9RA 1EU4A 3LNNA 1PUTA 3Q8BA 5EJWA 3CCVA 3W3AA 4DAPA 3DQVA 4KSKC 1F9JA 4LDTD 3UF8A 3BZDB 2ZEQA 4ZYNA 1IZ6A 3K58A 1MVKA 2KHSA 1EWYC 2MJDA 4ZYSA 4GOCA 4AS1A 1M8AA 4HJ8A 1C1YB 5IYDG 1PHJA 2UUBQ 4MJSA 3TUOA 4TKOB 2QGQA 3FHWA 1CTMA 5T1IA 2PMZB 2XWBB 3OPOA 3AE6B 3ENEA 4JW0A 1NEKB 1NYQA 4XDDA 5HURA 1EU3A 1B8AA 3Q0AA 2E75C 1SYCA 4RHSA 3PLUA 2Z6BA 4LDTB 2HCCA 4EQNA 5M5WH 3HOUH 4IFDI 2BPSA 3APDA 2KDIA 4RHRA 2F0UA 3Q2AC 3T8MA 2IT1A 4IWQA 4W9IA 4OVUA 1JWSD 4KTAA 1C4AA 2Z0SA 2K32A 3DWPA 3PUWA 2E74C 2YTVA 2R93H 2BYVE 2JRHA 2V3NA 4HAEA 3KDFA 5CV9A 1TS2A 2F0FA 3K9OB 1STBA 2NUCA 1SE8A 2Z6KA 2VQEQ 4DR5Q 2KD0A 2A68C 2SNMA 1WX9A 2C5LC 1VQAA 3KFUA 4X62Q 5C44H 3SK4A 5M5WB 4OEMB 1CA5A 2C60A 2N7DA 4GN4B 2NVYH 3S1NH 4R4QA 1GHJA 4HMIA 1SYBA 1XCQL 2V1YA 2ZW0A 4GMVA 4YT0B 3F2BA 4YTNB 3S14H 2ID0A 2DX5B 4E6IA 2KKCA 3O65B 1ZDXA 2ZNVC 1BUVT 4LWCA 5JJIA 1N32L 4DAYA 1OXTA 1FL0A 4ASWC 2KT7A 3CAMA 2EKIA 3W1GA 1LTTD 4KGTA 2PW7A 1IKMA 2R2QA 1FCCC 3IVFA 4NQKE 1OO9B 3K6OA 5ELFA 4A93H 1ZOYB 2F0SA 4HJ9A 3L9AX 2CKHB 2OJWA 4LUZA 2L0TA 1WRDB 3J7AF 2D0OA 4A3IH 2N78A 2Q8TA 4A3FG 3S14B 2J4XA 3Q6BA 2V4DA 4NY0A 1W3SA 2L1AA 3BDLA 3SDLC 3HIZA 3S17H 3AEBB 2HDEA 2HIXA 4R4IA 4XXEA 4GGQA 4BKSA 1Q1EA 4P75A 5GROA 3Q3MC 1WTRA 1K3RA 3P2BA 2V4LA 5IY0A 1B44D 1JOOA 4LNOA 3A8KE 3S1QH 2N1VA 2Q2HA 4QQBX 3ZXVA 3ULJA 4J3OD 1BR9A 4W9FA 5ELNA 3NS8A 1QZEA 3HOWG 3T1YQ 1J7CA 1PFDA 1EEID 5CV4A 1A8VA 5IYCG 1JJ2A 1K0RA 1X55A 1I42A 1WI0A 2MP2B 3S17B 2D9UA 3SDZA 5AZFA 2C9WB 4DQOC 1QJOA 1JRUA 2EE1A 1QF6A 2LKVA 5HHDG 5EAYA 4CQNA 1Y69U 3PO2G 4C1NI 1SIJA 3M4YA 3ZRFA 2XTIA 3MC8A 2LRUA 3S1QB 3EHVA 4Q2JA 4IUQA 1PRTC 4YWGG 4UP7A 1GUNA 3I4NH 4LCDE 1Q10A 2PQAA 3ML8A 3PUXA 1I3QH 2K05A 3H0GH 4Q5VA 2ZZPB 3PHXB 1R4PB 3VTWA 3PGZA 1LM8B 5FO7B 4JG2A 4YY3L 1KAAA 3KUCB 1HZ9A 3QJZA 2IZVB 3QOJA 4RMFA 1PA6A 3U9OA 1K51A 3J7ZC 3H15A 4YSXB 3C1EA 1QE6A 4US8A 4WWNA 3LYYA 4IUTA 3Q23A 1TJEA 3W1YA 3TS0A 1E8YA 2HTME 4EVOA 3ZIMA 1I3QB 3H0GB 1SNQA 3PZ8A 4YIJA 2LHDA 3UGBB 4E3CA 3IRBA 1X3PA 4DV0Q 3DBLB 3H7PB 4JI8L 2WS3B 3QJYA 3H6NA 1A62A 1D6EC 4A3MG 5EBDA 1R7SA 4DWFA 3NBHB 4MHEA 3RNUA 3U50C 4OO1H 3MTNB 2XVSA 1Q82C 4MTNA 2CVRA 2MLBA 2MFIA 4JI1L 3P75A 1D1KA 2WNMA 3DBLI 4QUFA 1QZGA 3AQQA 1WD1A 1UF0A 3X23A 4G7ZC 3R7RA 3D6WA 4R4CA 5KGUA 1KNEA 3H09A 2F0IA 4OWWB 2HTHA 3A33B 2KWVB 4M8MA 4Q0FA 3M3YH 2D5DA 4LK1C 2NWGA 5H1SE 5FLMH 4KV2A 4XQNA 1G2SA 3GTLH 2E2IB 1XYIA 2PIAA 2LHEA 1TIFA 1Q0WB 3HOVH 1R4QB 1A3UA 3CIRB 1X54A 4HSVA 3NHEB 1SJHD 3IFTA 2RPQA 3I9V1 1GG3A 2F3WA 1IL8A 1J6QA 1HZAA 5HY6A 5I2YA 3VDZA 1ZP0B 3HEJA 4I7AA 1GUSA 1O7ZA 3RULA 1EYCA 3M3JA 4POGA 4DR4L 1IPGA 1CI3M 2L05A 1HEZE 3RPFC 3PZ7A 4HCPB 4TUUA 3GTMH 3M3YB 2BGFA 1FGBD 5EKKA 4OO1I 4Y52H 1LTLA 2FIDA 5KRUA 3IBEA 4K2LA 1XLPA 2KC2A 2R7DA 3GTLB 2MJEA 4GZYC 3K7AH 1AE2A 3H91A 3ONAB 3HOVB 1HUNA 1CMXB 2N9KA 4HKZE 4PS3A 3S2AA 3NHHA 1UE7A 1JMCA 3WIMA 2JA8H 1E24A 2IX1A 1A15A 3D0FA 2GLSA 4JVZA 4BXXG 3WOEA 5CMDA 1ASYA 2LJIA 2WX0A 3TIXA 1QWYA 4P6VF 2PW5A 4A3CH 1XNRL 2JQOA 1N33L 1FRRA 3J81c 3I91A 1HH2P 2INDC 1GVPA 3A5ZB 3GTKB 3IT6B 3RNBC 1I6VC 2RSNA 4K1RB 3A5UA 3WAOA 3F1ZA 1F9QA 4FJYA 1G51A 2M56B 1KNAA 5EDSA 4DR3L 1WX7A 3CQZB 1WTVA 3ONSA 1DOMA 1V1PA 4CDDC 2RHSB 2CKZB 2FJ2A 2VXWA 2F52A 1VR9A 1WX8A 3MFYA 5CBEE 1RAXA 1VDVA 3SEBA 3VXWA 2O6VA 1EUVB 3HUIA 5LHY1 3AE8B 4A75A 1XO3A 2KMAA 4JOIA 2ON8A 4RFBA 3GV6A 1X3GA 2AWTA 1LT4D 2ICIA 3C8YA 1AWDA 2V1CC 2XK5B 2Y0SG 1J5EL 3UI3A 4I6PA 1L4DB 5AUIA 2H4OA 3DWAA 1HJPA 1E7VA 3G4SA 4LNNA 3ICEA 2EQSA 4FF4A 1PZJD 1WR6E 3CC7A 2KQ7A 2KX0A 1MSHA 2WIIB 2Z4IA 4OONA 1L1OA 2F0NA 2UXDQ 5HG2A 2ZXOA 4LF7L 3AFPA 4ZRKA 4HRSA 2WB1G 1XX8A 1OGWA 2MBEA 3T3NA 2M0XA 2ZCBA 2CH4W 4R1JA 1W2BA 2JXXA 3K8AA 4CGYB 4L63B 3L54A 5L95C 1JJCB 5JEAJ 3S16H 2L5TA 1ZUD2 2LFIA 2LVPA 4KIKB 3CCLA 4JC0A 4TQ0A 1B9MA 2GBKA 4NW2A 3PLVA 2RCFA 1EY0A 4K6DA 5KNCA 3KYHC 2UU9L 4GXBA 2Q8RE 2CW0D 2KCMA 2V3SA 3PRZA 4GNXB 3Q8AA 1WCMB 1CZWA 3BG3A 4O42A 3EN2A 3VHTC 4YY3Q 1DXMA 4E71A 2OTLA 2W3RA 3S16B 1P9DU 4KY6A 1V9JA 2HUGA 1TWHH 3KF8A 5EE3A 5HI1A 3PCOB 2ZVOA 4ZDVA 2DJGC 2JT4B 1I4XA 3HK0A 4KSLC 1WZ0A 2JXTA 4APVA 2CCZA 3RD2A 1GUGA 4A3BB 4W9JA 4ODGA 1P7FA 5TR5A 4BS9A 4N9F4 1PYBA 3PGEA 2A6HC 2JE6I 5GAGC 2KCNA 4JI8Q 2FIFA 3Q14C 2G45B 2IGDA 4JBWA 5I4DA 3AI5A 4S0RA 3NRZA 2PO4A 1TWHB 2RQXA 4N58A 2K1FA 2D3CA 1V43A 5IOIA 4JI1Q 4ACFA 1U4MA 2K22A 2WXHA 3VR8B 1IW7D 3TEWA 4ID6A 4DK0A 1TU2B 1V81A 3FVQA 1C77A 3DOWA 2Z1CA 4ZRPA 1D1IA 4BA1I 1ESRA 4HCNB 4M0WB 4A3EG 1X56A 1YEZA 2HD5B 1AH9A 2A8VA 3J7AV 3EGRA 3ZJVA 2MBOA 3DHHC 3MEFA 5BMGA 4K8IA 1EY8A 1UUPA 5I9PA 2N1WA 5D7GA 5FR6A 1XTCD 1YJ1A 3CCUA 4X6AH 2HQLA 5E3FA 4DXGA 3AFQA 5IGEA 2MX2A 1BNZA 3OMGA 1OEYJ 3F2CA 5J18A 4DR4Q 3EFUA 4YSZB 1K8GA 4IQZA 4HIMA 3WALA 3JYUA 1VMCA 3DHQA 4YCUA 2INNE 1ET9A 4JI2L 2D3BA 2NR2A 4YHHQ 2WXKA 3FRPB 3DPDA 1NAPA 2KEEA 4ZOHC 1TWCH 2KDMA 1YD8U 1S5FD 5ELBA 1VQCA 3VRBB 2CQOA 4FXKC 3N52A 3QIAA 2W82A 1WMHA 1IYFA 1MI2A 4ANVA 2IY1B 3V3XA 4DHZB 3T56B 5JXVA 3STBC 3ND9A 3SR6A 1KDAA 1JWBD 1PQSA 4OGQC 5C3EG 3PV1A 1QOFA 2PLPA 1KAWA 2KJ6A 3HM6X 2J7QB 3CRKC 2HT1A 3C19A 1XNRQ 1SMYC 1BBWA 1EWCA 3VDYA 1UBQA 1N33Q 1YITA 1PGAA 1ILPA 3PO3G 4HK2A 5C4ZA 5IP7G 2EY2A 1FYCA 1X9NA 2B2VC 4MELA 1L2NA 3KLSA 2JA5H 3D4RA 3B08A 4BBNF 3PQIA 3PHWB 5CV6A 4QUCA 2Y0SE 3FKIH 2FMCA 4L5TA 3OIQA 4DR3Q 4N6EB 3U8ZA 4B3TL 2QEJC 3V61A 1PH5A 1PDQA 2R2OA 2EMTA 1XWEA 5LXIB 2K5HA 1X32A 1F0ZA 1L0YB 4UHVA 1TGZB 2A6EC 1IBXB 3MC9A 4MNOA 4DBGA 2MP2A 2JA9A 4PMWA 1Q8IA 4DV6L 2WB1E 5KIXA 2K3UA 2WXOA 1VCIA 2QKIC 4HCSA 2G9DA 4MSMB 1NR4A 1S3OA 2JA6H 2K4KA 2CHWA 3FKIB 4B9XA 4GOPA 2Z59B 1SBBB 3L7ZC 3KW5B 1PH8A 1WFYA 3S24A 4CKBA 1J5EQ 3ER0A 1N62A 2K0PA 1KH0A 4J6IA 4LAAA 3BJUA 4B0EA 2RA4A 5A35A 2Z0EB 2PPHA 1SSOA 1YNJC 1AYFA 4PZ6A 4ULLA 4IFDG 3AE7B 1EY4A 1RDPD 4LF7Q 2DZKA 2BKFA 1Q46A 1JQ4A 2BOSA 2BE5C 3KF6A 2R6GA 1VF5C 1PRTF 5GQOA 4YXDB 1WXVA 1C3TA 3VH4B 1LT3D 3ZGZA 3RYTA 2X38A 2J0JA 2LMCB 2JA6B 2WP9B 3AEAB 3S2HH 1ENAA 4BKTA 1Y1WB 1AZPA 4LJPB 3CHBD 3AU5A 1WWTA 5HKHA 2ACZB 3QC8B 1HA6A 2BYFA 3H7PA 3CCEA 2UU9Q 3V2TA 1QZHA 1ZGUB 4A3KH 1H4RA 1E1TA 2LVQA 5EQ0A 2QILA 4Y7NH 3NBHA 2JQRB 2RVLA 3A55A 2FCSA 4JI5L 1WXSA 4B3SL 1H9SB 3T13A 3GTJB 3PTFC 1WJNA 2DGYA 3MXNB 5IP9H 3AEVA 1D2BA 1E8XA 2D3GA 1GM5A 4V0BA 3S2HB 2WDRB 1U4PA 1WTPA 3DVGX 1A2TA 4JI7Q 3B1LX 2HQEA 2F0HA 4R4TA 1WM2A 4NAMA 2GBJA 1YNXA 4GKJQ 1E9MA 1J8CA 3SFDB 1M4VA 4DV7L 3PIO3 1VQPA 2PQAB 2D5GA 2DYBA 3L10B 4GDKB 2WKDA 4A3KB 2MJ3A 2REXA 3ULPA 4K2KA 4KN7C 3KUDB 1KDBA 1WGDA 1LFDA 3MJ5A 1KC8C 2DJFC 2LASA 3NVZA 5D3DA 4LJOB 4K5WA 3TZDA 2R92H 1OXXK 3S1MH 1G2TA 2MO1A 3MA2B 2RHQB 5M3MB 3IAYA 4LFBL 4IUUA 3BWUD 3A4RA 4TVAB 4AQ7A 2FUHB 5C4XG 3VAWA 1P0RA 5KEEA 3RN2A 1UH6A 2F0MA 1CKNB 2K8HA 2M1MA 5JH5C 3HG9A 3R66C 4EX5A 4TSSA 4XGAB 3S1RH 3DMUA 1QQRA 3CU7A 2O2VB 3GV3A 2UYZB 2A6HD 4MIUA 2R92B 1MBYA 1PMRA 2LFNA 3GTPH 2AL3A 5D94A 2I1KA 4G50A 5L83A 4IURA 3PUZA 2L32A 2EY1A 1PH1A 5JPMC 2J0KA 3T16A 3OAWA 5DM63 3NY5A 3O13A 3NE5B 3W5UB 4ZLTF 1F77A 1E5WA 3DBHB 5FJ8H 2RSOA 4I6NB 1VS0A 1HFGA 1KL9A 1MJDA 1D7QA 4F87A 1F52A 3EJIA 5C0XG 1B53A 2NN6G 3SK6A 4QMGA 4A3DH 3TEXA 1YHQA 3GTPB 4EUTA 2NB0A 3E9IA 1E90A 4DR2L 2KANA 2AUKA 1HNWL 1DGJA 4LUOA 2MBHA 3CC2A 2UUAQ 2EKEC 1SNOA 1YOVB 1P8LA 2GBNA 1CT1D 5J39A 3ULLA 1IYUA 1S5BD 4KKUA 4K5VA 2WU5B 4GU2A 5CHFA 1MG8A 1P3QU 5KYIA 1WXQA 2XK5A 1KRSA 1EY9A 2HDLA 1N6ZA 1P1AA 3WAPA 2CJOA 2BS3B 3APFA 1FO4A 4J6HA 4UP9A 4EKUA 3D3RA 2PNHA 4N8X1 3G71A 5JVG3 2K8CA 4DNIA 3H6MA 3HRZC 2JZPA 2KMCA 1BDOA 4C3IB 3J81j 2JY6A 3FC4A 1YQ3B 1MKHA 1FCLA 1UE6A 4B3TQ 1EZ6A 4IALA 2EPBA 3VA5A 2AKWB 1J19A 2EYLA 4CBVA 5C6AA 2O6VD 1QLBB 1EYAA 3X0WA 2WP8J 2DAJA 3TQYA 1AP0A 3H0GG 4P16A 2XGTA 1JE4A 4DV6Q 4DGZA 2PMZE 2PVOD 4W9HA 1E6EB 5C4JH 3I56A 2HE7A 4IM0A 3N30A 4KIKA 1V2YA 3NVWA 1GB4A 1YQBA 3A9KA 4LFAL 2VZKB 4BZAA 1ZYRD 3NENA 4CDEC 2LGXA 2JP1A 4IUNA 1PH6A 3Q3FA 3GOEA 4A3GB 3DBRI 2KVZA 5CHVC 5M5XH 5JJLA 4B6WA 1F1HA 4XIGS 3HOXB 4NPSA 3MFGA 4ZHOA 3IHPC 3Q8FA 1I50B 4LFCL 2L15A 5C4JB 3P4QB 2NVUI 4DR7L 4IM2A 2QDBA 5GXGB 2MCNB 3G6JB 3IFDA 4CDCC 2V3PA 2W55A 5G3LF 2MQHA 4KJNA 2AWOA 1YBYA 1FPYA 1PFNA 4JWSC 2EXZA 5M5XB 1KLUD 1DGSA 5JZEB 5K36G 1WYGA 4R3DA 5C1ZA 3D31A 2V0GA 1SJED 3I90A 1KD1C 1PXUA 2JJQA 1VQGA 5FLMG 1VQBA 4LMQD 4KZ0A 2EZVA 4JI5Q 2KDBA 3JAMc 3HKZE 3HOVG 2BE5D 4JWUC 3MEHA 1OXSC 1XMQL 1V49A 1CZPA 2BS4B 1CSQA 2GVBA 4AIMA 4DN4M 3QO2A 2EVBA 1FEHA 1WSPA 1EUJA 1TWGH 1KLGD 3N3KB 1H9KA 1VQDA 2IGHA 4M0WA 4QJFA 3I72A 2LZ6A 1QB5D 1J7AA 2WAQG 2BQQA 3R3MA 4DV7Q 5GADC 1HNZL 3ND8A 2BS2B 1C78A 5AZGA 1EWIA 2JXMB 2PKOA 1NNXA 1AARA 4FN2A 4C3HH 4KY5A 2EYFA 4PZ8A 4II2B 4GIVA 1WOCA 1CJEA 4IPHA 1PH7A 1OQRA 3I4LA 1GAQB 3PZDA 3NZSA 1TTNA 4F7ZA 3ZNHB 1NR2A 3G7LA 1OQYA 1GOZA 3KF8B 4LFBQ 2KLGA 1FRDA 2BT6A 4F8CB 4X65L 2CWAA 3TJPA 1HQMC 1HR0W 3DWQA 3GTQH 4A3CG 3CMAA 4XQQA 3P4PB 4FJZA 1LTSD 3HOZH 2MSED 1OTRB 2E8GA 5JVH3 1PH3A 3VUYA 4C3HB 3HS0C 2CHXA 1K83H 1VQFA 2IX3A 4YL8A 3GD7A 2F0PA 2LVOA 3GZNB 3M7NA 4J15A 3I2ZA 1A3VA 2HCIA 3Q22A 1LTGD 4LF9L 1L5PA 3CSTA 4GDLA 3B9JA 2KFJA 3S9WA 1SE9A 3NVYA 4OW0A 2PMVA 1NI3A 1FNWA 2Y5BB 3GS2A 4NJCA 2B2TC 4MACA 4BOZB 3I4MH 2E5LL 3E6ZX 1WVLA 2KFKB 2LY7A 4XQJA 1QNKA 1L0XB 4DV5L 3BZCA 4X64L 3GZNI 1LTBD 5DPTA 3V6CB 1A70A 2MO0A 1Q5WB 1Z6HA 2ZXRA 4OIKA 2RCNA 3TRZA 3MVVA 4JYAQ 1HE8A 1YN5A 1K83B 2N7EA 3HOUB 1MD2D 2NCNA 3AEFB 5GAHC 1EIGA 4DV3L 3PIPA 2VUMH 2UXBQ 1BMLC 3VTVA 1IBXA 5FLXE 1QVFA 3ZNGC 2R7FA 3I4MB 3K0XA 3AM9A 4JX1C 3CCSA 1Q86C 2R93B 1FXTB 3T53B 2MJ8A 1WCMG 2B2UC 2R7ZH 1DOIA 5IAAC 3EBEA 4KMUC 3PMFA 3UE0A 1SYGA 1EQQA 2OOBB 3LDZE 3RFZB 1SSNA 5LL6X 4WWPA 4I7ZC 3A9JB 1O7LA 5C44B 1IBLL 4FJVB 4G57A 2K03A 4DV1L 4IPDA 4LF8L 2NVYB 2VUMB 3S1NB 1UWXA 1WMHB 2LGYA 3QK0A 4KGRA 2SOBA 1IUEA 3N20C 3Q3JA 2WU2B 5IYBH 2O5JC 5AEKB 4A3BG 3BDOA 2LMCA 4DV4Q 4K6LA 4FXDA 2P5ZX 4FULA 4A93B 2E2JH 1XCTL 4FYDA 4LFAQ 3C1FA 3TBIB 2RGFA 4M01A 4NXML 1ET6A 1SMXA 1WTHA 3OW7A 4B9KA 1EF5A 4HKQA 4A3IB 2E2HH 2J42A 4A20A 1N9WA 2VQFQ 2I38A 3K57A 3EROA 2UUCL 1C79A 4HJAA 1QCBD 2W9NA 2LSSA 1VQ4A 3CMMB 1VQEA 1H9SA 2G3QB 2R61A 3J7YW 4IWOA 1I4RA 4XWTA 3MXNA 1EY6A 2WXJA 1MHXA 4YWLA 1NMGA 4YCVA 1IBKQ 3AULA 3SU8X 3DM1A 4FXGC 3TSSA 3ERSX 4LFCQ 3MWYW 3CMEA 1UE1A 2FHTA 1WTXA 1PZKD 2K5VA 4DR7Q 2Z0DB 2VRRB 5BO4B 3ZXRA 2F0KA 4GOPB 3D4DA 3DBSA 2B63H 1K9MC 1QVGA 2Y5PA 4L1BA 3CPWA 4GDKA 3FP9A 2VS1A 3TEZA 4BY7H 4H02A 4BBRH 2WAQE 5LL6S 3FDTA 4PZ7A 5I9OA 3SE0A 2XWJB 3G6EA 4ICVA 1R9TH 3C2PA 3VH3B 3UIPB 1TKEA 4NDXA 3KF6B 1QOAA 1I4HA 2JEBI 3RI7C 4DDGD 1F2RC 4LF5L 1RODA 1DONA 4EZKA 2EDGA 3ZNZB 2QDLA 1BQQT 3QA8A 3I4NB 2B63B 1CKNA 4C2MH 1K73C 2INPE 1LTAD 2L00B 3UQBA 3E5SA 4BY1H 4BY7B 2WXMA 4BBRB 1WTWA 4GLVB 2F0GA 1CK1A 4W9CA 3RN5A 2O2VA 2QDFA 4EZJA 1HNZQ 3AB5A 5JPNC 1SE3A 1A2UA 1LV9A 1A63A 1I35A 2RDHA 1STAA 1K50A 4GLAC 3EVQA 5JOBA 3LB8C 1WGHA 4H2AA 5I6YA 4G4KA 4LW1A 2F0JA 3RMKC 1UEBA 2N3SA 4KD3A 3KJPA 4A55A 2F0LA 4C2MB 2X8XX 3ABVB 3L16A 1N8RC 4X65Q 1WM3A 4AH6A 2MW5A 4BY1B 1H9JA 4PYUA 2N9LA 2KWUB 5HFYA 2WXQA 3B0AA 5EGTA 3PT2B 5I6WA 1JQYD 1TWFH 3D6CA 4LNQA 1TBEA 3IAS1 4G3XB 1FNUA 1XLQA 1FJGL 2B8FA 1R4MI 5DNFA 1XJVA 3HVDA 2IJ0A 1TIID 3MAQA 4DUYL 1YIJA 2LXCA 3FKIG 4FVMA 4JV5L 3CCRA 2FINB 4P2CB 4A3JH 1T5XD 3TZUA 5IO9A 5IIFA 3JSVB 4HXDA 3AE3B 3W1SC 1KRTA 3NUHB 4GKKL 3E9HA 1B3AA 3GP7A 5AFWA 4DAMA 2B8GA 2VY3A 2E5LQ 1JC7A 2VNUD 2DNFA 4DV5Q 1TWFB 1FIQA 1TZ1A 3WOFA 2QCZA 2MBQA 1RRBA 4IN3A 1C9OA 2BDNA 2EMSA 3UE1A 1DYQA 4RGNA 4KD4A 4HJ5A 4FF2A 3NG0A 3VUWA 1YN3A 1KTKA 1V1OA 2JA6G 1KJTA 3MHBA 2PI2A 3M4QA 4HIKA 4A3JB 1Y1WG 3QCAA 4DV3Q 3NZUA 3I70A 4DAVA 1JOKA 4WWOA 3WAMA 3K59A 3IFWB 3GTMB 3VR5A 3SFEB 2EYOA 1RYJA 5T1GA 1N32Q 3AU7A 3K7AB 1MGSA 3NPPA 4MTKA 3ZKJC 3NELA 4OWTB 1P98A 3J7A5 5IKCM 1JE5A 2ZTCA 2K8BA 2JA8B 3W9CB 1S4ZA 4F7XA 3AEDB 2K04A 1JR0D 2A68D 3ERQA 5ELCA 3TDQA 2MHVA 1XPRA 1Z47A 1EFID 1IBLQ 1C4CA 1E7PB 2DY8A 4DV1Q 4DK1A 3AMUA 5L37A 1LGRA 2AX5A 1PZID 4OWXB 3OJ4B 2SDFA 3R2TA 2LUEA 3P1MA 1ZKOA 4QB4A 1EOVA 1OEYA 4KHZA 2G4DB 2JVCA 4ARIA 2M2LA 2I46A 3I55A 2ENBA 4A3KG 4K5XA 3PIOA 4M8NA 2QJLA 3HOYG 4A3PA 1E2VA 1WJ4A 2QCPX 4EQ5A 4QY7A 3SGIA 3IL8A 5CV5A 4TRDA 2J0MA 2YU9H 3ZLZA 2NPTB 5IP9G 4KDIC 4GB9A 5M3MG 2QW7A 4X57B 4NXMQ 2K75A 4CHTB 3TMPB 1ACCA 5IP4D 3H3VC 3BVGA 1W6JA 3PPAA 5LMNW 2UUCQ 3A0JA 4WJWA 2B2WC 2L11A 2K25A 3G48A 2SNSA 5KNDA 2KQSA 2CFMA 1VZ6A 4DDID 4BWGB 2ZNVB 3PIP3 5EPKA 4ZQ3A 2QSDA 3L2PA 4HMJA 3Q69A 1E1OA 5EE1A 1KF6B 2FNJB 3BDCA 2YU9B 1ENCA 2R92G 1WJJA 5H92C 1GC7A 3A9KB 4IO9A 1X65A 1ZEQX 2ZM6L 5JEAG 2DZJA 1UD7A 4DV2L 3NVVA 4DA2A 1SRUA 2M9VA 3DEPA 4Z9CB 1U9RA 5T8IA 2B76B 3RLNA 4XYQA 2DWQA 1JICA 2KTFA 1G291 4RM8A 5CR3A 2KZRA 4LK0M
chains in the Genus database with same CATH topology
4FXCA 1JALA 4C80A 2LGIA 4X3KA 2CQAA 2I07B 1YN4A 3BVMA 5IGCA 4GLSC 1UWMA 3BS1A 2AWNA 1PRTD 2W3SA 2WACA 4X3UA 1ZDVA 1H9MA 1F2MA 5E4WC 3TP6A 2Z4HA 1TS4A 4XWWA 1DJRD 5FLXL 2AQ3B 1BCPC 5ELDA 2PTLA 4C3IG 1I4QA 3RMHA 2B2YC 5M3FB 2L4NA 4PV1C 4IZ8A 4XE0A 2L9HA 2FE8A 1PRTB 1OFFA 3HVZA 1DOXA 2DN8A 4MT5A 5D14A 1CHQD 2ONQA 1FR3A 1QT9A 1JORA 1ZXIA 4KGSA 1GUTA 3W5VB 3HP3A 2B39A 3HGBA 4PNYA 2CHBD 1SDFA 5LNK1 1PTOC 5E1FA 4A6QA 3LXFA 3VYSA 1F2RI 1NVID 4FF3A 2EJFC 3AE1B 3VR9B 4GDLB 5IGDA 2M19A 2V4IB 1C48A 2WINB 4M1UB 4J1MA 3FILA 3VR4A 2OEDA 1Y8OB 4QF4A 3J81E 1JWUD 4DNRB 2LEKA 4ILWA 1TWCB 2A69C 1Q3LA 1QNUA 3TP5A 4DNTB 3VR3A 2EY5A 3AE9B 1FNVA 2L0CA 2K5QA 2WXGA 3D8GA 1IGCA 5D3IB 4PT5A 3NWSA 3MXPA 4UAIA 4G7HC 2RDGA 4H44C 2D62A 1Q90A 1OQQA 5FO9B 2IX0A 1TWAB 4HJGE 1DM0B 1SAPA 4KI0A 2JA5B 3MHZA 2IL8A 5E6JA 1TY0A 2MEKA 2EYJA 2J0TD 2Z8LA 4BBSB 1N60A 3OWFA 2A73B 4ZRZA 2M0AA 1RFKA 4RF0A 1SNDA 2KMMA 2F1MA 1AW7A 2TSSA 2PNRC 1TYGB 3NK9A 5ELEA 4C3HG 3NQIA 2XRQD 1DOYA 1HZ6A 1JW9D 4X3TA 2ICEC 3AMZA 3FPUB 1ESFA 1STHA 2KEDA 5BN5A 2GRIA 1SEBD 4L23A 5IT9E 1VJKA 5EBCA 3N9YC 3P20A 1HRJA 1SF0A 3P4SB 5IGBA 3FMCA 3DUZA 4JE3B 2XIWA 4DU9A 3I57A 4CJ2C 1RWSA 4WIPA 2F0WA 4WORA 1JWMD 1B50A 2KJXA 1EY5A 4H7BA 1EYDA 1V8QA 1S5ED 1HTLD 2JSOA 1QOHA 3TP7A 2F4IA 4Y7NB 1L6UA 4UDUC 5G3LD 2E6XA 2IDYA 4HR7B 1TS5A 4V190 4B9WA 2EY6A 2X69A 1J8IA 3NTHA 1RKNA 1K52A 4OL7A 1TKWB 3KWVA 1I4GA 1VDZA 2MP1A 1HFNA 1EZ8A 1ONLA 3MXUA 1RCVD 4LTUA 1DZ1A 3A54A 1FD7D 3KBXA 3S1MB 3P63A 3CKIB 1P7EA 3MC0B 3ETRA 1T5EA 1YMHE 1T3QA 3GQBA 1CQVA 4OZCA 2XRSD 4RCOA 4C3JB 5FOBB 1O7YA 3S1RB 2ZW1A 2K5WA 1I7HA 3E56A 5C2TB 3SK5A 2QMTA 1GB1A 3BK1A 2WXPA 1FFVA 1EQVA 1CHPD 4USAA 2NMQA 4ABNA 1AN8A 2VB3X 1N63A 1FXAA 1PTOH 2VZKD 3S2DB 2RMMA 4A3DB 4R9WA 4RF1A 5TSSA 1YJIA 2F0VA 2IPKD 3ZJTA 1W6KA 1C76A 4AYBB 2EYMA 3WCQA 4KKSA 4RH6A 1TS3A 1SMYD 3ZYYX 2B2UA 2J7ZA 5C5LA 1PTOB 2CJNA 4NMZA 1Y56A 2W54A 1D5XC 5CGKA 2A69D 3R3OA 2ZXPA 2MGSA 4OZAA 3ZJUA 2NBFA 4KV6A 4JPSA 2A6ED 2JSVX 3I3CA 5AUKA 1PGXA 4B0MA 1K53A 4C1NK 4OO1G 5DEHA 1N61A 3BIID 1MPEA 5EKIA 4OZBA 4YTMB 4K14A 1LABA 1VZ8A 1SE2A 5CBAE 3PUYA 1RM6C 5F2DA 4RA8A 1YNJD 1RF2D 3PO0A 4WQMA 1HQRD 4TMAB 1KDCA 4M8AA 2BYTA 1II3A 2JA7B 3RD4A 4YTPB 2OHFA 1TKYA 4OVZA 2DBYA 5DAUA 3H94A 2L55A 1BCPF 4CKEA 1H9RA 4HCEA 1SNMA 1ZXHA 3CRLC 1SYEA 3MTSA 1ZPSA 1PDXA 1E0BA 4XYOA 1TWGB 3U52E 1YNNC 3J81L 2JYEA 1RHPA 5JAVA 2NZ1D 1SE4A 2PZTA 3BYYB 1J7BA 1CQFA 1FD6A 1Y1VB 4ZUIA 1ICWA 1E2ZA 1JOQA 1TVXA 1PTOF 3LWUA 2PVGC 1EM7A 2BTEA 2XSCA 4YSYB 3HZXA 1IHZA 1CM9A 3GTQB 1F2LA 1SYDA 4XT3B 3HOZB 2N55A 4ZKCB 1N5WA 5M5YB 4KKJA 5H8YE 2FBWB 2I2YA 2KACA 2H1EA 1RD9D 2IGGA 4L2YA 3TMEA 2Q8IB 3VRAB 2K28A 5FK9C 2DYMA 1FMAD 3W1SA 4FNFA 1G91A 2N0SB 1G8ZD 1NYRA 1JRPA 1HCZA 1Y8PB 3GO5A 1YJJA 5EE0A 1SNPA 3Q8EA 3I73A 5IT9L 2DYOA 1MI0A 5IGFA 1XLOA 1E10A 4H0LC 5EKLA 4N9PA 2K5DA 3FILB 3NBIA 2R7ZB 1LO5D 3HKZB 5FKAC 3NXWA 1HUMA 3EUB2 1UGJA 4KJOA 3J80E 4BA2I 3P1HA 1STNA 5C4XB 2IW3A 4U68A 3GB1A 4HROA 1TY2A 4MM3B 1RTOA 1L4ZB 2DNCA 3E9SA 5J22A 2PCFB 2DNEA 5C5MA 2EOTA 2PYKA 1KABA 3SK8A 1AFPA 1BO0A 5C0XH 2WDQB 4TQ1A 2NN6H 3K5NA 3IKJA 1A6XA 1A3TA 3L3OC 3QOLA 2E2JB 2F0EA 3RLFA 5IGGA 2CW0C 5ISRA 1STEA 3AE5B 1GJXA 2E2HB 1LTRD 1B9NA 3I8ZA 5EPLA 3GTOB 2C5CA 2LUMA 1HPCA 3K5OA 2K7VA 2B2WA 1CA6A 3JAME 1FM0D 2EYHA 3X3MA 2BA0A 1BUIC 4NAWB 4RKBA 3M85A 1U4LA 3URYA 5C0XI 4NZLB 3UI2A 2NN6I 3X3NA 3OOCA 3SXHA 1R9TB 5CORA 3QB3A 2DLBA 3AV8A 2KWDA 1GHKA 4HSPA 1IW7C 1BOSA 5K5PA 3NTIA 3T3OA 4A9AA 3AH7A 2SEBD 4A90A 2C9OA 1I6HB 2FMMA 2X6GA 1VLBA 2JWUA 3BYTB 3NZ3A 5C3XA 2O5IC 3OHXC 1TT2A 2BA1A 3V96A 3Q6SA 1K8OA 1WRIA 2Q5WD 1DD2A 4ZHPA 2K01A 2WDVB 3NTKA 3M7GA 4RAUC 1ILQA 1X3QA 2XN9C 5K36H 2B2YA 1YNND 3J9CA 5IOCA 3K5MA 1ZE3D 4WH4A 1U4RA 2FUG1 1Q1BA 1NENB 1EOTA 2MH7A 2KUMA 3NP8A 1PFMA 4J8QA 3DWGC 3NQTA 4KX6B 3ITPA 4PQXA 4EQPA 2WXFA 2K6AA 3SR1A 2OT2A 4N59A 1QKZA 3EA6A 5FR3A 2A74C 2PQEA 3EFXD 4F8MA 1AEXA 4B08A 4XDXA 3NUCA 2NTTA 1TQOA 1KRHA 2WKCA 1D5MC 4ME5A 2VB2X 2Y5CA 1SB3C 2KOLA 1LACA 3VYUA 3ZQ4A 2X6LA 3FPPA 2WAQB 4KK7A 3T4AC 3RUZA 2PZWA 3T51B 1WTQA 2BBCA 1L6VA 2B2VA 4CJ1B 4IUVA 4DFAA 1TZOA 5C4HA 2F0DA 4HEA1 1E2WA 2KQ3A 4U673 1GUWA 1B1ZA 4RGMA 4C56C 3AB9A 4EGVA 4KHVA 2F3VA 1DOLA 5BMIA 4WAFA 1DOKA 1C4QA 5CV7A 3R8BA 3SVMA 1TR5A 3OSOA 4DXFA 1PLFA 1BF4A 2KN4A 1EY7A 3E0JA 3NSWA 3IAM1 1EQTA 3FAHA 3MP9A 2K1BA 4X3SA 2DY7A 2H88B 2YEPB 5C3JB 1VF7A 4CKCA 2NTSA 5BN4A 2CU3A 4L8JA 3AE4B 3A8IE 3PV0A 4C3JG 3N6RA 2F03A 1STYA 2KVMA 3GTGB 5G5HA 3VYTA 3KWLA 1EIHA 4MH8A 2WXRA 1IKLA 1JWAD 1UAPA 3MXGA 3KLSX 3AE2B 2A5HA 4NP5A 1OXUA 1F2YA 3KLRA 3V05A 2NVQB 1HTPA 2OF1A 3F2UA 1HHVA 1QOBA 2F0TA 1VZ7A 2BCOA 2WXNA 1STGA 2XNAC 4ARCA 3EQLC 5A2QE 4R8IA 1N5XA 4A3FB 1RTNA 4K8JA 4WURA 3DXJC 5BN3A 5M9OA 2RDFA 5BMHA 1LT6D 2NYZD 1SFOB 3DWMA 2J52A 1NSNS 2ZT9C 3C46A 1JCKB 2LS01 4NKLA 3HOWB 1TKGA 2AQ2B 2FFKB 3QG1A 1C9FA 1QOGA 3TN2A 1WGKA 1QILA 3VA7A 5BYRA 3VR6A 3QWNA 4QCLA 1BXTA 2F0QA 1XXGA 4I65A 4IKGA 5CV8A 3J80L 1HXYD 3PO2B 1ZXTA 3A7AB 1IYVA 4PMCA 4H13C 1XLNA 4OIJA 2EYPA 3TEYA 4G7OC 1HA5A 4US9A 3U9SA 4ZAIA 2BB5A 3W2DA 3KUPA 4ZK9B 1Q12A 2YEPF 1D4BA 2KA7A 5IODA 2EJMA 5MPOA 5DM73 2RKSA 2WXIA 5JJZA 1F2ZA 3Q24A 3RZDB 2N7JA 4ITKA 1O80A 3DEOA 5EPJA 4CJ0B 2F0OA 4LJZC 1F9PA 1KFYB 1LLRD 1LT5D 3A8JE 2JEAI 3NS1A 4A3MB 3JAML 4RCNA 3RZOB 1T6BX 1MHHE 2PW9A 1ZYRC 2JYTA 1V97A 5D65A 5KYLA 4IDIA 1UNSA 2L12A 3A7LA 1GPXA 1B9RA 1SXTA 5EE9A 4LLGM 2J53A 4OHJA 2KCCA 2JYOA 1AZQA 1JROA 2WXLA 4FO2A 1EEFD 2WQYB 5G5GA 4IFDJ 1MSGA 1EL0A 1OXVA 2SAKA 4XTCS 4KN4C 1B2TA 1O78A 3VQIA 2K9XA 1S5DD 4A8XC 4PMBA 1XEEA 2Y3AA 5NUCA 2K33A 4KY7A 5J1ZA 1V8CA 4D2KA 4C7YA 5CYUA 3A56A 2YYZA 5CC4A 1Z7TA 4S3SA 1E0ZA 4IOIE 1ENFA 1LTID 4DF7A 3LX0A 1B4OA 3U4EG 5E4XA 3H8HA 1WD0A 4RGTA 2BDOA 3KBGA 2E3TA 3K5LA 1FFUA 1XF5L 2BB6A 1NCVA 2EELA 3AEEB 3P4RB 1VRAB 1K8MA 1GUOA 3KQ4A 4JK1C 1PGBA 1IGDA 2MPMA 3LWEA 2NVTB 4L6TB 3HOYB 1PFBA 4RGOS 2KAJA 4KKIA 2Y0SB 3WDNA 4C7ZA 1UEAB 2G1EA 2KECA 4QIWB 3BK2A 1JB3A 3IXSA 3K0YA 1WTOA 3R2IA 3U7ZA 5JEAH 1BCPD 2EJGC 2G9HD 2K5PA 4ZKBB 2WB1B 1GXDC 3SHLA 5COYA 3B2GA 2NVXB 2MUYA 1J9OA 4HN7A 1Y8NB 3AN1A 1ROEA 2RBMA 4F88A 2WV6D 4TQUS 3B2FA 2E76C 2D2CC 1HZ5A 3HRDD 2AQ1B 2QIEB 3MZ5A 1BCPB 3PUVA 3M4OB 2B2TA 4KKTA 5C0XJ 2BW2A 1EWHA 4XDCA 1PTOD 4FP5D 3OMCA 2L52A 3R93A 4WFN3 2O4XA 4IUPA 1CFMA 1SYFA 3CWIA 5FO8B 5I2XA 1S5CD 2IWHA 2JX5A 1VMPA 5BYQA 4RWSC 4FF1A 2L83A 3C3LA 1BBXC 3S15B 4ZRQA 4XT1B 2E2DC 3P7JA 4R8NA 1FXIA 5BYSA 2TMPA 5C3WA 2WLBA 1YQ4B 2HDMA 4MN3A 4A3EB 2PZUA 1D5ZC 2GB1A 2GI9A 2OEOA 4RNAA 1PYWD 2L1BA 2PPBC 5KNBA 5A2QL 1QG7A 3P42A 1SNCA 1G6ZA 2M00A 1DCZA 3Q8CA 1V1PB 3KK7A 2KQ4X 3TP8A 3VR2A 2RPVA 2JU6X 2O2LD 2QF7A 5HGTA 2R3ZA 1ML0D 1L0VB 3AECB 5C3EB 4HTHA 3D4WA 4RKLA 4EE2A 2OXPA 4ZUJA 4WWMA 3FEWX 2N88A 1CZGA 3PO3B 3AEGB 3OWEB 4REZA 1I4PA 1JMLA 4N9TA 4O1NA 1YNTE 3BVZA 4EQOA 1C4PA 3U2SC 3VYRA 2GA4B 4WRDA 4HEDA 2H89B 3IT4B 3OIPA 3L4PA 4IFDH 3NWTA 2AUJD 1F9SA 1NUCA 1C8CA 1RJTA 1F9RA 1EU4A 3LNNA 1PUTA 3Q8BA 5EJWA 3W3AA 4DAPA 3BZDB 3K58A 1MVKA 2KHSA 1EWYC 2MJDA 4ZYSA 4AS1A 1M8AA 3TUOA 4TKOB 1CTMA 5T1IA 2PMZB 2XWBB 3OPOA 3AE6B 1NEKB 4XDDA 1NYQA 5HURA 1EU3A 3Q0AA 2E75C 1SYCA 4RHSA 2HCCA 4EQNA 4IFDI 4RHRA 2F0UA 2IT1A 1JWSD 4KTAA 1C4AA 2K32A 3DWPA 3PUWA 2E74C 2V3NA 4HAEA 5CV9A 1TS2A 2F0FA 1STBA 2NUCA 2A68C 2SNMA 3SK4A 5M5WB 1CA5A 1GHJA 4HMIA 1SYBA 1XCQL 2ZW0A 4YT0B 4YTNB 2ID0A 4E6IA 1ZDXA 1BUVT 4DAYA 1OXTA 2EKIA 1LTTD 4KGTA 2PW7A 1IKMA 1FCCC 1OO9B 3K6OA 5ELFA 1ZOYB 2F0SA 3L9AX 3J7AF 2Q8TA 3S14B 2J4XA 2V4DA 2L1AA 3BDLA 3AEBB 2HDEA 4XXEA 1Q1EA 1WTRA 1B44D 1JOOA 3A8KE 4J3OD 1BR9A 1PFDA 1J7CA 1EEID 5CV4A 3S17B 2D9UA 3SDZA 4DQOC 1QF6A 1QJOA 2EE1A 2LKVA 5HHDG 4CQNA 1Y69U 4C1NI 1SIJA 3M4YA 3S1QB 4Q2JA 4IUQA 1PRTC 4YWGG 1GUNA 1Q10A 3PUXA 2K05A 4Q5VA 1R4PB 5FO7B 1KAAA 3QOJA 3U9OA 1K51A 4YSXB 3C1EA 1QE6A 4US8A 3LYYA 4IUTA 3Q23A 1TJEA 2HTME 4EVOA 1I3QB 3H0GB 1SNQA 3PZ8A 4YIJA 2LHDA 1X3PA 2WS3B 3QJYA 1D6EC 5EBDA 1R7SA 4MHEA 4OO1H 2XVSA 2CVRA 2WNMA 3P75A 1D1KA 4QUFA 1WD1A 4G7ZC 3D6WA 5KGUA 1KNEA 3H09A 2F0IA 4Q0FA 2D5DA 4LK1C 2NWGA 4XQNA 1G2SA 2E2IB 1XYIA 2PIAA 2LHEA 1R4QB 1A3UA 3CIRB 4HSVA 1SJHD 3IFTA 3I9V1 2F3WA 1IL8A 5I2YA 1ZP0B 3HEJA 1GUSA 1O7ZA 1EYCA 1CI3M 3RPFC 1HEZE 3PZ7A 3M3YB 1FGBD 5EKKA 4OO1I 5KRUA 4K2LA 1XLPA 2MJEA 3GTLB 4GZYC 3ONAB 4HKZE 3H91A 2N9KA 3HOVB 1HUNA 3NHHA 2IX1A 1A15A 3WOEA 5CMDA 2LJIA 1QWYA 4P6VF 2PW5A 1FRRA 3I91A 3GTKB 3IT6B 1I6VC 2RSNA 1F9QA 2M56B 1KNAA 3CQZB 1WTVA 1DOMA 1V1PA 2FJ2A 2VXWA 1VR9A 3MFYA 5CBEE 1VDVA 3SEBA 3HUIA 5LHY1 3AE8B 1XO3A 2ON8A 4RFBA 3GV6A 1LT4D 2ICIA 3C8YA 1AWDA 3UI3A 1L4DB 5AUIA 2H4OA 3DWAA 4FF4A 1PZJD 1MSHA 2WIIB 2Z4IA 5HG2A 2F0NA 2ZXOA 4HRSA 1XX8A 3T3NA 4CGYB 4L63B 5JEAJ 2L5TA 1ZUD2 2LFIA 4TQ0A 1B9MA 4NW2A 1EY0A 4K6DA 5KNCA 2Q8RE 2CW0D 3Q8AA 1WCMB 1CZWA 3BG3A 4O42A 1DXMA 2W3RA 3S16B 4KY6A 2HUGA 3KF8A 5EE3A 5HI1A 1I4XA 2JXTA 1GUGA 4A3BB 4ODGA 1P7FA 4BS9A 2A6HC 2JE6I 2KCNA 2IGDA 4JBWA 5I4DA 3NRZA 2PO4A 1TWHB 2RQXA 4N58A 1V43A 1U4MA 2K22A 2WXHA 3VR8B 1IW7D 3TEWA 4ID6A 4DK0A 1TU2B 3FVQA 1C77A 2Z1CA 4ZRPA 1D1IA 4BA1I 1ESRA 3J7AV 3EGRA 3ZJVA 5BMGA 4K8IA 1EY8A 1UUPA 5I9PA 5D7GA 1XTCD 4DXGA 5E3FA 5IGEA 1BNZA 3OMGA 4YSZB 4IQZA 1VMCA 3DHQA 2INNE 1ET9A 2WXKA 3FRPB 1NAPA 2KEEA 4ZOHC 2KDMA 1S5FD 5ELBA 3VRBB 4FXKC 3N52A 3QIAA 2W82A 1MI2A 3V3XA 3T56B 5JXVA 3SR6A 3ND9A 1KDAA 1JWBD 4OGQC 1QOFA 2PLPA 3CRKC 1SMYC 1EWCA 1PGAA 1ILPA 5C4ZA 2EY2A 1FYCA 2B2VC 3KLSA 3D4RA 5CV6A 4QUCA 2FMCA 3OIQA 4N6EB 2QEJC 1PDQA 1XWEA 1X32A 1F0ZA 1L0YB 2A6EC 1IBXB 4PMWA 1Q8IA 5KIXA 2K3UA 2WXOA 1VCIA 2QKIC 4HCSA 2G9DA 1NR4A 3FKIB 4B9XA 1SBBB 3L7ZC 4CKBA 1N62A 2K0PA 1KH0A 4LAAA 4B0EA 2RA4A 5A35A 1SSOA 1YNJC 1AYFA 4ULLA 4IFDG 3AE7B 1EY4A 1RDPD 1JQ4A 2BOSA 2BE5C 2R6GA 1VF5C 1PRTF 4YXDB 1LT3D 3ZGZA 2X38A 2LMCB 2JA6B 2WP9B 3AEAB 1ENAA 1Y1WB 1AZPA 3CHBD 1WWTA 2ACZB 1HA6A 3V2TA 5EQ0A 2QILA 2JQRB 3NBHA 2RVLA 3A55A 1H9SB 3T13A 3GTJB 1D2BA 2WDRB 4V0BA 3S2HB 1U4PA 1WTPA 1A2TA 2HQEA 2F0HA 4NAMA 1E9MA 3SFDB 1M4VA 3PIO3 2D5GA 4GDKB 2WKDA 4A3KB 2MJ3A 4K2KA 4KN7C 1KDBA 3MJ5A 3NVZA 5D3DA 4K5WA 3TZDA 1OXXK 1G2TA 3MA2B 5M3MB 3IAYA 4IUUA 3BWUD 4AQ7A 5KEEA 2F0MA 3HG9A 4TSSA 1QQRA 3DMUA 3CU7A 3GV3A 2A6HD 4MIUA 2R92B 1MBYA 1PMRA 2LFNA 4IURA 3PUZA 2L32A 2EY1A 5JPMC 3T16A 5DM63 3O13A 3NE5B 3W5UB 4ZLTF 1F77A 2RSOA 1HFGA 4F87A 3EJIA 5C0XG 1B53A 2NN6G 3SK6A 4QMGA 3TEXA 3GTPB 2NB0A 2AUKA 1DGJA 1SNOA 1CT1D 5J39A 1IYUA 1S5BD 4KKUA 4K5VA 2WU5B 5KYIA 1WXQA 1EY9A 2HDLA 2CJOA 2BS3B 1FO4A 4J6HA 3D3RA 5JVG3 3H6MA 3HRZC 2JZPA 1BDOA 4C3IB 3FC4A 1YQ3B 1FCLA 1EZ6A 4IALA 2EPBA 3VA5A 2EYLA 4CBVA 5C6AA 1QLBB 1EYAA 2WP8J 1AP0A 4P16A 1JE4A 4DGZA 2PVOD 1E6EB 3NVWA 1GB4A 2VZKB 1ZYRD 2JP1A 4IUNA 4A3GB 4XIGS 3HOXB 3MFGA 4ZHOA 3Q8FA 1I50B 5C4JB 3P4QB 2QDBA 5GXGB 3G6JB 3IFDA 2V3PA 2W55A 5G3LF 4KJNA 2AWOA 1PFNA 4JWSC 2EXZA 5M5XB 1KLUD 5K36G 1WYGA 4R3DA 3D31A 2V0GA 1SJED 3I90A 1PXUA 4LMQD 2EZVA 4JWUC 2BE5D 3MEHA 1OXSC 1CZPA 2BS4B 4DN4M 3QO2A 2EVBA 1FEHA 1WSPA 1KLGD 1H9KA 2IGHA 4M0WA 3I72A 1QB5D 1J7AA 3ND8A 2BS2B 1C78A 2JXMB 2PKOA 4KY5A 2EYFA 1CJEA 1OQRA 3I4LA 1GAQB 1NR2A 3G7LA 1GOZA 1FRDA 2BT6A 1HQMC 3DWQA 4XQQA 3P4PB 1LTSD 5JVH3 4C3HB 3HS0C 2IX3A 3GD7A 2F0PA 3M7NA 3Q22A 1A3VA 2HCIA 1L5PA 1LTGD 3B9JA 3NVYA 3S9WA 4OW0A 2PMVA 1NI3A 1FNWA 3GS2A 4NJCA 2B2TC 4MACA 3E6ZX 1WVLA 2LY7A 4XQJA 1QNKA 1L0XB 1LTBD 1A70A 1Z6HA 2ZXRA 4OIKA 3MVVA 1YN5A 1K83B 3HOUB 1MD2D 3AEFB 1EIGA 1BMLC 1IBXA 5FLXE 3I4MB 3AM9A 4JX1C 2R93B 3T53B 2MJ8A 2B2UC 1DOIA 4KMUC 3PMFA 1SYGA 3RFZB 1SSNA 5LL6X 4I7ZC 1O7LA 5C44B 4G57A 2K03A 2NVYB 2VUMB 3S1NB 1UWXA 4KGRA 2SOBA 1IUEA 2WU2B 2O5JC 3BDOA 2LMCA 4K6LA 4FXDA 4A93B 1XCTL 4FYDA 3C1FA 3TBIB 1ET6A 3OW7A 4HKQA 4A3IB 2J42A 2I38A 3K57A 3EROA 1C79A 1QCBD 1H9SA 2R61A 3J7YW 1I4RA 4XWTA 3MXNA 1EY6A 2WXJA 1MHXA 3DM1A 4FXGC 3TSSA 3MWYW 2FHTA 1WTXA 1PZKD 2F0KA 3D4DA 2Y5PA 4L1BA 3TEZA 5LL6S 3FDTA 5I9OA 3SE0A 2XWJB 3C2PA 1TKEA 4NDXA 1QOAA 1I4HA 2JEBI 1F2RC 1RODA 1DONA 2EDGA 1BQQT 3I4NB 2B63B 2INPE 1LTAD 3E5SA 4BY7B 2WXMA 4BBRB 1WTWA 2F0GA 1CK1A 3AB5A 5JPNC 1SE3A 1A2UA 1LV9A 2RDHA 1STAA 1K50A 3EVQA 5JOBA 3LB8C 4H2AA 5I6YA 4G4KA 2F0JA 4KD3A 4A55A 2F0LA 4C2MB 3ABVB 4BY1B 1H9JA 5HFYA 2N9LA 2WXQA 5EGTA 5I6WA 1JQYD 3D6CA 3IAS1 1FNUA 1XLQA 2B8FA 5DNFA 3HVDA 2IJ0A 1TIID 3MAQA 4FVMA 2FINB 4P2CB 1T5XD 3TZUA 5IIFA 3AE3B 3NUHB 1B3AA 3GP7A 5AFWA 2B8GA 1JC7A 2VNUD 1FIQA 1TWFB 3WOFA 4IN3A 2BDNA 1DYQA 4RGNA 4KD4A 4FF2A 1YN3A 1KTKA 1V1OA 3MHBA 4A3JB 3I70A 4DAVA 1JOKA 3K59A 3GTMB 3VR5A 3SFEB 2EYOA 1RYJA 5T1GA 3AU7A 3K7AB 1MGSA 3NPPA 3W9CB 2JA8B 1S4ZA 4F7XA 3AEDB 2K04A 1JR0D 2A68D 3ERQA 5ELCA