2IO1B

Crystal structure of human senp2 in complex with presumo-3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 81
sequence length 81
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io1B00
2GBMA 1WX9A 1OEYJ 5DPSA 1WM3A 4IM2A 3R7QA 3QHTA 2KFKB 5CHWA 2AYOB 2GBJA 2ASQA 2GBKA 1V49A 4LJPB 2KQSA 3LJ3A 2LGDA 4W9DA 2JWZA 4PYZA 3WAPA 3ZNID 2GMIC 3RZFA 4AWJA 2BKFA 2ZJDA 1C1YB 2O2VA 3A1QA 3MHSD 3R3MA 4MGYE 2LXAA 2KWCA 3AULA 3T8MA 1LXDA 1R4NI 3ENEA 3ZDTA 2MP2A 1GG3A 2ZCBA 2NCNA 2O6VD 2ZVNA 2O6VB 2JUOA 5CHVC 4DBGA 1PQSA 1WZ3A 1SGHA 4W9FA 4AJYB 4NAWA 2MCNB 3VQIA 4FN2A 3H7PA 2R2OA 2M17A 5IAAC 2J0KA 3QCAA 4FADA 3QQ8B 3PHWB 2LRWA 3B0AA 3QC8B 4ICUA 3RT3B 5D7GA 4ZRKA 2N9PC 4HLEA 4B95A 3H6NA 2CU1A 1J19A 1KJTA 1WX7A 4JQWC 4NJ7A 3UQBA 2N1WA 2K8CA 2JXXA 3DOWA 3S2AA 4GN1A 5DCNA 4EZLA 2C7NB 3RYTA 4FHKA 2JZZA 2DYOA 4NY0A 3L54A 3KW5B 2I1JA 2K6DB 3HM3A 1KM7A 4JLCA 2CHWA 3RCZA 2BKRB 2MA9B 3SHQA 3JSVB 1WGYA 3VVWB 2OJRA 4JIOU 1QZEA 3PHXB 3ECIA 5D94A 4I6NB 3VDZA 2PPHA 1WJ4A 2KDFB 4F8CB 4HCPB 2ZPNA 3V60A 1LQBA 1GJZA 5JH5C 3KUCB 2LASA 2GBNA 1AARA 4GDLA 1WJNA 1S3SG 3A4SC 1TGZB 2D2QA 4NQLB 2O2VB 3A1QB 1V9JA 4I6LB 4KV2A 2KDEB 4JGHB 4KZ0A 3TIXA 4FHJA 3TJPA 4JL9A 2MP2B 2V1YA 2KC2A 4TKNA 2IO3B 4AOFA 3PVLA 3WAMA 4N9F4 2ZVOA 2XBBC 3PRPB 2KDBA 4CHKA 5JHAA 4NAWB 4ICVA 3L13A 3ZRCA 2MBQA 3H7PB 3TBLD 3U8ZA 2KMCA 2LVPA 2N1VA 2MBEA 3GZNI 3SDLC 2IY0B 4YL8A 1E8ZA 3UF8A 1I35A 1E7UA 1G6JA 1UH6A 3Q3JA 1RLFA 2KLGA 4HVBA 3H7SA 3QIJA 3VUYA 3QJZA 2RGFA 1KLVA 2KFJA 4BOZB 2LVQA 1V2YA 1E8WA 3VHTC 2MBBB 3JW0X 1GC6A 4RMAA 2G45B 3IVFA 2KNBA 3ZW3A 2J0MA 5IA7A 2Y5BB 3WIMA 3R7RA 2DZMA 2V4LA 3W1SC 3VH3B 4FLHA 4CYEA 1E7VA 4LDTD 2NPTA 4LDTB 4ZRJA 4EEWA 1XQQA 4GDLB 2IO2B 3DPDA 5L95C 3U7DA 1WFYA 3PRMB 1EO6A 5E6NA 1RAXA 1OEYA 4DHZE 2L76A 2JVCA 3EHVA 1P1AA 4KZCA 4NNJB 1WJ6A 2M4NA 1WF9A 3JYUA 4IUMB 4B6WA 2K8BA 4DDGD 2BYEA 1JRUA 1K8RB 2L05A 3QX1A 4HPLB 3X23A 4IM3A 3ZNHB 4WQOB 3HM6X 3U30A 2CS4A 3DDCB 4E71A 3KH0A 1ISNA 3L0WB 1UD7A 3ML9A 1WI0A 1Q5WB 2UYZB 3ZO5B 1UZXB 2IBIB 2EKEC 2MQJA 3DBLI 3PGEA 1Z2MA 2WYQA 2KC1A 1E8YA 2JF5A 2KLCA 4W9CA 2RR9A 4IWPA 1IP9A 1FXTB 2XK5A 4IM0A 3RUIB 3OJ4B 3VAWA 3WA0A 1YJ1A 4ANXA 2J0JA 4IWQA 2WX0A 1IYFA 2IO0B 3O65B 1Z5SB 2BWES 4RM8A 2QHOA 1F9JA 3DVGY 3KYDD 3NHEB 4G50A 4WAAA 3ZTCA 2DZIA 4GU2A 4IG7B 5GMVA 1YQBA 4AJWA 2KTFA 1P3QU 2NPTB 4PS8A 4DDID 4FA6A 4P7IA 4BFRA 3QAQA 4WWOA 2L0TA 2FAZA 1CMXB 1P0RA 1WJUA 3ONSA 4G11A 1V5OA 2KO3A 1WH3A 4DWFA 1UGMA 4PS7A 1XD3B 3QWZB 1VD2A 3PPAA 2FIDA 2L3ZA 2PJHA 3UINB 4K1RB 4NQKE 2KXJA 2FUHB 3VTWA 1J8CA 2L7RA 2I1KA 2REXA 5KHOA 3T9LA 3ZLZA 1V86A 5EDSA 3HHMA 1WGRA 5D6JB 2N7DA 4A20A 2LJ5A 1GC7A 3IG3A 3UIOB 4MELA 3DCGA 2KJHB 2C9WB 3WAOA 4BOSC 4KSLC 3AXCA 2D07B 3CMMB 4HDQA 4OVUA 2ZPYA 5JHBA 2KZRA 3BY4B 4KSKC 2C5LC 1VCBA 2XK5B 3DBRI 2KKCA 3ZNZB 1WMHA 2MWSB 4GGQA 1YIWA 2W9NA 5BO4B 3JVZX 3PSEB 1P9DU 3ZDMC 1TZ1A 4OVVA 3DVNV 5AEKB 4G3XB 4W9GA 2PEAA 3M95A 3VUXA 5E6PA 2K8HA 1WX8A 4GDKA 3CF6E 2AL6A 2BWFA 3ZRFA 4ANWA 1E90A 2Z59B 3PLVA 2C60A 4EFOA 4IWOA 2FCQA 2KX0A 1XT9B 4NPNA 2NBVB 2ZNVB 2M1MA 3A9JA 4MJSA 1E8XA 5JZEB 3OJ3A 1RFAA 2DZJA 4X57B 3EC8A 2DHZA 5LXIB 5KHQA 2ZCCA 2ZEQA 4TV3A 1WGGA 4BBNF 1SIFA 1SE9A 5CHFA 2B3AA 4ANUA 3CSFA 3VTUA 2G3QB 3VFKA 4F7ZA 1S1QB 1YX6B 4ASWC 1WYWB 5J18A 2CKHB 2L8JA 1TBEA 2A4ZA 3MTNB 2MX2A 4ZRIA 2N7EA 4BKTA 5CX3A 5CTRC 3TCAA 2Z0EB 2G4SA 4GMVA 2KJRA 2KTRA 3NY5A 4W9LA 2J7QB 3QARA 1L7YA 4EKUA 1ZGUB 3APCA 1P98A 5L83A 4WJPA 3VH4B 4EUTA 1Q1OA 3AU4A 3HK0A 3OLMD 3P2BA 1RRBA 3PZDA 4ZYNA 2V3SA 3KYCD 3L08A 2LD9A 4KDIC 4K81A 4XX5A 1WMHB 2N4FA 4GOCA 4WWPA 4TQ1A 4HJKA 5AZFA 5J17A 3EFUA 2KN5A 1IPGA 3KUZA 3NOBA 2EMTA 2LI5A 4K7SA 1C3TA 2ZZPB 2HTHA 2WWZA 4PS3A 3H9DA 1WM2A 4LCDE 4MGIE 2YVCA 2FCNA 4MH0E 2BPSA 2NS5A 4WJOA 3TL5A 1WGDA 4FJZA 4W9HA 1WR1A 5LXHA 3ZTDA 2BYFA 3ML8A 2VRRB 1UBQA 3PV1A 2KVRA 4MSMB 4WJQA 3A9JB 4MJSB 1ZW7A 1EF5A 2IO1B 1WXVA 2DYMA 3MJWA 4W9IA 2WX1A 1R4MI 3CSTA 3DVGX 1H8CA 3OAWA 2KK8A 4II3B 3ZVVA 3RULA 2MW5A 3M3JA 1UELA 4MEMA 3V61A 1V6EA 3PREA 2K25A 4IC7B 3PTFC 4HK2A 2BYVE 3PRZA 2JT4B 1NBFC 3DBHI 2JZ3B 2R2QA 4BKSD 1TTNA 2KTRB 3AU5A 4MGKE 4II2B 3HIZA 3R66C 3UGBB 1UBIA 3APFA 4AUQC 5E6OA 3SU8X 3QA8A 1V81A 2KDIA 2OOBB 3N3KB 1T0YA 3A33B 3V62A 2FIFA 3PLUA 1NI2A 4HPMB 3D32A 3VXWA 2DENB 2IYDB 3DQVA 4XZ4A 2CHXA 4W9KA 4HXDA 2LXCA 2Z0DB 1WZ0A 2KWVB 1I42A 4BBNC 4A3PA 4LJOB 4DK5A 3L16A 4BVUC 3UIPB 3X0WA 1WXMA 2LVOA 2HE7A 5DPRA 2LGXA 3NS8A 2D11A 2MBHA 3PT2B 5DPTA 4HWIB 2LZ6A 4M8MA 3H1UA 1WIAA 1HE8A 2DYBA 3A9KA 2D10A 5J2RA 2JPHA 4DXAB 3A4RA 2DAJA 3BINA 1OGWA 3NZSA 2C7HA 1ZKHA 2L00B 1U4AA 3ZKJC 1WE7A 2K6QA 2LUEA 5G2NA 4J6IA 1EF1A 4FJVB 4KIKA 2KJ6A 4DHZB 4ANVA 1E5WA 4TUUA 2LWPA 1LM8B 3UQAA 3M63B 2JRHA 3VUWA 1YD8U 4W9EA 4BKGA 5AZHA 2CHZA 2BGFA 3Q3FA 4FULA 2HD5B 1GNUA 2PE9A 1YX5B 3IFWB 3W1SA 2BF8B 4EZKA 4IW0A 2KX3A 4NJ6A 2LGYA 3VTVA 2ZNVC 2MBOA 5TR5A 4HDOA 1NDDA 3I3TB 3KVFB 4AP4C 3K9PB 2CR5A 4F1SA 2UWQA 2DX5B 4EOYA 2WDTB 2K1FA 3L17A 3V6CB 1KOTA 4ZDVA 3DVNU 1M94A 4GB9A 5C23A 2FCSA 4G0NB 4KVGB 4XC2A 2DAFA 3AI5A 1L2NA 4GXBA 1WGHA 3KUDB 4B9KA 4A3OA 5HKHA 3V6EB 1WR6E 4MDKE 3L10B 3WANA 4M0WB 3B08A 3C0RB 3K9OB 4MGZE 2D3GA 4PYUA 2KFKA 1BT0A 1Q0WB 1A5RA 1MG8A 3PS6A 2JRIB 1WY8A 3RZWC 5FR6A 2N9EB 4BKSA 4RM9A 2GBRA 3NZUA 2RPQA 3A9KB 4MSQB 5LLIA 2KWUB 2EMSA 2HJ8A 3IBEA 2L0FA 2KMAA 3RD2A 2KD0A 1LFDA 2NBUA 1EUVB 2IY1B 2FNJB 4TQ0A 2C7MB 2FCMA 4CO7A 2O6VA 2AWTA 2KANA 3W1YA 3ZNGC 2M8SA 2KOXA 3EECA 3ALBA 4KIKB 4E3CA 4FBJB 2NR2A 3APDA 4W9JA 2MRPA 2AEHA 1X1MA 4GSWA 2N9XA 4GDKB 1OTRB 3SD5A 1J0GA 5AZGA 1WXSA 3M62B 1WE6A 2JY6A 3N32A 3LDZE 3QK0A 4GIVA 3TMPB 3ZUNA 4EZJA 3N30A 4WJNA 3DBSA 2MLBA 4MM3A 2MSED 3B1LX 3GOEA 2XEWA 5D2MB 2RD0A 3ZIMA 1D3ZA 2PE6B 4URKA 5DPWA 2KQ7A 2GOWA 2K39A 2KHWB 4K7UA 1V5TA 1GUAB 3WALA 2YLMA 4KDLB 2AL3A 3IHPC 2RSUA 5G55A 4DHJD 2M0XA 1WXAA 1OQYA 4WWNA 4DHJB 5C1ZA 1Y8RC 2IZVB 1H4RA 4K7WA 2DZKA 2LRUA 2A5UA 2NBWB 4I6PA 4E74A 4M8NA 4HCNB 1WRDB 1V80A 3JSVA 4FJYA 2G4DB 2NVUI
chains in the Genus database with same CATH superfamily
1SB3C 2GBMA 1WX9A 4M01A 5DPSA 1WM3A 4M00A 2AYOB 2GBJA 2JWZA 3ZNID 3IAM1 2BKFA 1C1YB 2O2VA 3MHSD 4YTNB 1LXDA 1R4NI 2MP2A 3RFZB 2RDBC 5D3DA 1N5XA 3H7PA 3ZYYX 3RPFC 4FADA 2LRWA 4N58A 4HLEA 2CU1A 4YTPB 4EZLA 5DCNA 4KKJA 2MHJA 1WSPA 2LMCA 3KW5B 2WXPA 2K6DB 3SHQA 4JIOU 3ECIA 5D94A 3VDZA 5G5HA 3RMKC 1GJZA 5JH5C 3OWEB 2GBNA 4C56C 1TGZB 2D2QA 4DK5A 2O2VB 4KZ0A 4C4VA 2KDEB 4JGHB 3TIXA 1XXGA 3TJPA 2MP2B 2IO3B 3WAMA 3L13A 3H7PB 3U8ZA 2KMCA 2LVPA 2KDMA 3GZNI 1DOYA 4YL8A 1ET6A 3TEYA 2WXHA 5HFYA 1E7UA 3AM9A 3QIJA 3I63C 2KFJA 2LUMA 2KN4A 3VHTC 3JW0X 4O1NA 2KNBA 4KGRA 3U52E 3W1SC 3VH3B 3SEBA 4LDTD 2LGIA 1JWMD 2IO2B 1FCLA 3U7DA 1ESFA 1XLPA 4C4VB 2MJ3A 5IOIA 5E6NA 4DHZE 4KZCA 1N5WA 4ZRPA 1WF9A 4IUMB 2K8BA 2DLBA 1JRUA 1K8RB 3AEGB 1FXAA 3X23A 4IM3A 4WQOB 3HM6X 3U30A 1IGDA 1NVID 1FNVA 3ML9A 3ZO5B 4IDIA 3Q6BA 3DBLI 4XDDA 4LLGM 2WYQA 2KC1A 1E8YA 2OJWA 3EUB2 3AE1B 2KLCA 4W9CA 2RR9A 4IWPA 1IP9A 4IM0A 3RUIB 3OJ4B 3VAWA 1D5XC 1ENFA 3WA0A 4RM8A 2QHOA 3KYDD 3DVGY 4OW0A 4OHJA 4GU2A 2LEKA 3SR6A 4Q2JA 3RNAC 1TY0A 1EM7A 4PT5A 1SJED 4DWFA 2KO3A 1UGMA 5E6JA 2RDHA 1VD2A 1ACCA 2JYEA 1GPXA 4US9A 2FUHB 3KQ4A 1XEEA 2REXA 3P1MA 4A20A 2LJ5A 2R61A 3ZGZA 3W5UB 1ZP0B 1CK1A 3DCGA 4P1BC 1D4BA 2D07B 4HDQA 2K22A 2KZRA 3NVYA 1VCBA 3ZNZB 2L1AA 4GGQA 4B0EA 1QOFA 1TZ1A 3DVNV 5AEKB 4G3XB 4BZAA 3RNEC 3M95A 3FKYA 4GDKA 2BWFA 2JU6X 2Y5CA 1E90A 5H8YE 3PLVA 2C60A 5G5GA 2NTTA 4C7ZA 1DGJA 2WP9B 4JX1C 2M1MA 1E8XA 1PFDA 3AEFB 1RFAA 1YN5A 3EC8A 2ZCCA 2ZEQA 4TV3A 5CHFA 1JW9D 4BAXA 3BK2A 1I4XA 3DWMA 1NI3A 4F7ZA 4MT5A 1YX6B 4LNIA 4XE0A 2CKHB 2A4ZA 2N7EA 4GMVA 2KTRA 3BVGA 4EKUA 3APCA 3VH4B 1EWYC 1Q1OA 3AU4A 3HK0A 1VZ8A 1RRBA 4KDIC 3I5JC 3MC9A 4P16A 4WWPA 4HJKA 3EFUA 2KN5A 1C3TA 2ZZPB 1I4PA 3H9DA 4LCDE 1L4DB 2FCNA 2BPSA 3TL5A 1VZ6A 3NS1A 3ML8A 2VRRB 2X8XX 4WJQA 1ZW7A 1EF5A 1WXVA 2I38A 4W9IA 1H8CA 1UELA 1FFVA 5HHDG 4K3BA 4ARIA 3PREA 3PTFC 4HK2A 2BYVE 2JT4B 3DBHI 1JALA 2JZ3B 1TTNA 2KTRB 4WAFA 2E6XA 3HIZA 3UGBB 1QKZA 1L0YB 5E6OA 3SU8X 1V81A 4RNAA 2OOBB 1ZXHA 3I57A 4TSSA 2DENB 3DQVA 4JPSA 1WZ0A 3TEZA 4C00A 4KX6B 3AE9B 3X0WA 2LVOA 2LGXA 1F2RI 2D11A 1L6UA 1K52A 3N1ZC 3PT2B 4JE3B 3H1UA 1HE8A 4A8XC 2LUEA 4FJVB 1N63A 2W3RA 5AUIA 3UQAA 3VUWA 1FD6A 4BKGA 5AZHA 2CHZA 2HD5B 1GNUA 4EZKA 2BF8B 1L4ZB 2KX3A 1K50A 2ZNVC 2X38A 4AP4C 3C8YA 2FCSA 1E7PB 4XC2A 3AI5A 1WGHA 3Q14C 2QCZA 3K9OB 1KF6B 2FBWB 3TEXA 1FO4A 1MG8A 3PS6A 1V8CA 2GBRA 1FPYA 1PUTA 2WXMA 2L0FA 2KMAA 3RD2A 1P7EA 1LFDA 2GI9A 1EUVB 3HVDA 2FNJB 2C7MB 2O6VA 2WXKA 3ZNGC 4A90A 2G1EA 4FBJB 1WXQA 1IUEA 2NR2A 4OZAA 2VZKD 2AEHA 1X1MA 4GIVA 4EZJA 4WJNA 2MSED 3GOEA 2PE6B 4URKA 5BYRA 2KQ7A 2GOWA 4K7UA 3WALA 4KDLB 2WU5B 2M0XA 2XN9C 1OQYA 4WWNA 5C1ZA 2NBWB 2N9KA 1WRDB 1V80A 1XO3A 3JSVA 3ZXRA 3CIRB 2NVUI 4MSQB 1SE3A 3R7QA 3QHTA 5CHWA 2J42A 4LJPB 3WAPA 1SXTA 3RZFA 2IPKD 2KWCA 3AULA 4RFBA 2ZCBA 2O6VB 4DBGA 1WZ3A 4W9FA 1ZUD2 3VQIA 1CJEA 3Q69A 2R2OA 2BBCA 2K0PA 3Q2AC 3PHWB 4ICUA 3RT3B 5D7GA 4ZRKA 3FC4A 2JSVX 3DOWA 2JXXA 3S2AA 2N9LA 4GN1A 3IT6B 4RF0A 3L54A 4YXDB 4R3DA 1KM7A 2QMTA 3JSVB 1WGYA 2OJRA 1QZEA 4LK0M 3Q3MC 3Q3NC 1LQBA 4GDLA 1WJNA 1S3SG 3A4SC 4NQLB 1V9JA 1B9RA 3MP9A 2Q5WD 3PVLA 4N9F4 4CHKA 3ZRCA 2MBQA 2E3TA 3TBLD 5BMHA 3ZJTA 2WXRA 2W3SA 4LNOA 3MFGA 3QJZA 2RGFA 2N0SB 3B2FA 1J7BA 3ABVB 4RMAA 1I4HA 1WWTA 4RCOA 5IA7A 2Y5BB 2PKOA 3R7RA 2DZMA 2M0AA 4A6QA 1YMHE 1Q10A 2WDVB 2NPTA 1XQQA 3HVZA 4GDLB 4M02A 1QF6A 2WDQB 5BMGA 1OQQA 2J52A 1RAXA 2L76A 3Q8FA 3EHVA 2M4NA 4HEA1 1YQ4B 3JYUA 1WYGA 4DDGD 3ZNHB 1JQ4A 2CS4A 4HROA 4E71A 2FE8A 2WDRB 2I2YA 3PGEA 4LNFA 1FXTB 1YJ1A 2HDEA 5FR3A 3DBLB 3O65B 3BZDB 3VR8B 1Z5SB 1WGKA 1ZDVA 3NHEB 1QOGA 2QJLA 4IG7B 1YQBA 3N1XC 1P3QU 2NPTB 4PS8A 2VH1A 4N6EB 3KWLA 1YN4A 3AECB 1WJUA 3AE5B 4PS7A 1TJEA 3P4QB 3DHHC 2L7RA 1TS3A 1V86A 3HHMA 1WGRA 5FK9C 4HKZE 2Y3AA 2JQRB 4TMAB 2UU7A 3WAOA 2HTME 1R7SA 3CMMB 5BYQA 3AE7B 4YTMB 3BY4B 4KSKC 3MJ5A 1XLOA 3FAHA 1I4QA 3PSEB 4OVVA 4IOIE 5EE9A 2KACA 2K8HA 4JWUC 2W54A 2AL6A 4IWOA 4DXGA 1N60A 1UUPA 4ZHPA 1TKYA 4KGTA 2DNFA 1XLNA 3RNBC 5LXIB 1A70A 1WGGA 4BBNF 1SE9A 2B3AA 1PGXA 4ANUA 2LJIA 4ASWC 2RPVA 4BKTA 3MTNB 5CTRC 2Z0EB 1VZ7A 3R2IA 2G4SA 2LHDA 1ZGUB 4WJPA 3PZDA 4ZYNA 3KYCD 3L08A 2LD9A 1C78A 5C3JB 4GOCA 4TQ1A 5AZFA 5J17A 3NOBA 2EMTA 2LI5A 2WQYB 2WHIA 2V3NA 4MGIE 1FIQA 2NS5A 1EU4A 2CJNA 1WGDA 2PMVA 4FJZA 3VRBB 3ZTDA 5LXHA 2BYFA 1DOIA 2BVCA 4MSMB 1D6EC 2IO1B 1AYFA 2DYMA 1TKEA 3MJWA 1R4MI 4MEMA 3V61A 3UI3A 3EA6A 3ZJUA 1SJHD 3MC8A 3APFA 4OZBA 2KDIA 2OEDA 3DBHB 3A33B 3V62A 2WNMA 2FIFA 3PLUA 4HPMB 4XWTA 2IYDB 4W9KA 2YEPF 4HXDA 2Z0DB 3LB8C 2KWVB 4A3PA 3NVWA 1WXMA 1Y56A 1GAQB 5DPRA 4QAYA 4HWIB 4M8MA 1WIAA 3RNFC 3A9KA 2JPHA 3A4RA 1OGWA 1F2RC 1U4AA 1WE7A 2K6QA 4A9AA 1SBBB 2KJ6A 4DHZB 1NYRA 2PVGC 2AQ2B 1XCQL 2BGFA 2ACZB 2PE9A 3IFWB 3T3OA 2LFIA 2LGYA 3Q8EA 1UF0A 2MBOA 1NDDA 3KVFB 2CR5A 4CQNA 3V6CB 3P4RB 1HTQA 1L2NA 5HKHA 3PZ7A 1UGJA 2V4IB 4ZHOA 3L10B 3WANA 2MJEA 4PYUA 2KFKA 2K5PA 1YN3A 4P6VF 2N9EB 2BTEA 4RM9A 3MC0B 3A9KB 1T6BX 2RDGA 2EMSA 2HJ8A 2KD0A 1MHXA 4TQ0A 2FCMA 3ZXVA 3IT4B 2AWTA 4W9JA 2BT6A 4GSWA 2N9XA 4GDKB 1J0GA 3M62B 2JY6A 3N30A 4MM3A 2RD0A 2WXGA 3U4EG 3Q8BA 5DPWA 4WWMA 1WXAA 4E74A 2A5UA 2QILA 1SE4A 3I9V1 1MI0A 4HCNB 4I6PA 3ZQ4A 1BMLC 4IM2A 2KFKB 2JZPA 2M56B 1PGAA 1FFUA 3PO0A 1V1OA 1QT9A 2EELA 2KQSA 2LGDA 3LJ3A 4PYZA 2ZJDA 3A1QA 3R3MA 3EFCA 3T8MA 5JXVA 4ZRQA 3ENEA 1FMAD 3ZDTA 2NCNA 2O6VD 2PLPA 5CHVC 1PQSA 1SGHA 4AJYB 1XF5L 2DWQA 3P4PB 4FN2A 4EE2A 1HZ5A 2M17A 2J0KA 3NZ3A 3QQ8B 3QC8B 4USAA 4MM3B 3H6NA 1WX7A 1KJTA 4NJ7A 2N1WA 2K8CA 2PIAA 3AE6B 2C7NB 4YT0B 3RYTA 2MEKA 4FHKA 2JZZA 1TKGA 1AWDA 4JLCA 2PW9A 3RCZA 2MA9B 3VVWB 3PHXB 1WJ4A 4DXFA 4J3OD 1GOZA 4HCPB 2ZPNA 1PGBA 2Z8LA 3KUCB 3FILA 4A55A 3A1QB 4I6LB 1HXYD 3U7ZA 1C77A 2V1YA 1SIJA 2KC2A 4AOFA 2M19A 2XBBC 2KDBA 1F52A 2PTLA 5JHAA 4ICVA 3BYTB 1FM0D 2KT7A 2N1VA 3DBRB 2IY0B 1E8ZA 1ROEA 1G6JA 1UH6A 1RLFA 2KLGA 3E9SA 4HVBA 1KLVA 3W2DA 1VR9A 4ITKA 1FXIA 4BOZB 2V0GA 3NRZA 4AQ7A 1GC6A 4LTUA 3IVFA 3WIMA 1MJDA 2V4LA 2DBYA 3H8HA 1JCKB 3V05A 4ZRJA 3FILB 3VR9B 1C79A 1WFYA 1JWSD 3PRMB 4RGOS 4WH4A 3DHIC 2BS2B 1UWMA 1OEYA 3Q8CA 2IGGA 2JVCA 4NNJB 1P1AA 1E6EB 4HPLB 3DDCB 3KH0A 1UD7A 1WI0A 1Q5WB 2UYZB 1NENB 2MQJA 2EKEC 1TY2A 2D5GA 2WXNA 2INDC 2GB1A 1T0QC 5AUKA 4WQMA 2BWES 1BXTA 1F9JA 4G50A 1T0RC 3ZTCA 1FEHA 1ET9A 2BW2A 4FA6A 4WIPA 4P7IA 1FNWA 3QAQA 4WWOA 4YSXB 4NJCA 3LXFA 3RI7C 2L0TA 2AX5A 2FAZA 1SF0A 1P0RA 3ONSA 4G11A 1WH3A 2FUG1 3GB1A 3PPAA 4YSYB 2FIDA 2PJHA 5IKCM 3VTWA 2KXJA 4MACA 1J8CA 1F1HA 4L2YA 3ZLZA 5EDSA 1HTOA 4WURA 2N7DA 4HRSA 1GC7A 1KLUD 3UIOB 4MELA 2KJHB 3AEBB 3AV8A 1GB1A 3BYYB 4OVZA 4REZA 4OVUA 4YWGG 3DBRI 1QLBB 1WMHA 2W9NA 1RM6C 3IXSA 3ETRA 2KMMA 4W9GA 2PEAA 1I4RA 3TUOA 3VUXA 5E6PA 2QEJC 3CF6E 3AEAB 2Z59B 4EFOA 5BMIA 4DQOC 2FCQA 2KX0A 1XT9B 5C2TB 2NBVB 5GXGB 4MJSA 5JZEB 5KHQA 2H89B 1HA5A 1S1QB 3BVMA 2L8JA 4ZRIA 2MX2A 5CX3A 1KFYB 3TCAA 2KJRA 2J7QB 1L7YA 5L83A 1STEA 3OLMD 4XX5A 4US8A 1WMHB 2N4FA 2QIEB 2Y5PA 3AEEB 2V9HA 2TSSA 2HTHA 1SSNA 2WWZA 4PS3A 5EE0A 1WM2A 2V3PA 2YVCA 1QILA 4HJGE 1KRHA 4ARCA 4W9HA 1WR1A 1L5PA 2YEPB 2WXIA 4D2KA 1TS5A 3PV1A 4MJSB 1P7FA 1F0ZA 1M4VA 3AN1A 1JWUD 5BYSA 2WX1A 3DVGX 1KH0A 2KK8A 2MW5A 3M3JA 2K3UA 1ZDXA 2IGHA 2K25A 4IC7B 1NBFC 2CJOA 4BKSD 1R4MB 1MHHE 4AUQC 1YOVB 3QA8A 3N3KB 2WXLA 3CWIA 5MPOA 3D32A 1AW7A 1TZOA 2XNAC 1QOAA 4FXCA 1I42A 4BVUC 3O13A 2HE7A 1FCCC 3NS8A 3R2TA 2MBHA 1IBXA 3KLSX 1FRRA 2B76B 2LZ6A 2J4XA 3AE4B 4RF1A 2DYBA 2D10A 5J2RA 2BS3B 2DAJA 3BINA 3NZSA 3T3NA 2L00B 2WLBA 2J53A 3ZKJC 1E0ZA 4J6IA 1EF1A 4NAMA 4ACFA 1LM8B 1IGCA 1YD8U 4W9EA 3TEWA 3W1SA 4IW0A 4NJ6A 1YNTE 5TR5A 4HDOA 3I3TB 1ZXIA 2WS3B 3AMZA 2K1FA 3L17A 1KOTA 1M94A 5C23A 4G0NB 2PVOD 4KGSA 1JROA 4GXBA 4B9KA 3KUDB 4A3OA 2JX5A 4UDUC 4B0MA 4XDCA 3B08A 2D3GA 1BT0A 1A5RA 3RZWC 4BKSA 1WY8A 1IBXB 1LGRA 1E9MA 2D3BA 3NZUA 2KWUB 1JWAD 2G9HD 3IBEA 4K3CA 2IY1B 3BIID 4CO7A 4L1BA 1T0SC 2M8SA 2KOXA 4E3CA 3GS2A 1VDVA 1OTRB 5AZGA 1WXSA 1WE6A 3ZUNA 3TMPB 2MLBA 2LGSA 3B1LX 1C9FA 1ZPSA 1QOBA 5H92C 2YLMA 3V3XA 2AL3A 3IHPC 2RSUA 1I4GA 5G55A 1C4CA 2INCC 4DHJB 1KLGD 3NG0A 2IZVB 4XWWA 4K7WA 1H4RA 3HUIA 4M8NA 4FJYA 2WXOA 1I7HA 2G4DB 4ZOHC 3AH7A 1OEYJ 1MFWA 1RFKA 2ASQA 2GBKA 2INPE 2SAKA 1V49A 1DOXA 4W9DA 2MJDA 2GMIC 4AWJA 4MGYE 2LXAA 1JRPA 1OQRA 1NEKB 2HJ1A 1GG3A 2ZVNA 2JUOA 3VRAB 4NAWA 2MCNB 3P4SB 4XGAB 3DHGC 5IAAC 3QCAA 1C4PA 3NVZA 3B0AA 2GLSA 2N9PC 4B95A 1J19A 2D3CA 4JQWC 3UQBA 4P1CC 2ONQA 4LNNA 1KTKA 3AE2B 3BK1A 2DYOA 4NY0A 3W9CB 1OFFA 2I1JA 3HM3A 2WXQA 2CHWA 2BKRB 4JWSC 1C76A 1PYWD 4XYCA 4I6NB 2PPHA 3GE8C 2KDFB 4F8CB 3V60A 2LASA 1AARA 3GE3C 5TSSA 4KV2A 1GB4A 4FHJA 2JWUA 1N62A 4JL9A 1YJIA 4KKIA 4TKNA 3N9YC 3C19A 1HZ6A 2ZVOA 3NVVA 3PRPB 4NAWB 1VJKA 2H88B 1F77A 2MBEA 3SDLC 3UF8A 2BB6A 1I35A 1T5XD 3B9JA 1L0VB 3EGRA 1JMLA 3Q3JA 3H7SA 1CZPA 3VUYA 1EU3A 1QQRA 2LVQA 1V2YA 1E8WA 1V97A 2MBBB 2RMMA 1VRAB 2G45B 3ZW3A 2J0MA 3BWUD 3RN9C 3L4PA 4FLHA 4CYEA 1E7VA 4LDTB 4EEWA 2QSDA 2ICIA 3J9CA 5L95C 3DPDA 4HPPA 1ZE3D 5EE3A 1EO6A 4YSZB 4PK1A 1N6ZA 3W5VB 1TIFA 1B1ZA 1WJ6A 1ZOYB 4B6WA 2BYEA 3QX1A 2L05A 4N59A 1ISNA 3L0WB 2NTSA 5LNK1 3LYYA 1UZXB 2IBIB 2W82A 2IDYA 1Z2MA 2JF5A 3AE3B 3U2SC 2JYTA 2L83A 4RGTA 2XK5A 4OZCA 5T8IA 2K9XA 4ANXA 2J0JA 2IJ0A 2WX0A 4IWQA 1IYFA 2IO0B 1NYQA 4H2AA 3KWVA 4WAAA 2DZIA 5GMVA 4AJWA 2KTFA 2KWDA 4DDID 2IGDA 3IAS1 4BFRA 2BS4B 1K53A 1FRDA 1CMXB 1V5OA 3BVZA 1XD3B 3Q3OC 3QWZB 2L3ZA 3UINB 1D5ZC 4K1RB 4NQKE 3RNGC 2I1KA 5KHOA 3T9LA 5D6JB 3GP7A 1VLBA 3AEDB 3IG3A 2WXFA 3SFDB 2C9WB 5HI1A 4BOSC 4KSLC 4HKQA 3AXCA 1T3QA 2ZPYA 5JHBA 2C5LC 1SE2A 2XK5B 2KKCA 2MWSB 5BO4B 1YIWA 3JVZX 1P9DU 3ZDMC 2EKIA 1LO5D 5IO9A 1WX8A 3ZRFA 4ANWA 3NJTA 1WRIA 1J7AA 3HRDD 1V1PA 4NPNA 5EE1A 2ZNVB 3A9JA 2AQ3B 2L52A 3OJ3A 2DZJA 4X57B 3TSSA 2DHZA 4NZLB 1FNUA 1SIFA 1JWBD 3CSFA 3VTUA 1K51A 2G3QB 3VFKA 5D3IB 5I4DA 1WYWB 1XCTL 1HQRD 5J18A 1TBEA 4L23A 3RNCC 4W9LA 3NY5A 4AS1A 3QARA 1P98A 2N7JA 4EUTA 1SEBD 2INNE 3P2BA 2V3SA 4K81A 3E56A 2ON8A 2MH7A 4C7YA 1IPGA 1RWSA 3KUZA 4K7SA 3AE8B 4RH6A 1E10A 3DWGC 1PDXA 5HG2A 4MH0E 4WJOA 1UWXA 1MPEA 3R8BA 2SEBD 4ZYSA 1V1PB 2QC8A 1UBQA 2KVRA 3A9JB 1N61A 1C4AA 3PZ8A 1CQVA 3CSTA 3OAWA 4II3B 3ZVVA 3RULA 2VH2A 3WCQA 3N20C 1V6EA 3PRZA 4MH8A 3Q8AA 2R2QA 1RYJA 3AU5A 4MGKE 4II2B 3R66C 1UBIA 3OG5A 3ZJVA 4IKGA 2WXJA 5FKAC 3NUHB 1T0YA 2ZW1A 5IN7A 3VXWA 1NI2A 4XZ4A 4RGNA 3SFEB 2CHXA 2OHFA 1D5MC 2LXCA 3B2GA 4BBNC 1AN8A 4S0RA 4LJOB 1R4NB 3MHZA 4M0WA 2WGSA 3L16A 3UIPB 1HEZE 1YQ3B 2BB5A 5DPTA 2W55A 2GRIA 3AB5A 4DXAB 1EWCA 2C7HA 1ZKHA 2KAJA 5G2NA 2BQQA 1UNSA 4KIKA 4ANVA 1E5WA 2AQ1B 2LWPA 4TUUA 4LNKA 2D3AA 3M63B 2JRHA 1L6VA 3P42A 3Q3FA 4FULA 1YX5B 1YJJA 3VTVA 1L0XB 4C80A 4F1SA 1TS4A 3K9PB 2UWQA 2KVZA 2DX5B 1DYQA 1MVKA 2WDTB 4EOYA 4RGMA 4ZDVA 3DVNU 4GB9A 4KVGB 2ZW0A 1TS2A 2DAFA 4GLSC 2L32A 3V6EB 1WR6E 4MDKE 4M0WB 3C0RB 3URYA 4MGZE 2QDFA 1Q0WB 2JRIB 2NMQA 1TYGB 5FR6A 4S17A 3N1YC 2WU2B 2RPQA 3GZNB 5LLIA 5IP4D 2NBUA 1BUIC 2KANA 3W1YA 3EECA 4KIKB 3ALBA 2BYTA 3APDA 2MRPA 2KQ4X 2VZKB 1TT5B 1MG4A 3SD5A 1J7CA 3N32A 3QK0A 3LDZE 2JXTA 2LHEA 3DBSA 2XEWA 5D2MB 3ZIMA 1D3ZA 2K39A 2KHWB 1V5TA 1GUAB 2KYWA 4DHJD 3P63A 1Y8RC 2DZKA 2LRUA 1XLQA 2CU3A
chains in the Genus database with same CATH topology
2GBMA 1WX9A 1OEYJ 5DPSA 1WM3A 4IM2A 3R7QA 3QHTA 2KFKB 5CHWA 2AYOB 2GBJA 2ASQA 2GBKA 1V49A 4LJPB 2KQSA 3LJ3A 2LGDA 4W9DA 2JWZA 4PYZA 3WAPA 3ZNID 2GMIC 3RZFA 4AWJA 2BKFA 2ZJDA 1C1YB 2O2VA 3A1QA 3MHSD 3R3MA 4MGYE 2LXAA 2KWCA 3AULA 3T8MA 1LXDA 1R4NI 3ENEA 3ZDTA 2MP2A 1GG3A 2ZCBA 2NCNA 2O6VD 2ZVNA 2O6VB 2JUOA 5CHVC 4DBGA 1PQSA 1WZ3A 1SGHA 4W9FA 4AJYB 4NAWA 2MCNB 3VQIA 4FN2A 3H7PA 2R2OA 2M17A 5IAAC 2J0KA 3QCAA 4FADA 3QQ8B 3PHWB 2LRWA 3B0AA 3QC8B 4ICUA 3RT3B 5D7GA 4ZRKA 2N9PC 4HLEA 4B95A 3H6NA 2CU1A 1J19A 1KJTA 1WX7A 4JQWC 4NJ7A 3UQBA 2N1WA 2K8CA 2JXXA 3DOWA 3S2AA 4GN1A 5DCNA 4EZLA 2C7NB 3RYTA 4FHKA 2JZZA 2DYOA 4NY0A 3L54A 3KW5B 2I1JA 2K6DB 3HM3A 1KM7A 4JLCA 2CHWA 3RCZA 2BKRB 2MA9B 3SHQA 3JSVB 1WGYA 3VVWB 2OJRA 4JIOU 1QZEA 3PHXB 3ECIA 5D94A 4I6NB 3VDZA 2PPHA 1WJ4A 2KDFB 4F8CB 4HCPB 2ZPNA 3V60A 1LQBA 1GJZA 5JH5C 3KUCB 2LASA 2GBNA 1AARA 4GDLA 1WJNA 1S3SG 3A4SC 1TGZB 2D2QA 4NQLB 2O2VB 3A1QB 1V9JA 4I6LB 4KV2A 2KDEB 4JGHB 4KZ0A 3TIXA 4FHJA 3TJPA 4JL9A 2MP2B 2V1YA 2KC2A 4TKNA 2IO3B 4AOFA 3PVLA 3WAMA 4N9F4 2ZVOA 2XBBC 3PRPB 2KDBA 4CHKA 5JHAA 4NAWB 4ICVA 3L13A 3ZRCA 2MBQA 3H7PB 3TBLD 3U8ZA 2KMCA 2LVPA 2N1VA 2MBEA 3GZNI 3SDLC 2IY0B 4YL8A 1E8ZA 3UF8A 1I35A 1E7UA 1G6JA 1UH6A 3Q3JA 1RLFA 2KLGA 4HVBA 3H7SA 3QIJA 3VUYA 3QJZA 2RGFA 1KLVA 2KFJA 4BOZB 2LVQA 1V2YA 1E8WA 3VHTC 2MBBB 3JW0X 1GC6A 4RMAA 2G45B 3IVFA 2KNBA 3ZW3A 2J0MA 5IA7A 2Y5BB 3WIMA 3R7RA 2DZMA 2V4LA 3W1SC 3VH3B 4FLHA 4CYEA 1E7VA 4LDTD 2NPTA 4LDTB 4ZRJA 4EEWA 1XQQA 4GDLB 2IO2B 3DPDA 5L95C 3U7DA 1WFYA 3PRMB 1EO6A 5E6NA 1RAXA 1OEYA 4DHZE 2L76A 2JVCA 3EHVA 1P1AA 4KZCA 4NNJB 1WJ6A 2M4NA 1WF9A 3JYUA 4IUMB 4B6WA 2K8BA 4DDGD 2BYEA 1JRUA 1K8RB 2L05A 3QX1A 4HPLB 3X23A 4IM3A 3ZNHB 4WQOB 3HM6X 3U30A 2CS4A 3DDCB 4E71A 3KH0A 1ISNA 3L0WB 1UD7A 3ML9A 1WI0A 1Q5WB 2UYZB 3ZO5B 1UZXB 2IBIB 2EKEC 2MQJA 3DBLI 3PGEA 1Z2MA 2WYQA 2KC1A 1E8YA 2JF5A 2KLCA 4W9CA 2RR9A 4IWPA 1IP9A 1FXTB 2XK5A 4IM0A 3RUIB 3OJ4B 3VAWA 3WA0A 1YJ1A 4ANXA 2J0JA 4IWQA 2WX0A 1IYFA 2IO0B 3O65B 1Z5SB 2BWES 4RM8A 2QHOA 1F9JA 3DVGY 3KYDD 3NHEB 4G50A 4WAAA 3ZTCA 2DZIA 4GU2A 4IG7B 5GMVA 1YQBA 4AJWA 2KTFA 1P3QU 2NPTB 4PS8A 4DDID 4FA6A 4P7IA 4BFRA 3QAQA 4WWOA 2L0TA 2FAZA 1CMXB 1P0RA 1WJUA 3ONSA 4G11A 1V5OA 2KO3A 1WH3A 4DWFA 1UGMA 4PS7A 1XD3B 3QWZB 1VD2A 3PPAA 2FIDA 2L3ZA 2PJHA 3UINB 4K1RB 4NQKE 2KXJA 2FUHB 3VTWA 1J8CA 2L7RA 2I1KA 2REXA 5KHOA 3T9LA 3ZLZA 1V86A 5EDSA 3HHMA 1WGRA 5D6JB 2N7DA 4A20A 2LJ5A 1GC7A 3IG3A 3UIOB 4MELA 3DCGA 2KJHB 2C9WB 3WAOA 4BOSC 4KSLC 3AXCA 2D07B 3CMMB 4HDQA 4OVUA 2ZPYA 5JHBA 2KZRA 3BY4B 4KSKC 2C5LC 1VCBA 2XK5B 3DBRI 2KKCA 3ZNZB 1WMHA 2MWSB 4GGQA 1YIWA 2W9NA 5BO4B 3JVZX 3PSEB 1P9DU 3ZDMC 1TZ1A 4OVVA 3DVNV 5AEKB 4G3XB 4W9GA 2PEAA 3M95A 3VUXA 5E6PA 2K8HA 1WX8A 4GDKA 3CF6E 2AL6A 2BWFA 3ZRFA 4ANWA 1E90A 2Z59B 3PLVA 2C60A 4EFOA 4IWOA 2FCQA 2KX0A 1XT9B 4NPNA 2NBVB 2ZNVB 2M1MA 3A9JA 4MJSA 1E8XA 5JZEB 3OJ3A 1RFAA 2DZJA 4X57B 3EC8A 2DHZA 5LXIB 5KHQA 2ZCCA 2ZEQA 4TV3A 1WGGA 4BBNF 1SIFA 1SE9A 5CHFA 2B3AA 4ANUA 3CSFA 3VTUA 2G3QB 3VFKA 4F7ZA 1S1QB 1YX6B 4ASWC 1WYWB 5J18A 2CKHB 2L8JA 1TBEA 2A4ZA 3MTNB 2MX2A 4ZRIA 2N7EA 4BKTA 5CX3A 5CTRC 3TCAA 2Z0EB 2G4SA 4GMVA 2KJRA 2KTRA 3NY5A 4W9LA 2J7QB 3QARA 1L7YA 4EKUA 1ZGUB 3APCA 1P98A 5L83A 4WJPA 3VH4B 4EUTA 1Q1OA 3AU4A 3HK0A 3OLMD 3P2BA 1RRBA 3PZDA 4ZYNA 2V3SA 3KYCD 3L08A 2LD9A 4KDIC 4K81A 4XX5A 1WMHB 2N4FA 4GOCA 4WWPA 4TQ1A 4HJKA 5AZFA 5J17A 3EFUA 2KN5A 1IPGA 3KUZA 3NOBA 2EMTA 2LI5A 4K7SA 1C3TA 2ZZPB 2HTHA 2WWZA 4PS3A 3H9DA 1WM2A 4LCDE 4MGIE 2YVCA 2FCNA 4MH0E 2BPSA 2NS5A 4WJOA 3TL5A 1WGDA 4FJZA 4W9HA 1WR1A 5LXHA 3ZTDA 2BYFA 3ML8A 2VRRB 1UBQA 3PV1A 2KVRA 4MSMB 4WJQA 3A9JB 4MJSB 1ZW7A 1EF5A 2IO1B 1WXVA 2DYMA 3MJWA 4W9IA 2WX1A 1R4MI 3CSTA 3DVGX 1H8CA 3OAWA 2KK8A 4II3B 3ZVVA 3RULA 2MW5A 3M3JA 1UELA 4MEMA 3V61A 1V6EA 3PREA 2K25A 4IC7B 3PTFC 4HK2A 2BYVE 3PRZA 2JT4B 1NBFC 3DBHI 2JZ3B 2R2QA 4BKSD 1TTNA 2KTRB 3AU5A 4MGKE 4II2B 3HIZA 3R66C 3UGBB 1UBIA 3APFA 4AUQC 5E6OA 3SU8X 3QA8A 1V81A 2KDIA 2OOBB 3N3KB 1T0YA 3A33B 3V62A 2FIFA 3PLUA 1NI2A 4HPMB 3D32A 3VXWA 2DENB 2IYDB 3DQVA 4XZ4A 2CHXA 4W9KA 4HXDA 2LXCA 2Z0DB 1WZ0A 2KWVB 1I42A 4BBNC 4A3PA 4LJOB 4DK5A 3L16A 4BVUC 3UIPB 3X0WA 1WXMA 2LVOA 2HE7A 5DPRA 2LGXA 3NS8A 2D11A 2MBHA 3PT2B 5DPTA 4HWIB 2LZ6A 4M8MA 3H1UA 1WIAA 1HE8A 2DYBA 3A9KA 2D10A 5J2RA 2JPHA 4DXAB 3A4RA 2DAJA 3BINA 1OGWA 3NZSA 2C7HA 1ZKHA 2L00B 1U4AA 3ZKJC 1WE7A 2K6QA 2LUEA 5G2NA 4J6IA 1EF1A 4FJVB 4KIKA 2KJ6A 4DHZB 4ANVA 1E5WA 4TUUA 2LWPA 1LM8B 3UQAA 3M63B 2JRHA 3VUWA 1YD8U 4W9EA 4BKGA 5AZHA 2CHZA 2BGFA 3Q3FA 4FULA 2HD5B 1GNUA 2PE9A 1YX5B 3IFWB 3W1SA 2BF8B 4EZKA 4IW0A 2KX3A 4NJ6A 2LGYA 3VTVA 2ZNVC 2MBOA 5TR5A 4HDOA 1NDDA 3I3TB 3KVFB 4AP4C 3K9PB 2CR5A 4F1SA 2UWQA 2DX5B 4EOYA 2WDTB 2K1FA 3L17A 3V6CB 1KOTA 4ZDVA 3DVNU 1M94A 4GB9A 5C23A 2FCSA 4G0NB 4KVGB 4XC2A 2DAFA 3AI5A 1L2NA 4GXBA 1WGHA 3KUDB 4B9KA 4A3OA 5HKHA 3V6EB 1WR6E 4MDKE 3L10B 3WANA 4M0WB 3B08A 3C0RB 3K9OB 4MGZE 2D3GA 4PYUA 2KFKA 1BT0A 1Q0WB 1A5RA 1MG8A 3PS6A 2JRIB 1WY8A 3RZWC 5FR6A 2N9EB 4BKSA 4RM9A 2GBRA 3NZUA 2RPQA 3A9KB 4MSQB 5LLIA 2KWUB 2EMSA 2HJ8A 3IBEA 2L0FA 2KMAA 3RD2A 2KD0A 1LFDA 2NBUA 1EUVB 2IY1B 2FNJB 4TQ0A 2C7MB 2FCMA 4CO7A 2O6VA 2AWTA 2KANA 3W1YA 3ZNGC 2M8SA 2KOXA 3EECA 3ALBA 4KIKB 4E3CA 4FBJB 2NR2A 3APDA 4W9JA 2MRPA 2AEHA 1X1MA 4GSWA 2N9XA 4GDKB 1OTRB 3SD5A 1J0GA 5AZGA 1WXSA 3M62B 1WE6A 2JY6A 3N32A 3LDZE 3QK0A 4GIVA 3TMPB 3ZUNA 4EZJA 3N30A 4WJNA 3DBSA 2MLBA 4MM3A 2MSED 3B1LX 3GOEA 2XEWA 5D2MB 2RD0A 3ZIMA 1D3ZA 2PE6B 4URKA 5DPWA 2KQ7A 2GOWA 2K39A 2KHWB 4K7UA 1V5TA 1GUAB 3WALA 2YLMA 4KDLB 2AL3A 3IHPC 2RSUA 5G55A 4DHJD 2M0XA 1WXAA 1OQYA 4WWNA 4DHJB 5C1ZA 1Y8RC 2IZVB 1H4RA 4K7WA 2DZKA 2LRUA 2A5UA 2NBWB 4I6PA 4E74A 4M8NA 4HCNB 1WRDB 1V80A 3JSVA 4FJYA 2G4DB 2NVUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBM A;  1WX9 A;  1OEY J;  5DPS A;  1WM3 A;  4IM2 A;  3R7Q A;  3QHT A;  2KFK B;  5CHW A;  2AYO B;  2GBJ A;  2ASQ A;  2GBK A;  1V49 A;  4LJP B;  2KQS A;  3LJ3 A;  2LGD A;  4W9D A;  2JWZ A;  4PYZ A;  3WAP A;  3ZNI D;  2GMI C;  3RZF A;  4AWJ A;  2BKF A;  2ZJD A;  1C1Y B;  2O2V A;  3A1Q A;  3MHS D;  3R3M A;  4MGY E;  2LXA A;  2KWC A;  3AUL A;  3T8M A;  1LXD A;  1R4N I;  3ENE A;  3ZDT A;  2MP2 A;  1GG3 A;  2ZCB A;  2NCN A;  2O6V D;  2ZVN A;  2O6V B;  2JUO A;  5CHV C;  4DBG A;  1PQS A;  1WZ3 A;  1SGH A;  4W9F A;  4AJY B;  4NAW A;  2MCN B;  3VQI A;  4FN2 A;  3H7P A;  2R2O A;  2M17 A;  5IAA C;  2J0K A;  3QCA A;  4FAD A;  3QQ8 B;  3PHW B;  2LRW A;  3B0A A;  3QC8 B;  4ICU A;  3RT3 B;  5D7G A;  4ZRK A;  2N9P C;  4HLE A;  4B95 A;  3H6N A;  2CU1 A;  1J19 A;  1KJT A;  1WX7 A;  4JQW C;  4NJ7 A;  3UQB A;  2N1W A;  2K8C A;  2JXX A;  3DOW A;  3S2A A;  4GN1 A;  5DCN A;  4EZL A;  2C7N B;  3RYT A;  4FHK A;  2JZZ A;  2DYO A;  4NY0 A;  3L54 A;  3KW5 B;  2I1J A;  2K6D B;  3HM3 A;  1KM7 A;  4JLC A;  2CHW A;  3RCZ A;  2BKR B;  2MA9 B;  3SHQ A;  3JSV B;  1WGY A;  3VVW B;  2OJR A;  4JIO U;  1QZE A;  3PHX B;  3ECI A;  5D94 A;  4I6N B;  3VDZ A;  2PPH A;  1WJ4 A;  2KDF B;  4F8C B;  4HCP B;  2ZPN A;  3V60 A;  1LQB A;  1GJZ A;  5JH5 C;  3KUC B;  2LAS A;  2GBN A;  1AAR A;  4GDL A;  1WJN A;  1S3S G;  3A4S C;  1TGZ B;  2D2Q A;  4NQL B;  2O2V B;  3A1Q B;  1V9J A;  4I6L B;  4KV2 A;  2KDE B;  4JGH B;  4KZ0 A;  3TIX A;  4FHJ A;  3TJP A;  4JL9 A;  2MP2 B;  2V1Y A;  2KC2 A;  4TKN A;  2IO3 B;  4AOF A;  3PVL A;  3WAM A;  4N9F 4;  2ZVO A;  2XBB C;  3PRP B;  2KDB A;  4CHK A;  5JHA A;  4NAW B;  4ICV A;  3L13 A;  3ZRC A;  2MBQ A;  3H7P B;  3TBL D;  3U8Z A;  2KMC A;  2LVP A;  2N1V A;  2MBE A;  3GZN I;  3SDL C;  2IY0 B;  4YL8 A;  1E8Z A;  3UF8 A;  1I35 A;  1E7U A;  1G6J A;  1UH6 A;  3Q3J A;  1RLF A;  2KLG A;  4HVB A;  3H7S A;  3QIJ A;  3VUY A;  3QJZ A;  2RGF A;  1KLV A;  2KFJ A;  4BOZ B;  2LVQ A;  1V2Y A;  1E8W A;  3VHT C;  2MBB B;  3JW0 X;  1GC6 A;  4RMA A;  2G45 B;  3IVF A;  2KNB A;  3ZW3 A;  2J0M A;  5IA7 A;  2Y5B B;  3WIM A;  3R7R A;  2DZM A;  2V4L A;  3W1S C;  3VH3 B;  4FLH A;  4CYE A;  1E7V A;  4LDT D;  2NPT A;  4LDT B;  4ZRJ A;  4EEW A;  1XQQ A;  4GDL B;  2IO2 B;  3DPD A;  5L95 C;  3U7D A;  1WFY A;  3PRM B;  1EO6 A;  5E6N A;  1RAX A;  1OEY A;  4DHZ E;  2L76 A;  2JVC A;  3EHV A;  1P1A A;  4KZC A;  4NNJ B;  1WJ6 A;  2M4N A;  1WF9 A;  3JYU A;  4IUM B;  4B6W A;  2K8B A;  4DDG D;  2BYE A;  1JRU A;  1K8R B;  2L05 A;  3QX1 A;  4HPL B;  3X23 A;  4IM3 A;  3ZNH B;  4WQO B;  3HM6 X;  3U30 A;  2CS4 A;  3DDC B;  4E71 A;  3KH0 A;  1ISN A;  3L0W B;  1UD7 A;  3ML9 A;  1WI0 A;  1Q5W B;  2UYZ B;  3ZO5 B;  1UZX B;  2IBI B;  2EKE C;  2MQJ A;  3DBL I;  3PGE A;  1Z2M A;  2WYQ A;  2KC1 A;  1E8Y A;  2JF5 A;  2KLC A;  4W9C A;  2RR9 A;  4IWP A;  1IP9 A;  1FXT B;  2XK5 A;  4IM0 A;  3RUI B;  3OJ4 B;  3VAW A;  3WA0 A;  1YJ1 A;  4ANX A;  2J0J A;  4IWQ A;  2WX0 A;  1IYF A;  2IO0 B;  3O65 B;  1Z5S B;  2BWE S;  4RM8 A;  2QHO A;  1F9J A;  3DVG Y;  3KYD D;  3NHE B;  4G50 A;  4WAA A;  3ZTC A;  2DZI A;  4GU2 A;  4IG7 B;  5GMV A;  1YQB A;  4AJW A;  2KTF A;  1P3Q U;  2NPT B;  4PS8 A;  4DDI D;  4FA6 A;  4P7I A;  4BFR A;  3QAQ A;  4WWO A;  2L0T A;  2FAZ A;  1CMX B;  1P0R A;  1WJU A;  3ONS A;  4G11 A;  1V5O A;  2KO3 A;  1WH3 A;  4DWF A;  1UGM A;  4PS7 A;  1XD3 B;  3QWZ B;  1VD2 A;  3PPA A;  2FID A;  2L3Z A;  2PJH A;  3UIN B;  4K1R B;  4NQK E;  2KXJ A;  2FUH B;  3VTW A;  1J8C A;  2L7R A;  2I1K A;  2REX A;  5KHO A;  3T9L A;  3ZLZ A;  1V86 A;  5EDS A;  3HHM A;  1WGR A;  5D6J B;  2N7D A;  4A20 A;  2LJ5 A;  1GC7 A;  3IG3 A;  3UIO B;  4MEL A;  3DCG A;  2KJH B;  2C9W B;  3WAO A;  4BOS C;  4KSL C;  3AXC A;  2D07 B;  3CMM B;  4HDQ A;  4OVU A;  2ZPY A;  5JHB A;  2KZR A;  3BY4 B;  4KSK C;  2C5L C;  1VCB A;  2XK5 B;  3DBR I;  2KKC A;  3ZNZ B;  1WMH A;  2MWS B;  4GGQ A;  1YIW A;  2W9N A;  5BO4 B;  3JVZ X;  3PSE B;  1P9D U;  3ZDM C;  1TZ1 A;  4OVV A;  3DVN V;  5AEK B;  4G3X B;  4W9G A;  2PEA A;  3M95 A;  3VUX A;  5E6P A;  2K8H A;  1WX8 A;  4GDK A;  3CF6 E;  2AL6 A;  2BWF A;  3ZRF A;  4ANW A;  1E90 A;  2Z59 B;  3PLV A;  2C60 A;  4EFO A;  4IWO A;  2FCQ A;  2KX0 A;  1XT9 B;  4NPN A;  2NBV B;  2ZNV B;  2M1M A;  3A9J A;  4MJS A;  1E8X A;  5JZE B;  3OJ3 A;  1RFA A;  2DZJ A;  4X57 B;  3EC8 A;  2DHZ A;  5LXI B;  5KHQ A;  2ZCC A;  2ZEQ A;  4TV3 A;  1WGG A;  4BBN F;  1SIF A;  1SE9 A;  5CHF A;  2B3A A;  4ANU A;  3CSF A;  3VTU A;  2G3Q B;  3VFK A;  4F7Z A;  1S1Q B;  1YX6 B;  4ASW C;  1WYW B;  5J18 A;  2CKH B;  2L8J A;  1TBE A;  2A4Z A;  3MTN B;  2MX2 A;  4ZRI A;  2N7E A;  4BKT A;  5CX3 A;  5CTR C;  3TCA A;  2Z0E B;  2G4S A;  4GMV A;  2KJR A;  2KTR A;  3NY5 A;  4W9L A;  2J7Q B;  3QAR A;  1L7Y A;  4EKU A;  1ZGU B;  3APC A;  1P98 A;  5L83 A;  4WJP A;  3VH4 B;  4EUT A;  1Q1O A;  3AU4 A;  3HK0 A;  3OLM D;  3P2B A;  1RRB A;  3PZD A;  4ZYN A;  2V3S A;  3KYC D;  3L08 A;  2LD9 A;  4KDI C;  4K81 A;  4XX5 A;  1WMH B;  2N4F A;  4GOC A;  4WWP A;  4TQ1 A;  4HJK A;  5AZF A;  5J17 A;  3EFU A;  2KN5 A;  1IPG A;  3KUZ A;  3NOB A;  2EMT A;  2LI5 A;  4K7S A;  1C3T A;  2ZZP B;  2HTH A;  2WWZ A;  4PS3 A;  3H9D A;  1WM2 A;  4LCD E;  4MGI E;  2YVC A;  2FCN A;  4MH0 E;  2BPS A;  2NS5 A;  4WJO A;  3TL5 A;  1WGD A;  4FJZ A;  4W9H A;  1WR1 A;  5LXH A;  3ZTD A;  2BYF A;  3ML8 A;  2VRR B;  1UBQ A;  3PV1 A;  2KVR A;  4MSM B;  4WJQ A;  3A9J B;  4MJS B;  1ZW7 A;  1EF5 A;  2IO1 B;  1WXV A;  2DYM A;  3MJW A;  4W9I A;  2WX1 A;  1R4M I;  3CST A;  3DVG X;  1H8C A;  3OAW A;  2KK8 A;  4II3 B;  3ZVV A;  3RUL A;  2MW5 A;  3M3J A;  1UEL A;  4MEM A;  3V61 A;  1V6E A;  3PRE A;  2K25 A;  4IC7 B;  3PTF C;  4HK2 A;  2BYV E;  3PRZ A;  2JT4 B;  1NBF C;  3DBH I;  2JZ3 B;  2R2Q A;  4BKS D;  1TTN A;  2KTR B;  3AU5 A;  4MGK E;  4II2 B;  3HIZ A;  3R66 C;  3UGB B;  1UBI A;  3APF A;  4AUQ C;  5E6O A;  3SU8 X;  3QA8 A;  1V81 A;  2KDI A;  2OOB B;  3N3K B;  1T0Y A;  3A33 B;  3V62 A;  2FIF A;  3PLU A;  1NI2 A;  4HPM B;  3D32 A;  3VXW A;  2DEN B;  2IYD B;  3DQV A;  4XZ4 A;  2CHX A;  4W9K A;  4HXD A;  2LXC A;  2Z0D B;  1WZ0 A;  2KWV B;  1I42 A;  4BBN C;  4A3P A;  4LJO B;  4DK5 A;  3L16 A;  4BVU C;  3UIP B;  3X0W A;  1WXM A;  2LVO A;  2HE7 A;  5DPR A;  2LGX A;  3NS8 A;  2D11 A;  2MBH A;  3PT2 B;  5DPT A;  4HWI B;  2LZ6 A;  4M8M A;  3H1U A;  1WIA A;  1HE8 A;  2DYB A;  3A9K A;  2D10 A;  5J2R A;  2JPH A;  4DXA B;  3A4R A;  2DAJ A;  3BIN A;  1OGW A;  3NZS A;  2C7H A;  1ZKH A;  2L00 B;  1U4A A;  3ZKJ C;  1WE7 A;  2K6Q A;  2LUE A;  5G2N A;  4J6I A;  1EF1 A;  4FJV B;  4KIK A;  2KJ6 A;  4DHZ B;  4ANV A;  1E5W A;  4TUU A;  2LWP A;  1LM8 B;  3UQA A;  3M63 B;  2JRH A;  3VUW A;  1YD8 U;  4W9E A;  4BKG A;  5AZH A;  2CHZ A;  2BGF A;  3Q3F A;  4FUL A;  2HD5 B;  1GNU A;  2PE9 A;  1YX5 B;  3IFW B;  3W1S A;  2BF8 B;  4EZK A;  4IW0 A;  2KX3 A;  4NJ6 A;  2LGY A;  3VTV A;  2ZNV C;  2MBO A;  5TR5 A;  4HDO A;  1NDD A;  3I3T B;  3KVF B;  4AP4 C;  3K9P B;  2CR5 A;  4F1S A;  2UWQ A;  2DX5 B;  4EOY A;  2WDT B;  2K1F A;  3L17 A;  3V6C B;  1KOT A;  4ZDV A;  3DVN U;  1M94 A;  4GB9 A;  5C23 A;  2FCS A;  4G0N B;  4KVG B;  4XC2 A;  2DAF A;  3AI5 A;  1L2N A;  4GXB A;  1WGH A;  3KUD B;  4B9K A;  4A3O A;  5HKH A;  3V6E B;  1WR6 E;  4MDK E;  3L10 B;  3WAN A;  4M0W B;  3B08 A;  3C0R B;  3K9O B;  4MGZ E;  2D3G A;  4PYU A;  2KFK A;  1BT0 A;  1Q0W B;  1A5R A;  1MG8 A;  3PS6 A;  2JRI B;  1WY8 A;  3RZW C;  5FR6 A;  2N9E B;  4BKS A;  4RM9 A;  2GBR A;  3NZU A;  2RPQ A;  3A9K B;  4MSQ B;  5LLI A;  2KWU B;  2EMS A;  2HJ8 A;  3IBE A;  2L0F A;  2KMA A;  3RD2 A;  2KD0 A;  1LFD A;  2NBU A;  1EUV B;  2IY1 B;  2FNJ B;  4TQ0 A;  2C7M B;  2FCM A;  4CO7 A;  2O6V A;  2AWT A;  2KAN A;  3W1Y A;  3ZNG C;  2M8S A;  2KOX A;  3EEC A;  3ALB A;  4KIK B;  4E3C A;  4FBJ B;  2NR2 A;  3APD A;  4W9J A;  2MRP A;  2AEH A;  1X1M A;  4GSW A;  2N9X A;  4GDK B;  1OTR B;  3SD5 A;  1J0G A;  5AZG A;  1WXS A;  3M62 B;  1WE6 A;  2JY6 A;  3N32 A;  3LDZ E;  3QK0 A;  4GIV A;  3TMP B;  3ZUN A;  4EZJ A;  3N30 A;  4WJN A;  3DBS A;  2MLB A;  4MM3 A;  2MSE D;  3B1L X;  3GOE A;  2XEW A;  5D2M B;  2RD0 A;  3ZIM A;  1D3Z A;  2PE6 B;  4URK A;  5DPW A;  2KQ7 A;  2GOW A;  2K39 A;  2KHW B;  4K7U A;  1V5T A;  1GUA B;  3WAL A;  2YLM A;  4KDL B;  2AL3 A;  3IHP C;  2RSU A;  5G55 A;  4DHJ D;  2M0X A;  1WXA A;  1OQY A;  4WWN A;  4DHJ B;  5C1Z A;  1Y8R C;  2IZV B;  1H4R A;  4K7W A;  2DZK A;  2LRU A;  2A5U A;  2NBW B;  4I6P A;  4E74 A;  4M8N A;  4HCN B;  1WRD B;  1V80 A;  3JSV A;  4FJY A;  2G4D B;  2NVU I; 
#chains in the Genus database with same CATH topology
 1SB3 C;  2GBM A;  1WX9 A;  4M01 A;  5DPS A;  1WM3 A;  4M00 A;  2AYO B;  2GBJ A;  2JWZ A;  3ZNI D;  3IAM 1;  2BKF A;  1C1Y B;  2O2V A;  3MHS D;  4YTN B;  1LXD A;  1R4N I;  2MP2 A;  3RFZ B;  2RDB C;  5D3D A;  1N5X A;  3H7P A;  3ZYY X;  3RPF C;  4FAD A;  2LRW A;  4N58 A;  4HLE A;  2CU1 A;  4YTP B;  4EZL A;  5DCN A;  4KKJ A;  2MHJ A;  1WSP A;  2LMC A;  3KW5 B;  2WXP A;  2K6D B;  3SHQ A;  4JIO U;  3ECI A;  5D94 A;  3VDZ A;  5G5H A;  3RMK C;  1GJZ A;  5JH5 C;  3OWE B;  2GBN A;  4C56 C;  1TGZ B;  2D2Q A;  4DK5 A;  2O2V B;  4KZ0 A;  4C4V A;  2KDE B;  4JGH B;  3TIX A;  1XXG A;  3TJP A;  2MP2 B;  2IO3 B;  3WAM A;  3L13 A;  3H7P B;  3U8Z A;  2KMC A;  2LVP A;  2KDM A;  3GZN I;  1DOY A;  4YL8 A;  1ET6 A;  3TEY A;  2WXH A;  5HFY A;  1E7U A;  3AM9 A;  3QIJ A;  3I63 C;  2KFJ A;  2LUM A;  2KN4 A;  3VHT C;  3JW0 X;  4O1N A;  2KNB A;  4KGR A;  3U52 E;  3W1S C;  3VH3 B;  3SEB A;  4LDT D;  2LGI A;  1JWM D;  2IO2 B;  1FCL A;  3U7D A;  1ESF A;  1XLP A;  4C4V B;  2MJ3 A;  5IOI A;  5E6N A;  4DHZ E;  4KZC A;  1N5W A;  4ZRP A;  1WF9 A;  4IUM B;  2K8B A;  2DLB A;  1JRU A;  1K8R B;  3AEG B;  1FXA A;  3X23 A;  4IM3 A;  4WQO B;  3HM6 X;  3U30 A;  1IGD A;  1NVI D;  1FNV A;  3ML9 A;  3ZO5 B;  4IDI A;  3Q6B A;  3DBL I;  4XDD A;  4LLG M;  2WYQ A;  2KC1 A;  1E8Y A;  2OJW A;  3EUB 2;  3AE1 B;  2KLC A;  4W9C A;  2RR9 A;  4IWP A;  1IP9 A;  4IM0 A;  3RUI B;  3OJ4 B;  3VAW A;  1D5X C;  1ENF A;  3WA0 A;  4RM8 A;  2QHO A;  3KYD D;  3DVG Y;  4OW0 A;  4OHJ A;  4GU2 A;  2LEK A;  3SR6 A;  4Q2J A;  3RNA C;  1TY0 A;  1EM7 A;  4PT5 A;  1SJE D;  4DWF A;  2KO3 A;  1UGM A;  5E6J A;  2RDH A;  1VD2 A;  1ACC A;  2JYE A;  1GPX A;  4US9 A;  2FUH B;  3KQ4 A;  1XEE A;  2REX A;  3P1M A;  4A20 A;  2LJ5 A;  2R61 A;  3ZGZ A;  3W5U B;  1ZP0 B;  1CK1 A;  3DCG A;  4P1B C;  1D4B A;  2D07 B;  4HDQ A;  2K22 A;  2KZR A;  3NVY A;  1VCB A;  3ZNZ B;  2L1A A;  4GGQ A;  4B0E A;  1QOF A;  1TZ1 A;  3DVN V;  5AEK B;  4G3X B;  4BZA A;  3RNE C;  3M95 A;  3FKY A;  4GDK A;  2BWF A;  2JU6 X;  2Y5C A;  1E90 A;  5H8Y E;  3PLV A;  2C60 A;  5G5G A;  2NTT A;  4C7Z A;  1DGJ A;  2WP9 B;  4JX1 C;  2M1M A;  1E8X A;  1PFD A;  3AEF B;  1RFA A;  1YN5 A;  3EC8 A;  2ZCC A;  2ZEQ A;  4TV3 A;  5CHF A;  1JW9 D;  4BAX A;  3BK2 A;  1I4X A;  3DWM A;  1NI3 A;  4F7Z A;  4MT5 A;  1YX6 B;  4LNI A;  4XE0 A;  2CKH B;  2A4Z A;  2N7E A;  4GMV A;  2KTR A;  3BVG A;  4EKU A;  3APC A;  3VH4 B;  1EWY C;  1Q1O A;  3AU4 A;  3HK0 A;  1VZ8 A;  1RRB A;  4KDI C;  3I5J C;  3MC9 A;  4P16 A;  4WWP A;  4HJK A;  3EFU A;  2KN5 A;  1C3T A;  2ZZP B;  1I4P A;  3H9D A;  4LCD E;  1L4D B;  2FCN A;  2BPS A;  3TL5 A;  1VZ6 A;  3NS1 A;  3ML8 A;  2VRR B;  2X8X X;  4WJQ A;  1ZW7 A;  1EF5 A;  1WXV A;  2I38 A;  4W9I A;  1H8C A;  1UEL A;  1FFV A;  5HHD G;  4K3B A;  4ARI A;  3PRE A;  3PTF C;  4HK2 A;  2BYV E;  2JT4 B;  3DBH I;  1JAL A;  2JZ3 B;  1TTN A;  2KTR B;  4WAF A;  2E6X A;  3HIZ A;  3UGB B;  1QKZ A;  1L0Y B;  5E6O A;  3SU8 X;  1V81 A;  4RNA A;  2OOB B;  1ZXH A;  3I57 A;  4TSS A;  2DEN B;  3DQV A;  4JPS A;  1WZ0 A;  3TEZ A;  4C00 A;  4KX6 B;  3AE9 B;  3X0W A;  2LVO A;  2LGX A;  1F2R I;  2D11 A;  1L6U A;  1K52 A;  3N1Z C;  3PT2 B;  4JE3 B;  3H1U A;  1HE8 A;  4A8X C;  2LUE A;  4FJV B;  1N63 A;  2W3R A;  5AUI A;  3UQA A;  3VUW A;  1FD6 A;  4BKG A;  5AZH A;  2CHZ A;  2HD5 B;  1GNU A;  4EZK A;  2BF8 B;  1L4Z B;  2KX3 A;  1K50 A;  2ZNV C;  2X38 A;  4AP4 C;  3C8Y A;  2FCS A;  1E7P B;  4XC2 A;  3AI5 A;  1WGH A;  3Q14 C;  2QCZ A;  3K9O B;  1KF6 B;  2FBW B;  3TEX A;  1FO4 A;  1MG8 A;  3PS6 A;  1V8C A;  2GBR A;  1FPY A;  1PUT A;  2WXM A;  2L0F A;  2KMA A;  3RD2 A;  1P7E A;  1LFD A;  2GI9 A;  1EUV B;  3HVD A;  2FNJ B;  2C7M B;  2O6V A;  2WXK A;  3ZNG C;  4A90 A;  2G1E A;  4FBJ B;  1WXQ A;  1IUE A;  2NR2 A;  4OZA A;  2VZK D;  2AEH A;  1X1M A;  4GIV A;  4EZJ A;  4WJN A;  2MSE D;  3GOE A;  2PE6 B;  4URK A;  5BYR A;  2KQ7 A;  2GOW A;  4K7U A;  3WAL A;  4KDL B;  2WU5 B;  2M0X A;  2XN9 C;  1OQY A;  4WWN A;  5C1Z A;  2NBW B;  2N9K A;  1WRD B;  1V80 A;  1XO3 A;  3JSV A;  3ZXR A;  3CIR B;  2NVU I;  4MSQ B;  1SE3 A;  3R7Q A;  3QHT A;  5CHW A;  2J42 A;  4LJP B;  3WAP A;  1SXT A;  3RZF A;  2IPK D;  2KWC A;  3AUL A;  4RFB A;  2ZCB A;  2O6V B;  4DBG A;  1WZ3 A;  4W9F A;  1ZUD 2;  3VQI A;  1CJE A;  3Q69 A;  2R2O A;  2BBC A;  2K0P A;  3Q2A C;  3PHW B;  4ICU A;  3RT3 B;  5D7G A;  4ZRK A;  3FC4 A;  2JSV X;  3DOW A;  2JXX A;  3S2A A;  2N9L A;  4GN1 A;  3IT6 B;  4RF0 A;  3L54 A;  4YXD B;  4R3D A;  1KM7 A;  2QMT A;  3JSV B;  1WGY A;  2OJR A;  1QZE A;  4LK0 M;  3Q3M C;  3Q3N C;  1LQB A;  4GDL A;  1WJN A;  1S3S G;  3A4S C;  4NQL B;  1V9J A;  1B9R A;  3MP9 A;  2Q5W D;  3PVL A;  4N9F 4;  4CHK A;  3ZRC A;  2MBQ A;  2E3T A;  3TBL D;  5BMH A;  3ZJT A;  2WXR A;  2W3S A;  4LNO A;  3MFG A;  3QJZ A;  2RGF A;  2N0S B;  3B2F A;  1J7B A;  3ABV B;  4RMA A;  1I4H A;  1WWT A;  4RCO A;  5IA7 A;  2Y5B B;  2PKO A;  3R7R A;  2DZM A;  2M0A A;  4A6Q A;  1YMH E;  1Q10 A;  2WDV B;  2NPT A;  1XQQ A;  3HVZ A;  4GDL B;  4M02 A;  1QF6 A;  2WDQ B;  5BMG A;  1OQQ A;  2J52 A;  1RAX A;  2L76 A;  3Q8F A;  3EHV A;  2M4N A;  4HEA 1;  1YQ4 B;  3JYU A;  1WYG A;  4DDG D;  3ZNH B;  1JQ4 A;  2CS4 A;  4HRO A;  4E71 A;  2FE8 A;  2WDR B;  2I2Y A;  3PGE A;  4LNF A;  1FXT B;  1YJ1 A;  2HDE A;  5FR3 A;  3DBL B;  3O65 B;  3BZD B;  3VR8 B;  1Z5S B;  1WGK A;  1ZDV A;  3NHE B;  1QOG A;  2QJL A;  4IG7 B;  1YQB A;  3N1X C;  1P3Q U;  2NPT B;  4PS8 A;  2VH1 A;  4N6E B;  3KWL A;  1YN4 A;  3AEC B;  1WJU A;  3AE5 B;  4PS7 A;  1TJE A;  3P4Q B;  3DHH C;  2L7R A;  1TS3 A;  1V86 A;  3HHM A;  1WGR A;  5FK9 C;  4HKZ E;  2Y3A A;  2JQR B;  4TMA B;  2UU7 A;  3WAO A;  2HTM E;  1R7S A;  3CMM B;  5BYQ A;  3AE7 B;  4YTM B;  3BY4 B;  4KSK C;  3MJ5 A;  1XLO A;  3FAH A;  1I4Q A;  3PSE B;  4OVV A;  4IOI E;  5EE9 A;  2KAC A;  2K8H A;  4JWU C;  2W54 A;  2AL6 A;  4IWO A;  4DXG A;  1N60 A;  1UUP A;  4ZHP A;  1TKY A;  4KGT A;  2DNF A;  1XLN A;  3RNB C;  5LXI B;  1A70 A;  1WGG A;  4BBN F;  1SE9 A;  2B3A A;  1PGX A;  4ANU A;  2LJI A;  4ASW C;  2RPV A;  4BKT A;  3MTN B;  5CTR C;  2Z0E B;  1VZ7 A;  3R2I A;  2G4S A;  2LHD A;  1ZGU B;  4WJP A;  3PZD A;  4ZYN A;  3KYC D;  3L08 A;  2LD9 A;  1C78 A;  5C3J B;  4GOC A;  4TQ1 A;  5AZF A;  5J17 A;  3NOB A;  2EMT A;  2LI5 A;  2WQY B;  2WHI A;  2V3N A;  4MGI E;  1FIQ A;  2NS5 A;  1EU4 A;  2CJN A;  1WGD A;  2PMV A;  4FJZ A;  3VRB B;  3ZTD A;  5LXH A;  2BYF A;  1DOI A;  2BVC A;  4MSM B;  1D6E C;  2IO1 B;  1AYF A;  2DYM A;  1TKE A;  3MJW A;  1R4M I;  4MEM A;  3V61 A;  3UI3 A;  3EA6 A;  3ZJU A;  1SJH D;  3MC8 A;  3APF A;  4OZB A;  2KDI A;  2OED A;  3DBH B;  3A33 B;  3V62 A;  2WNM A;  2FIF A;  3PLU A;  4HPM B;  4XWT A;  2IYD B;  4W9K A;  2YEP F;  4HXD A;  2Z0D B;  3LB8 C;  2KWV B;  4A3P A;  3NVW A;  1WXM A;  1Y56 A;  1GAQ B;  5DPR A;  4QAY A;  4HWI B;  4M8M A;  1WIA A;  3RNF C;  3A9K A;  2JPH A;  3A4R A;  1OGW A;  1F2R C;  1U4A A;  1WE7 A;  2K6Q A;  4A9A A;  1SBB B;  2KJ6 A;  4DHZ B;  1NYR A;  2PVG C;  2AQ2 B;  1XCQ L;  2BGF A;  2ACZ B;  2PE9 A;  3IFW B;  3T3O A;  2LFI A;  2LGY A;  3Q8E A;  1UF0 A;  2MBO A;  1NDD A;  3KVF B;  2CR5 A;  4CQN A;  3V6C B;  3P4R B;  1HTQ A;  1L2N A;  5HKH A;  3PZ7 A;  1UGJ A;  2V4I B;  4ZHO A;  3L10 B;  3WAN A;  2MJE A;  4PYU A;  2KFK A;  2K5P A;  1YN3 A;  4P6V F;  2N9E B;  2BTE A;  4RM9 A;  3MC0 B;  3A9K B;  1T6B X;  2RDG A;  2EMS A;  2HJ8 A;  2KD0 A;  1MHX A;  4TQ0 A;  2FCM A;  3ZXV A;  3IT4 B;  2AWT A;  4W9J A;  2BT6 A;  4GSW A;  2N9X A;  4GDK B;  1J0G A;  3M62 B;  2JY6 A;  3N30 A;  4MM3 A;  2RD0 A;  2WXG A;  3U4E G;  3Q8B A;  5DPW A;  4WWM A;  1WXA A;  4E74 A;  2A5U A;  2QIL A;  1SE4 A;  3I9V 1;  1MI0 A;  4HCN B;  4I6P A;  3ZQ4 A;  1BML C;  4IM2 A;  2KFK B;  2JZP A;  2M56 B;  1PGA A;  1FFU A;  3PO0 A;  1V1O A;  1QT9 A;  2EEL A;  2KQS A;  2LGD A;  3LJ3 A;  4PYZ A;  2ZJD A;  3A1Q A;  3R3M A;  3EFC A;  3T8M A;  5JXV A;  4ZRQ A;  3ENE A;  1FMA D;  3ZDT A;  2NCN A;  2O6V D;  2PLP A;  5CHV C;  1PQS A;  1SGH A;  4AJY B;  1XF5 L;  2DWQ A;  3P4P B;  4FN2 A;  4EE2 A;  1HZ5 A;  2M17 A;  2J0K A;  3NZ3 A;  3QQ8 B;  3QC8 B;  4USA A;  4MM3 B;  3H6N A;  1WX7 A;  1KJT A;  4NJ7 A;  2N1W A;  2K8C A;  2PIA A;  3AE6 B;  2C7N B;  4YT0 B;  3RYT A;  2MEK A;  4FHK A;  2JZZ A;  1TKG A;  1AWD A;  4JLC A;  2PW9 A;  3RCZ A;  2MA9 B;  3VVW B;  3PHX B;  1WJ4 A;  4DXF A;  4J3O D;  1GOZ A;  4HCP B;  2ZPN A;  1PGB A;  2Z8L A;  3KUC B;  3FIL A;  4A55 A;  3A1Q B;  4I6L B;  1HXY D;  3U7Z A;  1C77 A;  2V1Y A;  1SIJ A;  2KC2 A;  4AOF A;  2M19 A;  2XBB C;  2KDB A;  1F52 A;  2PTL A;  5JHA A;  4ICV A;  3BYT B;  1FM0 D;  2KT7 A;  2N1V A;  3DBR B;  2IY0 B;  1E8Z A;  1ROE A;  1G6J A;  1UH6 A;  1RLF A;  2KLG A;  3E9S A;  4HVB A;  1KLV A;  3W2D A;  1VR9 A;  4ITK A;  1FXI A;  4BOZ B;  2V0G A;  3NRZ A;  4AQ7 A;  1GC6 A;  4LTU A;  3IVF A;  3WIM A;  1MJD A;  2V4L A;  2DBY A;  3H8H A;  1JCK B;  3V05 A;  4ZRJ A;  3FIL B;  3VR9 B;  1C79 A;  1WFY A;  1JWS D;  3PRM B;  4RGO S;  4WH4 A;  3DHI C;  2BS2 B;  1UWM A;  1OEY A;  3Q8C A;  2IGG A;  2JVC A;  4NNJ B;  1P1A A;  1E6E B;  4HPL B;  3DDC B;  3KH0 A;  1UD7 A;  1WI0 A;  1Q5W B;  2UYZ B;  1NEN B;  2MQJ A;  2EKE C;  1TY2 A;  2D5G A;  2WXN A;  2IND C;  2GB1 A;  1T0Q C;  5AUK A;  4WQM A;  2BWE S;  1BXT A;  1F9J A;  4G50 A;  1T0R C;  3ZTC A;  1FEH A;  1ET9 A;  2BW2 A;  4FA6 A;  4WIP A;  4P7I A;  1FNW A;  3QAQ A;  4WWO A;  4YSX B;  4NJC A;  3LXF A;  3RI7 C;  2L0T A;  2AX5 A;  2FAZ A;  1SF0 A;  1P0R A;  3ONS A;  4G11 A;  1WH3 A;  2FUG 1;  3GB1 A;  3PPA A;  4YSY B;  2FID A;  2PJH A;  5IKC M;  3VTW A;  2KXJ A;  4MAC A;  1J8C A;  1F1H A;  4L2Y A;  3ZLZ A;  5EDS A;  1HTO A;  4WUR A;  2N7D A;  4HRS A;  1GC7 A;  1KLU D;  3UIO B;  4MEL A;  2KJH B;  3AEB B;  3AV8 A;  1GB1 A;  3BYY B;  4OVZ A;  4REZ A;  4OVU A;  4YWG G;  3DBR I;  1QLB B;  1WMH A;  2W9N A;  1RM6 C;  3IXS A;  3ETR A;  2KMM A;  4W9G A;  2PEA A;  1I4R A;  3TUO A;  3VUX A;  5E6P A;  2QEJ C;  3CF6 E;  3AEA B;  2Z59 B;  4EFO A;  5BMI A;  4DQO C;  2FCQ A;  2KX0 A;  1XT9 B;  5C2T B;  2NBV B;  5GXG B;  4MJS A;  5JZE B;  5KHQ A;  2H89 B;  1HA5 A;  1S1Q B;  3BVM A;  2L8J A;  4ZRI A;  2MX2 A;  5CX3 A;  1KFY B;  3TCA A;  2KJR A;  2J7Q B;  1L7Y A;  5L83 A;  1STE A;  3OLM D;  4XX5 A;  4US8 A;  1WMH B;  2N4F A;  2QIE B;  2Y5P A;  3AEE B;  2V9H A;  2TSS A;  2HTH A;  1SSN A;  2WWZ A;  4PS3 A;  5EE0 A;  1WM2 A;  2V3P A;  2YVC A;  1QIL A;  4HJG E;  1KRH A;  4ARC A;  4W9H A;  1WR1 A;  1L5P A;  2YEP B;  2WXI A;  4D2K A;  1TS5 A;  3PV1 A;  4MJS B;  1P7F A;  1F0Z A;  1M4V A;  3AN1 A;  1JWU D;  5BYS A;  2WX1 A;  3DVG X;  1KH0 A;  2KK8 A;  2MW5 A;  3M3J A;  2K3U A;  1ZDX A;  2IGH A;  2K25 A;  4IC7 B;  1NBF C;  2CJO A;  4BKS D;  1R4M B;  1MHH E;  4AUQ C;  1YOV B;  3QA8 A;  3N3K B;  2WXL A;  3CWI A;  5MPO A;  3D32 A;  1AW7 A;  1TZO A;  2XNA C;  1QOA A;  4FXC A;  1I42 A;  4BVU C;  3O13 A;  2HE7 A;  1FCC C;  3NS8 A;  3R2T A;  2MBH A;  1IBX A;  3KLS X;  1FRR A;  2B76 B;  2LZ6 A;  2J4X A;  3AE4 B;  4RF1 A;  2DYB A;  2D10 A;  5J2R A;  2BS3 B;  2DAJ A;  3BIN A;  3NZS A;  3T3N A;  2L00 B;  2WLB A;  2J53 A;  3ZKJ C;  1E0Z A;  4J6I A;  1EF1 A;  4NAM A;  4ACF A;  1LM8 B;  1IGC A;  1YD8 U;  4W9E A;  3TEW A;  3W1S A;  4IW0 A;  4NJ6 A;  1YNT E;  5TR5 A;  4HDO A;  3I3T B;  1ZXI A;  2WS3 B;  3AMZ A;  2K1F A;  3L17 A;  1KOT A;  1M94 A;  5C23 A;  4G0N B;  2PVO D;  4KGS A;  1JRO A;  4GXB A;  4B9K A;  3KUD B;  4A3O A;  2JX5 A;  4UDU C;  4B0M A;  4XDC A;  3B08 A;  2D3G A;  1BT0 A;  1A5R A;  3RZW C;  4BKS A;  1WY8 A;  1IBX B;  1LGR A;  1E9M A;  2D3B A;  3NZU A;  2KWU B;  1JWA D;  2G9H D;  3IBE A;  4K3C A;  2IY1 B;  3BII D;  4CO7 A;  4L1B A;  1T0S C;  2M8S A;  2KOX A;  4E3C A;  3GS2 A;  1VDV A;  1OTR B;  5AZG A;  1WXS A;  1WE6 A;  3ZUN A;  3TMP B;  2MLB A;  2LGS A;  3B1L X;  1C9F A;  1ZPS A;  1QOB A;  5H92 C;  2YLM A;  3V3X A;  2AL3 A;  3IHP C;  2RSU A;  1I4G A;  5G55 A;  1C4C A;  2INC C;  4DHJ B;  1KLG D;  3NG0 A;  2IZV B;  4XWW A;  4K7W A;  1H4R A;  3HUI A;  4M8N A;  4FJY A;  2WXO A;  1I7H A;  2G4D B;  4ZOH C;  3AH7 A;  1OEY J;  1MFW A;  1RFK A;  2ASQ A;  2GBK A;  2INP E;  2SAK A;  1V49 A;  1DOX A;  4W9D A;  2MJD A;  2GMI C;  4AWJ A;  4MGY E;  2LXA A;  1JRP A;  1OQR A;  1NEK B;  2HJ1 A;  1GG3 A;  2ZVN A;  2JUO A;  3VRA B;  4NAW A;  2MCN B;  3P4S B;  4XGA B;  3DHG C;  5IAA C;  3QCA A;  1C4P A;  3NVZ A;  3B0A A;  2GLS A;  2N9P C;  4B95 A;  1J19 A;  2D3C A;  4JQW C;  3UQB A;  4P1C C;  2ONQ A;  4LNN A;  1KTK A;  3AE2 B;  3BK1 A;  2DYO A;  4NY0 A;  3W9C B;  1OFF A;  2I1J A;  3HM3 A;  2WXQ A;  2CHW A;  2BKR B;  4JWS C;  1C76 A;  1PYW D;  4XYC A;  4I6N B;  2PPH A;  3GE8 C;  2KDF B;  4F8C B;  3V60 A;  2LAS A;  1AAR A;  3GE3 C;  5TSS A;  4KV2 A;  1GB4 A;  4FHJ A;  2JWU A;  1N62 A;  4JL9 A;  1YJI A;  4KKI A;  4TKN A;  3N9Y C;  3C19 A;  1HZ6 A;  2ZVO A;  3NVV A;  3PRP B;  4NAW B;  1VJK A;  2H88 B;  1F77 A;  2MBE A;  3SDL C;  3UF8 A;  2BB6 A;  1I35 A;  1T5X D;  3B9J A;  1L0V B;  3EGR A;  1JML A;  3Q3J A;  3H7S A;  1CZP A;  3VUY A;  1EU3 A;  1QQR A;  2LVQ A;  1V2Y A;  1E8W A;  1V97 A;  2MBB B;  2RMM A;  1VRA B;  2G45 B;  3ZW3 A;  2J0M A;  3BWU D;  3RN9 C;  3L4P A;  4FLH A;  4CYE A;  1E7V A;  4LDT B;  4EEW A;  2QSD A;  2ICI A;  3J9C A;  5L95 C;  3DPD A;  4HPP A;  1ZE3 D;  5EE3 A;  1EO6 A;  4YSZ B;  4PK1 A;  1N6Z A;  3W5V B;  1TIF A;  1B1Z A;  1WJ6 A;  1ZOY B;  4B6W A;  2BYE A;  3QX1 A;  2L05 A;  4N59 A;  1ISN A;  3L0W B;  2NTS A;  5LNK 1;  3LYY A;  1UZX B;  2IBI B;  2W82 A;  2IDY A;  1Z2M A;  2JF5 A;  3AE3 B;  3U2S C;  2JYT A;  2L83 A;  4RGT A;  2XK5 A;  4OZC A;  5T8I A;  2K9X A;  4ANX A;  2J0J A;  2IJ0 A;  2WX0 A;  4IWQ A;  1IYF A;  2IO0 B;  1NYQ A;  4H2A A;  3KWV A;  4WAA A;  2DZI A;  5GMV A;  4AJW A;  2KTF A;  2KWD A;  4DDI D;  2IGD A;  3IAS 1;  4BFR A;  2BS4 B;  1K53 A;  1FRD A;  1CMX B;  1V5O A;  3BVZ A;  1XD3 B;  3Q3O C;  3QWZ B;  2L3Z A;  3UIN B;  1D5Z C;  4K1R B;  4NQK E;  3RNG C;  2I1K A;  5KHO A;  3T9L A;  5D6J B;  3GP7 A;  1VLB A;  3AED B;  3IG3 A;  2WXF A;  3SFD B;  2C9W B;  5HI1 A;  4BOS C;  4KSL C;  4HKQ A;  3AXC A;  1T3Q A;  2ZPY A;  5JHB A;  2C5L C;  1SE2 A;  2XK5 B;  2KKC A;  2MWS B;  5BO4 B;  1YIW A;  3JVZ X;  1P9D U;  3ZDM C;  2EKI A;  1LO5 D;  5IO9 A;  1WX8 A;  3ZRF A;  4ANW A;  3NJT A;  1WRI A;  1J7A A;  3HRD D;  1V1P A;  4NPN A;  5EE1 A;  2ZNV B;  3A9J A;  2AQ3 B;  2L52 A;  3OJ3 A;  2DZJ A;  4X57 B;  3TSS A;  2DHZ A;  4NZL B;  1FNU A;  1SIF A;  1JWB D;  3CSF A;  3VTU A;  1K51 A;  2G3Q B;  3VFK A;  5D3I B;  5I4D A;  1WYW B;  1XCT L;  1HQR D;  5J18 A;  1TBE A;  4L23 A;  3RNC C;  4W9L A;  3NY5 A;  4AS1 A;  3QAR A;  1P98 A;  2N7J A;  4EUT A;  1SEB D;  2INN E;  3P2B A;  2V3S A;  4K81 A;  3E56 A;  2ON8 A;  2MH7 A;  4C7Y A;  1IPG A;  1RWS A;  3KUZ A;  4K7S A;  3AE8 B;  4RH6 A;  1E10 A;  3DWG C;  1PDX A;  5HG2 A;  4MH0 E;  4WJO A;  1UWX A;  1MPE A;  3R8B A;  2SEB D;  4ZYS A;  1V1P B;  2QC8 A;  1UBQ A;  2KVR A;  3A9J B;  1N61 A;  1C4A A;  3PZ8 A;  1CQV A;  3CST A;  3OAW A;  4II3 B;  3ZVV A;  3RUL A;  2VH2 A;  3WCQ A;  3N20 C;  1V6E A;  3PRZ A;  4MH8 A;  3Q8A A;  2R2Q A;  1RYJ A;  3AU5 A;  4MGK E;  4II2 B;  3R66 C;  1UBI A;  3OG5 A;  3ZJV A;  4IKG A;  2WXJ A;  5FKA C;  3NUH B;  1T0Y A;  2ZW1 A;  5IN7 A;  3VXW A;  1NI2 A;  4XZ4 A;  4RGN A;  3SFE B;  2CHX A;  2OHF A;  1D5M C;  2LXC A;  3B2G A;  4BBN C;  1AN8 A;  4S0R A;  4LJO B;  1R4N B;  3MHZ A;  4M0W A;  2WGS A;  3L16 A;  3UIP B;  1HEZ E;  1YQ3 B;  2BB5 A;  5DPT A;  2W55 A;  2GRI A;  3AB5 A;  4DXA B;  1EWC A;  2C7H A;  1ZKH A;  2KAJ A;  5G2N A;  2BQQ A;  1UNS A;  4KIK A;  4ANV A;  1E5W A;  2AQ1 B;  2LWP A;  4TUU A;  4LNK A;  2D3A A;  3M63 B;  2JRH A;  1L6V A;  3P42 A;  3Q3F A;  4FUL A;  1YX5 B;  1YJJ A;  3VTV A;  1L0X B;  4C80 A;  4F1S A;  1TS4 A;  3K9P B;  2UWQ A;  2KVZ A;  2DX5 B;  1DYQ A;  1MVK A;  2WDT B;  4EOY A;  4RGM A;  4ZDV A;  3DVN U;  4GB9 A;  4KVG B;  2ZW0 A;  1TS2 A;  2DAF A;  4GLS C;  2L32 A;  3V6E B;  1WR6 E;  4MDK E;  4M0W B;  3C0R B;  3URY A;  4MGZ E;  2QDF A;  1Q0W B;  2JRI B;  2NMQ A;  1TYG B;  5FR6 A;  4S17 A;  3N1Y C;  2WU2 B;  2RPQ A;  3GZN B;  5LLI A;  5IP4 D;  2NBU A;  1BUI C;  2KAN A;  3W1Y A;  3EEC A;  4KIK B;  3ALB A;  2BYT A;  3APD A;  2MRP A;  2KQ4 X;  2VZK B;  1TT5 B;  1MG4 A;  3SD5 A;  1J7C A;  3N32 A;  3QK0 A;  3LDZ E;  2JXT A;  2LHE A;  3DBS A;  2XEW A;  5D2M B;  3ZIM A;  1D3Z A;  2K39 A;  2KHW B;  1V5T A;  1GUA B;  2KYW A;  4DHJ D;  3P63 A;  1Y8R C;  2DZK A;  2LRU A;  1XLQ A;  2CU3 A; 
#chains in the Genus database with same CATH homology
 2GBM A;  1WX9 A;  1OEY J;  5DPS A;  1WM3 A;  4IM2 A;  3R7Q A;  3QHT A;  2KFK B;  5CHW A;  2AYO B;  2GBJ A;  2ASQ A;  2GBK A;  1V49 A;  4LJP B;  2KQS A;  3LJ3 A;  2LGD A;  4W9D A;  2JWZ A;  4PYZ A;  3WAP A;  3ZNI D;  2GMI C;  3RZF A;  4AWJ A;  2BKF A;  2ZJD A;  1C1Y B;  2O2V A;  3A1Q A;  3MHS D;  3R3M A;  4MGY E;  2LXA A;  2KWC A;  3AUL A;  3T8M A;  1LXD A;  1R4N I;  3ENE A;  3ZDT A;  2MP2 A;  1GG3 A;  2ZCB A;  2NCN A;  2O6V D;  2ZVN A;  2O6V B;  2JUO A;  5CHV C;  4DBG A;  1PQS A;  1WZ3 A;  1SGH A;  4W9F A;  4AJY B;  4NAW A;  2MCN B;  3VQI A;  4FN2 A;  3H7P A;  2R2O A;  2M17 A;  5IAA C;  2J0K A;  3QCA A;  4FAD A;  3QQ8 B;  3PHW B;  2LRW A;  3B0A A;  3QC8 B;  4ICU A;  3RT3 B;  5D7G A;  4ZRK A;  2N9P C;  4HLE A;  4B95 A;  3H6N A;  2CU1 A;  1J19 A;  1KJT A;  1WX7 A;  4JQW C;  4NJ7 A;  3UQB A;  2N1W A;  2K8C A;  2JXX A;  3DOW A;  3S2A A;  4GN1 A;  5DCN A;  4EZL A;  2C7N B;  3RYT A;  4FHK A;  2JZZ A;  2DYO A;  4NY0 A;  3L54 A;  3KW5 B;  2I1J A;  2K6D B;  3HM3 A;  1KM7 A;  4JLC A;  2CHW A;  3RCZ A;  2BKR B;  2MA9 B;  3SHQ A;  3JSV B;  1WGY A;  3VVW B;  2OJR A;  4JIO U;  1QZE A;  3PHX B;  3ECI A;  5D94 A;  4I6N B;  3VDZ A;  2PPH A;  1WJ4 A;  2KDF B;  4F8C B;  4HCP B;  2ZPN A;  3V60 A;  1LQB A;  1GJZ A;  5JH5 C;  3KUC B;  2LAS A;  2GBN A;  1AAR A;  4GDL A;  1WJN A;  1S3S G;  3A4S C;  1TGZ B;  2D2Q A;  4NQL B;  2O2V B;  3A1Q B;  1V9J A;  4I6L B;  4KV2 A;  2KDE B;  4JGH B;  4KZ0 A;  3TIX A;  4FHJ A;  3TJP A;  4JL9 A;  2MP2 B;  2V1Y A;  2KC2 A;  4TKN A;  2IO3 B;  4AOF A;  3PVL A;  3WAM A;  4N9F 4;  2ZVO A;  2XBB C;  3PRP B;  2KDB A;  4CHK A;  5JHA A;  4NAW B;  4ICV A;  3L13 A;  3ZRC A;  2MBQ A;  3H7P B;  3TBL D;  3U8Z A;  2KMC A;  2LVP A;  2N1V A;  2MBE A;  3GZN I;  3SDL C;  2IY0 B;  4YL8 A;  1E8Z A;  3UF8 A;  1I35 A;  1E7U A;  1G6J A;  1UH6 A;  3Q3J A;  1RLF A;  2KLG A;  4HVB A;  3H7S A;  3QIJ A;  3VUY A;  3QJZ A;  2RGF A;  1KLV A;  2KFJ A;  4BOZ B;  2LVQ A;  1V2Y A;  1E8W A;  3VHT C;  2MBB B;  3JW0 X;  1GC6 A;  4RMA A;  2G45 B;  3IVF A;  2KNB A;  3ZW3 A;  2J0M A;  5IA7 A;  2Y5B B;  3WIM A;  3R7R A;  2DZM A;  2V4L A;  3W1S C;  3VH3 B;  4FLH A;  4CYE A;  1E7V A;  4LDT D;  2NPT A;  4LDT B;  4ZRJ A;  4EEW A;  1XQQ A;  4GDL B;  2IO2 B;  3DPD A;  5L95 C;  3U7D A;  1WFY A;  3PRM B;  1EO6 A;  5E6N A;  1RAX A;  1OEY A;  4DHZ E;  2L76 A;  2JVC A;  3EHV A;  1P1A A;  4KZC A;  4NNJ B;  1WJ6 A;  2M4N A;  1WF9 A;  3JYU A;  4IUM B;  4B6W A;  2K8B A;  4DDG D;  2BYE A;  1JRU A;  1K8R B;  2L05 A;  3QX1 A;  4HPL B;  3X23 A;  4IM3 A;  3ZNH B;  4WQO B;  3HM6 X;  3U30 A;  2CS4 A;  3DDC B;  4E71 A;  3KH0 A;  1ISN A;  3L0W B;  1UD7 A;  3ML9 A;  1WI0 A;  1Q5W B;  2UYZ B;  3ZO5 B;  1UZX B;  2IBI B;  2EKE C;  2MQJ A;  3DBL I;  3PGE A;  1Z2M A;  2WYQ A;  2KC1 A;  1E8Y A;  2JF5 A;  2KLC A;  4W9C A;  2RR9 A;  4IWP A;  1IP9 A;  1FXT B;  2XK5 A;  4IM0 A;  3RUI B;  3OJ4 B;  3VAW A;  3WA0 A;  1YJ1 A;  4ANX A;  2J0J A;  4IWQ A;  2WX0 A;  1IYF A;  2IO0 B;  3O65 B;  1Z5S B;  2BWE S;  4RM8 A;  2QHO A;  1F9J A;  3DVG Y;  3KYD D;  3NHE B;  4G50 A;  4WAA A;  3ZTC A;  2DZI A;  4GU2 A;  4IG7 B;  5GMV A;  1YQB A;  4AJW A;  2KTF A;  1P3Q U;  2NPT B;  4PS8 A;  4DDI D;  4FA6 A;  4P7I A;  4BFR A;  3QAQ A;  4WWO A;  2L0T A;  2FAZ A;  1CMX B;  1P0R A;  1WJU A;  3ONS A;  4G11 A;  1V5O A;  2KO3 A;  1WH3 A;  4DWF A;  1UGM A;  4PS7 A;  1XD3 B;  3QWZ B;  1VD2 A;  3PPA A;  2FID A;  2L3Z A;  2PJH A;  3UIN B;  4K1R B;  4NQK E;  2KXJ A;  2FUH B;  3VTW A;  1J8C A;  2L7R A;  2I1K A;  2REX A;  5KHO A;  3T9L A;  3ZLZ A;  1V86 A;  5EDS A;  3HHM A;  1WGR A;  5D6J B;  2N7D A;  4A20 A;  2LJ5 A;  1GC7 A;  3IG3 A;  3UIO B;  4MEL A;  3DCG A;  2KJH B;  2C9W B;  3WAO A;  4BOS C;  4KSL C;  3AXC A;  2D07 B;  3CMM B;  4HDQ A;  4OVU A;  2ZPY A;  5JHB A;  2KZR A;  3BY4 B;  4KSK C;  2C5L C;  1VCB A;  2XK5 B;  3DBR I;  2KKC A;  3ZNZ B;  1WMH A;  2MWS B;  4GGQ A;  1YIW A;  2W9N A;  5BO4 B;  3JVZ X;  3PSE B;  1P9D U;  3ZDM C;  1TZ1 A;  4OVV A;  3DVN V;  5AEK B;  4G3X B;  4W9G A;  2PEA A;  3M95 A;  3VUX A;  5E6P A;  2K8H A;  1WX8 A;  4GDK A;  3CF6 E;  2AL6 A;  2BWF A;  3ZRF A;  4ANW A;  1E90 A;  2Z59 B;  3PLV A;  2C60 A;  4EFO A;  4IWO A;  2FCQ A;  2KX0 A;  1XT9 B;  4NPN A;  2NBV B;  2ZNV B;  2M1M A;  3A9J A;  4MJS A;  1E8X A;  5JZE B;  3OJ3 A;  1RFA A;  2DZJ A;  4X57 B;  3EC8 A;  2DHZ A;  5LXI B;  5KHQ A;  2ZCC A;  2ZEQ A;  4TV3 A;  1WGG A;  4BBN F;  1SIF A;  1SE9 A;  5CHF A;  2B3A A;  4ANU A;  3CSF A;  3VTU A;  2G3Q B;  3VFK A;  4F7Z A;  1S1Q B;  1YX6 B;  4ASW C;  1WYW B;  5J18 A;  2CKH B;  2L8J A;  1TBE A;  2A4Z A;  3MTN B;  2MX2 A;  4ZRI A;  2N7E A;  4BKT A;  5CX3 A;  5CTR C;  3TCA A;  2Z0E B;  2G4S A;  4GMV A;  2KJR A;  2KTR A;  3NY5 A;  4W9L A;  2J7Q B;  3QAR A;  1L7Y A;  4EKU A;  1ZGU B;  3APC A;  1P98 A;  5L83 A;  4WJP A;  3VH4 B;  4EUT A;  1Q1O A;  3AU4 A;  3HK0 A;  3OLM D;  3P2B A;  1RRB A;  3PZD A;  4ZYN A;  2V3S A;  3KYC D;  3L08 A;  2LD9 A;  4KDI C;  4K81 A;  4XX5 A;  1WMH B;  2N4F A;  4GOC A;  4WWP A;  4TQ1 A;  4HJK A;  5AZF A;  5J17 A;  3EFU A;  2KN5 A;  1IPG A;  3KUZ A;  3NOB A;  2EMT A;  2LI5 A;  4K7S A;  1C3T A;  2ZZP B;  2HTH A;  2WWZ A;  4PS3 A;  3H9D A;  1WM2 A;  4LCD E;  4MGI E;  2YVC A;  2FCN A;  4MH0 E;  2BPS A;  2NS5 A;  4WJO A;  3TL5 A;  1WGD A;  4FJZ A;  4W9H A;  1WR1 A;  5LXH A;  3ZTD A;  2BYF A;  3ML8 A;  2VRR B;  1UBQ A;  3PV1 A;  2KVR A;  4MSM B;  4WJQ A;  3A9J B;  4MJS B;  1ZW7 A;  1EF5 A;  2IO1 B;  1WXV A;  2DYM A;  3MJW A;  4W9I A;  2WX1 A;  1R4M I;  3CST A;  3DVG X;  1H8C A;  3OAW A;  2KK8 A;  4II3 B;  3ZVV A;  3RUL A;  2MW5 A;  3M3J A;  1UEL A;  4MEM A;  3V61 A;  1V6E A;  3PRE A;  2K25 A;  4IC7 B;  3PTF C;  4HK2 A;  2BYV E;  3PRZ A;  2JT4 B;  1NBF C;  3DBH I;  2JZ3 B;  2R2Q A;  4BKS D;  1TTN A;  2KTR B;  3AU5 A;  4MGK E;  4II2 B;  3HIZ A;  3R66 C;  3UGB B;  1UBI A;  3APF A;  4AUQ C;  5E6O A;  3SU8 X;  3QA8 A;  1V81 A;  2KDI A;  2OOB B;  3N3K B;  1T0Y A;  3A33 B;  3V62 A;  2FIF A;  3PLU A;  1NI2 A;  4HPM B;  3D32 A;  3VXW A;  2DEN B;  2IYD B;  3DQV A;  4XZ4 A;  2CHX A;  4W9K A;  4HXD A;  2LXC A;  2Z0D B;  1WZ0 A;  2KWV B;  1I42 A;  4BBN C;  4A3P A;  4LJO B;  4DK5 A;  3L16 A;  4BVU C;  3UIP B;  3X0W A;  1WXM A;  2LVO A;  2HE7 A;  5DPR A;  2LGX A;  3NS8 A;  2D11 A;  2MBH A;  3PT2 B;  5DPT A;  4HWI B;  2LZ6 A;  4M8M A;  3H1U A;  1WIA A;  1HE8 A;  2DYB A;  3A9K A;  2D10 A;  5J2R A;  2JPH A;  4DXA B;  3A4R A;  2DAJ A;  3BIN A;  1OGW A;  3NZS A;  2C7H A;  1ZKH A;  2L00 B;  1U4A A;  3ZKJ C;  1WE7 A;  2K6Q A;  2LUE A;  5G2N A;  4J6I A;  1EF1 A;  4FJV B;  4KIK A;  2KJ6 A;  4DHZ B;  4ANV A;  1E5W A;  4TUU A;  2LWP A;  1LM8 B;  3UQA A;  3M63 B;  2JRH A;  3VUW A;  1YD8 U;  4W9E A;  4BKG A;  5AZH A;  2CHZ A;  2BGF A;  3Q3F A;  4FUL A;  2HD5 B;  1GNU A;  2PE9 A;  1YX5 B;  3IFW B;  3W1S A;  2BF8 B;  4EZK A;  4IW0 A;  2KX3 A;  4NJ6 A;  2LGY A;  3VTV A;  2ZNV C;  2MBO A;  5TR5 A;  4HDO A;  1NDD A;  3I3T B;  3KVF B;  4AP4 C;  3K9P B;  2CR5 A;  4F1S A;  2UWQ A;  2DX5 B;  4EOY A;  2WDT B;  2K1F A;  3L17 A;  3V6C B;  1KOT A;  4ZDV A;  3DVN U;  1M94 A;  4GB9 A;  5C23 A;  2FCS A;  4G0N B;  4KVG B;  4XC2 A;  2DAF A;  3AI5 A;  1L2N A;  4GXB A;  1WGH A;  3KUD B;  4B9K A;  4A3O A;  5HKH A;  3V6E B;  1WR6 E;  4MDK E;  3L10 B;  3WAN A;  4M0W B;  3B08 A;  3C0R B;  3K9O B;  4MGZ E;  2D3G A;  4PYU A;  2KFK A;  1BT0 A;  1Q0W B;  1A5R A;  1MG8 A;  3PS6 A;  2JRI B;  1WY8 A;  3RZW C;  5FR6 A;  2N9E B;  4BKS A;  4RM9 A;  2GBR A;  3NZU A;  2RPQ A;  3A9K B;  4MSQ B;  5LLI A;  2KWU B;  2EMS A;  2HJ8 A;  3IBE A;  2L0F A;  2KMA A;  3RD2 A;  2KD0 A;  1LFD A;  2NBU A;  1EUV B;  2IY1 B;  2FNJ B;  4TQ0 A;  2C7M B;  2FCM A;  4CO7 A;  2O6V A;  2AWT A;  2KAN A;  3W1Y A;  3ZNG C;  2M8S A;  2KOX A;  3EEC A;  3ALB A;  4KIK B;  4E3C A;  4FBJ B;  2NR2 A;  3APD A;  4W9J A;  2MRP A;  2AEH A;  1X1M A;  4GSW A;  2N9X A;  4GDK B;  1OTR B;  3SD5 A;  1J0G A;  5AZG A;  1WXS A;  3M62 B;  1WE6 A;  2JY6 A;  3N32 A;  3LDZ E;  3QK0 A;  4GIV A;  3TMP B;  3ZUN A;  4EZJ A;  3N30 A;  4WJN A;  3DBS A;  2MLB A;  4MM3 A;  2MSE D;  3B1L X;  3GOE A;  2XEW A;  5D2M B;  2RD0 A;  3ZIM A;  1D3Z A;  2PE6 B;  4URK A;  5DPW A;  2KQ7 A;  2GOW A;  2K39 A;  2KHW B;  4K7U A;  1V5T A;  1GUA B;  3WAL A;  2YLM A;  4KDL B;  2AL3 A;  3IHP C;  2RSU A;  5G55 A;  4DHJ D;  2M0X A;  1WXA A;  1OQY A;  4WWN A;  4DHJ B;  5C1Z A;  1Y8R C;  2IZV B;  1H4R A;  4K7W A;  2DZK A;  2LRU A;  2A5U A;  2NBW B;  4I6P A;  4E74 A;  4M8N A;  4HCN B;  1WRD B;  1V80 A;  3JSV A;  4FJY A;  2G4D B;  2NVU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...