2IZVB

Crystal structure of socs-4 in complex with elongin-b and elongin-c at 2.55a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SUPPRESSOR OF CYTOKINE SIGNALING 4
publication title Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2izvB00
2KWVB 1Q0WB 3S2AA 4MSQB 3SU8X 4MGIE 1WM3A 3L13A 2I1JA 5CX3A 2WYQA 3AU5A 1L7YA 3L10B 3PPAA 4WWOA 3MHSD 3W1SC 2V3SA 3Q3FA 2MCNB 2XBBC 4BBNF 1C1YB 1AARA 4PYZA 3GZNI 4PS8A 3X0WA 2DYBA 4B95A 3M3JA 2KDIA 4DBGA 1V2YA 3ZVVA 4F8CB 1LQBA 2LRWA 4CO7A 2KXJA 3R7RA 3L08A 3LJ3A 4FA6A 4BOSC 2RPQA 3K9OB 3OLMD 4RM8A 1WGHA 1UZXB 3QA8A 4G0NB 1VD2A 2DHZA 2GBRA 4MGKE 5AZFA 4TV3A 3VTUA 1WR6E 4DHJB 4EZKA 1S1QB 3RT3B 4ANVA 2BGFA 4NJ6A 4EZJA 4IC7B 3UIPB 3V6CB 2ZVOA 1WH3A 2O6VA 3B1LX 2L0FA 3LDZE 4AJYB 1E5WA 3EFUA 1V81A 4A20A 4W9CA 3A4RA 1YQBA 2CU1A 2LWPA 5HKHA 2FCNA 3ML8A 3ZDTA 4KDIC 5C1ZA 1L2NA 1WXAA 1WMHA 3DVGX 3RD2A 2L76A 3DBRI 3APDA 2HD5B 4IG7B 2IY0B 2K39A 2NBVB 3I3TB 2KK8A 1ZGUB 4DWFA 2IO1B 2OOBB 2BKFA 2PE6B 2PEAA 2LVQA 4J6IA 3DPDA 4MDKE 1IPGA 3ZNID 1WMHB 3JVZX 3ZUNA 3QC8B 5EDSA 3HHMA 4AUQC 1EUVB 3DCGA 1RFAA 1S3SG 2ZVNA 4K81A 5D7GA 3QAQA 3WAMA 2ZJDA 4ANWA 2HE7A 3HK0A 1J0GA 2C7HA 2NBUA 2G45B 3ZDMC 4EFOA 1WGYA 3SDLC 1SE9A 3TIXA 2V4LA 2FIFA 2L8JA 4DDID 3V62A 3N3KB 1WXMA 1I42A 3AI5A 1LM8B 3IBEA 2LGXA 4FLHA 2YLMA 5JH5C 2LZ6A 2NS5A 2N4FA 2PJHA 2RD0A 1RAXA 2CR5A 2N9EB 1EF1A 2K8CA 2FCSA 2CKHB 1GNUA 5DPWA 2Z59B 3H7SA 3IG3A 2KNBA 3A4SC 4HK2A 2KZRA 3JSVA 3DBLI 4FN2A 4WQOB 3VVWB 4BKSA 3ZLZA 3U7DA 5AZGA 3RZFA 5L95C 4W9FA 3QWZB 1H4RA 4GDKA 4W9JA 4EEWA 3PT2B 3JSVB 2L7RA 2CHZA 3AULA 4EKUA 3HM3A 4TKNA 3ZIMA 4HDOA 1E8WA 4GOCA 3APFA 2MBQA 1E8YA 2IBIB 4DHJD 3PGEA 3R3MA 3DBHI 4GDKB 1YJ1A 2ZNVB 5IAAC 2LJ5A 4BBNC 2JRHA 1P1AA 2ZNVC 4ICVA 2BYVE 3B08A 3VTVA 2KWUB 5FR6A 3ZO5B 3VAWA 3IVFA 3CMMB 1YX6B 4GXBA 4ASWC 4DHZE 2NCNA 3ENEA 1X1MA 4HPMB 4N9F4 4E71A 2KJRA 3UQAA 3PRZA 1WX7A 4GMVA 3PZDA 4W9EA 3UGBB 2JVCA 3KW5B 1OEYA 5J17A 2D11A 3P2BA 1R4MI 2JF5A 2O6VD 3UF8A 3ZTDA 3SHQA 3RZWC 1P9DU 1IYFA 4X57B 4ANXA 4KDLB 2RSUA 4FULA 4I6LB 4I6NB 1YX5B 3U8ZA 1A5RA 4HXDA 5D94A 3NZSA 1WR1A 3Q3JA 4B9KA 2LVPA 4FADA 3M63B 4GIVA 3KYCD 2G4DB 5AEKB 1H8CA 2G3QB 2REXA 3PLUA 3R66C 1WI0A 1WXVA 2JRIB 3QHTA 2K8BA 2FCQA 3T9LA 2DZIA 1NBFC 3L54A 3V61A 4HCNB 4MGYE 1KOTA 1U4AA 4ICUA 2UWQA 1TBEA 2DX5B 1TZ1A 4KIKA 2AEHA 1Z2MA 2CHXA 2N9XA 3A9KA 4URKA 3PVLA 2CHWA 2IY1B 1K8RB 2KLGA 2GBNA 2NPTA 2JPHA 4KIKB 4LDTB 2MQJA 1SIFA 2XK5A 4MH0E 3NZUA 3V6EB 4IWOA 3A9KB 3MTNB 2EKEC 3A9JA 2JUOA 3PTFC 2R2OA 4NPNA 4ZYNA 4W9IA 2KLCA 1WF9A 1OQYA 3QIJA 4TUUA 3VUXA 5JHAA 2NPTB 1V86A 2KTRA 1WXSA 1GC7A 1WJUA 1V6EA 3CSTA 2XK5B 3M62B 1WGDA 2KN5A 3QX1A 2Z0EB 4E3CA 1Q1OA 4BKSD 2LRUA 3A9JB 4DDGD 4HWIB 5IA7A 4PYUA 1ZKHA 2XEWA 3WA0A 1M94A 2C9WB 1JRUA 2KTRB 3RYTA 2O6VB 4ZRJA 2QHOA 3ONSA 4M0WB 4LCDE 1Q5WB 3W1YA 2LI5A 3UIOB 3DVNU 2M17A 4FJYA 2KOXA 4IWPA 3QJZA 4A3OA 5J18A 1EO6A 2DYOA 2MBOA 5DPSA 2EMTA 1WIAA 3KH0A 1ZW7A 3QQ8B 4NNJB 5CHWA 2FIDA 2IO3B 1F9JA 1E90A 1PQSA 4HLEA 4G50A 1WY8A 1YD8U 2MBHA 3APCA 4IM2A 4K7SA 4IW0A 5DPRA 1E7VA 4CYEA 3PRMB 4EUTA 3DQVA 2KDBA 2K25A 2L3ZA 1XQQA 3V60A 3O65B 4DK5A 4BKTA 4B6WA 1ISNA 2AL3A 2DAJA 4GDLA 4JIOU 4K7WA 3ZRCA 1TTNA 1EF5A 4WWPA 4YL8A 3TJPA 2DAFA 4W9KA 1RRBA 2C5LC 2M8SA 2MP2A 2RGFA 4FBJB 2DZJA 3UINB 2KX3A 5JZEB 2LGDA 5CTRC 2ASQA 4GDLB 2WX0A 2PPHA 4WAAA 4NQLB 4ZDVA 4GU2A 4MEMA 1V49A 2M1MA 2W9NA 2KANA 3EC8A 4ZRIA 2N1VA 2MP2B 4GSWA 1XT9B 5D6JB 1G6JA 2Z0DB 4JGHB 4WJQA 2LUEA 3U30A 2LGYA 4NQKE 2O2VA 1KM7A 4DHZB 1Y8RC 4BFRA 2MRPA 3IHPC 2K1FA 2NR2A 1VCBA 2KMCA 2WX1A 2CS4A 3DDCB 4LDTD 2L00B 3L16A 3MJWA 1FXTB 2FNJB 2JZZA 5C23A 2O2VB 4W9GA 4LJPB 3QCAA 3H6NA 4IM3A 2LVOA 5AZHA 4JQWC 3GOEA 2KJHB 2KMAA 1NDDA 4OVUA 3VQIA 2L05A 4IWQA 4AP4C 1E8XA 3VUWA 1GUAB 4AOFA 1R4NI 5TR5A 3L17A 4HJKA 4BKGA 4EZLA 4KV2A 3WALA 4OVVA 2MBEA 1GJZA 1Z5SB 3TBLD 4F1SA 4FJVB 2YVCA 4NJ7A 2GOWA 3N30A 4W9HA 2MLBA 2NVUI 2N7DA 2FCMA 3PLVA 2B3AA 3PV1A 3JW0X 3NHEB 3M95A 1HE8A 1XD3B 1UBQA 1WZ3A 1GG3A 2D10A 3ZW3A 4XX5A 1UH6A 3OJ3A 3X23A 4IUMB 2KKCA 1WRDB 4RM9A 2D3GA 1KJTA 2A5UA 1WYWB 2NBWB 4TQ1A 2KO3A 3R7QA 4AWJA 4BOZB 3N32A 2J0MA 4MELA 1P98A 5G55A 4E74A 2UYZB 4KZCA 4PS3A 1V80A 2VRRB 3VUYA 2KFJA 2K6QA 4ANUA 1UD7A 3W1SA 2C60A 5BO4B 2G4SA 2J7QB 3BY4B 3PREA 2LD9A 3ALBA 5CHVC 4G3XB 2JY6A 5DCNA 3WIMA 3ZNGC 1BT0A 2LXCA 2BKRB 4NY0A 2IYDB 2IO2B 2MW5A 2Y5BB 1GC6A 2ZEQA 4FJZA 5L83A 4P7IA 3CF6E 5KHOA 3VHTC 2M4NA 4KZ0A 5J2RA 3ZKJC 3OJ4B 5E6OA 2MSED 3ZTCA 3DOWA 5E6PA 1UELA 1WX8A 2DENB 2KQSA 3PS6A 3TMPB 2KDEB 1RLFA 2BF8B 1WZ0A 2KDFB 2K8HA 4FHJA 2BWES 2HTHA 3RCZA 1MG8A 2MX2A 2A4ZA 2IO0B 4FHKA 2R2QA 1P3QU 2MWSB 3KYDD 1YIWA 3NOBA 2M0XA 2L0TA 2J0KA 2GMIC 2ZZPB 3RUIB 3VH3B 1P0RA 2PE9A 3VH4B 1C3TA 3H1UA 1UBIA 3H7PA 2GBMA 3D32A 3QARA 2OJRA 1WJ6A 3SD5A 3A1QA 4HCPB 2KFKA 4CHKA 4KVGB 2BPSA 2KWCA 2DZKA 2KVRA 3C0RB 2I1KA 3H7PB 4M8NA 2BYEA 3K9PB 1WX9A 2WDTB 1WGGA 3A1QB 2J0JA 2KHWB 2MA9B 1V5TA 3OAWA 3DVNV 2KFKB 3DBSA 4JL9A 1V9JA 5E6NA 3TCAA 5G2NA 4GGQA 4WJNA 3B0AA 2ZCBA 4MSMB 3KUZA 1WJ4A 2N1WA 3ML9A 3IFWB 1J8CA 4HVBA 3RULA 3ECIA 4M8MA 2V1YA 2ZPYA 2KTFA 4HDQA 3AXCA 2ZCCA 5LLIA 4XC2A 4PS7A 4AJWA 2AYOB 4NAWA 3EECA 1D3ZA 5KHQA 4GB9A 4HPLB 4GN1A 1E8ZA 1WFYA 1T0YA 4I6PA 4F7ZA 3NY5A 4MGZE 3T8MA 4RMAA 1WJNA 1OTRB 1WM2A 3NS8A 4NAWB 2ZPNA 2K6DB 1WE6A 4JLCA 4A3PA 1E7UA 3UQBA 2IZVB 2FUHB 4II2B 3AU4A 2RR9A 2KD0A 5DPTA 4TQ0A 5D2MB 4WJOA 2EMSA 1UGMA 3H9DA 2KC2A 3DVGY 1LFDA 2BWFA 2GBKA 3VDZA 3TL5A 1WGRA 3CSFA 3WAPA 3PSEB 2KJ6A 2JWZA 3PHXB 4G11A 4II3B 2D07B 3EHVA 2KC1A 4KSKC 4MM3A 3WANA 3ZRFA 1LXDA 3HIZA 4W9LA 4K7UA 3JYUA 5GMVA 1CMXB 1J19A 2N9PC 4KSLC 2DZMA 4W9DA 4EOYA 1OEYJ 1TGZB 1KLVA 3PHWB 2DYMA 3L0WB 3QK0A 1WE7A 4ZRKA 2BYFA 4MJSA 1OGWA 2C7NB 2C7MB 2KX0A 2LXAA 2HJ8A 5LXIB 2KQ7A 3ZNHB 1V5OA 2D2QA 2JT4B 2AL6A 4WWNA 4MJSB 4XZ4A 4K1RB 1IP9A 2LASA 2WWZA 2MBBB 4IM0A 4WJPA 3VXWA 3ZNZB 2N7EA 3VTWA 1NI2A 3KUCB 3PRPB 3WAOA 3KVFB 5CHFA 1I35A 4DXAB 5LXHA 1SGHA 2AWTA 2JXXA 3VFKA 4BVUC 3KUDB 1QZEA 3A33B 4LJOB 3BINA 2JZ3B 5JHBA 2FAZA 2GBJA 3HM6X
chains in the Genus database with same CATH superfamily
1SSNA 3S2AA 4XDCA 3SU8X 2WYQA 3MFGA 2WQYB 2FBWB 3PPAA 3V05A 3W1SC 2V3SA 2XBBC 4B95A 1AARA 4PS8A 3IAS1 2KDIA 4YTMB 1FRRA 1LQBA 3LJ3A 4BOSC 2RPQA 3K9OB 2L83A 1MI0A 1VD2A 5AZFA 2GBRA 1S1QB 3DBHB 2CU3A 3UIPB 3V6CB 4AQ7A 4IDIA 2ZVOA 3B1LX 1KTKA 1TKYA 3U4EG 1SE3A 3IT4B 1FCLA 4A20A 4W9CA 1CK1A 2Q5WD 2HJ1A 5HKHA 3DHHC 3ZDTA 1R4MB 5BMHA 2ACZB 4S17A 3APDA 4IG7B 2IY0B 1B1ZA 1FM0D 2KK8A 3AE5B 2IO1B 4DWFA 1C9FA 1QF6A 3DPDA 4LNIA 4K81A 1S3SG 2IGHA 2ZVNA 3QAQA 4ANWA 2HE7A 1J0GA 3ZDMC 4EFOA 1WGYA 3SDLC 1GB1A 1SE9A 3TIXA 2V4LA 2L8JA 4Q2JA 1I42A 2RPVA 3IBEA 5JH5C 2LZ6A 1DOIA 3MC9A 2FUG1 1P7FA 1YQ4B 1OQQA 2KNBA 4UDUC 4HK2A 3L4PA 1XLNA 3DBLI 4BKSA 3ZLZA 1QOFA 4W9FA 4RGNA 2G9HD 1H4RA 1EU4A 2L7RA 3HM3A 4HDOA 2MBQA 2MEKA 1YJ1A 1ZDXA 2ZNVB 2LJ5A 4BBNC 3B08A 3DBRB 2KWUB 5FR6A 3ZO5B 3IVFA 1XO3A 4DHZE 2JYTA 4N9F4 3UQAA 1VJKA 5J17A 3KW5B 2D11A 2ONQA 2O6VD 3UF8A 3SHQA 3RZWC 4X57B 4KDLB 1UNSA 4HXDA 4C4VA 1FNUA 3BVMA 5AEKB 2KN4A 2REXA 3LXFA 5BYSA 4C4VB 1KLGD 5HFYA 1NBFC 2PTLA 3L54A 2PLPA 2LHDA 3AB5A 4ICUA 2DX5B 3DWMA 3AN1A 3SFDB 3A9KA 3PVLA 2CHWA 2KLGA 2WXHA 4JX1C 3AEDB 1SIFA 3A9KB 3PTFC 4NPNA 4W9IA 3VUXA 5JHAA 1QQRA 4L1BA 1WJUA 3ETRA 3M62B 3KWVA 2LRUA 4HWIB 1JRUA 3RYTA 2QHOA 3BYYB 2LI5A 4JWSC 3UIOB 3QJZA 4NJCA 1EO6A 5BYRA 2VZKD 2OEDA 2EMTA 1I4QA 2WXJA 1WIAA 1ZW7A 4KKJA 2FIDA 1F9JA 1PQSA 2ON8A 3GE8C 4HLEA 2IPKD 1YD8U 3APCA 2LJIA 1L6UA 2KDBA 2X38A 2K25A 2L3ZA 2D5GA 3O65B 1L0VB 4HKZE 4WWPA 1BUIC 4KGTA 3UINB 1YN4A 5JZEB 1I4HA 5CTRC 4MACA 1HXYD 4GU2A 1JQ4A 1V49A 2KANA 3EC8A 4ZRIA 1XT9B 2Y3AA 4DHZB 1KM7A 4BFRA 1I7HA 1VCBA 5IO9A 4LDTD 2RMMA 2JZZA 1KH0A 4LJPB 2K0PA 1SB3C 3EUB2 4RGMA 1HA5A 3GOEA 2KMAA 4QAYA 4ARIA 3CIRB 2L05A 4AP4C 1T0SC 1FXIA 1E8XA 5TR5A 4BKGA 3NVWA 3WALA 4LNNA 5AUKA 2DBYA 2WXNA 1GJZA 2INCC 3PZ7A 4FJVB 3N30A 4YSZB 2SEBD 2BW2A 2NVUI 3B2GA 4BAXA 3M95A 1MPEA 2KWDA 3X23A 1UH6A 1N5WA 1WRDB 2CJOA 2KO3A 4BOZB 1C4CA 4WIPA 2J0MA 1P98A 4KZCA 3RNEC 3T3OA 1GB4A 3BY4B 1F1HA 4G3XB 1BT0A 2PVGC 2JQRB 2MW5A 2W3RA 2Y5BB 2ZEQA 2JWUA 1YQ3B 3AE6B 3BWUD 4NZLB 4P7IA 2M4NA 4KZ0A 5FK9C 3AM9A 3DOWA 2Z8LA 2INNE 2KDEB 4KKIA 1I4RA 4FHJA 3N1ZC 1TT5B 2BWES 2HTHA 3RCZA 1MG8A 2MX2A 2IO0B 4REZA 4FHKA 4YSXB 2GI9A 3KYDD 1SBBB 2L0TA 3OG5A 2ZZPB 2N0SB 3RUIB 3VH3B 1P0RA 3VH4B 2GBMA 3WCQA 3BIID 4KVGB 4ZYSA 1IGDA 2MJEA 2KWCA 2DZKA 3C0RB 2BYEA 3K9PB 2WDTB 1WGGA 2J0JA 2MA9B 4P6VF 3DVNV 4JL9A 3GS2A 4WJNA 3P63A 4RGTA 4M8MA 4AS1A 1NYRA 1T3QA 4PS7A 2BBCA 2LMCA 1N6ZA 2W82A 1D6EC 2R61A 1QILA 5TSSA 2EKIA 2ZPNA 1WE6A 3UQBA 2IZVB 2QC8A 5HG2A 3AU4A 3TEWA 1STEA 4TQ0A 4WJOA 3J9CA 3GE3C 1UGMA 5IN7A 1C76A 2KC2A 5D3IB 3BVZA 2GBKA 1T0RC 3VDZA 3AEBB 4HEA1 3WAPA 3AEEB 3EA6A 4II3B 4KSKC 2D07B 3I9V1 2D3AA 1J19A 4W9DA 3PHWB 3L0WB 4MJSA 1K52A 1RYJA 2LXAA 3BVGA 4IOIE 1SE2A 3BK1A 1ROEA 4WWNA 4MJSB 2LASA 4IM0A 2N7EA 3VTWA 4B0EA 5CHFA 4ZHPA 2AWTA 2JXXA 2BB6A 4LJOB 1D5ZC 4MGIE 1EM7A 4WWOA 1C1YB 4PYZA 1WYGA 1V2YA 2X8XX 3R7RA 3NVZA 4GLSC 4FA6A 1XXGA 1E9MA 1UZXB 4RGOS 3QA8A 4EZKA 4ANVA 2BGFA 4IC7B 5C3JB 3AE9B 4LNKA 2O6VA 2L0FA 3LDZE 4WAFA 1LGRA 3EFUA 2CU1A 3ML8A 2H88B 4KDIC 1YNTE 5C1ZA 3N1XC 4HKQA 1WMHA 3DVGX 3DBRI 4WH4A 2HD5B 2NBVB 3I3TB 4US8A 4YTNB 1AWDA 2BKFA 3Q8AA 1DGJA 4MDKE 3TEYA 1WMHB 1TS2A 3AE4B 5EDSA 1EUVB 3DCGA 4A3PA 2NBUA 2G45B 1T6BX 1AW7A 1JWAD 3AE3B 3GZNB 1N5XA 2YLMA 2QSDA 2N4FA 2RD0A 2CR5A 3AE2B 1YJIA 2K8CA 3P4QB 1NEKB 1N63A 3H7SA 4L23A 3A4SC 4FN2A 3VVWB 1F52A 1GOZA 3U7DA 3RZFA 3AEAB 4GDKA 2L52A 3NVVA 2CHZA 3AULA 4EKUA 3TUOA 3ZIMA 2IBIB 3PGEA 3Q69A 4GDKB 3LYYA 2ZNVC 2Y5CA 2BYVE 3DHIC 1TS3A 1MFWA 2VZKB 1YX6B 3ENEA 2KJRA 4GMVA 3PZDA 3UGBB 2BS3B 2WNMA 3ZTDA 3ZXRA 3E56A 3BK2A 3FKYA 4ANXA 2RSUA 1J7AA 3IAM1 1YX5B 1A5RA 5D94A 1WR1A 1SXTA 3M63B 2W54A 2NTTA 4GIVA 2G4DB 2K22A 3I63C 1P7EA 1YN5A 3PLUA 3BYTB 3QHTA 2M0AA 1KOTA 1XLOA 1FPYA 1TKGA 5LNK1 1PGBA 4URKA 3IXSA 1TYGB 4LDTB 3KLSX 3NZUA 3V6EB 4IWOA 4ZRPA 3V3XA 2BVCA 2EKEC 2R2OA 1V86A 2KTRA 1NENB 3KQ4A 1GC7A 1V6EA 4M0WA 3CSTA 1WGDA 4E3CA 2Z0EB 1DYQA 1ZKHA 1R4NB 1M94A 1JALA 2KTRB 4M0WB 3GP7A 3SFEB 4FJYA 4A3OA 5J18A 1C4PA 2AX5A 2INPE 4ACFA 2PKOA 1E90A 3RMKC 3RFZB 1JWSD 1WSPA 4YT0B 3V60A 3AECB 2WDRB 4BKTA 4XGAB 4B6WA 2DAJA 4GDLA 4K7WA 1SIJA 4YL8A 4W9KA 2M8SA 2RGFA 2DZJA 1AYFA 2ASQA 4GDLB 4MEMA 1F77A 2M1MA 1FNWA 4JGHB 3P1MA 3U30A 2LGYA 4NQKE 2O2VA 1K50A 1XCQL 2KMCA 4XWTA 3ZJVA 2CS4A 4ZOHC 2O2VB 3W5VB 3QCAA 4IM3A 5AZHA 4JQWC 5GXGB 3U52E 1EWCA 2LGIA 3VUWA 1GUAB 4AOFA 2NMQA 4HJKA 2JZPA 4OVVA 2LGSA 4NJ7A 1T0QC 3R2TA 1HE8A 4YXDB 1UBQA 2JSVX 2QDFA 5AUIA 1GG3A 3ZW3A 4XX5A 3OJ3A 4YTPB 2BB5A 2KKCA 4IUMB 2ZW1A 4AWJA 3N32A 1NI3A 2SAKA 1ZXIA 4E74A 1M4VA 1ZUD2 2WU5B 3W1SA 3C8YA 3NVYA 2C60A 3NZ3A 3PREA 2JY6A 1YJJA 2LXCA 2WXPA 1B9RA 4NY0A 2IYDB 2IO2B 4FJZA 5L83A 3CF6E 3TEXA 3VHTC 3OJ4B 5E6OA 1WX8A 1EWYC 3TMPB 1JWMD 2FE8A 3I57A 5EE0A 2HDEA 2MJ3A 1C77A 2QCZA 1YIWA 2HTME 3NOBA 3MC8A 1QT9A 1L4ZB 1IBXA 2PE9A 1UBIA 3H7PA 3D32A 3A1QA 5EE1A 4CHKA 2BPSA 1IBXB 2KVRA 2I1KA 1R7SA 2NTSA 3H7PB 4M8NA 2BS4B 3A1QB 3N1YC 2IGGA 4HJGE 1VDVA 3DBSA 2JYEA 1V9JA 5E6NA 5G2NA 3AH7A 4MSMB 4WURA 3ECIA 4OW0A 3Q3OC 4AJWA 3C19A 4HPLB 1E8ZA 1WFYA 2DWQA 3T8MA 1WJNA 1WM2A 3NS8A 4JLCA 1V1OA 2FUHB 2KD0A 2JX5A 3AEFB 3N20C 1UGJA 2JXTA 3H9DA 1LFDA 2BWFA 1TY0A 2MH7A 1XCTL 2IJ0A 2JWZA 2PMVA 1I4GA 3EHVA 3ZRFA 2KC1A 4ZHOA 4K7UA 3JYUA 1CMXB 2N9PC 2DZMA 4C00A 1OEYJ 1WE7A 1OGWA 2V0GA 5IKCM 3N9YC 2G1EA 2AL6A 1J7BA 4K1RB 3RNBC 2ICIA 1IP9A 2V3PA 3VXWA 3ZNZB 3HVZA 3KUCB 3PRPB 4N59A 3WAOA 1Q10A 4DXAB 1FIQA 1HQRD 1QZEA 3RN9C 3SR6A 1E7PB 3NG0A 1C4AA 2KWVB 1WM3A 1XEEA 2I1JA 5CX3A 3AU5A 4A90A 3MHSD 3Q3FA 3GZNI 2DYBA 1F0ZA 2CJNA 3DBLB 4EE2A 3ZVVA 4F8CB 2LRWA 4CO7A 2KXJA 3VR9B 1YN3A 3T3NA 1V97A 3ZJTA 4NAMA 4RCOA 5FKAC 2QJLA 4NJ6A 4EZJA 1VZ7A 2RDHA 1E5WA 1V81A 1YQBA 1RWSA 2LWPA 2KVZA 1L2NA 1WXAA 2ZW0A 2L76A 3Q8FA 4FXCA 2KAJA 2K39A 1ZGUB 4J6IA 3ZNID 3JVZX 3QC8B 2C7HA 3V62A 2PW9A 2WXGA 3AI5A 2LGXA 4FLHA 1VR9A 2IDYA 3Q8BA 4OZBA 1HTOA 2NS5A 1RAXA 2J42A 2FCSA 5DPWA 1QLBB 3FILA 4N6EB 3JSVA 1K53A 5AZGA 1WRIA 5L95C 3QWZB 4D2KA 4W9JA 3FILB 3PT2B 3JSVB 1V8CA 2KT7A 3APFA 1SJED 4GOCA 1E8YA 4DHJD 3R3MA 3DBHI 1HZ6A 3VAWA 3B9JA 2NCNA 4HPMB 1X1MA 2L32A 3PRZA 2BYTA 2JVCA 1OEYA 1R4MI 2JF5A 1P9DU 4I6LB 4I6NB 2BT6A 3U8ZA 3NZSA 2M19A 2LVPA 1DOYA 4P1CC 1SEBD 1C79A 1H8CA 2G3QB 3CWIA 3R66C 2JRIB 2K8BA 2FCQA 2DZIA 3E9SA 3RNAC 2BTEA 3NRZA 3V61A 4HCNB 2UWQA 5G5GA 3OWEB 5FR3A 3PO0A 4KIKA 2QMTA 2CHXA 3DHGC 2N9XA 1TZOA 2DLBA 1K8RB 2JPHA 4KIKB 1WWTA 2XK5A 2N9KA 3MTNB 2JUOA 4ZYNA 2KLCA 2B76B 3QIJA 1WXSA 2XK5B 2KN5A 1Q1OA 1QOAA 4DDGD 5IA7A 4PYUA 3VRBB 1VLBA 3WA0A 1VZ8A 2O6VB 3ONSA 2WLBA 2WXLA 3W1YA 1Q5WB 1N61A 3SEBA 2YEPB 3DVNU 2DYOA 2WS3B 3KH0A 3QQ8B 4R3DA 2IO3B 1UWMA 4K7SA 3URYA 4IM2A 4IW0A 5BMIA 1E7VA 1FO4A 3DQVA 1XQQA 2WHIA 4O1NA 1ISNA 4JIOU 3ZRCA 2I38A 4K3BA 2MP2A 2C5LC 2K5PA 2WGSA 1I4XA 2LGDA 4XYCA 3ZYYX 2WX0A 4ZDVA 4NQLB 1XLPA 2MP2B 5D6JB 1G6JA 2Z0DB 3Q6BA 3IHPC 3ZGZA 2K1FA 2NR2A 4S0RA 4M00A 2WX1A 3DDCB 2L00B 1Y56A 3L16A 2FNJB 3AV8A 5C23A 1FEHA 4HPPA 4W9GA 1MHXA 1PYWD 3H6NA 2LVOA 1IUEA 2KJHB 1VRAB 3VR8B 1NDDA 3VQIA 4IWQA 4RF0A 1D5MC 2LHEA 4EZLA 4KV2A 3B2FA 1Z5SB 4KGSA 1E10A 3RNCC 2YVCA 2GOWA 1N60A 2N7DA 3PLVA 4CQNA 1XD3B 1WZ3A 5JXVA 4M01A 2D3GA 2WDQB 3R8BA 1D4BA 3R7QA 1JRPA 1WXQA 2WDVB 2VRRB 4PK1A 2KFJA 4TSSA 2K6QA 4ANUA 1UD7A 2G4SA 2J7QB 2LD9A 5CHVC 5DCNA 3ZNGC 1ET9A 1FCCC 4YSYB 3Q2AC 1MG4A 3ZKJC 2M56B 1QKZA 5E6PA 2KQSA 2DENB 1HTQA 3PS6A 2E3TA 2AQ3B 4YWGG 1TJEA 3U7ZA 2D3BA 2BF8B 3RI7C 2K8HA 4A55A 3I5JC 1KF6B 2A4ZA 2MHJA 2R2QA 1P3QU 2D3CA 2MWSB 4ARCA 1D5XC 4P1BC 4C7YA 3SD5A 1MVKA 4HCPB 1FFVA 2TSSA 2KFKA 2J53A 2WXFA 3NUHB 2K3UA 1BXTA 2GLSA 2KHWB 3OAWA 2KFKB 4JWUC 1UWXA 3BZDB 1RM6C 2KYWA 3VRAB 4GGQA 2ZCBA 2OHFA 5EE3A 3KUZA 1WJ4A 3ML9A 1XLQA 3GB1A 2MJDA 2V3NA 3RULA 2V1YA 3AXCA 5T8IA 4XC2A 4NAWA 3EECA 2WU2B 1D3ZA 2XN9C 3FAHA 5KHQA 4GN1A 4F7ZA 3NY5A 4MGZE 1PGXA 4RMAA 2WP9B 4NAWB 1E7UA 2RR9A 5DPTA 3MHZA 3NS1A 3DVGY 3AE8B 3TSSA 1FMAD 3TL5A 5IOIA 3CSFA 3PSEB 2KJ6A 4G11A 4HRSA 1LXDA 5GMVA 2QIEB 4PT5A 1TGZB 2LFIA 2DYMA 3QK0A 2WXRA 1ZPSA 2BYFA 3W9CB 2C7MB 2HJ8A 2KQ7A 2WXQA 2JT4B 5BMGA 1NYQA 1L0XB 4XZ4A 1KRHA 2WWZA 2MBBB 1NI2A 3KVFB 5LXHA 3VFKA 4BVUC 2LUMA 3A33B 1FFUA 3BINA 2JZ3B 5C2TB 1WH3A 1UF0A 3ZJUA 1FRDA 1Q0WB 1RFKA 2KACA 4MSQB 2N9LA 3HVDA 3L13A 3U2SC 1L7YA 3L10B 2MCNB 3PZ8A 4BBNF 3X0WA 1BMLC 3M3JA 4DBGA 4RF1A 3EGRA 3IT6B 3AEGB 3L08A 4H2AA 3OLMD 4RM8A 5BYQA 1WGHA 3MJ5A 3ABVB 2V9HA 1I4PA 4G0NB 2DHZA 4DHJB 4MGKE 4TV3A 1TS5A 1WR6E 3VTUA 3RT3B 4J3OD 4N58A 1YOVB 1JW9D 4AJYB 3MC0B 1NVID 3A4RA 4USAA 1SE4A 2FCNA 1ACCA 3Q3MC 1K51A 3RD2A 5HI1A 1V1PA 3FC4A 1FD6A 2OOBB 2PE6B 3P42A 2PEAA 2LVQA 2QEJC 4XDDA 1IPGA 3ZUNA 2WXIA 3HHMA 4AUQC 2KQ4X 5D7GA 1RFAA 4WWMA 5EE9A 3WAMA 4EOYA 1V1PB 1ZOYB 2ZJDA 3HK0A 2L1AA 1QOBA 2FIFA 4DDID 3N3KB 1WXMA 1LM8B 4XE0A 2PJHA 1OFFA 2N9EB 1EF1A 2CKHB 1GNUA 1L0YB 2Z59B 3IG3A 3P4SB 2KZRA 4WQOB 4B0MA 4LLGM 4MT5A 2XNAC 3P4PB 1MJDA 4MH8A 4EEWA 4TKNA 1E8WA 2IGDA 5IAAC 1CQVA 3P4RB 2JRHA 1P1AA 2BQQA 4ICVA 3VTVA 4ZRQA 3CMMB 4GXBA 4ASWC 1E6EB 4E71A 1WX7A 4W9EA 3P2BA 1IYFA 2WXKA 1UUPA 4FULA 2VH1A 3Q3JA 4JE3B 4KX6B 4B9KA 4FADA 3KYCD 4JPSA 3Q8CA 1ZDVA 2RDGA 4US9A 4BZAA 3HRDD 1WI0A 1CJEA 1WXVA 3RNGC 3T9LA 2KDMA 4M02A 5HHDG 4MGYE 1U4AA 1TBEA 3Q8EA 1TZ1A 3ZXVA 1FNVA 2AEHA 1Z2MA 2UU7A 3Q14C 1HZ5A 1MHHE 4IKGA 2IY1B 4A6QA 2GBNA 2NPTA 2MQJA 5I4DA 4LK0M 4MH0E 4K3CA 1TIFA 3A9JA 1T5XD 1WF9A 1OQYA 2J52A 4TUUA 2GB1A 2NPTB 1L6VA 3QX1A 4L2YA 4BKSD 3A9JB 2AQ1B 4LTUA 5D3DA 4XWWA 2XEWA 1VZ6A 2C9WB 4ZRJA 1PUTA 3RPFC 1QOGA 1TKEA 4LCDE 1L5PA 2M17A 2KOXA 4IWPA 2MBOA 5DPSA 4LNOA 4NNJB 5CHWA 2Y5PA 1KFYB 4G50A 1WY8A 2MBHA 2K9XA 5DPRA 4OZCA 4CYEA 3PRMB 4EUTA 2VH2A 3H8HA 1ET6A 4DK5A 2AL3A 1TTNA 1EF5A 3TJPA 2DAFA 1RRBA 4FBJB 2KX3A 3TEZA 1JWBD 4WAAA 2PPHA 2JU6X 1JROA 2W9NA 2YEPF 2N1VA 4GSWA 4C7ZA 4WJQA 5E6JA 2LUEA 1Y8RC 1YMHE 2MRPA 1IGCA 1ZXHA 3NJTA 5G5HA 3UI3A 3MJWA 1FXTB 1N62A 1JMLA 1WGKA 3O13A 4A8XC 1ENFA 4OVUA 2OJWA 3MP9A 4DXGA 1R4NI 3L17A 3EFCA 4OZAA 2H89B 2MBEA 2W55A 3TBLD 2KMMA 4F1SA 2V4IB 4W9HA 1DOXA 1PFDA 2MLBA 2FCMA 2B3AA 3PV1A 3JW0X 1L4DB 2I2YA 2EELA 3NHEB 4KGRA 2D10A 4RM9A 1SF0A 1KJTA 2A5UA 1F2RI 4RNAA 1WYWB 2NBWB 4TQ1A 2J4XA 2E6XA 4MELA 5G55A 1ESFA 2PIAA 1JCKB 2UYZB 4PS3A 4P16A 1PDXA 1V80A 3VUYA 1TY2A 5BO4B 1ZP0B 3ALBA 3WIMA 4LNFA 2BKRB 1KLUD 1GC6A 2WXOA 5KHOA 1GPXA 3R2IA 2LEKA 5J2RA 3AMZA 2GRIA 2MSED 3ZTCA 2N7JA 1UELA 1GAQB 1RLFA 1WZ0A 2KDFB 5MPOA 4RFBA 4DQOC 1AN8A 2M0XA 2J0KA 2GMIC 3LB8C 1C3TA 3H1UA 2RDBC 3QARA 2OJRA 1HEZE 1WJ6A 3Q3NC 4WQMA 1PGAA 5H8YE 3W2DA 1F2RC 1WX9A 3W5UB 1V5TA 2WXMA 1TS4A 4ITKA 3TCAA 2PVOD 3B0AA 1J7CA 1ZE3D 2N1WA 3KWLA 4TMAB 3IFWB 4OHJA 1J8CA 4HVBA 2ZPYA 2KTFA 4HDQA 1OQRA 2ZCCA 5LLIA 3ZQ4A 1JWUD 1A70A 2AYOB 4HROA 4GB9A 1T0YA 4I6PA 4DXFA 5H92C 4C80A 1OTRB 2BS2B 2K6DB 4II2B 5D2MB 3AE1B 2EMSA 3AE7B 2DNFA 1WGRA 3RNFC 3PHXB 3WANA 4MM3A 2W3SA 3HIZA 4W9LA 1SJHD 2AQ2B 4KSLC 1EU3A 1FXAA 2INDC 1KLVA 1E0ZA 4MM3B 4ZRKA 3DWGC 2C7NB 2KX0A 1C78A 2QILA 5LXIB 5IP4D 3ZNHB 4RH6A 4C56C 1V5OA 2D2QA 4A9AA 4OVZA 3HUIA 4WJPA 1XF5L 1I35A 1CZPA 1SGHA 3KUDB 5JHBA 2FAZA 2GBJA 3HM6X 1LO5D
chains in the Genus database with same CATH topology
2KWVB 1Q0WB 3S2AA 4MSQB 3SU8X 4MGIE 1WM3A 3L13A 2I1JA 5CX3A 2WYQA 3AU5A 1L7YA 3L10B 3PPAA 4WWOA 3MHSD 3W1SC 2V3SA 3Q3FA 2MCNB 2XBBC 4BBNF 1C1YB 1AARA 4PYZA 3GZNI 4PS8A 3X0WA 2DYBA 4B95A 3M3JA 2KDIA 4DBGA 1V2YA 3ZVVA 4F8CB 1LQBA 2LRWA 4CO7A 2KXJA 3R7RA 3L08A 3LJ3A 4FA6A 4BOSC 2RPQA 3K9OB 3OLMD 4RM8A 1WGHA 1UZXB 3QA8A 4G0NB 1VD2A 2DHZA 2GBRA 4MGKE 5AZFA 4TV3A 3VTUA 1WR6E 4DHJB 4EZKA 1S1QB 3RT3B 4ANVA 2BGFA 4NJ6A 4EZJA 4IC7B 3UIPB 3V6CB 2ZVOA 1WH3A 2O6VA 3B1LX 2L0FA 3LDZE 4AJYB 1E5WA 3EFUA 1V81A 4A20A 4W9CA 3A4RA 1YQBA 2CU1A 2LWPA 5HKHA 2FCNA 3ML8A 3ZDTA 4KDIC 5C1ZA 1L2NA 1WXAA 1WMHA 3DVGX 3RD2A 2L76A 3DBRI 3APDA 2HD5B 4IG7B 2IY0B 2K39A 2NBVB 3I3TB 2KK8A 1ZGUB 4DWFA 2IO1B 2OOBB 2BKFA 2PE6B 2PEAA 2LVQA 4J6IA 3DPDA 4MDKE 1IPGA 3ZNID 1WMHB 3JVZX 3ZUNA 3QC8B 5EDSA 3HHMA 4AUQC 1EUVB 3DCGA 1RFAA 1S3SG 2ZVNA 4K81A 5D7GA 3QAQA 3WAMA 2ZJDA 4ANWA 2HE7A 3HK0A 1J0GA 2C7HA 2NBUA 2G45B 3ZDMC 4EFOA 1WGYA 3SDLC 1SE9A 3TIXA 2V4LA 2FIFA 2L8JA 4DDID 3V62A 3N3KB 1WXMA 1I42A 3AI5A 1LM8B 3IBEA 2LGXA 4FLHA 2YLMA 5JH5C 2LZ6A 2NS5A 2N4FA 2PJHA 2RD0A 1RAXA 2CR5A 2N9EB 1EF1A 2K8CA 2FCSA 2CKHB 1GNUA 5DPWA 2Z59B 3H7SA 3IG3A 2KNBA 3A4SC 4HK2A 2KZRA 3JSVA 3DBLI 4FN2A 4WQOB 3VVWB 4BKSA 3ZLZA 3U7DA 5AZGA 3RZFA 5L95C 4W9FA 3QWZB 1H4RA 4GDKA 4W9JA 4EEWA 3PT2B 3JSVB 2L7RA 2CHZA 3AULA 4EKUA 3HM3A 4TKNA 3ZIMA 4HDOA 1E8WA 4GOCA 3APFA 2MBQA 1E8YA 2IBIB 4DHJD 3PGEA 3R3MA 3DBHI 4GDKB 1YJ1A 2ZNVB 5IAAC 2LJ5A 4BBNC 2JRHA 1P1AA 2ZNVC 4ICVA 2BYVE 3B08A 3VTVA 2KWUB 5FR6A 3ZO5B 3VAWA 3IVFA 3CMMB 1YX6B 4GXBA 4ASWC 4DHZE 2NCNA 3ENEA 1X1MA 4HPMB 4N9F4 4E71A 2KJRA 3UQAA 3PRZA 1WX7A 4GMVA 3PZDA 4W9EA 3UGBB 2JVCA 3KW5B 1OEYA 5J17A 2D11A 3P2BA 1R4MI 2JF5A 2O6VD 3UF8A 3ZTDA 3SHQA 3RZWC 1P9DU 1IYFA 4X57B 4ANXA 4KDLB 2RSUA 4FULA 4I6LB 4I6NB 1YX5B 3U8ZA 1A5RA 4HXDA 5D94A 3NZSA 1WR1A 3Q3JA 4B9KA 2LVPA 4FADA 3M63B 4GIVA 3KYCD 2G4DB 5AEKB 1H8CA 2G3QB 2REXA 3PLUA 3R66C 1WI0A 1WXVA 2JRIB 3QHTA 2K8BA 2FCQA 3T9LA 2DZIA 1NBFC 3L54A 3V61A 4HCNB 4MGYE 1KOTA 1U4AA 4ICUA 2UWQA 1TBEA 2DX5B 1TZ1A 4KIKA 2AEHA 1Z2MA 2CHXA 2N9XA 3A9KA 4URKA 3PVLA 2CHWA 2IY1B 1K8RB 2KLGA 2GBNA 2NPTA 2JPHA 4KIKB 4LDTB 2MQJA 1SIFA 2XK5A 4MH0E 3NZUA 3V6EB 4IWOA 3A9KB 3MTNB 2EKEC 3A9JA 2JUOA 3PTFC 2R2OA 4NPNA 4ZYNA 4W9IA 2KLCA 1WF9A 1OQYA 3QIJA 4TUUA 3VUXA 5JHAA 2NPTB 1V86A 2KTRA 1WXSA 1GC7A 1WJUA 1V6EA 3CSTA 2XK5B 3M62B 1WGDA 2KN5A 3QX1A 2Z0EB 4E3CA 1Q1OA 4BKSD 2LRUA 3A9JB 4DDGD 4HWIB 5IA7A 4PYUA 1ZKHA 2XEWA 3WA0A 1M94A 2C9WB 1JRUA 2KTRB 3RYTA 2O6VB 4ZRJA 2QHOA 3ONSA 4M0WB 4LCDE 1Q5WB 3W1YA 2LI5A 3UIOB 3DVNU 2M17A 4FJYA 2KOXA 4IWPA 3QJZA 4A3OA 5J18A 1EO6A 2DYOA 2MBOA 5DPSA 2EMTA 1WIAA 3KH0A 1ZW7A 3QQ8B 4NNJB 5CHWA 2FIDA 2IO3B 1F9JA 1E90A 1PQSA 4HLEA 4G50A 1WY8A 1YD8U 2MBHA 3APCA 4IM2A 4K7SA 4IW0A 5DPRA 1E7VA 4CYEA 3PRMB 4EUTA 3DQVA 2KDBA 2K25A 2L3ZA 1XQQA 3V60A 3O65B 4DK5A 4BKTA 4B6WA 1ISNA 2AL3A 2DAJA 4GDLA 4JIOU 4K7WA 3ZRCA 1TTNA 1EF5A 4WWPA 4YL8A 3TJPA 2DAFA 4W9KA 1RRBA 2C5LC 2M8SA 2MP2A 2RGFA 4FBJB 2DZJA 3UINB 2KX3A 5JZEB 2LGDA 5CTRC 2ASQA 4GDLB 2WX0A 2PPHA 4WAAA 4NQLB 4ZDVA 4GU2A 4MEMA 1V49A 2M1MA 2W9NA 2KANA 3EC8A 4ZRIA 2N1VA 2MP2B 4GSWA 1XT9B 5D6JB 1G6JA 2Z0DB 4JGHB 4WJQA 2LUEA 3U30A 2LGYA 4NQKE 2O2VA 1KM7A 4DHZB 1Y8RC 4BFRA 2MRPA 3IHPC 2K1FA 2NR2A 1VCBA 2KMCA 2WX1A 2CS4A 3DDCB 4LDTD 2L00B 3L16A 3MJWA 1FXTB 2FNJB 2JZZA 5C23A 2O2VB 4W9GA 4LJPB 3QCAA 3H6NA 4IM3A 2LVOA 5AZHA 4JQWC 3GOEA 2KJHB 2KMAA 1NDDA 4OVUA 3VQIA 2L05A 4IWQA 4AP4C 1E8XA 3VUWA 1GUAB 4AOFA 1R4NI 5TR5A 3L17A 4HJKA 4BKGA 4EZLA 4KV2A 3WALA 4OVVA 2MBEA 1GJZA 1Z5SB 3TBLD 4F1SA 4FJVB 2YVCA 4NJ7A 2GOWA 3N30A 4W9HA 2MLBA 2NVUI 2N7DA 2FCMA 3PLVA 2B3AA 3PV1A 3JW0X 3NHEB 3M95A 1HE8A 1XD3B 1UBQA 1WZ3A 1GG3A 2D10A 3ZW3A 4XX5A 1UH6A 3OJ3A 3X23A 4IUMB 2KKCA 1WRDB 4RM9A 2D3GA 1KJTA 2A5UA 1WYWB 2NBWB 4TQ1A 2KO3A 3R7QA 4AWJA 4BOZB 3N32A 2J0MA 4MELA 1P98A 5G55A 4E74A 2UYZB 4KZCA 4PS3A 1V80A 2VRRB 3VUYA 2KFJA 2K6QA 4ANUA 1UD7A 3W1SA 2C60A 5BO4B 2G4SA 2J7QB 3BY4B 3PREA 2LD9A 3ALBA 5CHVC 4G3XB 2JY6A 5DCNA 3WIMA 3ZNGC 1BT0A 2LXCA 2BKRB 4NY0A 2IYDB 2IO2B 2MW5A 2Y5BB 1GC6A 2ZEQA 4FJZA 5L83A 4P7IA 3CF6E 5KHOA 3VHTC 2M4NA 4KZ0A 5J2RA 3ZKJC 3OJ4B 5E6OA 2MSED 3ZTCA 3DOWA 5E6PA 1UELA 1WX8A 2DENB 2KQSA 3PS6A 3TMPB 2KDEB 1RLFA 2BF8B 1WZ0A 2KDFB 2K8HA 4FHJA 2BWES 2HTHA 3RCZA 1MG8A 2MX2A 2A4ZA 2IO0B 4FHKA 2R2QA 1P3QU 2MWSB 3KYDD 1YIWA 3NOBA 2M0XA 2L0TA 2J0KA 2GMIC 2ZZPB 3RUIB 3VH3B 1P0RA 2PE9A 3VH4B 1C3TA 3H1UA 1UBIA 3H7PA 2GBMA 3D32A 3QARA 2OJRA 1WJ6A 3SD5A 3A1QA 4HCPB 2KFKA 4CHKA 4KVGB 2BPSA 2KWCA 2DZKA 2KVRA 3C0RB 2I1KA 3H7PB 4M8NA 2BYEA 3K9PB 1WX9A 2WDTB 1WGGA 3A1QB 2J0JA 2KHWB 2MA9B 1V5TA 3OAWA 3DVNV 2KFKB 3DBSA 4JL9A 1V9JA 5E6NA 3TCAA 5G2NA 4GGQA 4WJNA 3B0AA 2ZCBA 4MSMB 3KUZA 1WJ4A 2N1WA 3ML9A 3IFWB 1J8CA 4HVBA 3RULA 3ECIA 4M8MA 2V1YA 2ZPYA 2KTFA 4HDQA 3AXCA 2ZCCA 5LLIA 4XC2A 4PS7A 4AJWA 2AYOB 4NAWA 3EECA 1D3ZA 5KHQA 4GB9A 4HPLB 4GN1A 1E8ZA 1WFYA 1T0YA 4I6PA 4F7ZA 3NY5A 4MGZE 3T8MA 4RMAA 1WJNA 1OTRB 1WM2A 3NS8A 4NAWB 2ZPNA 2K6DB 1WE6A 4JLCA 4A3PA 1E7UA 3UQBA 2IZVB 2FUHB 4II2B 3AU4A 2RR9A 2KD0A 5DPTA 4TQ0A 5D2MB 4WJOA 2EMSA 1UGMA 3H9DA 2KC2A 3DVGY 1LFDA 2BWFA 2GBKA 3VDZA 3TL5A 1WGRA 3CSFA 3WAPA 3PSEB 2KJ6A 2JWZA 3PHXB 4G11A 4II3B 2D07B 3EHVA 2KC1A 4KSKC 4MM3A 3WANA 3ZRFA 1LXDA 3HIZA 4W9LA 4K7UA 3JYUA 5GMVA 1CMXB 1J19A 2N9PC 4KSLC 2DZMA 4W9DA 4EOYA 1OEYJ 1TGZB 1KLVA 3PHWB 2DYMA 3L0WB 3QK0A 1WE7A 4ZRKA 2BYFA 4MJSA 1OGWA 2C7NB 2C7MB 2KX0A 2LXAA 2HJ8A 5LXIB 2KQ7A 3ZNHB 1V5OA 2D2QA 2JT4B 2AL6A 4WWNA 4MJSB 4XZ4A 4K1RB 1IP9A 2LASA 2WWZA 2MBBB 4IM0A 4WJPA 3VXWA 3ZNZB 2N7EA 3VTWA 1NI2A 3KUCB 3PRPB 3WAOA 3KVFB 5CHFA 1I35A 4DXAB 5LXHA 1SGHA 2AWTA 2JXXA 3VFKA 4BVUC 3KUDB 1QZEA 3A33B 4LJOB 3BINA 2JZ3B 5JHBA 2FAZA 2GBJA 3HM6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWV B;  1Q0W B;  3S2A A;  4MSQ B;  3SU8 X;  4MGI E;  1WM3 A;  3L13 A;  2I1J A;  5CX3 A;  2WYQ A;  3AU5 A;  1L7Y A;  3L10 B;  3PPA A;  4WWO A;  3MHS D;  3W1S C;  2V3S A;  3Q3F A;  2MCN B;  2XBB C;  4BBN F;  1C1Y B;  1AAR A;  4PYZ A;  3GZN I;  4PS8 A;  3X0W A;  2DYB A;  4B95 A;  3M3J A;  2KDI A;  4DBG A;  1V2Y A;  3ZVV A;  4F8C B;  1LQB A;  2LRW A;  4CO7 A;  2KXJ A;  3R7R A;  3L08 A;  3LJ3 A;  4FA6 A;  4BOS C;  2RPQ A;  3K9O B;  3OLM D;  4RM8 A;  1WGH A;  1UZX B;  3QA8 A;  4G0N B;  1VD2 A;  2DHZ A;  2GBR A;  4MGK E;  5AZF A;  4TV3 A;  3VTU A;  1WR6 E;  4DHJ B;  4EZK A;  1S1Q B;  3RT3 B;  4ANV A;  2BGF A;  4NJ6 A;  4EZJ A;  4IC7 B;  3UIP B;  3V6C B;  2ZVO A;  1WH3 A;  2O6V A;  3B1L X;  2L0F A;  3LDZ E;  4AJY B;  1E5W A;  3EFU A;  1V81 A;  4A20 A;  4W9C A;  3A4R A;  1YQB A;  2CU1 A;  2LWP A;  5HKH A;  2FCN A;  3ML8 A;  3ZDT A;  4KDI C;  5C1Z A;  1L2N A;  1WXA A;  1WMH A;  3DVG X;  3RD2 A;  2L76 A;  3DBR I;  3APD A;  2HD5 B;  4IG7 B;  2IY0 B;  2K39 A;  2NBV B;  3I3T B;  2KK8 A;  1ZGU B;  4DWF A;  2IO1 B;  2OOB B;  2BKF A;  2PE6 B;  2PEA A;  2LVQ A;  4J6I A;  3DPD A;  4MDK E;  1IPG A;  3ZNI D;  1WMH B;  3JVZ X;  3ZUN A;  3QC8 B;  5EDS A;  3HHM A;  4AUQ C;  1EUV B;  3DCG A;  1RFA A;  1S3S G;  2ZVN A;  4K81 A;  5D7G A;  3QAQ A;  3WAM A;  2ZJD A;  4ANW A;  2HE7 A;  3HK0 A;  1J0G A;  2C7H A;  2NBU A;  2G45 B;  3ZDM C;  4EFO A;  1WGY A;  3SDL C;  1SE9 A;  3TIX A;  2V4L A;  2FIF A;  2L8J A;  4DDI D;  3V62 A;  3N3K B;  1WXM A;  1I42 A;  3AI5 A;  1LM8 B;  3IBE A;  2LGX A;  4FLH A;  2YLM A;  5JH5 C;  2LZ6 A;  2NS5 A;  2N4F A;  2PJH A;  2RD0 A;  1RAX A;  2CR5 A;  2N9E B;  1EF1 A;  2K8C A;  2FCS A;  2CKH B;  1GNU A;  5DPW A;  2Z59 B;  3H7S A;  3IG3 A;  2KNB A;  3A4S C;  4HK2 A;  2KZR A;  3JSV A;  3DBL I;  4FN2 A;  4WQO B;  3VVW B;  4BKS A;  3ZLZ A;  3U7D A;  5AZG A;  3RZF A;  5L95 C;  4W9F A;  3QWZ B;  1H4R A;  4GDK A;  4W9J A;  4EEW A;  3PT2 B;  3JSV B;  2L7R A;  2CHZ A;  3AUL A;  4EKU A;  3HM3 A;  4TKN A;  3ZIM A;  4HDO A;  1E8W A;  4GOC A;  3APF A;  2MBQ A;  1E8Y A;  2IBI B;  4DHJ D;  3PGE A;  3R3M A;  3DBH I;  4GDK B;  1YJ1 A;  2ZNV B;  5IAA C;  2LJ5 A;  4BBN C;  2JRH A;  1P1A A;  2ZNV C;  4ICV A;  2BYV E;  3B08 A;  3VTV A;  2KWU B;  5FR6 A;  3ZO5 B;  3VAW A;  3IVF A;  3CMM B;  1YX6 B;  4GXB A;  4ASW C;  4DHZ E;  2NCN A;  3ENE A;  1X1M A;  4HPM B;  4N9F 4;  4E71 A;  2KJR A;  3UQA A;  3PRZ A;  1WX7 A;  4GMV A;  3PZD A;  4W9E A;  3UGB B;  2JVC A;  3KW5 B;  1OEY A;  5J17 A;  2D11 A;  3P2B A;  1R4M I;  2JF5 A;  2O6V D;  3UF8 A;  3ZTD A;  3SHQ A;  3RZW C;  1P9D U;  1IYF A;  4X57 B;  4ANX A;  4KDL B;  2RSU A;  4FUL A;  4I6L B;  4I6N B;  1YX5 B;  3U8Z A;  1A5R A;  4HXD A;  5D94 A;  3NZS A;  1WR1 A;  3Q3J A;  4B9K A;  2LVP A;  4FAD A;  3M63 B;  4GIV A;  3KYC D;  2G4D B;  5AEK B;  1H8C A;  2G3Q B;  2REX A;  3PLU A;  3R66 C;  1WI0 A;  1WXV A;  2JRI B;  3QHT A;  2K8B A;  2FCQ A;  3T9L A;  2DZI A;  1NBF C;  3L54 A;  3V61 A;  4HCN B;  4MGY E;  1KOT A;  1U4A A;  4ICU A;  2UWQ A;  1TBE A;  2DX5 B;  1TZ1 A;  4KIK A;  2AEH A;  1Z2M A;  2CHX A;  2N9X A;  3A9K A;  4URK A;  3PVL A;  2CHW A;  2IY1 B;  1K8R B;  2KLG A;  2GBN A;  2NPT A;  2JPH A;  4KIK B;  4LDT B;  2MQJ A;  1SIF A;  2XK5 A;  4MH0 E;  3NZU A;  3V6E B;  4IWO A;  3A9K B;  3MTN B;  2EKE C;  3A9J A;  2JUO A;  3PTF C;  2R2O A;  4NPN A;  4ZYN A;  4W9I A;  2KLC A;  1WF9 A;  1OQY A;  3QIJ A;  4TUU A;  3VUX A;  5JHA A;  2NPT B;  1V86 A;  2KTR A;  1WXS A;  1GC7 A;  1WJU A;  1V6E A;  3CST A;  2XK5 B;  3M62 B;  1WGD A;  2KN5 A;  3QX1 A;  2Z0E B;  4E3C A;  1Q1O A;  4BKS D;  2LRU A;  3A9J B;  4DDG D;  4HWI B;  5IA7 A;  4PYU A;  1ZKH A;  2XEW A;  3WA0 A;  1M94 A;  2C9W B;  1JRU A;  2KTR B;  3RYT A;  2O6V B;  4ZRJ A;  2QHO A;  3ONS A;  4M0W B;  4LCD E;  1Q5W B;  3W1Y A;  2LI5 A;  3UIO B;  3DVN U;  2M17 A;  4FJY A;  2KOX A;  4IWP A;  3QJZ A;  4A3O A;  5J18 A;  1EO6 A;  2DYO A;  2MBO A;  5DPS A;  2EMT A;  1WIA A;  3KH0 A;  1ZW7 A;  3QQ8 B;  4NNJ B;  5CHW A;  2FID A;  2IO3 B;  1F9J A;  1E90 A;  1PQS A;  4HLE A;  4G50 A;  1WY8 A;  1YD8 U;  2MBH A;  3APC A;  4IM2 A;  4K7S A;  4IW0 A;  5DPR A;  1E7V A;  4CYE A;  3PRM B;  4EUT A;  3DQV A;  2KDB A;  2K25 A;  2L3Z A;  1XQQ A;  3V60 A;  3O65 B;  4DK5 A;  4BKT A;  4B6W A;  1ISN A;  2AL3 A;  2DAJ A;  4GDL A;  4JIO U;  4K7W A;  3ZRC A;  1TTN A;  1EF5 A;  4WWP A;  4YL8 A;  3TJP A;  2DAF A;  4W9K A;  1RRB A;  2C5L C;  2M8S A;  2MP2 A;  2RGF A;  4FBJ B;  2DZJ A;  3UIN B;  2KX3 A;  5JZE B;  2LGD A;  5CTR C;  2ASQ A;  4GDL B;  2WX0 A;  2PPH A;  4WAA A;  4NQL B;  4ZDV A;  4GU2 A;  4MEM A;  1V49 A;  2M1M A;  2W9N A;  2KAN A;  3EC8 A;  4ZRI A;  2N1V A;  2MP2 B;  4GSW A;  1XT9 B;  5D6J B;  1G6J A;  2Z0D B;  4JGH B;  4WJQ A;  2LUE A;  3U30 A;  2LGY A;  4NQK E;  2O2V A;  1KM7 A;  4DHZ B;  1Y8R C;  4BFR A;  2MRP A;  3IHP C;  2K1F A;  2NR2 A;  1VCB A;  2KMC A;  2WX1 A;  2CS4 A;  3DDC B;  4LDT D;  2L00 B;  3L16 A;  3MJW A;  1FXT B;  2FNJ B;  2JZZ A;  5C23 A;  2O2V B;  4W9G A;  4LJP B;  3QCA A;  3H6N A;  4IM3 A;  2LVO A;  5AZH A;  4JQW C;  3GOE A;  2KJH B;  2KMA A;  1NDD A;  4OVU A;  3VQI A;  2L05 A;  4IWQ A;  4AP4 C;  1E8X A;  3VUW A;  1GUA B;  4AOF A;  1R4N I;  5TR5 A;  3L17 A;  4HJK A;  4BKG A;  4EZL A;  4KV2 A;  3WAL A;  4OVV A;  2MBE A;  1GJZ A;  1Z5S B;  3TBL D;  4F1S A;  4FJV B;  2YVC A;  4NJ7 A;  2GOW A;  3N30 A;  4W9H A;  2MLB A;  2NVU I;  2N7D A;  2FCM A;  3PLV A;  2B3A A;  3PV1 A;  3JW0 X;  3NHE B;  3M95 A;  1HE8 A;  1XD3 B;  1UBQ A;  1WZ3 A;  1GG3 A;  2D10 A;  3ZW3 A;  4XX5 A;  1UH6 A;  3OJ3 A;  3X23 A;  4IUM B;  2KKC A;  1WRD B;  4RM9 A;  2D3G A;  1KJT A;  2A5U A;  1WYW B;  2NBW B;  4TQ1 A;  2KO3 A;  3R7Q A;  4AWJ A;  4BOZ B;  3N32 A;  2J0M A;  4MEL A;  1P98 A;  5G55 A;  4E74 A;  2UYZ B;  4KZC A;  4PS3 A;  1V80 A;  2VRR B;  3VUY A;  2KFJ A;  2K6Q A;  4ANU A;  1UD7 A;  3W1S A;  2C60 A;  5BO4 B;  2G4S A;  2J7Q B;  3BY4 B;  3PRE A;  2LD9 A;  3ALB A;  5CHV C;  4G3X B;  2JY6 A;  5DCN A;  3WIM A;  3ZNG C;  1BT0 A;  2LXC A;  2BKR B;  4NY0 A;  2IYD B;  2IO2 B;  2MW5 A;  2Y5B B;  1GC6 A;  2ZEQ A;  4FJZ A;  5L83 A;  4P7I A;  3CF6 E;  5KHO A;  3VHT C;  2M4N A;  4KZ0 A;  5J2R A;  3ZKJ C;  3OJ4 B;  5E6O A;  2MSE D;  3ZTC A;  3DOW A;  5E6P A;  1UEL A;  1WX8 A;  2DEN B;  2KQS A;  3PS6 A;  3TMP B;  2KDE B;  1RLF A;  2BF8 B;  1WZ0 A;  2KDF B;  2K8H A;  4FHJ A;  2BWE S;  2HTH A;  3RCZ A;  1MG8 A;  2MX2 A;  2A4Z A;  2IO0 B;  4FHK A;  2R2Q A;  1P3Q U;  2MWS B;  3KYD D;  1YIW A;  3NOB A;  2M0X A;  2L0T A;  2J0K A;  2GMI C;  2ZZP B;  3RUI B;  3VH3 B;  1P0R A;  2PE9 A;  3VH4 B;  1C3T A;  3H1U A;  1UBI A;  3H7P A;  2GBM A;  3D32 A;  3QAR A;  2OJR A;  1WJ6 A;  3SD5 A;  3A1Q A;  4HCP B;  2KFK A;  4CHK A;  4KVG B;  2BPS A;  2KWC A;  2DZK A;  2KVR A;  3C0R B;  2I1K A;  3H7P B;  4M8N A;  2BYE A;  3K9P B;  1WX9 A;  2WDT B;  1WGG A;  3A1Q B;  2J0J A;  2KHW B;  2MA9 B;  1V5T A;  3OAW A;  3DVN V;  2KFK B;  3DBS A;  4JL9 A;  1V9J A;  5E6N A;  3TCA A;  5G2N A;  4GGQ A;  4WJN A;  3B0A A;  2ZCB A;  4MSM B;  3KUZ A;  1WJ4 A;  2N1W A;  3ML9 A;  3IFW B;  1J8C A;  4HVB A;  3RUL A;  3ECI A;  4M8M A;  2V1Y A;  2ZPY A;  2KTF A;  4HDQ A;  3AXC A;  2ZCC A;  5LLI A;  4XC2 A;  4PS7 A;  4AJW A;  2AYO B;  4NAW A;  3EEC A;  1D3Z A;  5KHQ A;  4GB9 A;  4HPL B;  4GN1 A;  1E8Z A;  1WFY A;  1T0Y A;  4I6P A;  4F7Z A;  3NY5 A;  4MGZ E;  3T8M A;  4RMA A;  1WJN A;  1OTR B;  1WM2 A;  3NS8 A;  4NAW B;  2ZPN A;  2K6D B;  1WE6 A;  4JLC A;  4A3P A;  1E7U A;  3UQB A;  2IZV B;  2FUH B;  4II2 B;  3AU4 A;  2RR9 A;  2KD0 A;  5DPT A;  4TQ0 A;  5D2M B;  4WJO A;  2EMS A;  1UGM A;  3H9D A;  2KC2 A;  3DVG Y;  1LFD A;  2BWF A;  2GBK A;  3VDZ A;  3TL5 A;  1WGR A;  3CSF A;  3WAP A;  3PSE B;  2KJ6 A;  2JWZ A;  3PHX B;  4G11 A;  4II3 B;  2D07 B;  3EHV A;  2KC1 A;  4KSK C;  4MM3 A;  3WAN A;  3ZRF A;  1LXD A;  3HIZ A;  4W9L A;  4K7U A;  3JYU A;  5GMV A;  1CMX B;  1J19 A;  2N9P C;  4KSL C;  2DZM A;  4W9D A;  4EOY A;  1OEY J;  1TGZ B;  1KLV A;  3PHW B;  2DYM A;  3L0W B;  3QK0 A;  1WE7 A;  4ZRK A;  2BYF A;  4MJS A;  1OGW A;  2C7N B;  2C7M B;  2KX0 A;  2LXA A;  2HJ8 A;  5LXI B;  2KQ7 A;  3ZNH B;  1V5O A;  2D2Q A;  2JT4 B;  2AL6 A;  4WWN A;  4MJS B;  4XZ4 A;  4K1R B;  1IP9 A;  2LAS A;  2WWZ A;  2MBB B;  4IM0 A;  4WJP A;  3VXW A;  3ZNZ B;  2N7E A;  3VTW A;  1NI2 A;  3KUC B;  3PRP B;  3WAO A;  3KVF B;  5CHF A;  1I35 A;  4DXA B;  5LXH A;  1SGH A;  2AWT A;  2JXX A;  3VFK A;  4BVU C;  3KUD B;  1QZE A;  3A33 B;  4LJO B;  3BIN A;  2JZ3 B;  5JHB A;  2FAZ A;  2GBJ A;  3HM6 X; 
#chains in the Genus database with same CATH topology
 1SSN A;  3S2A A;  4XDC A;  3SU8 X;  2WYQ A;  3MFG A;  2WQY B;  2FBW B;  3PPA A;  3V05 A;  3W1S C;  2V3S A;  2XBB C;  4B95 A;  1AAR A;  4PS8 A;  3IAS 1;  2KDI A;  4YTM B;  1FRR A;  1LQB A;  3LJ3 A;  4BOS C;  2RPQ A;  3K9O B;  2L83 A;  1MI0 A;  1VD2 A;  5AZF A;  2GBR A;  1S1Q B;  3DBH B;  2CU3 A;  3UIP B;  3V6C B;  4AQ7 A;  4IDI A;  2ZVO A;  3B1L X;  1KTK A;  1TKY A;  3U4E G;  1SE3 A;  3IT4 B;  1FCL A;  4A20 A;  4W9C A;  1CK1 A;  2Q5W D;  2HJ1 A;  5HKH A;  3DHH C;  3ZDT A;  1R4M B;  5BMH A;  2ACZ B;  4S17 A;  3APD A;  4IG7 B;  2IY0 B;  1B1Z A;  1FM0 D;  2KK8 A;  3AE5 B;  2IO1 B;  4DWF A;  1C9F A;  1QF6 A;  3DPD A;  4LNI A;  4K81 A;  1S3S G;  2IGH A;  2ZVN A;  3QAQ A;  4ANW A;  2HE7 A;  1J0G A;  3ZDM C;  4EFO A;  1WGY A;  3SDL C;  1GB1 A;  1SE9 A;  3TIX A;  2V4L A;  2L8J A;  4Q2J A;  1I42 A;  2RPV A;  3IBE A;  5JH5 C;  2LZ6 A;  1DOI A;  3MC9 A;  2FUG 1;  1P7F A;  1YQ4 B;  1OQQ A;  2KNB A;  4UDU C;  4HK2 A;  3L4P A;  1XLN A;  3DBL I;  4BKS A;  3ZLZ A;  1QOF A;  4W9F A;  4RGN A;  2G9H D;  1H4R A;  1EU4 A;  2L7R A;  3HM3 A;  4HDO A;  2MBQ A;  2MEK A;  1YJ1 A;  1ZDX A;  2ZNV B;  2LJ5 A;  4BBN C;  3B08 A;  3DBR B;  2KWU B;  5FR6 A;  3ZO5 B;  3IVF A;  1XO3 A;  4DHZ E;  2JYT A;  4N9F 4;  3UQA A;  1VJK A;  5J17 A;  3KW5 B;  2D11 A;  2ONQ A;  2O6V D;  3UF8 A;  3SHQ A;  3RZW C;  4X57 B;  4KDL B;  1UNS A;  4HXD A;  4C4V A;  1FNU A;  3BVM A;  5AEK B;  2KN4 A;  2REX A;  3LXF A;  5BYS A;  4C4V B;  1KLG D;  5HFY A;  1NBF C;  2PTL A;  3L54 A;  2PLP A;  2LHD A;  3AB5 A;  4ICU A;  2DX5 B;  3DWM A;  3AN1 A;  3SFD B;  3A9K A;  3PVL A;  2CHW A;  2KLG A;  2WXH A;  4JX1 C;  3AED B;  1SIF A;  3A9K B;  3PTF C;  4NPN A;  4W9I A;  3VUX A;  5JHA A;  1QQR A;  4L1B A;  1WJU A;  3ETR A;  3M62 B;  3KWV A;  2LRU A;  4HWI B;  1JRU A;  3RYT A;  2QHO A;  3BYY B;  2LI5 A;  4JWS C;  3UIO B;  3QJZ A;  4NJC A;  1EO6 A;  5BYR A;  2VZK D;  2OED A;  2EMT A;  1I4Q A;  2WXJ A;  1WIA A;  1ZW7 A;  4KKJ A;  2FID A;  1F9J A;  1PQS A;  2ON8 A;  3GE8 C;  4HLE A;  2IPK D;  1YD8 U;  3APC A;  2LJI A;  1L6U A;  2KDB A;  2X38 A;  2K25 A;  2L3Z A;  2D5G A;  3O65 B;  1L0V B;  4HKZ E;  4WWP A;  1BUI C;  4KGT A;  3UIN B;  1YN4 A;  5JZE B;  1I4H A;  5CTR C;  4MAC A;  1HXY D;  4GU2 A;  1JQ4 A;  1V49 A;  2KAN A;  3EC8 A;  4ZRI A;  1XT9 B;  2Y3A A;  4DHZ B;  1KM7 A;  4BFR A;  1I7H A;  1VCB A;  5IO9 A;  4LDT D;  2RMM A;  2JZZ A;  1KH0 A;  4LJP B;  2K0P A;  1SB3 C;  3EUB 2;  4RGM A;  1HA5 A;  3GOE A;  2KMA A;  4QAY A;  4ARI A;  3CIR B;  2L05 A;  4AP4 C;  1T0S C;  1FXI A;  1E8X A;  5TR5 A;  4BKG A;  3NVW A;  3WAL A;  4LNN A;  5AUK A;  2DBY A;  2WXN A;  1GJZ A;  2INC C;  3PZ7 A;  4FJV B;  3N30 A;  4YSZ B;  2SEB D;  2BW2 A;  2NVU I;  3B2G A;  4BAX A;  3M95 A;  1MPE A;  2KWD A;  3X23 A;  1UH6 A;  1N5W A;  1WRD B;  2CJO A;  2KO3 A;  4BOZ B;  1C4C A;  4WIP A;  2J0M A;  1P98 A;  4KZC A;  3RNE C;  3T3O A;  1GB4 A;  3BY4 B;  1F1H A;  4G3X B;  1BT0 A;  2PVG C;  2JQR B;  2MW5 A;  2W3R A;  2Y5B B;  2ZEQ A;  2JWU A;  1YQ3 B;  3AE6 B;  3BWU D;  4NZL B;  4P7I A;  2M4N A;  4KZ0 A;  5FK9 C;  3AM9 A;  3DOW A;  2Z8L A;  2INN E;  2KDE B;  4KKI A;  1I4R A;  4FHJ A;  3N1Z C;  1TT5 B;  2BWE S;  2HTH A;  3RCZ A;  1MG8 A;  2MX2 A;  2IO0 B;  4REZ A;  4FHK A;  4YSX B;  2GI9 A;  3KYD D;  1SBB B;  2L0T A;  3OG5 A;  2ZZP B;  2N0S B;  3RUI B;  3VH3 B;  1P0R A;  3VH4 B;  2GBM A;  3WCQ A;  3BII D;  4KVG B;  4ZYS A;  1IGD A;  2MJE A;  2KWC A;  2DZK A;  3C0R B;  2BYE A;  3K9P B;  2WDT B;  1WGG A;  2J0J A;  2MA9 B;  4P6V F;  3DVN V;  4JL9 A;  3GS2 A;  4WJN A;  3P63 A;  4RGT A;  4M8M A;  4AS1 A;  1NYR A;  1T3Q A;  4PS7 A;  2BBC A;  2LMC A;  1N6Z A;  2W82 A;  1D6E C;  2R61 A;  1QIL A;  5TSS A;  2EKI A;  2ZPN A;  1WE6 A;  3UQB A;  2IZV B;  2QC8 A;  5HG2 A;  3AU4 A;  3TEW A;  1STE A;  4TQ0 A;  4WJO A;  3J9C A;  3GE3 C;  1UGM A;  5IN7 A;  1C76 A;  2KC2 A;  5D3I B;  3BVZ A;  2GBK A;  1T0R C;  3VDZ A;  3AEB B;  4HEA 1;  3WAP A;  3AEE B;  3EA6 A;  4II3 B;  4KSK C;  2D07 B;  3I9V 1;  2D3A A;  1J19 A;  4W9D A;  3PHW B;  3L0W B;  4MJS A;  1K52 A;  1RYJ A;  2LXA A;  3BVG A;  4IOI E;  1SE2 A;  3BK1 A;  1ROE A;  4WWN A;  4MJS B;  2LAS A;  4IM0 A;  2N7E A;  3VTW A;  4B0E A;  5CHF A;  4ZHP A;  2AWT A;  2JXX A;  2BB6 A;  4LJO B;  1D5Z C;  4MGI E;  1EM7 A;  4WWO A;  1C1Y B;  4PYZ A;  1WYG A;  1V2Y A;  2X8X X;  3R7R A;  3NVZ A;  4GLS C;  4FA6 A;  1XXG A;  1E9M A;  1UZX B;  4RGO S;  3QA8 A;  4EZK A;  4ANV A;  2BGF A;  4IC7 B;  5C3J B;  3AE9 B;  4LNK A;  2O6V A;  2L0F A;  3LDZ E;  4WAF A;  1LGR A;  3EFU A;  2CU1 A;  3ML8 A;  2H88 B;  4KDI C;  1YNT E;  5C1Z A;  3N1X C;  4HKQ A;  1WMH A;  3DVG X;  3DBR I;  4WH4 A;  2HD5 B;  2NBV B;  3I3T B;  4US8 A;  4YTN B;  1AWD A;  2BKF A;  3Q8A A;  1DGJ A;  4MDK E;  3TEY A;  1WMH B;  1TS2 A;  3AE4 B;  5EDS A;  1EUV B;  3DCG A;  4A3P A;  2NBU A;  2G45 B;  1T6B X;  1AW7 A;  1JWA D;  3AE3 B;  3GZN B;  1N5X A;  2YLM A;  2QSD A;  2N4F A;  2RD0 A;  2CR5 A;  3AE2 B;  1YJI A;  2K8C A;  3P4Q B;  1NEK B;  1N63 A;  3H7S A;  4L23 A;  3A4S C;  4FN2 A;  3VVW B;  1F52 A;  1GOZ A;  3U7D A;  3RZF A;  3AEA B;  4GDK A;  2L52 A;  3NVV A;  2CHZ A;  3AUL A;  4EKU A;  3TUO A;  3ZIM A;  2IBI B;  3PGE A;  3Q69 A;  4GDK B;  3LYY A;  2ZNV C;  2Y5C A;  2BYV E;  3DHI C;  1TS3 A;  1MFW A;  2VZK B;  1YX6 B;  3ENE A;  2KJR A;  4GMV A;  3PZD A;  3UGB B;  2BS3 B;  2WNM A;  3ZTD A;  3ZXR A;  3E56 A;  3BK2 A;  3FKY A;  4ANX A;  2RSU A;  1J7A A;  3IAM 1;  1YX5 B;  1A5R A;  5D94 A;  1WR1 A;  1SXT A;  3M63 B;  2W54 A;  2NTT A;  4GIV A;  2G4D B;  2K22 A;  3I63 C;  1P7E A;  1YN5 A;  3PLU A;  3BYT B;  3QHT A;  2M0A A;  1KOT A;  1XLO A;  1FPY A;  1TKG A;  5LNK 1;  1PGB A;  4URK A;  3IXS A;  1TYG B;  4LDT B;  3KLS X;  3NZU A;  3V6E B;  4IWO A;  4ZRP A;  3V3X A;  2BVC A;  2EKE C;  2R2O A;  1V86 A;  2KTR A;  1NEN B;  3KQ4 A;  1GC7 A;  1V6E A;  4M0W A;  3CST A;  1WGD A;  4E3C A;  2Z0E B;  1DYQ A;  1ZKH A;  1R4N B;  1M94 A;  1JAL A;  2KTR B;  4M0W B;  3GP7 A;  3SFE B;  4FJY A;  4A3O A;  5J18 A;  1C4P A;  2AX5 A;  2INP E;  4ACF A;  2PKO A;  1E90 A;  3RMK C;  3RFZ B;  1JWS D;  1WSP A;  4YT0 B;  3V60 A;  3AEC B;  2WDR B;  4BKT A;  4XGA B;  4B6W A;  2DAJ A;  4GDL A;  4K7W A;  1SIJ A;  4YL8 A;  4W9K A;  2M8S A;  2RGF A;  2DZJ A;  1AYF A;  2ASQ A;  4GDL B;  4MEM A;  1F77 A;  2M1M A;  1FNW A;  4JGH B;  3P1M A;  3U30 A;  2LGY A;  4NQK E;  2O2V A;  1K50 A;  1XCQ L;  2KMC A;  4XWT A;  3ZJV A;  2CS4 A;  4ZOH C;  2O2V B;  3W5V B;  3QCA A;  4IM3 A;  5AZH A;  4JQW C;  5GXG B;  3U52 E;  1EWC A;  2LGI A;  3VUW A;  1GUA B;  4AOF A;  2NMQ A;  4HJK A;  2JZP A;  4OVV A;  2LGS A;  4NJ7 A;  1T0Q C;  3R2T A;  1HE8 A;  4YXD B;  1UBQ A;  2JSV X;  2QDF A;  5AUI A;  1GG3 A;  3ZW3 A;  4XX5 A;  3OJ3 A;  4YTP B;  2BB5 A;  2KKC A;  4IUM B;  2ZW1 A;  4AWJ A;  3N32 A;  1NI3 A;  2SAK A;  1ZXI A;  4E74 A;  1M4V A;  1ZUD 2;  2WU5 B;  3W1S A;  3C8Y A;  3NVY A;  2C60 A;  3NZ3 A;  3PRE A;  2JY6 A;  1YJJ A;  2LXC A;  2WXP A;  1B9R A;  4NY0 A;  2IYD B;  2IO2 B;  4FJZ A;  5L83 A;  3CF6 E;  3TEX A;  3VHT C;  3OJ4 B;  5E6O A;  1WX8 A;  1EWY C;  3TMP B;  1JWM D;  2FE8 A;  3I57 A;  5EE0 A;  2HDE A;  2MJ3 A;  1C77 A;  2QCZ A;  1YIW A;  2HTM E;  3NOB A;  3MC8 A;  1QT9 A;  1L4Z B;  1IBX A;  2PE9 A;  1UBI A;  3H7P A;  3D32 A;  3A1Q A;  5EE1 A;  4CHK A;  2BPS A;  1IBX B;  2KVR A;  2I1K A;  1R7S A;  2NTS A;  3H7P B;  4M8N A;  2BS4 B;  3A1Q B;  3N1Y C;  2IGG A;  4HJG E;  1VDV A;  3DBS A;  2JYE A;  1V9J A;  5E6N A;  5G2N A;  3AH7 A;  4MSM B;  4WUR A;  3ECI A;  4OW0 A;  3Q3O C;  4AJW A;  3C19 A;  4HPL B;  1E8Z A;  1WFY A;  2DWQ A;  3T8M A;  1WJN A;  1WM2 A;  3NS8 A;  4JLC A;  1V1O A;  2FUH B;  2KD0 A;  2JX5 A;  3AEF B;  3N20 C;  1UGJ A;  2JXT A;  3H9D A;  1LFD A;  2BWF A;  1TY0 A;  2MH7 A;  1XCT L;  2IJ0 A;  2JWZ A;  2PMV A;  1I4G A;  3EHV A;  3ZRF A;  2KC1 A;  4ZHO A;  4K7U A;  3JYU A;  1CMX B;  2N9P C;  2DZM A;  4C00 A;  1OEY J;  1WE7 A;  1OGW A;  2V0G A;  5IKC M;  3N9Y C;  2G1E A;  2AL6 A;  1J7B A;  4K1R B;  3RNB C;  2ICI A;  1IP9 A;  2V3P A;  3VXW A;  3ZNZ B;  3HVZ A;  3KUC B;  3PRP B;  4N59 A;  3WAO A;  1Q10 A;  4DXA B;  1FIQ A;  1HQR D;  1QZE A;  3RN9 C;  3SR6 A;  1E7P B;  3NG0 A;  1C4A A;  2KWV B;  1WM3 A;  1XEE A;  2I1J A;  5CX3 A;  3AU5 A;  4A90 A;  3MHS D;  3Q3F A;  3GZN I;  2DYB A;  1F0Z A;  2CJN A;  3DBL B;  4EE2 A;  3ZVV A;  4F8C B;  2LRW A;  4CO7 A;  2KXJ A;  3VR9 B;  1YN3 A;  3T3N A;  1V97 A;  3ZJT A;  4NAM A;  4RCO A;  5FKA C;  2QJL A;  4NJ6 A;  4EZJ A;  1VZ7 A;  2RDH A;  1E5W A;  1V81 A;  1YQB A;  1RWS A;  2LWP A;  2KVZ A;  1L2N A;  1WXA A;  2ZW0 A;  2L76 A;  3Q8F A;  4FXC A;  2KAJ A;  2K39 A;  1ZGU B;  4J6I A;  3ZNI D;  3JVZ X;  3QC8 B;  2C7H A;  3V62 A;  2PW9 A;  2WXG A;  3AI5 A;  2LGX A;  4FLH A;  1VR9 A;  2IDY A;  3Q8B A;  4OZB A;  1HTO A;  2NS5 A;  1RAX A;  2J42 A;  2FCS A;  5DPW A;  1QLB B;  3FIL A;  4N6E B;  3JSV A;  1K53 A;  5AZG A;  1WRI A;  5L95 C;  3QWZ B;  4D2K A;  4W9J A;  3FIL B;  3PT2 B;  3JSV B;  1V8C A;  2KT7 A;  3APF A;  1SJE D;  4GOC A;  1E8Y A;  4DHJ D;  3R3M A;  3DBH I;  1HZ6 A;  3VAW A;  3B9J A;  2NCN A;  4HPM B;  1X1M A;  2L32 A;  3PRZ A;  2BYT A;  2JVC A;  1OEY A;  1R4M I;  2JF5 A;  1P9D U;  4I6L B;  4I6N B;  2BT6 A;  3U8Z A;  3NZS A;  2M19 A;  2LVP A;  1DOY A;  4P1C C;  1SEB D;  1C79 A;  1H8C A;  2G3Q B;  3CWI A;  3R66 C;  2JRI B;  2K8B A;  2FCQ A;  2DZI A;  3E9S A;  3RNA C;  2BTE A;  3NRZ A;  3V61 A;  4HCN B;  2UWQ A;  5G5G A;  3OWE B;  5FR3 A;  3PO0 A;  4KIK A;  2QMT A;  2CHX A;  3DHG C;  2N9X A;  1TZO A;  2DLB A;  1K8R B;  2JPH A;  4KIK B;  1WWT A;  2XK5 A;  2N9K A;  3MTN B;  2JUO A;  4ZYN A;  2KLC A;  2B76 B;  3QIJ A;  1WXS A;  2XK5 B;  2KN5 A;  1Q1O A;  1QOA A;  4DDG D;  5IA7 A;  4PYU A;  3VRB B;  1VLB A;  3WA0 A;  1VZ8 A;  2O6V B;  3ONS A;  2WLB A;  2WXL A;  3W1Y A;  1Q5W B;  1N61 A;  3SEB A;  2YEP B;  3DVN U;  2DYO A;  2WS3 B;  3KH0 A;  3QQ8 B;  4R3D A;  2IO3 B;  1UWM A;  4K7S A;  3URY A;  4IM2 A;  4IW0 A;  5BMI A;  1E7V A;  1FO4 A;  3DQV A;  1XQQ A;  2WHI A;  4O1N A;  1ISN A;  4JIO U;  3ZRC A;  2I38 A;  4K3B A;  2MP2 A;  2C5L C;  2K5P A;  2WGS A;  1I4X A;  2LGD A;  4XYC A;  3ZYY X;  2WX0 A;  4ZDV A;  4NQL B;  1XLP A;  2MP2 B;  5D6J B;  1G6J A;  2Z0D B;  3Q6B A;  3IHP C;  3ZGZ A;  2K1F A;  2NR2 A;  4S0R A;  4M00 A;  2WX1 A;  3DDC B;  2L00 B;  1Y56 A;  3L16 A;  2FNJ B;  3AV8 A;  5C23 A;  1FEH A;  4HPP A;  4W9G A;  1MHX A;  1PYW D;  3H6N A;  2LVO A;  1IUE A;  2KJH B;  1VRA B;  3VR8 B;  1NDD A;  3VQI A;  4IWQ A;  4RF0 A;  1D5M C;  2LHE A;  4EZL A;  4KV2 A;  3B2F A;  1Z5S B;  4KGS A;  1E10 A;  3RNC C;  2YVC A;  2GOW A;  1N60 A;  2N7D A;  3PLV A;  4CQN A;  1XD3 B;  1WZ3 A;  5JXV A;  4M01 A;  2D3G A;  2WDQ B;  3R8B A;  1D4B A;  3R7Q A;  1JRP A;  1WXQ A;  2WDV B;  2VRR B;  4PK1 A;  2KFJ A;  4TSS A;  2K6Q A;  4ANU A;  1UD7 A;  2G4S A;  2J7Q B;  2LD9 A;  5CHV C;  5DCN A;  3ZNG C;  1ET9 A;  1FCC C;  4YSY B;  3Q2A C;  1MG4 A;  3ZKJ C;  2M56 B;  1QKZ A;  5E6P A;  2KQS A;  2DEN B;  1HTQ A;  3PS6 A;  2E3T A;  2AQ3 B;  4YWG G;  1TJE A;  3U7Z A;  2D3B A;  2BF8 B;  3RI7 C;  2K8H A;  4A55 A;  3I5J C;  1KF6 B;  2A4Z A;  2MHJ A;  2R2Q A;  1P3Q U;  2D3C A;  2MWS B;  4ARC A;  1D5X C;  4P1B C;  4C7Y A;  3SD5 A;  1MVK A;  4HCP B;  1FFV A;  2TSS A;  2KFK A;  2J53 A;  2WXF A;  3NUH B;  2K3U A;  1BXT A;  2GLS A;  2KHW B;  3OAW A;  2KFK B;  4JWU C;  1UWX A;  3BZD B;  1RM6 C;  2KYW A;  3VRA B;  4GGQ A;  2ZCB A;  2OHF A;  5EE3 A;  3KUZ A;  1WJ4 A;  3ML9 A;  1XLQ A;  3GB1 A;  2MJD A;  2V3N A;  3RUL A;  2V1Y A;  3AXC A;  5T8I A;  4XC2 A;  4NAW A;  3EEC A;  2WU2 B;  1D3Z A;  2XN9 C;  3FAH A;  5KHQ A;  4GN1 A;  4F7Z A;  3NY5 A;  4MGZ E;  1PGX A;  4RMA A;  2WP9 B;  4NAW B;  1E7U A;  2RR9 A;  5DPT A;  3MHZ A;  3NS1 A;  3DVG Y;  3AE8 B;  3TSS A;  1FMA D;  3TL5 A;  5IOI A;  3CSF A;  3PSE B;  2KJ6 A;  4G11 A;  4HRS A;  1LXD A;  5GMV A;  2QIE B;  4PT5 A;  1TGZ B;  2LFI A;  2DYM A;  3QK0 A;  2WXR A;  1ZPS A;  2BYF A;  3W9C B;  2C7M B;  2HJ8 A;  2KQ7 A;  2WXQ A;  2JT4 B;  5BMG A;  1NYQ A;  1L0X B;  4XZ4 A;  1KRH A;  2WWZ A;  2MBB B;  1NI2 A;  3KVF B;  5LXH A;  3VFK A;  4BVU C;  2LUM A;  3A33 B;  1FFU A;  3BIN A;  2JZ3 B;  5C2T B;  1WH3 A;  1UF0 A;  3ZJU A;  1FRD A;  1Q0W B;  1RFK A;  2KAC A;  4MSQ B;  2N9L A;  3HVD A;  3L13 A;  3U2S C;  1L7Y A;  3L10 B;  2MCN B;  3PZ8 A;  4BBN F;  3X0W A;  1BML C;  3M3J A;  4DBG A;  4RF1 A;  3EGR A;  3IT6 B;  3AEG B;  3L08 A;  4H2A A;  3OLM D;  4RM8 A;  5BYQ A;  1WGH A;  3MJ5 A;  3ABV B;  2V9H A;  1I4P A;  4G0N B;  2DHZ A;  4DHJ B;  4MGK E;  4TV3 A;  1TS5 A;  1WR6 E;  3VTU A;  3RT3 B;  4J3O D;  4N58 A;  1YOV B;  1JW9 D;  4AJY B;  3MC0 B;  1NVI D;  3A4R A;  4USA A;  1SE4 A;  2FCN A;  1ACC A;  3Q3M C;  1K51 A;  3RD2 A;  5HI1 A;  1V1P A;  3FC4 A;  1FD6 A;  2OOB B;  2PE6 B;  3P42 A;  2PEA A;  2LVQ A;  2QEJ C;  4XDD A;  1IPG A;  3ZUN A;  2WXI A;  3HHM A;  4AUQ C;  2KQ4 X;  5D7G A;  1RFA A;  4WWM A;  5EE9 A;  3WAM A;  4EOY A;  1V1P B;  1ZOY B;  2ZJD A;  3HK0 A;  2L1A A;  1QOB A;  2FIF A;  4DDI D;  3N3K B;  1WXM A;  1LM8 B;  4XE0 A;  2PJH A;  1OFF A;  2N9E B;  1EF1 A;  2CKH B;  1GNU A;  1L0Y B;  2Z59 B;  3IG3 A;  3P4S B;  2KZR A;  4WQO B;  4B0M A;  4LLG M;  4MT5 A;  2XNA C;  3P4P B;  1MJD A;  4MH8 A;  4EEW A;  4TKN A;  1E8W A;  2IGD A;  5IAA C;  1CQV A;  3P4R B;  2JRH A;  1P1A A;  2BQQ A;  4ICV A;  3VTV A;  4ZRQ A;  3CMM B;  4GXB A;  4ASW C;  1E6E B;  4E71 A;  1WX7 A;  4W9E A;  3P2B A;  1IYF A;  2WXK A;  1UUP A;  4FUL A;  2VH1 A;  3Q3J A;  4JE3 B;  4KX6 B;  4B9K A;  4FAD A;  3KYC D;  4JPS A;  3Q8C A;  1ZDV A;  2RDG A;  4US9 A;  4BZA A;  3HRD D;  1WI0 A;  1CJE A;  1WXV A;  3RNG C;  3T9L A;  2KDM A;  4M02 A;  5HHD G;  4MGY E;  1U4A A;  1TBE A;  3Q8E A;  1TZ1 A;  3ZXV A;  1FNV A;  2AEH A;  1Z2M A;  2UU7 A;  3Q14 C;  1HZ5 A;  1MHH E;  4IKG A;  2IY1 B;  4A6Q A;  2GBN A;  2NPT A;  2MQJ A;  5I4D A;  4LK0 M;  4MH0 E;  4K3C A;  1TIF A;  3A9J A;  1T5X D;  1WF9 A;  1OQY A;  2J52 A;  4TUU A;  2GB1 A;  2NPT B;  1L6V A;  3QX1 A;  4L2Y A;  4BKS D;  3A9J B;  2AQ1 B;  4LTU A;  5D3D A;  4XWW A;  2XEW A;  1VZ6 A;  2C9W B;  4ZRJ A;  1PUT A;  3RPF C;  1QOG A;  1TKE A;  4LCD E;  1L5P A;  2M17 A;  2KOX A;  4IWP A;  2MBO A;  5DPS A;  4LNO A;  4NNJ B;  5CHW A;  2Y5P A;  1KFY B;  4G50 A;  1WY8 A;  2MBH A;  2K9X A;  5DPR A;  4OZC A;  4CYE A;  3PRM B;  4EUT A;  2VH2 A;  3H8H A;  1ET6 A;  4DK5 A;  2AL3 A;  1TTN A;  1EF5 A;  3TJP A;  2DAF A;  1RRB A;  4FBJ B;  2KX3 A;  3TEZ A;  1JWB D;  4WAA A;  2PPH A;  2JU6 X;  1JRO A;  2W9N A;  2YEP F;  2N1V A;  4GSW A;  4C7Z A;  4WJQ A;  5E6J A;  2LUE A;  1Y8R C;  1YMH E;  2MRP A;  1IGC A;  1ZXH A;  3NJT A;  5G5H A;  3UI3 A;  3MJW A;  1FXT B;  1N62 A;  1JML A;  1WGK A;  3O13 A;  4A8X C;  1ENF A;  4OVU A;  2OJW A;  3MP9 A;  4DXG A;  1R4N I;  3L17 A;  3EFC A;  4OZA A;  2H89 B;  2MBE A;  2W55 A;  3TBL D;  2KMM A;  4F1S A;  2V4I B;  4W9H A;  1DOX A;  1PFD A;  2MLB A;  2FCM A;  2B3A A;  3PV1 A;  3JW0 X;  1L4D B;  2I2Y A;  2EEL A;  3NHE B;  4KGR A;  2D10 A;  4RM9 A;  1SF0 A;  1KJT A;  2A5U A;  1F2R I;  4RNA A;  1WYW B;  2NBW B;  4TQ1 A;  2J4X A;  2E6X A;  4MEL A;  5G55 A;  1ESF A;  2PIA A;  1JCK B;  2UYZ B;  4PS3 A;  4P16 A;  1PDX A;  1V80 A;  3VUY A;  1TY2 A;  5BO4 B;  1ZP0 B;  3ALB A;  3WIM A;  4LNF A;  2BKR B;  1KLU D;  1GC6 A;  2WXO A;  5KHO A;  1GPX A;  3R2I A;  2LEK A;  5J2R A;  3AMZ A;  2GRI A;  2MSE D;  3ZTC A;  2N7J A;  1UEL A;  1GAQ B;  1RLF A;  1WZ0 A;  2KDF B;  5MPO A;  4RFB A;  4DQO C;  1AN8 A;  2M0X A;  2J0K A;  2GMI C;  3LB8 C;  1C3T A;  3H1U A;  2RDB C;  3QAR A;  2OJR A;  1HEZ E;  1WJ6 A;  3Q3N C;  4WQM A;  1PGA A;  5H8Y E;  3W2D A;  1F2R C;  1WX9 A;  3W5U B;  1V5T A;  2WXM A;  1TS4 A;  4ITK A;  3TCA A;  2PVO D;  3B0A A;  1J7C A;  1ZE3 D;  2N1W A;  3KWL A;  4TMA B;  3IFW B;  4OHJ A;  1J8C A;  4HVB A;  2ZPY A;  2KTF A;  4HDQ A;  1OQR A;  2ZCC A;  5LLI A;  3ZQ4 A;  1JWU D;  1A70 A;  2AYO B;  4HRO A;  4GB9 A;  1T0Y A;  4I6P A;  4DXF A;  5H92 C;  4C80 A;  1OTR B;  2BS2 B;  2K6D B;  4II2 B;  5D2M B;  3AE1 B;  2EMS A;  3AE7 B;  2DNF A;  1WGR A;  3RNF C;  3PHX B;  3WAN A;  4MM3 A;  2W3S A;  3HIZ A;  4W9L A;  1SJH D;  2AQ2 B;  4KSL C;  1EU3 A;  1FXA A;  2IND C;  1KLV A;  1E0Z A;  4MM3 B;  4ZRK A;  3DWG C;  2C7N B;  2KX0 A;  1C78 A;  2QIL A;  5LXI B;  5IP4 D;  3ZNH B;  4RH6 A;  4C56 C;  1V5O A;  2D2Q A;  4A9A A;  4OVZ A;  3HUI A;  4WJP A;  1XF5 L;  1I35 A;  1CZP A;  1SGH A;  3KUD B;  5JHB A;  2FAZ A;  2GBJ A;  3HM6 X;  1LO5 D; 
#chains in the Genus database with same CATH homology
 2KWV B;  1Q0W B;  3S2A A;  4MSQ B;  3SU8 X;  4MGI E;  1WM3 A;  3L13 A;  2I1J A;  5CX3 A;  2WYQ A;  3AU5 A;  1L7Y A;  3L10 B;  3PPA A;  4WWO A;  3MHS D;  3W1S C;  2V3S A;  3Q3F A;  2MCN B;  2XBB C;  4BBN F;  1C1Y B;  1AAR A;  4PYZ A;  3GZN I;  4PS8 A;  3X0W A;  2DYB A;  4B95 A;  3M3J A;  2KDI A;  4DBG A;  1V2Y A;  3ZVV A;  4F8C B;  1LQB A;  2LRW A;  4CO7 A;  2KXJ A;  3R7R A;  3L08 A;  3LJ3 A;  4FA6 A;  4BOS C;  2RPQ A;  3K9O B;  3OLM D;  4RM8 A;  1WGH A;  1UZX B;  3QA8 A;  4G0N B;  1VD2 A;  2DHZ A;  2GBR A;  4MGK E;  5AZF A;  4TV3 A;  3VTU A;  1WR6 E;  4DHJ B;  4EZK A;  1S1Q B;  3RT3 B;  4ANV A;  2BGF A;  4NJ6 A;  4EZJ A;  4IC7 B;  3UIP B;  3V6C B;  2ZVO A;  1WH3 A;  2O6V A;  3B1L X;  2L0F A;  3LDZ E;  4AJY B;  1E5W A;  3EFU A;  1V81 A;  4A20 A;  4W9C A;  3A4R A;  1YQB A;  2CU1 A;  2LWP A;  5HKH A;  2FCN A;  3ML8 A;  3ZDT A;  4KDI C;  5C1Z A;  1L2N A;  1WXA A;  1WMH A;  3DVG X;  3RD2 A;  2L76 A;  3DBR I;  3APD A;  2HD5 B;  4IG7 B;  2IY0 B;  2K39 A;  2NBV B;  3I3T B;  2KK8 A;  1ZGU B;  4DWF A;  2IO1 B;  2OOB B;  2BKF A;  2PE6 B;  2PEA A;  2LVQ A;  4J6I A;  3DPD A;  4MDK E;  1IPG A;  3ZNI D;  1WMH B;  3JVZ X;  3ZUN A;  3QC8 B;  5EDS A;  3HHM A;  4AUQ C;  1EUV B;  3DCG A;  1RFA A;  1S3S G;  2ZVN A;  4K81 A;  5D7G A;  3QAQ A;  3WAM A;  2ZJD A;  4ANW A;  2HE7 A;  3HK0 A;  1J0G A;  2C7H A;  2NBU A;  2G45 B;  3ZDM C;  4EFO A;  1WGY A;  3SDL C;  1SE9 A;  3TIX A;  2V4L A;  2FIF A;  2L8J A;  4DDI D;  3V62 A;  3N3K B;  1WXM A;  1I42 A;  3AI5 A;  1LM8 B;  3IBE A;  2LGX A;  4FLH A;  2YLM A;  5JH5 C;  2LZ6 A;  2NS5 A;  2N4F A;  2PJH A;  2RD0 A;  1RAX A;  2CR5 A;  2N9E B;  1EF1 A;  2K8C A;  2FCS A;  2CKH B;  1GNU A;  5DPW A;  2Z59 B;  3H7S A;  3IG3 A;  2KNB A;  3A4S C;  4HK2 A;  2KZR A;  3JSV A;  3DBL I;  4FN2 A;  4WQO B;  3VVW B;  4BKS A;  3ZLZ A;  3U7D A;  5AZG A;  3RZF A;  5L95 C;  4W9F A;  3QWZ B;  1H4R A;  4GDK A;  4W9J A;  4EEW A;  3PT2 B;  3JSV B;  2L7R A;  2CHZ A;  3AUL A;  4EKU A;  3HM3 A;  4TKN A;  3ZIM A;  4HDO A;  1E8W A;  4GOC A;  3APF A;  2MBQ A;  1E8Y A;  2IBI B;  4DHJ D;  3PGE A;  3R3M A;  3DBH I;  4GDK B;  1YJ1 A;  2ZNV B;  5IAA C;  2LJ5 A;  4BBN C;  2JRH A;  1P1A A;  2ZNV C;  4ICV A;  2BYV E;  3B08 A;  3VTV A;  2KWU B;  5FR6 A;  3ZO5 B;  3VAW A;  3IVF A;  3CMM B;  1YX6 B;  4GXB A;  4ASW C;  4DHZ E;  2NCN A;  3ENE A;  1X1M A;  4HPM B;  4N9F 4;  4E71 A;  2KJR A;  3UQA A;  3PRZ A;  1WX7 A;  4GMV A;  3PZD A;  4W9E A;  3UGB B;  2JVC A;  3KW5 B;  1OEY A;  5J17 A;  2D11 A;  3P2B A;  1R4M I;  2JF5 A;  2O6V D;  3UF8 A;  3ZTD A;  3SHQ A;  3RZW C;  1P9D U;  1IYF A;  4X57 B;  4ANX A;  4KDL B;  2RSU A;  4FUL A;  4I6L B;  4I6N B;  1YX5 B;  3U8Z A;  1A5R A;  4HXD A;  5D94 A;  3NZS A;  1WR1 A;  3Q3J A;  4B9K A;  2LVP A;  4FAD A;  3M63 B;  4GIV A;  3KYC D;  2G4D B;  5AEK B;  1H8C A;  2G3Q B;  2REX A;  3PLU A;  3R66 C;  1WI0 A;  1WXV A;  2JRI B;  3QHT A;  2K8B A;  2FCQ A;  3T9L A;  2DZI A;  1NBF C;  3L54 A;  3V61 A;  4HCN B;  4MGY E;  1KOT A;  1U4A A;  4ICU A;  2UWQ A;  1TBE A;  2DX5 B;  1TZ1 A;  4KIK A;  2AEH A;  1Z2M A;  2CHX A;  2N9X A;  3A9K A;  4URK A;  3PVL A;  2CHW A;  2IY1 B;  1K8R B;  2KLG A;  2GBN A;  2NPT A;  2JPH A;  4KIK B;  4LDT B;  2MQJ A;  1SIF A;  2XK5 A;  4MH0 E;  3NZU A;  3V6E B;  4IWO A;  3A9K B;  3MTN B;  2EKE C;  3A9J A;  2JUO A;  3PTF C;  2R2O A;  4NPN A;  4ZYN A;  4W9I A;  2KLC A;  1WF9 A;  1OQY A;  3QIJ A;  4TUU A;  3VUX A;  5JHA A;  2NPT B;  1V86 A;  2KTR A;  1WXS A;  1GC7 A;  1WJU A;  1V6E A;  3CST A;  2XK5 B;  3M62 B;  1WGD A;  2KN5 A;  3QX1 A;  2Z0E B;  4E3C A;  1Q1O A;  4BKS D;  2LRU A;  3A9J B;  4DDG D;  4HWI B;  5IA7 A;  4PYU A;  1ZKH A;  2XEW A;  3WA0 A;  1M94 A;  2C9W B;  1JRU A;  2KTR B;  3RYT A;  2O6V B;  4ZRJ A;  2QHO A;  3ONS A;  4M0W B;  4LCD E;  1Q5W B;  3W1Y A;  2LI5 A;  3UIO B;  3DVN U;  2M17 A;  4FJY A;  2KOX A;  4IWP A;  3QJZ A;  4A3O A;  5J18 A;  1EO6 A;  2DYO A;  2MBO A;  5DPS A;  2EMT A;  1WIA A;  3KH0 A;  1ZW7 A;  3QQ8 B;  4NNJ B;  5CHW A;  2FID A;  2IO3 B;  1F9J A;  1E90 A;  1PQS A;  4HLE A;  4G50 A;  1WY8 A;  1YD8 U;  2MBH A;  3APC A;  4IM2 A;  4K7S A;  4IW0 A;  5DPR A;  1E7V A;  4CYE A;  3PRM B;  4EUT A;  3DQV A;  2KDB A;  2K25 A;  2L3Z A;  1XQQ A;  3V60 A;  3O65 B;  4DK5 A;  4BKT A;  4B6W A;  1ISN A;  2AL3 A;  2DAJ A;  4GDL A;  4JIO U;  4K7W A;  3ZRC A;  1TTN A;  1EF5 A;  4WWP A;  4YL8 A;  3TJP A;  2DAF A;  4W9K A;  1RRB A;  2C5L C;  2M8S A;  2MP2 A;  2RGF A;  4FBJ B;  2DZJ A;  3UIN B;  2KX3 A;  5JZE B;  2LGD A;  5CTR C;  2ASQ A;  4GDL B;  2WX0 A;  2PPH A;  4WAA A;  4NQL B;  4ZDV A;  4GU2 A;  4MEM A;  1V49 A;  2M1M A;  2W9N A;  2KAN A;  3EC8 A;  4ZRI A;  2N1V A;  2MP2 B;  4GSW A;  1XT9 B;  5D6J B;  1G6J A;  2Z0D B;  4JGH B;  4WJQ A;  2LUE A;  3U30 A;  2LGY A;  4NQK E;  2O2V A;  1KM7 A;  4DHZ B;  1Y8R C;  4BFR A;  2MRP A;  3IHP C;  2K1F A;  2NR2 A;  1VCB A;  2KMC A;  2WX1 A;  2CS4 A;  3DDC B;  4LDT D;  2L00 B;  3L16 A;  3MJW A;  1FXT B;  2FNJ B;  2JZZ A;  5C23 A;  2O2V B;  4W9G A;  4LJP B;  3QCA A;  3H6N A;  4IM3 A;  2LVO A;  5AZH A;  4JQW C;  3GOE A;  2KJH B;  2KMA A;  1NDD A;  4OVU A;  3VQI A;  2L05 A;  4IWQ A;  4AP4 C;  1E8X A;  3VUW A;  1GUA B;  4AOF A;  1R4N I;  5TR5 A;  3L17 A;  4HJK A;  4BKG A;  4EZL A;  4KV2 A;  3WAL A;  4OVV A;  2MBE A;  1GJZ A;  1Z5S B;  3TBL D;  4F1S A;  4FJV B;  2YVC A;  4NJ7 A;  2GOW A;  3N30 A;  4W9H A;  2MLB A;  2NVU I;  2N7D A;  2FCM A;  3PLV A;  2B3A A;  3PV1 A;  3JW0 X;  3NHE B;  3M95 A;  1HE8 A;  1XD3 B;  1UBQ A;  1WZ3 A;  1GG3 A;  2D10 A;  3ZW3 A;  4XX5 A;  1UH6 A;  3OJ3 A;  3X23 A;  4IUM B;  2KKC A;  1WRD B;  4RM9 A;  2D3G A;  1KJT A;  2A5U A;  1WYW B;  2NBW B;  4TQ1 A;  2KO3 A;  3R7Q A;  4AWJ A;  4BOZ B;  3N32 A;  2J0M A;  4MEL A;  1P98 A;  5G55 A;  4E74 A;  2UYZ B;  4KZC A;  4PS3 A;  1V80 A;  2VRR B;  3VUY A;  2KFJ A;  2K6Q A;  4ANU A;  1UD7 A;  3W1S A;  2C60 A;  5BO4 B;  2G4S A;  2J7Q B;  3BY4 B;  3PRE A;  2LD9 A;  3ALB A;  5CHV C;  4G3X B;  2JY6 A;  5DCN A;  3WIM A;  3ZNG C;  1BT0 A;  2LXC A;  2BKR B;  4NY0 A;  2IYD B;  2IO2 B;  2MW5 A;  2Y5B B;  1GC6 A;  2ZEQ A;  4FJZ A;  5L83 A;  4P7I A;  3CF6 E;  5KHO A;  3VHT C;  2M4N A;  4KZ0 A;  5J2R A;  3ZKJ C;  3OJ4 B;  5E6O A;  2MSE D;  3ZTC A;  3DOW A;  5E6P A;  1UEL A;  1WX8 A;  2DEN B;  2KQS A;  3PS6 A;  3TMP B;  2KDE B;  1RLF A;  2BF8 B;  1WZ0 A;  2KDF B;  2K8H A;  4FHJ A;  2BWE S;  2HTH A;  3RCZ A;  1MG8 A;  2MX2 A;  2A4Z A;  2IO0 B;  4FHK A;  2R2Q A;  1P3Q U;  2MWS B;  3KYD D;  1YIW A;  3NOB A;  2M0X A;  2L0T A;  2J0K A;  2GMI C;  2ZZP B;  3RUI B;  3VH3 B;  1P0R A;  2PE9 A;  3VH4 B;  1C3T A;  3H1U A;  1UBI A;  3H7P A;  2GBM A;  3D32 A;  3QAR A;  2OJR A;  1WJ6 A;  3SD5 A;  3A1Q A;  4HCP B;  2KFK A;  4CHK A;  4KVG B;  2BPS A;  2KWC A;  2DZK A;  2KVR A;  3C0R B;  2I1K A;  3H7P B;  4M8N A;  2BYE A;  3K9P B;  1WX9 A;  2WDT B;  1WGG A;  3A1Q B;  2J0J A;  2KHW B;  2MA9 B;  1V5T A;  3OAW A;  3DVN V;  2KFK B;  3DBS A;  4JL9 A;  1V9J A;  5E6N A;  3TCA A;  5G2N A;  4GGQ A;  4WJN A;  3B0A A;  2ZCB A;  4MSM B;  3KUZ A;  1WJ4 A;  2N1W A;  3ML9 A;  3IFW B;  1J8C A;  4HVB A;  3RUL A;  3ECI A;  4M8M A;  2V1Y A;  2ZPY A;  2KTF A;  4HDQ A;  3AXC A;  2ZCC A;  5LLI A;  4XC2 A;  4PS7 A;  4AJW A;  2AYO B;  4NAW A;  3EEC A;  1D3Z A;  5KHQ A;  4GB9 A;  4HPL B;  4GN1 A;  1E8Z A;  1WFY A;  1T0Y A;  4I6P A;  4F7Z A;  3NY5 A;  4MGZ E;  3T8M A;  4RMA A;  1WJN A;  1OTR B;  1WM2 A;  3NS8 A;  4NAW B;  2ZPN A;  2K6D B;  1WE6 A;  4JLC A;  4A3P A;  1E7U A;  3UQB A;  2IZV B;  2FUH B;  4II2 B;  3AU4 A;  2RR9 A;  2KD0 A;  5DPT A;  4TQ0 A;  5D2M B;  4WJO A;  2EMS A;  1UGM A;  3H9D A;  2KC2 A;  3DVG Y;  1LFD A;  2BWF A;  2GBK A;  3VDZ A;  3TL5 A;  1WGR A;  3CSF A;  3WAP A;  3PSE B;  2KJ6 A;  2JWZ A;  3PHX B;  4G11 A;  4II3 B;  2D07 B;  3EHV A;  2KC1 A;  4KSK C;  4MM3 A;  3WAN A;  3ZRF A;  1LXD A;  3HIZ A;  4W9L A;  4K7U A;  3JYU A;  5GMV A;  1CMX B;  1J19 A;  2N9P C;  4KSL C;  2DZM A;  4W9D A;  4EOY A;  1OEY J;  1TGZ B;  1KLV A;  3PHW B;  2DYM A;  3L0W B;  3QK0 A;  1WE7 A;  4ZRK A;  2BYF A;  4MJS A;  1OGW A;  2C7N B;  2C7M B;  2KX0 A;  2LXA A;  2HJ8 A;  5LXI B;  2KQ7 A;  3ZNH B;  1V5O A;  2D2Q A;  2JT4 B;  2AL6 A;  4WWN A;  4MJS B;  4XZ4 A;  4K1R B;  1IP9 A;  2LAS A;  2WWZ A;  2MBB B;  4IM0 A;  4WJP A;  3VXW A;  3ZNZ B;  2N7E A;  3VTW A;  1NI2 A;  3KUC B;  3PRP B;  3WAO A;  3KVF B;  5CHF A;  1I35 A;  4DXA B;  5LXH A;  1SGH A;  2AWT A;  2JXX A;  3VFK A;  4BVU C;  3KUD B;  1QZE A;  3A33 B;  4LJO B;  3BIN A;  2JZ3 B;  5JHB A;  2FAZ A;  2GBJ A;  3HM6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...