2IO1B

Crystal structure of human senp2 in complex with presumo-3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 16
structure length 81
sequence length 81
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io1B00
4MGYE 2ZVOA 4WJPA 1WE6A 3VTWA 3ZW3A 4BKTA 4F8CB 2KTRB 2N1WA 2K6QA 1SIFA 2MBHA 2J0JA 2NVUI 3A33B 1WGRA 3EC8A 4EZLA 3IG3A 3L54A 3ZLZA 1WJ6A 2KFJA 2KWUB 5G2NA 3EFUA 1UBIA 4WJNA 5CHWA 4URKA 1L2NA 2XK5B 2IYDB 4HVBA 3UQBA 4WWNA 2DZJA 4MSQB 4IWQA 3V6CB 3UQAA 3DPDA 3PT2B 3RCZA 4GIVA 3PZDA 4DHZE 3PS6A 4KZCA 4FADA 4HCNB 1WGYA 3H1UA 2KC1A 4DWFA 4K81A 2C7MB 5J18A 3PV1A 5D6JB 2KMAA 1WM2A 2ZVNA 2KJ6A 3N30A 3SDLC 3M63B 1TZ1A 2AL3A 2D11A 2M4NA 2A4ZA 2G45B 2CHWA 2K25A 2O2VA 2D2QA 3VDZA 2ZCBA 2NBWB 3ML9A 1P98A 2M1MA 4HXDA 3QAQA 2W9NA 4NQLB 4B6WA 3OJ3A 5L95C 1OEYJ 1WR1A 2KLGA 2Z0DB 5DPRA 2KFKB 3U30A 3QQ8B 4W9GA 4PS3A 5JHBA 2JVCA 3A4SC 4IW0A 2G3QB 2LZ6A 3B0AA 1P0RA 3VQIA 2GMIC 3TMPB 5LLIA 2L76A 4HK2A 3T8MA 1WJ4A 3HK0A 2AWTA 2AYOB 4II3B 2MBEA 3JYUA 1WFYA 2KJRA 3KUCB 5KHQA 1GJZA 5J2RA 3DVGX 4IM2A 4KIKA 3OLMD 3RD2A 4KSKC 3VTUA 2CKHB 3AU4A 3NZSA 3PRMB 1VD2A 3SHQA 4AUQC 3AXCA 3IVFA 2HD5B 4ANUA 2EKEC 2NCNA 1WY8A 1WX8A 2KNBA 3LDZE 2J0MA 1U4AA 1WRDB 2N4FA 2N7EA 3KUZA 2WDTB 4BVUC 2IZVB 1A5RA 1ZW7A 5LXIB 2KQSA 2K8CA 2V3SA 3AI5A 4IM3A 1LFDA 3B08A 1J8CA 3NS8A 2RD0A 2LXAA 4GB9A 1WGHA 4MEMA 1WE7A 1L7YA 1WMHB 2O6VB 3QC8B 2KANA 2ZPNA 3PTFC 3Q3FA 1WGDA 2BYEA 1EF1A 4RMAA 2OJRA 4WJQA 3BY4B 2C5LC 3DBLI 2KN5A 2KLCA 2VRRB 3VUYA 2PE6B 1RRBA 4J6IA 1OEYA 5DPWA 2KHWB 2L3ZA 2JZ3B 2IY0B 2Y5BB 3L0WB 1UH6A 2FUHB 4XC2A 2MX2A 3TBLD 3RZFA 3M3JA 2EMTA 2JF5A 1V5OA 4GOCA 4GU2A 4I6NB 4EKUA 4FN2A 4KDLB 5HKHA 2PPHA 4AWJA 4FBJB 2MP2B 2LVOA 4MELA 2M8SA 2L05A 2BF8B 1EO6A 3M95A 4M8MA 4W9EA 2N9EB 2JXXA 4HLEA 1E7UA 5C1ZA 3ENEA 2LASA 3RT3B 3HM6X 4G0NB 5AZHA 2KJHB 4RM9A 4DHJD 1KLVA 4MH0E 1E8XA 3ZNGC 4ASWC 2ZEQA 4K7UA 3JVZX 4KVGB 4TV3A 4ICVA 4DDGD 1P9DU 1S3SG 1X1MA 4LJOB 1T0YA 4JLCA 1KOTA 5AZGA 2K39A 3TIXA 3PGEA 2N9XA 4TQ0A 3ALBA 3TL5A 2PE9A 2D3GA 1WX7A 3ZDMC 2KFKA 4K7SA 3RULA 3T9LA 3V60A 1Z2MA 3IHPC 2DZIA 2ZPYA 5AZFA 1GC7A 1YIWA 1Q1OA 3WANA 2KO3A 2DYMA 2UWQA 4G11A 4JGHB 2KKCA 2HTHA 4PS8A 1C1YB 4FJYA 1E7VA 1V81A 1UD7A 2Z0EB 3RYTA 3APDA 1Z5SB 3H7PB 4RM8A 2GBKA 2FCQA 4ZRKA 4FHJA 3NY5A 4A3OA 1JRUA 2N7DA 1GNUA 2IBIB 3ZRFA 4HDOA 1LM8B 1CMXB 4IG7B 3VUXA 3HIZA 3WAMA 1UGMA 3H9DA 3N32A 4AOFA 3TJPA 3UF8A 4A20A 5LXHA 2MSED 4AJWA 3HHMA 1V86A 3PLUA 3M62B 1TGZB 3RZWC 3A4RA 2KMCA 2DZKA 4W9KA 2L0TA 3QJZA 2L8JA 4MGZE 2KDFB 1WMHA 2GBMA 2PEAA 2ASQA 1KJTA 4YL8A 4OVUA 1RAXA 3PVLA 4W9DA 4CO7A 1K8RB 1WJUA 3KVFB 2L0FA 4HPMB 3UINB 2JY6A 1E8YA 3DCGA 4GGQA 1WYWB 5DPSA 3S2AA 3PRZA 2MBQA 4W9IA 4P7IA 4IUMB 2KDEB 2K6DB 4PYUA 4NAWB 1XT9B 2J7QB 3QA8A 2C60A 3O65B 3JSVB 4I6LB 2YLMA 2KK8A 3NZUA 4BOZB 2L00B 4DDID 4DK5A 5E6NA 2FCNA 2K1FA 2LRWA 4LDTD 5GMVA 4ZRIA 2R2QA 3A9JB 3DQVA 2BPSA 4GDLA 1YX5B 4BKSA 1XQQA 2I1KA 2AEHA 2G4SA 4GN1A 1E8ZA 4ICUA 2NS5A 4E71A 1IYFA 2R2OA 4HJKA 2BKFA 5E6PA 2LVQA 3L08A 1WR6E 2LGXA 3X0WA 2FNJB 2LD9A 4W9JA 2WWZA 3AULA 3ZVVA 2XBBC 3Q3JA 3R3MA 4NNJB 2KWVB 4FHKA 4BBNF 2KXJA 3V6EB 2D10A 2MBBB 2NPTB 4CHKA 5JHAA 5CHVC 1Q0WB 2IO3B 4WWPA 4AJYB 4PS7A 3NHEB 1GC6A 4K1RB 4NPNA 5CTRC 4BFRA 2C7NB 3PHXB 4EEWA 4IM0A 1ZGUB 1WXSA 1EF5A 2MRPA 3P2BA 2RPQA 3DDCB 1TTNA 1UZXB 1EUVB 3VVWB 1V49A 2KTRA 5L83A 2KDIA 2RR9A 1H4RA 4XZ4A 2BGFA 2G4DB 3ZIMA 4DXAB 2V4LA 3UGBB 4GXBA 1WJNA 2KOXA 2V1YA 3QIJA 4OVVA 5E6OA 2KQ7A 4DHZB 1YX6B 1ZKHA 4GMVA 1IPGA 1V6EA 2XK5A 3EECA 1J0GA 5DPTA 5DCNA 3KUDB 3I3TB 2XEWA 1QZEA 2RGFA 3L10B 3DBHI 3H7PA 1WI0A 4KSLC 2GOWA 4TUUA 4W9LA 2CHXA 2GBRA 2IO0B 1G6JA 3K9OB 4B95A 3ZTDA 4FJZA 1SGHA 3KYDD 3BINA 2NR2A 1P1AA 3R7RA 1UBQA 3ZO5B 5D7GA 2A5UA 2N1VA 2L7RA 4EOYA 2RSUA 1OGWA 4ANXA 2K8HA 3PPAA 4WAAA 2BYVE 3L16A 4G50A 2WX1A 4BKGA 3QCAA 1NDDA 4NJ6A 4ZDVA 3W1YA 4BKSD 3ZDTA 3PREA 1VCBA 1NBFC 3HM3A 1F9JA 4BOSC 3CMMB 4MM3A 3JW0X 2DYOA 2LWPA 1WXMA 3A9KB 3R7QA 1WXAA 3VTVA 4GDKB 1LQBA 5KHOA 1MG8A 2DX5B 2WYQA 4NY0A 1Y8RC 2M17A 4W9HA 1FXTB 4GSWA 1V80A 2LUEA 1UELA 5J17A 4NAWA 1RLFA 3PRPB 3QX1A 1H8CA 1IP9A 1WX9A 2DENB 3MTNB 2CR5A 3ZKJC 3W1SC 2MQJA 3TCAA 2MA9B 3KYCD 1BT0A 2KX0A 4FLHA 5G55A 2LGYA 4B9KA 1V5TA 5AEKB 3A9JA 4EFOA 3B1LX 4HWIB 2CS4A 2DHZA 1V9JA 1GG3A 2JZZA 2LI5A 4II2B 3UIOB 1TBEA 4PYZA 3DBSA 3ZRCA 4E74A 1XD3B 2CHZA 2ZJDA 3EHVA 3H6NA 3NOBA 4MJSB 4DBGA 3QWZB 2KD0A 5D2MB 4JIOU 4TKNA 2REXA 4M0WB 3ZNZB 2KVRA 5EDSA 1HE8A 4ZRJA 1M94A 4EZKA 2FIDA 2O6VA 3L13A 2NPTA 3WIMA 2KX3A 3DBRI 4KV2A 3VAWA 4FULA 2KTFA 3PSEB 3A1QB 5CX3A 3DVNV 3UIPB 2I1JA 2KZRA 4NQKE 4BBNC 1RFAA 3ECIA 1WH3A 4AP4C 1S1QB 2IY1B 4LDTB 2LRUA 3AU5A 2JT4B 1PQSA 2C9WB 3IFWB 5IAAC 3U7DA 4FJVB 3V61A 5FR6A 4MDKE 2MBOA 1YJ1A 1J19A 3PLVA 2NBVB 3LJ3A 2OOBB 3X23A 2GBJA 4JL9A 2JPHA 2MP2A 2ZCCA 3K9PB 1OQYA 3ONSA 1GUAB 5D94A 5C23A 1V2YA 2EMSA 2LVPA 4W9FA 2LGDA 4KZ0A 2KC2A 2K8BA 1LXDA 4MSMB 1I35A 1WGGA 1WF9A 1WXVA 3MJWA 2DAFA 2IO2B 1WM3A 4WJOA 2MLBA 3VH3B 4EUTA 2MCNB 3VHTC 1YD8U 4A3PA 5JH5C 1WZ0A 2LJ5A 3ZTCA 1WZ3A 5JZEB 4ZYNA 3RUIB 4K7WA 3ZNHB 5BO4B 4W9CA 4HCPB 1I42A 3DVGY 1ISNA 2LXCA 2AL6A 2Z59B 1E90A 2KDBA 2MWSB 3U8ZA 3WA0A 2WX0A 2PJHA 3ML8A 3A9KA 2O2VB 3OJ4B 1YQBA 4F1SA 4GDKA 3DOWA 3C0RB 2CU1A 3H7SA 2D07B 4FA6A 1OTRB 4JQWC 1R4NI 4LCDE 2JUOA 2FCMA 2IO1B 3MHSD 4I6PA 2JWZA 2BYFA 3APCA 3KW5B 4X57B 1C3TA 2BWES 3N3KB 3CSTA 2O6VD 3CSFA 1D3ZA 3WAPA 2MW5A 4KDIC 4DHJB 3PHWB 3CF6E 3IBEA 1NI2A 4HPLB 3R66C 2M0XA 2DAJA 3WALA 4IWOA 3GZNI 4N9F4 4KIKB 3ZNID 2ZNVC 2JRIB 1KM7A 2QHOA 2NBUA 2FAZA 1Q5WB 2UYZB 4GDLB 2BWFA 1E8WA 4HDQA 3QK0A 4MJSA 2B3AA 5IA7A 4ANVA 3VFKA 3APFA 2KWCA 3WAOA 4NJ7A 4MGIE 3D32A 3L17A 1SE9A 2C7HA 4E3CA 5CHFA 3V62A 2N9PC 4MGKE 2JRHA 4ANWA 3W1SA 2DZMA 2FCSA 4TQ1A 2ZZPB 4XX5A 3VUWA 3ZUNA 3VXWA 4G3XB 4WWOA 3GOEA 4IWPA 3A1QA 4F7ZA 3QARA 1R4MI 3SD5A 1WIAA 2HE7A 4M8NA 2J0KA 3SU8X 1P3QU 3JSVA 3OAWA 4CYEA 3QHTA 2ZNVB 3VH4B 2BKRB 4EZJA 3KH0A 5TR5A 1AARA 2YVCA 2HJ8A 4LJPB 2DYBA 2FIFA 1E5WA 4WQOB 4IC7B 3DVNU 2GBNA
chains in the Genus database with same CATH superfamily
4BKTA 1F77A 2K6QA 1SIFA 2PW9A 3A33B 3R8BA 4OZBA 2FE8A 4XDCA 5MPOA 1WJ6A 3ABVB 1T0SC 2KFJA 2KWUB 4WWNA 3UQAA 3Q8EA 3PZDA 3B2GA 2HDEA 4P16A 3AM9A 1WGYA 3H1UA 2C7MB 5J18A 1SJED 3MHZA 4XE0A 2KMAA 2KJ6A 3BIID 3M63B 2O2VA 4B0EA 3VDZA 2D3CA 2ZCBA 3Q6BA 2J42A 2Z8LA 4LNKA 4USAA 4NQLB 4B6WA 5DPRA 4W9GA 1ZDVA 1TS2A 2LZ6A 3R2IA 2GMIC 2WS3B 1YN5A 3KUCB 4BAXA 2K3UA 3VTUA 3ETRA 2CKHB 2QJLA 2ONQA 3PRMB 4AUQC 4UDUC 1N5WA 4RGTA 2KNBA 2J0MA 1WRDB 2IZVB 2PLPA 1XLPA 3AI5A 3NS8A 4GB9A 4MEMA 1L7YA 3BK1A 3O13A 2BYEA 1EF1A 4OZAA 2C5LC 1RRBA 3GE3C 1JROA 1OEYA 5DPWA 2WXQA 4YSXB 2INDC 4RGNA 4HPPA 2LJIA 2Y5BB 1J7CA 3L0WB 1QILA 2MX2A 3HVZA 1SB3C 5FKAC 2EMTA 4GOCA 4GU2A 4FN2A 3UI3A 2LVOA 4MELA 4M8MA 4W9EA 2JXXA 2XNAC 1E7UA 3SEBA 3RFZB 3AE5B 4LLGM 2LASA 1E10A 3I63C 1T0RC 1KLVA 4MH0E 1L4ZB 1JWAD 3N1ZC 4KKJA 4P1BC 5D3DA 2WXPA 1KH0A 3NZ3A 2G1EA 1T0YA 1CJEA 1VJKA 1YN3A 4YSZB 3T9LA 3V60A 3KWVA 3RNCC 3IHPC 2KMMA 2CJNA 5AZFA 1Q1OA 2IGHA 2KKCA 4FJYA 1V81A 1UD7A 2Z0EB 1VZ6A 2G9HD 1Z5SB 2H89B 4ZRKA 1JW9D 3BK2A 4A3OA 2N7DA 1GNUA 2IBIB 2Y5PA 1M4VA 1XLQA 3NJTA 3VUXA 3HIZA 3N32A 2KYWA 3HHMA 1V86A 4HEA1 3FILB 1C76A 1FIQA 2L8JA 1WMHA 2GBMA 2PEAA 2ASQA 5C2TB 3VR9B 4W9DA 3PVLA 2CU3A 1E8YA 5DPSA 3PRZA 4C7YA 4P7IA 4NAWB 3W2DA 3NZUA 1GB1A 4DK5A 4Q2JA 4LDTD 2BB5A 1FRRA 2BPSA 4GDLA 4BKSA 2OJWA 5JXVA 3P42A 2NS5A 3Q8AA 3W5UB 2LVQA 1SEBD 1WR6E 4AS1A 2LGXA 1KFYB 4C4VB 2FNJB 4W9JA 2WWZA 3P4RB 3R3MA 3NVVA 1NVID 4RF0A 2MBBB 3EFCA 3E9SA 4WWPA 4PS7A 3NHEB 3AE2B 4K1RB 4NPNA 2YEPF 1JWUD 4BFRA 3J9CA 1HXYD 4ACFA 4IM0A 1ZGUB 2RR9A 1XLOA 4CQNA 3UGBB 1SE2A 4GXBA 2KOXA 2QSDA 5EE3A 1ZKHA 3Q8CA 4KGSA 1V6EA 2W55A 3RNEC 3I3TB 2RGFA 3L10B 2W3SA 2QEJC 2M0AA 4KSLC 4W9LA 2CHXA 4FJZA 4OVZA 3Q3MC 1K50A 4P1CC 2WQYB 2A5UA 2L7RA 1MHHE 4ANXA 1UUPA 2BYVE 3L16A 2GRIA 2AQ3B 4BKGA 1KLUD 3PREA 1NBFC 3HM3A 3N20C 2Q5WD 4MM3A 3A9KB 3R7QA 3I5JC 1ZOYB 3VTVA 1LQBA 1C9FA 2DX5B 2M17A 1UELA 3QX1A 3T3NA 2CR5A 3AMZA 1PDXA 1V1OA 2LGYA 1XCQL 3A9JA 4EFOA 1YQ3B 1P7EA 3AE8B 4HWIB 4II2B 5C3JB 4RCOA 1MFWA 3U2SC 3DBSA 1RM6C 2ZJDA 3EHVA 2VH2A 1IBXA 3QWZB 4JIOU 4TKNA 1T5XD 4M0WB 2NTTA 5EDSA 1HE8A 3DBRB 1NENB 4YTPB 2O6VA 4DXGA 3L13A 3VAWA 2KTFA 3PSEB 1FEHA 4ZHPA 2LUMA 3UIPB 4NQKE 4AP4C 1S1QB 2LRUA 1ET9A 4A8XC 1PQSA 2C9WB 2QC8A 4FJVB 3V61A 1GB4A 2MBOA 1K53A 3X23A 3ONSA 1V2YA 2EMSA 4XWTA 2LVPA 2LGDA 4KZ0A 2X38A 1LXDA 1ET6A 1WGGA 1WF9A 1L4DB 2M56B 3MJWA 2IO2B 4WJOA 4EUTA 3VHTC 1YD8U 1WZ0A 1NYRA 3RUIB 1YJIA 4HCPB 3U4EG 2VZKB 2KDBA 3NRZA 1HTOA 3ML8A 3OJ4B 4F1SA 2N9KA 1R4NB 5HHDG 4IDIA 4FA6A 1OTRB 4JQWC 3U7ZA 2FCMA 2IO1B 2BYFA 3APCA 3KW5B 3AE3B 3CSFA 2LEKA 4NJCA 3WAPA 2MW5A 3GZNB 2W3RA 3IBEA 1NI2A 1ESFA 4KIKB 2MJDA 3P4PB 1RWSA 3MP9A 1F0ZA 2IGDA 1QOFA 1SE9A 2C7HA 1J7AA 3V62A 4MGKE 4D2KA 1MPEA 4XX5A 4TQ1A 2ZZPB 3VXWA 4WWOA 4IWPA 3A1QA 3QARA 1MG4A 1R7SA 2I38A 3JSVA 1D5XC 1UF0A 1KRHA 2ZNVB 4WQOB 1E5WA 4KKIA 3BWUD 2KWDA 1GAQB 2J0JA 1JCKB 4WH4A 3C8YA 1TYGB 1P7FA 3DHHC 3IAS1 1UBIA 4URKA 2XK5B 2IYDB 4MSQB 1L0YB 2K5PA 3V6CB 3DPDA 2Y3AA 5EE1A 2INPE 3PZ8A 1AYFA 3AEAB 4HCNB 1HZ5A 3PV1A 3EUB2 1YNTE 3E56A 4RNAA 1TZ1A 2AL3A 2M4NA 2WDQB 2G45B 2EKIA 1XO3A 4HXDA 3QAQA 1QOBA 1WR1A 2KLGA 3AE7B 5BMHA 2KFKB 3U30A 3QQ8B 5JHBA 4IW0A 3B0AA 3VQIA 1SIJA 2K22A 3HK0A 2AWTA 2AYOB 3VRBB 5E6JA 2MBEA 3JYUA 1WFYA 5KHQA 1L0XB 2LHDA 1OQRA 4KSKC 2WHIA 3AU4A 4ANUA 1C78A 2EKEC 2NCNA 1WX8A 1FRDA 1U4AA 1JWMD 2WDTB 3MC8A 1A5RA 3BVZA 4RF1A 5LXIB 4HJGE 1LFDA 3B08A 2HJ1A 1F2RI 4MH8A 1WGHA 1JQ4A 2KANA 2ZPNA 3PTFC 4RMAA 2KN5A 4J6IA 4ARCA 5IKCM 1WSPA 2JZ3B 1C79A 2BBCA 1UH6A 2FUHB 2L52A 4XC2A 1ZPSA 3M3JA 4YT0B 4I6NB 1A70A 2WXHA 4KDLB 3LYYA 4EE2A 2PPHA 1AN8A 4FBJB 4PK1A 1EO6A 4A55A 2N9LA 4HLEA 3RNGC 5C1ZA 1GOZA 1SSNA 4RM9A 4DHJD 3U52E 1E8XA 1FCCC 3ZNGC 5IO9A 1IUEA 4JLCA 1MJDA 1KOTA 4TQ0A 3ALBA 3TL5A 1WX7A 3TEWA 1IGCA 1Z2MA 3KLSX 1I4PA 1TS5A 2ZPYA 1BMLC 1YIWA 2N7JA 1PUTA 2DYMA 1MVKA 2UWQA 4YXDB 1E7VA 4YTMB 2FCQA 4WAFA 1D5ZC 1SF0A 2IGGA 1JRUA 1FO4A 1LM8B 1UGMA 3TJPA 3TEXA 3UF8A 4AJWA 2JYTA 3M62B 1RYJA 3A4RA 4W9KA 3P1MA 3QJZA 4OVUA 1RAXA 4CO7A 3UINB 3KVFB 2L0FA 4GGQA 5BYSA 2MBQA 4W9IA 3RMKC 4IUMB 4PYUA 1XT9B 2J7QB 2C60A 2MJEA 4I6LB 4BOZB 3ZJVA 2LRWA 5GMVA 1YX5B 1SJHD 1XQQA 4YTNB 2G4SA 4GN1A 4C80A 3AEBB 3Q14C 2R2OA 2IDYA 5E6PA 2ZW0A 2I2YA 2Y5CA 2E6XA 1TY0A 3AULA 3ZVVA 3Q3JA 4NNJB 2KWVB 4BBNF 3P63A 3C19A 1QOGA 4CHKA 5JHAA 4KX6B 2IO3B 1FNWA 4L1BA 1Q10A 3GE8C 5CTRC 3CWIA 1OQQA 1V97A 3PHXB 1L6UA 2MRPA 4US8A 2JQRB 2RPQA 2KTRA 2VZKD 4XZ4A 2G4DB 3QIJA 4DHZB 2KQ7A 3I9V1 3KUDB 3SFEB 3Q69A 3AN1A 2IO0B 3ZYYX 1G6JA 3ZTDA 1B9RA 4JE3B 1SGHA 3KYDD 1OGWA 4MT5A 2DWQA 4M02A 3MFGA 3FILA 1NDDA 4NJ6A 2WXOA 3ZDTA 1VCBA 2KACA 2DYOA 2AQ1B 2LWPA 1WXMA 4GDKB 1MG8A 4HKZE 1FXTB 1N63A 1PGBA 2FBWB 1V80A 2ICIA 4LNNA 5J17A 4NAWA 1H8CA 5HI1A 2DENB 3W1SC 2MQJA 2MA9B 3KYCD 1BT0A 2KX0A 5G55A 3HUIA 1KF6B 5AEKB 1XLNA 2CS4A 2DHZA 3UIOB 1BXTA 3MC0B 4REZA 3ZRCA 4WQMA 2J4XA 4NAMA 2CHZA 3H6NA 2WU2B 4DBGA 3NOBA 4MJSB 4C4VA 4R3DA 4ZRPA 2REXA 4PT5A 4ZRJA 2FIDA 4KGRA 3WIMA 2KX3A 3DBRI 5AUKA 4XWWA 3DVNV 2I1JA 2WDRB 1RFAA 3ECIA 5BMIA 2L83A 2J52A 2RDHA 3OWEB 2JT4B 2BW2A 3IFWB 4DXFA 3U7DA 1CK1A 5FR6A 4MDKE 1YJ1A 1J19A 2AX5A 2GBJA 1I4XA 2MP2A 3K9PB 1OQYA 1F52A 3BVMA 1GUAB 1JWBD 2L32A 3LXFA 5D94A 1L6VA 3AECB 3P4QB 1K52A 2KC2A 4MSMB 3V05A 1I35A 1WXVA 2E3TA 1I4QA 2DAFA 1WM3A 3VH3B 2MLBA 2SAKA 4A3PA 1V1PB 5JH5C 3NS1A 3ZTCA 5JZEB 2BS2B 3ZQ4A 4OW0A 4L23A 3URYA 3ZNHB 1N61A 1ISNA 2AL6A 1E90A 3RI7C 2IPKD 1FFVA 3A9KA 1YQBA 2WXGA 3ZJUA 1N5XA 3H7SA 2CU1A 1R4NI 4LCDE 3MHSD 2JWZA 4X57B 2AQ2B 1D3ZA 1XF5L 2KT7A 4DHJB 3CF6E 4ZYSA 3R66C 5TSSA 1EU4A 2DAJA 3WALA 2ACZB 4IWOA 4XDDA 3GZNI 3ZNID 1KM7A 1Q5WB 2UYZB 3FC4A 4GDLB 1UGJA 1E8WA 3QK0A 2B3AA 2PVGC 1WWTA 3VFKA 2KWCA 2WXLA 4NJ7A 4M0WA 4MGIE 4LNOA 4E3CA 3PO0A 2FCSA 1R4MB 4US9A 3Q8FA 3GOEA 2WNMA 1HZ6A 4F7ZA 1QT9A 1DOIA 2HE7A 2J0KA 3OAWA 2BKRB 3CIRB 3KH0A 4LJPB 2FIFA 1I4RA 2RMMA 2JSVX 1RFKA 3DVNU 1ZE3D 2KDMA 2ZVOA 4WJPA 4F8CB 1CQVA 2N1WA 1ZP0B 2MBHA 1WGRA 3IG3A 3L54A 3ZLZA 5G2NA 3AEDB 3EFUA 4HVBA 1ROEA 3UQBA 4IWQA 3PT2B 3RCZA 2B76B 3PS6A 4KZCA 3ZXRA 2QIEB 2H88B 5G5GA 2KC1A 4DWFA 5D6JB 4B0MA 1D4BA 1FXIA 1WM2A 2ZVNA 1E9MA 2LGIA 3N30A 2D11A 2A4ZA 2CHWA 2D2QA 3ML9A 3OJ3A 1OEYJ 5G5HA 1TJEA 3N1XC 2JVCA 3A4SC 2G3QB 3HRDD 1P0RA 1EWCA 3TMPB 5LNK1 5LLIA 2L76A 4HK2A 1WJ4A 4II3B 2KJRA 3DVGX 4IM2A 4KIKA 5BYRA 2WP9B 1UNSA 3RD2A 1FNUA 2NTSA 3NZSA 3SHQA 3AXCA 3IAM1 1WY8A 3LDZE 2N4FA 4BVUC 3L4PA 1ZW7A 2KQSA 2V3SA 4IM3A 1J8CA 2RD0A 2LXAA 3DBLB 1AW7A 1WE7A 2O6VB 3Q3FA 1WGDA 2GLSA 2LGSA 3NVWA 1C4AA 1WXQA 2VRRB 3VUYA 1C77A 2PE6B 3FKYA 3TBLD 1ENFA 3RZFA 2JF5A 1EU3A 4ZRQA 1QOAA 3HVDA 5HKHA 2OHFA 2L05A 2WXRA 3MJ5A 2QCZA 4YSYB 1SE4A 2PIAA 3ENEA 3RT3B 3IT4B 4ASWC 1WRIA 1WGKA 2MH7A 3BYYB 4KVGB 4A9AA 4FXCA 1D5MC 4TV3A 1N60A 4ICVA 1P9DU 1S3SG 1X1MA 4LJOB 4ZOHC 1K51A 1ACCA 3TIXA 3DHGC 3PGEA 1TS4A 2X8XX 2PE9A 2D3GA 2KFKA 2DZIA 3RNAC 1GC7A 3WANA 2XN9C 2RDBC 2SEBD 4PS8A 2HTHA 3APDA 3H7PB 4RM8A 3AEGB 4FHJA 2JYEA 1CMXB 3WAMA 3RPFC 4AOFA 2WXNA 1D6EC 2PVOD 2WDVB 3PLUA 1TGZB 3RZWC 2V3NA 2KMCA 2DZKA 3IT6B 3RNFC 4O1NA 4MGZE 2KDFB 3P4SB 3TEYA 4HPMB 2JY6A 1WYWB 3BYTB 1JWSD 2WGSA 1N62A 2BS3B 2K6DB 2KDEB 3QA8A 3JSVB 4RGOS 4XYCA 5BMGA 2YLMA 2JXTA 2KK8A 2L00B 5E6NA 2FCNA 2K1FA 1OFFA 2R2QA 3DQVA 2V0GA 1HQRD 1FCLA 3TSSA 2AEHA 1E8ZA 3RN9C 1VLBA 1IYFA 4HJKA 2BKFA 3L08A 2DBYA 2XBBC 3NG0A 4FHKA 2PKOA 1ZUD2 4P6VF 2KXJA 3V6EB 2N0SB 2NPTB 1Q0WB 3AV8A 4AJYB 2HTME 2C7NB 1EF5A 3KQ4A 1B1ZA 3P2BA 3DDCB 1PGAA 1UZXB 1EUVB 3VVWB 5L83A 2KDIA 2BGFA 3ZIMA 4DXAB 3GB1A 2V4LA 4OZCA 3B9JA 1FFUA 4N58A 2V1YA 4OVVA 3DBHB 4GMVA 3VR8B 3DWMA 5DCNA 2XEWA 1QZEA 1WI0A 2DLBA 2PMVA 4TUUA 2GBRA 1XEEA 4B95A 1YMHE 3H8HA 3BINA 2NR2A 3R7RA 1UBQA 3LB8C 5D7GA 2RSUA 1FD6A 1XCTL 2K8HA 3PPAA 3I57A 2WX1A 3W1YA 4BKSD 1F9JA 4JX1C 3JW0X 2GB1A 2MJ3A 4NY0A 1Y8RC 4W9HA 1RLFA 3PRPB 1IP9A 1WX9A 3MTNB 3Q3OC 4FLHA 4B9KA 2BT6A 4ZHOA 1T3QA 1V9JA 2JZZA 2TSSA 2WU5B 4PYZA 4A6QA 1XD3B 2BS4B 2KD0A 3ZNZB 2KVRA 1M94A 1L0VB 4WURA 4KV2A 5CX3A 4WWMA 1WH3A 3FAHA 4J3OD 4HKQA 4KGTA 2WXKA 1N6ZA 5IAAC 2OOBB 2PTLA 4LK0M 2ZCCA 4NZLB 5C23A 2DNFA 4H2AA 4W9FA 2K8BA 4C00A 1JMLA 2WXFA 2MCNB 2MHJA 3N1YC 5AUIA 4S17A 4W9CA 1I42A 2LXCA 2R61A 2JU6X 3U8ZA 4RFBA 3ZGZA 2O2VB 4GDKA 3DOWA 1TZOA 2ZW1A 3C0RB 2JUOA 2BWES 3CSTA 2O6VD 5HG2A 3PHWB 1STEA 3EA6A 4N9F4 2NBUA 2FAZA 2BWFA 4HDQA 4MJSA 2BTEA 4ANVA 5D3IB 3D32A 3L17A 4MACA 5H8YE 5CHFA 2D3BA 2JRHA 4ANWA 2DZMA 2M19A 1TIFA 1R4MI 1UWXA 3T3OA 3SU8X 2K0PA 4CYEA 5TR5A 4TSSA 1AARA 1YQ4B 1DOYA 3AEFB 1PYWD 4MGYE 3ZW3A 3VTWA 1WE6A 4IOIE 2KTRB 4BZAA 3EC8A 2NVUI 4EZLA 2WXMA 5FK9C 1QQRA 2KAJA 4WJNA 5CHWA 1L2NA 1LGRA 4XGAB 2DZJA 1V1PA 4GIVA 4DHZE 1SE3A 4JWUC 4FADA 2W54A 4K81A 5IOIA 2NMQA 3BZDB 1SXTA 3SDLC 2RDGA 2K25A 2NBWB 1P98A 2M1MA 5L95C 2W9NA 2Z0DB 1F2RC 2K9XA 4PS3A 4S0RA 1I4HA 1JRPA 1LO5D 3T8MA 1FPYA 5H92C 2KVZA 1GJZA 2VH1A 5J2RA 4YWGG 3OLMD 4LTUA 1VD2A 3IVFA 2HD5B 2INNE 3AH7A 2BYTA 2JZPA 3KUZA 2N7EA 4QAYA 2QDFA 2K8CA 4N6EB 1HEZE 2WXJA 4TMAB 1WMHB 3QC8B 1E0ZA 2OJRA 4WJQA 3BY4B 3DBLI 2KLCA 1Y56A 3Q2AC 2KHWB 2L3ZA 1TKYA 2IY0B 1EWYC 4GLSC 1GPXA 1ZDXA 5IN7A 2QMTA 1V5OA 3ZXVA 2WXIA 4EKUA 4AWJA 2MP2B 4IKGA 2M8SA 3M95A 2BF8B 2D5GA 2INCC 3RNBC 2N9EB 1WYGA 2V9HA 3HM6X 4G0NB 5AZHA 2KJHB 2LMCA 2ZEQA 4K3CA 4K7UA 3JVZX 2LHEA 1VZ7A 4DDGD 2W82A 2BVCA 2JWUA 4C56C 1AWDA 2K39A 5AZGA 2JX5A 1ZXIA 2N9XA 2V4IB 3ZDMC 3RULA 4K7SA 4JWSC 1I7HA 1I4GA 1FMAD 3WCQA 2KO3A 4G11A 4JGHB 1C1YB 3DWGC 3RYTA 1FXAA 2GBKA 5EE9A 5T8IA 1SBBB 3NY5A 3ZRFA 4HDOA 4LNIA 4OHJA 4IG7B 3N9YC 3H9DA 1UWMA 4A20A 5LXHA 2MSED 4M01A 2CJOA 1DOXA 1PGXA 1VRAB 1E7PB 2L0TA 3TCAA 1KJTA 1TY2A 4MM3B 4YL8A 2KN4A 1K8RB 1WJUA 3DCGA 3DHIC 1ZXHA 3EGRA 3S2AA 1NYQA 3MC9A 3O65B 5I4DA 1PFDA 4DDID 4ITKA 4ZRIA 1L5PA 3A9JB 1DGJA 2I1KA 4ICUA 4E71A 2L1AA 2KQ4X 1IBXB 5HFYA 3X0WA 2LD9A 2BB6A 1NI3A 3AEEB 2D10A 2WLBA 3AE1B 5CHVC 1EM7A 1JALA 1YOVB 4L2YA 1GC6A 3VRAB 4EEWA 3Q8BA 1WXSA 2UU7A 1TTNA 1V49A 1H4RA 1TKEA 1WJNA 5E6OA 1YX6B 1TS3A 1IPGA 3TEZA 1T0QC 2XK5A 3EECA 4LNFA 5DPTA 1J0GA 3DBHI 3H7PA 3NVZA 2GOWA 1BUIC 4A90A 1KTKA 3K9OB 4DQOC 1P1AA 4RH6A 3ZO5B 2N1VA 4EOYA 3AE6B 4K3BA 4WAAA 4G50A 4AQ7A 3QCAA 4ZDVA 3AB5A 3CMMB 4BOSC 1WXAA 5KHOA 2WYQA 1YJJA 3ZJTA 4GSWA 2LUEA 1TKGA 2ON8A 3ZKJC 1CZPA 2J53A 3B2FA 1V5TA 4HRSA 3W5VB 2D3AA 3B1LX 5BYQA 1GG3A 3AE9B 2LI5A 1T6BX 1VDVA 1TBEA 1TT5B 1V8CA 3W9CB 5IP4D 4E74A 4N59A 3TUOA 5D2MB 1HTQA 4ARIA 1C4CA 1DYQA 4EZKA 2NPTA 5GXGB 4FULA 1MI0A 3R2TA 3A1QB 2KZRA 4BBNC 2IY1B 3BVGA 4LDTB 1F1HA 3AU5A 1QKZA 4HROA 3PLVA 2NBVB 3LJ3A 3Q3NC 4JL9A 2JPHA 1C4PA 1VZ8A 4RGMA 2QILA 3KWLA 1KLGD 3OG5A 2BQQA 2V3PA 3PZ7A 3SR6A 2LJ5A 1WZ3A 2YEPB 4ZYNA 4K7WA 5BO4B 3SFDB 1VR9A 1MHXA 3DVGY 2Z59B 5EE0A 1YN4A 2MWSB 3WA0A 2WX0A 5FR3A 2PJHA 1QF6A 4M00A 2GI9A 2D07B 1FM0D 3NVYA 4I6PA 1C3TA 1J7BA 1E6EB 3N3KB 3V3XA 1QLBB 1FNVA 2LFIA 4KDIC 4HPLB 2M0XA 2ZNVC 2JRIB 2QHOA 4WIPA 2OEDA 3GP7A 5IA7A 3APFA 3WAOA 2N9PC 4C7ZA 2IJ0A 3W1SA 3ZUNA 3VUWA 3AE4B 3GS2A 4G3XB 1NEKB 3SD5A 1WIAA 2EELA 4M8NA 1HA5A 1P3QU 4JPSA 2RPVA 3QHTA 1XXGA 3VH4B 4EZJA 2FUG1 3NUHB 2YVCA 2HJ8A 2DYBA 2MEKA 1IGDA 4IC7B 2GBNA 3IXSA
chains in the Genus database with same CATH topology
4MGYE 2ZVOA 4WJPA 1WE6A 3VTWA 3ZW3A 4BKTA 4F8CB 2KTRB 2N1WA 2K6QA 1SIFA 2MBHA 2J0JA 2NVUI 3A33B 1WGRA 3EC8A 4EZLA 3IG3A 3L54A 3ZLZA 1WJ6A 2KFJA 2KWUB 5G2NA 3EFUA 1UBIA 4WJNA 5CHWA 4URKA 1L2NA 2XK5B 2IYDB 4HVBA 3UQBA 4WWNA 2DZJA 4MSQB 4IWQA 3V6CB 3UQAA 3DPDA 3PT2B 3RCZA 4GIVA 3PZDA 4DHZE 3PS6A 4KZCA 4FADA 4HCNB 1WGYA 3H1UA 2KC1A 4DWFA 4K81A 2C7MB 5J18A 3PV1A 5D6JB 2KMAA 1WM2A 2ZVNA 2KJ6A 3N30A 3SDLC 3M63B 1TZ1A 2AL3A 2D11A 2M4NA 2A4ZA 2G45B 2CHWA 2K25A 2O2VA 2D2QA 3VDZA 2ZCBA 2NBWB 3ML9A 1P98A 2M1MA 4HXDA 3QAQA 2W9NA 4NQLB 4B6WA 3OJ3A 5L95C 1OEYJ 1WR1A 2KLGA 2Z0DB 5DPRA 2KFKB 3U30A 3QQ8B 4W9GA 4PS3A 5JHBA 2JVCA 3A4SC 4IW0A 2G3QB 2LZ6A 3B0AA 1P0RA 3VQIA 2GMIC 3TMPB 5LLIA 2L76A 4HK2A 3T8MA 1WJ4A 3HK0A 2AWTA 2AYOB 4II3B 2MBEA 3JYUA 1WFYA 2KJRA 3KUCB 5KHQA 1GJZA 5J2RA 3DVGX 4IM2A 4KIKA 3OLMD 3RD2A 4KSKC 3VTUA 2CKHB 3AU4A 3NZSA 3PRMB 1VD2A 3SHQA 4AUQC 3AXCA 3IVFA 2HD5B 4ANUA 2EKEC 2NCNA 1WY8A 1WX8A 2KNBA 3LDZE 2J0MA 1U4AA 1WRDB 2N4FA 2N7EA 3KUZA 2WDTB 4BVUC 2IZVB 1A5RA 1ZW7A 5LXIB 2KQSA 2K8CA 2V3SA 3AI5A 4IM3A 1LFDA 3B08A 1J8CA 3NS8A 2RD0A 2LXAA 4GB9A 1WGHA 4MEMA 1WE7A 1L7YA 1WMHB 2O6VB 3QC8B 2KANA 2ZPNA 3PTFC 3Q3FA 1WGDA 2BYEA 1EF1A 4RMAA 2OJRA 4WJQA 3BY4B 2C5LC 3DBLI 2KN5A 2KLCA 2VRRB 3VUYA 2PE6B 1RRBA 4J6IA 1OEYA 5DPWA 2KHWB 2L3ZA 2JZ3B 2IY0B 2Y5BB 3L0WB 1UH6A 2FUHB 4XC2A 2MX2A 3TBLD 3RZFA 3M3JA 2EMTA 2JF5A 1V5OA 4GOCA 4GU2A 4I6NB 4EKUA 4FN2A 4KDLB 5HKHA 2PPHA 4AWJA 4FBJB 2MP2B 2LVOA 4MELA 2M8SA 2L05A 2BF8B 1EO6A 3M95A 4M8MA 4W9EA 2N9EB 2JXXA 4HLEA 1E7UA 5C1ZA 3ENEA 2LASA 3RT3B 3HM6X 4G0NB 5AZHA 2KJHB 4RM9A 4DHJD 1KLVA 4MH0E 1E8XA 3ZNGC 4ASWC 2ZEQA 4K7UA 3JVZX 4KVGB 4TV3A 4ICVA 4DDGD 1P9DU 1S3SG 1X1MA 4LJOB 1T0YA 4JLCA 1KOTA 5AZGA 2K39A 3TIXA 3PGEA 2N9XA 4TQ0A 3ALBA 3TL5A 2PE9A 2D3GA 1WX7A 3ZDMC 2KFKA 4K7SA 3RULA 3T9LA 3V60A 1Z2MA 3IHPC 2DZIA 2ZPYA 5AZFA 1GC7A 1YIWA 1Q1OA 3WANA 2KO3A 2DYMA 2UWQA 4G11A 4JGHB 2KKCA 2HTHA 4PS8A 1C1YB 4FJYA 1E7VA 1V81A 1UD7A 2Z0EB 3RYTA 3APDA 1Z5SB 3H7PB 4RM8A 2GBKA 2FCQA 4ZRKA 4FHJA 3NY5A 4A3OA 1JRUA 2N7DA 1GNUA 2IBIB 3ZRFA 4HDOA 1LM8B 1CMXB 4IG7B 3VUXA 3HIZA 3WAMA 1UGMA 3H9DA 3N32A 4AOFA 3TJPA 3UF8A 4A20A 5LXHA 2MSED 4AJWA 3HHMA 1V86A 3PLUA 3M62B 1TGZB 3RZWC 3A4RA 2KMCA 2DZKA 4W9KA 2L0TA 3QJZA 2L8JA 4MGZE 2KDFB 1WMHA 2GBMA 2PEAA 2ASQA 1KJTA 4YL8A 4OVUA 1RAXA 3PVLA 4W9DA 4CO7A 1K8RB 1WJUA 3KVFB 2L0FA 4HPMB 3UINB 2JY6A 1E8YA 3DCGA 4GGQA 1WYWB 5DPSA 3S2AA 3PRZA 2MBQA 4W9IA 4P7IA 4IUMB 2KDEB 2K6DB 4PYUA 4NAWB 1XT9B 2J7QB 3QA8A 2C60A 3O65B 3JSVB 4I6LB 2YLMA 2KK8A 3NZUA 4BOZB 2L00B 4DDID 4DK5A 5E6NA 2FCNA 2K1FA 2LRWA 4LDTD 5GMVA 4ZRIA 2R2QA 3A9JB 3DQVA 2BPSA 4GDLA 1YX5B 4BKSA 1XQQA 2I1KA 2AEHA 2G4SA 4GN1A 1E8ZA 4ICUA 2NS5A 4E71A 1IYFA 2R2OA 4HJKA 2BKFA 5E6PA 2LVQA 3L08A 1WR6E 2LGXA 3X0WA 2FNJB 2LD9A 4W9JA 2WWZA 3AULA 3ZVVA 2XBBC 3Q3JA 3R3MA 4NNJB 2KWVB 4FHKA 4BBNF 2KXJA 3V6EB 2D10A 2MBBB 2NPTB 4CHKA 5JHAA 5CHVC 1Q0WB 2IO3B 4WWPA 4AJYB 4PS7A 3NHEB 1GC6A 4K1RB 4NPNA 5CTRC 4BFRA 2C7NB 3PHXB 4EEWA 4IM0A 1ZGUB 1WXSA 1EF5A 2MRPA 3P2BA 2RPQA 3DDCB 1TTNA 1UZXB 1EUVB 3VVWB 1V49A 2KTRA 5L83A 2KDIA 2RR9A 1H4RA 4XZ4A 2BGFA 2G4DB 3ZIMA 4DXAB 2V4LA 3UGBB 4GXBA 1WJNA 2KOXA 2V1YA 3QIJA 4OVVA 5E6OA 2KQ7A 4DHZB 1YX6B 1ZKHA 4GMVA 1IPGA 1V6EA 2XK5A 3EECA 1J0GA 5DPTA 5DCNA 3KUDB 3I3TB 2XEWA 1QZEA 2RGFA 3L10B 3DBHI 3H7PA 1WI0A 4KSLC 2GOWA 4TUUA 4W9LA 2CHXA 2GBRA 2IO0B 1G6JA 3K9OB 4B95A 3ZTDA 4FJZA 1SGHA 3KYDD 3BINA 2NR2A 1P1AA 3R7RA 1UBQA 3ZO5B 5D7GA 2A5UA 2N1VA 2L7RA 4EOYA 2RSUA 1OGWA 4ANXA 2K8HA 3PPAA 4WAAA 2BYVE 3L16A 4G50A 2WX1A 4BKGA 3QCAA 1NDDA 4NJ6A 4ZDVA 3W1YA 4BKSD 3ZDTA 3PREA 1VCBA 1NBFC 3HM3A 1F9JA 4BOSC 3CMMB 4MM3A 3JW0X 2DYOA 2LWPA 1WXMA 3A9KB 3R7QA 1WXAA 3VTVA 4GDKB 1LQBA 5KHOA 1MG8A 2DX5B 2WYQA 4NY0A 1Y8RC 2M17A 4W9HA 1FXTB 4GSWA 1V80A 2LUEA 1UELA 5J17A 4NAWA 1RLFA 3PRPB 3QX1A 1H8CA 1IP9A 1WX9A 2DENB 3MTNB 2CR5A 3ZKJC 3W1SC 2MQJA 3TCAA 2MA9B 3KYCD 1BT0A 2KX0A 4FLHA 5G55A 2LGYA 4B9KA 1V5TA 5AEKB 3A9JA 4EFOA 3B1LX 4HWIB 2CS4A 2DHZA 1V9JA 1GG3A 2JZZA 2LI5A 4II2B 3UIOB 1TBEA 4PYZA 3DBSA 3ZRCA 4E74A 1XD3B 2CHZA 2ZJDA 3EHVA 3H6NA 3NOBA 4MJSB 4DBGA 3QWZB 2KD0A 5D2MB 4JIOU 4TKNA 2REXA 4M0WB 3ZNZB 2KVRA 5EDSA 1HE8A 4ZRJA 1M94A 4EZKA 2FIDA 2O6VA 3L13A 2NPTA 3WIMA 2KX3A 3DBRI 4KV2A 3VAWA 4FULA 2KTFA 3PSEB 3A1QB 5CX3A 3DVNV 3UIPB 2I1JA 2KZRA 4NQKE 4BBNC 1RFAA 3ECIA 1WH3A 4AP4C 1S1QB 2IY1B 4LDTB 2LRUA 3AU5A 2JT4B 1PQSA 2C9WB 3IFWB 5IAAC 3U7DA 4FJVB 3V61A 5FR6A 4MDKE 2MBOA 1YJ1A 1J19A 3PLVA 2NBVB 3LJ3A 2OOBB 3X23A 2GBJA 4JL9A 2JPHA 2MP2A 2ZCCA 3K9PB 1OQYA 3ONSA 1GUAB 5D94A 5C23A 1V2YA 2EMSA 2LVPA 4W9FA 2LGDA 4KZ0A 2KC2A 2K8BA 1LXDA 4MSMB 1I35A 1WGGA 1WF9A 1WXVA 3MJWA 2DAFA 2IO2B 1WM3A 4WJOA 2MLBA 3VH3B 4EUTA 2MCNB 3VHTC 1YD8U 4A3PA 5JH5C 1WZ0A 2LJ5A 3ZTCA 1WZ3A 5JZEB 4ZYNA 3RUIB 4K7WA 3ZNHB 5BO4B 4W9CA 4HCPB 1I42A 3DVGY 1ISNA 2LXCA 2AL6A 2Z59B 1E90A 2KDBA 2MWSB 3U8ZA 3WA0A 2WX0A 2PJHA 3ML8A 3A9KA 2O2VB 3OJ4B 1YQBA 4F1SA 4GDKA 3DOWA 3C0RB 2CU1A 3H7SA 2D07B 4FA6A 1OTRB 4JQWC 1R4NI 4LCDE 2JUOA 2FCMA 2IO1B 3MHSD 4I6PA 2JWZA 2BYFA 3APCA 3KW5B 4X57B 1C3TA 2BWES 3N3KB 3CSTA 2O6VD 3CSFA 1D3ZA 3WAPA 2MW5A 4KDIC 4DHJB 3PHWB 3CF6E 3IBEA 1NI2A 4HPLB 3R66C 2M0XA 2DAJA 3WALA 4IWOA 3GZNI 4N9F4 4KIKB 3ZNID 2ZNVC 2JRIB 1KM7A 2QHOA 2NBUA 2FAZA 1Q5WB 2UYZB 4GDLB 2BWFA 1E8WA 4HDQA 3QK0A 4MJSA 2B3AA 5IA7A 4ANVA 3VFKA 3APFA 2KWCA 3WAOA 4NJ7A 4MGIE 3D32A 3L17A 1SE9A 2C7HA 4E3CA 5CHFA 3V62A 2N9PC 4MGKE 2JRHA 4ANWA 3W1SA 2DZMA 2FCSA 4TQ1A 2ZZPB 4XX5A 3VUWA 3ZUNA 3VXWA 4G3XB 4WWOA 3GOEA 4IWPA 3A1QA 4F7ZA 3QARA 1R4MI 3SD5A 1WIAA 2HE7A 4M8NA 2J0KA 3SU8X 1P3QU 3JSVA 3OAWA 4CYEA 3QHTA 2ZNVB 3VH4B 2BKRB 4EZJA 3KH0A 5TR5A 1AARA 2YVCA 2HJ8A 4LJPB 2DYBA 2FIFA 1E5WA 4WQOB 4IC7B 3DVNU 2GBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGY E;  2ZVO A;  4WJP A;  1WE6 A;  3VTW A;  3ZW3 A;  4BKT A;  4F8C B;  2KTR B;  2N1W A;  2K6Q A;  1SIF A;  2MBH A;  2J0J A;  2NVU I;  3A33 B;  1WGR A;  3EC8 A;  4EZL A;  3IG3 A;  3L54 A;  3ZLZ A;  1WJ6 A;  2KFJ A;  2KWU B;  5G2N A;  3EFU A;  1UBI A;  4WJN A;  5CHW A;  4URK A;  1L2N A;  2XK5 B;  2IYD B;  4HVB A;  3UQB A;  4WWN A;  2DZJ A;  4MSQ B;  4IWQ A;  3V6C B;  3UQA A;  3DPD A;  3PT2 B;  3RCZ A;  4GIV A;  3PZD A;  4DHZ E;  3PS6 A;  4KZC A;  4FAD A;  4HCN B;  1WGY A;  3H1U A;  2KC1 A;  4DWF A;  4K81 A;  2C7M B;  5J18 A;  3PV1 A;  5D6J B;  2KMA A;  1WM2 A;  2ZVN A;  2KJ6 A;  3N30 A;  3SDL C;  3M63 B;  1TZ1 A;  2AL3 A;  2D11 A;  2M4N A;  2A4Z A;  2G45 B;  2CHW A;  2K25 A;  2O2V A;  2D2Q A;  3VDZ A;  2ZCB A;  2NBW B;  3ML9 A;  1P98 A;  2M1M A;  4HXD A;  3QAQ A;  2W9N A;  4NQL B;  4B6W A;  3OJ3 A;  5L95 C;  1OEY J;  1WR1 A;  2KLG A;  2Z0D B;  5DPR A;  2KFK B;  3U30 A;  3QQ8 B;  4W9G A;  4PS3 A;  5JHB A;  2JVC A;  3A4S C;  4IW0 A;  2G3Q B;  2LZ6 A;  3B0A A;  1P0R A;  3VQI A;  2GMI C;  3TMP B;  5LLI A;  2L76 A;  4HK2 A;  3T8M A;  1WJ4 A;  3HK0 A;  2AWT A;  2AYO B;  4II3 B;  2MBE A;  3JYU A;  1WFY A;  2KJR A;  3KUC B;  5KHQ A;  1GJZ A;  5J2R A;  3DVG X;  4IM2 A;  4KIK A;  3OLM D;  3RD2 A;  4KSK C;  3VTU A;  2CKH B;  3AU4 A;  3NZS A;  3PRM B;  1VD2 A;  3SHQ A;  4AUQ C;  3AXC A;  3IVF A;  2HD5 B;  4ANU A;  2EKE C;  2NCN A;  1WY8 A;  1WX8 A;  2KNB A;  3LDZ E;  2J0M A;  1U4A A;  1WRD B;  2N4F A;  2N7E A;  3KUZ A;  2WDT B;  4BVU C;  2IZV B;  1A5R A;  1ZW7 A;  5LXI B;  2KQS A;  2K8C A;  2V3S A;  3AI5 A;  4IM3 A;  1LFD A;  3B08 A;  1J8C A;  3NS8 A;  2RD0 A;  2LXA A;  4GB9 A;  1WGH A;  4MEM A;  1WE7 A;  1L7Y A;  1WMH B;  2O6V B;  3QC8 B;  2KAN A;  2ZPN A;  3PTF C;  3Q3F A;  1WGD A;  2BYE A;  1EF1 A;  4RMA A;  2OJR A;  4WJQ A;  3BY4 B;  2C5L C;  3DBL I;  2KN5 A;  2KLC A;  2VRR B;  3VUY A;  2PE6 B;  1RRB A;  4J6I A;  1OEY A;  5DPW A;  2KHW B;  2L3Z A;  2JZ3 B;  2IY0 B;  2Y5B B;  3L0W B;  1UH6 A;  2FUH B;  4XC2 A;  2MX2 A;  3TBL D;  3RZF A;  3M3J A;  2EMT A;  2JF5 A;  1V5O A;  4GOC A;  4GU2 A;  4I6N B;  4EKU A;  4FN2 A;  4KDL B;  5HKH A;  2PPH A;  4AWJ A;  4FBJ B;  2MP2 B;  2LVO A;  4MEL A;  2M8S A;  2L05 A;  2BF8 B;  1EO6 A;  3M95 A;  4M8M A;  4W9E A;  2N9E B;  2JXX A;  4HLE A;  1E7U A;  5C1Z A;  3ENE A;  2LAS A;  3RT3 B;  3HM6 X;  4G0N B;  5AZH A;  2KJH B;  4RM9 A;  4DHJ D;  1KLV A;  4MH0 E;  1E8X A;  3ZNG C;  4ASW C;  2ZEQ A;  4K7U A;  3JVZ X;  4KVG B;  4TV3 A;  4ICV A;  4DDG D;  1P9D U;  1S3S G;  1X1M A;  4LJO B;  1T0Y A;  4JLC A;  1KOT A;  5AZG A;  2K39 A;  3TIX A;  3PGE A;  2N9X A;  4TQ0 A;  3ALB A;  3TL5 A;  2PE9 A;  2D3G A;  1WX7 A;  3ZDM C;  2KFK A;  4K7S A;  3RUL A;  3T9L A;  3V60 A;  1Z2M A;  3IHP C;  2DZI A;  2ZPY A;  5AZF A;  1GC7 A;  1YIW A;  1Q1O A;  3WAN A;  2KO3 A;  2DYM A;  2UWQ A;  4G11 A;  4JGH B;  2KKC A;  2HTH A;  4PS8 A;  1C1Y B;  4FJY A;  1E7V A;  1V81 A;  1UD7 A;  2Z0E B;  3RYT A;  3APD A;  1Z5S B;  3H7P B;  4RM8 A;  2GBK A;  2FCQ A;  4ZRK A;  4FHJ A;  3NY5 A;  4A3O A;  1JRU A;  2N7D A;  1GNU A;  2IBI B;  3ZRF A;  4HDO A;  1LM8 B;  1CMX B;  4IG7 B;  3VUX A;  3HIZ A;  3WAM A;  1UGM A;  3H9D A;  3N32 A;  4AOF A;  3TJP A;  3UF8 A;  4A20 A;  5LXH A;  2MSE D;  4AJW A;  3HHM A;  1V86 A;  3PLU A;  3M62 B;  1TGZ B;  3RZW C;  3A4R A;  2KMC A;  2DZK A;  4W9K A;  2L0T A;  3QJZ A;  2L8J A;  4MGZ E;  2KDF B;  1WMH A;  2GBM A;  2PEA A;  2ASQ A;  1KJT A;  4YL8 A;  4OVU A;  1RAX A;  3PVL A;  4W9D A;  4CO7 A;  1K8R B;  1WJU A;  3KVF B;  2L0F A;  4HPM B;  3UIN B;  2JY6 A;  1E8Y A;  3DCG A;  4GGQ A;  1WYW B;  5DPS A;  3S2A A;  3PRZ A;  2MBQ A;  4W9I A;  4P7I A;  4IUM B;  2KDE B;  2K6D B;  4PYU A;  4NAW B;  1XT9 B;  2J7Q B;  3QA8 A;  2C60 A;  3O65 B;  3JSV B;  4I6L B;  2YLM A;  2KK8 A;  3NZU A;  4BOZ B;  2L00 B;  4DDI D;  4DK5 A;  5E6N A;  2FCN A;  2K1F A;  2LRW A;  4LDT D;  5GMV A;  4ZRI A;  2R2Q A;  3A9J B;  3DQV A;  2BPS A;  4GDL A;  1YX5 B;  4BKS A;  1XQQ A;  2I1K A;  2AEH A;  2G4S A;  4GN1 A;  1E8Z A;  4ICU A;  2NS5 A;  4E71 A;  1IYF A;  2R2O A;  4HJK A;  2BKF A;  5E6P A;  2LVQ A;  3L08 A;  1WR6 E;  2LGX A;  3X0W A;  2FNJ B;  2LD9 A;  4W9J A;  2WWZ A;  3AUL A;  3ZVV A;  2XBB C;  3Q3J A;  3R3M A;  4NNJ B;  2KWV B;  4FHK A;  4BBN F;  2KXJ A;  3V6E B;  2D10 A;  2MBB B;  2NPT B;  4CHK A;  5JHA A;  5CHV C;  1Q0W B;  2IO3 B;  4WWP A;  4AJY B;  4PS7 A;  3NHE B;  1GC6 A;  4K1R B;  4NPN A;  5CTR C;  4BFR A;  2C7N B;  3PHX B;  4EEW A;  4IM0 A;  1ZGU B;  1WXS A;  1EF5 A;  2MRP A;  3P2B A;  2RPQ A;  3DDC B;  1TTN A;  1UZX B;  1EUV B;  3VVW B;  1V49 A;  2KTR A;  5L83 A;  2KDI A;  2RR9 A;  1H4R A;  4XZ4 A;  2BGF A;  2G4D B;  3ZIM A;  4DXA B;  2V4L A;  3UGB B;  4GXB A;  1WJN A;  2KOX A;  2V1Y A;  3QIJ A;  4OVV A;  5E6O A;  2KQ7 A;  4DHZ B;  1YX6 B;  1ZKH A;  4GMV A;  1IPG A;  1V6E A;  2XK5 A;  3EEC A;  1J0G A;  5DPT A;  5DCN A;  3KUD B;  3I3T B;  2XEW A;  1QZE A;  2RGF A;  3L10 B;  3DBH I;  3H7P A;  1WI0 A;  4KSL C;  2GOW A;  4TUU A;  4W9L A;  2CHX A;  2GBR A;  2IO0 B;  1G6J A;  3K9O B;  4B95 A;  3ZTD A;  4FJZ A;  1SGH A;  3KYD D;  3BIN A;  2NR2 A;  1P1A A;  3R7R A;  1UBQ A;  3ZO5 B;  5D7G A;  2A5U A;  2N1V A;  2L7R A;  4EOY A;  2RSU A;  1OGW A;  4ANX A;  2K8H A;  3PPA A;  4WAA A;  2BYV E;  3L16 A;  4G50 A;  2WX1 A;  4BKG A;  3QCA A;  1NDD A;  4NJ6 A;  4ZDV A;  3W1Y A;  4BKS D;  3ZDT A;  3PRE A;  1VCB A;  1NBF C;  3HM3 A;  1F9J A;  4BOS C;  3CMM B;  4MM3 A;  3JW0 X;  2DYO A;  2LWP A;  1WXM A;  3A9K B;  3R7Q A;  1WXA A;  3VTV A;  4GDK B;  1LQB A;  5KHO A;  1MG8 A;  2DX5 B;  2WYQ A;  4NY0 A;  1Y8R C;  2M17 A;  4W9H A;  1FXT B;  4GSW A;  1V80 A;  2LUE A;  1UEL A;  5J17 A;  4NAW A;  1RLF A;  3PRP B;  3QX1 A;  1H8C A;  1IP9 A;  1WX9 A;  2DEN B;  3MTN B;  2CR5 A;  3ZKJ C;  3W1S C;  2MQJ A;  3TCA A;  2MA9 B;  3KYC D;  1BT0 A;  2KX0 A;  4FLH A;  5G55 A;  2LGY A;  4B9K A;  1V5T A;  5AEK B;  3A9J A;  4EFO A;  3B1L X;  4HWI B;  2CS4 A;  2DHZ A;  1V9J A;  1GG3 A;  2JZZ A;  2LI5 A;  4II2 B;  3UIO B;  1TBE A;  4PYZ A;  3DBS A;  3ZRC A;  4E74 A;  1XD3 B;  2CHZ A;  2ZJD A;  3EHV A;  3H6N A;  3NOB A;  4MJS B;  4DBG A;  3QWZ B;  2KD0 A;  5D2M B;  4JIO U;  4TKN A;  2REX A;  4M0W B;  3ZNZ B;  2KVR A;  5EDS A;  1HE8 A;  4ZRJ A;  1M94 A;  4EZK A;  2FID A;  2O6V A;  3L13 A;  2NPT A;  3WIM A;  2KX3 A;  3DBR I;  4KV2 A;  3VAW A;  4FUL A;  2KTF A;  3PSE B;  3A1Q B;  5CX3 A;  3DVN V;  3UIP B;  2I1J A;  2KZR A;  4NQK E;  4BBN C;  1RFA A;  3ECI A;  1WH3 A;  4AP4 C;  1S1Q B;  2IY1 B;  4LDT B;  2LRU A;  3AU5 A;  2JT4 B;  1PQS A;  2C9W B;  3IFW B;  5IAA C;  3U7D A;  4FJV B;  3V61 A;  5FR6 A;  4MDK E;  2MBO A;  1YJ1 A;  1J19 A;  3PLV A;  2NBV B;  3LJ3 A;  2OOB B;  3X23 A;  2GBJ A;  4JL9 A;  2JPH A;  2MP2 A;  2ZCC A;  3K9P B;  1OQY A;  3ONS A;  1GUA B;  5D94 A;  5C23 A;  1V2Y A;  2EMS A;  2LVP A;  4W9F A;  2LGD A;  4KZ0 A;  2KC2 A;  2K8B A;  1LXD A;  4MSM B;  1I35 A;  1WGG A;  1WF9 A;  1WXV A;  3MJW A;  2DAF A;  2IO2 B;  1WM3 A;  4WJO A;  2MLB A;  3VH3 B;  4EUT A;  2MCN B;  3VHT C;  1YD8 U;  4A3P A;  5JH5 C;  1WZ0 A;  2LJ5 A;  3ZTC A;  1WZ3 A;  5JZE B;  4ZYN A;  3RUI B;  4K7W A;  3ZNH B;  5BO4 B;  4W9C A;  4HCP B;  1I42 A;  3DVG Y;  1ISN A;  2LXC A;  2AL6 A;  2Z59 B;  1E90 A;  2KDB A;  2MWS B;  3U8Z A;  3WA0 A;  2WX0 A;  2PJH A;  3ML8 A;  3A9K A;  2O2V B;  3OJ4 B;  1YQB A;  4F1S A;  4GDK A;  3DOW A;  3C0R B;  2CU1 A;  3H7S A;  2D07 B;  4FA6 A;  1OTR B;  4JQW C;  1R4N I;  4LCD E;  2JUO A;  2FCM A;  2IO1 B;  3MHS D;  4I6P A;  2JWZ A;  2BYF A;  3APC A;  3KW5 B;  4X57 B;  1C3T A;  2BWE S;  3N3K B;  3CST A;  2O6V D;  3CSF A;  1D3Z A;  3WAP A;  2MW5 A;  4KDI C;  4DHJ B;  3PHW B;  3CF6 E;  3IBE A;  1NI2 A;  4HPL B;  3R66 C;  2M0X A;  2DAJ A;  3WAL A;  4IWO A;  3GZN I;  4N9F 4;  4KIK B;  3ZNI D;  2ZNV C;  2JRI B;  1KM7 A;  2QHO A;  2NBU A;  2FAZ A;  1Q5W B;  2UYZ B;  4GDL B;  2BWF A;  1E8W A;  4HDQ A;  3QK0 A;  4MJS A;  2B3A A;  5IA7 A;  4ANV A;  3VFK A;  3APF A;  2KWC A;  3WAO A;  4NJ7 A;  4MGI E;  3D32 A;  3L17 A;  1SE9 A;  2C7H A;  4E3C A;  5CHF A;  3V62 A;  2N9P C;  4MGK E;  2JRH A;  4ANW A;  3W1S A;  2DZM A;  2FCS A;  4TQ1 A;  2ZZP B;  4XX5 A;  3VUW A;  3ZUN A;  3VXW A;  4G3X B;  4WWO A;  3GOE A;  4IWP A;  3A1Q A;  4F7Z A;  3QAR A;  1R4M I;  3SD5 A;  1WIA A;  2HE7 A;  4M8N A;  2J0K A;  3SU8 X;  1P3Q U;  3JSV A;  3OAW A;  4CYE A;  3QHT A;  2ZNV B;  3VH4 B;  2BKR B;  4EZJ A;  3KH0 A;  5TR5 A;  1AAR A;  2YVC A;  2HJ8 A;  4LJP B;  2DYB A;  2FIF A;  1E5W A;  4WQO B;  4IC7 B;  3DVN U;  2GBN A; 
#chains in the Genus database with same CATH topology
 4BKT A;  1F77 A;  2K6Q A;  1SIF A;  2PW9 A;  3A33 B;  3R8B A;  4OZB A;  2FE8 A;  4XDC A;  5MPO A;  1WJ6 A;  3ABV B;  1T0S C;  2KFJ A;  2KWU B;  4WWN A;  3UQA A;  3Q8E A;  3PZD A;  3B2G A;  2HDE A;  4P16 A;  3AM9 A;  1WGY A;  3H1U A;  2C7M B;  5J18 A;  1SJE D;  3MHZ A;  4XE0 A;  2KMA A;  2KJ6 A;  3BII D;  3M63 B;  2O2V A;  4B0E A;  3VDZ A;  2D3C A;  2ZCB A;  3Q6B A;  2J42 A;  2Z8L A;  4LNK A;  4USA A;  4NQL B;  4B6W A;  5DPR A;  4W9G A;  1ZDV A;  1TS2 A;  2LZ6 A;  3R2I A;  2GMI C;  2WS3 B;  1YN5 A;  3KUC B;  4BAX A;  2K3U A;  3VTU A;  3ETR A;  2CKH B;  2QJL A;  2ONQ A;  3PRM B;  4AUQ C;  4UDU C;  1N5W A;  4RGT A;  2KNB A;  2J0M A;  1WRD B;  2IZV B;  2PLP A;  1XLP A;  3AI5 A;  3NS8 A;  4GB9 A;  4MEM A;  1L7Y A;  3BK1 A;  3O13 A;  2BYE A;  1EF1 A;  4OZA A;  2C5L C;  1RRB A;  3GE3 C;  1JRO A;  1OEY A;  5DPW A;  2WXQ A;  4YSX B;  2IND C;  4RGN A;  4HPP A;  2LJI A;  2Y5B B;  1J7C A;  3L0W B;  1QIL A;  2MX2 A;  3HVZ A;  1SB3 C;  5FKA C;  2EMT A;  4GOC A;  4GU2 A;  4FN2 A;  3UI3 A;  2LVO A;  4MEL A;  4M8M A;  4W9E A;  2JXX A;  2XNA C;  1E7U A;  3SEB A;  3RFZ B;  3AE5 B;  4LLG M;  2LAS A;  1E10 A;  3I63 C;  1T0R C;  1KLV A;  4MH0 E;  1L4Z B;  1JWA D;  3N1Z C;  4KKJ A;  4P1B C;  5D3D A;  2WXP A;  1KH0 A;  3NZ3 A;  2G1E A;  1T0Y A;  1CJE A;  1VJK A;  1YN3 A;  4YSZ B;  3T9L A;  3V60 A;  3KWV A;  3RNC C;  3IHP C;  2KMM A;  2CJN A;  5AZF A;  1Q1O A;  2IGH A;  2KKC A;  4FJY A;  1V81 A;  1UD7 A;  2Z0E B;  1VZ6 A;  2G9H D;  1Z5S B;  2H89 B;  4ZRK A;  1JW9 D;  3BK2 A;  4A3O A;  2N7D A;  1GNU A;  2IBI B;  2Y5P A;  1M4V A;  1XLQ A;  3NJT A;  3VUX A;  3HIZ A;  3N32 A;  2KYW A;  3HHM A;  1V86 A;  4HEA 1;  3FIL B;  1C76 A;  1FIQ A;  2L8J A;  1WMH A;  2GBM A;  2PEA A;  2ASQ A;  5C2T B;  3VR9 B;  4W9D A;  3PVL A;  2CU3 A;  1E8Y A;  5DPS A;  3PRZ A;  4C7Y A;  4P7I A;  4NAW B;  3W2D A;  3NZU A;  1GB1 A;  4DK5 A;  4Q2J A;  4LDT D;  2BB5 A;  1FRR A;  2BPS A;  4GDL A;  4BKS A;  2OJW A;  5JXV A;  3P42 A;  2NS5 A;  3Q8A A;  3W5U B;  2LVQ A;  1SEB D;  1WR6 E;  4AS1 A;  2LGX A;  1KFY B;  4C4V B;  2FNJ B;  4W9J A;  2WWZ A;  3P4R B;  3R3M A;  3NVV A;  1NVI D;  4RF0 A;  2MBB B;  3EFC A;  3E9S A;  4WWP A;  4PS7 A;  3NHE B;  3AE2 B;  4K1R B;  4NPN A;  2YEP F;  1JWU D;  4BFR A;  3J9C A;  1HXY D;  4ACF A;  4IM0 A;  1ZGU B;  2RR9 A;  1XLO A;  4CQN A;  3UGB B;  1SE2 A;  4GXB A;  2KOX A;  2QSD A;  5EE3 A;  1ZKH A;  3Q8C A;  4KGS A;  1V6E A;  2W55 A;  3RNE C;  3I3T B;  2RGF A;  3L10 B;  2W3S A;  2QEJ C;  2M0A A;  4KSL C;  4W9L A;  2CHX A;  4FJZ A;  4OVZ A;  3Q3M C;  1K50 A;  4P1C C;  2WQY B;  2A5U A;  2L7R A;  1MHH E;  4ANX A;  1UUP A;  2BYV E;  3L16 A;  2GRI A;  2AQ3 B;  4BKG A;  1KLU D;  3PRE A;  1NBF C;  3HM3 A;  3N20 C;  2Q5W D;  4MM3 A;  3A9K B;  3R7Q A;  3I5J C;  1ZOY B;  3VTV A;  1LQB A;  1C9F A;  2DX5 B;  2M17 A;  1UEL A;  3QX1 A;  3T3N A;  2CR5 A;  3AMZ A;  1PDX A;  1V1O A;  2LGY A;  1XCQ L;  3A9J A;  4EFO A;  1YQ3 B;  1P7E A;  3AE8 B;  4HWI B;  4II2 B;  5C3J B;  4RCO A;  1MFW A;  3U2S C;  3DBS A;  1RM6 C;  2ZJD A;  3EHV A;  2VH2 A;  1IBX A;  3QWZ B;  4JIO U;  4TKN A;  1T5X D;  4M0W B;  2NTT A;  5EDS A;  1HE8 A;  3DBR B;  1NEN B;  4YTP B;  2O6V A;  4DXG A;  3L13 A;  3VAW A;  2KTF A;  3PSE B;  1FEH A;  4ZHP A;  2LUM A;  3UIP B;  4NQK E;  4AP4 C;  1S1Q B;  2LRU A;  1ET9 A;  4A8X C;  1PQS A;  2C9W B;  2QC8 A;  4FJV B;  3V61 A;  1GB4 A;  2MBO A;  1K53 A;  3X23 A;  3ONS A;  1V2Y A;  2EMS A;  4XWT A;  2LVP A;  2LGD A;  4KZ0 A;  2X38 A;  1LXD A;  1ET6 A;  1WGG A;  1WF9 A;  1L4D B;  2M56 B;  3MJW A;  2IO2 B;  4WJO A;  4EUT A;  3VHT C;  1YD8 U;  1WZ0 A;  1NYR A;  3RUI B;  1YJI A;  4HCP B;  3U4E G;  2VZK B;  2KDB A;  3NRZ A;  1HTO A;  3ML8 A;  3OJ4 B;  4F1S A;  2N9K A;  1R4N B;  5HHD G;  4IDI A;  4FA6 A;  1OTR B;  4JQW C;  3U7Z A;  2FCM A;  2IO1 B;  2BYF A;  3APC A;  3KW5 B;  3AE3 B;  3CSF A;  2LEK A;  4NJC A;  3WAP A;  2MW5 A;  3GZN B;  2W3R A;  3IBE A;  1NI2 A;  1ESF A;  4KIK B;  2MJD A;  3P4P B;  1RWS A;  3MP9 A;  1F0Z A;  2IGD A;  1QOF A;  1SE9 A;  2C7H A;  1J7A A;  3V62 A;  4MGK E;  4D2K A;  1MPE A;  4XX5 A;  4TQ1 A;  2ZZP B;  3VXW A;  4WWO A;  4IWP A;  3A1Q A;  3QAR A;  1MG4 A;  1R7S A;  2I38 A;  3JSV A;  1D5X C;  1UF0 A;  1KRH A;  2ZNV B;  4WQO B;  1E5W A;  4KKI A;  3BWU D;  2KWD A;  1GAQ B;  2J0J A;  1JCK B;  4WH4 A;  3C8Y A;  1TYG B;  1P7F A;  3DHH C;  3IAS 1;  1UBI A;  4URK A;  2XK5 B;  2IYD B;  4MSQ B;  1L0Y B;  2K5P A;  3V6C B;  3DPD A;  2Y3A A;  5EE1 A;  2INP E;  3PZ8 A;  1AYF A;  3AEA B;  4HCN B;  1HZ5 A;  3PV1 A;  3EUB 2;  1YNT E;  3E56 A;  4RNA A;  1TZ1 A;  2AL3 A;  2M4N A;  2WDQ B;  2G45 B;  2EKI A;  1XO3 A;  4HXD A;  3QAQ A;  1QOB A;  1WR1 A;  2KLG A;  3AE7 B;  5BMH A;  2KFK B;  3U30 A;  3QQ8 B;  5JHB A;  4IW0 A;  3B0A A;  3VQI A;  1SIJ A;  2K22 A;  3HK0 A;  2AWT A;  2AYO B;  3VRB B;  5E6J A;  2MBE A;  3JYU A;  1WFY A;  5KHQ A;  1L0X B;  2LHD A;  1OQR A;  4KSK C;  2WHI A;  3AU4 A;  4ANU A;  1C78 A;  2EKE C;  2NCN A;  1WX8 A;  1FRD A;  1U4A A;  1JWM D;  2WDT B;  3MC8 A;  1A5R A;  3BVZ A;  4RF1 A;  5LXI B;  4HJG E;  1LFD A;  3B08 A;  2HJ1 A;  1F2R I;  4MH8 A;  1WGH A;  1JQ4 A;  2KAN A;  2ZPN A;  3PTF C;  4RMA A;  2KN5 A;  4J6I A;  4ARC A;  5IKC M;  1WSP A;  2JZ3 B;  1C79 A;  2BBC A;  1UH6 A;  2FUH B;  2L52 A;  4XC2 A;  1ZPS A;  3M3J A;  4YT0 B;  4I6N B;  1A70 A;  2WXH A;  4KDL B;  3LYY A;  4EE2 A;  2PPH A;  1AN8 A;  4FBJ B;  4PK1 A;  1EO6 A;  4A55 A;  2N9L A;  4HLE A;  3RNG C;  5C1Z A;  1GOZ A;  1SSN A;  4RM9 A;  4DHJ D;  3U52 E;  1E8X A;  1FCC C;  3ZNG C;  5IO9 A;  1IUE A;  4JLC A;  1MJD A;  1KOT A;  4TQ0 A;  3ALB A;  3TL5 A;  1WX7 A;  3TEW A;  1IGC A;  1Z2M A;  3KLS X;  1I4P A;  1TS5 A;  2ZPY A;  1BML C;  1YIW A;  2N7J A;  1PUT A;  2DYM A;  1MVK A;  2UWQ A;  4YXD B;  1E7V A;  4YTM B;  2FCQ A;  4WAF A;  1D5Z C;  1SF0 A;  2IGG A;  1JRU A;  1FO4 A;  1LM8 B;  1UGM A;  3TJP A;  3TEX A;  3UF8 A;  4AJW A;  2JYT A;  3M62 B;  1RYJ A;  3A4R A;  4W9K A;  3P1M A;  3QJZ A;  4OVU A;  1RAX A;  4CO7 A;  3UIN B;  3KVF B;  2L0F A;  4GGQ A;  5BYS A;  2MBQ A;  4W9I A;  3RMK C;  4IUM B;  4PYU A;  1XT9 B;  2J7Q B;  2C60 A;  2MJE A;  4I6L B;  4BOZ B;  3ZJV A;  2LRW A;  5GMV A;  1YX5 B;  1SJH D;  1XQQ A;  4YTN B;  2G4S A;  4GN1 A;  4C80 A;  3AEB B;  3Q14 C;  2R2O A;  2IDY A;  5E6P A;  2ZW0 A;  2I2Y A;  2Y5C A;  2E6X A;  1TY0 A;  3AUL A;  3ZVV A;  3Q3J A;  4NNJ B;  2KWV B;  4BBN F;  3P63 A;  3C19 A;  1QOG A;  4CHK A;  5JHA A;  4KX6 B;  2IO3 B;  1FNW A;  4L1B A;  1Q10 A;  3GE8 C;  5CTR C;  3CWI A;  1OQQ A;  1V97 A;  3PHX B;  1L6U A;  2MRP A;  4US8 A;  2JQR B;  2RPQ A;  2KTR A;  2VZK D;  4XZ4 A;  2G4D B;  3QIJ A;  4DHZ B;  2KQ7 A;  3I9V 1;  3KUD B;  3SFE B;  3Q69 A;  3AN1 A;  2IO0 B;  3ZYY X;  1G6J A;  3ZTD A;  1B9R A;  4JE3 B;  1SGH A;  3KYD D;  1OGW A;  4MT5 A;  2DWQ A;  4M02 A;  3MFG A;  3FIL A;  1NDD A;  4NJ6 A;  2WXO A;  3ZDT A;  1VCB A;  2KAC A;  2DYO A;  2AQ1 B;  2LWP A;  1WXM A;  4GDK B;  1MG8 A;  4HKZ E;  1FXT B;  1N63 A;  1PGB A;  2FBW B;  1V80 A;  2ICI A;  4LNN A;  5J17 A;  4NAW A;  1H8C A;  5HI1 A;  2DEN B;  3W1S C;  2MQJ A;  2MA9 B;  3KYC D;  1BT0 A;  2KX0 A;  5G55 A;  3HUI A;  1KF6 B;  5AEK B;  1XLN A;  2CS4 A;  2DHZ A;  3UIO B;  1BXT A;  3MC0 B;  4REZ A;  3ZRC A;  4WQM A;  2J4X A;  4NAM A;  2CHZ A;  3H6N A;  2WU2 B;  4DBG A;  3NOB A;  4MJS B;  4C4V A;  4R3D A;  4ZRP A;  2REX A;  4PT5 A;  4ZRJ A;  2FID A;  4KGR A;  3WIM A;  2KX3 A;  3DBR I;  5AUK A;  4XWW A;  3DVN V;  2I1J A;  2WDR B;  1RFA A;  3ECI A;  5BMI A;  2L83 A;  2J52 A;  2RDH A;  3OWE B;  2JT4 B;  2BW2 A;  3IFW B;  4DXF A;  3U7D A;  1CK1 A;  5FR6 A;  4MDK E;  1YJ1 A;  1J19 A;  2AX5 A;  2GBJ A;  1I4X A;  2MP2 A;  3K9P B;  1OQY A;  1F52 A;  3BVM A;  1GUA B;  1JWB D;  2L32 A;  3LXF A;  5D94 A;  1L6V A;  3AEC B;  3P4Q B;  1K52 A;  2KC2 A;  4MSM B;  3V05 A;  1I35 A;  1WXV A;  2E3T A;  1I4Q A;  2DAF A;  1WM3 A;  3VH3 B;  2MLB A;  2SAK A;  4A3P A;  1V1P B;  5JH5 C;  3NS1 A;  3ZTC A;  5JZE B;  2BS2 B;  3ZQ4 A;  4OW0 A;  4L23 A;  3URY A;  3ZNH B;  1N61 A;  1ISN A;  2AL6 A;  1E90 A;  3RI7 C;  2IPK D;  1FFV A;  3A9K A;  1YQB A;  2WXG A;  3ZJU A;  1N5X A;  3H7S A;  2CU1 A;  1R4N I;  4LCD E;  3MHS D;  2JWZ A;  4X57 B;  2AQ2 B;  1D3Z A;  1XF5 L;  2KT7 A;  4DHJ B;  3CF6 E;  4ZYS A;  3R66 C;  5TSS A;  1EU4 A;  2DAJ A;  3WAL A;  2ACZ B;  4IWO A;  4XDD A;  3GZN I;  3ZNI D;  1KM7 A;  1Q5W B;  2UYZ B;  3FC4 A;  4GDL B;  1UGJ A;  1E8W A;  3QK0 A;  2B3A A;  2PVG C;  1WWT A;  3VFK A;  2KWC A;  2WXL A;  4NJ7 A;  4M0W A;  4MGI E;  4LNO A;  4E3C A;  3PO0 A;  2FCS A;  1R4M B;  4US9 A;  3Q8F A;  3GOE A;  2WNM A;  1HZ6 A;  4F7Z A;  1QT9 A;  1DOI A;  2HE7 A;  2J0K A;  3OAW A;  2BKR B;  3CIR B;  3KH0 A;  4LJP B;  2FIF A;  1I4R A;  2RMM A;  2JSV X;  1RFK A;  3DVN U;  1ZE3 D;  2KDM A;  2ZVO A;  4WJP A;  4F8C B;  1CQV A;  2N1W A;  1ZP0 B;  2MBH A;  1WGR A;  3IG3 A;  3L54 A;  3ZLZ A;  5G2N A;  3AED B;  3EFU A;  4HVB A;  1ROE A;  3UQB A;  4IWQ A;  3PT2 B;  3RCZ A;  2B76 B;  3PS6 A;  4KZC A;  3ZXR A;  2QIE B;  2H88 B;  5G5G A;  2KC1 A;  4DWF A;  5D6J B;  4B0M A;  1D4B A;  1FXI A;  1WM2 A;  2ZVN A;  1E9M A;  2LGI A;  3N30 A;  2D11 A;  2A4Z A;  2CHW A;  2D2Q A;  3ML9 A;  3OJ3 A;  1OEY J;  5G5H A;  1TJE A;  3N1X C;  2JVC A;  3A4S C;  2G3Q B;  3HRD D;  1P0R A;  1EWC A;  3TMP B;  5LNK 1;  5LLI A;  2L76 A;  4HK2 A;  1WJ4 A;  4II3 B;  2KJR A;  3DVG X;  4IM2 A;  4KIK A;  5BYR A;  2WP9 B;  1UNS A;  3RD2 A;  1FNU A;  2NTS A;  3NZS A;  3SHQ A;  3AXC A;  3IAM 1;  1WY8 A;  3LDZ E;  2N4F A;  4BVU C;  3L4P A;  1ZW7 A;  2KQS A;  2V3S A;  4IM3 A;  1J8C A;  2RD0 A;  2LXA A;  3DBL B;  1AW7 A;  1WE7 A;  2O6V B;  3Q3F A;  1WGD A;  2GLS A;  2LGS A;  3NVW A;  1C4A A;  1WXQ A;  2VRR B;  3VUY A;  1C77 A;  2PE6 B;  3FKY A;  3TBL D;  1ENF A;  3RZF A;  2JF5 A;  1EU3 A;  4ZRQ A;  1QOA A;  3HVD A;  5HKH A;  2OHF A;  2L05 A;  2WXR A;  3MJ5 A;  2QCZ A;  4YSY B;  1SE4 A;  2PIA A;  3ENE A;  3RT3 B;  3IT4 B;  4ASW C;  1WRI A;  1WGK A;  2MH7 A;  3BYY B;  4KVG B;  4A9A A;  4FXC A;  1D5M C;  4TV3 A;  1N60 A;  4ICV A;  1P9D U;  1S3S G;  1X1M A;  4LJO B;  4ZOH C;  1K51 A;  1ACC A;  3TIX A;  3DHG C;  3PGE A;  1TS4 A;  2X8X X;  2PE9 A;  2D3G A;  2KFK A;  2DZI A;  3RNA C;  1GC7 A;  3WAN A;  2XN9 C;  2RDB C;  2SEB D;  4PS8 A;  2HTH A;  3APD A;  3H7P B;  4RM8 A;  3AEG B;  4FHJ A;  2JYE A;  1CMX B;  3WAM A;  3RPF C;  4AOF A;  2WXN A;  1D6E C;  2PVO D;  2WDV B;  3PLU A;  1TGZ B;  3RZW C;  2V3N A;  2KMC A;  2DZK A;  3IT6 B;  3RNF C;  4O1N A;  4MGZ E;  2KDF B;  3P4S B;  3TEY A;  4HPM B;  2JY6 A;  1WYW B;  3BYT B;  1JWS D;  2WGS A;  1N62 A;  2BS3 B;  2K6D B;  2KDE B;  3QA8 A;  3JSV B;  4RGO S;  4XYC A;  5BMG A;  2YLM A;  2JXT A;  2KK8 A;  2L00 B;  5E6N A;  2FCN A;  2K1F A;  1OFF A;  2R2Q A;  3DQV A;  2V0G A;  1HQR D;  1FCL A;  3TSS A;  2AEH A;  1E8Z A;  3RN9 C;  1VLB A;  1IYF A;  4HJK A;  2BKF A;  3L08 A;  2DBY A;  2XBB C;  3NG0 A;  4FHK A;  2PKO A;  1ZUD 2;  4P6V F;  2KXJ A;  3V6E B;  2N0S B;  2NPT B;  1Q0W B;  3AV8 A;  4AJY B;  2HTM E;  2C7N B;  1EF5 A;  3KQ4 A;  1B1Z A;  3P2B A;  3DDC B;  1PGA A;  1UZX B;  1EUV B;  3VVW B;  5L83 A;  2KDI A;  2BGF A;  3ZIM A;  4DXA B;  3GB1 A;  2V4L A;  4OZC A;  3B9J A;  1FFU A;  4N58 A;  2V1Y A;  4OVV A;  3DBH B;  4GMV A;  3VR8 B;  3DWM A;  5DCN A;  2XEW A;  1QZE A;  1WI0 A;  2DLB A;  2PMV A;  4TUU A;  2GBR A;  1XEE A;  4B95 A;  1YMH E;  3H8H A;  3BIN A;  2NR2 A;  3R7R A;  1UBQ A;  3LB8 C;  5D7G A;  2RSU A;  1FD6 A;  1XCT L;  2K8H A;  3PPA A;  3I57 A;  2WX1 A;  3W1Y A;  4BKS D;  1F9J A;  4JX1 C;  3JW0 X;  2GB1 A;  2MJ3 A;  4NY0 A;  1Y8R C;  4W9H A;  1RLF A;  3PRP B;  1IP9 A;  1WX9 A;  3MTN B;  3Q3O C;  4FLH A;  4B9K A;  2BT6 A;  4ZHO A;  1T3Q A;  1V9J A;  2JZZ A;  2TSS A;  2WU5 B;  4PYZ A;  4A6Q A;  1XD3 B;  2BS4 B;  2KD0 A;  3ZNZ B;  2KVR A;  1M94 A;  1L0V B;  4WUR A;  4KV2 A;  5CX3 A;  4WWM A;  1WH3 A;  3FAH A;  4J3O D;  4HKQ A;  4KGT A;  2WXK A;  1N6Z A;  5IAA C;  2OOB B;  2PTL A;  4LK0 M;  2ZCC A;  4NZL B;  5C23 A;  2DNF A;  4H2A A;  4W9F A;  2K8B A;  4C00 A;  1JML A;  2WXF A;  2MCN B;  2MHJ A;  3N1Y C;  5AUI A;  4S17 A;  4W9C A;  1I42 A;  2LXC A;  2R61 A;  2JU6 X;  3U8Z A;  4RFB A;  3ZGZ A;  2O2V B;  4GDK A;  3DOW A;  1TZO A;  2ZW1 A;  3C0R B;  2JUO A;  2BWE S;  3CST A;  2O6V D;  5HG2 A;  3PHW B;  1STE A;  3EA6 A;  4N9F 4;  2NBU A;  2FAZ A;  2BWF A;  4HDQ A;  4MJS A;  2BTE A;  4ANV A;  5D3I B;  3D32 A;  3L17 A;  4MAC A;  5H8Y E;  5CHF A;  2D3B A;  2JRH A;  4ANW A;  2DZM A;  2M19 A;  1TIF A;  1R4M I;  1UWX A;  3T3O A;  3SU8 X;  2K0P A;  4CYE A;  5TR5 A;  4TSS A;  1AAR A;  1YQ4 B;  1DOY A;  3AEF B;  1PYW D;  4MGY E;  3ZW3 A;  3VTW A;  1WE6 A;  4IOI E;  2KTR B;  4BZA A;  3EC8 A;  2NVU I;  4EZL A;  2WXM A;  5FK9 C;  1QQR A;  2KAJ A;  4WJN A;  5CHW A;  1L2N A;  1LGR A;  4XGA B;  2DZJ A;  1V1P A;  4GIV A;  4DHZ E;  1SE3 A;  4JWU C;  4FAD A;  2W54 A;  4K81 A;  5IOI A;  2NMQ A;  3BZD B;  1SXT A;  3SDL C;  2RDG A;  2K25 A;  2NBW B;  1P98 A;  2M1M A;  5L95 C;  2W9N A;  2Z0D B;  1F2R C;  2K9X A;  4PS3 A;  4S0R A;  1I4H A;  1JRP A;  1LO5 D;  3T8M A;  1FPY A;  5H92 C;  2KVZ A;  1GJZ A;  2VH1 A;  5J2R A;  4YWG G;  3OLM D;  4LTU A;  1VD2 A;  3IVF A;  2HD5 B;  2INN E;  3AH7 A;  2BYT A;  2JZP A;  3KUZ A;  2N7E A;  4QAY A;  2QDF A;  2K8C A;  4N6E B;  1HEZ E;  2WXJ A;  4TMA B;  1WMH B;  3QC8 B;  1E0Z A;  2OJR A;  4WJQ A;  3BY4 B;  3DBL I;  2KLC A;  1Y56 A;  3Q2A C;  2KHW B;  2L3Z A;  1TKY A;  2IY0 B;  1EWY C;  4GLS C;  1GPX A;  1ZDX A;  5IN7 A;  2QMT A;  1V5O A;  3ZXV A;  2WXI A;  4EKU A;  4AWJ A;  2MP2 B;  4IKG A;  2M8S A;  3M95 A;  2BF8 B;  2D5G A;  2INC C;  3RNB C;  2N9E B;  1WYG A;  2V9H A;  3HM6 X;  4G0N B;  5AZH A;  2KJH B;  2LMC A;  2ZEQ A;  4K3C A;  4K7U A;  3JVZ X;  2LHE A;  1VZ7 A;  4DDG D;  2W82 A;  2BVC A;  2JWU A;  4C56 C;  1AWD A;  2K39 A;  5AZG A;  2JX5 A;  1ZXI A;  2N9X A;  2V4I B;  3ZDM C;  3RUL A;  4K7S A;  4JWS C;  1I7H A;  1I4G A;  1FMA D;  3WCQ A;  2KO3 A;  4G11 A;  4JGH B;  1C1Y B;  3DWG C;  3RYT A;  1FXA A;  2GBK A;  5EE9 A;  5T8I A;  1SBB B;  3NY5 A;  3ZRF A;  4HDO A;  4LNI A;  4OHJ A;  4IG7 B;  3N9Y C;  3H9D A;  1UWM A;  4A20 A;  5LXH A;  2MSE D;  4M01 A;  2CJO A;  1DOX A;  1PGX A;  1VRA B;  1E7P B;  2L0T A;  3TCA A;  1KJT A;  1TY2 A;  4MM3 B;  4YL8 A;  2KN4 A;  1K8R B;  1WJU A;  3DCG A;  3DHI C;  1ZXH A;  3EGR A;  3S2A A;  1NYQ A;  3MC9 A;  3O65 B;  5I4D A;  1PFD A;  4DDI D;  4ITK A;  4ZRI A;  1L5P A;  3A9J B;  1DGJ A;  2I1K A;  4ICU A;  4E71 A;  2L1A A;  2KQ4 X;  1IBX B;  5HFY A;  3X0W A;  2LD9 A;  2BB6 A;  1NI3 A;  3AEE B;  2D10 A;  2WLB A;  3AE1 B;  5CHV C;  1EM7 A;  1JAL A;  1YOV B;  4L2Y A;  1GC6 A;  3VRA B;  4EEW A;  3Q8B A;  1WXS A;  2UU7 A;  1TTN A;  1V49 A;  1H4R A;  1TKE A;  1WJN A;  5E6O A;  1YX6 B;  1TS3 A;  1IPG A;  3TEZ A;  1T0Q C;  2XK5 A;  3EEC A;  4LNF A;  5DPT A;  1J0G A;  3DBH I;  3H7P A;  3NVZ A;  2GOW A;  1BUI C;  4A90 A;  1KTK A;  3K9O B;  4DQO C;  1P1A A;  4RH6 A;  3ZO5 B;  2N1V A;  4EOY A;  3AE6 B;  4K3B A;  4WAA A;  4G50 A;  4AQ7 A;  3QCA A;  4ZDV A;  3AB5 A;  3CMM B;  4BOS C;  1WXA A;  5KHO A;  2WYQ A;  1YJJ A;  3ZJT A;  4GSW A;  2LUE A;  1TKG A;  2ON8 A;  3ZKJ C;  1CZP A;  2J53 A;  3B2F A;  1V5T A;  4HRS A;  3W5V B;  2D3A A;  3B1L X;  5BYQ A;  1GG3 A;  3AE9 B;  2LI5 A;  1T6B X;  1VDV A;  1TBE A;  1TT5 B;  1V8C A;  3W9C B;  5IP4 D;  4E74 A;  4N59 A;  3TUO A;  5D2M B;  1HTQ A;  4ARI A;  1C4C A;  1DYQ A;  4EZK A;  2NPT A;  5GXG B;  4FUL A;  1MI0 A;  3R2T A;  3A1Q B;  2KZR A;  4BBN C;  2IY1 B;  3BVG A;  4LDT B;  1F1H A;  3AU5 A;  1QKZ A;  4HRO A;  3PLV A;  2NBV B;  3LJ3 A;  3Q3N C;  4JL9 A;  2JPH A;  1C4P A;  1VZ8 A;  4RGM A;  2QIL A;  3KWL A;  1KLG D;  3OG5 A;  2BQQ A;  2V3P A;  3PZ7 A;  3SR6 A;  2LJ5 A;  1WZ3 A;  2YEP B;  4ZYN A;  4K7W A;  5BO4 B;  3SFD B;  1VR9 A;  1MHX A;  3DVG Y;  2Z59 B;  5EE0 A;  1YN4 A;  2MWS B;  3WA0 A;  2WX0 A;  5FR3 A;  2PJH A;  1QF6 A;  4M00 A;  2GI9 A;  2D07 B;  1FM0 D;  3NVY A;  4I6P A;  1C3T A;  1J7B A;  1E6E B;  3N3K B;  3V3X A;  1QLB B;  1FNV A;  2LFI A;  4KDI C;  4HPL B;  2M0X A;  2ZNV C;  2JRI B;  2QHO A;  4WIP A;  2OED A;  3GP7 A;  5IA7 A;  3APF A;  3WAO A;  2N9P C;  4C7Z A;  2IJ0 A;  3W1S A;  3ZUN A;  3VUW A;  3AE4 B;  3GS2 A;  4G3X B;  1NEK B;  3SD5 A;  1WIA A;  2EEL A;  4M8N A;  1HA5 A;  1P3Q U;  4JPS A;  2RPV A;  3QHT A;  1XXG A;  3VH4 B;  4EZJ A;  2FUG 1;  3NUH B;  2YVC A;  2HJ8 A;  2DYB A;  2MEK A;  1IGD A;  4IC7 B;  2GBN A;  3IXS A; 
#chains in the Genus database with same CATH homology
 4MGY E;  2ZVO A;  4WJP A;  1WE6 A;  3VTW A;  3ZW3 A;  4BKT A;  4F8C B;  2KTR B;  2N1W A;  2K6Q A;  1SIF A;  2MBH A;  2J0J A;  2NVU I;  3A33 B;  1WGR A;  3EC8 A;  4EZL A;  3IG3 A;  3L54 A;  3ZLZ A;  1WJ6 A;  2KFJ A;  2KWU B;  5G2N A;  3EFU A;  1UBI A;  4WJN A;  5CHW A;  4URK A;  1L2N A;  2XK5 B;  2IYD B;  4HVB A;  3UQB A;  4WWN A;  2DZJ A;  4MSQ B;  4IWQ A;  3V6C B;  3UQA A;  3DPD A;  3PT2 B;  3RCZ A;  4GIV A;  3PZD A;  4DHZ E;  3PS6 A;  4KZC A;  4FAD A;  4HCN B;  1WGY A;  3H1U A;  2KC1 A;  4DWF A;  4K81 A;  2C7M B;  5J18 A;  3PV1 A;  5D6J B;  2KMA A;  1WM2 A;  2ZVN A;  2KJ6 A;  3N30 A;  3SDL C;  3M63 B;  1TZ1 A;  2AL3 A;  2D11 A;  2M4N A;  2A4Z A;  2G45 B;  2CHW A;  2K25 A;  2O2V A;  2D2Q A;  3VDZ A;  2ZCB A;  2NBW B;  3ML9 A;  1P98 A;  2M1M A;  4HXD A;  3QAQ A;  2W9N A;  4NQL B;  4B6W A;  3OJ3 A;  5L95 C;  1OEY J;  1WR1 A;  2KLG A;  2Z0D B;  5DPR A;  2KFK B;  3U30 A;  3QQ8 B;  4W9G A;  4PS3 A;  5JHB A;  2JVC A;  3A4S C;  4IW0 A;  2G3Q B;  2LZ6 A;  3B0A A;  1P0R A;  3VQI A;  2GMI C;  3TMP B;  5LLI A;  2L76 A;  4HK2 A;  3T8M A;  1WJ4 A;  3HK0 A;  2AWT A;  2AYO B;  4II3 B;  2MBE A;  3JYU A;  1WFY A;  2KJR A;  3KUC B;  5KHQ A;  1GJZ A;  5J2R A;  3DVG X;  4IM2 A;  4KIK A;  3OLM D;  3RD2 A;  4KSK C;  3VTU A;  2CKH B;  3AU4 A;  3NZS A;  3PRM B;  1VD2 A;  3SHQ A;  4AUQ C;  3AXC A;  3IVF A;  2HD5 B;  4ANU A;  2EKE C;  2NCN A;  1WY8 A;  1WX8 A;  2KNB A;  3LDZ E;  2J0M A;  1U4A A;  1WRD B;  2N4F A;  2N7E A;  3KUZ A;  2WDT B;  4BVU C;  2IZV B;  1A5R A;  1ZW7 A;  5LXI B;  2KQS A;  2K8C A;  2V3S A;  3AI5 A;  4IM3 A;  1LFD A;  3B08 A;  1J8C A;  3NS8 A;  2RD0 A;  2LXA A;  4GB9 A;  1WGH A;  4MEM A;  1WE7 A;  1L7Y A;  1WMH B;  2O6V B;  3QC8 B;  2KAN A;  2ZPN A;  3PTF C;  3Q3F A;  1WGD A;  2BYE A;  1EF1 A;  4RMA A;  2OJR A;  4WJQ A;  3BY4 B;  2C5L C;  3DBL I;  2KN5 A;  2KLC A;  2VRR B;  3VUY A;  2PE6 B;  1RRB A;  4J6I A;  1OEY A;  5DPW A;  2KHW B;  2L3Z A;  2JZ3 B;  2IY0 B;  2Y5B B;  3L0W B;  1UH6 A;  2FUH B;  4XC2 A;  2MX2 A;  3TBL D;  3RZF A;  3M3J A;  2EMT A;  2JF5 A;  1V5O A;  4GOC A;  4GU2 A;  4I6N B;  4EKU A;  4FN2 A;  4KDL B;  5HKH A;  2PPH A;  4AWJ A;  4FBJ B;  2MP2 B;  2LVO A;  4MEL A;  2M8S A;  2L05 A;  2BF8 B;  1EO6 A;  3M95 A;  4M8M A;  4W9E A;  2N9E B;  2JXX A;  4HLE A;  1E7U A;  5C1Z A;  3ENE A;  2LAS A;  3RT3 B;  3HM6 X;  4G0N B;  5AZH A;  2KJH B;  4RM9 A;  4DHJ D;  1KLV A;  4MH0 E;  1E8X A;  3ZNG C;  4ASW C;  2ZEQ A;  4K7U A;  3JVZ X;  4KVG B;  4TV3 A;  4ICV A;  4DDG D;  1P9D U;  1S3S G;  1X1M A;  4LJO B;  1T0Y A;  4JLC A;  1KOT A;  5AZG A;  2K39 A;  3TIX A;  3PGE A;  2N9X A;  4TQ0 A;  3ALB A;  3TL5 A;  2PE9 A;  2D3G A;  1WX7 A;  3ZDM C;  2KFK A;  4K7S A;  3RUL A;  3T9L A;  3V60 A;  1Z2M A;  3IHP C;  2DZI A;  2ZPY A;  5AZF A;  1GC7 A;  1YIW A;  1Q1O A;  3WAN A;  2KO3 A;  2DYM A;  2UWQ A;  4G11 A;  4JGH B;  2KKC A;  2HTH A;  4PS8 A;  1C1Y B;  4FJY A;  1E7V A;  1V81 A;  1UD7 A;  2Z0E B;  3RYT A;  3APD A;  1Z5S B;  3H7P B;  4RM8 A;  2GBK A;  2FCQ A;  4ZRK A;  4FHJ A;  3NY5 A;  4A3O A;  1JRU A;  2N7D A;  1GNU A;  2IBI B;  3ZRF A;  4HDO A;  1LM8 B;  1CMX B;  4IG7 B;  3VUX A;  3HIZ A;  3WAM A;  1UGM A;  3H9D A;  3N32 A;  4AOF A;  3TJP A;  3UF8 A;  4A20 A;  5LXH A;  2MSE D;  4AJW A;  3HHM A;  1V86 A;  3PLU A;  3M62 B;  1TGZ B;  3RZW C;  3A4R A;  2KMC A;  2DZK A;  4W9K A;  2L0T A;  3QJZ A;  2L8J A;  4MGZ E;  2KDF B;  1WMH A;  2GBM A;  2PEA A;  2ASQ A;  1KJT A;  4YL8 A;  4OVU A;  1RAX A;  3PVL A;  4W9D A;  4CO7 A;  1K8R B;  1WJU A;  3KVF B;  2L0F A;  4HPM B;  3UIN B;  2JY6 A;  1E8Y A;  3DCG A;  4GGQ A;  1WYW B;  5DPS A;  3S2A A;  3PRZ A;  2MBQ A;  4W9I A;  4P7I A;  4IUM B;  2KDE B;  2K6D B;  4PYU A;  4NAW B;  1XT9 B;  2J7Q B;  3QA8 A;  2C60 A;  3O65 B;  3JSV B;  4I6L B;  2YLM A;  2KK8 A;  3NZU A;  4BOZ B;  2L00 B;  4DDI D;  4DK5 A;  5E6N A;  2FCN A;  2K1F A;  2LRW A;  4LDT D;  5GMV A;  4ZRI A;  2R2Q A;  3A9J B;  3DQV A;  2BPS A;  4GDL A;  1YX5 B;  4BKS A;  1XQQ A;  2I1K A;  2AEH A;  2G4S A;  4GN1 A;  1E8Z A;  4ICU A;  2NS5 A;  4E71 A;  1IYF A;  2R2O A;  4HJK A;  2BKF A;  5E6P A;  2LVQ A;  3L08 A;  1WR6 E;  2LGX A;  3X0W A;  2FNJ B;  2LD9 A;  4W9J A;  2WWZ A;  3AUL A;  3ZVV A;  2XBB C;  3Q3J A;  3R3M A;  4NNJ B;  2KWV B;  4FHK A;  4BBN F;  2KXJ A;  3V6E B;  2D10 A;  2MBB B;  2NPT B;  4CHK A;  5JHA A;  5CHV C;  1Q0W B;  2IO3 B;  4WWP A;  4AJY B;  4PS7 A;  3NHE B;  1GC6 A;  4K1R B;  4NPN A;  5CTR C;  4BFR A;  2C7N B;  3PHX B;  4EEW A;  4IM0 A;  1ZGU B;  1WXS A;  1EF5 A;  2MRP A;  3P2B A;  2RPQ A;  3DDC B;  1TTN A;  1UZX B;  1EUV B;  3VVW B;  1V49 A;  2KTR A;  5L83 A;  2KDI A;  2RR9 A;  1H4R A;  4XZ4 A;  2BGF A;  2G4D B;  3ZIM A;  4DXA B;  2V4L A;  3UGB B;  4GXB A;  1WJN A;  2KOX A;  2V1Y A;  3QIJ A;  4OVV A;  5E6O A;  2KQ7 A;  4DHZ B;  1YX6 B;  1ZKH A;  4GMV A;  1IPG A;  1V6E A;  2XK5 A;  3EEC A;  1J0G A;  5DPT A;  5DCN A;  3KUD B;  3I3T B;  2XEW A;  1QZE A;  2RGF A;  3L10 B;  3DBH I;  3H7P A;  1WI0 A;  4KSL C;  2GOW A;  4TUU A;  4W9L A;  2CHX A;  2GBR A;  2IO0 B;  1G6J A;  3K9O B;  4B95 A;  3ZTD A;  4FJZ A;  1SGH A;  3KYD D;  3BIN A;  2NR2 A;  1P1A A;  3R7R A;  1UBQ A;  3ZO5 B;  5D7G A;  2A5U A;  2N1V A;  2L7R A;  4EOY A;  2RSU A;  1OGW A;  4ANX A;  2K8H A;  3PPA A;  4WAA A;  2BYV E;  3L16 A;  4G50 A;  2WX1 A;  4BKG A;  3QCA A;  1NDD A;  4NJ6 A;  4ZDV A;  3W1Y A;  4BKS D;  3ZDT A;  3PRE A;  1VCB A;  1NBF C;  3HM3 A;  1F9J A;  4BOS C;  3CMM B;  4MM3 A;  3JW0 X;  2DYO A;  2LWP A;  1WXM A;  3A9K B;  3R7Q A;  1WXA A;  3VTV A;  4GDK B;  1LQB A;  5KHO A;  1MG8 A;  2DX5 B;  2WYQ A;  4NY0 A;  1Y8R C;  2M17 A;  4W9H A;  1FXT B;  4GSW A;  1V80 A;  2LUE A;  1UEL A;  5J17 A;  4NAW A;  1RLF A;  3PRP B;  3QX1 A;  1H8C A;  1IP9 A;  1WX9 A;  2DEN B;  3MTN B;  2CR5 A;  3ZKJ C;  3W1S C;  2MQJ A;  3TCA A;  2MA9 B;  3KYC D;  1BT0 A;  2KX0 A;  4FLH A;  5G55 A;  2LGY A;  4B9K A;  1V5T A;  5AEK B;  3A9J A;  4EFO A;  3B1L X;  4HWI B;  2CS4 A;  2DHZ A;  1V9J A;  1GG3 A;  2JZZ A;  2LI5 A;  4II2 B;  3UIO B;  1TBE A;  4PYZ A;  3DBS A;  3ZRC A;  4E74 A;  1XD3 B;  2CHZ A;  2ZJD A;  3EHV A;  3H6N A;  3NOB A;  4MJS B;  4DBG A;  3QWZ B;  2KD0 A;  5D2M B;  4JIO U;  4TKN A;  2REX A;  4M0W B;  3ZNZ B;  2KVR A;  5EDS A;  1HE8 A;  4ZRJ A;  1M94 A;  4EZK A;  2FID A;  2O6V A;  3L13 A;  2NPT A;  3WIM A;  2KX3 A;  3DBR I;  4KV2 A;  3VAW A;  4FUL A;  2KTF A;  3PSE B;  3A1Q B;  5CX3 A;  3DVN V;  3UIP B;  2I1J A;  2KZR A;  4NQK E;  4BBN C;  1RFA A;  3ECI A;  1WH3 A;  4AP4 C;  1S1Q B;  2IY1 B;  4LDT B;  2LRU A;  3AU5 A;  2JT4 B;  1PQS A;  2C9W B;  3IFW B;  5IAA C;  3U7D A;  4FJV B;  3V61 A;  5FR6 A;  4MDK E;  2MBO A;  1YJ1 A;  1J19 A;  3PLV A;  2NBV B;  3LJ3 A;  2OOB B;  3X23 A;  2GBJ A;  4JL9 A;  2JPH A;  2MP2 A;  2ZCC A;  3K9P B;  1OQY A;  3ONS A;  1GUA B;  5D94 A;  5C23 A;  1V2Y A;  2EMS A;  2LVP A;  4W9F A;  2LGD A;  4KZ0 A;  2KC2 A;  2K8B A;  1LXD A;  4MSM B;  1I35 A;  1WGG A;  1WF9 A;  1WXV A;  3MJW A;  2DAF A;  2IO2 B;  1WM3 A;  4WJO A;  2MLB A;  3VH3 B;  4EUT A;  2MCN B;  3VHT C;  1YD8 U;  4A3P A;  5JH5 C;  1WZ0 A;  2LJ5 A;  3ZTC A;  1WZ3 A;  5JZE B;  4ZYN A;  3RUI B;  4K7W A;  3ZNH B;  5BO4 B;  4W9C A;  4HCP B;  1I42 A;  3DVG Y;  1ISN A;  2LXC A;  2AL6 A;  2Z59 B;  1E90 A;  2KDB A;  2MWS B;  3U8Z A;  3WA0 A;  2WX0 A;  2PJH A;  3ML8 A;  3A9K A;  2O2V B;  3OJ4 B;  1YQB A;  4F1S A;  4GDK A;  3DOW A;  3C0R B;  2CU1 A;  3H7S A;  2D07 B;  4FA6 A;  1OTR B;  4JQW C;  1R4N I;  4LCD E;  2JUO A;  2FCM A;  2IO1 B;  3MHS D;  4I6P A;  2JWZ A;  2BYF A;  3APC A;  3KW5 B;  4X57 B;  1C3T A;  2BWE S;  3N3K B;  3CST A;  2O6V D;  3CSF A;  1D3Z A;  3WAP A;  2MW5 A;  4KDI C;  4DHJ B;  3PHW B;  3CF6 E;  3IBE A;  1NI2 A;  4HPL B;  3R66 C;  2M0X A;  2DAJ A;  3WAL A;  4IWO A;  3GZN I;  4N9F 4;  4KIK B;  3ZNI D;  2ZNV C;  2JRI B;  1KM7 A;  2QHO A;  2NBU A;  2FAZ A;  1Q5W B;  2UYZ B;  4GDL B;  2BWF A;  1E8W A;  4HDQ A;  3QK0 A;  4MJS A;  2B3A A;  5IA7 A;  4ANV A;  3VFK A;  3APF A;  2KWC A;  3WAO A;  4NJ7 A;  4MGI E;  3D32 A;  3L17 A;  1SE9 A;  2C7H A;  4E3C A;  5CHF A;  3V62 A;  2N9P C;  4MGK E;  2JRH A;  4ANW A;  3W1S A;  2DZM A;  2FCS A;  4TQ1 A;  2ZZP B;  4XX5 A;  3VUW A;  3ZUN A;  3VXW A;  4G3X B;  4WWO A;  3GOE A;  4IWP A;  3A1Q A;  4F7Z A;  3QAR A;  1R4M I;  3SD5 A;  1WIA A;  2HE7 A;  4M8N A;  2J0K A;  3SU8 X;  1P3Q U;  3JSV A;  3OAW A;  4CYE A;  3QHT A;  2ZNV B;  3VH4 B;  2BKR B;  4EZJ A;  3KH0 A;  5TR5 A;  1AAR A;  2YVC A;  2HJ8 A;  4LJP B;  2DYB A;  2FIF A;  1E5W A;  4WQO B;  4IC7 B;  3DVN U;  2GBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...