2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
5ELBA 1I4HA 1RDPD 1B44D 1TS5A 1ET6A 1S5CD 1EFID 1ET9A 1LT5D 1CT1D 3TSSA 3MC0B 5ELCA 1LT6D 4ZYSA 1V1PB 3DWPA 1I4GA 3O13A 5I4DA 1JWMD 2AQ1B 1EWCA 1SE2A 1I4XA 1TS2A 5ELFA 1S5DD 1PTOD 4BWGB 1CHQD 2RDGA 1SXTA 3OWEB 1AN8A 2XN9C 3BZDB 1EU3A 2J4XA 1UUPA 1CQVA 2QEJC 1LTSD 4RHSA 3CHBD 4RH6A 1PTOB 4NZLB 1D5ZC 1F77A 1HQRD 3DWAA 1EEFD 4L6TB 4RCOA 1LTID 1PRTC 4DXFA 1B1ZA 1S5ED 1PRTF 2NTSA 1RF2D 2XRQD 1SBBB 2XNAC 1BCPD 5ELDA 1EEID 1FNWA 5ELEA 1KLUD 1M4VA 2CHBD 4RGNA 4RHRA 4RGMA 1LLRD 2R61A 1HTLD 1I4RA 1BCPB 1TS3A 3R2IA 1V1OA 3V05A 1JWUD 1LTGD 1SJED 1ENFA 1GOZA 3R8BA 2XRSD 3SEBA 4RGOS 1SJHD 2IPKD 4K6LA 4UDUC 4RGTA 1LTTD 1SE4A 1LTBD 1KTKA 1MD2D 1FNUA 2WV6D 2AQ3B 2SEBD 1D5XC 1XXGA 2O2LD 3R2TA 3BYTB 1JQYD 5FK9C 1I4QA 1SE3A 3EFXD 1UNSA 1JCKB 1PTOH 1PYWD 3BVZA 1YN4A 2ICIA 1BXTA 1FD7D 4O1NA 1I4PA 1LTRD 1D6EC 1RCVD 1L0YB 1DYQA 1PRTD 2AQ2B 3BVMA 3EA6A 1SEBD 3W2DA 4DXGA 1BCPC 1FNVA 4Z9CB 3MFGA 5D3IB 1LT4D 1RD9D 1XTCD 1LT3D 1T5XD 2QILA 1QILA 1PRTB 1TS4A 1LO5D 5TSSA 2G9HD 1CHPD 2IJ0A 1S5FD 2RDHA 1KLGD 3BVGA 1S5BD 1PTOC 4TSSA 4C56C 1DJRD 1D5MC 1PTOF 1PZJD 1YN5A 1YN3A 2TSSA 4RFBA 1PZID 1L0XB 3URYA 1TY0A 5D3DA 3GP7A 1JWSD 1TY2A 2NTTA 1G8ZD 1CK1A 1LTAD 4L63B 2Z8LA 1PZKD 1ESFA 4OHJA 1AW7A 3KLSX 1STEA 1HXYD 3BYYB 3DWQA 1V1PA 1FGBD 1EU4A 5FKAC 1HA5A 1BCPF 1JR0D
chains in the Genus database with same CATH superfamily
3KW5B 5IWAQ 5D2MB 1F9RA 2A6ED 2L15A 3H7PA 4NQKE 3J7ZC 2Q8TA 4X3SA 2OWOA 1WTOA 3N30A 2KWVB 2MLBA 2QHOA 1C3TA 3GB1A 1WFYA 1QZGA 3EGRA 1VMPA 2RVLA 3ZRCA 3V3XA 3NBHB 1QT9A 3C3LA 1IXRA 3LB8C 2N9KA 3L10B 2PQAA 4BWGB 5D7GA 3NQTA 2GVBA 3FKIB 2YEPF 1Z9FA 2FNJB 1ZW7A 2WP9B 4MSMB 2VL6A 2FXQA 3H3VC 2FFKB 1LTSD 2WAQB 1CZGA 3S2HH 2KT7A 1Z47A 2Z6KC 2HQEA 1IKMA 2Q5WD 3S16H 1OEYJ 1ZE3D 1WTVA 1JB7A 2B63H 2F4VL 5C4XG 1D2BA 1IYFA 1NYQA 3MJ5A 5IA7A 1AZQA 1HNZQ 2MJ3A 2R2OA 4EQNA 4US9A 2NTSA 3QWZB 1IBXA 1PHJA 3PO3G 5EE9A 1O80A 1UWMA 4A3FG 4RG1A 2HD5B 2UXDL 5EGTA 4TVAB 5GAHC 2KCNA 5KNCA 3LJ3A 4DR4L 2CCZA 1E2ZA 4NJ7A 3ZYYX 1NR2A 2E2HB 4KGSA 1G51A 3K81C 1JWUD 2O5JC 2DENB 4W9IA 1SMYD 1SFOH 4POFA 1ENFA 3U7DA 5DPWA 3DOWA 4GKKQ 3E6ZX 4RGOS 5A2QE 2A73B 4O42A 1CZWA 3K59A 1EIGA 2MH7A 1L2NA 2EQSA 3NOBA 4NJ6A 2PE6B 2N9PC 3ENEA 3DCGA 5K36G 1G6JA 2PMZE 3OWFA 2VY3A 1I4QA 5FJ8H 4YXDB 1QUQB 1VF7A 5FLMG 1VQLA 4IOAA 1KNEA 1TR5A 4DU9A 2H5XA 3B6YA 4OVZA 2DUDA 1WX8A 3OTOQ 4I6NB 2LD9A 1DYQA 4B3ML 2JX5A 2NVYH 1SEBD 5EKLA 4TKOB 2KLCA 4ME3A 3Q8AA 2IGGA 4YTNB 3KUCB 4LCDE 3L0OA 3EJIA 5D3IB 3ULLA 4A3BH 5C44H 3RD4A 3PQIA 4AYBE 3ABVB 3W1GA 5C3JB 3VYRA 2IJ0A 2SAKA 4IPDA 4R4TA 4I6LB 4QF4A 4HJ5A 4A3LG 2J0TD 3ITPA 4CHTB 4AJYB 2EJMA 1IYJB 3S9WA 2B76B 2Z6KA 4C1NI 1PMRA 3T13A 4LF9Q 2DZIA 2ASBA 3CU7A 3RLFA 4K3BA 3IBEA 1XYIA 5IAAC 1P16A 3MEFA 4I7AA 2PCFB 3K58A 2ZTCA 2E74C 3MHZA 2CU3A 1C76A 1MHXA 2IO0B 1PFSA 5M9OA 4ID6A 1LACA 3GV3A 4QJFA 4EX5A 1F2LA 2DHZA 3N3KB 1FGBD 4XDCA 2E2IH 1V8CA 3AEVA 2KDBA 3CMMB 4JPSA 2K04A 1BCPF 2ICEC 4LF5L 5EDSA 2C35B 1L2FA 1IBMQ 1Y1WH 4JI3L 3A7LA 1XNQL 5IOCA 4YWLA 2Z4IA 4B3SL 4GU2A 1ZOYB 3ZTCA 1LT6D 3AE6B 3UQAA 4CKBA 5M5XB 1AWDA 3BS1A 2B29A 1Q5WB 2IGHA 4MIUA 1NUCA 3AE1B 4KKSA 2VB3X 5T8IA 3KLRA 3S1MH 4WJ4A 4RKLA 2B2WC 2NVQB 3GTPB 3RD2A 3BJUA 4C2MH 1CZPA 3I3TB 2KVMA 2A5HA 2JA6H 2WGSA 1K3RA 4XGAB 2UXBQ 3WWVA 4NMZA 5DAUA 5L37A 3AQQA 1L5PA 1V5TA 5JJZA 3H6NA 5E6JA 3BZDB 5IIFA 4EVOA 1OO9B 2Y0SB 3HOVG 3RMKC 2G4SA 1IP9A 2K7VA 3AU7A 2FCQA 1D5ZC 3Q8FA 4HKQA 1H8CA 5GMVA 1NCVA 3TP5A 5DCNA 3DWAA 5EPJA 1FCCC 1FEHA 3P4QB 4RCOA 1LTID 2CKZB 3IT6B 4OONA 5KGUA 4Y7NB 2R7ZH 3K80C 2L00B 1OEYA 1DD2A 5JVG3 5CMDA 1BQQT 1WR6E 4ILWA 4LFAQ 1VQ5A 1EEID 3L54A 4QGUA 5E3FA 4DR3Q 1SGHA 2KFKB 2GBMA 1YQ3B 1LLRD 4WURA 1QVFA 2LUMA 4W9LA 1C9FA 2G9DA 3UQBA 4Y52H 3OIPA 4IUMB 4A3GG 2BYFA 2F1MA 2LVQA 3AEDB 2FCSA 4KJNA 3Q6SA 4K7WA 3FHWA 5M3MH 1JMCA 4H0LC 3MTNB 1KLVA 3ONAB 4S0RA 1C4QA 3VXWA 1TJEA 5KEEA 1LM8B 4HCPB 5AJ3Q 4MGIE 2KDMA 1MD2D 4OGQC 2QF7A 4DR6L 5C4XB 1R7SA 3HGBA 5C4JH 3NZ3A 2CH4A 2PO4A 1VJKA 1E22A 4JC0A 1M94A 2PYKA 1YOVB 3GS2A 4B3RL 3BDCA 1IGCA 3PO3B 3V2TA 4BBNC 1IW7C 5K5PA 2EXDA 2Q8RE 4A3FB 2NN6H 1E8WA 1RCVD 2M2LA 3KUDB 4L23A 5J22A 4WJ3M 3BVMA 3P1MA 1B3QA 3CCVA 4W9DA 4YHHL 2ES2A 4IUVA 3R66C 1HNXL 1LT4D 1E8YA 1LT3D 5FOBB 2X6LA 1YI2A 1HR0L 1VCIA 5AUIA 3QJZA 1GB4A 3OOCA 2JEAI 2PVGC 2RDHA 2L76A 4X62Q 3ALBA 4ARCA 1YITA 2Q2UA 4KVGB 3MJWA 1VQOA 5DLQE 2WWZA 1Q3LA 3PF4A 4HMIA 4QUCA 4A3KG 2UU7A 3TEWA 3NP8A 5KYLA 4WJQA 3AE3B 5E4WC 4XYOA 2NBFA 4GXBA 2OJWA 4BKSA 3Q22A 3X3NA 3HUIA 2DAJA 3U50C 2Z0SA 2I1KA 1NY4A 5IGDA 1KAAA 2O6VD 4ZHOA 1GJZA 4A3CH 3HRDD 2JK8A 4LNFA 5JH5C 3UIPB 1FXIA 3AE9B 3Q0AA 4XWTA 3DHHC 5T1IA 2FUHB 1VDZA 3GOEA 4NAWA 1BUVT 2A68C 4IFDG 1A15A 1SAPA 4F87A 4FXDA 3A7AB 3CIRB 4M8MA 3TSSA 2E3TA 3TBLD 5IGBA 1ZP0B 3NTIA 3PF5A 2N78A 2GLSA 2K3UA 3VH4B 4FXKC 1MFWA 2NPTA 3DWGC 4ZUJA 2BF8B 1YJWA 1EZ8A 2K25A 1LQBA 4GDKB 2UUAQ 4IPHA 4YIJA 5GROA 2QCZA 2KECA 5L83A 1PH9A 3M4OH 2CKHB 2HTME 3S14B 2D62A 3AE5B 4LJOB 3RNUA 3W1BA 2KFJA 1VQ8A 2RPVA 4MGYE 2N49A 3C1FA 2LGSA 5EQ0A 3DHGC 4DR2Q 4GB9A 4M0WB 1CQVA 4RM8A 3AECB 2QDBA 3FILA 2LUEA 2K33A 5NUCA 4A3EG 4A3IH 1E6EB 2WXFA 2INDC 2K5PA 1IYUA 2H1EA 1F77A 2CJOA 3J80i 5J2RA 2WX0A 2Y0SE 4OEMB 4KKTA 1PRTC 2FCMA 1UF0A 2RF4A 2JWZA 3MC9A 4OL7A 2QCPX 1SB3C 1XD3B 2YU9H 4LW1A 2W54A 5JJLA 4ZRIA 1AP0A 1L6UA 4XQNA 1EYCA 3AN1A 3VH3B 2D5DA 2EPBA 2OHFA 4G7OC 2BQQA 2RSOA 1EO6A 1U4RA 4IN3A 2WFWA 5EBDA 1T0RC 2NVXH 2RHSB 1OFFA 1E9MA 1HTPA 4JIOU 4B9XA 1SJED 3P4SB 2KNBA 4DK1A 2OEOA 1WJUA 3MZ5A 4HCEA 3ZTDA 3SEBA 4K7UA 1ZXTA 2VUMG 1SJHD 3RZFA 1DXMA 1PH3A 3HOVB 4WJPA 3GTKB 4RWSC 1R9TH 3C19A 4DUYL 2K5QA 2F0SA 3PGEA 4WH4A 4D2KA 3GTGB 2N7JA 3S2AA 3T1YQ 4DPGA 2RCFA 2SEBD 4DR7L 4NXML 2O2LD 1H4RA 5E4XA 4HJ8A 4IM3A 3A0JA 3B0AA 3ZNID 3MA2B 4ZLTF 1K8AC 1GAQB 1PYWD 2F0IA 3BIID 1I4PA 3HKZG 1C4PA 5CHFA 3L4PA 1BVSA 1F2RI 3FILB 1BCPC 1KQSA 4KKJA 4A3GB 2KMCA 3H8HA 3PLVA 3ML9A 1FL0A 2LASA 4OWXB 1RLFA 3Q14C 1TWAH 4EQ5A 1YVCA 1VLBA 4R4IA 4L1BA 3A1QB 1L4ZB 1QKZA 1WX9A 3QA8A 4FF2A 1KH0A 2KXJA 2BDNA 3L0WB 1SNCA 2G45B 4X66Q 1VQ9A 3GTJB 2DYOA 2LMCA 2Z0EB 4L63B 5EE0A 2Z8LA 3QHTA 3RNFC 3BZKA 1MJDA 1N63A 2LWPA 3OPOA 4H02A 2GOWA 2FBWB 1STEA 4BOZB 4JI1L 3OSOA 3K7AH 2WP8J 3VR8B 2W9NA 4BY1H 2PI2E 1N36L 3EROA 3TREA 1GB1A 3CAMA 3JW0X 4E71A 2WXNA 3MWYW 3SXHA 3T1HQ 1B9NA 4OX9Q 2W55A 4R4QA 4EZKA 3G6JB 3QWNA 2I2YA 2VQFL 2O6VB 3TMPB 3W5OA 1TIFA 4HK2A 4KIKA 1AYFA 1ET9A 5JHBA 2WXIA 1WCMH 2K05A 3MC0B 4AUQC 4OO1G 2JZPA 3P1HA 1J9OA 1E5WA 3IHPC 1X3GA 3OYYA 4R9WA 2UXCL 1LGRA 1NAPA 1T5EA 1ENAA 1STAA 2B2YC 2K9XA 4A3KB 1I4XA 4A9AA 3MTSA 1CKMA 3HOZH 2K6QA 2PIAA 1VQHA 4FXCA 2K03A 2GA4B 2LVOA 1SXTA 1NJIC 3PUVA 4F8MA 4GKJQ 2QIEB 2CW0C 3CHBD 1WXAA 3NZSA 2D9UA 4A93G 2C5CA 2BA1A 4BXXH 1S40A 4NY0A 4MT5A 1SR3A 1QOHA 3I7FA 3M85A 2M19A 2E2JH 5DPSA 2KCTA 2ZPNA 4AOFA 2OTLA 4FJVB 3DBRB 2QW7A 3F1ZA 2XNAC 3H0GH 4N9PA 1K53A 4ICVA 3VR6A 2UUBL 3ZNHB 2K01A 1WMHA 2R7DA 5GAGC 2Q2IA 4YSZB 3A56A 3KH0A 2BTEA 1XMQL 4WAAA 4F1SA 3ZXRA 4HIOA 3MP9A 4DV1L 2KC1A 4WIPA 3S15B 2IW3A 5EKIA 3H15A 1LXDA 4LF8Q 2F3IA 2CHXA 3DM3A 1PH6A 3M7GA 1HRJA 4BA2I 1Y8OB 4A3EB 3UI2A 2IL8A 1JORA 4LFBL 4IM2A 1E1OA 3R2TA 1VMCA 1VQPA 1I35A 2PKOA 2SNSA 3NSWA 2B63G 1XF5L 3VR9B 3HM6X 3KBXA 3UE0A 3NEMA 1KDCA 3FKYA 1UNSA 2LZ6A 4TQUS 2ZJQA 3VYSA 1B3AA 3J7AV 3U4EG 1VR9A 4F7ZA 1XLPA 4WQMA 1KNAA 2HDEA 3NVZA 4KLKA 1XO3A 1I3QH 4XT3B 4U673 2MEKA 1T0QC 4MJSA 2K50A 1HTQA 4XYQA 1OQQA 1XTCD 2EYHA 4X64L 3OMCA 2CH4W 2BT6A 5TSSA 1WGRA 3P4PB 4APVA 1D7QA 3R7QA 1S5FD 3M95A 2JRHA 2H4OA 2LGYA 2C60A 4RFBA 4DDID 4OW0A 3TEYA 3URYA 3PRZA 4EFOA 1TY0A 5AFWA 1SNPA 2AEHA 3EC8A 3KYHC 2NTTA 1E0BA 4ZDVA 3I70A 3ZNZB 1GUWA 4HJ9A 4QB4A 5AZHA 1UWVA 2WXQA 1HFGA 2VH1A 1VQDA 3J81E 2KOXA 1DGSA 1K3BC 1TWGB 1AFPA 5IP7H 3A5ZB 4AQYL 4HJ7A 2YTXA 4XYCA 4GLXA 2X6GA 1XJVA 2XIWA 3HKZB 2VQEQ 2HDMA 4RMFA 3KBGA 4CDFC 5FKAC 5IGEA 4MDKE 4DFAA 3RNBC 3HP3A 2FCNA 2M8SA 1XMOL 1IW7D 2J42A 3E9HA 2L12A 2R92H 1HNWQ 4LDTD 1JALA 4NXNL 4KDLB 2HIXA 1OQRA 4KD4A 1CT1D 1L4DB 2BVCA 2CHWA 2HTHA 1KRHA 1V1PB 1I4GA 1LYLA 1PH7A 3STBC 5CX3A 4QY7A 2NUCA 3LNNA 2LFNA 3EIVA 3QX1A 1UE1A 4JG2A 3DVNV 3KWVA 4AQ7A 1VZ7A 4IOIE 2BYTA 1WX7A 2RSUA 4IM0A 1EQRA 3NUCA 1SNOA 4FVMA 2CQAA 2QC8A 4A55A 2XN9C 1Z6HA 2WAQG 4LF7L 4ANVA 3TRZA 5M3FH 2EXZA 1GUOA 3PUZA 3B2FA 2K14A 1MSHA 4HJAA 2RD0A 1A6XA 4ZOHC 2LGIA 4IJLA 3A5UA 4DV5Q 2JXXA 1JOQA 5BMGA 2RDFA 1LV9A 2A6HC 3HOWH 3M3JA 1YHQA 4PG3A 4GN4B 1B50A 3S17H 1QQRA 2FAZA 4A8XC 1N6ZA 4ITKA 1TGZB 1HCZA 2JA8H 5IO9A 4LF4Q 1FNWA 1V8QA 5ELEA 1W2BA 4BKTA 3H94A 4IUQA 4IALA 4PQXA 4ZRZA 1PH1A 1MJCA 2A68D 3PGZA 4A75A 1L0WA 1C4AA 1F9SA 1BBXC 2EYOA 4GOPC 1F1HA 4LFCQ 2FHTA 2JUOA 2W3RA 3AB5A 3I57A 1LTGD 5ELOA 3SU8X 2N4FA 4KHZA 5GAEC 5CV8A 3KLSA 4UP7A 3HS0C 3R8BA 4K8IA 1WD1A 2LRWA 3NY5A 2JA9A 2C9OA 2JA6G 3A4RA 2PI2A 4H44C 2MQHA 4JI7L 1UD7A 3BINA 4M01A 3VRAB 1U4LA 3QOLA 1NE3A 2ZJPA 4A93B 4UP8A 1LFDA 5FO8B 3N9YC 1Q90A 2V4IB 1E3PA 4HPPA 2Q2TA 1WGDA 1IBKQ 3HKSA 1Q1OA 4JE3B 3BDLA 3C8YA 3W1SA 4HJKA 4JI6L 3J81c 3ECIA 3Q2AC 3BVZA 2D5GA 1VQ4A 1VCBA 3IVFA 2R7ZG 3APCA 2BS4B 1A8VA 1D6EC 1JC7A 2J7QB 2Z59B 2N55A 5IT9L 1PRTD 2AQ2B 3EA6A 3J81j 4JI2Q 3J81i 1HE8A 3W2DA 2JA5H 2B3AA 2PPHA 3LDZE 1H9SB 1U4AA 4K6DA 1ZXIA 2LEKA 2N1VA 2WXGA 2MFIA 2P5ZX 4BBSH 4BA1I 2HQLA 2M00A 2K1FA 5LNK1 1TYGB 1LO5D 5BYSA 5EAYA 2N9LA 1IBLQ 3N1ZC 1TBEA 4WFN3 1F2YA 2DNEA 2NR2A 4DQOC 1PTOF 2D0PA 1PZJD 5M3MG 1DGJA 3DEOA 4V0BA 3HEJA 5ISRA 2KHSA 1B7YB 4DUZQ 4ZKCB 1XX8A 2BOSA 2HDLA 3GQBA 3HM3A 3S2HB 2RCNA 4ZKBB 1OXVA 3HK0A 3RR5A 5DM63 1ML0D 3E9SA 2B63B 1N61A 4A3DG 1JQ4A 4HSPA 1HFNA 4GDLB 2B3GA 2UU9L 1FM0D 5BO4B 3NZUA 1GHKA 4GGQA 1HXYD 3DWQA 1Q1EA 1W3SA 4L5QA 2JSVX 4JV5Q 2LVPA 4JI5L 3F2DA 4DDGD 3MXNA 5CV5A 1SYBA 3HKZE 1MI0A 3NS8A 2WLBA 4DKAC 2C9WB 3U30A 1NI3A 1EY8A 1SFOB 1GG3A 2ON8A 2K6AA 4ODGA 1Q7YC 3QARA 4LDTB 4JYAQ 3HOYH 1BNZA 5CC4A 1EIYB 4BFRA 3RUIB 4LJPB 1MPEA 5BYQA 4KGRA 1P3QU 1HUMA 1HNZL 1I6HB 5FO7B 1YJNA 5KHQA 4PMBA 2INNE 1CHQD 3QG1A 1FR3A 1HZBA 4HDOA 2R93H 1WWTA 4BOSC 3VUYA 4IZ8A 1TT5B 1P9DU 2I1JA 1WYGA 4RH6A 5BN3A 1JICA 1Q10A 1J5EQ 4P72A 2UWQA 1A0IA 1FXAA 2L52A 1HQRD 5HHDG 4B3TL 4A3CG 2NVYB 1Y8PB 2V1YA 3QCAA 4KZ0A 3M3YH 5DM73 5G3LD 4DXFA 2JPHA 4HWIB 4JI8Q 5CTRC 1XPOA 4A3BB 1S1QB 2ZVOA 5C44B 3J7A5 2REXA 2KD0A 1EYDA 3AEAB 1E2VA 1ZKOA 2FJ2A 5CV6A 3FVQA 2V4LA 3RCZA 1OTCA 4K81A 5IYDG 1CKOA 1QOBA 4DK0A 2I07B 5FLXL 3CCRA 3EFCA 2KHIA 2KCCA 1KAWA 2Z0DB 2OCEA 2IDYA 2KHJA 3QJYA 2C7NB 1MIUA 2N1WA 4F8CB 4BZAA 2DN8A 2X38A 4RGTA 2B2VA 3OTOL 3ND9A 2EKIA 2BGFA 1J7BA 4JPBW 3LYYA 3RI7C 4BBRH 3B9JA 4HPLB 3MEHA 4BS9A 5G55A 3I4NH 3CCEA 3JSVA 3CQZB 3A4SC 4A3IG 5IYCG 2E2IB 4E74A 1VQIA 1WI0A 4DV6Q 1WGHA 3VTUA 1WD0A 1TZ1A 2CW0D 3J7AF 1B4OA 3KF6B 1DOLA 5I2YA 3KJOA 1JCKB 2JEBI 4ASWC 1GUGA 2ZEQA 2KJRA 1FFVA 1XNRQ 4DAYA 1CFMA 4DR5Q 4B6WA 3I4LA 3S1MB 3D31A 2OT2A 4LF6Q 3V62A 4GOCA 1PRTB 3CP0A 3IFDA 4OIKA 3TP7A 2C5LC 2K5NA 4K2KA 2JA6B 5C2TB 3ZJVA 1S5BD 4KK7A 4C56C 4DV4Q 4KSLC 1L0XB 3ZGZA 4IPGA 4JQWC 1D3ZA 1SE8A 3NTKA 1WRDB 5D3DA 1PH2A 1QZHA 2DY8A 3GP7A 4IW0A 3D0FA 5BMHA 1IBML 5IKCM 2NZHA 2F0NA 3CXCA 1HHVA 4DGZA 2JY6A 5C5MA 3FAHA 4KV6A 4GNXA 1AH9A 2ZXOA 3A9JA 1SE9A 2JXMB 1BT0A 2KQ3A 2R7ZB 4WQOB 5IYBG 3OMGA 2M1MA 1Y8NB 3NK9A 2VW9A 1FJGQ 1K9MC 2D3BA 4NJCA 2MUYA 3I4MH 1WTXA 2F4IA 3KDFB 5IGGA 1WR1A 4KX6B 4MH8A 1SNMA 4N9F4 1QZEA 4RMAA 3CRLC 3NTHA 1TS5A 4MN3A 1Z5SB 1QWYA 3EN2A 2WHIA 2M0AA 1YNNC 4QUFA 1E7PB 5IE8A 3NVVA 2IBIB 4EEWA 2JXTA 3D4RA 5M3MB 1X3FA 2BS2B 2PZTA 2IHFA 2DX5B 5HKHA 2AQ1B 1UH6A 4FF1A 3AE4B 1TS2A 2BS3B 2MHJA 1ZDVA 2LHEA 4FADA 3I5JC 2Z6BA 4AIMA 1HQMC 4A3DB 1XTDA 5C4JB 2NBWB 3TZDA 2K8BA 3HOXG 3UIOB 3V60A 4N59A 1DONA 5IY0A 3R7RA 2BB6A 1JRPA 3VUWA 2UXDQ 2JSOA 1RODA 3P2BA 2ZNVC 2E75C 3AFQA 4DR4Q 5BR8L 4HPMB 3RN9C 4HEDA 3TDQA 3TN2A 1HJPA 1V43A 2KUMA 2L1AA 3VHTC 2Y5CA 3FKIH 3HRZC 5KRUA 2TMPA 2HHHL 1WH3A 4C4VA 4FJYA 3PO2G 2DNCA 4JK1C 3E0EA 2ZXRA 2F0FA 1P7FA 2CHBD 3AEGB 4C3JH 1TKWB 3P42A 2HUGA 3JC66 2MBOA 4PZ7A 1TS3A 2MPMA 2AL3A 3GDEA 3K8AA 4XTCS 5E1FA 4AS1A 3I56A 3KUPA 2ZTEA 4FNFA 2K8CA 2Z9HA 2GMIC 2PEAA 3PVLA 2D11A 1GKHA 4O0AA 4YSXB 3NENA 2F0KA 1JE5A 4OZAA 4CO7A 1X3QA 3EFUA 3VR5A 4Q5VA 2WAQE 4B3MQ 4FN2A 3FRPB 1O7IA 1EY7A 2WACA 3ICEA 3UI3A 2NZ1D 2NS5A 4G50A 1KRTA 1OTRB 2KWUB 3U7ZA 1C78A 2F0JA 2WIIB 2XK5A 4UY8C 2KTRB 3H0GG 4KMUC 2ZCBA 1YIWA 4EGVA 2A6HD 1FD6A 2N7EA 2D3GA 4G3XB 1NTGA 1L1OC 1WTQA 1YX6B 4DR1L 2KX0A 1V9PA 3W5UB 2QGQA 3M4OB 2FMMA 2CVRA 2N8NA 3VYTA 3WDNA 5F2DA 2K6DB 4JBWA 2KO3A 3SR6A 3S24A 1X32A 3AULA 4QAYA 3SD5A 3SK6A 2DNFA 1ILPA 2HJ1A 1WJ4A 3RLOA 2RPQA 3KUZA 1ILQA 1N33L 2RGFA 2WYQA 3V96A 3MAQA 4M8AA 1YMHE 3OHXC 2W3SA 3ML8A 3GTOH 1V9JA 2WS3B 2KDEB 1A2UA 1WM2A 3M4YA 4A3IB 3N20C 1BR9A 3DMUA 1CK1A 5CV7A 4LF5Q 1HZAA 1STNA 4M8NA 1ESFA 1VQ6A 2M17A 3KLSX 3SFEB 1XNQQ 4B3SQ 4K3CA 3FC4A 1EQQA 2YU9B 3WALA 3NELA 3CF5A 4NP5A 2XTIA 4YCWA 2EZVA 3A9KA 1C48A 1NMGA 3J80L 2NVXB 5KYIA 1OGWA 1WXVA 2PW7A 4LLGM 4MSQB 4JWSC 3NVWA 1BKBA 1SMXA 1YEZA 3L17A 3DBLB 5G5GA 4F7XA 4A76A 4HXDA 3NWSA 2A4ZA 4DR2L 5H92C 4XWWA 1FRDA 2HIVA 3U58A 3S1RH 2J53A 4K5VA 2V4DA 4ZHPA 1R9TB 4LNKA 5J3BA 4ULLA 2MBEA 3TQYA 4S17A 3QC8B 1JMLA 4X65L 5AUKA 1STYA 4ZCKA 5CBEE 4E3CA 2BDOA 4IUUA 5M5XH 5JEAG 2GBNA 3SK4A 3EHVA 4LK0M 3D4DA 1ICWA 3A74A 3WOFA 1JOOA 1JW9D 4BKGA 3GTPH 1L1OA 4HJGE 1EQVA 1KL9A 1S5ED 4GMVA 3S1NB 3VTWA 4EZJA 2WU2B 5H8YE 3W9CB 2CU1A 1KLUD 4DHJB 4LAAA 4UPAA 1K8OA 1B9RA 1XT9B 1RWSA 4DV7L 1H9KA 4MELA 4K7SA 3W5VB 4TQ1A 5C0XG 4DR6Q 4EOYA 2E6XA 3BZCA 4Y7NH 3OAWA 3F2CA 2EYLA 5M5WB 4XT1B 3HOXB 3QO2A 2XRSD 4B3RQ 1P98A 4YWGG 1HZCA 2KX3A 5MPOA 1LTTD 3IG3A 1P0RA 1QNUA 4FDBA 4A3MG 1U9RA 4LWCA 4DV3Q 2MBQA 4JI4L 2L11A 2L9HA 4P74A 3JVZX 4KY6A 1SE3A 2WINB 5LMNQ 4X3TA 1EUVB 1B9MA 1HNXQ 2LXAA 1PUTA 3PHWB 3RNAC 3P7JA 1HR0Q 3A54A 3PO2B 1WZ3A 2ZVNA 4W9CA 4AP4C 1FD7D 1GO3E 1QB5D 1RKNA 3QIAA 4OVUA 5C23A 2FIFA 2MO1A 1EUJA 3ERSX 3G4SA 2JA8G 3GTLH 2EMTA 4MGZE 3PT2B 2KQSA 3AXCA 3HVDA 4X66L 2F0EA 3AE2B 1K83H 2QDLA 1KDAA 2JN4A 4G7ZC 3PO3H 1PGBA 4UP9A 1R4QB 1D1IA 2I38A 2L8JA 2MP2B 2EYMA 4A3FH 1CKNB 1NR4A 4HRSA 3RZDB 3K5LA 2KENA 1KFYB 4MM3B 4LMQD 2KOLA 2WDRB 4FHKA 3IAYA 1A63A 5GXGB 2EY5A 1ZDXA 3H1UA 2A69C 2BKRB 5C3XA 2D2QA 3KF8B 1WJ6A 4GOPB 1IL8A 2WB1G 4US8A 2EYJA 4R4OA 2Y5BB 3P20A 1M1KC 3F2BA 3B1LX 2CJNA 4W9EA 1UE7A 3H0GB 5EPLA 1N34L 3ER0A 4CBVA 4IJHA 1EOVA 5K36H 4DXGA 4ZUIA 4DHZB 2K52A 1MVKA 2INCC 3NBHA 5FLMH 1UEAB 2D3AA 3NUHB 1QE6A 1DOXA 1CI3M 2KK8A 5KIXA 2UUCQ 3CC2A 3DWPA 5C1ZA 3O13A 3G7LA 2PW5A 1UZXB 3LWUA 4J1MA 2L0TA 5LL6X 3FEWX 2EY2A 5M5YB 1NDDA 2C7HA 3H7PB 3TS2A 2N9XA 1WI5A 2Y3AA 4B9KA 2VRRB 4JOIA 1I6VC 2EJGC 1SYEA 2EYFA 4II2B 1EY6A 1SROA 3RZOH 2KWDA 2BA0A 4A3LH 4QL5A 2R6GA 3BK1A 3K5NA 2RQXA 1CQFA 5HY6A 4ZRPA 1PV4A 5EJWA 1XEEA 3S14H 3Q8EA 3GTMH 3JYUA 3IFWB 2PQAB 1N9WA 2Q2HA 1WY8A 3NG0A 4GLVB 4WJNA 4DWFA 4GLAC 5EPKA 2DWQA 4LF8L 3Q8DA 3CC7A 4RNAA 3DHQA 2V1CC 2IZVB 5COYA 1GVPA 2D10A 1TWHH 1PH5A 1X6OA 4DNRB 3Q8BA 4MNOA 3I3CA 4RGMA 2B8GA 4DUYQ 1YNND 3HOYG 4N58A 1D4BA 2KQ4X 2R3ZA 2MQJA 4DR7Q 2QMTA 1IBXB 2QKIC 1H95A 2ZW1A 1QUQA 1WTHA 1DOKA 1GOZA 2Q8IB 1WOCA 2B2TA 3OW7A 3RUZA 2KQ7A 4BAXA 4IURA 2IPKD 5EKKA 2IO2B 1OXSC 2KEDA 4PNYA 1Q81C 2QDFA 1GUNA 4A3PA 2AUJD 2JE6I 1X1MA 1ZXHA 2WU5B 2F0DA 1D5XC 1XXGA 2L1BA 3AEBB 4WJOA 2F0MA 3EECA 1MJEA 1WYDA 1K50A 2D07B 3VR2A 3CCQA 2R92B 4WRDA 1P1AA 4EQOA 4P6VF 5JPMC 3HOVH 2M9VA 5JXVA 2H89B 3I55A 4MEMA 4ARIA 1Q86C 1ISNA 3GTGH 4IFDI 1F2MA 1WJJA 1F9PA 2IT1A 2JVCA 2KZRA 3DBRI 4ZRJA 3VAWA 2K5HA 5EE3A 4LK1C 1T5XD 1XPRA 1H9MA 5CR3A 2CS4A 1EZ6A 3PZDA 4J15A 1TKGA 4TSSA 2KBNA 2IX1A 3OW2A 1YN3A 4DV0L 3SHQA 4A20A 3FP9A 1SMYC 2AUKA 2I5HA 4JI1Q 2VQEL 2EJFC 2HT1A 4A3MB 5C0XI 3K7UC 4G0NB 5CV9A 1N36Q 2OF1A 4A3GH 1I50H 3I4NG 3ONSA 5EE1A 2IYDB 2NMQA 3DWMA 4M00A 2LXCA 4BY7H 4W9FA 1FCLA 2M0XA 1VQEA 2VQFQ 3HOWB 1AZPA 1Y1VH 1S3SG 3MVVA 1YJ9A 1P8LA 3S17B 2PJHA 2WDQB 3WAOA 4I65A 1KXLA 2CWAA 2JA8B 2WDTB 4BKSD 1ZEQX 1EU4A 5E6NA 2JZZA 1LM0A 2WXLA 4CJ1B 1J0GA 2UXCQ 1PFDA 3UDXA 1D8LA 5HI1A 3TBIB 3M7NA 4JW0A 1QOFA 3N52A 2M4NA 2NWGA 1CM9A 4N8X1 3R3OA 3H3VI 4XZ4A 4B0EA 1SIJA 1CUKA 1EWYC 4DHZE 3KOJA 3SR1A 3JAML 3BY4B 2FMCA 3MHSD 3OG5A 2DGYA 4R8NA 3IAS1 2YTVA 4DV5L 3U4VA 1SE2A 4RAUC 2MBBB 1E7ZA 2K4KA 1ONLA 3Q24A 4IWPA 4DXAB 2SNMA 2WB1B 1WRIA 1X54A 4HCSA 2NVUI 5FJ8G 2RDGA 1X56A 2Z4HA 3OWEB 2KJHB 3BK2A 1AN8A 1V81A 3LXFA 4USAA 2RHQB 3MFYA 4TMAB 4JBJA 3K5MA 2UUBQ 4CJ2C 2KFKA 4HMJA 1TVXA 1VQKA 1SYGA 4A3KH 3KVFB 4X3UA 2L4NA 2DYMA 2EVBA 1C0AA 1XMQQ 1C4CA 2QSDA 4MTKA 3W1SC 1UAPA 4A3BG 3T8MA 2EIFA 3RLNA 5C44G 2DLBA 3IXSA 4TQ0A 2F3WA 2XRQD 2V3NA 5J1ZA 4ZK9B 2ZZPB 5A35A 4YY3L 2BYVE 3Q3FA 3D32A 1O7ZA 3GTQH 2ZM6Q 4RGNA 3PIOA 4URKA 1V6EA 1WE6A 4N8FA 2WDVB 2FIDA 4W9HA 1HTLD 3J81L 1G6ZA 3MC8A 4LFBQ 3ZVVA 2JZ3B 2KLGA 4KHPL 5JJIA 3N1YC 5DEHA 5AEKB 4K1RB 3WAPA 1VS0A 1VQFA 3ZQ4A 4A3JH 4PYUA 3QIJA 3WANA 3ZKJC 3NWTA 4QIWB 4CKCA 2I0QA 4G57A 2LFIA 2YLMA 4HIKA 4JI0L 2MGSA 4TV3A 1FNUA 2E2DC 1VQMA 1YHAA 1G6PA 4K0KL 3QQ8B 1TWFH 4J6IA 3UDGA 3P63A 4NAMA 1MBYA 1Y1WG 3S15H 2QEXA 1WJNA 4HLEA 1A62A 1Y14B 2ALYB 3D8GA 2ATWA 4ANWA 2E76C 1MHWC 1NBFC 1LTRD 3I72A 2E5LQ 2JF5A 4DUZL 3P4RB 1RL2A 4YL8A 2QA4A 1C7YA 2JA7H 3MHBA 2EOTA 3AYHB 3S2DH 3HOYB 3ETRA 4OO1I 1FNVA 4C3JG 2G3QB 5G5HA 1RD9D 1I94L 5I9OA 4DN4M 4R3DA 3FDTA 2PMVA 1EOTA 1NVID 1CHPD 1EWHA 3FMCA 1WFQA 1E1TA 2GBKA 4YT0B 2XWJB 1KLGD 1PDQA 3CCSA 2OTJA 4V190 3T4AC 2RKSA 2VZKD 4ZAIA 1WE7A 4PYZA 4RM9A 1X55A 3PUWA 2NVTH 2K39A 3RNGC 4KDIC 4AH6A 1JWSD 3LGJA 2PTLA 5CHVC 4P75A 2PQEA 1U4MA 3H91A 1XMOQ 4CDDC 4XDDA 1WM3A 2KMMA 1F2RC 1PFBA 5CHWA 1BO0A 2EY6A 3K0XA 4OHJA 4DV2Q 3UE1A 4NXNQ 2VUMH 3M3YB 2BWES 3WA0A 4LNNA 4OXPA 4NKLA 3OIQA 3CCLA 3HOUH 1G291 4JGHB 4JYAL 5IP9H 4FP5D 2GVAA 4GDKA 5E6PA 1EIHA 1HA5A 2EKEC 1J19A 3KJPA 1JR0D 4KY7A 2WXHA 2H88B 1TIID 2W82A 1UWXA 1I4HA 2N3SA 3ZW3A 1B44D 1PGAA 2LGXA 4OWTB 3KLWA 3N6RA 3GE8C 4KN7C 1S5CD 3PO0A 4GN1A 4GSWA 2CQOA 1TWGH 3NHHA 3VA7A 2I5LX 3CMAA 3G71A 1Y8RC 1KF6B 3IL8A 3EBEA 3L9AX 3CSTA 4M0WA 2YTYA 4IFDJ 4LF7Q 4C3HH 3NPPA 5IWAL 2X8XX 3S16B 1PVOA 1XWEA 3IKJA 4HROA 3DDCB 4RKBA 1E8XA 4FBJB 2N9EB 3I4NB 4NAWB 1L1OB 3X23A 4PT5A 4M02A 4K2LA 1YQ4B 2L55A 3IRBA 2B2VC 5D65A 1IUEA 1EU3A 1TQOA 3SVMA 2NPTB 1UUPA 2NN6G 3F8TA 2WB1E 4NPNA 1EY9A 3ZDTA 3TEHB 4LUOA 5C0XJ 2PMZB 2PZWA 1TWCH 1P7EA 3C0RB 1EEFD 1Q8KA 3PV0A 4IUTA 2LXKA 4IQZA 3GZNB 1B1ZA 2BKFA 4IKGA 3FPPA 2WXKA 3AB9A 2D3CA 1BCPD 1XLOA 3ZNGC 2AL6A 2LJ5A 2J0KA 1X65A 1NEKB 3CPFA 4JI7Q 2GN5A 3ZJTA 2A74C 1F9JA 3PUYA 4JBMA 4POGA 1N32Q 3EQLC 1I4RA 4LTUA 1V1OA 4FYDA 1Q82C 2UYZB 4KN4C 2IY5B 3NJTA 3HIZA 3PZ7A 1DOMA 2K75A 1XLNA 2GBRA 3OJ4B 3G48A 3MXPA 4UDUC 4GN3B 1KM7A 3PLUA 1G2TA 4WWOA 1W6KA 1KTKA 1XNRL 2RMMA 2WKDA 2B8FA 4DR5L 1T0SC 2JP1A 2RA4A 1WXMA 4RA8A 3ZJYC 1HA6A 4QIWE 2YYZA 4LF6L 1RYJA 4DK3C 3I4MB 5FK9C 4YWKA 1YZ6A 3EFXD 4GNXC 4GKKL 1CJEA 1K8RB 3KWLA 1U0LA 3KYCD 4BBNF 2YEPB 1BOSA 1PTOH 5FLXE 1YN4A 2F0OA 2ICIA 5LMNW 2KJXA 3E56A 3L3OC 1N5WA 4P73A 2OOBB 3A1QA 2KEEA 4PMCA 2D0OA 1DZ1A 1WGGA 1JJCB 1STBA 3NVYA 1DOYA 1LABA 4C3IH 2ZJRA 1TU2B 1WZ0A 1IPGA 2JT4B 2BH2A 4P1BC 3SFDB 2ASQA 3BVGA 2UU9Q 1MG4A 4WORA 1YN5A 5C6AA 1M90C 2JU6X 1FJGL 3KFUA 2NCNA 3PIPA 4ALPA 4YCUA 5I2XA 2DZMA 1B8AA 3DVGX 3A55A 1KABA 4JI5Q 4IC7B 1WXSA 4II3B 1GD7A 1Y1WB 2VZKB 1KOTA 1TXYA 2O6VA 1STGA 3O65B 1R4NB 5JHAA 4CDCC 5EBCA 2K32A 1FMAD 4PK1A 2INPE 2WXRA 4LF9L 4X57B 4BVUC 1SNDA 2KC2A 5HGQA 1UGJA 4MH0E 1IL2A 2DBYA 5C3EH 5ELBA 3PPAA 4B0MA 4C3JB 5H1SE 2LMCB 1RDPD 1R4NI 5CORA 4C2MB 1ET6A 4DNIA 1K0RA 3G6EA 4DF7A 2JQOA 3ULPA 1LT5D 2DY7A 1NMFA 1PA6A 2BW2A 3PZ8A 2M56B 3L16A 2JYEA 1RRBA 4UHVA 1STHA 1V80A 3DUZA 5LMUQ 2HCCA 2HD3A 2VZAA 3ZRFA 2KA7A 4P71A 2LRUA 3A8KE 1GUTA 5J18A 4B3TQ 2O2VA 5AZFA 4KIKB 2PVOD 4HSVA 1BUIC 4W9KA 4B9WA 4M1UB 3PHXB 3DM1A 3RPFC 1XLQA 4MZ9A 4PS3A 2V3PA 2MCNB 3TEZA 4R8IA 4NZLB 2KMAA 3GV6A 1F0ZA 4PS7A 5A2QL 3CMEA 1I6HH 1YHBA 3FPUB 2UXBL 5IGCA 4C80A 1PRTF 1YJIA 3DPDA 3S1QH 1PFMA 2K0PA 2V9HA 3UF8A 4K8JA 1SBBB 5FLXc 5C4ZA 2E8GA 4QMGA 1E24A 1VZ8A 2BB5A 4CDEC 4L8JA 1C79A 2DYBA 4CQNA 3AMZA 3RZWC 2F4VQ 1QG7A 4FF3A 4NQLB 2I5MX 1BCPB 1H9RA 3R2IA 3GTOB 2AHOB 3RYTA 4CGYB 5LHY1 2KWCA 3TMEA 4L5TA 4KSKC 1ICFB 4LFAL 3AM9A 3AEFB 1CA5A 1TTNA 4C1NK 4DR3L 1ASYA 5HG2A 1WMHB 2O4XA 4XQQA 1WTPA 1IZ6A 1JJ2A 1QJOA 3MXGA 4BY1G 1Y69U 3Q23A 2BYEA 2BCOA 4DHJD 1GXDC 2ZCCA 2F0VA 2MBHA 2OJRA 1KD1C 2KTFA 3SDLC 4FO2A 1E7VA 2NN6I 2F52A 1GJXA 1K8GA 1WCMG 2KHWB 4GZYC 3CW2C 5AJ3L 2SDFA 5BN4A 4K5WA 1HZ9A 2NZOA 4XXEA 1N5XA 1NENB 1E2WA 4HDQA 3CQZH 4O2DA 4PZ8A 3S1RB 3U4ZA 1Q8IA 1EWIA 3HOZG 1UE6A 2BE5C 3STBD 2YV5A 3N32A 4WJWA 3DEPA 1GHJA 1TKYA 1PTOC 2K5VA 2MO0A 2KJ6A 2F0PA 4YTMB 2KACA 5BMIA 2K8HA 2E2HH 1Q0WB 4OELB 2X69A 4IOCA 4MACA 1K8MA 3I63C 4BXXG 4MJSB 2K1BA 3GD7A 3PRMB 3PCOB 3PV1A 5CYUA 1QNKA 4NW2A 1WTRA 2N88A 4X62L 3AU5A 1B2TA 1RAXA 1Q46A 1AW7A 4MTNA 1IKLA 1EL0A 3WIMA 2SOBA 1MG8A 2V0GA 3RN5A 4W9GA 5G3LF 1V1PA 1AARA 2L3ZA 1O7LA 4ME5A 2LXJA 3T16A 3VTVA 2J7ZA 3ND8A 3U9SA 1E7UA 4ABNA 3TZUA 1PH4A 3AE8B 5C5LA 3PIO3 3TIXA 2A1AA 4NB3A 2D2CC 1JE4A 3R93A 1NI2A 1AE3A 1GUSA 2CWPA 3PMFA 3DBHB 2EY1A 4KKUA 3NRZA 3Q8CA 3RNCC 5BR8Q 2XVSA 1JOKA 4JI3Q 3NHEB 5D94A 3ZIMA 1MHHE 1ASZA 3DBHI 2ZW0A 2HHHQ 4BY7G 5GQOA 3J80E 1TT2A 2NYZD 3DLLA 2UUAL 1RM6C 5DPTA 1FPYA 1Y1VG 2ZJDA 3SE0A 2F0LA 1VQCA 4L6TB 3GTLB 3PS6A 4S3SA 4XE0A 4X6AH 3DBSA 4A3DH 1EM7A 2KDIA 5JVH3 3D3RA 2LI5A 5LXIB 1MI2A 1IYVA 1YBYA 5FR6A 3UDIA 3SGIA 1K83B 3T51B 1EQTA 3AE7B 4LUZA 2PPBC 1DM0B 3BWUD 5HURA 2PW9A 4DK5A 1PFNA 2NB0A 4DAPA 1YQBA 4CYEA 4DV3L 2LSSA 3TP6A 3EVQA 4CKEA 1WTWA 3DBLI 1FYCA 3AFPA 3V05A 4H7BA 2ZT9C 2B2WA 1HPCA 1QCBD 5LMNL 4L5SA 4OWWB 1E10A 1VF5C 2ID0A 1RHPA 1Q12A 4IO9A 4HIDA 5IP7G 1UBQA 4FXGC 5IP4D 2KDFB 1C77A 1VZ6A 1LTBD 2WKCA 3BG3A 5JOBA 2NVQH 1KJTA 3SHLA 2WV6D 2GBJA 2AQ3B 2Z1CA 4KKIA 1KC8C 1H9SA 3T9LA 1VRAB 3BYTB 1ZGUB 3H9DA 2R92G 4DR1Q 2A5UA 5I9PA 1A3UA 3PUXA 4P2CB 1H9JA 1TWAB 2V3SA 1EIFA 3UGBB 3ZJUA 5J17A 2GB1A 2J0MA 3NE5B 2IGDA 3T1YL 1N33Q 4WWMA 4XDXA 1HZ5A 5LXHA 1RFKA 3Q3JA 1RJTA 2RSNA 1GC7A 3W1YA 3MFGA 1YNJC 1FFUA 4JVZA 4GDLA 1TS4A 1SSNA 2G9HD 2F03A 2F3VA 1A70A 4AJWA 1RTOA 1PH8A 2F0TA 3M9BA 1DJRD 1D5MC 1YD8U 3RZOB 3K7AB 5M3FG 2MA9B 3QOJA 4A3JG 3TS0A 2GI9A 4BY1B 5IYDH 4WWNA 3VVWB 1QVCA 5BN5A 1WF9A 3K9PB 3NBIA 4JOIC 4YHHQ 3T3OA 4G11A 4TUUA 2B2UC 1PYSB 2IX0A 3HOWG 2IX3A 3GTMB 2EELA 3EUB2 3VRBB 4ICUA 2L32A 4Q0FA 4ZQ3A 2ACZB 1R4PB 1WCMB 4LNQA 1I42A 2UUCL 2G1EA 3J80c 2J0JA 1ZYRC 5C4XH 1HTOA 2HJ8A 2YVCA 4PMWA 3E9IA 5IYCH 2KVRA 3AI5A 1TWHB 1CSPA 5J39A 1BBWA 4CJ0B 4XX5A 3ERQA 2JA7G 3HOZB 4P7IA 1O7YA 4IWQA 4X65Q 1XPUA 3AU4A 1DCZA 1T0YA 1EYAA 2L05A 5ELNA 4ACFA 1X3PA 3D6CA 3VR4A 4ZYSA 5FO9B 4C00A 2MJEA 3T1HL 5I4DA 1JWAD 4YTPB 4OX9L 2MP1A 3MXNB 1HH2P 1S3OA 3I9V1 1S5DD 3ZUNA 1E0ZA 2B2TC 2E2JB 3HZXA 1QOAA 1J6QA 1VQNA 3PREA 1VD2A 4ZRQA 2AX5A 4GN5A 2J4XA 2HCIA 4RHSA 1Y56A 5KHOA 3TCAA 1AE2A 3CCJA 1YJ1A 3K6OA 1LUZA 1WVLA 3L08A 1SYFA 1O78A 3MXUA 3HOUG 4YCVA 3H7SA 1G2SA 5C3WA 5IP9G 2B39A 3ULJA 2JA5G 3PRPB 2K5DA 3RT3B 3WAMA 3WOEA 4DV7Q 3ZLZA 2FINB 4BBSG 1RF2D 1VQAA 4GKJL 3UINB 2WXJA 4I6PA 1FRRA 1VQGA 1W6JA 3HG9A 3I91A 5IYBH 2GRIA 3V61A 3CSFA 1M4VA 4B95A 2DAFA 4RHRA 1JJGA 1G91A 1DOIA 5IGFA 2FUG1 3L13A 2R61A 4C3HG 1A2TA 3H09A 1V97A 3KK7A 4KI0A 2LKVA 4JI4Q 1VQ7A 2B2UA 3HFZB 3S1NH 2F0GA 5TR5A 1I50B 4DK6C 3WCQA 3KF6A 1WYWB 2PLPA 4G4KA 4KJOA 3VYUA 3PIP3 4BY7B 1XQQA 1KDBA 2K5WA 2KANA 1Y1VB 1ZPSA 3AMUA 4E6IA 1I3QB 2O5IC 1R4MB 2EE1A 1ENCA 2PNRC 4PV1C 1NNXA 1L0VB 5M5WH 3F2UA 3HOXH 4QCLA 4L5RC 1SF0A 1F2ZA 2A6EC 1KIXA 3Q3NC 2CHZA 1TZOA 4O1NA 1A3VA 4C7ZA 1R4MI 2L7RA 3QR8A 1IHZA 2JQRB 3JSVB 2K28A 2VS1A 2EMSA 4EKUA 4NXMQ 2LGDA 1U4PA 3HHMA 4MGKE 4EZLA 2BWFA 4P1CC 2OQKA 3SK5A 4ZYNA 3PO2H 3APFA 1YNXA 1SRUA 2ZXPA 1F52A 1UELA 1S4ZA 2R93G 2LJIA 1U5KA 3CF6E 2VNUD 4G7HC 2G4DB 1GUAB 1J8IA 5JPNC 3QK0A 1E8ZA 4DAYB 1N34Q 1OXXK 2XSCA 3VDYA 4RCNA 1N62A 2KKCA 3KDFA 4OIJA 3VUXA 3KYDD 1FVIA 4DBGA 2JRIB 5E6OA 2VH2A 2MJ8A 1K51A 3R3MA 4REZA 3RZDH 3GTKH 2IWHA 1K73C 3OLMD 2PZUA 2J52A 3APDA 4LNOA 3N1XC 1T9HA 4OZCA 3M4PA 4KD3A 3GTQB 1SN8A 1JROA 1ZKHA 3X3MA 4HTHA 1JT8A 2EDGA 3HVZA 4JWUC 1EFID 4GNXB 1VQBA 3UDFA 4C3IG 5I6YA 2O2VB 3A9JB 5ELCA 2MSED 4NPSA 1BF4A 1WGKA 1CSQA 5M3FB 4HIMA 1FGUA 4A3JB 2BE5D 4HEA1 4RF1A 4BBRG 1EWCA 1AEXA 2ZTDA 4XC2A 1HNWL 1X3EA 3CKIB 5ELFA 3VQIA 2JYOA 2L0CA 1MGSA 1PTOD 3DQVA 2JYTA 1KHIA 2KN4A 1L7YA 4HKZE 2XGTA 4UAIA 2Y5PA 1TWFB 3RN2A 3RULA 3K57A 1K52A 2WXPA 1XCTL 3SDZA 4GLSC 1ZUD2 2ZM6L 4HCNB 2IY0B 4AWJA 3AH7A 3M63B 5IODA 2AWNA 3GTJH 2BBCA 5M5YH 2KAJA 4EE2A 3JAME 2L0FA 4OZBA 4TKNA 2MWSB 1OXUA 4FF4A 2JA7B 1GNUA 1TKEA 4IUPA 5C3EG 1BDOA 3S2DB 3V6EB 4EQPA 3DVNU 4C7YA 2A8VA 2DZJA 5ELDA 2KYWA 3P75A 2XBBC 1HEZE 2XEWA 4YSYB 4DAVA 1RIPA 1T6BX 2I46A 3I8ZA 3I73A 5D14A 4AYBG 5HGTA 3CCUA 4HN7A 5BYRA 3OJ3A 1IGDA 2CR5A 2B2YA 1C9OA 2NVTB 3GE3C 5I6WA 1EYGA 2MJDA 2WQYB 4LF4L 4C4VB 4X3KA 4FLHA 4K6LA 3PSIA 4HVBA 1L6VA 2E5LL 2VUMB 2MX2A 1SE4A 5CBAE 2L5TA 3E0JA 2KTRA 2WXOA 1N60A 2LHDA 2WXMA 4LFCL 1C1YB 3HOUB 5LLIA 3M62B 1V2YA 3ZXVA 4KV2A 3I4MG 5CV4A 2JA5B 3C1EA 4DV1Q 1JQYD 1MSGA 1ACCA 2ZPYA 4BBSB 4FA6A 3M4QA 2NBUA 5JEAH 3H6MA 2RR9A 3I4OA 3BU2A 1UBIA 2MNAA 1B70B 4FHJA 5GADC 4ANXA 2R2QA 1L0YB 1SYDA 2MHVA 3NQIA 2R7FA 1JRUA 4ANUA 2N0SB 4DV0Q 4JX1C 1CTMA 1IBKL 4C3HB 4IFDH 1JWBD 4Z9CB 1YJJA 2KN5A 1SYCA 3A33B 1BMLC 1II3A 4XIGS 3AV8A 2QILA 3J9CA 1QILA 1E90A 3B2GA 1PLFA 1T3QA 4GS3A 4DV2L 3D6WA 1UE5A 3RMHA 2XK5B 3TUOA 1S72A 1PGXA 2WNMA 4JI2L 1GC6A 3PTFC 4RF0A 2LS01 1FIQA 2C7MB 2CFMA 4IG7B 3C2PA 3PSEB 2XWBB 3TEXA 1QF6A 2QJLA 4MHEA 5C0XH 1G8ZD 1TWCB 1SDFA 4J8QA 1LTAD 1JB3A 1MKHA 1HUNA 1J7AA 1V5OA 2AWTA 4NNJB 1IBLL 4X64Q 3FKIG 1UEBA 2JJQA 1XCQL 5DPRA 4DAMA 5LL6S 4A3EH 5D6JB 4A6QA 5T1GA 1RTNA 5JJKA 3CWIA 2G5DA 4IDIA 4A3MH 3Q69A 1SSOA 4YWMA 1SNQA 5JAVA 2ZNVB 3U8ZA 3IAM1 2AWOA 4Q2JA 3U52E 1Q1BA 1NYRA 3CPWA 1KRSA 2OQ0A 3JAMc 1M8AA 4GIVA 3GO5A 3C46A 1EF5A 5AZGA 4R1JA 3TP8A 1C8CA 1YNTE 2BH8A 4DNTB 2MRPA 3D4WA 1F9QA 3LWEA 1EY4A 4KGTA 3H3VH 3JAMi 2F0HA 3LX0A 4AQYQ 2R93B 1FO4A 1N8RC 4JV5L 3DVGY 4W9JA 1V1QA 1JWMD 1YNJD 1WGYA 4TRDA 3L7ZC 4J3OD 3VDZA 1NBWA 2PNHA 3T53B 1BBUA 3A9KB 1LTLA 5IT9E 4N6EB 4K14A 5E7NA 4H13C 2NBVB 2DJGC 4F88A 4EUTA 2DZKA 3CC4A 4FJZA 2AKWB 1K28A 2QEJC 3Q6BA 5L95C 4DA2A 1PTOB 4YY3Q 3TJPA 1EF1A 4JLCA 1N32L 1GM5A 5JEAJ 4KHVA 2PE9A 1VDVA 3DHIC 1WXQA 3AEEB 3TL5A 4R4CA 5HFYA 2AMCB 4IPCA 1EY5A 1ZYRD 3W3AA 3VA5A 5C4HA 4C3IB 4KHPQ 1SLJA 3A8IE 4XQJA 1ESRA 2F0WA 1YX5B 4L2YA 3BDOA 3T56B 3RFZB 1J5EL 1EFWA 1WSPA 3NXWA 3KQ4A 3Q3OC 4PS8A 4BBRB 3VFKA 4A90A 3V6CB 2OXPA 3DXJC 3L2PA 4JI0Q 5KNBA 5DNFA 2AYOB 3B08A 3NS1A 3IT4B 1CMXB 4JI8L 1SIFA 1PQSA 4IUNA 2IO1B 2BPSA 4K0KQ 2F0QA 4P16A 2EYPA 5IOIA 4KY5A 1A3TA 4LUVA 2A69D 1ROEA 3SK8A 5CGKA 2VB2X 1QVGA 2FE8A 2K22A 4FULA 4IWOA 1B53A 3ZO5B 2KCMA 3I90A 1GPXA 2L83A 1CA6A 4JCVE 1D1KA 4QQBX 3U9OA 2VXWA 3I2ZA 3QB3A 2F0UA 2KVZA 1YIJA 4B08A 3VR3A 5KNDA 5C3EB 2MW5A 2A19A 4OVVA 2MP2A 3E3XA 4A4IA 2ONQA 1I94Q 3RNEC 2N7DA 1PDXA 2HE7A 1CKNA 1UGMA 1BXTA 1A5RA 2IO3B 4MM3A 3GZNI 4HR7B 2RDBC 2RBMA 3K0YA 2OEDA 4AYBB 1J7CA 4DV6L 4LJZC 4JL9A 1PYBA 1OXTA 3U2SC 5IN7A 3KF8A 1V86A 2JWUA 2ENBA 1RFAA 5FR3A 4PZ6A 4GOPA 4OO1H 4U68A 2DJFC 3J7YW 4CHKA 3CRKC 1I5FA 4JI6Q 1OQYA 3Q3MC 4J6HA 4K5XA 3CD6A 1EY0A 3A8JE 3E5SA 4LNIA 2TSSA 1PZID 2LY7A 4ZRKA 5JZEB 4NDXA 1PXUA 4N9TA 2IHEA 1FXTB 1WIAA 1TY2A 3K9OB 4H2AA 4A3OA 5IT9c 4KZCA 3X0WA 1QOGA 1Z2MA 4I7ZC 3K5OA 4HAEA 1PZKD 1V49A 4DV4L 4WAFA 1I7HA 1NSNS 4A93H 3S1QB 1Z7TA 1HR0W 3BYYB 4KTAA 3IFTA 2Y0SG 1QLBB 1X9NA 1K0SA 5G2NA 4JBKA 3CCMA 1VQJA 1HZ6A 4WWPA 3T3NA 1J8CA 3QAQA 3ZDMC 5LMUL 2IY1B 2WX1A
chains in the Genus database with same CATH topology
1F9RA 2A6ED 2Q8TA 4X3SA 1WTOA 3GB1A 3EGRA 1VMPA 2RVLA 3V3XA 3LB8C 1QT9A 3C3LA 2N9KA 5D7GA 4BWGB 3NQTA 3FKIB 2YEPF 2WP9B 3H3VC 2FFKB 1LTSD 2WAQB 1CZGA 1Z47A 1IKMA 2HQEA 2Q5WD 1ZE3D 1WTVA 1D2BA 1NYQA 3MJ5A 1AZQA 2MJ3A 4EQNA 4US9A 2NTSA 1IBXA 5EE9A 1O80A 1UWMA 5EGTA 2KCNA 5KNCA 1E2ZA 3ZYYX 1NR2A 2E2HB 4KGSA 1JWUD 2O5JC 1SMYD 1ENFA 3E6ZX 4RGOS 5A2QE 2A73B 4O42A 1CZWA 3K59A 1EIGA 2MH7A 5K36G 3OWFA 1I4QA 4YXDB 1VF7A 1KNEA 1TR5A 4DU9A 4OVZA 1DYQA 2JX5A 1SEBD 5EKLA 4TKOB 4YTNB 3Q8AA 2IGGA 3EJIA 5D3IB 3RD4A 3ABVB 5C3JB 3VYRA 2IJ0A 2SAKA 4QF4A 2J0TD 4CHTB 3ITPA 2EJMA 3S9WA 2B76B 4C1NI 1PMRA 3T13A 3CU7A 3RLFA 1XYIA 3K58A 2PCFB 2E74C 3MHZA 2CU3A 1C76A 1MHXA 5M9OA 4ID6A 1LACA 3GV3A 1F2LA 1FGBD 4XDCA 1V8CA 4JPSA 2K04A 1BCPF 2ICEC 3A7LA 5IOCA 2Z4IA 1ZOYB 1LT6D 3AE6B 4CKBA 5M5XB 1AWDA 3BS1A 2IGHA 4MIUA 1NUCA 3AE1B 4KKSA 2VB3X 5T8IA 3KLRA 4RKLA 2B2WC 2NVQB 3GTPB 1CZPA 2KVMA 2A5HA 5E6JA 4NMZA 5DAUA 1L5PA 5JJZA 3BZDB 5IIFA 4EVOA 1OO9B 2Y0SB 2K7VA 3AU7A 3Q8FA 1D5ZC 4HKQA 1NCVA 3TP5A 3DWAA 5EPJA 1FCCC 1FEHA 3P4QB 4RCOA 1LTID 3IT6B 5KGUA 4Y7NB 1DD2A 5JVG3 5CMDA 1BQQT 4ILWA 1EEID 5E3FA 1YQ3B 1LLRD 4WURA 2LUMA 1C9FA 2G9DA 3OIPA 2F1MA 3AEDB 4KJNA 3Q6SA 4H0LC 3ONAB 1C4QA 1TJEA 5KEEA 2KDMA 1MD2D 4OGQC 2QF7A 5C4XB 1R7SA 3HGBA 3NZ3A 2PO4A 1VJKA 2PYKA 3GS2A 3BDCA 1IGCA 3PO3B 3V2TA 1IW7C 5K5PA 2Q8RE 4A3FB 2NN6H 1RCVD 2M2LA 4L23A 5J22A 3BVMA 3P1MA 4IUVA 1LT4D 1LT3D 5FOBB 2X6LA 1VCIA 5AUIA 1GB4A 3OOCA 2JEAI 2PVGC 2RDHA 4ARCA 1Q3LA 4HMIA 4QUCA 3TEWA 3NP8A 5KYLA 3AE3B 5E4WC 4XYOA 2NBFA 3Q22A 3X3NA 3HUIA 5IGDA 1KAAA 4ZHOA 3HRDD 1FXIA 3AE9B 3Q0AA 4XWTA 5T1IA 1VDZA 1BUVT 2A68C 4IFDG 1A15A 1SAPA 4F87A 4FXDA 3A7AB 3CIRB 3TSSA 2E3TA 5IGBA 1ZP0B 3NTIA 2K3UA 4FXKC 3DWGC 4ZUJA 4GDKB 1EZ8A 4YIJA 2KECA 2HTME 3S14B 2D62A 3AE5B 2RPVA 3C1FA 5EQ0A 1CQVA 3AECB 2QDBA 2K33A 5NUCA 2WXFA 1E6EB 2K5PA 1IYUA 2H1EA 1F77A 2CJOA 4KKTA 1PRTC 4OL7A 2QCPX 1SB3C 2W54A 1AP0A 1L6UA 4XQNA 1EYCA 3AN1A 2D5DA 2EPBA 2OHFA 4G7OC 2RSOA 1U4RA 4IN3A 5EBDA 1OFFA 1E9MA 1HTPA 4B9XA 1SJED 3P4SB 4DK1A 2OEOA 3MZ5A 4HCEA 3SEBA 1ZXTA 1SJHD 1DXMA 3HOVB 3GTKB 4RWSC 2K5QA 2F0SA 4WH4A 4D2KA 3GTGB 2N7JA 2SEBD 2O2LD 5E4XA 3MA2B 4ZLTF 1GAQB 1PYWD 2F0IA 3BIID 1I4PA 1C4PA 3L4PA 4KKJA 1F2RI 3FILB 1BCPC 4A3GB 3H8HA 1VLBA 4L1BA 1L4ZB 1QKZA 4FF2A 1KH0A 2BDNA 1SNCA 3GTJB 2DYOA 2LMCA 3T3NA 4L63B 5EE0A 2Z8LA 1N63A 3OPOA 2FBWB 1STEA 3OSOA 2WP8J 3VR8B 3EROA 1GB1A 2WXNA 3MWYW 3SXHA 1B9NA 2W55A 3G6JB 3QWNA 2I2YA 1AYFA 1ET9A 2WXIA 2K05A 3MC0B 4OO1G 2JZPA 3P1HA 1J9OA 4R9WA 1NAPA 1T5EA 1ENAA 1STAA 2B2YC 2K9XA 4A3KB 1I4XA 4A9AA 3MTSA 2PIAA 4FXCA 2K03A 2GA4B 1SXTA 3PUVA 4F8MA 2QIEB 2CW0C 3CHBD 2D9UA 2C5CA 2BA1A 4MT5A 1QOHA 3M85A 2M19A 1K53A 2XNAC 4N9PA 3VR6A 2K01A 4YSZB 3A56A 2BTEA 3MP9A 4WIPA 3S15B 2IW3A 5EKIA 3M7GA 1HRJA 4BA2I 1Y8OB 4A3EB 3UI2A 2IL8A 1JORA 3R2TA 1VMCA 2PKOA 2SNSA 3NSWA 1XF5L 3VR9B 3KBXA 1KDCA 1UNSA 4TQUS 3VYSA 1B3AA 3J7AV 3U4EG 1VR9A 1XLPA 4WQMA 1KNAA 2HDEA 3NVZA 1XO3A 4XT3B 4U673 2MEKA 4XYQA 1OQQA 1XTCD 2EYHA 3OMCA 2BT6A 5TSSA 3P4PB 1S5FD 2H4OA 4RFBA 4OW0A 3TEYA 3URYA 1TY0A 5AFWA 1SNPA 2NTTA 1E0BA 3I70A 1GUWA 4QB4A 2WXQA 1HFGA 3J81E 1TWGB 1AFPA 2X6GA 2XIWA 3HKZB 2HDMA 5IGEA 3KBGA 5FKAC 4DFAA 3HP3A 1IW7D 2J42A 2L12A 1JALA 1OQRA 4KD4A 1CT1D 1L4DB 1KRHA 1V1PB 1I4GA 2NUCA 3LNNA 2LFNA 3KWVA 4AQ7A 1VZ7A 4IOIE 2BYTA 3NUCA 1SNOA 4FVMA 2CQAA 4A55A 2XN9C 1Z6HA 2EXZA 1GUOA 3PUZA 3B2FA 1MSHA 1A6XA 4ZOHC 2LGIA 1JOQA 5BMGA 2RDFA 1LV9A 2A6HC 1B50A 1QQRA 4A8XC 4ITKA 1HCZA 1FNWA 1V8QA 5ELEA 3H94A 4IUQA 4IALA 4PQXA 4ZRZA 2A68D 1C4AA 1F9SA 1BBXC 2EYOA 2W3RA 3I57A 2FHTA 3AB5A 1LTGD 4KHZA 5CV8A 3KLSA 3HS0C 3R8BA 4K8IA 1WD1A 4HEA1 2C9OA 4H44C 3VRAB 1U4LA 3QOLA 4A93B 3N9YC 5FO8B 1Q90A 2V4IB 4JE3B 3BDLA 3C8YA 3W1SA 3BVZA 2D5GA 2BS4B 1JC7A 1D6EC 2N55A 5IT9L 1PRTD 2AQ2B 3EA6A 3W2DA 1H9SB 4K6DA 1ZXIA 2LEKA 2WXGA 4BA1I 2M00A 5LNK1 1TYGB 1LO5D 5BYSA 2N9LA 4WFN3 1F2YA 2DNEA 4DQOC 1PTOF 1PZJD 1DGJA 4USAA 3DEOA 4V0BA 3HEJA 5ISRA 2KHSA 4ZKCB 1XX8A 2BOSA 2HDLA 3GQBA 3S2HB 4ZKBB 1OXVA 5DM63 1ML0D 3E9SA 2B63B 1N61A 1JQ4A 4HSPA 1HFNA 4GDLB 1FM0D 1GHKA 1HXYD 3DWQA 1Q1EA 2JSVX 3MXNA 5CV5A 1SYBA 1MI0A 2WLBA 1NI3A 1EY8A 1SFOB 2ON8A 2K6AA 4ODGA 1BNZA 5CC4A 1MPEA 5BYQA 4KGRA 1HUMA 1I6HB 5FO7B 4PMBA 2INNE 1CHQD 3QG1A 1FR3A 1WWTA 4IZ8A 1WYGA 4RH6A 5BN3A 1JICA 1Q10A 1FXAA 2L52A 1HQRD 5HHDG 2NVYB 1Y8PB 5DM73 5G3LD 4DXFA 4A3BB 5C44B 1EYDA 3AEAB 1E2VA 1ZKOA 2FJ2A 5CV6A 3FVQA 1QOBA 4DK0A 2I07B 5FLXL 2KCCA 2IDYA 3QJYA 2DN8A 2X38A 4RGTA 2B2VA 3ND9A 2EKIA 1J7BA 3LYYA 3B9JA 3MEHA 4BS9A 3CQZB 2E2IB 1WD0A 2CW0D 3J7AF 1B4OA 1DOLA 5I2YA 1JCKB 2JEBI 1GUGA 1FFVA 4DAYA 1CFMA 3I4LA 3S1MB 3D31A 2OT2A 1PRTB 3IFDA 3TP7A 4OIKA 2JA6B 4K2KA 5C2TB 3ZJVA 1S5BD 4KK7A 4C56C 1L0XB 3ZGZA 3NTKA 5D3DA 2DY8A 3GP7A 5BMHA 1HHVA 2F0NA 4DGZA 5C5MA 3FAHA 4KV6A 2ZXOA 2JXMB 2KQ3A 2R7ZB 3OMGA 1Y8NB 3NK9A 4NJCA 2MUYA 1WTXA 2F4IA 5IGGA 4KX6B 4MH8A 1SNMA 3CRLC 3NTHA 1TS5A 4MN3A 1QWYA 2M0AA 1YNNC 4QUFA 1E7PB 3NVVA 2JXTA 3D4RA 5M3MB 2BS2B 2PZTA 2AQ1B 4FF1A 3AE4B 1TS2A 2BS3B 1ZDVA 2LHEA 1HQMC 4A3DB 5C4JB 3TZDA 4N59A 1DONA 2BB6A 1JRPA 2JSOA 1RODA 2E75C 4HEDA 3TDQA 3TN2A 1V43A 2KUMA 2L1AA 2Y5CA 3HRZC 5KRUA 2TMPA 2DNCA 4JK1C 2ZXRA 2F0FA 1P7FA 2CHBD 3AEGB 3P42A 1TKWB 2HUGA 1TS3A 2MPMA 4XTCS 4AS1A 5E1FA 3KUPA 4FNFA 4YSXB 2F0KA 4OZAA 1X3QA 3VR5A 4Q5VA 3FRPB 1EY7A 2WACA 3UI3A 2NZ1D 3U7ZA 1C78A 2F0JA 2WIIB 4KMUC 4EGVA 2A6HD 1FD6A 1WTQA 3W5UB 3M4OB 2FMMA 2CVRA 3VYTA 3WDNA 3SR6A 5F2DA 4JBWA 1X32A 3SK6A 1ILPA 1ILQA 3V96A 3MAQA 4M8AA 1YMHE 3OHXC 2W3SA 2WS3B 1A2UA 3M4YA 4A3IB 1BR9A 3DMUA 1CK1A 5CV7A 1STNA 1ESFA 3SFEB 3KLSX 3FC4A 2YU9B 4NP5A 2EZVA 1C48A 3J80L 2NVXB 5KYIA 2PW7A 4LLGM 4JWSC 3NVWA 5G5GA 4F7XA 3NWSA 5H92C 4XWWA 1FRDA 2J53A 4K5VA 2V4DA 4ZHPA 1R9TB 4ULLA 1JMLA 5AUKA 1STYA 5CBEE 2BDOA 4IUUA 5JEAG 3SK4A 4LK0M 3D4DA 1ICWA 3WOFA 1JOOA 1JW9D 4HJGE 1EQVA 1S5ED 3S1NB 2WU2B 5H8YE 3W9CB 1KLUD 4LAAA 1K8OA 1B9RA 1RWSA 1H9KA 3W5VB 4TQ1A 5C0XG 2E6XA 2EYLA 5M5WB 4XT1B 3HOXB 3QO2A 2XRSD 4YWGG 5MPOA 1LTTD 1QNUA 1U9RA 2L11A 2L9HA 4KY6A 1SE3A 2WINB 4X3TA 1B9MA 1PUTA 3P7JA 3PO2B 3A54A 1FD7D 1RKNA 1QB5D 3QIAA 3HVDA 2F0EA 3AE2B 1KDAA 4G7ZC 1PGBA 2I38A 1R4QB 1D1IA 2EYMA 1NR4A 4HRSA 3RZDB 3K5LA 1KFYB 4MM3B 4LMQD 2KOLA 2WDRB 3IAYA 5GXGB 2EY5A 1ZDXA 2A69C 5C3XA 1IL8A 4US8A 2EYJA 3P20A 2CJNA 3H0GB 5EPLA 4CBVA 5K36H 4DXGA 4ZUIA 1MVKA 3NBHA 1UEAB 3NUHB 1QE6A 1DOXA 1CI3M 5KIXA 3DWPA 3O13A 3G7LA 2PW5A 3LWUA 4J1MA 5LL6X 3FEWX 2EY2A 5M5YB 2Y3AA 1I6VC 2EJGC 1SYEA 2EYFA 1EY6A 2KWDA 2BA0A 2R6GA 3BK1A 3K5NA 2RQXA 1CQFA 4ZRPA 5EJWA 1XEEA 3Q8EA 5EPKA 2DWQA 4RNAA 3DHQA 5COYA 4DNRB 3Q8BA 3I3CA 4RGMA 2B8GA 1YNND 1D4BA 4N58A 2KQ4X 2R3ZA 2QMTA 1IBXB 2QKIC 2ZW1A 2Q8IB 1DOKA 1GOZA 3RUZA 2B2TA 3OW7A 4IURA 2IPKD 5EKKA 1OXSC 2KEDA 4PNYA 1GUNA 2AUJD 2JE6I 1ZXHA 2WU5B 2F0DA 1D5XC 1XXGA 2L1BA 3AEBB 2F0MA 1K50A 3VR2A 2R92B 4WRDA 4EQOA 4P6VF 5JPMC 2M9VA 5JXVA 2H89B 4ARIA 4IFDI 1F2MA 1F9PA 2IT1A 5EE3A 4LK1C 1T5XD 1H9MA 5CR3A 1EZ6A 1TKGA 4TSSA 2IX1A 1YN3A 1SMYC 2AUKA 2EJFC 4A3MB 5C0XI 5CV9A 2OF1A 5EE1A 2NMQA 3DWMA 1FCLA 3HOWB 1AZPA 3MVVA 3S17B 2WDQB 4I65A 2JA8B 1ZEQX 1EU4A 2WXLA 4CJ1B 1PFDA 5HI1A 3TBIB 3M7NA 1QOFA 3N52A 2NWGA 1CM9A 3R3OA 4B0EA 1SIJA 1EWYC 3SR1A 3JAML 2FMCA 4R8NA 3IAS1 1SE2A 4RAUC 1ONLA 3Q24A 2SNMA 2WB1B 1WRIA 4HCSA 2RDGA 2Z4HA 3OWEB 3BK2A 3LXFA 1AN8A 3MFYA 4TMAB 3K5MA 4CJ2C 4HMJA 1TVXA 1SYGA 4X3UA 2L4NA 2DYMA 2EVBA 1C4CA 2QSDA 1UAPA 2DLBA 3IXSA 4TQ0A 2F3WA 2XRQD 2V3NA 5J1ZA 4ZK9B 5A35A 1O7ZA 4RGNA 2WDVB 1HTLD 3J81L 1G6ZA 5DEHA 3ZQ4A 3NWTA 4QIWB 4CKCA 4G57A 2LFIA 2MGSA 1FNUA 2E2DC 3P63A 4NAMA 1MBYA 3D8GA 2E76C 1LTRD 3I72A 3P4RB 3MHBA 2EOTA 3HOYB 3ETRA 4OO1I 1FNVA 4C3JG 5G5HA 1RD9D 5I9OA 4DN4M 4R3DA 3FDTA 2PMVA 1EOTA 1NVID 1CHPD 1EWHA 3FMCA 4YT0B 2XWJB 1KLGD 1PDQA 4V190 3T4AC 2RKSA 2VZKD 4ZAIA 3PUWA 2PTLA 1JWSD 2PQEA 1U4MA 3H91A 4XDDA 2KMMA 1F2RC 1PFBA 1BO0A 2EY6A 4OHJA 3M3YB 4NKLA 3OIQA 1G291 4FP5D 1EIHA 1HA5A 1JR0D 4KY7A 2WXHA 2H88B 1TIID 2W82A 1UWXA 1I4HA 1B44D 1PGAA 3PO0A 3N6RA 4KN7C 1S5CD 3NHHA 3VA7A 1KF6B 3IL8A 4M0WA 3L9AX 4IFDJ 3NPPA 3S16B 1XWEA 3IKJA 4HROA 4RKBA 3I4NB 4NAWB 4PT5A 4K2LA 1YQ4B 2L55A 2B2VC 5D65A 1IUEA 1EU3A 1TQOA 3SVMA 1UUPA 2NN6G 1EY9A 5C0XJ 2PMZB 2PZWA 1P7EA 1EEFD 3PV0A 4IUTA 4IQZA 1B1ZA 4IKGA 3FPPA 2WXKA 3AB9A 1BCPD 1XLOA 1NEKB 3ZJTA 2A74C 3PUYA 3EQLC 1I4RA 4LTUA 1V1OA 4FYDA 4KN4C 3PZ7A 1DOMA 1XLNA 3MXPA 4UDUC 1G2TA 1W6KA 1KTKA 2RMMA 2WKDA 2B8FA 2JP1A 2RA4A 4RA8A 3FILA 1HA6A 1RYJA 2YYZA 3I4MB 5FK9C 1CJEA 3EFXD 3KWLA 2YEPB 1BOSA 1PTOH 5FLXE 1YN4A 2F0OA 2ICIA 2KJXA 3E56A 3L3OC 1N5WA 2KEEA 4PMCA 1DZ1A 1STBA 3NVYA 1DOYA 1LABA 1TU2B 3SFDB 3BVGA 4WORA 1YN5A 5C6AA 2JU6X 5I2XA 3A55A 1KABA 1Y1WB 2VZKB 1STGA 5EBCA 2K32A 1FMAD 2INPE 2WXRA 1SNDA 1UGJA 2DBYA 5ELBA 4B0MA 4C3JB 2LMCB 1RDPD 5CORA 4C2MB 1ET6A 4DF7A 1LT5D 2DY7A 2BW2A 3PZ8A 2M56B 2JYEA 1STHA 3DUZA 2HCCA 2KA7A 3A8KE 1GUTA 2PVOD 4HSVA 1BUIC 4B9WA 4M1UB 3DM1A 3RPFC 1XLQA 2V3PA 3TEZA 4R8IA 4NZLB 3GV6A 1F0ZA 5A2QL 3FPUB 5IGCA 4C80A 1PRTF 1YJIA 1PFMA 2K0PA 4K8JA 1SBBB 5C4ZA 4QMGA 1VZ8A 2BB5A 4CQNA 4L8JA 1C79A 3AMZA 1QG7A 4FF3A 1BCPB 1H9RA 3R2IA 3GTOB 4CGYB 5LHY1 3TMEA 3AM9A 3AEFB 1CA5A 4C1NK 5HG2A 2O4XA 4XQQA 1WTPA 1QJOA 3MXGA 1Y69U 3Q23A 2BCOA 1GXDC 2F0VA 4FO2A 2NN6I 1GJXA 4GZYC 2SDFA 5BN4A 4K5WA 4XXEA 1N5XA 1NENB 1E2WA 3S1RB 1Q8IA 2BE5C 4WJWA 3DEPA 1GHJA 1TKYA 1PTOC 4YTMB 2F0PA 2KACA 5BMIA 4MACA 2X69A 1K8MA 2K1BA 3GD7A 5CYUA 1QNKA 4NW2A 1WTRA 2N88A 1B2TA 1AW7A 1EL0A 1IKLA 2SOBA 2V0GA 5G3LF 1V1PA 1O7LA 4ME5A 3T16A 2J7ZA 3ND8A 3U9SA 4ABNA 3TZUA 3AE8B 5C5LA 3PIO3 3R93A 2D2CC 1JE4A 1GUSA 3PMFA 2EY1A 4KKUA 3NRZA 3Q8CA 2XVSA 1JOKA 1MHHE 2ZW0A 3J80E 1TT2A 2NYZD 1RM6C 3SE0A 2F0LA 4L6TB 3GTLB 4S3SA 4XE0A 1EM7A 5JVH3 3D3RA 1MI2A 1IYVA 1K83B 3T51B 1EQTA 3AE7B 2PPBC 1DM0B 3BWUD 5HURA 2PW9A 1PFNA 2NB0A 4DAPA 3TP6A 3EVQA 4CKEA 1WTWA 1FYCA 3V05A 4H7BA 2ZT9C 2B2WA 1HPCA 1QCBD 1E10A 1VF5C 2ID0A 1RHPA 1Q12A 4FXGC 1C77A 1VZ6A 1LTBD 2WKCA 3BG3A 5JOBA 3SHLA 2WV6D 2AQ3B 2Z1CA 4KKIA 1H9SA 1VRAB 3BYTB 5I9PA 1A3UA 3PUXA 4P2CB 1H9JA 1TWAB 3ZJUA 2GB1A 3NE5B 2IGDA 4WWMA 4XDXA 1HZ5A 1RFKA 1RJTA 2RSNA 3MFGA 1YNJC 1FFUA 1TS4A 1SSNA 2G9HD 2F03A 2F3VA 1A70A 1RTOA 2F0TA 1DJRD 1D5MC 3RZOB 3K7AB 3QOJA 2GI9A 4BY1B 5BN5A 3NBIA 3T3OA 2B2UC 2IX0A 3GTMB 2IX3A 3EUB2 2EELA 3VRBB 2L32A 4Q0FA 4ZQ3A 2ACZB 1R4PB 1WCMB 2G1EA 1ZYRC 4PMWA 1TWHB 5J39A 4CJ0B 3ERQA 3HOZB 1O7YA 1DCZA 1EYAA 1X3PA 3D6CA 3VR4A 4ZYSA 5FO9B 2MJEA 5I4DA 1JWAD 4YTPB 2MP1A 3I9V1 1E0ZA 1S5DD 2B2TC 2E2JB 3HZXA 1QOAA 4ZRQA 2AX5A 2J4XA 2HCIA 4RHSA 1Y56A 3K6OA 1WVLA 1SYFA 1O78A 3MXUA 1G2SA 5C3WA 2B39A 2K5DA 3WOEA 2FINB 1RF2D 2WXJA 1FRRA 1W6JA 3HG9A 3I91A 2GRIA 1M4VA 2FUG1 4RHRA 1G91A 1DOIA 5IGFA 2R61A 4C3HG 1A2TA 3H09A 1V97A 3KK7A 4KI0A 2LKVA 2B2UA 2F0GA 1I50B 3WCQA 2PLPA 4G4KA 4KJOA 3VYUA 3PIP3 4BY7B 1KDBA 2K5WA 1Y1VB 1ZPSA 3AMUA 4E6IA 1I3QB 2O5IC 2EE1A 1ENCA 2PNRC 4PV1C 1L0VB 3F2UA 4QCLA 1SF0A 1F2ZA 2A6EC 1TZOA 4O1NA 1A3VA 4C7ZA 1IHZA 2JQRB 2K28A 1U4PA 3SK5A 2ZXPA 1S4ZA 2LJIA 2VNUD 4G7HC 1J8IA 5JPNC 1OXXK 2XSCA 1N62A 4RCNA 4OIJA 2MJ8A 1K51A 4REZA 2IWHA 2PZUA 2J52A 4OZCA 4KD3A 3GTQB 1JROA 3X3MA 4HTHA 2EDGA 3HVZA 4JWUC 1EFID 4C3IG 5I6YA 5ELCA 1BF4A 1WGKA 5M3FB 4A3JB 2BE5D 4RF1A 1EWCA 1AEXA 3CKIB 5ELFA 3VQIA 2JYOA 2L0CA 1MGSA 1PTOD 2JYTA 2KN4A 4HKZE 4UAIA 2Y5PA 1TWFB 3K57A 1K52A 2WXPA 1XCTL 3SDZA 4GLSC 1ZUD2 3AH7A 5IODA 2AWNA 2BBCA 2KAJA 4EE2A 3JAME 4OZBA 1OXUA 4FF4A 2JA7B 1TKEA 4IUPA 3S2DB 1BDOA 4EQPA 4C7YA 5ELDA 3P75A 1HEZE 4YSYB 4DAVA 1T6BX 2I46A 3I8ZA 3I73A 5D14A 5HGTA 4HN7A 5BYRA 1IGDA 2B2YA 2NVTB 5I6WA 2MJDA 2WQYB 4X3KA 4K6LA 1L6VA 2VUMB 1SE4A 5CBAE 2L5TA 3E0JA 2WXOA 1N60A 2LHDA 2WXMA 3HOUB 2JA5B 5CV4A 3C1EA 1JQYD 1MSGA 1ACCA 4BBSB 5JEAH 3H6MA 1L0YB 1SYDA 2MHVA 3NQIA 2N0SB 4JX1C 1CTMA 4C3HB 4IFDH 1JWBD 4Z9CB 1YJJA 1SYCA 1BMLC 1II3A 4XIGS 3AV8A 2QILA 3J9CA 1QILA 3B2GA 1PLFA 1T3QA 3D6WA 3RMHA 3TUOA 1PGXA 2WNMA 4RF0A 2LS01 1FIQA 1QF6A 3C2PA 3TEXA 2XWBB 2QJLA 4MHEA 5C0XH 1G8ZD 1TWCB 1SDFA 4J8QA 1LTAD 1JB3A 1HUNA 1J7AA 1XCQL 5LL6S 4A6QA 5T1GA 1RTNA 3CWIA 4IDIA 3Q69A 1SSOA 5JAVA 1SNQA 3IAM1 2AWOA 4Q2JA 3U52E 1Q1BA 1NYRA 1M8AA 3GO5A 3C46A 3TP8A 1C8CA 1YNTE 4DNTB 3D4WA 1F9QA 3LWEA 1EY4A 4KGTA 1FO4A 2F0HA 3LX0A 2R93B 1JWMD 1YNJD 4J3OD 4TRDA 3L7ZC 3T53B 4N6EB 5IT9E 4K14A 4H13C 4F88A 2QEJC 4DA2A 1PTOB 5JEAJ 4KHVA 1VDVA 1WXQA 3AEEB 5HFYA 1EY5A 1ZYRD 3W3AA 3VA5A 5C4HA 4C3IB 3A8IE 4XQJA 1ESRA 2F0WA 4L2YA 3BDOA 3T56B 3RFZB 1WSPA 3NXWA 3KQ4A 4BBRB 4A90A 2OXPA 3DXJC 3NS1A 5KNBA 5DNFA 3IT4B 4IUNA 2F0QA 4P16A 2EYPA 4KY5A 1A3TA 2A69D