2VH1A

Crystal structure of bacterial cell division protein ftsq from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSQ
total genus 50
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh1A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh1A02
3MC8A 3NJTA 2QDFA 2QCZA 4C4VA 3MC9A 2V9HA 3Q6BA 2MHJA 2VH2A 4C00A 3OG5A 4PK1A 4QAYA 2VH1A 4K3BA 4BZAA 4K3CA 3EFCA 4XGAB 2X8XX 4C4VB
chains in the Genus database with same CATH superfamily
2FYTA 2YWXA 3AERB 2VTVA 2VZ0A 3PDIA 2BUBA 3GNQA 5I51A 4ZIRA 2VJAA 3HKCA 1RWSA 3GZNB 2NUTB 3BFVA 2QDKA 4GKBA 3R0XA 1ZAYA 4MR8A 1TLLA 2W2KB 4KGRA 5E3HA 4R9NA 1DC5A 4O2RA 4F21A 1PKEA 2MBQA 1GSAA 2XNSA 2NTSA 1M67A 4F0JA 4F9GA 2A78A 4BX3A 4YHHB 1Q17A 2PR7A 1FD6A 3OZIA 3QFSA 5CVDA 5HF9A 4MVJM 2Y05A 1R6VA 4V3CA 2KTRB 1WZEA 3TZLA 4RTQA 4BCBA 2QTHA 3SX2A 4X7RA 1ESDA 3V8QA 2QQGA 2L19A 3BE4A 2HMYB 3CO0S 2C99A 2HJSA 2Q1UA 3D3NA 5JCZA 3L41A 3O8RA 3U7GA 3CLSC 1UEJA 3OZ7A 5TLSA 1TLFA 1V9SA 4FIDA 2WDVB 3H2GA 3QKWA 3ZCUA 1R10A 3A4MA 4FYYA 1KZGB 1VKHA 2JYEA 2WHXA 4IX9A 4W9RA 5K8CA 4MVJF 3ZTCA 2QQ5A 2WYVA 1J19A 4N3GA 4DQVA 3ZXRA 2EIHA 3QELA 2IUUA 1OJLA 1N6NA 4MUKA 4CKBA 4B73A 4F96A 1HTQA 5KJ1A 3CCBA 4M21A 4DHEA 4E11A 4MWZA 1VZ8A 1QH9A 3FSGD 2RGYA 1JFRA 3EZ6A 1M8JA 2R6ZA 2IFTA 2XCIA 3KXDA 3BGWA 4GE3A 3UW1A 3GVPA 1XPOA 2K7ZA 1P5FA 4R2IA 4YO8A 2OVFA 1SGHA 1TADA 3AY3A 1MVLA 3ASYA 2P67A 4OHXA 2B25A 3Q7TA 1L5YA 2CZCA 4ANWA 3TNDA 1MZPA 2IITA 4JMPA 2QTZA 1NXPA 4EL0A 7MDHA 4GI7A 4W5OA 2DBRA 4U2BA 3B1FA 1V45E 1P19A 4ZYVA 3LPCA 4H18A 3RABA 1KY4A 4QUGA 4LGYA 5CLHA 3CLRC 3U37A 3LUPA 4NE7A 1P39A 4BBJA 1R0BA 1X74A 4XA8A 3ZGVA 4EO7A 4J49A 2RAFA 1ZVJA 2L1AA 1J0CA 2QAJA 3HB7A 2OYCA 3SJAA 1ZK0A 5BMVA 5A2QA 1HETA 1Z45A 3M34A 1T34A 2HBYA 4ZVSA 1Z6YA 3JYPA 4JE3B 4L50A 1VRAB 3SSMA 1EBBA 3C15C 4E3CA 3FDIA 1YBFA 4XWGA 2WWVD 1NJFA 2CE7A 1Q15A 2GZAA 2WAMA 3HY6A 2ONQA 2FVXA 3EVNA 2YEPB 3TTUA 4UTNA 1PKXA 2GMWA 2CDBA 2ZBVA 4N5NA 4RF3A 5CAEB 5L3SB 2NO0A 3CNNA 3L18A 3ZWNA 1QAQA 1NFFA 1ZG3A 4CCYA 4UAGA 2XXBA 4OXRA 1B8OA 3UMRA 4WFQA 4AURA 5F2KA 4J94A 2NO7A 1YZTA 2GUWA 1H22A 4L07A 3VUXA 1GRRA 3QVXA 2I8LA 3E61A 3OCVA 4XOIA 1Y4ZA 4C4ZA 3W1SA 4LHEA 4DLTA 4GYYA 4BVAA 3NMUF 2C07A 2EKBA 5EZ5A 2ZSEA 3UB2A 1W0CA 2PUGA 2K87A 1XROA 3BUSA 3CR3C 3R9XA 4RE6A 3DFUA 1RHJA 4R1QA 2KKCA 4P38A 3T7DA 5L6MB 3K6JA 3ZZNA 1PDXA 3IT2A 4G1EB 3F3YA 1I4DD 3FB1A 4HAWA 5HA5A 4AKGA 1X1MA 2BY4A 4CW7A 3DWGC 3NHFA 4J7CA 1XPUA 3ROPA 3U3MA 3UJDA 2WU2B 1WLSA 2LD9A 1MMFB 1XTKA 2RHRA 4ZHPA 3WWCA 4OTZA 1E3DA 3DONA 4YBRA 3M8KA 4R9UC 2CF6A 4A03A 1GGNA 1N2OA 4FLHA 3X1JA 4E5PA 2P9FA 3N6RA 1TCCA 1U2QA 1WD7A 1RLFA 1RBQA 2DWPA 1TJYA 1NC1A 1M1NA 1XZLA 3FPEA 5H68A 1W75A 1WV0A 2NM0A 3BCUA 2XVZA 3DE7X 4U7PB 1K51A 3S7ZA 3KR2A 3KE9A 4UEWA 1ONNA 2J0SA 3N2YA 1CZHA 4XM1A 3BE8A 3L10B 1BKSB 1GD1O 3DULA 3DWFA 3E7DA 1OTHA 2CU1A 3KPYA 3P45A 5HQ3A 2W6NA 2M6KA 3MJFA 4HFMA 3RK0A 3NVZA 2PZEA 4HN4B 4KRYA 1TGYA 1QHIA 3FBWA 3FCEA 3R41A 2V65A 4IAOA 3SOPA 1CERA 2PMKA 4PGFA 1XTIA 1K8YB 2G06A 2H0QA 2VQEB 2IS2A 1NJ8A 2CFIA 1ZSNA 4HDKA 3GH1A 5ICCA 2PDAA 5CT9A 4BN5A 1N2CE 2CFSA 5BOSA 4UBMA 4CU5A 2PKWA 4MWDA 2XEWA 1DMSA 3OTIA 4G6ZA 4V3BA 1AK9A 1VCHA 4Q6BA 5ESDA 2L05A 1ILEA 3R5FA 5M3BA 1QP0A 3OG9A 4AG3A 4OAOA 1CJCA 2FWJA 2FMXA 2LGSA 2H6EA 4Y6LA 3TMYA 2J9ZB 3G2QA 4GICA 4B6GA 2AI3A 3RAFC 3HA5A 1TTTA 4LF6B 1QYCA 2OFWA 1F1BA 1M2FA 3MK31 4W99A 1M6YA 3GHYA 3OQ6A 2AH5A 2QMEA 3OOJA 2G04A 2BEJA 4I55A 1O5TA 1Z4JA 4EE2A 2XB8A 4F2WA 4G5GA 1SEPA 1YOVB 4FLEA 3ENKA 1NM5A 2O50A 5CB8A 1RWWA 2Z8XA 1AUXA 2BF8B 1JSCA 8ATCA 3O8OB 4E88A 3DPDA 2YDYA 3TLKA 5G02A 3R2JA 4YMHA 3NVWA 5KVSA 3L7IA 3BXXA 3FPKA 2OGTA 3O2JA 1TKEA 1X1SA 4XCVA 1ZU5A 2BEVA 2LASA 1R3DA 4J16A 5LXTA 2WJPA 4MGYE 2FCMA 4HN9A 1M2KA 4L5CA 3MXTA 3SM9A 3FTDA 1K75A 3ZIUA 3IEXA 2FZ5A 2BBWA 2V96A 1JWSD 1YASA 3L8ZA 5LQSA 1YA6A 1I4OA 2A0FA 3RC8A 1EGMB 3DKVA 2NT4A 2R6DA 3D2AA 4AS3A 3AUAA 3G5AA 4BQPA 2PTHA 4G25A 2PLRA 3H2BA 3K09C 3MWGA 4RM8A 2C9BA 1LUAA 3ET4A 3AFHA 5JAMA 3TL5A 4N76A 2ZZPB 4XZ3A 4ENWA 1DTSA 1F3OA 5KYWA 5KOYA 3C3AA 4KHPB 1VPTA 3HFJA 1H2BA 4X7BA 4EQ6A 1D8TA 4TXMA 1E6EB 5SZJA 2MDTA 3FG9A 3WAPA 3FHCB 3OOWA 3QEMA 1XX6A 1J2EA 1PJ2A 4PEVA 4QOJA 4A5OA 4PO9A 5HKKD 1NDHA 2XR1A 3A7EA 3PQ7A 3TSOA 1GL9B 2J7PD 2OD7A 5SZHB 5T6MA 1A95A 2I91A 1Z08A 1H3NA 1TIFA 4EMSA 2LWPA 2W0MA 3OZRA 5GIPE 5ICFA 2RG1A 3CUTA 1HV8A 1DBRA 1N6KA 4LJ6A 3WK8A 4QU8A 1BNCA 3QTTA 1F8YA 1ORDA 4XGAB 2PXAA 4WGGA 5DDIP 4DDWA 4FI3F 3SZ3A 3ZKWA 3HCDA 2WPDD 3N58A 4FNGA 1I6KA 3GFOA 4DLUA 1SUSA 1C7JA 2W54A 3EFOA 5E3JA 3U7QB 3WL8A 4YRTA 5FTWA 5C7OO 4FOLA 4QNMA 3P32A 3X44A 4F86A 2MSKA 1QB8A 2DHQA 4J0CA 3BT7A 1K7EB 1GGEA 1H23A 2QN2A 1RRGA 1WXSA 2I2WA 3CJTA 2EFYA 3GDWA 4GBMA 4LXYA 4UU8A 4XUCA 3SF0A 1QHSA 3W5SA 1GRNA 3IVMA 4DQ0A 1TA9A 2ZRGA 2B9EA 2D3WA 5KWVA 1UBIA 3QI2A 3CV3A 1Q21A 4QDUA 5IMBA 2WIAA 2XBLA 1NUHA 2WXPA 3GS2A 3W7AA 5JI2E 1ZVQA 2PYDA 3I0NA 4U9IS 5K4HA 3LCVB 4NJCA 2P41A 3FRIA 4XRGA 1XD2B 1S3FA 1GPWB 4QGAA 3UAOA 2WZCA 2EW2A 4GXQA 3X43A 5FTLA 1GUAA 3IIEA 3A1UA 1QONA 3EH2A 3S5JA 5HVNA 4YPOA 3GLGB 4NAHA 4G8JA 1MAVA 1K7YA 1ZW6A 4Q15A 1J1ZA 3BIXA 1AOXA 4OI2A 5DHFA 4DG5A 4UPEA 3ORHA 5H3HA 2QRJA 1B4DA 4LUCA 3WIUA 5KSOA 5KYUB 4OBWA 2RG7A 3AZQA 4JI7B 2CMKA 3COVA 2WXIA 2C7PA 4RBNA 5EHNA 3URMA 3VZRA 5I7EA 3WMXA 4LTUA 2ZK7A 5EIBD 2ZSDA 5IDYA 4DJAA 1ZOIA 2FFRA 1T3TA 3TOVA 1G8MA 3MN1A 4OQQA 1RAIA 3KTAB 4IFBA 1VG1A 5C2TB 1EVIA 3CF6E 1VKJA 5ITZB 3QHQA 4HNTA 3ZDXB 4BNLA 2PUWA 4JYAB 2AQ8A 3DC2A 4BKOA 1IY1A 5KJFA 3GGOA 1MVNA 2DFPA 1VD2A 3CEJA 3PYXA 1P3Y1 1ZH2A 4AZ3A 3LX6A 1PFWA 4NMMA 3UK0A 1W76A 3ADOA 3L13A 2BHRA 3K8OE 3HCFA 5AKYA 3RUDA 2NO6A 2A7QA 3R2IA 1GN8A 1LBIA 4HZUA 4ND1A 3CO5A 4Q82A 4QOFA 2V9CA 3QEKA 3F5FA 4DG8A 1N7IA 2BFWA 3IDOA 5LLTA 3I45A 3ZN2A 2FN9A 2E49A 2BMAA 10MHA 3K0AB 1GUFA 3LA8A 3O5AA 1CUHA 1PW7A 1S02A 4RAQA 3SQDA 1SD5A 4OQDA 4DR5B 2Y1OA 1TQDA 2YX1A 1CJEA 3K5HA 3C19A 5JPIA 1BEEA 2Q6VA 3H9UA 2G8LA 3PPYA 3QE4A 4I14A 1T5IA 1QO0A 1T10A 1HXYD 4RH3A 3ZNQA 3CKLA 3B2EA 5E4TA 3KZVA 1KMNA 1J8QA 2PPVA 3DKPA 3O6VA 4REQB 3FPSA 2HR1A 2BKLA 4BO8A 5HIJA 1TD1A 3VUYA 3LTEA 3H9QA 5CLJA 3VZCA 4V02A 4GUAA 4RULA 3P2IA 1X94A 2X15A 4A26A 2ZPYA 2REQA 4D6PA 1KKUA 4RKFA 5AW0A 1ET9A 2JKZA 4BLQA 1RTKA 1YIWA 3CUWA 1YTUA 1EFUA 4C21A 3FHTA 1JGTA 2VWPA 2AJ8A 4H4CA 1R27A 3DC7A 1P4JA 2YBDA 3S8MA 1OX6A 3L7AA 1MXHA 3M4YA 4UBJA 3W6ZA 2WKRA 2ZB8A 1YQQA 3PIIA 1A5SB 2Z5VA 3JRWA 5KPDA 4B3BA 2JRLA 2O8EB 5AUNB 3QQ5A 4AF8A 4H6WA 1YHZA 4K0RA 1S2OA 1I13A 3BTOA 4E12A 4RDXA 4AC9A 3GJRA 2FE8A 5DNUA 4K2HA 4RVUA 3EYWA 4L4SA 3JQFC 4N82A 2SAKA 5IFKA 4O5OA 1RBZA 1L4LA 1L3BA 5HF8A 5A62A 3AH7A 1UZLA 1XVLA 1U8CB 1Y8AA 4D3FA 3GE8C 4JWSC 1QGUB 3R7NA 4F4DA 4ICIA 1TYCA 3RSLA 3TG2A 3NT4A 2GCOA 4ZQFA 3BYTB 1CT9A 1LLUA 4NNPA 1T4MA 2GN6A 4LF4B 5IT4A 1P3JA 1FP2A 3H5IA 1PL6A 3P4UA 4M49A 4LRTB 2AHRA 2CUKA 3CZ9A 3MELA 1WSWA 5KAMA 3RYHB 1UXHA 2R96A 2UKDA 4NJ6A 2H16A 3CSFA 3OZFA 2QAGA 3TUIC 2DUMA 1U2GC 2Q8QA 3ZHTA 2GF2A 5I7UA 3PYMA 3PR1A 3NVKI 1ATIA 1JIXA 1IFXA 5A1JA 3GT0A 4D46A 2IVFA 3NNNA 4UE6A 1GILA 3R09A 2IKQA 4TOIA 5L51A 1ODCA 3GCXA 3TVYA 2XODA 3UGTA 4J1SA 2X58A 4DXAB 4JSYA 4I4TB 1VJGA 1XMXA 3KJFA 1KI8A 3EHDA 2GBJA 4W1SA 4ITRC 2JAOA 1BEUB 1VJKA 1NT4A 1UDAA 5CVUA 1DG3A 1OHHA 2GHIA 3RQIA 2VIIA 1U0SY 5DT2A 3NBKA 1JQ3A 4ND2A 3SD5A 1GVHA 2B37A 2QRKA 1X77A 3CUVA 4ZAFA 4KXMA 1DJOA 2C5LC 4PM4A 4DBLE 3IOBA 1GQSA 5FR2A 3VVCA 2E6XA 2WD7A 4PS0A 1MZVA 2PYIA 1P3DA 4L0QA 1UR5A 4Y6SA 3GWGA 1VYHA 4BATA 5SY9A 3YASA 2OBNA 1VKRA 1Y5NA 3NTVA 1KZ9A 2QI9F 5JC1A 1RQPA 5IKXA 2OGSA 2QRPA 4YAUA 4EGJA 5FWDA 1J8YF 4C4XA 2EX0A 5JJCA 4CM7A 3FUWA 1V1MB 3OWHA 4QO8A 5HDBB 3ANSA 2QIEB 1MRZA 3ZTWA 1SJHD 3EOAI 4DLNA 4GXTA 1T4CA 3DDSA 4JA0A 5K05A 1WMAA 2FQ1A 4IV8A 1ICIA 2QYTA 1FP1D 2RI0A 3KVVA 2ZM6B 3F7NA 2M98A 3KSMA 1QNFA 3NHKA 4LE2A 4QAQA 4QTYA 5AUIA 3MWEA 5KOJB 2W6JA 1V1JA 4N5IX 1XDGA 4Z4IA 3AY0A 2H4HA 1V7ZA 3MSXA 4FYJA 1XVVA 3RFZB 2A4KA 5J2TF 1CUFA 4WZZA 4RTMA 1MLDA 2NVBA 1RRKA 1ZDXA 2X41A 4PHTA 1KYIA 1Z8HA 4K7WA 3AO0B 2CUNA 3O74A 3QYPA 1C76A 2RDBC 1PS9A 2E9SA 2YV3A 4PLFA 1SOVA 1RYJA 2J9FA 4UDUC 3UJ8A 1U0LA 1AK1A 3I92A 2V6GA 1HOXA 3I6ZA 1CNMA 3IUQA 4F2DA 4POOA 3KHUA 4M76B 2FSGA 5DTJA 3E8SA 3FFTA 4EMTA 5A03A 3FF1A 2ZIAA 3GRVA 3UJAA 4Y8VA 4GPEA 2AFIE 3EIFA 1IY0A 4YQZA 5TSDA 3IALA 4DR7B 1F0KA 1Y7TA 4UXJA 1I5EA 2H3HA 4Z86A 3TJMA 3HA7A 5L3VA 5ALLA 1CK1A 3L8EA 1NX9A 5B3AA 2CXOA 2RGBA 4FGUA 4JJAA 2B5OA 3PFBA 5ED4A 1NENB 2GAOA 2WIDA 3RB8A 1UBEA 3PRHA 3PNPA 1USUA 4FFVA 4YJ2F 4DCGA 5HUQA 4O4IF 4FKMA 4GU5A 2QTVA 4FSHA 4LKRA 1FLAA 3QQ8B 1PUIA 3FUTA 4LVOA 2H92A 3P9XA 1PT5A 4Z1MA 1ZW1A 4EJ2A 5KKNB 3ER6A 4TRRA 4EBBA 4EK9A 1HDRA 2AL7A 2OFXA 1OLOA 3MD0A 4IGKA 3WTBA 3GFPA 1G8SA 1RCFA 3NZ3A 4FJYA 4CO7A 1LBTA 3FCXA 3H7AA 4QXPA 3KZMA 1ZXLA 4O25A 4YMVA 3V5NA 3H7IA 5MGNA 4TV8A 4FZ3A 4I66A 3IE1A 1RCTE 1THGA 2QVGA 2OWDA 1VJ5A 1WH3A 2IYQA 4M9UA 4O08A 1USVA 4BNIA 1AXEA 2OCDA 1J5EB 3PS6A 1DV2A 2QHXA 4EYKA 2I2CA 2YMQA 3IHPC 1MJ5A 3K72B 4M1TA 4OB7A 4QFCA 1M8KA 2FOIA 4H1TA 5F5NA 5I9MA 4WK4B 4EG3A 3AP3A 2O3SA 4MGZE 3FNRA 3ACBA 3OPYA 2GVZC 3LX5A 4QDOA 4CMAA 1HE2A 5BPFA 4WKGA 3I8OA 3TK1A 1PLJA 3IT6B 1FEZA 2VK4A 2M32A 4OP2A 3SK0A 4C06A 5DEIA 4UBKA 5FWXA 5ICGA 3E1SA 4JK3A 4S1PA 3MINB 4DPMA 4NG5A 4BFRA 2WWZA 1P4AA 4UPVA 4CIBA 1Y3BE 5BQFA 1KM7A 3NIDB 3AU9A 5AJYA 1DXQA 4CQJA 3G89A 2HOQA 5KUTA 3MOSA 5DTMA 4IIVA 3CF4G 1GPJA 1FRVA 3HUTA 1QIFA 2FMHA 4ILKA 4P1ZA 3LJ3A 4QVIA 2N1MA 4BVEA 4A6QA 1P91A 1ZJ5A 9ABPA 3FGZA 2J3KA 1KRWA 1A69A 3DW3X 2YR0A 1XZ8A 2J7PA 3IS3A 1TIPA 1PV4A 5ARDA 3I12A 3N70A 3STWA 4LIPD 2ZZMA 3OTWA 3W5CA 3BWYA 2IYAA 4F8EA 2CC2A 4Q03A 1VSQA 5ERXA 1YCFA 1L2TA 3FWKA 3G85A 4DRXA 4JXZA 1PUXA 4KUGA 2XW6A 1CUGA 1J90A 2AYZA 3CONA 1KEVA 4G2TA 3IAM1 4YLGA 5U4QA 2IS4A 4IP0A 2WFMA 1PYGA 2DUJA 4IEFB 5EXEA 1S9DA 3CRZA 3ZJUA 4WDQA 5G0WA 4W63A 5BQPA 3IEMA 1IN1A 1DO0A 2BYFA 1QFJA 4LS3A 4JLBA 5AOBA 3HVZA 4MW4A 4XWKA 1A9SA 1WCXA 2Q5LA 1ODSA 1QYIA 3N2GB 3O0TA 4WLVA 3WK6A 4KIWA 2D2VA 4PLPA 4FONA 2XZLA 4U00A 4BLOA 3M3HA 1IZZA 3FPCA 3G2IA 3OTGA 4REZA 4QD3A 5IN4A 1ORHA 3TW6A 2BFEA 1MN6A 4UW9A 5EXTA 2HF8A 1VE7A 4U3JA 2BBOA 3CM0A 1IBXA 2BGIA 2VHZA 4GM0A 1L0XB 1R0LA 2WPNA 1W4BA 3MWJA 4LDNA 3RK1A 3WGOA 2IYWA 2PH3A 2OZEA 2DERA 3K9QO 1Z4PX 1GAXA 3U4QA 3WANA 3W05A 1V8ZA 5HI1A 1WNTA 2XE4A 3FDXA 3VPAA 4W9NA 1G8FA 2P4UA 4WXMA 1UBKS 3TSZA 5E6SA 3SIWA 2GARA 3QMWA 1D4FA 3AUYA 4ZU6X 3VO1A 4XFKA 3C3EA 2KD0A 4B3HA 1HKUA 1YUNA 2G6BA 4U7FA 5D7NA 2GJ8A 1AQ6A 2HCTA 4ZK2A 3WLNA 5HWSA 4NY0A 4PN3A 2GJ4A 1R0SA 2Q2OA 2QM0A 4YUVA 4CTMA 2ZRIA 4XVQA 2KJQA 4F5EA 2J0KA 4BKSD 3L6DA 4JSRA 5JNRA 5F7ZA 3VJMA 2OBYA 3KP1A 5D6NA 3EEOA 1ADYA 1DRWA 2GETA 2WMYA 2X7HA 2ZU0C 3R7WB 2BMFA 3QFTA 1NDQA 2P9GA 4RNAA 4IDOA 3R9XB 2YVKA 1NW9B 4KAFA 1V8OA 3EJWA 1DCTA 3OY2A 1DADA 2O5CA 1FMLA 1KTVA 1JHZA 3UMMA 1QIMA 3W2EA 5AUPB 3MS2A 3JVEA 3DTTA 1WHTB 3IIIA 4TN5A 3RJ5A 5B7GA 2F1KA 2IHTA 2Y5PA 1F52A 2O2GA 1VL5A 3IBTA 3DVGX 3MHZA 3KRTA 4UARA 1IJEA 1TPYA 4JB3A 5CJPA 4P33A 1ISMA 1CY0A 2CF5A 3OLMD 1E79D 2G08A 2GCIA 2QB5A 4E2ZA 1TM4E 4O02B 4RO0A 1Z25A 4V2IA 3Q3CA 5IM4F 3NTLA 1P0IA 1N9ZA 4F4UA 1U7UA 4OX9Y 2PNFA 3COPA 4BX0A 2KQSA 1UJCA 1JJIA 1W73A 1Z5WA 4G4SP 5KKAA 4K3CA 2WJJA 3DHNA 3AG5A 1J42A 3TRHA 4P3NA 4G11A 1QGDA 1RM0A 2LCIA 2NU6B 3CS3A 2Y2VA 5JZEB 4R1SA 4RK1A 3RUCA 1PQWA 2G5TA 1YMUA 1HQYE 4OJTA 4ER7A 5CA0B 1W44A 5F1KA 4HHEA 1FXWF 5LP6F 5IAOA 1Q92A 4MW9A 3BXHA 4UNIA 2YASA 1WL8A 3P1JA 1SRQA 4BRWA 1MJGA 1PTJC 2ODBA 4BGVA 2QYSA 1LTHR 4HK2A 1DVRA 3WYAA 2JU6X 5LQNA 2YZNA 1AW7A 3RWOA 3NQ41 4BV8A 3WAGA 4RC9A 1EFAA 2YH2A 2OGUA 2FEOA 3X1YA 1PG5A 1G7SA 1Y6JA 4R6WA 1OYWA 3TQRA 1KZYC 1PUJA 2NZYA 3B9PA 3KOWA 2HJ9A 4ZRPA 1ZOLA 2BJHA 3QKSA 4G4JA 4ZC8A 3FWYA 2VJPA 3QXHA 4V24A 5J1SB 1HQKA 1P2BA 5KMGA 1OH7A 1P1BA 5CM8B 3OEED 1R0RE 3NVAA 2PJZA 4Q3NA 3CZMA 5DHAA 4RXTA 3F90A 3IV7A 2WXFA 1QOGA 1XD3B 3P4PB 1G4UR 2F3SA 2AT1A 2BUAA 1ZD3A 2NTVA 4P81A 1PWXA 5D3KA 3WK4A 1JKIA 1OT3A 1KY3A 4B40A 4D2IA 4RANA 4F9FA 1BH6A 3ESZA 3Q3HA 3ICPA 5A5FA 2DFKB 2A5LA 3HNRA 4PK1A 3WXBA 1AKRA 1D3ZA 2K8BA 4BB6A 2KTRA 1LS6A 1ZN8A 4D44A 3PC3A 1QOBA 2R2QA 1XDSA 3EAFA 2JIDA 4IMPA 3EWNA 1UKAA 4WIPA 1PJQA 1YZVA 3QVTA 1YQ4B 2XMPA 4UU1A 1IYZA 3V48A 1GSIA 1ISFA 4AROA 5EEHA 3DLAA 4A0GA 3JQ6A 1T1RA 1U4NA 3DE1X 3GB1A 1BMTA 4HAOA 4QTXA 1I4EB 1XEAA 4QG3A 3K30A 1ULAA 3ELYA 1O97C 2AXEA 1SBZA 1SG9A 1A96A 3IVGA 4CDNA 2DB3A 2HJ1A 3DDNA 3FSRA 3M6UA 4OMCA 4W8HA 5K8TA 2N46A 3K8QA 4P4LA 4ZIRB 4O2AB 1BUIC 1T6BX 1WUIS 4URXR 2IGGA 3ADKA 1JFFB 4DY6A 3AOEC 3BB4A 1OBVA 3VTFA 2PL5A 3FNBA 4HDMA 2AMFA 5ECWA 2ZUFA 2C7OA 3ETDA 5TSSA 1MPTA 2ZIGA 3FZYA 1YBHA 4X8LA 3M7IA 4G37A 3DZIA 5JUWA 4DR1B 3I62A 4GLJA 2I3AA 5BRNA 3TQHA 1UBNA 2EFDB 2F8MA 4ZI7B 1X1DA 4MQ6A 1CP2A 1NN3A 3HMKA 5BWOA 4CKCA 5C23A 1TFRA 1UANA 1FNUA 2H88B 1Y89A 2JK0A 2ALJA 3I4LA 3M3JA 1XQWA 4IF4A 4URKA 1A0OA 4AXBA 3TIXA 1CK4A 1FMJA 1GRQA 2PSJA 3D0RA 4QYWA 2YRWA 4ITVA 4ZCPA 1E2NA 2PQ0A 1I6MA 2ZJ8A 3D8UA 3QUTA 5ILQA 3WADA 1FSPA 1ROEA 4JPSA 1YQ9A 3DZDA 2E4UA 5CVJA 4IDQA 5CB4F 2WWYA 1J9ZA 2O20A 4ARZA 3JYLA 4P5DA 3I1IA 5LB4A 3PC6A 3WLJA 4BNNA 1NQXA 2OHIA 3B1WA 2NPOA 1LJLA 3ZI7A 3E9QA 2JFZA 1Q0ZA 4DBGA 2F55A 1A5BB 4KYUA 2UVDA 1QVWA 3PICA 3THWB 1I1NA 1WB5A 1YGYA 2GR9A 2P4EA 3GG2A 1ID1A 3FPHA 4JAVC 4N18A 5B30A 5L6LB 3RYFB 2ONYA 4G4SO 2DJIA 1PFUA 3G8AA 3MW8A 3GB9A 3OE7A 3NEYA 2ZPNA 1GNPA 1P72A 2CZGA 3EXIB 1G8HA 3O0DA 1FPYA 1U7OA 3PKZA 4IHQA 1G3MA 1DLJA 2GWHA 4O2AF 4PHGA 5K0BA 1YO6A 1ICEA 2JLCA 1MQSA 4C0AC 2XUHA 3SQXA 4ZYNA 4BYMA 2EMSA 4FJZA 2ZYDA 4CIYA 3CX7A 1V41E 3V42A 4DA4A 3IP3A 2FI1A 4LY9A 1U0GA 3AYZB 3DS8A 2I6SA 3OZSA 2OCAA 4OUDA 1GTSA 2I9KA 2K0PA 2AXNA 3MM4A 2W9XA 3SBEA 1FFCA 2A6PA 1ZH4A 1WX9A 3JYNA 4BPRA 3IUPA 4CI0B 3S8EA 3H5WA 2R47A 4TL8A 1OVGA 4LDTB 3WQRA 4QTZA 5E6NA 1GPBA 2RPVA 5J4VA 4XC2A 2HJHA 4ONEA 1C4KA 2ZCBA 3B13B 3KZ1E 1UADA 5CDFA 3VR9B 4RF2A 2GAFA 2BKXA 2YL2A 4BVLA 3MC9A 4NG4A 3VSBA 4HDSA 1I6LA 4OF4A 5EP1A 3LYYA 1H2XA 4TL9A 3SIXA 2YHSA 2CMDA 1VHDA 1RRMA 4I8DA 3OFNA 3BSSA 3O8QA 4HDSB 1LV8A 2F3PA 4HGOA 2VJMA 1U1FA 1ZD4A 1RQ7A 2LWIA 3D7RA 1LLQA 3A27A 3OIWA 1K66A 3TQCA 4CLHA 1JH9A 3R24A 4H7KA 4RDCA 4Y2XA 4JQCA 1XAJA 4M22A 4TUUA 5GMOA 1Q91A 4BEJA 4DB2A 1IG0A 3F97A 4PWZA 1SD1A 3TAHA 4X97A 4INZA 5JWHA 1HE4A 4AY5A 4DCMA 2BDTA 4YUZA 1OZ0A 1QGED 1WXGA 2Q6TA 2FFHA 3GGDA 1JAHA 3KHTA 2L69A 4WRRA 3VU3A 3ZNOA 4IG7B 1LB1B 1Y0BA 4DQUA 3UEOA 3TEXA 2BKFA 3CRRA 3LVFO 5LIPA 3GLGE 3T5MA 3VRAB 1XZHA 4MUEA 1PWEA 2ZKLA 1VECA 1JTEA 1OY1A 2JA1A 2Q9CA 1R8QA 3NFYA 2PX2A 3TRKA 1Q6YA 3MUEA 5E7QA 3AE8B 1ZICA 4JODA 5EWLB 5KSZA 3EUWA 2ZNVC 4WX2B 1U1GA 2CU3A 3H8SA 4NOKA 3RRJA 3SAJA 3T9FA 3N74A 2I4OA 3K0CC 2GZ3A 1T1JA 4FQ5A 2BFBA 3SHFA 5BYQA 3R3VA 2HT1A 1KFKB 4G5XA 4CMGA 3R66C 5LKRA 3ETEA 4PQEA 3PVSA 3G17A 2C2YA 4HTFB 1SK9A 4IXWA 4ENPA 4OQZA 1KF0A 1KWKA 4G1CA 4KZ0A 1I4PA 3GEGA 2LVQA 4R1PA 3RRXA 1FMFA 1J8VA 2WE7A 2Y0PA 1ORTA 2HCJB 2RSLA 4EY3A 5IWCA 3DMTC 3KSUA 5CXSA 1RT9A 1R16A 3PO0A 4FSDA 2AUTA 4TV9F 3AR9A 4QUIA 1T91A 1KI7A 5ALNA 2Y3AA 2ZBQA 2PUHA 1WKBA 2C98A 3ROTA 3T9EA 1KSGA 4DYHA 4ABTA 1TYBE 3AF1A 2G9HD 5CAEA 2ZR8A 3OQPA 3WFJA 3I9FA 4V0MA 4ANFA 1XQ9A 2JGDA 2FW9A 2V3NA 1I30A 1X7XB 3RBAA 3W9YA 3JWEA 3BD7A 1PDVA 2WA1A 1JA9A 1XU4A 4MVJA 4WCFA 5CUQA 4JI2B 4I7EA 2XNCA 2P2NA 1BJRE 4Y6OA 1IK6A 3TOZA 2O8CB 5EWMA 4BRZA 5JHHB 1TUEA 4X0EA 2QGNA 3GUZA 2JH8A 3BWCA 1A5TA 1DCMA 2FW1A 4UM7A 4UQPA 3WJAA 1JIVA 3W9CB 3EFCA 2AZDA 1K8XB 1RWNA 3BFPA 1ZQ1A 1EA5A 1OFUX 3KJGA 3I42A 4K1LA 2DPHA 3TD9A 1WDLA 4E5NA 3FDJA 4IIFA 4YPVA 4JYZA 2IO2B 2O8EA 2PAAA 2A35A 5EMLA 4ND8B 5TMEA 1AMNA 2ATVA 4HWRA 2AKYA 1FPQA 4GBED 5J2RA 1A9PA 1WDMA 2EU8A 1GT6A 1MA0A 3NO4A 5DHPA 4ZTBA 3ZW9A 1XQ1A 4EPXA 2PU7A 3D4LA 5KJEA 3A05A 1M54A 2F17A 1AQJA 3VV3A 1N6ZA 3W1YA 4W9JA 4M89A 1OIXA 2GZSA 4LNIA 2D7DA 3LKVA 1PGAA 4KVGA 5BMVF 4RA9A 3DBLI 1V9LA 2I6QA 4MW7A 1KDRA 2W4IA 3APCA 2XCQA 2KK8A 3ZWOA 5KYTA 2WUEA 1EE1A 3SC2B 4H2DA 2QPLA 3I23A 1QX3A 3MIZA 3CGGA 4I36A 4IIBA 4HWTA 2I2FA 3EXHB 2R0QC 4KBYA 5EHQA 1E9RA 1CUEA 3M33A 4DMGA 1NNEA 5T6BA 4HDKB 2JJ1D 4CMEC 3QU2A 2I33A 2PVGC 1UBCA 4WV3A 4ARCA 5K5EA 1HT2E 4MS4A 3R8CA 2P5TB 2MSED 3T1NA 5LN1A 3BJMA 3PWTA 2J0QA 1G9SA 4LJ5A 3BGSA 3PTZA 4MS4B 2IP2A 4C76A 1J5XA 2IHUA 2CJFA 3UMCA 2ZDQA 1TX4B 3ZXVA 5TVGA 3H0KA 2FFJA 1E32A 4LVUA 4BHTA 4IRUB 4DVJA 1EMDA 1TZOA 3PHXB 1SR8A 3EDQA 3NALA 5K99A 4KWEA 4M1WA 3P4XA 4BLWA 3R6TA 1P6UA 4BNHA 1BVRA 1LDYA 4GF5A 1NVXQ 1YDFA 4MYUA 4J2HA 4WE3A 3CVUA 5CU7A 3D8NA 4EZJA 3RWBA 3EGRA 4O29A 4CHTA 2QUBA 5HBGA 1B23P 3ZNZB 1R1DA 5I5GA 1XVAA 3ZH2A 1SKBA 2GN0A 3K8ZA 4I6NB 2EKPA 3NHSA 4FW8A 1JR6A 3NT2A 2J0MA 1FS5A 1G6KA 3KTAA 1WSPA 3AVQA 2ZT7A 3NIGB 1BE6A 3KR9A 2JGJA 3QOXA 1O94A 3IAS1 1N9GB 1P74A 4TUYB 4KYIB 5TS2A 4EJSC 3S5UA 4BB0A 4RTLA 2AKAB 2ZI3A 2FU5C 3V8BA 4TT8A 4WQMA 3ZE8A 4FFDA 3NV9A 2Q7OE 3QNMA 4WFIA 1GYPA 4TTQA 3KQVA 1VCMA 3SYMA 3WMRA 1YL6A 1ULTA 4D8TA 3L0BA 3T7CA 5CK4A 5EIAA 2W2TA 3E8XA 3ITDA 3A28A 4FOPA 1JH8A 4LXXA 3W2FA 5TV2A 1FB5A 4IQ8A 2Q0SA 4M3NA 4WBNF 4JELA 4QHTA 3G2KA 1K3TA 1NZDA 3PV0A 3GJ8A 3DEIA 4HP8A 3EARA 4MITA 1KBOA 3MJSA 4UTPA 4O2BB 1ZONA 1A2OA 4G0NB 3GFTA 2FWIA 3JQ8B 4INPA 3RW9A 3U3XA 1ADGA 2RD2A 1Z63A 2FDRA 1DQNA 1C0PA 2IEYA 2JHAA 3AZPA 3DV9A 4RAOA 4IWPA 2NTEA 1CRPA 4KQ2A 4OVZA 5AVRA 1IBRA 5KKCA 1OR8A 1TM3E 4Z1MD 1ZMRA 1DEXA 2IPMA 3ABVB 4HC4A 4HV4A 2WXJA 2AHOA 2HB6A 4IXDA 2ON6A 4REOA 3O9MA 2OPBA 5B2EA 4NPCA 1KOLA 1FNWA 1X42A 3DVRX 4K9OA 4PRZA 4TZ6A 5BNIA 4FBGA 5DNVA 3KYCA 3VXWA 1NULA 2LE0A 4KHZA 2AG5A 5C1OA 4LOLA 2VCEA 3C24A 1VLQA 3RVDA 1B1AA 4D0NA 3P4YA 2IXBA 1J1IA 3N3AC 1H4SA 3D5QA 3WLEA 1BVHA 3O8BA 1SCQA 3LY7A 4ENVA 3KHSA 5IJ9B 1D0VA 1GITA 2FG5A 2IPNA 4JLOA 1JFFA 2YVQA 4US9A 2F90A 1D1TA 3DFFA 2YNMD 1WIAA 3N7TA 4F46A 3O7WA 3H0CA 3W9UA 4JY7A 3NIFB 1ESFA 4KIKA 4W9MC 3TTWA 2JC3A 2EKEC 1J0AA 3RVJA 4UUBA 3OIVA 4X57B 2E87A 1AF4A 2H7XA 1W19A 2P6PA 2DR2A 4KO1S 5UKDA 3CNHA 1XD9A 1KMCA 3QFFA 1MPEA 2WUFA 1WCWA 2X4GA 1MORA 3W06A 1WX1A 1JWAD 4HWGA 1JEDA 2XDQB 3UB3A 4DLWA 4ZALA 2YQ5A 3JX9A 1LCIA 4XXHA 3JQCA 5DMHA 4QWMA 2BZGA 4RGNA 4CMJA 5ICMA 4MQBA 2ZITA 4W5TA 2QJOA 2CSUA 4JWUC 2EJWA 1FSZA 2XCUA 4FADA 1STEA 3ZUNA 1ORWA 3T34A 4ETIA 5JZMA 3FLMA 3PGJA 2AKEA 5IBQA 3T7SA 1H2HA 2F8LA 4RUKA 2ZQ5A 3DT6A 2QENA 4I3HA 1KDPA 5CD9A 2BMVA 1FP6A 4MW5A 1YDWA 2JIBA 1ZYUA 4OEHA 1FXIA 1OVMA 4WN9B 2D5GA 2H4WA 4J0HA 8LDHA 4W5JA 4ANVA 1IN8A 3H5OA 3W6OA 3QPVA 2VUSA 2E82A 4WD3A 1X1CA 2AOTA 2WTBA 5J47A 2GNPA 3PNKA 3TD2A 4DKJA 2NUBA 4F04A 4DWWA 4UHDA 2GXQA 2ZRAA 2HXYA 4MVJG 2Z95A 4MZXA 3ZV4A 2V7QD 3B5IA 2BVCA 4DIEA 1CDEA 1CVIA 2DM6A 1ISJA 2VSXA 3VKHA 3T61A 1N5RA 2PRSA 2HGZA 2WEKA 4DUYB 4L73A 1YI0A 1UWVA 1FVHA 3AV8A 2BT6A 1DT5A 2ZUDA 4LBYA 2AI1A 1DAIA 4JYCA 1BTOA 3FWPA 2LJ5A 4HPPA 3D6UA 2C2GA 3ADCA 3L0OA 1UINA 4H7HA 3WQSB 4OSOA 1TM5E 3IPCA 4M0WA 2ACWA 3RFXA 4B74A 3TZCA 1RWPA 3QWAA 4G41A 1SZDA 3QE3A 4BE7B 1X92A 3ZDFA 1CS0A 2QZJA 3PSEB 1QO9A 3I04A 1XCTL 5D51S 3UA3A 3A58B 2WSMA 2ZRHA 3DOOA 3SSNA 1WM1A 2IZ6A 1G3QA 2ODNA 2K7FA 2WQ7A 1UJBA 1E9CA 1I33A 1NBMA 3NB0A 2HLDA 1D1PA 4UMDA 3TW4A 2A8YA 1ZDMA 2O2IA 1D2EA 1RE1A 4OW0A 1DOHA 2NT3A 3SDBA 1XEFA 3K0BA 3ZCTA 4ES6A 3NBMA 2ZJBA 4XQ9A 4GDFA 1GOZA 1ESMA 4RA9B 4EFMA 4C88A 4XTRA 2VTBA 3W5AA 3F3KA 1E3IA 1FBNA 3T3GA 1U11A 2NYUA 2GJAA 1E1KA 2YQ4A 4I5DA 4HXDA 1L6RA 2QEQA 4WWPA 4HYQA 3VZPA 2PSFA 5EJ7A 1C3TA 2FR1A 4XB2A 4DJDC 1H1LA 2D07B 3AI5A 3ACDA 4RVNA 5LB2A 2QNBA 2O54A 5AZGA 4M9RA 4BFWA 2NV6A 1LVUA 4ISBA 1ZW7A 2XSZA 4QEKA 4OFZA 3F6EX 3NGLA 2DZJA 4K86A 1G6HA 2BM8A 1NYQA 3GBSA 3W3AD 3QLUA 4ZJZA 4UE3S 2UZ0A 7MHTA 1Z34A 2I1WA 5E8JA 1YHYA 3OA0A 4TLBA 5ENDA 4NL4H 3WI7A 1DIBA 2QUHA 3IMCA 5BN3A 2NU6A 1UPTA 4W5RA 1JHRA 2C3PA 2HCFA 3OQJA 4P0QB 4MYCA 2R2AA 4Y9RA 1JJ7A 1AN0A 5EERA 4O5AA 3PX3A 4C4OA 3N75A 4ABYA 3NS8A 3H6NA 5EE1A 1XAGA 4OGKA 3X1KA 1B6TA 1Y1RA 2NPIA 4B6SA 1LNQA 4UUQA 3RF7A 1KIMA 2VRRB 1E59A 3FF4A 3NOQA 2IUEA 1FDVA 2XRFA 3R5TA 1SXJD 3WP0A 2JVJA 1EIZA 1WW2A 3H87A 3VJKA 2GXUA 3B38A 3LV8A 1LFDA 3BGIA 5FF9A 721PA 5I01A 4J91A 1LI5A 4NZOA 1CRQA 2XN9C 3A25A 2BV3A 3W4KA 3S7TA 1R4NI 5I8PA 4GL2A 4NZYA 1AGXA 3B1VA 5FOXA 3DVNV 4KP7A 1T25A 1QF6A 3FMPB 3JD2A 3PPWA 3BXPA 4TT3D 4AJEA 3F2VA 2VDWA 3IQEA 1VI5A 1I2ZA 1GP2A 3PA8A 3ND9A 3QXGA 4H77A 4L3WA 4C6SA 1H2ZA 4QJ5A 2JEOA 3LCRA 3LOPA 1Z33A 4PHCA 4Q4AA 1V2HE 3W5DA 1GDDA 1YX6B 3ZK9A 3BD9A 3FOFC 1HURA 1ZMBA 1Y81A 8MHTA 1SNYA 4RY9A 4Q4HB 3DDUA 2O59A 2EGGA 1PQPA 4C2AA 1RHUA 4GP7A 4PQRA 2GO1A 5J40A 2YCLA 3G1TA 4C1BA 4QM7A 2WXKA 2DWUA 2QTRA 3KV1A 1VL6A 1J20A 4K28A 3Q2KA 5EUCA 2YWBA 3CA8A 3VYUB 2CLSA 3DL2A 4C7XA 2BDEA 2PGIA 3K0HA 3UVEA 3DD5A 4W6QA 4P1CC 1E3QA 3BCHA 3L84A 4LRQA 4BUJA 4EGSA 2EBFX 2ILTA 4L78A 4U2DA 4Q01A 3RSZA 4D9HA 5A4DA 2PFSA 5AW3A 1QF7A 4A15A 1ONPA 2WF7A 1N5OX 1RWBA 1U7TA 2BBSA 5AH0A 3WS7A 1TYDE 3NRBA 4K6HA 7AT1A 1J0BA 1Q50A 3BHIA 2GBPA 1S89A 1TVCA 4GLLA 5A7HA 4DL9A 2OM6A 4B3DA 3GLHA 1R15A 1VMAA 2YY5A 3FSJX 3MJDA 3GPCA 2C2HA 2G76A 2H31A 2IHKA 4X60A 4HUQA 4MS3A 1FCCC 4MVJI 2PE9A 3VX4A 3OKAA 1YB6A 2II6A 1J7KA 4EFKA 3BGVA 1UBSB 2H0AA 4V0RA 1QOFA 4MAFA 3W90A 1PHRA 4IGFA 3AB5A 1CBUA 2XUFA 3JV7A 3KU1A 1T9BA 2CLDX 5MDHA 2IQIA 2ZBUA 3PIDA 4E2YA 3RC7A 4DFDA 1E4YA 2PZMA 2C0CA 1H6AA 4PX2A 4X44A 4YJ3A 3O91A 3B1YA 4E94A 5A4MS 3IFSA 1MO2A 1N2ZA 4IXNA 3HVUA 3F1KA 2P5SA 4OA5A 5GJVC 4A1OA 3QAQA 4OLAA 1Z82A 4I5EA 4H3SA 3PDCA 1V16B 4HNQA 4EB0A 4RKYA 3GAMA 1DTWA 1EXVA 4MQEA 5BNTA 5IBPA 1F1HA 2G40A 2IHVA 3B78A 3HEAA 3EEIA 2NSDA 1P33A 2PL1A 2Y2UA 3T3HA 4JI3B 2BC9A 3DD1A 4Y7CA 3PF9A 4KGVA 1QG4A 1C3JA 5CHYA 3QKIA 4AO6A 2Y92A 4A0FA 3VX3A 5BR4A 4QUDA 1GFZA 2KLBA 4YPFA 5AJTA 1AKQA 1JPUA 1KORA 4IQ0A 5G0SA 5I9TA 4ZI2A 2IDMA 2Q41A 3MJRA 3DNFA 2JVKA 5KNCA 4KQ1A 4RZ3A 1Z17A 3L0SA 3RC3A 1GAQA 2AG1A 3CYFA 4KR9A 2K2QB 3BILA 4Q00A 1KSFX 1SIJA 3LVQE 3MRXA 4ZPXA 4KEAA 1RLTA 4OHKA 2G80A 4FE3A 2K6DB 3BWDD 3KB6A 3P2EA 4KW7A 2OO5C 2IJ0A 1YUBA 2O1WA 4WA7A 5AI5A 4DLAA 3O4IA 5M29A 4C22A 1E0KA 1KKMA 2EWMA 4GL4A 4NJOA 1QE0A 4OOEA 3OQIA 1PQSA 4DDID 1QRSA 1EESA 3NAQA 4PINA 1ZKHA 5CB0A 1QS0B 2SCUB 1QYXA 3QA9A 1U8FO 3GG9A 4U5XA 2CE2X 1ADCA 1FVOA 4MUNA 1FLDA 4AX4A 4KIGA 1B00A 5IAAA 2VNHA 4ZKDA 1QWSA 2CLOB 3HVKA 4KH0A 1KDVA 5K20A 1ULUA 4BBNC 4RXUA 2PO7A 5DBFA 2C03A 3F67A 4A0RA 1QVAA 4QDZA 3UJ6A 1H4RA 2SHKA 2C3MA 3UAYA 3RTEA 4OPMA 4RLHA 4ESHA 1K8RA 1A4IA 2N7EA 1FFSA 1H42A 5JEEA 2CNWD 4X62B 3GD5A 3V05A 5A71A 4L74A 2DAPA 3OMLA 2O6VD 3G2PA 3AR4A 2BFBB 4I6LB 5KNDD 2GPNA 4YIKA 2G9VA 4ENRA 1JEYA 4TKUB 3IULA 3RNLA 4V0QA 5JXGA 4G50A 4K3BA 1J0DA 1JU3A 3AMVA 4TTTS 3D3KA 2VQDA 2HFKA 3MQ4A 3D54D 4YJ2A 3EBPA 3SYRA 1PDOA 2QR2A 4J03A 1I2AA 1XYGA 1W0KD 2HMUA 4WJZA 4E09A 3AI3A 4YXWA 1B0UA 3HFGA 4BZWA 1L5SA 1RIIA 1K8RB 3HBLA 1JAYA 3AU5A 1FNCA 1Q1ZA 3PEWA 4D56A 5E6UB 3U4EG 4TWZA 4DSNA 1WPXA 2D0OB 1QTQA 1GDHA 2G28A 3O92A 4D0LB 1EXMA 3E5RA 2ID7A 5COAA 1NXTA 4ZCLA 4C56C 4KN9S 4ZVOA 5BSKA 1H5QA 2J4XA 1YJAA 1X7ZA 2Z2XA 1GLNA 1RRFA 3GFRA 5HW0A 1I3LA 3ONVA 2IU0A 3AH8A 4NXNB 1ESNA 2H1CA 2HIGA 3HB1A 2C88A 3AHEA 3DHGC 4FNAA 2ODPA 2WSLA 4PYOA 2XNAC 3A8TA 1G8GA 4C89A 4ZOBA 2C2WA 2R79A 4OREX 5D1NA 3R3SA 3P2YA 5F3RA 5EJAA 3OOSA 5GOZA 5H3CA 2ZUBA 3ED1A 1KGSA 1LSOA 2JIRA 4Q21A 1P62B 4KVGB 1QIIA 1AC5A 1FP7A 3B89A 3DQPA 4Q48A 2O0LA 2Z98A 1IQUA 1QGAA 1ZEJA 3K2BA 1DXOA 5LMUB 1YVRA 4Q1BA 1FIQA 2YIJA 2Z83A 3CKMA 4WAAA 4OHVA 2FMFA 2M56B 1U3VA 3MHSD 3TEFA 2F62A 2BL4A 3TMPB 2IUYA 3ZCRA 3WLKX 4DQXA 4E31A 2AQHA 2POCA 1EUDA 1DRVA 4NHEA 1P7PA 4YSZB 4CUZA 5JJ5A 3SDLC 1FYDA 3ZE0B 5MHTA 5JHAA 1IHUA 1KAMA 3V6MA 3KX2A 6AT1A 4W6ZA 1JQBA 4BNGA 1NW6A 1ZCFA 2X40A 5IASA 5GIOE 4D6YA 3PE3A 1W30A 4ZRIA 1T2CA 2QMYA 3N1ZC 1HRKA 1SCUA 4JL8A 4MO2A 2QTCA 4Q3CA 2QRLA 1E7WA 2VKTA 4B7CA 3TNYA 1S1CA 3FTEA 5JHGB 4R1MA 4AG6A 5F73A 1NJ6A 3FZNA 1NVKA 4XM2A 4YLYA 5FYDA 4ZYXA 3DM9B 3IQZA 1XALA 1B16A 5AO9A 5FOVA 5HPYB 5GM2A 3HADA 2VQ3A 1LK5A 2BTQA 4IH4A 2XAUA 3O1HB 1L5HB 1KLUD 1JNXX 1WV1A 1CQVA 1PR3A 1ZOSA 2QNRA 3FVVA 3KKKA 3LT5A 3A6FA 1Z0IA 3D8BA 4H0NA 4HT3B 4CKZA 4QFBA 1SUPA 1F2UB 2DE0X 2FPUA 3TFQA 4BMXA 3LP5A 4BO9A 2JFGA 1C81A 1R2QA 3K1AA 4J0FA 1IWOA 3KC2A 4DV7B 5FI3A 1U1IA 4XJSA 2A57A 1U31A 1DWPA 3RYTC 2BRUA 3DLBA 1U98A 2GCOB 3G8CA 3V4OA 2ZRJA 3R7DA 5HJ7A 4R41A 1KJWA 4ZRMA 4KAJA 1N6IA 1WE7A 3EYAA 4O4JB 2FN3A 4MYSA 4RZIA 3ZYZA 5HSGA 4BKMA 4ETMA 1M5RA 5KTYA 1O6CA 2QYHA 2K5PA 1QCCA 1THZA 3EDOA 3GJ0A 1P5JA 3VOBA 5B4UA 3D6TB 1QP4A 5GINE 1P81A 1X87A 4J1TC 4DEYA 5B3LA 1H9CA 1EINA 2QW0X 1D4AA 3LDGA 3NIWA 5SY4A 4ARBA 4OMDA 4LVCA 1WMHB 4R9VA 3D81A 4DCJA 3MMZA 1D2AA 1OKKA 1MG5A 1KY2A 4JU9A 5EIBC 5C0OE 3WBJA 2W4MA 4PC2A 1C8KA 3ZZMA 1XTSA 2R86A 3TGPA 4N6GA 1LV7A 1WBDA 1HXHA 4OZBA 3R75A 1QRDA 1I4RA 5KIAA 3BCRA 2YNMC 4K3UA 1S3SG 4IWQA 1SZJG 2ACVA 4W1PA 4YC7A 5BN4B 5J2UA 4IDHA 1IOWA 4FT4A 4WWOA 5KX5A 2VP2A 1PJSA 4EEZA 1ISPA 2XYGA 3BRSA 1FUUA 4OQYA 4E6EA 2XWQA 3ZCXA 2LGXA 4YT2A 2CL5A 3QF4B 5IM5A 4B79A 2BTOA 5D3ZA 3DVQX 5CPBA 3THYB 2V7BA 1U7WA 4ZRKA 4B0MA 1SQSA 2IEIA 2GLSA 2O8NA 5HILA 3W3AH 3CINA 4LQLA 5B64A 5K9ZA 2DZDA 4IZ6A 1E60A 2QU7A 3EGVA 2PLNA 4YRLA 2WU0A 5LSAA 1C0IA 2NPTA 3VU1A 3FKSA 3ICWA 3EXHA 2FIFA 4L2IB 4E5DA 4KQIA 5E4JA 4Z5XA 4I1VA 3V7UA 2Q3EA 4L3VA 2BS3B 2V58A 2YQZA 4RELA 4DTCA 2XK5B 2W22A 1W88A 1F2UA 4B71A 3GEPA 4DMFA 1P1IA 4FMDB 3OQIB 3GBPA 3DEYX 1RFAA 1HH4A 2XDQA 3GAFA 1XZMA 3PKJA 4JBWA 3Q6NA 3VRBB 1EO6A 1LSSA 3FPAA 4D42A 1UDCA 5IDWA 5ARBA 4WURA 2GFIA 2W37A 4NAVA 4MR8B 3X1DA 4JVOA 4DJJA 3OOYA 4L08A 3M2TA 1IB0A 2W2OA 4LZJA 3NRJA 5K0SA 2PWAA 1JR3E 2W6ID 3W5IA 3OM0A 2M1ZA 2JLUA 1AB5A 3HJCA 5D8DA 3SKXA 4M1SA 3VH3B 1GU1A 4DDTA 5DI3B 2N9LA 4X71A 2IBIB 4RQUA 5DI3A 3INRA 4EHBA 2UUCB 4M2LA 3UENA 3VNBA 4FBMA 2RE8A 2X8XX 1A98A 1VE3A 2O06A 1P98A 2NXCA 3Q8EA 1QWOA 2W6QA 4J6EA 3HZZA 3ADBA 3RTDA 3PRZA 1NX6A 4KSYA 3TRDA 4IOJA 1D1QA 3T0IA 1DHTA 4LN1A 4TVKA 1ZD2P 3VC2A 5DNEA 4CJXA 1DL5A 3CUSA 1WHSA 5CA1A 1E7SA 1GCIA 2R1UA 5JCJA 2H3EA 1U28C 2IXAA 3GFQA 3NHAA 3ZLUA 5IKEA 2R1ZA 4K0KB 2M4NA 3L8GA 1OU0A 4C0BA 2ZIXB 3BVPA 5IZ4A 3D5TA 3CZRA 3E5HA 1M1UA 3S55A 4ZGWA 1ZZEA 4J3FA 1MGOA 2GK7A 3COYA 2Q3CA 2XYVA 1JL3A 1L5MA 3AEDB 3BC1A 3PWZA 1V11A 3RHZA 4NIMA 4EA8A 4AIIA 3QVOA 3ZJVA 3L08A 1I9CA 2WMOB 2K4MA 2I7VA 4S24A 4HXYA 3WNDA 3EPKA 4NCJA 5ER9A 4FNOA 4MS1B 5DASA 5JVDA 5EYPB 1DWOA 4GIVA 4NJMB 2H1WA 3HRIA 1DO2A 2XBUA 1NNLA 3GMIA 4TS1A 4Z0PA 4LF5B 3LLCA 4KUHA 3GLQA 4F6RA 1UM9A 1D6JA 3JSVA 1LC3A 1H9AA 4DF3A 1YZ3A 3QE9Y 2J0UB 4Q3AA 4UFOA 1XCPA 4B6PA 2R8BA 1RWKA 4TKLA 2O23A 2M0XA 5K2OA 3OURA 3PCXA 3Q7QA 5ALFA 4IEEA 5DOVA 3ECAA 3B8HA 4BZZA 4DR4B 2Q21A 3H5RA 3LQ2A 5K01A 1JVNA 3DG9A 4G67A 1RZUA 3FNGA 2IGDA 4C3UA 3AF6A 2WD8A 3LCJA 3JAWB 4PG7A 4S3MA 3FVQA 1ZA1A 1CCWA 1JIJA 2RFLA 3B3JA 3GRKA 3I09A 3BE5A 2PG3A 2W8BB 5B3JA 4BVBA 2ZT6A 1HPLA 1YC5A 2PSSA 3DCJA 5DISB 4BNUA 3BXGA 1E20A 1Y5MA 3EZXA 4J0IA 3DEJA 1A71A 1ESZA 1JIQA 2B9VA 4L51A 4ZO6A 2PM8A 5JANA 2RMMA 3B1XA 3PSAA 4WMLA 5AM1A 2RHGB 2H89B 4UHEA 3Q8FA 2CWDA 4WY8A 3A6PC 2A1TS 1ZD1A 3ILYA 1VYVA 1YR2A 2X8BA 3K9BA 3VKFA 3SC2A 3UYKA 3ZLTA 5BYSA 5LU9A 1MXFA 4O4JA 3NHZA 3VGJA 2F8SA 2JCXA 1FZQA 4GWGA 1JHXA 3ETHA 2CWWA 3NYQA 4U2EA 2CJOA 3K70C 4EI9A 3GIWA 2EXXA 3LA6A 4RZXA 1ZP0B 4ZCTA 4Q6WA 3P1MA 4FN2A 1EVJA 2X9NA 2J32A 4H35A 4K05A 4MXDA 2B8NA 4RESA 4R16A 5IF9A 1P45A 1KXJA 4H31A 1HA5A 3GGJA 2PCJA 1JW9B 3I4FA 3OZCA 1P5RA 2ZUWA 1W5EA 2H1SA 2VWGA 1IQ0A 3P0RA 3HP1A 2KO3A 3PFNA 4DCUA 5AFSA 2NYAA 4MWBA 1TU4A 3U4CA 1CS4C 1FMCA 3DHWC 1W85A 4QOHA 4BGDA 2WU4A 2XRZA 4LSGA 4JJ8A 5I4IA 2J5KA 1FNNA 2GHTA 3LT1A 1WUHS 4K03A 3RV4A 4A6PA 4GLOA 2WW8A 3I5AA 1E66A 4P86A 3GK3A 1UXGA 4FR2A 3E4DA 3DZBA 1Q83A 2QOEA 2W6OA 2YV2A 4H0FA 3I9LA 1ZN2A 2DQSA 4V38A 4BMYA 5LZ2A 2AXPA 1QKKA 1WNFA 3WSVA 5EWMB 1W4AA 3ASZA 3FZEA 4QQRA 4Y2SA 1W4RA 2GA9A 2GQ0A 3L77A 3NJ8A 4L1KA 4RJ2A 3TE6A 4OM8A 1H2YA 1Y7PA 3GEMA 4KLZA 5EP4A 1JMLA 1EE9A 4WXHA 1IOZA 1KJQA 4MKHA 4RF4A 2DYBA 3ET5A 1CETA 3K53A 2GYUA 2WGSA 2V54A 5H59A 2K5UA 2HI0A 4K9NA 1N0HA 1A27A 3L40A 4KB5A 4K81A 2R8OA 1GZSA 2UUOA 4LY3A 4MX8A 4LY6A 2H9YA 4J2TA 3PC8A 1LPPA 2D1TA 2FMUA 2NBUA 1VGVA 3QV1A 3ZY5A 1S4QA 4BKTA 4P08A 3KYDB 3ZNID 1YDMA 4OX9B 1CQZA 4OLFA 2BGFA 1G7TA 3H8VA 1S2IA 1L5PA 1OYVA 5DSXA 4EYEA 2BFFA 4WBNB 2BM1A 2Q1YA 4G0XA 3EQ9A 5CFRA 1CF9A 1IWBB 1U4SA 2PKCA 3GW8A 3IQGX 4UBNA 4JUBA 4BNJA 2YYZA 3ITEA 2V4LA 4NPHA 3D43A 5TMBA 3UK7A 3RC9A 3MYRA 2DEUA 5D7GA 1FFYA 1YRWA 1TKYA 4BTVA 2GCGA 2I8CA 3AEQB 3LUDA 3ZU6A 3LH5A 2B4YA 4A0QA 3UMSA 5FK9C 1IM8A 3I5XA 3Q8KA 5C5CA 3ADPA 1FTYA 3STTA 4S1VA 5JMPA 1C1YB 2VJOA 2HQBA 3EK2A 2FA9A 4C3VA 4AKIA 5EKSA 4HD8A 5T3YA 4BO3A 5G0TA 4Q16A 1Z3CA 5CTJA 2W83A 3OZUA 5BO5A 2VYND 4JEIA 1EWVA 3H5AA 4RHXA 1N8TA 3KKNA 1QYRA 3PDWA 1WVMA 2V3WA 2LD4A 1SC6A 2WV9A 3BCSA 5A3JA 3IV6A 521PA 4BO5A 4DTIA 1E1QA 1IHPA 1Z7WA 2HIHA 3O8NA 4LC0A 4QU0A 4C04A 2JFQA 2V55B 3R5JA 5ISMA 2F3RA 4QRIA 4YHBA 4F3NA 2GDJA 4GLFA 4TMXA 4DCCA 621PA 1YJQA 4MYHA 3T7RA 1E2HA 4XGRA 2FPIB 1YA4A 1JPJA 3MERA 4ALNA 5EVCA 1W2GA 4DIOA 3Q3VA 4DQDA 3FOWA 4CZ2A 4JL6A 2NTYC 3W8RA 3SQMA 2BWJA 4ECEA 3R8FA 1SBTA 4TRJA 3VHLB 4HB4A 2R2OA 1W93A 1NBFC 1NVBA 1Z3IX 3HBFA 2BEVB 1GNUA 3OPXA 5FPSA 3R7FA 3UTDA 4DT1A 3C6XA 4DV1B 4GS5A 1SHZA 2ZTSA 4ENUA 5BRJA 3ZIAA 2QIPA 3AFMA 3UMYA 5MFPA 1QAOA 4BAXA 2A9PA 3CSDA 2R25B 3H5TA 2FG7C 2PUFA 3IVFA 1GQFA 3U19A 1WQ4A 3AQ4A 5JWRA 3QJZA 1W0KA 1VG9B 4B32A 4NNOA 3MHTA 3V1KA 3A9VA 1EDOA 4C43A 2PRIA 3VR4D 7ADHA 4U02A 4A6EA 1WIWA 1NAIA 1QZUA 4BLSA 2P1DA 2WD7B 1KOFA 3VDZA 3R44A 2J3LA 4LXQA 2AC7A 4A8JC 2J0UA 3WKAA 1EWYC 4YRGA 2G9QA 2QP9X 3DL0A 3FYUA 4MRNA 1FBTA 1NRWA 2JCSA 3ROXA 4ZCIA 1C3OB 1NURA 2BZ1A 2POQX 2B2CA 1ACCA 2ZYTX 1NQVA 1H8CA 3BULA 3U7ZA 3CB4A 3DMRA 4LA4A 2I1JA 3NI2A 1U0NA 2P2DA 4L3OA 5CJ2A 5K8VA 3UHFA 1VCOA 3O9VA 4HX2A 1GJZA 4K7SA 1V9CA 2MINA 1JQEA 3ND6A 3INGA 5F1PA 1FFXA 1TKGA 2O2DA 3HK0A 4H7DA 1ML4A 1W48A 1MG4A 4GMXA 1CKEA 3T54A 3JARB 4BZAA 1HNZB 3A0UA 3CPJB 2EQ5A 2G25A 4KTVE 5AM3A 4IS2A 1LQ2A 3DMYA 2Q0HA 3RVOA 1FRNA 1MB9A 1XA0A 3GFBA 3IGFA 4KPYA 2QD5A 2X9VA 4MB0A 5K3FB 1VTKA 2ZATA 4OQ4A 3T5TA 3I6YA 1S3GA 4FW9A 4JYMA 1WWKA 2Q9AA 4M8KA 3LY9A 5TXGA 1PJ8A 3LHIA 1LX7A 4YXFA 4Q3KA 3HXQA 1D04A 1N0WA 1TTHA 4P7BA 4QPCA 5LBIA 2GBIA 2HY7A 2GB4A 3BN3A 3CISA 3GGSA 3MGBA 5IKOA 5BUSA 4L4UA 1E5LA 3JQ9A 4JFRA 3GI1A 5EJ4A 2HTEA 4XGNA 4QE3A 1Q44A 3PXXA 2IH5A 1SJED 3X0WA 1EIWA 5CYPA 3AUXA 2C20A 4ZU1X 4C4RA 3K2IA 1COWD 2CV0A 2JGMA 5FV4A 2PWYA 4JX9A 3VH2A 5LDHA 1II8B 2R751 1ZC4A 1VMDA 2BGWA 3AVWA 3PQ3A 2PGDA 4M37A 3U9LA 2OLKA 5DM60 3AV3A 2PGOA 1MO3A 3LCCA 4HVAA 3UV3A 2C3UA 2J48A 4RQTA 1GZ3A 3ZWWA 4MVJD 4LF9B 4OAQA 2X23A 3IESA 5E6SB 4ZHSA 1QDUA 3BREA 2UYCA 4FWTA 3ANTA 1CY1A 1LZLA 1YXMA 2P78A 2O7NA 3B7WA 1ZNQO 3LPAA 4LJ8A 4POAA 4Y2RA 1NQUA 3NGXA 4GRAA 1DOAA 1EJ0A 3APFA 1CP3A 4DBLC 5DU2A 2YYYA 3QBVA 4FYMA 4NU5A 3A3OA 3MVEA 4ZZ1A 1WSBA 3MC0B 3C70A 4TN1A 4HVLA 4MW1A 3R1IA 4G4IA 4S1OA 2ZPTX 4U6QA 3KKZA 4L0MA 1KJIA 4OZCA 4REQA 4UXIA 5FA5A 3LECA 3N1XC 3PX2A 2C8KA 1RZ3A 2GFQA 2FV8A 4OQNA 3WQQA 4D96A 5CBPA 5CLIA 3DA8A 1ZGGA 1VMEA 2GS9A 1I24A 1TF5A 4EUTA 4NQRA 1B42A 3EDYA 1VFNA 5E9JA 3IIKA 3L8CA 2RGWA 5FPYA 4J07A 1HQRD 3FAZA 5P21A 3UJ7A 4P32A 3X0DA 3DPIA 1B8NA 3AF0A 1GCGA 3N32A 1O5IA 4WZAB 4ED9A 1IUNA 3GEEA 4JMLA 2C8VA 1SVUA 1CZRA 2VDVE 1QMPA 4QPZA 4WK2B 1Y3CE 1GLGA 4TXLA 3JD0A 1I10A 2I22A 1PZNA 3ENVA 5CBKA 5T3UA 5LP1A 2QRHA 1SXJB 1RHQA 4DCPA 5HRCA 1IBMB 3KSAC 4B5KA 3DTNA 1GAEO 3EQZA 1D5MC 3A1EA 3ZDCA 3RQSA 3OJLA 1HDYA 3KJQA 2AMLA 3T41A 5EJFA 1XIVA 4R2JA 5KQGA 2IH4A 2NZXA 2BS2B 2QRMA 2HO5A 1WZ3A 1J0GA 5I9IA 4H6VA 1WZ0A 1UMCB 2IC5A 1CFZA 1RAFA 4PRLA 1N4AA 4HNUA 1NG9A 3FWNA 4KSLC 1P2SA 1Y1KE 2VTEA 4IEIA 4B43A 4FHJA 3L0YA 2TS1A 1YR1A 1ZD8A 4HATA 5EG5A 3L46A 1C0EA 1TO6A 6YASA 1U9ZA 1SVSA 1YZQA 4MULA 5CVVA 4HWSA 3UTCA 3ZXXA 2FJUA 2HLDD 1KFCB 3KQLA 1DGJA 1VL1A 3IP1A 3BL5A 4D9FA 4PNEA 3H9BA 5LYJB 2PIAA 3OPVA 3LL7A 2N4FA 2EGHA 1GZVA 2H1HA 4ZRJA 2JAQA 3QX7A 1TKCA 2B4KA 4D79A 4BECA 1NMSA 2CHGA 4AQYB 4DLLA 1CFJA 1UT5A 1KARA 2DTDA 4HPWA 1L7YA 4F8CB 1NR1A 1RXEA 3NVDA 3CX4A 4OP1A 3RVPA 4DNFA 1VPVA 2AE2A 1WR6E 1Q3KA 2HFJA 3C16C 3MLBA 4UXHA 5AHRA 5JFOA 1G291 2CNKA 5JASA 4D4GA 1AXRA 1HSOA 3HUFA 3PNVA 4K8OA 3R0QA 4KE8A 3O75A 4HH1A 1W6UA 1X7HA 3IP8A 2C7BA 1AUQA 1CQJA 1TM2A 1KGDA 1AKVA 4PYUA 3AEKB 3LY5A 4E5MA 3O31A 1FNDA 5IN5A 2KDMA 1G2OA 4ZI7F 4AYXA 1G21B 2DUUA 5KQRA 5CDYA 2LRHA 1KQPA 3ZPXA 4PSDA 3PZRA 2IIBA 5AESA 3I9NA 3R6WA 4R51A 1L4GA 4QXRA 4GVLA 3Q8WA 5JV5A 2FWNA 4XUGB 2V7QA 1RWMA 3WL3A 2ANCA 3EVBA 2FWRA 1JSLA 3K2EA 1Z6GA 1SUDA 1DBPA 3U7QA 1NBHA 1YA8A 1VB5A 1ZM4A 3P0FA 2Q50A 4ENTA 3A9RA 1WO8A 2I6XA 3RYIA 1UFVA 3GRAA 4QVKA 5BVGA 2JI9A 3H65A 4FDAA 2NTJA 4KVAA 4Y9UA 4HVCA 4DEVA 1HE8A 1YN5A 5EKTA 3PXBA 4D8WA 3EVGA 1A8IA 1L8QA 2OKGA 3HYNA 4F97A 2VNIA 2GZDA 3L1KA 1UBLS 5AW6A 5JO0A 3FCAA 2FGJA 3FMIA 3BH7A 5ANRB 1QU2A 3OT1B 2O0KA 3S70A 5CDUA 2ZW1A 5C5IA 3TNFA 1V97A 2NS5A 8AT1A 3UN1A 4RFBA 5DHRA 2KVZA 5MGBA 1IMOA 4JL5A 4PRKA 1GSOA 1Q6ZA 4B8WA 2TYSB 1ONSA 1ZS9A 2I67A 4MYTA 4QOIA 4A4DA 1QYDA 2IL1A 2B36A 2ZR0A 3BGDA 4LZAA 4K81B 3OLYA 2DX5B 1DOXA 2GWRA 4B9KA 1HO3A 3DCYA 5DX8A 5F23A 4RNCA 1R9NA 2R1VA 3EFBA 1NXOA 4FR0A 3HVRA 1T13A 2WK1A 3KT8A 4URUR 5CIYA 2EV9A 1U2DA 1KJ8A 3A6KA 3Q5DA 3T1VA 4RDIA 3N8NA 3UOAB 1L5QA 2WM2A 1TMYA 3EASA 1NVDA 3NT5A 3RIMA 4TT3A 3RFVA 3Q87B 3WBKA 1TK3A 1HT1E 1R74A 2XWPA 3PHGA 4J7AA 4HUQB 2VXCA 5BQOA 5TE9A 1H4TA 2O1EA 1E2UA 1VHTA 1WP4A 5KOHB 4XE0A 1G0OA 5EGSA 1TCUA 2L18A 1RYFA 1JHPA 2VDMB 2ZRCA 1J7AA 3NASA 1ZH0A 4N54A 1J07A 5A0TA 2G9RA 3WOHA 4Y3UA 2W2XA 4W8GA 2ZT5A 4FCTA 2CKMA 3AJ9A 1E8MA 4E13A 5LP6B 3A2MA 3LXXA 1PD0A 3H1UA 5JCXA 3M4XA 1Y9AA 1KTKA 1KFJB 4MM3B 2AWOA 3A1TA 3OO1A 5C31A 1Y4DE 3GRYA 4S0ZA 2RGAA 2VDJA 3AM5A 5C1BA 2HIMA 1A72A 2LXNA 3AUTA 1MCZA 2CCGA 1ELOA 4WK6A 4BVFA 3MOGA 1AQIA 1EAMA 4E4YA 5HUJA 3HIZA 1E7YA 7REQB 4DQKA 4CMIA 5AVSA 4E46A 1JW9D 3RUHA 3WLPA 1WRIA 3WLIA 2IY7A 3JPYA 3B51X 3JQBA 2QVLA 2YC4C 2W2PA 3DB2A 4JQSA 2PMEA 2IZ7A 1OQYA 1HFKA 2RK3A 1FW8A 1G5QA 2EFCB 1DEHA 1ZVVA 1JLLB 5JXHA 2HJWA 3W5UB 5IU6A 2XOXA 3CH5A 1K6XA 2VP4A 1Z5GA 1QFMA 3ISJA 4F12A 4WOKA 1HA3A 2W11A 4GSLA 2MRPA 2Q3FA 2KX3A 2YJ6A 4BU1A 5E2BA 3DVAA 1NIJA 2I03A 1C1DA 1COWA 2VSOA 1W96A 2WAYA 4IL5A 1T6NA 1IP9A 5FR1A 2J1LA 4B75A 5H9WA 1YN3A 2YXLA 4MTCA 3CQ9A 2B8EA 3NEPX 1ZXHA 1O95C 2UVQA 2WNHA 4GRIA 3HC7A 2IPLA 5B1YA 3MQ2A 1EK0A 5LQAA 1U7ZA 3ZWKA 2AEFA 3RU7A 1QOPB 2BE7A 2IOYA 5AW5A 5LFAA 1YONA 1V5TA 3QIAA 3RCZA 4NH0A 2AA3A 2JI4A 1GZ4A 2IYRA 1E4EA 4TV9B 4KVFA 5DYIA 5DBIA 5K3OA 2DLDA 4DLBA 4NABA 3AF3A 2IF0A 1G8AA 2KJ6A 2RK6A 4PVDA 1KH2A 3HR7A 2XOKA 4GR5A 4MK4A 4Y1RB 1QFXA 1U4AA 1NVTA 1XMJA 1WXHA 2YZMA 3KWJA 4Y6RA 1XNHA 1F38A 3CT6A 2AN5A 3U4GA 4MRSA 3QBTA 1XMOB 1E89A 2OXIA 4CIVA 5L7TA 1W59A 1MDFA 1PGBA 3ZLZA 3PTLA 1KYVA 2JW5A 4JEUA 4O6VA 3V1YA 4YACA 2ZJ7A 3BMCA 1U2RA 4ROTA 5DSTA 1QILA 2KE5A 3FPLA 4EFDA 1K63A 3W5JA 3IT0A 3BF8A 2EWVA 3LWDA 3MBOA 4ESEA 1E3MA 2PVOD 1BXGB 2PFGA 3VPBA 5EUQB 1B0ZA 3IQFA 3HY3A 1PHPA 2YMLA 4CPDA 1HLFA 3KQ4A 3H2KA 4KITB 1G5HA 1NSTA 2WSIA 2WIGA 2GKSA 2WPDA 4RF0A 1KC1A 3B3AA 3CRMA 1O6FA 2YZKA 4XAQA 2MSEB 1MX3A 4XSVA 4JQZA 4EZEA 4AOFA 5HRUA 1MUUA 1Y1QA 1QIKA 1YVEI 2E7ZA 2FPGB 4IGIA 8GPBA 4FYVA 1P4HA 2CJWB 4KYVA 2J33A 3P52A 4YJ3F 5FULA 3NAGA 3JVUA 2DOKA 3ZO5B 3BB1A 3ML1A 4FYKA 2YYSA 4I9HA 3DEKA 3R3ZA 3N1YC 4TMFA 1DKQA 4TSFD 1U63A 4HH0A 1PFGA 2R60A 2BKUA 2JFOA 1KEPA 1XQVA 3OU7A 4QTTB 3EXFB 2OZLA 4NZ9A 5AK6A 1GL3A 4B6WA 3BQ9A 4P80A 3RIGA 2FCRA 5BN1A 1EG7A 2CK3D 4NV3A 4HQLA 2AOVA 1Q0PA 5KC9A 1H0RA 4KUEA 2VSFA 3K6RA 3VVMA 4I6GA 1M5TA 5FA6A 4YT0B 2OORC 3GFGA 4KFUA 1X2BA 4OUDB 3ESRA 4L2YA 2X19A 4D9BA 3FOZA 3H6GA 5ER6A 4PZUA 5JATA 4PSVA 5LOVA 2WYQA 1D2MA 4H16A 4ZMBA 2VSYA 2YUTA 3CB2A 4TMWA 5CVEA 3TQFA 1UP4A 4UDOA 1N3BA 3AQIA 3VR6H 3COJA 3FI0A 4OLBA 1U0BB 1P9DU 3E3AA 5JZSA 4CM3A 3KAKA 1TTNA 5EKXA 3BDAA 3WHKA 1KNQA 2H57A 3SQNA 3NWOA 4Z7QB 3GAZA 5FP0A 1UWMA 2RHCA 5AZHA 3W6PA 4RH0A 2ES4A 1TCAA 4PZZA 1PCXA 3DL7A 3MQFA 4KZKA 5JI3E 5ETJA 3O8QB 1JWUD 2JJ1A 3IE0A 4RPLA 1BHQ1 3N0WA 3PXEA 3DOFA 3Q6IA 3W1WA 2PD6A 2AMVA 4QAJA 1I4HA 2BFFB 1WW3A 3H13A 4WBNA 4FHZA 1ORVA 5EI5A 3K71B 3SZOA 2AXQA 1CRZA 4B7XA 4YRKA 2YYAA 3PE6A 2XGGA 3WRWA 1GQYA 2ICIA 3F73A 1AUVA 3TX6A 3AI2A 2W43A 2WJ6A 5AM2A 1SO8A 1XYYA 3PENA 5H4GA 4TL7A 3T1OA 3RR2A 1O0BA 3AEFB 1HYGA 1UK7A 2XY4A 3LF1A 4P4GA 2X1LA 1HL7A 4HB0A 1F6DA 4FB4A 1DRKA 1Q7EA 2R44A 3FGOA 2ZSJA 4R5MA 2B0JA 4YA6A 2SKCA 2UU9B 4U1RA 1Q1OA 1WULS 4FMCF 4QJIA 3K31A 3AKZA 2N42A 2XUAA 3KQQA 2H7VA 3AMZA 1CUZA 1JV2B 4MKIA 2FW0A 4RZ2A 1E10A 4QXOA 1E7RA 3ZU4A 4B6JA 1P3QU 2VP5A 2L17A 3LUHA 3GCWA 2OHGA 2NO9A 2XH8A 2FPWA 3N5KA 4AP4C 4LRUA 4EVIA 5BN3B 2B30A 4RGYA 1HFJA 2QF7A 1PIWA 2YDXA 4XR9A 2SBTA 1YWGO 3WKDA 2ZDHA 4DSAA 1H1LB 1VKOA 4J8PA 1DIHA 2AJCA 3I2FA 1QH8A 4R8KA 4WVLA 4RK0A 4A8XC 2M1MA 4BTEA 4KV2A 1U9YA 1X9GA 3OM1A 1JZQA 4G65A 4PICA 4TWIA 4OUKX 3KQWA 5BMIA 1P75A 1VBKA 4JB2A 4N3AA 5HEKA 4EH1A 5ADUS 5JQGF 5F98A 2CMHA 2VA9A 2FGKA 3GPDG 3LOUA 4PWYA 5HFAA 4LC1A 4NBUA 4W5QA 1EFRA 2BFDA 3PXDA 1XCQL 2UYZB 1N6PA 1Y9EA 1BA3A 2BPOA 2QTBA 1WGYA 4FX5A 1OGYA 1UBMS 5AOVA 2JZ3B 1MJDA 1M94A 2RJ3A 2Q49A 4OQFA 3BZWA 1IGDA 4Z9YA 3WDKA 1QANA 3OMWA 4HNVA 3OKFA 4HLUC 3DBRB 4JJKA 4Y2YA 1UJ5A 3DGFC 1UC9A 1T0IA 2LJIA 3DTYA 4BWFB 3D64A 4NK4A 4HNHA 3M6MD 3OLXA 4HGNA 4OQEA 3WGGA 4ZGGA 3LT2A 2B99A 4AUNA 4P9NA 1Q3HA 2JGFA 2QVYX 3JALA 3SR0A 1B73A 3LOQA 1F4VA 4LOHA 3TOSA 4BMSA 4MT5A 2AC2A 2GRAA 3HDVA 4FEEA 1BHJA 1PGPA 2H08A 7YASA 3S81A 3LXRA 5JZOA 4UBIA 4FFSA 4N9WA 1G42A 3QI7A 3V4RA 1HRDA 4GYJA 4RJKA 2O3TA 2P75A 1TIBA 4TS9A 3QEAZ 1RZRA 1IOVA 1SIBE 2BN4A 2RHOA 1P1JA 4RD2A 3NP7A 2WJWA 4MNTA 2WXHA 1JXOA 2P90A 5A6SB 3EOBI 4RF1A 4B46A 2OAGA 1JHVA 3DZCA 3JSVB 1E9SA 2BFAA 2OXCA 3QKUA 1F2TB 4GBJA 4KLNA 3C3PA 3KW5B 1AN9A 2V7PA 3BSWA 4XUDA 4G0VA 3U7JA 2ZW0A 3V6LA 4JD5A 3NS7A 2SEBD 4EQZA 1K3FA 2NZ2A 2KNBA 2V7EA 2QSZA 2FWBA 3PLNA 3SR6A 4D9GA 3O2NA 1M2EA 2JHFA 2WRZA 2XT0A 4ZAVA 3C4VA 3UPDA 1V47A 2JKVA 1C3VA 3DBOB 2WT9A 4HNAA 4WN9A 1SXTA 1H1TA 3D3WA 1WB4A 3KB2A 1W8DA 5A4IS 3H05A 1Z0FA 4CR8A 1VZ3A 4RXMA 3QW2A 3AEEB 3FRHA 3UYLA 4RVCA 3OZDA 1XMPA 4QBGB 4YJHA 2ZANA 4ITUA 4LYFA 5AI8A 3S27A 1O6BA 3LX4A 2V9PA 2QTFA 2CHUA 3TJZA 3P2JA 1RP1A 1RQXA 3BSFA 5FPKA 1YS6A 3CRNA 3OUTA 1CG6A 1P73A 1XI2A 4KLAA 4S2EA 2KOXA 4NZNA 5CLQA 4ZAZA 3FETA 3EODA 4UNRA 2AYXA 3U40A 4JV5B 5BO4B 2H8GA 3OCYA 2OCGA 4LK3A 4D43A 4RNDB 3V00A 4AUQC 1XRJA 3COSA 2JI6A 4ER3A 3PC4A 4C4TA 3D0QA 3RKRA 2WWRA 1CY2A 2OHOA 2ZIEA 3AEUA 5EFOA 1QG6A 4IFTA 4N0PA 3HN6A 1JDSA 3WRXC 2XLCA 1L4HA 4UHHA 1C50A 3BZDB 2XGSA 2WIKA 3OTQA 4HNRA 1QUFA 5CG1A 3T3NA 2QLJA 1KK1A 1WJGA 4PTZA 4ZREA 5BVHB 4Q0MA 2AJTA 2CJNA 2XVAA 1PX0A 4WADA 4BPBA 5C4GB 4KGSA 1R0KA 3IUYA 2JI7A 3O73A 1PJLA 3ZHXA 2R48A 3AOGA 3KDPA 4XIFA 3WGJA 4HQNA 2UYYA 1M8PA 1PK8A 2OQIA 3OWEB 2WSSD 3A6EA 1JJBA 1U2SA 1UMCA 1XWFA 1EXWA 1E8WA 1GTMA 1OWLA 3V3KA 5ILOA 1MBZA 3KG2A 4XWYA 3RNOA 3IO3A 3QWHA 2ZI9A 5G55A 3DDOA 4TTSA 2QRVB 4NE2A 1PNOA 2W48A 5F5LA 2W6MA 2ZDGA 1RE0A 1C2YA 2CNWA 2GI9A 3BRWD 4IQGA 4UQOA 2GAJA 2IEZA 2OECA 5A0FA 3EEBA 5EJMA 4N5LA 3D7LA 3H9DA 1SWVA 4BNZA 2QJFA 4HNAB 2CYBA 5FNZA 4GI2A 4IJMA 1BS9A 2ZFUA 2EWWA 5AICA 5KS2A 3S0JA 4EF4A 1I7QB 3E7WA 1EZ4A 1Z5PA 4UAJA 3ZDQA 2UUBB 1QPZA 4OYYA 5T4HA 5JH7F 4YP9A 4ARSA 4A73A 3FRJA 3REQA 1Y8QA 1U81A 1LVGA 1O9HA 2V4MA 2JVIA 1TGZB 2J3HA 4FYWA 2DAJA 1SHKA 3EZLA 1YS4A 3ZVVA 3AF2A 3HGTA 1DQPA 3HDYA 3NTUA 1H6CA 1EZ1A 4IDEA 3I4CA 1R0CA 1T1GA 4NJMA 4D82A 3X2SA 2HWYA 2IPXA 2X14A 2YWFA 3U4QB 5ULLA 2I7XA 1W1WA 3N1UA 3SEBA 4AJOA 2GZ1A 3PJFA 5FYQA 4MO9A 5BSFA 3ZW3A 4FA6A 2H1RA 3U5TA 1OOEA 2QQEA 2RH9B 3ST7A 2OB2A 4C5AA 1C5KA 2VK2A 1JDBB 2FKNA 1T3ZA 3THOA 4AECA 1KH3A 4NU0A 5F7JA 1B7GO 1MNAA 1UPUA 3D7MA 3LPMA 1BFKA 3T94A 3CLUD 3DE5X 5BQ5A 2JPHA 1TNDA 4KPUA 1I51A 3MT7A 3ZE1B 2FPGA 4BYGA 2JS7A 5KSYA 4RCYA 1OH5A 2Z1NA 4CTJA 5I8ZA 2QX6A 2P91A 3BB3A 5D6JB 3SU8X 4P4SA 3BHMA 4E2FA 3U17A 1AJEA 5IABA 1KWGA 2HL6A 2PX5A 4G5FA 1QQRA 1XZEA 2JUOA 2D4AA 4BNDA 1QIJA 3VTVA 1XZIA 3A1QA 3HZRA 2QRVA 4J3JA 4RPGA 5IVHA 2A0UA 3FR7A 2AFHA 2AZTA 2YHAA 1J25A 3IXLA 3OPMA 2A94A 4IKPA 3L4BC 1YDHA 2DKNA 2DULA 3E84A 4RTKA 4UD6A 4YMIA 5EXSA 5J63A 3TSSA 4DNXA 1XWWA 4Y2VA 1QORA 4JXJA 2QE6A 1SQGA 3DVNU 1LFAA 1MC1A 2ZJZA 1CUWA 3AHCA 1EPUA 5CGZA 4EUKA 3G5LA 5DHTA 3WYBA 1F8XA 1M72A 1YB4A 4XDDA 3DZKA 3HQ4O 4XE5A 4L9SA 2PUAA 4Q18A 2ZTLA 4X1IB 1OLSB 4JHLA 1I36A 4OQMA 5B7QA 4JLSA 3DF9A 4QRDA 3ORQA 1B3RA 1UT8A 4HAYA 1BEZA 1Z7GA 2JCYA 5F52A 1TZKA 2YXEA 3FCYA 2H2WA 2ZRMA 5MN6A 4E7PA 2ZEJA 1NNUA 2PJDA 3VA7A 2DPYA 1IBLB 4NARA 3OI7A 1VZ6A 5JS1A 1I0ZA 1W1UA 3NOOA 5HIAA