1TS4A

Q139k mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTKIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 53
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts4A01
1PTOD 1B1ZA 1D5ZC 1D6EC 1TS5A 4NZLB 1PRTD 1CT1D 2RDGA 1CHPD 3DWPA 2ICIA 4BWGB 1RCVD 1PRTB 2R61A 1CQVA 3CHBD 2QILA 3O13A 1I4RA 2G9HD 1YN5A 5ELBA 2IPKD 4RGOS 1BCPF 1STEA 2NTTA 1HQRD 1TS3A 5FKAC 4RHSA 1I4GA 3R2TA 3W2DA 5I4DA 1G8ZD 1DJRD 2WV6D 1DYQA 1SE3A 1HXYD 1JR0D 1BXTA 1SE2A 3URYA 5D3DA 2AQ1B 4DXFA 3V05A 1EEFD 1LT4D 1LTSD 1PTOB 4TSSA 4L6TB 1UNSA 1RD9D 1PTOF 1FNWA 1PRTF 5FK9C 2RDHA 3DWAA 1YN3A 4ZYSA 1CHQD 4RHRA 1JWMD 4UDUC 1JCKB 3MFGA 4C56C 1LTAD 3EA6A 5ELCA 1KTKA 3BVZA 3BVGA 3BYTB 4RGMA 1SJHD 1EEID 2AQ3B 1LTID 1SEBD 1AW7A 2XRQD 1S5DD 1PZJD 1SJED 1LLRD 3MC0B 1PTOH 5ELDA 1RDPD 4RH6A 2Z8LA 1CK1A 2XRSD 3KLSX 1BCPC 1S5FD 1ESFA 1LT3D 1HA5A 1LTRD 2J4XA 1FNUA 1SBBB 1V1PB 2QEJC 1PYWD 4RGTA 1S5CD 1L0XB 1LO5D 1TY2A 1AN8A 4L63B 3R8BA 5ELFA 1PZID 2TSSA 3SEBA 1ET6A 1I4XA 1JWUD 1GOZA 3R2IA 1KLUD 1FNVA 1T5XD 3BZDB 1I4HA 4RCOA 1KLGD 2O2LD 1I4QA 1TS4A 4RFBA 1SE4A 5TSSA 1FGBD 1SXTA 2XNAC 1M4VA 2CHBD 1PRTC 1EU3A 1S5ED 1UUPA 4DXGA 1I4PA 1L0YB 1TY0A 1B44D 1S5BD 2SEBD 4OHJA 1ENFA 4Z9CB 1BCPD 1EWCA 1JWSD 1BCPB 1TS2A 3EFXD 5D3IB 5ELEA 1LTTD 4RGNA 2XN9C 3BYYB 1LT5D 1F77A 1EU4A 3BVMA 1LT6D 3OWEB 1LTBD 1QILA 2AQ2B 1D5XC 1ET9A 2NTSA 1YN4A 1EFID 1XXGA 2IJ0A 1MD2D 1PZKD 1XTCD 1RF2D 4K6LA 1HTLD 1D5MC 3DWQA 3GP7A 1FD7D 1LTGD 1V1PA 4O1NA 3TSSA 1V1OA 1PTOC 1JQYD
chains in the Genus database with same CATH superfamily
1PTOD 1WCMH 1N34Q 4NZLB 1CHPD 4K1RB 1CKNA 3DWPA 4TUUA 4JI6Q 3J7A5 3K7AB 3TZDA 2A6ED 2GBRA 2K1FA 4C3HH 1K8OA 1VRAB 1XCQL 4MH0E 4JGHB 3NRZA 2Z4HA 3T4AC 1K83B 1X1MA 2KCNA 1QOBA 3QARA 4RHSA 1NBWA 4Q5VA 4P74A 1G6PA 3WOFA 1VQPA 4LF7Q 1DJRD 2Z6KA 3X3MA 2DN8A 3Q6BA 1AARA 2VB2X 1E9MA 3SGIA 1Y1WG 4ZHPA 4ZRJA 3PPAA 4BKSA 3KBGA 2MP2B 4GLXA 3FC4A 3P20A 1MI2A 1XNRL 4IALA 2X38A 3PO0A 4K0KL 4RKLA 1ML0D 4DK3C 1IW7D 3H3VI 1FFVA 2KJ6A 1E22A 3GTGH 3NOBA 1XLOA 3NHHA 1D7QA 3P4RB 1ROEA 4K6DA 4OZCA 3PV0A 4A3FB 2NB0A 3DUZA 3S14B 2H89B 3GTQB 2QHOA 4DHJD 2K4KA 2RKSA 4CJ2C 5C3EH 2R7ZH 2E5LL 4IFDI 1SFOH 3PGEA 4TKNA 4OO1H 2LGDA 4WAFA 1R9TB 2LGIA 4FJZA 4JI0Q 1KOTA 2Z9HA 1XO3A 4R4CA 2EJMA 3HUIA 4KSLC 1RTNA 4QGUA 2Z8LA 2KMCA 2DNEA 2IGGA 2XIWA 1NYRA 2JXTA 2KDMA 4MGIE 1HA5A 1WX7A 2KXJA 4QIWE 1UH6A 5EKIA 2I1KA 4NPSA 4GOCA 1S5CD 3CPFA 1YQ4B 1H9MA 2Y0SB 4LCDE 3RN9C 3N30A 1HE8A 1PDXA 4EOYA 2DJFC 3K5MA 1Q8IA 1G6ZA 1TKEA 3TUOA 1K28A 4R9WA 1I94L 2LWPA 3Q2AC 2IL8A 2EZVA 3U8ZA 5C4JB 1XMOL 4HROA 2MP2A 3LWEA 1A3TA 3PUWA 4GNXA 3S1NH 4BAXA 4GNXC 4GKKQ 1V5TA 1QVGA 1JOQA 1LFDA 1EQRA 3L16A 5EBCA 2VQFQ 4OZBA 2FJ2A 1M94A 3QAQA 4IUUA 2PI2E 1L1OB 1WGRA 3J80E 3ULPA 5BYQA 3GTPH 2WAQB 3UI3A 4XQNA 2AWTA 3H8HA 1TIID 1ZYRC 1G51A 3SE0A 3T1YL 2OTJA 2NWGA 4X6AH 3N9YC 1WM2A 4OHJA 2K01A 1BCPD 2PW7A 1IBKQ 5H8YE 5KNDA 2EMTA 2OQ0A 1Y8RC 4YSXB 3AYHB 1BUVT 2FXQA 1LTTD 4IWOA 1AWDA 2C5CA 2HQEA 2Y0SG 3S1QB 4G7OC 2A4ZA 3ITPA 3RYTA 1Q8KA 1UE5A 1Q82C 3KW5B 4LTUA 4ICUA 4N9F4 3J81L 4Q2JA 2RHSB 4JI5L 3IG3A 1I35A 1HZBA 4OIKA 4WFN3 3ULLA 1NAPA 2NN6H 3HFZB 1YJ1A 3VR6A 3W1SA 4A93B 2AWNA 4ID6A 3S2HB 1Z5SB 5LMUQ 1HRJA 2EE1A 3AH7A 2EMSA 3B2FA 3L17A 3MEFA 2PCFB 4HPMB 2L55A 4J15A 4DR6Q 2WDTB 1C4QA 4GOPB 3SK5A 5LHY1 5FJ8G 5T1GA 1PH6A 1V81A 1D6EC 3HGBA 4JC0A 1WXAA 2Y5PA 5IKCM 1VQ7A 1T0RC 3BU2A 2QDFA 1DOMA 1HTPA 2LI5A 4CKCA 2L0TA 1F0ZA 4R4TA 3AE8B 1VQEA 3HOYH 4A3EB 4RM8A 3O13A 3K58A 3CIRB 3OTOL 3BK1A 1VCIA 2IPKD 4A3GG 1WVLA 4ZQ3A 4NJCA 1YQ3B 2C5LC 2CHWA 4LF5Q 4ZRIA 5MPOA 3B1LX 1DOXA 2WXHA 4BVUC 1E10A 5E6OA 5IIFA 2LVPA 2UXCL 2WX1A 3EECA 3AE3B 4JWUC 2MP1A 3TP7A 2KMMA 4WIPA 4C3IH 4TQ0A 2NYZD 4A93G 5KEEA 4BY1H 3VVWB 2K5QA 4HLEA 1STGA 2I5MX 3ZTDA 1SE2A 5D2MB 5DLQE 5G5HA 3NZUA 1TWGB 2KX3A 2G3QB 2CCZA 4JI4Q 4N6EB 2QEXA 2X6LA 2HDLA 2EVBA 4AJYB 5C5MA 1V9JA 4TSSA 4V0BA 4DV2L 3J81c 3HHMA 1X3PA 3D6CA 4KDLB 1WTQA 3HOXB 1GXDC 2BQQA 3DHIC 2TMPA 4A3EG 4IWQA 4K5WA 5C2TB 2JSOA 2WU5B 4J8QA 5FO7B 4LNOA 1E6EB 3DMUA 4RHRA 4HRSA 1YIWA 4R3DA 1JWMD 3ABVB 2XWBB 3L0OA 1WOCA 3GV6A 4IFDG 1C78A 4ITKA 2FUG1 1SYCA 4RGMA 3ZRCA 2XRQD 4E6IA 1C4PA 3DBSA 1TGZB 3C46A 5AFWA 5IOCA 2WXRA 5CBEE 1MKHA 4B9WA 2B2UA 4CKEA 3ZJUA 3ECIA 3RLNA 1ZDVA 1LT3D 1Z47A 4KIKA 4JYAQ 3TP6A 2NVYB 5C3WA 4MTNA 2OJRA 3IAS1 1VQNA 1ZUD2 4NKLA 2R93H 4IJHA 2BB6A 2Q5WD 1UEAB 2C7HA 2F0JA 4W9JA 4HMIA 4DAPA 4L5RC 4JX1C 1H9SA 3FEWX 2KTRB 1GUSA 2NVXB 4FJVB 2F0GA 2VL6A 3W5OA 2FBWB 3QCAA 4NXNL 4DNIA 3CAMA 3CC7A 2I5HA 2BBCA 3DHGC 5C5LA 2LZ6A 5T8IA 1SE4A 4JBKA 1PH4A 1JOOA 2WXPA 3A0JA 4JCVE 3H91A 1PRTC 1KHIA 2BWFA 1YX6B 3P7JA 3E56A 3ENEA 2AUJD 1ZOYB 1L0YB 2J42A 4BZAA 5IY0A 3EC8A 5BYRA 3KQ4A 3M3YB 1Y1VB 1Q81C 4DV5Q 1B9MA 4OWTB 2RGFA 3UGBB 3MEHA 1Q7YC 1FJGL 3TS0A 2B63H 2NMQA 2KENA 2Z59B 3GTJH 3TN2A 1MHWC 2D3AA 2VZKB 4DR7L 4K5XA 2L52A 3Q69A 1STNA 2WDRB 1A62A 3MJWA 2L7RA 1PZKD 4BKTA 2N9LA 5KHOA 2JPHA 4H44C 3TMPB 2OCEA 2GOWA 2E3TA 1QUQB 3M63B 1X3FA 4C3JH 4KKSA 5BN3A 3NVZA 4USAA 4AQ7A 3A7LA 3A1QB 2WU2B 2V0GA 5IGCA 3PMFA 4HR7B 1EO6A 3I70A 1EIGA 1VQ4A 3I3CA 4IQZA 4WRDA 1JMCA 1Y1VG 1GHKA 2OEDA 4JLCA 4IJLA 1IUEA 2RPVA 2ZNVB 4BBNF 3I4OA 2A69C 4JWSC 1PFBA 4JPBW 2WP9B 1K8AC 4FHKA 3NY5A 2V3NA 3BIID 1HNXL 1STAA 2VS1A 2VH2A 1W6JA 2IT1A 3PHWB 2VRRB 3CRKC 5BR8L 4FN2A 3JAML 1WJ4A 4OO1I 2IW3A 4W9CA 5GAHC 3BDCA 3VYSA 4FXCA 2H4OA 2UYZB 2YYZA 2ZPYA 4ZRPA 4U68A 4WJOA 4EZKA 3VAWA 3F1ZA 2E6XA 1C0AA 3CMMB 1I7HA 4KTAA 1PTOB 3NS8A 1L6VA 1F9JA 1SNQA 4UP8A 4JQWC 1XCTL 2QC8A 4P73A 4WQMA 4APVA 3J7YW 5J22A 4ZAIA 1KM7A 4CDDC 4CDEC 4YSYB 1L5PA 5H1SE 1IYFA 1JCKB 2KC1A 2RDBC 3EA6A 1VQLA 3RUIB 1B9RA 3PRMB 2JVCA 1HEZE 2CS4A 4A3JB 2K75A 4XDCA 5ELDA 1UGJA 3I8ZA 2D3CA 2DX5B 4M1UB 5FLMG 2AWOA 1YVCA 2E2HH 2KT7A 1KAWA 2PMZE 1J8CA 1WZ0A 2KWVB 1N33L 1S72A 3CF6E 2NBVB 1SYGA 1V8CA 2LFNA 3I4NB 3CQZB 2KJRA 1IBMQ 3KLSA 3QHTA 1QNKA 2VUMB 4OVZA 3O65B 3QIAA 3G6JB 5DM63 3VA7A 3ONAB 1LGRA 1MG8A 2BVCA 2K9XA 4AP4C 4LUVA 3S2DH 2EQSA 1WD1A 1PVOA 4RNAA 1WRIA 2OF1A 4C3HB 3JAMc 2O6VD 1N36L 5LXIB 3VDYA 1T5XD 1E7UA 3E0JA 4JI2Q 3H1UA 4K81A 5C4HA 3T1HL 4JI8L 1R4MI 2N9KA 2WXQA 2K5DA 2ENBA 1ASZA 5KNCA 4L2YA 3PV1A 4GLSC 1XYIA 1XTDA 2MWSB 2KDEB 3Q8AA 3U7DA 2NVQH 4A3JG 2L12A 3N52A 3J81E 2VW9A 3IFWB 4K2LA 4PYUA 2L15A 3DBRB 1PV4A 1HZCA 4XYOA 3S15B 2UXDQ 2A6EC 1VQCA 1JWSD 4FF3A 3PLVA 2L9HA 3E0EA 3IFTA 5G55A 2KK8A 5CHWA 2KJXA 4KD3A 3OSOA 4HCEA 1BMLC 4DHZE 2VUMG 2HD5B 3JSVB 4O42A 4DA2A 4KDIC 1S3OA 1IYUA 4DK6C 1JB3A 1VQOA 1HFNA 2UXBL 4BXXH 4LF9L 1BBXC 4AIMA 1WXMA 1VQHA 4YCVA 1A63A 2FMCA 4C3HG 5LMNQ 1B2TA 4R4OA 2NBUA 4R8IA 3AULA 1X6OA 2JXXA 4JV5L 2B8GA 2RCFA 5DNFA 4KY6A 2DWQA 1FMAD 4GN5A 3WDNA 3A9KA 1JALA 1OXUA 3QOJA 5DPRA 2REXA 3AE6B 3RZOB 5D7GA 2WXNA 1U4MA 2RDGA 1IW7C 1DM0B 4BWGB 4KD4A 2PPHA 2R61A 4A20A 3EVQA 3A8KE 3F2CA 4GDLB 4RCNA 3VR3A 3LJ3A 2WLBA 3IXSA 2NTTA 5IAAC 2D5DA 1IL2A 1QOAA 1KNEA 1TBEA 3LXFA 4MGKE 3CKIB 3C0RB 2FCMA 2G45B 1JROA 3HS0C 1IGDA 1DYQA 2WXMA 2R7ZG 3S1NB 1NR4A 4XX5A 4JW0A 4FA6A 3T8MA 5JAVA 3X23A 4B9XA 1N8RC 1HUMA 3IHPC 2W55A 1GC6A 1J5EL 1TJEA 2KN4A 3FILB 2HIXA 3RZDB 1N6ZA 1WXVA 3LB8C 1VS0A 2YEPF 2N3SA 1IP9A 2NPTB 2KWDA 3HP3A 2UU9L 1Q90A 3EUB2 4P2CB 3HOUH 4DR4L 3GDEA 2JA8B 1ASYA 1WMHB 3UIPB 2M2LA 4DUYQ 4HIKA 2LUMA 1OEYJ 2CU1A 1TWAH 4JBMA 1X3GA 1IGCA 3M62B 3L13A 4RH6A 4KHZA 2B3GA 4H13C 1BCPC 5CV9A 1WTRA 3PSIA 1TZ1A 1VDVA 5LMNW 2G9DA 1Q5WB 3HM3A 3QK0A 1LTRD 2M0XA 1QQRA 2R92B 3AECB 4ARIA 3AN1A 1JJCB 3PRPB 4LJPB 1NBFC 1FVIA 4P7IA 2BKRB 2PW9A 2KO3A 1U4RA 1A5RA 1PFNA 1I4XA 4TV3A 4CHTB 4GKJQ 1J7CA 1UBQA 2KYWA 3R2IA 1WD0A 2F4VQ 2JA8G 3WA0A 1DOLA 5J18A 4DR1Q 5IYDH 1SR3A 4X3UA 2N0SB 4CDFC 1YNXA 2H5XA 3U52E 2NN6G 3H09A 1WY8A 3FILA 5C44B 5AZGA 4LWCA 3GTOH 4DXAB 3PF5A 3A9JB 4DKAC 2NPTA 3MAQA 4HEA1 4GU2A 4OVUA 1WH3A 2PMZB 1HZAA 3NVVA 4A3CG 1UBIA 1E8YA 1WMHA 1YJIA 3GS2A 5HFYA 3HOVB 5ELEA 2R92G 2CWPA 2V3PA 2VZAA 2ZW0A 3RCZA 1FXIA 2K05A 2A19A 2RD0A 4NPNA 4IO9A 1DOIA 1OGWA 2JYEA 2WYQA 3DBLI 4XZ4A 2MHJA 1CZPA 5G3LF 1U0LA 1F2YA 1GVPA 3B2GA 1K8GA 3AFPA 5DM73 3R3OA 3DWQA 3AFQA 3MC9A 5M5YH 1EL0A 4FXKC 4KJOA 2F0FA 1D8LA 1FYCA 1MJCA 4UAIA 1BQQT 2RSOA 5K36H 4LNIA 3VUYA 5EDSA 1B1ZA 4C3IG 5C44G 1HNZL 2JQRB 3H0GB 4BY1G 1HNWQ 5LLIA 4C2MH 1R4NI 1Q1BA 4HPPA 3VRBB 2OXPA 5L95C 2E75C 2Q2TA 1K3RA 3JAME 1EZ8A 1Q12A 3HOWH 1KDBA 3UE1A 3STBD 1MGSA 3RULA 4PS8A 2R93B 4C4VB 4RGOS 4DAMA 4I7ZC 1CZWA 2V4IB 2ATWA 4KY7A 2UUCL 5D94A 5JHAA 1A6XA 1FPYA 1KDCA 3A9JA 2K5PA 1FCCC 5JVH3 4C1NI 4PNYA 2WV6D 1PGXA 2WFWA 3QJZA 3ERSX 1WYWB 4MACA 1VQ8A 1V1QA 4XXEA 2M00A 3K8AA 5C6AA 1Z6HA 3NBIA 3NXWA 1IL8A 4BA1I 5FOBB 4S17A 4K14A 3H0GG 5FLXL 2LXCA 1OXVA 4IN3A 2JA6B 3LDZE 4FYDA 1VQFA 1VQJA 1UNSA 4JI7Q 2KKCA 4HJAA 4DV6L 2HCCA 2MLBA 4A3KB 4LF8Q 1TWFB 2WNMA 1E2VA 1JW9D 1NVID 2R93G 1CHQD 1N63A 4OX9L 2NCNA 4KZ0A 3EIVA 3BVGA 3BYTB 1OEYA 1PFDA 3CCEA 1LABA 4ASWC 4DV4Q 4G11A 4DR5Q 1NDDA 3OIQA 4IUVA 3I56A 1G291 2CU3A 3SFDB 5C4ZA 3A7AB 4JI3L 2LHEA 1WGYA 4E71A 1VQIA 2QA4A 4B3RQ 3W5VB 4MT5A 3DLLA 2JA6G 2EY1A 1L0XB 1UZXB 2LXJA 2F0LA 1WX9A 3M9BA 4BBSH 3AE7B 3DBHI 3AMZA 4TQ1A 2GBNA 5DPWA 1JE4A 3A33B 1UWXA 4A3KG 2K03A 3S1MB 2F0WA 1YJWA 4QJFA 1YBYA 2HQLA 1WGDA 2LVQA 1BVSA 2A74C 4ABNA 3MJ5A 2Z6BA 2Q8TA 2KWCA 1PUTA 4X66Q 4YSZB 3I4MH 2KTFA 3FVQA 5JJIA 5FLXc 5JJKA 3PQIA 5LXHA 1SNMA 4EFOA 3W3AA 2D0OA 4G7HC 1UUPA 1E7PB 4L1BA 1TY0A 3K5NA 3MFYA 1WI0A 3NHEB 2JA7H 1P98A 3GTKH 2KCMA 1A2TA 1AE2A 2JRIB 2BYTA 2F52A 5ELNA 1OXSC 3IRBA 1L4ZB 4YWGG 1JQ4A 3T13A 2JA5H 1LT5D 2MQJA 3D4RA 3BVMA 3F2BA 1NR2A 2PVOD 3KYDD 4LNKA 1IBLQ 4NQLB 4AQYQ 2CWAA 4ANUA 2K8BA 1UWMA 2FFKB 2QDBA 3ZTCA 4LFCL 1YJNA 4ME3A 2WIIB 4K6LA 1F2ZA 2KZRA 2O6VB 4M8NA 1I50H 4WJNA 4C7YA 1MSGA 3M4PA 2HHHQ 2F3VA 1KNAA 3B0AA 2UWQA 1GUNA 3CC2A 3J9CA 3PIOA 4A3LG 5EPKA 4B08A 1SRUA 2C9WB 3CC4A 2IY0B 4L5TA 4AJWA 3NWTA 1HZ9A 5CYUA 2WINB 2N1VA 4LJOB 1PMRA 3OJ3A 2PEAA 3U9OA 3K57A 1EY4A 1EQQA 5ELBA 4WJQA 3QA8A 1QCBD 1QLBB 1NEKB 4LFAL 4IM2A 1FD6A 2BS3B 3EN2A 2D2QA 3AEEB 1I4GA 3U9SA 4ODGA 4FDBA 2WKDA 3PO3H 2YTVA 3FDTA 1WE7A 4MHEA 1KLVA 1J19A 1YX5B 1STBA 4W9FA 3URYA 3L08A 1WFYA 4IM3A 3HG9A 3HVDA 3Q3NC 3SHLA 1EIHA 4GIVA 2PYKA 1N34L 4CGYB 4HCNB 2NVQB 3HKZB 1LT4D 5L37A 1VQBA 4TKOB 1BBWA 3L3OC 3M85A 4JI6L 1JJGA 1GJZA 5E6PA 1NMFA 4PYZA 1SNDA 3WAOA 5EJWA 4DV0Q 4CQNA 2O6VA 2WXIA 1FRRA 3SXHA 2LFIA 4FNFA 4W9GA 2HCIA 4G57A 2EJGC 4C56C 2IO0B 1LTAD 2F0MA 4KKUA 4C1NK 2FCSA 4LF7L 4MSMB 2E8GA 1K0SA 1AW7A 3K0YA 1SJED 1PZJD 2Z6KC 4DR2Q 1ZW7A 1U4PA 4BA2I 2OQKA 1TWCB 2WWZA 4FBJB 2XRSD 1M90C 4IPHA 4WWPA 1LXDA 3Q3MC 3R93A 1XMQQ 3PIO3 2L1AA 2MJ3A 3QC8B 1I6HH 4HIDA 1EWYC 3GTLH 4RGTA 3HKZG 4JVZA 5AUIA 3BWUD 1WJJA 5C4XB 2XVSA 4ICVA 2Z4IA 1PZID 3H7SA 3SEBA 1MHXA 4DK1A 2NVUI 2KC2A 1C3TA 1QB5D 2KOLA 4OVVA 1DZ1A 1P3QU 1J8IA 2F0NA 4CJ1B 2AMCB 2LMCB 2BYEA 4ZRKA 3PF4A 1LV9A 1E8XA 4DV3Q 3VUWA 3ZGZA 1X3QA 3K5LA 4ZHOA 3S16H 2ZVNA 2MGSA 3AI5A 1AE3A 2MSED 4HIOA 2VNUD 3DWGC 4ZRQA 4KSKC 2E2JB 1SE9A 3TEZA 4IFDJ 1N32Q 2M17A 4KV6A 4TQUS 3S1RH 2BTEA 5M3MH 3PGZA 3A8JE 5C4XG 2DZKA 3UQBA 3HOZH 4Y7NB 2KN5A 3GZNB 1X3EA 2WP8J 5CMDA 4MDKE 2EY2A 1SSNA 1F2MA 3M4OB 2MW5A 4GKKL 2N9PC 3KYHC 2VQFL 2LXAA 2KVMA 4IOIE 2BYFA 2ZJPA 2YTYA 1VQ9A 1U4AA 5C23A 4BBRH 2KAJA 2PMVA 1JQYD 1KFYB 2J7QB 1YITA 4WJ3M 5H92C 1LM0A 4OZAA 3CD6A 2KEDA 5M9OA 2NVTH 4EZLA 3JW0X 1IBKL 3ALBA 2ICIA 3CU7A 2F0TA 1RCVD 3VDZA 4AYBE 2QGQA 2UUAQ 1MVKA 4KGRA 2G9HD 1SYEA 3UI2A 3IAYA 2LMCA 1DONA 2LVOA 4EUTA 4QUCA 4A3GB 3ML8A 1D4BA 1TWHH 2DZJA 3RLFA 2IZVB 1PDQA 4J6HA 3ZYYX 3WANA 3F8TA 1XWEA 4QUFA 3TCAA 1VQ5A 5LMUL 3Q3JA 3EBEA 1VMCA 3TL5A 3AE1B 3W1SC 3C3LA 4DR6L 3NG0A 1L2FA 1XLNA 4RG1A 2FUHB 2MCNB 4FADA 1C76A 1KJTA 2VY3A 1QZGA 1TT2A 1TKGA 1TKYA 2QMTA 4I6NB 1S40A 3OIPA 1ZEQX 2ALYB 4R4IA 4HDOA 2KVRA 4B0MA 5I9OA 1STHA 2Q8RE 5C0XH 1F2RC 3CWIA 3GB1A 4OONA 4PV1C 3H6MA 4JI1Q 1YIJA 4POFA 3M95A 3QWZB 3V62A 1D3ZA 4ILWA 1B53A 4F88A 1QJOA 2INDC 4P72A 4LF5L 1VZ8A 4QQBX 1L1OA 1L1OC 4UDUC 4KMUC 1QZEA 2KHWB 3BK2A 3I3TB 2ZTEA 4DAYB 2IYDB 1R4PB 1ENAA 4CHKA 3W1YA 2KJHB 1DOYA 4YT0B 5D65A 1YJJA 1IXRA 1AZQA 1H8CA 1MJEA 2K22A 4JI4L 5IYDG 3D32A 1EF1A 2KBNA 4WH4A 1D1IA 2D9UA 5JVG3 4KK7A 2DYOA 5J2RA 1PYWD 3AB9A 4S0RA 1CFMA 4QY7A 3EROA 3X3NA 3Q3OC 2JWZA 4L63B 1TY2A 1AN8A 2MA9B 4TMAB 4C2MB 3CCRA 1Y69U 1YQBA 2BWES 5GADC 3Q14C 3GO5A 4K8JA 1XT9B 1NCVA 2TSSA 2MO0A 2YVCA 4K7WA 2IDYA 3K9PB 5JPMC 4GOPA 2E2IH 4WQOB 4GOPC 3QJYA 1KLGD 3RLOA 2WXLA 1BO0A 2BOSA 1R7SA 1Z2MA 4HJGE 1WFQA 4RFBA 4UHVA 1L7YA 4US9A 3UF8A 3GTMH 4EQNA 1WM3A 4A90A 3H7PB 5HI1A 1QZHA 1XD3B 3I4LA 1M4VA 2LGSA 2M0AA 4KGTA 3WOEA 1EIFA 4D2KA 3SD5A 1NTGA 3H3VC 1JICA 1X32A 2B2UC 2J7ZA 3C1FA 4JYAL 2AL6A 5BYSA 3VHTC 3MWYW 1GUWA 1JRUA 4BS9A 1SNCA 3PCOB 4N9PA 3STBC 3VA5A 2D10A 5TR5A 4B95A 3TEWA 4FXGC 1FFUA 4IPDA 1X56A 4NDXA 3G48A 2RBMA 4B3TQ 1EOTA 5C3XA 2AL3A 2CQOA 3D31A 4DAYA 2MJEA 5JEAG 2XK5B 1PYSB 2K50A 1E5WA 2MBEA 5ELOA 3DVGX 5CV6A 1I5FA 2NBFA 2EELA 2B2WA 3HOWG 1LQBA 1I3QH 1MD2D 4GN1A 1VD2A 2EY6A 1WXSA 2PVGC 5HG2A 1J7AA 3NP8A 5J39A 1D5MC 2DNCA 5J1ZA 2GB1A 1H9RA 3NSWA 2B2TA 1VF5C 2B2TC 3A56A 1HUNA 3AEFB 3FHWA 1N5XA 3JYUA 2WDQB 4MH8A 4HVBA 5C3JB 5E1FA 3D4WA 1FRDA 3CMEA 3UINB 1JE5A 4QIWB 1C9OA 2PIAA 4WURA 4JL9A 4DV5L 3NPPA 1NENB 4FF2A 4XYCA 4G7ZC 2N7JA 4FXDA 2K5HA 4E74A 4CBVA 5L83A 1T5EA 1WJUA 5M3FH 4BY7H 2BW2A 2QCPX 2GRIA 3H7PA 4B3SQ 2L11A 1O7IA 4A3BH 4YHHQ 2I46A 1U9RA 2GBJA 3B6YA 3FKIB 1G91A 3ZW3A 1DCZA 3NUCA 2OTLA 2GI9A 1JRPA 2ON8A 4FVMA 1BXTA 3NE5B 1E7ZA 5D3DA 4JIOU 3CCMA 2EYJA 5HGQA 5D6JB 1KABA 2UUBL 1XJVA 5JZEB 2NS5A 2D5GA 2D3BA 3KK7A 3OMGA 3W1BA 4DXFA 5CV8A 2AKWB 1RODA 3SDZA 4FP5D 4X62Q 2KQSA 3RT3B 3RNUA 4MNOA 5KRUA 3OLMD 2KHIA 4AYBB 2KTRA 2L00B 3C8YA 1WGHA 1WR6E 4IG7B 3EFUA 1VQGA 3JVZX 3D8GA 2Q2IA 4RWSC 2LJIA 3VR4A 3KUZA 1YN3A 3K6OA 2ZPNA 2F3WA 3V60A 4TRDA 2F4IA 1A15A 2K5VA 1XPRA 4A6QA 1PHJA 4UPAA 3X0WA 3EQLC 4R8NA 3VFKA 2MQHA 1IKLA 3FKIG 2ZTCA 2BB5A 2EPBA 3UDXA 4DR3Q 4KHPQ 3NBHB 4DU9A 3MP9A 1RDPD 5J17A 4DNRB 2KVZA 1PQSA 3I9V1 3C19A 3V61A 1WGKA 2KMAA 3PUYA 4DN4M 2J4XA 5JJZA 4G4KA 3K59A 3OWFA 3JC66 4A3IH 5C1ZA 2INPE 5GROA 2A8VA 2YLMA 4AYBG 2ID0A 1HZ6A 4IURA 5CV4A 4KGSA 3BG3A 4NXMQ 2GBMA 4UP7A 2EOTA 2Z1CA 4FO2A 1RHPA 3BZDB 1RFKA 2FCNA 2PI2A 1QUQA 3KH0A 4CDCC 1XF5L 3VUXA 2ZZPB 2A5HA 1F9SA 3A1QA 1LM8B 1FGBD 4IZ8A 3WWVA 2CJOA 2JY6A 4NQKE 2L5TA 4IUMB 5EE9A 2HJ1A 1SMXA 4MIUA 2RQXA 3IKJA 4LF4Q 1DGJA 2BDOA 2V3SA 2SEBD 1P8LA 2ZNVC 4GGQA 3SK4A 1JC7A 5LNK1 2ZW1A 4HJ5A 1IBML 4RGNA 2XN9C 3AU5A 2EYPA 1WCMB 2I0QA 2DHZA 3MTNB 1C1YB 1PYBA 3D3RA 4EKUA 1HH2P 1Y14B 3S17H 2F0DA 3NBHA 4F7XA 2NBWB 1C79A 1EFID 3PO2H 4JI2L 3AEVA 1GPXA 3VR2A 2IX0A 1HZ5A 2LJ5A 3OW2A 1ICWA 1P0RA 1GUTA 3LNNA 2WXKA 4BFRA 3KWVA 1PTOC 3Q8DA 5IYCG 3A74A 3PT2B 2UXDL 4X64Q 2CW0D 2HTHA 4GN3B 4ZLTF 1CQVA 3CCJA 1QT9A 2BCOA 3AEGB 1PH7A 2ZCBA 1D1KA 4QMGA 2LRUA 2V9HA 4M8MA 2K6DB 1WCMG 2DY8A 1CUKA 3V2TA 2ZM6Q 4DUZQ 5C0XI 2JYOA 1WRDB 3APDA 1Y1WH 1Q0WB 3CSFA 1H4RA 5BMHA 4L5QA 1C7YA 1JWBD 3M4QA 5LMNL 3GTGB 2PLPA 4HN7A 3RNAC 1ZXHA 4YTMB 5IYBH 2J0JA 4N8FA 3J7AV 4P75A 2BGFA 5EE0A 5M5XH 5C3EB 2R7ZB 3ZIMA 5AEKB 1SFOB 3RMHA 3RD4A 2Z0DB 2I2YA 3K7AH 5KHQA 4IKGA 3PUZA 4N9TA 1HQMC 1CM9A 5IE8A 3TS2A 3I2ZA 2M9VA 4L6TB 1K83H 3S16B 4IM0A 3P2BA 4MN3A 5I6WA 3DEPA 5I9PA 3APCA 2K5WA 3T56B 2OOBB 2EYHA 3NQTA 3PZ7A 2RF4A 1EQVA 2P5ZX 2IO3B 3E9SA 4L8JA 5KIXA 3TJPA 3LGJA 1O80A 4R1JA 4YWLA 2EIFA 5KNBA 4DAVA 3VTUA 3NELA 3AEBB 1CQFA 1HHVA 4N58A 1KTKA 2OWOA 3HOZB 2EJFC 3KUCB 4A9AA 4NB3A 4EEWA 2KHSA 4YCWA 1S5DD 4MEMA 3AE9B 2HE7A 5C3EG 3H6NA 1XNQQ 1N5WA 1SIJA 3HIZA 2R3ZA 4OO1G 4HK2A 4LNQA 1CI3M 3I7FA 1F2LA 4HSPA 2IY5B 4NW2A 4LK1C 2WGSA 2WXFA 3V6EB 3JSVA 3T3OA 4LF6Q 1V1PB 4A3FH 1C4CA 2LD9A 3GTPB 3S14H 2R2QA 3GTQH 3NJTA 4FLHA 5BMGA 4OW0A 4JOIA 5EE3A 2KFKB 3RI7C 5BMIA 1EQTA 1R9TH 4XE0A 3R7QA 2OT2A 2B2VA 2RCNA 3OW7A 4J6IA 2B2VC 2PQAB 4PZ6A 4QCLA 3TIXA 3PREA 3TDQA 1IKMA 4DUYL 3Q24A 2V4LA 4UP9A 5CGKA 3T9LA 3RMKC 1T0YA 3ER0A 3KLWA 3HOZG 1R4MB 2FNJB 2G4SA 4DDID 2N8NA 2MBQA 5DPTA 5TSSA 1BUIC 4CO7A 2J52A 3TBIB 1VCBA 4HIMA 4A3MH 2CHBD 2SAKA 4ZDVA 2LSSA 2KX0A 1PFSA 4HJKA 4GDLA 4K7SA 3ND9A 2VQEQ 1TQOA 3BY4B 4KKJA 4GZYC 3EFXD 1WR1A 2GA4B 2KDFB 5C4JH 3KF8B 3ONSA 2INNE 3BYYB 3W1GA 3ZJVA 1L4DB 3IAM1 3IT6B 5LL6S 4OWWB 2WB1E 4IUPA 1YJ9A 4GKJL 1ZE3D 4NJ6A 4A3PA 2F4VL 3HOYB 1HA6A 1EYCA 2A6HD 5FJ8H 2WX0A 1Y8NB 4DR1L 5M5WH 3D4DA 1GB4A 1HTLD 1T3QA 5LL6X 1WE6A 2L83A 1V1PA 4O1NA 2K1BA 4DV7Q 2DBYA 3IFDA 1JT8A 3E5SA 5HY6A 4X65Q 2AEHA 3DVNU 2KFKA 4C3IB 3KVFB 5EKKA 4LNNA 2EXDA 3MVVA 5IWAQ 4BY1B 1QVFA 3AEDB 1TS5A 4A3OA 4K3BA 4URKA 4IPCA 4CYEA 1J7BA 1V6EA 1OO9B 3RNEC 5HKHA 4P1BC 1WTPA 4M0WB 2BDNA 1F52A 2HUGA 1P1AA 2C60A 5BO4B 4C7ZA 3SR6A 3WCQA 2IO1B 3S2AA 4A93H 2K14A 4H2AA 2RDFA 4U673 3KDFB 1HQRD 1IYVA 4KKTA 5FKAC 1X55A 1E3PA 2IO2B 3AM9A 2L0FA 2PTLA 2WACA 1STYA 4F87A 3HOYG 3HZXA 1G8ZD 2Q2HA 5AJ3Q 4ZUIA 4B3MQ 1RM6C 4IUQA 1T6BX 2A5UA 3TEXA 4IPGA 2RSNA 1YI2A 1V97A 5E4XA 3S9WA 2M1MA 3KWLA 2ASBA 5G2NA 3KF8A 5IP4D 4B0EA 1XLQA 3QO2A 3RZFA 1M8AA 3OYYA 4A3EH 4M00A 1N9WA 3IVFA 1HNWL 4NJ7A 1G2TA 4LUZA 2DJGC 2JWUA 3L54A 2JZ3B 4HCSA 3CRLC 1G2SA 1SYBA 2QDLA 2KQ7A 4GSWA 2I38A 2CH4A 1AYFA 5FK9C 1GKHA 4DHZB 3J81j 2KD0A 2AHOB 5JHBA 1NI3A 1AH9A 2PO4A 4RAUC 2N55A 3DQVA 1WGGA 1V86A 1Q1EA 1PGAA 3BJUA 2LEKA 2MBOA 2HIVA 4BBNC 1SSOA 3SVMA 3Q8EA 4IWPA 1WYGA 4DWFA 1X9NA 1KRTA 3HOXH 1B3QA 4KX6B 1MG4A 4IUTA 4JI7L 3CCVA 4XGAB 3K0XA 1LO5D 4LNFA 2JX5A 4HKZE 3U7ZA 4A3DH 3J80L 1OTRB 4MM3B 5ELFA 1RTOA 4LF8L 2VH1A 3QX1A 3V96A 4EQ5A 1JWUD 2UUCQ 5IA7A 2B3AA 4C00A 2N7DA 2B63B 2C35B 1HR0Q 5M3FB 4UY8C 3GTJB 2F0OA 1FEHA 3T16A 3RNFC 1TS4A 1YOVB 2GBKA 4DV4L 3AU4A 4A3BB 4YY3Q 4DR5L 4P6VF 2NVYH 4R4QA 1GHJA 1C9FA 1MJDA 4FULA 1EU3A 1AP0A 3ETRA 5KYLA 2L8JA 1GB1A 1I4PA 2KACA 5IGGA 3Q0AA 3NQIA 2F0HA 2GVBA 4W9KA 4C4VA 1E0ZA 5T1IA 4B3RL 3N1YC 1NNXA 4C3JB 1QVCA 5E4WC 1TS2A 2IBIB 4XWWA 4ZYNA 2C7NB 1YHAA 2NVXH 3TP5A 5HURA 3FPPA 1X54A 3W9CB 1BDOA 1VMPA 1T0QC 3NVYA 4KY5A 1SE8A 2W9NA 4W9DA 1GJXA 3DBLB 1KC8C 5IO9A 2B63G 2EYFA 5M3FG 2BKFA 4QAYA 3FP9A 4HAEA 1IYJB 4EGVA 3E3XA 4W9HA 5JH5C 2JRHA 4J1MA 4A3BG 4LFBQ 4MZ9A 3U4VA 2E2DC 3M3YH 1Y1VH 2IX3A 1V8QA 1PA6A 2R7FA 1K0RA 2HD3A 4PZ7A 4MM3A 3A54A 3UDFA 2CJNA 4LAAA 1TU2B 3J80c 4HJ9A 2DYBA 1MIUA 1R4NB 3DVNV 2SOBA 3GV3A 3CHBD 4C3JG 2IHFA 2Q2UA 2W3SA 1YN5A 1OXXK 1KIXA 1IBLL 1UD7A 1KAAA 4AQYL 3P1MA 2EDGA 2K0PA 3I90A 3IBEA 4MGZE 2WB1B 4IUNA 1VLBA 2VXWA 3I73A 1SGHA 4II3B 4K7UA 2HHHL 1A2UA 4V190 1SE3A 2WAQE 4DV1Q 1OQRA 4GDKB 2G4DB 4KN7C 1EY9A 3MZ5A 2N78A 1HR0W 2IHEA 3GD7A 3FMCA 2N9XA 1F9PA 2RMMA 5EAYA 2YEPB 1Z7TA 3G71A 4MSQB 2I1JA 2E2HB 2L76A 1PRTF 1SYFA 1YHBA 5IGEA 2RDHA 1SN8A 2JUOA 2V4DA 4ZYSA 5AZFA 3L9AX 3ZQ4A 2F0UA 4A3IG 4NAWB 4H0LC 4FF4A 4IC7B 1A3UA 2WB1G 3LWUA 2KDIA 3P63A 2QW7A 5GXGB 3ZXRA 1SAPA 1NYQA 1EY7A 3AEAB 4PQXA 1E24A 3CCUA 2O5IC 1V5OA 3S2DB 1ZP0B 1GUAB 1KRSA 3RNBC 4X3KA 3CP0A 1E90A 4W9EA 1PTOH 2KEEA 5FR3A 1GC7A 2JJQA 5IGFA 2EKEC 2K39A 1GO3E 1CZGA 2H1EA 5ISRA 3CF5A 1K8RB 3I63C 4HWIB 3NTHA 3WALA 3TEYA 3RUZA 1HJPA 1V49A 3G7LA 2N4FA 4YCUA 2PE6B 2EKIA 3V3XA 3RR5A 4DV0L 3DBHB 4JPSA 2W3RA 1WI5A 2DENB 2JF5A 4F1SA 4LFAQ 2K33A 1BKBA 1SNPA 2EYLA 1F2RI 2KLCA 4II2B 4K5VA 4A3JH 1FNVA 2DYMA 2FMMA 1C8CA 1RWSA 1BR9A 1WX8A 3IL8A 1Q10A 2D62A 2CFMA 4DR2L 3WAPA 1SXTA 3PVLA 4NY0A 1UELA 4A75A 3I4NH 3CQZH 5M5XB 5IP9H 2CW0C 1XMQL 2VUMH 2KANA 2BS4B 4Z9CB 2K6QA 1XEEA 2MFIA 2BPSA 3J80i 4NAWA 3IT4B 5IODA 2VB3X 3M3JA 3DDCB 3RD2A 3OWEB 3KFUA 3U30A 5IP7H 5EBDA 3VTWA 4HMJA 3E6ZX 3KLRA 1YN4A 1XXGA 2KHJA 5E3FA 4Y52H 2QJLA 4F7ZA 1RF2D 3UDIA 3GE3C 5GMVA 4JI0L 1B8AA 3PZ8A 3S15H 1WYDA 1FGUA 3PSEB 4EE2A 4DV3L 4BXXG 5CV7A 4GNXB 4IOCA 2ACZB 5IYBG 3AU7A 1FXAA 2JQOA 3P4QB 3ZNHB 5DAUA 4EQPA 1KDAA 2KUMA 5CR3A 1XNRQ 4FJYA 4J3OD 1AFPA 4PZ8A 1OTCA 4K0KQ 5CBAE 2JE6I 1RLFA 1AEXA 1N32L 2H88B 3PUXA 4ULLA 2K25A 2KNBA 1O7YA 1A3VA 1EY6A 4WJPA 1CSPA 4XT1B 2HJ8A 1MBYA 2PNRC 1TS3A 1PH3A 2E5LQ 2CQAA 3ND8A 4PMWA 3W2DA 3A5UA 3M4YA 3ML9A 3PS6A 3E9HA 3HOUB 3RZOH 2E76C 1JWAD 2F0SA 3U58A 1PH9A 1NI2A 2XBBC 2ZCCA 5A35A 1SMYD 2JXMB 4WWNA 3R3MA 3MXNB 4KV2A 3N32A 2AQ1B 2MBBB 3RFZB 1TWAB 2R6GA 1JORA 4A3MB 1EEFD 5JEAJ 3PUVA 1LTSD 3TQYA 1YHQA 2IGHA 4XWTA 2N1WA 1SNOA 2UUAL 1RD9D 4ALPA 5JJLA 1L0VB 3A4RA 1PTOF 3QG1A 3D0FA 2XSCA 1RYJA 3RNGC 4E3CA 4ANXA 2F3IA 5NUCA 4A3FG 2MJ8A 3UDGA 1I94Q 3APFA 1YNJD 1O78A 2NZ1D 3CCLA 4WORA 4DF7A 3ZJYC 1XMOQ 3MFGA 1QOGA 5FLXE 1MPEA 3BS1A 4HXDA 1LTID 3DM1A 5HGTA 3QWNA 1KD1C 3I55A 3HOUG 3MHBA 3L2PA 1QOFA 2F03A 2JU6X 5M5WB 4QL5A 2JN4A 3RZDH 1S5FD 3T1YQ 4DGZA 1V9PA 3N20C 3H9DA 4A3MG 2QIEB 3GTOB 2JA8H 4GN4B 1B4OA 3R8BA 1RAXA 1S3SG 1CSQA 1YEZA 2Y3AA 4W9IA 1ZXTA 4JI1L 1T0SC 3OJ4B 1YNND 1Q86C 4NP5A 2LY7A 3PTFC 2A6HC 4MELA 1ET6A 3VYRA 1Y56A 4JI5Q 2ZVOA 2NR2A 2K32A 4HJ8A 1IPGA 4X3TA 1QF6A 3MXNA 2RSUA 4WWOA 1J9OA 2ZXPA 2IWHA 3T53B 1I4QA 1VQAA 1UF0A 2ZJDA 1DD2A 2DNFA 1ZPSA 3U2SC 4KI0A 4A3CH 3B9JA 1KQSA 2R92H 3HRDD 4KVGB 2WAQG 1W3SA 1B50A 3WIMA 3ZDMC 1DGSA 2C9OA 4DXGA 2B76B 3LYYA 1C77A 2HDEA 3UE0A 2INCC 1B44D 5BN4A 3P4SB 4WWMA 1VF7A 5M5YB 2FHTA 1NSNS 2B29A 1ISNA 2PZWA 5E6JA 1E0BA 2EXZA 3NEMA 2NZOA 2ZXRA 1FR3A 4KIKB 3NUHB 2CKZB 2K52A 4ME5A 3E9IA 3NZSA 3ZNZB 3OTOQ 1LT6D 2F0KA 3VYUA 1B70B 4WJWA 2LGYA 1MI0A 2WXOA 1D5XC 3HOWB 1E1TA 2M56B 2CH4W 2UXCQ 3VQIA 5C44H 1ENCA 1TKWB 4ZKBB 4POGA 1QG7A 1H9SB 2ZXOA 2FIDA 2RVLA 3A5ZB 3NENA 3P1HA 3CPWA 2A73B 3TSSA 3ULJA 1TZOA 2Q8IB 1H9JA 2JYTA 2EYMA 1CMXB 1GM5A 3HOVH 3UQAA 5D14A 3HRZC 1CT1D 4QB4A 1HTQA 1PRTB 2ZTDA 4DV2Q 4AOFA 1QWYA 5EPJA 4EVOA 1P7EA 5K36G 2QILA 2LRWA 1O7ZA 1MFWA 4B3TL 2JA9A 4KN4C 1BNZA 3RPFC 4XIGS 1KXLA 3Q8BA 3KF6B 1BCPF 1LTLA 2X69A 3EJIA 4HCPB 4A3DB 1HPCA 2G5DA 4ZKCB 1C4AA 5EGTA 2MPMA 2B2WC 4XQJA 3OMCA 2BE5D 3DM3A 3H0GH 3ZXVA 1N61A 4GB9A 1NJIC 3U4ZA 1GUGA 5K5PA 3N1XC 1MHHE 5IN7A 2DAJA 3NTKA 4JK1C 3UIOB 3MXGA 4Q0FA 3MXUA 3AE4B 5A2QL 1K52A 4IDIA 1ESRA 1I6VC 2JZPA 1WTVA 1WTOA 3SR1A 1FNWA 3HOXG 1RIPA 2MRPA 1RFAA 4XT3B 4HTHA 4B3SL 1KL9A 1WTXA 3K81C 4YHHL 4BBSB 3BDLA 2FCQA 2X8XX 5JXVA 1K9MC 4A3DG 3BVZA 2CR5A 3MC8A 4NXNQ 1F9RA 2PJHA 4LW1A 3RZWC 1WTHA 4O0AA 3ZUNA 1FO4A 3KOJA 2N49A 2RR9A 3HKSA 3FKYA 4GS3A 2JSVX 1R4QB 2JA6H 3ICEA 2R2OA 1IHZA 1ESFA 4ZCKA 1CJEA 3DWMA 3I4MB 2GN5A 3KF6A 4A3KH 2J0KA 4X62L 1SBBB 1TWFH 1UAPA 1PH8A 2MJDA 2XK5A 3VTVA 3VR8B 1K51A 1XPOA 3SHQA 4A8XC 1FJGQ 2D3GA 2JA7B 3GTKB 4A55A 1TXYA 2HTME 1PXUA 3J7ZC 1LYLA 1SB3C 2K3UA 3M7NA 4DR7Q 2KA7A 5KGUA 3L4PA 2JA5B 4YWKA 2LHDA 4ACFA 2ONQA 5E7NA 4NMZA 3G4SA 4BBSG 1ACCA 3DPDA 3PHXB 1YZ6A 3DVGY 4LDTB 3BZCA 2AX5A 1E2ZA 2JEBI 3M7GA 4DR3L 2GLSA 4KHPL 2F0QA 2JZZA 2A1AA 3S24A 2BT6A 2UUBQ 3DBRI 1ICFB 1WZ3A 2OJWA 5DEHA 3SK6A 5CC4A 1I50B 4HJ7A 1V2YA 4PG3A 3ZVVA 5I6YA 3ZDTA 1EWCA 1B3AA 1Y8OB 2AUKA 3I4MG 2A68D 2L1BA 3S1MH 4RA8A 1VQDA 2F0EA 5D3IB 4I7AA 3J81i 3MHZA 1ILQA 1P7FA 1RRBA 2KQ4X 3P42A 2MHVA 2I07B 4NXML 2JA7G 2CKHB 1NUCA 2NTSA 2FINB 4A3LH 1SDFA 1HNXQ 3Q8CA 2LASA 2N9EB 1PFMA 2JA5G 1ZDXA 2MUYA 1ZKHA 5BR8Q 4F8CB 3CCSA 1UEBA 2JP1A 1F9QA 4LUOA 2YU9H 2G1EA 1V1OA 4TVAB 3GE8C 2EY5A 4LF4L 3PO3B 3KJOA 2PKOA 3MHSD 3EFCA 3KUDB 2MH7A 2JEAI 4FF1A 1CA6A 2K28A 1V43A 3NS1A 2O4XA 2PW5A 4KZCA 2FE8A 1RKNA 4RMFA 1DXMA 4OIJA 3CCQA 3OAWA 4EQOA 4W9LA 1GUOA 3MA2B 2PQEA 2IGDA 4PMCA 4YXDB 5I4DA 2WQYB 2D0PA 4YL8A 1EOVA 2M8SA 3P75A 1T9HA 5DCNA 4REZA 4ZRZA 2NUCA 1JR0D 4YWMA 2O5JC 3NVWA 4XYQA 5GAEC 1P9DU 1B9NA 1EY5A 2ES2A 3CSTA 3PO3G 5CHVC 3BINA 3ZO5B 1OQQA 1N33Q 1KF6B 4X64L 3SU8X 3N1ZC 4O2DA 2V1YA 1TTNA 2K8CA 3A9KB 2PPBC 2QSDA 4LLGM 4ANWA 1I6HB 2N88A 2ZM6L 4DUZL 2L05A 3GTLB 3HK0A 2BH2A 4DK0A 5CHFA 3U4EG 4BKGA 3SK8A 1J6QA 1RL2A 1N36Q 4DHJB 1A8VA 2LGXA 3CXCA 3ZRFA 3T1HQ 4JI8Q 4FHJA 1SJHD 3KBXA 3PRZA 2NN6I 1SEBD 4A4IA 2L0CA 2JK8A 5I2XA 2YTXA 4KKIA 1I42A 1OXTA 1CA5A 1WJ6A 1GNUA 3J7AF 1DOKA 2F0PA 1FIQA 1SF0A 1ZGUB 2BYVE 2K8HA 4PS3A 1CKOA 4X57B 4BKSD 3I5JC 4RF1A 5FR6A 2RA4A 3D6WA 4JBJA 4S3SA 3TP8A 5C0XJ 4HKQA 3K7UC 5E6NA 5IT9L 2M4NA 3I4NG 1IBXB 1BOSA 3K5OA 5IP9G 3VXWA 4DFAA 4DDGD 4KHVA 4NNJB 2KECA 2RPQA 4XQQA 2UXBQ 2MO1A 1NY4A 1BBUA 3NK9A 4LF9Q 1L6UA 2W82A 3VH4B 2FAZA 3HVZA 1TR5A 3S1RB 3VR5A 1I4HA 1TWCH 4RCOA 5M3MB 2L3ZA 3KYCD 5IP7G 4JV5Q 2PZTA 1OFFA 2KQ3A 2L4NA 4HPLB 3RN5A 3P4PB 3Q22A 1XNQL 1JMLA 1QNUA 1TVXA 4K2KA 2BF8B 1K8MA 1II3A 5C4XH 2RHQB 1ENFA 4ZK9B 1WXQA 3Q8FA 4YIJA 4LF6L 1PLFA 3ZNGC 4BBRB 1A70A 1K3BC 3SFEB 1BCPB 1VQMA 4K3CA 4XC2A 2R7DA 3MTSA 1B7YB 2NVTB 5KYIA 4JOIC 4CKBA 1ONLA 5G3LD 3EGRA 1EYGA 1O7LA 1E8ZA 2J0MA 1G6JA 1LTBD 5G5GA 3CW2C 4HDQA 1UE7A 1K50A 1VZ7A 4M02A 1ET9A 3ZKJC 1Y8PB 4DBGA 3QB3A 1EYAA 1TYGB 3Q3FA 5EKLA 3C2PA 4JBWA 2KCTA 2D11A 4BOZB 5M3MG 1CKMA 1TWHB 1E7VA 4MJSB 1SMYC 3GP7A 1JB7A 2D07B 1LTGD 4ARCA 5CV5A 4I65A 1EUJA 4G50A 2LKVA 3DHHC 1W6KA 2E2JH 1IBXA 3TEHB 5IT9c 2MEKA 1FL0A 3LX0A 1JJ2A 4L5SA 1GD7A 1ZYRD 4DNTB 2ICEC 2VQEL 1J5EQ 4Y7NH 4BBRG 1Z9FA 3AQQA 1FM0D 3CMAA 1XPUA 1I4RA 1TIFA 3M4OH 1YNJC 1WJNA 1IZ6A 1SLJA 2O2VB 2UU9Q 2LXKA 1ZKOA 5HHDG 3TRZA 2W54A 3RNCC 4DR4Q 3QQ8B 3K80C 2DZMA 3QIJA 4AUQC 3JAMi 1P16A 5A2QE 2FIFA 4HEDA 1S1QB 1UWVA 5EQ0A 2PE9A 4G3XB 4I6PA 2ASQA 1CTMA 1SROA 1ZXIA 3VR9B 2BA1A 2B8FA 2QF7A 4OL7A 2DY7A 4DV7L 1HXYD 1W2BA 1K73C 4X65L 2HT1A 3Q23A 2M19A 5IWAL 3AV8A 5J3BA 2L32A 1M1KC 4RF0A 1AZPA 1VQKA 3S1QH 4A3GH 2PQAA 1BF4A 1RJTA 2WXGA 4OXPA 2IX1A 1GG3A 3MXPA 3GOEA 1YNNC 2MBHA 3A4SC 5COYA 3VH3B 1U4LA 5EPLA 4MJSA 3PLUA 1FCLA 2BH8A 2XWJB 1EF5A 4I6LB 4MGYE 3S2HH 3FRPB 3BDOA 1SIFA 2ZEQA 4NAMA 4IOAA 1E8WA 5C0XG 2D2CC 3AXCA 1Q46A 3BZKA 1MSHA 4RKBA 5ELCA 5AJ3L 4B3ML 1A0IA 4LJZC 2SNMA 4DPGA 1LLRD 4H02A 3EHVA 1L0WA 4P71A 1PH5A 2E2IB 3SDLC 3KLSX 1CK1A 2XEWA 1JOKA 3GTMB 3H3VH 3QOLA 1PH2A 1XQQA 2O2VA 5BN5A 1X65A 2DAFA 2QEJC 1FNUA 2B39A 4GXBA 4IW0A 1Q3LA 5IGDA 3F2UA 1TT5B 2EYOA 5F2DA 2C7MB 4IFDH 2HDMA 4ZUJA 2PZUA 1H95A 2PNHA 2DGYA 3ZNID 4A76A 1EWHA 5I2YA 1HCZA 1N62A 1VDZA 3AE2B 3ZJTA 1XX8A 1GOZA 1WF9A 3AB5A 3Q6SA 4MTKA 3NWSA 2CHZA 3L0WB 5CTRC 4BOSC 5CORA 3H15A 1EYDA 5AZHA 1LUZA 2NZHA 3TMEA 1TWGH 3DXJC 4XDXA 1I3QB 2JT4B 4M0WA 4N8X1 5JPNC 1BT0A 2B2YA 1S5ED 2B2YC 4OEMB 2Z0SA 3HKZE 1E1OA 3PIPA 1HNZQ 1S5BD 2BS2B 5GAGC 4JE3B 4PK1A 5JEAH 1LACA 3KDFA 4H7BA 3NZ3A 3HOVG 1XLPA 4X3SA 2F1MA 4LK0M 1F77A 1EU4A 1HFGA 1NE3A 1ILPA 1EUVB 1NMGA 4GMVA 4AWJA 4DQOC 4DK5A 1WWTA 3KJPA 2AQ2B 3AE5B 5FO8B 1EIYB 3VRAB 2BE5C 2X6GA 2DZIA 3VYTA 1UE1A 3QR8A 3U50C 1HR0L 4BY7B 3WAMA 1KRHA 4YY3L 3RN2A 5IOIA 2E74C 1GAQB 2XTIA 1EZ6A 2Y5BB 3V6CB 3TZUA 1V80A 1WIAA 1D5ZC 4ANVA 5JOBA 1PRTD 3NTIA 2ZJRA 1QOHA 1FXTB 2OHFA 3TBLD 4EZJA 1F1HA 4DV6Q 4YTPB 1D2BA 1U5KA 3KUPA 4PT5A 2WDVB 2MNAA 1STEA 3H94A 4CJ0B 5AUKA 1VQ6A 1EFWA 1Q1OA 4OX9Q 4QF4A 1C48A 3R2TA 5EE1A 3TREA 4BY7G 4X66L 2K04A 3HEJA 4LFBL 2MX2A 2CVRA 1WTWA 4JI3Q 3HM6X 4PS7A 2F0IA 3PZDA 1EM7A 3V05A 2K5NA 1J0GA 3I91A 5GQOA 3PIP3 3AMUA 2KDBA 1L2NA 4JG2A 2Y0SE 1YMHE 2KFJA 2Z0EB 4P16A 4WAAA 3GQBA 4US8A 2QCZA 4K8IA 1VJKA 3FKIH 2WHIA 3A8IE 2J53A 3DWAA 4PMBA 4P1CC 1SYDA 4A3IB 1PH1A 3G6EA 2A69D 2XGTA 2K7VA 4HSVA 2SDFA 3OPOA 3K9OB 5FO9B 4G0NB 1QE6A 2QKIC 2AQ3B 1EEID 2ZT9C 5IT9E 4XDDA 1HTOA 4KLKA 1PGBA 2WS3B 1VZ6A 3R66C 3MC0B 4DV1L 3W5UB 3OOCA 1EY0A 3T3NA 2ZJQA 2WXJA 1EY8A 3DHQA 2SNSA 2IY1B 1EWIA 2A68C 1OQYA 3L7ZC 2YU9B 4M01A 2UU7A 3C1EA 1QKZA 2KOXA 2VZKD 2F0VA 3OHXC 1K53A 2Y5CA 2KLGA 1CKNB 4LMQD 3N3KB 1KLUD 4KJNA 5DPSA 4LDTD 1S4ZA 2K6AA 4LFCQ 2O2LD 2I5LX 3ERQA 5FLMH 2LS01 2WKCA 2N7EA 3ZLZA 4ZOHC 2J0TD 3S17B 3N6RA 3DCGA 4M8AA 3PO2B 2XNAC 3FAHA 2LUEA 4GLVB 2KCCA 3DEOA 4AH6A 1E2WA 4AS1A 2BA0A 4N59A 4OGQC 2AYOB 2KWUB 1KH0A 4B6WA 1YNTE 4F8MA 3T51B 1YD8U 4YTNB 1N60A 1UE6A 4OWXB 1VR9A 4RMAA 3F2DA 3L10B 2DUDA 2V1CC 1QILA 2YV5A 4GLAC 2OEOA 3GZNI 5CX3A 4WJ4A 2GVAA 4XTCS 3I57A 2GMIC 1H9KA 2IJ0A 3B08A 4L23A 5IYCH 5IGBA 3FPUB 1XTCD 4GDKA 3DOWA 4B9KA 1Y1WB 3OG5A 2DLBA 4OELB 1FD7D 1WSPA 4C80A 1UGMA 2CHXA 4EX5A 3I72A 3R7RA 3PO2G 3A55A 4RM9A
chains in the Genus database with same CATH topology
1PTOD 4NZLB 1CHPD 3DWPA 3K7AB 3TZDA 2A6ED 1VRAB 1K8OA 1XCQL 3NRZA 2Z4HA 3T4AC 1K83B 2KCNA 1QOBA 4RHSA 4Q5VA 3WOFA 1DJRD 3X3MA 2DN8A 2VB2X 1E9MA 4ZHPA 3KBGA 3FC4A 3P20A 1MI2A 4IALA 2X38A 3PO0A 4RKLA 1ML0D 1IW7D 1FFVA 1XLOA 3NHHA 3P4RB 4OZCA 1ROEA 4K6DA 3PV0A 4A3FB 2NB0A 3DUZA 3S14B 2H89B 3GTQB 2RKSA 4CJ2C 4IFDI 4OO1H 4WAFA 1R9TB 2LGIA 1XO3A 2EJMA 3HUIA 1RTNA 2Z8LA 2DNEA 2IGGA 2XIWA 1NYRA 2JXTA 2KDMA 1HA5A 5EKIA 1S5CD 1YQ4B 1H9MA 2Y0SB 1PDXA 3K5MA 1Q8IA 1G6ZA 1TKEA 3TUOA 4R9WA 2IL8A 2EZVA 5C4JB 4HROA 3LWEA 1A3TA 3PUWA 1JOQA 5EBCA 4OZBA 2FJ2A 4IUUA 3J80E 5BYQA 2WAQB 3UI3A 4XQNA 3H8HA 1TIID 1ZYRC 3SE0A 3N9YC 2NWGA 4OHJA 2K01A 1BCPD 2PW7A 5H8YE 5KNDA 4YSXB 1BUVT 1LTTD 1AWDA 2C5CA 2HQEA 3S1QB 4G7OC 3ITPA 4Q2JA 4LTUA 3J81L 4OIKA 4WFN3 1NAPA 2NN6H 3VR6A 3W1SA 4A93B 2AWNA 4ID6A 3S2HB 3AH7A 3B2FA 1HRJA 2EE1A 2PCFB 2L55A 1C4QA 3SK5A 5LHY1 5T1GA 1D6EC 3HGBA 2Y5PA 1DOMA 1HTPA 4CKCA 1F0ZA 3AE8B 4A3EB 3O13A 3K58A 3CIRB 3BK1A 1VCIA 2IPKD 1WVLA 4ZQ3A 4NJCA 1YQ3B 5MPOA 1DOXA 2WXHA 1E10A 5IIFA 3AE3B 4JWUC 2MP1A 3TP7A 2KMMA 4WIPA 4TQ0A 2NYZD 5KEEA 2K5QA 1STGA 1SE2A 5G5HA 1TWGB 4N6EB 2X6LA 2HDLA 2EVBA 5C5MA 4TSSA 4V0BA 1X3PA 3D6CA 1WTQA 3HOXB 1GXDC 2TMPA 4K5WA 5C2TB 2JSOA 2WU5B 4J8QA 5FO7B 1E6EB 3DMUA 4RHRA 4HRSA 4R3DA 1JWMD 3ABVB 2XWBB 1C78A 3GV6A 4IFDG 4ITKA 2FUG1 1SYCA 4RGMA 2XRQD 4E6IA 1C4PA 3C46A 5AFWA 5IOCA 2WXRA 5CBEE 4B9WA 2B2UA 4CKEA 3ZJUA 1ZDVA 1LT3D 1Z47A 3TP6A 2NVYB 5C3WA 3IAS1 1ZUD2 4NKLA 2BB6A 2Q5WD 1UEAB 2F0JA 4HMIA 4DAPA 4JX1C 1H9SA 3FEWX 1GUSA 2NVXB 2F0GA 2FBWB 2BBCA 5T8IA 5C5LA 1SE4A 1JOOA 2WXPA 3H91A 1PRTC 3E56A 3P7JA 2AUJD 1ZOYB 1L0YB 2J42A 5BYRA 3KQ4A 3M3YB 1Y1VB 1B9MA 3MEHA 2NMQA 3TN2A 2VZKB 4K5XA 2L52A 3Q69A 1STNA 2WDRB 1PZKD 2N9LA 4H44C 2E3TA 4KKSA 5BN3A 3NVZA 4USAA 4AQ7A 3A7LA 2V0GA 2WU2B 5IGCA 3PMFA 4HR7B 3I70A 1EIGA 1GHKA 3I3CA 4IQZA 4WRDA 2OEDA 2RPVA 1IUEA 2A69C 4JWSC 1PFBA 2WP9B 2V3NA 3BIID 1STAA 1W6JA 2IT1A 3CRKC 3JAML 4OO1I 2IW3A 3BDCA 3VYSA 4FXCA 2H4OA 4ZRPA 2YYZA 4U68A 2E6XA 1I7HA 4KTAA 1PTOB 1L6VA 1SNQA 1XCTL 4WQMA 3J7YW 5J22A 4ZAIA 4YSYB 1L5PA 1JCKB 3EA6A 1B9RA 1HEZE 4A3JB 4XDCA 5ELDA 1UGJA 3I8ZA 4M1UB 2AWOA 1SYGA 1V8CA 2LFNA 3I4NB 3CQZB 3KLSA 4OVZA 1QNKA 2VUMB 3QIAA 3G6JB 5DM63 3VA7A 3ONAB 2K9XA 1WD1A 4RNAA 1WRIA 2OF1A 4C3HB 1T5XD 3E0JA 5C4HA 2N9KA 2WXQA 2K5DA 2ENBA 4L2YA 5KNCA 4GLSC 1XYIA 3Q8AA 2L12A 3N52A 3J81E 4K2LA 4XYOA 3S15B 2A6EC 1JWSD 4FF3A 2L9HA 3IFTA 2KJXA 4KD3A 3OSOA 4HCEA 1BMLC 4O42A 4DA2A 1IYUA 1JB3A 1HFNA 1BBXC 2FMCA 4C3HG 1B2TA 4R8IA 2B8GA 5DNFA 4KY6A 2DWQA 1FMAD 3WDNA 1JALA 1OXUA 3QOJA 3AE6B 3RZOB 5D7GA 2WXNA 1U4MA 2RDGA 1IW7C 1DM0B 4BWGB 4KD4A 2R61A 3EVQA 3A8KE 4GDLB 4RCNA 3VR3A 2WLBA 3IXSA 2NTTA 2D5DA 1QOAA 1KNEA 3LXFA 3CKIB 1JROA 3HS0C 1IGDA 1DYQA 2WXMA 3S1NB 1NR4A 5JAVA 4B9XA 1HUMA 2W55A 1TJEA 2KN4A 3FILB 3RZDB 3LB8C 2YEPF 2KWDA 3HP3A 3EUB2 1Q90A 4P2CB 2JA8B 2M2LA 2LUMA 1IGCA 4RH6A 4KHZA 4H13C 1BCPC 5CV9A 1WTRA 1VDVA 2G9DA 1LTRD 1QQRA 2R92B 3AECB 4ARIA 3AN1A 2PW9A 1U4RA 1PFNA 1I4XA 4CHTB 1J7CA 3R2IA 1WD0A 1DOLA 4X3UA 2N0SB 3U52E 2NN6G 3H09A 3FILA 5C44B 3MAQA 4HEA1 2PMZB 3NVVA 3GS2A 1YJIA 5HFYA 3HOVB 5ELEA 2V3PA 2ZW0A 1FXIA 2K05A 1DOIA 2JYEA 1CZPA 5G3LF 1F2YA 3B2GA 5DM73 3R3OA 3DWQA 1EL0A 4FXKC 4KJOA 2F0FA 1FYCA 4UAIA 1BQQT 2RSOA 5K36H 1B1ZA 4C3IG 2JQRB 3H0GB 1Q1BA 3VRBB 2OXPA 2E75C 3JAME 1EZ8A 1Q12A 1KDBA 1MGSA 2R93B 4RGOS 4I7ZC 1CZWA 2V4IB 4KY7A 1A6XA 1KDCA 2K5PA 1FCCC 5JVH3 4C1NI 4PNYA 2WV6D 1PGXA 4MACA 4XXEA 2M00A 5C6AA 1Z6HA 3NBIA 3NXWA 1IL8A 4BA1I 5FOBB 4K14A 5FLXL 1OXVA 4IN3A 2JA6B 4FYDA 1UNSA 2HCCA 4A3KB 1TWFB 2WNMA 1E2VA 1JW9D 1NVID 1CHQD 1N63A 3BVGA 3BYTB 1PFDA 1LABA 3OIQA 4IUVA 1G291 2CU3A 3SFDB 5C4ZA 3A7AB 2LHEA 3W5VB 4MT5A 2EY1A 1L0XB 3AMZA 2F0LA 4TQ1A 3AE7B 1JE4A 1UWXA 2K03A 3S1MB 2F0WA 2A74C 4ABNA 3MJ5A 2Q8TA 1PUTA 4YSZB 3FVQA 1SNMA 3W3AA 4G7HC 1UUPA 1E7PB 4L1BA 1TY0A 3K5NA 3MFYA 1A2TA 2BYTA 1OXSC 1L4ZB 4YWGG 3T13A 1LT5D 3D4RA 3BVMA 1NR2A 2PVOD 1UWMA 2FFKB 2QDBA 2WIIB 4K6LA 1F2ZA 4C7YA 1MSGA 2F3VA 1KNAA 1GUNA 3J9CA 5EPKA 4B08A 3NWTA 5CYUA 2WINB 1PMRA 3U9OA 3K57A 1EY4A 5ELBA 1QCBD 1QLBB 1NEKB 2BS3B 3AEEB 1I4GA 3U9SA 4ODGA 2WKDA 3FDTA 4MHEA 1STBA 3URYA 3HG9A 3HVDA 3SHLA 1EIHA 2PYKA 4CGYB 2NVQB 3HKZB 1LT4D 4TKOB 3L3OC 3M85A 1SNDA 5EJWA 4CQNA 2WXIA 1FRRA 3SXHA 2LFIA 4FNFA 2HCIA 4G57A 2EJGC 4C56C 1LTAD 2F0MA 4KKUA 4C1NK 1AW7A 3K0YA 1SJED 1PZJD 1U4PA 4BA2I 1TWCB 2XRSD 3R93A 2L1AA 3PIO3 2MJ3A 1EWYC 4RGTA 5AUIA 3BWUD 5C4XB 2XVSA 2Z4IA 1PZID 3SEBA 1MHXA 4DK1A 1QB5D 2KOLA 1DZ1A 1J8IA 2F0NA 4CJ1B 2LMCB 1LV9A 3ZGZA 1X3QA 3K5LA 4ZHOA 2MGSA 4ZRQA 2VNUD 3DWGC 2E2JB 3TEZA 4IFDJ 4KV6A 4TQUS 2BTEA 3A8JE 4Y7NB 2WP8J 5CMDA 2EY2A 1SSNA 1F2MA 3M4OB 2KVMA 4IOIE 2KAJA 2PMVA 1JQYD 1KFYB 5H92C 4OZAA 2KEDA 5M9OA 2ICIA 3CU7A 2F0TA 1RCVD 1MVKA 4KGRA 2G9HD 1SYEA 3UI2A 3IAYA 2LMCA 1DONA 4QUCA 4A3GB 1D4BA 3RLFA 1PDQA 4J6HA 3ZYYX 1XWEA 4QUFA 1VMCA 3AE1B 3C3LA 1XLNA 1C76A 1TT2A 1TKGA 1TKYA 2QMTA 3OIPA 1ZEQX 4B0MA 5I9OA 1STHA 2Q8RE 5C0XH 1F2RC 3CWIA 3GB1A 4PV1C 3H6MA 4ILWA 1B53A 4F88A 1QJOA 1VZ8A 4UDUC 4KMUC 3BK2A 1R4PB 1ENAA 1DOYA 4YT0B 5D65A 1YJJA 1AZQA 2K22A 4WH4A 1D1IA 2D9UA 5JVG3 4KK7A 2DYOA 1PYWD 3AB9A 1CFMA 3EROA 3X3NA 4L63B 1TY2A 1AN8A 4TMAB 4C2MB 1Y69U 3GO5A 4K8JA 1NCVA 2TSSA 2IDYA 5JPMC 3QJYA 1KLGD 2WXLA 1BO0A 2BOSA 1R7SA 4HJGE 4US9A 1FD6A 4RFBA 4A90A 4EQNA 5HI1A 3I4LA 1M4VA 4D2KA 2M0AA 4KGTA 3WOEA 3H3VC 1JICA 1X32A 2B2UC 2J7ZA 3C1FA 5BYSA 3MWYW 1GUWA 4BS9A 1SNCA 3TEWA 4N9PA 3VA5A 4FXGC 1FFUA 4NDXA 2RBMA 1EOTA 5C3XA 3D31A 4DAYA 2MJEA 5JEAG 5CV6A 2NBFA 2EELA 2B2WA 1MD2D 2EY6A 2PVGC 5HG2A 1J7AA 3NP8A 5J39A 1D5MC 2DNCA 5J1ZA 2GB1A 1H9RA 3NSWA 2B2TA 1VF5C 2B2TC 3A56A 1HUNA 3AEFB 1N5XA 2WDQB 4MH8A 5C3JB 5E1FA 3D4WA 1FRDA 4QIWB 2PIAA 4WURA 1NENB 3NPPA 4FF2A 4G7ZC 2N7JA 4FXDA 4CBVA 1T5EA 2BW2A 2QCPX 2GRIA 2L11A 2I46A 1U9RA 3FKIB 1G91A 1DCZA 3NUCA 2GI9A 1JRPA 2ON8A 4FVMA 1BXTA 3NE5B 5D3DA 2EYJA 1KABA 2D5GA 3KK7A 3OMGA 4DXFA 5CV8A 3SDZA 1RODA 4FP5D 5KRUA 4AYBB 3C8YA 3D8GA 4RWSC 2LJIA 3VR4A 1YN3A 3K6OA 2F3WA 4TRDA 2F4IA 1A15A 4A6QA 3EQLC 4R8NA 1IKLA 2BB5A 2EPBA 4DU9A 3MP9A 1RDPD 4DNRB 3I9V1 1WGKA 3PUYA 4DN4M 2J4XA 5JJZA 4G4KA 3K59A 3OWFA 2INPE 2ID0A 1HZ6A 4IURA 5CV4A 4KGSA 3BG3A 2EOTA 2Z1CA 4FO2A 1RHPA 3BZDB 1RFKA 1XF5L 2A5HA 1F9SA 1FGBD 4IZ8A 2CJOA 2L5TA 5EE9A 4MIUA 2RQXA 3IKJA 1DGJA 2BDOA 2SEBD 3SK4A 1JC7A 5LNK1 2ZW1A 4RGNA 2XN9C 2EYPA 1WCMB 3D3RA 2F0DA 3NBHA 4F7XA 1C79A 1EFID 1GPXA 3VR2A 2IX0A 1HZ5A 1ICWA 1GUTA 3LNNA 2WXKA 3KWVA 1PTOC 2CW0D 4ZLTF 1CQVA 1QT9A 3AEGB 2BCOA 1D1KA 4QMGA 2DY8A 3V2TA 5C0XI 2JYOA 5BMHA 1JWBD 3GTGB 2PLPA 4HN7A 4YTMB 1ZXHA 3J7AV 5EE0A 5C3EB 2R7ZB 1SFOB 3RMHA 3RD4A 2I2YA 4IKGA 3PUZA 4N9TA 1HQMC 1CM9A 2M9VA 4L6TB 3S16B 4MN3A 5I6WA 3DEPA 5I9PA 2K5WA 3T56B 3PZ7A 2EYHA 3NQTA 1EQVA 3E9SA 4L8JA 5KIXA 1O80A 5KNBA 4DAVA 3AEBB 1CQFA 1HHVA 4N58A 1KTKA 3HOZB 2EJFC 4A9AA 2KHSA 1S5DD 3AE9B 1N5WA 1SIJA 2R3ZA 4OO1G 1CI3M 1F2LA 4HSPA 4NW2A 4LK1C 2WXFA 3T3OA 1C4CA 1V1PB 3GTPB 5BMGA 4OW0A 5EE3A 5BMIA 1EQTA 4XE0A 2OT2A 2B2VA 3OW7A 1JQ4A 2B2VC 4QCLA 3TDQA 1IKMA 3Q24A 5CGKA 5TSSA 1BUIC 2J52A 3TBIB 2CHBD 2SAKA 3ND9A 1TQOA 4KKJA 4GZYC 3EFXD 2GA4B 3ZJVA 2INNE 3BYYB 1L4DB 3IAM1 3IT6B 5LL6S 4IUPA 1ZE3D 3HOYB 1HA6A 1EYCA 2A6HD 1Y8NB 3D4DA 1GB4A 1HTLD 1T3QA 5LL6X 2L83A 1V1PA 4O1NA 2K1BA 2DBYA 3IFDA 3E5SA 4C3IB 5EKKA 3MVVA 4BY1B 3AEDB 1TS5A 1J7BA 1OO9B 1WTPA 2BDNA 2HUGA 4C7ZA 3SR6A 3WCQA 4H2AA 2RDFA 4U673 1HQRD 1IYVA 4KKTA 5FKAC 3AM9A 2PTLA 2WACA 1STYA 4F87A 3HZXA 1G8ZD 4ZUIA 1RM6C 4IUQA 1T6BX 3TEXA 2RSNA 1V97A 5E4XA 3S9WA 3KWLA 3KF8A 4B0EA 1XLQA 3QO2A 1M8AA 1G2TA 2JWUA 4HCSA 3CRLC 1G2SA 1SYBA 2I38A 1AYFA 5FK9C 1NI3A 2PO4A 4RAUC 2N55A 1Q1EA 1PGAA 2LEKA 1SSOA 3SVMA 3Q8EA 1WYGA 4KX6B 4IUTA 1LO5D 2JX5A 4HKZE 3U7ZA 3J80L 4MM3B 5ELFA 1RTOA 3V96A 1JWUD 2B63B 1FEHA 5M3FB 3GTJB 2F0OA 3T16A 1TS4A 4A3BB 4P6VF 1GHJA 1C9FA 1EU3A 1AP0A 3ETRA 5KYLA 1GB1A 1I4PA 2KACA 5IGGA 3Q0AA 3NQIA 2F0HA 1E0ZA 5T1IA 4C3JB 5E4WC 1TS2A 4XWWA 3TP5A 5HURA 3FPPA 3W9CB 1BDOA 1VMPA 3NVYA 4KY5A 1GJXA 2EYFA 4HAEA 4EGVA 4J1MA 2E2DC 2IX3A 1V8QA 3A54A 2CJNA 4LAAA 1TU2B 2SOBA 3GV3A 3CHBD 4C3JG 2W3SA 1YN5A 1OXXK 1KAAA 3P1MA 2EDGA 2K0PA 3I90A 2WB1B 4IUNA 1VLBA 2VXWA 3I73A 1A2UA 4V190 1SE3A 1OQRA 4GDKB 4KN7C 1EY9A 3MZ5A 3GD7A 3FMCA 1F9PA 2RMMA 2YEPB 1Z7TA 2E2HB 1PRTF 1SYFA 5IGEA 2RDHA 2V4DA 4ZYSA 3ZQ4A 3L9AX 2F0UA 4NAWB 4H0LC 4FF4A 1A3UA 3LWUA 3P63A 5GXGB 1SAPA 1NYQA 1EY7A 3AEAB 4PQXA 2O5IC 1ZP0B 3S2DB 4X3KA 1PTOH 2KEEA 5FR3A 5IGFA 1CZGA 2H1EA 5ISRA 3NTHA 3TEYA 3RUZA 3G7LA 3V3XA 2EKIA 4JPSA 2W3RA 2K33A 1SNPA 2EYLA 1F2RI 4K5VA 1FNVA 2DYMA 2FMMA 1C8CA 1RWSA 1BR9A 3IL8A 1Q10A 2D62A 1SXTA 5M5XB 2CW0C 2BS4B 4Z9CB 1XEEA 3IT4B 5IODA 2VB3X 3OWEB 5EBDA 4HMJA 3E6ZX 3KLRA 1YN4A 1XXGA 5E3FA 2QJLA 1RF2D 3PZ8A 4EE2A 5CV7A 2ACZB 3AU7A 1FXAA 3P4QB 5DAUA 4EQPA 1KDAA 2KUMA 5CR3A 4J3OD 1AFPA 5CBAE 2JE6I 1AEXA 2H88B 3PUXA 4ULLA 1O7YA 1A3VA 1EY6A 4XT1B 1MBYA 2PNRC 1TS3A 2CQAA 3ND8A 4PMWA 3W2DA 3M4YA 3HOUB 2E76C 1JWAD 2F0SA 5A35A 1SMYD 2JXMB 2AQ1B 3RFZB 1TWAB 2R6GA 1JORA 4A3MB 1EEFD 5JEAJ 3PUVA 1LTSD 4XWTA 2IGHA 1SNOA 1RD9D 1L0VB 1PTOF 3QG1A 2XSCA 1RYJA 5NUCA 2MJ8A 1YNJD 1O78A 2NZ1D 4WORA 4DF7A 3MFGA 1QOGA 5FLXE 1MPEA 3BS1A 1LTID 3DM1A 5HGTA 3QWNA 3MHBA 1QOFA 2F03A 2JU6X 5M5WB 1S5FD 4DGZA 2QIEB 3GTOB 3R8BA 1B4OA 2Y3AA 1ZXTA 1YNND 4NP5A 2LY7A 2A6HC 1ET6A 3VYRA 1Y56A 2K32A 4X3TA 1QF6A 3MXNA 1J9OA 2ZXPA 2IWHA 3T53B 1I4QA 1DD2A 1ZPSA 3U2SC 4KI0A 3B9JA 3HRDD 1B50A 2C9OA 3LYYA 4DXGA 2B76B 1C77A 2HDEA 1B44D 5BN4A 3P4SB 4WWMA 1VF7A 5M5YB 2FHTA 1NSNS 2PZWA 5E6JA 1E0BA 2EXZA 2ZXRA 1FR3A 3NUHB 4ME5A 1LT6D 2F0KA 3VYUA 4WJWA 1MI0A 2WXOA 1D5XC 3HOWB 2M56B 3VQIA 1ENCA 1TKWB 4ZKBB 3DWMA 1QG7A 1H9SB 2ZXOA 2RVLA 3P1HA 2A73B 3TSSA 1TZOA 2Q8IB 1H9JA 2JYTA 2EYMA 5D14A 3HRZC 1CT1D 4QB4A 1PRTB 1QWYA 5EPJA 4EVOA 1P7EA 5K36G 2QILA 1O7ZA 4KN4C 1BNZA 3RPFC 4XIGS 3Q8BA 1BCPF 2X69A 3EJIA 4A3DB 1HPCA 4ZKCB 1C4AA 5EGTA 2MPMA 2B2WC 4XQJA 3OMCA 2BE5D 1N61A 1GUGA 5K5PA 1MHHE 3NTKA 4JK1C 3MXGA 4Q0FA 3MXUA 3AE4B 5A2QL 1K52A 4IDIA 1ESRA 1I6VC 2JZPA 1WTVA 1WTOA 3SR1A 1FNWA 4XT3B 4HTHA 1WTXA 4BBSB 3BDLA 5JXVA 3BVZA 1F9RA 1FO4A 2JSVX 1R4QB 1IHZA 1ESFA 1CJEA 3I4MB 1SBBB 1UAPA 2MJDA 3VR8B 1K51A 4A8XC 2JA7B 3GTKB 4A55A 2HTME 1PXUA 2K3UA 1SB3C 3M7NA 2KA7A 5KGUA 3L4PA 2JA5B 2LHDA 2ONQA 4NMZA 1ACCA 2AX5A 1E2ZA 2JEBI 3M7GA 2F0QA 2BT6A 5DEHA 3SK6A 5CC4A 1I50B 5I6YA 1EWCA 1B3AA 1Y8OB 2AUKA 2A68D 2L1BA 4RA8A 2F0EA 5D3IB 3MHZA 1ILQA 1P7FA 2KQ4X 3P42A 2MHVA 2I07B 1NUCA 2NTSA 2FINB 3Q8CA 1SDFA 1PFMA 1ZDXA 2MUYA 2JP1A 1F9QA 2G1EA 1V1OA 2EY5A 3PO3B 2PKOA 2MH7A 2JEAI 4FF1A 1CA6A 2K28A 1V43A 3NS1A 2O4XA 2PW5A 2FE8A 1RKNA 1DXMA 4OIJA 4EQOA 1GUOA 3MA2B 2PQEA 2IGDA 4PMCA 4YXDB 5I4DA 2WQYB 3P75A 4REZA 4ZRZA 2NUCA 1JR0D 2O5JC 3NVWA 4XYQA 1B9NA 1EY5A 1OQQA 1KF6B 2PPBC 2QSDA 4LLGM 1I6HB 2N88A 3GTLB 3U4EG 4DK0A 3SK8A 1SJHD 3KBXA 2NN6I 1SEBD 2L0CA 5I2XA 4KKIA 1OXTA 1CA5A 3J7AF 1DOKA 2F0PA 1FIQA 1SF0A 4RF1A 2RA4A 3D6WA 4S3SA 3TP8A 5C0XJ 4HKQA 5IT9L 1IBXB 1BOSA 3K5OA 4DFAA 4KHVA 2KECA 4XQQA 3NK9A 2W82A 1L6UA 3HVZA 1TR5A 3S1RB 3VR5A 1I4HA 4RCOA 5M3MB 2PZTA 1OFFA 2KQ3A 2L4NA 3P4PB 3Q22A 1JMLA 1QNUA 1TVXA 4K2KA 1K8MA 1II3A 1ENFA 4ZK9B 1WXQA 3Q8FA 4YIJA 1PLFA 4BBRB 1A70A 3SFEB 1BCPB 3MTSA 2NVTB 5KYIA 4CKBA 1ONLA 5G3LD 3EGRA 1O7LA 1LTBD 5G5GA 1K50A 1VZ7A 1ET9A 1Y8PB 3QB3A 1EYAA 1TYGB 5EKLA 3C2PA 4JBWA 1TWHB 1SMYC 3GP7A 4ARCA 1LTGD 5CV5A 4I65A 2LKVA 1W6KA 1IBXA 2MEKA 3LX0A 1ZYRD 4DNTB 2ICEC 1FM0D 1I4RA 1YNJC 1ZKOA 5HHDG 2W54A 5A2QE 4HEDA 5EQ0A 1CTMA 1ZXIA 3VR9B 2BA1A 2B8FA 2QF7A 4OL7A 2DY7A 1HXYD 3Q23A 2M19A 3AV8A 2L32A 4RF0A 1AZPA 1BF4A 1RJTA 2WXGA 2IX1A 3MXPA 1YNNC 5COYA 1U4LA 5EPLA 1FCLA 2XWJB 3FRPB 3BDOA 4NAMA 5C0XG 2D2CC 5ELCA 1MSHA 4RKBA 4LJZC 2SNMA 1LLRD 2E2IB 3KLSX 1CK1A 1JOKA 3GTMB 3QOLA 5BN5A 2QEJC 1FNUA 2B39A 1Q3LA 5IGDA 3F2UA 2EYOA 5F2DA 4IFDH 2HDMA 4ZUJA 2PZUA 1EWHA 5I2YA 1HCZA 1N62A 1VDZA 3AE2B 3ZJTA 1XX8A 1GOZA 3AB5A 3Q6SA 3NWSA 5CORA 1EYDA 3TMEA 3DXJC 4XDXA 1I3QB 4M0WA 5JPNC 2B2YA 1S5ED 2B2YC 1S5BD 2BS2B 4JE3B 5JEAH 1LACA 4H7BA 3NZ3A 1XLPA 4X3SA 2F1MA 4LK0M 1F77A 1EU4A 1HFGA 1ILPA 4DQOC 1WWTA 2AQ2B 3AE5B 5FO8B 3VRAB 2BE5C 2X6GA 3VYTA 4BY7B 1KRHA 2E74C 1GAQB 1EZ6A 3TZUA 1D5ZC 5JOBA 1PRTD 3NTIA 1QOHA 2OHFA 4YTPB 1D2BA 3KUPA 4PT5A 2WDVB 1STEA 3H94A 4CJ0B 5AUKA 4QF4A 1C48A 3R2TA 5EE1A 2K04A 3HEJA 2CVRA 1WTWA 2F0IA 1EM7A 3V05A 3I91A 3PIP3 3AMUA 1YMHE 4P16A 4US8A 3GQBA 4K8IA 1VJKA 3A8IE 2J53A 3DWAA 4PMBA 1SYDA 4A3IB 2A69D 4HSVA 2K7VA 2SDFA 3OPOA 5FO9B 1QE6A 2QKIC 2AQ3B 1EEID 2ZT9C 5IT9E 4XDDA 1PGBA 2WS3B