2LMCA

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial RNA polymerase inhibitor
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transcription
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lmcA00
4LK0M 4LLGM 2WNMA 2LMCA
chains in the Genus database with same CATH superfamily
2OEDA 4IC7B 2OJWA 2FCNA 3AE3B 3PRMB 4MM3A 1WXQA 3RNFC 5HFYA 3KQ4A 1ZDXA 1V80A 4HKZE 2ICIA 4IWPA 3KVFB 3HRDD 4MM3B 4A20A 3ZXRA 4R3DA 3PRPB 4NQLB 2K5PA 3N1XC 2JXXA 2KLGA 1Y56A 4W9GA 4REZA 3WAOA 1LQBA 2NBVB 2KWUB 4KKIA 2GI9A 2ONQA 3UGBB 3B1LX 1H4RA 4DHZB 2G4SA 1GC7A 2WX1A 4ITKA 5IOIA 2N0SB 4NY0A 4JGHB 3NZ3A 4ZYSA 2MBBB 3QK0A 1L4ZB 4ZRJA 4ZRKA 2M4NA 5DCNA 4OZAA 1WMHA 1GUAB 2SAKA 1GNUA 4B9KA 1XCTL 2PVGC 2LXAA 4KZCA 2IY0B 3M62B 3ZYYX 5E6JA 1XQQA 3IAM1 2Z59B 1WMHB 2KT7A 3AEBB 1TBEA 1V86A 2AEHA 3BYTB 1ZE3D 4UDUC 2GLSA 4JE3B 4JLCA 4TQ1A 2V0GA 2BYVE 2N9LA 3AEEB 3AE8B 4E71A 3W1YA 4IWOA 2PVOD 3BWUD 2K6QA 2RR9A 5J17A 4HWIB 1SBBB 1WX7A 3ZJTA 3W1SA 2IDYA 3NS8A 4II2B 5BYRA 3SFDB 2KN5A 4J6IA 2PJHA 2RDHA 2J0JA 3BYYB 4X57B 4RGTA 2Q5WD 2WHIA 1OEYJ 3ZLZA 1VZ8A 1YX5B 4HVBA 3JYUA 2B76B 1QF6A 3NRZA 3L54A 3DBLB 4TSSA 4PK1A 2BS2B 1D4BA 1R4NI 3B9JA 3SEBA 3HVZA 5E6NA 1WJ6A 1UBQA 5FKAC 3W1SC 2WXKA 4ANXA 4LNNA 4JX1C 3B0AA 3H1UA 1TGZB 2MCNB 3TSSA 1VLBA 3O65B 1S1QB 1EF5A 4AS1A 2UWQA 4K1RB 3V6CB 4M8NA 2JQRB 2WWZA 3DVNV 4IUMB 4NAWA 3RD2A 1SEBD 3SHQA 1GPXA 5DPTA 3P4RB 3RPFC 5TR5A 3ZNHB 4LNFA 2WDRB 1WE6A 3DBHI 4MGZE 1XEEA 3R7RA 2QC8A 2ZCCA 2L52A 3U2SC 1DOYA 2L8JA 1WGYA 1I4PA 1Z5SB 3W9CB 3PGEA 3I5JC 3RZWC 2JZZA 2D5GA 1WYGA 1NENB 4W9CA 3SU8X 3P42A 1FD6A 2PW9A 1WX8A 3BVGA 2WXLA 4KGRA 3KWLA 4RM8A 1NDDA 2RPQA 1WE7A 5T8IA 4EKUA 2C9WB 1NEKB 2MP2A 1QKZA 5J18A 4DK5A 3NZSA 3AM9A 1VR9A 1C3TA 2MP2B 1P1AA 4B6WA 1TJEA 2N9PC 2KKCA 3AE2B 4WJPA 4LNKA 2BB5A 4KX6B 1XCQL 2BYEA 4C56C 2KACA 4BKGA 2CJOA 3MP9A 3RNEC 4FJVB 1JRPA 3GZNB 5L83A 1BT0A 3L17A 1IPGA 3BVZA 2K3UA 1NVID 3AV8A 1QQRA 1I7HA 1RLFA 4MSQB 4YSYB 3BIID 4L1BA 2C7MB 2BGFA 3Q8CA 2M19A 1N60A 1ZXIA 1JALA 1E8WA 3I3TB 2NBWB 2NR2A 2PPHA 2EKIA 3AEFB 3SD5A 1V6EA 2PTLA 3TIXA 3MC0B 4XE0A 3V3XA 3NVYA 1WWTA 4M0WA 3IXSA 2E6XA 1E0ZA 2LGIA 3H7PA 4YSZB 5H92C 2V3NA 1N6ZA 1TKEA 2BB6A 4KSLC 2MBHA 3Q3MC 3AMZA 4M0WB 2WXPA 3NZUA 3TCAA 2C7HA 3P4PB 5JZEB 1JCKB 1WZ0A 2JUOA 2KC1A 4ZYNA 2SEBD 2KMAA 2JVCA 2MBQA 4BKSD 1WXSA 1SIFA 1TS2A 1I4RA 1MHXA 4WJNA 1TIFA 2GBNA 2KFKA 3DBRB 1NI2A 1FPYA 1LM8B 3FKYA 3AECB 1FCLA 2VZKB 1ENFA 2FIFA 1GB1A 1TZ1A 1FNVA 4DBGA 4DHJB 4QAYA 2DX5B 2N9XA 4OZCA 1YN5A 1J19A 3EC8A 3DDCB 4W9JA 4WQMA 1L0YB 4BBNF 1WXVA 4OVZA 4DHZE 2KDEB 3DPDA 3NHEB 1F52A 5CHWA 4DQOC 1T0RC 1WXMA 4TQ0A 3PO0A 3OJ3A 2J52A 2KX3A 3PZ8A 1LFDA 4XZ4A 2WDQB 1YN4A 4RGNA 5IO9A 5EE0A 4NNJB 5JHAA 2M56B 1OQQA 2KWVB 3QQ8B 2X38A 2INCC 2L83A 1TY2A 3ONSA 2FE8A 2R2QA 4ANUA 2BYFA 1KFYB 1MPEA 3A1QA 4ASWC 1SJED 2KLCA 2WXQA 3IVFA 3SFEB 4PT5A 4NJ6A 3WIMA 1XO3A 2KQ4X 2L3ZA 3Q8AA 1NBFC 4JPSA 2DNFA 2ZVOA 3MHSD 1WH3A 3N1ZC 3Q3OC 3AB5A 1TKYA 1E10A 1FRDA 1PFDA 2UYZB 2AQ2B 4IW0A 1SE4A 4FN2A 5JHBA 1XLOA 2MW5A 2MLBA 4NQKE 1KLUD 3NG0A 4MACA 3TMPB 4GGQA 3PRZA 4WQOB 1JQ4A 3L13A 3IAS1 3HIZA 1FXTB 2H88B 1IGCA 1VD2A 1QT9A 1AARA 5D6JB 4II3B 1PGXA 4EEWA 4JQWC 2INDC 1N63A 3ZDMC 5HKHA 4NZLB 2KAJA 1C9FA 2BF8B 1J7AA 2LGDA 4G3XB 4K3BA 3CMMB 4OVVA 4P1BC 3ALBA 3VUYA 4XX5A 1YX6B 3PTFC 4PS7A 2IPKD 3VH4B 2K25A 3I57A 3DWMA 2JYEA 2CR5A 2LGSA 2MJDA 1KRHA 2MX2A 3HM3A 4ICVA 4CHKA 2XEWA 1UGJA 3A9KB 2LWPA 3T3NA 2I1JA 1TKGA 1BUIC 4BBNC 3MC8A 1D3ZA 1V1OA 1KJTA 1YQBA 4OZBA 1YOVB 1I4HA 1P0RA 4JWSC 2JZPA 2ZEQA 1J0GA 4I6NB 1T0QC 4AJYB 2QCZA 2AQ1B 2CS4A 1T0SC 1T5XD 5TSSA 3B2GA 2GBJA 1JWMD 4S17A 5AUKA 1TS5A 3WCQA 4KDIC 3H8HA 3V60A 3ZRCA 3URYA 3QCAA 3A9JB 1P3QU 3VFKA 4FADA 1C4PA 1M94A 4HPLB 1GAQB 4G11A 4B95A 4BVUC 4ICUA 2L1AA 2M8SA 3N3KB 4KGSA 2RDGA 4L23A 1MJDA 3AE9B 4GDKA 3DHHC 4KIKA 1AYFA 1E7UA 3KUCB 1HQRD 2L00B 2AL6A 2CHWA 2KWCA 2D3GA 2BBCA 4GDKB 3PHXB 4KIKB 2JT4B 5EDSA 1F9JA 4W9DA 3DBLI 3SDLC 2AL3A 4AQ7A 1TT5B 3PZDA 2PE9A 3SR6A 5H8YE 1PUTA 2LVOA 3P2BA 3P4QB 1HEZE 4XC2A 1UZXB 4DXAB 1I4QA 3BINA 1SE2A 1KM7A 3H6NA 4DXFA 1FNWA 2KXJA 2ZJDA 2L7RA 5D3DA 4WWNA 3RNGC 1WSPA 1YQ4B 3AU4A 3ZUNA 3C0RB 1VZ6A 1Y8RC 1KLGD 3VXWA 1WX9A 1CMXB 2UU7A 1TS4A 4HRSA 3V62A 3PLUA 3ZNGC 4NPNA 1NI3A 2HD5B 3V6EB 2JPHA 3JSVA 2GRIA 2BWFA 2ON8A 1N61A 3VHTC 3PS6A 3HHMA 1WY8A 1YQ3B 2V4LA 2DYOA 3JSVB 1SF0A 1HZ5A 5FR3A 2D11A 4WIPA 1EU3A 2BTEA 4M8MA 1AWDA 3ML8A 2J53A 3EECA 2D3CA 1A70A 2IGDA 3T9LA 1N5WA 3MTNB 3R66C 4EOYA 3C19A 3TEZA 4USAA 4N58A 4C00A 1IBXA 1YMHE 1OFFA 3PZ7A 4NJCA 3ZQ4A 3IG3A 1RWSA 1XLPA 2N1WA 5C23A 1IBXB 2MHJA 4YTMB 3W5UB 2KK8A 4YT0B 2BW2A 1PGBA 1JROA 4RF0A 1FXIA 2ZVNA 2JY6A 4MSMB 4A6QA 3UQBA 3AE6B 1WYWB 1FRRA 2KC2A 3GZNI 4US9A 4KVGB 2KO3A 4EUTA 3ZW3A 3JW0X 4W9EA 2O2VA 4M01A 4I6LB 3L08A 2MH7A 3DVGY 2V1YA 3MJ5A 3QARA 1L5PA 1WXAA 4GB9A 4TV3A 1D5MC 2O2VB 2D3AA 1J7CA 4XDDA 4WAAA 4IOIE 4MDKE 4EZKA 4LLGM 3E9SA 4IKGA 3V05A 1K50A 2MRPA 2O6VD 1SGHA 3VTVA 4NAWB 2IGGA 1WM3A 2BYTA 3AN1A 2LUMA 3ZTDA 1EF1A 3BVMA 3Q14C 2QDFA 4BOSC 2KDIA 1L0VB 2VH2A 4A3PA 2LGYA 3QIJA 2J42A 1RYJA 4P6VF 1STEA 1P7FA 3IT4B 3X0WA 3NVZA 2YLMA 2L05A 3B08A 1UD7A 1QILA 2N9KA 3L10B 2K8BA 4KV2A 3ABVB 1E6EB 3N30A 1F0ZA 1QOFA 3DBRI 3IT6B 3MFGA 3AEAB 2WXIA 2KFJA 3APFA 3ZIMA 4YWGG 3FC4A 1OEYA 2NTTA 2WXOA 1C1YB 2W54A 5LNK1 4JWUC 4EZJA 3R2IA 4AOFA 1F2RI 1JW9D 3TUOA 4GU2A 2BPSA 1C4CA 1XLQA 3RN9C 3LDZE 1V81A 4O1NA 2JWUA 1FFUA 4DDGD 5AZHA 2LUEA 1R4MB 3Q6BA 1N62A 3TEYA 5HHDG 4RFBA 4GLSC 5CX3A 1UH6A 1YJIA 1E9MA 2PMVA 1V1PA 2W9NA 3GOEA 2KQ7A 5E6PA 1GOZA 2X8XX 4K3CA 3NUHB 4HXDA 1JWBD 4BKSA 2IZVB 2OHFA 1I35A 3ZO5B 1HTQA 2JF5A 3EFUA 2J0KA 1PQSA 2JU6X 2KDMA 2JRIB 2G1EA 1WR6E 4XYCA 4N9F4 4CQNA 3Q3FA 4F7ZA 3DHGC 2C60A 2IGHA 1TZOA 1XD3B 4C7YA 2V4IB 2TSSA 1XLNA 3MC9A 2WLBA 4YTPB 2KNBA 1WR1A 2KD0A 2CHZA 4B0MA 4MJSA 2OJRA 2YVCA 3VQIA 3H7PB 1SXTA 3AU5A 4RGOS 3QWZB 1Z2MA 4C7ZA 4MJSB 2Y3AA 4G0NB 2FUHB 2BVCA 2KOXA 4CO7A 1V5TA 2DHZA 3I63C 1UWXA 3X23A 1HA5A 2KFKB 2N7JA 3BK1A 4WURA 3VRBB 1DOIA 1ET9A 2C5LC 1WGDA 1ISNA 1V9JA 1HZ6A 3RI7C 2KVRA 1C76A 3IBEA 2NVUI 1WZ3A 2D07B 5LXHA 1H8CA 3NJTA 1SIJA 4OW0A 1L7YA 1K53A 2PIAA 1BMLC 1PGAA 2JXTA 1EM7A 5HG2A 2LASA 3HM6X 2BWES 1BXTA 1CQVA 1Q5WB 1J7BA 2M0AA 2DZKA 3VAWA 1UNSA 1VRAB 1WIAA 3HVDA 3Q3JA 2ZW0A 3Q3NC 2DAFA 2K0PA 2IO2B 3PV1A 1KF6B 3FAHA 2WNMA 1IUEA 2N7DA 3ETRA 3ENEA 5L95C 1TYGB 1FNUA 3L4PA 2MA9B 4A8XC 3Q8BA 1QZEA 2RSUA 4ARCA 5CTRC 1V5OA 5G5GA 4LNOA 4ZRIA 3A1QB 1D5XC 1YNTE 2JRHA 4NAMA 4F8CB 1WGKA 2FUG1 3PSEB 1OQRA 2KJHB 3DQVA 2FCQA 2YEPF 3RYTA 4W9LA 4YXDB 4I6PA 1GC6A 1WRDB 1L6UA 4S0RA 4M00A 2JZ3B 4IG7B 4N6EB 2MEKA 3AE7B 2DZMA 2AYOB 2LRUA 2J7QB 2I2YA 3AI5A 4IWQA 1U4AA 2WU2B 2ASQA 3AH7A 1UF0A 4FHJA 4GOCA 2K1FA 2I1KA 2KJRA 2AWTA 4A90A 1L2NA 3TBLD 2LJIA 2A5UA 4KDLB 1V8CA 4FJZA 1T0YA 1GG3A 2R2OA 3A4RA 4K81A 1HTOA 1ZP0B 2INNE 3QJZA 2WU5B 4EFOA 1ZOYB 3A33B 4K7SA 3DOWA 3KWVA 1AW7A 4MGKE 2XNAC 3L16A 4PS3A 2M17A 4XDCA 1KTKA 2IYDB 2XN9C 2CU3A 1ZKHA 1ZXHA 3PREA 3ZDTA 1VJKA 3UINB 4CYEA 1T6BX 1I4GA 3BK2A 2AQ3B 4XWTA 1E90A 3AE4B 1IGDA 1V49A 2KTFA 1DYQA 2HE7A 3Q69A 2EMTA 4RNAA 1DOXA 1RFKA 2KHWB 2HTME 4GN1A 1C77A 4G50A 4ANVA 3AE1B 5GXGB 3DVGX 2J4XA 4LCDE 2ZZPB 1CK1A 1P9DU 2I38A 4HDOA 5KHQA 4HLEA 2G45B 4ANWA 4HEA1 2DLBA 1UELA 2DENB 4ZRPA 1VZ7A 4FULA 1FFVA 1ET6A 3GS2A 2KX0A 2A4ZA 4W9HA 4IDIA 3KUZA 1L4DB 1ZW7A 4P7IA 1TS3A 3D32A 2WP9B 1SB3C 4W9IA 4IM3A 1JWUD 1OGWA 3RNBC 4DWFA 2MJ3A 1GJZA 1UGMA 2DZJA 2DBYA 4IM2A 5DPWA 2WXJA 2QEJC 4DXGA 5CHVC 3HK0A 1FEHA 4XGAB 4DDID 3ZNID 1C4AA 2QILA 2AX5A 2MSED 4LJOB 3VRAB 2WXHA 2HTHA 2NTSA 1LXDA 2BT6A 2DAJA 3KLSX 3LYYA 1MHHE 4BZAA 4RCOA 1M4VA 2KN4A 2MQJA 3WAPA 1ZDVA 4MH8A 3AEDB 2LHDA 1EO6A 3P4SB 2IO1B 1UWMA 2LVPA 2LXCA 1Q1OA 2L76A 1UBIA 3ZRFA 2PLPA 2NPTA 2KVZA 3L0WB 3K9PB 4K7WA 4WWMA 4NJ7A 2KYWA 1WRIA 2NPTB 3I9V1 3JVZX 5BMIA 3VTWA 1P98A 3ZKJC 2LEKA 3T3OA 3OWEB 3EUB2 2WGSA 3N20C 5FK9C 1OTRB 2LVQA 3VH3B 4C4VA 4H2AA 2V9HA 3U7ZA 1RAXA 5E6OA 2HJ8A 2HJ1A 2W82A 1KH0A 5CHFA 3E56A 4GXBA 2FNJB 4C4VB 2MJEA 3R8BA 4MH0E 2LFIA 2IBIB 2WXRA 2WYQA 1SE3A 2CHXA 3BY4B 1G6JA 1J8CA 2W55A 3AULA 2LMCA 5LLIA 2KQSA 2Z8LA 3PVLA 1Q0WB 2KTRA 1WM2A 4HCPB 2LJ5A 1T3QA 2WDVB 2MWSB 3GE8C 1A5RA 3C8YA 1C78A 2KTRB 4WWOA 4ZRQA 2N9EB 1WFYA 1K8RB 5J2RA 1MG8A 1ZGUB 4HCNB 3DWGC 2WS3B 2IO3B 3UI3A 1Q10A 5JH5C 2DZIA 2O6VA 1DGJA 3IFWB 4RGMA 3GB1A 1RFAA 5D3IB 4C80A 2RD0A 2GOWA 3UIOB 1R4MI 4WJQA 1E8YA 2O6VB 2QJLA 3VUXA 5EE1A 4MGIE 1ACCA 2E3TA 4HPMB 5G5HA 4MELA 3M95A 2R61A 5BMGA 2LZ6A 2XBBC 2RMMA 4LTUA 1WGGA 1L6VA 3TJPA 3KYCD 3RZFA 5JXVA 3KYDD 1FO4A 2KWDA 1SE9A 5IA7A 2VH1A 2DYMA 3DHIC 1E7VA 2V3SA 2CKHB 3QC8B 2XK5A 3FILA 1QLBB 5D7GA 2WXMA 3ML9A 5C2TB 5AEKB 4GMVA 2XK5B 2JYTA 5EE9A 3FILB 2EKEC 2QSDA 5BYQA 2QMTA 2GBMA 4MEMA 2BQQA 2Z0EB 2KDFB 4EZLA 3WA0A 4GIVA 3WANA 2WXFA 2H89B 3O13A 3QX1A 3VTUA 4WH4A 1MFWA 4MGYE 1EUVB 3NY5A 1WI0A 3U8ZA 4EE2A 3H9DA 4JL9A 5LXIB 1FIQA 3HUIA 4B0EA 2JWZA 4MT5A 3UIPB 1AN8A 3ECIA 2RPVA 2L0FA 2N4FA 3V61A 2ZPYA 3Q2AC 1FM0D 1WF9A 3OLMD 1MG4A 1RRBA 3ZGZA 3KUDB 4WJOA 4FLHA 3P63A 2D2QA 5AUIA 2LGXA 4L2YA 4LDTB 1R4NB 2BS3B 2LI5A 3PLVA 1WGRA 3CF6E 4IM0A 4W9KA 2LHEA 3CWIA 2MBEA 3N32A 1QOAA 3EA6A 1FXAA 1L0XB 1YIWA 2K8CA 3M63B 2HDEA 3S2AA 4AWJA 3VDZA 2QIEB 3EFCA 4ZDVA 2IO0B 1V1PB 1F1HA 4LDTD 5DPSA 3RNAC 1VDVA 2ZW1A 3TEXA 5BO4B 1JWAD 2NS5A 4KGTA 3ZVVA 2JX5A 1JMLA 3DBSA 3GP7A 4PYUA 2BKRB 4HKQA 2V3PA 3ZJVA 1SJHD 3RUIB 3K9OB 3WALA 1NYQA 2DWQA 5I4DA 2BS4B 1CJEA 3APCA 2NMQA 2ACZB 2FBWB 3VUWA 4ZHPA 2KDBA 2DYBA 5IP4D 1F77A 4BOZB 4P1CC 3DBHB 1TTNA 2M0XA 5FR6A 2IY1B 4AJWA 1TY0A 1XF5L 1R7SA 2N1VA 3KW5B 3MJWA 3AE5B 4LJPB 3UQAA 2CU1A 4TKNA 3LB8C 3ZXVA 5G55A 4US8A 4HPPA 4FXCA 2FIDA 4YL8A 2K8HA 3DVNU 2PKOA 4E74A 1X1MA 4A9AA 1LO5D 3Q8EA 2GB1A 3BZDB 4OVUA 2VRRB 2JSVX 1YJJA 4E3CA 3DCGA 2CJNA 1QOGA 1NYRA 1WJUA 4J3OD 3Q8FA 1E8XA 3R2TA 4GDLA 2K22A 4BFRA 1EU4A 4M02A 3H7SA 4N59A 5DPRA 2ZCBA 3P1MA 4FJYA 4GSWA 4PYZA 4FBJB 3CIRB 4GDLB 1ROEA 1HXYD 3ZNZB 4LK0M 3KH0A 4BAXA 3GE3C 3VVWB 2J0MA 3U7DA 4D2KA 3WAMA 4RMAA 1I42A 3NVWA 3VR9B 2FCMA 2VZKD 4ZOHC 3N1YC 4Q2JA 2LRWA 5EE3A 4DHJD 3LJ3A 2K6DB 2WQYB 3QA8A 2REXA 3R3MA 3RCZA 1E7PB 2EMSA 2WXGA 2WX0A 2BKFA 4RH6A 1F2RC 3N9YC 1OQYA 5BMHA 4AP4C 4WAFA 2D3BA 2Y5PA 2GMIC 1V2YA 5HI1A 1WJ4A 4F1SA 5BYSA 2L0TA 2PEAA 3PHWB 2WDTB 3OAWA 1PYWD 2C7NB 2G4DB 4TUUA 5IAAC 3CSTA 4HROA 2G9HD 3TL5A 5C1ZA 2FCSA 3NS1A 3PPAA 2KZRA 3MHZA 2KMMA 2INPE 4HJGE 5D2MB 1YD8U 3NVVA 4KSKC 4W9FA 3U4EG 1JWSD 4PS8A 1UUPA 1XXGA 2LD9A 2NBUA 2N7EA 5AZFA 3NOBA 4FHKA 2KJ6A 4P16A 4ACFA 3UF8A 4URKA 3ZTCA 3RULA 2K39A 4K7UA 4ARIA 2L32A 2FAZA 3RMKC 1ZUD2 1S3SG 1MVKA 4FA6A 4RM9A 1YN3A 2D10A 3RNCC 2Z0DB 3APDA 3RFZB 1GB4A 1B1ZA 3W5VB 2ZNVB 1I4XA 1VCBA 4JIOU 3EGRA 4LNIA 3B2FA 1YJ1A 3ZJUA 4A55A 1K51A 1D5ZC 2IJ0A 1C79A 3R7QA 1FMAD 2PE6B 1HE8A 4A3OA 1MI0A 4KZ0A 3TEWA 3A9KA 1EWYC 3VR8B 3W2DA 1FCCC 3A4SC 2M1MA 2RDBC 2KANA 1SSNA 3EHVA 2KMCA 3CSFA 2NCNA 4AUQC 2ZNVC 3LXFA 1CZPA 3U30A 1XT9B 1EWCA 2QHOA 2WXNA 5IKCM 2OOBB 1ZPSA 2EELA 1IP9A 4HK2A 2GBRA 5G2NA 5D94A 5GMVA 2GBKA 2MBOA 1JRUA 2Y5CA 2W3SA 3OG5A 1IYFA 5MPOA 1LGRA 3QHTA 5C3JB 1E5WA 1ESFA 1WJNA 4WWPA 1N5XA 5IN7A 4KKJA 2B3AA 1P7EA 4TMAB 2G3QB 2YEPB 2K9XA 3RT3B 3A9JA 1V97A 1E8ZA 1B9RA 4BKTA 1WGHA 1PDXA 1RM6C 4YTNB 2RGFA 3IHPC 3T8MA 1KLVA 4XWWA 3AEGB 4OHJA 4YSXB 5KHOA 3OJ4B 5AZGA 1D6EC 3J9CA 1KOTA 4HDQA 3M3JA 1QOBA 4ZHOA 3PT2B 2ZPNA 3U52E 4HJKA 2Y5BB 3QAQA 4RF1A 1K52A 2W3RA 3AXCA
chains in the Genus database with same CATH topology
4RGMA 2OEDA 3GB1A 3AE3B 3AB5A 1TKYA 3NUHB 1JWBD 5D3IB 1WXQA 4C80A 1E10A 5HFYA 2OHFA 3KQ4A 1ZDXA 1FRDA 1PFDA 4HKZE 2ICIA 2QJLA 2JU6X 2KDMA 5EE1A 2AQ2B 1SE4A 1ACCA 3HRDD 1XLOA 2G1EA 2E3TA 4MM3B 5G5HA 4CQNA 2IGHA 1KLUD 4R3DA 1TZOA 2R61A 4MACA 5BMGA 4C7YA 2V4IB 2K5PA 2TSSA 2RMMA 4LTUA 1Y56A 1JQ4A 1L6VA 1XLNA 3IAS1 2WLBA 5JXVA 4REZA 4YTPB 4B0MA 2H88B 1IGCA 4KKIA 1QT9A 2GI9A 2ONQA 1FO4A 2KWDA 3VQIA 1PGXA 1SXTA 2DYMA 1N63A 4RGOS 3FILA 1QLBB 4NZLB 4C7ZA 2KAJA 4ITKA 1C9FA 5D7GA 2N0SB 1J7AA 2WXMA 2Y3AA 3NZ3A 4ZYSA 5C2TB 1L4ZB 2JYTA 5EE9A 3FILB 2IPKD 2QSDA 5BYQA 3I57A 2QMTA 2SAKA 3DWMA 4OZAA 2JYEA 1XCTL 1UWXA 2PVGC 1HA5A 3ZYYX 2MJDA 2N7JA 5E6JA 1KRHA 2WXFA 3BK1A 4WURA 2H89B 3O13A 4WH4A 1UGJA 3VRBB 3IAM1 1DOIA 3T3NA 1ET9A 3AEBB 4EE2A 1HZ6A 1TKGA 1BUIC 1C76A 3BYTB 1V1OA 1ZE3D 4UDUC 4JE3B 4TQ1A 1FIQA 2V0GA 3HUIA 4OZBA 4B0EA 1I4HA 4MT5A 4JWSC 1SIJA 2JZPA 4OW0A 2N9LA 1AN8A 1K53A 1BMLC 1PGAA 2JXTA 1EM7A 2PIAA 2RPVA 3AE8B 3AEEB 5HG2A 1BXTA 1CQVA 1FM0D 2AQ1B 2PVOD 3BWUD 1J7BA 3ZGZA 1T5XD 2M0AA 5TSSA 3B2GA 1SBBB 1UNSA 1VRAB 1JWMD 3HVDA 3P63A 5AUKA 2ZW0A 3ZJTA 5AUIA 1TS5A 3W1SA 4L2YA 3WCQA 2K0PA 2IDYA 5BYRA 3SFDB 3H8HA 1KF6B 3FAHA 2BS3B 2WNMA 3URYA 1IUEA 3ETRA 2RDHA 1TYGB 1C4PA 2LHEA 3CWIA 1GAQB 1FNUA 3BYYB 1QOAA 3EA6A 3L4PA 4A8XC 1FXAA 3Q8BA 1L0XB 4ARCA 4RGTA 2Q5WD 2HDEA 2L1AA 1VZ8A 5G5GA 2B76B 2QIEB 1QF6A 3NRZA 1D5XC 1YNTE 4NAMA 4TSSA 4KGSA 1WGKA 1V1PB 2BS2B 1D4BA 2FUG1 2RDGA 3AE9B 3B9JA 4L23A 3SEBA 1OQRA 3HVZA 1AYFA 1VDVA 2ZW1A 3TEXA 2YEPF 5FKAC 4YXDB 1HQRD 1JWAD 1L6UA 2WXKA 4KGTA 2JX5A 1JMLA 2BBCA 3GP7A 4HKQA 4JX1C 2V3PA 3ZJVA 4GDKB 1SJHD 4N6EB 2MEKA 3TSSA 3AE7B 1NYQA 2DWQA 5I4DA 1VLBA 1CJEA 2BS4B 2NMQA 2ACZB 2FBWB 2I2YA 4ZHPA 4AQ7A 2WU2B 4AS1A 3AH7A 1F77A 3SR6A 5H8YE 1PUTA 2JQRB 3P4QB 1HEZE 1TY0A 1XF5L 1R7SA 1I4QA 3AE5B 4A90A 1SE2A 2LJIA 3LB8C 4DXFA 1FNWA 1V8CA 4US8A 1SEBD 4FXCA 1GPXA 3P4RB 5D3DA 1ZP0B 2INNE 1WSPA 1YQ4B 2PKOA 2WU5B 3RPFC 1ZOYB 3KWVA 1AW7A 2XNAC 2WDRB 4A9AA 4XDCA 1VZ6A 1LO5D 3Q8EA 1KTKA 1XEEA 2GB1A 1KLGD 2L52A 3BZDB 3U2SC 2XN9C 1DOYA 2CU3A 1TS4A 1I4PA 4HRSA 3W9CB 2JSVX 1YJJA 1ZXHA 2CJNA 1VJKA 1QOGA 1NYRA 4J3OD 1NI3A 3Q8FA 3R2TA 1T6BX 2D5GA 1I4GA 1WYGA 1NENB 2K22A 3BK2A 2AQ3B 1EU4A 4N59A 3P42A 3P1MA 1FD6A 2PW9A 4XWTA 3AE4B 3BVGA 2WXLA 4KGRA 2GRIA 3KWLA 2ON8A 1N61A 3CIRB 1IGDA 4GDLB 1ROEA 1DYQA 1HXYD 3Q69A 5T8IA 4LK0M 1YQ3B 4RNAA 1RFKA 1DOXA 2HTME 1NEKB 1C77A 3AE1B 5GXGB 1QKZA 4D2KA 2DYOA 1SF0A 2J4XA 1HZ5A 3NVWA 1CK1A 5FR3A 2I38A 3VR9B 3AM9A 1EU3A 4WIPA 1VR9A 2VZKD 2BTEA 1AWDA 4ZOHC 4HEA1 2DLBA 2J53A 4Q2JA 1TJEA 5EE3A 4ZRPA 1VZ7A 1FFVA 3AE2B 1ET6A 2WQYB 3GS2A 2BB5A 4IDIA 1E7PB 4KX6B 1A70A 2IGDA 1XCQL 1N5WA 2WXGA 4C56C 2KACA 1L4DB 4RH6A 3TEZA 1F2RC 1TS3A 3N9YC 4USAA 2WP9B 5BMHA 2CJOA 3MP9A 4N58A 1SB3C 1IBXA 1JRPA 4WAFA 1JWUD 2Y5PA 3BVZA 2MJ3A 1YMHE 1OFFA 3PZ7A 4NJCA 5HI1A 2K3UA 1NVID 3ZQ4A 3AV8A 1QQRA 1RWSA 1I7HA 2DBYA 1XLPA 5BYSA 4YSYB 2WXJA 3BIID 4L1BA 2QEJC 4DXGA 1IBXB 4YTMB 1FEHA 1PYWD 3W5UB 3Q8CA 1C4AA 2M19A 2QILA 4HROA 4YT0B 2AX5A 2BW2A 2G9HD 1N60A 1PGBA 1ZXIA 1JROA 3NS1A 4RF0A 1JALA 1FXIA 4A6QA 3VRAB 3MHZA 2KMMA 2EKIA 2WXHA 3AEFB 3AE6B 1FRRA 2INPE 2NTSA 4HJGE 2BT6A 3NVVA 4US9A 3U4EG 1JWSD 3KLSX 3LYYA 1UUPA 1XXGA 2PTLA 1MHHE 4P16A 4RCOA 1M4VA 2KN4A 3MC0B 4XE0A 1ZDVA 2MH7A 4MH8A 3AEDB 3V3XA 2LHDA 3NVYA 1WWTA 4M0WA 3MJ5A 3IXSA 3P4SB 4ARIA 2L32A 1UWMA 1L5PA 2E6XA 1E0ZA 2LGIA 1ZUD2 4YSZB 1MVKA 5H92C 2V3NA 1D5MC 1TKEA 1YN3A 2BB6A 1J7CA 2PLPA 4XDDA 3AMZA 3RFZB 2WXPA 1GB4A 1B1ZA 4IOIE 3W5VB 4LLGM 1I4XA 3E9SA 4IKGA 3V05A 3EGRA 3P4PB 1K50A 1JCKB 4WWMA 3B2FA 2SEBD 3ZJUA 4A55A 1K51A 4NAWB 1D5ZC 2IGGA 2IJ0A 2BYTA 3AN1A 1WRIA 1C79A 2LUMA 1FMAD 1TS2A 1I4RA 1MHXA 3BVMA 3I9V1 5BMIA 1MI0A 1L0VB 3TEWA 1EWYC 3AECB 3VR8B 1FCLA 2LEKA 3W2DA 2VZKB 1FCCC 1ENFA 3T3OA 3OWEB 3EUB2 2J42A 1GB1A 1RYJA 4P6VF 1STEA 1SSNA 1P7FA 1FNVA 5FK9C 3IT4B 3LXFA 1CZPA 4OZCA 1YN5A 3NVZA 4H2AA 1EWCA 2WXNA 3U7ZA 4WQMA 2W82A 1L0YB 1ZPSA 2EELA 1QILA 2N9KA 1KH0A 3ABVB 1E6EB 3E56A 4OVZA 1F0ZA 1QOFA 3IT6B 2MJEA 3MFGA 3R8BA 2Y5CA 2W3SA 3AEAB 2WXIA 2LFIA 2WXRA 1SE3A 5MPOA 4DQOC 1ESFA 5C3JB 4TQ0A 3PO0A 1N5XA 4YWGG 3FC4A 2J52A 2W55A 2NTTA 4KKJA 2WXOA 3PZ8A 2LMCA 1P7EA 4TMAB 2Z8LA 2W54A 5LNK1 2YEPB 2K9XA 4JWUC 2WDQB 1YN4A 3R2IA 4RGNA 1F2RI 1V97A 1JW9D 5EE0A 3TUOA 1B9RA 1C4CA 1XLQA 1PDXA 2M56B 1T3QA 4O1NA 1OQQA 1RM6C 4YTNB 2WDVB 2JWUA 1FFUA 2X38A 2L83A 1TY2A 3C8YA 1N62A 3TEYA 4XWWA 1C78A 3AEGB 2FE8A 4OHJA 5HHDG 4YSXB 4RFBA 4ZRQA 1KFYB 4GLSC 1MPEA 1SJED 2WXQA 3SFEB 1D6EC 3J9CA 4PT5A 1QOBA 1YJIA 4ZHOA 3DWGC 1E9MA 2WS3B 3UI3A 2PMVA 1Q10A 1V1PA 3U52E 1XO3A 2KQ4X 1GOZA 3Q8AA 4RF1A 1K52A 4JPSA 2W3RA 1DGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 M;  4LLG M;  2WNM A;  2LMC A; 
#chains in the Genus database with same CATH topology
 2OED A;  4IC7 B;  2OJW A;  2FCN A;  3AE3 B;  3PRM B;  4MM3 A;  1WXQ A;  3RNF C;  5HFY A;  3KQ4 A;  1ZDX A;  1V80 A;  4HKZ E;  2ICI A;  4IWP A;  3KVF B;  3HRD D;  4MM3 B;  4A20 A;  3ZXR A;  4R3D A;  3PRP B;  4NQL B;  2K5P A;  3N1X C;  2JXX A;  2KLG A;  1Y56 A;  4W9G A;  4REZ A;  3WAO A;  1LQB A;  2NBV B;  2KWU B;  4KKI A;  2GI9 A;  2ONQ A;  3UGB B;  3B1L X;  1H4R A;  4DHZ B;  2G4S A;  1GC7 A;  2WX1 A;  4ITK A;  5IOI A;  2N0S B;  4NY0 A;  4JGH B;  3NZ3 A;  4ZYS A;  2MBB B;  3QK0 A;  1L4Z B;  4ZRJ A;  4ZRK A;  2M4N A;  5DCN A;  4OZA A;  1WMH A;  1GUA B;  2SAK A;  1GNU A;  4B9K A;  1XCT L;  2PVG C;  2LXA A;  4KZC A;  2IY0 B;  3M62 B;  3ZYY X;  5E6J A;  1XQQ A;  3IAM 1;  2Z59 B;  1WMH B;  2KT7 A;  3AEB B;  1TBE A;  1V86 A;  2AEH A;  3BYT B;  1ZE3 D;  4UDU C;  2GLS A;  4JE3 B;  4JLC A;  4TQ1 A;  2V0G A;  2BYV E;  2N9L A;  3AEE B;  3AE8 B;  4E71 A;  3W1Y A;  4IWO A;  2PVO D;  3BWU D;  2K6Q A;  2RR9 A;  5J17 A;  4HWI B;  1SBB B;  1WX7 A;  3ZJT A;  3W1S A;  2IDY A;  3NS8 A;  4II2 B;  5BYR A;  3SFD B;  2KN5 A;  4J6I A;  2PJH A;  2RDH A;  2J0J A;  3BYY B;  4X57 B;  4RGT A;  2Q5W D;  2WHI A;  1OEY J;  3ZLZ A;  1VZ8 A;  1YX5 B;  4HVB A;  3JYU A;  2B76 B;  1QF6 A;  3NRZ A;  3L54 A;  3DBL B;  4TSS A;  4PK1 A;  2BS2 B;  1D4B A;  1R4N I;  3B9J A;  3SEB A;  3HVZ A;  5E6N A;  1WJ6 A;  1UBQ A;  5FKA C;  3W1S C;  2WXK A;  4ANX A;  4LNN A;  4JX1 C;  3B0A A;  3H1U A;  1TGZ B;  2MCN B;  3TSS A;  1VLB A;  3O65 B;  1S1Q B;  1EF5 A;  4AS1 A;  2UWQ A;  4K1R B;  3V6C B;  4M8N A;  2JQR B;  2WWZ A;  3DVN V;  4IUM B;  4NAW A;  3RD2 A;  1SEB D;  3SHQ A;  1GPX A;  5DPT A;  3P4R B;  3RPF C;  5TR5 A;  3ZNH B;  4LNF A;  2WDR B;  1WE6 A;  3DBH I;  4MGZ E;  1XEE A;  3R7R A;  2QC8 A;  2ZCC A;  2L52 A;  3U2S C;  1DOY A;  2L8J A;  1WGY A;  1I4P A;  1Z5S B;  3W9C B;  3PGE A;  3I5J C;  3RZW C;  2JZZ A;  2D5G A;  1WYG A;  1NEN B;  4W9C A;  3SU8 X;  3P42 A;  1FD6 A;  2PW9 A;  1WX8 A;  3BVG A;  2WXL A;  4KGR A;  3KWL A;  4RM8 A;  1NDD A;  2RPQ A;  1WE7 A;  5T8I A;  4EKU A;  2C9W B;  1NEK B;  2MP2 A;  1QKZ A;  5J18 A;  4DK5 A;  3NZS A;  3AM9 A;  1VR9 A;  1C3T A;  2MP2 B;  1P1A A;  4B6W A;  1TJE A;  2N9P C;  2KKC A;  3AE2 B;  4WJP A;  4LNK A;  2BB5 A;  4KX6 B;  1XCQ L;  2BYE A;  4C56 C;  2KAC A;  4BKG A;  2CJO A;  3MP9 A;  3RNE C;  4FJV B;  1JRP A;  3GZN B;  5L83 A;  1BT0 A;  3L17 A;  1IPG A;  3BVZ A;  2K3U A;  1NVI D;  3AV8 A;  1QQR A;  1I7H A;  1RLF A;  4MSQ B;  4YSY B;  3BII D;  4L1B A;  2C7M B;  2BGF A;  3Q8C A;  2M19 A;  1N60 A;  1ZXI A;  1JAL A;  1E8W A;  3I3T B;  2NBW B;  2NR2 A;  2PPH A;  2EKI A;  3AEF B;  3SD5 A;  1V6E A;  2PTL A;  3TIX A;  3MC0 B;  4XE0 A;  3V3X A;  3NVY A;  1WWT A;  4M0W A;  3IXS A;  2E6X A;  1E0Z A;  2LGI A;  3H7P A;  4YSZ B;  5H92 C;  2V3N A;  1N6Z A;  1TKE A;  2BB6 A;  4KSL C;  2MBH A;  3Q3M C;  3AMZ A;  4M0W B;  2WXP A;  3NZU A;  3TCA A;  2C7H A;  3P4P B;  5JZE B;  1JCK B;  1WZ0 A;  2JUO A;  2KC1 A;  4ZYN A;  2SEB D;  2KMA A;  2JVC A;  2MBQ A;  4BKS D;  1WXS A;  1SIF A;  1TS2 A;  1I4R A;  1MHX A;  4WJN A;  1TIF A;  2GBN A;  2KFK A;  3DBR B;  1NI2 A;  1FPY A;  1LM8 B;  3FKY A;  3AEC B;  1FCL A;  2VZK B;  1ENF A;  2FIF A;  1GB1 A;  1TZ1 A;  1FNV A;  4DBG A;  4DHJ B;  4QAY A;  2DX5 B;  2N9X A;  4OZC A;  1YN5 A;  1J19 A;  3EC8 A;  3DDC B;  4W9J A;  4WQM A;  1L0Y B;  4BBN F;  1WXV A;  4OVZ A;  4DHZ E;  2KDE B;  3DPD A;  3NHE B;  1F52 A;  5CHW A;  4DQO C;  1T0R C;  1WXM A;  4TQ0 A;  3PO0 A;  3OJ3 A;  2J52 A;  2KX3 A;  3PZ8 A;  1LFD A;  4XZ4 A;  2WDQ B;  1YN4 A;  4RGN A;  5IO9 A;  5EE0 A;  4NNJ B;  5JHA A;  2M56 B;  1OQQ A;  2KWV B;  3QQ8 B;  2X38 A;  2INC C;  2L83 A;  1TY2 A;  3ONS A;  2FE8 A;  2R2Q A;  4ANU A;  2BYF A;  1KFY B;  1MPE A;  3A1Q A;  4ASW C;  1SJE D;  2KLC A;  2WXQ A;  3IVF A;  3SFE B;  4PT5 A;  4NJ6 A;  3WIM A;  1XO3 A;  2KQ4 X;  2L3Z A;  3Q8A A;  1NBF C;  4JPS A;  2DNF A;  2ZVO A;  3MHS D;  1WH3 A;  3N1Z C;  3Q3O C;  3AB5 A;  1TKY A;  1E10 A;  1FRD A;  1PFD A;  2UYZ B;  2AQ2 B;  4IW0 A;  1SE4 A;  4FN2 A;  5JHB A;  1XLO A;  2MW5 A;  2MLB A;  4NQK E;  1KLU D;  3NG0 A;  4MAC A;  3TMP B;  4GGQ A;  3PRZ A;  4WQO B;  1JQ4 A;  3L13 A;  3IAS 1;  3HIZ A;  1FXT B;  2H88 B;  1IGC A;  1VD2 A;  1QT9 A;  1AAR A;  5D6J B;  4II3 B;  1PGX A;  4EEW A;  4JQW C;  2IND C;  1N63 A;  3ZDM C;  5HKH A;  4NZL B;  2KAJ A;  1C9F A;  2BF8 B;  1J7A A;  2LGD A;  4G3X B;  4K3B A;  3CMM B;  4OVV A;  4P1B C;  3ALB A;  3VUY A;  4XX5 A;  1YX6 B;  3PTF C;  4PS7 A;  2IPK D;  3VH4 B;  2K25 A;  3I57 A;  3DWM A;  2JYE A;  2CR5 A;  2LGS A;  2MJD A;  1KRH A;  2MX2 A;  3HM3 A;  4ICV A;  4CHK A;  2XEW A;  1UGJ A;  3A9K B;  2LWP A;  3T3N A;  2I1J A;  1TKG A;  1BUI C;  4BBN C;  3MC8 A;  1D3Z A;  1V1O A;  1KJT A;  1YQB A;  4OZB A;  1YOV B;  1I4H A;  1P0R A;  4JWS C;  2JZP A;  2ZEQ A;  1J0G A;  4I6N B;  1T0Q C;  4AJY B;  2QCZ A;  2AQ1 B;  2CS4 A;  1T0S C;  1T5X D;  5TSS A;  3B2G A;  2GBJ A;  1JWM D;  4S17 A;  5AUK A;  1TS5 A;  3WCQ A;  4KDI C;  3H8H A;  3V60 A;  3ZRC A;  3URY A;  3QCA A;  3A9J B;  1P3Q U;  3VFK A;  4FAD A;  1C4P A;  1M94 A;  4HPL B;  1GAQ B;  4G11 A;  4B95 A;  4BVU C;  4ICU A;  2L1A A;  2M8S A;  3N3K B;  4KGS A;  2RDG A;  4L23 A;  1MJD A;  3AE9 B;  4GDK A;  3DHH C;  4KIK A;  1AYF A;  1E7U A;  3KUC B;  1HQR D;  2L00 B;  2AL6 A;  2CHW A;  2KWC A;  2D3G A;  2BBC A;  4GDK B;  3PHX B;  4KIK B;  2JT4 B;  5EDS A;  1F9J A;  4W9D A;  3DBL I;  3SDL C;  2AL3 A;  4AQ7 A;  1TT5 B;  3PZD A;  2PE9 A;  3SR6 A;  5H8Y E;  1PUT A;  2LVO A;  3P2B A;  3P4Q B;  1HEZ E;  4XC2 A;  1UZX B;  4DXA B;  1I4Q A;  3BIN A;  1SE2 A;  1KM7 A;  3H6N A;  4DXF A;  1FNW A;  2KXJ A;  2ZJD A;  2L7R A;  5D3D A;  4WWN A;  3RNG C;  1WSP A;  1YQ4 B;  3AU4 A;  3ZUN A;  3C0R B;  1VZ6 A;  1Y8R C;  1KLG D;  3VXW A;  1WX9 A;  1CMX B;  2UU7 A;  1TS4 A;  4HRS A;  3V62 A;  3PLU A;  3ZNG C;  4NPN A;  1NI3 A;  2HD5 B;  3V6E B;  2JPH A;  3JSV A;  2GRI A;  2BWF A;  2ON8 A;  1N61 A;  3VHT C;  3PS6 A;  3HHM A;  1WY8 A;  1YQ3 B;  2V4L A;  2DYO A;  3JSV B;  1SF0 A;  1HZ5 A;  5FR3 A;  2D11 A;  4WIP A;  1EU3 A;  2BTE A;  4M8M A;  1AWD A;  3ML8 A;  2J53 A;  3EEC A;  2D3C A;  1A70 A;  2IGD A;  3T9L A;  1N5W A;  3MTN B;  3R66 C;  4EOY A;  3C19 A;  3TEZ A;  4USA A;  4N58 A;  4C00 A;  1IBX A;  1YMH E;  1OFF A;  3PZ7 A;  4NJC A;  3ZQ4 A;  3IG3 A;  1RWS A;  1XLP A;  2N1W A;  5C23 A;  1IBX B;  2MHJ A;  4YTM B;  3W5U B;  2KK8 A;  4YT0 B;  2BW2 A;  1PGB A;  1JRO A;  4RF0 A;  1FXI A;  2ZVN A;  2JY6 A;  4MSM B;  4A6Q A;  3UQB A;  3AE6 B;  1WYW B;  1FRR A;  2KC2 A;  3GZN I;  4US9 A;  4KVG B;  2KO3 A;  4EUT A;  3ZW3 A;  3JW0 X;  4W9E A;  2O2V A;  4M01 A;  4I6L B;  3L08 A;  2MH7 A;  3DVG Y;  2V1Y A;  3MJ5 A;  3QAR A;  1L5P A;  1WXA A;  4GB9 A;  4TV3 A;  1D5M C;  2O2V B;  2D3A A;  1J7C A;  4XDD A;  4WAA A;  4IOI E;  4MDK E;  4EZK A;  4LLG M;  3E9S A;  4IKG A;  3V05 A;  1K50 A;  2MRP A;  2O6V D;  1SGH A;  3VTV A;  4NAW B;  2IGG A;  1WM3 A;  2BYT A;  3AN1 A;  2LUM A;  3ZTD A;  1EF1 A;  3BVM A;  3Q14 C;  2QDF A;  4BOS C;  2KDI A;  1L0V B;  2VH2 A;  4A3P A;  2LGY A;  3QIJ A;  2J42 A;  1RYJ A;  4P6V F;  1STE A;  1P7F A;  3IT4 B;  3X0W A;  3NVZ A;  2YLM A;  2L05 A;  3B08 A;  1UD7 A;  1QIL A;  2N9K A;  3L10 B;  2K8B A;  4KV2 A;  3ABV B;  1E6E B;  3N30 A;  1F0Z A;  1QOF A;  3DBR I;  3IT6 B;  3MFG A;  3AEA B;  2WXI A;  2KFJ A;  3APF A;  3ZIM A;  4YWG G;  3FC4 A;  1OEY A;  2NTT A;  2WXO A;  1C1Y B;  2W54 A;  5LNK 1;  4JWU C;  4EZJ A;  3R2I A;  4AOF A;  1F2R I;  1JW9 D;  3TUO A;  4GU2 A;  2BPS A;  1C4C A;  1XLQ A;  3RN9 C;  3LDZ E;  1V81 A;  4O1N A;  2JWU A;  1FFU A;  4DDG D;  5AZH A;  2LUE A;  1R4M B;  3Q6B A;  1N62 A;  3TEY A;  5HHD G;  4RFB A;  4GLS C;  5CX3 A;  1UH6 A;  1YJI A;  1E9M A;  2PMV A;  1V1P A;  2W9N A;  3GOE A;  2KQ7 A;  5E6P A;  1GOZ A;  2X8X X;  4K3C A;  3NUH B;  4HXD A;  1JWB D;  4BKS A;  2IZV B;  2OHF A;  1I35 A;  3ZO5 B;  1HTQ A;  2JF5 A;  3EFU A;  2J0K A;  1PQS A;  2JU6 X;  2KDM A;  2JRI B;  2G1E A;  1WR6 E;  4XYC A;  4N9F 4;  4CQN A;  3Q3F A;  4F7Z A;  3DHG C;  2C60 A;  2IGH A;  1TZO A;  1XD3 B;  4C7Y A;  2V4I B;  2TSS A;  1XLN A;  3MC9 A;  2WLB A;  4YTP B;  2KNB A;  1WR1 A;  2KD0 A;  2CHZ A;  4B0M A;  4MJS A;  2OJR A;  2YVC A;  3VQI A;  3H7P B;  1SXT A;  3AU5 A;  4RGO S;  3QWZ B;  1Z2M A;  4C7Z A;  4MJS B;  2Y3A A;  4G0N B;  2FUH B;  2BVC A;  2KOX A;  4CO7 A;  1V5T A;  2DHZ A;  3I63 C;  1UWX A;  3X23 A;  1HA5 A;  2KFK B;  2N7J A;  3BK1 A;  4WUR A;  3VRB B;  1DOI A;  1ET9 A;  2C5L C;  1WGD A;  1ISN A;  1V9J A;  1HZ6 A;  3RI7 C;  2KVR A;  1C76 A;  3IBE A;  2NVU I;  1WZ3 A;  2D07 B;  5LXH A;  1H8C A;  3NJT A;  1SIJ A;  4OW0 A;  1L7Y A;  1K53 A;  2PIA A;  1BML C;  1PGA A;  2JXT A;  1EM7 A;  5HG2 A;  2LAS A;  3HM6 X;  2BWE S;  1BXT A;  1CQV A;  1Q5W B;  1J7B A;  2M0A A;  2DZK A;  3VAW A;  1UNS A;  1VRA B;  1WIA A;  3HVD A;  3Q3J A;  2ZW0 A;  3Q3N C;  2DAF A;  2K0P A;  2IO2 B;  3PV1 A;  1KF6 B;  3FAH A;  2WNM A;  1IUE A;  2N7D A;  3ETR A;  3ENE A;  5L95 C;  1TYG B;  1FNU A;  3L4P A;  2MA9 B;  4A8X C;  3Q8B A;  1QZE A;  2RSU A;  4ARC A;  5CTR C;  1V5O A;  5G5G A;  4LNO A;  4ZRI A;  3A1Q B;  1D5X C;  1YNT E;  2JRH A;  4NAM A;  4F8C B;  1WGK A;  2FUG 1;  3PSE B;  1OQR A;  2KJH B;  3DQV A;  2FCQ A;  2YEP F;  3RYT A;  4W9L A;  4YXD B;  4I6P A;  1GC6 A;  1WRD B;  1L6U A;  4S0R A;  4M00 A;  2JZ3 B;  4IG7 B;  4N6E B;  2MEK A;  3AE7 B;  2DZM A;  2AYO B;  2LRU A;  2J7Q B;  2I2Y A;  3AI5 A;  4IWQ A;  1U4A A;  2WU2 B;  2ASQ A;  3AH7 A;  1UF0 A;  4FHJ A;  4GOC A;  2K1F A;  2I1K A;  2KJR A;  2AWT A;  4A90 A;  1L2N A;  3TBL D;  2LJI A;  2A5U A;  4KDL B;  1V8C A;  4FJZ A;  1T0Y A;  1GG3 A;  2R2O A;  3A4R A;  4K81 A;  1HTO A;  1ZP0 B;  2INN E;  3QJZ A;  2WU5 B;  4EFO A;  1ZOY B;  3A33 B;  4K7S A;  3DOW A;  3KWV A;  1AW7 A;  4MGK E;  2XNA C;  3L16 A;  4PS3 A;  2M17 A;  4XDC A;  1KTK A;  2IYD B;  2XN9 C;  2CU3 A;  1ZKH A;  1ZXH A;  3PRE A;  3ZDT A;  1VJK A;  3UIN B;  4CYE A;  1T6B X;  1I4G A;  3BK2 A;  2AQ3 B;  4XWT A;  1E90 A;  3AE4 B;  1IGD A;  1V49 A;  2KTF A;  1DYQ A;  2HE7 A;  3Q69 A;  2EMT A;  4RNA A;  1DOX A;  1RFK A;  2KHW B;  2HTM E;  4GN1 A;  1C77 A;  4G50 A;  4ANV A;  3AE1 B;  5GXG B;  3DVG X;  2J4X A;  4LCD E;  2ZZP B;  1CK1 A;  1P9D U;  2I38 A;  4HDO A;  5KHQ A;  4HLE A;  2G45 B;  4ANW A;  4HEA 1;  2DLB A;  1UEL A;  2DEN B;  4ZRP A;  1VZ7 A;  4FUL A;  1FFV A;  1ET6 A;  3GS2 A;  2KX0 A;  2A4Z A;  4W9H A;  4IDI A;  3KUZ A;  1L4D B;  1ZW7 A;  4P7I A;  1TS3 A;  3D32 A;  2WP9 B;  1SB3 C;  4W9I A;  4IM3 A;  1JWU D;  1OGW A;  3RNB C;  4DWF A;  2MJ3 A;  1GJZ A;  1UGM A;  2DZJ A;  2DBY A;  4IM2 A;  5DPW A;  2WXJ A;  2QEJ C;  4DXG A;  5CHV C;  3HK0 A;  1FEH A;  4XGA B;  4DDI D;  3ZNI D;  1C4A A;  2QIL A;  2AX5 A;  2MSE D;  4LJO B;  3VRA B;  2WXH A;  2HTH A;  2NTS A;  1LXD A;  2BT6 A;  2DAJ A;  3KLS X;  3LYY A;  1MHH E;  4BZA A;  4RCO A;  1M4V A;  2KN4 A;  2MQJ A;  3WAP A;  1ZDV A;  4MH8 A;  3AED B;  2LHD A;  1EO6 A;  3P4S B;  2IO1 B;  1UWM A;  2LVP A;  2LXC A;  1Q1O A;  2L76 A;  1UBI A;  3ZRF A;  2PLP A;  2NPT A;  2KVZ A;  3L0W B;  3K9P B;  4K7W A;  4WWM A;  4NJ7 A;  2KYW A;  1WRI A;  2NPT B;  3I9V 1;  3JVZ X;  5BMI A;  3VTW A;  1P98 A;  3ZKJ C;  2LEK A;  3T3O A;  3OWE B;  3EUB 2;  2WGS A;  3N20 C;  5FK9 C;  1OTR B;  2LVQ A;  3VH3 B;  4C4V A;  4H2A A;  2V9H A;  3U7Z A;  1RAX A;  5E6O A;  2HJ8 A;  2HJ1 A;  2W82 A;  1KH0 A;  5CHF A;  3E56 A;  4GXB A;  2FNJ B;  4C4V B;  2MJE A;  3R8B A;  4MH0 E;  2LFI A;  2IBI B;  2WXR A;  2WYQ A;  1SE3 A;  2CHX A;  3BY4 B;  1G6J A;  1J8C A;  2W55 A;  3AUL A;  2LMC A;  5LLI A;  2KQS A;  2Z8L A;  3PVL A;  1Q0W B;  2KTR A;  1WM2 A;  4HCP B;  2LJ5 A;  1T3Q A;  2WDV B;  2MWS B;  3GE8 C;  1A5R A;  3C8Y A;  1C78 A;  2KTR B;  4WWO A;  4ZRQ A;  2N9E B;  1WFY A;  1K8R B;  5J2R A;  1MG8 A;  1ZGU B;  4HCN B;  3DWG C;  2WS3 B;  2IO3 B;  3UI3 A;  1Q10 A;  5JH5 C;  2DZI A;  2O6V A;  1DGJ A;  3IFW B;  4RGM A;  3GB1 A;  1RFA A;  5D3I B;  4C80 A;  2RD0 A;  2GOW A;  3UIO B;  1R4M I;  4WJQ A;  1E8Y A;  2O6V B;  2QJL A;  3VUX A;  5EE1 A;  4MGI E;  1ACC A;  2E3T A;  4HPM B;  5G5H A;  4MEL A;  3M95 A;  2R61 A;  5BMG A;  2LZ6 A;  2XBB C;  2RMM A;  4LTU A;  1WGG A;  1L6V A;  3TJP A;  3KYC D;  3RZF A;  5JXV A;  3KYD D;  1FO4 A;  2KWD A;  1SE9 A;  5IA7 A;  2VH1 A;  2DYM A;  3DHI C;  1E7V A;  2V3S A;  2CKH B;  3QC8 B;  2XK5 A;  3FIL A;  1QLB B;  5D7G A;  2WXM A;  3ML9 A;  5C2T B;  5AEK B;  4GMV A;  2XK5 B;  2JYT A;  5EE9 A;  3FIL B;  2EKE C;  2QSD A;  5BYQ A;  2QMT A;  2GBM A;  4MEM A;  2BQQ A;  2Z0E B;  2KDF B;  4EZL A;  3WA0 A;  4GIV A;  3WAN A;  2WXF A;  2H89 B;  3O13 A;  3QX1 A;  3VTU A;  4WH4 A;  1MFW A;  4MGY E;  1EUV B;  3NY5 A;  1WI0 A;  3U8Z A;  4EE2 A;  3H9D A;  4JL9 A;  5LXI B;  1FIQ A;  3HUI A;  4B0E A;  2JWZ A;  4MT5 A;  3UIP B;  1AN8 A;  3ECI A;  2RPV A;  2L0F A;  2N4F A;  3V61 A;  2ZPY A;  3Q2A C;  1FM0 D;  1WF9 A;  3OLM D;  1MG4 A;  1RRB A;  3ZGZ A;  3KUD B;  4WJO A;  4FLH A;  3P63 A;  2D2Q A;  5AUI A;  2LGX A;  4L2Y A;  4LDT B;  1R4N B;  2BS3 B;  2LI5 A;  3PLV A;  1WGR A;  3CF6 E;  4IM0 A;  4W9K A;  2LHE A;  3CWI A;  2MBE A;  3N32 A;  1QOA A;  3EA6 A;  1FXA A;  1L0X B;  1YIW A;  2K8C A;  3M63 B;  2HDE A;  3S2A A;  4AWJ A;  3VDZ A;  2QIE B;  3EFC A;  4ZDV A;  2IO0 B;  1V1P B;  1F1H A;  4LDT D;  5DPS A;  3RNA C;  1VDV A;  2ZW1 A;  3TEX A;  5BO4 B;  1JWA D;  2NS5 A;  4KGT A;  3ZVV A;  2JX5 A;  1JML A;  3DBS A;  3GP7 A;  4PYU A;  2BKR B;  4HKQ A;  2V3P A;  3ZJV A;  1SJH D;  3RUI B;  3K9O B;  3WAL A;  1NYQ A;  2DWQ A;  5I4D A;  2BS4 B;  1CJE A;  3APC A;  2NMQ A;  2ACZ B;  2FBW B;  3VUW A;  4ZHP A;  2KDB A;  2DYB A;  5IP4 D;  1F77 A;  4BOZ B;  4P1C C;  3DBH B;  1TTN A;  2M0X A;  5FR6 A;  2IY1 B;  4AJW A;  1TY0 A;  1XF5 L;  1R7S A;  2N1V A;  3KW5 B;  3MJW A;  3AE5 B;  4LJP B;  3UQA A;  2CU1 A;  4TKN A;  3LB8 C;  3ZXV A;  5G55 A;  4US8 A;  4HPP A;  4FXC A;  2FID A;  4YL8 A;  2K8H A;  3DVN U;  2PKO A;  4E74 A;  1X1M A;  4A9A A;  1LO5 D;  3Q8E A;  2GB1 A;  3BZD B;  4OVU A;  2VRR B;  2JSV X;  1YJJ A;  4E3C A;  3DCG A;  2CJN A;  1QOG A;  1NYR A;  1WJU A;  4J3O D;  3Q8F A;  1E8X A;  3R2T A;  4GDL A;  2K22 A;  4BFR A;  1EU4 A;  4M02 A;  3H7S A;  4N59 A;  5DPR A;  2ZCB A;  3P1M A;  4FJY A;  4GSW A;  4PYZ A;  4FBJ B;  3CIR B;  4GDL B;  1ROE A;  1HXY D;  3ZNZ B;  4LK0 M;  3KH0 A;  4BAX A;  3GE3 C;  3VVW B;  2J0M A;  3U7D A;  4D2K A;  3WAM A;  4RMA A;  1I42 A;  3NVW A;  3VR9 B;  2FCM A;  2VZK D;  4ZOH C;  3N1Y C;  4Q2J A;  2LRW A;  5EE3 A;  4DHJ D;  3LJ3 A;  2K6D B;  2WQY B;  3QA8 A;  2REX A;  3R3M A;  3RCZ A;  1E7P B;  2EMS A;  2WXG A;  2WX0 A;  2BKF A;  4RH6 A;  1F2R C;  3N9Y C;  1OQY A;  5BMH A;  4AP4 C;  4WAF A;  2D3B A;  2Y5P A;  2GMI C;  1V2Y A;  5HI1 A;  1WJ4 A;  4F1S A;  5BYS A;  2L0T A;  2PEA A;  3PHW B;  2WDT B;  3OAW A;  1PYW D;  2C7N B;  2G4D B;  4TUU A;  5IAA C;  3CST A;  4HRO A;  2G9H D;  3TL5 A;  5C1Z A;  2FCS A;  3NS1 A;  3PPA A;  2KZR A;  3MHZ A;  2KMM A;  2INP E;  4HJG E;  5D2M B;  1YD8 U;  3NVV A;  4KSK C;  4W9F A;  3U4E G;  1JWS D;  4PS8 A;  1UUP A;  1XXG A;  2LD9 A;  2NBU A;  2N7E A;  5AZF A;  3NOB A;  4FHK A;  2KJ6 A;  4P16 A;  4ACF A;  3UF8 A;  4URK A;  3ZTC A;  3RUL A;  2K39 A;  4K7U A;  4ARI A;  2L32 A;  2FAZ A;  3RMK C;  1ZUD 2;  1S3S G;  1MVK A;  4FA6 A;  4RM9 A;  1YN3 A;  2D10 A;  3RNC C;  2Z0D B;  3APD A;  3RFZ B;  1GB4 A;  1B1Z A;  3W5V B;  2ZNV B;  1I4X A;  1VCB A;  4JIO U;  3EGR A;  4LNI A;  3B2F A;  1YJ1 A;  3ZJU A;  4A55 A;  1K51 A;  1D5Z C;  2IJ0 A;  1C79 A;  3R7Q A;  1FMA D;  2PE6 B;  1HE8 A;  4A3O A;  1MI0 A;  4KZ0 A;  3TEW A;  3A9K A;  1EWY C;  3VR8 B;  3W2D A;  1FCC C;  3A4S C;  2M1M A;  2RDB C;  2KAN A;  1SSN A;  3EHV A;  2KMC A;  3CSF A;  2NCN A;  4AUQ C;  2ZNV C;  3LXF A;  1CZP A;  3U30 A;  1XT9 B;  1EWC A;  2QHO A;  2WXN A;  5IKC M;  2OOB B;  1ZPS A;  2EEL A;  1IP9 A;  4HK2 A;  2GBR A;  5G2N A;  5D94 A;  5GMV A;  2GBK A;  2MBO A;  1JRU A;  2Y5C A;  2W3S A;  3OG5 A;  1IYF A;  5MPO A;  1LGR A;  3QHT A;  5C3J B;  1E5W A;  1ESF A;  1WJN A;  4WWP A;  1N5X A;  5IN7 A;  4KKJ A;  2B3A A;  1P7E A;  4TMA B;  2G3Q B;  2YEP B;  2K9X A;  3RT3 B;  3A9J A;  1V97 A;  1E8Z A;  1B9R A;  4BKT A;  1WGH A;  1PDX A;  1RM6 C;  4YTN B;  2RGF A;  3IHP C;  3T8M A;  1KLV A;  4XWW A;  3AEG B;  4OHJ A;  4YSX B;  5KHO A;  3OJ4 B;  5AZG A;  1D6E C;  3J9C A;  1KOT A;  4HDQ A;  3M3J A;  1QOB A;  4ZHO A;  3PT2 B;  2ZPN A;  3U52 E;  4HJK A;  2Y5B B;  3QAQ A;  4RF1 A;  1K52 A;  2W3R A;  3AXC A; 
#chains in the Genus database with same CATH homology
 4RGM A;  2OED A;  3GB1 A;  3AE3 B;  3AB5 A;  1TKY A;  3NUH B;  1JWB D;  5D3I B;  1WXQ A;  4C80 A;  1E10 A;  5HFY A;  2OHF A;  3KQ4 A;  1ZDX A;  1FRD A;  1PFD A;  4HKZ E;  2ICI A;  2QJL A;  2JU6 X;  2KDM A;  5EE1 A;  2AQ2 B;  1SE4 A;  1ACC A;  3HRD D;  1XLO A;  2G1E A;  2E3T A;  4MM3 B;  5G5H A;  4CQN A;  2IGH A;  1KLU D;  4R3D A;  1TZO A;  2R61 A;  4MAC A;  5BMG A;  4C7Y A;  2V4I B;  2K5P A;  2TSS A;  2RMM A;  4LTU A;  1Y56 A;  1JQ4 A;  1L6V A;  1XLN A;  3IAS 1;  2WLB A;  5JXV A;  4REZ A;  4YTP B;  4B0M A;  2H88 B;  1IGC A;  4KKI A;  1QT9 A;  2GI9 A;  2ONQ A;  1FO4 A;  2KWD A;  3VQI A;  1PGX A;  1SXT A;  2DYM A;  1N63 A;  4RGO S;  3FIL A;  1QLB B;  4NZL B;  4C7Z A;  2KAJ A;  4ITK A;  1C9F A;  5D7G A;  2N0S B;  1J7A A;  2WXM A;  2Y3A A;  3NZ3 A;  4ZYS A;  5C2T B;  1L4Z B;  2JYT A;  5EE9 A;  3FIL B;  2IPK D;  2QSD A;  5BYQ A;  3I57 A;  2QMT A;  2SAK A;  3DWM A;  4OZA A;  2JYE A;  1XCT L;  1UWX A;  2PVG C;  1HA5 A;  3ZYY X;  2MJD A;  2N7J A;  5E6J A;  1KRH A;  2WXF A;  3BK1 A;  4WUR A;  2H89 B;  3O13 A;  4WH4 A;  1UGJ A;  3VRB B;  3IAM 1;  1DOI A;  3T3N A;  1ET9 A;  3AEB B;  4EE2 A;  1HZ6 A;  1TKG A;  1BUI C;  1C76 A;  3BYT B;  1V1O A;  1ZE3 D;  4UDU C;  4JE3 B;  4TQ1 A;  1FIQ A;  2V0G A;  3HUI A;  4OZB A;  4B0E A;  1I4H A;  4MT5 A;  4JWS C;  1SIJ A;  2JZP A;  4OW0 A;  2N9L A;  1AN8 A;  1K53 A;  1BML C;  1PGA A;  2JXT A;  1EM7 A;  2PIA A;  2RPV A;  3AE8 B;  3AEE B;  5HG2 A;  1BXT A;  1CQV A;  1FM0 D;  2AQ1 B;  2PVO D;  3BWU D;  1J7B A;  3ZGZ A;  1T5X D;  2M0A A;  5TSS A;  3B2G A;  1SBB B;  1UNS A;  1VRA B;  1JWM D;  3HVD A;  3P63 A;  5AUK A;  2ZW0 A;  3ZJT A;  5AUI A;  1TS5 A;  3W1S A;  4L2Y A;  3WCQ A;  2K0P A;  2IDY A;  5BYR A;  3SFD B;  3H8H A;  1KF6 B;  3FAH A;  2BS3 B;  2WNM A;  3URY A;  1IUE A;  3ETR A;  2RDH A;  1TYG B;  1C4P A;  2LHE A;  3CWI A;  1GAQ B;  1FNU A;  3BYY B;  1QOA A;  3EA6 A;  3L4P A;  4A8X C;  1FXA A;  3Q8B A;  1L0X B;  4ARC A;  4RGT A;  2Q5W D;  2HDE A;  2L1A A;  1VZ8 A;  5G5G A;  2B76 B;  2QIE B;  1QF6 A;  3NRZ A;  1D5X C;  1YNT E;  4NAM A;  4TSS A;  4KGS A;  1WGK A;  1V1P B;  2BS2 B;  1D4B A;  2FUG 1;  2RDG A;  3AE9 B;  3B9J A;  4L23 A;  3SEB A;  1OQR A;  3HVZ A;  1AYF A;  1VDV A;  2ZW1 A;  3TEX A;  2YEP F;  5FKA C;  4YXD B;  1HQR D;  1JWA D;  1L6U A;  2WXK A;  4KGT A;  2JX5 A;  1JML A;  2BBC A;  3GP7 A;  4HKQ A;  4JX1 C;  2V3P A;  3ZJV A;  4GDK B;  1SJH D;  4N6E B;  2MEK A;  3TSS A;  3AE7 B;  1NYQ A;  2DWQ A;  5I4D A;  1VLB A;  1CJE A;  2BS4 B;  2NMQ A;  2ACZ B;  2FBW B;  2I2Y A;  4ZHP A;  4AQ7 A;  2WU2 B;  4AS1 A;  3AH7 A;  1F77 A;  3SR6 A;  5H8Y E;  1PUT A;  2JQR B;  3P4Q B;  1HEZ E;  1TY0 A;  1XF5 L;  1R7S A;  1I4Q A;  3AE5 B;  4A90 A;  1SE2 A;  2LJI A;  3LB8 C;  4DXF A;  1FNW A;  1V8C A;  4US8 A;  1SEB D;  4FXC A;  1GPX A;  3P4R B;  5D3D A;  1ZP0 B;  2INN E;  1WSP A;  1YQ4 B;  2PKO A;  2WU5 B;  3RPF C;  1ZOY B;  3KWV A;  1AW7 A;  2XNA C;  2WDR B;  4A9A A;  4XDC A;  1VZ6 A;  1LO5 D;  3Q8E A;  1KTK A;  1XEE A;  2GB1 A;  1KLG D;  2L52 A;  3BZD B;  3U2S C;  2XN9 C;  1DOY A;  2CU3 A;  1TS4 A;  1I4P A;  4HRS A;  3W9C B;  2JSV X;  1YJJ A;  1ZXH A;  2CJN A;  1VJK A;  1QOG A;  1NYR A;  4J3O D;  1NI3 A;  3Q8F A;  3R2T A;  1T6B X;  2D5G A;  1I4G A;  1WYG A;  1NEN B;  2K22 A;  3BK2 A;  2AQ3 B;  1EU4 A;  4N59 A;  3P42 A;  3P1M A;  1FD6 A;  2PW9 A;  4XWT A;  3AE4 B;  3BVG A;  2WXL A;  4KGR A;  2GRI A;  3KWL A;  2ON8 A;  1N61 A;  3CIR B;  1IGD A;  4GDL B;  1ROE A;  1DYQ A;  1HXY D;  3Q69 A;  5T8I A;  4LK0 M;  1YQ3 B;  4RNA A;  1RFK A;  1DOX A;  2HTM E;  1NEK B;  1C77 A;  3AE1 B;  5GXG B;  1QKZ A;  4D2K A;  2DYO A;  1SF0 A;  2J4X A;  1HZ5 A;  3NVW A;  1CK1 A;  5FR3 A;  2I38 A;  3VR9 B;  3AM9 A;  1EU3 A;  4WIP A;  1VR9 A;  2VZK D;  2BTE A;  1AWD A;  4ZOH C;  4HEA 1;  2DLB A;  2J53 A;  4Q2J A;  1TJE A;  5EE3 A;  4ZRP A;  1VZ7 A;  1FFV A;  3AE2 B;  1ET6 A;  2WQY B;  3GS2 A;  2BB5 A;  4IDI A;  1E7P B;  4KX6 B;  1A70 A;  2IGD A;  1XCQ L;  1N5W A;  2WXG A;  4C56 C;  2KAC A;  1L4D B;  4RH6 A;  3TEZ A;  1F2R C;  1TS3 A;  3N9Y C;  4USA A;  2WP9 B;  5BMH A;  2CJO A;  3MP9 A;  4N58 A;  1SB3 C;  1IBX A;  1JRP A;  4WAF A;  1JWU D;  2Y5P A;  3BVZ A;  2MJ3 A;  1YMH E;  1OFF A;  3PZ7 A;  4NJC A;  5HI1 A;  2K3U A;  1NVI D;  3ZQ4 A;  3AV8 A;  1QQR A;  1RWS A;  1I7H A;  2DBY A;  1XLP A;  5BYS A;  4YSY B;  2WXJ A;  3BII D;  4L1B A;  2QEJ C;  4DXG A;  1IBX B;  4YTM B;  1FEH A;  1PYW D;  3W5U B;  3Q8C A;  1C4A A;  2M19 A;  2QIL A;  4HRO A;  4YT0 B;  2AX5 A;  2BW2 A;  2G9H D;  1N60 A;  1PGB A;  1ZXI A;  1JRO A;  3NS1 A;  4RF0 A;  1JAL A;  1FXI A;  4A6Q A;  3VRA B;  3MHZ A;  2KMM A;  2EKI A;  2WXH A;  3AEF B;  3AE6 B;  1FRR A;  2INP E;  2NTS A;  4HJG E;  2BT6 A;  3NVV A;  4US9 A;  3U4E G;  1JWS D;  3KLS X;  3LYY A;  1UUP A;  1XXG A;  2PTL A;  1MHH E;  4P16 A;  4RCO A;  1M4V A;  2KN4 A;  3MC0 B;  4XE0 A;  1ZDV A;  2MH7 A;  4MH8 A;  3AED B;  3V3X A;  2LHD A;  3NVY A;  1WWT A;  4M0W A;  3MJ5 A;  3IXS A;  3P4S B;  4ARI A;  2L32 A;  1UWM A;  1L5P A;  2E6X A;  1E0Z A;  2LGI A;  1ZUD 2;  4YSZ B;  1MVK A;  5H92 C;  2V3N A;  1D5M C;  1TKE A;  1YN3 A;  2BB6 A;  1J7C A;  2PLP A;  4XDD A;  3AMZ A;  3RFZ B;  2WXP A;  1GB4 A;  1B1Z A;  4IOI E;  3W5V B;  4LLG M;  1I4X A;  3E9S A;  4IKG A;  3V05 A;  3EGR A;  3P4P B;  1K50 A;  1JCK B;  4WWM A;  3B2F A;  2SEB D;  3ZJU A;  4A55 A;  1K51 A;  4NAW B;  1D5Z C;  2IGG A;  2IJ0 A;  2BYT A;  3AN1 A;  1WRI A;  1C79 A;  2LUM A;  1FMA D;  1TS2 A;  1I4R A;  1MHX A;  3BVM A;  3I9V 1;  5BMI A;  1MI0 A;  1L0V B;  3TEW A;  1EWY C;  3AEC B;  3VR8 B;  1FCL A;  2LEK A;  3W2D A;  2VZK B;  1FCC C;  1ENF A;  3T3O A;  3OWE B;  3EUB 2;  2J42 A;  1GB1 A;  1RYJ A;  4P6V F;  1STE A;  1SSN A;  1P7F A;  1FNV A;  5FK9 C;  3IT4 B;  3LXF A;  1CZP A;  4OZC A;  1YN5 A;  3NVZ A;  4H2A A;  1EWC A;  2WXN A;  3U7Z A;  4WQM A;  2W82 A;  1L0Y B;  1ZPS A;  2EEL A;  1QIL A;  2N9K A;  1KH0 A;  3ABV B;  1E6E B;  3E56 A;  4OVZ A;  1F0Z A;  1QOF A;  3IT6 B;  2MJE A;  3MFG A;  3R8B A;  2Y5C A;  2W3S A;  3AEA B;  2WXI A;  2LFI A;  2WXR A;  1SE3 A;  5MPO A;  4DQO C;  1ESF A;  5C3J B;  4TQ0 A;  3PO0 A;  1N5X A;  4YWG G;  3FC4 A;  2J52 A;  2W55 A;  2NTT A;  4KKJ A;  2WXO A;  3PZ8 A;  2LMC A;  1P7E A;  4TMA B;  2Z8L A;  2W54 A;  5LNK 1;  2YEP B;  2K9X A;  4JWU C;  2WDQ B;  1YN4 A;  3R2I A;  4RGN A;  1F2R I;  1V97 A;  1JW9 D;  5EE0 A;  3TUO A;  1B9R A;  1C4C A;  1XLQ A;  1PDX A;  2M56 B;  1T3Q A;  4O1N A;  1OQQ A;  1RM6 C;  4YTN B;  2WDV B;  2JWU A;  1FFU A;  2X38 A;  2L83 A;  1TY2 A;  3C8Y A;  1N62 A;  3TEY A;  4XWW A;  1C78 A;  3AEG B;  2FE8 A;  4OHJ A;  5HHD G;  4YSX B;  4RFB A;  4ZRQ A;  1KFY B;  4GLS C;  1MPE A;  1SJE D;  2WXQ A;  3SFE B;  1D6E C;  3J9C A;  4PT5 A;  1QOB A;  1YJI A;  4ZHO A;  3DWG C;  1E9M A;  2WS3 B;  3UI3 A;  2PMV A;  1Q10 A;  1V1P A;  3U52 E;  1XO3 A;  2KQ4 X;  1GOZ A;  3Q8A A;  4RF1 A;  1K52 A;  4JPS A;  2W3R A;  1DGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...