2KK8A

Nmr solution structure of a putative uncharacterized protein obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3449a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AT4g05270
publication title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kk8A01
1KM7A 3QX1A 1T0YA 1NI2A 3JYUA 1WJNA 4I6LB 1WRDB 1L2NA 4JQWC 3VAWA 3N3KB 2N1WA 4G0NB 2NR2A 4IM0A 1WX9A 3WAPA 1KJTA 1SGHA 3CF6E 1WX7A 2CHXA 3NOBA 2K8CA 2DZIA 2D07B 2JY6A 1R4NI 3ZIMA 2K8HA 3EECA 1SIFA 3JW0X 2K6QA 3U30A 2D3GA 3ZNGC 2KJHB 2JXXA 1V49A 3L10B 1UH6A 2M8SA 4RMAA 1IP9A 4GB9A 1WMHA 2LXCA 4IUMB 1V2YA 2MBHA 3JVZX 4W9CA 4IWOA 2I1JA 1L7YA 2C7HA 2D2QA 3A9KB 2KOXA 1TTNA 3NY5A 2MP2B 4W9JA 4IM3A 1WXSA 2FNJB 2MBQA 2MBBB 4FJZA 2M1MA 4HPLB 2N1VA 3VUWA 1TBEA 3TIXA 2MW5A 2V1YA 2KXJA 3S2AA 2LD9A 3WALA 2WWZA 4FHJA 1H4RA 2J0JA 5CX3A 1Y8RC 3L13A 2G45B 5JHBA 4BKGA 1AARA 3OAWA 2DZMA 3PTFC 3H6NA 3W1YA 2LXAA 1C1YB 3Q3JA 1LXDA 3QHTA 3ZVVA 4KSLC 3I3TB 1MG8A 2KVRA 3HIZA 3KVFB 1WGYA 4BVUC 2PEAA 2M0XA 2XEWA 3ECIA 3NHEB 4ICUA 5DPSA 2IO2B 2CKHB 1KLVA 1V86A 1J8CA 2HTHA 4EZKA 3KYDD 3JSVA 5J18A 2R2OA 4GIVA 4MELA 1WY8A 2Z0EB 4ZYNA 4ZRJA 1GG3A 2LRWA 4EOYA 1H8CA 4PYZA 4KDIC 3ZNID 1Z5SB 1E8WA 4YL8A 5AZFA 2IZVB 3UIOB 5EDSA 2LVQA 4W9FA 2BWFA 1S3SG 2DYBA 2KWCA 3AULA 4E74A 4B6WA 5D6JB 4TKNA 2L3ZA 4A3OA 3VH3B 4KZCA 3QWZB 2QHOA 3RUIB 3PPAA 4KDLB 2KDFB 4PS8A 1LQBA 4FHKA 3X23A 4EZJA 2BYVE 1P3QU 2WDTB 3DVGY 3K9PB 2FIFA 4KIKA 2V3SA 4HWIB 3U8ZA 1I42A 5E6OA 4JGHB 3BY4B 2JUOA 1EF5A 4M0WB 5DPTA 1WXMA 2O2VA 5JHAA 2UWQA 1UBQA 1WXAA 1J19A 1WGGA 4MEMA 3W1SC 3CSFA 3IG3A 4K7WA 1WGRA 1WJUA 4F7ZA 1WE7A 4EFOA 3AXCA 4GSWA 3QAQA 3D32A 5HKHA 2LI5A 3HHMA 2IY1B 1S1QB 1UELA 2DZKA 4IW0A 4FBJB 1WZ0A 4FJYA 1ZGUB 4WWOA 3A4RA 2I1KA 3TBLD 3H9DA 1Q5WB 3APDA 3JSVB 3PHWB 1E8XA 3IVFA 3WIMA 3QCAA 4K1RB 2N7DA 2BWES 3T8MA 3VHTC 4A3PA 5JH5C 2IBIB 4W9LA 3A1QA 4GDKA 4GMVA 4HCPB 3AU4A 2GBJA 4W9HA 3ENEA 4ANVA 3ALBA 2KLCA 2D10A 2NBVB 2WX1A 2RR9A 3A4SC 3AU5A 3DBHI 4I6PA 4MGYE 2ZEQA 2V4LA 3Q3FA 4W9KA 5BO4B 3ZLZA 2KC2A 3R66C 1I35A 4II3B 4MDKE 2YVCA 3RYTA 1JRUA 3K9OB 3NS8A 4MGZE 3TJPA 5E6PA 1FXTB 2EKEC 2M4NA 4TV3A 2K6DB 2KWVB 2CU1A 5CTRC 4MH0E 1RFAA 2KMAA 2KKCA 3KH0A 1BT0A 2G4DB 2L8JA 4GGQA 4ANXA 3OJ4B 1V80A 3GOEA 4KIKB 1UD7A 1NDDA 3M95A 1KOTA 2O6VA 3TMPB 4XZ4A 2J0KA 3VFKA 2WYQA 4FLHA 2O2VB 3C0RB 3N30A 3PGEA 2R2QA 2MWSB 1VCBA 2HD5B 1EO6A 3DQVA 4P7IA 2KJ6A 2AWTA 3L08A 4ZRKA 2KX0A 5AZGA 4LJPB 4XC2A 1E5WA 3UQAA 4NPNA 2ZJDA 4CHKA 2LUEA 3VH4B 1IPGA 2ZCBA 3PRPB 3U7DA 2BYEA 3PS6A 1G6JA 4NY0A 1LFDA 5J2RA 2A5UA 2MRPA 4WWPA 1YD8U 2ZNVB 3H1UA 2K25A 4BBNF 4G11A 3DBLI 1M94A 1WZ3A 4KSKC 1WF9A 1X1MA 2C7MB 1ISNA 2FCNA 2BYFA 5J17A 3A1QB 4GDKB 1YIWA 2BGFA 4FN2A 4URKA 3PRMB 4GDLA 3WAOA 2KTFA 5LXHA 2JT4B 2KX3A 4HCNB 2MLBA 2ZNVC 1V81A 2JVCA 2KJRA 4W9EA 2KK8A 3VVWB 3CMMB 2N9EB 2DAJA 2DAFA 1V9JA 4DDGD 1UBIA 5G2NA 2WX0A 1HE8A 3A33B 1V6EA 4M8NA 4M8MA 2Z0DB 2CS4A 3MTNB 3RULA 3RT3B 2AEHA 2LWPA 3V61A 4EKUA 3OLMD 2BF8B 4HXDA 1OEYA 2G4SA 2IO1B 1A5RA 2FIDA 1UZXB 2RD0A 4GOCA 3SDLC 2IYDB 3ZW3A 2O6VB 3RD2A 1WMHB 1GNUA 3UINB 4MGKE 3M3JA 4EUTA 2N4FA 1E8ZA 1P1AA 3DVNV 4BOZB 2HE7A 3PSEB 2JPHA 3DVGX 3L17A 4TQ1A 3IBEA 2BKFA 2Y5BB 2J7QB 1GC7A 3NZSA 4LCDE 1P98A 5LLIA 4I6NB 4E3CA 2K8BA 3ONSA 2KQSA 3IHPC 5TR5A 3DDCB 2K39A 3B08A 3QC8B 4ICVA 3ZNHB 4ANUA 3PLVA 5GMVA 1LM8B 1E7VA 2O6VD 3DOWA 4KV2A 5IAAC 3QA8A 4PS3A 3QARA 2KANA 2N9PC 2KDEB 2PE9A 4E71A 5DPWA 2XK5A 5D2MB 3KUCB 2JZ3B 2FCMA 4AJYB 1J0GA 1Q1OA 1WR1A 3L54A 4JIOU 4OVUA 1F9JA 3ML8A 2GOWA 4GDLB 4LDTB 2CHZA 2YLMA 4JL9A 2LVPA 2K1FA 3R7QA 3ZNZB 2REXA 4DHZB 4IWPA 1OGWA 2LGDA 1RLFA 3A9JA 4NJ6A 4WJNA 2LRUA 4ANWA 4FULA 4N9F4 3ZUNA 4FA6A 3N32A 2NCNA 4G3XB 5AZHA 1Z2MA 2ZCCA 3QQ8B 3QJZA 1OQYA 4F1SA 2JRHA 4NNJB 5D7GA 1YX6B 4MM3A 3TCAA 2KWUB 1E90A 2ZPNA 2KTRA 4GXBA 3WA0A 2C7NB 2GMIC 3QIJA 1WFYA 4WWNA 1XD3B 2FCSA 4LDTD 2C9WB 3O65B 1P9DU 2PJHA 5L95C 2IY0B 2LASA 1TZ1A 2BPSA 4MJSA 4FJVB 3EC8A 3GZNI 3H7SA 4X57B 2W9NA 3VTWA 2ZVOA 3UIPB 1WX8A 4CYEA 1K8RB 1Q0WB 4BFRA 4W9GA 3QK0A 3ZRFA 3KW5B 4NAWA 4ASWC 1RAXA 1YQBA 1IYFA 2DENB 3ZDTA 2RSUA 3RCZA 3VUXA 2L0FA 4GN1A 1WYWB 4DXAB 4DHZE 2NBUA 5G55A 1UGMA 4EEWA 1V5TA 4GU2A 3VUYA 5E6NA 3ZKJC 2KDBA 2IO0B 3AI5A 4K7SA 2RPQA 1WXVA 3PHXB 1V5OA 1GC6A 1TGZB 2D11A 1PQSA 1XQQA 5FR6A 2LJ5A 4G50A 3DBSA 2RGFA 3H7PA 5D94A 3M62B 3VQIA 4CO7A 1CMXB 2GBRA 2MSED 2KFKA 3PVLA 3TL5A 2HJ8A 2KD0A 2XK5B 2BKRB 4HDOA 5CHVC 3RZWC 4BKTA 2L0TA 1WGHA 3KUZA 3APFA 1OTRB 2KZRA 2OJRA 3APCA 3VXWA 2ZPYA 3EHVA 1SE9A 3R3MA 4XX5A 3T9LA 1P0RA 2B3AA 4MSMB 3PLUA 3A9JB 4LJOB 3UF8A 1R4MI 1VD2A 3L16A 4WAAA 3PV1A 3KYCD 1EF1A 3SU8X 1GJZA 4F8CB 4NQLB 3B1LX 3M63B 4NJ7A 5DPRA 5C23A 3PT2B 3X0WA 1WH3A 2KMCA 5IA7A 2KTRB 4IG7B 5KHQA 1NBFC 2FUHB 4AJWA 2KN5A 5DCNA 5L83A 2L05A 1WGDA 3KUDB 3V6EB 4EZLA 3ZO5B 4BKSA 2C5LC 4MJSB 3VTVA 2AL6A 2XBBC 1XT9B 4KVGB 2PE6B 1ZW7A 2DZJA 4BBNC 3PREA 1C3TA 4NAWB 4K7UA 4A20A 4DBGA 2CR5A 3DCGA 2ASQA 2N7EA 2KQ7A 4W9DA 3SHQA 3L0WB 3W1SA 4DK5A 4WJQA 2NPTA 4W9IA 4ZDVA 5AEKB 4WJOA 4AUQC 3ZRCA 4MSQB 5LXIB 4FADA 4PYUA 4K81A 2NVUI 3ZDMC 5JZEB 3CSTA 3H7PB 1OEYJ 4RM9A 3UQBA 2KFKB 2NS5A 3LJ3A 2MCNB 1WR6E 4DDID 3WANA 3MJWA 3PZDA 2M17A 1WI0A 2DYOA 3P2BA 3VTUA 2AYOB 2A4ZA 4WJPA 3R7RA 3LDZE 3OJ3A 1EUVB 2KNBA 2C60A 1GUAB 5C1ZA 2EMTA 4PS7A 3WAMA 4B9KA 5CHWA 2DHZA 2MA9B 3NZUA 1WIAA 3VDZA 4HJKA 3PRZA 2GBMA 3EFUA 2L76A 4WQOB 1YJ1A 2KFJA 4IWQA 5KHOA 2LVOA 2CHWA 1WE6A 4B95A 5CHFA 2AL3A 2ZVNA 1ZKHA 4HDQA 2KHWB 3V60A 2NBWB 3HM3A 2FAZA 2JRIB 2MQJA 2IO3B 2KLGA 2UYZB 2DX5B 4AOFA 4DWFA 4RM8A 3BINA 1WM2A 2G3QB 3B0AA 2NPTB 4MGIE 4HLEA 1WJ4A 2KDIA 3UGBB 4JLCA 1YX5B 1U4AA 2ZZPB 2MBOA 2EMSA 2GBKA 2LZ6A 2JF5A 3RZFA 3A9KA 4BKSD 1WJ6A 2LGYA 2OOBB 4IM2A 4ZRIA 2JZZA 3SD5A 2MP2A 4HPMB 4DHJB 4AWJA 1WM3A 1E8YA 2L00B 4J6IA 3V6CB 4HVBA 1E7UA 2J0MA 3MHSD 3ZTCA 2GBNA 1QZEA 4TUUA 1RRBA 2FCQA 2JWZA 3IFWB 3ML9A 4KZ0A 3HM6X 4NQKE 2MX2A 4TQ0A 1D3ZA 2PPHA 3ZTDA 3V62A 3DBRI 2N9XA 2KO3A 4II2B 2LGXA 3DVNU 2L7RA 2VRRB 4AP4C 2MBEA 2DYMA 2Z59B 3HK0A 4BOSC 4IC7B 4DHJD 4HK2A 2KC1A 3DPDA 4OVVA
chains in the Genus database with same CATH superfamily
3BK1A 1WJNA 1WRDB 4ITKA 1L2NA 1C4PA 3AE2B 1SSNA 2NR2A 2CHXA 2LMCA 2D07B 1XCQL 1R4NI 1IGCA 1SIFA 3ZNGC 2J42A 2JXXA 1V49A 2M8SA 1IP9A 1L4DB 5IN7A 1V2YA 2MBHA 3JVZX 3P1MA 4IWOA 1MFWA 1N63A 2D2QA 1MPEA 1FO4A 3TEYA 4L1BA 2N1VA 3Q8CA 3TIXA 2MW5A 3GB1A 4RGOS 2N0SB 3UI3A 2WWZA 1K51A 4M0WA 2Q5WD 2INPE 5CX3A 4NJCA 4BKGA 3N9YC 1AYFA 2LXAA 1C1YB 3BYYB 2KYWA 3Q3JA 1XCTL 4KSLC 1N6ZA 4YTNB 3RNFC 3KVFB 4BVUC 3RNAC 1C79A 2XEWA 3R2IA 1Q10A 1J8CA 2MJ3A 3AV8A 5HG2A 4EZKA 3GS2A 3JSVA 4RF0A 1CQVA 1VDVA 2WXGA 4KDIC 4WQMA 3GE8C 1T0QC 4YL8A 4BZAA 4YT0B 3RFZB 2BWFA 3P4QB 3AULA 4B0MA 1JWAD 2Y3AA 3VR9B 3VH3B 4H2AA 2QHOA 4DXGA 2WXQA 3MC0B 4LNKA 1P3QU 3KQ4A 3DVGY 3K9PB 2FIFA 3U8ZA 2Y5PA 3BY4B 1EF5A 4C80A 5DPTA 5JHAA 1KLUD 4LNNA 1WGGA 2DNFA 1WE7A 3AXCA 4GSWA 3TUOA 2LI5A 3HHMA 2IY1B 4IW0A 3C8YA 4FBJB 4O1NA 3AEEB 2KMMA 1KTKA 4A3PA 2CJNA 2Y5CA 5G5GA 4GDKA 2GBJA 4W9HA 4YXDB 2KLCA 2NBVB 1FPYA 3U7ZA 1I7HA 3R66C 2YVCA 1JRUA 4A9AA 3K9OB 1J7BA 3TJPA 5E6PA 1D4BA 1KLGD 4MH0E 4ANXA 1BT0A 4GGQA 4KIKB 1EM7A 1UD7A 2EKIA 2O6VA 2J0KA 3VFKA 2WYQA 4C00A 4FLHA 3N30A 2MWSB 3B2GA 3RNCC 4P7IA 3L08A 2PTLA 5AZGA 1KF6B 3UQAA 4NPNA 1WWTA 5J2RA 1YD8U 1SJHD 1UWMA 5BMIA 5TSSA 3DBLI 4IKGA 1WF9A 1X1MA 2V3PA 4KSKC 2FCNA 3A1QB 1NENB 2MLBA 2ZNVC 3ZXRA 3NVWA 1FRDA 2WLBA 3VVWB 2KAJA 2X8XX 1KFYB 3IT6B 2WX0A 3A33B 3RULA 3MTNB 3N1YC 2AEHA 2LWPA 3OLMD 2BF8B 2G4SA 4TSSA 1A5RA 2RD0A 1QOBA 3SDLC 3NVVA 2H89B 4OHJA 4EUTA 1E8ZA 1QOFA 2HE7A 3DVGX 4TQ1A 2BKFA 4E3CA 3MC8A 2KN4A 2KQSA 3EGRA 3AEDB 3BK2A 2OHFA 1LM8B 4KV2A 3QA8A 1YQ4B 2GRIA 5DPWA 2PE9A 4E71A 4K3BA 1Q1OA 1WR1A 3L54A 1WRIA 4OVUA 1F9JA 4LDTB 2CHZA 2REXA 1MJDA 3J9CA 1OGWA 3FAHA 4WAFA 2K0PA 2D3BA 4A90A 4FA6A 2V0GA 2M0AA 5AZHA 1OQQA 3QJZA 3VRAB 4NNJB 2KWUB 1E90A 3T3NA 2C7NB 2QCZA 4WWNA 2BVCA 4LDTD 2PJHA 2IY0B 2LASA 2BPSA 4CQNA 2W9NA 3BVMA 3UIPB 5EE0A 4CYEA 4ZHOA 5D3DA 1K8RB 3LB8C 4YTMB 1IYFA 3RCZA 1TJEA 2L0FA 1WYWB 4DHZE 1QOAA 2WXRA 3ZKJC 4K7SA 3PHXB 1ZDXA 4LNFA 4CO7A 2KFKA 2XK5B 2BKRB 2L83A 1VZ7A 1OTRB 3APCA 1F52A 4M00A 2ZPYA 1D5MC 1WYGA 1R4NB 1FNUA 1VD2A 2WGSA 3PV1A 4L2YA 1SF0A 1DYQA 1E6EB 1GJZA 2LHDA 2LUMA 4NJ7A 5C23A 3PT2B 1WH3A 2KTRB 4IG7B 1NBFC 5DCNA 5L83A 1WGDA 3EFCA 3P4RB 3V6EB 4EZLA 3VTVA 2PE6B 1F2RC 2J53A 1UWXA 5MPOA 1C3TA 3Q8BA 4K7UA 2ASQA 4WJQA 2WDRB 4ZDVA 1K53A 4WJOA 4AUQC 4MSQB 2LEKA 3DHGC 3B2FA 1I4QA 4K81A 3ZDMC 2FUG1 1ENFA 2WXLA 3ABVB 2NS5A 2L32A 2WP9B 3WANA 3PZDA 2AYOB 4WJPA 2BTEA 1GUAB 3Q69A 5C1ZA 3WAMA 5LNK1 1JWUD 2MA9B 3NZUA 1WXQA 1K52A 3PRZA 2L76A 1JRPA 1WE6A 3AEFB 2INNE 5CHFA 2ZVNA 4KGRA 2KHWB 3RPFC 2GI9A 2NBWB 3HM3A 2FAZA 2UU7A 1QKZA 2BT6A 2DX5B 1B1ZA 4MGIE 1GOZA 1WJ4A 2ZZPB 2GBKA 5JXVA 1QT9A 1AWDA 2OOBB 4IDIA 4ZRIA 2MP2A 4XWWA 4KGTA 1WM3A 2GB1A 3V6CB 2GBNA 3W9CB 2HDEA 3ML9A 4TQ0A 1FRRA 2PPHA 2WXKA 3ZTDA 3V62A 2YEPF 2YEPB 3H8HA 1T3QA 2DYMA 3P63A 3HK0A 4IC7B 1PDXA 4RGTA 2KC1A 3QX1A 1T0YA 1NI2A 3JYUA 5IOIA 4I6LB 4NAMA 1NI3A 2N1WA 3WCQA 3E9SA 3WAPA 1KJTA 1SGHA 3CF6E 3RNBC 1C4CA 2I38A 2JY6A 3TEXA 1ZXHA 2K8HA 3JW0X 2K6QA 3U30A 4RCOA 2QDFA 4GB9A 2LXCA 4IUMB 1F2RI 3HRDD 2DWQA 3C19A 2JXTA 2KOXA 4W9JA 5GXGB 2FNJB 1R4MB 2MBQA 2WXNA 3AE8B 4FJZA 4RFBA 2WXIA 4REZA 2V1YA 3T3OA 1MHXA 2H88B 2J0JA 1Y8RC 2G45B 5JHBA 1HEZE 2JSVX 3PTFC 1N61A 2DZMA 3AM9A 2ACZB 3ZVVA 2M19A 2KVRA 2WXOA 1C78A 4ZRQA 2M0XA 2RMMA 3ECIA 4JWUC 2CKHB 1KLVA 5J18A 1WY8A 4ZYNA 4ZRJA 4EOYA 2M56B 4MH8A 2IZVB 3MHZA 2G1EA 1S3SG 2DYBA 5EE1A 1JW9D 2D3AA 5D6JB 2FE8A 4KDLB 2KDFB 4PS8A 2BB5A 1LGRA 1SE3A 2IJ0A 4UDUC 3FKYA 5E6OA 4JGHB 3ZJTA 4K3CA 2JUOA 4M0WB 1WXMA 2MHJA 2BBCA 2UWQA 1UBQA 1J19A 2E6XA 4ZOHC 3IG3A 1WGRA 1WJUA 2CU3A 2K9XA 3QAQA 5HKHA 4A55A 1UELA 2W54A 4OZAA 1I4RA 4FJYA 1ZGUB 5IO9A 3TBLD 3JSVB 2N7DA 2BWES 3T8MA 1XXGA 1FFUA 4ZHPA 2JWUA 4ARCA 2HTME 3ENEA 4ANVA 2D10A 2WX1A 3A4SC 4MGYE 4I6PA 4EE2A 1JWSD 2V4LA 3Q3FA 4W9KA 4GLSC 1I35A 4B0EA 4MGZE 2QJLA 2BS2B 4N6EB 1RFAA 3KH0A 4A6QA 3OJ4B 1XLNA 1KOTA 2EELA 3SFDB 2N9LA 1YOVB 2QC8A 1E9MA 5EE3A 4XC2A 1E5WA 4HPPA 4CHKA 1IPGA 3PRPB 1G6JA 2A5UA 2MRPA 4WWPA 3DHHC 2ZNVB 3H1UA 4BBNF 4ARIA 2C7MB 1ISNA 2PKOA 5J17A 1FCLA 4GDKB 1ACCA 3PRMB 4GDLA 3WAOA 4ZYSA 3BYTB 4JX1C 2PMVA 2KJRA 1MVKA 1ROEA 3CMMB 2DAJA 4P6VF 4DDGD 1UBIA 5G2NA 1TY0A 4M8MA 3V61A 1VR9A 4XGAB 2JZPA 3PO0A 2IO1B 3SEBA 2SAKA 2O6VB 3Q6BA 1WMHB 1GNUA 3UINB 4MGKE 5D3IB 3M3JA 3PSEB 3IBEA 5LLIA 1C4AA 4I6NB 1RM6C 4YSXB 3ONSA 3IHPC 1ET9A 3DDCB 1HTQA 2K39A 3B08A 4KX6B 3ZNHB 1HZ5A 2O6VD 2IGDA 5IAAC 1OQRA 1F0ZA 1ZE3D 2JZ3B 1J0GA 3AMZA 2PLPA 4JIOU 3ML8A 2GOWA 4JL9A 1QOGA 2K1FA 4DHZB 1QF6A 2LGDA 1RLFA 4NJ6A 4ANWA 1JWBD 4FULA 3ZUNA 1Z2MA 2NTSA 3QQ8B 2JRHA 1VLBA 2C9WB 1FIQA 3EC8A 4X57B 3ZJUA 1WX8A 4BFRA 4W9GA 1GB4A 2DENB 3ZDTA 2KVZA 3W5UB 2RSUA 3RN9C 3PZ8A 4DXAB 2ICIA 3SR6A 1V5TA 3VUYA 2IO0B 3AI5A 1WXVA 1V5OA 1GC6A 1L0XB 5FR6A 4P1CC 4BAXA 3DBSA 4M02A 2RGFA 3H7PA 1ZOYB 2D5GA 3VQIA 1CMXB 2HJ8A 4HDOA 4RH6A 3RZWC 5IP4D 1WGHA 3KUZA 4XX5A 1P0RA 3PLUA 1XO3A 4HJGE 2WXPA 1YN4A 1R4MI 1TS5A 1V1OA 3L16A 4WAAA 1I4PA 1TT5B 3KYCD 1EF1A 4KGSA 4F8CB 4NQLB 4AJWA 2KN5A 5AUKA 3ZO5B 3V3XA 4BKSA 1IUEA 2AL6A 1FNWA 4KVGB 2BW2A 5BMGA 4OVZA 2DZJA 4BBNC 2J4XA 2RDGA 3KWLA 1V8CA 4DBGA 2CR5A 4KKJA 3L0WB 3W1SA 1TS2A 1SE4A 4RF1A 3ZRCA 2K22A 2BYTA 2NVUI 3CSTA 3R2TA 3UQBA 1YN3A 1TYGB 2KFKB 2PVGC 1RYJA 3I9V1 3BWUD 3LXFA 4TMAB 2M17A 3P2BA 1V97A 2DYOA 3OJ3A 2BS3B 5T8IA 2J52A 2V4IB 4B9KA 4JE3B 5CHWA 4N58A 2GBMA 1WSPA 1YJ1A 4IWQA 5KHOA 2CHWA 1C77A 1ZKHA 2OEDA 1UF0A 3U4EG 1PFDA 3HUIA 3RI7C 2IO3B 4DWFA 4RM8A 1NVID 3W2DA 3V05A 3AE9B 1TKGA 2KDIA 4LK0M 2AQ2B 4C4VB 2EMSA 3A9KA 3MP9A 4HPMB 3TEWA 3MJ5A 4AWJA 1E8YA 2L00B 2KACA 4J6IA 4YWGG 4WURA 4MT5A 1QZEA 4TUUA 1RRBA 4KZ0A 1V1PA 4NQKE 3O13A 3VRBB 2N9XA 4II2B 3EUB2 3DVNU 4M01A 2VRRB 2MBEA 2Z59B 2PIAA 3FILA 4HK2A 4OVVA 1KM7A 1J7CA 1F1HA 3VAWA 4G0NB 4XYCA 2AQ3B 2NMQA 2FBWB 2K8CA 1E0ZA 2WXJA 3AE6B 2D3GA 2KJHB 3L10B 4FXCA 1UH6A 3FC4A 2ON8A 2WXHA 4W9CA 4LNOA 3E56A 2W3RA 1TTNA 3NY5A 2MP2B 4OW0A 3LYYA 4IM3A 1DOYA 1WXSA 2MBBB 2XNAC 2L1AA 3BIID 3VUWA 4AQ7A 1TBEA 2XN9C 2KXJA 3S2AA 2VH1A 4FHJA 1H4RA 1TIFA 2LFIA 1YJJA 3OAWA 3H6NA 2CJOA 3W1YA 1LXDA 3QHTA 2BB6A 3I3TB 3HIZA 1WGYA 4ICUA 2PEAA 1ZXIA 2QMTA 3NVYA 1SB3C 4MELA 2Z0EB 1ZPSA 3AEAB 1GG3A 2LRWA 4XDDA 1C76A 3IAS1 1JALA 3ZNID 2KWDA 5H8YE 4WWMA 1TS4A 1E8WA 2LJIA 3P4PB 3UIOB 2LVQA 4W9FA 2KWCA 4E74A 4B6WA 3P4SB 4TKNA 3AE7B 3QWZB 5FKAC 2MJDA 4JWSC 1LQBA 2V3SA 4HWIB 1I42A 2O2VA 2TSSA 1FM0D 4MEMA 3CSFA 2B76B 1HA5A 4K7WA 1SEBD 1VRAB 1S1QB 1WZ0A 4WWOA 3A4RA 2I1KA 1Q5WB 3APDA 3PHWB 3IVFA 3WIMA 3QCAA 4K1RB 3VHTC 5JH5C 2IBIB 4GMVA 3AU4A 2N9KA 3ALBA 2RDBC 3U52E 2ONQA 3AU5A 2ZEQA 5BO4B 1ZDVA 1CK1A 2KC2A 1XLOA 4MDKE 2WXMA 3DBRB 3ETRA 1XLPA 4TV3A 5CTRC 2K6DB 2CU1A 3NUHB 2KMAA 3AEGB 1RWSA 1UNSA 2G4DB 2L8JA 1WGKA 1T5XD 1NDDA 2IDYA 4XZ4A 4ZRPA 3ZXVA 3I63C 5BYQA 1VCBA 2HD5B 1EO6A 2KJ6A 2AWTA 2KX0A 3VH4B 2ZCBA 3U7DA 2BYEA 3PS6A 1LFDA 5EE9A 4P16A 2DBYA 3I57A 1MI0A 1M94A 1YIWA 2BGFA 4FN2A 4D2KA 4USAA 5LXHA 2JT4B 2KX3A 2WU2B 1V81A 2KK8A 1RFKA 2DAFA 3BVGA 1BXTA 3NZ3A 1HE8A 4M8NA 2Z0DB 2CS4A 3RT3B 1JROA 4EKUA 4DXFA 4HROA 4HXDA 1D6EC 1OEYA 1UZXB 2V9HA 2BS4B 2IYDB 5BYSA 3ZW3A 2K3UA 3NVZA 2QEJC 3U2SC 1SXTA 2X38A 2IGGA 2AX5A 1GC7A 4LCDE 1N5XA 2MEKA 5TR5A 3BZDB 3QC8B 4ICVA 4ANUA 4C7YA 1NYRA 5GMVA 1E7VA 3DOWA 5HHDG 4PS3A 3CWIA 2N9PC 2KDEB 3EA6A 1FD6A 5D2MB 3KUCB 1AN8A 1CZPA 2FCMA 4AJYB 4PT5A 4GDLB 5IKCM 1K50A 1YNTE 2YLMA 4PK1A 3ZNZB 1SE2A 3Q8AA 3A9JA 4WJNA 2LRUA 3GP7A 3N20C 2MH7A 2GLSA 2SEBD 1IGDA 1OQYA 2ZCCA 5D7GA 1YX6B 4MM3A 3TCAA 4GXBA 2GMIC 1XD3B 2FCSA 4R3DA 1P9DU 2IGHA 4MJSA 4WIPA 3GZNI 3H7SA 3VTWA 2ZVOA 2VH2A 1Q0WB 1E10A 3KW5B 4NAWA 4ASWC 1RAXA 2I2YA 1GAQB 3VUXA 1IBXA 1D5ZC 2NBUA 3ZQ4A 4GU2A 5E6NA 1DOIA 2RPQA 2D11A 1PQSA 1XQQA 2Z8LA 4G50A 5D94A 3DBHB 3M62B 3PVLA 4L23A 4BKTA 2L0TA 2JQRB 2KZRA 3APFA 1SE9A 3R3MA 3T9LA 2B3AA 4MSMB 1QQRA 2NTTA 4LJOB 4XDCA 4US9A 3UF8A 3VR8B 1TKEA 3SU8X 5DPRA 3B1LX 3M63B 5IA7A 5KHQA 2JX5A 2L05A 4OZCA 1JWMD 3KUDB 4YSYB 1F77A 2XBBC 1XT9B 1YMHE 3KLSX 1ZW7A 2LHEA 4HEA1 4HKQA 1XF5L 2V3NA 3SHQA 2N7EA 4W9DA 2KQ7A 4JPSA 2NPTA 1FMAD 4XWTA 4C7ZA 1N60A 5LXIB 4FADA 4PYUA 5JZEB 1ZUD2 4OZBA 1J7AA 3H7PB 3NRZA 4RM9A 4LTUA 2RPVA 3DWMA 1MG4A 4AS1A 3AE1B 1WR6E 1JMLA 3Q8FA 4DDID 3MJWA 3VTUA 4N59A 1HXYD 2A4ZA 3LDZE 1NEKB 1EUVB 1EU3A 2EMTA 4PS7A 3MFGA 1WIAA 3VDZA 4HJKA 3AECB 1KH0A 2WXFA 4WQOB 2LVOA 5AUIA 4B95A 1LO5D 2WQYB 2AL3A 4S17A 3AE4B 3V60A 2LGSA 2JYEA 3B0AA 3UGBB 1YX5B 2MBOA 2INDC 1D5XC 1SBBB 2L52A 2OJWA 2LZ6A 2JF5A 3RZFA 4YSZB 4BKSD 1JQ4A 2LGYA 4IM2A 2JZZA 1FEHA 2WU5B 4Q2JA 2WS3B 3MHSD 3ZTCA 5G5HA 4XE0A 2MX2A 3Q3NC 1SIJA 3AEBB 3DBRI 2LGXA 1XEEA 4AP4C 2VZKB 4LLGM 4BOSC 3IT4B 3OWEB 1M4VA 1HTOA 4KKIA 4US8A 4HRSA 4JQWC 3RNGC 3N3KB 4IM0A 1WX9A 3AE3B 1MHHE 1WX7A 5C3JB 3NOBA 4J3OD 4P1BC 2JYTA 2N7JA 2DZIA 2VZKD 3ZIMA 3EECA 4RMAA 1WMHA 2INCC 2I1JA 3GE3C 1L7YA 2C7HA 3A9KB 3CIRB 1P7EA 2M1MA 4HPLB 3B9JA 1V1PB 2LD9A 3RNEC 3WALA 3L13A 1AARA 1FXIA 3FILB 1MG8A 4ACFA 1YJIA 2WDQB 2QSDA 3NHEB 5DPSA 2IO2B 3URYA 1V86A 2HTHA 3KYDD 2R2OA 4GIVA 1H8CA 1L6UA 4PYZA 1TS3A 3P42A 3N1ZC 3Q14C 1Z5SB 4A8XC 5AZFA 5EDSA 4WH4A 2AQ1B 2RDHA 2L3ZA 1UGJA 4A3OA 4KZCA 3RUIB 3PPAA 4C56C 4FHKA 3X23A 4EZJA 2BYVE 1E7PB 5HFYA 2WDTB 1GPXA 2PVOD 4KIKA 1TZOA 1SJED 1PGAA 1WXAA 1BMLC 3AN1A 5H92C 3W1SC 3N1XC 4F7ZA 4EFOA 3D32A 2DZKA 1Y56A 3H9DA 4RGMA 1E8XA 3NS1A 4DQOC 2QIEB 1TKYA 3DWGC 4W9LA 3A1QA 2BQQA 4HCPB 2G9HD 1FXAA 3GZNB 1L6VA 3DBHI 2RR9A 3R8BA 3ZLZA 2W82A 2LGIA 4II3B 3SFEB 2KT7A 3RYTA 3NS8A 1FXTB 2EKEC 2M4NA 2KWVB 2KKCA 1VZ8A 1V80A 3GOEA 3NG0A 3M95A 1QILA 3TMPB 1I4HA 4QAYA 2O2VB 3C0RB 3PGEA 2R2QA 1CJEA 3DQVA 4ZRKA 4LJPB 5C2TB 2ZJDA 2LUEA 4NY0A 2K25A 3I5JC 4NZLB 4G11A 1WZ3A 2BYFA 3ZJVA 4URKA 1ET6A 3TSSA 1PUTA 2KTFA 1HZ6A 1QLBB 4HCNB 2JVCA 4W9EA 1T0RC 3L4PA 2N9EB 1V9JA 3ZGZA 1V6EA 1L5PA 1A70A 4C4VA 1T6BX 2FIDA 5FK9C 4GOCA 1T0SC 3NJTA 3RD2A 2N4FA 1P1AA 3DVNV 4BOZB 1I4XA 2JPHA 3L17A 2ZW0A 2Y5BB 2J7QB 3NZSA 1P98A 2HJ1A 2K8BA 2K5PA 1PGBA 3Q3MC 1L4ZB 3PLVA 1N62A 4MACA 4YTPB 3QARA 2KANA 1VJKA 2XK5A 4RGNA 2LVPA 2JU6X 3R7QA 3AH7A 4IWPA 2R61A 4N9F4 3OG5A 3N32A 2KDMA 2NCNA 4G3XB 1DGJA 4F1SA 3Q2AC 1C9FA 2ZPNA 2KTRA 3WA0A 3QIJA 1WFYA 3O65B 5HI1A 5L95C 1TZ1A 4FJVB 3IAM1 1YN5A 3QK0A 3ZRFA 1YQBA 4S0RA 4GN1A 5G55A 1UGMA 4EEWA 3PZ7A 2KDBA 1TGZB 2LJ5A 3BVZA 1P7FA 1ZP0B 1PGXA 2MSED 2GBRA 3TL5A 2KD0A 5CHVC 3VXWA 1R7SA 2OJRA 1STEA 3EHVA 3TEZA 1VZ6A 2W3SA 3A9JB 3IXSA 5BMHA 1NYQA 2KQ4X 5I4DA 2IPKD 3X0WA 4MM3B 2KMCA 2MJEA 2FUHB 1GB1A 1YQ3B 2C5LC 1L0VB 4MJSB 1PYWD 1FNVA 3MC9A 3PREA 2D3CA 4NAWB 2WDVB 4A20A 3DCGA 4DK5A 3KWVA 1IBXB 4W9IA 3DBLB 5E6JA 5AEKB 1EWCA 3Q3OC 1B9RA 1AW7A 1OEYJ 5FR3A 1HQRD 2WHIA 1EWYC 3LJ3A 3RMKC 2MCNB 3HVDA 3AB5A 1WI0A 3R7RA 2KNBA 2C60A 1EU4A 2QILA 2W55A 2DHZA 2DLBA 1N5WA 1UUPA 1KRHA 3EFUA 2PW9A 2KFJA 4LNIA 1FCCC 3AE5B 1TY2A 3W5VB 4HDQA 3ZYYX 3Q8EA 2JRIB 2MQJA 2ZW1A 2KLGA 2UYZB 4AOFA 3BINA 1I4GA 1WM2A 2G3QB 2NPTB 4HLEA 4JLCA 1JCKB 1U4AA 2E3TA 1WJ6A 3SD5A 3HVZA 4DHJB 1XLQA 1FFVA 4IOIE 4HVBA 1E7UA 1DOXA 2J0MA 1BUIC 2FCQA 2JWZA 1OFFA 3IFWB 5BYRA 3HM6X 1D3ZA 2WNMA 4RNAA 2KO3A 2L7RA 1L0YB 1ESFA 3DHIC 4DHJD 4HKZE 3DPDA
chains in the Genus database with same CATH topology
1KM7A 3QX1A 1T0YA 1NI2A 3JYUA 1WJNA 4I6LB 1WRDB 1L2NA 4JQWC 3VAWA 3N3KB 2N1WA 4G0NB 2NR2A 4IM0A 1WX9A 3WAPA 1KJTA 1SGHA 3CF6E 1WX7A 2CHXA 3NOBA 2K8CA 2DZIA 2D07B 2JY6A 1R4NI 3ZIMA 2K8HA 3EECA 1SIFA 3JW0X 2K6QA 3U30A 2D3GA 3ZNGC 2KJHB 2JXXA 1V49A 3L10B 1UH6A 2M8SA 4RMAA 1IP9A 4GB9A 1WMHA 2LXCA 4IUMB 1V2YA 2MBHA 3JVZX 4W9CA 4IWOA 2I1JA 1L7YA 2C7HA 2D2QA 3A9KB 2KOXA 1TTNA 3NY5A 2MP2B 4W9JA 4IM3A 1WXSA 2FNJB 2MBQA 2MBBB 4FJZA 2M1MA 4HPLB 2N1VA 3VUWA 1TBEA 3TIXA 2MW5A 2V1YA 2KXJA 3S2AA 2LD9A 3WALA 2WWZA 4FHJA 1H4RA 2J0JA 5CX3A 1Y8RC 3L13A 2G45B 5JHBA 4BKGA 1AARA 3OAWA 2DZMA 3PTFC 3H6NA 3W1YA 2LXAA 1C1YB 3Q3JA 1LXDA 3QHTA 3ZVVA 4KSLC 3I3TB 1MG8A 2KVRA 3HIZA 3KVFB 1WGYA 4BVUC 2PEAA 2M0XA 2XEWA 3ECIA 3NHEB 4ICUA 5DPSA 2IO2B 2CKHB 1KLVA 1V86A 1J8CA 2HTHA 4EZKA 3KYDD 3JSVA 5J18A 2R2OA 4GIVA 4MELA 1WY8A 2Z0EB 4ZYNA 4ZRJA 1GG3A 2LRWA 4EOYA 1H8CA 4PYZA 4KDIC 3ZNID 1Z5SB 1E8WA 4YL8A 5AZFA 2IZVB 3UIOB 5EDSA 2LVQA 4W9FA 2BWFA 1S3SG 2DYBA 2KWCA 3AULA 4E74A 4B6WA 5D6JB 4TKNA 2L3ZA 4A3OA 3VH3B 4KZCA 3QWZB 2QHOA 3RUIB 3PPAA 4KDLB 2KDFB 4PS8A 1LQBA 4FHKA 3X23A 4EZJA 2BYVE 1P3QU 2WDTB 3DVGY 3K9PB 2FIFA 4KIKA 2V3SA 4HWIB 3U8ZA 1I42A 5E6OA 4JGHB 3BY4B 2JUOA 1EF5A 4M0WB 5DPTA 1WXMA 2O2VA 5JHAA 2UWQA 1UBQA 1WXAA 1J19A 1WGGA 4MEMA 3W1SC 3CSFA 3IG3A 4K7WA 1WGRA 1WJUA 4F7ZA 1WE7A 4EFOA 3AXCA 4GSWA 3QAQA 3D32A 5HKHA 2LI5A 3HHMA 2IY1B 1S1QB 1UELA 2DZKA 4IW0A 4FBJB 1WZ0A 4FJYA 1ZGUB 4WWOA 3A4RA 2I1KA 3TBLD 3H9DA 1Q5WB 3APDA 3JSVB 3PHWB 1E8XA 3IVFA 3WIMA 3QCAA 4K1RB 2N7DA 2BWES 3T8MA 3VHTC 4A3PA 5JH5C 2IBIB 4W9LA 3A1QA 4GDKA 4GMVA 4HCPB 3AU4A 2GBJA 4W9HA 3ENEA 4ANVA 3ALBA 2KLCA 2D10A 2NBVB 2WX1A 2RR9A 3A4SC 3AU5A 3DBHI 4I6PA 4MGYE 2ZEQA 2V4LA 3Q3FA 4W9KA 5BO4B 3ZLZA 2KC2A 3R66C 1I35A 4II3B 4MDKE 2YVCA 3RYTA 1JRUA 3K9OB 3NS8A 4MGZE 3TJPA 5E6PA 1FXTB 2EKEC 2M4NA 4TV3A 2K6DB 2KWVB 2CU1A 5CTRC 4MH0E 1RFAA 2KMAA 2KKCA 3KH0A 1BT0A 2G4DB 2L8JA 4GGQA 4ANXA 3OJ4B 1V80A 3GOEA 4KIKB 1UD7A 1NDDA 3M95A 1KOTA 2O6VA 3TMPB 4XZ4A 2J0KA 3VFKA 2WYQA 4FLHA 2O2VB 3C0RB 3N30A 3PGEA 2R2QA 2MWSB 1VCBA 2HD5B 1EO6A 3DQVA 4P7IA 2KJ6A 2AWTA 3L08A 4ZRKA 2KX0A 5AZGA 4LJPB 4XC2A 1E5WA 3UQAA 4NPNA 2ZJDA 4CHKA 2LUEA 3VH4B 1IPGA 2ZCBA 3PRPB 3U7DA 2BYEA 3PS6A 1G6JA 4NY0A 1LFDA 5J2RA 2A5UA 2MRPA 4WWPA 1YD8U 2ZNVB 3H1UA 2K25A 4BBNF 4G11A 3DBLI 1M94A 1WZ3A 4KSKC 1WF9A 1X1MA 2C7MB 1ISNA 2FCNA 2BYFA 5J17A 3A1QB 4GDKB 1YIWA 2BGFA 4FN2A 4URKA 3PRMB 4GDLA 3WAOA 2KTFA 5LXHA 2JT4B 2KX3A 4HCNB 2MLBA 2ZNVC 1V81A 2JVCA 2KJRA 4W9EA 2KK8A 3VVWB 3CMMB 2N9EB 2DAJA 2DAFA 1V9JA 4DDGD 1UBIA 5G2NA 2WX0A 1HE8A 3A33B 1V6EA 4M8NA 4M8MA 2Z0DB 2CS4A 3MTNB 3RULA 3RT3B 2AEHA 2LWPA 3V61A 4EKUA 3OLMD 2BF8B 4HXDA 1OEYA 2G4SA 2IO1B 1A5RA 2FIDA 1UZXB 2RD0A 4GOCA 3SDLC 2IYDB 3ZW3A 2O6VB 3RD2A 1WMHB 1GNUA 3UINB 4MGKE 3M3JA 4EUTA 2N4FA 1E8ZA 1P1AA 3DVNV 4BOZB 2HE7A 3PSEB 2JPHA 3DVGX 3L17A 4TQ1A 3IBEA 2BKFA 2Y5BB 2J7QB 1GC7A 3NZSA 4LCDE 1P98A 5LLIA 4I6NB 4E3CA 2K8BA 3ONSA 2KQSA 3IHPC 5TR5A 3DDCB 2K39A 3B08A 3QC8B 4ICVA 3ZNHB 4ANUA 3PLVA 5GMVA 1LM8B 1E7VA 2O6VD 3DOWA 4KV2A 5IAAC 3QA8A 4PS3A 3QARA 2KANA 2N9PC 2KDEB 2PE9A 4E71A 5DPWA 2XK5A 5D2MB 3KUCB 2JZ3B 2FCMA 4AJYB 1J0GA 1Q1OA 1WR1A 3L54A 4JIOU 4OVUA 1F9JA 3ML8A 2GOWA 4GDLB 4LDTB 2CHZA 2YLMA 4JL9A 2LVPA 2K1FA 3R7QA 3ZNZB 2REXA 4DHZB 4IWPA 1OGWA 2LGDA 1RLFA 3A9JA 4NJ6A 4WJNA 2LRUA 4ANWA 4FULA 4N9F4 3ZUNA 4FA6A 3N32A 2NCNA 4G3XB 5AZHA 1Z2MA 2ZCCA 3QQ8B 3QJZA 1OQYA 4F1SA 2JRHA 4NNJB 5D7GA 1YX6B 4MM3A 3TCAA 2KWUB 1E90A 2ZPNA 2KTRA 4GXBA 3WA0A 2C7NB 2GMIC 3QIJA 1WFYA 4WWNA 1XD3B 2FCSA 4LDTD 2C9WB 3O65B 1P9DU 2PJHA 5L95C 2IY0B 2LASA 1TZ1A 2BPSA 4MJSA 4FJVB 3EC8A 3GZNI 3H7SA 4X57B 2W9NA 3VTWA 2ZVOA 3UIPB 1WX8A 4CYEA 1K8RB 1Q0WB 4BFRA 4W9GA 3QK0A 3ZRFA 3KW5B 4NAWA 4ASWC 1RAXA 1YQBA 1IYFA 2DENB 3ZDTA 2RSUA 3RCZA 3VUXA 2L0FA 4GN1A 1WYWB 4DXAB 4DHZE 2NBUA 5G55A 1UGMA 4EEWA 1V5TA 4GU2A 3VUYA 5E6NA 3ZKJC 2KDBA 2IO0B 3AI5A 4K7SA 2RPQA 1WXVA 3PHXB 1V5OA 1GC6A 1TGZB 2D11A 1PQSA 1XQQA 5FR6A 2LJ5A 4G50A 3DBSA 2RGFA 3H7PA 5D94A 3M62B 3VQIA 4CO7A 1CMXB 2GBRA 2MSED 2KFKA 3PVLA 3TL5A 2HJ8A 2KD0A 2XK5B 2BKRB 4HDOA 5CHVC 3RZWC 4BKTA 2L0TA 1WGHA 3KUZA 3APFA 1OTRB 2KZRA 2OJRA 3APCA 3VXWA 2ZPYA 3EHVA 1SE9A 3R3MA 4XX5A 3T9LA 1P0RA 2B3AA 4MSMB 3PLUA 3A9JB 4LJOB 3UF8A 1R4MI 1VD2A 3L16A 4WAAA 3PV1A 3KYCD 1EF1A 3SU8X 1GJZA 4F8CB 4NQLB 3B1LX 3M63B 4NJ7A 5DPRA 5C23A 3PT2B 3X0WA 1WH3A 2KMCA 5IA7A 2KTRB 4IG7B 5KHQA 1NBFC 2FUHB 4AJWA 2KN5A 5DCNA 5L83A 2L05A 1WGDA 3KUDB 3V6EB 4EZLA 3ZO5B 4BKSA 2C5LC 4MJSB 3VTVA 2AL6A 2XBBC 1XT9B 4KVGB 2PE6B 1ZW7A 2DZJA 4BBNC 3PREA 1C3TA 4NAWB 4K7UA 4A20A 4DBGA 2CR5A 3DCGA 2ASQA 2N7EA 2KQ7A 4W9DA 3SHQA 3L0WB 3W1SA 4DK5A 4WJQA 2NPTA 4W9IA 4ZDVA 5AEKB 4WJOA 4AUQC 3ZRCA 4MSQB 5LXIB 4FADA 4PYUA 4K81A 2NVUI 3ZDMC 5JZEB 3CSTA 3H7PB 1OEYJ 4RM9A 3UQBA 2KFKB 2NS5A 3LJ3A 2MCNB 1WR6E 4DDID 3WANA 3MJWA 3PZDA 2M17A 1WI0A 2DYOA 3P2BA 3VTUA 2AYOB 2A4ZA 4WJPA 3R7RA 3LDZE 3OJ3A 1EUVB 2KNBA 2C60A 1GUAB 5C1ZA 2EMTA 4PS7A 3WAMA 4B9KA 5CHWA 2DHZA 2MA9B 3NZUA 1WIAA 3VDZA 4HJKA 3PRZA 2GBMA 3EFUA 2L76A 4WQOB 1YJ1A 2KFJA 4IWQA 5KHOA 2LVOA 2CHWA 1WE6A 4B95A 5CHFA 2AL3A 2ZVNA 1ZKHA 4HDQA 2KHWB 3V60A 2NBWB 3HM3A 2FAZA 2JRIB 2MQJA 2IO3B 2KLGA 2UYZB 2DX5B 4AOFA 4DWFA 4RM8A 3BINA 1WM2A 2G3QB 3B0AA 2NPTB 4MGIE 4HLEA 1WJ4A 2KDIA 3UGBB 4JLCA 1YX5B 1U4AA 2ZZPB 2MBOA 2EMSA 2GBKA 2LZ6A 2JF5A 3RZFA 3A9KA 4BKSD 1WJ6A 2LGYA 2OOBB 4IM2A 4ZRIA 2JZZA 3SD5A 2MP2A 4HPMB 4DHJB 4AWJA 1WM3A 1E8YA 2L00B 4J6IA 3V6CB 4HVBA 1E7UA 2J0MA 3MHSD 3ZTCA 2GBNA 1QZEA 4TUUA 1RRBA 2FCQA 2JWZA 3IFWB 3ML9A 4KZ0A 3HM6X 4NQKE 2MX2A 4TQ0A 1D3ZA 2PPHA 3ZTDA 3V62A 3DBRI 2N9XA 2KO3A 4II2B 2LGXA 3DVNU 2L7RA 2VRRB 4AP4C 2MBEA 2DYMA 2Z59B 3HK0A 4BOSC 4IC7B 4DHJD 4HK2A 2KC1A 3DPDA 4OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KM7 A;  3QX1 A;  1T0Y A;  1NI2 A;  3JYU A;  1WJN A;  4I6L B;  1WRD B;  1L2N A;  4JQW C;  3VAW A;  3N3K B;  2N1W A;  4G0N B;  2NR2 A;  4IM0 A;  1WX9 A;  3WAP A;  1KJT A;  1SGH A;  3CF6 E;  1WX7 A;  2CHX A;  3NOB A;  2K8C A;  2DZI A;  2D07 B;  2JY6 A;  1R4N I;  3ZIM A;  2K8H A;  3EEC A;  1SIF A;  3JW0 X;  2K6Q A;  3U30 A;  2D3G A;  3ZNG C;  2KJH B;  2JXX A;  1V49 A;  3L10 B;  1UH6 A;  2M8S A;  4RMA A;  1IP9 A;  4GB9 A;  1WMH A;  2LXC A;  4IUM B;  1V2Y A;  2MBH A;  3JVZ X;  4W9C A;  4IWO A;  2I1J A;  1L7Y A;  2C7H A;  2D2Q A;  3A9K B;  2KOX A;  1TTN A;  3NY5 A;  2MP2 B;  4W9J A;  4IM3 A;  1WXS A;  2FNJ B;  2MBQ A;  2MBB B;  4FJZ A;  2M1M A;  4HPL B;  2N1V A;  3VUW A;  1TBE A;  3TIX A;  2MW5 A;  2V1Y A;  2KXJ A;  3S2A A;  2LD9 A;  3WAL A;  2WWZ A;  4FHJ A;  1H4R A;  2J0J A;  5CX3 A;  1Y8R C;  3L13 A;  2G45 B;  5JHB A;  4BKG A;  1AAR A;  3OAW A;  2DZM A;  3PTF C;  3H6N A;  3W1Y A;  2LXA A;  1C1Y B;  3Q3J A;  1LXD A;  3QHT A;  3ZVV A;  4KSL C;  3I3T B;  1MG8 A;  2KVR A;  3HIZ A;  3KVF B;  1WGY A;  4BVU C;  2PEA A;  2M0X A;  2XEW A;  3ECI A;  3NHE B;  4ICU A;  5DPS A;  2IO2 B;  2CKH B;  1KLV A;  1V86 A;  1J8C A;  2HTH A;  4EZK A;  3KYD D;  3JSV A;  5J18 A;  2R2O A;  4GIV A;  4MEL A;  1WY8 A;  2Z0E B;  4ZYN A;  4ZRJ A;  1GG3 A;  2LRW A;  4EOY A;  1H8C A;  4PYZ A;  4KDI C;  3ZNI D;  1Z5S B;  1E8W A;  4YL8 A;  5AZF A;  2IZV B;  3UIO B;  5EDS A;  2LVQ A;  4W9F A;  2BWF A;  1S3S G;  2DYB A;  2KWC A;  3AUL A;  4E74 A;  4B6W A;  5D6J B;  4TKN A;  2L3Z A;  4A3O A;  3VH3 B;  4KZC A;  3QWZ B;  2QHO A;  3RUI B;  3PPA A;  4KDL B;  2KDF B;  4PS8 A;  1LQB A;  4FHK A;  3X23 A;  4EZJ A;  2BYV E;  1P3Q U;  2WDT B;  3DVG Y;  3K9P B;  2FIF A;  4KIK A;  2V3S A;  4HWI B;  3U8Z A;  1I42 A;  5E6O A;  4JGH B;  3BY4 B;  2JUO A;  1EF5 A;  4M0W B;  5DPT A;  1WXM A;  2O2V A;  5JHA A;  2UWQ A;  1UBQ A;  1WXA A;  1J19 A;  1WGG A;  4MEM A;  3W1S C;  3CSF A;  3IG3 A;  4K7W A;  1WGR A;  1WJU A;  4F7Z A;  1WE7 A;  4EFO A;  3AXC A;  4GSW A;  3QAQ A;  3D32 A;  5HKH A;  2LI5 A;  3HHM A;  2IY1 B;  1S1Q B;  1UEL A;  2DZK A;  4IW0 A;  4FBJ B;  1WZ0 A;  4FJY A;  1ZGU B;  4WWO A;  3A4R A;  2I1K A;  3TBL D;  3H9D A;  1Q5W B;  3APD A;  3JSV B;  3PHW B;  1E8X A;  3IVF A;  3WIM A;  3QCA A;  4K1R B;  2N7D A;  2BWE S;  3T8M A;  3VHT C;  4A3P A;  5JH5 C;  2IBI B;  4W9L A;  3A1Q A;  4GDK A;  4GMV A;  4HCP B;  3AU4 A;  2GBJ A;  4W9H A;  3ENE A;  4ANV A;  3ALB A;  2KLC A;  2D10 A;  2NBV B;  2WX1 A;  2RR9 A;  3A4S C;  3AU5 A;  3DBH I;  4I6P A;  4MGY E;  2ZEQ A;  2V4L A;  3Q3F A;  4W9K A;  5BO4 B;  3ZLZ A;  2KC2 A;  3R66 C;  1I35 A;  4II3 B;  4MDK E;  2YVC A;  3RYT A;  1JRU A;  3K9O B;  3NS8 A;  4MGZ E;  3TJP A;  5E6P A;  1FXT B;  2EKE C;  2M4N A;  4TV3 A;  2K6D B;  2KWV B;  2CU1 A;  5CTR C;  4MH0 E;  1RFA A;  2KMA A;  2KKC A;  3KH0 A;  1BT0 A;  2G4D B;  2L8J A;  4GGQ A;  4ANX A;  3OJ4 B;  1V80 A;  3GOE A;  4KIK B;  1UD7 A;  1NDD A;  3M95 A;  1KOT A;  2O6V A;  3TMP B;  4XZ4 A;  2J0K A;  3VFK A;  2WYQ A;  4FLH A;  2O2V B;  3C0R B;  3N30 A;  3PGE A;  2R2Q A;  2MWS B;  1VCB A;  2HD5 B;  1EO6 A;  3DQV A;  4P7I A;  2KJ6 A;  2AWT A;  3L08 A;  4ZRK A;  2KX0 A;  5AZG A;  4LJP B;  4XC2 A;  1E5W A;  3UQA A;  4NPN A;  2ZJD A;  4CHK A;  2LUE A;  3VH4 B;  1IPG A;  2ZCB A;  3PRP B;  3U7D A;  2BYE A;  3PS6 A;  1G6J A;  4NY0 A;  1LFD A;  5J2R A;  2A5U A;  2MRP A;  4WWP A;  1YD8 U;  2ZNV B;  3H1U A;  2K25 A;  4BBN F;  4G11 A;  3DBL I;  1M94 A;  1WZ3 A;  4KSK C;  1WF9 A;  1X1M A;  2C7M B;  1ISN A;  2FCN A;  2BYF A;  5J17 A;  3A1Q B;  4GDK B;  1YIW A;  2BGF A;  4FN2 A;  4URK A;  3PRM B;  4GDL A;  3WAO A;  2KTF A;  5LXH A;  2JT4 B;  2KX3 A;  4HCN B;  2MLB A;  2ZNV C;  1V81 A;  2JVC A;  2KJR A;  4W9E A;  2KK8 A;  3VVW B;  3CMM B;  2N9E B;  2DAJ A;  2DAF A;  1V9J A;  4DDG D;  1UBI A;  5G2N A;  2WX0 A;  1HE8 A;  3A33 B;  1V6E A;  4M8N A;  4M8M A;  2Z0D B;  2CS4 A;  3MTN B;  3RUL A;  3RT3 B;  2AEH A;  2LWP A;  3V61 A;  4EKU A;  3OLM D;  2BF8 B;  4HXD A;  1OEY A;  2G4S A;  2IO1 B;  1A5R A;  2FID A;  1UZX B;  2RD0 A;  4GOC A;  3SDL C;  2IYD B;  3ZW3 A;  2O6V B;  3RD2 A;  1WMH B;  1GNU A;  3UIN B;  4MGK E;  3M3J A;  4EUT A;  2N4F A;  1E8Z A;  1P1A A;  3DVN V;  4BOZ B;  2HE7 A;  3PSE B;  2JPH A;  3DVG X;  3L17 A;  4TQ1 A;  3IBE A;  2BKF A;  2Y5B B;  2J7Q B;  1GC7 A;  3NZS A;  4LCD E;  1P98 A;  5LLI A;  4I6N B;  4E3C A;  2K8B A;  3ONS A;  2KQS A;  3IHP C;  5TR5 A;  3DDC B;  2K39 A;  3B08 A;  3QC8 B;  4ICV A;  3ZNH B;  4ANU A;  3PLV A;  5GMV A;  1LM8 B;  1E7V A;  2O6V D;  3DOW A;  4KV2 A;  5IAA C;  3QA8 A;  4PS3 A;  3QAR A;  2KAN A;  2N9P C;  2KDE B;  2PE9 A;  4E71 A;  5DPW A;  2XK5 A;  5D2M B;  3KUC B;  2JZ3 B;  2FCM A;  4AJY B;  1J0G A;  1Q1O A;  1WR1 A;  3L54 A;  4JIO U;  4OVU A;  1F9J A;  3ML8 A;  2GOW A;  4GDL B;  4LDT B;  2CHZ A;  2YLM A;  4JL9 A;  2LVP A;  2K1F A;  3R7Q A;  3ZNZ B;  2REX A;  4DHZ B;  4IWP A;  1OGW A;  2LGD A;  1RLF A;  3A9J A;  4NJ6 A;  4WJN A;  2LRU A;  4ANW A;  4FUL A;  4N9F 4;  3ZUN A;  4FA6 A;  3N32 A;  2NCN A;  4G3X B;  5AZH A;  1Z2M A;  2ZCC A;  3QQ8 B;  3QJZ A;  1OQY A;  4F1S A;  2JRH A;  4NNJ B;  5D7G A;  1YX6 B;  4MM3 A;  3TCA A;  2KWU B;  1E90 A;  2ZPN A;  2KTR A;  4GXB A;  3WA0 A;  2C7N B;  2GMI C;  3QIJ A;  1WFY A;  4WWN A;  1XD3 B;  2FCS A;  4LDT D;  2C9W B;  3O65 B;  1P9D U;  2PJH A;  5L95 C;  2IY0 B;  2LAS A;  1TZ1 A;  2BPS A;  4MJS A;  4FJV B;  3EC8 A;  3GZN I;  3H7S A;  4X57 B;  2W9N A;  3VTW A;  2ZVO A;  3UIP B;  1WX8 A;  4CYE A;  1K8R B;  1Q0W B;  4BFR A;  4W9G A;  3QK0 A;  3ZRF A;  3KW5 B;  4NAW A;  4ASW C;  1RAX A;  1YQB A;  1IYF A;  2DEN B;  3ZDT A;  2RSU A;  3RCZ A;  3VUX A;  2L0F A;  4GN1 A;  1WYW B;  4DXA B;  4DHZ E;  2NBU A;  5G55 A;  1UGM A;  4EEW A;  1V5T A;  4GU2 A;  3VUY A;  5E6N A;  3ZKJ C;  2KDB A;  2IO0 B;  3AI5 A;  4K7S A;  2RPQ A;  1WXV A;  3PHX B;  1V5O A;  1GC6 A;  1TGZ B;  2D11 A;  1PQS A;  1XQQ A;  5FR6 A;  2LJ5 A;  4G50 A;  3DBS A;  2RGF A;  3H7P A;  5D94 A;  3M62 B;  3VQI A;  4CO7 A;  1CMX B;  2GBR A;  2MSE D;  2KFK A;  3PVL A;  3TL5 A;  2HJ8 A;  2KD0 A;  2XK5 B;  2BKR B;  4HDO A;  5CHV C;  3RZW C;  4BKT A;  2L0T A;  1WGH A;  3KUZ A;  3APF A;  1OTR B;  2KZR A;  2OJR A;  3APC A;  3VXW A;  2ZPY A;  3EHV A;  1SE9 A;  3R3M A;  4XX5 A;  3T9L A;  1P0R A;  2B3A A;  4MSM B;  3PLU A;  3A9J B;  4LJO B;  3UF8 A;  1R4M I;  1VD2 A;  3L16 A;  4WAA A;  3PV1 A;  3KYC D;  1EF1 A;  3SU8 X;  1GJZ A;  4F8C B;  4NQL B;  3B1L X;  3M63 B;  4NJ7 A;  5DPR A;  5C23 A;  3PT2 B;  3X0W A;  1WH3 A;  2KMC A;  5IA7 A;  2KTR B;  4IG7 B;  5KHQ A;  1NBF C;  2FUH B;  4AJW A;  2KN5 A;  5DCN A;  5L83 A;  2L05 A;  1WGD A;  3KUD B;  3V6E B;  4EZL A;  3ZO5 B;  4BKS A;  2C5L C;  4MJS B;  3VTV A;  2AL6 A;  2XBB C;  1XT9 B;  4KVG B;  2PE6 B;  1ZW7 A;  2DZJ A;  4BBN C;  3PRE A;  1C3T A;  4NAW B;  4K7U A;  4A20 A;  4DBG A;  2CR5 A;  3DCG A;  2ASQ A;  2N7E A;  2KQ7 A;  4W9D A;  3SHQ A;  3L0W B;  3W1S A;  4DK5 A;  4WJQ A;  2NPT A;  4W9I A;  4ZDV A;  5AEK B;  4WJO A;  4AUQ C;  3ZRC A;  4MSQ B;  5LXI B;  4FAD A;  4PYU A;  4K81 A;  2NVU I;  3ZDM C;  5JZE B;  3CST A;  3H7P B;  1OEY J;  4RM9 A;  3UQB A;  2KFK B;  2NS5 A;  3LJ3 A;  2MCN B;  1WR6 E;  4DDI D;  3WAN A;  3MJW A;  3PZD A;  2M17 A;  1WI0 A;  2DYO A;  3P2B A;  3VTU A;  2AYO B;  2A4Z A;  4WJP A;  3R7R A;  3LDZ E;  3OJ3 A;  1EUV B;  2KNB A;  2C60 A;  1GUA B;  5C1Z A;  2EMT A;  4PS7 A;  3WAM A;  4B9K A;  5CHW A;  2DHZ A;  2MA9 B;  3NZU A;  1WIA A;  3VDZ A;  4HJK A;  3PRZ A;  2GBM A;  3EFU A;  2L76 A;  4WQO B;  1YJ1 A;  2KFJ A;  4IWQ A;  5KHO A;  2LVO A;  2CHW A;  1WE6 A;  4B95 A;  5CHF A;  2AL3 A;  2ZVN A;  1ZKH A;  4HDQ A;  2KHW B;  3V60 A;  2NBW B;  3HM3 A;  2FAZ A;  2JRI B;  2MQJ A;  2IO3 B;  2KLG A;  2UYZ B;  2DX5 B;  4AOF A;  4DWF A;  4RM8 A;  3BIN A;  1WM2 A;  2G3Q B;  3B0A A;  2NPT B;  4MGI E;  4HLE A;  1WJ4 A;  2KDI A;  3UGB B;  4JLC A;  1YX5 B;  1U4A A;  2ZZP B;  2MBO A;  2EMS A;  2GBK A;  2LZ6 A;  2JF5 A;  3RZF A;  3A9K A;  4BKS D;  1WJ6 A;  2LGY A;  2OOB B;  4IM2 A;  4ZRI A;  2JZZ A;  3SD5 A;  2MP2 A;  4HPM B;  4DHJ B;  4AWJ A;  1WM3 A;  1E8Y A;  2L00 B;  4J6I A;  3V6C B;  4HVB A;  1E7U A;  2J0M A;  3MHS D;  3ZTC A;  2GBN A;  1QZE A;  4TUU A;  1RRB A;  2FCQ A;  2JWZ A;  3IFW B;  3ML9 A;  4KZ0 A;  3HM6 X;  4NQK E;  2MX2 A;  4TQ0 A;  1D3Z A;  2PPH A;  3ZTD A;  3V62 A;  3DBR I;  2N9X A;  2KO3 A;  4II2 B;  2LGX A;  3DVN U;  2L7R A;  2VRR B;  4AP4 C;  2MBE A;  2DYM A;  2Z59 B;  3HK0 A;  4BOS C;  4IC7 B;  4DHJ D;  4HK2 A;  2KC1 A;  3DPD A;  4OVV A; 
#chains in the Genus database with same CATH topology
 3BK1 A;  1WJN A;  1WRD B;  4ITK A;  1L2N A;  1C4P A;  3AE2 B;  1SSN A;  2NR2 A;  2CHX A;  2LMC A;  2D07 B;  1XCQ L;  1R4N I;  1IGC A;  1SIF A;  3ZNG C;  2J42 A;  2JXX A;  1V49 A;  2M8S A;  1IP9 A;  1L4D B;  5IN7 A;  1V2Y A;  2MBH A;  3JVZ X;  3P1M A;  4IWO A;  1MFW A;  1N63 A;  2D2Q A;  1MPE A;  1FO4 A;  3TEY A;  4L1B A;  2N1V A;  3Q8C A;  3TIX A;  2MW5 A;  3GB1 A;  4RGO S;  2N0S B;  3UI3 A;  2WWZ A;  1K51 A;  4M0W A;  2Q5W D;  2INP E;  5CX3 A;  4NJC A;  4BKG A;  3N9Y C;  1AYF A;  2LXA A;  1C1Y B;  3BYY B;  2KYW A;  3Q3J A;  1XCT L;  4KSL C;  1N6Z A;  4YTN B;  3RNF C;  3KVF B;  4BVU C;  3RNA C;  1C79 A;  2XEW A;  3R2I A;  1Q10 A;  1J8C A;  2MJ3 A;  3AV8 A;  5HG2 A;  4EZK A;  3GS2 A;  3JSV A;  4RF0 A;  1CQV A;  1VDV A;  2WXG A;  4KDI C;  4WQM A;  3GE8 C;  1T0Q C;  4YL8 A;  4BZA A;  4YT0 B;  3RFZ B;  2BWF A;  3P4Q B;  3AUL A;  4B0M A;  1JWA D;  2Y3A A;  3VR9 B;  3VH3 B;  4H2A A;  2QHO A;  4DXG A;  2WXQ A;  3MC0 B;  4LNK A;  1P3Q U;  3KQ4 A;  3DVG Y;  3K9P B;  2FIF A;  3U8Z A;  2Y5P A;  3BY4 B;  1EF5 A;  4C80 A;  5DPT A;  5JHA A;  1KLU D;  4LNN A;  1WGG A;  2DNF A;  1WE7 A;  3AXC A;  4GSW A;  3TUO A;  2LI5 A;  3HHM A;  2IY1 B;  4IW0 A;  3C8Y A;  4FBJ B;  4O1N A;  3AEE B;  2KMM A;  1KTK A;  4A3P A;  2CJN A;  2Y5C A;  5G5G A;  4GDK A;  2GBJ A;  4W9H A;  4YXD B;  2KLC A;  2NBV B;  1FPY A;  3U7Z A;  1I7H A;  3R66 C;  2YVC A;  1JRU A;  4A9A A;  3K9O B;  1J7B A;  3TJP A;  5E6P A;  1D4B A;  1KLG D;  4MH0 E;  4ANX A;  1BT0 A;  4GGQ A;  4KIK B;  1EM7 A;  1UD7 A;  2EKI A;  2O6V A;  2J0K A;  3VFK A;  2WYQ A;  4C00 A;  4FLH A;  3N30 A;  2MWS B;  3B2G A;  3RNC C;  4P7I A;  3L08 A;  2PTL A;  5AZG A;  1KF6 B;  3UQA A;  4NPN A;  1WWT A;  5J2R A;  1YD8 U;  1SJH D;  1UWM A;  5BMI A;  5TSS A;  3DBL I;  4IKG A;  1WF9 A;  1X1M A;  2V3P A;  4KSK C;  2FCN A;  3A1Q B;  1NEN B;  2MLB A;  2ZNV C;  3ZXR A;  3NVW A;  1FRD A;  2WLB A;  3VVW B;  2KAJ A;  2X8X X;  1KFY B;  3IT6 B;  2WX0 A;  3A33 B;  3RUL A;  3MTN B;  3N1Y C;  2AEH A;  2LWP A;  3OLM D;  2BF8 B;  2G4S A;  4TSS A;  1A5R A;  2RD0 A;  1QOB A;  3SDL C;  3NVV A;  2H89 B;  4OHJ A;  4EUT A;  1E8Z A;  1QOF A;  2HE7 A;  3DVG X;  4TQ1 A;  2BKF A;  4E3C A;  3MC8 A;  2KN4 A;  2KQS A;  3EGR A;  3AED B;  3BK2 A;  2OHF A;  1LM8 B;  4KV2 A;  3QA8 A;  1YQ4 B;  2GRI A;  5DPW A;  2PE9 A;  4E71 A;  4K3B A;  1Q1O A;  1WR1 A;  3L54 A;  1WRI A;  4OVU A;  1F9J A;  4LDT B;  2CHZ A;  2REX A;  1MJD A;  3J9C A;  1OGW A;  3FAH A;  4WAF A;  2K0P A;  2D3B A;  4A90 A;  4FA6 A;  2V0G A;  2M0A A;  5AZH A;  1OQQ A;  3QJZ A;  3VRA B;  4NNJ B;  2KWU B;  1E90 A;  3T3N A;  2C7N B;  2QCZ A;  4WWN A;  2BVC A;  4LDT D;  2PJH A;  2IY0 B;  2LAS A;  2BPS A;  4CQN A;  2W9N A;  3BVM A;  3UIP B;  5EE0 A;  4CYE A;  4ZHO A;  5D3D A;  1K8R B;  3LB8 C;  4YTM B;  1IYF A;  3RCZ A;  1TJE A;  2L0F A;  1WYW B;  4DHZ E;  1QOA A;  2WXR A;  3ZKJ C;  4K7S A;  3PHX B;  1ZDX A;  4LNF A;  4CO7 A;  2KFK A;  2XK5 B;  2BKR B;  2L83 A;  1VZ7 A;  1OTR B;  3APC A;  1F52 A;  4M00 A;  2ZPY A;  1D5M C;  1WYG A;  1R4N B;  1FNU A;  1VD2 A;  2WGS A;  3PV1 A;  4L2Y A;  1SF0 A;  1DYQ A;  1E6E B;  1GJZ A;  2LHD A;  2LUM A;  4NJ7 A;  5C23 A;  3PT2 B;  1WH3 A;  2KTR B;  4IG7 B;  1NBF C;  5DCN A;  5L83 A;  1WGD A;  3EFC A;  3P4R B;  3V6E B;  4EZL A;  3VTV A;  2PE6 B;  1F2R C;  2J53 A;  1UWX A;  5MPO A;  1C3T A;  3Q8B A;  4K7U A;  2ASQ A;  4WJQ A;  2WDR B;  4ZDV A;  1K53 A;  4WJO A;  4AUQ C;  4MSQ B;  2LEK A;  3DHG C;  3B2F A;  1I4Q A;  4K81 A;  3ZDM C;  2FUG 1;  1ENF A;  2WXL A;  3ABV B;  2NS5 A;  2L32 A;  2WP9 B;  3WAN A;  3PZD A;  2AYO B;  4WJP A;  2BTE A;  1GUA B;  3Q69 A;  5C1Z A;  3WAM A;  5LNK 1;  1JWU D;  2MA9 B;  3NZU A;  1WXQ A;  1K52 A;  3PRZ A;  2L76 A;  1JRP A;  1WE6 A;  3AEF B;  2INN E;  5CHF A;  2ZVN A;  4KGR A;  2KHW B;  3RPF C;  2GI9 A;  2NBW B;  3HM3 A;  2FAZ A;  2UU7 A;  1QKZ A;  2BT6 A;  2DX5 B;  1B1Z A;  4MGI E;  1GOZ A;  1WJ4 A;  2ZZP B;  2GBK A;  5JXV A;  1QT9 A;  1AWD A;  2OOB B;  4IDI A;  4ZRI A;  2MP2 A;  4XWW A;  4KGT A;  1WM3 A;  2GB1 A;  3V6C B;  2GBN A;  3W9C B;  2HDE A;  3ML9 A;  4TQ0 A;  1FRR A;  2PPH A;  2WXK A;  3ZTD A;  3V62 A;  2YEP F;  2YEP B;  3H8H A;  1T3Q A;  2DYM A;  3P63 A;  3HK0 A;  4IC7 B;  1PDX A;  4RGT A;  2KC1 A;  3QX1 A;  1T0Y A;  1NI2 A;  3JYU A;  5IOI A;  4I6L B;  4NAM A;  1NI3 A;  2N1W A;  3WCQ A;  3E9S A;  3WAP A;  1KJT A;  1SGH A;  3CF6 E;  3RNB C;  1C4C A;  2I38 A;  2JY6 A;  3TEX A;  1ZXH A;  2K8H A;  3JW0 X;  2K6Q A;  3U30 A;  4RCO A;  2QDF A;  4GB9 A;  2LXC A;  4IUM B;  1F2R I;  3HRD D;  2DWQ A;  3C19 A;  2JXT A;  2KOX A;  4W9J A;  5GXG B;  2FNJ B;  1R4M B;  2MBQ A;  2WXN A;  3AE8 B;  4FJZ A;  4RFB A;  2WXI A;  4REZ A;  2V1Y A;  3T3O A;  1MHX A;  2H88 B;  2J0J A;  1Y8R C;  2G45 B;  5JHB A;  1HEZ E;  2JSV X;  3PTF C;  1N61 A;  2DZM A;  3AM9 A;  2ACZ B;  3ZVV A;  2M19 A;  2KVR A;  2WXO A;  1C78 A;  4ZRQ A;  2M0X A;  2RMM A;  3ECI A;  4JWU C;  2CKH B;  1KLV A;  5J18 A;  1WY8 A;  4ZYN A;  4ZRJ A;  4EOY A;  2M56 B;  4MH8 A;  2IZV B;  3MHZ A;  2G1E A;  1S3S G;  2DYB A;  5EE1 A;  1JW9 D;  2D3A A;  5D6J B;  2FE8 A;  4KDL B;  2KDF B;  4PS8 A;  2BB5 A;  1LGR A;  1SE3 A;  2IJ0 A;  4UDU C;  3FKY A;  5E6O A;  4JGH B;  3ZJT A;  4K3C A;  2JUO A;  4M0W B;  1WXM A;  2MHJ A;  2BBC A;  2UWQ A;  1UBQ A;  1J19 A;  2E6X A;  4ZOH C;  3IG3 A;  1WGR A;  1WJU A;  2CU3 A;  2K9X A;  3QAQ A;  5HKH A;  4A55 A;  1UEL A;  2W54 A;  4OZA A;  1I4R A;  4FJY A;  1ZGU B;  5IO9 A;  3TBL D;  3JSV B;  2N7D A;  2BWE S;  3T8M A;  1XXG A;  1FFU A;  4ZHP A;  2JWU A;  4ARC A;  2HTM E;  3ENE A;  4ANV A;  2D10 A;  2WX1 A;  3A4S C;  4MGY E;  4I6P A;  4EE2 A;  1JWS D;  2V4L A;  3Q3F A;  4W9K A;  4GLS C;  1I35 A;  4B0E A;  4MGZ E;  2QJL A;  2BS2 B;  4N6E B;  1RFA A;  3KH0 A;  4A6Q A;  3OJ4 B;  1XLN A;  1KOT A;  2EEL A;  3SFD B;  2N9L A;  1YOV B;  2QC8 A;  1E9M A;  5EE3 A;  4XC2 A;  1E5W A;  4HPP A;  4CHK A;  1IPG A;  3PRP B;  1G6J A;  2A5U A;  2MRP A;  4WWP A;  3DHH C;  2ZNV B;  3H1U A;  4BBN F;  4ARI A;  2C7M B;  1ISN A;  2PKO A;  5J17 A;  1FCL A;  4GDK B;  1ACC A;  3PRM B;  4GDL A;  3WAO A;  4ZYS A;  3BYT B;  4JX1 C;  2PMV A;  2KJR A;  1MVK A;  1ROE A;  3CMM B;  2DAJ A;  4P6V F;  4DDG D;  1UBI A;  5G2N A;  1TY0 A;  4M8M A;  3V61 A;  1VR9 A;  4XGA B;  2JZP A;  3PO0 A;  2IO1 B;  3SEB A;  2SAK A;  2O6V B;  3Q6B A;  1WMH B;  1GNU A;  3UIN B;  4MGK E;  5D3I B;  3M3J A;  3PSE B;  3IBE A;  5LLI A;  1C4A A;  4I6N B;  1RM6 C;  4YSX B;  3ONS A;  3IHP C;  1ET9 A;  3DDC B;  1HTQ A;  2K39 A;  3B08 A;  4KX6 B;  3ZNH B;  1HZ5 A;  2O6V D;  2IGD A;  5IAA C;  1OQR A;  1F0Z A;  1ZE3 D;  2JZ3 B;  1J0G A;  3AMZ A;  2PLP A;  4JIO U;  3ML8 A;  2GOW A;  4JL9 A;  1QOG A;  2K1F A;  4DHZ B;  1QF6 A;  2LGD A;  1RLF A;  4NJ6 A;  4ANW A;  1JWB D;  4FUL A;  3ZUN A;  1Z2M A;  2NTS A;  3QQ8 B;  2JRH A;  1VLB A;  2C9W B;  1FIQ A;  3EC8 A;  4X57 B;  3ZJU A;  1WX8 A;  4BFR A;  4W9G A;  1GB4 A;  2DEN B;  3ZDT A;  2KVZ A;  3W5U B;  2RSU A;  3RN9 C;  3PZ8 A;  4DXA B;  2ICI A;  3SR6 A;  1V5T A;  3VUY A;  2IO0 B;  3AI5 A;  1WXV A;  1V5O A;  1GC6 A;  1L0X B;  5FR6 A;  4P1C C;  4BAX A;  3DBS A;  4M02 A;  2RGF A;  3H7P A;  1ZOY B;  2D5G A;  3VQI A;  1CMX B;  2HJ8 A;  4HDO A;  4RH6 A;  3RZW C;  5IP4 D;  1WGH A;  3KUZ A;  4XX5 A;  1P0R A;  3PLU A;  1XO3 A;  4HJG E;  2WXP A;  1YN4 A;  1R4M I;  1TS5 A;  1V1O A;  3L16 A;  4WAA A;  1I4P A;  1TT5 B;  3KYC D;  1EF1 A;  4KGS A;  4F8C B;  4NQL B;  4AJW A;  2KN5 A;  5AUK A;  3ZO5 B;  3V3X A;  4BKS A;  1IUE A;  2AL6 A;  1FNW A;  4KVG B;  2BW2 A;  5BMG A;  4OVZ A;  2DZJ A;  4BBN C;  2J4X A;  2RDG A;  3KWL A;  1V8C A;  4DBG A;  2CR5 A;  4KKJ A;  3L0W B;  3W1S A;  1TS2 A;  1SE4 A;  4RF1 A;  3ZRC A;  2K22 A;  2BYT A;  2NVU I;  3CST A;  3R2T A;  3UQB A;  1YN3 A;  1TYG B;  2KFK B;  2PVG C;  1RYJ A;  3I9V 1;  3BWU D;  3LXF A;  4TMA B;  2M17 A;  3P2B A;  1V97 A;  2DYO A;  3OJ3 A;  2BS3 B;  5T8I A;  2J52 A;  2V4I B;  4B9K A;  4JE3 B;  5CHW A;  4N58 A;  2GBM A;  1WSP A;  1YJ1 A;  4IWQ A;  5KHO A;  2CHW A;  1C77 A;  1ZKH A;  2OED A;  1UF0 A;  3U4E G;  1PFD A;  3HUI A;  3RI7 C;  2IO3 B;  4DWF A;  4RM8 A;  1NVI D;  3W2D A;  3V05 A;  3AE9 B;  1TKG A;  2KDI A;  4LK0 M;  2AQ2 B;  4C4V B;  2EMS A;  3A9K A;  3MP9 A;  4HPM B;  3TEW A;  3MJ5 A;  4AWJ A;  1E8Y A;  2L00 B;  2KAC A;  4J6I A;  4YWG G;  4WUR A;  4MT5 A;  1QZE A;  4TUU A;  1RRB A;  4KZ0 A;  1V1P A;  4NQK E;  3O13 A;  3VRB B;  2N9X A;  4II2 B;  3EUB 2;  3DVN U;  4M01 A;  2VRR B;  2MBE A;  2Z59 B;  2PIA A;  3FIL A;  4HK2 A;  4OVV A;  1KM7 A;  1J7C A;  1F1H A;  3VAW A;  4G0N B;  4XYC A;  2AQ3 B;  2NMQ A;  2FBW B;  2K8C A;  1E0Z A;  2WXJ A;  3AE6 B;  2D3G A;  2KJH B;  3L10 B;  4FXC A;  1UH6 A;  3FC4 A;  2ON8 A;  2WXH A;  4W9C A;  4LNO A;  3E56 A;  2W3R A;  1TTN A;  3NY5 A;  2MP2 B;  4OW0 A;  3LYY A;  4IM3 A;  1DOY A;  1WXS A;  2MBB B;  2XNA C;  2L1A A;  3BII D;  3VUW A;  4AQ7 A;  1TBE A;  2XN9 C;  2KXJ A;  3S2A A;  2VH1 A;  4FHJ A;  1H4R A;  1TIF A;  2LFI A;  1YJJ A;  3OAW A;  3H6N A;  2CJO A;  3W1Y A;  1LXD A;  3QHT A;  2BB6 A;  3I3T B;  3HIZ A;  1WGY A;  4ICU A;  2PEA A;  1ZXI A;  2QMT A;  3NVY A;  1SB3 C;  4MEL A;  2Z0E B;  1ZPS A;  3AEA B;  1GG3 A;  2LRW A;  4XDD A;  1C76 A;  3IAS 1;  1JAL A;  3ZNI D;  2KWD A;  5H8Y E;  4WWM A;  1TS4 A;  1E8W A;  2LJI A;  3P4P B;  3UIO B;  2LVQ A;  4W9F A;  2KWC A;  4E74 A;  4B6W A;  3P4S B;  4TKN A;  3AE7 B;  3QWZ B;  5FKA C;  2MJD A;  4JWS C;  1LQB A;  2V3S A;  4HWI B;  1I42 A;  2O2V A;  2TSS A;  1FM0 D;  4MEM A;  3CSF A;  2B76 B;  1HA5 A;  4K7W A;  1SEB D;  1VRA B;  1S1Q B;  1WZ0 A;  4WWO A;  3A4R A;  2I1K A;  1Q5W B;  3APD A;  3PHW B;  3IVF A;  3WIM A;  3QCA A;  4K1R B;  3VHT C;  5JH5 C;  2IBI B;  4GMV A;  3AU4 A;  2N9K A;  3ALB A;  2RDB C;  3U52 E;  2ONQ A;  3AU5 A;  2ZEQ A;  5BO4 B;  1ZDV A;  1CK1 A;  2KC2 A;  1XLO A;  4MDK E;  2WXM A;  3DBR B;  3ETR A;  1XLP A;  4TV3 A;  5CTR C;  2K6D B;  2CU1 A;  3NUH B;  2KMA A;  3AEG B;  1RWS A;  1UNS A;  2G4D B;  2L8J A;  1WGK A;  1T5X D;  1NDD A;  2IDY A;  4XZ4 A;  4ZRP A;  3ZXV A;  3I63 C;  5BYQ A;  1VCB A;  2HD5 B;  1EO6 A;  2KJ6 A;  2AWT A;  2KX0 A;  3VH4 B;  2ZCB A;  3U7D A;  2BYE A;  3PS6 A;  1LFD A;  5EE9 A;  4P16 A;  2DBY A;  3I57 A;  1MI0 A;  1M94 A;  1YIW A;  2BGF A;  4FN2 A;  4D2K A;  4USA A;  5LXH A;  2JT4 B;  2KX3 A;  2WU2 B;  1V81 A;  2KK8 A;  1RFK A;  2DAF A;  3BVG A;  1BXT A;  3NZ3 A;  1HE8 A;  4M8N A;  2Z0D B;  2CS4 A;  3RT3 B;  1JRO A;  4EKU A;  4DXF A;  4HRO A;  4HXD A;  1D6E C;  1OEY A;  1UZX B;  2V9H A;  2BS4 B;  2IYD B;  5BYS A;  3ZW3 A;  2K3U A;  3NVZ A;  2QEJ C;  3U2S C;  1SXT A;  2X38 A;  2IGG A;  2AX5 A;  1GC7 A;  4LCD E;  1N5X A;  2MEK A;  5TR5 A;  3BZD B;  3QC8 B;  4ICV A;  4ANU A;  4C7Y A;  1NYR A;  5GMV A;  1E7V A;  3DOW A;  5HHD G;  4PS3 A;  3CWI A;  2N9P C;  2KDE B;  3EA6 A;  1FD6 A;  5D2M B;  3KUC B;  1AN8 A;  1CZP A;  2FCM A;  4AJY B;  4PT5 A;  4GDL B;  5IKC M;  1K50 A;  1YNT E;  2YLM A;  4PK1 A;  3ZNZ B;  1SE2 A;  3Q8A A;  3A9J A;  4WJN A;  2LRU A;  3GP7 A;  3N20 C;  2MH7 A;  2GLS A;  2SEB D;  1IGD A;  1OQY A;  2ZCC A;  5D7G A;  1YX6 B;  4MM3 A;  3TCA A;  4GXB A;  2GMI C;  1XD3 B;  2FCS A;  4R3D A;  1P9D U;  2IGH A;  4MJS A;  4WIP A;  3GZN I;  3H7S A;  3VTW A;  2ZVO A;  2VH2 A;  1Q0W B;  1E10 A;  3KW5 B;  4NAW A;  4ASW C;  1RAX A;  2I2Y A;  1GAQ B;  3VUX A;  1IBX A;  1D5Z C;  2NBU A;  3ZQ4 A;  4GU2 A;  5E6N A;  1DOI A;  2RPQ A;  2D11 A;  1PQS A;  1XQQ A;  2Z8L A;  4G50 A;  5D94 A;  3DBH B;  3M62 B;  3PVL A;  4L23 A;  4BKT A;  2L0T A;  2JQR B;  2KZR A;  3APF A;  1SE9 A;  3R3M A;  3T9L A;  2B3A A;  4MSM B;  1QQR A;  2NTT A;  4LJO B;  4XDC A;  4US9 A;  3UF8 A;  3VR8 B;  1TKE A;  3SU8 X;  5DPR A;  3B1L X;  3M63 B;  5IA7 A;  5KHQ A;  2JX5 A;  2L05 A;  4OZC A;  1JWM D;  3KUD B;  4YSY B;  1F77 A;  2XBB C;  1XT9 B;  1YMH E;  3KLS X;  1ZW7 A;  2LHE A;  4HEA 1;  4HKQ A;  1XF5 L;  2V3N A;  3SHQ A;  2N7E A;  4W9D A;  2KQ7 A;  4JPS A;  2NPT A;  1FMA D;  4XWT A;  4C7Z A;  1N60 A;  5LXI B;  4FAD A;  4PYU A;  5JZE B;  1ZUD 2;  4OZB A;  1J7A A;  3H7P B;  3NRZ A;  4RM9 A;  4LTU A;  2RPV A;  3DWM A;  1MG4 A;  4AS1 A;  3AE1 B;  1WR6 E;  1JML A;  3Q8F A;  4DDI D;  3MJW A;  3VTU A;  4N59 A;  1HXY D;  2A4Z A;  3LDZ E;  1NEK B;  1EUV B;  1EU3 A;  2EMT A;  4PS7 A;  3MFG A;  1WIA A;  3VDZ A;  4HJK A;  3AEC B;  1KH0 A;  2WXF A;  4WQO B;  2LVO A;  5AUI A;  4B95 A;  1LO5 D;  2WQY B;  2AL3 A;  4S17 A;  3AE4 B;  3V60 A;  2LGS A;  2JYE A;  3B0A A;  3UGB B;  1YX5 B;  2MBO A;  2IND C;  1D5X C;  1SBB B;  2L52 A;  2OJW A;  2LZ6 A;  2JF5 A;  3RZF A;  4YSZ B;  4BKS D;  1JQ4 A;  2LGY A;  4IM2 A;  2JZZ A;  1FEH A;  2WU5 B;  4Q2J A;  2WS3 B;  3MHS D;  3ZTC A;  5G5H A;  4XE0 A;  2MX2 A;  3Q3N C;  1SIJ A;  3AEB B;  3DBR I;  2LGX A;  1XEE A;  4AP4 C;  2VZK B;  4LLG M;  4BOS C;  3IT4 B;  3OWE B;  1M4V A;  1HTO A;  4KKI A;  4US8 A;  4HRS A;  4JQW C;  3RNG C;  3N3K B;  4IM0 A;  1WX9 A;  3AE3 B;  1MHH E;  1WX7 A;  5C3J B;  3NOB A;  4J3O D;  4P1B C;  2JYT A;  2N7J A;  2DZI A;  2VZK D;  3ZIM A;  3EEC A;  4RMA A;  1WMH A;  2INC C;  2I1J A;  3GE3 C;  1L7Y A;  2C7H A;  3A9K B;  3CIR B;  1P7E A;  2M1M A;  4HPL B;  3B9J A;  1V1P B;  2LD9 A;  3RNE C;  3WAL A;  3L13 A;  1AAR A;  1FXI A;  3FIL B;  1MG8 A;  4ACF A;  1YJI A;  2WDQ B;  2QSD A;  3NHE B;  5DPS A;  2IO2 B;  3URY A;  1V86 A;  2HTH A;  3KYD D;  2R2O A;  4GIV A;  1H8C A;  1L6U A;  4PYZ A;  1TS3 A;  3P42 A;  3N1Z C;  3Q14 C;  1Z5S B;  4A8X C;  5AZF A;  5EDS A;  4WH4 A;  2AQ1 B;  2RDH A;  2L3Z A;  1UGJ A;  4A3O A;  4KZC A;  3RUI B;  3PPA A;  4C56 C;  4FHK A;  3X23 A;  4EZJ A;  2BYV E;  1E7P B;  5HFY A;  2WDT B;  1GPX A;  2PVO D;  4KIK A;  1TZO A;  1SJE D;  1PGA A;  1WXA A;  1BML C;  3AN1 A;  5H92 C;  3W1S C;  3N1X C;  4F7Z A;  4EFO A;  3D32 A;  2DZK A;  1Y56 A;  3H9D A;  4RGM A;  1E8X A;  3NS1 A;  4DQO C;  2QIE B;  1TKY A;  3DWG C;  4W9L A;  3A1Q A;  2BQQ A;  4HCP B;  2G9H D;  1FXA A;  3GZN B;  1L6V A;  3DBH I;  2RR9 A;  3R8B A;  3ZLZ A;  2W82 A;  2LGI A;  4II3 B;  3SFE B;  2KT7 A;  3RYT A;  3NS8 A;  1FXT B;  2EKE C;  2M4N A;  2KWV B;  2KKC A;  1VZ8 A;  1V80 A;  3GOE A;  3NG0 A;  3M95 A;  1QIL A;  3TMP B;  1I4H A;  4QAY A;  2O2V B;  3C0R B;  3PGE A;  2R2Q A;  1CJE A;  3DQV A;  4ZRK A;  4LJP B;  5C2T B;  2ZJD A;  2LUE A;  4NY0 A;  2K25 A;  3I5J C;  4NZL B;  4G11 A;  1WZ3 A;  2BYF A;  3ZJV A;  4URK A;  1ET6 A;  3TSS A;  1PUT A;  2KTF A;  1HZ6 A;  1QLB B;  4HCN B;  2JVC A;  4W9E A;  1T0R C;  3L4P A;  2N9E B;  1V9J A;  3ZGZ A;  1V6E A;  1L5P A;  1A70 A;  4C4V A;  1T6B X;  2FID A;  5FK9 C;  4GOC A;  1T0S C;  3NJT A;  3RD2 A;  2N4F A;  1P1A A;  3DVN V;  4BOZ B;  1I4X A;  2JPH A;  3L17 A;  2ZW0 A;  2Y5B B;  2J7Q B;  3NZS A;  1P98 A;  2HJ1 A;  2K8B A;  2K5P A;  1PGB A;  3Q3M C;  1L4Z B;  3PLV A;  1N62 A;  4MAC A;  4YTP B;  3QAR A;  2KAN A;  1VJK A;  2XK5 A;  4RGN A;  2LVP A;  2JU6 X;  3R7Q A;  3AH7 A;  4IWP A;  2R61 A;  4N9F 4;  3OG5 A;  3N32 A;  2KDM A;  2NCN A;  4G3X B;  1DGJ A;  4F1S A;  3Q2A C;  1C9F A;  2ZPN A;  2KTR A;  3WA0 A;  3QIJ A;  1WFY A;  3O65 B;  5HI1 A;  5L95 C;  1TZ1 A;  4FJV B;  3IAM 1;  1YN5 A;  3QK0 A;  3ZRF A;  1YQB A;  4S0R A;  4GN1 A;  5G55 A;  1UGM A;  4EEW A;  3PZ7 A;  2KDB A;  1TGZ B;  2LJ5 A;  3BVZ A;  1P7F A;  1ZP0 B;  1PGX A;  2MSE D;  2GBR A;  3TL5 A;  2KD0 A;  5CHV C;  3VXW A;  1R7S A;  2OJR A;  1STE A;  3EHV A;  3TEZ A;  1VZ6 A;  2W3S A;  3A9J B;  3IXS A;  5BMH A;  1NYQ A;  2KQ4 X;  5I4D A;  2IPK D;  3X0W A;  4MM3 B;  2KMC A;  2MJE A;  2FUH B;  1GB1 A;  1YQ3 B;  2C5L C;  1L0V B;  4MJS B;  1PYW D;  1FNV A;  3MC9 A;  3PRE A;  2D3C A;  4NAW B;  2WDV B;  4A20 A;  3DCG A;  4DK5 A;  3KWV A;  1IBX B;  4W9I A;  3DBL B;  5E6J A;  5AEK B;  1EWC A;  3Q3O C;  1B9R A;  1AW7 A;  1OEY J;  5FR3 A;  1HQR D;  2WHI A;  1EWY C;  3LJ3 A;  3RMK C;  2MCN B;  3HVD A;  3AB5 A;  1WI0 A;  3R7R A;  2KNB A;  2C60 A;  1EU4 A;  2QIL A;  2W55 A;  2DHZ A;  2DLB A;  1N5W A;  1UUP A;  1KRH A;  3EFU A;  2PW9 A;  2KFJ A;  4LNI A;  1FCC C;  3AE5 B;  1TY2 A;  3W5V B;  4HDQ A;  3ZYY X;  3Q8E A;  2JRI B;  2MQJ A;  2ZW1 A;  2KLG A;  2UYZ B;  4AOF A;  3BIN A;  1I4G A;  1WM2 A;  2G3Q B;  2NPT B;  4HLE A;  4JLC A;  1JCK B;  1U4A A;  2E3T A;  1WJ6 A;  3SD5 A;  3HVZ A;  4DHJ B;  1XLQ A;  1FFV A;  4IOI E;  4HVB A;  1E7U A;  1DOX A;  2J0M A;  1BUI C;  2FCQ A;  2JWZ A;  1OFF A;  3IFW B;  5BYR A;  3HM6 X;  1D3Z A;  2WNM A;  4RNA A;  2KO3 A;  2L7R A;  1L0Y B;  1ESF A;  3DHI C;  4DHJ D;  4HKZ E;  3DPD A; 
#chains in the Genus database with same CATH homology
 1KM7 A;  3QX1 A;  1T0Y A;  1NI2 A;  3JYU A;  1WJN A;  4I6L B;  1WRD B;  1L2N A;  4JQW C;  3VAW A;  3N3K B;  2N1W A;  4G0N B;  2NR2 A;  4IM0 A;  1WX9 A;  3WAP A;  1KJT A;  1SGH A;  3CF6 E;  1WX7 A;  2CHX A;  3NOB A;  2K8C A;  2DZI A;  2D07 B;  2JY6 A;  1R4N I;  3ZIM A;  2K8H A;  3EEC A;  1SIF A;  3JW0 X;  2K6Q A;  3U30 A;  2D3G A;  3ZNG C;  2KJH B;  2JXX A;  1V49 A;  3L10 B;  1UH6 A;  2M8S A;  4RMA A;  1IP9 A;  4GB9 A;  1WMH A;  2LXC A;  4IUM B;  1V2Y A;  2MBH A;  3JVZ X;  4W9C A;  4IWO A;  2I1J A;  1L7Y A;  2C7H A;  2D2Q A;  3A9K B;  2KOX A;  1TTN A;  3NY5 A;  2MP2 B;  4W9J A;  4IM3 A;  1WXS A;  2FNJ B;  2MBQ A;  2MBB B;  4FJZ A;  2M1M A;  4HPL B;  2N1V A;  3VUW A;  1TBE A;  3TIX A;  2MW5 A;  2V1Y A;  2KXJ A;  3S2A A;  2LD9 A;  3WAL A;  2WWZ A;  4FHJ A;  1H4R A;  2J0J A;  5CX3 A;  1Y8R C;  3L13 A;  2G45 B;  5JHB A;  4BKG A;  1AAR A;  3OAW A;  2DZM A;  3PTF C;  3H6N A;  3W1Y A;  2LXA A;  1C1Y B;  3Q3J A;  1LXD A;  3QHT A;  3ZVV A;  4KSL C;  3I3T B;  1MG8 A;  2KVR A;  3HIZ A;  3KVF B;  1WGY A;  4BVU C;  2PEA A;  2M0X A;  2XEW A;  3ECI A;  3NHE B;  4ICU A;  5DPS A;  2IO2 B;  2CKH B;  1KLV A;  1V86 A;  1J8C A;  2HTH A;  4EZK A;  3KYD D;  3JSV A;  5J18 A;  2R2O A;  4GIV A;  4MEL A;  1WY8 A;  2Z0E B;  4ZYN A;  4ZRJ A;  1GG3 A;  2LRW A;  4EOY A;  1H8C A;  4PYZ A;  4KDI C;  3ZNI D;  1Z5S B;  1E8W A;  4YL8 A;  5AZF A;  2IZV B;  3UIO B;  5EDS A;  2LVQ A;  4W9F A;  2BWF A;  1S3S G;  2DYB A;  2KWC A;  3AUL A;  4E74 A;  4B6W A;  5D6J B;  4TKN A;  2L3Z A;  4A3O A;  3VH3 B;  4KZC A;  3QWZ B;  2QHO A;  3RUI B;  3PPA A;  4KDL B;  2KDF B;  4PS8 A;  1LQB A;  4FHK A;  3X23 A;  4EZJ A;  2BYV E;  1P3Q U;  2WDT B;  3DVG Y;  3K9P B;  2FIF A;  4KIK A;  2V3S A;  4HWI B;  3U8Z A;  1I42 A;  5E6O A;  4JGH B;  3BY4 B;  2JUO A;  1EF5 A;  4M0W B;  5DPT A;  1WXM A;  2O2V A;  5JHA A;  2UWQ A;  1UBQ A;  1WXA A;  1J19 A;  1WGG A;  4MEM A;  3W1S C;  3CSF A;  3IG3 A;  4K7W A;  1WGR A;  1WJU A;  4F7Z A;  1WE7 A;  4EFO A;  3AXC A;  4GSW A;  3QAQ A;  3D32 A;  5HKH A;  2LI5 A;  3HHM A;  2IY1 B;  1S1Q B;  1UEL A;  2DZK A;  4IW0 A;  4FBJ B;  1WZ0 A;  4FJY A;  1ZGU B;  4WWO A;  3A4R A;  2I1K A;  3TBL D;  3H9D A;  1Q5W B;  3APD A;  3JSV B;  3PHW B;  1E8X A;  3IVF A;  3WIM A;  3QCA A;  4K1R B;  2N7D A;  2BWE S;  3T8M A;  3VHT C;  4A3P A;  5JH5 C;  2IBI B;  4W9L A;  3A1Q A;  4GDK A;  4GMV A;  4HCP B;  3AU4 A;  2GBJ A;  4W9H A;  3ENE A;  4ANV A;  3ALB A;  2KLC A;  2D10 A;  2NBV B;  2WX1 A;  2RR9 A;  3A4S C;  3AU5 A;  3DBH I;  4I6P A;  4MGY E;  2ZEQ A;  2V4L A;  3Q3F A;  4W9K A;  5BO4 B;  3ZLZ A;  2KC2 A;  3R66 C;  1I35 A;  4II3 B;  4MDK E;  2YVC A;  3RYT A;  1JRU A;  3K9O B;  3NS8 A;  4MGZ E;  3TJP A;  5E6P A;  1FXT B;  2EKE C;  2M4N A;  4TV3 A;  2K6D B;  2KWV B;  2CU1 A;  5CTR C;  4MH0 E;  1RFA A;  2KMA A;  2KKC A;  3KH0 A;  1BT0 A;  2G4D B;  2L8J A;  4GGQ A;  4ANX A;  3OJ4 B;  1V80 A;  3GOE A;  4KIK B;  1UD7 A;  1NDD A;  3M95 A;  1KOT A;  2O6V A;  3TMP B;  4XZ4 A;  2J0K A;  3VFK A;  2WYQ A;  4FLH A;  2O2V B;  3C0R B;  3N30 A;  3PGE A;  2R2Q A;  2MWS B;  1VCB A;  2HD5 B;  1EO6 A;  3DQV A;  4P7I A;  2KJ6 A;  2AWT A;  3L08 A;  4ZRK A;  2KX0 A;  5AZG A;  4LJP B;  4XC2 A;  1E5W A;  3UQA A;  4NPN A;  2ZJD A;  4CHK A;  2LUE A;  3VH4 B;  1IPG A;  2ZCB A;  3PRP B;  3U7D A;  2BYE A;  3PS6 A;  1G6J A;  4NY0 A;  1LFD A;  5J2R A;  2A5U A;  2MRP A;  4WWP A;  1YD8 U;  2ZNV B;  3H1U A;  2K25 A;  4BBN F;  4G11 A;  3DBL I;  1M94 A;  1WZ3 A;  4KSK C;  1WF9 A;  1X1M A;  2C7M B;  1ISN A;  2FCN A;  2BYF A;  5J17 A;  3A1Q B;  4GDK B;  1YIW A;  2BGF A;  4FN2 A;  4URK A;  3PRM B;  4GDL A;  3WAO A;  2KTF A;  5LXH A;  2JT4 B;  2KX3 A;  4HCN B;  2MLB A;  2ZNV C;  1V81 A;  2JVC A;  2KJR A;  4W9E A;  2KK8 A;  3VVW B;  3CMM B;  2N9E B;  2DAJ A;  2DAF A;  1V9J A;  4DDG D;  1UBI A;  5G2N A;  2WX0 A;  1HE8 A;  3A33 B;  1V6E A;  4M8N A;  4M8M A;  2Z0D B;  2CS4 A;  3MTN B;  3RUL A;  3RT3 B;  2AEH A;  2LWP A;  3V61 A;  4EKU A;  3OLM D;  2BF8 B;  4HXD A;  1OEY A;  2G4S A;  2IO1 B;  1A5R A;  2FID A;  1UZX B;  2RD0 A;  4GOC A;  3SDL C;  2IYD B;  3ZW3 A;  2O6V B;  3RD2 A;  1WMH B;  1GNU A;  3UIN B;  4MGK E;  3M3J A;  4EUT A;  2N4F A;  1E8Z A;  1P1A A;  3DVN V;  4BOZ B;  2HE7 A;  3PSE B;  2JPH A;  3DVG X;  3L17 A;  4TQ1 A;  3IBE A;  2BKF A;  2Y5B B;  2J7Q B;  1GC7 A;  3NZS A;  4LCD E;  1P98 A;  5LLI A;  4I6N B;  4E3C A;  2K8B A;  3ONS A;  2KQS A;  3IHP C;  5TR5 A;  3DDC B;  2K39 A;  3B08 A;  3QC8 B;  4ICV A;  3ZNH B;  4ANU A;  3PLV A;  5GMV A;  1LM8 B;  1E7V A;  2O6V D;  3DOW A;  4KV2 A;  5IAA C;  3QA8 A;  4PS3 A;  3QAR A;  2KAN A;  2N9P C;  2KDE B;  2PE9 A;  4E71 A;  5DPW A;  2XK5 A;  5D2M B;  3KUC B;  2JZ3 B;  2FCM A;  4AJY B;  1J0G A;  1Q1O A;  1WR1 A;  3L54 A;  4JIO U;  4OVU A;  1F9J A;  3ML8 A;  2GOW A;  4GDL B;  4LDT B;  2CHZ A;  2YLM A;  4JL9 A;  2LVP A;  2K1F A;  3R7Q A;  3ZNZ B;  2REX A;  4DHZ B;  4IWP A;  1OGW A;  2LGD A;  1RLF A;  3A9J A;  4NJ6 A;  4WJN A;  2LRU A;  4ANW A;  4FUL A;  4N9F 4;  3ZUN A;  4FA6 A;  3N32 A;  2NCN A;  4G3X B;  5AZH A;  1Z2M A;  2ZCC A;  3QQ8 B;  3QJZ A;  1OQY A;  4F1S A;  2JRH A;  4NNJ B;  5D7G A;  1YX6 B;  4MM3 A;  3TCA A;  2KWU B;  1E90 A;  2ZPN A;  2KTR A;  4GXB A;  3WA0 A;  2C7N B;  2GMI C;  3QIJ A;  1WFY A;  4WWN A;  1XD3 B;  2FCS A;  4LDT D;  2C9W B;  3O65 B;  1P9D U;  2PJH A;  5L95 C;  2IY0 B;  2LAS A;  1TZ1 A;  2BPS A;  4MJS A;  4FJV B;  3EC8 A;  3GZN I;  3H7S A;  4X57 B;  2W9N A;  3VTW A;  2ZVO A;  3UIP B;  1WX8 A;  4CYE A;  1K8R B;  1Q0W B;  4BFR A;  4W9G A;  3QK0 A;  3ZRF A;  3KW5 B;  4NAW A;  4ASW C;  1RAX A;  1YQB A;  1IYF A;  2DEN B;  3ZDT A;  2RSU A;  3RCZ A;  3VUX A;  2L0F A;  4GN1 A;  1WYW B;  4DXA B;  4DHZ E;  2NBU A;  5G55 A;  1UGM A;  4EEW A;  1V5T A;  4GU2 A;  3VUY A;  5E6N A;  3ZKJ C;  2KDB A;  2IO0 B;  3AI5 A;  4K7S A;  2RPQ A;  1WXV A;  3PHX B;  1V5O A;  1GC6 A;  1TGZ B;  2D11 A;  1PQS A;  1XQQ A;  5FR6 A;  2LJ5 A;  4G50 A;  3DBS A;  2RGF A;  3H7P A;  5D94 A;  3M62 B;  3VQI A;  4CO7 A;  1CMX B;  2GBR A;  2MSE D;  2KFK A;  3PVL A;  3TL5 A;  2HJ8 A;  2KD0 A;  2XK5 B;  2BKR B;  4HDO A;  5CHV C;  3RZW C;  4BKT A;  2L0T A;  1WGH A;  3KUZ A;  3APF A;  1OTR B;  2KZR A;  2OJR A;  3APC A;  3VXW A;  2ZPY A;  3EHV A;  1SE9 A;  3R3M A;  4XX5 A;  3T9L A;  1P0R A;  2B3A A;  4MSM B;  3PLU A;  3A9J B;  4LJO B;  3UF8 A;  1R4M I;  1VD2 A;  3L16 A;  4WAA A;  3PV1 A;  3KYC D;  1EF1 A;  3SU8 X;  1GJZ A;  4F8C B;  4NQL B;  3B1L X;  3M63 B;  4NJ7 A;  5DPR A;  5C23 A;  3PT2 B;  3X0W A;  1WH3 A;  2KMC A;  5IA7 A;  2KTR B;  4IG7 B;  5KHQ A;  1NBF C;  2FUH B;  4AJW A;  2KN5 A;  5DCN A;  5L83 A;  2L05 A;  1WGD A;  3KUD B;  3V6E B;  4EZL A;  3ZO5 B;  4BKS A;  2C5L C;  4MJS B;  3VTV A;  2AL6 A;  2XBB C;  1XT9 B;  4KVG B;  2PE6 B;  1ZW7 A;  2DZJ A;  4BBN C;  3PRE A;  1C3T A;  4NAW B;  4K7U A;  4A20 A;  4DBG A;  2CR5 A;  3DCG A;  2ASQ A;  2N7E A;  2KQ7 A;  4W9D A;  3SHQ A;  3L0W B;  3W1S A;  4DK5 A;  4WJQ A;  2NPT A;  4W9I A;  4ZDV A;  5AEK B;  4WJO A;  4AUQ C;  3ZRC A;  4MSQ B;  5LXI B;  4FAD A;  4PYU A;  4K81 A;  2NVU I;  3ZDM C;  5JZE B;  3CST A;  3H7P B;  1OEY J;  4RM9 A;  3UQB A;  2KFK B;  2NS5 A;  3LJ3 A;  2MCN B;  1WR6 E;  4DDI D;  3WAN A;  3MJW A;  3PZD A;  2M17 A;  1WI0 A;  2DYO A;  3P2B A;  3VTU A;  2AYO B;  2A4Z A;  4WJP A;  3R7R A;  3LDZ E;  3OJ3 A;  1EUV B;  2KNB A;  2C60 A;  1GUA B;  5C1Z A;  2EMT A;  4PS7 A;  3WAM A;  4B9K A;  5CHW A;  2DHZ A;  2MA9 B;  3NZU A;  1WIA A;  3VDZ A;  4HJK A;  3PRZ A;  2GBM A;  3EFU A;  2L76 A;  4WQO B;  1YJ1 A;  2KFJ A;  4IWQ A;  5KHO A;  2LVO A;  2CHW A;  1WE6 A;  4B95 A;  5CHF A;  2AL3 A;  2ZVN A;  1ZKH A;  4HDQ A;  2KHW B;  3V60 A;  2NBW B;  3HM3 A;  2FAZ A;  2JRI B;  2MQJ A;  2IO3 B;  2KLG A;  2UYZ B;  2DX5 B;  4AOF A;  4DWF A;  4RM8 A;  3BIN A;  1WM2 A;  2G3Q B;  3B0A A;  2NPT B;  4MGI E;  4HLE A;  1WJ4 A;  2KDI A;  3UGB B;  4JLC A;  1YX5 B;  1U4A A;  2ZZP B;  2MBO A;  2EMS A;  2GBK A;  2LZ6 A;  2JF5 A;  3RZF A;  3A9K A;  4BKS D;  1WJ6 A;  2LGY A;  2OOB B;  4IM2 A;  4ZRI A;  2JZZ A;  3SD5 A;  2MP2 A;  4HPM B;  4DHJ B;  4AWJ A;  1WM3 A;  1E8Y A;  2L00 B;  4J6I A;  3V6C B;  4HVB A;  1E7U A;  2J0M A;  3MHS D;  3ZTC A;  2GBN A;  1QZE A;  4TUU A;  1RRB A;  2FCQ A;  2JWZ A;  3IFW B;  3ML9 A;  4KZ0 A;  3HM6 X;  4NQK E;  2MX2 A;  4TQ0 A;  1D3Z A;  2PPH A;  3ZTD A;  3V62 A;  3DBR I;  2N9X A;  2KO3 A;  4II2 B;  2LGX A;  3DVN U;  2L7R A;  2VRR B;  4AP4 C;  2MBE A;  2DYM A;  2Z59 B;  3HK0 A;  4BOS C;  4IC7 B;  4DHJ D;  4HK2 A;  2KC1 A;  3DPD A;  4OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...