2VH1A

Crystal structure of bacterial cell division protein ftsq from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh1A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh1A02
2V9HA 3OG5A 4XGAB 4C00A 4K3BA 2VH2A 3EFCA 3MC9A 4C4VA 2X8XX 4C4VB 2QCZA 3NJTA 3MC8A 4PK1A 4QAYA 2MHJA 2VH1A 2QDFA 4BZAA 3Q6BA 4K3CA
chains in the Genus database with same CATH superfamily
4LJLA 4D41A 2JFQA 2ZIUB 3PNOA 4QJBA 4HNAB 1WW3A 3LW8A 2NO5A 2GASA 3D6HA 3M4YA 3WZLA 4V0NA 1NG1A 4MS4B 4YR9A 4RIHA 1DQYA 1JQEA 2FSPA 4TM8A 1C0IA 1R2QA 3RFXA 1M83A 3LKVA 3N7TA 2OENG 1ZNXA 2QM7A 4LY0A 4I9NA 1JFLA 2ZG6A 1Q1OA 2QN9A 1MG0A 3EH1A 1C1DA 5AVVA 1VZ3A 3V3XA 2JYTA 2M0XA 2QSJA 4I4TF 3ZLTA 4MDEA 3O75A 1XQVA 1V4BA 4MUXA 2VIIA 2KN4A 2XEWA 4MGZE 3JQAB 4A91A 1E66A 1OXVA 4HXFB 4CKEA 4U2EA 2N75A 3GEIA 4C76A 4C0BA 1N1GA 2PX8A 1ENPA 4Z0NA 5JJKA 3NHKA 5KQRA 4K0KB 3OZGA 5ALIA 2I7TA 1UWKA 4G26A 3O91A 1FS4A 5DYWA 2I4OA 2C9DA 1Q0HA 2YZ2A 1IBKB 1HI9A 4R8KA 1UC4B 4RC9A 2HUNA 4RKWA 1U81A 4IH9A 4LBWA 2HT1A 3AE2B 1CWUA 1YJBA 1JFFB 4AI6A 1KY3A 1OBCA 2WFZA 1O5TA 2XVXA 4ND6A 3NEAA 2X15A 5JMPA 3P2OA 4EVQA 4C04A 1Q95A 4CM4B 4D8YA 2GPTA 3ZE0B 3B5IA 1GPUA 2XKKA 2BKLA 4ABYA 2WP0A 4HDCA 4RGOS 4JJ4A 3W5VA 4TL6A 2CL7X 1L1RA 1GPNA 4MROA 5GMVA 3ESRA 4ZEWA 3SJ7A 2PY6A 1J20A 3B2FA 1A2KC 1ZPSA 2M1ZA 1RJEA 4AN1A 2ALJA 1P2VA 1VPWA 4JBHA 5DHQA 4P0TA 2NBVB 1N2CA 5HKAA 5EJ8A 4M89A 1XSEA 1GTVA 4WXHA 2PW9A 3G0BA 5EXPA 1HTTA 3AOEA 1J06A 4DK5A 5I9IA 3AEXA 2JC3A 1G8HA 3I9NA 4YJHB 2FP4A 1Q77A 1RC0A 1PGXA 4LJKA 1EM6A 6ABPA 4TLMB 1NVEA 1PDWA 4J7CA 3WLJA 4FYWA 2EKPA 2OCPA 3DMHA 3BJEA 3N2ZB 4UNNA 2FFHA 3AUFA 5D5PA 4BZPA 1U0BB 2KWDA 1E5XA 4C4SA 2HREA 2ZJYA 2O5RA 3KQMA 2BMVA 4MEJA 1Q83A 4BJ3A 1SIJA 4UOEA 2HTFA 2NSJA 1KDZA 1WH3A 1ND6A 1EFAA 2FPLA 3S2SA 3CO5A 2H4HA 3IV9A 3ESQA 2VHVA 3HWSA 5ENVA 3BINA 1EYZA 4MWZA 4PCAA 3QEBZ 4CDNA 4RCVA 5G1NA 3I09A 3DZ8A 5AMXA 1DBRA 1VL6A 5L40A 1FXUA 1KOLA 2CFSA 2I8LA 3COZA 2W9XA 3BMNA 4I1YA 3EGIA 3GFBA 3T5PA 5DXAA 2W37A 2XODA 1RPTA 1X7WB 4BV8A 5ALJA 5I7SA 3NS1A 1R0SA 2ADOA 2II6A 3P8ZA 3GNTA 5AIBA 2Z3WA 1KVQA 1J1UA 3AE6B 2IV7A 3S1AA 3AEBB 3PEFA 4DHWA 5LMUB 4XM0A 4IIHA 2O3RA 1RYNA 4N5DA 2FRVA 2GCGA 1C3EA 1JN0A 4I8IA 4DV2B 3P0EA 2Z8XA 3TQOA 4LZAA 3OLZA 5TX7A 1YI8A 2XJ9A 3HC7A 4M86A 3FZYA 3Q3VA 3ZIAA 1JWUD 5M7EA 1Y1SA 1E3TA 3ONNA 4XGIA 1NZDA 3CG4A 4FFLA 3VPAA 3PLNA 4P1BC 4EY4A 2AJLI 5H9WA 2JKYA 2ZB3A 4BVBA 2AEEA 4UD2A 1FSGA 1W2HA 2O8DA 2B37A 2OCLA 1JDBC 5TR5A 4A3OA 2VTEA 2JCBA 2WVJA 3W9YA 1VM6A 2PJUA 5JSZB 2DUMA 3PQ3A 5DJ5A 3HDTA 4JOCA 4J49A 4LRTB 2VKTA 4TZTA 4L02A 2R3SA 4YJ2A 3BE5A 4Q4AA 4O4JA 2Y5PA 2OHOA 1PW7A 5A02A 3T7EA 2C9YA 4O2BF 5AKKA 4IVPA 1NR1A 3M3HA 1AUXA 4J1TC 1EBFA 4K46A 2UZIR 2C60A 2O3TA 1YASA 1KQFA 1IJKA 3BYZA 1VKOA 5CX1B 5JDCA 1NJSA 3G0HA 2GPYA 5AI0A 1M8KA 3TTWA 2QN1A 3H5OA 2J6CA 2QTGA 2WE8A 3FOFC 3K2QA 3GYBA 4YEDA 1CQXA 1W52X 4LTMA 4G25A 1GNTA 2R5WA 1JIKA 3BFJA 1YB1A 2HB6A 1L4ZB 1XO3A 2MSLA 2XSZA 4E6PA 3DR3A 1XMVA 3K5WA 1XE3A 4QXMA 4Q3EA 1BA3A 3X1YA 5ICSA 1USGA 1A4IA 4GPIB 4R2IA 4P4LA 1N2OA 5LQNA 4IUDS 1PLLA 3IVXA 5EOVA 1SMKA 4Y6QA 3AU8A 4EYOA 1DX6A 1YS1X 4MAAA 1ISJA 3G9TA 4BOZB 2EC5A 5LZ8A 3AJRA 5IC4A 2ODEA 2XMPA 3TW8B 4C29A 2ZM5A 1KIAA 4AQDA 4RTJA 1OI3A 1FXTB 3NKVA 1TY0A 2Y9MB 3C1OA 2EFYA 1OBOA 3PS9A 2ZJOA 4OHUA 1YIDA 3S2YA 2W6PA 2BEVA 3KU1A 5GGXA 4UCQA 3KKPA 5EHNA 3G9UA 1KC1A 4I4CA 4GDMA 2WF9A 1HWYA 4NK5A 2G45B 3GOEA 2QTLA 4FX5A 3VRHA 5HGXA 2DH5A 5CVUA 1FP6A 2XKAA 4R1NA 2IODA 1XA3A 1PTJA 1W5SA 2FEPA 5H02A 3PDCA 5FR3A 1XK6A 3L0OA 1GNPA 2ZYRA 4F45A 2QQFA 3S28A 1V5OA 4DV7B 4J0KA 4NPHA 3T1QA 4RVSA 5E6RB 2P2YA 1WIWA 4MRNA 4W9KA 3MJ4A 1UWCA 2YVAA 1UKBA 2ZWVA 4KSKC 2VSFA 5D85A 2C7HA 2WXPA 2I2YA 4USAA 1I2DA 4ZZ1A 2ZRKA 2XYPA 4S1VA 1C4AA 5EIBD 2EZ9A 4N6NA 1XA0A 5JBQA 1WPQA 1M1NB 1Z0IA 2GZ2A 1HNWB 4JKOA 5A06A 3RDPA 3R5FA 5DTJA 1A4UA 1NW3A 3DCYA 3AVVA 1AB5A 3N3KB 2DVMA 1DCTA 1G2OA 1JQ5A 1TO6A 2IYOA 5FJIA 2A58A 4KE6A 1RABA 3GLTA 3BKXA 4DDID 3VH4B 1NA5A 4Q3DA 5AVXA 3H8VA 2C1XA 1I5EA 2E89A 2P2GA 3P4RB 4YRIA 1L0XB 1G8MA 4DQ0A 1Y6JA 4UVIA 3GVXA 3V00A 3ZDZB 5M5BA 3B52X 2GB4A 4ALMA 6CHYA 3TCKA 1RXEA 1N34B 2ICAA 1QVWA 3OLCX 2PRIA 3ORHA 1S1CA 2A9PA 3U4QA 1DCFA 3CPHA 4BU1A 3GLKA 3DDUA 5A5FA 1M94A 4D0RA 2O5CA 2Q46A 2WFLB 3M5DA 3DWIA 3Q8CA 5EIBC 1QT9A 1MRSA 1GRRA 4IDOA 4YRFA 4UREA 2ZYAA 4P32A 3RYIB 1KSHA 1U2GA 3B1XA 4KSLC 4ASUA 4BVEA 1CK1A 1KH1A 3WRXA 2K0PA 3IDZA 4BEWA 2NVWA 2BBTA 3RNCC 4DA7A 3V1LA 5B1HA 2OC9A 2WAAA 4M98A 3WGJA 1R5OA 3D4PA 2EHDA 4V03A 3WRYA 1E4EB 1OZHA 1VLVA 2QIOA 5EWMB 2I1JA 4NE9A 2CLCX 3GR6A 2D3CA 1RTTA 1UIRA 1U5CA 2EFDB 4XGQA 2WM3A 1S6YA 4D9EA 2X86A 4B17A 2YN2A 1CKEA 3HO8A 2JNWA 1CY0A 4QUDA 4BFSA 3VR3A 5HMLA 5DULA 8MHTA 1YL7A 3NRCA 1ZZEA 4B6GA 3TLKA 2FQ1A 3R76A 2HJVA 4U02A 5LOVF 1FJGB 1N2XA 1QM5A 2MMCA 3DAOA 3PI7A 3G8AA 2BKUA 3P9NA 1AVTA 1S3FA 3OZAA 1AQ6A 4AN0A 3L7NA 4M9SA 2RDHA 5DHTA 5JSYA 4RZIA 4WA7A 1U5BA 3EPRA 2FOLA 2H9AA 4BCBA 2PQ0A 4UEQA 5IKOA 5KEIA 3Q6IA 3QVWA 1ZNQO 3PV0A 4RPKA 3RUDA 3B6ZA 2XUKA 3B89A 1XN1A 2PXHA 2W54A 1Q16A 2JFYA 3KR2A 4MSQB 3RYTC 3ZE9A 2VHQA 3L4SO 2AFVA 1EMDA 3LW7A 1WDLA 4ZARA 1RYMA 1SUEA 3TLZA 3HR8A 2PRJA 1ZUHA 2X5NA 4LWOA 1WJ6A 4Y0NA 2JEYA 1D5ZC 2IVFA 4J03A 3CBQA 3EA6A 1Q3HA 2AFRA 3A31A 1E5WA 5L3RA 2WEKA 1B9RA 1JQKA 4DZTA 3T9CA 4ZQBA 5FHRA 1U02A 3H3JA 3WHKA 3ETLA 4DQDA 3OWOA 4M1KA 1XMQB 3W1SC 1ZI9A 5JSZA 1VRVA 1L7RA 3HB9A 3IOEA 4P5PA 4D6XA 2WZQA 4QX6A 3N2NA 3DVGY 4C0LA 1KDOA 2EJCA 4F8EA 2WXKA 3BFVA 2H52A 3CWZA 4HKZE 4Q34A 1GJZA 3PZ7A 4V1CA 2BYEA 1QK4A 4M9ZA 3QKUA 3A4VA 1VLBA 2QW1A 2EAUA 4ZYLA 5CX1A 5BV0A 1B2RA 1T9GR 3IDQA 3C15C 2VF5X 1PWZA 4UFOA 3TEWA 4IWQA 3D54D 2LGDA 2O2GA 2V3VA 4YAJA 2W11A 1V7QA 4WLEA 5AJHA 4WASA 2JLBA 1BHSA 4N01A 1ZICA 5JHAA 1BFDA 2JI6A 2GGSA 1Z2CA 3DMDA 3QWZB 4J7AA 3HCFA 1JJVA 2M6LA 1WXMA 1Z2AA 3ENZA 5LJIA 1K9SA 5I7WA 4JEIA 1YTLA 4IWPA 1ZN8A 5LNK6 5KWJA 3EAGA 3GH1A 1UKVY 1YDFA 2R8RA 2XE8A 1UADA 1F1JA 1QAQA 4EHNA 5BV7A 4FGJA 3U7HB 1WRBA 5KTNA 5F98A 2P2CA 2HLDD 2CZQA 1MHHE 1ZGZA 3X1ZA 5I9NA 4ZDJA 3DO6A 4ITVA 3A4YA 1HK7A 3NOXA 2PJZA 4JE3B 4MKHA 1UMDA 4FFRA 2VSOA 2Z04A 4AKSA 3KWVA 4C4RA 3RC9A 4ILEA 2JAHA 4PLZA 2AF4C 3BIJA 2BWJA 5IUNC 2C92A 2H07A 2VJOA 4B4UA 3TQQA 3WGNA 2XTAA 1Y9ZA 2WQYB 1Z0AA 2A67A 1A1VA 3Q2OA 1WKVA 2OVFA 3UMYA 3RM3A 2CLOB 3IT4B 1R4MB 5AIAA 4OYHA 2WNMA 3L0ZA 2F3TA 1EEHA 2OHJA 3RIMA 2VYND 3QE4A 4IIYA 1MC8A 4CT5A 1TQDA 3JWPA 4HGQA 5HUJA 5DHUA 4PZPA 4P1ZA 4YB8A 3LQ1A 5LFAA 5L51A 1FQKA 1ID8A 3IUQA 4O4HB 5B6JA 1ZH8A 1JIQA 4NBLA 1GRVA 3BJZA 2Q6VA 1Z4OA 4EI8A 5C5EA 2Q1WA 4BMSA 2X8JA 3ZHVA 2QRZA 4NBKA 1AY0A 2C03A 5SV2A 2VJQA 4BBPA 2Y9PB 4K9DA 2YKGA 5E2AA 1TO1E 5T8KC 3FSRA 1R6TA 4BNYA 2ERCA 4DMHA 4MB2A 3QF4A 1ZMTA 4C06A 1T8SA 3D2BA 1T43A 3IUJA 3RBXA 3JQBA 3CURA 1SD5A 3IPRA 2W82A 1WHSB 2MINB 2X0JA 3KUDB 4R1UA 1I4GA 1QOAA 3WS7A 3GLRA 3G8BA 1W2WB 1JWBB 2XMGA 3L4EA 3KVNA 4E15A 1VP3A 3PRMB 2EBHX 1G3RA 3J9CA 3CIFA 1QF6A 3WLEA 1GDTA 3B3GA 1GT91 3DBHI 4K7SA 1MG5A 4OHPA 3Q6NA 3UK2A 3WALA 3R7LA 3TB6A 3P4UA 2VNIA 4EDFA 4PRZA 4LCJA 5MDHA 5M04A 1JG7A 1GPYA 3AINA 1U4OA 1Z06A 3QVOA 5A2GA 3J81A 3HNPA 3SQDA 3BZBA 3PNLA 5JXJA 5IVKA 1TM1E 1U8FO 3B6JA 1Q2XA 3FILA 4I7EA 1ATIA 4H1TA 2XA1A 3FNBA 3CRW1 5ECGC 2O6VB 2I3ZA 2I3GA 2FW1A 3HJRA 5IBCA 4L2IB 4RSGA 2I91A 2ECFA 1E4EA 3TR5A 3NFYA 2OZPA 2B61A 5ALGA 3H3XA 1VKRA 3IURA 5DLQC 2FY8A 2OYCA 1DI0A 3UVEA 1E9RA 1RYYA 3NOOA 4WZAE 3QX3A 5BPFA 5LLTA 1DPFA 2WOOA 4O3FA 4WL0A 2UYHA 1E5QA 1I3OA 2J0EA 1NRIA 1JROA 1AUVA 5BYSA 3T7DA 3KEGA 4FHEA 1CB0A 2IZVB 3K9NA 3UH0A 3IE1A 2J7QB 2CR5A 2GEVA 1ENYA 1LF5A 1RP1A 3F4KA 3DDCA 2VF7A 2F00A 3UWMA 1BYUA 3HDVA 1C0KA 121PA 1YR9A 2GK6A 5EEGA 4LK2A 5B2FA 1ZMRA 1BT0A 4OTZA 2JKZA 1G4HA 4WCFB 2HHJA 5CIWA 1KNQA 5DTQA 2YZMA 2Y1LA 3C3WA 2ET6A 2BHLA 3ZLVA 1O94A 3SEAA 5KX5F 3M1AA 1YN5A 1PVVA 4JGIA 3RUIA 2ZVOA 1ISFA 3ZO5B 1NPDA 5GZ6A 3N76A 3RSOA 4FW9A 2FTKE 1IY0A 4R5MA 1JTEA 5FULA 3VKVA 1JU4A 4ERNA 1RVV1 2NZUG 1V6AA 4KMSA 2DE0X 2DFPA 1FNMA 2VLBA 1K06A 5D01A 5LYJB 2BMDA 1QIMA 1PL8A 1LBQA 3SEZA 2J48A 5BRAA 4UMVA 1IZ7A 4Z7JA 2AKEA 1H8ED 4LNIA 1TU0A 1PLKA 4YYEA 4RJLA 2I03A 4XVHA 3T3GA 3HXLA 3KO8A 2RHDA 3H5WA 1KEKA 1RWVA 2ATVA 4RVFA 1GTRA 2P79A 2JVJA 3O8BA 4J1NA 1VPDA 1P77A 1D6JA 1SJED 5LB2A 5JYCA 5TQVA 4YAIA 5EMLA 5DEIA 4IKGA 2XWQA 3ZR4B 1ODFA 3OTOB 1DG1G 6Q21A 3KOXA 1G291 4QBKA 2UXDB 1WQ4A 4RQAA 2PN1A 2IUYA 3ENQA 3MTNB 1NY5A 4ZJUA 2X1VA 2XBUA 2ZUCA 1FZTA 5GP1A 3TJMA 1RHRA 1GN9A 3K20A 5ESRA 1H22A 4MI1A 4F5DA 3CFYA 4EM6A 3F6BX 2JYEA 1Z37A 2CNWA 4PLCA 4Y18A 1NF8A 2DMRA 3QLJA 4ARSA 3FWPA 1QGED 2QDKA 4I3FA 1AXGA 4MARA 3GPDG 3RSCA 3LRXA 5KINB 4NICA 1MTOA 4JYCA 3ZYYX 1BNCA 1JPUA 4P58A 4TWZA 3S1LA 4AF7A 4D0GA 3UAVA 3IESA 3IVMA 1EVLA 5LQSA 2K87A 4OGWA 3DTVD 3FLEA 2GILA 1U1IA 1Z34A 2FR8C 4H17A 2VQFB 4MS1B 5TT0A 1NBIA 3QKSB 1XQ1A 2V4UA 2R2GA 4L5YA 4DDMA 2A5YB 2BYFA 3MWLA 1FDWA 4JT8A 4OI4A 4WXMA 3CMMB 3K4PA 4HDNB 1SKQA 3PXUA 2DJ5A 4Q3LA 4HQFA 1FNUA 2B4RO 3ZQUA 3QPDA 2IBTA 3RO7A 2Q2VA 2WXRA 3GVPA 1XTKA 1E0DA 3NOBA 2GN6A 1IB6A 2Q3EA 3B9BA 1P61B 1CUZA 1R4MA 4KRYA 4DMRA 7ADHA 2N9UA 3WB0A 4IHJF 3P7MA 3TW0A 4GGPA 1Y42X 2AYZA 1UF0A 4L1BA 5BQPA 4TLBA 1HA3A 4OW0A 2B3DA 1TEXA 1R8QA 2LGJA 1H0SA 4I9UA 5JCXA 4I8DA 2VQDA 1Z4JA 1T36B 4DFDA 3EARA 2BPOA 3T7SA 1YR8A 3UM9A 3KZKA 2EBFX 1EWQA 4F6RB 2I4IA 2LWIA 4Q9JA 4RMGA 2P7IA 3HM9A 3ZIDA 2Z57A 2Q5HA 2B82A 1W87A 2JJ1A 4X6UA 2HCJB 4P7GA 3JWHA 1Q5PA 5JPDA 1EB9A 5CIQA 2WXFA 4NR0A 3OFSA 2Q4OA 2ACKA 1SGWA 4C14A 4U5QA 1F3OA 4JLOA 2PGAA 1TTPB 3X2FA 4IO1A 1AHNA 3FGPA 4Y6LA 3RWBA 1TT7A 3EXG1 1F4PA 4WH4A 1D5CA 3P4QB 4LQLA 3KUDA 4OK3A 1HE3A 3RU3A 2XUPA 1VMEA 1E6UA 4FULA 5ITWA 2OGZA 1OLUB 1SBQA 1YHZA 4HT3B 3N8DA 4LZOA 3KWJA 5AW5A 1QHNA 2RGYA 5KOJB 4P92A 3OX2A 2CFIA 4IXMA 3ISTA 1ZVJA 3PLAE 1FFBA 1XJWA 2BKVA 1S89A 1O8BA 4YJ3A 3GLHB 1PZEA 3FDJA 4G0PA 1QIKA 4PTZA 1M2JA 1YO6A 4H0CA 3G5TA 4R9SA 1BOFA 4DR3B 3ZCQA 1B93A 4MO2A 3F0TA 2FWAA 2E2WA 2E4UA 3R1IA 1CQJA 4G1CA 1C8BA 3PEUA 4R05A 3LUKA 2EQBA 2H65A 2P9BA 2ZTLA 4HTFB 5JAZA 3NP7A 1X86B 5FTLA 5K1ZA 1GB1A 4X8LA 1TQ6A 3W5AA 1Q14A 2AFHA 1JYSA 2YMQA 3EGVA 1HETA 1U65A 3OT1B 4LNNA 1OB5A 3S7TA 2W4MA 1R15A 1ZW1A 4ERXA 3BBPA 1TQ8A 4TZ6A 2ZJ3A 4CMBA 4QOIA 1FB5A 4RD0A 3P1JA 2CCGA 3THXA 5ALRA 3N87A 5GJBA 4FGKA 4RK0A 3C5CA 1WM2A 5FBQB 4RACA 3LTNC 1DTWA 3R8XA 3WGUA 2JCYA 3DWFA 3GDOA 3FYHA 3NBKA 4ZWNA 3G5AA 1WGYA 2PTLA 4R2LA 2Z4RA 2JJ2A 3O26A 2ODBA 4MT5A 2PKRA 5BSRA 1MORA 1EP2B 2H06A 1AWDA 1NLFA 3KAPA 4BVFA 1PZNA 5CT5A 1FCLA 3F7TA 3PP8A 3KKQA 4KOAA 2VPTA 2JH3A 3TSWA 4B85A 3SQMA 3KKZA 2WD9A 3NHWA 4PFJA 4QA9A 2KMLA 4ZT2A 3U3DA 2VUUA 3FYCA 4JI6B 5LL6P 3H9QA 2D1RA 4BZQA 5F5LA 1AC5A 2OXFA 4WY5A 3KJHA 4PW0A 4BV9A 1X7DA 2AMLA 1WVIA 3M4NA 3F3YA 3AU4A 5EMNA 3LLMA 1K4MA 3DHYA 2R8PA 2AEJA 1UGMA 1PR4A 3WGGA 4TTAA 3W6ZA 4NYMR 2KQ4X 2QNRA 5F64A 4PYNA 5TMEA 1EFLA 4J2TA 1VKHA 2WKSA 3E61A 4HUTA 1BDIA 2QTCA 3IMCA 3RF6A 3EDMA 1PSDA 1MDBA 5LYJA 2ZQYA 3TSAA 1QFZA 3WZMA 3JX9A 4OM7A 1M2OA 3SHFA 1SURA 3HJHA 3MWDB 4D9JA 3ZHSA 4AP4C 4W99A 4KPUA 5K6RA 1PJAA 4F4UA 5BSKA 5JXWA 5E7MA 2GOWA 4LIPD 1G16A 2OP0A 4AULA 2ZR7A 2RI1A 1DO8A 2PMFA 3ETGA 4MUAA 2MJDA 2NXEA 5LA6F 2H1LA 2YLMA 3L07A 3BXOA 2A1TS 3K72B 2FXIA 2HNBA 1GNQA 4K6FA 4HATA 2OAEA 4HPPA 2FUKA 3ZNQA 5CYGA 1C1DB 1FLVA 2NO4A 3SXUB 4G0NA 2LDBA 5DYTA 1Y8RA 3N1ZC 2A9VA 4OXIA 3UV3A 1RZRD 1AQNA 4K26A 4X3PA 3CVVA 1B1ZA 4M0FA 3JQ7A 3QHPA 3FY4A 1CRLA 1IFXA 2VDVE 2J0MA 2GA8A 2OK7A 3QEMA 3AF1A 2C20A 3WWPA 1KO1A 3KEQA 1Y5RA 5HKKD 2PFKA 3QIAA 3SYNA 5JSHA 4AROA 4GVPA 1XAGA 3E8XA 3MJDA 4KKXB 2ZBDA 1E9VA 3JAWA 1SE2A 3SQOA 2RGCA 3PYXA 1AYFA 3BK2A 2GPBA 4WIPA 5ALWA 2WWFA 1Z25A 3NWJA 4FYIA 5JMTA 3KBOA 4IH4A 1ONBA 2GD1O 1D8TA 4ZDWA 1ESMA 2CLSA 4F11A 4YROA 4BQPA 5JMWA 4P16A 1SA0A 4X6LA 3W5VB 1A9XA 4JSTA 1SBNE 5HJ2A 5IN7A 2BGGA 5IKPA 3X1XA 4CWAA 6LDHA 4BAUA 2ZSFA 4AZ0A 3EIQA 3TNYA 1MC5A 1Z2OX 3TMKA 4PO9A 1U11A 4TMKA 4XGNA 1HQYE 1BWQA 3G02A 3OZRA 5BR7A 3IHWA 1OIVA 3JAKA 1TTNA 1DUSA 2BRUC 1N2CB 3HR7A 1EI9A 3S8YA 3LD9A 1ZJYA 4RTMA 4G63A 5A71A 4V0KA 2D7CA 4EJ6A 1NQTA 4PC7A 3FJOA 2FP4B 2XR1A 3WSVA 1KSJA 4XW2A 4OQNA 1T4GA 2GWHA 3MLBA 1E77A 3V1YA 2WTEA 1ECJA 3E7FA 3IT2A 3C8UA 2Q29A 1NN0A 3O90A 3I42A 5I7AA 3TVDA 4OBWA 3ORYA 5JNLA 2AZTA 2XBBC 4RFSB 3V8NA 1JR3E 3PTLA 2QAGC 1DRJA 3PPIA 5CRIA 1LU9A 3V6CB 3OG5A 2PNFA 3MS4A 2G6BA 4JP2A 1DPGA 2MBQA 3VO8A 1CDZA 1K0UA 4D92A 5KQPA 4XYEA 8OHMA 4KR9A 4FBMA 1L4BA 1KWKA 3FZEA 3SP1A 2ZGVA 2DHDA 3WJ7A 2QR5A 1LD3A 3U7DA 3RAJA 4YAGA 1ID1A 2R6R1 3ESBA 3MWGA 3BMNB 3QE2A 1B8VA 1YR2A 4NHEA 3VR6D 4CHGA 1BU5A 4RIEA 2V7UA 5E6SA 1GLGA 1QOQB 1V6SA 4U5XA 3VYRB 3JD2A 2PAAA 4JV5B 4HYEA 1JH8A 4LY9A 1T5XD 2XTZA 5BT8A 2CFCA 3S1AB 5DLDA 3PVLA 1GTG1 3S2ZA 1RQLA 2CB9A 2ZR8A 1U9ZA 4BKRA 3KZVA 4HWIB 2J4XA 1PF7E 1JHYA 3AK4A 1P75A 3L18A 2A5LA 2AJTA 4YX9A 1TECE 3MQ4A 5CJJA 4CG3A 2FQXA 1FRFS 4NVRA 3N2IA 4CUJA 4WWHA 5B57C 1YCDA 2Q5FA 3C3XA 4EFOA 4H3SA 4D9HA 1X14A 5CTRC 1UJ6A 2JLWA 3FLBA 1NKVA 3KDPA 3KSRA 1B1CA 2PKXA 1FP4B 4LXHA 2LW7A 3PJEA 1E89A 3FPFA 3R8CA 1GPH1 4V2UA 1ZKHA 5DE3A 3RU2A 2OLJA 2KDIA 1KKUA 5IH7A 2O8DB 3MJWA 4CMKA 5IVIA 1RXUA 4IS2A 2NYVA 4NCNA 1SRRA 2G09A 3UAXA 3GV0A 1G1AA 5E9JA 3A11A 1SOUA 3QU7A 4MGIE 3V48A 1D6NA 2EZ4A 4PQEA 1VBKA 5FI0B 1KH3A 5CNIA 4YJ2B 2SKEA 4Q4AB 4O4JB 4K9KA 1ZXXA 3O47A 3GF4A 1NKTA 2BGLA 1A5BB 4RGQA 4DWVA 4ECAA 3SEQA 1K6EA 4AJJA 4BAZA 4FEAA 4Q24A 4EG8A 1GAXA 1SOWA 1U0HC 3RVKA 4YRJA 4OCZA 1OD6A 2CU3A 1UT6A 4IIJA 2NN3C 1AO3A 5KDOA 2JX5A 3BHIA 4N1AA 3LCMA 2AYYA 4I50F 4LTDA 3HMKA 4BLUA 1EZZA 3MJSA 1F2RI 3VAYA 1EB8A 3PPAA 3M6WA 3R5SA 5F3RA 2V7VA 1PR6A 2CV1A 2PV7A 1YTUA 3S5UA 1IE3A 2L1AA 1UOPA 3W3AH 4FHJA 1I24A 3MIZA 1D5MC 1DOIA 2XLCA 1RBYA 1LF0A 4PVDA 2Y0CA 3QTLA 1BMTA 3GN1A 2KW5A 3TSZA 1QBGA 5I4DA 4MSMB 4WW0A 3DOOA 2ONKA 4WNYA 1RBMA 3IBYA 3ZE1B 1J2JA 1G6KA 3S1SA 2AD5A 4I55F 1LVGA 3O2NA 5IVHA 3I2FA 3HRHA 5HQJA 3UJHA 1E62A 4YLEA 1HMYA 4HH3C 3EEBA 1A5AB 2PGIA 3W5DA 2W2NA 3FR7A 5JMOA 4JELA 1LSJA 2Y0EA 1T1GA 2GN2A 1AKWA 3G7NA 3U1VA 4A16A 1RI3A 2BZSA 5BWNA 1XLQA 1PZMA 2RKOA 4RM9A 2Q1TA 5C7YA 3W77A 3VKUA 1U0JA 3ORFA 5BV2P 2DM6A 1UJ5A 2F3SA 2X13A 4IIUA 3TTUA 4DQLA 2QV7A 2X0FA 2HA6A 5EESA 4U7HA 4I1PA 4PS0A 1YKSA 4X7PA 1FDIA 1TEZA 1IY8A 4KDEA 3AESA 4BKQA 3QUQA 2OWEA 3M6XA 3CSSA 2H5IA 3SXUA 3SD5A 4R68A 1WETA 4J29A 4KN9S 5MFZA 1W75A 3IODA 4EHFA 4BKGA 2W58A 1T0BA 4NBVA 4S0XA 4WFQA 4ETMA 2Y1DA 2Z8YA 4MKGA 1QB8A 2O23A 5K0CA 5CX3A 3HHEA 2CNLA 2CD9A 2XX3A 2IYZA 3MUOA 5HJEA 4KTTE 4EA6A 5JV5A 4Z2YA 5KNBH 3NG1A 2V9HA 1XAIA 2CXHA 1MPEA 3Q8AA 4BNWA 4A0RA 1O9HA 3F74A 3LK6A 5CU7A 2XMRA 4V3CA 4KWCA 3DZDA 3HBLA 3E5HA 3N86A 5FKJA 1VRCA 2KANA 5J2RA 1DQNA 3T38A 2P4UA 2F7SA 4OI2A 1GL9B 4GDLA 5L95A 1CPYA 3NHEB 1G3QA 3RR2A 4LHXA 2N3ZA 1QYVA 3MT8A 3CVYA 1R6UA 4F56A 1PQSA 4ARCA 4ZQGA 1X80A 2HXSA 3U4QB 2VH5R 4IO0A 4FILA 5DTIA 1ZUWA 2Q1XA 5H0IA 2H59A 4RFBA 4TSFA 3HPRA 4YPOA 2VG8A 3ZQJA 1WXFA 4ZCPA 4GL4A 1JLLB 3OQ1A 4MLZA 3RU9A 3ZOKA 4DILA 2O05A 3VPGA 2CC2A 1QDEA 1ODLA 1Z82A 2ESRA 1JIUA 3H19A 1XEFA 2VDNB 4JOQA 1RHUA 3NALA 3B1VA 2FUHB 2PD6A 5KJ1A 2QRHA 2MP2A 5EHIA 4UUNA 5DM1A 3ICVA 3I5XA 4RFSA 2BTEA 2F3PA 4N5HX 3ZHTA 1VXOA 4HMPA 3WP1B 5JQGA 3FYTA 1IUNA 3KEMA 4B5LA 4RGVA 1JIIA 3F3SA 3RJZA 1KAHA 3LH5A 1K5PA 3T54A 3A32A 5DTMA 3UMRA 1VMAA 3TOSA 4UUOA 3U5TA 2MJLA 1HYBA 3RBAA 3VUEA 4LUCA 2D10A 4EOYA 1G7SA 1RYDA 1JKFA 4YXDB 3I2HA 1Z47A 4JJEA 3F3MA 3HWRA 4Q7EA 1U5BB 1N60A 2OFFA 2VRBA 3OWEB 2C2BA 2JGKA 1CY4A 4H7FA 4JYPA 1FDVA 2P77A 1BE0A 2A92A 2GBLA 3AHDA 4NQZA 3CH4B 3BVZA 3OU7A 2XDAA 4E31A 3UENA 5FAKA 4IFEA 1PNOA 3GFPA 1DOAA 4W82A 4PYRA 1JAHA 5E4FA 2NPIA 1UGJA 2FPPA 1FP4A 2XCIA 3D3WA 4CZ2A 2XUZA 1OWOA 3IQHX 1NRJB 5AUIA 4XPIA 3VTUA 2O07A 4QDXA 1XLWA 2DT5A 4OL9A 4FFDA 1IL0A 5FTMA 1TC1A 3LE8A 3HU2A 1FTNA 3ML8A 2JFXA 3KQOA 3JQFC 3RSFA 4CYMA 1CUAA 3HHMA 3L02A 4AOFA 2BGRA 4IICA 3HB7A 3F2IA 1IVNA 3CMCO 3OQPA 2EX4A 1I4PA 3TRKA 1H4QA 1WMEA 2RHMA 1UR5A 3MYRA 4MJ7A 2ORYA 5LNK1 5EP3A 2X8XX 4V1CB 1SU4A 5IS2A 3EXG2 1DQPA 3OF2A 3UJ6A 1ZKDA 3EZ2A 4HNVA 1CQWA 1D09A 4YP1A 3RHSA 4I4IA 2Q3FA 5FUXA 1MEOA 3ZY6A 3ZTDA 3VHTC 3TLEA 2GN9A 2IWRA 4KFCA 1U1EA 4I5FA 1WMDA 1GUDA 2CJOA 1V8OA 3TUJC 4F04A 4FGLA 3PZ8A 4RXTA 1GCIA 2D2QA 1P80A 3H5IA 2ZWIA 2CHEA 3LT2A 4W7SA 5FNZA 5HF8A 4Q93A 4CIXA 4PT5A 4WESA 4MDFA 3JQDA 2WYIA 3HM6X 3W7VA 2Z6AA 1FD6A 1IN1A 3GLHE 2BFCA 2PANA 5FBWB 1IZ0A 3GLIA 2P9QA 5DIZA 2WU5B 2H57A 4X6YA 3WRWA 2Q3JA 3HGTA 3T9FA 3M3JA 4ITKA 5CH3A 3T06B 2WXGA 4QRDA 3I58A 5HCNA 2N1BA 4UNPA 1UMDB 2OXRA 3ZWBA 4HKTA 3CRQA 2PS3A 3KXKA 3OIWA 1VE1A 5JSKA 4HHEA 3TSCA 1Q22A 4DYDA 5LMNB 3ZZ0A 4EKYA 4ZOQI 3VNUA 4CDRA 5P21A 2XNKA 2F9MA 4DE5A 5CHFA 2G77B 3E1KA 3T8MA 1ZIOA 1G3IA 1LTKA 2C3OA 2LUOA 4U7DA 3I1YA 1D2RA 3IJ5A 2G7ZA 2GPAA 2YC4C 1X7XA 1T2NA 5BNFA 2P6UA 1ENZA 3U4IA 3GRAA 3Q2AC 4ML3A 4TVOA 1FFWA 2CF6A 5YASA 1E2QA 3EB9A 3D6VA 3I5UA 1IB0A 3B38A 4D4IA 1I3LA 2WIDA 4RANA 3SWWA 4O2RA 3DLCA 3A10A 3NHJA 4TV8A 2X8JB 4HNSA 2H9IA 2Z8ZA 1D4FA 3JSXA 4OA8A 1P0CA 4WECA 4OXRA 3M63B 1QORA 5JEEA 4ILKA 2G5CA 1FNNA 4L4SA 1U5AA 4LC1A 1L5RA 1F8FA 2QL7A 3HVIA 3E70C 3LHSA 1RAAA 3QF4B 1W4ZA 1SVNA 1PGJA 3QW2A 2J87A 4HGPA 1HLFA 4NZYA 4JLCA 4FHZA 1TU3A 3MT7A 3VC7A 1RR6A 3ZHCA 1D4OA 1B15A 5EE5B 4OH7A 3D8TA 1CZLA 1OQRA 2C7QA 1DUIA 4XVQA 1OJ7A 3GZJA 5AT1A 4AZWA 2AMJA 5EKXA 2NU7B 3OPQA 4X97A 2IEGA 1STEA 1TJ4A 1WTCA 2I2WA 3MRVA 5IBRA 4AY4A 3K5HA 5CLJA 3ZKWA 1EESA 2DBRA 2WMOB 1C7QA 3TGWA 3VSDA 1O6FA 3F7NA 1P7PA 2W00A 1BD3A 2J30A 1GR1A 1NM5C 3DFZA 4JB2A 4IF6A 4FK8A 4KFTA 2JAQA 2C0QA 1Z4IA 1KOGA 4D4LA 4UTZA 4ZXPA 3R2IA 3C6YA 2EX0A 1BMFD 1U7XA 2ZRBA 3GCXA 3PNYA 3OCYA 3X23A 1V80A 1TQHA 3UINB 3FILB 1JLLA 2CVHA 3MILA 1Z8NA 2WIKA 2B0JA 4QPCA 4DT1A 4FQ7A 2OILA 4JI5B 4IUBS 3C5EA 4UTPA 2ZTSA 4KQJA 2PIAA 1VFNA 2ZT8A 2MR6A 3OPYA 1ZC3A 1Q3TA 3L93A 4JX1C 5JLJA 1PEKE 4UTVA 4MULA 3RK0A 2GPSA 3LQRA 2J59A 4MKXA 4ENVA 3IUNA 1N6ZA 1PYDA 5EFOA 2AI2A 3F90A 1T25A 1S2GA 4IYJA 4RY2A 3CLRD 2EOAA 1ACCA 3QIVA 3WY9A 4BAXA 4PLTA 3ZZUA 2XUHA 4GMKA 2OBLA 3TMYA 3VR2D 3MUNA 3GCDA 1XL0A 3KOMA 2IT1A 3OWHA 2OV1A 4DWWA 1M76A 4FHKA 4IVRA 3DDCB 4DBZA 2OSBA 4C4TA 1CQPA 3OTHA 4RY0A 1JHRA 3RRJA 4D44A 4GSLA 4RXUA 5C4MA 1Y3BE 3P0IA 1RJ9A 1NGSA 2NW6A 3GNLA 5FR6A 1YZNA 3W7AA 4X1OA 3CKYA 3RUIB 3JALB 4BV2A 3WGHA 2VO1A 2J53A 1N9KA 2PUGA 1QZZA 1KXZA 5E1DA 4ZEXA 2H7CA 4FKBA 5KUTA 5K2OA 1V8ZA 2H51A 1OIXA 4K8OA 3ILSA 3VI3B 4KDLB 4GX5A 4HVLA 3KL2A 3REGA 3B3JA 4JC4A 1CF4A 1Y37A 4TM7A 5GGYA 3CLRC 2O1EA 1H0KA 3N1YC 4R41A 2JIOA 1KJQA 3OJXA 4L3WA 3DHNA 4A7PA 4OB7A 1IUOA 1I3CA 4JN6B 5DZSA 3G1WA 1WEHA 1FFUA 4ZC1A 2KZRA 4R7ZA 4Q1EA 1O5OA 1BDMA 1VHQA 3C6QA 4M0KA 2FPOA 1Z22A 2QB5A 2YOHA 4EQ6A 3GXOA 4YT0B 2GJ8A 4CV3A 1W8DA 5J1TB 2LIVA 1G9XA 2P68A 2OV3A 1XPJA 5E6JA 4DQXA 4OIFA 3HJAA 2QX7A 4QU9A 3K92A 3KDSE 1IJFA 1WY8A 1X9HA 1Y8CA 4BTLA 3CGGA 3QLEA 4I1SA 3JVEA 2PL5A 5J63A 2N9EB 5F33A 5IA7A 1BWRA 1Y5LA 2OXCA 5CB4F 5C7OO 5G0VA 1U98A 2AX3A 1YQEA 3FMOB 3RCBA 3EBPA 3VYTB 4EGJA 4LMAA 5J2UA 4BP1A 1OFTA 1R4NA 2VBFA 2D54A 1RZ3A 2H1OA 4Q7MB 3OTGA 2ZRAA 1XD3B 3PXEA 4D57A 2X0EA 4XDGA 3EZGA 2EKLA 3DVGX 4QEZA 1QP8A 3OZSA 4ZI2A 2FMIA 4FBGA 4WV3A 1K6XA 4GOJA 3GB9A 3T3MB 1O89A 1AUOA 2R00A 4MUKA 3SIWA 4B3FX 1E0KA 1OHHA 3EEYA 4OY3A 2FW6A 1XI2A 3B8EA 3H1BA 1QX3A 3L1IA 3WHIA 1UK9A 3Q3JA 5EINA 3SR3A 3HLYA 3A1QA 1YR6A 2XDWA 4LJYA 4BRUA 5CHEA 4N4AA 3WWZA 5KAPA 3R6WA 3DDWA 1FU4A 1DEXA 3KT3A 2FQQA 3RIXA 3BQMB 5CDGA 3DBVO 4F3CA 4D8VA 4RMAA 5KJEA 1ZXIA 4MPDA 2NO0A 3WLRA 1UBCA 4FW8A 2HPAA 3M34A 4PZ9A 3TL6A 2JRHA 3ZEIA 2D2XA 4UHEA 2AL6A 4E09A 4B6PA 2GYUA 4I5IA 3L0SA 3E27A 4O0LA 4DR7B 1R10A 4BRWA 1JG2A 1QDUA 3RTCA 1RYFA 4CEHA 2W5UA 3ZZTA 3PFCA 2BFNA 2G82A 1QR6A 2H9YA 2YHIA 2IDYA 5JHBA 2OMKA 2H0QA 5D5HA 4JEMA 4HH4A 3SSOA 1T8PA 4GU2A 1WUYA 2V5AA 4GM1A 3KD2A 1CXZA 4R9UC 5MGNA 4OO3A 3JZFA 1C76A 4E2YA 1WV1A 1ZA1A 4CU2A 3IEIA 3S2FA 2K8HA 3GUHA 1NSFA 1HO3A 1PNRA 3L6OO 4UCFA 2HMAA 1TYBE 2Q5LA 1JSRA 4IUYA 1DT3A 1NUTA 4BQQA 2BB6A 3NT2A 1HDYA 2Z43A 5HEKA 1M6VA 3V4RA 2AN3A 3KKNA 5KTPA 4GXBA 5C1BA 2BOVA 4OJQA 1T4BA 2K5PA 4UHDA 3P5SA 2I6TA 1RLFA 2PR7A 3BWEA 1QMPA 4AJWA 2AEMA 5B55A 1E2KA 1VD2A 3GVHA 5GZ1A 4ZMRA 1OTHA 3Q41A 4B2IA 2NU7A 3EXIA 2Y76A 3QHAA 2G4DB 3QSYA 3HKBB 1V25A 1E8DA 4M8SA 2OB1A 4QUGA 5AK6A 4X66B 5M2QA 1OX5A 3NC1C 4OFBA 2XXBA 4YJ3B 4C4ZA 3BWVA 1TK3A 2Q50A 4GO1A 4WEOA 4C1NA 2O59A 2ZXUA 1QTRA 3U0BA 4FM9A 5AJZA 3RW9A 1EX6A 2GF2A 1CQJB 4BBZA 1FMFA 4UQPA 4DA6A 3VBCA 1TVMA 2VJMB 3PNVA 3AKCA 1EFKA 4FR2A 3WAGA 2H4YA 2WYUA 5E8JA 3TI7A 1QCCA 2NZYA 2AFHB 5L3QA 2BB5A 5AHXA 4FIZA 3GEGA 1HTBA 2GOYA 2N7DA 3DMTC 3B78A 1TIBA 3BL5A 2EFGA 4AS2A 4E74A 4BFLA 3IVAA 2QMQA 3MT0A 3COYA 2LXAA 1GFSA 4WBNA 1X92A 3THXB 3V7YA 4WWPA 2PMCA 2LV8A 4W5HA 2WJVA 3VR9B 3UZUA 4DXDA 1DQZA 1T2AA 1DTWB 1U2TA 1UBJS 4LVCA 4JJAA 4IZ6A 1T8WA 1II9A 2QX6A 3CB2A 2R61A 2Q5OA 1H3EA 3W79A 5EJFA 1CVRA 4RD1A 2OKGA 1T2DA 1JG6A 1ORHA 4L9SA 3I28A 2VYVA 4E22A 4NU0A 1XF9A 3ANMA 3AFNA 3OD1A 2PG3A 3HM2A 4I2VA 3BG5A 5AKGA 4PO3X 3HFGA 3VRAB 4GKBA 2CNOA 1KA9H 3FE2A 4PYKA 3U3RA 1FFHA 1OZFA 1VXRA 1BIFA 1ZVQA 2F1HA 4BUJA 4GC9A 3GGPA 3U9LA 1JPNA 4K87A 3JALA 4CIAA 2HK9A 4U8GA 1KFEB 2DECA 2VWPA 1VYHA 5IASA 1EFDN 3HRIA 3RYCA 5H1YA 2XKJE 2R86A 3KQ4A 2R6CA 1A71A 2BEKA 3LUJA 2VP4A 2FH5B 1IEVA 2FR0A 1T6NA 4DRZA 1TCVA 1NENB 4M1SA 3ABZA 4UVDA 1IMOA 5B4UA 2KB0A 4KB5A 1M2OB 4DAOA 4NHOA 2CDBA 1SD2A 2FPSA 3KC2A 3RVRA 3CW8X 4BFXA 4KPUB 4E7OA 3CLHA 3QEAZ 2XAUA 3AH8A 3E9NA 1U3DA 4C3UA 1QB7A 2N9LA 1HTOA 1VJ5A 3AKYA 3NYRA 4MR9A 4UBIA 4HC4A 3LDAA 3Q0EA 1Y1QA 4HSEA 4K5QA 1JMYA 2A0FA 2Q5CA 3L7KA 4C21A 5LXTB 4ZI5A 1T6ZA 4ID3A 3UI3A 2V96A 1QXSA 1FRQA 1UT8A 3BM5A 4CDMA 2VJPA 4YRMA 2BWFA 3A37A 4V0SA 3VUYA 3PXBA 4IFTA 4OF4A 4G4GA 4G0NB 3NHMA 4UW9A 1Y8RB 1O0SA 1DOHA 2JGMA 1UQTA 3V2GA 3JQ7B 4U7WA 3DM5A 5G4LA 1KRXA 3C6KA 3D64A 3M7IA 1Q7GA 2AE1A 1AQIA 3QEMB 2OECA 4PAWA 4ARAA 3D6FA 5ALZA 5U1PA 4OP1A 2IPXA 1T0UA 5GM1A 5E1BA 1UKYA 3HCWA 3JAWB 2WG2A 3QBVA 5JS6A 4Z6KA 4RENA 3R3MA 5B58T 1OXUA 1C4KA 1YJ5A 5H3LA 5CTAA 2PX2A 4P3KA 4JUCA 1E2EA 9GPBA 4DA9A 4LJ6A 1RQRA 1JECA 1Y6ZA 2PMDA 1M72A 4MW5A 5JE8A 1R27A 1NW9B 5H9VA 4JR1A 4MVJA 1SA0B 4B46A 4AYTA 4YAFA 1A9XB 3EVZA 4MCHA 3OLMD 4RH0A 3HJFA 1TMYA 2UUOA 2ECOA 2Z5GA 4AZ0B 4OJYA 1VE6A 4LF9B 3FRJA 2ZWPA 2B20A 4MIKA 1E1QA 5DGXA 2OZLA 3IR5A 4AWXA 3VZSA 4AG3A 4B4DA 4Y9SA 4D8WA 3JAKB 3LTEA 1TIFA 2WX1A 1JUDA 1AMNA 4BYMA 2FWPA 3OEED 2PU5A 5CCBA 4OP3A 4ZU6X 1V9LA 4GKVA 3JD4A 3P32A 3ITEA 4A2CA 2P1DA 4ZRMA 3I9LA 3P9CA 3QLVC 4A8JC 2GZMA 4I1VA 1AHHA 3B7GA 4DHJB 5ECYA 8ABPA 4IHQA 2XGMA 1PQWA 1WKCA 3URYA 2XTMA 2WXJA 2VJYA 3DWGC 3CINA 2QM8A 1QE3A 3SVZA 4NU8X 3R0VA 5FOQA 4OV6B 5JJ5A 4TQUS 2RIRA 1EFUA 1VIDA 4O4IA 4DLWA 4O1HA 4RGYA 2DPHA 4M9UA 2VC2B 3MOIA 3WAOA 2J3IA 1IQRA 4ZALA 2L76A 4K7JA 1WZCA 3UH1A 5ENDA 4WLNA 4N41A 1BMQA 4PR0A 1GJRA 3TI9A 2KS6A 3HE3A 4ZGGA 3OP1A 4PHGA 2YUIA 3ZX4A 2Q21A 1EXMA 2DYOA 3DFMA 4QLBA 2SCUA 4JXKA 2CV0A 5SZJA 4KXNA 3H5NA 3SOPA 3RAEC 2V7QD 4D6PA 3IBFA 2C1ZA 3MXOA 3BAFA 3FWKA 4PC6A 4PZCA 1DJQA 4B7XA 3B82A 5K20A 1GGVA 5E6SB 5BXYA 3A9UA 4MQLA 2QZ9A 2R5FA 4OLFA 2IGGA 4DLVA 1AK9A 4EZEA 5KYKA 3HKBA 2QW8A 4QNNA 2AVNA 4JB3A 3TBLD 5C1ZA 1V11A 4LGVA 3VJLA 3Q8BA 2R25B 4PSDA 2PH1A 5IN5A 4YREA 1QQ5A 2F2TA 2OHFA 5JADA 4BUZA 1LWNA 2X2PA 3DB1A 3OCWA 2FE1A 1AW7A 4BDSA 1MV5A 4L8VA 3TPFA 4YPFA 3TLAA 4IFBA 2VJMA 5EZSA 4TUYA 3M1IA 4HLUC 3ABVB 4FZ5A 4G0QA 4PX9A 3TTVA 3QZUA 4P93A 3GT0A 1AKRA 3M6LA 4ISBA 4RZXA 1M6HA 4D9KA 3EZXA 3R5JA 1N33B 3A6EA 16PKA 2OO7A 4KWTA 3IKLA 1MB4A 1NF9A 2OYRA 4I1RA 2WPDA 1GQRA 3IPCA 4EPVA 4K2AA 2UXBB 3RN9C 4CMEC 1SKYB 5F7OA 2DZKA 1FFDA 2RHRA 5D8DA 1KETA 3NW9A 1KYZA 3TRFA 1WUKS 1Y9EA 2KHZA 1NYLA 4Z9AA 4JI3B 4Q3BA 4KSCA 1JJIA 2QKYA 1MX5A 2QVYX 4GPD1 4IIJB 1SR8A 1Z12A 1CEEA 2FWNA 5AVWA 3C97A 1EP3B 3DZFA 3TQTA 2PSJA 4MZDA 3CM0A 3LQYA 3M6IA 1FSZA 1Q3KA 2RH4A 1IPEA 3IBEA 1HFWA 2Q4TA 1CDEA 1CJSA 3H3FA 4YFYA 2Q27A 3QPUA 1ZHOA 3BYTB 1Q7CA 3SDZA 3V32A 4CIWA 3G89A 1T3LA 2E9SA 2A5FA 2AN5A 4XFKA 4DDWA 3DCNA 1P7CA 3GB1A 3LO5A 1XGKA 3UC5A 4DDTA 3O2SB 1N1EA 4XDYA 2J3QA 1QV6A 2X3FA 4Y0AA 5GMOA 2CUKA 4WDRA 4ZYVA 3HFJA 2KBFA 2NVUI 4JGGA 3KTOA 3R7NA 2FIDA 5EZ5A 5B3AA 3UHOA 1EUZA 3ABQB 2XB6A 4CIDA 1NDUA 4EJ0A 2WXMA 2YZGA 4I9GA 3QIJA 1C9NA 1J7AA 2MYTA 1HE5A 3L06A 4TYWA 4JL9A 3PF8A 5FNVA 3HMQA 2QXUA 1F6BA 4DIBA 2L8JA 3C39A 4FADA 2DGDA 2AG5A 4XM2A 1CUCA 3IDAA 4F4JA 3AJ8A 2EEPA 1YVUA 4Q1VA 1ZJZA 4P38A 2ZJ5A 4HFRA 5FLEX 4J4HA 4RPJA 3W9BA 4ZVKA 3WDKA 1LDEA 1BXTA 2I8CA 1PP4A 3L6RA 2WUVA 2LGYA 4BV3A 3W78A 8ADHA 5K8UA 2VDLB 5CCDA 5JSFA 2GRJA 3PZBA 1XRRA 1TE2A 2I55A 3AM3A 2P6RA 2XPCA 2O8FA 5LXTA 3DTNA 3M2PA 1QKZA 2H2AA 1IH8A 3TPZA 1JZTA 4MCJA 1PFWA 4QVIA 3EJ6A 3UIOB 2EIXA 1Z39A 3AESB 1ZIYA 1G3MA 2DR0A 5COBA 4NJCA 3NORA 5C8YF 3MQFA 4YALA 1QH1A 4CGZA 2P4QA 1IOWA 2PT7A 4Y1RA 3TS1A 1JMKC 3ZY2A 2REXA 1N2IA 3T4UA 1KKLA 2HD5B 3ZVVA 3I45A 2D5GA 1CF2O 4Y3UA 1U0FA 1A8QA 1NEKB 5TPZA 4JDUA 2F3QA 3JQ9A 4DUZB 4TV3A 1VSUA 4YUVA 4UTNA 3ISVA 5C32A 4ZT6A 5IBPA 3HA7A 1UOQA 2BGNA 4KX6B 3AUTA 1NXTA 2OESA 2H2FA 1MJGA 1PT5A 1JEJA 3ROFA 1E10A 4JA0A 4BO0A 3A3YA 1NHGA 1KH0A 3PC6A 2IU3A 2HTME 1Z9BA 3TNFA 3ZNPA 4Q3AA 4XEHA 4HRAA 1A0OA 3EC1A 4C5BA 4GDLB 1Q1AA 4M53A 4Z0PA 3F8SA 4MW7A 2MWMA 1ZD3A 4HYTA 3MVEA 4N5LA 3MTGA 2K4MA 3I9FA 1PQPA 4EQZA 1X80B 1KVRA 1IBLB 3N7UA 3HXMA 2GXSA 2Q0XA 4BJHB 5AHRA 4MGYE 3DFIA 3RJTA 2L19A 4OSPA 1PBNA 4PYIA 4AMBA 4JLWA 2GH1A 3OETA 4MB6A 3PR3A 3AF2A 4G1BA 4MUJA 4YUYA 5CD1A 2PUBA 4FDUA 3X43A 4JEHA 2BUAA 1KQGA 5D3IB 1T0JB 5HJ5A 3PC8A 3ESYA 4EB3A 2V45A 4LYJA 3QYAA 4HN4B 2I4LA 5M29A 1QR2A 5ICCA 4EP1A 3PF9A 3WQHA 1EA5A 1KAGA 2NBUA 1ZNZA 3D7MA 1V7CA 3LB8C 4ZO4A 5DVZA 2D3GA 2OJWA 3JZIA 1C3VA 3GK3A 4C78A 3CWCA 1UKZA 1SBZA 2Z5VA 3GZTB 4KL8S 2MP2B 2OUIA 2PXCA 4IINA 4BQIA 3EN0A 2N4FA 4KQMA 4ZT4A 4GZ5A 3GOQA 5JQGB 5BWOA 4AQ7A 3T5GA 2JLXA 2PKEA 1V3UA 4M1ZA 1Z0UA 3ROXA 3ZHRA 4MR8A 1EU4A 1YK0A 2OSVA 1XF5L 4AY6A 3F6EX 2MLBA 3RREA 1FUIA 1Z56C 3KK0A 4FLFA 1W8IA 2EKDA 3ENKA 1JDTA 2W2QA 3NVWA 4JODA 2JLSA 3QWAA 1G5IA 3WR5A 2YV5A 2HADA 1I4QA 4YP9A 3PC7A 1FMAD 3RASA 3TBKA 2Z2YA 2E49A 2WYQA 4CFZA 1VDZA 2ZAMA 3OKFA 1GM5A 3ROMA 4LDPA 4XAQA 3AV8A 1HDXA 3E9SA 2JI7A 3DEJA 4P7BA 3GARA 1ATZA 3M9WA 5ALHA 1JQLB 2Y5CA 4KQ1A 1KI9A 2WX0A 4TKVA 2R11A 2GMWA 4XFDA 3K96A 4UULA 2P30A 1EDEA 2JH9A 4ZVMA 1QTQA 1EWYA 1WE2A 4PC3A 3NAZA 1DE0A 2ONQA 1WMFA 2FPPB 3L1JA 4Q2JA 2G0NA 1WM1A 5I7UA 3D3WB 4X7MA 1ESDA 2WYHA 2O2IA 4IUCS 3IVCA 4XPIB 5F1KA 5CW1A 1GITA 1E58A 1BJTA 3OOSA 4U4AA 1KFJB 1TLLA 1ISNA 1SG0A 1UNSA 2OYSA 4UOQA 4WVFA 3OCUA 3OQIA 2XUJA 5AJYA 3N8HA 3RODA 4N8EA 3QQPA 1VDMA 5G41A 1DXQA 4RF0A 5KTRA 5LCXA 5JZSA 3FNIA 3T0IA 4HVCA 4US8A 3AO0B 3GJ4A 1V6EA 5AKJA 4K9MA 2RK6A 3LA6A 3PL5A 1O58A 1WPGA 3HN7A 1Z2DA 4Q9LA 4A1OA 2QT9A 3L8MA 4D9CA 4Z9BA 5AFSA 2QD1A 5KAMA 5L7TA 4X54A 2JBWA 4CLXA 2KACA 3QKRA 5K05A 2I2XB 2FN9A 1HLPA 1KPIA 2I7XA 1L7DA 3JQRA 3PSEB 3OU2A 4N9WA 3LUBA 2JA2A 3EGOA 4JJ6A 2O9JA 3AM4A 1WXSA 2QG4A 3T5AA 4B6SA 3NWEA 3FH0A 4X45A 4WESB 4IP0A 2OHXA 5KYVA 1R12A 1TYZA 5D1NA 2OL4A 2BFCB 4PCVA 3DDSA 2AZMA 4ZICA 3HWWA 3TRIA 1V8BA 2XW6A 5LP6F 3GLIB 4MP3A 1U7UA 4WOCA 3FUXA 4EW1A 1Z0KA 4WOPA 1V49A 2L82A 5JD3A 1SXPA 3UANA 1ZSVA 3ANLA 1KXJA 4NZMA 1IIBA 4GI5A 1JDNA 1U9CA 2D0OB 1U3TA 4PO8A 2DLNA 2P4SA 5G53C 4XRGA 3DH0A 5IJWA 5EYPA 3ZPXA 2W43A 1J1ZA 4BAGA 3SM3A 2IU6A 2AFHE 4ITRC 2KN5A 2KVRA 4EG5A 3DPSA 5ES4B 2DT8A 2POQX 1X1DA 1X7YA 4JP1A 3AR8A 3EIXA 2O57A 5EFZA 3DOFA 3TLYA 4M1MA 2E7ZA 1PR3A 1X7XB 1PGOA 4MI3A 4XUEA 4XDDA 1M0EA 1ZRMA 2WT9A 2ZXEA 4IZHA 3PITA 3E9CA 4MGZR 3B5EA 2KYWA 3L7YA 2Q2NA 3SU8A 2HJ8A 1PZFA 2IO0B 1Z0FA 2R8ZA 3MJTA 1ZJWA 2G9VA 3FAKA 4NLLA 4RLFA 3AZPA 3GFGA 4F92B 2HA3A 2CL5A 4TV8B 2W71A 5D51S 4AJOA 2GPNA 1XVAA 4YV1A 3HLKA 1GC7A 2B83A 3TTXA 2WW8A 1JF8A 3OMLA 2FBWB 1SC3A 3AVTA 5CITA 3JR7A 1CZHA 4RTLA 2IU4A 4B3CA 1NLZA 5AI9A 3LWNA 3L1VA 2HWUA 1B1AA 4V39A 2YWFA 3EWIA 4QARA 1XD9A 3AP1A 4D8XA 1TTQB 5LQAA 2OV6A 1VG8A 5ALEA 4MS3A 1NUPA 5KI6A 3SSMA 1KZ4A 4HFJA 4AM8A 2F67A 1QQ6A 1HE1C 2Y1FA 1W85B 1F2DA 1IK4A 5CFZA 4IDEA 1EUDA 3ZKWB 1C7RA 4EJSC 4IJKA 4D45A 5BV1A 4RPGA 4ESEA 3Q8XB 1G5QA 5ICMA 1T26A 3QA3E 3BGWA 1LCIA 1NVKA 1RJDA 4HLDA 1Z7EA 4TTTS 1W0KA 2J5KA 2JHGA 2NQ2C 2QD3A 4FWTA 1EVQA 1D6EC 1H8CA 4K2HA 4F3RA 4G5GA 4XXHA 1TKEA 3NM6B 5DI3A 2AN4A 4E2FA 3DXXA 3T9AA 4M55A 3G7SA 3KELA 4MEAA 3WV5A 3KUZA 3GQVA 2HNKA 3QK0A 3OOWA 4D3YA 1TADA 1C9JA 3T7KA 2IGBA 4X8OA 2ETXA 4DT1B 5KWEA 5C7LO 1M33A 3MGBA 2QCZA 3UXHA 4PYLA 3CGWA 1MMFB 2JDID 1M34A 2P5TB 2IHKA 1QV9A 3OPYB 3IOYA 3EAFA 4NENA 3ZDAA 4F97A 2HDOA 4P81A 1C41A 1HLDA 4JU8A 2XUDA 3DBLB 4BQNA 3WQSB 2GI9A 1TS2A 1UBHS 3PFWO 1FUEA 3U9SA 3E2PA 4EG1A 1NBAA 4YRPA 4MPPA 3TFWA 4NY1A 2IZ7A 4EUFA 1NVBA 3PRJA 4EKNB 5TS2A 3MAGA 3ZEAA 2WUFA 1CUIA 2I54A 1QTIA 3ZD7A 5LZ7A 1W1UA 2DPGA 3MFGA 2PWZA 1L5GB 1DLIA 3AW8A 1SE4A 1Q0SA 3TJZA 1L8OA 1VCHA 3T3DA 5AKHA 1H2WA 4H4DA 3SAJA 1E1LA 9LDTA 4Q7LA 3L7MA 1SXHA 4BXOA 2HRCA 3INTA 2BDTA 5AESA 2SKCA 5LQDA 1RJ9B 1AJEA 3FSGD 5TQ0A 2NXCA 2IYUA 2H92A 2QUHA 4BNTA 4ZAYA 2WU2B 4YSXB 4W1SA 3S8MA 4JC5A 3DC7A 3R9WA 2EARA 2PL1A 4C6HA 4XLTA 4EBFA 1Z8FA 3V4FA 3NXKA 2UZAA 5IYZF 2FPXA 2JSVX 3NIWA 2VF8A 3LXFA 1SHZA 1STOA 2IBSA 1RXWA 3Q7PA 2QX9A 2Q5JA 3ZI0A 1YU9A 4JWUC 1MC4A 3K2BA 2IOYA 4QU5A 1SHKA 2ZRHA 2DZJA 1NMSA 1RQ2A 1XCGB 3IQGX 4X61A 1R6DA 5A5VA 5CDTA 1JHPA 3RHTA 1I4WA 3KTFA 1AGYA 1X6VA 1FUYB 3O4JA 2FZWA 1BC5A 4P33A 3MLAA 4YL8A 5NLLA 4NAMA 4EQ6B 1RRCA 4Q1BA 5EKUA 2ZPYA 5IAGA 3H6HA 1R0YA 4E11A 4DDHA 3KLNA 3HM3A 2W2XA 5B1YA 5LZ9A 1QO0D 3GP3A 3ZCUA 4RW0A 1H2BA 3UXMA 621PA 3OH8A 1C8LA 3PUJA 3EVFA 2ZTVA 4AJHA 4GDKA 4A8HA 3NHRA 2ZJ6A 4EEZA 3ZJUA 2P11A 1W93A 4EEWA 2WT8A 4RFLA 4BKPA 3U7QA 5LP6C 5JARA 2J3MA 3AEQB 4Y9UA 3WAMA 5K6AA 2J7PD 4L75A 2PT6A 1PUJA 2DX7A 1WHTA 4UUQA 4P22A 3RHZA 3BH6A 2HJ1A 1XB2A 3C87A 3E3MA 1JEAA 3ZGVA 4WMLA 5J2UB 1SHTX 4PPNA 1R4NB 2WD7B 2WNSA 3OFNA 2GJ4A 1I8TA 1KQNA 4YV0A 3COSA 3WBBA 3AVYA 3GMSA 2KLGA 1I7QB 4IQGA 5DNYB 4JIOU 5KNDA 1YUNA 2FPUA 2D62A 4QQRA 3JXEA 4YRSA 1O2DA 4PWZA 1UD7A 2B98A 2Q6KA 2FIFA 2CVQA 5KIAA 3FVVA 4ZC8A 2H2GA 1BX3A 2XB2A 3ABOB 5B1EA 5BP7A 4LXUA 1T3HA 2C83A 1IY1A 3VR4D 1N8KA 1GG3A 5KKNB 4H1HA 1C0EA 2VUTA 3Q3JB 3GEBA 3SE0A 2BS3B 3A1QB 5EJEA 2PZJA 4ZK6A 5B7NA 2WXLA 4Y30A 5TJ9A 3F3KA 3OZDA 1HOXA 1E9CA 3E7PA 1MPXA 2IPAB 3OJ4B 1YD7A 1S0UA 2QIPA 3B1YA 2ZB7A 4I08A 5EMHA 4OJKA 2DERA 2LNDA 9ABPA 1QILA 1KJNA 3HTXA 1JTVA 1BMLC 1PV2A 1KFKB 3KYCA 5AK3A 1SKYE 2NCNA 3W1YA 2IHUA 4YCDA 2M4NA 3JD0A 3EEOA 3VRBB 4LQCA 4DVGA 2I2CA 1E2BA 3KR0A 4GZLA 5MN6A 1BX0A 4BMXA 2BHRA 4CEHB 3RHFA 1S1MA 2BFEA 1DIAA 1RJFA 2QEJC 2YHIB 2VTVA 4Y9TA 2D13A 1UWMA 3UJNA 2HL6A 4L7QA 2MHCA 5FLYA 4DSOA 3PC4A 3TL5A 1Y8AA 3K1YA 1IEWA 3EDYA 1MJFA 1EDBA 3AEUA 1YX5B 2CWWA 2PZAA 2TS1A 1U9JA 4YYZA 5HDBB 2J45A 1EIWA 2IEBA 4FOOA 4I6GA 4Q9DA 1YA4A 3EISA 3A25A 2B1IA 3RMKC 1TF7A 5DYNA 1EWKA 4GGMX 5TGDA 5H8WA 1PGNA 3ZWKA 3T9LA 2JLCA 3WIDA 3DMRA 1K0FA 1M6VB 4R3NA 1JQ3A 4MUEA 2ZAIA 4QECA 4BKSA 1S2OA 3WYGA 3FNRA 3PRZA 1ZN2A 2BYVE 1IY9A 4OA5A 5DU2A 2J3EA 3V6EB 3RFUA 2BEWA 3TN7A 2W2OA 3DSRA 4LK3A 2QHOA 1F8XA 4MRRA 1Z5OA 2QSZA 3EY4A 2QUKA 2PX5A 3SNKA 3TVTA 4E4YA 3NJ8A 4YXFA 3L41A 3F5MA 1L4DB 2D0DA 1W85A 3EXIB 3UJPA 3A1FA 5LC1A 2GM4A 4HWKA 3NHAA 5EWLA 5CT9A 1UP6A 3P2YA 5HRAA 1ZS9A 3JCZA 3LHFA 1MAUA 4WADA 3NCTA 1BVYF 5BR4A 3ETEA 3RNOA 3HDQA 3EZ6A 4XCXA 4ZFNA 3FCCA 1ZH0A 4RHTA 1FU8A 3BILA 1WDMA 4ZCQA 1W0CA 1G9SA 3WLLA 3Q8EA 1VTKA 2RAFA 3STUA 2WWIA 3L5KA 4TSKA 5FPKA 1C3JA 1JGTA 3JR3A 3G17A 1C81A 721PA 4KWIA 4P4SA 3UT6A 2WGSA 2QRJA 1C1HA 2OJRA 5L3QB 3TEXA 1GUBA 3PXGA 1KL7A 1Q0WB 4HFMA 5CMLA 4P7JA 2OV8A 1V1OA 3S99A 1FUUA 3MCAA 1CEYA 4YDRA 5KVQA 1A76A 3DBLA 3HXTA 4GOLD 2XLBA 3KAQA 2CSUA 4WBNB 1M5UA 3TL2A 1OAKA 1VSVA 5EL0A 4ETIA 1F0KA 4NAVA 3KT8A 2A9RA 4QHYA 4C7MA 1DCMA 1U1DA 4L28A 2TMKA 4P5DA 2Q6OA 1W0JA 2FFQA 3WDMA 5HRUA 4KLZA 3WK4A 2XUFA 4ZU1X 1V9SA 2FG6C 1J6UA 3FETA 2C97A 3FF1A 2BGWA 4Y2PA 1X70A 2WU1A 3W7BA 4B4VA 3OY2A 3C6MA 4EG6A 2JJMA 2FDRA 4KDFA 1SWWA 2CJYA 2V8OA 5K0NA 1IXZA 4FEGA 3OE7A 1E8NA 2WB2A 3ED1A 3WK5A 5HIIA 1N8NA 1UWXA 2ZSUA 2FPKA 4C0QC 2OAP1 3E9ZA 1SM4A 1XMSA 1GL7A 4KI7A 3F67A 4EVRA 3DC2A 2ASEA 2DZDA 4RTQA 8AT1A 4ZREA 3H1FA 4KOEC 4MYUA 3QX8A 3TLMA 3X2SA 4QOJA 1N2CE 4L07A 2HDWA 1QSGA 4EKEA 4DG9A 2BFDA 3OEHA 1QHXA 3RYCB 4ZRDA 3MCWA 4RPIA 3U13A 4R0MA 1ZCAA 3OF5A 2JL1A 4EPTA 3ZRCA 1KQOA 3EXHC 3CVJA 3T7RA 4BO6A 3P20A 1I4DD 1C8KA 5JECA 3VO1A 1Q92A 3LIPA 4C00A 3ACCA 3CEJA 3I32A 5ADHA 2ZRCA 1GTL1 2C5HA 1FRNA 4AJIA 2IHVA 4Q19A 2VP2A 2YWHA 4MR9B 1A7KA 5EP2A 1DX4A 4J16C 3EVTA 3ZWYA 4RJ2A 1H2RS 4C22A 3WAKA 2VJAA 3Q3MC 2FFBA 2P35A 4TQ1A 4J91A 2AUNA 2PX0A 3QKTA 4WKOA 1P1AA 1EIZA 3FNEA 1NATA 3TR0A 2D74A 3KTAA 2G25A 4G86A 3N8NA 3WO0A 3NTVA 1Z36A 4D96A 2ZUTA 3IDOA 3U7GA 1QYXA 2JPHA 1JHQA 5PGMA 3AEQA 3NIBA 1GQYA 1LEHA 4GGQA 2ZRPA 1NJ6A 5TT1A 2PXXA 3HVUA 1C9MA 4KZ0A 1T0HB 2WJGA 1P33A 2CXTA 3MXTA 4A6PA 2QN7A 1CU1A 3Q87B 1VBFA 5AQEA 2I0FA 4JBYA 2WD7A 4HQ0A 3GMDA 3I1JA 4DNOA 3D8SA 1YRBA 3VH1A 3P0RA 1HEYA 3W2GA 1VYUA 4IHAA 2C61A 4CKXA 2G3QB 3WB2A 5JZ9A 3J7AC 3S29A 3ZLUA 4RVOA 3VU0A 2ZJBA 3L9XA 3N8IA 3COJA 2DUNA 3JZDA 2GRAA 2JJQA 3I6BA 2XD4A 1QHGA 1EFRD 3AKDA 4YDHB 1N1MA 4J2HA 2BEJA 1UAYA 1W25A 3UWKA 2R7LA 2FEMA 1G6Q1 2DFKB 2XQIA 3PUYA 3AXSA 3GGGA 4ZPJA 2OZLB 4KVGA 2CMKA 4AVYA 1D2GA 1SU6A 2XT0A 1YGYA 4P0QB 2QP4A 5AUKA 5FYQA 1J5XA 2ZI3A 3ZCXA 3HP4A 1V71A 1AXEA 2XNDD 3KZCA 4CCSA 4GDFA 2AR0A 6PFKA 3PD0A 4G41A 2C2HA 4L4XA 3PT9A 4RPCA 2HBYA 1A2BA 3FOZA 1EK2A 4U63A 1OWNA 2PS0A 3LYUA 4MV3A 4BNFA 2WMNB 4OQPA 1WXGA 5BYKA 3IP5A 2OGUA 2KT7A 2P9GA 4DCVA 3SNHA 2UVPA 3RC7A 5KO2A 4PQGA 2BZ1A 2BT6A 1P7YA 1RE1A 4WN9A 1GR0A 4O4IB 2V3PA 2PLFA 1GVNB 1NNEA 3GPCA 4ALIA 1P4GA 3E9YA 13PKA 4E5SA 1ZOPA 2ACZB 4F4FA 4QYSA 4Z8YA 3X1MA 2IXFA 2RGFA 3JW8A 5DTRA 1KEUA 3R2TA 1FP7A 3THOA 3MJ5A 1MT0A 1FTQA 2SCUB 3OHMA 1QYRA 2QRQA 3N7AA 5JUWA 3SZRA 2BPSA 1WB6A 2DJIA 2TYSB 3R0JA 1XJCA 2QTRA 4INZA 2QSUA 4P54A 5JU6A 3WYFA 2XQKA 1BXGB 4QOSA 1LPSA 2E87A 4C3ZA 1DMRA 4Z86A 2UYCA 4BJ6A 2ZBQA 2VAMA 1WU7A 3HYRA 4LSMA 4Z4QA 1T9AA 4D9IA 4LWZA 4AO6A 4YH1A 4Q9KA 4EYQA 5AM1A 1TJEA 2G67A 3CB4A 2FETA 4GLJA 2CXOA 3HXKA 5F51A 1V11B 2N9XA 5D7GA 5A0FA 2IS6A 3LYHA 2J9YB 1II0A 2Z08A 5BO5A 3ID6C 1KY4A 3LPMA 1EXNA 3SS7X 4BASA 5U9CA 1IEXA 3HO6A 3MMSA 2G9UA 3L7AA 3EUWA 3SFDB 4HB3A 1YT5A 1QHFA 2IHYA 4A4DA 2YIVX 3YASA 2Z6QA 1E0JA 2MSNA 2BH9A 2YEPB 4TUYB 2Q3CA 2EKIA 2OTCA 2QDFA 1KJ9A 4K9RA 4MR7A 1CDOA 4II3B 1H69A 1G21A 5ALQA 1DARA 3LIIA 3DR5A 3FM9A 4LGCA 5CBKA 1NXWA 4F5YA 1POXA 2HEIA 4LJAA 2D1YA 3ONSA 2EMTA 5E2IA 3HYTA 5T64A 1YV9A 5JPCA 3A1NA 2CXQA 4B3DA 3UUFA 1BKSB 4BNDA 1TA0A 1LBIA 1X9IA 3LFHA 2IDMA 3LY9A 3WL3A 1OC4A 4JMPA 2IBMA 4ZVOA 4FX2A 4Y0VA 4EABA 1AQJA 1U3UA 5FUBA 2WUWE 1C80A 3FSEA 4FC7A 2J3JA 3RJMA 5KTKA 2NXWA 3W2HA 3R74A 3N5CA 4BFYA 1U3FA 1B6SA 2A35A 1TQ4A 1DEOA 3GP5A 5HK9A 5KTMA 1NUAA 1G0NA 3Q7RA 5DN6D 4MWBA 4O8CA 5FUQA 1E32A 3QBEA 5DLEA 1XRJA 4H7IA 2ICIA 3LS2A 4OKIA 2HSEA 1JSZA 3CSTA 1AN8A 5FYDA 1ITZA 3VR6H 3QA9A 4JI4B 4R0NA 1N3IA 2CUNA 4H1WA 2EL9A 2CXNA 3A1SA 3V33A 1M2VB 3ANNA 4DF3A 2BTOA 2VHEA 4HWGA 1CHNA 1UJCA 5FPYA 1U0SY 2XV1A 4L76A 3ZOZA 1SCNE 5J4KA 4JLVA 5HZMA 4MQFA 2WIFA 3AHHA 2JD0A 3KYBA 3ZXVA 1U7WA 3I2JA 1BDJA 1G41A 3AW9A 1L7AA 4J6EA 4AZSA 4P4NA 2C4VA 3U4GA 3CUEF 2WWYA 1OFHA 3MUFA 4Y8VA 4ZQFA 1T5SA 5FNVB 2R6ZA 2X1LA 3L49A 5B2EA 2PVPA 2VHYA 3GPBA 2ZI5A 4REOA 3D7NA 3Q3CA 4HNGA 4F5EA 1G8SA 2ZRLA 3FYUA 3H8WA 1XZLA 1NLUA 2WXIA 1E2FA 3WLPA 1MI0A 1VLZA 3AE8B 2CVOA 3UK7A 2K5UA 4IM3A 3ADBA 4Q3NA 3DKRA 4DCSA 4DBLE 2RH9B 2O8EA 1HYHA 2IO1B 1PK8A 3T9EA 4Q3OA 3FTDA 1DAKA 3G0GA 5AZFA 3HVHA 4BVLA 2O8FB 1J49A 4UTRA 2AXEA 5DHRA 1HC7A 4TWAA 3ILXA 1WXHA 2N1WA 1TM2A 4DLLA 3AI7A 5EP1A 1TVCA 1QH1B 4II7A 4Y1RB 2EWMA 4K3VA 2REXB 2IOFK 3UB4A 4GLLA 1DOXA 1TMOA 3HV0A 1R0WA 2IHJA 3Q5EA 2J07A 1UAGA 1YQBA 3L43A 1KYQA 2W6ZA 3GN2A 4NE2A 1U2ZA 3AJDA 3JVDA 3L16A 2WWWA 3ZS9A 3OCCA 4EIWA 5C51B 3WGMA 4HH1A 2KJHB 2BEUB 3HACA 1DMSA 5KHOC 3L4JA 1TIKA 4UJ5A 5K8CA 5A3VA 3OHSX 3H9DA 2QRLA 4YECA 2VAXA 3NEPX 2B21A 2HBQA 4EI2A 4UBNA 4FCCA 3NVMB 2W6NA 5IAAA 2FCSA 1T1JA 3DYVA 4BLOA 1C29B 1KMHA 4CT4B 2XCRB 4LV8B 1CYEA 4WCVA 3ASVA 1PFGA 4OEHA 3KYDD 4ZOEA 4CFYA 3ZDDA 1MX1A 1IZZA 3D5TA 4UNSA 3NY5A 2VYCA 1GADO 4GMDA 4AXXA 3EPLA 4HXDA 2OBBA 4N3GA 1NMEA 1RZUA 3BEDA 1N3LA 4FIDA 1HL3A 1L3IA 2UYZB 1YB5A 2DUWA 2Q8QA 2O2EA 4DIMA 5B30A 5LZ4A 4FYYA 1TI7A 2QAIA 3AECB 1YZQA 5JLAA 2DCUA 1AOXA 2YHSA 2WF7A 4KYUA 3WWEA 3NHZA 1ZW7A 3UMVA 1OJLA 1U90A 1ZXLA 4MTCA 1TJ5A 2GPJA 4KYIB 1SOMA 1PNTA 3KCNA 2C5LA 4GVXA 1CMXB 1M1YA 3B7WA 4HRSA 1AX9A 4IUMB 1QOFA 1X2EA 1SCKA 3PLUA 2FKAA 2CE2X 2UU7A 1ZN7A 3ZGOA 1DKPA 4QWMA 4QIHA 5BQ5A 4OFZA 3DZCA 1NSTA 3VR5D 1ONNA 2P90A 3EASA 2QC8A 4W7IA 1ZSNA 3FDZB 4OAQA 2PRYA 1GFWA 1SIUA 4KPGA 4UBMA 3JYUA 2EKQA 1WP4A 3M6UA 4FB4A 2QLFA 3R7WA 4MR8B 1H0RA 1OGWA 1OX6A 3PQEA 5DGDA 1NPTO 4C7OA 3IPAA 1C1XA 4LE1A 1KFYB 3N53A 3GRPA 4EO7A 1BOOA 2C42A 2LZ6A 3PQ7A 2DAPA 1YN4A 3LBNA 3AOGA 4IXDA 4LHZA 3NS7A 5DT2A 2ZWOA 1JQAA 1M0SA 2CHXA 1K92A 1KDVA 2JAPA 1T5LA 4AWAA 1BXGA 1XKTA 3LOQA 1B4DA 3GD5A 1XZPA 3GAZA 1L0VB 2P6OA 3R2JA 4KAAA 2PS9A 4DUGA 3N0XA 1B3RA 3JQQA 2DPMA 3AF4A 1F2RC 2WUDA 3SLKA 1QCYA 5G40A 3LP5A 3LT0A 3AJEA 4TKVB 4YR7A 5IM4F 1K4KA 3AEEB 4LZZA 3W5SA 1K6MA 5BT9A 3PGEA 3V80A 1O95A 3ZGLA 5KREA 3EF3A 3OAWA 2OLEA 3L2OB 3RKUA 2WXHA 4N9QA 1OYYA 4R1PA 1I0LA 1T4DA 1Z0DA 4R9RA 3RADC 2R60A 4AY2A 2QZPA 4ICVA 3S40A 1PAUA 2QTMA 3I01M 2BY4A 2R2QA 4II3A 3OQIB 2QJWA 3P2EA 1G7CA 3DFUA 3OICA 3CZQA 1F38A 2BV3A 3JYNA 2DZIA 1Y6QA 4HK2A 3KSBC 2X8BA 1RAHA 3AUXA 1J97A 3ZDQA 4XCQA 1MIOA 2Y6VA 4C9BA 3T1NA 2GK3A 1Z63A 2YINC 5SY6A 3USES 3CUWA 4GHWA 1BGWA 4IV0A 5SZKB 3PRPB 3PHCA 2N46A 3TR6A 4BLWA 3T5CA 4ENRA 5CLGA 1XF1A 1GO2A 3OQNA 1OXMA 2H1VA 4UE6A 2BVNA 1OT3A 4FOSA 2JVKA 4FDAA 4EGCB 2G72A 1SQGA 2NZVG 4JSRA 3I52A 4Y9DA 2W93A 3W90A 2OPBA 1FDOA 2EEZA 5CFMA 4EHIA 4P31A 3QKRB 5D6NA 3T1VA 2PQ2A 5GY7A 1IUKA 1G8FA 3RK4A 2GLSA 3L08A 1VL2A 1PYWD 2JK1A 3LC2O 3GIWA 4KFUA 3GUUA 2IDKA 2GK4A 1R6AA 4B32A 2ZXFA 1XO1A 4WNIA 1A7AA 3DVSX 4BNLA 4XQGA 3DMNA 3M70A 1M2VA 1EE2A 3Q88A 4EMUA 5I45A 1MNAA 4KR6A 1SHJA 3I6IA 4JITA 3JTMA 3A3PA 1U9IA 2ROQA 3MS7A 1MO6A 2P9JA 1IWPB 3U09A 1PV4A 2B1JA 2H2DA 4G4SP 4TVKA 3NHLA 3K9OB 1U2EA 2ZNVC 4J9VA 2ZAOA 1BSVA 4TL7A 3A6ZA 1Y7HA 2JZCA 1B0AA 1NXPA 2DTEA 4X6XA 4DREA 5LB4A 1P9NA 2FN4A 3AVOA 2TMGA 2ILVA 3EFOB 5FDFA 2WSLA 5BN1A 5LQMA 3F1KA 4W8OA 5EYPB 4B73A 1TA9A 4CQMD 4BLVA 4LHSA 5KU1A 1BHQ1 3T95A 2EQAA 2ZYDA 1ML4A 4GP6A 3GE8C 4PRLA 2P5SA 2P5UA 4X92A 4X8MA 4LSGA 4OHVA 2H31A 3RC1A 4XLZA 1X7YB 1KMQA 2FUEA 2YN4A 4OQZA 1QX4A 1I42A 3RROA 1F4VA 1EGMB 1JSLA 2X9NA 1P98A 2CS4A 3H6KA 2FRDC 1PVDA 4DCPA 5IAOA 4HWSA 2ASQA 5AM2A 1JYEA 2V59A 3TAUA 4B3BA 4DQUA 3CNBA 3ZCTA 5CUQA 2IYYA 4Z7NB 4UU0A 1UH5A 1GGNA 1MA0A 4IMJB 1KEZA 2ZIFA 3W8FA 4C2AA 1O4VA 1JPVA 1PBTA 3LLCA 1DKUA 4UM8B 5FBLB 3IP6A 2O6HA 4UM9D 2R7KA 1CJMA 2PS1A 3F2VA 4MJXA 3ELYA 3N32A 5KYWA 1Y34E 1XCLA 5FT9A 2FYTA 3I4CA 2IX3A 3DQVA 2VCYA 4KGVA 1R00A 2W42A 2RDBC 4O25A 2F48A 3TQHA 2K7ZA 2O6LA 4HNTA 4PZ0A 3R3XA 4FSHA 4B8WA 2HH9A 4KI0A 5K0SA 3ZKJC 1P8JA 2C4MA 2H5EA 4NBNA 2BEUA 2X9VA 1YBMA 3ND9A 5JNVA 4IAOA 3C5WP 3EJWA 2V6IA 4MS3B 1PEAA 5D00A 5D2CA 4KO3S 5J2TA 5BY2A 3FKJA 3FPHA 1A4RA 4KW7A 4FSXA 2P3OA 3KQKA 1P1RA 4DYHA 3K70B 2Q3HA 4LFBB 4OOEA 1EUDB 4U3JA 2V7PA 4P2GA 1U63A 1VG9B 5L3SA 5LXIB 5K0JA 1JLHA 2OG1A 5CB0A 3FVTA 4GWKA 1SVSA 3KB1A 1S5PA 5CA1F 4YWHA 1IM8A 2YZKA 4EHDA 4QU8A 1JIVA 1SCDA 4P7KA 1OKKA 4ER5A 3K09C 2G5TA 4RH3A 4A90A 1NVFA 4GECA 2H2HA 3K30A 4AU1A 5DI3B 1OI4A 5BSTA 3CO0S 5GONF 3GIDA 3C3KA 1HQKA 3PQ4A 1SGHA 5EPUA 4JVLA 5C8DA 1SXJD 3KNZA 3ZJYA 3EIUA 4INOA 1DV1A 4I1IA 4DMCA 1D0SA 4FD2A 1M34B 3NGMA 1M5RA 4S1NA 4NENB 1GYQA 1LQUA 4JU9A 4L8GA 2BR5A 1FXWA 2CU1A 1HYEA 4OBXA 1ZIDA 4YRQA 3FDZA 3SJZA 3A1VA 2WDRB 3BCRA 4JI7B 1Y8QA 2LXCA 4IDQA 2CUTA 4ZQIA 1SVMA 4KFSA 5TY0A 4R40A 4I99A 1WW8A 3FW1A 4MKRA 4IZOA 2HJHA 1ESZA 1O0BA 2H1WA 3I39X 3UOWA 5EEHA 1IK6A 4DNQA 4LTUA 2XT6A 5JATA 2KTFA 2VXOA 1V2GA 5BYRA 1ZP0B 1VZ7A 2IHTA 4FCWA 3PJGA 4RTKA 5DNAA 1HNZB 4HXYA 3LV8A 3Q3EA 4MVJE 1X39A 4PXSA 1INLA 1ECFA 2GBMA 2QTZA 3SFZA 4E32A 1XRPA 4BXOB 3V3TA 1A8SA 1Z6TA 2E82A 5F2EA 1B7GO 4WNCA 2R6HA 3AI5A 1WABA 4ISCA 5TQ0B 1IQPA 1SXJC 5EZ6B 5JH7F 4JS0A 4BFTA 3FB4A 3G2MA 3MAAC 3HU1A 3MJHA 1YZKA 4LAFA 5C35A 3E5MA 1IHPA 1Y3DE 5DDIP 4HY3A 4W9FA 2Z1MA 3AIIA 1GPDG 5A7FA 1P2FA 2WZCA 1SBBB 1HURA 4R16A 3SI7A 4JJGA 2B5OA 2KBEA 3TUOA