2VH1A

Crystal structure of bacterial cell division protein ftsq from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 50
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh1A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh1A02
4C4VB 2VH2A 4C4VA 3MC9A 4C00A 4XGAB 4QAYA 2VH1A 2MHJA 2V9HA 3OG5A 3NJTA 3Q6BA 4BZAA 4PK1A 3EFCA 3MC8A 2X8XX 2QCZA 2QDFA 4K3BA 4K3CA
chains in the Genus database with same CATH superfamily
4MX8A 2V7VA 1RS0A 1X7DA 3NWEA 3N3BC 5LXTA 5GJCA 4FMDF 4M7PA 4X1YB 2QN1A 2P7HA 2PHZA 1XD3B 3NYRA 3UATA 3WBFA 2Y1KA 3HA5A 5K3CA 4WMLA 4WLOA 3GLHB 4FCTA 5DZSA 1L5HB 2OBLA 3M6FA 3WIUA 3RTBA 3W1SA 1WGYA 4PN7A 4QUDA 5LUBA 4EEWA 4UQLA 1GV0A 4M46A 4I0WB 2WAMA 2B1RA 1EGMB 1QCCA 1B8VA 3ZDCA 5I6DA 3ZV4A 2C42A 5CAEB 3KB8A 4LJ4A 4N6GA 5DP1A 3REGA 3HZHA 2AEEA 2AG1A 3BMNA 1YE5A 2LD9A 3TMKA 1R0XA 4ZDJA 3CO0S 3AM1A 4NS1A 2CDRA 1O77A 1D8TA 4HLEA 4I81A 4FHFA 4XYCA 5I51A 3JU3A 5IAAA 5IC5A 3RYFA 1BHSA 3UANA 1FK8A 2W82A 4KKIA 4RO0A 1WIAA 4QM6A 2WU2B 3VTVA 2ZUUA 1F0ZA 4KV9A 4NDZA 4OHBA 3EXHB 4UEJA 3P26A 3UV6A 2B8WA 3A4VA 1ZD5A 2SICE 3CZ4A 5EESA 1XTKA 3IPRA 1J0EA 2P68A 2XKBA 2P1ZA 4KITB 1FXUA 2XE7A 3C98A 1VXRA 1GAJA 5C8VA 4GPTA 2XEWA 3R7DA 1TT5B 2XQFA 5F9MA 1N5DA 3AEGB 3QH4A 3QLEA 2ZUCA 4RF4A 1FBNA 4IIJB 2BWFA 1XMIA 3H8VA 4OW0A 2JATA 1UIMA 1U0HC 3TZKA 2KQUA 3BX1A 5JI2E 2H9AA 4HGNA 5LLDA 2XNDD 1GTG1 3T41A 3BMQA 1QB8A 2GRIA 4HN9A 4JYBA 4ZZ1A 1YD8U 3NNSA 3OCVA 2WXPA 4PS0A 2CYCA 3PKIA 1PN3A 3TH5A 5KTYA 2I33A 1L7OA 2ZUDA 4TKUA 3U4QA 3LYLA 3P4QB 3S55A 4CM4B 1SN7A 2FW6A 3Q7TA 3CZ5A 2JH3A 4W9MC 1XTQA 4KMSA 3BH6A 3RJTA 1RPTA 4LGCA 5KYWB 2IRWA 1UWCA 3EUEA 1D7OA 5K8IA 1L4KA 5EP1A 4LZZA 4RLQA 2O6VB 3G0DA 2ORVA 1JEOA 1NM5A 1RU3A 2JIDA 3QMMA 2NO7A 4KC0A 3HY6A 1Z33A 2QMQA 4EJ0A 1ZG3A 1ZJ6A 1A5AB 4QXMA 1R0LA 5ICEA 2ZXUA 1ZI8A 4DV3B 3FKSD 4K40A 3NC1C 5I4KA 4RTMA 4ENPA 2R7KA 2ATIA 2WUVA 1H4SA 2XOEA 2H57A 4WKGA 3VZBA 2V5UA 1IHPA 3FHLA 4Z86A 1WEKA 1LDNA 1P3JA 3DZ8A 1FSZA 4EH1A 2JLCA 5JJLA 1G3IA 1FIQA 4S1VA 3M2TA 3NOOA 4M1KA 2P77A 4YR9A 2YRXA 3DE4X 2IO2B 4QGAA 1E7YA 4CHKA 2PMWB 1WMDA 2VPTA 2XUPA 1UWXA 4MYCA 2XB4A 4EHAA 4C20A 4B3DA 3ZYCA 2OHFA 3HZOA 1QILA 3ZQJA 2R61A 2X2OA 3W79A 1E92A 2HHCA 2GJ9A 2ZZKA 3FMFA 2JJMA 3BRSA 4YSXB 3VPHA 4AB1A 2JLYA 2WXRA 3ZY4A 2XK5B 1MLDA 4JYAB 1JIQA 4MLZA 3S44A 3FROA 1HGXA 2KVRA 1RRMA 1XTBA 2I6UA 4OZBA 4TLBA 3VC1A 1FFCA 2QF7A 3WHKA 1NJ6A 5TJHA 4TYYA 1GUAA 1E2DA 4PFSA 4V39A 3EIWA 2XAAA 1E61A 2W2LD 3KEOA 4KOEC 3CEMA 3SYMA 3IR7A 2OE2A 3PC7A 3W2HA 3GDGA 3OJWA 1ISGA 4DCNA 5A5FA 3M6VA 1Z63A 4FFLA 2A1UA 2ZJ2A 2AX5A 1U1CA 5AICA 3P20A 3V8BA 2B30A 1U2QA 4PYRA 4O2LA 3B2QA 3BHMA 3IUEA 3WG9A 1G2QA 5DFAA 1QFMA 2CLMB 3GAMA 3DR5A 3DE3X 3O03A 1TO2E 1NUTA 3LCVB 2QTFA 1V1MB 3K5HA 3Q8LA 4I50A 421PA 1TE2A 3INGA 3T9CA 3GDOA 3HEAA 2QSDA 3RUPA 2Q4OA 2QAGB 3DBHB 4XD2A 4R1MA 2VN8A 2C95A 1N9ZA 1QYDA 3EAFA 4S05A 1OEYJ 1OCEA 2O2SA 4LYYA 3G8BA 4DIFA 4J0GA 3U7FB 4L4YA 4BKUA 3OPMA 3PPWA 5D86A 1XLPA 3H9BA 4ZGBA 3WCQA 3WLMA 4BGEA 4GG1A 4JH0A 2HCJB 1VECA 1NQVA 2J7PD 2LUOA 4PW0A 1PR6A 4AT1A 2IZOA 3QY9A 2VTEA 3CURA 3ROPA 1IY8A 1OT3A 1NXTA 3TJRA 3X0WA 4FS8A 1P60A 3DGEC 3D6UA 4KDEA 3VAWA 4NJOA 4RVCA 1UMDB 3FVVA 3S2UA 1XTRA 5BN5B 2ZIXA 4HS9A 1N7GA 1E1RD 3MT0A 1WDWB 1FRDA 3TXAA 1U4AA 3AJDA 1Z2NX 3A6PC 2UVDA 3ND9A 2CJPA 4CMAA 4CN9A 2IIBA 3IOMA 5D7BA 3QSYA 3MM4A 1YQ4B 3DNPA 1ZXBA 1U3UA 1PGQA 3RPEA 4ZTZB 3IP3A 4RPJA 3ENWA 4WK2B 4C7KA 4HXFB 2XCSB 1IN6A 2YOHA 2GASA 4YCSA 3AESB 5FOVA 1R37A 1Z7WA 5GGXA 3NGLA 3OEHD 2C7HA 5H0IA 3ZVRA 4JY7A 2J5QA 2QVZX 2QP3A 1MZPA 1PE0A 3ECAA 2QL6A 3V1MA 1PQ4A 4LDAA 5I7AA 3SX4A 1ZD8A 2POQX 5D87A 1PYOA 3STWA 4H16A 5DBOA 4HLNA 2C9MA 1FMFA 3T94A 4PZEA 1Z18A 3EXAA 1D7AA 2H5LA 4FHEA 3U9LA 3GZJA 4AICA 3AOEA 5FRDA 5C7OO 3BULA 1QP8A 2KLCA 3N1UA 4UE2A 1GHTA 1N75A 1PVDA 2KANA 4J6EA 4DWJA 5A5VA 4N54A 3NAGA 4PQRA 4MKIA 5AVXA 5L8VA 2W98A 1J8CA 1IY2A 1BHJA 2BEJA 2W90A 3KWMA 1CKEA 4EGCB 2RB4A 4KWHA 2DFLA 2IV7A 4NQZA 2FLWA 1TK3A 3GJ7A 1NUAA 4JL9A 2Q5LA 2WV7A 1XL1A 2ZWAA 4O63O 5H59A 3RVKA 2MU1A 4AO7A 5E7QA 1NOIA 1Y98A 4C3ZA 1OLXB 2VXCA 3QPBA 4V0KA 5JALA 1CK1A 4V0OA 1E9BA 3T61A 3OZWA 5EKSA 4MYUA 1Z4KA 4FSXA 4A0QA 1VMAA 2G09A 1EK1A 2QV0A 3PQFA 4DL9A 1QGED 1F12A 3K5IA 3PXXA 3VR0A 4QU8A 4FLHA 3WIBA 1STEA 3GEIA 3OC0A 2A8YA 4GXRA 2ZETA 3GQVA 2VUIB 2CV2A 1CHNA 5BQXA 4ND7A 5GZ1A 1RP1A 2W9XA 1YR8A 1YA6A 1XV5A 2FETA 8MHTA 1L0BA 4PC7A 2DCMA 1JQJC 3IAAA 4EA6A 4J4TA 2X0JA 3EYAA 3DV9A 1D1SA 2LCFA 4X95A 3D8RA 2XKKA 4C21A 1ZESA 1YB2A 3CF4A 1RLFA 3BEDA 2BF7A 3K9PB 2P4UA 3BS4A 3BSSA 1HF3A 2J0QA 5C8YB 2P0EA 3MXOA 4UXIA 1FNDA 1U2TA 2R6HA 2NUPB 2IHUA 3A70A 2ZJ3A 3K1TA 1EZZA 1F2TB 5C5DA 4Z0NA 1PJSA 4WGGA 3BYZA 3LU1A 2UV8A 5A5DA 1KFBB 4NCAA 4ZYZA 4JGHB 2VSOA 1YIWA 3KE9A 1BMTA 4ND2A 5C5IA 4DLYA 2OL4A 3U6KA 2AJCA 1H8EA 5C0OE 1XCQL 2G9QA 4PHHA 2FRDA 3AL3A 3RFTA 5A5GA 4LMRA 1JZSA 2IXTA 3H19A 4X3OA 5TMEA 1CR4A 1ZA2A 1A9QA 4REMA 3V42A 2PUFA 3PL5A 4CG3A 3UHFA 1HM5A 3GOHA 2Q5QA 4Q1AA 4C5AA 1TF7A 4U00A 4DDKA 2XBUA 2NS5A 3I8SA 2TECE 4XEUA 3F9CA 4HVAA 5JAMA 4Z0PA 2JFYA 5I7WA 3K1YA 3H2JA 1W8DA 2HV9A 1A70A 4Z53A 2Z58A 4ED9A 2QN2A 1P61B 1QUEA 1VKJA 4W82A 1CQXA 3BFPA 1ZLXA 1DKOA 1LPBB 1KE2A 4TRRA 3N05A 3HCNA 1OWNA 1S96A 4NYJR 3D7NA 5H80A 1LBEA 4LGMA 5KNDA 3JYQA 1Y8RB 1HE3A 2VJKA 1OILA 1AKUA 1OZFA 5CFMA 3K70B 2AVDA 3WGKA 2QT0A 2FE8A 1DV2A 2IEIA 2B98A 2WV9A 4XR4A 3WSVA 3WKAA 3SQLA 2EYQA 5K8CA 3L8HA 1OZ0A 3EXG1 3D7RA 2P79A 4LN1A 3AVPA 3FY4A 4Z1MD 2V7EA 2WDQB 2OBYA 3GVCA 3KXLA 4Y6PA 2XVMA 3AKYA 2EKPA 1NVID 1HXHA 3BAZA 4IINA 3UCXA 1ZSYA 1P45A 2NBUA 1WQ4A 3VKGA 2WMYA 3OZCA 1JHXA 5D3MA 1RLUA 4NJMA 3PLAE 2JARA 2IBTA 3LBIA 2LGXA 3KFLA 3ZY5A 1E96A 3VPCA 4IRXA 3A2LA 1RYYA 2DENB 4IEFB 3T0GA 1FU4A 1BE6A 4DC9A 5CT8A 1UC5B 5FBVB 4LAFA 2KN4A 2FFBA 3CMCO 3B9QA 4UC0A 3IT0A 3O4GA 2XQIA 4I9NA 3Q14C 2JLRA 1NP3A 4FI3C 4D4IA 3VUWA 4OJQA 3EECA 2PSHA 3K09C 3N20C 2WHPB 4M9XA 3SS9X 4TGLA 4KUHA 3BM5A 3PGJA 3ZTTA 2XODA 2C92A 2YNMD 3NZUA 4UTNA 3H4TA 3MIIA 5ED0A 2EP7A 4DILA 1X8XA 4X8HA 5CDFE 2N1MA 1SCJA 1I4WA 4QYMA 1IQPA 1E62A 1ZM3A 3ZHTA 2WNIA 4FR5A 1B00A 1R4ZA 3Q9LA 1ESNA 3JQFC 2ZZPB 2PAFA 1T2DA 3H6NA 4DMUB 1ZUD1 4YCMA 1SXJD 1P5JA 1VXOA 3IUJA 4F4FA 5ALLA 3WQBA 1COZA 4ZQBA 2KBFA 4G5HA 3U7EB 4HQRA 4CGZA 3AJ8A 3MZ0A 3QVOA 1E3DA 5L3VA 2AYXA 4BO5A 2HL6A 4HFJA 5LQRA 3UF8A 1E2UA 4EGJA 5AYVA 1NA5A 2IEDA 4MO9A 2P4QA 4KFTA 2J3IA 3K4QA 4P22A 2SNIE 5JWOA 5SZJA 1M75A 1YNSA 3CX3A 4HCJA 2YX1A 4OP3A 3GCZA 2P5TB 4PXAA 1C0KA 2GXUA 4Q7QA 1KFEB 4P2BA 5D5PA 3KOXA 2JFFA 1BW9A 3UMBA 3SIWA 3EIHA 4MV0A 3CNBA 1E9EA 1EDZA 1P44A 2JXXA 3KLOA 4C04A 4TTIA 2VUTA 5A7FA 3W3ZB 5FR6A 2X58A 1M5UA 4MHTA 3IELA 3DAFA 5H82A 1D6MA 2V7XA 4RGTA 3TTXA 2K39A 2ST1A 3S6JA 2G1JA 1L5WA 1Z2OX 1K6IA 3V8EA 1I4QA 3OPYI 5JAIA 4V0SA 1PGAA 4Z1OA 1A9OA 1W36D 3K1AA 2ANBA 1Y48E 2CSUA 4IQ4A 1TYAE 4ZIRB 2VLBA 5FWAA 1SPXA 5ES4B 2XUIA 3A10A 4P5PA 4KYUA 1AUVA 3DEFA 3AONB 3ZTDA 4WZAB 5LMUB 4XVCA 4G3XB 1CIVA 1EM6A 1SBQA 1RKVA 3B1VA 3Q2OA 2H63A 2IPLA 3PG5A 2NU6B 3BWEA 2WYHA 1OFFA 4X7PA 1QV6A 5DP2A 1WETA 3PFGA 2QJLA 4NBNA 3UG6A 2IODA 2QP4A 3IOCA 4DOMA 2QGNA 3R6DA 3Q3JA 5J43A 3LBHA 2H08A 2F1OA 4BB0A 1RJWA 3EODA 4MMYB 2FSFA 3RRNA 3Q40A 3S1AB 3SE7A 4PLHA 1ZWKA 2H0AA 4HDQA 4B6GA 4IG7B 3OLXA 5FPKA 4JNCA 5FJIA 4EUEA 4QC2A 2C4UA 3FMVA 3UMSA 3MTDA 2BISA 4FBGA 3GLFB 1I9GA 2XCIA 4EG1A 2HWXA 5KYUB 2I3AA 4S1TA 1QKIA 3O3NB 3K9OB 1H9CA 4RGBA 3BL6A 3V6CB 3L7YA 3DAGA 3PRYA 3ER6A 3O3OB 3ZDMC 2HRCA 1VJ5A 4A0HA 5ECDA 3GELA 3AVVA 3E18A 4JVLA 4NAWA 2CXXA 3CLSC 3X1DA 2F62A 5LQNA 1YZLA 2CHXA 1JSXA 1G6HA 1SBZA 2QSZA 4CG2A 5AUQA 4R05A 2X0DA 4CU5A 2JGKA 3FTNA 1QNFA 3GJYA 4QDZA 2YHBA 4OQMA 5CK5A 3ISVA 5K3AA 4B8YA 1MKYA 1USVA 1DG9A 1RI3A 1SKYE 2JAXA 2DFNA 4HNVA 1E69A 3HA3A 3DO6A 4AJPA 5ARBA 3RYCB 3JWIA 2LW7A 5F76A 1NBFC 3IOBA 2HMVA 1Y4DE 1P19A 5ENDA 5BN3A 3CNLA 1U8CB 3KUDA 1KDVA 4WRRA 3LDHA 2DT8A 1TAUA 3LPDA 1KOGA 3N39C 2VO1A 4UEOA 2CJXA 2QDFA 5CH8A 3ANNA 2ODPA 2C54A 1X7HA 3PIIA 3OM8A 4MJ7A 3VZPA 3VYVA 3S2EA 3X1MA 3PQ7A 4CLRB 1E90A 1NAHA 5CLQA 3K15A 2YZKA 3ITKA 1TD9A 5DOZA 1U9YA 3UHAA 4QXQA 1BS9A 1XLQA 1E1LA 2QN3A 1W4AA 2BGIA 3BCRA 1KZGB 3CRQA 4N0DA 2WB4A 1NYTA 4M9SA 2O6LA 2ZRKA 3E27A 1HQKA 3GPCA 3FJYA 2QZ4A 4JJ4A 2PKQP 2XWPA 4LJYA 1EG2A 1WP4A 4EPXA 3V5NA 1Y3AA 4LZAA 2X7XA 1RWWA 2CD9A 1NVVQ 4C08A 3VTWA 3FLBA 4XUEA 4OOFA 4Q9HA 3CA8A 4WW0A 2C9YA 4LF4B 1MJNA 1IHXA 1OSNA 2W3RA 2PE6B 1RXVA 3Q1LA 5T5QA 2QMYA 1DWUA 1QPZA 5AVRA 1E8DA 4AWXA 2H2GA 4Z4IA 4ND3A 2ZE5A 1N1EA 2ZVJA 1XK7A 1XQWA 1KVUA 1JQEA 3T7TA 4MEBA 1RLTA 3I28A 3EC8A 3EVNA 5E4YA 5G3ZA 1SIWA 3PD0A 3JATB 5JRDS 2ZSJA 1BVHA 5CTAA 1K6JA 4AULA 2ON8A 1C0IA 3V6EB 2RMMA 3R0ZA 4ZJPA 1P9OA 2B4KA 3A9VA 2ZPAA 5A6SB 4EHHA 4WJKB 4Q7KA 4ADSG 4CMEC 4MKFA 1X6VA 3VFDA 3WP1B 4BNKA 1ACLA 3T5CA 1WZEA 3I12A 1E4EA 2Q3JA 3A4NA 3A8TA 2WPNA 3FPSA 5MFPA 2JBWA 4FUTA 3ISJA 1FLAA 3RM3A 4EZBA 1FW8A 4HH4A 2X4IA 3MCWA 1U3GA 2LASA 3ZWNA 4IUBS 1C1YB 3A9UA 5G4KB 2MEKA 3E9NA 3ZIAD 3M3JA 2JKYA 1BA3A 3TG8A 4G8JA 3U4MA 3H4MA 4EL5A 3ZZ1A 1O58A 4CKEA 3VYUB 4GBGA 1AKEA 4YJHB 1E6LA 3MXTA 4P86A 5FV7A 1UMBB 3T7IA 4GKKB 4PLPA 1EE1A 3BWUD 3PHLA 4L9RA 1VFPA 1WL8A 4JITA 4KO8A 3AF0A 1L4HA 5ITZA 3EPHA 3ZUGA 2N0SA 4RNAA 2WE7A 1VSTA 2NO5A 3M0EA 1YJ8A 4JR0A 5FR1A 1KC3A 3BORA 1R8YA 3O9MA 2BMDA 3BD7A 2Z0DB 2WA2A 3EQ9A 3Q5EA 4KMRA 2MDTA 1A4UA 3WMFA 4ESHA 2NNWB 3KTOA 3OOYA 1FYWA 2QTBA 3MS2A 5IBCA 5CDGA 2UZ4A 1JJIA 3UB4A 2I6GA 1DC4A 2Q27A 4BP3A 3V9AA 5G2NA 4FLFA 4JR1A 1U0JA 1UQTA 4Q5IA 3LT5A 3CM0A 3ICWA 4GUAA 2V3WA 4IWXA 2DQKA 2BC9A 1FUEA 2CL5A 2GN2A 3VR6A 1IM8A 1DC5A 1ISIA 1FDUA 4F85A 1TFRA 4A20A 2YUIA 4LC9A 2PMEA 4XEHA 4IIJF 5AM4A 1K27A 3AXTA 5BYJA 5ITVA 2R86A 1U0OC 1CF9A 1PNRA 4FS3A 4HB0A 5F1PA 3VKUA 3W8FA 2OZVA 4ALKA 2OFWA 2HLHA 4UTXA 4IW3B 1WX8A 4MSUA 2O2XA 3PJEA 3M3DA 2WA1A 2PH5A 2R2OA 3MINA 4R1SA 1XLNA 4MB2A 3OPQA 1YCFA 1VG9B 2ISSD 2X5OA 4MQEB 3RIXA 2B7CA 4MP6A 2XA1A 4LWPA 3JWGA 2XTJA 3HDTA 4CGYA 4P16A 1DDGA 2ONQA 1Q1AA 4YJDA 2DGDA 3D2BA 4LFAB 3EGRA 2AOVA 4IRUB 1VL8A 4ZTBA 4MV4A 4EYOA 1ZN9A 5FBLB 5HF6A 3SXUB 3C43A 2B8TA 2FG7C 1WE2A 1YT5A 3ZIUA 3IP9A 3HB7A 3IQDB 3OZAA 2CFCA 1J5EB 4AWAA 4KQIA 3ZBUA 3DLBA 3KCQA 3UVEA 3A1UA 2HC9A 1YH3A 1X7ZA 3KDSE 3MUOA 4QATA 2AC2A 1YK0A 3VU9B 2VDOB 5KJEA 2HQBA 1R6XA 3CEAA 2ZCUA 3NJ8A 4RVSA 3TUIC 4PG7A 2Y0DA 5FUMA 2ZYRA 1TYEB 3SQDA 5CLIA 3L4EA 4IH1A 1I10A 4YP5A 3JPYA 3PKZA 4U7GA 3AB3A 4J43A 3ZNOA 1JQ3A 2HKIA 1WXVA 3TIIA 3Q3IA 2BWES 4L76A 2PL1A 4BLSA 5JW6A 4A82A 1T0RC 2BDEA 2FP3A 4BEVA 1SCQA 4YECA 3C6MA 1KQGA 1OAKA 1PAUA 2DUUA 1EK6A 4BV3A 3KQWA 1L7EA 5HM8A 2VJCA 2QY6A 3S4YA 2V9PA 1P5RA 2QTTA 4YJKA 3QEMB 3FTEA 1LSSA 4YALA 1F6WA 5LJLA 1AXRA 2WAAA 1E0SA 3EXEB 1GPAA 1WGKA 5CITA 4HPJB 1QS0B 4G0XA 3VOSA 4XDHA 4MR8B 2ZZNA 2EKIA 2MH7A 1WU8A 4GI3A 2ZYWX 4S2EA 4PZDA 4Q1EA 2RHCA 4CVNA 5EQFA 2Y9PB 3KD2A 3AEKA 1PQWA 1YUBA 2A33A 3QX8A 1GGVA 2D2VA 4W9EA 4ZVLA 2IH2A 2ZJZA 3QITA 4NXMB 4DB2A 1DJPA 2ZYGA 3I9FA 4QLAA 3F49S 3R0JA 1NXWA 3SS7X 3ZGYA 4RDCA 2PXAA 1SBYA 2QLNA 4BNJA 1T4DA 2GZ1A 1A9ZA 1ITZA 2R96A 2ZZMA 1LLFA 1QHEA 3DMNA 2JGMA 3CX4A 4FYKA 3BCSA 1Y7IA 1XJQA 5KYTA 2R6ZA 5CA0A 4B3FX 5KJFA 5KDDA 4TWZA 4Y0NA 4P5EA 2IIPA 1JSRA 4F5EA 4AMVA 1MX1A 2AQ1B 5KSOA 3K20A 3V4SA 2JX5A 2KLHA 5JROA 3QLJA 5T4BA 4FNAA 4PZZA 1EUYA 2C2XA 1I80A 3GZNI 5C8DA 3KETA 3A27A 2ZIZA 4UJ3A 3UC9A 4F86A 1SCIA 2GHRA 1KY3A 4TTQA 3NJ4A 2PGLA 2LVOA 1QH8A 1B1AA 3FBWA 1II8B 5HMLA 4EF4A 3EXFB 3TRFA 4L0CA 3D4IA 3PJFA 2XRFA 4GX2A 1E2EA 3DVAB 4IZHA 1QFYA 1SE3A 4ZV7A 1FYEA 3ND6A 4KXNA 1JEQB 1N33B 2E4YA 5AKGA 4WERA 2XCRB 2FUNB 1KQPA 3FJ1A 1V3TA 3QKSB 4R5HA 4JC0A 3U80A 3VR5H 1YF3A 1DTWA 3BIWA 3KQSA 1CR1A 5DTJA 2EP8A 4BX0A 5LP6C 2Z08A 2R47A 5D3QA 1AHHA 4EHJA 3HNOA 4L1KA 2O8FB 2GZSA 2CNOA 4BQRA 3ZE0B 1SG9A 5KHLB 1SIJA 4YRLA 3ZNGC 3ZU4A 2AUTA 3SDBA 3IBSA 1XZPA 3Q9SA 2H4JA 3AM3A 4FDVA 2F48A 3ABVB 2OWEA 1JH9A 1W88B 4WFJA 3DQVA 2WD7B 4YGYA 2LXCA 2FGKA 4DMRA 3U5TA 3OFJA 3R77A 5IDWA 4LE0A 3RS4A 2W6ZA 4E07A 5JOQA 2EAUA 1X1RA 2NXJA 1AE1A 3G17A 1X7YA 4YV7A 2I2DA 1LTKA 1DMRA 3I9JA 4C4XA 3MEQA 5A9TA 1IY9A 2GLTA 2GFQA 5DWDA 1DKNA 5KCMA 4D8YA 1C4XA 4AZVA 5A05A 2OO7A 3WBBA 5JS7A 3UQAA 4KKXB 4RIHA 1W0JA 2IGHA 1XHLA 2Q3FA 5JTUA 1P7EA 3E9YA 2HAEA 3FCYA 3RNGC 2I5PO 3MB8A 4KFSA 1QOQB 3HQ4O 1YS9A 1GPUA 4JI3B 5KVSA 4ACBA 1NQ5A 5KQSA 3KV3O 5AHKA 4KH0A 1PJCA 1U0SY 1W19A 3VYRB 1WGGA 5DDIP 1GNRA 1GY8A 5EJ2A 4D4HA 3RNFC 3H5WA 4LC1A 4J75A 2XUQA 3WLKX 4B0PA 4N65A 5DTMA 2JLAA 5EGNA 1GU1A 2VNSA 3QA8A 3OCYA 4B7AA 3J9CA 4WDQA 4XD7A 2B4TO 3AETA 3KAQA 2E5LB 3HUEA 1RQRA 3INNA 2IH5A 5JAOA 5EHXA 4X20B 4C0KA 3W8DA 5C8YF 4RZ3A 2ZYVX 3ILYA 1RKBA 2IY1B 5ALOA 3D43A 4O5OA 4TKLA 1GL3A 3N3KB 3O0TA 1WSDA 4FN5A 1GG9A 4W9KA 2ZJ6A 4ZKEA 5TARA 1LQTA 5AXDA 4G9GA 2CLCX 2AOUA 2AT1A 3B3GA 5K0LA 1HMYA 4RD4A 1HYEA 1RHKA 3COZA 3I05A 5GMOA 3EEOA 5CCDA 4J1SA 4PRKA 2V0CA 2NPOA 2YJGA 3TQTA 1C4KA 3CF6R 4YT0B 1MW9X 3A6KA 1A9PA 2VDQB 1MVLA 3QGMA 4GDLA 2HA6A 1L6VA 4RD3A 1RADA 2KDIA 1JLKA 3I9V1 1TUBA 3FYTA 1Z6QA 1H42A 3CF2A 4LSMA 4E46A 1D2HA 2PDAA 1CU1A 1B2LA 2X3UA 1TS3A 4GPZA 4JLSA 5KQMA 3BGIA 4UW9A 5AM5A 2CNBA 3LTEA 2A92A 2IXEA 2VDNB 3WC4A 1PNQA 1SFRA 4L8FA 1KZ7B 1GG2A 4H27A 1T36A 3C3BA 1IN5A 2D0OB 4HDMA 5K0GA 2X8XX 1QO7A 2GVDC 5CM9C 5MGBA 3JYPA 2GWHA 1PJZA 4MP3A 2V1XA 4ZMRA 2O2IA 1Q1GA 1YI8A 5BP7A 5I01A 4DTIA 1XC7A 4MUEA 3P2EA 4M0LA 2O8NA 3W2TA 1NIJA 3OD5A 3JCZA 3DDWA 4I8XA 3PE4A 1GUZA 3QLUA 2EX4A 1IOLA 1IB0A 3NYWA 3O2JA 1E10A 2WFAA 2Q4DA 3ABIA 1BFDA 1PCXA 5E8JA 4PYMA 3C3XA 4DYDA 1AKYA 1ISFA 2IYVA 1Z26A 1R6DA 3CB4A 3KHKA 1QV9A 3NCHA 2JHGA 1CC1S 2J4DA 3EDCA 1YU6A 3DMRA 3NUHB 2PLPA 1SPBS 5DPTA 1AN9A 1ZDVA 2NTVA 3AH7A 3BL8A 2A0YA 1Q22A 1U3CA 2H7YA 2NZXA 1K52A 4KN5A 4NL4H 4RFSB 4JYPA 4I66A 5CYFA 4IHJB 1ODSA 4RC9A 1E0AA 1S9HA 3JQCA 1XBTA 3S2GA 5BNWA 2BD0A 1N0WA 3BRCA 2PKXA 3UYKA 1PS8A 3IO3A 2IO0B 4LKRA 3TTWA 1JVNA 1W59A 4KEAA 3DDOA 4B3MB 1MRNA 3G89A 3ZHXA 4AJHA 4X9XA 1VGQA 3K9HA 4KXMA 3KPVA 2GM9A 4OHOA 3UQZA 4JQCA 3F6CA 4ZU3A 3BUSA 5AUPB 3I76A 1C2TA 3JWEA 1WMBA 4CTMA 1HDXA 1FJXA 1BJTA 3R7FA 2Q0QA 3DDSA 1VIAA 2ZSDA 4P4SB 4LBVA 1USKA 2VFAA 3CVOA 3K71B 5ELXA 3NC0C 4GE3A 4LXYA 1BUIC 5TQJA 4PF1A 3VVMA 1MI0A 4PQGA 4B31A 3CRZA 2HDHA 3M6WA 1YVUA 3WBKA 2AN5A 5FNZA 4BKMA 2NTJA 2OHHA 2ZUVA 4NZZA 3HJCA 3MUEA 2WXLA 4DJTA 1VL2A 2GEDA 2QROA 5AVYA 3VZCA 2OZEA 3VNAA 2J3EA 4MGEA 5LNK1 3GVXA 2Z2XA 4OI2A 3QKUA 3IIKA 1XRNA 1U7UA 3VAAA 5ED4A 4ITVA 4NPCA 4LVNA 1CRLA 2JHAA 4RMGA 3V9PA 4E2FA 1V3UA 3QW4B 1O5OA 5IW8A 3KLSX 4DPMA 3HYTA 1JUDA 1FXAA 3KXKA 2C4NA 2QVCA 3QUQA 4KK3A 5FUXA 2EJBA 4FW8A 2OHVA 1JFLA 1F0KA 1WO8A 4Q93A 4YTEA 3W1EA 4QVIA 5TSSA 1C4AA 2DLDA 3OX3A 3RC8A 5K45A 3VJKA 1KRHA 2XH8A 4IO1A 4LPKA 4KDCA 3RWBA 4XDDA 1JFFB 5BT8A 1U0LA 2EZUA 3HJTA 2KJ6A 3K0CC 1D0IA 1JLLA 3N74A 1W73A 1XCOA 1EBUA 2XTMA 3KZXA 4IM3A 4X45A 2E4XA 4CV0A 4Z2AA 1HV8A 5AW2A 3BYTB 3ZE9A 5ALTA 3HJGA 5ELLA 1J00A 2K4MA 1Y8AA 5HIKA 1ZZGA 5IA7A 2NPTB 2OAGA 1ONPA 1FNUA 2F55A 3UAOA 2QKYA 3O65B 1GA1A 3PSHA 3PS9A 3PZRA 4XSVA 3LQFA 1D4OA 2FGJA 3GJ4A 4RJLA 2ZRMA 4UMDA 2NVWA 3QOFA 4EIWA 2YRWA 2IU3A 4WSOA 2VP6A 2KFJA 4YT8A 4OUDA 1L8XA 2GEUA 4W63A 2WSMA 2I6SA 5JS6A 1SQGA 2LIVA 4BQOA 5FXMA 3WYFA 3VHXB 3RQSA 4X7BA 3OQIA 1E1MA 1AW7A 2JK0A 2YY5A 3V7UA 5I9TA 1LXCA 4AN0A 1YS2X 3WS7A 4IDIA 1J7CA 1KTVA 2AXQA 2W0SA 4DPKA 3RHTA 3ANSA 3KC2A 2KMMA 4GPEA 4XQGA 3WQQA 1DG3A 1L8QA 3CE6A 2IPMA 4EQ6A 1JWSD 3KOYA 3O6VA 3ZI7A 2F43B 1U9IC 3QNUA 3FUCA 4KZKA 4JBXA 5THKA 1RXCA 4GM4A 2FUKA 4GN1A 3BCUA 3NXKA 1DC7A 2A6PA 4HDOB 4KOAA 3RFXA 2Q1WA 3AR8A 2AZTA 2OV4A 4JT2A 4KQEA 2PAAA 2YNMC 2RHRA 3HHEA 3KEQA 1Z06A 4GMVA 3A4MA 3GYBA 1ZYUA 2JZNA 4UZEA 3MNFA 3UJPA 4TT3A 3LX8A 4Y2XA 2RD0A 1MENA 3HXMA 1FMCA 3WGOA 4ASWC 3ZIMA 3TI9A 4FULA 5B1DA 3I4FA 2O3TA 3PFCA 1SXJC 2D7CA 1WU7A 2MQJA 1JX6A 1JHAA 5IT4A 4CKYA 2HHJA 3SZ3A 4H7JA 3BMXA 1TZCA 1EB8A 1OLUB 2GFIA 2C7RA 4C6HA 2O8DA 4UAGA 5CTRC 4MW2A 4YRCA 2YJ5A 4GM1A 4JLAA 3NBZC 5JXWA 1G5HA 1CEEA 3C4QA 2VAXA 3L41A 4HVTA 4XFJA 4NX2A 4LVOA 3JQ7A 4ICVA 1T9KA 2LD4A 3BWMA 2JLUA 2ZRNA 1L9XA 1GKYA 1UZMA 2VTBB 1G3QA 1L1FA 2FFJA 3K2EA 1DUIA 5JVDA 4IJ5A 1MIOA 1H2XA 3E0QA 3K0BA 5TNXA 4ZQGA 4C4ZA 3K0FB 2RGBA 1T5IA 1MPXA 4E13A 4OQPA 2ZTHA 3PFFA 3L08A 2V55B 1OI7A 3NS1A 2F1HA 2LDBA 4D9IA 3OVMA 4YAIA 4R2KA 1XPUA 4M8LA 5KOJA 3I9OA 4JQZA 3H18A 3OWXA 1JKJB 1MB0A 1W36C 4UJ5A 5JWRA 2GI9A 3AVTA 4C4VB 2D06A 2HEIA 3GHYA 4HH1A 3QPVA 2VCHA 3ZZTA 3OLQA 5K8VA 3NY5A 5AHWA 4EUNA 1GCIA 4CMGA 5HIJA 4CTJA 2KWVB 2GEFA 2HK8A 2APJA 3QIJA 3DPUA 1KO7A 2JGFA 3ZY3A 1QXSA 3VU1A 2J07A 1CZLA 1WB9A 3P1MA 1GYRA 3L1KA 4W1RA 1TJPB 1GKKA 3BMCA 3L7AA 1BKSB 4Q24A 3FHTA 1RM5A 1UPXA 3GP8A 2C04A 2ACZB 4QREA 4L5BA 2FOIA 4ZCLA 3IP6A 4IVPA 3UXYA 1ZC4A 5GXGB 1U1EA 1RJEA 3K9QO 3T4EA 3OFND 1YR6A 1HG0A 3BICA 1SCUA 1VP9A 3MWKA 4ZRNA 4WBSA 3RPFC 4WXEA 3PR2B 5IVHA 1KOLA 4B5KA 3WIDA 2ZRLA 2PEAA 3H2IA 4E03A 4J2TA 1BMDA 1NNSA 1F17A 3KOMA 5HCUA 4GOCA 2RH4A 2Z0EB 1F4PA 1Q0ZA 3BGWA 1K68A 2WJZB 4N7RA 2KPOA 2HW8A 3E7DA 2B1IA 1EI9A 4W5RA 1AT1A 3H5AA 1P7PA 2Z98A 3A6FA 5DRYA 1EHIA 1T34A 4BWVA 4YRSA 4I2VA 1HZZC 1FDRA 1JHRA 2BB5A 1EVZA 1XEXA 2CHZA 3QI7A 4OYYA 1I24A 3K9WA 1UANA 3R5FA 4N18A 1SUWA 3HFRA 4E2WA 1F4LA 2XRYA 5LFAA 1UKVY 5BYRA 3W9BA 2DTXA 1IZ8A 4ZREA 2NT4A 3NVAA 4TV8B 5GIOE 4EJ6A 3G85A 2GTIA 4WUVA 4ETMA 4QPCA 2XD4A 6REQA 1YDEA 1CY4A 1M2OA 3ACCA 3BA1A 2ATCA 1Y3HA 4XX0B 3NUQA 1AU9A 1HT0A 1C8LA 4A73A 4DXGA 2FPIB 2IXAA 2XCTB 3R3XA 1XMPA 1P0MA 5FO0A 4I4NA 1ORVA 2P4HX 3AZQA 2R2GA 4RL6A 4BB9A 4P92A 3UBMA 1RJ9B 1B3BA 2NACA 3WKCA 5CDHA 4E5PA 4CMKA 2ZPYA 4BNWA 2OCXA 2FX2A 1T9CA 3S29A 2XMPA 2Z30A 3FGPA 1R8QA 1GDDA 3GGGA 3QF4A 4P93A 2FEXA 5L4LA 1SBNE 1SHJA 1R6BX 2RHGB 5KC8A 5KVQA 2YICA 1WR6E 1JBKA 3VSDA 3KTFA 1V80A 1L7RA 1TMGE 2RC5A 2IW1A 3G0OA 2I71A 4GBMA 2VHVA 3EPPA 4D74A 2R6JA 5HKHA 4FR0A 3L4BA 3QW2A 4UATA 1GPMA 5L3SB 4HV4A 2UZ1A 4MUFA 4X7RA 4FGUA 2CE2X 5JNRA 3C5EA 4DC1A 2ZI9A 1OX4B 1QZZA 4JYCA 5KNBA 2NTNA 1NY6A 4MS1A 3ZU6A 2ABWA 1K86A 2PQMA 3CBQA 5JSZA 1YZ3A 4BIMA 3T9BA 2MHCA 1P6UA 4WT7A 1T3SA 3NH6A 1QCZA 1QHHA 5DLDA 3DEJA 4RQBA 3PQ8A 4O5AA 2KSQA 2WMDA 2N9KA 3HWRA 4EHFA 4YX9A 4IWOA 3ZW8A 4ZCRA 3QBEA 2J08A 5CVTA 1FRFS 5FB3A 1M10A 1P8AA 1A8QA 3M34A 4RPIA 4D0SA 3G5TA 4RBNA 2IJGX 2ZIEA 2UWQA 1DBVO 1LPSA 3QLTA 3KKZA 3OF2A 1V6AA 3PNQA 3UZUA 4RM9A 5CRIA 5KTNA 1L5RA 1POWA 4GMKA 2I2YA 2Q6LA 1I42A 2NQ8A 4EVRA 1Q0PA 1V5EA 4NPHA 1HKHA 3CKMA 3FPKA 1YJCA 4C5CA 2W6NA 3K0EA 2GZHA 3KOZA 3QIAA 3H2ZA 3ODPA 4GOXA 3PENA 2WD8A 3FOZA 4CUKA 2FPPA 5DT9A 2KQ4X 3EZ9A 1NW5A 3CVYA 4U9UA 2N7EA 1TCBA 4RQTA 5KC9A 3RANA 4X90A 1XD8A 2QBYA 2QI9C 3F5SA 5BT9A 1H8HD 3ZQKA 2H11A 3UJAA 4IDPA 3UMYA 1QU3A 4YUXA 2NZYA 2CNWA 3T5BA 3TSWA 4JX8A 4LCBA 3DXFA 3OAAA 1H6BA 1E5VA 5HZGA 4Q3DA 3Q8BA 2OGTA 1ISRA 1N7HA 1X7WA 1HYBA 4UE3S 2Z4SA 1N4AA 3HO1A 1CK4A 4RKRA 5JNTA 2R85A 3A11A 3C39A 3DLTA 3EGXA 1KO4A 3KSUA 1PR1A 3K6SA 4E70A 4XX1A 4KXQA 1EVLA 5FL7D 2AV6A 1YQGA 4OTZA 1IPEA 3RKUA 3KALA 5FBKA 1V8OA 3D3NA 5ALEA 4R1QA 2V03A 1JU3A 2V7GA 1FO4A 4QEDA 3V32A 2R7MA 1KJTA 3LNCA 5DTRA 4C7OA 3AEQA 1T6NA 2HMSA 3BPSA 2I22A 2GBGA 4OOEA 1YOBA 4YMIA 1H2AS 3WSTA 5CT4A 5M5BA 5L7YA 2JHFA 2P9FA 2FK8A 4YTMB 4RY2A 3MTNB 2V9ZA 2Q2NA 1U8EA 4DYVA 5JH7B 4K03A 2M0XA 3GF4A 3ABQB 1M2KA 1OBOA 2WILA 3JQBA 4DW8A 4LY0A 1Z38A 2IKQA 2EFEB 4XAQA 1G6Q1 4LXUA 5EMKA 3W78A 3PV0A 2WWGA 3L8MA 4BECA 4KX5A 3M49A 3M5DA 3ABRB 4R16A 2ZRHA 2FWAA 721PA 3DTNA 2GCNA 4FN4A 4BP9A 5BORA 2IZ7A 3DP9A 4XVUA 2UKDA 1H2YA 4W9RA 1MOPA 3G2QA 4HUQB 1QHXA 2I67A 2RAVA 4OLFA 3AIKA 4K7JA 4ARUA 3ZEIA 1KDRA 2MMGA 5FO1A 4BNXA 2G40A 3OQNA 4OBXA 5JS2A 2ZJAA 1NSYA 1Q15A 3R0XA 1E32A 5EZYB 4XC2A 4CQJA 5LZ4A 1DAHA 4LNKA 5HZHA 1E2IA 2WTMA 2N9UA 1II0A 3KT6A 5EZSA 2O2ZA 2DH5A 3P2IA 4QAJA 1GPNA 3WLFA 1IZZA 1ZIDA 4CF5A 2XADA 4KWEA 4QZVA 4HWRA 2HYDA 3AGPA 1WZ0A 3GFOA 4YXDB 1IDN1 2LXAA 2DPGA 1ORTA 1HQYE 1II9A 1NVGA 3O90A 2ID7A 1RLIA 3WWCA 2HJWA 2I2WA 4LJLA 1E8MA 3EIOA 4AI6A 1Y5LA 2ZDQA 3PXDA 3PZ7A 4EZEA 1Z0AA 2C96A 1L6UA 1D9ZA 2UYGA 3B9JA 4G1CA 4D8VA 4DIUA 1Y5NA 3ABZA 4NG4A 4WH0A 1CPYA 3HVJA 2VDWA 1WM3A 6NULA 3DNFA 1YA8A 1ECBA 1NW8A 2YJ6A 1ADYA 1CYDA 2JGNA 2ZCJA 3WV4A 5HDBB 3KPJA 1TKEA 4Z8YA 3ZYYX 2BHSA 2FAXA 1TW2A 5FOQA 1KM7A 4O02B 5IAGA 1SEPA 3Q8MA 2DFDA 1DEXA 4EEZA 4FWTA 1YWGO 4PK1A 2IYLD 1UDAA 2DHQA 2G1UA 4URWR 3A9TA 3ESDA 2IC5A 1OXBB 4XB6B 2M17A 4WWNA 2HLDA 3NG1A 1MR3F 3OIUA 1DIHA 1G55A 1F2DA 5JWHA 2X41A 3G7UA 4KVAA 1K98A 2BP7A 4RY8A 1B8NA 2OVBA 1A5SB 4ZHPA 3GH3A 2MHJA 1Z16A 2E1PA 4AKSA 2C3MA 4AG3A 5C3JB 1T4CA 1K9VF 4I1UA 1ESZA 2A5DA 1CR2A 2V65A 5CHFA 3FN4A 1PDVA 2QRVA 5CTJA 3FYSA 3LI2A 3GPDG 5HA5A 3R7WB 2PL3A 2O2GA 2DZMA 1G66A 4Z3OA 4DANA 4Z2YA 2PKQO 3C8ZA 2IY7A 3HO8A 1QP7A 3OQJA 3A1SA 3UMVA 4ZALA 1AMOA 3OSZA 4EMTA 1YXMA 4PIPA 5AMXA 5BV8A 5LKAA 2P3LA 1BMQA 1ENZA 4ZOLA 3G23A 4IM0A 1AA9A 3U7HB 1QR2A 1A2QA 3W2FA 4KFUA 4AJIA 4RTRA 3RS2A 1Y6QA 5D7GA 4OEHA 3FOFC 5JJ5A 2OMKA 5AKLA 1GGKA 2GN9A 1O94A 4OK6A 3F47A 1FP2A 3BREA 1LTHR 3MTIA 2J6CA 1SCKA 3DLIA 4J16A 3J7TA 1S3GA 4ANXA 3AB5A 3C3PA 3HKDB 1LPAB 5EEGA 2GOYA 3JAKB 2M56B 4HWTA 4X93A 4KE9A 5FBWB 2P6NA 1VMKA 2DHZA 2P8JA 1R15A 1NDUA 1Y4SA 2PRZA 1EUVB 5LZ5A 3QU9A 1FDIA 4C7ZA 4WZBB 1WW3A 4A3SA 1NQOA 2QEQA 1IWBB 1E1QA 1MOQA 4BIIA 5K0ZA 5ER6A 1KSGA 4RHYA 3PQEA 5DM2A 3GFVA 3AJ9A 3TSZA 1F8XA 3P9YA 1LXDA 3I01A 4C4OA 5K6AA 1UKBA 1BQ3A 1GLGA 2JVKA 2AKYA 1I1OA 4V3BA 4W9FA 4I5GA 2UUCB 2ODQA 3GPIA 1ZFNA 5BQ5A 4KIKA 1OFUX 3IA7A 4HI0E 1XN4A 3IMKA 1WWTA 4MPDA 3SI7A 4YDSA 4R3WA 5E6PA 1Q14A 5D84A 4WQOB 1WOYA 4B7CA 4QU9A 1LNSA 5H7XA 1QQ6A 4IHJF 3DPSA 1EFRD 4BJ3A 1VJKA 1LPPA 4J4HA 1DZ3A 4N5DA 4CL2A 5ALXA 5JAHA 1XYYA 5HSGA 4UEWA 3PI7A 4NOJA 3OUTA 3JTEA 5L95C 1CUIA 2FMUA 1SA0A 2F1RA 4YL8A 2OKGA 2M19A 3P2BA 5DBHX 1RCTE 4JI2B 1O9GA 4KR0A 2OLJA 4R1LA 2NO0A 3PPIA 1V97A 2IU6A 1IULA 4ATNA 3KAKA 3D3KA 5JH5C 1SC9A 3PDHA 2FPMA 2QLLA 4LJ8A 3WHIA 1BJKA 3I83A 1OXKB 3R7LA 5ALDA 1SOVA 1H5QA 3HB5X 5A9SA 4HVBA 3RSCA 4G0WA 3AWDA 2ILVA 3PE6A 5ITWA 4GR5A 3KTAB 5JDCA 1B1CA 3SM3A 4OIFA 2IEGA 1BE1A 3F98A 4XYEA 4J0IA 5G0WA 3B2EA 1MDFA 3EG9B 1U8FO 3AEAB 3A9WA 4EPYA 5JZBA 1VHQA 1H4VB 3LPCA 2WM8A 3ZZMA 2RPQA 2C9BA 3GJTA 4Y98A 2XA9A 2B0CA 2CLSA 4L2IA 3HRIA 3PSEB 1AC5A 1QDEA 5DHPA 3GEEA 4YQYA 4LSWA 1QWSA 3AHCA 4GPBA 3J7AC 3DVQX 2E3TA 3GLQA 2ENWA 2XZLA 1X39A 1BJRE 3P2JA 5DNWA 1BFUA 1TVMA 3WLLA 5CIWA 3DBLA 3OU2A 4S1PA 3FSGA 4RK1A 5DGCA 4AW9A 3ZHBA 3RFUA 1UIRA 2Q4TA 2XZOA 4WK4B 3EGIA 1A5TA 3M4JA 1AQ6A 5I9SA 3RW9A 1H6CA 4Z4FA 2W54A 2FQXA 5JNLA 4ALLA 2M2IA 4B6PA 3AYZB 3BHNA 4L0MA 4OGFA 3FYDA 3A3PA 5C4MA 5E3JA 1U2EA 4E7OA 1I6LA 1C50A 4MARA 1IBLB 2NU8A 4YAFA 1FD6A 1UAGA 1IXYA 1B6SA 1XKXA 1LI5A 1X15A 3L6CA 4ZI2A 2JI7A 4YJ2B 1XTTA 1M1YA 3HUUA 5AVUA 2A1IA 1U7OA 2DBRA 1P6XA 3B7PA 1T43A 4KVGB 2JI4A 3DZBA 3TJPA 1G19A 1I4EB 2JBHA 5LQCA 1FVFA 4CYMA 2CJOA 2FQ1A 4CHGA 4G0NB 5CH5A 2KLBA 5MHTA 3DDNA 3CMMB 1OZAA 4UM7A 4NTZA 4AMZA 4E4TA 2QQEA 1HOTA 3DBIA 2DKFA 4LOAA 1ZUNA 2H00A 1R4MI 4DQLA 1EBBA 2KT7A 2FRVA 1N5WA 2R8BA 4D44A 2IU0A 2Y5CA 1KI1A 2VKQA 3CZRA 1F5NA 3EMVA 3FNBA 5IZ4A 1RM3A 4N5IX 2G67A 4MTCA 4L22A 1NRXA 4JUDX 2GZ2A 2DAPA 2Z8YA 4DG5A 3IS3A 2P5SA 4WXRA 3TJZA 3HBJA 2RE8A 2XY4A 3CS3A 2PT9A 2BKRB 1SD1A 4NCHA 4V3CA 4ZAWA 1W4LA 1YBMA 3KB1A 1UFOA 5A5EA 3W5VA 3GLGB 2BFEB 2O8EA 2VP3A 3Q8CA 4LDNA 3X1WA 2XSZD 1U80A 2CNNA 3UFXA 2LVBA 3QWAA 3ETRA 2QN6A 1KRWA 2D3AA 1WUHS 3MT9A 3D64A 2FZGA 4ALNA 4OP1A 2B69A 3O8DA 3L07A 3OICA 4D57A 3W9UA 1PR9A 4FFRA 1MJGM 2ICIA 1EM8B 3DDUA 2IP4A 2E87A 3TD9A 4QQRA 1GADO 2FWJA 2GEKA 1T6YA 3L0IB 1FZTA 2GF2A 5DHFA 4I9GA 3R9WA 2OESA 3RCBA 1Q6YA 1QB7A 2H06A 3W5SA 4ZHQB 1S9DA 2ZSIA 2WYVA 1PZHA 4RMIA 2WRZA 3R9IA 3RSZA 1UBEA 4DV5B 4CM9A 1Z6ZA 1PEYA 3PUYA 2ZW9A 5J3JA 2I3DA 4LVUA 2VXBA 3AVQA 1X7XB 3S27A 2D1TA 1Z25A 4FYYA 2DSNA 2HSJA 3L49A 1KPIA 4M9RA 4B6OA 3UKOA 4MVJE 1KJNA 1PV1A 3ZCXA 1OY1A 3ZQ6A 1E4OA 3C48A 2Y77A 4IDHA 3WB2A 2DBYA 3G7NA 2OSBA 3JQ8A 1RIIA 4O3MA 4G0VA 1EB9A 4MYDA 1ACMA 1ZIXA 5DMXA 4IH4A 3SKXA 2O5RA 1PG0A 4AP9A 5J4LA 3LHFA 3PYXA 4TSSA 4MKHA 2EEZA 1EWKA 3FRIA 4B80A 2J3HA 3I2JA 3UI3A 2KWCA 5GJVC 3ILSA 1O6ZA 5KKAA 1OGYA 1WF3A 2UUBB 4ZPXA 4AS2A 1JDZA 3PLUA 1X80B 5CXSA 5DHUA 4UARA 1HR0B 1I3OA 5ERGB 3U2QA 2P27A 3AEUB 4P31A 4MDEA 3ZDTA 2L52A 3ETNA 1QLJA 2XMQA 5C1PA 2BEWA 1C9KA 4A5OA 1JG6A 1QDLB 3OE7D 4O4JA 4PYQA 4LNIA 2R8XA 4XDYA 1J49A 5B58T 1QOPB 2KTFA 3MPUA 1EINA 1VLJA 3HR8A 3PXUA 4JLKA 1VKHA 1I7NA 1WGHA 4TV3A 4QXAA 2QN7A 3AU9A 4QGFA 3DZFA 4KX3A 3NHYA 3A9SA 1A04A 2P65A 3BL5A 1I35A 3R5TA 1H1TA 2NU7A 1PZNA 3G2LA 2WJ4A 1B0UA 2CJWA 5EJ4A 4I1SA 1AD2A 4BCDA 1FXWA 3P0IA 1QOGA 1T9ZA 2GTPA 5IP5A 4DPLA 3LX6A 3Q3NC 3BJZA 3L6RA 1NU8A 3GBSA 2YHIB 4IZIA 1DEKA 3X0DA 3N70A 2R11A 3P9SA 4KRGA 7REQA 4P35A 1PT5A 3ZCTA 5HYVA 1LC0A 1BH6A 1A7JA 3GEBA 2PX2A 5DGIA 5LVAA 1OTXA 4NJEB 1S1CA 1FUIA 5KWIA 3ZDYB 1E3WA 3GEDA 3TM5A 5F64A 1HFEL 3OTQA 4WKOA 1G4HA 1PVOA 1IUKA 3IT2A 4MVJH 4BO8A 2HMYB 3DTVB 2QSYA 3MWEA 3U0BA 1VTKA 4I99A 1TA9A 4YCBA 4RZ2A 4TV8F 5C1BA 5AJTA 4NNJB 3WK6A 3AF4A 3IDOA 3FAZA 3BKXA 3OJCA 4RXMA 3G9ZA 3RC3A 4JI0B 1UZUA 4CCYB 2VYNA 2OCDA 3TR5A 3PT2B 5KYVA 2O3UA 5KU7A 2VYCA 1JSZA 3KH0A 1AQUA 4H59A 4O2RA 5EKTA 2XT0A 4TKVA 5GTDA 1YRLA 1C1DA 2AOTA 2ONJA 1S2DA 3DZHA 1A2KC 4KP7A 2JRIB 4XYGA 4B6FA 4UDUC 3AUUA 3DOJA 3OLMD 4NSNA 1XNQB 1NONA 3EA0A 1SXGA 5LJIA 3PCTA 5IWCA 3PS6A 2AUNA 1SIUA 3KWFA 4GDFA 4V0LA 3ZRCA 5DVZA 4TV9B 2VAVA 5JTTA 3U61B 4XPIA 1QVWA 4JSYA 1G8SA 4RVFA 4H7KA 3UMMA 4WGFA 1ISJA 3H86A 1E2JA 4LXQA 5AWFC 4PYIA 3TTUA 3RAPR 1UGMA 3GQBB 2AWTA 1QVAA 1W7AA 1I4PA 1T1GA 1C7QA 2XNSA 1GA4A 4LY9A 4MQUA 1YMVA 2Q5OA 2W7TA 1JR6A 2OFPA 2RBEA 3FGOA 1ECPA 4ZVTA 4EA7A 4U9HS 2C7NB 4JLDA 2HF2A 2EGGA 4LYFA 3RTAA 2X7HA 4MTLA 4ENWA 1KGDA 1RYJA 4HFRA 3KE8A 3MT8A 3PGA1 2IV2X 3K4PA 3E9DA 4TN5A 2EU8A 2Z0MA 2HYIC 4I08A 1S89A 1K06A 1VHTA 5AW8A 3AG6A 2BKVA 1FXTB 1TYCA 2PVSA 1CQPA 2A94A 1CJSA 1SXTA 4UTRA 2XBMA 4IUMB 5AVSA 3GWGA 3E9QA 4ZK6A 2UUAB 5ARCA 4D1YA 2Q46A 2I4OA 3H9CA 4R41A 3W06A 4XUDA 4M76B 1JTVA 3FTDA 4M8IA 3HPRA 1WVMA 3CXRA 3VH3B 3WWDA 1KJJA 3DUWA 4ASUA 4FINA 3PLRA 1KXJA 3WZLA 2VNKA 4FYVA 4A0RA 1SBHA 2ZSUA 2D62A 3I2HA 2B1JA 1KVRA 2PNFA 4YAKA 1Y3CE 1DO8A 1Y7LA 1JFTA 5DPWA 3BGVA 4GAEA 2AXEA 4TM7A 2IYTA 4OJTA 2IE8A 2QSUA 3R6WA 3W77A 4GZLA 4IV8A 4OUKX 1TM3E 4ZK2A 4ZAYA 2AOXA 2QD3A 2DG2A 3F3SA 4HWOA 3GIWA 3HMKA 4UZSA 2QLJA 3FNQA 3W6NA 1JYEA 4OK3A 4QJ3A 1ZMOA 1JAHA 2UVPA 3OFKA 1CCWA 2VH2A 3I2GA 1X0XA 1TS5A 3QHQA 2PR2A 1G7SA 2PZJA 2Y4OA 1Y1TA 4BC0A 3R1IA 3Q5GA 3CO5A 2D3GA 4W9DA 1XFAA 3H2KA 4Z9FA 4MM3B 2MP2B 3K0SA 1KSJA 4RJTA 2B5OA 5J4HA 2WU3A 1EK2A 5DYWA 2JAHA 1MB3A 3PNSA 1V5WA 1TT7A 3HRKA 5LP6B 3WDMA 2O1XA 2CL0X 2GPYA 2P9YA 2F3PA 4LHYA 4WX2B 2W2VA 1FFSA 1YQQA 5CHWA 3VH4B 1U5BB 3ROEA 2PBRA 5JH7F 4BO6A 3BT7A 4QECA 2NTTA 1G5TA 3K9GA 2HA5A 5JS1A 2HQOA 1NWHA 5GMVA 1L5PA 5FWXB 2EATA 1HLGA 3WL4A 1E7VA 1OZHA 1QG6A 3NZ3A 5AK5A 3TEZA 1XZKA 3BFXA 1A8SA 4DJJA 3NEAA 1VGVA 4P32A 5E7JA 3TQFA 2VZEA 4EL0A 4D3YA 2JQRB 1T13A 3HN7A 4M0PA 4EI7A 1I0IA 4XVHA 1YRAA 2VQDA 4MRAA 2PV7A 1ZM9A 3ZCVA 2VTDA 4QRIA 4RCVA 3WL7A 3RS0A 4E5DA 4MVWA 3CY6A 4FD3A 1H0SA 1QKJA 1WZCA 2N46A 5I7VA 2BHLA 3IA2A 2OGUA 1VBNA 1T5HX 3KUXA 5DX1A 4FHZA 5TS2A 5EZYF 1P0IA 3JD1A 1G8JA 4QGSA 4TYQA 2J48A 1FLVA 1NDDA 3KUCA 1P31A 4IL5A 4Y30A 3ESYA 2EBHX 3NO4A 1C4WA 4FQ7A 4F3CA 4ZZ3A 4RV5A 2PPHA 4RJJA 5ICFA 2G9ZA 5GONA 2GA9A 4DFDA 3GUVA 2OGZA 5CT6A 3SBOA 3ZHRA 1UPUA 1I2BA 1R6AA 3FAKA 1KNQA 1JDTA 2HY7A 2ZJ1A 1U5CA 5CB8A 2QP9X 1TKYA 2WMNB 2XWQA 3I0ZA 2GK7A 4QGHA 2NADA 3HCRA 3JQQA 2GN6A 4DB4A 4HZUB 5HXAA 4RHTA 4D2KA 4L85A 3MTQA 2E4UA 1O08A 4NAHA 4Y2SA 1SKAA 1YB4A 2H4WA 5JRJA 2OM6A 3E3MA 4GM0A 4QODA 4LJKA 4MUYA 3TWOA 4TMFA 4Y2TA 2QYHA 2V74B 3C8HA 3O2QB 2FCQA 5LCXA 5SICE 4ER0A 3O84A 3WISA 4M1TA 3PLNA 2CDNA 1DHRA 2XVXA 2IS2A 3VVWB 3DL4A 4N82A 2BBCA 1G64A 2NR2A 4HJXA 1Y5IA 1A9XB 3QMWA 1UINA 3WYCA 5LBTA 4DTCA 4KAJA 4P98A 1USIA 3RJ5A 4ZJYA 3G1WA 3S2ZA 3T5PA 2I2FA 2IQIA 5ETJA 1C1HA 1KAMA 3L0PA 3K9LA 1JA9A 2IXGA 3CF6E 1O0BA 5FWNA 1L9KA 3EEBA 4B4WA 2DTEA 4CQMD 5AQEA 4OXNA 5AVJA 1N9KA 4H1WA 2Y5PA 5SYMA 4B82A 3IXQA 2OTCA 1KJYA 3EOAI 1L5GB 3EQ8A 1N6PA 3P27A 5TGTA 4YAUA 1YQDA 2YS6A 5HFNA 3L7LA 4ETNA 2QRQA 4S0ZA 4LZPA 1FFAA 3M9WA 1S2IA 4IRMA 2HD4A 4XM1A 4MIOA 1SVNA 3PQ6A 3FKYA 3NU1A 4BZQA 2VSFA 3E3OA 4W99A 1DCMA 3WL5A 2YQZA 1JFSA 3AF1A 3SY8A 1YN5A 1CY6A 4YWJA 1PR0A 1WMHB 2IYUA 1CS0B 4G0PA 4UTOA 1E77A 4EM6A 3CLTD 3FYUA 2YW2A 5J23A 3W6UA 5IKPA 2YFQA 2IOFA 2J0JA 2V7PA 1I2CA 4BCCA 3LTNC 3TL3A 1FNSA 4E08A 1H2WA 5F9HA 2H51A 4BQPA 1MW8X 3GW8A 4DSTA 5MN4A 2ZRAA 1QYXA 1N57A 2JIBA 1LI7A 3LDAA 2QUAA 4OM8A 3K53A 1XMXA 2RHJA 3TKAA 3VTUA 4XX5A 2PCJA 5E2AA 3SWWA 2LEKA 3U8ZA 4FB5A 4Z7OB 3ZBQA 1TCCA 1ZP6A 4WCFC 1E3MA 5LZ8A 1U65A 5LBIA 4JX1C 3F7MA 3F46A 2ZWVA 4X92A 4OL0A 1U2GC 2PMBA 3MGKA 3GUUA 5GP1A 2VTKA 4DCPA 2P9GA 1JW9D 4FCCA 1UOQA 1YKSA 2VBGA 1N6KA 1VRCA 4MWEA 2FQQA 4BX2A 1NKTA 1OQAA 4BNHA 2P2CA 1VG8A 3EVEA 1VSUA 5CHVC 4G11A 4EOGA 4ZHSA 2QMHA 3NVKI 3FF1A 5B12A 2REBA 1C9YA 5KTMA 2WNHA 4QUEA 2BGLA 3SR3A 2REXB 3ACBA 1ODJA 3RABA 4K9QA 1L8OA 3UK1A 1IC6A 4IDQA 4F2WA 3DD1A 3NRZA 3ZQ4A 3MC8A 1LY1A 2RCNA 4Z99A 2V4IB 3AIMA 3TMYA 1R1DA 3I1IA 1MABB 2R60A 1RLJA 2B2XA 5E2IA 4FILA 3SC2A 1KTIA 2FZLA 5C34B 2X3YA 3PA6A 1ULSA 3TG2A 1BXGB 1UP6A 2GK6A 2O7VA 3IE1A 2QR2A 3Q0EA 1SBTA 3N8HA 5FORA 5K8UA 3VX3A 3MB5A 1HO3A 2CKMA 3MMSA 1A8PA 1XZCA 1TTPB 2ZVPX 3MWDB 2JL1A 2RARA 3APCA 5P8WA 5HBGA 4FX5A 3IR5A 2AQKA 2NSLA 4D9FA 5LXHA 3ALBA 1EUQA 3CG4A 1F0PA 2JIZD 1RKXA 2HWYA 3PX7A 1RJGA 3GC6A 3PJDA 4OFZA 3I5YA 2FEKA 1W25A 2B8NA 4BE9A 4RA6A 4D41A 3F8SA 5J2TB 4BVEA 3USZA 4CLOA 1TIPA 2AFHB 3C6QA 3OG9A 4JUBA 1GL9B 3AI1A 5T7BA 3DOEA 4CKWA 1O6CA 1XUOA 1LLDA 3AV8A 1FS6A 2RBKA 4CU2A 4G5QA 1IIRA 1ONOA 2NTYC 2L05A 1OWOA 1BCSB 4P4LA 2G28A 4RMNA 3HCEA 2C60A 4ARSA 3F7OA 3SHFA 3W3AA 2NO4A 3BSYA 1GCUA 4PTZA 3F6EX 2G4LA 2Q4RA 2EMTA 5IU6A 3KR0A 2JEOA 3K92A 3IKTA 3T3HA 1WHSB 4K8RB 3VM6A 1N5IA 4L15A 4TLEA 1ZKDA 2C2YA 3DV0A 4J7AA 5D3DA 4K05A 2J42A 4B9KA 3NWJA 1AKVA 5BOSA 1KKLA 1VIVA 3BXXA 1S2GA 3BZUA 1V26A 1NLFA 1RKQA 1WRBA 4DWVA 4N3GA 3V8RA 3N58A 1F1BA 4RPGA 4AQYB 4MCHA 1T0SC 3A36A 4NENB 4S3MA 4KH1A 2I91A 2C8JA 4OI1A 1GNLA 2XVZA 5ALMA 4XYMA 1BHQ1 6PFKA 3KELA 3MQ4A 4Y2VA 2NVBA 3MJHA 1OH8A 1R6UA 1C7JA 1U8TA 2GFHA 5F7ZA 4DWFA 2CNKA 1YDWA 4EQZA 5K9ZA 4Q34A 2ZRBA 2N9LA 3IQFA 3PNOA 1EFVA 1FF9A 1CUCA 3RIMA 2C4TA 4F8YA 4YJ2F 3H1PA 4AG6A 2RGYA 1KIFA 4AQ7A 5CYPA 2HJRA 5KHAA 5KU1A 4LRTB 2FHSA 3CNNA 1CNFA 3L0ZA 2PUEA 2PL9A 3JASB 4C0WA 3F8TA 2W2KB 1M6HA 1AG9A 3N1ZC 3N53A 2FPUA 2YCLA 1E79A 1LPNA 2YTZA 5JDIC 1V8ZA 2CHWA 3JXEA 5EQJB 4FW9A 1NXXA 2RKWA 4R7ZA 4DXHA 1CUAA 3EVCA 1V7QA 1XTZA 2DERA 4HNQA 4Q4HA 3CUTA 3B2NA 2HJSA 3LB8C 2FJPA 4GGQA 3RV3A 4Y2GA 3JQGB 1EMDA 2FR8C 2JZ3B 1AKTA 1EFPB 4LOJA 1E5WA 2DECA 3EEIA 5I7OA 3ZY2A 4BMXA 3W8NA 4YAGA 3U6BA 5D1HA 1VI6A 3L10B 1KJ9A 1SXJB 3K6RA 4XM2A 2GXQA 4D80A 4NBKA 4GBED 1SCNE 3HN2A 2BUCA 2VDKB 2DFKB 2O14A 3VR8B 2WQYB 3PNVA 4NPNA 3PKJA 3TQCA 3SC4A 1ZIYA 2WSSA 3GVHA 1UFRA 4BGDA 1XVIA 4GPAA 4IVRA 3GT4A 4ZOAA 1FBTA 1CT9A 2IF2A 1W4BA 5FUQA 2ZM6B 1M8KA 4AF6A 1J9EA 2FR1A 4D6PA 1RZ3A 1EJ6A 1K3UB 2RHTA 2KX3A 1BX0A 2N1WA 3N2IA 4AWJA 1GKLA 1Q1NA 1K2VN 2DFVA 1PS9A 2I4RA 1O03A 3T1NA 1K8RB 1NJ8A 2BRUC 4KRFA 3ZXSA 3N0XA 4DXFA 4MUAA 4CO7A 2QGFA 3VOAA 3BWBA 3NHEB 1NBHA 3H7PB 4H1VA 2N1BA 2AZ4A 5HK9A 1TKRA 1RHQA 5LN1A 1FFXB 4YJGA 5L40A 3AUTA 3UWKA 3CNQS 2QLBA 5DN9A 1W36B 1B26A 3OU7A 5E6RB 5GV8A 1WCIB 2IYAA 3ED5A 3TZBA 5JYEA 1E4VA 1DQRA 3RYHA 1O0CA 4E32A 4UBJA 2R7AA 3ASVA 1EDBA 4JASB 2ZTMA 3AR4A 3SYNA 4BKOA 4MWBA 4DE5A 4IDNA 1AXGA 4JOSA 4JWSC 5AHOA 3H5LA 1ZGAA 2R8OA 4CV2A 4MP8A 1LEHA 3L4SO 3JRWA 1QHFA 1WXXA 3VR2D 3L0SA 2G9RA 2IXDA 4WWOA 4IWQA 4M0WB 3UMJA 3KYCA 2QE7A 5DI9A 2RGRA 4QTZA 4PS7A 1EX9A 1P1CA 1N32B 4P7IA 1PJLA 4J7UA 3JWHA 3PFBA 1WMAA 3DF7A 1ECFA 5I45A 1G9TA 1D5XC 3I2FA 1OQRA 3AVUA 5U9CA 2WXFA 2PRKA 4BY9E 2ZXEA 1SUEA 1YI1A 5JG7A 4N5LA 5EIAA 3M83A 3R7RA 4HKTA 1XZDA 2BWJA 1M83A 4HNAA 5KDOA 3E4CA 1DQPA 3L8EA 1KVQA 4DWOA 1JQAA 1KETA 5IHXA 2LIPA 3SLRA 4JUCA 4DLVA 5GIPE 1QNLA 1M1NB 2YWEA 1XXHB 2R4QA 3TDNA 4YRJA 2P41A 5KYYB 2C58A 5B36A 2IPAB 4OKSA 1KYXA 4ITKA 2CE7A 4DT1B 2BEVB 4FJ2A 2FPGB 3I32A 3AUJB 3IVGA 2Q7OE 4TMAB 2ZI4A 2WWRA 4Y2HA 3MBKA 1N36B 2FZEA 5JHGB 3E3LA 3CH4B 3R4VA 4HB2A 2AL3A 4UE6A 4HNGA 1LFDB 4LSGA 1UT6A 3N2KB 2VJLA 2ZT7A 3N5CA 3Q98A 4HDSB 1IZ9A 4DLBA 4GLLA 3DQQA 5EIEA 1UAYA 1DT5A 2B1QA 1RWKA 1OAOC 4Q1VA 1XJWA 3DOCA 3IQWA 3GFTA 1PSZA 4C7BA 3L1HA 1Y1PA 4ZQIA 3GL9A 5EMNA 1CXZA 2FTKE 1FP6A 4EX6A 4GRDA 4HAOA 3O1LA 3HU3A 1VKOA 2QTVB 4JB3A 1NE7A 4QEKA 4I6GA 2PS1A 3IKLA 1R8JA 3FYHA 3HEMA 5SZIA 2ZDGA 3ER8A 2QM0A 1NR1A 3WRXC 2LGDA 2J67A 3HXOA 3SSAA 3WJ2A 3ICCA 2HHLA 3SBXA 5HX7A 5I7HA 3E5HA 1J0DA 3MWJA 5J4VA 4WLFA 2C9WB 4M99A 2HTME 2BT6A 3AB8A 1HNWB 1TLLA 1VCNA 5DN6D 5TT1A 4V24A 3TZLA 4D43A 1TC2A 1EUDA 1YFZA 4WKNA 4J0FA 1TCUA 4INJA 2O59A 1KMHA 2WTUA 3TNFA 2XGJA 3RO7A 2QUHA 3GRFA 3PP8A 4WEOA 1JMLA 1XD2A 1LSUA 2RAFA 1U7WA 4I5DA 1W49A 5BSMA 2O05A 4PRZA 4TV9F 4EYSA 1B9RA 1OLSB 1J1UA 2RGNC 2NUTA 4XWOA 4FX2A 2QB5A 4EFLA 4L8WB 3DT8A 3ZUNA 1YRQA 5AW5A 2C5FA 2PGOA 3HGQA 2ZIUB 4EMSA 2B7BA 1T29A 1THZA 4BNDA 1L5YA 5CM8B 1G5IA 3FFXA 1G21A 5IK2A 2R5FA 4CQNA 5EQDA 4DR5B 4JROA 4ZYUA 1YBVA 4PPGA 4JFRA 3HG7A 3FLEA 3AFHA 4DA6A 2AJLI 2Q4BA 3GFFA 3WGYA 4M1QA 2G07A 4AUNA 2DLBA 1UXIA 4EKUA 2BYFA 3STTA 5CB4B 1JWBD 3ADPA 1F38A 1LDYA 2WLBA 3FH0A 3KVFB 1DBSA 4GB9A 4CM8A 3OPYB 4B0EA 1EQAA 3D6VA 5TPWB 2DSTA 4KAXA 3PUWA 4KLNA 3NRJA 4MMXB 1YDMA 2PZ8A 4JI6B 2M1MA 2GJ8A 4FVTA 4XB1A 1JIIA 2B92A 2R97A 3F3KA 5HNKA 1U1GA 3P4SB 4B79A 4EY4A 4BKSA 2PEYA 4RIGA 1L4BA 4XYLA 1NVEA 5FH9A 3FLAA 4CKBB 1XROA 3LUBA 3ZE2B 3RVOA 3U39A 1R27A 1KOJA 2J3DA 4RAQA 1ZJYA 5B5SA 2C1ZA 3W7BA 4RHUA 2WWTA 2J3MA 1SCDA 3EPRA 2QPAA 3DW3X 3NYIA 4YRBA 3AUKA 1AF4A 2BR3A 1ZINA 3O2NA 2VUSA 1QTQA 3IDFA 1PDWA 1PK7A 1RDFA 3ONWA 4G37A 2BW2A 4XM0A 3OJXA 1VPVA 3IT3A 4I3FA 5E9AA 5DWVA 2HDOA 3X2SA 3N2LA 1WHTA 3DCIA 5JD6A 2JG3A 2L17A 4DSUA 1I01A 4HSGA 5I9NA 4HEA6 2QG9A 4C0HA 3O8BA 5F1OA 3RBXA 1M2VA 3BD6A 1JLHA 1YIDA 1J8QA 3T1VA 2XDQA 3OT1A 1P4SA 2Q6OA 2FWBA 1ODTC 4A10A 1DO2A 1Z35A 4FNGA 2QX9A 2A3NA 4YACA 5T64A 4C2AA 1CQZA 1MXHA 1CQIB 5LOVA 3PJGA 4HN2A 1T0UA 3NH9A 4OXQA 4BHTA 1Z74A 4KDFA 2Q2QA 1RWVA 4ZAZA 3MSCA 3RUDA 1M94A 3QFSA 2BKXA 2NVUA 1PTJC 2BL4A 2XOXA 4FE7A 4DMGA 4CUJA 2K2QB 4NMWA 1KFCB 2XLCA 1PI3A 4B8ZA 1HZJA 1CX9B 4LXXA 1ZD4A 2X4LA 1AMNA 1IQUA 2VLIA 3LVBA 4D8WA 5KYXA 5LP6F 1Z4JA 4IJUA 5H68A 4OF4A 4ZVMA 2H1FA 1VCMA 4II2A 2P9TA 1E0DA 4UPVA 1JHYA 2HGSA 2HJ9A 2MYTA 5DYGA 3WGTA 1OROA 1LZLA 4PAQA 2ERCA 4V1CA 1GNPA 4GEKA 3MS4A 2VDPB 2F3SA 2G80A 1MNAA 1Z5PA 3EFUA 4UD6A 4KE7A 3BD8A 2W2XA 4I4LA 1QT9A 1JJAA 1EU4A 3CX6A 4JU8A 1Q20A 1Z7YA 1JE0A 4L57A 2UYYA 5JD3A 6ABPA 4QOEA 3DT6A 4RW0A 5BNZA 1XLOA 4OXIA 2FA9A 1GLVA 3IAHA 3KM0A 1AS2A 5F78A 4CCAA 1JKFA 1RBYA 3A1TA 3DUFA 2TMKA 4K3CA 1E9VA 1L4YA 3CE9A 1YZVA 2Y0BA 4XFKA 3STYA 2OHXA 3MP9A 2Z56A 4US1R 1HT3A 5IMSA 3A9JA 2D8AA 2WNMA 2PMKA 4KXXA 1P5FA 2P6RA 3QFTA 3NS7A 4LYEA 2I3BA 1NVWQ 3ZLBA 1FX1A 3HR4A 4C6SA 1TZJA 3B7GA 3PGEA 4MGIR 4EG0A 3J81A 3QVGA 5CCEA 1FTQA 2FFQA 3W5UB 1R0CA 3KP1A 4Q1DA 2XITA 1DAMA 3IEXA 2J53A 3LUPA 3OLZA 5CX3A 5EKUA 4MQFB 2I6FA 4U5QA 4KGTA 2GI4A 4X6UA 5ECWA 4AO6A 3I58A 4O08A 2ZVNA 4ID3A 1OJLA 3U4CA 3CEJA 1ISPA 2EX0A 4G5SA 3KYDD 1THMA 3M4XA 1NMEA 2C2WA 2TYSB 4K2HA 5HS6A 3EWNA 3KSBC 2AMFA 3S1LA 3A31A 5AXCA 2MCNB 1L3CA 2F7SA 4NWIA 1L8AA 4DBGA 3TR6A 2C0CA 1F20A 3PVCA 4OU4A 4EABA 3QNMA 3DE1X 1CHDA 2G08A 1F2VA 4AJYB 2PSSA 3WYNA 4I55A 3DAOA 2XOKA 4QX6A 4YK7A 4HYTA 2OCLA 1ZM2A 3R6GA 3GRRA 2L82A 5IDXA 1BH2A 1HOXA 1RVDA 3ZWPA 4TQGA 4Q01A 3OBBA 3QOWA 5H70A 1Z83A 3R8XA 1CZHA 5E1DA 4QBGB 3VH2A 3BQMB 4DZTA 2J85A 3ZK9A 3JAWA 2WJ6A 4QARA 5BR7A 3LT1A 1XU4A 2QNBA 3Q41A 2FH5B 4UBNA 3B36A 3QELA 4J03A 3TQSA 2DC1A 3KR1A 1TIKA 1J20A 1EWVA 4YHHB 3TW0A 1NW4A 2AQIA 2ZYDA 5CT5A 4O4LA 1R00A 3R9XB 2NV2B 1G6JA 1W4ZA 4G09A 2X14A 4BO7A 2HRQA 4CLDA 4U8HA 5GADl 3OQ6A 2OD2A 1J8MF 1G8YA 1E6KA 1SC4A 1MQSA 4WK0B 4OJYA 2X42A 4U7TB 3WDKA 3Q2KA 1QMPA 1PT8A 3U13A 1JGTA 4DRXA 3DMPA 4MWCA 4LDPA 2PX3A 1P29A 2KQ7A 2IHKA 4GSLA 1QRSA 4XI9A 5LKRA 4YJ3B 2XB9A 1WXAA 3FPBA 4WKBA 1E3JA 1OFGA 1V41E 1WXDA 3QPUA 3SC3A 5JXHA 3O7WA 1QQ5A 1CBUA 4IYJA 2IUFA 4D6YA 2FG5A 2JGDA 3RK0A 1PJTA 1TZMA 3QXXA 3BSFA 1O96A 3NTRA 2NO1A 4JZYA 3PPXA 3VPSA 3E7FA 3O5AA 1JKIA 4PQFA 2NGRA 1JECA 1JI0A 1WTCA 2DE0X 3Q2AC 3W9SA 3H13A 1PG2A 1IJEA 4O25A 4JFAA 3ACDA 3CSDA 1P0PA 1CJVC 4XGNA 3KJHA 3NT4A 1K5GA 2GKSA 3KL2A 4KDLB 4O4IB 2FW9A 2FHPA 1UQRA 1WCWA 4I3HA 4FEGA 2FMHA 5KWSA 1IEWA 1Z2CA 3WJ1A 1Z36A 1HE2A 5JASA 3NGMA 1ZXXA 3GMIA 5T8IA 4NV1A 2FI1A 4BLWA 2OP0A 4KI0A 4KUGA 4NFHA 1A3CA 1MAHA 4DDMA 1L4EA 3DB1A 3BVPA 4C0QC 2K8HA 3D7SA 4JBNA 3P0JA 4WFKA 2NU9B 1PJ8A 2E48A 1SU8A 3ANTA 4LISA 4Q3AA 1MT3A 5JMPA 2SKEA 2WF6A 3EDRA 3AFGA 2CFSA 3OLCX 3LPAA 5HKAA 2PQ0A 3L6BA 2C31A 2H31A 4L8GA 1D5MC 3V55A 5BUCA 5FTJA 4PZ9A 1IHUA 1XKQA 1GNVA 4KXLA 2N42A 1TUGA 3T9FA 4HPWA 4RANA 3Q15C 3JARB 1QHSA 3HKBB 1TRKA 4QBKA 4JJIA 1JWMD 3LP5A 1H2ZA 2D7DA 3FFTA 3D6FA 3X3HA 4K9SA 1S5PA 3E56A 2GPSA 4Y2QA 3UOAB 3FZYA 4ZXFA 4EKNB 4MVJI 2L18A 1SWVA 2GO1A 5LZ7A 3CXUA 3KO8A 3U40A 5ESXA 3T7AA 1GYPA 3RSSA 4FT2A 5DX0A 3UFBA 2VHTA 2VHXA 2AR9A 4LQLA 5LPNA 1P5HA 1PYWD 4DJAA 2BCEA 1AQJA 1NW9B 4W9HA 2P3QA 2Z5FA 5DWQA 3VISA 3LJKA 5DYIA 3GJ5A 3WIVA 2VJPA 3BTOA 1M5TA 5ARDA 3CX8A 3ORFA 2O5VA 2FG6C 4NJ6A 4L72A 1IP9A 1DDOA 3WADA 1OXMA 3QVTA 2OHOA 3R40A 4BZXA 4ZOEA 1Y1SA 4AY3A 1EVIA 4NZ9A 5J2TF 3HDJA 5HOEA 2OCAA 3KQ4A 2XUZA 3U7QB 4NCJA 3ZCPA 3LW8A 5ALSA 2FN8A 2ASEA 3OI7A 1FRNA 4TOIA 1K0UA 2ZCBA 1T2CA 2BV3A 2C2BA 4M0FA 2D07B 1XZNA 2VWGA 3TNYA 1ESEA 3IVFA 2ODWA 2IDKA 1V3VA 2H3HA 4C2TA 1ST3A 3EARA 5GPBA 3H04A 2J3JA 2Q3EA 1Y1KE 1Z8DA 2J41A 2IBSA 5FLXA 4UHBA 1BO6A 4DWWA 5JCJA 1GGMA 2DB3A 3VJMA 1WF9A 2W58A 3ZTWA 5BVGB 2Q9BA 3WNVA 1GUYA 4P3KA 3USCS 3PYLA 3ROTA 3UG7A 4IEIA 4J0EA 3GLIA 4N7JA 4X91A 3ONDA 1EXVA 4Y1RA 1FM0D 4AS1A 1A8HA 1X1SA 2HA0A 2NSYA 1KP3A 3G5UA 4BLPA 4A0FA 4QU0A 5BMHA 1FFBA 3THYA 4MITA 3QEJA 4US0R 4R2WA 1YX5B 4DA8A 3CF0A 2ZI6A 1HXYD 4A2CA 3IOYA 3CLTC 1HEUA 3KFVA 5H5JA 3VFKA 1MT0A 2OV6A 3NKLA 5AHRA 3GP7A 1FVHA 2GEVA 2ZCVA 1P9LA 1YC5A 5EZQA 4PSAA 1F6BA 5AM2A 1R8SA 3MCZA 3A3KA 2E5WA 4OVUA 4OB6A 3GARA 1JI3A 1Q57A 1SZCA 2PA3A 1FLDA 3I9V6 1Q0LA 1DHTA 3CW8X 3OLYA 1ODKA 3WQRA 2J30A 1E2LA 1JJ7A 3D9QX 4MEJA 2O0LA 4GX5A 1Z0DA 3N3AC 1I4LD 4CTKA 3M4YA 1DNPA 1W93A 4KGRA 1UD7A 1E3TA 5AVTA 2H5EA 4A8XC 2O57A 2VBFA 3DA8A 3EZ7A 4NU0A 4W9JA 4D4JA 1J8VA 2RH8A 1VLBA 1ADJA 1J2EA 5JCOA 4LRUA 1M34B 2BGJA 2P9QA 3WWZA 5KOYA 1ZIOA 5HK8A 1K7XB 5DH9A 1BQEA 1YZNA 2Q0XA 3RAFC 2JFUA 3KWLA 1UJ6A 3OHPA 3DT9A 4I7EA 1DRUA 3CYFA 3FDIA 1ONBA 8OHMA 1ROEA 1P98A 1G20B 4O4HA 1MCZA 2KXJA 1H3NA 3M5CA 3JD4A 5T4EA 3DVLA 2AQ8A 2WC1A 4IOLA 5FA6A 2HH9A 1MA3A 1G16A 3JQDA 4OMFG 2Y8EA 2BR4A 4II3A 1E6EB 5A3VA 4P3NA 1XR3A 3WOHA 3TNDA 3OLWA 4Z7NB 4IQGA 5CBPB 4MPJA 2EXXA 2OM2A 1PSDA 3F6BX 3QMPA 4GKVA 3CH7A 3HB0A 1FPQA 3MK31 1XVUA 1LRLA 4RLSA 1G7TA 4NJCA 4B3RB 4F72A 1JN0A 3K1ZA 2PS9A 2A4KA 4WN9B 1M6NA 1VYTA 2H17A 4DG8A 3H11A 2HMAA 2CDBA 3NBXX 2WAOA 1BHO1 4QDKA 1C7ZA 4M9CA 4P83A 1M72A 4KR9A 2DNFA 4JL6A 5EJ9A 4C6TA 1XEEA 3GRAA 5LYYA 5KI6A 3KB2A 3R3ZA 4USAA 3EGOA 2SEBD 2NZUG 5JBQA 5KOIA 1C7RA 1Z2PX 5JE8A 4DUPA 2VT3A 2ZEJA 3SN6A 1PFQA 1FTGA 1SC1A 4AY5A 2NVOA 1OHHA 4YMUA 1R9JA 1TPZA 4CQMB 4KREA 2YW9A 2YINC 4IJ6A 3L54A 1GDTA 3F3MA 4GQAA 2BMEA 2OCPA 1LZKA 3VR5D 5IYZB 1KI2A 1GRNA 2RHHA 5F5NA 2ZB7A 3PFKA 1TJEA 4GKBA 1JPNA 1GQQA 3WNZA 5EWMA 1KO1A 4FKMA 3UQYS 2B1GA 1W34A 4OHMA 2N4FA 3Q9UA 5TQVA 1YGPA 2HGZA 5AI8A 4DLNA 1GTMA 1Z8FA 3WMEA 4PYZA 5FHQA 2KWDA 2ENUA 3SBEA 2EV9A 1B6GA 1QYWA 2JBAB 1SMKA 3V8NA 1W5BA 2PUBA 1DC3A 3WALA 4R68A 4DLRA 2GLUA 5EWLB 3T4PA 1P73A 3CNEA 4R54A 3RARA 3L0DA 4EHBA 5IBQA 1ZP0B 2O8VA 1G0OA 5EP2A 4KHPB 3ORQA 2V98A 2X9VA 2ADFA 5KNCA 4KRXA 3MW8A 5CUQA 3WRVA 2IYZA 4DMKA 4K9OA 4TVBA 5CU7A 3NBQA 2JJ2D 1Q0RA 4IIDA 1GIAA 3B20A 2C98A 3U3OA 1Z6YA 3MF4A 5E6UB 3LA8A 2A5FA 3DHWC 1P1FA 3ORRA 2PK3A 4WL0A 3VKHA 1J2TA 4GU2A 2Q2VA 1E2GA 1N2CA 1CJKC 4FT4A 2XUGA 2UYZB 2D2IA 3W34A 4D8TA 1NR5A 1QCDA 1AGRA 1L3BA 4N59A 1VDMA 5H3HA 5TMDA 3DM9B 2QMTA 2LCQA 3OOWA 1JW9B 1YDFA 2EBUA 1N6ZA 3KJZA 4A3OA 4M9ZA 3T3OA 4IX1A 3M62B 1RQ2A 4OREX 4A92A 4U2KA 1ZLYA 1JR3A 1MB2A 1LWOA 4AMYA 4XVRA 5DCNA 4H7EA 1KYYA 3T8YA 2E6XA 4DQDA 2WHXA 4AZWA 2J6HA 1GAQA 4H4DA 1TRHA 4A8TA 2WU8A 3RT1A 4EYGA 4K5QA 1WLYA 3M5PA 1FPMA 3AE6B 2OCIA 2XIJA