2AWTA

Solution structure of human small ubiquitin-like modifier protein isoform 2 (sumo-2)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
95
structure length
95
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 2
publication title Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 9
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2awtA00
2AL6A 2Z59B 5G55A 2GMIC 1EO6A 2LVOA 1PQSA 2MLBA 2XK5B 3H9DA 4ASWC 2J0KA 2LD9A 1U4AA 3ENEA 4W9GA 3QQ8B 1TGZB 3DVNU 2V1YA 4PS7A 4HVBA 5GMVA 4ANVA 2YVCA 5CX3A 4BOSC 1WJUA 3APDA 1FXTB 3H1UA 3N30A 2Z0DB 2JRIB 4KV2A 4DDGD 3OAWA 3EECA 2EMTA 3VUXA 4MGKE 3W1YA 4BKSD 4W9FA 1RRBA 2WYQA 2GOWA 1E8XA 3DVNV 3DPDA 4ICVA 4RM8A 4HDOA 3IVFA 2K8BA 4DHJB 1IPGA 2MA9B 4KIKB 3VTVA 4KSKC 1T0YA 3RZWC 1X1MA 2KTRA 2FUHB 2FCMA 5DPRA 4GDKB 3PV1A 1L7YA 4GXBA 4XX5A 4AP4C 2N1WA 4II3B 2FAZA 2NR2A 2M0XA 1LXDA 4B6WA 3SDLC 3Q3JA 5L83A 1ZGUB 2DZKA 4AJWA 1WZ0A 1WMHB 5LLIA 2IZVB 2KWCA 2REXA 3A1QA 1SE9A 3UIPB 2G45B 4AJYB 3PRZA 3H7PA 5CHFA 1WXMA 3ZTDA 4K7WA 2KFKB 4EZLA 2L0TA 3VH4B 3L08A 4BKTA 3O65B 4A20A 1Q5WB 4W9DA 4ZRKA 1RFAA 2DYOA 3M62B 5J18A 3DBRI 3GZNI 1ZKHA 3TL5A 4XC2A 3APFA 1WYWB 2C9WB 3HM6X 4TV3A 1A5RA 1V80A 3WAPA 2IBIB 2K1FA 3WAMA 4KVGB 4E3CA 4WWOA 1P3QU 3TCAA 2PE9A 4G0NB 4FULA 4K7UA 4GB9A 4PYUA 2KHWB 4FJZA 4K1RB 1V9JA 3VTUA 2R2OA 3H7SA 2LVPA 4IWOA 4RM9A 1TTNA 2MBHA 3ZTCA 1Q1OA 3KUCB 5C1ZA 3DVGY 4B9KA 1WX7A 1WM3A 4DWFA 2D2QA 2YLMA 1ISNA 1XQQA 4W9HA 2D3GA 3CF6E 2O2VB 3JSVB 4FLHA 2D07B 4FA6A 3IG3A 2KJHB 1Z5SB 2G4DB 3X0WA 4G11A 5D7GA 3LDZE 2Y5BB 2D10A 3VQIA 1WIAA 2M1MA 4FJVB 4LJOB 1UBQA 3ZUNA 4ANWA 3UQBA 1H8CA 4CYEA 1Y8RC 2ZNVC 3MHSD 5E6PA 1NBFC 3VFKA 1E8ZA 3ZKJC 2C7MB 4FHJA 1NDDA 2K25A 3HIZA 2L8JA 2J7QB 4KZ0A 4WJOA 3VVWB 3NS8A 3MTNB 3AULA 4FN2A 5JHBA 1IP9A 3KUDB 2CHXA 3A4RA 3A9JB 3PRMB 1D3ZA 3V6EB 4M8MA 3T9LA 3N32A 2KN5A 4MGYE 5JH5C 1WF9A 2L0FA 2QHOA 5G2NA 3ALBA 3PHWB 2Z0EB 4LDTD 3ZRFA 5CTRC 4JL9A 3V61A 1NI2A 1P98A 4PS8A 4W9EA 2PJHA 2IO0B 1LM8B 2K39A 2NPTA 2DAJA 4BKGA 4PYZA 1V6EA 1WE6A 3VDZA 5L95C 2JF5A 3M3JA 4MDKE 3AXCA 1UD7A 2FIDA 2N4FA 5J17A 1WFYA 4WJQA 2KMAA 3UINB 5E6OA 4BBNC 1WI0A 4W9IA 2KLGA 3PVLA 2DX5B 2KDFB 1WX8A 1GUAB 2KQ7A 4W9KA 2N9EB 2KQSA 2JXXA 3TIXA 4WQOB 4GOCA 3RYTA 3U8ZA 2O6VA 5TR5A 2JRHA 2M17A 1R4MI 3ML9A 3VAWA 3WALA 1UELA 4NAWB 4EOYA 2KWVB 3W1SA 1AARA 2MRPA 2OOBB 3T8MA 1E8WA 2LRWA 2AL3A 3TBLD 2KLCA 3A9KB 1TBEA 3W1SC 5CHWA 2L3ZA 1F9JA 3MJWA 3X23A 3ZNHB 1OQYA 4IWPA 2L76A 3VUWA 4NNJB 2MP2A 3C0RB 2KMCA 2BGFA 5J2RA 1P9DU 4LDTB 2W9NA 4GN1A 2C5LC 2JT4B 4URKA 2DHZA 1SGHA 5AZGA 4BFRA 4WJNA 3QK0A 2I1KA 1I42A 5DPSA 2D11A 2KXJA 3NZSA 1KJTA 2HE7A 1XD3B 2ZCBA 2MW5A 3KYCD 3EFUA 2AYOB 1K8RB 2MBQA 1YIWA 4MELA 4GDLA 2DZMA 3WANA 4W9LA 5AZHA 1WJNA 3EC8A 4F1SA 4NJ6A 5D2MB 2MBEA 3ZW3A 4MGZE 2HTHA 4BVUC 4F8CB 2MWSB 1E7VA 3RD2A 3OJ3A 1GC7A 2G3QB 3L54A 1KLVA 2BF8B 2IY0B 3NY5A 2IO2B 4MH0E 3DBSA 1WXSA 1GNUA 2GBRA 2DAFA 2K8CA 2KTRB 2KFJA 4EZKA 2LXAA 3RT3B 1V2YA 2AWTA 2RR9A 4P7IA 4WJPA 3WAOA 2BKRB 4ICUA 1E7UA 4ZRJA 4EEWA 3TMPB 4I6PA 2DENB 1WE7A 3PZDA 1RAXA 1WGGA 3L13A 4I6NB 1M94A 4IUMB 1GJZA 4FBJB 5D6JB 2LXCA 2RGFA 2CHZA 1WGDA 3AU5A 5KHOA 1I35A 2KTFA 3A1QB 3HM3A 5AZFA 3ZVVA 1QZEA 2JPHA 3H7PB 3KYDD 4TKNA 2N7EA 2B3AA 2K6QA 4N9F4 2BYVE 2NBVB 3JYUA 2G4SA 2FNJB 2GBNA 2HD5B 3BY4B 3HK0A 1J19A 4IC7B 3P2BA 4A3PA 4E71A 3JVZX 4KDLB 4HDQA 3WIMA 3ONSA 2KDBA 1JRUA 1WGRA 2LI5A 4DBGA 2N7DA 3QCAA 1S3SG 3S2AA 2C7HA 4FHKA 3L16A 5LXIB 4II2B 2JWZA 1H4RA 1WGYA 1P0RA 3K9PB 2KC1A 4M0WB 2I1JA 4WWPA 4BOZB 1OEYA 5E6NA 4E74A 4RMAA 5IAAC 5DPTA 3ZNZB 4HXDA 1YX6B 2IO3B 4DHZB 2RD0A 5JZEB 3L17A 2CS4A 4GIVA 3PGEA 2WX1A 4F7ZA 4K81A 5KHQA 3D32A 1YD8U 4JIOU 4G3XB 1OGWA 3ECIA 3RUIB 4WWNA 3NHEB 4MM3A 2CR5A 3V60A 1OEYJ 2LWPA 1TZ1A 2EKEC 3L10B 4JQWC 1Z2MA 4IWQA 3UIOB 2NVUI 4K7SA 3V6CB 1UH6A 2A4ZA 4MJSA 2MBBB 2MSED 4YL8A 1YQBA 1R4NI 2VRRB 3OJ4B 2XK5A 2KVRA 4MEMA 3LJ3A 5FR6A 2L05A 2DZIA 4CHKA 1GG3A 2RSUA 4TQ1A 1Q0WB 3DOWA 2HJ8A 5HKHA 2GBMA 2KNBA 2UYZB 3QA8A 1GC6A 2O6VD 3QX1A 4HPMB 2J0JA 2ZNVB 3CMMB 3PS6A 4IW0A 4ZYNA 2GBKA 2IO1B 2IYDB 3DBLI 4CO7A 1WH3A 2BPSA 2JVCA 5D94A 3NZUA 2CKHB 4TQ0A 3UQAA 4JGHB 3HHMA 3K9OB 2NBUA 4DK5A 2BWES 4EUTA 3PREA 5IA7A 2C7NB 3RZFA 4KIKA 5DCNA 4KSLC 1WM2A 2LJ5A 4KZCA 3B08A 3B1LX 4MJSB 1G6JA 1ZW7A 1EF5A 4GMVA 4HCNB 2KX3A 2M4NA 2V3SA 1P1AA 2A5UA 5JHAA 2NPTB 1S1QB 3WA0A 2DYMA 2FIFA 1EUVB 2N1VA 4XZ4A 1HE8A 1VCBA 4GSWA 4A3OA 1BT0A 2EMSA 4AOFA 2M8SA 4TUUA 2OJRA 2C60A 2KK8A 1KM7A 1WX9A 4ZDVA 1WMHA 2LGXA 2GBJA 4ANUA 4AWJA 1J8CA 2WDTB 4ANXA 3PRPB 1MG8A 1EF1A 2KFKA 1SIFA 4ZRIA 1WRDB 2KJRA 3CSTA 4DXAB 3V62A 4EFOA 4OVUA 2MX2A 3IFWB 2O6VB 3EHVA 2JY6A 2KX0A 2KWUB 1E90A 2LVQA 3OLMD 4GGQA 4IM0A 3Q3FA 5LXHA 3IHPC 5CHVC 4BKSA 2LASA 3DVGX 3GOEA 4NPNA 3QC8B 4AUQC 3KH0A 4IM3A 1L2NA 3VXWA 3BINA 2ZPNA 1WXVA 3VTWA 3QHTA 1UBIA 4EKUA 1WR1A 1WZ3A 4DDID 3QAQA 2MP2B 3ZNID 1E8YA 2L7RA 1LQBA 1OTRB 3IBEA 2CU1A 1J0GA 2LGDA 3PLUA 4G50A 1V81A 1YX5B 2LZ6A 2NBWB 4HWIB 3H6NA 2N9XA 2R2QA 2MQJA 5AEKB 4W9JA 4JLCA 3CSFA 3QWZB 3ZLZA 2CHWA 2KANA 2O2VA 3JSVA 4HCPB 4M8NA 3PHXB 4NY0A 4IM2A 2ZPYA 2BYFA 2BYEA 4GDLB 1UZXB 3N3KB 3ML8A 3PSEB 4J6IA 4WAAA 1WXAA 2JUOA 3ZNGC 3DDCB 3DQVA 1V5OA 3L0WB 5DPWA 2KC2A 3DBHI 4HK2A 3DCGA 1WGHA 2NCNA 2KZRA 4X57B 3RULA 4FJYA 2ZZPB 2ZVOA 1XT9B 3M63B 3R7RA 3QARA 3ZRCA 3ZIMA 2AEHA 2ZCCA 1IYFA 2KDEB 3VHTC 2KO3A 3ZDMC 4KDIC 3A9JA 4NJ7A 4BBNF 4I6LB 3R66C 2N9PC 1RLFA 2ZVNA 2XBBC 3APCA 3QIJA 4MSQB 4HJKA 2KD0A 3SU8X 2DYBA 3U30A 4DHZE 4LJPB 2UWQA 4FADA 1WY8A 3PLVA 1WJ6A 2XEWA 3JW0X 2ASQA 2FCSA 1E5WA 1KOTA 2J0MA 1YJ1A 2PEAA 3I3TB 2IY1B 1V5TA 3M95A 2L00B 4MGIE 2LRUA 3ZDTA 2FCNA 2NS5A 2ZJDA 3TJPA 2JZZA 3A33B 1C3TA 4GU2A 4NQKE 3R7QA 3VUYA 2K8HA 3U7DA 4B95A 2KKCA 1UGMA 2K6DB 3R3MA 4HPLB 4EZJA 1LFDA 4HLEA 3RCZA 2BKFA 3B0AA 5C23A 2LUEA 3KUZA 3PT2B 4MSMB 2JZ3B 4LCDE 2KDIA 4NQLB 3PPAA 1C1YB 2BWFA 2PPHA 2WX0A 2MBOA 1WR6E 2PE6B 3NOBA 3PTFC 2V4LA 4DHJD 1CMXB 3QJZA 3VH3B 1V86A 4NAWA 3SHQA 1WJ4A 3UF8A 2LGYA 2DZJA 2ZEQA 4PS3A 3ZO5B 3A9KA 3KVFB 3UGBB 4W9CA 2FCQA 2KJ6A 5EDSA 3A4SC 3AU4A 3KW5B 2WWZA 1VD2A 4IG7B 5BO4B 3AI5A 2RPQA 3SD5A 4OVVA 2MCNB 2KOXA 4GDKA 1V49A
chains in the Genus database with same CATH superfamily
1HTQA 2LD9A 1U4AA 1D5XC 3DVNU 1TS2A 4HVBA 4BOSC 1M4VA 4DDGD 3OAWA 4MGKE 2V0GA 4W9FA 5EE9A 5HFYA 1RFKA 4HDOA 3VTVA 4KSKC 5GXGB 1YN3A 1SE3A 2DNFA 2RPVA 1L7YA 4NAMA 1YJIA 2FAZA 1TYGB 3AE2B 1KTKA 4B6WA 2EKIA 1C4CA 2REXA 1QQRA 3A1QA 3HVZA 3PRZA 3N9YC 3ZTDA 2KFKB 2L0TA 2W54A 1KH0A 1Q5WB 5IP4D 4JPSA 1RFAA 3DBRI 3GZNI 2Y3AA 1WYWB 1GB1A 3HM6X 2K1FA 1N6ZA 2WXHA 2BB6A 1PGBA 2KT7A 2R2OA 1TTNA 1JQ4A 2MBHA 2ICIA 2LJIA 1L6VA 5C1ZA 1CZPA 1Q10A 2D2QA 2YLMA 4W9HA 4XDDA 2O2VB 4FLHA 1NYQA 3L4PA 1FCCC 1TS5A 4G11A 3URYA 3LDZE 1SEBD 3SFDB 3AE3B 3FILA 1C79A 1FFVA 4LJOB 4WURA 1UBQA 3UQBA 4LK0M 3AEEB 1K50A 1E7PB 1ET9A 1NBFC 3VFKA 1E8ZA 3ZKJC 2C7MB 1NDDA 2L8JA 5JHBA 3A9JB 1UGJA 2W82A 1QLBB 4PS8A 2IO0B 2NPTA 2DAJA 4BKGA 2DBYA 4PYZA 3KWLA 1WE6A 3TUOA 1FRRA 1TY2A 1YQ3B 3AXCA 2FIDA 3R2TA 4N58A 2N4FA 3AEGB 2J53A 4BBNC 5E6OA 1DOXA 4W9IA 1WWTA 2KQ7A 2N9EB 2KQSA 3IAM1 3P1MA 1D5ZC 3RYTA 3U8ZA 3ML9A 1OFFA 3VAWA 4DXGA 3NVZA 1UELA 3CWIA 4EOYA 4YSYB 2KLCA 1QOAA 2NTTA 1KFYB 2L3ZA 1ZPSA 1I4HA 2L76A 2MP2A 3MHZA 2W9NA 4GN1A 2DHZA 1SGHA 4LTUA 1F1HA 3QK0A 3TEWA 1N5XA 2D11A 3NZSA 1KJTA 1TT5B 1K8RB 1YIWA 4MELA 2DZMA 2PTLA 2QSDA 1SE2A 2MBEA 2HTHA 4F8CB 3OJ3A 3L54A 2BF8B 2IY0B 3WCQA 3DBSA 2DAFA 2KFJA 4EZKA 4IOIE 2RR9A 4P7IA 1E7UA 4ZRJA 4EEWA 4I6PA 4IUMB 1GJZA 3L13A 1M94A 1BXTA 2K0PA 1WGDA 2KTFA 5AZFA 3ZVVA 1QZEA 4TKNA 3KYDD 4ITKA 2B3AA 4N9F4 2BYVE 5LXHA 2GBNA 3U4EG 4A3PA 3FC4A 3JVZX 3PZ8A 4HDQA 3SFEB 3WIMA 4DBGA 2JXTA 3QCAA 1S3SG 1ZP0B 4FHKA 4II2B 2JWZA 1H4RA 1XLQA 3N1XC 2KC1A 4BOZB 2I1JA 1OEYA 1FNUA 4RMAA 3P4SB 2IO3B 2CS4A 4GIVA 2IGGA 3D32A 3RUIB 3NHEB 4MM3A 3V60A 1OEYJ 3AN1A 1TZ1A 5EE0A 5IOIA 3V6CB 2A4ZA 2PMVA 4MJSA 4AQ7A 2MSED 4YL8A 1R4NI 2KVRA 4MEMA 1OQQA 5FR3A 1GG3A 4TQ1A 1Q0WB 4HEA1 2GBMA 2O6VD 3PS6A 2ZNVB 3N1YC 1J7AA 5D94A 5BYQA 3NVVA 4TQ0A 1XCTL 3MC8A 1E0ZA 3HHMA 1K51A 2NBUA 4XWWA 4MM3B 2C7NB 1Y56A 1SJED 3RZFA 3ZJTA 4KIKA 4Q2JA 5DCNA 4P1BC 4MJSB 2M4NA 2V3SA 1P1AA 3WA0A 2FIFA 2GI9A 4IDIA 1JWSD 4XZ4A 4A3OA 1BT0A 2EMSA 3IXSA 2OJRA 3RNBC 3V3XA 2V3NA 2EELA 4ANXA 1MG8A 1EF1A 2KVZA 1SIFA 4ZRIA 1QOGA 4DXAB 2D5GA 4OZBA 4OVUA 3IFWB 2KX0A 4GGQA 3OLMD 2LVQA 2VZKD 5CHVC 1FEHA 2LASA 4YTNB 1P7FA 1L0VB 2ZPNA 1STEA 3VTWA 1TJEA 4EKUA 4DDID 3Q3NC 1E8YA 1LQBA 3IBEA 1V81A 1YX5B 4RGOS 3H6NA 4W9JA 3Q3MC 3BWUD 2M0AA 2CHWA 3U7ZA 1R4MB 3PHXB 4NY0A 3Q69A 4GDLB 4J3OD 2PLPA 3ML8A 2QJLA 1N63A 3NUHB 3DCGA 2NCNA 1AYFA 1ZXHA 2YEPF 4TMAB 2L1AA 2ZVOA 1XT9B 4HRSA 3M63B 3ZIMA 2AEHA 2ZCCA 3DWGC 4YWGG 5D3IB 3R66C 3QIJA 4WAFA 5IN7A 4DHZE 2HJ1A 3PLVA 1WJ6A 3JW0X 2ASQA 2IDYA 4AS1A 4A8XC 2L00B 1YJJA 2FCNA 2Z8LA 5MPOA 4OVZA 1RWSA 4GLSC 4GU2A 1JWMD 3GE8C 3PO0A 2KKCA 4HLEA 2L52A 5C23A 3KUZA 4LCDE 1WR6E 2PE6B 1FIQA 4KGTA 4RF1A 1IBXA 1WJ4A 2DZJA 3BK2A 2NTSA 3NZ3A 3KVFB 3MC0B 3V05A 5EDSA 3A4SC 3KW5B 2WWZA 4XWTA 3IAS1 1E6EB 4OVVA 5BMHA 2LUMA 2ZW1A 2AL6A 2Z59B 4S17A 2GMIC 3H9DA 2LVOA 4ASWC 2DLBA 1UF0A 2YVCA 5CX3A 1ZE3D 1JW9D 3APDA 3H1UA 3N30A 2JRIB 4KGRA 4KV2A 3VUXA 1RRBA 2VH1A 2GOWA 4ICVA 1I7HA 1IPGA 4HJGE 2X8XX 4WH4A 2WQYB 1HZ5A 4AP4C 2FE8A 2NR2A 2M0XA 3GB1A 2WLBA 3SDLC 3Q6BA 2DZKA 2Y5PA 1LO5D 3DBLB 4AJYB 1SE9A 2WDQB 3H7PA 1VDVA 4RNAA 3VH4B 3O13A 3P4PB 2E6XA 4ZRKA 2KQ4X 1AWDA 1BMLC 1JCKB 1A5RA 3WAMA 4E3CA 1P3QU 1XEEA 3KLSX 5H92C 4FULA 4GB9A 2KHWB 4K1RB 3VTUA 3H7SA 2LVPA 4IWOA 2FUG1 1PYWD 1BUIC 3ZTCA 1GPXA 1YQ4B 5BMGA 1WX7A 4DWFA 4PT5A 1ISNA 2D07B 2KYWA 4FA6A 2KJHB 1Z5SB 3P63A 4C7ZA 3VQIA 3W5VB 2WU5B 1WIAA 2ON8A 4REZA 1XO3A 2N9LA 3MFGA 3ZUNA 1H8CA 4N59A 4CYEA 1Y8RC 5E6PA 3AM9A 5H8YE 3RN9C 3ZJVA 4WQMA 3VVWB 3AULA 4FN2A 3MP9A 3A4RA 2INCC 3U2SC 4MGYE 4A9AA 5G2NA 4LDTD 5CTRC 1C9FA 1P98A 2K39A 1LM8B 2JYEA 2D3CA 1MG4A 1AN8A 3VDZA 5L95C 3M3JA 4MDKE 1MVKA 1K52A 1I4XA 5J17A 3NRZA 3Q8FA 1WI0A 2KLGA 1D5MC 3PVLA 3T3OA 4JWSC 1ZXIA 2DX5B 4EE2A 4RCOA 2JXXA 2AX5A 3TIXA 1PGXA 2WGSA 4PK1A 2O6VA 5D3DA 4NAWB 3W1SA 3P4RB 2OOBB 3ZXRA 1RM6C 4KGSA 3TBLD 2G1EA 3W1SC 3AE4B 3X23A 4IWPA 3VUWA 1QOBA 4NNJB 5C3JB 1P9DU 1ZDVA 1QOFA 2JT4B 2I2YA 5AZGA 4BFRA 2W3RA 3AE5B 4RF0A 2MW5A 1AW7A 3EFUA 2AYOB 3AEDB 1I4QA 2OHFA 4W9LA 5AZHA 2MJ3A 3EC8A 4F1SA 5D2MB 1PDXA 4BVUC 2MWSB 1E7VA 1SBBB 1NVID 2AQ3B 1FXAA 2K8CA 2W3SA 3AEAB 3RT3B 2V4IB 2AWTA 3WAOA 3N20C 1WE7A 3PZDA 4FBJB 5D6JB 2JQRB 2RGFA 4US8A 3AU5A 4B0EA 3A1QB 4RFBA 1RYJA 1J7BA 1P7EA 4NZLB 4C80A 1YNTE 3I5JC 3BVGA 2NBVB 3JYUA 1YN4A 2FNJB 2G4SA 2HD5B 3P2BA 2GRIA 4P6VF 4E71A 2LGIA 1JRUA 2PVGC 4H2AA 2C7HA 2JU6X 2SAKA 5IAAC 2K22A 2WXQA 5JZEB 4YTPB 3L17A 3I9V1 2WX1A 4F7ZA 1YD8U 1JMLA 4WWNA 1DOIA 1FD6A 3AEBB 3UIOB 4K7SA 1FCLA 1WXQA 5HHDG 2XK5A 3OG5A 5FR6A 2L05A 2DZIA 1V1PA 3DBRB 3GZNB 2X38A 3BZDB 4HPMB 2PKOA 3QA8A 2UYZB 3CMMB 3FILB 2IO1B 2BPSA 1NEKB 3AECB 3KWVA 4JGHB 1N5WA 2BWES 5IA7A 2JWUA 2Y5CA 4JE3B 4US9A 1WM2A 1FPYA 2FBWB 4KZCA 4HKQA 3B08A 3B1LX 1VRAB 1ZW7A 2L83A 4HCNB 1QF6A 1I4PA 5JHAA 2NPTB 4USAA 2M19A 2WNMA 1VCBA 2M8SA 3I63C 5EE1A 4ZDVA 1WMHA 4ANUA 3PRPB 1B9RA 3AE6B 1T3QA 1F0ZA 2GB1A 1WRDB 2KJRA 1C78A 4IM0A 4C4VA 3N1ZC 2QEJC 3EFCA 3DVGX 4C56C 4XGAB 3KH0A 1L2NA 1UNSA 3AE8B 5C2TB 3QHTA 5AUKA 3QAQA 2MP2B 3ZNID 1OTRB 1FNWA 2LGDA 3PLUA 4G50A 4A55A 2OEDA 1EM7A 2IPKD 2MQJA 1TS4A 3CSFA 4CQNA 3JSVA 4UDUC 2BYTA 4IM2A 2BYFA 1L6UA 1L4ZB 1SSNA 3L0WB 3DBHI 4HK2A 1ESFA 3QARA 3Q8BA 1IYFA 3VHTC 4DXFA 1KLUD 4TSSA 4KDIC 4I6LB 2N9PC 1RLFA 3APCA 3VRBB 4HJKA 2BW2A 5BYSA 2UWQA 3T3NA 2G9HD 1KOTA 4N6EB 2J0MA 1YJ1A 2IY1B 3M95A 3ZDTA 3W5UB 3A33B 1V1OA 3R3MA 4EZJA 3EGRA 4KKJA 2WX0A 2BWFA 1V86A 3UF8A 1EU4A 3B9JA 3A9KA 1JRPA 4HPPA 3RMKC 4YT0B 3Q2AC 3LYYA 2RPQA 3SD5A 2MCNB 4GDKA 2N9KA 4MH8A 2MLBA 2K9XA 1VZ7A 1HZ6A 2KN4A 1TGZB 4PS7A 5GMVA 2ZW0A 5AUIA 1EWCA 3AE9B 2Z0DB 3EECA 2D3BA 2B76B 1MPEA 3R8BA 5IKCM 3B2GA 4RM8A 3I57A 3IVFA 2K8BA 2WXGA 4DHJB 2NMQA 4KIKB 2WP9B 1T0YA 1X1MA 2KTRA 2FUHB 4GDKB 3PV1A 2N1WA 4II3B 1LXDA 2RDBC 3Q3JA 5L83A 1WZ0A 2QILA 1I4GA 2IZVB 1NI3A 5LLIA 1TKGA 2G45B 2JX5A 1WXMA 4EZLA 3P4QB 4YSXB 1PFDA 1HXYD 1TS3A 2LFIA 3O65B 4A20A 1EWYC 1I4RA 3DHGC 5J18A 1F77A 4XC2A 2RDHA 1V80A 4M0WA 3Q14C 2IBIB 4G0NB 4K7UA 4PYUA 4FJZA 1E9MA 1V9JA 4RGNA 1UWXA 1VZ6A 4RM9A 1JALA 2PVOD 2KACA 1Q1OA 4HROA 3KUCB 3CIRB 1WM3A 1YMHE 3DHHC 1XQQA 4C00A 4O1NA 4NJCA 1IUEA 3X0WA 5E6JA 2Y5BB 2M1MA 4ANWA 3AH7A 3BYYB 2H88B 3AE7B 3MHSD 1SE4A 2INDC 2K25A 3HIZA 4WJOA 3RPFC 3MTNB 2CHXA 3PRMB 4LNNA 3V6EB 3T9LA 2RMMA 1F52A 4DQOC 2OJWA 2L0FA 5JH5C 3ALBA 2Z0EB 3V61A 4JL9A 1L5PA 4W9EA 4ZOHC 1MHHE 3Q8CA 3UI3A 2WXLA 1V6EA 2K3UA 2JF5A 3BVMA 4WJQA 3UINB 1UUPA 1XLNA 1GUAB 4W9KA 4L2YA 4WQOB 4XE0A 1SF0A 5TR5A 2LGSA 2M17A 4K3CA 1JROA 2KWVB 1IBXB 1IGCA 3ZJUA 1AARA 2MRPA 1E8WA 2LRWA 5CHWA 2LMCA 3MJWA 2N7JA 2BB5A 2KMCA 4M00A 2BGFA 3HUIA 2BVCA 2BS2B 4URKA 2KDMA 4M01A 4WJNA 1I42A 3OWEB 2KXJA 2HE7A 1XD3B 2CJOA 2AQ2B 2MBQA 1WJNA 1L0YB 4NJ6A 4RGMA 2WDVB 3ZW3A 1QT9A 4MGZE 4C7YA 1MHXA 3RD2A 3MC9A 2G3QB 3NY5A 1WXSA 1C4AA 1GNUA 2LXAA 4IKGA 2XNAC 1V2YA 2QCZA 4WJPA 2BKRB 1SXTA 2HDEA 3TEZA 2WHIA 3IT4B 1WGGA 4I6NB 4ARCA 2CHZA 1I35A 1T0SC 3TSSA 3NVYA 3H7PB 4S0RA 2MHJA 3EUB2 2K6QA 4ZHOA 3BY4B 4KDLB 3ZQ4A 1GB4A 3ONSA 1HA5A 4QAYA 1WGRA 5LXIB 1WGYA 3K9PB 4WWPA 3BK1A 4HXDA 1YX6B 4DHZB 1ZUD2 3PGEA 5G5HA 1KRHA 2IJ0A 3ECIA 4MACA 2EKEC 3NVWA 1Z2MA 4IWQA 3DWMA 1UH6A 4OZAA 2MBBB 3P42A 3VR8B 1C76A 3LXFA 4OZCA 1QILA 2W55A 4YTMB 3AE1B 1HTOA 3FKYA 3NJTA 2HJ8A 5HKHA 2KNBA 2BT6A 3QX1A 4RH6A 2QC8A 4CO7A 1WH3A 2JVCA 1SIJA 1T5XD 4A6QA 2CKHB 4WWMA 3W9CB 1DOYA 4DK5A 4EUTA 1ACCA 3PREA 1NYRA 2J42A 2LJ5A 1HEZE 5TSSA 1G6JA 4YXDB 1EF5A 3RNAC 2KX3A 2A5UA 5IO9A 2DYMA 1J7CA 1TKEA 2DWQA 1HE8A 4GSWA 3Q8EA 2C60A 1KM7A 1WX9A 2LGXA 1N61A 1J8CA 3EA6A 2KFKA 4HKZE 2MX2A 1MI0A 2O6VB 3DHIC 4ARIA 2PIAA 4ACFA 1VLBA 3IHPC 3GOEA 3E56A 1JWAD 3VXWA 3BINA 1WXVA 1UBIA 1YN5A 1WR1A 2BQQA 1WRIA 1XLOA 2L7RA 3IT6B 3GS2A 2NBWB 4HWIB 2N9XA 5AEKB 3ZLZA 2KANA 2O2VA 4M8NA 2ZPYA 2R61A 3N3KB 3PSEB 4J6IA 4WAAA 2JUOA 3ZNGC 2WXPA 5DPWA 2KC2A 1WGHA 1FMAD 2KZRA 3RULA 3RNGC 4JWUC 1N62A 2LHDA 3R7RA 1MJDA 2VZKB 2KDEB 3RI7C 3A9JA 4LNIA 4NJ7A 4BBNF 2ZVNA 3B2FA 3RFZB 2KD0A 4LJPB 3Q3OC 2J4XA 2TSSA 1WY8A 2XEWA 2FCSA 1D4BA 4BAXA 2PEAA 4ZRPA 2N0SB 1V5TA 3AEFB 1E10A 2NS5A 1V8CA 2JZZA 1C3TA 4NQKE 3AMZA 2K8HA 4B95A 4HPLB 1UWMA 1LFDA 3RCZA 2BKFA 3PT2B 2PPHA 2MBOA 3NOBA 3PTFC 1CMXB 3QJZA 2JYTA 3SHQA 1EU3A 1GAQB 1XXGA 3ZO5B 1QKZA 3UGBB 4W9CA 2FCQA 4KKIA 1VD2A 1VR9A 1T0RC 2BTEA 5G55A 1EO6A 2XK5B 1PQSA 2J0KA 3ENEA 3Q8AA 4W9GA 3QQ8B 1V1PB 2V1YA 2K5PA 4ANVA 3NS1A 1WJUA 3GE3C 1FXTB 3GP7A 5FKAC 3W1YA 2EMTA 1V97A 1CJEA 4BKSD 2JSVX 2IGDA 2WYQA 4LNFA 4KX6B 3DVNV 1E8XA 3DPDA 5HI1A 2WXRA 2MA9B 2J52A 3RZWC 1XCQL 3FAHA 4L1BA 2FCMA 5DPRA 1KF6B 1PUTA 4GXBA 4XX5A 2QDFA 2KAJA 5BMIA 1XLPA 3LB8C 1ZGUB 1ZDXA 4AJWA 2PW9A 1WMHB 2KWCA 3UIPB 2WXOA 1ENFA 5CHFA 4K7WA 1JWUD 3L08A 4BKTA 5JXVA 4W9DA 1TKYA 1FXIA 1KLGD 2DYOA 3M62B 3TL5A 4C4VB 1ZKHA 3APFA 2C9WB 4TV3A 5HG2A 3WAPA 5G5GA 4KVGB 4WWOA 3TCAA 2PE9A 3PZ7A 4BZAA 1CQVA 1VJKA 3ZGZA 3AB5A 3R2IA 2HTME 3SR6A 4D2KA 3DVGY 4B9KA 4FXCA 3TEYA 2D3GA 3CF6E 3ZXVA 3JSVB 1L0XB 3IG3A 2G4DB 5D7GA 2D10A 4FJVB 2ZNVC 3W2DA 2WDRB 4FHJA 4KZ0A 2J7QB 2M56B 3NS8A 1IP9A 3KUDB 2H89B 1PGAA 1D3ZA 4M8MA 3N32A 2BS4B 2KN5A 2AQ1B 2BS3B 1WF9A 3MJ5A 2QHOA 3ZRFA 3HVDA 3PHWB 1NI2A 4R3DA 2PJHA 2I38A 1R7SA 2MEKA 4RGTA 1UD7A 1TIFA 3DBHB 1WFYA 2KMAA 1B1ZA 2KDFB 1WX8A 3VR9B 2WXKA 4GOCA 4ZYSA 3BIID 1DGJA 2JRHA 2MJEA 1R4MI 3WALA 1TY0A 3ETRA 1A70A 2WU2B 5BYRA 3T8MA 2E3TA 2AL3A 3A9KB 1TBEA 1F9JA 3ZNHB 1OQYA 3C0RB 1OQRA 1R4NB 3RNEC 5J2RA 4LDTB 1ROEA 5I4DA 4WIPA 2C5LC 4JX1C 1CK1A 1FM0D 4XYCA 2I1KA 3KQ4A 5DPSA 2ZCBA 3KYCD 2SEBD 4GDLA 3WANA 1FO4A 4K3BA 2JZPA 3SEBA 1GC7A 1KLVA 1FFUA 2IO2B 4MH0E 2CJNA 2GBRA 2KTRB 2WXFA 4P16A 4ICUA 4P1CC 3TMPB 3U52E 2DENB 2KWDA 3RNCC 1RAXA 2QMTA 2LXCA 3ABVB 5KHOA 3HM3A 2JPHA 2N7EA 1DYQA 1IGDA 4IC7B 3HK0A 1J19A 2D3AA 2KDBA 1TZOA 2LI5A 2N7DA 3S2AA 1F2RI 1SB3C 3L16A 1P0RA 2IGHA 4LNKA 4M0WB 5E6NA 4E74A 3ZNZB 2INPE 5DPTA 1WYGA 2RD0A 1MFWA 1ZOYB 2WS3B 4MT5A 4K81A 5KHQA 4JIOU 2RDGA 1OGWA 2LHEA 4G3XB 4OW0A 2ACZB 2CR5A 2LWPA 1T6BX 1C4PA 3L10B 4JQWC 2CU3A 2NVUI 1T0QC 1SJHD 1YQBA 2VRRB 1LGRA 2V3PA 3OJ4B 3TEXA 3LJ3A 2V9HA 4CHKA 2RSUA 3DOWA 4YSZB 1GC6A 4IW0A 1F2RC 2J0JA 2ONQA 2KMMA 4OHJA 4ZYNA 2GBKA 2IYDB 3DBLI 5FK9C 3NZUA 3UQAA 1FRDA 5LNK1 3K9OB 2L32A 3E9SA 2YEPB 2INNE 2VH2A 4KSLC 1K53A 1FNVA 2GLSA 3BYTB 4GMVA 1S1QB 1EUVB 2N1VA 4A90A 1JWBD 4AOFA 2QIEB 4TUUA 2WXJA 2KK8A 3VRAB 3RNFC 2MH7A 2GBJA 4AWJA 2WDTB 3J9CA 1WGKA 1NENB 3CSTA 4ZRQA 3V62A 4EFOA 2BBCA 3EHVA 4L23A 2JY6A 2KWUB 1E90A 3Q3FA 2MJDA 4BKSA 1C77A 1ET6A 4NPNA 3QC8B 4AUQC 4IM3A 1WSPA 5T8IA 1WZ3A 1J0GA 2CU1A 2LZ6A 1N60A 2R2QA 4JLCA 3QWZB 3NG0A 4HCPB 1D6EC 2BYEA 1UZXB 1WXAA 3DDCB 3DQVA 1V5OA 3C8YA 4X57B 3AV8A 4FJYA 2ZZPB 2WXIA 1L4DB 3ZRCA 4LNOA 4B0MA 3ZYYX 2KO3A 3ZDMC 4LLGM 2XN9C 4MSQB 2XBBC 3SU8X 2DYBA 3U30A 1VZ8A 4FADA 4ZHPA 2WXNA 2LEKA 1E5WA 3I3TB 4MGIE 2LRUA 2ZJDA 3TJPA 1GOZA 4M02A 3R7QA 3VUYA 3U7DA 1UGMA 2K6DB 3HRDD 3H8HA 2WXMA 3B0AA 2LUEA 4MSMB 2JZ3B 2KDIA 4NQLB 3PPAA 1C1YB 4DHJD 2V4LA 3BVZA 1YOVB 3VH3B 4NAWA 2Q5WD 2LGYA 2ZEQA 4PS3A 2UU7A 1XF5L 1HQRD 5EE3A 2KJ6A 3AU4A 3C19A 4XDCA 5BO4B 4IG7B 3AI5A 2KOXA 1V49A
chains in the Genus database with same CATH topology
2AL6A 2Z59B 5G55A 2GMIC 1EO6A 2LVOA 1PQSA 2MLBA 2XK5B 3H9DA 4ASWC 2J0KA 2LD9A 1U4AA 3ENEA 4W9GA 3QQ8B 1TGZB 3DVNU 2V1YA 4PS7A 4HVBA 5GMVA 4ANVA 2YVCA 5CX3A 4BOSC 1WJUA 3APDA 1FXTB 3H1UA 3N30A 2Z0DB 2JRIB 4KV2A 4DDGD 3OAWA 3EECA 2EMTA 3VUXA 4MGKE 3W1YA 4BKSD 4W9FA 1RRBA 2WYQA 2GOWA 1E8XA 3DVNV 3DPDA 4ICVA 4RM8A 4HDOA 3IVFA 2K8BA 4DHJB 1IPGA 2MA9B 4KIKB 3VTVA 4KSKC 1T0YA 3RZWC 1X1MA 2KTRA 2FUHB 2FCMA 5DPRA 4GDKB 3PV1A 1L7YA 4GXBA 4XX5A 4AP4C 2N1WA 4II3B 2FAZA 2NR2A 2M0XA 1LXDA 4B6WA 3SDLC 3Q3JA 5L83A 1ZGUB 2DZKA 4AJWA 1WZ0A 1WMHB 5LLIA 2IZVB 2KWCA 2REXA 3A1QA 1SE9A 3UIPB 2G45B 4AJYB 3PRZA 3H7PA 5CHFA 1WXMA 3ZTDA 4K7WA 2KFKB 4EZLA 2L0TA 3VH4B 3L08A 4BKTA 3O65B 4A20A 1Q5WB 4W9DA 4ZRKA 1RFAA 2DYOA 3M62B 5J18A 3DBRI 3GZNI 1ZKHA 3TL5A 4XC2A 3APFA 1WYWB 2C9WB 3HM6X 4TV3A 1A5RA 1V80A 3WAPA 2IBIB 2K1FA 3WAMA 4KVGB 4E3CA 4WWOA 1P3QU 3TCAA 2PE9A 4G0NB 4FULA 4K7UA 4GB9A 4PYUA 2KHWB 4FJZA 4K1RB 1V9JA 3VTUA 2R2OA 3H7SA 2LVPA 4IWOA 4RM9A 1TTNA 2MBHA 3ZTCA 1Q1OA 3KUCB 5C1ZA 3DVGY 4B9KA 1WX7A 1WM3A 4DWFA 2D2QA 2YLMA 1ISNA 1XQQA 4W9HA 2D3GA 3CF6E 2O2VB 3JSVB 4FLHA 2D07B 4FA6A 3IG3A 2KJHB 1Z5SB 2G4DB 3X0WA 4G11A 5D7GA 3LDZE 2Y5BB 2D10A 3VQIA 1WIAA 2M1MA 4FJVB 4LJOB 1UBQA 3ZUNA 4ANWA 3UQBA 1H8CA 4CYEA 1Y8RC 2ZNVC 3MHSD 5E6PA 1NBFC 3VFKA 1E8ZA 3ZKJC 2C7MB 4FHJA 1NDDA 2K25A 3HIZA 2L8JA 2J7QB 4KZ0A 4WJOA 3VVWB 3NS8A 3MTNB 3AULA 4FN2A 5JHBA 1IP9A 3KUDB 2CHXA 3A4RA 3A9JB 3PRMB 1D3ZA 3V6EB 4M8MA 3T9LA 3N32A 2KN5A 4MGYE 5JH5C 1WF9A 2L0FA 2QHOA 5G2NA 3ALBA 3PHWB 2Z0EB 4LDTD 3ZRFA 5CTRC 4JL9A 3V61A 1NI2A 1P98A 4PS8A 4W9EA 2PJHA 2IO0B 1LM8B 2K39A 2NPTA 2DAJA 4BKGA 4PYZA 1V6EA 1WE6A 3VDZA 5L95C 2JF5A 3M3JA 4MDKE 3AXCA 1UD7A 2FIDA 2N4FA 5J17A 1WFYA 4WJQA 2KMAA 3UINB 5E6OA 4BBNC 1WI0A 4W9IA 2KLGA 3PVLA 2DX5B 2KDFB 1WX8A 1GUAB 2KQ7A 4W9KA 2N9EB 2KQSA 2JXXA 3TIXA 4WQOB 4GOCA 3RYTA 3U8ZA 2O6VA 5TR5A 2JRHA 2M17A 1R4MI 3ML9A 3VAWA 3WALA 1UELA 4NAWB 4EOYA 2KWVB 3W1SA 1AARA 2MRPA 2OOBB 3T8MA 1E8WA 2LRWA 2AL3A 3TBLD 2KLCA 3A9KB 1TBEA 3W1SC 5CHWA 2L3ZA 1F9JA 3MJWA 3X23A 3ZNHB 1OQYA 4IWPA 2L76A 3VUWA 4NNJB 2MP2A 3C0RB 2KMCA 2BGFA 5J2RA 1P9DU 4LDTB 2W9NA 4GN1A 2C5LC 2JT4B 4URKA 2DHZA 1SGHA 5AZGA 4BFRA 4WJNA 3QK0A 2I1KA 1I42A 5DPSA 2D11A 2KXJA 3NZSA 1KJTA 2HE7A 1XD3B 2ZCBA 2MW5A 3KYCD 3EFUA 2AYOB 1K8RB 2MBQA 1YIWA 4MELA 4GDLA 2DZMA 3WANA 4W9LA 5AZHA 1WJNA 3EC8A 4F1SA 4NJ6A 5D2MB 2MBEA 3ZW3A 4MGZE 2HTHA 4BVUC 4F8CB 2MWSB 1E7VA 3RD2A 3OJ3A 1GC7A 2G3QB 3L54A 1KLVA 2BF8B 2IY0B 3NY5A 2IO2B 4MH0E 3DBSA 1WXSA 1GNUA 2GBRA 2DAFA 2K8CA 2KTRB 2KFJA 4EZKA 2LXAA 3RT3B 1V2YA 2AWTA 2RR9A 4P7IA 4WJPA 3WAOA 2BKRB 4ICUA 1E7UA 4ZRJA 4EEWA 3TMPB 4I6PA 2DENB 1WE7A 3PZDA 1RAXA 1WGGA 3L13A 4I6NB 1M94A 4IUMB 1GJZA 4FBJB 5D6JB 2LXCA 2RGFA 2CHZA 1WGDA 3AU5A 5KHOA 1I35A 2KTFA 3A1QB 3HM3A 5AZFA 3ZVVA 1QZEA 2JPHA 3H7PB 3KYDD 4TKNA 2N7EA 2B3AA 2K6QA 4N9F4 2BYVE 2NBVB 3JYUA 2G4SA 2FNJB 2GBNA 2HD5B 3BY4B 3HK0A 1J19A 4IC7B 3P2BA 4A3PA 4E71A 3JVZX 4KDLB 4HDQA 3WIMA 3ONSA 2KDBA 1JRUA 1WGRA 2LI5A 4DBGA 2N7DA 3QCAA 1S3SG 3S2AA 2C7HA 4FHKA 3L16A 5LXIB 4II2B 2JWZA 1H4RA 1WGYA 1P0RA 3K9PB 2KC1A 4M0WB 2I1JA 4WWPA 4BOZB 1OEYA 5E6NA 4E74A 4RMAA 5IAAC 5DPTA 3ZNZB 4HXDA 1YX6B 2IO3B 4DHZB 2RD0A 5JZEB 3L17A 2CS4A 4GIVA 3PGEA 2WX1A 4F7ZA 4K81A 5KHQA 3D32A 1YD8U 4JIOU 4G3XB 1OGWA 3ECIA 3RUIB 4WWNA 3NHEB 4MM3A 2CR5A 3V60A 1OEYJ 2LWPA 1TZ1A 2EKEC 3L10B 4JQWC 1Z2MA 4IWQA 3UIOB 2NVUI 4K7SA 3V6CB 1UH6A 2A4ZA 4MJSA 2MBBB 2MSED 4YL8A 1YQBA 1R4NI 2VRRB 3OJ4B 2XK5A 2KVRA 4MEMA 3LJ3A 5FR6A 2L05A 2DZIA 4CHKA 1GG3A 2RSUA 4TQ1A 1Q0WB 3DOWA 2HJ8A 5HKHA 2GBMA 2KNBA 2UYZB 3QA8A 1GC6A 2O6VD 3QX1A 4HPMB 2J0JA 2ZNVB 3CMMB 3PS6A 4IW0A 4ZYNA 2GBKA 2IO1B 2IYDB 3DBLI 4CO7A 1WH3A 2BPSA 2JVCA 5D94A 3NZUA 2CKHB 4TQ0A 3UQAA 4JGHB 3HHMA 3K9OB 2NBUA 4DK5A 2BWES 4EUTA 3PREA 5IA7A 2C7NB 3RZFA 4KIKA 5DCNA 4KSLC 1WM2A 2LJ5A 4KZCA 3B08A 3B1LX 4MJSB 1G6JA 1ZW7A 1EF5A 4GMVA 4HCNB 2KX3A 2M4NA 2V3SA 1P1AA 2A5UA 5JHAA 2NPTB 1S1QB 3WA0A 2DYMA 2FIFA 1EUVB 2N1VA 4XZ4A 1HE8A 1VCBA 4GSWA 4A3OA 1BT0A 2EMSA 4AOFA 2M8SA 4TUUA 2OJRA 2C60A 2KK8A 1KM7A 1WX9A 4ZDVA 1WMHA 2LGXA 2GBJA 4ANUA 4AWJA 1J8CA 2WDTB 4ANXA 3PRPB 1MG8A 1EF1A 2KFKA 1SIFA 4ZRIA 1WRDB 2KJRA 3CSTA 4DXAB 3V62A 4EFOA 4OVUA 2MX2A 3IFWB 2O6VB 3EHVA 2JY6A 2KX0A 2KWUB 1E90A 2LVQA 3OLMD 4GGQA 4IM0A 3Q3FA 5LXHA 3IHPC 5CHVC 4BKSA 2LASA 3DVGX 3GOEA 4NPNA 3QC8B 4AUQC 3KH0A 4IM3A 1L2NA 3VXWA 3BINA 2ZPNA 1WXVA 3VTWA 3QHTA 1UBIA 4EKUA 1WR1A 1WZ3A 4DDID 3QAQA 2MP2B 3ZNID 1E8YA 2L7RA 1LQBA 1OTRB 3IBEA 2CU1A 1J0GA 2LGDA 3PLUA 4G50A 1V81A 1YX5B 2LZ6A 2NBWB 4HWIB 3H6NA 2N9XA 2R2QA 2MQJA 5AEKB 4W9JA 4JLCA 3CSFA 3QWZB 3ZLZA 2CHWA 2KANA 2O2VA 3JSVA 4HCPB 4M8NA 3PHXB 4NY0A 4IM2A 2ZPYA 2BYFA 2BYEA 4GDLB 1UZXB 3N3KB 3ML8A 3PSEB 4J6IA 4WAAA 1WXAA 2JUOA 3ZNGC 3DDCB 3DQVA 1V5OA 3L0WB 5DPWA 2KC2A 3DBHI 4HK2A 3DCGA 1WGHA 2NCNA 2KZRA 4X57B 3RULA 4FJYA 2ZZPB 2ZVOA 1XT9B 3M63B 3R7RA 3QARA 3ZRCA 3ZIMA 2AEHA 2ZCCA 1IYFA 2KDEB 3VHTC 2KO3A 3ZDMC 4KDIC 3A9JA 4NJ7A 4BBNF 4I6LB 3R66C 2N9PC 1RLFA 2ZVNA 2XBBC 3APCA 3QIJA 4MSQB 4HJKA 2KD0A 3SU8X 2DYBA 3U30A 4DHZE 4LJPB 2UWQA 4FADA 1WY8A 3PLVA 1WJ6A 2XEWA 3JW0X 2ASQA 2FCSA 1E5WA 1KOTA 2J0MA 1YJ1A 2PEAA 3I3TB 2IY1B 1V5TA 3M95A 2L00B 4MGIE 2LRUA 3ZDTA 2FCNA 2NS5A 2ZJDA 3TJPA 2JZZA 3A33B 1C3TA 4GU2A 4NQKE 3R7QA 3VUYA 2K8HA 3U7DA 4B95A 2KKCA 1UGMA 2K6DB 3R3MA 4HPLB 4EZJA 1LFDA 4HLEA 3RCZA 2BKFA 3B0AA 5C23A 2LUEA 3KUZA 3PT2B 4MSMB 2JZ3B 4LCDE 2KDIA 4NQLB 3PPAA 1C1YB 2BWFA 2PPHA 2WX0A 2MBOA 1WR6E 2PE6B 3NOBA 3PTFC 2V4LA 4DHJD 1CMXB 3QJZA 3VH3B 1V86A 4NAWA 3SHQA 1WJ4A 3UF8A 2LGYA 2DZJA 2ZEQA 4PS3A 3ZO5B 3A9KA 3KVFB 3UGBB 4W9CA 2FCQA 2KJ6A 5EDSA 3A4SC 3AU4A 3KW5B 2WWZA 1VD2A 4IG7B 5BO4B 3AI5A 2RPQA 3SD5A 4OVVA 2MCNB 2KOXA 4GDKA 1V49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  2Z59 B;  5G55 A;  2GMI C;  1EO6 A;  2LVO A;  1PQS A;  2MLB A;  2XK5 B;  3H9D A;  4ASW C;  2J0K A;  2LD9 A;  1U4A A;  3ENE A;  4W9G A;  3QQ8 B;  1TGZ B;  3DVN U;  2V1Y A;  4PS7 A;  4HVB A;  5GMV A;  4ANV A;  2YVC A;  5CX3 A;  4BOS C;  1WJU A;  3APD A;  1FXT B;  3H1U A;  3N30 A;  2Z0D B;  2JRI B;  4KV2 A;  4DDG D;  3OAW A;  3EEC A;  2EMT A;  3VUX A;  4MGK E;  3W1Y A;  4BKS D;  4W9F A;  1RRB A;  2WYQ A;  2GOW A;  1E8X A;  3DVN V;  3DPD A;  4ICV A;  4RM8 A;  4HDO A;  3IVF A;  2K8B A;  4DHJ B;  1IPG A;  2MA9 B;  4KIK B;  3VTV A;  4KSK C;  1T0Y A;  3RZW C;  1X1M A;  2KTR A;  2FUH B;  2FCM A;  5DPR A;  4GDK B;  3PV1 A;  1L7Y A;  4GXB A;  4XX5 A;  4AP4 C;  2N1W A;  4II3 B;  2FAZ A;  2NR2 A;  2M0X A;  1LXD A;  4B6W A;  3SDL C;  3Q3J A;  5L83 A;  1ZGU B;  2DZK A;  4AJW A;  1WZ0 A;  1WMH B;  5LLI A;  2IZV B;  2KWC A;  2REX A;  3A1Q A;  1SE9 A;  3UIP B;  2G45 B;  4AJY B;  3PRZ A;  3H7P A;  5CHF A;  1WXM A;  3ZTD A;  4K7W A;  2KFK B;  4EZL A;  2L0T A;  3VH4 B;  3L08 A;  4BKT A;  3O65 B;  4A20 A;  1Q5W B;  4W9D A;  4ZRK A;  1RFA A;  2DYO A;  3M62 B;  5J18 A;  3DBR I;  3GZN I;  1ZKH A;  3TL5 A;  4XC2 A;  3APF A;  1WYW B;  2C9W B;  3HM6 X;  4TV3 A;  1A5R A;  1V80 A;  3WAP A;  2IBI B;  2K1F A;  3WAM A;  4KVG B;  4E3C A;  4WWO A;  1P3Q U;  3TCA A;  2PE9 A;  4G0N B;  4FUL A;  4K7U A;  4GB9 A;  4PYU A;  2KHW B;  4FJZ A;  4K1R B;  1V9J A;  3VTU A;  2R2O A;  3H7S A;  2LVP A;  4IWO A;  4RM9 A;  1TTN A;  2MBH A;  3ZTC A;  1Q1O A;  3KUC B;  5C1Z A;  3DVG Y;  4B9K A;  1WX7 A;  1WM3 A;  4DWF A;  2D2Q A;  2YLM A;  1ISN A;  1XQQ A;  4W9H A;  2D3G A;  3CF6 E;  2O2V B;  3JSV B;  4FLH A;  2D07 B;  4FA6 A;  3IG3 A;  2KJH B;  1Z5S B;  2G4D B;  3X0W A;  4G11 A;  5D7G A;  3LDZ E;  2Y5B B;  2D10 A;  3VQI A;  1WIA A;  2M1M A;  4FJV B;  4LJO B;  1UBQ A;  3ZUN A;  4ANW A;  3UQB A;  1H8C A;  4CYE A;  1Y8R C;  2ZNV C;  3MHS D;  5E6P A;  1NBF C;  3VFK A;  1E8Z A;  3ZKJ C;  2C7M B;  4FHJ A;  1NDD A;  2K25 A;  3HIZ A;  2L8J A;  2J7Q B;  4KZ0 A;  4WJO A;  3VVW B;  3NS8 A;  3MTN B;  3AUL A;  4FN2 A;  5JHB A;  1IP9 A;  3KUD B;  2CHX A;  3A4R A;  3A9J B;  3PRM B;  1D3Z A;  3V6E B;  4M8M A;  3T9L A;  3N32 A;  2KN5 A;  4MGY E;  5JH5 C;  1WF9 A;  2L0F A;  2QHO A;  5G2N A;  3ALB A;  3PHW B;  2Z0E B;  4LDT D;  3ZRF A;  5CTR C;  4JL9 A;  3V61 A;  1NI2 A;  1P98 A;  4PS8 A;  4W9E A;  2PJH A;  2IO0 B;  1LM8 B;  2K39 A;  2NPT A;  2DAJ A;  4BKG A;  4PYZ A;  1V6E A;  1WE6 A;  3VDZ A;  5L95 C;  2JF5 A;  3M3J A;  4MDK E;  3AXC A;  1UD7 A;  2FID A;  2N4F A;  5J17 A;  1WFY A;  4WJQ A;  2KMA A;  3UIN B;  5E6O A;  4BBN C;  1WI0 A;  4W9I A;  2KLG A;  3PVL A;  2DX5 B;  2KDF B;  1WX8 A;  1GUA B;  2KQ7 A;  4W9K A;  2N9E B;  2KQS A;  2JXX A;  3TIX A;  4WQO B;  4GOC A;  3RYT A;  3U8Z A;  2O6V A;  5TR5 A;  2JRH A;  2M17 A;  1R4M I;  3ML9 A;  3VAW A;  3WAL A;  1UEL A;  4NAW B;  4EOY A;  2KWV B;  3W1S A;  1AAR A;  2MRP A;  2OOB B;  3T8M A;  1E8W A;  2LRW A;  2AL3 A;  3TBL D;  2KLC A;  3A9K B;  1TBE A;  3W1S C;  5CHW A;  2L3Z A;  1F9J A;  3MJW A;  3X23 A;  3ZNH B;  1OQY A;  4IWP A;  2L76 A;  3VUW A;  4NNJ B;  2MP2 A;  3C0R B;  2KMC A;  2BGF A;  5J2R A;  1P9D U;  4LDT B;  2W9N A;  4GN1 A;  2C5L C;  2JT4 B;  4URK A;  2DHZ A;  1SGH A;  5AZG A;  4BFR A;  4WJN A;  3QK0 A;  2I1K A;  1I42 A;  5DPS A;  2D11 A;  2KXJ A;  3NZS A;  1KJT A;  2HE7 A;  1XD3 B;  2ZCB A;  2MW5 A;  3KYC D;  3EFU A;  2AYO B;  1K8R B;  2MBQ A;  1YIW A;  4MEL A;  4GDL A;  2DZM A;  3WAN A;  4W9L A;  5AZH A;  1WJN A;  3EC8 A;  4F1S A;  4NJ6 A;  5D2M B;  2MBE A;  3ZW3 A;  4MGZ E;  2HTH A;  4BVU C;  4F8C B;  2MWS B;  1E7V A;  3RD2 A;  3OJ3 A;  1GC7 A;  2G3Q B;  3L54 A;  1KLV A;  2BF8 B;  2IY0 B;  3NY5 A;  2IO2 B;  4MH0 E;  3DBS A;  1WXS A;  1GNU A;  2GBR A;  2DAF A;  2K8C A;  2KTR B;  2KFJ A;  4EZK A;  2LXA A;  3RT3 B;  1V2Y A;  2AWT A;  2RR9 A;  4P7I A;  4WJP A;  3WAO A;  2BKR B;  4ICU A;  1E7U A;  4ZRJ A;  4EEW A;  3TMP B;  4I6P A;  2DEN B;  1WE7 A;  3PZD A;  1RAX A;  1WGG A;  3L13 A;  4I6N B;  1M94 A;  4IUM B;  1GJZ A;  4FBJ B;  5D6J B;  2LXC A;  2RGF A;  2CHZ A;  1WGD A;  3AU5 A;  5KHO A;  1I35 A;  2KTF A;  3A1Q B;  3HM3 A;  5AZF A;  3ZVV A;  1QZE A;  2JPH A;  3H7P B;  3KYD D;  4TKN A;  2N7E A;  2B3A A;  2K6Q A;  4N9F 4;  2BYV E;  2NBV B;  3JYU A;  2G4S A;  2FNJ B;  2GBN A;  2HD5 B;  3BY4 B;  3HK0 A;  1J19 A;  4IC7 B;  3P2B A;  4A3P A;  4E71 A;  3JVZ X;  4KDL B;  4HDQ A;  3WIM A;  3ONS A;  2KDB A;  1JRU A;  1WGR A;  2LI5 A;  4DBG A;  2N7D A;  3QCA A;  1S3S G;  3S2A A;  2C7H A;  4FHK A;  3L16 A;  5LXI B;  4II2 B;  2JWZ A;  1H4R A;  1WGY A;  1P0R A;  3K9P B;  2KC1 A;  4M0W B;  2I1J A;  4WWP A;  4BOZ B;  1OEY A;  5E6N A;  4E74 A;  4RMA A;  5IAA C;  5DPT A;  3ZNZ B;  4HXD A;  1YX6 B;  2IO3 B;  4DHZ B;  2RD0 A;  5JZE B;  3L17 A;  2CS4 A;  4GIV A;  3PGE A;  2WX1 A;  4F7Z A;  4K81 A;  5KHQ A;  3D32 A;  1YD8 U;  4JIO U;  4G3X B;  1OGW A;  3ECI A;  3RUI B;  4WWN A;  3NHE B;  4MM3 A;  2CR5 A;  3V60 A;  1OEY J;  2LWP A;  1TZ1 A;  2EKE C;  3L10 B;  4JQW C;  1Z2M A;  4IWQ A;  3UIO B;  2NVU I;  4K7S A;  3V6C B;  1UH6 A;  2A4Z A;  4MJS A;  2MBB B;  2MSE D;  4YL8 A;  1YQB A;  1R4N I;  2VRR B;  3OJ4 B;  2XK5 A;  2KVR A;  4MEM A;  3LJ3 A;  5FR6 A;  2L05 A;  2DZI A;  4CHK A;  1GG3 A;  2RSU A;  4TQ1 A;  1Q0W B;  3DOW A;  2HJ8 A;  5HKH A;  2GBM A;  2KNB A;  2UYZ B;  3QA8 A;  1GC6 A;  2O6V D;  3QX1 A;  4HPM B;  2J0J A;  2ZNV B;  3CMM B;  3PS6 A;  4IW0 A;  4ZYN A;  2GBK A;  2IO1 B;  2IYD B;  3DBL I;  4CO7 A;  1WH3 A;  2BPS A;  2JVC A;  5D94 A;  3NZU A;  2CKH B;  4TQ0 A;  3UQA A;  4JGH B;  3HHM A;  3K9O B;  2NBU A;  4DK5 A;  2BWE S;  4EUT A;  3PRE A;  5IA7 A;  2C7N B;  3RZF A;  4KIK A;  5DCN A;  4KSL C;  1WM2 A;  2LJ5 A;  4KZC A;  3B08 A;  3B1L X;  4MJS B;  1G6J A;  1ZW7 A;  1EF5 A;  4GMV A;  4HCN B;  2KX3 A;  2M4N A;  2V3S A;  1P1A A;  2A5U A;  5JHA A;  2NPT B;  1S1Q B;  3WA0 A;  2DYM A;  2FIF A;  1EUV B;  2N1V A;  4XZ4 A;  1HE8 A;  1VCB A;  4GSW A;  4A3O A;  1BT0 A;  2EMS A;  4AOF A;  2M8S A;  4TUU A;  2OJR A;  2C60 A;  2KK8 A;  1KM7 A;  1WX9 A;  4ZDV A;  1WMH A;  2LGX A;  2GBJ A;  4ANU A;  4AWJ A;  1J8C A;  2WDT B;  4ANX A;  3PRP B;  1MG8 A;  1EF1 A;  2KFK A;  1SIF A;  4ZRI A;  1WRD B;  2KJR A;  3CST A;  4DXA B;  3V62 A;  4EFO A;  4OVU A;  2MX2 A;  3IFW B;  2O6V B;  3EHV A;  2JY6 A;  2KX0 A;  2KWU B;  1E90 A;  2LVQ A;  3OLM D;  4GGQ A;  4IM0 A;  3Q3F A;  5LXH A;  3IHP C;  5CHV C;  4BKS A;  2LAS A;  3DVG X;  3GOE A;  4NPN A;  3QC8 B;  4AUQ C;  3KH0 A;  4IM3 A;  1L2N A;  3VXW A;  3BIN A;  2ZPN A;  1WXV A;  3VTW A;  3QHT A;  1UBI A;  4EKU A;  1WR1 A;  1WZ3 A;  4DDI D;  3QAQ A;  2MP2 B;  3ZNI D;  1E8Y A;  2L7R A;  1LQB A;  1OTR B;  3IBE A;  2CU1 A;  1J0G A;  2LGD A;  3PLU A;  4G50 A;  1V81 A;  1YX5 B;  2LZ6 A;  2NBW B;  4HWI B;  3H6N A;  2N9X A;  2R2Q A;  2MQJ A;  5AEK B;  4W9J A;  4JLC A;  3CSF A;  3QWZ B;  3ZLZ A;  2CHW A;  2KAN A;  2O2V A;  3JSV A;  4HCP B;  4M8N A;  3PHX B;  4NY0 A;  4IM2 A;  2ZPY A;  2BYF A;  2BYE A;  4GDL B;  1UZX B;  3N3K B;  3ML8 A;  3PSE B;  4J6I A;  4WAA A;  1WXA A;  2JUO A;  3ZNG C;  3DDC B;  3DQV A;  1V5O A;  3L0W B;  5DPW A;  2KC2 A;  3DBH I;  4HK2 A;  3DCG A;  1WGH A;  2NCN A;  2KZR A;  4X57 B;  3RUL A;  4FJY A;  2ZZP B;  2ZVO A;  1XT9 B;  3M63 B;  3R7R A;  3QAR A;  3ZRC A;  3ZIM A;  2AEH A;  2ZCC A;  1IYF A;  2KDE B;  3VHT C;  2KO3 A;  3ZDM C;  4KDI C;  3A9J A;  4NJ7 A;  4BBN F;  4I6L B;  3R66 C;  2N9P C;  1RLF A;  2ZVN A;  2XBB C;  3APC A;  3QIJ A;  4MSQ B;  4HJK A;  2KD0 A;  3SU8 X;  2DYB A;  3U30 A;  4DHZ E;  4LJP B;  2UWQ A;  4FAD A;  1WY8 A;  3PLV A;  1WJ6 A;  2XEW A;  3JW0 X;  2ASQ A;  2FCS A;  1E5W A;  1KOT A;  2J0M A;  1YJ1 A;  2PEA A;  3I3T B;  2IY1 B;  1V5T A;  3M95 A;  2L00 B;  4MGI E;  2LRU A;  3ZDT A;  2FCN A;  2NS5 A;  2ZJD A;  3TJP A;  2JZZ A;  3A33 B;  1C3T A;  4GU2 A;  4NQK E;  3R7Q A;  3VUY A;  2K8H A;  3U7D A;  4B95 A;  2KKC A;  1UGM A;  2K6D B;  3R3M A;  4HPL B;  4EZJ A;  1LFD A;  4HLE A;  3RCZ A;  2BKF A;  3B0A A;  5C23 A;  2LUE A;  3KUZ A;  3PT2 B;  4MSM B;  2JZ3 B;  4LCD E;  2KDI A;  4NQL B;  3PPA A;  1C1Y B;  2BWF A;  2PPH A;  2WX0 A;  2MBO A;  1WR6 E;  2PE6 B;  3NOB A;  3PTF C;  2V4L A;  4DHJ D;  1CMX B;  3QJZ A;  3VH3 B;  1V86 A;  4NAW A;  3SHQ A;  1WJ4 A;  3UF8 A;  2LGY A;  2DZJ A;  2ZEQ A;  4PS3 A;  3ZO5 B;  3A9K A;  3KVF B;  3UGB B;  4W9C A;  2FCQ A;  2KJ6 A;  5EDS A;  3A4S C;  3AU4 A;  3KW5 B;  2WWZ A;  1VD2 A;  4IG7 B;  5BO4 B;  3AI5 A;  2RPQ A;  3SD5 A;  4OVV A;  2MCN B;  2KOX A;  4GDK A;  1V49 A; 
#chains in the Genus database with same CATH topology
 1HTQ A;  2LD9 A;  1U4A A;  1D5X C;  3DVN U;  1TS2 A;  4HVB A;  4BOS C;  1M4V A;  4DDG D;  3OAW A;  4MGK E;  2V0G A;  4W9F A;  5EE9 A;  5HFY A;  1RFK A;  4HDO A;  3VTV A;  4KSK C;  5GXG B;  1YN3 A;  1SE3 A;  2DNF A;  2RPV A;  1L7Y A;  4NAM A;  1YJI A;  2FAZ A;  1TYG B;  3AE2 B;  1KTK A;  4B6W A;  2EKI A;  1C4C A;  2REX A;  1QQR A;  3A1Q A;  3HVZ A;  3PRZ A;  3N9Y C;  3ZTD A;  2KFK B;  2L0T A;  2W54 A;  1KH0 A;  1Q5W B;  5IP4 D;  4JPS A;  1RFA A;  3DBR I;  3GZN I;  2Y3A A;  1WYW B;  1GB1 A;  3HM6 X;  2K1F A;  1N6Z A;  2WXH A;  2BB6 A;  1PGB A;  2KT7 A;  2R2O A;  1TTN A;  1JQ4 A;  2MBH A;  2ICI A;  2LJI A;  1L6V A;  5C1Z A;  1CZP A;  1Q10 A;  2D2Q A;  2YLM A;  4W9H A;  4XDD A;  2O2V B;  4FLH A;  1NYQ A;  3L4P A;  1FCC C;  1TS5 A;  4G11 A;  3URY A;  3LDZ E;  1SEB D;  3SFD B;  3AE3 B;  3FIL A;  1C79 A;  1FFV A;  4LJO B;  4WUR A;  1UBQ A;  3UQB A;  4LK0 M;  3AEE B;  1K50 A;  1E7P B;  1ET9 A;  1NBF C;  3VFK A;  1E8Z A;  3ZKJ C;  2C7M B;  1NDD A;  2L8J A;  5JHB A;  3A9J B;  1UGJ A;  2W82 A;  1QLB B;  4PS8 A;  2IO0 B;  2NPT A;  2DAJ A;  4BKG A;  2DBY A;  4PYZ A;  3KWL A;  1WE6 A;  3TUO A;  1FRR A;  1TY2 A;  1YQ3 B;  3AXC A;  2FID A;  3R2T A;  4N58 A;  2N4F A;  3AEG B;  2J53 A;  4BBN C;  5E6O A;  1DOX A;  4W9I A;  1WWT A;  2KQ7 A;  2N9E B;  2KQS A;  3IAM 1;  3P1M A;  1D5Z C;  3RYT A;  3U8Z A;  3ML9 A;  1OFF A;  3VAW A;  4DXG A;  3NVZ A;  1UEL A;  3CWI A;  4EOY A;  4YSY B;  2KLC A;  1QOA A;  2NTT A;  1KFY B;  2L3Z A;  1ZPS A;  1I4H A;  2L76 A;  2MP2 A;  3MHZ A;  2W9N A;  4GN1 A;  2DHZ A;  1SGH A;  4LTU A;  1F1H A;  3QK0 A;  3TEW A;  1N5X A;  2D11 A;  3NZS A;  1KJT A;  1TT5 B;  1K8R B;  1YIW A;  4MEL A;  2DZM A;  2PTL A;  2QSD A;  1SE2 A;  2MBE A;  2HTH A;  4F8C B;  3OJ3 A;  3L54 A;  2BF8 B;  2IY0 B;  3WCQ A;  3DBS A;  2DAF A;  2KFJ A;  4EZK A;  4IOI E;  2RR9 A;  4P7I A;  1E7U A;  4ZRJ A;  4EEW A;  4I6P A;  4IUM B;  1GJZ A;  3L13 A;  1M94 A;  1BXT A;  2K0P A;  1WGD A;  2KTF A;  5AZF A;  3ZVV A;  1QZE A;  4TKN A;  3KYD D;  4ITK A;  2B3A A;  4N9F 4;  2BYV E;  5LXH A;  2GBN A;  3U4E G;  4A3P A;  3FC4 A;  3JVZ X;  3PZ8 A;  4HDQ A;  3SFE B;  3WIM A;  4DBG A;  2JXT A;  3QCA A;  1S3S G;  1ZP0 B;  4FHK A;  4II2 B;  2JWZ A;  1H4R A;  1XLQ A;  3N1X C;  2KC1 A;  4BOZ B;  2I1J A;  1OEY A;  1FNU A;  4RMA A;  3P4S B;  2IO3 B;  2CS4 A;  4GIV A;  2IGG A;  3D32 A;  3RUI B;  3NHE B;  4MM3 A;  3V60 A;  1OEY J;  3AN1 A;  1TZ1 A;  5EE0 A;  5IOI A;  3V6C B;  2A4Z A;  2PMV A;  4MJS A;  4AQ7 A;  2MSE D;  4YL8 A;  1R4N I;  2KVR A;  4MEM A;  1OQQ A;  5FR3 A;  1GG3 A;  4TQ1 A;  1Q0W B;  4HEA 1;  2GBM A;  2O6V D;  3PS6 A;  2ZNV B;  3N1Y C;  1J7A A;  5D94 A;  5BYQ A;  3NVV A;  4TQ0 A;  1XCT L;  3MC8 A;  1E0Z A;  3HHM A;  1K51 A;  2NBU A;  4XWW A;  4MM3 B;  2C7N B;  1Y56 A;  1SJE D;  3RZF A;  3ZJT A;  4KIK A;  4Q2J A;  5DCN A;  4P1B C;  4MJS B;  2M4N A;  2V3S A;  1P1A A;  3WA0 A;  2FIF A;  2GI9 A;  4IDI A;  1JWS D;  4XZ4 A;  4A3O A;  1BT0 A;  2EMS A;  3IXS A;  2OJR A;  3RNB C;  3V3X A;  2V3N A;  2EEL A;  4ANX A;  1MG8 A;  1EF1 A;  2KVZ A;  1SIF A;  4ZRI A;  1QOG A;  4DXA B;  2D5G A;  4OZB A;  4OVU A;  3IFW B;  2KX0 A;  4GGQ A;  3OLM D;  2LVQ A;  2VZK D;  5CHV C;  1FEH A;  2LAS A;  4YTN B;  1P7F A;  1L0V B;  2ZPN A;  1STE A;  3VTW A;  1TJE A;  4EKU A;  4DDI D;  3Q3N C;  1E8Y A;  1LQB A;  3IBE A;  1V81 A;  1YX5 B;  4RGO S;  3H6N A;  4W9J A;  3Q3M C;  3BWU D;  2M0A A;  2CHW A;  3U7Z A;  1R4M B;  3PHX B;  4NY0 A;  3Q69 A;  4GDL B;  4J3O D;  2PLP A;  3ML8 A;  2QJL A;  1N63 A;  3NUH B;  3DCG A;  2NCN A;  1AYF A;  1ZXH A;  2YEP F;  4TMA B;  2L1A A;  2ZVO A;  1XT9 B;  4HRS A;  3M63 B;  3ZIM A;  2AEH A;  2ZCC A;  3DWG C;  4YWG G;  5D3I B;  3R66 C;  3QIJ A;  4WAF A;  5IN7 A;  4DHZ E;  2HJ1 A;  3PLV A;  1WJ6 A;  3JW0 X;  2ASQ A;  2IDY A;  4AS1 A;  4A8X C;  2L00 B;  1YJJ A;  2FCN A;  2Z8L A;  5MPO A;  4OVZ A;  1RWS A;  4GLS C;  4GU2 A;  1JWM D;  3GE8 C;  3PO0 A;  2KKC A;  4HLE A;  2L52 A;  5C23 A;  3KUZ A;  4LCD E;  1WR6 E;  2PE6 B;  1FIQ A;  4KGT A;  4RF1 A;  1IBX A;  1WJ4 A;  2DZJ A;  3BK2 A;  2NTS A;  3NZ3 A;  3KVF B;  3MC0 B;  3V05 A;  5EDS A;  3A4S C;  3KW5 B;  2WWZ A;  4XWT A;  3IAS 1;  1E6E B;  4OVV A;  5BMH A;  2LUM A;  2ZW1 A;  2AL6 A;  2Z59 B;  4S17 A;  2GMI C;  3H9D A;  2LVO A;  4ASW C;  2DLB A;  1UF0 A;  2YVC A;  5CX3 A;  1ZE3 D;  1JW9 D;  3APD A;  3H1U A;  3N30 A;  2JRI B;  4KGR A;  4KV2 A;  3VUX A;  1RRB A;  2VH1 A;  2GOW A;  4ICV A;  1I7H A;  1IPG A;  4HJG E;  2X8X X;  4WH4 A;  2WQY B;  1HZ5 A;  4AP4 C;  2FE8 A;  2NR2 A;  2M0X A;  3GB1 A;  2WLB A;  3SDL C;  3Q6B A;  2DZK A;  2Y5P A;  1LO5 D;  3DBL B;  4AJY B;  1SE9 A;  2WDQ B;  3H7P A;  1VDV A;  4RNA A;  3VH4 B;  3O13 A;  3P4P B;  2E6X A;  4ZRK A;  2KQ4 X;  1AWD A;  1BML C;  1JCK B;  1A5R A;  3WAM A;  4E3C A;  1P3Q U;  1XEE A;  3KLS X;  5H92 C;  4FUL A;  4GB9 A;  2KHW B;  4K1R B;  3VTU A;  3H7S A;  2LVP A;  4IWO A;  2FUG 1;  1PYW D;  1BUI C;  3ZTC A;  1GPX A;  1YQ4 B;  5BMG A;  1WX7 A;  4DWF A;  4PT5 A;  1ISN A;  2D07 B;  2KYW A;  4FA6 A;  2KJH B;  1Z5S B;  3P63 A;  4C7Z A;  3VQI A;  3W5V B;  2WU5 B;  1WIA A;  2ON8 A;  4REZ A;  1XO3 A;  2N9L A;  3MFG A;  3ZUN A;  1H8C A;  4N59 A;  4CYE A;  1Y8R C;  5E6P A;  3AM9 A;  5H8Y E;  3RN9 C;  3ZJV A;  4WQM A;  3VVW B;  3AUL A;  4FN2 A;  3MP9 A;  3A4R A;  2INC C;  3U2S C;  4MGY E;  4A9A A;  5G2N A;  4LDT D;  5CTR C;  1C9F A;  1P98 A;  2K39 A;  1LM8 B;  2JYE A;  2D3C A;  1MG4 A;  1AN8 A;  3VDZ A;  5L95 C;  3M3J A;  4MDK E;  1MVK A;  1K52 A;  1I4X A;  5J17 A;  3NRZ A;  3Q8F A;  1WI0 A;  2KLG A;  1D5M C;  3PVL A;  3T3O A;  4JWS C;  1ZXI A;  2DX5 B;  4EE2 A;  4RCO A;  2JXX A;  2AX5 A;  3TIX A;  1PGX A;  2WGS A;  4PK1 A;  2O6V A;  5D3D A;  4NAW B;  3W1S A;  3P4R B;  2OOB B;  3ZXR A;  1RM6 C;  4KGS A;  3TBL D;  2G1E A;  3W1S C;  3AE4 B;  3X23 A;  4IWP A;  3VUW A;  1QOB A;  4NNJ B;  5C3J B;  1P9D U;  1ZDV A;  1QOF A;  2JT4 B;  2I2Y A;  5AZG A;  4BFR A;  2W3R A;  3AE5 B;  4RF0 A;  2MW5 A;  1AW7 A;  3EFU A;  2AYO B;  3AED B;  1I4Q A;  2OHF A;  4W9L A;  5AZH A;  2MJ3 A;  3EC8 A;  4F1S A;  5D2M B;  1PDX A;  4BVU C;  2MWS B;  1E7V A;  1SBB B;  1NVI D;  2AQ3 B;  1FXA A;  2K8C A;  2W3S A;  3AEA B;  3RT3 B;  2V4I B;  2AWT A;  3WAO A;  3N20 C;  1WE7 A;  3PZD A;  4FBJ B;  5D6J B;  2JQR B;  2RGF A;  4US8 A;  3AU5 A;  4B0E A;  3A1Q B;  4RFB A;  1RYJ A;  1J7B A;  1P7E A;  4NZL B;  4C80 A;  1YNT E;  3I5J C;  3BVG A;  2NBV B;  3JYU A;  1YN4 A;  2FNJ B;  2G4S A;  2HD5 B;  3P2B A;  2GRI A;  4P6V F;  4E71 A;  2LGI A;  1JRU A;  2PVG C;  4H2A A;  2C7H A;  2JU6 X;  2SAK A;  5IAA C;  2K22 A;  2WXQ A;  5JZE B;  4YTP B;  3L17 A;  3I9V 1;  2WX1 A;  4F7Z A;  1YD8 U;  1JML A;  4WWN A;  1DOI A;  1FD6 A;  3AEB B;  3UIO B;  4K7S A;  1FCL A;  1WXQ A;  5HHD G;  2XK5 A;  3OG5 A;  5FR6 A;  2L05 A;  2DZI A;  1V1P A;  3DBR B;  3GZN B;  2X38 A;  3BZD B;  4HPM B;  2PKO A;  3QA8 A;  2UYZ B;  3CMM B;  3FIL B;  2IO1 B;  2BPS A;  1NEK B;  3AEC B;  3KWV A;  4JGH B;  1N5W A;  2BWE S;  5IA7 A;  2JWU A;  2Y5C A;  4JE3 B;  4US9 A;  1WM2 A;  1FPY A;  2FBW B;  4KZC A;  4HKQ A;  3B08 A;  3B1L X;  1VRA B;  1ZW7 A;  2L83 A;  4HCN B;  1QF6 A;  1I4P A;  5JHA A;  2NPT B;  4USA A;  2M19 A;  2WNM A;  1VCB A;  2M8S A;  3I63 C;  5EE1 A;  4ZDV A;  1WMH A;  4ANU A;  3PRP B;  1B9R A;  3AE6 B;  1T3Q A;  1F0Z A;  2GB1 A;  1WRD B;  2KJR A;  1C78 A;  4IM0 A;  4C4V A;  3N1Z C;  2QEJ C;  3EFC A;  3DVG X;  4C56 C;  4XGA B;  3KH0 A;  1L2N A;  1UNS A;  3AE8 B;  5C2T B;  3QHT A;  5AUK A;  3QAQ A;  2MP2 B;  3ZNI D;  1OTR B;  1FNW A;  2LGD A;  3PLU A;  4G50 A;  4A55 A;  2OED A;  1EM7 A;  2IPK D;  2MQJ A;  1TS4 A;  3CSF A;  4CQN A;  3JSV A;  4UDU C;  2BYT A;  4IM2 A;  2BYF A;  1L6U A;  1L4Z B;  1SSN A;  3L0W B;  3DBH I;  4HK2 A;  1ESF A;  3QAR A;  3Q8B A;  1IYF A;  3VHT C;  4DXF A;  1KLU D;  4TSS A;  4KDI C;  4I6L B;  2N9P C;  1RLF A;  3APC A;  3VRB B;  4HJK A;  2BW2 A;  5BYS A;  2UWQ A;  3T3N A;  2G9H D;  1KOT A;  4N6E B;  2J0M A;  1YJ1 A;  2IY1 B;  3M95 A;  3ZDT A;  3W5U B;  3A33 B;  1V1O A;  3R3M A;  4EZJ A;  3EGR A;  4KKJ A;  2WX0 A;  2BWF A;  1V86 A;  3UF8 A;  1EU4 A;  3B9J A;  3A9K A;  1JRP A;  4HPP A;  3RMK C;  4YT0 B;  3Q2A C;  3LYY A;  2RPQ A;  3SD5 A;  2MCN B;  4GDK A;  2N9K A;  4MH8 A;  2MLB A;  2K9X A;  1VZ7 A;  1HZ6 A;  2KN4 A;  1TGZ B;  4PS7 A;  5GMV A;  2ZW0 A;  5AUI A;  1EWC A;  3AE9 B;  2Z0D B;  3EEC A;  2D3B A;  2B76 B;  1MPE A;  3R8B A;  5IKC M;  3B2G A;  4RM8 A;  3I57 A;  3IVF A;  2K8B A;  2WXG A;  4DHJ B;  2NMQ A;  4KIK B;  2WP9 B;  1T0Y A;  1X1M A;  2KTR A;  2FUH B;  4GDK B;  3PV1 A;  2N1W A;  4II3 B;  1LXD A;  2RDB C;  3Q3J A;  5L83 A;  1WZ0 A;  2QIL A;  1I4G A;  2IZV B;  1NI3 A;  5LLI A;  1TKG A;  2G45 B;  2JX5 A;  1WXM A;  4EZL A;  3P4Q B;  4YSX B;  1PFD A;  1HXY D;  1TS3 A;  2LFI A;  3O65 B;  4A20 A;  1EWY C;  1I4R A;  3DHG C;  5J18 A;  1F77 A;  4XC2 A;  2RDH A;  1V80 A;  4M0W A;  3Q14 C;  2IBI B;  4G0N B;  4K7U A;  4PYU A;  4FJZ A;  1E9M A;  1V9J A;  4RGN A;  1UWX A;  1VZ6 A;  4RM9 A;  1JAL A;  2PVO D;  2KAC A;  1Q1O A;  4HRO A;  3KUC B;  3CIR B;  1WM3 A;  1YMH E;  3DHH C;  1XQQ A;  4C00 A;  4O1N A;  4NJC A;  1IUE A;  3X0W A;  5E6J A;  2Y5B B;  2M1M A;  4ANW A;  3AH7 A;  3BYY B;  2H88 B;  3AE7 B;  3MHS D;  1SE4 A;  2IND C;  2K25 A;  3HIZ A;  4WJO A;  3RPF C;  3MTN B;  2CHX A;  3PRM B;  4LNN A;  3V6E B;  3T9L A;  2RMM A;  1F52 A;  4DQO C;  2OJW A;  2L0F A;  5JH5 C;  3ALB A;  2Z0E B;  3V61 A;  4JL9 A;  1L5P A;  4W9E A;  4ZOH C;  1MHH E;  3Q8C A;  3UI3 A;  2WXL A;  1V6E A;  2K3U A;  2JF5 A;  3BVM A;  4WJQ A;  3UIN B;  1UUP A;  1XLN A;  1GUA B;  4W9K A;  4L2Y A;  4WQO B;  4XE0 A;  1SF0 A;  5TR5 A;  2LGS A;  2M17 A;  4K3C A;  1JRO A;  2KWV B;  1IBX B;  1IGC A;  3ZJU A;  1AAR A;  2MRP A;  1E8W A;  2LRW A;  5CHW A;  2LMC A;  3MJW A;  2N7J A;  2BB5 A;  2KMC A;  4M00 A;  2BGF A;  3HUI A;  2BVC A;  2BS2 B;  4URK A;  2KDM A;  4M01 A;  4WJN A;  1I42 A;  3OWE B;  2KXJ A;  2HE7 A;  1XD3 B;  2CJO A;  2AQ2 B;  2MBQ A;  1WJN A;  1L0Y B;  4NJ6 A;  4RGM A;  2WDV B;  3ZW3 A;  1QT9 A;  4MGZ E;  4C7Y A;  1MHX A;  3RD2 A;  3MC9 A;  2G3Q B;  3NY5 A;  1WXS A;  1C4A A;  1GNU A;  2LXA A;  4IKG A;  2XNA C;  1V2Y A;  2QCZ A;  4WJP A;  2BKR B;  1SXT A;  2HDE A;  3TEZ A;  2WHI A;  3IT4 B;  1WGG A;  4I6N B;  4ARC A;  2CHZ A;  1I35 A;  1T0S C;  3TSS A;  3NVY A;  3H7P B;  4S0R A;  2MHJ A;  3EUB 2;  2K6Q A;  4ZHO A;  3BY4 B;  4KDL B;  3ZQ4 A;  1GB4 A;  3ONS A;  1HA5 A;  4QAY A;  1WGR A;  5LXI B;  1WGY A;  3K9P B;  4WWP A;  3BK1 A;  4HXD A;  1YX6 B;  4DHZ B;  1ZUD 2;  3PGE A;  5G5H A;  1KRH A;  2IJ0 A;  3ECI A;  4MAC A;  2EKE C;  3NVW A;  1Z2M A;  4IWQ A;  3DWM A;  1UH6 A;  4OZA A;  2MBB B;  3P42 A;  3VR8 B;  1C76 A;  3LXF A;  4OZC A;  1QIL A;  2W55 A;  4YTM B;  3AE1 B;  1HTO A;  3FKY A;  3NJT A;  2HJ8 A;  5HKH A;  2KNB A;  2BT6 A;  3QX1 A;  4RH6 A;  2QC8 A;  4CO7 A;  1WH3 A;  2JVC A;  1SIJ A;  1T5X D;  4A6Q A;  2CKH B;  4WWM A;  3W9C B;  1DOY A;  4DK5 A;  4EUT A;  1ACC A;  3PRE A;  1NYR A;  2J42 A;  2LJ5 A;  1HEZ E;  5TSS A;  1G6J A;  4YXD B;  1EF5 A;  3RNA C;  2KX3 A;  2A5U A;  5IO9 A;  2DYM A;  1J7C A;  1TKE A;  2DWQ A;  1HE8 A;  4GSW A;  3Q8E A;  2C60 A;  1KM7 A;  1WX9 A;  2LGX A;  1N61 A;  1J8C A;  3EA6 A;  2KFK A;  4HKZ E;  2MX2 A;  1MI0 A;  2O6V B;  3DHI C;  4ARI A;  2PIA A;  4ACF A;  1VLB A;  3IHP C;  3GOE A;  3E56 A;  1JWA D;  3VXW A;  3BIN A;  1WXV A;  1UBI A;  1YN5 A;  1WR1 A;  2BQQ A;  1WRI A;  1XLO A;  2L7R A;  3IT6 B;  3GS2 A;  2NBW B;  4HWI B;  2N9X A;  5AEK B;  3ZLZ A;  2KAN A;  2O2V A;  4M8N A;  2ZPY A;  2R61 A;  3N3K B;  3PSE B;  4J6I A;  4WAA A;  2JUO A;  3ZNG C;  2WXP A;  5DPW A;  2KC2 A;  1WGH A;  1FMA D;  2KZR A;  3RUL A;  3RNG C;  4JWU C;  1N62 A;  2LHD A;  3R7R A;  1MJD A;  2VZK B;  2KDE B;  3RI7 C;  3A9J A;  4LNI A;  4NJ7 A;  4BBN F;  2ZVN A;  3B2F A;  3RFZ B;  2KD0 A;  4LJP B;  3Q3O C;  2J4X A;  2TSS A;  1WY8 A;  2XEW A;  2FCS A;  1D4B A;  4BAX A;  2PEA A;  4ZRP A;  2N0S B;  1V5T A;  3AEF B;  1E10 A;  2NS5 A;  1V8C A;  2JZZ A;  1C3T A;  4NQK E;  3AMZ A;  2K8H A;  4B95 A;  4HPL B;  1UWM A;  1LFD A;  3RCZ A;  2BKF A;  3PT2 B;  2PPH A;  2MBO A;  3NOB A;  3PTF C;  1CMX B;  3QJZ A;  2JYT A;  3SHQ A;  1EU3 A;  1GAQ B;  1XXG A;  3ZO5 B;  1QKZ A;  3UGB B;  4W9C A;  2FCQ A;  4KKI A;  1VD2 A;  1VR9 A;  1T0R C;  2BTE A;  5G55 A;  1EO6 A;  2XK5 B;  1PQS A;  2J0K A;  3ENE A;  3Q8A A;  4W9G A;  3QQ8 B;  1V1P B;  2V1Y A;  2K5P A;  4ANV A;  3NS1 A;  1WJU A;  3GE3 C;  1FXT B;  3GP7 A;  5FKA C;  3W1Y A;  2EMT A;  1V97 A;  1CJE A;  4BKS D;  2JSV X;  2IGD A;  2WYQ A;  4LNF A;  4KX6 B;  3DVN V;  1E8X A;  3DPD A;  5HI1 A;  2WXR A;  2MA9 B;  2J52 A;  3RZW C;  1XCQ L;  3FAH A;  4L1B A;  2FCM A;  5DPR A;  1KF6 B;  1PUT A;  4GXB A;  4XX5 A;  2QDF A;  2KAJ A;  5BMI A;  1XLP A;  3LB8 C;  1ZGU B;  1ZDX A;  4AJW A;  2PW9 A;  1WMH B;  2KWC A;  3UIP B;  2WXO A;  1ENF A;  5CHF A;  4K7W A;  1JWU D;  3L08 A;  4BKT A;  5JXV A;  4W9D A;  1TKY A;  1FXI A;  1KLG D;  2DYO A;  3M62 B;  3TL5 A;  4C4V B;  1ZKH A;  3APF A;  2C9W B;  4TV3 A;  5HG2 A;  3WAP A;  5G5G A;  4KVG B;  4WWO A;  3TCA A;  2PE9 A;  3PZ7 A;  4BZA A;  1CQV A;  1VJK A;  3ZGZ A;  3AB5 A;  3R2I A;  2HTM E;  3SR6 A;  4D2K A;  3DVG Y;  4B9K A;  4FXC A;  3TEY A;  2D3G A;  3CF6 E;  3ZXV A;  3JSV B;  1L0X B;  3IG3 A;  2G4D B;  5D7G A;  2D10 A;  4FJV B;  2ZNV C;  3W2D A;  2WDR B;  4FHJ A;  4KZ0 A;  2J7Q B;  2M56 B;  3NS8 A;  1IP9 A;  3KUD B;  2H89 B;  1PGA A;  1D3Z A;  4M8M A;  3N32 A;  2BS4 B;  2KN5 A;  2AQ1 B;  2BS3 B;  1WF9 A;  3MJ5 A;  2QHO A;  3ZRF A;  3HVD A;  3PHW B;  1NI2 A;  4R3D A;  2PJH A;  2I38 A;  1R7S A;  2MEK A;  4RGT A;  1UD7 A;  1TIF A;  3DBH B;  1WFY A;  2KMA A;  1B1Z A;  2KDF B;  1WX8 A;  3VR9 B;  2WXK A;  4GOC A;  4ZYS A;  3BII D;  1DGJ A;  2JRH A;  2MJE A;  1R4M I;  3WAL A;  1TY0 A;  3ETR A;  1A70 A;  2WU2 B;  5BYR A;  3T8M A;  2E3T A;  2AL3 A;  3A9K B;  1TBE A;  1F9J A;  3ZNH B;  1OQY A;  3C0R B;  1OQR A;  1R4N B;  3RNE C;  5J2R A;  4LDT B;  1ROE A;  5I4D A;  4WIP A;  2C5L C;  4JX1 C;  1CK1 A;  1FM0 D;  4XYC A;  2I1K A;  3KQ4 A;  5DPS A;  2ZCB A;  3KYC D;  2SEB D;  4GDL A;  3WAN A;  1FO4 A;  4K3B A;  2JZP A;  3SEB A;  1GC7 A;  1KLV A;  1FFU A;  2IO2 B;  4MH0 E;  2CJN A;  2GBR A;  2KTR B;  2WXF A;  4P16 A;  4ICU A;  4P1C C;  3TMP B;  3U52 E;  2DEN B;  2KWD A;  3RNC C;  1RAX A;  2QMT A;  2LXC A;  3ABV B;  5KHO A;  3HM3 A;  2JPH A;  2N7E A;  1DYQ A;  1IGD A;  4IC7 B;  3HK0 A;  1J19 A;  2D3A A;  2KDB A;  1TZO A;  2LI5 A;  2N7D A;  3S2A A;  1F2R I;  1SB3 C;  3L16 A;  1P0R A;  2IGH A;  4LNK A;  4M0W B;  5E6N A;  4E74 A;  3ZNZ B;  2INP E;  5DPT A;  1WYG A;  2RD0 A;  1MFW A;  1ZOY B;  2WS3 B;  4MT5 A;  4K81 A;  5KHQ A;  4JIO U;  2RDG A;  1OGW A;  2LHE A;  4G3X B;  4OW0 A;  2ACZ B;  2CR5 A;  2LWP A;  1T6B X;  1C4P A;  3L10 B;  4JQW C;  2CU3 A;  2NVU I;  1T0Q C;  1SJH D;  1YQB A;  2VRR B;  1LGR A;  2V3P A;  3OJ4 B;  3TEX A;  3LJ3 A;  2V9H A;  4CHK A;  2RSU A;  3DOW A;  4YSZ B;  1GC6 A;  4IW0 A;  1F2R C;  2J0J A;  2ONQ A;  2KMM A;  4OHJ A;  4ZYN A;  2GBK A;  2IYD B;  3DBL I;  5FK9 C;  3NZU A;  3UQA A;  1FRD A;  5LNK 1;  3K9O B;  2L32 A;  3E9S A;  2YEP B;  2INN E;  2VH2 A;  4KSL C;  1K53 A;  1FNV A;  2GLS A;  3BYT B;  4GMV A;  1S1Q B;  1EUV B;  2N1V A;  4A90 A;  1JWB D;  4AOF A;  2QIE B;  4TUU A;  2WXJ A;  2KK8 A;  3VRA B;  3RNF C;  2MH7 A;  2GBJ A;  4AWJ A;  2WDT B;  3J9C A;  1WGK A;  1NEN B;  3CST A;  4ZRQ A;  3V62 A;  4EFO A;  2BBC A;  3EHV A;  4L23 A;  2JY6 A;  2KWU B;  1E90 A;  3Q3F A;  2MJD A;  4BKS A;  1C77 A;  1ET6 A;  4NPN A;  3QC8 B;  4AUQ C;  4IM3 A;  1WSP A;  5T8I A;  1WZ3 A;  1J0G A;  2CU1 A;  2LZ6 A;  1N60 A;  2R2Q A;  4JLC A;  3QWZ B;  3NG0 A;  4HCP B;  1D6E C;  2BYE A;  1UZX B;  1WXA A;  3DDC B;  3DQV A;  1V5O A;  3C8Y A;  4X57 B;  3AV8 A;  4FJY A;  2ZZP B;  2WXI A;  1L4D B;  3ZRC A;  4LNO A;  4B0M A;  3ZYY X;  2KO3 A;  3ZDM C;  4LLG M;  2XN9 C;  4MSQ B;  2XBB C;  3SU8 X;  2DYB A;  3U30 A;  1VZ8 A;  4FAD A;  4ZHP A;  2WXN A;  2LEK A;  1E5W A;  3I3T B;  4MGI E;  2LRU A;  2ZJD A;  3TJP A;  1GOZ A;  4M02 A;  3R7Q A;  3VUY A;  3U7D A;  1UGM A;  2K6D B;  3HRD D;  3H8H A;  2WXM A;  3B0A A;  2LUE A;  4MSM B;  2JZ3 B;  2KDI A;  4NQL B;  3PPA A;  1C1Y B;  4DHJ D;  2V4L A;  3BVZ A;  1YOV B;  3VH3 B;  4NAW A;  2Q5W D;  2LGY A;  2ZEQ A;  4PS3 A;  2UU7 A;  1XF5 L;  1HQR D;  5EE3 A;  2KJ6 A;  3AU4 A;  3C19 A;  4XDC A;  5BO4 B;  4IG7 B;  3AI5 A;  2KOX A;  1V49 A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  2Z59 B;  5G55 A;  2GMI C;  1EO6 A;  2LVO A;  1PQS A;  2MLB A;  2XK5 B;  3H9D A;  4ASW C;  2J0K A;  2LD9 A;  1U4A A;  3ENE A;  4W9G A;  3QQ8 B;  1TGZ B;  3DVN U;  2V1Y A;  4PS7 A;  4HVB A;  5GMV A;  4ANV A;  2YVC A;  5CX3 A;  4BOS C;  1WJU A;  3APD A;  1FXT B;  3H1U A;  3N30 A;  2Z0D B;  2JRI B;  4KV2 A;  4DDG D;  3OAW A;  3EEC A;  2EMT A;  3VUX A;  4MGK E;  3W1Y A;  4BKS D;  4W9F A;  1RRB A;  2WYQ A;  2GOW A;  1E8X A;  3DVN V;  3DPD A;  4ICV A;  4RM8 A;  4HDO A;  3IVF A;  2K8B A;  4DHJ B;  1IPG A;  2MA9 B;  4KIK B;  3VTV A;  4KSK C;  1T0Y A;  3RZW C;  1X1M A;  2KTR A;  2FUH B;  2FCM A;  5DPR A;  4GDK B;  3PV1 A;  1L7Y A;  4GXB A;  4XX5 A;  4AP4 C;  2N1W A;  4II3 B;  2FAZ A;  2NR2 A;  2M0X A;  1LXD A;  4B6W A;  3SDL C;  3Q3J A;  5L83 A;  1ZGU B;  2DZK A;  4AJW A;  1WZ0 A;  1WMH B;  5LLI A;  2IZV B;  2KWC A;  2REX A;  3A1Q A;  1SE9 A;  3UIP B;  2G45 B;  4AJY B;  3PRZ A;  3H7P A;  5CHF A;  1WXM A;  3ZTD A;  4K7W A;  2KFK B;  4EZL A;  2L0T A;  3VH4 B;  3L08 A;  4BKT A;  3O65 B;  4A20 A;  1Q5W B;  4W9D A;  4ZRK A;  1RFA A;  2DYO A;  3M62 B;  5J18 A;  3DBR I;  3GZN I;  1ZKH A;  3TL5 A;  4XC2 A;  3APF A;  1WYW B;  2C9W B;  3HM6 X;  4TV3 A;  1A5R A;  1V80 A;  3WAP A;  2IBI B;  2K1F A;  3WAM A;  4KVG B;  4E3C A;  4WWO A;  1P3Q U;  3TCA A;  2PE9 A;  4G0N B;  4FUL A;  4K7U A;  4GB9 A;  4PYU A;  2KHW B;  4FJZ A;  4K1R B;  1V9J A;  3VTU A;  2R2O A;  3H7S A;  2LVP A;  4IWO A;  4RM9 A;  1TTN A;  2MBH A;  3ZTC A;  1Q1O A;  3KUC B;  5C1Z A;  3DVG Y;  4B9K A;  1WX7 A;  1WM3 A;  4DWF A;  2D2Q A;  2YLM A;  1ISN A;  1XQQ A;  4W9H A;  2D3G A;  3CF6 E;  2O2V B;  3JSV B;  4FLH A;  2D07 B;  4FA6 A;  3IG3 A;  2KJH B;  1Z5S B;  2G4D B;  3X0W A;  4G11 A;  5D7G A;  3LDZ E;  2Y5B B;  2D10 A;  3VQI A;  1WIA A;  2M1M A;  4FJV B;  4LJO B;  1UBQ A;  3ZUN A;  4ANW A;  3UQB A;  1H8C A;  4CYE A;  1Y8R C;  2ZNV C;  3MHS D;  5E6P A;  1NBF C;  3VFK A;  1E8Z A;  3ZKJ C;  2C7M B;  4FHJ A;  1NDD A;  2K25 A;  3HIZ A;  2L8J A;  2J7Q B;  4KZ0 A;  4WJO A;  3VVW B;  3NS8 A;  3MTN B;  3AUL A;  4FN2 A;  5JHB A;  1IP9 A;  3KUD B;  2CHX A;  3A4R A;  3A9J B;  3PRM B;  1D3Z A;  3V6E B;  4M8M A;  3T9L A;  3N32 A;  2KN5 A;  4MGY E;  5JH5 C;  1WF9 A;  2L0F A;  2QHO A;  5G2N A;  3ALB A;  3PHW B;  2Z0E B;  4LDT D;  3ZRF A;  5CTR C;  4JL9 A;  3V61 A;  1NI2 A;  1P98 A;  4PS8 A;  4W9E A;  2PJH A;  2IO0 B;  1LM8 B;  2K39 A;  2NPT A;  2DAJ A;  4BKG A;  4PYZ A;  1V6E A;  1WE6 A;  3VDZ A;  5L95 C;  2JF5 A;  3M3J A;  4MDK E;  3AXC A;  1UD7 A;  2FID A;  2N4F A;  5J17 A;  1WFY A;  4WJQ A;  2KMA A;  3UIN B;  5E6O A;  4BBN C;  1WI0 A;  4W9I A;  2KLG A;  3PVL A;  2DX5 B;  2KDF B;  1WX8 A;  1GUA B;  2KQ7 A;  4W9K A;  2N9E B;  2KQS A;  2JXX A;  3TIX A;  4WQO B;  4GOC A;  3RYT A;  3U8Z A;  2O6V A;  5TR5 A;  2JRH A;  2M17 A;  1R4M I;  3ML9 A;  3VAW A;  3WAL A;  1UEL A;  4NAW B;  4EOY A;  2KWV B;  3W1S A;  1AAR A;  2MRP A;  2OOB B;  3T8M A;  1E8W A;  2LRW A;  2AL3 A;  3TBL D;  2KLC A;  3A9K B;  1TBE A;  3W1S C;  5CHW A;  2L3Z A;  1F9J A;  3MJW A;  3X23 A;  3ZNH B;  1OQY A;  4IWP A;  2L76 A;  3VUW A;  4NNJ B;  2MP2 A;  3C0R B;  2KMC A;  2BGF A;  5J2R A;  1P9D U;  4LDT B;  2W9N A;  4GN1 A;  2C5L C;  2JT4 B;  4URK A;  2DHZ A;  1SGH A;  5AZG A;  4BFR A;  4WJN A;  3QK0 A;  2I1K A;  1I42 A;  5DPS A;  2D11 A;  2KXJ A;  3NZS A;  1KJT A;  2HE7 A;  1XD3 B;  2ZCB A;  2MW5 A;  3KYC D;  3EFU A;  2AYO B;  1K8R B;  2MBQ A;  1YIW A;  4MEL A;  4GDL A;  2DZM A;  3WAN A;  4W9L A;  5AZH A;  1WJN A;  3EC8 A;  4F1S A;  4NJ6 A;  5D2M B;  2MBE A;  3ZW3 A;  4MGZ E;  2HTH A;  4BVU C;  4F8C B;  2MWS B;  1E7V A;  3RD2 A;  3OJ3 A;  1GC7 A;  2G3Q B;  3L54 A;  1KLV A;  2BF8 B;  2IY0 B;  3NY5 A;  2IO2 B;  4MH0 E;  3DBS A;  1WXS A;  1GNU A;  2GBR A;  2DAF A;  2K8C A;  2KTR B;  2KFJ A;  4EZK A;  2LXA A;  3RT3 B;  1V2Y A;  2AWT A;  2RR9 A;  4P7I A;  4WJP A;  3WAO A;  2BKR B;  4ICU A;  1E7U A;  4ZRJ A;  4EEW A;  3TMP B;  4I6P A;  2DEN B;  1WE7 A;  3PZD A;  1RAX A;  1WGG A;  3L13 A;  4I6N B;  1M94 A;  4IUM B;  1GJZ A;  4FBJ B;  5D6J B;  2LXC A;  2RGF A;  2CHZ A;  1WGD A;  3AU5 A;  5KHO A;  1I35 A;  2KTF A;  3A1Q B;  3HM3 A;  5AZF A;  3ZVV A;  1QZE A;  2JPH A;  3H7P B;  3KYD D;  4TKN A;  2N7E A;  2B3A A;  2K6Q A;  4N9F 4;  2BYV E;  2NBV B;  3JYU A;  2G4S A;  2FNJ B;  2GBN A;  2HD5 B;  3BY4 B;  3HK0 A;  1J19 A;  4IC7 B;  3P2B A;  4A3P A;  4E71 A;  3JVZ X;  4KDL B;  4HDQ A;  3WIM A;  3ONS A;  2KDB A;  1JRU A;  1WGR A;  2LI5 A;  4DBG A;  2N7D A;  3QCA A;  1S3S G;  3S2A A;  2C7H A;  4FHK A;  3L16 A;  5LXI B;  4II2 B;  2JWZ A;  1H4R A;  1WGY A;  1P0R A;  3K9P B;  2KC1 A;  4M0W B;  2I1J A;  4WWP A;  4BOZ B;  1OEY A;  5E6N A;  4E74 A;  4RMA A;  5IAA C;  5DPT A;  3ZNZ B;  4HXD A;  1YX6 B;  2IO3 B;  4DHZ B;  2RD0 A;  5JZE B;  3L17 A;  2CS4 A;  4GIV A;  3PGE A;  2WX1 A;  4F7Z A;  4K81 A;  5KHQ A;  3D32 A;  1YD8 U;  4JIO U;  4G3X B;  1OGW A;  3ECI A;  3RUI B;  4WWN A;  3NHE B;  4MM3 A;  2CR5 A;  3V60 A;  1OEY J;  2LWP A;  1TZ1 A;  2EKE C;  3L10 B;  4JQW C;  1Z2M A;  4IWQ A;  3UIO B;  2NVU I;  4K7S A;  3V6C B;  1UH6 A;  2A4Z A;  4MJS A;  2MBB B;  2MSE D;  4YL8 A;  1YQB A;  1R4N I;  2VRR B;  3OJ4 B;  2XK5 A;  2KVR A;  4MEM A;  3LJ3 A;  5FR6 A;  2L05 A;  2DZI A;  4CHK A;  1GG3 A;  2RSU A;  4TQ1 A;  1Q0W B;  3DOW A;  2HJ8 A;  5HKH A;  2GBM A;  2KNB A;  2UYZ B;  3QA8 A;  1GC6 A;  2O6V D;  3QX1 A;  4HPM B;  2J0J A;  2ZNV B;  3CMM B;  3PS6 A;  4IW0 A;  4ZYN A;  2GBK A;  2IO1 B;  2IYD B;  3DBL I;  4CO7 A;  1WH3 A;  2BPS A;  2JVC A;  5D94 A;  3NZU A;  2CKH B;  4TQ0 A;  3UQA A;  4JGH B;  3HHM A;  3K9O B;  2NBU A;  4DK5 A;  2BWE S;  4EUT A;  3PRE A;  5IA7 A;  2C7N B;  3RZF A;  4KIK A;  5DCN A;  4KSL C;  1WM2 A;  2LJ5 A;  4KZC A;  3B08 A;  3B1L X;  4MJS B;  1G6J A;  1ZW7 A;  1EF5 A;  4GMV A;  4HCN B;  2KX3 A;  2M4N A;  2V3S A;  1P1A A;  2A5U A;  5JHA A;  2NPT B;  1S1Q B;  3WA0 A;  2DYM A;  2FIF A;  1EUV B;  2N1V A;  4XZ4 A;  1HE8 A;  1VCB A;  4GSW A;  4A3O A;  1BT0 A;  2EMS A;  4AOF A;  2M8S A;  4TUU A;  2OJR A;  2C60 A;  2KK8 A;  1KM7 A;  1WX9 A;  4ZDV A;  1WMH A;  2LGX A;  2GBJ A;  4ANU A;  4AWJ A;  1J8C A;  2WDT B;  4ANX A;  3PRP B;  1MG8 A;  1EF1 A;  2KFK A;  1SIF A;  4ZRI A;  1WRD B;  2KJR A;  3CST A;  4DXA B;  3V62 A;  4EFO A;  4OVU A;  2MX2 A;  3IFW B;  2O6V B;  3EHV A;  2JY6 A;  2KX0 A;  2KWU B;  1E90 A;  2LVQ A;  3OLM D;  4GGQ A;  4IM0 A;  3Q3F A;  5LXH A;  3IHP C;  5CHV C;  4BKS A;  2LAS A;  3DVG X;  3GOE A;  4NPN A;  3QC8 B;  4AUQ C;  3KH0 A;  4IM3 A;  1L2N A;  3VXW A;  3BIN A;  2ZPN A;  1WXV A;  3VTW A;  3QHT A;  1UBI A;  4EKU A;  1WR1 A;  1WZ3 A;  4DDI D;  3QAQ A;  2MP2 B;  3ZNI D;  1E8Y A;  2L7R A;  1LQB A;  1OTR B;  3IBE A;  2CU1 A;  1J0G A;  2LGD A;  3PLU A;  4G50 A;  1V81 A;  1YX5 B;  2LZ6 A;  2NBW B;  4HWI B;  3H6N A;  2N9X A;  2R2Q A;  2MQJ A;  5AEK B;  4W9J A;  4JLC A;  3CSF A;  3QWZ B;  3ZLZ A;  2CHW A;  2KAN A;  2O2V A;  3JSV A;  4HCP B;  4M8N A;  3PHX B;  4NY0 A;  4IM2 A;  2ZPY A;  2BYF A;  2BYE A;  4GDL B;  1UZX B;  3N3K B;  3ML8 A;  3PSE B;  4J6I A;  4WAA A;  1WXA A;  2JUO A;  3ZNG C;  3DDC B;  3DQV A;  1V5O A;  3L0W B;  5DPW A;  2KC2 A;  3DBH I;  4HK2 A;  3DCG A;  1WGH A;  2NCN A;  2KZR A;  4X57 B;  3RUL A;  4FJY A;  2ZZP B;  2ZVO A;  1XT9 B;  3M63 B;  3R7R A;  3QAR A;  3ZRC A;  3ZIM A;  2AEH A;  2ZCC A;  1IYF A;  2KDE B;  3VHT C;  2KO3 A;  3ZDM C;  4KDI C;  3A9J A;  4NJ7 A;  4BBN F;  4I6L B;  3R66 C;  2N9P C;  1RLF A;  2ZVN A;  2XBB C;  3APC A;  3QIJ A;  4MSQ B;  4HJK A;  2KD0 A;  3SU8 X;  2DYB A;  3U30 A;  4DHZ E;  4LJP B;  2UWQ A;  4FAD A;  1WY8 A;  3PLV A;  1WJ6 A;  2XEW A;  3JW0 X;  2ASQ A;  2FCS A;  1E5W A;  1KOT A;  2J0M A;  1YJ1 A;  2PEA A;  3I3T B;  2IY1 B;  1V5T A;  3M95 A;  2L00 B;  4MGI E;  2LRU A;  3ZDT A;  2FCN A;  2NS5 A;  2ZJD A;  3TJP A;  2JZZ A;  3A33 B;  1C3T A;  4GU2 A;  4NQK E;  3R7Q A;  3VUY A;  2K8H A;  3U7D A;  4B95 A;  2KKC A;  1UGM A;  2K6D B;  3R3M A;  4HPL B;  4EZJ A;  1LFD A;  4HLE A;  3RCZ A;  2BKF A;  3B0A A;  5C23 A;  2LUE A;  3KUZ A;  3PT2 B;  4MSM B;  2JZ3 B;  4LCD E;  2KDI A;  4NQL B;  3PPA A;  1C1Y B;  2BWF A;  2PPH A;  2WX0 A;  2MBO A;  1WR6 E;  2PE6 B;  3NOB A;  3PTF C;  2V4L A;  4DHJ D;  1CMX B;  3QJZ A;  3VH3 B;  1V86 A;  4NAW A;  3SHQ A;  1WJ4 A;  3UF8 A;  2LGY A;  2DZJ A;  2ZEQ A;  4PS3 A;  3ZO5 B;  3A9K A;  3KVF B;  3UGB B;  4W9C A;  2FCQ A;  2KJ6 A;  5EDS A;  3A4S C;  3AU4 A;  3KW5 B;  2WWZ A;  1VD2 A;  4IG7 B;  5BO4 B;  3AI5 A;  2RPQ A;  3SD5 A;  4OVV A;  2MCN B;  2KOX A;  4GDK A;  1V49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...