2KK8A

Nmr solution structure of a putative uncharacterized protein obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3449a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AT4g05270
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kk8A01
4LDTB 2IYDB 1TBEA 1WH3A 2MLBA 2XK5B 3D32A 1GJZA 1P0RA 3L54A 1XQQA 1MG8A 2IO2B 4IC7B 1OEYA 4XC2A 1H8CA 1WM3A 2KDFB 3N32A 2KJRA 2K6QA 4ANWA 3WANA 4KZCA 4X57B 3HHMA 1IP9A 4FULA 4DK5A 2KX3A 1D3ZA 1OGWA 4FJYA 5DPRA 1E5WA 3RZFA 2M0XA 2MW5A 4GSWA 1WGYA 3OJ3A 3QQ8B 1WJNA 3PRMB 3L0WB 4PYZA 5HKHA 3ZKJC 4AOFA 4W9LA 2PJHA 2D3GA 3JSVA 4TKNA 5D7GA 3UIPB 4MJSB 2BKFA 2FIFA 2M1MA 2CU1A 4EZJA 2ZNVB 3VVWB 4EEWA 2N9PC 5DCNA 3CMMB 3HM3A 3PLUA 4CO7A 3RD2A 4PYUA 2WDTB 4K81A 4MSMB 3PLVA 4DHZE 1E8WA 2KOXA 2FNJB 4KDLB 4ANVA 4GXBA 4EKUA 3Q3JA 4K7UA 3UQAA 2G4DB 5AZGA 2IY0B 1EUVB 2LGDA 4RM9A 4ZDVA 4MGKE 2GMIC 2MP2B 3EHVA 3MHSD 3X23A 3B08A 2IBIB 3KW5B 5G2NA 2HD5B 4GDLB 2HTHA 1GC7A 4E74A 3KUDB 3VDZA 1BT0A 3ONSA 4G0NB 2ZNVC 2DYMA 4TQ0A 4LCDE 4W9KA 1IPGA 2KZRA 3AI5A 3A9KA 3R3MA 4WWOA 4LJPB 1RRBA 1T0YA 2MRPA 4FJVB 3KUCB 1SGHA 3QJZA 3EECA 4YL8A 4W9IA 5CHWA 2ZEQA 2FCMA 3A4RA 2C9WB 3QHTA 1L2NA 4AWJA 2Y5BB 3VUXA 3RT3B 3ECIA 2UWQA 4TUUA 3CSTA 3NZUA 2A5UA 1WIAA 4IWOA 3VFKA 1VCBA 3KYDD 4JLCA 2DZIA 4K7WA 4GGQA 4HDQA 3NOBA 1NI2A 5CHVC 4ICUA 4NPNA 4I6PA 2J0JA 3AU5A 1E8YA 1TTNA 4AJWA 3PTFC 1WR6E 3PREA 3B0AA 2AL3A 1IYFA 3JSVB 3TMPB 5JZEB 2RSUA 4MJSA 2G3QB 3DBHI 3ZRFA 1P3QU 3GZNI 3H7PA 4W9EA 4IM0A 1V5OA 3W1SA 4NAWA 5DPWA 4A3OA 1KJTA 4E3CA 2KNBA 2LWPA 2LZ6A 2NBUA 3A33B 2DAFA 2KN5A 2LVQA 1WE7A 2N7EA 3O65B 1LQBA 2C7MB 4OVVA 3PS6A 4FJZA 2GBKA 2M8SA 4HPMB 2JT4B 2LXCA 4M8MA 3L16A 2WYQA 2G45B 1Z2MA 4GMVA 2EMTA 2FIDA 3RUIB 5JH5C 1WRDB 3QC8B 4XZ4A 4WAAA 1YX5B 1UGMA 3DQVA 2KWCA 2JWZA 2MBBB 3APCA 2C7NB 1WGGA 2L76A 1UZXB 3PRZA 1FXTB 2L00B 1UBQA 2OOBB 1C3TA 4J6IA 1EO6A 2ASQA 2L0FA 2LRWA 3U7DA 2N1WA 2G4SA 5C1ZA 2L05A 1OQYA 2REXA 2K39A 2FAZA 4K1RB 2DHZA 3RYTA 3JW0X 1WY8A 4CYEA 4FLHA 4BFRA 3RULA 5JHBA 2BWES 4FHKA 3VUYA 2LVOA 4EFOA 4GN1A 2LGYA 5IA7A 4ZRIA 2MWSB 3AXCA 4W9HA 2LGXA 2JZ3B 1KM7A 2KC1A 4KSKC 4AJYB 4NNJB 2KKCA 3ZNZB 2LD9A 1V86A 3QCAA 1Z5SB 3H6NA 4A3PA 4GDKA 4HCPB 4FA6A 3TIXA 2KDEB 1U4AA 3A1QB 4KVGB 5KHOA 1WJUA 4ZRKA 2CHWA 2UYZB 3AU4A 2D2QA 2KK8A 2M4NA 2DYBA 3ENEA 1M94A 2M17A 4PS8A 2C5LC 3QX1A 4HVBA 2JPHA 3UINB 4II2B 5JHAA 1WM2A 2KJ6A 2EKEC 4BVUC 3KH0A 1OEYJ 1J0GA 4NJ6A 1Q1OA 4XX5A 2YLMA 4MSQB 1Q5WB 4WJQA 2LI5A 2D07B 2BKRB 2K8BA 3ZIMA 4E71A 1J19A 2JXXA 3PV1A 1NDDA 1WGHA 3S2AA 1YX6B 2D11A 3WAOA 2O2VA 2MSED 5LXIB 4MEMA 2KVRA 3VTWA 4F8CB 4BKGA 1RAXA 2MBOA 1UELA 5CTRC 1E90A 2MBHA 2CHXA 3ZDMC 1E8XA 5EDSA 2IO3B 3IFWB 4P7IA 5J18A 5CX3A 5DPTA 3VTVA 3R7QA 1HE8A 4IW0A 3V60A 4DHJB 1R4MI 3ZDTA 3DBLI 1CMXB 1AARA 1GUAB 1JRUA 1WMHB 5D2MB 2ZVNA 2K8CA 4JL9A 2LASA 3ALBA 3V6EB 1Y8RC 3PHXB 4B95A 4BBNF 2N9EB 3CF6E 2R2QA 3CSFA 4ANUA 1WJ6A 2KX0A 4BKSD 5AZHA 4IWQA 1WGRA 1WI0A 3VH3B 2R2OA 3W1SC 1WXVA 4BBNC 2NR2A 2DAJA 3DVNU 3V62A 4WJNA 3LJ3A 4M0WB 4OVUA 3ZLZA 1A5RA 2NCNA 2I1KA 2ZPYA 3NZSA 5TR5A 3ML9A 2FCSA 1S3SG 2Z0DB 2ZJDA 2MCNB 1ISNA 2BF8B 2MP2A 3IHPC 1V9JA 4IUMB 3OAWA 3GOEA 3TJPA 3TBLD 2BYFA 4HWIB 3N30A 2MX2A 3PGEA 1GG3A 2KWUB 3DCGA 2KANA 2KO3A 3VH4B 3W1YA 3ZO5B 4W9CA 3I3TB 4IM2A 2JY6A 4AUQC 3ZW3A 3SDLC 3EC8A 3SHQA 2RD0A 4G11A 1WXAA 3PT2B 3V6CB 1LXDA 2JZZA 2K6DB 2PE6B 3WALA 5J17A 3BY4B 2V3SA 5E6NA 1SIFA 3IG3A 2OJRA 1QZEA 4ANXA 2GBMA 2LUEA 1RFAA 3HK0A 2O6VA 3PPAA 1UH6A 4A20A 1V80A 3QIJA 4HDOA 5DPSA 4WWNA 5L83A 3MJWA 3L10B 3OLMD 4NY0A 3ZTDA 1E7UA 2BGFA 4HXDA 4RM8A 3WAMA 3L17A 4F7ZA 2XEWA 4GIVA 2BYVE 4GU2A 5LLIA 2GBJA 3JVZX 1V5TA 2J0KA 3KYCD 2W9NA 1S1QB 1G6JA 4URKA 1E8ZA 2DZMA 4G50A 1YJ1A 4LDTD 3VHTC 2MQJA 4W9DA 4ZYNA 2QHOA 3PRPB 2NPTA 2MBEA 1SE9A 3QA8A 2KLCA 1UD7A 4W9GA 2KLGA 3PSEB 3JYUA 3ZNHB 3PZDA 2V1YA 2B3AA 2FCQA 2KHWB 2D10A 4G3XB 3M95A 4KIKA 4JIOU 3K9PB 4BKTA 3APFA 2KMCA 2JUOA 3R7RA 4W9FA 2DENB 1WZ0A 4IM3A 3IBEA 4PS3A 4W9JA 3A9KB 4PS7A 1WGDA 1F9JA 4EOYA 2KDBA 3NS8A 3DVNV 3T8MA 2BWFA 2IZVB 5G55A 4FHJA 4MGIE 2ZCCA 2L0TA 4KZ0A 2DZJA 4NJ7A 3DBRI 4I6LB 2KJHB 3UF8A 2Z0EB 1WX8A 2KQSA 5E6OA 2ZVOA 3TL5A 4MM3A 5BO4B 4FN2A 2N1VA 2C60A 2J0MA 2FCNA 3A9JA 1Q0WB 4NAWB 2KTRA 2O6VB 2KC2A 3ZVVA 1WZ3A 4MGZE 1WFYA 2PPHA 4ASWC 1WF9A 2K25A 2I1JA 3T9LA 2NBWB 4TV3A 3WA0A 4GDLA 2KXJA 1ZKHA 4I6NB 3M62B 1RLFA 3NHEB 4TQ1A 4ICVA 1WXMA 3RCZA 5GMVA 2HJ8A 5IAAC 3ZNGC 3ZTCA 5E6PA 1UBIA 5C23A 2Z59B 4EUTA 1VD2A 3ZNID 3A1QA 2CS4A 1L7YA 1E7VA 5L95C 4MH0E 2NS5A 1KLVA 1H4RA 2KFKB 2NPTB 4DWFA 3UQBA 5J2RA 3VAWA 3ZRCA 4MELA 2PEAA 3N3KB 2BYEA 4WJOA 3V61A 4F1SA 4IWPA 4FADA 1PQSA 1R4NI 4EZLA 1NBFC 1OTRB 3UIOB 4KIKB 1TGZB 3DOWA 4DDID 4GOCA 3HIZA 2KTFA 3PVLA 3WIMA 2DZKA 2KFJA 1WE6A 4ZRJA 2JRIB 1WX7A 2AL6A 4IG7B 2AWTA 2DX5B 4K7SA 5CHFA 1WJ4A 2L8JA 1TZ1A 4NQKE 4BKSA 4MDKE 3DVGY 3M63B 5FR6A 2AEHA 2KWVB 1V6EA 2ZPNA 2KDIA 1P98A 3DBSA 3EFUA 4WQOB 1P9DU 3A9JB 3AULA 3DVGX 3NY5A 4CHKA 3SU8X 2KTRB 4DHJD 1J8CA 2JF5A 2IO1B 2LJ5A 3SD5A 1V81A 2IY1B 2A4ZA 1YIWA 2LXAA 2PE9A 2RGFA 3DDCB 4KDIC 2K8HA 4HK2A 2GOWA 4B9KA 2GBNA 2N9XA 2RR9A 2ZCBA 3A4SC 2N7DA 3UGBB 2WWZA 3P2BA 1WYWB 2C7HA 2MBQA 1C1YB 1V49A 1EF1A 2IO0B 1X1MA 2V4LA 3PHWB 4RMAA 2L3ZA 1WX9A 2XK5A 2O6VD 5D6JB 2J7QB 4DHZB 2GBRA 3QK0A 1I35A 1WR1A 1ZW7A 1V2YA 2LVPA 4HLEA 1GC6A 2WX1A 3H1UA 2NVUI 3QWZB 3U30A 2LRUA 4B6WA 4JQWC 4HPLB 4KV2A 2MA9B 1XT9B 2O2VB 3KVFB 2KFKA 4N9F4 4DXAB 1LFDA 1EF5A 2VRRB 3BINA 1XD3B 3APDA 2XBBC 2DYOA 2RPQA 2CKHB 2FUHB 1WXSA 2AYOB 3MTNB 1ZGUB 2K1FA 4WJPA 4AP4C 3QARA 2JRHA 4M8NA 3ML8A 1KOTA 2L7RA 4WWPA 2WX0A 4KSLC 1GNUA 3KUZA 3R66C 3VXWA 5D94A 3IVFA 2JVCA 4BOSC 3HM6X 3H7SA 2NBVB 3ZUNA 2YVCA 5LXHA 1I42A 5AZFA 2N4FA 3H9DA 4GDKB 4FBJB 4GB9A 3LDZE 1WMHA 2HE7A 4LJOB 3M3JA 3TCAA 3VUWA 2CHZA 4HJKA 5AEKB 2ZZPB 3K9OB 3VTUA 3VQIA 2KQ7A 3H7PB 1YD8U 5KHQA 4BOZB 3Q3FA 4NQLB 3B1LX 3DPDA 3L13A 3QAQA 4DDGD 3X0WA 2BPSA 4HCNB 3WAPA 2KD0A 1YQBA 3L08A 1P1AA 4DBGA 3C0RB 3OJ4B 4EZKA 2KMAA 2EMSA 4MGYE 4II3B 3RZWC 1K8RB 4JGHB 2CR5A 1LM8B 3U8ZA
chains in the Genus database with same CATH superfamily
4LDTB 1FXIA 1GJZA 3L54A 1XQQA 1H8CA 3EGRA 3WANA 5G5GA 4DK5A 1D3ZA 1K51A 1E5WA 2BS3B 4GSWA 3OJ3A 3QQ8B 1PUTA 4ARCA 3ZKJC 3AEGB 5D7GA 3JSVA 3UIPB 4TKNA 1FFUA 3FILB 3HM3A 4CO7A 3RD2A 2NTTA 3NVVA 2KOXA 2K22A 2FNJB 4KDLB 4ANVA 4EKUA 3UQAA 2JYEA 2G4DB 1VLBA 4YTNB 4RM9A 1B9RA 4HKQA 4MGKE 2GMIC 2MP2B 4XDDA 4G0NB 2J42A 4TQ0A 3AE7B 1PGAA 3NVWA 2KZRA 3ZJUA 1RRBA 4K3BA 4FJVB 3LYYA 1ZE3D 3EECA 3QJZA 3AE4B 4W9IA 3A4RA 3QHTA 2Y5BB 3VUXA 2UWQA 3CSTA 1YNTE 1WIAA 3KYDD 4JLCA 1NI2A 2LFIA 4NPNA 4I6PA 3AU5A 3BYTB 3PTFC 3DBRB 3JSVB 3TMPB 2G3QB 3ZXRA 5DPWA 4A3OA 1KJTA 2LZ6A 1JWBD 2W3RA 1YQ4B 1GPXA 2JT4B 4M8MA 3L16A 4GMVA 1Z2MA 1BUIC 2G1EA 4WAAA 4P1CC 1TYGB 3DQVA 2MBBB 2C7NB 1WGGA 2L76A 1UZXB 1UBQA 3AE8B 1EO6A 1QOGA 3U4EG 1IGDA 1UGJA 5C1ZA 3UI3A 1OQYA 2K39A 3B2FA 4Q2JA 5BMIA 2WP9B 4KGRA 3O13A 2LGYA 2SEBD 3NJTA 1VRAB 2LGXA 1KM7A 3GB1A 3TEYA 3RMKC 2LJIA 1ROEA 2LD9A 2K3UA 3Q8CA 1Z5SB 4GDKA 4LNIA 3ENEA 1YJIA 3AU4A 1F2RC 2M4NA 2DYBA 3I63C 4RCOA 1M94A 1VJKA 2M17A 1SXTA 3Q6BA 2QMTA 1EWCA 4II2B 2K0PA 2LEKA 1IUEA 4NJ6A 1Q1OA 4XX5A 2YLMA 2V9HA 2D07B 2BKRB 4LNOA 3Q69A 3BWUD 3PV1A 3S2AA 3WAOA 1V1PB 2MSED 3VTWA 4F8CB 1RAXA 5CTRC 4KGSA 2MBHA 1E6EB 3ZDMC 3NZ3A 5EDSA 4P7IA 3PZ7A 4IW0A 1R4MI 4YSYB 2D3CA 5IP4D 3AB5A 2KDMA 2INCC 4YTPB 1L5PA 2LASA 5EE0A 1ZPSA 4B95A 2N9EB 1TS4A 1ET6A 3KWLA 2LHEA 1WGRA 2WXGA 3W1SC 3V62A 2E6XA 4XDCA 5TR5A 3GP7A 5IN7A 3ML9A 1FD6A 1S3SG 2M19A 2Z0DB 1V9JA 4IUMB 1N6ZA 2MX2A 1QOAA 3R2TA 2KO3A 3ZO5B 1SE4A 4IM2A 4AUQC 3SDLC 2PTLA 2RD0A 2EKIA 1FRRA 3P42A 5C2TB 1ESFA 3WALA 2K6DB 3NG0A 2PE6B 3AE1B 5E6NA 3IG3A 4ANXA 3HK0A 3PPAA 4A20A 1ZP0B 4HDOA 4XWWA 1QILA 2J52A 3AE3B 4C4VA 3WAMA 3L17A 2RPVA 2XEWA 4GU2A 5LLIA 1KF6B 2INPE 4A90A 1G6JA 1YJ1A 4LDTD 2WDQB 3CWIA 2MBEA 1TT5B 1UD7A 1JALA 4W9GA 3PSEB 3ZNHB 4EE2A 4G3XB 4BKTA 3APFA 3N1YC 2IGHA 2JUOA 1HQRD 1N5WA 1WXQA 4C7YA 3IBEA 3Q8EA 4PS3A 2KVZA 4W9JA 4PS7A 3NS8A 5G55A 1BXTA 4FHJA 4MGIE 2L0TA 2DZJA 1VZ7A 2J4XA 4NJ7A 1SJED 4JWUC 4ZOHC 1K50A 1WX8A 4OZCA 2J0MA 1Q0WB 4HKZE 3ZVVA 3H8HA 1WF9A 2K25A 5FK9C 4OZAA 1P7EA 4TV3A 3E9SA 1RLFA 3BVGA 2HJ8A 5IAAC 3ZTCA 5C23A 1GOZA 3ETRA 4EUTA 1VD2A 3A1QA 2NPTB 2KAJA 3UQBA 5J2RA 4MELA 2PEAA 4WJOA 1PQSA 3C19A 1NBFC 3UIOB 3NVYA 1TGZB 4GOCA 4GLSC 3PVLA 3WIMA 1F1HA 1TJEA 1E9MA 4ZRJA 4C80A 3FC4A 4TSSA 3HUIA 2KACA 1TZ1A 4NQKE 4D2KA 3AEDB 3M63B 2KWVB 1C4CA 2ZPNA 3EFUA 1SE2A 1P9DU 4H2AA 4DHJD 3SU8X 2JF5A 4B0MA 2IO1B 1KH0A 2LJ5A 2WU2B 1V81A 4KDIC 1YN5A 1AN8A 2LXAA 2MHJA 2OEDA 2GBNA 1UNSA 2ZCBA 4YWGG 2DLBA 2WWZA 3P2BA 2C7HA 4RMAA 1V49A 1EF1A 2IO0B 5D6JB 2L3ZA 1WX9A 2GBRA 3QK0A 1I35A 1WR1A 2LVPA 1GC6A 2NVUI 3QWZB 2L83A 3I57A 2O2VB 1QOBA 4DXAB 1LFDA 1EF5A 1XLQA 2Y3AA 3APDA 2XBBC 2RPQA 3EFCA 1HZ6A 2DWQA 1WRIA 1WXSA 3WCQA 1L6UA 4WJPA 1ZGUB 2INDC 1I4PA 1M4VA 4WWPA 4KSLC 3R66C 5D94A 3AE9B 5LXHA 3DBLB 4FBJB 4JX1C 4LJOB 4HJKA 5AEKB 5EE3A 2ZZPB 3VQIA 3U2SC 1YD8U 5KHQA 4NQLB 3B1LX 4DDGD 3EUB2 4HCNB 4DBGA 3TEXA 1F52A 1XXGA 4OZBA 1OQQA 2EMSA 3MP9A 4YSXB 4II3B 2CR5A 1LM8B 3U8ZA 1YN4A 2MLBA 2XK5B 1P0RA 2IO2B 3DHHC 1OEYA 3B2GA 2K6QA 4ANWA 4KZCA 2KX3A 1OGWA 4FJYA 2M0XA 2MW5A 2BVCA 3L0WB 1ZOYB 1N62A 2FIFA 2M1MA 4EEWA 1E7PB 5DCNA 3CMMB 2FBWB 3GE3C 4PYUA 4K81A 1CJEA 1IBXA 5AZGA 2LGDA 1KTKA 1MG4A 3N9YC 3EHVA 3AEFB 3KW5B 2JYTA 2HD5B 2HTHA 1GC7A 4E74A 3KUDB 1ET9A 2ON8A 4LCDE 1IPGA 2KMMA 3AI5A 3A9KA 3R3MA 1DOYA 4US8A 1T0YA 4KKIA 1SGHA 2FCMA 1L2NA 1JMLA 4AWJA 3P1MA 4TUUA 4US9A 2A5UA 4J3OD 2DZIA 2LMCA 4K7WA 3NOBA 4RNAA 4ICUA 1GB1A 1TKEA 2H89B 2J0JA 1E8YA 2JU6X 2FE8A 4IKGA 1JWUD 4AJWA 1FEHA 4AS1A 1WR6E 1YQ3B 3AEAB 3B0AA 2AL3A 4USAA 2RSUA 3DBHI 4S17A 3H7PA 4IM0A 1V5OA 3SFEB 4NAWA 3RNFC 2LWPA 2NBUA 2X8XX 2LVQA 1NEKB 1LQBA 2C7MB 2GB1A 5FKAC 4CQNA 2GBKA 2M8SA 2MH7A 2BW2A 3HVZA 5IKCM 3AH7A 3RUIB 5JH5C 3QC8B 4MACA 1YX5B 1UGMA 3U7ZA 1J7CA 2L00B 2CJNA 2WXMA 2OOBB 1C3TA 3NVZA 2ASQA 2L0FA 2G4SA 1K52A 2REXA 2DHZA 1XLNA 4C7ZA 3RYTA 3JW0X 1WY8A 4BFRA 5JHBA 3RULA 3Q3MC 2XNAC 3N20C 2WDVB 4FHKA 4GN1A 1D5XC 1J7AA 2WNMA 1NENB 2MWSB 3AXCA 1IBXB 3BVZA 1VR9A 1XCTL 2HTME 4A3PA 3H6NA 5BYQA 1FIQA 2KDEB 3A1QB 5KHOA 1I4RA 1WJUA 3L4PA 4ZRKA 2D3AA 1YN3A 2C5LC 4HVBA 1ZDXA 1WM2A 4O1NA 4MH8A 4BVUC 2V0GA 4OVZA 3ZIMA 2K8BA 1NI3A 4ZYSA 5LXIB 2WXIA 3TEWA 2CU3A 1RFKA 1E90A 2WXRA 1E8XA 2IO3B 3IAS1 2OHFA 2LGIA 1L4DB 4DHJB 3ZDTA 3DBLI 2RDBC 1AARA 2WXPA 2ZVNA 3Q3OC 3ALBA 3PHXB 4ANUA 3B9JA 1WI0A 3VH3B 2BTEA 1WXVA 2DAJA 4WJNA 4OVUA 4M0WB 2NCNA 4FXCA 4ZRPA 2FCSA 2QILA 2MP2A 3Q8BA 3TJPA 2BYFA 3N30A 1GG3A 2KWUB 2KANA 4W9CA 2JY6A 3EC8A 2D3BA 1L4ZB 2JZZA 2KN4A 1KRHA 3BY4B 1SIFA 2NMQA 4N59A 3E56A 2GBMA 2LUEA 1RFAA 1UH6A 2JXTA 1V80A 2WXHA 1MI0A 5DPSA 3ZGZA 3MJWA 3OLMD 2BT6A 4YSZB 4WWMA 2BGFA 4RM8A 3FILA 4L23A 4OW0A 1QT9A 1D4BA 1FNVA 2BYVE 1RM6C 1S1QB 4URKA 1SIJA 2DZMA 3VHTC 3BIID 3PRPB 1I4XA 4QAYA 4LNFA 3QA8A 2V1YA 1L6VA 3NS1A 2RDHA 2B3AA 3AECB 2KHWB 1T3QA 1HXYD 2V3PA 3SR6A 4IM3A 1WGDA 2KDBA 2MJEA 3MHZA 2BWFA 3T8MA 1VZ6A 2ZCCA 4S0RA 3UF8A 1JWMD 2KQSA 2ZVOA 4MM3A 1YOVB 5BO4B 4FN2A 2N1VA 1SSNA 2O6VB 1D5MC 2PPHA 4ASWC 2I1JA 3T9LA 2NBWB 4GDLA 1ZKHA 2UU7A 3U52E 3M62B 3NHEB 2JSVX 4ICVA 5E6PA 1UBIA 1V97A 2CS4A 1L7YA 1E7VA 5L95C 4MH0E 1KLVA 1H4RA 3V61A 1UWMA 1KFYB 1L0VB 1FXAA 4HPPA 1R4NI 1OTRB 4KIKB 3AN1A 1HTOA 1TY0A 5D3IB 5EE9A 2DZKA 2QEJC 2N9KA 4IG7B 5CHFA 2L8JA 1UWXA 3ZXVA 2PVGC 4DXFA 3ZJVA 2Z8LA 5E6JA 2KDIA 1P98A 2WU5B 2IDYA 3DVGX 4IOIE 1J8CA 3SD5A 4WIPA 1YIWA 2PE9A 3DDCB 2Q5WD 4HK2A 4B9KA 2RR9A 3UGBB 1YJJA 4XE0A 2I38A 1C1YB 3FKYA 4LTUA 1ZUD2 4DHZB 4AQ7A 1V2YA 3GZNB 2WHIA 5HI1A 1FPYA 2WX1A 3U30A 4B6WA 2W3SA 4JQWC 4ZHOA 2MA9B 3VRAB 2E3TA 4N9F4 2KFKA 4RGTA 3BINA 1XD3B 1CZPA 2ONQA 2M56B 3ABVB 4P6VF 4ACFA 4AP4C 1EM7A 1T0RC 2JRHA 4M8NA 4MM3B 3NUHB 1GB4A 2WX0A 1GNUA 3VXWA 3IVFA 2JVCA 3HM6X 2NBVB 3ZUNA 3I9V1 3IT4B 5AZFA 3LDZE 2CHZA 3K9OB 2BYTA 4BOZB 2WLBA 3L13A 3FAHA 2BPSA 1CK1A 3C0RB 4DXGA 4EZKA 2KMAA 3VUYA 2H88B 3D32A 2N9LA 4IC7B 3N32A 2KJRA 3AMZA 5HG2A 3DWGC 1F2RI 3P63A 5T8IA 1WJNA 3PRMB 3V05A 1QOFA 2BS4B 1DOIA 4AOFA 2WXFA 2PJHA 2D3GA 3AEBB 2BKFA 3AE5B 4C56C 4EZJA 2ZNVB 3VVWB 4XYCA 4XWTA 1UF0A 4NJCA 4MSMB 3PLVA 3DWMA 4A8XC 3P4RB 4REZA 3W9CB 4GXBA 4K7UA 1HA5A 3GE8C 1SB3C 2AX5A 3B08A 2IBIB 5G2NA 4GDLB 4YT0B 3VDZA 1BT0A 3RNGC 3ONSA 2ZNVC 1GAQB 4BAXA 5HHDG 4W9KA 1FCLA 1MVKA 4WWOA 3KUCB 1XCQL 5BYSA 5CHWA 1FO4A 4N6EB 1AW7A 2C9WB 4M00A 3RT3B 3ECIA 3NZUA 4MT5A 1PGXA 1VCBA 4GGQA 2KWDA 5CHVC 3MFGA 1P3QU 3P4QB 3W1SA 2KNBA 1J7BA 2PMVA 3A33B 2DAFA 1T0SC 2PLPA 1WE7A 2V3NA 2J53A 3PS6A 3W2DA 3ZYYX 2WXJA 2WYQA 2EMTA 1SF0A 1XO3A 1N61A 2JWZA 3N1ZC 3NRZA 2I2YA 4J6IA 2RDGA 2L05A 2FAZA 1C77A 4K1RB 1Q10A 4FLHA 2BWES 3RN9C 4EFOA 2HJ1A 4ZRIA 4W9HA 2JZ3B 2KC1A 4KSKC 2KKCA 5I4DA 2OJWA 3ZNZB 3QCAA 4HCPB 1AYFA 3BZDB 2UYZB 3BK2A 3QX1A 2JPHA 3UINB 3SEBA 4KKJA 5JHAA 3W5UB 2KJ6A 2EKEC 4UDUC 3IT6B 2B76B 1STEA 3KH0A 1J0GA 4MSQB 4WJQA 2LI5A 3T3NA 1SBBB 4RGMA 2JXXA 1NDDA 1WGHA 1YX6B 2D11A 2KVRA 4BKGA 1UELA 1YMHE 1N60A 2CHXA 1C79A 2L52A 2WDRB 5J18A 2BBCA 5DPTA 3R7QA 1HE8A 2D5GA 3V60A 1EU4A 1CMXB 2K9XA 1GUAB 1WMHB 2PIAA 4JL9A 1C76A 3CF6E 2R2QA 3CSFA 3KQ4A 1WJ6A 2KX0A 2GRIA 2LGSA 5AZHA 5AUKA 4B0EA 2R2OA 2NR2A 1A5RA 2MJDA 3LJ3A 2ZPYA 2MCNB 2ZJDA 4KX6B 4M02A 2JWUA 4OHJA 1ISNA 1TS5A 1WWTA 3IHPC 2WQYB 3GOEA 2LHDA 3PGEA 3DCGA 3LXFA 4DQOC 3VH4B 2W54A 2PKOA 3Q8FA 2PVOD 1RYJA 4G11A 1F77A 1TY2A 3V6CB 1LXDA 1C4PA 2V3SA 2OJRA 4WQMA 1P7FA 2KT7A 3QIJA 4P16A 1Y56A 1QQRA 4HEA1 4NY0A 3ZTDA 3C8YA 1N63A 1JWAD 4F7ZA 4GIVA 3T3OA 2GBJA 3PO0A 3JVZX 2J0KA 3KYCD 3V3XA 2MQJA 1CQVA 1NVID 4ZYNA 3RNEC 2NPTA 3IXSA 2KLCA 5GXGB 2KLGA 2FUG1 1SE3A 2FCQA 2D10A 3R7RA 4W9FA 2DENB 2IPKD 2CJOA 3RNAC 3EA6A 1F9JA 2Y5CA 2IZVB 2W82A 3DBRI 2BQQA 3LB8C 1LO5D 5BMGA 1ZXIA 1I7HA 3TSSA 5E6OA 3TL5A 5HFYA 3A9JA 4NAWB 2HDEA 2KC2A 4PT5A 1WZ3A 3P4PB 1WFYA 3WA0A 4I6NB 2KXJA 2MEKA 4TQ1A 3RNBC 3RCZA 3ZNGC 2AQ1B 3ZNID 4ITKA 2YEPB 4DWFA 2KFKB 3ZJTA 3N3KB 4IWPA 2M0AA 4EZLA 3HIZA 3OG5A 2JRIB 1WX7A 1T5XD 1R4MB 1T0QC 4K7SA 1MHXA 2AEHA 4PK1A 1C4AA 1SEBD 1QLBB 4HJGE 3A9JB 3AULA 4CHKA 5H92C 2KTRB 4RGNA 2ACZB 2IY1B 2A4ZA 5IOIA 3MC9A 1ZDVA 3A4SC 1ENFA 1MPEA 2MBQA 3Q2AC 3HRDD 1X1MA 2XK5A 2K5PA 2J7QB 2N7JA 2XN9C 4JE3B 2JX5A 2LRUA 1PGBA 5IO9A 1D5ZC 1DYQA 2VRRB 2DYOA 1DGJA 2QDFA 4M01A 3W5VB 4A55A 2CKHB 1OFFA 3MTNB 1V1OA 5FR3A 2JZPA 3ML8A 3MC0B 4BOSC 3H7SA 1KLGD 1FMAD 2YVCA 2N4FA 3H9DA 1BMLC 4GB9A 1WMHA 1N5XA 2HE7A 3VUWA 4C00A 4A6QA 2RMMA 3H7PB 1WYGA 4WURA 3DPDA 3ZQ4A 3QAQA 3WAPA 2KD0A 1YQBA 2L32A 1P1AA 3VR8B 1PYWD 3KLSX 3RZWC 1K8RB 1ACCA 2EELA 2IYDB 1TBEA 1WH3A 4NZLB 1MG8A 4XC2A 1WM3A 2KDFB 4X57B 3HHMA 3MJ5A 4FULA 1IP9A 1TKYA 1FFVA 5DPRA 1JWSD 3CIRB 2V4IB 3RZFA 1WGYA 4PYZA 3Q14C 5HKHA 1HTQA 4W9LA 1VDVA 4RF0A 4A9AA 4MJSB 2CU1A 2N9PC 2QIEB 4R3DA 3PLUA 2WDTB 3VR9B 5JXVA 4DHZE 1E8WA 1JW9D 3Q3JA 2PW9A 1I4HA 1A70A 1OQRA 2IY0B 1EUVB 4YTMB 4ZDVA 2L1AA 3MHSD 3X23A 2QJLA 1FNWA 4IDIA 2DYMA 1XF5L 2X38A 1EWYC 4LK0M 3KWVA 1QF6A 4LJPB 2MRPA 4YL8A 2ZEQA 5D3DA 2GLSA 2WXNA 1IGCA 2BS2B 4IWOA 3VFKA 3AEEB 4HDQA 2WXKA 4HROA 2NTSA 4C4VB 1TTNA 1ZXHA 3PREA 1IYFA 5JZEB 4LLGM 4MJSA 2Y5PA 3ZRFA 1FNUA 3GZNI 1MHHE 4W9EA 1MFWA 1HZ5A 4E3CA 1XEEA 2KN5A 2N0SB 2N7EA 3O65B 4OVVA 4FJZA 4HPMB 2LXCA 2G45B 4RFBA 1PFDA 2FIDA 1WRDB 5H8YE 1TS2A 5MPOA 4XZ4A 4XGAB 1L0YB 1LGRA 2KWCA 2QCZA 3APCA 3PRZA 1FXTB 2LRWA 3U7DA 2N1WA 5C3JB 4HRSA 1WGKA 4CYEA 2LUMA 3DHGC 1RWSA 2LVOA 3AV8A 2ZW1A 2WXLA 5IA7A 3R8BA 3PZ8A 4AJYB 4NNJB 2JQRB 1V86A 4FA6A 3TIXA 3DHIC 1U4AA 4KVGB 2CHWA 3BYYB 1TS3A 2WGSA 2D2QA 2KK8A 5TSSA 4PS8A 4RGOS 4ZRQA 4JWSC 3AM9A 1OEYJ 1Q5WB 4K3CA 1WSPA 4E71A 1J19A 4RF1A 2O2VA 1MJDA 4MEMA 1E0ZA 2MBOA 3IFWB 1HEZE 3Q8AA 5CX3A 3VTVA 1E10A 1QKZA 1JROA 1JRUA 5D2MB 2K8CA 3RPFC 3N1XC 3V6EB 1Y8RC 4BBNF 4BKSD 4IWQA 3RFZB 4BBNC 3DVNU 2QC8A 3ZLZA 2I1KA 3NZSA 2BF8B 3OAWA 3TBLD 4HWIB 1NYQA 2QSDA 3W1YA 3I3TB 1T6BX 3ZW3A 3SHQA 4L2YA 1WXAA 2DBYA 3PT2B 5J17A 5EE1A 3AE2B 1QZEA 2ICIA 2O6VA 1NYRA 1FCCC 3P4SB 5L83A 1VZ8A 4WWNA 3L10B 4YXDB 2VH1A 1E7UA 4HXDA 3SFDB 2IGDA 5LNK1 1V5TA 1R4NB 2W9NA 1B1ZA 1JQ4A 1I4QA 3J9CA 2MJ3A 1E8ZA 4G50A 4W9DA 2QHOA 1K53A 2YEPF 1SE9A 2DNFA 3JYUA 3PZDA 1L0XB 1AWDA 1PDXA 4WH4A 3M95A 4KIKA 4JIOU 3K9PB 2KMCA 1V8CA 2WXOA 2ZW0A 1WZ0A 3AE6B 4ZHPA 3A9KB 4WAFA 1KLUD 4EOYA 3DVNV 4KZ0A 2G9HD 4I6LB 2KQ4X 2KJHB 2Z0EB 4TMAB 3DBHB 2R61A 2C60A 1I4GA 2FCNA 3RNCC 2KTRA 4LNKA 4MGZE 2IJ0A 4JPSA 1XLOA 3BK1A 1WXMA 1SJHD 3BVMA 5GMVA 1C78A 3URYA 1F0ZA 2Z59B 1C9FA 1TKGA 2NS5A 3VAWA 2KYWA 3ZRCA 2BYEA 4F1SA 2GI9A 4BZAA 1FRDA 4FADA 2IGGA 1D6EC 4LNNA 3DOWA 4DDID 2BB5A 2KTFA 2KFJA 1WE6A 4ARIA 2SAKA 2AL6A 4NAMA 2AWTA 2DX5B 3GS2A 1WJ4A 4BKSA 4MDKE 3DVGY 5FR6A 3Q3NC 1V6EA 4N58A 2VH2A 5BMHA 3DBSA 1JRPA 4WQOB 3NY5A 1UUPA 2AQ2B 1DOXA 2RGFA 2K8HA 2GOWA 1R7SA 3VRBB 2N9XA 2N7DA 1WYWB 4L1BA 3PHWB 2V4LA 2W55A 3IAM1 2TSSA 2O6VD 1ZW7A 4HLEA 3H1UA 2WXQA 4HPLB 4KV2A 1XT9B 1V1PA 3KVFB 3HVDA 3MC8A 2INNE 1TIFA 1JCKB 5BYRA 3TUOA 3I5JC 2FUHB 2AQ3B 2AYOB 2K1FA 3QARA 1FM0D 3OWEB 3R2IA 2WS3B 1KOTA 1XLPA 2L7RA 3KUZA 5G5HA 3RI7C 1TZOA 2VZKB 1I42A 5AUIA 4GDKB 2VZKD 1EU3A 4P1BC 3M3JA 3TCAA 2BB6A 4M0WA 3VTUA 2KQ7A 3Q3FA 4KGTA 3X0WA 3L08A 3TEZA 4RH6A 3OJ4B 4MGYE 4JGHB
chains in the Genus database with same CATH topology
4LDTB 2IYDB 1TBEA 1WH3A 2MLBA 2XK5B 3D32A 1GJZA 1P0RA 3L54A 1XQQA 1MG8A 2IO2B 4IC7B 1OEYA 4XC2A 1H8CA 1WM3A 2KDFB 3N32A 2KJRA 2K6QA 4ANWA 3WANA 4KZCA 4X57B 3HHMA 1IP9A 4FULA 4DK5A 2KX3A 1D3ZA 1OGWA 4FJYA 5DPRA 1E5WA 3RZFA 2M0XA 2MW5A 4GSWA 1WGYA 3OJ3A 3QQ8B 1WJNA 3PRMB 3L0WB 4PYZA 5HKHA 3ZKJC 4AOFA 4W9LA 2PJHA 2D3GA 3JSVA 4TKNA 5D7GA 3UIPB 4MJSB 2BKFA 2FIFA 2M1MA 2CU1A 4EZJA 2ZNVB 3VVWB 4EEWA 2N9PC 5DCNA 3CMMB 3HM3A 3PLUA 4CO7A 3RD2A 4PYUA 2WDTB 4K81A 4MSMB 3PLVA 4DHZE 1E8WA 2KOXA 2FNJB 4KDLB 4ANVA 4GXBA 4EKUA 3Q3JA 4K7UA 3UQAA 2G4DB 5AZGA 2IY0B 1EUVB 2LGDA 4RM9A 4ZDVA 4MGKE 2GMIC 2MP2B 3EHVA 3MHSD 3X23A 3B08A 2IBIB 3KW5B 5G2NA 2HD5B 4GDLB 2HTHA 1GC7A 4E74A 3KUDB 3VDZA 1BT0A 3ONSA 4G0NB 2ZNVC 2DYMA 4TQ0A 4LCDE 4W9KA 1IPGA 2KZRA 3AI5A 3A9KA 3R3MA 4WWOA 4LJPB 1RRBA 1T0YA 2MRPA 4FJVB 3KUCB 1SGHA 3QJZA 3EECA 4YL8A 4W9IA 5CHWA 2ZEQA 2FCMA 3A4RA 2C9WB 3QHTA 1L2NA 4AWJA 2Y5BB 3VUXA 3RT3B 3ECIA 2UWQA 4TUUA 3CSTA 3NZUA 2A5UA 1WIAA 4IWOA 3VFKA 1VCBA 3KYDD 4JLCA 2DZIA 4K7WA 4GGQA 4HDQA 3NOBA 1NI2A 5CHVC 4ICUA 4NPNA 4I6PA 2J0JA 3AU5A 1E8YA 1TTNA 4AJWA 3PTFC 1WR6E 3PREA 3B0AA 2AL3A 1IYFA 3JSVB 3TMPB 5JZEB 2RSUA 4MJSA 2G3QB 3DBHI 3ZRFA 1P3QU 3GZNI 3H7PA 4W9EA 4IM0A 1V5OA 3W1SA 4NAWA 5DPWA 4A3OA 1KJTA 4E3CA 2KNBA 2LWPA 2LZ6A 2NBUA 3A33B 2DAFA 2KN5A 2LVQA 1WE7A 2N7EA 3O65B 1LQBA 2C7MB 4OVVA 3PS6A 4FJZA 2GBKA 2M8SA 4HPMB 2JT4B 2LXCA 4M8MA 3L16A 2WYQA 2G45B 1Z2MA 4GMVA 2EMTA 2FIDA 3RUIB 5JH5C 1WRDB 3QC8B 4XZ4A 4WAAA 1YX5B 1UGMA 3DQVA 2KWCA 2JWZA 2MBBB 3APCA 2C7NB 1WGGA 2L76A 1UZXB 3PRZA 1FXTB 2L00B 1UBQA 2OOBB 1C3TA 4J6IA 1EO6A 2ASQA 2L0FA 2LRWA 3U7DA 2N1WA 2G4SA 5C1ZA 2L05A 1OQYA 2REXA 2K39A 2FAZA 4K1RB 2DHZA 3RYTA 3JW0X 1WY8A 4CYEA 4FLHA 4BFRA 3RULA 5JHBA 2BWES 4FHKA 3VUYA 2LVOA 4EFOA 4GN1A 2LGYA 5IA7A 4ZRIA 2MWSB 3AXCA 4W9HA 2LGXA 2JZ3B 1KM7A 2KC1A 4KSKC 4AJYB 4NNJB 2KKCA 3ZNZB 2LD9A 1V86A 3QCAA 1Z5SB 3H6NA 4A3PA 4GDKA 4HCPB 4FA6A 3TIXA 2KDEB 1U4AA 3A1QB 4KVGB 5KHOA 1WJUA 4ZRKA 2CHWA 2UYZB 3AU4A 2D2QA 2KK8A 2M4NA 2DYBA 3ENEA 1M94A 2M17A 4PS8A 2C5LC 3QX1A 4HVBA 2JPHA 3UINB 4II2B 5JHAA 1WM2A 2KJ6A 2EKEC 4BVUC 3KH0A 1OEYJ 1J0GA 4NJ6A 1Q1OA 4XX5A 2YLMA 4MSQB 1Q5WB 4WJQA 2LI5A 2D07B 2BKRB 2K8BA 3ZIMA 4E71A 1J19A 2JXXA 3PV1A 1NDDA 1WGHA 3S2AA 1YX6B 2D11A 3WAOA 2O2VA 2MSED 5LXIB 4MEMA 2KVRA 3VTWA 4F8CB 4BKGA 1RAXA 2MBOA 1UELA 5CTRC 1E90A 2MBHA 2CHXA 3ZDMC 1E8XA 5EDSA 2IO3B 3IFWB 4P7IA 5J18A 5CX3A 5DPTA 3VTVA 3R7QA 1HE8A 4IW0A 3V60A 4DHJB 1R4MI 3ZDTA 3DBLI 1CMXB 1AARA 1GUAB 1JRUA 1WMHB 5D2MB 2ZVNA 2K8CA 4JL9A 2LASA 3ALBA 3V6EB 1Y8RC 3PHXB 4B95A 4BBNF 2N9EB 3CF6E 2R2QA 3CSFA 4ANUA 1WJ6A 2KX0A 4BKSD 5AZHA 4IWQA 1WGRA 1WI0A 3VH3B 2R2OA 3W1SC 1WXVA 4BBNC 2NR2A 2DAJA 3DVNU 3V62A 4WJNA 3LJ3A 4M0WB 4OVUA 3ZLZA 1A5RA 2NCNA 2I1KA 2ZPYA 3NZSA 5TR5A 3ML9A 2FCSA 1S3SG 2Z0DB 2ZJDA 2MCNB 1ISNA 2BF8B 2MP2A 3IHPC 1V9JA 4IUMB 3OAWA 3GOEA 3TJPA 3TBLD 2BYFA 4HWIB 3N30A 2MX2A 3PGEA 1GG3A 2KWUB 3DCGA 2KANA 2KO3A 3VH4B 3W1YA 3ZO5B 4W9CA 3I3TB 4IM2A 2JY6A 4AUQC 3ZW3A 3SDLC 3EC8A 3SHQA 2RD0A 4G11A 1WXAA 3PT2B 3V6CB 1LXDA 2JZZA 2K6DB 2PE6B 3WALA 5J17A 3BY4B 2V3SA 5E6NA 1SIFA 3IG3A 2OJRA 1QZEA 4ANXA 2GBMA 2LUEA 1RFAA 3HK0A 2O6VA 3PPAA 1UH6A 4A20A 1V80A 3QIJA 4HDOA 5DPSA 4WWNA 5L83A 3MJWA 3L10B 3OLMD 4NY0A 3ZTDA 1E7UA 2BGFA 4HXDA 4RM8A 3WAMA 3L17A 4F7ZA 2XEWA 4GIVA 2BYVE 4GU2A 5LLIA 2GBJA 3JVZX 1V5TA 2J0KA 3KYCD 2W9NA 1S1QB 1G6JA 4URKA 1E8ZA 2DZMA 4G50A 1YJ1A 4LDTD 3VHTC 2MQJA 4W9DA 4ZYNA 2QHOA 3PRPB 2NPTA 2MBEA 1SE9A 3QA8A 2KLCA 1UD7A 4W9GA 2KLGA 3PSEB 3JYUA 3ZNHB 3PZDA 2V1YA 2B3AA 2FCQA 2KHWB 2D10A 4G3XB 3M95A 4KIKA 4JIOU 3K9PB 4BKTA 3APFA 2KMCA 2JUOA 3R7RA 4W9FA 2DENB 1WZ0A 4IM3A 3IBEA 4PS3A 4W9JA 3A9KB 4PS7A 1WGDA 1F9JA 4EOYA 2KDBA 3NS8A 3DVNV 3T8MA 2BWFA 2IZVB 5G55A 4FHJA 4MGIE 2ZCCA 2L0TA 4KZ0A 2DZJA 4NJ7A 3DBRI 4I6LB 2KJHB 3UF8A 2Z0EB 1WX8A 2KQSA 5E6OA 2ZVOA 3TL5A 4MM3A 5BO4B 4FN2A 2N1VA 2C60A 2J0MA 2FCNA 3A9JA 1Q0WB 4NAWB 2KTRA 2O6VB 2KC2A 3ZVVA 1WZ3A 4MGZE 1WFYA 2PPHA 4ASWC 1WF9A 2K25A 2I1JA 3T9LA 2NBWB 4TV3A 3WA0A 4GDLA 2KXJA 1ZKHA 4I6NB 3M62B 1RLFA 3NHEB 4TQ1A 4ICVA 1WXMA 3RCZA 5GMVA 2HJ8A 5IAAC 3ZNGC 3ZTCA 5E6PA 1UBIA 5C23A 2Z59B 4EUTA 1VD2A 3ZNID 3A1QA 2CS4A 1L7YA 1E7VA 5L95C 4MH0E 2NS5A 1KLVA 1H4RA 2KFKB 2NPTB 4DWFA 3UQBA 5J2RA 3VAWA 3ZRCA 4MELA 2PEAA 3N3KB 2BYEA 4WJOA 3V61A 4F1SA 4IWPA 4FADA 1PQSA 1R4NI 4EZLA 1NBFC 1OTRB 3UIOB 4KIKB 1TGZB 3DOWA 4DDID 4GOCA 3HIZA 2KTFA 3PVLA 3WIMA 2DZKA 2KFJA 1WE6A 4ZRJA 2JRIB 1WX7A 2AL6A 4IG7B 2AWTA 2DX5B 4K7SA 5CHFA 1WJ4A 2L8JA 1TZ1A 4NQKE 4BKSA 4MDKE 3DVGY 3M63B 5FR6A 2AEHA 2KWVB 1V6EA 2ZPNA 2KDIA 1P98A 3DBSA 3EFUA 4WQOB 1P9DU 3A9JB 3AULA 3DVGX 3NY5A 4CHKA 3SU8X 2KTRB 4DHJD 1J8CA 2JF5A 2IO1B 2LJ5A 3SD5A 1V81A 2IY1B 2A4ZA 1YIWA 2LXAA 2PE9A 2RGFA 3DDCB 4KDIC 2K8HA 4HK2A 2GOWA 4B9KA 2GBNA 2N9XA 2RR9A 2ZCBA 3A4SC 2N7DA 3UGBB 2WWZA 3P2BA 1WYWB 2C7HA 2MBQA 1C1YB 1V49A 1EF1A 2IO0B 1X1MA 2V4LA 3PHWB 4RMAA 2L3ZA 1WX9A 2XK5A 2O6VD 5D6JB 2J7QB 4DHZB 2GBRA 3QK0A 1I35A 1WR1A 1ZW7A 1V2YA 2LVPA 4HLEA 1GC6A 2WX1A 3H1UA 2NVUI 3QWZB 3U30A 2LRUA 4B6WA 4JQWC 4HPLB 4KV2A 2MA9B 1XT9B 2O2VB 3KVFB 2KFKA 4N9F4 4DXAB 1LFDA 1EF5A 2VRRB 3BINA 1XD3B 3APDA 2XBBC 2DYOA 2RPQA 2CKHB 2FUHB 1WXSA 2AYOB 3MTNB 1ZGUB 2K1FA 4WJPA 4AP4C 3QARA 2JRHA 4M8NA 3ML8A 1KOTA 2L7RA 4WWPA 2WX0A 4KSLC 1GNUA 3KUZA 3R66C 3VXWA 5D94A 3IVFA 2JVCA 4BOSC 3HM6X 3H7SA 2NBVB 3ZUNA 2YVCA 5LXHA 1I42A 5AZFA 2N4FA 3H9DA 4GDKB 4FBJB 4GB9A 3LDZE 1WMHA 2HE7A 4LJOB 3M3JA 3TCAA 3VUWA 2CHZA 4HJKA 5AEKB 2ZZPB 3K9OB 3VTUA 3VQIA 2KQ7A 3H7PB 1YD8U 5KHQA 4BOZB 3Q3FA 4NQLB 3B1LX 3DPDA 3L13A 3QAQA 4DDGD 3X0WA 2BPSA 4HCNB 3WAPA 2KD0A 1YQBA 3L08A 1P1AA 4DBGA 3C0RB 3OJ4B 4EZKA 2KMAA 2EMSA 4MGYE 4II3B 3RZWC 1K8RB 4JGHB 2CR5A 1LM8B 3U8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDT B;  2IYD B;  1TBE A;  1WH3 A;  2MLB A;  2XK5 B;  3D32 A;  1GJZ A;  1P0R A;  3L54 A;  1XQQ A;  1MG8 A;  2IO2 B;  4IC7 B;  1OEY A;  4XC2 A;  1H8C A;  1WM3 A;  2KDF B;  3N32 A;  2KJR A;  2K6Q A;  4ANW A;  3WAN A;  4KZC A;  4X57 B;  3HHM A;  1IP9 A;  4FUL A;  4DK5 A;  2KX3 A;  1D3Z A;  1OGW A;  4FJY A;  5DPR A;  1E5W A;  3RZF A;  2M0X A;  2MW5 A;  4GSW A;  1WGY A;  3OJ3 A;  3QQ8 B;  1WJN A;  3PRM B;  3L0W B;  4PYZ A;  5HKH A;  3ZKJ C;  4AOF A;  4W9L A;  2PJH A;  2D3G A;  3JSV A;  4TKN A;  5D7G A;  3UIP B;  4MJS B;  2BKF A;  2FIF A;  2M1M A;  2CU1 A;  4EZJ A;  2ZNV B;  3VVW B;  4EEW A;  2N9P C;  5DCN A;  3CMM B;  3HM3 A;  3PLU A;  4CO7 A;  3RD2 A;  4PYU A;  2WDT B;  4K81 A;  4MSM B;  3PLV A;  4DHZ E;  1E8W A;  2KOX A;  2FNJ B;  4KDL B;  4ANV A;  4GXB A;  4EKU A;  3Q3J A;  4K7U A;  3UQA A;  2G4D B;  5AZG A;  2IY0 B;  1EUV B;  2LGD A;  4RM9 A;  4ZDV A;  4MGK E;  2GMI C;  2MP2 B;  3EHV A;  3MHS D;  3X23 A;  3B08 A;  2IBI B;  3KW5 B;  5G2N A;  2HD5 B;  4GDL B;  2HTH A;  1GC7 A;  4E74 A;  3KUD B;  3VDZ A;  1BT0 A;  3ONS A;  4G0N B;  2ZNV C;  2DYM A;  4TQ0 A;  4LCD E;  4W9K A;  1IPG A;  2KZR A;  3AI5 A;  3A9K A;  3R3M A;  4WWO A;  4LJP B;  1RRB A;  1T0Y A;  2MRP A;  4FJV B;  3KUC B;  1SGH A;  3QJZ A;  3EEC A;  4YL8 A;  4W9I A;  5CHW A;  2ZEQ A;  2FCM A;  3A4R A;  2C9W B;  3QHT A;  1L2N A;  4AWJ A;  2Y5B B;  3VUX A;  3RT3 B;  3ECI A;  2UWQ A;  4TUU A;  3CST A;  3NZU A;  2A5U A;  1WIA A;  4IWO A;  3VFK A;  1VCB A;  3KYD D;  4JLC A;  2DZI A;  4K7W A;  4GGQ A;  4HDQ A;  3NOB A;  1NI2 A;  5CHV C;  4ICU A;  4NPN A;  4I6P A;  2J0J A;  3AU5 A;  1E8Y A;  1TTN A;  4AJW A;  3PTF C;  1WR6 E;  3PRE A;  3B0A A;  2AL3 A;  1IYF A;  3JSV B;  3TMP B;  5JZE B;  2RSU A;  4MJS A;  2G3Q B;  3DBH I;  3ZRF A;  1P3Q U;  3GZN I;  3H7P A;  4W9E A;  4IM0 A;  1V5O A;  3W1S A;  4NAW A;  5DPW A;  4A3O A;  1KJT A;  4E3C A;  2KNB A;  2LWP A;  2LZ6 A;  2NBU A;  3A33 B;  2DAF A;  2KN5 A;  2LVQ A;  1WE7 A;  2N7E A;  3O65 B;  1LQB A;  2C7M B;  4OVV A;  3PS6 A;  4FJZ A;  2GBK A;  2M8S A;  4HPM B;  2JT4 B;  2LXC A;  4M8M A;  3L16 A;  2WYQ A;  2G45 B;  1Z2M A;  4GMV A;  2EMT A;  2FID A;  3RUI B;  5JH5 C;  1WRD B;  3QC8 B;  4XZ4 A;  4WAA A;  1YX5 B;  1UGM A;  3DQV A;  2KWC A;  2JWZ A;  2MBB B;  3APC A;  2C7N B;  1WGG A;  2L76 A;  1UZX B;  3PRZ A;  1FXT B;  2L00 B;  1UBQ A;  2OOB B;  1C3T A;  4J6I A;  1EO6 A;  2ASQ A;  2L0F A;  2LRW A;  3U7D A;  2N1W A;  2G4S A;  5C1Z A;  2L05 A;  1OQY A;  2REX A;  2K39 A;  2FAZ A;  4K1R B;  2DHZ A;  3RYT A;  3JW0 X;  1WY8 A;  4CYE A;  4FLH A;  4BFR A;  3RUL A;  5JHB A;  2BWE S;  4FHK A;  3VUY A;  2LVO A;  4EFO A;  4GN1 A;  2LGY A;  5IA7 A;  4ZRI A;  2MWS B;  3AXC A;  4W9H A;  2LGX A;  2JZ3 B;  1KM7 A;  2KC1 A;  4KSK C;  4AJY B;  4NNJ B;  2KKC A;  3ZNZ B;  2LD9 A;  1V86 A;  3QCA A;  1Z5S B;  3H6N A;  4A3P A;  4GDK A;  4HCP B;  4FA6 A;  3TIX A;  2KDE B;  1U4A A;  3A1Q B;  4KVG B;  5KHO A;  1WJU A;  4ZRK A;  2CHW A;  2UYZ B;  3AU4 A;  2D2Q A;  2KK8 A;  2M4N A;  2DYB A;  3ENE A;  1M94 A;  2M17 A;  4PS8 A;  2C5L C;  3QX1 A;  4HVB A;  2JPH A;  3UIN B;  4II2 B;  5JHA A;  1WM2 A;  2KJ6 A;  2EKE C;  4BVU C;  3KH0 A;  1OEY J;  1J0G A;  4NJ6 A;  1Q1O A;  4XX5 A;  2YLM A;  4MSQ B;  1Q5W B;  4WJQ A;  2LI5 A;  2D07 B;  2BKR B;  2K8B A;  3ZIM A;  4E71 A;  1J19 A;  2JXX A;  3PV1 A;  1NDD A;  1WGH A;  3S2A A;  1YX6 B;  2D11 A;  3WAO A;  2O2V A;  2MSE D;  5LXI B;  4MEM A;  2KVR A;  3VTW A;  4F8C B;  4BKG A;  1RAX A;  2MBO A;  1UEL A;  5CTR C;  1E90 A;  2MBH A;  2CHX A;  3ZDM C;  1E8X A;  5EDS A;  2IO3 B;  3IFW B;  4P7I A;  5J18 A;  5CX3 A;  5DPT A;  3VTV A;  3R7Q A;  1HE8 A;  4IW0 A;  3V60 A;  4DHJ B;  1R4M I;  3ZDT A;  3DBL I;  1CMX B;  1AAR A;  1GUA B;  1JRU A;  1WMH B;  5D2M B;  2ZVN A;  2K8C A;  4JL9 A;  2LAS A;  3ALB A;  3V6E B;  1Y8R C;  3PHX B;  4B95 A;  4BBN F;  2N9E B;  3CF6 E;  2R2Q A;  3CSF A;  4ANU A;  1WJ6 A;  2KX0 A;  4BKS D;  5AZH A;  4IWQ A;  1WGR A;  1WI0 A;  3VH3 B;  2R2O A;  3W1S C;  1WXV A;  4BBN C;  2NR2 A;  2DAJ A;  3DVN U;  3V62 A;  4WJN A;  3LJ3 A;  4M0W B;  4OVU A;  3ZLZ A;  1A5R A;  2NCN A;  2I1K A;  2ZPY A;  3NZS A;  5TR5 A;  3ML9 A;  2FCS A;  1S3S G;  2Z0D B;  2ZJD A;  2MCN B;  1ISN A;  2BF8 B;  2MP2 A;  3IHP C;  1V9J A;  4IUM B;  3OAW A;  3GOE A;  3TJP A;  3TBL D;  2BYF A;  4HWI B;  3N30 A;  2MX2 A;  3PGE A;  1GG3 A;  2KWU B;  3DCG A;  2KAN A;  2KO3 A;  3VH4 B;  3W1Y A;  3ZO5 B;  4W9C A;  3I3T B;  4IM2 A;  2JY6 A;  4AUQ C;  3ZW3 A;  3SDL C;  3EC8 A;  3SHQ A;  2RD0 A;  4G11 A;  1WXA A;  3PT2 B;  3V6C B;  1LXD A;  2JZZ A;  2K6D B;  2PE6 B;  3WAL A;  5J17 A;  3BY4 B;  2V3S A;  5E6N A;  1SIF A;  3IG3 A;  2OJR A;  1QZE A;  4ANX A;  2GBM A;  2LUE A;  1RFA A;  3HK0 A;  2O6V A;  3PPA A;  1UH6 A;  4A20 A;  1V80 A;  3QIJ A;  4HDO A;  5DPS A;  4WWN A;  5L83 A;  3MJW A;  3L10 B;  3OLM D;  4NY0 A;  3ZTD A;  1E7U A;  2BGF A;  4HXD A;  4RM8 A;  3WAM A;  3L17 A;  4F7Z A;  2XEW A;  4GIV A;  2BYV E;  4GU2 A;  5LLI A;  2GBJ A;  3JVZ X;  1V5T A;  2J0K A;  3KYC D;  2W9N A;  1S1Q B;  1G6J A;  4URK A;  1E8Z A;  2DZM A;  4G50 A;  1YJ1 A;  4LDT D;  3VHT C;  2MQJ A;  4W9D A;  4ZYN A;  2QHO A;  3PRP B;  2NPT A;  2MBE A;  1SE9 A;  3QA8 A;  2KLC A;  1UD7 A;  4W9G A;  2KLG A;  3PSE B;  3JYU A;  3ZNH B;  3PZD A;  2V1Y A;  2B3A A;  2FCQ A;  2KHW B;  2D10 A;  4G3X B;  3M95 A;  4KIK A;  4JIO U;  3K9P B;  4BKT A;  3APF A;  2KMC A;  2JUO A;  3R7R A;  4W9F A;  2DEN B;  1WZ0 A;  4IM3 A;  3IBE A;  4PS3 A;  4W9J A;  3A9K B;  4PS7 A;  1WGD A;  1F9J A;  4EOY A;  2KDB A;  3NS8 A;  3DVN V;  3T8M A;  2BWF A;  2IZV B;  5G55 A;  4FHJ A;  4MGI E;  2ZCC A;  2L0T A;  4KZ0 A;  2DZJ A;  4NJ7 A;  3DBR I;  4I6L B;  2KJH B;  3UF8 A;  2Z0E B;  1WX8 A;  2KQS A;  5E6O A;  2ZVO A;  3TL5 A;  4MM3 A;  5BO4 B;  4FN2 A;  2N1V A;  2C60 A;  2J0M A;  2FCN A;  3A9J A;  1Q0W B;  4NAW B;  2KTR A;  2O6V B;  2KC2 A;  3ZVV A;  1WZ3 A;  4MGZ E;  1WFY A;  2PPH A;  4ASW C;  1WF9 A;  2K25 A;  2I1J A;  3T9L A;  2NBW B;  4TV3 A;  3WA0 A;  4GDL A;  2KXJ A;  1ZKH A;  4I6N B;  3M62 B;  1RLF A;  3NHE B;  4TQ1 A;  4ICV A;  1WXM A;  3RCZ A;  5GMV A;  2HJ8 A;  5IAA C;  3ZNG C;  3ZTC A;  5E6P A;  1UBI A;  5C23 A;  2Z59 B;  4EUT A;  1VD2 A;  3ZNI D;  3A1Q A;  2CS4 A;  1L7Y A;  1E7V A;  5L95 C;  4MH0 E;  2NS5 A;  1KLV A;  1H4R A;  2KFK B;  2NPT B;  4DWF A;  3UQB A;  5J2R A;  3VAW A;  3ZRC A;  4MEL A;  2PEA A;  3N3K B;  2BYE A;  4WJO A;  3V61 A;  4F1S A;  4IWP A;  4FAD A;  1PQS A;  1R4N I;  4EZL A;  1NBF C;  1OTR B;  3UIO B;  4KIK B;  1TGZ B;  3DOW A;  4DDI D;  4GOC A;  3HIZ A;  2KTF A;  3PVL A;  3WIM A;  2DZK A;  2KFJ A;  1WE6 A;  4ZRJ A;  2JRI B;  1WX7 A;  2AL6 A;  4IG7 B;  2AWT A;  2DX5 B;  4K7S A;  5CHF A;  1WJ4 A;  2L8J A;  1TZ1 A;  4NQK E;  4BKS A;  4MDK E;  3DVG Y;  3M63 B;  5FR6 A;  2AEH A;  2KWV B;  1V6E A;  2ZPN A;  2KDI A;  1P98 A;  3DBS A;  3EFU A;  4WQO B;  1P9D U;  3A9J B;  3AUL A;  3DVG X;  3NY5 A;  4CHK A;  3SU8 X;  2KTR B;  4DHJ D;  1J8C A;  2JF5 A;  2IO1 B;  2LJ5 A;  3SD5 A;  1V81 A;  2IY1 B;  2A4Z A;  1YIW A;  2LXA A;  2PE9 A;  2RGF A;  3DDC B;  4KDI C;  2K8H A;  4HK2 A;  2GOW A;  4B9K A;  2GBN A;  2N9X A;  2RR9 A;  2ZCB A;  3A4S C;  2N7D A;  3UGB B;  2WWZ A;  3P2B A;  1WYW B;  2C7H A;  2MBQ A;  1C1Y B;  1V49 A;  1EF1 A;  2IO0 B;  1X1M A;  2V4L A;  3PHW B;  4RMA A;  2L3Z A;  1WX9 A;  2XK5 A;  2O6V D;  5D6J B;  2J7Q B;  4DHZ B;  2GBR A;  3QK0 A;  1I35 A;  1WR1 A;  1ZW7 A;  1V2Y A;  2LVP A;  4HLE A;  1GC6 A;  2WX1 A;  3H1U A;  2NVU I;  3QWZ B;  3U30 A;  2LRU A;  4B6W A;  4JQW C;  4HPL B;  4KV2 A;  2MA9 B;  1XT9 B;  2O2V B;  3KVF B;  2KFK A;  4N9F 4;  4DXA B;  1LFD A;  1EF5 A;  2VRR B;  3BIN A;  1XD3 B;  3APD A;  2XBB C;  2DYO A;  2RPQ A;  2CKH B;  2FUH B;  1WXS A;  2AYO B;  3MTN B;  1ZGU B;  2K1F A;  4WJP A;  4AP4 C;  3QAR A;  2JRH A;  4M8N A;  3ML8 A;  1KOT A;  2L7R A;  4WWP A;  2WX0 A;  4KSL C;  1GNU A;  3KUZ A;  3R66 C;  3VXW A;  5D94 A;  3IVF A;  2JVC A;  4BOS C;  3HM6 X;  3H7S A;  2NBV B;  3ZUN A;  2YVC A;  5LXH A;  1I42 A;  5AZF A;  2N4F A;  3H9D A;  4GDK B;  4FBJ B;  4GB9 A;  3LDZ E;  1WMH A;  2HE7 A;  4LJO B;  3M3J A;  3TCA A;  3VUW A;  2CHZ A;  4HJK A;  5AEK B;  2ZZP B;  3K9O B;  3VTU A;  3VQI A;  2KQ7 A;  3H7P B;  1YD8 U;  5KHQ A;  4BOZ B;  3Q3F A;  4NQL B;  3B1L X;  3DPD A;  3L13 A;  3QAQ A;  4DDG D;  3X0W A;  2BPS A;  4HCN B;  3WAP A;  2KD0 A;  1YQB A;  3L08 A;  1P1A A;  4DBG A;  3C0R B;  3OJ4 B;  4EZK A;  2KMA A;  2EMS A;  4MGY E;  4II3 B;  3RZW C;  1K8R B;  4JGH B;  2CR5 A;  1LM8 B;  3U8Z A; 
#chains in the Genus database with same CATH topology
 4LDT B;  1FXI A;  1GJZ A;  3L54 A;  1XQQ A;  1H8C A;  3EGR A;  3WAN A;  5G5G A;  4DK5 A;  1D3Z A;  1K51 A;  1E5W A;  2BS3 B;  4GSW A;  3OJ3 A;  3QQ8 B;  1PUT A;  4ARC A;  3ZKJ C;  3AEG B;  5D7G A;  3JSV A;  3UIP B;  4TKN A;  1FFU A;  3FIL B;  3HM3 A;  4CO7 A;  3RD2 A;  2NTT A;  3NVV A;  2KOX A;  2K22 A;  2FNJ B;  4KDL B;  4ANV A;  4EKU A;  3UQA A;  2JYE A;  2G4D B;  1VLB A;  4YTN B;  4RM9 A;  1B9R A;  4HKQ A;  4MGK E;  2GMI C;  2MP2 B;  4XDD A;  4G0N B;  2J42 A;  4TQ0 A;  3AE7 B;  1PGA A;  3NVW A;  2KZR A;  3ZJU A;  1RRB A;  4K3B A;  4FJV B;  3LYY A;  1ZE3 D;  3EEC A;  3QJZ A;  3AE4 B;  4W9I A;  3A4R A;  3QHT A;  2Y5B B;  3VUX A;  2UWQ A;  3CST A;  1YNT E;  1WIA A;  3KYD D;  4JLC A;  1NI2 A;  2LFI A;  4NPN A;  4I6P A;  3AU5 A;  3BYT B;  3PTF C;  3DBR B;  3JSV B;  3TMP B;  2G3Q B;  3ZXR A;  5DPW A;  4A3O A;  1KJT A;  2LZ6 A;  1JWB D;  2W3R A;  1YQ4 B;  1GPX A;  2JT4 B;  4M8M A;  3L16 A;  4GMV A;  1Z2M A;  1BUI C;  2G1E A;  4WAA A;  4P1C C;  1TYG B;  3DQV A;  2MBB B;  2C7N B;  1WGG A;  2L76 A;  1UZX B;  1UBQ A;  3AE8 B;  1EO6 A;  1QOG A;  3U4E G;  1IGD A;  1UGJ A;  5C1Z A;  3UI3 A;  1OQY A;  2K39 A;  3B2F A;  4Q2J A;  5BMI A;  2WP9 B;  4KGR A;  3O13 A;  2LGY A;  2SEB D;  3NJT A;  1VRA B;  2LGX A;  1KM7 A;  3GB1 A;  3TEY A;  3RMK C;  2LJI A;  1ROE A;  2LD9 A;  2K3U A;  3Q8C A;  1Z5S B;  4GDK A;  4LNI A;  3ENE A;  1YJI A;  3AU4 A;  1F2R C;  2M4N A;  2DYB A;  3I63 C;  4RCO A;  1M94 A;  1VJK A;  2M17 A;  1SXT A;  3Q6B A;  2QMT A;  1EWC A;  4II2 B;  2K0P A;  2LEK A;  1IUE A;  4NJ6 A;  1Q1O A;  4XX5 A;  2YLM A;  2V9H A;  2D07 B;  2BKR B;  4LNO A;  3Q69 A;  3BWU D;  3PV1 A;  3S2A A;  3WAO A;  1V1P B;  2MSE D;  3VTW A;  4F8C B;  1RAX A;  5CTR C;  4KGS A;  2MBH A;  1E6E B;  3ZDM C;  3NZ3 A;  5EDS A;  4P7I A;  3PZ7 A;  4IW0 A;  1R4M I;  4YSY B;  2D3C A;  5IP4 D;  3AB5 A;  2KDM A;  2INC C;  4YTP B;  1L5P A;  2LAS A;  5EE0 A;  1ZPS A;  4B95 A;  2N9E B;  1TS4 A;  1ET6 A;  3KWL A;  2LHE A;  1WGR A;  2WXG A;  3W1S C;  3V62 A;  2E6X A;  4XDC A;  5TR5 A;  3GP7 A;  5IN7 A;  3ML9 A;  1FD6 A;  1S3S G;  2M19 A;  2Z0D B;  1V9J A;  4IUM B;  1N6Z A;  2MX2 A;  1QOA A;  3R2T A;  2KO3 A;  3ZO5 B;  1SE4 A;  4IM2 A;  4AUQ C;  3SDL C;  2PTL A;  2RD0 A;  2EKI A;  1FRR A;  3P42 A;  5C2T B;  1ESF A;  3WAL A;  2K6D B;  3NG0 A;  2PE6 B;  3AE1 B;  5E6N A;  3IG3 A;  4ANX A;  3HK0 A;  3PPA A;  4A20 A;  1ZP0 B;  4HDO A;  4XWW A;  1QIL A;  2J52 A;  3AE3 B;  4C4V A;  3WAM A;  3L17 A;  2RPV A;  2XEW A;  4GU2 A;  5LLI A;  1KF6 B;  2INP E;  4A90 A;  1G6J A;  1YJ1 A;  4LDT D;  2WDQ B;  3CWI A;  2MBE A;  1TT5 B;  1UD7 A;  1JAL A;  4W9G A;  3PSE B;  3ZNH B;  4EE2 A;  4G3X B;  4BKT A;  3APF A;  3N1Y C;  2IGH A;  2JUO A;  1HQR D;  1N5W A;  1WXQ A;  4C7Y A;  3IBE A;  3Q8E A;  4PS3 A;  2KVZ A;  4W9J A;  4PS7 A;  3NS8 A;  5G55 A;  1BXT A;  4FHJ A;  4MGI E;  2L0T A;  2DZJ A;  1VZ7 A;  2J4X A;  4NJ7 A;  1SJE D;  4JWU C;  4ZOH C;  1K50 A;  1WX8 A;  4OZC A;  2J0M A;  1Q0W B;  4HKZ E;  3ZVV A;  3H8H A;  1WF9 A;  2K25 A;  5FK9 C;  4OZA A;  1P7E A;  4TV3 A;  3E9S A;  1RLF A;  3BVG A;  2HJ8 A;  5IAA C;  3ZTC A;  5C23 A;  1GOZ A;  3ETR A;  4EUT A;  1VD2 A;  3A1Q A;  2NPT B;  2KAJ A;  3UQB A;  5J2R A;  4MEL A;  2PEA A;  4WJO A;  1PQS A;  3C19 A;  1NBF C;  3UIO B;  3NVY A;  1TGZ B;  4GOC A;  4GLS C;  3PVL A;  3WIM A;  1F1H A;  1TJE A;  1E9M A;  4ZRJ A;  4C80 A;  3FC4 A;  4TSS A;  3HUI A;  2KAC A;  1TZ1 A;  4NQK E;  4D2K A;  3AED B;  3M63 B;  2KWV B;  1C4C A;  2ZPN A;  3EFU A;  1SE2 A;  1P9D U;  4H2A A;  4DHJ D;  3SU8 X;  2JF5 A;  4B0M A;  2IO1 B;  1KH0 A;  2LJ5 A;  2WU2 B;  1V81 A;  4KDI C;  1YN5 A;  1AN8 A;  2LXA A;  2MHJ A;  2OED A;  2GBN A;  1UNS A;  2ZCB A;  4YWG G;  2DLB A;  2WWZ A;  3P2B A;  2C7H A;  4RMA A;  1V49 A;  1EF1 A;  2IO0 B;  5D6J B;  2L3Z A;  1WX9 A;  2GBR A;  3QK0 A;  1I35 A;  1WR1 A;  2LVP A;  1GC6 A;  2NVU I;  3QWZ B;  2L83 A;  3I57 A;  2O2V B;  1QOB A;  4DXA B;  1LFD A;  1EF5 A;  1XLQ A;  2Y3A A;  3APD A;  2XBB C;  2RPQ A;  3EFC A;  1HZ6 A;  2DWQ A;  1WRI A;  1WXS A;  3WCQ A;  1L6U A;  4WJP A;  1ZGU B;  2IND C;  1I4P A;  1M4V A;  4WWP A;  4KSL C;  3R66 C;  5D94 A;  3AE9 B;  5LXH A;  3DBL B;  4FBJ B;  4JX1 C;  4LJO B;  4HJK A;  5AEK B;  5EE3 A;  2ZZP B;  3VQI A;  3U2S C;  1YD8 U;  5KHQ A;  4NQL B;  3B1L X;  4DDG D;  3EUB 2;  4HCN B;  4DBG A;  3TEX A;  1F52 A;  1XXG A;  4OZB A;  1OQQ A;  2EMS A;  3MP9 A;  4YSX B;  4II3 B;  2CR5 A;  1LM8 B;  3U8Z A;  1YN4 A;  2MLB A;  2XK5 B;  1P0R A;  2IO2 B;  3DHH C;  1OEY A;  3B2G A;  2K6Q A;  4ANW A;  4KZC A;  2KX3 A;  1OGW A;  4FJY A;  2M0X A;  2MW5 A;  2BVC A;  3L0W B;  1ZOY B;  1N62 A;  2FIF A;  2M1M A;  4EEW A;  1E7P B;  5DCN A;  3CMM B;  2FBW B;  3GE3 C;  4PYU A;  4K81 A;  1CJE A;  1IBX A;  5AZG A;  2LGD A;  1KTK A;  1MG4 A;  3N9Y C;  3EHV A;  3AEF B;  3KW5 B;  2JYT A;  2HD5 B;  2HTH A;  1GC7 A;  4E74 A;  3KUD B;  1ET9 A;  2ON8 A;  4LCD E;  1IPG A;  2KMM A;  3AI5 A;  3A9K A;  3R3M A;  1DOY A;  4US8 A;  1T0Y A;  4KKI A;  1SGH A;  2FCM A;  1L2N A;  1JML A;  4AWJ A;  3P1M A;  4TUU A;  4US9 A;  2A5U A;  4J3O D;  2DZI A;  2LMC A;  4K7W A;  3NOB A;  4RNA A;  4ICU A;  1GB1 A;  1TKE A;  2H89 B;  2J0J A;  1E8Y A;  2JU6 X;  2FE8 A;  4IKG A;  1JWU D;  4AJW A;  1FEH A;  4AS1 A;  1WR6 E;  1YQ3 B;  3AEA B;  3B0A A;  2AL3 A;  4USA A;  2RSU A;  3DBH I;  4S17 A;  3H7P A;  4IM0 A;  1V5O A;  3SFE B;  4NAW A;  3RNF C;  2LWP A;  2NBU A;  2X8X X;  2LVQ A;  1NEK B;  1LQB A;  2C7M B;  2GB1 A;  5FKA C;  4CQN A;  2GBK A;  2M8S A;  2MH7 A;  2BW2 A;  3HVZ A;  5IKC M;  3AH7 A;  3RUI B;  5JH5 C;  3QC8 B;  4MAC A;  1YX5 B;  1UGM A;  3U7Z A;  1J7C A;  2L00 B;  2CJN A;  2WXM A;  2OOB B;  1C3T A;  3NVZ A;  2ASQ A;  2L0F A;  2G4S A;  1K52 A;  2REX A;  2DHZ A;  1XLN A;  4C7Z A;  3RYT A;  3JW0 X;  1WY8 A;  4BFR A;  5JHB A;  3RUL A;  3Q3M C;  2XNA C;  3N20 C;  2WDV B;  4FHK A;  4GN1 A;  1D5X C;  1J7A A;  2WNM A;  1NEN B;  2MWS B;  3AXC A;  1IBX B;  3BVZ A;  1VR9 A;  1XCT L;  2HTM E;  4A3P A;  3H6N A;  5BYQ A;  1FIQ A;  2KDE B;  3A1Q B;  5KHO A;  1I4R A;  1WJU A;  3L4P A;  4ZRK A;  2D3A A;  1YN3 A;  2C5L C;  4HVB A;  1ZDX A;  1WM2 A;  4O1N A;  4MH8 A;  4BVU C;  2V0G A;  4OVZ A;  3ZIM A;  2K8B A;  1NI3 A;  4ZYS A;  5LXI B;  2WXI A;  3TEW A;  2CU3 A;  1RFK A;  1E90 A;  2WXR A;  1E8X A;  2IO3 B;  3IAS 1;  2OHF A;  2LGI A;  1L4D B;  4DHJ B;  3ZDT A;  3DBL I;  2RDB C;  1AAR A;  2WXP A;  2ZVN A;  3Q3O C;  3ALB A;  3PHX B;  4ANU A;  3B9J A;  1WI0 A;  3VH3 B;  2BTE A;  1WXV A;  2DAJ A;  4WJN A;  4OVU A;  4M0W B;  2NCN A;  4FXC A;  4ZRP A;  2FCS A;  2QIL A;  2MP2 A;  3Q8B A;  3TJP A;  2BYF A;  3N30 A;  1GG3 A;  2KWU B;  2KAN A;  4W9C A;  2JY6 A;  3EC8 A;  2D3B A;  1L4Z B;  2JZZ A;  2KN4 A;  1KRH A;  3BY4 B;  1SIF A;  2NMQ A;  4N59 A;  3E56 A;  2GBM A;  2LUE A;  1RFA A;  1UH6 A;  2JXT A;  1V80 A;  2WXH A;  1MI0 A;  5DPS A;  3ZGZ A;  3MJW A;  3OLM D;  2BT6 A;  4YSZ B;  4WWM A;  2BGF A;  4RM8 A;  3FIL A;  4L23 A;  4OW0 A;  1QT9 A;  1D4B A;  1FNV A;  2BYV E;  1RM6 C;  1S1Q B;  4URK A;  1SIJ A;  2DZM A;  3VHT C;  3BII D;  3PRP B;  1I4X A;  4QAY A;  4LNF A;  3QA8 A;  2V1Y A;  1L6V A;  3NS1 A;  2RDH A;  2B3A A;  3AEC B;  2KHW B;  1T3Q A;  1HXY D;  2V3P A;  3SR6 A;  4IM3 A;  1WGD A;  2KDB A;  2MJE A;  3MHZ A;  2BWF A;  3T8M A;  1VZ6 A;  2ZCC A;  4S0R A;  3UF8 A;  1JWM D;  2KQS A;  2ZVO A;  4MM3 A;  1YOV B;  5BO4 B;  4FN2 A;  2N1V A;  1SSN A;  2O6V B;  1D5M C;  2PPH A;  4ASW C;  2I1J A;  3T9L A;  2NBW B;  4GDL A;  1ZKH A;  2UU7 A;  3U52 E;  3M62 B;  3NHE B;  2JSV X;  4ICV A;  5E6P A;  1UBI A;  1V97 A;  2CS4 A;  1L7Y A;  1E7V A;  5L95 C;  4MH0 E;  1KLV A;  1H4R A;  3V61 A;  1UWM A;  1KFY B;  1L0V B;  1FXA A;  4HPP A;  1R4N I;  1OTR B;  4KIK B;  3AN1 A;  1HTO A;  1TY0 A;  5D3I B;  5EE9 A;  2DZK A;  2QEJ C;  2N9K A;  4IG7 B;  5CHF A;  2L8J A;  1UWX A;  3ZXV A;  2PVG C;  4DXF A;  3ZJV A;  2Z8L A;  5E6J A;  2KDI A;  1P98 A;  2WU5 B;  2IDY A;  3DVG X;  4IOI E;  1J8C A;  3SD5 A;  4WIP A;  1YIW A;  2PE9 A;  3DDC B;  2Q5W D;  4HK2 A;  4B9K A;  2RR9 A;  3UGB B;  1YJJ A;  4XE0 A;  2I38 A;  1C1Y B;  3FKY A;  4LTU A;  1ZUD 2;  4DHZ B;  4AQ7 A;  1V2Y A;  3GZN B;  2WHI A;  5HI1 A;  1FPY A;  2WX1 A;  3U30 A;  4B6W A;  2W3S A;  4JQW C;  4ZHO A;  2MA9 B;  3VRA B;  2E3T A;  4N9F 4;  2KFK A;  4RGT A;  3BIN A;  1XD3 B;  1CZP A;  2ONQ A;  2M56 B;  3ABV B;  4P6V F;  4ACF A;  4AP4 C;  1EM7 A;  1T0R C;  2JRH A;  4M8N A;  4MM3 B;  3NUH B;  1GB4 A;  2WX0 A;  1GNU A;  3VXW A;  3IVF A;  2JVC A;  3HM6 X;  2NBV B;  3ZUN A;  3I9V 1;  3IT4 B;  5AZF A;  3LDZ E;  2CHZ A;  3K9O B;  2BYT A;  4BOZ B;  2WLB A;  3L13 A;  3FAH A;  2BPS A;  1CK1 A;  3C0R B;  4DXG A;  4EZK A;  2KMA A;  3VUY A;  2H88 B;  3D32 A;  2N9L A;  4IC7 B;  3N32 A;  2KJR A;  3AMZ A;  5HG2 A;  3DWG C;  1F2R I;  3P63 A;  5T8I A;  1WJN A;  3PRM B;  3V05 A;  1QOF A;  2BS4 B;  1DOI A;  4AOF A;  2WXF A;  2PJH A;  2D3G A;  3AEB B;  2BKF A;  3AE5 B;  4C56 C;  4EZJ A;  2ZNV B;  3VVW B;  4XYC A;  4XWT A;  1UF0 A;  4NJC A;  4MSM B;  3PLV A;  3DWM A;  4A8X C;  3P4R B;  4REZ A;  3W9C B;  4GXB A;  4K7U A;  1HA5 A;  3GE8 C;  1SB3 C;  2AX5 A;  3B08 A;  2IBI B;  5G2N A;  4GDL B;  4YT0 B;  3VDZ A;  1BT0 A;  3RNG C;  3ONS A;  2ZNV C;  1GAQ B;  4BAX A;  5HHD G;  4W9K A;  1FCL A;  1MVK A;  4WWO A;  3KUC B;  1XCQ L;  5BYS A;  5CHW A;  1FO4 A;  4N6E B;  1AW7 A;  2C9W B;  4M00 A;  3RT3 B;  3ECI A;  3NZU A;  4MT5 A;  1PGX A;  1VCB A;  4GGQ A;  2KWD A;  5CHV C;  3MFG A;  1P3Q U;  3P4Q B;  3W1S A;  2KNB A;  1J7B A;  2PMV A;  3A33 B;  2DAF A;  1T0S C;  2PLP A;  1WE7 A;  2V3N A;  2J53 A;  3PS6 A;  3W2D A;  3ZYY X;  2WXJ A;  2WYQ A;  2EMT A;  1SF0 A;  1XO3 A;  1N61 A;  2JWZ A;  3N1Z C;  3NRZ A;  2I2Y A;  4J6I A;  2RDG A;  2L05 A;  2FAZ A;  1C77 A;  4K1R B;  1Q10 A;  4FLH A;  2BWE S;  3RN9 C;  4EFO A;  2HJ1 A;  4ZRI A;  4W9H A;  2JZ3 B;  2KC1 A;  4KSK C;  2KKC A;  5I4D A;  2OJW A;  3ZNZ B;  3QCA A;  4HCP B;  1AYF A;  3BZD B;  2UYZ B;  3BK2 A;  3QX1 A;  2JPH A;  3UIN B;  3SEB A;  4KKJ A;  5JHA A;  3W5U B;  2KJ6 A;  2EKE C;  4UDU C;  3IT6 B;  2B76 B;  1STE A;  3KH0 A;  1J0G A;  4MSQ B;  4WJQ A;  2LI5 A;  3T3N A;  1SBB B;  4RGM A;  2JXX A;  1NDD A;  1WGH A;  1YX6 B;  2D11 A;  2KVR A;  4BKG A;  1UEL A;  1YMH E;  1N60 A;  2CHX A;  1C79 A;  2L52 A;  2WDR B;  5J18 A;  2BBC A;  5DPT A;  3R7Q A;  1HE8 A;  2D5G A;  3V60 A;  1EU4 A;  1CMX B;  2K9X A;  1GUA B;  1WMH B;  2PIA A;  4JL9 A;  1C76 A;  3CF6 E;  2R2Q A;  3CSF A;  3KQ4 A;  1WJ6 A;  2KX0 A;  2GRI A;  2LGS A;  5AZH A;  5AUK A;  4B0E A;  2R2O A;  2NR2 A;  1A5R A;  2MJD A;  3LJ3 A;  2ZPY A;  2MCN B;  2ZJD A;  4KX6 B;  4M02 A;  2JWU A;  4OHJ A;  1ISN A;  1TS5 A;  1WWT A;  3IHP C;  2WQY B;  3GOE A;  2LHD A;  3PGE A;  3DCG A;  3LXF A;  4DQO C;  3VH4 B;  2W54 A;  2PKO A;  3Q8F A;  2PVO D;  1RYJ A;  4G11 A;  1F77 A;  1TY2 A;  3V6C B;  1LXD A;  1C4P A;  2V3S A;  2OJR A;  4WQM A;  1P7F A;  2KT7 A;  3QIJ A;  4P16 A;  1Y56 A;  1QQR A;  4HEA 1;  4NY0 A;  3ZTD A;  3C8Y A;  1N63 A;  1JWA D;  4F7Z A;  4GIV A;  3T3O A;  2GBJ A;  3PO0 A;  3JVZ X;  2J0K A;  3KYC D;  3V3X A;  2MQJ A;  1CQV A;  1NVI D;  4ZYN A;  3RNE C;  2NPT A;  3IXS A;  2KLC A;  5GXG B;  2KLG A;  2FUG 1;  1SE3 A;  2FCQ A;  2D10 A;  3R7R A;  4W9F A;  2DEN B;  2IPK D;  2CJO A;  3RNA C;  3EA6 A;  1F9J A;  2Y5C A;  2IZV B;  2W82 A;  3DBR I;  2BQQ A;  3LB8 C;  1LO5 D;  5BMG A;  1ZXI A;  1I7H A;  3TSS A;  5E6O A;  3TL5 A;  5HFY A;  3A9J A;  4NAW B;  2HDE A;  2KC2 A;  4PT5 A;  1WZ3 A;  3P4P B;  1WFY A;  3WA0 A;  4I6N B;  2KXJ A;  2MEK A;  4TQ1 A;  3RNB C;  3RCZ A;  3ZNG C;  2AQ1 B;  3ZNI D;  4ITK A;  2YEP B;  4DWF A;  2KFK B;  3ZJT A;  3N3K B;  4IWP A;  2M0A A;  4EZL A;  3HIZ A;  3OG5 A;  2JRI B;  1WX7 A;  1T5X D;  1R4M B;  1T0Q C;  4K7S A;  1MHX A;  2AEH A;  4PK1 A;  1C4A A;  1SEB D;  1QLB B;  4HJG E;  3A9J B;  3AUL A;  4CHK A;  5H92 C;  2KTR B;  4RGN A;  2ACZ B;  2IY1 B;  2A4Z A;  5IOI A;  3MC9 A;  1ZDV A;  3A4S C;  1ENF A;  1MPE A;  2MBQ A;  3Q2A C;  3HRD D;  1X1M A;  2XK5 A;  2K5P A;  2J7Q B;  2N7J A;  2XN9 C;  4JE3 B;  2JX5 A;  2LRU A;  1PGB A;  5IO9 A;  1D5Z C;  1DYQ A;  2VRR B;  2DYO A;  1DGJ A;  2QDF A;  4M01 A;  3W5V B;  4A55 A;  2CKH B;  1OFF A;  3MTN B;  1V1O A;  5FR3 A;  2JZP A;  3ML8 A;  3MC0 B;  4BOS C;  3H7S A;  1KLG D;  1FMA D;  2YVC A;  2N4F A;  3H9D A;  1BML C;  4GB9 A;  1WMH A;  1N5X A;  2HE7 A;  3VUW A;  4C00 A;  4A6Q A;  2RMM A;  3H7P B;  1WYG A;  4WUR A;  3DPD A;  3ZQ4 A;  3QAQ A;  3WAP A;  2KD0 A;  1YQB A;  2L32 A;  1P1A A;  3VR8 B;  1PYW D;  3KLS X;  3RZW C;  1K8R B;  1ACC A;  2EEL A;  2IYD B;  1TBE A;  1WH3 A;  4NZL B;  1MG8 A;  4XC2 A;  1WM3 A;  2KDF B;  4X57 B;  3HHM A;  3MJ5 A;  4FUL A;  1IP9 A;  1TKY A;  1FFV A;  5DPR A;  1JWS D;  3CIR B;  2V4I B;  3RZF A;  1WGY A;  4PYZ A;  3Q14 C;  5HKH A;  1HTQ A;  4W9L A;  1VDV A;  4RF0 A;  4A9A A;  4MJS B;  2CU1 A;  2N9P C;  2QIE B;  4R3D A;  3PLU A;  2WDT B;  3VR9 B;  5JXV A;  4DHZ E;  1E8W A;  1JW9 D;  3Q3J A;  2PW9 A;  1I4H A;  1A70 A;  1OQR A;  2IY0 B;  1EUV B;  4YTM B;  4ZDV A;  2L1A A;  3MHS D;  3X23 A;  2QJL A;  1FNW A;  4IDI A;  2DYM A;  1XF5 L;  2X38 A;  1EWY C;  4LK0 M;  3KWV A;  1QF6 A;  4LJP B;  2MRP A;  4YL8 A;  2ZEQ A;  5D3D A;  2GLS A;  2WXN A;  1IGC A;  2BS2 B;  4IWO A;  3VFK A;  3AEE B;  4HDQ A;  2WXK A;  4HRO A;  2NTS A;  4C4V B;  1TTN A;  1ZXH A;  3PRE A;  1IYF A;  5JZE B;  4LLG M;  4MJS A;  2Y5P A;  3ZRF A;  1FNU A;  3GZN I;  1MHH E;  4W9E A;  1MFW A;  1HZ5 A;  4E3C A;  1XEE A;  2KN5 A;  2N0S B;  2N7E A;  3O65 B;  4OVV A;  4FJZ A;  4HPM B;  2LXC A;  2G45 B;  4RFB A;  1PFD A;  2FID A;  1WRD B;  5H8Y E;  1TS2 A;  5MPO A;  4XZ4 A;  4XGA B;  1L0Y B;  1LGR A;  2KWC A;  2QCZ A;  3APC A;  3PRZ A;  1FXT B;  2LRW A;  3U7D A;  2N1W A;  5C3J B;  4HRS A;  1WGK A;  4CYE A;  2LUM A;  3DHG C;  1RWS A;  2LVO A;  3AV8 A;  2ZW1 A;  2WXL A;  5IA7 A;  3R8B A;  3PZ8 A;  4AJY B;  4NNJ B;  2JQR B;  1V86 A;  4FA6 A;  3TIX A;  3DHI C;  1U4A A;  4KVG B;  2CHW A;  3BYY B;  1TS3 A;  2WGS A;  2D2Q A;  2KK8 A;  5TSS A;  4PS8 A;  4RGO S;  4ZRQ A;  4JWS C;  3AM9 A;  1OEY J;  1Q5W B;  4K3C A;  1WSP A;  4E71 A;  1J19 A;  4RF1 A;  2O2V A;  1MJD A;  4MEM A;  1E0Z A;  2MBO A;  3IFW B;  1HEZ E;  3Q8A A;  5CX3 A;  3VTV A;  1E10 A;  1QKZ A;  1JRO A;  1JRU A;  5D2M B;  2K8C A;  3RPF C;  3N1X C;  3V6E B;  1Y8R C;  4BBN F;  4BKS D;  4IWQ A;  3RFZ B;  4BBN C;  3DVN U;  2QC8 A;  3ZLZ A;  2I1K A;  3NZS A;  2BF8 B;  3OAW A;  3TBL D;  4HWI B;  1NYQ A;  2QSD A;  3W1Y A;  3I3T B;  1T6B X;  3ZW3 A;  3SHQ A;  4L2Y A;  1WXA A;  2DBY A;  3PT2 B;  5J17 A;  5EE1 A;  3AE2 B;  1QZE A;  2ICI A;  2O6V A;  1NYR A;  1FCC C;  3P4S B;  5L83 A;  1VZ8 A;  4WWN A;  3L10 B;  4YXD B;  2VH1 A;  1E7U A;  4HXD A;  3SFD B;  2IGD A;  5LNK 1;  1V5T A;  1R4N B;  2W9N A;  1B1Z A;  1JQ4 A;  1I4Q A;  3J9C A;  2MJ3 A;  1E8Z A;  4G50 A;  4W9D A;  2QHO A;  1K53 A;  2YEP F;  1SE9 A;  2DNF A;  3JYU A;  3PZD A;  1L0X B;  1AWD A;  1PDX A;  4WH4 A;  3M95 A;  4KIK A;  4JIO U;  3K9P B;  2KMC A;  1V8C A;  2WXO A;  2ZW0 A;  1WZ0 A;  3AE6 B;  4ZHP A;  3A9K B;  4WAF A;  1KLU D;  4EOY A;  3DVN V;  4KZ0 A;  2G9H D;  4I6L B;  2KQ4 X;  2KJH B;  2Z0E B;  4TMA B;  3DBH B;  2R61 A;  2C60 A;  1I4G A;  2FCN A;  3RNC C;  2KTR A;  4LNK A;  4MGZ E;  2IJ0 A;  4JPS A;  1XLO A;  3BK1 A;  1WXM A;  1SJH D;  3BVM A;  5GMV A;  1C78 A;  3URY A;  1F0Z A;  2Z59 B;  1C9F A;  1TKG A;  2NS5 A;  3VAW A;  2KYW A;  3ZRC A;  2BYE A;  4F1S A;  2GI9 A;  4BZA A;  1FRD A;  4FAD A;  2IGG A;  1D6E C;  4LNN A;  3DOW A;  4DDI D;  2BB5 A;  2KTF A;  2KFJ A;  1WE6 A;  4ARI A;  2SAK A;  2AL6 A;  4NAM A;  2AWT A;  2DX5 B;  3GS2 A;  1WJ4 A;  4BKS A;  4MDK E;  3DVG Y;  5FR6 A;  3Q3N C;  1V6E A;  4N58 A;  2VH2 A;  5BMH A;  3DBS A;  1JRP A;  4WQO B;  3NY5 A;  1UUP A;  2AQ2 B;  1DOX A;  2RGF A;  2K8H A;  2GOW A;  1R7S A;  3VRB B;  2N9X A;  2N7D A;  1WYW B;  4L1B A;  3PHW B;  2V4L A;  2W55 A;  3IAM 1;  2TSS A;  2O6V D;  1ZW7 A;  4HLE A;  3H1U A;  2WXQ A;  4HPL B;  4KV2 A;  1XT9 B;  1V1P A;  3KVF B;  3HVD A;  3MC8 A;  2INN E;  1TIF A;  1JCK B;  5BYR A;  3TUO A;  3I5J C;  2FUH B;  2AQ3 B;  2AYO B;  2K1F A;  3QAR A;  1FM0 D;  3OWE B;  3R2I A;  2WS3 B;  1KOT A;  1XLP A;  2L7R A;  3KUZ A;  5G5H A;  3RI7 C;  1TZO A;  2VZK B;  1I42 A;  5AUI A;  4GDK B;  2VZK D;  1EU3 A;  4P1B C;  3M3J A;  3TCA A;  2BB6 A;  4M0W A;  3VTU A;  2KQ7 A;  3Q3F A;  4KGT A;  3X0W A;  3L08 A;  3TEZ A;  4RH6 A;  3OJ4 B;  4MGY E;  4JGH B; 
#chains in the Genus database with same CATH homology
 4LDT B;  2IYD B;  1TBE A;  1WH3 A;  2MLB A;  2XK5 B;  3D32 A;  1GJZ A;  1P0R A;  3L54 A;  1XQQ A;  1MG8 A;  2IO2 B;  4IC7 B;  1OEY A;  4XC2 A;  1H8C A;  1WM3 A;  2KDF B;  3N32 A;  2KJR A;  2K6Q A;  4ANW A;  3WAN A;  4KZC A;  4X57 B;  3HHM A;  1IP9 A;  4FUL A;  4DK5 A;  2KX3 A;  1D3Z A;  1OGW A;  4FJY A;  5DPR A;  1E5W A;  3RZF A;  2M0X A;  2MW5 A;  4GSW A;  1WGY A;  3OJ3 A;  3QQ8 B;  1WJN A;  3PRM B;  3L0W B;  4PYZ A;  5HKH A;  3ZKJ C;  4AOF A;  4W9L A;  2PJH A;  2D3G A;  3JSV A;  4TKN A;  5D7G A;  3UIP B;  4MJS B;  2BKF A;  2FIF A;  2M1M A;  2CU1 A;  4EZJ A;  2ZNV B;  3VVW B;  4EEW A;  2N9P C;  5DCN A;  3CMM B;  3HM3 A;  3PLU A;  4CO7 A;  3RD2 A;  4PYU A;  2WDT B;  4K81 A;  4MSM B;  3PLV A;  4DHZ E;  1E8W A;  2KOX A;  2FNJ B;  4KDL B;  4ANV A;  4GXB A;  4EKU A;  3Q3J A;  4K7U A;  3UQA A;  2G4D B;  5AZG A;  2IY0 B;  1EUV B;  2LGD A;  4RM9 A;  4ZDV A;  4MGK E;  2GMI C;  2MP2 B;  3EHV A;  3MHS D;  3X23 A;  3B08 A;  2IBI B;  3KW5 B;  5G2N A;  2HD5 B;  4GDL B;  2HTH A;  1GC7 A;  4E74 A;  3KUD B;  3VDZ A;  1BT0 A;  3ONS A;  4G0N B;  2ZNV C;  2DYM A;  4TQ0 A;  4LCD E;  4W9K A;  1IPG A;  2KZR A;  3AI5 A;  3A9K A;  3R3M A;  4WWO A;  4LJP B;  1RRB A;  1T0Y A;  2MRP A;  4FJV B;  3KUC B;  1SGH A;  3QJZ A;  3EEC A;  4YL8 A;  4W9I A;  5CHW A;  2ZEQ A;  2FCM A;  3A4R A;  2C9W B;  3QHT A;  1L2N A;  4AWJ A;  2Y5B B;  3VUX A;  3RT3 B;  3ECI A;  2UWQ A;  4TUU A;  3CST A;  3NZU A;  2A5U A;  1WIA A;  4IWO A;  3VFK A;  1VCB A;  3KYD D;  4JLC A;  2DZI A;  4K7W A;  4GGQ A;  4HDQ A;  3NOB A;  1NI2 A;  5CHV C;  4ICU A;  4NPN A;  4I6P A;  2J0J A;  3AU5 A;  1E8Y A;  1TTN A;  4AJW A;  3PTF C;  1WR6 E;  3PRE A;  3B0A A;  2AL3 A;  1IYF A;  3JSV B;  3TMP B;  5JZE B;  2RSU A;  4MJS A;  2G3Q B;  3DBH I;  3ZRF A;  1P3Q U;  3GZN I;  3H7P A;  4W9E A;  4IM0 A;  1V5O A;  3W1S A;  4NAW A;  5DPW A;  4A3O A;  1KJT A;  4E3C A;  2KNB A;  2LWP A;  2LZ6 A;  2NBU A;  3A33 B;  2DAF A;  2KN5 A;  2LVQ A;  1WE7 A;  2N7E A;  3O65 B;  1LQB A;  2C7M B;  4OVV A;  3PS6 A;  4FJZ A;  2GBK A;  2M8S A;  4HPM B;  2JT4 B;  2LXC A;  4M8M A;  3L16 A;  2WYQ A;  2G45 B;  1Z2M A;  4GMV A;  2EMT A;  2FID A;  3RUI B;  5JH5 C;  1WRD B;  3QC8 B;  4XZ4 A;  4WAA A;  1YX5 B;  1UGM A;  3DQV A;  2KWC A;  2JWZ A;  2MBB B;  3APC A;  2C7N B;  1WGG A;  2L76 A;  1UZX B;  3PRZ A;  1FXT B;  2L00 B;  1UBQ A;  2OOB B;  1C3T A;  4J6I A;  1EO6 A;  2ASQ A;  2L0F A;  2LRW A;  3U7D A;  2N1W A;  2G4S A;  5C1Z A;  2L05 A;  1OQY A;  2REX A;  2K39 A;  2FAZ A;  4K1R B;  2DHZ A;  3RYT A;  3JW0 X;  1WY8 A;  4CYE A;  4FLH A;  4BFR A;  3RUL A;  5JHB A;  2BWE S;  4FHK A;  3VUY A;  2LVO A;  4EFO A;  4GN1 A;  2LGY A;  5IA7 A;  4ZRI A;  2MWS B;  3AXC A;  4W9H A;  2LGX A;  2JZ3 B;  1KM7 A;  2KC1 A;  4KSK C;  4AJY B;  4NNJ B;  2KKC A;  3ZNZ B;  2LD9 A;  1V86 A;  3QCA A;  1Z5S B;  3H6N A;  4A3P A;  4GDK A;  4HCP B;  4FA6 A;  3TIX A;  2KDE B;  1U4A A;  3A1Q B;  4KVG B;  5KHO A;  1WJU A;  4ZRK A;  2CHW A;  2UYZ B;  3AU4 A;  2D2Q A;  2KK8 A;  2M4N A;  2DYB A;  3ENE A;  1M94 A;  2M17 A;  4PS8 A;  2C5L C;  3QX1 A;  4HVB A;  2JPH A;  3UIN B;  4II2 B;  5JHA A;  1WM2 A;  2KJ6 A;  2EKE C;  4BVU C;  3KH0 A;  1OEY J;  1J0G A;  4NJ6 A;  1Q1O A;  4XX5 A;  2YLM A;  4MSQ B;  1Q5W B;  4WJQ A;  2LI5 A;  2D07 B;  2BKR B;  2K8B A;  3ZIM A;  4E71 A;  1J19 A;  2JXX A;  3PV1 A;  1NDD A;  1WGH A;  3S2A A;  1YX6 B;  2D11 A;  3WAO A;  2O2V A;  2MSE D;  5LXI B;  4MEM A;  2KVR A;  3VTW A;  4F8C B;  4BKG A;  1RAX A;  2MBO A;  1UEL A;  5CTR C;  1E90 A;  2MBH A;  2CHX A;  3ZDM C;  1E8X A;  5EDS A;  2IO3 B;  3IFW B;  4P7I A;  5J18 A;  5CX3 A;  5DPT A;  3VTV A;  3R7Q A;  1HE8 A;  4IW0 A;  3V60 A;  4DHJ B;  1R4M I;  3ZDT A;  3DBL I;  1CMX B;  1AAR A;  1GUA B;  1JRU A;  1WMH B;  5D2M B;  2ZVN A;  2K8C A;  4JL9 A;  2LAS A;  3ALB A;  3V6E B;  1Y8R C;  3PHX B;  4B95 A;  4BBN F;  2N9E B;  3CF6 E;  2R2Q A;  3CSF A;  4ANU A;  1WJ6 A;  2KX0 A;  4BKS D;  5AZH A;  4IWQ A;  1WGR A;  1WI0 A;  3VH3 B;  2R2O A;  3W1S C;  1WXV A;  4BBN C;  2NR2 A;  2DAJ A;  3DVN U;  3V62 A;  4WJN A;  3LJ3 A;  4M0W B;  4OVU A;  3ZLZ A;  1A5R A;  2NCN A;  2I1K A;  2ZPY A;  3NZS A;  5TR5 A;  3ML9 A;  2FCS A;  1S3S G;  2Z0D B;  2ZJD A;  2MCN B;  1ISN A;  2BF8 B;  2MP2 A;  3IHP C;  1V9J A;  4IUM B;  3OAW A;  3GOE A;  3TJP A;  3TBL D;  2BYF A;  4HWI B;  3N30 A;  2MX2 A;  3PGE A;  1GG3 A;  2KWU B;  3DCG A;  2KAN A;  2KO3 A;  3VH4 B;  3W1Y A;  3ZO5 B;  4W9C A;  3I3T B;  4IM2 A;  2JY6 A;  4AUQ C;  3ZW3 A;  3SDL C;  3EC8 A;  3SHQ A;  2RD0 A;  4G11 A;  1WXA A;  3PT2 B;  3V6C B;  1LXD A;  2JZZ A;  2K6D B;  2PE6 B;  3WAL A;  5J17 A;  3BY4 B;  2V3S A;  5E6N A;  1SIF A;  3IG3 A;  2OJR A;  1QZE A;  4ANX A;  2GBM A;  2LUE A;  1RFA A;  3HK0 A;  2O6V A;  3PPA A;  1UH6 A;  4A20 A;  1V80 A;  3QIJ A;  4HDO A;  5DPS A;  4WWN A;  5L83 A;  3MJW A;  3L10 B;  3OLM D;  4NY0 A;  3ZTD A;  1E7U A;  2BGF A;  4HXD A;  4RM8 A;  3WAM A;  3L17 A;  4F7Z A;  2XEW A;  4GIV A;  2BYV E;  4GU2 A;  5LLI A;  2GBJ A;  3JVZ X;  1V5T A;  2J0K A;  3KYC D;  2W9N A;  1S1Q B;  1G6J A;  4URK A;  1E8Z A;  2DZM A;  4G50 A;  1YJ1 A;  4LDT D;  3VHT C;  2MQJ A;  4W9D A;  4ZYN A;  2QHO A;  3PRP B;  2NPT A;  2MBE A;  1SE9 A;  3QA8 A;  2KLC A;  1UD7 A;  4W9G A;  2KLG A;  3PSE B;  3JYU A;  3ZNH B;  3PZD A;  2V1Y A;  2B3A A;  2FCQ A;  2KHW B;  2D10 A;  4G3X B;  3M95 A;  4KIK A;  4JIO U;  3K9P B;  4BKT A;  3APF A;  2KMC A;  2JUO A;  3R7R A;  4W9F A;  2DEN B;  1WZ0 A;  4IM3 A;  3IBE A;  4PS3 A;  4W9J A;  3A9K B;  4PS7 A;  1WGD A;  1F9J A;  4EOY A;  2KDB A;  3NS8 A;  3DVN V;  3T8M A;  2BWF A;  2IZV B;  5G55 A;  4FHJ A;  4MGI E;  2ZCC A;  2L0T A;  4KZ0 A;  2DZJ A;  4NJ7 A;  3DBR I;  4I6L B;  2KJH B;  3UF8 A;  2Z0E B;  1WX8 A;  2KQS A;  5E6O A;  2ZVO A;  3TL5 A;  4MM3 A;  5BO4 B;  4FN2 A;  2N1V A;  2C60 A;  2J0M A;  2FCN A;  3A9J A;  1Q0W B;  4NAW B;  2KTR A;  2O6V B;  2KC2 A;  3ZVV A;  1WZ3 A;  4MGZ E;  1WFY A;  2PPH A;  4ASW C;  1WF9 A;  2K25 A;  2I1J A;  3T9L A;  2NBW B;  4TV3 A;  3WA0 A;  4GDL A;  2KXJ A;  1ZKH A;  4I6N B;  3M62 B;  1RLF A;  3NHE B;  4TQ1 A;  4ICV A;  1WXM A;  3RCZ A;  5GMV A;  2HJ8 A;  5IAA C;  3ZNG C;  3ZTC A;  5E6P A;  1UBI A;  5C23 A;  2Z59 B;  4EUT A;  1VD2 A;  3ZNI D;  3A1Q A;  2CS4 A;  1L7Y A;  1E7V A;  5L95 C;  4MH0 E;  2NS5 A;  1KLV A;  1H4R A;  2KFK B;  2NPT B;  4DWF A;  3UQB A;  5J2R A;  3VAW A;  3ZRC A;  4MEL A;  2PEA A;  3N3K B;  2BYE A;  4WJO A;  3V61 A;  4F1S A;  4IWP A;  4FAD A;  1PQS A;  1R4N I;  4EZL A;  1NBF C;  1OTR B;  3UIO B;  4KIK B;  1TGZ B;  3DOW A;  4DDI D;  4GOC A;  3HIZ A;  2KTF A;  3PVL A;  3WIM A;  2DZK A;  2KFJ A;  1WE6 A;  4ZRJ A;  2JRI B;  1WX7 A;  2AL6 A;  4IG7 B;  2AWT A;  2DX5 B;  4K7S A;  5CHF A;  1WJ4 A;  2L8J A;  1TZ1 A;  4NQK E;  4BKS A;  4MDK E;  3DVG Y;  3M63 B;  5FR6 A;  2AEH A;  2KWV B;  1V6E A;  2ZPN A;  2KDI A;  1P98 A;  3DBS A;  3EFU A;  4WQO B;  1P9D U;  3A9J B;  3AUL A;  3DVG X;  3NY5 A;  4CHK A;  3SU8 X;  2KTR B;  4DHJ D;  1J8C A;  2JF5 A;  2IO1 B;  2LJ5 A;  3SD5 A;  1V81 A;  2IY1 B;  2A4Z A;  1YIW A;  2LXA A;  2PE9 A;  2RGF A;  3DDC B;  4KDI C;  2K8H A;  4HK2 A;  2GOW A;  4B9K A;  2GBN A;  2N9X A;  2RR9 A;  2ZCB A;  3A4S C;  2N7D A;  3UGB B;  2WWZ A;  3P2B A;  1WYW B;  2C7H A;  2MBQ A;  1C1Y B;  1V49 A;  1EF1 A;  2IO0 B;  1X1M A;  2V4L A;  3PHW B;  4RMA A;  2L3Z A;  1WX9 A;  2XK5 A;  2O6V D;  5D6J B;  2J7Q B;  4DHZ B;  2GBR A;  3QK0 A;  1I35 A;  1WR1 A;  1ZW7 A;  1V2Y A;  2LVP A;  4HLE A;  1GC6 A;  2WX1 A;  3H1U A;  2NVU I;  3QWZ B;  3U30 A;  2LRU A;  4B6W A;  4JQW C;  4HPL B;  4KV2 A;  2MA9 B;  1XT9 B;  2O2V B;  3KVF B;  2KFK A;  4N9F 4;  4DXA B;  1LFD A;  1EF5 A;  2VRR B;  3BIN A;  1XD3 B;  3APD A;  2XBB C;  2DYO A;  2RPQ A;  2CKH B;  2FUH B;  1WXS A;  2AYO B;  3MTN B;  1ZGU B;  2K1F A;  4WJP A;  4AP4 C;  3QAR A;  2JRH A;  4M8N A;  3ML8 A;  1KOT A;  2L7R A;  4WWP A;  2WX0 A;  4KSL C;  1GNU A;  3KUZ A;  3R66 C;  3VXW A;  5D94 A;  3IVF A;  2JVC A;  4BOS C;  3HM6 X;  3H7S A;  2NBV B;  3ZUN A;  2YVC A;  5LXH A;  1I42 A;  5AZF A;  2N4F A;  3H9D A;  4GDK B;  4FBJ B;  4GB9 A;  3LDZ E;  1WMH A;  2HE7 A;  4LJO B;  3M3J A;  3TCA A;  3VUW A;  2CHZ A;  4HJK A;  5AEK B;  2ZZP B;  3K9O B;  3VTU A;  3VQI A;  2KQ7 A;  3H7P B;  1YD8 U;  5KHQ A;  4BOZ B;  3Q3F A;  4NQL B;  3B1L X;  3DPD A;  3L13 A;  3QAQ A;  4DDG D;  3X0W A;  2BPS A;  4HCN B;  3WAP A;  2KD0 A;  1YQB A;  3L08 A;  1P1A A;  4DBG A;  3C0R B;  3OJ4 B;  4EZK A;  2KMA A;  2EMS A;  4MGY E;  4II3 B;  3RZW C;  1K8R B;  4JGH B;  2CR5 A;  1LM8 B;  3U8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...