2QJLA

Crystal structure of urm1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the dimeric Urm1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Ubiquitin-related modifier 1
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qjlA00
1FIQA 3FAHA 1QOGA 4KX6B 5H92C 2B76B 3CIRB 1JALA 1WXQA 4N59A 4JWUC 1CZPA 1E10A 1PDXA 3NVWA 1N60A 3FC4A 1A70A 4IDIA 2K22A 1T3QA 2E3TA 1E0ZA 5AUKA 3NVZA 3AE9B 1L5PA 1JWBD 2KMMA 2Y5CA 1IUEA 2OHFA 2W55A 1WGKA 2LEKA 3VRBB 5G5HA 1PUTA 3ABVB 1SB3C 1N5WA 1OQRA 2ACZB 1NI3A 2M56B 5MPOA 1DOIA 5EE0A 2MJDA 1KFYB 4YSXB 2QIEB 3DWMA 1YJIA 3WCQA 3AE1B 1XLPA 2M19A 2WDVB 1TKEA 1PFDA 3AE6B 3HUIA 1DOXA 3HVZA 1XLQA 3RPFC 1ROEA 2W3SA 2BS4B 1KRHA 4C7YA 2PVOD 3P4PB 5G5GA 4YXDB 1NVID 3ETRA 4HRSA 1VLBA 2W54A 4ZHOA 3ZYYX 1UWMA 2H89B 3CWIA 1RFKA 4ITKA 4USAA 3VR9B 3AEBB 5EE3A 3AEEB 1ZUD2 2MJ3A 1FO4A 3HRDD 1N5XA 1TKYA 3P4QB 3SFDB 3P1MA 3NS1A 4JWSC 1ZP0B 2MH7A 2PKOA 2WU5B 1GPXA 2DBYA 2K5PA 1DOYA 1KF6B 3AB5A 2JQRB 1FM0D 2H88B 1GAQB 1TKGA 2CJOA 1FRRA 1FFUA 3AEFB 3B2GA 1QF6A 1L0VB 1QOAA 2KAJA 4WWMA 4YSZB 2WDQB 1AYFA 2CU3A 3B9JA 3LB8C 3DWGC 3VR8B 1TJEA 1WRIA 1JW9D 3NVYA 4YSYB 2MJEA 1VJKA 1V97A 4JX1C 3SFEB 3AV8A 3AE3B 1F0ZA 2JX5A 3EUB2 5GXGB 5C3JB 1RYJA 1SF0A 2N0SB 1FRDA 1DGJA 3KWLA 3W5UB 3VRAB 1FFVA 3W9CB 2WDRB 3AN1A 2K9XA 4P6VF 1NYRA 2L52A 3W5VB 3P4SB 2WQYB 3B2FA 2EKIA 1QOFA 4WQMA 1QOBA 3AE2B 1NENB 2BS2B 4A9AA 4YT0B 1L6UA 2AX5A 2BT6A 1FXIA 3AE8B 1I7HA 4YTPB 5EE9A 3L4PA 1E9MA 2PVGC 1JRPA 1XLOA 1XLNA 4FXCA 4HROA 1ZXIA 1N63A 1NEKB 1FXAA 2WLBA 1YQ3B 1CJEA 1OQQA 2W3RA 2CJNA 4US8A 1R7SA 3AEGB 2WP9B 4C80A 1E7PB 4C7ZA 3AEDB 2BS3B 3LXFA 1JWAD 1JROA 1N62A 4US9A 1E6EB 3AEAB 2FBWB 3P63A 1ZOYB 1WYGA 3AE4B 2DWQA 1XO3A 3NVVA 2G1EA 2WS3B 3BIID 3SR6A 2WU2B 4YTMB 1N61A 1J7BA 1FMAD 3AM9A 3P4RB 1B9RA 3AE7B 1L6VA 1YJJA 5EE1A 1OFFA 2PIAA 3PO0A 1QT9A 1J7AA 3AH7A 4ZOHC 3AE5B 4ZHPA 1NYQA 2Q5WD 1YQ4B 1JQ4A 1RM6C 1EWYC 2L83A 4YTNB 3AMZA 1TYGB 1J7CA 1V8CA 2HTME 2QJLA 3AECB 1AWDA 5C2TB 4LTUA 4N6EB 1RWSA 5AUIA 5H8YE 4N58A 1WWTA 1QLBB 3NRZA 1SIJA 1VDVA
chains in the Genus database with same CATH superfamily
3T8MA 5KHQA 5HI1A 2N7EA 4BFRA 2GOWA 1SE9A 2UYZB 3ZO5B 1TY0A 2XK5B 5I4DA 1WE6A 2IDYA 3VDZA 3Q3NC 1GJZA 4KVGB 4G11A 2M56B 3C8YA 2JZZA 3QK0A 1V1PB 3SEBA 4C7YA 4OZCA 1QQRA 5G5GA 1EUVB 4ZYSA 1SGHA 1V81A 4HKQA 1JWMD 2KWDA 2LFIA 1SE3A 4JWSC 2MH7A 3RNBC 2DYOA 1TKGA 2EELA 1FFUA 1L0VB 4LNOA 2QEJC 2KFKB 1ET6A 4FULA 3RZWC 1SF0A 1R4NB 3JVZX 2O2VB 1XT9B 2WDRB 4W9CA 1ENFA 4PS7A 4URKA 3AE2B 3ZKJC 4EZKA 5E6OA 2C9WB 2KJ6A 1BT0A 2IGGA 2DAJA 3I63C 1LXDA 2JPHA 3BK2A 2KWVB 1B1ZA 3CMMB 1K51A 5AEKB 2Q5WD 2FCNA 3Q14C 4GLSC 2PJHA 5CHWA 5C2TB 2FNJB 2KDFB 4R3DA 3ZLZA 3U52E 4KV2A 5GMVA 1KM7A 3UQAA 2QCZA 2G3QB 5IP4D 4DHZB 2BQQA 2ZVOA 3NVZA 2QSDA 1IUEA 2OHFA 2W55A 2LEKA 2HD5B 3VRBB 2FIFA 5HKHA 3AE6B 2MW5A 2VZKD 4XC2A 2KD0A 2BS4B 4TKNA 2KWCA 2FE8A 2QMTA 1RFKA 2M1MA 1STEA 1OQYA 3L17A 3WIMA 2JSVX 2J0MA 2PPHA 1K8RB 3N9YC 2WXRA 4W9HA 4O1NA 3ZTDA 1Z5SB 4BKSD 1WR6E 2G45B 5D3IB 1LFDA 2PMVA 2LRWA 5BYQA 1HTOA 1T0RC 4LJPB 2O6VA 1FRDA 3W9CB 4LCDE 3V6EB 1TTNA 2INNE 1KH0A 3TBLD 1M94A 4M8MA 1WGHA 4II2B 1D6EC 2NTTA 2JYTA 2WXKA 1FXAA 4G3XB 1C4PA 4C4VB 3ZNID 1U4AA 3QHTA 4IG7B 4C80A 2J0KA 1XO3A 2WXOA 1B9RA 2GI9A 1WZ0A 1XXGA 3ZXRA 1NYQA 4W9LA 1FD6A 2ZW1A 4IKGA 4IWOA 1WRDB 4MGKE 1AWDA 2I1KA 1WWTA 3NOBA 4MSQB 2RMMA 1E7UA 3MP9A 2XEWA 1E10A 2K1FA 2K22A 2E3TA 4AP4C 2KMMA 2KDBA 1IGDA 4A3PA 1SB3C 4M0WB 4REZA 2MP2B 3H7PB 2KQ4X 4ZDVA 4PS3A 3S2AA 4HLEA 1NDDA 1LM8B 1AW7A 4EZLA 2NBWB 2MLBA 4W9IA 3KUDB 1WX9A 2BTEA 2N9XA 3A9KA 3CWIA 3UI3A 3AEEB 1PGAA 2INCC 4P1CC 5E6JA 1VZ8A 1P7EA 4XDDA 4MM3B 3O13A 2DZJA 3HIZA 2MBOA 4MJSA 4XGAB 3AB5A 3K9PB 2BWES 2L00B 3VR8B 4RH6A 3IXSA 1V97A 4JX1C 3SFEB 4KSKC 2LI5A 4JPSA 3H8HA 1UZXB 2BWFA 2ZEQA 2WQYB 1UH6A 3VQIA 1YJ1A 1AARA 4MM3A 4XYCA 2LXAA 4GB9A 1ZXIA 3KYDD 4W9FA 3V6CB 3HHMA 3MTNB 2CJNA 3TMPB 4YL8A 3WA0A 4MGZE 2PTLA 1V6EA 2RPQA 4AJWA 4JL9A 2OOBB 4HPLB 4NY0A 3H7PA 1J8CA 4OHJA 1WGDA 4OVVA 4I6NB 3L54A 2DHZA 1NI2A 3NZ3A 4N6EB 3DBLI 1SIJA 3VTVA 2KLCA 2ZNVB 3H7SA 2DYBA 4NJCA 3KUZA 3LJ3A 4IM2A 5AUKA 2AQ3B 4HJGE 3NUHB 5G5HA 4FLHA 1NI3A 2RDGA 3ZXVA 4YSXB 3DWMA 1D5MC 3MC0B 3IG3A 2N7DA 4RM9A 2YEPB 4HRSA 4RM8A 1IGCA 1E8XA 2MRPA 3BZDB 1ZUD2 4OZAA 4BZAA 3ZUNA 2V0GA 1T0SC 1ZP0B 3WAPA 1L4ZB 2GBKA 1KF6B 2V1YA 2CJOA 4TQ1A 1QF6A 3EA6A 1UD7A 3ML9A 1K52A 3LB8C 2RPVA 4YSYB 2D3BA 3AV8A 4CQNA 3W5UB 1XD3B 4CYEA 2CHZA 1Q10A 3B0AA 4WAAA 3P4SB 2SAKA 3MFGA 2ZCCA 1ZPSA 4QAYA 2LMCA 3AE8B 4K3BA 3L4PA 4EEWA 3BWUD 2C7MB 2AEHA 3T3OA 1HXYD 3V60A 4C7ZA 2NBUA 4FA6A 1JWAD 4US9A 3VFKA 1LGRA 2DWQA 3VUXA 3P4RB 3TCAA 2L8JA 4P7IA 3WALA 2INPE 3DOWA 2KTRA 3EFCA 3LYYA 3M3JA 1EWYC 3NHEB 3DVGX 2L83A 3RN9C 5JH5C 2HTME 2LUMA 3SDLC 3OWEB 3X0WA 3GZNB 2WX1A 3BINA 4KKIA 1H8CA 4NPNA 1P1AA 1YX6B 1OGWA 2L0FA 1UBIA 4J6IA 3UINB 1H4RA 2IO2B 5FR6A 2B3AA 4F1SA 3BYTB 1R4MB 1WSPA 2V4LA 3WCQA 1YJIA 3ECIA 1TKEA 3NG0A 4HDQA 4YXDB 4HPMB 2J4XA 3VR9B 3RNAC 2MJ3A 5LLIA 2MSED 1EF5A 2C7NB 3CF6E 2I2YA 1TZ1A 2PEAA 4EUTA 2H88B 2AL6A 3EC8A 3VVWB 1J19A 3RNCC 1WRIA 2LGDA 3AI5A 3IVFA 3UIPB 2KFKA 3Q8CA 1FFVA 3VTWA 1C3TA 2ICIA 4KKJA 1L4DB 3R3MA 3TEWA 1GOZA 4ZRQA 2NR2A 3RNFC 4BKTA 3RT3B 3VXWA 1WJUA 3KWVA 5D3DA 2TSSA 2LD9A 3IHPC 2KX0A 3GS2A 3TEZA 5HG2A 3T3NA 1WXSA 1V1PA 1MG4A 1ZDVA 4RGNA 3OLMD 4BVUC 4ZRPA 2WXHA 2IYDB 3GE8C 5J17A 1KLUD 3FILA 2NVUI 2QDFA 3Q8BA 1PQSA 4AS1A 2XK5A 3PZ8A 3B2FA 2EKIA 2O6VB 4KIKA 1QOGA 4KX6B 3RMKC 2ZCBA 1VZ6A 4BKSA 1WE7A 2YEPF 1T3QA 1E0ZA 4WWNA 1ISNA 2NTSA 1TBEA 1WGKA 2LHDA 2KMAA 3WANA 4BOZB 4RF1A 4FJVB 2D3GA 2JT4B 4IC7B 3U4EG 3Q8EA 1KFYB 1WY8A 2CS4A 5BYSA 2M19A 5E6PA 3MHZA 2PVOD 3P4PB 3QIJA 3N20C 2BB6A 3Q3JA 3IAS1 1HQRD 5C1ZA 1HEZE 3N30A 3ZNZB 3SFDB 2PKOA 4FHKA 4WH4A 1HTQA 2JQRB 2Y3AA 5HFYA 3B2GA 3J9CA 4XWTA 2WDQB 3VAWA 1FNVA 2N9KA 2RD0A 1YNTE 2BKRB 3ZRFA 2ASQA 3EUB2 4DXGA 5FR3A 3P42A 2DAFA 2N9LA 1TZOA 3AN1A 1F2RC 4HCNB 5BMIA 1WX8A 2MWSB 2KDEB 2WXJA 4LNIA 5EE9A 3ZW3A 4HDOA 1KOTA 3B08A 1YQ3B 1OQQA 1IP9A 4B6WA 4A90A 2KFJA 3AEGB 2YLMA 5D2MB 4A55A 3ZJUA 2IPKD 1MG8A 1WYGA 3NVVA 2FUHB 2WS3B 4J3OD 2MEKA 1N61A 1J7BA 2KQ7A 2N7JA 5HHDG 3PRPB 2L3ZA 4OVUA 1GB4A 2PE9A 1JRUA 1YQ4B 3MHSD 2R61A 2LUEA 2KVRA 4NNJB 4YTNB 3QJZA 3PTFC 3NZSA 2D11A 4N59A 4GMVA 4ANWA 4BKGA 2CKHB 4IM3A 4RGMA 3ABVB 1WM2A 1N5WA 1V5TA 2DLBA 2X38A 2QIEB 1EM7A 1XLPA 1XLQA 2W3SA 2G9HD 4ZHOA 2H89B 1LO5D 2OJWA 3ZNGC 3AEBB 3OG5A 4RF0A 2FCSA 2LVQA 3QQ8B 3DHIC 2MBEA 3APDA 4RNAA 4KZCA 4DXAB 4B95A 4ASWC 2KLGA 4OZBA 2PW9A 1MHHE 3L0WB 3NZUA 2PE6B 4I6PA 4HJKA 4NAWA 1LQBA 2JVCA 2KK8A 4JLCA 3L16A 2FCQA 1FXIA 2J42A 4BBNF 4HROA 2WLBA 1CJEA 4G0NB 1RAXA 3ZTCA 1P3QU 4IM0A 4HVBA 1QZEA 3AE7B 3KVFB 2VRRB 4RFBA 2EMTA 3N1XC 1N6ZA 4M01A 4AUQC 1KTKA 3M95A 2K8HA 5H8YE 3HM6X 1V2YA 5AZGA 5DPRA 3RYTA 5H92C 2MHJA 1WXQA 4MACA 3NS8A 1YN3A 3MC9A 2UU7A 4NAMA 4JE3B 4ACFA 3OJ3A 5CHVC 4CHKA 4DDID 2FCMA 1SXTA 4E71A 2Z0EB 1T6BX 2KKCA 4H2AA 1HZ6A 4XE0A 1ACCA 3RPFC 2ON8A 1I42A 2W54A 4AWJA 4NJ7A 2RR9A 4AOFA 4WJNA 3VH4B 2HE7A 2K8CA 2NS5A 3DBHB 4FHJA 5JZEB 3RD2A 3HRDD 1N5XA 1TKYA 4IUMB 4BOSC 1SIFA 3C19A 1FM0D 3AXCA 2EKEC 4L2YA 3KW5B 4WWPA 3IBEA 2UWQA 2ZPYA 1C77A 4LNFA 1SJED 4W9DA 1DGJA 3KWLA 2PLPA 4FJZA 1ZXHA 3A33B 2K9XA 2MBQA 1UELA 4ANUA 3QWZB 4LNKA 4YT0B 4YTPB 3PPAA 5L83A 2W3RA 3QA8A 1FCLA 2WP9B 2MX2A 3JSVA 4BBNC 4WJPA 3RUIB 3ZRCA 2D5GA 1GG3A 4YTMB 4GDKB 1WMHB 1P9DU 4TUUA 1OFFA 1EU4A 4K7UA 2L76A 1J7AA 1FNUA 4ZHPA 4MH0E 2HJ8A 3DBSA 3AMZA 3AECB 2QJLA 5DPWA 1RWSA 5AUIA 4WJQA 1VDVA 1FIQA 1R4NI 3CIRB 4JGHB 4JWUC 1PDXA 4MT5A 2ZVNA 1L7YA 2DZKA 5DPTA 2NMQA 2OEDA 3UF8A 1QKZA 4KZ0A 3KQ4A 1PGXA 2YVCA 2NPTA 1E90A 3APFA 3K9OB 1BUIC 4PS8A 3VHTC 5MPOA 1CQVA 4LDTB 2K25A 2AWTA 3DCGA 2NPTB 5JXVA 1I4PA 1TS4A 3X23A 3TL5A 2WNMA 3U7DA 2HTHA 1F2RI 3A1QA 3L13A 4KDLB 1FPYA 1XEEA 3U7ZA 1WJ4A 1MVKA 3NS1A 2BKFA 2V3PA 2D3CA 2LVOA 3GB1A 3RNGC 2NBVB 4GXBA 1E8WA 2KDMA 5CHFA 1I4RA 2BYTA 4YSZB 3PLUA 3KUCB 3B9JA 1SE2A 3JW0X 1TJEA 1YMHE 4E3CA 1WJ6A 1WMHA 3AE3B 1F0ZA 1RYJA 3QARA 2BF8B 1Y8RC 2BBCA 3DBHI 2MQJA 1L0YB 2Z0DB 4OVZA 1C4CA 1RRBA 1I7HA 3ZVVA 2IY1B 4G50A 2LVPA 1VD2A 5EDSA 3PRMB 3AU5A 4FADA 1L0XB 3AEDB 3LDZE 1E6EB 4GIVA 3EECA 4W9KA 3BYYB 1Q5WB 3H1UA 2WXPA 5LXIB 3L10B 4CO7A 4JIOU 3PHXB 3U8ZA 2L05A 4EOYA 4NQLB 2A4ZA 1VR9A 3N1YC 1IYFA 3NRZA 4IWQA 1WYWB 3ENEA 1TY2A 4K81A 1N60A 2MBBB 1S1QB 2JY6A 3DQVA 3AE9B 1VRAB 2VH1A 3DPDA 3W1SA 2WXQA 3SD5A 1OQRA 1SSNA 1DOIA 5DCNA 5EE0A 4C56C 1UF0A 2LZ6A 3D32A 1SE4A 4A6QA 5BMGA 4XDCA 4TV3A 2C60A 1D5ZC 5TR5A 1NBFC 2R2OA 1FO4A 2O6VD 2IJ0A 2WU5B 2K5PA 1FRRA 1UGMA 2MA9B 3UQBA 4DXFA 2BYFA 4DBGA 1AYFA 2CU3A 3DWGC 5AZHA 2KO3A 3IFWB 4ZRIA 2N0SB 4LLGM 2V3SA 2EMSA 1WXVA 2WWZA 2KC1A 4ANVA 5L95C 2V3NA 1A5RA 1F1HA 1VCBA 1N63A 4ICUA 2WYQA 1G6JA 2GLSA 3PSEB 5IN7A 4NAWB 1V5OA 1S3SG 1T0YA 4KDIC 1TS5A 2FBWB 1WGYA 3A9JB 1MFWA 1ZOYB 3AE4B 3U2SC 1E7VA 1WR1A 2WX0A 3AM9A 3V61A 4MSMB 5EE1A 2LGYA 2ZW0A 3AH7A 2IO1B 2D3AA 4GDLA 2D07B 2K6DB 4S0RA 1V8CA 4K7SA 2HJ1A 3NJTA 1HZ5A 4RGOS 2N4FA 2IO0B 3NVWA 2KZRA 1JWBD 3I57A 2KWUB 4UDUC 4A20A 1E5WA 3H6NA 2KX3A 3TEYA 4RCOA 1ZDXA 4PK1A 3TUOA 3VTUA 2Y5BB 2JF5A 3BY4B 2WDVB 4I6LB 2GMIC 4F8CB 3ETRA 2QILA 3HVDA 4USAA 1IBXA 4ZYNA 1OEYA 3PS6A 1GPXA 1KJTA 2JXXA 5D6JB 1D5XC 1QOAA 4WWMA 3KH0A 2N1WA 2LJ5A 2L32A 3HM3A 1R4MI 4WIPA 2KTFA 1JW9D 3DBLB 3A4SC 2WXIA 1KLGD 2BGFA 1YN5A 5D7GA 4P6VF 1M4VA 4DHZE 1WI0A 3W5VB 3MJ5A 2BS2B 4DWFA 3APCA 2BT6A 2BVCA 2PVGC 3H9DA 1SJHD 4LDTD 3Q8FA 4TMAB 3PT2B 3LXFA 1JROA 2WHIA 3SU8X 1VZ7A 3P63A 4EFOA 2FIDA 2NCNA 4JQWC 2WU2B 3I5JC 4MGIE 4DHJB 2MCNB 3PO0A 1C4AA 1YX5B 2LXCA 4L1BA 1WFYA 1YD8U 5G2NA 3R2TA 2LGXA 3QAQA 1CK1A 1SBBB 2K39A 2D2QA 3FAHA 2B76B 4Q2JA 2AQ1B 1F77A 3BVZA 2KOXA 3PRZA 1I4XA 2LGSA 4B9KA 4MGYE 3NY5A 2ACZB 2CHWA 4GDLB 3VUWA 4ARIA 2KQSA 1C9FA 3E56A 3AE1B 3QX1A 4IWPA 3A9JA 2WDTB 3HVZA 2MBHA 2LASA 2XNAC 3R2IA 1NVID 2N1VA 5J18A 1VLBA 2V9HA 1JCKB 2WXNA 2V4IB 1ZGUB 4KIKB 3GP7A 4XWWA 4W9EA 2IGHA 2RDBC 2JZ3B 3A4RA 2N9EB 1ZW7A 3DVGY 4AQ7A 4HEA1 1CMXB 3FILB 3ZNHB 2KHWB 1P98A 4N9F4 1VJKA 2K0PA 2KJRA 2JX5A 5C3JB 2N9PC 1V9JA 4GGQA 1I35A 2M4NA 5LNK1 2IO3B 2BYVE 2GBRA 2L7RA 5TSSA 5IKCM 3GE3C 4MH8A 5E6NA 1GC6A 2WXMA 1L6UA 2AX5A 4IW0A 5BMHA 2LRUA 1XLOA 2I38A 2J0JA 3PGEA 1C79A 1E7PB 1ET9A 1YIWA 4AJYB 3IT6B 4HWIB 1YJJA 3ZQ4A 2PIAA 5BO4B 3AE5B 4HPPA 2WXFA 4MELA 3KYCD 2C5LC 3Q2AC 4GU2A 1YOVB 4GSWA 4LTUA 3GZNI 3DVNU 3AU4A 1FEHA 1TS2A 3URYA 5LXHA 3Q3MC 2DX5B 3ZGZA 3SHQA 1FCCC 2KT7A 1CZPA 3RI7C 4LJOB 4MDKE 5D94A 4TQ0A 3FC4A 1IPGA 1C1YB 1RLFA 1WXMA 4XX5A 1JWSD 3TEXA 3ALBA 1WH3A 4B0MA 2JUOA 2REXA 5JHAA 3IT4B 4FN2A 4II3B 2JRIB 1IBXB 2IGDA 1PFDA 2BYEA 3PV1A 3M63B 1MJDA 1L2NA 4GOCA 3OJ4B 4ITKA 4C00A 3M62B 3W2DA 3BVMA 3P4QB 3RNEC 2RGFA 1E8ZA 3V3XA 1DOYA 1V80A 2GRIA 2LGIA 2DZIA 3CSTA 2KTRB 5FK9C 1TIFA 4MJSB 2JZPA 4LNNA 2INDC 1YN4A 5IAAC 3A9KB 2J53A 3VRAB 2IZVB 1WGGA 5DPSA 1WIAA 1UBQA 1ZKHA 5C23A 1YQBA 2A5UA 3VUYA 3DDCB 4M0WA 3W1SC 3ZDMC 4US8A 1XF5L 2RDHA 4B0EA 2OJRA 2BS3B 4ICVA 1WJNA 1P0RA 1EO6A 1T5XD 1C78A 2DZMA 3UIOB 1FMAD 4KGTA 2ZPNA 4ZRJA 5AZFA 2KACA 2WGSA 1TS3A 4NJ6A 4A8XC 2VH2A 4BAXA 4EZJA 4X57B 4N58A 4DHJD 4RGTA 3WAOA 3DBRB 3ML8A 1QILA 1TT5B 2BPSA 4M8NA 1A70A 4XZ4A 2M0XA 3KLSX 4MEMA 2MJDA 2I1JA 2QC8A 4GDKA 3C0RB 1MPEA 3Q3OC 4NQKE 3JSVB 3ZJTA 1DYQA 1GC7A 2KANA 3Q8AA 2J52A 4F7ZA 1SEBD 1MHXA 3RZFA 3P1MA 2KVZA 3DHGC 1OTRB 2DBYA 1J0GA 2KDIA 3AULA 3BVGA 3AEFB 1FXTB 3EGRA 3T9LA 2KAJA 2G4SA 2CU1A 2JWZA 1JWUD 2G4DB 2JXTA 2KJHB 2HDEA 4FJYA 2VZKB 1BMLC 3W1YA 3RULA 2ZJDA 3MJWA 3TJPA 4WQMA 4K3CA 4IOIE 3U30A 3I3TB 4A9AA 1GUAB 2KXJA 4HK2A 2SEBD 1JRPA 3N32A 1NEKB 3BK1A 2GBNA 1N62A 1UGJA 1EU3A 4ZRKA 2G1EA 3BIID 3SR6A 2FAZA 1TGZB 2ONQA 2Z59B 1QT9A 1RFAA 2W9NA 2L0TA 2X8XX 3N3KB 2JWUA 1V1OA 3ONSA 1J7CA 1UNSA 4A3OA 3E9SA 1QLBB 5CTRC 4FBJB 1ESFA 3PHWB 3DBRI 2CHXA 3TIXA 4WWOA 1KLVA 5J2RA 3HK0A 3PZDA 4NZLB 4GN1A 4E74A 3Q6BA 3QC8B 1WF9A 2GBJA 4OW0A 1PUTA 1HE8A 2GB1A 3OAWA 2KN5A 1WZ3A 2MP2A 4HKZE 1BXTA 1FNWA 4P1BC 3A1QB 3DHHC 3EFUA 3HUIA 1DOXA 1ROEA 1JMLA 1I4GA 2AL3A 1UWMA 3R7QA 1AN8A 4W9JA 5EE3A 4HXDA 1Z2MA 3GOEA 3R8BA 4P16A 2RSUA 2DNFA 3O65B 3MC8A 2ZZPB 3JYUA 2J7QB 3EHVA 4PT5A 4WAFA 3PZ7A 4K1RB 1D3ZA 2WXLA 2KNBA 1ZE3D 3QCAA 2KMCA 3IAM1 3N1ZC 1F52A 1T0QC 2E6XA 2AYOB 2D10A 3L08A 2K3UA 3R66C 1F9JA 5G55A 4C4VA 1I4HA 2IY0B 2KYWA 1E9MA 1XLNA 1WXAA 2R2QA 1WX7A 4RMAA 1Y56A 2BW2A 4W9GA 3V62A 1PGBA 1XQQA 3CSFA 3ZDTA 5JHBA 3AEAB 2WXGA 4LK0M 1V49A 4PYZA 1K53A 1L6VA 4ZOHC 1GNUA 1JQ4A 1EWCA 2JYEA 2K6QA 2DYMA 1TYGB 2M17A 4EE2A 1D4BA 1PYWD 1XCTL 4ANXA 4HCPB 1JALA 1HA5A 1X1MA 2M0AA 3Q3FA 1XCQL 1C76A 4IDIA 5KHOA 4M02A 1L5PA 1E8YA 2Y5CA 2DENB 3PVLA 5FKAC 2Z8LA 3I9V1 3ZIMA 4DQOC 5IO9A 1P7FA 4KSLC 1WM3A 2L1AA 3R7RA 1KRHA 1UWXA 4DK5A 2AQ2B 3ZYYX 1Q0WB 1EF1A 4EKUA 4D2KA 1I4QA 2JRHA 2KN4A 2K8BA 5BYRA 5T8IA 3TSSA 1GAQB 4KGSA 3ZJVA 1GB1A 3P2BA 4KGRA 2JU6X 3PLVA 3NVYA 4M00A 2MJEA 3RCZA 2IBIB 5IOIA 4WURA 5GXGB 4K7WA 3DVNV 1NYRA 2L52A 4TSSA 4WJOA 4DDGD 1QOFA 1QOBA 1WGRA 1NENB 2Y5PA 4ARCA 2LJIA 4FXCA 1K50A 5CX3A 2XBBC 3WAMA 1MI0A 2BB5A 1R7SA 2XN9C 2W82A 3UGBB 1OEYJ 1V86A 2O2VA 2LWPA 3VH3B 2ZNVC 4PYUA 1Q1OA 3B1LX 2KC2A 5IA7A 3V05A 4S17A 3Q69A 1RM6C 4L23A 2QHOA 3PREA 2CR5A 2FUG1 2M8SA 4WQOB 4YWGG 1UUPA 3FKYA 2C7HA 2LHEA 3RFZB 2GBMA
chains in the Genus database with same CATH topology
1FIQA 3ZGZA 1FCCC 3CIRB 5HI1A 4JWUC 1CZPA 4KKIA 1PDXA 4MT5A 4TQ0A 3FC4A 1TY0A 5I4DA 2NMQA 2OEDA 2IDYA 1QKZA 1JWSD 3KQ4A 1PGXA 3TEXA 1BUIC 5MPOA 2M56B 4B0MA 1CQVA 3C8YA 3BYTB 3IT4B 1WSPA 5JXVA 1V1PB 3WCQA 1YJIA 1IBXB 2IGDA 1I4PA 1TKEA 1PFDA 1TS4A 3SEBA 2WNMA 4C7YA 4OZCA 1QQRA 5G5GA 4YXDB 4ZYSA 2J4XA 1F2RI 3VR9B 4ITKA 1XEEA 3W2DA 4HKQA 1JWMD 3U7ZA 3BVMA 2MJ3A 2KWDA 2LFIA 3P4QB 1SE3A 1MVKA 3NS1A 4JWSC 2MH7A 2V3PA 3V3XA 3GB1A 1DOYA 2I2YA 2H88B 2DYOA 2KDMA 1TKGA 2GRIA 2LGIA 2EELA 1FFUA 1I4RA 2BYTA 1L0VB 4YSZB 2QEJC 5FK9C 3B9JA 1SE2A 1TJEA 2JZPA 1WRIA 1YMHE 1ET6A 1YN4A 3AE3B 1F0ZA 1RYJA 1SF0A 2J53A 3Q8CA 3VRAB 1FFVA 2WDRB 2ICIA 1ENFA 2BBCA 4KKJA 1L4DB 3TEWA 1GOZA 1L0YB 3AE2B 4ZRQA 4OVZA 1C4CA 1I7HA 4M0WA 3KWVA 5D3DA 2TSSA 1XF5L 4US8A 2RDHA 1L0XB 4B0EA 3AEDB 2BS3B 1E6EB 2IGGA 3TEZA 3GS2A 3T3NA 5HG2A 1T5XD 1C78A 3BYYB 1V1PA 1FMAD 1ZDVA 3BK2A 4RGNA 1B1ZA 2WXPA 4ZRPA 1K51A 2WXHA 4KGTA 2Q5WD 2KACA 1KLUD 3FILA 4GLSC 3Q8BA 1TS3A 5C2TB 4AS1A 4A8XC 4R3DA 3U52E 1VR9A 3PZ8A 4N58A 4RGTA 3NRZA 3B2FA 2EKIA 1QOGA 4KX6B 1VZ6A 1QILA 1TY2A 2YEPF 1N60A 1A70A 1T3QA 1E0ZA 3NVZA 3AE9B 1VRAB 2QSDA 3W1SA 2WXQA 2NTSA 1IUEA 2OHFA 2W55A 1WGKA 2LEKA 3VRBB 2LHDA 1OQRA 1SSNA 3KLSX 1DOIA 4RF1A 5EE0A 2MJDA 3U4EG 4C56C 3Q8EA 1KFYB 5BYSA 2M19A 3AE6B 2VZKD 1MPEA 2BS4B 3MHZA 2PVOD 3P4PB 1SE4A 3ZJTA 4A6QA 5BMGA 4XDCA 2BB6A 2FE8A 1D5ZC 2QMTA 1DYQA 1RFKA 3IAS1 1HQRD 1STEA 1HEZE 2JSVX 2J52A 3Q8AA 1SEBD 1MHXA 1FO4A 3SFDB 3N9YC 2IJ0A 3P1MA 2PKOA 2WU5B 2DBYA 2K5PA 4WH4A 2JQRB 2WXRA 4O1NA 2Y3AA 1FRRA 3BVGA 3AEFB 5HFYA 3B2GA 3EGRA 2KAJA 3J9CA 4DXFA 4XWTA 2WDQB 1AYFA 1JWUD 2CU3A 3DWGC 5D3IB 1FNVA 2N9KA 2JXTA 2PMVA 1YNTE 5BYQA 3EUB2 4DXGA 5FR3A 2N0SB 3P42A 4LLGM 1FRDA 2N9LA 2HDEA 3W9CB 1TZOA 3AN1A 1F2RC 1KH0A 2INNE 2VZKB 1BMLC 5BMIA 4WQMA 2V3NA 4IOIE 2WXJA 4A9AA 1D6EC 2NTTA 5EE9A 2SEBD 2JYTA 1JRPA 1N63A 1NEKB 2WXKA 1FXAA 1C4PA 1YQ3B 1OQQA 4A90A 3AEGB 3BK1A 4C80A 4NAWB 4A55A 1N62A 3ZJUA 2IPKD 1UGJA 1TS5A 2FBWB 1ZOYB 1EU3A 1WYGA 3AE4B 1XO3A 3NVVA 2G1EA 2WS3B 2WXOA 3BIID 4J3OD 2MEKA 3SR6A 3U2SC 1N61A 1J7BA 3AM9A 1B9RA 2ONQA 5EE1A 2N7JA 5HHDG 2GI9A 2ZW0A 1QT9A 3AH7A 1XXGA 1NYQA 1GB4A 1YQ4B 2ZW1A 1FD6A 2R61A 4IKGA 2JWUA 1V1OA 4YTNB 1J7CA 1V8CA 1UNSA 1AWDA 3E9SA 1WWTA 1HZ5A 1QLBB 4RGOS 2RMMA 1ESFA 3MP9A 4N59A 1E10A 3NVWA 4NZLB 2K22A 2E3TA 1JWBD 2KMMA 3I57A 4UDUC 1IGDA 4OW0A 4RGMA 1PUTA 3ABVB 1SB3C 1N5WA 4REZA 2GB1A 3TEYA 2KQ4X 2DLBA 2X38A 4HKZE 4RCOA 1BXTA 1FNWA 1ZDXA 2QIEB 3TUOA 1EM7A 1XLPA 2WDVB 1AW7A 3HUIA 1DOXA 1XLQA 1ROEA 2W3SA 2G9HD 3ETRA 1JMLA 2QILA 1I4GA 3HVDA 4ZHOA 1UWMA 2BTEA 1AN8A 2H89B 1LO5D 3CWIA 4USAA 3UI3A 1IBXA 3AEBB 4RF0A 5EE3A 3AEEB 1PGAA 5E6JA 1VZ8A 1P7EA 1GPXA 4XDDA 3R8BA 4MM3B 3O13A 4P16A 1D5XC 3AB5A 4RNAA 1QOAA 4WWMA 2L32A 4PT5A 3VR8B 4RH6A 3IXSA 3PZ7A 4WAFA 4WIPA 4OZBA 1JW9D 2PW9A 2WXLA 1MHHE 1V97A 4JX1C 3SFEB 2WXIA 1KLGD 1ZE3D 4JPSA 5D7GA 1YN5A 3IAM1 3H8HA 4P6VF 2E6XA 1M4VA 3W5VB 2WQYB 3MJ5A 2K3UA 3VQIA 2BS2B 1I4HA 2BT6A 1FXIA 1E9MA 2PVGC 2J42A 1XLNA 4HROA 1ZXIA 2WLBA 1CJEA 1SJHD 1Y56A 2CJNA 3Q8FA 2BW2A 4TMAB 3LXFA 1JROA 1PGBA 3AEAB 1VZ7A 2PTLA 3P63A 2WXGA 4LK0M 2WU2B 1K53A 3AE7B 1L6VA 3PO0A 1C4AA 4ZOHC 4L1BA 4OHJA 4RFBA 1JQ4A 1EWCA 3R2TA 2JYEA 2DYMA 1TYGB 1KTKA 3NZ3A 4N6EB 1CK1A 5H8YE 4EE2A 1D4BA 1PYWD 1SBBB 1XCTL 1SIJA 3FAHA 5H92C 2B76B 1JALA 1HA5A 1WXQA 4Q2JA 2M0AA 2AQ1B 4MACA 4NJCA 1F77A 1XCQL 1C76A 3BVZA 4IDIA 1YN3A 5AUKA 1L5PA 1I4XA 2AQ3B 2Y5CA 4NAMA 4JE3B 4HJGE 3NUHB 5G5HA 5FKAC 2Z8LA 3I9V1 2ACZB 1NI3A 1SXTA 4GDLB 2RDGA 4ARIA 4DQOC 4YSXB 1C9FA 1T6BX 3DWMA 3E56A 3AE1B 1P7FA 1D5MC 3MC0B 4H2AA 1HZ6A 3HVZA 1ACCA 2XNAC 2L1AA 4XE0A 3RPFC 1KRHA 1UWXA 2ON8A 3R2IA 2YEPB 1NVID 2AQ2B 1VLBA 2W54A 4HRSA 1IGCA 3ZYYX 1JCKB 2WXNA 3BZDB 2V4IB 1ZUD2 4OZAA 4D2KA 3GP7A 1I4QA 1N5XA 1TKYA 2KN4A 3HRDD 4XWWA 2V0GA 2IGHA 1ZP0B 1L4ZB 5BYRA 1KF6B 5T8IA 1FM0D 3TSSA 1GAQB 4KGSA 3ZJVA 2CJOA 4TQ1A 1GB1A 1QF6A 4AQ7A 4HEA1 3FILB 3EA6A 4L2YA 4KGRA 1K52A 2JU6X 3LB8C 1C77A 2RPVA 3NVYA 4YSYB 2MJEA 1VJKA 2K0PA 1SJED 3AV8A 4CQNA 2JX5A 4WURA 5GXGB 5C3JB 1DGJA 3KWLA 2PLPA 3W5UB 1ZXHA 5LNK1 2K9XA 1NYRA 2L52A 4TSSA 5TSSA 1Q10A 3P4SB 2SAKA 3MFGA 4MH8A 1QOFA 1QOBA 1ZPSA 1NENB 2LMCA 4YT0B 2WXMA 1L6UA 2AX5A 3AE8B 4YTPB 2Y5PA 3L4PA 5BMHA 2LJIA 1XLOA 4ARCA 4FXCA 1K50A 2I38A 3BWUD 2W3RA 1MI0A 2BB5A 1C79A 1HXYD 3T3OA 1R7SA 2XN9C 2W82A 2WP9B 1FCLA 1E7PB 4C7ZA 1JWAD 4US9A 1ET9A 2DWQA 2D5GA 4YTMB 4GDKB 3IT6B 3P4RB 1YJJA 1OFFA 2PIAA 3ZQ4A 1EU4A 3V05A 1J7AA 1FNUA 3AE5B 2INPE 4ZHPA 2WXFA 3Q69A 3LYYA 1RM6C 4L23A 1EWYC 2L83A 2FUG1 3AMZA 2HTME 2LUMA 2QJLA 3AECB 4YWGG 1UUPA 3OWEB 4LTUA 1RWSA 5AUIA 2LHEA 3RFZB 1FEHA 1TS2A 1VDVA 3URYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ A;  3FAH A;  1QOG A;  4KX6 B;  5H92 C;  2B76 B;  3CIR B;  1JAL A;  1WXQ A;  4N59 A;  4JWU C;  1CZP A;  1E10 A;  1PDX A;  3NVW A;  1N60 A;  3FC4 A;  1A70 A;  4IDI A;  2K22 A;  1T3Q A;  2E3T A;  1E0Z A;  5AUK A;  3NVZ A;  3AE9 B;  1L5P A;  1JWB D;  2KMM A;  2Y5C A;  1IUE A;  2OHF A;  2W55 A;  1WGK A;  2LEK A;  3VRB B;  5G5H A;  1PUT A;  3ABV B;  1SB3 C;  1N5W A;  1OQR A;  2ACZ B;  1NI3 A;  2M56 B;  5MPO A;  1DOI A;  5EE0 A;  2MJD A;  1KFY B;  4YSX B;  2QIE B;  3DWM A;  1YJI A;  3WCQ A;  3AE1 B;  1XLP A;  2M19 A;  2WDV B;  1TKE A;  1PFD A;  3AE6 B;  3HUI A;  1DOX A;  3HVZ A;  1XLQ A;  3RPF C;  1ROE A;  2W3S A;  2BS4 B;  1KRH A;  4C7Y A;  2PVO D;  3P4P B;  5G5G A;  4YXD B;  1NVI D;  3ETR A;  4HRS A;  1VLB A;  2W54 A;  4ZHO A;  3ZYY X;  1UWM A;  2H89 B;  3CWI A;  1RFK A;  4ITK A;  4USA A;  3VR9 B;  3AEB B;  5EE3 A;  3AEE B;  1ZUD 2;  2MJ3 A;  1FO4 A;  3HRD D;  1N5X A;  1TKY A;  3P4Q B;  3SFD B;  3P1M A;  3NS1 A;  4JWS C;  1ZP0 B;  2MH7 A;  2PKO A;  2WU5 B;  1GPX A;  2DBY A;  2K5P A;  1DOY A;  1KF6 B;  3AB5 A;  2JQR B;  1FM0 D;  2H88 B;  1GAQ B;  1TKG A;  2CJO A;  1FRR A;  1FFU A;  3AEF B;  3B2G A;  1QF6 A;  1L0V B;  1QOA A;  2KAJ A;  4WWM A;  4YSZ B;  2WDQ B;  1AYF A;  2CU3 A;  3B9J A;  3LB8 C;  3DWG C;  3VR8 B;  1TJE A;  1WRI A;  1JW9 D;  3NVY A;  4YSY B;  2MJE A;  1VJK A;  1V97 A;  4JX1 C;  3SFE B;  3AV8 A;  3AE3 B;  1F0Z A;  2JX5 A;  3EUB 2;  5GXG B;  5C3J B;  1RYJ A;  1SF0 A;  2N0S B;  1FRD A;  1DGJ A;  3KWL A;  3W5U B;  3VRA B;  1FFV A;  3W9C B;  2WDR B;  3AN1 A;  2K9X A;  4P6V F;  1NYR A;  2L52 A;  3W5V B;  3P4S B;  2WQY B;  3B2F A;  2EKI A;  1QOF A;  4WQM A;  1QOB A;  3AE2 B;  1NEN B;  2BS2 B;  4A9A A;  4YT0 B;  1L6U A;  2AX5 A;  2BT6 A;  1FXI A;  3AE8 B;  1I7H A;  4YTP B;  5EE9 A;  3L4P A;  1E9M A;  2PVG C;  1JRP A;  1XLO A;  1XLN A;  4FXC A;  4HRO A;  1ZXI A;  1N63 A;  1NEK B;  1FXA A;  2WLB A;  1YQ3 B;  1CJE A;  1OQQ A;  2W3R A;  2CJN A;  4US8 A;  1R7S A;  3AEG B;  2WP9 B;  4C80 A;  1E7P B;  4C7Z A;  3AED B;  2BS3 B;  3LXF A;  1JWA D;  1JRO A;  1N62 A;  4US9 A;  1E6E B;  3AEA B;  2FBW B;  3P63 A;  1ZOY B;  1WYG A;  3AE4 B;  2DWQ A;  1XO3 A;  3NVV A;  2G1E A;  2WS3 B;  3BII D;  3SR6 A;  2WU2 B;  4YTM B;  1N61 A;  1J7B A;  1FMA D;  3AM9 A;  3P4R B;  1B9R A;  3AE7 B;  1L6V A;  1YJJ A;  5EE1 A;  1OFF A;  2PIA A;  3PO0 A;  1QT9 A;  1J7A A;  3AH7 A;  4ZOH C;  3AE5 B;  4ZHP A;  1NYQ A;  2Q5W D;  1YQ4 B;  1JQ4 A;  1RM6 C;  1EWY C;  2L83 A;  4YTN B;  3AMZ A;  1TYG B;  1J7C A;  1V8C A;  2HTM E;  2QJL A;  3AEC B;  1AWD A;  5C2T B;  4LTU A;  4N6E B;  1RWS A;  5AUI A;  5H8Y E;  4N58 A;  1WWT A;  1QLB B;  3NRZ A;  1SIJ A;  1VDV A; 
#chains in the Genus database with same CATH topology
 3T8M A;  5KHQ A;  5HI1 A;  2N7E A;  4BFR A;  2GOW A;  1SE9 A;  2UYZ B;  3ZO5 B;  1TY0 A;  2XK5 B;  5I4D A;  1WE6 A;  2IDY A;  3VDZ A;  3Q3N C;  1GJZ A;  4KVG B;  4G11 A;  2M56 B;  3C8Y A;  2JZZ A;  3QK0 A;  1V1P B;  3SEB A;  4C7Y A;  4OZC A;  1QQR A;  5G5G A;  1EUV B;  4ZYS A;  1SGH A;  1V81 A;  4HKQ A;  1JWM D;  2KWD A;  2LFI A;  1SE3 A;  4JWS C;  2MH7 A;  3RNB C;  2DYO A;  1TKG A;  2EEL A;  1FFU A;  1L0V B;  4LNO A;  2QEJ C;  2KFK B;  1ET6 A;  4FUL A;  3RZW C;  1SF0 A;  1R4N B;  3JVZ X;  2O2V B;  1XT9 B;  2WDR B;  4W9C A;  1ENF A;  4PS7 A;  4URK A;  3AE2 B;  3ZKJ C;  4EZK A;  5E6O A;  2C9W B;  2KJ6 A;  1BT0 A;  2IGG A;  2DAJ A;  3I63 C;  1LXD A;  2JPH A;  3BK2 A;  2KWV B;  1B1Z A;  3CMM B;  1K51 A;  5AEK B;  2Q5W D;  2FCN A;  3Q14 C;  4GLS C;  2PJH A;  5CHW A;  5C2T B;  2FNJ B;  2KDF B;  4R3D A;  3ZLZ A;  3U52 E;  4KV2 A;  5GMV A;  1KM7 A;  3UQA A;  2QCZ A;  2G3Q B;  5IP4 D;  4DHZ B;  2BQQ A;  2ZVO A;  3NVZ A;  2QSD A;  1IUE A;  2OHF A;  2W55 A;  2LEK A;  2HD5 B;  3VRB B;  2FIF A;  5HKH A;  3AE6 B;  2MW5 A;  2VZK D;  4XC2 A;  2KD0 A;  2BS4 B;  4TKN A;  2KWC A;  2FE8 A;  2QMT A;  1RFK A;  2M1M A;  1STE A;  1OQY A;  3L17 A;  3WIM A;  2JSV X;  2J0M A;  2PPH A;  1K8R B;  3N9Y C;  2WXR A;  4W9H A;  4O1N A;  3ZTD A;  1Z5S B;  4BKS D;  1WR6 E;  2G45 B;  5D3I B;  1LFD A;  2PMV A;  2LRW A;  5BYQ A;  1HTO A;  1T0R C;  4LJP B;  2O6V A;  1FRD A;  3W9C B;  4LCD E;  3V6E B;  1TTN A;  2INN E;  1KH0 A;  3TBL D;  1M94 A;  4M8M A;  1WGH A;  4II2 B;  1D6E C;  2NTT A;  2JYT A;  2WXK A;  1FXA A;  4G3X B;  1C4P A;  4C4V B;  3ZNI D;  1U4A A;  3QHT A;  4IG7 B;  4C80 A;  2J0K A;  1XO3 A;  2WXO A;  1B9R A;  2GI9 A;  1WZ0 A;  1XXG A;  3ZXR A;  1NYQ A;  4W9L A;  1FD6 A;  2ZW1 A;  4IKG A;  4IWO A;  1WRD B;  4MGK E;  1AWD A;  2I1K A;  1WWT A;  3NOB A;  4MSQ B;  2RMM A;  1E7U A;  3MP9 A;  2XEW A;  1E10 A;  2K1F A;  2K22 A;  2E3T A;  4AP4 C;  2KMM A;  2KDB A;  1IGD A;  4A3P A;  1SB3 C;  4M0W B;  4REZ A;  2MP2 B;  3H7P B;  2KQ4 X;  4ZDV A;  4PS3 A;  3S2A A;  4HLE A;  1NDD A;  1LM8 B;  1AW7 A;  4EZL A;  2NBW B;  2MLB A;  4W9I A;  3KUD B;  1WX9 A;  2BTE A;  2N9X A;  3A9K A;  3CWI A;  3UI3 A;  3AEE B;  1PGA A;  2INC C;  4P1C C;  5E6J A;  1VZ8 A;  1P7E A;  4XDD A;  4MM3 B;  3O13 A;  2DZJ A;  3HIZ A;  2MBO A;  4MJS A;  4XGA B;  3AB5 A;  3K9P B;  2BWE S;  2L00 B;  3VR8 B;  4RH6 A;  3IXS A;  1V97 A;  4JX1 C;  3SFE B;  4KSK C;  2LI5 A;  4JPS A;  3H8H A;  1UZX B;  2BWF A;  2ZEQ A;  2WQY B;  1UH6 A;  3VQI A;  1YJ1 A;  1AAR A;  4MM3 A;  4XYC A;  2LXA A;  4GB9 A;  1ZXI A;  3KYD D;  4W9F A;  3V6C B;  3HHM A;  3MTN B;  2CJN A;  3TMP B;  4YL8 A;  3WA0 A;  4MGZ E;  2PTL A;  1V6E A;  2RPQ A;  4AJW A;  4JL9 A;  2OOB B;  4HPL B;  4NY0 A;  3H7P A;  1J8C A;  4OHJ A;  1WGD A;  4OVV A;  4I6N B;  3L54 A;  2DHZ A;  1NI2 A;  3NZ3 A;  4N6E B;  3DBL I;  1SIJ A;  3VTV A;  2KLC A;  2ZNV B;  3H7S A;  2DYB A;  4NJC A;  3KUZ A;  3LJ3 A;  4IM2 A;  5AUK A;  2AQ3 B;  4HJG E;  3NUH B;  5G5H A;  4FLH A;  1NI3 A;  2RDG A;  3ZXV A;  4YSX B;  3DWM A;  1D5M C;  3MC0 B;  3IG3 A;  2N7D A;  4RM9 A;  2YEP B;  4HRS A;  4RM8 A;  1IGC A;  1E8X A;  2MRP A;  3BZD B;  1ZUD 2;  4OZA A;  4BZA A;  3ZUN A;  2V0G A;  1T0S C;  1ZP0 B;  3WAP A;  1L4Z B;  2GBK A;  1KF6 B;  2V1Y A;  2CJO A;  4TQ1 A;  1QF6 A;  3EA6 A;  1UD7 A;  3ML9 A;  1K52 A;  3LB8 C;  2RPV A;  4YSY B;  2D3B A;  3AV8 A;  4CQN A;  3W5U B;  1XD3 B;  4CYE A;  2CHZ A;  1Q10 A;  3B0A A;  4WAA A;  3P4S B;  2SAK A;  3MFG A;  2ZCC A;  1ZPS A;  4QAY A;  2LMC A;  3AE8 B;  4K3B A;  3L4P A;  4EEW A;  3BWU D;  2C7M B;  2AEH A;  3T3O A;  1HXY D;  3V60 A;  4C7Z A;  2NBU A;  4FA6 A;  1JWA D;  4US9 A;  3VFK A;  1LGR A;  2DWQ A;  3VUX A;  3P4R B;  3TCA A;  2L8J A;  4P7I A;  3WAL A;  2INP E;  3DOW A;  2KTR A;  3EFC A;  3LYY A;  3M3J A;  1EWY C;  3NHE B;  3DVG X;  2L83 A;  3RN9 C;  5JH5 C;  2HTM E;  2LUM A;  3SDL C;  3OWE B;  3X0W A;  3GZN B;  2WX1 A;  3BIN A;  4KKI A;  1H8C A;  4NPN A;  1P1A A;  1YX6 B;  1OGW A;  2L0F A;  1UBI A;  4J6I A;  3UIN B;  1H4R A;  2IO2 B;  5FR6 A;  2B3A A;  4F1S A;  3BYT B;  1R4M B;  1WSP A;  2V4L A;  3WCQ A;  1YJI A;  3ECI A;  1TKE A;  3NG0 A;  4HDQ A;  4YXD B;  4HPM B;  2J4X A;  3VR9 B;  3RNA C;  2MJ3 A;  5LLI A;  2MSE D;  1EF5 A;  2C7N B;  3CF6 E;  2I2Y A;  1TZ1 A;  2PEA A;  4EUT A;  2H88 B;  2AL6 A;  3EC8 A;  3VVW B;  1J19 A;  3RNC C;  1WRI A;  2LGD A;  3AI5 A;  3IVF A;  3UIP B;  2KFK A;  3Q8C A;  1FFV A;  3VTW A;  1C3T A;  2ICI A;  4KKJ A;  1L4D B;  3R3M A;  3TEW A;  1GOZ A;  4ZRQ A;  2NR2 A;  3RNF C;  4BKT A;  3RT3 B;  3VXW A;  1WJU A;  3KWV A;  5D3D A;  2TSS A;  2LD9 A;  3IHP C;  2KX0 A;  3GS2 A;  3TEZ A;  5HG2 A;  3T3N A;  1WXS A;  1V1P A;  1MG4 A;  1ZDV A;  4RGN A;  3OLM D;  4BVU C;  4ZRP A;  2WXH A;  2IYD B;  3GE8 C;  5J17 A;  1KLU D;  3FIL A;  2NVU I;  2QDF A;  3Q8B A;  1PQS A;  4AS1 A;  2XK5 A;  3PZ8 A;  3B2F A;  2EKI A;  2O6V B;  4KIK A;  1QOG A;  4KX6 B;  3RMK C;  2ZCB A;  1VZ6 A;  4BKS A;  1WE7 A;  2YEP F;  1T3Q A;  1E0Z A;  4WWN A;  1ISN A;  2NTS A;  1TBE A;  1WGK A;  2LHD A;  2KMA A;  3WAN A;  4BOZ B;  4RF1 A;  4FJV B;  2D3G A;  2JT4 B;  4IC7 B;  3U4E G;  3Q8E A;  1KFY B;  1WY8 A;  2CS4 A;  5BYS A;  2M19 A;  5E6P A;  3MHZ A;  2PVO D;  3P4P B;  3QIJ A;  3N20 C;  2BB6 A;  3Q3J A;  3IAS 1;  1HQR D;  5C1Z A;  1HEZ E;  3N30 A;  3ZNZ B;  3SFD B;  2PKO A;  4FHK A;  4WH4 A;  1HTQ A;  2JQR B;  2Y3A A;  5HFY A;  3B2G A;  3J9C A;  4XWT A;  2WDQ B;  3VAW A;  1FNV A;  2N9K A;  2RD0 A;  1YNT E;  2BKR B;  3ZRF A;  2ASQ A;  3EUB 2;  4DXG A;  5FR3 A;  3P42 A;  2DAF A;  2N9L A;  1TZO A;  3AN1 A;  1F2R C;  4HCN B;  5BMI A;  1WX8 A;  2MWS B;  2KDE B;  2WXJ A;  4LNI A;  5EE9 A;  3ZW3 A;  4HDO A;  1KOT A;  3B08 A;  1YQ3 B;  1OQQ A;  1IP9 A;  4B6W A;  4A90 A;  2KFJ A;  3AEG B;  2YLM A;  5D2M B;  4A55 A;  3ZJU A;  2IPK D;  1MG8 A;  1WYG A;  3NVV A;  2FUH B;  2WS3 B;  4J3O D;  2MEK A;  1N61 A;  1J7B A;  2KQ7 A;  2N7J A;  5HHD G;  3PRP B;  2L3Z A;  4OVU A;  1GB4 A;  2PE9 A;  1JRU A;  1YQ4 B;  3MHS D;  2R61 A;  2LUE A;  2KVR A;  4NNJ B;  4YTN B;  3QJZ A;  3PTF C;  3NZS A;  2D11 A;  4N59 A;  4GMV A;  4ANW A;  4BKG A;  2CKH B;  4IM3 A;  4RGM A;  3ABV B;  1WM2 A;  1N5W A;  1V5T A;  2DLB A;  2X38 A;  2QIE B;  1EM7 A;  1XLP A;  1XLQ A;  2W3S A;  2G9H D;  4ZHO A;  2H89 B;  1LO5 D;  2OJW A;  3ZNG C;  3AEB B;  3OG5 A;  4RF0 A;  2FCS A;  2LVQ A;  3QQ8 B;  3DHI C;  2MBE A;  3APD A;  4RNA A;  4KZC A;  4DXA B;  4B95 A;  4ASW C;  2KLG A;  4OZB A;  2PW9 A;  1MHH E;  3L0W B;  3NZU A;  2PE6 B;  4I6P A;  4HJK A;  4NAW A;  1LQB A;  2JVC A;  2KK8 A;  4JLC A;  3L16 A;  2FCQ A;  1FXI A;  2J42 A;  4BBN F;  4HRO A;  2WLB A;  1CJE A;  4G0N B;  1RAX A;  3ZTC A;  1P3Q U;  4IM0 A;  4HVB A;  1QZE A;  3AE7 B;  3KVF B;  2VRR B;  4RFB A;  2EMT A;  3N1X C;  1N6Z A;  4M01 A;  4AUQ C;  1KTK A;  3M95 A;  2K8H A;  5H8Y E;  3HM6 X;  1V2Y A;  5AZG A;  5DPR A;  3RYT A;  5H92 C;  2MHJ A;  1WXQ A;  4MAC A;  3NS8 A;  1YN3 A;  3MC9 A;  2UU7 A;  4NAM A;  4JE3 B;  4ACF A;  3OJ3 A;  5CHV C;  4CHK A;  4DDI D;  2FCM A;  1SXT A;  4E71 A;  2Z0E B;  1T6B X;  2KKC A;  4H2A A;  1HZ6 A;  4XE0 A;  1ACC A;  3RPF C;  2ON8 A;  1I42 A;  2W54 A;  4AWJ A;  4NJ7 A;  2RR9 A;  4AOF A;  4WJN A;  3VH4 B;  2HE7 A;  2K8C A;  2NS5 A;  3DBH B;  4FHJ A;  5JZE B;  3RD2 A;  3HRD D;  1N5X A;  1TKY A;  4IUM B;  4BOS C;  1SIF A;  3C19 A;  1FM0 D;  3AXC A;  2EKE C;  4L2Y A;  3KW5 B;  4WWP A;  3IBE A;  2UWQ A;  2ZPY A;  1C77 A;  4LNF A;  1SJE D;  4W9D A;  1DGJ A;  3KWL A;  2PLP A;  4FJZ A;  1ZXH A;  3A33 B;  2K9X A;  2MBQ A;  1UEL A;  4ANU A;  3QWZ B;  4LNK A;  4YT0 B;  4YTP B;  3PPA A;  5L83 A;  2W3R A;  3QA8 A;  1FCL A;  2WP9 B;  2MX2 A;  3JSV A;  4BBN C;  4WJP A;  3RUI B;  3ZRC A;  2D5G A;  1GG3 A;  4YTM B;  4GDK B;  1WMH B;  1P9D U;  4TUU A;  1OFF A;  1EU4 A;  4K7U A;  2L76 A;  1J7A A;  1FNU A;  4ZHP A;  4MH0 E;  2HJ8 A;  3DBS A;  3AMZ A;  3AEC B;  2QJL A;  5DPW A;  1RWS A;  5AUI A;  4WJQ A;  1VDV A;  1FIQ A;  1R4N I;  3CIR B;  4JGH B;  4JWU C;  1PDX A;  4MT5 A;  2ZVN A;  1L7Y A;  2DZK A;  5DPT A;  2NMQ A;  2OED A;  3UF8 A;  1QKZ A;  4KZ0 A;  3KQ4 A;  1PGX A;  2YVC A;  2NPT A;  1E90 A;  3APF A;  3K9O B;  1BUI C;  4PS8 A;  3VHT C;  5MPO A;  1CQV A;  4LDT B;  2K25 A;  2AWT A;  3DCG A;  2NPT B;  5JXV A;  1I4P A;  1TS4 A;  3X23 A;  3TL5 A;  2WNM A;  3U7D A;  2HTH A;  1F2R I;  3A1Q A;  3L13 A;  4KDL B;  1FPY A;  1XEE A;  3U7Z A;  1WJ4 A;  1MVK A;  3NS1 A;  2BKF A;  2V3P A;  2D3C A;  2LVO A;  3GB1 A;  3RNG C;  2NBV B;  4GXB A;  1E8W A;  2KDM A;  5CHF A;  1I4R A;  2BYT A;  4YSZ B;  3PLU A;  3KUC B;  3B9J A;  1SE2 A;  3JW0 X;  1TJE A;  1YMH E;  4E3C A;  1WJ6 A;  1WMH A;  3AE3 B;  1F0Z A;  1RYJ A;  3QAR A;  2BF8 B;  1Y8R C;  2BBC A;  3DBH I;  2MQJ A;  1L0Y B;  2Z0D B;  4OVZ A;  1C4C A;  1RRB A;  1I7H A;  3ZVV A;  2IY1 B;  4G50 A;  2LVP A;  1VD2 A;  5EDS A;  3PRM B;  3AU5 A;  4FAD A;  1L0X B;  3AED B;  3LDZ E;  1E6E B;  4GIV A;  3EEC A;  4W9K A;  3BYY B;  1Q5W B;  3H1U A;  2WXP A;  5LXI B;  3L10 B;  4CO7 A;  4JIO U;  3PHX B;  3U8Z A;  2L05 A;  4EOY A;  4NQL B;  2A4Z A;  1VR9 A;  3N1Y C;  1IYF A;  3NRZ A;  4IWQ A;  1WYW B;  3ENE A;  1TY2 A;  4K81 A;  1N60 A;  2MBB B;  1S1Q B;  2JY6 A;  3DQV A;  3AE9 B;  1VRA B;  2VH1 A;  3DPD A;  3W1S A;  2WXQ A;  3SD5 A;  1OQR A;  1SSN A;  1DOI A;  5DCN A;  5EE0 A;  4C56 C;  1UF0 A;  2LZ6 A;  3D32 A;  1SE4 A;  4A6Q A;  5BMG A;  4XDC A;  4TV3 A;  2C60 A;  1D5Z C;  5TR5 A;  1NBF C;  2R2O A;  1FO4 A;  2O6V D;  2IJ0 A;  2WU5 B;  2K5P A;  1FRR A;  1UGM A;  2MA9 B;  3UQB A;  4DXF A;  2BYF A;  4DBG A;  1AYF A;  2CU3 A;  3DWG C;  5AZH A;  2KO3 A;  3IFW B;  4ZRI A;  2N0S B;  4LLG M;  2V3S A;  2EMS A;  1WXV A;  2WWZ A;  2KC1 A;  4ANV A;  5L95 C;  2V3N A;  1A5R A;  1F1H A;  1VCB A;  1N63 A;  4ICU A;  2WYQ A;  1G6J A;  2GLS A;  3PSE B;  5IN7 A;  4NAW B;  1V5O A;  1S3S G;  1T0Y A;  4KDI C;  1TS5 A;  2FBW B;  1WGY A;  3A9J B;  1MFW A;  1ZOY B;  3AE4 B;  3U2S C;  1E7V A;  1WR1 A;  2WX0 A;  3AM9 A;  3V61 A;  4MSM B;  5EE1 A;  2LGY A;  2ZW0 A;  3AH7 A;  2IO1 B;  2D3A A;  4GDL A;  2D07 B;  2K6D B;  4S0R A;  1V8C A;  4K7S A;  2HJ1 A;  3NJT A;  1HZ5 A;  4RGO S;  2N4F A;  2IO0 B;  3NVW A;  2KZR A;  1JWB D;  3I57 A;  2KWU B;  4UDU C;  4A20 A;  1E5W A;  3H6N A;  2KX3 A;  3TEY A;  4RCO A;  1ZDX A;  4PK1 A;  3TUO A;  3VTU A;  2Y5B B;  2JF5 A;  3BY4 B;  2WDV B;  4I6L B;  2GMI C;  4F8C B;  3ETR A;  2QIL A;  3HVD A;  4USA A;  1IBX A;  4ZYN A;  1OEY A;  3PS6 A;  1GPX A;  1KJT A;  2JXX A;  5D6J B;  1D5X C;  1QOA A;  4WWM A;  3KH0 A;  2N1W A;  2LJ5 A;  2L32 A;  3HM3 A;  1R4M I;  4WIP A;  2KTF A;  1JW9 D;  3DBL B;  3A4S C;  2WXI A;  1KLG D;  2BGF A;  1YN5 A;  5D7G A;  4P6V F;  1M4V A;  4DHZ E;  1WI0 A;  3W5V B;  3MJ5 A;  2BS2 B;  4DWF A;  3APC A;  2BT6 A;  2BVC A;  2PVG C;  3H9D A;  1SJH D;  4LDT D;  3Q8F A;  4TMA B;  3PT2 B;  3LXF A;  1JRO A;  2WHI A;  3SU8 X;  1VZ7 A;  3P63 A;  4EFO A;  2FID A;  2NCN A;  4JQW C;  2WU2 B;  3I5J C;  4MGI E;  4DHJ B;  2MCN B;  3PO0 A;  1C4A A;  1YX5 B;  2LXC A;  4L1B A;  1WFY A;  1YD8 U;  5G2N A;  3R2T A;  2LGX A;  3QAQ A;  1CK1 A;  1SBB B;  2K39 A;  2D2Q A;  3FAH A;  2B76 B;  4Q2J A;  2AQ1 B;  1F77 A;  3BVZ A;  2KOX A;  3PRZ A;  1I4X A;  2LGS A;  4B9K A;  4MGY E;  3NY5 A;  2ACZ B;  2CHW A;  4GDL B;  3VUW A;  4ARI A;  2KQS A;  1C9F A;  3E56 A;  3AE1 B;  3QX1 A;  4IWP A;  3A9J A;  2WDT B;  3HVZ A;  2MBH A;  2LAS A;  2XNA C;  3R2I A;  1NVI D;  2N1V A;  5J18 A;  1VLB A;  2V9H A;  1JCK B;  2WXN A;  2V4I B;  1ZGU B;  4KIK B;  3GP7 A;  4XWW A;  4W9E A;  2IGH A;  2RDB C;  2JZ3 B;  3A4R A;  2N9E B;  1ZW7 A;  3DVG Y;  4AQ7 A;  4HEA 1;  1CMX B;  3FIL B;  3ZNH B;  2KHW B;  1P98 A;  4N9F 4;  1VJK A;  2K0P A;  2KJR A;  2JX5 A;  5C3J B;  2N9P C;  1V9J A;  4GGQ A;  1I35 A;  2M4N A;  5LNK 1;  2IO3 B;  2BYV E;  2GBR A;  2L7R A;  5TSS A;  5IKC M;  3GE3 C;  4MH8 A;  5E6N A;  1GC6 A;  2WXM A;  1L6U A;  2AX5 A;  4IW0 A;  5BMH A;  2LRU A;  1XLO A;  2I38 A;  2J0J A;  3PGE A;  1C79 A;  1E7P B;  1ET9 A;  1YIW A;  4AJY B;  3IT6 B;  4HWI B;  1YJJ A;  3ZQ4 A;  2PIA A;  5BO4 B;  3AE5 B;  4HPP A;  2WXF A;  4MEL A;  3KYC D;  2C5L C;  3Q2A C;  4GU2 A;  1YOV B;  4GSW A;  4LTU A;  3GZN I;  3DVN U;  3AU4 A;  1FEH A;  1TS2 A;  3URY A;  5LXH A;  3Q3M C;  2DX5 B;  3ZGZ A;  3SHQ A;  1FCC C;  2KT7 A;  1CZP A;  3RI7 C;  4LJO B;  4MDK E;  5D94 A;  4TQ0 A;  3FC4 A;  1IPG A;  1C1Y B;  1RLF A;  1WXM A;  4XX5 A;  1JWS D;  3TEX A;  3ALB A;  1WH3 A;  4B0M A;  2JUO A;  2REX A;  5JHA A;  3IT4 B;  4FN2 A;  4II3 B;  2JRI B;  1IBX B;  2IGD A;  1PFD A;  2BYE A;  3PV1 A;  3M63 B;  1MJD A;  1L2N A;  4GOC A;  3OJ4 B;  4ITK A;  4C00 A;  3M62 B;  3W2D A;  3BVM A;  3P4Q B;  3RNE C;  2RGF A;  1E8Z A;  3V3X A;  1DOY A;  1V80 A;  2GRI A;  2LGI A;  2DZI A;  3CST A;  2KTR B;  5FK9 C;  1TIF A;  4MJS B;  2JZP A;  4LNN A;  2IND C;  1YN4 A;  5IAA C;  3A9K B;  2J53 A;  3VRA B;  2IZV B;  1WGG A;  5DPS A;  1WIA A;  1UBQ A;  1ZKH A;  5C23 A;  1YQB A;  2A5U A;  3VUY A;  3DDC B;  4M0W A;  3W1S C;  3ZDM C;  4US8 A;  1XF5 L;  2RDH A;  4B0E A;  2OJR A;  2BS3 B;  4ICV A;  1WJN A;  1P0R A;  1EO6 A;  1T5X D;  1C78 A;  2DZM A;  3UIO B;  1FMA D;  4KGT A;  2ZPN A;  4ZRJ A;  5AZF A;  2KAC A;  2WGS A;  1TS3 A;  4NJ6 A;  4A8X C;  2VH2 A;  4BAX A;  4EZJ A;  4X57 B;  4N58 A;  4DHJ D;  4RGT A;  3WAO A;  3DBR B;  3ML8 A;  1QIL A;  1TT5 B;  2BPS A;  4M8N A;  1A70 A;  4XZ4 A;  2M0X A;  3KLS X;  4MEM A;  2MJD A;  2I1J A;  2QC8 A;  4GDK A;  3C0R B;  1MPE A;  3Q3O C;  4NQK E;  3JSV B;  3ZJT A;  1DYQ A;  1GC7 A;  2KAN A;  3Q8A A;  2J52 A;  4F7Z A;  1SEB D;  1MHX A;  3RZF A;  3P1M A;  2KVZ A;  3DHG C;  1OTR B;  2DBY A;  1J0G A;  2KDI A;  3AUL A;  3BVG A;  3AEF B;  1FXT B;  3EGR A;  3T9L A;  2KAJ A;  2G4S A;  2CU1 A;  2JWZ A;  1JWU D;  2G4D B;  2JXT A;  2KJH B;  2HDE A;  4FJY A;  2VZK B;  1BML C;  3W1Y A;  3RUL A;  2ZJD A;  3MJW A;  3TJP A;  4WQM A;  4K3C A;  4IOI E;  3U30 A;  3I3T B;  4A9A A;  1GUA B;  2KXJ A;  4HK2 A;  2SEB D;  1JRP A;  3N32 A;  1NEK B;  3BK1 A;  2GBN A;  1N62 A;  1UGJ A;  1EU3 A;  4ZRK A;  2G1E A;  3BII D;  3SR6 A;  2FAZ A;  1TGZ B;  2ONQ A;  2Z59 B;  1QT9 A;  1RFA A;  2W9N A;  2L0T A;  2X8X X;  3N3K B;  2JWU A;  1V1O A;  3ONS A;  1J7C A;  1UNS A;  4A3O A;  3E9S A;  1QLB B;  5CTR C;  4FBJ B;  1ESF A;  3PHW B;  3DBR I;  2CHX A;  3TIX A;  4WWO A;  1KLV A;  5J2R A;  3HK0 A;  3PZD A;  4NZL B;  4GN1 A;  4E74 A;  3Q6B A;  3QC8 B;  1WF9 A;  2GBJ A;  4OW0 A;  1PUT A;  1HE8 A;  2GB1 A;  3OAW A;  2KN5 A;  1WZ3 A;  2MP2 A;  4HKZ E;  1BXT A;  1FNW A;  4P1B C;  3A1Q B;  3DHH C;  3EFU A;  3HUI A;  1DOX A;  1ROE A;  1JML A;  1I4G A;  2AL3 A;  1UWM A;  3R7Q A;  1AN8 A;  4W9J A;  5EE3 A;  4HXD A;  1Z2M A;  3GOE A;  3R8B A;  4P16 A;  2RSU A;  2DNF A;  3O65 B;  3MC8 A;  2ZZP B;  3JYU A;  2J7Q B;  3EHV A;  4PT5 A;  4WAF A;  3PZ7 A;  4K1R B;  1D3Z A;  2WXL A;  2KNB A;  1ZE3 D;  3QCA A;  2KMC A;  3IAM 1;  3N1Z C;  1F52 A;  1T0Q C;  2E6X A;  2AYO B;  2D10 A;  3L08 A;  2K3U A;  3R66 C;  1F9J A;  5G55 A;  4C4V A;  1I4H A;  2IY0 B;  2KYW A;  1E9M A;  1XLN A;  1WXA A;  2R2Q A;  1WX7 A;  4RMA A;  1Y56 A;  2BW2 A;  4W9G A;  3V62 A;  1PGB A;  1XQQ A;  3CSF A;  3ZDT A;  5JHB A;  3AEA B;  2WXG A;  4LK0 M;  1V49 A;  4PYZ A;  1K53 A;  1L6V A;  4ZOH C;  1GNU A;  1JQ4 A;  1EWC A;  2JYE A;  2K6Q A;  2DYM A;  1TYG B;  2M17 A;  4EE2 A;  1D4B A;  1PYW D;  1XCT L;  4ANX A;  4HCP B;  1JAL A;  1HA5 A;  1X1M A;  2M0A A;  3Q3F A;  1XCQ L;  1C76 A;  4IDI A;  5KHO A;  4M02 A;  1L5P A;  1E8Y A;  2Y5C A;  2DEN B;  3PVL A;  5FKA C;  2Z8L A;  3I9V 1;  3ZIM A;  4DQO C;  5IO9 A;  1P7F A;  4KSL C;  1WM3 A;  2L1A A;  3R7R A;  1KRH A;  1UWX A;  4DK5 A;  2AQ2 B;  3ZYY X;  1Q0W B;  1EF1 A;  4EKU A;  4D2K A;  1I4Q A;  2JRH A;  2KN4 A;  2K8B A;  5BYR A;  5T8I A;  3TSS A;  1GAQ B;  4KGS A;  3ZJV A;  1GB1 A;  3P2B A;  4KGR A;  2JU6 X;  3PLV A;  3NVY A;  4M00 A;  2MJE A;  3RCZ A;  2IBI B;  5IOI A;  4WUR A;  5GXG B;  4K7W A;  3DVN V;  1NYR A;  2L52 A;  4TSS A;  4WJO A;  4DDG D;  1QOF A;  1QOB A;  1WGR A;  1NEN B;  2Y5P A;  4ARC A;  2LJI A;  4FXC A;  1K50 A;  5CX3 A;  2XBB C;  3WAM A;  1MI0 A;  2BB5 A;  1R7S A;  2XN9 C;  2W82 A;  3UGB B;  1OEY J;  1V86 A;  2O2V A;  2LWP A;  3VH3 B;  2ZNV C;  4PYU A;  1Q1O A;  3B1L X;  2KC2 A;  5IA7 A;  3V05 A;  4S17 A;  3Q69 A;  1RM6 C;  4L23 A;  2QHO A;  3PRE A;  2CR5 A;  2FUG 1;  2M8S A;  4WQO B;  4YWG G;  1UUP A;  3FKY A;  2C7H A;  2LHE A;  3RFZ B;  2GBM A; 
#chains in the Genus database with same CATH homology
 1FIQ A;  3ZGZ A;  1FCC C;  3CIR B;  5HI1 A;  4JWU C;  1CZP A;  4KKI A;  1PDX A;  4MT5 A;  4TQ0 A;  3FC4 A;  1TY0 A;  5I4D A;  2NMQ A;  2OED A;  2IDY A;  1QKZ A;  1JWS D;  3KQ4 A;  1PGX A;  3TEX A;  1BUI C;  5MPO A;  2M56 B;  4B0M A;  1CQV A;  3C8Y A;  3BYT B;  3IT4 B;  1WSP A;  5JXV A;  1V1P B;  3WCQ A;  1YJI A;  1IBX B;  2IGD A;  1I4P A;  1TKE A;  1PFD A;  1TS4 A;  3SEB A;  2WNM A;  4C7Y A;  4OZC A;  1QQR A;  5G5G A;  4YXD B;  4ZYS A;  2J4X A;  1F2R I;  3VR9 B;  4ITK A;  1XEE A;  3W2D A;  4HKQ A;  1JWM D;  3U7Z A;  3BVM A;  2MJ3 A;  2KWD A;  2LFI A;  3P4Q B;  1SE3 A;  1MVK A;  3NS1 A;  4JWS C;  2MH7 A;  2V3P A;  3V3X A;  3GB1 A;  1DOY A;  2I2Y A;  2H88 B;  2DYO A;  2KDM A;  1TKG A;  2GRI A;  2LGI A;  2EEL A;  1FFU A;  1I4R A;  2BYT A;  1L0V B;  4YSZ B;  2QEJ C;  5FK9 C;  3B9J A;  1SE2 A;  1TJE A;  2JZP A;  1WRI A;  1YMH E;  1ET6 A;  1YN4 A;  3AE3 B;  1F0Z A;  1RYJ A;  1SF0 A;  2J53 A;  3Q8C A;  3VRA B;  1FFV A;  2WDR B;  2ICI A;  1ENF A;  2BBC A;  4KKJ A;  1L4D B;  3TEW A;  1GOZ A;  1L0Y B;  3AE2 B;  4ZRQ A;  4OVZ A;  1C4C A;  1I7H A;  4M0W A;  3KWV A;  5D3D A;  2TSS A;  1XF5 L;  4US8 A;  2RDH A;  1L0X B;  4B0E A;  3AED B;  2BS3 B;  1E6E B;  2IGG A;  3TEZ A;  3GS2 A;  3T3N A;  5HG2 A;  1T5X D;  1C78 A;  3BYY B;  1V1P A;  1FMA D;  1ZDV A;  3BK2 A;  4RGN A;  1B1Z A;  2WXP A;  4ZRP A;  1K51 A;  2WXH A;  4KGT A;  2Q5W D;  2KAC A;  1KLU D;  3FIL A;  4GLS C;  3Q8B A;  1TS3 A;  5C2T B;  4AS1 A;  4A8X C;  4R3D A;  3U52 E;  1VR9 A;  3PZ8 A;  4N58 A;  4RGT A;  3NRZ A;  3B2F A;  2EKI A;  1QOG A;  4KX6 B;  1VZ6 A;  1QIL A;  1TY2 A;  2YEP F;  1N60 A;  1A70 A;  1T3Q A;  1E0Z A;  3NVZ A;  3AE9 B;  1VRA B;  2QSD A;  3W1S A;  2WXQ A;  2NTS A;  1IUE A;  2OHF A;  2W55 A;  1WGK A;  2LEK A;  3VRB B;  2LHD A;  1OQR A;  1SSN A;  3KLS X;  1DOI A;  4RF1 A;  5EE0 A;  2MJD A;  3U4E G;  4C56 C;  3Q8E A;  1KFY B;  5BYS A;  2M19 A;  3AE6 B;  2VZK D;  1MPE A;  2BS4 B;  3MHZ A;  2PVO D;  3P4P B;  1SE4 A;  3ZJT A;  4A6Q A;  5BMG A;  4XDC A;  2BB6 A;  2FE8 A;  1D5Z C;  2QMT A;  1DYQ A;  1RFK A;  3IAS 1;  1HQR D;  1STE A;  1HEZ E;  2JSV X;  2J52 A;  3Q8A A;  1SEB D;  1MHX A;  1FO4 A;  3SFD B;  3N9Y C;  2IJ0 A;  3P1M A;  2PKO A;  2WU5 B;  2DBY A;  2K5P A;  4WH4 A;  2JQR B;  2WXR A;  4O1N A;  2Y3A A;  1FRR A;  3BVG A;  3AEF B;  5HFY A;  3B2G A;  3EGR A;  2KAJ A;  3J9C A;  4DXF A;  4XWT A;  2WDQ B;  1AYF A;  1JWU D;  2CU3 A;  3DWG C;  5D3I B;  1FNV A;  2N9K A;  2JXT A;  2PMV A;  1YNT E;  5BYQ A;  3EUB 2;  4DXG A;  5FR3 A;  2N0S B;  3P42 A;  4LLG M;  1FRD A;  2N9L A;  2HDE A;  3W9C B;  1TZO A;  3AN1 A;  1F2R C;  1KH0 A;  2INN E;  2VZK B;  1BML C;  5BMI A;  4WQM A;  2V3N A;  4IOI E;  2WXJ A;  4A9A A;  1D6E C;  2NTT A;  5EE9 A;  2SEB D;  2JYT A;  1JRP A;  1N63 A;  1NEK B;  2WXK A;  1FXA A;  1C4P A;  1YQ3 B;  1OQQ A;  4A90 A;  3AEG B;  3BK1 A;  4C80 A;  4NAW B;  4A55 A;  1N62 A;  3ZJU A;  2IPK D;  1UGJ A;  1TS5 A;  2FBW B;  1ZOY B;  1EU3 A;  1WYG A;  3AE4 B;  1XO3 A;  3NVV A;  2G1E A;  2WS3 B;  2WXO A;  3BII D;  4J3O D;  2MEK A;  3SR6 A;  3U2S C;  1N61 A;  1J7B A;  3AM9 A;  1B9R A;  2ONQ A;  5EE1 A;  2N7J A;  5HHD G;  2GI9 A;  2ZW0 A;  1QT9 A;  3AH7 A;  1XXG A;  1NYQ A;  1GB4 A;  1YQ4 B;  2ZW1 A;  1FD6 A;  2R61 A;  4IKG A;  2JWU A;  1V1O A;  4YTN B;  1J7C A;  1V8C A;  1UNS A;  1AWD A;  3E9S A;  1WWT A;  1HZ5 A;  1QLB B;  4RGO S;  2RMM A;  1ESF A;  3MP9 A;  4N59 A;  1E10 A;  3NVW A;  4NZL B;  2K22 A;  2E3T A;  1JWB D;  2KMM A;  3I57 A;  4UDU C;  1IGD A;  4OW0 A;  4RGM A;  1PUT A;  3ABV B;  1SB3 C;  1N5W A;  4REZ A;  2GB1 A;  3TEY A;  2KQ4 X;  2DLB A;  2X38 A;  4HKZ E;  4RCO A;  1BXT A;  1FNW A;  1ZDX A;  2QIE B;  3TUO A;  1EM7 A;  1XLP A;  2WDV B;  1AW7 A;  3HUI A;  1DOX A;  1XLQ A;  1ROE A;  2W3S A;  2G9H D;  3ETR A;  1JML A;  2QIL A;  1I4G A;  3HVD A;  4ZHO A;  1UWM A;  2BTE A;  1AN8 A;  2H89 B;  1LO5 D;  3CWI A;  4USA A;  3UI3 A;  1IBX A;  3AEB B;  4RF0 A;  5EE3 A;  3AEE B;  1PGA A;  5E6J A;  1VZ8 A;  1P7E A;  1GPX A;  4XDD A;  3R8B A;  4MM3 B;  3O13 A;  4P16 A;  1D5X C;  3AB5 A;  4RNA A;  1QOA A;  4WWM A;  2L32 A;  4PT5 A;  3VR8 B;  4RH6 A;  3IXS A;  3PZ7 A;  4WAF A;  4WIP A;  4OZB A;  1JW9 D;  2PW9 A;  2WXL A;  1MHH E;  1V97 A;  4JX1 C;  3SFE B;  2WXI A;  1KLG D;  1ZE3 D;  4JPS A;  5D7G A;  1YN5 A;  3IAM 1;  3H8H A;  4P6V F;  2E6X A;  1M4V A;  3W5V B;  2WQY B;  3MJ5 A;  2K3U A;  3VQI A;  2BS2 B;  1I4H A;  2BT6 A;  1FXI A;  1E9M A;  2PVG C;  2J42 A;  1XLN A;  4HRO A;  1ZXI A;  2WLB A;  1CJE A;  1SJH D;  1Y56 A;  2CJN A;  3Q8F A;  2BW2 A;  4TMA B;  3LXF A;  1JRO A;  1PGB A;  3AEA B;  1VZ7 A;  2PTL A;  3P63 A;  2WXG A;  4LK0 M;  2WU2 B;  1K53 A;  3AE7 B;  1L6V A;  3PO0 A;  1C4A A;  4ZOH C;  4L1B A;  4OHJ A;  4RFB A;  1JQ4 A;  1EWC A;  3R2T A;  2JYE A;  2DYM A;  1TYG B;  1KTK A;  3NZ3 A;  4N6E B;  1CK1 A;  5H8Y E;  4EE2 A;  1D4B A;  1PYW D;  1SBB B;  1XCT L;  1SIJ A;  3FAH A;  5H92 C;  2B76 B;  1JAL A;  1HA5 A;  1WXQ A;  4Q2J A;  2M0A A;  2AQ1 B;  4MAC A;  4NJC A;  1F77 A;  1XCQ L;  1C76 A;  3BVZ A;  4IDI A;  1YN3 A;  5AUK A;  1L5P A;  1I4X A;  2AQ3 B;  2Y5C A;  4NAM A;  4JE3 B;  4HJG E;  3NUH B;  5G5H A;  5FKA C;  2Z8L A;  3I9V 1;  2ACZ B;  1NI3 A;  1SXT A;  4GDL B;  2RDG A;  4ARI A;  4DQO C;  4YSX B;  1C9F A;  1T6B X;  3DWM A;  3E56 A;  3AE1 B;  1P7F A;  1D5M C;  3MC0 B;  4H2A A;  1HZ6 A;  3HVZ A;  1ACC A;  2XNA C;  2L1A A;  4XE0 A;  3RPF C;  1KRH A;  1UWX A;  2ON8 A;  3R2I A;  2YEP B;  1NVI D;  2AQ2 B;  1VLB A;  2W54 A;  4HRS A;  1IGC A;  3ZYY X;  1JCK B;  2WXN A;  3BZD B;  2V4I B;  1ZUD 2;  4OZA A;  4D2K A;  3GP7 A;  1I4Q A;  1N5X A;  1TKY A;  2KN4 A;  3HRD D;  4XWW A;  2V0G A;  2IGH A;  1ZP0 B;  1L4Z B;  5BYR A;  1KF6 B;  5T8I A;  1FM0 D;  3TSS A;  1GAQ B;  4KGS A;  3ZJV A;  2CJO A;  4TQ1 A;  1GB1 A;  1QF6 A;  4AQ7 A;  4HEA 1;  3FIL B;  3EA6 A;  4L2Y A;  4KGR A;  1K52 A;  2JU6 X;  3LB8 C;  1C77 A;  2RPV A;  3NVY A;  4YSY B;  2MJE A;  1VJK A;  2K0P A;  1SJE D;  3AV8 A;  4CQN A;  2JX5 A;  4WUR A;  5GXG B;  5C3J B;  1DGJ A;  3KWL A;  2PLP A;  3W5U B;  1ZXH A;  5LNK 1;  2K9X A;  1NYR A;  2L52 A;  4TSS A;  5TSS A;  1Q10 A;  3P4S B;  2SAK A;  3MFG A;  4MH8 A;  1QOF A;  1QOB A;  1ZPS A;  1NEN B;  2LMC A;  4YT0 B;  2WXM A;  1L6U A;  2AX5 A;  3AE8 B;  4YTP B;  2Y5P A;  3L4P A;  5BMH A;  2LJI A;  1XLO A;  4ARC A;  4FXC A;  1K50 A;  2I38 A;  3BWU D;  2W3R A;  1MI0 A;  2BB5 A;  1C79 A;  1HXY D;  3T3O A;  1R7S A;  2XN9 C;  2W82 A;  2WP9 B;  1FCL A;  1E7P B;  4C7Z A;  1JWA D;  4US9 A;  1ET9 A;  2DWQ A;  2D5G A;  4YTM B;  4GDK B;  3IT6 B;  3P4R B;  1YJJ A;  1OFF A;  2PIA A;  3ZQ4 A;  1EU4 A;  3V05 A;  1J7A A;  1FNU A;  3AE5 B;  2INP E;  4ZHP A;  2WXF A;  3Q69 A;  3LYY A;  1RM6 C;  4L23 A;  1EWY C;  2L83 A;  2FUG 1;  3AMZ A;  2HTM E;  2LUM A;  2QJL A;  3AEC B;  4YWG G;  1UUP A;  3OWE B;  4LTU A;  1RWS A;  5AUI A;  2LHE A;  3RFZ B;  1FEH A;  1TS2 A;  1VDV A;  3URY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...