2KK8A

Nmr solution structure of a putative uncharacterized protein obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3449a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AT4g05270
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kk8A01
2A5UA 2ZNVC 1IP9A 5FR6A 2BYFA 1AARA 1MG8A 4LJPB 5KHOA 4ANUA 5C1ZA 3IVFA 3UIOB 2PPHA 2EKEC 3WA0A 1WE6A 4EFOA 2K1FA 2ZZPB 2L05A 1UELA 5LLIA 2KTRB 3I3TB 2XK5B 4BKGA 2N7DA 1LQBA 4E74A 3PV1A 2KK8A 4IC7B 4EUTA 2WX0A 2K39A 4ANXA 4FADA 5CHFA 1VCBA 2CHZA 3IBEA 3VFKA 3DVNV 4ZYNA 2KJRA 2JY6A 2BKFA 2L3ZA 2REXA 4BOZB 2KX0A 4IM0A 4TQ0A 3APDA 5JHAA 4CO7A 2ZCBA 4DDID 1SE9A 3JSVB 3DVGX 2MCNB 1GNUA 4JQWC 1EF5A 4N9F4 3VTWA 3KYDD 2MSED 4NAWB 5IAAC 4RM8A 3U30A 1SGHA 1WI0A 2LGDA 3NZSA 5DPTA 4II2B 3VH4B 2C7NB 3QX1A 4K7WA 1EO6A 1OQYA 4DHJD 2CKHB 2KD0A 2KKCA 3HM6X 3KW5B 4FLHA 4PS3A 3WANA 4ASWC 4J6IA 1WXMA 4JL9A 4FJZA 1WX8A 3ML9A 2PJHA 4W9GA 2KQ7A 1UZXB 2JZZA 2D07B 3ZTCA 2CHXA 4M8NA 1WJNA 2HTHA 3VH3B 1KJTA 3QWZB 3GOEA 2N1VA 2ASQA 4KDLB 3OLMD 4EZKA 3DVGY 2A4ZA 1GG3A 3KVFB 4TQ1A 3VQIA 5LXHA 2L0FA 3SHQA 2M1MA 3ZNZB 2RPQA 3PREA 2KDEB 5D94A 3ZIMA 3VXWA 5CX3A 1S3SG 3C0RB 2CHWA 2LRWA 3DVNU 4DK5A 1ZGUB 3WAPA 3A1QA 3QK0A 2N1WA 3QCAA 4WWNA 2K8CA 3RULA 4DHZE 2D11A 1C1YB 2DYMA 4A3PA 2PEAA 3PHWB 4MGKE 3SU8X 1GC6A 4B6WA 4IW0A 2LUEA 4MJSA 3PS6A 2O6VB 4PS7A 5E6OA 4B9KA 2ZNVB 3UQAA 2KOXA 3EC8A 1WGYA 2KX3A 2CS4A 3DBSA 4IWQA 3T9LA 2FIDA 3WALA 4FJYA 3VTVA 2ZVOA 4IM2A 2KFKA 3ZRFA 5HKHA 3HK0A 2KDIA 4AJYB 2YLMA 2IBIB 3PPAA 3DDCB 1WZ0A 2MLBA 2Z0EB 3L13A 3HIZA 1WM3A 1Y8RC 3B0AA 2DAFA 3NS8A 2LXCA 2MBOA 4OVUA 3QJZA 3V6EB 1J19A 5KHQA 3W1SC 4G0NB 4HPMB 3MHSD 1RFAA 1WRDB 5AZHA 3APFA 2DZMA 3UIPB 1ZKHA 4G3XB 2JVCA 4G11A 2I1KA 2MP2B 2KLCA 2RGFA 1KOTA 2LVQA 2KVRA 4XX5A 2KTFA 4GOCA 3T8MA 3JW0X 3DCGA 4MSQB 4W9EA 4G50A 2DZJA 4PS8A 5J17A 3A9KB 2FCQA 3M63B 2KANA 3TIXA 5D2MB 2KFKB 5JHBA 3V62A 3B1LX 1WGGA 2CR5A 3UINB 4MEMA 3OAWA 4OVVA 2KXJA 4BOSC 3VAWA 4DWFA 3PLVA 3R66C 1WF9A 4GDKA 2MRPA 3TBLD 5TR5A 2KMAA 1UH6A 2NPTB 3A4RA 4KZ0A 3N30A 4W9JA 4DXAB 4NQLB 4RM9A 4EZLA 3KUDB 4TKNA 2LWPA 3A9JB 1YX6B 2BF8B 3NHEB 3QARA 4ZRKA 3ZTDA 2C7MB 1E8WA 3JYUA 1RAXA 1A5RA 1E90A 2BYVE 2DHZA 3A9JA 3K9OB 4KZCA 2MQJA 2YVCA 4LDTD 3EFUA 1WFYA 2FIFA 2WDTB 2Z0DB 3H7PA 3DBLI 5AEKB 4FBJB 3CMMB 4XZ4A 2GMIC 1WMHB 2GBKA 1E8YA 3IHPC 4RMAA 2K8HA 4W9CA 2LASA 4W9HA 2B3AA 4HJKA 2LRUA 5LXIB 4P7IA 3ZDTA 3TL5A 1CMXB 2AYOB 2ZPNA 3APCA 3MTNB 4FHKA 3L0WB 3RUIB 2DYOA 4TUUA 2K6QA 3QC8B 2NVUI 4I6NB 2BYEA 1WH3A 3A33B 4X57B 1WJUA 3LJ3A 2DX5B 4GN1A 4I6PA 4F1SA 4LDTB 1WJ4A 4FA6A 3A4SC 1RRBA 3BINA 2J0JA 2JZ3B 1P98A 3PRZA 1QZEA 2ZVNA 3L17A 3D32A 1UGMA 2M0XA 1V5OA 4WQOB 4HDQA 4ICVA 3ZDMC 4EKUA 1IYFA 4FN2A 4IWOA 2KLGA 4GU2A 2N9XA 2WX1A 4ANWA 2IYDB 1R4MI 2IO0B 2OJRA 4KIKA 2R2QA 3H7SA 3M95A 4WJQA 2K8BA 3ZO5B 5J2RA 3V60A 2KHWB 1C3TA 3VDZA 2DAJA 1H8CA 2N4FA 3PVLA 4MGIE 5L83A 3NZUA 3QAQA 3PSEB 3U8ZA 2KJHB 2KFJA 3ZUNA 5CHWA 3B08A 3ZW3A 4E71A 1V80A 2DYBA 2IO3B 5JZEB 5AZGA 1D3ZA 5CHVC 5E6PA 3AU5A 2NBVB 3ML8A 4W9FA 2KZRA 4A3OA 2WWZA 2KDBA 4DDGD 1JRUA 3X23A 4EOYA 4MELA 2RR9A 1WE7A 2FUHB 4IWPA 2BWFA 2LZ6A 2EMSA 2W9NA 2IZVB 3RD2A 2PE6B 4GIVA 4FJVB 1WR6E 1XT9B 3ZKJC 2KDFB 1LM8B 4MGZE 4KV2A 1P3QU 2ZPYA 4MDKE 5DCNA 4F8CB 3QIJA 2FCSA 4DBGA 3K9PB 1E7UA 3ECIA 5DPSA 1WX9A 1WXVA 2DZKA 2KC1A 3L16A 4HDOA 3N32A 1P0RA 3ZNHB 3PHXB 4W9IA 2KJ6A 2D10A 1FXTB 4HCPB 1K8RB 2NBWB 2O6VA 3N3KB 2KWUB 4IG7B 2MBBB 4LJOB 1WJ6A 3HHMA 2L8JA 2V4LA 1V86A 4ZRIA 3SDLC 1YIWA 2L0TA 4K81A 1WGRA 3AI5A 1S1QB 3ZRCA 2D2QA 1EUVB 3SD5A 3W1YA 3X0WA 4HLEA 3TCAA 3LDZE 1EF1A 2BPSA 3KUCB 1P9DU 4GDKB 3HM3A 3M3JA 3ZVVA 5DPRA 3ZLZA 1ZW7A 3W1SA 4F7ZA 2LI5A 1V81A 4EZJA 1YD8U 3UF8A 1UD7A 4GSWA 1V6EA 3RZWC 1Q5WB 4WJOA 3VUYA 2GOWA 1TTNA 2MBEA 2MBHA 4GB9A 3GZNI 1YQBA 1Q1OA 2J0KA 2FAZA 3O65B 1V9JA 1T0YA 2KTRA 3DBRI 2BWES 2I1JA 2J7QB 5JH5C 3H7PB 2M4NA 4PYUA 1NI2A 3QHTA 2R2OA 3ONSA 3L54A 4DHZB 2V3SA 2NCNA 2V1YA 1ISNA 1WMHA 3UGBB 2ZCCA 1KLVA 1WY8A 2M17A 2O2VB 4AWJA 1RLFA 4CHKA 2KO3A 2C60A 1E7VA 3PTFC 1U4AA 2LGYA 1GUAB 1WGHA 2FNJB 4NAWA 2G3QB 3CSTA 1J0GA 2N7EA 5D6JB 3VVWB 4LCDE 4AUQC 4I6LB 1OTRB 4PYZA 4HWIB 4URKA 2KMCA 3Q3JA 1XQQA 2JRIB 3AXCA 3EECA 2NBUA 3VTUA 4KIKB 3R3MA 2BGFA 5J18A 2KQSA 2KWCA 2BKRB 2K6DB 3TJPA 4JLCA 4MM3A 4WJNA 4JIOU 3RYTA 1OEYJ 3S2AA 3R7RA 4EEWA 2LD9A 2MX2A 4K7SA 2PE9A 4A20A 4DHJB 5EDSA 4KSKC 3RCZA 4XC2A 3DPDA 3PLUA 1YJ1A 2JUOA 3Q3FA 1WGDA 2O6VD 1HE8A 4M8MA 5DPWA 1GJZA 4GDLB 2UYZB 2M8SA 2GBRA 2KC2A 2JT4B 4TV3A 5GMVA 5G55A 3WAOA 4W9LA 4AP4C 2L7RA 2LXAA 4AOFA 2NS5A 3WIMA 1Q0WB 1I42A 3R7QA 1WZ3A 2MA9B 2JWZA 3U7DA 3KH0A 1G6JA 2IY0B 2IY1B 4II3B 2LGXA 4WJPA 4ZRJA 2N9PC 5E6NA 2CU1A 1V49A 2HD5B 1UBIA 2L76A 3L08A 3QA8A 4IUMB 1E8ZA 1P1AA 2RD0A 4IM3A 2DENB 3OJ4B 3KUZA 1X1MA 4FULA 2FCNA 2IO1B 1NBFC 2AEHA 2AL6A 3AU4A 4K7UA 4WAAA 5C23A 3ZNID 5AZFA 4W9KA 4NQKE 5G2NA 4GMVA 4HPLB 4HVBA 4NPNA 2JRHA 3PZDA 4BBNC 1WXSA 3V6CB 4M0WB 3PGEA 1Z5SB 2GBMA 1WXAA 2QHOA 3MJWA 1PQSA 2HE7A 2HJ8A 2K25A 2VRRB 2ZEQA 4NJ7A 1BT0A 2G4DB 2JPHA 4KDIC 4YL8A 3PT2B 2KN5A 3IFWB 3VUXA 2Y5BB 3H1UA 1E5WA 3QQ8B 3DQVA 2MBQA 2LJ5A 3JSVA 3RT3B 3UQBA 2D3GA 3VUWA 1VD2A 2XBBC 1L7YA 2G4SA 2DZIA 4ANVA 2LVOA 3TMPB 2L00B 3RZFA 2AWTA 4B95A 1L2NA 2KWVB 1TZ1A 4KVGB 2ZJDA 3L10B 4KSLC 2XEWA 2MW5A 3M62B 1R4NI 1Z2MA 2G45B 3NOBA 5D7GA 4AJWA 1I35A 3H9DA 2C7HA 2GBJA 2UWQA 5CTRC 3WAMA 4BKSA 2JXXA 1KM7A 1V5TA 2MP2A 2WYQA 3A9KA 3KYCD 4K1RB 3ENEA 3CF6E 3ALBA 2NR2A 2KNBA 3VHTC 1WR1A 4MGYE 1OGWA 4NJ6A 4HCNB 2OOBB 2GBNA 2IO2B 2MWSB 2C9WB 4BKTA 1E8XA 3BY4B 1V2YA 4NNJB 4CYEA 1OEYA 1J8CA 3OJ3A 2Z59B 4JGHB 1H4RA 1WM2A 2N9EB 1GC7A 3PRPB 4HK2A 4W9DA 4ZDVA 1SIFA 2LVPA 4HXDA 2J0MA 4BKSD 4MSMB 1NDDA 5BO4B 2NPTA 4GXBA 3NY5A 1LFDA 1YX5B 1WX7A 4MJSB 2AL3A 3AULA 1XD3B 1F9JA 3H6NA 1TGZB 4WWPA 3V61A 2XK5A 1UBQA 2C5LC 4FHJA 3IG3A 1WYWB 3JVZX 4BBNF 1LXDA 3ZNGC 2EMTA 2O2VA 1IPGA 4E3CA 4NY0A 3DBHI 3DOWA 3P2BA 5L95C 4BFRA 1WIAA 4GDLA 4MH0E 3A1QB 4BVUC 4GGQA 3CSFA 5IA7A 2FCMA 3PRMB 1TBEA 1M94A 4WWOA 2RSUA 4ICUA 2JF5A 3EHVA
chains in the Genus database with same CATH superfamily
1IP9A 5FR6A 2N9KA 5KHOA 4ANUA 3DBLB 3UIOB 2PPHA 2EKEC 3PZ7A 4LNKA 4EFOA 2L05A 1F77A 2VZKB 3PV1A 1QOFA 3EUB2 4IC7B 3U4EG 4EUTA 2WX0A 1RYJA 4OZAA 4FADA 1UWMA 4US9A 2CHZA 3IBEA 3VFKA 3DVNV 1F52A 3GZNB 3APDA 4CO7A 1MI0A 3DVGX 3VTWA 1IUEA 2KT7A 2MSED 3NZ3A 1TS4A 4M01A 3U30A 1WI0A 2BTEA 4K7WA 1OQYA 3URYA 2CKHB 3VRBB 4J6IA 1WXMA 4JL9A 5FR3A 2KQ7A 1UZXB 2JZZA 2CHXA 2WQYB 2K5PA 1JWUD 2HTHA 3ABVB 3N9YC 3QWZB 3TUOA 2N1VA 3R2TA 4S0RA 2A4ZA 2L0FA 3SHQA 3ZNZB 2E6XA 3I9V1 1S3SG 1E10A 3C0RB 1N5XA 2LRWA 3DVNU 4XE0A 1ZGUB 2AQ2B 3A1QA 1MPEA 3QK0A 2N1WA 3QCAA 3H8HA 2K8CA 2D11A 1C1YB 1FO4A 2WXHA 3GE3C 2D3AA 3AEBB 1GC6A 4B6WA 5JZEB 1EWCA 5H92C 4L2YA 1D5XC 3VTVA 1CQVA 2KDIA 2YLMA 4B0MA 1FD6A 4N59A 1ZP0B 3HIZA 4C7YA 3AECB 1WM3A 2DAFA 3V6EB 4G0NB 4WIPA 5LNK1 1WRDB 2BS2B 1R4NB 2DZMA 1ZKHA 1WGKA 5BYQA 2JVCA 2I1KA 2MP2B 2KLCA 1MVKA 2LVQA 2KVRA 3AE1B 2WXMA 4GOCA 3T8MA 4W9EA 2QSDA 2WXLA 3A9KB 3M63B 3SFDB 1SXTA 3B1LX 2CR5A 3OAWA 1V1OA 4OVVA 1GOZA 3AEAB 4A90A 3A4RA 2WNMA 3N30A 2INNE 4EE2A 3AB5A 5EE0A 2LWPA 1TT5B 2X38A 3QARA 2C7MB 2PKOA 1E8WA 2G9HD 3JYUA 1C78A 1A5RA 2WDVB 1E90A 2BYVE 3A9JA 3K9OB 4KZCA 1VLBA 1WFYA 2FIFA 2INPE 4P6VF 1I4RA 3J9CA 4XZ4A 2GMIC 3RFZB 4TSSA 1C76A 2LASA 5LXIB 4JWUC 2L83A 3RI7C 2ZPNA 2VH2A 1R4MB 4TUUA 2K6QA 2GB1A 4I6NB 4YT0B 2WGSA 2DX5B 4GN1A 4F1SA 1HTOA 3IT4B 3A4SC 1RRBA 3NG0A 3SEBA 3L17A 4WQOB 4HDQA 4FN2A 4IWOA 2Y5CA 4RH6A 4ANWA 1R4MI 2IO0B 1D5MC 5J2RA 4XWTA 2KHWB 3PVLA 3N1YC 2JYTA 5CHWA 4P1BC 1QOGA 5AZGA 5CHVC 1XXGA 3ML8A 3CWIA 4XDCA 3GP7A 3IXSA 3CIRB 2RR9A 1SIJA 2BWFA 2LZ6A 2W9NA 3RD2A 2WS3B 5D3IB 4GIVA 1WR6E 2KDFB 1GAQB 2BS3B 2ON8A 1EU3A 3ECIA 1FRRA 5BYRA 2IGDA 4IKGA 1SE2A 1I4XA 4HCPB 2NBWB 3Q8EA 3N3KB 2ZW0A 4ZRPA 4LJOB 1CJEA 3HHMA 1HZ6A 4ZRIA 4WURA 4RGNA 3SDLC 4YTMB 1WGRA 1S1QB 3ZRCA 3SD5A 3I5JC 1FFUA 1WXQA 1P9DU 4RGTA 3ZQ4A 1JWSD 3BVZA 2LI5A 4IOIE 2KMMA 1V6EA 2GOWA 1TTNA 2K0PA 3GZNI 1YQBA 4YSZB 2FAZA 3AE2B 2L32A 2KTRA 2J7QB 3NVWA 4PYUA 3QHTA 2R2OA 2V1YA 1SSNA 4USAA 2AX5A 1KFYB 1SF0A 2ZCCA 1KLVA 1WY8A 2O2VB 4CHKA 1C4PA 2KO3A 3PTFC 1VZ7A 2NTSA 4M02A 3NVZA 3P4PB 1D6EC 5D6JB 1L6VA 3P1MA 4PYZA 4URKA 3Q3JA 1XQQA 2BGFA 3NVVA 2BKRB 2K6DB 3AE9B 4HRSA 3HVZA 2KACA 2LD9A 2PW9A 3RCZA 4QAYA 3DPDA 3AE8B 1YJ1A 2KVZA 5DPWA 4TV3A 2GBRA 4AP4C 2WP9B 1T3QA 2V0GA 3R7QA 2MA9B 2JWZA 1OQQA 2FE8A 3KH0A 4II3B 4ZRJA 2N9PC 1YOVB 2CU1A 3QA8A 1UBIA 2PVOD 1E8ZA 1P1AA 4IM3A 1YN4A 2FCNA 2IO1B 3EGRA 5G2NA 1XEEA 3OG5A 2EELA 2SEBD 3AE6B 2BQQA 1I4GA 4RNAA 1YJIA 1RFKA 4NZLB 2W82A 3UI3A 2D3CA 1Z5SB 2GBMA 3GB1A 1TS3A 1ZDVA 4NJ7A 3VUXA 1B9RA 2J42A 3QQ8B 1NVID 1VD2A 2J52A 2DZIA 3TMPB 2WXFA 3X0WA 3MFGA 3L10B 2XEWA 1Z2MA 2G45B 2UU7A 5CTRC 2VZKD 2G1EA 4JPSA 3KYCD 1T0SC 4K1RB 3ENEA 3ALBA 3C19A 1WR1A 2WU5B 4LNOA 2KDMA 2GBNA 2OOBB 1QF6A 3BY4B 4NNJB 1OEYA 1WM2A 4W9DA 2GRIA 2QIEB 2J0MA 2NPTA 1TZOA 2LGIA 3U52E 4PK1A 1C4AA 3AULA 1F9JA 3H6NA 2VH1A 4FHJA 2GLSA 1XLOA 2L52A 3P4RB 1JMLA 4BBNF 2EMTA 4NY0A 5L95C 4BFRA 1V97A 1WIAA 4GGQA 3AE5B 3RNFC 1B1ZA 1M94A 1TBEA 4WWOA 3BK2A 1HA5A 4ICUA 2A5UA 5IP4D 4C80A 3N1ZC 1AARA 1MG8A 4LJPB 4Q2JA 1BUIC 1D5ZC 2ZZPB 5LLIA 2KN4A 2KTRB 3BVMA 4BKGA 2W55A 2N7DA 4D2KA 2KK8A 1MFWA 1NEKB 2K39A 4ANXA 5CHFA 1VCBA 2JY6A 2BKFA 4BOZB 2KX0A 1SJED 5JHAA 1GNUA 2EKIA 4JQWC 2GI9A 5IAAC 4RM8A 1SGHA 1I4QA 1YN3A 3LXFA 5DPTA 2C7NB 2MJEA 2KKCA 4PS3A 3KW5B 4ASWC 4FJZA 3ML9A 2PJHA 5MPOA 2WXOA 1WJNA 1C77A 1SJHD 4K3BA 4KDLB 4EZKA 3DVGY 1GG3A 2RPQA 3PREA 3VXWA 1KRHA 1KLUD 4DHZE 4WWNA 1SBBB 4C7ZA 2DYMA 2K9XA 4MGKE 3SU8X 2LUEA 2O6VB 5IN7A 2ZNVB 3RPFC 1WGYA 3NJTA 4IWQA 4R3DA 2ZVOA 3W5UB 4AJYB 1WZ0A 3RMKC 4ZRQA 2N0SB 3B0AA 3N1XC 2MBOA 1J19A 2MH7A 4HPMB 3MHSD 1I4PA 5AZHA 3MC9A 3UIPB 4G11A 1N60A 2WXGA 1KOTA 2WXKA 2JX5A 3AEDB 3JW0X 4G50A 5J17A 2K3UA 2FCQA 4LK0M 4O1NA 2KFKB 3PLVA 4GDKA 2MRPA 3KWLA 3TBLD 1N61A 4JE3B 4A55A 4RM9A 2PTLA 4TKNA 3NHEB 4KGTA 3ZTDA 4IDIA 2DHZA 4YTNB 3ZGZA 2YVCA 4LDTD 1FPYA 3WCQA 1XF5L 3HVDA 3FKYA 3CMMB 4MT5A 1J7AA 1WMHB 3RNCC 1IBXB 4UDUC 1SEBD 4W9HA 2B3AA 4P7IA 3ZDTA 1CMXB 2AYOB 1TJEA 3APCA 3MTNB 4XYCA 3L0WB 1FXAA 1VZ6A 2NVUI 3AV8A 3A33B 1QQRA 1TY2A 4LDTB 2J0JA 2JZ3B 1E9MA 2IDYA 2HDEA 1V1PA 3D32A 3Q8CA 4EKUA 2N9XA 2XN9C 2DNFA 2IYDB 2OJRA 2R2QA 4WJQA 2K8BA 2DAJA 5L83A 2J4XA 3QAQA 1FCCC 2KFJA 1V80A 1XLNA 3AU5A 2KZRA 5IOIA 4A3OA 3Q6BA 4DDGD 1JRUA 4RFBA 4IWPA 2EMSA 1PGBA 4WAFA 2IZVB 3W2DA 1XT9B 4JWSC 4P16A 4KV2A 1P3QU 4RF1A 2OJWA 4MDKE 3K9PB 1E7UA 5DPSA 3AE3B 1KTKA 2N9LA 3Q8BA 5E6JA 3ZNHB 3PHXB 1JROA 1L4ZB 1K8RB 2O6VA 2KWUB 2DWQA 2IGHA 1YMHE 1V86A 1TKGA 2LMCA 2AQ3B 1AWDA 4PT5A 3NS1A 4K81A 1WWTA 2D2QA 3ZJVA 3LDZE 1EF1A 3KQ4A 4GDKB 3ZVVA 3HM3A 3M3JA 4C00A 1C79A 2DBYA 1N63A 1V81A 3BZDB 3P4SB 3RZWC 1Q5WB 4WJOA 1GB1A 2QEJC 1Q1OA 3AN1A 1V9JA 1T0YA 3Q2AC 3DBRI 4RGOS 4K3CA 2WU2B 3L54A 2V3SA 1JRPA 2L1AA 4RCOA 3W9CB 3KWVA 1U4AA 2LGYA 5HFYA 1GUAB 1WGHA 4CQNA 4NAWA 2G3QB 3O13A 1DOYA 3BK1A 2KMCA 2Y5PA 3MJ5A 2JU6X 3VTUA 3BYYB 1NYRA 1J7CA 2KWCA 4HPPA 2I38A 2D5GA 2CJOA 2RPVA 4K7SA 4A20A 4AQ7A 3PLUA 3Q8AA 1GPXA 2JUOA 2W3RA 2M8SA 2JT4B 3WAOA 2L7RA 2LXAA 3MC8A 1G6JA 1C9FA 5HG2A 4WJPA 1IBXA 3Q14C 2HD5B 3U2SC 1QOAA 1TKEA 1UUPA 4GLSC 1YJJA 3AU4A 4K7UA 5C23A 4NQKE 4HVBA 2JRHA 1PFDA 1WXSA 1MJDA 3V6CB 1WXAA 1PQSA 4LNFA 4YTPB 2G4DB 4KDIC 2QMTA 2KN5A 1E7PB 2Y5BB 3PZ8A 1E5WA 2MBQA 2D3GA 2XBBC 1NYQA 4ANVA 5BMGA 5IO9A 2AWTA 1FFVA 1FNWA 4BAXA 4F7ZA 4KSLC 2JXTA 1I35A 1R4NI 3WAMA 4BKSA 1V5TA 1ZDXA 2MP2A 2WYQA 1N62A 4NAMA 1I7HA 3U7ZA 2KNBA 4MGYE 4NJ6A 2C9WB 4BKTA 1E8XA 5HHDG 2HTME 1H4RA 3PRPB 4HK2A 4B0EA 4MSMB 5BO4B 3NY5A 2AL3A 1DGJA 1XD3B 2XK5A 2C5LC 3IG3A 1WYWB 4A8XC 5FKAC 5T8IA 2R61A 1FEHA 3CSFA 1GB4A 5IA7A 3GS2A 3P63A 4KGRA 2JF5A 1CZPA 2ZNVC 3B2GA 1ENFA 4RF0A 2MEKA 2BYFA 3Q8FA 5GXGB 5HI1A 3WA0A 2K1FA 1FNVA 1UELA 1DOXA 1ZE3D 4E74A 5I4DA 1L0VB 2JYEA 2BB6A 4ZYNA 2WXIA 4TQ0A 1UNSA 2ZCBA 1SE9A 2MCNB 1EF5A 2ICIA 4N9F4 3KYDD 2WXQA 4ZYSA 5BMIA 3QX1A 3ZJUA 2NTTA 2KD0A 3WANA 1WX8A 4W9GA 2D07B 1FIQA 4M8NA 5C3JB 1BMLC 3VH3B 1KJTA 3GOEA 1MHXA 2ASQA 3PO0A 3OLMD 1R7SA 1EWYC 5EE9A 3V05A 5LXHA 2M1MA 1PDXA 3DBRB 3I63C 1F2RC 5CX3A 2ONQA 2CHWA 1C4CA 1M4VA 5C2TB 2PEAA 3FILB 4B9KA 4PS7A 2HJ1A 5E6OA 1MG4A 5G5GA 3AH7A 3UQAA 2CS4A 3T9LA 3WALA 3HK0A 1FRDA 1NI3A 2BT6A 3PPAA 2V4IB 1V1PB 3SFEB 3KLSX 4OZCA 5JXVA 1Y8RC 4OVUA 1F0ZA 1VR9A 2LXCA 3QJZA 3W1SC 1RFAA 2LHDA 3APFA 3E56A 2W54A 4XX5A 3AM9A 2TSSA 4MSQB 4C56C 1ET9A 3AE7B 2KANA 2RDBC 3TIXA 5JHBA 3V62A 1UWXA 1WGGA 3UINB 4MEMA 4DWFA 3VAWA 3R66C 2XNAC 5TR5A 2NPTB 4W9JA 4DXAB 4EZLA 3RNGC 2JWUA 3A9JB 1YX6B 3BWUD 3W5VB 1RAXA 1JW9D 1UGJA 2Z8LA 2MQJA 2WDTB 3DBLI 3MC0B 1WYGA 5AEKB 1ROEA 4RMAA 3IHPC 1QT9A 1D4BA 1FMAD 3T3NA 3P42A 3DHGC 3TL5A 3ZYYX 2I2YA 1L0YB 2BYEA 4X57B 2NMQA 3AEEB 1WJUA 2LUMA 2OEDA 3LJ3A 1KH0A 4I6PA 4C4VA 1WJ4A 4FA6A 4FXCA 3R2IA 1P98A 1QLBB 1TIFA 1CK1A 2ZVNA 1L5PA 2LGSA 1UGMA 2WXPA 1V5OA 3P4QB 4ICVA 3ZDMC 3EFCA 4KIKA 1HEZE 4N6EB 3M95A 1QILA 3ZO5B 3VDZA 4MGIE 3U8ZA 1UF0A 3PSEB 2KJHB 5EE1A 3ZW3A 2DYBA 1STEA 2KYWA 1D3ZA 2NBVB 5AUKA 3ZXRA 4W9FA 2INCC 4LNIA 4REZA 2QJLA 4EOYA 2FUHB 1OFFA 4C4VB 1WSPA 3BIID 5FK9C 4FJVB 2M56B 2ZPYA 5DCNA 3QIJA 2FCSA 2WXNA 1AYFA 3E9SA 1SE3A 1WX9A 5D3DA 3L16A 3N32A 1P0RA 4ARIA 3DBHB 1IGDA 4W9IA 2D10A 1FXTB 4PS8A 4A9AA 4IG7B 1WJ6A 4XGAB 2V4LA 1NENB 3I57A 4XDDA 5IKCM 2PIAA 4HEA1 2FBWB 1KF6B 3W1YA 3TCAA 3RNBC 3KUCB 2LJIA 5DPRA 3ZLZA 1ZW7A 1ZXHA 3W1SA 2IGGA 1F2RI 4EZJA 1YD8U 3UF8A 3VUYA 4YSYB 3O65B 2I1JA 3H7PB 1NI2A 1ISNA 1WMHA 4KGSA 2INDC 1HQRD 2M17A 4AWJA 3DWGC 2JQRB 1EU4A 1E7VA 2FNJB 3CSTA 1J0GA 3VVWB 3DHIC 4LCDE 1OTRB 2N7JA 3EECA 1EM7A 2WDRB 3R3MA 3BVGA 5J18A 2KQSA 1PGAA 1K50A 4YSXB 1FCLA 4MM3A 3AMZA 1OEYJ 4EEWA 2MX2A 1QKZA 4DHJB 4XC2A 3FILA 3Q3FA 1WGDA 1AN8A 2O6VD 4M8MA 1GJZA 2BB5A 5GMVA 3TEWA 4OVZA 3U7DA 4LLGM 2IY0B 3L08A 3MHZA 3VR9B 3OJ4B 2QDFA 3KUZA 4FULA 1X1MA 1XO3A 3OWEB 4MM3B 2AL6A 3ZNID 4WAAA 5AZFA 2KQ4X 4GMVA 4BBNC 2QHOA 2K25A 2HE7A 2HJ8A 2ZEQA 2JPHA 4YL8A 3PT2B 2AQ1B 4M0WA 3H1UA 3DQVA 2LJ5A 3JSVA 4DQOC 3UQBA 1IGCA 1Y56A 2LVOA 2L00B 1TZ1A 2K22A 4AJWA 3H9DA 2GBJA 1AW7A 2JXXA 5H8YE 2M0AA 1OGWA 2RDGA 4KKIA 1VZ8A 4HCNB 3V3XA 2IO2B 1T0RC 2Q5WD 2IJ0A 2Z59B 2LEKA 4JX1C 1T5XD 2B76B 1SIFA 2LVPA 4HXDA 2ACZB 1L0XB 1NDDA 2FUG1 2V9HA 1LFDA 1YX5B 1WX7A 4MJSB 1MHHE 2DLBA 3RNAC 1TGZB 4DXFA 1QOBA 3HRDD 1LXDA 4E3CA 1E6EB 5AUIA 4TMAB 4BZAA 3A1QB 4DXGA 2FCMA 3PRMB 1V8CA 2RSUA 1L7YA 3EHVA 3IT6B 5C1ZA 1L4DB 3IVFA 1WE6A 3I3TB 2XK5B 1PYWD 1LQBA 4OW0A 1T0QC 2QC8A 1YN5A 2KJRA 2L3ZA 2REXA 1JWAD 4N58A 4IM0A 4DDID 3JSVB 4ITKA 1K53A 2YEPB 1XCQL 4NAWB 1RWSA 2LGDA 3NZSA 4HJGE 3NVYA 4II2B 3VH4B 1ACCA 1EO6A 4DHJD 3HM6X 4L23A 4FLHA 3LB8C 4HKZE 1F1HA 3ZTCA 3RN9C 1E0ZA 3NUHB 3KVFB 4TQ1A 3Q69A 3VQIA 1SB3C 2KDEB 5D94A 3ZIMA 4DK5A 3WAPA 1FM0D 1N6ZA 2JZPA 3EA6A 3RULA 4ZOHC 3ZJTA 4A3PA 3PHWB 2JSVX 1Q10A 3C8YA 4IW0A 4MJSA 3PS6A 1ZXIA 1WRIA 2KOXA 3EC8A 3DBSA 2KX3A 2FIDA 4FJYA 4IM2A 3ZRFA 2KFKA 2RMMA 5HKHA 4AS1A 5EE3A 1ESFA 4ARCA 2IBIB 3DDCB 4H2AA 4KKJA 2MLBA 3BYTB 2Z0EB 3L13A 3NS8A 4A6QA 5KHQA 2MHJA 1YQ4B 3FAHA 3VR8B 2LFIA 4KX6B 1HTQA 4ZHPA 4G3XB 4WH4A 3T3OA 1YNTE 1JWBD 2RGFA 3GE8C 2KTFA 4HKQA 3DCGA 1TS5A 2DZJA 3TSSA 5D2MB 1BXTA 2KXJA 4BOSC 5TSSA 1WF9A 1K51A 2KMAA 1UH6A 3DWMA 4KZ0A 4NQLB 2RDHA 3KUDB 4LTUA 2BF8B 2YEPF 1LGRA 4ZRKA 1XLPA 3B2FA 1JWMD 1XCTL 1J7BA 3AE4B 3EFUA 3TEXA 2Z0DB 5G5HA 3H7PA 4FBJB 2GBKA 1E8YA 1HZ5A 2K8HA 3FC4A 4W9CA 2SAKA 3AEGB 2WHIA 4HJKA 1SE4A 2V3PA 3R8BA 2LRUA 2IPKD 4FHKA 3RUIB 2DYOA 3QC8B 1WH3A 2KAJA 1VJKA 3BINA 3PRZA 3HUIA 3AEFB 1QZEA 1VDVA 2M0XA 1IYFA 2KLGA 4GU2A 3TEYA 2WX1A 5BMHA 3H7SA 3V60A 1C3TA 1H8CA 2N4FA 3NZUA 3ZUNA 3ETRA 3B08A 4E71A 2IO3B 1T6BX 2V3NA 5E6PA 2H88B 1P7EA 1N5WA 2LHEA 2WWZA 2KDBA 3Q3NC 3X23A 4MELA 3Q3MC 1WE7A 3DHHC 2E3TA 3ZKJC 1LM8B 4MGZE 2BVCA 4F8CB 4DBGA 3MP9A 1WXVA 2DZKA 2KC1A 4HDOA 1YQ3B 2KJ6A 2MBBB 4J3OD 2L8JA 1YIWA 2L0TA 1VRAB 3AI5A 1P7FA 1EUVB 4HLEA 4ZHOA 2BPSA 1TS2A 1UD7A 4GSWA 3VRAB 2PLPA 1ET6A 2MBEA 2MBHA 2W3SA 4GB9A 3N20C 2J0KA 4WWMA 4YXDB 2BWES 5JH5C 2WXRA 2M4NA 2BS4B 4ACFA 3ONSA 4M00A 4DHZB 2NCNA 1JCKB 3UGBB 2D3BA 1OQRA 1A70A 1RLFA 3SR6A 1JALA 2C60A 4L1BA 2N7EA 2OHFA 2WDQB 1ZPSA 1DOIA 4AUQC 4I6LB 4HWIB 4MH8A 4S17A 2WLBA 2JRIB 1HXYD 3AXCA 2NBUA 4KIKB 1FXIA 2X8XX 3TJPA 4JLCA 4WJNA 2BYTA 4JIOU 3RYTA 3S2AA 3R7RA 2MJ3A 2PE9A 5EDSA 4KSKC 4WQMA 5BYSA 2BBCA 1ZUD2 1HE8A 3RNEC 4GDLB 2UYZB 2KC2A 5G55A 3IAS1 4AOFA 4W9LA 2NS5A 1FNUA 3WIMA 1Q0WB 1I42A 1XLQA 1WZ3A 2IY1B 2LGXA 3LYYA 2J53A 4P1CC 5E6NA 1V49A 2L76A 4IUMB 2QILA 4HROA 1KLGD 2RD0A 1RM6C 2DENB 2PVGC 1PGXA 4YWGG 1JQ4A 1NBFC 2AEHA 4NJCA 4W9KA 1PUTA 4HPLB 4NPNA 3PZDA 2H89B 1TY0A 3NRZA 1K52A 4M0WB 3PGEA 3MJWA 2VRRB 1BT0A 3IFWB 3RT3B 1DYQA 1I4HA 4OHJA 3VUWA 2G4SA 2BW2A 4XWWA 3RZFA 4B95A 1L2NA 2KWVB 4KVGB 3Q3OC 2ZJDA 3NOBA 2MW5A 3M62B 5D7GA 3TEZA 2C7HA 2UWQA 3IAM1 1KM7A 3A9KA 3CF6E 2NR2A 3VHTC 1TYGB 1L6UA 2MWSB 1V2YA 4CYEA 2Y3AA 1ZOYB 1J8CA 3OJ3A 4JGHB 2N9EB 1GC7A 4OZBA 4ZDVA 4US8A 4LNNA 4BKSD 4GXBA 2CU3A 3ZXVA 2WXJA 2PMVA 4WWPA 3V61A 1UBQA 2KWDA 2CJNA 2M19A 3B9JA 3JVZX 3ZNGC 2O2VA 1IPGA 3DBHI 3DOWA 3P2BA 2QCZA 1LO5D 4GDLA 2MJDA 1TKYA 4MH0E 4RGMA 4BVUC 3L4PA 2ZW1A 4MACA 2PE6B
chains in the Genus database with same CATH topology
2A5UA 2ZNVC 1IP9A 5FR6A 2BYFA 1AARA 1MG8A 4LJPB 5KHOA 4ANUA 5C1ZA 3IVFA 3UIOB 2PPHA 2EKEC 3WA0A 1WE6A 4EFOA 2K1FA 2ZZPB 2L05A 1UELA 5LLIA 2KTRB 3I3TB 2XK5B 4BKGA 2N7DA 1LQBA 4E74A 3PV1A 2KK8A 4IC7B 4EUTA 2WX0A 2K39A 4ANXA 4FADA 5CHFA 1VCBA 2CHZA 3IBEA 3VFKA 3DVNV 4ZYNA 2KJRA 2JY6A 2BKFA 2L3ZA 2REXA 4BOZB 2KX0A 4IM0A 4TQ0A 3APDA 5JHAA 4CO7A 2ZCBA 4DDID 1SE9A 3JSVB 3DVGX 2MCNB 1GNUA 4JQWC 1EF5A 4N9F4 3VTWA 3KYDD 2MSED 4NAWB 5IAAC 4RM8A 3U30A 1SGHA 1WI0A 2LGDA 3NZSA 5DPTA 4II2B 3VH4B 2C7NB 3QX1A 4K7WA 1EO6A 1OQYA 4DHJD 2CKHB 2KD0A 2KKCA 3HM6X 3KW5B 4FLHA 4PS3A 3WANA 4ASWC 4J6IA 1WXMA 4JL9A 4FJZA 1WX8A 3ML9A 2PJHA 4W9GA 2KQ7A 1UZXB 2JZZA 2D07B 3ZTCA 2CHXA 4M8NA 1WJNA 2HTHA 3VH3B 1KJTA 3QWZB 3GOEA 2N1VA 2ASQA 4KDLB 3OLMD 4EZKA 3DVGY 2A4ZA 1GG3A 3KVFB 4TQ1A 3VQIA 5LXHA 2L0FA 3SHQA 2M1MA 3ZNZB 2RPQA 3PREA 2KDEB 5D94A 3ZIMA 3VXWA 5CX3A 1S3SG 3C0RB 2CHWA 2LRWA 3DVNU 4DK5A 1ZGUB 3WAPA 3A1QA 3QK0A 2N1WA 3QCAA 4WWNA 2K8CA 3RULA 4DHZE 2D11A 1C1YB 2DYMA 4A3PA 2PEAA 3PHWB 4MGKE 3SU8X 1GC6A 4B6WA 4IW0A 2LUEA 4MJSA 3PS6A 2O6VB 4PS7A 5E6OA 4B9KA 2ZNVB 3UQAA 2KOXA 3EC8A 1WGYA 2KX3A 2CS4A 3DBSA 4IWQA 3T9LA 2FIDA 3WALA 4FJYA 3VTVA 2ZVOA 4IM2A 2KFKA 3ZRFA 5HKHA 3HK0A 2KDIA 4AJYB 2YLMA 2IBIB 3PPAA 3DDCB 1WZ0A 2MLBA 2Z0EB 3L13A 3HIZA 1WM3A 1Y8RC 3B0AA 2DAFA 3NS8A 2LXCA 2MBOA 4OVUA 3QJZA 3V6EB 1J19A 5KHQA 3W1SC 4G0NB 4HPMB 3MHSD 1RFAA 1WRDB 5AZHA 3APFA 2DZMA 3UIPB 1ZKHA 4G3XB 2JVCA 4G11A 2I1KA 2MP2B 2KLCA 2RGFA 1KOTA 2LVQA 2KVRA 4XX5A 2KTFA 4GOCA 3T8MA 3JW0X 3DCGA 4MSQB 4W9EA 4G50A 2DZJA 4PS8A 5J17A 3A9KB 2FCQA 3M63B 2KANA 3TIXA 5D2MB 2KFKB 5JHBA 3V62A 3B1LX 1WGGA 2CR5A 3UINB 4MEMA 3OAWA 4OVVA 2KXJA 4BOSC 3VAWA 4DWFA 3PLVA 3R66C 1WF9A 4GDKA 2MRPA 3TBLD 5TR5A 2KMAA 1UH6A 2NPTB 3A4RA 4KZ0A 3N30A 4W9JA 4DXAB 4NQLB 4RM9A 4EZLA 3KUDB 4TKNA 2LWPA 3A9JB 1YX6B 2BF8B 3NHEB 3QARA 4ZRKA 3ZTDA 2C7MB 1E8WA 3JYUA 1RAXA 1A5RA 1E90A 2BYVE 2DHZA 3A9JA 3K9OB 4KZCA 2MQJA 2YVCA 4LDTD 3EFUA 1WFYA 2FIFA 2WDTB 2Z0DB 3H7PA 3DBLI 5AEKB 4FBJB 3CMMB 4XZ4A 2GMIC 1WMHB 2GBKA 1E8YA 3IHPC 4RMAA 2K8HA 4W9CA 2LASA 4W9HA 2B3AA 4HJKA 2LRUA 5LXIB 4P7IA 3ZDTA 3TL5A 1CMXB 2AYOB 2ZPNA 3APCA 3MTNB 4FHKA 3L0WB 3RUIB 2DYOA 4TUUA 2K6QA 3QC8B 2NVUI 4I6NB 2BYEA 1WH3A 3A33B 4X57B 1WJUA 3LJ3A 2DX5B 4GN1A 4I6PA 4F1SA 4LDTB 1WJ4A 4FA6A 3A4SC 1RRBA 3BINA 2J0JA 2JZ3B 1P98A 3PRZA 1QZEA 2ZVNA 3L17A 3D32A 1UGMA 2M0XA 1V5OA 4WQOB 4HDQA 4ICVA 3ZDMC 4EKUA 1IYFA 4FN2A 4IWOA 2KLGA 4GU2A 2N9XA 2WX1A 4ANWA 2IYDB 1R4MI 2IO0B 2OJRA 4KIKA 2R2QA 3H7SA 3M95A 4WJQA 2K8BA 3ZO5B 5J2RA 3V60A 2KHWB 1C3TA 3VDZA 2DAJA 1H8CA 2N4FA 3PVLA 4MGIE 5L83A 3NZUA 3QAQA 3PSEB 3U8ZA 2KJHB 2KFJA 3ZUNA 5CHWA 3B08A 3ZW3A 4E71A 1V80A 2DYBA 2IO3B 5JZEB 5AZGA 1D3ZA 5CHVC 5E6PA 3AU5A 2NBVB 3ML8A 4W9FA 2KZRA 4A3OA 2WWZA 2KDBA 4DDGD 1JRUA 3X23A 4EOYA 4MELA 2RR9A 1WE7A 2FUHB 4IWPA 2BWFA 2LZ6A 2EMSA 2W9NA 2IZVB 3RD2A 2PE6B 4GIVA 4FJVB 1WR6E 1XT9B 3ZKJC 2KDFB 1LM8B 4MGZE 4KV2A 1P3QU 2ZPYA 4MDKE 5DCNA 4F8CB 3QIJA 2FCSA 4DBGA 3K9PB 1E7UA 3ECIA 5DPSA 1WX9A 1WXVA 2DZKA 2KC1A 3L16A 4HDOA 3N32A 1P0RA 3ZNHB 3PHXB 4W9IA 2KJ6A 2D10A 1FXTB 4HCPB 1K8RB 2NBWB 2O6VA 3N3KB 2KWUB 4IG7B 2MBBB 4LJOB 1WJ6A 3HHMA 2L8JA 2V4LA 1V86A 4ZRIA 3SDLC 1YIWA 2L0TA 4K81A 1WGRA 3AI5A 1S1QB 3ZRCA 2D2QA 1EUVB 3SD5A 3W1YA 3X0WA 4HLEA 3TCAA 3LDZE 1EF1A 2BPSA 3KUCB 1P9DU 4GDKB 3HM3A 3M3JA 3ZVVA 5DPRA 3ZLZA 1ZW7A 3W1SA 4F7ZA 2LI5A 1V81A 4EZJA 1YD8U 3UF8A 1UD7A 4GSWA 1V6EA 3RZWC 1Q5WB 4WJOA 3VUYA 2GOWA 1TTNA 2MBEA 2MBHA 4GB9A 3GZNI 1YQBA 1Q1OA 2J0KA 2FAZA 3O65B 1V9JA 1T0YA 2KTRA 3DBRI 2BWES 2I1JA 2J7QB 5JH5C 3H7PB 2M4NA 4PYUA 1NI2A 3QHTA 2R2OA 3ONSA 3L54A 4DHZB 2V3SA 2NCNA 2V1YA 1ISNA 1WMHA 3UGBB 2ZCCA 1KLVA 1WY8A 2M17A 2O2VB 4AWJA 1RLFA 4CHKA 2KO3A 2C60A 1E7VA 3PTFC 1U4AA 2LGYA 1GUAB 1WGHA 2FNJB 4NAWA 2G3QB 3CSTA 1J0GA 2N7EA 5D6JB 3VVWB 4LCDE 4AUQC 4I6LB 1OTRB 4PYZA 4HWIB 4URKA 2KMCA 3Q3JA 1XQQA 2JRIB 3AXCA 3EECA 2NBUA 3VTUA 4KIKB 3R3MA 2BGFA 5J18A 2KQSA 2KWCA 2BKRB 2K6DB 3TJPA 4JLCA 4MM3A 4WJNA 4JIOU 3RYTA 1OEYJ 3S2AA 3R7RA 4EEWA 2LD9A 2MX2A 4K7SA 2PE9A 4A20A 4DHJB 5EDSA 4KSKC 3RCZA 4XC2A 3DPDA 3PLUA 1YJ1A 2JUOA 3Q3FA 1WGDA 2O6VD 1HE8A 4M8MA 5DPWA 1GJZA 4GDLB 2UYZB 2M8SA 2GBRA 2KC2A 2JT4B 4TV3A 5GMVA 5G55A 3WAOA 4W9LA 4AP4C 2L7RA 2LXAA 4AOFA 2NS5A 3WIMA 1Q0WB 1I42A 3R7QA 1WZ3A 2MA9B 2JWZA 3U7DA 3KH0A 1G6JA 2IY0B 2IY1B 4II3B 2LGXA 4WJPA 4ZRJA 2N9PC 5E6NA 2CU1A 1V49A 2HD5B 1UBIA 2L76A 3L08A 3QA8A 4IUMB 1E8ZA 1P1AA 2RD0A 4IM3A 2DENB 3OJ4B 3KUZA 1X1MA 4FULA 2FCNA 2IO1B 1NBFC 2AEHA 2AL6A 3AU4A 4K7UA 4WAAA 5C23A 3ZNID 5AZFA 4W9KA 4NQKE 5G2NA 4GMVA 4HPLB 4HVBA 4NPNA 2JRHA 3PZDA 4BBNC 1WXSA 3V6CB 4M0WB 3PGEA 1Z5SB 2GBMA 1WXAA 2QHOA 3MJWA 1PQSA 2HE7A 2HJ8A 2K25A 2VRRB 2ZEQA 4NJ7A 1BT0A 2G4DB 2JPHA 4KDIC 4YL8A 3PT2B 2KN5A 3IFWB 3VUXA 2Y5BB 3H1UA 1E5WA 3QQ8B 3DQVA 2MBQA 2LJ5A 3JSVA 3RT3B 3UQBA 2D3GA 3VUWA 1VD2A 2XBBC 1L7YA 2G4SA 2DZIA 4ANVA 2LVOA 3TMPB 2L00B 3RZFA 2AWTA 4B95A 1L2NA 2KWVB 1TZ1A 4KVGB 2ZJDA 3L10B 4KSLC 2XEWA 2MW5A 3M62B 1R4NI 1Z2MA 2G45B 3NOBA 5D7GA 4AJWA 1I35A 3H9DA 2C7HA 2GBJA 2UWQA 5CTRC 3WAMA 4BKSA 2JXXA 1KM7A 1V5TA 2MP2A 2WYQA 3A9KA 3KYCD 4K1RB 3ENEA 3CF6E 3ALBA 2NR2A 2KNBA 3VHTC 1WR1A 4MGYE 1OGWA 4NJ6A 4HCNB 2OOBB 2GBNA 2IO2B 2MWSB 2C9WB 4BKTA 1E8XA 3BY4B 1V2YA 4NNJB 4CYEA 1OEYA 1J8CA 3OJ3A 2Z59B 4JGHB 1H4RA 1WM2A 2N9EB 1GC7A 3PRPB 4HK2A 4W9DA 4ZDVA 1SIFA 2LVPA 4HXDA 2J0MA 4BKSD 4MSMB 1NDDA 5BO4B 2NPTA 4GXBA 3NY5A 1LFDA 1YX5B 1WX7A 4MJSB 2AL3A 3AULA 1XD3B 1F9JA 3H6NA 1TGZB 4WWPA 3V61A 2XK5A 1UBQA 2C5LC 4FHJA 3IG3A 1WYWB 3JVZX 4BBNF 1LXDA 3ZNGC 2EMTA 2O2VA 1IPGA 4E3CA 4NY0A 3DBHI 3DOWA 3P2BA 5L95C 4BFRA 1WIAA 4GDLA 4MH0E 3A1QB 4BVUC 4GGQA 3CSFA 5IA7A 2FCMA 3PRMB 1TBEA 1M94A 4WWOA 2RSUA 4ICUA 2JF5A 3EHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5U A;  2ZNV C;  1IP9 A;  5FR6 A;  2BYF A;  1AAR A;  1MG8 A;  4LJP B;  5KHO A;  4ANU A;  5C1Z A;  3IVF A;  3UIO B;  2PPH A;  2EKE C;  3WA0 A;  1WE6 A;  4EFO A;  2K1F A;  2ZZP B;  2L05 A;  1UEL A;  5LLI A;  2KTR B;  3I3T B;  2XK5 B;  4BKG A;  2N7D A;  1LQB A;  4E74 A;  3PV1 A;  2KK8 A;  4IC7 B;  4EUT A;  2WX0 A;  2K39 A;  4ANX A;  4FAD A;  5CHF A;  1VCB A;  2CHZ A;  3IBE A;  3VFK A;  3DVN V;  4ZYN A;  2KJR A;  2JY6 A;  2BKF A;  2L3Z A;  2REX A;  4BOZ B;  2KX0 A;  4IM0 A;  4TQ0 A;  3APD A;  5JHA A;  4CO7 A;  2ZCB A;  4DDI D;  1SE9 A;  3JSV B;  3DVG X;  2MCN B;  1GNU A;  4JQW C;  1EF5 A;  4N9F 4;  3VTW A;  3KYD D;  2MSE D;  4NAW B;  5IAA C;  4RM8 A;  3U30 A;  1SGH A;  1WI0 A;  2LGD A;  3NZS A;  5DPT A;  4II2 B;  3VH4 B;  2C7N B;  3QX1 A;  4K7W A;  1EO6 A;  1OQY A;  4DHJ D;  2CKH B;  2KD0 A;  2KKC A;  3HM6 X;  3KW5 B;  4FLH A;  4PS3 A;  3WAN A;  4ASW C;  4J6I A;  1WXM A;  4JL9 A;  4FJZ A;  1WX8 A;  3ML9 A;  2PJH A;  4W9G A;  2KQ7 A;  1UZX B;  2JZZ A;  2D07 B;  3ZTC A;  2CHX A;  4M8N A;  1WJN A;  2HTH A;  3VH3 B;  1KJT A;  3QWZ B;  3GOE A;  2N1V A;  2ASQ A;  4KDL B;  3OLM D;  4EZK A;  3DVG Y;  2A4Z A;  1GG3 A;  3KVF B;  4TQ1 A;  3VQI A;  5LXH A;  2L0F A;  3SHQ A;  2M1M A;  3ZNZ B;  2RPQ A;  3PRE A;  2KDE B;  5D94 A;  3ZIM A;  3VXW A;  5CX3 A;  1S3S G;  3C0R B;  2CHW A;  2LRW A;  3DVN U;  4DK5 A;  1ZGU B;  3WAP A;  3A1Q A;  3QK0 A;  2N1W A;  3QCA A;  4WWN A;  2K8C A;  3RUL A;  4DHZ E;  2D11 A;  1C1Y B;  2DYM A;  4A3P A;  2PEA A;  3PHW B;  4MGK E;  3SU8 X;  1GC6 A;  4B6W A;  4IW0 A;  2LUE A;  4MJS A;  3PS6 A;  2O6V B;  4PS7 A;  5E6O A;  4B9K A;  2ZNV B;  3UQA A;  2KOX A;  3EC8 A;  1WGY A;  2KX3 A;  2CS4 A;  3DBS A;  4IWQ A;  3T9L A;  2FID A;  3WAL A;  4FJY A;  3VTV A;  2ZVO A;  4IM2 A;  2KFK A;  3ZRF A;  5HKH A;  3HK0 A;  2KDI A;  4AJY B;  2YLM A;  2IBI B;  3PPA A;  3DDC B;  1WZ0 A;  2MLB A;  2Z0E B;  3L13 A;  3HIZ A;  1WM3 A;  1Y8R C;  3B0A A;  2DAF A;  3NS8 A;  2LXC A;  2MBO A;  4OVU A;  3QJZ A;  3V6E B;  1J19 A;  5KHQ A;  3W1S C;  4G0N B;  4HPM B;  3MHS D;  1RFA A;  1WRD B;  5AZH A;  3APF A;  2DZM A;  3UIP B;  1ZKH A;  4G3X B;  2JVC A;  4G11 A;  2I1K A;  2MP2 B;  2KLC A;  2RGF A;  1KOT A;  2LVQ A;  2KVR A;  4XX5 A;  2KTF A;  4GOC A;  3T8M A;  3JW0 X;  3DCG A;  4MSQ B;  4W9E A;  4G50 A;  2DZJ A;  4PS8 A;  5J17 A;  3A9K B;  2FCQ A;  3M63 B;  2KAN A;  3TIX A;  5D2M B;  2KFK B;  5JHB A;  3V62 A;  3B1L X;  1WGG A;  2CR5 A;  3UIN B;  4MEM A;  3OAW A;  4OVV A;  2KXJ A;  4BOS C;  3VAW A;  4DWF A;  3PLV A;  3R66 C;  1WF9 A;  4GDK A;  2MRP A;  3TBL D;  5TR5 A;  2KMA A;  1UH6 A;  2NPT B;  3A4R A;  4KZ0 A;  3N30 A;  4W9J A;  4DXA B;  4NQL B;  4RM9 A;  4EZL A;  3KUD B;  4TKN A;  2LWP A;  3A9J B;  1YX6 B;  2BF8 B;  3NHE B;  3QAR A;  4ZRK A;  3ZTD A;  2C7M B;  1E8W A;  3JYU A;  1RAX A;  1A5R A;  1E90 A;  2BYV E;  2DHZ A;  3A9J A;  3K9O B;  4KZC A;  2MQJ A;  2YVC A;  4LDT D;  3EFU A;  1WFY A;  2FIF A;  2WDT B;  2Z0D B;  3H7P A;  3DBL I;  5AEK B;  4FBJ B;  3CMM B;  4XZ4 A;  2GMI C;  1WMH B;  2GBK A;  1E8Y A;  3IHP C;  4RMA A;  2K8H A;  4W9C A;  2LAS A;  4W9H A;  2B3A A;  4HJK A;  2LRU A;  5LXI B;  4P7I A;  3ZDT A;  3TL5 A;  1CMX B;  2AYO B;  2ZPN A;  3APC A;  3MTN B;  4FHK A;  3L0W B;  3RUI B;  2DYO A;  4TUU A;  2K6Q A;  3QC8 B;  2NVU I;  4I6N B;  2BYE A;  1WH3 A;  3A33 B;  4X57 B;  1WJU A;  3LJ3 A;  2DX5 B;  4GN1 A;  4I6P A;  4F1S A;  4LDT B;  1WJ4 A;  4FA6 A;  3A4S C;  1RRB A;  3BIN A;  2J0J A;  2JZ3 B;  1P98 A;  3PRZ A;  1QZE A;  2ZVN A;  3L17 A;  3D32 A;  1UGM A;  2M0X A;  1V5O A;  4WQO B;  4HDQ A;  4ICV A;  3ZDM C;  4EKU A;  1IYF A;  4FN2 A;  4IWO A;  2KLG A;  4GU2 A;  2N9X A;  2WX1 A;  4ANW A;  2IYD B;  1R4M I;  2IO0 B;  2OJR A;  4KIK A;  2R2Q A;  3H7S A;  3M95 A;  4WJQ A;  2K8B A;  3ZO5 B;  5J2R A;  3V60 A;  2KHW B;  1C3T A;  3VDZ A;  2DAJ A;  1H8C A;  2N4F A;  3PVL A;  4MGI E;  5L83 A;  3NZU A;  3QAQ A;  3PSE B;  3U8Z A;  2KJH B;  2KFJ A;  3ZUN A;  5CHW A;  3B08 A;  3ZW3 A;  4E71 A;  1V80 A;  2DYB A;  2IO3 B;  5JZE B;  5AZG A;  1D3Z A;  5CHV C;  5E6P A;  3AU5 A;  2NBV B;  3ML8 A;  4W9F A;  2KZR A;  4A3O A;  2WWZ A;  2KDB A;  4DDG D;  1JRU A;  3X23 A;  4EOY A;  4MEL A;  2RR9 A;  1WE7 A;  2FUH B;  4IWP A;  2BWF A;  2LZ6 A;  2EMS A;  2W9N A;  2IZV B;  3RD2 A;  2PE6 B;  4GIV A;  4FJV B;  1WR6 E;  1XT9 B;  3ZKJ C;  2KDF B;  1LM8 B;  4MGZ E;  4KV2 A;  1P3Q U;  2ZPY A;  4MDK E;  5DCN A;  4F8C B;  3QIJ A;  2FCS A;  4DBG A;  3K9P B;  1E7U A;  3ECI A;  5DPS A;  1WX9 A;  1WXV A;  2DZK A;  2KC1 A;  3L16 A;  4HDO A;  3N32 A;  1P0R A;  3ZNH B;  3PHX B;  4W9I A;  2KJ6 A;  2D10 A;  1FXT B;  4HCP B;  1K8R B;  2NBW B;  2O6V A;  3N3K B;  2KWU B;  4IG7 B;  2MBB B;  4LJO B;  1WJ6 A;  3HHM A;  2L8J A;  2V4L A;  1V86 A;  4ZRI A;  3SDL C;  1YIW A;  2L0T A;  4K81 A;  1WGR A;  3AI5 A;  1S1Q B;  3ZRC A;  2D2Q A;  1EUV B;  3SD5 A;  3W1Y A;  3X0W A;  4HLE A;  3TCA A;  3LDZ E;  1EF1 A;  2BPS A;  3KUC B;  1P9D U;  4GDK B;  3HM3 A;  3M3J A;  3ZVV A;  5DPR A;  3ZLZ A;  1ZW7 A;  3W1S A;  4F7Z A;  2LI5 A;  1V81 A;  4EZJ A;  1YD8 U;  3UF8 A;  1UD7 A;  4GSW A;  1V6E A;  3RZW C;  1Q5W B;  4WJO A;  3VUY A;  2GOW A;  1TTN A;  2MBE A;  2MBH A;  4GB9 A;  3GZN I;  1YQB A;  1Q1O A;  2J0K A;  2FAZ A;  3O65 B;  1V9J A;  1T0Y A;  2KTR A;  3DBR I;  2BWE S;  2I1J A;  2J7Q B;  5JH5 C;  3H7P B;  2M4N A;  4PYU A;  1NI2 A;  3QHT A;  2R2O A;  3ONS A;  3L54 A;  4DHZ B;  2V3S A;  2NCN A;  2V1Y A;  1ISN A;  1WMH A;  3UGB B;  2ZCC A;  1KLV A;  1WY8 A;  2M17 A;  2O2V B;  4AWJ A;  1RLF A;  4CHK A;  2KO3 A;  2C60 A;  1E7V A;  3PTF C;  1U4A A;  2LGY A;  1GUA B;  1WGH A;  2FNJ B;  4NAW A;  2G3Q B;  3CST A;  1J0G A;  2N7E A;  5D6J B;  3VVW B;  4LCD E;  4AUQ C;  4I6L B;  1OTR B;  4PYZ A;  4HWI B;  4URK A;  2KMC A;  3Q3J A;  1XQQ A;  2JRI B;  3AXC A;  3EEC A;  2NBU A;  3VTU A;  4KIK B;  3R3M A;  2BGF A;  5J18 A;  2KQS A;  2KWC A;  2BKR B;  2K6D B;  3TJP A;  4JLC A;  4MM3 A;  4WJN A;  4JIO U;  3RYT A;  1OEY J;  3S2A A;  3R7R A;  4EEW A;  2LD9 A;  2MX2 A;  4K7S A;  2PE9 A;  4A20 A;  4DHJ B;  5EDS A;  4KSK C;  3RCZ A;  4XC2 A;  3DPD A;  3PLU A;  1YJ1 A;  2JUO A;  3Q3F A;  1WGD A;  2O6V D;  1HE8 A;  4M8M A;  5DPW A;  1GJZ A;  4GDL B;  2UYZ B;  2M8S A;  2GBR A;  2KC2 A;  2JT4 B;  4TV3 A;  5GMV A;  5G55 A;  3WAO A;  4W9L A;  4AP4 C;  2L7R A;  2LXA A;  4AOF A;  2NS5 A;  3WIM A;  1Q0W B;  1I42 A;  3R7Q A;  1WZ3 A;  2MA9 B;  2JWZ A;  3U7D A;  3KH0 A;  1G6J A;  2IY0 B;  2IY1 B;  4II3 B;  2LGX A;  4WJP A;  4ZRJ A;  2N9P C;  5E6N A;  2CU1 A;  1V49 A;  2HD5 B;  1UBI A;  2L76 A;  3L08 A;  3QA8 A;  4IUM B;  1E8Z A;  1P1A A;  2RD0 A;  4IM3 A;  2DEN B;  3OJ4 B;  3KUZ A;  1X1M A;  4FUL A;  2FCN A;  2IO1 B;  1NBF C;  2AEH A;  2AL6 A;  3AU4 A;  4K7U A;  4WAA A;  5C23 A;  3ZNI D;  5AZF A;  4W9K A;  4NQK E;  5G2N A;  4GMV A;  4HPL B;  4HVB A;  4NPN A;  2JRH A;  3PZD A;  4BBN C;  1WXS A;  3V6C B;  4M0W B;  3PGE A;  1Z5S B;  2GBM A;  1WXA A;  2QHO A;  3MJW A;  1PQS A;  2HE7 A;  2HJ8 A;  2K25 A;  2VRR B;  2ZEQ A;  4NJ7 A;  1BT0 A;  2G4D B;  2JPH A;  4KDI C;  4YL8 A;  3PT2 B;  2KN5 A;  3IFW B;  3VUX A;  2Y5B B;  3H1U A;  1E5W A;  3QQ8 B;  3DQV A;  2MBQ A;  2LJ5 A;  3JSV A;  3RT3 B;  3UQB A;  2D3G A;  3VUW A;  1VD2 A;  2XBB C;  1L7Y A;  2G4S A;  2DZI A;  4ANV A;  2LVO A;  3TMP B;  2L00 B;  3RZF A;  2AWT A;  4B95 A;  1L2N A;  2KWV B;  1TZ1 A;  4KVG B;  2ZJD A;  3L10 B;  4KSL C;  2XEW A;  2MW5 A;  3M62 B;  1R4N I;  1Z2M A;  2G45 B;  3NOB A;  5D7G A;  4AJW A;  1I35 A;  3H9D A;  2C7H A;  2GBJ A;  2UWQ A;  5CTR C;  3WAM A;  4BKS A;  2JXX A;  1KM7 A;  1V5T A;  2MP2 A;  2WYQ A;  3A9K A;  3KYC D;  4K1R B;  3ENE A;  3CF6 E;  3ALB A;  2NR2 A;  2KNB A;  3VHT C;  1WR1 A;  4MGY E;  1OGW A;  4NJ6 A;  4HCN B;  2OOB B;  2GBN A;  2IO2 B;  2MWS B;  2C9W B;  4BKT A;  1E8X A;  3BY4 B;  1V2Y A;  4NNJ B;  4CYE A;  1OEY A;  1J8C A;  3OJ3 A;  2Z59 B;  4JGH B;  1H4R A;  1WM2 A;  2N9E B;  1GC7 A;  3PRP B;  4HK2 A;  4W9D A;  4ZDV A;  1SIF A;  2LVP A;  4HXD A;  2J0M A;  4BKS D;  4MSM B;  1NDD A;  5BO4 B;  2NPT A;  4GXB A;  3NY5 A;  1LFD A;  1YX5 B;  1WX7 A;  4MJS B;  2AL3 A;  3AUL A;  1XD3 B;  1F9J A;  3H6N A;  1TGZ B;  4WWP A;  3V61 A;  2XK5 A;  1UBQ A;  2C5L C;  4FHJ A;  3IG3 A;  1WYW B;  3JVZ X;  4BBN F;  1LXD A;  3ZNG C;  2EMT A;  2O2V A;  1IPG A;  4E3C A;  4NY0 A;  3DBH I;  3DOW A;  3P2B A;  5L95 C;  4BFR A;  1WIA A;  4GDL A;  4MH0 E;  3A1Q B;  4BVU C;  4GGQ A;  3CSF A;  5IA7 A;  2FCM A;  3PRM B;  1TBE A;  1M94 A;  4WWO A;  2RSU A;  4ICU A;  2JF5 A;  3EHV A; 
#chains in the Genus database with same CATH topology
 1IP9 A;  5FR6 A;  2N9K A;  5KHO A;  4ANU A;  3DBL B;  3UIO B;  2PPH A;  2EKE C;  3PZ7 A;  4LNK A;  4EFO A;  2L05 A;  1F77 A;  2VZK B;  3PV1 A;  1QOF A;  3EUB 2;  4IC7 B;  3U4E G;  4EUT A;  2WX0 A;  1RYJ A;  4OZA A;  4FAD A;  1UWM A;  4US9 A;  2CHZ A;  3IBE A;  3VFK A;  3DVN V;  1F52 A;  3GZN B;  3APD A;  4CO7 A;  1MI0 A;  3DVG X;  3VTW A;  1IUE A;  2KT7 A;  2MSE D;  3NZ3 A;  1TS4 A;  4M01 A;  3U30 A;  1WI0 A;  2BTE A;  4K7W A;  1OQY A;  3URY A;  2CKH B;  3VRB B;  4J6I A;  1WXM A;  4JL9 A;  5FR3 A;  2KQ7 A;  1UZX B;  2JZZ A;  2CHX A;  2WQY B;  2K5P A;  1JWU D;  2HTH A;  3ABV B;  3N9Y C;  3QWZ B;  3TUO A;  2N1V A;  3R2T A;  4S0R A;  2A4Z A;  2L0F A;  3SHQ A;  3ZNZ B;  2E6X A;  3I9V 1;  1S3S G;  1E10 A;  3C0R B;  1N5X A;  2LRW A;  3DVN U;  4XE0 A;  1ZGU B;  2AQ2 B;  3A1Q A;  1MPE A;  3QK0 A;  2N1W A;  3QCA A;  3H8H A;  2K8C A;  2D11 A;  1C1Y B;  1FO4 A;  2WXH A;  3GE3 C;  2D3A A;  3AEB B;  1GC6 A;  4B6W A;  5JZE B;  1EWC A;  5H92 C;  4L2Y A;  1D5X C;  3VTV A;  1CQV A;  2KDI A;  2YLM A;  4B0M A;  1FD6 A;  4N59 A;  1ZP0 B;  3HIZ A;  4C7Y A;  3AEC B;  1WM3 A;  2DAF A;  3V6E B;  4G0N B;  4WIP A;  5LNK 1;  1WRD B;  2BS2 B;  1R4N B;  2DZM A;  1ZKH A;  1WGK A;  5BYQ A;  2JVC A;  2I1K A;  2MP2 B;  2KLC A;  1MVK A;  2LVQ A;  2KVR A;  3AE1 B;  2WXM A;  4GOC A;  3T8M A;  4W9E A;  2QSD A;  2WXL A;  3A9K B;  3M63 B;  3SFD B;  1SXT A;  3B1L X;  2CR5 A;  3OAW A;  1V1O A;  4OVV A;  1GOZ A;  3AEA B;  4A90 A;  3A4R A;  2WNM A;  3N30 A;  2INN E;  4EE2 A;  3AB5 A;  5EE0 A;  2LWP A;  1TT5 B;  2X38 A;  3QAR A;  2C7M B;  2PKO A;  1E8W A;  2G9H D;  3JYU A;  1C78 A;  1A5R A;  2WDV B;  1E90 A;  2BYV E;  3A9J A;  3K9O B;  4KZC A;  1VLB A;  1WFY A;  2FIF A;  2INP E;  4P6V F;  1I4R A;  3J9C A;  4XZ4 A;  2GMI C;  3RFZ B;  4TSS A;  1C76 A;  2LAS A;  5LXI B;  4JWU C;  2L83 A;  3RI7 C;  2ZPN A;  2VH2 A;  1R4M B;  4TUU A;  2K6Q A;  2GB1 A;  4I6N B;  4YT0 B;  2WGS A;  2DX5 B;  4GN1 A;  4F1S A;  1HTO A;  3IT4 B;  3A4S C;  1RRB A;  3NG0 A;  3SEB A;  3L17 A;  4WQO B;  4HDQ A;  4FN2 A;  4IWO A;  2Y5C A;  4RH6 A;  4ANW A;  1R4M I;  2IO0 B;  1D5M C;  5J2R A;  4XWT A;  2KHW B;  3PVL A;  3N1Y C;  2JYT A;  5CHW A;  4P1B C;  1QOG A;  5AZG A;  5CHV C;  1XXG A;  3ML8 A;  3CWI A;  4XDC A;  3GP7 A;  3IXS A;  3CIR B;  2RR9 A;  1SIJ A;  2BWF A;  2LZ6 A;  2W9N A;  3RD2 A;  2WS3 B;  5D3I B;  4GIV A;  1WR6 E;  2KDF B;  1GAQ B;  2BS3 B;  2ON8 A;  1EU3 A;  3ECI A;  1FRR A;  5BYR A;  2IGD A;  4IKG A;  1SE2 A;  1I4X A;  4HCP B;  2NBW B;  3Q8E A;  3N3K B;  2ZW0 A;  4ZRP A;  4LJO B;  1CJE A;  3HHM A;  1HZ6 A;  4ZRI A;  4WUR A;  4RGN A;  3SDL C;  4YTM B;  1WGR A;  1S1Q B;  3ZRC A;  3SD5 A;  3I5J C;  1FFU A;  1WXQ A;  1P9D U;  4RGT A;  3ZQ4 A;  1JWS D;  3BVZ A;  2LI5 A;  4IOI E;  2KMM A;  1V6E A;  2GOW A;  1TTN A;  2K0P A;  3GZN I;  1YQB A;  4YSZ B;  2FAZ A;  3AE2 B;  2L32 A;  2KTR A;  2J7Q B;  3NVW A;  4PYU A;  3QHT A;  2R2O A;  2V1Y A;  1SSN A;  4USA A;  2AX5 A;  1KFY B;  1SF0 A;  2ZCC A;  1KLV A;  1WY8 A;  2O2V B;  4CHK A;  1C4P A;  2KO3 A;  3PTF C;  1VZ7 A;  2NTS A;  4M02 A;  3NVZ A;  3P4P B;  1D6E C;  5D6J B;  1L6V A;  3P1M A;  4PYZ A;  4URK A;  3Q3J A;  1XQQ A;  2BGF A;  3NVV A;  2BKR B;  2K6D B;  3AE9 B;  4HRS A;  3HVZ A;  2KAC A;  2LD9 A;  2PW9 A;  3RCZ A;  4QAY A;  3DPD A;  3AE8 B;  1YJ1 A;  2KVZ A;  5DPW A;  4TV3 A;  2GBR A;  4AP4 C;  2WP9 B;  1T3Q A;  2V0G A;  3R7Q A;  2MA9 B;  2JWZ A;  1OQQ A;  2FE8 A;  3KH0 A;  4II3 B;  4ZRJ A;  2N9P C;  1YOV B;  2CU1 A;  3QA8 A;  1UBI A;  2PVO D;  1E8Z A;  1P1A A;  4IM3 A;  1YN4 A;  2FCN A;  2IO1 B;  3EGR A;  5G2N A;  1XEE A;  3OG5 A;  2EEL A;  2SEB D;  3AE6 B;  2BQQ A;  1I4G A;  4RNA A;  1YJI A;  1RFK A;  4NZL B;  2W82 A;  3UI3 A;  2D3C A;  1Z5S B;  2GBM A;  3GB1 A;  1TS3 A;  1ZDV A;  4NJ7 A;  3VUX A;  1B9R A;  2J42 A;  3QQ8 B;  1NVI D;  1VD2 A;  2J52 A;  2DZI A;  3TMP B;  2WXF A;  3X0W A;  3MFG A;  3L10 B;  2XEW A;  1Z2M A;  2G45 B;  2UU7 A;  5CTR C;  2VZK D;  2G1E A;  4JPS A;  3KYC D;  1T0S C;  4K1R B;  3ENE A;  3ALB A;  3C19 A;  1WR1 A;  2WU5 B;  4LNO A;  2KDM A;  2GBN A;  2OOB B;  1QF6 A;  3BY4 B;  4NNJ B;  1OEY A;  1WM2 A;  4W9D A;  2GRI A;  2QIE B;  2J0M A;  2NPT A;  1TZO A;  2LGI A;  3U52 E;  4PK1 A;  1C4A A;  3AUL A;  1F9J A;  3H6N A;  2VH1 A;  4FHJ A;  2GLS A;  1XLO A;  2L52 A;  3P4R B;  1JML A;  4BBN F;  2EMT A;  4NY0 A;  5L95 C;  4BFR A;  1V97 A;  1WIA A;  4GGQ A;  3AE5 B;  3RNF C;  1B1Z A;  1M94 A;  1TBE A;  4WWO A;  3BK2 A;  1HA5 A;  4ICU A;  2A5U A;  5IP4 D;  4C80 A;  3N1Z C;  1AAR A;  1MG8 A;  4LJP B;  4Q2J A;  1BUI C;  1D5Z C;  2ZZP B;  5LLI A;  2KN4 A;  2KTR B;  3BVM A;  4BKG A;  2W55 A;  2N7D A;  4D2K A;  2KK8 A;  1MFW A;  1NEK B;  2K39 A;  4ANX A;  5CHF A;  1VCB A;  2JY6 A;  2BKF A;  4BOZ B;  2KX0 A;  1SJE D;  5JHA A;  1GNU A;  2EKI A;  4JQW C;  2GI9 A;  5IAA C;  4RM8 A;  1SGH A;  1I4Q A;  1YN3 A;  3LXF A;  5DPT A;  2C7N B;  2MJE A;  2KKC A;  4PS3 A;  3KW5 B;  4ASW C;  4FJZ A;  3ML9 A;  2PJH A;  5MPO A;  2WXO A;  1WJN A;  1C77 A;  1SJH D;  4K3B A;  4KDL B;  4EZK A;  3DVG Y;  1GG3 A;  2RPQ A;  3PRE A;  3VXW A;  1KRH A;  1KLU D;  4DHZ E;  4WWN A;  1SBB B;  4C7Z A;  2DYM A;  2K9X A;  4MGK E;  3SU8 X;  2LUE A;  2O6V B;  5IN7 A;  2ZNV B;  3RPF C;  1WGY A;  3NJT A;  4IWQ A;  4R3D A;  2ZVO A;  3W5U B;  4AJY B;  1WZ0 A;  3RMK C;  4ZRQ A;  2N0S B;  3B0A A;  3N1X C;  2MBO A;  1J19 A;  2MH7 A;  4HPM B;  3MHS D;  1I4P A;  5AZH A;  3MC9 A;  3UIP B;  4G11 A;  1N60 A;  2WXG A;  1KOT A;  2WXK A;  2JX5 A;  3AED B;  3JW0 X;  4G50 A;  5J17 A;  2K3U A;  2FCQ A;  4LK0 M;  4O1N A;  2KFK B;  3PLV A;  4GDK A;  2MRP A;  3KWL A;  3TBL D;  1N61 A;  4JE3 B;  4A55 A;  4RM9 A;  2PTL A;  4TKN A;  3NHE B;  4KGT A;  3ZTD A;  4IDI A;  2DHZ A;  4YTN B;  3ZGZ A;  2YVC A;  4LDT D;  1FPY A;  3WCQ A;  1XF5 L;  3HVD A;  3FKY A;  3CMM B;  4MT5 A;  1J7A A;  1WMH B;  3RNC C;  1IBX B;  4UDU C;  1SEB D;  4W9H A;  2B3A A;  4P7I A;  3ZDT A;  1CMX B;  2AYO B;  1TJE A;  3APC A;  3MTN B;  4XYC A;  3L0W B;  1FXA A;  1VZ6 A;  2NVU I;  3AV8 A;  3A33 B;  1QQR A;  1TY2 A;  4LDT B;  2J0J A;  2JZ3 B;  1E9M A;  2IDY A;  2HDE A;  1V1P A;  3D32 A;  3Q8C A;  4EKU A;  2N9X A;  2XN9 C;  2DNF A;  2IYD B;  2OJR A;  2R2Q A;  4WJQ A;  2K8B A;  2DAJ A;  5L83 A;  2J4X A;  3QAQ A;  1FCC C;  2KFJ A;  1V80 A;  1XLN A;  3AU5 A;  2KZR A;  5IOI A;  4A3O A;  3Q6B A;  4DDG D;  1JRU A;  4RFB A;  4IWP A;  2EMS A;  1PGB A;  4WAF A;  2IZV B;  3W2D A;  1XT9 B;  4JWS C;  4P16 A;  4KV2 A;  1P3Q U;  4RF1 A;  2OJW A;  4MDK E;  3K9P B;  1E7U A;  5DPS A;  3AE3 B;  1KTK A;  2N9L A;  3Q8B A;  5E6J A;  3ZNH B;  3PHX B;  1JRO A;  1L4Z B;  1K8R B;  2O6V A;  2KWU B;  2DWQ A;  2IGH A;  1YMH E;  1V86 A;  1TKG A;  2LMC A;  2AQ3 B;  1AWD A;  4PT5 A;  3NS1 A;  4K81 A;  1WWT A;  2D2Q A;  3ZJV A;  3LDZ E;  1EF1 A;  3KQ4 A;  4GDK B;  3ZVV A;  3HM3 A;  3M3J A;  4C00 A;  1C79 A;  2DBY A;  1N63 A;  1V81 A;  3BZD B;  3P4S B;  3RZW C;  1Q5W B;  4WJO A;  1GB1 A;  2QEJ C;  1Q1O A;  3AN1 A;  1V9J A;  1T0Y A;  3Q2A C;  3DBR I;  4RGO S;  4K3C A;  2WU2 B;  3L54 A;  2V3S A;  1JRP A;  2L1A A;  4RCO A;  3W9C B;  3KWV A;  1U4A A;  2LGY A;  5HFY A;  1GUA B;  1WGH A;  4CQN A;  4NAW A;  2G3Q B;  3O13 A;  1DOY A;  3BK1 A;  2KMC A;  2Y5P A;  3MJ5 A;  2JU6 X;  3VTU A;  3BYY B;  1NYR A;  1J7C A;  2KWC A;  4HPP A;  2I38 A;  2D5G A;  2CJO A;  2RPV A;  4K7S A;  4A20 A;  4AQ7 A;  3PLU A;  3Q8A A;  1GPX A;  2JUO A;  2W3R A;  2M8S A;  2JT4 B;  3WAO A;  2L7R A;  2LXA A;  3MC8 A;  1G6J A;  1C9F A;  5HG2 A;  4WJP A;  1IBX A;  3Q14 C;  2HD5 B;  3U2S C;  1QOA A;  1TKE A;  1UUP A;  4GLS C;  1YJJ A;  3AU4 A;  4K7U A;  5C23 A;  4NQK E;  4HVB A;  2JRH A;  1PFD A;  1WXS A;  1MJD A;  3V6C B;  1WXA A;  1PQS A;  4LNF A;  4YTP B;  2G4D B;  4KDI C;  2QMT A;  2KN5 A;  1E7P B;  2Y5B B;  3PZ8 A;  1E5W A;  2MBQ A;  2D3G A;  2XBB C;  1NYQ A;  4ANV A;  5BMG A;  5IO9 A;  2AWT A;  1FFV A;  1FNW A;  4BAX A;  4F7Z A;  4KSL C;  2JXT A;  1I35 A;  1R4N I;  3WAM A;  4BKS A;  1V5T A;  1ZDX A;  2MP2 A;  2WYQ A;  1N62 A;  4NAM A;  1I7H A;  3U7Z A;  2KNB A;  4MGY E;  4NJ6 A;  2C9W B;  4BKT A;  1E8X A;  5HHD G;  2HTM E;  1H4R A;  3PRP B;  4HK2 A;  4B0E A;  4MSM B;  5BO4 B;  3NY5 A;  2AL3 A;  1DGJ A;  1XD3 B;  2XK5 A;  2C5L C;  3IG3 A;  1WYW B;  4A8X C;  5FKA C;  5T8I A;  2R61 A;  1FEH A;  3CSF A;  1GB4 A;  5IA7 A;  3GS2 A;  3P63 A;  4KGR A;  2JF5 A;  1CZP A;  2ZNV C;  3B2G A;  1ENF A;  4RF0 A;  2MEK A;  2BYF A;  3Q8F A;  5GXG B;  5HI1 A;  3WA0 A;  2K1F A;  1FNV A;  1UEL A;  1DOX A;  1ZE3 D;  4E74 A;  5I4D A;  1L0V B;  2JYE A;  2BB6 A;  4ZYN A;  2WXI A;  4TQ0 A;  1UNS A;  2ZCB A;  1SE9 A;  2MCN B;  1EF5 A;  2ICI A;  4N9F 4;  3KYD D;  2WXQ A;  4ZYS A;  5BMI A;  3QX1 A;  3ZJU A;  2NTT A;  2KD0 A;  3WAN A;  1WX8 A;  4W9G A;  2D07 B;  1FIQ A;  4M8N A;  5C3J B;  1BML C;  3VH3 B;  1KJT A;  3GOE A;  1MHX A;  2ASQ A;  3PO0 A;  3OLM D;  1R7S A;  1EWY C;  5EE9 A;  3V05 A;  5LXH A;  2M1M A;  1PDX A;  3DBR B;  3I63 C;  1F2R C;  5CX3 A;  2ONQ A;  2CHW A;  1C4C A;  1M4V A;  5C2T B;  2PEA A;  3FIL B;  4B9K A;  4PS7 A;  2HJ1 A;  5E6O A;  1MG4 A;  5G5G A;  3AH7 A;  3UQA A;  2CS4 A;  3T9L A;  3WAL A;  3HK0 A;  1FRD A;  1NI3 A;  2BT6 A;  3PPA A;  2V4I B;  1V1P B;  3SFE B;  3KLS X;  4OZC A;  5JXV A;  1Y8R C;  4OVU A;  1F0Z A;  1VR9 A;  2LXC A;  3QJZ A;  3W1S C;  1RFA A;  2LHD A;  3APF A;  3E56 A;  2W54 A;  4XX5 A;  3AM9 A;  2TSS A;  4MSQ B;  4C56 C;  1ET9 A;  3AE7 B;  2KAN A;  2RDB C;  3TIX A;  5JHB A;  3V62 A;  1UWX A;  1WGG A;  3UIN B;  4MEM A;  4DWF A;  3VAW A;  3R66 C;  2XNA C;  5TR5 A;  2NPT B;  4W9J A;  4DXA B;  4EZL A;  3RNG C;  2JWU A;  3A9J B;  1YX6 B;  3BWU D;  3W5V B;  1RAX A;  1JW9 D;  1UGJ A;  2Z8L A;  2MQJ A;  2WDT B;  3DBL I;  3MC0 B;  1WYG A;  5AEK B;  1ROE A;  4RMA A;  3IHP C;  1QT9 A;  1D4B A;  1FMA D;  3T3N A;  3P42 A;  3DHG C;  3TL5 A;  3ZYY X;  2I2Y A;  1L0Y B;  2BYE A;  4X57 B;  2NMQ A;  3AEE B;  1WJU A;  2LUM A;  2OED A;  3LJ3 A;  1KH0 A;  4I6P A;  4C4V A;  1WJ4 A;  4FA6 A;  4FXC A;  3R2I A;  1P98 A;  1QLB B;  1TIF A;  1CK1 A;  2ZVN A;  1L5P A;  2LGS A;  1UGM A;  2WXP A;  1V5O A;  3P4Q B;  4ICV A;  3ZDM C;  3EFC A;  4KIK A;  1HEZ E;  4N6E B;  3M95 A;  1QIL A;  3ZO5 B;  3VDZ A;  4MGI E;  3U8Z A;  1UF0 A;  3PSE B;  2KJH B;  5EE1 A;  3ZW3 A;  2DYB A;  1STE A;  2KYW A;  1D3Z A;  2NBV B;  5AUK A;  3ZXR A;  4W9F A;  2INC C;  4LNI A;  4REZ A;  2QJL A;  4EOY A;  2FUH B;  1OFF A;  4C4V B;  1WSP A;  3BII D;  5FK9 C;  4FJV B;  2M56 B;  2ZPY A;  5DCN A;  3QIJ A;  2FCS A;  2WXN A;  1AYF A;  3E9S A;  1SE3 A;  1WX9 A;  5D3D A;  3L16 A;  3N32 A;  1P0R A;  4ARI A;  3DBH B;  1IGD A;  4W9I A;  2D10 A;  1FXT B;  4PS8 A;  4A9A A;  4IG7 B;  1WJ6 A;  4XGA B;  2V4L A;  1NEN B;  3I57 A;  4XDD A;  5IKC M;  2PIA A;  4HEA 1;  2FBW B;  1KF6 B;  3W1Y A;  3TCA A;  3RNB C;  3KUC B;  2LJI A;  5DPR A;  3ZLZ A;  1ZW7 A;  1ZXH A;  3W1S A;  2IGG A;  1F2R I;  4EZJ A;  1YD8 U;  3UF8 A;  3VUY A;  4YSY B;  3O65 B;  2I1J A;  3H7P B;  1NI2 A;  1ISN A;  1WMH A;  4KGS A;  2IND C;  1HQR D;  2M17 A;  4AWJ A;  3DWG C;  2JQR B;  1EU4 A;  1E7V A;  2FNJ B;  3CST A;  1J0G A;  3VVW B;  3DHI C;  4LCD E;  1OTR B;  2N7J A;  3EEC A;  1EM7 A;  2WDR B;  3R3M A;  3BVG A;  5J18 A;  2KQS A;  1PGA A;  1K50 A;  4YSX B;  1FCL A;  4MM3 A;  3AMZ A;  1OEY J;  4EEW A;  2MX2 A;  1QKZ A;  4DHJ B;  4XC2 A;  3FIL A;  3Q3F A;  1WGD A;  1AN8 A;  2O6V D;  4M8M A;  1GJZ A;  2BB5 A;  5GMV A;  3TEW A;  4OVZ A;  3U7D A;  4LLG M;  2IY0 B;  3L08 A;  3MHZ A;  3VR9 B;  3OJ4 B;  2QDF A;  3KUZ A;  4FUL A;  1X1M A;  1XO3 A;  3OWE B;  4MM3 B;  2AL6 A;  3ZNI D;  4WAA A;  5AZF A;  2KQ4 X;  4GMV A;  4BBN C;  2QHO A;  2K25 A;  2HE7 A;  2HJ8 A;  2ZEQ A;  2JPH A;  4YL8 A;  3PT2 B;  2AQ1 B;  4M0W A;  3H1U A;  3DQV A;  2LJ5 A;  3JSV A;  4DQO C;  3UQB A;  1IGC A;  1Y56 A;  2LVO A;  2L00 B;  1TZ1 A;  2K22 A;  4AJW A;  3H9D A;  2GBJ A;  1AW7 A;  2JXX A;  5H8Y E;  2M0A A;  1OGW A;  2RDG A;  4KKI A;  1VZ8 A;  4HCN B;  3V3X A;  2IO2 B;  1T0R C;  2Q5W D;  2IJ0 A;  2Z59 B;  2LEK A;  4JX1 C;  1T5X D;  2B76 B;  1SIF A;  2LVP A;  4HXD A;  2ACZ B;  1L0X B;  1NDD A;  2FUG 1;  2V9H A;  1LFD A;  1YX5 B;  1WX7 A;  4MJS B;  1MHH E;  2DLB A;  3RNA C;  1TGZ B;  4DXF A;  1QOB A;  3HRD D;  1LXD A;  4E3C A;  1E6E B;  5AUI A;  4TMA B;  4BZA A;  3A1Q B;  4DXG A;  2FCM A;  3PRM B;  1V8C A;  2RSU A;  1L7Y A;  3EHV A;  3IT6 B;  5C1Z A;  1L4D B;  3IVF A;  1WE6 A;  3I3T B;  2XK5 B;  1PYW D;  1LQB A;  4OW0 A;  1T0Q C;  2QC8 A;  1YN5 A;  2KJR A;  2L3Z A;  2REX A;  1JWA D;  4N58 A;  4IM0 A;  4DDI D;  3JSV B;  4ITK A;  1K53 A;  2YEP B;  1XCQ L;  4NAW B;  1RWS A;  2LGD A;  3NZS A;  4HJG E;  3NVY A;  4II2 B;  3VH4 B;  1ACC A;  1EO6 A;  4DHJ D;  3HM6 X;  4L23 A;  4FLH A;  3LB8 C;  4HKZ E;  1F1H A;  3ZTC A;  3RN9 C;  1E0Z A;  3NUH B;  3KVF B;  4TQ1 A;  3Q69 A;  3VQI A;  1SB3 C;  2KDE B;  5D94 A;  3ZIM A;  4DK5 A;  3WAP A;  1FM0 D;  1N6Z A;  2JZP A;  3EA6 A;  3RUL A;  4ZOH C;  3ZJT A;  4A3P A;  3PHW B;  2JSV X;  1Q10 A;  3C8Y A;  4IW0 A;  4MJS A;  3PS6 A;  1ZXI A;  1WRI A;  2KOX A;  3EC8 A;  3DBS A;  2KX3 A;  2FID A;  4FJY A;  4IM2 A;  3ZRF A;  2KFK A;  2RMM A;  5HKH A;  4AS1 A;  5EE3 A;  1ESF A;  4ARC A;  2IBI B;  3DDC B;  4H2A A;  4KKJ A;  2MLB A;  3BYT B;  2Z0E B;  3L13 A;  3NS8 A;  4A6Q A;  5KHQ A;  2MHJ A;  1YQ4 B;  3FAH A;  3VR8 B;  2LFI A;  4KX6 B;  1HTQ A;  4ZHP A;  4G3X B;  4WH4 A;  3T3O A;  1YNT E;  1JWB D;  2RGF A;  3GE8 C;  2KTF A;  4HKQ A;  3DCG A;  1TS5 A;  2DZJ A;  3TSS A;  5D2M B;  1BXT A;  2KXJ A;  4BOS C;  5TSS A;  1WF9 A;  1K51 A;  2KMA A;  1UH6 A;  3DWM A;  4KZ0 A;  4NQL B;  2RDH A;  3KUD B;  4LTU A;  2BF8 B;  2YEP F;  1LGR A;  4ZRK A;  1XLP A;  3B2F A;  1JWM D;  1XCT L;  1J7B A;  3AE4 B;  3EFU A;  3TEX A;  2Z0D B;  5G5H A;  3H7P A;  4FBJ B;  2GBK A;  1E8Y A;  1HZ5 A;  2K8H A;  3FC4 A;  4W9C A;  2SAK A;  3AEG B;  2WHI A;  4HJK A;  1SE4 A;  2V3P A;  3R8B A;  2LRU A;  2IPK D;  4FHK A;  3RUI B;  2DYO A;  3QC8 B;  1WH3 A;  2KAJ A;  1VJK A;  3BIN A;  3PRZ A;  3HUI A;  3AEF B;  1QZE A;  1VDV A;  2M0X A;  1IYF A;  2KLG A;  4GU2 A;  3TEY A;  2WX1 A;  5BMH A;  3H7S A;  3V60 A;  1C3T A;  1H8C A;  2N4F A;  3NZU A;  3ZUN A;  3ETR A;  3B08 A;  4E71 A;  2IO3 B;  1T6B X;  2V3N A;  5E6P A;  2H88 B;  1P7E A;  1N5W A;  2LHE A;  2WWZ A;  2KDB A;  3Q3N C;  3X23 A;  4MEL A;  3Q3M C;  1WE7 A;  3DHH C;  2E3T A;  3ZKJ C;  1LM8 B;  4MGZ E;  2BVC A;  4F8C B;  4DBG A;  3MP9 A;  1WXV A;  2DZK A;  2KC1 A;  4HDO A;  1YQ3 B;  2KJ6 A;  2MBB B;  4J3O D;  2L8J A;  1YIW A;  2L0T A;  1VRA B;  3AI5 A;  1P7F A;  1EUV B;  4HLE A;  4ZHO A;  2BPS A;  1TS2 A;  1UD7 A;  4GSW A;  3VRA B;  2PLP A;  1ET6 A;  2MBE A;  2MBH A;  2W3S A;  4GB9 A;  3N20 C;  2J0K A;  4WWM A;  4YXD B;  2BWE S;  5JH5 C;  2WXR A;  2M4N A;  2BS4 B;  4ACF A;  3ONS A;  4M00 A;  4DHZ B;  2NCN A;  1JCK B;  3UGB B;  2D3B A;  1OQR A;  1A70 A;  1RLF A;  3SR6 A;  1JAL A;  2C60 A;  4L1B A;  2N7E A;  2OHF A;  2WDQ B;  1ZPS A;  1DOI A;  4AUQ C;  4I6L B;  4HWI B;  4MH8 A;  4S17 A;  2WLB A;  2JRI B;  1HXY D;  3AXC A;  2NBU A;  4KIK B;  1FXI A;  2X8X X;  3TJP A;  4JLC A;  4WJN A;  2BYT A;  4JIO U;  3RYT A;  3S2A A;  3R7R A;  2MJ3 A;  2PE9 A;  5EDS A;  4KSK C;  4WQM A;  5BYS A;  2BBC A;  1ZUD 2;  1HE8 A;  3RNE C;  4GDL B;  2UYZ B;  2KC2 A;  5G55 A;  3IAS 1;  4AOF A;  4W9L A;  2NS5 A;  1FNU A;  3WIM A;  1Q0W B;  1I42 A;  1XLQ A;  1WZ3 A;  2IY1 B;  2LGX A;  3LYY A;  2J53 A;  4P1C C;  5E6N A;  1V49 A;  2L76 A;  4IUM B;  2QIL A;  4HRO A;  1KLG D;  2RD0 A;  1RM6 C;  2DEN B;  2PVG C;  1PGX A;  4YWG G;  1JQ4 A;  1NBF C;  2AEH A;  4NJC A;  4W9K A;  1PUT A;  4HPL B;  4NPN A;  3PZD A;  2H89 B;  1TY0 A;  3NRZ A;  1K52 A;  4M0W B;  3PGE A;  3MJW A;  2VRR B;  1BT0 A;  3IFW B;  3RT3 B;  1DYQ A;  1I4H A;  4OHJ A;  3VUW A;  2G4S A;  2BW2 A;  4XWW A;  3RZF A;  4B95 A;  1L2N A;  2KWV B;  4KVG B;  3Q3O C;  2ZJD A;  3NOB A;  2MW5 A;  3M62 B;  5D7G A;  3TEZ A;  2C7H A;  2UWQ A;  3IAM 1;  1KM7 A;  3A9K A;  3CF6 E;  2NR2 A;  3VHT C;  1TYG B;  1L6U A;  2MWS B;  1V2Y A;  4CYE A;  2Y3A A;  1ZOY B;  1J8C A;  3OJ3 A;  4JGH B;  2N9E B;  1GC7 A;  4OZB A;  4ZDV A;  4US8 A;  4LNN A;  4BKS D;  4GXB A;  2CU3 A;  3ZXV A;  2WXJ A;  2PMV A;  4WWP A;  3V61 A;  1UBQ A;  2KWD A;  2CJN A;  2M19 A;  3B9J A;  3JVZ X;  3ZNG C;  2O2V A;  1IPG A;  3DBH I;  3DOW A;  3P2B A;  2QCZ A;  1LO5 D;  4GDL A;  2MJD A;  1TKY A;  4MH0 E;  4RGM A;  4BVU C;  3L4P A;  2ZW1 A;  4MAC A;  2PE6 B; 
#chains in the Genus database with same CATH homology
 2A5U A;  2ZNV C;  1IP9 A;  5FR6 A;  2BYF A;  1AAR A;  1MG8 A;  4LJP B;  5KHO A;  4ANU A;  5C1Z A;  3IVF A;  3UIO B;  2PPH A;  2EKE C;  3WA0 A;  1WE6 A;  4EFO A;  2K1F A;  2ZZP B;  2L05 A;  1UEL A;  5LLI A;  2KTR B;  3I3T B;  2XK5 B;  4BKG A;  2N7D A;  1LQB A;  4E74 A;  3PV1 A;  2KK8 A;  4IC7 B;  4EUT A;  2WX0 A;  2K39 A;  4ANX A;  4FAD A;  5CHF A;  1VCB A;  2CHZ A;  3IBE A;  3VFK A;  3DVN V;  4ZYN A;  2KJR A;  2JY6 A;  2BKF A;  2L3Z A;  2REX A;  4BOZ B;  2KX0 A;  4IM0 A;  4TQ0 A;  3APD A;  5JHA A;  4CO7 A;  2ZCB A;  4DDI D;  1SE9 A;  3JSV B;  3DVG X;  2MCN B;  1GNU A;  4JQW C;  1EF5 A;  4N9F 4;  3VTW A;  3KYD D;  2MSE D;  4NAW B;  5IAA C;  4RM8 A;  3U30 A;  1SGH A;  1WI0 A;  2LGD A;  3NZS A;  5DPT A;  4II2 B;  3VH4 B;  2C7N B;  3QX1 A;  4K7W A;  1EO6 A;  1OQY A;  4DHJ D;  2CKH B;  2KD0 A;  2KKC A;  3HM6 X;  3KW5 B;  4FLH A;  4PS3 A;  3WAN A;  4ASW C;  4J6I A;  1WXM A;  4JL9 A;  4FJZ A;  1WX8 A;  3ML9 A;  2PJH A;  4W9G A;  2KQ7 A;  1UZX B;  2JZZ A;  2D07 B;  3ZTC A;  2CHX A;  4M8N A;  1WJN A;  2HTH A;  3VH3 B;  1KJT A;  3QWZ B;  3GOE A;  2N1V A;  2ASQ A;  4KDL B;  3OLM D;  4EZK A;  3DVG Y;  2A4Z A;  1GG3 A;  3KVF B;  4TQ1 A;  3VQI A;  5LXH A;  2L0F A;  3SHQ A;  2M1M A;  3ZNZ B;  2RPQ A;  3PRE A;  2KDE B;  5D94 A;  3ZIM A;  3VXW A;  5CX3 A;  1S3S G;  3C0R B;  2CHW A;  2LRW A;  3DVN U;  4DK5 A;  1ZGU B;  3WAP A;  3A1Q A;  3QK0 A;  2N1W A;  3QCA A;  4WWN A;  2K8C A;  3RUL A;  4DHZ E;  2D11 A;  1C1Y B;  2DYM A;  4A3P A;  2PEA A;  3PHW B;  4MGK E;  3SU8 X;  1GC6 A;  4B6W A;  4IW0 A;  2LUE A;  4MJS A;  3PS6 A;  2O6V B;  4PS7 A;  5E6O A;  4B9K A;  2ZNV B;  3UQA A;  2KOX A;  3EC8 A;  1WGY A;  2KX3 A;  2CS4 A;  3DBS A;  4IWQ A;  3T9L A;  2FID A;  3WAL A;  4FJY A;  3VTV A;  2ZVO A;  4IM2 A;  2KFK A;  3ZRF A;  5HKH A;  3HK0 A;  2KDI A;  4AJY B;  2YLM A;  2IBI B;  3PPA A;  3DDC B;  1WZ0 A;  2MLB A;  2Z0E B;  3L13 A;  3HIZ A;  1WM3 A;  1Y8R C;  3B0A A;  2DAF A;  3NS8 A;  2LXC A;  2MBO A;  4OVU A;  3QJZ A;  3V6E B;  1J19 A;  5KHQ A;  3W1S C;  4G0N B;  4HPM B;  3MHS D;  1RFA A;  1WRD B;  5AZH A;  3APF A;  2DZM A;  3UIP B;  1ZKH A;  4G3X B;  2JVC A;  4G11 A;  2I1K A;  2MP2 B;  2KLC A;  2RGF A;  1KOT A;  2LVQ A;  2KVR A;  4XX5 A;  2KTF A;  4GOC A;  3T8M A;  3JW0 X;  3DCG A;  4MSQ B;  4W9E A;  4G50 A;  2DZJ A;  4PS8 A;  5J17 A;  3A9K B;  2FCQ A;  3M63 B;  2KAN A;  3TIX A;  5D2M B;  2KFK B;  5JHB A;  3V62 A;  3B1L X;  1WGG A;  2CR5 A;  3UIN B;  4MEM A;  3OAW A;  4OVV A;  2KXJ A;  4BOS C;  3VAW A;  4DWF A;  3PLV A;  3R66 C;  1WF9 A;  4GDK A;  2MRP A;  3TBL D;  5TR5 A;  2KMA A;  1UH6 A;  2NPT B;  3A4R A;  4KZ0 A;  3N30 A;  4W9J A;  4DXA B;  4NQL B;  4RM9 A;  4EZL A;  3KUD B;  4TKN A;  2LWP A;  3A9J B;  1YX6 B;  2BF8 B;  3NHE B;  3QAR A;  4ZRK A;  3ZTD A;  2C7M B;  1E8W A;  3JYU A;  1RAX A;  1A5R A;  1E90 A;  2BYV E;  2DHZ A;  3A9J A;  3K9O B;  4KZC A;  2MQJ A;  2YVC A;  4LDT D;  3EFU A;  1WFY A;  2FIF A;  2WDT B;  2Z0D B;  3H7P A;  3DBL I;  5AEK B;  4FBJ B;  3CMM B;  4XZ4 A;  2GMI C;  1WMH B;  2GBK A;  1E8Y A;  3IHP C;  4RMA A;  2K8H A;  4W9C A;  2LAS A;  4W9H A;  2B3A A;  4HJK A;  2LRU A;  5LXI B;  4P7I A;  3ZDT A;  3TL5 A;  1CMX B;  2AYO B;  2ZPN A;  3APC A;  3MTN B;  4FHK A;  3L0W B;  3RUI B;  2DYO A;  4TUU A;  2K6Q A;  3QC8 B;  2NVU I;  4I6N B;  2BYE A;  1WH3 A;  3A33 B;  4X57 B;  1WJU A;  3LJ3 A;  2DX5 B;  4GN1 A;  4I6P A;  4F1S A;  4LDT B;  1WJ4 A;  4FA6 A;  3A4S C;  1RRB A;  3BIN A;  2J0J A;  2JZ3 B;  1P98 A;  3PRZ A;  1QZE A;  2ZVN A;  3L17 A;  3D32 A;  1UGM A;  2M0X A;  1V5O A;  4WQO B;  4HDQ A;  4ICV A;  3ZDM C;  4EKU A;  1IYF A;  4FN2 A;  4IWO A;  2KLG A;  4GU2 A;  2N9X A;  2WX1 A;  4ANW A;  2IYD B;  1R4M I;  2IO0 B;  2OJR A;  4KIK A;  2R2Q A;  3H7S A;  3M95 A;  4WJQ A;  2K8B A;  3ZO5 B;  5J2R A;  3V60 A;  2KHW B;  1C3T A;  3VDZ A;  2DAJ A;  1H8C A;  2N4F A;  3PVL A;  4MGI E;  5L83 A;  3NZU A;  3QAQ A;  3PSE B;  3U8Z A;  2KJH B;  2KFJ A;  3ZUN A;  5CHW A;  3B08 A;  3ZW3 A;  4E71 A;  1V80 A;  2DYB A;  2IO3 B;  5JZE B;  5AZG A;  1D3Z A;  5CHV C;  5E6P A;  3AU5 A;  2NBV B;  3ML8 A;  4W9F A;  2KZR A;  4A3O A;  2WWZ A;  2KDB A;  4DDG D;  1JRU A;  3X23 A;  4EOY A;  4MEL A;  2RR9 A;  1WE7 A;  2FUH B;  4IWP A;  2BWF A;  2LZ6 A;  2EMS A;  2W9N A;  2IZV B;  3RD2 A;  2PE6 B;  4GIV A;  4FJV B;  1WR6 E;  1XT9 B;  3ZKJ C;  2KDF B;  1LM8 B;  4MGZ E;  4KV2 A;  1P3Q U;  2ZPY A;  4MDK E;  5DCN A;  4F8C B;  3QIJ A;  2FCS A;  4DBG A;  3K9P B;  1E7U A;  3ECI A;  5DPS A;  1WX9 A;  1WXV A;  2DZK A;  2KC1 A;  3L16 A;  4HDO A;  3N32 A;  1P0R A;  3ZNH B;  3PHX B;  4W9I A;  2KJ6 A;  2D10 A;  1FXT B;  4HCP B;  1K8R B;  2NBW B;  2O6V A;  3N3K B;  2KWU B;  4IG7 B;  2MBB B;  4LJO B;  1WJ6 A;  3HHM A;  2L8J A;  2V4L A;  1V86 A;  4ZRI A;  3SDL C;  1YIW A;  2L0T A;  4K81 A;  1WGR A;  3AI5 A;  1S1Q B;  3ZRC A;  2D2Q A;  1EUV B;  3SD5 A;  3W1Y A;  3X0W A;  4HLE A;  3TCA A;  3LDZ E;  1EF1 A;  2BPS A;  3KUC B;  1P9D U;  4GDK B;  3HM3 A;  3M3J A;  3ZVV A;  5DPR A;  3ZLZ A;  1ZW7 A;  3W1S A;  4F7Z A;  2LI5 A;  1V81 A;  4EZJ A;  1YD8 U;  3UF8 A;  1UD7 A;  4GSW A;  1V6E A;  3RZW C;  1Q5W B;  4WJO A;  3VUY A;  2GOW A;  1TTN A;  2MBE A;  2MBH A;  4GB9 A;  3GZN I;  1YQB A;  1Q1O A;  2J0K A;  2FAZ A;  3O65 B;  1V9J A;  1T0Y A;  2KTR A;  3DBR I;  2BWE S;  2I1J A;  2J7Q B;  5JH5 C;  3H7P B;  2M4N A;  4PYU A;  1NI2 A;  3QHT A;  2R2O A;  3ONS A;  3L54 A;  4DHZ B;  2V3S A;  2NCN A;  2V1Y A;  1ISN A;  1WMH A;  3UGB B;  2ZCC A;  1KLV A;  1WY8 A;  2M17 A;  2O2V B;  4AWJ A;  1RLF A;  4CHK A;  2KO3 A;  2C60 A;  1E7V A;  3PTF C;  1U4A A;  2LGY A;  1GUA B;  1WGH A;  2FNJ B;  4NAW A;  2G3Q B;  3CST A;  1J0G A;  2N7E A;  5D6J B;  3VVW B;  4LCD E;  4AUQ C;  4I6L B;  1OTR B;  4PYZ A;  4HWI B;  4URK A;  2KMC A;  3Q3J A;  1XQQ A;  2JRI B;  3AXC A;  3EEC A;  2NBU A;  3VTU A;  4KIK B;  3R3M A;  2BGF A;  5J18 A;  2KQS A;  2KWC A;  2BKR B;  2K6D B;  3TJP A;  4JLC A;  4MM3 A;  4WJN A;  4JIO U;  3RYT A;  1OEY J;  3S2A A;  3R7R A;  4EEW A;  2LD9 A;  2MX2 A;  4K7S A;  2PE9 A;  4A20 A;  4DHJ B;  5EDS A;  4KSK C;  3RCZ A;  4XC2 A;  3DPD A;  3PLU A;  1YJ1 A;  2JUO A;  3Q3F A;  1WGD A;  2O6V D;  1HE8 A;  4M8M A;  5DPW A;  1GJZ A;  4GDL B;  2UYZ B;  2M8S A;  2GBR A;  2KC2 A;  2JT4 B;  4TV3 A;  5GMV A;  5G55 A;  3WAO A;  4W9L A;  4AP4 C;  2L7R A;  2LXA A;  4AOF A;  2NS5 A;  3WIM A;  1Q0W B;  1I42 A;  3R7Q A;  1WZ3 A;  2MA9 B;  2JWZ A;  3U7D A;  3KH0 A;  1G6J A;  2IY0 B;  2IY1 B;  4II3 B;  2LGX A;  4WJP A;  4ZRJ A;  2N9P C;  5E6N A;  2CU1 A;  1V49 A;  2HD5 B;  1UBI A;  2L76 A;  3L08 A;  3QA8 A;  4IUM B;  1E8Z A;  1P1A A;  2RD0 A;  4IM3 A;  2DEN B;  3OJ4 B;  3KUZ A;  1X1M A;  4FUL A;  2FCN A;  2IO1 B;  1NBF C;  2AEH A;  2AL6 A;  3AU4 A;  4K7U A;  4WAA A;  5C23 A;  3ZNI D;  5AZF A;  4W9K A;  4NQK E;  5G2N A;  4GMV A;  4HPL B;  4HVB A;  4NPN A;  2JRH A;  3PZD A;  4BBN C;  1WXS A;  3V6C B;  4M0W B;  3PGE A;  1Z5S B;  2GBM A;  1WXA A;  2QHO A;  3MJW A;  1PQS A;  2HE7 A;  2HJ8 A;  2K25 A;  2VRR B;  2ZEQ A;  4NJ7 A;  1BT0 A;  2G4D B;  2JPH A;  4KDI C;  4YL8 A;  3PT2 B;  2KN5 A;  3IFW B;  3VUX A;  2Y5B B;  3H1U A;  1E5W A;  3QQ8 B;  3DQV A;  2MBQ A;  2LJ5 A;  3JSV A;  3RT3 B;  3UQB A;  2D3G A;  3VUW A;  1VD2 A;  2XBB C;  1L7Y A;  2G4S A;  2DZI A;  4ANV A;  2LVO A;  3TMP B;  2L00 B;  3RZF A;  2AWT A;  4B95 A;  1L2N A;  2KWV B;  1TZ1 A;  4KVG B;  2ZJD A;  3L10 B;  4KSL C;  2XEW A;  2MW5 A;  3M62 B;  1R4N I;  1Z2M A;  2G45 B;  3NOB A;  5D7G A;  4AJW A;  1I35 A;  3H9D A;  2C7H A;  2GBJ A;  2UWQ A;  5CTR C;  3WAM A;  4BKS A;  2JXX A;  1KM7 A;  1V5T A;  2MP2 A;  2WYQ A;  3A9K A;  3KYC D;  4K1R B;  3ENE A;  3CF6 E;  3ALB A;  2NR2 A;  2KNB A;  3VHT C;  1WR1 A;  4MGY E;  1OGW A;  4NJ6 A;  4HCN B;  2OOB B;  2GBN A;  2IO2 B;  2MWS B;  2C9W B;  4BKT A;  1E8X A;  3BY4 B;  1V2Y A;  4NNJ B;  4CYE A;  1OEY A;  1J8C A;  3OJ3 A;  2Z59 B;  4JGH B;  1H4R A;  1WM2 A;  2N9E B;  1GC7 A;  3PRP B;  4HK2 A;  4W9D A;  4ZDV A;  1SIF A;  2LVP A;  4HXD A;  2J0M A;  4BKS D;  4MSM B;  1NDD A;  5BO4 B;  2NPT A;  4GXB A;  3NY5 A;  1LFD A;  1YX5 B;  1WX7 A;  4MJS B;  2AL3 A;  3AUL A;  1XD3 B;  1F9J A;  3H6N A;  1TGZ B;  4WWP A;  3V61 A;  2XK5 A;  1UBQ A;  2C5L C;  4FHJ A;  3IG3 A;  1WYW B;  3JVZ X;  4BBN F;  1LXD A;  3ZNG C;  2EMT A;  2O2V A;  1IPG A;  4E3C A;  4NY0 A;  3DBH I;  3DOW A;  3P2B A;  5L95 C;  4BFR A;  1WIA A;  4GDL A;  4MH0 E;  3A1Q B;  4BVU C;  4GGQ A;  3CSF A;  5IA7 A;  2FCM A;  3PRM B;  1TBE A;  1M94 A;  4WWO A;  2RSU A;  4ICU A;  2JF5 A;  3EHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...