2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
b'DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
1V1PB 2CHBD 2ICIA 3MFGA 1B1ZA 1KLUD 3BYTB 2XN9C 1BCPC 1S5BD 5TSSA 2RDGA 5FK9C 1DJRD 1BCPF 4Z9CB 1PRTB 4RFBA 1LTBD 1KTKA 2Z8LA 1PYWD 4DXFA 1TY2A 4NZLB 4RCOA 1ENFA 1PTOB 1JR0D 1JCKB 1FGBD 1DYQA 2IPKD 1RCVD 3BVMA 1LT6D 1FNVA 1PZID 1EU3A 1HXYD 1D5MC 1FNUA 4TSSA 4O1NA 1PZJD 1RF2D 1ESFA 1STEA 3BYYB 1LT5D 1I4RA 2XRQD 1ET6A 1TS3A 1ET9A 3R8BA 1HTLD 3W2DA 2SEBD 1V1OA 4C56C 1HA5A 1BCPD 1LT4D 1SE2A 3EFXD 1TS4A 4UDUC 1TS5A 2IJ0A 5ELDA 1S5FD 1LT3D 1LLRD 4RHRA 1LTAD 1KLGD 1LO5D 1L0XB 3BZDB 3MC0B 1AN8A 1RD9D 1LTGD 3OWEB 3EA6A 3URYA 5ELFA 1I4PA 1SBBB 4RH6A 1PZKD 4BWGB 2AQ3B 3TSSA 2QEJC 5FKAC 1EU4A 1LTID 1PRTC 3V05A 1FD7D 5D3DA 1I4XA 1PRTD 1PRTF 3CHBD 1UUPA 1XTCD 2AQ1B 2J4XA 5I4DA 1G8ZD 1PTOF 1T5XD 1S5DD 3BVGA 1GOZA 1EEFD 5D3IB 1TS2A 1JQYD 2NTSA 1BCPB 3O13A 5ELBA 1RDPD 4L63B 4K6LA 1F77A 2QILA 1SE4A 1SXTA 2TSSA 1XXGA 1TY0A 1CHQD 4RGNA 1D6EC 1BXTA 3BVZA 1I4QA 1EEID 1SEBD 4RGOS 3DWPA 2XRSD 2NTTA 2R61A 4L6TB 4RGTA 1FNWA 1CQVA 3DWAA 1UNSA 1LTRD 1AW7A 2O2LD 1SE3A 1SJHD 1D5XC 3GP7A 3R2IA 3SEBA 1PTOH 1PTOC 1LTTD 2RDHA 1CK1A 1PTOD 1V1PA 3KLSX 2G9HD 1YN4A 1I4GA 2XNAC 1S5ED 4RHSA 1JWSD 1QILA 3R2TA 4ZYSA 1EWCA 1I4HA 4OHJA 1B44D 1YN5A 1CHPD 3DWQA 1L0YB 1YN3A 5ELEA 1S5CD 1MD2D 2AQ2B 1LTSD 4RGMA 1JWMD 4DXGA 2WV6D 1JWUD 1SJED 5ELCA 1HQRD 1CT1D 1EFID 1D5ZC 1M4VA
chains in the Genus database with same CATH superfamily
3WANA 1A2TA 4LF8Q 1B2TA 3AU5A 3BYTB 4UP8A 3HS0C 3Q8AA 1E8XA 4KHZA 4BKTA 4OZCA 1AWDA 2KVZA 4DV3L 3AEEB 5E6NA 1MIUA 1WGRA 1OO9B 2F0TA 4RCOA 1SSNA 2DYBA 2KMCA 1TZ1A 4R4IA 2YYZA 2O4XA 4K0KQ 1T3QA 3NEMA 3PZ7A 5C0XJ 1VD2A 3U7DA 3Q23A 3BU2A 1FJGL 1KDCA 5HG2A 3MXGA 2DJGC 2MBHA 2K14A 5H8YE 2A74C 5DPRA 2EJMA 1IL8A 2JZ3B 4ZRPA 4II3B 2JEBI 2O5IC 1DCZA 1ET6A 3KF6A 4YHHL 3CMEA 2DWQA 3I7FA 3R8BA 2WNMA 1ZGUB 1GUNA 1I5FA 1Y1WH 1P0RA 1E9MA 4I6NB 4PQXA 3B9JA 3V3XA 4J1MA 4HKQA 5COYA 2Z1CA 4R8IA 2LKVA 1EIYB 1EF5A 1ZW7A 2W54A 2WP9B 1LO5D 4B6WA 3NTIA 3MC0B 1Z7TA 2B2WA 1PFNA 1RD9D 1NMFA 3K7UC 2K0PA 3MJ5A 4DR7Q 2VY3A 1IBMQ 3UQBA 3HOWH 3IXSA 4QMGA 3T9LA 1SBBB 3PUZA 1WTOA 4MSQB 4A3BB 3PIOA 3EVQA 1RTOA 1ICFB 5JPNC 3BS1A 3PV0A 4KX6B 3ZNZB 5FKAC 5KNBA 3FKIH 3GE3C 3ECIA 2KJHB 3PLUA 3I91A 4HJ7A 1D4BA 3H91A 1HTOA 1IW7D 4QF4A 1V43A 1XTCD 2R7DA 5I4DA 3GTOH 4FN2A 1ICWA 1SYGA 1EY8A 1HR0Q 1E8ZA 3AEBB 3ZTDA 1GOZA 2PNHA 3FMCA 1E8WA 1L0WA 3S1MH 2F0SA 1EFWA 1V5OA 3S17H 4A3IH 2LJ5A 1DOMA 2KWVB 1F52A 4U673 3OAWA 2HQEA 2MLBA 1QVCA 3RCZA 1WJ4A 1UAPA 1TWAB 4AOFA 3T1YQ 2JA8H 1UELA 3SHLA 3H09A 5GAEC 1I35A 3X0WA 2I1JA 3HOVG 2DY7A 2KMAA 3GDEA 4JI5Q 3FC4A 3BJUA 4GZYC 2NBVB 4W9HA 4USAA 4CO7A 5CV6A 5EBCA 4JI0Q 3I4NH 1VCBA 2JSVX 2BOSA 1LFDA 2IGDA 2D5DA 3I73A 1GNUA 1XPRA 5IYDH 1PTOH 3GTKH 5KGUA 3MC9A 4BAXA 2UYZB 1C76A 1CK1A 1V1PA 2YTYA 3L3OC 2BW2A 2OJWA 3PO2B 4A3BG 4GGQA 4K3BA 1P7EA 4J3OD 4G7ZC 5TR5A 4V0BA 5BYQA 3OW2A 1HFGA 4YWGG 2L7RA 2AWTA 4ZRKA 5JVG3 1WX8A 1JWUD 5KNDA 1E7UA 1XLOA 5ELCA 1IYVA 1Y1VB 2TMPA 2K3UA 2GA4B 4DV4L 1CT1D 5J39A 5M3MH 3VUWA 2UUAL 1VQLA 1VQHA 3S1QH 1C7YA 2GBMA 1WCMH 3NTKA 2KAJA 2VH1A 3S2AA 1WM2A 2BYEA 3AU4A 2JYOA 4QGUA 2I5MX 1N32Q 3Q6BA 2WB1B 3GV6A 3K5OA 4X64Q 1YOVB 2IO0B 2JYEA 4AUQC 1BO0A 4N8X1 3T16A 3HOYB 1JWBD 4AYBB 1GUOA 4RFBA 2DYOA 2LFIA 1KTKA 2DY8A 1K51A 3B1LX 3ZQ4A 1TWCB 2QC8A 3L54A 1D3ZA 1TGZB 5C44H 2MP2B 1HZCA 5NUCA 2Q8TA 4US9A 1LABA 1CZGA 1PZID 2OQKA 4P73A 2ON8A 4MELA 1K8MA 3ABVB 4XQNA 1VMCA 4C00A 4IPDA 4L8JA 1XLQA 1STNA 4DF7A 1WTXA 2YU9H 4YTMB 3PO2G 4S17A 2NN6H 1L2NA 2NVYH 3WA0A 2DX5B 2CCZA 3Q8CA 3RULA 3EJIA 3MAQA 2L55A 3I4LA 2WACA 3MP9A 4BKGA 1JWAD 4IUQA 2OXPA 1V8CA 1S5FD 2YEPF 3RUZA 1Y1VG 2F3IA 4XDDA 3I72A 4IFDJ 3U4EG 4C7YA 3SD5A 1B8AA 2FINB 3I2ZA 4K7SA 2QJLA 5ELFA 1EQVA 1SYFA 4AYBE 2HTME 1AARA 2K4KA 3T13A 3VA5A 2OCEA 2WB1G 4MTNA 1R4NB 2QGQA 4LNQA 1E6EB 1C8CA 3HOYG 4X62Q 3H3VH 4AYBG 4NP5A 1Y8OB 2DJFC 2I07B 4UAIA 5C3XA 1WZ0A 1X1MA 4A4IA 3SR6A 1GUGA 4A3MH 4DNRB 4BXXG 2E2JB 2FCNA 4FHJA 2L52A 2UXCQ 3EECA 1XEEA 1HA6A 1QOFA 3QIJA 1PQSA 2EKIA 4C3IH 3KLSA 5GROA 1BF4A 4FJZA 1ENCA 1A63A 3S15H 4LFCQ 3V60A 1EQTA 4BKSD 1LTLA 2VB3X 4ZAIA 4GN1A 3LGJA 4TQUS 1ASZA 1E22A 3KJPA 4YSZB 5JEAH 4BOZB 4KKTA 3M4OH 4WRDA 1Y8RC 1SEBD 2MSED 2WDVB 3NPPA 2ZVOA 1IYJB 3A56A 4N9TA 1N5XA 2PI2A 1H95A 3AECB 3SHQA 1YEZA 3H3VI 2RF4A 3W1BA 4C1NI 3CW2C 2DZMA 1WY8A 5AUIA 1JRPA 1SB3C 1FVIA 2NVUI 3DBLB 2XK5B 3K58A 2D0OA 4Q0FA 2RHQB 5FJ8G 3G6EA 3TIXA 2WXLA 1DGJA 3RLFA 4IM2A 2CWPA 4YCVA 1Z47A 4C7ZA 2EXZA 2ZPNA 3U9SA 3EC8A 2B2TC 2MO0A 4TV3A 2C7HA 4GXBA 2F0NA 4IURA 4YIJA 1CKNA 5M5YH 4FULA 4RGMA 2H89B 3CMMB 1N63A 2WV6D 1TWFH 2FCQA 3E9IA 2WXMA 2Y5CA 3VYTA 4CDCC 2JA9A 4A75A 5C3WA 3S1RH 2ATWA 1YD8U 3TEZA 2EYLA 1WWTA 2PW5A 3DM3A 1F2LA 2ICIA 5C3EB 1N36Q 4J6IA 4LDTD 1X3GA 4X65Q 4R3DA 1EY4A 3X23A 3SFDB 1MHWC 2PW9A 2RGFA 3QCAA 2O2VB 4BY7H 5HGTA 3IT4B 4F7ZA 2PW7A 2JEAI 3P1HA 2E5LQ 4K5WA 4GDKB 3AE3B 1FGBD 2WAQB 2EMTA 3WOEA 2KQ7A 4ICUA 3WAPA 1C9OA 3NQIA 3KFUA 4DR3Q 1PGBA 4YWLA 3VR6A 2JU6X 2Z0EB 3NS1A 5IP7H 2PPBC 1RF2D 4J8QA 4B9XA 5IP9H 3HOXH 3K5LA 1LT5D 1IBKQ 1HZ6A 4B9KA 3LNNA 2NZHA 2J0MA 2RDFA 2V3NA 3AN1A 3UDFA 3P4QB 3RZOB 3PV1A 4EE2A 1O78A 2F0QA 4QJFA 4RM8A 1D1IA 3UGBB 1PDQA 2GVBA 5AZFA 3HG9A 1TZOA 2I5LX 1WXQA 3OLMD 4RHRA 2F0LA 4N59A 3TCAA 2B63H 4YCWA 1A0IA 4AQ7A 2INPE 1BQQT 4NAWA 3C8YA 4POFA 1Q1OA 1WXMA 3ZDMC 5C23A 2KJRA 3HRZC 3AB5A 5C3EG 1L7YA 4OVVA 4C2MB 4BVUC 3R7QA 2FHTA 2Z6KC 5KNCA 2REXA 2PZWA 1H9JA 4NPSA 2EOTA 3TEHB 3RNUA 2QIEB 1X6OA 3DEOA 3PO3B 1G91A 2YV5A 1QOGA 2O6VD 3ZRFA 4TUUA 1J5EL 1PYSB 3GTMB 2AUKA 1BKBA 2L76A 2WAQG 3D4WA 2AL3A 5C6AA 2EJFC 4H44C 3APDA 3BVGA 1XWEA 1YHAA 2NBFA 2QA4A 3UE0A 4K7UA 3CQZB 1MPEA 4JE3B 1J7CA 1WI5A 4KIKA 1Q1BA 1VQNA 2FFKB 5D14A 1TWHB 1TT5B 4MGZE 1GJZA 3HZXA 4MH8A 4ASWC 4KY7A 5AZGA 2RPQA 1HNZL 4WWNA 1IYUA 2BTEA 1K0RA 2LMCA 5IOCA 2N9KA 4C1NK 1L1OC 3I90A 4NKLA 4ZQ3A 2INCC 2LGDA 4GLSC 4RF1A 1EWYC 2N9XA 5IGBA 4Q2JA 2M00A 1UNSA 1PH6A 3DHGC 2R6GA 3P20A 2WIIB 5K36H 3MA2B 5IP4D 4DXAB 4JBWA 5CV7A 1OEYA 2KTRB 2KUMA 4HXDA 4N8FA 4LF6Q 2N1VA 4BBRB 3SK4A 4YY3Q 1ASYA 3KBXA 2ASBA 2R92B 1EY6A 3RN2A 3PRMB 4DV1L 1U4AA 5BR8L 1EWCA 2EY5A 2KLCA 3PO3G 2YEPB 2EE1A 3PS6A 5IYCG 1WTQA 3VRAB 1WTVA 3HGBA 5C0XH 5JJKA 5DNFA 2JJQA 3TP8A 2CU3A 3NUHB 4JI1Q 3QB3A 3GOEA 1OQYA 3F1ZA 3VFKA 5IGCA 3ML8A 1X55A 5H1SE 4GNXB 4LF5L 2R7ZH 4ZLTF 1WGGA 2F3WA 3H15A 1MJDA 4CHKA 1JC7A 1HCZA 3DWGC 3VTUA 2IDYA 4IUMB 5I9PA 2WXIA 3I57A 1NNXA 2JA6B 2NZ1D 2SAKA 2O6VB 4XTCS 4LNIA 3J80i 1NI3A 3ONAB 2PE9A 2IL8A 4IUPA 4KKIA 4DXFA 1GXDC 5CHVC 4WJ4A 1WM3A 2E2IB 4JW0A 2JF5A 1JRUA 2OHFA 1YQ3B 1LT6D 1FNVA 1KAAA 1OXVA 4F8CB 3VTWA 3R66C 1SAPA 1EUJA 3JAME 1PH9A 4LNFA 1E10A 4KTAA 3QHTA 4F88A 3D31A 4BBRG 4IKGA 4WQOB 3HKSA 1PH1A 4PMCA 2R92G 4TKNA 4PG3A 3BY4B 3C1FA 4AJWA 1JW9D 4UP9A 2PPHA 2E3TA 1AFPA 2DUDA 4JI4L 1V5TA 1JE5A 2JQRB 5HY6A 2NBUA 3RD4A 3EBEA 1VQKA 2DZIA 1CM9A 4A93H 4HJKA 4EX5A 3BZDB 1NSNS 1VQPA 4V190 4RCNA 3UDXA 4N6EB 4DUZQ 1UWXA 1TIID 1A3TA 3GTJH 2F0OA 1FCCC 2JA6G 2HIXA 1DD2A 5C2TB 1DOIA 3I3CA 4MJSB 3CRLC 4FJYA 1EU4A 3DBSA 4I7AA 1XNRQ 4MGIE 1BVSA 4DV6Q 4B95A 1EIFA 3RZFA 1GO3E 1N6ZA 2AQ1B 3TBIB 4A6QA 2SOBA 2HHHQ 1S5DD 1N34Q 5LLIA 4R4CA 3SFEB 1X56A 3J9CA 2MP1A 4PS7A 3QOLA 5IY0A 1TJEA 3D4RA 3V61A 3T53B 1JJ2A 2RD0A 1XMQL 1K73C 2MP2A 2QCZA 2UU7A 4A3FH 2D2CC 4H7BA 3I4OA 2C7NB 2XRSD 4JOIA 1RWSA 2J0KA 2INNE 5LXIB 1GD7A 3NBHB 1V81A 1CQVA 1Z2MA 2BS4B 3DWAA 3JYUA 3I9V1 1LTRD 3F2CA 2E2HB 1YQ4B 3PHWB 3S2DH 5L95C 1FFUA 3GP7A 1Q10A 2K5QA 1KNAA 2CWAA 3HOUB 1T0YA 1K83B 5BYSA 1W2BA 2O2VA 2GLSA 5G2NA 4KI0A 1HNZQ 4YSXB 3TQYA 2HQLA 4XWTA 4FBJB 3S2HH 2LUMA 1KNEA 1PXUA 4RHSA 4U68A 2L4NA 1O7ZA 2M9VA 3C3LA 3JSVB 3WOFA 1I42A 4JI8L 5GADC 1BBWA 3A54A 2MCNB 3H6NA 2WXJA 5GAHC 3P7JA 4OXPA 1L0VB 3G48A 3GTLB 2AWOA 4MM3B 3F2UA 1X3FA 3CU7A 4HROA 2I0QA 1WJNA 3PUVA 5FLMG 1PYBA 2ZJRA 4KVGB 4M01A 1G2TA 2KX0A 4L5TA 3M95A 4HPPA 1B1ZA 3CF5A 2G1EA 2KN4A 1G51A 2JPHA 2B76B 1Z5SB 3N1YC 3DVGY 3Q6SA 4JPBW 4HJGE 3BZKA 4DHZB 2NVXB 2HJ8A 3GS2A 4KJOA 4JLCA 3ZXVA 3HIZA 5FR6A 4NZLB 3SK6A 2K6DB 2RBMA 1N62A 5CV4A 2OOBB 3VXWA 3CRKC 3IFWB 1K52A 4LJZC 1KABA 3AEVA 1RCVD 3PZ8A 3M63B 2CW0C 4DV7L 1HEZE 1K3BC 1EU3A 1QOHA 2F0KA 5A2QL 2VUMB 3HOUG 4ITKA 3G71A 5JEAJ 2A4ZA 4LF4Q 3MXNA 3ZO5B 2MX2A 5JOBA 2IX1A 1PH8A 3S14H 2JSOA 1VZ6A 2KOXA 1EZ6A 3A7LA 1L1OB 3W9CB 1NUCA 3P4SB 1VQ7A 4C56C 4B3TQ 1YJJA 2XK5A 4OX9L 1R9TB 2WINB 1UE5A 3I4MB 1LT3D 1D7QA 4CHTB 1JALA 1WR6E 2KDMA 4BBSB 2N7EA 5FOBB 3RNBC 3N32A 2UXDL 2ALYB 2BKFA 1EWIA 4DAPA 1BT0A 3ALBA 3DCGA 4IM3A 1VS0A 4KKSA 2LGIA 4UPAA 3AE5B 2VW9A 4GOPC 3MTSA 4DV0L 2AEHA 2KWCA 4DV5Q 2ZTCA 3W1GA 2KD0A 1N33L 5D6JB 3RNAC 3IFDA 2EYPA 1T5XD 1FMAD 2IGHA 4ABNA 2KWUB 2VUMG 2KLGA 4LF9L 3L13A 1QZGA 3A9JA 4LMQD 4ULLA 5D3IB 2KFKB 3IHPC 1FFVA 4NNJB 5JJIA 5EE1A 1F77A 2WDRB 2K25A 2XEWA 2JXTA 4M00A 1XXGA 3DHQA 1CKMA 4OO1H 1HRJA 3NE5B 3RI7C 1KFYB 1NBWA 2KHJA 4CDDC 5F2DA 2M0XA 1GUSA 5IE8A 2PQAA 4B3SQ 1CUKA 1SSOA 1NYQA 1A6XA 3KYHC 2ZNVB 3ZVVA 3I4MG 3KUPA 1AW7A 2MQHA 3B08A 1XJVA 4KY5A 3WAOA 2ZM6L 1EUVB 1WGYA 2KO3A 2GB1A 4C3JB 5CORA 2JA7H 3A5UA 3NVYA 4JI3Q 4A3EH 1VQCA 4HSVA 3EIVA 2B3AA 2FBWB 4RNAA 4GKJQ 4GN4B 3ULPA 3DUZA 3AFQA 3QX1A 1YHBA 1WX7A 1ENAA 4W9JA 2EYMA 3K81C 5IWAL 4OELB 1A2UA 2QDBA 1HUMA 1B7YB 1WTPA 1FPYA 5CGKA 1Q3LA 4X3KA 3CCRA 1GAQB 4R8NA 1YNND 3J80L 3D3RA 3AEAB 1WYDA 1KLUD 5E4XA 3J80c 3DLLA 1Q7YC 2XN9C 2N7JA 2N9PC 3NVZA 3ZYYX 1HH2P 1R4MB 4HVBA 5FO8B 4XC2A 2PZTA 3J81i 3P75A 1WTRA 4DK5A 1PH2A 1PYWD 1WD1A 4IALA 4N9PA 1ROEA 1S4ZA 1PFBA 1TWGH 1A70A 1IYFA 1R4NI 4K7WA 2I5HA 2IBIB 4JIOU 2ID0A 3U30A 1LGRA 1BOSA 4IPCA 4DK3C 2Z0SA 3JAMi 5LMUQ 2HDEA 4C3JG 2A68C 3ND9A 1SE9A 5BMIA 4MNOA 4HCSA 4GOCA 2MRPA 1Q81C 1E1TA 1F1HA 3I3TB 2V4DA 1AP0A 2WXOA 5GAGC 1N60A 1N61A 4XGAB 1DOYA 3PF4A 3WALA 2KN5A 4UDUC 4XZ4A 3VR8B 2BQQA 2IJ0A 3NP8A 4HJ8A 4JI7Q 4HMIA 2ZCBA 3QARA 4ZCKA 1LTAD 5EKLA 2G4DB 2KTRA 1L0XB 2ZEQA 5C4HA 3TS2A 3HKZB 5CR3A 1WE6A 4B0MA 4PZ6A 3NY5A 5LMNL 1BDOA 3S16B 2DZKA 4RH6A 4WIPA 1H8CA 1IUEA 3TZUA 4FA6A 2Z4HA 4K2KA 1JMLA 3DBLI 1DOKA 4DR2L 3DBHI 3KWLA 2V0GA 2D3CA 5M5WH 2BB6A 2L05A 5J18A 5D3DA 1XQQA 5BMGA 3AEGB 3OPOA 5CX3A 4ME3A 5A2QE 4DAMA 2K52A 2NVTB 1L2FA 1NAPA 1HE8A 4XIGS 4A3CH 5CYUA 1IP9A 4MACA 4DK0A 3HOVB 2WP8J 2SNSA 3ERQA 5J3BA 4AH6A 4DAYA 4FF3A 2BF8B 1Q82C 3I8ZA 2O6VA 4WURA 1LXDA 2RHSB 1I6HB 2TSSA 1SXTA 2C60A 2FCSA 4A55A 2EZVA 1SLJA 4DPGA 1EYDA 1BXTA 2IX0A 4UHVA 1M90C 3VUYA 1XF5L 3P63A 4GN5A 1JMCA 4M0WB 3GD7A 4ODGA 2BYVE 2LVOA 4KV2A 1J6QA 4IJHA 3CWIA 3HKZE 1K8RB 4II2B 2N3SA 1T6BX 2V1YA 3Q3NC 2K5NA 2D11A 3B2FA 3LDZE 3NJTA 1WE7A 3CC7A 3L2PA 4JGHB 1NTGA 3HKZG 2K05A 1JB7A 4FHKA 3T3OA 3K8AA 1EL0A 2F0GA 1SMYD 1S40A 3MTNB 4BY1B 3RLNA 1FXTB 2X38A 4WAFA 1PLFA 5ELNA 3SXHA 2RDBC 3DXJC 1B44D 1WJJA 3VYUA 2NVQB 2SDFA 2X6LA 3CSTA 3A55A 1MD2D 1GPXA 1VQEA 4NXMQ 4KSLC 1SJED 1NR2A 4A3GH 1FM0D 3OJ3A 1TBEA 1L5PA 1E0ZA 4B3RQ 3PSEB 2UUCL 4TKOB 2A69C 3Q0AA 3DHIC 2B2TA 3T1HQ 1W6KA 2DN8A 3H7PA 3OTOQ 1TKEA 3MJWA 3G7LA 1B9NA 1E24A 2LSSA 3MFGA 1KRTA 4ARIA 3ER0A 2B8FA 1IBXB 1V97A 1I50B 1AYFA 5TSSA 3LWEA 4OIKA 2N1WA 4JQWC 4QCLA 4IWQA 2M17A 4GOPB 4EQPA 2M1MA 2E2DC 4YL8A 1MHHE 1QLBB 5T8IA 2K8CA 4XT3B 1L4DB 1MI2A 1MKHA 3B2GA 1VQGA 2J7ZA 2HE7A 1OEYJ 3RLOA 3AE7B 1DM0B 3CSFA 3A0JA 2KWDA 1ZKHA 1GB1A 5IGEA 1WMHB 3H0GH 1STEA 3S1NH 2INDC 1KOTA 1NI2A 1PA6A 2LXCA 3EFCA 1VQBA 3ULJA 4F7XA 4BY1G 5G5HA 4GKKQ 2EKEC 5AJ3L 3P42A 4PMWA 2UUBQ 2KCMA 3KF8B 4ACFA 2XRQD 4BOSC 3ZJUA 2F0FA 4DR5Q 3K0XA 3NBHA 4DV2L 1HTLD 2LUEA 4OONA 1KHIA 4P1CC 1T0RC 4LJPB 1I94L 1MHXA 3QJYA 1YX6B 4QL5A 3EFXD 1B3QA 2H4OA 1V6EA 3GB1A 4HJ5A 3HOZH 5E6PA 1X65A 2XIWA 3CKIB 4ZK9B 4JYAQ 1LLRD 3J80E 1QUQB 1IBLQ 1MI0A 4IWOA 2NS5A 2B2VC 3EHVA 1LTGD 1WFQA 4IOCA 4XT1B 1SFOB 3HOWB 1XPUA 2KQ4X 4F1SA 1SYCA 1MSHA 4GLXA 2D10A 4RKLA 2XTIA 1HPCA 2WXPA 1FRDA 1D1KA 5IO9A 3VR9B 5JHAA 1EY9A 2J0TD 5ELOA 2N88A 1OXSC 1LTID 4C3HB 2BGFA 4M02A 2F0EA 4MM3A 4DV3Q 1X3QA 1I3QH 5IYBH 2Z6BA 3ZUNA 5EJWA 1PTOF 2Z6KA 4IFDG 2OEOA 2MQJA 1Q90A 5MPOA 2MBOA 3TS0A 3CP0A 1XCTL 3DDCB 1ZP0B 2NTSA 3S24A 1LACA 3K0YA 1V8QA 1FJGQ 1RDPD 3VDZA 5H92C 2QILA 4JI2L 3QAQA 1SE4A 1F2ZA 4GNXC 2WB1E 1STBA 3ENEA 3U4VA 3J7YW 3N3KB 5L37A 2G4SA 4XQQA 1STYA 1Y8NB 1GUTA 1KH0A 4MDKE 5CBEE 1EEID 1E2VA 1HNWL 1PVOA 1Q8IA 4YHHQ 5C4XB 5DM73 1B50A 4OEMB 1BMLC 1YMHE 3J7AF 4FF2A 4JBJA 3CCEA 3A4SC 3L16A 3U2SC 4I65A 3TP7A 1TVXA 1M94A 3AEDB 3DEPA 2ZT9C 4ME5A 2R93B 3IAYA 1KL9A 2NPTB 3GTPB 3H8HA 3UIPB 3WIMA 4DR1L 3QQ8B 1L1OA 2IZVB 3AQQA 4DR6L 4A3LG 4NJ7A 2Q2HA 1Q0WB 2FIDA 2ZTDA 4FXGC 3KLRA 3KLWA 1QILA 3GZNB 4OWTB 3WCQA 1V86A 2EELA 3OJ4B 4C3HG 1CHPD 3I55A 1RRBA 2RSNA 1WFYA 3PRPB 3M3JA 2IT1A 4MT5A 4A90A 1LTSD 2QDLA 2BYTA 3R93A 3A8IE 2FJ2A 1JB3A 1FXAA 2Z9HA 1C4PA 5EAYA 4MIUA 3N1ZC 1WOCA 2DAFA 5T1GA 1F2RI 2LD9A 1EYGA 2WXFA 2M4NA 3EROA 4IUUA 4AQYL 3J81L 3KYCD 2A69D 3R3MA 5JH5C 2CHBD 5DPTA 4HKZE 1KDBA 1O7IA 1QQRA 2AUJD 1OQQA 2WWZA 3T3NA 3QC8B 1VQIA 1LTBD 2BDOA 5M3FH 1EY7A 1XMOL 3PUXA 2MGSA 3JAML 5C4XG 2Q2IA 2OQ0A 1WF9A 5HFYA 2AWNA 3JAMc 1DYQA 4DBGA 4ANXA 1B3AA 3NSWA 2VZAA 2KFKA 3KK7A 4A3KB 4B3ML 3RMKC 4DHJB 4PYZA 2F0UA 2QSDA 1HZ9A 2IO2B 3ZRCA 1BBXC 2R93G 3L4PA 3GTQH 2UXBL 3DM1A 4PK1A 3T56B 2JE6I 4QUFA 4ZUIA 1JOKA 2MJDA 5JPMC 1ZUD2 4R4QA 3DOWA 1QOAA 2LGYA 3IG3A 4GMVA 1RHPA 5DAUA 2BH8A 4JWSC 4LNOA 1IL2A 4M8MA 1HA5A 1SDFA 4PS8A 3SK5A 4WWPA 1TS5A 2F52A 1STAA 1JOOA 2F0WA 1E7VA 1IKMA 2LFNA 2WDTB 1WH3A 4JVZA 1J9OA 4ZRJA 2PCFB 1VLBA 4PZ7A 2PE6B 4DV4Q 2HCCA 5IGDA 1FD6A 2KANA 2UUAQ 1U4RA 1YHQA 1NYRA 5AEKB 3ZJVA 2K22A 5EGTA 1K50A 2LWPA 2IY1B 2R2QA 1Y14B 2KNBA 3DVNV 2WXRA 4GS3A 2NVXH 2LRWA 2GBRA 3A1QA 2JXXA 3NZUA 2PNRC 3T4AC 4NJ6A 2EYOA 2L3ZA 3CHBD 1HFNA 3A8JE 2K50A 3C1EA 4DDGD 5EE9A 1U5KA 2CQOA 2ZZPB 2JA5H 2CH4A 4A3KG 4IM0A 1TU2B 1UE6A 3CMAA 3ZNGC 3U7ZA 2KENA 1XNQL 1PH7A 1L6VA 3CCQA 1PFSA 2BE5C 5I2YA 2CH4W 3K57A 5JVH3 1Q46A 1GUAB 1OFFA 1WRDB 1Y1WB 3RZDH 2JZZA 4G3XB 1TY0A 4HDOA 5HKHA 2GN5A 2CQAA 3TN2A 3WAMA 3APFA 2K03A 4FYDA 5EKIA 1KDAA 4WORA 4XX5A 1I7HA 2XBBC 4YWMA 2DNEA 2Q8RE 4A76A 2KECA 2WAQE 3TDQA 4EQNA 2UU9L 4O2DA 4R1JA 3UDIA 1EIHA 2VQFL 3KYDD 2BA0A 3U52E 3SEBA 5BMHA 3IBEA 1LYLA 3FKIB 2G9HD 2QCPX 2M19A 2CKZB 2WXGA 2DGYA 1TXYA 5IODA 2N55A 1E90A 2KDBA 3GTGH 3GTOB 4P1BC 4YSYB 4WQMA 1I4HA 4OHJA 1CZPA 3I5JC 4S0RA 1EIGA 3VHTC 2J42A 2WGSA 3S1MB 3K7AB 1K9MC 3S17B 4AS1A 4A3IB 1ZOYB 2K5DA 5T1IA 1QZHA 1ISNA 1PGXA 4CYEA 4KLKA 4JV5L 2JXMB 5D94A 1AE3A 1MG8A 3TBLD 1HQRD 5IGFA 4NXNL 4DR1Q 4A3DH 5JJLA 1BUIC 2RCNA 1F9PA 1WD0A 2KC1A 5DPWA 1BR9A 4L5SA 1UBIA 1H9SB 1VF5C 2JA8B 3P4PB 2K1FA 1Y1WG 3STBC 5LL6S 3MXPA 1ZYRC 2CFMA 1EYAA 4KJNA 3PLVA 1D2BA 4OWXB 3I4NB 1JOQA 2NWGA 3BDLA 5CV5A 4KGTA 3EN2A 4ZDVA 1HZBA 1PTOB 3GTKB 4MHEA 4X3UA 3HOWG 2M0AA 3NENA 4KHPL 3FILB 4HEA1 4P6VF 1B53A 4M8NA 1NE3A 4B0EA 1TIFA 4TSSA 4EGVA 3FKIG 5M5XH 1P16A 2Y0SB 4NW2A 2OWOA 3M3YH 1YJIA 3CF6E 4PT5A 3M85A 4A3JH 2I38A 1PMRA 2QMTA 1EQQA 3HEJA 3K5NA 2SEBD 5M3MB 1QKZA 3N1XC 1SN8A 2YTXA 4L5QA 2MBQA 1TS4A 3S1QB 2FNJB 1WCMB 2G3QB 3NVWA 4A3IG 1YBYA 3J81E 2HIVA 4TRDA 3SVMA 5EDSA 1O7YA 3U58A 3ICEA 4ILWA 2KTFA 5C5MA 2LJIA 1DZ1A 4P71A 2ZNVC 1RFAA 1NMGA 3NTHA 2HTHA 4HCPB 2JA8G 4TQ0A 3PRZA 1UEBA 2FCMA 2G45B 2ZW1A 1NY4A 3RFZB 5C44B 1SR3A 3KF6B 3CCSA 3GO5A 4YTNB 4X57B 5C4JH 3I4NG 5AUKA 3DVNU 4E6IA 2A6HC 5IYDG 4IUTA 2PIAA 2D0PA 3CPWA 1EY5A 2CJOA 1UGMA 1KIXA 3PPAA 4IZ8A 3K9OB 2ZJPA 3M4PA 2YU9B 1CQFA 2DNFA 2NVYB 1A15A 4WFN3 2JK8A 2Y0SE 3IFTA 3TEXA 2ZW0A 1IBXA 4GLAC 4A3PA 2MJ3A 5ELBA 4GOPA 3PUWA 4PV1C 3M7NA 2Y0SG 4FNFA 2BE5D 1SNPA 2FMMA 2V3SA 3H6MA 3APCA 3MZ5A 1DGSA 4HR7B 2MA9B 2NMQA 2JX5A 3KUDB 3N52A 3NBIA 1YIJA 5KYLA 2CVRA 1HQMC 1WJUA 5M3MG 3NZSA 4DDID 2RVLA 1WCMG 1R4MI 2E75C 3VA7A 1WMHA 3FVQA 3R2IA 2HDLA 1YNJC 1C0AA 3UF8A 2N49A 3TMPB 1WJ6A 2K6QA 4LF7L 3Q2AC 4IPGA 4A3MB 1T9HA 2WX1A 5C44G 1SNMA 1UH6A 2K32A 3B0AA 2N78A 1LV9A 4G57A 3FEWX 1SNDA 3U4ZA 4C3IB 1S5CD 2AQ2B 2JZPA 1UWVA 2WU2B 2LXJA 4DK1A 1R4QB 2KT7A 3AM9A 1YJ1A 2A73B 3S15B 3N30A 4MEMA 1FIQA 4K1RB 4PS3A 1YJNA 1J5EQ 2KYWA 5CHFA 4YTPB 3VH4B 2NN6G 1PDXA 3NK9A 5JAVA 4IN3A 4CBVA 4OL7A 1V1PB 4KN4C 1HZ5A 3M4OB 4HCNB 2NR2A 2KOLA 3RNFC 1BCPC 1WXSA 4JX1C 4KMUC 1XTDA 1G6PA 3ZXRA 1BCPF 5LMNW 4F8MA 4NMZA 1NBFC 1ZYRD 3KW5B 4DR4L 2Z8LA 3NG0A 1WTHA 5FO7B 1ZXIA 2MFIA 3AEFB 4A3BH 5GMVA 2IPKD 1XO3A 4KZ0A 4NPNA 2O5JC 2P5ZX 2EIFA 2JVCA 3ZNHB 3RN9C 1MFWA 5EQ0A 2VQEL 3J7A5 4WJQA 4TVAB 1KF6B 1PZJD 1ESFA 2F4VL 5M5YB 3PIPA 4IJLA 1JROA 2KACA 4ZHPA 4WJNA 4A3MG 4LFBL 5AFWA 2ZCCA 5HI1A 1TWFB 3EQLC 2Q5WD 1UZXB 3S1RB 4HJAA 2OT2A 4DV1Q 1II3A 3PGZA 5BR8Q 4C3IG 4BS9A 4GDLB 3UINB 4EQOA 2MW5A 4KHPQ 2KHWB 3CXCA 4Y52H 3HK0A 4LFAL 1AH9A 1TWAH 4KY6A 1RLFA 1CSQA 4ZOHC 2PMZB 3E56A 4JPSA 2RSUA 4LF5Q 1C77A 2B3GA 1EO6A 5JEAG 4W9DA 1ML0D 3ETRA 2X69A 4X3TA 3I63C 5A35A 2DLBA 2LVPA 1FO4A 3V96A 2GVAA 4JI6L 2GBJA 1GKHA 4G4KA 2F0HA 4CKBA 1KC8C 3NZ3A 4NY0A 1EQRA 3HFZB 3L10B 1YJ9A 1UBQA 3SK8A 2W55A 2IX3A 3Q24A 1NEKB 3NXWA 5C4ZA 3FRPB 3PO2H 1EF1A 3PCOB 2LASA 2PMVA 1WI0A 2V4LA 4NAMA 1ESRA 3PHXB 1KAWA 3HOXB 1EM7A 4CKCA 1UWMA 1G8ZD 5E6JA 3TP6A 4QIWB 2V3PA 4Y7NB 3G4SA 1PGAA 2LY7A 2KJ6A 3ZIMA 3IAS1 1JQYD 4W9FA 4AWJA 4HLEA 5J2RA 1BBUA 4DAVA 4UY8C 2CKHB 3M62B 3ZLZA 3L0OA 1Y1VH 3EUB2 2A1AA 4L5RC 3BIID 5JHBA 1G6JA 4RF0A 4FF1A 4DHZE 2B63B 4YT0B 4M8AA 1NVID 3T51B 2NUCA 3KJOA 3DWPA 2M8SA 4K0KL 4PZ8A 4LK0M 2PMZE 1DONA 1BUVT 4OGQC 1S72A 4OVUA 3ZJYC 3HOYH 2MBBB 2RSOA 4JI4Q 2A19A 2MO1A 1ACCA 1TWCH 1GC7A 4BXXH 4DWFA 1YNJD 3W5OA 4BY7G 1OXUA 2BVCA 4DNIA 1CMXB 3D8GA 1SFOH 4XE0A 1I4GA 2XNAC 4EQ5A 1YX5B 3IAM1 4GLVB 3N9YC 1L0YB 1YN3A 1YZ6A 5CV8A 2PZUA 2MJEA 1GUWA 3CC2A 2ZXOA 2BB5A 2AKWB 2W82A 3H1UA 4QIWE 5IP7G 4GDKA 4IPHA 1VRAB 1EY0A 5IP9G 3HOXG 1PH3A 1C4QA 4HIKA 4IW0A 2L12A 4DR7L 2EJGC 2VS1A 1IBML 2FIFA 4HCEA 4B9WA 5EE0A 3TJPA 1A8VA 1M4VA 3NWSA 5IIFA 4I6LB 2D62A 4MZ9A 3TUOA 2HT1A 1K8GA 1KRHA 2JN4A 1S5BD 2F0JA 4EZJA 1DJRD 1GC6A 1VQMA 1SYEA 1CKNB 2B63G 1TY2A 2XVSA 1TKGA 1VQOA 1QNKA 5J1ZA 1YJWA 3V6CB 1XMQQ 1VQ6A 1JR0D 4H02A 1HR0L 1O7LA 5BYRA 3A74A 4FXCA 3BVMA 2CR5A 2B2YC 2DENB 5IT9E 2D9UA 3EFUA 4BBNF 3PTFC 2LGXA 2E2JH 3FDTA 4KGSA 2ONQA 2X6GA 4HN7A 4RAUC 3K59A 1IW7C 3C2PA 3NS8A 3Q22A 3T1YL 2AHOB 2BWES 1ET9A 4CDFC 2R7ZB 4FXKC 5DM63 4ALPA 5J17A 4LWCA 4JI8Q 3IT6B 4HIOA 4ZUJA 5ELDA 4JI0L 4KD3A 3FP9A 2K9XA 2OEDA 3HVZA 3LJ3A 1Q5WB 4DQOC 2N9EB 4P72A 1E0BA 1ZKOA 4EKUA 2XSCA 3E5SA 3DPDA 2ZXPA 1XT9B 3IL8A 4QY7A 2CW0D 4WJPA 2V4IB 4H2AA 2EY6A 1VQ9A 2LRUA 1U4PA 2B39A 1OTCA 3E0JA 1SRUA 1KM7A 3FAHA 5K36G 1SROA 1M8AA 3V05A 1I4XA 1I6VC 3MC8A 2B2VA 5BN4A 1IKLA 2XWBB 2J0JA 3GZNI 4CJ1B 1J7AA 3O65B 4LCDE 2K01A 2H88B 5IN7A 1A62A 1DOLA 1F9SA 1H9SA 1Z6HA 4UP7A 1PHJA 1HTQA 3KOJA 4DV7Q 1N32L 4X64L 2FUG1 1BCPB 3W1SC 5C0XG 2ZVNA 3OYYA 1QVFA 5IAAC 1AEXA 1CHQD 4A93B 5IKCM 1GG3A 4K5XA 3I70A 4DGZA 2R7ZG 5C3EH 1TKWB 5CV9A 2JYTA 2RMMA 3FILA 4IQZA 3GTJB 1STHA 1UEAB 1VZ8A 2R7FA 2L15A 2PYKA 1SE3A 3MWYW 2Z4IA 5E1FA 1H4RA 4KKUA 4OX9Q 5I2XA 4GNXA 3Q8EA 2V9HA 3VR3A 3NHHA 4RMFA 4KIKB 3KQ4A 2MPMA 1QE6A 3RN5A 1T0SC 2LS01 2UXDQ 1RFKA 1WXVA 3FKYA 2KHSA 2L0TA 2I2YA 1ILQA 3IKJA 4JL9A 2RQXA 1JICA 2LMCB 2F3VA 1U0LA 1CJEA 3OSOA 3BG3A 1WGHA 4KDLB 5JJZA 3PREA 3VRBB 1JWMD 2IW3A 2H1EA 4BA1I 4HWIB 4DXGA 4DV0Q 4XYOA 4L23A 2ASQA 5G3LF 1MBYA 5EBDA 1QCBD 4DKAC 2NZOA 1AZQA 1N33Q 2KEEA 3RZOH 2AMCB 1FXIA 2PKOA 1B70B 3NELA 4JBMA 5JZEB 2KCTA 3H7SA 4KDIC 3BDOA 4A3FB 4YCUA 4LF9Q 2E74C 5KIXA 2DZJA 4X62L 3VR2A 2JRIB 2KMMA 5IOIA 3OIQA 2WFWA 4N58A 1RIPA 3U8ZA 4A93G 1VF7A 1X3PA 4Z9CB 1K8AC 4IWPA 2BYFA 1K3RA 1CA6A 3S2DB 1ILPA 2E6XA 1EZ8A 2JWZA 2LHEA 2KC2A 2ZTEA 4C2MH 1NJIC 4JK1C 1WXAA 3LXFA 5JXVA 1ENFA 4LK1C 1TR5A 1HTPA 2UXCL 2L0FA 4FJVB 1A3UA 1RODA 3QR8A 3PO3H 3S2HB 1HXYD 1M1KC 5IYCH 4BFRA 3UDGA 1FNUA 4LFCL 5EKKA 3J7ZC 1UE1A 1OXTA 3GTMH 3CCMA 3BYYB 1WRIA 1FYCA 3AV8A 2ZM6Q 3A9KB 1I4RA 1P9DU 3PVLA 4HPMB 4N9F4 5HHDG 3CQZH 1TS3A 1LQBA 4HSPA 3KDFB 4IUVA 3ZW3A 4MJSA 3W2DA 1TWHH 1QZEA 1Q1EA 3Q8FA 2CHWA 3AFPA 2L1BA 4DNTB 3ZDTA 1S3SG 3K7AH 2LHDA 1ZDXA 2B2UC 5HGQA 3K6OA 5IWAQ 1AN8A 3A8KE 3OWEB 2YVCA 4JCVE 1L6UA 4YWKA 3PGEA 4EFOA 5CHWA 1CKOA 4A3FG 4FO2A 4YXDB 3ZTCA 1QG7A 1JQ4A 1EOVA 2C5CA 4LUVA 4XYCA 3W1YA 1MJCA 4JWUC 3NWTA 1UF0A 1GHKA 1HNXL 2A8VA 1VDZA 2A68D 3E9HA 5AZHA 1C4CA 1E2WA 2KDIA 4K3CA 4ZHOA 4BBRH 2LVQA 4G0NB 3AB9A 3SDLC 2FMCA 4DFAA 2NCNA 2A6EC 2R92H 2WXNA 3C46A 2VRRB 3D0FA 2J4XA 5D65A 3VTVA 3SE0A 3S14B 1IHZA 3AULA 1G291 4X6AH 3BDCA 4DUYL 2GI9A 1N36L 4G50A 1SNQA 3GQBA 4IO9A 5GXGB 1C78A 1HZAA 1TS2A 4X65L 1X54A 1E8YA 1P1AA 4H0LC 2IO3B 4L63B 2KVRA 1H9RA 2OF1A 1U4LA 1XYIA 4QAYA 2K5WA 3A5ZB 3MXUA 3A4RA 2C35B 3DHHC 4NDXA 2E5LL 4GIVA 2LGSA 3AYHB 2KK8A 3JSVA 2WKCA 4MTKA 4R9WA 3U9OA 1YNXA 3VYRA 4MH0E 4RGOS 2HCIA 1AZPA 2F0VA 2JA6H 1IGCA 2N0SB 3DBRB 4CKEA 1V2YA 2IGGA 4DR3L 1EOTA 3FHWA 4TQ1A 1SJHD 4RWSC 1WGKA 3TZDA 4ZKCB 3Q3OC 4G11A 4W9IA 1J8CA 1IBKL 3NRZA 4K81A 1PTOC 3TL5A 2E2IH 4QUCA 1YNTE 1QB5D 3Q3FA 3QWZB 4AJYB 3JVZX 2BS3B 1K53A 3R2TA 3PF5A 5LMNQ 4GDLA 4DHJD 3OG5A 1P98A 2D3GA 2KVMA 3DWQA 4G7OC 1RJTA 2SNMA 4FVMA 3J81j 2FXQA 4DR2Q 2KKCA 3Q8BA 4FF4A 3FPUB 1MJEA 4KKJA 5G3LD 4EVOA 2R3ZA 2L00B 2KEDA 4WAAA 1YITA 3BZCA 3C19A 2I1KA 1U4MA 3F8TA 1A5RA 1DOXA 4LW1A 2Y5PA 2JP1A 2Q8IB 4APVA 2ENBA 2GRIA 2HD5B 2YTVA 1QWYA 2MH7A 3HVDA 2W9NA 3UI3A 2RDGA 5FK9C 2EDGA 2KQSA 2F0MA 4CDEC 4XDCA 3RNEC 1XLPA 4EUTA 1GJXA 1AE2A 1ONLA 1SIJA 2MWSB 4L2YA 4H13C 2ZPYA 1FGUA 2ACZB 1SIFA 2HUGA 2JA7B 4J6HA 5DLQE 1RTNA 1N9WA 4A3EB 2K75A 2GBKA 1YI2A 1IGDA 2VL6A 1CFMA 1VZ7A 3OHXC 4X3SA 1J8IA 2RPVA 1RYJA 2FUHB 5CBAE 2MUYA 1QT9A 1FCLA 4HJ9A 2B2WC 5FLMH 2NN6I 4DN4M 3KUZA 1FR3A 1FRRA 4RA8A 3J81c 2FE8A 2WXKA 1WSPA 3ZKJC 2JRHA 3KBGA 3OMGA 4TMAB 1VQDA 2KA7A 3QG1A 4OIJA 2PVOD 4CGYB 2VB2X 4DA2A 4E71A 3SR1A 4PYUA 2C7MB 1WX9A 5EPKA 2LI5A 1E7PB 2MBEA 1F2YA 4XDXA 4OO1G 1PH5A 1Q86C 4LF6L 4ZRZA 3MXNB 3URYA 4K2LA 1CSPA 2UUCQ 3RYTA 4YY3L 3ULLA 2E2HH 4FXDA 1SE8A 2E8GA 1F2RC 1PZKD 1TWGB 1V1QA 1WTWA 2F03A 1LM0A 4B08A 3HOUH 1K83H 3TSSA 2N9LA 4REZA 3H3VC 2BDNA 3UQAA 1WYWB 2WS3B 4O42A 4JI1L 2A5UA 1ZEQX 3X3MA 1OGWA 4C4VB 2WYQA 4ANWA 3DBHB 2A5HA 1UUPA 1VR9A 4XWWA 2JA7G 1C4AA 1YIWA 1YQBA 2A6ED 4WJWA 4JBKA 2VZKD 4A3EG 2W3RA 4IOIE 1MGSA 1IPGA 3KVFB 1WYGA 2CHZA 2MHVA 3JW0X 1VQJA 1N8RC 4HTHA 4CJ0B 3GTLH 3NHEB 1Y8PB 1OXXK 4HEDA 5BN3A 3E6ZX 4K8IA 4NJCA 1HNXQ 3X3NA 4W9EA 4HIDA 2IHEA 5CMDA 4HMJA 5EE3A 1TQOA 1V9PA 5AJ3Q 3BVZA 1GHJA 1K0SA 2WXHA 4P74A 1R4PB 2C9OA 2R61A 1SYDA 2ICEC 4L6TB 4DV2Q 4POGA 4FDBA 1Z9FA 1I94Q 4DUYQ 2OTJA 2K39A 1B9RA 2D3AA 1VQAA 1D5XC 3WDNA 2C5LC 2RR9A 3A9JB 1JT8A 5CTRC 1JJCB 3AU7A 1H9MA 1X3EA 2BCOA 2WLBA 4EEWA 5M5WB 1T0QC 1MVKA 1PTOD 3KLSX 3AH7A 1YVCA 2WKDA 1Y56A 1TT2A 2BWFA 3ZJTA 2VUMH 3GE8C 2DYMA 1KRSA 3CD6A 3ML9A 2IY0B 2L83A 3E3XA 4RM9A 3D4DA 3UI2A 2PQAB 3F2DA 2QF7A 2PJHA 1EWHA 3OW7A 3VR4A 4AIMA 4RKBA 1XCQL 3CAMA 3PQIA 2MHJA 4OVZA 2K04A 4DUZL 2KBNA 2JY6A 3OIPA 2F0DA 1WIAA 3KWVA 4E3CA 2RKSA 1MG4A 1TYGB 4RG1A 1Q12A 3OOCA 4Y7NH 1UGJA 1RL2A 5EPJA 1E7ZA 1G2SA 4K14A 1R9TH 3I4MH 3QO2A 4BBSH 4ARCA 2K28A 3HP3A 4JI2Q 2Q2TA 1XNRL 1HUNA 5D7GA 4DV6L 4GU2A 2BA1A 4F87A 4CQNA 2VZKB 1PFMA 3R7RA 1IZ6A 1GVPA 3MFYA 2HHHL 1N34L 1HNWQ 2JUOA 3N6RA 1C79A 1FEHA 2B29A 3B6YA 2JWUA 4O1NA 3RR5A 2B8GA 3RZWC 2KXJA 2WX0A 2X8XX 3EGRA 2D3BA 1PUTA 4M1UB 1F9QA 3VYSA 4OZBA 4A3GB 3D6CA 3HHMA 3MVVA 1EYCA 4DR6Q 4C80A 3ZGZA 2D5GA 5LL6X 3LB8C 4ICVA 5FR3A 1PV4A 4MSMB 4A3CG 5ISRA 1C9FA 1HJPA 3BINA 3MEHA 4A3OA 4HPLB 1VCIA 4LDTB 2KDEB 4GSWA 1CI3M 1SYBA 1V9JA 3RMHA 2QDFA 4LNKA 1XD3B 1KLGD 3M9BA 3CCUA 1OQRA 3PUYA 3OWFA 1E5WA 3RNGC 2LEKA 4W9GA 2VXWA 1J7BA 4AQYQ 4FP5D 2CHXA 3MHZA 2EY1A 5L83A 2NB0A 3QJZA 2HDMA 3V2TA 4C3JH 5D2MB 1PRTC 4R4TA 2EYFA 2IY5B 1J19A 2F4IA 2L9HA 1XMOQ 1PRTF 1ZXHA 1GM5A 2PLPA 4M0WA 3H0GB 3S1NB 4ZRIA 3UE1A 2K6AA 1JJGA 3PSIA 2RA4A 3JC66 5FO9B 2Y5BB 1R7SA 2N4FA 3R3OA 3BWUD 1B4OA 1N5WA 2J7QB 4B3MQ 2EYJA 3RT3B 4US8A 3V6EB 1XX8A 2UXBQ 4FADA 4A8XC 2Z59B 3HOZB 4A3GG 1D6EC 1V80A 3T8MA 2AYOB 1I4QA 2KHIA 2QKIC 3ITPA 2NTTA 2LXAA 3LWUA 1DXMA 1PFDA 1WVLA 1TKYA 3RD2A 1VQ8A 4URKA 5KRUA 3Q3MC 4EOYA 1UE7A 2O2LD 3V62A 2JQOA 1HR0W 4LF4L 4DAYB 3A9KA 2EQSA 3K5MA 4IUNA 2RDHA 2G9DA 2K5HA 4AP4C 1YN4A 2KX3A 3KDFA 3PT2B 1I3QB 2MJ8A 3CCJA 3Q14C 1V49A 4ZYSA 2PTLA 4B3TL 2K5VA 4DK6C 1S1QB 3RUIB 2Q2UA 1YN5A 3AXCA 3ZNID 3E0EA 3E9SA 3PZDA 3D6WA 2EYHA 1NDDA 4HRSA 1SNCA 5C0XI 1ZE3D 3RNCC 4EZLA 4XXEA 3H0GG 3PIP3 2XWJB 3ND8A 4ZYNA 1E3PA 2IHFA 2MNAA 4J15A 4LNNA 2PQEA 3AE6B 2KJXA 3L7ZC 2KCNA 5K5PA 1WGDA 1TTNA 4MGYE 3TP5A 3VH3B 1XNQQ 3Q3JA 2EY2A 3GV3A 4LJOB 2IO1B 4LLGM 4A9AA 3QOJA 3QWNA 3HOZG 3U50C 1JE4A 3DMUA 3TREA 5IT9L 5G5GA 1QNUA 3KF8A 4DV5L 3FPPA 3SU8X 4E74A 4OWWB 5KHQA 4JG2A 5KHOA 5IT9c 3NVVA 2BH2A 4KV6A 5LXHA 3S16H 4W9KA 2GMIC 1P7FA 1CTMA 1H9KA 2EXDA 1X9NA 3NUCA 3H7PB 1QUQA 2UU9Q 4KHVA 3H9DA 2VQFQ 3HRDD 1X32A 2NVTH 3VQIA 1LUZA 2ES2A 2D07B 1HHVA 5BN5A 1O80A 1U9RA 3Q8DA 5IYBG 2LXKA 4P16A 3HOVH 4B3SL 4QQBX 3M4QA 4WWMA 3WWVA 2B2YA 5KEEA 1V1OA 4Q5VA 1I6HH 2AL6A 4P2CB 3STBD 1QJOA 3VR5A 5FLXL 2PEAA 5I9OA 3AE4B 5C5LA 4QB4A 5FLXc 2BKRB 3QA8A 3CC4A 2PO4A 3SGIA 4RMAA 1UD7A 1XLNA 3PMFA 4JV5Q 4JI3L 5M3FB 2NBWB 5E4WC 4NXNQ 1SMXA 1I4PA 1F9JA 2CU1A 4KN7C 4GKJL 5DPSA 4ANUA 3CIRB 1S3OA 2HD3A 3MHBA 3SDZA 3P4RB 3AE9B 2QEXA 4ANVA 2QEJC 1A3VA 3AE2B 4KSKC 5LHY1 1F2MA 3AI5A 1VMPA 4KGRA 2GOWA 2ZJDA 1FD7D 4WJOA 1PRTD 4X66L 3GTQB 1J0GA 4BY1H 1E1OA 3DWMA 1ZDVA 1P3QU 4LUOA 4HDQA 4NB3A 2L32A 1RM6C 4PNYA 3AMUA 5DCNA 1BNZA 2NVQH 3TEYA 2JT4B 4GB9A 3MEFA 5M9OA 4ZRQA 1VDVA 3IVFA 3D32A 2YLMA 3L08A 3A33B 1VQ4A 2NPTA 2KQ3A 3K80C 4P7IA 3M7GA 2DBYA 2VNUD 1VQ5A 3OMCA 2D2QA 4WJ3M 4RGNA 4BY7B 5I6WA 2Y3AA 5G55A 2L5TA 2UWQA 2WXQA 2CS4A 1D8LA 1YNNC 3KUCB 1I50H 3QIAA 2IYDB 4OZAA 2EPBA 4IOAA 1F0ZA 4PMBA 4HAEA 5LMUL 1E2ZA 3W1SA 3HUIA 3IRBA 2WQYB 3L0WB 2KCCA 1NENB 2J53A 2A6HD 4JC0A 2PVGC 5M3FG 3L9AX 4IC7B 3NOBA 3VAWA 2OTLA 3PO0A 4LF8L 1C48A 4LUZA 4IFDH 3BK1A 3K9PB 2ZJQA 2V1CC 5C3JB 3NQTA 2JA5B 2R2OA 3N20C 4JI7L 1XPOA 1CZWA 1FL0A 1Q8KA 3ERSX 4K5VA 1SGHA 3ONSA 4P75A 3RZDB 4A20A 2Z0DB 1D5ZC 5J22A 1VQFA 4ZKBB 1STGA 1KJTA 3W5UB 2ZXRA 4HIMA 3C0RB 4W9CA 4MN3A 4I7ZC 4C4VA 3J7AV 5C1ZA 2GBNA 1PRTB 1W3SA 3TEWA 2MEKA 1WZ3A 2QW7A 4K6DA 5KYIA 2L0CA 4A3LH 4IFDI 1KQSA 4LTUA 1JCKB 2FAZA 3HM3A 1QF6A 5E7NA 3LX0A 2VH2A 1QVGA 2W3SA 4C3HH 1D5MC 3GTGB 3I56A 3RPFC 3TRZA 3TMEA 1LM8B 1OTRB 1B9MA 2DAJA 1K28A 5CC4A 1NR4A 2KDFB 2E76C 2OJRA 3VVWB 5HURA 3VDYA 3DQVA 4LF7Q 1F9RA 2K1BA 2JA5G 1VJKA 4GN3B 2CJNA 4A3DB 2LZ6A 1LT4D 1BCPD 1SE2A 3H94A 2L1AA 3P2BA 5IGGA 3G6JB 2N8NA 2K33A 2I46A 3UIOB 3W5VB 5FJ8H 2K8HA 5IA7A 5BO4B 5C4XH 2F0PA 2M56B 2NYZD 3EA6A 2F0IA 2BBCA 2BS2B 2QHOA 3DBRI 4XYQA 4NQKE 4BBNC 3A7AB 4NQLB 4BWGB 1SNOA 2AQ3B 4BZAA 4MGKE 2J52A 2WHIA 3L17A 4I6PA 3M4YA 2EVBA 2R93H 2EMSA 1QOBA 1Y69U 4NXML 3GTPH 2B2UA 2XGTA 1K8OA 1CA5A 4BBSG 4OW0A 4WH4A 4WWOA 4BKSA 1SF0A 3AE1B 2PI2E 4DR4Q 2DNCA 3AMZA 4B3RL 5M5XB 1SMYC 1C3TA 1RKNA 3T1HL 3OTOL 1T5EA 3M3YB 3CPFA 1ZPSA 4JI5L 4JOIC 4A3JB 2RCFA 4S3SA 2KZRA 2K7VA 4BA2I 1C1YB 2BT6A 5LNK1 1EEFD 2WU5B 3O13A 3LYYA 5EPLA 4K6LA 3HM6X 1ZXTA 4DU9A 3S9WA 2VQEQ 5E6OA 2C9WB 2F4VQ 1IXRA 4OO1I 1NCVA 4LFBQ 1W6JA 2AX5A 3A1QB 4X66Q 5FLXE 2K8BA 2KFJA 4EZKA 4A3DG 4RGTA 1L4ZB 2K5PA 2L8JA 2N7DA 1FNWA 3CCLA 4CJ2C 3MHSD 4L1BA 5E3FA 4KD4A 4XQJA 4KK7A 4LAAA 4KZCA 1GB4A 3P1MA 1KD1C 1KXLA 3W3AA 2L11A 4LFAQ 1PH4A 1RAXA 4ID6A 5C4JB 3KH0A 1LTTD 4GKKL 3BK2A 1MSGA 2UUBL 3Q69A 4NAWB 2IWHA 2HJ1A 1P8LA 4DR5L 4A3KH 1WR1A 1S5ED 1JWSD 2BPSA 4IG7B 2M2LA 4R4OA 2H5XA 4IDIA 4JI6Q 3AE8B 3QK0A 3PIO3 4D2KA 4K8JA 5ELEA 4JYAL 5DEHA 2G5DA 2DHZA 3CCVA 1IBLL 3F2BA 2WDQB 5I6YA 4G7HC 4FLHA 2F1MA 5GQOA 1G6ZA 4HK2A 3DVGX 4O0AA 4W9LA 4A3JG 1EFID 1JORA 3VUXA 1KLVA
chains in the Genus database with same CATH topology
1A2TA 1B2TA 3BYTB 3HS0C 3Q8AA 4KHZA 4OZCA 1AWDA 3AEEB 1OO9B 2F0TA 4RCOA 1SSNA 2YYZA 2O4XA 1T3QA 3PZ7A 5C0XJ 3Q23A 1KDCA 5HG2A 3MXGA 5H8YE 2A74C 2EJMA 1IL8A 4ZRPA 2JEBI 2O5IC 1DCZA 1ET6A 2DWQA 3R8BA 2WNMA 1GUNA 1E9MA 4HKQA 4PQXA 3B9JA 3V3XA 4J1MA 5COYA 2Z1CA 4R8IA 2LKVA 2W54A 1LO5D 3NTIA 3MC0B 1Z7TA 2B2WA 1PFNA 1RD9D 2K0PA 3MJ5A 3IXSA 4QMGA 1SBBB 3PUZA 1WTOA 4A3BB 3EVQA 1RTOA 5JPNC 3BS1A 3PV0A 4KX6B 5FKAC 5KNBA 3I91A 1D4BA 3H91A 1IW7D 4QF4A 1V43A 1XTCD 5I4DA 1ICWA 1SYGA 1EY8A 3AEBB 1GOZA 3FMCA 2F0SA 1DOMA 4U673 2HQEA 1UAPA 1TWAB 3SHLA 3H09A 2DY7A 3FC4A 4GZYC 4USAA 5CV6A 5EBCA 2JSVX 2BOSA 2IGDA 2D5DA 3I73A 1PTOH 5KGUA 1C76A 1CK1A 1V1PA 3L3OC 2BW2A 3PO2B 1P7EA 4J3OD 4G7ZC 4V0BA 5BYQA 1HFGA 4YWGG 5JVG3 1JWUD 5KNDA 1XLOA 5ELCA 1IYVA 1Y1VB 2TMPA 2K3UA 2GA4B 1CT1D 5J39A 3NTKA 2KAJA 2JYOA 2WB1B 3GV6A 3K5OA 2JYEA 1BO0A 3HOYB 3T16A 1JWBD 4AYBB 1GUOA 4RFBA 2DYOA 2LFIA 1KTKA 2DY8A 1K51A 3ZQ4A 1TWCB 5NUCA 2Q8TA 4US9A 1LABA 1CZGA 1PZID 2ON8A 1K8MA 3ABVB 4XQNA 1VMCA 1XLQA 4L8JA 1STNA 4DF7A 1WTXA 4YTMB 2NN6H 3Q8CA 3EJIA 3MAQA 2L55A 3I4LA 2WACA 3MP9A 1JWAD 4IUQA 2OXPA 1V8CA 1S5FD 2YEPF 3RUZA 4XDDA 3U4EG 3I72A 4IFDJ 4C7YA 2FINB 2QJLA 5ELFA 1EQVA 1SYFA 2HTME 3T13A 3VA5A 1E6EB 1C8CA 4NP5A 1Y8OB 2I07B 4UAIA 5C3XA 3SR6A 1GUGA 4DNRB 2E2JB 2L52A 1XEEA 1HA6A 1QOFA 2EKIA 3KLSA 1BF4A 1ENCA 1EQTA 2VB3X 4ZAIA 4TQUS 4YSZB 5JEAH 4KKTA 4WRDA 1SEBD 2WDVB 3NPPA 3A56A 4N9TA 1N5XA 3AECB 4C1NI 5AUIA 1JRPA 1SB3C 3K58A 4Q0FA 2WXLA 1DGJA 3RLFA 1Z47A 4C7ZA 2EXZA 3U9SA 2B2TC 2F0NA 4IURA 4YIJA 4RGMA 2H89B 1N63A 2WV6D 2WXMA 2Y5CA 3VYTA 5C3WA 3TEZA 2EYLA 1WWTA 2PW5A 1F2LA 2ICIA 5C3EB 4R3DA 1EY4A 3SFDB 2PW9A 5HGTA 3IT4B 2PW7A 2JEAI 3P1HA 4K5WA 4GDKB 3AE3B 1FGBD 2WAQB 3WOEA 3NQIA 1PGBA 3VR6A 2JU6X 3NS1A 2PPBC 1RF2D 4J8QA 4B9XA 3K5LA 1LT5D 1HZ6A 3LNNA 2RDFA 2V3NA 3AN1A 3P4QB 3RZOB 4EE2A 1O78A 2F0QA 1D1IA 1PDQA 3HG9A 1TZOA 1WXQA 4N59A 4RHRA 2F0LA 4AQ7A 2INPE 1BQQT 3C8YA 3HRZC 3AB5A 4C2MB 2FHTA 5KNCA 2PZWA 1H9JA 2EOTA 2QIEB 3DEOA 3PO3B 1G91A 1QOGA 3GTMB 2AUKA 3D4WA 5C6AA 2EJFC 4H44C 3BVGA 1XWEA 2NBFA 3CQZB 1MPEA 4JE3B 1J7CA 1Q1BA 2FFKB 5D14A 1TWHB 3HZXA 4MH8A 4KY7A 1IYUA 2BTEA 2LMCA 5IOCA 2N9KA 4C1NK 3I90A 4NKLA 4ZQ3A 4GLSC 4RF1A 1EWYC 5IGBA 4Q2JA 2M00A 1UNSA 2R6GA 3P20A 2WIIB 5K36H 3MA2B 4JBWA 5CV7A 2KUMA 4BBRB 3SK4A 3KBXA 2R92B 1EY6A 1EWCA 2EY5A 2YEPB 2EE1A 3VRAB 1WTQA 1WTVA 3HGBA 5C0XH 5DNFA 3TP8A 2CU3A 3NUHB 3QB3A 5IGCA 4ZLTF 2F3WA 1JC7A 1HCZA 3DWGC 2IDYA 5I9PA 2WXIA 3I57A 2JA6B 2SAKA 2NZ1D 4XTCS 1NI3A 3ONAB 4KKIA 2IL8A 4IUPA 4DXFA 1GXDC 2E2IB 2OHFA 1YQ3B 1LT6D 1FNVA 1KAAA 1OXVA 1SAPA 3JAME 1E10A 4KTAA 4F88A 3D31A 4IKGA 4PMCA 3C1FA 1JW9D 2E3TA 1AFPA 2JQRB 3RD4A 1CM9A 3BZDB 1NSNS 4V190 4RCNA 4N6EB 1UWXA 1TIID 1A3TA 2F0OA 1FCCC 1DD2A 5C2TB 1DOIA 3I3CA 3CRLC 1EU4A 2AQ1B 3TBIB 4A6QA 2SOBA 1S5DD 3SFEB 3J9CA 2MP1A 3QOLA 1TJEA 3D4RA 3T53B 2D2CC 4H7BA 2XRSD 1RWSA 2INNE 2BS4B 1CQVA 3DWAA 3I9V1 1LTRD 2E2HB 1YQ4B 1FFUA 3GP7A 1Q10A 2K5QA 1KNAA 5BYSA 3HOUB 1K83B 4KI0A 4YSXB 4XWTA 2LUMA 1KNEA 1PXUA 4RHSA 4U68A 2L4NA 1O7ZA 2M9VA 3C3LA 3WOFA 3A54A 2WXJA 3P7JA 1L0VB 3GTLB 2AWOA 4MM3B 3F2UA 3CU7A 4HROA 3PUVA 1G2TA 1B1ZA 2G1EA 2KN4A 2B76B 3Q6SA 4HJGE 2NVXB 3GS2A 4KJOA 4NZLB 3SK6A 2RBMA 1N62A 5CV4A 3CRKC 1K52A 4LJZC 1KABA 3PZ8A 1RCVD 2CW0C 1HEZE 1EU3A 1QOHA 2F0KA 5A2QL 2VUMB 4ITKA 5JEAJ 3MXNA 5JOBA 2IX1A 1VZ6A 2JSOA 1EZ6A 3A7LA 3W9CB 1NUCA 3P4SB 4C56C 1YJJA 3I4MB 1R9TB 2WINB 1JALA 1LT3D 2KDMA 4CHTB 4BBSB 5FOBB 4DAPA 4KKSA 2LGIA 3AE5B 3MTSA 3IFDA 2EYPA 1T5XD 1FMAD 2IGHA 4ABNA 4LMQD 4ULLA 5D3IB 1FFVA 5EE1A 1F77A 2WDRB 2JXTA 1XXGA 3DHQA 4OO1H 1HRJA 3NE5B 1KFYB 5F2DA 1GUSA 1NYQA 1SSOA 1A6XA 3KUPA 1AW7A 4KY5A 2GB1A 4C3JB 5CORA 3NVYA 4HSVA 4RNAA 2FBWB 3DUZA 1ENAA 2EYMA 1A2UA 2QDBA 1HUMA 1WTPA 5CGKA 1Q3LA 4X3KA 1GAQB 4R8NA 1YNND 3J80L 3D3RA 3AEAB 1KLUD 5E4XA 2N7JA 3NVZA 2XN9C 3ZYYX 5FO8B 2PZTA 1WTRA 3P75A 1PYWD 1WD1A 4IALA 4N9PA 1ROEA 1S4ZA 1PFBA 1A70A 2ID0A 1BOSA 2HDEA 4C3JG 2A68C 3ND9A 5BMIA 4HCSA 2V4DA 1AP0A 2WXOA 1N60A 1N61A 1DOYA 4UDUC 3VR8B 2IJ0A 3NP8A 4HMIA 1LTAD 5EKLA 1L0XB 5C4HA 3HKZB 5CR3A 4B0MA 3S16B 1BDOA 4RH6A 4WIPA 1IUEA 3TZUA 2Z4HA 4K2KA 1JMLA 1DOKA 3KWLA 2V0GA 2BB6A 5D3DA 5BMGA 3AEGB 3OPOA 5A2QE 2NVTB 1NAPA 4XIGS 5CYUA 4MACA 4DK0A 3HOVB 2WP8J 2SNSA 3ERQA 4DAYA 4FF3A 4WURA 3I8ZA 1I6HB 2TSSA 1SXTA 4A55A 2EZVA 1EYDA 1BXTA 2IX0A 1XF5L 3P63A 3GD7A 4ODGA 3CWIA 1T6BX 3B2FA 2K05A 3T3OA 1EL0A 2F0GA 1SMYD 4BY1B 4WAFA 2X38A 1PLFA 3SXHA 3DXJC 1B44D 3VYUA 2NVQB 2SDFA 2X6LA 3A55A 1MD2D 1GPXA 1SJED 1NR2A 1FM0D 1L5PA 1E0ZA 4TKOB 2A69C 3Q0AA 2B2TA 1W6KA 2DN8A 1TKEA 3G7LA 1B9NA 3MFGA 4ARIA 2B8FA 1IBXB 1V97A 1I50B 1AYFA 5TSSA 3LWEA 4OIKA 4QCLA 4EQPA 2E2DC 1MHHE 1QLBB 5T8IA 4XT3B 1L4DB 1MI2A 3B2GA 2J7ZA 3AE7B 1DM0B 2KWDA 1GB1A 5IGEA 1STEA 4F7XA 5G5HA 3ZJUA 3P42A 4PMWA 2XRQD 2F0FA 3NBHA 1HTLD 1MHXA 3QJYA 3EFXD 2H4OA 3GB1A 2XIWA 4ZK9B 3CKIB 1LLRD 3J80E 1MI0A 2B2VC 1LTGD 4XT1B 1SFOB 2KQ4X 1SYCA 1MSHA 4RKLA 1HPCA 2WXPA 1FRDA 1D1KA 3VR9B 1EY9A 2J0TD 2N88A 1OXSC 1LTID 4C3HB 2F0EA 1X3QA 5EJWA 1PTOF 4IFDG 2OEOA 5MPOA 1Q90A 1XCTL 1ZP0B 2NTSA 1LACA 3K0YA 1V8QA 1RDPD 5H92C 2QILA 1SE4A 1F2ZA 1STBA 3J7YW 4XQQA 1STYA 1Y8NB 1GUTA 1KH0A 5CBEE 1EEID 1E2VA 1BMLC 1Q8IA 5C4XB 5DM73 1B50A 1YMHE 3J7AF 4FF2A 3U2SC 4I65A 3TP7A 1TVXA 3AEDB 3DEPA 2ZT9C 4ME5A 2R93B 3IAYA 3H8HA 3GTPB 4FXGC 3KLRA 1QILA 3WCQA 2EELA 4C3HG 1CHPD 4A90A 2RSNA 4MT5A 2IT1A 1LTSD 2BYTA 3R93A 3A8IE 2FJ2A 1JB3A 1FXAA 1C4PA 4MIUA 5T1GA 1F2RI 2WXFA 3EROA 4IUUA 3J81L 2A69D 2CHBD 4HKZE 1KDBA 1QQRA 2AUJD 1OQQA 3T3NA 1LTBD 2BDOA 1EY7A 3PUXA 2MGSA 3JAML 5HFYA 2AWNA 1DYQA 1B3AA 3NSWA 3KK7A 4A3KB 2F0UA 2QSDA 1BBXC 3DM1A 3T56B 2JE6I 4QUFA 4ZUIA 1JOKA 2MJDA 5JPMC 1ZUD2 1QOAA 1RHPA 5DAUA 4JWSC 1HA5A 1SDFA 3SK5A 1TS5A 1STAA 1JOOA 2F0WA 1IKMA 2LFNA 1J9OA 2PCFB 1VLBA 2HCCA 5IGDA 1FD6A 1U4RA 1NYRA 3ZJVA 2K22A 5EGTA 1K50A 2WXRA 2PNRC 3T4AC 2EYOA 3CHBD 1HFNA 3A8JE 3C1EA 5EE9A 1TU2B 3U7ZA 1L6VA 5JVH3 5I2YA 2BE5C 3K57A 2WP9B 1OFFA 1Y1WB 1TY0A 2CQAA 3TN2A 2K03A 4FYDA 5EKIA 1KDAA 4WORA 1I7HA 3HOWB 2DNEA 2Q8RE 2KECA 3TDQA 4EQNA 1EIHA 2BA0A 3U52E 3SEBA 5BMHA 3FKIB 2G9HD 2QCPX 2M19A 2WXGA 5IODA 2N55A 3GTOB 4YSYB 4WQMA 1I4HA 4OHJA 1CZPA 1EIGA 2J42A 3S1MB 3K7AB 3S17B 4AS1A 4A3IB 1ZOYB 2K5DA 5T1IA 1PGXA 2JXMB 1HQRD 5IGFA 1BUIC 1F9PA 1WD0A 1BR9A 1H9SB 1VF5C 2JA8B 3P4PB 5LL6S 3MXPA 1ZYRC 1EYAA 4KJNA 1D2BA 3I4NB 1JOQA 2NWGA 3BDLA 5CV5A 4KGTA 1PTOB 3GTKB 4MHEA 4X3UA 2M0AA 4HEA1 3FILB 4P6VF 1B53A 4B0EA 4TSSA 4EGVA 2Y0SB 4NW2A 4PT5A 1YJIA 3M85A 2I38A 1PMRA 2QMTA 3HEJA 3K5NA 2SEBD 5M3MB 1QKZA 1TS4A 3S1QB 1WCMB 3NVWA 3J81E 4TRDA 3SVMA 1O7YA 4ILWA 5C5MA 2LJIA 1DZ1A 3NTHA 4TQ0A 2ZW1A 3RFZB 5C44B 3GO5A 4YTNB 5AUKA 4E6IA 2A6HC 4IUTA 2PIAA 1EY5A 2CJOA 4IZ8A 2YU9B 1CQFA 2NVYB 1A15A 4WFN3 3IFTA 3TEXA 2ZW0A 1IBXA 2MJ3A 5ELBA 3PUWA 4PV1C 3M7NA 4FNFA 2BE5D 1SNPA 2FMMA 3H6MA 3MZ5A 4HR7B 2NMQA 2JX5A 3L4PA 3N52A 3NBIA 5KYLA 2CVRA 1HQMC 2RVLA 2E75C 3VA7A 3FVQA 3R2IA 2HDLA 1YNJC 4A3MB 1SNMA 2K32A 1LV9A 4G57A 3FEWX 1SNDA 2JZPA 4C3IB 1S5CD 2AQ2B 2WU2B 4DK1A 3AM9A 1R4QB 2A73B 3S15B 1FIQA 4YTPB 2NN6G 1PDXA 3NK9A 5JAVA 4IN3A 4CBVA 4OL7A 1V1PB 4KN4C 1HZ5A 3M4OB 2KOLA 1BCPC 4JX1C 4KMUC 1BCPF 4F8MA 4NMZA 1ZYRD 2Z8LA 5FO7B 1ZXIA 3AEFB 2IPKD 1XO3A 2O5JC 5EQ0A 1KF6B 1PZJD 1ESFA 5M5YB 1JROA 4ZHPA 2KACA 5HI1A 5AFWA 1TWFB 3EQLC 2Q5WD 3S1RB 2OT2A 1II3A 4C3IG 4BS9A 4GDLB 4EQOA 4KY6A 4ZOHC 2PMZB 3E56A 4JPSA 1C77A 5JEAG 1ML0D 3ETRA 2X69A 4X3TA 5A35A 2DLBA 1FO4A 3V96A 4G4KA 2F0HA 4CKBA 3NZ3A 3SK8A 2W55A 2IX3A 3Q24A 1NEKB 3NXWA 5C4ZA 3FRPB 2PMVA 4NAMA 1ESRA 3HOXB 1EM7A 4CKCA 1UWMA 1G8ZD 5E6JA 3TP6A 4QIWB 2V3PA 4Y7NB 1PGAA 2LY7A 3IAS1 1JQYD 4DAVA 3EUB2 3BIID 4RF0A 4FF1A 2B63B 4YT0B 4M8AA 1NVID 3T51B 2NUCA 3DWPA 4LK0M 1DONA 1BUVT 4OGQC 2RSOA 1ACCA 1YNJD 1OXUA 3D8GA 4XE0A 1I4GA 2XNAC 3IAM1 3N9YC 1L0YB 1YN3A 5CV8A 2W82A 2PZUA 2MJEA 1GUWA 2ZXOA 2BB5A 1VRAB 1EY0A 1C4QA 2L12A 2EJGC 5EE0A 4HCEA 4B9WA 1M4VA 3NWSA 5IIFA 2D62A 3TUOA 1KRHA 1S5BD 2F0JA 1DJRD 1SYEA 1TY2A 2XVSA 1TKGA 1QNKA 5J1ZA 1JR0D 1O7LA 5BYRA 4FXCA 3BVMA 2B2YC 5IT9E 2D9UA 3FDTA 4KGSA 2ONQA 2X6GA 4HN7A 4RAUC 3K59A 1IW7C 3C2PA 3Q22A 1ET9A 2R7ZB 4FXKC 5DM63 3IT6B 4ZUJA 5ELDA 2K9XA 4KD3A 2OEDA 3HVZA 4DQOC 1E0BA 1ZKOA 2XSCA 3E5SA 2ZXPA 3IL8A 2CW0D 2V4IB 4H2AA 2EY6A 1U4PA 2B39A 3E0JA 3FAHA 5K36G 1M8AA 3V05A 1I4XA 1I6VC 2B2VA 5BN4A 1IKLA 2XWBB 4CJ1B 1J7AA 2K01A 2H88B 1F9SA 1DOLA 1H9SA 1Z6HA 2FUG1 1BCPB 5C0XG 1AEXA 1CHQD 4A93B 4K5XA 3I70A 4DGZA 1TKWB 5CV9A 2JYTA 2RMMA 3FILA 4IQZA 3GTJB 1STHA 1UEAB 1VZ8A 2PYKA 1SE3A 3MWYW 2Z4IA 5E1FA 3Q8EA 4KKUA 5I2XA 3VR3A 3NHHA 3KQ4A 2MPMA 1QE6A 2LS01 1RFKA 2KHSA 2I2YA 1ILQA 3IKJA 2RQXA 1JICA 2LMCB 2F3VA 1CJEA 3OSOA 3BG3A 5JJZA 3VRBB 1JWMD 2IW3A 2H1EA 4BA1I 4DXGA 4XYOA 4L23A 5G3LF 1MBYA 5EBDA 1QCBD 1AZQA 2PKOA 2KEEA 1FXIA 3BDOA 4A3FB 2E74C 5KIXA 3VR2A 2KMMA 3OIQA 4N58A 1VF7A 1X3PA 4Z9CB 1CA6A 1ILPA 3S2DB 2E6XA 2LHEA 1EZ8A 5JXVA 4JK1C 3LXFA 1ENFA 4LK1C 1TR5A 1HTPA 1A3UA 1RODA 3S2HB 1HXYD 1FNUA 5EKKA 1OXTA 3BYYB 1WRIA 1FYCA 3AV8A 1I4RA 5HHDG 1TS3A 4HSPA 4IUVA 3W2DA 1Q1EA 3Q8FA 2L1BA 4DNTB 2LHDA 1ZDXA 2B2UC 3K6OA 1AN8A 3A8KE 3OWEB 1L6UA 4YXDB 1JQ4A 4FO2A 1QG7A 2C5CA 4JWUC 3NWTA 1GHKA 1VDZA 2A68D 1C4CA 1E2WA 4ZHOA 3AB9A 2FMCA 4DFAA 2A6EC 2WXNA 3C46A 2J4XA 5D65A 3SE0A 3S14B 1IHZA 1G291 3BDCA 2GI9A 1SNQA 3GQBA 5GXGB 1C78A 1TS2A 4H0LC 4L63B 1H9RA 2OF1A 1U4LA 1XYIA 2K5WA 3MXUA 4NDXA 2WKCA 4R9WA 3U9OA 3VYRA 4RGOS 2HCIA 1AZPA 2F0VA 1IGCA 2N0SB 4CKEA 2IGGA 1EOTA 4TQ1A 1SJHD 4RWSC 1WGKA 3TZDA 4ZKCB 3NRZA 1PTOC 4QUCA 1YNTE 1QB5D 2BS3B 1K53A 3R2TA 2KVMA 3DWQA 4G7OC 1RJTA 2SNMA 4FVMA 3Q8BA 4FF4A 3FPUB 4KKJA 5G3LD 4EVOA 2R3ZA 2KEDA 1U4MA 1DOXA 2Y5PA 2Q8IB 2JP1A 2GRIA 2ENBA 1QWYA 2MH7A 3HVDA 3UI3A 2RDGA 5FK9C 2EDGA 2F0MA 4XDCA 1XLPA 1GJXA 1ONLA 1SIJA 4L2YA 4H13C 2ACZB 2HUGA 2JA7B 4J6HA 1RTNA 4A3EB 1IGDA 1CFMA 1VZ7A 3OHXC 4X3SA 1J8IA 2RPVA 1RYJA 5CBAE 2MUYA 1QT9A 1FCLA 2B2WC 2NN6I 4DN4M 1FR3A 1FRRA 4RA8A 2FE8A 2WXKA 1WSPA 3KBGA 3OMGA 4TMAB 2KA7A 3QG1A 4OIJA 2PVOD 4CGYB 2VB2X 4DA2A 3SR1A 5EPKA 1E7PB 1F2YA 4XDXA 4OO1G 4ZRZA 3URYA 4K2LA 4FXDA 1F2RC 1PZKD 1TWGB 1WTWA 2F03A 4B08A 2N9LA 3TSSA 4REZA 3H3VC 2BDNA 2WS3B 4O42A 1ZEQX 3X3MA 2A5HA 1UUPA 1VR9A 4XWWA 1C4AA 2A6ED 4WJWA 2VZKD 2W3RA 4IOIE 1MGSA 1WYGA 2MHVA 4HTHA 4CJ0B 1Y8PB 1OXXK 4HEDA 5BN3A 3E6ZX 4K8IA 4NJCA 3X3NA 5CMDA 4HMJA 5EE3A 1TQOA 3BVZA 1GHJA 2WXHA 1R4PB 2C9OA 2R61A 1SYDA 2ICEC 4L6TB 1B9RA 1D5XC 3WDNA 3AU7A 1H9MA 2WLBA 2BCOA 5M5WB 1MVKA 1PTOD 3KLSX 3AH7A 2WKDA 1Y56A 1TT2A 3ZJTA 2DYMA 2L83A 3D4DA 3UI2A 2QF7A 1EWHA 3OW7A 3VR4A 4RKBA 1XCQL 4OVZA 2K04A 3OIPA 2F0DA 3KWVA 2RKSA 1TYGB 1Q12A 3OOCA 1UGJA 5EPJA 1G2SA 4K14A 3QO2A 4ARCA 2K28A 3HP3A 1HUNA 5D7GA 2BA1A 4F87A 4CQNA 2VZKB 1PFMA 3MFYA 3N6RA 1C79A 1FEHA 2JWUA 4O1NA 2B8GA 3EGRA 1PUTA 4M1UB 1F9QA 3VYSA 4OZBA 4A3GB 3D6CA 4C80A 3MVVA 1EYCA 3ZGZA 2D5GA 5LL6X 3LB8C 5FR3A 5ISRA 1C9FA 3MEHA 1VCIA 1CI3M 1SYBA 3RMHA 1KLGD 1OQRA 3PUYA 3OWFA 2LEKA 2VXWA 1J7BA 4FP5D 3MHZA 2EY1A 2NB0A 2HDMA 3V2TA 1PRTC 2EYFA 2F4IA 2L9HA 1PRTF 1ZXHA 2PLPA 4M0WA 3H0GB 3S1NB 2K6AA 2RA4A 5FO9B 1R7SA 3R3OA 3BWUD 1B4OA 1N5WA 2EYJA 4US8A 1XX8A 4A8XC 3HOZB 1D6EC 1I4QA 2QKIC 3ITPA 2NTTA 3LWUA 1DXMA 1PFDA 1WVLA 1TKYA 5KRUA 2O2LD 3K5MA 4IUNA 2RDHA 2G9DA 1YN4A 1I3QB 2MJ8A 4ZYSA 2PTLA 1YN5A 3E9SA 3D6WA 2EYHA 4HRSA 1SNCA 5C0XI 1ZE3D 4XXEA 3PIP3 2XWJB 3ND8A 2PQEA 3AE6B 2KJXA 3L7ZC 2KCNA 5K5PA 3TP5A 2EY2A 3GV3A 4LLGM 4A9AA 3QOJA 3QWNA 5G5GA 1JE4A 3DMUA 5IT9L 1QNUA 3KF8A 3FPPA 3NVVA 4KV6A 1P7FA 1CTMA 1H9KA 3NUCA 4KHVA 3HRDD 1X32A 3VQIA 1HHVA 5BN5A 1O80A 1U9RA 4P16A 4WWMA 2B2YA 5KEEA 1V1OA 4Q5VA 4P2CB 1QJOA 3VR5A 5FLXL 5I9OA 3AE4B 5C5LA 4QB4A 2PO4A 1XLNA 3PMFA 5M3FB 5E4WC 1I4PA 4KN7C 3CIRB 3MHBA 3SDZA 3P4RB 3AE9B 2QEJC 1A3VA 3AE2B 5LHY1 1F2MA 4KGRA 1VMPA 1FD7D 1PRTD 3GTQB 3DWMA 1ZDVA 2L32A 1RM6C 4PNYA 3AMUA 1BNZA 3TEYA 5M9OA 4ZRQA 1VDVA 2KQ3A 3M7GA 2DBYA 2VNUD 3OMCA 4RGNA 4BY7B 5I6WA 2Y3AA 2L5TA 2WXQA 1YNNC 3QIAA 4OZAA 2EPBA 1F0ZA 4PMBA 4HAEA 1E2ZA 3W1SA 3HUIA 2WQYB 2KCCA 1NENB 2J53A 2A6HD 2PVGC 3L9AX 3PO0A 1C48A 4IFDH 3BK1A 5C3JB 3NQTA 2JA5B 1CZWA 4K5VA 3RZDB 1D5ZC 5J22A 4ZKBB 1STGA 3W5UB 2ZXRA 4MN3A 4I7ZC 3J7AV 1PRTB 3TEWA 2MEKA 4K6DA 5KYIA 2L0CA 4IFDI 4LTUA 1JCKB 1QF6A 3LX0A 2W3SA 1D5MC 3GTGB 3RPFC 3TMEA 1B9MA 5CC4A 1NR4A 2E76C 5HURA 1F9RA 2K1BA 1VJKA 2CJNA 4A3DB 1LT4D 1BCPD 1SE2A 3H94A 2L1AA 5IGGA 3G6JB 2K33A 2I46A 3W5VB 2M56B 2F0PA 2NYZD 3EA6A 2F0IA 2BBCA 2BS2B 4XYQA 3A7AB 4BWGB 1SNOA 2AQ3B 2J52A 3M4YA 2EVBA 1QOBA 1Y69U 4OW0A 2B2UA 1K8OA 1CA5A 4WH4A 1SF0A 3AE1B