2LMCA

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bacterial RNA polymerase inhibitor
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lmcA00
2WNMA 2LMCA 4LK0M 4LLGM
chains in the Genus database with same CATH superfamily
4BKTA 3CWIA 5DPTA 4M00A 2MLBA 4M01A 4WAFA 2JYTA 4PK1A 3ZVVA 4CHKA 4A55A 2NTSA 3QHTA 3WCQA 2SEBD 4ZOHC 1HTQA 2NMQA 2QC8A 2LVOA 2DZJA 2LGDA 4W9LA 2JSVX 4P7IA 2L0FA 3R2TA 2KWDA 3DDCB 3V6EB 2HD5B 2FCMA 2JPHA 2N9XA 4M8MA 3VQIA 2N1WA 1EF5A 1RYJA 2KQ7A 1KLGD 2PTLA 3IG3A 4S0RA 3UQAA 2ZCCA 2WDRB 4EE2A 4N58A 3M63B 1C4PA 2KTFA 1J7BA 2BYFA 1VR9A 4EZLA 4AQ7A 1JWUD 1JRPA 4ITKA 3EUB2 1V1PB 2CHXA 3QJZA 1V2YA 2RPVA 2WXJA 3N32A 5EDSA 1FXTB 5E6OA 4I6NB 1WJ6A 3NY5A 2MEKA 3DVNU 2K6QA 3RNBC 1I4RA 3ZRFA 1EWCA 2WXIA 2AYOB 2L8JA 2KDBA 1FXAA 3M95A 4W9IA 3DVGX 3KH0A 1F9JA 4GOCA 2Y5PA 3Q3FA 3AE4B 3I5JC 2BS2B 4P16A 2WXNA 2XEWA 2KT7A 4EOYA 4HJKA 1LFDA 4RMAA 1KJTA 2HDEA 2QDFA 4KIKB 1I7HA 3U7DA 2E3TA 4RGOS 2JUOA 4I6LB 2KYWA 3VTWA 3RPFC 2W82A 4KX6B 4EZJA 4FBJB 2LGYA 1R4MI 2KACA 2FUG1 4JE3B 4GDLA 4YSZB 2QJLA 1MHHE 3MJ5A 1TY0A 2JF5A 1PGXA 3DHHC 1V81A 4ANXA 1WYWB 2L83A 4PS8A 2M19A 5I4DA 2LUEA 4MH8A 2LGXA 2BS3B 5MPOA 2KAJA 3AE8B 4FN2A 3DBSA 5EE3A 3T9LA 2IY1B 2Z59B 2DWQA 2LUMA 1AARA 3NZUA 2V0GA 1ZDXA 4G50A 4ARCA 3M3JA 1QT9A 3ZNGC 3QC8B 2ON8A 1ZOYB 4LLGM 2D11A 2D07B 3VTUA 1V1PA 4AOFA 4HEA1 1V9JA 5LXIB 3W1SA 1IBXB 2IO0B 2N9PC 1NVID 3C8YA 3QX1A 2LZ6A 5IA7A 2KDFB 3MP9A 3ZRCA 2ZVNA 3I63C 1RLFA 4NAMA 1OTRB 4AP4C 1M94A 4B6WA 2MX2A 2KMCA 2LGSA 1EF1A 4ZDVA 1L0XB 5H92C 5AEKB 1C3TA 1UF0A 2LJIA 3AEEB 3SHQA 4BZAA 3WAMA 4NY0A 2WXKA 1QOGA 3ALBA 2WHIA 4KIKA 2KNBA 2CHZA 4W9DA 2C7NB 2DX5B 2BVCA 5G5GA 5BMGA 3ECIA 2WYQA 4P6VF 2RDGA 3IAS1 1EU3A 3S2AA 2MCNB 1E8XA 2EMSA 3N30A 1SB3C 2MQJA 1SSNA 5D2MB 1L4ZB 1V80A 4FJZA 1SJHD 3PRMB 4RNAA 3VH4B 4OW0A 2MP2A 1GJZA 3W2DA 1YQ3B 5EE0A 3JSVB 2QIEB 2HTHA 3L54A 3LJ3A 1T0SC 1C78A 4IG7B 1E5WA 4ACFA 1WSPA 1YNTE 3ZJTA 4OZCA 4PYUA 2RDHA 1S1QB 1E8YA 2HTME 2PKOA 5C2TB 2KMAA 3TL5A 2Q5WD 2JRIB 1UNSA 1WH3A 4PYZA 2WS3B 5J2RA 4GDKB 1IBXA 2J52A 1Z2MA 2GBJA 4G11A 4WJPA 2MJEA 2N7EA 3AEGB 1Y8RC 2UWQA 1YJIA 3I57A 1TGZB 2WXRA 3ZUNA 3CMMB 2LRUA 4WQOB 1YMHE 3TUOA 3ONSA 1VDVA 4HVBA 2M17A 4NQLB 1PGBA 1P7FA 1VLBA 1TT5B 1V6EA 3AEDB 1FIQA 3NUHB 5E6JA 2AL6A 3GE8C 1WY8A 2DHZA 3AULA 1XLNA 3A9JA 4ASWC 4K7WA 3PHWB 2N7DA 2FUHB 3EECA 2NR2A 1KRHA 4CQNA 3NZ3A 2LGIA 3QARA 1YOVB 3AMZA 3LB8C 4N9F4 3A1QA 1FFVA 2C7HA 5BYSA 1FCLA 1XD3B 3PRPB 1VJKA 2AWTA 4BFRA 1YQ4B 2KLCA 1WXVA 3SD5A 4YTMB 1P98A 3NG0A 3CF6E 1P0RA 2WLBA 2LRWA 3MFGA 4DXGA 2W55A 2Z0EB 2LFIA 3IBEA 1SE2A 5AZFA 4MELA 2FIFA 2NCNA 2GRIA 4IWOA 1E90A 5AUIA 2ZJDA 2PMVA 4XDDA 3P1MA 2M4NA 3DBLB 2ZPYA 4GN1A 3RI7C 1CQVA 2JVCA 4WAAA 2NS5A 3KQ4A 1T3QA 3U8ZA 3AECB 3Q8EA 1QKZA 3AE1B 4TMAB 1G6JA 2KX3A 2KJRA 1P9DU 1DYQA 4M0WB 3Q6BA 2KANA 2IY0B 2KD0A 3N1YC 1GNUA 1FD6A 4GDKA 3AEFB 1FRDA 2DAJA 2OEDA 1J0GA 1XO3A 2JWZA 4I6PA 3T3OA 3CSFA 3Q69A 2JXTA 4BOSC 5JHBA 3Q8FA 3EFUA 2QCZA 4L2YA 4ZRPA 1Q1OA 4NAWB 3PV1A 1SE4A 4HPPA 3QAQA 3I9V1 2WXGA 2WX1A 2JQRB 3WALA 3AE3B 1YJ1A 2DENB 1C76A 4IDIA 1UWXA 2LMCA 1WXQA 2AEHA 1L7YA 1WX9A 4IWPA 4G0NB 3ZW3A 2BB5A 3QK0A 1D3ZA 4RGTA 4NPNA 4L1BA 3W5VB 4EFOA 3RULA 2MSED 1M4VA 2J0KA 4MGZE 3PZ8A 1TKYA 1D4BA 3Q3MC 3ZO5B 3JW0X 3DBRI 2REXA 1Q0WB 3DBLI 3VUWA 5IO9A 2D3CA 3RD2A 1FNUA 2XNAC 1VZ6A 4ANVA 2WU2B 2I1KA 3DBHB 2KWVB 1TYGB 3FILA 4RM8A 2K8HA 1SE9A 3RN9C 3AXCA 2BS4B 1N5XA 4ZRQA 2WXMA 4DHZE 1SBBB 4AUQC 4DXAB 3ML8A 1FNWA 2KZRA 2NBWB 4RFBA 5CHVC 2NVUI 3EA6A 4GLSC 2KN5A 4KVGB 3I3TB 3OG5A 3ZNZB 2H89B 1UBQA 4RGMA 3U52E 3PLUA 5BYRA 4LTUA 1C4AA 1RM6C 1ZXHA 1SXTA 2BYVE 4M0WA 4MGKE 5IAAC 4RM9A 1DOIA 3H7SA 1OGWA 1SF0A 2RD0A 2FNJB 1UGJA 3QIJA 4OHJA 2IYDB 1FM0D 2JZZA 4K7SA 1TTNA 3B2GA 4W9HA 4W9JA 3HUIA 4WWOA 2BW2A 1SEBD 5D3DA 4EUTA 2ZPNA 2K22A 3IVFA 2PLPA 3GZNB 4HLEA 2ICIA 3RFZB 4NNJB 1XF5L 1MVKA 4F7ZA 3B2FA 2JXXA 4USAA 5BMHA 3DOWA 4NJ6A 4JPSA 4GDLB 4GIVA 3APDA 1F1HA 4XC2A 3AE7B 2OJRA 3MJWA 4ANUA 3N20C 2WDQB 3DBHI 1N63A 2L32A 4LDTB 1QOAA 1KF6B 3L10B 4LNKA 4C00A 1ET9A 4KGRA 4BOZB 3RCZA 1PYWD 2DYMA 2KDMA 4M8NA 4JGHB 2BTEA 1H4RA 3L4PA 1Q10A 4URKA 3P4RB 1WX8A 1GG3A 2YLMA 2JYEA 3VRAB 4F8CB 1WGGA 2MA9B 2B76B 5DPWA 3UGBB 3KYDD 3AE6B 1ZW7A 4ZHOA 4KGTA 4AS1A 1JMLA 2L7RA 1E7UA 2V3NA 3FAHA 5GMVA 3VFKA 4BVUC 1XCQL 4EEWA 3RMKC 3BYYB 3L16A 3RT3B 1HXYD 2LEKA 3DWGC 2PVGC 2MWSB 3PT2B 2AQ2B 1TS4A 3SFDB 1V1OA 2J42A 4BBNF 3VH3B 3DWMA 4GSWA 2CJNA 3UINB 2FBWB 1IGDA 3HHMA 4MEMA 4FXCA 1E7PB 2AX5A 4DDGD 1XLQA 1VD2A 3KVFB 2ZNVB 4MGYE 3UI3A 1KLUD 4ZHPA 3Q3NC 3AE5B 3VUYA 1LO5D 3NOBA 1N62A 2KX0A 4ARIA 3B9JA 2W3RA 4MM3A 2NBUA 2W3SA 1WGRA 2CU1A 1PQSA 1NENB 3V6CB 2IJ0A 3Q8AA 4HPLB 2RMMA 4HRSA 1OFFA 1FXIA 5C3JB 2MP2B 1FO4A 1TZOA 2CU3A 2L3ZA 3DPDA 4W9GA 1OQYA 1SIJA 2IO2B 3UIOB 3DHGC 3VDZA 2ZEQA 1FPYA 1QF6A 2V9HA 3AE9B 4WIPA 4S17A 1NI3A 1LQBA 1WGDA 3W1SC 4B0MA 2WP9B 1L2NA 3ABVB 2YEPF 4OVZA 2WWZA 4WH4A 3UQBA 4FULA 2V4LA 4ZRJA 3V62A 4DHZB 3BWUD 3DHIC 2LJ5A 3DQVA 3ZJVA 4KKIA 3PZDA 5D7GA 2HE7A 2KQ4X 1JW9D 3SR6A 1EM7A 4W9EA 1WRIA 2KJ6A 1RFAA 1NBFC 1HEZE 3D32A 2GBMA 1ZE3D 4GU2A 3SEBA 2WQYB 3VR9B 3TCAA 2K1FA 2O6VB 4RGNA 4MSQB 4DWFA 1V5OA 2CHWA 2VZKB 3PS6A 2ZNVC 5CHFA 4BKSA 1UH6A 1AWDA 3B1LX 1KTKA 4YWGG 3NVYA 2QILA 4DK5A 4EZKA 3A9JB 3HIZA 1FNVA 3V3XA 1MJDA 2ONQA 3H1UA 4YSXB 3AE2B 3HVZA 2DAFA 5HG2A 3BYTB 2BBCA 4IUMB 1MPEA 3AU4A 2IGDA 3AN1A 2AL3A 3A1QB 2BGFA 3IXSA 3R66C 1C79A 2CR5A 3ZLZA 1WE7A 1F2RI 1DOXA 3IT4B 1WJUA 1PGAA 4HJGE 1E9MA 1LGRA 2G1EA 1F2RC 2N7JA 4YT0B 2JRHA 3ML9A 3SU8X 1L5PA 1LXDA 3KWVA 3NS8A 3NS1A 3OJ3A 3V61A 1CZPA 3BIID 1D5MC 1QOFA 1TS2A 1ISNA 2PJHA 3ZJUA 3ZDMC 2HJ1A 4XDCA 4LNNA 4N59A 1T0YA 4K3BA 2J0MA 3VVWB 4DHJB 1K51A 3PHXB 2WXLA 1CJEA 2INCC 2EKIA 3GP7A 2W9NA 1EUVB 4LNFA 3K9OB 1UELA 3PGEA 1ET6A 1E7VA 1ZUD2 4XWTA 2ZW0A 3ZTCA 1JWBD 1WIAA 2DZKA 2DNFA 5BO4B 4XYCA 3KUDB 2ASQA 4GB9A 2O6VA 3ZDTA 1R4NB 2WNMA 4DDID 4MACA 1RFKA 4QAYA 2V3PA 3TEWA 3PREA 4TSSA 1WFYA 2KQSA 3HM3A 2Z0DB 4IM0A 2KLGA 2KKCA 2J7QB 1R7SA 3RZFA 3E9SA 3U30A 1D5XC 2C9WB 4BAXA 3M62B 3IAM1 1C9FA 2L0TA 4ZRIA 2L52A 1YIWA 3C19A 2MBEA 4LNOA 3IFWB 5FK9C 2AQ3B 2KVRA 2LVPA 1VCBA 2GB1A 1N5WA 3Q14C 3TBLD 3Q3JA 1E8WA 3MC9A 2N9EB 3AEAB 1KH0A 4MJSA 3V60A 1QZEA 2WXHA 3FILB 3MTNB 2MJ3A 3MHSD 1XEEA 1TBEA 2QHOA 3QQ8B 2D2QA 4MGIE 5CTRC 1OQQA 2Y5CA 2BF8B 3W5UB 4FHJA 1BT0A 1ENFA 4P1CC 1GUAB 2D10A 1XLPA 2IO1B 3EGRA 3HK0A 4WURA 2VRRB 4XWWA 2JU6X 5D6JB 1WZ0A 2WXOA 3B0AA 2IO3B 1R4NI 2PE6B 3AH7A 4RCOA 3KW5B 4HWIB 3PVLA 2I38A 4LJPB 1P1AA 5AUKA 4KDLB 2DYBA 4BKGA 3MHZA 4HROA 2YEPB 2BPSA 4GXBA 5JXVA 2LASA 2N4FA 1NEKB 4D2KA 4NJCA 1QQRA 1K52A 1H8CA 4KKJA 1L6UA 5JH5C 3KUCB 1KFYB 4TKNA 3TEZA 3PPAA 5FR3A 1RWSA 3R7QA 1WR6E 1WXMA 4BBNC 4YTNB 4ZYNA 2D5GA 3NJTA 3URYA 4MH0E 2QMTA 1IPGA 1WR1A 1MFWA 1XLOA 2GBRA 1XXGA 1HTOA 4WWNA 3U7ZA 1V97A 4AJYB 3ZYYX 1E10A 1WM3A 3RZWC 1GB1A 4HK2A 3ENEA 1WJNA 4ICVA 3BZDB 2KVZA 2EMTA 3X0WA 4AJWA 5KHOA 4A9AA 4OZAA 1TS3A 3N9YC 4F1SA 3RNFC 2K25A 1V8CA 2E6XA 3RNCC 2INPE 1UD7A 4TV3A 3PZ7A 4AWJA 1T0RC 2BB6A 1HQRD 2WU5B 2KDIA 3OLMD 2K0PA 2WDTB 1TKGA 3CIRB 5H8YE 2KJHB 1J19A 3IT6B 2B3AA 1F0ZA 1WXAA 4WJOA 3J9CA 2JT4B 3TMPB 2KXJA 4K1RB 5TR5A 4YXDB 1B9RA 3UF8A 4CO7A 5AZHA 2LI5A 3SFEB 2M1MA 5C1ZA 2XBBC 4MDKE 1ACCA 2ZVOA 4B9KA 1IYFA 3VRBB 3P42A 1PDXA 2K8BA 3HVDA 1WZ3A 4W9FA 3A4RA 4OVUA 3RNAC 1E0ZA 4ZYSA 1YX5B 2UYZB 1ZP0B 1D5ZC 3RNEC 2GLSA 4HDOA 4US8A 3FC4A 2ZCBA 1E8ZA 1XQQA 3BY4B 2FAZA 2H88B 5J17A 3JVZX 3K9PB 1GPXA 2J0JA 4CYEA 4KZCA 2KOXA 2MBHA 1ROEA 3BINA 2BT6A 2K39A 4IM2A 2R61A 1T5XD 2OJWA 3WANA 3P4QB 5D94A 2XK5B 1WRDB 2GOWA 4UDUC 1GOZA 1GAQB 4W9KA 3DVGY 5JHAA 1X1MA 1CMXB 3W1YA 1I4QA 5EE1A 4MM3B 3O13A 4KZ0A 3TJPA 4OZBA 4P1BC 4IKGA 4K81A 3P4PB 1I35A 2DZIA 2OHFA 4E71A 5GXGB 3AI5A 1QLBB 4FJYA 3R7RA 3GE3C 4LDTD 2R2QA 1MG8A 1S3SG 3U4EG 1MI0A 1YN3A 2DLBA 1UZXB 4TQ0A 1V86A 5G5HA 3R2IA 1JRUA 1J8CA 3QCAA 5DPSA 1GB4A 4YSYB 2X8XX 1WJ4A 3FKYA 2PW9A 3VR8B 1C4CA 3QA8A 4IC7B 2IDYA 1P3QU 2CKHB 2DZMA 1N6ZA 3SDLC 5HKHA 1QILA 1JROA 1L4DB 3GB1A 1R4MB 4LK0M 1SE3A 2O2VB 3T3NA 2INDC 2GBKA 1XT9B 3TSSA 2BKRB 1K50A 3AEBB 3CSTA 4FA6A 3BVZA 4A20A 2KO3A 3VAWA 2RPQA 4FHKA 1FRRA 2LD9A 4BKSD 3GZNI 1FFUA 2VH1A 4IOIE 1KLVA 1OQRA 5TSSA 4JL9A 4XE0A 5E6PA 1AN8A 5BYQA 4TQ1A 2FIDA 2DBYA 1WF9A 3TIXA 2K9XA 2BYTA 1GC6A 2FCNA 2MJDA 5LXHA 2C5LC 3KUZA 2LWPA 1WMHB 1C1YB 3LXFA 2XK5A 4II3B 5LLIA 1FMAD 3OJ4B 5IOIA 2QSDA 1TZ1A 4H2AA 3A9KB 3ZNID 1SIFA 2K3UA 4C4VB 4FADA 3WA0A 1DOYA 1ZPSA 2A4ZA 2G4SA 4FJVB 1XCTL 2HJ8A 3NRZA 3Q8CA 2GI9A 4A90A 4PS7A 1L6VA 2G4DB 3Q8BA 1OEYJ 2UU7A 4REZA 2JWUA 5IKCM 3LYYA 4ZRKA 3MC8A 4L23A 3NZSA 3N1ZC 1A70A 5DPRA 3A33B 1JWAD 2N0SB 4US9A 3TEYA 1A5RA 1YX6B 2N9LA 4N6EB 2MBQA 1VZ8A 4MT5A 3T8MA 2WGSA 5G2NA 2MBBB 3OAWA 4HKZE 5L83A 2IBIB 3RNGC 4KGSA 4C7ZA 1P7EA 1TY2A 2GBNA 4PS3A 1PFDA 4E3CA 3PSEB 1HZ5A 1MHXA 4WWPA 2O2VA 2W54A 2JY6A 4C56C 2PIAA 4A3OA 5J18A 2CS4A 4O1NA 2MRPA 2O6VD 2PEAA 1SJED 2VZKD 1ZGUB 4HDQA 4TUUA 3NVVA 4J3OD 1V5TA 1YN5A 3R3MA 4YL8A 4WJNA 1C77A 4J6IA 3NVZA 1QOBA 5EE9A 3Q2AC 1KOTA 2KN4A 3QWZB 2YVCA 1HE8A 3ETRA 3N3KB 3VXWA 1WMHA 1YQBA 3HM6X 2FCSA 2KC1A 3PRZA 3EHVA 2WXFA 5HFYA 3V05A 5IP4D 4XX5A 2L1AA 2Y5BB 4W9CA 1WX7A 2ACZB 3A9KA 1HZ6A 2KWUB 2LVQA 5FKAC 2M56B 4YTPB 4C4VA 3P2BA 2KDEB 1B1ZA 1TKEA 4WQMA 3UIPB 2VH2A 4MJSB 1JCKB 2BQQA 2RDBC 3PLVA 1KM7A 1WWTA 1NYRA 2IGGA 2D3GA 2V4IB 1K8RB 5DCNA 3VUXA 4EKUA 2SAKA 1I4XA 1TIFA 3A4SC 1UWMA 3HRDD 2K6DB 4JLCA 4KSKC 4KSLC 3L17A 2D3BA 5E6NA 5G55A 2PE9A 1YD8U 1TJEA 5CHWA 2ZW1A 4DHJD 1STEA 1ESFA 4A3PA 5IN7A 2KFKB 1DGJA 2FCQA 1F52A 1BMLC 2L00B 4K3CA 4RH6A 4MSMB 3APCA 5D3IB 3ZGZA 3KYCD 4LNIA 3AU5A 1JWSD 3AV8A 3C0RB 5L95C 3ZXVA 1UBIA 4II2B 4FLHA 3H6NA 4X57B 2EKEC 1I4GA 1Z5SB 3GS2A 2KC2A 2NTTA 5C23A 2K5PA 2KTRB 4LCDE 3KLSX 1BUIC 2GMIC 4JWUC 2C60A 4JQWC 2G9HD 3TEXA 5HHDG 1I4HA 1NDDA 3NVWA 4NQKE 3ZIMA 1JWMD 1WGKA 1ZKHA 4NZLB 3BVMA 1EWYC 3OWEB 3L08A 1WM2A 3LDZE 4RF0A 3H7PB 1UGMA 2BKFA 2WDVB 2K8CA 4E74A 2A5UA 2QEJC 5FR6A 1OEYA 3AM9A 4GMVA 1UUPA 2AQ1B 3L0WB 4C80A 1GC7A 1J7AA 3B08A 4PT5A 3BK1A 1MG4A 1AW7A 3ZNHB 1WXSA 1WI0A 2LHDA 1NI2A 3H8HA 2NBVB 3IHPC 2J4XA 1WGHA 3AB5A 3EC8A 2IGHA 2J53A 3P4SB 3U2SC 4DBGA 3EFCA 1AYFA 4NJ7A 4A8XC 2G45B 3ZKJC 2Z8LA 1K53A 4GGQA 4XZ4A 2RGFA 3VHTC 1ZXIA 2JX5A 2D3AA 3Q3OC 3RYTA 4Q2JA 5LNK1 1VRAB 2KFKA 2ZZPB 3JSVA 4B0EA 4R3DA 2X38A 4JIOU 1YJJA 3PO0A 2JZ3B 2N1VA 2XN9C 3DBRB 4JWSC 2OOBB 5KHQA 1PUTA 4K7UA 3RUIB 1YN4A 2TSSA 5T8IA 5JZEB 1EU4A 4JX1C 3MC0B 2V1YA 4B95A 1TS5A 1Y56A 2MBOA 3ZTDA 2Y3AA 3BVGA 1CK1A 2KWCA 2INNE 4HPMB 2KTRA 1JALA 5HI1A 1NYQA 4IW0A 2I1JA 2N9KA 2NPTB 5AZGA 2BWFA 3BK2A 1IGCA 1U4AA 4LJOB 3H9DA 4OVVA 1IP9A 1WYGA 4KV2A 4HKQA 4XGAB 2WX0A 3APFA 1Q5WB 3H7PA 3WAOA 4IWQA 3R8BA 1F77A 4KDIC 1N61A 1WE6A 2I2YA 3ZQ4A 3ZXRA 2JZPA 2RR9A 3N1XC 2RSUA 4ICUA 1E6EB 3DCGA 2IPKD 1I4PA 2KMMA 4HXDA 1HA5A 3KWLA 2MH7A 2FE8A 1N60A 2C7MB 2MHJA 2BYEA 1WGYA 1L0VB 1T6BX 2KK8A 4IM3A 3JYUA 3PTFC 2LXAA 1FCCC 1FEHA 2CJOA 1LM8B 4M02A 3O65B 4HCPB 4C7YA 1BXTA 2G3QB 1J7CA 2KHWB 4DQOC 2R2OA 2WXPA 1T0QC 2M0AA 3GOEA 2M8SA 1VZ7A 2LHEA 2BWES 1L0YB 3NHEB 4G3XB 1EO6A 2DYOA 2MW5A 2LXCA 3VTVA 3E56A 1RAXA 4RF1A 3L13A 1I42A 2PVOD 3DVNV 1IUEA 2M0XA 3WAPA 1D6EC 1RRBA 3W9CB 4HCNB 5BMIA 2V3SA 3WIMA 1JQ4A 4ANWA 2EELA 4A6QA 2IZVB 2PPHA 2L76A 4DXFA 2NPTA 2WXQA 3P63A 1V49A 1SGHA 2KFJA 4WJQA 5CX3A 3X23A 4WWMA 4NAWA 2L05A 1ZDVA
chains in the Genus database with same CATH topology
4L23A 3AEFB 1K51A 1FRDA 3CWIA 2OEDA 1A70A 1XO3A 3T3OA 1JWAD 2N0SB 1CJEA 2WXLA 3Q69A 2JXTA 4US9A 3TEYA 2N9LA 4N6EB 2EKIA 3GP7A 3Q8FA 4WAFA 2JYTA 1VZ8A 4L2YA 4MT5A 4ZRPA 2NTSA 4A55A 3WCQA 4NAWB 1ET6A 2SEBD 4ZOHC 4HKZE 1SE4A 1ZUD2 4XWTA 2NMQA 3I9V1 2ZW0A 2WXGA 1JWBD 2JSVX 2JQRB 4KGSA 4C7ZA 3R2TA 3AE3B 1P7EA 2KWDA 1TY2A 1C76A 1PFDA 4IDIA 1UWXA 1HZ5A 2LMCA 1MHXA 1WXQA 2WNMA 2W54A 3VQIA 4C56C 2BB5A 2PIAA 4MACA 1RFKA 2V3PA 4RGTA 3TEWA 4L1BA 3W5VB 4TSSA 4O1NA 1SJED 1RYJA 1KLGD 1M4VA 2PTLA 2VZKD 1R7SA 2WDRB 3PZ8A 3E9SA 4EE2A 1D5XC 3NVVA 4N58A 1TKYA 1D4BA 4J3OD 1YN5A 1C4PA 3IAM1 1C9FA 1J7BA 1VR9A 4AQ7A 2L52A 1C77A 1JWUD 1JRPA 4ITKA 3EUB2 1V1PB 3NVZA 1QOBA 5EE9A 1FNUA 2XNAC 1VZ6A 5FK9C 2AQ3B 2KN4A 2WU2B 2GB1A 2RPVA 1TYGB 2WXJA 3ETRA 1N5WA 3FILA 2MEKA 2WXFA 2BS4B 1N5XA 4ZRQA 1I4RA 5HFYA 2WXMA 3AEAB 3V05A 1EWCA 1SBBB 2WXIA 1KH0A 2L1AA 1FNWA 2WXHA 2ACZB 1FXAA 3FILB 1HZ6A 4RFBA 3EA6A 5FKAC 2MJ3A 2M56B 1XEEA 4GLSC 4YTPB 1B1ZA 1OQQA 1TKEA 2H89B 2Y5CA 4WQMA 3W5UB 2Y5PA 4RGMA 3U52E 1JCKB 3AE4B 1ENFA 5BYRA 2BS2B 4P16A 1WWTA 1NYRA 2IGGA 1C4AA 1XLPA 2V4IB 1RM6C 1ZXHA 1SXTA 2WXNA 3EGRA 4WURA 4M0WA 4XWWA 2JU6X 2WXOA 2SAKA 1DOIA 1I4XA 1UWMA 2HDEA 1SF0A 3HRDD 1I7HA 4LTUA 3AH7A 4RCOA 2E3TA 4RGOS 1UGJA 4OHJA 2I38A 5AUKA 1FM0D 1TJEA 3MHZA 3RPFC 3B2GA 2W82A 4KX6B 4HROA 2YEPB 5JXVA 2ZW1A 2KACA 3HUIA 1NEKB 2FUG1 1STEA 1ESFA 2BW2A 1SEBD 4JE3B 1QQRA 4NJCA 4D2KA 4YSZB 2QJLA 5D3DA 1K52A 1MHHE 3MJ5A 1DGJA 1TY0A 1PGXA 4KKJA 2K22A 1L6UA 2PLPA 2ICIA 3RFZB 1KFYB 2L83A 1BMLC 2M19A 3TEZA 1XF5L 5I4DA 4RH6A 4MH8A 1MVKA 3B2FA 5FR3A 4USAA 1RWSA 5BMHA 2BS3B 5D3IB 3ZGZA 4JPSA 4GDLB 5MPOA 2KAJA 4YTNB 3AE8B 2D5GA 3URYA 5EE3A 2QMTA 1JWSD 3AE7B 3AV8A 2WDQB 1XLOA 2DWQA 2LUMA 1N63A 1XXGA 2L32A 1I4GA 3U7ZA 1V97A 3GS2A 3ZYYX 1E10A 2V0GA 2NTTA 1ZDXA 4ARCA 1QOAA 1KF6B 1GB1A 1ET9A 2K5PA 1QT9A 3KLSX 2ON8A 3BZDB 1BUIC 1ZOYB 4JWUC 4KGRA 2G9HD 3TEXA 5HHDG 1I4HA 4LLGM 4A9AA 4OZAA 1TS3A 3N9YC 3NVWA 1PYWD 2DYMA 2KDMA 1V1PA 2BTEA 1JWMD 1WGKA 3L4PA 1Q10A 1V8CA 4NZLB 2E6XA 4HEA1 2INPE 3BVMA 3P4RB 3PZ7A 2BB6A 1EWYC 1HQRD 2WU5B 3OWEB 3W1SA 4RF0A 2JYEA 2K0PA 1IBXB 2WDVB 3VRAB 1NVID 3C8YA 1TKGA 3CIRB 5H8YE 2B76B 2QEJC 3MP9A 3IT6B 1F0ZA 3AE6B 4ZHOA 4NAMA 3J9CA 4KGTA 1JMLA 4AS1A 3AM9A 1UUPA 2AQ1B 2V3NA 3FAHA 4C80A 1XCQL 4YXDB 1J7AA 1B9RA 4PT5A 3BYYB 3BK1A 1HXYD 1AW7A 2LEKA 3DWGC 2PVGC 2LHDA 2AQ2B 1L0XB 5H92C 1TS4A 3H8HA 3SFEB 1ACCA 3SFDB 2LJIA 3VRBB 2J4XA 3P42A 3AB5A 3AEEB 1PDXA 1V1OA 2J42A 2IGHA 3HVDA 2J53A 3P4SB 2WXKA 3U2SC 1QOGA 3DWMA 1AYFA 2CJNA 2FBWB 1IGDA 1E0ZA 4ZYSA 4A8XC 1ZP0B 4FXCA 1E7PB 2AX5A 1D5ZC 5G5GA 5BMGA 2Z8LA 1K53A 1XLQA 4US8A 3FC4A 4P6VF 1ZXIA 2H88B 2JX5A 2RDGA 3IAS1 1EU3A 4Q2JA 3UI3A 1KLUD 5LNK1 1VRAB 4ZHPA 1GPXA 4B0EA 3AE5B 1SB3C 4R3DA 1SSNA 1LO5D 1L4ZB 2X38A 1N62A 1YJJA 1SJHD 3PO0A 1ROEA 2BT6A 4ARIA 3B9JA 2R61A 2XN9C 4RNAA 1T5XD 2W3RA 4OW0A 4JWSC 3P4QB 2W3SA 3W2DA 1YQ3B 1PUTA 1YN4A 2TSSA 5EE0A 5T8IA 2QIEB 1NENB 1EU4A 4JX1C 4UDUC 3MC0B 1GOZA 2IJ0A 1GAQB 3Q8AA 1C78A 1TS5A 1Y56A 1I4QA 2RMMA 2Y3AA 3BVGA 5EE1A 1WSPA 1YNTE 1CK1A 4HRSA 4MM3B 1OFFA 1FXIA 3O13A 5C3JB 3ZJTA 1FO4A 4OZCA 2RDHA 1TZOA 2CU3A 2INNE 4OZBA 4IKGA 2HTME 1SIJA 3P4PB 1JALA 2PKOA 1NYQA 5HI1A 5C2TB 2OHFA 2N9KA 1QF6A 3AE9B 5GXGB 1QLBB 4WIPA 1NI3A 2Q5WD 3BK2A 1IGCA 4B0MA 2WP9B 3U4EG 1WYGA 1UNSA 4HKQA 3ABVB 2YEPF 1MI0A 1YN3A 2DLBA 4OVZA 2WS3B 4WH4A 4GDKB 4TQ0A 5G5HA 3R2IA 2J52A 1IBXA 3R8BA 1GB4A 4YSYB 3BWUD 1F77A 3ZJVA 2MJEA 1N61A 3AEGB 4KKIA 5D7GA 2PW9A 2KQ4X 1YJIA 3I57A 1JW9D 3VR8B 2I2YA 3SR6A 3ZQ4A 2JZPA 1EM7A 1WRIA 1C4CA 2WXRA 3TUOA 1YMHE 2IDYA 1HEZE 1E6EB 1VDVA 1PGBA 1P7FA 2IPKD 1I4PA 1QILA 2KMMA 1JROA 1VLBA 1L4DB 1ZE3D 1HA5A 3KWLA 3SEBA 2MH7A 2WQYB 3GB1A 3VR9B 3AEDB 2FE8A 1N60A 1FIQA 3NUHB 5E6JA 4RGNA 4LK0M 1SE3A 3T3NA 1XLNA 2VZKB 1L0VB 3TSSA 1T6BX 1AWDA 1K50A 3AEBB 3BVZA 1KTKA 1FCCC 1FEHA 1KRHA 2CJOA 4CQNA 3NZ3A 4YWGG 2LGIA 4C7YA 3NVYA 3AMZA 1BXTA 2QILA 3LB8C 1FNVA 1FRRA 3V3XA 1J7CA 1FFUA 4IOIE 1FFVA 4DQOC 5BYSA 1FCLA 1OQRA 2ONQA 1VJKA 5TSSA 3AE2B 2WXPA 3HVZA 4YSXB 5HG2A 4XE0A 1YQ4B 2M0AA 3BYTB 1AN8A 1VZ7A 2BBCA 5BYQA 4TQ1A 4YTMB 2LHEA 2DBYA 1MPEA 2IGDA 3AN1A 2K9XA 2BYTA 2WLBA 2MJDA 3IXSA 1L0YB 3MFGA 4DXGA 1C79A 2W55A 2LFIA 1SE2A 1F2RI 1DOXA 3IT4B 3LXFA 1PGAA 4HJGE 2DYOA 1E9MA 2GRIA 1FMAD 3E56A 5AUIA 4RF1A 2G1EA 2PMVA 4XDDA 1F2RC 2QSDA 2PVOD 2N7JA 4YT0B 4H2AA 1IUEA 3P1MA 1D6EC 3W9CB 1L5PA 1CQVA 2K3UA 3KWVA 3NS1A 5BMIA 1JQ4A 3KQ4A 1T3QA 2EELA 1CZPA 1DOYA 1ZPSA 4A6QA 3BIID 3AECB 1D5MC 1QOFA 1TS2A 3Q8EA 1QKZA 3AE1B 1XCTL 4TMAB 4DXFA 2WXQA 3P63A 3NRZA 3Q8CA 1DYQA 2GI9A 4A90A 1L6VA 3ZJUA 3Q8BA 4XDCA 4N59A 4REZA 2JWUA 3LYYA 4WWMA 1FD6A 1ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNM A;  2LMC A;  4LK0 M;  4LLG M; 
#chains in the Genus database with same CATH topology
 4BKT A;  3CWI A;  5DPT A;  4M00 A;  2MLB A;  4M01 A;  4WAF A;  2JYT A;  4PK1 A;  3ZVV A;  4CHK A;  4A55 A;  2NTS A;  3QHT A;  3WCQ A;  2SEB D;  4ZOH C;  1HTQ A;  2NMQ A;  2QC8 A;  2LVO A;  2DZJ A;  2LGD A;  4W9L A;  2JSV X;  4P7I A;  2L0F A;  3R2T A;  2KWD A;  3DDC B;  3V6E B;  2HD5 B;  2FCM A;  2JPH A;  2N9X A;  4M8M A;  3VQI A;  2N1W A;  1EF5 A;  1RYJ A;  2KQ7 A;  1KLG D;  2PTL A;  3IG3 A;  4S0R A;  3UQA A;  2ZCC A;  2WDR B;  4EE2 A;  4N58 A;  3M63 B;  1C4P A;  2KTF A;  1J7B A;  2BYF A;  1VR9 A;  4EZL A;  4AQ7 A;  1JWU D;  1JRP A;  4ITK A;  3EUB 2;  1V1P B;  2CHX A;  3QJZ A;  1V2Y A;  2RPV A;  2WXJ A;  3N32 A;  5EDS A;  1FXT B;  5E6O A;  4I6N B;  1WJ6 A;  3NY5 A;  2MEK A;  3DVN U;  2K6Q A;  3RNB C;  1I4R A;  3ZRF A;  1EWC A;  2WXI A;  2AYO B;  2L8J A;  2KDB A;  1FXA A;  3M95 A;  4W9I A;  3DVG X;  3KH0 A;  1F9J A;  4GOC A;  2Y5P A;  3Q3F A;  3AE4 B;  3I5J C;  2BS2 B;  4P16 A;  2WXN A;  2XEW A;  2KT7 A;  4EOY A;  4HJK A;  1LFD A;  4RMA A;  1KJT A;  2HDE A;  2QDF A;  4KIK B;  1I7H A;  3U7D A;  2E3T A;  4RGO S;  2JUO A;  4I6L B;  2KYW A;  3VTW A;  3RPF C;  2W82 A;  4KX6 B;  4EZJ A;  4FBJ B;  2LGY A;  1R4M I;  2KAC A;  2FUG 1;  4JE3 B;  4GDL A;  4YSZ B;  2QJL A;  1MHH E;  3MJ5 A;  1TY0 A;  2JF5 A;  1PGX A;  3DHH C;  1V81 A;  4ANX A;  1WYW B;  2L83 A;  4PS8 A;  2M19 A;  5I4D A;  2LUE A;  4MH8 A;  2LGX A;  2BS3 B;  5MPO A;  2KAJ A;  3AE8 B;  4FN2 A;  3DBS A;  5EE3 A;  3T9L A;  2IY1 B;  2Z59 B;  2DWQ A;  2LUM A;  1AAR A;  3NZU A;  2V0G A;  1ZDX A;  4G50 A;  4ARC A;  3M3J A;  1QT9 A;  3ZNG C;  3QC8 B;  2ON8 A;  1ZOY B;  4LLG M;  2D11 A;  2D07 B;  3VTU A;  1V1P A;  4AOF A;  4HEA 1;  1V9J A;  5LXI B;  3W1S A;  1IBX B;  2IO0 B;  2N9P C;  1NVI D;  3C8Y A;  3QX1 A;  2LZ6 A;  5IA7 A;  2KDF B;  3MP9 A;  3ZRC A;  2ZVN A;  3I63 C;  1RLF A;  4NAM A;  1OTR B;  4AP4 C;  1M94 A;  4B6W A;  2MX2 A;  2KMC A;  2LGS A;  1EF1 A;  4ZDV A;  1L0X B;  5H92 C;  5AEK B;  1C3T A;  1UF0 A;  2LJI A;  3AEE B;  3SHQ A;  4BZA A;  3WAM A;  4NY0 A;  2WXK A;  1QOG A;  3ALB A;  2WHI A;  4KIK A;  2KNB A;  2CHZ A;  4W9D A;  2C7N B;  2DX5 B;  2BVC A;  5G5G A;  5BMG A;  3ECI A;  2WYQ A;  4P6V F;  2RDG A;  3IAS 1;  1EU3 A;  3S2A A;  2MCN B;  1E8X A;  2EMS A;  3N30 A;  1SB3 C;  2MQJ A;  1SSN A;  5D2M B;  1L4Z B;  1V80 A;  4FJZ A;  1SJH D;  3PRM B;  4RNA A;  3VH4 B;  4OW0 A;  2MP2 A;  1GJZ A;  3W2D A;  1YQ3 B;  5EE0 A;  3JSV B;  2QIE B;  2HTH A;  3L54 A;  3LJ3 A;  1T0S C;  1C78 A;  4IG7 B;  1E5W A;  4ACF A;  1WSP A;  1YNT E;  3ZJT A;  4OZC A;  4PYU A;  2RDH A;  1S1Q B;  1E8Y A;  2HTM E;  2PKO A;  5C2T B;  2KMA A;  3TL5 A;  2Q5W D;  2JRI B;  1UNS A;  1WH3 A;  4PYZ A;  2WS3 B;  5J2R A;  4GDK B;  1IBX A;  2J52 A;  1Z2M A;  2GBJ A;  4G11 A;  4WJP A;  2MJE A;  2N7E A;  3AEG B;  1Y8R C;  2UWQ A;  1YJI A;  3I57 A;  1TGZ B;  2WXR A;  3ZUN A;  3CMM B;  2LRU A;  4WQO B;  1YMH E;  3TUO A;  3ONS A;  1VDV A;  4HVB A;  2M17 A;  4NQL B;  1PGB A;  1P7F A;  1VLB A;  1TT5 B;  1V6E A;  3AED B;  1FIQ A;  3NUH B;  5E6J A;  2AL6 A;  3GE8 C;  1WY8 A;  2DHZ A;  3AUL A;  1XLN A;  3A9J A;  4ASW C;  4K7W A;  3PHW B;  2N7D A;  2FUH B;  3EEC A;  2NR2 A;  1KRH A;  4CQN A;  3NZ3 A;  2LGI A;  3QAR A;  1YOV B;  3AMZ A;  3LB8 C;  4N9F 4;  3A1Q A;  1FFV A;  2C7H A;  5BYS A;  1FCL A;  1XD3 B;  3PRP B;  1VJK A;  2AWT A;  4BFR A;  1YQ4 B;  2KLC A;  1WXV A;  3SD5 A;  4YTM B;  1P98 A;  3NG0 A;  3CF6 E;  1P0R A;  2WLB A;  2LRW A;  3MFG A;  4DXG A;  2W55 A;  2Z0E B;  2LFI A;  3IBE A;  1SE2 A;  5AZF A;  4MEL A;  2FIF A;  2NCN A;  2GRI A;  4IWO A;  1E90 A;  5AUI A;  2ZJD A;  2PMV A;  4XDD A;  3P1M A;  2M4N A;  3DBL B;  2ZPY A;  4GN1 A;  3RI7 C;  1CQV A;  2JVC A;  4WAA A;  2NS5 A;  3KQ4 A;  1T3Q A;  3U8Z A;  3AEC B;  3Q8E A;  1QKZ A;  3AE1 B;  4TMA B;  1G6J A;  2KX3 A;  2KJR A;  1P9D U;  1DYQ A;  4M0W B;  3Q6B A;  2KAN A;  2IY0 B;  2KD0 A;  3N1Y C;  1GNU A;  1FD6 A;  4GDK A;  3AEF B;  1FRD A;  2DAJ A;  2OED A;  1J0G A;  1XO3 A;  2JWZ A;  4I6P A;  3T3O A;  3CSF A;  3Q69 A;  2JXT A;  4BOS C;  5JHB A;  3Q8F A;  3EFU A;  2QCZ A;  4L2Y A;  4ZRP A;  1Q1O A;  4NAW B;  3PV1 A;  1SE4 A;  4HPP A;  3QAQ A;  3I9V 1;  2WXG A;  2WX1 A;  2JQR B;  3WAL A;  3AE3 B;  1YJ1 A;  2DEN B;  1C76 A;  4IDI A;  1UWX A;  2LMC A;  1WXQ A;  2AEH A;  1L7Y A;  1WX9 A;  4IWP A;  4G0N B;  3ZW3 A;  2BB5 A;  3QK0 A;  1D3Z A;  4RGT A;  4NPN A;  4L1B A;  3W5V B;  4EFO A;  3RUL A;  2MSE D;  1M4V A;  2J0K A;  4MGZ E;  3PZ8 A;  1TKY A;  1D4B A;  3Q3M C;  3ZO5 B;  3JW0 X;  3DBR I;  2REX A;  1Q0W B;  3DBL I;  3VUW A;  5IO9 A;  2D3C A;  3RD2 A;  1FNU A;  2XNA C;  1VZ6 A;  4ANV A;  2WU2 B;  2I1K A;  3DBH B;  2KWV B;  1TYG B;  3FIL A;  4RM8 A;  2K8H A;  1SE9 A;  3RN9 C;  3AXC A;  2BS4 B;  1N5X A;  4ZRQ A;  2WXM A;  4DHZ E;  1SBB B;  4AUQ C;  4DXA B;  3ML8 A;  1FNW A;  2KZR A;  2NBW B;  4RFB A;  5CHV C;  2NVU I;  3EA6 A;  4GLS C;  2KN5 A;  4KVG B;  3I3T B;  3OG5 A;  3ZNZ B;  2H89 B;  1UBQ A;  4RGM A;  3U52 E;  3PLU A;  5BYR A;  4LTU A;  1C4A A;  1RM6 C;  1ZXH A;  1SXT A;  2BYV E;  4M0W A;  4MGK E;  5IAA C;  4RM9 A;  1DOI A;  3H7S A;  1OGW A;  1SF0 A;  2RD0 A;  2FNJ B;  1UGJ A;  3QIJ A;  4OHJ A;  2IYD B;  1FM0 D;  2JZZ A;  4K7S A;  1TTN A;  3B2G A;  4W9H A;  4W9J A;  3HUI A;  4WWO A;  2BW2 A;  1SEB D;  5D3D A;  4EUT A;  2ZPN A;  2K22 A;  3IVF A;  2PLP A;  3GZN B;  4HLE A;  2ICI A;  3RFZ B;  4NNJ B;  1XF5 L;  1MVK A;  4F7Z A;  3B2F A;  2JXX A;  4USA A;  5BMH A;  3DOW A;  4NJ6 A;  4JPS A;  4GDL B;  4GIV A;  3APD A;  1F1H A;  4XC2 A;  3AE7 B;  2OJR A;  3MJW A;  4ANU A;  3N20 C;  2WDQ B;  3DBH I;  1N63 A;  2L32 A;  4LDT B;  1QOA A;  1KF6 B;  3L10 B;  4LNK A;  4C00 A;  1ET9 A;  4KGR A;  4BOZ B;  3RCZ A;  1PYW D;  2DYM A;  2KDM A;  4M8N A;  4JGH B;  2BTE A;  1H4R A;  3L4P A;  1Q10 A;  4URK A;  3P4R B;  1WX8 A;  1GG3 A;  2YLM A;  2JYE A;  3VRA B;  4F8C B;  1WGG A;  2MA9 B;  2B76 B;  5DPW A;  3UGB B;  3KYD D;  3AE6 B;  1ZW7 A;  4ZHO A;  4KGT A;  4AS1 A;  1JML A;  2L7R A;  1E7U A;  2V3N A;  3FAH A;  5GMV A;  3VFK A;  4BVU C;  1XCQ L;  4EEW A;  3RMK C;  3BYY B;  3L16 A;  3RT3 B;  1HXY D;  2LEK A;  3DWG C;  2PVG C;  2MWS B;  3PT2 B;  2AQ2 B;  1TS4 A;  3SFD B;  1V1O A;  2J42 A;  4BBN F;  3VH3 B;  3DWM A;  4GSW A;  2CJN A;  3UIN B;  2FBW B;  1IGD A;  3HHM A;  4MEM A;  4FXC A;  1E7P B;  2AX5 A;  4DDG D;  1XLQ A;  1VD2 A;  3KVF B;  2ZNV B;  4MGY E;  3UI3 A;  1KLU D;  4ZHP A;  3Q3N C;  3AE5 B;  3VUY A;  1LO5 D;  3NOB A;  1N62 A;  2KX0 A;  4ARI A;  3B9J A;  2W3R A;  4MM3 A;  2NBU A;  2W3S A;  1WGR A;  2CU1 A;  1PQS A;  1NEN B;  3V6C B;  2IJ0 A;  3Q8A A;  4HPL B;  2RMM A;  4HRS A;  1OFF A;  1FXI A;  5C3J B;  2MP2 B;  1FO4 A;  1TZO A;  2CU3 A;  2L3Z A;  3DPD A;  4W9G A;  1OQY A;  1SIJ A;  2IO2 B;  3UIO B;  3DHG C;  3VDZ A;  2ZEQ A;  1FPY A;  1QF6 A;  2V9H A;  3AE9 B;  4WIP A;  4S17 A;  1NI3 A;  1LQB A;  1WGD A;  3W1S C;  4B0M A;  2WP9 B;  1L2N A;  3ABV B;  2YEP F;  4OVZ A;  2WWZ A;  4WH4 A;  3UQB A;  4FUL A;  2V4L A;  4ZRJ A;  3V62 A;  4DHZ B;  3BWU D;  3DHI C;  2LJ5 A;  3DQV A;  3ZJV A;  4KKI A;  3PZD A;  5D7G A;  2HE7 A;  2KQ4 X;  1JW9 D;  3SR6 A;  1EM7 A;  4W9E A;  1WRI A;  2KJ6 A;  1RFA A;  1NBF C;  1HEZ E;  3D32 A;  2GBM A;  1ZE3 D;  4GU2 A;  3SEB A;  2WQY B;  3VR9 B;  3TCA A;  2K1F A;  2O6V B;  4RGN A;  4MSQ B;  4DWF A;  1V5O A;  2CHW A;  2VZK B;  3PS6 A;  2ZNV C;  5CHF A;  4BKS A;  1UH6 A;  1AWD A;  3B1L X;  1KTK A;  4YWG G;  3NVY A;  2QIL A;  4DK5 A;  4EZK A;  3A9J B;  3HIZ A;  1FNV A;  3V3X A;  1MJD A;  2ONQ A;  3H1U A;  4YSX B;  3AE2 B;  3HVZ A;  2DAF A;  5HG2 A;  3BYT B;  2BBC A;  4IUM B;  1MPE A;  3AU4 A;  2IGD A;  3AN1 A;  2AL3 A;  3A1Q B;  2BGF A;  3IXS A;  3R66 C;  1C79 A;  2CR5 A;  3ZLZ A;  1WE7 A;  1F2R I;  1DOX A;  3IT4 B;  1WJU A;  1PGA A;  4HJG E;  1E9M A;  1LGR A;  2G1E A;  1F2R C;  2N7J A;  4YT0 B;  2JRH A;  3ML9 A;  3SU8 X;  1L5P A;  1LXD A;  3KWV A;  3NS8 A;  3NS1 A;  3OJ3 A;  3V61 A;  1CZP A;  3BII D;  1D5M C;  1QOF A;  1TS2 A;  1ISN A;  2PJH A;  3ZJU A;  3ZDM C;  2HJ1 A;  4XDC A;  4LNN A;  4N59 A;  1T0Y A;  4K3B A;  2J0M A;  3VVW B;  4DHJ B;  1K51 A;  3PHX B;  2WXL A;  1CJE A;  2INC C;  2EKI A;  3GP7 A;  2W9N A;  1EUV B;  4LNF A;  3K9O B;  1UEL A;  3PGE A;  1ET6 A;  1E7V A;  1ZUD 2;  4XWT A;  2ZW0 A;  3ZTC A;  1JWB D;  1WIA A;  2DZK A;  2DNF A;  5BO4 B;  4XYC A;  3KUD B;  2ASQ A;  4GB9 A;  2O6V A;  3ZDT A;  1R4N B;  2WNM A;  4DDI D;  4MAC A;  1RFK A;  4QAY A;  2V3P A;  3TEW A;  3PRE A;  4TSS A;  1WFY A;  2KQS A;  3HM3 A;  2Z0D B;  4IM0 A;  2KLG A;  2KKC A;  2J7Q B;  1R7S A;  3RZF A;  3E9S A;  3U30 A;  1D5X C;  2C9W B;  4BAX A;  3M62 B;  3IAM 1;  1C9F A;  2L0T A;  4ZRI A;  2L52 A;  1YIW A;  3C19 A;  2MBE A;  4LNO A;  3IFW B;  5FK9 C;  2AQ3 B;  2KVR A;  2LVP A;  1VCB A;  2GB1 A;  1N5W A;  3Q14 C;  3TBL D;  3Q3J A;  1E8W A;  3MC9 A;  2N9E B;  3AEA B;  1KH0 A;  4MJS A;  3V60 A;  1QZE A;  2WXH A;  3FIL B;  3MTN B;  2MJ3 A;  3MHS D;  1XEE A;  1TBE A;  2QHO A;  3QQ8 B;  2D2Q A;  4MGI E;  5CTR C;  1OQQ A;  2Y5C A;  2BF8 B;  3W5U B;  4FHJ A;  1BT0 A;  1ENF A;  4P1C C;  1GUA B;  2D10 A;  1XLP A;  2IO1 B;  3EGR A;  3HK0 A;  4WUR A;  2VRR B;  4XWW A;  2JU6 X;  5D6J B;  1WZ0 A;  2WXO A;  3B0A A;  2IO3 B;  1R4N I;  2PE6 B;  3AH7 A;  4RCO A;  3KW5 B;  4HWI B;  3PVL A;  2I38 A;  4LJP B;  1P1A A;  5AUK A;  4KDL B;  2DYB A;  4BKG A;  3MHZ A;  4HRO A;  2YEP B;  2BPS A;  4GXB A;  5JXV A;  2LAS A;  2N4F A;  1NEK B;  4D2K A;  4NJC A;  1QQR A;  1K52 A;  1H8C A;  4KKJ A;  1L6U A;  5JH5 C;  3KUC B;  1KFY B;  4TKN A;  3TEZ A;  3PPA A;  5FR3 A;  1RWS A;  3R7Q A;  1WR6 E;  1WXM A;  4BBN C;  4YTN B;  4ZYN A;  2D5G A;  3NJT A;  3URY A;  4MH0 E;  2QMT A;  1IPG A;  1WR1 A;  1MFW A;  1XLO A;  2GBR A;  1XXG A;  1HTO A;  4WWN A;  3U7Z A;  1V97 A;  4AJY B;  3ZYY X;  1E10 A;  1WM3 A;  3RZW C;  1GB1 A;  4HK2 A;  3ENE A;  1WJN A;  4ICV A;  3BZD B;  2KVZ A;  2EMT A;  3X0W A;  4AJW A;  5KHO A;  4A9A A;  4OZA A;  1TS3 A;  3N9Y C;  4F1S A;  3RNF C;  2K25 A;  1V8C A;  2E6X A;  3RNC C;  2INP E;  1UD7 A;  4TV3 A;  3PZ7 A;  4AWJ A;  1T0R C;  2BB6 A;  1HQR D;  2WU5 B;  2KDI A;  3OLM D;  2K0P A;  2WDT B;  1TKG A;  3CIR B;  5H8Y E;  2KJH B;  1J19 A;  3IT6 B;  2B3A A;  1F0Z A;  1WXA A;  4WJO A;  3J9C A;  2JT4 B;  3TMP B;  2KXJ A;  4K1R B;  5TR5 A;  4YXD B;  1B9R A;  3UF8 A;  4CO7 A;  5AZH A;  2LI5 A;  3SFE B;  2M1M A;  5C1Z A;  2XBB C;  4MDK E;  1ACC A;  2ZVO A;  4B9K A;  1IYF A;  3VRB B;  3P42 A;  1PDX A;  2K8B A;  3HVD A;  1WZ3 A;  4W9F A;  3A4R A;  4OVU A;  3RNA C;  1E0Z A;  4ZYS A;  1YX5 B;  2UYZ B;  1ZP0 B;  1D5Z C;  3RNE C;  2GLS A;  4HDO A;  4US8 A;  3FC4 A;  2ZCB A;  1E8Z A;  1XQQ A;  3BY4 B;  2FAZ A;  2H88 B;  5J17 A;  3JVZ X;  3K9P B;  1GPX A;  2J0J A;  4CYE A;  4KZC A;  2KOX A;  2MBH A;  1ROE A;  3BIN A;  2BT6 A;  2K39 A;  4IM2 A;  2R61 A;  1T5X D;  2OJW A;  3WAN A;  3P4Q B;  5D94 A;  2XK5 B;  1WRD B;  2GOW A;  4UDU C;  1GOZ A;  1GAQ B;  4W9K A;  3DVG Y;  5JHA A;  1X1M A;  1CMX B;  3W1Y A;  1I4Q A;  5EE1 A;  4MM3 B;  3O13 A;  4KZ0 A;  3TJP A;  4OZB A;  4P1B C;  4IKG A;  4K81 A;  3P4P B;  1I35 A;  2DZI A;  2OHF A;  4E71 A;  5GXG B;  3AI5 A;  1QLB B;  4FJY A;  3R7R A;  3GE3 C;  4LDT D;  2R2Q A;  1MG8 A;  1S3S G;  3U4E G;  1MI0 A;  1YN3 A;  2DLB A;  1UZX B;  4TQ0 A;  1V86 A;  5G5H A;  3R2I A;  1JRU A;  1J8C A;  3QCA A;  5DPS A;  1GB4 A;  4YSY B;  2X8X X;  1WJ4 A;  3FKY A;  2PW9 A;  3VR8 B;  1C4C A;  3QA8 A;  4IC7 B;  2IDY A;  1P3Q U;  2CKH B;  2DZM A;  1N6Z A;  3SDL C;  5HKH A;  1QIL A;  1JRO A;  1L4D B;  3GB1 A;  1R4M B;  4LK0 M;  1SE3 A;  2O2V B;  3T3N A;  2IND C;  2GBK A;  1XT9 B;  3TSS A;  2BKR B;  1K50 A;  3AEB B;  3CST A;  4FA6 A;  3BVZ A;  4A20 A;  2KO3 A;  3VAW A;  2RPQ A;  4FHK A;  1FRR A;  2LD9 A;  4BKS D;  3GZN I;  1FFU A;  2VH1 A;  4IOI E;  1KLV A;  1OQR A;  5TSS A;  4JL9 A;  4XE0 A;  5E6P A;  1AN8 A;  5BYQ A;  4TQ1 A;  2FID A;  2DBY A;  1WF9 A;  3TIX A;  2K9X A;  2BYT A;  1GC6 A;  2FCN A;  2MJD A;  5LXH A;  2C5L C;  3KUZ A;  2LWP A;  1WMH B;  1C1Y B;  3LXF A;  2XK5 A;  4II3 B;  5LLI A;  1FMA D;  3OJ4 B;  5IOI A;  2QSD A;  1TZ1 A;  4H2A A;  3A9K B;  3ZNI D;  1SIF A;  2K3U A;  4C4V B;  4FAD A;  3WA0 A;  1DOY A;  1ZPS A;  2A4Z A;  2G4S A;  4FJV B;  1XCT L;  2HJ8 A;  3NRZ A;  3Q8C A;  2GI9 A;  4A90 A;  4PS7 A;  1L6V A;  2G4D B;  3Q8B A;  1OEY J;  2UU7 A;  4REZ A;  2JWU A;  5IKC M;  3LYY A;  4ZRK A;  3MC8 A;  4L23 A;  3NZS A;  3N1Z C;  1A70 A;  5DPR A;  3A33 B;  1JWA D;  2N0S B;  4US9 A;  3TEY A;  1A5R A;  1YX6 B;  2N9L A;  4N6E B;  2MBQ A;  1VZ8 A;  4MT5 A;  3T8M A;  2WGS A;  5G2N A;  2MBB B;  3OAW A;  4HKZ E;  5L83 A;  2IBI B;  3RNG C;  4KGS A;  4C7Z A;  1P7E A;  1TY2 A;  2GBN A;  4PS3 A;  1PFD A;  4E3C A;  3PSE B;  1HZ5 A;  1MHX A;  4WWP A;  2O2V A;  2W54 A;  2JY6 A;  4C56 C;  2PIA A;  4A3O A;  5J18 A;  2CS4 A;  4O1N A;  2MRP A;  2O6V D;  2PEA A;  1SJE D;  2VZK D;  1ZGU B;  4HDQ A;  4TUU A;  3NVV A;  4J3O D;  1V5T A;  1YN5 A;  3R3M A;  4YL8 A;  4WJN A;  1C77 A;  4J6I A;  3NVZ A;  1QOB A;  5EE9 A;  3Q2A C;  1KOT A;  2KN4 A;  3QWZ B;  2YVC A;  1HE8 A;  3ETR A;  3N3K B;  3VXW A;  1WMH A;  1YQB A;  3HM6 X;  2FCS A;  2KC1 A;  3PRZ A;  3EHV A;  2WXF A;  5HFY A;  3V05 A;  5IP4 D;  4XX5 A;  2L1A A;  2Y5B B;  4W9C A;  1WX7 A;  2ACZ B;  3A9K A;  1HZ6 A;  2KWU B;  2LVQ A;  5FKA C;  2M56 B;  4YTP B;  4C4V A;  3P2B A;  2KDE B;  1B1Z A;  1TKE A;  4WQM A;  3UIP B;  2VH2 A;  4MJS B;  1JCK B;  2BQQ A;  2RDB C;  3PLV A;  1KM7 A;  1WWT A;  1NYR A;  2IGG A;  2D3G A;  2V4I B;  1K8R B;  5DCN A;  3VUX A;  4EKU A;  2SAK A;  1I4X A;  1TIF A;  3A4S C;  1UWM A;  3HRD D;  2K6D B;  4JLC A;  4KSK C;  4KSL C;  3L17 A;  2D3B A;  5E6N A;  5G55 A;  2PE9 A;  1YD8 U;  1TJE A;  5CHW A;  2ZW1 A;  4DHJ D;  1STE A;  1ESF A;  4A3P A;  5IN7 A;  2KFK B;  1DGJ A;  2FCQ A;  1F52 A;  1BML C;  2L00 B;  4K3C A;  4RH6 A;  4MSM B;  3APC A;  5D3I B;  3ZGZ A;  3KYC D;  4LNI A;  3AU5 A;  1JWS D;  3AV8 A;  3C0R B;  5L95 C;  3ZXV A;  1UBI A;  4II2 B;  4FLH A;  3H6N A;  4X57 B;  2EKE C;  1I4G A;  1Z5S B;  3GS2 A;  2KC2 A;  2NTT A;  5C23 A;  2K5P A;  2KTR B;  4LCD E;  3KLS X;  1BUI C;  2GMI C;  4JWU C;  2C60 A;  4JQW C;  2G9H D;  3TEX A;  5HHD G;  1I4H A;  1NDD A;  3NVW A;  4NQK E;  3ZIM A;  1JWM D;  1WGK A;  1ZKH A;  4NZL B;  3BVM A;  1EWY C;  3OWE B;  3L08 A;  1WM2 A;  3LDZ E;  4RF0 A;  3H7P B;  1UGM A;  2BKF A;  2WDV B;  2K8C A;  4E74 A;  2A5U A;  2QEJ C;  5FR6 A;  1OEY A;  3AM9 A;  4GMV A;  1UUP A;  2AQ1 B;  3L0W B;  4C80 A;  1GC7 A;  1J7A A;  3B08 A;  4PT5 A;  3BK1 A;  1MG4 A;  1AW7 A;  3ZNH B;  1WXS A;  1WI0 A;  2LHD A;  1NI2 A;  3H8H A;  2NBV B;  3IHP C;  2J4X A;  1WGH A;  3AB5 A;  3EC8 A;  2IGH A;  2J53 A;  3P4S B;  3U2S C;  4DBG A;  3EFC A;  1AYF A;  4NJ7 A;  4A8X C;  2G45 B;  3ZKJ C;  2Z8L A;  1K53 A;  4GGQ A;  4XZ4 A;  2RGF A;  3VHT C;  1ZXI A;  2JX5 A;  2D3A A;  3Q3O C;  3RYT A;  4Q2J A;  5LNK 1;  1VRA B;  2KFK A;  2ZZP B;  3JSV A;  4B0E A;  4R3D A;  2X38 A;  4JIO U;  1YJJ A;  3PO0 A;  2JZ3 B;  2N1V A;  2XN9 C;  3DBR B;  4JWS C;  2OOB B;  5KHQ A;  1PUT A;  4K7U A;  3RUI B;  1YN4 A;  2TSS A;  5T8I A;  5JZE B;  1EU4 A;  4JX1 C;  3MC0 B;  2V1Y A;  4B95 A;  1TS5 A;  1Y56 A;  2MBO A;  3ZTD A;  2Y3A A;  3BVG A;  1CK1 A;  2KWC A;  2INN E;  4HPM B;  2KTR A;  1JAL A;  5HI1 A;  1NYQ A;  4IW0 A;  2I1J A;  2N9K A;  2NPT B;  5AZG A;  2BWF A;  3BK2 A;  1IGC A;  1U4A A;  4LJO B;  3H9D A;  4OVV A;  1IP9 A;  1WYG A;  4KV2 A;  4HKQ A;  4XGA B;  2WX0 A;  3APF A;  1Q5W B;  3H7P A;  3WAO A;  4IWQ A;  3R8B A;  1F77 A;  4KDI C;  1N61 A;  1WE6 A;  2I2Y A;  3ZQ4 A;  3ZXR A;  2JZP A;  2RR9 A;  3N1X C;  2RSU A;  4ICU A;  1E6E B;  3DCG A;  2IPK D;  1I4P A;  2KMM A;  4HXD A;  1HA5 A;  3KWL A;  2MH7 A;  2FE8 A;  1N60 A;  2C7M B;  2MHJ A;  2BYE A;  1WGY A;  1L0V B;  1T6B X;  2KK8 A;  4IM3 A;  3JYU A;  3PTF C;  2LXA A;  1FCC C;  1FEH A;  2CJO A;  1LM8 B;  4M02 A;  3O65 B;  4HCP B;  4C7Y A;  1BXT A;  2G3Q B;  1J7C A;  2KHW B;  4DQO C;  2R2O A;  2WXP A;  1T0Q C;  2M0A A;  3GOE A;  2M8S A;  1VZ7 A;  2LHE A;  2BWE S;  1L0Y B;  3NHE B;  4G3X B;  1EO6 A;  2DYO A;  2MW5 A;  2LXC A;  3VTV A;  3E56 A;  1RAX A;  4RF1 A;  3L13 A;  1I42 A;  2PVO D;  3DVN V;  1IUE A;  2M0X A;  3WAP A;  1D6E C;  1RRB A;  3W9C B;  4HCN B;  5BMI A;  2V3S A;  3WIM A;  1JQ4 A;  4ANW A;  2EEL A;  4A6Q A;  2IZV B;  2PPH A;  2L76 A;  4DXF A;  2NPT A;  2WXQ A;  3P63 A;  1V49 A;  1SGH A;  2KFJ A;  4WJQ A;  5CX3 A;  3X23 A;  4WWM A;  4NAW A;  2L05 A;  1ZDV A; 
#chains in the Genus database with same CATH homology
 4L23 A;  3AEF B;  1K51 A;  1FRD A;  3CWI A;  2OED A;  1A70 A;  1XO3 A;  3T3O A;  1JWA D;  2N0S B;  1CJE A;  2WXL A;  3Q69 A;  2JXT A;  4US9 A;  3TEY A;  2N9L A;  4N6E B;  2EKI A;  3GP7 A;  3Q8F A;  4WAF A;  2JYT A;  1VZ8 A;  4L2Y A;  4MT5 A;  4ZRP A;  2NTS A;  4A55 A;  3WCQ A;  4NAW B;  1ET6 A;  2SEB D;  4ZOH C;  4HKZ E;  1SE4 A;  1ZUD 2;  4XWT A;  2NMQ A;  3I9V 1;  2ZW0 A;  2WXG A;  1JWB D;  2JSV X;  2JQR B;  4KGS A;  4C7Z A;  3R2T A;  3AE3 B;  1P7E A;  2KWD A;  1TY2 A;  1C76 A;  1PFD A;  4IDI A;  1UWX A;  1HZ5 A;  2LMC A;  1MHX A;  1WXQ A;  2WNM A;  2W54 A;  3VQI A;  4C56 C;  2BB5 A;  2PIA A;  4MAC A;  1RFK A;  2V3P A;  4RGT A;  3TEW A;  4L1B A;  3W5V B;  4TSS A;  4O1N A;  1SJE D;  1RYJ A;  1KLG D;  1M4V A;  2PTL A;  2VZK D;  1R7S A;  2WDR B;  3PZ8 A;  3E9S A;  4EE2 A;  1D5X C;  3NVV A;  4N58 A;  1TKY A;  1D4B A;  4J3O D;  1YN5 A;  1C4P A;  3IAM 1;  1C9F A;  1J7B A;  1VR9 A;  4AQ7 A;  2L52 A;  1C77 A;  1JWU D;  1JRP A;  4ITK A;  3EUB 2;  1V1P B;  3NVZ A;  1QOB A;  5EE9 A;  1FNU A;  2XNA C;  1VZ6 A;  5FK9 C;  2AQ3 B;  2KN4 A;  2WU2 B;  2GB1 A;  2RPV A;  1TYG B;  2WXJ A;  3ETR A;  1N5W A;  3FIL A;  2MEK A;  2WXF A;  2BS4 B;  1N5X A;  4ZRQ A;  1I4R A;  5HFY A;  2WXM A;  3AEA B;  3V05 A;  1EWC A;  1SBB B;  2WXI A;  1KH0 A;  2L1A A;  1FNW A;  2WXH A;  2ACZ B;  1FXA A;  3FIL B;  1HZ6 A;  4RFB A;  3EA6 A;  5FKA C;  2MJ3 A;  2M56 B;  1XEE A;  4GLS C;  4YTP B;  1B1Z A;  1OQQ A;  1TKE A;  2H89 B;  2Y5C A;  4WQM A;  3W5U B;  2Y5P A;  4RGM A;  3U52 E;  1JCK B;  3AE4 B;  1ENF A;  5BYR A;  2BS2 B;  4P16 A;  1WWT A;  1NYR A;  2IGG A;  1C4A A;  1XLP A;  2V4I B;  1RM6 C;  1ZXH A;  1SXT A;  2WXN A;  3EGR A;  4WUR A;  4M0W A;  4XWW A;  2JU6 X;  2WXO A;  2SAK A;  1DOI A;  1I4X A;  1UWM A;  2HDE A;  1SF0 A;  3HRD D;  1I7H A;  4LTU A;  3AH7 A;  4RCO A;  2E3T A;  4RGO S;  1UGJ A;  4OHJ A;  2I38 A;  5AUK A;  1FM0 D;  1TJE A;  3MHZ A;  3RPF C;  3B2G A;  2W82 A;  4KX6 B;  4HRO A;  2YEP B;  5JXV A;  2ZW1 A;  2KAC A;  3HUI A;  1NEK B;  2FUG 1;  1STE A;  1ESF A;  2BW2 A;  1SEB D;  4JE3 B;  1QQR A;  4NJC A;  4D2K A;  4YSZ B;  2QJL A;  5D3D A;  1K52 A;  1MHH E;  3MJ5 A;  1DGJ A;  1TY0 A;  1PGX A;  4KKJ A;  2K22 A;  1L6U A;  2PLP A;  2ICI A;  3RFZ B;  1KFY B;  2L83 A;  1BML C;  2M19 A;  3TEZ A;  1XF5 L;  5I4D A;  4RH6 A;  4MH8 A;  1MVK A;  3B2F A;  5FR3 A;  4USA A;  1RWS A;  5BMH A;  2BS3 B;  5D3I B;  3ZGZ A;  4JPS A;  4GDL B;  5MPO A;  2KAJ A;  4YTN B;  3AE8 B;  2D5G A;  3URY A;  5EE3 A;  2QMT A;  1JWS D;  3AE7 B;  3AV8 A;  2WDQ B;  1XLO A;  2DWQ A;  2LUM A;  1N63 A;  1XXG A;  2L32 A;  1I4G A;  3U7Z A;  1V97 A;  3GS2 A;  3ZYY X;  1E10 A;  2V0G A;  2NTT A;  1ZDX A;  4ARC A;  1QOA A;  1KF6 B;  1GB1 A;  1ET9 A;  2K5P A;  1QT9 A;  3KLS X;  2ON8 A;  3BZD B;  1BUI C;  1ZOY B;  4JWU C;  4KGR A;  2G9H D;  3TEX A;  5HHD G;  1I4H A;  4LLG M;  4A9A A;  4OZA A;  1TS3 A;  3N9Y C;  3NVW A;  1PYW D;  2DYM A;  2KDM A;  1V1P A;  2BTE A;  1JWM D;  1WGK A;  3L4P A;  1Q10 A;  1V8C A;  4NZL B;  2E6X A;  4HEA 1;  2INP E;  3BVM A;  3P4R B;  3PZ7 A;  2BB6 A;  1EWY C;  1HQR D;  2WU5 B;  3OWE B;  3W1S A;  4RF0 A;  2JYE A;  2K0P A;  1IBX B;  2WDV B;  3VRA B;  1NVI D;  3C8Y A;  1TKG A;  3CIR B;  5H8Y E;  2B76 B;  2QEJ C;  3MP9 A;  3IT6 B;  1F0Z A;  3AE6 B;  4ZHO A;  4NAM A;  3J9C A;  4KGT A;  1JML A;  4AS1 A;  3AM9 A;  1UUP A;  2AQ1 B;  2V3N A;  3FAH A;  4C80 A;  1XCQ L;  4YXD B;  1J7A A;  1B9R A;  4PT5 A;  3BYY B;  3BK1 A;  1HXY D;  1AW7 A;  2LEK A;  3DWG C;  2PVG C;  2LHD A;  2AQ2 B;  1L0X B;  5H92 C;  1TS4 A;  3H8H A;  3SFE B;  1ACC A;  3SFD B;  2LJI A;  3VRB B;  2J4X A;  3P42 A;  3AB5 A;  3AEE B;  1PDX A;  1V1O A;  2J42 A;  2IGH A;  3HVD A;  2J53 A;  3P4S B;  2WXK A;  3U2S C;  1QOG A;  3DWM A;  1AYF A;  2CJN A;  2FBW B;  1IGD A;  1E0Z A;  4ZYS A;  4A8X C;  1ZP0 B;  4FXC A;  1E7P B;  2AX5 A;  1D5Z C;  5G5G A;  5BMG A;  2Z8L A;  1K53 A;  1XLQ A;  4US8 A;  3FC4 A;  4P6V F;  1ZXI A;  2H88 B;  2JX5 A;  2RDG A;  3IAS 1;  1EU3 A;  4Q2J A;  3UI3 A;  1KLU D;  5LNK 1;  1VRA B;  4ZHP A;  1GPX A;  4B0E A;  3AE5 B;  1SB3 C;  4R3D A;  1SSN A;  1LO5 D;  1L4Z B;  2X38 A;  1N62 A;  1YJJ A;  1SJH D;  3PO0 A;  1ROE A;  2BT6 A;  4ARI A;  3B9J A;  2R61 A;  2XN9 C;  4RNA A;  1T5X D;  2W3R A;  4OW0 A;  4JWS C;  3P4Q B;  2W3S A;  3W2D A;  1YQ3 B;  1PUT A;  1YN4 A;  2TSS A;  5EE0 A;  5T8I A;  2QIE B;  1NEN B;  1EU4 A;  4JX1 C;  4UDU C;  3MC0 B;  1GOZ A;  2IJ0 A;  1GAQ B;  3Q8A A;  1C78 A;  1TS5 A;  1Y56 A;  1I4Q A;  2RMM A;  2Y3A A;  3BVG A;  5EE1 A;  1WSP A;  1YNT E;  1CK1 A;  4HRS A;  4MM3 B;  1OFF A;  1FXI A;  3O13 A;  5C3J B;  3ZJT A;  1FO4 A;  4OZC A;  2RDH A;  1TZO A;  2CU3 A;  2INN E;  4OZB A;  4IKG A;  2HTM E;  1SIJ A;  3P4P B;  1JAL A;  2PKO A;  1NYQ A;  5HI1 A;  5C2T B;  2OHF A;  2N9K A;  1QF6 A;  3AE9 B;  5GXG B;  1QLB B;  4WIP A;  1NI3 A;  2Q5W D;  3BK2 A;  1IGC A;  4B0M A;  2WP9 B;  3U4E G;  1WYG A;  1UNS A;  4HKQ A;  3ABV B;  2YEP F;  1MI0 A;  1YN3 A;  2DLB A;  4OVZ A;  2WS3 B;  4WH4 A;  4GDK B;  4TQ0 A;  5G5H A;  3R2I A;  2J52 A;  1IBX A;  3R8B A;  1GB4 A;  4YSY B;  3BWU D;  1F77 A;  3ZJV A;  2MJE A;  1N61 A;  3AEG B;  4KKI A;  5D7G A;  2PW9 A;  2KQ4 X;  1YJI A;  3I57 A;  1JW9 D;  3VR8 B;  2I2Y A;  3SR6 A;  3ZQ4 A;  2JZP A;  1EM7 A;  1WRI A;  1C4C A;  2WXR A;  3TUO A;  1YMH E;  2IDY A;  1HEZ E;  1E6E B;  1VDV A;  1PGB A;  1P7F A;  2IPK D;  1I4P A;  1QIL A;  2KMM A;  1JRO A;  1VLB A;  1L4D B;  1ZE3 D;  1HA5 A;  3KWL A;  3SEB A;  2MH7 A;  2WQY B;  3GB1 A;  3VR9 B;  3AED B;  2FE8 A;  1N60 A;  1FIQ A;  3NUH B;  5E6J A;  4RGN A;  4LK0 M;  1SE3 A;  3T3N A;  1XLN A;  2VZK B;  1L0V B;  3TSS A;  1T6B X;  1AWD A;  1K50 A;  3AEB B;  3BVZ A;  1KTK A;  1FCC C;  1FEH A;  1KRH A;  2CJO A;  4CQN A;  3NZ3 A;  4YWG G;  2LGI A;  4C7Y A;  3NVY A;  3AMZ A;  1BXT A;  2QIL A;  3LB8 C;  1FNV A;  1FRR A;  3V3X A;  1J7C A;  1FFU A;  4IOI E;  1FFV A;  4DQO C;  5BYS A;  1FCL A;  1OQR A;  2ONQ A;  1VJK A;  5TSS A;  3AE2 B;  2WXP A;  3HVZ A;  4YSX B;  5HG2 A;  4XE0 A;  1YQ4 B;  2M0A A;  3BYT B;  1AN8 A;  1VZ7 A;  2BBC A;  5BYQ A;  4TQ1 A;  4YTM B;  2LHE A;  2DBY A;  1MPE A;  2IGD A;  3AN1 A;  2K9X A;  2BYT A;  2WLB A;  2MJD A;  3IXS A;  1L0Y B;  3MFG A;  4DXG A;  1C79 A;  2W55 A;  2LFI A;  1SE2 A;  1F2R I;  1DOX A;  3IT4 B;  3LXF A;  1PGA A;  4HJG E;  2DYO A;  1E9M A;  2GRI A;  1FMA D;  3E56 A;  5AUI A;  4RF1 A;  2G1E A;  2PMV A;  4XDD A;  1F2R C;  2QSD A;  2PVO D;  2N7J A;  4YT0 B;  4H2A A;  1IUE A;  3P1M A;  1D6E C;  3W9C B;  1L5P A;  1CQV A;  2K3U A;  3KWV A;  3NS1 A;  5BMI A;  1JQ4 A;  3KQ4 A;  1T3Q A;  2EEL A;  1CZP A;  1DOY A;  1ZPS A;  4A6Q A;  3BII D;  3AEC B;  1D5M C;  1QOF A;  1TS2 A;  3Q8E A;  1QKZ A;  3AE1 B;  1XCT L;  4TMA B;  4DXF A;  2WXQ A;  3P63 A;  3NRZ A;  3Q8C A;  1DYQ A;  2GI9 A;  4A90 A;  1L6V A;  3ZJU A;  3Q8B A;  4XDC A;  4N59 A;  4REZ A;  2JWU A;  3LYY A;  4WWM A;  1FD6 A;  1ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...