1TS4A

Q139k mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTKIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 53
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts4A01
1DYQA 1JWSD 2J4XA 1PTOB 1PYWD 1S5FD 3BYYB 3O13A 3V05A 2TSSA 2RDHA 4TSSA 1LTID 3DWPA 3EA6A 1YN3A 5ELDA 1S5ED 2QILA 4Z9CB 1RD9D 1D6EC 1PZID 4RHSA 1YN4A 3BYTB 1TY2A 5D3IB 5I4DA 1KLUD 1V1PA 1I4RA 1LT3D 1STEA 1CHQD 1LT6D 1UNSA 3URYA 1I4QA 1BCPB 5ELFA 1D5ZC 1ESFA 1HQRD 1JQYD 1LLRD 1RDPD 1V1OA 2XN9C 1AN8A 5FKAC 1SJHD 4NZLB 1F77A 1HTLD 1LTGD 1FNWA 1GOZA 3R2TA 1SJED 4RGNA 2ICIA 4C56C 1LT5D 1EEFD 1YN5A 1PRTC 4RGTA 4RHRA 1SE3A 2XNAC 2XRQD 1LTAD 1M4VA 1D5XC 1XTCD 4ZYSA 1L0YB 3BVMA 1V1PB 1SEBD 1PRTD 1RF2D 2G9HD 1FNVA 1S5DD 3CHBD 2Z8LA 1QILA 2IJ0A 5FK9C 1ENFA 4DXGA 4RGOS 4O1NA 3DWQA 1EFID 1PTOD 3MFGA 1KLGD 1JWUD 1LTTD 1BCPF 4RCOA 1CT1D 1PZKD 1EEID 1SXTA 4UDUC 2AQ2B 1LT4D 2CHBD 1RCVD 1D5MC 3MC0B 2AQ3B 2NTSA 3KLSX 1TS3A 1B44D 3R2IA 1T5XD 4DXFA 4L63B 1ET6A 2SEBD 1TY0A 2WV6D 3TSSA 1AW7A 1I4PA 4OHJA 1FGBD 1TS5A 3BVZA 1I4XA 1EU4A 2NTTA 3EFXD 1MD2D 2AQ1B 3GP7A 3R8BA 1TS2A 1EWCA 1LO5D 3OWEB 3W2DA 1PZJD 1PTOF 4K6LA 1FNUA 1FD7D 3BZDB 5ELCA 1S5BD 1L0XB 1UUPA 1HXYD 4RGMA 2XRSD 1BXTA 2O2LD 1PRTF 1PTOH 1KTKA 1BCPD 1CK1A 1JCKB 1EU3A 1CHPD 1BCPC 4L6TB 1B1ZA 1CQVA 1I4HA 1TS4A 4BWGB 1PTOC 1G8ZD 2IPKD 4RFBA 1JWMD 1SBBB 2RDGA 1LTRD 1I4GA 3SEBA 1DJRD 1ET9A 1S5CD 5TSSA 3DWAA 1XXGA 1PRTB 2R61A 5D3DA 1HA5A 5ELBA 4RH6A 3BVGA 1SE4A 1LTBD 5ELEA 1LTSD 1SE2A 2QEJC 1JR0D
chains in the Genus database with same CATH superfamily
4GKJQ 3RCZA 2IX1A 3PUZA 4A4IA 2AYOB 1GVPA 5GXGB 3O13A 4N8X1 2PW9A 1WGGA 5CX3A 1IBXA 4BY1B 4FF3A 4GU2A 2ZEQA 4C4VB 4X65L 3S15B 5C3EB 5AUIA 3EA6A 4NAMA 1CM9A 4C3IG 3J81j 1B9MA 3H1UA 1SNMA 3CPFA 2KLGA 5CTRC 4P1CC 4BKTA 1RJTA 2K01A 1NDDA 3JAMc 2SAKA 2H88B 2Q2IA 5CV9A 3WANA 1Q46A 2VY3A 4KV6A 3NQIA 4FJVB 4BBRG 4TV3A 5E6JA 4DK3C 4PYUA 2OEOA 3OTOQ 4BY7B 2D3CA 1P7FA 1X32A 1HR0W 3ZDMC 1KRHA 1VQNA 4W9GA 2IW3A 2YTVA 4BOSC 1IHZA 2K8CA 1IYFA 5IGEA 4KHZA 1F77A 4PYZA 4R8IA 4IFDH 1SMXA 1OQYA 5IODA 3KBXA 5IYDG 3B9JA 3K0YA 1EEFD 1BQQT 3HOVH 1G91A 4YCUA 1GO3E 4ZYSA 3I2ZA 1WR6E 4A93H 3NQTA 4JVZA 3T53B 1SEBD 2C7NB 2ZJPA 2KDMA 3Q69A 5T1IA 4ALPA 1SLJA 4JOIA 3L54A 2V1CC 2PJHA 4R4CA 4CQNA 1WTOA 2IJ0A 5FK9C 3OPOA 2PVOD 3AXCA 4HCPB 1RWSA 5C44G 3IFDA 4YTPB 1I6VC 4X62L 1PTOD 4R4TA 1FXTB 3CPWA 4B0MA 4TVAB 1J6QA 2KMAA 2KN5A 1KAAA 2IHEA 2JA7H 1U5KA 3W1SA 4V0BA 4KY6A 1GJXA 4DUYQ 3C2PA 4DR4L 1WJ4A 1YD8U 4KJNA 3KYDD 2WKDA 4HXDA 3NK9A 3Q23A 4ILWA 5IIFA 3N9YC 2OTJA 2YV5A 2NVQB 3QA8A 4KKUA 1TQOA 1UAPA 3DEOA 3RN5A 3OJ3A 4NXNL 5JVH3 1O78A 2N8NA 2IYDB 4YTNB 2JUOA 1R4NI 2ZVOA 4OX9Q 3GTKB 1B53A 4KTAA 1EYGA 1PZJD 1KRSA 1WTWA 5G3LF 1P16A 2AL6A 2I46A 3J80i 2LHEA 4LK0M 2ZNVB 1VDZA 1GUTA 2CWPA 2DBYA 2JA5B 1IL8A 3ENEA 1Y1VG 3TIXA 1PH3A 5L37A 1IKMA 2KHIA 1HTQA 1IBLL 5D2MB 2AKWB 2JVCA 1GD7A 3K5MA 1ICWA 3CMEA 3RZOB 3QB3A 1LQBA 1BCPC 1PQSA 3CWIA 4A3EG 4RWSC 3NTKA 4N8FA 3S15H 4RF1A 4DBGA 1A15A 2WAQG 2VQEL 5M5YB 2LJ5A 1GB4A 3TRZA 1Q81C 1YNXA 2R7ZB 2WS3B 3PVLA 1XXGA 1N34Q 2I5LX 2AL3A 3NOBA 2X6LA 4WAAA 2L4NA 2RMMA 4LF9L 4GIVA 2ID0A 3Q6BA 2O6VD 1KM7A 5EE0A 3T1YL 3CF5A 2R93H 4QIWB 2J4XA 3PF4A 1RM6C 3I4LA 1A63A 3RNCC 4KI0A 1GXDC 3D0FA 4Q2JA 4HDOA 4J8QA 5BN3A 1HNXQ 2N9LA 4FVMA 2F0LA 2BGFA 4YHHQ 2R92H 1YN4A 4HSVA 2ONQA 3ER0A 3MXGA 2QHOA 1LABA 1PH6A 2KX3A 1I6HB 3DMUA 2AEHA 3AU4A 5M9OA 2CQOA 2E2DC 2DNCA 1A2TA 1L0WA 3G71A 4KK7A 3WIMA 4A6QA 5C4XG 1O7YA 2H4OA 4X66Q 2JA7G 2R93B 5HHDG 1AARA 1PFSA 1HQRD 4JI0L 2DENB 4HIDA 4A3BH 3D4DA 1TWAB 3EGRA 4APVA 1QZEA 4CKEA 4PK1A 1SJED 3L9AX 1YIJA 1XLPA 3GTMB 2F0NA 2IL8A 1SE3A 4BA2I 4ME3A 4B9WA 4EX5A 1WF9A 3S2HB 4EZJA 3T1HQ 1Y1WH 1N36Q 2L15A 3CHBD 3G6EA 4DQOC 3V3XA 1VCIA 2PQAB 2ZJRA 1TKYA 2C9OA 1YJWA 2CS4A 3G4SA 2D10A 3ALBA 4HEA1 4O1NA 2G1EA 1QVCA 2A6ED 4JOIC 2DZKA 5M3MG 2IX3A 2UXCL 3J80c 3LGJA 1PGBA 1FD6A 4RCOA 4JI3Q 2L9HA 4W9DA 2K5VA 3EQLC 3C8YA 1WMHA 3TS0A 2DGYA 1G2TA 2X8XX 3B2FA 3VRAB 1ROEA 4GXBA 3CC7A 2HIXA 3GQBA 1KJTA 3H7PB 1X55A 5BN4A 1BBWA 1EY5A 4IFDG 4R9WA 2WACA 1AWDA 1SB3C 4TMAB 3CQZH 1CUKA 2BYVE 4DK0A 4ZLTF 3N3KB 5JOBA 4DNRB 2A6HC 2I07B 4OHJA 4B3RQ 2F0DA 3VR3A 4GNXA 3AEBB 3VTUA 2JA6G 3JSVB 5HKHA 3HOZG 2FAZA 2OEDA 1BMLC 3DM3A 1O7ZA 1MBYA 2N7JA 2D9UA 2VZKB 3QHTA 2BS3B 5EAYA 2GA4B 1GB1A 1VQMA 3PF5A 4KIKA 2EYLA 1SE8A 2BF8B 1ZE3D 5IYCH 4NXNQ 1N63A 1V8CA 2C7MB 1BXTA 3DOWA 1ZKHA 2JU6X 2LUMA 3HP3A 1FRDA 3IXSA 2NBVB 4WWOA 4US9A 2UUAL 3W1GA 1CMXB 3HVDA 5I2YA 2K6AA 2KWDA 3FKYA 2WXHA 4DR4Q 1V6EA 5C3XA 4MSMB 2ZJQA 4IUPA 1UH6A 4TQ0A 3VA5A 4NJ6A 4DV4Q 4WURA 2F0SA 4O42A 4X6AH 4TRDA 1F2RC 3HM3A 2KEDA 3RYTA 2WYQA 3S1NH 2F0PA 1ET9A 1DOMA 2F3WA 3GDEA 2YU9H 2M4NA 4IJHA 1Q0WB 1PRTB 1IBKQ 2K50A 2L1BA 2RA4A 1IGCA 2OJRA 1SE4A 4IUUA 5CV8A 3HOVG 1YX5B 3PO2B 4ANXA 4KV2A 2B2WA 4X3TA 1SE2A 2QEJC 4EUTA 4BVUC 1L0VB 1OEYA 2FIDA 3E9HA 2K8HA 1MFWA 2J0KA 1C9OA 5HI1A 4JI1Q 1PYWD 4BFRA 3A7AB 3HKZE 3F8TA 5M3FB 2SOBA 3HRZC 1YJ1A 3GV6A 2KAJA 4L2YA 1EWHA 3A8KE 1NAPA 3OJ4B 1LYLA 2PYKA 4K2LA 5ELDA 1QLBB 4JI4L 4HJAA 4Z9CB 3AE9B 3P63A 4K3BA 1MG8A 2LRUA 4M01A 4XQNA 2F0EA 2JJQA 3CW2C 2WXGA 1IBLQ 2A74C 1GC6A 3PIP3 1Y1WB 1YJIA 3QX1A 1VQFA 2JXXA 2MUYA 3MA2B 4QIWE 2JP1A 2LRWA 3T4AC 1K28A 4G0NB 3AB9A 2IO3B 3U8ZA 1UNSA 1FVIA 2HCIA 4AH6A 1I4QA 4LF4Q 4HMJA 2B3GA 5DAUA 4HLEA 1PLFA 1GUAB 4YL8A 5K36G 2G9DA 3BZKA 4A3MH 3QK0A 2N78A 1VRAB 2XN9C 3DUZA 3ULPA 4FF1A 1K8OA 2N9XA 2KECA 3NELA 3NZUA 4DV3Q 2PE9A 1LGRA 2VNUD 1CZPA 1YN5A 2R7DA 4RGTA 3AE4B 2M00A 5CV7A 4ZYNA 5GADC 1H9KA 3H94A 3VR9B 1WTXA 3UI2A 3V2TA 3CCEA 4NB3A 2BQQA 2MBOA 1WE7A 1VF5C 2BB5A 3N1XC 4W9KA 4FA6A 1G51A 2BB6A 3NWSA 1DONA 2ZW0A 4B95A 5IP7H 1GM5A 3AQQA 3AU7A 3QOLA 1IBXB 4BS9A 1JWUD 2MFIA 2BW2A 2MJ3A 3ITPA 1XLNA 2MX2A 1TT5B 3U4EG 2NZ1D 2V3NA 4C3JH 1W6KA 2M0XA 4OW0A 3TCAA 3S17B 4HN7A 1EIFA 3GE8C 4GKKQ 3GZNB 4JV5L 2O6VA 5HURA 2ZXOA 3ICEA 2ALYB 1K0SA 3KW5B 1M8AA 1UE5A 2HDMA 1F0ZA 2W82A 3I90A 3D6WA 2CKHB 2ZJDA 4B9XA 3VFKA 4FBJB 2K4KA 1I50B 1VZ7A 1JE5A 1UZXB 1N33L 1P98A 2UUBL 4DV0Q 1OO9B 1TWFH 4A3KG 1NY4A 3M4PA 4DR5Q 3PZ8A 3J7YW 2JF5A 2B2VA 2VH1A 4OZCA 1UWXA 1MSGA 3QCAA 3VR6A 1PH2A 3GTLB 1ZOYB 3RMKC 3RN9C 1PUTA 1L1OC 2A5HA 2YTYA 3PO2H 4JBMA 2EZVA 1V9JA 1VZ8A 4HSPA 2GBMA 3DQVA 2K28A 3P4PB 1M1KC 4DFAA 1Z7TA 3T3NA 3QWZB 3PS6A 1STHA 1HNZQ 2VUMH 1QWYA 1UD7A 1HHVA 2KA7A 2ZTCA 4CKBA 1E5WA 1HZBA 2KDIA 4FULA 3K5OA 2D2QA 3WALA 4PZ7A 3A8IE 1QQRA 2GBJA 4DXAB 4WJ4A 1XNRL 2Z1CA 2DYMA 2PPHA 2R61A 3FILB 1BOSA 1U4AA 4NXMQ 1WXSA 1A2UA 2BA0A 4NP5A 4Q0FA 4JI2Q 3TMPB 3MXNA 1DYQA 2R7FA 3NRZA 1MJDA 5BYQA 5D65A 4I7AA 5LL6S 1WM3A 3VR2A 2HHHL 4B3TL 4MSQB 3Q3JA 4ABNA 1UEBA 1IBMQ 1TXYA 3IL8A 4M1UB 4LFAQ 4L5SA 1E90A 1SNQA 5H8YE 3RD4A 1R4MI 1Y8RC 1HNZL 1J0GA 1D6EC 2ZT9C 4F88A 3CAMA 5AJ3Q 3S16B 1ZXIA 3NZ3A 1Y14B 3UIPB 2JYEA 1KLUD 2WDRB 1LT3D 3JC66 3SK4A 4M0WB 2LKVA 1HZ9A 4L5RC 4KN4C 3UDIA 5LMNQ 3CCQA 2OQ0A 1B3AA 3DPDA 4JYAQ 1SNCA 3CSTA 1SN8A 1CSPA 2L83A 4HJ5A 2EJGC 3K58A 4HIKA 2BTEA 4V190 1HTLD 2WDTB 3ZVVA 3U9OA 1GOZA 4B3MQ 2ICIA 1AH9A 4QAYA 3IAS1 4QL5A 2JYTA 4LF8Q 3CC4A 4P74A 3FVQA 4DV6L 3MC9A 1XTCD 3KUDB 3L08A 1RF2D 4PMBA 2KFKB 3I4NB 2Z6BA 3RI7C 1XPUA 3CU7A 5K5PA 1R4PB 2K52A 1H95A 1WD1A 2FIFA 2Z59B 1T9HA 5J18A 3NVWA 4GS3A 3EBEA 3M4OB 5LLIA 3JAME 4W9LA 3RNEC 3PQIA 1EFID 1X65A 2MBHA 4ID6A 4B6WA 1MIUA 1A3VA 1QVGA 1PA6A 4LNFA 4ANWA 4DHZE 1B7YB 2SNMA 1SXTA 1FJGL 3GTLH 2AQ2B 4IPGA 3L13A 2R6GA 4JWUC 4MGZE 2LVPA 5FJ8G 5HY6A 1J5EQ 2B63H 3KLSX 2WXOA 1EQTA 1STGA 3GTJH 3MJWA 3Q8BA 1NYRA 4K7WA 1L1OB 2V4LA 3P42A 1ZP0B 1PH5A 1ET6A 1IL2A 2X69A 2JWZA 1Q12A 3F2UA 4NDXA 2IDYA 1WM2A 3GP7A 3TDQA 3Q22A 4NPSA 3OWFA 3PO3H 4K8JA 4D2KA 3ZXRA 4C2MH 3GTGB 2IO1B 4C7YA 1LO5D 2WX0A 4XDCA 3NJTA 1B4OA 2JRHA 4NQKE 2HE7A 3DWMA 4JBWA 1ZEQX 1S5BD 1HR0L 2E74C 1L0XB 2KTFA 1VQKA 5LNK1 4BY1H 3OOCA 2WHIA 3UQAA 2MW5A 3ZUNA 1YQBA 2LEKA 2W9NA 3RZDH 4LDTD 4RM9A 1ENCA 1JCKB 1ZUD2 2NBFA 3SVMA 4R3DA 2DYBA 1WTVA 2PE6B 4DHJD 2Q8RE 4KMUC 4DV1L 1T0RC 5C5LA 1XEEA 1JWMD 1SBBB 1WTPA 2X38A 2RR9A 2FCNA 3A9KA 4JI3L 1OXSC 2PIAA 2NR2A 3OIQA 3KF6B 2DJFC 4ARIA 3KF8B 5ELEA 4ANVA 2NMQA 4DUZQ 5LMNW 2MNAA 1Y69U 4M02A 3D32A 4FYDA 1XQQA 2FCSA 2LWPA 3AEDB 3VH3B 2A5UA 3TEZA 4XXEA 2ZM6Q 2JA7B 1E8XA 1C4QA 3DEPA 2NVUI 1WXAA 4A93B 2YVCA 1LTLA 2QILA 4ZUJA 2QCZA 2F3IA 2F0IA 4FDBA 1EUJA 2MHJA 2KENA 4CDEC 1KD1C 3H91A 2CJNA 4IQZA 1FFUA 1BUVT 4AWJA 2PZTA 4LUZA 4DDGD 2LGDA 3FEWX 1AYFA 4MACA 3Q8DA 5GQOA 3HZXA 1N32Q 1Z2MA 2Y5PA 3KWVA 3Q8AA 3RZWC 2IWHA 4IM3A 3WAMA 2BKRB 4EEWA 3NE5B 1CTMA 1C48A 3U4VA 1VJKA 2XVSA 1XMOL 3HM6X 1ASZA 1HCZA 2PMVA 4G7ZC 3VXWA 1TIID 4F87A 2HT1A 1KL9A 3FPUB 3I3TB 4NZLB 3R2TA 1G6ZA 4RGNA 4A76A 2Z0SA 4PNYA 1X3EA 3CD6A 4ZRQA 3ZLZA 2EOTA 2JWUA 4AUQC 1VCBA 1R9TH 2XBBC 3AM9A 3I63C 3WCQA 3PO3G 2K5DA 4C1NI 1EWIA 2V4DA 5IGCA 4HJ8A 3QOJA 2KT7A 3AEEB 5FR6A 1TWFB 4WJQA 2PKOA 2L11A 5IA7A 5IT9E 1BVSA 2KC1A 5G5HA 3H9DA 1VQIA 1VF7A 2A6HD 2KHSA 2MA9B 2GVAA 2M19A 1LTTD 3I55A 1J7AA 1Q86C 1E7PB 2JA5G 4CO7A 3I4MG 2BKFA 1VQPA 1VQAA 5CV6A 3RUZA 3FRPB 5FOBB 1RFAA 2NN6G 2RHQB 4QUFA 5TR5A 4XWTA 3ULJA 3VTVA 3U2SC 1JT8A 3E6ZX 4KHPQ 5L83A 3R2IA 3KJOA 1X3FA 3OSOA 1FR3A 2J7QB 3H8HA 1GPXA 3B2GA 4G3XB 4W9HA 3UDGA 1YJ9A 1E3PA 1J7CA 1AZQA 2WDQB 4JE3B 3K6OA 4WFN3 1DGSA 2QMTA 4DV2Q 3OHXC 2IY1B 1LXDA 3AE1B 1NBFC 2OJWA 3FPPA 2A69C 2ZCBA 3P2BA 1I5FA 1CKOA 2I5HA 1EOVA 1KDBA 2XWJB 5CYUA 3SK5A 2O2LD 1ZYRD 2EE1A 5J3BA 3HOWB 2VZKD 3PT2B 3RT3B 3KWLA 4OVUA 3VVWB 1KTKA 1XX8A 3I70A 5DM63 1CK1A 1C77A 1WRDB 3AU5A 1J19A 5E6OA 2Z4HA 3S1RB 4W9IA 2KO3A 3MWYW 2O5IC 1XJVA 3J81E 1QZHA 2KEEA 4OWXB 2O6VB 1E0BA 4HR7B 2KYWA 5L95C 1F2LA 3UE1A 4DKAC 4A3BG 1YHQA 3GOEA 4HVBA 3DWAA 4DK5A 1YNNC 3PPAA 1EM7A 1WGKA 1E2ZA 3I57A 4KSLC 4I6PA 3HOZH 1KFYB 2O5JC 3M7NA 4FJZA 1KDAA 2NCNA 2N1VA 3JYUA 4A3BB 3AN1A 1U0LA 3C1FA 1WTRA 1OQRA 4PMCA 3R66C 3AEVA 1E9MA 2B2VC 1WJ6A 5GAGC 2J52A 3N30A 2EYOA 4LAAA 4OVVA 2RDHA 4HJ7A 1SYCA 2KX0A 1M90C 3M3YH 3ZNID 1QUQA 1STBA 1ESRA 4MZ9A 3A74A 3N32A 4BY7G 3ONAB 2C5LC 3STBD 5KRUA 3OW2A 1AZPA 5J22A 2W3SA 4JCVE 4KN7C 4E3CA 1L2FA 1JORA 3KYHC 1STAA 4GNXC 2EIFA 2R2OA 3HS0C 3M95A 4ZHOA 4KLKA 5CC4A 2F03A 3ABVB 3PZDA 5CR3A 5HG2A 3Q0AA 4H02A 5M5XH 1FCCC 3Q3OC 4IALA 1EL0A 3NS1A 5BMIA 1VQDA 5JHBA 1LLRD 3L0OA 2N88A 4LTUA 1LFDA 4LLGM 3H6NA 2WFWA 2BWES 1NMGA 1SMYC 2D62A 5C4ZA 3ULLA 1EY8A 1KDCA 1TR5A 4JI6Q 1MKHA 1LTAD 1K52A 1D5XC 2ZNVC 3EFUA 3KYCD 3GTPB 3ERSX 4EKUA 3M3JA 4WQOB 4DUYL 4DA2A 2QF7A 5C0XJ 4XT1B 3NHHA 3RMHA 2WXJA 1E7ZA 4NY0A 3CP0A 3P4SB 4EQPA 2FJ2A 1C4AA 4YSXB 5D7GA 3PIOA 5LL6X 3BG3A 4LF5Q 2R92G 4P16A 1CT1D 4LDTB 5K36H 1HTPA 4CDDC 4YY3Q 1T0YA 2C35B 2CHBD 1MSHA 3VUXA 1IYUA 1F2YA 1VS0A 3MC0B 1N61A 3Q8EA 4MGKE 1I42A 2Z9HA 3R7QA 3W1YA 5I2XA 4QJFA 4W9EA 3H3VC 1A70A 1KNEA 1WJJA 1VQ4A 4XX5A 3BIID 2PPBC 2IZVB 4KDIC 5E7NA 5BYSA 5C0XG 2NVQH 3FDTA 2DY7A 1FGBD 1TS5A 4GOPC 4P71A 1Q82C 1EIYB 2GBRA 2I5MX 2KQ4X 2N7DA 2Q8IB 2JE6I 3A4SC 3W2DA 4CJ0B 3J81c 1YITA 2WQYB 4KIKB 1PTOF 3HOYG 4A3DB 3DBLI 4GDLA 4LF7L 1BR9A 3D6CA 5GMVA 2FXQA 2BWFA 3PUYA 3E5SA 4A3JH 1X3GA 5LMNL 1T3QA 2N9KA 1FXIA 3AECB 5DM73 1TIFA 1PTOH 1EF1A 4TKNA 1MHWC 4PV1C 3VYSA 3D3RA 1IW7D 4LF6Q 1FPYA 1F9RA 1U4RA 2LFNA 5J2RA 4M0WA 4L6TB 1Q3LA 3M3YB 1JROA 4C00A 2QW7A 5LMUL 2Q2TA 4MGYE 2AMCB 4OONA 4BXXH 2V0GA 1EQQA 2B39A 2KN4A 3T9LA 3LDZE 3EN2A 5GAEC 4B3TQ 1SFOH 2C60A 2W55A 1C9FA 5BN5A 3PGEA 2G45B 4CYEA 2MO0A 2M9VA 5ELBA 1XNQL 2NS5A 4C3HH 2JY6A 3EHVA 3BVGA 4ZRZA 2RDFA 1S4ZA 3E56A 1FMAD 4MH8A 5KNCA 4NXML 5E4XA 4OWWB 3APFA 4QQBX 2VL6A 5C4HA 1XNRQ 1D7QA 2CR5A 1S5FD 4DF7A 1PH9A 4GSWA 2IY5B 2JPHA 1SDFA 1MHXA 2Q2UA 1YIWA 1LTID 4WJPA 2VQEQ 2LI5A 3PGZA 1F1HA 3WA0A 2F3VA 3PUXA 3S1RH 4B3ML 1TZOA 2D5GA 4JL9A 3ZTCA 2JRIB 1TJEA 4A90A 5DPTA 1FIQA 1E10A 4I6NB 1CKNB 2F0QA 3K57A 2REXA 1RIPA 2D11A 2G5DA 2HTME 3NBHA 1LT6D 4WORA 3W5UB 2RPQA 1WMHB 5JAVA 3TZUA 2ASBA 4BOZB 4LF7Q 3TBIB 2VB2X 1OTCA 4HPPA 1NTGA 2EKEC 5E6NA 3MVVA 2CQAA 5IT9L 4KGTA 1SRUA 2UUBQ 3H0GB 3GTOH 1VQ6A 4FHJA 2EXZA 2MBQA 4RMAA 1B3QA 4XC2A 5IE8A 3OAWA 3X23A 3LB8C 1UWMA 1TTNA 5DNFA 4EOYA 1WE6A 1YHBA 5KYIA 3GV3A 2PMZE 2JEAI 3BVMA 2K9XA 2HHHQ 2RQXA 3C3LA 3M4YA 3MHSD 3PV1A 2O4XA 4DPGA 3WWVA 4GKKL 2Z8LA 2KCCA 3A54A 1EFWA 3AMZA 1WFYA 4IUMB 3Q14C 3QARA 4AQ7A 5M5XB 2L0CA 2L05A 3I4NG 1WX9A 3APCA 1K8RB 4DR3Q 2TMPA 4JG2A 1U4LA 2E2JH 1HRJA 1V80A 3AE7B 3H0GH 3GTOB 1D5MC 1K0RA 4MH0E 5LMUQ 5JEAH 4II3B 3STBC 1XLQA 2KTRA 4LF6L 4JI6L 3K0XA 2WV6D 3CQZB 3PIPA 3DCGA 2AHOB 1H9MA 3HGBA 4I65A 2WU5B 1QOHA 4MGIE 5J39A 1FFVA 5IAAC 2BA1A 2HDEA 2KDBA 5FO7B 4ICUA 3RUIB 4IFDJ 3K7AB 1ACCA 2J53A 4K6LA 4G11A 4UP8A 4ZCKA 2ON8A 2L00B 3S2DH 1VMCA 4QCLA 1YX6B 1WTHA 1EY7A 2L3ZA 2BPSA 1E7VA 3SXHA 1BDOA 3P1MA 4DK6C 3ZNZB 2ZTEA 3RZOH 1II3A 4AJWA 1SSOA 2M2LA 5M5WH 5AJ3L 3GS2A 5IKCM 1EU3A 2WXIA 2CHZA 3AE2B 1AE3A 2L52A 2QGQA 3BZCA 2DYOA 3QIJA 2ATWA 3VR8B 5F2DA 3KLWA 2LMCA 3P1HA 2RDGA 1QKZA 2L55A 1JMCA 4F8MA 1YNTE 2DAFA 1YMHE 2JA6H 4GKJL 2QDLA 3HKZG 3M62B 3MJ5A 3IAM1 3TP8A 3UGBB 2MBBB 5ELNA 1LTSD 4BKGA 2N55A 2PW7A 4MTNA 3M4OH 3TL5A 1ZDXA 4IUQA 1WVLA 2F0TA 1VZ6A 2KTRB 5IOCA 5HFYA 4LW1A 1XCTL 3BYYB 4A3KH 2KMMA 2LMCB 2K6QA 3J80E 4DV4L 4L23A 1XO3A 2KHJA 1HZ6A 2DZMA 3N6RA 4HPLB 5EKKA 3SK8A 2XTIA 1FEHA 1TY2A 4BBSH 3ZKJC 1FL0A 3U7ZA 3NSWA 4WJWA 1T6BX 4LUVA 3C19A 2V4IB 4JX1C 4LNKA 3A0JA 2DZJA 1JQ4A 3JAML 3JVZX 1DD2A 4K0KL 5FO8B 4OXPA 4B08A 1O7IA 3URYA 4P1BC 4XYCA 2LVOA 4ZRIA 2IT1A 1A6XA 1RTNA 4HROA 4PZ8A 3M85A 1OGWA 4KKSA 4DV2L 2JXMB 1TGZB 1UBIA 2J0TD 1E6EB 4ZUIA 2GN5A 3Q8CA 4GLAC 4QMGA 4IWPA 1FNWA 3HOXH 1JJ2A 2NUCA 4JI4Q 4RNAA 4ACFA 1VQBA 3NEMA 1UE1A 1VQ8A 1ZYRC 1G6PA 2KJHB 3RNFC 3JAMi 1BNZA 2GMIC 2N9PC 4FHKA 2BYEA 4GNXB 2MP2A 2JN4A 5IN7A 3MTNB 4KHPL 3AEAB 4P75A 2HJ8A 2IX0A 4BBSB 5JEAJ 2NWGA 4JV5Q 1D4BA 3ZJUA 4WWPA 1LACA 2YU9B 2L1AA 1NR4A 2F1MA 3D4RA 3NHEB 1PFNA 2BH8A 3PSIA 2NVTB 1CKNA 3MFGA 3NVVA 2EYJA 1PDQA 2DJGC 4DV7L 1WYWB 2J0MA 2XSCA 1WD0A 4JI7L 5IP9G 2B2UC 1BF4A 4KKIA 2LXKA 1HZCA 4NQLB 3ZQ4A 3HUIA 4L5QA 1N36L 1YEZA 5C1ZA 4IOCA 1N5WA 3L17A 3AB5A 2A4ZA 2LY7A 4KY7A 4N9PA 2K75A 1KHIA 1PFDA 3VUWA 1YJNA 3TSSA 5G55A 2WXLA 5EGTA 3UIOB 3J80L 1I4XA 2WAQE 2AQ1B 4MHEA 1H8CA 4KGSA 4HIMA 2B2TC 3VA7A 1DOLA 2ICEC 4JI0Q 3MHBA 1ZGUB 2UXBQ 4X66L 1EIGA 3K9PB 3NBHB 2M0AA 1A0IA 4A8XC 2WLBA 1Y1WG 3MEFA 3SE0A 5ELCA 3NS8A 1QG7A 4RGMA 3S9WA 4A3MB 4TQ1A 4R4OA 4NMZA 3T51B 1PXUA 1XWEA 2HDLA 1JRPA 3KLRA 1D1KA 1TWGB 2JSOA 2NVYH 3S1MH 1VQOA 4KVGB 1XCQL 2K5NA 3BU2A 1WCMH 3VR4A 4FF4A 1BBUA 3HFZB 1X9NA 3H3VH 4OO1I 1V97A 3ZGZA 1B9RA 2N1WA 4N59A 4R4IA 4IPDA 4RFBA 1X1MA 4HMIA 5DEHA 3NTIA 2H5XA 3C1EA 2CCZA 2OT2A 4EQ5A 3X3MA 2L76A 3IHPC 5GROA 4A3CG 2LGSA 4NKLA 3W3AA 1D1IA 2IGGA 3KOJA 1WZ3A 1E8ZA 1EWYC 1K3RA 1W3SA 1B2TA 4TUUA 3BK1A 2XEWA 4A3JB 2BS4B 1A62A 2D07B 1ENAA 1OFFA 3T8MA 1NUCA 3QG1A 1J7BA 1L6VA 3IG3A 2A1AA 1ZXTA 2GOWA 1TWCB 3WAPA 2QKIC 1Y8PB 3HOWH 1H9JA 4YT0B 5LXIB 4DV5Q 4U673 5JPMC 3MFYA 1VQLA 1ZDVA 4A75A 5C23A 3DWPA 4ZRPA 1I35A 1N6ZA 4MT5A 1C8CA 1K8GA 2N7EA 3EIVA 4A3JG 4BKSD 4RHSA 1SNDA 2M56B 5I9PA 1YVCA 1V1PA 1MHHE 2JQOA 1K9MC 5IO9A 3ND8A 2KJXA 1A3UA 4DR6Q 5M3MH 3HOZB 1B9NA 2JA6B 4KSKC 4IOIE 2EYMA 4ZHPA 5DPRA 2RHSB 2UXBL 5IP9H 1RDPD 1JQYD 2EY5A 2PQEA 3R3OA 5C6AA 3RD2A 4C7ZA 1SJHD 2HD5B 4A9AA 4YHHL 1SAPA 2HD3A 3CCSA 2IGHA 4XZ4A 2F0UA 1IZ6A 5C3JB 2RF4A 4C3HG 1YJJA 1FO4A 2LSSA 3N52A 1HNXL 3Q6SA 1X56A 1Z47A 4R4QA 2F4VL 1IUEA 4URKA 1M4VA 2K3UA 2MWSB 4N58A 4A3LG 4UHVA 4IFDI 1F9QA 2INDC 4XYQA 2NYZD 3SDZA 4DUZL 2D5DA 2JX5A 4RA8A 5M3MB 4HTHA 4MM3B 4LF9Q 1Q1EA 2DN8A 3K7AH 4XDXA 2UYZB 3IT6B 5BR8Q 4QGUA 3S14H 3NZSA 1WYDA 1DZ1A 1BCPF 3RLFA 2NVXH 3A9JA 4PMWA 2W3RA 2ZW1A 4S17A 3VTWA 2OXPA 3E9IA 2RBMA 4K8IA 4X64L 1C0AA 2YEPB 4K7UA 2BE5D 3Q3MC 4GN4B 3BDOA 1NENB 3U58A 1WR1A 5IGFA 4DR1L 2Y5CA 4ITKA 4C80A 4LK1C 1R4NB 1GHJA 2B2UA 5IYBG 4OIJA 3L10B 3LWEA 2KKCA 2LGYA 2SNSA 1WX8A 4HAEA 5A2QL 5FLMG 3PIO3 1JJGA 5JPNC 3ZO5B 1FCLA 2R93G 1FM0D 5FR3A 2D3AA 3DM1A 2FBWB 5BO4B 3ONSA 4R1JA 3AULA 1GAQB 2GB1A 4EFOA 3NUHB 1IYJB 2XGTA 5IGGA 1TWCH 3ZYYX 5KEEA 1EY4A 4OX9L 2KWUB 3Q24A 4O2DA 4K0KQ 1L1OA 2KQSA 3A4RA 4A3KB 4JI5Q 3I72A 2ZPYA 3NY5A 1TVXA 2K6DB 2NN6I 1BCPD 1JW9D 1P0RA 2WDVB 4FF2A 2BH2A 1MPEA 1K83H 4QUCA 5G5GA 4G57A 1PHJA 4W9JA 2N9EB 2F0HA 1I4HA 2DAJA 3L0WB 3EJIA 4PS7A 1C3TA 3IFTA 1U9RA 2A19A 5E6PA 1V8QA 1I4GA 1FJGQ 4YY3L 4FN2A 4RAUC 4XQJA 1B8AA 3OYYA 1PH4A 1S5CD 1VQHA 1HUMA 3IAYA 2WNMA 1LV9A 2H1EA 3SGIA 2D0PA 4QB4A 3HOXG 1HA5A 4R8NA 1F9JA 4IN3A 3KK7A 4C4VA 2M17A 1DCZA 4OGQC 3SR6A 1Q8IA 4CHKA 4JQWC 2EPBA 1WJNA 2VQFL 1ONLA 5EDSA 3W5OA 1PTOB 4IPCA 1QE6A 4B9KA 1U4PA 4A3EB 2G3QB 4TSSA 3DHGC 1ILPA 4DV6Q 2M8SA 4M00A 3UF8A 3GTPH 3F1ZA 4KD4A 1P1AA 3MZ5A 1YI2A 1KABA 4BA1I 1BUIC 4IWOA 1BBXC 3HKZB 4M8NA 3T56B 4KKJA 3D31A 3AEGB 1WOCA 1SF0A 1Y56A 3R3MA 4JYAL 1K8AC 2CFMA 4LF4L 2CJOA 4LWCA 3RNGC 3OTOL 1BCPB 1I94L 1Q7YC 1XD3B 1D5ZC 2F0KA 3E3XA 3PHXB 1E1OA 1V1OA 1KLVA 1I3QB 1LTGD 2JYOA 3IRBA 1JE4A 4RKBA 5CORA 4C56C 1E2WA 2IO2B 1R7SA 4J1MA 2OWOA 3SU8X 4X65Q 4DAMA 4A3FH 2KJ6A 4HCEA 3HVZA 2EDGA 3QC8B 4DWFA 2D2CC 5LHY1 4FXDA 5KHOA 3X0WA 3AE3B 5M3FG 3VAWA 1QILA 1EQRA 2BYFA 2KACA 5C44B 4B0EA 1W6JA 3VH4B 4GN1A 4MJSB 3V61A 2WP8J 1C78A 3DWQA 3LXFA 4P7IA 5BMGA 4A3OA 4GLVB 2KANA 2E5LL 4OZAA 1KLGD 5JJZA 3PO2G 1CI3M 2DX5B 1PZKD 1K51A 4WJOA 1EEID 5E3FA 4S3SA 1IW7C 1RCVD 4KD3A 1HA6A 2IGDA 2NPTB 3HG9A 4HCNB 3NPPA 3RLNA 3S24A 1T0QC 4OZBA 4HCSA 2PI2E 5BMHA 5HGQA 2UUAQ 1B44D 2KCTA 3CXCA 1Q8KA 3TREA 1OEYJ 3C0RB 3DVNU 1C4PA 4JI5L 3I7FA 5FLXE 4B3SL 1V9PA 2KQ3A 1UWVA 2RDBC 4DU9A 2HIVA 4OELB 3R8BA 4GOPB 3ZNHB 4FADA 2BOSA 2FFKB 3SHLA 4HDQA 5CHWA 2F0GA 5T8IA 2EYHA 4A3FG 4DR5L 2K5HA 4CKCA 3OMCA 3AE6B 2FHTA 2JZPA 4N9F4 2OHFA 4ZQ3A 3VHTC 3SD5A 3BY4B 4LNNA 3VR5A 1HXYD 4RG1A 3IT4B 2WXKA 1NI3A 2EJFC 3N1YC 3DVNV 2RSUA 2OTLA 1BO0A 1PRTF 2K25A 3H0GG 4DNIA 4C3IB 1OXTA 1EO6A 1N5XA 2RPVA 1SYFA 4H2AA 1IGDA 1SNOA 5C3WA 3P4QB 2YTXA 2IBIB 1KC8C 1YZ6A 4P73A 2JZZA 4K3CA 4LMQD 5E1FA 4WAFA 2GRIA 3APDA 4P6VF 1L2NA 1VD2A 4BWGB 2I0QA 3I8ZA 3DLLA 4GN3B 2YYZA 1C4CA 3CMAA 2INCC 4HIOA 2R7ZH 5KIXA 4LF5L 2MRPA 1GUGA 2AUKA 2QDBA 1E8YA 3KBGA 5CMDA 4JI2L 1HJPA 4RF0A 1NMFA 3KDFA 3CIRB 2HTHA 1EIHA 3S2DB 3A5ZB 2ZCCA 1EZ6A 2WIIB 5AZGA 1MI2A 1IBKL 3S1MB 2WGSA 2VB3X 5ISRA 2FNJB 1KQSA 4UP9A 4JC0A 3NP8A 3H09A 2PVGC 1JB7A 4H0LC 1SYBA 2RSNA 1K83B 5IP7G 4DV3L 2B63B 1WGYA 4A3GH 2K5QA 3KH0A 3RNBC 3D8GA 4RKLA 5D6JB 1ZPSA 1PZID 2WXNA 2SDFA 1CFMA 3CKIB 3I3CA 4GLSC 2PZUA 4HKQA 3AE8B 1N32L 3V62A 4IO9A 1VQ5A 2WINB 4W9FA 1XTDA 2FUG1 2RD0A 2DY8A 1HH2P 1K3BC 4X3UA 2HQLA 4DR6L 2E2JB 4AYBB 1CJEA 1RRBA 2J0JA 3K9OB 1VQGA 4JK1C 2KFKA 5EPJA 2E2HB 4GZYC 4CJ1B 2PZWA 1HNWL 2J42A 2PEAA 1AEXA 1D2BA 3WAOA 5JJKA 4KHVA 2HCCA 5FLXc 4MELA 2YLMA 1VDVA 3BK2A 2VUMB 1BT0A 3A9JB 3EC8A 2K03A 2ZVNA 2KWCA 3NG0A 1JOKA 3TBLD 4ICVA 1XPRA 3S2HH 1IYVA 1VR9A 1V1PB 5KNDA 4DV5L 4GOCA 2WXMA 4XIGS 4DR1Q 1P9DU 1ZW7A 3VDZA 4NJCA 4DHZB 1V5OA 1ASYA 2QA4A 3VQIA 1EOTA 2UXDL 2MH7A 3GO5A 2F0MA 3N1ZC 4FXGC 4EQOA 4A3GG 1C1YB 1H9RA 2MP1A 4Q5VA 3FKIG 5FO9B 2ZTDA 2UXCQ 2PTLA 1MVKA 4ANUA 4XTCS 2FINB 2ZZPB 1T5EA 1C79A 4BBRH 1N60A 1LUZA 2K32A 3GD7A 4LFBQ 4J15A 2Y3AA 3P20A 2QIEB 2KVZA 2VH2A 4X3KA 3U7DA 4IM0A 2R92B 2K1FA 4LNQA 1TY0A 2F4VQ 4RMFA 4L1BA 4US8A 4HJGE 1JICA 2KK8A 3EFXD 1F9PA 1TS2A 1WI0A 1EWCA 1ZKOA 2UU9Q 3FILA 1P7EA 2INNE 3ERQA 1QOAA 1SMYD 3K8AA 4M8AA 4IUNA 3MXUA 3NBIA 1T0SC 4WH4A 2C7HA 1S72A 1HFGA 2XRSD 4AYBE 4AS1A 1IPGA 4EQNA 3TEXA 1RODA 2ZXRA 1OXVA 3GE3C 4A3GB 3RZDB 2DZIA 2JQRB 4E74A 3FAHA 2F4IA 1TS4A 4LFBL 1NR2A 5EKLA 4FXKC 1RFKA 1HE8A 5IT9c 1WGHA 2UWQA 3HRDD 4KGRA 3AEFB 1JC7A 4JI7Q 2Q8TA 3IBEA 3UE0A 1PYSB 1WRIA 2FCMA 1GUNA 2QDFA 1K8MA 2MJ8A 3KUZA 4ZRKA 4JLCA 2JXTA 3QIAA 3CCVA 2BT6A 4RH6A 1X3PA 4REZA 1H9SA 1LTBD 2D0OA 2A8VA 2UXDQ 2I38A 4XYOA 1L5PA 2OCEA 3SDLC 3RULA 2MO1A 3W1BA 3AFPA 2KBNA 4K5WA 2WXFA 2NBUA 3NUCA 2OQKA 3LNNA 3PCOB 4MN3A 5C3EH 4YWLA 1YQ3B 2TSSA 5M3FH 2KDFB 4AYBG 1QNUA 3X3NA 2L0TA 2IHFA 5IP4D 2B29A 2ACZB 5A35A 1S5ED 2YEPF 1SIFA 4K5XA 3NVYA 4K81A 4JPBW 1WXVA 4L8JA 4Y52H 1XMOQ 4X57B 2OF1A 3KLSA 5C4JH 3TP7A 3F2CA 1TKGA 4U68A 3L3OC 4DN4M 5C44H 1STEA 4NAWB 2MP2B 2B63G 5EBCA 1CHQD 3EUB2 2AWNA 4A3DH 4OVZA 4IM2A 2J7ZA 4H7BA 4Y7NH 3V6EB 3O65B 5ELFA 2F0WA 4WRDA 2JA5H 3KFUA 2K8BA 2WXQA 2WXRA 5J17A 3GTQH 3HOWG 4BBRB 2KC2A 3DBLB 3IFWB 3RZFA 3SK6A 4LFAL 3AH7A 2EMSA 1X54A 2XRQD 2CKZB 1SYDA 3A8JE 2Z0EB 5M5YH 4GLXA 3R93A 4WIPA 5C4JB 3M9BA 5C3EG 1S5DD 2MGSA 1N8RC 5IGBA 3T1YQ 2GBKA 4BY1G 2PNHA 1K50A 4YTMB 1E0ZA 5IY0A 2WU2B 4DXGA 3RFZB 3VUYA 5EE3A 1JWAD 3CF6E 3DBSA 5ELOA 1N34L 2LXAA 1U4MA 2N49A 1WGRA 1OXUA 2JZ3B 4WJNA 3PLUA 4BXXG 2A68D 2WXPA 5D94A 3IKJA 3GTJB 4DR7L 1J8CA 3I4MB 4MTKA 1MI0A 2K1BA 3KUCB 2KMCA 1G291 4A3FB 4LNOA 1Y8NB 2K04A 3H6MA 4OIKA 3BINA 4HJ9A 1EY6A 1DM0B 5COYA 4XDDA 1WWTA 3WDNA 4K2KA 5AZHA 5JZEB 2JA8G 3OWEB 3CSFA 3PO3B 3P4RB 3W5VB 4XQQA 3ZRFA 2PI2A 1FD7D 1Q90A 2WB1G 4DV0L 1FRRA 2F52A 4OWTB 4A3IB 3SFEB 2FE8A 2FUHB 5JH5C 3Q8FA 3PUWA 1GHKA 2M1MA 1JWBD 4XE0A 2AWOA 2MQHA 4H13C 3I4MH 3H15A 2JT4B 1STYA 1QOGA 5IWAL 1SYEA 1L7YA 4ZRJA 1IXRA 1CHPD 3ECIA 1Q1BA 1C76A 5IYBH 1TWHH 2UUCL 4BBNF 3SEBA 2LVQA 4TKOB 1EZ8A 3CRKC 1NVID 2I1KA 3TEWA 2BDNA 3S1NB 5TSSA 4CDFC 1GG3A 2VXWA 4LJPB 2E75C 1Q1OA 2KXJA 3PTFC 1JRUA 1J9OA 3J81L 2KUMA 3HOUG 5IOIA 3JW0X 4A93G 1A3TA 1GUWA 4IZ8A 3CMMB 2WKCA 2INPE 1C7YA 1XLOA 1QT9A 3MHZA 3AYHB 1AFPA 3GTQB 4LFCQ 5H1SE 4ZOHC 1SE9A 4DV1Q 2VS1A 3UDFA 1WIAA 1DOYA 2QSDA 4IW0A 1PDXA 1EYAA 1NJIC 2CHXA 4USAA 4YWGG 2QJLA 1QCBD 2V3PA 4A20A 1I4RA 1S1QB 3TQYA 4NPNA 2CU1A 3P7JA 4MEMA 2Y0SB 3SHQA 1HR0Q 2PQAA 3BDCA 5J1ZA 3OIPA 5EPLA 2KD0A 3TJPA 3JSVA 4FJYA 2B2WC 3HIZA 4CDCC 4YWMA 1ESFA 4BKSA 1DOXA 4EGVA 2N0SB 2UU9L 1PH1A 1E8WA 1YQ4B 5FKAC 4P72A 1JJCB 1PYBA 4N9TA 1YNJD 3UDXA 1HQMC 1WYGA 2EELA 5M5WB 5NUCA 3HOXB 4ULLA 2BVCA 3ZIMA 5C2TB 1SSNA 1ISNA 1MJEA 4HRSA 3U30A 1EQVA 3H7PA 5I9OA 4HK2A 1PV4A 2QC8A 3U52E 3G7LA 3MC8A 4XT3B 3BJUA 1XMQL 1L4ZB 2CW0D 4GDKB 4DR3L 4A3IH 4GGQA 3CRLC 5C0XI 3A56A 1UF0A 3U9SA 4DAYA 1KIXA 2L7RA 1ICFB 5JVG3 4UDUC 3ND9A 4DAYB 4IUVA 1WX7A 3LX0A 1UE7A 2UUCQ 2EY6A 3V96A 1WI5A 1HFNA 2X6GA 3F2DA 4A55A 4ZDVA 3NVZA 2Z4IA 4AOFA 1TWHB 4GB9A 3QJYA 3TP5A 1T5XD 4DXFA 1VQ7A 3K81C 2SEBD 4G4KA 3MTSA 4HKZE 2MCNB 2LXJA 1UE6A 4LF8L 3DBRB 1YOVB 4NJ7A 1QJOA 2KLCA 3DXJC 2KOLA 4JWSC 5EPKA 4A3CH 1P8LA 1K73C 3A5UA 1EU4A 3DVGY 4KX6B 1PFMA 2DLBA 2KZRA 1IP9A 5GAHC 5E4WC 2LZ6A 3D4WA 3J81i 2VZAA 1UEAB 2QEXA 3FC4A 4UPAA 1FNUA 1WH3A 5LXHA 1L4DB 3TZDA 4B3RL 1PVOA 3PREA 2Y0SE 1N33Q 1H9SB 1TBEA 4P2CB 3HKSA 2EY2A 4WQMA 4POFA 1HZ5A 4EZKA 4AQYQ 2UU7A 1FGUA 2XIWA 1EUVB 1UGMA 3QWNA 1QVFA 1B1ZA 4EVOA 2RCNA 3I91A 3NXWA 3I4NH 4K1RB 3ZRCA 1WTQA 4JBKA 1WFQA 2LFIA 4C3JG 4LFCL 1VLBA 1IBML 1WZ0A 4IUTA 4LCDE 1DJRD 2NN6H 1DGJA 3GB1A 4ASWC 1S40A 2H89B 2NZOA 2VQFQ 1YNJC 2JA8H 2A73B 5EKIA 3GTKH 2ZPNA 4C3HB 2K33A 4Y7NB 1XMQQ 1F52A 3AI5A 3V6CB 5C5MA 1UGJA 5MPOA 2WX1A 1OXXK 1JWSD 4C3JB 2E2IB 4DHJB 1HZAA 3SR1A 3VDYA 3V05A 3DHQA 5DPSA 3W9CB 5T1GA 1UELA 1SROA 3EROA 2KOXA 4HEDA 4BBNC 3J7A5 1YN3A 2K14A 3A1QB 1WCMG 1G6JA 3CCMA 4A3LH 1BKBA 2Q2HA 4GDLB 1DOKA 2WWZA 4ODGA 4OEMB 1RD9D 1TT2A 4IKGA 2CHWA 4C2MB 5KHQA 3BYTB 5D3IB 5I4DA 2V3SA 2RGFA 3QAQA 3GZNI 1HUNA 3AE5B 2GBNA 3DHHC 1FXAA 4UY8C 2FMMA 3FKIH 4MDKE 3PRZA 4ME5A 3VYTA 5KYLA 3B1LX 4G7OC 1JMLA 3ZJTA 1D8LA 1V2YA 2HJ1A 2MJEA 3BWUD 3HHMA 1CSQA 5BYRA 1AN8A 3AV8A 4K6DA 5EBDA 1TYGB 2MEKA 3DDCB 4B3SQ 4KJOA 1LT5D 1GC7A 1PRTC 4J6HA 3G48A 2Z0DB 1L0YB 5CBEE 4TQUS 1TU2B 2ASQA 2LUEA 3UQBA 4JI1L 2MHVA 3FHWA 4OO1G 3B6YA 1RKNA 3MEHA 2KJRA 2ES2A 2LHDA 1YBYA 5H92C 1WJUA 2PLPA 2Z6KC 4X64Q 5JJLA 4RGOS 2D3GA 1PH8A 2K0PA 2EKIA 1QNKA 1I6HH 2I1JA 3PSEB 5KNBA 4FNFA 4XWWA 3DBHB 3PV0A 2C5CA 4FXCA 2RVLA 2B2YC 4A3MG 2LD9A 4WJ3M 1LT4D 2KQ7A 2DNFA 2KFJA 3T16A 1WY8A 2NTSA 1NCVA 4IDIA 1LM8B 2KWVB 2CH4A 2BE5C 3M7GA 1GKHA 2BDOA 5C4XH 1XPOA 5KGUA 1A8VA 4II2B 5G2NA 1I50H 2D3BA 2B3AA 2NB0A 4JW0A 3SFDB 4PQXA 3A55A 2MBEA 3I9V1 3BVZA 5JHAA 2MQJA 4YXDB 2ZXPA 4HJKA 4KY5A 1SR3A 3LYYA 2Z6KA 2KVMA 2Y0SG 2I2YA 4IPHA 2N4FA 3ML9A 3A7LA 2E2IH 1O80A 4AP4C 3BZDB 1STNA 4YSZB 1Q10A 2RKSA 2R3ZA 3U4ZA 1QUQB 1UUPA 1RL2A 2A69D 2XWBB 3KDFB 3VYRA 4LJOB 3HEJA 4RM8A 1K53A 3TS2A 5CV5A 1Q5WB 3ML8A 4IC7B 1H4RA 4F1SA 3T3OA 4OL7A 2L8JA 2OOBB 2BCOA 3I56A 4NAWA 4ZAIA 1F2RI 4LJZC 4YWKA 1VQCA 4X3SA 1KNAA 1QF6A 2A6EC 1EYCA 4BBSG 3PO0A 2WB1E 1DOIA 1UBQA 4YCWA 2EJMA 1R4MB 3L16A 3H3VI 2B2TA 4KZCA 5G3LD 1N9WA 2GVBA 3RLOA 3PMFA 4DK1A 3DVGX 1QOFA 4AIMA 5JXVA 1LM0A 2P5ZX 4JGHB 3QO2A 1I7HA 1PH7A 3B0AA 4H44C 3K7UC 4IURA 3V60A 2RCFA 5A2QE 3I73A 1F2MA 2G4DB 4CGYB 1Y1VH 4GMVA 1VMPA 3TN2A 3VYUA 4DAVA 2PMZB 2Q5WD 4HWIB 3I4OA 3IVFA 2E76C 1DXMA 1E22A 3MAQA 3AFQA 4DR2L 1R4QB 5IGDA 4FP5D 3TMEA 3M4QA 3HOVB 1CA6A 3P75A 3DWGC 2E6XA 3T13A 2A68C 2Y5BB 2DUDA 3H7SA 4YCVA 3CCJA 4POGA 1J8IA 4ZKBB 1TKWB 4MIUA 1S3OA 2LGIA 3WOEA 1AE2A 5CV4A 1HTOA 5AZFA 1E24A 2JA8B 2VRRB 2DNEA 4YSYB 4I7ZC 1VQEA 3RNUA 2XK5A 3EFCA 1SGHA 3OW7A 4L5TA 3RNAC 4IJLA 5FJ8H 1JOQA 2NBWB 4MJSA 4EE2A 1RHPA 2VW9A 2LJIA 3TEYA 1V1QA 1EY9A 2EQSA 4E6IA 4UP7A 3G6JB 3N20C 4M8MA 3RR5A 2EY1A 2LS01 3W1SC 4DR2Q 4GN5A 2NZHA 1RTOA 1NBWA 1F9SA 2EYPA 5CBAE 1WCMB 2ZM6L 1R9TB 1PRTD 5C0XH 2EMTA 2G9HD 2LASA 3KVFB 3ZJVA 1SIJA 3TEHB 2K22A 1KOTA 4NW2A 4DR7Q 3ZNGC 4ZK9B 1N62A 3LJ3A 3TUOA 3CCRA 3J9CA 1D3ZA 2JEBI 1ENFA 4CBVA 1EF5A 4DV7Q 2LXCA 3S14B 1GUSA 2KDEB 3E0JA 5EQ0A 2CU3A 2F0JA 2EYFA 3J7AF 4N6EB 2RSOA 4DGZA 1S3SG 1NI2A 3MXPA 4O0AA 1PMRA 4G50A 4HPMB 3F2BA 3VRBB 4K5VA 1B70B 4QY7A 2AQ3B 2JSVX 3RPFC 4YIJA 3PHWB 4DDID 1NNXA 2IO0B 2MSED 3J7ZC 2JK8A 4K14A 2N3SA 5DLQE 2L0FA 3T1HL 4CJ2C 2FMCA 1B50A 2O2VB 5EE1A 2K39A 2C9WB 4FLHA 1NEKB 2DWQA 3DBHI 1GUOA 3A9KB 4IG7B 1AW7A 1QZGA 4PS8A 3Q3FA 1VQ9A 2NTTA 4WWNA 2PO4A 1MD2D 2CVRA 2PW5A 3S2AA 1TZ1A 5I6WA 4IOAA 3ZXVA 1RAXA 1EYDA 3HOUH 4J6IA 4NNJB 4A3PA 1CKMA 1YNND 1Z6HA 3K80C 3PZ7A 2KCMA 2F0VA 2IY0B 2MLBA 4WWMA 1ILQA 1WXMA 5D14A 1KF6B 2GI9A 4LNIA 4JI8L 3DHIC 3KQ4A 2B8GA 1G2SA 1Z9FA 4I6LB 3A33B 2EVBA 2G4SA 1WSPA 4W9CA 4C3IH 5C4XB 2JA9A 1V43A 3K5NA 1PTOC 4F7ZA 1NSNS 3KF8A 2IPKD 3BS1A 1WGDA 2WP9B 3ZTDA 3KF6A 3QJZA 1LTRD 3S1QH 3L7ZC 1JOOA 1SFOB 3PLVA 2PNRC 1W2BA 5JEAG 1KH0A 5I6YA 4X62Q 1WXQA 5D3DA 1A5RA 4JBJA 4ARCA 1V86A 1JR0D 2LGXA 3R7RA 1O7LA 4MM3A 2FCQA 5IYCG 3L2PA 2NVXB 2AWTA 1KRTA 5IYDH 2O2VA 4BZAA 1HEZE 2CH4W 4FO2A 3TP6A 1KXLA 2EXDA 2BBCA 4K7SA 1QB5D 3FMCA 4F8CB 4S0RA 3J7AV 2K5PA 3S1QB 2F0OA 1NYQA 3E0EA 1ZXHA 4AQYL 3UINB 4UAIA 4PS3A 2R7ZG 1I94Q 3ZW3A 4C1NK 1XYIA 1E7UA 5DPWA 3QR8A 2E8GA 2WAQB 2CWAA 2GLSA 4IWQA 3ZDTA 4F7XA 1HPCA 3E9SA 2KNBA 2KVRA 1OQQA 3K5LA 3I5JC 3A1QA 1ML0D 1V49A 2ENBA 4XGAB 3S17H 1VQJA 3NWTA 1Y1VB 1MG4A 2V9HA 3PRMB 3HK0A 4RHRA 3HOYH 2XNAC 4GOPA 5CGKA 3ETRA 2BS2B 4EZLA 1AP0A 1IKLA 3K59A 3ZJYC 1PGAA 5EE9A 3UI3A 1FNVA 1F2ZA 1FYCA 1J5EL 2KCNA 1PFBA 4PG3A 3FKIB 3OMGA 3C46A 3WOFA 2NVTH 3EECA 2AX5A 4J3OD 4DAPA 1XNQQ 4BY7H 3PRPB 1CA5A 3CCUA 2NPTA 2KHWB 3DBRI 3HOUB 2K05A 2E3TA 2PCFB 3CCLA 4CHTB 1SNPA 1E2VA 1CQFA 1SYGA 1L6UA 1MJCA 3FP9A 3MXNB 4PZ6A 1TWAH 1V81A 1RYJA 1JB3A 1KAWA 1QOBA 4ZKCB 1TS3A 3AMUA 2VUMG 2F0FA 4KKTA 4A3DG 3HOYB 4A3EH 5FLXL 1JALA 2L5TA 1GJZA 3GTMH 5IWAQ 3Q3NC 4KDLB 4L63B 3S16H 2L12A 4JI8Q 5JJIA 2L32A 1I4PA 1Z5SB 3KJPA 5CHFA 1GNUA 4E71A 2CW0C 3OLMD 2AUJD 2XK5B 3EVQA 3L4PA 4AJYB 5AUKA 4LUOA 1M94A 1XF5L 3KUPA 1HNWQ 2V1YA 2W54A 3B08A 1OTRB 3NENA 2HQEA 2R2QA 2B2YA 1P3QU 4A3IG 2WB1B 1MGSA 4OO1H 3OG5A 2K7VA 2E2HH 1CZGA 4MNOA 1TKEA 1YHAA 4QF4A 4RCNA 2HUGA 2B76B 3MP9A 4BAXA 1RLFA 1E1TA 5AEKB 4JIOU 1I3QH 1NE3A 1TWGH 2NVYB 1CZWA 1XT9B 2MJDA 1CQVA 4PT5A 5HGTA 1G8ZD 3LWUA 3RN2A 1V5TA 3PUVA 4DNTB 5FLMH 4JPSA 2BYTA 3CC2A 4GDKA 3Q2AC 2E5LQ 3QQ8B 2QCPX 5AFWA 1EY0A 1Y8OB 2DHZA 5BR8L 4G7HC 3M63B 1X3QA 5CHVC 5DCNA 3U50C 3GTGH 5EJWA 2B8FA 4KZ0A 2K5WA 3NTHA 3BDLA 2MPMA 1X6OA 1PGXA
chains in the Genus database with same CATH topology
2IX1A 3PUZA 5GXGB 3O13A 2PW9A 1IBXA 4BY1B 4FF3A 3S15B 5C3EB 5AUIA 3EA6A 4NAMA 1CM9A 4C3IG 1B9MA 1SNMA 1RJTA 2K01A 2SAKA 2H88B 5CV9A 4KV6A 3NQIA 5E6JA 2OEOA 4BY7B 1P7FA 1X32A 1KRHA 2IW3A 1IHZA 5IGEA 4KHZA 1F77A 4R8IA 4IFDH 5IODA 3KBXA 3B9JA 3K0YA 1EEFD 1BQQT 1G91A 4ZYSA 3NQTA 3T53B 1SEBD 2KDMA 3Q69A 5T1IA 4CQNA 1WTOA 2IJ0A 5FK9C 3OPOA 2PVOD 1RWSA 3IFDA 4YTPB 1I6VC 1PTOD 4B0MA 1KAAA 3W1SA 4V0BA 4KY6A 1GJXA 3C2PA 4KJNA 2WKDA 3NK9A 3Q23A 4ILWA 5IIFA 3N9YC 2NVQB 4KKUA 1TQOA 1UAPA 3DEOA 5JVH3 1O78A 4YTNB 3GTKB 1B53A 4KTAA 1PZJD 1WTWA 5G3LF 4LK0M 2I46A 2LHEA 1VDZA 1GUTA 2DBYA 2JA5B 1IL8A 1IKMA 3K5MA 3RZOB 1ICWA 3QB3A 1BCPC 3CWIA 4RWSC 3NTKA 4RF1A 1A15A 5M5YB 1GB4A 2R7ZB 2WS3B 1XXGA 2X6LA 2L4NA 2RMMA 2ID0A 5EE0A 4QIWB 2J4XA 1RM6C 3I4LA 4KI0A 1GXDC 4Q2JA 4J8QA 5BN3A 2N9LA 4FVMA 2F0LA 1YN4A 4HSVA 2ONQA 3MXGA 1LABA 1I6HB 3DMUA 5M9OA 2E2DC 2DNCA 1A2TA 4KK7A 4A6QA 1O7YA 2H4OA 5HHDG 2R93B 1HQRD 3D4DA 1TWAB 3EGRA 4CKEA 1SJED 3L9AX 1XLPA 3GTMB 2F0NA 2IL8A 1SE3A 4BA2I 4B9WA 3S2HB 3CHBD 4DQOC 3V3XA 1VCIA 1TKYA 2C9OA 4HEA1 4O1NA 2G1EA 2A6ED 2IX3A 1PGBA 1FD6A 4RCOA 2L9HA 3EQLC 3C8YA 1G2TA 3VRAB 3B2FA 1ROEA 3GQBA 5BN4A 4IFDG 1AWDA 1EY5A 4R9WA 2WACA 1SB3C 4TMAB 4DK0A 4ZLTF 5JOBA 4DNRB 2A6HC 2I07B 4OHJA 2F0DA 3VR3A 3AEBB 2OEDA 1BMLC 1MBYA 1O7ZA 2N7JA 2D9UA 2VZKB 2BS3B 2GA4B 1GB1A 2EYLA 1ZE3D 1V8CA 1N63A 1BXTA 2JU6X 2LUMA 3HP3A 1FRDA 3IXSA 4US9A 3HVDA 5I2YA 2K6AA 2KWDA 2WXHA 5C3XA 4IUPA 4TQ0A 3VA5A 4WURA 2F0SA 4O42A 1F2RC 4TRDA 2KEDA 2F0PA 1ET9A 1DOMA 2F3WA 1PRTB 2L1BA 2RA4A 1IGCA 1SE4A 4IUUA 5CV8A 3PO2B 2B2WA 4X3TA 1SE2A 2QEJC 1L0VB 5HI1A 1PYWD 3A7AB 5M3FB 2SOBA 3HRZC 3GV6A 2KAJA 4L2YA 1EWHA 3A8KE 1NAPA 2PYKA 4K2LA 5ELDA 1QLBB 3AE9B 4Z9CB 3P63A 4XQNA 2F0EA 2WXGA 2A74C 3PIP3 1Y1WB 1YJIA 2MUYA 3MA2B 2JP1A 3T4AC 3AB9A 1UNSA 2HCIA 1I4QA 4HMJA 5DAUA 1PLFA 5K36G 2G9DA 1VRAB 2XN9C 3DUZA 4FF1A 1K8OA 2KECA 2VNUD 1CZPA 1YN5A 4RGTA 3AE4B 2M00A 5CV7A 1H9KA 3H94A 3VR9B 1WTXA 3UI2A 3V2TA 1VF5C 2BB5A 2BB6A 3NWSA 1DONA 2ZW0A 3AU7A 3QOLA 1IBXB 4BS9A 1JWUD 2BW2A 2MJ3A 3ITPA 1XLNA 3U4EG 2NZ1D 2V3NA 1W6KA 4OW0A 3S17B 4HN7A 5HURA 2ZXOA 1M8AA 2HDMA 1F0ZA 2W82A 3I90A 3D6WA 4B9XA 1I50B 1VZ7A 1OO9B 3PZ8A 3J7YW 2B2VA 4OZCA 1UWXA 1MSGA 3VR6A 3GTLB 1ZOYB 1PUTA 2A5HA 2EZVA 1VZ8A 4HSPA 2K28A 3P4PB 4DFAA 1Z7TA 3T3NA 1STHA 1QWYA 1HHVA 2KA7A 4CKBA 3K5OA 3A8IE 1QQRA 2Z1CA 2DYMA 2R61A 3FILB 1BOSA 1A2UA 2BA0A 4NP5A 4Q0FA 3MXNA 1DYQA 3NRZA 5BYQA 5D65A 5LL6S 3VR2A 4ABNA 3IL8A 4M1UB 1SNQA 5H8YE 3RD4A 1D6EC 2ZT9C 4F88A 3S16B 1ZXIA 3NZ3A 2JYEA 1KLUD 2WDRB 1LT3D 3SK4A 2LKVA 4KN4C 1B3AA 1SNCA 2L83A 2EJGC 3K58A 2BTEA 4V190 1HTLD 3U9OA 1GOZA 2ICIA 3IAS1 2JYTA 3FVQA 1XTCD 1RF2D 4PMBA 3I4NB 3CU7A 5K5PA 1R4PB 1WD1A 3NVWA 3M4OB 3JAME 1EFID 4ID6A 1A3VA 2SNMA 1SXTA 2AQ2B 2R6GA 4JWUC 3KLSX 2WXOA 1EQTA 1STGA 3Q8BA 1NYRA 3P42A 1ZP0B 1ET6A 2X69A 1Q12A 3F2UA 4NDXA 2IDYA 3GP7A 3TDQA 3Q22A 3OWFA 4K8JA 4D2KA 3GTGB 4C7YA 1LO5D 4XDCA 1B4OA 3DWMA 4JBWA 1ZEQX 1S5BD 2E74C 1L0XB 5LNK1 3OOCA 2LEKA 1ENCA 1JCKB 1ZUD2 2NBFA 3SVMA 4R3DA 1WTVA 2Q8RE 4KMUC 5C5LA 1XEEA 1JWMD 1WTPA 1SBBB 2X38A 1OXSC 2PIAA 3OIQA 4ARIA 5ELEA 2NMQA 1Y69U 4FYDA 3AEDB 3TEZA 4XXEA 2JA7B 1C4QA 3DEPA 4A93B 2QILA 4ZUJA 2F0IA 3H91A 2CJNA 4IQZA 1FFUA 1BUVT 2PZTA 3FEWX 1AYFA 4MACA 3HZXA 2Y5PA 3KWVA 3Q8AA 2IWHA 3NE5B 1CTMA 1C48A 1VJKA 2XVSA 1HCZA 2PMVA 4G7ZC 1TIID 4F87A 4NZLB 3FPUB 3R2TA 1G6ZA 4RGNA 4PNYA 4ZRQA 2EOTA 3AM9A 3WCQA 2K5DA 4C1NI 2V4DA 5IGCA 3QOJA 3AEEB 1TWFB 2PKOA 2L11A 5IT9E 5G5HA 1VF7A 2A6HD 2KHSA 2M19A 1LTTD 1J7AA 1E7PB 5CV6A 3RUZA 3FRPB 5FOBB 2NN6G 4QUFA 4XWTA 3U2SC 3E6ZX 3R2IA 3OSOA 1FR3A 3H8HA 1GPXA 3B2GA 1J7CA 1AZQA 2WDQB 4JE3B 3K6OA 4WFN3 2QMTA 3OHXC 3AE1B 3FPPA 2A69C 2XWJB 1KDBA 5CYUA 3SK5A 2VZKD 2O2LD 1ZYRD 2EE1A 3HOWB 3KWLA 1KTKA 1XX8A 3I70A 5DM63 1CK1A 1C77A 2Z4HA 3S1RB 3MWYW 2O5IC 3J81E 2KEEA 1E0BA 4HR7B 1F2LA 3DWAA 1YNNC 1EM7A 1WGKA 1E2ZA 3I57A 1KFYB 2O5JC 3M7NA 1KDAA 4A3BB 3AN1A 3C1FA 1WTRA 1OQRA 4PMCA 1E9MA 2B2VC 2J52A 2EYOA 4LAAA 2RDHA 1SYCA 1STBA 1ESRA 3ONAB 5KRUA 1AZPA 2W3SA 5J22A 4KN7C 1JORA 1STAA 3HS0C 4ZHOA 5CC4A 2F03A 3ABVB 5CR3A 5HG2A 3Q0AA 1FCCC 4IALA 1EL0A 3NS1A 5BMIA 1LLRD 2N88A 4LTUA 4LLGM 1SMYC 2D62A 5C4ZA 2JWUA 1EY8A 1KDCA 1TR5A 1K52A 1LTAD 1D5XC 3GTPB 4DA2A 2QF7A 5C0XJ 4XT1B 3NHHA 3RMHA 2WXJA 3P4SB 4EQPA 2FJ2A 1C4AA 4YSXB 5D7GA 5LL6X 3BG3A 4P16A 1CT1D 5K36H 1HTPA 2CHBD 1MSHA 1IYUA 1F2YA 3MC0B 1N61A 3Q8EA 5I2XA 3H3VC 1A70A 1KNEA 3BIID 2PPBC 5BYSA 5C0XG 3FDTA 2DY7A 1FGBD 1TS5A 4YWGG 2KQ4X 2Q8IB 2JE6I 3W2DA 4CJ0B 2WQYB 1PTOF 4A3DB 1BR9A 3D6CA 3PUYA 3E5SA 2N9KA 1T3QA 1FXIA 3AECB 5DM73 1PTOH 3VYSA 4PV1C 3D3RA 1IW7D 1F9RA 1U4RA 2LFNA 4M0WA 4L6TB 1Q3LA 3M3YB 1JROA 2V0GA 2B39A 2KN4A 2W55A 1C9FA 5BN5A 2M9VA 5ELBA 3BVGA 4ZRZA 2RDFA 1S4ZA 3E56A 1FMAD 4MH8A 5KNCA 5E4XA 5C4HA 1S5FD 4DF7A 1SDFA 1MHXA 1LTID 2F3VA 3PUXA 1TZOA 2D5GA 4A90A 1TJEA 1FIQA 1E10A 2F0QA 3K57A 2HTME 3NBHA 1LT6D 4WORA 3W5UB 5JAVA 3TZUA 3TBIB 2VB2X 3MVVA 2CQAA 5IT9L 4KGTA 3H0GB 2EXZA 3LB8C 1UWMA 5DNFA 5KYIA 3GV3A 2JEAI 3BVMA 2K9XA 2RQXA 3C3LA 3M4YA 2O4XA 2Z8LA 2KCCA 3A54A 3AMZA 4AQ7A 5M5XB 2L0CA 2TMPA 1HRJA 1U4LA 3AE7B 3GTOB 1D5MC 5JEAH 1XLQA 2WV6D 3CQZB 1H9MA 3HGBA 4I65A 2WU5B 1QOHA 5J39A 1FFVA 2BA1A 2HDEA 5FO7B 4IFDJ 3K7AB 1ACCA 2J53A 4K6LA 2ON8A 1VMCA 4QCLA 1EY7A 3SXHA 1BDOA 3P1MA 1II3A 1SSOA 2M2LA 3GS2A 1EU3A 2WXIA 3AE2B 2L52A 2DYOA 3VR8B 5F2DA 2LMCA 3P1HA 2RDGA 1QKZA 2L55A 4F8MA 1YNTE 1YMHE 3MJ5A 3IAM1 3TP8A 1LTSD 2N55A 2PW7A 1ZDXA 4IUQA 1WVLA 2F0TA 1VZ6A 5IOCA 5HFYA 1XCTL 3BYYB 2KMMA 2LMCB 3J80E 4L23A 1XO3A 1HZ6A 3N6RA 5EKKA 3SK8A 1FEHA 1TY2A 3U7ZA 3NSWA 4WJWA 1T6BX 4JX1C 2V4IB 1JQ4A 3JAML 1DD2A 5FO8B 4B08A 3URYA 2IT1A 1A6XA 1RTNA 4HROA 3M85A 4KKSA 2JXMB 2J0TD 1E6EB 4ZUIA 3Q8CA 4QMGA 1FNWA 2NUCA 4RNAA 1ZYRC 1BNZA 3AEAB 2IX0A 4BBSB 5JEAJ 2NWGA 1D4BA 3ZJUA 1LACA 2YU9B 2L1AA 1NR4A 2F1MA 3D4RA 1PFNA 2NVTB 3MFGA 3NVVA 2EYJA 1PDQA 2XSCA 1WD0A 2B2UC 1BF4A 4KKIA 3ZQ4A 3HUIA 1N5WA 3AB5A 2LY7A 4KY7A 4N9PA 1PFDA 3TSSA 2WXLA 5EGTA 3J80L 1I4XA 2AQ1B 4MHEA 4KGSA 2B2TC 3VA7A 1DOLA 2ICEC 3MHBA 1EIGA 2M0AA 4A8XC 2WLBA 3SE0A 5ELCA 1QG7A 4RGMA 3S9WA 4A3MB 4TQ1A 4NMZA 3T51B 1PXUA 1XWEA 2HDLA 1JRPA 3KLRA 1D1KA 1TWGB 2JSOA 1XCQL 1V97A 4FF4A 3VR4A 1B9RA 4OO1I 3ZGZA 4N59A 4RFBA 4HMIA 5DEHA 3NTIA 3C1EA 2OT2A 3X3MA 4NKLA 3W3AA 1D1IA 2IGGA 1EWYC 1B2TA 3BK1A 4A3JB 2BS4B 1ENAA 1OFFA 1NUCA 3QG1A 1J7BA 1L6VA 1ZXTA 1TWCB 2QKIC 1Y8PB 1H9JA 4YT0B 4U673 5JPMC 3MFYA 1ZDVA 3DWPA 4ZRPA 4MT5A 1C8CA 4RHSA 1SNDA 2M56B 5I9PA 1MHHE 1V1PA 3ND8A 2KJXA 1A3UA 3HOZB 1B9NA 2JA6B 4IOIE 2EYMA 4ZHPA 1RDPD 1JQYD 2EY5A 2PQEA 3R3OA 5C6AA 4C7ZA 1SJHD 4A9AA 2IGHA 1SAPA 2F0UA 1FO4A 4C3HG 1YJJA 3N52A 3Q6SA 1Z47A 1IUEA 1M4VA 2K3UA 4N58A 4IFDI 1F9QA 4XYQA 2NYZD 3SDZA 2D5DA 2JX5A 4RA8A 5M3MB 4HTHA 4MM3B 1Q1EA 2DN8A 4XDXA 3IT6B 1DZ1A 1BCPF 3RLFA 4PMWA 2W3RA 2ZW1A 2OXPA 4K8IA 2RBMA 2YEPB 2BE5D 3BDOA 1NENB 5IGFA 2Y5CA 4ITKA 4C80A 4LK1C 1GHJA 2B2UA 4OIJA 3LWEA 2SNSA 4HAEA 5A2QL 3PIO3 5JPNC 1FCLA 1FM0D 5FR3A 2FBWB 3DM1A 1GAQB 2GB1A 3NUHB 5IGGA 5KEEA 3ZYYX 1EY4A 3Q24A 4A3KB 3I72A 1TVXA 2NN6I 1BCPD 1JW9D 2WDVB 4FF2A 1MPEA 4QUCA 5G5GA 4G57A 2F0HA 1I4HA 3EJIA 3IFTA 1U9RA 1V8QA 1I4GA 4RAUC 4XQJA 1S5CD 1HUMA 3IAYA 2WNMA 1LV9A 2H1EA 4QB4A 1HA5A 4R8NA 4IN3A 3KK7A 1DCZA 4OGQC 3SR6A 1Q8IA 2EPBA 1ONLA 1PTOB 1QE6A 1U4PA 4A3EB 4TSSA 1ILPA 4KD4A 3MZ5A 1KABA 4BA1I 1BUIC 1BBXC 3HKZB 3T56B 4KKJA 3D31A 3AEGB 1SF0A 1Y56A 2CJOA 1BCPB 1D5ZC 2F0KA 1V1OA 1I3QB 1LTGD 2JYOA 4RKBA 1JE4A 5CORA 4C56C 1E2WA 1R7SA 4J1MA 4HCEA 3HVZA 2EDGA 2D2CC 5LHY1 4FXDA 3AE3B 1QILA 2KACA 5C44B 4B0EA 1W6JA 2WP8J 1C78A 3DWQA 3LXFA 5BMGA 4OZAA 1KLGD 5JJZA 1CI3M 1PZKD 1K51A 1EEID 5E3FA 4S3SA 1IW7C 1RCVD 4KD3A 1HA6A 2IGDA 3HG9A 3NPPA 5BMHA 4OZBA 4HCSA 1B44D 1C4PA 5FLXE 2KQ3A 4DU9A 3R8BA 2BOSA 2FFKB 3SHLA 5T8IA 2F0GA 2EYHA 4CKCA 3OMCA 3AE6B 2FHTA 2JZPA 2OHFA 4ZQ3A 3VR5A 1HXYD 3IT4B 2WXKA 1NI3A 2EJFC 1BO0A 1PRTF 1N5XA 4C3IB 1OXTA 4H2AA 2RPVA 1SYFA 1IGDA 1SNOA 5C3WA 3P4QB 4WAFA 4LMQD 5E1FA 2GRIA 4P6VF 4BWGB 3I8ZA 1C4CA 2YYZA 5KIXA 1GUGA 2AUKA 2QDBA 3KBGA 5CMDA 4RF0A 3CIRB 1EIHA 3S2DB 1EZ6A 2WIIB 1MI2A 3S1MB 2VB3X 5ISRA 3NP8A 3H09A 2PVGC 1SYBA 4H0LC 2RSNA 1K83B 2B63B 2K5QA 3D8GA 4RKLA 1ZPSA 1PZID 2WXNA 2SDFA 1CFMA 3CKIB 3I3CA 4GLSC 2PZUA 4HKQA 3AE8B 2WINB 2FUG1 2DY8A 4X3UA 1CJEA 2E2JB 4AYBB 4JK1C 5EPJA 2E2HB 4GZYC 4CJ1B 2PZWA 2J42A 1AEXA 1D2BA 4KHVA 2HCCA 1VDVA 3BK2A 2VUMB 2K03A 1JOKA 1VR9A 1IYVA 1V1PB 5KNDA 2WXMA 4XIGS 4NJCA 3VQIA 1EOTA 2MH7A 3GO5A 2F0MA 4FXGC 4EQOA 1H9RA 2MP1A 4Q5VA 5FO9B 2PTLA 1MVKA 4XTCS 2FINB 1T5EA 1C79A 1N60A 3GD7A 2K32A 2Y3AA 3P20A 2QIEB 4X3KA 2R92B 1TY0A 4L1BA 4US8A 4HJGE 1JICA 3EFXD 1F9PA 1TS2A 3FILA 1EWCA 1ZKOA 1P7EA 2INNE 3ERQA 1QOAA 1SMYD 4M8AA 4IUNA 3MXUA 3NBIA 4WH4A 1HFGA 2XRSD 4AS1A 4EQNA 1RODA 2ZXRA 1OXVA 4A3GB 3RZDB 2JQRB 3FAHA 2F4IA 1TS4A 1NR2A 5EKLA 4FXKC 1RFKA 3HRDD 4KGRA 3AEFB 1JC7A 2Q8TA 1WRIA 1GUNA 1K8MA 2MJ8A 2JXTA 3QIAA 2BT6A 4RH6A 1X3PA 4REZA 1H9SA 1LTBD 2I38A 4XYOA 1L5PA 4K5WA 2WXFA 3NUCA 3LNNA 1YQ3B 4MN3A 2TSSA 1QNUA 3X3NA 2ACZB 5A35A 1S5ED 2YEPF 4K5XA 3NVYA 4L8JA 2OF1A 3KLSA 3TP7A 1TKGA 4U68A 3L3OC 4DN4M 4NAWB 1STEA 5EBCA 1CHQD 3EUB2 2AWNA 4OVZA 2J7ZA 4H7BA 5ELFA 2F0WA 4WRDA 2WXQA 2WXRA 4BBRB 3SK6A 3AH7A 2XRQD 3A8JE 1SYDA 3R93A 4WIPA 5C4JB 1S5DD 2MGSA 5IGBA 4YTMB 1K50A 1E0ZA 2WU2B 4DXGA 3RFZB 5EE3A 1JWAD 1U4MA 1OXUA 2A68D 2WXPA 3IKJA 3GTJB 3I4MB 1MI0A 2K1BA 1G291 4A3FB 1Y8NB 2K04A 3H6MA 4OIKA 1EY6A 1DM0B 5COYA 4XDDA 1WWTA 3WDNA 4K2KA 3OWEB 3PO3B 3P4RB 3W5VB 4XQQA 1FD7D 1Q90A 1FRRA 4A3IB 3SFEB 2FE8A 3Q8FA 3PUWA 1GHKA 4XE0A 1JWBD 2AWOA 4H13C 1STYA 1QOGA 1SYEA 1CHPD 1Q1BA 1C76A 3SEBA 4TKOB 1EZ8A 3CRKC 1NVID 3TEWA 2BDNA 3S1NB 5TSSA 2VXWA 2E75C 1J9OA 3J81L 2KUMA 1A3TA 1GUWA 4IZ8A 2WKCA 2INPE 1XLOA 1QT9A 3MHZA 1AFPA 3GTQB 4ZOHC 1DOYA 2QSDA 1PDXA 1EYAA 4USAA 2QJLA 1QCBD 2V3PA 1I4RA 3P7JA 2Y0SB 3BDCA 5J1ZA 3OIPA 5EPLA 2B2WC 1ESFA 1DOXA 4EGVA 2N0SB 1YQ4B 5FKAC 4N9TA 1YNJD 1HQMC 1WYGA 2EELA 5M5WB 5NUCA 3HOXB 4ULLA 5C2TB 1SSNA 4HRSA 1EQVA 5I9OA 3U52E 3G7LA 4XT3B 1L4ZB 2CW0D 4GDKB 3CRLC 5C0XI 3A56A 3U9SA 4DAYA 5JVG3 4UDUC 3ND9A 4IUVA 3LX0A 2EY6A 3V96A 1HFNA 4A55A 2X6GA 3NVZA 2Z4IA 1TWHB 3QJYA 3TP5A 1T5XD 4DXFA 2SEBD 4G4KA 3MTSA 4HKZE 1QJOA 4JWSC 3DXJC 2KOLA 5EPKA 1EU4A 4KX6B 1PFMA 2DLBA 5E4WC 3D4WA 1UEAB 3FC4A 1FNUA 1L4DB 3TZDA 1H9SB 4P2CB 2EY2A 4WQMA 1HZ5A 2XIWA 3QWNA 1B1ZA 4EVOA 3I91A 3NXWA 1WTQA 2LFIA 4C3JG 1VLBA 4IUTA 1DJRD 2NN6H 1DGJA 3GB1A 2H89B 1YNJC 2A73B 5EKIA 4C3HB 2K33A 4Y7NB 5C5MA 1UGJA 5MPOA 1OXXK 1JWSD 4C3JB 2E2IB 3SR1A 3V05A 3DHQA 3W9CB 5T1GA 3EROA 4HEDA 1YN3A 4GDLB 1DOKA 4ODGA 4IKGA 1RD9D 1TT2A 4C2MB 3BYTB 5D3IB 5I4DA 1HUNA 3AE5B 1FXAA 2FMMA 4ME5A 3VYTA 5KYLA 4G7OC 1JMLA 3ZJTA 2MJEA 3BWUD 5BYRA 1AN8A 3AV8A 4K6DA 5EBDA 1TYGB 2MEKA 4KJOA 1LT5D 1PRTC 4J6HA 1L0YB 5CBEE 4TQUS 1TU2B 2MHVA 4OO1G 1RKNA 3MEHA 2LHDA 5H92C 2PLPA 4RGOS 2K0PA 2EKIA 1QNKA 5KNBA 4FNFA 4XWWA 3PV0A 2C5CA 4FXCA 2RVLA 2B2YC 1LT4D 3T16A 2NTSA 1NCVA 4IDIA 2BE5C 3M7GA 2BDOA 5KGUA 2NB0A 3SFDB 4PQXA 3A55A 3I9V1 3BVZA 4YXDB 2ZXPA 4KY5A 3LYYA 2I2YA 2KVMA 3A7LA 1O80A 3BZDB 1STNA 4YSZB 1Q10A 2RKSA 2R3ZA 3VYRA 2A69D 1UUPA 2XWBB 3HEJA 1K53A 5CV5A 3T3OA 4OL7A 2BCOA 4ZAIA 1F2RI 4LJZC 4X3SA 1KNAA 1QF6A 2A6EC 1EYCA 3PO0A 1DOIA 2EJMA 2B2TA 5G3LD 4DK1A 3PMFA 1QOFA 5JXVA 3QO2A 1I7HA 4H44C 4IURA 5A2QE 3I73A 1F2MA 4CGYB 1VMPA 3TN2A 3VYUA 4DAVA 2PMZB 2Q5WD 2E76C 1DXMA 3MAQA 1R4QB 5IGDA 4FP5D 3TMEA 3HOVB 1CA6A 3P75A 3DWGC 2E6XA 3T13A 2A68C 1J8IA 4ZKBB 1TKWB 4MIUA 2LGIA 3WOEA 5CV4A 2JA8B 2DNEA 4YSYB 4I7ZC 3OW7A 5C3JB 1JOQA 4EE2A 1RHPA 2LJIA 3TEYA 1EY9A 4E6IA 3G6JB 2EY1A 2LS01 1RTOA 1F9SA 2EYPA 5CBAE 1WCMB 3ZJVA 1R9TB 1PRTD 5C0XH 2G9HD 1SIJA 2K22A 4NW2A 4ZK9B 1N62A 3TUOA 3J9CA 2JEBI 1ENFA 4CBVA 3S14B 1GUSA 3E0JA 5EQ0A 2CU3A 2F0JA 2EYFA 3J7AF 4N6EB 2RSOA 4DGZA 3MXPA 1PMRA 3VRBB 4K5VA 2AQ3B 2JSVX 3RPFC 4YIJA 3TEXA 4K14A 4CJ2C 2FMCA 1B50A 5EE1A 1NEKB 2DWQA 1GUOA 1AW7A 2NTTA 2PO4A 1MD2D 2CVRA 2PW5A 5I6WA 1EYDA 1YNND 1Z6HA 3PZ7A 2F0VA 4WWMA 1ILQA 5D14A 1KF6B 2GI9A 3KQ4A 2B8GA 1G2SA 2EVBA 1WSPA 5C4XB 1V43A 3K5NA 1PTOC 3BS1A 1NSNS 2IPKD 3KF8A 2WP9B 1LTRD 3L7ZC 1JOOA 1SFOB 2PNRC 5JEAG 1KH0A 5I6YA 1WXQA 5D3DA 4ARCA 1JR0D 1O7LA 2NVXB 1HEZE 4FO2A 3TP6A 2BBCA 1QB5D 3FMCA 3J7AV 2K5PA 3S1QB 2F0OA 1NYQA 1ZXHA 4UAIA 4C1NK 1XYIA 2WAQB 4F7XA 1HPCA 3E9SA 1OQQA 3K5LA 1ML0D 2ENBA 3NWTA 1Y1VB 4RHRA 2XNAC 5CGKA 3ETRA 2BS2B 1AP0A 1IKLA 3K59A 1PGAA 5EE9A 3UI3A 1FNVA 1F2ZA 1FYCA 2KCNA 1PFBA 3FKIB 3OMGA 3C46A 3WOFA 2AX5A 4J3OD 4DAPA 1CA5A 3HOUB 2K05A 2E3TA 2PCFB