2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
1GOZA 1JCKB 1FGBD 1V1OA 1HXYD 2IPKD 1PZKD 1SE2A 1RDPD 1UUPA 4RCOA 3BVMA 1LTTD 2IJ0A 3DWPA 1BCPC 1LTBD 2RDHA 1SXTA 4DXFA 1HTLD 4TSSA 1I4HA 2XRSD 1V1PA 1TY2A 1YN5A 1PTOF 1SE4A 4RGNA 1F77A 1L0XB 2Z8LA 5D3IB 1ET9A 1LO5D 2WV6D 3BVZA 1PTOH 1CHPD 1D6EC 1G8ZD 1KTKA 1RD9D 2QILA 1SE3A 3R2IA 1PTOD 3DWQA 1FNUA 1JR0D 1BCPF 1I4XA 3SEBA 4UDUC 4L6TB 1PRTC 1M4VA 4O1NA 1TY0A 5TSSA 1KLUD 1TS3A 2XNAC 5D3DA 1BCPD 1HQRD 1B44D 1PRTB 3CHBD 3W2DA 2TSSA 1JWSD 2AQ1B 1QILA 4OHJA 2NTSA 1LT6D 1RCVD 3KLSX 4BWGB 1V1PB 4RGOS 1S5BD 4RFBA 1PRTF 1I4QA 4Z9CB 2O2LD 1KLGD 1I4RA 3EFXD 1YN3A 3R2TA 1STEA 1AN8A 1ESFA 4C56C 1SJED 1EU4A 2AQ3B 4ZYSA 1LTGD 1LLRD 3GP7A 1JQYD 5I4DA 1I4PA 1UNSA 1XTCD 1SEBD 1LT5D 1LTRD 1PZID 1XXGA 3O13A 5FKAC 1JWUD 1LT3D 1CT1D 3OWEB 1EFID 5FK9C 1ENFA 1LTSD 1LT4D 5ELEA 1BXTA 1EU3A 1MD2D 2RDGA 4RH6A 4DXGA 1DJRD 3R8BA 3BZDB 1EEFD 1PZJD 1EWCA 1CK1A 3DWAA 1S5DD 1HA5A 4RGTA 1EEID 1ET6A 1SBBB 1FNVA 2XN9C 4RHRA 1CHQD 4NZLB 2J4XA 2G9HD 1TS4A 1S5ED 3EA6A 2R61A 3MC0B 1S5CD 1PRTD 1D5ZC 2CHBD 5ELBA 1S5FD 1LTID 1DYQA 3BYTB 5ELDA 3TSSA 2NTTA 2ICIA 1CQVA 2XRQD 3URYA 2AQ2B 1PYWD 1YN4A 1I4GA 1B1ZA 1PTOB 3MFGA 5ELFA 1LTAD 1D5XC 3BVGA 1SJHD 1AW7A 1D5MC 1BCPB 2QEJC 1JWMD 4K6LA 1TS2A 1RF2D 1FD7D 4L63B 1T5XD 1L0YB 4RGMA 4RHSA 2SEBD 1TS5A 5ELCA 3BYYB 3V05A 1FNWA 1PTOC
chains in the Genus database with same CATH superfamily
3R7RA 2Z9HA 2WX1A 4B0EA 1DOIA 5LMUL 2JA5G 1SSNA 5JHAA 2SNMA 3K7AB 1ASZA 3DM1A 4UP7A 2IBIB 3E9IA 3KWLA 4AYBB 3N30A 5BYQA 1EWHA 2KOLA 4GOPA 1KH0A 3F8TA 4QIWE 4LF8Q 1IHZA 1Y1WB 4JQWC 2EIFA 1WTQA 4OZAA 4DV2Q 4AQYQ 3FAHA 5MPOA 1D6EC 2IWHA 3CC2A 4OVZA 1VJKA 1C7YA 1FFVA 1E0BA 3NZSA 1SNDA 1CA5A 3F1ZA 1S3OA 4OWWB 2EMTA 1DGJA 4NJ7A 1HR0L 4DR2Q 2NVTB 2FIFA 4C3IB 1C4CA 2PTLA 1I5FA 1VS0A 5I2YA 3OG5A 4PYUA 2KA7A 2IY5B 3FILB 4BKSD 1GKHA 4EZKA 1EYGA 4QIWB 4BY1G 3TEYA 1FL0A 4P71A 1V86A 3L4PA 4B3TL 1EUJA 3M4OB 3CW2C 2KMMA 3BK2A 2WB1E 1JJGA 1SNOA 3HOWH 3AE9B 3U52E 1V5TA 3K6OA 3PGZA 3L3OC 2ZVNA 2F4IA 3J7ZC 4YWGG 1VQEA 4MELA 5DCNA 4DXAB 3UQAA 5IAAC 4JX1C 3VA7A 2VUMB 1DCZA 1MVKA 1TKGA 4KKTA 1EUVB 1MIUA 2K28A 4KKJA 4EUTA 3Q3NC 3DCGA 1WI5A 2L11A 2UUAL 3CRKC 3CMMB 1B4OA 3QIJA 3ZLZA 2Z4IA 1PLFA 4KHVA 5GAGC 2KWDA 4P73A 1N61A 3CPFA 4R4OA 3AE4B 2BTEA 5T8IA 3ICEA 2WB1B 1FIQA 2MJ3A 1EY8A 2PLPA 3DHGC 1FM0D 3AULA 3RNCC 3I4MG 2HIVA 1SYDA 3EJIA 4DXGA 5CYUA 5KNBA 2PW9A 3K9PB 3R8BA 1H95A 3CSTA 1P16A 3FKYA 2K75A 5T1GA 1C0AA 4BOZB 2L83A 4ID6A 5FJ8H 5LHY1 1ET6A 2ZW0A 1WTWA 2EQSA 4P75A 3M7GA 3HOZB 2BS2B 2WXHA 1SYEA 4NZLB 1QT9A 3STBC 1SIFA 3PS6A 5IGDA 2R7DA 1STBA 4JV5L 1F1HA 1S5CD 4W9JA 5ELBA 3OW2A 4MH0E 2NVQH 4BBSH 1IKMA 2C9WB 3F2CA 1M94A 3DVGX 1K9MC 4N8X1 3C0RB 3UIPB 1G2TA 2BPSA 1CQVA 4M8NA 1HTPA 2JA6B 1VQ5A 1SAPA 1G6PA 1WMHB 4K3CA 3DBHB 3JAML 1J6QA 1GAQB 3DWGC 2EY5A 2IL8A 2HDLA 4A93H 1KABA 4KKSA 3HRZC 1VCIA 3MFYA 4A3EB 1JE4A 3VRAB 1KNAA 5C3XA 4IWQA 1OO9B 1FYCA 4L1BA 3CCVA 3E9HA 3VYTA 2A5HA 2V4DA 3T8MA 1H9SA 1T5XD 2NPTB 4GLSC 2AEHA 2ONQA 3TEZA 1A70A 2LSSA 1LTLA 3ERSX 3R3OA 2FXQA 2BYEA 1WZ3A 4XE0A 4H02A 2K6DB 4LAAA 2DNFA 2N1WA 3NUCA 4HSVA 2WLBA 2FBWB 2WS3B 5DPSA 1R9TH 1PFNA 4U673 1YI2A 1FPYA 2WHIA 2H89B 2I2YA 1V1OA 1OXUA 5AUKA 3X3MA 3J81i 1CI3M 5JAVA 2IPKD 3AB9A 3GOEA 3ZNID 2FUG1 2DZMA 1D8LA 1LTTD 3CCQA 3S17B 4FF4A 3DWPA 3APDA 3I70A 4X62L 3TEWA 3SR6A 4DXFA 1EFWA 2ZM6L 3AE3B 4GDLB 4BY7B 3DBLB 4W9GA 3GTOH 3VHTC 1PA6A 3RYTA 2F0JA 1L2NA 2RHQB 4N9TA 1TT5B 1A3TA 5IP4D 4MEMA 3S2HH 2M19A 1JJCB 2RPQA 4ANXA 4C00A 4LFCL 2I5LX 1OXTA 5EPKA 3NEMA 3J81c 5D2MB 1BUVT 4LUOA 3FC4A 1E90A 2GA4B 4RG1A 1EM7A 5IP7G 3R7QA 2YVCA 3MJ5A 4FJVB 4II2B 2F0GA 1IKLA 5ELNA 4DV7Q 3S1RH 1VQCA 4JI8Q 1BDOA 2WKCA 2KANA 1EZ6A 1Y69U 2PZUA 1A63A 3ZRCA 1BCPD 3A0JA 1KAWA 2B29A 4DV0L 3DLLA 2UXDQ 3RFZB 5E6JA 2LEKA 2DNCA 4K8JA 3BJUA 3LB8C 3UDXA 1WM2A 1A5RA 4ZOHC 1S5BD 3DXJC 3S1MB 1E8WA 2VB2X 1I4RA 2FJ2A 2FMCA 1FXIA 3FKIH 4C56C 1VQAA 1X55A 2HIXA 1WGDA 2M8SA 1DM0B 1HFGA 4S3SA 3P1HA 3KYDD 3MXUA 2F0DA 5I4DA 2BE5D 4YY3L 1BBWA 3S16H 2M1MA 4N8FA 1HZAA 3HVDA 1EQQA 2WXJA 1JWUD 3BDLA 4WFN3 2F0QA 1GXDC 1YEZA 1LTSD 3SU8X 3MVVA 4MACA 5FJ8G 2FINB 5M5XB 3P4RB 3ZIMA 1EZ8A 2IZVB 4J8QA 4JI0Q 2PVOD 4WAAA 5A35A 2UXCL 1TTNA 5FO7B 1MHWC 4IFDG 2L32A 3APFA 3SD5A 2NN6G 3ZNGC 1TQOA 1I3QB 4O0AA 3WOEA 4HWIB 4DNRB 3K5LA 3IFWB 1PRTD 2HJ1A 2HUGA 2VXWA 3NQIA 2Y5PA 4KDIC 2MCNB 3PUVA 4QGUA 3HVZA 1F9PA 5JPNC 1F2LA 3RMHA 3QWNA 1MJEA 5DM73 5C3EG 2K6QA 1F2RC 1PTOB 3NP8A 2CH4A 3EIVA 3VAWA 4NAMA 3I4NH 1C76A 1YNNC 2FNJB 3WOFA 4AJYB 2Q5WD 3MC9A 1A2UA 2GN5A 4JI1L 1ICWA 1B9MA 1FO4A 3PRMB 1O7IA 3GZNI 3ZTCA 2WP8J 2E2IH 1DOXA 5M5YB 1K50A 1N34Q 1EYDA 1WCMH 2KHJA 3GDEA 5H1SE 1AARA 2ATWA 3UGBB 3DEOA 4TQUS 3DBSA 3P42A 3NHEB 3U4VA 3BYYB 1O80A 2KECA 5E3FA 1DOKA 1UUPA 5IGCA 4G3XB 4M01A 3RZOB 1C4PA 3WCQA 4DN4M 5BN3A 5IWAQ 3CP0A 3LX0A 5C44G 4A3GB 1F52A 4C3HH 3GTKH 2Z0DB 4B3SQ 5EDSA 1PFDA 5KHOA 3ZO5B 1QE6A 3M4YA 4KHPQ 2LRWA 4MIUA 3F2UA 2OEDA 3H1UA 3D6CA 2NUCA 1PFBA 2XRSD 4KGRA 4DDGD 4HCSA 4RMAA 2PJHA 1EWYC 3WANA 3K7AH 3TIXA 1WTHA 1C1YB 3RNBC 1PVOA 4DK1A 2KDIA 1A62A 5CHWA 2JQOA 3PZ8A 3IG3A 2WXKA 1SR3A 2LGYA 3QR8A 3A9JB 4UDUC 3AE6B 4KJNA 1WTXA 4EZLA 2ASBA 3MA2B 2PKOA 3K0XA 1Y1WH 4R4CA 1CQFA 3S15B 4IUUA 4DHJB 1WH3A 4JPSA 4F8MA 5J3BA 1KIXA 3PSEB 4DNIA 1KD1C 1WGGA 2TSSA 3HK0A 1TGZB 1D4BA 2OEOA 2Z59B 1WJ4A 1RCVD 2PIAA 4X64L 3C1EA 1K8OA 2L00B 4A3JG 1XNRQ 2INPE 5HURA 1V1PB 2C7NB 4A3CH 5BN4A 3N52A 4C3IH 2NVTH 3NVYA 1H9SB 2KLCA 3S1QH 5IN7A 3NE5B 2I07B 2F03A 4HPLB 1AN8A 1ESFA 4NY0A 2A73B 3C2PA 2BT6A 2KOXA 1HNZL 5K5PA 3T1HQ 4YTMB 2KCMA 4GKJL 1FXTB 1ZYRC 2N88A 3CC4A 1K83H 1XCTL 3MXNA 1PZID 1FCLA 3RNGC 1WJJA 3TEHB 4MT5A 3SE0A 2JEAI 3J7AF 4JI2L 2G1EA 2LMCA 2L3ZA 2JJQA 3A5UA 3AE5B 4YTPB 4XTCS 4HIKA 2E2JB 2AX5A 1SE8A 3CD6A 4N9F4 3A5ZB 2NYZD 1PZJD 5AZHA 2A1AA 3CU7A 2YTYA 5AJ3Q 1YNJD 1NAPA 3AFPA 3ZJYC 3JAMi 4AOFA 2ON8A 3U7ZA 3OJ4B 3MHBA 4LF7L 2PPHA 4HJ7A 3EECA 1CSQA 2ZW1A 3IAM1 2KLGA 3OWFA 2KTRB 1HZ5A 2WDVB 2JZZA 4KDLB 1UE7A 4YHHL 3U4ZA 4IM2A 1K51A 2D07B 2B8GA 2BB5A 2WDTB 3QHTA 4P2CB 4W9EA 1HPCA 1MI2A 4EQNA 1UELA 3I4NG 1H9JA 3HOZH 1I4GA 2LGDA 5KYIA 5IYBH 4KI0A 1B53A 4DV5Q 2JZPA 3PUXA 5JHBA 1FEHA 3RNEC 1N8RC 4HEDA 2NWGA 1JWMD 3HFZB 4AH6A 3C3LA 1TVXA 4K14A 2B63H 2R93H 2N55A 2LGIA 2JA6H 3A8KE 5M3MB 2DWQA 2YEPF 4P6VF 1CKOA 4MTNA 1F2ZA 1NI3A 1TJEA 4JL9A 3S9WA 1KC8C 2EE1A 1MSGA 4A3EH 1OXXK 3A55A 3TP5A 2ZNVB 4C7ZA 3HRDD 2BF8B 3TZDA 4DV4L 3LWUA 2DBYA 4QJFA 4XT1B 4L2YA 3E0JA 1MFWA 2G9DA 2J0TD 5KYLA 1P1AA 2BQQA 4IFDI 5DPRA 4K3BA 1GB1A 2KWUB 4FXGC 1N5WA 1AZPA 2X6GA 1A15A 1EY9A 4JCVE 3T53B 4K1RB 3ZNHB 3PLVA 2A69C 5EE0A 4DAVA 3FDTA 2NBFA 3V6CB 2KCCA 4NAWA 1IZ6A 2QDLA 5C4XB 3KWVA 4WJPA 1G6JA 3HOUH 4HTHA 3HOXB 4V0BA 2LVPA 1G8ZD 3S17H 3A9KA 1EIFA 4A3KH 4FF3A 4FNFA 4CBVA 1L1OB 1Z7TA 2PZTA 2GBRA 2KEDA 1NENB 2ZJPA 3WAPA 4WRDA 2KXJA 3W1GA 1A3UA 2ACZB 2MQJA 2CKHB 2F0TA 1GC6A 1HZ6A 2R2QA 4JYAL 2RSUA 1LGRA 3APCA 3RNFC 5C0XJ 2DZKA 3ALBA 4LNNA 4DR4Q 1PH8A 5IYCG 4K6DA 4GKKL 4RGOS 2F3IA 4ZLTF 4HPPA 4IUMB 3L0WB 5D14A 4LF5L 3R2TA 4K7SA 1STEA 3P20A 5E4WC 4B3RL 2M9VA 5LL6S 5GROA 1TBEA 1T9HA 2WXMA 2AQ3B 2JWZA 3H9DA 5CX3A 4ZHOA 1OQRA 1V6EA 2CW0C 3KJOA 1QJOA 4I6NB 4F8CB 2SOBA 1C4QA 1LTRD 1TWFH 2H4OA 1PH6A 2VUMG 4BKTA 4A3DB 1WXAA 2Q2HA 4UP8A 4DK6C 4GOPC 4X66Q 1NBFC 2LFNA 2JX5A 4DQOC 5BYRA 5G3LF 2QGQA 1J7BA 4ILWA 3PZDA 4WWNA 3PIO3 3QAQA 1CK1A 4WIPA 5FR6A 1HA6A 2W9NA 4BBNF 3Q8CA 1RLFA 4RHRA 4W9FA 2WDQB 3B2FA 2JYOA 1MJCA 1X3EA 3E6ZX 1IBMQ 4NQLB 1PFMA 3FEWX 3GTMB 1F9RA 2JK8A 1IUEA 1VQDA 2CVRA 1V2YA 1UEAB 2JWUA 4L5RC 3L13A 4YCWA 4WWMA 3W3AA 3RZFA 1NSNS 5A2QE 3CKIB 2KDBA 1C9OA 4QUFA 3F2BA 2PPBC 4DUYL 1ZPSA 3ZJUA 2MJDA 2JA7H 3AU5A 2MNAA 3EUB2 1WRIA 1QKZA 1Q82C 1UE5A 3BVGA 4RM9A 2NZHA 4JI7L 3KYHC 2ZZPB 2C5LC 2CU3A 5LMNL 3J9CA 3G4SA 3CQZB 4J1MA 4IO9A 4OX9L 2WXFA 3RNUA 2WXIA 1E3PA 2AYOB 2JSVX 3I5JC 4WJOA 3ZXRA 3VTWA 1E8YA 3ZJTA 1VQNA 4AP4C 1OFFA 3IKJA 1RHPA 1ZW7A 1W2BA 2VL6A 3W9CB 1GO3E 4N58A 4FBJB 1Q3LA 2D9UA 2ZTDA 4OZCA 2GLSA 3A7AB 5HG2A 3VUYA 1YNND 1ZXTA 1VQ8A 2EYFA 1R4MI 3E56A 4FN2A 1S4ZA 5KNCA 1C4AA 3TL5A 3ZGZA 1YJJA 5EBDA 1E5WA 4HAEA 2J53A 2L05A 3E9SA 1SYCA 3QQ8B 1B8AA 4CKCA 5COYA 1SMYC 1JALA 1BT0A 2MWSB 1KQSA 4GMVA 4DA2A 1SFOH 4ME5A 2B2WA 4BY7G 3OOCA 2K03A 1PH2A 2UUBL 5CBEE 5JEAJ 5C44B 2K1BA 3MXPA 5JJIA 4LNIA 2NVXB 4EQPA 4ACFA 2A74C 1F2YA 1HJPA 2K5QA 2VQFQ 2DHZA 3U50C 3CCUA 4W9HA 2Y0SG 3Q3FA 4X3UA 2E2HB 1HQRD 2PCFB 4DR3Q 1C78A 4GOCA 2AQ1B 3VDZA 4M0WB 3GTQB 2OOBB 4GDKB 2D11A 4LMQD 3C46A 4H44C 4LFBL 1WE6A 3IFDA 1F2RI 4BA1I 3U8ZA 1IBKQ 3WA0A 2V0GA 1I4QA 4IN3A 1ASYA 2GVAA 2EOTA 3VR8B 2CWAA 5CHFA 3OMGA 4JI4L 2KDFB 1JQYD 2LXJA 5FLMG 3CXCA 4PS7A 1P7EA 2EKEC 2J52A 4BBNC 3ENEA 5L37A 1XMQL 4PZ8A 4X65L 4LF6Q 4ICVA 1ENFA 3EQLC 4P72A 3B08A 4F1SA 1LT4D 1EU3A 2IHFA 2UYZB 3ZNZB 2CHZA 3GO5A 3BZDB 1JOQA 4DDID 1EEFD 4N9PA 1EWCA 4JI3Q 3IFTA 3NTIA 4BY1H 4KGTA 1W6KA 3VQIA 1TWGH 3ND8A 3TZUA 1ZUD2 4JI5L 4KX6B 3IT6B 2MSED 4Y52H 1JORA 4R4TA 4DUZQ 3H3VI 2L52A 3AE7B 3KQ4A 4D2KA 3J7AV 4B0MA 1ZYRD 2E2JH 1N32L 2KN5A 3A9KB 4TUUA 4QMGA 3B2GA 2ZT9C 2BWFA 1U0LA 3I55A 3SXHA 5C3JB 2EXDA 1P8LA 2ICIA 2M0AA 2HHHL 3J7YW 3KBGA 1T3QA 1WM3A 5C1ZA 3UINB 3M63B 3T4AC 1YN4A 3TCAA 4FF1A 4MJSB 2XEWA 2WXQA 4TQ0A 2WIIB 4CJ1B 3NS8A 5KNDA 3G6EA 4GDLA 3AE1B 5BR8L 4R8NA 1D5MC 3G7LA 3OLMD 1WJUA 1YJWA 1XNQQ 3I4MH 2BOSA 4XYOA 3OSOA 2RA4A 4DWFA 3JYUA 1NBWA 2O4XA 3AM9A 3HZXA 4QUCA 5E6PA 5HI1A 1E7VA 2M4NA 1DOYA 2N8NA 2HCCA 1VF7A 1TS5A 1Q5WB 5EKIA 4DAMA 4NPSA 3HHMA 3V05A 3A7LA 1ZXHA 1JT8A 2REXA 4R4QA 4A3LH 4HMJA 4YTNB 2DYBA 3M7NA 3NELA 2Z0EB 1JOKA 2HCIA 1YX6B 4PMWA 3VR2A 3J81E 1FGUA 2YTVA 4HIDA 1HH2P 1GJZA 2RDHA 4FHKA 2K50A 3I3CA 4B3TQ 4KVGB 4NJ6A 1J5EQ 4A3GG 2AMCB 4EX5A 4HIOA 3VR9B 4CDEC 3P7JA 4YCVA 4EFOA 3UE0A 2KYWA 2O5JC 3AXCA 5D3IB 4B3ML 4ZHPA 1STNA 3LGJA 1TWCH 4LDTD 1RD9D 1VQIA 1VZ7A 2V9HA 4OWXB 4A55A 4LUVA 3EFUA 2UUAQ 1PGXA 3VXWA 3N20C 2JXXA 3WDNA 1WF9A 3UDFA 2WDRB 2JP1A 1KDAA 4B9XA 5IODA 1OQYA 3DBHI 2FCNA 2ZPNA 1K0RA 2V1CC 1GUAB 1YQ4B 2NCNA 4KIKA 3DBRB 2NBUA 2E2DC 3SDZA 3P2BA 1OTRB 1TYGB 2NTSA 1VCBA 2MBOA 3AMZA 1NEKB 5CMDA 3I73A 3DWMA 2VY3A 4BWGB 2ALYB 1P98A 3Q8AA 3I4OA 4ANWA 2WU2B 4HJKA 3ZTDA 1KL9A 3IHPC 2A6EC 3H7PA 3EFXD 2N9XA 1YJ9A 1O7ZA 1VQFA 1F2MA 4FVMA 4DAPA 1UE1A 1X1MA 3D32A 1LTGD 2KACA 2PMZE 4LF4L 3X0WA 1UNSA 4EOYA 2D3GA 4REZA 1TWHB 3A56A 4B9WA 4LJZC 5IP7H 3HGBA 4K5XA 1E7UA 3OWEB 5DAUA 1EFID 4JK1C 3C19A 3NVVA 4MGYE 3MHSD 1MD2D 3AU7A 4RH6A 3DBLI 1YQ3B 1DJRD 1K8RB 4ZAIA 2LFIA 3AEFB 3Q14C 3QCAA 2KFJA 3X3NA 1FCCC 1ML0D 2J7QB 1S5DD 1KRTA 3GB1A 1EWIA 3AE8B 1X3GA 2K5WA 4A3DH 2PMZB 5C4JB 1L4DB 3S2DB 3AECB 2K8HA 3QK0A 3W1BA 4IKGA 1CZGA 2UUCL 1QVGA 2CW0D 2R6GA 3MC0B 2B2UA 3HS0C 4KZ0A 4ODGA 3T56B 5CBAE 2MBBB 1HQMC 1WXQA 2HD3A 5JOBA 4LCDE 4BFRA 2IW3A 1ACCA 4P16A 2K5PA 2FFKB 4KSKC 2LASA 1LTAD 1EYCA 1GG3A 2D0PA 3GTMH 4X62Q 4DR7L 1AP0A 3IXSA 4XQJA 4K81A 1XCQL 3MXGA 4K6LA 4A3FG 3RZWC 1DONA 2I38A 2N49A 5HKHA 1EIGA 3MC8A 3MJWA 4K7WA 2CH4W 4NKLA 2K05A 3CMEA 4A3LG 1F9QA 4IFDH 4JWUC 1EY6A 2G45B 2EYLA 2O6VB 2NN6H 3A9JA 1IYVA 5M3MG 1GOZA 2WWZA 4QB4A 1UAPA 4KV2A 3CCEA 1B70B 4G7OC 4C3JG 2NVYB 4ULLA 2C35B 4RCOA 3L2PA 4A3IB 2EELA 1JICA 4WQOB 3DOWA 3UF8A 4OO1G 1SXTA 5C3EH 1WSPA 3NBHB 2JXMB 4LF8L 1MG4A 4DR6Q 2R2OA 2RVLA 3K0YA 1V1PA 3T1YQ 4PS3A 5JZEB 1TY2A 2DENB 1YN5A 4DV2L 2PI2E 1MSHA 3CCJA 4AQYL 1V81A 4PQXA 2RSNA 4KKUA 4EE2A 1N6ZA 4IUVA 2BBCA 1I50H 2QILA 1KTKA 1VQPA 2QMTA 4WJQA 4WORA 2VZAA 4DR2L 5C4XG 1QQRA 3HOVG 3W5VB 4URKA 3JSVA 4O1NA 1JRUA 1WI0A 3HOXG 5TSSA 2QCZA 3ZDMC 3GD7A 1TT2A 3QOLA 4JI6Q 2Y0SE 3AH7A 2HTHA 2QDFA 1NVID 4US8A 4J15A 5JXVA 3GTJB 3L0OA 5C44H 3GE3C 3PRZA 1SMYD 3D8GA 4MGZE 3OAWA 1SLJA 1GD7A 2NVXH 1OTCA 2K32A 2MW5A 4C2MB 4E3CA 4KMUC 2UXCQ 2D2CC 4OGQC 4RKLA 1RTOA 3KF8A 2HQLA 3BZKA 2CKZB 3GTGB 1IGCA 1TZOA 1NYQA 3GTQH 4MH8A 4ARCA 3AB5A 1PH5A 2F0KA 4GIVA 2KTRA 4LNKA 1MKHA 2Y0SB 4C7YA 1TR5A 2E5LQ 1WX9A 1P7FA 1XLQA 1LT5D 2A19A 3FPUB 4UP9A 1BBUA 3A8IE 2AKWB 4DR1L 5HY6A 1AH9A 4NB3A 1EY4A 5C5LA 2JE6I 1QOFA 4ZRQA 4GXBA 3P4PB 3SR1A 4BBRG 3ONSA 5EJWA 4WWOA 4EVOA 2K04A 2B8FA 4A3DG 3G6JB 2KX3A 4NNJB 3V3XA 4L8JA 2N9KA 1GUWA 1STAA 4CHTB 3VFKA 1SYBA 5CC4A 4DR5Q 2PNHA 5G3LD 1XJVA 2A68C 1II3A 3JAME 4GNXB 4A3JH 2CHXA 2FUHB 3P4SB 4KN7C 2DUDA 5AFWA 4AS1A 2Y3AA 2R61A 1CZWA 2DZJA 1N63A 1VZ6A 1YD8U 1JRPA 1S5FD 5DPTA 1N36Q 4OVUA 2XRQD 2WXLA 4FHJA 4JIOU 5ELOA 1HNXQ 4EZJA 1UBIA 3T16A 1XMOQ 1QUQB 5AZGA 1J9OA 1J7AA 1G2SA 4DK5A 4KIKB 3S24A 4UY8C 2RDBC 4OWTB 3CF5A 3FVQA 5L95C 3A33B 1F0ZA 3KOJA 1A2TA 3D4DA 5C4ZA 1FRRA 2BWES 4KY7A 3VTVA 1CKMA 1ISNA 1Q1EA 2W3RA 2CFMA 1UGJA 2N7EA 3H7PB 4GGQA 1KLVA 4XYQA 2K0PA 3ERQA 1XD3B 3ZYYX 2SEBD 2XWBB 4I7ZC 3EBEA 2INNE 3GQBA 3M9BA 4YWMA 3VDYA 2F0LA 3I2ZA 1KFYB 1YMHE 2KC1A 1L1OA 3VUXA 2E6XA 1QG7A 2L4NA 3OTOQ 1YHQA 3PLUA 2HE7A 1EY7A 1L6UA 1Q7YC 4IOIE 3WWVA 2KAJA 1WTVA 2J0MA 2K9XA 2KFKB 3VR3A 2KJRA 1MGSA 3M3JA 3H0GB 3SK5A 1VQ6A 4X6AH 3GE8C 2C5CA 2VRRB 3M3YH 4JC0A 4Q5VA 3TEXA 4A20A 4LF9L 4MHEA 1YX5B 4NPNA 2O2VA 4J3OD 3F2DA 1WY8A 4LK0M 2MHVA 1HNZQ 3SHQA 1Y1VB 4L6TB 2WINB 4DV7L 4GKJQ 1YNXA 5GAEC 4FJYA 2F3WA 1NI2A 1PH1A 2W54A 5CV8A 3M4PA 1TS3A 1BVSA 2UXDL 4DV1Q 3DHIC 5LMNW 3VUWA 2XGTA 2RDFA 2PO4A 1E2ZA 5DEHA 1N33Q 1GHKA 2JRHA 1VQKA 1T0SC 3S1NB 3RUZA 1SMXA 5DPWA 4RF1A 3MP9A 1SN8A 2DJGC 2K5DA 2QIEB 1XT9B 2F0EA 2HDMA 4XXEA 4IOAA 3H3VC 4JBMA 4V190 1SF0A 2L9HA 2ZJRA 3BINA 3PHXB 5IKCM 2V1YA 1L0VB 3RN5A 1MHXA 4MM3A 4MSMB 4K2LA 2Y5CA 1ESRA 2HQEA 3PQIA 3IVFA 1E2VA 2M56B 1XLPA 4IWPA 1G51A 1GB4A 4GN1A 5AZFA 1C8CA 1DZ1A 2L0CA 1XXGA 2LXKA 2GOWA 1HUNA 1C77A 1NDDA 2I5MX 2KJ6A 2MBHA 3ZJVA 4E6IA 2GVBA 5FK9C 1C79A 1SIJA 1RFAA 2BGFA 4LJPB 3H3VH 1E6EB 1SDFA 4UAIA 3A8JE 3HKZG 2WXNA 3TN2A 2B2WC 2A6ED 2XVSA 1QOAA 2LGXA 2WQYB 5GQOA 5IGEA 3A1QA 5BMHA 1TWHH 3KUPA 1SBBB 4IG7B 1CHQD 1V43A 1LM8B 1T0QC 2B3GA 5IYCH 1NR4A 2KEEA 1IPGA 1S5ED 5M9OA 5IP9G 1VMCA 1QZGA 2PEAA 5JEAH 2OJRA 2R7ZG 2JA8G 3M4OH 1CFMA 5IO9A 1QB5D 4KLKA 1G291 2QCPX 2EYOA 3PV0A 2KHSA 4ZK9B 3JSVB 3RI7C 2AQ2B 2F4VL 2WXOA 4I6LB 5C4JH 2KHWB 5C0XG 3AMUA 1EIYB 3S2DH 1UH6A 4RCNA 2UWQA 2FCQA 1K8GA 2J42A 3PPAA 3PVLA 2VUMH 1MJDA 1HFNA 3I91A 3BK1A 1AW7A 4RMFA 2JYEA 1BCPB 1I42A 1JWAD 2DNEA 1N62A 4JWSC 2BA0A 3MWYW 4QQBX 2B3AA 4HCPB 4RHSA 1ENAA 3KF8B 5JJLA 2ZPYA 5T1IA 4PK1A 3OW7A 1L0WA 1BO0A 1DXMA 2UXBL 4ZRIA 3I63C 3PF4A 5IWAL 2CHBD 4H0LC 2WFWA 1PV4A 3JW0X 2CCZA 4LK1C 5J17A 1K52A 5EE1A 5IGGA 2D0OA 2J7ZA 4F88A 2X6LA 1I35A 1RDPD 5D7GA 4KHPL 1H9KA 2RD0A 4PS8A 4M0WA 4A3FB 4GDKA 1KRHA 5IT9L 5CV5A 1HNWQ 1ZOYB 1I4HA 1V80A 2FCSA 3MTNB 4XQQA 1E8ZA 1CSPA 1K8MA 4GKKQ 4BAXA 4L5QA 3LYYA 4HEA1 1PTOF 1EY5A 3P75A 1H4RA 2D3BA 5EE9A 3PSIA 4TV3A 3STBD 2NVYH 4WAFA 2L0FA 2ZVOA 1B9RA 4K2KA 2KTFA 1WTRA 4TMAB 2I1KA 2X69A 3E5SA 2DY8A 4C3JB 2WXPA 2DN8A 3DDCB 3U2SC 3A4SC 4B95A 4I6PA 2SDFA 1B2TA 3RT3B 2A6HC 3O65B 4NJCA 4G11A 3RN9C 3PUYA 4AUQC 1LYLA 3E3XA 1JE5A 4U68A 1PRTB 2NB0A 3OPOA 4Y7NB 2NN6I 1GVPA 2KK8A 1BBXC 3KLSX 3NS1A 4HLEA 5FO9B 4IWOA 1E0ZA 1F9JA 4RFBA 2DZIA 1STGA 4LNFA 2BS4B 1KLGD 5I6WA 1TKYA 3H6NA 2PYKA 5NUCA 1S3SG 1WGYA 3HOVB 4MSQB 1IBXA 2KZRA 1BQQT 3T1HL 2XWJB 1Y8RC 5M3FB 2BKRB 2B76B 3SVMA 3MTSA 2RGFA 1WOCA 3TJPA 2A5UA 4BY7H 4B08A 3U58A 3GTPB 2MPMA 2OF1A 5E6OA 1J7CA 3ULPA 2IDYA 4GZYC 4C4VB 5KHQA 3GTLB 3VR4A 3GTGH 4MJSA 2IY0B 3VRBB 1I6VC 4NW2A 1RTNA 4IURA 1G6ZA 2RDGA 4NXMQ 3KFUA 3VVWB 4P74A 2WAQB 1ICFB 5AJ3L 3QJZA 4O2DA 2F0HA 4F87A 3PF5A 3BDCA 5LMNQ 4B9KA 3LJ3A 3V2TA 1JB3A 2KX0A 2L15A 3ML9A 5GAHC 5JEAG 4OX9Q 1UEBA 2GBMA 1GUOA 5G55A 2O2VB 3EA6A 3CSFA 2M00A 4K0KQ 1RIPA 2VZKD 1D5ZC 4OONA 1GJXA 4HJ8A 4XYCA 3M95A 2NTTA 4A3BG 4A9AA 2VQEL 1WWTA 1GUGA 3S1MH 1YOVB 4W9CA 4BBRB 1AEXA 5FLMH 4DV5L 1B1ZA 2KDMA 2PZWA 2ES2A 1S40A 1N9WA 2GBNA 4NXNQ 1RAXA 3I4LA 2R92G 1HZBA 2QEXA 1H9MA 3CC7A 1PH7A 2A68D 3WALA 4FADA 3ZRFA 2F0UA 3CPWA 2ZTEA 4DV3Q 2EXZA 3I3TB 2Z6KA 1HR0W 4MM3B 3ITPA 2R3ZA 1SGHA 3L10B 3K57A 1KNEA 4GLXA 5M5XH 2L7RA 3G71A 3PRPB 1PTOC 1V9PA 1PYBA 2E3TA 1WGHA 4IDIA 4DV6Q 3NWSA 3R66C 4XWTA 2RHSB 3J80L 2N9EB 4OIJA 1RFKA 4UPAA 1I3QH 4ARIA 4A3MG 2GI9A 2NMQA 3DMUA 2EVBA 4ZQ3A 4A3IG 3A1QB 4NDXA 1QZEA 3I9V1 4MTKA 1DOLA 2B2UC 3AQQA 2DAFA 4JBWA 2LHEA 5CGKA 1PTOH 2BDNA 2PW7A 5FR3A 2ZXPA 1VDZA 1XTDA 3H94A 4LFAQ 1JR0D 4RF0A 3H15A 1Z2MA 3JVZX 1BMLC 3PTFC 4ZUJA 3CAMA 4CKEA 1Q8IA 2E75C 4DKAC 4US9A 3H0GH 4ANUA 3EN2A 3L9AX 4LUZA 2ZCCA 2KHIA 2IX3A 1GHJA 2A4ZA 3NVZA 1U4AA 4CO7A 1JWSD 3IL8A 5M5YH 4W9KA 1QILA 3TP7A 1R4QB 4OELB 3EC8A 2NVQB 4DR4L 2N3SA 2PW5A 2JF5A 1KDBA 1Y1VH 2WKDA 4PV1C 1R4NB 2WYQA 1PRTF 3KUZA 2LWPA 2QSDA 3RZOH 2Q8TA 1N60A 2JZ3B 3K58A 5JVH3 4A93B 4A3GH 3PIP3 2DAJA 5JJZA 1ZE3D 4R9WA 3S1NH 4RNAA 4YSYB 4BZAA 1EU4A 3CCLA 2LRUA 3KDFA 3QOJA 2MP1A 1CZPA 3V60A 3Q69A 1ZEQX 2ZXOA 2PMVA 2K6AA 4DBGA 1H8CA 1XTCD 3PIOA 1E7ZA 4BXXG 2HHHQ 5H8YE 4FDBA 4X66L 4WJ3M 2EYHA 5IY0A 3NUHB 1IYUA 2DYOA 4X57B 5K36H 3NVWA 1BXTA 1OXSC 1V8QA 4DAYB 1I94Q 3L17A 3IRBA 4S17A 3UE1A 1YQBA 2E76C 3HKZE 4XQNA 1CTMA 1R9TB 4GN5A 1KM7A 2NBVB 1WJ6A 2RKSA 1YITA 5CV4A 2K33A 1VQ4A 1IBML 3S15H 4RM8A 4A4IA 1FJGQ 4HRSA 4JW0A 4PNYA 1ZXIA 2KVZA 2G4DB 2LGSA 3AV8A 3GTOB 3CIRB 4G0NB 2O6VA 1XX8A 1KDCA 4IUPA 2LJIA 3AFQA 5ELDA 2FHTA 4CJ0B 4R8IA 3S2HB 2OTJA 2CWPA 4QAYA 5LLIA 3L7ZC 4K8IA 3SK6A 3MAQA 1WIAA 2L1AA 4XGAB 4A3OA 3HKZB 1QOBA 2LUMA 1HZ9A 3DBRI 5C2TB 3ULJA 2KVRA 2ZTCA 4EQOA 3L08A 1CMXB 1PH3A 2RF4A 1JW9D 5FLXL 2UU9Q 4IQZA 1E24A 2L55A 3NBHA 3VYUA 2A8VA 5CORA 2OQKA 4W9LA 3Q3JA 3K5MA 1IBLQ 1VQLA 1TS2A 1WTPA 3TRZA 1NCVA 1P3QU 5EGTA 2D3CA 1N5XA 2MO0A 4JBJA 2BCOA 2R7ZB 4KTAA 2JA8B 3WIMA 4XDCA 1IBXB 1B3AA 1HZCA 1IYJB 2JSOA 5GXGB 4A76A 1WR1A 4NMZA 1DD2A 2RPVA 3H8HA 1FMAD 3NRZA 2BE5C 3Q6SA 1JWBD 1WVLA 1WYWB 2HD5B 3B9JA 1A8VA 5M5WB 3NPPA 5J22A 2I0QA 1K8AC 3KW5B 5LMUQ 1SE2A 2LS01 1UE6A 2NS5A 3U4EG 3ULLA 2MGSA 1LTBD 1E10A 1YZ6A 1GM5A 2PI2A 5IT9c 3DHQA 1EL0A 2KMCA 1NUCA 4IJHA 2K4KA 5JVG3 1AWDA 1L0XB 3KF6A 3UDGA 2KQSA 1YJIA 3ZKJC 3V61A 2G4SA 2ZNVC 1D1KA 1XLOA 2EDGA 1SNCA 4L5SA 4A3FH 1YIWA 3H0GG 3ML8A 3W5UB 1SNPA 1PRTC 2BYVE 2KN4A 4DK0A 4HJGE 2YU9B 4POFA 1KLUD 3N1ZC 5KRUA 4DR3L 1HR0Q 3R93A 4P1BC 5IYDG 3LWEA 3HP3A 5M3MH 1Y1VG 3Q24A 3D4WA 3TREA 1E2WA 3RCZA 2EJMA 5EPLA 1IBKL 4E74A 1Z5SB 4FO2A 1L6VA 4C3JH 2D5DA 2YYZA 5JH5C 1FVIA 5BN5A 1I7HA 3P1MA 4KZCA 4OO1H 2O2LD 1UGMA 2ENBA 4G7ZC 5ISRA 3CCMA 4HIMA 3PO3G 4GNXA 2WACA 1GNUA 2K8CA 1L1OC 4JOIA 1SNMA 3TBIB 3HIZA 1J19A 1PDXA 1I4PA 2A6HD 2AUKA 4J6HA 3WAMA 2Z0SA 3KK7A 1EQTA 1WGKA 5K36G 4NP5A 2E2IB 5BYSA 1Y8NB 3O13A 3AEDB 1QUQA 4LW1A 1L7YA 2IY1B 1WCMB 5CV6A 4GN3B 5C4XH 3EVQA 1QNKA 3HOVH 2M17A 3RULA 4CHKA 3HOYG 1JJ2A 4IUNA 3HOXH 3ECIA 5C23A 3SK4A 3RLFA 2A69D 2JPHA 4JI3L 4GLVB 3GTPH 2LXAA 4BKSA 1Y14B 4DUZL 5C6AA 3GTKB 1D2BA 2PE6B 3NG0A 4WH4A 3SK8A 3M85A 3GTLH 3SFDB 1HUMA 4MDKE 1IXRA 2MBEA 4JV5Q 3N3KB 1TWAB 2HJ8A 1EF1A 3N1XC 1IYFA 2C7MB 3OHXC 1V49A 5CHVC 1UWVA 3BYTB 1M90C 3K5OA 2G3QB 4K5WA 2KJXA 1V5OA 5HGTA 4L5TA 3N6RA 3CF6E 3Q23A 3KYCD 4ZRJA 1TU2B 3PREA 4IPCA 3GV6A 2KFKA 2L76A 3AI5A 5AEKB 3BDOA 4YT0B 3FRPB 1XNQL 4H2AA 1CM9A 4HCEA 4LWCA 3KLWA 4DHZE 4RAUC 2B2YA 3J80i 1AZQA 4L63B 1L4ZB 2JYTA 1ZKHA 1UBQA 4BBRH 5G5GA 3MEFA 1JOOA 2AUJD 2E74C 3R3MA 4IZ8A 3B1LX 4A3BB 2PNRC 3QA8A 3QB3A 2F0PA 4GLAC 4DNTB 5ELCA 2K3UA 4KD4A 4LTUA 3VA5A 3KDFB 5ELFA 5KIXA 5F2DA 4EEWA 1JCKB 3UQBA 3S1QB 2OT2A 2MFIA 3NOBA 3Q3OC 1WYGA 3TP6A 3C8YA 3T9LA 2ICEC 1PZKD 1LACA 3M4QA 4DF7A 3J80c 2R92B 1L5PA 3GS2A 4DHZB 1DGSA 1WD1A 1J5EL 2WP9B 2MA9B 3ABVB 2KCTA 2V3NA 3K8AA 4A75A 3AEVA 1BF4A 2ZM6Q 1K83B 4Q2JA 3ZW3A 4PZ6A 1JMLA 1Z47A 4HCNB 2AHOB 1T6BX 3W1YA 1R7SA 4A90A 1YNJC 2ZXRA 2L8JA 2KO3A 5EKLA 4ZRZA 2EYJA 1OXVA 2WV6D 3BVZA 4S0RA 4LFCQ 5G5HA 3ZUNA 1PTOD 2LZ6A 3V96A 2JY6A 5TR5A 3CMAA 4FJZA 4L23A 1C48A 3P63A 2F0WA 2QW7A 5DM63 3CCSA 3M62B 2IGHA 4H7BA 4A3MB 3CQZH 5C4HA 4IALA 3NJTA 4XX5A 1XF5L 5G2NA 4IUTA 4DR1Q 2JUOA 3DPDA 3DUZA 2N7JA 2FIDA 4KHZA 4DV0Q 1EF5A 1LT6D 2HDEA 1E1TA 2LVQA 3K80C 1UF0A 1VQBA 2OJWA 4KSLC 2LI5A 4NQKE 5GMVA 1U5KA 2K22A 4M02A 3D6WA 2LVOA 2MJ8A 2MP2B 1VRAB 4LLGM 4YXDB 1WXMA 4GB9A 2KWCA 2SNSA 4JVZA 5C5MA 3D3RA 1K3RA 1Y8PB 1NTGA 5IGFA 1SJED 1VD2A 2MLBA 4OIKA 3PO2G 3GP7A 2XSCA 1YVCA 3CRLC 1U4RA 2PQEA 3U9SA 2PE9A 4FXCA 3W1SA 3IAS1 1GPXA 2Q8RE 2R93B 2N9LA 3ZXVA 1PDQA 4YY3Q 3QO2A 2B63B 2MJEA 3A74A 5D6JB 3QX1A 5M3FG 4JLCA 4KV6A 1PHJA 1LT3D 1SNQA 1A3VA 2INCC 2OWOA 3T13A 2CJNA 1C3TA 4CJ2C 4AWJA 4CQNA 4TQ1A 1NYRA 1QNUA 1NMGA 3NZUA 5I9OA 3VYRA 1GC7A 2LY7A 3LXFA 2E8GA 3DHHC 2IHEA 1PGAA 4RKBA 3VTUA 2QDBA 3KF6B 1C9FA 3TDQA 1GUSA 3D4RA 2WAQG 2E2HH 4QF4A 2G9HD 4DHJD 1TS4A 2KUMA 1OQQA 1PH4A 2ASQA 4W9DA 3GV3A 4HROA 4UHVA 2BVCA 1Q1BA 3PUZA 3TQYA 1EIHA 1TIID 1X3QA 1LM0A 1YIJA 1DYQA 1ILQA 2QKIC 3URYA 1DOMA 1PXUA 4LDTB 2NVUI 2JT4B 1PYWD 3HOUB 2NZOA 3EFCA 4II3B 1JC7A 4IM0A 3TS2A 4OW0A 1D5XC 2AWNA 2MQHA 4A3KB 2CS4A 1SJHD 3IAYA 1NNXA 3AYHB 1XLNA 4XZ4A 4YSXB 5FLXc 1FD6A 4WQMA 2Y5BB 3EROA 3RMKC 1A0IA 2QEJC 3FMCA 4JI1Q 3RZDB 4WJNA 2H5XA 4FLHA 2D5GA 2IT1A 4ABNA 3HM3A 3TP8A 1S1QB 2VH2A 2RCNA 2ID0A 2L1BA 4FXDA 2XK5B 4LF9Q 2DYMA 1Z6HA 2FMMA 1X3PA 2K7VA 4PYZA 1P0RA 4BKGA 3QC8B 4KN4C 2KD0A 2KMAA 3PV1A 4N6EB 4JBKA 3W2DA 1JQ4A 2IO2B 3KH0A 3MEHA 1UWMA 1FGBD 5IP9H 1QLBB 1YHAA 1HXYD 2IO1B 3KVFB 2R7ZH 1QVCA 2JA8H 3NTHA 1Z9FA 4XT3B 1X9NA 1QVFA 3HOWG 2Q8IB 2N78A 2IX1A 5L83A 4DR6L 2K25A 3T1YL 2KBNA 1EQVA 5C0XH 3Q8EA 2WXGA 4KKIA 1KOTA 2AWOA 1TWFB 3RR5A 4XWWA 3AU4A 3NBIA 5H92C 4KY6A 4RGNA 5EQ0A 5M5WH 4LNQA 1YHBA 1ET9A 2MO1A 2MH7A 4FF2A 2EYPA 1U9RA 4FYDA 1CHPD 4ZYNA 4A3PA 4YSZB 1PYSB 3PUWA 1SE3A 3DWQA 3RN2A 5J18A 3N32A 2BYFA 5FOBB 1RM6C 3ZVVA 1M4VA 1YBYA 1HRJA 1D1IA 2EZVA 2EJGC 2N9PC 2W3SA 4A6QA 4JI6L 2EY6A 2FAZA 1Q86C 2MBQA 4JG2A 2B2TA 1NJIC 3AEAB 2IO3B 2LHDA 4YWKA 2WNMA 4C4VA 2B2VA 1CUKA 2M0XA 3AEGB 5E4XA 2VNUD 1LABA 3OMCA 4APVA 4AIMA 4GOPB 2LJ5A 1T5EA 1VF5C 2W55A 4X3SA 1XPUA 2Z6KC 4X64Q 3CCRA 2YU9H 1TIFA 1S72A 5J1ZA 3MHZA 1B3QA 4BBSG 2JA7B 1CJEA 3C1FA 2NZ1D 4MGIE 4TVAB 4ZYSA 4HPMB 1LLRD 4G4KA 2E5LL 3EHVA 2I46A 3J7A5 4R3DA 4M8MA 2F0SA 1WRDB 1D3ZA 4A93G 4JI8L 4EGVA 1KHIA 4JE3B 3L16A 4ZCKA 5I2XA 2J0JA 3S14B 2F4VQ 1ZKOA 3UDIA 4ZRKA 2JVCA 4JI2Q 2YEPB 5ELEA 1X56A 2PQAA 3PO3B 4ZDVA 5DNFA 3ND9A 1ZGUB 4WJ4A 1VQMA 4DR5L 5HHDG 4CDDC 5GADC 3QARA 2EPBA 1WZ0A 1MG8A 4XC2A 3FP9A 3NWTA 2J4XA 3MZ5A 2HTME 3PZ7A 4LF7Q 3QIAA 3UI2A 1W3SA 4G57A 4GN4B 2L12A 1X32A 4R4IA 3L54A 1XPOA 1LXDA 2UXBQ 1LTID 1HEZE 2OXPA 1N36L 1KRSA 4OO1I 4YHHQ 1HNXL 3HOYB 5JJKA 1RRBA 1RODA 1XMOL 1SFOB 2KENA 1XPRA 2DGYA 2KCNA 3BIID 1STHA 2BS3B 1AYFA 4IM3A 3ETRA 3SFEB 2AL6A 2M2LA 4B6WA 2KDEB 2KNBA 3T3NA 2NR2A 2V3SA 4HKQA 1SSOA 2JEBI 1V97A 2I1JA 1TWAH 5J39A 4JI0L 5EPJA 1ZDVA 3I72A 3QG1A 1YJ1A 2Q2UA 1WJNA 3WAOA 4AQ7A 1EOTA 2K39A 2IGGA 4ZRPA 4KD3A 2K01A 3FHWA 1JB7A 2JXTA 1HTOA 4C1NK 4HR7B 3AEBB 2JA5B 5EAYA 3Q0AA 2GBKA 4IC7B 1K73C 1FNWA 4I7AA 4IOCA 1X3FA 3OTOL 4GSWA 4F7XA 2K1FA 2EKIA 1Q1OA 3BWUD 1J0GA 2J0KA 1AE3A 4DV4Q 3AE2B 1Y56A 5IE8A 3KLRA 1FFUA 1TKEA 2IJ0A 4XDXA 5JPMC 4A3BH 1JROA 3K59A 1HTLD 3V6EB 1WFQA 3G48A 3H91A 3FKIG 1V1QA 4IPGA 1NMFA 2EJFC 2H1EA 2D3AA 3TUOA 4QCLA 1SE4A 2D2QA 1F77A 2ZJQA 4CYEA 1IW7C 4X3KA 2MX2A 2R92H 4IFDJ 4ZKBB 1N34L 3Q8DA 3PCOB 4PMBA 4HJ5A 1ENCA 3NQTA 5BMIA 5EBCA 3R2IA 2KQ4X 3TMPB 2MHJA 1O7YA 1Y8OB 4BY1B 3RNAC 1TWGB 5HGQA 3QJYA 4DV1L 2F3VA 4PMCA 1OEYA 4E71A 1N33L 5D3DA 2VW9A 1B44D 2I5HA 4I65A 5IGBA 4B3SL 1JMCA 1SE9A 1T0RC 1E1OA 1ZP0B 5I6YA 2K8BA 4DAYA 4JYAQ 3QWZB 2JRIB 2N7DA 1NY4A 3OIPA 1MPEA 2GB1A 3U9OA 1MI0A 3B6YA 1IP9A 1W6JA 4OXPA 3K7UC 4Z9CB 1OEYJ 2V3PA 4A3MH 3LDZE 4HDQA 3GZNB 1SB3C 1RWSA 3UI3A 4DU9A 4LF5Q 4HMIA 4A3IH 1A6XA 1WD0A 3NXWA 4B3RQ 1J8IA 2GBJA 2IGDA 2LUEA 2JN4A 4MGKE 5BMGA 2F52A 3D31A 4DK3C 1PH9A 1STYA 4HDOA 1F9SA 4ICUA 3NENA 3A54A 1BR9A 1SEBD 3BU2A 5KEEA 3I4MB 4IW0A 2QHOA 2XIWA 2VQEQ 5IIFA 3BG3A 1I6HB 3JAMc 2Q2TA 4OEMB 2GRIA 5LNK1 3DVGY 4M8AA 1VR9A 1FR3A 1SRUA 1R4PB 1XNRL 2CHWA 3OJ3A 1QCBD 2RR9A 1WCMG 2EY1A 2VS1A 3DWAA 1HA5A 2JA9A 4RGTA 1WGRA 1EEID 3PO2B 1T0YA 4OL7A 2XN9C 4QL5A 4TRDA 2ZJDA 4FA6A 2O5IC 5LXIB 2WAQE 3Q3MC 4IPHA 4N59A 3NHHA 2VH1A 3TBLD 3GTJH 4G7HC 3RD2A 2AL3A 4C3HG 3DVNU 4FULA 4EQ5A 2L5TA 3TSSA 3B0AA 5D94A 1RKNA 2F0FA 2KVMA 4C2MH 2F0MA 2V4IB 2W82A 1WTOA 1TWCB 1KF6B 3MFGA 1V8CA 4DUYQ 1QZHA 4BVUC 1LFDA 4BXXH 1PUTA 2Z1CA 1J8CA 2VB3X 5IOCA 1R4NI 4BA2I 4GNXC 4JI7Q 2OCEA 5A2QL 4JOIC 2KQ7A 5LL6X 1RF2D 4AYBG 1RYJA 2IX0A 1NR2A 3K5NA 2ZCBA 1BNZA 4HSPA 1WXSA 2BH8A 2FE8A 1Y1WG 5IT9E 2BW2A 4WJWA 2LXCA 1MBYA 4FP5D 4YL8A 2DJFC 3VYSA 1Q81C 3NSWA 3UIOB 3RZDH 5AUIA 3T3OA 3K81C 2KT7A 4A3CG 1L2FA 1HNWL 2N4FA 4MNOA 4C3IG 3IBEA 4BS9A 3BY4B 1WX8A 3VH4B 2PQAB 3NTKA 3FPPA 2DLBA 3NZ3A 5BO4B 4TKOB 1X54A 2KC2A 1LV9A 4IJLA 1SYFA 3D0FA 1K28A 1WXVA 1LO5D 3ONAB 4KJOA 4PG3A 5FO8B 1P9DU 1U4MA 2WGSA 2CQAA 4YIJA 2H88B 1UWXA 2XTIA 2UUBQ 1BCPF 1I4XA 1X6OA 3SEBA 2F1MA 3Q22A 2YLMA 4XIGS 5E7NA 1EY0A 2RBMA 2L0TA 3Q8FA 3HOWB 1TY0A 2QA4A 1HHVA 1K53A 4HKZE 4YCUA 1FRDA 1E22A 1E8XA 1XO3A 1CKNA 4JPBW 1VQOA 4IPDA 1XEEA 2B2YC 3DQVA 2F0OA 1QWYA 1QOHA 5D65A 4LFBQ 4DPGA 3I57A 2INDC 4CGYB 2WB1G 1BKBA 2BH2A 4WWPA 4ZKCB 2KJHB 4J6IA 2X8XX 2OQ0A 2HT1A 2V4LA 1TZ1A 3VH3B 1Q0WB 3ER0A 3PHWB 5EKKA 1YNTE 2K5HA 3RUIB 4MZ9A 4JI4Q 2DY7A 4CDFC 5C0XI 2MEKA 3HOZG 4HXDA 1B50A 5IYBG 3V62A 3U7DA 3ZQ4A 5HFYA 3EGRA 2QC8A 1PQSA 5CTRC 4C80A 4RWSC 3KJPA 1LUZA 2RQXA 5FKAC 3AEEB 1XMQQ 4X65Q 3DVNV 2EMSA 2QJLA 1CT1D 4HK2A 4H13C 4NXML 1K3BC 4CKBA 2R93G 1E7PB 1MHHE 2B63G 1XWEA 1VQ7A 2JA6G 4BBSB 3HEJA 3X23A 5IYDH 1Q10A 1YJNA 1WFYA 3T51B 2MRPA 1HE8A 1VQJA 4A3EG 1VZ8A 5IOIA 1TXYA 3S14H 1RL2A 1RJTA 4OVVA 2BB6A 4JI5Q 1PGBA 1B9NA 4K0KL 1QF6A 3RLNA 4CDCC 5C3EB 3RPFC 1N32Q 3H7SA 3PO3H 4HVBA 1AE2A 5DLQE 4ANVA 1QOGA 1ROEA 3HUIA 3MXNB 3N9YC 1KXLA 4ITKA 3FILA 2K5NA 3NY5A 3KUDB 1B7YB 2LMCB 1K0SA 2FCMA 1I50B 3K9OB 1Q8KA 2KQ3A 2LKVA 1KJTA 5E6NA 3DM3A 2F0VA 4NXNL 2OHFA 3HM6X 4LJOB 3OIQA 4YWLA 2BDOA 2UU7A 1M8AA 3HOUG 4DV3L 2JQRB 5BR8Q 3HOYH 1IL8A 3VR5A 1VDVA 1O7LA 4A3KG 3J80E 3N1YC 4ZUIA 1PMRA 2K52A 1EYAA 3W1SC 4HJ9A 2EYMA 1H9RA 3H6MA 5CV7A 3RD4A 3W5OA 3Q2AC 4HN7A 3SHLA 1IGDA 3CWIA 3TMEA 2C9OA 2QF7A 5I9PA 2AWTA 2JU6X 2PVGC 4DV6L 4A8XC 4F7ZA 1IL2A 3ZDTA 2BYTA 2YTXA 4IUQA 4P1CC 2R7FA 1BUIC 4KY5A 3BVMA 4KK7A 1BCPC 2JA5H 1VQHA 4TSSA 2BKFA 3J81j 1M1KC 3S1RB 2MUYA 1V9JA 2KKCA 1E9MA 2MP2A 2WU5B 2Q2IA 1VMPA 4W9IA 2Z8LA 1U4LA 2K5VA 3J81L 4BOSC 4B3MQ 3KUCB 4LFAL 2KWVB 3AN1A 1WE7A 1FNUA 5LXHA 4LNOA 4OZBA 3S2AA 3KBXA 2X38A 1XYIA 2OTLA 3Q6BA 3PGEA 4QY7A 2GMIC 4EKUA 5KGUA 2C60A 4MN3A 2XNAC 4A3JB 3E0EA 4FXKC 1WMHA 3HG9A 3FKIB 1VLBA 3CHBD 2VZKB 4K7UA 4POGA 4PT5A 4WURA 5IA7A 4ALPA 4OHJA 3PIPA 2CU1A 3I56A 3VR6A 2K14A 1TKWB 1X65A 3JC66 3RLOA 1WX7A 2IO0B 3HKSA 1FXAA 4AJWA 2F0NA 4K5VA 3S16B 1WR6E 1IW7D 2O6VD 1GUTA 5CV9A 1PFSA 4NAWB 2NPTA 3Q8BA 1YN3A 4ME3A 1SYGA 2YV5A 4X3TA 3P4QB 3SDLC 2N1VA 4PZ7A 3DEPA 2C7HA 1WYDA 2JA7G 2VQFL 2XBBC 3PO0A 5C3WA 2NBWB 3I90A 4LF4Q 2DX5B 2Z4HA 2BA1A 1UD7A 5J2RA 4TKNA 4RA8A 4KGSA 2B39A 1G91A 3I8ZA 1I94L 5CR3A 1AFPA 1Q90A 1XQQA 4GS3A 1R4MB 2D62A 1CA6A 1U4PA 1D7QA 1LQBA 3IT4B 5EE3A 4GU2A 1GUNA 1KAAA 1BOSA 4M1UB 1FJGL 4JGHB 1HTQA 1FNVA 3BS1A 1I6HH 1O78A 4DGZA 2N0SB 3TS0A 2XK5A 3A4RA 3PT2B 2CR5A 2WX0A 3I4NB 2UUCQ 4P7IA 2LD9A 5FLXE 3NK9A 1Q12A 2RCFA 4Y7NH 2B2TC 1OGWA 1ILPA 4R1JA 2RMMA 2B2VC 1VQ9A 3SGIA 2IYDB 3M3YB 4LF6L 1EOVA 3PO2H 2CJOA 2F0IA 3H09A 4HJAA 1SROA 4Q0FA 3BZCA 1CKNB 3LNNA 2Z6BA 3I7FA 1VQGA 1NE3A 2UU9L 2D10A 4G50A 4C1NI 5E1FA 1ONLA 1HCZA 5M3FH 4USAA 2EY2A 3OYYA 4DFAA 1IBLL 1EQRA 4M00A 2G5DA 4DR7Q 1UZXB 2CQOA 4XDDA 4AYBE 1FD7D 3KLSA 1Q46A 1L0YB 4RGMA 4C3HB 2P5ZX 2TMPA 3PMFA 4O42A 2SAKA 1ZDXA 4ASWC 2RSOA 1EO6A 2ZEQA 2WXRA 3U30A
chains in the Genus database with same CATH topology
4B0EA 1DOIA 1SSNA 2SNMA 3K7AB 3DM1A 3KWLA 4AYBB 5BYQA 1EWHA 2KOLA 1KH0A 1IHZA 1Y1WB 1WTQA 4OZAA 3FAHA 5MPOA 1D6EC 2IWHA 4OVZA 1VJKA 1FFVA 1E0BA 1SNDA 1CA5A 1DGJA 2NVTB 4C3IB 1C4CA 2PTLA 5I2YA 2KA7A 3FILB 4QIWB 3TEYA 3L4PA 3M4OB 2KMMA 3BK2A 1SNOA 3AE9B 3U52E 3K6OA 3L3OC 2F4IA 4YWGG 4JX1C 3VA7A 2VUMB 1DCZA 1MVKA 1TKGA 4KKTA 4KKJA 2K28A 2L11A 3CRKC 1B4OA 2Z4IA 1PLFA 4KHVA 2KWDA 1N61A 3AE4B 2BTEA 5T8IA 2WB1B 1FIQA 2MJ3A 1EY8A 2PLPA 1FM0D 1SYDA 3EJIA 4DXGA 5CYUA 5KNBA 2PW9A 3R8BA 5T1GA 2L83A 4ID6A 5LHY1 1ET6A 2ZW0A 1WTWA 3HOZB 2BS2B 3M7GA 2WXHA 4NZLB 1SYEA 1QT9A 5IGDA 1STBA 1S5CD 5ELBA 1IKMA 1G2TA 1CQVA 1HTPA 2JA6B 1SAPA 3JAML 1GAQB 3DWGC 2EY5A 2IL8A 2HDLA 1KABA 4KKSA 3HRZC 1VCIA 3MFYA 4A3EB 1JE4A 3VRAB 1KNAA 5C3XA 1OO9B 1FYCA 4L1BA 3VYTA 2A5HA 2V4DA 1H9SA 1T5XD 4GLSC 3TEZA 2ONQA 1A70A 3R3OA 4XE0A 4LAAA 2WS3B 3NUCA 4HSVA 2WLBA 2FBWB 1PFNA 4U673 2H89B 2I2YA 1V1OA 1OXUA 5AUKA 3X3MA 1CI3M 5JAVA 2IPKD 3AB9A 2FUG1 1LTTD 3S17B 4FF4A 3DWPA 3I70A 3TEWA 3SR6A 4DXFA 3AE3B 4GDLB 4BY7B 2F0JA 4N9TA 1A3TA 2M19A 1OXTA 5EPKA 1BUVT 3FC4A 2GA4B 1EM7A 3MJ5A 2F0GA 1IKLA 1BDOA 2WKCA 1EZ6A 1Y69U 2PZUA 1BCPD 3RFZB 5E6JA 2LEKA 2DNCA 4K8JA 3LB8C 4ZOHC 1S5BD 3DXJC 3S1MB 2VB2X 1I4RA 2FJ2A 2FMCA 1FXIA 4C56C 1DM0B 1HFGA 4S3SA 3P1HA 3MXUA 2F0DA 5I4DA 2BE5D 3HVDA 2WXJA 1JWUD 3BDLA 4WFN3 2F0QA 1GXDC 1LTSD 3MVVA 4MACA 2FINB 5M5XB 3P4RB 1EZ8A 4J8QA 2PVOD 5A35A 5FO7B 4IFDG 2L32A 2NN6G 1TQOA 1I3QB 3WOEA 4DNRB 3K5LA 1PRTD 2HUGA 2VXWA 3NQIA 2Y5PA 3PUVA 3HVZA 1F9PA 5JPNC 1F2LA 3RMHA 3QWNA 5DM73 1F2RC 1PTOB 3NP8A 4NAMA 1C76A 1YNNC 3WOFA 2Q5WD 1A2UA 1ICWA 1B9MA 1FO4A 2WP8J 1DOXA 5M5YB 1K50A 1EYDA 3DEOA 4TQUS 3P42A 3BYYB 1O80A 2KECA 5E3FA 5IGCA 1DOKA 1UUPA 3WCQA 3RZOB 1C4PA 4DN4M 5BN3A 3LX0A 4A3GB 1PFDA 1QE6A 3M4YA 4MIUA 3F2UA 2OEDA 3D6CA 2NUCA 1PFBA 2XRSD 4KGRA 4HCSA 1EWYC 4DK1A 3PZ8A 2WXKA 4UDUC 3AE6B 4KJNA 1WTXA 3MA2B 2PKOA 1CQFA 3S15B 4IUUA 4JPSA 4F8MA 2TSSA 1D4BA 2OEOA 1RCVD 2PIAA 1K8OA 3C1EA 2INPE 5HURA 1V1PB 5BN4A 3N52A 3NVYA 1H9SB 3NE5B 2I07B 2F03A 1AN8A 1ESFA 2A73B 3C2PA 2BT6A 5K5PA 4YTMB 1ZYRC 2N88A 1XCTL 3MXNA 1PZID 1FCLA 4MT5A 3SE0A 2JEAI 3J7AF 2G1EA 2LMCA 3AE5B 4YTPB 4XTCS 2E2JB 2AX5A 2NYZD 1PZJD 3CU7A 1YNJD 1NAPA 2ON8A 3U7ZA 3MHBA 2ZW1A 3IAM1 3OWFA 1HZ5A 2WDVB 1K51A 2B8GA 2BB5A 4P2CB 1HPCA 1MI2A 4EQNA 1H9JA 1I4GA 5KYIA 4KI0A 1B53A 2JZPA 3PUXA 1FEHA 4HEDA 2NWGA 1JWMD 3C3LA 1TVXA 4K14A 2LGIA 2N55A 3A8KE 5M3MB 2DWQA 2YEPF 4P6VF 1F2ZA 1NI3A 1TJEA 3S9WA 2EE1A 1MSGA 1OXXK 3A55A 3TP5A 4C7ZA 3HRDD 3TZDA 3LWUA 2DBYA 4XT1B 4L2YA 3E0JA 2G9DA 2J0TD 5KYLA 4IFDI 1GB1A 4FXGC 1N5WA 1AZPA 2X6GA 1A15A 1EY9A 3T53B 2A69C 5EE0A 4DAVA 3FDTA 2NBFA 2KCCA 5C4XB 3KWVA 4HTHA 3HOXB 4V0BA 1G8ZD 4FF3A 4FNFA 4CBVA 1Z7TA 2PZTA 2KEDA 1NENB 4WRDA 1A3UA 2ACZB 2F0TA 1HZ6A 5C0XJ 4K6DA 4RGOS 4ZLTF 5D14A 3R2TA 1STEA 3P20A 5E4WC 2M9VA 5LL6S 2WXMA 2AQ3B 4ZHOA 1OQRA 2CW0C 1QJOA 2SOBA 1C4QA 1LTRD 2H4OA 4A3DB 2LFNA 2JX5A 5BYRA 5G3LF 1J7BA 4ILWA 3PIO3 1CK1A 4WIPA 1HA6A 3Q8CA 4RHRA 2WDQB 3B2FA 2JYOA 3E6ZX 1PFMA 3FEWX 3GTMB 1F9RA 1IUEA 2CVRA 1UEAB 2JWUA 4WWMA 3W3AA 1NSNS 5A2QE 3CKIB 4QUFA 2PPBC 1ZPSA 3ZJUA 2MJDA 3EUB2 1WRIA 1QKZA 3BVGA 2CU3A 3J9CA 3CQZB 4J1MA 2WXFA 2WXIA 2JSVX 3ZJTA 1OFFA 3IKJA 1RHPA 3W9CB 4N58A 1Q3LA 2D9UA 4OZCA 5HG2A 3A7AB 1YNND 1ZXTA 2EYFA 3E56A 3ZGZA 1S4ZA 5KNCA 1C4AA 1YJJA 5EBDA 4HAEA 2J53A 3E9SA 1SYCA 4CKCA 5COYA 1SMYC 1JALA 4DA2A 4ME5A 2B2WA 3OOCA 2K03A 5CBEE 5JEAJ 5C44B 2K1BA 3MXPA 2NVXB 4EQPA 2A74C 1F2YA 2K5QA 4X3UA 2E2HB 1HQRD 2PCFB 1C78A 2AQ1B 3GTQB 4GDKB 4LMQD 3C46A 4H44C 3IFDA 1F2RI 4BA1I 2V0GA 1I4QA 4IN3A 2EOTA 3VR8B 3OMGA 1JQYD 1P7EA 2J52A 1ENFA 3EQLC 1LT4D 1EU3A 3GO5A 3BZDB 1JOQA 1EEFD 4N9PA 1EWCA 3IFTA 3NTIA 4KGTA 1W6KA 3VQIA 3ND8A 3TZUA 1ZUD2 4KX6B 3IT6B 3AE7B 1JORA 2L52A 3KQ4A 4D2KA 3J7AV 4B0MA 1ZYRD 4QMGA 3B2GA 2ZT9C 3SXHA 5C3JB 2ICIA 2M0AA 3J7YW 3KBGA 1T3QA 3T4AC 1YN4A 4FF1A 2WXQA 4TQ0A 2WIIB 4CJ1B 5KNDA 3AE1B 4R8NA 1D5MC 3G7LA 2BOSA 4XYOA 3OSOA 2RA4A 2O4XA 3AM9A 3HZXA 4QUCA 5HI1A 1DOYA 2HCCA 1VF7A 1TS5A 5EKIA 3V05A 3A7LA 1ZXHA 4HMJA 4YTNB 3M7NA 1JOKA 2HCIA 4PMWA 3VR2A 3J81E 2RDHA 3I3CA 3VR9B 3P7JA 2O5JC 5D3IB 4ZHPA 1STNA 1RD9D 1VZ7A 4A55A 1PGXA 3WDNA 2WDRB 2JP1A 1KDAA 4B9XA 5IODA 1YQ4B 2E2DC 3SDZA 1TYGB 2NTSA 3AMZA 1NEKB 5CMDA 3I73A 3DWMA 4BWGB 3Q8AA 2WU2B 2A6EC 3EFXD 1O7ZA 1F2MA 4FVMA 4DAPA 1LTGD 2KACA 1UNSA 4REZA 1TWHB 3A56A 4B9WA 4LJZC 3HGBA 4K5XA 3OWEB 5DAUA 1EFID 4JK1C 3NVVA 1MD2D 3AU7A 4RH6A 1YQ3B 1DJRD 4ZAIA 2LFIA 3AEFB 3X3NA 1FCCC 1ML0D 1S5DD 3GB1A 3AE8B 2K5WA 2PMZB 5C4JB 1L4DB 3S2DB 3AECB 4IKGA 1CZGA 2CW0D 2R6GA 3MC0B 2B2UA 3HS0C 4ODGA 3T56B 5CBAE 1HQMC 1WXQA 5JOBA 2IW3A 1ACCA 4P16A 2K5PA 2FFKB 1LTAD 1EYCA 3IXSA 1AP0A 4XQJA 1XCQL 3MXGA 4K6LA 1DONA 2I38A 1EIGA 4NKLA 2K05A 4IFDH 4JWUC 1F9QA 1EY6A 2EYLA 2NN6H 1IYVA 1GOZA 4QB4A 1UAPA 4G7OC 4C3JG 2NVYB 4ULLA 2EELA 4RCOA 4A3IB 1JICA 4OO1G 1SXTA 1WSPA 2JXMB 2RVLA 3K0YA 1V1PA 1TY2A 1YN5A 1MSHA 4PQXA 2RSNA 4KKUA 4EE2A 4IUVA 2BBCA 2QMTA 2QILA 1KTKA 4WORA 3W5VB 1QQRA 4O1NA 5TSSA 3GD7A 1TT2A 3QOLA 3AH7A 1NVID 4US8A 5JXVA 3GTJB 1SMYD 3D8GA 2K32A 4C2MB 4KMUC 2D2CC 4OGQC 4RKLA 1RTOA 3KF8A 3GTGB 1IGCA 1TZOA 1NYQA 4MH8A 4ARCA 3AB5A 2F0KA 2Y0SB 4C7YA 1TR5A 1XLQA 1P7FA 1LT5D 3FPUB 3A8IE 1EY4A 5C5LA 2JE6I 1QOFA 4ZRQA 3P4PB 3SR1A 5EJWA 4EVOA 2K04A 2B8FA 3V3XA 3G6JB 4L8JA 2N9KA 1GUWA 1STAA 4CHTB 1SYBA 5CC4A 5G3LD 2A68C 1II3A 3JAME 3P4SB 4KN7C 4AS1A 5AFWA 2Y3AA 2R61A 1CZWA 1N63A 1VZ6A 1JRPA 1S5FD 2XRQD 2WXLA 3T16A 1J9OA 1J7AA 1G2SA 3FVQA 1F0ZA 1A2TA 3D4DA 5C4ZA 1FRRA 4KY7A 2W3RA 1Q1EA 1UGJA 4XYQA 2K0PA 3ERQA 3ZYYX 2SEBD 2XWBB 4I7ZC 2INNE 3GQBA 2F0LA 1KFYB 1YMHE 2E6XA 1QG7A 2L4NA 1EY7A 1L6UA 4IOIE 2KAJA 1WTVA 2K9XA 3VR3A 1MGSA 3H0GB 3SK5A 2C5CA 4Q5VA 3TEXA 4MHEA 4J3OD 4LK0M 2MHVA 1Y1VB 4L6TB 2WINB 2F3WA 2W54A 5CV8A 1TS3A 1GHKA 2RDFA 2PO4A 1E2ZA 5DEHA 3S1NB 3RUZA 4RF1A 3MP9A 2K5DA 2QIEB 2F0EA 2HDMA 4XXEA 3H3VC 4V190 1SF0A 2L9HA 1L0VB 1MHXA 4K2LA 2Y5CA 1ESRA 2HQEA 1E2VA 2M56B 1XLPA 1GB4A 1C8CA 1DZ1A 2L0CA 1XXGA 1HUNA 1C77A 3ZJVA 4E6IA 1SIJA 5FK9C 1C79A 1E6EB 1SDFA 4UAIA 3A8JE 2WXNA 3TN2A 2B2WC 2A6ED 2XVSA 1QOAA 2WQYB 5IGEA 5BMHA 3KUPA 1SBBB 1CHQD 1V43A 1NR4A 2KEEA 1S5ED 5M9OA 1VMCA 5JEAH 1CFMA 1QB5D 1G291 2QCPX 2EYOA 3PV0A 2KHSA 4ZK9B 2AQ2B 2WXOA 5C0XG 3AMUA 4RCNA 2J42A 1HFNA 3I91A 3BK1A 1AW7A 2JYEA 1BCPB 1JWAD 2DNEA 1N62A 4JWSC 2BA0A 3MWYW 4RHSA 1ENAA 5T1IA 3OW7A 1BO0A 1DXMA 2CHBD 4H0LC 4LK1C 1K52A 5EE1A 5IGGA 2J7ZA 4F88A 2X6LA 1RDPD 5D7GA 1H9KA 4M0WA 4A3FB 1KRHA 5IT9L 5CV5A 1ZOYB 1I4HA 4XQQA 1K8MA 3LYYA 4HEA1 1PTOF 1EY5A 3P75A 5EE9A 4WAFA 1B9RA 4K2KA 1WTRA 4TMAB 3U2SC 2X69A 3E5SA 2DY8A 4C3JB 2WXPA 2DN8A 2SDFA 1B2TA 2A6HC 4NJCA 3PUYA 4U68A 1PRTB 2NB0A 3OPOA 4Y7NB 2NN6I 3NS1A 1BBXC 3KLSX 5FO9B 1E0ZA 4RFBA 1STGA 2BS4B 1KLGD 5I6WA 1TKYA 2PYKA 5NUCA 1IBXA 3HOVB 1BQQT 2XWJB 5M3FB 2B76B 3SVMA 3MTSA 4B08A 3GTPB 2MPMA 2OF1A 1J7CA 2IDYA 4GZYC 3GTLB 3VR4A 3VRBB 1I6VC 4NW2A 1RTNA 4IURA 1G6ZA 2RDGA 2WAQB 2F0HA 4F87A 3BDCA 3V2TA 1JB3A 5JEAG 1GUOA 3EA6A 2M00A 2VZKD 1D5ZC 1GJXA 2NTTA 4A9AA 1WWTA 1GUGA 4BBRB 1AEXA 1B1ZA 2KDMA 2PZWA 3I4LA 1H9MA 2A68D 2F0UA 2EXZA 4MM3B 3ITPA 2R3ZA 3K57A 1KNEA 1PTOC 2E3TA 4IDIA 3NWSA 4XWTA 3J80L 4OIJA 1RFKA 4ARIA 2GI9A 2NMQA 3DMUA 2EVBA 4ZQ3A 4NDXA 3I9V1 1DOLA 2B2UC 2LHEA 4JBWA 5CGKA 1PTOH 2BDNA 2PW7A 5FR3A 2ZXPA 1VDZA 3H94A 1JR0D 4RF0A 1BMLC 4ZUJA 4CKEA 1Q8IA 2E75C 4US9A 3L9AX 2IX3A 1GHJA 3NVZA 1JWSD 3IL8A 1QILA 3TP7A 1R4QB 2NVQB 2PW5A 1KDBA 2WKDA 4PV1C 1PRTF 2QSDA 2Q8TA 1N60A 3K58A 5JVH3 4A93B 3PIP3 5JJZA 1ZE3D 4R9WA 4RNAA 4YSYB 1EU4A 3QOJA 2MP1A 1CZPA 3Q69A 1ZEQX 2ZXOA 2PMVA 2K6AA 1XTCD 5H8YE 2EYHA 3NUHB 1IYUA 2DYOA 5K36H 3NVWA 1BXTA 1OXSC 1V8QA 5C2TB 3SFEB 2E76C 4XQNA 1R9TB 1CTMA 2RKSA 5CV4A 2K33A 4HRSA 4PNYA 1ZXIA 3AV8A 3GTOB 3CIRB 1XX8A 1KDCA 4IUPA 2LJIA 5ELDA 2FHTA 4CJ0B 4R8IA 3S2HB 3L7ZC 4K8IA 3SK6A 3MAQA 2L1AA 3HKZB 1QOBA 2LUMA 4EQOA 1JW9D 5FLXL 4IQZA 2L55A 3NBHA 3VYUA 5CORA 3K5MA 1TS2A 1WTPA 1NCVA 5EGTA 1N5XA 2BCOA 2R7ZB 4KTAA 2JA8B 4XDCA 1IBXB 1B3AA 2JSOA 5GXGB 4NMZA 1DD2A 2RPVA 3H8HA 1FMAD 3NRZA 2BE5C 3Q6SA 1JWBD 1WVLA 3B9JA 5M5WB 3NPPA 5J22A 1SE2A 2LS01 3U4EG 2MGSA 1LTBD 1E10A 3DHQA 1EL0A 1NUCA 5JVG3 1AWDA 1L0XB 1YJIA 1D1KA 1XLOA 2EDGA 1SNCA 3W5UB 1SNPA 1PRTC 2KN4A 4DK0A 4HJGE 2YU9B 1KLUD 5KRUA 3R93A 3LWEA 3HP3A 3Q24A 3D4WA 1E2WA 2EJMA 5EPLA 4FO2A 1L6VA 2D5DA 2YYZA 1I7HA 5BN5A 3P1MA 4OO1H 2O2LD 2ENBA 4G7ZC 5ISRA 2WACA 1SNMA 3TBIB 1PDXA 1I4PA 2A6HD 2AUKA 4J6HA 3KK7A 1EQTA 1WGKA 5K36G 4NP5A 2E2IB 5BYSA 1Y8NB 3O13A 3AEDB 1WCMB 5CV6A 3EVQA 1QNKA 4IUNA 3SK4A 3RLFA 2A69D 5C6AA 3GTKB 1D2BA 4WH4A 3SK8A 3M85A 3SFDB 1HUMA 1TWAB 3OHXC 3BYTB 3K5OA 4K5WA 2KJXA 5HGTA 3N6RA 3Q23A 1TU2B 3GV6A 3BDOA 4YT0B 3FRPB 4H2AA 1CM9A 4HCEA 4RAUC 2B2YA 1AZQA 4L63B 1L4ZB 2JYTA 5G5GA 1JOOA 2AUJD 2E74C 4IZ8A 4A3BB 2PNRC 3QB3A 4DNTB 2F0PA 2K3UA 5ELCA 4KD4A 4LTUA 3VA5A 5ELFA 5KIXA 5F2DA 1JCKB 3S1QB 2OT2A 1WYGA 3TP6A 3C8YA 2ICEC 1PZKD 1LACA 4DF7A 2R92B 4DQOC 1L5PA 3GS2A 1WD1A 3ABVB 2WP9B 2V3NA 1BF4A 1K83B 4Q2JA 1JMLA 1Z47A 1T6BX 4A90A 1R7SA 1YNJC 2ZXRA 5EKLA 4ZRZA 2EYJA 1OXVA 2WV6D 3BVZA 5G5HA 1PTOD 3V96A 4L23A 1C48A 3P63A 2F0WA 5DM63 2IGHA 4H7BA 4A3MB 5C4HA 4IALA 1XF5L 4IUTA 3DUZA 2N7JA 4KHZA 1LT6D 2HDEA 2K22A 3D6WA 2MJ8A 4YXDB 1VRAB 4LLGM 2SNSA 5C5MA 3D3RA 1Y8PB 5IGFA 1SJED 4OIKA 3GP7A 2XSCA 3CRLC 1U4RA 2PQEA 3U9SA 4FXCA 3W1SA 1GPXA 3IAS1 2Q8RE 2R93B 2N9LA 1PDQA 2B63B 3QO2A 2MJEA 4KV6A 1LT3D 1SNQA 1A3VA 3T13A 2CJNA 4CJ2C 4CQNA 4TQ1A 1NYRA 1QNUA 5I9OA 3VYRA 2LY7A 3LXFA 1PGAA 4RKBA 2QDBA 1C9FA 3TDQA 1GUSA 3D4RA 4QF4A 2G9HD 1TS4A 2KUMA 1OQQA 3GV3A 4HROA 1Q1BA 3PUZA 1EIHA 1TIID 1X3QA 1DYQA 1ILQA 2QKIC 3URYA 1DOMA 1PXUA 1PYWD 3HOUB 1JC7A 4OW0A 1D5XC 2AWNA 4A3KB 1SJHD 3IAYA 1XLNA 4YSXB 1FD6A 4WQMA 3EROA 2QEJC 3FMCA 3RZDB 2D5GA 2IT1A 4ABNA 3TP8A 2ID0A 2L1BA 4FXDA 2DYMA 1Z6HA 2FMMA 1X3PA 2K7VA 4KN4C 1JQ4A 4N6EB 3W2DA 3MEHA 1UWMA 1FGBD 1QLBB 1HXYD 3NTHA 4XT3B 2Q8IB 2IX1A 1EQVA 5C0XH 3Q8EA 2WXGA 4KKIA 2AWOA 1TWFB 4XWWA 3NBIA 5H92C 4KY6A 4RGNA 5EQ0A 1ET9A 2MH7A 4FF2A 2EYPA 1U9RA 4FYDA 1CHPD 4YSZB 3PUWA 1SE3A 3DWQA 5FOBB 1RM6C 1M4VA 4A6QA 1HRJA 1D1IA 2EZVA 2EJGC 2W3SA 2EY6A 2B2TA 3AEAB 2LHDA 2WNMA 2B2VA 3AEGB 5E4XA 2VNUD 1LABA 3OMCA 2W55A 1T5EA 1VF5C 4X3SA 5J1ZA 3MHZA 2JA7B 1CJEA 3C1FA 2NZ1D 4ZYSA 1LLRD 4G4KA 2I46A 4R3DA 2F0SA 4EGVA 4JE3B 5I2XA 3S14B 1ZKOA 2YEPB 5ELEA 3PO3B 5DNFA 3ND9A 5HHDG 2EPBA 3NWTA 2J4XA 3MZ5A 2HTME 3PZ7A 3QIAA 3UI2A 4G57A 2L12A 1X32A 1HEZE 1LTID 2OXPA 4OO1I 3HOYB 1RODA 1SFOB 2KCNA 3BIID 1STHA 2BS3B 1AYFA 3ETRA 2M2LA 3T3NA 4HKQA 1SSOA 2JEBI 1V97A 5J39A 5EPJA 1ZDVA 3I72A 3QG1A 4AQ7A 1EOTA 4ZRPA 2IGGA 4KD3A 2K01A 2JXTA 3AEBB 4C1NK 4HR7B 2JA5B 3Q0AA 1FNWA 4F7XA 2EKIA 3BWUD 3AE2B 1Y56A 3KLRA 1FFUA 1TKEA 2IJ0A 4XDXA 5JPMC 1JROA 3K59A 1HTLD 3H91A 3TUOA 2EJFC 2H1EA 4QCLA 1SE4A 1F77A 1IW7C 4X3KA 4IFDJ 4ZKBB 4PMBA 1ENCA 3NQTA 5BMIA 5EBCA 3R2IA 2KQ4X 1O7YA 1Y8OB 4BY1B 1TWGB 3QJYA 2F3VA 4PMCA 5D3DA 1B44D 4I65A 5IGBA 1ZP0B 5I6YA 4DAYA 3OIPA 1MPEA 2GB1A 3U9OA 1MI0A 1W6JA 4Z9CB 2V3PA 1SB3C 1RWSA 3UI3A 4DU9A 4HMIA 1A6XA 1WD0A 3NXWA 1J8IA 2IGDA 5BMGA 3D31A 1STYA 1F9SA 3A54A 1BR9A 1SEBD 5KEEA 3I4MB 2XIWA 5IIFA 3BG3A 1I6HB 2GRIA 5LNK1 4M8AA 1VR9A 1FR3A 1R4PB 1QCBD 2EY1A 3DWAA 1HA5A 4RGTA 1EEID 3PO2B 4OL7A 2XN9C 4TRDA 2O5IC 4N59A 3NHHA 4G7HC 4C3HG 2L5TA 3TSSA 1RKNA 2F0FA 2KVMA 2F0MA 2V4IB 2W82A 1WTOA 1TWCB 1KF6B 3MFGA 1V8CA 1PUTA 2Z1CA 2VB3X 5IOCA 4BA2I 5A2QL 5LL6X 1RF2D 1RYJA 2IX0A 1NR2A 3K5NA 1BNZA 4HSPA 2FE8A 5IT9E 2BW2A 4WJWA 1MBYA 4FP5D 3VYSA 3NSWA 5AUIA 3T3OA 4C3IG 4BS9A 3NTKA 3FPPA 2DLBA 3NZ3A 4TKOB 1LV9A 1SYFA 1LO5D 3ONAB 4KJOA 5FO8B 1U4MA 2CQAA 4YIJA 2H88B 1UWXA 1BCPF 1I4XA 3SEBA 2F1MA 3Q22A 4XIGS 1EY0A 2RBMA 3Q8FA 3HOWB 1TY0A 1HHVA 1K53A 4HKZE 1FRDA 1XO3A 1XEEA 2B2YC 2F0OA 1QWYA 1QOHA 5D65A 3I57A 4CGYB 4ZKCB 5EKKA 1YNTE 2DY7A 5C0XI 2MEKA 1B50A 3ZQ4A 5HFYA 3EGRA 4C80A 4RWSC 2RQXA 5FKAC 3AEEB 2QJLA 1CT1D 4H13C 4CKBA 1E7PB 1MHHE 1XWEA 4BBSB 3HEJA 1Q10A 3T51B 1VZ8A 1RJTA 2BB6A 1PGBA 1B9NA 1QF6A 5C3EB 3RPFC 1QOGA 1ROEA 3HUIA 3N9YC 4ITKA 3FILA 2LMCB 1I50B 2LKVA 2KQ3A 2OHFA 2F0VA 3OIQA 2BDOA 1M8AA 2JQRB 1IL8A 3VR5A 1VDVA 1O7LA 3J80E 4ZUIA 1PMRA 1EYAA 2EYMA 1H9RA 3H6MA 3RD4A 5CV7A 4HN7A 3SHLA 1IGDA 3CWIA 3TMEA 2C9OA 2QF7A 5I9PA 2JU6X 2PVGC 4A8XC 2BYTA 4IUQA 1BUIC 4KY5A 3BVMA 4KK7A 1BCPC 4TSSA 3S1RB 2MUYA 1E9MA 2WU5B 1VMPA 2Z8LA 1U4LA 3J81L 3AN1A 1FNUA 4OZBA 3KBXA 2X38A 1XYIA 5KGUA 4MN3A 2XNAC 4A3JB 4FXKC 1VLBA 3HG9A 3FKIB 3CHBD 2VZKB 4WURA 4PT5A 4OHJA 3VR6A 1TKWB 1FXAA 2F0NA 4K5VA 3S16B 1IW7D 1GUTA 5CV9A