2VH1A

Crystal structure of bacterial cell division protein ftsq from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSQ
total genus 50
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh1A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh1A02
2MHJA 4C00A 4K3BA 4BZAA 3EFCA 2V9HA 3OG5A 4QAYA 4XGAB 3NJTA 3MC9A 2QCZA 3Q6BA 3MC8A 2QDFA 4C4VA 4C4VB 4PK1A 2VH2A 2X8XX 2VH1A 4K3CA
chains in the Genus database with same CATH superfamily
2E5WA 2QE6A 4N5IX 1QUFA 4Q1BA 5GM2A 2Z57A 3L84A 4BO9A 3AETB 4GQAA 4MYTA 1BG6A 4CXMA 1J7JA 1LDEA 2K22A 3V97A 3HJRA 2PNFA 2YL2A 2Y1LA 3W5UA 5CB4F 5T3UA 2GRJA 1W8DA 1KFKB 4L57A 2OO5C 4KIFA 1L5ZA 1NF8A 2PBRA 3ZWWA 4CU5A 5IX8A 3MVEA 3U44A 3NANA 3VUYA 2V7EA 1QHHA 3KOXA 1OZGA 1NVID 1YCGA 3VMFA 2J3DA 2C7OA 5FFNA 2GPAA 3I2IA 3N53A 4QXAA 3NAGA 2Q45A 3RQIA 2GBLC 4G0XA 3SBOA 1W87A 1A95A 1B8PA 4WE3A 1V95A 1NNSA 2B3AA 3FCCA 4JQWC 4X66B 1F0NA 1QE3A 3CNHA 4LYFA 4N82A 4TM8A 3ABQB 1HQDA 3AVYA 1PUIA 1SE2A 3PQ3A 5J59A 2Y8EA 4F92B 1OWNA 1VL2A 2VS1A 4EPVA 3AB3A 2XKKA 4CEIA 4QASA 4TVSA 4R2IA 2IX9A 3K9BA 1NTOA 4MINA 2JEOA 3AC0A 1H22A 3KJNA 4MQBA 3UMVA 2W2OA 4ZAFA 3STTA 1DQPA 1E3MA 2F48A 2IO3B 3IV6A 4TLLB 2NW6A 4C03A 5C37A 4DV4B 3H3XA 4LCDE 2MSDB 2RAFA 2QT1A 5TPWA 4BEBA 1ZU4A 4XE5A 1WXHA 4TL8A 3KW5B 4M49A 1TUIA 2CFRA 4QXRA 3R9XA 1T3ZA 1XAGA 4WEQA 4NENA 4BX3A 5HOQA 3VR3A 4HRYA 1WBJB 3C7KA 3NWPA 4JFAA 1X7HA 1Z8NA 5CUQA 3TSCA 3CF4A 5TC4A 1XMQB 4X6XA 1ZI9A 1GL6A 1R6XA 4QPJC 5B36A 4HPPA 2OG2A 3RT7A 1P29A 5ALRA 1YZFA 1UBHS 4LMAA 2PMKA 4HDOA 3L7JA 4F91B 4HPMB 4LNFA 3THYA 1WZ3A 2Y3IA 3TOZA 4HRSA 4O25A 1XZPA 1ZXHA 1X19A 3F46A 3K72B 2LW7A 2NT4A 4J0IA 5IN4A 4CGZA 1TIKA 4UXHA 4WWMA 2ISCA 1E0JA 4OQMA 3L13A 3LI2A 4J6EA 2PX3A 4WERA 1N34B 1PNRA 4HNQA 1L7PA 1NATA 2L2QA 3WQQA 2HPHA 2B82A 1G2OA 5JNLA 4OHXA 1B00A 3L8CA 4QFDA 4KVAA 5D85A 1FNCA 3GUHA 1L7VC 2FHSA 3L43A 4PFKA 3FNFA 4A0FA 2CVPA 5DI3A 4Y2QA 4UTVA 2ZSDA 3O95A 3QZUA 3V6EB 2CHGA 1XDDA 3DC2A 2PZLA 2FAXA 7ADHA 3L7BA 4W1QA 3GE3C 3IT4B 5FADA 3A25A 3GCWA 1F51E 4GRDA 4NJOA 1IBLB 4TYYA 2R2QA 1KYXA 4DWFA 1H65A 2FVYA 3MA0A 2QWXA 3GEIA 1V7CA 3E5RA 3GDGA 4IGFA 4MUHA 4XWYA 3ESZA 1EX1A 1W73A 4HDMB 4JN6B 1NMYA 2HIGA 2QW8A 5THXA 1W4RA 4EH1A 1Z7WA 3AE6B 2KBFA 2ZRKA 4HDKB 3ZYYX 1OLXB 2CMHA 4IIXA 3VX4A 2LHEA 1CRQA 4GGMX 9GPBA 1O58A 2G9VA 1PKEA 5CX4A 1OGYA 4MWZA 3M5DA 3FRJA 1DMSA 3FGPA 1KAHA 1ZOPA 4NIMA 4EOGA 4F97A 5ENZA 4TYNA 3D64A 1H4SA 4PQYA 1RYFA 2FG7C 2ZS8A 3CF2A 4N39A 3BZUA 4UZSA 3GNLA 4QYXA 2GQ0A 2FX2A 1MRSA 3C3KA 3AHDA 4PZPA 5ALSA 4IF4A 1OBHA 4U8GA 1M10A 2DEUA 2ZT6A 2C2WA 1N5JA 2FCMA 1CUSA 2V74B 1XKLA 4JEMA 2J8ZA 1BVUA 4DC9A 4DG9A 2M1ZA 4A73A 3CEPB 3DAFA 4LC9A 5BW8A 4BKQA 5C8XA 1LO5D 1SC4A 3RZFA 1K7YA 1UJBA 4HNAB 4Z9BA 1DIOB 1LRKA 1W2HA 2ZIEA 3HXPA 1NQ5A 1UZAA 3LZDA 1AZSC 1QTIA 1BH2A 3PR1A 3IOYA 1P1JA 1MQAA 4ZOLB 3MGGA 1RBYA 5JC1A 5EJMA 4AZ0A 1Z56C 3LU1A 4AYWA 2HDWA 2IDZA 1L5RA 3UV3A 4AG6A 5JC8A 4LPSA 3GLIB 1AQLA 2P2SA 3IEPA 4OBBA 4RK1A 4LTUA 5IMBA 4D9GA 2O8CB 1NOIA 3A3YA 4BTVA 1PBTA 2BBOA 1A77A 3QNMA 1T1SA 2GF0A 1GFSA 3D3WA 1EUQA 1YHNA 3ZE1B 4O4LB 3APCA 1RMTA 3KD3A 4PLGA 2CUZA 2WD7B 2HNBA 3PFIA 4GMDA 2PRYA 4I4IA 2MBBB 2WU4A 4RCZA 1U63A 4GG1A 2A2ZA 4C0XA 2DWUA 4ZYWA 4I6JA 3BXFA 1PQWA 1TKGA 4FT2A 3UKJA 4Q19A 1M8KA 3TSSA 1B7GO 4MUAA 2OBMA 3H4MA 4RXUA 3MUOA 4L07A 3KU4A 3LH5A 4P3NA 2YXBA 4CVNA 3E9CA 3GJ8A 1TQ6A 5LIPA 1D0VA 1IMOA 2E4ZA 3U4MA 4NFSA 4EG6A 2PYZA 3HBAA 2BFPA 3O0DA 4RETA 1KH0A 1YACA 1NF3A 3CSDA 3RYTA 4GZLA 2WXGA 2OGSA 4BAGA 3TL2A 1IRIA 1FRQA 2NZUG 1HA5A 2QNIA 3DULA 2BF8B 2GN6A 4RNCA 2OM6A 1QKKA 3M34A 3NHPA 1R0CA 3LXFA 5P8WA 1Z29A 1KS9A 2DPGA 4IIUA 3T9DA 1FD6A 1MB9A 3JALA 3JYLA 3OAAA 4PGMA 3CVUA 2YMQA 3G0HA 1IEVA 2VT7A 3LVBA 4UM9B 3S8MA 2ZOSA 1K97A 4JKOA 3F6EX 1VLJA 1TZKA 3EA6A 4L4RA 2WABA 1XXHB 2VJMB 1GAJA 4O4HA 1TOAA 1TO6A 5AVJA 2FEWB 5EE3A 4YTMB 4K7JA 3EISA 4XYLA 1XCQL 4BTEA 3DVNV 3G68A 4XM2A 1FLAA 3L9WA 2BSAA 4M2LA 1N2IA 2V58A 4ZQIA 1T25A 3PGMA 4MV4A 3ADKA 3ID6C 5JRDS 2IHJA 1TZ2A 1WKVA 2WM2A 3GMIA 4HRVA 2XUZA 1NRIA 4HNUA 1WV0A 4BHTA 4FZRA 2OUKA 1UDWA 4NDZA 4CM5A 4ZU6X 2FRXA 3TTVA 1C76A 4PAGA 3LPDA 3DDNA 3M2TA 2F62A 1LBHA 2Z2IA 4P5PA 4TV8F 4UHEA 3T38A 3ZI4A 5EJ4A 2JGDB 3QX3A 2GHQA 3FE2A 4DE5A 3NOQA 3NT5A 2J52A 3ND7A 4KX6B 3BKWA 2DZKA 1NQAO 1EWVA 1QDEA 1WUIS 2R8OA 4P0TA 1ECLA 1CZHA 2G8LA 3DE0X 1E32A 1RRGA 4EG4A 4HH1A 3WBFA 4EKYA 2FCRA 2Z8LA 2OJRA 2NTTA 3CO5A 3ONFA 3V3KA 1VZ7A 3RFUA 3R75A 1DLIA 2Q2WA 4DR4B 3FYUC 1DB3A 4R2JA 4IKPA 1DCFA 1V1MB 4KHZA 2F1IA 4B5KA 2G9RA 3UCFA 2XHEA 5FR1A 4QYIB 3HM6X 3WL8A 3C1UA 5HF6A 1TVCA 1WB6A 1KZYC 3MWFA 3VVCA 4DLXA 2L83A 3DZ8A 3E84A 3NPAA 2P9ZA 2Q5IA 2I2CA 2QN7A 3OTQA 4YCBA 3ROFA 3U37A 1DHRA 2NXCA 2CVOA 4IX9A 1UH5A 2FZCA 2W48A 1ZM4A 4I50F 4MPDA 4GDLB 4UDNA 3RBXA 1YULA 5T4FA 1LJLA 2P68A 1Y5LA 1E1CB 3HGQA 5C5IA 4A2PA 2I0FA 4M1SA 4EVSA 2UV8A 1K8QA 3QX8A 4JWTA 3TR6A 3ZWKA 4JLBA 4M8IA 3F4KA 2A9QA 2H1LA 4DGSA 3RH0A 5JFOA 4FHGA 3GLFB 5MHTA 3ROPA 4B79A 3MD0A 3DE1X 1NKTA 4HVBA 2BCGY 3GH3A 1J39A 2H6EA 2YEPB 2CXOA 1EUDB 5J2TF 4O2BA 3SVTA 2ZU0C 4OHOA 1GQRA 3OT1B 4C6HA 1K4KA 4GVXA 1TCUA 4L6CA 4Q24A 5IAOA 4XOIA 1N6HA 1VHWA 4KN9S 3AEKA 4L0CA 2IY0B 4QGHA 2R97A 4N6NA 4QLAA 2WOJA 3GB1A 3LHSA 1X1EA 1NI3A 1K6JA 3K31A 4YCDA 1WY8A 4LDRA 4MOWA 4NE2A 1XVTA 1KZ4A 1SH7A 2AYXA 4L3VA 4LECA 4AXBA 4X90A 1CUZA 2Y71A 4TTJA 1ZVQA 4YP1A 1RYDA 3CH6A 4YJDA 4CF3A 1FDTA 1ZVKA 2GM3A 3C3YA 3PNPA 2GBNA 3KJEA 4ILEA 4QLBA 3B60A 4F4JA 1OAKA 2ZVOA 3W6NA 3HXMA 1AQNA 3U4QA 1J9EA 2I4MA 1JFSA 2BKXA 3BN3A 4GW3A 2XQKA 3NLLA 1XCTL 4TWIA 1LXDA 1PNOA 1V3TA 3CRW1 4IDPA 2Y5BB 3BB4A 4Q1FA 1CY4A 3ILVA 4K3VA 4LV5B 1GC7A 4OEHA 3NTOA 1NP6A 2INDC 3D3QA 1C3OA 1EFUA 2V54A 2VPZA 1GPNA 3I30X 5HKOA 5KWJA 4LE1A 3T5GA 5KYWB 1QLJA 3D3JA 4BUZA 5L51A 2DQZA 3ORYA 1J2YA 1D7AA 2H9IA 1X13A 2G63A 2O20A 3CNQS 3EHDA 4NQKE 4BGVA 2JIPA 5KS2A 4IOLA 2LIPA 3GXOA 5D8DA 4B4VA 4ECEA 3GEGA 2IYYA 4R2MA 2H85A 4MA0A 3PJEA 4PGHA 1C7EA 1AZWA 2XWBF 2B4RO 2EDAA 4K7UA 3E81A 1PGJA 1W85B 4XYCA 3E22B 1JLKA 3VU9B 5BWLA 1Q74A 3RHSA 1T43A 4PZEA 3HEMA 4MJLA 3QVGA 3A1NA 1YJQA 3EXEB 3MPUA 1DFHA 2GCNA 1FSFA 3F9IA 1WXGA 5AKGA 2O3SA 2F3PA 4C4ZA 4XYMA 3A1VA 2RCYA 5HM6A 2IGBA 2RH8A 5GY7A 4E5KA 2IEDA 4KTVE 3K4PA 5IASA 4Z7JA 3ZVRA 1QLHA 2EJCA 4F38A 1HURA 1E69A 1SCAA 3ENKA 3NNDA 5AVUA 1JMYA 3ZHVA 4CJXA 3QBDA 1AKQA 1WR6E 4HX2A 3QPUA 4YGYA 3LQYA 2J9ZB 5EWLA 2AG5A 2NO1A 5D86A 1MC8A 1QZUA 2HJGA 1EQAA 3CBQA 3WKBA 1AUOA 1JEQA 4EMTA 2X5JO 3B9JA 4ZOHC 3OU7A 1GAXA 4LOLA 5H80A 4MLZA 3E05A 3KJIA 1Z2OX 5SZIA 3HGMA 4FLHA 4X0EA 2JLSA 3RT1A 1XOIA 2XODA 1ZINA 4F9GA 5JY6A 2J5XA 1EFHA 4BNGA 4M8MA 1YNOA 4NENB 3LRXA 5C2JB 5G3YA 4JYBA 1L9XA 3U5TA 1BMFD 2FCQA 3BE6A 4N5DA 4DUGD 2AN5A 2Q29A 3PWSA 3HU3A 4NCHA 3OWOA 3NGXA 2NCNA 4DNPA 5FBQB 1I24A 4RFSA 1JBQA 4P6VF 3ZDMC 2HADA 2NXNA 2R5WA 3R3XA 4K28A 4LXHA 4LC1A 4BMPB 1Y1LA 2CR5A 2IZ5A 2VA9A 2XD4A 1HGXA 4C4SA 5JCPA 1A2KC 2IY8A 2YJZA 4G36A 4QD3A 2XT9A 2WXKA 1U3CA 3RVBA 3FPGA 4A3SA 3U8ZA 3ZXUB 2BFAA 1UGJA 2H07A 1X15A 3LFTA 1OUMA 4FFNA 4KPUB 4LDQA 1KP3A 1H4TA 3KQWA 2Z9BA 3FHOA 3KIPA 1KNXA 3OPXA 4D6PA 4FDAA 4MQEA 1N60A 5LOVA 4FXCA 2HMAA 2K8HA 2R62A 4TLEA 3S2ZA 1UEXC 3B38A 1NVGA 4M7OA 5C1BA 3L41A 1GNLA 1OH5A 1J1ZA 3LC1O 4C43A 1IHYA 2AL7A 1OH6A 2O2EA 1S2OA 3FW1A 2CS4A 3ML1A 4FS8A 2BQQA 5HIAA 1B26A 1JILA 1S5PA 2AWOA 4C56C 2PG3A 4HUTA 2ZT5A 1L5PA 3UGBB 3SVLA 4E21A 4GRAA 2LIVA 3AUJB 4B48A 4C0SA 1M0EA 3KT3A 4DQOC 1I4GA 2B61A 1TW3A 2AFVA 4UFPA 1LFAA 2JFOA 1VIAA 2PKXA 4FFLA 2C8LA 3BSYA 4M7WA 1Y7LA 4NU6A 4WECA 2C88A 2QBYA 3BWUD 3QMWA 4IILA 1CUGA 1XRSB 2H17A 2QSUA 4KN6A 4EKNB 4DDTA 5B57C 3WB0A 2CNOA 2QX9A 3ACBA 3S5JA 1NNEA 2ZAOA 5BQOA 5L3SB 4D2KA 1FL9A 4HKZE 2GPTA 2Q27A 4RHYA 4KFCA 5G53C 2JHCA 1KDZA 5EVCA 3GCDA 5IJWA 4N3NA 1FB5A 1SCNE 2QIOA 1CQXA 3UXEA 2OKGA 2ZBQA 1N5XA 3K9GA 4S12A 1A9RA 2C78A 3FSGD 1KQPA 2O50A 3C4JA 3SVZA 3VUEA 3VNBA 1Y37A 3ZV7A 4BX0A 1BXRA 4CYMA 1S9DA 1GIAA 1JKXA 3KLMX 4HDOB 4AO6A 1UM8A 1F6WA 1JG4A 1F2RI 4QGBA 3UC9A 4DCCA 4EX6A 1A04A 5AO9A 3GYGA 4DHJD 3E4DA 3B52X 2AUMA 2CB0A 3JQAB 5A9SA 2XDWA 3LSYA 1D2RA 5LZ5A 4ERNA 3P63A 4LK2A 5HX7A 3PC4A 3GT0A 3HJNA 4Z51A 1Y80A 2ZCVA 3L08A 4EYQA 1LB1B 2N9PC 1A96A 1W581 3QFSA 3ITKA 3NUHB 3PE3A 2I1LA 3IKTA 4PC7A 3WDMA 3NVMB 2PKCA 4IDIA 2RGWA 2VPYA 4ENQA 4RENA 1RBMA 5DI3B 1UK8A 2IU6A 4YVFA 1OU4A 1QQ7A 1P6XA 5FL7D 4EENA 5IJZA 2NP6A 3OHMA 3QLTA 2MJDA 2V45A 3IUYA 4I5GA 4JEUA 2C4UA 2FZWA 1A4UA 2NPOA 4FUQA 3SF8A 1SUCA 2XVZA 2CL0X 1EGAA 2VPQA 4GQBA 4RO0A 3AESA 1OBVA 3D6UA 4P0QB 3ICWA 2HNKA 1M8PA 3OLCX 1ISHA 1PK8A 2XB6A 5KVCA 1O6GA 1X8JA 1Z2DA 4S24A 4BJHB 2KQ4X 4MQUA 1EP2B 3AVXA 1CCWA 2RBEA 5ECWA 1ZCJA 1JFFB 4K6FA 3SKYA 1PWYE 4DSOA 1KJQA 2LJ5A 1QV6A 2VNKA 3OTHA 2BF7A 2ZI4A 3CJTA 3KBOA 3K0FA 1IG3A 1GRCA 2O07A 3CKLA 3QX7A 4X1YB 3FCEA 3VMMA 3UGTA 3EQ8A 4GLOA 4LTNA 2DZMA 1ZRSA 1DQNA 2OV2A 3IIMA 3QEAZ 3UOWA 1AD2A 1Y4SA 3U3XA 4CM3A 3H2HA 4RZXA 1GNUA 4P3OA 1VMEA 4XLTA 1GTSA 5JO0A 2JWZA 3RZWC 3OETA 3T3NA 3B36A 5DSXA 5K0NA 3RGWS 2WHXA 2Y1KA 4TKUA 4HWPA 2JIOA 5K3AA 3RTDA 1E89A 3SIWA 1WUYA 1H1TA 1W1WA 1FVHA 3GQVA 1NBIA 5A1JA 3I83A 1X80A 1WMDA 2Y27A 3NU1A 4XYEA 4LBYA 5LXHA 1ORVA 4M4SA 4UM5A 1M5TA 4OLBA 4Q00A 1XHFA 2JGLA 1WRBA 1FNNA 4UUPA 4ZTZB 4JJ6A 1DNPA 3IX7A 4PO9A 1DJMA 1F1HA 3ADPA 4NDAA 1S4QA 1GN8A 3G59A 4NEQA 1OTHA 1DAGA 2HMTA 4K9LA 4LJSA 5D3ZA 3EFBA 4IM2A 1A76A 3C3WA 3BYTB 4H1TA 3BYZA 4MUBA 4U3JA 4S1OA 3UFXB 3B13B 3BWBA 3RG2A 4PG8A 3TDNA 5BUZA 2R7KA 2XKBA 1II0A 4IWPA 4W9HA 3ETDA 5EPOA 5JQGA 1A82A 3DYVA 5CD9A 3FLMA 3R0ZA 1XVLA 4UNRA 2QRUA 8AT1A 2LVOA 4GMXA 5C52B 4LYAA 4M1TA 2IGGA 4XD2A 3U6BA 3QE9Y 4DDHA 1XZCA 5JH7A 1W0CA 3QBVA 2OMKA 5I9IA 1J0GA 1AS2A 3FROA 4XIIA 1OLUA 4IIYA 2EX1A 3N7UA 4QBHA 2PQ0A 4HZUA 4M0KA 3I28A 4JU9A 4RK7A 2E4VA 5ERYA 1Q77A 4NCAA 1CUFA 5HI1A 1LK0A 3PJDA 3PLNA 1NN5A 3TNFA 4WQMA 2QTWB 3NRJA 3C4VA 1PQ4A 3C5WP 3M1AA 3A26A 2VCEA 1FYVA 2YDYA 3IERA 2O5RA 1HTQA 2IVFA 4R9SA 2ZSHA 1WJ6A 5TT1A 1UPAA 4QQ8A 5IC6A 1TTNA 3CRNA 1YA4A 3X1DA 4D80A 3RCZA 2NUAB 2CFIA 1YSCA 2QYHA 4RACA 3UUFA 1N2EA 4LY0A 4BKRA 4A15A 4CTKA 4JLDA 4Q1CA 1YS1X 5JWHA 3VZRA 3ZXRA 3KJFA 1S3FA 5TIIA 3H1EA 5CLLA 1RHKA 2G07A 4OXIA 1JNYA 3ZWYA 2F55A 4RYDA 4GMGA 4MHTA 2QVZX 4F9FA 1P2FA 3D6NB 3HGTA 3I9KA 3A6ZA 3WLSA 3R3JA 1ILEA 2RHRA 1TTTA 1YS4A 5COAA 1DOXA 3PC6A 2VTKA 5FJIA 5LP6F 1RP1A 2K2QB 4XR9A 1FFXA 4AJHA 5AUNB 2RIPA 4I4LA 1AV7A 4UU7A 1RI3A 3AIKA 3HVIA 3JR7A 3EAGA 2PH3A 3ESYA 4DRZA 4PZAA 4RSGA 1VXRA 4FZ5A 3RASA 5H8YE 2BWES 3I32A 3PCXA 4MKZA 1VE1A 5EMMA 1ZK2A 5TB5A 4X65B 4B43A 3JQFA 4TXLA 3HU2A 2FPXA 3RODA 1G9SA 2RG7A 3U3DA 2PYIA 1Z0FA 2OFOA 5EZ6B 3SNHA 3RYCA 2BC9A 3KZKA 3Q3FA 1JR2A 1KC1A 1RZ3A 4HRXA 2X0IA 3KKNA 3VFDA 2V6JA 1FNUA 3GFSA 3NHRA 3SYKA 2W2TA 1IB6A 3A9SA 3CINA 4JQZA 3A8TA 4DDVA 4FR2A 4YP7A 4WXYB 3AL0C 4HKTA 4EJFA 4YXDB 3ZO5B 1J42A 1DQRA 2EHDA 3NI2A 4MHOA 1MFWA 1DG1G 4YJ2F 5FRDA 4FFPA 2KACA 4ZRJA 1CR0A 2JGDA 1N1EA 1Y8RC 5DT2A 2RC6A 4AWBA 5IJ0A 2QYSA 3I6BA 4I3HA 1C9MA 1IAVA 5D1HA 5EUCA 3P9ZA 1W52X 2CEAA 4Q0MA 3AF3A 1S7CA 4XOUA 3ECIA 1LDYA 3FKSA 2O8CA 1Q19A 2EELA 3KQQA 1ULTA 4ZODA 4WJPA 5WRFA 3SEQA 2O8NA 1WOYA 1UOEA 4O33A 5JWRA 3SHQA 3WL7A 3SICE 1TADA 3LQFA 3Q3MC 1HLDA 1Q14A 2WXRA 2QLTA 2YFHA 1TZMA 4N01A 3VHTC 3ZK8A 1W9MA 1OFTA 5KCMA 1ZNXA 2RCNA 5HUJA 3R7LA 1ORTA 4DV2B 3AULA 3O2NA 1ISGA 1UT8A 3PKJA 3FHJA 2Y99A 2H3HA 4IMRA 1PZHA 2YHBA 3AINA 3ONVA 2M17A 4L27A 4Q37A 1TD1A 4MVYA 1V86A 1IBSA 4JBXA 3QKRB 4XDYA 1KIAA 4EW6A 2UU9B 4HNTA 4LF8B 2JEZA 3I76A 4FZVA 2FLKA 3RK1A 1I1QB 1YBMA 1SBYA 1HFKA 2WJWA 2YOHA 2ZTSA 5FLKA 5B1DA 3V2UA 3WHPA 1UWMA 3ZLTA 4W5OA 4S0RA 1ZKHA 2C9OA 2UUOA 1OTRB 1EA5A 2JFNA 4C14A 3OZBA 1VL6A 4YJ3A 5J18A 1IL0A 2WQYB 1UPUA 4N7RA 4OSEA 5FORA 1GB4A 1MO5A 3QMVA 4PQGA 1MPXA 2BLLA 3ZYCA 3EEBA 3VGJA 3D1VA 2MA9B 1GKUB 1P72A 3IDZA 5BQ5A 4NZZA 1XD8A 1KFJB 3KV1A 1R4ZA 1I0IA 1PFWA 2K9XA 2NNLD 4HRAA 5IFKA 3U0BA 4XRGA 1W25A 1J5EB 1EF1A 3IBEA 2M98A 4MH8A 4MDKE 3FC4A 4A90A 1CQPA 2W4IA 1LJ8A 3B82A 1Z2CA 4LJ7A 3H0CA 3MW8A 2DWCA 2OA0A 1XLUA 2QP9X 2PGNA 3UWKA 5YASA 3QVUA 4KSCA 5CM9C 2Z6AA 3ED5A 1IQUA 1YJ1A 2R5NA 5K3FB 4CV2A 2CDNA 2NZVG 2Z5VA 4E07A 1H0RA 3CSSA 1L7DA 3B2EA 4CUJA 2K8CA 2JNWA 2UUPA 1I42A 2BHTA 2C59A 2ZDQA 2HD4A 3WGTA 1G9TA 1D2AA 4BCCA 1SVSA 1Y8QA 4LHWA 1U2SA 1ZSYA 3LQRA 5H83A 3TMKA 4LMBA 3VAAA 3ZXXA 2QMYA 5IEJA 1QX4A 3AQIA 3LQ1A 1Z38A 5EJ6A 2V7UA 2PX0A 4D9KA 4EEWA 3FAHA 3LDZE 4JVNA 3QEOA 4GEGA 1YQ9A 4HDNA 2ZS7A 3GJ4A 3DF9A 3DD1A 4UPEA 3OSUA 2C04A 4RKRA 3N59A 1NPTO 4DR7B 4LDPA 3E1SA 2JEYA 4IBOA 4GS5A 1C8KA 1KVUA 1L0BA 2ZJ6A 4JL5A 4PBRA 4F1WA 2JLRA 1PR6A 2L1AA 3WLIA 1Z4PX 2BGIA 4FMPA 2CNBA 2Y0CA 3RPEA 4HGNA 3LHKA 3MIIA 4WXHA 3U81A 3WLHA 4QUJA 4F4DA 5BNTA 3L17A 4TKMA 3FF4A 4B2YA 4F3NA 3WANA 1MIOB 1BX0A 3RUEA 1X74A 3IR6A 1N9ZA 1U2EA 1SIOA 2GJ9A 4K40A 3WLAA 2VTBB 4J2OA 3D2AA 1GRRA 1P3DA 1RJEA 3C19A 3EFHA 4JYPA 4NHEA 1GGJA 1OLOA 1YB2A 3I12A 3U80A 3WIMA 3K15A 1P6QA 2WRZA 1A70A 1TX4B 1NE7A 4Y6SA 5ALMA 4CW7A 4INPA 4ZZIA 1KOGA 1WMAA 3HNPA 4BFTA 5KI6A 1FMAD 3SAJA 1CEQA 2W82A 1AA6A 2B1JA 1WPXA 5KOJA 2WHIA 1E1LA 4WKOA 3ZZUA 3MWGA 1CU1A 2P3SA 3UH1A 3S2IA 2ASQA 1LSSA 3OEEA 4UMVA 1KXZA 4Q3AA 5FCDA 3WGUA 2H31A 4F4UA 4WNIA 4I55F 2TSSA 5H4HA 1OPRA 2KX3A 2PE6B 2O05A 3B8EA 3VTAA 2OT3B 4XW2A 1LDNA 4L78A 1QQTA 3COYA 4UQOA 4I1RA 3LHIA 5EYPA 3UBMA 4V0RA 2DY0A 1W1UA 3U62A 1F8FA 4U2EA 4ED9A 3IDFA 2R44A 3KXIA 3TJRA 4M9UA 1NPDA 3A6JA 4BNDB 4LOKA 4FMDB 3IHTA 1I7QB 1UZXB 5E7IA 1JDSA 1TCCA 2XPCA 2HQRA 3H2ZA 4ER5A 4XPIB 2QQ0A 1TQ8A 3WLOA 4GLSC 1GNVA 1XZJA 2OXFA 2RHMA 2WV9A 4HFMA 1ISSA 2EZ4A 4LY3A 3CEAA 1FVXA 4N7BA 5EL0A 4I1PA 3PQ8A 1QO0A 2QZ4A 3PQ6A 4Q4AB 3SXUB 4K81B 9ATCA 5KYXA 4JS0A 1R4NA 3FCYA 2OGWA 1UEJA 3OMXA 1P7CA 1V16A 2VYVD 3FSEA 3Q3HA 3GLFE 1TYEB 3NEYA 3ZK9A 4R0VA 4ZVSA 2QRKA 3QBJA 5CX1B 5HVNA 2OCIA 3QITA 3KKQA 3KVNA 3Q5EA 1NEKB 1DU4A 2J9RA 3K09A 3NIBA 4A8JB 2GYVA 4JI0B 1JHXA 2Y2UA 3DE3X 4N12A 1IY2A 2BF4A 1HK7A 2NAFA 1XELA 3IEKA 4MMXB 2IXEA 3PDHA 4RIGA 4AZVA 1PL6A 3SJ7A 2N4FA 2Z3ZA 5FNVA 2YN0A 2VRWA 2ZJ4A 4XRRA 3VUFA 4OYLA 2DT5A 3AG6A 1LW7A 1TU3A 3GNTA 1MJDA 4ZMRA 4ZQCB 2I4TA 3BDVA 2QRPA 2BJHA 2GF9A 4H6VA 3Q2IA 3DAPA 5BOVA 1QGYA 4BFUA 1W7AA 4BRUA 1ULBA 1E5DA 1F2UB 1I7HA 4QZVA 1U31A 2WG0A 4DMFA 2VQFB 4DUYB 4HJRA 2OYSA 3LCRA 4MKGA 4H77A 2C2KA 3EZ6A 2CHVA 3UICA 5AUKA 3P42A 1XTPA 1Z13A 2L42A 2QAIA 3H99A 4L0DA 1HEIA 4AJPA 4DMHA 4JU8A 4K46A 4CL2A 4N9WA 2P78A 3ZD7A 2F3TA 3AFNA 3ADOA 4YP6A 3N1YC 3DE6X 4EHAA 4G0PA 4XGQA 4QGGA 1JS1X 3PC2A 4NAMA 3O4GA 1XNJA 3FPHA 4RADA 2ZI9A 3RI3A 5IU6A 3M3HA 1O4WA 4UNIA 5KJFA 1VLZA 1W29A 3FTPA 1DDOA 4ZRKA 2RMMA 1SC1A 2OEPA 3DVAA 3LSTA 5DV9A 1L3BA 2WY2D 3VDMA 4US8A 4OQEA 3SDSA 3FDIA 3G49A 1MRNA 4PO1A 3TQTA 1L5OA 2W2QA 3HCCA 2R7MA 4DABA 1KS2A 3EQ7A 3EDQA 3C15C 1SU8A 2OHHA 3K0FB 2GOYA 4HH4A 1HTWA 1MHPA 2P4UA 1X0VA 2PZFA 1Z6TA 4QTTB 4ZVKA 5BSMA 2RI6A 3M5WA 3SYTA 3VUWA 4TMFA 3K0AB 1M1ZA 2IPKD 1MUUA 2DKFA 3X1ZA 2G0NA 2OP1A 4CLOA 1D2EA 4MARA 5ITSA 2RARA 4D9CA 1HDXA 2PZKA 2WHPB 3MBOA 3V1KA 1MGOA 5D3IB 4LVOA 2D3TA 2V5UA 2Z2KA 3DNFA 1JHVA 3I6QA 5KJCA 1Q2UA 2CY0A 1YVUA 2YJGA 3CLTC 2EYQA 1FPMA 3P5BA 4MNTA 3E7FA 2O2IA 5D7GA 4BNXA 3ZG6A 4EABA 4DXAB 1NRXA 5IVPA 4BO4A 1IBKB 4HMPA 1X0XA 1KHHA 4HAVA 3BQNB 3UMCA 4EVRA 4WAFA 2EL7A 3DR5A 2H54A 4LHZA 3HVUA 4RJIA 5LQMA 3DLBA 1PJ3A 1H3EA 1V35A 1SB3C 1L4KA 1NVTA 4LIPD 5BUCA 6CHYA 1APBA 2G6TA 5D3MB 1PT7A 3JXEA 3V8PA 4FB4A 1FTSA 4M1QA 4UOQA 1WRDB 3ZWBA 5B1IA 5BN5B 3I05A 2FWAA 4R83A 3DNMA 3ZCPA 2GSWA 2BSQA 1LA2A 1EP1B 1G42A 3HMQA 5EMNA 5EJ9A 3QA3E 3ZJUA 3D3EA 1BMTA 4UTOA 4FN4A 1FE8A 4B75A 2OY0A 5JSKA 2BW2A 3RVDA 5EZYB 2NPTB 2Z08A 3QJYA 4JNCA 5C1ZA 4BKOA 4DNOA 3EF0A 4CM4A 4OAPA 1SCJA 1T1GA 4ND1A 5FQOA 4PLCA 2IUTA 5FPHA 3TL3A 3JRWA 1UWXA 1E9RA 1ZCAA 4MJSA 4HGPA 1LD3A 2A5LA 2KWIA 3CT6A 2QU7A 3DYIA 1JFRA 3L0DA 4KIGA 2JCBA 4LZAA 4PZDA 3LBNA 2I3ZA 3EC7A 3SS8A 2PZMA 3CG0A 3UENA 3RUPA 2OV1A 2G3QB 2LHDA 3RVMA 1P1KA 3B53X 4NK4A 4BASA 3F7TA 2XAAA 2H9YA 3JQ9A 2R9VA 3DLTA 2YBEA 3NYWA 4JIGA 1TI7A 1L5QA 4TKNA 1AS3A 1TEHA 1YI1A 3LBAA 1AE1A 4B33A 5KVVA 2O8EA 1AHHA 5LR6A 2ZBDA 3RB8A 4EYSA 1KO4A 1QIEA 4A8XC 4HDAA 5JBIA 4IEEA 2GTHA 4AUNA 3QK0A 1MW8X 3TLEA 2JZOA 4DFDA 1ZD3A 3I6ZA 1EK1A 2NGRA 3QWAA 5JPCA 3E27A 2K25A 1FRZA 1T15A 1A9XA 3ZUNA 4S35A 2C5AA 3WZ2A 5T7BA 4OUDA 1I10A 1TA4A 1E79A 4EUNA 2Z09A 3QG5A 4IHQA 4AP9A 1STOA 2EWMA 3F3KA 5D84A 4EEXA 1DTWB 5FUQA 2CK3D 2E3TA 3F1LA 2G77B 2ZVPX 2XEDA 4OI4A 3PQ5A 1WMEA 2PLPA 2C5EA 4G4IA 3OSZA 3L7LA 3RSHA 5HZGA 3O4VA 3EPKA 1BA2A 4MULA 1PJQA 1TNDA 4NMHA 3RWMB 5C4MA 4QU0A 4LZLA 3E0XA 3TRKA 4WWOA 1UAYA 1H2ZA 1MBZA 3NHMA 3P27A 4HXYA 4J0EA 4XH9B 3U3RA 1PW7A 1G4HA 1TYZA 2HCBA 2RHJA 4R0MA 5B6IA 3PVCA 4N3GA 2AK2A 2CN1A 2HQBA 4IDHA 3RVKA 4EA8A 2QLBA 1M6YA 2QL6A 1JZSA 4JI2B 3K70D 1F8YA 2DYBA 1RIFA 3DKIA 3DS8A 3WIDA 4AKHA 4Z9FA 4U9HS 4C4PA 2ETXA 1F2RC 5HG2A 1ZHHA 1KSJA 5AVKA 1V2YA 2R00A 1UDBA 3SZUA 1HEUA 1Z0AA 5FBVB 2C7VA 2N46A 3H16A 2ONJA 1OWMA 4XC2A 1P45A 3B7GA 1R4MB 3NH9A 2YWXA 1N1GA 4H35A 5EZYF 4BP1A 1Y7IA 2R1TA 4GX1A 3WLKX 2PTGA 3B5JA 2CLHB 3CHYA 1AHIA 2AUNA 2JA1A 3L4SO 2WIGA 3PP8A 3A33B 4WWPA 1BCSB 1R10A 3O90A 4CV0A 1JMVA 1ZCFA 4FKZA 4DHWA 3C3JA 5F9HA 1L7NA 3OG9A 2J32A 3GJ3A 1F9JA 3HJGA 4MDHA 1WX8A 4OA5A 3VZPA 4A27A 1W4AA 1TUBA 5LJLA 4MQ6A 4IH9A 2VBGA 2WVGA 3DDHA 3L05A 3OURA 2V3NA 2C7HA 1DEAA 3B12A 3GX1A 4LCEA 2ZI7A 1Z4LA 1ZSNA 5SY4A 1TD9A 2OILA 3U60B 1Z34A 1E7QA 2OLEA 1NI4A 1GPH1 3KQVA 4LVUA 3C1AA 4M9ZA 4X20A 3ZWNA 4ZEMA 3LT1A 4HXEB 4XQCA 4IX1A 1QT9A 1E2JA 4OHFA 1O4VA 3QVTA 2NVOA 4TXNA 5IHPA 1BE6A 3ILSA 2Q5WD 2X4DA 3UJ9A 3CWZA 4DIUA 2V8OA 2ZNVC 1M0SA 3G13A 2CSXA 4OY3A 2FWNA 4DHZE 4JLAA 4BJ5A 2GZRA 2X86A 2VSOA 4YJHB 4EKEA 4KXFB 4OJYA 3BK2A 3B5EA 4DCPA 2O8DA 1T5HX 2E9SA 4HUJA 4IKEA 1LWOA 4UMEA 4IWOA 1F12A 1G5RA 2X2PA 1BJTA 1DUIA 3ZTDA 2D54A 5CYGA 2CB9A 4QU9A 3R7QA 2Z6UA 4MRRA 1PTJC 3KQSA 1NZJA 4NH0A 3QFTA 1PUTA 3SMVA 4BUCA 3AO0B 3EGXA 4O6VA 2ZBRA 4MPRA 4B34A 2JJ1A 1NFQA 1YZVA 1C9DB 3HBMA 4UFNA 1Q1EA 2PR7A 3MTGA 1GHTA 3GGGA 3IOCA 5DTMA 5E2IA 5TV2A 4F6RA 3EFOA 4L3WA 1PYWD 2NO0A 1YRAA 3H2KA 1FU8A 2BDEA 3I5YA 3T5MA 4C00A 4GT1A 3M6LA 2KN5A 1ACLA 3TZCA 1P1BA 1NW7A 1RSZA 2IV2X 4Q9NA 2Q5EA 2RKBA 1GGVA 1SBNE 2X19A 3P2IA 4FFSA 5ALWA 4TV3A 1KJTA 3LUJA 1TZCA 2KN4A 2DUJA 1GY8A 3M6VA 2PCLA 3OU6A 3E0QA 4HQ6A 1G5IA 4XD7D 3AQ4A 3E35A 3GDFA 3OU2A 4NL4H 3RYIB 2AX5A 4WVLA 4AI6A 1Z8DA 4FTWA 1JVBA 1KO7A 1YU9A 1CZUA 3N30A 3NG0A 2FPLA 2JHFA 2XDAA 3DBVO 3SLGA 4YUAA 1EWKA 5H4GA 2WT4A 1LLCA 1HTOA 1XHEA 2HK8A 2BL4A 2RGDA 2ZAMA 3IIKA 3NIGB 3NXKA 3P9KA 4RM2A 1DVRA 2VDLB 4MTLA 3BJEA 3VH3A 2ZCJA 3THSA 4UEJA 1WDLA 4O4HF 2LBPA 5ILOA 2O48X 3T3PB 4E5VA 3FETA 4CM1A 2E82A 1ZXIA 3I0MA 4JJFA 5AOBA 5JS1A 1VL1A 3LLVA 4ZPXA 3IP5A 1SU4A 2JF5A 1K7SN 1AXEA 1RFGE 3NOVA 2D07B 4WBSA 4OBWA 5EHNA 4BBNC 5TRTA 5BVGB 3S40A 4LDAA 1BOFA 3P4RB 1D8AA 1PLJA 1Y7TA 2AV6A 4FA6A 1PEAA 1FVFA 2JD0A 4PONA 3OZAA 4Y7CA 3VR4D 4JPSA 2VHYA 5FR3A 2WGSA 3EWNA 2SBTA 3A4TA 4X61A 1JHDA 3R8CA 3COJA 1FBTA 1FFXB 3ANMA 1KVSA 3G0DA 3GV0A 2B99A 2YUTA 3IMFA 3O73A 2KTFA 5SYAA 3RVOA 3VU3A 1I4WA 2DWOA 4D6YA 2HQSA 4EPXA 1FLVA 1YH3A 2IOFA 1F4VA 2HRQA 2YWEA 1BGXT 1QHEA 3BE4A 3QFRA 5G2NA 4M0EA 4PYMA 4L9SA 5ALFA 1WVGA 2D2VA 2IO1B 1LNZA 3TIFA 1R8QA 2RMKA 1GCGA 2LXCA 1K7FB 1OQYA 1X9IA 1KORA 5LZ8A 3WSTA 4EIWA 3BGWA 2H0QA 2KTRB 2JLYA 5E7QA 4F5DA 1SXPA 3N0VA 4NICA 3RFFA 2N9EB 2DJ5A 2WUWE 3CRMA 3ETGA 3OIYA 3PENA 4MV1A 1RD4A 4BWYA 1G59A 2FE4A 2W11A 3T99A 4JXZA 1NNUA 3ZHSA 3IUSA 2XZPA 1M2NA 2VI5A 4UEOA 3UUGA 4K9OA 1D6SA 1L6RA 4A8JC 2DBQA 2QZ9A 5AJVB 1SU7A 3WDKA 1EUYA 2GEDA 2FZVA 3HB0A 3UF8A 1XMIA 2KQUA 3UK1A 4P38A 4EFKA 1EDDA 4GU2A 2ZYWX 3GEHA 1ABFA 2D7CA 3WLNA 5LN1A 3G5AA 4B6RA 1DPFA 1E60A 1GPYA 5D5QA 4OPMA 4WA7A 5IVIA 1ULUA 2ZTVA 3AF2A 5TY0A 2ZBPA 4GKJB 4F84A 1XPRA 2A58A 3L7OA 3TL6A 4E15A 3KQUA 4A6DA 5JBNA 4H59A 2AX4A 2FQXA 5CB4B 3Q12A 2GBKA 2EYUA 1A8SA 3EDOA 4EHKA 3U6KA 3AEQA 3MQFA 5FNVB 2Q4DA 4AP4C 4MV6A 2ZT8A 3Q7IA 3BHNA 3OLXA 3IHPC 3QC8B 1MX3A 3IHKA 5JAZA 4PZUA 3FYSA 2I38A 3WHIA 1ID1A 4UCXA 5KKCA 1FMFA 3SYLA 4DLRA 4A0GA 3W5IA 2KVRA 3KR1A 2X77A 3MC0B 4B6PA 5T6BA 3W5AA 1AKEA 1FTWA 4YT0B 2NSDA 1GQFA 3IXSA 3P0RA 4EZBA 2BYFA 2BGRA 1TMYA 2XNDA 1AH2A 4Q82A 4ANVA 1G8GA 2IYEA 3DMTC 1G7SA 3OCVA 3FLEA 2ZRNA 2KYRA 1ET9A 1JWBB 5EQDA 4JI7B 3IGFA 3ELBA 3X0WA 2FHPA 4H3HB 4MZDA 4PO8A 4JH0A 3ORRA 3HPQA 3K1ZA 2WYUA 5EWMB 1CRLA 1M1XB 2V3VA 1EU1A 2WB2A 4ER3A 1EZ1A 1YD8U 4F6RB 4XEUA 4GAEA 5BRNA 4S0XA 5BPHA 1O0CA 4U0JA 4LZOA 2AG6A 2FFAA 2C1ZA 2GA8A 1K86A 3AHHA 2WWZA 2WNSA 1S1MA 2QN6A 2I62A 3NZEA 3QTLA 1VMAA 4RORA 4C1NA 2Q3LA 2Z0MA 1SBCA 2JVKA 2BFDA 1N8TA 3C6QA 1U11A 5AKEA 1QOPB 4BLWA 4XTCS 8GPBA 3SQOA 5JEDA 3S8EA 4IUYA 4B3XA 2NS5A 1Y4ZA 3JWPA 4XQ0A 4BL5A 3QXGA 1X7WA 1N2SA 2JGEA 2IPAB 3KE9A 1WDMA 1GQSA 3M95A 1J6UA 2DLBA 1HQKA 1XP5A 3OESA 4AJKA 4WZZA 2QM3A 3SU8A 4WHMA 5JNVA 5K0CA 5K8LA 2O2GA 4UBIA 1YWGO 1C0KA 2WAOA 3QWHA 1JE0A 2AXQA 4GBED 5B1SA 3R7NA 4C76A 1GGKA 3KTOA 4OGFA 4BV3A 4LF6B 1RXYA 2O7NA 1BC5A 4EW1A 2OHJA 2VNAA 4U7PB 5BN4B 2MINA 4D0RA 1ZJZA 1X77A 1EBBA 3RBVA 4ALNA 2ECPA 3P26A 3NW9A 5FEMA 3G8YA 2XA2A 1BJRE 3DDSA 4GMKA 2WX1A 4I1VA 4FULA 3RDPA 1U8TA 1JWBD 3ZNGC 1ISRA 1HG0A 2W6IA 2Y1XA 3KOZA 5ALVA 4DV7B 2ZLBA 4K3CA 1BX3A 1BVYF 3BIOA 4F7DA 3UJ6A 3ZDXB 3JQCA 3DO6A 3MAAC 1QHSA 2EJVA 4F96A 1DPGA 3PLVA 4KR6A 5ARBA 4F3RA 5T4HA 4A1OA 1EDZA 1GQ2A 2ZBUA 1GTMA 1KKLA 1R3UA 1IONA 1D0SA 1WLYA 2D5BA 4QUEA 4TMWA 5C2TB 2NU9B 4ARUA 4C3UA 3SEBA 2F7SA 4O3FA 3NTUA 4NWIA 2J5KA 2G5GX 2HSWA 4EZLA 1JWMD 1ODJA 3AJRA 4EBBA 3JYUA 1ZCBA 4X45A 2R7AA 3QVOA 2IJ0A 5JXHA 4GVPA 1JF8A 4O4IF 1ND6A 1R5OA 1XJ5A 2ZRAA 3ESCA 2XNSA 3UAXA 3V8NA 1QWSA 5FTMA 1P19A 5IABA 4ZRPA 1EBFA 4B2IA 2C7QA 3K0CA 2X8XX 5BYRA 3MOGA 4BLRA 3WAMA 1KU6A 4KQEA 4PWYA 1CB0A 2I2YA 1YQDA 2H1WA 2MTBA 3SPXA 1FUEA 1XU9A 2CF5A 3O92A 5B4VA 2H7VA 2GWRA 1SXJC 2WXIA 5JCXA 2I29A 5CCBA 5TJ9A 5JAHA 4QNRA 4CI0B 1AVTA 1EESA 2IP1A 4OLJA 3BGDA 2FSUA 3Q6NA 2V9HA 4BE9A 4BZXA 3CISA 2QJOA 2E37A 3QVSA 3PC8C 3NVZA 5HGJA 5TT0A 4XCQA 1FYWA 1X7YB 4PSAA 2MP2A 3FY4A 1E62A 3DKVA 4MVJF 2RE8A 1IUKA 1EK5A 3PQFA 3DEFA 4UJ3A 5EKSA 2ZRHA 2C00A 1OX5A 1KMCA 1K7EB 3E7DA 4FHCA 3BORA 1Y5IA 3IH5A 4QPNA 3HVKA 2EHJA 3FRIA 4X1KA 3A9JA 1L4GA 2XCQA 1VCBA 2B6HA 4UD6A 2VRRB 2WYIA 4MEBA 1WU7A 5B3JA 3PNBA 5EJEA 2YVQA 3HKDA 5MN5A 1UC9A 3MERA 3SQWA 1G3MA 1VCNA 5LJIA 4PG5A 5CK5A 4KIKA 2Y93A 4HO1X 5M04A 1CTQA 3M3DA 1JAXA 3FR7A 3HCFA 1KJYA 3ZD8A 3B1YA 2BW0A 4TS3A 3R3MA 5DP2A 3UB3A 1JG7A 4B8WA 3AM5A 1IZYA 1VRWA 2FW9A 2YCLA 3QF4B 1T3SA 5FPQA 3CNOA 5JH7B 2WAXA 1XMJA 1EUCB 2D1FA 3HJBA 4TL7A 4XSVA 1DXOA 5CFPA 3GIDA 3LKVA 1IXSB 5G1PA 4H4CA 4NC9A 1MQ8B 3KDSE 3I2FA 2H8GA 4MO9A 1Z6QA 3O1JC 4V03A 5LBTA 5TNXA 3ZHXA 3Q8KA 2UUBB 4DBZA 3DLCA 3W4IA 1UDCA 4R41A 1SPXA 5DPTA 4J3OD 1SR8A 2FW1A 2H5EA 1E4YA 2J3JA 3HYSA 2GBPA 3M4YA 2A1UB 3WWEA 3LW8A 3SR4A 1Z4KA 4ZDKA 1ZZEA 2F9FA 4LQDA 3LLUA 5EXPA 1V97A 3UOAB 1N9GA 3QU4A 4NPHA 2IDMA 2IY7A 4DQVA 2OECA 3OD5A 3C85A 3I6IA 1LTQA 5ALKA 4MR7B 1TFRA 4GQIA 4WACA 5BNZA 4Q3NA 5DHTA 4LXUA 2KMLA 2QRNA 4G89A 3MJRA 1Z5NA 1I4OA 1UNSA 4E09A 4F5EA 2GPBA 2KNBA 4Z7OB 4KQFA 5JXGA 4EHLA 1ENFA 1S2GA 4HAYA 3OKAA 5ALXA 2JCSA 1N62A 1A9XB 2IO2B 4KQMA 5L95C 1NI4B 3ISJA 1MCZA 1O9BA 3O2QB 4DVGA 1X9GA 4D8YA 1WVIA 4Y6OA 1Q0UA 5CW2A 5A05A 1B1CA 1EEHA 1YI0A 3L8FA 4YI3A 5KKNB 2JLUA 2PJRA 1P0MA 4A8HA 2CXXA 2Z3WA 2B6NA 2WJ4A 1SHUX 3MS7A 1WIWA 2OHVA 3HABA 4IDAA 4LRSB 3PO0A 4P31A 3ADBA 5DLYA 1LM8B 2CJYA 3FOBA 2YOGA 1FCJA 1NWCA 1JMKC 3SCZA 4KK3A 4M6WA 4X1IB 3PHBE 5K45A 3SXJA 2REXA 4HOYA 3BY4B 1FMJA 2ZVDA 4ENTA 3GLGA 2FG5A 4KGRA 1E1QD 5BSWA 3SX4A 3EUWA 2M6LA 4D42A 3TW6A 2WM9B 4EGFA 4D0SA 1EJ0A 1F6BA 1NHGA 1YVRA 4MS1B 3PE6A 1C7JA 2Q49A 4QVGA 3D6HA 2WSLA 3GEMA 2ZCBA 1G5TA 3BTSA 3CRRA 3MJVA 3UWPA 4DG5A 4UDXX 4FYMA 3TNYA 5J43A 2YZ7A 4D9BA 4MEMA 1U2PA 2FSVA 2FE1A 2PWBA 4CCAA 1NBWB 3DPSA 4Q7LA 1XTJA 3HWSA 4QHSA 1XQWA 2WNHA 5IUJC 5JBQA 3I9OA 5CH8A 4B3MB 4B6EA 4RWZA 2CJPA 2AMYA 1KR2A 2BEVB 1NC3A 3CNNA 1HE2A 5FI5A 5CCEA 1G16A 4Q3OA 4ZAZA 5JJCA 2C2XA 2QS9A 4N6OA 4D8WA 2VDUE 1HRKA 1ZNWA 5ICGA 4EJSB 2C9CA 4EI9A 3JAWB 4D9JA 1AQUA 2I9PA 3UMFA 2OP0A 3TRJA 2Q0SA 1ZUD1 5KQPA 1WB5A 3CX3A 5HFAA 5LP6A 4WUTA 3OFND 1C9EA 1R15A 2AI1A 2YV2A 4JBIA 1OZHA 3OCWA 5AK4A 5ITVA 2QE7A 3CVYA 3I9V6 4RJJA 4KPYA 5BSUA 3P8ZA 3AE1B 4PLPA 3HDVA 4GXQA 9LDBA 3JQ9C 3GLRA 3M4JA 5A4MS 4MGIE 2XX3A 1RAXA 1FP7A 3SIRA 4EHIA 3FOEC 4AKIA 3L8GA 4QO8A 3RRJA 3UWDA 2ZIGA 1ULSA 1Z0ZA 4LI3X 1PJBA 4Q21A 4DLBA 1KMIY 2G9ZA 3EGDA 3ZVKA 3H04A 1UDAA 4JQCA 5DBOA 4EX7A 2XGMA 4XASA 4QAYA 1KMNA 4LYYA 4B74A 2R3SA 5C4GB 4GLBA 2DZIA 1E3DA 5DEIA 4YTEA 1GUFA 3PUYA 2PXHA 1DHTA 1PG2A 2VJYA 5KYGA 2JG3A 3BIWA 4OUKX 4RD6A 5DMHA 1OD6A 2ZVJA 4PCAA 3UY4A 2PGAA 1LQBA 4P81A 5J2UF 1QONA 3T3MB 1FQKA 4CEHA 3GBPA 4YIHA 2AKEA 2HO4A 2WU3A 4HZGA 4HQNA 3D31A 3R8BA 4OH7A 3WQHA 1OLSB 5J2TB 3LIIA 2V9ZA 5I4IA 4Q34A 2Y05A 3HACA 2W2NA 5EUMA 3LX4A 1UKZA 2CBXA 3NC0C 4WXMA 3HJUA 3NUZA 4I36A 1BOOA 4M0DA 4MKXA 4ZI7A 2NP7A 1CJCA 3W1SC 1XHLA 4FCVA 2OHXA 5ALNA 3AFGA 4BMCA 2IA5A 1SUPA 3OG5A 2QNBA 3N07A 1YFKA 4GI1A 3GARA 1MAHA 3NONA 1FYDA 3IBYA 2AFHB 2QA5A 3UJAA 1DJOA 4BQRA 2JATA 2BEJA 3CLSD 1O97C 5JR3A 5BVHA 1ADCA 1WV1A 3Q11A 2DECA 1B76A 3MK31 1P60A 2A33A 2HO5A 4HTFA 3K4QA 5LXTF 4EWLA 1VFPA 3LUFA 3VR8B 4MV8A 4IMJB 3T7CA 5C5EA 3EY4A 2I99A 1D1TA 2YW9A 3KC2A 1UKAA 2FXVA 2QJTA 1AU9A 3BH0A 4EGSA 2RAVA 1UJ5A 3CFYA 3QJGA 5DZSA 3TMYA 3ZHTA 5JROA 2BM8A 5C7LO 5LKRA 1KF6B 1B9RA 2C2MA 2IQIA 2YTZA 2WWGA 1CIPA 5HP4A 2EW1A 1ECBA 1T0JB 4YPFA 5AKJA 2NZXA 2ONZA 3U7QB 4C2UA 3DVGY 1OH7A 1WH3A 1JDNA 2IW3A 3INRA 4PF1A 4UPDA 1U81A 3E53A 1W44A 1WUKS 2EKPA 3AEQB 1P4GA 3IV9A 3KXKA 1N3IA 5KKAA 4X64B 4EW2A 1YJ8A 3A10A 3BFKA 3NUGA 3O2SB 3H5TA 4DMKA 5TGDA 2H1OA 1TO2E 1P9DU 4DK5A 4NU5A 3L06A 3WLRA 4Z4HA 1UKBA 2XVXA 3WMFA 1Z8HA 2BLNA 3KJZA 3P1JA 4CMBA 5GZ3A 1RPJA 2OCBA 1RXWA 3MTIA 3AI3A 1EFAA 3F9RA 3LUCA 1Z82A 1ZJ4A 1ZEMA 2WMYA 3C14C 3LMKA 1QM5A 1QX3A 1PWZA 4XTRA 5TMEA 5U4XA 1XEWY 3WS7A 4EP1A 1Z74A 3ORHA 5KTRA 4BDTA 2AKYA 4LOAA 2EEPA 3AP2A 3FG9A 1WHTA 4TT3D 1S9HA 3LYUA 1VRAB 4QOFA 2P11A 4IV0A 2PSFA 1YNSA 2POQX 3EMKA 1QDUA 4H9GA 5HF5A 3D81A 3AI5A 4JDUA 4JVSB 5KINB 3OQNA 4BVUC 1ZUWA 2WP0A 3GXBA 5LOVF 3GBVA 4XPIA 5DNVA 2P41A 4P36A 3OOWA 3V4PB 1T4BA 2QMZA 3QLEA 1IZ7A 4XJVA 1EUDA 2DU8A 2EQAA 4JBYA 4NY1A 1JNXX 2BBSA 4Q18A 3VPCA 5AXDA 2PRIA 2FLVA 4GP6A 1IBMB 4DIOA 4JLUA 4GPTA 2ZJ0A 1ETHA 2JFZA 4OJKA 3N5KA 4Q02A 4CMCA 1CUYA 2MSWA 2BFDB 1DV2A 3B78A 3TTSA 4QXMA 3MMXA 4CKCA 3JRNA 5JDCA 1K3UB 2REOA 1MNAA 1Q6ZA 2XYHA 2DRIA 4O1NA 2JGKA 3F2IA 3OZGA 3VI3B 5HIJA 3OBIA 4EK9A 4EYEA 4JT4A 4L3OA 4W6ZA 2WF6A 1OFUX 2FQWA 2GO7A 4L8VA 3CRVA 4YECA 3MJEA 2PUCA 4KZ0A 1DT5A 2P4SA 4M53A 3RSSA 5CDSA 1UEIA 8ABPA 1ZU5A 3Q3IA 1U0SY 4QDTA 4XQEA 2ATIA 3TEFA 3IP8A 4BQSA 5A5FA 2DKOA 5C8ZA 5CLJA 1QQBA 1MEJA 4R05A 3UW1A 2GRAA 3JPWA 4TYPA 1GNTA 2V6FA 1K6IA 2RHGB 4P1BC 3RN9C 2XQFA 2QP4A 4NEGA 4ND8B 4RKFA 1EJ6A 1CQJB 1MMFB 3DGFC 5IC5A 3BILA 4YI5A 3V34A 2HJHA 2VSFA 4F46A 3NV7A 2N1VA 2G6BA 3O75A 4NYIR 2DFPA 4AXXA 2Y1FA 4QUAA 4LXTA 4W8HA 1GGFA 2ODAA 3R6WA 1LI7A 2OG1A 2XVMA 3CUTA 3KKKA 4K03A 1LPNA 4RTQA 5LWQA 2I4OA 3HRKA 1D07A 1GLVA 1NVUQ 4DCGA 4I7EA 4P16A 3KOMA 2HA3A 4WCFC 2WOOA 4F3KA 4AX8A 3V1MA 4CF7A 5DNCA 5AW2A 5J2RA 1K8YB 4ZYUA 1TGZB 2CU3A 1YL7A 2NO5A 2I1JA 3Q40A 4XWAA 1CJSA 4ZQBA 3TB4A 4PTZA 2WIJA 3B6ZA 5B1YA 2FW6A 5JMOA 2YEPF 1QDLB 1LDMA 2LRHA 4JJ7A 1FXUA 1JDVA 1OLXA 1KIMA 1K7CA 3EBOA 3PFCA 5D87A 3SJUA 3W1EA 3GLGE 2PL3A 4C7ZA 5ECGC 3RHZA 4P35A 2WTBA 4PR0A 4UAJA 5AHRA 3HEBA 1R00A 4GOMD 3N0RA 2DX5B 1RW4A 1DIAA 2KLBA 3EPHA 3BSWA 2EFCB 3PNQA 2A9KA 3KDPA 5ILQA 1S4MA 4RSMA 2WHPA 5DGCA 4GNKA 1QHFA 4RDCA 4ND4A 3WAJA 3FLBA 1GD1O 1F1JA 3A6LA 4CEIB 3WGHA 3Q8WA 5JXJA 5INTA 2XBLA 4A26A 3QUBA 2VQ3A 3AM4A 5KX5F 1AUPA 1VKZA 1M1YB 1IIBA 4P58A 2PCJA 3PNSA 1N78A 1CQZA 1V2HE 5IBPA 2IBIB 5THQA 5C8YF 5A0VA 3UMYA 4PZ0A 1X7YA 3H1GA 3LQQA 2QG9A 1SUEA 3DUFA 3HUUA 3DAYA 4JC8A 4PPNA 4YWHA 1EJBA 3TZBA 3IIEA 4X7RA 3E2PA 4A2CA 3CW9A 4BKGA 1J8YF 4QRIA 3WB1A 5J40A 1JTFA 2WJIA 3PWTA 2KT7A 3V6CB 3KXDA 3NS7A 2PTLA 2ZCCA 3TTTA 1XEWX 1VI2A 1XZGA 1YHZA 2G4DB 2FMIA 4KBFA 2P1RA 3DB1A 4ITUA 4JZYA 2Q9AA 3OOEA 1JQEA 4BZPA 4WQOB 1KQNA 3VYWA 3KKLA 1N5IA 1ZK4A 3PBKA 2FNJB 3HKDB 1PFDA 1HE1C 1Y3AA 2AQKA 3Q72A 1MGPA 3B6EA 2Q07A 4ROTA 2ZGVA 4RANA 2DFDA 5E4YA 1Z12A 1GRVA 4QUKA 3ZPXA 2XWQA 5AJUA 2OCLA 2XUHA 2PZ8A 3AOEA 4IM7A 2O3RA 3I9V1 3MTJA 5B3LA 5T57A 2I55A 3LLMA 4I9GA 4DW8A 1YAHA 2PFSA 2I8LA 3G9ZA 1VPVA 2RGAA 4QOHA 3OTWA 1W0JA 4WK6A 5EXTA 2PXXA 1LV7A 4XM0A 2LEKA 1HE4A 1J0EA 3VUXA 1CUHA 1KI8A 1S8FA 1OYOA 2UZ3A 5H9VA 4BP3A 5IKMA 2VP9A 4KXWA 3BB3A 3GZNI 1RQRA 1MFPA 2GD1O 1A3CA 1RFAA 1N9GB 2ZKIA 1HZZA 2Z0EB 2I33A 1JXQA 2VK4A 2GD2A 4RFLA 4Y1GA 5DVZA 3VPBA 4G84A 3SQMA 3OO1A 3G2HA 3AV0B 4RESA 5C46F 3FSJX 3O3OB 3KUUA 4NYJR 4F0JA 2QMOA 3IAM1 1UT5A 2OD7A 2QE7D 4HP8A 4TWRA 3S1AA 1NVFA 4EZIA 1XL1A 3F3MA 4TN1A 1KC3A 1RM5A 3QPWA 3OFNA 3UJ8A 3ZIAD 3X1KA 2VN8A 4B1FA 4O1IA 1RLMA 4MWDA 2QW1A 4S3MA 1CIJA 4QAQA 5JSYA 5TE9A 2IP4A 3ELUA 4DUPA 4U9IS 2J0UB 2LR0A 2OV8A 4HWIB 2AMFA 1Y6FA 2E1RA 2R1VB 4Q3KA 2QUKA 1BDJA 2O2VB 1QS0B 1THGA 1U7HA 1G6KA 4F2HA 1PJTA 2HN9A 1PAUA 3TDKA 3APFA 1U5CA 4KIKB 4BQNA 2AVDA 3PEVA 1KQGA 4KWTA 2I03A 1U6KA 3ROMA 3T3IA 1YI8A 4ZAGA 1IOZA 2P2LA 2JU6X 3GGPA 4E0BA 4I5IA 4C7JA 3ITEA 1W5AA 1SIBE 1A7KA 2ACKA 4HS4A 4OB7A 4WN9A 2QN1A 3T94A 3WYNA 4F2PA 3EUB2 1NL3A 2IDJA 2EKEC 4O2BF 1OI4A 3FPSA 5BRJA 1FJHA 5KNBD 5LL6P 3HKCB 2OCXA 1MXFA 4HS9A 1M2KA 1A8UA 1XCJA 3EW7A 4FKBA 3RKSA 4XFKA 1UWVA 2IPXA 1GV0A 2NVUA 3RVJA 4CM6A 4A0QA 2V6GA 3N8GA 3GB9A 3NDJA 4MP8A 5FBKA 2OAP1 5GM1A 3JQAD 4C3VA 2E89A 1JRUA 2WKRA 3GOQA 3HP4A 3N8DA 4PHGA 5EP2A 4TSKA 4AL4A 4EY6A 2YWJA 3W05A 2JFGA 1P80A 5E3JA 3KEMA 3W2GA 4F3CA 1N2ZA 3VYUB 1BIFA 2OXIA 3L4EA 2BM9A 3IVXA 2BGLA 1T4MA 2O57A 5CFZA 3R44A 4M46A 4FFMA 1OR8A 1DUVG 2AEFA 1FPQA 1X1SA 2RHOA 3F8WA 4GOND 1MA0A 5DN6A 3AM1A 3GLHA 3JYHA 1BRTA 4G9EA 1W4BA 4IPTA 1J21A 1VDZA 1YZGA 2Y4NA 2JB9A 1G2PA 3PUXA 1XWFA 1WMSA 1QFXA 2JARA 4MO2A 5CR9A 1Y3BE 2GFHA 3F3YA 2WZBA 3SJCA 1OXSC 4WFJA 1LRLA 3AV3A 3URYA 2GPSA 2Z8XA 3JD2A 2WJJA 3IQIX 3KSDO 4N54A 2H1IA 5JE8A 5T4BA 3VR2A 3VR1A 1O8BA 3KPVA 1C3XA 1M73E 2BTQA 2WSYB 1L5KA 3V8EA 3GHYA 1KY5A 3LK7A 3IAM6 2VUSA 3QLUA 1IWBB 2CKHB 1I4HA 4LK3A 4B40A 5KBYA 4RM3A 3PC8A 2ZYDA 4BNJA 5F5LA 4CMIA 1B3BA 5LMNB 5LQDA 5CH5A 3H8HA 2PUGA 2CGEA 2P4QA 3H05A 2AWTA 3WY9A 1N1MA 3RROA 4B73A 1GZ7A 1ARZA 1NUQA 3NHJA 4OLFA 5L3ZA 4AY6A 4W63A 5DKFA 4D97A 4EARA 1WE7A 1P0CA 3A6FA 5BWMA 1ZLXA 4OP2A 5AJZA 5AZFA 3LY7A 1PFVA 4BNKA 4NJEA 2ZM6B 3V1NA 2OCAA 3PNOA 4NMWA 5C3JB 4GBGA 3RC8A 2GTPA 2BTEA 4U6QA 3FPEA 4C7KA 4YRKA 3D7LA 1GFWA 2L18A 2V03A 1G3UA 3HNRA 4MVCA 4NFYA 4BVGA 2WE8A 1RI1A 3L4BA 4ZZ3A 2A35A 4EJSA 2NTJA 3NOBA 2DFVA 2ACZB 2V4LA 3BIID 1ZDXA 1N5OX 1RRMA 4HPJB 4V1CI 2R8ZA 3M6MD 2PVOD 2PBFA 1JZTA 4M0LA 4LVCA 5IZCA 2VVTA 4RELA 5LLTA 1JDBC 4KYVA 2G09A 3VDXA 3KHSA 2INPE 2J7KA 4E51A 1V8CA 3V80A 4ZJZA 5I7RA 1XEAA 1D9XA 3DWMA 1O0SA 1C5KA 4A2WA 4CG3A 2FRDC 2JVCA 1E7UA 2KYWA 2Z3VA 4TL9A 3ZKJC 4YV7A 5HFNA 1G8FA 3TQHA 1GGHA 1WXDA 3QVMA 3BFVA 2J6IA 2CW5A 2LKDA 4BY9E 4L5BA 2GF2A 4UBMA 1ZIYA 4FOOA 3TIVA 1E0DA 3OTGA 3QM1A 2OWEA 3N2IA 5GGYA 3U1VA 1V5GA 2GK7A 1SG9A 3L0OA 1RKUA 3OE7A 4MR7A 4PLZA 4AMYA 5HZMA 3VHXB 1V81A 5KTPA 4UDUC 2CDBA 5HHTA 5JDIC 2YFKA 3WB2A 2GPJA 3V9AA 2KK8A 4H08A 5AW7A 1GG5A 4QYIA 3JQDA 1H9CA 1X8LA 5LKAA 3RIXA 4DQLA 4L5YA 1DKMA 4J29A 1YN4A 1B4DA 4CIVA 1IJBA 1JG6A 3Q98A 1I4EB 4NH4A 4UE3S 3UMJA 5CFOA 3NNNA 2XHZA 3T5TA 2BVCA 4MGYR 3PQDA 2CHQA 1KI4A 1BEUB 1CUWA 2IPMA 4C7OA 4C78A 1LK7A 1CRWG 3I63C 3PNLA 2QRJA 2GPWA 3G0BA 5DPWA 4Q3EA 2X23A 2XJ4A 5HF8A 2I1QA 1V6AA 4KPFC 5BXQC 1QP7A 1H8HD 1E61A 1TT7A 2ARKA 2OOBB 3A1QA 1KLGD 2JZZA 1J4AA 1P2SA 3K5IA 3JWEA 2BM1A 4OKNA 4OLHA 3WYCA 3REQA 3ZYZA 4N5MA 1PFUA 1GL9B 4E3WA 2JFVA 1CPYA 1T36A 3L4PA 2BGKA 4MHSA 4Z4FA 4UQPA 2L69A 4MS1A 3WLQA 1WXVA 2CV2A 2XSZD 2O0JA 1U94A 2D3BA 1VLLA 1CQWA 2I1VB 3DZGA 1U8EA 2F17A 2HH9A 4MQFA 5CAEB 5CA1A 2QEJC 1RQNA 4IXTA 4YO7A 5CB0A 3SN6A 1ZKDA 3P94A 1UPXA 4FXOA 4C6TB 1IAQA 2O1WA 1I0LA 1VHQA 2QAJA 4UMFA 3V4VB 2KXJA 4D0GA 2LD9A 3HBJA 5LBUA 1KAMA 1QHGA 2IP2A 1P9WA 4QPDA 3DTNA 1B16A 3IOBA 3H11B 3AI1A 3TEWA 4I66A 4ZAVA 5K2MA 3AECB 3FB1A 5SYMA 3LUPA 4KN5A 4RCYA 5FOXA 1C1XB 3CC8A 4JJGA 4JT9A 3IS3A 2EU8A 2W2KA 4QUHA 3L40A 4J0HA 2LE0A 1ACCA 4W8GA 1YQQA 3IAAA 3NKFA 1KVRA 3H9EO 4JX1C 3IB3A 3USES 2JK1A 4Z8XA 4A20A 3VSDA 4CIXA 3VJRA 3V62A 2WIKA 3BH6A 13PKA 3TF5A 3ZE6A 1UMDB 1TEVA 1FQWA 3BHJA 3PHJA 4RJTA 4PS7A 1T3TA 5LYJF 3ITNA 3LY9A 1RKVA 4GKVA 2VDOB 3I01M 3CPHA 3CW8X 5B2FA 4LMRA 2HBQA 2EXXA 1JR6A 3KYBA 4MAAA 3U48A 5A5EA 4CPDA 3H2IA 4MUKA 1ZGBA 3H5LA 2VHXA 2CMDA 1L5LA 4CE6A 1OMOA 3CSTA 4KAFA 3VSEA 4CT0A 5DX0A 4TSRA 1KJJA 5EOVA 3EIQA 5KTYA 1L5VA 1OBOA 3QLVC 4A0HA 5IM4A 3OM1A 3KKMA 2PMWB 1LJUA 5CEFA 3GPIA 1XZHA 4BFWA 1JDUA 5J2UB 4UW9A 4CN8A 2WF8A 4CKWB 4WKNA 2XV1A 2E2WA 2R25B 4Q1DA 1MXHA 1Z16A 2YJ3A 3WJ7A 1OFUA 4JLKA 4DDGD 1E2PA 2F43A 1GZ4A 3CLUC 2IZOA 3P0IA 5FI3A 1U5BA 3HS3A 5TQ2A 1DBRA 2B35A 4P4TA 4RX1A 3IR5A 1R64A 2WBLC 1T8RA 4BMVA 5IZ4A 1EPUA 5IKEA 3L3BA 4BVLA 1D09A 2EBHX 3L8DA 4LBWA 2QY6A 1XEFA 1VPWA 3DPUA 5CPBA 4XZ3A 2JFBA 5C7OO 4YDHB 1HTTA 5F7XA 1CHDA 4H7FA 3NTLA 4H1WA 3SS7X 2JJMA 1OXUA 2WJYA 4ZREA 2JLWA 1MAVA 3MJ5A 4RWEA 1XRPA 3FWKA 4XIFA 5B7GA 1ZNZA 2IV3A 2QUHA 2Q6VA 4DLUA 1I13A 2QX7A 4QTZA 4TTQA 2COEA 4GYJA 3I2JA 1XDZA 3GRYA 1Q0ZA 1KZHA 4Y2TA 1BN6A 4KFSA 1WEHA 2IW1A 3OY7A 4JOBA 2BI8A 2XITA 3IUQA 4TV8A 1I3LA 4CLDA 5KVSA 4LJ4A 1P77A 1DI0A 2M9MA 4WNCA 3DOJA 2B1IA 2REQA 3KS9A 4FHDA 4JB3A 1T6NA 3L0BA 1HPLA 1RRPA 1WUHS 2JI9A 4O1HA 4YT5A 1R88A 5ES3A 3SF8B 4DUZB 4LNOA 1OB2A 4DJTA 1Z7GA 3QKIA 2VNHA 3WYEA 2WA2A 4IJWA 3OQIA 3JZAA 1PEKE 4H0FA 3R2IA 5AM4A 2VOEA 5B7PA 4QPCA 4KH1A 3UT5A 4DXDA 5AMXA 1NGSA 1DLJA 2MMCA 3GT3A 4ZWNA 2YNMC 1N75A 5ERGB 5HBRA 1A27A 5H8WA 1HT3A 1L1RA 3ELDA 4MKHA 5CURA 1RZUA 1NN1A 2BR4A 2YV5A 4MYHA 3VR4A 4KC0A 4JGGA 2VT2A 4KXYA 2GMIC 3WK7A 5I45A 2PRZA 2HV8A 4IVNA 1X7DA 1Q91A 1H42A 2ODNA 3OWXA 1YDFA 2XE4A 2RKWA 4ZHQB 4XQGA 4FHKA 5JG7A 5LQKA 4KCGA 2VAVA 2YQ5A 4H7IA 5CNMA 4IL5A 4D8UA 4S1PA 2FWBA 3IT1A 3MMZA 4L85A 5AKKA 5SY9A 4CETA 4AZ3B 2OFPA 2FKNA 4H7KA 4IYRA 1X9HA 1P5HA 1U2ZA 1YR1A 3F98A 3VPAA 1PJRA 1IVSA 3OJLA 3S81A 4UOZA 1JXAA 1QYWA 1VG1A 1I4RA 1HOXA 3KE8A 4NULA 4YACA 3S0JA 3GCGA 1QRTA 1UJ2A 4DR6B 2FMUA 1LI4A 4MS3A 4QBKA 3AY7A 4P7KA 5K0LA 1COZA 4YJGB 1UD7A 5I7HA 1MV8A 1NY6A 1N5WA 4ZDVA 1XQXA 1YZYA 1CERA 2OXRA 1E1QA 2J0UA 1OA1A 3LFHA 2AW3A 4IIGA 4FDTA 5I4BA 1GNQA 1WGDA 1Y7HA 4WXEA 3QWIA 4QTXA 4B3JA 5JQGB 2O2VA 1QS0A 2BBTA 1DAMA 1XYVA 3DXZA 1FNDA 1MFZA 1VSQA 1IEQA 1A7UA 4BE7B 2HMVA 2UYHA 2IZ0A 4JDPA 3A9TA 3KSMA 1UXHA 1RBZA 2X8WA 3CTMA 3JQGA 3TLMA 4RFBA 4DIBA 5E6RB 4OMCA 2WD9A 2W0MA 4IQGA 4Q66C 2JJ1D 4IY1A 3FBGA 4P8RA 2J6CA 4P0PB 1JJ7A 4MGZE 3R41A 2LGYA 1Y34E 4RPGA 5AI5A 4BAZA 2FW7A 3WNZA 3VPFA 1OGWA 2IF0A 3RJZA 4O08A 3P20A 2EGGA 2BKUA 2Z4TA 3E23A 1PS9A 4P3KA 5FQNA 3MQ2A 4WCVA 4JR1A 4HXDA 3DWGA 4M0MA 2PAAA 4BGIA 6REQB 4TZ6A 2A1UA 4FGSA 3O9VA 4DLLA 1QH8B 5KU1A 5ABPA 1RYHA 2ZIZA 4WBNA 4YCSA 2LGJA 3CZQA 4W9EA 2D2XA 4Y18A 3VJKA 1DV1A 1VE6A 2ZUDA 4HI0E 2BMAA 2I65A 3DKKA 1YQTA 2GK4A 5B5SA 1IU9A 1FDSA 3TFOA 4HSGA 1C0PA 4JC5A 3GVIA 4Q3BA 4RMHA 1KERA 3CN7A 1KJZA 1N6OA 3FPLA 2KLHA 5E38A 3I9MA 4R2WA 1DG3A 1M34A 1TVKB 2BKVA 2Z8ZA 1ECGA 2IS2A 5ENVA 1OASA 3AW8A 2H1HA 1P3QU 1UFKA 1KE1A 3TLXA 1SUAA 3ZEIA 1M8FA 4KIUA 1BE0A 5AM3A 2KDIA 2WK1A 1WXEA 1XQQA 1FA9A 1KK1A 2P9YA 3H9GA 4A7PA 2WFAA 3UW3A 4G23A 4D3XA 1ONSA 2D0OB 4L4SA 1HXYD 1I36A 2W4MA 1Z2NX 2WWWA 4KJXA 4TMYA 1KTIA 2XZLA 1IBRA 2A0UA 3VBEA 2PT9A 2JDID 4H7HA 4MGEA 2D11A 1LPOA 3W0LB 4DGQA 3HM3A 2CVZA 3VOSA 3FHTA 3CF4G 1L7YA 1CP2A 3ZOZA 2R6CA 1HRDA 4AP5A 3HQ4O 5CLFA 1NW5A 1RTTA 1C1YA 5EQFA 3K6KA 3VU1A 2H5LA 3GJRA 1J0BA 1F77A 4AQDA 3EVGA 4J7CA 3RFCA 4ZU1X 4FGUA 5I8PA 2IO0B 4RZUA 3SGLA 2QDXA 1JAYA 1R6VA 2XB4A 1JVNA 3FZNA 2XQJA 1IGCA 2JFFA 4C80A 3OTOB 4MW9A 3B3JA 3GP5A 2R84A 1YBHA 1KJ8A 2I66A 2YZKA 4HUQB 1GO2A 4WGGA 2J3QA 3NOOA 4DC1A 4DWWA 2R6JA 5T67A 1SU6A 4CFSA 1KEVA 3WAKA 1H94A 1SXJA 3PYXA 2FUKA 4PX5A 4UE2A 2AD1A 5L3VA 4GR4A 2OLKA 4EG0A 1RMYA 3JAWA 5EZYA 2FR1A 1SA0B 1AS0A 1T9AA 3OWEB 3KVFB 3EEFA 3M33A 1SD1A 3OPNA 4IZOA 1OCEA 3ICEA 1QU3A 4YP5A 1PJCA 2NU8A 3LWDA 3GJYA 1RWKA 2IHUA 2JK0A 3ENZA 3MMNA 3X1XA 5LZ2A 1WXMA 2EBUA 3TI9A 4J16C 1XZEA 4AKTA 2F67A 1Z28A 1JE1A 5BN1A 5MFZA 5EHIA 4XSHA 2J1LA 4M1YA 1GA6A 4WNYA 2HGSA 3OFSA 3AEBB 4F11A 1L1QA 5IAAA 1NM5C 4CO7A 4TROA 5LYJA 3HM9A 1A2OA 1D5CA 1MAAA 1T2DA 3EGCA 3KZMA 5CNJA 4ZALA 3ALBA 1W35A 1RJ9A 1C4XA 2PMEA 4F04A 3NX4A 3QTTA 4AO7A 2B83A 4YSXB 1VA4A 2FDXA 3KELA 3CQ9A 1XMPA 3HP7A 3AUKA 3M82A 2D4AA 3TKLA 5J4YA 5LQRA 4P4SB 3IDOA 2Q6KA 3VZSA 2QR3A 3E3LA 1U3TA 2BR5A 2LGSA 2L82A 1YJIA 4JUBA 3AUXA 4H18A 4DJFC 1ZAKA 3HK2A 4MP6A 3R5FA 3D3KA 5EJGA 5JYCA 1TYCA 4AUQC 2ILTA 2WWRA 4KR3A 2X2EA 4UCQA 4HF7A 5A9TA 2O9JA 2Y76A 2AG1A 2Q8PA 3O4HA 1GN9A 3FKYA 1H5QA 5EEHA 4BFCA 4U3JB 3MJ4A 4MDFA 4POAA 1TU4A 3C5VA 1SUFA 4D9NA 4ND5A 2IGDA 2J87A 3LYYA 4GO1A 3SE0A 3OOHA 3HE3A 4RY9A 3HYCA 4CTMA 1OT5A 2QMTA 4M8SA 3L1HA 4EL5A 2QPTA 2IPLA 1DEKA 3PD0A 2BAGA 3TIGA 3L0SA 4R5HA 4WBNF 5EJIA 2F4NA 1SMKA 3QQ5A 4KXUA 4OP1A 4C6RA 4TQ1A 3U40A 4R69A 1SEVA 2CFCA 4RC9A 3WYAA 1QAQA 1G9XA 1XN1A 4I8XA 4NMMA 5MGBA 4HNGA 4IFEA 1KDPA 1YOVB 1J23A 5JPIA 4NXMB 4MGIR 5BMVA 4D5GA 1JEEA 4HZUB 3VYSB 4RF1A 1GAEO 5BYJA 2Q3MA 2DH6A 3JQQA 3H0EA 4OHBA 4TTIA 5JS2A 1JQLB 3DZHA 3ESXA 3MLEA 2EZTA 1OQRA 1A8QA 2Y9PB 4J3FA 1H0HA 1X1QA 2FWRA 3P9XA 3WNDA 4UEWA 2JRLA 3H84A 1U3GA 1W88A 2JI6A 1OXXK 2CDAA 2XYVA 3A9UA 3CX4A 4FSHA 5EUQB 4E88A 1IUPA 1Y42X 1W19A 1H85A 3AWDA 2MR5A 4DHJB 1ZDVA 3BMCA 4NBRA 5G0WA 1Q20A 2O8BB 1C4KA 1MO3A 2X9QA 4O4JB 4DBLE 2XRFA 2PPLA 1TIPA 4TLCA 2K5PA 1Z33A 2BKLA 1U0OC 3GMTA 4O2AB 5E1BA 3TM4A 2KWVB 4R2KA 4DMGA 1VGQA 2WDPA 3EB9A 1GA4A 1TTQB 3PFKA 4IJVA 3IUBA 4RMIA 3EUEA 3UJBA 3VNRA 3ZQ6A 5I6DA 5EGNA 4GN1A 3F6PA 5C31A 1U9JA 4WVFA 4BV2A 3MD9A 2YS7A 4GD3Q 4K9RA 1WKCA 1E8YA 2FPUA 3COWA 1GPXA 3HCPA 4OHRA 4ZI7F 1FU4A 1NAIA 2VHWA 2W90A 3C3MA 1R0KA 4I4TF 4KRXA 3T7KA 4NDNE 1GZVA 1KI7A 4I2VA 1QPBA 2PS1A 4RMAA 3Q7TA 2JYEA 1JJVA 1YA6A 3M83A 1NT4A 3MWJA 3JVUA 3OX2A 4TTSA 3KQ4A 1E7SA 1QFZA 5AK6A 2B9VA 2VPWA 2GYWA 4P83A 5EINA 2HCTA 3BIFA 4HV4A 4ZRNA 2K6QA 4N18A 4EECA 2UZ0A 3P4XA 3QE0A 2PUEA 4H6PA 5DMXA 3N3AC 2XN9C 1S3SG 2OGTA 3H3FA 3JYQA 1BW9A 4NZPA 1NFRA 2IZZA 1ZOSA 4BVBA 3WI7A 3MC9A 3DV9A 3PZDA 4IIBA 5T8KA 1N33B 2ZAYA 2KS6A 3FUXA 1ZL2A 1YS7A 4C7YA 2ZETA 3IMEA 1I4PA 2A57A 1Q21A 3OY2A 1PDWA 1U4AA 4QKQA 2OCGA 4INJA 1G20A 2AE2A 3WLJA 2DSTA 4BFLA 1LRJA 2G0TA 1SOAA 5DFAA 2PLFA 4ZVVA 1G0OA 4LHSA 5CDTA 3KWLA 2GK6A 1G6OA 4HWGA 1N4AA 1YDHA 4P2GA 2QXYA 2NPFA 4AJ9A 1WTAA 4GICA 2WJAA 1A5TA 5JECA 4DARA 1HZJA 2K6GA 3C6BA 1TJEA 3EF1A 3BA6A 4DJDC 3W9SA 3STHA 1GSHA 3DTVB 2XCOA 3W90A 2K3UA 1RWPA 3Q4GA 4F12A 3IBFA 4GM0A 4YK7A 1QO0D 3PA6A 1R18A 1UH6A 4ER0A 3VNUA 5K1ZA 3AH8A 3TN7A 2NTVA 2ZIFA 4OB8A 4M8NE 4M7PA 4BCDA 1Z0KA 3QTBA 3EVTA 3E9RA 1WXSA 1PRYA 1IBCA 4RZHA 4D57A 5DM2A 3DWEX 1UMDA 3B1WA 4I5DA 2P9TA 1OC4A 2Z5LA 3D0OA 2C7PA 1YBFA 4EKUA 3DLPX 2AN3A 1TVEA 1NKSA 2L05A 2RGFA 3FBTA 1OXTA 5F2NA 3FKQA 1DBQA 1SKQA 4UFOA 3TW0A 4B80A 2O1SA 2QGFA 4EA7A 4IHKA 1DAEA 1YB7A 5CVJA 4KKXB 1JHUA 1MP0A 2WNIA 2AS0A 2PFGA 3EEYA 5F52A 3A1EA 3MXTA 3W5UB 4IDNA 4UUAA 1GARA 2GPYA 3RC9A 5KU7A 4LQLA 2BONA 4DDID 3UQBA 5EJ7A 1E1RA 2FG6C 2VK8A 2X58A 5DM60 1L4HA 5BVGA 3EZFA 1S3SA 1T6YA 3U39A 1LK5A 2PLWA 4DJJA 1N3LA 3AFHA 3R66C 1G19A 4FADA 1R9JA 1ZA2A 1P3JA 4F8JA 1L6VA 2R7LA 3WZMA 1E99A 4CIDA 1XYGA 1HBJA 3H9QA 2PUHA 2R8RA 1H6DA 1SQ6A 1WY7A 2HX1A 1N6PA 2B2CA 4H15A 2GAFA 4CZ2A 1J2TA 2A7QA 3E9DA 1E4OA 1M94A 3QFHA 2WQ7A 1AB5A 4Q4DA 2D06A 2EC5A 3BWVA 5CFLA 1MORA 5MN4A 1ZR4A 3FMFA 4O02B 4ZD6A 5KSPA 1RXIA 2CKMA 2X1VA 4EGCB 2CHFA 4LV6A 1NVVR 2B7BA 1Q1OA 4UE6A 4CG2A 3U7IA 4YXWD 4ZCTA 1K4YA 1R0YA 2EFDB 2ZRPA 2CHUA 1SC9A 1U7TA 2Y3AA 2CKDA 3CLRC 1GTJ1 3QQPA 4IIJB 1QG4A 1SUWA 4RJ2A 3VHRA 4BKPA 3DUFB 2V3PA 1K6XA 1V37A 3OJOA 1JKFA 3VNSA 2AFIB 1NENB 4P86A 3VVBA 4KQ6A 4DIDA 1SOVA 1J0AA 5DASA 4MW6A 3A4LA 4YONB 4EYGA 4YJFB 1CG6A 1HLFA 2Q2QA 4UPVA 2JXTA 2Q1TA 1OVGA 2VFAA 3DPDA 2FN7A 5EHGA 1JX6A 3QXSA 2YV4A 1S6YA 4OI2A 2HBYA 1BXZA 1KIFA 3AF5A 5CP8A 4ZC1A 2NPTA 4AOFA 2H4YA 4FJ2A 1ICEA 4BX9A 4YRLA 5KNCH 2CHWA 1V3VA 2YXEA 3I5XA 4R81A 4YL8A 2WDVB 1T1JA 2A1TS 4R9VA 3IJEB 2AF3C 2TMYA 3OX4A 3HKBA 4W9JA 2KDFB