1TS4A

Q139k mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTKIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 53
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts4A01
2AQ2B 1LLRD 1XTCD 3BYYB 1D5MC 5D3IB 1D5ZC 2SEBD 1RF2D 4RCOA 1SBBB 1SEBD 3R8BA 5I4DA 5ELFA 5D3DA 1CT1D 1UUPA 1JWMD 2R61A 1I4HA 1YN5A 1SXTA 2XN9C 3V05A 1LTRD 1JQYD 1LTTD 1LTAD 5FKAC 1JCKB 3R2IA 1AW7A 1EU3A 1RDPD 4RGOS 3BZDB 3DWPA 1FNWA 4RH6A 1V1OA 1F77A 1BCPF 2XRQD 1PYWD 3KLSX 1BXTA 1S5DD 3OWEB 3R2TA 1KLGD 1CQVA 1BCPD 5ELEA 5FK9C 4NZLB 3DWAA 1ESFA 1PRTF 1SE3A 4Z9CB 1B44D 5ELCA 2NTSA 1MD2D 5ELBA 2AQ3B 2TSSA 4C56C 1EWCA 1S5BD 1PRTD 3BYTB 1XXGA 3GP7A 4ZYSA 1RCVD 1TY2A 1JR0D 3O13A 1D6EC 3BVZA 1D5XC 1HXYD 1PTOF 1PTOB 1S5CD 1STEA 4RGTA 4K6LA 3SEBA 1AN8A 1I4PA 1I4QA 1BCPB 1LT5D 1PTOD 1LTSD 4DXFA 1RD9D 2O2LD 1HQRD 2AQ1B 2QEJC 4RGNA 1ENFA 1S5ED 3URYA 4DXGA 1DJRD 1G8ZD 1V1PA 2G9HD 2QILA 1JWSD 1PRTB 1PZID 4RFBA 4UDUC 3W2DA 3TSSA 4RGMA 3BVMA 2IPKD 4L63B 1TS4A 1I4XA 1PZKD 2RDGA 3MC0B 1CHQD 1SJED 4O1NA 1TS2A 1M4VA 1DYQA 1TS3A 1EEID 5ELDA 1BCPC 1LTID 1FNUA 1SE2A 1SJHD 1KTKA 1EU4A 2NTTA 4BWGB 1TY0A 3BVGA 1B1ZA 1HTLD 1L0XB 3EA6A 1PZJD 2WV6D 3DWQA 1PRTC 3MFGA 1ET6A 1S5FD 1JWUD 2IJ0A 4OHJA 1KLUD 1CK1A 2J4XA 1UNSA 3EFXD 4L6TB 1ET9A 1YN3A 1FD7D 1FNVA 4RHSA 1LT3D 2CHBD 1CHPD 1LT4D 1LT6D 1EFID 1SE4A 1LO5D 1PTOC 1YN4A 1FGBD 1PTOH 1QILA 1LTGD 2XRSD 3CHBD 5TSSA 2Z8LA 2ICIA 1LTBD 4TSSA 4RHRA 1T5XD 1HA5A 2RDHA 1V1PB 2XNAC 1L0YB 1I4RA 1GOZA 1TS5A 1EEFD 1I4GA
chains in the Genus database with same CATH superfamily
2FXQA 3PSIA 4WQOB 3H7PB 2EPBA 2SEBD 4I6LB 4GS3A 4ZHOA 4TV3A 3Q23A 2EY5A 1PFBA 2R61A 1KQSA 4CDCC 2WX1A 2AWOA 4WFN3 1V8QA 5CBAE 1LTTD 2RVLA 3MEHA 3Q24A 3HM6X 3BZKA 1F1HA 4OVVA 3W5OA 4A3JB 2X6GA 1G91A 2KQSA 4OZCA 1SYEA 3CMEA 1C4CA 1I42A 4UP9A 4W9KA 4O2DA 2KC2A 2C5CA 1ONLA 1S5DD 3LWEA 2K25A 3AEAB 1A63A 3OTOL 1TZ1A 2LKVA 2ALYB 5KYIA 2B2WA 4IM0A 5ELEA 1XO3A 3KUZA 1QE6A 5BYRA 1B44D 3RYTA 4LNIA 2RCFA 4K0KL 4LF8Q 4DKAC 1IBLL 4MJSB 4AUQC 4TRDA 4YWKA 4IUMB 4TUUA 3BYTB 3I4NG 3CPFA 5NUCA 3TMEA 2BYFA 3T8MA 4PYUA 1YJ1A 2EYJA 5AFWA 1JICA 3NK9A 5EE9A 2DLBA 2RPVA 3RNAC 4KD4A 1D5XC 3ICEA 1VCBA 2MJEA 3DDCB 1HQMC 1GHKA 1QOFA 1SFOB 4USAA 3DVGX 1WYGA 3PO0A 4BBSH 1C8CA 1FFUA 1PTOD 2KHIA 4DR5Q 2K03A 1X6OA 3S17B 4PZ8A 4X6AH 3ZNZB 4DK0A 1YIWA 2F0EA 2M00A 2JA7B 2LD9A 4RGNA 1NSNS 2PEAA 5AUKA 2QDBA 3R7RA 1JWBD 1VQBA 2ENBA 2Z0SA 1JWSD 1Z47A 2B2VA 1FR3A 1NY4A 1E6EB 1FPYA 4RGMA 2PYKA 1VD2A 3MA2B 2F0WA 1X54A 4POGA 3JAME 1STYA 3M4OB 4AQ7A 2F52A 4DPGA 1X56A 2HTME 3S15B 5H8YE 1MHWC 1MI0A 5ELNA 3N30A 3S2DB 4NAWA 1FNUA 3GTPH 3ZQ4A 1KM7A 5EE1A 4AYBB 3NVVA 4JI5Q 1K83H 1HA6A 3W3AA 3RMHA 4A3DB 1EUVB 2KT7A 2WV6D 5BYQA 4K7UA 1V97A 4O0AA 2HDMA 2AWNA 3FKIG 4YWLA 1EQQA 1T3QA 2YYZA 1VQGA 2A19A 5K5PA 1XYIA 4AYBE 5JEAG 1V9PA 1E90A 3DVNV 4YTNB 4FULA 1MJDA 1LT4D 2WB1B 4KY5A 2B63B 1Q1BA 3U9SA 2AL3A 1SYDA 1KDBA 5C44B 3CWIA 4ANUA 2KX0A 3AEFB 5J17A 3T51B 5AZHA 4E74A 4TQ0A 4A3FH 5C3EG 1CA5A 1IBMQ 3TEZA 4MDKE 2K6AA 2WB1E 2EOTA 4JI6L 4BY1B 5IWAL 2NVXB 1YJJA 4JI2L 3IAYA 2WXJA 1IW7C 1F2ZA 4CYEA 4B6WA 4N9TA 4WURA 4G57A 2PVGC 1X3FA 3JC66 4DV6Q 5GQOA 1PGAA 3FILB 5AJ3L 2BB6A 2WYQA 3PTFC 3SDZA 4ASWC 1A62A 2NZHA 1UE1A 2NVTB 2Q8TA 1L5PA 1HUMA 4KHPL 4OZAA 2WXGA 5GADC 3PMFA 3RLFA 3I4NH 2G4SA 2WXNA 4FBJB 2EYOA 2NVUI 4R4TA 4AQYL 1SRUA 2M2LA 1UUPA 4P1CC 4DAPA 4LNOA 4L2YA 4ANXA 1QF6A 2NBVB 4UY8C 1D7QA 3HGBA 4A3GG 5KEEA 5LMNW 2JEBI 3APCA 2Q8IB 2F4VL 5T1GA 3NTIA 1DONA 4N9F4 3AU4A 2ZNVC 4Y52H 2VH1A 4FXDA 3TJPA 4V0BA 3A33B 1J8CA 1KRSA 3Q8CA 5IP9G 1GO3E 4L23A 2R2QA 1JRUA 2GRIA 3U4EG 2WAQB 2VZKB 1W6KA 4JL9A 2LWPA 2F0NA 5BMHA 2VUMB 2WXQA 3PUVA 1FCCC 2LEKA 4FYDA 3O65B 2NZOA 4XQQA 3M85A 3MVVA 4MGKE 4H02A 5DPRA 4KJOA 4OEMB 1QZEA 1RYJA 2D9UA 4KGRA 4OELB 2JE6I 2D5GA 1CKNA 1HXYD 3DHIC 1T0SC 3SEBA 1O80A 3NBIA 4N58A 1FXIA 2KWUB 2A68D 2KDMA 3GTJH 2LGXA 4HJ9A 1ZP0B 4KGTA 2PZTA 4AOFA 1K8MA 2BYVE 4GKKL 2BTEA 5LL6X 3E0EA 1VJKA 3ZYYX 1C48A 5JEAH 3URYA 2FE8A 1IBXB 1WVLA 2KQ3A 3Q3NC 4DNTB 5BN4A 4US8A 1NCVA 3LXFA 4TKNA 1SNPA 3TQYA 4A3BH 3P4QB 3A9KB 5C3EH 2QEXA 2XIWA 3HKZG 3TP5A 4RM8A 1LACA 1SNQA 1DZ1A 4XZ4A 4HROA 2SNMA 4GOCA 3BG3A 5IY0A 3ER0A 4GN5A 1HHVA 3NOBA 3TEYA 4A76A 2KFKB 3VR4A 5I6YA 1NR2A 1WJJA 1E7VA 4PQXA 1XMOL 2M4NA 4P72A 4KKTA 3AE8B 3QHTA 1WZ0A 5J2RA 1PYSB 2A73B 4DA2A 2JA9A 2G45B 2IY0B 2DGYA 5M5WH 3PF5A 3DHHC 1FD7D 2JEAI 1DOIA 2Z59B 3GTOH 1QVFA 3B1LX 3ZIMA 3OJ4B 2XWJB 2KVZA 4K8IA 3I72A 4UPAA 1CUKA 1CKNB 2IO2B 2KEEA 4WORA 5M9OA 4II3B 2Q2IA 1VQ7A 1YN4A 1PH9A 1KRHA 4L5TA 4EVOA 5IP9H 3CHBD 4JI1L 3HVDA 1MBYA 2I07B 4L5SA 1XLOA 4JOIC 2V9HA 1YHQA 4PS3A 5HFYA 3C19A 3GTGH 1N6ZA 5JPMC 4B0MA 2K1FA 3JW0X 4B9KA 3WAMA 5TR5A 1I50H 2JYTA 2QDFA 3AE6B 3L16A 2AQ2B 2KK8A 3SK5A 1ACCA 4B95A 2MRPA 4F88A 1RF2D 3NWSA 4A3IG 1PGXA 2GI9A 1JOQA 3CCEA 3IRBA 4GLXA 1KNAA 4FXGC 1CSQA 2VY3A 3H6MA 1V5TA 4WWNA 4NXML 3VR8B 2QA4A 3DHQA 2YU9H 4GZYC 2Q8RE 5EKKA 4KGSA 1WX7A 3FPUB 2LMCB 2JX5A 3W1YA 4R4QA 4A3LH 4YWGG 4CDDC 3DWPA 2K28A 1HTPA 2SNSA 3S1NB 3SDLC 3PO3G 2DWQA 2NVQH 2LS01 3KLSX 3J7A5 1BXTA 4ZHPA 5DPWA 2IBIB 5AZGA 2LXCA 3S1MH 2EY1A 1BOSA 4LUOA 1OXSC 3T16A 3OTOQ 4GNXB 5E4XA 5IP7G 2Q2HA 4DAYB 2EJMA 4X3TA 3P7JA 2FMMA 3NS1A 2KYWA 1KAWA 5C23A 4K0KQ 4A93G 1IBLQ 2WKCA 5C4HA 2GVAA 2CKHB 3K7AB 5C4XH 1NTGA 1A2TA 2F0QA 3K0XA 2WXRA 1EYCA 2M1MA 2CS4A 5EE3A 4JI0L 3A5UA 1G2TA 1VQLA 3HHMA 3N20C 5BYSA 1WM3A 3HFZB 1PH6A 3JVZX 3B2FA 4ZQ3A 3KUCB 2HQEA 3RR5A 3DBRI 3ONSA 3ITPA 2LI5A 3Q22A 4FA6A 1I4QA 2EE1A 2G4DB 3N6RA 5FO7B 3U4VA 2K01A 1YVCA 5I2XA 3B6YA 1Q82C 3QK0A 2OHFA 1G6ZA 5L37A 3V60A 2W3RA 3MZ5A 3SVMA 3T3OA 3VA5A 1V1PA 2ZJDA 5IOCA 1BVSA 4A3KB 2OJWA 2KHWB 3M4QA 5IGCA 5EQ0A 1KC8C 3H7SA 3S16B 2YTVA 1Q86C 3LB8C 3NUHB 2NCNA 3GE8C 2KTFA 3KWLA 2MBHA 3SD5A 1SJED 3J81i 4CHTB 1UELA 3M63B 2D07B 1UWVA 2JN4A 2JYEA 2PMZB 2CJNA 4LMQD 3OWFA 4GKJL 3IVFA 2FCMA 1TWGB 1EU4A 2NTTA 2WXOA 1WXSA 1N8RC 3NJTA 2N8NA 2K5HA 3K59A 4ZK9B 4X3KA 2IJ0A 2KJ6A 2PMZE 1WCMG 1X9NA 2IYDB 2L5TA 3NE5B 3E9HA 1D1KA 1D2BA 3CKIB 2IGDA 3HOYB 3AE5B 5FLXL 3TEWA 4HMIA 1X32A 1E24A 3A8KE 3SXHA 5LXIB 3CU7A 2C60A 3W5UB 4X66L 4NPNA 4IJHA 2Y3AA 4JI6Q 5IWAQ 4BXXG 2XRSD 4JI2Q 1B50A 5DEHA 3VR5A 1XX8A 1PUTA 5DM63 5IP7H 1E7PB 2LASA 3RZOH 3OG5A 2Z9HA 2QGQA 3Q8DA 3F2CA 2NYZD 4ZUJA 1V1PB 5AJ3Q 5C0XI 4KJNA 2JSVX 2N7JA 2WXFA 2KA7A 3GDEA 4NXNL 1WIAA 2HIXA 2RHSB 2NS5A 1DCZA 4LLGM 4DDID 1B9RA 1D5MC 1IYJB 2ES2A 2KUMA 4KHPQ 3NS8A 5H92C 4AQYQ 1WJ6A 3VRBB 1HJPA 3BJUA 4LK0M 3TDQA 4N6EB 3EHVA 2MH7A 3NZ3A 3V05A 5GAGC 2KQ4X 3UDIA 5IIFA 2F4VQ 1NYQA 4C3JG 1J5EL 2QC8A 2K8HA 2K0PA 2SOBA 1VDVA 3VTVA 1HZCA 3ERQA 3CSTA 3S1RH 3R7QA 2GBNA 3RD4A 4W9EA 4JI7L 1EOTA 3EC8A 4EKUA 1EO6A 2HJ1A 2X8XX 5LMNL 2INNE 3I4MB 4G3XB 4OGQC 2PLPA 2W54A 5E4WC 1EFWA 5HG2A 2BA0A 1TR5A 4L8JA 2NN6I 2LGSA 1J7CA 1JWAD 2EYLA 3W1SC 3U7ZA 3B2GA 3ULPA 2R7ZB 1EF5A 1EWCA 2O4XA 4TVAB 1PRTD 5A35A 3NUCA 1SE9A 4OO1G 1H95A 3RZDH 3GTQH 3ABVB 1RL2A 4IUTA 3CMMB 2PW7A 4BKSA 3H3VH 4RF0A 1PTOB 2QCPX 5KYLA 2UUBL 1E22A 4IPGA 2JSOA 3MC9A 5JPNC 5CORA 4HLEA 5G5GA 4M00A 3I2ZA 4A8XC 1YNJC 1LT5D 3D6WA 2DAJA 4KIKA 4GOPB 3Q0AA 4RM9A 3UIPB 4P16A 4GKKQ 2KDBA 1WCMH 2L1BA 4GIVA 2R6GA 1S5ED 3KF8B 4DXGA 3SK6A 4MSQB 1F2MA 1I6VC 2C7NB 4HRSA 1OEYA 3A1QA 1G51A 3TSSA 2Q2UA 2X69A 1V81A 4OIJA 3GV3A 1SAPA 4YTPB 3A8IE 5CV5A 1I4XA 1S3OA 2TMPA 1R4NI 2ZJQA 5COYA 3MC0B 1HNWQ 4ITKA 2J0TD 4RMAA 4H13C 4BXXH 4LFBL 3A9JA 1WTPA 2F0PA 2KDIA 1N62A 1HFGA 4QJFA 2BT6A 4FLHA 1QUQA 3CD6A 1WOCA 1L0WA 2N9LA 2CWAA 1YJNA 2E6XA 2K14A 1EYGA 1GJZA 1XMOQ 1IXRA 3ND8A 2Y5CA 4WJOA 3ZKJC 1TWHH 1BUVT 2WU5B 4GLVB 3AE3B 5L95C 2BDNA 2OQKA 4JCVE 1TWAB 1Y8RC 3U52E 2IX3A 1FNVA 2MJ8A 3GS2A 3NTKA 2BE5C 4KKUA 4WRDA 1VZ8A 1EFID 3NSWA 3S1QH 2J52A 2C9OA 2J42A 3NBHA 2D5DA 1B70B 3KOJA 1ZYRD 3DCGA 1AE2A 1D4BA 2KO3A 3U2SC 2IY1B 4HPPA 2JRHA 4H7BA 3WANA 4JI1Q 2ASQA 2LGIA 3J80i 1TKWB 2D0PA 3C3LA 2FBWB 1R4PB 2JA8G 3P75A 4TSSA 1V8CA 3DQVA 3I5JC 3QARA 3I73A 4FN2A 1HA5A 1ZW7A 5AZFA 4YTMB 4BBRB 2QHOA 1HRJA 4WJQA 2LHDA 5EDSA 2W82A 1XTCD 5C4JH 4MT5A 5D3IB 1Z9FA 3RNCC 4OO1H 1VQ5A 2H1EA 3R8BA 1PH3A 4JGHB 2IO1B 3QX1A 3KH0A 3V96A 1L7YA 4GSWA 2EJGC 3RCZA 1P16A 4NXMQ 3W1BA 1WX8A 4DK5A 1PQSA 1EZ8A 2XWBB 3Q69A 3KW5B 1GPXA 3CCVA 1UE6A 1T0RC 4IN3A 2UU7A 2XK5B 4IUUA 2BWES 2QJLA 1N34L 3KBGA 1E0ZA 3R2TA 1U4RA 2N0SB 2PO4A 4HPLB 3A54A 3EBEA 2Y5PA 4KZCA 4QUCA 3TEHB 2CU3A 1AP0A 4HIDA 1VCIA 4MSMB 2WKDA 4HIMA 2KQ7A 3NBHB 5C0XJ 2OTJA 2ZZPB 4YSYB 1ZUD2 3RD2A 4HJAA 1DD2A 1NVID 3BU2A 1VQEA 2R93B 4KHVA 1YNNC 4JI0Q 1Q3LA 1M8AA 2IL8A 5EGTA 3I7FA 2V3PA 4LUZA 4DAMA 3LNNA 2I5MX 5C5MA 1OXTA 3ML8A 3AE2B 4ME3A 5EAYA 1KF6B 5KHOA 4YCWA 5A2QL 2JWUA 2WACA 3WALA 5CYUA 4FVMA 2PQAA 2Z6KC 5CV8A 4EZJA 3NEMA 1HQRD 1HZ9A 3CF5A 1IHZA 4ZRKA 1EQTA 4JX1C 4IOIE 3IHPC 3SFDB 3DBRB 1Q1OA 3NQIA 2ASBA 3QWZB 4A3CG 3KLWA 5JHAA 5K36G 5M5XB 1IL2A 2NBFA 4O42A 2MJDA 1XWEA 5EKLA 3VXWA 3DBSA 4O1NA 1PH4A 1STNA 2L76A 5IYBH 2KC1A 2KX3A 1QB5D 2ZPYA 2JA8H 2L4NA 2MHVA 1QOBA 4R4OA 2RHQB 2CHWA 2XEWA 4GKJQ 4IFDH 2RMMA 3K5MA 1XNQL 1TKEA 4ANWA 2AHOB 2VW9A 3VYSA 3A4SC 5M5YH 4TMAB 2O6VA 3DWQA 3STBD 3J9CA 1C4PA 3QOLA 3CQZB 2RBMA 4HPMB 1LXDA 4WH4A 1UNSA 2NPTA 4JBMA 1EF1A 1SSNA 2JA6H 3IG3A 2E2JB 1CZPA 4RKBA 4C80A 5IP4D 1CHPD 1GD7A 2F0SA 1Y1WB 5GAEC 3AV8A 3HIZA 5ELOA 2DNFA 3G48A 1FRRA 1UWMA 3P2BA 1IYUA 2KD0A 1WGYA 1BKBA 4X66Q 4IO9A 1Y8PB 4B0EA 3WDNA 5DM73 1FJGL 3CXCA 4F7XA 2B2WC 3BDOA 1LTGD 3KLRA 5GAHC 1HTOA 1C79A 1FD6A 4I6PA 2L9HA 2QKIC 1RHPA 1I5FA 5JH5C 4MTNA 1II3A 4DV7L 2O5JC 2XNAC 3FEWX 1R9TH 2WP8J 2HD3A 4LK1C 1NMFA 2F0UA 1J6QA 2N88A 4YY3Q 4NXNQ 4BBSG 4EE2A 1NR4A 3J81E 2Z6KA 1Z2MA 5EBDA 5C4ZA 2KDFB 3ZNHB 5ELFA 1SXTA 2PZWA 1JMLA 2GB1A 1TU2B 1JQYD 2IW3A 4MJSA 3LGJA 1UBIA 1J5EQ 2V1YA 4WJ3M 3AN1A 3CCJA 4URKA 2DBYA 3M62B 4IM3A 4UAIA 4C2MH 4KLKA 4LCDE 4RH6A 4Y7NB 1TXYA 4CKCA 2LRUA 4JI7Q 1N33L 4L1BA 1E10A 1STAA 2F3IA 5LMNQ 4EQPA 1F9PA 2ZCBA 4AYBG 4HJ8A 2V3NA 1SF0A 4NZLB 4HEDA 2L00B 5K36H 3M7NA 2BA1A 3GTMH 1WY8A 2J0MA 3Q3FA 1Z7TA 3L7ZC 1YEZA 1MD2D 2ZTCA 3ULJA 1UZXB 1G6PA 1BBUA 4KI0A 2KNBA 1K9MC 4DV1L 5C44G 4A3JH 4QAYA 3OAWA 2EIFA 3PUWA 2UUBQ 1STEA 1GUAB 2WXIA 5E7NA 2IO3B 5BMIA 3PZ8A 3A74A 1I4PA 1E1TA 3DM3A 4BY1G 5IT9E 2JU6X 1F9RA 4A3FG 3H8HA 2OTLA 4LDTD 3Q6SA 1LTSD 3L13A 4OL7A 1VF7A 4B3SL 4A3PA 2DX5B 1P1AA 3IAS1 3M7GA 3AI5A 2I5LX 1PYBA 3AMUA 3NG0A 1WGHA 3EGRA 5IYCH 1SMYD 3G71A 3VA7A 1C76A 4AIMA 2BVCA 1MGSA 5IOIA 2J0KA 2G5DA 2RR9A 4FDBA 2PE6B 3CC2A 1PZKD 1KLVA 3S14B 4JBJA 1H9JA 4RMFA 4FP5D 4LFBQ 4K3CA 3VR3A 2B2TC 2BKFA 1FL0A 1HR0W 1K3BC 1E1OA 3K7UC 1G2SA 2KWVB 1YOVB 4AJWA 1R4NB 2NB0A 4K7WA 1VQDA 2E2HB 1CZWA 1V2YA 3C46A 4HR7B 2YTYA 4B9WA 2HDLA 1U4MA 4TKOB 1WZ3A 2GOWA 3AU7A 3NVYA 2BGFA 3FILA 3BY4B 2IX0A 2XSCA 2WAQG 1HNXL 2W55A 3QC8B 1FCLA 4DV3L 1BBXC 1LT6D 3WA0A 1AEXA 3N3KB 2EELA 4IWQA 1WTHA 1ICWA 4XXEA 4JW0A 4DV5L 1EWYC 1PHJA 1H9RA 3QR8A 4TQUS 3S2DH 5HGTA 4MGZE 4XYQA 4DN4M 1ESRA 4AJYB 4A3DH 2V3SA 3DHGC 1VMCA 2WWZA 4C00A 4MM3B 3D31A 1T5EA 1QT9A 2GVBA 2K6DB 2WHIA 4IC7B 2B8GA 3BZDB 4JBWA 3K9OB 1P7EA 1VQJA 3W9CB 1GC7A 2L0CA 2EYFA 2K39A 2E5LL 2E2IB 3NTHA 2B63H 5JJIA 1I7HA 2BYTA 5I4DA 1XD3B 4QCLA 2K7VA 5C44H 3MXNB 4KMUC 4J6IA 1IZ6A 1T0YA 4JYAL 1AFPA 1QKZA 1IBKL 3CCQA 2KCTA 1JB7A 2EYPA 1DM0B 4ALPA 2KDEB 2F3WA 4M8AA 2FFKB 3E5SA 2WDTB 3KYDD 1EU3A 3L17A 3HOXB 1RDPD 4RGOS 3PGZA 4C1NK 4BY1H 2NVXH 3HOVB 1LM0A 4A3BG 3EFCA 4XX5A 1JT8A 3V2TA 1FVIA 4G11A 2F0KA 3GTPB 4DR7L 2XRQD 1ZPSA 2BBCA 1PYWD 3EQLC 2GBRA 1GM5A 3KJOA 1N34Q 4BS9A 4PT5A 2AX5A 5C2TB 2K5NA 2C7HA 1KLGD 4Q0FA 2B2TA 5M3MB 4G7ZC 1UEBA 3PIPA 3A5ZB 1WX9A 1Y14B 4YHHL 1UD7A 4DHJB 2PMVA 1CMXB 5IA7A 2BYEA 3KUPA 5BR8L 5ELBA 2RSNA 4LNQA 1MG8A 3KUDB 3D3RA 4G50A 4BY7G 1E7ZA 1IBXA 3FRPB 2Y0SG 1HTQA 2I46A 3R66C 1N36L 4ZYSA 3L54A 3J80E 4JV5L 3AEDB 3BIID 1RM6C 2EY6A 3A9KA 1WI5A 3K0YA 4C7ZA 2N3SA 1V49A 2IGGA 1B7YB 1FO4A 4BA2I 2MA9B 2DY7A 4ZRJA 1WF9A 4GNXC 4DK1A 5GROA 2H88B 4L5RC 3K58A 1YJ9A 2PPBC 2JWZA 2O2LD 2EYHA 1PH2A 2JVCA 2KFKA 4E3CA 3UDFA 2AWTA 3I55A 4W9IA 4NQKE 4CDFC 1K0RA 1D8LA 3X3NA 5KNDA 3MJ5A 4G4KA 2NVYB 1S40A 4X57B 2ZJRA 1NBFC 4B3RL 2KWDA 4LF4Q 3PO2B 3UIOB 2VRRB 1A70A 1ZXTA 3QJYA 2JZPA 5H1SE 2AMCB 4MEMA 4FO2A 1LTLA 3HRZC 4IWOA 2FMCA 3DUZA 2SDFA 1VZ7A 3NQTA 1KRTA 4KZ0A 1E0BA 3DWMA 5KRUA 1XNQQ 3DEOA 1JE5A 4BWGB 4DNIA 2V4LA 4A3LG 3CIRB 2CW0C 2JXXA 2UXCL 1L6VA 1QVGA 2OEDA 4YXDB 1UAPA 3SE0A 1E2WA 4ZRIA 4P7IA 3A0JA 3NRZA 2INCC 3MTSA 1S4ZA 4DR1L 4FJZA 3H3VI 2OWOA 4YIJA 3NXWA 3AECB 3ULLA 4KKJA 4PZ7A 4NAMA 3GTLH 1K0SA 4HCSA 1HNWL 3DVGY 1PLFA 2Z4IA 4X3UA 4ZLTF 1FJGQ 5C4XG 3L08A 2V1CC 3P4SB 3QQ8B 4WWOA 4N59A 3KYHC 2KMAA 5E3FA 4C7YA 2WXKA 3OPOA 4BOSC 4OIKA 2LMCA 1RIPA 1E3PA 2K75A 5IE8A 2BQQA 3I57A 4HKQA 3FKIB 3HUIA 2KMCA 3SHLA 4DV7Q 1K52A 1YJWA 1RFKA 4A3MB 1EY7A 1L0YB 1SMXA 4MTKA 2HD5B 2IZVB 3A7LA 4GN4B 3RFZB 4AH6A 4L5QA 1WTRA 3ERSX 5EPLA 4BY7H 1YNJD 4GNXA 2VNUD 2EKEC 3K57A 1FIQA 3MFYA 4DFAA 1UE5A 4DAYA 3Q8FA 2JZZA 1CT1D 4JC0A 2EDGA 1P8LA 5C3EB 1YITA 1T0QC 3AM9A 4WAAA 3E9SA 4NPSA 2GMIC 1ZOYB 4HMJA 2A6HC 2RDFA 3RI7C 5EE0A 5CV9A 2V4IB 4WJWA 1YX5B 1B3QA 2FINB 1N33Q 3VR6A 3DM1A 1WH3A 3EECA 4BBNF 2CVRA 2INPE 4W9LA 4PMWA 4A3OA 2PZUA 1SROA 3T56B 2E74C 3J7ZC 3IBEA 2BDOA 2ICEC 3KF6B 4Z9CB 3WWVA 3V62A 3UQBA 3I63C 1MHHE 2MP1A 1C7YA 3C2PA 2BH8A 3NHHA 4A3GB 3GTOB 4PV1C 1U4AA 5DCNA 1Q8KA 1Y8OB 1MG4A 2WXMA 3L0WB 5CR3A 1EOVA 1IKLA 1KHIA 2UUCL 4FF1A 3MXUA 4DV4L 3RNUA 3RLNA 4LF7L 5CMDA 4OONA 4DV1Q 4GDLB 4XYCA 4EX5A 2MHJA 5CX3A 3APDA 2BE5D 3VR2A 1TGZB 3DEPA 3S1NH 1S5CD 4RGTA 2UUAL 1PVOA 1QLBB 2QMTA 3Q3MC 2DY8A 2LSSA 2ACZB 1TWFB 2EXZA 3S2AA 1IP9A 1BCPB 2KOLA 4OO1I 2NZ1D 1JJGA 1WYDA 3D4RA 1DGJA 4YSZB 5HKHA 1L1OB 2EMTA 4B3SQ 4J1MA 4W9HA 2JRIB 3PVLA 4P71A 1ENFA 4DF7A 1EWIA 1I50B 5C5LA 1E5WA 4UHVA 1WI0A 2IGHA 1BDOA 2A69D 2F0GA 3N32A 5JVH3 1VQMA 2MBOA 2W9NA 4K81A 4X65L 5FR6A 4HVBA 1STHA 2B39A 1A6XA 1V9JA 3E0JA 3LDZE 3TP7A 2QF7A 4PNYA 5I2YA 1K8AC 1Q10A 3AMZA 2L1AA 1M94A 1TS2A 1I3QH 2KBNA 3K5OA 2C35B 3M3YB 4BBNC 3E56A 4Q5VA 3BZCA 4J6HA 4K2KA 3I4LA 4GOPC 3S2HB 2MSED 2D11A 1VQ4A 1FMAD 3S1MB 1CTMA 1F9JA 1HTLD 2EXDA 1WSPA 3DBLI 3VYUA 1ZEQX 1JWUD 1HR0L 2B8FA 4JWSC 1B53A 2DZIA 4A3KH 5JZEB 2KOXA 1HNXQ 3D0FA 5IT9c 3U30A 1N63A 3AEVA 4ME5A 5EJWA 4DV3Q 3E9IA 1STGA 1JJCB 2N78A 3S16H 1ILPA 2HJ8A 2KACA 1YMHE 1STBA 3B08A 3B9JA 1KNEA 4B08A 1XEEA 4PMBA 2HTHA 2WQYB 4FADA 4IPDA 4DV5Q 3GE3C 5D2MB 1UF0A 2RSOA 5G3LF 3DBHI 4XGAB 2KLGA 4R8IA 3TRZA 3DOWA 4JLCA 2KN4A 2L12A 4QIWB 3HKZE 3GD7A 3OJ3A 3P20A 4IWPA 1TWGH 3TBIB 4KHZA 1YNND 3HOZB 2PNHA 2YEPF 1B9MA 4XQJA 3PIO3 1GUGA 3KLSA 4MACA 5HY6A 1F77A 2V0GA 2QDLA 4P75A 2A6ED 4QIWE 3FVQA 1VF5C 2K33A 3BYYB 1N5WA 2DYMA 5DPSA 2E5LQ 3HOYH 2R92G 3QAQA 4APVA 1OTRB 2L32A 2N9KA 5HGQA 5J3BA 2ONQA 4JYAQ 4DR3L 1IBKQ 2R3ZA 1BQQT 2E8GA 1H9KA 1LTRD 4DGZA 1YN5A 1LTAD 5FKAC 5C3XA 1JRPA 2RPQA 2N7DA 3U7DA 2KEDA 3S24A 3C8YA 1NNXA 2MEKA 3KBXA 4W9DA 4LWCA 1H9MA 1TQOA 1J8IA 5AUIA 4DR7Q 3TS0A 3HOWB 2FUHB 1B4OA 4DV2L 4XWWA 1E8XA 3JAMc 4C3HG 3LYYA 4QY7A 4KSLC 1Q81C 4LF9L 2WP9B 2F1MA 4LNNA 3K80C 3MHBA 4YHHQ 4A3IB 4GOPA 4YY3L 1KAAA 4KD3A 1TIID 5BR8Q 3KF8A 1VQNA 1I6HB 3AULA 4M8NA 3VH3B 2PQEA 1C9FA 5CGKA 2ID0A 1N36Q 1PGBA 3CC4A 3JYUA 2DNEA 4JV5Q 4FF4A 1N60A 4P1BC 3L3OC 1H9SB 2ZM6L 2MP2A 2LGDA 3PO3B 5IGFA 1N5XA 4KDLB 4LDTB 1YHAA 3M4PA 1D6EC 2K5DA 4FXCA 2MFIA 2LXAA 3ZTCA 3PHWB 4ZOHC 4MZ9A 4XE0A 1JQ4A 3VRAB 1HEZE 4BAXA 3CCMA 1KH0A 1EYAA 2UXBL 2LGYA 1M90C 2AQ1B 1JE4A 3SK8A 4ZRQA 1ZKOA 3OW7A 4CKEA 4EQNA 4A93B 3VDZA 1G8ZD 2ZXOA 2K04A 4BBRG 1W2BA 2Q2TA 3EFUA 3CRKC 5KHQA 1CFMA 1WTQA 1XPOA 3TP8A 1VQKA 1PDQA 1XT9B 1SNMA 3HOUB 3NZSA 4EOYA 1TS4A 2D10A 2GBMA 2H5XA 3IFTA 2A68C 4B3RQ 3BK2A 3UINB 1WRDB 3PPAA 1YI2A 5CHWA 3C1EA 2HUGA 3FDTA 4BFRA 1HZAA 3QO2A 3K8AA 2PI2A 2B3GA 1SE2A 1N9WA 1WJNA 4KX6B 1R7SA 4GDKB 1WD0A 1SJHD 1Y1VG 1E2ZA 1S3SG 1QG7A 1KTKA 3QG1A 4QL5A 5M3FG 4OWTB 1B8AA 2UXCQ 2EKIA 1B1ZA 2R92H 1ET6A 1XF5L 2N7EA 1XCQL 1ILQA 4KV6A 1T6BX 3AB5A 3M95A 1OGWA 3QA8A 4IUPA 2M19A 3H0GG 4DR1Q 1F2YA 1HUNA 1DOLA 3Q3OC 2PJHA 3KYCD 3AE7B 1JC7A 2BS4B 2MP2B 3CCLA 4PK1A 1VQCA 4HDOA 2K8BA 3FPPA 4LFCQ 2DZKA 4G7OC 1QZHA 2R93G 2B76B 2WU2B 1FGBD 2BWFA 3RNEC 3L2PA 1Q1EA 3MXGA 2IHEA 4C3HH 1ISNA 3DPDA 4EUTA 1SIJA 1ZE3D 5CV4A 3T13A 2X38A 1YNTE 1BT0A 3TP6A 3PLUA 2XK5A 1T5XD 4CJ1B 4R4CA 4DQOC 2LXJA 2R2OA 1WCMB 5JXVA 1K51A 3ALBA 2CJOA 3AU5A 2MBEA 5T1IA 3Q6BA 1TWAH 2MBQA 3X23A 4YSXB 1EY4A 3PUYA 1SBBB 3J7YW 2VZKD 1K3RA 3D4DA 3IL8A 4G0NB 1T9HA 5HURA 1Y56A 2K5QA 1JWMD 1UH6A 1OO9B 2N4FA 3VTUA 4A3EB 3AEEB 3ZXVA 3VH4B 2XTIA 2MBBB 2L3ZA 3Q8EA 2J53A 2JP1A 3AFPA 1CI3M 3ZVVA 5E6JA 2WIIB 1WGDA 1BMLC 4LTUA 1EIFA 5IYBG 1F9QA 3PIOA 2CR5A 3RT3B 2SAKA 1L2FA 2PI2E 2BH2A 2FCQA 1GUTA 2LJIA 4W9CA 4BBRH 1X3EA 5C3WA 3OW2A 4DDGD 2OEOA 1JORA 1EY6A 3JAML 1ESFA 3CCRA 1VQ8A 1FYCA 4IFDG 1P0RA 3P1MA 1Q5WB 3WCQA 1CA6A 1L2NA 1ASYA 2NTSA 2IDYA 2F0HA 1F2RI 3GZNI 2AQ3B 2TSSA 4JK1C 1LGRA 1S5BD 5JJKA 4C3IG 2WLBA 3RPFC 4C3JB 3KDFA 3F2UA 2E2DC 2UUCQ 2FNJB 2JA6G 4DV4Q 4LF7Q 2BKRB 2L52A 4LNKA 1VQAA 3PQIA 3CC7A 3PRMB 1NDDA 1Y1VH 4QUFA 4WJNA 1C9OA 3BVZA 4PMCA 2F03A 4HSVA 5M3FH 1YIJA 2CCZA 2UUAQ 2N9XA 3BWUD 3TCAA 4EEWA 2ZJPA 3GTKB 5IYDH 3CW2C 2YVCA 4JI4Q 4I7AA 4QB4A 2GA4B 4RWSC 3OHXC 3A7AB 2EQSA 1WTOA 2JT4B 3H0GH 4BKGA 3KJPA 1DOYA 3F1ZA 1HE8A 2G9HD 2L7RA 2OXPA 4X65Q 4CKBA 1PZID 4MN3A 1XJVA 3DLLA 1LQBA 1ZDXA 4MGIE 3ND9A 4LFAL 3V6EB 1OFFA 4L63B 5LHY1 4OX9L 1K8OA 4HN7A 3CMAA 2R93H 2MWSB 2FHTA 4HAEA 2BCOA 5JAVA 2M17A 3F8TA 1M4VA 4RKLA 1TS3A 3I90A 4S3SA 2KCNA 2L0FA 2DNCA 2E3TA 2KVMA 3I8ZA 3MP9A 2M0XA 1LFDA 4P74A 1WMHB 3AE1B 2BB5A 3WAPA 2XBBC 2A5HA 1GUSA 1O7YA 3VUWA 1EZ6A 4ABNA 2Z0DB 1HR0Q 1PA6A 2AUKA 1WGGA 1YQ4B 2DHZA 3OSOA 4I6NB 5LLIA 1IW7D 2G9DA 3HEJA 3F2DA 3KDFB 1LT3D 2CHBD 3ECIA 4MELA 1TKGA 3DBLB 3OLMD 2K9XA 1XLQA 3VQIA 5LNK1 4LF6L 5E1FA 2DYOA 2MO0A 3KK7A 4K3BA 2A1AA 3U9OA 3FP9A 4XC2A 2NN6G 4LF4L 5EPJA 1CQFA 1SDFA 4IUNA 5FO8B 3TMPB 2Z0EB 3NP8A 1WTXA 3OMCA 1FGUA 4LUVA 1C1YB 1SIFA 4JE3B 3HS0C 1NMGA 2Z8LA 3CF6E 4A3JG 2N9PC 2REXA 3DBHB 1VQOA 3IT6B 2FUG1 1H8CA 3PT2B 3ZJTA 1TS5A 3CQZH 5JHBA 1I4GA 3H15A 5JJLA 2VS1A 2ZW0A 3V6CB 3ZTDA 4C3IH 1D5ZC 3CSFA 1KL9A 4A20A 4UP7A 3E3XA 1SYBA 1KD1C 4RCNA 1Y1WH 2LUMA 5CC4A 3EN2A 3D8GA 2R7DA 1PH1A 4ARIA 4DR3Q 2J7ZA 3HZXA 5IYCG 2ZPNA 1WM2A 2FAZA 2D3CA 3SHQA 1RTOA 3AE9B 5IAAC 2FCSA 1M1KC 5D6JB 2JA8B 4IG7B 1CZGA 4IPHA 5J1ZA 4CDEC 5FLXE 1ENAA 1KDAA 4U68A 1NENB 4DV2Q 1TWCB 4WWMA 1ML0D 1SNCA 2O2VA 4LF9Q 2D3BA 2HT1A 3L9AX 3I56A 2ATWA 4BA1I 3VFKA 2JA7G 3N9YC 1MFWA 4MHEA 3PIP3 3K81C 4HTHA 1XTDA 3J81j 1YQ3B 2PKOA 1LM8B 3ZUNA 5JVG3 1Q90A 4POFA 3LJ3A 2OCEA 3ZDMC 2ZM6Q 4OWXB 5IGEA 1ENCA 3TBLD 1SN8A 2FCNA 1X3PA 1K8GA 4FXKC 1UGJA 4F8MA 4Y7NH 2KTRA 3TL5A 3AFQA 4CBVA 3G4SA 3PHXB 4GXBA 1I35A 2RA4A 3Q14C 1PH7A 2V4DA 4A6QA 1TZOA 2B29A 4DXFA 1RD9D 2UXBQ 1RLFA 3BINA 1J0GA 4QF4A 4DR2L 2QEJC 3PV1A 3AEBB 5C6AA 4A3DG 4HWIB 4XWTA 2EMSA 1EY8A 1C4AA 3TS2A 3MXPA 1IUEA 3RUIB 1J7AA 3M9BA 2NN6H 3KWVA 4OXPA 1J7BA 1TJEA 1MIUA 3QCAA 2RDGA 2JY6A 4XT1B 1A8VA 1A3VA 1V43A 2WB1G 2B63G 5I6WA 4JI8L 2ZXPA 1DYQA 5L83A 5MPOA 4JIOU 2WXLA 2KN5A 1X55A 5IGBA 4C1NI 5I9PA 3QWNA 2O2VB 3L10B 1X65A 4X64L 2JA5B 2W3SA 2J7QB 2KXJA 1EL0A 1XPRA 4J3OD 3ETRA 4HDQA 4HIKA 3K5LA 1AH9A 2IWHA 5M3MG 3GTMB 2WDRB 4MM3A 4JWUC 1ET9A 4HJ7A 1YN3A 1JOKA 4RHSA 5GXGB 1VLBA 1XPUA 4A9AA 1WR6E 2OT2A 4M0WB 2CH4A 4MGYE 3S14H 2F0JA 1YNXA 3VAWA 2H4OA 1NJIC 5AEKB 2UU9L 1LO5D 2Z4HA 5ISRA 2KTRB 3B0AA 3MXNA 2KCCA 4RG1A 3D4WA 1QILA 5HHDG 1TIFA 5TSSA 1N32L 1K50A 1SFOH 2E2HH 3OIQA 2RGFA 5I9OA 2LRWA 3UGBB 3S17H 2GBJA 3ENEA 5G55A 1RODA 3EVQA 4KK7A 2JA7H 1XCTL 4GN1A 4DWFA 3NWTA 1RKNA 3VVWB 1ZYRC 3R93A 4FHJA 4K1RB 2B2YA 5LL6S 2KMMA 1QOAA 2ZCCA 4RCOA 4NJ7A 2UYZB 1SGHA 3OOCA 1YD8U 3FMCA 4JI3L 2VUMG 4K2LA 2F0MA 3M4OH 2PW5A 4GLSC 1JCKB 3S15H 3PO2G 1EIHA 4ARCA 3DWGC 3Q8AA 4IW0A 3L4PA 1SNOA 1PDXA 1BCPF 1BUIC 5BMGA 1K28A 2JK8A 4I7ZC 1ZGUB 2AEHA 5C3JB 2WNMA 2JXTA 2K22A 4BBSB 4PS7A 1QOGA 3MAQA 4NJ6A 2ON8A 2K4KA 3TZUA 2HCIA 2KENA 3WOFA 5E6OA 2LHEA 1Z6HA 4JPSA 2E2IH 4XTCS 2K5PA 4UP8A 1B2TA 1VQHA 2PW9A 3FC4A 1WGKA 1Z5SB 3W1GA 2NWGA 2LVQA 3GB1A 4EGVA 1BBWA 2PNRC 1EQRA 1QNUA 1JR0D 2EY2A 3N52A 4A4IA 3HOXH 4DHZB 3HOVH 3GZNB 3AQQA 4C56C 1EM7A 4ANVA 1Q12A 2LVPA 2M56B 3KVFB 2KWCA 1A15A 1HZBA 1NE3A 4R8NA 5FLMG 3MHZA 2ZW1A 3RN5A 5DNFA 4DHZE 1K83B 5M3MH 1EY0A 5JEAJ 4BOZB 3U4ZA 1QOHA 5JOBA 2NVTH 4ODGA 4A3MG 1GNUA 5IO9A 3C0RB 3VR9B 1PRTB 1GXDC 1ROEA 4H0LC 2G3QB 4UDUC 1ZXHA 1LV9A 2ZXRA 3A56A 4LFAQ 1XNRL 4GLAC 2N49A 1G291 4V190 1GC6A 4OX9Q 4HK2A 4OW0A 1GB1A 1IGDA 4ACFA 1DXMA 2F0OA 2RQXA 1P98A 3K9PB 3H91A 4J8QA 3ZRFA 4IUQA 4KN4C 4XDCA 1RAXA 1X3QA 4IZ8A 2BS2B 4BKSD 1SYFA 4A3FB 1D3ZA 1BCPC 2KECA 3AB9A 3UI2A 5D65A 1L1OC 1ASZA 1RRBA 4U673 1JROA 4CQNA 1FXTB 4GN3B 2MCNB 1EIYB 4B3ML 3T3NA 1OQRA 4A90A 1CK1A 4X3SA 2J4XA 1UGMA 3EFXD 5G2NA 2VUMH 4IUVA 1SR3A 5A2QE 3PRPB 1S72A 3QIJA 3I4NB 4MNOA 5EBCA 1HNZL 2NVYH 3JSVA 1WFQA 3G6EA 4LF6Q 3PO2H 3T1YL 3NVWA 1SE8A 4NAWB 4N9PA 4NW2A 2UXDL 1BR9A 3H1UA 4HKZE 5CBEE 4PZ6A 1P3QU 4BVUC 3STBC 2QSDA 4NY0A 1A3TA 1R4MI 3M3JA 4ULLA 3T53B 2WX0A 4ZKCB 1SYGA 2IX1A 5G3LD 1SLJA 5CHFA 3QIAA 4E71A 3AE4B 1NEKB 4EQOA 1TKYA 2OQ0A 2LVOA 1GOZA 1C0AA 1EEFD 5BO4B 2F0LA 1OQYA 1BF4A 2K52A 3ONAB 2F0IA 4E6IA 1GG3A 2DJFC 3KF6A 1ZDVA 3ML9A 2RF4A 1WTVA 5DLQE 2WAQE 3LWUA 2K5WA 4DV0L 2ZT9C 1Y8NB 3MWYW 2PIAA 3NVZA 1HH2P 4B3TL 5FLMH 2R7FA 5CV6A 1OXXK 4LFCL 1TTNA 4HJGE 4OVUA 4F87A 4GDLA 4JQWC 3APFA 3FKIH 1WYWB 3R3MA 2G1EA 4XYOA 4F7ZA 2VB2X 4A3MH 3GTJB 1QNKA 4FJVB 4RA8A 5F2DA 3GO5A 1DGSA 1U4PA 1NUCA 4X62L 1L1OA 4CJ2C 3UQAA 4H44C 3JSVB 5DAUA 3I70A 3NHEB 4NQLB 4HCEA 4NP5A 2VQFL 3UDGA 4K5VA 1FFVA 3PUXA 3WIMA 1EY9A 4A3KG 4A3BB 3PRZA 1DOKA 3GTLB 2EJFC 1C77A 5EPKA 2NBWB 2JF5A 3KQ4A 3NZUA 1K73C 3PZ7A 4DUYL 4ZYNA 3VYRA 4JG2A 1PTOF 2L11A 4P2CB 2D2QA 3BS1A 2MUYA 4K6LA 4IKGA 2JQRB 2UWQA 3QOJA 1XQQA 3I9V1 2IO0B 1HZ5A 2D0OA 2I0QA 2ZTDA 4DR2Q 1HPCA 3HOZG 2X6LA 4R3DA 3PCOB 2CQAA 1FEHA 1OXVA 4ZAIA 4BY7B 4NMZA 5FLXc 2Y0SB 3RUZA 3BDLA 4A3GH 3ZLZA 1KOTA 5M5WB 5D14A 1WJUA 5KNBA 3RULA 1KJTA 3SGIA 3N1XC 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 1IYVA 3X3MA 4JI8Q 4RF1A 2Y0SE 2A4ZA 3J81c 1PFSA 2KHSA 3HG9A 1TWFH 3UE0A 2CH4W 1IL8A 1MI2A 1VQ6A 1KABA 1SMYC 4X64Q 2FIDA 3H09A 1I94L 3R3OA 3GTGB 4JI4L 1L0XB 1UEAB 5E6NA 5G5HA 5LMUL 3HOWG 3MFGA 1X1MA 1EYDA 1Q46A 2K8CA 4KVGB 4WJPA 1ICFB 2LFIA 1GB4A 4REZA 2OF1A 3H94A 1P9DU 2VZAA 1UE7A 1MHXA 1QZGA 2GBKA 1CM9A 2L8JA 2L15A 3K7AH 3NPPA 1W3SA 3I3CA 1S1QB 1GUNA 3SFEB 1A0IA 1VRAB 1YHBA 2UU9Q 2YU9B 1FRDA 3Q8BA 4W9JA 3SU8X 1PTOC 2JYOA 3IFWB 4GU2A 3M3YH 3IT4B 4KN7C 3S2HH 4ILWA 2F0VA 1N32Q 3PGEA 2D2CC 2EYMA 4LF5L 1E8YA 2ZNVB 1SSOA 2NVQB 1HZ6A 2RDBC 2RDHA 3RNBC 4ZDVA 2O6VD 3ZGZA 3HK0A 1V86A 1I4RA 2K3UA 1H4RA 1LLRD 3I4MG 4MH8A 3U50C 4NKLA 1V5OA 3RLOA 1SEBD 4EFOA 2JJQA 4K8JA 5J22A 1A5RA 3RZFA 5D3DA 3PUZA 4JI3Q 2ZTEA 3HKZB 2WXPA 1I4HA 3HOUG 2R7ZG 1WXVA 5C4XB 2A5UA 3ZNID 3H3VC 1R4QB 4KTAA 4P73A 2QCZA 1I3QB 1WXAA 3M4YA 3C1FA 3ZDTA 4QMGA 1YX6B 2DAFA 2L55A 3Q3JA 4F1SA 3V61A 4AP4C 3AYHB 3CCSA 3RNGC 5J18A 1H9SA 4WWPA 3HOZH 1WRIA 3A8JE 3HKSA 4HXDA 3PF4A 2PCFB 2LZ6A 4HJ5A 3OIPA 2DJGC 1P7FA 3GQBA 1PFDA 3SR1A 4JOIA 3PREA 4M02A 1JB3A 3IFDA 1RFAA 3ZRCA 1SNDA 5D7GA 1E7UA 4RNAA 2D62A 2L0TA 2LJ5A 2MLBA 1EQVA 5KGUA 4JPBW 2I2YA 1CKOA 2E75C 2Y5BB 1XLPA 1TY2A 5KNCA 4IDIA 1XLNA 4P6VF 1EY5A 4AS1A 4IFDI 3J7AV 2YTXA 4ZCKA 2K50A 4WIPA 2KJRA 1AN8A 2PE9A 2IHFA 2VQEL 4K5WA 2FIFA 3HOWH 3G7LA 1GJXA 4DUZL 4FF3A 3MJWA 5IN7A 4G7HC 1RWSA 4IOCA 1AWDA 4IURA 2CHXA 4A3IH 3PS6A 1F0ZA 4GDKA 4FF2A 2ZEQA 2I1KA 4DXAB 1RTNA 4HEA1 2QILA 4RFBA 2Q5WD 2JXMB 1I6HH 3RNFC 1XNRQ 1VDZA 2IPKD 3BVMA 4XDXA 1BO0A 4PYZA 1AZPA 1VMPA 4ICUA 2GN5A 4HCNB 1CHQD 2K6QA 2O5IC 2P5ZX 3PZDA 3PO3H 4PG3A 2HIVA 4A3EG 2MQHA 1XMQL 3J7AF 1Q0WB 2I38A 2Z1CA 1EEID 4DU9A 1O78A 4II2B 2H89B 1LABA 4ZRZA 4ID6A 4BZAA 1LTID 3FAHA 2KAJA 4GB9A 3J81L 2CU1A 2JZ3B 3IAM1 2HQLA 4DR4L 4KV2A 1N61A 3I4MH 3RZOB 2F0FA 1VS0A 3BVGA 3DVNU 1IYFA 2YV5A 1VQ9A 4A93H 5LXHA 4B3MQ 2M0AA 2XVSA 3H6NA 2YLMA 2HHHL 1GUWA 1IPGA 4KSKC 3HOUH 2R7ZH 4CHKA 2C5LC 3MEFA 5EKIA 1HNZQ 1F52A 3FKYA 2BPSA 1SE4A 4D2KA 3ZJUA 4JBKA 2DZMA 3NENA 5FOBB 1GUOA 4A75A 3T1YQ 2UXDQ 1GVPA 4C4VA 2CHZA 2J0JA 1CKMA 1U4LA 1WR1A 4XDDA 3T9LA 1K53A 5E6PA 1PTOH 1C4QA 3P4RB 1DOXA 2JPHA 3S1RB 1LTBD 2OOBB 3T1HL 1EIGA 1OEYJ 3RN9C 1LYLA 2QW7A 3J80c 4ICVA 4IALA 3RN2A 4DR6L 3HM3A 2HDEA 1R4MB 5IYDG 1UBQA 3RZWC 2LUEA 3S9WA 1WGRA 5IGGA 4R1JA 4QGUA 1KIXA 1O7LA 4DHJD 3EJIA 3V3XA 1AYFA 2AKWB 2KANA 4K14A 2WGSA 2N1WA 1AARA 1F2LA 1PXUA 4N8X1 1YBYA 5IT9L 1Y69U 1E9MA 4DV0Q 3CRLC 2AYOB 3AH7A 2BF8B 3RZDB 2L05A 1MKHA 1AW7A 4YCUA 1A2UA 4B3TQ 3GTQB 1J19A 3IKJA 3EUB2 3UDXA 1FNWA 3JAMi 3DXJC 2VL6A 4MIUA 1B9NA 1YJIA 1GAQB 2D3AA 2N9EB 3W5VB 1TT5B 3K5NA 5DPTA 3OWEB 4RAUC 5CTRC 2KJHB 1EWHA 1CQVA 4Q2JA 4QQBX 3N1YC 1PV4A 3T4AC 2R92B 2MQJA 3TEXA 3DWAA 4X62Q 2DENB 3SR6A 1SYCA 5ELCA 3ZW3A 2XGTA 3H9DA 3QJZA 4LF8L 2VQFQ 5CHVC 1DOMA 1NAPA 3F2BA 4K5XA 4A3EH 3GOEA 4C4VB 1JMCA 1V80A 1ZXIA 3GP7A 1TBEA 1RCVD 3G6JB 2N55A 2GLSA 1OXUA 1U5KA 3IXSA 1E8ZA 2RKSA 3O13A 4DUYQ 1QJOA 3DMUA 3EROA 1WE7A 4JVZA 3ZNGC 1G6JA 4B9XA 4KY6A 4OZBA 2JQOA 5CV7A 4C3HB 3E6ZX 2VH2A 3LX0A 2BOSA 2KVRA 1SB3C 2MPMA 4S0RA 2A8VA 3PV0A 4DR5L 3P63A 2KCMA 1Q8IA 1K8RB 4NNJB 2RD0A 4DAVA 3CCUA 1TWHB 3SK4A 3L0OA 1WMHA 1DJRD 2ZVOA 4YWMA 3UI3A 2B2UC 1A3UA 1QVCA 2AUJD 1WXMA 3W2DA 3Q2AC 3NELA 3BDCA 3I4OA 2EVBA 2KJXA 4C3JH 1PFMA 2M8SA 5GMVA 4WJ4A 3S1QB 4EZLA 2K5VA 2PTLA 1L4DB 1Y1WG 3W1SA 2CFMA 5IGDA 1WE6A 4IM2A 1TVXA 4KKSA 4KIKB 3TIXA 3OYYA 2A69C 3A55A 2C9WB 3GTKH 3VTWA 4F8CB 5FO9B 1FM0D 3MTNB 4IFDJ 1WXQA 4HJKA 2Z6BA 2C7MB 4JI5L 3UE1A 1I94Q 3A1QB 4J15A 5LMUQ 1PZJD 3P1HA 4NDXA 2KHJA 1IKMA 1C78A 1LUZA 1CJEA 2AL6A 1S5FD 3X0WA 2PPHA 4OHJA 2NMQA 5C4JB 5D94A 1NI3A 4L6TB 2K32A 1GKHA 4US9A 3WOEA 4S17A 3TUOA 2WDQB 1O7IA 1VQPA 1WFYA 3A9JB 4DBGA 2KKCA 4EZKA 1HCZA 5C1ZA 1PH5A 1QUQB 2VXWA 5C0XG 2INDC 4H2AA 2IY5B 4LNFA 1W6JA 2HCCA 1Y1VB 2OJRA 1IBML 3N1ZC 4WAFA 5FR3A 5M3FB 1YZ6A 3KFUA 1MPEA 3MC8A 1X3GA 2FJ2A 2WXHA 2ICIA 2BW2A 4LF5Q 1PMRA 4CO7A 4ZKBB 4HSPA 3D32A 4ZRPA 5BN5A 2YEPB 4DV6L 2L83A 1TYGB 2A74C 4R9WA 5J39A 4NB3A 2WINB 3H0GB 3J80L 2BS3B 3BK1A 1WJ4A 5FJ8G 2WDVB 2RCNA 2WFWA 2MO1A 4BKTA 3TZDA 1TT2A 4GGQA 2CWPA 2DZJA 4FHKA 1MJCA 1VQIA 5M5XH 1B3AA 3EIVA 1V6EA 1VR9A 2DYBA 1OTCA 2KFJA 1C3TA 3VUYA 1JJ2A 1U0LA 4HIOA 2PVOD 1U9RA 2ZVNA 2XN9C 2DUDA 4ZUIA 2B2UA 3R2IA 4AWJA 2MGSA 4LAAA 4CGYB 1MJEA 3TN2A 2MX2A 3P42A 2A6EC 1WD1A 1V1OA 1AZQA 1E8WA 4A55A 4M8MA 1KFYB 2JA5G 1BCPD 1MSGA 5FK9C 2NBUA 5JJZA 1WTWA 2D3GA 1PRTF 1SE3A 3UF8A 3HP3A 1KXLA 4WQMA 2E2JH 1V1QA 1FXAA 4W9GA 2IT1A 3CPWA 4KY7A 1J9OA 3P4PB 4OVZA 1L0VB 5T8IA 1XXGA 4XT3B 1JALA 1OQQA 3FHWA 2LY7A 4KKIA 4EQ5A 1UWXA 2KZRA 5KIXA 1VQFA 2F3VA 2VB3X 3GV6A 4HCPB 4I65A 2NUCA 3VHTC 5BN3A 2CQOA 2VQEQ 4FJYA 4PS8A 2K05A 1TWCH 4LJZC 4DUZQ 3ZO5B 4DK6C 3TREA 4LW1A 3VYTA 5M5YB 4IOAA 2I5HA 1F9SA 2E76C 1BNZA 4XIGS 2LFNA 4YCVA 4C3IB 3VDYA 1RJTA 2I1JA 2MNAA 4IJLA 3I3TB 2JA6B 2CW0D 2EZVA 3H7PA 4M01A 5C0XH 5IODA 1NYRA 1F2RC 3NY5A 1ZKHA 1L6UA 2N1VA 1WWTA 1XMQQ 1QCBD 1QQRA 2MJ3A 2M9VA 4YL8A 4M0WA 2LXKA 2F0TA 1PFNA 2WS3B 1Q7YC 2PQAB 5ELDA 3HRDD 3I91A 3A4RA 1IGCA 3MHSD 4KDIC 4LJOB 2KLCA 2MW5A 2K1BA 4R4IA 2B2YC 3WAOA 1QWYA 4DR4Q 1JW9D 3ZJVA 4XQNA 1TY0A 5FJ8H 4N8FA 3EA6A 4IQZA 1PRTC 3D6CA 3U58A 3VUXA 1JOOA 1R9TB 4OWWB 1YQBA 2HE7A 4K7SA 1KLUD 1KDCA 1MSHA 2HHHQ 3HVZA 1VZ6A 4MH0E 4K6DA 3QB3A 2NR2A 3K6OA 5HI1A 3ZXRA 4M1UB 4YT0B 4IPCA 1CSPA 3OMGA 4NJCA 3RMKC 1E2VA 1NI2A 1GHJA 1NBWA 2F4IA 3PSEB 3AXCA 1HFNA 4CJ0B 1MVKA 4TQ1A 3ZJYC 4C2MB 2O6VB 1D1IA 3HOXG 1EUJA 3CP0A 4DNRB 3T1HQ 2JA5H 3HOVG 4GMVA 2F0DA 4LJPB 1AE3A 2B2VC 4W9FA 5IKCM 4RHRA 4A3CH 1L4ZB 4DR6Q 2NPTB 2RSUA 3U8ZA 2DN8A 2JUOA 2QIEB 1O7ZA 2B3AA 2A6HD 3PLVA 3AEGB 4FNFA
chains in the Genus database with same CATH topology
2EPBA 2SEBD 4ZHOA 3Q23A 2EY5A 1PFBA 2R61A 2AWOA 4WFN3 1V8QA 5CBAE 1LTTD 2RVLA 3MEHA 3Q24A 4A3JB 2X6GA 1G91A 4OZCA 1SYEA 1C4CA 2C5CA 1ONLA 1S5DD 3LWEA 3AEAB 2LKVA 5KYIA 2B2WA 5ELEA 1XO3A 1QE6A 5BYRA 1B44D 4TRDA 3BYTB 5NUCA 3TMEA 2EYJA 5AFWA 1JICA 3NK9A 5EE9A 2DLBA 2RPVA 4KD4A 1D5XC 2MJEA 1HQMC 1GHKA 1QOFA 1SFOB 4USAA 3PO0A 1WYGA 1C8CA 1FFUA 1PTOD 2K03A 3S17B 4DK0A 2F0EA 2M00A 2JA7B 5AUKA 4RGNA 1NSNS 2QDBA 1JWBD 2ENBA 1JWSD 1Z47A 2B2VA 1FR3A 1E6EB 4RGMA 2PYKA 3MA2B 2F0WA 3JAME 1STYA 3M4OB 4AQ7A 2HTME 3S15B 5H8YE 1MI0A 3S2DB 1FNUA 3ZQ4A 5EE1A 4AYBB 3NVVA 1HA6A 3W3AA 3RMHA 4A3DB 2WV6D 5BYQA 1V97A 2HDMA 2AWNA 1T3QA 2YYZA 5K5PA 1XYIA 5JEAG 4YTNB 1LT4D 2WB1B 4KY5A 2B63B 1Q1BA 3U9SA 1SYDA 1KDBA 5C44B 3CWIA 3AEFB 3T51B 4TQ0A 1CA5A 3TEZA 2K6AA 4BY1B 2EOTA 2NVXB 1YJJA 2WXJA 3IAYA 1IW7C 1F2ZA 4N9TA 4WURA 4G57A 2PVGC 1PGAA 3FILB 2BB6A 3SDZA 2NVTB 2Q8TA 1L5PA 1HUMA 4OZAA 2WXGA 3PMFA 3RLFA 2WXNA 2EYOA 2M2LA 1UUPA 1QF6A 4DAPA 4L2YA 3HGBA 5KEEA 2JEBI 2Q8IB 5T1GA 3NTIA 1DONA 4FXDA 4V0BA 3Q8CA 4L23A 2GRIA 3U4EG 2WAQB 2VZKB 1W6KA 2F0NA 5BMHA 2VUMB 2WXQA 3PUVA 1FCCC 2LEKA 4FYDA 4XQQA 3M85A 3MVVA 4KJOA 1RYJA 4KGRA 2D9UA 2JE6I 2D5GA 1HXYD 3SEBA 1O80A 3NBIA 4N58A 1FXIA 2A68D 2KDMA 1ZP0B 4KGTA 2PZTA 2BTEA 1K8MA 5LL6X 1VJKA 3ZYYX 1C48A 5JEAH 3URYA 2FE8A 1IBXB 1WVLA 2KQ3A 4DNTB 5BN4A 4US8A 1NCVA 3LXFA 1SNPA 3P4QB 2XIWA 3TP5A 1LACA 1SNQA 1DZ1A 4HROA 2SNMA 3BG3A 1HHVA 3TEYA 3VR4A 5I6YA 1NR2A 4PQXA 4KKTA 3AE8B 2A73B 4DA2A 1FD7D 2JEAI 1DOIA 2XWJB 4K8IA 3I72A 2KEEA 4WORA 5M9OA 1YN4A 1KRHA 4EVOA 3CHBD 3HVDA 1MBYA 2I07B 1XLOA 5HFYA 5JPMC 4B0MA 2JYTA 3AE6B 2AQ2B 3SK5A 1ACCA 4F88A 1RF2D 3NWSA 1PGXA 2GI9A 1JOQA 1KNAA 4FXGC 3H6MA 3VR8B 3DHQA 4GZYC 2Q8RE 5EKKA 4KGSA 3FPUB 2LMCB 2JX5A 4YWGG 3DWPA 2K28A 1HTPA 2SNSA 3S1NB 2DWQA 2LS01 3KLSX 4ZHPA 1BXTA 2EY1A 1BOSA 3T16A 1OXSC 5E4XA 2EJMA 4X3TA 3P7JA 2FMMA 3NS1A 2WKCA 5C4HA 3K7AB 1A2TA 2F0QA 2WXRA 1EYCA 5EE3A 1G2TA 5BYSA 3B2FA 4ZQ3A 2HQEA 3ITPA 3Q22A 1I4QA 2EE1A 3N6RA 5FO7B 2K01A 5I2XA 2OHFA 1G6ZA 2W3RA 3MZ5A 3SVMA 3T3OA 3VA5A 1V1PA 5IOCA 4A3KB 5IGCA 5EQ0A 3S16B 3LB8C 3NUHB 3KWLA 1SJED 4CHTB 2JYEA 2PMZB 2CJNA 4LMQD 3OWFA 1TWGB 1EU4A 2NTTA 2WXOA 3K59A 4ZK9B 4X3KA 2IJ0A 2L5TA 3NE5B 1D1KA 1D2BA 3CKIB 2IGDA 3HOYB 3AE5B 5FLXL 3TEWA 4HMIA 1X32A 3A8KE 3SXHA 3CU7A 3W5UB 2Y3AA 2XRSD 1B50A 5DEHA 3VR5A 1XX8A 1PUTA 5DM63 1E7PB 2NYZD 4ZUJA 1V1PB 5C0XI 4KJNA 2JSVX 2N7JA 2WXFA 2KA7A 1B9RA 1DCZA 4LLGM 1D5MC 5H92C 2KUMA 3VRBB 4LK0M 3TDQA 4N6EB 3NZ3A 2MH7A 3V05A 2KQ4X 5IIFA 1NYQA 4C3JG 2K0PA 2SOBA 1VDVA 3ERQA 3RD4A 1EOTA 2INNE 3I4MB 4OGQC 2PLPA 2W54A 5E4WC 5HG2A 2BA0A 1TR5A 4L8JA 2NN6I 1J7CA 1JWAD 2EYLA 3U7ZA 3B2GA 2R7ZB 1EWCA 2O4XA 5A35A 1PRTD 3NUCA 4OO1G 3ABVB 4IUTA 2PW7A 4RF0A 1PTOB 2QCPX 5KYLA 2JSOA 5JPNC 5CORA 5G5GA 4A8XC 1YNJC 1LT5D 3D6WA 3Q0AA 4P16A 2L1BA 2R6GA 1S5ED 4DXGA 3SK6A 1F2MA 1I6VC 4HRSA 3TSSA 2X69A 4OIJA 3GV3A 1SAPA 4YTPB 3A8IE 5CV5A 1I4XA 2TMPA 5COYA 3MC0B 4ITKA 2J0TD 4H13C 1WTPA 2F0PA 1N62A 1HFGA 2BT6A 2N9LA 2E6XA 3ND8A 2Y5CA 2WU5B 1BUVT 3AE3B 2BDNA 1TWAB 3U52E 2IX3A 1FNVA 2MJ8A 3GS2A 3NTKA 2BE5C 4KKUA 4WRDA 1VZ8A 1EFID 3NSWA 2J52A 2C9OA 2J42A 3NBHA 2D5DA 1ZYRD 1D4BA 3U2SC 4H7BA 2LGIA 1TKWB 3C3LA 2FBWB 1R4PB 1V8CA 3P75A 4TSSA 3I73A 1HA5A 4YTMB 4BBRB 1HRJA 2LHDA 2W82A 1XTCD 4MT5A 5D3IB 4OO1H 2H1EA 3R8BA 3V96A 2EJGC 1EZ8A 2XWBB 3Q69A 1GPXA 4IN3A 4IUUA 2QJLA 3KBGA 1E0ZA 3R2TA 1U4RA 2N0SB 2PO4A 3A54A 2Y5PA 4QUCA 2CU3A 1AP0A 1VCIA 2WKDA 5C0XJ 4YSYB 1ZUD2 1DD2A 1NVID 2R93B 4KHVA 1YNNC 1Q3LA 1M8AA 2IL8A 5EGTA 2V3PA 3LNNA 5C5MA 1OXTA 3AE2B 1KF6B 5A2QL 2JWUA 2WACA 5CYUA 4FVMA 5CV8A 1HQRD 1IHZA 3SFDB 1EQTA 4JX1C 4IOIE 3NQIA 5K36G 5M5XB 2NBFA 4O42A 2MJDA 1XWEA 5EKLA 4O1NA 1STNA 1QB5D 2L4NA 2MHVA 1QOBA 4IFDH 2RMMA 3K5MA 1TKEA 3VYSA 4TMAB 3DWQA 3J9CA 1C4PA 3QOLA 3CQZB 2RBMA 4WH4A 1UNSA 1SSNA 4C80A 2E2JB 1CZPA 4RKBA 1CHPD 2F0SA 1Y1WB 3AV8A 1FRRA 1UWMA 1IYUA 1Y8PB 4B0EA 3WDNA 5DM73 4F7XA 2B2WC 3BDOA 1LTGD 3KLRA 1C79A 1FD6A 2L9HA 2QKIC 1RHPA 1II3A 2O5JC 2XNAC 3FEWX 2WP8J 4LK1C 2N88A 2F0UA 4EE2A 1NR4A 3J81E 5EBDA 5C4ZA 5ELFA 1SXTA 2PZWA 1JMLA 2GB1A 1TU2B 1JQYD 2IW3A 3AN1A 2DBYA 4UAIA 4RH6A 4Y7NB 4CKCA 1E10A 4L1BA 1STAA 4EQPA 1F9PA 2V3NA 1SF0A 4NZLB 4HEDA 5K36H 3M7NA 2BA1A 1Z7TA 3L7ZC 1MD2D 4KI0A 3PUWA 2WXIA 1STEA 5BMIA 3PZ8A 1I4PA 3H8HA 5IT9E 2JU6X 1F9RA 3Q6SA 1LTSD 4OL7A 1VF7A 3IAS1 3M7GA 3AMUA 3EGRA 1SMYD 3VA7A 1C76A 1MGSA 1PZKD 3S14B 1H9JA 4FP5D 3VR3A 2B2TC 1G2SA 2NB0A 2E2HB 1CZWA 3C46A 4HR7B 4B9WA 2HDLA 1U4MA 4TKOB 3AU7A 3NVYA 3FILA 1FCLA 2IX0A 2XSCA 2W55A 1BBXC 1LT6D 1AEXA 2EELA 1ICWA 4XXEA 1EWYC 1H9RA 4TQUS 5HGTA 4XYQA 4DN4M 1ESRA 1VMCA 4MM3B 3D31A 1T5EA 1QT9A 2B8GA 3BZDB 4JBWA 1P7EA 3W9CB 2L0CA 2EYFA 2E2IB 3NTHA 1I7HA 2BYTA 5I4DA 4QCLA 2K7VA 4KMUC 1AFPA 1QKZA 2EYPA 1DM0B 2F3WA 4M8AA 2FFKB 3E5SA 1EU3A 3HOXB 1RDPD 4RGOS 4C1NK 3HOVB 3V2TA 2F0KA 3GTPB 1ZPSA 2XRQD 2BBCA 1PYWD 3EQLC 4BS9A 4PT5A 2AX5A 5C2TB 1KLGD 4Q0FA 2B2TA 5M3MB 4G7ZC 2PMVA 3KUPA 5ELBA 2RSNA 3D3RA 1IBXA 3FRPB 2I46A 4ZYSA 3J80E 3BIID 3AEDB 1RM6C 2EY6A 3K0YA 4C7ZA 2IGGA 1FO4A 4BA2I 2DY7A 4DK1A 2H88B 3K58A 2PPBC 2O2LD 2EYHA 3X3NA 5KNDA 3MJ5A 4G4KA 2NVYB 2KWDA 3PO2B 1A70A 1ZXTA 3QJYA 2JZPA 4FO2A 3HRZC 2FMCA 3DUZA 2SDFA 1VZ7A 3NQTA 1E0BA 3DWMA 5KRUA 3CIRB 3DEOA 4BWGB 2CW0C 1L6VA 2OEDA 4YXDB 1UAPA 3SE0A 1E2WA 3NRZA 3MTSA 1S4ZA 4YIJA 3NXWA 3AECB 4KKJA 4NAMA 4HCSA 1PLFA 2Z4IA 4X3UA 4ZLTF 3P4SB 5EE0A 4N59A 5E3FA 4C7YA 2WXKA 3OPOA 4OIKA 2LMCA 4HKQA 3I57A 3FKIB 3HUIA 3SHLA 1K52A 1RFKA 4A3MB 1EY7A 1L0YB 3RFZB 3A7LA 1WTRA 5EPLA 1YNJD 2VNUD 3K57A 1FIQA 3MFYA 4DFAA 4DAYA 3Q8FA 1CT1D 2EDGA 5C3EB 3AM9A 3E9SA 1ZOYB 4HMJA 2A6HC 2RDFA 5CV9A 2V4IB 4WJWA 2FINB 3VR6A 3DM1A 2CVRA 2INPE 4PMWA 2PZUA 3T56B 2E74C 2BDOA 2ICEC 4Z9CB 1MHHE 2MP1A 3C2PA 3NHHA 4A3GB 3GTOB 4PV1C 1Y8OB 2WXMA 5CR3A 1IKLA 4FF1A 3MXUA 4GDLB 5CMDA 2BE5D 3VR2A 3DEPA 1S5CD 4RGTA 1QLBB 2QMTA 2DY8A 2ACZB 1TWFB 2EXZA 1BCPB 2KOLA 4OO1I 2NZ1D 4YSZB 3D4RA 1DGJA 4J1MA 1ENFA 4DF7A 5C5LA 1I50B 2IGHA 1BDOA 2A69D 2F0GA 5JVH3 1STHA 2B39A 1A6XA 3E0JA 3TP7A 2QF7A 4PNYA 5I2YA 1Q10A 3AMZA 2L1AA 1TS2A 3K5OA 3M3YB 3E56A 4Q5VA 4J6HA 4K2KA 3I4LA 3S2HB 1FMAD 3S1MB 1CTMA 1HTLD 1WSPA 3VYUA 1ZEQX 1JWUD 2B8FA 4JWSC 1B53A 1N63A 4ME5A 5EJWA 1STGA 1ILPA 2KACA 1YMHE 1STBA 3B9JA 1KNEA 4B08A 1XEEA 4PMBA 2WQYB 2RSOA 5G3LF 4R8IA 2KN4A 2L12A 4QIWB 3GD7A 3P20A 3TBIB 4KHZA 1YNND 3HOZB 2YEPF 1B9MA 4XQJA 3PIO3 1GUGA 3KLSA 4MACA 1F77A 2V0GA 2A6ED 2DYMA 3FVQA 1VF5C 2K33A 3BYYB 1N5WA 2L32A 2N9KA 2ONQA 1YN5A 2R3ZA 1BQQT 4DGZA 1H9KA 1LTRD 1LTAD 5FKAC 5C3XA 1JRPA 2KEDA 3C8YA 2MEKA 3KBXA 1H9MA 1TQOA 1J8IA 5AUIA 3HOWB 1B4OA 4XWWA 4C3HG 3LYYA 2WP9B 2F1MA 3MHBA 4A3IB 1KAAA 4KD3A 1TIID 3KF8A 1I6HB 1C9FA 2PQEA 5CGKA 2ID0A 1PGBA 2DNEA 1N60A 4FF4A 3L3OC 1H9SB 3PO3B 5IGFA 1N5XA 1D6EC 2K5DA 4FXCA 4ZOHC 4XE0A 1JQ4A 3VRAB 1HEZE 1KH0A 1EYAA 2AQ1B 1JE4A 3SK8A 4ZRQA 1ZKOA 3OW7A 4CKEA 4EQNA 4A93B 1G8ZD 2ZXOA 2K04A 3CRKC 1CFMA 1WTQA 3TP8A 1PDQA 1SNMA 3HOUB 1TS4A 3IFTA 3BK2A 2A68C 3C1EA 2HUGA 3FDTA 3QO2A 1SE2A 4KX6B 1R7SA 4GDKB 1WD0A 1SJHD 1E2ZA 1QG7A 1KTKA 3QG1A 2EKIA 1B1ZA 1XF5L 1ET6A 1XCQL 1ILQA 4KV6A 1T6BX 3AB5A 4IUPA 2M19A 1F2YA 1HUNA 1DOLA 3AE7B 1JC7A 2BS4B 3FPPA 4G7OC 2WU2B 2B76B 1FGBD 1Q1EA 3MXGA 1SIJA 1ZE3D 5CV4A 3T13A 2X38A 1YNTE 3TP6A 1T5XD 4CJ1B 4DQOC 5JXVA 1WCMB 1K51A 2CJOA 5T1IA 4YSXB 1EY4A 3PUYA 1SBBB 3J7YW 2VZKD 3D4DA 3IL8A 1Y56A 5HURA 2K5QA 1JWMD 1OO9B 4A3EB 3AEEB 3Q8EA 2J53A 2JP1A 1CI3M 5E6JA 2WIIB 1BMLC 4LTUA 1F9QA 2SAKA 1GUTA 2LJIA 5C3WA 2OEOA 1JORA 1EY6A 3JAML 1ESFA 4IFDG 3P1MA 1FYCA 3WCQA 1CA6A 2NTSA 2IDYA 2F0HA 1F2RI 2AQ3B 2TSSA 4JK1C 1S5BD 4C3IG 2WLBA 3RPFC 4C3JB 3F2UA 2E2DC 2L52A 4QUFA 3BVZA 2F03A 4PMCA 4HSVA 3BWUD 3GTKB 4QB4A 2GA4B 4RWSC 3OHXC 3A7AB 1WTOA 1DOYA 2G9HD 2OXPA 4CKBA 1PZID 4MN3A 1ZDXA 3ND9A 1OFFA 4L63B 5LHY1 1K8OA 4HN7A 2FHTA 4HAEA 2BCOA 5JAVA 1M4VA 4RKLA 1TS3A 3I90A 4S3SA 2KCNA 2DNCA 2E3TA 2KVMA 3I8ZA 3MP9A 3AE1B 2BB5A 2A5HA 1GUSA 1O7YA 1EZ6A 4ABNA 2AUKA 1YQ4B 3OSOA 1IW7D 2G9DA 3HEJA 1LT3D 2CHBD 1TKGA 2K9XA 1XLQA 3VQIA 5LNK1 5E1FA 2DYOA 3KK7A 3U9OA 2NN6G 5EPJA 1CQFA 1SDFA 4IUNA 5FO8B 3NP8A 1WTXA 3OMCA 4JE3B 3HS0C 2Z8LA 3IT6B 2FUG1 3ZJTA 1TS5A 1I4GA 2ZW0A 1D5ZC 1SYBA 4RCNA 2LUMA 5CC4A 3D8GA 4ARIA 2J7ZA 3HZXA 1RTOA 3AE9B 2JA8B 1CZGA 5J1ZA 5FLXE 1ENAA 1KDAA 4U68A 1NENB 1TWCB 4WWMA 1ML0D 1SNCA 3L9AX 4BA1I 3N9YC 4MHEA 3PIP3 4HTHA 1YQ3B 2PKOA 5JVG3 1Q90A 5IGEA 1ENCA 1X3PA 1UGJA 4FXKC 4F8MA 4CBVA 2RA4A 2V4DA 4A6QA 1TZOA 4DXFA 1RD9D 4QF4A 2QEJC 3AEBB 5C6AA 4XWTA 1EY8A 1C4AA 1IUEA 3MXPA 1J7AA 2NN6H 3KWVA 1J7BA 1TJEA 2RDGA 4XT1B 1A3VA 1V43A 5I6WA 2ZXPA 1DYQA 5MPOA 2WXLA 5IGBA 4C1NI 5I9PA 3QWNA 2JA5B 2W3SA 1EL0A 4J3OD 3ETRA 3K5LA 2IWHA 3GTMB 2WDRB 4JWUC 1ET9A 1YN3A 1JOKA 4RHSA 5GXGB 1VLBA 4A9AA 2OT2A 2F0JA 2H4OA 1LO5D 2Z4HA 5ISRA 3MXNA 2KCCA 3D4WA 1QILA 5HHDG 5TSSA 1K50A 3OIQA 5I9OA 1RODA 3EVQA 4KK7A 1XCTL 3NWTA 1RKNA 1ZYRC 3R93A 2B2YA 5LL6S 2KMMA 1QOAA 4RCOA 3OOCA 3FMCA 4K2LA 2F0MA 2PW5A 4GLSC 1JCKB 4ARCA 1EIHA 3DWGC 3Q8AA 3L4PA 1SNOA 1PDXA 1BCPF 1BUIC 5BMGA 4I7ZC 5C3JB 2WNMA 2JXTA 2K22A 4BBSB 1QOGA 3MAQA 2ON8A 3TZUA 2HCIA 3WOFA 2LHEA 1Z6HA 4JPSA 4XTCS 2K5PA 1B2TA 2PW9A 3FC4A 1WGKA 2NWGA 3GB1A 4EGVA 2PNRC 1QNUA 1JR0D 2EY2A 3N52A 4C56C 1EM7A 1Q12A 2M56B 1A15A 4R8NA 3MHZA 2ZW1A 5DNFA 1K83B 1EY0A 5JEAJ 1QOHA 5JOBA 4ODGA 3VR9B 1PRTB 1GXDC 1ROEA 4H0LC 4UDUC 1ZXHA 1LV9A 2ZXRA 3A56A 1G291 4V190 4OW0A 1GB1A 1IGDA 1DXMA 2F0OA 2RQXA 3H91A 4J8QA 4IUQA 4KN4C 4XDCA 1X3QA 4IZ8A 2BS2B 1SYFA 4A3FB 1BCPC 2KECA 3AB9A 3UI2A 5D65A 4U673 1JROA 4CQNA 3T3NA 1OQRA 4A90A 1CK1A 4X3SA 2J4XA 3EFXD 4IUVA 5A2QE 3I4NB 5EBCA 4NAWB 3NVWA 4N9PA 4NW2A 4HKZE 1BR9A 5CBEE 2QSDA 1A3TA 4ULLA 3T53B 4ZKCB 1SYGA 2IX1A 5G3LD 3QIAA 3AE4B 1NEKB 4EQOA 1TKYA 1GOZA 1EEFD 2F0LA 1BF4A 3ONAB 2F0IA 4E6IA 1ZDVA 1WTVA 3LWUA 2K5WA 2ZT9C 1Y8NB 3MWYW 2PIAA 3NVZA 5CV6A 1OXXK 4HJGE 4F87A 2G1EA 4XYOA 2VB2X 3GTJB 1QNKA 4RA8A 5F2DA 3GO5A 1U4PA 1NUCA 4CJ2C 4H44C 5DAUA 3I70A 4HCEA 4NP5A 1FFVA 4K5VA 3PUXA 1EY9A 4A3BB 1DOKA 3GTLB 2EJFC 1C77A 5EPKA 3PZ7A 3KQ4A 3VYRA 1PTOF 2L11A 4P2CB 4IKGA 3BS1A 2MUYA 4K6LA 2JQRB 3QOJA 3I9V1 1HZ5A 1HPCA 4R3DA 2X6LA 2CQAA 1FEHA 1OXVA 4ZAIA 4BY7B 4NMZA 2Y0SB 3RUZA 3BDLA 5M5WB 5D14A 5KNBA 1IYVA 3X3MA 4RF1A 2KHSA 3HG9A 1IL8A 1MI2A 1KABA 1SMYC 3H09A 3R3OA 3GTGB 5G5HA 1L0XB 1UEAB 3MFGA 1EYDA 2LFIA 1GB4A 4REZA 2OF1A 3H94A 1MHXA 1CM9A 3NPPA 3I3CA 1GUNA 3SFEB 1VRAB 2YU9B 1FRDA 3Q8BA 1PTOC 2JYOA 3IT4B 4KN7C 4ILWA 2F0VA 2D2CC 2EYMA 1SSOA 2NVQB 1HZ6A 2RDHA 3ZGZA 1I4RA 2K3UA 1LLRD 4MH8A 4NKLA 1SEBD 4K8JA 5J22A 5D3DA 3PUZA 3HKZB 2WXPA 1I4HA 5C4XB 3H3VC 1R4QB 4KTAA 1I3QB 3M4YA 3C1FA 4QMGA 2L55A 1H9SA 1WRIA 3A8JE 2PCFB 3OIPA 1P7FA 3GQBA 1PFDA 3SR1A 1JB3A 3IFDA 1SNDA 5D7GA 4RNAA 2D62A 1EQVA 5KGUA 2I2YA 4IDIA 2E75C 1XLPA 1TY2A 5KNCA 1XLNA 4P6VF 1EY5A 4AS1A 4IFDI 3J7AV 4WIPA 1AN8A 4K5WA 3G7LA 1GJXA 4FF3A 4G7HC 1RWSA 1AWDA 4IURA 1F0ZA 4FF2A 1RTNA 4HEA1 2QILA 4RFBA 2Q5WD 2JXMB 1VDZA 2IPKD 3BVMA 4XDXA 1BO0A 1AZPA 1VMPA 1CHQD 2O5IC 2I38A 3J7AF 2Z1CA 4DU9A 1EEID 1O78A 2H89B 1LABA 4ZRZA 4ID6A 1LTID 3FAHA 2KAJA 3J81L 3IAM1 1N61A 3RZOB 2F0FA 3BVGA 2M0AA 2XVSA 1GUWA 5EKIA 1SE4A 4D2KA 3ZJUA 5FOBB 1GUOA 1U4LA 4XDDA 1K53A 1PTOH 1C4QA 3P4RB 1DOXA 3S1RB 1LTBD 1EIGA 4IALA 2HDEA 3S9WA 5IGGA 1O7LA 3EJIA 3V3XA 1AYFA 4K14A 1F2LA 1PXUA 5IT9L 1Y69U 1E9MA 3AH7A 3CRLC 3RZDB 1AW7A 3GTQB 1A2UA 3IKJA 3EUB2 1FNWA 3DXJC 4MIUA 1YJIA 1B9NA 1GAQB 3W5VB 3K5NA 3OWEB 4RAUC 1EWHA 1CQVA 4Q2JA 3T4AC 2R92B 3TEXA 3DWAA 3SR6A 1SYCA 5ELCA 1DOMA 1NAPA 4K5XA 1ZXIA 3GP7A 1RCVD 3G6JB 2N55A 1OXUA 3IXSA 2RKSA 3O13A 1QJOA 3DMUA 3EROA 4B9XA 4KY6A 4OZBA 5CV7A 4C3HB 3E6ZX 3LX0A 2BOSA 1SB3C 2MPMA 3PV0A 3P63A 1Q8IA 4DAVA 1TWHB 3SK4A 1DJRD 3UI3A 2B2UC 1A3UA 2AUJD 3W2DA 3BDCA 2EVBA 2KJXA 1PFMA 3S1QB 2PTLA 1L4DB 3W1SA 5IGDA 1TVXA 4KKSA 2A69C 3A55A 5FO9B 1FM0D 4IFDJ 1WXQA 1CJEA 1PZJD 3P1HA 4NDXA 1C78A 1IKMA 1S5FD 4OHJA 2NMQA 5C4JB 1NI3A 4L6TB 2K32A 4US9A 3TUOA 3WOEA 2WDQB 1HCZA 2VXWA 5C0XG 4H2AA 1W6JA 2HCCA 1Y1VB 4WAFA 5FR3A 5M3FB 1MPEA 2FJ2A 2WXHA 2ICIA 2BW2A 1PMRA 4ZKBB 4HSPA 4ZRPA 5BN5A 2YEPB 2L83A 1TYGB 2A74C 4R9WA 5J39A 2WINB 3H0GB 3J80L 2BS3B 3BK1A 2WDVB 3TZDA 1TT2A 1VR9A 1B3AA 2PVOD 1U9RA 2XN9C 4ZUIA 2B2UA 3R2IA 2MGSA 4LAAA 4CGYB 3P42A 3TN2A 2A6EC 1WD1A 1V1OA 1AZQA 4A55A 1KFYB 1BCPD 1MSGA 5FK9C 5JJZA 1WTWA 1PRTF 1SE3A 3HP3A 4WQMA 1FXAA 2IT1A 4KY7A 1J9OA 3P4PB 4OVZA 1L0VB 5T8IA 1XXGA 4XT3B 1JALA 1OQQA 2LY7A 4KKIA 1UWXA 5KIXA 3GV6A 2F3VA 2VB3X 4I65A 2NUCA 5BN3A 2K05A 4LJZC 3VYTA 5M5YB 1F9SA 2E76C 1BNZA 4XIGS 2LFNA 4C3IB