2KK8A

Nmr solution structure of a putative uncharacterized protein obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3449a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AT4g05270
publication title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kk8A01
1WXAA 1WXVA 4M0WB 3DVGY 2L05A 2N9EB 2EKEC 3RD2A 3VUXA 2MP2B 2LGXA 3HIZA 3ZW3A 3KUZA 4RMAA 5LXHA 3IHPC 3L10B 1OQYA 1ZW7A 2KQSA 3VTUA 2LJ5A 1H8CA 1XD3B 3DDCB 5L95C 2BKRB 4ASWC 1X1MA 3APCA 1OTRB 2UYZB 2FIDA 2LASA 2KO3A 3ZNHB 4XX5A 1R4MI 2PEAA 1YIWA 2KDFB 3HM3A 1EF1A 3PT2B 4IWQA 1Q1OA 1UBQA 5KHQA 3OAWA 3PVLA 2ZEQA 2KWVB 1KLVA 3QK0A 2CKHB 5TR5A 4ANVA 3U30A 3GZNI 3GOEA 2WWZA 4MDKE 5E6NA 1V49A 2KDBA 2G45B 2PJHA 4FN2A 2JUOA 2WYQA 2KC2A 4GIVA 3WALA 2DAFA 1E5WA 2J0MA 1WYWB 2DZIA 2JF5A 2KLGA 2KWUB 2MBBB 3N32A 3NHEB 4MM3A 4MH0E 4HK2A 3ZRFA 1YJ1A 2XEWA 1P0RA 4PS8A 3V6CB 1SE9A 2O2VA 4HCNB 2KC1A 3Q3JA 3VFKA 2C9WB 1AARA 4GN1A 4F8CB 3M3JA 2CR5A 2LXAA 3JYUA 4BBNC 2ZNVC 4ICUA 4XZ4A 3RULA 4EUTA 2DZMA 2JT4B 5JZEB 1WE6A 3K9PB 4AJWA 4GB9A 4GOCA 2L7RA 3SDLC 3WAOA 1V2YA 2MW5A 5CHVC 1KJTA 1SGHA 2LZ6A 5C23A 3SHQA 3NS8A 3R7RA 4IM3A 5G2NA 1WX7A 1UH6A 1WM2A 2CHXA 3S2AA 4FHJA 4EZJA 3N30A 2A5UA 4W9DA 2KJRA 4W9EA 4MELA 2KJHB 3VUWA 2BF8B 2KMCA 3UQBA 4IM2A 2K8BA 3L16A 4I6PA 3ALBA 4K7UA 5AZFA 2C7NB 1K8RB 2CS4A 3VVWB 3R3MA 1WR1A 2OJRA 2FAZA 1TZ1A 3QAQA 4ZRKA 4IC7B 2D2QA 4MSQB 4IG7B 4ZYNA 1RAXA 2O2VB 4J6IA 2NR2A 1UGMA 4WJPA 2Y5BB 1TTNA 3R66C 1I42A 4OVVA 4LDTD 2M8SA 1KM7A 2MBEA 4M8MA 4BBNF 3V62A 2KFKA 2CU1A 4JIOU 3RUIB 2NVUI 2XBBC 2MP2A 2K25A 4EOYA 1Z5SB 2KNBA 2CHZA 4KDLB 2IO3B 2KOXA 1HE8A 3O65B 4TV3A 2L0TA 3DVNU 4JGHB 3PRPB 4GDKA 4KIKA 2IO0B 1L7YA 2ZPNA 2K39A 3JW0X 1Q5WB 3UGBB 2FCQA 3P2BA 2N1VA 3ML9A 3DPDA 4HDQA 2DYBA 2ZVOA 4DHJB 4XC2A 2AEHA 1P9DU 2EMTA 2ZZPB 3KYDD 1WJ4A 4HJKA 3A33B 3QJZA 4GXBA 3T9LA 2KK8A 2BPSA 2FIFA 3IVFA 1U4AA 4JLCA 4X57B 3VTWA 4HPLB 2MRPA 3M62B 3SD5A 2L0FA 1RLFA 4PS3A 1XT9B 4PYUA 4ZRIA 2KJ6A 3N3KB 2KXJA 2BWES 5E6PA 3ZVVA 4YL8A 1L2NA 1WXMA 3ZDMC 2MLBA 2GOWA 2D11A 1Q0WB 1LQBA 2N7EA 3BY4B 2N1WA 5AZHA 2V4LA 2MA9B 4FHKA 1TBEA 2ASQA 2RPQA 3WIMA 1IYFA 2KDIA 4EZLA 4KZCA 5AEKB 4KIKB 4GDKB 3DBLI 3OJ4B 3TMPB 4BKTA 2G4SA 3PHXB 4BOSC 4KSLC 3KYCD 4E3CA 5J18A 5J17A 1R4NI 4GGQA 1T0YA 5DPSA 1C1YB 1OGWA 2KMAA 2O6VB 2K1FA 3VAWA 4HXDA 3WA0A 2QHOA 3WANA 1EF5A 2ZPYA 4K81A 2J0JA 1WZ3A 3W1SA 3AU4A 1WMHB 4PS7A 4ANWA 4AP4C 3ZRCA 1S1QB 4PYZA 4I6NB 3VH3B 3KH0A 3L08A 2RSUA 2MX2A 4URKA 4AOFA 1J8CA 3U8ZA 5FR6A 4A3OA 2LVQA 4EEWA 4WJOA 3M95A 4HLEA 4F7ZA 4NQLB 2DENB 2LRUA 3AXCA 3ECIA 2D3GA 3ZNID 2C5LC 2FNJB 1V9JA 1GG3A 4II3B 2M4NA 3H7PB 2HE7A 3PRMB 2B3AA 3JSVA 1OEYJ 2HTHA 3UINB 5CTRC 5LLIA 1LM8B 4E74A 3V60A 1WX8A 1WJUA 1NI2A 4MGIE 3Q3FA 3SU8X 2Z59B 3QQ8B 1YD8U 3PZDA 3HK0A 1JRUA 5E6OA 2K6DB 4LJOB 1E8XA 2NS5A 4P7IA 3AU5A 3W1YA 4HDOA 2L76A 4FJYA 1IP9A 3L0WB 2A4ZA 4W9CA 2WX1A 3V61A 3MJWA 1NDDA 2YVCA 1LFDA 4WAAA 3KUDB 2GBJA 2OOBB 4JL9A 5IAAC 3DOWA 1WZ0A 4FADA 4NNJB 4W9KA 4I6LB 1ISNA 2DZJA 5GMVA 3K9OB 3JSVB 5JHAA 4MGKE 2NPTA 2KKCA 5DPTA 4DHJD 2IY0B 1WGRA 3ZDTA 3BINA 4KZ0A 4A20A 3UQAA 1SIFA 3VUYA 1ZGUB 3NZSA 1Z2MA 4N9F4 3JVZX 4RM9A 2DZKA 3VXWA 3QWZB 4B95A 2FCSA 3NZUA 1NBFC 4F1SA 1V6EA 3D32A 2K8HA 5JHBA 2LWPA 1VD2A 2N4FA 2IY1B 2Z0DB 2D10A 2JPHA 4IWOA 3X23A 2GBNA 3H6NA 5EDSA 4MJSA 5D7GA 1RRBA 1D3ZA 3RZFA 1V86A 3VQIA 2M1MA 2BWFA 2C7HA 2O6VA 3U7DA 3PSEB 3UIPB 3PS6A 1M94A 2GBMA 2LGDA 2LXCA 1WGHA 2LD9A 3KUCB 3PREA 4NJ7A 1GNUA 3QCAA 1WJNA 4AWJA 2HJ8A 4JQWC 3WAPA 4DDGD 3IG3A 2FCNA 1WMHA 5DCNA 3VDZA 2WX0A 2MSED 3A4RA 3H1UA 5JH5C 5CHFA 1FXTB 2LRWA 1XQQA 3KVFB 2KQ7A 3TBLD 5IA7A 3A1QB 2AYOB 2GMIC 1V5TA 4II2B 4HWIB 2R2OA 1UZXB 4DBGA 5G55A 1WRDB 2O6VD 3RT3B 2NPTB 1CMXB 1WR6E 1UD7A 3HHMA 4EFOA 3DCGA 4FJVB 1RFAA 3EC8A 4GSWA 4W9HA 3DVGX 5CHWA 2ZNVB 2J0KA 5L83A 3M63B 4E71A 3H7PA 2KLCA 4MSMB 2PE6B 3W1SC 3B1LX 3ZUNA 2RR9A 2J7QB 2ZCBA 3HM6X 4CO7A 1VCBA 2DAJA 3L17A 3EFUA 5LXIB 4DHZE 4EKUA 4MJSB 3ONSA 4B9KA 3QC8B 4AJYB 1E7VA 2JXXA 4TQ1A 4NJ6A 3QA8A 3VHTC 4NAWB 2JZ3B 2KVRA 2MQJA 3QARA 1MG8A 2DHZA 3ML8A 4KSKC 1WY8A 1QZEA 4MEMA 3AULA 4WQOB 1E8ZA 4WWNA 1WJ6A 3APDA 3VH4B 2L3ZA 2CHWA 3NOBA 4BFRA 2YLMA 4ICVA 4KVGB 5D94A 2IBIB 4MGZE 1GC7A 4OVUA 3B0AA 3DBSA 2GBKA 4LCDE 2IZVB 3QHTA 2JRIB 2LGYA 3CF6E 4W9FA 4NPNA 2IO2B 2PE9A 2REXA 2KN5A 2XK5A 2MBOA 4W9LA 5D6JB 4WWOA 4WJQA 3DBRI 1F9JA 5DPWA 2FCMA 4FJZA 2JY6A 4FLHA 3ZTCA 1E8YA 2KTRB 3RYTA 3ZLZA 3OJ3A 5BO4B 2DYMA 2D07B 2LI5A 2KWCA 3H9DA 4G50A 4AUQC 2MBQA 2LVPA 4CHKA 2KDEB 2Z0EB 3EHVA 4NY0A 5J2RA 4G0NB 1WX9A 2JWZA 4G11A 3MHSD 4HVBA 2HD5B 2W9NA 1P3QU 2BYVE 3QX1A 4MGYE 4FA6A 3EECA 1P98A 4IM0A 3WAMA 4ANXA 2KTFA 2BYEA 2NBVB 3PRZA 2ZCCA 2G4DB 4HPMB 3AI5A 3I3TB 3UIOB 3T8MA 2DX5B 4KDIC 2IYDB 1I35A 3A9JA 4BKGA 1GUAB 4DK5A 3PLVA 3VTVA 4KV2A 4DDID 2BYFA 2M17A 4ZDVA 3PGEA 3LDZE 3TIXA 3X0WA 3LJ3A 4BVUC 4NQKE 3PHWB 4TKNA 3DQVA 1TGZB 2NBUA 2I1KA 2N9PC 3CMMB 1GJZA 3KW5B 4FBJB 2M0XA 2XK5B 1WI0A 1WGDA 2I1JA 4G3XB 1IPGA 5D2MB 3A1QA 3TJPA 4EZKA 2KX3A 2IO1B 3A9KA 3PLUA 1WE7A 1C3TA 1EUVB 3ENEA 4GDLA 2DYOA 1YQBA 2KZRA 2LVOA 4GU2A 1WFYA 1ZKHA 3L13A 3IBEA 5HKHA 2ZVNA 2AL3A 3CSFA 4M8NA 5C1ZA 4BOZB 1H4RA 3L54A 2N7DA 1E90A 1A5RA 4ANUA 2L8JA 1WIAA 2FUHB 2V1YA 4CYEA 2NBWB 3RCZA 3H7SA 2N9XA 4WJNA 1GC6A 1LXDA 4DXAB 4LJPB 1WGYA 5CX3A 2KD0A 4WWPA 4K7WA 1EO6A 2JZZA 4A3PA 3CSTA 1UBIA 1PQSA 4K1RB 4B6WA 3A9JB 1E7UA 4NAWA 1S3SG 4TUUA 4HCPB 3ZIMA 3C0RB 2L00B 1KOTA 4IUMB 2JVCA 2AWTA 2KFJA 2PPHA 3A4SC 3MTNB 4W9IA 2LUEA 4TQ0A 3IFWB 3TCAA 1WGGA 4BKSA 2JRHA 1Y8RC 3APFA 2UWQA 3DVNV 1BT0A 3A9KB 5KHOA 3B08A 5AZGA 4GDLB 2KANA 2GBRA 2KHWB 2MCNB 3PTFC 2KX0A 4IWPA 1WF9A 2R2QA 1WXSA 4IW0A 2K6QA 3ZNGC 4DHZB 2RD0A 3OLMD 3ZTDA 4W9JA 3TL5A 4BKSD 1YX6B 5DPRA 4LDTB 1UELA 3PPAA 3V6EB 2K8CA 3PV1A 1OEYA 1V81A 2BKFA 1WH3A 1V5OA 2ZJDA 1J19A 3NY5A 4FULA 3ZO5B 1J0GA 1WM3A 2NCNA 1V80A 2G3QB 1YX5B 2KTRA 2C60A 2BGFA 2RGFA 2WDTB 2MBHA 2C7MB 3R7QA 4RM8A 3ZKJC 4DWFA 3UF8A 3RZWC 2VRRB 2AL6A 2V3SA 3QIJA 1G6JA 2EMSA 4GMVA 2MWSB 1P1AA 1E8WA 3DBHI 3ZNZB 4W9GA 4K7SA 2KFKB 4ZRJA
chains in the Genus database with same CATH superfamily
1WXAA 1BMLC 3DVGY 2N9EB 2EKEC 3RNBC 1JCKB 2TSSA 4HRSA 1H8CA 1PGXA 2Y3AA 4ASWC 4XX5A 5BYSA 2D3BA 3SEBA 2PEAA 2E3TA 2KAJA 3TEZA 2Q5WD 1UBQA 3GZNB 1C76A 4GLSC 4RF0A 3QK0A 4MDKE 2PJHA 3IT6B 2WYQA 4GIVA 2DAFA 1E5WA 2KLGA 2KWUB 3N32A 3NHEB 1YJ1A 5IKCM 1P0RA 4LK0M 1SE9A 2O2VA 1JWSD 4HCNB 3VFKA 4F8CB 3M3JA 2CR5A 2LXAA 4C56C 4ICUA 2J42A 3K9PB 4GB9A 3NG0A 5CHVC 4D2KA 1SGHA 2LZ6A 2FBWB 1ZDXA 3R7RA 1WX7A 1UH6A 3Q8FA 3S2AA 4FHJA 2A5UA 5C2TB 4MELA 2M19A 2KJHB 3VUWA 2BF8B 3UQBA 4I6PA 2SAKA 2C7NB 3R3MA 1I4GA 4MH8A 4MM3B 5I4DA 1FNUA 4MSQB 2Y5BB 1TTNA 4OVVA 4RCOA 3FILA 3RUIB 4B0MA 1VLBA 2ZW0A 1N61A 4UDUC 4JGHB 3RI7C 3JW0X 3UGBB 3P2BA 1FD6A 4HDQA 1KLUD 2DYBA 4DHJB 1P9DU 1XLOA 1ET9A 4GXBA 3IVFA 4JLCA 3M62B 2NMQA 3AE6B 2L0FA 2B76B 1T3QA 1HQRD 3W5VB 4ZOHC 2J52A 1WXMA 1EM7A 3ZDMC 2GOWA 3MHZA 2V4LA 2MA9B 4FHKA 4ZRQA 1PUTA 3PO0A 2GB1A 1L6UA 1E7PB 2MJEA 4KIKB 1VDVA 4A90A 3OJ4B 3TMPB 3PHXB 4KSLC 5J17A 1R4NI 1C1YB 2O6VB 1SEBD 2QCZA 3WA0A 5LNK1 3WANA 4K81A 4S17A 2DLBA 1RYJA 3AEDB 5IP4D 3AB5A 5D3DA 4KGRA 2JQRB 2R61A 4PYZA 3KH0A 3L08A 2MX2A 4K3BA 1N60A 4AOFA 4URKA 3NVYA 3M95A 3AXCA 4II3B 1V9JA 2M4NA 2B3AA 4A8XC 1J7BA 3I57A 5HI1A 2BQQA 5LLIA 4TSSA 2L1AA 4TMAB 4REZA 1YN4A 1QKZA 1E6EB 3TEYA 3SU8X 2Z59B 1PDXA 1C9FA 3PZDA 1OQQA 2AQ3B 3HK0A 1JRUA 5T8IA 1SBBB 2K6DB 3KLSX 2L76A 3PZ7A 1IP9A 4KGTA 1B9RA 2YVCA 3GE3C 1IGDA 4WAAA 3KUDB 5H92C 2OOBB 1GAQB 1J7CA 4KGSA 4FADA 1TY2A 4W9KA 1LGRA 5GMVA 1BUIC 3ZJUA 1KF6B 4DHJD 5DPTA 4YT0B 3RFZB 3ZDTA 1GPXA 2WQYB 4JWUC 2BS4B 3QWZB 3Q3NC 1XCTL 1QLBB 3D32A 3DHGC 3AECB 2Z0DB 4IWOA 2QDFA 3U52E 4MJSA 1PFDA 1RRBA 1JALA 4LNKA 2WXJA 3UIPB 3ZJVA 2LD9A 1SB3C 4AWJA 1UGJA 1WMHA 1D4BA 3VDZA 2WX0A 3H1UA 1FXTB 2MJ3A 5IA7A 2AYOB 3I9V1 2O6VD 3AMZA 3AE9B 1KFYB 3HHMA 4EFOA 1RFAA 3EC8A 3DVGX 2N7JA 2V3PA 4RGTA 3M63B 3U7ZA 2KLCA 2N9LA 1V8CA 2VH2A 1R4NB 4CO7A 3Q3OC 4TQ1A 3BYTB 4NJ6A 4QAYA 5HHDG 2KVRA 1FIQA 4KSKC 1QZEA 4J3OD 1KRHA 1JWAD 4H2AA 4WQOB 4WWNA 1ZE3D 1C4AA 4BFRA 1OQRA 2GBKA 1ZPSA 2LGYA 3CF6E 2MBOA 3NVWA 4WJQA 3DBRI 2LGIA 5DPWA 3AE1B 5IO9A 1CJEA 2KTRB 2DYMA 2D07B 2LI5A 2Z8LA 2MBQA 3BIID 4CHKA 2IPKD 3AEGB 5J2RA 1WX9A 2HD5B 2W9NA 2J53A 2BYVE 4FA6A 3EECA 4IM0A 3WAMA 3AEAB 2ZCCA 2G4DB 1YJJA 3T8MA 3AEEB 3VTVA 1TKEA 2M17A 1TY0A 1WYGA 2BBCA 3ZQ4A 1RFKA 5HFYA 3NVZA 3PHWB 4TKNA 1TGZB 2I1KA 4M01A 3DWMA 3E9SA 2M0XA 1WI0A 4G3XB 1JWBD 1TYGB 1VZ7A 4OW0A 3ENEA 4GDLA 2DYOA 3L4PA 3IAM1 2LVOA 4GU2A 4WURA 1WFYA 2AQ1B 3CSFA 1ROEA 3DWGC 1KH0A 1A5RA 2V1YA 1XLPA 2WXNA 1MHHE 2N9XA 4WJNA 1LXDA 2L52A 1WGYA 1IBXA 1WWTA 3CSTA 5EE3A 4K1RB 2K5PA 3Q8BA 4NAWA 1S3SG 2N0SB 4HCPB 3ZIMA 3C0RB 2L00B 1KOTA 4IUMB 1FFUA 2AWTA 3MTNB 2KFJA 2PPHA 5FR3A 1F1HA 4R3DA 4ARIA 3B08A 5AZGA 2GBRA 2MCNB 3PTFC 4IWPA 1QOAA 3ZTDA 3OLMD 3IXSA 2DWQA 4BKSD 1UELA 3BVGA 1OEYA 1WH3A 3NY5A 3ETRA 3AE5B 1WM3A 2INCC 5BYRA 1ET6A 2C60A 2WDTB 3ZKJC 1C79A 4RM8A 1V1OA 1YJIA 4HKZE 1NI3A 1P1AA 1E8WA 3R8BA 4K7SA 5BMIA 4ITKA 3FILB 4M0WB 2L05A 3ZW3A 1JWMD 2LGXA 3HIZA 2G9HD 4LLGM 5LXHA 1HTQA 3IHPC 2I38A 2XN9C 4KKIA 1D5ZC 3APCA 1OTRB 4YTNB 3DBRB 2WU2B 2KDFB 1NENB 4P6VF 5AUKA 5KHQA 5IOIA 3SFDB 2W82A 2KWVB 1SE3A 1OFFA 3GZNI 3GOEA 1V49A 2G45B 4FN2A 2JUOA 1K53A 1N63A 1WYWB 2DZIA 1L6VA 4XE0A 4HK2A 2XEWA 4P1BC 1TKYA 1L5PA 2C9WB 1AARA 2GI9A 2MJDA 2ZNVC 5BYQA 4EUTA 2JT4B 4IDIA 1WE6A 4AJWA 4GOCA 2L7RA 2QJLA 2MW5A 4JX1C 1KJTA 3SHQA 1HEZE 1RWSA 5G2NA 1P7FA 4EZJA 2BTEA 3NS1A 4S0RA 3NZ3A 4K7UA 5AZFA 1WXQA 1AN8A 3VRAB 3W9CB 1NYQA 2E6XA 4ZYNA 1XEEA 4J6IA 2NR2A 4M8MA 4XWTA 5G5HA 2CU1A 4JIOU 2NVUI 4KKJA 1JQ4A 4A6QA 4KDLB 2KOXA 1WGKA 1HE8A 4TV3A 2L0TA 2KDMA 3PRPB 2IO0B 2ZPNA 1E10A 3U4EG 4MACA 4XC2A 4HJKA 3QJZA 1WSPA 3P4RB 3SD5A 2LHDA 4RF1A 4B0EA 4ZRIA 2WHIA 2NTTA 1C4CA 1QQRA 2KXJA 2BWES 3AEBB 5E6PA 1K51A 2N9KA 1V1PB 1L2NA 4RGMA 2D11A 2N7EA 1FNWA 1XF5L 5AZHA 1TBEA 2KACA 1ZXHA 4EZLA 5AEKB 3BYYB 4GDKB 5J18A 3ZGZA 3GB1A 2OEDA 1L4DB 2WU5B 4HXDA 2ON8A 2BW2A 1WZ3A 1WMHB 3VR8B 4US9A 1S1QB 4HKQA 3FKYA 4WH4A 4Q2JA 3U8ZA 2LVQA 4N59A 4WJOA 4HLEA 2DENB 2LRUA 3ZNID 2FNJB 1GG3A 3IAS1 2HE7A 1ACCA 4EE2A 1OEYJ 1C4PA 2HTHA 4E74A 2OHFA 3Q3FA 1HTOA 1MG4A 2DNFA 1QF6A 3T3OA 5E6OA 3EUB2 3W1YA 3L0WB 3AE8B 2WX1A 3V61A 2JYTA 1LFDA 2GBJA 1MPEA 4JL9A 5IAAC 1NEKB 3MP9A 2INNE 2RDGA 3JSVB 5JHAA 2NPTA 4YSYB 1WGRA 2QILA 4A20A 5C3JB 1J7AA 1SIFA 1PGBA 3JVZX 4N9F4 3VXWA 4B95A 2WDRB 1L0VB 2N4FA 1ENFA 3BWUD 2M0AA 4PT5A 1NVID 5EDSA 1EU3A 5D7GA 4USAA 1V86A 4LNIA 2BWFA 2C7HA 3PSEB 3PS6A 1M94A 3KUCB 3I63C 2H88B 4NJ7A 1GNUA 3QCAA 1WJNA 4JQWC 3IG3A 2FCNA 2MSED 2LRWA 3DHIC 2LUMA 5HG2A 2KQ7A 4WWMA 2R2OA 5G55A 3RT3B 4LNNA 1UD7A 4HJGE 4FJVB 4W9HA 2J0KA 3I5JC 2PE6B 4BAXA 3W1SC 1N6ZA 1TZOA 1VCBA 2DAJA 3EFUA 1IBXB 5LXIB 3ONSA 4B9KA 3QC8B 4AJYB 1YMHE 3N1ZC 1E7VA 2RMMA 1ZUD2 3QA8A 4NAWB 2MQJA 1TS5A 3J9CA 1MG8A 3ML8A 1WY8A 4MEMA 1B1ZA 1WJ6A 2LHEA 3APDA 2CHWA 3NOBA 1FXAA 3ZXVA 2MEKA 4OVUA 2CJOA 4LCDE 1TJEA 3QHTA 2REXA 4W9LA 4WWOA 3AV8A 2JY6A 3B2GA 1Y56A 4AUQC 1DOYA 2KDEB 1UWXA 4XDDA 4G0NB 1P3QU 4ANXA 1SE2A 3PRZA 2BYEA 3I3TB 2IGGA 1STEA 3A9JA 4BKGA 3BVZA 4RGNA 4KV2A 3W2DA 2BYFA 1UF0A 3LDZE 3LJ3A 4ZHOA 2NBUA 4FBJB 2XK5B 3TJPA 2IO1B 3PLUA 2BB5A 1WE7A 1C78A 1YQBA 1M4VA 3L13A 4M8NA 2KYWA 2N7DA 1E90A 4K3CA 2L8JA 3AE2B 1WIAA 2IJ0A 1VR9A 1GC6A 3P4SB 4DXAB 4WWPA 4B6WA 4YSXB 1MVKA 4OZCA 2KN4A 2LGSA 3IFWB 3TCAA 2WXGA 1QOGA 3DVNV 3Q8AA 3A9KB 4XGAB 5KHOA 3ZYYX 1J8CA 2R2QA 1WXSA 4W9JA 3TL5A 1YX6B 5DPRA 3V6EB 3PV1A 4P1CC 2BKFA 1J0GA 1V5OA 2ZJDA 4FULA 3ZO5B 2K0PA 3DHHC 1E0ZA 4DWFA 2VRRB 1LO5D 2D3CA 3DBHI 3ZNZB 4W9GA 2YEPF 4ZRJA 1WXVA 1K50A 3RD2A 1JWUD 3KUZA 4RMAA 4OVZA 1I4PA 3BZDB 3L10B 3U2SC 1ZW7A 2FE8A 2KQSA 3VTUA 2LJ5A 3AE3B 1XD3B 1T0RC 1X1MA 3FAHA 1R4MI 1QILA 3P42A 1YIWA 1TS4A 1FMAD 1PYWD 4IWQA 1Q1OA 3OAWA 3PVLA 2Y5CA 1KLVA 2CKHB 5TR5A 4HROA 2JZPA 3OG5A 5E6NA 2KDBA 2LEKA 2J0MA 4MH0E 4MM3A 2IGDA 1PGAA 1E9MA 1UUPA 3EA6A 2KC1A 2LJIA 4ZYSA 3EFCA 2QC8A 2ACZB 2PMVA 3MC8A 3RN9C 4NJCA 2HDEA 1GB1A 3HVZA 2PW9A 3HVDA 5JZEB 3WAOA 1V2YA 1VRAB 4A9AA 5C23A 3AE7B 3NS8A 4IM3A 1WM2A 2CHXA 3VRBB 2MHJA 3N30A 4W9DA 2KQ4X 4W9EA 3VR9B 4IM2A 2K8BA 4OHJA 2X8XX 2CS4A 3C19A 2OJRA 1TZ1A 1F77A 3QAQA 3Q2AC 4IC7B 2D2QA 3AE4B 4IG7B 4YTMB 1RAXA 2O2VB 3N20C 3Q8EA 2M8SA 1KM7A 1WRIA 4C7YA 3V62A 5IN7A 2MP2A 2K25A 2K3UA 3AEFB 2KNBA 4NAMA 2IO3B 3O65B 3TSSA 4KIKA 2PLPA 1Q5WB 2FCQA 3ML9A 3DPDA 2V4IB 2ZVOA 3KYDD 1WJ4A 3T9LA 4C4VA 2BPSA 2FIFA 1RLFA 1TIFA 1XT9B 3DBHB 4C7ZA 3N3KB 1TKGA 1FNVA 3ZVVA 1L0YB 1Q0WB 1LQBA 2N1WA 3NVVA 4RH6A 2D3AA 2ASQA 2RPQA 1MI0A 2FUG1 1MHXA 1TS2A 3RPFC 2BYTA 3DBLI 4BKTA 4BOSC 2G4SA 1R4MB 2WXLA 3AH7A 1D5XC 4GGQA 1I4RA 2H89B 1OGWA 2KMAA 4RFBA 2K1FA 3VAWA 1DOXA 1L4ZB 3W1SA 4PS7A 4WIPA 5GXGB 3ZRCA 4I6NB 1IUEA 2WXKA 4A3OA 5FR6A 2V9HA 4EEWA 4F7ZA 2D3GA 2QMTA 5AUIA 1MFWA 3PRMB 1HXYD 3N1XC 1LM8B 1VZ6A 1NI2A 4MGIE 3QQ8B 4NZLB 3GE8C 1SXTA 4C00A 4FXCA 2JX5A 4LJOB 1E8XA 2NS5A 1HZ6A 2WDQB 2A4ZA 4W9CA 1XO3A 1FO4A 1NDDA 1YNTE 1F2RI 2INPE 3DOWA 1WZ0A 3Q8CA 4NNJB 4I6LB 4DXGA 2Y5PA 2KKCA 2IY0B 4BZAA 3UQAA 3NZSA 2VZKD 1Z2MA 1ESFA 3NZUA 1NBFC 4F1SA 1V6EA 5JHBA 2LWPA 1VD2A 2WXPA 2D10A 3X23A 2WXRA 2GBNA 1JW9D 1D3ZA 3RZFA 2M1MA 2V0GA 2GBMA 1ZOYB 2LXCA 3LXFA 3B2FA 1N5XA 3WAPA 1N5WA 3A4RA 3TBLD 2GMIC 1V5TA 4II2B 1P7EA 4HWIB 4US8A 1WR6E 4LNOA 1A70A 2W54A 2ZNVB 3MFGA 4E71A 3H7PA 1I4HA 3TUOA 3B1LX 3C8YA 3ZUNA 3DBLB 2J7QB 3HM6X 2I2YA 3L17A 4DHZE 1N62A 4MJSB 2KMMA 2JXXA 4DXFA 1DGJA 3QARA 3FC4A 1D6EC 3RNAC 3NUHB 3GS2A 3AULA 3MJ5A 3VH4B 2L3ZA 3URYA 1JMLA 5EE1A 1BXTA 2YLMA 4KVGB 5D94A 5JXVA 2IBIB 4MGZE 3B0AA 3DBSA 1FCLA 2IZVB 2JRIB 2W3RA 4NPNA 1UWMA 5D6JB 3BVMA 2GRIA 2EKIA 1NYRA 4XWWA 1F9JA 3ZTCA 1GB4A 1E8YA 3ZLZA 3OJ3A 2KWCA 1FEHA 4G50A 2LVPA 3ZXRA 2JWZA 5D3IB 3QX1A 1XLNA 3AM9A 1P98A 1HZ5A 2NBVB 1DYQA 1FFVA 3AI5A 3R2IA 2DX5B 1SSNA 2IYDB 3Q6BA 2RPVA 4DK5A 4LTUA 4M02A 4RNAA 2K22A 4ZDVA 3PGEA 2BS3B 3RNGC 2J4XA 4WAFA 3NRZA 2WXQA 3CMMB 2W3SA 4HEA1 5D2MB 3A1QA 1C3TA 2X38A 2KZRA 3IBEA 5HKHA 2ZVNA 2AL3A 2HJ1A 4BOZB 2IGHA 1DOIA 4ANUA 1TT5B 2NBWB 3RCZA 3H8HA 2GLSA 5CX3A 2KD0A 4K7WA 1EO6A 4A3PA 1UBIA 1PQSA 2D5GA 2RDHA 1YQ4B 3HUIA 1E7UA 4TUUA 4M0WA 2JVCA 4TQ0A 4N58A 3APFA 2UWQA 3LB8C 4GDLB 2KANA 2KHWB 2BB6A 5FK9C 1WF9A 1XLQA 4IW0A 3ZNGC 2RD0A 4C80A 4LDTB 2NTSA 4OZBA 1V81A 1UNSA 1L0XB 4CQNA 1YOVB 2RGFA 2G3QB 1YX5B 2L32A 2MBHA 2C7MB 4P16A 1MJDA 3CWIA 3GP7A 2V3SA 3QIJA 4GMVA 2PTLA 2WLBA 2BVCA 3VUXA 2MP2B 2QSDA 2QEJC 2V3NA 1OQYA 2WXIA 2BS2B 3DDCB 5L95C 2BKRB 2UYZB 2FIDA 2LASA 2KO3A 3ZNHB 3HM3A 1EF1A 2LMCA 4C4VB 3PT2B 2W55A 3IT4B 2ZEQA 3Q69A 1ZP0B 2ZW1A 4ANVA 3U30A 2WWZA 1R7SA 3P1MA 2WXMA 3BK1A 2KC2A 3WALA 3BK2A 2JF5A 2MBBB 3ZRFA 4LNFA 4PS8A 3N1YC 3V6CB 3V05A 3Q3JA 4GN1A 4L2YA 2IDYA 4L23A 4BBNC 3JYUA 4XZ4A 3RULA 1YN5A 2DZMA 3RNEC 3T3NA 3SDLC 1CZPA 2G1EA 3KWVA 1QT9A 3O13A 1F0ZA 2WXFA 3EGRA 2KJRA 1K52A 2WNMA 3PZ8A 2KMCA 3L16A 3ALBA 1SF0A 1K8RB 3VVWB 1WR1A 2KWDA 2FAZA 3RNCC 4ZRKA 2K9XA 2MH7A 3R2TA 1QOBA 1EU4A 1UGMA 1D5MC 4WJPA 3R66C 1I42A 4LDTD 1V1PA 2MBEA 2HTME 4BBNF 2KFKA 2XBBC 4EOYA 1Z5SB 4YTPB 2CHZA 3DVNU 4YXDB 1FRDA 4GDKA 1L7YA 4WQMA 2K39A 4L1BA 4KX6B 2N1VA 2KVZA 2AEHA 2EMTA 3HRDD 2ZZPB 1SE4A 3A33B 2KK8A 4X57B 3VTWA 1U4AA 3SFEB 4HPLB 2MRPA 4PS3A 2JYEA 3AN1A 4PYUA 2KJ6A 2WGSA 4YL8A 2MLBA 3ABVB 3BY4B 4ARCA 1EWCA 3B9JA 3WIMA 1GOZA 3Q14C 1IYFA 2KDIA 4KZCA 3KYCD 1AYFA 4E3CA 3N9YC 1T0YA 5DPSA 1FPYA 2QHOA 1EF5A 2ZPYA 2J0JA 1FCCC 4M00A 3AU4A 4ANWA 4AP4C 1SIJA 3VH3B 2XNAC 2RSUA 3RNFC 4NQLB 3ECIA 2YEPB 4AS1A 2C5LC 1QOFA 4ZHPA 3H7PB 1T5XD 3JSVA 1HA5A 4O1NA 3UINB 5CTRC 1ZDVA 3V60A 1WX8A 1WJUA 4XYCA 1YD8U 1CK1A 3V3XA 4P7IA 3AU5A 4HDOA 4FJYA 3MJWA 4JPSA 4YWGG 5E6JA 2WDVB 4N6EB 3OWEB 4YSZB 1ISNA 2DZJA 1XCQL 2CU3A 3K9OB 4JWSC 5FKAC 4MGKE 3BINA 4KZ0A 2WS3B 3CIRB 3TEWA 3VUYA 1ZGUB 3P63A 4RM9A 2DZKA 3W5UB 2EELA 2FCSA 2K8HA 2IY1B 2JPHA 2KT7A 3H6NA 1VJKA 1T0SC 2WXOA 3VQIA 3SR6A 2O6VA 3U7DA 2LGDA 1WGHA 4MT5A 3PREA 4DDGD 2HJ8A 5DCNA 5JH5C 4RGOS 2VZKB 2JSVX 2RDBC 1TS3A 1JRPA 1XQQA 3KVFB 3A1QB 1UZXB 4DBGA 1WRDB 2NPTB 1CMXB 2JWUA 2PIAA 2AQ2B 3DCGA 4GSWA 5CHWA 5L83A 4MSMB 3P4PB 4IKGA 1C77A 3LYYA 2RR9A 2ZCBA 1FM0D 4EKUA 4DQOC 3E56A 2BT6A 1I4QA 2CJNA 1KTKA 3VHTC 2JZ3B 1KLGD 2DHZA 4XDCA 1YQ3B 1E8ZA 2WXHA 4ZRPA 1RM6C 2M56B 4ACFA 4ICVA 1GC7A 4JE3B 1T0QC 4OZAA 4W9FA 3KWLA 1I4XA 2IO2B 2PE9A 2XK5A 2KN5A 3UI3A 3KQ4A 2AX5A 2FCMA 3P4QB 1CQVA 4FJZA 4FLHA 1Q10A 2LFIA 1VZ8A 3MC0B 3RYTA 5BO4B 3H9DA 3EHVA 2Z0EB 4NY0A 2WP9B 4G11A 3MHSD 4HVBA 4MGYE 2KTFA 4HPMB 3UIOB 1XXGA 4KDIC 2QIEB 1I35A 5EE9A 3MC9A 1GUAB 3PLVA 4DDID 3TIXA 2PKOA 3X0WA 4BVUC 4NQKE 1V97A 3DQVA 1JROA 2OJWA 2N9PC 1GJZA 3KW5B 1WGDA 2I1JA 4EZKA 1IPGA 2KX3A 3A9KA 1EUVB 1T6BX 4PK1A 1EWYC 2JXTA 1ZKHA 5C1ZA 1H4RA 3L54A 2L83A 3WCQA 3NJTA 2FUHB 4CYEA 2UU7A 3H7SA 4LJPB 2JZZA 2PVGC 2SEBD 5TSSA 1ZXIA 3A9JB 5MPOA 1YN3A 5G5GA 1FRRA 1AW7A 5BMHA 5BMGA 4W9IA 2ICIA 3A4SC 2PVOD 2LUEA 4BKSA 1WGGA 2JRHA 1Y8RC 5EE0A 1I7HA 1FXIA 3TEXA 1BT0A 2JU6X 5H8YE 2VH1A 4A55A 2KX0A 4DHZB 1F52A 2K6QA 2INDC 4AQ7A 3PPAA 1SJHD 2K8CA 1AWDA 4IOIE 1J19A 4HPPA 2NCNA 3RMKC 3ZJTA 1V80A 2KTRA 2BGFA 3R7QA 1F2RC 2ONQA 3UF8A 1SJED 3RZWC 2AL6A 1G6JA 2EMSA 3Q3MC 2MWSB 1IGCA 5CHFA 2KFKB 2DBYA
chains in the Genus database with same CATH topology
1WXAA 1WXVA 4M0WB 3DVGY 2L05A 2N9EB 2EKEC 3RD2A 3VUXA 2MP2B 2LGXA 3HIZA 3ZW3A 3KUZA 4RMAA 5LXHA 3IHPC 3L10B 1OQYA 1ZW7A 2KQSA 3VTUA 2LJ5A 1H8CA 1XD3B 3DDCB 5L95C 2BKRB 4ASWC 1X1MA 3APCA 1OTRB 2UYZB 2FIDA 2LASA 2KO3A 3ZNHB 4XX5A 1R4MI 2PEAA 1YIWA 2KDFB 3HM3A 1EF1A 3PT2B 4IWQA 1Q1OA 1UBQA 5KHQA 3OAWA 3PVLA 2ZEQA 2KWVB 1KLVA 3QK0A 2CKHB 5TR5A 4ANVA 3U30A 3GZNI 3GOEA 2WWZA 4MDKE 5E6NA 1V49A 2KDBA 2G45B 2PJHA 4FN2A 2JUOA 2WYQA 2KC2A 4GIVA 3WALA 2DAFA 1E5WA 2J0MA 1WYWB 2DZIA 2JF5A 2KLGA 2KWUB 2MBBB 3N32A 3NHEB 4MM3A 4MH0E 4HK2A 3ZRFA 1YJ1A 2XEWA 1P0RA 4PS8A 3V6CB 1SE9A 2O2VA 4HCNB 2KC1A 3Q3JA 3VFKA 2C9WB 1AARA 4GN1A 4F8CB 3M3JA 2CR5A 2LXAA 3JYUA 4BBNC 2ZNVC 4ICUA 4XZ4A 3RULA 4EUTA 2DZMA 2JT4B 5JZEB 1WE6A 3K9PB 4AJWA 4GB9A 4GOCA 2L7RA 3SDLC 3WAOA 1V2YA 2MW5A 5CHVC 1KJTA 1SGHA 2LZ6A 5C23A 3SHQA 3NS8A 3R7RA 4IM3A 5G2NA 1WX7A 1UH6A 1WM2A 2CHXA 3S2AA 4FHJA 4EZJA 3N30A 2A5UA 4W9DA 2KJRA 4W9EA 4MELA 2KJHB 3VUWA 2BF8B 2KMCA 3UQBA 4IM2A 2K8BA 3L16A 4I6PA 3ALBA 4K7UA 5AZFA 2C7NB 1K8RB 2CS4A 3VVWB 3R3MA 1WR1A 2OJRA 2FAZA 1TZ1A 3QAQA 4ZRKA 4IC7B 2D2QA 4MSQB 4IG7B 4ZYNA 1RAXA 2O2VB 4J6IA 2NR2A 1UGMA 4WJPA 2Y5BB 1TTNA 3R66C 1I42A 4OVVA 4LDTD 2M8SA 1KM7A 2MBEA 4M8MA 4BBNF 3V62A 2KFKA 2CU1A 4JIOU 3RUIB 2NVUI 2XBBC 2MP2A 2K25A 4EOYA 1Z5SB 2KNBA 2CHZA 4KDLB 2IO3B 2KOXA 1HE8A 3O65B 4TV3A 2L0TA 3DVNU 4JGHB 3PRPB 4GDKA 4KIKA 2IO0B 1L7YA 2ZPNA 2K39A 3JW0X 1Q5WB 3UGBB 2FCQA 3P2BA 2N1VA 3ML9A 3DPDA 4HDQA 2DYBA 2ZVOA 4DHJB 4XC2A 2AEHA 1P9DU 2EMTA 2ZZPB 3KYDD 1WJ4A 4HJKA 3A33B 3QJZA 4GXBA 3T9LA 2KK8A 2BPSA 2FIFA 3IVFA 1U4AA 4JLCA 4X57B 3VTWA 4HPLB 2MRPA 3M62B 3SD5A 2L0FA 1RLFA 4PS3A 1XT9B 4PYUA 4ZRIA 2KJ6A 3N3KB 2KXJA 2BWES 5E6PA 3ZVVA 4YL8A 1L2NA 1WXMA 3ZDMC 2MLBA 2GOWA 2D11A 1Q0WB 1LQBA 2N7EA 3BY4B 2N1WA 5AZHA 2V4LA 2MA9B 4FHKA 1TBEA 2ASQA 2RPQA 3WIMA 1IYFA 2KDIA 4EZLA 4KZCA 5AEKB 4KIKB 4GDKB 3DBLI 3OJ4B 3TMPB 4BKTA 2G4SA 3PHXB 4BOSC 4KSLC 3KYCD 4E3CA 5J18A 5J17A 1R4NI 4GGQA 1T0YA 5DPSA 1C1YB 1OGWA 2KMAA 2O6VB 2K1FA 3VAWA 4HXDA 3WA0A 2QHOA 3WANA 1EF5A 2ZPYA 4K81A 2J0JA 1WZ3A 3W1SA 3AU4A 1WMHB 4PS7A 4ANWA 4AP4C 3ZRCA 1S1QB 4PYZA 4I6NB 3VH3B 3KH0A 3L08A 2RSUA 2MX2A 4URKA 4AOFA 1J8CA 3U8ZA 5FR6A 4A3OA 2LVQA 4EEWA 4WJOA 3M95A 4HLEA 4F7ZA 4NQLB 2DENB 2LRUA 3AXCA 3ECIA 2D3GA 3ZNID 2C5LC 2FNJB 1V9JA 1GG3A 4II3B 2M4NA 3H7PB 2HE7A 3PRMB 2B3AA 3JSVA 1OEYJ 2HTHA 3UINB 5CTRC 5LLIA 1LM8B 4E74A 3V60A 1WX8A 1WJUA 1NI2A 4MGIE 3Q3FA 3SU8X 2Z59B 3QQ8B 1YD8U 3PZDA 3HK0A 1JRUA 5E6OA 2K6DB 4LJOB 1E8XA 2NS5A 4P7IA 3AU5A 3W1YA 4HDOA 2L76A 4FJYA 1IP9A 3L0WB 2A4ZA 4W9CA 2WX1A 3V61A 3MJWA 1NDDA 2YVCA 1LFDA 4WAAA 3KUDB 2GBJA 2OOBB 4JL9A 5IAAC 3DOWA 1WZ0A 4FADA 4NNJB 4W9KA 4I6LB 1ISNA 2DZJA 5GMVA 3K9OB 3JSVB 5JHAA 4MGKE 2NPTA 2KKCA 5DPTA 4DHJD 2IY0B 1WGRA 3ZDTA 3BINA 4KZ0A 4A20A 3UQAA 1SIFA 3VUYA 1ZGUB 3NZSA 1Z2MA 4N9F4 3JVZX 4RM9A 2DZKA 3VXWA 3QWZB 4B95A 2FCSA 3NZUA 1NBFC 4F1SA 1V6EA 3D32A 2K8HA 5JHBA 2LWPA 1VD2A 2N4FA 2IY1B 2Z0DB 2D10A 2JPHA 4IWOA 3X23A 2GBNA 3H6NA 5EDSA 4MJSA 5D7GA 1RRBA 1D3ZA 3RZFA 1V86A 3VQIA 2M1MA 2BWFA 2C7HA 2O6VA 3U7DA 3PSEB 3UIPB 3PS6A 1M94A 2GBMA 2LGDA 2LXCA 1WGHA 2LD9A 3KUCB 3PREA 4NJ7A 1GNUA 3QCAA 1WJNA 4AWJA 2HJ8A 4JQWC 3WAPA 4DDGD 3IG3A 2FCNA 1WMHA 5DCNA 3VDZA 2WX0A 2MSED 3A4RA 3H1UA 5JH5C 5CHFA 1FXTB 2LRWA 1XQQA 3KVFB 2KQ7A 3TBLD 5IA7A 3A1QB 2AYOB 2GMIC 1V5TA 4II2B 4HWIB 2R2OA 1UZXB 4DBGA 5G55A 1WRDB 2O6VD 3RT3B 2NPTB 1CMXB 1WR6E 1UD7A 3HHMA 4EFOA 3DCGA 4FJVB 1RFAA 3EC8A 4GSWA 4W9HA 3DVGX 5CHWA 2ZNVB 2J0KA 5L83A 3M63B 4E71A 3H7PA 2KLCA 4MSMB 2PE6B 3W1SC 3B1LX 3ZUNA 2RR9A 2J7QB 2ZCBA 3HM6X 4CO7A 1VCBA 2DAJA 3L17A 3EFUA 5LXIB 4DHZE 4EKUA 4MJSB 3ONSA 4B9KA 3QC8B 4AJYB 1E7VA 2JXXA 4TQ1A 4NJ6A 3QA8A 3VHTC 4NAWB 2JZ3B 2KVRA 2MQJA 3QARA 1MG8A 2DHZA 3ML8A 4KSKC 1WY8A 1QZEA 4MEMA 3AULA 4WQOB 1E8ZA 4WWNA 1WJ6A 3APDA 3VH4B 2L3ZA 2CHWA 3NOBA 4BFRA 2YLMA 4ICVA 4KVGB 5D94A 2IBIB 4MGZE 1GC7A 4OVUA 3B0AA 3DBSA 2GBKA 4LCDE 2IZVB 3QHTA 2JRIB 2LGYA 3CF6E 4W9FA 4NPNA 2IO2B 2PE9A 2REXA 2KN5A 2XK5A 2MBOA 4W9LA 5D6JB 4WWOA 4WJQA 3DBRI 1F9JA 5DPWA 2FCMA 4FJZA 2JY6A 4FLHA 3ZTCA 1E8YA 2KTRB 3RYTA 3ZLZA 3OJ3A 5BO4B 2DYMA 2D07B 2LI5A 2KWCA 3H9DA 4G50A 4AUQC 2MBQA 2LVPA 4CHKA 2KDEB 2Z0EB 3EHVA 4NY0A 5J2RA 4G0NB 1WX9A 2JWZA 4G11A 3MHSD 4HVBA 2HD5B 2W9NA 1P3QU 2BYVE 3QX1A 4MGYE 4FA6A 3EECA 1P98A 4IM0A 3WAMA 4ANXA 2KTFA 2BYEA 2NBVB 3PRZA 2ZCCA 2G4DB 4HPMB 3AI5A 3I3TB 3UIOB 3T8MA 2DX5B 4KDIC 2IYDB 1I35A 3A9JA 4BKGA 1GUAB 4DK5A 3PLVA 3VTVA 4KV2A 4DDID 2BYFA 2M17A 4ZDVA 3PGEA 3LDZE 3TIXA 3X0WA 3LJ3A 4BVUC 4NQKE 3PHWB 4TKNA 3DQVA 1TGZB 2NBUA 2I1KA 2N9PC 3CMMB 1GJZA 3KW5B 4FBJB 2M0XA 2XK5B 1WI0A 1WGDA 2I1JA 4G3XB 1IPGA 5D2MB 3A1QA 3TJPA 4EZKA 2KX3A 2IO1B 3A9KA 3PLUA 1WE7A 1C3TA 1EUVB 3ENEA 4GDLA 2DYOA 1YQBA 2KZRA 2LVOA 4GU2A 1WFYA 1ZKHA 3L13A 3IBEA 5HKHA 2ZVNA 2AL3A 3CSFA 4M8NA 5C1ZA 4BOZB 1H4RA 3L54A 2N7DA 1E90A 1A5RA 4ANUA 2L8JA 1WIAA 2FUHB 2V1YA 4CYEA 2NBWB 3RCZA 3H7SA 2N9XA 4WJNA 1GC6A 1LXDA 4DXAB 4LJPB 1WGYA 5CX3A 2KD0A 4WWPA 4K7WA 1EO6A 2JZZA 4A3PA 3CSTA 1UBIA 1PQSA 4K1RB 4B6WA 3A9JB 1E7UA 4NAWA 1S3SG 4TUUA 4HCPB 3ZIMA 3C0RB 2L00B 1KOTA 4IUMB 2JVCA 2AWTA 2KFJA 2PPHA 3A4SC 3MTNB 4W9IA 2LUEA 4TQ0A 3IFWB 3TCAA 1WGGA 4BKSA 2JRHA 1Y8RC 3APFA 2UWQA 3DVNV 1BT0A 3A9KB 5KHOA 3B08A 5AZGA 4GDLB 2KANA 2GBRA 2KHWB 2MCNB 3PTFC 2KX0A 4IWPA 1WF9A 2R2QA 1WXSA 4IW0A 2K6QA 3ZNGC 4DHZB 2RD0A 3OLMD 3ZTDA 4W9JA 3TL5A 4BKSD 1YX6B 5DPRA 4LDTB 1UELA 3PPAA 3V6EB 2K8CA 3PV1A 1OEYA 1V81A 2BKFA 1WH3A 1V5OA 2ZJDA 1J19A 3NY5A 4FULA 3ZO5B 1J0GA 1WM3A 2NCNA 1V80A 2G3QB 1YX5B 2KTRA 2C60A 2BGFA 2RGFA 2WDTB 2MBHA 2C7MB 3R7QA 4RM8A 3ZKJC 4DWFA 3UF8A 3RZWC 2VRRB 2AL6A 2V3SA 3QIJA 1G6JA 2EMSA 4GMVA 2MWSB 1P1AA 1E8WA 3DBHI 3ZNZB 4W9GA 4K7SA 2KFKB 4ZRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXA A;  1WXV A;  4M0W B;  3DVG Y;  2L05 A;  2N9E B;  2EKE C;  3RD2 A;  3VUX A;  2MP2 B;  2LGX A;  3HIZ A;  3ZW3 A;  3KUZ A;  4RMA A;  5LXH A;  3IHP C;  3L10 B;  1OQY A;  1ZW7 A;  2KQS A;  3VTU A;  2LJ5 A;  1H8C A;  1XD3 B;  3DDC B;  5L95 C;  2BKR B;  4ASW C;  1X1M A;  3APC A;  1OTR B;  2UYZ B;  2FID A;  2LAS A;  2KO3 A;  3ZNH B;  4XX5 A;  1R4M I;  2PEA A;  1YIW A;  2KDF B;  3HM3 A;  1EF1 A;  3PT2 B;  4IWQ A;  1Q1O A;  1UBQ A;  5KHQ A;  3OAW A;  3PVL A;  2ZEQ A;  2KWV B;  1KLV A;  3QK0 A;  2CKH B;  5TR5 A;  4ANV A;  3U30 A;  3GZN I;  3GOE A;  2WWZ A;  4MDK E;  5E6N A;  1V49 A;  2KDB A;  2G45 B;  2PJH A;  4FN2 A;  2JUO A;  2WYQ A;  2KC2 A;  4GIV A;  3WAL A;  2DAF A;  1E5W A;  2J0M A;  1WYW B;  2DZI A;  2JF5 A;  2KLG A;  2KWU B;  2MBB B;  3N32 A;  3NHE B;  4MM3 A;  4MH0 E;  4HK2 A;  3ZRF A;  1YJ1 A;  2XEW A;  1P0R A;  4PS8 A;  3V6C B;  1SE9 A;  2O2V A;  4HCN B;  2KC1 A;  3Q3J A;  3VFK A;  2C9W B;  1AAR A;  4GN1 A;  4F8C B;  3M3J A;  2CR5 A;  2LXA A;  3JYU A;  4BBN C;  2ZNV C;  4ICU A;  4XZ4 A;  3RUL A;  4EUT A;  2DZM A;  2JT4 B;  5JZE B;  1WE6 A;  3K9P B;  4AJW A;  4GB9 A;  4GOC A;  2L7R A;  3SDL C;  3WAO A;  1V2Y A;  2MW5 A;  5CHV C;  1KJT A;  1SGH A;  2LZ6 A;  5C23 A;  3SHQ A;  3NS8 A;  3R7R A;  4IM3 A;  5G2N A;  1WX7 A;  1UH6 A;  1WM2 A;  2CHX A;  3S2A A;  4FHJ A;  4EZJ A;  3N30 A;  2A5U A;  4W9D A;  2KJR A;  4W9E A;  4MEL A;  2KJH B;  3VUW A;  2BF8 B;  2KMC A;  3UQB A;  4IM2 A;  2K8B A;  3L16 A;  4I6P A;  3ALB A;  4K7U A;  5AZF A;  2C7N B;  1K8R B;  2CS4 A;  3VVW B;  3R3M A;  1WR1 A;  2OJR A;  2FAZ A;  1TZ1 A;  3QAQ A;  4ZRK A;  4IC7 B;  2D2Q A;  4MSQ B;  4IG7 B;  4ZYN A;  1RAX A;  2O2V B;  4J6I A;  2NR2 A;  1UGM A;  4WJP A;  2Y5B B;  1TTN A;  3R66 C;  1I42 A;  4OVV A;  4LDT D;  2M8S A;  1KM7 A;  2MBE A;  4M8M A;  4BBN F;  3V62 A;  2KFK A;  2CU1 A;  4JIO U;  3RUI B;  2NVU I;  2XBB C;  2MP2 A;  2K25 A;  4EOY A;  1Z5S B;  2KNB A;  2CHZ A;  4KDL B;  2IO3 B;  2KOX A;  1HE8 A;  3O65 B;  4TV3 A;  2L0T A;  3DVN U;  4JGH B;  3PRP B;  4GDK A;  4KIK A;  2IO0 B;  1L7Y A;  2ZPN A;  2K39 A;  3JW0 X;  1Q5W B;  3UGB B;  2FCQ A;  3P2B A;  2N1V A;  3ML9 A;  3DPD A;  4HDQ A;  2DYB A;  2ZVO A;  4DHJ B;  4XC2 A;  2AEH A;  1P9D U;  2EMT A;  2ZZP B;  3KYD D;  1WJ4 A;  4HJK A;  3A33 B;  3QJZ A;  4GXB A;  3T9L A;  2KK8 A;  2BPS A;  2FIF A;  3IVF A;  1U4A A;  4JLC A;  4X57 B;  3VTW A;  4HPL B;  2MRP A;  3M62 B;  3SD5 A;  2L0F A;  1RLF A;  4PS3 A;  1XT9 B;  4PYU A;  4ZRI A;  2KJ6 A;  3N3K B;  2KXJ A;  2BWE S;  5E6P A;  3ZVV A;  4YL8 A;  1L2N A;  1WXM A;  3ZDM C;  2MLB A;  2GOW A;  2D11 A;  1Q0W B;  1LQB A;  2N7E A;  3BY4 B;  2N1W A;  5AZH A;  2V4L A;  2MA9 B;  4FHK A;  1TBE A;  2ASQ A;  2RPQ A;  3WIM A;  1IYF A;  2KDI A;  4EZL A;  4KZC A;  5AEK B;  4KIK B;  4GDK B;  3DBL I;  3OJ4 B;  3TMP B;  4BKT A;  2G4S A;  3PHX B;  4BOS C;  4KSL C;  3KYC D;  4E3C A;  5J18 A;  5J17 A;  1R4N I;  4GGQ A;  1T0Y A;  5DPS A;  1C1Y B;  1OGW A;  2KMA A;  2O6V B;  2K1F A;  3VAW A;  4HXD A;  3WA0 A;  2QHO A;  3WAN A;  1EF5 A;  2ZPY A;  4K81 A;  2J0J A;  1WZ3 A;  3W1S A;  3AU4 A;  1WMH B;  4PS7 A;  4ANW A;  4AP4 C;  3ZRC A;  1S1Q B;  4PYZ A;  4I6N B;  3VH3 B;  3KH0 A;  3L08 A;  2RSU A;  2MX2 A;  4URK A;  4AOF A;  1J8C A;  3U8Z A;  5FR6 A;  4A3O A;  2LVQ A;  4EEW A;  4WJO A;  3M95 A;  4HLE A;  4F7Z A;  4NQL B;  2DEN B;  2LRU A;  3AXC A;  3ECI A;  2D3G A;  3ZNI D;  2C5L C;  2FNJ B;  1V9J A;  1GG3 A;  4II3 B;  2M4N A;  3H7P B;  2HE7 A;  3PRM B;  2B3A A;  3JSV A;  1OEY J;  2HTH A;  3UIN B;  5CTR C;  5LLI A;  1LM8 B;  4E74 A;  3V60 A;  1WX8 A;  1WJU A;  1NI2 A;  4MGI E;  3Q3F A;  3SU8 X;  2Z59 B;  3QQ8 B;  1YD8 U;  3PZD A;  3HK0 A;  1JRU A;  5E6O A;  2K6D B;  4LJO B;  1E8X A;  2NS5 A;  4P7I A;  3AU5 A;  3W1Y A;  4HDO A;  2L76 A;  4FJY A;  1IP9 A;  3L0W B;  2A4Z A;  4W9C A;  2WX1 A;  3V61 A;  3MJW A;  1NDD A;  2YVC A;  1LFD A;  4WAA A;  3KUD B;  2GBJ A;  2OOB B;  4JL9 A;  5IAA C;  3DOW A;  1WZ0 A;  4FAD A;  4NNJ B;  4W9K A;  4I6L B;  1ISN A;  2DZJ A;  5GMV A;  3K9O B;  3JSV B;  5JHA A;  4MGK E;  2NPT A;  2KKC A;  5DPT A;  4DHJ D;  2IY0 B;  1WGR A;  3ZDT A;  3BIN A;  4KZ0 A;  4A20 A;  3UQA A;  1SIF A;  3VUY A;  1ZGU B;  3NZS A;  1Z2M A;  4N9F 4;  3JVZ X;  4RM9 A;  2DZK A;  3VXW A;  3QWZ B;  4B95 A;  2FCS A;  3NZU A;  1NBF C;  4F1S A;  1V6E A;  3D32 A;  2K8H A;  5JHB A;  2LWP A;  1VD2 A;  2N4F A;  2IY1 B;  2Z0D B;  2D10 A;  2JPH A;  4IWO A;  3X23 A;  2GBN A;  3H6N A;  5EDS A;  4MJS A;  5D7G A;  1RRB A;  1D3Z A;  3RZF A;  1V86 A;  3VQI A;  2M1M A;  2BWF A;  2C7H A;  2O6V A;  3U7D A;  3PSE B;  3UIP B;  3PS6 A;  1M94 A;  2GBM A;  2LGD A;  2LXC A;  1WGH A;  2LD9 A;  3KUC B;  3PRE A;  4NJ7 A;  1GNU A;  3QCA A;  1WJN A;  4AWJ A;  2HJ8 A;  4JQW C;  3WAP A;  4DDG D;  3IG3 A;  2FCN A;  1WMH A;  5DCN A;  3VDZ A;  2WX0 A;  2MSE D;  3A4R A;  3H1U A;  5JH5 C;  5CHF A;  1FXT B;  2LRW A;  1XQQ A;  3KVF B;  2KQ7 A;  3TBL D;  5IA7 A;  3A1Q B;  2AYO B;  2GMI C;  1V5T A;  4II2 B;  4HWI B;  2R2O A;  1UZX B;  4DBG A;  5G55 A;  1WRD B;  2O6V D;  3RT3 B;  2NPT B;  1CMX B;  1WR6 E;  1UD7 A;  3HHM A;  4EFO A;  3DCG A;  4FJV B;  1RFA A;  3EC8 A;  4GSW A;  4W9H A;  3DVG X;  5CHW A;  2ZNV B;  2J0K A;  5L83 A;  3M63 B;  4E71 A;  3H7P A;  2KLC A;  4MSM B;  2PE6 B;  3W1S C;  3B1L X;  3ZUN A;  2RR9 A;  2J7Q B;  2ZCB A;  3HM6 X;  4CO7 A;  1VCB A;  2DAJ A;  3L17 A;  3EFU A;  5LXI B;  4DHZ E;  4EKU A;  4MJS B;  3ONS A;  4B9K A;  3QC8 B;  4AJY B;  1E7V A;  2JXX A;  4TQ1 A;  4NJ6 A;  3QA8 A;  3VHT C;  4NAW B;  2JZ3 B;  2KVR A;  2MQJ A;  3QAR A;  1MG8 A;  2DHZ A;  3ML8 A;  4KSK C;  1WY8 A;  1QZE A;  4MEM A;  3AUL A;  4WQO B;  1E8Z A;  4WWN A;  1WJ6 A;  3APD A;  3VH4 B;  2L3Z A;  2CHW A;  3NOB A;  4BFR A;  2YLM A;  4ICV A;  4KVG B;  5D94 A;  2IBI B;  4MGZ E;  1GC7 A;  4OVU A;  3B0A A;  3DBS A;  2GBK A;  4LCD E;  2IZV B;  3QHT A;  2JRI B;  2LGY A;  3CF6 E;  4W9F A;  4NPN A;  2IO2 B;  2PE9 A;  2REX A;  2KN5 A;  2XK5 A;  2MBO A;  4W9L A;  5D6J B;  4WWO A;  4WJQ A;  3DBR I;  1F9J A;  5DPW A;  2FCM A;  4FJZ A;  2JY6 A;  4FLH A;  3ZTC A;  1E8Y A;  2KTR B;  3RYT A;  3ZLZ A;  3OJ3 A;  5BO4 B;  2DYM A;  2D07 B;  2LI5 A;  2KWC A;  3H9D A;  4G50 A;  4AUQ C;  2MBQ A;  2LVP A;  4CHK A;  2KDE B;  2Z0E B;  3EHV A;  4NY0 A;  5J2R A;  4G0N B;  1WX9 A;  2JWZ A;  4G11 A;  3MHS D;  4HVB A;  2HD5 B;  2W9N A;  1P3Q U;  2BYV E;  3QX1 A;  4MGY E;  4FA6 A;  3EEC A;  1P98 A;  4IM0 A;  3WAM A;  4ANX A;  2KTF A;  2BYE A;  2NBV B;  3PRZ A;  2ZCC A;  2G4D B;  4HPM B;  3AI5 A;  3I3T B;  3UIO B;  3T8M A;  2DX5 B;  4KDI C;  2IYD B;  1I35 A;  3A9J A;  4BKG A;  1GUA B;  4DK5 A;  3PLV A;  3VTV A;  4KV2 A;  4DDI D;  2BYF A;  2M17 A;  4ZDV A;  3PGE A;  3LDZ E;  3TIX A;  3X0W A;  3LJ3 A;  4BVU C;  4NQK E;  3PHW B;  4TKN A;  3DQV A;  1TGZ B;  2NBU A;  2I1K A;  2N9P C;  3CMM B;  1GJZ A;  3KW5 B;  4FBJ B;  2M0X A;  2XK5 B;  1WI0 A;  1WGD A;  2I1J A;  4G3X B;  1IPG A;  5D2M B;  3A1Q A;  3TJP A;  4EZK A;  2KX3 A;  2IO1 B;  3A9K A;  3PLU A;  1WE7 A;  1C3T A;  1EUV B;  3ENE A;  4GDL A;  2DYO A;  1YQB A;  2KZR A;  2LVO A;  4GU2 A;  1WFY A;  1ZKH A;  3L13 A;  3IBE A;  5HKH A;  2ZVN A;  2AL3 A;  3CSF A;  4M8N A;  5C1Z A;  4BOZ B;  1H4R A;  3L54 A;  2N7D A;  1E90 A;  1A5R A;  4ANU A;  2L8J A;  1WIA A;  2FUH B;  2V1Y A;  4CYE A;  2NBW B;  3RCZ A;  3H7S A;  2N9X A;  4WJN A;  1GC6 A;  1LXD A;  4DXA B;  4LJP B;  1WGY A;  5CX3 A;  2KD0 A;  4WWP A;  4K7W A;  1EO6 A;  2JZZ A;  4A3P A;  3CST A;  1UBI A;  1PQS A;  4K1R B;  4B6W A;  3A9J B;  1E7U A;  4NAW A;  1S3S G;  4TUU A;  4HCP B;  3ZIM A;  3C0R B;  2L00 B;  1KOT A;  4IUM B;  2JVC A;  2AWT A;  2KFJ A;  2PPH A;  3A4S C;  3MTN B;  4W9I A;  2LUE A;  4TQ0 A;  3IFW B;  3TCA A;  1WGG A;  4BKS A;  2JRH A;  1Y8R C;  3APF A;  2UWQ A;  3DVN V;  1BT0 A;  3A9K B;  5KHO A;  3B08 A;  5AZG A;  4GDL B;  2KAN A;  2GBR A;  2KHW B;  2MCN B;  3PTF C;  2KX0 A;  4IWP A;  1WF9 A;  2R2Q A;  1WXS A;  4IW0 A;  2K6Q A;  3ZNG C;  4DHZ B;  2RD0 A;  3OLM D;  3ZTD A;  4W9J A;  3TL5 A;  4BKS D;  1YX6 B;  5DPR A;  4LDT B;  1UEL A;  3PPA A;  3V6E B;  2K8C A;  3PV1 A;  1OEY A;  1V81 A;  2BKF A;  1WH3 A;  1V5O A;  2ZJD A;  1J19 A;  3NY5 A;  4FUL A;  3ZO5 B;  1J0G A;  1WM3 A;  2NCN A;  1V80 A;  2G3Q B;  1YX5 B;  2KTR A;  2C60 A;  2BGF A;  2RGF A;  2WDT B;  2MBH A;  2C7M B;  3R7Q A;  4RM8 A;  3ZKJ C;  4DWF A;  3UF8 A;  3RZW C;  2VRR B;  2AL6 A;  2V3S A;  3QIJ A;  1G6J A;  2EMS A;  4GMV A;  2MWS B;  1P1A A;  1E8W A;  3DBH I;  3ZNZ B;  4W9G A;  4K7S A;  2KFK B;  4ZRJ A; 
#chains in the Genus database with same CATH topology
 1WXA A;  1BML C;  3DVG Y;  2N9E B;  2EKE C;  3RNB C;  1JCK B;  2TSS A;  4HRS A;  1H8C A;  1PGX A;  2Y3A A;  4ASW C;  4XX5 A;  5BYS A;  2D3B A;  3SEB A;  2PEA A;  2E3T A;  2KAJ A;  3TEZ A;  2Q5W D;  1UBQ A;  3GZN B;  1C76 A;  4GLS C;  4RF0 A;  3QK0 A;  4MDK E;  2PJH A;  3IT6 B;  2WYQ A;  4GIV A;  2DAF A;  1E5W A;  2KLG A;  2KWU B;  3N32 A;  3NHE B;  1YJ1 A;  5IKC M;  1P0R A;  4LK0 M;  1SE9 A;  2O2V A;  1JWS D;  4HCN B;  3VFK A;  4F8C B;  3M3J A;  2CR5 A;  2LXA A;  4C56 C;  4ICU A;  2J42 A;  3K9P B;  4GB9 A;  3NG0 A;  5CHV C;  4D2K A;  1SGH A;  2LZ6 A;  2FBW B;  1ZDX A;  3R7R A;  1WX7 A;  1UH6 A;  3Q8F A;  3S2A A;  4FHJ A;  2A5U A;  5C2T B;  4MEL A;  2M19 A;  2KJH B;  3VUW A;  2BF8 B;  3UQB A;  4I6P A;  2SAK A;  2C7N B;  3R3M A;  1I4G A;  4MH8 A;  4MM3 B;  5I4D A;  1FNU A;  4MSQ B;  2Y5B B;  1TTN A;  4OVV A;  4RCO A;  3FIL A;  3RUI B;  4B0M A;  1VLB A;  2ZW0 A;  1N61 A;  4UDU C;  4JGH B;  3RI7 C;  3JW0 X;  3UGB B;  3P2B A;  1FD6 A;  4HDQ A;  1KLU D;  2DYB A;  4DHJ B;  1P9D U;  1XLO A;  1ET9 A;  4GXB A;  3IVF A;  4JLC A;  3M62 B;  2NMQ A;  3AE6 B;  2L0F A;  2B76 B;  1T3Q A;  1HQR D;  3W5V B;  4ZOH C;  2J52 A;  1WXM A;  1EM7 A;  3ZDM C;  2GOW A;  3MHZ A;  2V4L A;  2MA9 B;  4FHK A;  4ZRQ A;  1PUT A;  3PO0 A;  2GB1 A;  1L6U A;  1E7P B;  2MJE A;  4KIK B;  1VDV A;  4A90 A;  3OJ4 B;  3TMP B;  3PHX B;  4KSL C;  5J17 A;  1R4N I;  1C1Y B;  2O6V B;  1SEB D;  2QCZ A;  3WA0 A;  5LNK 1;  3WAN A;  4K81 A;  4S17 A;  2DLB A;  1RYJ A;  3AED B;  5IP4 D;  3AB5 A;  5D3D A;  4KGR A;  2JQR B;  2R61 A;  4PYZ A;  3KH0 A;  3L08 A;  2MX2 A;  4K3B A;  1N60 A;  4AOF A;  4URK A;  3NVY A;  3M95 A;  3AXC A;  4II3 B;  1V9J A;  2M4N A;  2B3A A;  4A8X C;  1J7B A;  3I57 A;  5HI1 A;  2BQQ A;  5LLI A;  4TSS A;  2L1A A;  4TMA B;  4REZ A;  1YN4 A;  1QKZ A;  1E6E B;  3TEY A;  3SU8 X;  2Z59 B;  1PDX A;  1C9F A;  3PZD A;  1OQQ A;  2AQ3 B;  3HK0 A;  1JRU A;  5T8I A;  1SBB B;  2K6D B;  3KLS X;  2L76 A;  3PZ7 A;  1IP9 A;  4KGT A;  1B9R A;  2YVC A;  3GE3 C;  1IGD A;  4WAA A;  3KUD B;  5H92 C;  2OOB B;  1GAQ B;  1J7C A;  4KGS A;  4FAD A;  1TY2 A;  4W9K A;  1LGR A;  5GMV A;  1BUI C;  3ZJU A;  1KF6 B;  4DHJ D;  5DPT A;  4YT0 B;  3RFZ B;  3ZDT A;  1GPX A;  2WQY B;  4JWU C;  2BS4 B;  3QWZ B;  3Q3N C;  1XCT L;  1QLB B;  3D32 A;  3DHG C;  3AEC B;  2Z0D B;  4IWO A;  2QDF A;  3U52 E;  4MJS A;  1PFD A;  1RRB A;  1JAL A;  4LNK A;  2WXJ A;  3UIP B;  3ZJV A;  2LD9 A;  1SB3 C;  4AWJ A;  1UGJ A;  1WMH A;  1D4B A;  3VDZ A;  2WX0 A;  3H1U A;  1FXT B;  2MJ3 A;  5IA7 A;  2AYO B;  3I9V 1;  2O6V D;  3AMZ A;  3AE9 B;  1KFY B;  3HHM A;  4EFO A;  1RFA A;  3EC8 A;  3DVG X;  2N7J A;  2V3P A;  4RGT A;  3M63 B;  3U7Z A;  2KLC A;  2N9L A;  1V8C A;  2VH2 A;  1R4N B;  4CO7 A;  3Q3O C;  4TQ1 A;  3BYT B;  4NJ6 A;  4QAY A;  5HHD G;  2KVR A;  1FIQ A;  4KSK C;  1QZE A;  4J3O D;  1KRH A;  1JWA D;  4H2A A;  4WQO B;  4WWN A;  1ZE3 D;  1C4A A;  4BFR A;  1OQR A;  2GBK A;  1ZPS A;  2LGY A;  3CF6 E;  2MBO A;  3NVW A;  4WJQ A;  3DBR I;  2LGI A;  5DPW A;  3AE1 B;  5IO9 A;  1CJE A;  2KTR B;  2DYM A;  2D07 B;  2LI5 A;  2Z8L A;  2MBQ A;  3BII D;  4CHK A;  2IPK D;  3AEG B;  5J2R A;  1WX9 A;  2HD5 B;  2W9N A;  2J53 A;  2BYV E;  4FA6 A;  3EEC A;  4IM0 A;  3WAM A;  3AEA B;  2ZCC A;  2G4D B;  1YJJ A;  3T8M A;  3AEE B;  3VTV A;  1TKE A;  2M17 A;  1TY0 A;  1WYG A;  2BBC A;  3ZQ4 A;  1RFK A;  5HFY A;  3NVZ A;  3PHW B;  4TKN A;  1TGZ B;  2I1K A;  4M01 A;  3DWM A;  3E9S A;  2M0X A;  1WI0 A;  4G3X B;  1JWB D;  1TYG B;  1VZ7 A;  4OW0 A;  3ENE A;  4GDL A;  2DYO A;  3L4P A;  3IAM 1;  2LVO A;  4GU2 A;  4WUR A;  1WFY A;  2AQ1 B;  3CSF A;  1ROE A;  3DWG C;  1KH0 A;  1A5R A;  2V1Y A;  1XLP A;  2WXN A;  1MHH E;  2N9X A;  4WJN A;  1LXD A;  2L52 A;  1WGY A;  1IBX A;  1WWT A;  3CST A;  5EE3 A;  4K1R B;  2K5P A;  3Q8B A;  4NAW A;  1S3S G;  2N0S B;  4HCP B;  3ZIM A;  3C0R B;  2L00 B;  1KOT A;  4IUM B;  1FFU A;  2AWT A;  3MTN B;  2KFJ A;  2PPH A;  5FR3 A;  1F1H A;  4R3D A;  4ARI A;  3B08 A;  5AZG A;  2GBR A;  2MCN B;  3PTF C;  4IWP A;  1QOA A;  3ZTD A;  3OLM D;  3IXS A;  2DWQ A;  4BKS D;  1UEL A;  3BVG A;  1OEY A;  1WH3 A;  3NY5 A;  3ETR A;  3AE5 B;  1WM3 A;  2INC C;  5BYR A;  1ET6 A;  2C60 A;  2WDT B;  3ZKJ C;  1C79 A;  4RM8 A;  1V1O A;  1YJI A;  4HKZ E;  1NI3 A;  1P1A A;  1E8W A;  3R8B A;  4K7S A;  5BMI A;  4ITK A;  3FIL B;  4M0W B;  2L05 A;  3ZW3 A;  1JWM D;  2LGX A;  3HIZ A;  2G9H D;  4LLG M;  5LXH A;  1HTQ A;  3IHP C;  2I38 A;  2XN9 C;  4KKI A;  1D5Z C;  3APC A;  1OTR B;  4YTN B;  3DBR B;  2WU2 B;  2KDF B;  1NEN B;  4P6V F;  5AUK A;  5KHQ A;  5IOI A;  3SFD B;  2W82 A;  2KWV B;  1SE3 A;  1OFF A;  3GZN I;  3GOE A;  1V49 A;  2G45 B;  4FN2 A;  2JUO A;  1K53 A;  1N63 A;  1WYW B;  2DZI A;  1L6V A;  4XE0 A;  4HK2 A;  2XEW A;  4P1B C;  1TKY A;  1L5P A;  2C9W B;  1AAR A;  2GI9 A;  2MJD A;  2ZNV C;  5BYQ A;  4EUT A;  2JT4 B;  4IDI A;  1WE6 A;  4AJW A;  4GOC A;  2L7R A;  2QJL A;  2MW5 A;  4JX1 C;  1KJT A;  3SHQ A;  1HEZ E;  1RWS A;  5G2N A;  1P7F A;  4EZJ A;  2BTE A;  3NS1 A;  4S0R A;  3NZ3 A;  4K7U A;  5AZF A;  1WXQ A;  1AN8 A;  3VRA B;  3W9C B;  1NYQ A;  2E6X A;  4ZYN A;  1XEE A;  4J6I A;  2NR2 A;  4M8M A;  4XWT A;  5G5H A;  2CU1 A;  4JIO U;  2NVU I;  4KKJ A;  1JQ4 A;  4A6Q A;  4KDL B;  2KOX A;  1WGK A;  1HE8 A;  4TV3 A;  2L0T A;  2KDM A;  3PRP B;  2IO0 B;  2ZPN A;  1E10 A;  3U4E G;  4MAC A;  4XC2 A;  4HJK A;  3QJZ A;  1WSP A;  3P4R B;  3SD5 A;  2LHD A;  4RF1 A;  4B0E A;  4ZRI A;  2WHI A;  2NTT A;  1C4C A;  1QQR A;  2KXJ A;  2BWE S;  3AEB B;  5E6P A;  1K51 A;  2N9K A;  1V1P B;  1L2N A;  4RGM A;  2D11 A;  2N7E A;  1FNW A;  1XF5 L;  5AZH A;  1TBE A;  2KAC A;  1ZXH A;  4EZL A;  5AEK B;  3BYY B;  4GDK B;  5J18 A;  3ZGZ A;  3GB1 A;  2OED A;  1L4D B;  2WU5 B;  4HXD A;  2ON8 A;  2BW2 A;  1WZ3 A;  1WMH B;  3VR8 B;  4US9 A;  1S1Q B;  4HKQ A;  3FKY A;  4WH4 A;  4Q2J A;  3U8Z A;  2LVQ A;  4N59 A;  4WJO A;  4HLE A;  2DEN B;  2LRU A;  3ZNI D;  2FNJ B;  1GG3 A;  3IAS 1;  2HE7 A;  1ACC A;  4EE2 A;  1OEY J;  1C4P A;  2HTH A;  4E74 A;  2OHF A;  3Q3F A;  1HTO A;  1MG4 A;  2DNF A;  1QF6 A;  3T3O A;  5E6O A;  3EUB 2;  3W1Y A;  3L0W B;  3AE8 B;  2WX1 A;  3V61 A;  2JYT A;  1LFD A;  2GBJ A;  1MPE A;  4JL9 A;  5IAA C;  1NEK B;  3MP9 A;  2INN E;  2RDG A;  3JSV B;  5JHA A;  2NPT A;  4YSY B;  1WGR A;  2QIL A;  4A20 A;  5C3J B;  1J7A A;  1SIF A;  1PGB A;  3JVZ X;  4N9F 4;  3VXW A;  4B95 A;  2WDR B;  1L0V B;  2N4F A;  1ENF A;  3BWU D;  2M0A A;  4PT5 A;  1NVI D;  5EDS A;  1EU3 A;  5D7G A;  4USA A;  1V86 A;  4LNI A;  2BWF A;  2C7H A;  3PSE B;  3PS6 A;  1M94 A;  3KUC B;  3I63 C;  2H88 B;  4NJ7 A;  1GNU A;  3QCA A;  1WJN A;  4JQW C;  3IG3 A;  2FCN A;  2MSE D;  2LRW A;  3DHI C;  2LUM A;  5HG2 A;  2KQ7 A;  4WWM A;  2R2O A;  5G55 A;  3RT3 B;  4LNN A;  1UD7 A;  4HJG E;  4FJV B;  4W9H A;  2J0K A;  3I5J C;  2PE6 B;  4BAX A;  3W1S C;  1N6Z A;  1TZO A;  1VCB A;  2DAJ A;  3EFU A;  1IBX B;  5LXI B;  3ONS A;  4B9K A;  3QC8 B;  4AJY B;  1YMH E;  3N1Z C;  1E7V A;  2RMM A;  1ZUD 2;  3QA8 A;  4NAW B;  2MQJ A;  1TS5 A;  3J9C A;  1MG8 A;  3ML8 A;  1WY8 A;  4MEM A;  1B1Z A;  1WJ6 A;  2LHE A;  3APD A;  2CHW A;  3NOB A;  1FXA A;  3ZXV A;  2MEK A;  4OVU A;  2CJO A;  4LCD E;  1TJE A;  3QHT A;  2REX A;  4W9L A;  4WWO A;  3AV8 A;  2JY6 A;  3B2G A;  1Y56 A;  4AUQ C;  1DOY A;  2KDE B;  1UWX A;  4XDD A;  4G0N B;  1P3Q U;  4ANX A;  1SE2 A;  3PRZ A;  2BYE A;  3I3T B;  2IGG A;  1STE A;  3A9J A;  4BKG A;  3BVZ A;  4RGN A;  4KV2 A;  3W2D A;  2BYF A;  1UF0 A;  3LDZ E;  3LJ3 A;  4ZHO A;  2NBU A;  4FBJ B;  2XK5 B;  3TJP A;  2IO1 B;  3PLU A;  2BB5 A;  1WE7 A;  1C78 A;  1YQB A;  1M4V A;  3L13 A;  4M8N A;  2KYW A;  2N7D A;  1E90 A;  4K3C A;  2L8J A;  3AE2 B;  1WIA A;  2IJ0 A;  1VR9 A;  1GC6 A;  3P4S B;  4DXA B;  4WWP A;  4B6W A;  4YSX B;  1MVK A;  4OZC A;  2KN4 A;  2LGS A;  3IFW B;  3TCA A;  2WXG A;  1QOG A;  3DVN V;  3Q8A A;  3A9K B;  4XGA B;  5KHO A;  3ZYY X;  1J8C A;  2R2Q A;  1WXS A;  4W9J A;  3TL5 A;  1YX6 B;  5DPR A;  3V6E B;  3PV1 A;  4P1C C;  2BKF A;  1J0G A;  1V5O A;  2ZJD A;  4FUL A;  3ZO5 B;  2K0P A;  3DHH C;  1E0Z A;  4DWF A;  2VRR B;  1LO5 D;  2D3C A;  3DBH I;  3ZNZ B;  4W9G A;  2YEP F;  4ZRJ A;  1WXV A;  1K50 A;  3RD2 A;  1JWU D;  3KUZ A;  4RMA A;  4OVZ A;  1I4P A;  3BZD B;  3L10 B;  3U2S C;  1ZW7 A;  2FE8 A;  2KQS A;  3VTU A;  2LJ5 A;  3AE3 B;  1XD3 B;  1T0R C;  1X1M A;  3FAH A;  1R4M I;  1QIL A;  3P42 A;  1YIW A;  1TS4 A;  1FMA D;  1PYW D;  4IWQ A;  1Q1O A;  3OAW A;  3PVL A;  2Y5C A;  1KLV A;  2CKH B;  5TR5 A;  4HRO A;  2JZP A;  3OG5 A;  5E6N A;  2KDB A;  2LEK A;  2J0M A;  4MH0 E;  4MM3 A;  2IGD A;  1PGA A;  1E9M A;  1UUP A;  3EA6 A;  2KC1 A;  2LJI A;  4ZYS A;  3EFC A;  2QC8 A;  2ACZ B;  2PMV A;  3MC8 A;  3RN9 C;  4NJC A;  2HDE A;  1GB1 A;  3HVZ A;  2PW9 A;  3HVD A;  5JZE B;  3WAO A;  1V2Y A;  1VRA B;  4A9A A;  5C23 A;  3AE7 B;  3NS8 A;  4IM3 A;  1WM2 A;  2CHX A;  3VRB B;  2MHJ A;  3N30 A;  4W9D A;  2KQ4 X;  4W9E A;  3VR9 B;  4IM2 A;  2K8B A;  4OHJ A;  2X8X X;  2CS4 A;  3C19 A;  2OJR A;  1TZ1 A;  1F77 A;  3QAQ A;  3Q2A C;  4IC7 B;  2D2Q A;  3AE4 B;  4IG7 B;  4YTM B;  1RAX A;  2O2V B;  3N20 C;  3Q8E A;  2M8S A;  1KM7 A;  1WRI A;  4C7Y A;  3V62 A;  5IN7 A;  2MP2 A;  2K25 A;  2K3U A;  3AEF B;  2KNB A;  4NAM A;  2IO3 B;  3O65 B;  3TSS A;  4KIK A;  2PLP A;  1Q5W B;  2FCQ A;  3ML9 A;  3DPD A;  2V4I B;  2ZVO A;  3KYD D;  1WJ4 A;  3T9L A;  4C4V A;  2BPS A;  2FIF A;  1RLF A;  1TIF A;  1XT9 B;  3DBH B;  4C7Z A;  3N3K B;  1TKG A;  1FNV A;  3ZVV A;  1L0Y B;  1Q0W B;  1LQB A;  2N1W A;  3NVV A;  4RH6 A;  2D3A A;  2ASQ A;  2RPQ A;  1MI0 A;  2FUG 1;  1MHX A;  1TS2 A;  3RPF C;  2BYT A;  3DBL I;  4BKT A;  4BOS C;  2G4S A;  1R4M B;  2WXL A;  3AH7 A;  1D5X C;  4GGQ A;  1I4R A;  2H89 B;  1OGW A;  2KMA A;  4RFB A;  2K1F A;  3VAW A;  1DOX A;  1L4Z B;  3W1S A;  4PS7 A;  4WIP A;  5GXG B;  3ZRC A;  4I6N B;  1IUE A;  2WXK A;  4A3O A;  5FR6 A;  2V9H A;  4EEW A;  4F7Z A;  2D3G A;  2QMT A;  5AUI A;  1MFW A;  3PRM B;  1HXY D;  3N1X C;  1LM8 B;  1VZ6 A;  1NI2 A;  4MGI E;  3QQ8 B;  4NZL B;  3GE8 C;  1SXT A;  4C00 A;  4FXC A;  2JX5 A;  4LJO B;  1E8X A;  2NS5 A;  1HZ6 A;  2WDQ B;  2A4Z A;  4W9C A;  1XO3 A;  1FO4 A;  1NDD A;  1YNT E;  1F2R I;  2INP E;  3DOW A;  1WZ0 A;  3Q8C A;  4NNJ B;  4I6L B;  4DXG A;  2Y5P A;  2KKC A;  2IY0 B;  4BZA A;  3UQA A;  3NZS A;  2VZK D;  1Z2M A;  1ESF A;  3NZU A;  1NBF C;  4F1S A;  1V6E A;  5JHB A;  2LWP A;  1VD2 A;  2WXP A;  2D10 A;  3X23 A;  2WXR A;  2GBN A;  1JW9 D;  1D3Z A;  3RZF A;  2M1M A;  2V0G A;  2GBM A;  1ZOY B;  2LXC A;  3LXF A;  3B2F A;  1N5X A;  3WAP A;  1N5W A;  3A4R A;  3TBL D;  2GMI C;  1V5T A;  4II2 B;  1P7E A;  4HWI B;  4US8 A;  1WR6 E;  4LNO A;  1A70 A;  2W54 A;  2ZNV B;  3MFG A;  4E71 A;  3H7P A;  1I4H A;  3TUO A;  3B1L X;  3C8Y A;  3ZUN A;  3DBL B;  2J7Q B;  3HM6 X;  2I2Y A;  3L17 A;  4DHZ E;  1N62 A;  4MJS B;  2KMM A;  2JXX A;  4DXF A;  1DGJ A;  3QAR A;  3FC4 A;  1D6E C;  3RNA C;  3NUH B;  3GS2 A;  3AUL A;  3MJ5 A;  3VH4 B;  2L3Z A;  3URY A;  1JML A;  5EE1 A;  1BXT A;  2YLM A;  4KVG B;  5D94 A;  5JXV A;  2IBI B;  4MGZ E;  3B0A A;  3DBS A;  1FCL A;  2IZV B;  2JRI B;  2W3R A;  4NPN A;  1UWM A;  5D6J B;  3BVM A;  2GRI A;  2EKI A;  1NYR A;  4XWW A;  1F9J A;  3ZTC A;  1GB4 A;  1E8Y A;  3ZLZ A;  3OJ3 A;  2KWC A;  1FEH A;  4G50 A;  2LVP A;  3ZXR A;  2JWZ A;  5D3I B;  3QX1 A;  1XLN A;  3AM9 A;  1P98 A;  1HZ5 A;  2NBV B;  1DYQ A;  1FFV A;  3AI5 A;  3R2I A;  2DX5 B;  1SSN A;  2IYD B;  3Q6B A;  2RPV A;  4DK5 A;  4LTU A;  4M02 A;  4RNA A;  2K22 A;  4ZDV A;  3PGE A;  2BS3 B;  3RNG C;  2J4X A;  4WAF A;  3NRZ A;  2WXQ A;  3CMM B;  2W3S A;  4HEA 1;  5D2M B;  3A1Q A;  1C3T A;  2X38 A;  2KZR A;  3IBE A;  5HKH A;  2ZVN A;  2AL3 A;  2HJ1 A;  4BOZ B;  2IGH A;  1DOI A;  4ANU A;  1TT5 B;  2NBW B;  3RCZ A;  3H8H A;  2GLS A;  5CX3 A;  2KD0 A;  4K7W A;  1EO6 A;  4A3P A;  1UBI A;  1PQS A;  2D5G A;  2RDH A;  1YQ4 B;  3HUI A;  1E7U A;  4TUU A;  4M0W A;  2JVC A;  4TQ0 A;  4N58 A;  3APF A;  2UWQ A;  3LB8 C;  4GDL B;  2KAN A;  2KHW B;  2BB6 A;  5FK9 C;  1WF9 A;  1XLQ A;  4IW0 A;  3ZNG C;  2RD0 A;  4C80 A;  4LDT B;  2NTS A;  4OZB A;  1V81 A;  1UNS A;  1L0X B;  4CQN A;  1YOV B;  2RGF A;  2G3Q B;  1YX5 B;  2L32 A;  2MBH A;  2C7M B;  4P16 A;  1MJD A;  3CWI A;  3GP7 A;  2V3S A;  3QIJ A;  4GMV A;  2PTL A;  2WLB A;  2BVC A;  3VUX A;  2MP2 B;  2QSD A;  2QEJ C;  2V3N A;  1OQY A;  2WXI A;  2BS2 B;  3DDC B;  5L95 C;  2BKR B;  2UYZ B;  2FID A;  2LAS A;  2KO3 A;  3ZNH B;  3HM3 A;  1EF1 A;  2LMC A;  4C4V B;  3PT2 B;  2W55 A;  3IT4 B;  2ZEQ A;  3Q69 A;  1ZP0 B;  2ZW1 A;  4ANV A;  3U30 A;  2WWZ A;  1R7S A;  3P1M A;  2WXM A;  3BK1 A;  2KC2 A;  3WAL A;  3BK2 A;  2JF5 A;  2MBB B;  3ZRF A;  4LNF A;  4PS8 A;  3N1Y C;  3V6C B;  3V05 A;  3Q3J A;  4GN1 A;  4L2Y A;  2IDY A;  4L23 A;  4BBN C;  3JYU A;  4XZ4 A;  3RUL A;  1YN5 A;  2DZM A;  3RNE C;  3T3N A;  3SDL C;  1CZP A;  2G1E A;  3KWV A;  1QT9 A;  3O13 A;  1F0Z A;  2WXF A;  3EGR A;  2KJR A;  1K52 A;  2WNM A;  3PZ8 A;  2KMC A;  3L16 A;  3ALB A;  1SF0 A;  1K8R B;  3VVW B;  1WR1 A;  2KWD A;  2FAZ A;  3RNC C;  4ZRK A;  2K9X A;  2MH7 A;  3R2T A;  1QOB A;  1EU4 A;  1UGM A;  1D5M C;  4WJP A;  3R66 C;  1I42 A;  4LDT D;  1V1P A;  2MBE A;  2HTM E;  4BBN F;  2KFK A;  2XBB C;  4EOY A;  1Z5S B;  4YTP B;  2CHZ A;  3DVN U;  4YXD B;  1FRD A;  4GDK A;  1L7Y A;  4WQM A;  2K39 A;  4L1B A;  4KX6 B;  2N1V A;  2KVZ A;  2AEH A;  2EMT A;  3HRD D;  2ZZP B;  1SE4 A;  3A33 B;  2KK8 A;  4X57 B;  3VTW A;  1U4A A;  3SFE B;  4HPL B;  2MRP A;  4PS3 A;  2JYE A;  3AN1 A;  4PYU A;  2KJ6 A;  2WGS A;  4YL8 A;  2MLB A;  3ABV B;  3BY4 B;  4ARC A;  1EWC A;  3B9J A;  3WIM A;  1GOZ A;  3Q14 C;  1IYF A;  2KDI A;  4KZC A;  3KYC D;  1AYF A;  4E3C A;  3N9Y C;  1T0Y A;  5DPS A;  1FPY A;  2QHO A;  1EF5 A;  2ZPY A;  2J0J A;  1FCC C;  4M00 A;  3AU4 A;  4ANW A;  4AP4 C;  1SIJ A;  3VH3 B;  2XNA C;  2RSU A;  3RNF C;  4NQL B;  3ECI A;  2YEP B;  4AS1 A;  2C5L C;  1QOF A;  4ZHP A;  3H7P B;  1T5X D;  3JSV A;  1HA5 A;  4O1N A;  3UIN B;  5CTR C;  1ZDV A;  3V60 A;  1WX8 A;  1WJU A;  4XYC A;  1YD8 U;  1CK1 A;  3V3X A;  4P7I A;  3AU5 A;  4HDO A;  4FJY A;  3MJW A;  4JPS A;  4YWG G;  5E6J A;  2WDV B;  4N6E B;  3OWE B;  4YSZ B;  1ISN A;  2DZJ A;  1XCQ L;  2CU3 A;  3K9O B;  4JWS C;  5FKA C;  4MGK E;  3BIN A;  4KZ0 A;  2WS3 B;  3CIR B;  3TEW A;  3VUY A;  1ZGU B;  3P63 A;  4RM9 A;  2DZK A;  3W5U B;  2EEL A;  2FCS A;  2K8H A;  2IY1 B;  2JPH A;  2KT7 A;  3H6N A;  1VJK A;  1T0S C;  2WXO A;  3VQI A;  3SR6 A;  2O6V A;  3U7D A;  2LGD A;  1WGH A;  4MT5 A;  3PRE A;  4DDG D;  2HJ8 A;  5DCN A;  5JH5 C;  4RGO S;  2VZK B;  2JSV X;  2RDB C;  1TS3 A;  1JRP A;  1XQQ A;  3KVF B;  3A1Q B;  1UZX B;  4DBG A;  1WRD B;  2NPT B;  1CMX B;  2JWU A;  2PIA A;  2AQ2 B;  3DCG A;  4GSW A;  5CHW A;  5L83 A;  4MSM B;  3P4P B;  4IKG A;  1C77 A;  3LYY A;  2RR9 A;  2ZCB A;  1FM0 D;  4EKU A;  4DQO C;  3E56 A;  2BT6 A;  1I4Q A;  2CJN A;  1KTK A;  3VHT C;  2JZ3 B;  1KLG D;  2DHZ A;  4XDC A;  1YQ3 B;  1E8Z A;  2WXH A;  4ZRP A;  1RM6 C;  2M56 B;  4ACF A;  4ICV A;  1GC7 A;  4JE3 B;  1T0Q C;  4OZA A;  4W9F A;  3KWL A;  1I4X A;  2IO2 B;  2PE9 A;  2XK5 A;  2KN5 A;  3UI3 A;  3KQ4 A;  2AX5 A;  2FCM A;  3P4Q B;  1CQV A;  4FJZ A;  4FLH A;  1Q10 A;  2LFI A;  1VZ8 A;  3MC0 B;  3RYT A;  5BO4 B;  3H9D A;  3EHV A;  2Z0E B;  4NY0 A;  2WP9 B;  4G11 A;  3MHS D;  4HVB A;  4MGY E;  2KTF A;  4HPM B;  3UIO B;  1XXG A;  4KDI C;  2QIE B;  1I35 A;  5EE9 A;  3MC9 A;  1GUA B;  3PLV A;  4DDI D;  3TIX A;  2PKO A;  3X0W A;  4BVU C;  4NQK E;  1V97 A;  3DQV A;  1JRO A;  2OJW A;  2N9P C;  1GJZ A;  3KW5 B;  1WGD A;  2I1J A;  4EZK A;  1IPG A;  2KX3 A;  3A9K A;  1EUV B;  1T6B X;  4PK1 A;  1EWY C;  2JXT A;  1ZKH A;  5C1Z A;  1H4R A;  3L54 A;  2L83 A;  3WCQ A;  3NJT A;  2FUH B;  4CYE A;  2UU7 A;  3H7S A;  4LJP B;  2JZZ A;  2PVG C;  2SEB D;  5TSS A;  1ZXI A;  3A9J B;  5MPO A;  1YN3 A;  5G5G A;  1FRR A;  1AW7 A;  5BMH A;  5BMG A;  4W9I A;  2ICI A;  3A4S C;  2PVO D;  2LUE A;  4BKS A;  1WGG A;  2JRH A;  1Y8R C;  5EE0 A;  1I7H A;  1FXI A;  3TEX A;  1BT0 A;  2JU6 X;  5H8Y E;  2VH1 A;  4A55 A;  2KX0 A;  4DHZ B;  1F52 A;  2K6Q A;  2IND C;  4AQ7 A;  3PPA A;  1SJH D;  2K8C A;  1AWD A;  4IOI E;  1J19 A;  4HPP A;  2NCN A;  3RMK C;  3ZJT A;  1V80 A;  2KTR A;  2BGF A;  3R7Q A;  1F2R C;  2ONQ A;  3UF8 A;  1SJE D;  3RZW C;  2AL6 A;  1G6J A;  2EMS A;  3Q3M C;  2MWS B;  1IGC A;  5CHF A;  2KFK B;  2DBY A; 
#chains in the Genus database with same CATH homology
 1WXA A;  1WXV A;  4M0W B;  3DVG Y;  2L05 A;  2N9E B;  2EKE C;  3RD2 A;  3VUX A;  2MP2 B;  2LGX A;  3HIZ A;  3ZW3 A;  3KUZ A;  4RMA A;  5LXH A;  3IHP C;  3L10 B;  1OQY A;  1ZW7 A;  2KQS A;  3VTU A;  2LJ5 A;  1H8C A;  1XD3 B;  3DDC B;  5L95 C;  2BKR B;  4ASW C;  1X1M A;  3APC A;  1OTR B;  2UYZ B;  2FID A;  2LAS A;  2KO3 A;  3ZNH B;  4XX5 A;  1R4M I;  2PEA A;  1YIW A;  2KDF B;  3HM3 A;  1EF1 A;  3PT2 B;  4IWQ A;  1Q1O A;  1UBQ A;  5KHQ A;  3OAW A;  3PVL A;  2ZEQ A;  2KWV B;  1KLV A;  3QK0 A;  2CKH B;  5TR5 A;  4ANV A;  3U30 A;  3GZN I;  3GOE A;  2WWZ A;  4MDK E;  5E6N A;  1V49 A;  2KDB A;  2G45 B;  2PJH A;  4FN2 A;  2JUO A;  2WYQ A;  2KC2 A;  4GIV A;  3WAL A;  2DAF A;  1E5W A;  2J0M A;  1WYW B;  2DZI A;  2JF5 A;  2KLG A;  2KWU B;  2MBB B;  3N32 A;  3NHE B;  4MM3 A;  4MH0 E;  4HK2 A;  3ZRF A;  1YJ1 A;  2XEW A;  1P0R A;  4PS8 A;  3V6C B;  1SE9 A;  2O2V A;  4HCN B;  2KC1 A;  3Q3J A;  3VFK A;  2C9W B;  1AAR A;  4GN1 A;  4F8C B;  3M3J A;  2CR5 A;  2LXA A;  3JYU A;  4BBN C;  2ZNV C;  4ICU A;  4XZ4 A;  3RUL A;  4EUT A;  2DZM A;  2JT4 B;  5JZE B;  1WE6 A;  3K9P B;  4AJW A;  4GB9 A;  4GOC A;  2L7R A;  3SDL C;  3WAO A;  1V2Y A;  2MW5 A;  5CHV C;  1KJT A;  1SGH A;  2LZ6 A;  5C23 A;  3SHQ A;  3NS8 A;  3R7R A;  4IM3 A;  5G2N A;  1WX7 A;  1UH6 A;  1WM2 A;  2CHX A;  3S2A A;  4FHJ A;  4EZJ A;  3N30 A;  2A5U A;  4W9D A;  2KJR A;  4W9E A;  4MEL A;  2KJH B;  3VUW A;  2BF8 B;  2KMC A;  3UQB A;  4IM2 A;  2K8B A;  3L16 A;  4I6P A;  3ALB A;  4K7U A;  5AZF A;  2C7N B;  1K8R B;  2CS4 A;  3VVW B;  3R3M A;  1WR1 A;  2OJR A;  2FAZ A;  1TZ1 A;  3QAQ A;  4ZRK A;  4IC7 B;  2D2Q A;  4MSQ B;  4IG7 B;  4ZYN A;  1RAX A;  2O2V B;  4J6I A;  2NR2 A;  1UGM A;  4WJP A;  2Y5B B;  1TTN A;  3R66 C;  1I42 A;  4OVV A;  4LDT D;  2M8S A;  1KM7 A;  2MBE A;  4M8M A;  4BBN F;  3V62 A;  2KFK A;  2CU1 A;  4JIO U;  3RUI B;  2NVU I;  2XBB C;  2MP2 A;  2K25 A;  4EOY A;  1Z5S B;  2KNB A;  2CHZ A;  4KDL B;  2IO3 B;  2KOX A;  1HE8 A;  3O65 B;  4TV3 A;  2L0T A;  3DVN U;  4JGH B;  3PRP B;  4GDK A;  4KIK A;  2IO0 B;  1L7Y A;  2ZPN A;  2K39 A;  3JW0 X;  1Q5W B;  3UGB B;  2FCQ A;  3P2B A;  2N1V A;  3ML9 A;  3DPD A;  4HDQ A;  2DYB A;  2ZVO A;  4DHJ B;  4XC2 A;  2AEH A;  1P9D U;  2EMT A;  2ZZP B;  3KYD D;  1WJ4 A;  4HJK A;  3A33 B;  3QJZ A;  4GXB A;  3T9L A;  2KK8 A;  2BPS A;  2FIF A;  3IVF A;  1U4A A;  4JLC A;  4X57 B;  3VTW A;  4HPL B;  2MRP A;  3M62 B;  3SD5 A;  2L0F A;  1RLF A;  4PS3 A;  1XT9 B;  4PYU A;  4ZRI A;  2KJ6 A;  3N3K B;  2KXJ A;  2BWE S;  5E6P A;  3ZVV A;  4YL8 A;  1L2N A;  1WXM A;  3ZDM C;  2MLB A;  2GOW A;  2D11 A;  1Q0W B;  1LQB A;  2N7E A;  3BY4 B;  2N1W A;  5AZH A;  2V4L A;  2MA9 B;  4FHK A;  1TBE A;  2ASQ A;  2RPQ A;  3WIM A;  1IYF A;  2KDI A;  4EZL A;  4KZC A;  5AEK B;  4KIK B;  4GDK B;  3DBL I;  3OJ4 B;  3TMP B;  4BKT A;  2G4S A;  3PHX B;  4BOS C;  4KSL C;  3KYC D;  4E3C A;  5J18 A;  5J17 A;  1R4N I;  4GGQ A;  1T0Y A;  5DPS A;  1C1Y B;  1OGW A;  2KMA A;  2O6V B;  2K1F A;  3VAW A;  4HXD A;  3WA0 A;  2QHO A;  3WAN A;  1EF5 A;  2ZPY A;  4K81 A;  2J0J A;  1WZ3 A;  3W1S A;  3AU4 A;  1WMH B;  4PS7 A;  4ANW A;  4AP4 C;  3ZRC A;  1S1Q B;  4PYZ A;  4I6N B;  3VH3 B;  3KH0 A;  3L08 A;  2RSU A;  2MX2 A;  4URK A;  4AOF A;  1J8C A;  3U8Z A;  5FR6 A;  4A3O A;  2LVQ A;  4EEW A;  4WJO A;  3M95 A;  4HLE A;  4F7Z A;  4NQL B;  2DEN B;  2LRU A;  3AXC A;  3ECI A;  2D3G A;  3ZNI D;  2C5L C;  2FNJ B;  1V9J A;  1GG3 A;  4II3 B;  2M4N A;  3H7P B;  2HE7 A;  3PRM B;  2B3A A;  3JSV A;  1OEY J;  2HTH A;  3UIN B;  5CTR C;  5LLI A;  1LM8 B;  4E74 A;  3V60 A;  1WX8 A;  1WJU A;  1NI2 A;  4MGI E;  3Q3F A;  3SU8 X;  2Z59 B;  3QQ8 B;  1YD8 U;  3PZD A;  3HK0 A;  1JRU A;  5E6O A;  2K6D B;  4LJO B;  1E8X A;  2NS5 A;  4P7I A;  3AU5 A;  3W1Y A;  4HDO A;  2L76 A;  4FJY A;  1IP9 A;  3L0W B;  2A4Z A;  4W9C A;  2WX1 A;  3V61 A;  3MJW A;  1NDD A;  2YVC A;  1LFD A;  4WAA A;  3KUD B;  2GBJ A;  2OOB B;  4JL9 A;  5IAA C;  3DOW A;  1WZ0 A;  4FAD A;  4NNJ B;  4W9K A;  4I6L B;  1ISN A;  2DZJ A;  5GMV A;  3K9O B;  3JSV B;  5JHA A;  4MGK E;  2NPT A;  2KKC A;  5DPT A;  4DHJ D;  2IY0 B;  1WGR A;  3ZDT A;  3BIN A;  4KZ0 A;  4A20 A;  3UQA A;  1SIF A;  3VUY A;  1ZGU B;  3NZS A;  1Z2M A;  4N9F 4;  3JVZ X;  4RM9 A;  2DZK A;  3VXW A;  3QWZ B;  4B95 A;  2FCS A;  3NZU A;  1NBF C;  4F1S A;  1V6E A;  3D32 A;  2K8H A;  5JHB A;  2LWP A;  1VD2 A;  2N4F A;  2IY1 B;  2Z0D B;  2D10 A;  2JPH A;  4IWO A;  3X23 A;  2GBN A;  3H6N A;  5EDS A;  4MJS A;  5D7G A;  1RRB A;  1D3Z A;  3RZF A;  1V86 A;  3VQI A;  2M1M A;  2BWF A;  2C7H A;  2O6V A;  3U7D A;  3PSE B;  3UIP B;  3PS6 A;  1M94 A;  2GBM A;  2LGD A;  2LXC A;  1WGH A;  2LD9 A;  3KUC B;  3PRE A;  4NJ7 A;  1GNU A;  3QCA A;  1WJN A;  4AWJ A;  2HJ8 A;  4JQW C;  3WAP A;  4DDG D;  3IG3 A;  2FCN A;  1WMH A;  5DCN A;  3VDZ A;  2WX0 A;  2MSE D;  3A4R A;  3H1U A;  5JH5 C;  5CHF A;  1FXT B;  2LRW A;  1XQQ A;  3KVF B;  2KQ7 A;  3TBL D;  5IA7 A;  3A1Q B;  2AYO B;  2GMI C;  1V5T A;  4II2 B;  4HWI B;  2R2O A;  1UZX B;  4DBG A;  5G55 A;  1WRD B;  2O6V D;  3RT3 B;  2NPT B;  1CMX B;  1WR6 E;  1UD7 A;  3HHM A;  4EFO A;  3DCG A;  4FJV B;  1RFA A;  3EC8 A;  4GSW A;  4W9H A;  3DVG X;  5CHW A;  2ZNV B;  2J0K A;  5L83 A;  3M63 B;  4E71 A;  3H7P A;  2KLC A;  4MSM B;  2PE6 B;  3W1S C;  3B1L X;  3ZUN A;  2RR9 A;  2J7Q B;  2ZCB A;  3HM6 X;  4CO7 A;  1VCB A;  2DAJ A;  3L17 A;  3EFU A;  5LXI B;  4DHZ E;  4EKU A;  4MJS B;  3ONS A;  4B9K A;  3QC8 B;  4AJY B;  1E7V A;  2JXX A;  4TQ1 A;  4NJ6 A;  3QA8 A;  3VHT C;  4NAW B;  2JZ3 B;  2KVR A;  2MQJ A;  3QAR A;  1MG8 A;  2DHZ A;  3ML8 A;  4KSK C;  1WY8 A;  1QZE A;  4MEM A;  3AUL A;  4WQO B;  1E8Z A;  4WWN A;  1WJ6 A;  3APD A;  3VH4 B;  2L3Z A;  2CHW A;  3NOB A;  4BFR A;  2YLM A;  4ICV A;  4KVG B;  5D94 A;  2IBI B;  4MGZ E;  1GC7 A;  4OVU A;  3B0A A;  3DBS A;  2GBK A;  4LCD E;  2IZV B;  3QHT A;  2JRI B;  2LGY A;  3CF6 E;  4W9F A;  4NPN A;  2IO2 B;  2PE9 A;  2REX A;  2KN5 A;  2XK5 A;  2MBO A;  4W9L A;  5D6J B;  4WWO A;  4WJQ A;  3DBR I;  1F9J A;  5DPW A;  2FCM A;  4FJZ A;  2JY6 A;  4FLH A;  3ZTC A;  1E8Y A;  2KTR B;  3RYT A;  3ZLZ A;  3OJ3 A;  5BO4 B;  2DYM A;  2D07 B;  2LI5 A;  2KWC A;  3H9D A;  4G50 A;  4AUQ C;  2MBQ A;  2LVP A;  4CHK A;  2KDE B;  2Z0E B;  3EHV A;  4NY0 A;  5J2R A;  4G0N B;  1WX9 A;  2JWZ A;  4G11 A;  3MHS D;  4HVB A;  2HD5 B;  2W9N A;  1P3Q U;  2BYV E;  3QX1 A;  4MGY E;  4FA6 A;  3EEC A;  1P98 A;  4IM0 A;  3WAM A;  4ANX A;  2KTF A;  2BYE A;  2NBV B;  3PRZ A;  2ZCC A;  2G4D B;  4HPM B;  3AI5 A;  3I3T B;  3UIO B;  3T8M A;  2DX5 B;  4KDI C;  2IYD B;  1I35 A;  3A9J A;  4BKG A;  1GUA B;  4DK5 A;  3PLV A;  3VTV A;  4KV2 A;  4DDI D;  2BYF A;  2M17 A;  4ZDV A;  3PGE A;  3LDZ E;  3TIX A;  3X0W A;  3LJ3 A;  4BVU C;  4NQK E;  3PHW B;  4TKN A;  3DQV A;  1TGZ B;  2NBU A;  2I1K A;  2N9P C;  3CMM B;  1GJZ A;  3KW5 B;  4FBJ B;  2M0X A;  2XK5 B;  1WI0 A;  1WGD A;  2I1J A;  4G3X B;  1IPG A;  5D2M B;  3A1Q A;  3TJP A;  4EZK A;  2KX3 A;  2IO1 B;  3A9K A;  3PLU A;  1WE7 A;  1C3T A;  1EUV B;  3ENE A;  4GDL A;  2DYO A;  1YQB A;  2KZR A;  2LVO A;  4GU2 A;  1WFY A;  1ZKH A;  3L13 A;  3IBE A;  5HKH A;  2ZVN A;  2AL3 A;  3CSF A;  4M8N A;  5C1Z A;  4BOZ B;  1H4R A;  3L54 A;  2N7D A;  1E90 A;  1A5R A;  4ANU A;  2L8J A;  1WIA A;  2FUH B;  2V1Y A;  4CYE A;  2NBW B;  3RCZ A;  3H7S A;  2N9X A;  4WJN A;  1GC6 A;  1LXD A;  4DXA B;  4LJP B;  1WGY A;  5CX3 A;  2KD0 A;  4WWP A;  4K7W A;  1EO6 A;  2JZZ A;  4A3P A;  3CST A;  1UBI A;  1PQS A;  4K1R B;  4B6W A;  3A9J B;  1E7U A;  4NAW A;  1S3S G;  4TUU A;  4HCP B;  3ZIM A;  3C0R B;  2L00 B;  1KOT A;  4IUM B;  2JVC A;  2AWT A;  2KFJ A;  2PPH A;  3A4S C;  3MTN B;  4W9I A;  2LUE A;  4TQ0 A;  3IFW B;  3TCA A;  1WGG A;  4BKS A;  2JRH A;  1Y8R C;  3APF A;  2UWQ A;  3DVN V;  1BT0 A;  3A9K B;  5KHO A;  3B08 A;  5AZG A;  4GDL B;  2KAN A;  2GBR A;  2KHW B;  2MCN B;  3PTF C;  2KX0 A;  4IWP A;  1WF9 A;  2R2Q A;  1WXS A;  4IW0 A;  2K6Q A;  3ZNG C;  4DHZ B;  2RD0 A;  3OLM D;  3ZTD A;  4W9J A;  3TL5 A;  4BKS D;  1YX6 B;  5DPR A;  4LDT B;  1UEL A;  3PPA A;  3V6E B;  2K8C A;  3PV1 A;  1OEY A;  1V81 A;  2BKF A;  1WH3 A;  1V5O A;  2ZJD A;  1J19 A;  3NY5 A;  4FUL A;  3ZO5 B;  1J0G A;  1WM3 A;  2NCN A;  1V80 A;  2G3Q B;  1YX5 B;  2KTR A;  2C60 A;  2BGF A;  2RGF A;  2WDT B;  2MBH A;  2C7M B;  3R7Q A;  4RM8 A;  3ZKJ C;  4DWF A;  3UF8 A;  3RZW C;  2VRR B;  2AL6 A;  2V3S A;  3QIJ A;  1G6J A;  2EMS A;  4GMV A;  2MWS B;  1P1A A;  1E8W A;  3DBH I;  3ZNZ B;  4W9G A;  4K7S A;  2KFK B;  4ZRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...