2RPQA

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 2
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rpqA00
3KVFB 2JPHA 4EZKA 1C3TA 1WX7A 4ANVA 3QARA 3VHTC 3ONSA 2FUHB 3DBLI 2LJ5A 3ZNHB 2N7EA 2O6VD 4PS7A 3VXWA 3RZWC 1TZ1A 2KTFA 3L0WB 2KFKB 3M62B 3QQ8B 3BY4B 2KJRA 4MGYE 2LVQA 3PSEB 5CTRC 3A1QB 3DBHI 5AZHA 2EKEC 3R7RA 1M94A 1L7YA 1EO6A 1WXMA 3OLMD 4M8NA 2LWPA 2OJRA 2REXA 4IM2A 4IM3A 2DZKA 3GOEA 4LCDE 4ANXA 4RMAA 1E7UA 4W9LA 4X57B 3DVGX 5LXHA 2N9EB 2JT4B 4MM3A 1V2YA 5G55A 2AL6A 2YLMA 1WX8A 4MELA 2AYOB 4WWNA 2NPTB 3VUXA 4BKTA 2LZ6A 2WYQA 5AZFA 3ECIA 1WZ0A 2KD0A 4GSWA 3MJWA 4TUUA 2HE7A 1WI0A 3OJ3A 1LM8B 1IP9A 3EC8A 3ZW3A 2J0MA 3TJPA 2KWVB 1FXTB 4IC7B 1MG8A 4J6IA 4B6WA 3AU4A 2KO3A 3T9LA 2FAZA 4KZCA 4WAAA 4IM0A 4EEWA 5TR5A 4EZLA 3ZDMC 3B0AA 4M8MA 1IPGA 2LRWA 4G3XB 4ANWA 3UIOB 2MSED 2ZPYA 4LJOB 1LQBA 4NY0A 4IW0A 3QHTA 2ZCCA 4OVUA 1X1MA 4K7WA 4KIKB 2WWZA 1T0YA 2KZRA 1TTNA 2WDTB 4HVBA 2NCNA 3NOBA 4EUTA 1WR1A 5L95C 4BOZB 2L05A 1TBEA 2LVOA 4P7IA 5IAAC 3RZFA 3N3KB 2D2QA 4KDIC 3BINA 1TGZB 2K6QA 2GOWA 2LRUA 3QC8B 1VD2A 2KC1A 2R2QA 4GB9A 4ICUA 1WMHA 5G2NA 5AEKB 1KLVA 2BYFA 2JZZA 1SE9A 2UYZB 2LGYA 3SD5A 1WXSA 2KKCA 3KYDD 3L17A 2IBIB 4GOCA 2DYOA 2LXAA 2ZVNA 3I3TB 2NVUI 3SHQA 3ENEA 2W9NA 1JRUA 3Q3JA 4BVUC 2GBMA 4JIOU 2KOXA 4CO7A 2Z59B 2ZNVC 3PS6A 4MSQB 4GIVA 3IVFA 5E6NA 4A20A 1YX6B 4W9FA 2JXXA 3WANA 1WGDA 3QAQA 2ZJDA 4WJQA 2FIFA 2J7QB 4FULA 2DYBA 4W9DA 4LJPB 4W9HA 2L8JA 4JQWC 4NQKE 1U4AA 4WJOA 4DHJB 3ML8A 4K81A 1V81A 2EMSA 2G4SA 2UWQA 3P2BA 4GDKA 2RGFA 4DBGA 2RR9A 3AULA 3W1SC 2KK8A 2GMIC 2NBUA 2LD9A 3X0WA 1Q0WB 2BWES 4G50A 5C23A 2HTHA 1OEYA 4GDLA 4K7UA 4E74A 3VDZA 3ZRFA 4II2B 3VTUA 4KDLB 2BKFA 5J2RA 1WXAA 2NS5A 2KHWB 4EZJA 5DPTA 2BGFA 3UIPB 2V4LA 3CSTA 2A5UA 4W9IA 5HKHA 4HLEA 4DXAB 2JWZA 3A9KA 2I1JA 2KXJA 3N32A 1YIWA 2KWUB 4DHZE 3ZDTA 3PRPB 1WM2A 3JW0X 4I6LB 3QJZA 3UQBA 2B3AA 3L13A 4NJ6A 3WAPA 1UH6A 4LDTB 2WX0A 3H1UA 3VH4B 1GG3A 1PQSA 3QWZB 5D6JB 3ZLZA 1EF1A 2G3QB 1WX9A 1WYWB 4XC2A 2N4FA 1UBIA 4TQ0A 2RPQA 3L54A 3LJ3A 3ZKJC 4B9KA 2JF5A 2KLGA 3DPDA 4NAWB 3AXCA 2MBOA 1V80A 3ALBA 3KYCD 2AWTA 4PS3A 3PLVA 3V62A 2MCNB 2K6DB 3C0RB 3N30A 4LDTD 4NAWA 4PYUA 5J18A 2KDIA 1LFDA 2MQJA 3APDA 3LDZE 4FJZA 5KHOA 3ZNGC 3SDLC 1YJ1A 2ZNVB 2IZVB 2Z0DB 1KM7A 5CHVC 3TL5A 3VUWA 5CHWA 2LVPA 3WIMA 2MBBB 2ZZPB 4MJSA 2O2VB 2XK5A 3R66C 3PRZA 3VTVA 1Q1OA 2M4NA 3W1YA 3ZRCA 3KH0A 5DPRA 2IYDB 3DBRI 2DYMA 2FNJB 2D11A 4HWIB 3RULA 1UBQA 2BF8B 3V60A 3KUDB 1RAXA 3PREA 2JZ3B 1P0RA 5D94A 4ZRIA 4AOFA 1H4RA 2HD5B 3T8MA 2KANA 4HJKA 1OGWA 2KLCA 4GU2A 3U7DA 3QCAA 5JH5C 5CX3A 2NR2A 3A4RA 4NQLB 5IA7A 1P98A 1R4MI 1A5RA 5EDSA 1WGHA 2MRPA 2XEWA 2Y5BB 4MEMA 2KVRA 1C1YB 4MGZE 4EKUA 3H9DA 3Q3FA 3PPAA 4ANUA 3JYUA 2FCMA 2JY6A 2RD0A 2ZPNA 4HDQA 5JHAA 2MLBA 4ICVA 1WJUA 2R2OA 4WWOA 3QX1A 1RLFA 3TIXA 5DPSA 2PE9A 4ASWC 2BPSA 1F9JA 4E3CA 2BWFA 3ZUNA 2LGXA 1WIAA 2XBBC 3DVNV 4CHKA 3U8ZA 5KHQA 2D07B 3HHMA 3EFUA 1E90A 1YQBA 2N1WA 2N9XA 3QK0A 1G6JA 1WGRA 3DVGY 2CHWA 2LASA 1GC6A 4G11A 2MBHA 3JSVB 2V1YA 3TMPB 3ZTDA 1GC7A 2DENB 1V5TA 4A3PA 2YVCA 1S1QB 2PPHA 4WJNA 3W1SA 3L10B 2KC2A 4I6NB 1ZW7A 3VH3B 4FA6A 4KV2A 4F7ZA 4JL9A 2PEAA 4DK5A 3RUIB 2GBJA 1XT9B 2CKHB 2VRRB 4IWOA 2LXCA 1ISNA 1WJNA 2EMTA 2KX0A 4IUMB 2C9WB 1WZ3A 4HPLB 2BKRB 4JGHB 4NJ7A 4W9CA 4KZ0A 2FCNA 1L2NA 3ZVVA 2CHXA 1WRDB 3H7SA 3PZDA 3CF6E 5L83A 3PHXB 4FN2A 2Z0EB 1GNUA 4BKSA 4KSLC 2JRHA 3A4SC 3R7QA 1K8RB 2FCQA 3H7PA 3X23A 3PRMB 4I6PA 2MA9B 1WGGA 2GBRA 3NZSA 3DCGA 3JSVA 4W9EA 2MP2A 1ZKHA 2M8SA 2D10A 4MH0E 1I35A 4HCNB 5E6PA 4GN1A 4BKGA 1R4NI 1KJTA 4HPMB 3DVNU 2MBEA 2G45B 4JLCA 3MTNB 4IG7B 2C60A 2NPTA 2L76A 2MWSB 5LXIB 1OEYJ 2JUOA 1LXDA 4GXBA 2IO0B 5BO4B 2GBKA 2NBVB 2KTRA 1P9DU 1NI2A 2KDEB 2KDBA 3SU8X 2ZCBA 5D7GA 2GBNA 2DAFA 4YL8A 2DZJA 3DQVA 4KIKA 4BKSD 2KQ7A 3A1QA 3QA8A 3UQAA 3KW5B 4TQ1A 3NS8A 2MP2B 4BBNF 2ZEQA 3HK0A 4DHJD 1YD8U 3ZNZB 2BYVE 3V6EB 3EECA 2MW5A 5D2MB 4IWPA 2AEHA 4KSKC 3RT3B 3VUYA 3APCA 1Z2MA 3V6CB 1GJZA 2QHOA 2KJ6A 2JVCA 2L7RA 2M0XA 3ZTCA 3HM3A 3UGBB 2J0JA 3H6NA 3IHPC 4FJYA 5AZGA 2KN5A 2ASQA 1V5OA 1V86A 4E71A 3VQIA 2D3GA 2DX5B 4BBNC 3WAOA 2KMAA 4FHJA 4F8CB 1CMXB 4NPNA 4HCPB 1S3SG 3VVWB 3QIJA 2LUEA 4K1RB 4ZRKA 5DPWA 3U30A 3OAWA 3UINB 2AL3A 3PHWB 4W9GA 1RRBA 5JZEB 1V9JA 2I1KA 1Q5WB 3M63B 4WQOB 4EFOA 2KFJA 4KVGB 3B08A 3RD2A 1H8CA 2IO1B 4FJVB 4A3OA 3VAWA 3UF8A 4TV3A 4F1SA 5LLIA 4AJYB 2WX1A 4ZDVA 3RYTA 3PV1A 3K9OB 2ZVOA 4OVVA 3A9KB 4ZYNA 4FBJB 5DCNA 1E5WA 1V49A 5GMVA 2A4ZA 2KWCA 3DBSA 4XX5A 2CHZA 2PJHA 3V61A 3ZIMA 3APFA 3HM6X 3PT2B 2IO2B 4GGQA 4AJWA 4DHZB 2KDFB 3AU5A 2LI5A 4DDID 5E6OA 3VTWA 4W9JA 2KX3A 3VFKA 3KUZA 4GDLB 2DZMA 5FR6A 1P3QU 3PTFC 4MGKE 2BYEA 4TKNA 1HE8A 4DWFA 2KFKA 2M17A 2MBQA 2K8CA 3D32A 3ML9A 4AP4C 2L0TA 3PVLA 4RM8A 2LGDA 3DDCB 3HIZA 2MX2A 1RFAA 2N7DA 2DHZA 1E7VA 1WE6A 1KOTA 1WFYA 1ZGUB 3ZO5B 2KTRB 4BFRA 1Y8RC 2FIDA 4B95A 1E8ZA 3L08A 3PGEA 1XQQA 4N9F4 3K9PB 4MJSB 2KJHB 1WR6E 2O6VB 3MHSD 3WAMA 3ZNID 3IFWB 2K8BA 1BT0A 1V6EA 1WXVA 3O65B 1NBFC 1SIFA 2O6VA 3CSFA 4FHKA 1D3ZA 1WE7A 1UZXB 2CS4A 2K8HA 3CMMB 4M0WB 2L0FA 1E8YA 3A33B 1IYFA 1WM3A 4MGIE 2N9PC 1EF5A 4PYZA 3RCZA 3WALA 2M1MA 1YX5B 2DAJA 4CYEA 4DDGD 2V3SA 2KQSA 3DOWA 3H7PB 4FLHA 5C1ZA 2NBWB 1VCBA 5J17A 1UGMA 2OOBB 3GZNI 1WGYA 2RSUA 4NNJB 2IY1B 4IWQA 1J8CA 3L16A 3S2AA 1UELA 4PS8A 4II3B 3IG3A 4AUQC 3KUCB 4GMVA 1AARA 1E8WA 3A9JB 4W9KA 3WA0A 1WY8A 1J0GA 3NY5A 3JVZX 2O2VA 2XK5B 4RM9A 2G4DB 3PLUA 3OJ4B 4K7SA 2IY0B 1Z5SB 3A9JA 4URKA 2N1VA 1EUVB 2JRIB 2L3ZA 4BOSC 3B1LX 2FCSA 1UD7A 2C7HA 2PE6B 4ZRJA 5JHBA 1I42A 2L00B 4MSMB 3M3JA 4WJPA 2K25A 2IO3B 4XZ4A 4HK2A 2CU1A 4WWPA 2K1FA 3TBLD 1WJ6A 2DZIA 4G0NB 2KMCA 4HDOA 3R3MA 1E8XA 4HXDA 2HJ8A 4EOYA 3NHEB 3IBEA 2C5LC 2CR5A 5CHFA 1WH3A 1J19A 4GDKB 1NDDA 1OTRB 3AI5A 1P1AA 3EHVA 1GUAB 4AWJA 2C7MB 2C7NB 2K39A 3M95A 1WF9A 1SGHA 1WMHB 1OQYA 1WJ4A 1XD3B 3TCAA 2KNBA 1QZEA 3NZUA 4MDKE 2J0KA 4FADA
chains in the Genus database with same CATH superfamily
1RYJA 3ZYYX 4ANVA 3ONSA 2FUHB 4BAXA 3Q8AA 2QDFA 3RZWC 4YT0B 1FXIA 1NI3A 3A1QB 5AZHA 3AEEB 3UI3A 2LWPA 1UWXA 2REXA 1EM7A 2K3UA 4OZCA 1ZOYB 2JT4B 1V2YA 4MELA 2NPTB 1IP9A 4TUUA 3EC8A 3ZW3A 3CWIA 1ROEA 3TJPA 2W55A 1MG8A 1F2RI 4B0MA 1YN3A 3BYTB 2FAZA 1EWCA 4IM0A 4WAAA 4Q2JA 3IAS1 2JYTA 4G3XB 3Q3NC 2MSED 3P42A 3UIOB 1LQBA 3QHTA 2X8XX 1X1MA 2BQQA 4K7WA 2W3RA 2WXHA 3RNGC 1F77A 2WDTB 3NOBA 5L95C 3FAHA 2D2QA 4KDIC 3BINA 2K6QA 4ICUA 2R2QA 1KLVA 4GB9A 1SBBB 3SR6A 2LGYA 4XGAB 1WXSA 2ZVNA 3U52E 3MP9A 4IOIE 2KDMA 4RFBA 2TSSA 5FK9C 2J52A 1QT9A 4MSQB 3IVFA 1FRDA 1YX6B 3QAQA 2ZJDA 2FIFA 4FULA 4W9DA 4LJPB 4J3OD 1BUIC 2D3CA 4K81A 1V81A 2XN9C 2EMSA 3LXFA 4DBGA 3W1SC 2GMIC 2NBUA 3X0WA 1KFYB 4RGOS 1A70A 2RDBC 2NS5A 2PIAA 2V4LA 3C19A 5HKHA 2MJDA 2JWZA 3A9KA 1T0RC 1YIWA 4I6LB 1AW7A 3MC9A 3UQBA 3L13A 3Q8EA 2CU3A 1SEBD 2RPVA 2LHDA 4CQNA 1TKEA 1UBIA 3L54A 3LJ3A 3I9V1 3AXCA 3ALBA 2L83A 4YXDB 4YTMB 3MJ5A 4OW0A 3SDLC 2Z0DB 1GB1A 5CHVC 1D5XC 3WIMA 1TYGB 3VTVA 1Q1OA 1TS2A 3AE9B 4A9AA 3ZRCA 2IYDB 3DBRI 2DYMA 2D11A 1RAXA 1CQVA 5JXVA 4ZRIA 5EE1A 4AOFA 1H4RA 4ZHOA 5BYRA 3ZJTA 1E7PB 2ICIA 3U7DA 2JYEA 2LJIA 1DOXA 2MRPA 3KWLA 3L4PA 1HXYD 2XEWA 4KGTA 1E10A 2WP9B 3H9DA 3JYUA 2JY6A 1T6BX 4ICVA 4KKIA 2BPSA 4ZOHC 1MG4A 4E3CA 3ZUNA 2LGXA 3RNFC 1WIAA 3ZJUA 3GZNB 3NJTA 1MPEA 4RGTA 1HTOA 3EFUA 1E90A 1YQBA 4G11A 2CHWA 2NTTA 2KVZA 2MBHA 3JSVB 1M4VA 3ZTDA 1GC7A 1SE2A 2YVCA 4WJNA 2Q5WD 3L10B 3VH3B 2PEAA 1XT9B 4IWOA 2LXCA 1ISNA 1PGBA 5AUIA 1WJNA 2EMTA 2KX0A 2K0PA 2WDQB 4C7YA 1XCQL 4O1NA 3Q8FA 2FCNA 1YJIA 1VZ8A 1WYGA 2QCZA 3NVVA 4TMAB 2JRHA 3A4SC 3R7QA 3H7PA 3X23A 3B2GA 2MA9B 3DWGC 1CK1A 2GBRA 3DCGA 3DWMA 4W9EA 2WNMA 2M8SA 1AN8A 1R4NI 3MC0B 4IKGA 2WS3B 3FILA 1UF0A 1P7EA 3W2DA 1LXDA 5BO4B 1TJEA 2GBKA 5C2TB 1NI2A 2KQ4X 4XDDA 2Y5CA 1JRPA 1DYQA 2UU7A 4YL8A 2DZJA 1IGCA 1L4DB 1YNTE 1WRIA 4TQ1A 2ZW1A 2ZEQA 1V97A 3HK0A 1QILA 1V8CA 1YD8U 3ZNZB 1FPYA 3P4RB 5D2MB 3TUOA 2AEHA 4KSKC 3RT3B 1GJZA 5AZGA 4FJYA 2E6XA 2BB5A 1R4MB 3WAOA 4FHJA 1I4GA 3SFEB 3VVWB 2ACZB 3U30A 3M63B 4WQOB 2DLBA 1H8CA 2PLPA 4A3OA 3VAWA 4MACA 1KLGD 1QOFA 3RNEC 3UF8A 4F1SA 2WX1A 2FE8A 3RYTA 1RM6C 2WLBA 1EU4A 3KWVA 2XNAC 2WXJA 5IN7A 1V49A 5BMIA 2KWCA 3ZIMA 2CHZA 2PJHA 1HQRD 3HM6X 4GGQA 1IGDA 2KDFB 4RF0A 3VFKA 4K3CA 1OQQA 1FO4A 4MGKE 4DWFA 2MBQA 1L6UA 2K8CA 3D32A 3PVLA 4RM8A 3HIZA 1ZGUB 3ZO5B 2FIDA 3L08A 4BZAA 1NEKB 1WXVA 4JPSA 2AQ3B 1D3ZA 3CMMB 2K8HA 3HRDD 3EGRA 1YX5B 5C1ZA 1R7SA 2NBWB 2WXMA 1VCBA 2KYWA 1WGYA 3L16A 1LGRA 3A9JB 1WY8A 1J0GA 3NY5A 2XK5B 1QOGA 2G4DB 3PLUA 4RF1A 2N1VA 1EUVB 2AQ2B 2FCSA 2JSVX 5HHDG 2PE6B 3N1XC 5H8YE 4JX1C 5EE9A 4WJPA 2FBWB 2IO3B 2QSDA 3PZ8A 5D3IB 2K1FA 2N9LA 3TBLD 3BK1A 1FNUA 1N6ZA 3IBEA 2C5LC 1TY2A 3PO0A 2CR5A 3MHZA 1BXTA 3AI5A 2AX5A 2K39A 1WMHB 4C00A 4B0EA 3GE8C 1QZEA 4RNAA 2WXPA 2J0KA 3P4SB 1XEEA 2M56B 3DBLI 2O6VD 4PS7A 3VXWA 2KFKB 3QQ8B 4OHJA 3BWUD 4DQOC 4MGYE 2E3TA 5CTRC 1EO6A 5BYQA 2OJRA 4IM3A 3GOEA 1E7UA 1JALA 1YN4A 1I4HA 5G55A 2AL6A 4BKTA 3T3OA 3VUXA 2LZ6A 2WYQA 3ECIA 2KD0A 2L52A 3MJWA 2J0MA 1JMLA 2KWVB 1FXTB 3FC4A 4KZCA 4A8XC 3E9SA 3P63A 3B0AA 2LRWA 4ANWA 4NY0A 4IW0A 2MJEA 3HUIA 4KIKB 1TTNA 4HVBA 1CJEA 4P7IA 1P7FA 1TGZB 1VD2A 1WMHA 2WXIA 2JZZA 2KKCA 4LTUA 2I2YA 2INNE 3I3TB 2NVUI 1TY0A 3ENEA 3Q3JA 1VZ6A 4US8A 4M0WA 2WGSA 2ZNVC 3ZXVA 4GIVA 1I4RA 4L1BA 3WANA 5IOIA 1C78A 4DXFA 4A90A 1FIQA 4W9HA 4WJOA 1ZXIA 4NQKE 4DHJB 3ML8A 2G4SA 2UWQA 2LD9A 2QILA 2BWES 2WU5B 2PVOD 3VDZA 3ZRFA 3VTUA 4KDLB 3R8BA 1WXAA 4EZJA 3UIPB 3V3XA 3CSTA 2KT7A 4KX6B 2D3BA 2K5PA 2KXJA 3N32A 1L0YB 3U4EG 3C8YA 2KWUB 3ZDTA 1DOYA 1N5WA 1XLQA 1B1ZA 1TKGA 5G5HA 1DGJA 1ET6A 1HEZE 4XC2A 2N4FA 1MHXA 1GPXA 5AUKA 2WDVB 4TSSA 1XLOA 3KYCD 4PS3A 3V62A 2MCNB 3URYA 3N30A 4LDTD 4PYUA 5J18A 1I4XA 2OHFA 2KDIA 3APDA 5KHOA 4FJZA 1YJ1A 2ZNVB 4PK1A 1ZDXA 4K3BA 3TSSA 2IDYA 3B2FA 3W1YA 3KH0A 5DPRA 2V9HA 2BF8B 3AE7B 3KUDB 1SXTA 2Z8LA 1P0RA 5D94A 3W5VB 4GU2A 1C4CA 3QCAA 5IA7A 1P98A 1R4MI 5EDSA 1JW9D 3DBLB 2FCMA 2ZPNA 4HDQA 2W82A 2BB6A 2L1AA 2MLBA 2R2OA 3NVYA 1FFUA 4WWOA 1RLFA 1V1OA 3TIXA 2PE9A 4ASWC 1F9JA 2J4XA 2KMMA 3U8ZA 3HHMA 1G6JA 2YEPB 4ARCA 1BMLC 2OJWA 3VRBB 1S1QB 2PMVA 1ZW7A 4JL9A 1MI0A 4WQMA 3RUIB 4DK5A 1YJJA 3SEBA 2FUG1 2LFIA 2IJ0A 4HPLB 1WZ3A 2BKRB 4JGHB 4KGSA 2W54A 1WRDB 1Y56A 4BKSA 3ETRA 2JXTA 1WGGA 4NZLB 4PT5A 2N0SB 4ZRQA 1I35A 3DHIC 4HCNB 4GN1A 2BS2B 2MHJA 4MT5A 1JWAD 2MBEA 2G45B 4JLCA 4IG7B 1F0ZA 1QOBA 2NPTA 2L76A 1OEYJ 2JUOA 3N1YC 2NBVB 4LK0M 2KTRA 1P9DU 2KDEB 3U2SC 3AEGB 2GBNA 3DQVA 4KIKA 4BKSD 2KQ7A 3QA8A 3NS8A 4BBNF 2AQ1B 4DHJD 3BYYB 3CIRB 2LMCA 3V6EB 1Z2MA 2VZKD 3ABVB 2KN5A 2K22A 2JZPA 3R2IA 2BTEA 1CMXB 1VDVA 1T3QA 4K1RB 1XXGA 3OAWA 3UINB 4A55A 1RRBA 4A6QA 4L23A 2WXRA 4XE0A 3B08A 4TV3A 4EE2A 1QOAA 1LO5D 4USAA 3Q14C 4ZDVA 3VR9B 3K9OB 2ON8A 4ACFA 1FNVA 2ZVOA 5HI1A 4US9A 4ZYNA 2A4ZA 4XX5A 1JWBD 4DHZB 3I57A 1SSNA 1JWMD 5BYSA 2VH1A 5FR6A 1P3QU 4KGRA 1HE8A 2KFKA 4XWWA 2M17A 3ML9A 2I38A 1FCCC 1FNWA 1RFAA 2DHZA 2N7DA 1WE6A 1KOTA 2HJ1A 4B95A 3AMZA 1XQQA 3ZXRA 1V1PA 2GRIA 2KJHB 2O6VB 3ZNID 3IFWB 2K8BA 1V6EA 1NBFC 1SIFA 2O6VA 4FHKA 4M0WB 4RCOA 2MH7A 1EF5A 3DHGC 3WALA 4CYEA 4DDGD 2V3SA 2KQSA 2IGDA 3DOWA 3RI7C 1UGMA 3BVMA 3MC8A 2OOBB 3GZNI 2HDEA 3IAM1 2RSUA 4NNJB 2IY1B 1J8CA 3HVDA 1XF5L 4PS8A 2H88B 5C3JB 3P4QB 1PGAA 4AUQC 4GMVA 1E8WA 1JCKB 4RM9A 2IY0B 2L3ZA 2C7HA 3P4PB 4ZRJA 2L00B 4ZYSA 1I4PA 1R4NB 2K25A 4HK2A 2CU1A 1XLPA 4HKQA 3FKYA 3J9CA 1WJ6A 1YOVB 1ESFA 4G0NB 1FEHA 4HDOA 4WWMA 2HJ8A 2EELA 5CHFA 1WH3A 1ZPSA 1OTRB 1XCTL 3AE5B 3EHVA 1GUAB 2C7MB 2C7NB 3M95A 1WF9A 1SGHA 1WSPA 1HTQA 4YTPB 3TCAA 3FILB 2ONQA 3NZUA 3VH4B 3KVFB 3TEYA 4EZKA 1C3TA 1WX7A 1SE3A 3BVGA 4AS1A 3QARA 1VRAB 3VHTC 1NENB 2LJ5A 3ZNHB 4N6EB 3M62B 2N9KA 3BY4B 3PSEB 3LB8C 3EFCA 3DBHI 1C76A 2EKEC 3R7RA 2J53A 3OLMD 4HRSA 4ZHPA 3AECB 4LCDE 1MJDA 1F52A 2MJ3A 4RMAA 3Q3MC 4ANXA 4X57B 3RMKC 1SF0A 3DVGX 1N5XA 2N9EB 4MM3A 2YLMA 2X38A 4WWNA 1D4BA 2PVGC 2SAKA 5AZFA 2WXQA 4GSWA 2HE7A 1WI0A 5D3DA 1LM8B 3P1MA 2GI9A 4J6IA 2KO3A 4EEWA 3HVZA 4EZLA 3ZDMC 4M8MA 1IPGA 1T0SC 3AM9A 4LJOB 4OVUA 2KZRA 3AEDB 1WR1A 2L05A 2OEDA 3N3KB 3QC8B 1EWYC 2KC1A 1K51A 4D2KA 1IBXB 1SE9A 2UYZB 3SD5A 2RDGA 1QQRA 4GOCA 2DYOA 1D6EC 2B76B 4HROA 3NVZA 3LYYA 2W9NA 1JRUA 4JIOU 1XO3A 1ZDVA 1AYFA 2Z59B 3N20C 2GLSA 5E6NA 4A20A 2N7JA 4W9FA 2JXXA 3RNBC 2GB1A 2L8JA 4JQWC 3P2BA 4GDKA 2G1EA 1UGJA 2RR9A 3AULA 2KK8A 1Q0WB 2IPKD 5C23A 4E74A 4K7UA 4C4VA 4LNIA 3VRAB 4II2B 2KHWB 5DPTA 4C4VB 3T3NA 4W9IA 1NYRA 4DXAB 3V05A 4DHZE 1F1HA 3PRPB 3JW0X 3ZJVA 3W5UB 4NJ6A 3WAPA 2Y5PA 4LDTB 2WX0A 3H1UA 3AV8A 3QWZB 1PFDA 5D6JB 5IP4D 4HKZE 1WX9A 3RNCC 1WYWB 4YSZB 1V1PB 2MBOA 1V80A 2AWTA 1YMHE 4ARIA 3C0RB 4NAWA 5EE3A 3LDZE 2WXKA 3ZNGC 2IZVB 1KM7A 3VUWA 5CHWA 4HPPA 1ZP0B 2D3AA 2ZZPB 4MJSA 2O2VB 1TKYA 4IDIA 3WCQA 2FNJB 4HWIB 3RULA 3PREA 2JZ3B 2KANA 2MEKA 2RDHA 1FCLA 4HJKA 2KLCA 5CX3A 3A4RA 1A5RA 1FD6A 1J7CA 2Y5BB 2V4IB 4MEMA 1C1YB 5E6JA 4MGZE 4ANUA 5JHAA 2RD0A 4WAFA 1WJUA 2V3NA 2BWFA 4LNFA 3DVNV 3E56A 4CHKA 5KHQA 3N1ZC 4REZA 2N9XA 1SE4A 2INDC 1WGRA 4FXCA 2LASA 1GC6A 2WXLA 4A3PA 1SB3C 1MFWA 3RFZB 4FA6A 4KV2A 4F7ZA 1I7HA 1C79A 2R61A 3IT6B 2WDRB 4IUMB 4M02A 4NJ7A 4KZ0A 3BK2A 3ZVVA 3NVWA 2WXGA 3PZDA 1B9RA 5L83A 3PHXB 4LNNA 4KSLC 1K8RB 2G9HD 4I6PA 4DXGA 3NZSA 3JSVA 4XWTA 4M01A 2D10A 5E6PA 4BKGA 1KJTA 1N63A 1XLNA 3MTNB 2C60A 5LXIB 2QMTA 2IO0B 3TEZA 2WHIA 4LLGM 2KDBA 3SU8X 5FR3A 2ZCBA 5D7GA 4HEA1 2DAFA 1IUEA 3GP7A 3NG0A 1GB4A 2PW9A 1I4QA 4H2AA 2BVCA 3VR8B 3KW5B 3UQAA 2MP2B 2M19A 4GLSC 3GE3C 2BYVE 2EKIA 4UDUC 3EECA 3VUYA 1E0ZA 2JQRB 1UNSA 2M0XA 2J0JA 3Q6BA 2ASQA 1V5OA 2D3GA 2DX5B 3BZDB 4F8CB 1ZXHA 4HCPB 2LGSA 3B9JA 3QIJA 2LUEA 4ZRKA 4W9GA 2I1KA 1Q5WB 1VLBA 2KFJA 4KVGB 5TSSA 3NUHB 2IO1B 3PZ7A 1STEA 3AEBB 2JWUA 5LLIA 5T8IA 4M00A 4OVVA 3OG5A 1K53A 1YN5A 5GMVA 3V61A 5BMHA 1VZ7A 1N60A 1C4AA 4DDID 5MPOA 4W9JA 1OQRA 3KUZA 4GDLB 3PTFC 4JWUC 1HZ5A 2LGDA 3DDCB 1KH0A 1C77A 1KRHA 3KQ4A 3AE6B 5FKAC 1WFYA 2LEKA 1ACCA 1L6VA 3PGEA 4JE3B 4N9F4 3WAMA 3MHSD 1PUTA 3GB1A 4YSYB 3IT4B 1BT0A 3O65B 1ET9A 3AEAB 4P1BC 1UZXB 2LUMA 1L5PA 2L0FA 3A33B 4MGIE 4P16A 3RCZA 2M1MA 1WWTA 1PGXA 3H7PB 4FLHA 5J17A 2YEPF 1NVID 3S2AA 3MFGA 1UELA 4II3B 3IG3A 3KLSX 1PYWD 1AARA 1RFKA 3JVZX 4K7SA 3OJ4B 1F2RC 1Z5SB 4URKA 2JRIB 4BOSC 3B1LX 2QC8A 5JHBA 3Q2AC 4MSMB 1D5ZC 2ZW0A 2QJLA 2DZIA 2KMCA 4AQ7A 3R3MA 1E8XA 4HXDA 4EOYA 3NHEB 1J19A 4S17A 1NDDA 2WXOA 1OQYA 1WJ4A 5I4DA 1XD3B 2KNBA 4MDKE 4FADA 2JPHA 3TEWA 3AEFB 2N7EA 1TZ1A 2KTFA 3L0WB 3NS1A 2KJRA 3RPFC 2LVQA 1AWDA 2LGIA 1M94A 1L7YA 2QIEB 1WXMA 1ZUD2 4M8NA 2WXNA 1SJHD 4IM2A 2DZKA 2BW2A 2KACA 4W9LA 4MM3B 2M0AA 5LXHA 1D5MC 4WIPA 4N59A 3ZGZA 1WX8A 2AYOB 1WZ0A 3OJ3A 3I63C 4IC7B 3DBHB 3AU4A 3T9LA 4B6WA 1T5XD 5TR5A 1KF6B 4C56C 2ZPYA 2ZCCA 1E6EB 1IBXA 2WWZA 1T0YA 2V3PA 2NCNA 4EUTA 4BOZB 1TBEA 2LVOA 1ENFA 2RMMA 5IAAC 1C4PA 4LNOA 3RZFA 2GOWA 3EUB2 2LRUA 5AEKB 5G2NA 2BYFA 2WXFA 3KYDD 3L17A 2IBIB 2LXAA 4RGNA 4HJGE 3SHQA 3R2TA 4BVUC 2GBMA 5BMGA 2KOXA 4CO7A 1JROA 3PS6A 2CJNA 1VR9A 2DNFA 1WGDA 4WJQA 2J7QB 2DYBA 1U4AA 2LHEA 5LNK1 2RGFA 1TS3A 4G50A 2HTHA 1OEYA 4GDLA 1TS5A 2JU6X 2BKFA 1K52A 2BGFA 2BS3B 5H92C 2A5UA 4HLEA 2I1JA 3TEXA 1N62A 1WM2A 4RGMA 3QJZA 1FXAA 2B3AA 2VZKB 1UH6A 1GG3A 1PQSA 4QAYA 3ZLZA 1EF1A 2G3QB 4TQ0A 2RPQA 1RWSA 4B9KA 3ZKJC 1NYQA 2JF5A 2KLGA 3DPDA 4ITKA 4NAWB 2NMQA 3PLVA 1J7AA 2K6DB 3AN1A 2BT6A 1LFDA 1EU3A 2MQJA 2INCC 2D5GA 3TL5A 5HG2A 2DBYA 1FMAD 2LVPA 1VJKA 2MBBB 2XK5A 3R66C 3PRZA 2M4NA 4WH4A 3AE8B 4NJCA 1T0QC 1TS4A 1UBQA 1TZOA 3V60A 4YTNB 3SFDB 3T8MA 2HD5B 5IKCM 1OGWA 5JH5C 2NR2A 4NQLB 3ZQ4A 5HFYA 5G5GA 1WGHA 1UUPA 2WU2B 2KVRA 3Q69A 4P1CC 1PDXA 4EKUA 4BFRA 3Q3FA 3PPAA 1JWSD 3QX1A 5DPSA 3NZ3A 4YSXB 4P6VF 2XBBC 1J7BA 1SJED 4OZAA 2D07B 2N1WA 3QK0A 3DVGY 3RNAC 4NAMA 2V1YA 3TMPB 2DENB 1V5TA 2PPHA 3W1SA 1KLUD 2KC2A 4I6NB 4WURA 5J2RA 2GBJA 2CKHB 2VRRB 4XDCA 2NTSA 2C9WB 4W9CA 1L2NA 1GOZA 2BYTA 2INPE 2CHXA 3H7SA 3CF6E 4FN2A 2Z0EB 1GNUA 1SIJA 2FCQA 2H89B 3PRMB 4LNKA 2MP2A 1ZKHA 4MH0E 1DOIA 2KWDA 3AH7A 4HPMB 2WQYB 3DVNU 3AE2B 2MWSB 4GXBA 4R3DA 1ZE3D 1JWUD 3DBRB 3I5JC 3A1QA 1QKZA 5IO9A 4S0RA 2MW5A 4IWPA 1OFFA 3APCA 3V6CB 3Q3OC 2QHOA 2KJ6A 2JVCA 2L7RA 3ZTCA 3DHHC 3HM3A 3UGBB 3H6NA 3IHPC 4YWGG 4C7ZA 4ZRPA 1V86A 4E71A 3VQIA 4BBNC 2KMAA 3IXSA 4NPNA 1S3SG 3AB5A 5DPWA 1L0XB 2AL3A 3PHWB 5JZEB 1L4ZB 1V9JA 4EFOA 2PKOA 3RD2A 1FM0D 2Y3AA 4FJVB 1YQ4B 4AJYB 1TT5B 2VH2A 3PV1A 3Q8CA 3U7ZA 2K9XA 3O13A 1FRRA 3A9KB 3RN9C 4RH6A 5DCNA 1E5WA 4JWSC 4FBJB 3DBSA 1KTKA 3APFA 3PT2B 2IO2B 2W3SA 1YQ3B 2CJOA 4AJWA 3AU5A 2LI5A 4KKJA 5E6OA 3VTWA 3H8HA 2KX3A 2QEJC 1WXQA 2DZMA 3AE4B 4TKNA 2BYEA 2HTME 4AP4C 2L0TA 1WGKA 4OVZA 2MX2A 1E7VA 1E9MA 1FFVA 2KTRB 1Y8RC 1E8ZA 3NRZA 3K9PB 4MJSB 1WR6E 2JX5A 2KN4A 4C80A 3CSFA 2IGHA 1WE7A 5EE0A 1Q10A 2CS4A 4MH8A 1E8YA 1IYFA 1WM3A 2KAJA 2N9PC 2V0GA 1CZPA 4PYZA 4L2YA 3AE1B 2DAJA 2BS4B 1L0VB 2J42A 2SEBD 4IWQA 3BVZA 2DWQA 1JQ4A 4N58A 3AE3B 3KUCB 3WA0A 4OZBA 1HZ6A 4W9KA 1N61A 2L32A 2O2VA 3GS2A 3A9JA 1TIFA 1UWMA 3EA6A 1K50A 1UD7A 3Q8BA 1I42A 3M3JA 1MVKA 4XZ4A 4WWPA 1QLBB 2PTLA 4XYCA 5GXGB 1C9FA 3BIID 3N9YC 1HA5A 2IGGA 4GDKB 4AWJA 1P1AA 2BBCA 3W9CB 1QF6A 3OWEB 1MHHE 1GAQB
chains in the Genus database with same CATH topology
3KVFB 2JPHA 4EZKA 1C3TA 1WX7A 4ANVA 3QARA 3VHTC 3ONSA 2FUHB 3DBLI 2LJ5A 3ZNHB 2N7EA 2O6VD 4PS7A 3VXWA 3RZWC 1TZ1A 2KTFA 3L0WB 2KFKB 3M62B 3QQ8B 3BY4B 2KJRA 4MGYE 2LVQA 3PSEB 5CTRC 3A1QB 3DBHI 5AZHA 2EKEC 3R7RA 1M94A 1L7YA 1EO6A 1WXMA 3OLMD 4M8NA 2LWPA 2OJRA 2REXA 4IM2A 4IM3A 2DZKA 3GOEA 4LCDE 4ANXA 4RMAA 1E7UA 4W9LA 4X57B 3DVGX 5LXHA 2N9EB 2JT4B 4MM3A 1V2YA 5G55A 2AL6A 2YLMA 1WX8A 4MELA 2AYOB 4WWNA 2NPTB 3VUXA 4BKTA 2LZ6A 2WYQA 5AZFA 3ECIA 1WZ0A 2KD0A 4GSWA 3MJWA 4TUUA 2HE7A 1WI0A 3OJ3A 1LM8B 1IP9A 3EC8A 3ZW3A 2J0MA 3TJPA 2KWVB 1FXTB 4IC7B 1MG8A 4J6IA 4B6WA 3AU4A 2KO3A 3T9LA 2FAZA 4KZCA 4WAAA 4IM0A 4EEWA 5TR5A 4EZLA 3ZDMC 3B0AA 4M8MA 1IPGA 2LRWA 4G3XB 4ANWA 3UIOB 2MSED 2ZPYA 4LJOB 1LQBA 4NY0A 4IW0A 3QHTA 2ZCCA 4OVUA 1X1MA 4K7WA 4KIKB 2WWZA 1T0YA 2KZRA 1TTNA 2WDTB 4HVBA 2NCNA 3NOBA 4EUTA 1WR1A 5L95C 4BOZB 2L05A 1TBEA 2LVOA 4P7IA 5IAAC 3RZFA 3N3KB 2D2QA 4KDIC 3BINA 1TGZB 2K6QA 2GOWA 2LRUA 3QC8B 1VD2A 2KC1A 2R2QA 4GB9A 4ICUA 1WMHA 5G2NA 5AEKB 1KLVA 2BYFA 2JZZA 1SE9A 2UYZB 2LGYA 3SD5A 1WXSA 2KKCA 3KYDD 3L17A 2IBIB 4GOCA 2DYOA 2LXAA 2ZVNA 3I3TB 2NVUI 3SHQA 3ENEA 2W9NA 1JRUA 3Q3JA 4BVUC 2GBMA 4JIOU 2KOXA 4CO7A 2Z59B 2ZNVC 3PS6A 4MSQB 4GIVA 3IVFA 5E6NA 4A20A 1YX6B 4W9FA 2JXXA 3WANA 1WGDA 3QAQA 2ZJDA 4WJQA 2FIFA 2J7QB 4FULA 2DYBA 4W9DA 4LJPB 4W9HA 2L8JA 4JQWC 4NQKE 1U4AA 4WJOA 4DHJB 3ML8A 4K81A 1V81A 2EMSA 2G4SA 2UWQA 3P2BA 4GDKA 2RGFA 4DBGA 2RR9A 3AULA 3W1SC 2KK8A 2GMIC 2NBUA 2LD9A 3X0WA 1Q0WB 2BWES 4G50A 5C23A 2HTHA 1OEYA 4GDLA 4K7UA 4E74A 3VDZA 3ZRFA 4II2B 3VTUA 4KDLB 2BKFA 5J2RA 1WXAA 2NS5A 2KHWB 4EZJA 5DPTA 2BGFA 3UIPB 2V4LA 3CSTA 2A5UA 4W9IA 5HKHA 4HLEA 4DXAB 2JWZA 3A9KA 2I1JA 2KXJA 3N32A 1YIWA 2KWUB 4DHZE 3ZDTA 3PRPB 1WM2A 3JW0X 4I6LB 3QJZA 3UQBA 2B3AA 3L13A 4NJ6A 3WAPA 1UH6A 4LDTB 2WX0A 3H1UA 3VH4B 1GG3A 1PQSA 3QWZB 5D6JB 3ZLZA 1EF1A 2G3QB 1WX9A 1WYWB 4XC2A 2N4FA 1UBIA 4TQ0A 2RPQA 3L54A 3LJ3A 3ZKJC 4B9KA 2JF5A 2KLGA 3DPDA 4NAWB 3AXCA 2MBOA 1V80A 3ALBA 3KYCD 2AWTA 4PS3A 3PLVA 3V62A 2MCNB 2K6DB 3C0RB 3N30A 4LDTD 4NAWA 4PYUA 5J18A 2KDIA 1LFDA 2MQJA 3APDA 3LDZE 4FJZA 5KHOA 3ZNGC 3SDLC 1YJ1A 2ZNVB 2IZVB 2Z0DB 1KM7A 5CHVC 3TL5A 3VUWA 5CHWA 2LVPA 3WIMA 2MBBB 2ZZPB 4MJSA 2O2VB 2XK5A 3R66C 3PRZA 3VTVA 1Q1OA 2M4NA 3W1YA 3ZRCA 3KH0A 5DPRA 2IYDB 3DBRI 2DYMA 2FNJB 2D11A 4HWIB 3RULA 1UBQA 2BF8B 3V60A 3KUDB 1RAXA 3PREA 2JZ3B 1P0RA 5D94A 4ZRIA 4AOFA 1H4RA 2HD5B 3T8MA 2KANA 4HJKA 1OGWA 2KLCA 4GU2A 3U7DA 3QCAA 5JH5C 5CX3A 2NR2A 3A4RA 4NQLB 5IA7A 1P98A 1R4MI 1A5RA 5EDSA 1WGHA 2MRPA 2XEWA 2Y5BB 4MEMA 2KVRA 1C1YB 4MGZE 4EKUA 3H9DA 3Q3FA 3PPAA 4ANUA 3JYUA 2FCMA 2JY6A 2RD0A 2ZPNA 4HDQA 5JHAA 2MLBA 4ICVA 1WJUA 2R2OA 4WWOA 3QX1A 1RLFA 3TIXA 5DPSA 2PE9A 4ASWC 2BPSA 1F9JA 4E3CA 2BWFA 3ZUNA 2LGXA 1WIAA 2XBBC 3DVNV 4CHKA 3U8ZA 5KHQA 2D07B 3HHMA 3EFUA 1E90A 1YQBA 2N1WA 2N9XA 3QK0A 1G6JA 1WGRA 3DVGY 2CHWA 2LASA 1GC6A 4G11A 2MBHA 3JSVB 2V1YA 3TMPB 3ZTDA 1GC7A 2DENB 1V5TA 4A3PA 2YVCA 1S1QB 2PPHA 4WJNA 3W1SA 3L10B 2KC2A 4I6NB 1ZW7A 3VH3B 4FA6A 4KV2A 4F7ZA 4JL9A 2PEAA 4DK5A 3RUIB 2GBJA 1XT9B 2CKHB 2VRRB 4IWOA 2LXCA 1ISNA 1WJNA 2EMTA 2KX0A 4IUMB 2C9WB 1WZ3A 4HPLB 2BKRB 4JGHB 4NJ7A 4W9CA 4KZ0A 2FCNA 1L2NA 3ZVVA 2CHXA 1WRDB 3H7SA 3PZDA 3CF6E 5L83A 3PHXB 4FN2A 2Z0EB 1GNUA 4BKSA 4KSLC 2JRHA 3A4SC 3R7QA 1K8RB 2FCQA 3H7PA 3X23A 3PRMB 4I6PA 2MA9B 1WGGA 2GBRA 3NZSA 3DCGA 3JSVA 4W9EA 2MP2A 1ZKHA 2M8SA 2D10A 4MH0E 1I35A 4HCNB 5E6PA 4GN1A 4BKGA 1R4NI 1KJTA 4HPMB 3DVNU 2MBEA 2G45B 4JLCA 3MTNB 4IG7B 2C60A 2NPTA 2L76A 2MWSB 5LXIB 1OEYJ 2JUOA 1LXDA 4GXBA 2IO0B 5BO4B 2GBKA 2NBVB 2KTRA 1P9DU 1NI2A 2KDEB 2KDBA 3SU8X 2ZCBA 5D7GA 2GBNA 2DAFA 4YL8A 2DZJA 3DQVA 4KIKA 4BKSD 2KQ7A 3A1QA 3QA8A 3UQAA 3KW5B 4TQ1A 3NS8A 2MP2B 4BBNF 2ZEQA 3HK0A 4DHJD 1YD8U 3ZNZB 2BYVE 3V6EB 3EECA 2MW5A 5D2MB 4IWPA 2AEHA 4KSKC 3RT3B 3VUYA 3APCA 1Z2MA 3V6CB 1GJZA 2QHOA 2KJ6A 2JVCA 2L7RA 2M0XA 3ZTCA 3HM3A 3UGBB 2J0JA 3H6NA 3IHPC 4FJYA 5AZGA 2KN5A 2ASQA 1V5OA 1V86A 4E71A 3VQIA 2D3GA 2DX5B 4BBNC 3WAOA 2KMAA 4FHJA 4F8CB 1CMXB 4NPNA 4HCPB 1S3SG 3VVWB 3QIJA 2LUEA 4K1RB 4ZRKA 5DPWA 3U30A 3OAWA 3UINB 2AL3A 3PHWB 4W9GA 1RRBA 5JZEB 1V9JA 2I1KA 1Q5WB 3M63B 4WQOB 4EFOA 2KFJA 4KVGB 3B08A 3RD2A 1H8CA 2IO1B 4FJVB 4A3OA 3VAWA 3UF8A 4TV3A 4F1SA 5LLIA 4AJYB 2WX1A 4ZDVA 3RYTA 3PV1A 3K9OB 2ZVOA 4OVVA 3A9KB 4ZYNA 4FBJB 5DCNA 1E5WA 1V49A 5GMVA 2A4ZA 2KWCA 3DBSA 4XX5A 2CHZA 2PJHA 3V61A 3ZIMA 3APFA 3HM6X 3PT2B 2IO2B 4GGQA 4AJWA 4DHZB 2KDFB 3AU5A 2LI5A 4DDID 5E6OA 3VTWA 4W9JA 2KX3A 3VFKA 3KUZA 4GDLB 2DZMA 5FR6A 1P3QU 3PTFC 4MGKE 2BYEA 4TKNA 1HE8A 4DWFA 2KFKA 2M17A 2MBQA 2K8CA 3D32A 3ML9A 4AP4C 2L0TA 3PVLA 4RM8A 2LGDA 3DDCB 3HIZA 2MX2A 1RFAA 2N7DA 2DHZA 1E7VA 1WE6A 1KOTA 1WFYA 1ZGUB 3ZO5B 2KTRB 4BFRA 1Y8RC 2FIDA 4B95A 1E8ZA 3L08A 3PGEA 1XQQA 4N9F4 3K9PB 4MJSB 2KJHB 1WR6E 2O6VB 3MHSD 3WAMA 3ZNID 3IFWB 2K8BA 1BT0A 1V6EA 1WXVA 3O65B 1NBFC 1SIFA 2O6VA 3CSFA 4FHKA 1D3ZA 1WE7A 1UZXB 2CS4A 2K8HA 3CMMB 4M0WB 2L0FA 1E8YA 3A33B 1IYFA 1WM3A 4MGIE 2N9PC 1EF5A 4PYZA 3RCZA 3WALA 2M1MA 1YX5B 2DAJA 4CYEA 4DDGD 2V3SA 2KQSA 3DOWA 3H7PB 4FLHA 5C1ZA 2NBWB 1VCBA 5J17A 1UGMA 2OOBB 3GZNI 1WGYA 2RSUA 4NNJB 2IY1B 4IWQA 1J8CA 3L16A 3S2AA 1UELA 4PS8A 4II3B 3IG3A 4AUQC 3KUCB 4GMVA 1AARA 1E8WA 3A9JB 4W9KA 3WA0A 1WY8A 1J0GA 3NY5A 3JVZX 2O2VA 2XK5B 4RM9A 2G4DB 3PLUA 3OJ4B 4K7SA 2IY0B 1Z5SB 3A9JA 4URKA 2N1VA 1EUVB 2JRIB 2L3ZA 4BOSC 3B1LX 2FCSA 1UD7A 2C7HA 2PE6B 4ZRJA 5JHBA 1I42A 2L00B 4MSMB 3M3JA 4WJPA 2K25A 2IO3B 4XZ4A 4HK2A 2CU1A 4WWPA 2K1FA 3TBLD 1WJ6A 2DZIA 4G0NB 2KMCA 4HDOA 3R3MA 1E8XA 4HXDA 2HJ8A 4EOYA 3NHEB 3IBEA 2C5LC 2CR5A 5CHFA 1WH3A 1J19A 4GDKB 1NDDA 1OTRB 3AI5A 1P1AA 3EHVA 1GUAB 4AWJA 2C7MB 2C7NB 2K39A 3M95A 1WF9A 1SGHA 1WMHB 1OQYA 1WJ4A 1XD3B 3TCAA 2KNBA 1QZEA 3NZUA 4MDKE 2J0KA 4FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVF B;  2JPH A;  4EZK A;  1C3T A;  1WX7 A;  4ANV A;  3QAR A;  3VHT C;  3ONS A;  2FUH B;  3DBL I;  2LJ5 A;  3ZNH B;  2N7E A;  2O6V D;  4PS7 A;  3VXW A;  3RZW C;  1TZ1 A;  2KTF A;  3L0W B;  2KFK B;  3M62 B;  3QQ8 B;  3BY4 B;  2KJR A;  4MGY E;  2LVQ A;  3PSE B;  5CTR C;  3A1Q B;  3DBH I;  5AZH A;  2EKE C;  3R7R A;  1M94 A;  1L7Y A;  1EO6 A;  1WXM A;  3OLM D;  4M8N A;  2LWP A;  2OJR A;  2REX A;  4IM2 A;  4IM3 A;  2DZK A;  3GOE A;  4LCD E;  4ANX A;  4RMA A;  1E7U A;  4W9L A;  4X57 B;  3DVG X;  5LXH A;  2N9E B;  2JT4 B;  4MM3 A;  1V2Y A;  5G55 A;  2AL6 A;  2YLM A;  1WX8 A;  4MEL A;  2AYO B;  4WWN A;  2NPT B;  3VUX A;  4BKT A;  2LZ6 A;  2WYQ A;  5AZF A;  3ECI A;  1WZ0 A;  2KD0 A;  4GSW A;  3MJW A;  4TUU A;  2HE7 A;  1WI0 A;  3OJ3 A;  1LM8 B;  1IP9 A;  3EC8 A;  3ZW3 A;  2J0M A;  3TJP A;  2KWV B;  1FXT B;  4IC7 B;  1MG8 A;  4J6I A;  4B6W A;  3AU4 A;  2KO3 A;  3T9L A;  2FAZ A;  4KZC A;  4WAA A;  4IM0 A;  4EEW A;  5TR5 A;  4EZL A;  3ZDM C;  3B0A A;  4M8M A;  1IPG A;  2LRW A;  4G3X B;  4ANW A;  3UIO B;  2MSE D;  2ZPY A;  4LJO B;  1LQB A;  4NY0 A;  4IW0 A;  3QHT A;  2ZCC A;  4OVU A;  1X1M A;  4K7W A;  4KIK B;  2WWZ A;  1T0Y A;  2KZR A;  1TTN A;  2WDT B;  4HVB A;  2NCN A;  3NOB A;  4EUT A;  1WR1 A;  5L95 C;  4BOZ B;  2L05 A;  1TBE A;  2LVO A;  4P7I A;  5IAA C;  3RZF A;  3N3K B;  2D2Q A;  4KDI C;  3BIN A;  1TGZ B;  2K6Q A;  2GOW A;  2LRU A;  3QC8 B;  1VD2 A;  2KC1 A;  2R2Q A;  4GB9 A;  4ICU A;  1WMH A;  5G2N A;  5AEK B;  1KLV A;  2BYF A;  2JZZ A;  1SE9 A;  2UYZ B;  2LGY A;  3SD5 A;  1WXS A;  2KKC A;  3KYD D;  3L17 A;  2IBI B;  4GOC A;  2DYO A;  2LXA A;  2ZVN A;  3I3T B;  2NVU I;  3SHQ A;  3ENE A;  2W9N A;  1JRU A;  3Q3J A;  4BVU C;  2GBM A;  4JIO U;  2KOX A;  4CO7 A;  2Z59 B;  2ZNV C;  3PS6 A;  4MSQ B;  4GIV A;  3IVF A;  5E6N A;  4A20 A;  1YX6 B;  4W9F A;  2JXX A;  3WAN A;  1WGD A;  3QAQ A;  2ZJD A;  4WJQ A;  2FIF A;  2J7Q B;  4FUL A;  2DYB A;  4W9D A;  4LJP B;  4W9H A;  2L8J A;  4JQW C;  4NQK E;  1U4A A;  4WJO A;  4DHJ B;  3ML8 A;  4K81 A;  1V81 A;  2EMS A;  2G4S A;  2UWQ A;  3P2B A;  4GDK A;  2RGF A;  4DBG A;  2RR9 A;  3AUL A;  3W1S C;  2KK8 A;  2GMI C;  2NBU A;  2LD9 A;  3X0W A;  1Q0W B;  2BWE S;  4G50 A;  5C23 A;  2HTH A;  1OEY A;  4GDL A;  4K7U A;  4E74 A;  3VDZ A;  3ZRF A;  4II2 B;  3VTU A;  4KDL B;  2BKF A;  5J2R A;  1WXA A;  2NS5 A;  2KHW B;  4EZJ A;  5DPT A;  2BGF A;  3UIP B;  2V4L A;  3CST A;  2A5U A;  4W9I A;  5HKH A;  4HLE A;  4DXA B;  2JWZ A;  3A9K A;  2I1J A;  2KXJ A;  3N32 A;  1YIW A;  2KWU B;  4DHZ E;  3ZDT A;  3PRP B;  1WM2 A;  3JW0 X;  4I6L B;  3QJZ A;  3UQB A;  2B3A A;  3L13 A;  4NJ6 A;  3WAP A;  1UH6 A;  4LDT B;  2WX0 A;  3H1U A;  3VH4 B;  1GG3 A;  1PQS A;  3QWZ B;  5D6J B;  3ZLZ A;  1EF1 A;  2G3Q B;  1WX9 A;  1WYW B;  4XC2 A;  2N4F A;  1UBI A;  4TQ0 A;  2RPQ A;  3L54 A;  3LJ3 A;  3ZKJ C;  4B9K A;  2JF5 A;  2KLG A;  3DPD A;  4NAW B;  3AXC A;  2MBO A;  1V80 A;  3ALB A;  3KYC D;  2AWT A;  4PS3 A;  3PLV A;  3V62 A;  2MCN B;  2K6D B;  3C0R B;  3N30 A;  4LDT D;  4NAW A;  4PYU A;  5J18 A;  2KDI A;  1LFD A;  2MQJ A;  3APD A;  3LDZ E;  4FJZ A;  5KHO A;  3ZNG C;  3SDL C;  1YJ1 A;  2ZNV B;  2IZV B;  2Z0D B;  1KM7 A;  5CHV C;  3TL5 A;  3VUW A;  5CHW A;  2LVP A;  3WIM A;  2MBB B;  2ZZP B;  4MJS A;  2O2V B;  2XK5 A;  3R66 C;  3PRZ A;  3VTV A;  1Q1O A;  2M4N A;  3W1Y A;  3ZRC A;  3KH0 A;  5DPR A;  2IYD B;  3DBR I;  2DYM A;  2FNJ B;  2D11 A;  4HWI B;  3RUL A;  1UBQ A;  2BF8 B;  3V60 A;  3KUD B;  1RAX A;  3PRE A;  2JZ3 B;  1P0R A;  5D94 A;  4ZRI A;  4AOF A;  1H4R A;  2HD5 B;  3T8M A;  2KAN A;  4HJK A;  1OGW A;  2KLC A;  4GU2 A;  3U7D A;  3QCA A;  5JH5 C;  5CX3 A;  2NR2 A;  3A4R A;  4NQL B;  5IA7 A;  1P98 A;  1R4M I;  1A5R A;  5EDS A;  1WGH A;  2MRP A;  2XEW A;  2Y5B B;  4MEM A;  2KVR A;  1C1Y B;  4MGZ E;  4EKU A;  3H9D A;  3Q3F A;  3PPA A;  4ANU A;  3JYU A;  2FCM A;  2JY6 A;  2RD0 A;  2ZPN A;  4HDQ A;  5JHA A;  2MLB A;  4ICV A;  1WJU A;  2R2O A;  4WWO A;  3QX1 A;  1RLF A;  3TIX A;  5DPS A;  2PE9 A;  4ASW C;  2BPS A;  1F9J A;  4E3C A;  2BWF A;  3ZUN A;  2LGX A;  1WIA A;  2XBB C;  3DVN V;  4CHK A;  3U8Z A;  5KHQ A;  2D07 B;  3HHM A;  3EFU A;  1E90 A;  1YQB A;  2N1W A;  2N9X A;  3QK0 A;  1G6J A;  1WGR A;  3DVG Y;  2CHW A;  2LAS A;  1GC6 A;  4G11 A;  2MBH A;  3JSV B;  2V1Y A;  3TMP B;  3ZTD A;  1GC7 A;  2DEN B;  1V5T A;  4A3P A;  2YVC A;  1S1Q B;  2PPH A;  4WJN A;  3W1S A;  3L10 B;  2KC2 A;  4I6N B;  1ZW7 A;  3VH3 B;  4FA6 A;  4KV2 A;  4F7Z A;  4JL9 A;  2PEA A;  4DK5 A;  3RUI B;  2GBJ A;  1XT9 B;  2CKH B;  2VRR B;  4IWO A;  2LXC A;  1ISN A;  1WJN A;  2EMT A;  2KX0 A;  4IUM B;  2C9W B;  1WZ3 A;  4HPL B;  2BKR B;  4JGH B;  4NJ7 A;  4W9C A;  4KZ0 A;  2FCN A;  1L2N A;  3ZVV A;  2CHX A;  1WRD B;  3H7S A;  3PZD A;  3CF6 E;  5L83 A;  3PHX B;  4FN2 A;  2Z0E B;  1GNU A;  4BKS A;  4KSL C;  2JRH A;  3A4S C;  3R7Q A;  1K8R B;  2FCQ A;  3H7P A;  3X23 A;  3PRM B;  4I6P A;  2MA9 B;  1WGG A;  2GBR A;  3NZS A;  3DCG A;  3JSV A;  4W9E A;  2MP2 A;  1ZKH A;  2M8S A;  2D10 A;  4MH0 E;  1I35 A;  4HCN B;  5E6P A;  4GN1 A;  4BKG A;  1R4N I;  1KJT A;  4HPM B;  3DVN U;  2MBE A;  2G45 B;  4JLC A;  3MTN B;  4IG7 B;  2C60 A;  2NPT A;  2L76 A;  2MWS B;  5LXI B;  1OEY J;  2JUO A;  1LXD A;  4GXB A;  2IO0 B;  5BO4 B;  2GBK A;  2NBV B;  2KTR A;  1P9D U;  1NI2 A;  2KDE B;  2KDB A;  3SU8 X;  2ZCB A;  5D7G A;  2GBN A;  2DAF A;  4YL8 A;  2DZJ A;  3DQV A;  4KIK A;  4BKS D;  2KQ7 A;  3A1Q A;  3QA8 A;  3UQA A;  3KW5 B;  4TQ1 A;  3NS8 A;  2MP2 B;  4BBN F;  2ZEQ A;  3HK0 A;  4DHJ D;  1YD8 U;  3ZNZ B;  2BYV E;  3V6E B;  3EEC A;  2MW5 A;  5D2M B;  4IWP A;  2AEH A;  4KSK C;  3RT3 B;  3VUY A;  3APC A;  1Z2M A;  3V6C B;  1GJZ A;  2QHO A;  2KJ6 A;  2JVC A;  2L7R A;  2M0X A;  3ZTC A;  3HM3 A;  3UGB B;  2J0J A;  3H6N A;  3IHP C;  4FJY A;  5AZG A;  2KN5 A;  2ASQ A;  1V5O A;  1V86 A;  4E71 A;  3VQI A;  2D3G A;  2DX5 B;  4BBN C;  3WAO A;  2KMA A;  4FHJ A;  4F8C B;  1CMX B;  4NPN A;  4HCP B;  1S3S G;  3VVW B;  3QIJ A;  2LUE A;  4K1R B;  4ZRK A;  5DPW A;  3U30 A;  3OAW A;  3UIN B;  2AL3 A;  3PHW B;  4W9G A;  1RRB A;  5JZE B;  1V9J A;  2I1K A;  1Q5W B;  3M63 B;  4WQO B;  4EFO A;  2KFJ A;  4KVG B;  3B08 A;  3RD2 A;  1H8C A;  2IO1 B;  4FJV B;  4A3O A;  3VAW A;  3UF8 A;  4TV3 A;  4F1S A;  5LLI A;  4AJY B;  2WX1 A;  4ZDV A;  3RYT A;  3PV1 A;  3K9O B;  2ZVO A;  4OVV A;  3A9K B;  4ZYN A;  4FBJ B;  5DCN A;  1E5W A;  1V49 A;  5GMV A;  2A4Z A;  2KWC A;  3DBS A;  4XX5 A;  2CHZ A;  2PJH A;  3V61 A;  3ZIM A;  3APF A;  3HM6 X;  3PT2 B;  2IO2 B;  4GGQ A;  4AJW A;  4DHZ B;  2KDF B;  3AU5 A;  2LI5 A;  4DDI D;  5E6O A;  3VTW A;  4W9J A;  2KX3 A;  3VFK A;  3KUZ A;  4GDL B;  2DZM A;  5FR6 A;  1P3Q U;  3PTF C;  4MGK E;  2BYE A;  4TKN A;  1HE8 A;  4DWF A;  2KFK A;  2M17 A;  2MBQ A;  2K8C A;  3D32 A;  3ML9 A;  4AP4 C;  2L0T A;  3PVL A;  4RM8 A;  2LGD A;  3DDC B;  3HIZ A;  2MX2 A;  1RFA A;  2N7D A;  2DHZ A;  1E7V A;  1WE6 A;  1KOT A;  1WFY A;  1ZGU B;  3ZO5 B;  2KTR B;  4BFR A;  1Y8R C;  2FID A;  4B95 A;  1E8Z A;  3L08 A;  3PGE A;  1XQQ A;  4N9F 4;  3K9P B;  4MJS B;  2KJH B;  1WR6 E;  2O6V B;  3MHS D;  3WAM A;  3ZNI D;  3IFW B;  2K8B A;  1BT0 A;  1V6E A;  1WXV A;  3O65 B;  1NBF C;  1SIF A;  2O6V A;  3CSF A;  4FHK A;  1D3Z A;  1WE7 A;  1UZX B;  2CS4 A;  2K8H A;  3CMM B;  4M0W B;  2L0F A;  1E8Y A;  3A33 B;  1IYF A;  1WM3 A;  4MGI E;  2N9P C;  1EF5 A;  4PYZ A;  3RCZ A;  3WAL A;  2M1M A;  1YX5 B;  2DAJ A;  4CYE A;  4DDG D;  2V3S A;  2KQS A;  3DOW A;  3H7P B;  4FLH A;  5C1Z A;  2NBW B;  1VCB A;  5J17 A;  1UGM A;  2OOB B;  3GZN I;  1WGY A;  2RSU A;  4NNJ B;  2IY1 B;  4IWQ A;  1J8C A;  3L16 A;  3S2A A;  1UEL A;  4PS8 A;  4II3 B;  3IG3 A;  4AUQ C;  3KUC B;  4GMV A;  1AAR A;  1E8W A;  3A9J B;  4W9K A;  3WA0 A;  1WY8 A;  1J0G A;  3NY5 A;  3JVZ X;  2O2V A;  2XK5 B;  4RM9 A;  2G4D B;  3PLU A;  3OJ4 B;  4K7S A;  2IY0 B;  1Z5S B;  3A9J A;  4URK A;  2N1V A;  1EUV B;  2JRI B;  2L3Z A;  4BOS C;  3B1L X;  2FCS A;  1UD7 A;  2C7H A;  2PE6 B;  4ZRJ A;  5JHB A;  1I42 A;  2L00 B;  4MSM B;  3M3J A;  4WJP A;  2K25 A;  2IO3 B;  4XZ4 A;  4HK2 A;  2CU1 A;  4WWP A;  2K1F A;  3TBL D;  1WJ6 A;  2DZI A;  4G0N B;  2KMC A;  4HDO A;  3R3M A;  1E8X A;  4HXD A;  2HJ8 A;  4EOY A;  3NHE B;  3IBE A;  2C5L C;  2CR5 A;  5CHF A;  1WH3 A;  1J19 A;  4GDK B;  1NDD A;  1OTR B;  3AI5 A;  1P1A A;  3EHV A;  1GUA B;  4AWJ A;  2C7M B;  2C7N B;  2K39 A;  3M95 A;  1WF9 A;  1SGH A;  1WMH B;  1OQY A;  1WJ4 A;  1XD3 B;  3TCA A;  2KNB A;  1QZE A;  3NZU A;  4MDK E;  2J0K A;  4FAD A; 
#chains in the Genus database with same CATH topology
 1RYJ A;  3ZYY X;  4ANV A;  3ONS A;  2FUH B;  4BAX A;  3Q8A A;  2QDF A;  3RZW C;  4YT0 B;  1FXI A;  1NI3 A;  3A1Q B;  5AZH A;  3AEE B;  3UI3 A;  2LWP A;  1UWX A;  2REX A;  1EM7 A;  2K3U A;  4OZC A;  1ZOY B;  2JT4 B;  1V2Y A;  4MEL A;  2NPT B;  1IP9 A;  4TUU A;  3EC8 A;  3ZW3 A;  3CWI A;  1ROE A;  3TJP A;  2W55 A;  1MG8 A;  1F2R I;  4B0M A;  1YN3 A;  3BYT B;  2FAZ A;  1EWC A;  4IM0 A;  4WAA A;  4Q2J A;  3IAS 1;  2JYT A;  4G3X B;  3Q3N C;  2MSE D;  3P42 A;  3UIO B;  1LQB A;  3QHT A;  2X8X X;  1X1M A;  2BQQ A;  4K7W A;  2W3R A;  2WXH A;  3RNG C;  1F77 A;  2WDT B;  3NOB A;  5L95 C;  3FAH A;  2D2Q A;  4KDI C;  3BIN A;  2K6Q A;  4ICU A;  2R2Q A;  1KLV A;  4GB9 A;  1SBB B;  3SR6 A;  2LGY A;  4XGA B;  1WXS A;  2ZVN A;  3U52 E;  3MP9 A;  4IOI E;  2KDM A;  4RFB A;  2TSS A;  5FK9 C;  2J52 A;  1QT9 A;  4MSQ B;  3IVF A;  1FRD A;  1YX6 B;  3QAQ A;  2ZJD A;  2FIF A;  4FUL A;  4W9D A;  4LJP B;  4J3O D;  1BUI C;  2D3C A;  4K81 A;  1V81 A;  2XN9 C;  2EMS A;  3LXF A;  4DBG A;  3W1S C;  2GMI C;  2NBU A;  3X0W A;  1KFY B;  4RGO S;  1A70 A;  2RDB C;  2NS5 A;  2PIA A;  2V4L A;  3C19 A;  5HKH A;  2MJD A;  2JWZ A;  3A9K A;  1T0R C;  1YIW A;  4I6L B;  1AW7 A;  3MC9 A;  3UQB A;  3L13 A;  3Q8E A;  2CU3 A;  1SEB D;  2RPV A;  2LHD A;  4CQN A;  1TKE A;  1UBI A;  3L54 A;  3LJ3 A;  3I9V 1;  3AXC A;  3ALB A;  2L83 A;  4YXD B;  4YTM B;  3MJ5 A;  4OW0 A;  3SDL C;  2Z0D B;  1GB1 A;  5CHV C;  1D5X C;  3WIM A;  1TYG B;  3VTV A;  1Q1O A;  1TS2 A;  3AE9 B;  4A9A A;  3ZRC A;  2IYD B;  3DBR I;  2DYM A;  2D11 A;  1RAX A;  1CQV A;  5JXV A;  4ZRI A;  5EE1 A;  4AOF A;  1H4R A;  4ZHO A;  5BYR A;  3ZJT A;  1E7P B;  2ICI A;  3U7D A;  2JYE A;  2LJI A;  1DOX A;  2MRP A;  3KWL A;  3L4P A;  1HXY D;  2XEW A;  4KGT A;  1E10 A;  2WP9 B;  3H9D A;  3JYU A;  2JY6 A;  1T6B X;  4ICV A;  4KKI A;  2BPS A;  4ZOH C;  1MG4 A;  4E3C A;  3ZUN A;  2LGX A;  3RNF C;  1WIA A;  3ZJU A;  3GZN B;  3NJT A;  1MPE A;  4RGT A;  1HTO A;  3EFU A;  1E90 A;  1YQB A;  4G11 A;  2CHW A;  2NTT A;  2KVZ A;  2MBH A;  3JSV B;  1M4V A;  3ZTD A;  1GC7 A;  1SE2 A;  2YVC A;  4WJN A;  2Q5W D;  3L10 B;  3VH3 B;  2PEA A;  1XT9 B;  4IWO A;  2LXC A;  1ISN A;  1PGB A;  5AUI A;  1WJN A;  2EMT A;  2KX0 A;  2K0P A;  2WDQ B;  4C7Y A;  1XCQ L;  4O1N A;  3Q8F A;  2FCN A;  1YJI A;  1VZ8 A;  1WYG A;  2QCZ A;  3NVV A;  4TMA B;  2JRH A;  3A4S C;  3R7Q A;  3H7P A;  3X23 A;  3B2G A;  2MA9 B;  3DWG C;  1CK1 A;  2GBR A;  3DCG A;  3DWM A;  4W9E A;  2WNM A;  2M8S A;  1AN8 A;  1R4N I;  3MC0 B;  4IKG A;  2WS3 B;  3FIL A;  1UF0 A;  1P7E A;  3W2D A;  1LXD A;  5BO4 B;  1TJE A;  2GBK A;  5C2T B;  1NI2 A;  2KQ4 X;  4XDD A;  2Y5C A;  1JRP A;  1DYQ A;  2UU7 A;  4YL8 A;  2DZJ A;  1IGC A;  1L4D B;  1YNT E;  1WRI A;  4TQ1 A;  2ZW1 A;  2ZEQ A;  1V97 A;  3HK0 A;  1QIL A;  1V8C A;  1YD8 U;  3ZNZ B;  1FPY A;  3P4R B;  5D2M B;  3TUO A;  2AEH A;  4KSK C;  3RT3 B;  1GJZ A;  5AZG A;  4FJY A;  2E6X A;  2BB5 A;  1R4M B;  3WAO A;  4FHJ A;  1I4G A;  3SFE B;  3VVW B;  2ACZ B;  3U30 A;  3M63 B;  4WQO B;  2DLB A;  1H8C A;  2PLP A;  4A3O A;  3VAW A;  4MAC A;  1KLG D;  1QOF A;  3RNE C;  3UF8 A;  4F1S A;  2WX1 A;  2FE8 A;  3RYT A;  1RM6 C;  2WLB A;  1EU4 A;  3KWV A;  2XNA C;  2WXJ A;  5IN7 A;  1V49 A;  5BMI A;  2KWC A;  3ZIM A;  2CHZ A;  2PJH A;  1HQR D;  3HM6 X;  4GGQ A;  1IGD A;  2KDF B;  4RF0 A;  3VFK A;  4K3C A;  1OQQ A;  1FO4 A;  4MGK E;  4DWF A;  2MBQ A;  1L6U A;  2K8C A;  3D32 A;  3PVL A;  4RM8 A;  3HIZ A;  1ZGU B;  3ZO5 B;  2FID A;  3L08 A;  4BZA A;  1NEK B;  1WXV A;  4JPS A;  2AQ3 B;  1D3Z A;  3CMM B;  2K8H A;  3HRD D;  3EGR A;  1YX5 B;  5C1Z A;  1R7S A;  2NBW B;  2WXM A;  1VCB A;  2KYW A;  1WGY A;  3L16 A;  1LGR A;  3A9J B;  1WY8 A;  1J0G A;  3NY5 A;  2XK5 B;  1QOG A;  2G4D B;  3PLU A;  4RF1 A;  2N1V A;  1EUV B;  2AQ2 B;  2FCS A;  2JSV X;  5HHD G;  2PE6 B;  3N1X C;  5H8Y E;  4JX1 C;  5EE9 A;  4WJP A;  2FBW B;  2IO3 B;  2QSD A;  3PZ8 A;  5D3I B;  2K1F A;  2N9L A;  3TBL D;  3BK1 A;  1FNU A;  1N6Z A;  3IBE A;  2C5L C;  1TY2 A;  3PO0 A;  2CR5 A;  3MHZ A;  1BXT A;  3AI5 A;  2AX5 A;  2K39 A;  1WMH B;  4C00 A;  4B0E A;  3GE8 C;  1QZE A;  4RNA A;  2WXP A;  2J0K A;  3P4S B;  1XEE A;  2M56 B;  3DBL I;  2O6V D;  4PS7 A;  3VXW A;  2KFK B;  3QQ8 B;  4OHJ A;  3BWU D;  4DQO C;  4MGY E;  2E3T A;  5CTR C;  1EO6 A;  5BYQ A;  2OJR A;  4IM3 A;  3GOE A;  1E7U A;  1JAL A;  1YN4 A;  1I4H A;  5G55 A;  2AL6 A;  4BKT A;  3T3O A;  3VUX A;  2LZ6 A;  2WYQ A;  3ECI A;  2KD0 A;  2L52 A;  3MJW A;  2J0M A;  1JML A;  2KWV B;  1FXT B;  3FC4 A;  4KZC A;  4A8X C;  3E9S A;  3P63 A;  3B0A A;  2LRW A;  4ANW A;  4NY0 A;  4IW0 A;  2MJE A;  3HUI A;  4KIK B;  1TTN A;  4HVB A;  1CJE A;  4P7I A;  1P7F A;  1TGZ B;  1VD2 A;  1WMH A;  2WXI A;  2JZZ A;  2KKC A;  4LTU A;  2I2Y A;  2INN E;  3I3T B;  2NVU I;  1TY0 A;  3ENE A;  3Q3J A;  1VZ6 A;  4US8 A;  4M0W A;  2WGS A;  2ZNV C;  3ZXV A;  4GIV A;  1I4R A;  4L1B A;  3WAN A;  5IOI A;  1C78 A;  4DXF A;  4A90 A;  1FIQ A;  4W9H A;  4WJO A;  1ZXI A;  4NQK E;  4DHJ B;  3ML8 A;  2G4S A;  2UWQ A;  2LD9 A;  2QIL A;  2BWE S;  2WU5 B;  2PVO D;  3VDZ A;  3ZRF A;  3VTU A;  4KDL B;  3R8B A;  1WXA A;  4EZJ A;  3UIP B;  3V3X A;  3CST A;  2KT7 A;  4KX6 B;  2D3B A;  2K5P A;  2KXJ A;  3N32 A;  1L0Y B;  3U4E G;  3C8Y A;  2KWU B;  3ZDT A;  1DOY A;  1N5W A;  1XLQ A;  1B1Z A;  1TKG A;  5G5H A;  1DGJ A;  1ET6 A;  1HEZ E;  4XC2 A;  2N4F A;  1MHX A;  1GPX A;  5AUK A;  2WDV B;  4TSS A;  1XLO A;  3KYC D;  4PS3 A;  3V62 A;  2MCN B;  3URY A;  3N30 A;  4LDT D;  4PYU A;  5J18 A;  1I4X A;  2OHF A;  2KDI A;  3APD A;  5KHO A;  4FJZ A;  1YJ1 A;  2ZNV B;  4PK1 A;  1ZDX A;  4K3B A;  3TSS A;  2IDY A;  3B2F A;  3W1Y A;  3KH0 A;  5DPR A;  2V9H A;  2BF8 B;  3AE7 B;  3KUD B;  1SXT A;  2Z8L A;  1P0R A;  5D94 A;  3W5V B;  4GU2 A;  1C4C A;  3QCA A;  5IA7 A;  1P98 A;  1R4M I;  5EDS A;  1JW9 D;  3DBL B;  2FCM A;  2ZPN A;  4HDQ A;  2W82 A;  2BB6 A;  2L1A A;  2MLB A;  2R2O A;  3NVY A;  1FFU A;  4WWO A;  1RLF A;  1V1O A;  3TIX A;  2PE9 A;  4ASW C;  1F9J A;  2J4X A;  2KMM A;  3U8Z A;  3HHM A;  1G6J A;  2YEP B;  4ARC A;  1BML C;  2OJW A;  3VRB B;  1S1Q B;  2PMV A;  1ZW7 A;  4JL9 A;  1MI0 A;  4WQM A;  3RUI B;  4DK5 A;  1YJJ A;  3SEB A;  2FUG 1;  2LFI A;  2IJ0 A;  4HPL B;  1WZ3 A;  2BKR B;  4JGH B;  4KGS A;  2W54 A;  1WRD B;  1Y56 A;  4BKS A;  3ETR A;  2JXT A;  1WGG A;  4NZL B;  4PT5 A;  2N0S B;  4ZRQ A;  1I35 A;  3DHI C;  4HCN B;  4GN1 A;  2BS2 B;  2MHJ A;  4MT5 A;  1JWA D;  2MBE A;  2G45 B;  4JLC A;  4IG7 B;  1F0Z A;  1QOB A;  2NPT A;  2L76 A;  1OEY J;  2JUO A;  3N1Y C;  2NBV B;  4LK0 M;  2KTR A;  1P9D U;  2KDE B;  3U2S C;  3AEG B;  2GBN A;  3DQV A;  4KIK A;  4BKS D;  2KQ7 A;  3QA8 A;  3NS8 A;  4BBN F;  2AQ1 B;  4DHJ D;  3BYY B;  3CIR B;  2LMC A;  3V6E B;  1Z2M A;  2VZK D;  3ABV B;  2KN5 A;  2K22 A;  2JZP A;  3R2I A;  2BTE A;  1CMX B;  1VDV A;  1T3Q A;  4K1R B;  1XXG A;  3OAW A;  3UIN B;  4A55 A;  1RRB A;  4A6Q A;  4L23 A;  2WXR A;  4XE0 A;  3B08 A;  4TV3 A;  4EE2 A;  1QOA A;  1LO5 D;  4USA A;  3Q14 C;  4ZDV A;  3VR9 B;  3K9O B;  2ON8 A;  4ACF A;  1FNV A;  2ZVO A;  5HI1 A;  4US9 A;  4ZYN A;  2A4Z A;  4XX5 A;  1JWB D;  4DHZ B;  3I57 A;  1SSN A;  1JWM D;  5BYS A;  2VH1 A;  5FR6 A;  1P3Q U;  4KGR A;  1HE8 A;  2KFK A;  4XWW A;  2M17 A;  3ML9 A;  2I38 A;  1FCC C;  1FNW A;  1RFA A;  2DHZ A;  2N7D A;  1WE6 A;  1KOT A;  2HJ1 A;  4B95 A;  3AMZ A;  1XQQ A;  3ZXR A;  1V1P A;  2GRI A;  2KJH B;  2O6V B;  3ZNI D;  3IFW B;  2K8B A;  1V6E A;  1NBF C;  1SIF A;  2O6V A;  4FHK A;  4M0W B;  4RCO A;  2MH7 A;  1EF5 A;  3DHG C;  3WAL A;  4CYE A;  4DDG D;  2V3S A;  2KQS A;  2IGD A;  3DOW A;  3RI7 C;  1UGM A;  3BVM A;  3MC8 A;  2OOB B;  3GZN I;  2HDE A;  3IAM 1;  2RSU A;  4NNJ B;  2IY1 B;  1J8C A;  3HVD A;  1XF5 L;  4PS8 A;  2H88 B;  5C3J B;  3P4Q B;  1PGA A;  4AUQ C;  4GMV A;  1E8W A;  1JCK B;  4RM9 A;  2IY0 B;  2L3Z A;  2C7H A;  3P4P B;  4ZRJ A;  2L00 B;  4ZYS A;  1I4P A;  1R4N B;  2K25 A;  4HK2 A;  2CU1 A;  1XLP A;  4HKQ A;  3FKY A;  3J9C A;  1WJ6 A;  1YOV B;  1ESF A;  4G0N B;  1FEH A;  4HDO A;  4WWM A;  2HJ8 A;  2EEL A;  5CHF A;  1WH3 A;  1ZPS A;  1OTR B;  1XCT L;  3AE5 B;  3EHV A;  1GUA B;  2C7M B;  2C7N B;  3M95 A;  1WF9 A;  1SGH A;  1WSP A;  1HTQ A;  4YTP B;  3TCA A;  3FIL B;  2ONQ A;  3NZU A;  3VH4 B;  3KVF B;  3TEY A;  4EZK A;  1C3T A;  1WX7 A;  1SE3 A;  3BVG A;  4AS1 A;  3QAR A;  1VRA B;  3VHT C;  1NEN B;  2LJ5 A;  3ZNH B;  4N6E B;  3M62 B;  2N9K A;  3BY4 B;  3PSE B;  3LB8 C;  3EFC A;  3DBH I;  1C76 A;  2EKE C;  3R7R A;  2J53 A;  3OLM D;  4HRS A;  4ZHP A;  3AEC B;  4LCD E;  1MJD A;  1F52 A;  2MJ3 A;  4RMA A;  3Q3M C;  4ANX A;  4X57 B;  3RMK C;  1SF0 A;  3DVG X;  1N5X A;  2N9E B;  4MM3 A;  2YLM A;  2X38 A;  4WWN A;  1D4B A;  2PVG C;  2SAK A;  5AZF A;  2WXQ A;  4GSW A;  2HE7 A;  1WI0 A;  5D3D A;  1LM8 B;  3P1M A;  2GI9 A;  4J6I A;  2KO3 A;  4EEW A;  3HVZ A;  4EZL A;  3ZDM C;  4M8M A;  1IPG A;  1T0S C;  3AM9 A;  4LJO B;  4OVU A;  2KZR A;  3AED B;  1WR1 A;  2L05 A;  2OED A;  3N3K B;  3QC8 B;  1EWY C;  2KC1 A;  1K51 A;  4D2K A;  1IBX B;  1SE9 A;  2UYZ B;  3SD5 A;  2RDG A;  1QQR A;  4GOC A;  2DYO A;  1D6E C;  2B76 B;  4HRO A;  3NVZ A;  3LYY A;  2W9N A;  1JRU A;  4JIO U;  1XO3 A;  1ZDV A;  1AYF A;  2Z59 B;  3N20 C;  2GLS A;  5E6N A;  4A20 A;  2N7J A;  4W9F A;  2JXX A;  3RNB C;  2GB1 A;  2L8J A;  4JQW C;  3P2B A;  4GDK A;  2G1E A;  1UGJ A;  2RR9 A;  3AUL A;  2KK8 A;  1Q0W B;  2IPK D;  5C23 A;  4E74 A;  4K7U A;  4C4V A;  4LNI A;  3VRA B;  4II2 B;  2KHW B;  5DPT A;  4C4V B;  3T3N A;  4W9I A;  1NYR A;  4DXA B;  3V05 A;  4DHZ E;  1F1H A;  3PRP B;  3JW0 X;  3ZJV A;  3W5U B;  4NJ6 A;  3WAP A;  2Y5P A;  4LDT B;  2WX0 A;  3H1U A;  3AV8 A;  3QWZ B;  1PFD A;  5D6J B;  5IP4 D;  4HKZ E;  1WX9 A;  3RNC C;  1WYW B;  4YSZ B;  1V1P B;  2MBO A;  1V80 A;  2AWT A;  1YMH E;  4ARI A;  3C0R B;  4NAW A;  5EE3 A;  3LDZ E;  2WXK A;  3ZNG C;  2IZV B;  1KM7 A;  3VUW A;  5CHW A;  4HPP A;  1ZP0 B;  2D3A A;  2ZZP B;  4MJS A;  2O2V B;  1TKY A;  4IDI A;  3WCQ A;  2FNJ B;  4HWI B;  3RUL A;  3PRE A;  2JZ3 B;  2KAN A;  2MEK A;  2RDH A;  1FCL A;  4HJK A;  2KLC A;  5CX3 A;  3A4R A;  1A5R A;  1FD6 A;  1J7C A;  2Y5B B;  2V4I B;  4MEM A;  1C1Y B;  5E6J A;  4MGZ E;  4ANU A;  5JHA A;  2RD0 A;  4WAF A;  1WJU A;  2V3N A;  2BWF A;  4LNF A;  3DVN V;  3E56 A;  4CHK A;  5KHQ A;  3N1Z C;  4REZ A;  2N9X A;  1SE4 A;  2IND C;  1WGR A;  4FXC A;  2LAS A;  1GC6 A;  2WXL A;  4A3P A;  1SB3 C;  1MFW A;  3RFZ B;  4FA6 A;  4KV2 A;  4F7Z A;  1I7H A;  1C79 A;  2R61 A;  3IT6 B;  2WDR B;  4IUM B;  4M02 A;  4NJ7 A;  4KZ0 A;  3BK2 A;  3ZVV A;  3NVW A;  2WXG A;  3PZD A;  1B9R A;  5L83 A;  3PHX B;  4LNN A;  4KSL C;  1K8R B;  2G9H D;  4I6P A;  4DXG A;  3NZS A;  3JSV A;  4XWT A;  4M01 A;  2D10 A;  5E6P A;  4BKG A;  1KJT A;  1N63 A;  1XLN A;  3MTN B;  2C60 A;  5LXI B;  2QMT A;  2IO0 B;  3TEZ A;  2WHI A;  4LLG M;  2KDB A;  3SU8 X;  5FR3 A;  2ZCB A;  5D7G A;  4HEA 1;  2DAF A;  1IUE A;  3GP7 A;  3NG0 A;  1GB4 A;  2PW9 A;  1I4Q A;  4H2A A;  2BVC A;  3VR8 B;  3KW5 B;  3UQA A;  2MP2 B;  2M19 A;  4GLS C;  3GE3 C;  2BYV E;  2EKI A;  4UDU C;  3EEC A;  3VUY A;  1E0Z A;  2JQR B;  1UNS A;  2M0X A;  2J0J A;  3Q6B A;  2ASQ A;  1V5O A;  2D3G A;  2DX5 B;  3BZD B;  4F8C B;  1ZXH A;  4HCP B;  2LGS A;  3B9J A;  3QIJ A;  2LUE A;  4ZRK A;  4W9G A;  2I1K A;  1Q5W B;  1VLB A;  2KFJ A;  4KVG B;  5TSS A;  3NUH B;  2IO1 B;  3PZ7 A;  1STE A;  3AEB B;  2JWU A;  5LLI A;  5T8I A;  4M00 A;  4OVV A;  3OG5 A;  1K53 A;  1YN5 A;  5GMV A;  3V61 A;  5BMH A;  1VZ7 A;  1N60 A;  1C4A A;  4DDI D;  5MPO A;  4W9J A;  1OQR A;  3KUZ A;  4GDL B;  3PTF C;  4JWU C;  1HZ5 A;  2LGD A;  3DDC B;  1KH0 A;  1C77 A;  1KRH A;  3KQ4 A;  3AE6 B;  5FKA C;  1WFY A;  2LEK A;  1ACC A;  1L6V A;  3PGE A;  4JE3 B;  4N9F 4;  3WAM A;  3MHS D;  1PUT A;  3GB1 A;  4YSY B;  3IT4 B;  1BT0 A;  3O65 B;  1ET9 A;  3AEA B;  4P1B C;  1UZX B;  2LUM A;  1L5P A;  2L0F A;  3A33 B;  4MGI E;  4P16 A;  3RCZ A;  2M1M A;  1WWT A;  1PGX A;  3H7P B;  4FLH A;  5J17 A;  2YEP F;  1NVI D;  3S2A A;  3MFG A;  1UEL A;  4II3 B;  3IG3 A;  3KLS X;  1PYW D;  1AAR A;  1RFK A;  3JVZ X;  4K7S A;  3OJ4 B;  1F2R C;  1Z5S B;  4URK A;  2JRI B;  4BOS C;  3B1L X;  2QC8 A;  5JHB A;  3Q2A C;  4MSM B;  1D5Z C;  2ZW0 A;  2QJL A;  2DZI A;  2KMC A;  4AQ7 A;  3R3M A;  1E8X A;  4HXD A;  4EOY A;  3NHE B;  1J19 A;  4S17 A;  1NDD A;  2WXO A;  1OQY A;  1WJ4 A;  5I4D A;  1XD3 B;  2KNB A;  4MDK E;  4FAD A;  2JPH A;  3TEW A;  3AEF B;  2N7E A;  1TZ1 A;  2KTF A;  3L0W B;  3NS1 A;  2KJR A;  3RPF C;  2LVQ A;  1AWD A;  2LGI A;  1M94 A;  1L7Y A;  2QIE B;  1WXM A;  1ZUD 2;  4M8N A;  2WXN A;  1SJH D;  4IM2 A;  2DZK A;  2BW2 A;  2KAC A;  4W9L A;  4MM3 B;  2M0A A;  5LXH A;  1D5M C;  4WIP A;  4N59 A;  3ZGZ A;  1WX8 A;  2AYO B;  1WZ0 A;  3OJ3 A;  3I63 C;  4IC7 B;  3DBH B;  3AU4 A;  3T9L A;  4B6W A;  1T5X D;  5TR5 A;  1KF6 B;  4C56 C;  2ZPY A;  2ZCC A;  1E6E B;  1IBX A;  2WWZ A;  1T0Y A;  2V3P A;  2NCN A;  4EUT A;  4BOZ B;  1TBE A;  2LVO A;  1ENF A;  2RMM A;  5IAA C;  1C4P A;  4LNO A;  3RZF A;  2GOW A;  3EUB 2;  2LRU A;  5AEK B;  5G2N A;  2BYF A;  2WXF A;  3KYD D;  3L17 A;  2IBI B;  2LXA A;  4RGN A;  4HJG E;  3SHQ A;  3R2T A;  4BVU C;  2GBM A;  5BMG A;  2KOX A;  4CO7 A;  1JRO A;  3PS6 A;  2CJN A;  1VR9 A;  2DNF A;  1WGD A;  4WJQ A;  2J7Q B;  2DYB A;  1U4A A;  2LHE A;  5LNK 1;  2RGF A;  1TS3 A;  4G50 A;  2HTH A;  1OEY A;  4GDL A;  1TS5 A;  2JU6 X;  2BKF A;  1K52 A;  2BGF A;  2BS3 B;  5H92 C;  2A5U A;  4HLE A;  2I1J A;  3TEX A;  1N62 A;  1WM2 A;  4RGM A;  3QJZ A;  1FXA A;  2B3A A;  2VZK B;  1UH6 A;  1GG3 A;  1PQS A;  4QAY A;  3ZLZ A;  1EF1 A;  2G3Q B;  4TQ0 A;  2RPQ A;  1RWS A;  4B9K A;  3ZKJ C;  1NYQ A;  2JF5 A;  2KLG A;  3DPD A;  4ITK A;  4NAW B;  2NMQ A;  3PLV A;  1J7A A;  2K6D B;  3AN1 A;  2BT6 A;  1LFD A;  1EU3 A;  2MQJ A;  2INC C;  2D5G A;  3TL5 A;  5HG2 A;  2DBY A;  1FMA D;  2LVP A;  1VJK A;  2MBB B;  2XK5 A;  3R66 C;  3PRZ A;  2M4N A;  4WH4 A;  3AE8 B;  4NJC A;  1T0Q C;  1TS4 A;  1UBQ A;  1TZO A;  3V60 A;  4YTN B;  3SFD B;  3T8M A;  2HD5 B;  5IKC M;  1OGW A;  5JH5 C;  2NR2 A;  4NQL B;  3ZQ4 A;  5HFY A;  5G5G A;  1WGH A;  1UUP A;  2WU2 B;  2KVR A;  3Q69 A;  4P1C C;  1PDX A;  4EKU A;  4BFR A;  3Q3F A;  3PPA A;  1JWS D;  3QX1 A;  5DPS A;  3NZ3 A;  4YSX B;  4P6V F;  2XBB C;  1J7B A;  1SJE D;  4OZA A;  2D07 B;  2N1W A;  3QK0 A;  3DVG Y;  3RNA C;  4NAM A;  2V1Y A;  3TMP B;  2DEN B;  1V5T A;  2PPH A;  3W1S A;  1KLU D;  2KC2 A;  4I6N B;  4WUR A;  5J2R A;  2GBJ A;  2CKH B;  2VRR B;  4XDC A;  2NTS A;  2C9W B;  4W9C A;  1L2N A;  1GOZ A;  2BYT A;  2INP E;  2CHX A;  3H7S A;  3CF6 E;  4FN2 A;  2Z0E B;  1GNU A;  1SIJ A;  2FCQ A;  2H89 B;  3PRM B;  4LNK A;  2MP2 A;  1ZKH A;  4MH0 E;  1DOI A;  2KWD A;  3AH7 A;  4HPM B;  2WQY B;  3DVN U;  3AE2 B;  2MWS B;  4GXB A;  4R3D A;  1ZE3 D;  1JWU D;  3DBR B;  3I5J C;  3A1Q A;  1QKZ A;  5IO9 A;  4S0R A;  2MW5 A;  4IWP A;  1OFF A;  3APC A;  3V6C B;  3Q3O C;  2QHO A;  2KJ6 A;  2JVC A;  2L7R A;  3ZTC A;  3DHH C;  3HM3 A;  3UGB B;  3H6N A;  3IHP C;  4YWG G;  4C7Z A;  4ZRP A;  1V86 A;  4E71 A;  3VQI A;  4BBN C;  2KMA A;  3IXS A;  4NPN A;  1S3S G;  3AB5 A;  5DPW A;  1L0X B;  2AL3 A;  3PHW B;  5JZE B;  1L4Z B;  1V9J A;  4EFO A;  2PKO A;  3RD2 A;  1FM0 D;  2Y3A A;  4FJV B;  1YQ4 B;  4AJY B;  1TT5 B;  2VH2 A;  3PV1 A;  3Q8C A;  3U7Z A;  2K9X A;  3O13 A;  1FRR A;  3A9K B;  3RN9 C;  4RH6 A;  5DCN A;  1E5W A;  4JWS C;  4FBJ B;  3DBS A;  1KTK A;  3APF A;  3PT2 B;  2IO2 B;  2W3S A;  1YQ3 B;  2CJO A;  4AJW A;  3AU5 A;  2LI5 A;  4KKJ A;  5E6O A;  3VTW A;  3H8H A;  2KX3 A;  2QEJ C;  1WXQ A;  2DZM A;  3AE4 B;  4TKN A;  2BYE A;  2HTM E;  4AP4 C;  2L0T A;  1WGK A;  4OVZ A;  2MX2 A;  1E7V A;  1E9M A;  1FFV A;  2KTR B;  1Y8R C;  1E8Z A;  3NRZ A;  3K9P B;  4MJS B;  1WR6 E;  2JX5 A;  2KN4 A;  4C80 A;  3CSF A;  2IGH A;  1WE7 A;  5EE0 A;  1Q10 A;  2CS4 A;  4MH8 A;  1E8Y A;  1IYF A;  1WM3 A;  2KAJ A;  2N9P C;  2V0G A;  1CZP A;  4PYZ A;  4L2Y A;  3AE1 B;  2DAJ A;  2BS4 B;  1L0V B;  2J42 A;  2SEB D;  4IWQ A;  3BVZ A;  2DWQ A;  1JQ4 A;  4N58 A;  3AE3 B;  3KUC B;  3WA0 A;  4OZB A;  1HZ6 A;  4W9K A;  1N61 A;  2L32 A;  2O2V A;  3GS2 A;  3A9J A;  1TIF A;  1UWM A;  3EA6 A;  1K50 A;  1UD7 A;  3Q8B A;  1I42 A;  3M3J A;  1MVK A;  4XZ4 A;  4WWP A;  1QLB B;  2PTL A;  4XYC A;  5GXG B;  1C9F A;  3BII D;  3N9Y C;  1HA5 A;  2IGG A;  4GDK B;  4AWJ A;  1P1A A;  2BBC A;  3W9C B;  1QF6 A;  3OWE B;  1MHH E;  1GAQ B; 
#chains in the Genus database with same CATH homology
 3KVF B;  2JPH A;  4EZK A;  1C3T A;  1WX7 A;  4ANV A;  3QAR A;  3VHT C;  3ONS A;  2FUH B;  3DBL I;  2LJ5 A;  3ZNH B;  2N7E A;  2O6V D;  4PS7 A;  3VXW A;  3RZW C;  1TZ1 A;  2KTF A;  3L0W B;  2KFK B;  3M62 B;  3QQ8 B;  3BY4 B;  2KJR A;  4MGY E;  2LVQ A;  3PSE B;  5CTR C;  3A1Q B;  3DBH I;  5AZH A;  2EKE C;  3R7R A;  1M94 A;  1L7Y A;  1EO6 A;  1WXM A;  3OLM D;  4M8N A;  2LWP A;  2OJR A;  2REX A;  4IM2 A;  4IM3 A;  2DZK A;  3GOE A;  4LCD E;  4ANX A;  4RMA A;  1E7U A;  4W9L A;  4X57 B;  3DVG X;  5LXH A;  2N9E B;  2JT4 B;  4MM3 A;  1V2Y A;  5G55 A;  2AL6 A;  2YLM A;  1WX8 A;  4MEL A;  2AYO B;  4WWN A;  2NPT B;  3VUX A;  4BKT A;  2LZ6 A;  2WYQ A;  5AZF A;  3ECI A;  1WZ0 A;  2KD0 A;  4GSW A;  3MJW A;  4TUU A;  2HE7 A;  1WI0 A;  3OJ3 A;  1LM8 B;  1IP9 A;  3EC8 A;  3ZW3 A;  2J0M A;  3TJP A;  2KWV B;  1FXT B;  4IC7 B;  1MG8 A;  4J6I A;  4B6W A;  3AU4 A;  2KO3 A;  3T9L A;  2FAZ A;  4KZC A;  4WAA A;  4IM0 A;  4EEW A;  5TR5 A;  4EZL A;  3ZDM C;  3B0A A;  4M8M A;  1IPG A;  2LRW A;  4G3X B;  4ANW A;  3UIO B;  2MSE D;  2ZPY A;  4LJO B;  1LQB A;  4NY0 A;  4IW0 A;  3QHT A;  2ZCC A;  4OVU A;  1X1M A;  4K7W A;  4KIK B;  2WWZ A;  1T0Y A;  2KZR A;  1TTN A;  2WDT B;  4HVB A;  2NCN A;  3NOB A;  4EUT A;  1WR1 A;  5L95 C;  4BOZ B;  2L05 A;  1TBE A;  2LVO A;  4P7I A;  5IAA C;  3RZF A;  3N3K B;  2D2Q A;  4KDI C;  3BIN A;  1TGZ B;  2K6Q A;  2GOW A;  2LRU A;  3QC8 B;  1VD2 A;  2KC1 A;  2R2Q A;  4GB9 A;  4ICU A;  1WMH A;  5G2N A;  5AEK B;  1KLV A;  2BYF A;  2JZZ A;  1SE9 A;  2UYZ B;  2LGY A;  3SD5 A;  1WXS A;  2KKC A;  3KYD D;  3L17 A;  2IBI B;  4GOC A;  2DYO A;  2LXA A;  2ZVN A;  3I3T B;  2NVU I;  3SHQ A;  3ENE A;  2W9N A;  1JRU A;  3Q3J A;  4BVU C;  2GBM A;  4JIO U;  2KOX A;  4CO7 A;  2Z59 B;  2ZNV C;  3PS6 A;  4MSQ B;  4GIV A;  3IVF A;  5E6N A;  4A20 A;  1YX6 B;  4W9F A;  2JXX A;  3WAN A;  1WGD A;  3QAQ A;  2ZJD A;  4WJQ A;  2FIF A;  2J7Q B;  4FUL A;  2DYB A;  4W9D A;  4LJP B;  4W9H A;  2L8J A;  4JQW C;  4NQK E;  1U4A A;  4WJO A;  4DHJ B;  3ML8 A;  4K81 A;  1V81 A;  2EMS A;  2G4S A;  2UWQ A;  3P2B A;  4GDK A;  2RGF A;  4DBG A;  2RR9 A;  3AUL A;  3W1S C;  2KK8 A;  2GMI C;  2NBU A;  2LD9 A;  3X0W A;  1Q0W B;  2BWE S;  4G50 A;  5C23 A;  2HTH A;  1OEY A;  4GDL A;  4K7U A;  4E74 A;  3VDZ A;  3ZRF A;  4II2 B;  3VTU A;  4KDL B;  2BKF A;  5J2R A;  1WXA A;  2NS5 A;  2KHW B;  4EZJ A;  5DPT A;  2BGF A;  3UIP B;  2V4L A;  3CST A;  2A5U A;  4W9I A;  5HKH A;  4HLE A;  4DXA B;  2JWZ A;  3A9K A;  2I1J A;  2KXJ A;  3N32 A;  1YIW A;  2KWU B;  4DHZ E;  3ZDT A;  3PRP B;  1WM2 A;  3JW0 X;  4I6L B;  3QJZ A;  3UQB A;  2B3A A;  3L13 A;  4NJ6 A;  3WAP A;  1UH6 A;  4LDT B;  2WX0 A;  3H1U A;  3VH4 B;  1GG3 A;  1PQS A;  3QWZ B;  5D6J B;  3ZLZ A;  1EF1 A;  2G3Q B;  1WX9 A;  1WYW B;  4XC2 A;  2N4F A;  1UBI A;  4TQ0 A;  2RPQ A;  3L54 A;  3LJ3 A;  3ZKJ C;  4B9K A;  2JF5 A;  2KLG A;  3DPD A;  4NAW B;  3AXC A;  2MBO A;  1V80 A;  3ALB A;  3KYC D;  2AWT A;  4PS3 A;  3PLV A;  3V62 A;  2MCN B;  2K6D B;  3C0R B;  3N30 A;  4LDT D;  4NAW A;  4PYU A;  5J18 A;  2KDI A;  1LFD A;  2MQJ A;  3APD A;  3LDZ E;  4FJZ A;  5KHO A;  3ZNG C;  3SDL C;  1YJ1 A;  2ZNV B;  2IZV B;  2Z0D B;  1KM7 A;  5CHV C;  3TL5 A;  3VUW A;  5CHW A;  2LVP A;  3WIM A;  2MBB B;  2ZZP B;  4MJS A;  2O2V B;  2XK5 A;  3R66 C;  3PRZ A;  3VTV A;  1Q1O A;  2M4N A;  3W1Y A;  3ZRC A;  3KH0 A;  5DPR A;  2IYD B;  3DBR I;  2DYM A;  2FNJ B;  2D11 A;  4HWI B;  3RUL A;  1UBQ A;  2BF8 B;  3V60 A;  3KUD B;  1RAX A;  3PRE A;  2JZ3 B;  1P0R A;  5D94 A;  4ZRI A;  4AOF A;  1H4R A;  2HD5 B;  3T8M A;  2KAN A;  4HJK A;  1OGW A;  2KLC A;  4GU2 A;  3U7D A;  3QCA A;  5JH5 C;  5CX3 A;  2NR2 A;  3A4R A;  4NQL B;  5IA7 A;  1P98 A;  1R4M I;  1A5R A;  5EDS A;  1WGH A;  2MRP A;  2XEW A;  2Y5B B;  4MEM A;  2KVR A;  1C1Y B;  4MGZ E;  4EKU A;  3H9D A;  3Q3F A;  3PPA A;  4ANU A;  3JYU A;  2FCM A;  2JY6 A;  2RD0 A;  2ZPN A;  4HDQ A;  5JHA A;  2MLB A;  4ICV A;  1WJU A;  2R2O A;  4WWO A;  3QX1 A;  1RLF A;  3TIX A;  5DPS A;  2PE9 A;  4ASW C;  2BPS A;  1F9J A;  4E3C A;  2BWF A;  3ZUN A;  2LGX A;  1WIA A;  2XBB C;  3DVN V;  4CHK A;  3U8Z A;  5KHQ A;  2D07 B;  3HHM A;  3EFU A;  1E90 A;  1YQB A;  2N1W A;  2N9X A;  3QK0 A;  1G6J A;  1WGR A;  3DVG Y;  2CHW A;  2LAS A;  1GC6 A;  4G11 A;  2MBH A;  3JSV B;  2V1Y A;  3TMP B;  3ZTD A;  1GC7 A;  2DEN B;  1V5T A;  4A3P A;  2YVC A;  1S1Q B;  2PPH A;  4WJN A;  3W1S A;  3L10 B;  2KC2 A;  4I6N B;  1ZW7 A;  3VH3 B;  4FA6 A;  4KV2 A;  4F7Z A;  4JL9 A;  2PEA A;  4DK5 A;  3RUI B;  2GBJ A;  1XT9 B;  2CKH B;  2VRR B;  4IWO A;  2LXC A;  1ISN A;  1WJN A;  2EMT A;  2KX0 A;  4IUM B;  2C9W B;  1WZ3 A;  4HPL B;  2BKR B;  4JGH B;  4NJ7 A;  4W9C A;  4KZ0 A;  2FCN A;  1L2N A;  3ZVV A;  2CHX A;  1WRD B;  3H7S A;  3PZD A;  3CF6 E;  5L83 A;  3PHX B;  4FN2 A;  2Z0E B;  1GNU A;  4BKS A;  4KSL C;  2JRH A;  3A4S C;  3R7Q A;  1K8R B;  2FCQ A;  3H7P A;  3X23 A;  3PRM B;  4I6P A;  2MA9 B;  1WGG A;  2GBR A;  3NZS A;  3DCG A;  3JSV A;  4W9E A;  2MP2 A;  1ZKH A;  2M8S A;  2D10 A;  4MH0 E;  1I35 A;  4HCN B;  5E6P A;  4GN1 A;  4BKG A;  1R4N I;  1KJT A;  4HPM B;  3DVN U;  2MBE A;  2G45 B;  4JLC A;  3MTN B;  4IG7 B;  2C60 A;  2NPT A;  2L76 A;  2MWS B;  5LXI B;  1OEY J;  2JUO A;  1LXD A;  4GXB A;  2IO0 B;  5BO4 B;  2GBK A;  2NBV B;  2KTR A;  1P9D U;  1NI2 A;  2KDE B;  2KDB A;  3SU8 X;  2ZCB A;  5D7G A;  2GBN A;  2DAF A;  4YL8 A;  2DZJ A;  3DQV A;  4KIK A;  4BKS D;  2KQ7 A;  3A1Q A;  3QA8 A;  3UQA A;  3KW5 B;  4TQ1 A;  3NS8 A;  2MP2 B;  4BBN F;  2ZEQ A;  3HK0 A;  4DHJ D;  1YD8 U;  3ZNZ B;  2BYV E;  3V6E B;  3EEC A;  2MW5 A;  5D2M B;  4IWP A;  2AEH A;  4KSK C;  3RT3 B;  3VUY A;  3APC A;  1Z2M A;  3V6C B;  1GJZ A;  2QHO A;  2KJ6 A;  2JVC A;  2L7R A;  2M0X A;  3ZTC A;  3HM3 A;  3UGB B;  2J0J A;  3H6N A;  3IHP C;  4FJY A;  5AZG A;  2KN5 A;  2ASQ A;  1V5O A;  1V86 A;  4E71 A;  3VQI A;  2D3G A;  2DX5 B;  4BBN C;  3WAO A;  2KMA A;  4FHJ A;  4F8C B;  1CMX B;  4NPN A;  4HCP B;  1S3S G;  3VVW B;  3QIJ A;  2LUE A;  4K1R B;  4ZRK A;  5DPW A;  3U30 A;  3OAW A;  3UIN B;  2AL3 A;  3PHW B;  4W9G A;  1RRB A;  5JZE B;  1V9J A;  2I1K A;  1Q5W B;  3M63 B;  4WQO B;  4EFO A;  2KFJ A;  4KVG B;  3B08 A;  3RD2 A;  1H8C A;  2IO1 B;  4FJV B;  4A3O A;  3VAW A;  3UF8 A;  4TV3 A;  4F1S A;  5LLI A;  4AJY B;  2WX1 A;  4ZDV A;  3RYT A;  3PV1 A;  3K9O B;  2ZVO A;  4OVV A;  3A9K B;  4ZYN A;  4FBJ B;  5DCN A;  1E5W A;  1V49 A;  5GMV A;  2A4Z A;  2KWC A;  3DBS A;  4XX5 A;  2CHZ A;  2PJH A;  3V61 A;  3ZIM A;  3APF A;  3HM6 X;  3PT2 B;  2IO2 B;  4GGQ A;  4AJW A;  4DHZ B;  2KDF B;  3AU5 A;  2LI5 A;  4DDI D;  5E6O A;  3VTW A;  4W9J A;  2KX3 A;  3VFK A;  3KUZ A;  4GDL B;  2DZM A;  5FR6 A;  1P3Q U;  3PTF C;  4MGK E;  2BYE A;  4TKN A;  1HE8 A;  4DWF A;  2KFK A;  2M17 A;  2MBQ A;  2K8C A;  3D32 A;  3ML9 A;  4AP4 C;  2L0T A;  3PVL A;  4RM8 A;  2LGD A;  3DDC B;  3HIZ A;  2MX2 A;  1RFA A;  2N7D A;  2DHZ A;  1E7V A;  1WE6 A;  1KOT A;  1WFY A;  1ZGU B;  3ZO5 B;  2KTR B;  4BFR A;  1Y8R C;  2FID A;  4B95 A;  1E8Z A;  3L08 A;  3PGE A;  1XQQ A;  4N9F 4;  3K9P B;  4MJS B;  2KJH B;  1WR6 E;  2O6V B;  3MHS D;  3WAM A;  3ZNI D;  3IFW B;  2K8B A;  1BT0 A;  1V6E A;  1WXV A;  3O65 B;  1NBF C;  1SIF A;  2O6V A;  3CSF A;  4FHK A;  1D3Z A;  1WE7 A;  1UZX B;  2CS4 A;  2K8H A;  3CMM B;  4M0W B;  2L0F A;  1E8Y A;  3A33 B;  1IYF A;  1WM3 A;  4MGI E;  2N9P C;  1EF5 A;  4PYZ A;  3RCZ A;  3WAL A;  2M1M A;  1YX5 B;  2DAJ A;  4CYE A;  4DDG D;  2V3S A;  2KQS A;  3DOW A;  3H7P B;  4FLH A;  5C1Z A;  2NBW B;  1VCB A;  5J17 A;  1UGM A;  2OOB B;  3GZN I;  1WGY A;  2RSU A;  4NNJ B;  2IY1 B;  4IWQ A;  1J8C A;  3L16 A;  3S2A A;  1UEL A;  4PS8 A;  4II3 B;  3IG3 A;  4AUQ C;  3KUC B;  4GMV A;  1AAR A;  1E8W A;  3A9J B;  4W9K A;  3WA0 A;  1WY8 A;  1J0G A;  3NY5 A;  3JVZ X;  2O2V A;  2XK5 B;  4RM9 A;  2G4D B;  3PLU A;  3OJ4 B;  4K7S A;  2IY0 B;  1Z5S B;  3A9J A;  4URK A;  2N1V A;  1EUV B;  2JRI B;  2L3Z A;  4BOS C;  3B1L X;  2FCS A;  1UD7 A;  2C7H A;  2PE6 B;  4ZRJ A;  5JHB A;  1I42 A;  2L00 B;  4MSM B;  3M3J A;  4WJP A;  2K25 A;  2IO3 B;  4XZ4 A;  4HK2 A;  2CU1 A;  4WWP A;  2K1F A;  3TBL D;  1WJ6 A;  2DZI A;  4G0N B;  2KMC A;  4HDO A;  3R3M A;  1E8X A;  4HXD A;  2HJ8 A;  4EOY A;  3NHE B;  3IBE A;  2C5L C;  2CR5 A;  5CHF A;  1WH3 A;  1J19 A;  4GDK B;  1NDD A;  1OTR B;  3AI5 A;  1P1A A;  3EHV A;  1GUA B;  4AWJ A;  2C7M B;  2C7N B;  2K39 A;  3M95 A;  1WF9 A;  1SGH A;  1WMH B;  1OQY A;  1WJ4 A;  1XD3 B;  3TCA A;  2KNB A;  1QZE A;  3NZU A;  4MDK E;  2J0K A;  4FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...