2AWTA

Solution structure of human small ubiquitin-like modifier protein isoform 2 (sumo-2)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
95
structure length
95
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Small ubiquitin-related modifier 2
publication title Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
rcsb
source organism Homo sapiens
total genus 9
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2awtA00
1PQSA 4ICVA 4NQLB 1Y8RC 1WGGA 3DVGX 2N1WA 3O65B 4W9LA 2NS5A 4ZDVA 2FIDA 4MSMB 1E8XA 3QIJA 3L0WB 3K9OB 2KX0A 2MWSB 3T9LA 3HM3A 2N7DA 3JVZX 4LJPB 3KVFB 2M17A 5DPTA 1IYFA 2MRPA 5CHWA 3H7SA 3PLUA 2L8JA 3NS8A 2IZVB 2LVQA 2KNBA 1C1YB 4E71A 1WXSA 1LXDA 2EMTA 4HCNB 3A4RA 4GN1A 2CHXA 4PS3A 2PPHA 1SIFA 2K25A 3ONSA 4FHKA 3M63B 1UZXB 2FCSA 1WRDB 2DZMA 2KDIA 3AXCA 4G0NB 1H8CA 2C7MB 2LVOA 2NVUI 3MHSD 3NZSA 3VTUA 1E5WA 2JVCA 2V4LA 2L7RA 2M1MA 4B6WA 4LCDE 4WWNA 1Z2MA 1WFYA 2OOBB 1K8RB 3VTWA 4HCPB 4HDQA 3BINA 4EZKA 3B08A 1WMHB 3IFWB 2LRUA 2Z0EB 1H4RA 2KN5A 3OLMD 3EC8A 4HWIB 4NY0A 1V6EA 3PHXB 2AL6A 2V1YA 1AARA 2LI5A 2LJ5A 1GG3A 2LUEA 1NI2A 3L08A 4F8CB 1XT9B 2JXXA 3WAOA 1I42A 4MJSA 1LM8B 2ZVNA 3RCZA 2VRRB 3RD2A 3RYTA 4JQWC 4K7UA 4A3PA 4BKGA 3UQBA 3DPDA 2LXCA 4IWPA 4K1RB 1TZ1A 2CR5A 2N9PC 3CF6E 2BGFA 4ZYNA 2J0KA 1GC6A 1WIAA 1WX9A 4FADA 2D07B 3M62B 3AU5A 4FJYA 1EO6A 2MA9B 4KIKB 5KHOA 3R66C 1R4NI 4I6NB 1KM7A 3S2AA 4II2B 2UWQA 2J7QB 3V62A 4BBNC 2BYFA 4NAWB 2DYMA 4CO7A 3HIZA 3ML8A 4K7WA 3A1QB 3UF8A 5D6JB 1OQYA 1Q1OA 5D2MB 3ZRFA 2IO3B 2L3ZA 3W1YA 2KQ7A 4IUMB 4MDKE 2Z59B 5AZHA 2EKEC 2HE7A 4HLEA 1WY8A 3EHVA 1V2YA 4B95A 3GOEA 3TIXA 3QA8A 3UQAA 1SE9A 4LDTB 3DBLI 4TUUA 4NJ6A 2MSED 2A5UA 3HM6X 4BKSD 3V61A 2DENB 4MSQB 2KX3A 3ALBA 2J0MA 5C1ZA 1ZGUB 4MGKE 3APCA 3WA0A 1YJ1A 3P2BA 3OJ3A 2LGYA 5DPRA 2FNJB 4AP4C 2JUOA 3OAWA 5AZFA 3CSTA 5G2NA 1P9DU 4FA6A 1WGDA 2KK8A 1YX5B 5JHAA 3DBHI 1WGRA 2WDTB 4TKNA 3VTVA 2JRHA 3WAMA 1WH3A 1WJNA 4BKSA 3X23A 2LGDA 2K6QA 1U4AA 3A4SC 3KYCD 4FJZA 4M8MA 3LDZE 2K6DB 2KJRA 4WJNA 5L95C 1F9JA 3ZTDA 5C23A 3WAPA 2JZ3B 3QJZA 2MCNB 4KSLC 2KLCA 1EF1A 2Z0DB 5CTRC 2M8SA 4LDTD 4NAWA 2D11A 3ZNHB 3VQIA 2KWCA 3DDCB 2DAFA 3L16A 2K1FA 2CKHB 3A1QA 4LJOB 2JY6A 2JRIB 4N9F4 4W9GA 2BPSA 1V49A 3KUDB 1Q0WB 4W9KA 4W9HA 4BOSC 1E7VA 3VH3B 4IG7B 4MEMA 3SD5A 3L13A 4F1SA 3TMPB 3HK0A 2MBOA 4DDID 1V86A 2GBRA 3AULA 4W9DA 3A33B 2K8CA 3KYDD 4X57B 2CU1A 2I1KA 4I6LB 3W1SC 2KC1A 2KWVB 4M0WB 2KXJA 2KTFA 3C0RB 4G11A 1WX7A 1OEYA 2AYOB 5CHVC 2BKRB 4WAAA 3IHPC 2LVPA 3NOBA 3KH0A 3PSEB 4MGYE 2NCNA 2N1VA 2ZJDA 1WE7A 3U7DA 2MBBB 4DHZE 1I35A 5E6OA 1P3QU 2N4FA 5G55A 2AEHA 4ANVA 1YIWA 4NJ7A 3SHQA 4IWOA 2FCMA 1ZW7A 1V9JA 4W9IA 3DBRI 1EUVB 1Q5WB 2B3AA 1WM2A 2FCQA 3DVNU 4FN2A 1G6JA 2QHOA 3RZWC 1WR6E 2BKFA 2K8BA 2KWUB 3MJWA 3H1UA 3PS6A 2L0TA 4KSKC 2L0FA 3V60A 3N30A 3ML9A 2D10A 2G4SA 3VHTC 3ZRCA 4AJWA 4DDGD 5HKHA 4WJOA 1OEYJ 5FR6A 2ZNVC 2JPHA 2ZPYA 2KLGA 4GDLB 4KDIC 3TCAA 3VH4B 3D32A 3EECA 4NQKE 1WXMA 3T8MA 3VUYA 4DBGA 4GIVA 4ICUA 4NPNA 4GGQA 5E6PA 1WZ3A 1VCBA 2M0XA 2ASQA 1UELA 2MP2A 2WX1A 2BWFA 2IBIB 2YLMA 4JIOU 5JHBA 1V5OA 3QHTA 1TTNA 1WXAA 3JYUA 4XZ4A 2ZNVB 3ZKJC 1NDDA 2KQSA 2LGXA 1IP9A 2KD0A 2RD0A 4GU2A 3JSVB 2NBWB 2ZVOA 4EOYA 4IM0A 3PRMB 4ANWA 1E90A 4FLHA 3WIMA 3RT3B 4W9EA 3A9KB 3PRZA 4FULA 2EMSA 2IY1B 3APDA 2LXAA 3QX1A 3TL5A 1UBQA 2BF8B 3QQ8B 4BFRA 3ZLZA 2GMIC 5LXHA 2L05A 4A3OA 4OVUA 3QCAA 1VD2A 4DK5A 2DZKA 3HHMA 2GOWA 1UH6A 2DZIA 1L2NA 2CS4A 1IPGA 2LRWA 2BWES 1QZEA 4JL9A 3N32A 3W1SA 4HK2A 2IO2B 2M4NA 1YX6B 1WM3A 2PJHA 2XBBC 4KZCA 2KFJA 4GB9A 3VVWB 3PVLA 2XK5B 1J19A 2KC2A 4TQ1A 3WALA 3DOWA 5EDSA 2G4DB 2CHWA 1LFDA 3DVNV 2N9XA 4GDLA 4K7SA 4AJYB 4PYUA 2HD5B 2RSUA 1ISNA 1XD3B 1J8CA 4B9KA 4K81A 4NNJB 2ZPNA 3NY5A 2BYVE 4GSWA 2WWZA 4F7ZA 3APFA 4BBNF 3BY4B 4EFOA 2KDFB 1BT0A 3ENEA 5JZEB 2G3QB 1HE8A 3NZUA 4OVVA 2GBKA 1GC7A 3QAQA 2PE9A 2R2QA 1JRUA 1X1MA 2IO1B 3DVGY 2IYDB 3JSVA 2LZ6A 3MTNB 3UIPB 3ZUNA 3IVFA 3DCGA 4IM2A 3PT2B 1LQBA 1WF9A 1Z5SB 4YL8A 4GMVA 4MGIE 5GMVA 2KO3A 3M95A 1M94A 3A9KA 2J0JA 2XEWA 4GDKB 2JWZA 3PZDA 3ZNID 4JLCA 4HPMB 1WX8A 3VAWA 2FCNA 4FJVB 2D2QA 2GBJA 2MBEA 1E8WA 3VFKA 5TR5A 4ANXA 5J18A 2V3SA 4HVBA 3ZIMA 2MP2B 2KANA 3K9PB 1ZKHA 3AU4A 2MLBA 4TV3A 4AUQC 4RMAA 5KHQA 1KOTA 3KUZA 1J0GA 3ZO5B 3UIOB 3QARA 1OTRB 3CSFA 2PE6B 4MGZE 1RAXA 4AWJA 3PRPB 5CHFA 1SGHA 2KJ6A 3B1LX 4ASWC 1EF5A 4GXBA 4CYEA 1L7YA 2IO0B 4GOCA 2XK5A 5IAAC 2RR9A 3U30A 3V6EB 4EEWA 3ZDTA 4W9JA 5LXIB 3SDLC 1A5RA 4KZ0A 2W9NA 1YQBA 3VDZA 4DXAB 5D7GA 2KDBA 2I1JA 2YVCA 4MH0E 4A20A 2LWPA 3QC8B 3PLVA 3L17A 1FXTB 1NBFC 5AEKB 2KKCA 4ZRJA 1MG8A 2GBNA 1WJ6A 3PPAA 2DX5B 5D94A 2C5LC 3VUWA 4DWFA 3PTFC 4PS8A 3R7QA 4EZJA 2DHZA 3RUIB 1WJUA 3KUCB 4AOFA 4DHJB 2ZCBA 1R4MI 3QK0A 1WE6A 2KVRA 2ZEQA 4BKTA 3TBLD 1YD8U 3DBSA 2FUHB 4ANUA 2O6VD 2NBUA 1RLFA 4GDKA 1GUAB 3H6NA 3NHEB 2MQJA 4W9FA 2Y5BB 4KV2A 2NPTB 3IBEA 4WJPA 2L00B 2ZZPB 4WQOB 1RRBA 3PREA 2KFKB 3ZNZB 1P1AA 4ZRIA 3RZFA 4RM8A 2C7NB 5JH5C 2MBQA 3DQVA 2BYEA 1GJZA 1WXVA 3Q3FA 2O6VA 2N7EA 3L54A 4IC7B 4KDLB 2MX2A 4HJKA 1KLVA 2MBHA 3VXWA 1S3SG 3PV1A 2C9WB 3UGBB 3ECIA 4KVGB 4BVUC 2AL3A 1OGWA 2A4ZA 4MELA 1GNUA 1XQQA 4JGHB 4G3XB 3H7PB 4J6IA 4DHJD 3ZDMC 2JF5A 3V6CB 2L76A 1V80A 2KHWB 2NR2A 3ZW3A 4II3B 3A9JB 4MM3A 1WJ4A 3U8ZA 5J17A 1RFAA 3M3JA 5DPWA 2MW5A 2OJRA 2KMCA 2K8HA 5IA7A 1KJTA 2DZJA 3I3TB 2C60A 2KTRB 4WJQA 1E7UA 1C3TA 2NBVB 2KOXA 3TJPA 2DYBA 3L10B 5DPSA 5L83A 2O2VB 3Q3JA 4DHZB 3KW5B 3RULA 4PYZA 2GBMA 2AWTA 3ZVVA 3QWZB 2LASA 4HDOA 4G50A 2G45B 3JW0X 2KMAA 4EZLA 1WGYA 2NPTA 1TBEA 2KDEB 2IY0B 2KZRA 2RGFA 2WX0A 5AZGA 1E8YA 4BOZB 1WI0A 2FAZA 1T0YA 5LLIA 5CX3A 2CHZA 2KFKA 3AI5A 2REXA 3R3MA 2FIFA 2JT4B 2PEAA 3WANA 1UBIA 2K39A 3UINB 2RPQA 2HJ8A 4CHKA 3CMMB 3VUXA 1WMHA 2C7HA 3SU8X 1V5TA 3B0AA 4W9CA 4P7IA 1P0RA 4E3CA 2KJHB 1D3ZA 4HXDA 3H7PA 1WZ0A 4EKUA 3IG3A 4TQ0A 2UYZB 4HPLB 3N3KB 1P98A 2R2OA 2ZCCA 3A9JA 4FBJB 1UGMA 5J2RA 3H9DA 3GZNI 3PGEA 2N9EB 2O6VB 3X0WA 1E8ZA 2KTRA 5BO4B 4XC2A 2D3GA 4IWQA 3ZTCA 3PHWB 3OJ4B 2DYOA 1UD7A 4KIKA 2O2VA 4URKA 4RM9A 2HTHA 5DCNA 1TGZB 3LJ3A 4E74A 4EUTA 4IM3A 5E6NA 4I6PA 2JZZA 4ZRKA 3R7RA 4FHJA 2DAJA 1V81A 4XX5A 4MJSB 4IW0A 1S1QB 3ZNGC 3EFUA 4WWPA 4WWOA 1CMXB 4M8NA 2WYQA 2LD9A 1WR1A 4PS7A 1WYWB 1WGHA
chains in the Genus database with same CATH superfamily
4NQLB 1TKGA 3T9LA 3HM3A 3JVZX 2WS3B 1R4NB 1F0ZA 3PLUA 2L8JA 2KNBA 3BVZA 1FNWA 2EMTA 1LXDA 1D4BA 2CHXA 1SE4A 2PPHA 1FNVA 1TS3A 3ONSA 4FHKA 4RGNA 4WAFA 2IPKD 3M63B 2FCSA 2DZMA 3AXCA 1TIFA 3NZSA 2L7RA 1K8RB 1TT5B 2RDGA 3B08A 1VDVA 4HEA1 3U7ZA 4NY0A 1V6EA 3PHXB 1WWTA 1AARA 1GG3A 1JW9D 3WAOA 2I2YA 1I42A 2VRRB 4BKGA 4A3PA 2K5PA 2QEJC 3N1YC 1AWDA 3FAHA 2N9PC 3CF6E 3C8YA 1L5PA 1GC6A 1WX9A 3PZ7A 3AE7B 3M62B 3AU5A 4I6NB 4NAWB 2DYMA 4CO7A 3ML8A 3UF8A 2NTSA 3ZRFA 5D2MB 3IAM1 4LTUA 2EKEC 4S17A 3TIXA 3AH7A 3R8BA 1SE9A 1FRRA 4LDTB 3ZJUA 2JU6X 3R2TA 3AEEB 2DENB 4KGSA 1L6UA 4MGKE 1IBXA 3C19A 3OJ3A 1ZXHA 1C4PA 5AZFA 1P9DU 2KK8A 4QAYA 1HA5A 1VR9A 2B76B 5JHAA 3DBHI 4XGAB 4TKNA 5C2TB 2PMVA 1TKYA 1C4CA 4BKSA 3EFCA 1AN8A 4US9A 2LGDA 3A4SC 4M8MA 2K6DB 5L95C 3AE8B 1F9JA 3ZTDA 5C23A 2SEBD 2D3BA 1UWXA 3QJZA 5CTRC 2JSVX 1L4DB 2UU7A 2Y5PA 5GXGB 4LJOB 4N9F4 2JRIB 1EU4A 3KUDB 4B0EA 4W9HA 4YXDB 3VH3B 3GE3C 4MEMA 1FRDA 1DOYA 2MBOA 4HRSA 1V86A 4W9DA 2M0AA 2K8CA 4I6LB 4M0WB 2KTFA 5CHVC 2BKRB 3IHPC 3NOBA 2NCNA 2N1VA 1PGXA 2N4FA 3AE1B 4NJ7A 3W5VB 4JPSA 2FCMA 1ZW7A 2B3AA 2WXPA 1G6JA 1WR6E 2BKFA 2K8BA 3TEWA 2KWUB 2IGDA 1FO4A 2L0TA 3I57A 3ML9A 3VHTC 1ZPSA 5FR6A 2ZPYA 1WXMA 3T8MA 4GGQA 1WZ3A 3P4SB 2BWFA 4L23A 1V5OA 3QHTA 1FCLA 1RFKA 2KDMA 1FEHA 2KQSA 3VR9B 2KD0A 2RD0A 2J53A 1V1PA 1Y56A 1T6BX 2HDEA 3WIMA 4YSZB 2IY1B 3APDA 4LLGM 3ZLZA 4BZAA 2IJ0A 2WDVB 3PZ8A 4A90A 2K3UA 1UH6A 2DZIA 1GB1A 2M4NA 5FR3A 3DHGC 2XK5B 1SE3A 3V05A 1ZDXA 1L4ZB 4KGRA 3DVNV 2N9XA 3RI7C 3EUB2 2RSUA 1ISNA 3AEGB 2V3NA 4NNJB 2ZPNA 3NY5A 3APFA 1QF6A 1JRPA 3CIRB 1BT0A 4J3OD 2G3QB 1IUEA 3VR8B 1DGJA 3MJ5A 1GC7A 3H8HA 4C56C 3DVGY 3ZUNA 4IM2A 1R4MB 1ZUD2 4MGIE 5GMVA 2KO3A 4IKGA 4M01A 3A9KA 2J0JA 2IGHA 2JWZA 3PZDA 4RFBA 2GBJA 1SF0A 3VFKA 4ANXA 4MH8A 5J18A 2MP2B 4JX1C 2MLBA 3LB8C 2MH7A 3IT6B 3KUZA 1J0GA 3UIOB 3Q3NC 1RM6C 2PE6B 5AUKA 2KJ6A 1EF5A 1QLBB 4GXBA 2IO0B 4EEWA 1C78A 5HHDG 3BYTB 4W9JA 2JZPA 4OZBA 1C9FA 1EWYC 3SEBA 4DXAB 2KDBA 2I1JA 2LWPA 2LJIA 1ET6A 2ICIA 4ZRJA 1MG8A 2GBNA 1JWMD 2DX5B 2C5LC 3PTFC 4LNIA 3R7QA 3RUIB 2VH2A 5LNK1 3QK0A 1TS2A 1ZP0B 4HKQA 1T5XD 2KVRA 5BMGA 3TBLD 5EE0A 3BK2A 3ABVB 1JWSD 4OW0A 3H6NA 3NHEB 1KF6B 2NPTB 3FILB 2K0PA 4WQOB 2L32A 5IKCM 3ZNZB 2KQ4X 5JH5C 1WRIA 1D6EC 1WXVA 3Q3FA 2N7EA 2W54A 2MBHA 2FBWB 4OHJA 1S3SG 2WXNA 2KMMA 2C9WB 3ECIA 3P4PB 4BVUC 2G9HD 2A4ZA 2INNE 2N7JA 4FXCA 4DHJD 2NR2A 5J17A 5DPWA 2WXGA 4ACFA 1KJTA 3ZJTA 2C60A 1RWSA 3Q3JA 1FFVA 1L0XB 1FMAD 3KW5B 2GBMA 3QWZB 3SFDB 1F52A 1D5ZC 2KMAA 4PK1A 2JXTA 2KZRA 2IY0B 2RGFA 1WI0A 2W3SA 3AI5A 3R3MA 1YNTE 3RNFC 2JT4B 1UBIA 4CHKA 1QKZA 1WMHA 3SU8X 3IT4B 4XWTA 2BW2A 3GP7A 1XO3A 3P4QB 4O1NA 1D3ZA 5TSSA 4RNAA 4TQ0A 1WYGA 2R2OA 2ZCCA 1YMHE 1UGMA 3H9DA 2N9EB 1VLBA 1I4GA 1TYGB 1L6VA 2D3GA 4URKA 3AMZA 3NVWA 4EUTA 4IM3A 5E6NA 2DAJA 3N1ZC 4WWPA 1N61A 2LD9A 1WR1A 1I4PA 3E9SA 1D5XC 1PQSA 3KWVA 1Y8RC 4AS1A 3O65B 4W9LA 1GB4A 4ZDVA 3IAS1 1ET9A 2N7DA 4LJPB 3KVFB 2M17A 3KWLA 2AX5A 4HROA 2MRPA 2QCZA 5CHWA 5DPTA 3ZYYX 5BMHA 1IYFA 3NS8A 4E71A 1C1YB 2BTEA 2AQ3B 3A4RA 1SIFA 1XLQA 3U52E 3DWGC 3BK1A 4G0NB 3I5JC 2JWUA 1QOFA 3RN9C 4M02A 4PT5A 4LCDE 1T0SC 1A70A 2LUMA 4HDQA 4EZKA 1NI3A 2LRUA 1H4RA 1IBXB 2KN5A 3EC8A 4XE0A 2AL6A 2V1YA 4CQNA 1T0QC 3I63C 3B9JA 5FKAC 1NI2A 3L08A 3PO0A 1XCTL 3MP9A 4YWGG 3RCZA 3RD2A 1QOAA 2K22A 2LXCA 3N20C 4ZYNA 3GZNB 2WLBA 4YSXB 3Q8CA 4KIKB 3Q8BA 3S2AA 2UWQA 3TEXA 2MEKA 1CQVA 3Q8AA 1OQYA 2IO3B 2L3ZA 2KQ7A 5AZHA 2HE7A 1UWMA 1WY8A 2PKOA 4B95A 4N58A 4P1BC 3UQAA 4TUUA 1ROEA 3V61A 2J0MA 5C1ZA 1YJ1A 2OHFA 4AP4C 2BS2B 3OAWA 3ZXVA 1XEEA 3AE4B 1SB3C 2GLSA 1YX5B 3ZGZA 2WDTB 1YOVB 2Y5CA 2BQQA 4FJZA 3AE5B 3WAPA 2JZ3B 1MI0A 2PW9A 4K3BA 4KSLC 3ZNHB 3VQIA 3DDCB 3L16A 2K1FA 3N1XC 3A1QA 4W9GA 2JY6A 4AJYB 3HUIA 1Q0WB 1E7VA 4JWUC 2JYEA 1V1PB 4K3CA 1NYQA 1SBBB 2GBRA 3AULA 1FFUA 3A33B 1LO5D 2KXJA 3C0RB 4G11A 1D5MC 1QOGA 1E9MA 1DOIA 4WAAA 2LVPA 4MGYE 4DHZE 2EKIA 4IWOA 2N9LA 1FM0D 1V9JA 1EUVB 1Q5WB 2WXLA 2FCQA 3MJWA 3V60A 2D10A 4DDGD 3VH4B 1HEZE 2JPHA 2KLGA 4NJCA 4NQKE 2KWDA 1N6ZA 2WX1A 2BYTA 3JYUA 4HJGE 2LGIA 3AEAB 2NBWB 2ZVOA 4DXFA 3PRMB 4L2YA 4ANWA 4W9EA 3A9KB 2EMSA 1CK1A 2LXAA 5G5HA 4ZYSA 3QQ8B 4BFRA 1V8CA 5LXHA 3QCAA 1VD2A 2BS3B 4RH6A 1TY0A 1IPGA 2CS4A 1QZEA 2BWES 2X38A 3N32A 1YQ4B 3R2IA 4HK2A 1WM3A 3W2DA 4GB9A 1FXIA 3AEBB 3URYA 3OG5A 5IOIA 4GDLA 1VZ8A 1J8CA 2BT6A 1TY2A 2BYVE 4GSWA 4EFOA 2KDFB 2XN9C 3ENEA 1HE8A 4OVVA 3DBRB 3TUOA 1TJEA 2GRIA 2R2QA 2IO1B 4LNNA 3JSVA 3UIPB 2V4IB 2LZ6A 3PT2B 1JWAD 4GMVA 5BYRA 1M94A 1XXGA 3ZNID 1TZOA 2D2QA 1WSPA 3AV8A 4LNKA 3T3OA 1E8WA 5TR5A 3ZJVA 2KANA 5KHQA 3RNCC 3QARA 1OTRB 3CSFA 1STEA 2MHJA 5CHFA 4ASWC 4CYEA 2KAJA 4KZ0A 2W9NA 1YQBA 4C7ZA 1N5XA 5BMIA 5D7GA 4MH0E 3PLVA 1FXTB 4KKIA 5AEKB 1WJ6A 2TSSA 3AEFB 5D94A 4DWFA 4PS8A 3BVGA 2DHZA 2KN4A 1DYQA 2ZCBA 2AQ2B 1WE6A 4BKTA 3AE9B 2NBUA 1RLFA 1ZOYB 3NG0A 2FUG1 4P16A 3RZFA 2MBQA 3DQVA 2WU5B 4ITKA 1GJZA 3L54A 2N0SB 2LHDA 1IGCA 4B0MA 2BVCA 3B2FA 4KVGB 1OGWA 4JGHB 2JF5A 1OFFA 1JALA 2KHWB 3ZW3A 3U8ZA 1WJ4A 4R3DA 1RFAA 2L1AA 2OJRA 5IA7A 4A55A 2DZJA 2IDYA 3TEYA 2BBCA 3LXFA 1E7UA 1C4AA 1C3TA 2NBVB 1YJJA 3L10B 4RF0A 5DPSA 5L83A 4PYZA 4YT0B 2AWTA 2BB6A 2G45B 4EZLA 1WGYA 1TBEA 2KDEB 1YN5A 2WX0A 1E8YA 5LLIA 5CX3A 1YN4A 4TMAB 5BYQA 1V5TA 1ZE3D 3B0AA 4W9CA 2KJHB 2JYTA 3H7PA 1CZPA 2PLPA 3N3KB 4FBJB 5J2RA 1KH0A 1F77A 2O6VB 2KT7A 2KTRA 4XC2A 3ZTCA 1VZ7A 3OJ4B 2L83A 1I4QA 3MC9A 4RM9A 2HTHA 4E74A 3LJ3A 2PVOD 3R7RA 4WIPA 4XX5A 3AE3B 3ZNGC 3EFUA 4WWOA 1CMXB 2WYQA 4PS7A 4B9KA 1WYWB 2M56B 2N1WA 2NS5A 2WP9B 3NS1A 1PGAA 1FXAA 1E8XA 4MSMB 4C4VA 3L0WB 3K9OB 2MWSB 2Q5WD 3RNBC 3P1MA 2LVQA 4A9AA 4PS3A 2KDIA 3NUHB 1H8CA 2C7MB 2LVOA 2NVUI 3RMKC 3VTUA 1KLUD 2JVCA 2M1MA 1Z2MA 1WFYA 3VTWA 4HCPB 3V3XA 2WXOA 2VH1A 3OLMD 2QMTA 4HWIB 3HVDA 2VZKB 2LUEA 4F8CB 2K9XA 4MJSA 1L0YB 4DXGA 2FE8A 4IWPA 4K1RB 4JE3B 2BGFA 2WXIA 4Q2JA 1QQRA 4FADA 2D07B 4FJYA 2GI9A 2D3AA 1EO6A 2MA9B 4KX6B 5EE1A 5KHOA 3R66C 4RGOS 1KM7A 2J7QB 1ESFA 3HIZA 1JWBD 2I38A 1XLPA 2LHEA 4XDDA 1I7HA 3A1QB 1Q1OA 3W1YA 4MDKE 2Z59B 2J4XA 2KACA 4HLEA 2NMQA 3EHVA 3GOEA 3GE8C 1KTKA 1XLOA 3DBLI 2MSED 2A5UA 1FCCC 2KVZA 4MSQB 1T3QA 3ALBA 3CWIA 3P2BA 2LGYA 5DPRA 2JUOA 2DNFA 3J9CA 5G2NA 4FA6A 1WGDA 2G1EA 1WGRA 3VTVA 2JRHA 4RCOA 1WJNA 2W3RA 3X23A 2K6QA 3P4RB 1NVID 1U4AA 3KYCD 3LDZE 4WJNA 1MFWA 2RDBC 2WQYB 1AW7A 2MCNB 1ENFA 3LYYA 3P42A 4LDTD 2D11A 3BWUD 2DAFA 2CKHB 4W9KA 4BOSC 2BPSA 1V49A 3MC0B 3SD5A 2J42A 3L13A 4F1SA 3TMPB 4DDID 1C76A 3KYDD 1AYFA 3W1SC 2KWVB 2ON8A 1WX7A 4H2AA 1OEYA 3VRAB 4GLSC 3KH0A 1L2NA 4ANVA 4USAA 3SHQA 4N6EB 4WWMA 3DVNU 4FN2A 3RZWC 1Q10A 1B1ZA 2WNMA 4US8A 3PS6A 3N30A 3ZRCA 2G4SA 4AJWA 5HKHA 4ARIA 2AQ1B 3FKYA 2ZNVC 4KDIC 4GDLB 1XF5L 3TCAA 3D32A 3EECA 1F2RC 4NPNA 2WU2B 5E6PA 1E0ZA 1VCBA 2M0XA 2ASQA 2MP2A 2IBIB 1YN3A 2YLMA 3SR6A 1TTNA 1WXAA 3ZKJC 1NDDA 1K50A 3DBHB 2LGXA 4LK0M 3BIID 3JSVB 4EOYA 1SJHD 2JQRB 1GOZA 1E7PB 3AM9A 4BAXA 4FULA 3QX1A 2BB5A 3TL5A 2PVGC 2E6XA 2V3PA 4IOIE 4DK5A 1GAQB 2DZKA 2GOWA 2CJNA 3W1SA 2LRWA 1YX6B 2XNAC 3NVZA 1E6EB 2KFJA 2KC2A 3WALA 2MJEA 5EDSA 2LGSA 4ZRPA 3BVMA 2CHWA 5JXVA 4K7SA 3AEDB 4PYUA 1OQRA 2HD5B 3AE6B 1XD3B 1UF0A 3RNEC 3FC4A 4F7ZA 1MHHE 2D5GA 3BY4B 5JZEB 3NZUA 3WCQA 1F2RI 2RMMA 1IGDA 1JRUA 1X1MA 2IYDB 1MG4A 2N9KA 1V97A 3DCGA 4HPPA 3IVFA 1LQBA 1Z5SB 3MHZA 1EM7A 4KKJA 3M95A 5C3JB 2YEPB 1XLNA 4JLCA 1WX8A 2FCNA 2V3SA 3P63A 3KQ4A 4AUQC 2R61A 4RMAA 1JMLA 3DHIC 3N9YC 5IN7A 1SXTA 3Q14C 3ZO5B 3RFZB 3IXSA 3PRPB 1C77A 2OEDA 3UI3A 2MJDA 1L7YA 3U30A 4WURA 3ZDTA 3SDLC 3I9V1 1QT9A 3QC8B 3L17A 5D3DA 4ZRQA 3NRZA 4KGTA 1BMLC 2LEKA 1KRHA 3VUWA 2WGSA 1YQ3B 1WJUA 3KUCB 4AOFA 4DHJB 1YD8U 2FUHB 1J7BA 4ANUA 2O6VD 2WXFA 4OZCA 4GDKA 4W9FA 5I4DA 4ZHPA 2Y5BB 2HTME 3IBEA 4WJPA 2MJ3A 1RRBA 3PREA 1J7CA 2DBYA 2RPVA 4C00A 4EE2A 4RM8A 1LGRA 4IC7B 4KDLB 2MX2A 4ZHOA 4HJKA 1KLVA 1HZ6A 3U4EG 3AE2B 3RPFC 2AL3A 3RNAC 4MELA 1GNUA 1XQQA 5HI1A 1FIQA 4G3XB 3H7PB 2HJ1A 1P7FA 1I4XA 1XCQL 4JWSC 2QC8A 4MM3A 2MW5A 4S0RA 2INCC 2KMCA 2K8HA 1YJIA 2KTRB 4WJQA 3MC8A 4DHZB 4OVZA 3ZVVA 4XYCA 3JW0X 2WXQA 5AZGA 5D3IB 4NAMA 1VJKA 3GB1A 2SAKA 2FAZA 3OWEB 3VRBB 2KFKA 4LNOA 1MJDA 2FIFA 2VZKD 3WANA 4C4VB 2K39A 1HZ5A 1WGKA 2RPQA 2ZW0A 2C7HA 2D3CA 4P7IA 1P0RA 3Q69A 1OQQA 4E3CA 4HXDA 4NZLB 1FPYA 4EKUA 1DOXA 3IG3A 2UYZB 4HPLB 3AECB 4UDUC 3A9JA 3ZXRA 1PFDA 3GZNI 1SIJA 1SEBD 3X0WA 3Q3MC 2DYOA 3EGRA 3NJTA 4KIKA 2O2VA 2JX5A 2WHIA 2WXMA 5DCNA 1TGZB 4I6PA 2JZZA 4FHJA 5HG2A 4MJSB 4IW0A 4YTMB 1S1QB 2NTTA 4M8NA 1E90A 3L4PA 1WGHA 4ICVA 3DVGX 1WGGA 3NVVA 1QOBA 1BXTA 3Q2AC 2Z8LA 2FIDA 3QIJA 2WXHA 2KX0A 2GB1A 3H7SA 5IO9A 2IZVB 5AUIA 3W9CB 1WXSA 4HCNB 4GN1A 2K25A 1UZXB 1WRDB 2BS4B 3MHSD 1E5WA 3DHHC 1EU3A 2V4LA 4N59A 3Q8FA 4B6WA 4WWNA 2OOBB 3DBLB 3Q6BA 1VZ6A 3BINA 1WMHB 2INPE 3IFWB 2M19A 2Z0EB 3E56A 1VRAB 2LFIA 2LI5A 2LJ5A 5H92C 1XT9B 2JXXA 5MPOA 1LM8B 2ZVNA 1JWUD 2QSDA 4XWWA 3RYTA 4JQWC 4K7UA 3UQBA 4ZOHC 3DPDA 3HRDD 1HQRD 1TZ1A 2CR5A 1FD6A 3BYYB 1ZDVA 2J0KA 1WIAA 1PYWD 1R4NI 4II2B 3TEZA 3V62A 2CU3A 4BBNC 2BYFA 1K53A 3Q3OC 4K7WA 5D6JB 5G5GA 4IUMB 3T3NA 3MFGA 3W5UB 1V2YA 1MVKA 1P7EA 3QA8A 2H88B 4NJ6A 3HM6X 4BKSD 3NVYA 2KX3A 1ZGUB 3APCA 3WA0A 4MT5A 2WXJA 3HVZA 2FNJB 3CSTA 1K51A 1E10A 3GS2A 3WAMA 1WH3A 4C7YA 4RGMA 1I4RA 1BUIC 2KJRA 1PUTA 2E3TA 2YEPF 4WQMA 4TSSA 2KLCA 1EF1A 2Z0DB 2M8SA 4NAWA 3TSSA 2KWCA 2OJWA 2ONQA 4IG7B 2INDC 3HK0A 5IP4D 5T8IA 4DQOC 4X57B 4D2KA 2CU1A 2I1KA 1ZXIA 2H89B 2KC1A 4RF1A 1N63A 1GPXA 4L1BA 1I4HA 2AYOB 2X8XX 3PSEB 3U7DA 1V1OA 2ZJDA 1WE7A 2MBBB 1I35A 5E6OA 1P3QU 5G55A 2AEHA 1YIWA 4W9IA 3DBRI 1WM2A 1SE2A 2QHOA 2KYWA 3H1UA 1TS4A 1TS5A 4KSKC 2L0FA 1MPEA 2LMCA 4WJOA 1OEYJ 1ACCA 5HFYA 4DBGA 3VUYA 4GIVA 4ICUA 2ACZB 1UELA 1KLGD 4JIOU 5JHBA 2WDRB 4XZ4A 2PTLA 2ZNVB 1IP9A 4GU2A 3ETRA 4A6QA 1NYRA 4IM0A 1L0VB 4YSYB 4FLHA 3RT3B 3PRZA 3RNGC 1UBQA 1CJEA 2BF8B 4M0WA 4M00A 2GMIC 1B9RA 4A8XC 4LNFA 2L05A 4A3OA 4OVUA 4C80A 3HHMA 4HKZE 4JL9A 1NENB 1JCKB 2IO2B 3O13A 2PJHA 2XBBC 4KZCA 4RGTA 3VVWB 3PVLA 1J19A 4TQ1A 3DOWA 1R7SA 5E6JA 2J52A 2G4DB 2WXRA 1LFDA 2IGGA 1FNUA 4IDIA 1UUPA 1QILA 4K81A 2WWZA 4BBNF 4P6VF 2GBKA 3QAQA 2PE9A 3MTNB 3Q8EA 4YL8A 1WF9A 2WXKA 5EE9A 2XEWA 4GDKB 5EE3A 1NEKB 4HPMB 3VAWA 4FJVB 2MBEA 2WDQB 4HVBA 3ZIMA 3K9PB 1ZKHA 3AU4A 3B2GA 1KOTA 4AQ7A 1UGJA 1T0RC 4MGZE 1RAXA 4AWJA 1RYJA 1SGHA 3B1LX 2W55A 4GOCA 2XK5A 2QILA 2RR9A 5IAAC 3V6EB 5LXIB 1A5RA 1J7AA 3VDZA 2YVCA 3BZDB 4A20A 1KFYB 1JQ4A 4MM3B 1NBFC 2KKCA 2QDFA 3PPAA 1MHXA 4EZJA 2L52A 1N5WA 5H8YE 1R4MI 2CJOA 2ZEQA 3DBSA 3KLSX 1GUAB 2MQJA 4KV2A 2L00B 2ZZPB 2Y3AA 1EWCA 1PGBA 2KFKB 1P1AA 3SFEB 4ZRIA 1SSNA 1HTOA 2C7NB 2BYEA 2O6VA 2ZW1A 3VXWA 3PV1A 2QJLA 4WH4A 1C79A 4MACA 3UGBB 3NZ3A 4J6IA 3ZDMC 3V6CB 3AB5A 1V80A 2L76A 4YTNB 4II3B 3A9JB 2V0GA 1M4VA 3M3JA 3I3TB 1N60A 2RDHA 1F1HA 2KOXA 4XDCA 2DYBA 3TJPA 4ARCA 2O2VB 5FK9C 1HTQA 3RULA 1UNSA 2LASA 4HDOA 4G50A 2QIEB 4YTPB 2NPTA 2DLBA 3FILA 4BOZB 1SJED 1T0YA 2CHZA 2REXA 1TKEA 2PEAA 3UINB 2HJ8A 3CMMB 3VUXA 3EA6A 1PDXA 4REZA 4P1CC 1WZ0A 2V9HA 1JROA 2PIAA 1P98A 5BYSA 3PGEA 1E8ZA 5BO4B 3ZQ4A 3AN1A 4IWQA 3PHWB 2W82A 1HXYD 1UD7A 4OZAA 2DWQA 4ZRKA 3U2SC 1N62A 1V81A 2EELA 1WXQA 3DWMA 1K52A 4TV3A
chains in the Genus database with same CATH topology
1PQSA 4ICVA 4NQLB 1Y8RC 1WGGA 3DVGX 2N1WA 3O65B 4W9LA 2NS5A 4ZDVA 2FIDA 4MSMB 1E8XA 3QIJA 3L0WB 3K9OB 2KX0A 2MWSB 3T9LA 3HM3A 2N7DA 3JVZX 4LJPB 3KVFB 2M17A 5DPTA 1IYFA 2MRPA 5CHWA 3H7SA 3PLUA 2L8JA 3NS8A 2IZVB 2LVQA 2KNBA 1C1YB 4E71A 1WXSA 1LXDA 2EMTA 4HCNB 3A4RA 4GN1A 2CHXA 4PS3A 2PPHA 1SIFA 2K25A 3ONSA 4FHKA 3M63B 1UZXB 2FCSA 1WRDB 2DZMA 2KDIA 3AXCA 4G0NB 1H8CA 2C7MB 2LVOA 2NVUI 3MHSD 3NZSA 3VTUA 1E5WA 2JVCA 2V4LA 2L7RA 2M1MA 4B6WA 4LCDE 4WWNA 1Z2MA 1WFYA 2OOBB 1K8RB 3VTWA 4HCPB 4HDQA 3BINA 4EZKA 3B08A 1WMHB 3IFWB 2LRUA 2Z0EB 1H4RA 2KN5A 3OLMD 3EC8A 4HWIB 4NY0A 1V6EA 3PHXB 2AL6A 2V1YA 1AARA 2LI5A 2LJ5A 1GG3A 2LUEA 1NI2A 3L08A 4F8CB 1XT9B 2JXXA 3WAOA 1I42A 4MJSA 1LM8B 2ZVNA 3RCZA 2VRRB 3RD2A 3RYTA 4JQWC 4K7UA 4A3PA 4BKGA 3UQBA 3DPDA 2LXCA 4IWPA 4K1RB 1TZ1A 2CR5A 2N9PC 3CF6E 2BGFA 4ZYNA 2J0KA 1GC6A 1WIAA 1WX9A 4FADA 2D07B 3M62B 3AU5A 4FJYA 1EO6A 2MA9B 4KIKB 5KHOA 3R66C 1R4NI 4I6NB 1KM7A 3S2AA 4II2B 2UWQA 2J7QB 3V62A 4BBNC 2BYFA 4NAWB 2DYMA 4CO7A 3HIZA 3ML8A 4K7WA 3A1QB 3UF8A 5D6JB 1OQYA 1Q1OA 5D2MB 3ZRFA 2IO3B 2L3ZA 3W1YA 2KQ7A 4IUMB 4MDKE 2Z59B 5AZHA 2EKEC 2HE7A 4HLEA 1WY8A 3EHVA 1V2YA 4B95A 3GOEA 3TIXA 3QA8A 3UQAA 1SE9A 4LDTB 3DBLI 4TUUA 4NJ6A 2MSED 2A5UA 3HM6X 4BKSD 3V61A 2DENB 4MSQB 2KX3A 3ALBA 2J0MA 5C1ZA 1ZGUB 4MGKE 3APCA 3WA0A 1YJ1A 3P2BA 3OJ3A 2LGYA 5DPRA 2FNJB 4AP4C 2JUOA 3OAWA 5AZFA 3CSTA 5G2NA 1P9DU 4FA6A 1WGDA 2KK8A 1YX5B 5JHAA 3DBHI 1WGRA 2WDTB 4TKNA 3VTVA 2JRHA 3WAMA 1WH3A 1WJNA 4BKSA 3X23A 2LGDA 2K6QA 1U4AA 3A4SC 3KYCD 4FJZA 4M8MA 3LDZE 2K6DB 2KJRA 4WJNA 5L95C 1F9JA 3ZTDA 5C23A 3WAPA 2JZ3B 3QJZA 2MCNB 4KSLC 2KLCA 1EF1A 2Z0DB 5CTRC 2M8SA 4LDTD 4NAWA 2D11A 3ZNHB 3VQIA 2KWCA 3DDCB 2DAFA 3L16A 2K1FA 2CKHB 3A1QA 4LJOB 2JY6A 2JRIB 4N9F4 4W9GA 2BPSA 1V49A 3KUDB 1Q0WB 4W9KA 4W9HA 4BOSC 1E7VA 3VH3B 4IG7B 4MEMA 3SD5A 3L13A 4F1SA 3TMPB 3HK0A 2MBOA 4DDID 1V86A 2GBRA 3AULA 4W9DA 3A33B 2K8CA 3KYDD 4X57B 2CU1A 2I1KA 4I6LB 3W1SC 2KC1A 2KWVB 4M0WB 2KXJA 2KTFA 3C0RB 4G11A 1WX7A 1OEYA 2AYOB 5CHVC 2BKRB 4WAAA 3IHPC 2LVPA 3NOBA 3KH0A 3PSEB 4MGYE 2NCNA 2N1VA 2ZJDA 1WE7A 3U7DA 2MBBB 4DHZE 1I35A 5E6OA 1P3QU 2N4FA 5G55A 2AEHA 4ANVA 1YIWA 4NJ7A 3SHQA 4IWOA 2FCMA 1ZW7A 1V9JA 4W9IA 3DBRI 1EUVB 1Q5WB 2B3AA 1WM2A 2FCQA 3DVNU 4FN2A 1G6JA 2QHOA 3RZWC 1WR6E 2BKFA 2K8BA 2KWUB 3MJWA 3H1UA 3PS6A 2L0TA 4KSKC 2L0FA 3V60A 3N30A 3ML9A 2D10A 2G4SA 3VHTC 3ZRCA 4AJWA 4DDGD 5HKHA 4WJOA 1OEYJ 5FR6A 2ZNVC 2JPHA 2ZPYA 2KLGA 4GDLB 4KDIC 3TCAA 3VH4B 3D32A 3EECA 4NQKE 1WXMA 3T8MA 3VUYA 4DBGA 4GIVA 4ICUA 4NPNA 4GGQA 5E6PA 1WZ3A 1VCBA 2M0XA 2ASQA 1UELA 2MP2A 2WX1A 2BWFA 2IBIB 2YLMA 4JIOU 5JHBA 1V5OA 3QHTA 1TTNA 1WXAA 3JYUA 4XZ4A 2ZNVB 3ZKJC 1NDDA 2KQSA 2LGXA 1IP9A 2KD0A 2RD0A 4GU2A 3JSVB 2NBWB 2ZVOA 4EOYA 4IM0A 3PRMB 4ANWA 1E90A 4FLHA 3WIMA 3RT3B 4W9EA 3A9KB 3PRZA 4FULA 2EMSA 2IY1B 3APDA 2LXAA 3QX1A 3TL5A 1UBQA 2BF8B 3QQ8B 4BFRA 3ZLZA 2GMIC 5LXHA 2L05A 4A3OA 4OVUA 3QCAA 1VD2A 4DK5A 2DZKA 3HHMA 2GOWA 1UH6A 2DZIA 1L2NA 2CS4A 1IPGA 2LRWA 2BWES 1QZEA 4JL9A 3N32A 3W1SA 4HK2A 2IO2B 2M4NA 1YX6B 1WM3A 2PJHA 2XBBC 4KZCA 2KFJA 4GB9A 3VVWB 3PVLA 2XK5B 1J19A 2KC2A 4TQ1A 3WALA 3DOWA 5EDSA 2G4DB 2CHWA 1LFDA 3DVNV 2N9XA 4GDLA 4K7SA 4AJYB 4PYUA 2HD5B 2RSUA 1ISNA 1XD3B 1J8CA 4B9KA 4K81A 4NNJB 2ZPNA 3NY5A 2BYVE 4GSWA 2WWZA 4F7ZA 3APFA 4BBNF 3BY4B 4EFOA 2KDFB 1BT0A 3ENEA 5JZEB 2G3QB 1HE8A 3NZUA 4OVVA 2GBKA 1GC7A 3QAQA 2PE9A 2R2QA 1JRUA 1X1MA 2IO1B 3DVGY 2IYDB 3JSVA 2LZ6A 3MTNB 3UIPB 3ZUNA 3IVFA 3DCGA 4IM2A 3PT2B 1LQBA 1WF9A 1Z5SB 4YL8A 4GMVA 4MGIE 5GMVA 2KO3A 3M95A 1M94A 3A9KA 2J0JA 2XEWA 4GDKB 2JWZA 3PZDA 3ZNID 4JLCA 4HPMB 1WX8A 3VAWA 2FCNA 4FJVB 2D2QA 2GBJA 2MBEA 1E8WA 3VFKA 5TR5A 4ANXA 5J18A 2V3SA 4HVBA 3ZIMA 2MP2B 2KANA 3K9PB 1ZKHA 3AU4A 2MLBA 4TV3A 4AUQC 4RMAA 5KHQA 1KOTA 3KUZA 1J0GA 3ZO5B 3UIOB 3QARA 1OTRB 3CSFA 2PE6B 4MGZE 1RAXA 4AWJA 3PRPB 5CHFA 1SGHA 2KJ6A 3B1LX 4ASWC 1EF5A 4GXBA 4CYEA 1L7YA 2IO0B 4GOCA 2XK5A 5IAAC 2RR9A 3U30A 3V6EB 4EEWA 3ZDTA 4W9JA 5LXIB 3SDLC 1A5RA 4KZ0A 2W9NA 1YQBA 3VDZA 4DXAB 5D7GA 2KDBA 2I1JA 2YVCA 4MH0E 4A20A 2LWPA 3QC8B 3PLVA 3L17A 1FXTB 1NBFC 5AEKB 2KKCA 4ZRJA 1MG8A 2GBNA 1WJ6A 3PPAA 2DX5B 5D94A 2C5LC 3VUWA 4DWFA 3PTFC 4PS8A 3R7QA 4EZJA 2DHZA 3RUIB 1WJUA 3KUCB 4AOFA 4DHJB 2ZCBA 1R4MI 3QK0A 1WE6A 2KVRA 2ZEQA 4BKTA 3TBLD 1YD8U 3DBSA 2FUHB 4ANUA 2O6VD 2NBUA 1RLFA 4GDKA 1GUAB 3H6NA 3NHEB 2MQJA 4W9FA 2Y5BB 4KV2A 2NPTB 3IBEA 4WJPA 2L00B 2ZZPB 4WQOB 1RRBA 3PREA 2KFKB 3ZNZB 1P1AA 4ZRIA 3RZFA 4RM8A 2C7NB 5JH5C 2MBQA 3DQVA 2BYEA 1GJZA 1WXVA 3Q3FA 2O6VA 2N7EA 3L54A 4IC7B 4KDLB 2MX2A 4HJKA 1KLVA 2MBHA 3VXWA 1S3SG 3PV1A 2C9WB 3UGBB 3ECIA 4KVGB 4BVUC 2AL3A 1OGWA 2A4ZA 4MELA 1GNUA 1XQQA 4JGHB 4G3XB 3H7PB 4J6IA 4DHJD 3ZDMC 2JF5A 3V6CB 2L76A 1V80A 2KHWB 2NR2A 3ZW3A 4II3B 3A9JB 4MM3A 1WJ4A 3U8ZA 5J17A 1RFAA 3M3JA 5DPWA 2MW5A 2OJRA 2KMCA 2K8HA 5IA7A 1KJTA 2DZJA 3I3TB 2C60A 2KTRB 4WJQA 1E7UA 1C3TA 2NBVB 2KOXA 3TJPA 2DYBA 3L10B 5DPSA 5L83A 2O2VB 3Q3JA 4DHZB 3KW5B 3RULA 4PYZA 2GBMA 2AWTA 3ZVVA 3QWZB 2LASA 4HDOA 4G50A 2G45B 3JW0X 2KMAA 4EZLA 1WGYA 2NPTA 1TBEA 2KDEB 2IY0B 2KZRA 2RGFA 2WX0A 5AZGA 1E8YA 4BOZB 1WI0A 2FAZA 1T0YA 5LLIA 5CX3A 2CHZA 2KFKA 3AI5A 2REXA 3R3MA 2FIFA 2JT4B 2PEAA 3WANA 1UBIA 2K39A 3UINB 2RPQA 2HJ8A 4CHKA 3CMMB 3VUXA 1WMHA 2C7HA 3SU8X 1V5TA 3B0AA 4W9CA 4P7IA 1P0RA 4E3CA 2KJHB 1D3ZA 4HXDA 3H7PA 1WZ0A 4EKUA 3IG3A 4TQ0A 2UYZB 4HPLB 3N3KB 1P98A 2R2OA 2ZCCA 3A9JA 4FBJB 1UGMA 5J2RA 3H9DA 3GZNI 3PGEA 2N9EB 2O6VB 3X0WA 1E8ZA 2KTRA 5BO4B 4XC2A 2D3GA 4IWQA 3ZTCA 3PHWB 3OJ4B 2DYOA 1UD7A 4KIKA 2O2VA 4URKA 4RM9A 2HTHA 5DCNA 1TGZB 3LJ3A 4E74A 4EUTA 4IM3A 5E6NA 4I6PA 2JZZA 4ZRKA 3R7RA 4FHJA 2DAJA 1V81A 4XX5A 4MJSB 4IW0A 1S1QB 3ZNGC 3EFUA 4WWPA 4WWOA 1CMXB 4M8NA 2WYQA 2LD9A 1WR1A 4PS7A 1WYWB 1WGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQS A;  4ICV A;  4NQL B;  1Y8R C;  1WGG A;  3DVG X;  2N1W A;  3O65 B;  4W9L A;  2NS5 A;  4ZDV A;  2FID A;  4MSM B;  1E8X A;  3QIJ A;  3L0W B;  3K9O B;  2KX0 A;  2MWS B;  3T9L A;  3HM3 A;  2N7D A;  3JVZ X;  4LJP B;  3KVF B;  2M17 A;  5DPT A;  1IYF A;  2MRP A;  5CHW A;  3H7S A;  3PLU A;  2L8J A;  3NS8 A;  2IZV B;  2LVQ A;  2KNB A;  1C1Y B;  4E71 A;  1WXS A;  1LXD A;  2EMT A;  4HCN B;  3A4R A;  4GN1 A;  2CHX A;  4PS3 A;  2PPH A;  1SIF A;  2K25 A;  3ONS A;  4FHK A;  3M63 B;  1UZX B;  2FCS A;  1WRD B;  2DZM A;  2KDI A;  3AXC A;  4G0N B;  1H8C A;  2C7M B;  2LVO A;  2NVU I;  3MHS D;  3NZS A;  3VTU A;  1E5W A;  2JVC A;  2V4L A;  2L7R A;  2M1M A;  4B6W A;  4LCD E;  4WWN A;  1Z2M A;  1WFY A;  2OOB B;  1K8R B;  3VTW A;  4HCP B;  4HDQ A;  3BIN A;  4EZK A;  3B08 A;  1WMH B;  3IFW B;  2LRU A;  2Z0E B;  1H4R A;  2KN5 A;  3OLM D;  3EC8 A;  4HWI B;  4NY0 A;  1V6E A;  3PHX B;  2AL6 A;  2V1Y A;  1AAR A;  2LI5 A;  2LJ5 A;  1GG3 A;  2LUE A;  1NI2 A;  3L08 A;  4F8C B;  1XT9 B;  2JXX A;  3WAO A;  1I42 A;  4MJS A;  1LM8 B;  2ZVN A;  3RCZ A;  2VRR B;  3RD2 A;  3RYT A;  4JQW C;  4K7U A;  4A3P A;  4BKG A;  3UQB A;  3DPD A;  2LXC A;  4IWP A;  4K1R B;  1TZ1 A;  2CR5 A;  2N9P C;  3CF6 E;  2BGF A;  4ZYN A;  2J0K A;  1GC6 A;  1WIA A;  1WX9 A;  4FAD A;  2D07 B;  3M62 B;  3AU5 A;  4FJY A;  1EO6 A;  2MA9 B;  4KIK B;  5KHO A;  3R66 C;  1R4N I;  4I6N B;  1KM7 A;  3S2A A;  4II2 B;  2UWQ A;  2J7Q B;  3V62 A;  4BBN C;  2BYF A;  4NAW B;  2DYM A;  4CO7 A;  3HIZ A;  3ML8 A;  4K7W A;  3A1Q B;  3UF8 A;  5D6J B;  1OQY A;  1Q1O A;  5D2M B;  3ZRF A;  2IO3 B;  2L3Z A;  3W1Y A;  2KQ7 A;  4IUM B;  4MDK E;  2Z59 B;  5AZH A;  2EKE C;  2HE7 A;  4HLE A;  1WY8 A;  3EHV A;  1V2Y A;  4B95 A;  3GOE A;  3TIX A;  3QA8 A;  3UQA A;  1SE9 A;  4LDT B;  3DBL I;  4TUU A;  4NJ6 A;  2MSE D;  2A5U A;  3HM6 X;  4BKS D;  3V61 A;  2DEN B;  4MSQ B;  2KX3 A;  3ALB A;  2J0M A;  5C1Z A;  1ZGU B;  4MGK E;  3APC A;  3WA0 A;  1YJ1 A;  3P2B A;  3OJ3 A;  2LGY A;  5DPR A;  2FNJ B;  4AP4 C;  2JUO A;  3OAW A;  5AZF A;  3CST A;  5G2N A;  1P9D U;  4FA6 A;  1WGD A;  2KK8 A;  1YX5 B;  5JHA A;  3DBH I;  1WGR A;  2WDT B;  4TKN A;  3VTV A;  2JRH A;  3WAM A;  1WH3 A;  1WJN A;  4BKS A;  3X23 A;  2LGD A;  2K6Q A;  1U4A A;  3A4S C;  3KYC D;  4FJZ A;  4M8M A;  3LDZ E;  2K6D B;  2KJR A;  4WJN A;  5L95 C;  1F9J A;  3ZTD A;  5C23 A;  3WAP A;  2JZ3 B;  3QJZ A;  2MCN B;  4KSL C;  2KLC A;  1EF1 A;  2Z0D B;  5CTR C;  2M8S A;  4LDT D;  4NAW A;  2D11 A;  3ZNH B;  3VQI A;  2KWC A;  3DDC B;  2DAF A;  3L16 A;  2K1F A;  2CKH B;  3A1Q A;  4LJO B;  2JY6 A;  2JRI B;  4N9F 4;  4W9G A;  2BPS A;  1V49 A;  3KUD B;  1Q0W B;  4W9K A;  4W9H A;  4BOS C;  1E7V A;  3VH3 B;  4IG7 B;  4MEM A;  3SD5 A;  3L13 A;  4F1S A;  3TMP B;  3HK0 A;  2MBO A;  4DDI D;  1V86 A;  2GBR A;  3AUL A;  4W9D A;  3A33 B;  2K8C A;  3KYD D;  4X57 B;  2CU1 A;  2I1K A;  4I6L B;  3W1S C;  2KC1 A;  2KWV B;  4M0W B;  2KXJ A;  2KTF A;  3C0R B;  4G11 A;  1WX7 A;  1OEY A;  2AYO B;  5CHV C;  2BKR B;  4WAA A;  3IHP C;  2LVP A;  3NOB A;  3KH0 A;  3PSE B;  4MGY E;  2NCN A;  2N1V A;  2ZJD A;  1WE7 A;  3U7D A;  2MBB B;  4DHZ E;  1I35 A;  5E6O A;  1P3Q U;  2N4F A;  5G55 A;  2AEH A;  4ANV A;  1YIW A;  4NJ7 A;  3SHQ A;  4IWO A;  2FCM A;  1ZW7 A;  1V9J A;  4W9I A;  3DBR I;  1EUV B;  1Q5W B;  2B3A A;  1WM2 A;  2FCQ A;  3DVN U;  4FN2 A;  1G6J A;  2QHO A;  3RZW C;  1WR6 E;  2BKF A;  2K8B A;  2KWU B;  3MJW A;  3H1U A;  3PS6 A;  2L0T A;  4KSK C;  2L0F A;  3V60 A;  3N30 A;  3ML9 A;  2D10 A;  2G4S A;  3VHT C;  3ZRC A;  4AJW A;  4DDG D;  5HKH A;  4WJO A;  1OEY J;  5FR6 A;  2ZNV C;  2JPH A;  2ZPY A;  2KLG A;  4GDL B;  4KDI C;  3TCA A;  3VH4 B;  3D32 A;  3EEC A;  4NQK E;  1WXM A;  3T8M A;  3VUY A;  4DBG A;  4GIV A;  4ICU A;  4NPN A;  4GGQ A;  5E6P A;  1WZ3 A;  1VCB A;  2M0X A;  2ASQ A;  1UEL A;  2MP2 A;  2WX1 A;  2BWF A;  2IBI B;  2YLM A;  4JIO U;  5JHB A;  1V5O A;  3QHT A;  1TTN A;  1WXA A;  3JYU A;  4XZ4 A;  2ZNV B;  3ZKJ C;  1NDD A;  2KQS A;  2LGX A;  1IP9 A;  2KD0 A;  2RD0 A;  4GU2 A;  3JSV B;  2NBW B;  2ZVO A;  4EOY A;  4IM0 A;  3PRM B;  4ANW A;  1E90 A;  4FLH A;  3WIM A;  3RT3 B;  4W9E A;  3A9K B;  3PRZ A;  4FUL A;  2EMS A;  2IY1 B;  3APD A;  2LXA A;  3QX1 A;  3TL5 A;  1UBQ A;  2BF8 B;  3QQ8 B;  4BFR A;  3ZLZ A;  2GMI C;  5LXH A;  2L05 A;  4A3O A;  4OVU A;  3QCA A;  1VD2 A;  4DK5 A;  2DZK A;  3HHM A;  2GOW A;  1UH6 A;  2DZI A;  1L2N A;  2CS4 A;  1IPG A;  2LRW A;  2BWE S;  1QZE A;  4JL9 A;  3N32 A;  3W1S A;  4HK2 A;  2IO2 B;  2M4N A;  1YX6 B;  1WM3 A;  2PJH A;  2XBB C;  4KZC A;  2KFJ A;  4GB9 A;  3VVW B;  3PVL A;  2XK5 B;  1J19 A;  2KC2 A;  4TQ1 A;  3WAL A;  3DOW A;  5EDS A;  2G4D B;  2CHW A;  1LFD A;  3DVN V;  2N9X A;  4GDL A;  4K7S A;  4AJY B;  4PYU A;  2HD5 B;  2RSU A;  1ISN A;  1XD3 B;  1J8C A;  4B9K A;  4K81 A;  4NNJ B;  2ZPN A;  3NY5 A;  2BYV E;  4GSW A;  2WWZ A;  4F7Z A;  3APF A;  4BBN F;  3BY4 B;  4EFO A;  2KDF B;  1BT0 A;  3ENE A;  5JZE B;  2G3Q B;  1HE8 A;  3NZU A;  4OVV A;  2GBK A;  1GC7 A;  3QAQ A;  2PE9 A;  2R2Q A;  1JRU A;  1X1M A;  2IO1 B;  3DVG Y;  2IYD B;  3JSV A;  2LZ6 A;  3MTN B;  3UIP B;  3ZUN A;  3IVF A;  3DCG A;  4IM2 A;  3PT2 B;  1LQB A;  1WF9 A;  1Z5S B;  4YL8 A;  4GMV A;  4MGI E;  5GMV A;  2KO3 A;  3M95 A;  1M94 A;  3A9K A;  2J0J A;  2XEW A;  4GDK B;  2JWZ A;  3PZD A;  3ZNI D;  4JLC A;  4HPM B;  1WX8 A;  3VAW A;  2FCN A;  4FJV B;  2D2Q A;  2GBJ A;  2MBE A;  1E8W A;  3VFK A;  5TR5 A;  4ANX A;  5J18 A;  2V3S A;  4HVB A;  3ZIM A;  2MP2 B;  2KAN A;  3K9P B;  1ZKH A;  3AU4 A;  2MLB A;  4TV3 A;  4AUQ C;  4RMA A;  5KHQ A;  1KOT A;  3KUZ A;  1J0G A;  3ZO5 B;  3UIO B;  3QAR A;  1OTR B;  3CSF A;  2PE6 B;  4MGZ E;  1RAX A;  4AWJ A;  3PRP B;  5CHF A;  1SGH A;  2KJ6 A;  3B1L X;  4ASW C;  1EF5 A;  4GXB A;  4CYE A;  1L7Y A;  2IO0 B;  4GOC A;  2XK5 A;  5IAA C;  2RR9 A;  3U30 A;  3V6E B;  4EEW A;  3ZDT A;  4W9J A;  5LXI B;  3SDL C;  1A5R A;  4KZ0 A;  2W9N A;  1YQB A;  3VDZ A;  4DXA B;  5D7G A;  2KDB A;  2I1J A;  2YVC A;  4MH0 E;  4A20 A;  2LWP A;  3QC8 B;  3PLV A;  3L17 A;  1FXT B;  1NBF C;  5AEK B;  2KKC A;  4ZRJ A;  1MG8 A;  2GBN A;  1WJ6 A;  3PPA A;  2DX5 B;  5D94 A;  2C5L C;  3VUW A;  4DWF A;  3PTF C;  4PS8 A;  3R7Q A;  4EZJ A;  2DHZ A;  3RUI B;  1WJU A;  3KUC B;  4AOF A;  4DHJ B;  2ZCB A;  1R4M I;  3QK0 A;  1WE6 A;  2KVR A;  2ZEQ A;  4BKT A;  3TBL D;  1YD8 U;  3DBS A;  2FUH B;  4ANU A;  2O6V D;  2NBU A;  1RLF A;  4GDK A;  1GUA B;  3H6N A;  3NHE B;  2MQJ A;  4W9F A;  2Y5B B;  4KV2 A;  2NPT B;  3IBE A;  4WJP A;  2L00 B;  2ZZP B;  4WQO B;  1RRB A;  3PRE A;  2KFK B;  3ZNZ B;  1P1A A;  4ZRI A;  3RZF A;  4RM8 A;  2C7N B;  5JH5 C;  2MBQ A;  3DQV A;  2BYE A;  1GJZ A;  1WXV A;  3Q3F A;  2O6V A;  2N7E A;  3L54 A;  4IC7 B;  4KDL B;  2MX2 A;  4HJK A;  1KLV A;  2MBH A;  3VXW A;  1S3S G;  3PV1 A;  2C9W B;  3UGB B;  3ECI A;  4KVG B;  4BVU C;  2AL3 A;  1OGW A;  2A4Z A;  4MEL A;  1GNU A;  1XQQ A;  4JGH B;  4G3X B;  3H7P B;  4J6I A;  4DHJ D;  3ZDM C;  2JF5 A;  3V6C B;  2L76 A;  1V80 A;  2KHW B;  2NR2 A;  3ZW3 A;  4II3 B;  3A9J B;  4MM3 A;  1WJ4 A;  3U8Z A;  5J17 A;  1RFA A;  3M3J A;  5DPW A;  2MW5 A;  2OJR A;  2KMC A;  2K8H A;  5IA7 A;  1KJT A;  2DZJ A;  3I3T B;  2C60 A;  2KTR B;  4WJQ A;  1E7U A;  1C3T A;  2NBV B;  2KOX A;  3TJP A;  2DYB A;  3L10 B;  5DPS A;  5L83 A;  2O2V B;  3Q3J A;  4DHZ B;  3KW5 B;  3RUL A;  4PYZ A;  2GBM A;  2AWT A;  3ZVV A;  3QWZ B;  2LAS A;  4HDO A;  4G50 A;  2G45 B;  3JW0 X;  2KMA A;  4EZL A;  1WGY A;  2NPT A;  1TBE A;  2KDE B;  2IY0 B;  2KZR A;  2RGF A;  2WX0 A;  5AZG A;  1E8Y A;  4BOZ B;  1WI0 A;  2FAZ A;  1T0Y A;  5LLI A;  5CX3 A;  2CHZ A;  2KFK A;  3AI5 A;  2REX A;  3R3M A;  2FIF A;  2JT4 B;  2PEA A;  3WAN A;  1UBI A;  2K39 A;  3UIN B;  2RPQ A;  2HJ8 A;  4CHK A;  3CMM B;  3VUX A;  1WMH A;  2C7H A;  3SU8 X;  1V5T A;  3B0A A;  4W9C A;  4P7I A;  1P0R A;  4E3C A;  2KJH B;  1D3Z A;  4HXD A;  3H7P A;  1WZ0 A;  4EKU A;  3IG3 A;  4TQ0 A;  2UYZ B;  4HPL B;  3N3K B;  1P98 A;  2R2O A;  2ZCC A;  3A9J A;  4FBJ B;  1UGM A;  5J2R A;  3H9D A;  3GZN I;  3PGE A;  2N9E B;  2O6V B;  3X0W A;  1E8Z A;  2KTR A;  5BO4 B;  4XC2 A;  2D3G A;  4IWQ A;  3ZTC A;  3PHW B;  3OJ4 B;  2DYO A;  1UD7 A;  4KIK A;  2O2V A;  4URK A;  4RM9 A;  2HTH A;  5DCN A;  1TGZ B;  3LJ3 A;  4E74 A;  4EUT A;  4IM3 A;  5E6N A;  4I6P A;  2JZZ A;  4ZRK A;  3R7R A;  4FHJ A;  2DAJ A;  1V81 A;  4XX5 A;  4MJS B;  4IW0 A;  1S1Q B;  3ZNG C;  3EFU A;  4WWP A;  4WWO A;  1CMX B;  4M8N A;  2WYQ A;  2LD9 A;  1WR1 A;  4PS7 A;  1WYW B;  1WGH A; 
#chains in the Genus database with same CATH topology
 4NQL B;  1TKG A;  3T9L A;  3HM3 A;  3JVZ X;  2WS3 B;  1R4N B;  1F0Z A;  3PLU A;  2L8J A;  2KNB A;  3BVZ A;  1FNW A;  2EMT A;  1LXD A;  1D4B A;  2CHX A;  1SE4 A;  2PPH A;  1FNV A;  1TS3 A;  3ONS A;  4FHK A;  4RGN A;  4WAF A;  2IPK D;  3M63 B;  2FCS A;  2DZM A;  3AXC A;  1TIF A;  3NZS A;  2L7R A;  1K8R B;  1TT5 B;  2RDG A;  3B08 A;  1VDV A;  4HEA 1;  3U7Z A;  4NY0 A;  1V6E A;  3PHX B;  1WWT A;  1AAR A;  1GG3 A;  1JW9 D;  3WAO A;  2I2Y A;  1I42 A;  2VRR B;  4BKG A;  4A3P A;  2K5P A;  2QEJ C;  3N1Y C;  1AWD A;  3FAH A;  2N9P C;  3CF6 E;  3C8Y A;  1L5P A;  1GC6 A;  1WX9 A;  3PZ7 A;  3AE7 B;  3M62 B;  3AU5 A;  4I6N B;  4NAW B;  2DYM A;  4CO7 A;  3ML8 A;  3UF8 A;  2NTS A;  3ZRF A;  5D2M B;  3IAM 1;  4LTU A;  2EKE C;  4S17 A;  3TIX A;  3AH7 A;  3R8B A;  1SE9 A;  1FRR A;  4LDT B;  3ZJU A;  2JU6 X;  3R2T A;  3AEE B;  2DEN B;  4KGS A;  1L6U A;  4MGK E;  1IBX A;  3C19 A;  3OJ3 A;  1ZXH A;  1C4P A;  5AZF A;  1P9D U;  2KK8 A;  4QAY A;  1HA5 A;  1VR9 A;  2B76 B;  5JHA A;  3DBH I;  4XGA B;  4TKN A;  5C2T B;  2PMV A;  1TKY A;  1C4C A;  4BKS A;  3EFC A;  1AN8 A;  4US9 A;  2LGD A;  3A4S C;  4M8M A;  2K6D B;  5L95 C;  3AE8 B;  1F9J A;  3ZTD A;  5C23 A;  2SEB D;  2D3B A;  1UWX A;  3QJZ A;  5CTR C;  2JSV X;  1L4D B;  2UU7 A;  2Y5P A;  5GXG B;  4LJO B;  4N9F 4;  2JRI B;  1EU4 A;  3KUD B;  4B0E A;  4W9H A;  4YXD B;  3VH3 B;  3GE3 C;  4MEM A;  1FRD A;  1DOY A;  2MBO A;  4HRS A;  1V86 A;  4W9D A;  2M0A A;  2K8C A;  4I6L B;  4M0W B;  2KTF A;  5CHV C;  2BKR B;  3IHP C;  3NOB A;  2NCN A;  2N1V A;  1PGX A;  2N4F A;  3AE1 B;  4NJ7 A;  3W5V B;  4JPS A;  2FCM A;  1ZW7 A;  2B3A A;  2WXP A;  1G6J A;  1WR6 E;  2BKF A;  2K8B A;  3TEW A;  2KWU B;  2IGD A;  1FO4 A;  2L0T A;  3I57 A;  3ML9 A;  3VHT C;  1ZPS A;  5FR6 A;  2ZPY A;  1WXM A;  3T8M A;  4GGQ A;  1WZ3 A;  3P4S B;  2BWF A;  4L23 A;  1V5O A;  3QHT A;  1FCL A;  1RFK A;  2KDM A;  1FEH A;  2KQS A;  3VR9 B;  2KD0 A;  2RD0 A;  2J53 A;  1V1P A;  1Y56 A;  1T6B X;  2HDE A;  3WIM A;  4YSZ B;  2IY1 B;  3APD A;  4LLG M;  3ZLZ A;  4BZA A;  2IJ0 A;  2WDV B;  3PZ8 A;  4A90 A;  2K3U A;  1UH6 A;  2DZI A;  1GB1 A;  2M4N A;  5FR3 A;  3DHG C;  2XK5 B;  1SE3 A;  3V05 A;  1ZDX A;  1L4Z B;  4KGR A;  3DVN V;  2N9X A;  3RI7 C;  3EUB 2;  2RSU A;  1ISN A;  3AEG B;  2V3N A;  4NNJ B;  2ZPN A;  3NY5 A;  3APF A;  1QF6 A;  1JRP A;  3CIR B;  1BT0 A;  4J3O D;  2G3Q B;  1IUE A;  3VR8 B;  1DGJ A;  3MJ5 A;  1GC7 A;  3H8H A;  4C56 C;  3DVG Y;  3ZUN A;  4IM2 A;  1R4M B;  1ZUD 2;  4MGI E;  5GMV A;  2KO3 A;  4IKG A;  4M01 A;  3A9K A;  2J0J A;  2IGH A;  2JWZ A;  3PZD A;  4RFB A;  2GBJ A;  1SF0 A;  3VFK A;  4ANX A;  4MH8 A;  5J18 A;  2MP2 B;  4JX1 C;  2MLB A;  3LB8 C;  2MH7 A;  3IT6 B;  3KUZ A;  1J0G A;  3UIO B;  3Q3N C;  1RM6 C;  2PE6 B;  5AUK A;  2KJ6 A;  1EF5 A;  1QLB B;  4GXB A;  2IO0 B;  4EEW A;  1C78 A;  5HHD G;  3BYT B;  4W9J A;  2JZP A;  4OZB A;  1C9F A;  1EWY C;  3SEB A;  4DXA B;  2KDB A;  2I1J A;  2LWP A;  2LJI A;  1ET6 A;  2ICI A;  4ZRJ A;  1MG8 A;  2GBN A;  1JWM D;  2DX5 B;  2C5L C;  3PTF C;  4LNI A;  3R7Q A;  3RUI B;  2VH2 A;  5LNK 1;  3QK0 A;  1TS2 A;  1ZP0 B;  4HKQ A;  1T5X D;  2KVR A;  5BMG A;  3TBL D;  5EE0 A;  3BK2 A;  3ABV B;  1JWS D;  4OW0 A;  3H6N A;  3NHE B;  1KF6 B;  2NPT B;  3FIL B;  2K0P A;  4WQO B;  2L32 A;  5IKC M;  3ZNZ B;  2KQ4 X;  5JH5 C;  1WRI A;  1D6E C;  1WXV A;  3Q3F A;  2N7E A;  2W54 A;  2MBH A;  2FBW B;  4OHJ A;  1S3S G;  2WXN A;  2KMM A;  2C9W B;  3ECI A;  3P4P B;  4BVU C;  2G9H D;  2A4Z A;  2INN E;  2N7J A;  4FXC A;  4DHJ D;  2NR2 A;  5J17 A;  5DPW A;  2WXG A;  4ACF A;  1KJT A;  3ZJT A;  2C60 A;  1RWS A;  3Q3J A;  1FFV A;  1L0X B;  1FMA D;  3KW5 B;  2GBM A;  3QWZ B;  3SFD B;  1F52 A;  1D5Z C;  2KMA A;  4PK1 A;  2JXT A;  2KZR A;  2IY0 B;  2RGF A;  1WI0 A;  2W3S A;  3AI5 A;  3R3M A;  1YNT E;  3RNF C;  2JT4 B;  1UBI A;  4CHK A;  1QKZ A;  1WMH A;  3SU8 X;  3IT4 B;  4XWT A;  2BW2 A;  3GP7 A;  1XO3 A;  3P4Q B;  4O1N A;  1D3Z A;  5TSS A;  4RNA A;  4TQ0 A;  1WYG A;  2R2O A;  2ZCC A;  1YMH E;  1UGM A;  3H9D A;  2N9E B;  1VLB A;  1I4G A;  1TYG B;  1L6V A;  2D3G A;  4URK A;  3AMZ A;  3NVW A;  4EUT A;  4IM3 A;  5E6N A;  2DAJ A;  3N1Z C;  4WWP A;  1N61 A;  2LD9 A;  1WR1 A;  1I4P A;  3E9S A;  1D5X C;  1PQS A;  3KWV A;  1Y8R C;  4AS1 A;  3O65 B;  4W9L A;  1GB4 A;  4ZDV A;  3IAS 1;  1ET9 A;  2N7D A;  4LJP B;  3KVF B;  2M17 A;  3KWL A;  2AX5 A;  4HRO A;  2MRP A;  2QCZ A;  5CHW A;  5DPT A;  3ZYY X;  5BMH A;  1IYF A;  3NS8 A;  4E71 A;  1C1Y B;  2BTE A;  2AQ3 B;  3A4R A;  1SIF A;  1XLQ A;  3U52 E;  3DWG C;  3BK1 A;  4G0N B;  3I5J C;  2JWU A;  1QOF A;  3RN9 C;  4M02 A;  4PT5 A;  4LCD E;  1T0S C;  1A70 A;  2LUM A;  4HDQ A;  4EZK A;  1NI3 A;  2LRU A;  1H4R A;  1IBX B;  2KN5 A;  3EC8 A;  4XE0 A;  2AL6 A;  2V1Y A;  4CQN A;  1T0Q C;  3I63 C;  3B9J A;  5FKA C;  1NI2 A;  3L08 A;  3PO0 A;  1XCT L;  3MP9 A;  4YWG G;  3RCZ A;  3RD2 A;  1QOA A;  2K22 A;  2LXC A;  3N20 C;  4ZYN A;  3GZN B;  2WLB A;  4YSX B;  3Q8C A;  4KIK B;  3Q8B A;  3S2A A;  2UWQ A;  3TEX A;  2MEK A;  1CQV A;  3Q8A A;  1OQY A;  2IO3 B;  2L3Z A;  2KQ7 A;  5AZH A;  2HE7 A;  1UWM A;  1WY8 A;  2PKO A;  4B95 A;  4N58 A;  4P1B C;  3UQA A;  4TUU A;  1ROE A;  3V61 A;  2J0M A;  5C1Z A;  1YJ1 A;  2OHF A;  4AP4 C;  2BS2 B;  3OAW A;  3ZXV A;  1XEE A;  3AE4 B;  1SB3 C;  2GLS A;  1YX5 B;  3ZGZ A;  2WDT B;  1YOV B;  2Y5C A;  2BQQ A;  4FJZ A;  3AE5 B;  3WAP A;  2JZ3 B;  1MI0 A;  2PW9 A;  4K3B A;  4KSL C;  3ZNH B;  3VQI A;  3DDC B;  3L16 A;  2K1F A;  3N1X C;  3A1Q A;  4W9G A;  2JY6 A;  4AJY B;  3HUI A;  1Q0W B;  1E7V A;  4JWU C;  2JYE A;  1V1P B;  4K3C A;  1NYQ A;  1SBB B;  2GBR A;  3AUL A;  1FFU A;  3A33 B;  1LO5 D;  2KXJ A;  3C0R B;  4G11 A;  1D5M C;  1QOG A;  1E9M A;  1DOI A;  4WAA A;  2LVP A;  4MGY E;  4DHZ E;  2EKI A;  4IWO A;  2N9L A;  1FM0 D;  1V9J A;  1EUV B;  1Q5W B;  2WXL A;  2FCQ A;  3MJW A;  3V60 A;  2D10 A;  4DDG D;  3VH4 B;  1HEZ E;  2JPH A;  2KLG A;  4NJC A;  4NQK E;  2KWD A;  1N6Z A;  2WX1 A;  2BYT A;  3JYU A;  4HJG E;  2LGI A;  3AEA B;  2NBW B;  2ZVO A;  4DXF A;  3PRM B;  4L2Y A;  4ANW A;  4W9E A;  3A9K B;  2EMS A;  1CK1 A;  2LXA A;  5G5H A;  4ZYS A;  3QQ8 B;  4BFR A;  1V8C A;  5LXH A;  3QCA A;  1VD2 A;  2BS3 B;  4RH6 A;  1TY0 A;  1IPG A;  2CS4 A;  1QZE A;  2BWE S;  2X38 A;  3N32 A;  1YQ4 B;  3R2I A;  4HK2 A;  1WM3 A;  3W2D A;  4GB9 A;  1FXI A;  3AEB B;  3URY A;  3OG5 A;  5IOI A;  4GDL A;  1VZ8 A;  1J8C A;  2BT6 A;  1TY2 A;  2BYV E;  4GSW A;  4EFO A;  2KDF B;  2XN9 C;  3ENE A;  1HE8 A;  4OVV A;  3DBR B;  3TUO A;  1TJE A;  2GRI A;  2R2Q A;  2IO1 B;  4LNN A;  3JSV A;  3UIP B;  2V4I B;  2LZ6 A;  3PT2 B;  1JWA D;  4GMV A;  5BYR A;  1M94 A;  1XXG A;  3ZNI D;  1TZO A;  2D2Q A;  1WSP A;  3AV8 A;  4LNK A;  3T3O A;  1E8W A;  5TR5 A;  3ZJV A;  2KAN A;  5KHQ A;  3RNC C;  3QAR A;  1OTR B;  3CSF A;  1STE A;  2MHJ A;  5CHF A;  4ASW C;  4CYE A;  2KAJ A;  4KZ0 A;  2W9N A;  1YQB A;  4C7Z A;  1N5X A;  5BMI A;  5D7G A;  4MH0 E;  3PLV A;  1FXT B;  4KKI A;  5AEK B;  1WJ6 A;  2TSS A;  3AEF B;  5D94 A;  4DWF A;  4PS8 A;  3BVG A;  2DHZ A;  2KN4 A;  1DYQ A;  2ZCB A;  2AQ2 B;  1WE6 A;  4BKT A;  3AE9 B;  2NBU A;  1RLF A;  1ZOY B;  3NG0 A;  2FUG 1;  4P16 A;  3RZF A;  2MBQ A;  3DQV A;  2WU5 B;  4ITK A;  1GJZ A;  3L54 A;  2N0S B;  2LHD A;  1IGC A;  4B0M A;  2BVC A;  3B2F A;  4KVG B;  1OGW A;  4JGH B;  2JF5 A;  1OFF A;  1JAL A;  2KHW B;  3ZW3 A;  3U8Z A;  1WJ4 A;  4R3D A;  1RFA A;  2L1A A;  2OJR A;  5IA7 A;  4A55 A;  2DZJ A;  2IDY A;  3TEY A;  2BBC A;  3LXF A;  1E7U A;  1C4A A;  1C3T A;  2NBV B;  1YJJ A;  3L10 B;  4RF0 A;  5DPS A;  5L83 A;  4PYZ A;  4YT0 B;  2AWT A;  2BB6 A;  2G45 B;  4EZL A;  1WGY A;  1TBE A;  2KDE B;  1YN5 A;  2WX0 A;  1E8Y A;  5LLI A;  5CX3 A;  1YN4 A;  4TMA B;  5BYQ A;  1V5T A;  1ZE3 D;  3B0A A;  4W9C A;  2KJH B;  2JYT A;  3H7P A;  1CZP A;  2PLP A;  3N3K B;  4FBJ B;  5J2R A;  1KH0 A;  1F77 A;  2O6V B;  2KT7 A;  2KTR A;  4XC2 A;  3ZTC A;  1VZ7 A;  3OJ4 B;  2L83 A;  1I4Q A;  3MC9 A;  4RM9 A;  2HTH A;  4E74 A;  3LJ3 A;  2PVO D;  3R7R A;  4WIP A;  4XX5 A;  3AE3 B;  3ZNG C;  3EFU A;  4WWO A;  1CMX B;  2WYQ A;  4PS7 A;  4B9K A;  1WYW B;  2M56 B;  2N1W A;  2NS5 A;  2WP9 B;  3NS1 A;  1PGA A;  1FXA A;  1E8X A;  4MSM B;  4C4V A;  3L0W B;  3K9O B;  2MWS B;  2Q5W D;  3RNB C;  3P1M A;  2LVQ A;  4A9A A;  4PS3 A;  2KDI A;  3NUH B;  1H8C A;  2C7M B;  2LVO A;  2NVU I;  3RMK C;  3VTU A;  1KLU D;  2JVC A;  2M1M A;  1Z2M A;  1WFY A;  3VTW A;  4HCP B;  3V3X A;  2WXO A;  2VH1 A;  3OLM D;  2QMT A;  4HWI B;  3HVD A;  2VZK B;  2LUE A;  4F8C B;  2K9X A;  4MJS A;  1L0Y B;  4DXG A;  2FE8 A;  4IWP A;  4K1R B;  4JE3 B;  2BGF A;  2WXI A;  4Q2J A;  1QQR A;  4FAD A;  2D07 B;  4FJY A;  2GI9 A;  2D3A A;  1EO6 A;  2MA9 B;  4KX6 B;  5EE1 A;  5KHO A;  3R66 C;  4RGO S;  1KM7 A;  2J7Q B;  1ESF A;  3HIZ A;  1JWB D;  2I38 A;  1XLP A;  2LHE A;  4XDD A;  1I7H A;  3A1Q B;  1Q1O A;  3W1Y A;  4MDK E;  2Z59 B;  2J4X A;  2KAC A;  4HLE A;  2NMQ A;  3EHV A;  3GOE A;  3GE8 C;  1KTK A;  1XLO A;  3DBL I;  2MSE D;  2A5U A;  1FCC C;  2KVZ A;  4MSQ B;  1T3Q A;  3ALB A;  3CWI A;  3P2B A;  2LGY A;  5DPR A;  2JUO A;  2DNF A;  3J9C A;  5G2N A;  4FA6 A;  1WGD A;  2G1E A;  1WGR A;  3VTV A;  2JRH A;  4RCO A;  1WJN A;  2W3R A;  3X23 A;  2K6Q A;  3P4R B;  1NVI D;  1U4A A;  3KYC D;  3LDZ E;  4WJN A;  1MFW A;  2RDB C;  2WQY B;  1AW7 A;  2MCN B;  1ENF A;  3LYY A;  3P42 A;  4LDT D;  2D11 A;  3BWU D;  2DAF A;  2CKH B;  4W9K A;  4BOS C;  2BPS A;  1V49 A;  3MC0 B;  3SD5 A;  2J42 A;  3L13 A;  4F1S A;  3TMP B;  4DDI D;  1C76 A;  3KYD D;  1AYF A;  3W1S C;  2KWV B;  2ON8 A;  1WX7 A;  4H2A A;  1OEY A;  3VRA B;  4GLS C;  3KH0 A;  1L2N A;  4ANV A;  4USA A;  3SHQ A;  4N6E B;  4WWM A;  3DVN U;  4FN2 A;  3RZW C;  1Q10 A;  1B1Z A;  2WNM A;  4US8 A;  3PS6 A;  3N30 A;  3ZRC A;  2G4S A;  4AJW A;  5HKH A;  4ARI A;  2AQ1 B;  3FKY A;  2ZNV C;  4KDI C;  4GDL B;  1XF5 L;  3TCA A;  3D32 A;  3EEC A;  1F2R C;  4NPN A;  2WU2 B;  5E6P A;  1E0Z A;  1VCB A;  2M0X A;  2ASQ A;  2MP2 A;  2IBI B;  1YN3 A;  2YLM A;  3SR6 A;  1TTN A;  1WXA A;  3ZKJ C;  1NDD A;  1K50 A;  3DBH B;  2LGX A;  4LK0 M;  3BII D;  3JSV B;  4EOY A;  1SJH D;  2JQR B;  1GOZ A;  1E7P B;  3AM9 A;  4BAX A;  4FUL A;  3QX1 A;  2BB5 A;  3TL5 A;  2PVG C;  2E6X A;  2V3P A;  4IOI E;  4DK5 A;  1GAQ B;  2DZK A;  2GOW A;  2CJN A;  3W1S A;  2LRW A;  1YX6 B;  2XNA C;  3NVZ A;  1E6E B;  2KFJ A;  2KC2 A;  3WAL A;  2MJE A;  5EDS A;  2LGS A;  4ZRP A;  3BVM A;  2CHW A;  5JXV A;  4K7S A;  3AED B;  4PYU A;  1OQR A;  2HD5 B;  3AE6 B;  1XD3 B;  1UF0 A;  3RNE C;  3FC4 A;  4F7Z A;  1MHH E;  2D5G A;  3BY4 B;  5JZE B;  3NZU A;  3WCQ A;  1F2R I;  2RMM A;  1IGD A;  1JRU A;  1X1M A;  2IYD B;  1MG4 A;  2N9K A;  1V97 A;  3DCG A;  4HPP A;  3IVF A;  1LQB A;  1Z5S B;  3MHZ A;  1EM7 A;  4KKJ A;  3M95 A;  5C3J B;  2YEP B;  1XLN A;  4JLC A;  1WX8 A;  2FCN A;  2V3S A;  3P63 A;  3KQ4 A;  4AUQ C;  2R61 A;  4RMA A;  1JML A;  3DHI C;  3N9Y C;  5IN7 A;  1SXT A;  3Q14 C;  3ZO5 B;  3RFZ B;  3IXS A;  3PRP B;  1C77 A;  2OED A;  3UI3 A;  2MJD A;  1L7Y A;  3U30 A;  4WUR A;  3ZDT A;  3SDL C;  3I9V 1;  1QT9 A;  3QC8 B;  3L17 A;  5D3D A;  4ZRQ A;  3NRZ A;  4KGT A;  1BML C;  2LEK A;  1KRH A;  3VUW A;  2WGS A;  1YQ3 B;  1WJU A;  3KUC B;  4AOF A;  4DHJ B;  1YD8 U;  2FUH B;  1J7B A;  4ANU A;  2O6V D;  2WXF A;  4OZC A;  4GDK A;  4W9F A;  5I4D A;  4ZHP A;  2Y5B B;  2HTM E;  3IBE A;  4WJP A;  2MJ3 A;  1RRB A;  3PRE A;  1J7C A;  2DBY A;  2RPV A;  4C00 A;  4EE2 A;  4RM8 A;  1LGR A;  4IC7 B;  4KDL B;  2MX2 A;  4ZHO A;  4HJK A;  1KLV A;  1HZ6 A;  3U4E G;  3AE2 B;  3RPF C;  2AL3 A;  3RNA C;  4MEL A;  1GNU A;  1XQQ A;  5HI1 A;  1FIQ A;  4G3X B;  3H7P B;  2HJ1 A;  1P7F A;  1I4X A;  1XCQ L;  4JWS C;  2QC8 A;  4MM3 A;  2MW5 A;  4S0R A;  2INC C;  2KMC A;  2K8H A;  1YJI A;  2KTR B;  4WJQ A;  3MC8 A;  4DHZ B;  4OVZ A;  3ZVV A;  4XYC A;  3JW0 X;  2WXQ A;  5AZG A;  5D3I B;  4NAM A;  1VJK A;  3GB1 A;  2SAK A;  2FAZ A;  3OWE B;  3VRB B;  2KFK A;  4LNO A;  1MJD A;  2FIF A;  2VZK D;  3WAN A;  4C4V B;  2K39 A;  1HZ5 A;  1WGK A;  2RPQ A;  2ZW0 A;  2C7H A;  2D3C A;  4P7I A;  1P0R A;  3Q69 A;  1OQQ A;  4E3C A;  4HXD A;  4NZL B;  1FPY A;  4EKU A;  1DOX A;  3IG3 A;  2UYZ B;  4HPL B;  3AEC B;  4UDU C;  3A9J A;  3ZXR A;  1PFD A;  3GZN I;  1SIJ A;  1SEB D;  3X0W A;  3Q3M C;  2DYO A;  3EGR A;  3NJT A;  4KIK A;  2O2V A;  2JX5 A;  2WHI A;  2WXM A;  5DCN A;  1TGZ B;  4I6P A;  2JZZ A;  4FHJ A;  5HG2 A;  4MJS B;  4IW0 A;  4YTM B;  1S1Q B;  2NTT A;  4M8N A;  1E90 A;  3L4P A;  1WGH A;  4ICV A;  3DVG X;  1WGG A;  3NVV A;  1QOB A;  1BXT A;  3Q2A C;  2Z8L A;  2FID A;  3QIJ A;  2WXH A;  2KX0 A;  2GB1 A;  3H7S A;  5IO9 A;  2IZV B;  5AUI A;  3W9C B;  1WXS A;  4HCN B;  4GN1 A;  2K25 A;  1UZX B;  1WRD B;  2BS4 B;  3MHS D;  1E5W A;  3DHH C;  1EU3 A;  2V4L A;  4N59 A;  3Q8F A;  4B6W A;  4WWN A;  2OOB B;  3DBL B;  3Q6B A;  1VZ6 A;  3BIN A;  1WMH B;  2INP E;  3IFW B;  2M19 A;  2Z0E B;  3E56 A;  1VRA B;  2LFI A;  2LI5 A;  2LJ5 A;  5H92 C;  1XT9 B;  2JXX A;  5MPO A;  1LM8 B;  2ZVN A;  1JWU D;  2QSD A;  4XWW A;  3RYT A;  4JQW C;  4K7U A;  3UQB A;  4ZOH C;  3DPD A;  3HRD D;  1HQR D;  1TZ1 A;  2CR5 A;  1FD6 A;  3BYY B;  1ZDV A;  2J0K A;  1WIA A;  1PYW D;  1R4N I;  4II2 B;  3TEZ A;  3V62 A;  2CU3 A;  4BBN C;  2BYF A;  1K53 A;  3Q3O C;  4K7W A;  5D6J B;  5G5G A;  4IUM B;  3T3N A;  3MFG A;  3W5U B;  1V2Y A;  1MVK A;  1P7E A;  3QA8 A;  2H88 B;  4NJ6 A;  3HM6 X;  4BKS D;  3NVY A;  2KX3 A;  1ZGU B;  3APC A;  3WA0 A;  4MT5 A;  2WXJ A;  3HVZ A;  2FNJ B;  3CST A;  1K51 A;  1E10 A;  3GS2 A;  3WAM A;  1WH3 A;  4C7Y A;  4RGM A;  1I4R A;  1BUI C;  2KJR A;  1PUT A;  2E3T A;  2YEP F;  4WQM A;  4TSS A;  2KLC A;  1EF1 A;  2Z0D B;  2M8S A;  4NAW A;  3TSS A;  2KWC A;  2OJW A;  2ONQ A;  4IG7 B;  2IND C;  3HK0 A;  5IP4 D;  5T8I A;  4DQO C;  4X57 B;  4D2K A;  2CU1 A;  2I1K A;  1ZXI A;  2H89 B;  2KC1 A;  4RF1 A;  1N63 A;  1GPX A;  4L1B A;  1I4H A;  2AYO B;  2X8X X;  3PSE B;  3U7D A;  1V1O A;  2ZJD A;  1WE7 A;  2MBB B;  1I35 A;  5E6O A;  1P3Q U;  5G55 A;  2AEH A;  1YIW A;  4W9I A;  3DBR I;  1WM2 A;  1SE2 A;  2QHO A;  2KYW A;  3H1U A;  1TS4 A;  1TS5 A;  4KSK C;  2L0F A;  1MPE A;  2LMC A;  4WJO A;  1OEY J;  1ACC A;  5HFY A;  4DBG A;  3VUY A;  4GIV A;  4ICU A;  2ACZ B;  1UEL A;  1KLG D;  4JIO U;  5JHB A;  2WDR B;  4XZ4 A;  2PTL A;  2ZNV B;  1IP9 A;  4GU2 A;  3ETR A;  4A6Q A;  1NYR A;  4IM0 A;  1L0V B;  4YSY B;  4FLH A;  3RT3 B;  3PRZ A;  3RNG C;  1UBQ A;  1CJE A;  2BF8 B;  4M0W A;  4M00 A;  2GMI C;  1B9R A;  4A8X C;  4LNF A;  2L05 A;  4A3O A;  4OVU A;  4C80 A;  3HHM A;  4HKZ E;  4JL9 A;  1NEN B;  1JCK B;  2IO2 B;  3O13 A;  2PJH A;  2XBB C;  4KZC A;  4RGT A;  3VVW B;  3PVL A;  1J19 A;  4TQ1 A;  3DOW A;  1R7S A;  5E6J A;  2J52 A;  2G4D B;  2WXR A;  1LFD A;  2IGG A;  1FNU A;  4IDI A;  1UUP A;  1QIL A;  4K81 A;  2WWZ A;  4BBN F;  4P6V F;  2GBK A;  3QAQ A;  2PE9 A;  3MTN B;  3Q8E A;  4YL8 A;  1WF9 A;  2WXK A;  5EE9 A;  2XEW A;  4GDK B;  5EE3 A;  1NEK B;  4HPM B;  3VAW A;  4FJV B;  2MBE A;  2WDQ B;  4HVB A;  3ZIM A;  3K9P B;  1ZKH A;  3AU4 A;  3B2G A;  1KOT A;  4AQ7 A;  1UGJ A;  1T0R C;  4MGZ E;  1RAX A;  4AWJ A;  1RYJ A;  1SGH A;  3B1L X;  2W55 A;  4GOC A;  2XK5 A;  2QIL A;  2RR9 A;  5IAA C;  3V6E B;  5LXI B;  1A5R A;  1J7A A;  3VDZ A;  2YVC A;  3BZD B;  4A20 A;  1KFY B;  1JQ4 A;  4MM3 B;  1NBF C;  2KKC A;  2QDF A;  3PPA A;  1MHX A;  4EZJ A;  2L52 A;  1N5W A;  5H8Y E;  1R4M I;  2CJO A;  2ZEQ A;  3DBS A;  3KLS X;  1GUA B;  2MQJ A;  4KV2 A;  2L00 B;  2ZZP B;  2Y3A A;  1EWC A;  1PGB A;  2KFK B;  1P1A A;  3SFE B;  4ZRI A;  1SSN A;  1HTO A;  2C7N B;  2BYE A;  2O6V A;  2ZW1 A;  3VXW A;  3PV1 A;  2QJL A;  4WH4 A;  1C79 A;  4MAC A;  3UGB B;  3NZ3 A;  4J6I A;  3ZDM C;  3V6C B;  3AB5 A;  1V80 A;  2L76 A;  4YTN B;  4II3 B;  3A9J B;  2V0G A;  1M4V A;  3M3J A;  3I3T B;  1N60 A;  2RDH A;  1F1H A;  2KOX A;  4XDC A;  2DYB A;  3TJP A;  4ARC A;  2O2V B;  5FK9 C;  1HTQ A;  3RUL A;  1UNS A;  2LAS A;  4HDO A;  4G50 A;  2QIE B;  4YTP B;  2NPT A;  2DLB A;  3FIL A;  4BOZ B;  1SJE D;  1T0Y A;  2CHZ A;  2REX A;  1TKE A;  2PEA A;  3UIN B;  2HJ8 A;  3CMM B;  3VUX A;  3EA6 A;  1PDX A;  4REZ A;  4P1C C;  1WZ0 A;  2V9H A;  1JRO A;  2PIA A;  1P98 A;  5BYS A;  3PGE A;  1E8Z A;  5BO4 B;  3ZQ4 A;  3AN1 A;  4IWQ A;  3PHW B;  2W82 A;  1HXY D;  1UD7 A;  4OZA A;  2DWQ A;  4ZRK A;  3U2S C;  1N62 A;  1V81 A;  2EEL A;  1WXQ A;  3DWM A;  1K52 A;  4TV3 A; 
#chains in the Genus database with same CATH homology
 1PQS A;  4ICV A;  4NQL B;  1Y8R C;  1WGG A;  3DVG X;  2N1W A;  3O65 B;  4W9L A;  2NS5 A;  4ZDV A;  2FID A;  4MSM B;  1E8X A;  3QIJ A;  3L0W B;  3K9O B;  2KX0 A;  2MWS B;  3T9L A;  3HM3 A;  2N7D A;  3JVZ X;  4LJP B;  3KVF B;  2M17 A;  5DPT A;  1IYF A;  2MRP A;  5CHW A;  3H7S A;  3PLU A;  2L8J A;  3NS8 A;  2IZV B;  2LVQ A;  2KNB A;  1C1Y B;  4E71 A;  1WXS A;  1LXD A;  2EMT A;  4HCN B;  3A4R A;  4GN1 A;  2CHX A;  4PS3 A;  2PPH A;  1SIF A;  2K25 A;  3ONS A;  4FHK A;  3M63 B;  1UZX B;  2FCS A;  1WRD B;  2DZM A;  2KDI A;  3AXC A;  4G0N B;  1H8C A;  2C7M B;  2LVO A;  2NVU I;  3MHS D;  3NZS A;  3VTU A;  1E5W A;  2JVC A;  2V4L A;  2L7R A;  2M1M A;  4B6W A;  4LCD E;  4WWN A;  1Z2M A;  1WFY A;  2OOB B;  1K8R B;  3VTW A;  4HCP B;  4HDQ A;  3BIN A;  4EZK A;  3B08 A;  1WMH B;  3IFW B;  2LRU A;  2Z0E B;  1H4R A;  2KN5 A;  3OLM D;  3EC8 A;  4HWI B;  4NY0 A;  1V6E A;  3PHX B;  2AL6 A;  2V1Y A;  1AAR A;  2LI5 A;  2LJ5 A;  1GG3 A;  2LUE A;  1NI2 A;  3L08 A;  4F8C B;  1XT9 B;  2JXX A;  3WAO A;  1I42 A;  4MJS A;  1LM8 B;  2ZVN A;  3RCZ A;  2VRR B;  3RD2 A;  3RYT A;  4JQW C;  4K7U A;  4A3P A;  4BKG A;  3UQB A;  3DPD A;  2LXC A;  4IWP A;  4K1R B;  1TZ1 A;  2CR5 A;  2N9P C;  3CF6 E;  2BGF A;  4ZYN A;  2J0K A;  1GC6 A;  1WIA A;  1WX9 A;  4FAD A;  2D07 B;  3M62 B;  3AU5 A;  4FJY A;  1EO6 A;  2MA9 B;  4KIK B;  5KHO A;  3R66 C;  1R4N I;  4I6N B;  1KM7 A;  3S2A A;  4II2 B;  2UWQ A;  2J7Q B;  3V62 A;  4BBN C;  2BYF A;  4NAW B;  2DYM A;  4CO7 A;  3HIZ A;  3ML8 A;  4K7W A;  3A1Q B;  3UF8 A;  5D6J B;  1OQY A;  1Q1O A;  5D2M B;  3ZRF A;  2IO3 B;  2L3Z A;  3W1Y A;  2KQ7 A;  4IUM B;  4MDK E;  2Z59 B;  5AZH A;  2EKE C;  2HE7 A;  4HLE A;  1WY8 A;  3EHV A;  1V2Y A;  4B95 A;  3GOE A;  3TIX A;  3QA8 A;  3UQA A;  1SE9 A;  4LDT B;  3DBL I;  4TUU A;  4NJ6 A;  2MSE D;  2A5U A;  3HM6 X;  4BKS D;  3V61 A;  2DEN B;  4MSQ B;  2KX3 A;  3ALB A;  2J0M A;  5C1Z A;  1ZGU B;  4MGK E;  3APC A;  3WA0 A;  1YJ1 A;  3P2B A;  3OJ3 A;  2LGY A;  5DPR A;  2FNJ B;  4AP4 C;  2JUO A;  3OAW A;  5AZF A;  3CST A;  5G2N A;  1P9D U;  4FA6 A;  1WGD A;  2KK8 A;  1YX5 B;  5JHA A;  3DBH I;  1WGR A;  2WDT B;  4TKN A;  3VTV A;  2JRH A;  3WAM A;  1WH3 A;  1WJN A;  4BKS A;  3X23 A;  2LGD A;  2K6Q A;  1U4A A;  3A4S C;  3KYC D;  4FJZ A;  4M8M A;  3LDZ E;  2K6D B;  2KJR A;  4WJN A;  5L95 C;  1F9J A;  3ZTD A;  5C23 A;  3WAP A;  2JZ3 B;  3QJZ A;  2MCN B;  4KSL C;  2KLC A;  1EF1 A;  2Z0D B;  5CTR C;  2M8S A;  4LDT D;  4NAW A;  2D11 A;  3ZNH B;  3VQI A;  2KWC A;  3DDC B;  2DAF A;  3L16 A;  2K1F A;  2CKH B;  3A1Q A;  4LJO B;  2JY6 A;  2JRI B;  4N9F 4;  4W9G A;  2BPS A;  1V49 A;  3KUD B;  1Q0W B;  4W9K A;  4W9H A;  4BOS C;  1E7V A;  3VH3 B;  4IG7 B;  4MEM A;  3SD5 A;  3L13 A;  4F1S A;  3TMP B;  3HK0 A;  2MBO A;  4DDI D;  1V86 A;  2GBR A;  3AUL A;  4W9D A;  3A33 B;  2K8C A;  3KYD D;  4X57 B;  2CU1 A;  2I1K A;  4I6L B;  3W1S C;  2KC1 A;  2KWV B;  4M0W B;  2KXJ A;  2KTF A;  3C0R B;  4G11 A;  1WX7 A;  1OEY A;  2AYO B;  5CHV C;  2BKR B;  4WAA A;  3IHP C;  2LVP A;  3NOB A;  3KH0 A;  3PSE B;  4MGY E;  2NCN A;  2N1V A;  2ZJD A;  1WE7 A;  3U7D A;  2MBB B;  4DHZ E;  1I35 A;  5E6O A;  1P3Q U;  2N4F A;  5G55 A;  2AEH A;  4ANV A;  1YIW A;  4NJ7 A;  3SHQ A;  4IWO A;  2FCM A;  1ZW7 A;  1V9J A;  4W9I A;  3DBR I;  1EUV B;  1Q5W B;  2B3A A;  1WM2 A;  2FCQ A;  3DVN U;  4FN2 A;  1G6J A;  2QHO A;  3RZW C;  1WR6 E;  2BKF A;  2K8B A;  2KWU B;  3MJW A;  3H1U A;  3PS6 A;  2L0T A;  4KSK C;  2L0F A;  3V60 A;  3N30 A;  3ML9 A;  2D10 A;  2G4S A;  3VHT C;  3ZRC A;  4AJW A;  4DDG D;  5HKH A;  4WJO A;  1OEY J;  5FR6 A;  2ZNV C;  2JPH A;  2ZPY A;  2KLG A;  4GDL B;  4KDI C;  3TCA A;  3VH4 B;  3D32 A;  3EEC A;  4NQK E;  1WXM A;  3T8M A;  3VUY A;  4DBG A;  4GIV A;  4ICU A;  4NPN A;  4GGQ A;  5E6P A;  1WZ3 A;  1VCB A;  2M0X A;  2ASQ A;  1UEL A;  2MP2 A;  2WX1 A;  2BWF A;  2IBI B;  2YLM A;  4JIO U;  5JHB A;  1V5O A;  3QHT A;  1TTN A;  1WXA A;  3JYU A;  4XZ4 A;  2ZNV B;  3ZKJ C;  1NDD A;  2KQS A;  2LGX A;  1IP9 A;  2KD0 A;  2RD0 A;  4GU2 A;  3JSV B;  2NBW B;  2ZVO A;  4EOY A;  4IM0 A;  3PRM B;  4ANW A;  1E90 A;  4FLH A;  3WIM A;  3RT3 B;  4W9E A;  3A9K B;  3PRZ A;  4FUL A;  2EMS A;  2IY1 B;  3APD A;  2LXA A;  3QX1 A;  3TL5 A;  1UBQ A;  2BF8 B;  3QQ8 B;  4BFR A;  3ZLZ A;  2GMI C;  5LXH A;  2L05 A;  4A3O A;  4OVU A;  3QCA A;  1VD2 A;  4DK5 A;  2DZK A;  3HHM A;  2GOW A;  1UH6 A;  2DZI A;  1L2N A;  2CS4 A;  1IPG A;  2LRW A;  2BWE S;  1QZE A;  4JL9 A;  3N32 A;  3W1S A;  4HK2 A;  2IO2 B;  2M4N A;  1YX6 B;  1WM3 A;  2PJH A;  2XBB C;  4KZC A;  2KFJ A;  4GB9 A;  3VVW B;  3PVL A;  2XK5 B;  1J19 A;  2KC2 A;  4TQ1 A;  3WAL A;  3DOW A;  5EDS A;  2G4D B;  2CHW A;  1LFD A;  3DVN V;  2N9X A;  4GDL A;  4K7S A;  4AJY B;  4PYU A;  2HD5 B;  2RSU A;  1ISN A;  1XD3 B;  1J8C A;  4B9K A;  4K81 A;  4NNJ B;  2ZPN A;  3NY5 A;  2BYV E;  4GSW A;  2WWZ A;  4F7Z A;  3APF A;  4BBN F;  3BY4 B;  4EFO A;  2KDF B;  1BT0 A;  3ENE A;  5JZE B;  2G3Q B;  1HE8 A;  3NZU A;  4OVV A;  2GBK A;  1GC7 A;  3QAQ A;  2PE9 A;  2R2Q A;  1JRU A;  1X1M A;  2IO1 B;  3DVG Y;  2IYD B;  3JSV A;  2LZ6 A;  3MTN B;  3UIP B;  3ZUN A;  3IVF A;  3DCG A;  4IM2 A;  3PT2 B;  1LQB A;  1WF9 A;  1Z5S B;  4YL8 A;  4GMV A;  4MGI E;  5GMV A;  2KO3 A;  3M95 A;  1M94 A;  3A9K A;  2J0J A;  2XEW A;  4GDK B;  2JWZ A;  3PZD A;  3ZNI D;  4JLC A;  4HPM B;  1WX8 A;  3VAW A;  2FCN A;  4FJV B;  2D2Q A;  2GBJ A;  2MBE A;  1E8W A;  3VFK A;  5TR5 A;  4ANX A;  5J18 A;  2V3S A;  4HVB A;  3ZIM A;  2MP2 B;  2KAN A;  3K9P B;  1ZKH A;  3AU4 A;  2MLB A;  4TV3 A;  4AUQ C;  4RMA A;  5KHQ A;  1KOT A;  3KUZ A;  1J0G A;  3ZO5 B;  3UIO B;  3QAR A;  1OTR B;  3CSF A;  2PE6 B;  4MGZ E;  1RAX A;  4AWJ A;  3PRP B;  5CHF A;  1SGH A;  2KJ6 A;  3B1L X;  4ASW C;  1EF5 A;  4GXB A;  4CYE A;  1L7Y A;  2IO0 B;  4GOC A;  2XK5 A;  5IAA C;  2RR9 A;  3U30 A;  3V6E B;  4EEW A;  3ZDT A;  4W9J A;  5LXI B;  3SDL C;  1A5R A;  4KZ0 A;  2W9N A;  1YQB A;  3VDZ A;  4DXA B;  5D7G A;  2KDB A;  2I1J A;  2YVC A;  4MH0 E;  4A20 A;  2LWP A;  3QC8 B;  3PLV A;  3L17 A;  1FXT B;  1NBF C;  5AEK B;  2KKC A;  4ZRJ A;  1MG8 A;  2GBN A;  1WJ6 A;  3PPA A;  2DX5 B;  5D94 A;  2C5L C;  3VUW A;  4DWF A;  3PTF C;  4PS8 A;  3R7Q A;  4EZJ A;  2DHZ A;  3RUI B;  1WJU A;  3KUC B;  4AOF A;  4DHJ B;  2ZCB A;  1R4M I;  3QK0 A;  1WE6 A;  2KVR A;  2ZEQ A;  4BKT A;  3TBL D;  1YD8 U;  3DBS A;  2FUH B;  4ANU A;  2O6V D;  2NBU A;  1RLF A;  4GDK A;  1GUA B;  3H6N A;  3NHE B;  2MQJ A;  4W9F A;  2Y5B B;  4KV2 A;  2NPT B;  3IBE A;  4WJP A;  2L00 B;  2ZZP B;  4WQO B;  1RRB A;  3PRE A;  2KFK B;  3ZNZ B;  1P1A A;  4ZRI A;  3RZF A;  4RM8 A;  2C7N B;  5JH5 C;  2MBQ A;  3DQV A;  2BYE A;  1GJZ A;  1WXV A;  3Q3F A;  2O6V A;  2N7E A;  3L54 A;  4IC7 B;  4KDL B;  2MX2 A;  4HJK A;  1KLV A;  2MBH A;  3VXW A;  1S3S G;  3PV1 A;  2C9W B;  3UGB B;  3ECI A;  4KVG B;  4BVU C;  2AL3 A;  1OGW A;  2A4Z A;  4MEL A;  1GNU A;  1XQQ A;  4JGH B;  4G3X B;  3H7P B;  4J6I A;  4DHJ D;  3ZDM C;  2JF5 A;  3V6C B;  2L76 A;  1V80 A;  2KHW B;  2NR2 A;  3ZW3 A;  4II3 B;  3A9J B;  4MM3 A;  1WJ4 A;  3U8Z A;  5J17 A;  1RFA A;  3M3J A;  5DPW A;  2MW5 A;  2OJR A;  2KMC A;  2K8H A;  5IA7 A;  1KJT A;  2DZJ A;  3I3T B;  2C60 A;  2KTR B;  4WJQ A;  1E7U A;  1C3T A;  2NBV B;  2KOX A;  3TJP A;  2DYB A;  3L10 B;  5DPS A;  5L83 A;  2O2V B;  3Q3J A;  4DHZ B;  3KW5 B;  3RUL A;  4PYZ A;  2GBM A;  2AWT A;  3ZVV A;  3QWZ B;  2LAS A;  4HDO A;  4G50 A;  2G45 B;  3JW0 X;  2KMA A;  4EZL A;  1WGY A;  2NPT A;  1TBE A;  2KDE B;  2IY0 B;  2KZR A;  2RGF A;  2WX0 A;  5AZG A;  1E8Y A;  4BOZ B;  1WI0 A;  2FAZ A;  1T0Y A;  5LLI A;  5CX3 A;  2CHZ A;  2KFK A;  3AI5 A;  2REX A;  3R3M A;  2FIF A;  2JT4 B;  2PEA A;  3WAN A;  1UBI A;  2K39 A;  3UIN B;  2RPQ A;  2HJ8 A;  4CHK A;  3CMM B;  3VUX A;  1WMH A;  2C7H A;  3SU8 X;  1V5T A;  3B0A A;  4W9C A;  4P7I A;  1P0R A;  4E3C A;  2KJH B;  1D3Z A;  4HXD A;  3H7P A;  1WZ0 A;  4EKU A;  3IG3 A;  4TQ0 A;  2UYZ B;  4HPL B;  3N3K B;  1P98 A;  2R2O A;  2ZCC A;  3A9J A;  4FBJ B;  1UGM A;  5J2R A;  3H9D A;  3GZN I;  3PGE A;  2N9E B;  2O6V B;  3X0W A;  1E8Z A;  2KTR A;  5BO4 B;  4XC2 A;  2D3G A;  4IWQ A;  3ZTC A;  3PHW B;  3OJ4 B;  2DYO A;  1UD7 A;  4KIK A;  2O2V A;  4URK A;  4RM9 A;  2HTH A;  5DCN A;  1TGZ B;  3LJ3 A;  4E74 A;  4EUT A;  4IM3 A;  5E6N A;  4I6P A;  2JZZ A;  4ZRK A;  3R7R A;  4FHJ A;  2DAJ A;  1V81 A;  4XX5 A;  4MJS B;  4IW0 A;  1S1Q B;  3ZNG C;  3EFU A;  4WWP A;  4WWO A;  1CMX B;  4M8N A;  2WYQ A;  2LD9 A;  1WR1 A;  4PS7 A;  1WYW B;  1WGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...