2QJLA

Crystal structure of urm1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ubiquitin-related modifier 1
publication title Crystal structure of the dimeric Urm1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qjlA00
1RYJA 1E0ZA 1NEKB 2H88B 1JWBD 2BS4B 1GAQB 2WS3B 3AE7B 2M19A 4P6VF 1NYQA 1T3QA 4C7ZA 1ZXIA 5GXGB 1DOYA 3CIRB 4YTPB 4YTNB 1YJIA 3NS1A 1WGKA 1YQ4B 2MJDA 4JWSC 1NENB 1N5WA 1WRIA 3VR8B 1QOAA 1OQRA 1FM0D 1L5PA 3L4PA 1JQ4A 1FXIA 2K9XA 4WWMA 3NVZA 1WWTA 1QLBB 1L6UA 1XLQA 2WQYB 3AECB 1WXQA 2ACZB 2CJOA 1AWDA 1DGJA 3AE5B 2WLBA 2MH7A 4ZHOA 1E10A 3VR9B 3VRAB 3HRDD 1FMAD 1J7CA 1I7HA 2CJNA 1JWAD 2WDQB 1N61A 1PUTA 3CWIA 3ETRA 3LXFA 3AE6B 3B2FA 1VLBA 2W3RA 1WYGA 4JWUC 5AUKA 1ZOYB 1SF0A 3W5VB 3W5UB 4HRSA 1FO4A 3AV8A 1SIJA 2HTME 3ABVB 3SFEB 1DOIA 1NVID 1OFFA 5EE9A 4LTUA 1KFYB 2Q5WD 4YT0B 3AM9A 1RWSA 2K22A 3P1MA 3NVVA 3AH7A 5H92C 3ZYYX 1VJKA 1JW9D 4YTMB 4WQMA 1F0ZA 3HUIA 2L83A 1XO3A 3SR6A 1FIQA 1TKGA 2LEKA 1GPXA 1L6VA 1R7SA 5EE3A 3AEDB 4YXDB 5C3JB 2FBWB 2E3TA 1QF6A 1VDVA 1PFDA 3FC4A 2Y5CA 3HVZA 2EKIA 4ZOHC 5G5GA 5H8YE 3BIID 1V8CA 2MJ3A 3AE8B 1TJEA 4N59A 2WP9B 3SFDB 3AMZA 4ZHPA 3P4SB 2MJEA 2K5PA 4HROA 1SB3C 3AEGB 2WU2B 1XLNA 2G1EA 1FRRA 3RPFC 4YSXB 3B2GA 1JRPA 1A70A 2QJLA 3AE3B 2OHFA 2KMMA 2W55A 2PKOA 4USAA 1B9RA 3DWGC 2BS3B 3NVYA 1V97A 3W9CB 3AE2B 4C80A 3WCQA 1FXAA 3VRBB 3KWLA 1NI3A 2BS2B 1N62A 2BT6A 1JROA 2B76B 2CU3A 3NRZA 4IDIA 4ITKA 3AEFB 4C7YA 1RFKA 3AB5A 3B9JA 1N60A 2H89B 3AEAB 1E9MA 1CJEA 1J7BA 2JQRB 1J7AA 3PO0A 3AEEB 3NVWA 1QOGA 1QOFA 2QIEB 3P4PB 4N6EB 1ROEA 1YJJA 1YQ3B 2N0SB 5C2TB 4US8A 4FXCA 1JALA 2W3SA 2W54A 3DWMA 3FAHA 1TYGB 3P4QB 2DWQA 2L52A 4A9AA 1IUEA 5EE0A 3AE1B 4N58A 1NYRA 1EWYC 1L0VB 1RM6C 2PIAA 2PVOD 1FFUA 5EE1A 1N5XA 1QT9A 1FFVA 2PVGC 1E6EB 1KF6B 3P63A 3EUB2 3P4RB 2JX5A 5AUIA 1N63A 1QOBA 2WDRB 1KRHA 2WDVB 4KX6B 1ZP0B 1FRDA 1OQQA 2M56B 1UWMA 1ZUD2 5MPOA 2AX5A 1TKYA 1XLPA 2KAJA 4JX1C 2WU5B 3AN1A 1CZPA 3AE9B 1E7PB 3AEBB 5G5HA 3LB8C 2DBYA 4US9A 1AYFA 1PDXA 1TKEA 1XLOA 1DOXA 3AE4B 4YSYB 4YSZB
chains in the Genus database with same CATH superfamily
2LRUA 3I5JC 1KLUD 2CHWA 1C77A 3FILB 2WXRA 4RM9A 4YTNB 4JWSC 4WWOA 1QLBB 2ACZB 1E10A 4LNOA 2M1MA 3B2FA 4XE0A 4HXDA 5L95C 4RGMA 3P1MA 3ZYYX 2DX5B 3X0WA 1WR6E 4LCDE 4WAAA 1TGZB 4YXDB 4RM8A 2IGDA 2XNAC 2IGHA 2HJ1A 2O6VB 3B2GA 4RMAA 1WH3A 2NBVB 1IP9A 2C9WB 4YL8A 4IOIE 4HLEA 2DYMA 4IDIA 3EGRA 4C56C 3RCZA 2D3GA 2AWTA 3ZUNA 4G11A 1ROEA 1YJJA 1RLFA 4D2KA 1TYGB 1V5TA 2MLBA 4OZCA 2L52A 3AU4A 1UBIA 4N58A 3V60A 1L0VB 1LM8B 1I4XA 2NPTB 3HM3A 3Q69A 4LLGM 1IBXB 5BYQA 3ZNZB 4J3OD 5MPOA 3PREA 2G3QB 1UZXB 1C4PA 1WR1A 1GC6A 3PZ7A 1OTRB 2N7EA 5E6PA 1D4BA 1E90A 3DVGX 5GXGB 1GB4A 3IG3A 2J52A 2QDFA 3MJWA 2LI5A 1UELA 2KC2A 4MSQB 2Y5PA 3TSSA 4EKUA 3QAQA 1MG4A 1N61A 2KANA 1E8XA 2NCNA 3ZO5B 2HTME 1GUAB 1KFYB 3U7DA 4KSLC 1MG8A 3APDA 1GC7A 1YN5A 1XO3A 3Q8AA 3TBLD 3Q14C 1KTKA 5BYSA 1YX6B 3V3XA 2L32A 3V6CB 2ICIA 3BIID 2IO2B 1WY8A 3IAM1 2WU2B 1K52A 2MP2A 5JHAA 3ZRCA 4L23A 3K9PB 2PKOA 2MA9B 3NS8A 1IYFA 2KDMA 2N9KA 3WCQA 2IZVB 1N62A 2GBKA 1RFKA 1OQYA 4K3CA 3DVNU 2AL6A 2HDEA 2QMTA 4ACFA 1B1ZA 3MC9A 3FAHA 2QCZA 3PLUA 3ZW3A 1I42A 2FNJB 1SBBB 1P3QU 1VZ7A 1S3SG 3K9OB 3NG0A 1E7VA 2LD9A 3VTWA 1CK1A 1C9FA 1UWMA 1EWCA 2ON8A 4IWQA 4EZKA 1L4DB 3VQIA 1XLOA 4P1CC 1VRAB 3W1SA 1HQRD 2CKHB 2KOXA 4C7ZA 4YTPB 1WGKA 4EZLA 3M63B 4MGKE 2XN9C 1WXAA 2L0FA 3ZTDA 3NUHB 4MGYE 4BOSC 2LWPA 4M0WB 3WIMA 2Q5WD 3AM9A 4KZCA 2D5GA 3MFGA 5H92C 2N7JA 1VJKA 5AZFA 2RSUA 2O2VB 4MT5A 2E6XA 2WXIA 2ZVNA 3DQVA 1WGGA 4TMAB 1PFDA 1CQVA 1XCQL 2KWVB 5LXHA 3DBLB 5IN7A 1ZDVA 3SFDB 2I1JA 3P4SB 1SB3C 2WX1A 3Q2AC 4HJGE 4B0EA 2UWQA 3O13A 4DXAB 3AE3B 3TUOA 1WMHB 4C80A 1MPEA 3V6EB 2BPSA 2NTSA 4WIPA 3KH0A 1ZDXA 3BVGA 2VH1A 5D2MB 3VUYA 4E74A 1HXYD 3EUB2 2M56B 3PZ8A 3KVFB 4XX5A 4UDUC 3Q6BA 1I4GA 2A5UA 5JHBA 1WZ3A 3VH4B 1WJUA 1LQBA 1YOVB 3UIPB 2BS4B 2M19A 1T3QA 1ZXIA 1I4PA 1YJIA 2N9LA 3BYTB 4DHZB 2MJDA 2REXA 2KT7A 5AZHA 4JE3B 4EOYA 2DLBA 3L54A 1XLQA 2KQ7A 1SXTA 4MACA 2M0AA 3UGBB 2KDFB 3CWIA 1WYGA 5AUKA 4PK1A 1S1QB 5D3IB 4XWTA 3B08A 3SFEB 3HIZA 1T0YA 4LTUA 4DDID 4NAWB 3AH7A 2CHXA 4NZLB 4JQWC 3KYDD 1V1OA 3N1YC 2KTFA 2IY1B 2LXCA 2JRIB 3JYUA 3DBHB 1QF6A 3N3KB 5H8YE 2DZMA 2MQJA 1RAXA 4W9FA 1L7YA 3PS6A 1BXTA 2MJEA 3PRZA 2GI9A 2G1EA 3SEBA 4YSXB 3TJPA 4RNAA 4ZRJA 2BTEA 1EUVB 2KKCA 3RNFC 1XQQA 4BFRA 4GDLB 2BS2B 1V49A 3AEFB 4C7YA 2JZ3B 4XDDA 5KHQA 1EU3A 1J7BA 1U4AA 2KACA 3NVWA 2AL3A 4LNNA 1ET6A 1WJ6A 1C78A 2DWQA 4RGNA 1E5WA 1C4CA 2EMSA 2KX3A 2L00B 4K1RB 1IUEA 3ZTCA 1ET9A 2KWCA 4GDKB 2EELA 5EE1A 3H7PA 3IHPC 3QQ8B 4EZJA 5BMGA 2C60A 1TS3A 4AWJA 3RN9C 2JWUA 3TEWA 2WU5B 3S2AA 2WDTB 1V2YA 5E6NA 1LGRA 2KQSA 1GAQB 4WJQA 3URYA 3GE3C 1WRIA 3NZ3A 3L4PA 3EECA 2L76A 3W2DA 2KFKA 2INNE 4K7SA 3RFZB 1WM2A 5D6JB 3R66C 4AUQC 3PRPB 5J2RA 2LVPA 2BBCA 3AE6B 2KNBA 1E8WA 3NHEB 1HE8A 2JPHA 5CTRC 2DENB 3NOBA 2IBIB 1D5MC 2MRPA 3RNEC 2ZW0A 4KGTA 2L83A 2K6QA 1MJDA 2LEKA 4LNFA 1L6VA 3AEDB 3O65B 3VH3B 2GBNA 1LXDA 3JW0X 1R4MI 1MFWA 1VDVA 3Q8FA 3HVZA 4S17A 2PW9A 4OW0A 2WWZA 2J4XA 3AE8B 4II2B 2OJRA 4ZDVA 2RPQA 3LJ3A 4HROA 1UWXA 3VXWA 2D10A 4GGQA 4ZYSA 4HPPA 4FN2A 1XEEA 3CF6E 3DWGC 1B9RA 4CYEA 1YQBA 5JZEB 2KZRA 3P42A 5HKHA 4NY0A 3QCAA 3RNGC 3RULA 1XD3B 1CJEA 2EMTA 1QOFA 2LGXA 1WSPA 1UUPA 4XWWA 3A9KB 2ZZPB 1R4NB 2LMCA 1TTNA 2LJIA 3BINA 4NAMA 1QOBA 2LGIA 3MHZA 1ZPSA 1ZP0B 2KJHB 4FULA 2L1AA 2D3CA 1WFYA 2V4IB 3OWEB 1AYFA 3AE4B 2NVUI 4ZRPA 1E0ZA 1NEKB 2M17A 1J8CA 5LXIB 4P6VF 1Q0WB 2JVCA 5BMIA 3ZDMC 4OZBA 3KUDB 3GS2A 4TV3A 1QOAA 1OQRA 1JQ4A 2K9XA 4OZAA 2LRWA 1WXQA 1AWDA 1LFDA 1NDDA 1GB1A 3VR9B 2JF5A 3OG5A 3A9JB 4IW0A 2BKRB 2LVOA 3DBLI 4ZRIA 4BKTA 3LXFA 1UGMA 4WJPA 3L17A 3A4RA 2NBWB 4JWUC 1MVKA 1SF0A 3MC8A 1D3ZA 1SIJA 1M94A 4A8XC 1OFFA 4YT0B 2K22A 2R2OA 1WGYA 1F0ZA 3KUZA 1WX8A 4OVVA 2LASA 5C3JB 1T5XD 4DHJB 2XK5B 4F8CB 2GOWA 3GZNB 5DPSA 5G5GA 5HFYA 3TL5A 2YVCA 2WXMA 1IGCA 3UI3A 4BZAA 3ZLZA 3A1QA 1T0QC 1Y56A 2X8XX 4KIKA 4XZ4A 3HK0A 1I4HA 1XT9B 3RZWC 4DBGA 2KHWB 3BZDB 2BT6A 3NRZA 4AOFA 3U30A 4A6QA 2WYQA 3RT3B 3AEEB 1DYQA 4FHJA 1WX7A 2VZKB 4W9EA 1WZ0A 1NI2A 4TQ1A 3IXSA 2N9XA 4M8NA 2LUMA 1Z5SB 3QJZA 4M02A 3ZNID 5AUIA 3APCA 4MJSA 2MX2A 4II3B 5G55A 1MI0A 4B9KA 1PGAA 3PGEA 1WYWB 1WI0A 3X23A 2H88B 1TZOA 4GIVA 2NR2A 3DHGC 5AZGA 4XDCA 2QILA 1T0RC 2KWDA 2WNMA 4IWPA 2WQYB 5BO4B 2JT4B 3MP9A 2ZJDA 3ZKJC 1YJ1A 5FK9C 1PYWD 4A3OA 2C7HA 4M00A 4ASWC 3QHTA 1FNVA 2MBEA 2W3RA 3N30A 3ABVB 1FCCC 1K50A 1BUIC 2HJ8A 1FCLA 2JRHA 3VDZA 4A55A 1WE6A 5AEKB 1UNSA 3A4SC 1EF1A 2WP9B 1SE2A 2N7DA 1XF5L 2BWES 4W9JA 2KWUB 1PQSA 2V3SA 4O1NA 2W55A 1E8YA 3NVYA 1IPGA 1KLGD 1OEYA 3IBEA 4KGSA 2MHJA 3EFCA 2JWZA 4AQ7A 3B0AA 1N60A 3NZUA 4XYCA 2N0SB 3PRMB 3DBRI 2J42A 1JWMD 2KLCA 4CHKA 3RNBC 2WXJA 3RNAC 1J0GA 2JSVX 4EEWA 1FFVA 3H7SA 2NMQA 3RI7C 2D11A 3I63C 3Q8CA 1K51A 4FBJB 4L2YA 1X1MA 4K81A 4G3XB 2BB6A 3ZNGC 5HI1A 2WXLA 2AYOB 1Q1OA 1D5XC 1WGRA 4YSZB 3DCGA 2NPTA 1MHHE 1DOYA 5L83A 3D32A 3JVZX 3ZGZA 2LGDA 3VR8B 1WXMA 3PHWB 1FXIA 4WWMA 2AQ2B 4I6PA 2CJOA 3ZJUA 1KM7A 2FIDA 2WXNA 4C4VB 1J7CA 1UH6A 2WDQB 4K3BA 3W5UB 4HRSA 1DOIA 3IFWB 2KFJA 1TS5A 1QQRA 3WAPA 4HK2A 2IYDB 4Q2JA 4YTMB 4P7IA 4GOCA 3H9DA 2G9HD 1TKGA 2MCNB 5KHOA 1ZW7A 3W1SC 2BW2A 2K0PA 1YX5B 3Q8EA 2L8JA 2MJ3A 1TJEA 1TZ1A 2RDBC 2Z59B 4URKA 1V81A 1WM3A 2L7RA 2LJ5A 2KDIA 5DPRA 3M62B 2KMMA 2RD0A 1HTQA 2MBHA 5IKCM 3TEZA 1XXGA 4GLSC 3HVDA 4L1BA 1F1HA 2WXPA 4NJ6A 3L13A 1AARA 5G2NA 2PIAA 2PVOD 1SE3A 2LHEA 3H1UA 3N32A 1MHXA 3R3MA 1ISNA 1YN3A 1FRDA 1OQQA 1EF5A 3UINB 2FUHB 4LNKA 1TKYA 1XLPA 2RDHA 2V4LA 3DVGY 4DXGA 3EA6A 3QA8A 1L4ZB 4US9A 1TKEA 3RYTA 1JWBD 5JXVA 2BYEA 3GB1A 3DPDA 1HZ5A 1JWUD 1NENB 1AN8A 1CMXB 3NJTA 2XBBC 1WIAA 1I4QA 2PMVA 2PEAA 4RF1A 1PUTA 2Z0DB 2DYBA 1WF9A 3N1ZC 1QZEA 1FEHA 3L0WB 2BYTA 5JH5C 1UF0A 3ZIMA 4J6IA 2V3PA 4GMVA 4MELA 3HUIA 2KDEB 3MTNB 3ZNHB 5EE3A 2BB5A 2MBOA 1KJTA 2Y5CA 4G50A 4M0WA 2DAJA 4ZOHC 1V8CA 4DXFA 3NZSA 4RGOS 1A70A 3R7QA 2BYFA 4NJCA 1WX9A 3C0RB 2OHFA 2JYTA 3IT6B 4USAA 1V97A 5CHFA 3AE2B 3W9CB 3KWLA 4GN1A 1JROA 1VZ6A 2B3AA 2KFKB 2ZCBA 4N6EB 1RRBA 1C4AA 1OGWA 4ARIA 2C7NB 4A9AA 5EE0A 3B1LX 2ASQA 2GBJA 2J0MA 4WURA 1GJZA 2JX5A 4PS7A 4ICUA 3RMKC 4WH4A 3UF8A 4HDQA 1CZPA 3AE9B 4XGAB 1J19A 4KVGB 2WXKA 1RYJA 2KO3A 2XEWA 4W9KA 4XC2A 1WGDA 2RDGA 2GB1A 2JZPA 1P9DU 4RCOA 4A90A 3AULA 1SEBD 5DPWA 4KDIC 5IA7A 3I57A 2IDYA 4DHJD 2FCNA 2CJNA 5J18A 1ZKHA 4HPMB 1EM7A 2KD0A 4HVBA 2WXFA 1NVID 2KVZA 1RWSA 2EKEC 3EFUA 3IT4B 2SEBD 2N1VA 3BK1A 2CS4A 3SR6A 2CU1A 4LK0M 4W9IA 4HPLB 1H4RA 4P1BC 3WALA 5E6OA 2INDC 2DZKA 3N1XC 4MGIE 5IO9A 4NAWA 2RPVA 3DVNV 1YIWA 1LO5D 1TBEA 3UQBA 3I3TB 1JRPA 2V1YA 2O6VD 4B0MA 5BMHA 4NQLB 1WXSA 1F77A 1P7EA 3OLMD 3T3OA 1BMLC 3AB5A 1V80A 2GMIC 1J7AA 1T0SC 3PO0A 4MM3A 3P4PB 3U4EG 2J53A 4FXCA 3VTUA 3P4QB 3CSFA 4LJPB 3AE1B 4BAXA 1SE9A 4F7ZA 2PE6B 1T6BX 4RGTA 3R2IA 2ZPYA 2IO3B 2L0TA 2DNFA 3DOWA 4OVZA 2M8SA 1ZUD2 3ZJVA 2ONQA 1E7PB 2K1FA 4TQ0A 1L0XB 4GDKA 1NYQA 2PJHA 4OVUA 4NJ7A 3CIRB 2UU7A 3Q3NC 4BVUC 3A1QB 1Q10A 3PLVA 1ZXHA 3RD2A 4KV2A 1FM0D 1L5PA 2K8CA 1V86A 2A4ZA 1VZ8A 2UYZB 4KIKB 1KH0A 4YWGG 2JU6X 2LGSA 3LYYA 1HEZE 1SE4A 4DHZE 3JSVA 2KK8A 3VUWA 4IWOA 1BT0A 4IKGA 3BK2A 1PGBA 2MEKA 2D07B 4KKIA 4HKZE 2WXGA 3GOEA 3KQ4A 3CSTA 4X57B 5E6JA 4P16A 2W9NA 4IM0A 2CHZA 3FC4A 4MJSB 3PVLA 4HCPB 1K53A 4JGHB 3AMZA 4AS1A 1F9JA 3L10B 4AP4C 1SGHA 2M0XA 3OJ4B 1FRRA 2ZCCA 2SAKA 2WX0A 4JIOU 4MGZE 4NPNA 1JMLA 2VRRB 1SSNA 2FIFA 2Z8LA 3I9V1 2PLPA 2GRIA 2X38A 4ANUA 3KUCB 3ZQ4A 3TEYA 1WE7A 4OHJA 2KTRA 1JALA 2IY0B 1JRUA 3ZDTA 3QWZB 4ANWA 1EWYC 2V9HA 1QT9A 3KW5B 2D2QA 4WJNA 1Q5WB 2BWFA 1F52A 1V1PA 3SDLC 1F2RC 4JX1C 3AN1A 2OEDA 4KZ0A 2Y5BB 3A9KA 3PZDA 1PDXA 4AJWA 2NTTA 3R8BA 2LUEA 3A33B 1N5WA 3C8YA 4PYZA 4MSMB 1D5ZC 5C1ZA 3SD5A 3NVZA 4MH0E 1OEYJ 3PHXB 1WJ4A 2RGFA 2IO0B 4ZHOA 4WAFA 2FUG1 3WANA 1N6ZA 1WRDB 1FD6A 3KYCD 2K6DB 1FO4A 3BWUD 3VUXA 1ZGUB 4FJZA 2JUOA 3V05A 3ALBA 3UIOB 3OJ3A 2I2YA 2MP2B 4ICVA 4WQMA 4GU2A 3ENEA 2PPHA 1GPXA 1KLVA 3A9JA 1TY2A 3T3NA 2MSED 4E71A 4IM3A 3QC8B 3DBHI 3P2BA 4AJYB 3SU8X 1M4VA 2RMMA 2GBRA 3EHVA 3FILA 4EUTA 1QKZA 1XLNA 1VD2A 2ZNVB 4LDTB 5FR6A 1I35A 5D3DA 2MW5A 3ONSA 4IUMB 2XK5A 2K39A 3ZRFA 1NI3A 2CU3A 2AEHA 2AQ3B 2IGGA 1YQ3B 2FCMA 4KDLB 2K8BA 3Q8BA 2W54A 3U7ZA 2KN4A 5CHWA 4FJVB 3CMMB 1N5XA 1E6EB 1KF6B 3MHSD 3P4RB 3KWVA 3DBSA 3R2TA 1N63A 4BBNF 4GSWA 4RH6A 1EO6A 2WDRB 1KRHA 2WDVB 4G0NB 1HTOA 2YEPB 2L05A 4HCNB 4EE2A 2O6VA 3ML9A 1TS2A 5FKAC 1V5OA 1STEA 2WGSA 4WWPA 2KQ4X 3TMPB 2BQQA 1WGHA 2G4SA 3Q3MC 3T9LA 1WWTA 2LZ6A 1L6UA 3AECB 2KMCA 1WJNA 2MH7A 4M8MA 2KJRA 3J9CA 3VRAB 5I4DA 4WQOB 1ZE3D 3HRDD 3ETRA 2C5LC 1UD7A 5D94A 4A3PA 2J7QB 4JL9A 1GG3A 2K3UA 2DZJA 2NS5A 3WA0A 2HE7A 1IBXA 4R3DA 2DYOA 4KGRA 1YMHE 4N9F4 1R4MB 1AW7A 4RF0A 2RR9A 2K8HA 2G4DB 2ZNVC 4WJOA 1UBQA 1P0RA 1A5RA 3ZXRA 1C76A 4E3CA 3GE8C 3AEGB 2KLGA 2LXAA 4FJYA 3OAWA 5CX3A 2INCC 4FADA 4QAYA 1C3TA 2VH2A 1TIFA 4H2AA 1GNUA 2B76B 2FCQA 4ITKA 2WXOA 3B9JA 5IOIA 3PV1A 3ZXVA 4US8A 2KMAA 3DWMA 1Z2MA 3V61A 2R61A 1ENFA 1GOZA 1P98A 2GLSA 1F2RI 2WXHA 1FFUA 2DZIA 1R4NI 1TT5B 3P63A 4ZRQA 3PTFC 4DWFA 4HEA1 4JLCA 4ZRKA 3U52E 3DDCB 2PTLA 5EDSA 2QC8A 5G5HA 2HD5B 5T8IA 3AE7B 2WS3B 3WAMA 3M95A 3WAOA 3FKYA 3GP7A 4NQKE 3NS1A 4TUUA 5CHVC 3TCAA 1FNWA 4IM2A 3N9YC 1DGJA 2G45B 1JWAD 3SHQA 3Q3JA 3BY4B 3APFA 5D7GA 1ZOYB 5TSSA 4ARCA 3KLSX 4BKSD 2W82A 2HTHA 2ZW1A 2LVQA 2KN5A 4PT5A 2BKFA 3BYYB 2V3NA 3IAS1 1G6JA 4MDKE 1R7SA 4C4VA 2E3TA 3U2SC 3AU5A 5TR5A 4TSSA 2EKIA 3BVZA 4DQOC 2C7MB 1VR9A 2N4FA 3GZNI 4W9CA 3V62A 2FE8A 1IGDA 2K5PA 3PT2B 5LNK1 3AXCA 2IO1B 1C1YB 2ZPNA 3H8HA 1K8RB 5IAAC 3IVFA 2J0JA 3R7RA 3H7PB 2Z0EB 2MWSB 5HHDG 2CR5A 3VFKA 5C23A 2YLMA 2H89B 2JQRB 1C79A 2INPE 2QIEB 5C2TB 3QIJA 2KC1A 3BVMA 2N1WA 2DHZA 4W9DA 2KXJA 5IP4D 3MC0B 3ZJTA 1SJED 4FHKA 4BOZB 2O2VA 5HG2A 3QX1A 1D6EC 4NNJB 4PYUA 4KX6B 2I1KA 4DK5A 4GB9A 2AX5A 2ZEQA 4DDGD 2JYEA 3VTVA 2GBMA 2PE9A 3TIXA 2KX0A 1ACCA 3LDZE 4LNIA 1WMHA 1YQ4B 2R2QA 4ANVA 3W1YA 4KKJA 4LJOB 4M01A 4K7WA 2BF8B 2WLBA 3UQAA 5J17A 3U8ZA 1NBFC 1XCTL 3QK0A 1VLBA 3W5VB 4W9HA 2K25A 4MM3B 4A20A 2MBQA 2FCSA 3ZVVA 2QHOA 3AI5A 4JPSA 1JW9D 1SIFA 1FIQA 4PS3A 4ZYNA 4PS8A 2FBWB 1E7UA 4K7UA 2BGFA 1VCBA 3T8MA 2JXXA 3EC8A 2NBUA 1L0YB 1WXVA 4I6NB 4CQNA 4FLHA 1QILA 1V9JA 3RPFC 3RNCC 1L2NA 1V6EA 3RUIB 3E56A 4HWIB 3AEAB 1E9MA 3DBRB 3Q3FA 2JY6A 4HJKA 3ML8A 1ESFA 2LGYA 3M3JA 1EU4A 3JSVB 4GXBA 4CO7A 2LFIA 4W9LA 2VZKD 3DHIC 1RM6C 1YD8U 2PVGC 4MEMA 3L08A 3QARA 3PPAA 4TKNA 2Y3AA 3ECIA 4HKQA 2DAFA 3AEBB 4BBNC 4C00A 2YEPF 1E8ZA 1YNTE 2D3BA 2JZZA 2M4NA 4S0RA 2D3AA 1JCKB 2TSSA 2WXQA 4GDLA 1TY0A 2V0GA 3HHMA 2ZVOA 2KVRA 3HM6X 2OJWA 3AE5B 2J0KA 5DCNA 4BKGA 5DPTA 1UGJA 1FMAD 1I7HA 3N20C 5GMVA 4KSKC 5FR3A 2KTRB 3AV8A 1FNUA 4REZA 3C19A 5EE9A 2N9EB 3NVVA 2I38A 3DHHC 1HZ6A 1P7FA 4LDTD 3PSEB 4FA6A 2IJ0A 1I4RA 3TEXA 2JXTA 1RFAA 2WHIA 1FXTB 4IC7B 1V1PB 1YN4A 3VHTC 4N59A 4I6LB 4ZHPA 1Y8RC 2IPKD 3E9SA 3RZFA 3MJ5A 2FAZA 3NY5A 4B6WA 2QJLA 2QEJC 4B95A 2BYVE 2BS3B 2N9PC 1FXAA 3VRBB 1SJHD 3VAWA 1JWSD 3Q3OC 4RFBA 2LHDA 1HA5A 2BVCA 4BKSA 1QOGA 2L3ZA 1FPYA 4F1SA 4IG7B 2OOBB 2W3SA 5LLIA 5BYRA 4EFOA 1KOTA 2AQ1B 1NYRA 2QSDA 1TS4A 2KYWA 2MBBB 3H6NA 4ANXA 1H8CA 3L16A 2KJ6A 1P1AA 4HDOA 4MH8A 3VVWB 2KAJA 2KDBA 4W9GA 3LB8C 2DBYA 4WWNA 1DOXA 1PGXA 4YSYB
chains in the Genus database with same CATH topology
1TS2A 1JWBD 5JXVA 5FKAC 1KLUD 1GAQB 1STEA 1C77A 3URYA 2KQ4X 3GB1A 3FILB 1HZ5A 2WXRA 4YTNB 1JWUD 4JWSC 1NENB 1WRIA 3NZ3A 3L4PA 1AN8A 1WWTA 3W2DA 2INNE 1QLBB 1L6UA 3AECB 2ACZB 2MH7A 3J9CA 1E10A 3RFZB 3VRAB 1I4QA 5I4DA 1ZE3D 3HRDD 2PMVA 3ETRA 4RF1A 1PUTA 2BBCA 3AE6B 3B2FA 4XE0A 2K3UA 1D5MC 1FEHA 2BYTA 4RGMA 3P1MA 1IBXA 4R3DA 2ZW0A 3ZYYX 2V3PA 4KGTA 2DYOA 4KGRA 3HUIA 2L83A 1YMHE 1AW7A 2LEKA 4RF0A 1L6VA 4YXDB 5EE3A 2BB5A 3AEDB 1VDVA 3Q8FA 2Y5CA 3HVZA 4M0WA 2PW9A 4ZOHC 4OW0A 2IGDA 2J4XA 1C76A 1V8CA 3AE8B 4DXFA 2XNAC 2IGHA 4HROA 1UWXA 3AEGB 4RGOS 3B2GA 1A70A 4ZYSA 4NJCA 2OHFA 2JYTA 1XEEA 3IT6B 3DWGC 4USAA 1B9RA 1V97A 3W9CB 3AE2B 4IOIE 3P42A 3KWLA 4H2AA 1JROA 1VZ6A 2B76B 2DYMA 4IDIA 4ITKA 3EGRA 4C56C 2WXOA 3B9JA 1CJEA 1QOFA 4N6EB 1ROEA 1YJJA 1C4AA 4US8A 3DWMA 4D2KA 1TYGB 2R61A 4ARIA 1WSPA 4OZCA 1UUPA 4XWWA 1ENFA 1GOZA 2L52A 4A9AA 5EE0A 4N58A 1L0VB 1F2RI 2WXHA 1FFUA 4WURA 1I4XA 2LMCA 3Q69A 3P63A 2LJIA 2JX5A 4LLGM 4ZRQA 1IBXB 4NAMA 4HEA1 1QOBA 2LGIA 3MHZA 5BYQA 1ZPSA 1ZP0B 4WH4A 4J3OD 3U52E 5MPOA 2PTLA 2L1AA 1CZPA 3AE9B 1C4PA 5G5HA 2V4IB 3OWEB 1AYFA 3PZ7A 3AE4B 4ZRPA 2WXKA 1RYJA 1E0ZA 1NEKB 5T8IA 2RDGA 3AE7B 2WS3B 2GB1A 4P6VF 1D4BA 2JZPA 5GXGB 1GB4A 3GP7A 3NS1A 2J52A 4RCOA 4OZBA 4A90A 5BMIA 3GS2A 1SEBD 1FNWA 1OQRA 1QOAA 1JQ4A 2K9XA 4OZAA 3N9YC 1WXQA 1AWDA 1DGJA 2Y5PA 3TSSA 3I57A 1GB1A 3VR9B 2IDYA 2CJNA 1JWAD 1N61A 3LXFA 5D7GA 4JWUC 1MVKA 1ZOYB 1SF0A 1SIJA 2HTME 1EM7A 4A8XC 2WXFA 5TSSA 1NVID 1OFFA 4ARCA 1KFYB 4YT0B 1RWSA 3KLSX 2K22A 2W82A 2ZW1A 3IT4B 4PT5A 2SEBD 3BYYB 3BK1A 2V3NA 1YN5A 3IAS1 1F0ZA 1XO3A 3Q8AA 3SR6A 1R7SA 4LK0M 5C3JB 1KTKA 5BYSA 2E3TA 3U2SC 1T5XD 3V3XA 2L32A 2ICIA 4TSSA 2EKIA 5G5GA 5HFYA 3BIID 2WXMA 3BVZA 4DQOC 1IGCA 3UI3A 1VR9A 2RPVA 2FE8A 1IGDA 2K5PA 3IAM1 2WU2B 5LNK1 1K52A 1LO5D 1JRPA 4L23A 1Y56A 3H8HA 4B0MA 5BMHA 2PKOA 1I4HA 1F77A 1P7EA 3T3OA 2KDMA 2N9KA 1BMLC 3WCQA 3BZDB 1N62A 2BT6A 3NRZA 4A6QA 5HHDG 1RFKA 3AB5A 2H89B 2JQRB 1J7AA 3PO0A 3AEEB 1C79A 2INPE 2HDEA 2QIEB 1DYQA 3P4PB 3U4EG 2QMTA 5C2TB 1B1ZA 2J53A 4FXCA 3BVMA 3FAHA 2VZKB 3P4QB 4TQ1A 3AE1B 3IXSA 3MC0B 1SBBB 3ZJTA 1T6BX 4RGTA 3R2IA 1SJED 1VZ7A 2LUMA 5AUIA 5HG2A 1D6EC 4OVZA 1CK1A 4KX6B 1C9FA 1UWMA 1ZUD2 3ZJVA 1EWCA 2ONQA 2AX5A 2ON8A 1MI0A 1E7PB 1L4DB 3VQIA 2JYEA 1PGAA 4TQ0A 1L0XB 1XLOA 1VRAB 2H88B 1HQRD 1TZOA 3W1SA 1NYQA 4C7ZA 1ACCA 3CIRB 4YTPB 1WGKA 1YQ4B 1Q10A 4XDCA 1ZXHA 2QILA 2KWDA 1FM0D 1L5PA 2WNMA 1VZ8A 2XN9C 4KKJA 2WQYB 1KH0A 4YWGG 2JU6X 3LYYA 2WLBA 3MP9A 3NUHB 5FK9C 1PYWD 1HEZE 1SE4A 1XCTL 1VLBA 1FNVA 2W3RA 3W5VB 4MM3B 3ABVB 4IKGA 1FCCC 1K50A 2Q5WD 3AM9A 3BK2A 2D5GA 3MFGA 1PGBA 2MEKA 1BUIC 4KKIA 4JPSA 2N7JA 5H92C 1VJKA 4HKZE 1JW9D 1FCLA 2WXGA 3KQ4A 1FIQA 4MT5A 2E6XA 5E6JA 2WXIA 2FBWB 4P16A 4TMAB 1PFDA 1CQVA 1XCQL 3FC4A 4A55A 1UNSA 1K53A 1ZDVA 3SFDB 2WP9B 3AMZA 3P4SB 1SE2A 4AS1A 1XF5L 1SB3C 4HJGE 4B0EA 1L0YB 1FRRA 4CQNA 2SAKA 1QILA 3RPFC 3O13A 3AE3B 4O1NA 2W55A 1JMLA 3TUOA 3NVYA 4C80A 1SSNA 1KLGD 4KGSA 2Z8LA 3I9V1 4AQ7A 1MPEA 2PLPA 3E56A 2GRIA 2X38A 2NTSA 1N60A 3AEAB 3ZQ4A 1E9MA 3TEYA 4WIPA 4OHJA 2N0SB 1ZDXA 1JALA 1ESFA 3BVGA 2J42A 1JWMD 1EU4A 2LFIA 2VZKD 1EWYC 2WXJA 1RM6C 1HXYD 2JSVX 1QT9A 1FFVA 2PVGC 3EUB2 2NMQA 2M56B 3Q8CA 1V1PA 3PZ8A 1K51A 4L2YA 1F2RC 4JX1C 2Y3AA 3AN1A 2OEDA 4UDUC 4HKQA 3AEBB 1I4GA 2BB6A 5HI1A 2WXLA 1PDXA 2NTTA 1D5XC 3R8BA 2YEPF 4YSZB 1YNTE 2BS4B 2M19A 1MHHE 1T3QA 1ZXIA 1I4PA 1DOYA 1YJIA 2N9LA 3BYTB 2MJDA 1JCKB 3ZGZA 2TSSA 2WXQA 1N5WA 1TY0A 3C8YA 3VR8B 1D5ZC 4JE3B 2V0GA 1FXIA 4WWMA 3NVZA 2DLBA 2AQ2B 1XLQA 1SXTA 4MACA 2CJOA 3AE5B 4ZHOA 4WAFA 3ZJUA 2FUG1 1UGJA 2WXNA 2M0AA 1FMAD 1J7CA 1I7HA 2WDQB 3CWIA 1WYGA 5AUKA 5FR3A 1FD6A 3W5UB 4HRSA 1FO4A 3AV8A 5D3IB 1FNUA 3BWUD 4REZA 4XWTA 1DOIA 3SFEB 1QQRA 1TS5A 5EE9A 4LTUA 3NVVA 4NAWB 3V05A 2I38A 3AH7A 4Q2JA 1HZ6A 4NZLB 2I2YA 1P7FA 4YTMB 4WQMA 1V1OA 2IJ0A 2G9HD 1I4RA 1TKGA 3TEXA 1GPXA 2JXTA 1TY2A 3T3NA 1QF6A 2BW2A 5H8YE 1V1PB 1M4VA 1YN4A 2K0PA 3Q8EA 2MJ3A 4N59A 1TJEA 4ZHPA 2RMMA 1BXTA 2IPKD 2MJEA 3E9SA 3FILA 3MJ5A 1QKZA 1XLNA 2G1EA 2GI9A 3SEBA 4YSXB 2QJLA 2QEJC 4RNAA 2KMMA 2BTEA 5D3DA 2BS3B 1FXAA 3VRBB 1SJHD 1NI3A 4GDLB 2BS2B 2CU3A 3AEFB 1JWSD 3TEZA 1XXGA 4GLSC 4RFBA 4C7YA 3HVDA 2LHDA 4L1BA 4XDDA 1HA5A 1EU3A 1J7BA 2AQ3B 2KACA 2WXPA 2IGGA 3NVWA 1QOGA 1ET6A 1YQ3B 1C78A 3Q8BA 2W3SA 2W54A 3U7ZA 2KN4A 2DWQA 4RGNA 1C4CA 5BYRA 1IUEA 1ET9A 2AQ1B 1NYRA 2PIAA 2PVOD 2QSDA 4GDKB 1TS4A 1SE3A 2EELA 5EE1A 1N5XA 2LHEA 1E6EB 1KF6B 3P4RB 3KWVA 3R2TA 5BMGA 1N63A 1MHXA 4RH6A 2WDRB 1KRHA 1YN3A 2WDVB 1TS3A 1FRDA 1OQQA 4MH8A 2JWUA 3TEWA 2YEPB 1TKYA 1XLPA 2KAJA 2WU5B 2RDHA 4EE2A 3LB8C 2DBYA 4DXGA 3EA6A 4US9A 1L4ZB 1TKEA 1DOXA 1PGXA 4YSYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYJ A;  1E0Z A;  1NEK B;  2H88 B;  1JWB D;  2BS4 B;  1GAQ B;  2WS3 B;  3AE7 B;  2M19 A;  4P6V F;  1NYQ A;  1T3Q A;  4C7Z A;  1ZXI A;  5GXG B;  1DOY A;  3CIR B;  4YTP B;  4YTN B;  1YJI A;  3NS1 A;  1WGK A;  1YQ4 B;  2MJD A;  4JWS C;  1NEN B;  1N5W A;  1WRI A;  3VR8 B;  1QOA A;  1OQR A;  1FM0 D;  1L5P A;  3L4P A;  1JQ4 A;  1FXI A;  2K9X A;  4WWM A;  3NVZ A;  1WWT A;  1QLB B;  1L6U A;  1XLQ A;  2WQY B;  3AEC B;  1WXQ A;  2ACZ B;  2CJO A;  1AWD A;  1DGJ A;  3AE5 B;  2WLB A;  2MH7 A;  4ZHO A;  1E10 A;  3VR9 B;  3VRA B;  3HRD D;  1FMA D;  1J7C A;  1I7H A;  2CJN A;  1JWA D;  2WDQ B;  1N61 A;  1PUT A;  3CWI A;  3ETR A;  3LXF A;  3AE6 B;  3B2F A;  1VLB A;  2W3R A;  1WYG A;  4JWU C;  5AUK A;  1ZOY B;  1SF0 A;  3W5V B;  3W5U B;  4HRS A;  1FO4 A;  3AV8 A;  1SIJ A;  2HTM E;  3ABV B;  3SFE B;  1DOI A;  1NVI D;  1OFF A;  5EE9 A;  4LTU A;  1KFY B;  2Q5W D;  4YT0 B;  3AM9 A;  1RWS A;  2K22 A;  3P1M A;  3NVV A;  3AH7 A;  5H92 C;  3ZYY X;  1VJK A;  1JW9 D;  4YTM B;  4WQM A;  1F0Z A;  3HUI A;  2L83 A;  1XO3 A;  3SR6 A;  1FIQ A;  1TKG A;  2LEK A;  1GPX A;  1L6V A;  1R7S A;  5EE3 A;  3AED B;  4YXD B;  5C3J B;  2FBW B;  2E3T A;  1QF6 A;  1VDV A;  1PFD A;  3FC4 A;  2Y5C A;  3HVZ A;  2EKI A;  4ZOH C;  5G5G A;  5H8Y E;  3BII D;  1V8C A;  2MJ3 A;  3AE8 B;  1TJE A;  4N59 A;  2WP9 B;  3SFD B;  3AMZ A;  4ZHP A;  3P4S B;  2MJE A;  2K5P A;  4HRO A;  1SB3 C;  3AEG B;  2WU2 B;  1XLN A;  2G1E A;  1FRR A;  3RPF C;  4YSX B;  3B2G A;  1JRP A;  1A70 A;  2QJL A;  3AE3 B;  2OHF A;  2KMM A;  2W55 A;  2PKO A;  4USA A;  1B9R A;  3DWG C;  2BS3 B;  3NVY A;  1V97 A;  3W9C B;  3AE2 B;  4C80 A;  3WCQ A;  1FXA A;  3VRB B;  3KWL A;  1NI3 A;  2BS2 B;  1N62 A;  2BT6 A;  1JRO A;  2B76 B;  2CU3 A;  3NRZ A;  4IDI A;  4ITK A;  3AEF B;  4C7Y A;  1RFK A;  3AB5 A;  3B9J A;  1N60 A;  2H89 B;  3AEA B;  1E9M A;  1CJE A;  1J7B A;  2JQR B;  1J7A A;  3PO0 A;  3AEE B;  3NVW A;  1QOG A;  1QOF A;  2QIE B;  3P4P B;  4N6E B;  1ROE A;  1YJJ A;  1YQ3 B;  2N0S B;  5C2T B;  4US8 A;  4FXC A;  1JAL A;  2W3S A;  2W54 A;  3DWM A;  3FAH A;  1TYG B;  3P4Q B;  2DWQ A;  2L52 A;  4A9A A;  1IUE A;  5EE0 A;  3AE1 B;  4N58 A;  1NYR A;  1EWY C;  1L0V B;  1RM6 C;  2PIA A;  2PVO D;  1FFU A;  5EE1 A;  1N5X A;  1QT9 A;  1FFV A;  2PVG C;  1E6E B;  1KF6 B;  3P63 A;  3EUB 2;  3P4R B;  2JX5 A;  5AUI A;  1N63 A;  1QOB A;  2WDR B;  1KRH A;  2WDV B;  4KX6 B;  1ZP0 B;  1FRD A;  1OQQ A;  2M56 B;  1UWM A;  1ZUD 2;  5MPO A;  2AX5 A;  1TKY A;  1XLP A;  2KAJ A;  4JX1 C;  2WU5 B;  3AN1 A;  1CZP A;  3AE9 B;  1E7P B;  3AEB B;  5G5H A;  3LB8 C;  2DBY A;  4US9 A;  1AYF A;  1PDX A;  1TKE A;  1XLO A;  1DOX A;  3AE4 B;  4YSY B;  4YSZ B; 
#chains in the Genus database with same CATH topology
 2LRU A;  3I5J C;  1KLU D;  2CHW A;  1C77 A;  3FIL B;  2WXR A;  4RM9 A;  4YTN B;  4JWS C;  4WWO A;  1QLB B;  2ACZ B;  1E10 A;  4LNO A;  2M1M A;  3B2F A;  4XE0 A;  4HXD A;  5L95 C;  4RGM A;  3P1M A;  3ZYY X;  2DX5 B;  3X0W A;  1WR6 E;  4LCD E;  4WAA A;  1TGZ B;  4YXD B;  4RM8 A;  2IGD A;  2XNA C;  2IGH A;  2HJ1 A;  2O6V B;  3B2G A;  4RMA A;  1WH3 A;  2NBV B;  1IP9 A;  2C9W B;  4YL8 A;  4IOI E;  4HLE A;  2DYM A;  4IDI A;  3EGR A;  4C56 C;  3RCZ A;  2D3G A;  2AWT A;  3ZUN A;  4G11 A;  1ROE A;  1YJJ A;  1RLF A;  4D2K A;  1TYG B;  1V5T A;  2MLB A;  4OZC A;  2L52 A;  3AU4 A;  1UBI A;  4N58 A;  3V60 A;  1L0V B;  1LM8 B;  1I4X A;  2NPT B;  3HM3 A;  3Q69 A;  4LLG M;  1IBX B;  5BYQ A;  3ZNZ B;  4J3O D;  5MPO A;  3PRE A;  2G3Q B;  1UZX B;  1C4P A;  1WR1 A;  1GC6 A;  3PZ7 A;  1OTR B;  2N7E A;  5E6P A;  1D4B A;  1E90 A;  3DVG X;  5GXG B;  1GB4 A;  3IG3 A;  2J52 A;  2QDF A;  3MJW A;  2LI5 A;  1UEL A;  2KC2 A;  4MSQ B;  2Y5P A;  3TSS A;  4EKU A;  3QAQ A;  1MG4 A;  1N61 A;  2KAN A;  1E8X A;  2NCN A;  3ZO5 B;  2HTM E;  1GUA B;  1KFY B;  3U7D A;  4KSL C;  1MG8 A;  3APD A;  1GC7 A;  1YN5 A;  1XO3 A;  3Q8A A;  3TBL D;  3Q14 C;  1KTK A;  5BYS A;  1YX6 B;  3V3X A;  2L32 A;  3V6C B;  2ICI A;  3BII D;  2IO2 B;  1WY8 A;  3IAM 1;  2WU2 B;  1K52 A;  2MP2 A;  5JHA A;  3ZRC A;  4L23 A;  3K9P B;  2PKO A;  2MA9 B;  3NS8 A;  1IYF A;  2KDM A;  2N9K A;  3WCQ A;  2IZV B;  1N62 A;  2GBK A;  1RFK A;  1OQY A;  4K3C A;  3DVN U;  2AL6 A;  2HDE A;  2QMT A;  4ACF A;  1B1Z A;  3MC9 A;  3FAH A;  2QCZ A;  3PLU A;  3ZW3 A;  1I42 A;  2FNJ B;  1SBB B;  1P3Q U;  1VZ7 A;  1S3S G;  3K9O B;  3NG0 A;  1E7V A;  2LD9 A;  3VTW A;  1CK1 A;  1C9F A;  1UWM A;  1EWC A;  2ON8 A;  4IWQ A;  4EZK A;  1L4D B;  3VQI A;  1XLO A;  4P1C C;  1VRA B;  3W1S A;  1HQR D;  2CKH B;  2KOX A;  4C7Z A;  4YTP B;  1WGK A;  4EZL A;  3M63 B;  4MGK E;  2XN9 C;  1WXA A;  2L0F A;  3ZTD A;  3NUH B;  4MGY E;  4BOS C;  2LWP A;  4M0W B;  3WIM A;  2Q5W D;  3AM9 A;  4KZC A;  2D5G A;  3MFG A;  5H92 C;  2N7J A;  1VJK A;  5AZF A;  2RSU A;  2O2V B;  4MT5 A;  2E6X A;  2WXI A;  2ZVN A;  3DQV A;  1WGG A;  4TMA B;  1PFD A;  1CQV A;  1XCQ L;  2KWV B;  5LXH A;  3DBL B;  5IN7 A;  1ZDV A;  3SFD B;  2I1J A;  3P4S B;  1SB3 C;  2WX1 A;  3Q2A C;  4HJG E;  4B0E A;  2UWQ A;  3O13 A;  4DXA B;  3AE3 B;  3TUO A;  1WMH B;  4C80 A;  1MPE A;  3V6E B;  2BPS A;  2NTS A;  4WIP A;  3KH0 A;  1ZDX A;  3BVG A;  2VH1 A;  5D2M B;  3VUY A;  4E74 A;  1HXY D;  3EUB 2;  2M56 B;  3PZ8 A;  3KVF B;  4XX5 A;  4UDU C;  3Q6B A;  1I4G A;  2A5U A;  5JHB A;  1WZ3 A;  3VH4 B;  1WJU A;  1LQB A;  1YOV B;  3UIP B;  2BS4 B;  2M19 A;  1T3Q A;  1ZXI A;  1I4P A;  1YJI A;  2N9L A;  3BYT B;  4DHZ B;  2MJD A;  2REX A;  2KT7 A;  5AZH A;  4JE3 B;  4EOY A;  2DLB A;  3L54 A;  1XLQ A;  2KQ7 A;  1SXT A;  4MAC A;  2M0A A;  3UGB B;  2KDF B;  3CWI A;  1WYG A;  5AUK A;  4PK1 A;  1S1Q B;  5D3I B;  4XWT A;  3B08 A;  3SFE B;  3HIZ A;  1T0Y A;  4LTU A;  4DDI D;  4NAW B;  3AH7 A;  2CHX A;  4NZL B;  4JQW C;  3KYD D;  1V1O A;  3N1Y C;  2KTF A;  2IY1 B;  2LXC A;  2JRI B;  3JYU A;  3DBH B;  1QF6 A;  3N3K B;  5H8Y E;  2DZM A;  2MQJ A;  1RAX A;  4W9F A;  1L7Y A;  3PS6 A;  1BXT A;  2MJE A;  3PRZ A;  2GI9 A;  2G1E A;  3SEB A;  4YSX B;  3TJP A;  4RNA A;  4ZRJ A;  2BTE A;  1EUV B;  2KKC A;  3RNF C;  1XQQ A;  4BFR A;  4GDL B;  2BS2 B;  1V49 A;  3AEF B;  4C7Y A;  2JZ3 B;  4XDD A;  5KHQ A;  1EU3 A;  1J7B A;  1U4A A;  2KAC A;  3NVW A;  2AL3 A;  4LNN A;  1ET6 A;  1WJ6 A;  1C78 A;  2DWQ A;  4RGN A;  1E5W A;  1C4C A;  2EMS A;  2KX3 A;  2L00 B;  4K1R B;  1IUE A;  3ZTC A;  1ET9 A;  2KWC A;  4GDK B;  2EEL A;  5EE1 A;  3H7P A;  3IHP C;  3QQ8 B;  4EZJ A;  5BMG A;  2C60 A;  1TS3 A;  4AWJ A;  3RN9 C;  2JWU A;  3TEW A;  2WU5 B;  3S2A A;  2WDT B;  1V2Y A;  5E6N A;  1LGR A;  2KQS A;  1GAQ B;  4WJQ A;  3URY A;  3GE3 C;  1WRI A;  3NZ3 A;  3L4P A;  3EEC A;  2L76 A;  3W2D A;  2KFK A;  2INN E;  4K7S A;  3RFZ B;  1WM2 A;  5D6J B;  3R66 C;  4AUQ C;  3PRP B;  5J2R A;  2LVP A;  2BBC A;  3AE6 B;  2KNB A;  1E8W A;  3NHE B;  1HE8 A;  2JPH A;  5CTR C;  2DEN B;  3NOB A;  2IBI B;  1D5M C;  2MRP A;  3RNE C;  2ZW0 A;  4KGT A;  2L83 A;  2K6Q A;  1MJD A;  2LEK A;  4LNF A;  1L6V A;  3AED B;  3O65 B;  3VH3 B;  2GBN A;  1LXD A;  3JW0 X;  1R4M I;  1MFW A;  1VDV A;  3Q8F A;  3HVZ A;  4S17 A;  2PW9 A;  4OW0 A;  2WWZ A;  2J4X A;  3AE8 B;  4II2 B;  2OJR A;  4ZDV A;  2RPQ A;  3LJ3 A;  4HRO A;  1UWX A;  3VXW A;  2D10 A;  4GGQ A;  4ZYS A;  4HPP A;  4FN2 A;  1XEE A;  3CF6 E;  3DWG C;  1B9R A;  4CYE A;  1YQB A;  5JZE B;  2KZR A;  3P42 A;  5HKH A;  4NY0 A;  3QCA A;  3RNG C;  3RUL A;  1XD3 B;  1CJE A;  2EMT A;  1QOF A;  2LGX A;  1WSP A;  1UUP A;  4XWW A;  3A9K B;  2ZZP B;  1R4N B;  2LMC A;  1TTN A;  2LJI A;  3BIN A;  4NAM A;  1QOB A;  2LGI A;  3MHZ A;  1ZPS A;  1ZP0 B;  2KJH B;  4FUL A;  2L1A A;  2D3C A;  1WFY A;  2V4I B;  3OWE B;  1AYF A;  3AE4 B;  2NVU I;  4ZRP A;  1E0Z A;  1NEK B;  2M17 A;  1J8C A;  5LXI B;  4P6V F;  1Q0W B;  2JVC A;  5BMI A;  3ZDM C;  4OZB A;  3KUD B;  3GS2 A;  4TV3 A;  1QOA A;  1OQR A;  1JQ4 A;  2K9X A;  4OZA A;  2LRW A;  1WXQ A;  1AWD A;  1LFD A;  1NDD A;  1GB1 A;  3VR9 B;  2JF5 A;  3OG5 A;  3A9J B;  4IW0 A;  2BKR B;  2LVO A;  3DBL I;  4ZRI A;  4BKT A;  3LXF A;  1UGM A;  4WJP A;  3L17 A;  3A4R A;  2NBW B;  4JWU C;  1MVK A;  1SF0 A;  3MC8 A;  1D3Z A;  1SIJ A;  1M94 A;  4A8X C;  1OFF A;  4YT0 B;  2K22 A;  2R2O A;  1WGY A;  1F0Z A;  3KUZ A;  1WX8 A;  4OVV A;  2LAS A;  5C3J B;  1T5X D;  4DHJ B;  2XK5 B;  4F8C B;  2GOW A;  3GZN B;  5DPS A;  5G5G A;  5HFY A;  3TL5 A;  2YVC A;  2WXM A;  1IGC A;  3UI3 A;  4BZA A;  3ZLZ A;  3A1Q A;  1T0Q C;  1Y56 A;  2X8X X;  4KIK A;  4XZ4 A;  3HK0 A;  1I4H A;  1XT9 B;  3RZW C;  4DBG A;  2KHW B;  3BZD B;  2BT6 A;  3NRZ A;  4AOF A;  3U30 A;  4A6Q A;  2WYQ A;  3RT3 B;  3AEE B;  1DYQ A;  4FHJ A;  1WX7 A;  2VZK B;  4W9E A;  1WZ0 A;  1NI2 A;  4TQ1 A;  3IXS A;  2N9X A;  4M8N A;  2LUM A;  1Z5S B;  3QJZ A;  4M02 A;  3ZNI D;  5AUI A;  3APC A;  4MJS A;  2MX2 A;  4II3 B;  5G55 A;  1MI0 A;  4B9K A;  1PGA A;  3PGE A;  1WYW B;  1WI0 A;  3X23 A;  2H88 B;  1TZO A;  4GIV A;  2NR2 A;  3DHG C;  5AZG A;  4XDC A;  2QIL A;  1T0R C;  2KWD A;  2WNM A;  4IWP A;  2WQY B;  5BO4 B;  2JT4 B;  3MP9 A;  2ZJD A;  3ZKJ C;  1YJ1 A;  5FK9 C;  1PYW D;  4A3O A;  2C7H A;  4M00 A;  4ASW C;  3QHT A;  1FNV A;  2MBE A;  2W3R A;  3N30 A;  3ABV B;  1FCC C;  1K50 A;  1BUI C;  2HJ8 A;  1FCL A;  2JRH A;  3VDZ A;  4A55 A;  1WE6 A;  5AEK B;  1UNS A;  3A4S C;  1EF1 A;  2WP9 B;  1SE2 A;  2N7D A;  1XF5 L;  2BWE S;  4W9J A;  2KWU B;  1PQS A;  2V3S A;  4O1N A;  2W55 A;  1E8Y A;  3NVY A;  1IPG A;  1KLG D;  1OEY A;  3IBE A;  4KGS A;  2MHJ A;  3EFC A;  2JWZ A;  4AQ7 A;  3B0A A;  1N60 A;  3NZU A;  4XYC A;  2N0S B;  3PRM B;  3DBR I;  2J42 A;  1JWM D;  2KLC A;  4CHK A;  3RNB C;  2WXJ A;  3RNA C;  1J0G A;  2JSV X;  4EEW A;  1FFV A;  3H7S A;  2NMQ A;  3RI7 C;  2D11 A;  3I63 C;  3Q8C A;  1K51 A;  4FBJ B;  4L2Y A;  1X1M A;  4K81 A;  4G3X B;  2BB6 A;  3ZNG C;  5HI1 A;  2WXL A;  2AYO B;  1Q1O A;  1D5X C;  1WGR A;  4YSZ B;  3DCG A;  2NPT A;  1MHH E;  1DOY A;  5L83 A;  3D32 A;  3JVZ X;  3ZGZ A;  2LGD A;  3VR8 B;  1WXM A;  3PHW B;  1FXI A;  4WWM A;  2AQ2 B;  4I6P A;  2CJO A;  3ZJU A;  1KM7 A;  2FID A;  2WXN A;  4C4V B;  1J7C A;  1UH6 A;  2WDQ B;  4K3B A;  3W5U B;  4HRS A;  1DOI A;  3IFW B;  2KFJ A;  1TS5 A;  1QQR A;  3WAP A;  4HK2 A;  2IYD B;  4Q2J A;  4YTM B;  4P7I A;  4GOC A;  3H9D A;  2G9H D;  1TKG A;  2MCN B;  5KHO A;  1ZW7 A;  3W1S C;  2BW2 A;  2K0P A;  1YX5 B;  3Q8E A;  2L8J A;  2MJ3 A;  1TJE A;  1TZ1 A;  2RDB C;  2Z59 B;  4URK A;  1V81 A;  1WM3 A;  2L7R A;  2LJ5 A;  2KDI A;  5DPR A;  3M62 B;  2KMM A;  2RD0 A;  1HTQ A;  2MBH A;  5IKC M;  3TEZ A;  1XXG A;  4GLS C;  3HVD A;  4L1B A;  1F1H A;  2WXP A;  4NJ6 A;  3L13 A;  1AAR A;  5G2N A;  2PIA A;  2PVO D;  1SE3 A;  2LHE A;  3H1U A;  3N32 A;  1MHX A;  3R3M A;  1ISN A;  1YN3 A;  1FRD A;  1OQQ A;  1EF5 A;  3UIN B;  2FUH B;  4LNK A;  1TKY A;  1XLP A;  2RDH A;  2V4L A;  3DVG Y;  4DXG A;  3EA6 A;  3QA8 A;  1L4Z B;  4US9 A;  1TKE A;  3RYT A;  1JWB D;  5JXV A;  2BYE A;  3GB1 A;  3DPD A;  1HZ5 A;  1JWU D;  1NEN B;  1AN8 A;  1CMX B;  3NJT A;  2XBB C;  1WIA A;  1I4Q A;  2PMV A;  2PEA A;  4RF1 A;  1PUT A;  2Z0D B;  2DYB A;  1WF9 A;  3N1Z C;  1QZE A;  1FEH A;  3L0W B;  2BYT A;  5JH5 C;  1UF0 A;  3ZIM A;  4J6I A;  2V3P A;  4GMV A;  4MEL A;  3HUI A;  2KDE B;  3MTN B;  3ZNH B;  5EE3 A;  2BB5 A;  2MBO A;  1KJT A;  2Y5C A;  4G50 A;  4M0W A;  2DAJ A;  4ZOH C;  1V8C A;  4DXF A;  3NZS A;  4RGO S;  1A70 A;  3R7Q A;  2BYF A;  4NJC A;  1WX9 A;  3C0R B;  2OHF A;  2JYT A;  3IT6 B;  4USA A;  1V97 A;  5CHF A;  3AE2 B;  3W9C B;  3KWL A;  4GN1 A;  1JRO A;  1VZ6 A;  2B3A A;  2KFK B;  2ZCB A;  4N6E B;  1RRB A;  1C4A A;  1OGW A;  4ARI A;  2C7N B;  4A9A A;  5EE0 A;  3B1L X;  2ASQ A;  2GBJ A;  2J0M A;  4WUR A;  1GJZ A;  2JX5 A;  4PS7 A;  4ICU A;  3RMK C;  4WH4 A;  3UF8 A;  4HDQ A;  1CZP A;  3AE9 B;  4XGA B;  1J19 A;  4KVG B;  2WXK A;  1RYJ A;  2KO3 A;  2XEW A;  4W9K A;  4XC2 A;  1WGD A;  2RDG A;  2GB1 A;  2JZP A;  1P9D U;  4RCO A;  4A90 A;  3AUL A;  1SEB D;  5DPW A;  4KDI C;  5IA7 A;  3I57 A;  2IDY A;  4DHJ D;  2FCN A;  2CJN A;  5J18 A;  1ZKH A;  4HPM B;  1EM7 A;  2KD0 A;  4HVB A;  2WXF A;  1NVI D;  2KVZ A;  1RWS A;  2EKE C;  3EFU A;  3IT4 B;  2SEB D;  2N1V A;  3BK1 A;  2CS4 A;  3SR6 A;  2CU1 A;  4LK0 M;  4W9I A;  4HPL B;  1H4R A;  4P1B C;  3WAL A;  5E6O A;  2IND C;  2DZK A;  3N1X C;  4MGI E;  5IO9 A;  4NAW A;  2RPV A;  3DVN V;  1YIW A;  1LO5 D;  1TBE A;  3UQB A;  3I3T B;  1JRP A;  2V1Y A;  2O6V D;  4B0M A;  5BMH A;  4NQL B;  1WXS A;  1F77 A;  1P7E A;  3OLM D;  3T3O A;  1BML C;  3AB5 A;  1V80 A;  2GMI C;  1J7A A;  1T0S C;  3PO0 A;  4MM3 A;  3P4P B;  3U4E G;  2J53 A;  4FXC A;  3VTU A;  3P4Q B;  3CSF A;  4LJP B;  3AE1 B;  4BAX A;  1SE9 A;  4F7Z A;  2PE6 B;  1T6B X;  4RGT A;  3R2I A;  2ZPY A;  2IO3 B;  2L0T A;  2DNF A;  3DOW A;  4OVZ A;  2M8S A;  1ZUD 2;  3ZJV A;  2ONQ A;  1E7P B;  2K1F A;  4TQ0 A;  1L0X B;  4GDK A;  1NYQ A;  2PJH A;  4OVU A;  4NJ7 A;  3CIR B;  2UU7 A;  3Q3N C;  4BVU C;  3A1Q B;  1Q10 A;  3PLV A;  1ZXH A;  3RD2 A;  4KV2 A;  1FM0 D;  1L5P A;  2K8C A;  1V86 A;  2A4Z A;  1VZ8 A;  2UYZ B;  4KIK B;  1KH0 A;  4YWG G;  2JU6 X;  2LGS A;  3LYY A;  1HEZ E;  1SE4 A;  4DHZ E;  3JSV A;  2KK8 A;  3VUW A;  4IWO A;  1BT0 A;  4IKG A;  3BK2 A;  1PGB A;  2MEK A;  2D07 B;  4KKI A;  4HKZ E;  2WXG A;  3GOE A;  3KQ4 A;  3CST A;  4X57 B;  5E6J A;  4P16 A;  2W9N A;  4IM0 A;  2CHZ A;  3FC4 A;  4MJS B;  3PVL A;  4HCP B;  1K53 A;  4JGH B;  3AMZ A;  4AS1 A;  1F9J A;  3L10 B;  4AP4 C;  1SGH A;  2M0X A;  3OJ4 B;  1FRR A;  2ZCC A;  2SAK A;  2WX0 A;  4JIO U;  4MGZ E;  4NPN A;  1JML A;  2VRR B;  1SSN A;  2FIF A;  2Z8L A;  3I9V 1;  2PLP A;  2GRI A;  2X38 A;  4ANU A;  3KUC B;  3ZQ4 A;  3TEY A;  1WE7 A;  4OHJ A;  2KTR A;  1JAL A;  2IY0 B;  1JRU A;  3ZDT A;  3QWZ B;  4ANW A;  1EWY C;  2V9H A;  1QT9 A;  3KW5 B;  2D2Q A;  4WJN A;  1Q5W B;  2BWF A;  1F52 A;  1V1P A;  3SDL C;  1F2R C;  4JX1 C;  3AN1 A;  2OED A;  4KZ0 A;  2Y5B B;  3A9K A;  3PZD A;  1PDX A;  4AJW A;  2NTT A;  3R8B A;  2LUE A;  3A33 B;  1N5W A;  3C8Y A;  4PYZ A;  4MSM B;  1D5Z C;  5C1Z A;  3SD5 A;  3NVZ A;  4MH0 E;  1OEY J;  3PHX B;  1WJ4 A;  2RGF A;  2IO0 B;  4ZHO A;  4WAF A;  2FUG 1;  3WAN A;  1N6Z A;  1WRD B;  1FD6 A;  3KYC D;  2K6D B;  1FO4 A;  3BWU D;  3VUX A;  1ZGU B;  4FJZ A;  2JUO A;  3V05 A;  3ALB A;  3UIO B;  3OJ3 A;  2I2Y A;  2MP2 B;  4ICV A;  4WQM A;  4GU2 A;  3ENE A;  2PPH A;  1GPX A;  1KLV A;  3A9J A;  1TY2 A;  3T3N A;  2MSE D;  4E71 A;  4IM3 A;  3QC8 B;  3DBH I;  3P2B A;  4AJY B;  3SU8 X;  1M4V A;  2RMM A;  2GBR A;  3EHV A;  3FIL A;  4EUT A;  1QKZ A;  1XLN A;  1VD2 A;  2ZNV B;  4LDT B;  5FR6 A;  1I35 A;  5D3D A;  2MW5 A;  3ONS A;  4IUM B;  2XK5 A;  2K39 A;  3ZRF A;  1NI3 A;  2CU3 A;  2AEH A;  2AQ3 B;  2IGG A;  1YQ3 B;  2FCM A;  4KDL B;  2K8B A;  3Q8B A;  2W54 A;  3U7Z A;  2KN4 A;  5CHW A;  4FJV B;  3CMM B;  1N5X A;  1E6E B;  1KF6 B;  3MHS D;  3P4R B;  3KWV A;  3DBS A;  3R2T A;  1N63 A;  4BBN F;  4GSW A;  4RH6 A;  1EO6 A;  2WDR B;  1KRH A;  2WDV B;  4G0N B;  1HTO A;  2YEP B;  2L05 A;  4HCN B;  4EE2 A;  2O6V A;  3ML9 A;  1TS2 A;  5FKA C;  1V5O A;  1STE A;  2WGS A;  4WWP A;  2KQ4 X;  3TMP B;  2BQQ A;  1WGH A;  2G4S A;  3Q3M C;  3T9L A;  1WWT A;  2LZ6 A;  1L6U A;  3AEC B;  2KMC A;  1WJN A;  2MH7 A;  4M8M A;  2KJR A;  3J9C A;  3VRA B;  5I4D A;  4WQO B;  1ZE3 D;  3HRD D;  3ETR A;  2C5L C;  1UD7 A;  5D94 A;  4A3P A;  2J7Q B;  4JL9 A;  1GG3 A;  2K3U A;  2DZJ A;  2NS5 A;  3WA0 A;  2HE7 A;  1IBX A;  4R3D A;  2DYO A;  4KGR A;  1YMH E;  4N9F 4;  1R4M B;  1AW7 A;  4RF0 A;  2RR9 A;  2K8H A;  2G4D B;  2ZNV C;  4WJO A;  1UBQ A;  1P0R A;  1A5R A;  3ZXR A;  1C76 A;  4E3C A;  3GE8 C;  3AEG B;  2KLG A;  2LXA A;  4FJY A;  3OAW A;  5CX3 A;  2INC C;  4FAD A;  4QAY A;  1C3T A;  2VH2 A;  1TIF A;  4H2A A;  1GNU A;  2B76 B;  2FCQ A;  4ITK A;  2WXO A;  3B9J A;  5IOI A;  3PV1 A;  3ZXV A;  4US8 A;  2KMA A;  3DWM A;  1Z2M A;  3V61 A;  2R61 A;  1ENF A;  1GOZ A;  1P98 A;  2GLS A;  1F2R I;  2WXH A;  1FFU A;  2DZI A;  1R4N I;  1TT5 B;  3P63 A;  4ZRQ A;  3PTF C;  4DWF A;  4HEA 1;  4JLC A;  4ZRK A;  3U52 E;  3DDC B;  2PTL A;  5EDS A;  2QC8 A;  5G5H A;  2HD5 B;  5T8I A;  3AE7 B;  2WS3 B;  3WAM A;  3M95 A;  3WAO A;  3FKY A;  3GP7 A;  4NQK E;  3NS1 A;  4TUU A;  5CHV C;  3TCA A;  1FNW A;  4IM2 A;  3N9Y C;  1DGJ A;  2G45 B;  1JWA D;  3SHQ A;  3Q3J A;  3BY4 B;  3APF A;  5D7G A;  1ZOY B;  5TSS A;  4ARC A;  3KLS X;  4BKS D;  2W82 A;  2HTH A;  2ZW1 A;  2LVQ A;  2KN5 A;  4PT5 A;  2BKF A;  3BYY B;  2V3N A;  3IAS 1;  1G6J A;  4MDK E;  1R7S A;  4C4V A;  2E3T A;  3U2S C;  3AU5 A;  5TR5 A;  4TSS A;  2EKI A;  3BVZ A;  4DQO C;  2C7M B;  1VR9 A;  2N4F A;  3GZN I;  4W9C A;  3V62 A;  2FE8 A;  1IGD A;  2K5P A;  3PT2 B;  5LNK 1;  3AXC A;  2IO1 B;  1C1Y B;  2ZPN A;  3H8H A;  1K8R B;  5IAA C;  3IVF A;  2J0J A;  3R7R A;  3H7P B;  2Z0E B;  2MWS B;  5HHD G;  2CR5 A;  3VFK A;  5C23 A;  2YLM A;  2H89 B;  2JQR B;  1C79 A;  2INP E;  2QIE B;  5C2T B;  3QIJ A;  2KC1 A;  3BVM A;  2N1W A;  2DHZ A;  4W9D A;  2KXJ A;  5IP4 D;  3MC0 B;  3ZJT A;  1SJE D;  4FHK A;  4BOZ B;  2O2V A;  5HG2 A;  3QX1 A;  1D6E C;  4NNJ B;  4PYU A;  4KX6 B;  2I1K A;  4DK5 A;  4GB9 A;  2AX5 A;  2ZEQ A;  4DDG D;  2JYE A;  3VTV A;  2GBM A;  2PE9 A;  3TIX A;  2KX0 A;  1ACC A;  3LDZ E;  4LNI A;  1WMH A;  1YQ4 B;  2R2Q A;  4ANV A;  3W1Y A;  4KKJ A;  4LJO B;  4M01 A;  4K7W A;  2BF8 B;  2WLB A;  3UQA A;  5J17 A;  3U8Z A;  1NBF C;  1XCT L;  3QK0 A;  1VLB A;  3W5V B;  4W9H A;  2K25 A;  4MM3 B;  4A20 A;  2MBQ A;  2FCS A;  3ZVV A;  2QHO A;  3AI5 A;  4JPS A;  1JW9 D;  1SIF A;  1FIQ A;  4PS3 A;  4ZYN A;  4PS8 A;  2FBW B;  1E7U A;  4K7U A;  2BGF A;  1VCB A;  3T8M A;  2JXX A;  3EC8 A;  2NBU A;  1L0Y B;  1WXV A;  4I6N B;  4CQN A;  4FLH A;  1QIL A;  1V9J A;  3RPF C;  3RNC C;  1L2N A;  1V6E A;  3RUI B;  3E56 A;  4HWI B;  3AEA B;  1E9M A;  3DBR B;  3Q3F A;  2JY6 A;  4HJK A;  3ML8 A;  1ESF A;  2LGY A;  3M3J A;  1EU4 A;  3JSV B;  4GXB A;  4CO7 A;  2LFI A;  4W9L A;  2VZK D;  3DHI C;  1RM6 C;  1YD8 U;  2PVG C;  4MEM A;  3L08 A;  3QAR A;  3PPA A;  4TKN A;  2Y3A A;  3ECI A;  4HKQ A;  2DAF A;  3AEB B;  4BBN C;  4C00 A;  2YEP F;  1E8Z A;  1YNT E;  2D3B A;  2JZZ A;  2M4N A;  4S0R A;  2D3A A;  1JCK B;  2TSS A;  2WXQ A;  4GDL A;  1TY0 A;  2V0G A;  3HHM A;  2ZVO A;  2KVR A;  3HM6 X;  2OJW A;  3AE5 B;  2J0K A;  5DCN A;  4BKG A;  5DPT A;  1UGJ A;  1FMA D;  1I7H A;  3N20 C;  5GMV A;  4KSK C;  5FR3 A;  2KTR B;  3AV8 A;  1FNU A;  4REZ A;  3C19 A;  5EE9 A;  2N9E B;  3NVV A;  2I38 A;  3DHH C;  1HZ6 A;  1P7F A;  4LDT D;  3PSE B;  4FA6 A;  2IJ0 A;  1I4R A;  3TEX A;  2JXT A;  1RFA A;  2WHI A;  1FXT B;  4IC7 B;  1V1P B;  1YN4 A;  3VHT C;  4N59 A;  4I6L B;  4ZHP A;  1Y8R C;  2IPK D;  3E9S A;  3RZF A;  3MJ5 A;  2FAZ A;  3NY5 A;  4B6W A;  2QJL A;  2QEJ C;  4B95 A;  2BYV E;  2BS3 B;  2N9P C;  1FXA A;  3VRB B;  1SJH D;  3VAW A;  1JWS D;  3Q3O C;  4RFB A;  2LHD A;  1HA5 A;  2BVC A;  4BKS A;  1QOG A;  2L3Z A;  1FPY A;  4F1S A;  4IG7 B;  2OOB B;  2W3S A;  5LLI A;  5BYR A;  4EFO A;  1KOT A;  2AQ1 B;  1NYR A;  2QSD A;  1TS4 A;  2KYW A;  2MBB B;  3H6N A;  4ANX A;  1H8C A;  3L16 A;  2KJ6 A;  1P1A A;  4HDO A;  4MH8 A;  3VVW B;  2KAJ A;  2KDB A;  4W9G A;  3LB8 C;  2DBY A;  4WWN A;  1DOX A;  1PGX A;  4YSY B; 
#chains in the Genus database with same CATH homology
 1TS2 A;  1JWB D;  5JXV A;  5FKA C;  1KLU D;  1GAQ B;  1STE A;  1C77 A;  3URY A;  2KQ4 X;  3GB1 A;  3FIL B;  1HZ5 A;  2WXR A;  4YTN B;  1JWU D;  4JWS C;  1NEN B;  1WRI A;  3NZ3 A;  3L4P A;  1AN8 A;  1WWT A;  3W2D A;  2INN E;  1QLB B;  1L6U A;  3AEC B;  2ACZ B;  2MH7 A;  3J9C A;  1E10 A;  3RFZ B;  3VRA B;  1I4Q A;  5I4D A;  1ZE3 D;  3HRD D;  2PMV A;  3ETR A;  4RF1 A;  1PUT A;  2BBC A;  3AE6 B;  3B2F A;  4XE0 A;  2K3U A;  1D5M C;  1FEH A;  2BYT A;  4RGM A;  3P1M A;  1IBX A;  4R3D A;  2ZW0 A;  3ZYY X;  2V3P A;  4KGT A;  2DYO A;  4KGR A;  3HUI A;  2L83 A;  1YMH E;  1AW7 A;  2LEK A;  4RF0 A;  1L6V A;  4YXD B;  5EE3 A;  2BB5 A;  3AED B;  1VDV A;  3Q8F A;  2Y5C A;  3HVZ A;  4M0W A;  2PW9 A;  4ZOH C;  4OW0 A;  2IGD A;  2J4X A;  1C76 A;  1V8C A;  3AE8 B;  4DXF A;  2XNA C;  2IGH A;  4HRO A;  1UWX A;  3AEG B;  4RGO S;  3B2G A;  1A70 A;  4ZYS A;  4NJC A;  2OHF A;  2JYT A;  1XEE A;  3IT6 B;  3DWG C;  4USA A;  1B9R A;  1V97 A;  3W9C B;  3AE2 B;  4IOI E;  3P42 A;  3KWL A;  4H2A A;  1JRO A;  1VZ6 A;  2B76 B;  2DYM A;  4IDI A;  4ITK A;  3EGR A;  4C56 C;  2WXO A;  3B9J A;  1CJE A;  1QOF A;  4N6E B;  1ROE A;  1YJJ A;  1C4A A;  4US8 A;  3DWM A;  4D2K A;  1TYG B;  2R61 A;  4ARI A;  1WSP A;  4OZC A;  1UUP A;  4XWW A;  1ENF A;  1GOZ A;  2L52 A;  4A9A A;  5EE0 A;  4N58 A;  1L0V B;  1F2R I;  2WXH A;  1FFU A;  4WUR A;  1I4X A;  2LMC A;  3Q69 A;  3P63 A;  2LJI A;  2JX5 A;  4LLG M;  4ZRQ A;  1IBX B;  4NAM A;  4HEA 1;  1QOB A;  2LGI A;  3MHZ A;  5BYQ A;  1ZPS A;  1ZP0 B;  4WH4 A;  4J3O D;  3U52 E;  5MPO A;  2PTL A;  2L1A A;  1CZP A;  3AE9 B;  1C4P A;  5G5H A;  2V4I B;  3OWE B;  1AYF A;  3PZ7 A;  3AE4 B;  4ZRP A;  2WXK A;  1RYJ A;  1E0Z A;  1NEK B;  5T8I A;  2RDG A;  3AE7 B;  2WS3 B;  2GB1 A;  4P6V F;  1D4B A;  2JZP A;  5GXG B;  1GB4 A;  3GP7 A;  3NS1 A;  2J52 A;  4RCO A;  4OZB A;  4A90 A;  5BMI A;  3GS2 A;  1SEB D;  1FNW A;  1OQR A;  1QOA A;  1JQ4 A;  2K9X A;  4OZA A;  3N9Y C;  1WXQ A;  1AWD A;  1DGJ A;  2Y5P A;  3TSS A;  3I57 A;  1GB1 A;  3VR9 B;  2IDY A;  2CJN A;  1JWA D;  1N61 A;  3LXF A;  5D7G A;  4JWU C;  1MVK A;  1ZOY B;  1SF0 A;  1SIJ A;  2HTM E;  1EM7 A;  4A8X C;  2WXF A;  5TSS A;  1NVI D;  1OFF A;  4ARC A;  1KFY B;  4YT0 B;  1RWS A;  3KLS X;  2K22 A;  2W82 A;  2ZW1 A;  3IT4 B;  4PT5 A;  2SEB D;  3BYY B;  3BK1 A;  2V3N A;  1YN5 A;  3IAS 1;  1F0Z A;  1XO3 A;  3Q8A A;  3SR6 A;  1R7S A;  4LK0 M;  5C3J B;  1KTK A;  5BYS A;  2E3T A;  3U2S C;  1T5X D;  3V3X A;  2L32 A;  2ICI A;  4TSS A;  2EKI A;  5G5G A;  5HFY A;  3BII D;  2WXM A;  3BVZ A;  4DQO C;  1IGC A;  3UI3 A;  1VR9 A;  2RPV A;  2FE8 A;  1IGD A;  2K5P A;  3IAM 1;  2WU2 B;  5LNK 1;  1K52 A;  1LO5 D;  1JRP A;  4L23 A;  1Y56 A;  3H8H A;  4B0M A;  5BMH A;  2PKO A;  1I4H A;  1F77 A;  1P7E A;  3T3O A;  2KDM A;  2N9K A;  1BML C;  3WCQ A;  3BZD B;  1N62 A;  2BT6 A;  3NRZ A;  4A6Q A;  5HHD G;  1RFK A;  3AB5 A;  2H89 B;  2JQR B;  1J7A A;  3PO0 A;  3AEE B;  1C79 A;  2INP E;  2HDE A;  2QIE B;  1DYQ A;  3P4P B;  3U4E G;  2QMT A;  5C2T B;  1B1Z A;  2J53 A;  4FXC A;  3BVM A;  3FAH A;  2VZK B;  3P4Q B;  4TQ1 A;  3AE1 B;  3IXS A;  3MC0 B;  1SBB B;  3ZJT A;  1T6B X;  4RGT A;  3R2I A;  1SJE D;  1VZ7 A;  2LUM A;  5AUI A;  5HG2 A;  1D6E C;  4OVZ A;  1CK1 A;  4KX6 B;  1C9F A;  1UWM A;  1ZUD 2;  3ZJV A;  1EWC A;  2ONQ A;  2AX5 A;  2ON8 A;  1MI0 A;  1E7P B;  1L4D B;  3VQI A;  2JYE A;  1PGA A;  4TQ0 A;  1L0X B;  1XLO A;  1VRA B;  2H88 B;  1HQR D;  1TZO A;  3W1S A;  1NYQ A;  4C7Z A;  1ACC A;  3CIR B;  4YTP B;  1WGK A;  1YQ4 B;  1Q10 A;  4XDC A;  1ZXH A;  2QIL A;  2KWD A;  1FM0 D;  1L5P A;  2WNM A;  1VZ8 A;  2XN9 C;  4KKJ A;  2WQY B;  1KH0 A;  4YWG G;  2JU6 X;  3LYY A;  2WLB A;  3MP9 A;  3NUH B;  5FK9 C;  1PYW D;  1HEZ E;  1SE4 A;  1XCT L;  1VLB A;  1FNV A;  2W3R A;  3W5V B;  4MM3 B;  3ABV B;  4IKG A;  1FCC C;  1K50 A;  2Q5W D;  3AM9 A;  3BK2 A;  2D5G A;  3MFG A;  1PGB A;  2MEK A;  1BUI C;  4KKI A;  4JPS A;  2N7J A;  5H92 C;  1VJK A;  4HKZ E;  1JW9 D;  1FCL A;  2WXG A;  3KQ4 A;  1FIQ A;  4MT5 A;  2E6X A;  5E6J A;  2WXI A;  2FBW B;  4P16 A;  4TMA B;  1PFD A;  1CQV A;  1XCQ L;  3FC4 A;  4A55 A;  1UNS A;  1K53 A;  1ZDV A;  3SFD B;  2WP9 B;  3AMZ A;  3P4S B;  1SE2 A;  4AS1 A;  1XF5 L;  1SB3 C;  4HJG E;  4B0E A;  1L0Y B;  1FRR A;  4CQN A;  2SAK A;  1QIL A;  3RPF C;  3O13 A;  3AE3 B;  4O1N A;  2W55 A;  1JML A;  3TUO A;  3NVY A;  4C80 A;  1SSN A;  1KLG D;  4KGS A;  2Z8L A;  3I9V 1;  4AQ7 A;  1MPE A;  2PLP A;  3E56 A;  2GRI A;  2X38 A;  2NTS A;  1N60 A;  3AEA B;  3ZQ4 A;  1E9M A;  3TEY A;  4WIP A;  4OHJ A;  2N0S B;  1ZDX A;  1JAL A;  1ESF A;  3BVG A;  2J42 A;  1JWM D;  1EU4 A;  2LFI A;  2VZK D;  1EWY C;  2WXJ A;  1RM6 C;  1HXY D;  2JSV X;  1QT9 A;  1FFV A;  2PVG C;  3EUB 2;  2NMQ A;  2M56 B;  3Q8C A;  1V1P A;  3PZ8 A;  1K51 A;  4L2Y A;  1F2R C;  4JX1 C;  2Y3A A;  3AN1 A;  2OED A;  4UDU C;  4HKQ A;  3AEB B;  1I4G A;  2BB6 A;  5HI1 A;  2WXL A;  1PDX A;  2NTT A;  1D5X C;  3R8B A;  2YEP F;  4YSZ B;  1YNT E;  2BS4 B;  2M19 A;  1MHH E;  1T3Q A;  1ZXI A;  1I4P A;  1DOY A;  1YJI A;  2N9L A;  3BYT B;  2MJD A;  1JCK B;  3ZGZ A;  2TSS A;  2WXQ A;  1N5W A;  1TY0 A;  3C8Y A;  3VR8 B;  1D5Z C;  4JE3 B;  2V0G A;  1FXI A;  4WWM A;  3NVZ A;  2DLB A;  2AQ2 B;  1XLQ A;  1SXT A;  4MAC A;  2CJO A;  3AE5 B;  4ZHO A;  4WAF A;  3ZJU A;  2FUG 1;  1UGJ A;  2WXN A;  2M0A A;  1FMA D;  1J7C A;  1I7H A;  2WDQ B;  3CWI A;  1WYG A;  5AUK A;  5FR3 A;  1FD6 A;  3W5U B;  4HRS A;  1FO4 A;  3AV8 A;  5D3I B;  1FNU A;  3BWU D;  4REZ A;  4XWT A;  1DOI A;  3SFE B;  1QQR A;  1TS5 A;  5EE9 A;  4LTU A;  3NVV A;  4NAW B;  3V05 A;  2I38 A;  3AH7 A;  4Q2J A;  1HZ6 A;  4NZL B;  2I2Y A;  1P7F A;  4YTM B;  4WQM A;  1V1O A;  2IJ0 A;  2G9H D;  1I4R A;  1TKG A;  3TEX A;  1GPX A;  2JXT A;  1TY2 A;  3T3N A;  1QF6 A;  2BW2 A;  5H8Y E;  1V1P B;  1M4V A;  1YN4 A;  2K0P A;  3Q8E A;  2MJ3 A;  4N59 A;  1TJE A;  4ZHP A;  2RMM A;  1BXT A;  2IPK D;  2MJE A;  3E9S A;  3FIL A;  3MJ5 A;  1QKZ A;  1XLN A;  2G1E A;  2GI9 A;  3SEB A;  4YSX B;  2QJL A;  2QEJ C;  4RNA A;  2KMM A;  2BTE A;  5D3D A;  2BS3 B;  1FXA A;  3VRB B;  1SJH D;  1NI3 A;  4GDL B;  2BS2 B;  2CU3 A;  3AEF B;  1JWS D;  3TEZ A;  1XXG A;  4GLS C;  4RFB A;  4C7Y A;  3HVD A;  2LHD A;  4L1B A;  4XDD A;  1HA5 A;  1EU3 A;  1J7B A;  2AQ3 B;  2KAC A;  2WXP A;  2IGG A;  3NVW A;  1QOG A;  1ET6 A;  1YQ3 B;  1C78 A;  3Q8B A;  2W3S A;  2W54 A;  3U7Z A;  2KN4 A;  2DWQ A;  4RGN A;  1C4C A;  5BYR A;  1IUE A;  1ET9 A;  2AQ1 B;  1NYR A;  2PIA A;  2PVO D;  2QSD A;  4GDK B;  1TS4 A;  1SE3 A;  2EEL A;  5EE1 A;  1N5X A;  2LHE A;  1E6E B;  1KF6 B;  3P4R B;  3KWV A;  3R2T A;  5BMG A;  1N63 A;  1MHX A;  4RH6 A;  2WDR B;  1KRH A;  1YN3 A;  2WDV B;  1TS3 A;  1FRD A;  1OQQ A;  4MH8 A;  2JWU A;  3TEW A;  2YEP B;  1TKY A;  1XLP A;  2KAJ A;  2WU5 B;  2RDH A;  4EE2 A;  3LB8 C;  2DBY A;  4DXG A;  3EA6 A;  4US9 A;  1L4Z B;  1TKE A;  1DOX A;  1PGX A;  4YSY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...