2QJLA

Crystal structure of urm1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
b'MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-related modifier 1
publication title Crystal structure of the dimeric Urm1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qjlA00
1FRDA 1WGKA 1DOIA 1FXIA 1NENB 1KF6B 1PFDA 3ETRA 1VDVA 5C3JB 2MH7A 3B2GA 1OFFA 2AX5A 2QJLA 4WQMA 1RFKA 2WU2B 1QOBA 3DWMA 3P4RB 1NYRA 1TJEA 2WDVB 3AEEB 5G5GA 3WCQA 4ZHOA 4C80A 5H8YE 1ZUD2 3AH7A 2PKOA 2W54A 3P1MA 1RWSA 2CJNA 1NI3A 3AMZA 3HRDD 4YTPB 1JWAD 3KWLA 3L4PA 3B2FA 2M56B 1FIQA 3NVZA 3LB8C 1N61A 1B9RA 4YXDB 1L6VA 1ZXIA 3SFEB 3ZYYX 1YQ3B 1KFYB 2EKIA 1F0ZA 4YT0B 4YSZB 2WP9B 2CU3A 1PUTA 4US8A 2ACZB 2BS3B 2H88B 1CJEA 1XO3A 1YQ4B 2JQRB 2MJDA 3AEGB 3NVWA 4US9A 4YSYB 2W55A 4WWMA 3W9CB 4ZOHC 1XLPA 2G1EA 1AYFA 2OHFA 3AE8B 2KMMA 3VRAB 3AB5A 1DOYA 1XLNA 1JALA 1SB3C 1VJKA 5G5HA 1FMAD 5C2TB 2PVOD 1J7AA 1TKGA 3B9JA 1QF6A 1YJIA 2K22A 3AECB 3AV8A 2BT6A 2N0SB 2Q5WD 3AEFB 3AE5B 1N5WA 5EE3A 1UWMA 4HROA 4IDIA 2WU5B 2WLBA 1EWYC 2H89B 3AE3B 4N6EB 1QT9A 5EE0A 1ZP0B 3FAHA 1CZPA 1E7PB 3AM9A 2M19A 4LTUA 5H92C 2WDQB 1E0ZA 3FC4A 1YJJA 1JRPA 2WDRB 4FXCA 1DOXA 1JROA 1PDXA 1I7HA 1SF0A 1V97A 4JX1C 4C7YA 1L6UA 3P4PB 1FO4A 1N62A 3W5UB 2HTME 4YTNB 2MJEA 3BIID 5EE9A 2L83A 3AE1B 1KRHA 1AWDA 1QOGA 2PIAA 1TKYA 4ZHPA 1ROEA 2PVGC 2W3RA 4KX6B 1N5XA 2BS4B 1E6EB 4N58A 3NVVA 4P6VF 1JW9D 5MPOA 5AUIA 2K5PA 1N63A 3NVYA 3AN1A 1DGJA 3P4QB 3VR8B 1FM0D 1E10A 1FFVA 4YTMB 4N59A 1J7BA 1JWBD 1XLOA 3P4SB 1WXQA 2LEKA 2WQYB 2L52A 3LXFA 1NYQA 1L0VB 3DWGC 1FFUA 2Y5CA 3HVZA 3NS1A 3ABVB 1OQRA 1J7CA 3AEDB 1VLBA 1QOAA 3CWIA 4HRSA 4C7ZA 1E9MA 3AE7B 2KAJA 2E3TA 1N60A 2W3SA 2MJ3A 3AEBB 5GXGB 3VRBB 4A9AA 1IUEA 4ITKA 3AE2B 1QOFA 1TKEA 3W5VB 3AE9B 1XLQA 3AE4B 3P63A 1TYGB 1RM6C 2FBWB 4JWUC 1JQ4A 1T3QA 1FXAA 4JWSC 1GPXA 1R7SA 1QLBB 3EUB2 1WYGA 2JX5A 1SIJA 3NRZA 1ZOYB 1FRRA 1V8CA 3AE6B 3HUIA 2BS2B 3SR6A 4USAA 2B76B 2QIEB 2DWQA 3AEAB 1GAQB 5EE1A 1A70A 2DBYA 2K9XA 3PO0A 1WRIA 1OQQA 1NVID 1RYJA 5AUKA 3SFDB 2CJOA 3RPFC 2WS3B 3VR9B 1L5PA 4YSXB 3CIRB 1NEKB 1WWTA
chains in the Genus database with same CATH superfamily
1V1PB 1K52A 1WGGA 2AX5A 4ZYNA 2N9PC 2PW9A 4AWJA 5BO4B 4C56C 3Q8EA 3IXSA 2YLMA 2CKHB 5LXHA 3RNBC 3C0RB 2GBMA 5BYSA 2V1YA 2NTSA 2MHJA 3ZRCA 4WH4A 2M8SA 2KWDA 3R2IA 3ZJUA 3ZGZA 2NCNA 2KN5A 2MCNB 1WRDB 2BKRB 2PTLA 1AYFA 1MJDA 2WDTB 4M01A 1VJKA 3AU5A 4HWIB 5JH5C 1AN8A 4ANXA 3AECB 3IAM1 4OVVA 1Q0WB 5J17A 3OWEB 2UWQA 4PYZA 3NZUA 2YVCA 2LI5A 4HCPB 4XWWA 3ZVVA 2KMCA 2CS4A 2RPVA 4A6QA 3ZNID 4LNOA 2ICIA 1N5XA 2LZ6A 4N58A 5LNK1 5EDSA 2LRWA 1N63A 3HHMA 2D11A 1T0QC 2L1AA 2CHXA 3Q8FA 1TGZB 1KH0A 1RRBA 1ZXHA 4MM3A 1I42A 2IBIB 2LHDA 1E9MA 2E3TA 2MJ3A 1IUEA 3Q3OC 2KWVB 2KFJA 2KYWA 4DXGA 5L95C 1WE6A 1WX8A 1YX6B 1V8CA 3HUIA 2AQ3B 1C78A 2KK8A 4K3CA 1JWMD 4EFOA 1NVID 5AUKA 1QQRA 2RGFA 1JMLA 3C19A 3UGBB 3FILB 2REXA 3Q8CA 4W9LA 3UF8A 1PQSA 1I4PA 1YIWA 2J0MA 2BF8B 2KFKB 4G0NB 5HFYA 4WJPA 2KXJA 3L16A 5AZHA 3AH7A 2HTHA 3VHTC 2DHZA 1V81A 3HRDD 1RFAA 1BT0A 3NVZA 4IOIE 1PGAA 4BVUC 2KWUB 5D3DA 4A3PA 1SBBB 4US8A 4WWOA 2ACZB 1V80A 2HD5B 1EU4A 1I4RA 1ISNA 2I1KA 3ZTDA 4PT5A 3HM3A 2KJRA 2BVCA 5JHAA 4JLCA 3VTWA 1WJ4A 5BYRA 3TEYA 3P2BA 2WXHA 1UNSA 3AM9A 4LTUA 1I4HA 4W9CA 4JX1C 3P4PB 3RULA 4NNJB 1UBQA 4ZHPA 1ZPSA 5AUIA 3A9KB 2GBJA 4F1SA 3A1QB 3QIJA 2WQYB 1L2NA 3GE8C 3ZIMA 3ABVB 3GOEA 4HPPA 3UQBA 5IN7A 3VRBB 4GDLB 3GZNB 1WM3A 5BYQA 1C79A 3EECA 3W5VB 5D94A 1CQVA 1JQ4A 3H7PA 3LJ3A 2VZKD 4M8NA 3BVGA 1A70A 2DBYA 1HE8A 1TS4A 3GZNI 3RPFC 1EF5A 4YSXB 1NEKB 1WGKA 1FXIA 3M63B 4FHJA 4GMVA 3A9JA 2WXLA 2CR5A 2BYVE 2L76A 4KVGB 4GGQA 4RFBA 2D07B 3P4RB 3ZNGC 2BWFA 2JUOA 2KNBA 3IT4B 3M62B 4C80A 4ANWA 2GLSA 1P0RA 2KMAA 5HG2A 3L17A 4BOSC 1C4CA 1WR1A 2A5UA 1WGHA 2V9HA 2L0TA 4NJ7A 1ZXIA 2BB5A 1WXAA 2J0JA 2KOXA 1MG8A 2KMMA 1WGRA 3V60A 2D3AA 4QAYA 2PJHA 3O65B 1XEEA 4KZ0A 2N7DA 1VZ7A 3RNFC 3DHIC 2M4NA 3AE3B 4N6EB 1R4MI 1KLVA 2WXKA 1DOXA 4HPMB 4TMAB 2ZNVC 2OEDA 3H6NA 2JRHA 2J42A 4RMAA 2RPQA 5JHBA 1GC6A 2M17A 4WQOB 1XD3B 1T5XD 2JF5A 1IPGA 2C7NB 3DBHI 3VR8B 1L0YB 3MC0B 1IBXA 2L8JA 4NQKE 1LXDA 2K0PA 3NOBA 2XBBC 3I63C 3X23A 3ZDTA 1V5TA 2G3QB 1TYGB 1T3QA 1HZ5A 3BK2A 2KDBA 1FRRA 3AE6B 4XWTA 3NG0A 1SIFA 2WXRA 2WYQA 2CJOA 1WYWB 1UF0A 5L83A 3VDZA 3ETRA 4TQ1A 1FPYA 5G2NA 2K8BA 2FCSA 1TTNA 2HDEA 4WURA 4WQMA 2LGDA 3TEWA 1FXTB 3WCQA 2ZW0A 2R2OA 4IWOA 4EZLA 5HHDG 3RUIB 4K81A 2V3PA 1L6VA 1WY8A 1KFYB 2MJDA 1VZ6A 3KW5B 3AU4A 1OQYA 2N9LA 3DVGY 1EO6A 2GRIA 3CF6E 3APFA 3TCAA 1SB3C 1P3QU 1FMAD 3VH4B 2KQSA 4WAFA 4A55A 2K22A 2BBCA 1TBEA 2W9NA 4WJNA 2DYOA 2WLBA 1WFYA 5FKAC 4P1BC 5IO9A 4X57B 2WXGA 1GB4A 1ZKHA 1ACCA 2NBUA 2DNFA 1BUIC 1VZ8A 2LGSA 4LNIA 4ZRJA 3ZNZB 3URYA 2LXAA 1XF5L 3W1SC 4REZA 4KX6B 2CHZA 3RNCC 1R4NB 4F7ZA 3Q2AC 2MP2A 3JYUA 4N59A 3TSSA 2EELA 4O1NA 2AL3A 2LEKA 2KLCA 2K39A 2ZCCA 1NBFC 2KANA 2WX0A 1DYQA 2RDHA 4IUMB 2WNMA 3NZ3A 3L54A 3A4SC 3DBRI 1Y8RC 4FULA 2N7EA 3BK1A 3SDLC 2FBWB 3IHPC 1P9DU 2PPHA 1KTKA 3KUZA 3H7SA 3PO0A 2MBOA 2MBEA 2ASQA 5C23A 2V0GA 3GB1A 3BYTB 2N1WA 2MBHA 4HJKA 2QSDA 3DCGA 1YMHE 3NJTA 3V6EB 2DZJA 1ZUD2 3DVNU 4YWGG 2NVUI 4R3DA 1J8CA 2LHEA 1FIQA 1P7EA 1WZ0A 4XDDA 4DXAB 2H88B 3QX1A 2DZIA 3HM6X 5D2MB 2FIDA 3PLUA 4NJCA 2KKCA 3GP7A 3NHEB 3KYDD 4HDQA 4S0RA 5C2TB 4C00A 3B9JA 1QF6A 2XK5A 2MBQA 2N9XA 3OJ4B 2WU5B 3VUYA 2KDEB 2V4LA 2NBVB 3S2AA 2N4FA 2O6VB 3DVNV 2J53A 1E0ZA 4ZRQA 1YJJA 1WH3A 4J6IA 2INDC 2ONQA 1WGYA 4W9GA 2RMMA 1A5RA 4TKNA 1AARA 3DPDA 3MHSD 3KYCD 4YTMB 4ASWC 4XYCA 4ARCA 4OVZA 2YEPF 2ZVOA 1LFDA 2W82A 2OJRA 2L00B 2ZZPB 4BKSD 1ET9A 2WXJA 2LMCA 3EFCA 1MI0A 1P7FA 1SEBD 2MSED 1V6EA 3LDZE 1IGDA 3EA6A 4W9KA 2JX5A 3C8YA 4C4VA 1KLUD 5JZEB 1YJ1A 2ZEQA 4B6WA 1DOIA 1V9JA 2MH7A 1YN4A 1D5MC 3RNAC 2MQJA 1RFKA 2VH2A 1TIFA 3PSEB 3AEEB 4ZHOA 3VXWA 2AQ2B 3I9V1 4IW0A 2PKOA 3P1MA 2NMQA 1E8ZA 4IG7B 4MGZE 3AMZA 3ENEA 2MWSB 3E56A 2RSUA 2CU3A 2DAJA 3AEGB 3PLVA 4DHJD 4DHZB 2KVRA 5LXIB 4ZOHC 4RGTA 4RGNA 5IAAC 3WAPA 1XLNA 3A9KA 5G5HA 4FJZA 4II2B 1F2RC 3Q3NC 3KWVA 2BGFA 4MDKE 2PMVA 4IM3A 5HI1A 2FCNA 2G9HD 3K9PB 1JWUD 4IM2A 2JYEA 4GDLA 1E7PB 3TIXA 1SE9A 3WANA 3P42A 2GOWA 2X38A 1FO4A 4LDTD 1M94A 1QOGA 1TS5A 4LLGM 2WGSA 2BS4B 4BAXA 3P4QB 3AN1A 1XLOA 4MJSB 4JE3B 3V61A 3Q3FA 4NAWA 4AJWA 4A9AA 3LYYA 1B1ZA 4E71A 2IYDB 2Y5PA 4JWSC 5G55A 1SIJA 4K1RB 2B76B 3AEAB 1QKZA 4ZDVA 4ACFA 3SU8X 1TZ1A 3V05A 1PGBA 1G6JA 1GOZA 3BZDB 3PHWB 3KQ4A 2LRUA 4RCOA 4CHKA 3H8HA 4FJVB 3TJPA 5H8YE 3ZUNA 3MC8A 2N7JA 3B1LX 1IGCA 1WGDA 1TZOA 4RNAA 4A3OA 1N61A 4YXDB 5C1ZA 2KTRB 2L0FA 4ZRPA 2JXXA 4YSZB 1JWSD 1ZW7A 3N32A 2JQRB 3FKYA 3CSFA 3DBLB 1MPEA 5I4DA 2M1MA 4MSMB 1FD6A 2FE8A 4L2YA 4UDUC 2IGDA 1L0XB 1MG4A 2Q5WD 2ZJDA 2ZPNA 3OLMD 4BKSA 4PS3A 2IGGA 3KUCB 4RM8A 2H89B 3HVDA 2ZNVB 2ZW1A 2GBKA 1T0YA 2JZZA 2WDRB 1SF0A 4DQOC 2D3CA 3W5UB 2I2YA 3PZ7A 2HTME 2WXNA 3JSVB 5FK9C 4URKA 2Y3AA 5MPOA 2O2VB 3NVYA 1VR9A 2JU6X 4DHZE 4M0WB 1Q10A 2C5LC 2NPTA 4M00A 3BYYB 1SE2A 4HVBA 3U30A 1TKEA 4K3BA 1MHXA 3AE4B 4AJYB 3M3JA 2BKFA 3PHXB 4KSLC 3NRZA 1XCQL 2BS2B 1V86A 2NBWB 4EE2A 4HPLB 5E6JA 1WRIA 1RYJA 5J18A 4MT5A 3CIRB 4WIPA 2LFIA 4FJYA 3MC9A 1F77A 4WWPA 1UGJA 3T3OA 2UYZB 4H2AA 3APDA 3EFUA 3L08A 3QJZA 2KC1A 2KT7A 4EOYA 3ZJVA 3B2FA 4RH6A 4BBNF 2MX2A 3SFEB 2Z59B 1PUTA 5AEKB 1T6BX 4DDID 4S17A 1BMLC 3AE8B 3ALBA 4K7SA 4IKGA 4ANVA 2D2QA 3WIMA 2D10A 5T8IA 4L1BA 1E8YA 4RF0A 2BT6A 2QILA 5EE3A 2KTFA 2BQQA 2K3UA 3FAHA 3Q8AA 4DK5A 4LNKA 4JQWC 4GXBA 5DCNA 1PDXA 2KN4A 2AWTA 1N62A 5EE9A 2KACA 1AWDA 2PVGC 2C9WB 4EEWA 1JW9D 1WX9A 2JRIB 1FM0D 3LXFA 1L0VB 3BINA 4GDKA 2ZVNA 3QK0A 4WJOA 1J19A 1CMXB 1EUVB 4MM3B 2PLPA 4C7ZA 2NR2A 1GUAB 2IZVB 3MP9A 3IG3A 1C9FA 1QLBB 3T9LA 2PE9A 4HDOA 4LK0M 1WMHB 4KIKA 3X0WA 2QIEB 5J2RA 1OEYJ 1OGWA 4LJOB 2BPSA 1WJNA 1V1OA 4HLEA 1L4DB 1K51A 1NENB 1KF6B 5C3JB 2DENB 3TUOA 5CHFA 1LGRA 2KC2A 2LGYA 1NYRA 2AYOB 3RFZB 1HTQA 1PYWD 4FADA 1ZDXA 2LWPA 3J9CA 2CJNA 2C7MB 1K50A 3N3KB 4FN2A 1HA5A 3H9DA 1WSPA 1P1AA 2WP9B 2V4IB 1ET6A 2W55A 2VRRB 1FNVA 2LVOA 3PZDA 1FNUA 3AB5A 2XNAC 3PVLA 4HJGE 3MJWA 1XQQA 3DOWA 2GB1A 3ZQ4A 3SHQA 2LJIA 3UINB 4GB9A 2N0SB 3PGEA 1Z5SB 2FAZA 2X8XX 4D2KA 4NJ6A 2LUEA 4FHKA 1D6EC 1JRPA 3RNEC 1V97A 3RZFA 3TL5A 1I4XA 4JPSA 4EKUA 4PK1A 2V3NA 2PIAA 3QAQA 3U52E 4W9IA 3NVVA 4KZCA 3PRPB 3TBLD 1PGXA 1E10A 3PT2B 2QCZA 1J7BA 3R7QA 1NYQA 2ZCBA 1HXYD 2B3AA 2JVCA 2CHWA 4MELA 4AQ7A 1K8RB 1HZ6A 3ZXVA 1VCBA 3DDCB 3JVZX 3QA8A 2EMTA 3SR6A 2BYTA 1KM7A 1OQQA 3H7PB 1V1PA 1JRUA 4B95A 2WXFA 1MFWA 4BFRA 1R4NI 4G50A 3UIPB 4J3OD 1MVKA 3HIZA 1TJEA 3A9JB 5KHQA 1RWSA 4YTPB 4OZBA 2FCQA 3DHHC 3LB8C 1WXSA 1E8WA 3APCA 3U4EG 1C4PA 3IVFA 2EMSA 4Q2JA 1CJEA 1XO3A 2BW2A 4HEA1 3VRAB 3WALA 4KV2A 1D3ZA 4MEMA 2LVPA 3A33B 1SXTA 2KD0A 2WXIA 4ICVA 4IDIA 2OJWA 1YN3A 2DX5B 4KKIA 5CX3A 1EWYC 1YQBA 2BYFA 2HE7A 2PE6B 2N9KA 1F2RI 3WAOA 3MHZA 1T0RC 3CSTA 2JPHA 4KSKC 1LM8B 2L83A 2AL6A 4KDLB 1TKYA 4B9KA 1WX7A 4DDGD 4DXFA 3QWZB 4AS1A 2L32A 2J0KA 1FFVA 4PYUA 3B0AA 5BMIA 1FEHA 2Y5CA 1IBXB 1F0ZA 3PS6A 4MGKE 4B0EA 2BTEA 5FR6A 1GPXA 3SD5A 1WYGA 2JSVX 1I35A 3VUXA 4USAA 3RNGC 4W9EA 4XDCA 3FILA 4HKQA 4IWQA 2G4DB 1PFDA 2KFKA 4M02A 4FLHA 3TMPB 3JW0X 1S3SG 1QOBA 3PREA 2C7HA 3BY4B 4BZAA 4P16A 3K9OB 2XN9C 1FCLA 4TV3A 5E6NA 2KWCA 4WWNA 3DBSA 1Y56A 3ZYYX 2FUG1 4EUTA 4KDIC 4OZAA 4CQNA 3RI7C 2L3ZA 2R2QA 4US9A 3NVWA 2IDYA 1E90A 1RAXA 2N9EB 1TY0A 2K8CA 2LGIA 3ML9A 2MBBB 2IPKD 4E74A 3ZRFA 1EWCA 2WX1A 3AV8A 3AEFB 1D5XC 1UGMA 3KLSX 1UH6A 5EE0A 2MW5A 1FCCC 2AEHA 4OVUA 1LO5D 2WXQA 1I7HA 1C4AA 2MJEA 4GLSC 4A90A 2GBNA 1HEZE 2VZKB 1E6EB 3A1QA 1Q1OA 2BWES 1GC7A 3MJ5A 3U7ZA 3N1YC 5JXVA 1JWBD 2LUMA 3P4SB 1E5WA 1N6ZA 2INNE 2MP2B 3PV1A 2LXCA 4AOFA 3DWGC 2QEJC 2M0AA 4NQLB 2D3BA 5DPWA 3RMKC 2GMIC 4BKGA 1V2YA 1C3TA 2G4SA 3AEBB 5TSSA 2INPE 1XCTL 3P63A 4NZLB 3EC8A 1F1HA 4P7IA 2J7QB 5LLIA 5KHOA 4W9DA 4LJPB 1IP9A 4IC7B 2RD0A 1AW7A 5D7GA 3ZW3A 3VR9B 4P1CC 5D6JB 5E6OA 1FNWA 1WWTA 2IY0B 1SE4A 2QJLA 1Q5WB 3DVGX 4GN1A 5G5GA 1STEA 2WDVB 2YEPB 2JZ3B 3WA0A 3L13A 1NI3A 3PTFC 2PEAA 3L10B 4DBGA 3KWLA 3QARA 4WAAA 1WXMA 4K7WA 3D32A 3W1SA 4CYEA 3SEBA 2KDIA 5AZFA 4I6PA 2N1VA 2G1EA 1EM7A 4GOCA 2K25A 4MSQB 3VUWA 1ESFA 1QZEA 2JYTA 2UU7A 1X1MA 2SEBD 4E3CA 4AUQC 5CTRC 1UWMA 2KJHB 4EZJA 1GJZA 2XK5B 1SE3A 3R8BA 2LJ5A 3R7RA 1UELA 1ZP0B 1CZPA 1F52A 4OHJA 3TEZA 4FXCA 4EZKA 3EGRA 3VTUA 3DHGC 2OOBB 3RT3B 5IKCM 4L23A 4M8MA 1V49A 4HKZE 1WMHA 2MRPA 2KLGA 4AP4C 2IO0B 3B08A 2INCC 2LASA 3BVZA 1SJHD 3RCZA 2Y5BB 1C76A 4II3B 2R61A 3RZWC 3DBLI 2L52A 1ENFA 3VQIA 1KLGD 1WE7A 1V5OA 1P98A 3CWIA 1M4VA 1UZXB 2O6VD 3ZJTA 1YD8U 3I57A 4XC2A 3N20C 2HJ8A 1L7YA 4RM9A 3RD2A 2FCMA 3QHTA 2MEKA 1WR6E 1SSNA 4G3XB 4N9F4 5GMVA 3ZXRA 4GSWA 3SFDB 1OEYA 1C77A 5BMGA 4C4VB 1TS2A 2WS3B 3IAS1 1FRDA 2KQ7A 4PS7A 5CHVC 2RR9A 4IM0A 2WU2B 3ZNHB 5IOIA 3DWMA 5CHWA 4MGYE 1KOTA 3I5JC 2IJ0A 4I6LB 4HK2A 3Q14C 4XX5A 2EKIA 2KVZA 4A8XC 4YSYB 2K6DB 1IYFA 3N9YC 3NZSA 1DOYA 4ZRIA 3Q6BA 3ZKJC 1BXTA 1J7AA 1UWXA 2C60A 1NDDA 2VH1A 1YJIA 2DLBA 4NAMA 4ICUA 2LGXA 5IA7A 4JGHB 2Z0DB 4RGMA 3KVFB 4G11A 2KX0A 4LNFA 4C7YA 4YL8A 3HK0A 1WZ3A 1VRAB 2XEWA 2BYEA 3BWUD 2KDFB 1ZE3D 1SGHA 5DPSA 3OAWA 4P6VF 1J0GA 2RDGA 2D5GA 1LQBA 1FFUA 4MH0E 3AEDB 1TS3A 3AE7B 4W9FA 2W3SA 4NPNA 1XT9B 4NAWB 2DAFA 1MHHE 3DQVA 2L05A 2WXMA 3V6CB 3OG5A 1GAQB 4GIVA 2K6QA 1L5PA 1RLFA 1FXAA 2LVQA 3VVWB 4FBJB 1VDVA 1WM2A 3NUHB 3BVMA 3NY5A 1R4MB 1WIAA 2HJ1A 3NS8A 1GB1A 3QCAA 2LD9A 1JWAD 1EU3A 2M56B 2MLBA 2E6XA 1YN5A 4F8CB 3V3XA 1YQ3B 3TEXA 3DBHB 3EHVA 4WWMA 2WWZA 1XLPA 4HXDA 1UBIA 5TR5A 3E9SA 2O6VA 1QT9A 5HKHA 2D3GA 2WXOA 2JY6A 3QQ8B 2M19A 3O13A 2QHOA 2WDQB 3N1ZC 3R3MA 1JROA 3I3TB 4OW0A 1L6UA 2Z0EB 5D3IB 4YTNB 2DYBA 3BIID 3AE1B 3UI3A 3N1XC 1TT5B 4LNNA 1Z2MA 2WHIA 4MH8A 2NS5A 1EF1A 4HCNB 2KDMA 1D5ZC 4TQ0A 2K1FA 3UQAA 3V62A 1WXQA 3W2DA 2SAKA 3ZLZA 1OTRB 1J7CA 3R2TA 4BOZB 5GXGB 1N60A 2NPTB 2JXTA 4MGIE 2M0XA 3AE9B 3ZTCA 1XLQA 2FNJB 3H1UA 3ONSA 3VH3B 1K53A 1R7SA 2ZPYA 2ON8A 3L0WB 1WF9A 2J52A 3AI5A 2IO1B 2DWQA 5BMHA 5EE1A 2K9XA 2V3SA 4DHJB 1WJUA 5E6PA 4ANUA 3B2GA 1OFFA 2QMTA 4JL9A 1CK1A 1H8CA 1D4BA 2QDFA 4A20A 2TSSA 3QC8B 2FUHB 3CMMB 3VTVA 3L4PA 1B9RA 4BKTA 1ZDVA 4YT0B 1H4RA 4LDTB 2BS3B 1YQ4B 2QC8A 2G45B 4ARIA 4W9HA 3OJ3A 4RF1A 1JALA 2NTTA 2PVOD 1TKGA 3ZO5B 2WXPA 3RN9C 2A4ZA 3DBRB 2KX3A 1WXVA 1YOVB 2Z8LA 5DPRA 3Q3MC 3U7DA 1SJED 4XZ4A 5H92C 4FA6A 3PRZA 3M95A 1ZGUB 3IFWB 3R66C 1KRHA 2CU1A 1HTOA 4KGRA 4WJQA 5DPTA 4IWPA 1XXGA 2JWUA 3T8MA 4MJSA 3PPAA 4KGTA 2GBRA 1DGJA 3WAMA 2KJ6A 3MTNB 1YX5B 2GI9A 3A4RA 4ZRKA 3HVZA 3NS1A 1VLBA 4HRSA 4GDKB 2RDBC 1UD7A 4ITKA 4I6NB 4MACA 2JT4B 1RM6C 4JWUC 5AZGA 4BBNC 1ZOYB 3UIOB 4CO7A 2DZKA 1I4QA 3Q3JA 1I4GA 4KIKB 1GG3A 1JCKB 4GU2A 2EKEC 2KHWB 3VAWA 3MFGA 4W9JA 1U4AA 2IGHA 3N30A 2MA9B 2DZMA 3GE3C 3IBEA 2BB6A 2KZRA 4PS8A 3VFKA 1QILA 2W54A 1UUPA 1GNUA 3ECIA 2KTRA 3GS2A 1C1YB 2DYMA 3W1YA 1F9JA 2J4XA 4KKJA 3Q8BA 3ZDMC 3T3NA 3PRMB 3U2SC 4OZCA 3W9CB 2AQ1B 2JZPA 2OHFA 4NY0A 1E7VA 4B0MA 2L7RA 3RYTA 4KGSA 3ML8A 3AE5B 1N5WA 2FIFA 4HROA 4TSSA 2IY1B 3U8ZA 4K7UA 4XE0A 3FC4A 3AXCA 1E7UA 3JSVA 2I1JA 3Q69A 3IT6B 4RGOS 1E8XA 3KUDB 4LCDE 2O2VA 1ROEA 2W3RA 4XGAB 4DWFA 3AULA 2K5PA 4M0WA 2JWZA 1L4ZB 2KQ4X 4ZYSA 5FR3A 1OQRA 2IO2B 3KH0A 1QOAA 1S1QB 1T0SC 1YNTE 1NI2A 2I38A 2KAJA 2KO3A 3AE2B 1WJ6A 1QOFA 1HQRD 4JIOU 1TY2A 3EUB2 5IP4D 1VD2A 2IO3B 1KJTA 3PZ8A 2K8HA 1WI0A 4TUUA
chains in the Genus database with same CATH topology
1FRDA 1K51A 1V1PB 1K52A 2V0GA 3GB1A 1NENB 1KF6B 3BYTB 5C3JB 3TUOA 2AX5A 2QSDA 2PW9A 1YMHE 2WU2B 4C56C 3Q8EA 3DWMA 3IXSA 1NYRA 3RFZB 1PYWD 1ZDXA 1ZUD2 2IJ0A 3J9CA 4YWGG 2CJNA 5BYSA 4R3DA 2LHEA 2NTSA 1FIQA 1P7EA 1K50A 4WH4A 4XDDA 1HA5A 2EKIA 1WSPA 2KWDA 3R2IA 3ZJUA 3ZGZA 2WP9B 2H88B 4A8XC 4YSYB 2V4IB 1ET6A 2W55A 1FNVA 2PTLA 1AYFA 3N9YC 1FNUA 3AB5A 2XNAC 4HJGE 1DOYA 4NJCA 3GP7A 1VJKA 5C2TB 1BXTA 1J7AA 1UWXA 1AN8A 3B9JA 1QF6A 2GB1A 1YJIA 3ZQ4A 2LJIA 2DLBA 3AECB 4NAMA 2N0SB 3IAM1 2WU5B 4D2KA 3OWEB 4RGMA 1D6EC 2J53A 1E0ZA 4ZRQA 1YJJA 1JRPA 1V97A 4C7YA 4XWWA 1I4XA 1VRAB 4JPSA 2ONQA 2RPVA 4A6QA 2V3NA 3BWUD 2PIAA 2RMMA 3U52E 1ZE3D 2ICIA 1N5XA 4N58A 3NVVA 5LNK1 4P6VF 1PGXA 1N63A 2RDGA 1E10A 4YTMB 2L1AA 1J7BA 2D5GA 4ARCA 3Q8FA 4OVZA 1NYQA 1KH0A 1FFUA 1HXYD 1ZXHA 2YEPF 2W82A 3AEDB 1TS3A 1ET9A 1E9MA 2LHDA 3AE7B 2E3TA 2W3SA 2MJ3A 2WXJA 1IUEA 2LMCA 4AQ7A 1MI0A 4NAWB 1P7FA 1MHHE 1SEBD 4DXGA 1HZ6A 1IGDA 3EA6A 2JX5A 2WXMA 3C8YA 1V8CA 3HUIA 2AQ3B 1C78A 3SR6A 2BYTA 1JWMD 1GAQB 1OQQA 1NVID 5AUKA 1V1PA 1QQRA 1JMLA 1L5PA 1KLUD 3FILB 1FXAA 1DOIA 3Q8CA 1VDVA 2WXFA 2MH7A 1YN4A 1I4PA 3NUHB 1D5MC 3BVMA 1RFKA 4J3OD 1MVKA 5HFYA 1TJEA 3AEEB 4ZHOA 1GB1A 2AQ2B 3I9V1 3AH7A 2PKOA 3P1MA 1RWSA 2NMQA 3HRDD 3AMZA 4YTPB 1JWAD 1EU3A 4OZBA 2M56B 3NVZA 3LB8C 2E6XA 4IOIE 1YN5A 1PGAA 3U4EG 3V3XA 1YQ3B 5D3DA 3E56A 1C4PA 3TEXA 1SBBB 2CU3A 4US8A 2ACZB 4Q2JA 1CJEA 1XO3A 2BW2A 3AEGB 4HEA1 4WWMA 4ZOHC 1XLPA 4RGTA 1EU4A 1I4RA 4RGNA 3VRAB 1XLNA 5G5HA 1F2RC 1SXTA 3KWVA 4PT5A 2WXIA 2PMVA 3E9SA 4IDIA 1YN3A 5HI1A 2G9HD 4KKIA 1EWYC 1JWUD 1QT9A 3TEYA 2JYEA 2WXOA 5BYRA 2N9KA 2WXHA 1E7PB 1F2RI 1UNSA 2M19A 3AM9A 2WDQB 3O13A 4LTUA 3P42A 1I4HA 1JROA 2X38A 4OW0A 4JX1C 1L6UA 3MHZA 3P4PB 1FO4A 5D3IB 4YTNB 3BIID 2L83A 3AE1B 3UI3A 1QOGA 1TS5A 4LLGM 1TKYA 4ZHPA 2BS4B 4MH8A 4DXFA 1ZPSA 4AS1A 2L32A 5AUIA 2KDMA 1D5ZC 3AN1A 3P4QB 4TQ0A 1FFVA 1XLOA 1WXQA 2WQYB 5BMIA 3W2DA 2SAKA 1FEHA 2Y5CA 4JE3B 3ABVB 1IBXB 1J7CA 3R2TA 1F0ZA 3VRBB 5GXGB 1N60A 4A9AA 4GDLB 3LYYA 2JXTA 1B1ZA 5BYQA 1C79A 3W5VB 3AE9B 1XLQA 1CQVA 4B0EA 2BTEA 1JQ4A 2Y5PA 4JWSC 1GPXA 1K53A 1R7SA 2ON8A 1WYGA 1SIJA 2J52A 2JSVX 4USAA 2B76B 2VZKD 2DWQA 1QKZA 3AEAB 3BVGA 1A70A 2DBYA 2K9XA 3FILA 4XDCA 1TS4A 5EE1A 5BMHA 4HKQA 3RPFC 4YSXB 1NEKB 3V05A 1WGKA 1FXIA 1PFDA 1PGBA 1GOZA 3B2GA 1OFFA 3BZDB 2WXLA 2QMTA 3KQ4A 1CK1A 4RCOA 1QOBA 4RFBA 3P4RB 3IT4B 1D4BA 3H8HA 4C80A 5H8YE 5HG2A 4P16A 2TSSA 2N7JA 1C4CA 1IGCA 3L4PA 1TZOA 2XN9C 1FCLA 4RNAA 1N61A 1B9RA 4YXDB 1Y56A 1ZXIA 2FUG1 3ZYYX 1ZDVA 2BB5A 4YT0B 4ZRPA 4OZAA 4YSZB 1JWSD 4CQNA 2BS3B 1YQ4B 2JQRB 3NVWA 4US9A 2IDYA 4ARIA 1TY0A 4RF1A 1MPEA 2KMMA 2LGIA 5I4DA 1JALA 2IPKD 1FD6A 2FE8A 2NTTA 2PVOD 1XEEA 1TKGA 4L2YA 1EWCA 4UDUC 2IGDA 2WXPA 1L0XB 3AV8A 1VZ7A 2Q5WD 3AEFB 1D5XC 2IGGA 3KLSX 2H89B 3AE3B 4N6EB 2Z8LA 5EE0A 1FCCC 3HVDA 1LO5D 2ZW1A 1SJED 2WXQA 5H92C 2WXKA 1DOXA 2WDRB 4TMAB 1I7HA 1SF0A 2OEDA 4DQOC 3W5UB 2I2YA 1C4AA 3PZ7A 2J42A 2HTME 2MJEA 2WXNA 4GLSC 5FK9C 4A90A 1KRHA 4KGRA 1T5XD 1HEZE 2VZKB 2Y3AA 1E6EB 5MPOA 1XXGA 2JWUA 3NVYA 3MJ5A 4KGTA 1DGJA 3U7ZA 3VR8B 1L0YB 3MC0B 5JXVA 1JWBD 2LUMA 3P4SB 1IBXA 1VR9A 2INNE 2JU6X 2GI9A 1Q10A 3DWGC 2QEJC 2K0PA 3HVZA 3NS1A 2M0AA 1VLBA 3BYYB 4GDKB 4HRSA 1SE2A 3AEBB 4ITKA 1TKEA 4MACA 5TSSA 2INPE 1MHXA 1XCTL 3AE4B 3P63A 1TYGB 1RM6C 4JWUC 1T3QA 1HZ5A 3BK2A 4NZLB 3NRZA 1ZOYB 1FRRA 1XCQL 3AE6B 4XWTA 2BS2B 1I4QA 1AW7A 1I4GA 2WXRA 5D7GA 4EE2A 5E6JA 1WRIA 1RYJA 2CJOA 1JCKB 4MT5A 3VR9B 3CIRB 4WIPA 2LFIA 1WWTA 1FNWA 3ETRA 3MFGA 4TQ1A 1F77A 1SE4A 2IGHA 2HDEA 4WURA 2QJLA 4WQMA 3TEWA 1UGJA 3T3OA 2BB6A 4H2AA 5G5GA 1STEA 2WDVB 2YEPB 2ZW0A 3WCQA 1QILA 5HHDG 2W54A 1UUPA 1NI3A 3GS2A 3KWLA 3ZJVA 3B2FA 2DYMA 2V3PA 4RH6A 1L6VA 3SFEB 1KFYB 2J4XA 4KKJA 3Q8BA 3W1SA 3T3NA 1PUTA 3SEBA 2MJDA 1VZ6A 3U2SC 2N9LA 4OZCA 3W9CB 1T6BX 2AQ1B 2G1EA 2JZPA 1EM7A 1BMLC 2OHFA 3AE8B 2GRIA 4IKGA 1SB3C 4B0MA 1ESFA 1FMAD 2JYTA 5T8IA 4KGSA 4WAFA 4A55A 4L1BA 2SEBD 2K22A 4RF0A 2BT6A 2BBCA 2QILA 5EE3A 3AE5B 1N5WA 1UWMA 4HROA 2DYOA 1SE3A 2WLBA 3R8BA 2K3UA 4TSSA 5FKAC 1ZP0B 3FAHA 3Q8AA 2WXGA 1GB4A 1CZPA 1ACCA 4OHJA 4XE0A 3FC4A 3TEZA 4FXCA 3EGRA 1BUIC 1VZ8A 1PDXA 2KN4A 1N62A 3Q69A 3IT6B 4L23A 4RGOS 5EE9A 3URYA 1XF5L 2KACA 4HKZE 1AWDA 1ROEA 2PVGC 2W3RA 4KX6B 4REZA 1JW9D 3BVZA 1SJHD 2K5PA 1C76A 4M0WA 1FM0D 2R61A 1L4ZB 4N59A 3TSSA 2EELA 4O1NA 2KQ4X 2LEKA 2L52A 3LXFA 4ZYSA 1L0VB 5FR3A 1ENFA 1OQRA 3VQIA 1KLGD 4MM3B 1DYQA 1M4VA 1QOAA 2PLPA 2RDHA 3CWIA 4C7ZA 1YNTE 2I38A 2KAJA 2WNMA 3ZJTA 3I57A 3NZ3A 3AE2B 1QOFA 1HQRD 3BK1A 1TY2A 2FBWB 3MP9A 1C9FA 2MEKA 1QLBB 3EUB2 1KTKA 1SSNA 4LK0M 3PZ8A 2QIEB 3PO0A 3SFDB 1C77A 5BMGA 1TS2A 2WS3B 1V1OA 1L4DB 3IAS1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  1WGK A;  1DOI A;  1FXI A;  1NEN B;  1KF6 B;  1PFD A;  3ETR A;  1VDV A;  5C3J B;  2MH7 A;  3B2G A;  1OFF A;  2AX5 A;  2QJL A;  4WQM A;  1RFK A;  2WU2 B;  1QOB A;  3DWM A;  3P4R B;  1NYR A;  1TJE A;  2WDV B;  3AEE B;  5G5G A;  3WCQ A;  4ZHO A;  4C80 A;  5H8Y E;  1ZUD 2;  3AH7 A;  2PKO A;  2W54 A;  3P1M A;  1RWS A;  2CJN A;  1NI3 A;  3AMZ A;  3HRD D;  4YTP B;  1JWA D;  3KWL A;  3L4P A;  3B2F A;  2M56 B;  1FIQ A;  3NVZ A;  3LB8 C;  1N61 A;  1B9R A;  4YXD B;  1L6V A;  1ZXI A;  3SFE B;  3ZYY X;  1YQ3 B;  1KFY B;  2EKI A;  1F0Z A;  4YT0 B;  4YSZ B;  2WP9 B;  2CU3 A;  1PUT A;  4US8 A;  2ACZ B;  2BS3 B;  2H88 B;  1CJE A;  1XO3 A;  1YQ4 B;  2JQR B;  2MJD A;  3AEG B;  3NVW A;  4US9 A;  4YSY B;  2W55 A;  4WWM A;  3W9C B;  4ZOH C;  1XLP A;  2G1E A;  1AYF A;  2OHF A;  3AE8 B;  2KMM A;  3VRA B;  3AB5 A;  1DOY A;  1XLN A;  1JAL A;  1SB3 C;  1VJK A;  5G5H A;  1FMA D;  5C2T B;  2PVO D;  1J7A A;  1TKG A;  3B9J A;  1QF6 A;  1YJI A;  2K22 A;  3AEC B;  3AV8 A;  2BT6 A;  2N0S B;  2Q5W D;  3AEF B;  3AE5 B;  1N5W A;  5EE3 A;  1UWM A;  4HRO A;  4IDI A;  2WU5 B;  2WLB A;  1EWY C;  2H89 B;  3AE3 B;  4N6E B;  1QT9 A;  5EE0 A;  1ZP0 B;  3FAH A;  1CZP A;  1E7P B;  3AM9 A;  2M19 A;  4LTU A;  5H92 C;  2WDQ B;  1E0Z A;  3FC4 A;  1YJJ A;  1JRP A;  2WDR B;  4FXC A;  1DOX A;  1JRO A;  1PDX A;  1I7H A;  1SF0 A;  1V97 A;  4JX1 C;  4C7Y A;  1L6U A;  3P4P B;  1FO4 A;  1N62 A;  3W5U B;  2HTM E;  4YTN B;  2MJE A;  3BII D;  5EE9 A;  2L83 A;  3AE1 B;  1KRH A;  1AWD A;  1QOG A;  2PIA A;  1TKY A;  4ZHP A;  1ROE A;  2PVG C;  2W3R A;  4KX6 B;  1N5X A;  2BS4 B;  1E6E B;  4N58 A;  3NVV A;  4P6V F;  1JW9 D;  5MPO A;  5AUI A;  2K5P A;  1N63 A;  3NVY A;  3AN1 A;  1DGJ A;  3P4Q B;  3VR8 B;  1FM0 D;  1E10 A;  1FFV A;  4YTM B;  4N59 A;  1J7B A;  1JWB D;  1XLO A;  3P4S B;  1WXQ A;  2LEK A;  2WQY B;  2L52 A;  3LXF A;  1NYQ A;  1L0V B;  3DWG C;  1FFU A;  2Y5C A;  3HVZ A;  3NS1 A;  3ABV B;  1OQR A;  1J7C A;  3AED B;  1VLB A;  1QOA A;  3CWI A;  4HRS A;  4C7Z A;  1E9M A;  3AE7 B;  2KAJ A;  2E3T A;  1N60 A;  2W3S A;  2MJ3 A;  3AEB B;  5GXG B;  3VRB B;  4A9A A;  1IUE A;  4ITK A;  3AE2 B;  1QOF A;  1TKE A;  3W5V B;  3AE9 B;  1XLQ A;  3AE4 B;  3P63 A;  1TYG B;  1RM6 C;  2FBW B;  4JWU C;  1JQ4 A;  1T3Q A;  1FXA A;  4JWS C;  1GPX A;  1R7S A;  1QLB B;  3EUB 2;  1WYG A;  2JX5 A;  1SIJ A;  3NRZ A;  1ZOY B;  1FRR A;  1V8C A;  3AE6 B;  3HUI A;  2BS2 B;  3SR6 A;  4USA A;  2B76 B;  2QIE B;  2DWQ A;  3AEA B;  1GAQ B;  5EE1 A;  1A70 A;  2DBY A;  2K9X A;  3PO0 A;  1WRI A;  1OQQ A;  1NVI D;  1RYJ A;  5AUK A;  3SFD B;  2CJO A;  3RPF C;  2WS3 B;  3VR9 B;  1L5P A;  4YSX B;  3CIR B;  1NEK B;  1WWT A; 
#chains in the Genus database with same CATH topology
 1V1P B;  1K52 A;  1WGG A;  2AX5 A;  4ZYN A;  2N9P C;  2PW9 A;  4AWJ A;  5BO4 B;  4C56 C;  3Q8E A;  3IXS A;  2YLM A;  2CKH B;  5LXH A;  3RNB C;  3C0R B;  2GBM A;  5BYS A;  2V1Y A;  2NTS A;  2MHJ A;  3ZRC A;  4WH4 A;  2M8S A;  2KWD A;  3R2I A;  3ZJU A;  3ZGZ A;  2NCN A;  2KN5 A;  2MCN B;  1WRD B;  2BKR B;  2PTL A;  1AYF A;  1MJD A;  2WDT B;  4M01 A;  1VJK A;  3AU5 A;  4HWI B;  5JH5 C;  1AN8 A;  4ANX A;  3AEC B;  3IAM 1;  4OVV A;  1Q0W B;  5J17 A;  3OWE B;  2UWQ A;  4PYZ A;  3NZU A;  2YVC A;  2LI5 A;  4HCP B;  4XWW A;  3ZVV A;  2KMC A;  2CS4 A;  2RPV A;  4A6Q A;  3ZNI D;  4LNO A;  2ICI A;  1N5X A;  2LZ6 A;  4N58 A;  5LNK 1;  5EDS A;  2LRW A;  1N63 A;  3HHM A;  2D11 A;  1T0Q C;  2L1A A;  2CHX A;  3Q8F A;  1TGZ B;  1KH0 A;  1RRB A;  1ZXH A;  4MM3 A;  1I42 A;  2IBI B;  2LHD A;  1E9M A;  2E3T A;  2MJ3 A;  1IUE A;  3Q3O C;  2KWV B;  2KFJ A;  2KYW A;  4DXG A;  5L95 C;  1WE6 A;  1WX8 A;  1YX6 B;  1V8C A;  3HUI A;  2AQ3 B;  1C78 A;  2KK8 A;  4K3C A;  1JWM D;  4EFO A;  1NVI D;  5AUK A;  1QQR A;  2RGF A;  1JML A;  3C19 A;  3UGB B;  3FIL B;  2REX A;  3Q8C A;  4W9L A;  3UF8 A;  1PQS A;  1I4P A;  1YIW A;  2J0M A;  2BF8 B;  2KFK B;  4G0N B;  5HFY A;  4WJP A;  2KXJ A;  3L16 A;  5AZH A;  3AH7 A;  2HTH A;  3VHT C;  2DHZ A;  1V81 A;  3HRD D;  1RFA A;  1BT0 A;  3NVZ A;  4IOI E;  1PGA A;  4BVU C;  2KWU B;  5D3D A;  4A3P A;  1SBB B;  4US8 A;  4WWO A;  2ACZ B;  1V80 A;  2HD5 B;  1EU4 A;  1I4R A;  1ISN A;  2I1K A;  3ZTD A;  4PT5 A;  3HM3 A;  2KJR A;  2BVC A;  5JHA A;  4JLC A;  3VTW A;  1WJ4 A;  5BYR A;  3TEY A;  3P2B A;  2WXH A;  1UNS A;  3AM9 A;  4LTU A;  1I4H A;  4W9C A;  4JX1 C;  3P4P B;  3RUL A;  4NNJ B;  1UBQ A;  4ZHP A;  1ZPS A;  5AUI A;  3A9K B;  2GBJ A;  4F1S A;  3A1Q B;  3QIJ A;  2WQY B;  1L2N A;  3GE8 C;  3ZIM A;  3ABV B;  3GOE A;  4HPP A;  3UQB A;  5IN7 A;  3VRB B;  4GDL B;  3GZN B;  1WM3 A;  5BYQ A;  1C79 A;  3EEC A;  3W5V B;  5D94 A;  1CQV A;  1JQ4 A;  3H7P A;  3LJ3 A;  2VZK D;  4M8N A;  3BVG A;  1A70 A;  2DBY A;  1HE8 A;  1TS4 A;  3GZN I;  3RPF C;  1EF5 A;  4YSX B;  1NEK B;  1WGK A;  1FXI A;  3M63 B;  4FHJ A;  4GMV A;  3A9J A;  2WXL A;  2CR5 A;  2BYV E;  2L76 A;  4KVG B;  4GGQ A;  4RFB A;  2D07 B;  3P4R B;  3ZNG C;  2BWF A;  2JUO A;  2KNB A;  3IT4 B;  3M62 B;  4C80 A;  4ANW A;  2GLS A;  1P0R A;  2KMA A;  5HG2 A;  3L17 A;  4BOS C;  1C4C A;  1WR1 A;  2A5U A;  1WGH A;  2V9H A;  2L0T A;  4NJ7 A;  1ZXI A;  2BB5 A;  1WXA A;  2J0J A;  2KOX A;  1MG8 A;  2KMM A;  1WGR A;  3V60 A;  2D3A A;  4QAY A;  2PJH A;  3O65 B;  1XEE A;  4KZ0 A;  2N7D A;  1VZ7 A;  3RNF C;  3DHI C;  2M4N A;  3AE3 B;  4N6E B;  1R4M I;  1KLV A;  2WXK A;  1DOX A;  4HPM B;  4TMA B;  2ZNV C;  2OED A;  3H6N A;  2JRH A;  2J42 A;  4RMA A;  2RPQ A;  5JHB A;  1GC6 A;  2M17 A;  4WQO B;  1XD3 B;  1T5X D;  2JF5 A;  1IPG A;  2C7N B;  3DBH I;  3VR8 B;  1L0Y B;  3MC0 B;  1IBX A;  2L8J A;  4NQK E;  1LXD A;  2K0P A;  3NOB A;  2XBB C;  3I63 C;  3X23 A;  3ZDT A;  1V5T A;  2G3Q B;  1TYG B;  1T3Q A;  1HZ5 A;  3BK2 A;  2KDB A;  1FRR A;  3AE6 B;  4XWT A;  3NG0 A;  1SIF A;  2WXR A;  2WYQ A;  2CJO A;  1WYW B;  1UF0 A;  5L83 A;  3VDZ A;  3ETR A;  4TQ1 A;  1FPY A;  5G2N A;  2K8B A;  2FCS A;  1TTN A;  2HDE A;  4WUR A;  4WQM A;  2LGD A;  3TEW A;  1FXT B;  3WCQ A;  2ZW0 A;  2R2O A;  4IWO A;  4EZL A;  5HHD G;  3RUI B;  4K81 A;  2V3P A;  1L6V A;  1WY8 A;  1KFY B;  2MJD A;  1VZ6 A;  3KW5 B;  3AU4 A;  1OQY A;  2N9L A;  3DVG Y;  1EO6 A;  2GRI A;  3CF6 E;  3APF A;  3TCA A;  1SB3 C;  1P3Q U;  1FMA D;  3VH4 B;  2KQS A;  4WAF A;  4A55 A;  2K22 A;  2BBC A;  1TBE A;  2W9N A;  4WJN A;  2DYO A;  2WLB A;  1WFY A;  5FKA C;  4P1B C;  5IO9 A;  4X57 B;  2WXG A;  1GB4 A;  1ZKH A;  1ACC A;  2NBU A;  2DNF A;  1BUI C;  1VZ8 A;  2LGS A;  4LNI A;  4ZRJ A;  3ZNZ B;  3URY A;  2LXA A;  1XF5 L;  3W1S C;  4REZ A;  4KX6 B;  2CHZ A;  3RNC C;  1R4N B;  4F7Z A;  3Q2A C;  2MP2 A;  3JYU A;  4N59 A;  3TSS A;  2EEL A;  4O1N A;  2AL3 A;  2LEK A;  2KLC A;  2K39 A;  2ZCC A;  1NBF C;  2KAN A;  2WX0 A;  1DYQ A;  2RDH A;  4IUM B;  2WNM A;  3NZ3 A;  3L54 A;  3A4S C;  3DBR I;  1Y8R C;  4FUL A;  2N7E A;  3BK1 A;  3SDL C;  2FBW B;  3IHP C;  1P9D U;  2PPH A;  1KTK A;  3KUZ A;  3H7S A;  3PO0 A;  2MBO A;  2MBE A;  2ASQ A;  5C23 A;  2V0G A;  3GB1 A;  3BYT B;  2N1W A;  2MBH A;  4HJK A;  2QSD A;  3DCG A;  1YMH E;  3NJT A;  3V6E B;  2DZJ A;  1ZUD 2;  3DVN U;  4YWG G;  2NVU I;  4R3D A;  1J8C A;  2LHE A;  1FIQ A;  1P7E A;  1WZ0 A;  4XDD A;  4DXA B;  2H88 B;  3QX1 A;  2DZI A;  3HM6 X;  5D2M B;  2FID A;  3PLU A;  4NJC A;  2KKC A;  3GP7 A;  3NHE B;  3KYD D;  4HDQ A;  4S0R A;  5C2T B;  4C00 A;  3B9J A;  1QF6 A;  2XK5 A;  2MBQ A;  2N9X A;  3OJ4 B;  2WU5 B;  3VUY A;  2KDE B;  2V4L A;  2NBV B;  3S2A A;  2N4F A;  2O6V B;  3DVN V;  2J53 A;  1E0Z A;  4ZRQ A;  1YJJ A;  1WH3 A;  4J6I A;  2IND C;  2ONQ A;  1WGY A;  4W9G A;  2RMM A;  1A5R A;  4TKN A;  1AAR A;  3DPD A;  3MHS D;  3KYC D;  4YTM B;  4ASW C;  4XYC A;  4ARC A;  4OVZ A;  2YEP F;  2ZVO A;  1LFD A;  2W82 A;  2OJR A;  2L00 B;  2ZZP B;  4BKS D;  1ET9 A;  2WXJ A;  2LMC A;  3EFC A;  1MI0 A;  1P7F A;  1SEB D;  2MSE D;  1V6E A;  3LDZ E;  1IGD A;  3EA6 A;  4W9K A;  2JX5 A;  3C8Y A;  4C4V A;  1KLU D;  5JZE B;  1YJ1 A;  2ZEQ A;  4B6W A;  1DOI A;  1V9J A;  2MH7 A;  1YN4 A;  1D5M C;  3RNA C;  2MQJ A;  1RFK A;  2VH2 A;  1TIF A;  3PSE B;  3AEE B;  4ZHO A;  3VXW A;  2AQ2 B;  3I9V 1;  4IW0 A;  2PKO A;  3P1M A;  2NMQ A;  1E8Z A;  4IG7 B;  4MGZ E;  3AMZ A;  3ENE A;  2MWS B;  3E56 A;  2RSU A;  2CU3 A;  2DAJ A;  3AEG B;  3PLV A;  4DHJ D;  4DHZ B;  2KVR A;  5LXI B;  4ZOH C;  4RGT A;  4RGN A;  5IAA C;  3WAP A;  1XLN A;  3A9K A;  5G5H A;  4FJZ A;  4II2 B;  1F2R C;  3Q3N C;  3KWV A;  2BGF A;  4MDK E;  2PMV A;  4IM3 A;  5HI1 A;  2FCN A;  2G9H D;  3K9P B;  1JWU D;  4IM2 A;  2JYE A;  4GDL A;  1E7P B;  3TIX A;  1SE9 A;  3WAN A;  3P42 A;  2GOW A;  2X38 A;  1FO4 A;  4LDT D;  1M94 A;  1QOG A;  1TS5 A;  4LLG M;  2WGS A;  2BS4 B;  4BAX A;  3P4Q B;  3AN1 A;  1XLO A;  4MJS B;  4JE3 B;  3V61 A;  3Q3F A;  4NAW A;  4AJW A;  4A9A A;  3LYY A;  1B1Z A;  4E71 A;  2IYD B;  2Y5P A;  4JWS C;  5G55 A;  1SIJ A;  4K1R B;  2B76 B;  3AEA B;  1QKZ A;  4ZDV A;  4ACF A;  3SU8 X;  1TZ1 A;  3V05 A;  1PGB A;  1G6J A;  1GOZ A;  3BZD B;  3PHW B;  3KQ4 A;  2LRU A;  4RCO A;  4CHK A;  3H8H A;  4FJV B;  3TJP A;  5H8Y E;  3ZUN A;  3MC8 A;  2N7J A;  3B1L X;  1IGC A;  1WGD A;  1TZO A;  4RNA A;  4A3O A;  1N61 A;  4YXD B;  5C1Z A;  2KTR B;  2L0F A;  4ZRP A;  2JXX A;  4YSZ B;  1JWS D;  1ZW7 A;  3N32 A;  2JQR B;  3FKY A;  3CSF A;  3DBL B;  1MPE A;  5I4D A;  2M1M A;  4MSM B;  1FD6 A;  2FE8 A;  4L2Y A;  4UDU C;  2IGD A;  1L0X B;  1MG4 A;  2Q5W D;  2ZJD A;  2ZPN A;  3OLM D;  4BKS A;  4PS3 A;  2IGG A;  3KUC B;  4RM8 A;  2H89 B;  3HVD A;  2ZNV B;  2ZW1 A;  2GBK A;  1T0Y A;  2JZZ A;  2WDR B;  1SF0 A;  4DQO C;  2D3C A;  3W5U B;  2I2Y A;  3PZ7 A;  2HTM E;  2WXN A;  3JSV B;  5FK9 C;  4URK A;  2Y3A A;  5MPO A;  2O2V B;  3NVY A;  1VR9 A;  2JU6 X;  4DHZ E;  4M0W B;  1Q10 A;  2C5L C;  2NPT A;  4M00 A;  3BYY B;  1SE2 A;  4HVB A;  3U30 A;  1TKE A;  4K3B A;  1MHX A;  3AE4 B;  4AJY B;  3M3J A;  2BKF A;  3PHX B;  4KSL C;  3NRZ A;  1XCQ L;  2BS2 B;  1V86 A;  2NBW B;  4EE2 A;  4HPL B;  5E6J A;  1WRI A;  1RYJ A;  5J18 A;  4MT5 A;  3CIR B;  4WIP A;  2LFI A;  4FJY A;  3MC9 A;  1F77 A;  4WWP A;  1UGJ A;  3T3O A;  2UYZ B;  4H2A A;  3APD A;  3EFU A;  3L08 A;  3QJZ A;  2KC1 A;  2KT7 A;  4EOY A;  3ZJV A;  3B2F A;  4RH6 A;  4BBN F;  2MX2 A;  3SFE B;  2Z59 B;  1PUT A;  5AEK B;  1T6B X;  4DDI D;  4S17 A;  1BML C;  3AE8 B;  3ALB A;  4K7S A;  4IKG A;  4ANV A;  2D2Q A;  3WIM A;  2D10 A;  5T8I A;  4L1B A;  1E8Y A;  4RF0 A;  2BT6 A;  2QIL A;  5EE3 A;  2KTF A;  2BQQ A;  2K3U A;  3FAH A;  3Q8A A;  4DK5 A;  4LNK A;  4JQW C;  4GXB A;  5DCN A;  1PDX A;  2KN4 A;  2AWT A;  1N62 A;  5EE9 A;  2KAC A;  1AWD A;  2PVG C;  2C9W B;  4EEW A;  1JW9 D;  1WX9 A;  2JRI B;  1FM0 D;  3LXF A;  1L0V B;  3BIN A;  4GDK A;  2ZVN A;  3QK0 A;  4WJO A;  1J19 A;  1CMX B;  1EUV B;  4MM3 B;  2PLP A;  4C7Z A;  2NR2 A;  1GUA B;  2IZV B;  3MP9 A;  3IG3 A;  1C9F A;  1QLB B;  3T9L A;  2PE9 A;  4HDO A;  4LK0 M;  1WMH B;  4KIK A;  3X0W A;  2QIE B;  5J2R A;  1OEY J;  1OGW A;  4LJO B;  2BPS A;  1WJN A;  1V1O A;  4HLE A;  1L4D B;  1K51 A;  1NEN B;  1KF6 B;  5C3J B;  2DEN B;  3TUO A;  5CHF A;  1LGR A;  2KC2 A;  2LGY A;  1NYR A;  2AYO B;  3RFZ B;  1HTQ A;  1PYW D;  4FAD A;  1ZDX A;  2LWP A;  3J9C A;  2CJN A;  2C7M B;  1K50 A;  3N3K B;  4FN2 A;  1HA5 A;  3H9D A;  1WSP A;  1P1A A;  2WP9 B;  2V4I B;  1ET6 A;  2W55 A;  2VRR B;  1FNV A;  2LVO A;  3PZD A;  1FNU A;  3AB5 A;  2XNA C;  3PVL A;  4HJG E;  3MJW A;  1XQQ A;  3DOW A;  2GB1 A;  3ZQ4 A;  3SHQ A;  2LJI A;  3UIN B;  4GB9 A;  2N0S B;  3PGE A;  1Z5S B;  2FAZ A;  2X8X X;  4D2K A;  4NJ6 A;  2LUE A;  4FHK A;  1D6E C;  1JRP A;  3RNE C;  1V97 A;  3RZF A;  3TL5 A;  1I4X A;  4JPS A;  4EKU A;  4PK1 A;  2V3N A;  2PIA A;  3QAQ A;  3U52 E;  4W9I A;  3NVV A;  4KZC A;  3PRP B;  3TBL D;  1PGX A;  1E10 A;  3PT2 B;  2QCZ A;  1J7B A;  3R7Q A;  1NYQ A;  2ZCB A;  1HXY D;  2B3A A;  2JVC A;  2CHW A;  4MEL A;  4AQ7 A;  1K8R B;  1HZ6 A;  3ZXV A;  1VCB A;  3DDC B;  3JVZ X;  3QA8 A;  2EMT A;  3SR6 A;  2BYT A;  1KM7 A;  1OQQ A;  3H7P B;  1V1P A;  1JRU A;  4B95 A;  2WXF A;  1MFW A;  4BFR A;  1R4N I;  4G50 A;  3UIP B;  4J3O D;  1MVK A;  3HIZ A;  1TJE A;  3A9J B;  5KHQ A;  1RWS A;  4YTP B;  4OZB A;  2FCQ A;  3DHH C;  3LB8 C;  1WXS A;  1E8W A;  3APC A;  3U4E G;  1C4P A;  3IVF A;  2EMS A;  4Q2J A;  1CJE A;  1XO3 A;  2BW2 A;  4HEA 1;  3VRA B;  3WAL A;  4KV2 A;  1D3Z A;  4MEM A;  2LVP A;  3A33 B;  1SXT A;  2KD0 A;  2WXI A;  4ICV A;  4IDI A;  2OJW A;  1YN3 A;  2DX5 B;  4KKI A;  5CX3 A;  1EWY C;  1YQB A;  2BYF A;  2HE7 A;  2PE6 B;  2N9K A;  1F2R I;  3WAO A;  3MHZ A;  1T0R C;  3CST A;  2JPH A;  4KSK C;  1LM8 B;  2L83 A;  2AL6 A;  4KDL B;  1TKY A;  4B9K A;  1WX7 A;  4DDG D;  4DXF A;  3QWZ B;  4AS1 A;  2L32 A;  2J0K A;  1FFV A;  4PYU A;  3B0A A;  5BMI A;  1FEH A;  2Y5C A;  1IBX B;  1F0Z A;  3PS6 A;  4MGK E;  4B0E A;  2BTE A;  5FR6 A;  1GPX A;  3SD5 A;  1WYG A;  2JSV X;  1I35 A;  3VUX A;  4USA A;  3RNG C;  4W9E A;  4XDC A;  3FIL A;  4HKQ A;  4IWQ A;  2G4D B;  1PFD A;  2KFK A;  4M02 A;  4FLH A;  3TMP B;  3JW0 X;  1S3S G;  1QOB A;  3PRE A;  2C7H A;  3BY4 B;  4BZA A;  4P16 A;  3K9O B;  2XN9 C;  1FCL A;  4TV3 A;  5E6N A;  2KWC A;  4WWN A;  3DBS A;  1Y56 A;  3ZYY X;  2FUG 1;  4EUT A;  4KDI C;  4OZA A;  4CQN A;  3RI7 C;  2L3Z A;  2R2Q A;  4US9 A;  3NVW A;  2IDY A;  1E90 A;  1RAX A;  2N9E B;  1TY0 A;  2K8C A;  2LGI A;  3ML9 A;  2MBB B;  2IPK D;  4E74 A;  3ZRF A;  1EWC A;  2WX1 A;  3AV8 A;  3AEF B;  1D5X C;  1UGM A;  3KLS X;  1UH6 A;  5EE0 A;  2MW5 A;  1FCC C;  2AEH A;  4OVU A;  1LO5 D;  2WXQ A;  1I7H A;  1C4A A;  2MJE A;  4GLS C;  4A90 A;  2GBN A;  1HEZ E;  2VZK B;  1E6E B;  3A1Q A;  1Q1O A;  2BWE S;  1GC7 A;  3MJ5 A;  3U7Z A;  3N1Y C;  5JXV A;  1JWB D;  2LUM A;  3P4S B;  1E5W A;  1N6Z A;  2INN E;  2MP2 B;  3PV1 A;  2LXC A;  4AOF A;  3DWG C;  2QEJ C;  2M0A A;  4NQL B;  2D3B A;  5DPW A;  3RMK C;  2GMI C;  4BKG A;  1V2Y A;  1C3T A;  2G4S A;  3AEB B;  5TSS A;  2INP E;  1XCT L;  3P63 A;  4NZL B;  3EC8 A;  1F1H A;  4P7I A;  2J7Q B;  5LLI A;  5KHO A;  4W9D A;  4LJP B;  1IP9 A;  4IC7 B;  2RD0 A;  1AW7 A;  5D7G A;  3ZW3 A;  3VR9 B;  4P1C C;  5D6J B;  5E6O A;  1FNW A;  1WWT A;  2IY0 B;  1SE4 A;  2QJL A;  1Q5W B;  3DVG X;  4GN1 A;  5G5G A;  1STE A;  2WDV B;  2YEP B;  2JZ3 B;  3WA0 A;  3L13 A;  1NI3 A;  3PTF C;  2PEA A;  3L10 B;  4DBG A;  3KWL A;  3QAR A;  4WAA A;  1WXM A;  4K7W A;  3D32 A;  3W1S A;  4CYE A;  3SEB A;  2KDI A;  5AZF A;  4I6P A;  2N1V A;  2G1E A;  1EM7 A;  4GOC A;  2K25 A;  4MSQ B;  3VUW A;  1ESF A;  1QZE A;  2JYT A;  2UU7 A;  1X1M A;  2SEB D;  4E3C A;  4AUQ C;  5CTR C;  1UWM A;  2KJH B;  4EZJ A;  1GJZ A;  2XK5 B;  1SE3 A;  3R8B A;  2LJ5 A;  3R7R A;  1UEL A;  1ZP0 B;  1CZP A;  1F52 A;  4OHJ A;  3TEZ A;  4FXC A;  4EZK A;  3EGR A;  3VTU A;  3DHG C;  2OOB B;  3RT3 B;  5IKC M;  4L23 A;  4M8M A;  1V49 A;  4HKZ E;  1WMH A;  2MRP A;  2KLG A;  4AP4 C;  2IO0 B;  3B08 A;  2INC C;  2LAS A;  3BVZ A;  1SJH D;  3RCZ A;  2Y5B B;  1C76 A;  4II3 B;  2R61 A;  3RZW C;  3DBL I;  2L52 A;  1ENF A;  3VQI A;  1KLG D;  1WE7 A;  1V5O A;  1P98 A;  3CWI A;  1M4V A;  1UZX B;  2O6V D;  3ZJT A;  1YD8 U;  3I57 A;  4XC2 A;  3N20 C;  2HJ8 A;  1L7Y A;  4RM9 A;  3RD2 A;  2FCM A;  3QHT A;  2MEK A;  1WR6 E;  1SSN A;  4G3X B;  4N9F 4;  5GMV A;  3ZXR A;  4GSW A;  3SFD B;  1OEY A;  1C77 A;  5BMG A;  4C4V B;  1TS2 A;  2WS3 B;  3IAS 1;  1FRD A;  2KQ7 A;  4PS7 A;  5CHV C;  2RR9 A;  4IM0 A;  2WU2 B;  3ZNH B;  5IOI A;  3DWM A;  5CHW A;  4MGY E;  1KOT A;  3I5J C;  2IJ0 A;  4I6L B;  4HK2 A;  3Q14 C;  4XX5 A;  2EKI A;  2KVZ A;  4A8X C;  4YSY B;  2K6D B;  1IYF A;  3N9Y C;  3NZS A;  1DOY A;  4ZRI A;  3Q6B A;  3ZKJ C;  1BXT A;  1J7A A;  1UWX A;  2C60 A;  1NDD A;  2VH1 A;  1YJI A;  2DLB A;  4NAM A;  4ICU A;  2LGX A;  5IA7 A;  4JGH B;  2Z0D B;  4RGM A;  3KVF B;  4G11 A;  2KX0 A;  4LNF A;  4C7Y A;  4YL8 A;  3HK0 A;  1WZ3 A;  1VRA B;  2XEW A;  2BYE A;  3BWU D;  2KDF B;  1ZE3 D;  1SGH A;  5DPS A;  3OAW A;  4P6V F;  1J0G A;  2RDG A;  2D5G A;  1LQB A;  1FFU A;  4MH0 E;  3AED B;  1TS3 A;  3AE7 B;  4W9F A;  2W3S A;  4NPN A;  1XT9 B;  4NAW B;  2DAF A;  1MHH E;  3DQV A;  2L05 A;  2WXM A;  3V6C B;  3OG5 A;  1GAQ B;  4GIV A;  2K6Q A;  1L5P A;  1RLF A;  1FXA A;  2LVQ A;  3VVW B;  4FBJ B;  1VDV A;  1WM2 A;  3NUH B;  3BVM A;  3NY5 A;  1R4M B;  1WIA A;  2HJ1 A;  3NS8 A;  1GB1 A;  3QCA A;  2LD9 A;  1JWA D;  1EU3 A;  2M56 B;  2MLB A;  2E6X A;  1YN5 A;  4F8C B;  3V3X A;  1YQ3 B;  3TEX A;  3DBH B;  3EHV A;  4WWM A;  2WWZ A;  1XLP A;  4HXD A;  1UBI A;  5TR5 A;  3E9S A;  2O6V A;  1QT9 A;  5HKH A;  2D3G A;  2WXO A;  2JY6 A;  3QQ8 B;  2M19 A;  3O13 A;  2QHO A;  2WDQ B;  3N1Z C;  3R3M A;  1JRO A;  3I3T B;  4OW0 A;  1L6U A;  2Z0E B;  5D3I B;  4YTN B;  2DYB A;  3BII D;  3AE1 B;  3UI3 A;  3N1X C;  1TT5 B;  4LNN A;  1Z2M A;  2WHI A;  4MH8 A;  2NS5 A;  1EF1 A;  4HCN B;  2KDM A;  1D5Z C;  4TQ0 A;  2K1F A;  3UQA A;  3V62 A;  1WXQ A;  3W2D A;  2SAK A;  3ZLZ A;  1OTR B;  1J7C A;  3R2T A;  4BOZ B;  5GXG B;  1N60 A;  2NPT B;  2JXT A;  4MGI E;  2M0X A;  3AE9 B;  3ZTC A;  1XLQ A;  2FNJ B;  3H1U A;  3ONS A;  3VH3 B;  1K53 A;  1R7S A;  2ZPY A;  2ON8 A;  3L0W B;  1WF9 A;  2J52 A;  3AI5 A;  2IO1 B;  2DWQ A;  5BMH A;  5EE1 A;  2K9X A;  2V3S A;  4DHJ B;  1WJU A;  5E6P A;  4ANU A;  3B2G A;  1OFF A;  2QMT A;  4JL9 A;  1CK1 A;  1H8C A;  1D4B A;  2QDF A;  4A20 A;  2TSS A;  3QC8 B;  2FUH B;  3CMM B;  3VTV A;  3L4P A;  1B9R A;  4BKT A;  1ZDV A;  4YT0 B;  1H4R A;  4LDT B;  2BS3 B;  1YQ4 B;  2QC8 A;  2G45 B;  4ARI A;  4W9H A;  3OJ3 A;  4RF1 A;  1JAL A;  2NTT A;  2PVO D;  1TKG A;  3ZO5 B;  2WXP A;  3RN9 C;  2A4Z A;  3DBR B;  2KX3 A;  1WXV A;  1YOV B;  2Z8L A;  5DPR A;  3Q3M C;  3U7D A;  1SJE D;  4XZ4 A;  5H92 C;  4FA6 A;  3PRZ A;  3M95 A;  1ZGU B;  3IFW B;  3R66 C;  1KRH A;  2CU1 A;  1HTO A;  4KGR A;  4WJQ A;  5DPT A;  4IWP A;  1XXG A;  2JWU A;  3T8M A;  4MJS A;  3PPA A;  4KGT A;  2GBR A;  1DGJ A;  3WAM A;  2KJ6 A;  3MTN B;  1YX5 B;  2GI9 A;  3A4R A;  4ZRK A;  3HVZ A;  3NS1 A;  1VLB A;  4HRS A;  4GDK B;  2RDB C;  1UD7 A;  4ITK A;  4I6N B;  4MAC A;  2JT4 B;  1RM6 C;  4JWU C;  5AZG A;  4BBN C;  1ZOY B;  3UIO B;  4CO7 A;  2DZK A;  1I4Q A;  3Q3J A;  1I4G A;  4KIK B;  1GG3 A;  1JCK B;  4GU2 A;  2EKE C;  2KHW B;  3VAW A;  3MFG A;  4W9J A;  1U4A A;  2IGH A;  3N30 A;  2MA9 B;  2DZM A;  3GE3 C;  3IBE A;  2BB6 A;  2KZR A;  4PS8 A;  3VFK A;  1QIL A;  2W54 A;  1UUP A;  1GNU A;  3ECI A;  2KTR A;  3GS2 A;  1C1Y B;  2DYM A;  3W1Y A;  1F9J A;  2J4X A;  4KKJ A;  3Q8B A;  3ZDM C;  3T3N A;  3PRM B;  3U2S C;  4OZC A;  3W9C B;  2AQ1 B;  2JZP A;  2OHF A;  4NY0 A;  1E7V A;  4B0M A;  2L7R A;  3RYT A;  4KGS A;  3ML8 A;  3AE5 B;  1N5W A;  2FIF A;  4HRO A;  4TSS A;  2IY1 B;  3U8Z A;  4K7U A;  4XE0 A;  3FC4 A;  3AXC A;  1E7U A;  3JSV A;  2I1J A;  3Q69 A;  3IT6 B;  4RGO S;  1E8X A;  3KUD B;  4LCD E;  2O2V A;  1ROE A;  2W3R A;  4XGA B;  4DWF A;  3AUL A;  2K5P A;  4M0W A;  2JWZ A;  1L4Z B;  2KQ4 X;  4ZYS A;  5FR3 A;  1OQR A;  2IO2 B;  3KH0 A;  1QOA A;  1S1Q B;  1T0S C;  1YNT E;  1NI2 A;  2I38 A;  2KAJ A;  2KO3 A;  3AE2 B;  1WJ6 A;  1QOF A;  1HQR D;  4JIO U;  1TY2 A;  3EUB 2;  5IP4 D;  1VD2 A;  2IO3 B;  1KJT A;  3PZ8 A;  2K8H A;  1WI0 A;  4TUU A; 
#chains in the Genus database with same CATH homology
 1FRD A;  1K51 A;  1V1P B;  1K52 A;  2V0G A;  3GB1 A;  1NEN B;  1KF6 B;  3BYT B;  5C3J B;  3TUO A;  2AX5 A;  2QSD A;  2PW9 A;  1YMH E;  2WU2 B;  4C56 C;  3Q8E A;  3DWM A;  3IXS A;  1NYR A;  3RFZ B;  1PYW D;  1ZDX A;  1ZUD 2;  2IJ0 A;  3J9C A;  4YWG G;  2CJN A;  5BYS A;  4R3D A;  2LHE A;  2NTS A;  1FIQ A;  1P7E A;  1K50 A;  4WH4 A;  4XDD A;  1HA5 A;  2EKI A;  1WSP A;  2KWD A;  3R2I A;  3ZJU A;  3ZGZ A;  2WP9 B;  2H88 B;  4A8X C;  4YSY B;  2V4I B;  1ET6 A;  2W55 A;  1FNV A;  2PTL A;  1AYF A;  3N9Y C;  1FNU A;  3AB5 A;  2XNA C;  4HJG E;  1DOY A;  4NJC A;  3GP7 A;  1VJK A;  5C2T B;  1BXT A;  1J7A A;  1UWX A;  1AN8 A;  3B9J A;  1QF6 A;  2GB1 A;  1YJI A;  3ZQ4 A;  2LJI A;  2DLB A;  3AEC B;  4NAM A;  2N0S B;  3IAM 1;  2WU5 B;  4D2K A;  3OWE B;  4RGM A;  1D6E C;  2J53 A;  1E0Z A;  4ZRQ A;  1YJJ A;  1JRP A;  1V97 A;  4C7Y A;  4XWW A;  1I4X A;  1VRA B;  4JPS A;  2ONQ A;  2RPV A;  4A6Q A;  2V3N A;  3BWU D;  2PIA A;  2RMM A;  3U52 E;  1ZE3 D;  2ICI A;  1N5X A;  4N58 A;  3NVV A;  5LNK 1;  4P6V F;  1PGX A;  1N63 A;  2RDG A;  1E10 A;  4YTM B;  2L1A A;  1J7B A;  2D5G A;  4ARC A;  3Q8F A;  4OVZ A;  1NYQ A;  1KH0 A;  1FFU A;  1HXY D;  1ZXH A;  2YEP F;  2W82 A;  3AED B;  1TS3 A;  1ET9 A;  1E9M A;  2LHD A;  3AE7 B;  2E3T A;  2W3S A;  2MJ3 A;  2WXJ A;  1IUE A;  2LMC A;  4AQ7 A;  1MI0 A;  4NAW B;  1P7F A;  1MHH E;  1SEB D;  4DXG A;  1HZ6 A;  1IGD A;  3EA6 A;  2JX5 A;  2WXM A;  3C8Y A;  1V8C A;  3HUI A;  2AQ3 B;  1C78 A;  3SR6 A;  2BYT A;  1JWM D;  1GAQ B;  1OQQ A;  1NVI D;  5AUK A;  1V1P A;  1QQR A;  1JML A;  1L5P A;  1KLU D;  3FIL B;  1FXA A;  1DOI A;  3Q8C A;  1VDV A;  2WXF A;  2MH7 A;  1YN4 A;  1I4P A;  3NUH B;  1D5M C;  3BVM A;  1RFK A;  4J3O D;  1MVK A;  5HFY A;  1TJE A;  3AEE B;  4ZHO A;  1GB1 A;  2AQ2 B;  3I9V 1;  3AH7 A;  2PKO A;  3P1M A;  1RWS A;  2NMQ A;  3HRD D;  3AMZ A;  4YTP B;  1JWA D;  1EU3 A;  4OZB A;  2M56 B;  3NVZ A;  3LB8 C;  2E6X A;  4IOI E;  1YN5 A;  1PGA A;  3U4E G;  3V3X A;  1YQ3 B;  5D3D A;  3E56 A;  1C4P A;  3TEX A;  1SBB B;  2CU3 A;  4US8 A;  2ACZ B;  4Q2J A;  1CJE A;  1XO3 A;  2BW2 A;  3AEG B;  4HEA 1;  4WWM A;  4ZOH C;  1XLP A;  4RGT A;  1EU4 A;  1I4R A;  4RGN A;  3VRA B;  1XLN A;  5G5H A;  1F2R C;  1SXT A;  3KWV A;  4PT5 A;  2WXI A;  2PMV A;  3E9S A;  4IDI A;  1YN3 A;  5HI1 A;  2G9H D;  4KKI A;  1EWY C;  1JWU D;  1QT9 A;  3TEY A;  2JYE A;  2WXO A;  5BYR A;  2N9K A;  2WXH A;  1E7P B;  1F2R I;  1UNS A;  2M19 A;  3AM9 A;  2WDQ B;  3O13 A;  4LTU A;  3P42 A;  1I4H A;  1JRO A;  2X38 A;  4OW0 A;  4JX1 C;  1L6U A;  3MHZ A;  3P4P B;  1FO4 A;  5D3I B;  4YTN B;  3BII D;  2L83 A;  3AE1 B;  3UI3 A;  1QOG A;  1TS5 A;  4LLG M;  1TKY A;  4ZHP A;  2BS4 B;  4MH8 A;  4DXF A;  1ZPS A;  4AS1 A;  2L32 A;  5AUI A;  2KDM A;  1D5Z C;  3AN1 A;  3P4Q B;  4TQ0 A;  1FFV A;  1XLO A;  1WXQ A;  2WQY B;  5BMI A;  3W2D A;  2SAK A;  1FEH A;  2Y5C A;  4JE3 B;  3ABV B;  1IBX B;  1J7C A;  3R2T A;  1F0Z A;  3VRB B;  5GXG B;  1N60 A;  4A9A A;  4GDL B;  3LYY A;  2JXT A;  1B1Z A;  5BYQ A;  1C79 A;  3W5V B;  3AE9 B;  1XLQ A;  1CQV A;  4B0E A;  2BTE A;  1JQ4 A;  2Y5P A;  4JWS C;  1GPX A;  1K53 A;  1R7S A;  2ON8 A;  1WYG A;  1SIJ A;  2J52 A;  2JSV X;  4USA A;  2B76 B;  2VZK D;  2DWQ A;  1QKZ A;  3AEA B;  3BVG A;  1A70 A;  2DBY A;  2K9X A;  3FIL A;  4XDC A;  1TS4 A;  5EE1 A;  5BMH A;  4HKQ A;  3RPF C;  4YSX B;  1NEK B;  3V05 A;  1WGK A;  1FXI A;  1PFD A;  1PGB A;  1GOZ A;  3B2G A;  1OFF A;  3BZD B;  2WXL A;  2QMT A;  3KQ4 A;  1CK1 A;  4RCO A;  1QOB A;  4RFB A;  3P4R B;  3IT4 B;  1D4B A;  3H8H A;  4C80 A;  5H8Y E;  5HG2 A;  4P16 A;  2TSS A;  2N7J A;  1C4C A;  1IGC A;  3L4P A;  1TZO A;  2XN9 C;  1FCL A;  4RNA A;  1N61 A;  1B9R A;  4YXD B;  1Y56 A;  1ZXI A;  2FUG 1;  3ZYY X;  1ZDV A;  2BB5 A;  4YT0 B;  4ZRP A;  4OZA A;  4YSZ B;  1JWS D;  4CQN A;  2BS3 B;  1YQ4 B;  2JQR B;  3NVW A;  4US9 A;  2IDY A;  4ARI A;  1TY0 A;  4RF1 A;  1MPE A;  2KMM A;  2LGI A;  5I4D A;  1JAL A;  2IPK D;  1FD6 A;  2FE8 A;  2NTT A;  2PVO D;  1XEE A;  1TKG A;  4L2Y A;  1EWC A;  4UDU C;  2IGD A;  2WXP A;  1L0X B;  3AV8 A;  1VZ7 A;  2Q5W D;  3AEF B;  1D5X C;  2IGG A;  3KLS X;  2H89 B;  3AE3 B;  4N6E B;  2Z8L A;  5EE0 A;  1FCC C;  3HVD A;  1LO5 D;  2ZW1 A;  1SJE D;  2WXQ A;  5H92 C;  2WXK A;  1DOX A;  2WDR B;  4TMA B;  1I7H A;  1SF0 A;  2OED A;  4DQO C;  3W5U B;  2I2Y A;  1C4A A;  3PZ7 A;  2J42 A;  2HTM E;  2MJE A;  2WXN A;  4GLS C;  5FK9 C;  4A90 A;  1KRH A;  4KGR A;  1T5X D;  1HEZ E;  2VZK B;  2Y3A A;  1E6E B;  5MPO A;  1XXG A;  2JWU A;  3NVY A;  3MJ5 A;  4KGT A;  1DGJ A;  3U7Z A;  3VR8 B;  1L0Y B;  3MC0 B;  5JXV A;  1JWB D;  2LUM A;  3P4S B;  1IBX A;  1VR9 A;  2INN E;  2JU6 X;  2GI9 A;  1Q10 A;  3DWG C;  2QEJ C;  2K0P A;  3HVZ A;  3NS1 A;  2M0A A;  1VLB A;  3BYY B;  4GDK B;  4HRS A;  1SE2 A;  3AEB B;  4ITK A;  1TKE A;  4MAC A;  5TSS A;  2INP E;  1MHX A;  1XCT L;  3AE4 B;  3P63 A;  1TYG B;  1RM6 C;  4JWU C;  1T3Q A;  1HZ5 A;  3BK2 A;  4NZL B;  3NRZ A;  1ZOY B;  1FRR A;  1XCQ L;  3AE6 B;  4XWT A;  2BS2 B;  1I4Q A;  1AW7 A;  1I4G A;  2WXR A;  5D7G A;  4EE2 A;  5E6J A;  1WRI A;  1RYJ A;  2CJO A;  1JCK B;  4MT5 A;  3VR9 B;  3CIR B;  4WIP A;  2LFI A;  1WWT A;  1FNW A;  3ETR A;  3MFG A;  4TQ1 A;  1F77 A;  1SE4 A;  2IGH A;  2HDE A;  4WUR A;  2QJL A;  4WQM A;  3TEW A;  1UGJ A;  3T3O A;  2BB6 A;  4H2A A;  5G5G A;  1STE A;  2WDV B;  2YEP B;  2ZW0 A;  3WCQ A;  1QIL A;  5HHD G;  2W54 A;  1UUP A;  1NI3 A;  3GS2 A;  3KWL A;  3ZJV A;  3B2F A;  2DYM A;  2V3P A;  4RH6 A;  1L6V A;  3SFE B;  1KFY B;  2J4X A;  4KKJ A;  3Q8B A;  3W1S A;  3T3N A;  1PUT A;  3SEB A;  2MJD A;  1VZ6 A;  3U2S C;  2N9L A;  4OZC A;  3W9C B;  1T6B X;  2AQ1 B;  2G1E A;  2JZP A;  1EM7 A;  1BML C;  2OHF A;  3AE8 B;  2GRI A;  4IKG A;  1SB3 C;  4B0M A;  1ESF A;  1FMA D;  2JYT A;  5T8I A;  4KGS A;  4WAF A;  4A55 A;  4L1B A;  2SEB D;  2K22 A;  4RF0 A;  2BT6 A;  2BBC A;  2QIL A;  5EE3 A;  3AE5 B;  1N5W A;  1UWM A;  4HRO A;  2DYO A;  1SE3 A;  2WLB A;  3R8B A;  2K3U A;  4TSS A;  5FKA C;  1ZP0 B;  3FAH A;  3Q8A A;  2WXG A;  1GB4 A;  1CZP A;  1ACC A;  4OHJ A;  4XE0 A;  3FC4 A;  3TEZ A;  4FXC A;  3EGR A;  1BUI C;  1VZ8 A;  1PDX A;  2KN4 A;  1N62 A;  3Q69 A;  3IT6 B;  4L23 A;  4RGO S;  5EE9 A;  3URY A;  1XF5 L;  2KAC A;  4HKZ E;  1AWD A;  1ROE A;  2PVG C;  2W3R A;  4KX6 B;  4REZ A;  1JW9 D;  3BVZ A;  1SJH D;  2K5P A;  1C76 A;  4M0W A;  1FM0 D;  2R61 A;  1L4Z B;  4N59 A;  3TSS A;  2EEL A;  4O1N A;  2KQ4 X;  2LEK A;  2L52 A;  3LXF A;  4ZYS A;  1L0V B;  5FR3 A;  1ENF A;  1OQR A;  3VQI A;  1KLG D;  4MM3 B;  1DYQ A;  1M4V A;  1QOA A;  2PLP A;  2RDH A;  3CWI A;  4C7Z A;  1YNT E;  2I38 A;  2KAJ A;  2WNM A;  3ZJT A;  3I57 A;  3NZ3 A;  3AE2 B;  1QOF A;  1HQR D;  3BK1 A;  1TY2 A;  2FBW B;  3MP9 A;  1C9F A;  2MEK A;  1QLB B;  3EUB 2;  1KTK A;  1SSN A;  4LK0 M;  3PZ8 A;  2QIE B;  3PO0 A;  3SFD B;  1C77 A;  5BMG A;  1TS2 A;  2WS3 B;  1V1O A;  1L4D B;  3IAS 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...