2KK8A

Nmr solution structure of a putative uncharacterized protein obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3449a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AT4g05270
publication title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kk8A01
1WJ6A 2NBVB 1J0GA 2KMAA 2DHZA 2KMCA 1TBEA 5KHQA 3IG3A 3PVLA 1WJUA 3ZIMA 2D10A 1GNUA 2MW5A 2XBBC 3LJ3A 4GSWA 4EZJA 2V3SA 4AJYB 2KHWB 3I3TB 4IM2A 3WIMA 3KW5B 1NBFC 3WALA 3HM3A 4PS7A 1WM2A 2LRWA 1WM3A 4W9GA 2FAZA 3QAQA 1C1YB 1WZ0A 3AULA 2L7RA 1EF5A 3WAOA 1J8CA 4ICUA 1UZXB 2EKEC 4HJKA 2BYEA 1WGDA 5L95C 2KWVB 4LDTD 2N7DA 3ZRCA 5G55A 1E7VA 2LZ6A 2MP2A 4W9JA 3R3MA 3OJ4B 2KD0A 4FA6A 4KDIC 1Z2MA 1K8RB 4LJOB 5J17A 2FCNA 2L05A 3HHMA 2KC1A 3DBLI 4MJSA 3ZTDA 2BWFA 2JXXA 2YVCA 3GOEA 3V62A 2DZJA 4ANXA 3OLMD 2BPSA 1R4NI 1RRBA 2KKCA 4MSQB 4F8CB 5DCNA 2K6DB 1RLFA 2L8JA 2VRRB 1QZEA 3Q3FA 2LUEA 4FHJA 3RZFA 3VHTC 3V6EB 4WJOA 1Y8RC 3O65B 3SDLC 3B1LX 2BYFA 4ZRJA 3VUWA 3K9OB 3A33B 4P7IA 2ZNVB 2D07B 1AARA 2L76A 4FJVB 4DHZB 2DZKA 4FJZA 4MH0E 2CR5A 4JL9A 4GIVA 3DDCB 3WANA 3TBLD 1UGMA 5D94A 4DBGA 4URKA 4EKUA 3PREA 4CYEA 4KIKA 4LJPB 3SD5A 4MSMB 3WAMA 1PQSA 1WXAA 2AL3A 2D11A 4K7UA 2MX2A 4HXDA 4MGIE 3UQAA 2LGDA 3VFKA 3H7PA 2REXA 4FLHA 1NDDA 1E90A 2JY6A 2M8SA 2W9NA 2ZNVC 4FJYA 3B0AA 3RT3B 3VUYA 4AUQC 2NPTA 4LCDE 3QWZB 1L2NA 3A9KB 3IHPC 5EDSA 2KJRA 2LXCA 2Z0EB 4XZ4A 3DOWA 1E8WA 4HK2A 4WJNA 3RYTA 2CHZA 3SHQA 4BKGA 5AZGA 1GG3A 2KWCA 3PHXB 2GMIC 5CHWA 2MLBA 3B08A 3H1UA 4EUTA 1XD3B 2IY0B 5D7GA 2GBRA 4HDQA 3ZDTA 4WWPA 3PRPB 4ZRKA 3DVGY 1UELA 1WH3A 2KK8A 1CMXB 3U7DA 1Q0WB 3IBEA 2KDFB 5AEKB 5IA7A 1OTRB 3TCAA 4NQKE 3HM6X 1TTNA 3UQBA 1KOTA 1P0RA 2JF5A 2PE9A 3DBHI 1X1MA 3L0WB 2MP2B 2MBBB 5DPWA 4G0NB 2K25A 2GOWA 4PS3A 4MJSB 4W9DA 3NS8A 4DXAB 3KYCD 4A20A 3PS6A 4ANVA 3ECIA 4HCNB 5LXHA 2C7NB 2ZCBA 2V4LA 4IWOA 3L13A 1Q1OA 1WZ3A 2KX3A 1WR6E 1WX9A 3IVFA 3RULA 4W9IA 4E71A 4M0WB 1GC6A 4K7SA 2MBOA 2M4NA 1J19A 3L08A 5G2NA 1SIFA 2ZEQA 1JRUA 2ZPNA 4HDOA 1UD7A 4WWNA 2JRIB 4ANUA 2O6VD 1S3SG 2CHXA 1WF9A 3HIZA 3BY4B 1VCBA 3N30A 3H6NA 1WE6A 1E8YA 2AYOB 2NPTB 4IM0A 4NPNA 4I6NB 1F9JA 3M63B 4RMAA 1WGHA 2WX0A 2J0KA 1EUVB 1V5TA 3KUCB 3PHWB 4NAWB 2HD5B 3JW0X 4W9KA 3VTWA 3M3JA 2ZPYA 1RAXA 4GDLA 2PEAA 3PRMB 1V6EA 2PJHA 3AI5A 2JUOA 1T0YA 3VTUA 1A5RA 2KWUB 4XX5A 3GZNI 4ICVA 2RGFA 2K8HA 2M17A 3DCGA 4EZLA 4LDTB 2KTFA 2LVPA 3L16A 1WJNA 3JYUA 4TQ1A 3DPDA 1U4AA 1V49A 3KVFB 2BWES 2KFKA 2LGYA 3AU5A 1LXDA 1Q5WB 2DZIA 3A1QB 3N32A 4WJPA 3JSVB 4WWOA 3OAWA 3VVWB 4DK5A 5DPTA 1WGYA 5KHOA 3T9LA 3LDZE 4ANWA 2KJHB 2N1VA 4M8NA 2V1YA 2L3ZA 4EZKA 3UIOB 1V2YA 3ZDMC 1P1AA 2CS4A 4JGHB 3M95A 5C1ZA 2KNBA 2O2VA 2KOXA 2J0JA 1LQBA 1YIWA 2BKRB 4HCPB 3RD2A 2MQJA 3PGEA 1RFAA 3UIPB 2JZ3B 1P9DU 3ZW3A 1BT0A 2UWQA 3PPAA 2KANA 3MHSD 1XQQA 4B95A 4EOYA 2KZRA 1YD8U 2WWZA 2IZVB 3K9PB 2O6VA 2DYOA 4TUUA 2IO0B 4K81A 1WGGA 1I35A 2HTHA 2G3QB 1WI0A 2PE6B 4NJ6A 2FNJB 2M1MA 4ASWC 4II2B 2GBNA 2LRUA 1ISNA 2BYVE 2C60A 5D6JB 3VUXA 4F1SA 5FR6A 1WMHA 2R2OA 5DPRA 4TQ0A 2GBMA 2KN5A 2J0MA 1E8ZA 1LFDA 2LVQA 2M0XA 3CMMB 4KDLB 1TZ1A 2MCNB 1WR1A 3QQ8B 2KDEB 3NHEB 1D3ZA 3AU4A 2C7MB 4BBNF 4DHZE 3L17A 1P3QU 2L00B 1GC7A 1TGZB 2KQSA 2RPQA 2B3AA 3APFA 3H7SA 3PTFC 4WQOB 2L0TA 4K7WA 1P98A 1EF1A 3RZWC 2QHOA 3WA0A 2Z59B 5CHFA 3ZNID 2I1KA 4GDLB 3TIXA 2JZZA 3ONSA 2FCQA 3PRZA 2CU1A 3ML9A 4F7ZA 2RSUA 1OQYA 4AWJA 3NY5A 2MBEA 2UYZB 4DDID 2IO3B 4JIOU 3VTVA 2LWPA 1C3TA 1H8CA 2NVUI 5IAAC 1ZW7A 5L83A 2DAFA 4DDGD 4BFRA 4KSLC 2DX5B 2AL6A 1WXSA 2O2VB 2C5LC 2KQ7A 3QK0A 4RM8A 2GBJA 3DBSA 4G3XB 1MG8A 4BOSC 2JRHA 5AZFA 3QHTA 2AWTA 4MGYE 3A4RA 3ALBA 3W1SA 3NZSA 2Y5BB 4HVBA 2ZVOA 1UH6A 2MBHA 1XT9B 4CHKA 1WIAA 1WGRA 4CO7A 2KX0A 2O6VB 3ZVVA 4W9HA 2LD9A 1ZGUB 5E6NA 1UBIA 2LXAA 3DVNU 4I6LB 4KIKB 2IY1B 2LGXA 2MRPA 4KZ0A 4PYUA 2DENB 4HPLB 3OJ3A 4MGKE 1WXVA 1GUAB 2YLMA 2R2QA 3H7PB 2GBKA 2XK5A 3QJZA 3R66C 2MA9B 3D32A 3VDZA 4E74A 3ZNGC 3ML8A 4I6PA 3C0RB 3NOBA 1V5OA 4PYZA 3ZNHB 4JLCA 5LXIB 2IO1B 2Z0DB 4II3B 3ZO5B 2LI5A 4MELA 3ENEA 2C7HA 4BKSA 1E5WA 4FADA 1GJZA 4BOZB 4BVUC 1V80A 3JVZX 3T8MA 5BO4B 3ZUNA 4G11A 4DHJD 2FIDA 3IFWB 2NCNA 1VD2A 2N7EA 3A9JA 2K8CA 2KFJA 2JT4B 4ZRIA 2BF8B 1IYFA 3VH3B 4PS8A 4W9LA 3SU8X 1YX6B 4K1RB 2KLGA 2NBWB 3QIJA 5D2MB 2NR2A 3PSEB 1WFYA 5LLIA 2FCSA 2K39A 2AEHA 2C9WB 3KH0A 3PV1A 5CX3A 3RCZA 2EMSA 1EO6A 3AXCA 2KVRA 1HE8A 2RR9A 4XC2A 2A4ZA 2KXJA 2PPHA 2JWZA 3PLUA 3PLVA 4KVGB 4MM3A 4NNJB 2JPHA 3DBRI 4AOFA 4FHKA 2DAJA 4HWIB 3S2AA 1WRDB 3BINA 2WDTB 4TKNA 3CSTA 5JHBA 1KJTA 3PT2B 2MWSB 5CTRC 3VXWA 3ZLZA 2K6QA 3VQIA 2CHWA 3APDA 1SGHA 3L10B 3DQVA 3EFUA 2BKFA 3MJWA 4IUMB 4MGZE 4FULA 1ZKHA 2MBQA 2N9PC 4IWQA 2N9XA 3W1YA 1V86A 2KC2A 3L54A 4B6WA 4N9F4 4BKTA 2BGFA 4GDKA 4IC7B 5JH5C 1OEYA 3U30A 2KTRA 2G45B 2OOBB 5C23A 2ASQA 2G4DB 3RUIB 3EECA 3NZUA 4HPMB 5E6PA 2KDBA 3R7QA 2FIFA 3ZRFA 2RD0A 5J18A 4EEWA 2XK5B 4RM9A 2N4FA 4GMVA 3W1SC 2HJ8A 2MSED 2K8BA 1KM7A 3EC8A 3QX1A 3ZKJC 4YL8A 2N1WA 4FN2A 1WX8A 2WX1A 4W9CA 3KUZA 2CKHB 4KSKC 2ZCCA 2D2QA 4IWPA 5AZHA 1IPGA 3X0WA 4A3PA 1WYWB 5JZEB 2KO3A 3QC8B 4B9KA 1R4MI 4AP4C 4NJ7A 1OEYJ 3UF8A 3A4SC 3A9JB 3V6CB 4BKSD 2L0FA 2DZMA 4EFOA 4WJQA 3EHVA 1Z5SB 4E3CA 4OVUA 2EMTA 2IO2B 1V9JA 3QA8A 4ZDVA 4IG7B 1WY8A 5E6OA 1I42A 1WE7A 2FCMA 3P2BA 1SE9A 2J7QB 4A3OA 4GOCA 1M94A 4KZCA 5J2RA 1G6JA 4M8MA 3M62B 2KFKB 4NAWA 4TV3A 4GB9A 1YX5B 2FUHB 4X57B 1YQBA 3QARA 4W9FA 2A5UA 3N3KB 4AJWA 3TMPB 2K1FA 4MEMA 2NS5A 3VAWA 4IM3A 4DWFA 2D3GA 2IYDB 4ZYNA 4WAAA 3V60A 2ZJDA 4HLEA 1KLVA 4MDKE 1YJ1A 3A1QA 3PZDA 3JSVA 3V61A 3R7RA 1OGWA 1V81A 4J6IA 2I1JA 2HE7A 1LM8B 2NBUA 4KV2A 5CHVC 2WYQA 3Q3JA 2XEWA 1S1QB 3KYDD 3QCAA 4GDKB 5GMVA 1H4RA 3HK0A 2DYBA 2KTRB 2KJ6A 4FBJB 4G50A 2ZVNA 1WJ4A 2DYMA 3DVNV 1WXMA 1L7YA 5DPSA 5TR5A 4JQWC 1FXTB 2N9EB 4OVVA 3WAPA 3X23A 3TL5A 1WMHB 3CF6E 3MTNB 4GU2A 2IBIB 2LASA 1NI2A 1WX7A 3ZNZB 2OJRA 3APCA 3ZTCA 3VH4B 4GGQA 4BBNC 4DHJB 5HKHA 3U8ZA 3H9DA 4NY0A 2LVOA 2ZZPB 2KDIA 2G4SA 3DVGX 4IW0A 1E7UA 3TJPA 4NQLB 3UINB 1E8XA 2LJ5A 3CSFA 3UGBB 2JVCA 3KUDB 1UBQA 4GXBA 5JHAA 3A9KA 4W9EA 1IP9A 4GN1A 2KLCA
chains in the Genus database with same CATH superfamily
1XEEA 4RF1A 1J0GA 2DHZA 1JWAD 5KHQA 3W5UB 1YMHE 2XBBC 4GSWA 2V3SA 2KHWB 3I3TB 3HM3A 3O13A 4W9GA 3BVGA 2BS2B 1PUTA 2LJIA 1WZ0A 3OG5A 1EF5A 1J7BA 3ABVB 2ACZB 4LNKA 1IUEA 2BYEA 2KWVB 3Q8AA 1E7VA 4KDIC 1Z2MA 2BWFA 2JXXA 3OLMD 1RWSA 3ZXRA 3SR6A 1R4NI 4MSQB 4F8CB 2K6DB 2K0PA 3RFZB 1Y8RC 2ZNVB 3BVMA 4FJVB 2L76A 4DHZB 4MH0E 2CR5A 4JL9A 2WQYB 4DBGA 2R61A 3PREA 1WXAA 3UQAA 2LGDA 4BZAA 3RT3B 2NPTA 1J7CA 2KJRA 4BKGA 5FKAC 2KWCA 3PHXB 2GMIC 2W54A 4EUTA 4IOIE 2KAJA 1B1ZA 4A9AA 3PRPB 4PK1A 1I4GA 1MJDA 2MH7A 3U7DA 1Q0WB 2BS4B 2K3UA 1OTRB 3TCAA 1VLBA 1TTNA 2FE8A 3AN1A 1KOTA 1N6ZA 5T8IA 4BAXA 2MBBB 3FILA 4S17A 4K3BA 1TKGA 3KYCD 1E9MA 3NVVA 3R8BA 3ECIA 4HCNB 1SEBD 1J7AA 2V4LA 2KX3A 2RDBC 2MEKA 1ESFA 4M0WB 1UNSA 1SIFA 2ZEQA 5IN7A 4WWNA 2SAKA 3AE4B 1S3SG 2CHXA 1SE3A 3HIZA 1VCBA 3N30A 2AYOB 2V0GA 3DBLB 2BQQA 3B9JA 3KUCB 2HD5B 3JW0X 4C80A 3VTWA 3M3JA 2ZPYA 1RAXA 3KWVA 1V6EA 1AW7A 2WGSA 2H89B 2KWUB 1FMAD 3MFGA 3GZNI 2N7JA 3R2TA 4MT5A 2KTFA 3KQ4A 2G9HD 1V49A 2WDVB 1LO5D 2OEDA 4KGTA 1TS5A 4WWOA 3WCQA 5DPTA 1WGYA 1YJIA 2I2YA 4EZKA 2V4IB 3I63C 5C1ZA 4OHJA 2O2VA 1LQBA 1R7SA 4HCPB 2MQJA 5JXVA 1BT0A 2V3NA 2UWQA 2KANA 1C78A 4TUUA 1I4QA 2ICIA 4II2B 2NTTA 2GBNA 4NJCA 4HJGE 2C60A 3NVYA 3VRAB 1WMHA 2R2OA 2INNE 1YOVB 3CMMB 2SEBD 1P7FA 1JW9D 1TKYA 3W2DA 2W3RA 4GDLB 3APFA 3H7SA 2L0TA 2Z59B 5CHFA 3ZNID 2QEJC 1YN3A 3P42A 1XLPA 2RSUA 3BYYB 4XE0A 2NVUI 4DDGD 1ZP0B 4RGMA 5IO9A 2XN9C 2DWQA 1KH0A 1NI3A 1P7EA 3DBSA 4HEA1 2JRHA 5IP4D 3QHTA 2AWTA 3A4RA 3ALBA 3NZSA 4WWMA 1JROA 4CO7A 2KX0A 4W9HA 2LD9A 2WXHA 1UBIA 2IY1B 1EU4A 1V8CA 4CQNA 3OJ3A 1WXVA 1VJKA 4JWSC 3Q3NC 4E74A 1Q10A 1VZ6A 3NOBA 3U4EG 2IO1B 3ENEA 1GJZA 1V80A 2MJ3A 3ZUNA 1E6EB 2GI9A 2K8CA 2JT4B 1JALA 4ZRIA 3NVZA 3VH3B 2KYWA 4LLGM 2LGIA 4W9LA 1E7PB 3SU8X 2NR2A 3PSEB 3Q8CA 1V1PB 2C9WB 3KH0A 1QOGA 3I57A 3RCZA 3HUIA 2JWZA 4MM3A 2JPHA 2WP9B 2DAJA 3LYYA 4US8A 2E6XA 2MHJA 5CTRC 3ZLZA 1N5WA 3VQIA 2IPKD 3L10B 1F2RC 2BKFA 3MJWA 4MACA 2MBQA 4IWQA 1HTOA 4N9F4 2TSSA 2FBWB 4OVZA 3AE3B 2OOBB 5C23A 2ASQA 3AEFB 2CJOA 1PGAA 3RUIB 3NZUA 1OQQA 2FIFA 3I9V1 4EEWA 2XK5B 2K9XA 3N9YC 3ZQ4A 1KM7A 3EC8A 5MPOA 1WX8A 3PZ8A 2M56B 2E3TA 3AE6B 1MHXA 3X0WA 1WYWB 3QC8B 4B9KA 1ZPSA 4NJ7A 3UF8A 4BKSD 2L0FA 3AE9B 2IO2B 4ZDVA 4IG7B 4YT0B 5E6OA 1I42A 2FCMA 4A3OA 4KZCA 1TJEA 3M62B 4X57B 4B0MA 1KFYB 2WXPA 1PGBA 4HROA 4W9FA 4H2AA 3EGRA 1ENFA 2A5UA 2LHDA 4MEMA 1BMLC 2IYDB 1ZXHA 1Y56A 3VRBB 1YJ1A 3A1QA 2WXGA 3R7RA 1OGWA 2NBUA 1LM8B 5BYSA 2IGDA 1S1QB 3U2SC 2PLPA 2DYBA 1WXMA 5DPSA 3T3OA 4OVVA 3WAPA 3X23A 1NI2A 3ZNZB 2OJRA 3ZTCA 2X8XX 2AX5A 1I4XA 4IW0A 3UI3A 3AE8B 2PVOD 2N0SB 4GXBA 5JHAA 2L52A 3A9KA 2KLCA 2KMAA 3AE2B 3IG3A 3DHHC 3HVZA 5GXGB 2MW5A 3ZIMA 2VZKD 3LJ3A 4IM2A 3FAHA 4UDUC 1NVID 2L7RA 1CZPA 1L4DB 2W82A 1GB4A 1R4MB 4C7YA 4HJKA 1WGDA 5L95C 2Q5WD 1FFVA 2MP2A 3R3MA 3OJ4B 4ZRPA 3MP9A 2LGSA 1K8RB 1CJEA 2L05A 4MJSA 2KC1A 3DBLI 3NRZA 3ZTDA 2YVCA 4ANXA 3T3NA 2KKCA 4EE2A 5DCNA 3WA0A 4WJOA 2JU6X 1YN5A 3VUWA 3K9OB 3A33B 4P7IA 4ZRQA 5AUIA 2D07B 4KKIA 3H8HA 1ACCA 4DXFA 4EKUA 4KIKA 4MSMB 1PQSA 4MGIE 2MX2A 1E0ZA 1I7HA 4YSZB 3QWZB 3IHPC 2AQ3B 4XZ4A 2Z8LA 4WJNA 4HK2A 2Y5CA 5EE9A 2IDYA 1UWMA 2MLBA 3B08A 1FCLA 3H1UA 4A90A 1XD3B 2IY0B 1QLBB 4C56C 1UELA 2WNMA 1IBXA 2NTSA 1RM6C 5IA7A 1V1OA 4P6VF 1GAQB 3HM6X 4YTMB 1P0RA 3P4QB 1X1MA 1T5XD 5DPWA 1FNWA 3NS8A 2C7NB 4IWOA 3IVFA 1WR6E 3GB1A 4TMAB 2M0AA 4E71A 2L32A 1C4CA 2WXMA 3I5JC 2WU2B 2GB1A 3EA6A 1I4PA 2V3PA 1WYGA 1SJED 1E8YA 3SFDB 2VZKB 2NPTB 3Q2AC 4IM0A 4NPNA 1WGHA 2J0KA 2WXOA 4N59A 4W9KA 2K5PA 2JUOA 1T0YA 3VTUA 1A5RA 3V05A 4XX5A 4ICVA 3DCGA 3MJ5A 3JYUA 4TQ1A 3RN9C 3KVFB 2KFKA 4XDDA 3MC9A 3VVWB 5KHOA 4ANWA 3LDZE 5E6JA 2KJHB 4M8NA 1NENB 2V1YA 3UIOB 1V2YA 1ZUD2 4LNNA 2J0JA 3PGEA 2JZ3B 3ZW3A 3V3XA 5H92C 1DGJA 1SE2A 4EOYA 2KZRA 3OWEB 4YTNB 2IZVB 4K81A 1WGGA 4RNAA 2HTHA 4NJ6A 2M1MA 2ONQA 3NZ3A 2LRUA 1ISNA 1WWTA 1T6BX 3MC8A 5D6JB 4F1SA 4TQ0A 2GBMA 2KN5A 3AEEB 4ZOHC 4D2KA 2M0XA 1LFDA 4LK0M 1VZ7A 1WR1A 3QQ8B 1D3ZA 3AU4A 1EWCA 4DHZE 5LLIA 1P3QU 2KWDA 1GC7A 1TGZB 2B3AA 1DOXA 2J53A 4ACFA 4K7WA 1P98A 2QHOA 4O1NA 1BUIC 2FCQA 2CU1A 2YEPF 3DHIC 2RDGA 1OQYA 3Q8BA 3NY5A 2IGGA 2IO3B 2LWPA 5IAAC 1ZW7A 3AEAB 2DAFA 1K52A 2DX5B 2AL6A 4USAA 2O2VB 2C5LC 2KQ7A 3QK0A 4RM8A 4MGYE 3TSSA 2GRIA 2B76B 1FD6A 3ZJUA 2V9HA 5E6NA 2KMMA 3DVNU 1SBBB 4KZ0A 4MGKE 2YLMA 1GUAB 1EWYC 3H7PB 3QJZA 3R66C 4C4VA 3VDZA 3GS2A 2PVGC 3ZNGC 3B2FA 4PYZA 2Z0DB 3RNAC 3MHZA 4MELA 3P63A 1E5WA 4FADA 1FXAA 4NZLB 4DHJD 2NCNA 1VD2A 3A9JA 2KFJA 5G5HA 2BF8B 1IYFA 2WHIA 3P4SB 3QIJA 5D2MB 1L4ZB 1OQRA 4IDIA 1AN8A 2FCSA 2WXLA 2D3AA 2AEHA 2PTLA 3PV1A 1EO6A 3GE3C 2RR9A 4HPPA 2A4ZA 2KXJA 2PPHA 3PLVA 1VZ8A 4KVGB 1L0VB 4NNJB 2BBCA 4A55A 1KLUD 1T0RC 4FHKA 4HWIB 3S2AA 2LMCA 4TKNA 1KJTA 4L2YA 2WU5B 3VXWA 2CHWA 5HHDG 5HFYA 3DQVA 3U7ZA 1C4AA 4IUMB 1ZKHA 4A6QA 1ZDXA 1TIFA 2BGFA 4GDKA 1OEYA 3SFEB 5BYQA 1CQVA 3N1YC 3EECA 1YQ3B 3Q8EA 4RM9A 2HJ8A 1QQRA 1K53A 3ZKJC 4YL8A 4XGAB 4FN2A 4M0WA 4KSKC 2ZCCA 1XCTL 2J42A 5AZHA 1I4HA 1WSPA 4A3PA 4KGRA 5JZEB 3Q69A 2KDMA 1R4MI 1ROEA 1QOAA 1OEYJ 3V6CB 2BW2A 3LXFA 2DZMA 4RGTA 4EFOA 5I4DA 3EHVA 1Z5SB 3AMZA 4OVUA 2W3SA 2EMTA 4IKGA 4N6EB 1WY8A 2GLSA 1SE9A 4GOCA 2RPVA 4TV3A 4GB9A 2FUHB 5FR3A 3BYTB 2WXKA 4MM3B 4ZHPA 3IXSA 2G1EA 2NMQA 3N3KB 4AJWA 3TMPB 2KVZA 2K1FA 2BT6A 2NS5A 4IM3A 3ZGZA 4ZYNA 4WAAA 4MDKE 3E56A 2UU7A 3NJTA 2I1JA 2HE7A 4RH6A 3Q3JA 3KYDD 3QCAA 1H4RA 2JWUA 1B9RA 2KJ6A 4DXGA 3FKYA 1WJ4A 3DVNV 1L7YA 5TR5A 1FXTB 1XLNA 2N9EB 1NEKB 3DBRB 1TY2A 3Q3MC 2IBIB 2LASA 1WX7A 2LHEA 2WXRA 4DHJB 3H9DA 4NY0A 1FXIA 2ZZPB 1JMLA 2KDIA 1E7UA 2LFIA 1E8XA 2LJ5A 2XNAC 1UBQA 5G5GA 2M19A 1TBEA 4OZAA 1JWBD 1GNUA 3B2GA 4LNFA 1NBFC 3WALA 4PS7A 1FPYA 4P1CC 3NS1A 2VH1A 1C1YB 3AULA 3TEWA 4KX6B 2D3CA 4ICUA 1ZXIA 4QAYA 3ZRCA 3VR8B 5G55A 2LZ6A 4W9JA 4FA6A 2KD0A 1GPXA 4LNIA 5J17A 3RI7C 2FCNA 3GOEA 2RMMA 4TSSA 4US9A 3RZFA 2L8JA 3Q3FA 3VHTC 2LUEA 3HRDD 4ZRJA 2BYFA 2W55A 1VRAB 4RGOS 1AARA 4FJZA 4XWTA 2JYTA 1MI0A 3DDCB 1UGMA 5D94A 3AEGB 3TEYA 3Q14C 3SD5A 3WAMA 2AL3A 2D11A 4K7UA 4YTPB 2REXA 4FLHA 1NDDA 2JY6A 2W9NA 1I4RA 3B0AA 1WXQA 3A9KB 4M00A 5EDSA 3DHGC 3DOWA 1PYWD 2J4XA 2CHZA 5BYRA 4J3OD 1GG3A 4ITKA 1SJHD 1FM0D 3RNGC 4ZYSA 3LB8C 2D3BA 5EE3A 1HEZE 2KK8A 1V1PA 1CMXB 2K22A 2D5GA 3NVWA 2KDFB 4NQKE 3UQBA 3L0WB 2MP2B 3Q8FA 1EU3A 4G0NB 2K25A 4PS3A 4MJSB 4ARIA 3C8YA 4ANVA 1XXGA 4P1BC 4WIPA 3L13A 1Q1OA 1C79A 1WX9A 3RULA 4W9IA 1GB1A 4K7SA 2QMTA 2MBOA 2M4NA 1J19A 3L08A 5G2NA 1ET9A 1JRUA 2ZPNA 4HDOA 1NYQA 2JRIB 4ANUA 1WF9A 3BY4B 3H6NA 1WGKA 1TY0A 4YWGG 1F9JA 3M63B 4RMAA 1HA5A 4AQ7A 3IT4B 1V5TA 2HJ1A 2DBYA 1QILA 4NAWB 1L0YB 1HZ6A 2PEAA 3PRMB 2PJHA 3RMKC 3AI5A 1FFUA 4FXCA 4EZLA 5D3IB 2LVPA 1TZOA 1N63A 4Q2JA 1LXDA 1Q5WB 4WJPA 3N32A 3JSVB 3OAWA 2N1VA 4XWWA 3ZDMC 1P1AA 4JGHB 3M95A 1YIWA 2BKRB 3ZJTA 3RD2A 4WQMA 1XLOA 3UIPB 2OHFA 3EFCA 3PPAA 3MHSD 1XQQA 4WURA 2WWZA 1EM7A 3K9PB 2O6VA 3BVZA 2IO0B 1I35A 1SB3C 1WI0A 2FNJB 3CIRB 4ASWC 3ZJVA 2LUMA 2QC8A 1F2RI 5EE0A 3VUXA 3DBHB 5DPRA 3W9CB 2J0MA 4AS1A 2KDEB 3Q6BA 3U52E 2C7MB 3L17A 2L00B 2RPQA 4JX1C 1FRRA 3RZWC 3TUOA 5TSSA 1YQ4B 1ZOYB 3TIXA 2JZZA 3PRZA 3ML9A 1XCQL 4AWJA 2MBEA 4DDID 1L6UA 4JIOU 1C3TA 1UF0A 3C19A 3URYA 1F52A 3AE1B 4NAMA 5L83A 1TS3A 2PIAA 3AB5A 1D6EC 1WXSA 4KKJA 3Q3OC 4G3XB 2AQ1B 3RNCC 3W1SA 2Y5BB 4HVBA 1UH6A 2INDC 2MBHA 4CHKA 1ZE3D 2WXNA 3FC4A 1YN4A 2LXAA 2DENB 4HPLB 3DWGC 2R2QA 1N5XA 4L1BA 3D32A 3IAS1 3ML8A 4I6PA 3ZO5B 2LI5A 5AUKA 1PGXA 1KF6B 4BKSA 2WLBA 3GE8C 4BOZB 4BVUC 3T8MA 4G11A 3IFWB 5IOIA 2N7EA 5LNK1 1SXTA 1C77A 1YX6B 1K51A 2KLGA 4K1RB 1STEA 3NG0A 1WFYA 5C3JB 5IKCM 2K39A 2EMSA 2KVRA 3VR9B 4XC2A 3P4RB 3DBRI 2WXQA 2ZW1A 4AOFA 3FILB 4XYCA 1WRDB 2WDTB 2MWSB 2K6QA 3APDA 1SGHA 2J52A 1QKZA 2N9PC 2N9XA 1V86A 2X38A 4BKTA 4B6WA 3U30A 2KTRA 2G45B 2QSDA 1RFKA 2G4DB 4C00A 4HPMB 5E6PA 4GLSC 2KDBA 3R7QA 3ZRFA 2RD0A 4OZCA 2N4FA 4GMVA 3W1SC 2MSED 3TEXA 4C4VB 2N1WA 3J9CA 4W9CA 2CKHB 5BMGA 1VDVA 2Y3AA 4YSYB 2KO3A 1PFDA 1QOFA 4AP4C 3A9JB 2CJNA 4WJQA 3MC0B 1T0SC 3DWMA 1V9JA 2ZW0A 1XF5L 3AEDB 3P2BA 1M94A 4M8MA 3RNBC 1YQBA 3QARA 1VR9A 3ZYYX 3VAWA 1UWXA 4DWFA 2D3GA 2JXTA 1CK1A 1HZ5A 1MG4A 1IGCA 3V60A 3IT6B 2ZJDA 4P16A 1V81A 4KV2A 2KQ4X 2WYQA 2JZPA 3AV8A 3NUHB 2IGHA 4GDKB 2HTME 4YSXB 5EE1A 4FBJB 3KWLA 3P1MA 4G50A 4ZHOA 1JCKB 2ZVNA 2DYMA 1MVKA 4M02A 1WMHB 3CF6E 4R3DA 4GU2A 2INCC 3APCA 4GGQA 4C7ZA 3RPFC 1GOZA 1PDXA 2YEPB 4JPSA 3TJPA 2PW9A 4NQLB 1D4BA 3UINB 3CSFA 3KUDB 4RFBA 2KN4A 4W9EA 1IP9A 4GN1A 1WJ6A 2NBVB 2KMCA 4A8XC 1ZDVA 3PVLA 1WJUA 2D10A 2FUG1 2QJLA 1L6VA 4EZJA 4XDCA 4AJYB 3WIMA 3KW5B 1WM2A 2LRWA 1WM3A 2FAZA 3QAQA 1F77A 1J8CA 3WAOA 1UZXB 1LGRA 2EKEC 4LDTD 5BMIA 2N7DA 3AM9A 3W5VB 4HKZE 3SEBA 4LJOB 3HHMA 4HKQA 1N62A 3V62A 2DZJA 1SIJA 2BPSA 1RRBA 2PMVA 1RLFA 2VRRB 1QZEA 2LEKA 4FHJA 3V6EB 3O65B 3SDLC 3B1LX 2OJWA 2DZKA 1FEHA 4GIVA 3WANA 2INPE 3TBLD 1MFWA 1TS2A 4URKA 4CYEA 2AQ2B 4LJPB 4HXDA 1IGDA 2PKOA 4L23A 3VFKA 3H7PA 4M01A 2M8SA 1E90A 2ZNVC 1RYJA 4FJYA 3VUYA 4AUQC 1KLGD 4LCDE 1KRHA 4RGNA 1L2NA 2LXCA 2Z0EB 1E8WA 3RYTA 3TEZA 1C9FA 1SSNA 3SHQA 5AZGA 2N9LA 1FIQA 5CHWA 3E9SA 5D7GA 2GBRA 4HDQA 3ZDTA 4WWPA 4ZRKA 2EKIA 3DVGY 1WH3A 5BMHA 2QDFA 2JX5A 3IBEA 4WH4A 5AEKB 3BK2A 3AE7B 2JF5A 1YNTE 2PE9A 3DBHI 5HI1A 3R2IA 2N9KA 1XO3A 1FNUA 2GOWA 4W9DA 4DXAB 2BVCA 4A20A 3PS6A 1SE4A 2KACA 3N1ZC 5LXHA 2KT7A 2ZCBA 1WZ3A 1N60A 5D3DA 2QCZA 3RNEC 1GC6A 2L83A 1UD7A 2DLBA 1QOBA 2O6VD 4RF0A 3HVDA 4ARCA 1WE6A 4I6NB 1YJJA 4S0RA 2WS3B 2WX0A 1EUVB 2WXIA 1R4NB 3PHWB 1HQRD 4GDLA 2JSVX 1D5XC 1TKEA 4OW0A 3IAM1 1QT9A 2RGFA 2K8HA 2M17A 4LDTB 3L16A 1WJNA 3DPDA 1U4AA 2BWES 2LGYA 3AU5A 3RNFC 2DZIA 3A1QB 3BWUD 1FRDA 4DK5A 3T9LA 4RCOA 2L3ZA 2CS4A 3AECB 2BB6A 2KNBA 2KOXA 1HTQA 1RFAA 1N61A 1DOIA 1L5PA 1P9DU 3PZ7A 1NYRA 4B95A 1YD8U 1SF0A 2DYOA 1XLQA 2G3QB 2PE6B 3ETRA 1AYFA 1OFFA 2BYVE 5FR6A 2Y5PA 2I38A 2JQRB 1E8ZA 2LVQA 4KDLB 1TZ1A 1HXYD 2MCNB 3NHEB 4BBNF 4B0EA 2KQSA 3PTFC 4WQOB 2BS3B 1DYQA 1JWSD 3CWIA 1EF1A 1DOYA 1F0ZA 2I1KA 3ONSA 1E10A 4F7ZA 2UYZB 1H8CA 3VTVA 2WXFA 1JWUD 4BFRA 4KSLC 2DNFA 2CU3A 2QILA 5HG2A 1M4VA 4KGSA 2GBJA 1MG8A 4BOSC 5AZFA 1K50A 3ZXVA 2ZVOA 3GZNB 1XT9B 2RDHA 1WIAA 1WGRA 2O6VB 3ZVVA 1UUPA 1ZGUB 4KIKB 4I6LB 2LGXA 2MRPA 4PYUA 2WDQB 1FNVA 1TT5B 2GBKA 2XK5A 2MA9B 3PO0A 1JQ4A 3BK1A 3C0RB 4WAFA 1V5OA 3ZNHB 4JLCA 5LXIB 4II3B 3N1XC 2ON8A 2C7HA 1TYGB 3JVZX 1ET6A 1FO4A 5BO4B 2FIDA 4PS8A 5C2TB 4YXDB 2NBWB 3N20C 2BYTA 1IBXB 4REZA 5CX3A 2MJEA 1D5ZC 3AXCA 1HE8A 3PLUA 1MHHE 5H8YE 3BINA 5JHBA 3CSTA 1C4PA 3PT2B 4OZBA 4JE3B 3EFUA 2EELA 4JWUC 4MGZE 1AWDA 4FULA 3W1YA 2KC2A 3L54A 2IJ0A 4IC7B 5JH5C 4HRSA 2QIEB 4MH8A 5J18A 1T0QC 2K8BA 3QX1A 2WX1A 1WRIA 3KUZA 4IWPA 2D2QA 4LTUA 1IPGA 3P4PB 1FCCC 3A4SC 3L4PA 4E3CA 3QA8A 2H88B 1WE7A 2L1AA 3AEBB 2J7QB 1G6JA 1KTKA 2VH2A 5J2RA 1QF6A 2KFKB 4NAWA 1D5MC 1YX5B 3BIID 1UGJA 3AE5B 4N58A 1MPEA 1V97A 4LNOA 1T3QA 2BB5A 1JRPA 2WDRB 4HLEA 1KLVA 3PZDA 3JSVA 3V61A 4J6IA 5CHVC 2XEWA 5GMVA 4DQOC 1JWMD 3HK0A 1F1HA 2WXJA 2KTRB 4K3CA 3EUB2 2BTEA 3GP7A 1A70A 4JQWC 2HDEA 3AH7A 3TL5A 3BZDB 2MJDA 3MTNB 1BXTA 2JYEA 3VH4B 4PT5A 5FK9C 4BBNC 5HKHA 3U8ZA 1C76A 2LVOA 1L0XB 1TS4A 2G4SA 3DVGX 3KLSX 3UGBB 2JVCA
chains in the Genus database with same CATH topology
1WJ6A 2NBVB 1J0GA 2KMAA 2DHZA 2KMCA 1TBEA 5KHQA 3IG3A 3PVLA 1WJUA 3ZIMA 2D10A 1GNUA 2MW5A 2XBBC 3LJ3A 4GSWA 4EZJA 2V3SA 4AJYB 2KHWB 3I3TB 4IM2A 3WIMA 3KW5B 1NBFC 3WALA 3HM3A 4PS7A 1WM2A 2LRWA 1WM3A 4W9GA 2FAZA 3QAQA 1C1YB 1WZ0A 3AULA 2L7RA 1EF5A 3WAOA 1J8CA 4ICUA 1UZXB 2EKEC 4HJKA 2BYEA 1WGDA 5L95C 2KWVB 4LDTD 2N7DA 3ZRCA 5G55A 1E7VA 2LZ6A 2MP2A 4W9JA 3R3MA 3OJ4B 2KD0A 4FA6A 4KDIC 1Z2MA 1K8RB 4LJOB 5J17A 2FCNA 2L05A 3HHMA 2KC1A 3DBLI 4MJSA 3ZTDA 2BWFA 2JXXA 2YVCA 3GOEA 3V62A 2DZJA 4ANXA 3OLMD 2BPSA 1R4NI 1RRBA 2KKCA 4MSQB 4F8CB 5DCNA 2K6DB 1RLFA 2L8JA 2VRRB 1QZEA 3Q3FA 2LUEA 4FHJA 3RZFA 3VHTC 3V6EB 4WJOA 1Y8RC 3O65B 3SDLC 3B1LX 2BYFA 4ZRJA 3VUWA 3K9OB 3A33B 4P7IA 2ZNVB 2D07B 1AARA 2L76A 4FJVB 4DHZB 2DZKA 4FJZA 4MH0E 2CR5A 4JL9A 4GIVA 3DDCB 3WANA 3TBLD 1UGMA 5D94A 4DBGA 4URKA 4EKUA 3PREA 4CYEA 4KIKA 4LJPB 3SD5A 4MSMB 3WAMA 1PQSA 1WXAA 2AL3A 2D11A 4K7UA 2MX2A 4HXDA 4MGIE 3UQAA 2LGDA 3VFKA 3H7PA 2REXA 4FLHA 1NDDA 1E90A 2JY6A 2M8SA 2W9NA 2ZNVC 4FJYA 3B0AA 3RT3B 3VUYA 4AUQC 2NPTA 4LCDE 3QWZB 1L2NA 3A9KB 3IHPC 5EDSA 2KJRA 2LXCA 2Z0EB 4XZ4A 3DOWA 1E8WA 4HK2A 4WJNA 3RYTA 2CHZA 3SHQA 4BKGA 5AZGA 1GG3A 2KWCA 3PHXB 2GMIC 5CHWA 2MLBA 3B08A 3H1UA 4EUTA 1XD3B 2IY0B 5D7GA 2GBRA 4HDQA 3ZDTA 4WWPA 3PRPB 4ZRKA 3DVGY 1UELA 1WH3A 2KK8A 1CMXB 3U7DA 1Q0WB 3IBEA 2KDFB 5AEKB 5IA7A 1OTRB 3TCAA 4NQKE 3HM6X 1TTNA 3UQBA 1KOTA 1P0RA 2JF5A 2PE9A 3DBHI 1X1MA 3L0WB 2MP2B 2MBBB 5DPWA 4G0NB 2K25A 2GOWA 4PS3A 4MJSB 4W9DA 3NS8A 4DXAB 3KYCD 4A20A 3PS6A 4ANVA 3ECIA 4HCNB 5LXHA 2C7NB 2ZCBA 2V4LA 4IWOA 3L13A 1Q1OA 1WZ3A 2KX3A 1WR6E 1WX9A 3IVFA 3RULA 4W9IA 4E71A 4M0WB 1GC6A 4K7SA 2MBOA 2M4NA 1J19A 3L08A 5G2NA 1SIFA 2ZEQA 1JRUA 2ZPNA 4HDOA 1UD7A 4WWNA 2JRIB 4ANUA 2O6VD 1S3SG 2CHXA 1WF9A 3HIZA 3BY4B 1VCBA 3N30A 3H6NA 1WE6A 1E8YA 2AYOB 2NPTB 4IM0A 4NPNA 4I6NB 1F9JA 3M63B 4RMAA 1WGHA 2WX0A 2J0KA 1EUVB 1V5TA 3KUCB 3PHWB 4NAWB 2HD5B 3JW0X 4W9KA 3VTWA 3M3JA 2ZPYA 1RAXA 4GDLA 2PEAA 3PRMB 1V6EA 2PJHA 3AI5A 2JUOA 1T0YA 3VTUA 1A5RA 2KWUB 4XX5A 3GZNI 4ICVA 2RGFA 2K8HA 2M17A 3DCGA 4EZLA 4LDTB 2KTFA 2LVPA 3L16A 1WJNA 3JYUA 4TQ1A 3DPDA 1U4AA 1V49A 3KVFB 2BWES 2KFKA 2LGYA 3AU5A 1LXDA 1Q5WB 2DZIA 3A1QB 3N32A 4WJPA 3JSVB 4WWOA 3OAWA 3VVWB 4DK5A 5DPTA 1WGYA 5KHOA 3T9LA 3LDZE 4ANWA 2KJHB 2N1VA 4M8NA 2V1YA 2L3ZA 4EZKA 3UIOB 1V2YA 3ZDMC 1P1AA 2CS4A 4JGHB 3M95A 5C1ZA 2KNBA 2O2VA 2KOXA 2J0JA 1LQBA 1YIWA 2BKRB 4HCPB 3RD2A 2MQJA 3PGEA 1RFAA 3UIPB 2JZ3B 1P9DU 3ZW3A 1BT0A 2UWQA 3PPAA 2KANA 3MHSD 1XQQA 4B95A 4EOYA 2KZRA 1YD8U 2WWZA 2IZVB 3K9PB 2O6VA 2DYOA 4TUUA 2IO0B 4K81A 1WGGA 1I35A 2HTHA 2G3QB 1WI0A 2PE6B 4NJ6A 2FNJB 2M1MA 4ASWC 4II2B 2GBNA 2LRUA 1ISNA 2BYVE 2C60A 5D6JB 3VUXA 4F1SA 5FR6A 1WMHA 2R2OA 5DPRA 4TQ0A 2GBMA 2KN5A 2J0MA 1E8ZA 1LFDA 2LVQA 2M0XA 3CMMB 4KDLB 1TZ1A 2MCNB 1WR1A 3QQ8B 2KDEB 3NHEB 1D3ZA 3AU4A 2C7MB 4BBNF 4DHZE 3L17A 1P3QU 2L00B 1GC7A 1TGZB 2KQSA 2RPQA 2B3AA 3APFA 3H7SA 3PTFC 4WQOB 2L0TA 4K7WA 1P98A 1EF1A 3RZWC 2QHOA 3WA0A 2Z59B 5CHFA 3ZNID 2I1KA 4GDLB 3TIXA 2JZZA 3ONSA 2FCQA 3PRZA 2CU1A 3ML9A 4F7ZA 2RSUA 1OQYA 4AWJA 3NY5A 2MBEA 2UYZB 4DDID 2IO3B 4JIOU 3VTVA 2LWPA 1C3TA 1H8CA 2NVUI 5IAAC 1ZW7A 5L83A 2DAFA 4DDGD 4BFRA 4KSLC 2DX5B 2AL6A 1WXSA 2O2VB 2C5LC 2KQ7A 3QK0A 4RM8A 2GBJA 3DBSA 4G3XB 1MG8A 4BOSC 2JRHA 5AZFA 3QHTA 2AWTA 4MGYE 3A4RA 3ALBA 3W1SA 3NZSA 2Y5BB 4HVBA 2ZVOA 1UH6A 2MBHA 1XT9B 4CHKA 1WIAA 1WGRA 4CO7A 2KX0A 2O6VB 3ZVVA 4W9HA 2LD9A 1ZGUB 5E6NA 1UBIA 2LXAA 3DVNU 4I6LB 4KIKB 2IY1B 2LGXA 2MRPA 4KZ0A 4PYUA 2DENB 4HPLB 3OJ3A 4MGKE 1WXVA 1GUAB 2YLMA 2R2QA 3H7PB 2GBKA 2XK5A 3QJZA 3R66C 2MA9B 3D32A 3VDZA 4E74A 3ZNGC 3ML8A 4I6PA 3C0RB 3NOBA 1V5OA 4PYZA 3ZNHB 4JLCA 5LXIB 2IO1B 2Z0DB 4II3B 3ZO5B 2LI5A 4MELA 3ENEA 2C7HA 4BKSA 1E5WA 4FADA 1GJZA 4BOZB 4BVUC 1V80A 3JVZX 3T8MA 5BO4B 3ZUNA 4G11A 4DHJD 2FIDA 3IFWB 2NCNA 1VD2A 2N7EA 3A9JA 2K8CA 2KFJA 2JT4B 4ZRIA 2BF8B 1IYFA 3VH3B 4PS8A 4W9LA 3SU8X 1YX6B 4K1RB 2KLGA 2NBWB 3QIJA 5D2MB 2NR2A 3PSEB 1WFYA 5LLIA 2FCSA 2K39A 2AEHA 2C9WB 3KH0A 3PV1A 5CX3A 3RCZA 2EMSA 1EO6A 3AXCA 2KVRA 1HE8A 2RR9A 4XC2A 2A4ZA 2KXJA 2PPHA 2JWZA 3PLUA 3PLVA 4KVGB 4MM3A 4NNJB 2JPHA 3DBRI 4AOFA 4FHKA 2DAJA 4HWIB 3S2AA 1WRDB 3BINA 2WDTB 4TKNA 3CSTA 5JHBA 1KJTA 3PT2B 2MWSB 5CTRC 3VXWA 3ZLZA 2K6QA 3VQIA 2CHWA 3APDA 1SGHA 3L10B 3DQVA 3EFUA 2BKFA 3MJWA 4IUMB 4MGZE 4FULA 1ZKHA 2MBQA 2N9PC 4IWQA 2N9XA 3W1YA 1V86A 2KC2A 3L54A 4B6WA 4N9F4 4BKTA 2BGFA 4GDKA 4IC7B 5JH5C 1OEYA 3U30A 2KTRA 2G45B 2OOBB 5C23A 2ASQA 2G4DB 3RUIB 3EECA 3NZUA 4HPMB 5E6PA 2KDBA 3R7QA 2FIFA 3ZRFA 2RD0A 5J18A 4EEWA 2XK5B 4RM9A 2N4FA 4GMVA 3W1SC 2HJ8A 2MSED 2K8BA 1KM7A 3EC8A 3QX1A 3ZKJC 4YL8A 2N1WA 4FN2A 1WX8A 2WX1A 4W9CA 3KUZA 2CKHB 4KSKC 2ZCCA 2D2QA 4IWPA 5AZHA 1IPGA 3X0WA 4A3PA 1WYWB 5JZEB 2KO3A 3QC8B 4B9KA 1R4MI 4AP4C 4NJ7A 1OEYJ 3UF8A 3A4SC 3A9JB 3V6CB 4BKSD 2L0FA 2DZMA 4EFOA 4WJQA 3EHVA 1Z5SB 4E3CA 4OVUA 2EMTA 2IO2B 1V9JA 3QA8A 4ZDVA 4IG7B 1WY8A 5E6OA 1I42A 1WE7A 2FCMA 3P2BA 1SE9A 2J7QB 4A3OA 4GOCA 1M94A 4KZCA 5J2RA 1G6JA 4M8MA 3M62B 2KFKB 4NAWA 4TV3A 4GB9A 1YX5B 2FUHB 4X57B 1YQBA 3QARA 4W9FA 2A5UA 3N3KB 4AJWA 3TMPB 2K1FA 4MEMA 2NS5A 3VAWA 4IM3A 4DWFA 2D3GA 2IYDB 4ZYNA 4WAAA 3V60A 2ZJDA 4HLEA 1KLVA 4MDKE 1YJ1A 3A1QA 3PZDA 3JSVA 3V61A 3R7RA 1OGWA 1V81A 4J6IA 2I1JA 2HE7A 1LM8B 2NBUA 4KV2A 5CHVC 2WYQA 3Q3JA 2XEWA 1S1QB 3KYDD 3QCAA 4GDKB 5GMVA 1H4RA 3HK0A 2DYBA 2KTRB 2KJ6A 4FBJB 4G50A 2ZVNA 1WJ4A 2DYMA 3DVNV 1WXMA 1L7YA 5DPSA 5TR5A 4JQWC 1FXTB 2N9EB 4OVVA 3WAPA 3X23A 3TL5A 1WMHB 3CF6E 3MTNB 4GU2A 2IBIB 2LASA 1NI2A 1WX7A 3ZNZB 2OJRA 3APCA 3ZTCA 3VH4B 4GGQA 4BBNC 4DHJB 5HKHA 3U8ZA 3H9DA 4NY0A 2LVOA 2ZZPB 2KDIA 2G4SA 3DVGX 4IW0A 1E7UA 3TJPA 4NQLB 3UINB 1E8XA 2LJ5A 3CSFA 3UGBB 2JVCA 3KUDB 1UBQA 4GXBA 5JHAA 3A9KA 4W9EA 1IP9A 4GN1A 2KLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ6 A;  2NBV B;  1J0G A;  2KMA A;  2DHZ A;  2KMC A;  1TBE A;  5KHQ A;  3IG3 A;  3PVL A;  1WJU A;  3ZIM A;  2D10 A;  1GNU A;  2MW5 A;  2XBB C;  3LJ3 A;  4GSW A;  4EZJ A;  2V3S A;  4AJY B;  2KHW B;  3I3T B;  4IM2 A;  3WIM A;  3KW5 B;  1NBF C;  3WAL A;  3HM3 A;  4PS7 A;  1WM2 A;  2LRW A;  1WM3 A;  4W9G A;  2FAZ A;  3QAQ A;  1C1Y B;  1WZ0 A;  3AUL A;  2L7R A;  1EF5 A;  3WAO A;  1J8C A;  4ICU A;  1UZX B;  2EKE C;  4HJK A;  2BYE A;  1WGD A;  5L95 C;  2KWV B;  4LDT D;  2N7D A;  3ZRC A;  5G55 A;  1E7V A;  2LZ6 A;  2MP2 A;  4W9J A;  3R3M A;  3OJ4 B;  2KD0 A;  4FA6 A;  4KDI C;  1Z2M A;  1K8R B;  4LJO B;  5J17 A;  2FCN A;  2L05 A;  3HHM A;  2KC1 A;  3DBL I;  4MJS A;  3ZTD A;  2BWF A;  2JXX A;  2YVC A;  3GOE A;  3V62 A;  2DZJ A;  4ANX A;  3OLM D;  2BPS A;  1R4N I;  1RRB A;  2KKC A;  4MSQ B;  4F8C B;  5DCN A;  2K6D B;  1RLF A;  2L8J A;  2VRR B;  1QZE A;  3Q3F A;  2LUE A;  4FHJ A;  3RZF A;  3VHT C;  3V6E B;  4WJO A;  1Y8R C;  3O65 B;  3SDL C;  3B1L X;  2BYF A;  4ZRJ A;  3VUW A;  3K9O B;  3A33 B;  4P7I A;  2ZNV B;  2D07 B;  1AAR A;  2L76 A;  4FJV B;  4DHZ B;  2DZK A;  4FJZ A;  4MH0 E;  2CR5 A;  4JL9 A;  4GIV A;  3DDC B;  3WAN A;  3TBL D;  1UGM A;  5D94 A;  4DBG A;  4URK A;  4EKU A;  3PRE A;  4CYE A;  4KIK A;  4LJP B;  3SD5 A;  4MSM B;  3WAM A;  1PQS A;  1WXA A;  2AL3 A;  2D11 A;  4K7U A;  2MX2 A;  4HXD A;  4MGI E;  3UQA A;  2LGD A;  3VFK A;  3H7P A;  2REX A;  4FLH A;  1NDD A;  1E90 A;  2JY6 A;  2M8S A;  2W9N A;  2ZNV C;  4FJY A;  3B0A A;  3RT3 B;  3VUY A;  4AUQ C;  2NPT A;  4LCD E;  3QWZ B;  1L2N A;  3A9K B;  3IHP C;  5EDS A;  2KJR A;  2LXC A;  2Z0E B;  4XZ4 A;  3DOW A;  1E8W A;  4HK2 A;  4WJN A;  3RYT A;  2CHZ A;  3SHQ A;  4BKG A;  5AZG A;  1GG3 A;  2KWC A;  3PHX B;  2GMI C;  5CHW A;  2MLB A;  3B08 A;  3H1U A;  4EUT A;  1XD3 B;  2IY0 B;  5D7G A;  2GBR A;  4HDQ A;  3ZDT A;  4WWP A;  3PRP B;  4ZRK A;  3DVG Y;  1UEL A;  1WH3 A;  2KK8 A;  1CMX B;  3U7D A;  1Q0W B;  3IBE A;  2KDF B;  5AEK B;  5IA7 A;  1OTR B;  3TCA A;  4NQK E;  3HM6 X;  1TTN A;  3UQB A;  1KOT A;  1P0R A;  2JF5 A;  2PE9 A;  3DBH I;  1X1M A;  3L0W B;  2MP2 B;  2MBB B;  5DPW A;  4G0N B;  2K25 A;  2GOW A;  4PS3 A;  4MJS B;  4W9D A;  3NS8 A;  4DXA B;  3KYC D;  4A20 A;  3PS6 A;  4ANV A;  3ECI A;  4HCN B;  5LXH A;  2C7N B;  2ZCB A;  2V4L A;  4IWO A;  3L13 A;  1Q1O A;  1WZ3 A;  2KX3 A;  1WR6 E;  1WX9 A;  3IVF A;  3RUL A;  4W9I A;  4E71 A;  4M0W B;  1GC6 A;  4K7S A;  2MBO A;  2M4N A;  1J19 A;  3L08 A;  5G2N A;  1SIF A;  2ZEQ A;  1JRU A;  2ZPN A;  4HDO A;  1UD7 A;  4WWN A;  2JRI B;  4ANU A;  2O6V D;  1S3S G;  2CHX A;  1WF9 A;  3HIZ A;  3BY4 B;  1VCB A;  3N30 A;  3H6N A;  1WE6 A;  1E8Y A;  2AYO B;  2NPT B;  4IM0 A;  4NPN A;  4I6N B;  1F9J A;  3M63 B;  4RMA A;  1WGH A;  2WX0 A;  2J0K A;  1EUV B;  1V5T A;  3KUC B;  3PHW B;  4NAW B;  2HD5 B;  3JW0 X;  4W9K A;  3VTW A;  3M3J A;  2ZPY A;  1RAX A;  4GDL A;  2PEA A;  3PRM B;  1V6E A;  2PJH A;  3AI5 A;  2JUO A;  1T0Y A;  3VTU A;  1A5R A;  2KWU B;  4XX5 A;  3GZN I;  4ICV A;  2RGF A;  2K8H A;  2M17 A;  3DCG A;  4EZL A;  4LDT B;  2KTF A;  2LVP A;  3L16 A;  1WJN A;  3JYU A;  4TQ1 A;  3DPD A;  1U4A A;  1V49 A;  3KVF B;  2BWE S;  2KFK A;  2LGY A;  3AU5 A;  1LXD A;  1Q5W B;  2DZI A;  3A1Q B;  3N32 A;  4WJP A;  3JSV B;  4WWO A;  3OAW A;  3VVW B;  4DK5 A;  5DPT A;  1WGY A;  5KHO A;  3T9L A;  3LDZ E;  4ANW A;  2KJH B;  2N1V A;  4M8N A;  2V1Y A;  2L3Z A;  4EZK A;  3UIO B;  1V2Y A;  3ZDM C;  1P1A A;  2CS4 A;  4JGH B;  3M95 A;  5C1Z A;  2KNB A;  2O2V A;  2KOX A;  2J0J A;  1LQB A;  1YIW A;  2BKR B;  4HCP B;  3RD2 A;  2MQJ A;  3PGE A;  1RFA A;  3UIP B;  2JZ3 B;  1P9D U;  3ZW3 A;  1BT0 A;  2UWQ A;  3PPA A;  2KAN A;  3MHS D;  1XQQ A;  4B95 A;  4EOY A;  2KZR A;  1YD8 U;  2WWZ A;  2IZV B;  3K9P B;  2O6V A;  2DYO A;  4TUU A;  2IO0 B;  4K81 A;  1WGG A;  1I35 A;  2HTH A;  2G3Q B;  1WI0 A;  2PE6 B;  4NJ6 A;  2FNJ B;  2M1M A;  4ASW C;  4II2 B;  2GBN A;  2LRU A;  1ISN A;  2BYV E;  2C60 A;  5D6J B;  3VUX A;  4F1S A;  5FR6 A;  1WMH A;  2R2O A;  5DPR A;  4TQ0 A;  2GBM A;  2KN5 A;  2J0M A;  1E8Z A;  1LFD A;  2LVQ A;  2M0X A;  3CMM B;  4KDL B;  1TZ1 A;  2MCN B;  1WR1 A;  3QQ8 B;  2KDE B;  3NHE B;  1D3Z A;  3AU4 A;  2C7M B;  4BBN F;  4DHZ E;  3L17 A;  1P3Q U;  2L00 B;  1GC7 A;  1TGZ B;  2KQS A;  2RPQ A;  2B3A A;  3APF A;  3H7S A;  3PTF C;  4WQO B;  2L0T A;  4K7W A;  1P98 A;  1EF1 A;  3RZW C;  2QHO A;  3WA0 A;  2Z59 B;  5CHF A;  3ZNI D;  2I1K A;  4GDL B;  3TIX A;  2JZZ A;  3ONS A;  2FCQ A;  3PRZ A;  2CU1 A;  3ML9 A;  4F7Z A;  2RSU A;  1OQY A;  4AWJ A;  3NY5 A;  2MBE A;  2UYZ B;  4DDI D;  2IO3 B;  4JIO U;  3VTV A;  2LWP A;  1C3T A;  1H8C A;  2NVU I;  5IAA C;  1ZW7 A;  5L83 A;  2DAF A;  4DDG D;  4BFR A;  4KSL C;  2DX5 B;  2AL6 A;  1WXS A;  2O2V B;  2C5L C;  2KQ7 A;  3QK0 A;  4RM8 A;  2GBJ A;  3DBS A;  4G3X B;  1MG8 A;  4BOS C;  2JRH A;  5AZF A;  3QHT A;  2AWT A;  4MGY E;  3A4R A;  3ALB A;  3W1S A;  3NZS A;  2Y5B B;  4HVB A;  2ZVO A;  1UH6 A;  2MBH A;  1XT9 B;  4CHK A;  1WIA A;  1WGR A;  4CO7 A;  2KX0 A;  2O6V B;  3ZVV A;  4W9H A;  2LD9 A;  1ZGU B;  5E6N A;  1UBI A;  2LXA A;  3DVN U;  4I6L B;  4KIK B;  2IY1 B;  2LGX A;  2MRP A;  4KZ0 A;  4PYU A;  2DEN B;  4HPL B;  3OJ3 A;  4MGK E;  1WXV A;  1GUA B;  2YLM A;  2R2Q A;  3H7P B;  2GBK A;  2XK5 A;  3QJZ A;  3R66 C;  2MA9 B;  3D32 A;  3VDZ A;  4E74 A;  3ZNG C;  3ML8 A;  4I6P A;  3C0R B;  3NOB A;  1V5O A;  4PYZ A;  3ZNH B;  4JLC A;  5LXI B;  2IO1 B;  2Z0D B;  4II3 B;  3ZO5 B;  2LI5 A;  4MEL A;  3ENE A;  2C7H A;  4BKS A;  1E5W A;  4FAD A;  1GJZ A;  4BOZ B;  4BVU C;  1V80 A;  3JVZ X;  3T8M A;  5BO4 B;  3ZUN A;  4G11 A;  4DHJ D;  2FID A;  3IFW B;  2NCN A;  1VD2 A;  2N7E A;  3A9J A;  2K8C A;  2KFJ A;  2JT4 B;  4ZRI A;  2BF8 B;  1IYF A;  3VH3 B;  4PS8 A;  4W9L A;  3SU8 X;  1YX6 B;  4K1R B;  2KLG A;  2NBW B;  3QIJ A;  5D2M B;  2NR2 A;  3PSE B;  1WFY A;  5LLI A;  2FCS A;  2K39 A;  2AEH A;  2C9W B;  3KH0 A;  3PV1 A;  5CX3 A;  3RCZ A;  2EMS A;  1EO6 A;  3AXC A;  2KVR A;  1HE8 A;  2RR9 A;  4XC2 A;  2A4Z A;  2KXJ A;  2PPH A;  2JWZ A;  3PLU A;  3PLV A;  4KVG B;  4MM3 A;  4NNJ B;  2JPH A;  3DBR I;  4AOF A;  4FHK A;  2DAJ A;  4HWI B;  3S2A A;  1WRD B;  3BIN A;  2WDT B;  4TKN A;  3CST A;  5JHB A;  1KJT A;  3PT2 B;  2MWS B;  5CTR C;  3VXW A;  3ZLZ A;  2K6Q A;  3VQI A;  2CHW A;  3APD A;  1SGH A;  3L10 B;  3DQV A;  3EFU A;  2BKF A;  3MJW A;  4IUM B;  4MGZ E;  4FUL A;  1ZKH A;  2MBQ A;  2N9P C;  4IWQ A;  2N9X A;  3W1Y A;  1V86 A;  2KC2 A;  3L54 A;  4B6W A;  4N9F 4;  4BKT A;  2BGF A;  4GDK A;  4IC7 B;  5JH5 C;  1OEY A;  3U30 A;  2KTR A;  2G45 B;  2OOB B;  5C23 A;  2ASQ A;  2G4D B;  3RUI B;  3EEC A;  3NZU A;  4HPM B;  5E6P A;  2KDB A;  3R7Q A;  2FIF A;  3ZRF A;  2RD0 A;  5J18 A;  4EEW A;  2XK5 B;  4RM9 A;  2N4F A;  4GMV A;  3W1S C;  2HJ8 A;  2MSE D;  2K8B A;  1KM7 A;  3EC8 A;  3QX1 A;  3ZKJ C;  4YL8 A;  2N1W A;  4FN2 A;  1WX8 A;  2WX1 A;  4W9C A;  3KUZ A;  2CKH B;  4KSK C;  2ZCC A;  2D2Q A;  4IWP A;  5AZH A;  1IPG A;  3X0W A;  4A3P A;  1WYW B;  5JZE B;  2KO3 A;  3QC8 B;  4B9K A;  1R4M I;  4AP4 C;  4NJ7 A;  1OEY J;  3UF8 A;  3A4S C;  3A9J B;  3V6C B;  4BKS D;  2L0F A;  2DZM A;  4EFO A;  4WJQ A;  3EHV A;  1Z5S B;  4E3C A;  4OVU A;  2EMT A;  2IO2 B;  1V9J A;  3QA8 A;  4ZDV A;  4IG7 B;  1WY8 A;  5E6O A;  1I42 A;  1WE7 A;  2FCM A;  3P2B A;  1SE9 A;  2J7Q B;  4A3O A;  4GOC A;  1M94 A;  4KZC A;  5J2R A;  1G6J A;  4M8M A;  3M62 B;  2KFK B;  4NAW A;  4TV3 A;  4GB9 A;  1YX5 B;  2FUH B;  4X57 B;  1YQB A;  3QAR A;  4W9F A;  2A5U A;  3N3K B;  4AJW A;  3TMP B;  2K1F A;  4MEM A;  2NS5 A;  3VAW A;  4IM3 A;  4DWF A;  2D3G A;  2IYD B;  4ZYN A;  4WAA A;  3V60 A;  2ZJD A;  4HLE A;  1KLV A;  4MDK E;  1YJ1 A;  3A1Q A;  3PZD A;  3JSV A;  3V61 A;  3R7R A;  1OGW A;  1V81 A;  4J6I A;  2I1J A;  2HE7 A;  1LM8 B;  2NBU A;  4KV2 A;  5CHV C;  2WYQ A;  3Q3J A;  2XEW A;  1S1Q B;  3KYD D;  3QCA A;  4GDK B;  5GMV A;  1H4R A;  3HK0 A;  2DYB A;  2KTR B;  2KJ6 A;  4FBJ B;  4G50 A;  2ZVN A;  1WJ4 A;  2DYM A;  3DVN V;  1WXM A;  1L7Y A;  5DPS A;  5TR5 A;  4JQW C;  1FXT B;  2N9E B;  4OVV A;  3WAP A;  3X23 A;  3TL5 A;  1WMH B;  3CF6 E;  3MTN B;  4GU2 A;  2IBI B;  2LAS A;  1NI2 A;  1WX7 A;  3ZNZ B;  2OJR A;  3APC A;  3ZTC A;  3VH4 B;  4GGQ A;  4BBN C;  4DHJ B;  5HKH A;  3U8Z A;  3H9D A;  4NY0 A;  2LVO A;  2ZZP B;  2KDI A;  2G4S A;  3DVG X;  4IW0 A;  1E7U A;  3TJP A;  4NQL B;  3UIN B;  1E8X A;  2LJ5 A;  3CSF A;  3UGB B;  2JVC A;  3KUD B;  1UBQ A;  4GXB A;  5JHA A;  3A9K A;  4W9E A;  1IP9 A;  4GN1 A;  2KLC A; 
#chains in the Genus database with same CATH topology
 1XEE A;  4RF1 A;  1J0G A;  2DHZ A;  1JWA D;  5KHQ A;  3W5U B;  1YMH E;  2XBB C;  4GSW A;  2V3S A;  2KHW B;  3I3T B;  3HM3 A;  3O13 A;  4W9G A;  3BVG A;  2BS2 B;  1PUT A;  2LJI A;  1WZ0 A;  3OG5 A;  1EF5 A;  1J7B A;  3ABV B;  2ACZ B;  4LNK A;  1IUE A;  2BYE A;  2KWV B;  3Q8A A;  1E7V A;  4KDI C;  1Z2M A;  2BWF A;  2JXX A;  3OLM D;  1RWS A;  3ZXR A;  3SR6 A;  1R4N I;  4MSQ B;  4F8C B;  2K6D B;  2K0P A;  3RFZ B;  1Y8R C;  2ZNV B;  3BVM A;  4FJV B;  2L76 A;  4DHZ B;  4MH0 E;  2CR5 A;  4JL9 A;  2WQY B;  4DBG A;  2R61 A;  3PRE A;  1WXA A;  3UQA A;  2LGD A;  4BZA A;  3RT3 B;  2NPT A;  1J7C A;  2KJR A;  4BKG A;  5FKA C;  2KWC A;  3PHX B;  2GMI C;  2W54 A;  4EUT A;  4IOI E;  2KAJ A;  1B1Z A;  4A9A A;  3PRP B;  4PK1 A;  1I4G A;  1MJD A;  2MH7 A;  3U7D A;  1Q0W B;  2BS4 B;  2K3U A;  1OTR B;  3TCA A;  1VLB A;  1TTN A;  2FE8 A;  3AN1 A;  1KOT A;  1N6Z A;  5T8I A;  4BAX A;  2MBB B;  3FIL A;  4S17 A;  4K3B A;  1TKG A;  3KYC D;  1E9M A;  3NVV A;  3R8B A;  3ECI A;  4HCN B;  1SEB D;  1J7A A;  2V4L A;  2KX3 A;  2RDB C;  2MEK A;  1ESF A;  4M0W B;  1UNS A;  1SIF A;  2ZEQ A;  5IN7 A;  4WWN A;  2SAK A;  3AE4 B;  1S3S G;  2CHX A;  1SE3 A;  3HIZ A;  1VCB A;  3N30 A;  2AYO B;  2V0G A;  3DBL B;  2BQQ A;  3B9J A;  3KUC B;  2HD5 B;  3JW0 X;  4C80 A;  3VTW A;  3M3J A;  2ZPY A;  1RAX A;  3KWV A;  1V6E A;  1AW7 A;  2WGS A;  2H89 B;  2KWU B;  1FMA D;  3MFG A;  3GZN I;  2N7J A;  3R2T A;  4MT5 A;  2KTF A;  3KQ4 A;  2G9H D;  1V49 A;  2WDV B;  1LO5 D;  2OED A;  4KGT A;  1TS5 A;  4WWO A;  3WCQ A;  5DPT A;  1WGY A;  1YJI A;  2I2Y A;  4EZK A;  2V4I B;  3I63 C;  5C1Z A;  4OHJ A;  2O2V A;  1LQB A;  1R7S A;  4HCP B;  2MQJ A;  5JXV A;  1BT0 A;  2V3N A;  2UWQ A;  2KAN A;  1C78 A;  4TUU A;  1I4Q A;  2ICI A;  4II2 B;  2NTT A;  2GBN A;  4NJC A;  4HJG E;  2C60 A;  3NVY A;  3VRA B;  1WMH A;  2R2O A;  2INN E;  1YOV B;  3CMM B;  2SEB D;  1P7F A;  1JW9 D;  1TKY A;  3W2D A;  2W3R A;  4GDL B;  3APF A;  3H7S A;  2L0T A;  2Z59 B;  5CHF A;  3ZNI D;  2QEJ C;  1YN3 A;  3P42 A;  1XLP A;  2RSU A;  3BYY B;  4XE0 A;  2NVU I;  4DDG D;  1ZP0 B;  4RGM A;  5IO9 A;  2XN9 C;  2DWQ A;  1KH0 A;  1NI3 A;  1P7E A;  3DBS A;  4HEA 1;  2JRH A;  5IP4 D;  3QHT A;  2AWT A;  3A4R A;  3ALB A;  3NZS A;  4WWM A;  1JRO A;  4CO7 A;  2KX0 A;  4W9H A;  2LD9 A;  2WXH A;  1UBI A;  2IY1 B;  1EU4 A;  1V8C A;  4CQN A;  3OJ3 A;  1WXV A;  1VJK A;  4JWS C;  3Q3N C;  4E74 A;  1Q10 A;  1VZ6 A;  3NOB A;  3U4E G;  2IO1 B;  3ENE A;  1GJZ A;  1V80 A;  2MJ3 A;  3ZUN A;  1E6E B;  2GI9 A;  2K8C A;  2JT4 B;  1JAL A;  4ZRI A;  3NVZ A;  3VH3 B;  2KYW A;  4LLG M;  2LGI A;  4W9L A;  1E7P B;  3SU8 X;  2NR2 A;  3PSE B;  3Q8C A;  1V1P B;  2C9W B;  3KH0 A;  1QOG A;  3I57 A;  3RCZ A;  3HUI A;  2JWZ A;  4MM3 A;  2JPH A;  2WP9 B;  2DAJ A;  3LYY A;  4US8 A;  2E6X A;  2MHJ A;  5CTR C;  3ZLZ A;  1N5W A;  3VQI A;  2IPK D;  3L10 B;  1F2R C;  2BKF A;  3MJW A;  4MAC A;  2MBQ A;  4IWQ A;  1HTO A;  4N9F 4;  2TSS A;  2FBW B;  4OVZ A;  3AE3 B;  2OOB B;  5C23 A;  2ASQ A;  3AEF B;  2CJO A;  1PGA A;  3RUI B;  3NZU A;  1OQQ A;  2FIF A;  3I9V 1;  4EEW A;  2XK5 B;  2K9X A;  3N9Y C;  3ZQ4 A;  1KM7 A;  3EC8 A;  5MPO A;  1WX8 A;  3PZ8 A;  2M56 B;  2E3T A;  3AE6 B;  1MHX A;  3X0W A;  1WYW B;  3QC8 B;  4B9K A;  1ZPS A;  4NJ7 A;  3UF8 A;  4BKS D;  2L0F A;  3AE9 B;  2IO2 B;  4ZDV A;  4IG7 B;  4YT0 B;  5E6O A;  1I42 A;  2FCM A;  4A3O A;  4KZC A;  1TJE A;  3M62 B;  4X57 B;  4B0M A;  1KFY B;  2WXP A;  1PGB A;  4HRO A;  4W9F A;  4H2A A;  3EGR A;  1ENF A;  2A5U A;  2LHD A;  4MEM A;  1BML C;  2IYD B;  1ZXH A;  1Y56 A;  3VRB B;  1YJ1 A;  3A1Q A;  2WXG A;  3R7R A;  1OGW A;  2NBU A;  1LM8 B;  5BYS A;  2IGD A;  1S1Q B;  3U2S C;  2PLP A;  2DYB A;  1WXM A;  5DPS A;  3T3O A;  4OVV A;  3WAP A;  3X23 A;  1NI2 A;  3ZNZ B;  2OJR A;  3ZTC A;  2X8X X;  2AX5 A;  1I4X A;  4IW0 A;  3UI3 A;  3AE8 B;  2PVO D;  2N0S B;  4GXB A;  5JHA A;  2L52 A;  3A9K A;  2KLC A;  2KMA A;  3AE2 B;  3IG3 A;  3DHH C;  3HVZ A;  5GXG B;  2MW5 A;  3ZIM A;  2VZK D;  3LJ3 A;  4IM2 A;  3FAH A;  4UDU C;  1NVI D;  2L7R A;  1CZP A;  1L4D B;  2W82 A;  1GB4 A;  1R4M B;  4C7Y A;  4HJK A;  1WGD A;  5L95 C;  2Q5W D;  1FFV A;  2MP2 A;  3R3M A;  3OJ4 B;  4ZRP A;  3MP9 A;  2LGS A;  1K8R B;  1CJE A;  2L05 A;  4MJS A;  2KC1 A;  3DBL I;  3NRZ A;  3ZTD A;  2YVC A;  4ANX A;  3T3N A;  2KKC A;  4EE2 A;  5DCN A;  3WA0 A;  4WJO A;  2JU6 X;  1YN5 A;  3VUW A;  3K9O B;  3A33 B;  4P7I A;  4ZRQ A;  5AUI A;  2D07 B;  4KKI A;  3H8H A;  1ACC A;  4DXF A;  4EKU A;  4KIK A;  4MSM B;  1PQS A;  4MGI E;  2MX2 A;  1E0Z A;  1I7H A;  4YSZ B;  3QWZ B;  3IHP C;  2AQ3 B;  4XZ4 A;  2Z8L A;  4WJN A;  4HK2 A;  2Y5C A;  5EE9 A;  2IDY A;  1UWM A;  2MLB A;  3B08 A;  1FCL A;  3H1U A;  4A90 A;  1XD3 B;  2IY0 B;  1QLB B;  4C56 C;  1UEL A;  2WNM A;  1IBX A;  2NTS A;  1RM6 C;  5IA7 A;  1V1O A;  4P6V F;  1GAQ B;  3HM6 X;  4YTM B;  1P0R A;  3P4Q B;  1X1M A;  1T5X D;  5DPW A;  1FNW A;  3NS8 A;  2C7N B;  4IWO A;  3IVF A;  1WR6 E;  3GB1 A;  4TMA B;  2M0A A;  4E71 A;  2L32 A;  1C4C A;  2WXM A;  3I5J C;  2WU2 B;  2GB1 A;  3EA6 A;  1I4P A;  2V3P A;  1WYG A;  1SJE D;  1E8Y A;  3SFD B;  2VZK B;  2NPT B;  3Q2A C;  4IM0 A;  4NPN A;  1WGH A;  2J0K A;  2WXO A;  4N59 A;  4W9K A;  2K5P A;  2JUO A;  1T0Y A;  3VTU A;  1A5R A;  3V05 A;  4XX5 A;  4ICV A;  3DCG A;  3MJ5 A;  3JYU A;  4TQ1 A;  3RN9 C;  3KVF B;  2KFK A;  4XDD A;  3MC9 A;  3VVW B;  5KHO A;  4ANW A;  3LDZ E;  5E6J A;  2KJH B;  4M8N A;  1NEN B;  2V1Y A;  3UIO B;  1V2Y A;  1ZUD 2;  4LNN A;  2J0J A;  3PGE A;  2JZ3 B;  3ZW3 A;  3V3X A;  5H92 C;  1DGJ A;  1SE2 A;  4EOY A;  2KZR A;  3OWE B;  4YTN B;  2IZV B;  4K81 A;  1WGG A;  4RNA A;  2HTH A;  4NJ6 A;  2M1M A;  2ONQ A;  3NZ3 A;  2LRU A;  1ISN A;  1WWT A;  1T6B X;  3MC8 A;  5D6J B;  4F1S A;  4TQ0 A;  2GBM A;  2KN5 A;  3AEE B;  4ZOH C;  4D2K A;  2M0X A;  1LFD A;  4LK0 M;  1VZ7 A;  1WR1 A;  3QQ8 B;  1D3Z A;  3AU4 A;  1EWC A;  4DHZ E;  5LLI A;  1P3Q U;  2KWD A;  1GC7 A;  1TGZ B;  2B3A A;  1DOX A;  2J53 A;  4ACF A;  4K7W A;  1P98 A;  2QHO A;  4O1N A;  1BUI C;  2FCQ A;  2CU1 A;  2YEP F;  3DHI C;  2RDG A;  1OQY A;  3Q8B A;  3NY5 A;  2IGG A;  2IO3 B;  2LWP A;  5IAA C;  1ZW7 A;  3AEA B;  2DAF A;  1K52 A;  2DX5 B;  2AL6 A;  4USA A;  2O2V B;  2C5L C;  2KQ7 A;  3QK0 A;  4RM8 A;  4MGY E;  3TSS A;  2GRI A;  2B76 B;  1FD6 A;  3ZJU A;  2V9H A;  5E6N A;  2KMM A;  3DVN U;  1SBB B;  4KZ0 A;  4MGK E;  2YLM A;  1GUA B;  1EWY C;  3H7P B;  3QJZ A;  3R66 C;  4C4V A;  3VDZ A;  3GS2 A;  2PVG C;  3ZNG C;  3B2F A;  4PYZ A;  2Z0D B;  3RNA C;  3MHZ A;  4MEL A;  3P63 A;  1E5W A;  4FAD A;  1FXA A;  4NZL B;  4DHJ D;  2NCN A;  1VD2 A;  3A9J A;  2KFJ A;  5G5H A;  2BF8 B;  1IYF A;  2WHI A;  3P4S B;  3QIJ A;  5D2M B;  1L4Z B;  1OQR A;  4IDI A;  1AN8 A;  2FCS A;  2WXL A;  2D3A A;  2AEH A;  2PTL A;  3PV1 A;  1EO6 A;  3GE3 C;  2RR9 A;  4HPP A;  2A4Z A;  2KXJ A;  2PPH A;  3PLV A;  1VZ8 A;  4KVG B;  1L0V B;  4NNJ B;  2BBC A;  4A55 A;  1KLU D;  1T0R C;  4FHK A;  4HWI B;  3S2A A;  2LMC A;  4TKN A;  1KJT A;  4L2Y A;  2WU5 B;  3VXW A;  2CHW A;  5HHD G;  5HFY A;  3DQV A;  3U7Z A;  1C4A A;  4IUM B;  1ZKH A;  4A6Q A;  1ZDX A;  1TIF A;  2BGF A;  4GDK A;  1OEY A;  3SFE B;  5BYQ A;  1CQV A;  3N1Y C;  3EEC A;  1YQ3 B;  3Q8E A;  4RM9 A;  2HJ8 A;  1QQR A;  1K53 A;  3ZKJ C;  4YL8 A;  4XGA B;  4FN2 A;  4M0W A;  4KSK C;  2ZCC A;  1XCT L;  2J42 A;  5AZH A;  1I4H A;  1WSP A;  4A3P A;  4KGR A;  5JZE B;  3Q69 A;  2KDM A;  1R4M I;  1ROE A;  1QOA A;  1OEY J;  3V6C B;  2BW2 A;  3LXF A;  2DZM A;  4RGT A;  4EFO A;  5I4D A;  3EHV A;  1Z5S B;  3AMZ A;  4OVU A;  2W3S A;  2EMT A;  4IKG A;  4N6E B;  1WY8 A;  2GLS A;  1SE9 A;  4GOC A;  2RPV A;  4TV3 A;  4GB9 A;  2FUH B;  5FR3 A;  3BYT B;  2WXK A;  4MM3 B;  4ZHP A;  3IXS A;  2G1E A;  2NMQ A;  3N3K B;  4AJW A;  3TMP B;  2KVZ A;  2K1F A;  2BT6 A;  2NS5 A;  4IM3 A;  3ZGZ A;  4ZYN A;  4WAA A;  4MDK E;  3E56 A;  2UU7 A;  3NJT A;  2I1J A;  2HE7 A;  4RH6 A;  3Q3J A;  3KYD D;  3QCA A;  1H4R A;  2JWU A;  1B9R A;  2KJ6 A;  4DXG A;  3FKY A;  1WJ4 A;  3DVN V;  1L7Y A;  5TR5 A;  1FXT B;  1XLN A;  2N9E B;  1NEK B;  3DBR B;  1TY2 A;  3Q3M C;  2IBI B;  2LAS A;  1WX7 A;  2LHE A;  2WXR A;  4DHJ B;  3H9D A;  4NY0 A;  1FXI A;  2ZZP B;  1JML A;  2KDI A;  1E7U A;  2LFI A;  1E8X A;  2LJ5 A;  2XNA C;  1UBQ A;  5G5G A;  2M19 A;  1TBE A;  4OZA A;  1JWB D;  1GNU A;  3B2G A;  4LNF A;  1NBF C;  3WAL A;  4PS7 A;  1FPY A;  4P1C C;  3NS1 A;  2VH1 A;  1C1Y B;  3AUL A;  3TEW A;  4KX6 B;  2D3C A;  4ICU A;  1ZXI A;  4QAY A;  3ZRC A;  3VR8 B;  5G55 A;  2LZ6 A;  4W9J A;  4FA6 A;  2KD0 A;  1GPX A;  4LNI A;  5J17 A;  3RI7 C;  2FCN A;  3GOE A;  2RMM A;  4TSS A;  4US9 A;  3RZF A;  2L8J A;  3Q3F A;  3VHT C;  2LUE A;  3HRD D;  4ZRJ A;  2BYF A;  2W55 A;  1VRA B;  4RGO S;  1AAR A;  4FJZ A;  4XWT A;  2JYT A;  1MI0 A;  3DDC B;  1UGM A;  5D94 A;  3AEG B;  3TEY A;  3Q14 C;  3SD5 A;  3WAM A;  2AL3 A;  2D11 A;  4K7U A;  4YTP B;  2REX A;  4FLH A;  1NDD A;  2JY6 A;  2W9N A;  1I4R A;  3B0A A;  1WXQ A;  3A9K B;  4M00 A;  5EDS A;  3DHG C;  3DOW A;  1PYW D;  2J4X A;  2CHZ A;  5BYR A;  4J3O D;  1GG3 A;  4ITK A;  1SJH D;  1FM0 D;  3RNG C;  4ZYS A;  3LB8 C;  2D3B A;  5EE3 A;  1HEZ E;  2KK8 A;  1V1P A;  1CMX B;  2K22 A;  2D5G A;  3NVW A;  2KDF B;  4NQK E;  3UQB A;  3L0W B;  2MP2 B;  3Q8F A;  1EU3 A;  4G0N B;  2K25 A;  4PS3 A;  4MJS B;  4ARI A;  3C8Y A;  4ANV A;  1XXG A;  4P1B C;  4WIP A;  3L13 A;  1Q1O A;  1C79 A;  1WX9 A;  3RUL A;  4W9I A;  1GB1 A;  4K7S A;  2QMT A;  2MBO A;  2M4N A;  1J19 A;  3L08 A;  5G2N A;  1ET9 A;  1JRU A;  2ZPN A;  4HDO A;  1NYQ A;  2JRI B;  4ANU A;  1WF9 A;  3BY4 B;  3H6N A;  1WGK A;  1TY0 A;  4YWG G;  1F9J A;  3M63 B;  4RMA A;  1HA5 A;  4AQ7 A;  3IT4 B;  1V5T A;  2HJ1 A;  2DBY A;  1QIL A;  4NAW B;  1L0Y B;  1HZ6 A;  2PEA A;  3PRM B;  2PJH A;  3RMK C;  3AI5 A;  1FFU A;  4FXC A;  4EZL A;  5D3I B;  2LVP A;  1TZO A;  1N63 A;  4Q2J A;  1LXD A;  1Q5W B;  4WJP A;  3N32 A;  3JSV B;  3OAW A;  2N1V A;  4XWW A;  3ZDM C;  1P1A A;  4JGH B;  3M95 A;  1YIW A;  2BKR B;  3ZJT A;  3RD2 A;  4WQM A;  1XLO A;  3UIP B;  2OHF A;  3EFC A;  3PPA A;  3MHS D;  1XQQ A;  4WUR A;  2WWZ A;  1EM7 A;  3K9P B;  2O6V A;  3BVZ A;  2IO0 B;  1I35 A;  1SB3 C;  1WI0 A;  2FNJ B;  3CIR B;  4ASW C;  3ZJV A;  2LUM A;  2QC8 A;  1F2R I;  5EE0 A;  3VUX A;  3DBH B;  5DPR A;  3W9C B;  2J0M A;  4AS1 A;  2KDE B;  3Q6B A;  3U52 E;  2C7M B;  3L17 A;  2L00 B;  2RPQ A;  4JX1 C;  1FRR A;  3RZW C;  3TUO A;  5TSS A;  1YQ4 B;  1ZOY B;  3TIX A;  2JZZ A;  3PRZ A;  3ML9 A;  1XCQ L;  4AWJ A;  2MBE A;  4DDI D;  1L6U A;  4JIO U;  1C3T A;  1UF0 A;  3C19 A;  3URY A;  1F52 A;  3AE1 B;  4NAM A;  5L83 A;  1TS3 A;  2PIA A;  3AB5 A;  1D6E C;  1WXS A;  4KKJ A;  3Q3O C;  4G3X B;  2AQ1 B;  3RNC C;  3W1S A;  2Y5B B;  4HVB A;  1UH6 A;  2IND C;  2MBH A;  4CHK A;  1ZE3 D;  2WXN A;  3FC4 A;  1YN4 A;  2LXA A;  2DEN B;  4HPL B;  3DWG C;  2R2Q A;  1N5X A;  4L1B A;  3D32 A;  3IAS 1;  3ML8 A;  4I6P A;  3ZO5 B;  2LI5 A;  5AUK A;  1PGX A;  1KF6 B;  4BKS A;  2WLB A;  3GE8 C;  4BOZ B;  4BVU C;  3T8M A;  4G11 A;  3IFW B;  5IOI A;  2N7E A;  5LNK 1;  1SXT A;  1C77 A;  1YX6 B;  1K51 A;  2KLG A;  4K1R B;  1STE A;  3NG0 A;  1WFY A;  5C3J B;  5IKC M;  2K39 A;  2EMS A;  2KVR A;  3VR9 B;  4XC2 A;  3P4R B;  3DBR I;  2WXQ A;  2ZW1 A;  4AOF A;  3FIL B;  4XYC A;  1WRD B;  2WDT B;  2MWS B;  2K6Q A;  3APD A;  1SGH A;  2J52 A;  1QKZ A;  2N9P C;  2N9X A;  1V86 A;  2X38 A;  4BKT A;  4B6W A;  3U30 A;  2KTR A;  2G45 B;  2QSD A;  1RFK A;  2G4D B;  4C00 A;  4HPM B;  5E6P A;  4GLS C;  2KDB A;  3R7Q A;  3ZRF A;  2RD0 A;  4OZC A;  2N4F A;  4GMV A;  3W1S C;  2MSE D;  3TEX A;  4C4V B;  2N1W A;  3J9C A;  4W9C A;  2CKH B;  5BMG A;  1VDV A;  2Y3A A;  4YSY B;  2KO3 A;  1PFD A;  1QOF A;  4AP4 C;  3A9J B;  2CJN A;  4WJQ A;  3MC0 B;  1T0S C;  3DWM A;  1V9J A;  2ZW0 A;  1XF5 L;  3AED B;  3P2B A;  1M94 A;  4M8M A;  3RNB C;  1YQB A;  3QAR A;  1VR9 A;  3ZYY X;  3VAW A;  1UWX A;  4DWF A;  2D3G A;  2JXT A;  1CK1 A;  1HZ5 A;  1MG4 A;  1IGC A;  3V60 A;  3IT6 B;  2ZJD A;  4P16 A;  1V81 A;  4KV2 A;  2KQ4 X;  2WYQ A;  2JZP A;  3AV8 A;  3NUH B;  2IGH A;  4GDK B;  2HTM E;  4YSX B;  5EE1 A;  4FBJ B;  3KWL A;  3P1M A;  4G50 A;  4ZHO A;  1JCK B;  2ZVN A;  2DYM A;  1MVK A;  4M02 A;  1WMH B;  3CF6 E;  4R3D A;  4GU2 A;  2INC C;  3APC A;  4GGQ A;  4C7Z A;  3RPF C;  1GOZ A;  1PDX A;  2YEP B;  4JPS A;  3TJP A;  2PW9 A;  4NQL B;  1D4B A;  3UIN B;  3CSF A;  3KUD B;  4RFB A;  2KN4 A;  4W9E A;  1IP9 A;  4GN1 A;  1WJ6 A;  2NBV B;  2KMC A;  4A8X C;  1ZDV A;  3PVL A;  1WJU A;  2D10 A;  2FUG 1;  2QJL A;  1L6V A;  4EZJ A;  4XDC A;  4AJY B;  3WIM A;  3KW5 B;  1WM2 A;  2LRW A;  1WM3 A;  2FAZ A;  3QAQ A;  1F77 A;  1J8C A;  3WAO A;  1UZX B;  1LGR A;  2EKE C;  4LDT D;  5BMI A;  2N7D A;  3AM9 A;  3W5V B;  4HKZ E;  3SEB A;  4LJO B;  3HHM A;  4HKQ A;  1N62 A;  3V62 A;  2DZJ A;  1SIJ A;  2BPS A;  1RRB A;  2PMV A;  1RLF A;  2VRR B;  1QZE A;  2LEK A;  4FHJ A;  3V6E B;  3O65 B;  3SDL C;  3B1L X;  2OJW A;  2DZK A;  1FEH A;  4GIV A;  3WAN A;  2INP E;  3TBL D;  1MFW A;  1TS2 A;  4URK A;  4CYE A;  2AQ2 B;  4LJP B;  4HXD A;  1IGD A;  2PKO A;  4L23 A;  3VFK A;  3H7P A;  4M01 A;  2M8S A;  1E90 A;  2ZNV C;  1RYJ A;  4FJY A;  3VUY A;  4AUQ C;  1KLG D;  4LCD E;  1KRH A;  4RGN A;  1L2N A;  2LXC A;  2Z0E B;  1E8W A;  3RYT A;  3TEZ A;  1C9F A;  1SSN A;  3SHQ A;  5AZG A;  2N9L A;  1FIQ A;  5CHW A;  3E9S A;  5D7G A;  2GBR A;  4HDQ A;  3ZDT A;  4WWP A;  4ZRK A;  2EKI A;  3DVG Y;  1WH3 A;  5BMH A;  2QDF A;  2JX5 A;  3IBE A;  4WH4 A;  5AEK B;  3BK2 A;  3AE7 B;  2JF5 A;  1YNT E;  2PE9 A;  3DBH I;  5HI1 A;  3R2I A;  2N9K A;  1XO3 A;  1FNU A;  2GOW A;  4W9D A;  4DXA B;  2BVC A;  4A20 A;  3PS6 A;  1SE4 A;  2KAC A;  3N1Z C;  5LXH A;  2KT7 A;  2ZCB A;  1WZ3 A;  1N60 A;  5D3D A;  2QCZ A;  3RNE C;  1GC6 A;  2L83 A;  1UD7 A;  2DLB A;  1QOB A;  2O6V D;  4RF0 A;  3HVD A;  4ARC A;  1WE6 A;  4I6N B;  1YJJ A;  4S0R A;  2WS3 B;  2WX0 A;  1EUV B;  2WXI A;  1R4N B;  3PHW B;  1HQR D;  4GDL A;  2JSV X;  1D5X C;  1TKE A;  4OW0 A;  3IAM 1;  1QT9 A;  2RGF A;  2K8H A;  2M17 A;  4LDT B;  3L16 A;  1WJN A;  3DPD A;  1U4A A;  2BWE S;  2LGY A;  3AU5 A;  3RNF C;  2DZI A;  3A1Q B;  3BWU D;  1FRD A;  4DK5 A;  3T9L A;  4RCO A;  2L3Z A;  2CS4 A;  3AEC B;  2BB6 A;  2KNB A;  2KOX A;  1HTQ A;  1RFA A;  1N61 A;  1DOI A;  1L5P A;  1P9D U;  3PZ7 A;  1NYR A;  4B95 A;  1YD8 U;  1SF0 A;  2DYO A;  1XLQ A;  2G3Q B;  2PE6 B;  3ETR A;  1AYF A;  1OFF A;  2BYV E;  5FR6 A;  2Y5P A;  2I38 A;  2JQR B;  1E8Z A;  2LVQ A;  4KDL B;  1TZ1 A;  1HXY D;  2MCN B;  3NHE B;  4BBN F;  4B0E A;  2KQS A;  3PTF C;  4WQO B;  2BS3 B;  1DYQ A;  1JWS D;  3CWI A;  1EF1 A;  1DOY A;  1F0Z A;  2I1K A;  3ONS A;  1E10 A;  4F7Z A;  2UYZ B;  1H8C A;  3VTV A;  2WXF A;  1JWU D;  4BFR A;  4KSL C;  2DNF A;  2CU3 A;  2QIL A;  5HG2 A;  1M4V A;  4KGS A;  2GBJ A;  1MG8 A;  4BOS C;  5AZF A;  1K50 A;  3ZXV A;  2ZVO A;  3GZN B;  1XT9 B;  2RDH A;  1WIA A;  1WGR A;  2O6V B;  3ZVV A;  1UUP A;  1ZGU B;  4KIK B;  4I6L B;  2LGX A;  2MRP A;  4PYU A;  2WDQ B;  1FNV A;  1TT5 B;  2GBK A;  2XK5 A;  2MA9 B;  3PO0 A;  1JQ4 A;  3BK1 A;  3C0R B;  4WAF A;  1V5O A;  3ZNH B;  4JLC A;  5LXI B;  4II3 B;  3N1X C;  2ON8 A;  2C7H A;  1TYG B;  3JVZ X;  1ET6 A;  1FO4 A;  5BO4 B;  2FID A;  4PS8 A;  5C2T B;  4YXD B;  2NBW B;  3N20 C;  2BYT A;  1IBX B;  4REZ A;  5CX3 A;  2MJE A;  1D5Z C;  3AXC A;  1HE8 A;  3PLU A;  1MHH E;  5H8Y E;  3BIN A;  5JHB A;  3CST A;  1C4P A;  3PT2 B;  4OZB A;  4JE3 B;  3EFU A;  2EEL A;  4JWU C;  4MGZ E;  1AWD A;  4FUL A;  3W1Y A;  2KC2 A;  3L54 A;  2IJ0 A;  4IC7 B;  5JH5 C;  4HRS A;  2QIE B;  4MH8 A;  5J18 A;  1T0Q C;  2K8B A;  3QX1 A;  2WX1 A;  1WRI A;  3KUZ A;  4IWP A;  2D2Q A;  4LTU A;  1IPG A;  3P4P B;  1FCC C;  3A4S C;  3L4P A;  4E3C A;  3QA8 A;  2H88 B;  1WE7 A;  2L1A A;  3AEB B;  2J7Q B;  1G6J A;  1KTK A;  2VH2 A;  5J2R A;  1QF6 A;  2KFK B;  4NAW A;  1D5M C;  1YX5 B;  3BII D;  1UGJ A;  3AE5 B;  4N58 A;  1MPE A;  1V97 A;  4LNO A;  1T3Q A;  2BB5 A;  1JRP A;  2WDR B;  4HLE A;  1KLV A;  3PZD A;  3JSV A;  3V61 A;  4J6I A;  5CHV C;  2XEW A;  5GMV A;  4DQO C;  1JWM D;  3HK0 A;  1F1H A;  2WXJ A;  2KTR B;  4K3C A;  3EUB 2;  2BTE A;  3GP7 A;  1A70 A;  4JQW C;  2HDE A;  3AH7 A;  3TL5 A;  3BZD B;  2MJD A;  3MTN B;  1BXT A;  2JYE A;  3VH4 B;  4PT5 A;  5FK9 C;  4BBN C;  5HKH A;  3U8Z A;  1C76 A;  2LVO A;  1L0X B;  1TS4 A;  2G4S A;  3DVG X;  3KLS X;  3UGB B;  2JVC A; 
#chains in the Genus database with same CATH homology
 1WJ6 A;  2NBV B;  1J0G A;  2KMA A;  2DHZ A;  2KMC A;  1TBE A;  5KHQ A;  3IG3 A;  3PVL A;  1WJU A;  3ZIM A;  2D10 A;  1GNU A;  2MW5 A;  2XBB C;  3LJ3 A;  4GSW A;  4EZJ A;  2V3S A;  4AJY B;  2KHW B;  3I3T B;  4IM2 A;  3WIM A;  3KW5 B;  1NBF C;  3WAL A;  3HM3 A;  4PS7 A;  1WM2 A;  2LRW A;  1WM3 A;  4W9G A;  2FAZ A;  3QAQ A;  1C1Y B;  1WZ0 A;  3AUL A;  2L7R A;  1EF5 A;  3WAO A;  1J8C A;  4ICU A;  1UZX B;  2EKE C;  4HJK A;  2BYE A;  1WGD A;  5L95 C;  2KWV B;  4LDT D;  2N7D A;  3ZRC A;  5G55 A;  1E7V A;  2LZ6 A;  2MP2 A;  4W9J A;  3R3M A;  3OJ4 B;  2KD0 A;  4FA6 A;  4KDI C;  1Z2M A;  1K8R B;  4LJO B;  5J17 A;  2FCN A;  2L05 A;  3HHM A;  2KC1 A;  3DBL I;  4MJS A;  3ZTD A;  2BWF A;  2JXX A;  2YVC A;  3GOE A;  3V62 A;  2DZJ A;  4ANX A;  3OLM D;  2BPS A;  1R4N I;  1RRB A;  2KKC A;  4MSQ B;  4F8C B;  5DCN A;  2K6D B;  1RLF A;  2L8J A;  2VRR B;  1QZE A;  3Q3F A;  2LUE A;  4FHJ A;  3RZF A;  3VHT C;  3V6E B;  4WJO A;  1Y8R C;  3O65 B;  3SDL C;  3B1L X;  2BYF A;  4ZRJ A;  3VUW A;  3K9O B;  3A33 B;  4P7I A;  2ZNV B;  2D07 B;  1AAR A;  2L76 A;  4FJV B;  4DHZ B;  2DZK A;  4FJZ A;  4MH0 E;  2CR5 A;  4JL9 A;  4GIV A;  3DDC B;  3WAN A;  3TBL D;  1UGM A;  5D94 A;  4DBG A;  4URK A;  4EKU A;  3PRE A;  4CYE A;  4KIK A;  4LJP B;  3SD5 A;  4MSM B;  3WAM A;  1PQS A;  1WXA A;  2AL3 A;  2D11 A;  4K7U A;  2MX2 A;  4HXD A;  4MGI E;  3UQA A;  2LGD A;  3VFK A;  3H7P A;  2REX A;  4FLH A;  1NDD A;  1E90 A;  2JY6 A;  2M8S A;  2W9N A;  2ZNV C;  4FJY A;  3B0A A;  3RT3 B;  3VUY A;  4AUQ C;  2NPT A;  4LCD E;  3QWZ B;  1L2N A;  3A9K B;  3IHP C;  5EDS A;  2KJR A;  2LXC A;  2Z0E B;  4XZ4 A;  3DOW A;  1E8W A;  4HK2 A;  4WJN A;  3RYT A;  2CHZ A;  3SHQ A;  4BKG A;  5AZG A;  1GG3 A;  2KWC A;  3PHX B;  2GMI C;  5CHW A;  2MLB A;  3B08 A;  3H1U A;  4EUT A;  1XD3 B;  2IY0 B;  5D7G A;  2GBR A;  4HDQ A;  3ZDT A;  4WWP A;  3PRP B;  4ZRK A;  3DVG Y;  1UEL A;  1WH3 A;  2KK8 A;  1CMX B;  3U7D A;  1Q0W B;  3IBE A;  2KDF B;  5AEK B;  5IA7 A;  1OTR B;  3TCA A;  4NQK E;  3HM6 X;  1TTN A;  3UQB A;  1KOT A;  1P0R A;  2JF5 A;  2PE9 A;  3DBH I;  1X1M A;  3L0W B;  2MP2 B;  2MBB B;  5DPW A;  4G0N B;  2K25 A;  2GOW A;  4PS3 A;  4MJS B;  4W9D A;  3NS8 A;  4DXA B;  3KYC D;  4A20 A;  3PS6 A;  4ANV A;  3ECI A;  4HCN B;  5LXH A;  2C7N B;  2ZCB A;  2V4L A;  4IWO A;  3L13 A;  1Q1O A;  1WZ3 A;  2KX3 A;  1WR6 E;  1WX9 A;  3IVF A;  3RUL A;  4W9I A;  4E71 A;  4M0W B;  1GC6 A;  4K7S A;  2MBO A;  2M4N A;  1J19 A;  3L08 A;  5G2N A;  1SIF A;  2ZEQ A;  1JRU A;  2ZPN A;  4HDO A;  1UD7 A;  4WWN A;  2JRI B;  4ANU A;  2O6V D;  1S3S G;  2CHX A;  1WF9 A;  3HIZ A;  3BY4 B;  1VCB A;  3N30 A;  3H6N A;  1WE6 A;  1E8Y A;  2AYO B;  2NPT B;  4IM0 A;  4NPN A;  4I6N B;  1F9J A;  3M63 B;  4RMA A;  1WGH A;  2WX0 A;  2J0K A;  1EUV B;  1V5T A;  3KUC B;  3PHW B;  4NAW B;  2HD5 B;  3JW0 X;  4W9K A;  3VTW A;  3M3J A;  2ZPY A;  1RAX A;  4GDL A;  2PEA A;  3PRM B;  1V6E A;  2PJH A;  3AI5 A;  2JUO A;  1T0Y A;  3VTU A;  1A5R A;  2KWU B;  4XX5 A;  3GZN I;  4ICV A;  2RGF A;  2K8H A;  2M17 A;  3DCG A;  4EZL A;  4LDT B;  2KTF A;  2LVP A;  3L16 A;  1WJN A;  3JYU A;  4TQ1 A;  3DPD A;  1U4A A;  1V49 A;  3KVF B;  2BWE S;  2KFK A;  2LGY A;  3AU5 A;  1LXD A;  1Q5W B;  2DZI A;  3A1Q B;  3N32 A;  4WJP A;  3JSV B;  4WWO A;  3OAW A;  3VVW B;  4DK5 A;  5DPT A;  1WGY A;  5KHO A;  3T9L A;  3LDZ E;  4ANW A;  2KJH B;  2N1V A;  4M8N A;  2V1Y A;  2L3Z A;  4EZK A;  3UIO B;  1V2Y A;  3ZDM C;  1P1A A;  2CS4 A;  4JGH B;  3M95 A;  5C1Z A;  2KNB A;  2O2V A;  2KOX A;  2J0J A;  1LQB A;  1YIW A;  2BKR B;  4HCP B;  3RD2 A;  2MQJ A;  3PGE A;  1RFA A;  3UIP B;  2JZ3 B;  1P9D U;  3ZW3 A;  1BT0 A;  2UWQ A;  3PPA A;  2KAN A;  3MHS D;  1XQQ A;  4B95 A;  4EOY A;  2KZR A;  1YD8 U;  2WWZ A;  2IZV B;  3K9P B;  2O6V A;  2DYO A;  4TUU A;  2IO0 B;  4K81 A;  1WGG A;  1I35 A;  2HTH A;  2G3Q B;  1WI0 A;  2PE6 B;  4NJ6 A;  2FNJ B;  2M1M A;  4ASW C;  4II2 B;  2GBN A;  2LRU A;  1ISN A;  2BYV E;  2C60 A;  5D6J B;  3VUX A;  4F1S A;  5FR6 A;  1WMH A;  2R2O A;  5DPR A;  4TQ0 A;  2GBM A;  2KN5 A;  2J0M A;  1E8Z A;  1LFD A;  2LVQ A;  2M0X A;  3CMM B;  4KDL B;  1TZ1 A;  2MCN B;  1WR1 A;  3QQ8 B;  2KDE B;  3NHE B;  1D3Z A;  3AU4 A;  2C7M B;  4BBN F;  4DHZ E;  3L17 A;  1P3Q U;  2L00 B;  1GC7 A;  1TGZ B;  2KQS A;  2RPQ A;  2B3A A;  3APF A;  3H7S A;  3PTF C;  4WQO B;  2L0T A;  4K7W A;  1P98 A;  1EF1 A;  3RZW C;  2QHO A;  3WA0 A;  2Z59 B;  5CHF A;  3ZNI D;  2I1K A;  4GDL B;  3TIX A;  2JZZ A;  3ONS A;  2FCQ A;  3PRZ A;  2CU1 A;  3ML9 A;  4F7Z A;  2RSU A;  1OQY A;  4AWJ A;  3NY5 A;  2MBE A;  2UYZ B;  4DDI D;  2IO3 B;  4JIO U;  3VTV A;  2LWP A;  1C3T A;  1H8C A;  2NVU I;  5IAA C;  1ZW7 A;  5L83 A;  2DAF A;  4DDG D;  4BFR A;  4KSL C;  2DX5 B;  2AL6 A;  1WXS A;  2O2V B;  2C5L C;  2KQ7 A;  3QK0 A;  4RM8 A;  2GBJ A;  3DBS A;  4G3X B;  1MG8 A;  4BOS C;  2JRH A;  5AZF A;  3QHT A;  2AWT A;  4MGY E;  3A4R A;  3ALB A;  3W1S A;  3NZS A;  2Y5B B;  4HVB A;  2ZVO A;  1UH6 A;  2MBH A;  1XT9 B;  4CHK A;  1WIA A;  1WGR A;  4CO7 A;  2KX0 A;  2O6V B;  3ZVV A;  4W9H A;  2LD9 A;  1ZGU B;  5E6N A;  1UBI A;  2LXA A;  3DVN U;  4I6L B;  4KIK B;  2IY1 B;  2LGX A;  2MRP A;  4KZ0 A;  4PYU A;  2DEN B;  4HPL B;  3OJ3 A;  4MGK E;  1WXV A;  1GUA B;  2YLM A;  2R2Q A;  3H7P B;  2GBK A;  2XK5 A;  3QJZ A;  3R66 C;  2MA9 B;  3D32 A;  3VDZ A;  4E74 A;  3ZNG C;  3ML8 A;  4I6P A;  3C0R B;  3NOB A;  1V5O A;  4PYZ A;  3ZNH B;  4JLC A;  5LXI B;  2IO1 B;  2Z0D B;  4II3 B;  3ZO5 B;  2LI5 A;  4MEL A;  3ENE A;  2C7H A;  4BKS A;  1E5W A;  4FAD A;  1GJZ A;  4BOZ B;  4BVU C;  1V80 A;  3JVZ X;  3T8M A;  5BO4 B;  3ZUN A;  4G11 A;  4DHJ D;  2FID A;  3IFW B;  2NCN A;  1VD2 A;  2N7E A;  3A9J A;  2K8C A;  2KFJ A;  2JT4 B;  4ZRI A;  2BF8 B;  1IYF A;  3VH3 B;  4PS8 A;  4W9L A;  3SU8 X;  1YX6 B;  4K1R B;  2KLG A;  2NBW B;  3QIJ A;  5D2M B;  2NR2 A;  3PSE B;  1WFY A;  5LLI A;  2FCS A;  2K39 A;  2AEH A;  2C9W B;  3KH0 A;  3PV1 A;  5CX3 A;  3RCZ A;  2EMS A;  1EO6 A;  3AXC A;  2KVR A;  1HE8 A;  2RR9 A;  4XC2 A;  2A4Z A;  2KXJ A;  2PPH A;  2JWZ A;  3PLU A;  3PLV A;  4KVG B;  4MM3 A;  4NNJ B;  2JPH A;  3DBR I;  4AOF A;  4FHK A;  2DAJ A;  4HWI B;  3S2A A;  1WRD B;  3BIN A;  2WDT B;  4TKN A;  3CST A;  5JHB A;  1KJT A;  3PT2 B;  2MWS B;  5CTR C;  3VXW A;  3ZLZ A;  2K6Q A;  3VQI A;  2CHW A;  3APD A;  1SGH A;  3L10 B;  3DQV A;  3EFU A;  2BKF A;  3MJW A;  4IUM B;  4MGZ E;  4FUL A;  1ZKH A;  2MBQ A;  2N9P C;  4IWQ A;  2N9X A;  3W1Y A;  1V86 A;  2KC2 A;  3L54 A;  4B6W A;  4N9F 4;  4BKT A;  2BGF A;  4GDK A;  4IC7 B;  5JH5 C;  1OEY A;  3U30 A;  2KTR A;  2G45 B;  2OOB B;  5C23 A;  2ASQ A;  2G4D B;  3RUI B;  3EEC A;  3NZU A;  4HPM B;  5E6P A;  2KDB A;  3R7Q A;  2FIF A;  3ZRF A;  2RD0 A;  5J18 A;  4EEW A;  2XK5 B;  4RM9 A;  2N4F A;  4GMV A;  3W1S C;  2HJ8 A;  2MSE D;  2K8B A;  1KM7 A;  3EC8 A;  3QX1 A;  3ZKJ C;  4YL8 A;  2N1W A;  4FN2 A;  1WX8 A;  2WX1 A;  4W9C A;  3KUZ A;  2CKH B;  4KSK C;  2ZCC A;  2D2Q A;  4IWP A;  5AZH A;  1IPG A;  3X0W A;  4A3P A;  1WYW B;  5JZE B;  2KO3 A;  3QC8 B;  4B9K A;  1R4M I;  4AP4 C;  4NJ7 A;  1OEY J;  3UF8 A;  3A4S C;  3A9J B;  3V6C B;  4BKS D;  2L0F A;  2DZM A;  4EFO A;  4WJQ A;  3EHV A;  1Z5S B;  4E3C A;  4OVU A;  2EMT A;  2IO2 B;  1V9J A;  3QA8 A;  4ZDV A;  4IG7 B;  1WY8 A;  5E6O A;  1I42 A;  1WE7 A;  2FCM A;  3P2B A;  1SE9 A;  2J7Q B;  4A3O A;  4GOC A;  1M94 A;  4KZC A;  5J2R A;  1G6J A;  4M8M A;  3M62 B;  2KFK B;  4NAW A;  4TV3 A;  4GB9 A;  1YX5 B;  2FUH B;  4X57 B;  1YQB A;  3QAR A;  4W9F A;  2A5U A;  3N3K B;  4AJW A;  3TMP B;  2K1F A;  4MEM A;  2NS5 A;  3VAW A;  4IM3 A;  4DWF A;  2D3G A;  2IYD B;  4ZYN A;  4WAA A;  3V60 A;  2ZJD A;  4HLE A;  1KLV A;  4MDK E;  1YJ1 A;  3A1Q A;  3PZD A;  3JSV A;  3V61 A;  3R7R A;  1OGW A;  1V81 A;  4J6I A;  2I1J A;  2HE7 A;  1LM8 B;  2NBU A;  4KV2 A;  5CHV C;  2WYQ A;  3Q3J A;  2XEW A;  1S1Q B;  3KYD D;  3QCA A;  4GDK B;  5GMV A;  1H4R A;  3HK0 A;  2DYB A;  2KTR B;  2KJ6 A;  4FBJ B;  4G50 A;  2ZVN A;  1WJ4 A;  2DYM A;  3DVN V;  1WXM A;  1L7Y A;  5DPS A;  5TR5 A;  4JQW C;  1FXT B;  2N9E B;  4OVV A;  3WAP A;  3X23 A;  3TL5 A;  1WMH B;  3CF6 E;  3MTN B;  4GU2 A;  2IBI B;  2LAS A;  1NI2 A;  1WX7 A;  3ZNZ B;  2OJR A;  3APC A;  3ZTC A;  3VH4 B;  4GGQ A;  4BBN C;  4DHJ B;  5HKH A;  3U8Z A;  3H9D A;  4NY0 A;  2LVO A;  2ZZP B;  2KDI A;  2G4S A;  3DVG X;  4IW0 A;  1E7U A;  3TJP A;  4NQL B;  3UIN B;  1E8X A;  2LJ5 A;  3CSF A;  3UGB B;  2JVC A;  3KUD B;  1UBQ A;  4GXB A;  5JHA A;  3A9K A;  4W9E A;  1IP9 A;  4GN1 A;  2KLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...