2QJLA

Crystal structure of urm1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-related modifier 1
publication title Crystal structure of the dimeric Urm1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qjlA00
4YSZB 2WDRB 4JX1C 1JROA 1N61A 1RM6C 2L52A 4US8A 1YJIA 3AE7B 1FFVA 2AX5A 3VR9B 1KFYB 3AE8B 3AM9A 1A70A 2MJ3A 2E3TA 3KWLA 4N6EB 1NEKB 5EE0A 4C80A 3FAHA 1ZOYB 2QJLA 2W54A 3FC4A 4JWUC 3ZYYX 4N59A 1N5XA 3VRAB 3DWMA 3AEDB 4ZHPA 5G5HA 4YT0B 1DOYA 3CIRB 1DOIA 1JWAD 2FBWB 3AEEB 3AE2B 1JRPA 3AV8A 1FIQA 3DWGC 4FXCA 1QOGA 1XLQA 5AUKA 1NI3A 1I7HA 2L83A 1OQRA 1PUTA 5MPOA 2WU5B 3AEBB 1L6UA 1YQ3B 4WQMA 3AMZA 4P6VF 5AUIA 5C3JB 1WRIA 1RWSA 2ACZB 2G1EA 1E10A 2KAJA 3W5UB 1V8CA 1GPXA 1PFDA 3B2FA 1WXQA 1NVID 1J7BA 3AEFB 1QOFA 3AE3B 2M19A 1L6VA 1F0ZA 3P4PB 3HUIA 1ZUD2 2K9XA 1DOXA 1ZXIA 1FMAD 1OQQA 1SIJA 2BS4B 2K5PA 2BT6A 1AWDA 3W9CB 1E0ZA 1E6EB 2MH7A 3NVVA 5H92C 1QOAA 1L0VB 4ZOHC 4YTMB 3P4QB 3WCQA 1TKEA 1J7CA 2K22A 2BS3B 2W3SA 4US9A 1T3QA 1B9RA 1JALA 1CZPA 3VR8B 2WLBA 3AE9B 3LXFA 2PVOD 3SFEB 4JWSC 1SF0A 2B76B 1YQ4B 3AE4B 3NRZA 3W5VB 4A9AA 4KX6B 1E9MA 3ETRA 1VLBA 1XLOA 1J7AA 1YJJA 1GAQB 1FM0D 1IUEA 2MJDA 4N58A 4YTNB 1WYGA 1OFFA 3AE1B 3AN1A 2PKOA 4ZHOA 1WGKA 3AECB 3HRDD 1JWBD 1N63A 2DBYA 2HTME 3AE5B 1NENB 1QLBB 3AE6B 5G5GA 4C7YA 2W55A 1FXAA 2QIEB 5EE9A 5C2TB 2WDVB 3P63A 3NVWA 1V97A 1JW9D 2H88B 2JQRB 3B2GA 1NYRA 3AB5A 3BIID 3NVZA 3RPFC 1VDVA 4YTPB 1QT9A 1N5WA 4C7ZA 3PO0A 3P4SB 2WDQB 1QF6A 5EE3A 1E7PB 2KMMA 2M56B 1QOBA 4IDIA 1CJEA 1JQ4A 1ZP0B 2JX5A 2WS3B 3LB8C 3L4PA 2WP9B 2WQYB 3ABVB 1VJKA 3EUB2 1TKGA 3SR6A 1KRHA 5EE1A 4LTUA 5H8YE 1FO4A 2H89B 3NS1A 4YSXB 3NVYA 4WWMA 4USAA 2BS2B 3CWIA 2PVGC 2CU3A 2DWQA 1AYFA 1WWTA 1FRRA 5GXGB 2Q5WD 3AEAB 1TJEA 3P4RB 1FRDA 3AEGB 3AH7A 2CJOA 2PIAA 1DGJA 1FXIA 2MJEA 4ITKA 1RFKA 1TKYA 1RYJA 1PDXA 1EWYC 1ROEA 1XLPA 2LEKA 2OHFA 3VRBB 3B9JA 4YXDB 1XLNA 2N0SB 1KF6B 2W3RA 1XO3A 1R7SA 1UWMA 1N62A 4YSYB 1SB3C 2EKIA 3P1MA 2WU2B 2CJNA 3SFDB 2Y5CA 1L5PA 4HRSA 4HROA 1FFUA 1TYGB 3HVZA 1N60A 1NYQA
chains in the Genus database with same CATH superfamily
3TEXA 2KKCA 1R4NI 4A6QA 4XC2A 3QIJA 2V9HA 2CU1A 2JXXA 1FFVA 2KDFB 3FILB 2LWPA 3ALBA 2G3QB 2BWES 1V1PA 3KYCD 4FJVB 4WURA 1UWXA 2L32A 1DOIA 2DYMA 4ZRPA 3IG3A 1EWCA 5MPOA 3RMKC 2KTFA 3PRPB 1L4ZB 2AL6A 4EKUA 2HE7A 1YN5A 1ZDVA 3R3MA 1YX6B 2DYOA 1V5TA 1C79A 3T9LA 1YQBA 5HFYA 1E8XA 2XBBC 5I4DA 2PVOD 2MSED 3AE4B 3P42A 4KX6B 4NPNA 1J7AA 2K8HA 1YJJA 3Q6BA 4RF0A 2PW9A 2BPSA 3AECB 2KANA 1T0SC 4YL8A 4MEMA 1HXYD 1NYRA 4F8CB 2ON8A 1AN8A 4WH4A 2QDFA 3IT6B 4K7SA 4ANWA 3RZWC 2FAZA 1UNSA 1Q1OA 5H8YE 1FO4A 4BFRA 1Z5SB 2WHIA 4HKQA 1XD3B 4WWMA 2IYDB 4DDGD 2LASA 2KN4A 3DBLI 1FRRA 1QKZA 3VTUA 3U2SC 4URKA 2YLMA 3N1ZC 4EZKA 3VRBB 3U8ZA 2KWVB 2AQ2B 3A1QB 2LXCA 1LFDA 1D6EC 3DHHC 3WAMA 2ZCCA 4PS7A 1TYGB 3APFA 4I6LB 4N58A 1KLGD 4HPLB 4US8A 1XF5L 1ZE3D 4DHZB 2FCSA 1PGAA 2VZKD 2WYQA 2PMVA 3VRAB 1V5OA 1XCQL 2BB5A 2FE8A 4S0RA 4GDLB 2QCZA 1YOVB 4NY0A 4UDUC 5D7GA 4IWOA 4ZRIA 4EEWA 4AP4C 2KK8A 4XZ4A 2CHWA 2K5PA 4HDOA 2K25A 3BK1A 3CSTA 2K0PA 1YX5B 3C19A 4WWOA 2MLBA 2X38A 3N3KB 3IVFA 1UH6A 1WGKA 2Z8LA 3MC0B 2RMMA 1C4CA 4CYEA 2W55A 3N32A 4L23A 2CS4A 3EC8A 1TY0A 1XXGA 1VDVA 1EU4A 1WX9A 2CR5A 1V2YA 3PS6A 3VQIA 3WIMA 2PJHA 3GP7A 2GI9A 5DPWA 2JX5A 1WJ4A 3RUIB 2DZKA 2L76A 1QZEA 2L05A 2BYTA 3ZRFA 2KXJA 3M62B 1CQVA 3Q8AA 1TJEA 4MM3A 2JRIB 3ML9A 3PPAA 4OZCA 4NQKE 1LGRA 3SEBA 1SIFA 5BYQA 3OWEB 3M3JA 1SB3C 5DPSA 3CF6E 4A3OA 4ZHOA 4LLGM 1JROA 2CHZA 1RM6C 2KQSA 2L52A 3BYTB 2K8CA 2QSDA 3V62A 4C80A 1SJED 3DBSA 4P1BC 5AZHA 4MT5A 4ACFA 3ZJTA 1V6EA 1WGHA 1YNTE 1MVKA 5J17A 2KX3A 2LVQA 1Y56A 1PGBA 3ZNGC 1OTRB 4EZLA 2PTLA 1WXQA 2TSSA 3EHVA 2Z0DB 3DOWA 2J0JA 3Q3NC 1FEHA 3DVGY 3OAWA 3RN9C 2MH7A 5H92C 1QOAA 2HD5B 4RFBA 2V4IB 4KGRA 1Q10A 1EM7A 1MJDA 3VR8B 2WLBA 5DPTA 3LXFA 3PHWB 1J0GA 1SBBB 3X0WA 1X1MA 4YTNB 1D3ZA 1MHXA 3HHMA 3AN1A 4PYUA 4ANVA 1QLBB 1D5XC 1FXAA 4XX5A 1SE4A 2KYWA 4O1NA 3SHQA 2GLSA 2LGDA 4XDDA 2UWQA 1K50A 4IDIA 2ASQA 1C4AA 2MQJA 1ZPSA 4K81A 4BOSC 2J4XA 3ZXRA 4C56C 1LM8B 2DENB 4OVZA 2KLGA 2G45B 1P0RA 3BVZA 5GXGB 3U7DA 3P4RB 1FRDA 4A3PA 3KH0A 1ZGUB 5LXHA 1GG3A 2LEKA 3A9JB 1EWYC 3DQVA 3QARA 1H4RA 2FUG1 4ZYNA 1Q5WB 1RRBA 3ZDTA 3MP9A 4E74A 2INPE 1EO6A 4YSZB 4WAAA 4IKGA 3B08A 1UGJA 2INCC 4RGNA 3EFCA 3KUDB 2WXFA 1N5XA 2V1YA 3QX1A 2J0MA 1FIQA 2KJ6A 4EZJA 2FNJB 3QHTA 5C3JB 1N6ZA 2BW2A 2WXOA 4OVVA 1VZ6A 1UD7A 3TEZA 1V1OA 3H7PA 1SE3A 1ISNA 1SIJA 4W9GA 1SXTA 4W9JA 2K6QA 3Q2AC 1MG8A 4KZ0A 5IA7A 3WCQA 3QAQA 1C77A 2W3SA 4M01A 1WZ3A 1I4RA 4LNKA 1EUVB 2DYBA 2ZW0A 1YQ4B 4PS8A 2N9EB 4KIKA 2KTRB 1UZXB 2BBCA 1PQSA 4K7WA 3AE5B 3AE6B 2KFKA 2WDVB 3D32A 2LJIA 4ARCA 2BWFA 3X23A 3ENEA 2KZRA 2WDQB 3GB1A 2KQ4X 4IC7B 3DPDA 1BUIC 4IM3A 3E9SA 4ANXA 2IGGA 2XK5A 4L1BA 1YMHE 3L17A 2JZZA 2JZ3B 3H9DA 2RR9A 2GOWA 1V80A 4ZRQA 1L0YB 3ECIA 2LRUA 5FK9C 3PZ7A 2PPHA 1Y8RC 4B0MA 2VRRB 3ZXVA 4LK0M 1LXDA 3ZNZB 2O2VB 4KSKC 1HQRD 2GBRA 3GS2A 4KKJA 3AM9A 2N1VA 3R2IA 3KWLA 4KZCA 1OEYA 4G3XB 3FAHA 2K1FA 3HK0A 3IBEA 3CIRB 2AYOB 1TY2A 4HPPA 3H8HA 1ZKHA 3UIPB 2DZIA 1GB4A 1XQQA 3L08A 5IO9A 3VTVA 2I38A 3AE3B 4WWNA 4DHJD 3P4PB 4ASWC 3ZNID 1RFAA 4L2YA 3Q3FA 3L54A 1SSNA 1MFWA 3NOBA 3LDZE 4CO7A 4D2KA 4US9A 4NJ6A 1LO5D 4A9AA 4MH8A 1V49A 1F0ZA 1IBXB 4N9F4 2KQ7A 1T0RC 2Y3AA 3MC9A 3PREA 1QOBA 1WGGA 4QAYA 1M94A 1GNUA 5EE1A 3IAS1 2JUOA 3NS1A 2O6VB 4BBNC 3U7ZA 2IY1B 3HM6X 4HWIB 2CU3A 4JL9A 3JSVB 4CQNA 3DBRB 3WAPA 1DGJA 1RYJA 1I4QA 2KJHB 5C23A 3PGEA 3ZVVA 2LGXA 3DVNU 4Q2JA 4YSYB 1T5XD 1KTKA 1XCTL 1FFUA 4YT0B 3VUYA 4NNJB 4EE2A 5J2RA 3IHPC 3RD2A 3AE7B 3GOEA 4HVBA 3FILA 1GOZA 3AE8B 5D3IB 1ZOYB 4KVGB 1TS2A 2MBBB 2E6XA 3ZQ4A 3RT3B 4HPMB 5AUKA 3MJ5A 2D3BA 3AI5A 2G1EA 2D3AA 3QC8B 4RCOA 1XEEA 3LJ3A 4GIVA 4B0EA 4NAWB 2K9XA 4LNIA 4NJCA 1D5MC 2VH1A 4RGTA 5AZFA 3I9V1 3MFGA 2L00B 2IO3B 2IO1B 3AU4A 3MJWA 5IOIA 4MJSB 2JT4B 1GAQB 1IUEA 4KGTA 1WYGA 3AE1B 2W82A 2JYTA 2LRWA 2DBYA 2KJRA 4FADA 1TT5B 3APCA 1GJZA 1UBIA 4HCNB 3NVWA 3K9OB 4XDCA 5T8IA 3B2GA 3RPFC 3Q8BA 1BMLC 4WJPA 3ZTDA 3KW5B 2SEBD 2BF8B 3VVWB 3VUXA 3IXSA 4FN2A 1AYFA 4DXGA 3K9PB 3AEAB 2A4ZA 1WXAA 3HIZA 4M0WB 1VZ8A 3OJ4B 4KV2A 3EFUA 1FXIA 2C5LC 3DVNV 5C1ZA 1TKYA 4JQWC 2W3RA 1VRAB 3A1QA 5E6OA 1UELA 1EF5A 1ET9A 3P1MA 3RNBC 3A33B 1L5PA 2MBOA 3OLMD 3R66C 3SDLC 2HTHA 2Z59B 3SU8X 3M95A 2ZJDA 4MSMB 3KUCB 3ZGZA 1QOGA 4GDLA 3O65B 3V60A 1OGWA 2INDC 3AEBB 1YQ3B 4EOYA 3DHGC 1RLFA 2B3AA 4XYCA 4BKSD 1FMAD 1QILA 2LVOA 4LDTB 3VHTC 4YTMB 2N9LA 4TQ0A 4W9KA 1F1HA 4MGYE 5HI1A 3BVGA 5CHVC 3ONSA 3W5VB 3VTWA 4G0NB 4W9HA 4A55A 2K3UA 3MC8A 3W2DA 2PKOA 2JXTA 2MBQA 1WGDA 1CK1A 2HTME 4AWJA 1YN3A 1IGCA 3T3OA 1ZDXA 2MEKA 5BO4B 1FNVA 4P16A 4HLEA 1ZXHA 1AARA 1IYFA 4C7ZA 3ZIMA 2WGSA 4C4VB 2WNMA 2R2OA 3BWUD 3RNCC 2NPTB 4DQOC 1K53A 2XNAC 2DWQA 2V3SA 2Y5BB 3WANA 2OHFA 4PT5A 3QA8A 2J53A 1SE9A 1HA5A 4BKSA 1N61A 3OG5A 5BMIA 1P7EA 1GB1A 2WXNA 2HJ1A 1C1YB 4IG7B 2JZPA 2DAJA 2LMCA 2KMAA 3ZYYX 4JPSA 3AULA 3AV8A 3DWGC 4P1CC 1P7FA 1I7HA 1L6UA 3NZ3A 2LZ6A 4WQMA 1F77A 4GXBA 1F2RC 1WE7A 2R61A 2ZZPB 2IO0B 1ZW7A 3NS8A 2N7DA 5BMHA 2CHXA 1E90A 4BVUC 1TS5A 1E6EB 1WGRA 4DK5A 3TMPB 1L0VB 4ZOHC 2J0KA 2Y5PA 2K6DB 2K22A 4OVUA 1T3QA 1JALA 5D2MB 1G6JA 5L83A 4PK1A 4DHJB 2KC1A 3VXWA 1OFFA 4OZAA 5JHAA 1JMLA 4B9KA 1N63A 3ZLZA 4J3OD 3RNGC 3P63A 2LUEA 1JW9D 4ZDVA 3APDA 1QT9A 5DPRA 1SE2A 4C00A 2MHJA 2MP2B 1KOTA 1VR9A 2FIDA 4LNNA 1P1AA 3ABVB 3EUB2 3SR6A 4AS1A 4NJ7A 2KMCA 5LLIA 2INNE 2D2QA 3VAWA 1K8RB 2MCNB 2RPVA 2V3NA 3A9KB 5E6NA 3A9JA 2FIFA 1ROEA 4KKIA 2J7QB 4JGHB 1CMXB 1P3QU 2WU2B 1ACCA 2QEJC 4HROA 4RH6A 2N9KA 1ZP0B 1T0YA 1NYQA 2LXAA 2D3CA 1VCBA 2OJRA 3Q69A 1A70A 5EE0A 4LJPB 1KLUD 2QJLA 3TBLD 1V9JA 1JWAD 4RGOS 1TZOA 3ZJVA 4P6VF 4FHKA 1WRIA 3DBHB 1I42A 1E8YA 2BYVE 2FCMA 2R2QA 5JH5C 3L16A 3L10B 3EECA 5JXVA 2AQ1B 3KQ4A 2MWSB 3UINB 4AJWA 1I4PA 4BZAA 4B95A 2YEPB 1DYQA 2FCNA 4RM9A 2V0GA 2LUMA 3TUOA 5AZGA 4ANUA 3PLVA 4MACA 4JWSC 3T8MA 2KTRA 2KWUB 5FKAC 2DX5B 1F2RI 2QC8A 5G5GA 4C7YA 2NR2A 5J18A 1D4BA 1Q0WB 1C76A 1V97A 2A5UA 2FUHB 1MHHE 1AW7A 3NVZA 4YTPB 3BK2A 1WMHB 2KN5A 5IKCM 4LCDE 4GLSC 3CSFA 3EGRA 2WS3B 3BZDB 2AL3A 1GUAB 1KRHA 4LNFA 2RDGA 5E6PA 4USAA 2X8XX 1JWMD 2Q5WD 5HKHA 2QMTA 2ZNVB 2WXJA 2I1KA 3PHXB 1MI0A 1XLPA 4FLHA 4DDID 1ENFA 3R7RA 3ZJUA 1R7SA 1UWMA 1TIFA 2WXHA 3P2BA 1ET6A 2Y5CA 3PZDA 3HVZA 1L7YA 1WR6E 4K3BA 2O2VA 1STEA 1D5ZC 1L0XB 2O6VD 3ZW3A 2E3TA 3DBRI 1K51A 3GZNB 4N59A 3DWMA 5D3DA 3S2AA 2GBJA 3DDCB 2RDHA 4IWQA 4NAMA 2L8JA 1KJTA 4BOZB 1E5WA 2KAJA 2NTSA 2ICIA 4A8XC 1NVID 3H1UA 1WZ0A 4DWFA 2IO2B 1V86A 3BYYB 1ZUD2 1M4VA 5GMVA 3JW0X 5EDSA 4H2AA 2BT6A 5HHDG 4WJNA 3ZKJC 1WR1A 4NZLB 4GDKB 1MPEA 2D11A 1WSPA 3IAM1 3NRZA 4JE3B 3VUWA 1C78A 1E9MA 3ETRA 3PT2B 4WWPA 4M8NA 4EFOA 1BT0A 1IBXA 2KVZA 2N1WA 2JF5A 5LXIB 4ICVA 1B1ZA 3I3TB 2JY6A 3RI7C 3QJZA 4OZBA 2M1MA 2GBMA 1HZ6A 2BYEA 1YN4A 1QF6A 3ML8A 2WX0A 3U4EG 2MW5A 3LB8C 3L4PA 3FKYA 4GGQA 4LTUA 2H89B 2O6VA 2GBNA 3KYDD 3CWIA 4KSLC 4BKGA 2IGHA 3N20C 3JSVA 1BXTA 2CJOA 2N9XA 3ZUNA 2NBUA 2BVCA 3AXCA 1XLNA 2N0SB 4WQOB 1C9FA 3IT4B 1GPXA 3R7QA 2BS2B 2WXKA 2N7JA 2WDRB 4JX1C 3DHIC 3VDZA 3NZSA 3UQAA 4MELA 2SAKA 1NEKB 2LGYA 2HJ8A 2DZJA 2KHWB 1P9DU 1EF1A 3IFWB 3I63C 1XLQA 4EUTA 1SEBD 1OEYJ 2JWUA 1V8CA 1PFDA 4M00A 3UI3A 2LHDA 1J7BA 1QOFA 3N1XC 4II2B 2M19A 1L6VA 2IJ0A 4NAWA 3UIOB 2G9HD 2KVRA 1ZXIA 2NBVB 4W9EA 2LGIA 5JZEB 4REZA 1WX7A 1LQBA 2G4DB 5BYSA 2NMQA 2PEAA 3AE9B 2ZCBA 3NY5A 3LYYA 1UGMA 2KFJA 1E8WA 2IY0B 4MJSA 3V6CB 5G2NA 1FM0D 2N7EA 1HZ5A 3HRDD 1NBFC 1JWBD 2KNBA 3H6NA 1S3SG 4HK2A 2RDBC 2JQRB 1YIWA 2DAFA 2KD0A 2KLCA 2KWCA 4LDTD 1V81A 1A5RA 1E7PB 2KMMA 5E6JA 2JPHA 4FHJA 1R4MB 1VJKA 3RCZA 2JU6X 2REXA 2I2YA 4ZRJA 1WWTA 2WDTB 3CMMB 3DVGX 4JIOU 4M0WA 4ARIA 3V05A 1RFKA 1WXSA 1PDXA 1P98A 4K1RB 4F1SA 3Q8EA 2GMIC 3Q14C 1HTOA 2PE6B 3TIXA 3Q8FA 3WAOA 2WXGA 2AX5A 1KFYB 2MJ3A 1YJ1A 4IW0A 4JWUC 3PV1A 1V1PB 2KDEB 3E56A 2FBWB 1WY8A 1C3TA 4FXCA 1PYWD 2L83A 2WU5B 2KX0A 3W1YA 1K52A 2ACZB 1EU3A 4K7UA 2YEPF 1Z2MA 2EELA 2DZMA 1UBQA 2M0AA 2NS5A 2BS4B 4W9CA 2DHZA 3W9CB 4WIPA 3I57A 3A4SC 4HJKA 2BS3B 5IP4D 1JWUD 4ICUA 3V61A 1WJUA 4TV3A 2ONQA 2LD9A 4RGMA 4OHJA 1KLVA 2XN9C 4GMVA 2LGSA 2DLBA 1SGHA 1F52A 2QIEB 2KWDA 4MH0E 1FCLA 4J6IA 3U52E 3ZRCA 3T3NA 4MGIE 3P4SB 1WIAA 2KDIA 2RGFA 2UU7A 1WJNA 2Z0EB 4IM2A 4C4VA 2ZNVC 3PLUA 3SD5A 2NPTA 3VFKA 4YSXB 1J8CA 2LI5A 3NVYA 2L0FA 1R4NB 2PVGC 3AEGB 3AH7A 2D5GA 1RAXA 4XWWA 4ITKA 3TJPA 2QHOA 3TEWA 4DXAB 5JHBA 2BTEA 2JVCA 2C7MB 2IGDA 1H8CA 2CJNA 3TL5A 3B1LX 4BAXA 1N60A 1WYWB 4GB9A 4RMAA 2M0XA 3RULA 3TCAA 4R3DA 1WE6A 2J42A 3I5JC 3M63B 1HEZE 3MHZA 4N6EB 2L1AA 2W54A 1DOYA 3AEEB 2M4NA 1JRPA 1YD8U 5BMGA 1NI3A 3Q3JA 1PUTA 3N1YC 3NG0A 1UUPA 3VH3B 4IM0A 1E10A 2KACA 3W5UB 4DHZE 2QILA 1XT9B 4HCPB 2PLPA 3TEYA 4PYZA 1FNUA 3PSEB 3OJ3A 3Q8CA 3NVVA 5G55A 3P4QB 1TKEA 2WXQA 3DBHI 4GU2A 1I4HA 2M8SA 2KOXA 4AUQC 3HVDA 1WJ6A 3PVLA 2G4SA 2C60A 3JYUA 3NHEB 1L2NA 1JWSD 1IPGA 5EE9A 1WM2A 2H88B 3AB5A 1GC7A 2V4LA 1MG4A 3DBLB 3QCAA 3PRMB 2MP2A 2KDMA 3PO0A 4ZRKA 3PTFC 2K8BA 3V6EB 4RM8A 4IWPA 2LJ5A 2D10A 5L95C 4XGAB 4K3CA 5KHQA 3KLSX 2FCQA 2VZKB 4W9FA 2BGFA 4B6WA 4LJOB 4GN1A 2KDBA 1WXMA 4MM3B 3A9KA 4TKNA 1WRDB 4YXDB 3B9JA 1XO3A 2BB6A 2LFIA 4XE0A 4PS3A 4HRSA 1E8ZA 1I35A 2K39A 2OEDA 3O13A 2C7HA 3GE8C 3U30A 1FD6A 2ZPYA 4I6PA 3AEDB 4F7ZA 2M17A 5CTRC 3J9CA 3QWZB 5IN7A 1JRUA 1TS3A 3W1SC 4FJYA 3ZNHB 1WH3A 3AEFB 3BVMA 4M8MA 4X57B 2AWTA 3UGBB 1F9JA 4FULA 1WI0A 3GZNI 4IUMB 4RNAA 5DCNA 4TUUA 4HKZE 3UQBA 1AWDA 1E0ZA 3C0RB 1TBEA 2JYEA 3AU5A 2BKRB 2LVPA 2WXLA 1WGYA 3RYTA 1CZPA 1U4AA 1WX8A 3JVZX 3SFEB 1SF0A 2D3GA 2ZVOA 1FXTB 3NUHB 5FR6A 2AEHA 2N4FA 1HTQA 2EMTA 4FBJB 2PE9A 1WF9A 3BIID 4G11A 2NCNA 4AOFA 1N5WA 1WMHA 3Q3MC 2DNFA 1FPYA 2ZW1A 1CJEA 1TZ1A 4OW0A 4WJOA 5HG2A 2MRPA 2WP9B 1TKGA 4S17A 3N9YC 4FJZA 2D07B 4P7IA 3C8YA 5D6JB 1VZ7A 4MGZE 4AJYB 1GC6A 5KHOA 4KDIC 2WX1A 3L13A 2PIAA 2W9NA 2EMSA 4DBGA 4NQLB 3BINA 4DXFA 2EKIA 2IZVB 2WXMA 4E71A 5D94A 3VR9B 2RSUA 3KWVA 4YWGG 2L7RA 3FC4A 2JWZA 4I6NB 4ZHPA 4IOIE 4WAFA 1J19A 4TQ1A 3RNEC 2BQQA 1OQRA 2MBEA 5AUIA 4HXDA 1OQYA 2GB1A 2UYZB 3RNFC 1C4PA 2NTTA 3H7PB 2GRIA 1DOXA 5CHWA 3ZO5B 1OQQA 3L0WB 3GE3C 2CKHB 2IBIB 2OOBB 4GDKA 1J7CA 4GSWA 3VH4B 3TSSA 1IP9A 2B76B 5CX3A 2N9PC 4MDKE 1VLBA 4KIKB 3WA0A 3EA6A 4LNOA 2BYFA 3URYA 4RF1A 3KUZA 3MHSD 2ZEQA 4MSQB 3QQ8B 5C2TB 1TTNA 2KFKB 2IDYA 5AEKB 3B0AA 1E7UA 5EE3A 4E3CA 1L4DB 2M56B 2WXPA 1KM7A 1S1QB 4M02A 1QQRA 1WFYA 2V3PA 1JQ4A 1T6BX 2KO3A 2XEWA 1NDDA 2MA9B 4ZYSA 4A20A 4W9DA 2XK5B 2LHEA 1TS4A 4W9LA 2L3ZA 1ESFA 3HM3A 5TSSA 1KF6B 2RD0A 1N62A 1R4MI 2RPQA 3ZDMC 3SFDB 1HE8A 3UF8A 4FA6A 1YJIA 1PGXA 4HJGE 4KGSA 5G5HA 2GBKA 1FNWA 2IPKD 4GOCA 3AE2B 3V3XA 2WXRA 2NVUI 3NZUA 1UF0A 3AMZA 2WWZA 4XWTA 1RWSA 2I1JA 3R8BA 1IGDA 2MBHA 2NBWB 1WXVA 3B2FA 4MGKE 2JRHA 3H7SA 4KDLB 3HUIA 1T0QC 4II3B 5CHFA 3W1SA 4WJQA 2EKEC 2KC2A 5TR5A 5BYRA 3RZFA 2ZVNA 3A4RA 3Q3OC 4AQ7A 1B9RA 3BY4B 1JCKB 2KT7A 1VD2A 4W9IA 2ZPNA 2OJWA 1XLOA 3WALA 2MJDA 2BKFA 4BBNF 1FCCC 1NENB 2VH2A 3RNAC 4TMAB 3PRZA 3PZ8A 2C7NB 3NJTA 3MTNB 3N30A 4HEA1 3QK0A 3DCGA 4CHKA 4A90A 1SJHD 2JSVX 2WXIA 2J52A 2HDEA 5LNK1 2WQYB 3RFZB 2AQ3B 3ZTCA 4HDQA 4BKTA 2YVCA 1I4XA 4G50A 1TGZB 1E7VA 4TSSA 2MJEA 2C9WB 3KVFB 1WM3A 3R2TA 4JLCA 1NI2A 2L0TA 1I4GA 2MX2A 5FR3A 5IAAC 1KH0A
chains in the Genus database with same CATH topology
3TEXA 4LK0M 4A6QA 3Q69A 1HQRD 1FFVA 4R3DA 3GS2A 4KKJA 2J42A 3AM9A 3FILB 1A70A 1HEZE 3KWLA 3MHZA 3R2IA 4N6EB 5EE0A 3FAHA 2L1AA 1KLUD 2QJLA 2W54A 1V1PA 1DOYA 4WURA 1UWXA 2L32A 3CIRB 1DOIA 1JWAD 1TY2A 2DYMA 3AEEB 4ZRPA 3H8HA 1JRPA 5BMGA 1NI3A 4RGOS 1EWCA 1PUTA 5MPOA 1GB4A 1TZOA 3ZJVA 1UUPA 4P6VF 1WRIA 1E10A 2KACA 3W5UB 1L4ZB 2I38A 2QILA 3AE3B 2PLPA 3P4PB 5JXVA 1YN5A 1ZDVA 2AQ1B 3KQ4A 2DYOA 4L2YA 3TEYA 1FNUA 3Q8CA 1SSNA 1C79A 3NVVA 1I4PA 3P4QB 2YEPB 1TKEA 1DYQA 5HFYA 4D2KA 4US9A 2V0GA 2LUMA 3TUOA 2WXQA 5I4DA 1LO5D 2PVOD 4MACA 4JWSC 3AE4B 4A9AA 4MH8A 1I4HA 3P42A 4KX6B 3HVDA 1J7AA 1YJJA 5FKAC 4RF0A 2PW9A 3AECB 1F0ZA 1IBXB 1F2RI 5G5GA 4C7YA 1JWSD 5EE9A 1D4BA 1C76A 1V97A 1HXYD 1MHHE 2H88B 1NYRA 3AB5A 1AW7A 3NVZA 4YTPB 2ON8A 3BK2A 2KDMA 2Y3AA 1AN8A 3PO0A 4WH4A 1QOBA 4GLSC 3EGRA 3IT6B 2WS3B 3BZDB 1UNSA 1KRHA 5EE1A 5H8YE 1FO4A 3IAS1 3KLSX 2RDGA 3NS1A 2VZKB 3U7ZA 4HKQA 4WWMA 4USAA 2CU3A 2KN4A 1JWMD 1FRRA 1QKZA 2Q5WD 3U2SC 2QMTA 2WXJA 4MM3B 4CQNA 1DGJA 1RYJA 1MI0A 1I4QA 1XLPA 3VRBB 1ENFA 4YXDB 3B9JA 2AQ2B 1XO3A 1R7SA 1UWMA 3ZJUA 2BB6A 2LFIA 4Q2JA 4XE0A 4YSYB 1T5XD 2WXHA 1ET6A 1D6EC 1KTKA 2Y5CA 1XCTL 4HRSA 1FFUA 1TYGB 3HVZA 4N58A 4YT0B 4EE2A 1KLGD 1STEA 4US8A 1XF5L 1ZE3D 3AE7B 1D5ZC 1L0XB 2OEDA 3FILA 1GOZA 3AE8B 3O13A 1PGAA 2E3TA 2VZKD 1FD6A 5D3IB 1ZOYB 1K51A 4N59A 2PMVA 3DWMA 1XCQL 2BB5A 3AEDB 5D3DA 3VRAB 2FE8A 1TS2A 2E6XA 3ZQ4A 2RDHA 5AUKA 4GDLB 3MJ5A 3J9CA 4NAMA 1TS3A 2G1EA 4UDUC 2KAJA 5D7GA 4RCOA 2NTSA 2ICIA 4A8XC 1NVID 3AEFB 3BVMA 1XEEA 4B0EA 4NAWB 3BYYB 1ZUD2 1M4VA 2K9XA 4NJCA 4RNAA 1D5MC 4H2AA 2K5PA 4HKZE 2BT6A 5HHDG 1AWDA 1E0ZA 4RGTA 2JYEA 3I9V1 3BK1A 3MFGA 2K0PA 4NZLB 4GDKB 2WXLA 1CZPA 1MPEA 3SFEB 1SF0A 1WSPA 3IAM1 3NRZA 4JE3B 2X38A 3NUHB 1C78A 1E9MA 3ETRA 1GAQB 1IUEA 4KGTA 1WYGA 3AE1B 2W82A 1WGKA 2JYTA 2Z8LA 3MC0B 1IBXA 2DBYA 1C4CA 2RMMA 2W55A 4L23A 1B1ZA 3NVWA 4OZBA 4XDCA 5T8IA 3B2GA 1HZ6A 3BIID 1TY0A 1XXGA 3RPFC 1VDVA 1YN4A 1EU4A 3Q8BA 1N5WA 1BMLC 1QF6A 3VQIA 3GP7A 2GI9A 2ZW1A 3U4EG 1CJEA 2JX5A 3LB8C 3L4PA 4OW0A 5HG2A 2WP9B 1TKGA 3N9YC 2SEBD 4LTUA 2H89B 3C8YA 1VZ7A 2BYTA 3IXSA 3CWIA 1AYFA 4DXGA 1CQVA 2IGHA 3AEAB 3Q8AA 1TJEA 1BXTA 1VZ8A 2CJOA 2PIAA 1FXIA 4OZCA 1TKYA 3SEBA 1XLNA 2N0SB 5BYQA 2W3RA 1VRAB 1C9FA 3OWEB 1ET9A 1SB3C 2EKIA 3P1MA 4DXFA 2WXMA 1L5PA 3IT4B 4ZHOA 1GPXA 2BS2B 4LLGM 2WXKA 2N7JA 2WDRB 4JX1C 1JROA 1RM6C 2L52A 3BYTB 2QSDA 3VR9B 3KWVA 2SAKA 4YWGG 4C80A 1NEKB 1SJED 3FC4A 4ZHPA 4IOIE 4MT5A 4WAFA 3ZJTA 4TQ1A 1YNTE 1MVKA 3ZGZA 1QOGA 1XLQA 1Y56A 1OQRA 3AEBB 5AUIA 1YQ3B 1SEBD 1PGBA 2JWUA 2GB1A 1V8CA 2PTLA 1PFDA 3UI3A 1WXQA 2LHDA 1J7BA 1QOFA 2TSSA 1C4PA 1L6VA 2M19A 2IJ0A 2NTTA 2G9HD 2GRIA 1DOXA 1ZXIA 1FMAD 1OQQA 1FEHA 2LGIA 1QILA 4REZA 2MH7A 5H92C 1QOAA 4RFBA 4YTMB 2N9LA 2V4IB 4TQ0A 4KGRA 1J7CA 1Q10A 1EM7A 5HI1A 3BVGA 5BYSA 3VR8B 2WLBA 2NMQA 3AE9B 3TSSA 3LXFA 2B76B 3LYYA 3W5VB 1SBBB 1VLBA 1FM0D 4YTNB 4A55A 1MHXA 2K3UA 3W2DA 3AN1A 1HZ5A 2PKOA 2JXTA 3EA6A 3HRDD 3URYA 1JWBD 1CK1A 2HTME 4RF1A 1QLBB 1D5XC 1FXAA 1YN3A 1SE4A 1IGCA 3T3OA 5C2TB 4O1NA 1ZDXA 2MEKA 2IDYA 2JQRB 1FNVA 4P16A 4XDDA 1ZXHA 4C7ZA 5EE3A 1K50A 1E7PB 1L4DB 2KMMA 2M56B 2WXPA 4IDIA 5E6JA 1QQRA 2V3PA 1JQ4A 1T6BX 1C4AA 1VJKA 2WNMA 3BWUD 2JU6X 4ZYSA 1ZPSA 4DQOC 1K53A 2J4XA 2XNAC 4C56C 2I2YA 2LHEA 1TS4A 2DWQA 4OVZA 1WWTA 5GXGB 3BVZA 4M0WA 4ARIA 3P4RB 1FRDA 3V05A 1RFKA 2LEKA 1PDXA 1ESFA 1EWYC 2OHFA 4PT5A 5TSSA 2FUG1 1KF6B 1N62A 2J53A 1HA5A 3SFDB 3Q8EA 3MP9A 2INPE 4YSZB 4IKGA 1N61A 3Q8FA 5BMIA 1P7EA 1YJIA 1GB1A 1UGJA 4RGNA 2WXNA 2WXGA 2AX5A 1PGXA 1KFYB 4HJGE 2MJ3A 2JZPA 2LMCA 2WXFA 4JWUC 3ZYYX 1N5XA 4KGSA 1V1PB 5G5HA 3E56A 1FNWA 2FBWB 2IPKD 4JPSA 3AE2B 3V3XA 3AV8A 1FIQA 3DWGC 4FXCA 1P7FA 2WXRA 1I7HA 1PYWD 2L83A 2WU5B 1L6UA 3NZ3A 4WQMA 3AMZA 5C3JB 2BW2A 1F77A 1K52A 4XWTA 1RWSA 2ACZB 2WXOA 1F2RC 1EU3A 3R8BA 1IGDA 3B2FA 2R61A 1VZ6A 2YEPF 2EELA 3TEZA 1V1OA 3HUIA 1SE3A 5BMHA 2M0AA 3W1SA 1SIJA 2BS4B 1SXTA 1TS5A 3W9CB 1E6EB 5BYRA 4WIPA 1L0VB 3I57A 4ZOHC 4AQ7A 3WCQA 2Y5PA 1C77A 2K22A 2BS3B 2W3SA 1T3QA 1B9RA 1JALA 1I4RA 1JWUD 1JCKB 2ZW0A 1YQ4B 1XLOA 2MJDA 2ONQA 1OFFA 2BBCA 4OZAA 4RGMA 1FCCC 4OHJA 1JMLA 2XN9C 3AE5B 1N63A 1NENB 2DLBA 3AE6B 4TMAB 4J3OD 3PZ8A 2QIEB 2WDVB 3P63A 1JW9D 4HEA1 2KWDA 2LJIA 4ARCA 1FCLA 3U52E 3T3NA 1QT9A 1SE2A 4A90A 1SJHD 3P4SB 2WDQB 3GB1A 2JSVX 1VR9A 2KQ4X 2WXIA 2J52A 2HDEA 1BUIC 5LNK1 2WQYB 3ABVB 3EUB2 3SR6A 3RFZB 3E9SA 2AQ3B 2IGGA 4AS1A 4L1BA 4YSXB 2INNE 3NVYA 1I4XA 2PVGC 1YMHE 3AEGB 2RPVA 3AH7A 2D5GA 2V3NA 4TSSA 4XWWA 2MJEA 3R2TA 4ITKA 1ROEA 4KKIA 4ZRQA 3TEWA 1L0YB 1I4GA 2BTEA 2IGDA 2WU2B 2CJNA 5FR3A 1ACCA 2QEJC 5FK9C 4HROA 4RH6A 2N9KA 1KH0A 3PZ7A 1ZP0B 4B0MA 1N60A 1NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSZ B;  2WDR B;  4JX1 C;  1JRO A;  1N61 A;  1RM6 C;  2L52 A;  4US8 A;  1YJI A;  3AE7 B;  1FFV A;  2AX5 A;  3VR9 B;  1KFY B;  3AE8 B;  3AM9 A;  1A70 A;  2MJ3 A;  2E3T A;  3KWL A;  4N6E B;  1NEK B;  5EE0 A;  4C80 A;  3FAH A;  1ZOY B;  2QJL A;  2W54 A;  3FC4 A;  4JWU C;  3ZYY X;  4N59 A;  1N5X A;  3VRA B;  3DWM A;  3AED B;  4ZHP A;  5G5H A;  4YT0 B;  1DOY A;  3CIR B;  1DOI A;  1JWA D;  2FBW B;  3AEE B;  3AE2 B;  1JRP A;  3AV8 A;  1FIQ A;  3DWG C;  4FXC A;  1QOG A;  1XLQ A;  5AUK A;  1NI3 A;  1I7H A;  2L83 A;  1OQR A;  1PUT A;  5MPO A;  2WU5 B;  3AEB B;  1L6U A;  1YQ3 B;  4WQM A;  3AMZ A;  4P6V F;  5AUI A;  5C3J B;  1WRI A;  1RWS A;  2ACZ B;  2G1E A;  1E10 A;  2KAJ A;  3W5U B;  1V8C A;  1GPX A;  1PFD A;  3B2F A;  1WXQ A;  1NVI D;  1J7B A;  3AEF B;  1QOF A;  3AE3 B;  2M19 A;  1L6V A;  1F0Z A;  3P4P B;  3HUI A;  1ZUD 2;  2K9X A;  1DOX A;  1ZXI A;  1FMA D;  1OQQ A;  1SIJ A;  2BS4 B;  2K5P A;  2BT6 A;  1AWD A;  3W9C B;  1E0Z A;  1E6E B;  2MH7 A;  3NVV A;  5H92 C;  1QOA A;  1L0V B;  4ZOH C;  4YTM B;  3P4Q B;  3WCQ A;  1TKE A;  1J7C A;  2K22 A;  2BS3 B;  2W3S A;  4US9 A;  1T3Q A;  1B9R A;  1JAL A;  1CZP A;  3VR8 B;  2WLB A;  3AE9 B;  3LXF A;  2PVO D;  3SFE B;  4JWS C;  1SF0 A;  2B76 B;  1YQ4 B;  3AE4 B;  3NRZ A;  3W5V B;  4A9A A;  4KX6 B;  1E9M A;  3ETR A;  1VLB A;  1XLO A;  1J7A A;  1YJJ A;  1GAQ B;  1FM0 D;  1IUE A;  2MJD A;  4N58 A;  4YTN B;  1WYG A;  1OFF A;  3AE1 B;  3AN1 A;  2PKO A;  4ZHO A;  1WGK A;  3AEC B;  3HRD D;  1JWB D;  1N63 A;  2DBY A;  2HTM E;  3AE5 B;  1NEN B;  1QLB B;  3AE6 B;  5G5G A;  4C7Y A;  2W55 A;  1FXA A;  2QIE B;  5EE9 A;  5C2T B;  2WDV B;  3P63 A;  3NVW A;  1V97 A;  1JW9 D;  2H88 B;  2JQR B;  3B2G A;  1NYR A;  3AB5 A;  3BII D;  3NVZ A;  3RPF C;  1VDV A;  4YTP B;  1QT9 A;  1N5W A;  4C7Z A;  3PO0 A;  3P4S B;  2WDQ B;  1QF6 A;  5EE3 A;  1E7P B;  2KMM A;  2M56 B;  1QOB A;  4IDI A;  1CJE A;  1JQ4 A;  1ZP0 B;  2JX5 A;  2WS3 B;  3LB8 C;  3L4P A;  2WP9 B;  2WQY B;  3ABV B;  1VJK A;  3EUB 2;  1TKG A;  3SR6 A;  1KRH A;  5EE1 A;  4LTU A;  5H8Y E;  1FO4 A;  2H89 B;  3NS1 A;  4YSX B;  3NVY A;  4WWM A;  4USA A;  2BS2 B;  3CWI A;  2PVG C;  2CU3 A;  2DWQ A;  1AYF A;  1WWT A;  1FRR A;  5GXG B;  2Q5W D;  3AEA B;  1TJE A;  3P4R B;  1FRD A;  3AEG B;  3AH7 A;  2CJO A;  2PIA A;  1DGJ A;  1FXI A;  2MJE A;  4ITK A;  1RFK A;  1TKY A;  1RYJ A;  1PDX A;  1EWY C;  1ROE A;  1XLP A;  2LEK A;  2OHF A;  3VRB B;  3B9J A;  4YXD B;  1XLN A;  2N0S B;  1KF6 B;  2W3R A;  1XO3 A;  1R7S A;  1UWM A;  1N62 A;  4YSY B;  1SB3 C;  2EKI A;  3P1M A;  2WU2 B;  2CJN A;  3SFD B;  2Y5C A;  1L5P A;  4HRS A;  4HRO A;  1FFU A;  1TYG B;  3HVZ A;  1N60 A;  1NYQ A; 
#chains in the Genus database with same CATH topology
 3TEX A;  2KKC A;  1R4N I;  4A6Q A;  4XC2 A;  3QIJ A;  2V9H A;  2CU1 A;  2JXX A;  1FFV A;  2KDF B;  3FIL B;  2LWP A;  3ALB A;  2G3Q B;  2BWE S;  1V1P A;  3KYC D;  4FJV B;  4WUR A;  1UWX A;  2L32 A;  1DOI A;  2DYM A;  4ZRP A;  3IG3 A;  1EWC A;  5MPO A;  3RMK C;  2KTF A;  3PRP B;  1L4Z B;  2AL6 A;  4EKU A;  2HE7 A;  1YN5 A;  1ZDV A;  3R3M A;  1YX6 B;  2DYO A;  1V5T A;  1C79 A;  3T9L A;  1YQB A;  5HFY A;  1E8X A;  2XBB C;  5I4D A;  2PVO D;  2MSE D;  3AE4 B;  3P42 A;  4KX6 B;  4NPN A;  1J7A A;  2K8H A;  1YJJ A;  3Q6B A;  4RF0 A;  2PW9 A;  2BPS A;  3AEC B;  2KAN A;  1T0S C;  4YL8 A;  4MEM A;  1HXY D;  1NYR A;  4F8C B;  2ON8 A;  1AN8 A;  4WH4 A;  2QDF A;  3IT6 B;  4K7S A;  4ANW A;  3RZW C;  2FAZ A;  1UNS A;  1Q1O A;  5H8Y E;  1FO4 A;  4BFR A;  1Z5S B;  2WHI A;  4HKQ A;  1XD3 B;  4WWM A;  2IYD B;  4DDG D;  2LAS A;  2KN4 A;  3DBL I;  1FRR A;  1QKZ A;  3VTU A;  3U2S C;  4URK A;  2YLM A;  3N1Z C;  4EZK A;  3VRB B;  3U8Z A;  2KWV B;  2AQ2 B;  3A1Q B;  2LXC A;  1LFD A;  1D6E C;  3DHH C;  3WAM A;  2ZCC A;  4PS7 A;  1TYG B;  3APF A;  4I6L B;  4N58 A;  1KLG D;  4HPL B;  4US8 A;  1XF5 L;  1ZE3 D;  4DHZ B;  2FCS A;  1PGA A;  2VZK D;  2WYQ A;  2PMV A;  3VRA B;  1V5O A;  1XCQ L;  2BB5 A;  2FE8 A;  4S0R A;  4GDL B;  2QCZ A;  1YOV B;  4NY0 A;  4UDU C;  5D7G A;  4IWO A;  4ZRI A;  4EEW A;  4AP4 C;  2KK8 A;  4XZ4 A;  2CHW A;  2K5P A;  4HDO A;  2K25 A;  3BK1 A;  3CST A;  2K0P A;  1YX5 B;  3C19 A;  4WWO A;  2MLB A;  2X38 A;  3N3K B;  3IVF A;  1UH6 A;  1WGK A;  2Z8L A;  3MC0 B;  2RMM A;  1C4C A;  4CYE A;  2W55 A;  3N32 A;  4L23 A;  2CS4 A;  3EC8 A;  1TY0 A;  1XXG A;  1VDV A;  1EU4 A;  1WX9 A;  2CR5 A;  1V2Y A;  3PS6 A;  3VQI A;  3WIM A;  2PJH A;  3GP7 A;  2GI9 A;  5DPW A;  2JX5 A;  1WJ4 A;  3RUI B;  2DZK A;  2L76 A;  1QZE A;  2L05 A;  2BYT A;  3ZRF A;  2KXJ A;  3M62 B;  1CQV A;  3Q8A A;  1TJE A;  4MM3 A;  2JRI B;  3ML9 A;  3PPA A;  4OZC A;  4NQK E;  1LGR A;  3SEB A;  1SIF A;  5BYQ A;  3OWE B;  3M3J A;  1SB3 C;  5DPS A;  3CF6 E;  4A3O A;  4ZHO A;  4LLG M;  1JRO A;  2CHZ A;  1RM6 C;  2KQS A;  2L52 A;  3BYT B;  2K8C A;  2QSD A;  3V62 A;  4C80 A;  1SJE D;  3DBS A;  4P1B C;  5AZH A;  4MT5 A;  4ACF A;  3ZJT A;  1V6E A;  1WGH A;  1YNT E;  1MVK A;  5J17 A;  2KX3 A;  2LVQ A;  1Y56 A;  1PGB A;  3ZNG C;  1OTR B;  4EZL A;  2PTL A;  1WXQ A;  2TSS A;  3EHV A;  2Z0D B;  3DOW A;  2J0J A;  3Q3N C;  1FEH A;  3DVG Y;  3OAW A;  3RN9 C;  2MH7 A;  5H92 C;  1QOA A;  2HD5 B;  4RFB A;  2V4I B;  4KGR A;  1Q10 A;  1EM7 A;  1MJD A;  3VR8 B;  2WLB A;  5DPT A;  3LXF A;  3PHW B;  1J0G A;  1SBB B;  3X0W A;  1X1M A;  4YTN B;  1D3Z A;  1MHX A;  3HHM A;  3AN1 A;  4PYU A;  4ANV A;  1QLB B;  1D5X C;  1FXA A;  4XX5 A;  1SE4 A;  2KYW A;  4O1N A;  3SHQ A;  2GLS A;  2LGD A;  4XDD A;  2UWQ A;  1K50 A;  4IDI A;  2ASQ A;  1C4A A;  2MQJ A;  1ZPS A;  4K81 A;  4BOS C;  2J4X A;  3ZXR A;  4C56 C;  1LM8 B;  2DEN B;  4OVZ A;  2KLG A;  2G45 B;  1P0R A;  3BVZ A;  5GXG B;  3U7D A;  3P4R B;  1FRD A;  4A3P A;  3KH0 A;  1ZGU B;  5LXH A;  1GG3 A;  2LEK A;  3A9J B;  1EWY C;  3DQV A;  3QAR A;  1H4R A;  2FUG 1;  4ZYN A;  1Q5W B;  1RRB A;  3ZDT A;  3MP9 A;  4E74 A;  2INP E;  1EO6 A;  4YSZ B;  4WAA A;  4IKG A;  3B08 A;  1UGJ A;  2INC C;  4RGN A;  3EFC A;  3KUD B;  2WXF A;  1N5X A;  2V1Y A;  3QX1 A;  2J0M A;  1FIQ A;  2KJ6 A;  4EZJ A;  2FNJ B;  3QHT A;  5C3J B;  1N6Z A;  2BW2 A;  2WXO A;  4OVV A;  1VZ6 A;  1UD7 A;  3TEZ A;  1V1O A;  3H7P A;  1SE3 A;  1ISN A;  1SIJ A;  4W9G A;  1SXT A;  4W9J A;  2K6Q A;  3Q2A C;  1MG8 A;  4KZ0 A;  5IA7 A;  3WCQ A;  3QAQ A;  1C77 A;  2W3S A;  4M01 A;  1WZ3 A;  1I4R A;  4LNK A;  1EUV B;  2DYB A;  2ZW0 A;  1YQ4 B;  4PS8 A;  2N9E B;  4KIK A;  2KTR B;  1UZX B;  2BBC A;  1PQS A;  4K7W A;  3AE5 B;  3AE6 B;  2KFK A;  2WDV B;  3D32 A;  2LJI A;  4ARC A;  2BWF A;  3X23 A;  3ENE A;  2KZR A;  2WDQ B;  3GB1 A;  2KQ4 X;  4IC7 B;  3DPD A;  1BUI C;  4IM3 A;  3E9S A;  4ANX A;  2IGG A;  2XK5 A;  4L1B A;  1YMH E;  3L17 A;  2JZZ A;  2JZ3 B;  3H9D A;  2RR9 A;  2GOW A;  1V80 A;  4ZRQ A;  1L0Y B;  3ECI A;  2LRU A;  5FK9 C;  3PZ7 A;  2PPH A;  1Y8R C;  4B0M A;  2VRR B;  3ZXV A;  4LK0 M;  1LXD A;  3ZNZ B;  2O2V B;  4KSK C;  1HQR D;  2GBR A;  3GS2 A;  4KKJ A;  3AM9 A;  2N1V A;  3R2I A;  3KWL A;  4KZC A;  1OEY A;  4G3X B;  3FAH A;  2K1F A;  3HK0 A;  3IBE A;  3CIR B;  2AYO B;  1TY2 A;  4HPP A;  3H8H A;  1ZKH A;  3UIP B;  2DZI A;  1GB4 A;  1XQQ A;  3L08 A;  5IO9 A;  3VTV A;  2I38 A;  3AE3 B;  4WWN A;  4DHJ D;  3P4P B;  4ASW C;  3ZNI D;  1RFA A;  4L2Y A;  3Q3F A;  3L54 A;  1SSN A;  1MFW A;  3NOB A;  3LDZ E;  4CO7 A;  4D2K A;  4US9 A;  4NJ6 A;  1LO5 D;  4A9A A;  4MH8 A;  1V49 A;  1F0Z A;  1IBX B;  4N9F 4;  2KQ7 A;  1T0R C;  2Y3A A;  3MC9 A;  3PRE A;  1QOB A;  1WGG A;  4QAY A;  1M94 A;  1GNU A;  5EE1 A;  3IAS 1;  2JUO A;  3NS1 A;  2O6V B;  4BBN C;  3U7Z A;  2IY1 B;  3HM6 X;  4HWI B;  2CU3 A;  4JL9 A;  3JSV B;  4CQN A;  3DBR B;  3WAP A;  1DGJ A;  1RYJ A;  1I4Q A;  2KJH B;  5C23 A;  3PGE A;  3ZVV A;  2LGX A;  3DVN U;  4Q2J A;  4YSY B;  1T5X D;  1KTK A;  1XCT L;  1FFU A;  4YT0 B;  3VUY A;  4NNJ B;  4EE2 A;  5J2R A;  3IHP C;  3RD2 A;  3AE7 B;  3GOE A;  4HVB A;  3FIL A;  1GOZ A;  3AE8 B;  5D3I B;  1ZOY B;  4KVG B;  1TS2 A;  2MBB B;  2E6X A;  3ZQ4 A;  3RT3 B;  4HPM B;  5AUK A;  3MJ5 A;  2D3B A;  3AI5 A;  2G1E A;  2D3A A;  3QC8 B;  4RCO A;  1XEE A;  3LJ3 A;  4GIV A;  4B0E A;  4NAW B;  2K9X A;  4LNI A;  4NJC A;  1D5M C;  2VH1 A;  4RGT A;  5AZF A;  3I9V 1;  3MFG A;  2L00 B;  2IO3 B;  2IO1 B;  3AU4 A;  3MJW A;  5IOI A;  4MJS B;  2JT4 B;  1GAQ B;  1IUE A;  4KGT A;  1WYG A;  3AE1 B;  2W82 A;  2JYT A;  2LRW A;  2DBY A;  2KJR A;  4FAD A;  1TT5 B;  3APC A;  1GJZ A;  1UBI A;  4HCN B;  3NVW A;  3K9O B;  4XDC A;  5T8I A;  3B2G A;  3RPF C;  3Q8B A;  1BML C;  4WJP A;  3ZTD A;  3KW5 B;  2SEB D;  2BF8 B;  3VVW B;  3VUX A;  3IXS A;  4FN2 A;  1AYF A;  4DXG A;  3K9P B;  3AEA B;  2A4Z A;  1WXA A;  3HIZ A;  4M0W B;  1VZ8 A;  3OJ4 B;  4KV2 A;  3EFU A;  1FXI A;  2C5L C;  3DVN V;  5C1Z A;  1TKY A;  4JQW C;  2W3R A;  1VRA B;  3A1Q A;  5E6O A;  1UEL A;  1EF5 A;  1ET9 A;  3P1M A;  3RNB C;  3A33 B;  1L5P A;  2MBO A;  3OLM D;  3R66 C;  3SDL C;  2HTH A;  2Z59 B;  3SU8 X;  3M95 A;  2ZJD A;  4MSM B;  3KUC B;  3ZGZ A;  1QOG A;  4GDL A;  3O65 B;  3V60 A;  1OGW A;  2IND C;  3AEB B;  1YQ3 B;  4EOY A;  3DHG C;  1RLF A;  2B3A A;  4XYC A;  4BKS D;  1FMA D;  1QIL A;  2LVO A;  4LDT B;  3VHT C;  4YTM B;  2N9L A;  4TQ0 A;  4W9K A;  1F1H A;  4MGY E;  5HI1 A;  3BVG A;  5CHV C;  3ONS A;  3W5V B;  3VTW A;  4G0N B;  4W9H A;  4A55 A;  2K3U A;  3MC8 A;  3W2D A;  2PKO A;  2JXT A;  2MBQ A;  1WGD A;  1CK1 A;  2HTM E;  4AWJ A;  1YN3 A;  1IGC A;  3T3O A;  1ZDX A;  2MEK A;  5BO4 B;  1FNV A;  4P16 A;  4HLE A;  1ZXH A;  1AAR A;  1IYF A;  4C7Z A;  3ZIM A;  2WGS A;  4C4V B;  2WNM A;  2R2O A;  3BWU D;  3RNC C;  2NPT B;  4DQO C;  1K53 A;  2XNA C;  2DWQ A;  2V3S A;  2Y5B B;  3WAN A;  2OHF A;  4PT5 A;  3QA8 A;  2J53 A;  1SE9 A;  1HA5 A;  4BKS A;  1N61 A;  3OG5 A;  5BMI A;  1P7E A;  1GB1 A;  2WXN A;  2HJ1 A;  1C1Y B;  4IG7 B;  2JZP A;  2DAJ A;  2LMC A;  2KMA A;  3ZYY X;  4JPS A;  3AUL A;  3AV8 A;  3DWG C;  4P1C C;  1P7F A;  1I7H A;  1L6U A;  3NZ3 A;  2LZ6 A;  4WQM A;  1F77 A;  4GXB A;  1F2R C;  1WE7 A;  2R61 A;  2ZZP B;  2IO0 B;  1ZW7 A;  3NS8 A;  2N7D A;  5BMH A;  2CHX A;  1E90 A;  4BVU C;  1TS5 A;  1E6E B;  1WGR A;  4DK5 A;  3TMP B;  1L0V B;  4ZOH C;  2J0K A;  2Y5P A;  2K6D B;  2K22 A;  4OVU A;  1T3Q A;  1JAL A;  5D2M B;  1G6J A;  5L83 A;  4PK1 A;  4DHJ B;  2KC1 A;  3VXW A;  1OFF A;  4OZA A;  5JHA A;  1JML A;  4B9K A;  1N63 A;  3ZLZ A;  4J3O D;  3RNG C;  3P63 A;  2LUE A;  1JW9 D;  4ZDV A;  3APD A;  1QT9 A;  5DPR A;  1SE2 A;  4C00 A;  2MHJ A;  2MP2 B;  1KOT A;  1VR9 A;  2FID A;  4LNN A;  1P1A A;  3ABV B;  3EUB 2;  3SR6 A;  4AS1 A;  4NJ7 A;  2KMC A;  5LLI A;  2INN E;  2D2Q A;  3VAW A;  1K8R B;  2MCN B;  2RPV A;  2V3N A;  3A9K B;  5E6N A;  3A9J A;  2FIF A;  1ROE A;  4KKI A;  2J7Q B;  4JGH B;  1CMX B;  1P3Q U;  2WU2 B;  1ACC A;  2QEJ C;  4HRO A;  4RH6 A;  2N9K A;  1ZP0 B;  1T0Y A;  1NYQ A;  2LXA A;  2D3C A;  1VCB A;  2OJR A;  3Q69 A;  1A70 A;  5EE0 A;  4LJP B;  1KLU D;  2QJL A;  3TBL D;  1V9J A;  1JWA D;  4RGO S;  1TZO A;  3ZJV A;  4P6V F;  4FHK A;  1WRI A;  3DBH B;  1I42 A;  1E8Y A;  2BYV E;  2FCM A;  2R2Q A;  5JH5 C;  3L16 A;  3L10 B;  3EEC A;  5JXV A;  2AQ1 B;  3KQ4 A;  2MWS B;  3UIN B;  4AJW A;  1I4P A;  4BZA A;  4B95 A;  2YEP B;  1DYQ A;  2FCN A;  4RM9 A;  2V0G A;  2LUM A;  3TUO A;  5AZG A;  4ANU A;  3PLV A;  4MAC A;  4JWS C;  3T8M A;  2KTR A;  2KWU B;  5FKA C;  2DX5 B;  1F2R I;  2QC8 A;  5G5G A;  4C7Y A;  2NR2 A;  5J18 A;  1D4B A;  1Q0W B;  1C76 A;  1V97 A;  2A5U A;  2FUH B;  1MHH E;  1AW7 A;  3NVZ A;  4YTP B;  3BK2 A;  1WMH B;  2KN5 A;  5IKC M;  4LCD E;  4GLS C;  3CSF A;  3EGR A;  2WS3 B;  3BZD B;  2AL3 A;  1GUA B;  1KRH A;  4LNF A;  2RDG A;  5E6P A;  4USA A;  2X8X X;  1JWM D;  2Q5W D;  5HKH A;  2QMT A;  2ZNV B;  2WXJ A;  2I1K A;  3PHX B;  1MI0 A;  1XLP A;  4FLH A;  4DDI D;  1ENF A;  3R7R A;  3ZJU A;  1R7S A;  1UWM A;  1TIF A;  2WXH A;  3P2B A;  1ET6 A;  2Y5C A;  3PZD A;  3HVZ A;  1L7Y A;  1WR6 E;  4K3B A;  2O2V A;  1STE A;  1D5Z C;  1L0X B;  2O6V D;  3ZW3 A;  2E3T A;  3DBR I;  1K51 A;  3GZN B;  4N59 A;  3DWM A;  5D3D A;  3S2A A;  2GBJ A;  3DDC B;  2RDH A;  4IWQ A;  4NAM A;  2L8J A;  1KJT A;  4BOZ B;  1E5W A;  2KAJ A;  2NTS A;  2ICI A;  4A8X C;  1NVI D;  3H1U A;  1WZ0 A;  4DWF A;  2IO2 B;  1V86 A;  3BYY B;  1ZUD 2;  1M4V A;  5GMV A;  3JW0 X;  5EDS A;  4H2A A;  2BT6 A;  5HHD G;  4WJN A;  3ZKJ C;  1WR1 A;  4NZL B;  4GDK B;  1MPE A;  2D11 A;  1WSP A;  3IAM 1;  3NRZ A;  4JE3 B;  3VUW A;  1C78 A;  1E9M A;  3ETR A;  3PT2 B;  4WWP A;  4M8N A;  4EFO A;  1BT0 A;  1IBX A;  2KVZ A;  2N1W A;  2JF5 A;  5LXI B;  4ICV A;  1B1Z A;  3I3T B;  2JY6 A;  3RI7 C;  3QJZ A;  4OZB A;  2M1M A;  2GBM A;  1HZ6 A;  2BYE A;  1YN4 A;  1QF6 A;  3ML8 A;  2WX0 A;  3U4E G;  2MW5 A;  3LB8 C;  3L4P A;  3FKY A;  4GGQ A;  4LTU A;  2H89 B;  2O6V A;  2GBN A;  3KYD D;  3CWI A;  4KSL C;  4BKG A;  2IGH A;  3N20 C;  3JSV A;  1BXT A;  2CJO A;  2N9X A;  3ZUN A;  2NBU A;  2BVC A;  3AXC A;  1XLN A;  2N0S B;  4WQO B;  1C9F A;  3IT4 B;  1GPX A;  3R7Q A;  2BS2 B;  2WXK A;  2N7J A;  2WDR B;  4JX1 C;  3DHI C;  3VDZ A;  3NZS A;  3UQA A;  4MEL A;  2SAK A;  1NEK B;  2LGY A;  2HJ8 A;  2DZJ A;  2KHW B;  1P9D U;  1EF1 A;  3IFW B;  3I63 C;  1XLQ A;  4EUT A;  1SEB D;  1OEY J;  2JWU A;  1V8C A;  1PFD A;  4M00 A;  3UI3 A;  2LHD A;  1J7B A;  1QOF A;  3N1X C;  4II2 B;  2M19 A;  1L6V A;  2IJ0 A;  4NAW A;  3UIO B;  2G9H D;  2KVR A;  1ZXI A;  2NBV B;  4W9E A;  2LGI A;  5JZE B;  4REZ A;  1WX7 A;  1LQB A;  2G4D B;  5BYS A;  2NMQ A;  2PEA A;  3AE9 B;  2ZCB A;  3NY5 A;  3LYY A;  1UGM A;  2KFJ A;  1E8W A;  2IY0 B;  4MJS A;  3V6C B;  5G2N A;  1FM0 D;  2N7E A;  1HZ5 A;  3HRD D;  1NBF C;  1JWB D;  2KNB A;  3H6N A;  1S3S G;  4HK2 A;  2RDB C;  2JQR B;  1YIW A;  2DAF A;  2KD0 A;  2KLC A;  2KWC A;  4LDT D;  1V81 A;  1A5R A;  1E7P B;  2KMM A;  5E6J A;  2JPH A;  4FHJ A;  1R4M B;  1VJK A;  3RCZ A;  2JU6 X;  2REX A;  2I2Y A;  4ZRJ A;  1WWT A;  2WDT B;  3CMM B;  3DVG X;  4JIO U;  4M0W A;  4ARI A;  3V05 A;  1RFK A;  1WXS A;  1PDX A;  1P98 A;  4K1R B;  4F1S A;  3Q8E A;  2GMI C;  3Q14 C;  1HTO A;  2PE6 B;  3TIX A;  3Q8F A;  3WAO A;  2WXG A;  2AX5 A;  1KFY B;  2MJ3 A;  1YJ1 A;  4IW0 A;  4JWU C;  3PV1 A;  1V1P B;  2KDE B;  3E56 A;  2FBW B;  1WY8 A;  1C3T A;  4FXC A;  1PYW D;  2L83 A;  2WU5 B;  2KX0 A;  3W1Y A;  1K52 A;  2ACZ B;  1EU3 A;  4K7U A;  2YEP F;  1Z2M A;  2EEL A;  2DZM A;  1UBQ A;  2M0A A;  2NS5 A;  2BS4 B;  4W9C A;  2DHZ A;  3W9C B;  4WIP A;  3I57 A;  3A4S C;  4HJK A;  2BS3 B;  5IP4 D;  1JWU D;  4ICU A;  3V61 A;  1WJU A;  4TV3 A;  2ONQ A;  2LD9 A;  4RGM A;  4OHJ A;  1KLV A;  2XN9 C;  4GMV A;  2LGS A;  2DLB A;  1SGH A;  1F52 A;  2QIE B;  2KWD A;  4MH0 E;  1FCL A;  4J6I A;  3U52 E;  3ZRC A;  3T3N A;  4MGI E;  3P4S B;  1WIA A;  2KDI A;  2RGF A;  2UU7 A;  1WJN A;  2Z0E B;  4IM2 A;  4C4V A;  2ZNV C;  3PLU A;  3SD5 A;  2NPT A;  3VFK A;  4YSX B;  1J8C A;  2LI5 A;  3NVY A;  2L0F A;  1R4N B;  2PVG C;  3AEG B;  3AH7 A;  2D5G A;  1RAX A;  4XWW A;  4ITK A;  3TJP A;  2QHO A;  3TEW A;  4DXA B;  5JHB A;  2BTE A;  2JVC A;  2C7M B;  2IGD A;  1H8C A;  2CJN A;  3TL5 A;  3B1L X;  4BAX A;  1N60 A;  1WYW B;  4GB9 A;  4RMA A;  2M0X A;  3RUL A;  3TCA A;  4R3D A;  1WE6 A;  2J42 A;  3I5J C;  3M63 B;  1HEZ E;  3MHZ A;  4N6E B;  2L1A A;  2W54 A;  1DOY A;  3AEE B;  2M4N A;  1JRP A;  1YD8 U;  5BMG A;  1NI3 A;  3Q3J A;  1PUT A;  3N1Y C;  3NG0 A;  1UUP A;  3VH3 B;  4IM0 A;  1E10 A;  2KAC A;  3W5U B;  4DHZ E;  2QIL A;  1XT9 B;  4HCP B;  2PLP A;  3TEY A;  4PYZ A;  1FNU A;  3PSE B;  3OJ3 A;  3Q8C A;  3NVV A;  5G55 A;  3P4Q B;  1TKE A;  2WXQ A;  3DBH I;  4GU2 A;  1I4H A;  2M8S A;  2KOX A;  4AUQ C;  3HVD A;  1WJ6 A;  3PVL A;  2G4S A;  2C60 A;  3JYU A;  3NHE B;  1L2N A;  1JWS D;  1IPG A;  5EE9 A;  1WM2 A;  2H88 B;  3AB5 A;  1GC7 A;  2V4L A;  1MG4 A;  3DBL B;  3QCA A;  3PRM B;  2MP2 A;  2KDM A;  3PO0 A;  4ZRK A;  3PTF C;  2K8B A;  3V6E B;  4RM8 A;  4IWP A;  2LJ5 A;  2D10 A;  5L95 C;  4XGA B;  4K3C A;  5KHQ A;  3KLS X;  2FCQ A;  2VZK B;  4W9F A;  2BGF A;  4B6W A;  4LJO B;  4GN1 A;  2KDB A;  1WXM A;  4MM3 B;  3A9K A;  4TKN A;  1WRD B;  4YXD B;  3B9J A;  1XO3 A;  2BB6 A;  2LFI A;  4XE0 A;  4PS3 A;  4HRS A;  1E8Z A;  1I35 A;  2K39 A;  2OED A;  3O13 A;  2C7H A;  3GE8 C;  3U30 A;  1FD6 A;  2ZPY A;  4I6P A;  3AED B;  4F7Z A;  2M17 A;  5CTR C;  3J9C A;  3QWZ B;  5IN7 A;  1JRU A;  1TS3 A;  3W1S C;  4FJY A;  3ZNH B;  1WH3 A;  3AEF B;  3BVM A;  4M8M A;  4X57 B;  2AWT A;  3UGB B;  1F9J A;  4FUL A;  1WI0 A;  3GZN I;  4IUM B;  4RNA A;  5DCN A;  4TUU A;  4HKZ E;  3UQB A;  1AWD A;  1E0Z A;  3C0R B;  1TBE A;  2JYE A;  3AU5 A;  2BKR B;  2LVP A;  2WXL A;  1WGY A;  3RYT A;  1CZP A;  1U4A A;  1WX8 A;  3JVZ X;  3SFE B;  1SF0 A;  2D3G A;  2ZVO A;  1FXT B;  3NUH B;  5FR6 A;  2AEH A;  2N4F A;  1HTQ A;  2EMT A;  4FBJ B;  2PE9 A;  1WF9 A;  3BII D;  4G11 A;  2NCN A;  4AOF A;  1N5W A;  1WMH A;  3Q3M C;  2DNF A;  1FPY A;  2ZW1 A;  1CJE A;  1TZ1 A;  4OW0 A;  4WJO A;  5HG2 A;  2MRP A;  2WP9 B;  1TKG A;  4S17 A;  3N9Y C;  4FJZ A;  2D07 B;  4P7I A;  3C8Y A;  5D6J B;  1VZ7 A;  4MGZ E;  4AJY B;  1GC6 A;  5KHO A;  4KDI C;  2WX1 A;  3L13 A;  2PIA A;  2W9N A;  2EMS A;  4DBG A;  4NQL B;  3BIN A;  4DXF A;  2EKI A;  2IZV B;  2WXM A;  4E71 A;  5D94 A;  3VR9 B;  2RSU A;  3KWV A;  4YWG G;  2L7R A;  3FC4 A;  2JWZ A;  4I6N B;  4ZHP A;  4IOI E;  4WAF A;  1J19 A;  4TQ1 A;  3RNE C;  2BQQ A;  1OQR A;  2MBE A;  5AUI A;  4HXD A;  1OQY A;  2GB1 A;  2UYZ B;  3RNF C;  1C4P A;  2NTT A;  3H7P B;  2GRI A;  1DOX A;  5CHW A;  3ZO5 B;  1OQQ A;  3L0W B;  3GE3 C;  2CKH B;  2IBI B;  2OOB B;  4GDK A;  1J7C A;  4GSW A;  3VH4 B;  3TSS A;  1IP9 A;  2B76 B;  5CX3 A;  2N9P C;  4MDK E;  1VLB A;  4KIK B;  3WA0 A;  3EA6 A;  4LNO A;  2BYF A;  3URY A;  4RF1 A;  3KUZ A;  3MHS D;  2ZEQ A;  4MSQ B;  3QQ8 B;  5C2T B;  1TTN A;  2KFK B;  2IDY A;  5AEK B;  3B0A A;  1E7U A;  5EE3 A;  4E3C A;  1L4D B;  2M56 B;  2WXP A;  1KM7 A;  1S1Q B;  4M02 A;  1QQR A;  1WFY A;  2V3P A;  1JQ4 A;  1T6B X;  2KO3 A;  2XEW A;  1NDD A;  2MA9 B;  4ZYS A;  4A20 A;  4W9D A;  2XK5 B;  2LHE A;  1TS4 A;  4W9L A;  2L3Z A;  1ESF A;  3HM3 A;  5TSS A;  1KF6 B;  2RD0 A;  1N62 A;  1R4M I;  2RPQ A;  3ZDM C;  3SFD B;  1HE8 A;  3UF8 A;  4FA6 A;  1YJI A;  1PGX A;  4HJG E;  4KGS A;  5G5H A;  2GBK A;  1FNW A;  2IPK D;  4GOC A;  3AE2 B;  3V3X A;  2WXR A;  2NVU I;  3NZU A;  1UF0 A;  3AMZ A;  2WWZ A;  4XWT A;  1RWS A;  2I1J A;  3R8B A;  1IGD A;  2MBH A;  2NBW B;  1WXV A;  3B2F A;  4MGK E;  2JRH A;  3H7S A;  4KDL B;  3HUI A;  1T0Q C;  4II3 B;  5CHF A;  3W1S A;  4WJQ A;  2EKE C;  2KC2 A;  5TR5 A;  5BYR A;  3RZF A;  2ZVN A;  3A4R A;  3Q3O C;  4AQ7 A;  1B9R A;  3BY4 B;  1JCK B;  2KT7 A;  1VD2 A;  4W9I A;  2ZPN A;  2OJW A;  1XLO A;  3WAL A;  2MJD A;  2BKF A;  4BBN F;  1FCC C;  1NEN B;  2VH2 A;  3RNA C;  4TMA B;  3PRZ A;  3PZ8 A;  2C7N B;  3NJT A;  3MTN B;  3N30 A;  4HEA 1;  3QK0 A;  3DCG A;  4CHK A;  4A90 A;  1SJH D;  2JSV X;  2WXI A;  2J52 A;  2HDE A;  5LNK 1;  2WQY B;  3RFZ B;  2AQ3 B;  3ZTC A;  4HDQ A;  4BKT A;  2YVC A;  1I4X A;  4G50 A;  1TGZ B;  1E7V A;  4TSS A;  2MJE A;  2C9W B;  3KVF B;  1WM3 A;  3R2T A;  4JLC A;  1NI2 A;  2L0T A;  1I4G A;  2MX2 A;  5FR3 A;  5IAA C;  1KH0 A; 
#chains in the Genus database with same CATH homology
 3TEX A;  4LK0 M;  4A6Q A;  3Q69 A;  1HQR D;  1FFV A;  4R3D A;  3GS2 A;  4KKJ A;  2J42 A;  3AM9 A;  3FIL B;  1A70 A;  1HEZ E;  3KWL A;  3MHZ A;  3R2I A;  4N6E B;  5EE0 A;  3FAH A;  2L1A A;  1KLU D;  2QJL A;  2W54 A;  1V1P A;  1DOY A;  4WUR A;  1UWX A;  2L32 A;  3CIR B;  1DOI A;  1JWA D;  1TY2 A;  2DYM A;  3AEE B;  4ZRP A;  3H8H A;  1JRP A;  5BMG A;  1NI3 A;  4RGO S;  1EWC A;  1PUT A;  5MPO A;  1GB4 A;  1TZO A;  3ZJV A;  1UUP A;  4P6V F;  1WRI A;  1E10 A;  2KAC A;  3W5U B;  1L4Z B;  2I38 A;  2QIL A;  3AE3 B;  2PLP A;  3P4P B;  5JXV A;  1YN5 A;  1ZDV A;  2AQ1 B;  3KQ4 A;  2DYO A;  4L2Y A;  3TEY A;  1FNU A;  3Q8C A;  1SSN A;  1C79 A;  3NVV A;  1I4P A;  3P4Q B;  2YEP B;  1TKE A;  1DYQ A;  5HFY A;  4D2K A;  4US9 A;  2V0G A;  2LUM A;  3TUO A;  2WXQ A;  5I4D A;  1LO5 D;  2PVO D;  4MAC A;  4JWS C;  3AE4 B;  4A9A A;  4MH8 A;  1I4H A;  3P42 A;  4KX6 B;  3HVD A;  1J7A A;  1YJJ A;  5FKA C;  4RF0 A;  2PW9 A;  3AEC B;  1F0Z A;  1IBX B;  1F2R I;  5G5G A;  4C7Y A;  1JWS D;  5EE9 A;  1D4B A;  1C76 A;  1V97 A;  1HXY D;  1MHH E;  2H88 B;  1NYR A;  3AB5 A;  1AW7 A;  3NVZ A;  4YTP B;  2ON8 A;  3BK2 A;  2KDM A;  2Y3A A;  1AN8 A;  3PO0 A;  4WH4 A;  1QOB A;  4GLS C;  3EGR A;  3IT6 B;  2WS3 B;  3BZD B;  1UNS A;  1KRH A;  5EE1 A;  5H8Y E;  1FO4 A;  3IAS 1;  3KLS X;  2RDG A;  3NS1 A;  2VZK B;  3U7Z A;  4HKQ A;  4WWM A;  4USA A;  2CU3 A;  2KN4 A;  1JWM D;  1FRR A;  1QKZ A;  2Q5W D;  3U2S C;  2QMT A;  2WXJ A;  4MM3 B;  4CQN A;  1DGJ A;  1RYJ A;  1MI0 A;  1I4Q A;  1XLP A;  3VRB B;  1ENF A;  4YXD B;  3B9J A;  2AQ2 B;  1XO3 A;  1R7S A;  1UWM A;  3ZJU A;  2BB6 A;  2LFI A;  4Q2J A;  4XE0 A;  4YSY B;  1T5X D;  2WXH A;  1ET6 A;  1D6E C;  1KTK A;  2Y5C A;  1XCT L;  4HRS A;  1FFU A;  1TYG B;  3HVZ A;  4N58 A;  4YT0 B;  4EE2 A;  1KLG D;  1STE A;  4US8 A;  1XF5 L;  1ZE3 D;  3AE7 B;  1D5Z C;  1L0X B;  2OED A;  3FIL A;  1GOZ A;  3AE8 B;  3O13 A;  1PGA A;  2E3T A;  2VZK D;  1FD6 A;  5D3I B;  1ZOY B;  1K51 A;  4N59 A;  2PMV A;  3DWM A;  1XCQ L;  2BB5 A;  3AED B;  5D3D A;  3VRA B;  2FE8 A;  1TS2 A;  2E6X A;  3ZQ4 A;  2RDH A;  5AUK A;  4GDL B;  3MJ5 A;  3J9C A;  4NAM A;  1TS3 A;  2G1E A;  4UDU C;  2KAJ A;  5D7G A;  4RCO A;  2NTS A;  2ICI A;  4A8X C;  1NVI D;  3AEF B;  3BVM A;  1XEE A;  4B0E A;  4NAW B;  3BYY B;  1ZUD 2;  1M4V A;  2K9X A;  4NJC A;  4RNA A;  1D5M C;  4H2A A;  2K5P A;  4HKZ E;  2BT6 A;  5HHD G;  1AWD A;  1E0Z A;  4RGT A;  2JYE A;  3I9V 1;  3BK1 A;  3MFG A;  2K0P A;  4NZL B;  4GDK B;  2WXL A;  1CZP A;  1MPE A;  3SFE B;  1SF0 A;  1WSP A;  3IAM 1;  3NRZ A;  4JE3 B;  2X38 A;  3NUH B;  1C78 A;  1E9M A;  3ETR A;  1GAQ B;  1IUE A;  4KGT A;  1WYG A;  3AE1 B;  2W82 A;  1WGK A;  2JYT A;  2Z8L A;  3MC0 B;  1IBX A;  2DBY A;  1C4C A;  2RMM A;  2W55 A;  4L23 A;  1B1Z A;  3NVW A;  4OZB A;  4XDC A;  5T8I A;  3B2G A;  1HZ6 A;  3BII D;  1TY0 A;  1XXG A;  3RPF C;  1VDV A;  1YN4 A;  1EU4 A;  3Q8B A;  1N5W A;  1BML C;  1QF6 A;  3VQI A;  3GP7 A;  2GI9 A;  2ZW1 A;  3U4E G;  1CJE A;  2JX5 A;  3LB8 C;  3L4P A;  4OW0 A;  5HG2 A;  2WP9 B;  1TKG A;  3N9Y C;  2SEB D;  4LTU A;  2H89 B;  3C8Y A;  1VZ7 A;  2BYT A;  3IXS A;  3CWI A;  1AYF A;  4DXG A;  1CQV A;  2IGH A;  3AEA B;  3Q8A A;  1TJE A;  1BXT A;  1VZ8 A;  2CJO A;  2PIA A;  1FXI A;  4OZC A;  1TKY A;  3SEB A;  1XLN A;  2N0S B;  5BYQ A;  2W3R A;  1VRA B;  1C9F A;  3OWE B;  1ET9 A;  1SB3 C;  2EKI A;  3P1M A;  4DXF A;  2WXM A;  1L5P A;  3IT4 B;  4ZHO A;  1GPX A;  2BS2 B;  4LLG M;  2WXK A;  2N7J A;  2WDR B;  4JX1 C;  1JRO A;  1RM6 C;  2L52 A;  3BYT B;  2QSD A;  3VR9 B;  3KWV A;  2SAK A;  4YWG G;  4C80 A;  1NEK B;  1SJE D;  3FC4 A;  4ZHP A;  4IOI E;  4MT5 A;  4WAF A;  3ZJT A;  4TQ1 A;  1YNT E;  1MVK A;  3ZGZ A;  1QOG A;  1XLQ A;  1Y56 A;  1OQR A;  3AEB B;  5AUI A;  1YQ3 B;  1SEB D;  1PGB A;  2JWU A;  2GB1 A;  1V8C A;  2PTL A;  1PFD A;  3UI3 A;  1WXQ A;  2LHD A;  1J7B A;  1QOF A;  2TSS A;  1C4P A;  1L6V A;  2M19 A;  2IJ0 A;  2NTT A;  2G9H D;  2GRI A;  1DOX A;  1ZXI A;  1FMA D;  1OQQ A;  1FEH A;  2LGI A;  1QIL A;  4REZ A;  2MH7 A;  5H92 C;  1QOA A;  4RFB A;  4YTM B;  2N9L A;  2V4I B;  4TQ0 A;  4KGR A;  1J7C A;  1Q10 A;  1EM7 A;  5HI1 A;  3BVG A;  5BYS A;  3VR8 B;  2WLB A;  2NMQ A;  3AE9 B;  3TSS A;  3LXF A;  2B76 B;  3LYY A;  3W5V B;  1SBB B;  1VLB A;  1FM0 D;  4YTN B;  4A55 A;  1MHX A;  2K3U A;  3W2D A;  3AN1 A;  1HZ5 A;  2PKO A;  2JXT A;  3EA6 A;  3HRD D;  3URY A;  1JWB D;  1CK1 A;  2HTM E;  4RF1 A;  1QLB B;  1D5X C;  1FXA A;  1YN3 A;  1SE4 A;  1IGC A;  3T3O A;  5C2T B;  4O1N A;  1ZDX A;  2MEK A;  2IDY A;  2JQR B;  1FNV A;  4P16 A;  4XDD A;  1ZXH A;  4C7Z A;  5EE3 A;  1K50 A;  1E7P B;  1L4D B;  2KMM A;  2M56 B;  2WXP A;  4IDI A;  5E6J A;  1QQR A;  2V3P A;  1JQ4 A;  1T6B X;  1C4A A;  1VJK A;  2WNM A;  3BWU D;  2JU6 X;  4ZYS A;  1ZPS A;  4DQO C;  1K53 A;  2J4X A;  2XNA C;  4C56 C;  2I2Y A;  2LHE A;  1TS4 A;  2DWQ A;  4OVZ A;  1WWT A;  5GXG B;  3BVZ A;  4M0W A;  4ARI A;  3P4R B;  1FRD A;  3V05 A;  1RFK A;  2LEK A;  1PDX A;  1ESF A;  1EWY C;  2OHF A;  4PT5 A;  5TSS A;  2FUG 1;  1KF6 B;  1N62 A;  2J53 A;  1HA5 A;  3SFD B;  3Q8E A;  3MP9 A;  2INP E;  4YSZ B;  4IKG A;  1N61 A;  3Q8F A;  5BMI A;  1P7E A;  1YJI A;  1GB1 A;  1UGJ A;  4RGN A;  2WXN A;  2WXG A;  2AX5 A;  1PGX A;  1KFY B;  4HJG E;  2MJ3 A;  2JZP A;  2LMC A;  2WXF A;  4JWU C;  3ZYY X;  1N5X A;  4KGS A;  1V1P B;  5G5H A;  3E56 A;  1FNW A;  2FBW B;  2IPK D;  4JPS A;  3AE2 B;  3V3X A;  3AV8 A;  1FIQ A;  3DWG C;  4FXC A;  1P7F A;  2WXR A;  1I7H A;  1PYW D;  2L83 A;  2WU5 B;  1L6U A;  3NZ3 A;  4WQM A;  3AMZ A;  5C3J B;  2BW2 A;  1F77 A;  1K52 A;  4XWT A;  1RWS A;  2ACZ B;  2WXO A;  1F2R C;  1EU3 A;  3R8B A;  1IGD A;  3B2F A;  2R61 A;  1VZ6 A;  2YEP F;  2EEL A;  3TEZ A;  1V1O A;  3HUI A;  1SE3 A;  5BMH A;  2M0A A;  3W1S A;  1SIJ A;  2BS4 B;  1SXT A;  1TS5 A;  3W9C B;  1E6E B;  5BYR A;  4WIP A;  1L0V B;  3I57 A;  4ZOH C;  4AQ7 A;  3WCQ A;  2Y5P A;  1C77 A;  2K22 A;  2BS3 B;  2W3S A;  1T3Q A;  1B9R A;  1JAL A;  1I4R A;  1JWU D;  1JCK B;  2ZW0 A;  1YQ4 B;  1XLO A;  2MJD A;  2ONQ A;  1OFF A;  2BBC A;  4OZA A;  4RGM A;  1FCC C;  4OHJ A;  1JML A;  2XN9 C;  3AE5 B;  1N63 A;  1NEN B;  2DLB A;  3AE6 B;  4TMA B;  4J3O D;  3PZ8 A;  2QIE B;  2WDV B;  3P63 A;  1JW9 D;  4HEA 1;  2KWD A;  2LJI A;  4ARC A;  1FCL A;  3U52 E;  3T3N A;  1QT9 A;  1SE2 A;  4A90 A;  1SJH D;  3P4S B;  2WDQ B;  3GB1 A;  2JSV X;  1VR9 A;  2KQ4 X;  2WXI A;  2J52 A;  2HDE A;  1BUI C;  5LNK 1;  2WQY B;  3ABV B;  3EUB 2;  3SR6 A;  3RFZ B;  3E9S A;  2AQ3 B;  2IGG A;  4AS1 A;  4L1B A;  4YSX B;  2INN E;  3NVY A;  1I4X A;  2PVG C;  1YMH E;  3AEG B;  2RPV A;  3AH7 A;  2D5G A;  2V3N A;  4TSS A;  4XWW A;  2MJE A;  3R2T A;  4ITK A;  1ROE A;  4KKI A;  4ZRQ A;  3TEW A;  1L0Y B;  1I4G A;  2BTE A;  2IGD A;  2WU2 B;  2CJN A;  5FR3 A;  1ACC A;  2QEJ C;  5FK9 C;  4HRO A;  4RH6 A;  2N9K A;  1KH0 A;  3PZ7 A;  1ZP0 B;  4B0M A;  1N60 A;  1NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...