2Z8LA

Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
DIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Exotoxin 3
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z8lA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2z8lA01
1RDPD 1D5XC 1TS3A 1JCKB 5ELEA 4UDUC 5ELFA 3SEBA 1EU3A 1CHPD 1PRTD 3BYYB 3O13A 1TS4A 1LTTD 1T5XD 1GOZA 3EFXD 1PTOH 2QEJC 3DWPA 3R8BA 1PRTF 1FGBD 5ELCA 3DWQA 1LT3D 1S5CD 1DYQA 1SXTA 1KLGD 1D5MC 1SBBB 2AQ2B 3MFGA 1QILA 5D3DA 3R2TA 2O2LD 4RFBA 1HXYD 1SJED 1FNUA 1SE4A 4RGOS 3MC0B 1S5FD 1TS2A 1I4HA 4DXFA 4RGTA 5I4DA 1HTLD 1LO5D 1FNVA 1LTSD 2XRSD 1V1PA 3BVGA 1EU4A 1LLRD 1PRTB 1PTOB 3BVMA 2QILA 2SEBD 3V05A 1PTOF 1D6EC 1L0YB 1PZJD 1ET6A 1PTOC 2RDGA 1BCPD 3BZDB 1BXTA 1D5ZC 4BWGB 1I4GA 1PYWD 4L6TB 1UUPA 1EFID 1LTRD 4NZLB 2CHBD 1BCPF 1STEA 1LTGD 4RHRA 1S5BD 1SE2A 2G9HD 3EA6A 1V1PB 4RHSA 5ELDA 1V1OA 1UNSA 5D3IB 1G8ZD 1EWCA 4RCOA 1SJHD 4ZYSA 5FKAC 3OWEB 1FNWA 1M4VA 1PRTC 4RGNA 1B44D 2TSSA 1FD7D 1SE3A 4RH6A 3TSSA 1DJRD 1AW7A 1S5DD 2AQ1B 1LTAD 1S5ED 3W2DA 1JR0D 1KTKA 3KLSX 1JWUD 1I4PA 4DXGA 4TSSA 1EEID 1PTOD 1JWSD 3GP7A 2AQ3B 4C56C 1PZID 4K6LA 2RDHA 1KLUD 1LT6D 5TSSA 1RCVD 2ICIA 1CT1D 1LTID 1YN5A 1LT5D 3URYA 3DWAA 1SEBD 1ESFA 1I4RA 5FK9C 3R2IA 3BVZA 1YN4A 1BCPB 1CHQD 1B1ZA 1ET9A 1CQVA 3CHBD 4L63B 1LT4D 1PZKD 2XNAC 4RGMA 1RD9D 1HQRD 1ENFA 1XTCD 1AN8A 1XXGA 1YN3A 2NTTA 5ELBA 4OHJA 4Z9CB 1CK1A 1F77A 2R61A 1MD2D 4O1NA 1JQYD 1JWMD 1TY0A 2XN9C 1HA5A 2WV6D 1EEFD 2Z8LA 2IJ0A 2J4XA 1TY2A 1BCPC 1L0XB 2IPKD 1RF2D 1I4QA 1LTBD 3BYTB 1I4XA 2NTSA 1TS5A 2XRQD
chains in the Genus database with same CATH superfamily
3FKIB 1NI2A 2FCSA 2L0FA 1E8WA 2J42A 3KF6A 3VRAB 2JWZA 4AYBG 4MGIE 5BMIA 1YJ1A 2HJ1A 3RR5A 1WTRA 3DWPA 2LGYA 4JIOU 4YCUA 4HJGE 5HFYA 2O4XA 3QA8A 2BOSA 1TKEA 4DDGD 1MSHA 5AUIA 2VZKD 3B0AA 4IDIA 3S15H 5D3DA 4IFDH 2O2LD 2FUHB 3A9JB 3CD6A 3AEFB 3ZRFA 1JROA 1CQFA 1YNNC 2OOBB 3P75A 2XWBB 4CKCA 4DXFA 3GQBA 1B7YB 3X0WA 2GB1A 3W5OA 2KQSA 2WXKA 3TS0A 3HS0C 1PA6A 2XRSD 2UXCQ 2EOTA 2M2LA 1XNQL 4M01A 4EZLA 1TKWB 3DEOA 3J81E 4DN4M 1LLRD 3HKZG 2ES2A 1T0SC 1V5TA 4F7ZA 4H02A 3HOZG 1A2TA 1DZ1A 2YEPF 3NWTA 2PZUA 2MRPA 3H1UA 1TWAH 3I90A 5FR3A 3U2SC 1VQHA 4ICVA 4H0LC 3ONAB 3U4VA 1YMHE 2O6VD 1N32Q 4B6WA 1L2NA 3J80c 1HNWQ 4HEDA 1XMQQ 3GV6A 4DV2Q 2NN6I 2MP1A 1QQRA 4R3DA 2CHBD 4TMAB 2K6DB 3OTOL 3PRZA 1RM6C 3NVWA 3AB9A 1YZ6A 3WCQA 2NVTH 2LWPA 4NPNA 2CU1A 5C3EH 2WACA 5JVG3 4U68A 3VA7A 2F3IA 4PZ7A 2EMTA 1VS0A 4LLGM 1I7HA 4RGNA 3VYRA 1AARA 4XE0A 5EPLA 2H1EA 4OEMB 4ARCA 1Q0WB 2LJIA 1X32A 2SNMA 1E0ZA 4IJHA 1EEID 4BBRB 1OTRB 4OO1I 5C3EG 2LY7A 4OVUA 1STNA 5IIFA 5IGBA 3MAQA 2DY7A 3H0GH 4KDIC 1HR0Q 1YJWA 4B0EA 2B3AA 5FLMG 2V1CC 4JI2Q 4MEMA 2IWHA 4LFBL 3PRPB 2KDBA 1K3BC 1YIJA 4L23A 1SYBA 4DR5Q 1CA6A 3KVFB 4HTHA 3RD2A 3CMMB 2F0VA 1IPGA 4JLCA 3I73A 4IFDI 1SB3C 4NQKE 4N58A 3IKJA 4LUZA 5JPMC 3KYDD 3ZO5B 3NZUA 5CGKA 3PIPA 2JP1A 1L1OA 2PZTA 3BDOA 3S1RH 4MGYE 3RT3B 3CMEA 1O78A 4RM9A 4G0NB 4CKEA 2N1VA 3GTPB 3GD7A 2FUG1 3V62A 4QQBX 1J7AA 2L00B 2V9HA 1I5FA 2WAQG 1RWSA 1E24A 4UP9A 4JI0L 4B3SL 3U52E 4BBNC 2VS1A 2RHQB 1D5XC 3FMCA 4ZUJA 3LGJA 1ROEA 1V49A 4N8FA 1EQVA 1MJCA 1N60A 2X38A 4K81A 1GOZA 1J8IA 5JEAJ 3HIZA 3VH4B 1C3TA 4BBSH 2UYZB 5EKLA 4XDXA 2VH2A 3CW2C 5ELCA 5G3LD 2K5VA 1G291 3QJZA 3MFGA 3MTSA 3I7FA 4DV4L 2LASA 4YWGG 1OEYJ 2LVQA 1VQCA 5C4ZA 2BYFA 2PMZB 3FPPA 2JEBI 1LYLA 3GZNI 1EYDA 3H0GB 3D6WA 3P42A 4PS8A 4FULA 2B2UC 2JRHA 1XMOL 1V43A 1WM2A 4X3SA 1UWXA 3HOWB 2AYOB 4IKGA 3FC4A 3CRLC 1DOYA 4EVOA 2KKCA 2BA0A 3NEMA 2CFMA 4OVVA 2D9UA 1RTOA 1QVGA 5E6JA 2L1AA 3RNCC 1WGGA 3CXCA 2KX0A 1YBYA 2JSVX 2PMVA 4UP8A 2Z0DB 1B50A 1HRJA 4DDID 3TEWA 2QCPX 1TWHB 1Y1VG 5C4JB 2AWTA 1BUIC 2NR2A 2RDGA 1Q7YC 1PQSA 3PRMB 1DGJA 2NVTB 3GTJB 4ZRPA 4EFOA 1BXTA 1L0WA 1ZKOA 4A3EG 1EIGA 2IO1B 4CHKA 1O7ZA 1X3FA 4FYDA 1R4NI 4C7YA 4KV2A 1SN8A 1ZOYB 4H2AA 4XWTA 3C46A 1VDVA 2J0KA 3G6EA 2VXWA 4KHVA 1WJJA 3EA6A 1RRBA 1DXMA 1F9QA 1V1PB 2ZT9C 5M3FH 4JI2L 3BG3A 2GMIC 3SU8X 1IXRA 2CW0D 4A3CH 1VMCA 5LXIB 3FEWX 3D32A 1AP0A 3NUCA 1JC7A 4DFAA 2DYOA 2VZAA 1NDDA 3ZNHB 4XC2A 4KIKB 1QCBD 1XMOQ 2ID0A 1D7QA 1I50B 1S5DD 4X3KA 5BYRA 3ZKJC 2KYWA 3FILB 1PFDA 2ZTEA 3MEHA 3SR6A 3PUYA 2DZJA 1I6HH 2EDGA 3EROA 1MKHA 1VQFA 2WHIA 1K52A 1YNJD 2FINB 5TSSA 5IY0A 4DR7L 4A3JB 2SNSA 3JAMi 4LFCL 5LL6S 4HSVA 4YY3L 4OWXB 3DWAA 4PMCA 2BS3B 4HKZE 1PYSB 5HKHA 3B6YA 2ZJRA 1KL9A 2UU9Q 1CQVA 3MJ5A 1WI0A 2XNAC 1NY4A 1XXGA 3HFZB 1EO6A 1OXUA 3S1QH 2KQ7A 2HHHL 3NSWA 2FCNA 3MHBA 3B2GA 4LK1C 4O1NA 3EBEA 4FF4A 4A3DH 4L2YA 1FMAD 3HEJA 5M5XB 2ZCBA 2EYMA 3NE5B 4K5WA 4DBGA 5M3FB 2A5UA 1C4PA 2PI2A 4D2KA 3V6EB 2DYMA 2KT7A 2EJGC 5M3MH 4R4OA 1XPOA 4G57A 3QARA 3MWYW 3P7JA 3TBLD 2HQLA 1Z7TA 3H0GG 4FDBA 1Y1WH 4HCPB 1OTCA 3BZCA 4IUVA 3RZOB 2N9PC 4A93G 3AE8B 1EU3A 2VB2X 5DPRA 1HEZE 4RNAA 2BH2A 4XTCS 3Q23A 3HRDD 1TKGA 4FXKC 5GQOA 3EFXD 2VQEQ 4BY7H 1TBEA 5LNK1 3EUB2 5EGTA 4ILWA 2JA9A 1PDQA 2M00A 3SHLA 1X54A 1SBBB 4TRDA 4GZYC 4WFN3 3UQBA 4A3JG 2W3SA 5IOCA 2GLSA 3ULLA 2NMQA 4X65L 2WDTB 4DR6L 2QHOA 3PLUA 2IT1A 4RAUC 4DV0Q 2R7FA 3L7ZC 3AN1A 5HGQA 3P4PB 3RMKC 5LXHA 4MZ9A 5FO7B 1TWGB 4A90A 5NUCA 2GBRA 3MZ5A 3FP9A 3L0OA 4MGZE 2WXJA 2UWQA 4A3GG 4ZRZA 4DQOC 2Q2TA 1RODA 4A3JH 2JE6I 4C1NK 3BVMA 1A6XA 2KVMA 1XLQA 3TS2A 3GTQH 3VR6A 1VQ5A 3NVZA 2UXDQ 1UH6A 1WYWB 4K2LA 5J1ZA 2ONQA 5AZGA 4POFA 1SAPA 2VZKB 3SK8A 2GBMA 4A93H 1WX8A 4DV5Q 5C3WA 4PYZA 4DR2L 1N62A 3RZDH 1GUWA 1HZ5A 1X3GA 4NXNL 5J3BA 1Y14B 3JSVB 2SDFA 3MXUA 1G6JA 5HI1A 3W5VB 4Q5VA 2REXA 2MBOA 1HPCA 2L0TA 2BYTA 4HIDA 1GNUA 3AEAB 2MO0A 1KXLA 4ZAIA 3ZNID 1T9HA 1ZDVA 1BBXC 4RCOA 1SJHD 1ZXHA 1WZ3A 5FKAC 3D3RA 1XNQQ 4RWSC 3OJ3A 1SE3A 1A3VA 4DR2Q 1A63A 4A3GH 1DJRD 2NBVB 1X3QA 4JI5L 1P8LA 1J8CA 3JAME 4X66L 1KTKA 2FIFA 1L1OC 2OT2A 1XPUA 1HA6A 2WXNA 5C23A 3QQ8B 3GB1A 1WTOA 2ZW1A 3J81i 1WYGA 4HIOA 2F0JA 3U8ZA 2N78A 3T53B 2I2YA 1FM0D 2NS5A 4DGZA 4QAYA 1CFMA 4KHZA 1GM5A 1YN4A 2O5JC 1KDBA 1BCPB 2LKVA 2D3BA 4CO7A 2KHSA 3ZJYC 4Y52H 2FBWB 4RGMA 2F52A 2JXXA 1AN8A 3GO5A 2YV5A 4DAMA 2MJ8A 1VR9A 2D5DA 1F77A 2EELA 4DR6Q 4DUZQ 4BZAA 1I35A 4BY7B 1EIHA 4QL5A 2G4DB 2MA9B 2PE6B 4JWUC 3A8KE 2WFWA 4V0BA 2PIAA 2A69C 2ZPYA 2W55A 4KK7A 2Z8LA 1SGHA 2EYOA 3T4AC 3ML9A 1P98A 4C3HG 5C0XJ 2RCFA 1SR3A 4QUCA 2KWCA 1CZPA 4LF7Q 3GDEA 4NY0A 5JAVA 1B70B 4W9FA 4JPSA 4FXGC 4JL9A 1GUTA 4A3DG 2N9XA 2WXHA 4JBKA 1NSNS 5JJZA 4J6IA 4C3IG 4DV1Q 3P4SB 1TS4A 4JBJA 3KDFA 5FJ8H 2AWOA 4DUYL 1JB3A 5DLQE 4A3DB 3X23A 1UE6A 4XXEA 5IYDH 4A3OA 1PH8A 4G7ZC 1MJEA 1LV9A 1VQPA 1ZPSA 3NZ3A 2IW3A 3NQIA 2GBNA 3FAHA 3ZNZB 4A3KG 3U50C 1PH3A 1SJED 1SSNA 2Z1CA 3DEPA 3J80i 1MI0A 4GLAC 2ENBA 3BDCA 1FR3A 1D1KA 1HTLD 1SNOA 1YHAA 3SK4A 5M5YB 3LXFA 1LTSD 4QCLA 5DPSA 2OEDA 3W1BA 4C3JG 1V80A 2LHEA 3D4WA 3CRKC 4FF1A 2QILA 4RKLA 2YTXA 3T16A 2MJDA 3AE9B 3VH3B 1NBWA 1SNDA 3ERSX 4A3FB 3RLFA 2ZXRA 1C7YA 2LGSA 3HUIA 3S14B 4C7ZA 4OX9Q 5C3JB 1LQBA 2D10A 5FO9B 2W82A 2PCFB 3M63B 4E74A 4ULLA 1I4GA 1EQQA 1PYWD 3EIVA 4JG2A 4CGYB 2C60A 3P63A 3EFUA 2KDFB 4N9F4 1II3A 4ZDVA 4DR3Q 2QSDA 4B08A 4GU2A 5T8IA 5E1FA 1F2RC 1TWCB 3ZDMC 1VF5C 4MM3B 4KKUA 5BR8L 2ACZB 1KRHA 4K6DA 3VUXA 3DLLA 1Y56A 4I6PA 3BU2A 1EWCA 3F8TA 4RA8A 2ON8A 2GBJA 4S0RA 2PQAB 1TZOA 5BMHA 1FNWA 2M4NA 5CBEE 4JI8L 3TSSA 1H9MA 3NG0A 2JA8B 3ULJA 3KK7A 4NB3A 5KNDA 1VQBA 2OQ0A 4DR1L 3Q3NC 1TWFH 1JR0D 1FFUA 4YCVA 2QF7A 5ELNA 1U4PA 1QJOA 3PO0A 2OTLA 1FXTB 1XF5L 1TT2A 2E2DC 4L5TA 2RA4A 5T1GA 5I2XA 5IOIA 3TIXA 5IYCG 1EOTA 4B9XA 3RNBC 1E8YA 1GJXA 3SHQA 3ZW3A 4XQQA 2F0GA 1ICFB 2B63H 2FAZA 5IGCA 3J80L 3CHBD 5M9OA 3ERQA 3MXPA 4DV7L 2FFKB 1J5EQ 3ABVB 3L10B 4YSXB 3KFUA 5E4XA 4BOSC 2MQJA 3S2HH 2K01A 3A33B 5C5MA 1JICA 5IWAL 1F2YA 3H15A 1PH6A 4HCEA 3IAYA 2INPE 4CJ1B 4GDLA 3V6CB 1NE3A 5KNBA 3IBEA 4IUMB 3IL8A 3DVGX 3IHPC 5IO9A 3GTOH 2L11A 1UF0A 1I4XA 4A3MH 4WJ3M 3E56A 2PW7A 1P7EA 3S2DB 4YHHL 3GTLH 3DQVA 1JCKB 4S17A 4WWOA 1KIXA 1YJ9A 1CHPD 4HLEA 3BK2A 3HOVH 4A3PA 4EOYA 3V61A 2JXTA 4R4TA 1K50A 4NJ7A 3AEVA 2I46A 1PRTF 3MFYA 1JALA 3CQZB 3SVMA 2JA7H 1D5MC 2ASBA 1A5RA 5C5LA 4UP7A 2B2TC 1RJTA 5M5WH 3T1HL 1KQSA 3L2PA 1PVOA 1XLOA 3DBRI 3SD5A 3J81j 1LGRA 1Y1VB 3A8IE 1WX9A 1H9RA 3M7GA 4PZ6A 1VLBA 3P2BA 3M7NA 2RPQA 3VYUA 4ZRJA 5H8YE 1Q12A 1ZKHA 1WTWA 3J81L 1E3PA 3SK5A 1E9MA 1AE3A 1H4RA 4OZAA 3TP6A 3QO2A 3M3JA 3VR3A 1TTNA 4XZ4A 4ZRQA 1MBYA 1PRTB 3HOUG 3AE7B 4APVA 4YTPB 2K9XA 2KVZA 4R8IA 5IP7G 4C3IH 3PZ8A 1WYDA 2WKCA 1B9NA 2GVBA 1L4ZB 1WJ4A 1PZJD 1ET6A 4JI5Q 2ZXOA 1UWVA 2L05A 2ZJPA 2Y3AA 1J6QA 1TVXA 1VQ7A 4OZCA 4HIMA 4WAAA 3PMFA 2F0QA 5HG2A 4JYAL 1J7BA 2AL3A 1H9SB 4DR4L 4LDTB 1E1TA 5K36H 1UEAB 4IFDJ 3WOEA 2UUCQ 1N34Q 3IVFA 4ALPA 4DAYA 1C78A 2Z6KC 1JJCB 3E5SA 3PF4A 1WR6E 1WE7A 1Q1BA 3I4MG 3VYTA 1R9TH 2K33A 4K8IA 2F0UA 2LFIA 4LNOA 3A4SC 5IN7A 4N9TA 5C3XA 1KH0A 2AQ1B 4LF7L 1IYJB 3ZJUA 4A6QA 3V3XA 3F2BA 1N36Q 3U58A 3JAML 3A7AB 1WF9A 1O7LA 3LYYA 3QHTA 1S3SG 1U5KA 3HVZA 2EIFA 2OWOA 1FD6A 1CI3M 3FHWA 3S9WA 2NN6G 1CT1D 3HG9A 3HKZB 1IGCA 3UDGA 4IM0A 2E74C 3IFDA 1R4NB 3D8GA 1DOLA 2M8SA 2B2UA 3VTUA 3VR4A 4DK0A 2G3QB 1Y69U 3M4OH 2L76A 2NBUA 4ZHOA 1VQ8A 2LMCA 1P0RA 1YD8U 3Q22A 3F2DA 3IAS1 1CSQA 1XNRQ 1E7VA 2A6ED 2CJNA 1WE6A 2HE7A 3PREA 5E4WC 4YXDB 1A62A 2CCZA 2CWPA 3STBD 2WP9B 3QX1A 1FXAA 2AEHA 2SOBA 4RG1A 4DAPA 2L8JA 2V4IB 3TUOA 1QOHA 3CAMA 2INNE 2H4OA 1PGAA 4W9LA 5EPKA 4ZYNA 5IP9G 3J81c 1DOXA 1GUOA 4II3B 1IL2A 4NJCA 4CDDC 2BA1A 1HUMA 1PFBA 5I9PA 4DUZL 1I6HB 1PXUA 2R92H 1H8CA 4KJOA 1IBLL 3ENEA 3IT6B 3UIPB 1VCBA 4WURA 1X55A 4N8X1 1HNZL 1XNRL 3N9YC 3CF6E 2DZKA 2QDFA 1FGUA 4XQNA 2WB1B 1T0QC 1VF7A 2B29A 2BKFA 1BF4A 1G2SA 1V8CA 2D5GA 4YTNB 4V190 1HR0W 1ISNA 2NUCA 2OHFA 2R3ZA 2UU7A 1PTOH 1WJNA 2Z59B 3AFPA 4HR7B 4GLSC 5H92C 2N7JA 2N9LA 4QUFA 5M3FG 1XPRA 1EYGA 4KGSA 3HP3A 1Q8KA 4OL7A 4DV6Q 5C4XG 1TWAB 4RFBA 4HMIA 3B1LX 3QR8A 3GTJH 3HOYB 5DM63 1I4HA 1SFOB 3ZXVA 2CVRA 2FHTA 4C3HH 1OQRA 3I3TB 4GGQA 2Z0EB 5C4JH 1QE6A 4KSKC 2RR9A 4LK0M 1GB4A 3WOFA 5J39A 4P6VF 1E7PB 3FPUB 4CDEC 5AZFA 2VQFQ 2Y0SG 3VYSA 4YSYB 4AQ7A 2LD9A 3DPDA 5COYA 2K3UA 5CV6A 3WANA 3V05A 3HK0A 2QGQA 2L15A 1RKNA 3HOWH 1TXYA 2WXPA 4HXDA 2WP8J 1EY0A 2WAQE 2V3NA 1C0AA 1VZ6A 4MELA 3Q8AA 1STAA 2HCCA 4YL8A 2D3GA 3T1YL 1PH5A 1EFID 2AKWB 3T51B 3OHXC 1IYUA 2K8BA 3PGEA 2KZRA 1EYAA 2KBNA 3RYTA 1N61A 2W54A 2UXBL 5G5HA 3R3OA 3TMPB 1J0GA 2ZXPA 2JWUA 1BOSA 1MFWA 4MJSB 5I6WA 4LAAA 1WM3A 3C8YA 1SRUA 1S40A 1IW7D 3IAM1 1FCLA 5ELDA 4B3ML 5D3IB 1VQDA 2KN5A 2RDBC 3ETRA 2KJRA 4WIPA 5AUKA 1H9SA 4A3BH 1QOBA 4WWNA 4ZYSA 3T1YQ 2EPBA 1JORA 4C3JH 3LWEA 2RHSB 3L54A 1LTAD 3K0XA 1ASZA 3S1MB 4A3IH 1PGBA 4NXMQ 1K83B 5IGDA 4W9EA 4ZRIA 4X6AH 4HJ5A 2FNJB 3CCUA 5E6PA 3RMHA 4G7HC 4DPGA 2KOLA 1ASYA 3E9SA 1A3UA 2E2JH 2KLGA 1LT5D 4AUQC 3VUWA 3AV8A 4IN3A 1E1OA 4K5XA 2DUDA 4DUYQ 3TP5A 2DZIA 2NB0A 4TQ1A 5JJLA 2W9NA 1F9RA 3J7ZC 4I6LB 1JOQA 1CSPA 2KWUB 4A3CG 1F0ZA 1IBXA 3DM1A 1NMFA 2R61A 1BUVT 1F2LA 3MP9A 4C4VB 2B2WA 3HGBA 3R3MA 4N6EB 2PNHA 3OWFA 2KK8A 2QDBA 5GAGC 3AMZA 1JT8A 3DBLI 4HWIB 2IHEA 2WLBA 4ME3A 2EKIA 4NAWB 4HK2A 1L0XB 2IPKD 1RF2D 5LLIA 2QCZA 4US9A 1NYRA 1MI2A 2NTSA 4J1MA 5HY6A 2HT1A 2CQAA 2PLPA 4CDFC 1NI3A 1TS5A 1XCTL 4C1NI 3EFCA 2HTME 3HOXH 1SNQA 4GNXA 1C8CA 4KI0A 1MHHE 2IO2B 3VVWB 1WOCA 3C1FA 1U0LA 2N88A 1EUJA 1ZYRD 2GOWA 2R2OA 4M00A 4JX1C 2KTRB 2L7RA 1K73C 1PMRA 2BB6A 4YT0B 4F87A 1N32L 2ZNVB 3P4QB 4PNYA 2F03A 2NVQH 4C3JB 4W9IA 2EXZA 3PIO3 4TVAB 4G7OC 2VUMB 3PTFC 1GUNA 5IGEA 3GTKB 5BYQA 1CKNA 2F3VA 4P74A 3RNGC 4JI4L 1TIID 4HJAA 3X3NA 4LFAQ 4ZOHC 1FEHA 5K36G 1IL8A 3I70A 3CCMA 2OXPA 1DONA 3NZSA 3ICEA 4WJOA 4LNIA 4OO1H 4MTNA 3J7YW 2XEWA 1FNVA 2MPMA 3BS1A 4DNTB 3WIMA 1XLNA 4BVUC 3H6MA 1A2UA 4IC7B 2YTYA 4M8NA 2OF1A 5BN3A 1KC8C 4BBSG 4HJ9A 3DBRB 1PFMA 2RPVA 3MJWA 5HHDG 2WXOA 4U673 4GXBA 2K4KA 1QZHA 1C4CA 2NPTA 3AE1B 2MJEA 5G55A 3Q6SA 1HFGA 1UE1A 3PUXA 4GN5A 1PDXA 4KGRA 3IRBA 1WH3A 5AZHA 3TCAA 1TJEA 2RMMA 4C2MB 3CSTA 3DHHC 1GB1A 1HTOA 1ZDXA 1RFKA 2K04A 1Y1WG 4DHJD 2ASQA 5I2YA 1STEA 4IJLA 2EYLA 4UAIA 5CTRC 4E71A 2D3CA 1SYGA 4RMFA 2M1MA 1U4RA 3ECIA 4KZCA 2G9HD 4KKJA 4LF8L 1F2RI 5BN4A 1JRUA 5MPOA 4WJPA 3N1XC 2H5XA 1X56A 3A9KB 2EZVA 4HMJA 5GADC 4NQLB 1ML0D 3ZRCA 2UUBQ 3ZGZA 2MBQA 3EECA 3Q8EA 1QOAA 4W9KA 1MSGA 5E6OA 2SAKA 5C0XI 2OJWA 2D2QA 1R4PB 5CYUA 1DCZA 2K5PA 1S5ED 4A55A 2WXMA 5JJKA 3D4RA 3K8AA 2KC2A 2CQOA 2F0WA 1IBKL 2ZW0A 5I9OA 3APFA 4XX5A 1MG4A 4FBJB 5GAHC 2FCMA 1U4MA 5J22A 1E2ZA 1LT6D 1KF6B 1GUSA 3TN2A 1GXDC 4NPSA 4LF5L 2C7MB 1S72A 1G6PA 1I4RA 3UINB 2AWNA 2Q5WD 1BR9A 1YJNA 1JJGA 1LACA 1PGXA 4P73A 3H8HA 1ET9A 4KD3A 2X8XX 2AUKA 2WS3B 4H44C 4R1JA 3J9CA 1Z47A 2NTTA 2D2CC 1Q86C 4Z9CB 4FHJA 4OVZA 3TP8A 1ENCA 1ENAA 2CWAA 1UZXB 2KCMA 3OW2A 1P16A 4X62L 4M02A 2IJ0A 4LF6L 4NAMA 4DV6L 1FIQA 3PCOB 1Q46A 3AEDB 3DWGC 3I4OA 1KM7A 1WZ0A 4FN2A 4CBVA 3DOWA 2YTVA 3AH7A 3UGBB 4JI7L 3I9V1 1M90C 2K50A 3BWUD 1EY8A 1WSPA 2DYBA 1HZ9A 3NRZA 3OLMD 4MH8A 2I07B 3NENA 4GMVA 1YNND 3HM6X 1JQ4A 1T5XD 2A68D 4K3CA 2K5WA 3I4NG 1YHBA 3CP0A 3HOUH 2Q8IB 2MHJA 4DV4Q 2KCCA 2RF4A 3CC4A 4DV2L 4MT5A 4MN3A 3PIOA 5AJ3Q 2BKRB 2LGIA 2NVQB 1C79A 1F2ZA 2LXCA 3MC9A 3NTIA 5IA7A 3W1YA 3TMEA 3OMCA 1CUKA 4YSZB 2BB5A 3EHVA 4OZBA 4DKAC 4ASWC 3I56A 1SYCA 3M3YH 3T3NA 4A93B 2OCEA 2EE1A 1B2TA 2K28A 2G45B 3MVVA 3CIRB 2DAJA 2N9EB 3GV3A 1B3QA 1B9MA 1VQEA 2CHZA 2EY6A 1YVCA 2K03A 2YU9B 2C9WB 1EWIA 4EUTA 1HTPA 1J9OA 1V1PA 1EYCA 2K6AA 3M9BA 1WMHB 4KY6A 1EIYB 5KNCA 1WX7A 1EY9A 1D8LA 5D65A 5FLXL 1CKMA 1VQAA 1S4ZA 2ZTCA 2RSOA 2QEXA 2DZMA 3P1MA 1IUEA 3NY5A 3WDNA 4WJ4A 4HROA 1FJGQ 1HFNA 3PHWB 5LMUL 5A2QL 2QJLA 3I4MB 5EAYA 3IG3A 1UD7A 2XBBC 3V60A 2YVCA 5J2RA 1UUPA 3S1NH 1W6JA 2V3SA 4QF4A 3NBHA 3KWVA 1AEXA 4AH6A 4K14A 4BS9A 5HURA 1LFDA 1AE2A 4RHRA 1S5BD 5EBDA 4B3TL 4JWSC 2Z9HA 2JK8A 4KHPL 3NBIA 3H3VH 4LF5Q 2RDFA 3VDYA 2E2JB 1Y1VH 4KY5A 1LXDA 3NUHB 2R7DA 3ZYYX 1K8AC 3M3YB 1V8QA 5C0XH 1JMLA 3N1ZC 3OPOA 2F4VQ 2V4LA 3K9OB 2PEAA 1N36L 4P1BC 3I4LA 2E2HH 1KABA 1FFVA 4GB9A 2INDC 3EJIA 1QZEA 4DV3Q 3NQTA 4TSSA 3TZDA 3H7PA 1WXAA 1Z5SB 3PF5A 2KHJA 2LSSA 3EN2A 3RLNA 1XX8A 2BT6A 1ESRA 4F8MA 1VJKA 1ONLA 4DXAB 1K8GA 5M5XH 2KO3A 5DPWA 1GD7A 3GOEA 4IW0A 2JXMB 2Q8RE 4XQJA 4A3FH 2RGFA 2BW2A 2GN5A 3K58A 3G48A 2UXBQ 2WB1G 3CCSA 3F2UA 1WR1A 1WTPA 1TGZB 3AU7A 3KLSA 4HJKA 2VNUD 5JXVA 2XSCA 3F1ZA 2KAJA 4BKSD 4IALA 4AQYL 3GTQB 1JWBD 4GIVA 4OXPA 5FR6A 5LMNQ 1HNZQ 1YNXA 4MSQB 2K14A 1TR5A 2QDLA 3DMUA 4K7WA 1YHQA 1E90A 1B4OA 3P1HA 1BCPC 3S15B 2DNFA 2JQOA 4JVZA 4B9WA 2J0MA 4K3BA 5IKCM 4ARIA 3DBHB 4HDQA 5AFWA 3K7UC 4LF4L 4MHEA 3PUVA 2QKIC 1UE7A 3KJOA 1B53A 3T56B 2MP2A 1NR4A 2A5HA 3JYUA 1SLJA 2DLBA 4ZQ3A 1YJJA 4NKLA 1L1OB 1OGWA 4JV5Q 1UEBA 1GAQB 2CHXA 5KGUA 1SMXA 2KOXA 3R8BA 2R6GA 3MC8A 2JZPA 1Q10A 1L4DB 4CKBA 1QUQA 4IQZA 3HOZH 3PVLA 3D6CA 2BS4B 1VZ7A 4P2CB 1FYCA 2HJ8A 2DJGC 2EVBA 3PV1A 4KKIA 2BYEA 3RN5A 3S17H 2WAQB 4JCVE 2B2VC 1FVIA 4F8CB 5AEKB 3H3VI 1TKYA 3GTGH 2MX2A 4OELB 2PPBC 4WORA 1C9OA 1SYDA 2E2HB 4YWMA 4EQPA 1HZ6A 1XD3B 2KFKA 2OQKA 1Q8IA 3ZDTA 2FCQA 2KEEA 3T3OA 4RF1A 1LM0A 2K5DA 2XIWA 4HAEA 5EKKA 4LW1A 4B3TQ 3S17B 5BR8Q 2C7NB 4L1BA 3ZUNA 2LXAA 2B76B 5KHQA 4G3XB 2RSNA 5CV4A 2JPHA 2R7ZG 1OXSC 1I3QB 2I5MX 4JI3L 5FJ8G 3QJYA 3FKYA 3WALA 1C4AA 2F0OA 1NJIC 2KENA 3W5UB 4LJZC 4LF9Q 1WTHA 2WB1E 4A3BG 2DAFA 2JZZA 2LRUA 4KVGB 3BZDB 1D5ZC 1ZE3D 1OFFA 3DBHI 4UHVA 3UI2A 2BE5D 2HD5B 4WJQA 2D0PA 1WJUA 4WWMA 3PZDA 1ACCA 4AS1A 4AYBB 1WXMA 2VQFL 4BA2I 4QIWE 5D6JB 4JOIC 3RNAC 2KDIA 1ZXIA 1G8ZD 2JA6B 3UI3A 3TZUA 1XWEA 3OWEB 4ZLTF 4JE3B 1QNKA 3PLVA 4GOCA 2KHWB 2KJ6A 1YQ4B 2WNMA 3AE3B 3LWUA 4DR3L 3U7ZA 4IUTA 3OOCA 2E8GA 2G4SA 3ML8A 3VXWA 3W9CB 2VUMH 3NWSA 3RD4A 2KLCA 4DA2A 3ULPA 1WY8A 4GDLB 4DAYB 2WQYB 2BH8A 4IG7B 3WA0A 3BZKA 2EQSA 2MBHA 4AYBE 3RFZB 2IY1B 1LTID 4DHJB 1Q5WB 1EZ8A 4JI8Q 3HOUB 1R4MB 3APCA 1B9RA 1T5EA 2K5NA 3S1RB 3PIP3 3Q14C 2E2IB 5IP4D 2IYDB 4L63B 2IBIB 2C9OA 5JPNC 1HCZA 1HQRD 3MXNA 3LJ3A 1XJVA 2NBFA 3RCZA 1KDCA 4KHPQ 3HOVG 5ELBA 4X65Q 3PUZA 5IODA 2FMMA 1K8RB 4EZJA 1D2BA 2OTJA 4IOAA 1HR0L 5DAUA 3SGIA 1K53A 4R4CA 3ZLZA 4GN3B 3RN9C 5CHVC 1GC7A 1E10A 3N30A 1V97A 3FILA 2OEOA 3MTNB 1STHA 1HE8A 2M0XA 4US8A 3J7A5 2MBEA 4GOPB 2PE9A 1I4QA 2N3SA 4IPDA 3BYTB 4CDCC 4X66Q 2DNCA 2LHDA 1QLBB 2WGSA 3GE3C 1GHKA 2G9DA 2GBKA 1I3QH 4QGUA 3STBC 5ELOA 2EY1A 1HHVA 3SE0A 3H91A 1EF5A 2A19A 1CKNB 3HZXA 4HJ7A 1WXVA 5JZEB 4BKTA 2ZTDA 5C2TB 1X9NA 2IGGA 2B2TA 4IPCA 3I4NH 3CC7A 4GOPA 1TT5B 4YHHQ 3KYCD 3L4PA 4A3IB 4AJYB 1IBXB 1KOTA 3N1YC 4NDXA 4B0MA 1STYA 4C4VA 3FVQA 2D62A 5C3EB 3PSEB 5LL6X 1E8ZA 2E2IH 1ZP0B 1VQOA 1KLGD 4BBSB 2IO0B 3PT2B 4IM2A 4DHZB 3I63C 4P71A 1HUNA 5M3MB 1WGDA 1KD1C 5K5PA 1LUZA 3VRBB 5G3LF 4HEA1 1JMCA 2PJHA 3DBSA 1ZGUB 1QF6A 1B8AA 4H7BA 4FADA 1STGA 1U4AA 2DBYA 3R7RA 5EE3A 1WJ6A 4NAWA 2ZJDA 3UF8A 2N8NA 2D11A 1D1IA 4KMUC 2ATWA 1EU4A 1SYFA 3HOWG 2MLBA 2ZEQA 1VCIA 1VQMA 3GTOB 4A9AA 4PMWA 2LUEA 4K5VA 4LUOA 2EYPA 3KWLA 3Q3OC 3TEXA 2JA6G 4FHKA 4P16A 1PTOF 1D6EC 1V9JA 3AEGB 3SK6A 4EQOA 2ICEC 3LX0A 3GS2A 3VA5A 2Q2HA 1Q81C 2BPSA 2KVRA 1GC6A 2M19A 1GO3E 2F0SA 5A2QE 2H88B 2NVUI 3CCEA 3UE1A 1O80A 4BOZB 1UBQA 5LMUQ 2I5HA 1XQQA 5CV7A 3CMAA 1L6VA 1LABA 2JJQA 3SXHA 2L55A 3K81C 1MGSA 4A3EB 2UUAL 1TWGH 4DV7Q 1ILPA 5IAAC 4WWPA 5D14A 2L1BA 3NK9A 1OXXK 5CV9A 4O42A 1K51A 3NP8A 4WRDA 1SFOH 3KW5B 4IO9A 1KAWA 2CJOA 2F0IA 2NZHA 2Q2UA 4CQNA 2F0TA 4ZKBB 1V2YA 1T6BX 4LF6Q 1WCMB 3CF5A 1YX6B 2MWSB 3ZNGC 3AE6B 3L0WB 3KLSX 2JA8H 1FJGL 2BBCA 2JN4A 1P3QU 3KUCB 2NPTB 3KBGA 4P75A 1VZ8A 2N0SB 1KLUD 1AZQA 5GMVA 1OO9B 3A0JA 1PH7A 2MHVA 4A4IA 2GI9A 3TEYA 2C5CA 2IL8A 4IUPA 2GA4B 5IT9L 5D2MB 3W1SA 5CX3A 4NXNQ 4ZHPA 2RSUA 1NENB 2V1YA 1P7FA 1DOMA 1LT4D 3ALBA 3ZJVA 1S1QB 5IT9E 2KFKB 3NS8A 2K22A 2QC8A 3PZ7A 3A9JA 3TDQA 2A73B 4MDKE 2FXQA 2R93H 1KFYB 2XN9C 2ALYB 3S14H 1NVID 4DU9A 1ZYRC 2L5TA 4EKUA 5KHOA 1YITA 2F0KA 1EUVB 2JX5A 4JI6Q 2K05A 3Q3FA 5JH5C 4FJZA 4TUUA 2CKZB 1EY7A 1SMYC 4A3EH 3CPFA 1T0YA 1D3ZA 3UE0A 2L3ZA 4CJ2C 5M5YH 3Q3MC 2F0FA 2O2VB 1TIFA 4UDUC 3AU4A 4KJNA 4UPAA 2WKDA 3AI5A 1C9FA 3KF8B 1Y8NB 2KC1A 3K80C 3AB5A 1JE4A 2VL6A 4LFBQ 3CKIB 2VUMG 5D94A 5CR3A 3T8MA 1E2WA 2EYJA 1FGBD 1HZBA 1S5CD 1SXTA 2HQEA 3DWQA 1NNXA 2AQ2B 1Z2MA 4GNXB 3OW7A 4ZKCB 2GRIA 1MJDA 2MQHA 5L83A 2JSOA 1R9TB 1BNZA 3BY4B 5LMNL 4RGOS 3N20C 4KD4A 2MCNB 2Q8TA 4RGTA 1FXIA 2BS2B 1XYIA 1YQ3B 4EX5A 3KDFB 4L8JA 1VQ4A 3AXCA 4OWWB 2ZZPB 3Q3JA 3GTKH 1YNTE 3BVGA 2K25A 1CA5A 3AE2B 3AECB 2IY5B 4B9KA 4FP5D 4HPMB 4EEWA 2R7ZH 5G5GA 2QA4A 2SEBD 3LNNA 2PO4A 1N6ZA 3M85A 2PTLA 1EL0A 3C2PA 3L3OC 2DWQA 4JC0A 1ICWA 3ZXRA 2KXJA 4IOCA 3BDLA 2IY0B 4IWOA 1WCMH 3K0YA 3N3KB 1GVPA 1VQ6A 3B2FA 3NJTA 1RLFA 3OIQA 4GOPC 3T13A 2KNBA 1JJ2A 1RTNA 3DBLB 4BBRH 4AQYQ 2A68C 1RFAA 2EMSA 2BE5C 1SE2A 2ZJQA 5IP9H 2I1KA 2WXLA 3KQ4A 1V6EA 3PO2H 4GLVB 4RHSA 2M0AA 2AHOB 3OTOQ 1UNSA 4IFDG 2KMCA 4M1UB 4OONA 4GN4B 2MO1A 1LM8B 4W9JA 1DOKA 3QB3A 5DEHA 1WTXA 2JA7G 2R93G 2JZ3B 1G2TA 3H9DA 3AU5A 2B8FA 1AW7A 1EY6A 1PUTA 3W1GA 1L7YA 2K5HA 2PZWA 4JPBW 1MHXA 5E7NA 4A3LH 1PFNA 4A3MG 1A0IA 3H6NA 5GXGB 3G7LA 2A6HC 4GKJQ 2KDEB 4K6LA 3PO2G 2CHWA 3QAQA 3ZIMA 2KX3A 3Q69A 2A8VA 5C6AA 5JEAG 2HDMA 3JVZX 3S2DH 1UGMA 5C1ZA 2VQEL 3GE8C 3OIPA 4JV5L 4B3SQ 1NBFC 2O6VB 2XK5A 4JK1C 1B3AA 1WCMG 2Y5PA 3WAMA 4HPLB 4I65A 2JA8G 4LTUA 1HZAA 1QWYA 1RD9D 1S3OA 1W2BA 2IZVB 2M56B 1A8VA 3AEEB 2Q2IA 2Y5BB 4ZCKA 4KKTA 3UQAA 4I7ZC 1E7UA 3PO3B 2WXRA 4N59A 4PS3A 5IYDG 4PS7A 1TY0A 1Q90A 2JYEA 1JWAD 2D07B 4NMZA 1OQYA 3E6ZX 5IYCH 1BVSA 3I5JC 4C2MH 1KRSA 3LB8C 3K7AB 2Y0SE 4PV1C 1G51A 2B63G 4A3FG 2EYHA 2D0OA 1CTMA 1LTBD 3DVNU 2BWES 4JI1Q 2WXGA 1QVFA 3I8ZA 2B63B 4BBNF 4JOIA 4RF0A 1QOFA 3SFDB 1A3TA 5FLXc 2JYTA 3Q8DA 3PV0A 4EQ5A 3VR8B 3S2AA 5ELFA 2EXDA 4IOIE 1R4MI 1BKBA 4GN1A 4O2DA 4JI0Q 2KJHB 1E22A 3MA2B 5CORA 4X3UA 3AMUA 3SFEB 2A69D 2K1BA 4J6HA 1VRAB 4HN7A 4CJ0B 3PPAA 3NPPA 1C4QA 3N32A 3S16H 1K8OA 3Q24A 1EWHA 1HXYD 2F1MA 1QZGA 1FNUA 4XYOA 3MC0B 3H3VC 3AQQA 1C77A 4WJWA 1S5FD 1VQGA 3I57A 3R66C 4XYCA 3KH0A 2HD3A 1OXVA 4CYEA 4QY7A 1V81A 4KN7C 1N33Q 1KLVA 2JF5A 5JVH3 2EY5A 2ZVOA 4FJYA 3GTMB 5CC4A 1Y1WB 2HIXA 3HM3A 3IFWB 2F0HA 4LF8Q 1Z9FA 4BXXH 3CCLA 2AMCB 4QIWB 2EJFC 4MTKA 3P20A 2J52A 4WQMA 1UGJA 1PTOB 4IPHA 1H9JA 3DWMA 4IPGA 1PLFA 2BTEA 1SSOA 5DPTA 3QWNA 4IZ8A 2C5LC 3B9JA 1YX5B 3NOBA 4IWQA 3HRZC 2PQAA 4REZA 1GUGA 4OWTB 2ZM6Q 5L37A 3TJPA 2PMZE 3ER0A 5FLMH 1QB5D 4R4IA 3K59A 3S1QB 4MM3A 4BFRA 2DENB 3L08A 1OXTA 2PW9A 3OYYA 2FIDA 3TRZA 1YI2A 4B3MQ 3A7LA 1CJEA 4A3KH 2N9KA 3NVYA 1XO3A 2X6LA 1BT0A 4HCSA 2L0CA 1V1OA 3I3CA 4HCNB 1EIFA 5CHFA 1IBMQ 1XLPA 3U7DA 1JB7A 2JQRB 3R7QA 2RVLA 3N52A 2B8GA 4RH6A 1U9RA 4X57B 2V0GA 3TL5A 4GLXA 3OMGA 3H94A 4BKGA 2K0PA 3ZTDA 2DN8A 3CWIA 1HJPA 2O2VA 1I4PA 3PO3G 1HNWL 1SIFA 5M5WB 4LJPB 4P7IA 5H1SE 4EE2A 1JWSD 5ISRA 1E7ZA 4K0KQ 2I1JA 1MIUA 2KQ3A 3TREA 2AUJD 4AIMA 5BN5A 4ANVA 1FPYA 4A76A 3E9HA 1Q82C 4DF7A 1X3EA 1G6ZA 3SR1A 2UUBL 3URYA 3PO3H 3ONSA 4R9WA 1QT9A 4L5RC 4XT1B 1U4LA 4MGKE 4M8MA 1PZKD 4GNXC 2MNAA 1MG8A 1ENFA 2MGSA 1XTCD 3EQLC 5CBAE 2Z4IA 2UUCL 2K6QA 3NTHA 2I38A 4A3MB 1WGYA 1IYVA 1VD2A 1CMXB 3K6OA 1MD2D 2LVOA 4FJVB 4AWJA 4F1SA 4DAVA 3J7AV 1Q3LA 1H9KA 2EKEC 2HHHQ 2M17A 3HOZB 2N7DA 1TQOA 4ABNA 5EBCA 4GS3A 5EJWA 1TY2A 4H13C 2PNRC 3TEZA 3FKIG 4AP4C 1JE5A 2HCIA 2J7ZA 2B2WC 3EGRA 1W6KA 4FA6A 3QC8B 2QMTA 1TS3A 2LGDA 4LFCQ 3SEBA 4GKKL 4BY1H 1PRTD 4YY3Q 3BYYB 3WAOA 2RCNA 3M4YA 2KDMA 3U4EG 5J18A 3KLRA 1V86A 2QEJC 1GKHA 4KX6B 4IUQA 4C3HB 5IE8A 2NBWB 2BDNA 5IP7H 4JI7Q 2LJ5A 3EVQA 4DK3C 4LFAL 4USAA 1ZUD2 2L52A 3DCGA 4RMAA 4W9GA 2XK5B 1QILA 5KRUA 2K32A 1WWTA 4WAFA 2NN6H 4HIKA 4MH0E 2F0LA 4OIKA 1M1KC 1AZPA 2PKOA 2PPHA 4X62Q 2MFIA 3BIID 1PH4A 1IBML 2F0DA 3A5UA 2V3PA 1LO5D 4BBRG 4WH4A 4B95A 5C44G 3AULA 2X6GA 4KLKA 2R7ZB 4A3IG 1Q1OA 3AE5B 2RBMA 3VFKA 2F0PA 2K8HA 1E0BA 4A20A 3C1EA 3I2ZA 2JA5H 2AL6A 4IWPA 3RZWC 3NHEB 1XCQL 3A54A 5CV5A 4EZKA 1IBKQ 4TQUS 1QNUA 3W3AA 4DHZE 3FRPB 1L0YB 3QG1A 4K0KL 3IFTA 1OEYA 3A1QB 3H7SA 2N4FA 1VQJA 3HOYG 2O6VA 4J15A 4OO1G 5BO4B 4BWGB 2K52A 1N63A 2ZCCA 4II2B 4L6TB 4HJ8A 5AJ3L 1LTRD 5EQ0A 4NZLB 1GJZA 1RYJA 2J0JA 4FO2A 2K75A 1XEEA 1FRRA 3KJPA 5BMGA 2F0NA 5L95C 2K8CA 2KFJA 3DVNV 4LCDE 1VQNA 3DM3A 1E5WA 2MEKA 2NZOA 2WU2B 2WXFA 3NVVA 3G6JB 4NP5A 4DR7Q 1C1YB 1X1MA 3VHTC 4DNRB 3I91A 3S24A 1FCCC 2PYKA 2E3TA 1WGRA 1PRTC 5GROA 1B44D 1WD1A 1PH9A 3BINA 3RPFC 1NTGA 2PI2E 4OIJA 5FLXE 3J7AF 3CSFA 1RAXA 4KN4C 2KUMA 4FNFA 3U9SA 3HOXG 4LJOB 2MUYA 3I4MH 1T3QA 1N5WA 3VR5A 1JWUD 2PW5A 5J17A 1XMQL 2KECA 2UXDL 3GP7A 4C56C 5JHAA 2PVOD 5C44B 1EQTA 4ITKA 3AEBB 2N7EA 4ME5A 1GPXA 1CKOA 2VY3A 2ICIA 3M62B 5BYSA 3MHZA 5C4XB 1N9WA 5M3MG 4HRSA 1ESFA 2CW0C 2YU9H 4UY8C 4M0WA 1TWFB 1CHQD 3ND8A 1V9PA 1NYQA 3U9OA 5C4HA 1B1ZA 1WI5A 4KIKA 4K1RB 3RNEC 4ANXA 1GG3A 1O7IA 1CM9A 1TU2B 1SE9A 5EE1A 4ANUA 3GTMH 3RULA 5E6NA 5EPJA 1UWMA 1GHJA 1I94L 1WRDB 2HTHA 1JWMD 1F9JA 1V1QA 3MXNB 5C0XG 1WFYA 1F9SA 4ODGA 3C3LA 3C19A 2BWFA 4KTAA 2WU5B 1YNJC 1AH9A 2NYZD 4MACA 2LXJA 2KMMA 3VTVA 4TKOB 5C44H 4QMGA 3S16B 2BDOA 1VQ9A 4BKSA 1IKMA 2QIEB 1ZW7A 2E5LL 3BJUA 4JBWA 1WXQA 3D0FA 4W9DA 3ZQ4A 2BYVE 3QK0A 1G91A 3ZJTA 1RDPD 3HVDA 3K57A 1HH2P 2A6EC 4IUNA 2UXCL 2UU9L 4W9HA 3T9LA 4LF4Q 4W9CA 4ICUA 3VR9B 2C35B 2DJFC 2YYZA 3PGZA 2N49A 2WXQA 2HDLA 2WX0A 2G5DA 3NBHB 4DNIA 3IXSA 3SDZA 3KLWA 1I50H 1JW9D 2YEPB 3L13A 1ZEQX 4YCWA 5IYBH 4OX9L 2D3AA 3ND9A 3NXWA 3F2CA 2WDQB 3R2TA 4IM3A 2YLMA 3K7AH 4LNNA 2E76C 5D7GA 1QUQB 4YTMB 3RI7C 5A35A 5EKIA 4I6NB 4X64Q 2RKSA 4IURA 3OG5A 3B08A 3NTKA 3VUYA 3FKIH 1I42A 2KTRA 2HUGA 3HOVB 2VRRB 3O65B 3RNFC 4ACFA 1WIAA 1WGHA 1N33L 2L12A 4JI1L 1TZ1A 2DHZA 3EC8A 4XGAB 2ZNVC 4DWFA 2Z6KA 3Q2AC 1GUAB 4HVBA 1IBLQ 1JOKA 4RCNA 5E3FA 1K0SA 1SF0A 2LFNA 3A8JE 2GVAA 3AFQA 1YJIA 3A74A 2LGXA 2Y5CA 4OGQC 4E3CA 4KKSA 4ZRKA 4PK1A 1SMYD 4A8XC 1SNCA 4ID6A 4DR1Q 2F3WA 2DNEA 1N8RC 2WYQA 3P4RB 3JW0X 3HOXB 3DVGY 3PSIA 4G4KA 1P9DU 2LI5A 3RNUA 2ZM6L 4XDCA 5LHY1 1X6OA 2PVGC 2WDRB 1K0RA 4NW2A 5C4XH 1EF1A 1L0VB 2OJRA 4J8QA 2KWDA 2BGFA 3C0RB 3NS1A 4N9PA 2FJ2A 2J53A 3PQIA 4RKBA 2LUMA 2NVXB 3HHMA 3AYHB 2TSSA 3UDFA 1FD7D 2NVXH 1WGKA 3TBIB 2WDVB 5I6YA 1UELA 4BXXG 3PUWA 1KHIA 2DX5B 4YWKA 3CC2A 2MP2B 2KEDA 1E6EB 1Y8PB 1PTOD 4CHTB 2EYFA 2N1WA 3AM9A 1NAPA 3GZNB 1XTDA 4LF9L 2BF8B 5TR5A 2RDHA 3RN2A 2Y0SB 1RCVD 4JBMA 1K9MC 2IGDA 3WAPA 2CU3A 1YN5A 2WXIA 5LMNW 1ILQA 4LNKA 3CCQA 2LVPA 3X3MA 2A6HD 2KMAA 4G50A 1HZCA 3S1MH 2JA7B 4FLHA 3RZOH 4FF2A 1D4BA 4JYAQ 1PFSA 4Y7NH 1NEKB 3SDLC 4P72A 4LNQA 1YIWA 1HNXQ 1YN3A 2IHFA 3APDA 1TWCH 1EWYC 1WD0A 4OHJA 3QOLA 2R2QA 2L4NA 2MW5A 3A9KA 1JQYD 2A1AA 1WMHA 3GTLB 1HA5A 3L17A 5EDSA 5DNFA 1BQQT 1IP9A 1QVCA 1EEFD 2G1EA 1SNPA 4Y7NB 2LRWA 5IWAQ 3QOJA 1KDAA 1OQQA 2P5ZX 1NMGA 4NJ6A 2KJXA 4L5QA 5IGGA 5GAEC 2MH7A 4E6IA 1YOVB 3V96A 1C48A 4FXDA 1DM0B 1TYGB 2LS01 4K7SA 3K5MA 2B2YC 3E9IA 4K2KA 4C80A 4FF3A 3JAMc 1EFWA 1KNEA 2JA6H 1LTTD 3S2HB 4BY7G 4NXML 2M9VA 4DK1A 1DGSA 3MXGA 2ZPNA 3M4PA 3CCJA 4FXCA 1K28A 3G4SA 2X69A 1L2FA 1WTQA 3S1NB 1FL0A 4WQOB 1QKZA 3KF8A 4KDLB 1M8AA 1EM7A 1FRDA 1HQMC 2E75C 2HIVA 2AX5A 2W3RA 1E8XA 1KRTA 1SYEA 2KD0A 2KTFA 4ZK9B 1IHZA 4EGVA 4OW0A 4J3OD 4FVMA 4PG3A 1SE4A 4F7XA 4BY1B 4PT5A 4NNJB 3ZVVA 2XVSA 3UDIA 4MSMB 2JT4B 1Z6HA 1IGDA 3A55A 3K9PB 4S3SA 5EE9A 3HOYH 4Q0FA 1VQLA 3QWZB 4XWWA 2L32A 1VQIA 5KYIA 3E0EA 1KJTA 2WIIB 2QW7A 1XT9B 1CZWA 4KY7A 1K83H 4XIGS 3W1SC 1BBUA 1PV4A 1W3SA 3K5OA 1T0RC 3UDXA 1VQKA 2JA5G 1WRIA 5FO8B 1BBWA 4MNOA 1MPEA 1VMPA 1EQRA 4ZUIA 2NCNA 4JQWC 4POGA 4MIUA 5IT9c 3GTGB 4Q2JA 1Y8OB 1DOIA 4URKA 4B3RQ 1JOOA 2V4DA 5KEEA 2R92G 1R7SA 5JJIA 3RUIB 1IW7C 4EQNA 1A15A 2H89B 1HNXL 4M0WB 2Z6BA 2R92B 3IT4B 1L5PA 1HTQA 5G2NA 1BO0A 2LMCB 4DR4Q 2IX1A 1UAPA 3ZTCA 4XYQA 1F2MA 4PQXA 2EY2A 1M4VA 3K5LA 1N34L 1AYFA 2K5QA 4O0AA 3WWVA 2E6XA 2KQ4X 3A4RA 3L9AX 2KWVB 1IZ6A 1UE5A 4TKNA 2KHIA 2CH4W 3QIJA 2FMCA 2XGTA 4M8AA 3VQIA 2KANA 2F0EA 2TMPA 2K7VA 3R93A 4DXGA 5JHBA 4JI3Q 2CS4A 2KACA 2ZVNA 3HKSA 3JC66 1F52A 2K39A 2I5LX 3A56A 4DK6C 2LXKA 4YIJA 1PYBA 1WTVA 1JRPA 5HGTA 4A3GB 4IUUA 4A75A 2I0QA 2DGYA 1SNMA 2RQXA 3CU7A 4A3KB 2IO3B 2JRIB 2JY6A 1SEBD 2IX3A 3TP7A 4HDOA 1SROA 5FK9C 1VDZA 2UUAQ 2IX0A 1N5XA 4HSPA 1WVLA 4K8JA 3UIOB 2JA5B 3NHHA 2VH1A 2NVYB 3J80E 4P1CC 3VDZA 3L16A 5FOBB 4JI4Q 1M94A 4BAXA 1PHJA 3RZFA 1UBIA 1CZGA 3D4DA 3TQYA 4JW0A 3T1HQ 3RZDB 2JVCA 1RIPA 3QIAA 4DV3L 2RD0A 1STBA 2VB3X 3CPWA 4LMQD 4GKJL 2WX1A 1F9PA 2WV6D 1EOVA 3KF6B 2B3GA 2J4XA 1I6VC 3HKZE 1Y8RC 1IYFA 2KCTA 5T1IA 4F88A 2PQEA 4GKKQ 4C00A 3KUDB 1WFQA 5IYBG 3KYHC 2XRQD 4PZ8A 4DR5L 2LZ6A 1Q1EA 3DHIC 3DHGC 2FE8A 3A5ZB 4PMBA 3U4ZA 2WINB 5ELEA 3I4NB 1J5EL 2N55A 1AFPA 3DUZA 1P1AA 3O13A 4YWLA 3MHSD 4X3TA 2B39A 4AOFA 2A4ZA 3N6RA 3E0JA 4C3IB 4XT3B 3VTWA 3PO2B 1LT3D 1DYQA 2Z0SA 2BVCA 5DCNA 4B3RL 2KA7A 3KBXA 3KUPA 4LWCA 1BDOA 1IKLA 2JU6X 1E2VA 2WWZA 1X65A 2XTIA 2L83A 3D31A 2NWGA 4I7AA 1TS2A 4LUVA 2B2YA 5I4DA 2MJ3A 3G71A 2C7HA 1L6UA 3OSOA 1A70A 5CMDA 2KN4A 3MEFA 3M4OB 2MSED 4KSLC 4DV1L 2XWJB 4X64L 2E5LQ 3RLOA 2CR5A 3LDZE 3QCAA 3Q6BA 2BCOA 4HPPA 3M95A 2DY8A 3E3XA 1J19A 5CHWA 3CQZH 1EZ6A 2IDYA 3U30A 2INCC 1J7CA 4BY1G 1NR2A 4LNFA 1YEZA 1PTOC 3PHXB 2JYOA 1QG7A 1AWDA 4KZ0A 1BCPD 1KAAA 5DM73 2F4IA 2F4VL 3KOJA 1QOGA 2HDEA 1BCPF 1I94Q 5EE0A 2VW9A 2CH4A 3Q0AA 1PH1A 2LEKA 1LTGD 3H7PB 5F2DA 3ITPA 3GTPH 3AE4B 2JEAI 2NZ1D 1F1HA 4GDKA 2J0TD 1YQBA 3I55A 1SIJA 2J7QB 2K1FA 5KIXA 1K8MA 4KV6A 2O5IC 2KCNA 3BK1A 3NELA 3DDCB 3JSVA 3Q8FA 2JUOA 4XDDA 4JI6L 2MBBB 3W2DA 1LTLA 3RUZA 4GDKB 3DXJC 1FO4A 3K5NA 5JOBA 1MHWC 3FDTA 4QJFA 3VR2A 2AQ3B 1WXSA 1PZID 4AJWA 1MVKA 3OAWA 3A1QA 4R8NA 2F0MA 1SE8A 1RHPA 3V2TA 5CV8A 2EJMA 3CCRA 1NUCA 1O7YA 3OJ4B 2IGHA 4QB4A 4PYUA 4BA1I 3R2IA 3BVZA 2R93B 4JGHB 1X3PA 3PS6A 4MJSA 3TEHB 5IGFA 1BMLC 4DV5L 2BQQA 5KYLA 1V5OA 1K3RA 4K7UA 4DK5A 1H95A 1CK1A 4GSWA 3M4QA 4LDTD 3KUZA 1EY5A 3I72A 4R4QA 4L5SA 4DV0L 4WJNA 4HKQA 1ZXTA 1EY4A 1PH2A 4TQ0A 1SDFA 1RL2A 3DHQA 2L9HA 1R4QB 2A74C 2Z4HA 3CCVA 2NVYH 4G11A 1NCVA 2CKHB 3H09A 1DD2A 3Q8CA 4TV3A 1TWHH 1C76A 3Q8BA 3VAWA 5JEAH 4ANWA 4A3BB 1KNAA 2B2VA 4RM8A 4A3LG 4KGTA
chains in the Genus database with same CATH topology
3FKIB 2J42A 3VRAB 5BMIA 1WTRA 3DWPA 4HJGE 5HFYA 2O4XA 2BOSA 1TKEA 1MSHA 5AUIA 2VZKD 4IDIA 5D3DA 4IFDH 2O2LD 3AEFB 1JROA 1CQFA 1YNNC 3P75A 2XWBB 4CKCA 4DXFA 3GQBA 2GB1A 2WXKA 3HS0C 2XRSD 2EOTA 2M2LA 1TKWB 3DEOA 3J81E 4DN4M 1LLRD 2YEPF 1A2TA 1DZ1A 3NWTA 2PZUA 3I90A 5FR3A 3U2SC 4H0LC 3ONAB 1YMHE 4HEDA 3GV6A 2NN6I 2MP1A 1QQRA 4R3DA 2CHBD 4TMAB 1RM6C 3NVWA 3AB9A 3WCQA 2WACA 5JVG3 4U68A 3VA7A 4LLGM 1I7HA 4RGNA 3VYRA 4XE0A 5EPLA 2H1EA 4ARCA 2LJIA 1X32A 2SNMA 1E0ZA 1EEID 4BBRB 4OO1I 2LY7A 1STNA 5IIFA 5IGBA 3MAQA 2DY7A 4B0EA 2IWHA 4L23A 1SYBA 1CA6A 4HTHA 2F0VA 3I73A 4IFDI 1SB3C 4N58A 3IKJA 5JPMC 5CGKA 2JP1A 2PZTA 3BDOA 1O78A 4CKEA 3GTPB 3GD7A 2FUG1 1J7AA 1RWSA 3U52E 1D5XC 3FMCA 4ZUJA 1ROEA 1EQVA 2X38A 1N60A 1GOZA 1J8IA 5JEAJ 5EKLA 4XDXA 5ELCA 5G3LD 1G291 3MFGA 3MTSA 4YWGG 5C4ZA 2PMZB 3FPPA 2JEBI 1EYDA 3H0GB 3D6WA 3P42A 2B2UC 1V43A 4X3SA 1UWXA 3HOWB 4IKGA 3FC4A 3CRLC 1DOYA 4EVOA 2BA0A 2D9UA 1RTOA 5E6JA 2L1AA 2JSVX 2PMVA 1B50A 1HRJA 3TEWA 2QCPX 1TWHB 5C4JB 1BUIC 2RDGA 4ZRPA 1DGJA 2NVTB 3GTJB 1BXTA 1ZKOA 1EIGA 1O7ZA 4FYDA 4C7YA 1ZOYB 4H2AA 4XWTA 3C46A 1VDVA 2VXWA 3EA6A 4KHVA 1DXMA 1F9QA 1V1PB 2ZT9C 3BG3A 2CW0D 1VMCA 3FEWX 1AP0A 3NUCA 1JC7A 4DFAA 2DYOA 1QCBD 2ID0A 1I50B 1S5DD 4X3KA 5BYRA 3FILB 1PFDA 3MEHA 3SR6A 3PUYA 2EDGA 3EROA 1K52A 1YNJD 2FINB 5TSSA 4A3JB 2SNSA 5LL6S 4HSVA 3DWAA 4PMCA 2BS3B 4HKZE 1CQVA 3MJ5A 2XNAC 1XXGA 1OXUA 3NSWA 3MHBA 3B2GA 4LK1C 4O1NA 4FF4A 4L2YA 1FMAD 3HEJA 5M5XB 2EYMA 3NE5B 4K5WA 5M3FB 1C4PA 4D2KA 2DYMA 2EJGC 4G57A 3MWYW 3P7JA 1Z7TA 4IUVA 3RZOB 3AE8B 1EU3A 2VB2X 1HEZE 4RNAA 4XTCS 3Q23A 3HRDD 1TKGA 4FXKC 3EFXD 5LNK1 3EUB2 5EGTA 4ILWA 1PDQA 2M00A 3SHLA 1SBBB 4TRDA 4GZYC 4WFN3 2W3SA 5IOCA 2NMQA 2IT1A 4RAUC 3L7ZC 3AN1A 3P4PB 5FO7B 1TWGB 4A90A 5NUCA 3MZ5A 2WXJA 4ZRZA 4DQOC 1RODA 2JE6I 4C1NK 3BVMA 1A6XA 2KVMA 1XLQA 3NVZA 3VR6A 4K2LA 5J1ZA 2ONQA 1SAPA 2VZKB 3SK8A 5C3WA 1N62A 1GUWA 1HZ5A 2SDFA 3MXUA 5HI1A 3W5VB 4Q5VA 1HPCA 2BYTA 3AEAB 4ZAIA 1ZDVA 1BBXC 4RCOA 1SJHD 1ZXHA 5FKAC 3D3RA 4RWSC 1SE3A 1A3VA 1DJRD 1X3QA 3JAME 1KTKA 2OT2A 1HA6A 2WXNA 3GB1A 1WTOA 2ZW1A 1WYGA 2F0JA 3T53B 2I2YA 1FM0D 4DGZA 1CFMA 4KHZA 1YN4A 2O5JC 1KDBA 1BCPB 2LKVA 2KHSA 2FBWB 4RGMA 1AN8A 3GO5A 1VR9A 2MJ8A 2D5DA 1F77A 2EELA 4BY7B 1EIHA 4JWUC 3A8KE 4V0BA 2PIAA 2A69C 2W55A 4KK7A 2Z8LA 2EYOA 3T4AC 4C3HG 5C0XJ 4QUCA 1CZPA 5JAVA 4JPSA 4FXGC 1GUTA 2WXHA 1NSNS 5JJZA 4C3IG 3P4SB 1TS4A 2AWOA 1JB3A 4A3DB 4XXEA 4G7ZC 1LV9A 1ZPSA 3NZ3A 2IW3A 3NQIA 3FAHA 1SJED 1SSNA 2Z1CA 3DEPA 1MI0A 2ENBA 3BDCA 1FR3A 1D1KA 1HTLD 1SNOA 3SK4A 5M5YB 3LXFA 1LTSD 4QCLA 2OEDA 4C3JG 2LHEA 3D4WA 3CRKC 4FF1A 2QILA 4RKLA 3T16A 2MJDA 3AE9B 1SNDA 4A3FB 4C7ZA 3RLFA 2ZXRA 3HUIA 3S14B 5C3JB 5FO9B 2W82A 2PCFB 4ULLA 1I4GA 1PYWD 4CGYB 3P63A 1II3A 2QSDA 4B08A 5T8IA 5E1FA 1F2RC 1TWCB 1VF5C 4MM3B 4KKUA 2ACZB 1KRHA 4K6DA 1Y56A 1EWCA 4RA8A 2ON8A 5BMHA 1TZOA 1FNWA 5CBEE 3TSSA 1H9MA 2JA8B 5KNDA 3KK7A 1JR0D 1FFUA 2QF7A 1U4PA 1QJOA 3PO0A 1GB4A 1XF5L 1TT2A 5I2XA 2E2DC 2RA4A 5T1GA 1EOTA 4B9XA 1GJXA 4XQQA 2F0GA 5IGCA 3J80L 3CHBD 5M9OA 3ERQA 3MXPA 2FFKB 3ABVB 4YSXB 5E4XA 2K01A 5C5MA 1JICA 1F2YA 4HCEA 3IAYA 2INPE 4CJ1B 5KNBA 3IL8A 2L11A 1I4XA 3E56A 2PW7A 1P7EA 3S2DB 1JCKB 1CHPD 3BK2A 2JXTA 1K50A 2I46A 1PRTF 3MFYA 1JALA 3CQZB 3SVMA 1D5MC 5C5LA 2B2TC 1RJTA 1XLOA 1Y1VB 3A8IE 1H9RA 3M7GA 1VLBA 3M7NA 3VYUA 5H8YE 1Q12A 1WTWA 3J81L 3SK5A 1E9MA 4OZAA 3TP6A 3QO2A 3VR3A 4ZRQA 1MBYA 1PRTB 4YTPB 3AE7B 2K9XA 4R8IA 3PZ8A 2WKCA 1B9NA 1L4ZB 1PZJD 1ET6A 2ZXOA 2Y3AA 1TVXA 4OZCA 3PMFA 2F0QA 5HG2A 1J7BA 1H9SB 5K36H 1UEAB 4IFDJ 3WOEA 4DAYA 1C78A 3E5SA 1Q1BA 3VYTA 2K33A 4K8IA 2F0UA 2LFIA 4N9TA 5C3XA 1KH0A 2AQ1B 3ZJUA 4A6QA 3V3XA 3JAML 3A7AB 1O7LA 3LYYA 3HVZA 1FD6A 1CI3M 3S9WA 2NN6G 1CT1D 3HG9A 3HKZB 1IGCA 2E74C 3IFDA 3D8GA 1DOLA 2B2UA 3VR4A 4DK0A 1Y69U 4ZHOA 2LMCA 3Q22A 3IAS1 2A6ED 2CJNA 4YXDB 5E4WC 2WP9B 1FXAA 2SOBA 4DAPA 2V4IB 3TUOA 1QOHA 2INNE 2H4OA 1PGAA 5EPKA 1DOXA 1GUOA 4NJCA 2BA1A 1HUMA 1PFBA 5I9PA 1I6HB 1PXUA 4KJOA 3IT6B 4WURA 3N9YC 4XQNA 2WB1B 1VF7A 1BF4A 1G2SA 1V8CA 2D5GA 4YTNB 4V190 2NUCA 2OHFA 2R3ZA 1PTOH 4HR7B 5H92C 2N7JA 2N9LA 4QUFA 4KGSA 3HP3A 4OL7A 1TWAB 4RFBA 4HMIA 3HOYB 5DM63 1I4HA 1SFOB 2CVRA 2FHTA 1OQRA 1QE6A 4LK0M 3WOFA 5J39A 4P6VF 1E7PB 3FPUB 3VYSA 4YSYB 4AQ7A 5COYA 2K3UA 5CV6A 3V05A 1RKNA 2WXPA 2WP8J 1EY0A 2V3NA 1VZ6A 3Q8AA 1STAA 2HCCA 1EFID 3T51B 3OHXC 1IYUA 1EYAA 1N61A 2W54A 5G5HA 3R3OA 2ZXPA 2JWUA 1BOSA 5I6WA 4LAAA 3C8YA 3IAM1 1IW7D 1FCLA 5ELDA 5D3IB 3ETRA 5AUKA 4WIPA 1H9SA 1QOBA 4ZYSA 2EPBA 1JORA 3LWEA 1LTAD 3S1MB 1PGBA 1K83B 5IGDA 3RMHA 4G7HC 2KOLA 3E9SA 1A3UA 1LT5D 3AV8A 4IN3A 4K5XA 3TP5A 2NB0A 4TQ1A 1F9RA 1JOQA 1IBXA 1F0ZA 3DM1A 2R61A 1BUVT 1F2LA 3MP9A 2B2WA 3HGBA 4N6EB 3OWFA 2QDBA 3AMZA 2WLBA 2EKIA 4NAWB 1L0XB 2IPKD 1RF2D 4US9A 1NYRA 1MI2A 2NTSA 4J1MA 2PLPA 2CQAA 1NI3A 1TS5A 1XCTL 4C1NI 2HTME 1SNQA 1C8CA 1MHHE 4KI0A 3C1FA 2N88A 1ZYRD 4JX1C 1PMRA 2BB6A 4YT0B 4F87A 3P4QB 4PNYA 2F03A 4C3JB 2EXZA 3PIO3 4G7OC 2VUMB 1GUNA 5IGEA 3GTKB 5BYQA 2F3VA 1TIID 3X3NA 4ZOHC 1FEHA 5K36G 1IL8A 3I70A 2OXPA 1DONA 4OO1H 3J7YW 1FNVA 2MPMA 3BS1A 4DNTB 1XLNA 3H6MA 1A2UA 2OF1A 5BN3A 1PFMA 2RPVA 5HHDG 2WXOA 4U673 1C4CA 3AE1B 2MJEA 3Q6SA 1HFGA 3PUXA 1PDXA 4KGRA 1TJEA 2RMMA 4C2MB 1GB1A 1ZDXA 1RFKA 2K04A 5I2YA 1STEA 4UAIA 2EYLA 1SYGA 1U4RA 2G9HD 4KKJA 1F2RI 5BN4A 5MPOA 2EZVA 4HMJA 1ML0D 3ZGZA 3Q8EA 1QOAA 1MSGA 2SAKA 5C0XI 4A55A 1R4PB 5CYUA 1DCZA 2K5PA 1S5ED 2WXMA 3D4RA 2F0WA 2ZW0A 5I9OA 1U4MA 5J22A 1E2ZA 1LT6D 1KF6B 1GUSA 3TN2A 1GXDC 1I4RA 2AWNA 2Q5WD 1BR9A 1LACA 1PGXA 3H8HA 1ET9A 4KD3A 2AUKA 2WS3B 4H44C 3J9CA 1Z47A 2NTTA 2D2CC 4Z9CB 4OVZA 3TP8A 1ENCA 1ENAA 2IJ0A 4NAMA 1FIQA 3AEDB 3DWGC 4CBVA 3AH7A 3I9V1 3BWUD 1EY8A 1WSPA 3NRZA 4MH8A 2I07B 1YNND 1JQ4A 1T5XD 2A68D 2K5WA 2Q8IB 2KCCA 4MT5A 4MN3A 2LGIA 2NVQB 1C79A 1F2ZA 3NTIA 3TMEA 3OMCA 4YSZB 2BB5A 4OZBA 1SYCA 3T3NA 4A93B 2EE1A 1B2TA 2K28A 3CIRB 3MVVA 3GV3A 1B9MA 2EY6A 2YU9B 2K03A 1HTPA 1J9OA 1V1PA 1EYCA 2K6AA 4KY6A 5KNCA 1EY9A 5D65A 5FLXL 1S4ZA 2RSOA 3P1MA 1IUEA 3WDNA 4HROA 1HFNA 5A2QL 2QJLA 3I4MB 1UUPA 1W6JA 4QF4A 3NBHA 3KWVA 1AEXA 4K14A 4BS9A 5HURA 4RHRA 1S5BD 5EBDA 4JWSC 3NBIA 2RDFA 2E2JB 4KY5A 3NUHB 3ZYYX 3M3YB 1V8QA 5C0XH 1JMLA 3OPOA 3I4LA 1KABA 1FFVA 3EJIA 3NQTA 4TSSA 3TZDA 1XX8A 2BT6A 1ESRA 4F8MA 1VJKA 1ONLA 2JXMB 2Q8RE 4XQJA 2BW2A 3K58A 3F2UA 1WTPA 3AU7A 3KLSA 2VNUD 5JXVA 2XSCA 2KAJA 4IALA 3GTQB 1JWBD 1TR5A 3DMUA 1B4OA 3P1HA 1BCPC 3S15B 4B9WA 4ARIA 5AFWA 4MHEA 3PUVA 2QKIC 1B53A 3T56B 1NR4A 2A5HA 2DLBA 4ZQ3A 1YJJA 4NKLA 1GAQB 5KGUA 3R8BA 2R6GA 2JZPA 1Q10A 1L4DB 4CKBA 4IQZA 3D6CA 2BS4B 1VZ7A 4P2CB 1FYCA 2EVBA 2WAQB 2B2VC 1TKYA 2PPBC 4WORA 1SYDA 2E2HB 4EQPA 1HZ6A 1Q8IA 2KEEA 3T3OA 4RF1A 2K5DA 2XIWA 4HAEA 3S17B 5EKKA 4L1BA 2B76B 2RSNA 5CV4A 1OXSC 1I3QB 3QJYA 1C4AA 2F0OA 3W5UB 4LJZC 3BZDB 1D5ZC 1ZE3D 1OFFA 3UI2A 2BE5D 4WWMA 1ACCA 4AS1A 4AYBB 4BA2I 1ZXIA 1G8ZD 2JA6B 3UI3A 3TZUA 1XWEA 3OWEB 4ZLTF 4JE3B 1QNKA 2WNMA 3AE3B 1YQ4B 3LWUA 3U7ZA 4IUTA 3OOCA 3W9CB 3NWSA 3RD4A 4DA2A 4GDLB 2WQYB 3RFZB 1LTID 1EZ8A 3HOUB 1B9RA 1T5EA 3S1RB 3PIP3 2E2IB 4L63B 2C9OA 5JPNC 1HCZA 1HQRD 3MXNA 2NBFA 1KDCA 5ELBA 3PUZA 5IODA 2FMMA 1D2BA 5DAUA 1K53A 1E10A 1V97A 3FILA 2OEOA 1STHA 4US8A 1I4QA 2LHDA 3BYTB 2DNCA 1QLBB 1GHKA 2G9DA 2EY1A 1HHVA 3SE0A 3H91A 3HZXA 5C2TB 2IGGA 2B2TA 3L4PA 4A3IB 1IBXB 4NDXA 4B0MA 1STYA 3FVQA 2D62A 5C3EB 5LL6X 1ZP0B 1KLGD 4BBSB 1HUNA 5M3MB 5K5PA 3VRBB 5G3LF 4HEA1 1QF6A 4H7BA 1STGA 2DBYA 5EE3A 1D1IA 4KMUC 1EU4A 1SYFA 1VCIA 3GTOB 4A9AA 4PMWA 4K5VA 3KWLA 2EYPA 3TEXA 4P16A 1PTOF 1D6EC 3AEGB 3SK6A 4EQOA 2ICEC 3LX0A 3GS2A 3VA5A 2M19A 5A2QE 2F0SA 2H88B 1O80A 5CV7A 1L6VA 1LABA 3SXHA 2L55A 1MGSA 4A3EB 1ILPA 5D14A 2L1BA 3NK9A 1OXXK 5CV9A 4O42A 1K51A 3NP8A 4WRDA 2CJOA 2F0IA 4CQNA 2F0TA 4ZKBB 1T6BX 1WCMB 3AE6B 3KLSX 2BBCA 3KBGA 1VZ8A 2N0SB 1KLUD 1AZQA 1OO9B 2MHVA 2GI9A 3TEYA 2C5CA 2IL8A 4IUPA 2GA4B 5IT9L 3W1SA 4ZHPA 1NENB 1P7FA 1DOMA 1LT4D 3ZJVA 5IT9E 2K22A 3PZ7A 3TDQA 2A73B 1KFYB 2XN9C 1NVID 4DU9A 1ZYRC 2L5TA 2F0KA 2JX5A 2K05A 1EY7A 1SMYC 4CJ2C 2F0FA 4UDUC 4KJNA 2WKDA 1C9FA 1Y8NB 3AB5A 1JE4A 3CKIB 5CR3A 1E2WA 2EYJA 1FGBD 3DWQA 1S5CD 1SXTA 2HQEA 2AQ2B 3OW7A 4ZKCB 2GRIA 2JSOA 1R9TB 1BNZA 4RGOS 4KD4A 2Q8TA 4RGTA 1FXIA 2BS2B 1XYIA 1YQ3B 4L8JA 1YNTE 3BVGA 1CA5A 3AE2B 3AECB 4FP5D 5G5GA 2SEBD 3LNNA 2PO4A 3M85A 2PTLA 1EL0A 3C2PA 3L3OC 2DWQA 1ICWA 3BDLA 3K0YA 3B2FA 3OIQA 3T13A 1RTNA 2A68C 2BE5C 1SE2A 2WXLA 3KQ4A 4RHSA 2M0AA 1UNSA 4IFDG 4M1UB 1DOKA 3QB3A 5DEHA 1WTXA 1G2TA 2B8FA 1AW7A 1EY6A 1PUTA 2PZWA 1MHXA 5GXGB 1PFNA 3G7LA 2A6HC 4K6LA 3Q69A 5C6AA 5JEAG 2HDMA 3OIPA 4JK1C 1B3AA 2Y5PA 4I65A 4LTUA 1QWYA 1RD9D 3AEEB 2M56B 4KKTA 4I7ZC 3PO3B 2WXRA 4N59A 1TY0A 1Q90A 2JYEA 1JWAD 4NMZA 3E6ZX 3LB8C 3K7AB 4PV1C 2EYHA 1CTMA 1LTBD 2WXGA 3I8ZA 2B63B 4RF0A 1QOFA 3SFDB 1A3TA 2JYTA 3PV0A 3VR8B 5ELFA 4IOIE 3MA2B 5CORA 4X3UA 3AMUA 3SFEB 2A69D 2K1BA 4J6HA 1VRAB 4HN7A 4CJ0B 3NPPA 1C4QA 1K8OA 3Q24A 1EWHA 1HXYD 2F1MA 1FNUA 4XYOA 3MC0B 3H3VC 1C77A 4WJWA 1S5FD 3I57A 1OXVA 4KN7C 5JVH3 2EY5A 3GTMB 5CC4A 1Y1WB 2F0HA 4QIWB 2EJFC 3P20A 2J52A 4WQMA 1UGJA 1PTOB 1H9JA 3DWMA 2BTEA 1PLFA 1SSOA 3QWNA 4IZ8A 3B9JA 3HRZC 4REZA 1GUGA 1QB5D 3K59A 3S1QB 1OXTA 2PW9A 3A7LA 1CJEA 2N9KA 3NVYA 1XO3A 2X6LA 4HCSA 2L0CA 1V1OA 3I3CA 1XLPA 2JQRB 2RVLA 3N52A 2B8GA 4RH6A 1U9RA 2V0GA 3OMGA 3H94A 2K0PA 2DN8A 3CWIA 1I4PA 5M5WB 4EE2A 1JWSD 5ISRA 2KQ3A 5BN5A 2AUJD 4DF7A 1G6ZA 3SR1A 3URYA 4R9WA 1QT9A 4XT1B 1U4LA 1PZKD 1ENFA 2MGSA 1XTCD 3EQLC 5CBAE 2Z4IA 3NTHA 2I38A 4A3MB 1IYVA 3K6OA 1MD2D 4DAVA 3J7AV 1Q3LA 1H9KA 3HOZB 1TQOA 4ABNA 5EBCA 5EJWA 1TY2A 4H13C 2PNRC 3TEZA 2HCIA 2J7ZA 2B2WC 3EGRA 1W6KA 2QMTA 1TS3A 3SEBA 1PRTD 3BYYB 3M4YA 2KDMA 3U4EG 3KLRA 2QEJC 4KX6B 4IUQA 4C3HB 2BDNA 3EVQA 4USAA 1ZUD2 2L52A 1QILA 5KRUA 2K32A 1WWTA 4WAFA 2NN6H 2F0LA 4OIKA 1AZPA 2PKOA 3BIID 2F0DA 2V3PA 4WH4A 1LO5D 2X6GA 2R7ZB 3AE5B 2RBMA 2F0PA 1E0BA 3C1EA 1XCQL 3A54A 5CV5A 4TQUS 1QNUA 3W3AA 3FRPB 1L0YB 3QG1A 3IFTA 4OO1G 4BWGB 1N63A 4L6TB 1LTRD 5EQ0A 4NZLB 1RYJA 4FO2A 1XEEA 1FRRA 5BMGA 2F0NA 2MEKA 2WU2B 2WXFA 3NVVA 3G6JB 4NP5A 4DNRB 3I91A 1FCCC 2E3TA 2PYKA 1PRTC 1B44D 1WD1A 3RPFC 4OIJA 5FLXE 3J7AF 4KN4C 2KUMA 4FNFA 3U9SA 2MUYA 1T3QA 1N5WA 3VR5A 1JWUD 2PW5A 2KECA 3GP7A 4C56C 2PVOD 5C44B 1EQTA 4ITKA 3AEBB 4ME5A 1GPXA 2ICIA 5BYSA 3MHZA 5C4XB 4HRSA 1ESFA 2CW0C 4M0WA 1TWFB 1CHQD 3ND8A 1NYQA 3U9OA 5C4HA 1B1ZA 1CM9A 1TU2B 5EE1A 5EPJA 1UWMA 1GHJA 1JWMD 5C0XG 1F9SA 4ODGA 3C3LA 4KTAA 2WU5B 1YNJC 2NYZD 4MACA 2KMMA 4TKOB 4QMGA 3S16B 2BDOA 1IKMA 2QIEB 4JBWA 1WXQA 3ZQ4A 3ZJTA 1G91A 1RDPD 3HVDA 3K57A 2A6EC 4IUNA 3VR9B 2YYZA 2WXQA 2HDLA 3IXSA 3SDZA 1JW9D 2YEPB 1ZEQX 4KKIA 3ND9A 3NXWA 2WDQB 3R2TA 2E76C 5D7GA 4YTMB 5A35A 5EKIA 2RKSA 4IURA 3NTKA 2HUGA 3HOVB 2L12A 1JOKA 4RCNA 5E3FA 1SF0A 2LFNA 3A8JE 1YJIA 2Y5CA 4OGQC 4KKSA 1SMYD 4A8XC 1SNCA 4ID6A 2F3WA 2DNEA 3P4RB 3HOXB 4G4KA 4XDCA 5LHY1 2PVGC 2WDRB 4NW2A 1L0VB 3NS1A 4J8QA 2KWDA 4N9PA 2FJ2A 2J53A 4RKBA 2LUMA 2NVXB 2TSSA 1FD7D 1WGKA 3TBIB 2WDVB 5I6YA 3PUWA 2KEDA 1E6EB 1Y8PB 1PTOD 4CHTB 2EYFA 3AM9A 1NAPA 2RDHA 2Y0SB 1RCVD 2IGDA 2CU3A 1YN5A 2WXIA 1ILQA 3X3MA 2A6HD 2JA7B 4FF2A 1D4BA 1NEKB 1YN3A 1EWYC 1WD0A 4OHJA 3QOLA 2L4NA 1JQYD 3GTLB 1HA5A 5DNFA 1BQQT 2G1EA 1EEFD 1SNPA 4Y7NB 3QOJA 1KDAA 1OQQA 2KJXA 5IGGA 2MH7A 4E6IA 3V96A 1C48A 4FXDA 1DM0B 1TYGB 2LS01 3K5MA 2B2YC 4K2KA 4C80A 4FF3A 1KNEA 1LTTD 3S2HB 4GLSC 2M9VA 4DK1A 3MXGA 4FXCA 1WTQA 3S1NB 2X69A 1QKZA 3KF8A 1M8AA 1EM7A 1FRDA 1HQMC 2E75C 2AX5A 2W3RA 1SYEA 4ZK9B 1IHZA 4EGVA 4OW0A 4J3OD 4FVMA 4BY1B 1SE4A 4F7XA 4PT5A 2XVSA 1Z6HA 1IGDA 3A55A 4S3SA 5EE9A 4Q0FA 4XWWA 2L32A 5KYIA 2WIIB 1CZWA 4KY7A 4XIGS 3K5OA 1WRIA 5FO8B 1MPEA 1VMPA 4ZUIA 3GTGB 4MIUA 4Q2JA 1Y8OB 1DOIA 1JOOA 2V4DA 5KEEA 1R7SA 1IW7C 4EQNA 1A15A 2H89B 2R92B 3IT4B 1L5PA 1BO0A 2LMCB 2IX1A 1UAPA 4XYQA 1F2MA 4PQXA 2EY2A 1M4VA 3K5LA 1AYFA 2E6XA 2K5QA 2KQ4X 3L9AX 2FMCA 4M8AA 3VQIA 2F0EA 2TMPA 2K7VA 3R93A 4DXGA 2KACA 3A56A 4YIJA 1WTVA 1JRPA 5HGTA 4A3GB 4IUUA 2RQXA 1SNMA 3CU7A 4A3KB 2IX3A 1SEBD 3TP7A 5FK9C 1VDZA 2IX0A 1N5XA 4HSPA 1WVLA 4K8JA 2JA5B 3NHHA 2NVYB 3J80E 5FOBB 1CZGA 3D4DA 3RZDB 3QIAA 1STBA 2VB3X 4LMQD 1F9PA 2WV6D 2J4XA 1I6VC 5T1IA 4F88A 2PQEA 2XRQD 1Q1EA 2FE8A 4PMBA 3I4NB 2WINB 5ELEA 1AFPA 2N55A 3DUZA 3O13A 4X3TA 2B39A 3N6RA 3E0JA 4C3IB 4XT3B 3PO2B 1LT3D 1DYQA 2KA7A 3KBXA 3KUPA 1BDOA 1IKLA 2JU6X 1E2VA 2L83A 3D31A 1TS2A 2B2YA 2NWGA 5I4DA 2MJ3A 1L6UA 3OSOA 1A70A 5CMDA 2KN4A 3M4OB 2XWJB 2BCOA 2DY8A 1EZ6A 2IDYA 1J7CA 1NR2A 1PTOC 2JYOA 1QG7A 1AWDA 1BCPD 1KAAA 5DM73 2F4IA 1QOGA 2HDEA 1BCPF 5EE0A 3Q0AA 2LEKA 1LTGD 5F2DA