2VH1A

Crystal structure of bacterial cell division protein ftsq from e.coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
b'SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 50
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh1A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh1A02
3Q6BA 4BZAA 2V9HA 2QDFA 2X8XX 2VH1A 3OG5A 3EFCA 4C4VA 4C00A 4K3CA 4XGAB 4C4VB 2MHJA 2QCZA 3MC8A 4PK1A 3MC9A 4QAYA 2VH2A 3NJTA 4K3BA
chains in the Genus database with same CATH superfamily
4MARA 4F4DA 1RRCA 1K0FA 4IIJF 2O2YA 3JS5A 5A3SA 3ZVKA 3PJGA 1U9CA 3S8MA 3UHJA 4FFOA 3T94A 4ZV9A 3WLEA 1FTSA 4XX0A 1DMRA 3E3LA 3TG8A 1PYOA 2HDNB 3SQWA 3WIEA 1A95A 4ZCQA 2W6MA 3LA6A 1C77A 3QLUA 4Z51A 2X41A 3GDHA 5A05A 3TEZA 1FFYA 4Q34A 1GZVA 4C0LA 3I6IA 3TQFA 1ECJA 3RLFA 2E4YA 5JE8A 4CCSA 3UCEA 3KOOA 5BT9A 1PL7A 1L1RA 1QWOA 3DYVA 2YVCA 1J9GA 1V8FA 2VQDA 3OCWA 2P8SA 1VE3A 5F52A 2WZCA 4KQ2A 3GARA 2F8LA 3W5CA 4RDCA 4G86A 3MC8A 4MQLA 4BX3A 5A9SB 1ZOYB 2XA9A 4DUYB 4KITB 3PQDA 2YY5A 4N40A 3HYLA 2DNFA 1Z7WA 5FXMA 4BNJA 3A1FA 1V96A 4ICUA 3Q98A 3GDGA 1RWSA 5JAMA 3ZNOA 3ETGA 4KTVE 3CRZA 1EFRA 4IOIE 1ZUWA 2X40A 3A1NA 3AE6B 3GFSA 3H65A 4ETNA 1DIOB 4NC9A 2DHZA 4BMCA 1VRWA 2V9HA 1KRXA 3AIMA 1PFDA 1FP4B 4Z8YA 3AEQB 5C7IO 3M6LA 3DHNA 4ASUD 5E2BA 4JR1A 4HR7A 5FWYA 2ZUWA 2CEKA 3GBVA 4FKMA 1Z6QA 3TCNA 3IQGX 2PX4A 3AVVA 1QLJA 3NANA 1SVMA 5GPBA 3VHLB 1PUIA 3B85A 4GXTA 3AECB 3I72A 4I6JA 1GADO 2OMEA 3RS7A 4CO7A 3AJ9A 3OWHA 1I2ZA 4RTMA 1VLZA 4JA2A 2ZZPB 1ZRNA 4Q1CA 3SFVA 2P4HX 1AO0A 3UWMA 2EX1A 2B7BA 4IRXA 4YT4A 2JJYA 4EKEA 3CVUA 4N41A 3ZE0B 4DLRA 3FNEA 3JATB 4UBNA 5KOHB 4YJ2B 1YJQA 4ALJA 3L4KA 2I4TA 1L1QA 1X13A 1F51E 4ZHSA 1Q3KA 1DRVA 1J7AA 2NYVA 2HGSA 4EYQA 3F74A 3MILA 1QV9A 2F7SA 2VT6A 3F2IA 2X1HA 1NWCA 3A37A 3BL5A 5FAKA 1N7IA 1N6LA 3IVGA 4XM1A 3APDA 2JGDB 3K0EA 4FZVA 3APFA 1GKUB 2P68A 2AC4A 3VH3B 1IXRC 1BMFD 2ZDHA 3PGXA 2B78A 4E1BA 5L51A 3GGCA 5JDCC 1K51A 4PS1A 3BCUA 4CLXA 5INTA 1QLWA 1K08A 1MG4A 3W2EA 1TIBA 3HO6A 4X54A 2FUG6 1GVNB 3AJ8A 1BRMA 4B47A 5C2TB 1E18A 1UPFA 2BEUA 1QZZA 4IKPA 3VU8A 2VJOA 1VQ1A 4IL5A 3OTWA 2G7ZA 4Y1FA 3C87A 2RH8A 4OGGA 5T4EA 3ZUPA 1QOPB 2CFCA 3A9JB 3PG5A 1MA0A 4JMLA 5B58T 1DDGA 1NJ1A 4OXYA 4LOLA 3W1SC 4PFKA 3TFQA 4D9FA 1P2GA 3E0QA 3T0FA 1JG7A 3CKKA 3P0HA 3PHHA 1VE6A 4D4LA 5E6JA 1Z36A 4HAYA 2JGEA 4LDTB 5AVRA 1JBQA 4IY1A 4HQRA 3PF8A 2OWEA 3RSOA 3MFGA 4EENA 1H8HA 1ZIDA 2PEYA 4Z0PA 1JG2A 4B3JA 1IZZA 1ZM7A 4ZZIA 5AMXA 3H5NA 2Q49A 3KXIA 2D00A 2BZ1A 2O2DA 4ZI2A 1MO3A 5G41A 2AQ1B 1KMIY 4RSGA 1ZITA 2ORYA 3QHAA 4I7EA 4MQMA 2CNWA 1RR6A 4FSDA 1HLGA 3T61A 3DTVD 3WLJA 1S0UA 2QIEB 1HYGA 2XSZD 3R3ZA 2YHSA 1HF3A 2HEIA 2P9TA 3KZOA 4MCJA 1XDWA 4YFVA 1Z63A 4JA0A 1RC1A 1VLJA 3ENZA 5BMVF 4U2EA 4YV1A 3U3JA 4BLPA 2VBFA 4YV0A 4Q9JA 2KSQA 2O3JA 4L7VA 3BN3A 3LV8A 1L5NA 3TAUA 4AMZA 1YB5A 4MSQB 1N2BA 2X77A 4DDGD 1L7MA 3ROFA 3EA6A 4MA4A 4RY0A 3DO8A 4TVSA 1TKCA 3A7DA 3NM6B 1IPHA 1EQUA 3FBGA 4P4SB 1ARZA 4J75A 3ODGA 3ZGOA 3VV3A 3D0KA 1VB5A 4D41A 3O2SB 3WNDA 3WLFA 2MYUA 3Q40A 2VH2A 3IIEA 3ITEA 4Y9UA 2H17A 4DLBA 3Q7PA 4K9PA 5I3ZA 3OVMA 1IC6A 3R5HA 1X70A 2Q1SA 2YWBA 3CSDA 3Q69A 5CAEA 1T1EA 3O8LA 2PKEA 1PJLA 4X71A 2RG7A 3GLIA 4LDPA 2AEEA 3HVJA 2NUAB 2H48A 1I4EB 4FVTA 1MT0A 4UHCA 4XOUA 3M4YA 1Y3HA 3RHFA 3RZWC 4IOLA 1L0YB 4LV8B 4MUJA 2CS4A 1G19A 1BZYA 3HRIA 4BJ3A 2KS6A 4DHWA 3WS7A 1TK3A 4FHZA 2R84A 4ZU3A 2YNMC 5TMPA 3DVLA 2OP1A 1Q77A 2C4KA 2PU7A 4MR9B 5D1NA 3KEFA 3PQ7A 2ZSKA 1VG8A 3VU3A 3FLMA 1J06A 2EFJA 2FSPA 4LBWA 4YCDA 1NGSA 4FDMA 4MTCA 5JCJA 2EYUA 2MBHA 1TKBA 5G5GA 2XTZA 2B5VA 2PJUA 1AUPA 2XUKA 2R7AA 3ESBA 5CM9C 3STXA 4G5FA 1M6YA 1A4IA 4BNXA 2VH1A 3O6VA 1OMOA 1LSOA 2CXUA 1JAIA 2HU2A 4BEVA 3W6OA 3WGUA 5ICFA 2VAWA 4WBNF 4C08A 2PR2A 5FWAA 5JWHA 5JC1A 5J43A 1ZGGA 5DIZA 3PVSA 3OP4A 5LA6A 4PC2A 1OKKD 1G66A 1VBNA 5JW6A 3TM4A 3T0IA 4Q4HB 2P1ZA 1HOTA 3K71B 4XCVA 3T3PB 5DNUA 4TVBA 2P40A 1RMQA 3GWZA 3R44A 4PAMA 3SSOA 4RFSA 2TSYB 1M6EX 5JEEA 2Y66A 3IEXA 2ZSFA 1UBGA 1B00A 5EJIA 1IOLA 3GZNA 1RFLA 1OLXA 4UTVA 1I6WA 1MVKA 5F98A 3CRW1 1KIMA 5LLIA 4H0NA 4L75A 1E89A 3C1TA 5GADl 4RJTA 1IZ8A 1IXZA 2V3PA 4QYSA 2VIIA 4AKIA 3ZQJA 4CXMA 2WMOB 3G2NA 2KHWB 2XNCA 5ICMA 1KU6A 4F3NA 3ND5A 4ESEA 1D2AA 3O3NB 4L0MA 3I6QA 4LG1A 4X97A 4DEXA 3LK6A 5DU2A 3L8GA 2EELA 3LKVA 1MRNA 2QENA 1NXOA 1JIXA 5EXDA 1K5PA 3DT6A 1MB4A 3FG9A 2HMUA 1CWUA 3FMGA 1GXSB 5CYPA 3IAFA 5JY1A 5DN9A 2PPVA 3MD0A 2IUUA 1ENOA 3ZH9B 4ESVA 1G8JA 4NV1A 4G8DA 4EY7A 3ICEA 2J5XA 2Y1LA 4J0CA 1ONNA 3LLSA 2H1WA 2WFMA 4RTJA 1WJ4A 2HZBA 2GAOA 3EAFA 5BQPA 2RJNA 1VMDA 2GO7A 1O6BA 3ZCSA 4ATNA 1J70A 3BJZA 1RKXA 3D8UA 3P4XA 4KVGA 3SQXA 4YJGA 4M1KA 2M2IA 4BB6A 5BNWA 2ZT5A 4KNWA 4NV3A 4MM3A 1WGKA 3N59A 4HYQA 4MDKE 3UGJA 4LHXA 1JEQB 4FMBB 3HPQA 2YDXA 1YR9A 4G9GA 4YDQA 2Q3BA 5KU1A 4DZRA 3FPHA 1IY1A 2UZ3A 3HBNA 4KCGA 3NBZC 1SC3A 1GV0A 2FQ1A 1RAHA 4MWSA 3RIEA 3UK1A 2H9YA 4M1ZA 2IOHA 2WU2B 3KCQA 1XJCA 3OZBA 4RYDA 2DWCA 2FPWA 2IYNA 3IPRA 1I8TA 1XZAA 5AK5A 4DTIA 5KJEA 4TL6A 2VDLB 4UMDA 5C18A 5IN5A 1PYWD 1SC6A 4LMBA 5KTTA 1G6HA 4EHHA 3G2QA 3UFXA 4C4TA 5M5BA 1YRYE 3RT1A 4BLWA 1M76A 3UB4A 2JIZA 5TRTA 3CUWA 2L83A 5DSTA 3I05A 1VHDA 3NONA 3V6MA 1II0A 4OBEA 4ZVTA 5J3JA 3NTLA 4M54A 1LDNA 2HSEA 4GXBA 3DEHA 3LK7A 2ACWA 3AY0A 8ABPA 2V98A 1X9GA 3VZCA 1K88A 4AJ9A 2DT5A 3NBAA 4II3B 1BE0A 3QE3A 3F7OA 3TSZA 3U7FB 1BXTA 1DJMA 2B76B 2MLBA 4F4CA 2BZGA 4M7RA 3UJNA 3RUHA 3H2ZA 4FW8A 3MOGA 3M2TA 1Q1BA 4CCYA 3HCPA 3MJEA 5DCYA 3CEPB 1SQ6A 4WN9A 1EE1A 3JASB 4PFQA 1Q0WB 3MSXA 3U4QA 1E6KA 3S2GA 1R5NA 3AEXA 2HHJA 2ZVQX 5JAUA 3DONA 4B7ZA 1V7ZA 4MQBA 2K87A 2GHTA 5AVXA 3NDRA 5DP2A 1V1MB 4C56C 2O2CA 2B99A 3B13B 1E5VA 5LBUA 1YUBA 3T41A 2MWMA 1T9KA 2OSVA 1QHXA 3BREA 4KSLC 4MICA 1CZKA 2ZEQA 2GZ2A 1KC3A 4HUQB 2B8TA 2I8LA 1MJDA 2GFHA 3E05A 4BVFA 5L3QA 2KNBA 2QI9C 1IUOA 3E81A 4CG1A 2WTEA 1JFSA 1MHPA 2XQFA 4R9NA 2V7QD 5JSZA 1IBLB 1KYXA 2NQ8A 2JLWA 2O4UX 3KZNA 2LIPA 1OUMA 1TRKA 4RHTA 1WB9A 4GM1A 5TS3A 3TRHA 3HCWA 5LQAA 1PNQA 2G83A 3FAKA 3TX6A 3L93A 3NORA 3GZTB 3BVZA 1WUHS 1TGVA 4XQEA 2PXXA 2PWAA 4DQLA 3TBLD 4ZRQA 1WVIA 1J4AA 1EGHA 4EHAA 3RNEC 3SI7A 4R0MA 4RAOA 5ER9A 5AZHA 3Q7IA 4RD4A 4NL4H 3UICA 3LPAA 1XCOA 3AY3A 2AOUA 4QOSA 4QNNA 1HEUA 4KODA 3PZBA 5AM4A 1GU7A 4UM7A 4CR7A 1EXWA 5BMVB 3ZV7A 1RWNA 2C7OA 2XCRB 2J3HA 4GLBA 4OQZA 5BSFA 4TMFA 2JBHA 4JQOA 1NJ6A 4YTPB 2H7XA 2IUFA 3M6AA 4FFVA 1V6AA 5AXDA 3L9XA 2GA8A 1J5XA 1LBSA 2PH3A 3LLUA 4FLMA 4WGFA 1NUUA 2C3YA 2KTFA 4D9HA 3T9CA 1R7SA 1KF0A 1K9VF 4MVCA 3KDPA 1SUFA 1PKEA 5LXHA 3G6KA 3TBFA 3ZD6A 5E6PA 1NF8A 2QM7A 1YDMA 2FSUA 1E9RA 2VDWA 1WH3A 4MUAA 3GB1A 2ZIXA 1GCOA 4IQ8A 1D4FA 1RJGA 4Y1RA 1EM8B 1P18A 2YWCA 1JBEA 4PYIA 1H42A 2C2OA 2FQYA 1HT2E 3NUGA 4FBJB 3LQFA 5DX8A 3VTUA 1AA9A 3LCUA 4DNFA 1V3TA 4JVMA 3Q3GE 2GNOA 1QP4A 3IO5A 1E7RA 1RWVA 1RMYA 1MCZA 3BXGA 2C2KA 4BO6A 3L3BA 2NO0A 1JVNA 1JFFB 1ZJ4A 3FVQA 2X4DA 5KTYA 2I2BA 4Q3EA 4C7XA 4ZCLA 3GBSA 2OGZA 1YZQA 4A8JC 3TLKA 4RXUA 3Q41A 3CW9A 3KP1A 4D82A 1RKQA 3VR2A 2YKGA 3AR6A 1P75A 1CYEA 1UUFA 1Z6ZA 4ZPXA 2LRUA 3K96A 1ZHHA 4DNXA 3PHXB 1VE9A 2J4DA 4N3BA 2RGUA 2PWYA 2QDKA 3SZLA 3ZQ6A 2P2LA 1NIPA 1RFKA 2QGNA 3L43A 1U1GA 4WBNB 4D0RA 4XM0A 3I57A 4AZVA 3KT6A 4F5DA 3RHTA 4DAOA 2FSHA 4ZYZA 1GILA 4P8RA 4OHMA 2DLDA 3LPLA 4I8XA 2EIXA 4Q05A 2CCJA 3NIFB 2BF7A 3RGGA 3U3DA 4RGNA 3P9ZA 3O90A 1T5HX 2GXQA 4YUXA 2O2IA 4BWVA 3IQWA 4JV5B 3K3PA 4XC2A 5K0NA 3P45A 2I91A 2VAMA 3K6KA 1YBFA 2GRAA 1Y5IA 1E2QA 5EPOA 3SP1A 3KYCD 3NAGA 2ONQA 3PC8C 1FYWA 2A0KA 2ETXA 3BA1A 4HG2A 3ADDA 1SBHA 2X7XA 4URKA 3EMBA 3TSOA 3Q2IA 4Q02A 3ZGYA 4BWGA 3P9XA 4ER7A 4FIZA 3OOJA 4J90A 2R8OA 5BUCA 1HOXA 4B0MA 1MJGA 3MPOA 4TN1A 4NEGA 4X1YA 3VMMA 2VPYA 3LHDA 5THKA 1KDRA 5LQMA 1WXDA 5KC8A 5TT1A 2YV3A 2FFHA 2CHUA 4BKOA 1J33A 5LWQA 4M9QA 1ZPSA 2HLDA 2BBSA 4GXRA 4CPDA 3OJLA 1W4RA 2AE2A 1EU1A 5B3JC 3GRCA 5K3SA 1TO1E 1A9YA 2BMJA 4HMPA 4LRTB 1FUKA 1PR3A 3HB0A 3EZ9A 5ICSA 2AI1A 4U5XA 3CRMA 2Y0EA 4BRUA 2QHOA 4KKIA 4HXFB 3S7ZA 1TW2A 4F3TA 2WIFA 3S1SA 3KLSX 4W5NA 1SPXA 4YUZA 3E9YA 1TLLA 3ZVMA 4DGSA 1WPRA 5DULA 2O48X 3ELWA 2XQVA 1CD5A 1WDLA 2WXPA 3HBFA 1VIDA 2C20A 2H4HA 5B36A 3DB1A 3BRWA 1QIFA 1Y9EA 4G8BA 1KSFX 3Q7TA 1C3EA 1W4AA 5LQJA 1XDUA 3V4ZA 3HDQA 4WFKA 1J19A 3BIJA 4GVPA 4IDHA 1OTRB 1JL3A 3HP1A 4KQCA 5FUMA 2D07B 4GI5A 2HWWA 1PBNA 4J1QA 4I99A 4YSZB 4MV5A 1N5JA 3IHKA 1ZVVA 2J09A 4F5YA 2VPPA 3HADA 1AVTA 3O38A 1WR6E 4UUPA 1HT1E 4TQGA 1T2EA 1ZG3A 1ZZGA 1YX5B 3FWHA 2XUQA 1BRTA 5KQMA 1XXHB 3DL7A 3IDSA 3PP8A 4YRLA 2J0UB 3B6ZA 2ZYTX 1AGYA 4RBNA 1YKSA 3Q8KA 4ZEVA 2VT2A 1RWQA 2B9EA 4FCWA 3SSAA 4RD2A 3K1YA 2WSSA 4LRYA 3TD9A 4BVBA 3FUVA 3VHTC 2HT6A 3IXMA 4RZSA 1Q7GA 3L08A 3AE7B 4FJ1A 4XPIB 2Y05A 4RM3A 2Q8QA 3OWOA 1CJCA 4Y98A 4YP7A 4CWAA 1U3TA 2J87A 3U2QA 3KJHA 3FZQA 4MP3A 3H1FA 4ZQCB 4CNBA 3BQ9A 4ERNA 3LUDA 3NRJA 4MUXA 3ABVB 2V9PA 2OXRA 1XMOB 4KOEC 2I03A 3F7MA 2P9JA 1N8SA 2YRWA 4M0WB 1XC7A 1G0NA 3AHEA 2NSDA 4LCBA 3RLIA 4U8GA 2ORWA 3W8FA 2X6TA 2G6TA 1H1DA 5AW5A 4A03A 1T2DA 3W77A 1FDTA 2XVMA 4ETMA 5KSPA 1GLVA 3GT0A 1GL9B 1HT0A 5GAJA 1YZGA 2QMEA 1N3BA 3AB3A 2HD4A 4HXGA 3FGNA 5EPEA 4CJXA 2ABWA 5CH8A 4OU5A 3A4NA 3QV2A 3NCTA 4OQYA 1FP6A 2V7TA 2NVWA 3NR2A 1WIAA 1HBJA 1NJ5A 2H0QA 1YS1X 3WV5A 1Y9ZA 4Y6SA 1GNUA 2OFFA 1G7CA 2EU8A 3U40A 2A4MA 3Q7QA 2DPGA 4MKZA 4TYQA 3SD5A 3AL0C 3AF1A 4R01A 4EVRA 3WHLA 3CSSA 3QQ5A 4RWEA 4FINA 2GM3A 4UMEA 3ZWPA 1IQPA 2HK8A 2KWDA 2NVUB 3BG5A 5JNRA 2HI0A 1X7WA 4B8ZA 2OT3B 1YHZA 3IIJA 5C1BA 4IDGA 1JWUD 1X7HA 2G04A 1XZEA 3RIGA 4I4TA 2QLNA 4XPZA 5CXUA 1C1XB 2KTRB 5AW8A 2CE7A 4S1PA 4DA9A 3N0TA 1K63A 2OCYC 4X95A 4IGAA 4MAMA 3OEYA 2OESA 4NZMA 3BINA 1KI3A 5IKXA 1EFDN 4D1YA 4Z9FA 3USZA 3DV9A 4EHKA 1WSWA 2F00A 4L5IA 4PT5A 1EWYA 1E8DA 4BAXA 3WWYA 1VI5A 3N76A 4TWAA 1I7NA 3G7UA 1SNYA 2GPWA 1O9HA 2H92A 2ZDQA 5CHWA 2WNHA 4FKBA 4RHFA 3CVJA 4QICA 2QYSA 1Z2CA 3PUWA 3AR3A 3A0UA 4EI9A 3A6DA 4LJ7A 1MGOA 5EJMA 1X7ZA 1R74A 4TZ0A 3IBCA 1P5RA 2VWQA 2EW8A 1Z25A 3RCZA 4RVFA 1NC1A 3R7BA 4LTMA 4N5DA 2NOAA 3H8HA 2Z6UA 3UKDA 1N60A 1I33A 3UZUA 3CZRA 1T3GA 1KAEA 3DHGC 4K8RB 5A2GA 5E4YA 1ZH4A 1TUGA 1WQ3A 4KDIC 4BX9A 3GK3A 2X13A 4P82A 2EF0A 1NZJA 1YWGO 1YJIA 1JMLA 1SBZA 3DKPA 3RMKC 1FTWA 4FYJA 3H17A 1NE7A 2JLRA 1G64A 3MCWA 5ILGA 4X6UA 1COWA 5CW2A 1GRNA 2OPHA 4RF5A 3TLXA 2CJWA 5P8WA 5ADHA 1SQ5A 4TZKA 1HKUA 4PSUA 1EXMA 3BJMA 2IPNA 5B1DA 4ISCA 4RGMA 2VJCA 5IP5A 1VJCA 2R8YA 4V2UA 1XPRA 3FR7A 5MHTA 1W4CA 2M19A 2Z09A 4PG5A 1WXIA 4YTEA 2CD7A 4HTFA 4KIFA 4DSOA 1N5DA 3TSSA 4C0JA 5B3AA 4YRJA 3AEUA 3RVBA 2WSMA 1SBQA 3BF8A 5E3JA 1LLCA 2HCTA 1XWWA 4JLJA 1ICIA 3C1AA 3WIOA 2I99A 3MWJA 4MEMA 5C5IA 4M9RA 4EPVA 4Q0MA 5EP4A 4KAAA 3WLRA 1Z34A 2CC2A 1H22A 1IQ0A 1RYFA 2Z4SA 2F90A 5CJPA 3BGDA 3WTCA 2ZS8A 1GQFA 3OO1A 1J07A 3HEAA 1XRLA 4Z7QB 4IH1A 1RWKA 4B4KA 1YX6B 3K5WA 3ORHA 5CIQA 4EG3A 2O2ZA 3FTEA 1W0JD 5IDXA 2JFQA 1RLTA 5LB2A 4YXWD 2Q62A 3KFXA 5FAXA 5ECDA 3WDMA 3ENWA 3OZTA 5LUAA 1XPOA 3VRBB 1GA6A 1OBHA 2J42A 4USAA 1LX6A 3O8NA 4XYMA 2ZULA 1G8SA 1SJ9A 1YRLA 1E6UA 2CHWA 3A8TA 4KX6B 2HWXA 4LX0A 5JANA 1YKGA 1RRPA 2ZB8A 2PGJA 3Q6MA 1NBMA 4MQUA 1R50A 3AM4A 5DT2A 1IBRA 2ONJA 2MSCB 3HSKA 3PENA 1CR4A 4IEFB 1RM6C 1YZHA 4WLOA 2K6QA 1V86A 5H59A 4R2HA 5HK8A 4RCZA 4MO2A 3NLLA 2PZMA 5DI3B 3UT5B 2N7EA 4WWPA 1Y63A 2CE2X 4BL5A 1D2NA 4YH1A 4KXXA 5JAZA 4MJXA 1FQOA 5HUQA 1FRQA 2NTTA 1LPOA 2G1UA 3DCIA 2WSIA 4EEKA 3EJWA 2ODEA 1LDYA 2QRNA 4B35A 3QUBA 1AN9A 1T8RA 2NPOA 1KJQA 2K1FA 1R4MI 3AUJB 4B3FX 1NC3A 1ODSA 1PD0A 3N2IA 5C7OO 4BRWA 1ZI6A 3NIDB 5K3BA 4DUZB 4L50A 4BBNF 2E5LB 4W9FA 1F1HA 3DDOA 4CTOA 3AE9B 1DXOA 5CLFA 2NBWB 2WY2D 4UBIA 4L27A 1QH8B 1GPLA 5LP1A 1D2HA 1JSCA 2E3TA 4OO3A 3RV4A 1AM4D 2QN8A 3UATA 3RAPR 1ZR2A 1DS6A 4HCJA 3LYLA 4P7IA 2PUWA 5B3KA 2ZRNA 3H84A 3UGTA 4J29A 3H5OA 3MCVA 4OQPA 5IJXA 3X1XA 1I3OA 4X7PA 4WDRA 4DXFA 4I1IA 1RXIA 2H11A 1OGWA 5IJ9A 3ZW8A 3WAJA 1CMXB 1HORA 3LUAA 2ISSD 1C1YA 4UUAA 2OK7A 3TAHA 1XKTA 4P9NA 1Z5VA 1RVDA 4A0HA 1WQ1R 2IY1B 4OGKA 3T4XA 1GZUA 5H8WA 4KQ9A 5B6PA 2CFOA 1RBMA 2QP4A 5C46F 3ABQB 4IFBA 4IXMA 4OL9A 1WD7A 1E3JA 3W5VA 2J0JA 2R6AA 1YI1A 2OSBA 5K3FB 1G41A 1L7RA 3ZRFA 4N8EA 2WYQA 4M60A 1VKZA 3D8RA 3QY9A 3GLGA 2O2VB 4HDNA 1V9LA 4FIDA 1P1CA 1E58A 1UWLA 3UYLA 4M0FA 3UANA 1DTWB 4V3BA 4GKKB 4RDXA 3UF0A 4DIUA 3CVWA 1TM3E 1V48A 3EXIB 2CUTA 1ADYA 4Z99A 1E4YA 4WNIA 4D8YA 4BYGA 3IPXA 1M2EA 4N9QA 1QZ3A 2H1SA 3WAMA 1NW8A 4KFRA 4MJSA 3HEBA 1YULA 4HVLA 5BP7A 3I8XA 1XJQA 5GONF 4R6XA 1F48A 5ETJA 3PC3A 3V3TA 4C9BA 4CKEB 2C07A 1ABBA 1L5RA 4F04A 5LUBA 3CY6A 4R9SA 1T8SA 4UNIA 4B81A 3O0TA 1Q1GA 3RADC 3H6GA 1OLOA 1JAXA 2PGDA 1AKNA 1KZ4A 2YIMA 2PUAA 4MW2A 1GV1A 1PWHA 1E1YA 1FNCA 1OB2A 3Q9SA 4NOJA 3VDXA 2NW6A 2Z9DA 1HDCA 5FUXA 2FPPB 3UXYA 4GG1A 4JLUA 1ACCA 1OFGA 3SK0A 4PPNA 4XE5A 1P5HA 2C59A 4HYYA 5JUWA 2GUWA 4ZT5A 4PC6A 5LIRA 4I4LA 1ZXHA 4EZJA 4HNAA 2F1IA 2GD6A 3OHSX 2N47A 1X0VA 1JFVA 1GT91 4BQFA 4FYKA 1H9CA 4K9RA 3ZKWB 3DM9B 3T5DA 3T7RA 4DW8A 2ZS7A 3V8EA 4A55A 5IBRA 3NNSA 2ZPYA 3GMSA 1YBVA 2NZ8A 2PYDA 2E1PA 3UUGA 2JI8A 1IWBB 3QE0A 1PDOA 4JYPA 5IUJC 2YNMD 1P4AA 3EN0A 3WFJA 4H27A 5EHIA 4KH0A 3UN1A 3I5MA 3FYSA 4KPUB 4W9IA 1JDVA 2D3WA 2W43A 1SA0A 4TS4A 3U4EG 1E8WA 4HH4A 5AW3A 2GI4A 2H1FA 1D6MA 4E32A 5JJ5A 5HWSA 2AOXA 3KB8A 2NPFA 1ML4A 1TOAA 3K1ZA 2A6PA 1ZOSA 2IPOA 4XCQA 5F21A 4S12A 1RPJA 4Z9BA 4QIHA 3D1VA 1R0YA 1TYAE 4B3CA 4H7HA 2I65A 1HX7A 3VU0A 1DAPA 2YYYA 4B73A 3JQQA 2QA5A 4BVEA 4KGXA 4WOBA 4EPXA 1ZJ6A 3M6MD 4NX2A 1EFCA 3CF4A 1DX6A 2RHRA 2MBQA 1HUQA 2MINB 3GRAA 1QUFA 5ERYA 5F23A 4QUEA 2FLKA 1SZCA 4IFIA 5JSFA 3DMPA 2YJ4A 3BC1A 4KI0A 5KHOC 1FMFA 3H99A 4ARCA 2FEOA 1EUYA 5TY0A 2KN4A 4GR4A 2ZCUA 4RCVA 2VHVA 1NR5A 1SCIA 4ITRC 3NS1A 2XLCA 2BMEA 4IZIA 4O25A 1PFVA 3WB0A 3DLBA 4FUQA 1JHVA 1MZVA 4KX3A 1Z22A 4YPOA 2N0SB 2Y93A 4KR6A 3UAOA 5KJFA 4FHCA 5DWVA 5JHBA 2OKGA 4RETA 1MRZA 1RZVA 1P2DA 2G7MC 1C4OA 2WLTA 5CLLA 4L0DA 4BEBA 1WW2A 4PZYA 3AUYA 2AS0A 2C94A 4GMXA 3WANA 2Q2OA 4ROSA 3DVGY 1E99A 3IJEB 2F1KA 1D09A 5HHTA 4WJNA 4QELA 1WA5A 2J7QB 1AKWA 2YRXA 3ZHXA 5FUQA 4YHHB 1T3TA 1DRUA 2YMPA 4IX9A 3RROA 3P9KA 2O3RA 2C9OA 1J6UA 3UBMA 1E8YA 4JODA 5FI5A 5A3RA 1VCMA 2FCAA 4G56A 4X20B 1FNDA 1VMAA 4QEKA 4RM8A 2P9QA 5KJ1A 1JQLB 2HPVA 3GN2A 1XMSA 5H4GA 5A04A 2C5LA 5AKLA 1T8WA 4BOZB 5JH5C 1FFDA 1GPDG 2QVCA 5HS6A 1GYQA 4C6RA 4FFDA 4URWR 3N2YA 3F5FA 2VP5A 4N01A 3PSEB 3I8SA 3E3OA 1TJNA 5IANA 4GVXA 2V1XA 1K8ZB 1N5KA 4R1OA 4RCOA 4OXRA 1XTRA 1NF3A 3FDIA 1VHQA 5C53B 2GQ0A 2A86A 4DILA 3KVRA 1QG0A 2IO3B 4RGBA 4K81B 1QRRA 4KSBA 3H4MA 2IIPA 4QT4A 4M83A 2RONA 4E4RA 3AE4B 4J0KA 1DBQA 3R1IA 4UMVA 3VRHA 1P9NA 4H35A 1K8RA 2QUZA 1EA7A 3A58B 3U6BA 2LGYA 2VHQA 1I94B 4F2HA 4DBGA 5SV2A 1QYVA 4EQ6A 3IRUA 1JSXA 3CUYA 4BAGA 1ZMBA 4IWPA 1KZGB 1HNWB 4O4HA 3EY9A 5DM0A 2OXTA 3WLLA 3MMZA 1YONA 2I80A 1GU0A 3UJ3X 4UTPA 1Z37A 4JC4A 1RWMA 3PHLA 3LXMA 1CQPA 5K4AA 4ZOEA 4XWKA 4YK7A 3HK0A 2C7VA 2GNAA 1TKGA 2AEFA 2VZ0A 4A6PA 3TZ6A 1W6UA 3HYTA 3VR9B 4IIHA 2Y9MB 4N54A 5LCXA 1DB3A 4O2BA 4WXRA 2O8VA 5AOAA 2WNIA 4RHCA 3PFCA 4G0NB 4JJGA 1QRTA 3HB5X 2J9FB 1SVIA 4YAEA 4A10A 3EQ8A 4O08A 4F71A 1BXGA 2Z8XA 2R25B 2H08A 2YZ7A 1ZSYA 1PEAA 3ICQB 1LTQA 2GKOA 3UENA 4RWZA 3F90A 2Z1NA 2CDRA 5IVIA 4MWDA 5ALIA 1E61A 4BOYA 1H5QA 2A0YA 2HCJB 2ONZA 2WP8J 1ZQ1A 4HUTA 4MQEA 2TS1A 2EWVA 4YASA 3M3PA 1WKBA 4MWGA 4JFRA 5FOWA 1II8A 2I6FA 3WB2A 3KKPA 1JR2A 2XMCA 2JBAA 4EJ2A 5ILOA 4QJBA 4QOJA 2OV3A 2IYFA 2R60A 4EVQA 3ON5A 1ECFA 3I37X 2PA0A 5DYWA 3RKUA 3AKZA 2IZVB 1H3NA 3RYTC 4BNDA 1VOTA 1NATA 3FCAA 3NB0A 1XLQA 2R1VB 3QU4A 5JCZA 5AUNB 5T4HA 3BGOS 1FDVA 1J99A 3IBTA 1ZMRA 3B08A 2KDEB 4R83A 2IY0B 5F12A 1GRRA 2BTEA 2C2WA 2Y8EA 2XGJA 2RARA 5I7UA 4HNHA 2PG3A 4O4JF 3OPXA 4PN3A 4E08A 1KYWA 1USGA 4L15A 1JAYA 2ECKA 5T8KC 3V5NA 1QBGA 1R0ZA 4ZRMA 5BY2A 4QJ5A 2NSYA 5GONB 3T99A 4ZGBA 1UC9A 4PZLA 1Y34E 2G28A 5T6MA 4TTRA 1SBIA 3B7WA 3H5IA 4GMHA 4FA6A 2VP0A 3HWX1 5D6OA 3D8BA 2X76A 1KK0A 1M1YB 1UBNA 2W42A 3N2ZB 1QZXA 3BXPA 5H16A 4EI2A 1UXGA 3KVOA 4O2LA 2HSZA 1G7TA 3O7WA 4HDOB 1I4LD 4LV5B 2AK3A 3SLRA 2V7GA 1N63A 4ZAYA 3RBAA 1L8OA 1OYOA 1SE4A 1O89A 1DKQA 1RRVA 1HA3A 5BQXA 1NFFA 4YJ3F 5LIPA 3KX2A 4G0WA 1NYTA 1ISMA 2P3QA 4HAIA 2VJKA 2PEZA 1BT0A 3LTNC 3B1KA 1HT3A 3DUFA 5AKZA 5CTRC 3HR4A 1R6AA 4C7VA 1WMHB 4FNMA 2F1RA 5AVJA 5E2AA 4YAUA 1ZYUA 5KOJB 4C0HA 3MJRA 3OI7A 3G82C 2DWQA 1SEBD 1PFQA 1TZCA 2Q29A 3SQLA 2LRWA 3IXSA 3R6WA 1UP6A 1SHKA 1Z0IA 1BCSA 4BX8A 1RKUA 4WA7A 5ALEA 4RA9B 4HPWA 1L6VA 3VNUA 1CUVA 5D84A 5KMGB 1MZPA 3GLHB 2J32A 5FT9A 1SKYB 1NXXA 2MSNA 2N1WA 1CEQA 3ZLVA 2Z5FA 3L6UA 2OHHA 4PQEA 1H94A 2Z2ZA 3A26A 5F5NA 1SHTX 1P4RA 4RGQA 4PLFA 1YR7A 1LNZA 1N34B 4TZTA 4DQVA 1BHJA 4LJYA 3T6KA 5CFQA 4LJAA 4M49A 5JI3E 3PWKA 1UFVA 2QLJA 2WJPA 2L32A 4O2AA 1ULUA 3HVRA 1YS6A 4CIAA 5JLJA 4IUCS 2DULA 4DCSA 2AT1A 3HV0A 4PN7A 3PRJA 2ZW1A 1O3YA 3W6PA 4LN1A 2Y1EA 3LS2A 5CVVA 3G85A 1VLBA 4QTYA 3O8RA 3AF5A 3NETA 2VHUA 4CV2A 4D4GA 5C9ZA 1C8BA 4A5OA 2QYHA 3VTFA 2OGWA 5IDVA 3UHAA 3I1JA 5KC9A 4F8YA 1GGEA 2BMAA 2ZI9A 3ROTA 4OW0A 5IFLA 1T8TA 1OXMA 2XUFA 3K6SA 3T0GA 4PS7A 2LUMA 3QX7A 1M1NA 4E88A 3SOPA 2Q4DA 3ZNQA 4HN9A 5BQFA 4QXPA 1TZ1A 3QX3A 2EG5A 1DYQA 4FPXA 1S2OA 1CJMA 4B0PA 3DDZX 3JQCA 4HDSA 4BBZA 4MKRA 5EDSA 3OUUA 3VR5A 5K01A 3VAYA 1QR6A 2KX0A 2PVCA 2UU7A 2ZE8A 1CUZA 3A3OA 1LFAA 3CUEF 4R1TA 4I36A 4WNYA 5IKCM 4FQ8A 5BN4A 1Q7TA 4RF1A 4HLEA 1P6UA 3PNSA 2J31A 2QQFA 4YDRA 2FMHA 3TOXA 2ONYA 4ZRIA 4MR8A 1LLQA 5DSXA 4RTSA 2WA2A 3JD3A 4Z4EA 3OJ3A 2PBFA 3PNMA 1V8BA 3WLIA 4PF1A 1I1NA 2J33A 4D6PA 1W5FA 4OMCA 2W6IA 4LUCA 3I52A 3VPDA 2DLBA 1FL9A 4UD6A 3R8XA 2XUDA 3NP9A 3HG7A 5IBQA 2CXSA 4C3ZA 2OJWA 1VFPA 2A1UA 3LY5A 2EW1A 3EFOB 4LNIA 1V9SA 1Y48E 4ZEXA 4Q1DA 4NU6A 3QW4B 2QW1A 1WR1A 5B7NA 2B61A 1UT6A 2OVBA 4RFVA 3VX4A 2DFLA 2WIGA 4KQJA 4NAUA 1RXSA 4UTXA 4MNTA 3JW8A 1LZKA 5SY9A 4BECA 4B1FA 2X8LA 5LXIB 4K9QA 3N8GA 5ANRB 1MPXA 3I45A 1S2GA 3QEAZ 5D51S 3OZSA 3IELA 1US8B 3P32A 4CM3A 1V1PA 4M86A 4LXHA 5H92C 1D5MC 5EFZA 1XVTA 4BN0A 1L6IA 4KGDA 3H9QA 1VJ5A 1EUQA 4ND2A 4CMEC 1FSGA 2EERA 3T3NA 4CN9A 1YQUA 5C8XA 4JITA 2QM0A 3CISA 2FFJA 3T7IA 1XVUA 4LDRA 1MO6A 1NMEA 5HTKA 1RHQA 3NVMB 1ZN2A 3OCYA 4YJDA 1EHCA 4ENVA 1I42A 5DEOA 1SHUX 1CQIB 1SGWA 2KJQA 2COEA 1DWQA 2QKYA 3JQAB 4IIJB 4BATA 4AN1A 3FBTA 1G6KA 3SJZA 2IXGA 4WJLA 3HK2A 4B43A 4N5NA 1OWMA 1BDIA 4ARZB 1QRSA 2VA9A 1Q50A 3DAHA 3EZXA 1W0KD 3CZ4A 2C7PA 2XCUA 3R4VA 1JAHA 4W1RA 3F0TA 2IUEA 1E3WA 4BO4A 1UZAA 2OBYA 5CG1A 4YRRA 4KMOA 3MP9A 1QHIA 3FE2A 2V9ZA 2RGFA 2EFHB 3HZRA 4KQFA 3JTMA 3K4HA 1SKUA 3QYPA 1BJRE 4LY0A 3ALBA 1YRHA 3E56A 3U4CA 4EATA 1SK9A 3VR3A 5ARBA 1GP2A 1DIRA 1QHYA 1NTOA 2D2FA 2JA1A 2GN0A 4H7PA 4KVFA 4NZZA 1BGWA 1L8QA 4BKGA 5L9AA 3Q6IA 4RSMA 3BCSA 5BSKA 2PIDA 4RQAA 2JU6X 1U3UA 4J0GA 1ZNXA 5KO2A 2J6BA 2GSWA 4V0MA 1LFDA 3PQCA 3VSAA 1KI4A 3KSUA 2ECFA 2Y99A 4CLRB 5C5DA 1BG6A 1VLMA 2ACVA 1IN7A 4W5TA 2QRMA 3TLBA 3E6AA 4L9SA 1BTOA 4QEDA 3U61B 3SZRA 1C9KA 5JARA 1DCTA 3F67A 4RELA 2WM3A 1VSBA 3OZRA 5ALKA 4KPEC 2HU7A 4B0OA 2C2XA 2YJTD 1DUIA 3S28A 3KZVA 2C31A 3RK0A 2E48A 3HMQA 1NVEA 3P9YA 5CHYA 1E7YA 2ZTHA 4HCPB 5EJ8A 3HDHA 3TRKA 3G0HA 1KI6B 4L2IA 1SRRA 3PEEA 1R18A 3F1LA 4U5QA 4RKRA 1H3FA 2QQ0A 2BFBB 3EIEA 2QN1A 4KU4A 4WXEA 3HUEA 1UBCA 1KQPA 3PUKA 5M04A 3M4XA 5KWJA 2VZLA 3L0DA 1CR6A 1DKMA 3UAZA 3KWJA 2A9RA 4YCSA 4Q1BA 3ST7A 1CQXA 4XYEA 1HXHA 3G8BA 4U6QA 5JH7A 3OE7A 1ML3A 5I01A 3I04M 1L5WA 4YT8A 4IQGA 1XYGA 3A1WA 4IDEA 4FBLA 3FKSD 2I71A 3M63B 2JD1A 1NQWA 2PLAA 4LIPD 1XDDA 4AB1A 5D86A 2B21A 2D4AA 5IAAC 1SE3A 4KWEA 2M0XA 3VO2A 1GZHB 1X80B 1XZKA 2EZUA 4YJ3B 4C7BA 1H8EA 3PNKA 4PM4A 2EKZA 4FC6A 5FQOA 3F6RA 1XZMA 1G0OA 2BTQB 2RBGA 3MTBA 2AXQA 1DOAA 1EB8A 1TKRA 4C80A 4DXHA 3HCDA 1A50B 3SHTA 3BOSA 4CCWA 4ZT4A 3WL8A 4DDMA 2Z04A 2PAFA 4GOLD 1QYWA 1Z5OA 3L18A 4XWWA 1XCPA 1XYVA 2NTVA 5E6OA 2UYOA 1B1AA 5KQSA 1J8YF 1WZUA 3L4JA 2WPNA 3GNQA 1XZQA 3IQEA 4DGQA 3ZIDA 3KKLA 2PWPA 2JY6A 4BX0A 1FS6A 3H6NA 3HP4A 2WWGA 5AXAA 1GPMA 1VIYA 3WLNA 5BUQA 4E09A 4J0DA 3PQ3A 3L8DA 5ALSA 2OWDA 1O8CA 2IYWA 2H1IA 4REMA 3VFDA 2BKLA 4OI4A 3KRTA 4TYMA 3TW6A 3AFMA 4YAKA 4X7BA 2ZGVA 3FYUA 4ZVMA 4OA5A 3VPXA 3JYQA 2SNIE 3OG5A 3EHDA 1H0SA 3PWSA 2GOWA 3KQKA 4UHBA 3VUWA 2FZ5A 2HIGA 3U7EB 1B76A 1YRAA 5EUMA 4WXMA 6GPBA 1ZVJA 3I73A 4E94A 3O1IC 3MTJA 2FNJB 4I08A 1EWRA 4XQGA 3ABIA 2A1TS 4LDTD 5JCOC 3JYHA 1JNXX 3SF8B 5DTQA 5HSGA 1YGYA 1LS1A 5IEJA 3K2IA 4AKEA 4ARSA 1MX5A 4RD0A 2QM3A 2PWBA 1TT7A 2MIIA 1SU4A 1NI4B 2BP7B 3P1MA 4EG8A 3TDKA 2WX1A 4GMGA 1DIBA 3B2NA 4MUGA 3MJCA 2Y77A 3BTVA 3WTBA 3QKRA 2HXSA 3N7AA 2D2XA 4U0KA 1LPMA 3U9LA 2UYZB 3X23A 4B6GA 5GM1A 4BZPA 5KZMB 5HJ2A 2FYTA 1M0EA 2PUFA 3NEJA 1LWNA 1JYFA 1P2FA 4KI7A 2J9ZB 2CNKA 3DE3X 1A5BB 4XD2A 4YJFB 3NGXA 1YJCA 2Z2YA 1CNEA 4II2A 2NSHA 1POXA 5CBKA 1O6FA 5BSRA 1W1IA 1ZCAA 2JFYA 1NHGA 1XCGB 4Q47A 3FPBA 3EAGA 1XPJA 2UVPB 5J4HA 4YMTA 1EDBA 3JVIA 4NYJR 1JHPA 2W37A 1QS0A 2SKCA 1CIJA 1P61B 3M5WA 4LVOA 3DXFA 3L7KA 3AHIA 3KTOA 4ZALA 1XPUA 1URPA 2W6QA 3A6JA 3A4RA 4B3HA 3T3EA 3OIFA 1ZUHA 5I8ZA 3AM5A 2BGNA 1WYGA 4UW9A 4E2FA 4HDAA 2W2LD 3DWFA 4EKUA 1OFTA 3ROKA 2ZYGA 2IJGX 2JIPA 2ZZKA 3I6YA 3W4KA 1B23P 3K1AB 2X2FA 2W6JD 1E98A 3AONB 4NAHA 3L1VA 2QVBA 3C8MA 1D6SA 3NBKA 1P74A 2DHEA 3RHSA 1FFEA 2BMFA 4GU5A 1E1QD 3V4FA 1JP7A 1TCUA 1MVNA 1V1RA 4EHLA 5WRFA 2XOKA 3QNMA 3QXJA 3DT9A 1Y6GA 1TM5E 3CRRA 4NDZA 3TQOA 3QVLA 2MMCA 5AW0A 3VPAA 1DEKA 4J7UA 1M2VA 4Q48A 1I3LA 4BQIA 2XYRA 3AVYA 5BW6B 2Y1KA 2YFYA 1VSUA 1QU2A 4L8VA 2QAIA 3Q14C 3S2UA 3L8YA 4RADA 1A9SA 3STHA 2ZR9A 1PTKA 3D0OA 2ID7A 3MVEA 1TT5B 1FE8A 4BO0A 1OZ0A 4HWGA 4AXXA 1GPWB 2WZQA 2OBFA 2LUOA 3ET5A 3EPRA 1JJVA 5LP6C 2WU1A 5AWFC 4AP6A 1ANKA 2W2PA 2HSJA 2QMQA 2ZUEA 2I78A 5JDIA 3MLEA 3PGMA 3THWB 2ACEA 3FI9A 5JJBA 3AILA 2ES4A 3VQTA 5CX3A 4FWIB 2MT9A 3VU9A 1MW8X 2J3LA 3TEXA 2XE4A 1H6CA 3I3SR 1GTJ1 4S2EA 1BKDR 2FWMX 3B2GA 3U2SC 3JQ9C 4RK7A 4I0WB 3AX6A 4DYVA 1T2UA 5KWSA 3TQSA 1AGNA 1SB3C 5C1ZA 3UJ9A 2N1VA 5K05A 5E6NA 2H57A 3REGA 5F78A 1EK0A 2CXHA 3ZDAA 1QIIA 3A1TA 1QIJA 3AERB 1BUIC 3SFDB 2W54A 3GVCA 4KDRA 4HH1A 5KYXB 2SCUB 4HDMB 4U4AA 4YRNA 3IODA 2WF8A 3EIXA 2JHFA 3G5MA 1D6EC 2FUG1 8GPBA 2B1QA 4TUYA 3ZCXA 4V0KA 1OFVA 2NT3A 8ATCA 1FUIA 2D8AA 1PEYA 3UF8A 5GJCA 10MHA 1XRSB 4IWYA 1CPYA 3WGNA 4LV6A 3ZQ4A 3BERA 3HCBA 4RDIA 2VAXA 4A8TA 3T1YB 3P5SA 3PFHA 5GOZA 2F3SA 1QFMA 3C7KA 2XTJA 2Q5FA 4FJVB 1DHRA 3AE3B 5KSOA 1WD5A 3AE5B 4UULA 4MH8A 3RS3A 2GEJA 3A9UA 1FFGA 2DEUA 4HNVA 1M1YE 3K32A 4DEVA 1W4LA 3B70A 3K0HA 1A70A 3R9XB 3CF0A 1CR0A 1Z5ZA 1FPYA 3IEKA 2O7RA 2EFYA 3IKLA 2ZB3A 2JGKA 3Q85A 2AYXA 3QELA 2QK4A 2QX4A 4HPLB 3X1WA 4AMVA 5LU9A 1E60A 4CG0A 5FA8A 5IBPA 3AU9A 2LD4A 5FBVB 3L84A 2ZIGA 3AVPA 2RPQA 2ZJZA 1C3VA 4IWQA 6REQA 3VHXB 1AZSC 4IS3A 3L7YA 4KACA 3W8NA 5BRAA 1RHUA 4ZT3A 1N9GB 5ALYA 3ITKA 2DP4E 1KLVA 5AH0A 4MV4A 2CFIA 1MPTA 1Y5LA 1W85B 3D5QA 3LBFA 4CIDA 3C5CA 5IULC 1UFQA 3KQLA 3NRZA 2WV9A 2IYTA 4FYYA 4R4JA 3DPUA 4KMRA 5I4IA 3VC2A 1EGQA 3PHIA 2ID4A 1EFUA 1XJ0A 4MDFA 1LBQA 1YDWA 1N62A 4GC5A 3K9OB 4HDQB 2JW5A 2ZRDA 3FSGD 3BIXA 1YT5A 3B8EA 4IJUA 3GLHE 1SKYE 1X19A 1NG9A 3JQBC 1IBCA 2QAGB 3HYCA 1A72A 3LWZA 4W5WA 3LYYA 4M8NA 3EH1A 2IOFA 2P8JA 2HIHA 2PRYA 2LDXA 2Z2XA 3V55A 3NIWA 5DI9A 3TLEA 2IYQA 1O08A 1QF9A 3K31A 2GK7A 2DFTA 2FW8A 1KETA 3I12A 4J94A 4GYYA 1K92A 3C98A 4BPBA 2G72A 3WK9A 2ILTA 3H18A 3DDNA 2V7XA 2P6RA 3QEMB 3RJTA 3TCXB 5A0FA 3UQYS 1GU1A 1LK7A 4FGJA 4ZARA 1VD2A 2Q5CA 1KP9A 1KQFA 3WCQA 1W2HA 1E8XA 3NOQA 3R7DA 1PCXA 3S5JA 4RIGA 2I29A 3MSCA 2XY4A 2HRCA 3E61A 2H2DA 3M34A 3MUFA 3FTFA 1CJUC 2ZW0A 4FXCA 1G8KA 2POCA 4PYKA 2XPCA 4QVKA 5JPCA 5I7EA 1HEIA 3I64A 3PJRA 3MPUA 1F0YA 2EFGA 2FJ0A 4EAAA 4PG4A 3PZRA 4HAOA 3LKDA 2ZUCA 2DR0A 1X0XA 3D81A 4IO1A 2E6UX 1YI0A 2QSJA 1MNAA 2B82A 5BSHA 1Q0SA 1GOZA 1E2FA 3VXWA 1U9IA 2C9WB 3RRJA 4FN4A 5A6SB 3GBPA 4HZUB 5CU7A 3O4GA 3U44A 1DKUA 3SEAA 3ZXVA 1I5EA 4ZD6A 3NHWA 1AB6A 3KLMX 1VMEA 1UXHA 3JQ8A 1RQ7A 2I8AA 2BGIA 3Q8MA 1I7HA 3IJ5A 3N2LA 3HXPA 1ZA2A 3AR9A 4BO9A 2HAEA 1LPAB 1IL0A 2X9VA 3IVAA 3KFLA 2O6LA 5AM2A 1QHHA 1V26A 3LW8A 1FD6A 2ZDGA 2J5QA 1G21A 3NTXA 4RABA 2CL6X 1WMAA 4JWKA 3BFXA 3ZGXA 1N57A 5K4GA 4CM8B 4FHJA 1W75A 1LF0A 1JDSA 1EZ1A 1UZUA 1FW6A 4Y9DA 5KYVA 3PDIB 4B6SA 3LCRA 1CV2A 1FRDA 1AK9A 1WRDB 4QDZA 3QEJA 2FSVC 2C83A 4AM8A 4CR8A 4X65B 4ITKA 1MMFB 2GETA 5ARCA 3MCTA 2PXCA 1IMOA 2VWHA 1CK1A 1BFUA 4BQRA 4LNUA 2C2HA 3M2PA 4HKTA 1IZ0A 4LVCA 2IYDB 2QJRA 4G1EB 1T3SA 2Q99A 2WP0A 4F86A 4U2DA 3P0EA 4ZEWA 1JDBB 4BO1A 3GYGA 2PQMA 3PYXA 3PWZA 3P9NA 3WC4A 2VF4X 2ERCA 1AZTA 4WZBA 1EU3A 5D3ZA 2M56B 4OJQA 1AN0A 2Y1CA 2C42A 5IG2A 2QN9A 3GUCA 1R4AA 2XRZA 2XQIA 3KUDA 4R2KA 5EIWA 3L0SA 1R4NB 1YL6A 2INGX 3T9BA 1E4VA 3WL5A 2LKDA 3IERA 4OKIA 2H2HA 2O05A 5L3ZA 1P77A 2VG8A 3B9PA 2DFVA 4WOCA 1PQYA 2WDTB 5EQJB 1IDOA 4S1VA 5J2UA 3NHAA 3B3QA 1SD5A 4KXMA 1KDZA 4EX7A 1T0QC 5DT9A 3W1VA 3OJXA 2WFLB 3CKLA 5ILQA 1M6NA 1MN6A 3N3BC 2C8LA 1IVYA 3SBOA 2E4XA 1E7PB 3ZJUA 4P7JA 5CDFE 2XDWA 3IUMA 1XKQA 2XADA 4B84A 4E5DA 3TIXA 5EMJA 4YY3B 1VM6A 4QUJA 4MVJA 1L1FA 4GQIA 4NYIQ 1CUFA 1TO6A 1N6KA 5JTTA 3R6LA 2PIAA 2D5IA 2PE5A 1PGPA 3BYYB 2FU5C 3PC7A 2NXWA 2W9XA 3PPVA 3NOBA 1VZ8A 4NBLA 2FP4A 1LEHA 4H7IA 1SHLA 1ZOIA 4M01A 5E4TA 3PFFA 1MX1A 2QLBA 3D6HA 4RIEA 1AB5A 2DSTA 4G01B 2MWSB 2DBYA 1JZSA 3BTSA 3WLKX 2RHBA 4Q6WA 4C0BA 4W4TA 4L73A 2D6FA 1T5DX 4GU2A 4V39A 1OH6A 1S89A 2GO1A 5L4LA 1HQDA 1GKLA 2ZBFA 2J5RA 2OZKA 4IXDA 2QR5A 3K8QA 2NMQA 1WJUA 2MOKA 1AV6A 3PNVA 4WIAA 2GRJA 5J1SB 3WP1B 3RRZA 5FV7A 3A2LA 4QQKA 2J3JA 1Z2AA 4CTKA 3B5IA 5JQGA 2FWAA 4CVNA 1TTNA 1KDTA 1DWUA 5FEUA 5D85A 4CFSA 3QUQA 1ZL2A 4TMVA 4U1RA 5DEIA 5F7XA 4L28A 3UB3A 1FPMA 3QAQA 4FADA 1QIGA 3MT8A 4UVIA 2I7DA 2C8VA 3RUAA 4XSVA 3HJFA 4I1SA 1ZCFA 3TIIA 2CHXA 4G1FA 4BO8A 1QLBB 3H04A 3GMIA 3D7RA 5LQKA 4IGKA 1LQUA 1RC0A 3S55A 3UHPA 3LKZA 4ARIA 3KOYA 1V7CA 3R3JA 2GD2A 3FDXA 2CU3A 1E9VA 1MBZA 4Z5XA 2XMRA 2Q6IA 4IW3B 3UO8B 2Q0HA 3ZU5A 2BM8A 4CQMB 2UVDA 3RVLA 3SOZA 1BDMA 3PDUA 1PUJA 1RWOA 3VDQA 4MRMB 4K28A 5DTMA 3CX7A 2CBXA 3QVWA 3TIGA 2WWVD 1SXJB 2DXIA 1TUEA 1I3KA 1Y8QB 1WCWA 3GZNI 2WJ6A 2Y0PA 3KT0A 4BNKA 4D8XA 3KJZA 3WYBA 3TNYA 1KFEB 3WZMA 1WEKA 1ODTC 4CI9A 1DGQA 4UAJA 1BIFA 3TPCA 5CA1F 2ORIA 2F2TA 2AI3A 3HLYA 2VO1A 4GLJA 1VC2A 5JJIA 4RPKA 3APCA 2V9CA 1XTBA 4EA9A 4JVSB 4YMVA 1OI4A 3RIMA 4EFMA 2QTGA 2IS2A 3U62A 1ZH2A 5JMPA 2G88A 1MO4A 2J48A 2ZZNA 1V39A 2PUCA 1G7SA 4CF5A 3H7PA 3SE7A 5BNIA 1JR6A 1KA9H 3B2FA 3GI1A 4G24A 2RHTA 1KKUA 1A7AA 2JVJA 4LXTA 2HHHB 3DE0X 5E6UA 2IXFA 3QARA 1IU9A 3LHIA 1K0UA 1I2DA 3OOHA 4ZC1A 1HQKA 2CVQA 5LDHA 2FDCA 1Z39A 3BHJA 1P0QA 2P3LA 2JAOA 3PNYA 5ECWA 1VRCA 3E4DA 1IRIA 4RPLA 2J0VA 1L6UA 1Z13A 5EMNA 2YASA 5D3IB 4LJLA 1ONOA 2ATIA 3ZH2A 1Q19A 2HA2A 3TNJA 3QKSB 4HOYA 1A4RA 3SYLA 3TLGB 3LUPA 3A4YA 3EGDB 3SMVA 3GG2A 2RAVA 4UHEA 3A9CA 5KWIA 1E7QA 2AD5A 2G77B 3NOOA 3NS7A 3M7IA 2H07A 2FP3A 4ZDJA 2GI9A 4D9GA 2R8PA 2GDZA 3BXEA 1TEHA 1U02A 4C22A 3AXCA 3E22B 1QAQA 5A3JA 1Y6FA 1LH0A 5DFAA 5CP8A 4ADSG 3U6KA 1RAFA 1SU7A 4DOMA 5DGDA 2XMDA 4XJTA 1FYXA 2WMDA 2BFCB 1MAAA 4G84A 1WX8A 2QX9A 1RAIA 4XR4A 2M1XA 1N8NA 2ZJ3A 1ISPA 4GMVA 4KVZA 1DAEA 1W59A 5CLJA 4H9GA 4YJHB 1J8VA 3C3PA 5ALDA 3IAEA 2FMTA 4L3VA 4DWWA 1IHYA 5AM0A 2X2EA 2Y9PB 3U17A 1NUQA 4B2YA 1NF2A 3W8EA 4KREA 4LEIA 2E4WA 3L6BA 2CMFA 3UHFA 3K0AA 4CMIA 2A14A 1FP2A 1X42A 4ACFA 5DLQC 1XAGA 2AWTA 5KQPA 4C6TA 1UF9A 1E63A 3OHPA 4QEZA 4FUTA 3O21A 2PSSA 2ZI3A 3KZXA 4NARA 1U6KA 3AF3A 4ZVUA 3THYB 4GDMA 2FZGA 3VHQA 1WO8A 4QODA 3BH7A 1XZGA 2QP3A 4C06A 2VJPA 4DYHA 1B14A 4NI5A 1IK4A 1L8AA 3CCCA 3ZNPA 3BKWA 2XN9C 1M72A 1RJEA 5EZ5A 4RK5A 3E4CA 2WDZA 2D1QA 4URUR 1IAQA 3TZHA 4JKOA 3ZR4B 5KSWB 4WLNA 4L9RA 5J9FA 4DCNA 1OZHA 2FOIA 5TJHA 4RE5A 4CKBB 2DWUA 3SJUA 3I6ZA 2HDHA 2D1FA 5HGJA 5AXCA 2G9VA 2IHUA 2ZBPA 4I9NA 3QBTA 1PG2A 3SJCA 2HRDA 5JG7A 5IEBA 2VRCA 2B8WA 1MDBA 2R6CA 4CMGA 4JUCA 2GJKA 4DAEA 2G4VA 4MS3B 2Y71A 4F5WA 3AUXA 1T0JB 1JQ5A 5JADA 1H2YA 3ZVVA 5COAA 4AMBA 1C7JA 3K35A 2H85A 1ZUD1 4RHYA 2QXUA 2BCJQ 1ICEA 3WHKA 4ZI7A 1IN1A 3FFAA 3V61A 3JWGA 3ZVNA 3LI2A 2BS4B 3EBLA 5BO5A 4EPTA 5EP3A 3P71T 1XKLA 3VTVA 2VI5A 2YY6A 1UT8A 1HDRA 4X92A 4K3CA 5DTRA 2PN1A 2FEKA 1SY7A 3F3SA 4Q4AB 1T2FA 5ALGA 1XZ8A 5DPSA 3S27A 4BE4A 4KVAA 4X1IB 1BE1A 5BOSB 3TD6A 4YIHA 4UHJA 3QUAA 3EUFA 4XQCA 5NLLA 4C7ZA 5G1NA 2OLJA 3FJOA 5IZCA 1N4DA 4MGHA 2ZYHA 4FR5A 2VJBA 5ELXA 4MOWA 1SVLA 1UXOA 4HRVA 1KIFA 2JANA 4AWAA 1TA9A 4O33A 2QRJA 3V4OA 3DLIA 3H2HA 4DLAA 1SEVA 2VDUE 5JZBA 2EF1A 1DAKA 1WGDA 5AVOA 3MC1A 5CT8A 3ED1A 4ZAFA 2L69A 3O2QB 4DR1B 1XXHE 4EL5A 2Q1WA 2NZJA 5DO9A 2QQEA 1P1IA 4ZRDA 1R4MB 1HH4A 1Y1TA 4I8IA 5G0UA 3A9KB 2QE6A 4LK2A 5TEWA 1G6OA 3R7LA 4PYZA 2ZI7A 4AZ0B 4DWJA 3KAPA 4PYUA 4TMKA 1D0SA 3DT8A 3RRXA 2CFTA 4RS3A 1FLNA 2GZDA 3S4YA 1AZWA 2BMWA 4GX1A 2BFNA 1HE2A 3LYUA 5GV7A 2F1JA 2V4MA 1Y81A 5KOIA 1Q1EA 1J2YA 1XUOA 3P5BA 5UKDA 3IQIX 1NAIA 3SFZA 3K2EA 2JWZA 4KZ0A 1IBXA 2G0AA 3FAHA 4CUKA 1OFHA 1KC1A 5HEKA 1TS4A 3DV0B 4R6WA 3CZ5A 1T91A 4FXPA 3E8SA 1BW9B 4UXIA 1MEEA 4D3FA 2O0KA 2ICIA 2ZPTX 2I4IA 4R8RA 3VSDA 5A4MS 3IT0A 3NHSA 3WL6A 1XNRB 1V97A 2JCVA 4YT5A 2KMAA 3CT4A 4G3XA 2IKQA 1AXGA 4DQ0A 3UA3A 3CXUA 3ZOZA 1N9ZA 4F1JA 3V2HA 4IQ0A 3SXJA 5CFRA 1JIQA 5EE0A 2A92A 1CG6A 3EWIA 4TMTA 1OWNA 3IURA 3IO3A 3J9CA 1WIWA 3RULA 4UBKA 3R7WA 4IXWA 1GN8A 2M8SA 4PGFA 2IL1A 3UJCA 2CDCA 3N8IA 2WTMA 3VBCA 3O75A 2PU5A 1VSVA 2O8FA 5I5GA 2VJQA 2PZKA 3H2IA 2RSLA 4ZVQA 3QUCA 1FP1D 5ADWA 3URKA 4MV0A 4P3YA 5FNVF 2QB5A 5CA1B 4KN8A 4HWPA 1L7OA 4C5BA 1ZQ9A 1C8LA 4NYMQ 4PQYA 1KMNA 1MRSA 2BUBA 2LR0A 3MTQA 2YC2C 1PVVA 4PANA 2A3RA 4LQ4A 4D4HA 1GPKA 5KINB 4U02A 3EIFA 4RLSA 5G02A 2I9KA 5EIOA 4HP8A 2EFCB 2X5OA 3DHYA 4ZCPA 1MG8A 4GQBA 2Y1GA 1X7YA 3L6EA 2A5YB 1NT4A 4EPRA 3HDTA 3T9AA 1PUXA 1FFXA 3DS8A 1AKTA 4N5MA 1CUBA 3QVXA 3GRVA 2NZ2A 4RZXA 3QVKA 1QTIA 2C78A 4B4VA 3O83A 2G1PA 4PLYA 3KQUA 1VYVA 1M5UA 3DAOA 4JI6B 1O5IA 3C7DB 4FGUA 2QX8A 4JKYA 1KXZA 2AZTA 5HQJA 3E1SA 3R9WA 1C9FA 1CLUA 3WQRA 4LNNA 3NASA 2M6KA 3WHIA 2FG5A 1N78A 2LFIA 2OUKA 5LFAA 5B7PA 7REQB 2HA3A 5HRCA 2OFXA 2WQZA 3W8RA 4PYJA 4UM9B 4MUEA 1NBHA 3LCCA 1Q83A 3I5UA 2WD7B 4L5JA 4YAOA 2NT4A 1XR3A 2OV1A 1J21A 1DKNA 1GWNA 3DD1A 1K06A 3NHRA 1ZXLA 4FE4A 1J0GA 2BEJA 3GT7A 2BD0A 1Y7IA 4IAOA 2XE8A 1SVOA 2NYAA 3ZTWA 4Y6LA 1J24A 2A5LA 3D3WB 2YWRA 5IH3A 2DGDA 4YRMA 3I9LA 1A8HA 3ZHOA 4B3RB 2YV5A 3ZNGC 2AMYA 1E7UA 2Y4NA 2FRVA 4JU9A 4ZU6X 1ZH0A 1VL5A 3QPUA 5FWXB 4FX2A 5KIAA 4OI2A 5CITA 1FYFA 2D2EA 3FVWA 4BKRA 5BYKA 1GNRA 4G09A 2GBLC 2KQ4X 2QUIA 1AKMA 2JBWA 4HC4A 4U2BA 2PD3A 4FONA 2IY8A 1SPBS 2XMQA 3P9PA 1RCUA 4PS3A 4X57B 3GOQA 1C41A 1PZMA 1ZJJA 3SZGA 2I7CA 1YR6A 1U11A 4OKNA 3HUIA 1VCOA 3PFBA 3GPIA 2IXTA 3MJSA 2PZ8A 1UM9A 3SXUB 1NNUA 4J7CA 2WYVA 1FO4A 2B0JA 2IK8A 3SY8A 5CT6A 1OROA 5KNDD 3DVGX 4C0KA 5EOVA 4B33A 2FPOA 4Y2RA 5KYUA 4LNKA 5AOBA 3BD7A 2DC1A 1MT3A 3S8YA 4Z0TA 1K68A 2WWTA 1PJSA 3B1VA 1PFWA 5DYNA 2QR2A 3DEJA 1SKBA 3HJGA 4GI2A 1GA1A 3ASVA 3PSHA 1DFGA 4ZYSA 2VCYA 5IM5A 4HT3B 3MTGA 4GRIA 4I5IA 2B69A 3MGGA 1WCV1 2DMRA 1OLUB 2C9YA 3I01M 3CVXA 4MCHA 1FY2A 3AWDA 2JH3A 2RIRA 3ZXIA 3ZWVA 4CEHA 4WY5A 1NM5A 2QORA 3QMWA 4LHYA 4DC1A 4N7BA 3H9JA 3FTQA 2VQSA 1CB0A 2IH2A 3RAJA 3KSBC 4JHXA 3HHPA 3GXBA 3EZ6A 2W4QA 1L7VC 3CH7A 2E21A 1VKNA 3GGGA 4B5LA 4BVHA 4LPSA 1TU0A 2RGRA 1EO6A 5HFNA 1GN9A 3R77A 4H6WA 1NKSA 4LF7B 2KFKA 2WSBA 4TYWA 4Q3NA 721PA 5FPPA 5FLYA 4IO0A 3N1YC 3ENVA 1J00A 1QXSA 3TLAA 5HKKA 4K9OA 4RKWA 5GJVC 1E7VA 3RVMA 5TARA 2H54A 1YGPA 3RVKA 1FFSA 1L7YA 1WKCA 3R7FA 1J2RA 3MJWA 3BWXA 2PW9A 5KHQA 4HKZE 2VPIA 1X2EA 1R88A 1V7PC 5K20A 3BUSA 5ALPA 3ZHYA 4BLOA 4BFXA 3THXA 2ZRBA 1XTIA 4ON9A 1BO6A 3E8MA 3NHUA 4OQLA 4W1SA 1A0OA 3OX2A 1RDFA 1YFLA 4TTJA 3R3VA 1FF9A 1BA3A 2FZWA 3OP1A 2IPAB 3REQB 3DOUA 2QTVA 3PCXA 2RH9B 3TF5A 4JB3A 4MIEA 3CPSA 1F2UB 1V5EA 2AX4A 1O4WA 1LC0A 1CW2B 1CCWA 2Q3CA 2VZ9A 1QGUA 3O92A 3AKYA 2OHIA 4FYMA 1Q0RA 5FL3A 1R5JA 1GZDA 4K26A 2OFWA 2GWRA 4XDHA 3EPPA 1XN1A 1OYYA 1Q7RA 3ERCA 3DCNA 3M4ZA 4XYGA 1WXWA 2Q7XA 5T67A 4I55F 4X94A 4PZ9A 4N4AA 2HIMA 1USKA 1W7AA 2ZUBA 2G9QA 2C4WA 4RO0A 3RBZA 3H19A 1X1EA 3LA8A 2WWIA 3LX4A 4KBYA 3NYRA 4RZHA 2QS9A 2R4TA 3RZFA 3LUJA 4MDEA 7MHTA 3VYRB 5TSSA 4F3KA 3LIPA 2GN9A 4TYNA 4BFYA 3G0DA 2HJ1A 4DMMA 4NQKE 2FQWA 4YO8A 3NHZA 4NBNA 3GLUA 3DDWA 4R1PA 3CN7A 3NATA 4TMWA 1P1KA 3GB9A 3RF7A 4LJ6A 3VVCA 1CRLA 4WVFA 3WR5A 1CZLA 3AR4A 4ZIRA 2Q6KA 3TGLA 4R7TA 5FTJA 3UTDA 3OAAA 4U9UA 2D2IA 4DA0A 2HGZA 2HFKA 5F1YA 1I2CA 3N7UA 1N2SA 1J23A 4DDVA 1NMZA 1V25A 2W82A 4I2VA 1SXJE 1S7GA 3WGQA 4FYWA 4JLKA 4KNVA 1J97A 1JIVA 4MRPA 1JWLA 2WHPA 3LC2O 5KI6A 4RH1A 4FHFA 2IOFK 3T5TA 2W6PA 4UOQA 2UDPA 3D7NA 4X24A 3T4PA 4Y0VA 3A2KA 3O74A 4AIRA 2QR3A 3SZMA 5FPHA 2GR9A 3H9DA 1DEXA 2AF3C 3HR8A 1YIWA 4BV8A 2O54A 1GTG1 2XVXA 1L5QA 5EZYF 3T1OA 2IO0B 1H2RS 1GSIA 2Y6VA 4JLVA 1E2EA 2XE6A 2W2OA 1WPQA 1GAEO 4O4JB 5BXYA 3MJHA 1SBNE 4LZNA 1T1RA 2ZB7A 3ZWMA 1QOZA 1W9HA 3SLGA 3WICA 4PZEA 1E1NA 1YMQA 4C4VB 3F6EX 2WD9A 1ZH6A 1NMXA 1X3LA 1XD8A 1QFXA 4LRQA 1KQGA 1JDJA 1XRMA 3CFYA 3USES 1HRKA 3RUIB 4OG2A 4TROA 3C6BA 2GUGA 3LDZE 4KZCA 1PTJC 2AJBA 4YAIA 2V55B 1QB8A 2WB2A 1QGZA 4K9LA 3CNHA 1NVBA 1F14A 1R8SA 2BR4A 1WU7A 1FFUA 3HYRA 3CEJA 3P9RA 4S0RA 1QH0A 4CQLA 5K0EA 2VNSA 4EO7A 1GEEA 1F2TA 3ZDRA 1YQ9A 3ECIA 5C0OE 2WKRA 3OPNA 3I4LA 1YDEA 2A0FA 3GJRA 2C9DA 2F9LA 4TQUS 4TV3A 1Q1NA 3MG9A 1DG1G 4CYEA 1J1UA 5JXGA 2XUJA 4WKOA 4KXNA 3P19A 2NU8A 4E22A 2PGOA 1R0SA 3TUZC 1DIAA 3W1WA 4L57A 4Y2JA 2NUPB 4J1NA 4ACAA 1IEVA 4KWHA 2O20A 2JHGA 2OOBB 2A35A 1ZI9A 2GPAA 3ZE6A 4ZVLA 2YBEA 3M1IA 3FLAA 4KLRA 1QNFA 1QIEA 2X4GA 4MPTA 1E3QA 1SG6A 2UZ1B 4QU8A 4QZVA 4J9UE 3AFGA 3JQPA 1CUYA 3ML8A 3V8MA 1T4DA 4NE2A 3F47A 3SQDA 5IC4A 2AKYA 3W4IA 1M2KA 1LPPA 3KWFA 2XZLA 3TEJA 1BYIA 1XT6A 4HV4A 4KUGA 4Q7MB 2MSWA 3OCVA 2IO2B 4QBKA 1Z6YA 3GRZA 1YQBA 3KLOA 4QT0A 2LDBA 2AXEA 1MF7A 4YSYB 3WJ1A 1LPSA 1A8IA 1SJED 2PVGC 2CMDA 2NU9A 1JS1X 1NUPA 5HILA 4AWJA 2VHCA 2D2VA 5FPKA 3ZWDA 1EIZA 1VPLA 4TLDA 2YEPF 4B7AA 2VWPA 1KMHB 3MS4A 2ILVA 4E7PA 1N33B 3WZLA 2RBEA 5IC6A 4OVZA 2F3RA 1B0ZA 1BC5A 3OTIA 4UU0A 2GYUA 5E3HA 1X9HA 1XVVA 3CB4A 4OOFA 2JF5A 1HYEA 2WMYA 1G18A 1J49A 3TTVA 4MYCA 2W98A 5G4KA 4A9AA 1E6CA 4BDTA 1PG0A 1WW3A 1VRVA 2G9UA 2V6BA 4G5YA 4MS4B 2CBZA 3NVVA 3P52A 4QTXA 1I51A 2WUWE 1W5BA 1TFUA 1X8LA 4IDAA 3ABOB 2AUNA 1BHSA 2CLHB 3H1AA 2BDTA 3IT3A 4JQSA 3U56A 4FYPA 4YI3A 4KGRA 1XXLA 3JQ7B 1JRPA 2R4UA 1G8MA 1ZN8A 2XWQA 2V1YA 2ZBUA 3AHDA 2Y2VA 3WE7A 1CQWA 4J3OD 1XMVA 3N2KB 3L4BA 3L0ZA 4YCBA 1EPUA 3W78A 3MNFA 2P7HA 3UK7A 2DFKB 4E1AA 3HA5A 2DWOA 1CFZA 2FZLA 3AEKA 1PK8A 3EQZA 1DTSA 4ZCIA 2Z08A 2D4HA 4ZZ0A 4TRJA 3KB6A 4C4OA 1P33A 3A4IA 2G17A 4DVJA 2OFPA 4CT0A 3KZKA 3UAWA 2OO5C 5K8LA 3UAVA 1AIPA 3OLYA 1YB2A 3SG0A 2Z3VA 2IU3A 4PLZA 3HUTA 2C4MA 1DKLA 1CP2A 2RGEA 3IXQA 1N75A 2WF7A 4D96A 1C0EA 4HJGE 2BFFB 3AVOA 1GPAA 5K4HA 5EP2A 3PRMB 2A57A 4A2WA 2QX6A 1S1QB 2QRGA 3LYAA 3KQ4A 3MRSA 2D5CA 1B7GO 5PGMA 3BFPA 1HMPA 3GW8A 2IYZA 2FX5A 2YJNA 2HMYB 5BWCA 4I2NA 5TGDA 4IH9A 1EINA 2ATVA 4TGLA 4EOYA 2XGOA 4WBSA 3QLTA 2PSJA 5LM3A 3LVRE 2RGBA 5KWEA 4MV6A 4EW2A 5BURA 1T15A 2B0CA 5G2OA 4MR7A 3VM6A 2BB6A 3H5LA 1DJQA 4DNOA 1V4NA 5D3KA 2C61A 2CXOA 2AMJA 3MWEB 2Z98A 1XD9A 2ZIFA 4PLCA 1L5OA 4UAGA 1CXZA 3DBOB 1ZCBA 4E14A 1L7QA 2NBUA 3ZDTA 1PI3A 2Q8PA 1QH1B 2GZRA 1A5TA 3WGTA 2YMLA 3AR8A 2JG3A 3TZLA 1D5ZC 3OG9A 1ESMA 3I2YX 2VYND 2YHIB 3TMPB 1HRDA 1JG4A 2YWDA 3NBQA 4I55B 3OFSA 1JT2A 1QGYA 1ZKMA 3EF0A 3LBHA 3U3OA 1BHQ1 4D81A 2YQ4A 2GEUA 1H2EA 1ZIXA 1JLHA 1FDSA 2ISCA 4LYAA 2GT1A 5KX5A 4XVQA 3VJMA 1KQOA 5BSUA 3HWSA 3GEHA 4OP1A 5DXFA 4TOIA 4MT5A 5FLEX 1A1VA 1YIOA 1XCQL 3OQIB 2QJFA 4CIWA 1Z7YA 3M95A 5T57A 3BE8A 1XRJA 2UXDB 1GJRA 2YTZA 5MGBA 4B45A 2R2GA 2HRQA 2PO5A 5CT5A 3I34X 4X91A 3ROGA 3BMNA 3NC4A 3Q2KA 1ZBQA 3JQAD 4QFCA 1D0VA 3RSFA 3E18A 1T4BA 3L7LA 2WDVB 1F9AA 2H4XA 3BPSA 3D54D 4K2HA 5A0TA 3SS7X 1TZJA 3DVAB 3RTGA 4QYIA 3PGVA 1V16A 1PO7A 3TLMA 2YVKA 1TF2A 3L0YA 2JAUA 3SYTA 2QUBA 2IW1A 2VZEA 3TTXA 3CNQS 1TI7A 2Q5OA 3VVWB 4GS5A 2KDFB 3OWEB 2C5EA 2R7KA 1L5LA 4EHFA 4C1NA 2QTRA 4D4JA 2K22A 3QFSA 3WGYA 5BV1A 3P2EA 2H89B 3KYIB 4L6CA 4RCYA 4X5OA 3FDZB 1Q1AA 1KH2A 3E2PA 4OV6B 4C88A 3LDUA 2ZIEA 1RLMA 1GFSA 1Q95A 5FL7A 4LOHA 3OEHA 4WUVA 1WB4A 5I8WA 4INJA 4IEEA 3GA7A 3P1JA 5EZYB 3GEMA 2EJBA 1ZUNB 3WLMA 4F45A 4PICA 3K94A 5EIHA 1QCCA 3ZUGA 1EQ2A 1DC7A 1LDBA 1KFYB 1CY7A 1EGVB 2QNRA 6AT1A 1BEZA 2VDNB 2PMFA 2YZGA 1F8FA 3MB8A 1QVZA 4C5AA 1FJ2A 3OIDA 2GVDC 5EHNA 4NICA 1NQTA 4XB6B 3A3YA 2MMGA 5JVDA 4Z53A 2KBFA 4S1NA 4IM3A 2ZEJA 3NAQA 4REZA 4AS1A 4K9NA 4MGZE 3OZIA 3NJ4A 1QE5A 4DRXA 5EQTA 1GQYA 2C3OA 4JVNA 1C4XA 3QU5A 5AHXA 3PPWA 4GKJB 1WHTA 3VC3A 4RJLA 3NY5A 2B92A 1X38A 3P4PB 5EUCA 3I9FA 3PR2B 1BJKA 4EJFA 3F9CA 3TB6A 1KI2A 3LSYA 3AWIA 4FJ2A 3VPCA 1PQ4A 3FYDA 3VISA 4HVBA 4DS3A 1TUBA 2BLLA 3MCAA 4JX8A 1K9SA 4BFTA 2O9JA 3PIRA 2OEPA 1IN4A 3H0EA 1PJ3A 3BJEA 3M0EA 1G9TA 5BVGA 3C3MA 3ZDYB 3G13A 1EKXA 3CZ9A 2ETVA 1IY2A 4XUDA 3PQ5A 5DX1A 3DEZA 1EXDA 1UCFA 1VTKA 2X1LA 1TBEA 3PD0A 4NBWA 3HSYA 4C0WA 4UCWA 3GT4A 3LY9A 1ZSVA 1RJDA 4NJEA 5F9MA 2HBQA 1DAGA 2WWWA 3BMCB 4BBNC 4MV3A 3WWEA 3VTWA 4MK4A 3AKEA 1Q7CA 1UKYA 1UK8A 3ASZA 2Q9CA 5FR6A 4PBRA 1V37A 2RH5A 1ZONA 3FCOA 3AP1A 5I4CA 1YZYA 2I1LA 1OYVA 2EAUA 3MEQA 3OU7A 3WA6A 1KGDA 2B8JA 1SK8A 4JLOA 5C5EA 5AM1A 3I5YA 2CJPA 2RGWA 2JAQA 4CLOA 1TCBA 4QFDA 3QYJA 5DHTA 1SJHD 1ID8A 4ZRKA 5J4LA 4WN3A 1DZ3A 2VOEA 1M73E 5FTLA 1Y80A 5J40A 4CM4B 4Z6KA 1D7OA 1RLFA 2X0NA 3EGXA 3A4LA 1N5RA 4LX8A 2BIFA 2Y6UA 4BVKA 2W2VA 3U9TA 3WGLA 3K9QO 3TEMA 2OVFA 5JQWA 2VS1A 3P4QB 5LB4A 3JALA 1CUEA 4J6IA 1OIXA 3C14C 2F8MA 3CX4A 3G8CA 2YEPB 3CPHA 3O4RA 3L7BA 4JP8A 1V45E 4NOMA 2PNJA 3ZS9A 5JS6A 1M54A 2A9FA 4MLPA 4AJJA 4JKIA 1O57A 4RF3A 4WAAA 3VC7A 4WI1A 4LZOA 4DB4A 2B1JA 2BGMA 3ESRA 2YXLA 4W8GA 3E5HA 4DQUA 4PCVA 4AUEA 3FUUA 4IM2A 1FEHA 2DBVO 3X3HA 2AFIB 3B6JA 2R7LA 3Q3MC 2AG0A 5JD3A 1F12A 2PRZA 3ZWQA 3EXHA 1ZMTA 2F59A 1WDWB 3ZDXB 4JZKA 3VPHA 5C7LO 1JI0A 1M75A 1Z2NX 1SAYA 4DY4A 3HO8A 3GD7A 1EX1A 4QLBA 5AT1A 1D07A 5F4BA 2PE6B 3CXRA 3HFGA 4JB2A 1HKHA 5CLGA 1MAUA 3W9CB 4KGZA 4E6PA 4M76B 1PZHA 1WMSA 4G25A 1LSSA 1XJWA 1FU4A 2BKVA 4AI6A 1HE8A 2ZAIA 5GTDA 1ZGAA 1NONA 4OHPA 2GH1A 2VKQA 4KXYA 3U4AA 3GAMA 2AVDA 4B6JA 4H1WA 2NBVB 4OHKA 4CKYA 1EFVA 1Z6XA 5C8VA 2UYGA 3D3QA 2YH2A 1ZK1A 1KVTA 3UMCA 3Q8WA 1V95A 3EOBI 5CEJA 3UG6A 2BGUA 1E69A 4QPDA 3RNOA 1EFPB 4OHOA 5L45A 4OFWA 4F3CA 4Z86A 1B6TA 3H2KA 4BO5A 4NDNE 3NQ41 4FI3C 4OTZA 4RLHA 5KNDH 421PA 4M0EA 2RKWA 5F9FA 4Q3CA 4GZ3A 3OE5A 4H31A 2F3QA 4KQEA 1KE2A 2X8JB 4EUNA 4EABA 2QYTA 1K4KA 2NU6A 3Q0EA 3QXCA 1AV7A 3ANMA 4AZSA 4GL4A 4PZ0A 5REQA 1ISJA 1KNQA 1EE9A 2PKQO 2VP2A 3A4TA 4JX1C 4JT2A 3ZEAA 2VXBA 1B4DA 4HLNA 2FEWB 1FXSA 1UKZA 4KE7A 4K1RB 3MWDB 5IF3A 4LVNA 3WNQA 3MC0B 3FILA 1EB9A 1KJIA 4XGKA 1U8CB 4IIBA 5DYIA 4DJTA 1UDWA 1MEJA 2FGKA 1GTSA 5ERGB 3G1WA 2OAP1 3V4LA 2EL7A 1P9OA 2I3DA 1XZJA 1E1DA 1T9CA 3FXAA 4BASA 3Q2AC 1CS0A 4V24A 4RZUA 3CO0S 3KKMA 4JHLA 1E3MA 1QTQA 2AG1A 4W5QA 4N1AA 3IG3A 2JDID 4D3XA 2PV0A 2HTEA 3PHWB 4MZXA 4AN4A 1E94E 1MJHA 1RHMA 1D2EA 4F6LA 4Q9KA 5IZ4A 2HK9A 4ZVNA 2KD0A 3JVDA 2C7GA 4C7OA 1PT9A 3E03A 1USIA 2HBZA 4J4TA 1S96A 1JA9A 3P26A 1G1MA 2JUOA 1LS6A 4QOIA 2LE0A 3KZMA 2G5CA 4XIGS 2PMEA 1R2QA 1RXVA 4UEJA 1GQ2A 2XUOA 4UTRA 1EDOA 1TTPB 2IF0A 1M1ZA 3GAFA 4YRTA 3AO0B 3BWCA 2MCFA 3UMBA 4CI0B 4K46A 1DARA 1R15A 2LI5A 2HH9A 4Q4CA 2P90A 3BH6A 2Z30A 4B3SB 1FMCA 5AVYA 2JT4B 4MYTA 4HL6A 2H4JA 1M1XB 2AK2A 4DC9A 1NJFA 1MTOA 5HDBB 5U4XA 3MMPA 2ZE6A 4O5OA 2RHMA 5I51A 3L7JA 4NQRA 1C30A 2ZCJA 3U49A 5HIIA 4PRLA 4HKQA 4HUJA 3EZNA 3MHZA 1A9XB 1EP9A 1GC6A 3CH5A 1NW6A 3RU9A 3D6VA 1JKXA 4TKVB 1UDAA 2I2DA 3ES9A 4KAJA 5IUKC 1KOLA 4MV9A 3L4PA 2B20A 5ITZA 4RX1A 3OD1A 4PO8A 4LHSA 1ZNYA 1BYUA 5LU8A 2PMDA 1XQWA 3KOMA 1Z29A 2H59A 3BWYA 5B2EA 1JSZA 2FRDA 1EP2B 1UL1X 4Y2HA 2W8BB 2B98A 1X1BA 1SSNA 1BGXT 1CRZA 3MGKA 4C04A 4XCXA 1YB1A 4ZAZA 4D45A 1IDN1 4NMMA 4FFBB 5I4BA 2GCEA 1GCUA 2KK8A 5KQLA 2PA3A 5EEGA 3FOFC 3E3NA 1JFLA 3ZXYA 4HXDA 2O8EB 3R7AA 5E9QA 1JWAB 3WAPA 1KY5A 4AG6A 3DVNV 1J2UA 4A0QA 3UUWA 4IGIA 4CLDA 1NNSA 2XZOA 4LF8B 5HIAA 2HF8A 5TQ2B 2D11A 3K9GA 5LA6F 2NLOA 1C7ZA 3DKVA 4MKFA 4NMWA 1YIDA 2QYOA 2Q3JA 3M70A 3UKOA 4V2IA 3P2JA 4F4IA 3KS9A 4YC7A 2DHCA 4EI7A 4R5HA 2REXB 2CVZA 3KPYA 3ISVA 1E0KA 4Z4FA 4IF6A 2Z5GA 4KH1A 3C8DA 1HNXB 5E1OA 2WZBA 2R6JA 4X45A 2C99A 1USWA 1BKYA 1SXIA 4X9XA 1DEHA 3PT9A 3OTHA 2O2XA 4MCIA 3E5RA 2VYVA 2GMIC 4MGYE 3O3OB 1JT9A 1TS5A 2HMTA 3V7NA 2PJRA 4PZZA 2J0KA 2HKIA 3MHPA 3NTVA 2KVZA 5AKXA 3V1YA 3C3XA 5HUJA 2E55A 2JCGA 5BNTA 1Z4MA 3AF2A 2FA9A 4DQXA 4YS6A 2B4QA 3NBMA 2YOHA 2DYBA 1O94A 2XYVA 3LDAA 1X77A 2EKIA 4XX0B 3U16A 3GMTA 4A36A 5E1BA 3OZ7A 4IWOA 4EJMA 1YV9A 1NP6A 1TPZA 3ZHQA 5HHDG 3CC8A 1UDBA