2RPQA

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 2
publication title Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rpqA00
4KV2A 4FJZA 3A1QA 3PHXB 1WGHA 3PSEB 4F8CB 3ZO5B 2ASQA 2ZVOA 4KSKC 4EEWA 1FXTB 4HDOA 1E8XA 2V3SA 2LASA 4I6LB 4E71A 1V2YA 4AOFA 3V60A 2N1VA 4MSMB 4GGQA 5G2NA 2MP2A 4TQ1A 3BY4B 1A5RA 4E3CA 2MP2B 4WWNA 5TR5A 3SU8X 4A3OA 4N9F4 3ZTCA 1WF9A 2K6QA 1EUVB 3K9OB 3R66C 1WR1A 3H7SA 2IO0B 2MX2A 3O65B 3VXWA 4TQ0A 2FCSA 3L16A 3EC8A 4GDLA 3DCGA 4MGYE 2KD0A 4GDLB 2D3GA 4IM0A 4OVVA 1PQSA 3A9KA 1P98A 1V86A 2MBQA 4JL9A 1GUAB 3A9KB 2KVRA 5AZHA 2DZMA 4CYEA 2FIDA 2HJ8A 2JT4B 5AEKB 1E8WA 3B0AA 5AZFA 2LGXA 4NY0A 1OEYA 4GU2A 5LXHA 3A9JA 4WWOA 4YL8A 3A9JB 1Q0WB 2K8CA 2LI5A 2CHXA 4TV3A 1V49A 3VFKA 5FR6A 1MG8A 2BKRB 4RMAA 4AJWA 1VD2A 2AL6A 3ZKJC 2XEWA 2LGDA 2JF5A 4GMVA 1H4RA 2BYVE 3ZNGC 2CKHB 4IM3A 3DVNV 4GIVA 4PS7A 3QA8A 2IY1B 2LRWA 3B1LX 3QJZA 2N7DA 2M0XA 4DHZE 3ZDMC 1WJ4A 3VH4B 1E90A 1OQYA 2DYOA 2XK5B 2O6VA 2L05A 2Z0DB 4B9KA 2MCNB 2IO3B 3ZLZA 4MGZE 1Y8RC 4NAWA 1NI2A 3H1UA 3SDLC 1SIFA 3DVGY 4NAWB 1WZ3A 1WX8A 4HVBA 3L10B 1OGWA 3BINA 3H9DA 1WR6E 2GBKA 3WALA 3WANA 2L0FA 3OJ4B 2D10A 4HCNB 3LJ3A 2A5UA 2IYDB 2AYOB 3APFA 4W9JA 4A20A 3UIPB 2KXJA 1WGDA 3ZNZB 2JRHA 2KNBA 3R7QA 1C1YB 1WXSA 4JGHB 4LDTB 2KJRA 4DDGD 1WI0A 4MH0E 3ZRFA 2DYBA 2JRIB 5L83A 3KYDD 3PLUA 4JQWC 3AULA 2BYEA 2LD9A 3KW5B 4MDKE 4WJOA 4KZCA 3ZTDA 2CR5A 4DWFA 5E6NA 4BBNF 3T8MA 2KFKA 1KM7A 3VTUA 2FNJB 4MGIE 1IP9A 4FBJB 2BWES 1C3TA 3PRZA 1J19A 3IG3A 4KVGB 2KKCA 1V6EA 2C9WB 5D94A 4DHZB 2ZNVB 4AWJA 2ZPNA 2N7EA 1V5TA 1F9JA 1YX6B 4IWQA 3X23A 4EZLA 2KQ7A 5CHVC 4BOZB 2M4NA 1WXVA 2PE9A 4GOCA 4XX5A 3ENEA 3OAWA 3TCAA 3ML8A 4KDLB 2KZRA 1D3ZA 3UIOB 3PLVA 4X57B 3APDA 2KK8A 4HXDA 4KDIC 2A4ZA 3PHWB 1TBEA 3DOWA 4FADA 3AXCA 2C7MB 4IG7B 4FHJA 2IY0B 3B08A 4LDTD 1RRBA 2FUHB 3CF6E 3Q3JA 2KDBA 2LXCA 2NCNA 4KSLC 3ZNHB 1TZ1A 3QAQA 1WX9A 2NPTB 2BYFA 2BGFA 2K39A 2KTRA 3UINB 1ZGUB 4ANUA 3DBRI 3KUZA 3RZFA 2FIFA 2LJ5A 3QHTA 4M8MA 3RULA 2DX5B 3SHQA 4W9IA 2MQJA 2K8HA 2HE7A 2WWZA 4FLHA 1J8CA 3KUCB 2AWTA 3VAWA 2J0JA 1YX5B 5HKHA 5JH5C 2DAFA 4AUQC 3APCA 3JVZX 1Q1OA 3RT3B 3TMPB 2KDEB 1GG3A 2WDTB 4WWPA 2MRPA 5BO4B 2MW5A 2GBNA 2M1MA 2LWPA 2KJHB 4W9DA 2JUOA 4W9GA 1WJUA 4XC2A 1EF5A 3EHVA 4G11A 4MJSA 2LVOA 2REXA 5JZEB 3NHEB 4MJSB 1P3QU 3V61A 2LUEA 3QCAA 2DZJA 1Q5WB 3OJ3A 2MBHA 2I1KA 4DHJB 3A4RA 4LJPB 2NBVB 2CS4A 3VTVA 3HM3A 2Z59B 1IPGA 3MTNB 4PS8A 1R4MI 3VQIA 2DYMA 3RCZA 4W9LA 1U4AA 4MGKE 1JRUA 1EF1A 2K6DB 4W9CA 3VVWB 3LDZE 3WAMA 4W9HA 2D11A 3K9PB 3PTFC 4XZ4A 2BF8B 2NVUI 3MJWA 4G50A 4LCDE 5D2MB 4KZ0A 4HJKA 3TIXA 3VUYA 2UWQA 4WQOB 1P0RA 3QX1A 4MSQB 3NY5A 4P7IA 1BT0A 3RUIB 1WZ0A 1GC7A 1YQBA 5C23A 1V5OA 3NZUA 1VCBA 2EMSA 1S1QB 2FCMA 2RSUA 3IVFA 1R4NI 2WYQA 3PT2B 3QWZB 3V6CB 3RZWC 4DHJD 5E6OA 5LXIB 3AI5A 4BKSD 2NS5A 1AARA 2KJ6A 2OJRA 1CMXB 2MLBA 2N4FA 2K8BA 2NR2A 3V6EB 4PS3A 3QQ8B 1I42A 3WIMA 2YLMA 2RGFA 2G4SA 2XK5A 2ZNVC 2WX0A 4EFOA 3QK0A 4A3PA 2PJHA 5G55A 2N9EB 3KH0A 4II3B 4URKA 5CTRC 5J2RA 1WRDB 1E8YA 2C5LC 2RR9A 3EECA 2KX0A 4EZKA 3N3KB 2N9PC 3VUXA 3DVNU 2B3AA 3NS8A 1OTRB 2KWUB 2FAZA 2L7RA 3SD5A 1NDDA 1WH3A 1I35A 4GN1A 2LGYA 3DBLI 2JPHA 3AU5A 4G3XB 4BVUC 3U8ZA 3HHMA 3V62A 4NNJB 2NBWB 2JZ3B 4WJPA 3DDCB 5DPWA 3A4SC 4HCPB 2K1FA 1WY8A 1L7YA 1XT9B 4HDQA 2FCQA 2KQSA 2KMCA 3AU4A 1WX7A 1YJ1A 3C0RB 1WGGA 3ZDTA 4HLEA 1XQQA 2G4DB 4BOSC 2HTHA 4DK5A 2G3QB 3QARA 4W9EA 1GNUA 2GBMA 3VTWA 3U7DA 4DBGA 2VRRB 3X0WA 1ISNA 4BKGA 3UQAA 2C60A 1T0YA 5D6JB 3U30A 4ZRKA 2ZPYA 1KOTA 2LRUA 1LM8B 3H7PB 4ANXA 4K7SA 4M0WB 1LXDA 2N1WA 4GDKB 3EFUA 3ECIA 2MBEA 2M8SA 5DCNA 4NJ7A 5GMVA 4B95A 1KLVA 3IFWB 3M95A 3IBEA 1V81A 4GSWA 5C1ZA 2DENB 2XBBC 4DDID 4AJYB 3L0WB 2NPTA 1IYFA 1WYWB 4EOYA 2ZVNA 2KC2A 5IA7A 2ZCCA 1YIWA 3M3JA 2KMAA 4K7UA 1UD7A 4EUTA 3IHPC 2CHWA 4IC7B 2MBOA 5L95C 3QIJA 2KLCA 3ZW3A 4G0NB 5LLIA 2KOXA 3ZNID 3M63B 5CHFA 3PRPB 1WE6A 3JW0X 1LFDA 3WAOA 4BFRA 4KIKB 4FJYA 1K8RB 2V1YA 1GC6A 3L08A 5E6PA 2PPHA 1WXAA 3DVGX 4RM9A 2NBUA 5CHWA 3PVLA 2OOBB 4IM2A 4J6IA 3RD2A 3ZUNA 5DPRA 4BKSA 2GOWA 2AL3A 2BWFA 5JHAA 1V9JA 4LJOB 4PYZA 2Y5BB 2C7HA 1V80A 2MSED 2O2VB 3DQVA 4TKNA 2W9NA 2KANA 2JXXA 1H8CA 4JLCA 2PEAA 5JHBA 2J0MA 1RAXA 2DZIA 4IUMB 2YVCA 4IWOA 4PYUA 3A1QB 3HK0A 4BKTA 3W1SA 2QHOA 1WM3A 1G6JA 5AZGA 1ZKHA 3HIZA 2MBBB 3ZRCA 1HE8A 3JYUA 2ZZPB 4HK2A 4FULA 4GXBA 3VUWA 2RD0A 3W1YA 1P9DU 1UGMA 1UZXB 3ONSA 4K7WA 2LXAA 4ICUA 4NQLB 4FHKA 3UQBA 4JIOU 1RLFA 4ZRIA 3UF8A 2LZ6A 3GZNI 3S2AA 5J18A 1UH6A 2L00B 4CO7A 1TGZB 1E7VA 4MEMA 3ALBA 2KDFB 3PRMB 4NPNA 3M62B 4II2B 3N30A 3KVFB 1S3SG 3PPAA 1E7UA 2GBJA 2D07B 2DAJA 3JSVA 3TJPA 2KHWB 3JSVB 2KWCA 2D2QA 1E8ZA 3WA0A 3MHSD 3R7RA 3PREA 2KLGA 2C7NB 2L76A 1WIAA 3ML9A 1QZEA 3OLMD 3DPDA 1KJTA 2GBRA 3KYCD 4ANVA 4AP4C 2GMIC 1P1AA 3Q3FA 4ZRJA 2BKFA 2KX3A 3DBHI 2KWVB 1SGHA 3A33B 2MWSB 4ANWA 4CHKA 4EKUA 2WX1A 2ZCBA 4TUUA 5CX3A 1LQBA 3L17A 4FJVB 5DPSA 3ZIMA 4M8NA 5EDSA 1EO6A 2ZJDA 1L2NA 4ZDVA 4W9FA 4NQKE 1GJZA 1WE7A 2KDIA 2O6VB 4I6NB 5KHQA 1J0GA 2JWZA 2KFJA 2L8JA 4WAAA 2J0KA 4F7ZA 3QC8B 1YD8U 2BPSA 2EKEC 3D32A 4K81A 1E5WA 4MM3A 4MELA 1UBQA 2AEHA 3TL5A 2FCNA 1UBIA 5DPTA 3NOBA 1NBFC 2DZKA 3TBLD 5J17A 2IO1B 1OEYJ 3KUDB 3R3MA 4K1RB 2M17A 2Z0EB 3L13A 4B6WA 3VHTC 3VH3B 2CU1A 1TTNA 5IAAC 3RYTA 2R2OA 3PGEA 4ICVA 2JVCA 3H7PA 2N9XA 3H6NA 4HWIB 2JZZA 2V4LA 4GDKA 1WGYA 1ZW7A 1RFAA 2IBIB 3VDZA 4WJQA 2KFKB 3PV1A 3DBSA 4I6PA 1WMHA 1Z5SB 4ZYNA 1WMHB 2EMTA 2O6VD 2KTFA 4BBNC 2KC1A 4IW0A 3ZVVA 3W1SC 4ASWC 2KO3A 5KHOA 1X1MA 1WFYA 4HPLB 1WM2A 1WXMA 3P2BA 5D7GA 3HM6X 4EZJA 2K25A 4RM8A 3I3TB 3N32A 3L54A 3WAPA 4WJNA 4DXAB 3CSTA 1UELA 4IWPA 2KN5A 4NJ6A 4FA6A 3PS6A 4KIKA 1WJ6A 2RPQA 1M94A 2IO2B 2LVQA 4OVUA 2R2QA 2PE6B 2I1JA 3CSFA 3NZSA 1WJNA 2G45B 2L3ZA 2KTRB 2CHZA 2HD5B 2DHZA 4HPMB 2LVPA 4E74A 3UGBB 4W9KA 3GOEA 1Z2MA 2MA9B 2O2VA 2ZEQA 4F1SA 4GB9A 2IZVB 3PZDA 1WGRA 2L0TA 3CMMB 3T9LA 1XD3B 2JY6A 2UYZB 4FN2A 2J7QB 1SE9A
chains in the Genus database with same CATH superfamily
2DWQA 3FILB 3PSEB 3PHXB 4F8CB 1ET9A 2V3SA 1RWSA 4HJGE 4AOFA 2WXKA 2LJIA 3LXFA 1IBXB 3KWLA 3SU8X 3R66C 1EUVB 2KAJA 2KN4A 1FRDA 1PYWD 2MX2A 3H8HA 4GDLB 4IM0A 1PQSA 3A9KB 1EU3A 1WRIA 2CJNA 5AEKB 3B0AA 4GU2A 5LXHA 1I4RA 1Q0WB 2LI5A 1V49A 5FR6A 2BKRB 1AYFA 3ZKJC 4OZAA 3CWIA 2GB1A 1NYRA 4FXCA 2IY1B 3SFEB 3B1LX 2N7DA 1XLQA 1WJ4A 1XLOA 1E90A 2DYOA 2I2YA 2Z0DB 1ZPSA 1Y56A 4MGZE 4NAWA 1TJEA 1F77A 1C4PA 3DVGY 1WZ3A 4HVBA 3L10B 3BINA 1PGAA 2GBKA 3AEGB 2NMQA 3LJ3A 2IYDB 1I7HA 4A20A 3UIPB 1WGDA 2INDC 4LLGM 3RN9C 2WHIA 2Q5WD 2KJRA 1WI0A 2JRIB 3NVWA 4JQWC 4DWFA 3ZTDA 1FFUA 2CR5A 2WXLA 2LUMA 4BBNF 3T8MA 1K51A 2BS4B 4MGIE 1C3TA 3BVZA 3PRZA 1V6EA 1TS2A 1XCQL 2C9WB 5D94A 2ZNVB 2KQ7A 5CHVC 3EGRA 2M4NA 1CJEA 3C8YA 3BIID 1HA5A 3APDA 3R2TA 4KDIC 2A4ZA 3CF6E 5H92C 3ZNHB 3UINB 3N1XC 3TUOA 3I57A 1EU4A 2PTLA 3N1YC 1LO5D 2HE7A 2PVGC 3VAWA 1J7BA 2Y5PA 2DAFA 2AQ2B 3JVZX 1DOIA 4DXGA 2KDEB 5BO4B 4WWPA 2UU7A 2M1MA 2LWPA 1OQQA 4W9DA 2JUOA 4US9A 2LVOA 4MJSB 2LUEA 1Q5WB 3OWEB 3MJ5A 4YSZB 2Z59B 3MTNB 1TS3A 4PS8A 1JRUA 1ENFA 2M19A 3LDZE 3WAMA 1AN8A 1SXTA 4LCDE 2TSSA 4KZ0A 3TIXA 4WQOB 1SSNA 4MSQB 5G5GA 1JCKB 4CQNA 4M02A 3IT4B 1RM6C 1VCBA 2FCMA 2QILA 1R4NI 2VZKB 3PT2B 2ONQA 5LXIB 2NS5A 2MLBA 2N4FA 3V6EB 3ZXRA 1QKZA 2W82A 2XK5A 4RH6A 1YN5A 3QK0A 2PJHA 1DGJA 4URKA 3AE6B 4ZRQA 1WRDB 3N1ZC 4C56C 4JPSA 1OTRB 2L7RA 3SD5A 3W5VB 1M4VA 1JWBD 1FNWA 4BVUC 3V62A 4NNJB 1TS5A 2NBWB 1I4QA 1L0VB 1WY8A 4HDQA 1F1HA 2QDFA 2QSDA 1YJ1A 4MM3B 3VRBB 1WGGA 1YN3A 3Q3NC 1KRHA 1GNUA 2GBMA 3U7DA 2RDGA 2KACA 5BYQA 3VR8B 1K52A 2LRUA 1YMHE 3H7PB 4GDKB 3ECIA 4NJ7A 5C1ZA 1TYGB 3MC0B 1WYWB 1IGCA 1N61A 1STEA 2KMAA 2CHWA 2MBOA 3Q3MC 1E0ZA 5LLIA 2KOXA 1QT9A 5CHFA 4IDIA 3JW0X 1LFDA 5C2TB 4FJYA 1K8RB 2V1YA 5E6PA 2PPHA 2ZW0A 3DVGX 2NBUA 5CHWA 1YJIA 4J6IA 4BKSA 1ZXHA 3KWVA 3P4RB 3MFGA 2MSED 1YN4A 2LHDA 1IGDA 3EA6A 3P42A 2QHOA 3NJTA 5AZGA 1C4CA 3Q3OC 1ZXIA 3VUWA 1MFWA 1VR9A 1P9DU 1UGMA 4KGSA 1FD6A 1VZ6A 3ONSA 4K7WA 4ICUA 3Q8CA 2R61A 5J18A 4PT5A 2KDFB 3ETRA 4NPNA 1KF6B 3N30A 3KVFB 1S3SG 2DAJA 3WA0A 4RGOS 2L76A 3OLMD 3T3NA 1N63A 1P1AA 4ZRJA 2KX3A 4EKUA 2ZCBA 1KH0A 1GOZA 2BW2A 4I6NB 4TSSA 3P4SB 4C80A 4LTUA 2KQ4X 2KFJA 2L8JA 2J0KA 4F7ZA 4N59A 2WDRB 4MELA 1UBIA 2MJEA 2EELA 1F2RC 1SF0A 3L13A 3VH3B 2QIEB 3H6NA 4HWIB 1RFAA 2IBIB 1R7SA 4J3OD 1VZ8A 1Z5SB 4WURA 4P6VF 2KTFA 3RNFC 2N9KA 2KO3A 5KHOA 4BZAA 1WM2A 2K25A 1UELA 4IWPA 2IPKD 2MH7A 4KIKA 2RPQA 1P7FA 2JQRB 4XDDA 2LVQA 1FEHA 1XEEA 1LGRA 2PE6B 4OHJA 3PZ7A 1KTKA 2L3ZA 2Y3AA 4W9KA 1Z2MA 2MA9B 4A9AA 2GI9A 5BYRA 3PZDA 3CMMB 1XD3B 1SE9A 5FR3A 4EEWA 2WQYB 1QLBB 4HDOA 2V0GA 3SR6A 2IJ0A 3V60A 2KT7A 2K5PA 2N1VA 2WU2B 4MSMB 3WCQA 3L4PA 5G2NA 2MP2A 4TQ1A 1A5RA 4WWNA 4B0EA 5TR5A 3ZTCA 2K6QA 3K9OB 1WXQA 4REZA 3O65B 4TQ0A 1K53A 4MGYE 2AX5A 2KD0A 1DOYA 2MBQA 1JWUD 1QOAA 3U4EG 4HRSA 2FIDA 2HJ8A 5AZFA 3DBRB 2LGXA 4NY0A 3A9JA 2D3BA 4YL8A 2K8CA 4TV3A 2WXOA 4RMAA 2XEWA 2LGDA 1C79A 4GMVA 1H4RA 1TT5B 3DVNV 3QA8A 2LRWA 2K9XA 1OQYA 2XK5B 4B9KA 3ZLZA 1Y8RC 3TEYA 3ABVB 3H9DA 4ZHPA 1WR6E 3WALA 3WANA 2L0FA 2D10A 1SBBB 2WDQB 3APFA 1MG4A 2WXGA 2JYTA 2KXJA 4JGHB 4DDGD 2DYBA 4MDKE 3KW5B 2LD9A 4KZCA 1N5XA 1TIFA 3MHZA 3BYTB 2LGSA 2BWES 3IG3A 4KVGB 3AEFB 2KKCA 4DHZB 4AWJA 3RNBC 3HUIA 1JWSD 2N7EA 1F9JA 4BOZB 1WXVA 2YEPF 4KDLB 1I4HA 2KZRA 4HPPA 1NI3A 3PLVA 2KK8A 1XLPA 3DOWA 1HTOA 3AXCA 4FADA 4IG7B 2IY0B 3B08A 4KSLC 2KDBA 2LXCA 2M56B 3LYYA 2K39A 2KTRA 1ZGUB 1HZ5A 2FIFA 3SHQA 2MQJA 3KUCB 2AWTA 5HKHA 2J0JA 1YX5B 2E3TA 5JH5C 3V05A 3RT3B 1GG3A 3W5UB 2MRPA 4W9GA 2RMMA 2WXPA 4G11A 5HI1A 2BTEA 1P3QU 3V61A 2HDEA 2WXMA 1TKEA 4DHJB 4LJPB 2CS4A 3VTVA 2J52A 4AQ7A 4W9LA 4MGKE 4MACA 1VJKA 1D4BA 4OZBA 3CIRB 3OG5A 3BK1A 3PTFC 4XZ4A 4HJKA 3VUYA 2UWQA 3GE8C 2PKOA 2V9HA 4P7IA 5EE1A 2PLPA 3C19A 4JX1C 1UWXA 2RSUA 3MC9A 3V6CB 1HZ6A 3RZWC 5E6OA 1GAQB 1CMXB 1UF0A 2K8BA 2IGHA 4BAXA 3SFDB 3WIMA 2WX0A 4A3PA 1FFVA 5G55A 5CTRC 3EFCA 1E8YA 2PIAA 4KKJA 3N3KB 2MEKA 2N9PC 3DVNU 2B3AA 3NS8A 2FAZA 2VZKD 3P1MA 1NDDA 1I35A 2L52A 3AU5A 4G3XB 3U8ZA 2JZ3B 4WJPA 5DPWA 1V97A 2FCQA 1QQRA 2J4XA 1WX7A 4C7YA 3Q8BA 1XQQA 2WLBA 3VR9B 4DK5A 2G3QB 2VRRB 3UQAA 2KYWA 2C60A 1T0YA 2NTTA 4ZRKA 2W54A 1KOTA 1SE3A 3DHHC 1LM8B 4M0WA 4ANXA 2GRIA 2WP9B 2N1WA 2M8SA 1ZE3D 4B95A 3E9SA 2DBYA 4GSWA 4ARIA 4AJYB 3L0WB 2N7JA 1T6BX 2NPTA 4YTNB 4EOYA 2ZVNA 2KC2A 5IA7A 2ZCCA 3NVYA 4IC7B 2VH2A 3QIJA 3ZW3A 1A70A 3ZNID 3M63B 3PRPB 1FRRA 5EE9A 4RNAA 4KIKB 1N62A 1GC6A 1WXAA 1YJJA 3TSSA 2OOBB 4R3DA 3RD2A 2CJOA 1MPEA 2QMTA 5JHAA 2QJLA 1V9JA 3AEEB 4LNKA 1PGBA 2W9NA 1SEBD 2SAKA 4IUMB 4IWOA 2K0PA 4BKTA 3W1SA 1ZKHA 3HIZA 2MBBB 4RGNA 1FIQA 2ZZPB 3BK2A 2INCC 2RD0A 3W1YA 4C00A 1T3QA 4FHKA 1RLFA 3AE4B 4ZRIA 3UF8A 3GZNI 3MP9A 5HG2A 1UH6A 4L2YA 3ZXVA 4CO7A 4MEMA 3ALBA 3BZDB 3TEXA 2BB5A 4OZCA 1JWAD 3JSVA 3TJPA 2KWCA 5MPOA 1L4DB 5EE0A 3MHSD 1QOBA 2KLGA 2C7NB 5D3DA 1KJTA 3KYCD 1SB3C 3VRAB 3P4QB 4EE2A 2LEKA 3DBHI 2KWVB 3A33B 4ANWA 4TUUA 5CX3A 3L17A 4FJVB 5DPSA 3ZIMA 2ZJDA 3NVZA 4ZDVA 1L2NA 4NQKE 1D5ZC 1WE7A 2KDIA 1FMAD 4LNFA 2JWZA 4HKQA 1FO4A 1YD8U 3TL5A 2WXNA 1HTQA 2IGDA 4KGTA 2ON8A 2DZKA 3TBLD 5J17A 2IO1B 3KUDB 2M17A 2RPVA 2GLSA 3VHTC 2E6XA 2ACZB 2R2OA 3PGEA 4ICVA 2JVCA 1NVID 2N9XA 4C7ZA 1ZDVA 1WGYA 1ZW7A 4S0RA 4I6PA 1WMHA 2LGIA 4BBNC 1FXAA 3Q8EA 1QILA 4WIPA 4K3CA 3P2BA 3HM6X 4EZJA 4K3BA 4WJNA 4N58A 2INNE 3CSTA 2IGGA 4NJ6A 2KN5A 4PK1A 2WS3B 1B1ZA 1D6EC 4NAMA 4YTMB 2LMCA 2BYTA 2I1JA 2HJ1A 1EM7A 2N9LA 2KTRB 2QC8A 4HPMB 2LVPA 4E74A 4GB9A 3KLSX 1KLGD 3T9LA 3FILA 3I9V1 4KV2A 3AEBB 2ASQA 1FCCC 1FXTB 5BMIA 1T0RC 2LASA 4HKZE 1YNTE 1V2YA 4GLSC 4GGQA 1E6EB 1ET6A 3BY4B 1IBXA 4E3CA 2WNMA 4A3OA 1WF9A 2RDHA 3H7SA 2FCSA 1OQRA 4GDLA 3DCGA 5HHDG 4N6EB 4OVVA 3URYA 2LHEA 3A9KA 4JL9A 4CYEA 5C3JB 2Y5CA 1OEYA 3NUHB 4WWOA 3AE8B 2JX5A 2VH1A 3Q69A 3ZJVA 1MG8A 1JROA 1VD2A 2PMVA 3ZNGC 3PO0A 4GIVA 4PS7A 2LFIA 3I5JC 4A8XC 1FCLA 2M0XA 4DHZE 3ZDMC 1L0XB 1L4ZB 1HEZE 3VH4B 2O6VA 4XWWA 4YWGG 2MCNB 2IO3B 1FNUA 1NI2A 1QOGA 3H1UA 2M0AA 1SIFA 4NAWB 1L5PA 1OGWA 3OJ4B 4HCNB 3W9CB 2A5UA 2AYOB 3ZNZB 3R7QA 1C1YB 1MI0A 4LDTB 4MH0E 3ZRFA 5L83A 4WJOA 3RNCC 3AULA 2BYEA 1P7EA 5E6NA 4YXDB 3GZNB 4S17A 3IXSA 2KFKA 2FNJB 1IP9A 4FBJB 2KVZA 1R4NB 1J19A 4QAYA 1PUTA 2ZW1A 3BVMA 4IKGA 2ZPNA 1V5TA 1YX6B 4IWQA 3X23A 5IOIA 4GOCA 4XX5A 1FM0D 2RDBC 3BVGA 3OAWA 3ML8A 2MJDA 1D3ZA 1GPXA 1FXIA 4X57B 3W2DA 3PHWB 3AV8A 2C7MB 4FHJA 3DBHB 1T0SC 1RRBA 2FUHB 1C77A 2NCNA 3QAQA 2NPTB 2BYFA 1FNVA 3NVVA 5AUIA 3RZFA 3KUZA 1KFYB 2K8HA 4FLHA 3NZ3A 2WXHA 3FKYA 3APCA 1Q1OA 3RNGC 2MW5A 3DHIC 2D3CA 4ARCA 4XC2A 2J53A 3EHVA 4MJSA 5BYSA 2QEJC 5JZEB 1ROEA 3FAHA 3OJ3A 2I1KA 4XWTA 2NBVB 3HM3A 1IPGA 1TS4A 4RCOA 3VQIA 1R4MI 2IDYA 5TSSA 4W9CA 3VVWB 2K3UA 3UI3A 4USAA 2D11A 3K9PB 3N20C 2BF8B 2NVUI 3MJWA 3GS2A 3HVDA 3AE3B 2OJWA 1P0RA 3QX1A 1Q10A 3NY5A 3RUIB 1WZ0A 1GC7A 3NZUA 2EMSA 3IVFA 3QWZB 2WYQA 1ZUD2 4DHJD 1D5MC 3AI5A 2V3PA 4BKSD 2OJRA 2WDVB 4M01A 2JYEA 3KQ4A 3SEBA 2EKIA 2W3SA 5G5HA 1I42A 2G1EA 2RGFA 2G4SA 4IOIE 4EFOA 2Z8LA 2N9EB 3KH0A 4II3B 3ZGZA 1UNSA 5J2RA 2C5LC 3Q6BA 1TKGA 2NTSA 1JMLA 1RYJA 2LGYA 4JWSC 2JPHA 3HHMA 1ZOYB 3DDCB 1L7YA 2KQSA 3AU4A 2BT6A 4KGRA 3C0RB 1V1PA 4HLEA 3DHGC 3U2SC 4BOSC 2HTHA 2WXJA 2PW9A 4W9EA 1MJDA 3B2GA 3X0WA 4BKGA 1ISNA 3U30A 2ZPYA 1VZ7A 3NRZA 1PGXA 2MBEA 5GMVA 3IFWB 4LNOA 2JZPA 3IBEA 1GB1A 1T0QC 1V81A 2XBBC 4DDID 1I4PA 4K7UA 3M3JA 4EUTA 3TEZA 3IHPC 5I4DA 4G0NB 1UGJA 3WAOA 3BWUD 3L08A 1NEKB 3PVLA 4IM2A 1MHHE 5DPRA 4ZYSA 1DYQA 2L83A 2Y5BB 1V80A 3ZJTA 4TKNA 4OW0A 1H8CA 4JLCA 2PEAA 2DZIA 2YVCA 3HK0A 4ZOHC 1G6JA 3DWGC 3ZRCA 4HK2A 4FULA 3ZYYX 3AEDB 1TKYA 4NQLB 4L23A 3RI7C 5E6JA 2V3NA 2LZ6A 4NZLB 1XO3A 3U7ZA 1V1OA 2BS2B 4MT5A 3PRMB 4A90A 3PPAA 1E7UA 2GBJA 1DOXA 1WGKA 1L6UA 2D2QA 1E8ZA 3R7RA 5IKCM 1QZEA 4ITKA 2GMIC 3AE7B 4C4VA 1UWMA 3Q3FA 3Q14C 2BKFA 1JWMD 4XE0A 2WXQA 1V8CA 1LQBA 1NENB 5D3IB 5HFYA 4M8NA 1EO6A 3NG0A 1VDVA 4YSYB 2O6VB 1J0GA 5FK9C 5IO9A 1PDXA 2BPSA 1R4MB 2EKEC 3D32A 5T8IA 1E5WA 1UBQA 2FCNA 3NOBA 1NBFC 3R3MA 4RFBA 4K1RB 2Z0EB 2CU1A 1HXYD 3AM9A 4WJQA 2KFKB 4A55A 1SJED 4ZYNA 1E9MA 2FUG1 4US8A 2KC1A 1CK1A 3W1SC 4ASWC 3Q8AA 1X1MA 3ZQ4A 4HEA1 1VLBA 4HPLB 4ZHOA 2WGSA 2JWUA 1WSPA 4DXAB 4FA6A 1WJ6A 1BUIC 2IO2B 4WQMA 3NZSA 2G45B 3T3OA 1QF6A 2ZEQA 2O2VA 3IAM1 4F1SA 3GB1A 4FN2A 2J7QB 1AW7A 4MH8A 1T5XD 3B2FA 4FJZA 3A1QA 1WGHA 3O13A 3ZO5B 1WWTA 2ZVOA 2FBWB 4KSKC 4WH4A 1E8XA 4I6LB 4E71A 2X38A 2I38A 1HQRD 2MP2B 1L0YB 3P63A 3IT6B 1L6VA 4N9F4 1ACCA 1WR1A 1B9RA 2IO0B 3VXWA 3L16A 4L1BA 3EC8A 4UDUC 2D3GA 3LB8C 1P98A 1V86A 1GUAB 2KVRA 5AZHA 2DZMA 2JT4B 4ACFA 1E8WA 2H89B 3HRDD 2DLBA 1SIJA 1VRAB 3A9JB 1D5XC 2CHXA 3VFKA 4AJWA 2AL6A 2JF5A 2BYVE 3AH7A 2D3AA 2CKHB 4IM3A 3B9JA 2CU3A 4M00A 3QJZA 4OVZA 3U52E 1IUEA 2L05A 1JRPA 4YSXB 5IN7A 2WU5B 1TZOA 3SDLC 4P16A 1WX8A 1SE4A 2HTME 4O1NA 2XNAC 4W9JA 3RFZB 4JWUC 2JRHA 2KNBA 1AWDA 1WXSA 3KYDD 3PLUA 4LK0M 3VTUA 1KM7A 3E56A 1I4GA 2ICIA 1V1PB 1WYGA 4EZLA 1YOVB 5BMHA 2PE9A 3ENEA 3TCAA 4RF1A 1RFKA 3UIOB 1N5WA 4HXDA 1J7CA 3R8BA 1TBEA 4LDTD 3Q3JA 1TZ1A 1WX9A 2BGFA 4ANUA 2JU6X 3DBRI 2LJ5A 1YQ3B 3QHTA 4DQOC 2SEBD 4M8MA 3RULA 2DX5B 4W9IA 1YQ4B 2WWZA 5AUKA 1J8CA 3I63C 1C9FA 1I4XA 4AUQC 3PZ8A 3TMPB 2WDTB 2BQQA 1PFDA 2BBCA 4XDCA 1NYQA 3AMZA 2GBNA 2BB6A 2KJHB 4P1BC 1WJUA 1EF5A 2REXA 3NHEB 3QCAA 1SE2A 2DZJA 1C76A 2MBHA 3P4PB 3A4RA 2KDMA 1MHXA 3AEAB 2G9HD 4YT0B 2WXFA 3FC4A 2DYMA 3RCZA 4XYCA 4RF0A 1ZDXA 1EWYC 2BVCA 1U4AA 2DNFA 2PVOD 1EF1A 2K6DB 3HVZA 3RPFC 4KKIA 4TMAB 4KX6B 4W9HA 1TY2A 4G50A 5D2MB 1F52A 1BT0A 1YQBA 5C23A 1V5OA 1S1QB 1KLUD 3AE2B 4DXFA 1AARA 2KJ6A 2D5GA 2JSVX 2XN9C 1UUPA 2NR2A 1XCTL 4PS3A 4RGMA 3QQ8B 2AQ1B 3DWMA 1XLNA 2YLMA 2ZNVC 2H88B 4D2KA 3TEWA 1EWCA 1K50A 4C4VB 1C78A 2RR9A 3EECA 1F0ZA 2KX0A 5H8YE 1CZPA 2OHFA 4EZKA 5LNK1 3VUXA 2KWUB 2N0SB 1WH3A 4GN1A 3DBLI 1BMLC 3AB5A 4A6QA 1ESFA 2MJ3A 3A4SC 4HCPB 2K1FA 3V3XA 1JQ4A 1XT9B 2J42A 1TY0A 2KMCA 3ZDTA 2QCZA 2G4DB 1XXGA 3QARA 3VTWA 4DBGA 3AECB 5D6JB 4K7SA 4M0WB 1LXDA 5DCNA 3EFUA 1KLVA 3M95A 5EE3A 2DENB 1FPYA 3N9YC 1IYFA 1YIWA 1E7PB 1UD7A 3Q2AC 5JXVA 2W55A 5L95C 2X8XX 1N6ZA 2KLCA 2B76B 1WE6A 4BFRA 2AQ3B 3IAS1 4RM9A 2INPE 2FE8A 2L1AA 3ZUNA 2GOWA 2AL3A 2BWFA 4LNNA 4LJOB 4PYZA 2C7HA 2O2VB 3BYYB 3DQVA 2KANA 4NJCA 2JXXA 3GP7A 5JHBA 2J0MA 1RAXA 4PYUA 3A1QB 1WM3A 1CQVA 1HE8A 3JYUA 4XGAB 4GXBA 2JXTA 1QOFA 3MC8A 1UZXB 2LXAA 3UQBA 4JIOU 2KMMA 3Q8FA 3S2AA 2YEPB 2L00B 2MHJA 1TGZB 1E7VA 3M62B 4II2B 2D07B 2KHWB 3JSVB 5BMGA 3PREA 4H2AA 1WIAA 3ML9A 3AN1A 4P1CC 4Q2JA 3DPDA 5IP4D 2GBRA 4ANVA 4AP4C 4WWMA 2V4IB 1SGHA 2MWSB 4CHKA 2WX1A 5FKAC 3AE1B 1E10A 2WXIA 3EUB2 5EDSA 1SJHD 3AE5B 4W9FA 1GJZA 2OEDA 2BS3B 2W3RA 5KHQA 1JALA 1F2RI 3NS1A 4WAAA 3QC8B 4K81A 4MM3A 5GXGB 2AEHA 5DPTA 1MVKA 1OFFA 1OEYJ 2KWDA 2K22A 4B6WA 1TTNA 5IAAC 3RYTA 3H7PA 2JZZA 3AE9B 2V4LA 4GDKA 4HROA 3VDZA 4WAFA 4B0MA 3PV1A 3DBSA 1J7AA 1WMHB 2EMTA 2O6VD 4IW0A 3ZVVA 3RNAC 1XF5L 1N60A 1WFYA 1ZP0B 1WXMA 5D7GA 2WXRA 4RM8A 3I3TB 4LNIA 4YTPB 3N32A 3L54A 3WAPA 3R2IA 3RNEC 3RMKC 3GE3C 3PS6A 1JW9D 1M94A 3ZJUA 4OVUA 1BXTA 4AS1A 2R2QA 3CSFA 1C4AA 1WJNA 3J9CA 2CHZA 2HD5B 2DHZA 3UGBB 3GOEA 4ZRPA 2IZVB 4JE3B 1WGRA 2L0TA 3DBLB 2JY6A 2L32A 4RGTA 2UYZB 1GB4A
chains in the Genus database with same CATH topology
4KV2A 4FJZA 3A1QA 3PHXB 1WGHA 3PSEB 4F8CB 3ZO5B 2ASQA 2ZVOA 4KSKC 4EEWA 1FXTB 4HDOA 1E8XA 2V3SA 2LASA 4I6LB 4E71A 1V2YA 4AOFA 3V60A 2N1VA 4MSMB 4GGQA 5G2NA 2MP2A 4TQ1A 3BY4B 1A5RA 4E3CA 2MP2B 4WWNA 5TR5A 3SU8X 4A3OA 4N9F4 3ZTCA 1WF9A 2K6QA 1EUVB 3K9OB 3R66C 1WR1A 3H7SA 2IO0B 2MX2A 3O65B 3VXWA 4TQ0A 2FCSA 3L16A 3EC8A 4GDLA 3DCGA 4MGYE 2KD0A 4GDLB 2D3GA 4IM0A 4OVVA 1PQSA 3A9KA 1P98A 1V86A 2MBQA 4JL9A 1GUAB 3A9KB 2KVRA 5AZHA 2DZMA 4CYEA 2FIDA 2HJ8A 2JT4B 5AEKB 1E8WA 3B0AA 5AZFA 2LGXA 4NY0A 1OEYA 4GU2A 5LXHA 3A9JA 4WWOA 4YL8A 3A9JB 1Q0WB 2K8CA 2LI5A 2CHXA 4TV3A 1V49A 3VFKA 5FR6A 1MG8A 2BKRB 4RMAA 4AJWA 1VD2A 2AL6A 3ZKJC 2XEWA 2LGDA 2JF5A 4GMVA 1H4RA 2BYVE 3ZNGC 2CKHB 4IM3A 3DVNV 4GIVA 4PS7A 3QA8A 2IY1B 2LRWA 3B1LX 3QJZA 2N7DA 2M0XA 4DHZE 3ZDMC 1WJ4A 3VH4B 1E90A 1OQYA 2DYOA 2XK5B 2O6VA 2L05A 2Z0DB 4B9KA 2MCNB 2IO3B 3ZLZA 4MGZE 1Y8RC 4NAWA 1NI2A 3H1UA 3SDLC 1SIFA 3DVGY 4NAWB 1WZ3A 1WX8A 4HVBA 3L10B 1OGWA 3BINA 3H9DA 1WR6E 2GBKA 3WALA 3WANA 2L0FA 3OJ4B 2D10A 4HCNB 3LJ3A 2A5UA 2IYDB 2AYOB 3APFA 4W9JA 4A20A 3UIPB 2KXJA 1WGDA 3ZNZB 2JRHA 2KNBA 3R7QA 1C1YB 1WXSA 4JGHB 4LDTB 2KJRA 4DDGD 1WI0A 4MH0E 3ZRFA 2DYBA 2JRIB 5L83A 3KYDD 3PLUA 4JQWC 3AULA 2BYEA 2LD9A 3KW5B 4MDKE 4WJOA 4KZCA 3ZTDA 2CR5A 4DWFA 5E6NA 4BBNF 3T8MA 2KFKA 1KM7A 3VTUA 2FNJB 4MGIE 1IP9A 4FBJB 2BWES 1C3TA 3PRZA 1J19A 3IG3A 4KVGB 2KKCA 1V6EA 2C9WB 5D94A 4DHZB 2ZNVB 4AWJA 2ZPNA 2N7EA 1V5TA 1F9JA 1YX6B 4IWQA 3X23A 4EZLA 2KQ7A 5CHVC 4BOZB 2M4NA 1WXVA 2PE9A 4GOCA 4XX5A 3ENEA 3OAWA 3TCAA 3ML8A 4KDLB 2KZRA 1D3ZA 3UIOB 3PLVA 4X57B 3APDA 2KK8A 4HXDA 4KDIC 2A4ZA 3PHWB 1TBEA 3DOWA 4FADA 3AXCA 2C7MB 4IG7B 4FHJA 2IY0B 3B08A 4LDTD 1RRBA 2FUHB 3CF6E 3Q3JA 2KDBA 2LXCA 2NCNA 4KSLC 3ZNHB 1TZ1A 3QAQA 1WX9A 2NPTB 2BYFA 2BGFA 2K39A 2KTRA 3UINB 1ZGUB 4ANUA 3DBRI 3KUZA 3RZFA 2FIFA 2LJ5A 3QHTA 4M8MA 3RULA 2DX5B 3SHQA 4W9IA 2MQJA 2K8HA 2HE7A 2WWZA 4FLHA 1J8CA 3KUCB 2AWTA 3VAWA 2J0JA 1YX5B 5HKHA 5JH5C 2DAFA 4AUQC 3APCA 3JVZX 1Q1OA 3RT3B 3TMPB 2KDEB 1GG3A 2WDTB 4WWPA 2MRPA 5BO4B 2MW5A 2GBNA 2M1MA 2LWPA 2KJHB 4W9DA 2JUOA 4W9GA 1WJUA 4XC2A 1EF5A 3EHVA 4G11A 4MJSA 2LVOA 2REXA 5JZEB 3NHEB 4MJSB 1P3QU 3V61A 2LUEA 3QCAA 2DZJA 1Q5WB 3OJ3A 2MBHA 2I1KA 4DHJB 3A4RA 4LJPB 2NBVB 2CS4A 3VTVA 3HM3A 2Z59B 1IPGA 3MTNB 4PS8A 1R4MI 3VQIA 2DYMA 3RCZA 4W9LA 1U4AA 4MGKE 1JRUA 1EF1A 2K6DB 4W9CA 3VVWB 3LDZE 3WAMA 4W9HA 2D11A 3K9PB 3PTFC 4XZ4A 2BF8B 2NVUI 3MJWA 4G50A 4LCDE 5D2MB 4KZ0A 4HJKA 3TIXA 3VUYA 2UWQA 4WQOB 1P0RA 3QX1A 4MSQB 3NY5A 4P7IA 1BT0A 3RUIB 1WZ0A 1GC7A 1YQBA 5C23A 1V5OA 3NZUA 1VCBA 2EMSA 1S1QB 2FCMA 2RSUA 3IVFA 1R4NI 2WYQA 3PT2B 3QWZB 3V6CB 3RZWC 4DHJD 5E6OA 5LXIB 3AI5A 4BKSD 2NS5A 1AARA 2KJ6A 2OJRA 1CMXB 2MLBA 2N4FA 2K8BA 2NR2A 3V6EB 4PS3A 3QQ8B 1I42A 3WIMA 2YLMA 2RGFA 2G4SA 2XK5A 2ZNVC 2WX0A 4EFOA 3QK0A 4A3PA 2PJHA 5G55A 2N9EB 3KH0A 4II3B 4URKA 5CTRC 5J2RA 1WRDB 1E8YA 2C5LC 2RR9A 3EECA 2KX0A 4EZKA 3N3KB 2N9PC 3VUXA 3DVNU 2B3AA 3NS8A 1OTRB 2KWUB 2FAZA 2L7RA 3SD5A 1NDDA 1WH3A 1I35A 4GN1A 2LGYA 3DBLI 2JPHA 3AU5A 4G3XB 4BVUC 3U8ZA 3HHMA 3V62A 4NNJB 2NBWB 2JZ3B 4WJPA 3DDCB 5DPWA 3A4SC 4HCPB 2K1FA 1WY8A 1L7YA 1XT9B 4HDQA 2FCQA 2KQSA 2KMCA 3AU4A 1WX7A 1YJ1A 3C0RB 1WGGA 3ZDTA 4HLEA 1XQQA 2G4DB 4BOSC 2HTHA 4DK5A 2G3QB 3QARA 4W9EA 1GNUA 2GBMA 3VTWA 3U7DA 4DBGA 2VRRB 3X0WA 1ISNA 4BKGA 3UQAA 2C60A 1T0YA 5D6JB 3U30A 4ZRKA 2ZPYA 1KOTA 2LRUA 1LM8B 3H7PB 4ANXA 4K7SA 4M0WB 1LXDA 2N1WA 4GDKB 3EFUA 3ECIA 2MBEA 2M8SA 5DCNA 4NJ7A 5GMVA 4B95A 1KLVA 3IFWB 3M95A 3IBEA 1V81A 4GSWA 5C1ZA 2DENB 2XBBC 4DDID 4AJYB 3L0WB 2NPTA 1IYFA 1WYWB 4EOYA 2ZVNA 2KC2A 5IA7A 2ZCCA 1YIWA 3M3JA 2KMAA 4K7UA 1UD7A 4EUTA 3IHPC 2CHWA 4IC7B 2MBOA 5L95C 3QIJA 2KLCA 3ZW3A 4G0NB 5LLIA 2KOXA 3ZNID 3M63B 5CHFA 3PRPB 1WE6A 3JW0X 1LFDA 3WAOA 4BFRA 4KIKB 4FJYA 1K8RB 2V1YA 1GC6A 3L08A 5E6PA 2PPHA 1WXAA 3DVGX 4RM9A 2NBUA 5CHWA 3PVLA 2OOBB 4IM2A 4J6IA 3RD2A 3ZUNA 5DPRA 4BKSA 2GOWA 2AL3A 2BWFA 5JHAA 1V9JA 4LJOB 4PYZA 2Y5BB 2C7HA 1V80A 2MSED 2O2VB 3DQVA 4TKNA 2W9NA 2KANA 2JXXA 1H8CA 4JLCA 2PEAA 5JHBA 2J0MA 1RAXA 2DZIA 4IUMB 2YVCA 4IWOA 4PYUA 3A1QB 3HK0A 4BKTA 3W1SA 2QHOA 1WM3A 1G6JA 5AZGA 1ZKHA 3HIZA 2MBBB 3ZRCA 1HE8A 3JYUA 2ZZPB 4HK2A 4FULA 4GXBA 3VUWA 2RD0A 3W1YA 1P9DU 1UGMA 1UZXB 3ONSA 4K7WA 2LXAA 4ICUA 4NQLB 4FHKA 3UQBA 4JIOU 1RLFA 4ZRIA 3UF8A 2LZ6A 3GZNI 3S2AA 5J18A 1UH6A 2L00B 4CO7A 1TGZB 1E7VA 4MEMA 3ALBA 2KDFB 3PRMB 4NPNA 3M62B 4II2B 3N30A 3KVFB 1S3SG 3PPAA 1E7UA 2GBJA 2D07B 2DAJA 3JSVA 3TJPA 2KHWB 3JSVB 2KWCA 2D2QA 1E8ZA 3WA0A 3MHSD 3R7RA 3PREA 2KLGA 2C7NB 2L76A 1WIAA 3ML9A 1QZEA 3OLMD 3DPDA 1KJTA 2GBRA 3KYCD 4ANVA 4AP4C 2GMIC 1P1AA 3Q3FA 4ZRJA 2BKFA 2KX3A 3DBHI 2KWVB 1SGHA 3A33B 2MWSB 4ANWA 4CHKA 4EKUA 2WX1A 2ZCBA 4TUUA 5CX3A 1LQBA 3L17A 4FJVB 5DPSA 3ZIMA 4M8NA 5EDSA 1EO6A 2ZJDA 1L2NA 4ZDVA 4W9FA 4NQKE 1GJZA 1WE7A 2KDIA 2O6VB 4I6NB 5KHQA 1J0GA 2JWZA 2KFJA 2L8JA 4WAAA 2J0KA 4F7ZA 3QC8B 1YD8U 2BPSA 2EKEC 3D32A 4K81A 1E5WA 4MM3A 4MELA 1UBQA 2AEHA 3TL5A 2FCNA 1UBIA 5DPTA 3NOBA 1NBFC 2DZKA 3TBLD 5J17A 2IO1B 1OEYJ 3KUDB 3R3MA 4K1RB 2M17A 2Z0EB 3L13A 4B6WA 3VHTC 3VH3B 2CU1A 1TTNA 5IAAC 3RYTA 2R2OA 3PGEA 4ICVA 2JVCA 3H7PA 2N9XA 3H6NA 4HWIB 2JZZA 2V4LA 4GDKA 1WGYA 1ZW7A 1RFAA 2IBIB 3VDZA 4WJQA 2KFKB 3PV1A 3DBSA 4I6PA 1WMHA 1Z5SB 4ZYNA 1WMHB 2EMTA 2O6VD 2KTFA 4BBNC 2KC1A 4IW0A 3ZVVA 3W1SC 4ASWC 2KO3A 5KHOA 1X1MA 1WFYA 4HPLB 1WM2A 1WXMA 3P2BA 5D7GA 3HM6X 4EZJA 2K25A 4RM8A 3I3TB 3N32A 3L54A 3WAPA 4WJNA 4DXAB 3CSTA 1UELA 4IWPA 2KN5A 4NJ6A 4FA6A 3PS6A 4KIKA 1WJ6A 2RPQA 1M94A 2IO2B 2LVQA 4OVUA 2R2QA 2PE6B 2I1JA 3CSFA 3NZSA 1WJNA 2G45B 2L3ZA 2KTRB 2CHZA 2HD5B 2DHZA 4HPMB 2LVPA 4E74A 3UGBB 4W9KA 3GOEA 1Z2MA 2MA9B 2O2VA 2ZEQA 4F1SA 4GB9A 2IZVB 3PZDA 1WGRA 2L0TA 3CMMB 3T9LA 1XD3B 2JY6A 2UYZB 4FN2A 2J7QB 1SE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KV2 A;  4FJZ A;  3A1Q A;  3PHX B;  1WGH A;  3PSE B;  4F8C B;  3ZO5 B;  2ASQ A;  2ZVO A;  4KSK C;  4EEW A;  1FXT B;  4HDO A;  1E8X A;  2V3S A;  2LAS A;  4I6L B;  4E71 A;  1V2Y A;  4AOF A;  3V60 A;  2N1V A;  4MSM B;  4GGQ A;  5G2N A;  2MP2 A;  4TQ1 A;  3BY4 B;  1A5R A;  4E3C A;  2MP2 B;  4WWN A;  5TR5 A;  3SU8 X;  4A3O A;  4N9F 4;  3ZTC A;  1WF9 A;  2K6Q A;  1EUV B;  3K9O B;  3R66 C;  1WR1 A;  3H7S A;  2IO0 B;  2MX2 A;  3O65 B;  3VXW A;  4TQ0 A;  2FCS A;  3L16 A;  3EC8 A;  4GDL A;  3DCG A;  4MGY E;  2KD0 A;  4GDL B;  2D3G A;  4IM0 A;  4OVV A;  1PQS A;  3A9K A;  1P98 A;  1V86 A;  2MBQ A;  4JL9 A;  1GUA B;  3A9K B;  2KVR A;  5AZH A;  2DZM A;  4CYE A;  2FID A;  2HJ8 A;  2JT4 B;  5AEK B;  1E8W A;  3B0A A;  5AZF A;  2LGX A;  4NY0 A;  1OEY A;  4GU2 A;  5LXH A;  3A9J A;  4WWO A;  4YL8 A;  3A9J B;  1Q0W B;  2K8C A;  2LI5 A;  2CHX A;  4TV3 A;  1V49 A;  3VFK A;  5FR6 A;  1MG8 A;  2BKR B;  4RMA A;  4AJW A;  1VD2 A;  2AL6 A;  3ZKJ C;  2XEW A;  2LGD A;  2JF5 A;  4GMV A;  1H4R A;  2BYV E;  3ZNG C;  2CKH B;  4IM3 A;  3DVN V;  4GIV A;  4PS7 A;  3QA8 A;  2IY1 B;  2LRW A;  3B1L X;  3QJZ A;  2N7D A;  2M0X A;  4DHZ E;  3ZDM C;  1WJ4 A;  3VH4 B;  1E90 A;  1OQY A;  2DYO A;  2XK5 B;  2O6V A;  2L05 A;  2Z0D B;  4B9K A;  2MCN B;  2IO3 B;  3ZLZ A;  4MGZ E;  1Y8R C;  4NAW A;  1NI2 A;  3H1U A;  3SDL C;  1SIF A;  3DVG Y;  4NAW B;  1WZ3 A;  1WX8 A;  4HVB A;  3L10 B;  1OGW A;  3BIN A;  3H9D A;  1WR6 E;  2GBK A;  3WAL A;  3WAN A;  2L0F A;  3OJ4 B;  2D10 A;  4HCN B;  3LJ3 A;  2A5U A;  2IYD B;  2AYO B;  3APF A;  4W9J A;  4A20 A;  3UIP B;  2KXJ A;  1WGD A;  3ZNZ B;  2JRH A;  2KNB A;  3R7Q A;  1C1Y B;  1WXS A;  4JGH B;  4LDT B;  2KJR A;  4DDG D;  1WI0 A;  4MH0 E;  3ZRF A;  2DYB A;  2JRI B;  5L83 A;  3KYD D;  3PLU A;  4JQW C;  3AUL A;  2BYE A;  2LD9 A;  3KW5 B;  4MDK E;  4WJO A;  4KZC A;  3ZTD A;  2CR5 A;  4DWF A;  5E6N A;  4BBN F;  3T8M A;  2KFK A;  1KM7 A;  3VTU A;  2FNJ B;  4MGI E;  1IP9 A;  4FBJ B;  2BWE S;  1C3T A;  3PRZ A;  1J19 A;  3IG3 A;  4KVG B;  2KKC A;  1V6E A;  2C9W B;  5D94 A;  4DHZ B;  2ZNV B;  4AWJ A;  2ZPN A;  2N7E A;  1V5T A;  1F9J A;  1YX6 B;  4IWQ A;  3X23 A;  4EZL A;  2KQ7 A;  5CHV C;  4BOZ B;  2M4N A;  1WXV A;  2PE9 A;  4GOC A;  4XX5 A;  3ENE A;  3OAW A;  3TCA A;  3ML8 A;  4KDL B;  2KZR A;  1D3Z A;  3UIO B;  3PLV A;  4X57 B;  3APD A;  2KK8 A;  4HXD A;  4KDI C;  2A4Z A;  3PHW B;  1TBE A;  3DOW A;  4FAD A;  3AXC A;  2C7M B;  4IG7 B;  4FHJ A;  2IY0 B;  3B08 A;  4LDT D;  1RRB A;  2FUH B;  3CF6 E;  3Q3J A;  2KDB A;  2LXC A;  2NCN A;  4KSL C;  3ZNH B;  1TZ1 A;  3QAQ A;  1WX9 A;  2NPT B;  2BYF A;  2BGF A;  2K39 A;  2KTR A;  3UIN B;  1ZGU B;  4ANU A;  3DBR I;  3KUZ A;  3RZF A;  2FIF A;  2LJ5 A;  3QHT A;  4M8M A;  3RUL A;  2DX5 B;  3SHQ A;  4W9I A;  2MQJ A;  2K8H A;  2HE7 A;  2WWZ A;  4FLH A;  1J8C A;  3KUC B;  2AWT A;  3VAW A;  2J0J A;  1YX5 B;  5HKH A;  5JH5 C;  2DAF A;  4AUQ C;  3APC A;  3JVZ X;  1Q1O A;  3RT3 B;  3TMP B;  2KDE B;  1GG3 A;  2WDT B;  4WWP A;  2MRP A;  5BO4 B;  2MW5 A;  2GBN A;  2M1M A;  2LWP A;  2KJH B;  4W9D A;  2JUO A;  4W9G A;  1WJU A;  4XC2 A;  1EF5 A;  3EHV A;  4G11 A;  4MJS A;  2LVO A;  2REX A;  5JZE B;  3NHE B;  4MJS B;  1P3Q U;  3V61 A;  2LUE A;  3QCA A;  2DZJ A;  1Q5W B;  3OJ3 A;  2MBH A;  2I1K A;  4DHJ B;  3A4R A;  4LJP B;  2NBV B;  2CS4 A;  3VTV A;  3HM3 A;  2Z59 B;  1IPG A;  3MTN B;  4PS8 A;  1R4M I;  3VQI A;  2DYM A;  3RCZ A;  4W9L A;  1U4A A;  4MGK E;  1JRU A;  1EF1 A;  2K6D B;  4W9C A;  3VVW B;  3LDZ E;  3WAM A;  4W9H A;  2D11 A;  3K9P B;  3PTF C;  4XZ4 A;  2BF8 B;  2NVU I;  3MJW A;  4G50 A;  4LCD E;  5D2M B;  4KZ0 A;  4HJK A;  3TIX A;  3VUY A;  2UWQ A;  4WQO B;  1P0R A;  3QX1 A;  4MSQ B;  3NY5 A;  4P7I A;  1BT0 A;  3RUI B;  1WZ0 A;  1GC7 A;  1YQB A;  5C23 A;  1V5O A;  3NZU A;  1VCB A;  2EMS A;  1S1Q B;  2FCM A;  2RSU A;  3IVF A;  1R4N I;  2WYQ A;  3PT2 B;  3QWZ B;  3V6C B;  3RZW C;  4DHJ D;  5E6O A;  5LXI B;  3AI5 A;  4BKS D;  2NS5 A;  1AAR A;  2KJ6 A;  2OJR A;  1CMX B;  2MLB A;  2N4F A;  2K8B A;  2NR2 A;  3V6E B;  4PS3 A;  3QQ8 B;  1I42 A;  3WIM A;  2YLM A;  2RGF A;  2G4S A;  2XK5 A;  2ZNV C;  2WX0 A;  4EFO A;  3QK0 A;  4A3P A;  2PJH A;  5G55 A;  2N9E B;  3KH0 A;  4II3 B;  4URK A;  5CTR C;  5J2R A;  1WRD B;  1E8Y A;  2C5L C;  2RR9 A;  3EEC A;  2KX0 A;  4EZK A;  3N3K B;  2N9P C;  3VUX A;  3DVN U;  2B3A A;  3NS8 A;  1OTR B;  2KWU B;  2FAZ A;  2L7R A;  3SD5 A;  1NDD A;  1WH3 A;  1I35 A;  4GN1 A;  2LGY A;  3DBL I;  2JPH A;  3AU5 A;  4G3X B;  4BVU C;  3U8Z A;  3HHM A;  3V62 A;  4NNJ B;  2NBW B;  2JZ3 B;  4WJP A;  3DDC B;  5DPW A;  3A4S C;  4HCP B;  2K1F A;  1WY8 A;  1L7Y A;  1XT9 B;  4HDQ A;  2FCQ A;  2KQS A;  2KMC A;  3AU4 A;  1WX7 A;  1YJ1 A;  3C0R B;  1WGG A;  3ZDT A;  4HLE A;  1XQQ A;  2G4D B;  4BOS C;  2HTH A;  4DK5 A;  2G3Q B;  3QAR A;  4W9E A;  1GNU A;  2GBM A;  3VTW A;  3U7D A;  4DBG A;  2VRR B;  3X0W A;  1ISN A;  4BKG A;  3UQA A;  2C60 A;  1T0Y A;  5D6J B;  3U30 A;  4ZRK A;  2ZPY A;  1KOT A;  2LRU A;  1LM8 B;  3H7P B;  4ANX A;  4K7S A;  4M0W B;  1LXD A;  2N1W A;  4GDK B;  3EFU A;  3ECI A;  2MBE A;  2M8S A;  5DCN A;  4NJ7 A;  5GMV A;  4B95 A;  1KLV A;  3IFW B;  3M95 A;  3IBE A;  1V81 A;  4GSW A;  5C1Z A;  2DEN B;  2XBB C;  4DDI D;  4AJY B;  3L0W B;  2NPT A;  1IYF A;  1WYW B;  4EOY A;  2ZVN A;  2KC2 A;  5IA7 A;  2ZCC A;  1YIW A;  3M3J A;  2KMA A;  4K7U A;  1UD7 A;  4EUT A;  3IHP C;  2CHW A;  4IC7 B;  2MBO A;  5L95 C;  3QIJ A;  2KLC A;  3ZW3 A;  4G0N B;  5LLI A;  2KOX A;  3ZNI D;  3M63 B;  5CHF A;  3PRP B;  1WE6 A;  3JW0 X;  1LFD A;  3WAO A;  4BFR A;  4KIK B;  4FJY A;  1K8R B;  2V1Y A;  1GC6 A;  3L08 A;  5E6P A;  2PPH A;  1WXA A;  3DVG X;  4RM9 A;  2NBU A;  5CHW A;  3PVL A;  2OOB B;  4IM2 A;  4J6I A;  3RD2 A;  3ZUN A;  5DPR A;  4BKS A;  2GOW A;  2AL3 A;  2BWF A;  5JHA A;  1V9J A;  4LJO B;  4PYZ A;  2Y5B B;  2C7H A;  1V80 A;  2MSE D;  2O2V B;  3DQV A;  4TKN A;  2W9N A;  2KAN A;  2JXX A;  1H8C A;  4JLC A;  2PEA A;  5JHB A;  2J0M A;  1RAX A;  2DZI A;  4IUM B;  2YVC A;  4IWO A;  4PYU A;  3A1Q B;  3HK0 A;  4BKT A;  3W1S A;  2QHO A;  1WM3 A;  1G6J A;  5AZG A;  1ZKH A;  3HIZ A;  2MBB B;  3ZRC A;  1HE8 A;  3JYU A;  2ZZP B;  4HK2 A;  4FUL A;  4GXB A;  3VUW A;  2RD0 A;  3W1Y A;  1P9D U;  1UGM A;  1UZX B;  3ONS A;  4K7W A;  2LXA A;  4ICU A;  4NQL B;  4FHK A;  3UQB A;  4JIO U;  1RLF A;  4ZRI A;  3UF8 A;  2LZ6 A;  3GZN I;  3S2A A;  5J18 A;  1UH6 A;  2L00 B;  4CO7 A;  1TGZ B;  1E7V A;  4MEM A;  3ALB A;  2KDF B;  3PRM B;  4NPN A;  3M62 B;  4II2 B;  3N30 A;  3KVF B;  1S3S G;  3PPA A;  1E7U A;  2GBJ A;  2D07 B;  2DAJ A;  3JSV A;  3TJP A;  2KHW B;  3JSV B;  2KWC A;  2D2Q A;  1E8Z A;  3WA0 A;  3MHS D;  3R7R A;  3PRE A;  2KLG A;  2C7N B;  2L76 A;  1WIA A;  3ML9 A;  1QZE A;  3OLM D;  3DPD A;  1KJT A;  2GBR A;  3KYC D;  4ANV A;  4AP4 C;  2GMI C;  1P1A A;  3Q3F A;  4ZRJ A;  2BKF A;  2KX3 A;  3DBH I;  2KWV B;  1SGH A;  3A33 B;  2MWS B;  4ANW A;  4CHK A;  4EKU A;  2WX1 A;  2ZCB A;  4TUU A;  5CX3 A;  1LQB A;  3L17 A;  4FJV B;  5DPS A;  3ZIM A;  4M8N A;  5EDS A;  1EO6 A;  2ZJD A;  1L2N A;  4ZDV A;  4W9F A;  4NQK E;  1GJZ A;  1WE7 A;  2KDI A;  2O6V B;  4I6N B;  5KHQ A;  1J0G A;  2JWZ A;  2KFJ A;  2L8J A;  4WAA A;  2J0K A;  4F7Z A;  3QC8 B;  1YD8 U;  2BPS A;  2EKE C;  3D32 A;  4K81 A;  1E5W A;  4MM3 A;  4MEL A;  1UBQ A;  2AEH A;  3TL5 A;  2FCN A;  1UBI A;  5DPT A;  3NOB A;  1NBF C;  2DZK A;  3TBL D;  5J17 A;  2IO1 B;  1OEY J;  3KUD B;  3R3M A;  4K1R B;  2M17 A;  2Z0E B;  3L13 A;  4B6W A;  3VHT C;  3VH3 B;  2CU1 A;  1TTN A;  5IAA C;  3RYT A;  2R2O A;  3PGE A;  4ICV A;  2JVC A;  3H7P A;  2N9X A;  3H6N A;  4HWI B;  2JZZ A;  2V4L A;  4GDK A;  1WGY A;  1ZW7 A;  1RFA A;  2IBI B;  3VDZ A;  4WJQ A;  2KFK B;  3PV1 A;  3DBS A;  4I6P A;  1WMH A;  1Z5S B;  4ZYN A;  1WMH B;  2EMT A;  2O6V D;  2KTF A;  4BBN C;  2KC1 A;  4IW0 A;  3ZVV A;  3W1S C;  4ASW C;  2KO3 A;  5KHO A;  1X1M A;  1WFY A;  4HPL B;  1WM2 A;  1WXM A;  3P2B A;  5D7G A;  3HM6 X;  4EZJ A;  2K25 A;  4RM8 A;  3I3T B;  3N32 A;  3L54 A;  3WAP A;  4WJN A;  4DXA B;  3CST A;  1UEL A;  4IWP A;  2KN5 A;  4NJ6 A;  4FA6 A;  3PS6 A;  4KIK A;  1WJ6 A;  2RPQ A;  1M94 A;  2IO2 B;  2LVQ A;  4OVU A;  2R2Q A;  2PE6 B;  2I1J A;  3CSF A;  3NZS A;  1WJN A;  2G45 B;  2L3Z A;  2KTR B;  2CHZ A;  2HD5 B;  2DHZ A;  4HPM B;  2LVP A;  4E74 A;  3UGB B;  4W9K A;  3GOE A;  1Z2M A;  2MA9 B;  2O2V A;  2ZEQ A;  4F1S A;  4GB9 A;  2IZV B;  3PZD A;  1WGR A;  2L0T A;  3CMM B;  3T9L A;  1XD3 B;  2JY6 A;  2UYZ B;  4FN2 A;  2J7Q B;  1SE9 A; 
#chains in the Genus database with same CATH topology
 2DWQ A;  3FIL B;  3PSE B;  3PHX B;  4F8C B;  1ET9 A;  2V3S A;  1RWS A;  4HJG E;  4AOF A;  2WXK A;  2LJI A;  3LXF A;  1IBX B;  3KWL A;  3SU8 X;  3R66 C;  1EUV B;  2KAJ A;  2KN4 A;  1FRD A;  1PYW D;  2MX2 A;  3H8H A;  4GDL B;  4IM0 A;  1PQS A;  3A9K B;  1EU3 A;  1WRI A;  2CJN A;  5AEK B;  3B0A A;  4GU2 A;  5LXH A;  1I4R A;  1Q0W B;  2LI5 A;  1V49 A;  5FR6 A;  2BKR B;  1AYF A;  3ZKJ C;  4OZA A;  3CWI A;  2GB1 A;  1NYR A;  4FXC A;  2IY1 B;  3SFE B;  3B1L X;  2N7D A;  1XLQ A;  1WJ4 A;  1XLO A;  1E90 A;  2DYO A;  2I2Y A;  2Z0D B;  1ZPS A;  1Y56 A;  4MGZ E;  4NAW A;  1TJE A;  1F77 A;  1C4P A;  3DVG Y;  1WZ3 A;  4HVB A;  3L10 B;  3BIN A;  1PGA A;  2GBK A;  3AEG B;  2NMQ A;  3LJ3 A;  2IYD B;  1I7H A;  4A20 A;  3UIP B;  1WGD A;  2IND C;  4LLG M;  3RN9 C;  2WHI A;  2Q5W D;  2KJR A;  1WI0 A;  2JRI B;  3NVW A;  4JQW C;  4DWF A;  3ZTD A;  1FFU A;  2CR5 A;  2WXL A;  2LUM A;  4BBN F;  3T8M A;  1K51 A;  2BS4 B;  4MGI E;  1C3T A;  3BVZ A;  3PRZ A;  1V6E A;  1TS2 A;  1XCQ L;  2C9W B;  5D94 A;  2ZNV B;  2KQ7 A;  5CHV C;  3EGR A;  2M4N A;  1CJE A;  3C8Y A;  3BII D;  1HA5 A;  3APD A;  3R2T A;  4KDI C;  2A4Z A;  3CF6 E;  5H92 C;  3ZNH B;  3UIN B;  3N1X C;  3TUO A;  3I57 A;  1EU4 A;  2PTL A;  3N1Y C;  1LO5 D;  2HE7 A;  2PVG C;  3VAW A;  1J7B A;  2Y5P A;  2DAF A;  2AQ2 B;  3JVZ X;  1DOI A;  4DXG A;  2KDE B;  5BO4 B;  4WWP A;  2UU7 A;  2M1M A;  2LWP A;  1OQQ A;  4W9D A;  2JUO A;  4US9 A;  2LVO A;  4MJS B;  2LUE A;  1Q5W B;  3OWE B;  3MJ5 A;  4YSZ B;  2Z59 B;  3MTN B;  1TS3 A;  4PS8 A;  1JRU A;  1ENF A;  2M19 A;  3LDZ E;  3WAM A;  1AN8 A;  1SXT A;  4LCD E;  2TSS A;  4KZ0 A;  3TIX A;  4WQO B;  1SSN A;  4MSQ B;  5G5G A;  1JCK B;  4CQN A;  4M02 A;  3IT4 B;  1RM6 C;  1VCB A;  2FCM A;  2QIL A;  1R4N I;  2VZK B;  3PT2 B;  2ONQ A;  5LXI B;  2NS5 A;  2MLB A;  2N4F A;  3V6E B;  3ZXR A;  1QKZ A;  2W82 A;  2XK5 A;  4RH6 A;  1YN5 A;  3QK0 A;  2PJH A;  1DGJ A;  4URK A;  3AE6 B;  4ZRQ A;  1WRD B;  3N1Z C;  4C56 C;  4JPS A;  1OTR B;  2L7R A;  3SD5 A;  3W5V B;  1M4V A;  1JWB D;  1FNW A;  4BVU C;  3V62 A;  4NNJ B;  1TS5 A;  2NBW B;  1I4Q A;  1L0V B;  1WY8 A;  4HDQ A;  1F1H A;  2QDF A;  2QSD A;  1YJ1 A;  4MM3 B;  3VRB B;  1WGG A;  1YN3 A;  3Q3N C;  1KRH A;  1GNU A;  2GBM A;  3U7D A;  2RDG A;  2KAC A;  5BYQ A;  3VR8 B;  1K52 A;  2LRU A;  1YMH E;  3H7P B;  4GDK B;  3ECI A;  4NJ7 A;  5C1Z A;  1TYG B;  3MC0 B;  1WYW B;  1IGC A;  1N61 A;  1STE A;  2KMA A;  2CHW A;  2MBO A;  3Q3M C;  1E0Z A;  5LLI A;  2KOX A;  1QT9 A;  5CHF A;  4IDI A;  3JW0 X;  1LFD A;  5C2T B;  4FJY A;  1K8R B;  2V1Y A;  5E6P A;  2PPH A;  2ZW0 A;  3DVG X;  2NBU A;  5CHW A;  1YJI A;  4J6I A;  4BKS A;  1ZXH A;  3KWV A;  3P4R B;  3MFG A;  2MSE D;  1YN4 A;  2LHD A;  1IGD A;  3EA6 A;  3P42 A;  2QHO A;  3NJT A;  5AZG A;  1C4C A;  3Q3O C;  1ZXI A;  3VUW A;  1MFW A;  1VR9 A;  1P9D U;  1UGM A;  4KGS A;  1FD6 A;  1VZ6 A;  3ONS A;  4K7W A;  4ICU A;  3Q8C A;  2R61 A;  5J18 A;  4PT5 A;  2KDF B;  3ETR A;  4NPN A;  1KF6 B;  3N30 A;  3KVF B;  1S3S G;  2DAJ A;  3WA0 A;  4RGO S;  2L76 A;  3OLM D;  3T3N A;  1N63 A;  1P1A A;  4ZRJ A;  2KX3 A;  4EKU A;  2ZCB A;  1KH0 A;  1GOZ A;  2BW2 A;  4I6N B;  4TSS A;  3P4S B;  4C80 A;  4LTU A;  2KQ4 X;  2KFJ A;  2L8J A;  2J0K A;  4F7Z A;  4N59 A;  2WDR B;  4MEL A;  1UBI A;  2MJE A;  2EEL A;  1F2R C;  1SF0 A;  3L13 A;  3VH3 B;  2QIE B;  3H6N A;  4HWI B;  1RFA A;  2IBI B;  1R7S A;  4J3O D;  1VZ8 A;  1Z5S B;  4WUR A;  4P6V F;  2KTF A;  3RNF C;  2N9K A;  2KO3 A;  5KHO A;  4BZA A;  1WM2 A;  2K25 A;  1UEL A;  4IWP A;  2IPK D;  2MH7 A;  4KIK A;  2RPQ A;  1P7F A;  2JQR B;  4XDD A;  2LVQ A;  1FEH A;  1XEE A;  1LGR A;  2PE6 B;  4OHJ A;  3PZ7 A;  1KTK A;  2L3Z A;  2Y3A A;  4W9K A;  1Z2M A;  2MA9 B;  4A9A A;  2GI9 A;  5BYR A;  3PZD A;  3CMM B;  1XD3 B;  1SE9 A;  5FR3 A;  4EEW A;  2WQY B;  1QLB B;  4HDO A;  2V0G A;  3SR6 A;  2IJ0 A;  3V60 A;  2KT7 A;  2K5P A;  2N1V A;  2WU2 B;  4MSM B;  3WCQ A;  3L4P A;  5G2N A;  2MP2 A;  4TQ1 A;  1A5R A;  4WWN A;  4B0E A;  5TR5 A;  3ZTC A;  2K6Q A;  3K9O B;  1WXQ A;  4REZ A;  3O65 B;  4TQ0 A;  1K53 A;  4MGY E;  2AX5 A;  2KD0 A;  1DOY A;  2MBQ A;  1JWU D;  1QOA A;  3U4E G;  4HRS A;  2FID A;  2HJ8 A;  5AZF A;  3DBR B;  2LGX A;  4NY0 A;  3A9J A;  2D3B A;  4YL8 A;  2K8C A;  4TV3 A;  2WXO A;  4RMA A;  2XEW A;  2LGD A;  1C79 A;  4GMV A;  1H4R A;  1TT5 B;  3DVN V;  3QA8 A;  2LRW A;  2K9X A;  1OQY A;  2XK5 B;  4B9K A;  3ZLZ A;  1Y8R C;  3TEY A;  3ABV B;  3H9D A;  4ZHP A;  1WR6 E;  3WAL A;  3WAN A;  2L0F A;  2D10 A;  1SBB B;  2WDQ B;  3APF A;  1MG4 A;  2WXG A;  2JYT A;  2KXJ A;  4JGH B;  4DDG D;  2DYB A;  4MDK E;  3KW5 B;  2LD9 A;  4KZC A;  1N5X A;  1TIF A;  3MHZ A;  3BYT B;  2LGS A;  2BWE S;  3IG3 A;  4KVG B;  3AEF B;  2KKC A;  4DHZ B;  4AWJ A;  3RNB C;  3HUI A;  1JWS D;  2N7E A;  1F9J A;  4BOZ B;  1WXV A;  2YEP F;  4KDL B;  1I4H A;  2KZR A;  4HPP A;  1NI3 A;  3PLV A;  2KK8 A;  1XLP A;  3DOW A;  1HTO A;  3AXC A;  4FAD A;  4IG7 B;  2IY0 B;  3B08 A;  4KSL C;  2KDB A;  2LXC A;  2M56 B;  3LYY A;  2K39 A;  2KTR A;  1ZGU B;  1HZ5 A;  2FIF A;  3SHQ A;  2MQJ A;  3KUC B;  2AWT A;  5HKH A;  2J0J A;  1YX5 B;  2E3T A;  5JH5 C;  3V05 A;  3RT3 B;  1GG3 A;  3W5U B;  2MRP A;  4W9G A;  2RMM A;  2WXP A;  4G11 A;  5HI1 A;  2BTE A;  1P3Q U;  3V61 A;  2HDE A;  2WXM A;  1TKE A;  4DHJ B;  4LJP B;  2CS4 A;  3VTV A;  2J52 A;  4AQ7 A;  4W9L A;  4MGK E;  4MAC A;  1VJK A;  1D4B A;  4OZB A;  3CIR B;  3OG5 A;  3BK1 A;  3PTF C;  4XZ4 A;  4HJK A;  3VUY A;  2UWQ A;  3GE8 C;  2PKO A;  2V9H A;  4P7I A;  5EE1 A;  2PLP A;  3C19 A;  4JX1 C;  1UWX A;  2RSU A;  3MC9 A;  3V6C B;  1HZ6 A;  3RZW C;  5E6O A;  1GAQ B;  1CMX B;  1UF0 A;  2K8B A;  2IGH A;  4BAX A;  3SFD B;  3WIM A;  2WX0 A;  4A3P A;  1FFV A;  5G55 A;  5CTR C;  3EFC A;  1E8Y A;  2PIA A;  4KKJ A;  3N3K B;  2MEK A;  2N9P C;  3DVN U;  2B3A A;  3NS8 A;  2FAZ A;  2VZK D;  3P1M A;  1NDD A;  1I35 A;  2L52 A;  3AU5 A;  4G3X B;  3U8Z A;  2JZ3 B;  4WJP A;  5DPW A;  1V97 A;  2FCQ A;  1QQR A;  2J4X A;  1WX7 A;  4C7Y A;  3Q8B A;  1XQQ A;  2WLB A;  3VR9 B;  4DK5 A;  2G3Q B;  2VRR B;  3UQA A;  2KYW A;  2C60 A;  1T0Y A;  2NTT A;  4ZRK A;  2W54 A;  1KOT A;  1SE3 A;  3DHH C;  1LM8 B;  4M0W A;  4ANX A;  2GRI A;  2WP9 B;  2N1W A;  2M8S A;  1ZE3 D;  4B95 A;  3E9S A;  2DBY A;  4GSW A;  4ARI A;  4AJY B;  3L0W B;  2N7J A;  1T6B X;  2NPT A;  4YTN B;  4EOY A;  2ZVN A;  2KC2 A;  5IA7 A;  2ZCC A;  3NVY A;  4IC7 B;  2VH2 A;  3QIJ A;  3ZW3 A;  1A70 A;  3ZNI D;  3M63 B;  3PRP B;  1FRR A;  5EE9 A;  4RNA A;  4KIK B;  1N62 A;  1GC6 A;  1WXA A;  1YJJ A;  3TSS A;  2OOB B;  4R3D A;  3RD2 A;  2CJO A;  1MPE A;  2QMT A;  5JHA A;  2QJL A;  1V9J A;  3AEE B;  4LNK A;  1PGB A;  2W9N A;  1SEB D;  2SAK A;  4IUM B;  4IWO A;  2K0P A;  4BKT A;  3W1S A;  1ZKH A;  3HIZ A;  2MBB B;  4RGN A;  1FIQ A;  2ZZP B;  3BK2 A;  2INC C;  2RD0 A;  3W1Y A;  4C00 A;  1T3Q A;  4FHK A;  1RLF A;  3AE4 B;  4ZRI A;  3UF8 A;  3GZN I;  3MP9 A;  5HG2 A;  1UH6 A;  4L2Y A;  3ZXV A;  4CO7 A;  4MEM A;  3ALB A;  3BZD B;  3TEX A;  2BB5 A;  4OZC A;  1JWA D;  3JSV A;  3TJP A;  2KWC A;  5MPO A;  1L4D B;  5EE0 A;  3MHS D;  1QOB A;  2KLG A;  2C7N B;  5D3D A;  1KJT A;  3KYC D;  1SB3 C;  3VRA B;  3P4Q B;  4EE2 A;  2LEK A;  3DBH I;  2KWV B;  3A33 B;  4ANW A;  4TUU A;  5CX3 A;  3L17 A;  4FJV B;  5DPS A;  3ZIM A;  2ZJD A;  3NVZ A;  4ZDV A;  1L2N A;  4NQK E;  1D5Z C;  1WE7 A;  2KDI A;  1FMA D;  4LNF A;  2JWZ A;  4HKQ A;  1FO4 A;  1YD8 U;  3TL5 A;  2WXN A;  1HTQ A;  2IGD A;  4KGT A;  2ON8 A;  2DZK A;  3TBL D;  5J17 A;  2IO1 B;  3KUD B;  2M17 A;  2RPV A;  2GLS A;  3VHT C;  2E6X A;  2ACZ B;  2R2O A;  3PGE A;  4ICV A;  2JVC A;  1NVI D;  2N9X A;  4C7Z A;  1ZDV A;  1WGY A;  1ZW7 A;  4S0R A;  4I6P A;  1WMH A;  2LGI A;  4BBN C;  1FXA A;  3Q8E A;  1QIL A;  4WIP A;  4K3C A;  3P2B A;  3HM6 X;  4EZJ A;  4K3B A;  4WJN A;  4N58 A;  2INN E;  3CST A;  2IGG A;  4NJ6 A;  2KN5 A;  4PK1 A;  2WS3 B;  1B1Z A;  1D6E C;  4NAM A;  4YTM B;  2LMC A;  2BYT A;  2I1J A;  2HJ1 A;  1EM7 A;  2N9L A;  2KTR B;  2QC8 A;  4HPM B;  2LVP A;  4E74 A;  4GB9 A;  3KLS X;  1KLG D;  3T9L A;  3FIL A;  3I9V 1;  4KV2 A;  3AEB B;  2ASQ A;  1FCC C;  1FXT B;  5BMI A;  1T0R C;  2LAS A;  4HKZ E;  1YNT E;  1V2Y A;  4GLS C;  4GGQ A;  1E6E B;  1ET6 A;  3BY4 B;  1IBX A;  4E3C A;  2WNM A;  4A3O A;  1WF9 A;  2RDH A;  3H7S A;  2FCS A;  1OQR A;  4GDL A;  3DCG A;  5HHD G;  4N6E B;  4OVV A;  3URY A;  2LHE A;  3A9K A;  4JL9 A;  4CYE A;  5C3J B;  2Y5C A;  1OEY A;  3NUH B;  4WWO A;  3AE8 B;  2JX5 A;  2VH1 A;  3Q69 A;  3ZJV A;  1MG8 A;  1JRO A;  1VD2 A;  2PMV A;  3ZNG C;  3PO0 A;  4GIV A;  4PS7 A;  2LFI A;  3I5J C;  4A8X C;  1FCL A;  2M0X A;  4DHZ E;  3ZDM C;  1L0X B;  1L4Z B;  1HEZ E;  3VH4 B;  2O6V A;  4XWW A;  4YWG G;  2MCN B;  2IO3 B;  1FNU A;  1NI2 A;  1QOG A;  3H1U A;  2M0A A;  1SIF A;  4NAW B;  1L5P A;  1OGW A;  3OJ4 B;  4HCN B;  3W9C B;  2A5U A;  2AYO B;  3ZNZ B;  3R7Q A;  1C1Y B;  1MI0 A;  4LDT B;  4MH0 E;  3ZRF A;  5L83 A;  4WJO A;  3RNC C;  3AUL A;  2BYE A;  1P7E A;  5E6N A;  4YXD B;  3GZN B;  4S17 A;  3IXS A;  2KFK A;  2FNJ B;  1IP9 A;  4FBJ B;  2KVZ A;  1R4N B;  1J19 A;  4QAY A;  1PUT A;  2ZW1 A;  3BVM A;  4IKG A;  2ZPN A;  1V5T A;  1YX6 B;  4IWQ A;  3X23 A;  5IOI A;  4GOC A;  4XX5 A;  1FM0 D;  2RDB C;  3BVG A;  3OAW A;  3ML8 A;  2MJD A;  1D3Z A;  1GPX A;  1FXI A;  4X57 B;  3W2D A;  3PHW B;  3AV8 A;  2C7M B;  4FHJ A;  3DBH B;  1T0S C;  1RRB A;  2FUH B;  1C77 A;  2NCN A;  3QAQ A;  2NPT B;  2BYF A;  1FNV A;  3NVV A;  5AUI A;  3RZF A;  3KUZ A;  1KFY B;  2K8H A;  4FLH A;  3NZ3 A;  2WXH A;  3FKY A;  3APC A;  1Q1O A;  3RNG C;  2MW5 A;  3DHI C;  2D3C A;  4ARC A;  4XC2 A;  2J53 A;  3EHV A;  4MJS A;  5BYS A;  2QEJ C;  5JZE B;  1ROE A;  3FAH A;  3OJ3 A;  2I1K A;  4XWT A;  2NBV B;  3HM3 A;  1IPG A;  1TS4 A;  4RCO A;  3VQI A;  1R4M I;  2IDY A;  5TSS A;  4W9C A;  3VVW B;  2K3U A;  3UI3 A;  4USA A;  2D11 A;  3K9P B;  3N20 C;  2BF8 B;  2NVU I;  3MJW A;  3GS2 A;  3HVD A;  3AE3 B;  2OJW A;  1P0R A;  3QX1 A;  1Q10 A;  3NY5 A;  3RUI B;  1WZ0 A;  1GC7 A;  3NZU A;  2EMS A;  3IVF A;  3QWZ B;  2WYQ A;  1ZUD 2;  4DHJ D;  1D5M C;  3AI5 A;  2V3P A;  4BKS D;  2OJR A;  2WDV B;  4M01 A;  2JYE A;  3KQ4 A;  3SEB A;  2EKI A;  2W3S A;  5G5H A;  1I42 A;  2G1E A;  2RGF A;  2G4S A;  4IOI E;  4EFO A;  2Z8L A;  2N9E B;  3KH0 A;  4II3 B;  3ZGZ A;  1UNS A;  5J2R A;  2C5L C;  3Q6B A;  1TKG A;  2NTS A;  1JML A;  1RYJ A;  2LGY A;  4JWS C;  2JPH A;  3HHM A;  1ZOY B;  3DDC B;  1L7Y A;  2KQS A;  3AU4 A;  2BT6 A;  4KGR A;  3C0R B;  1V1P A;  4HLE A;  3DHG C;  3U2S C;  4BOS C;  2HTH A;  2WXJ A;  2PW9 A;  4W9E A;  1MJD A;  3B2G A;  3X0W A;  4BKG A;  1ISN A;  3U30 A;  2ZPY A;  1VZ7 A;  3NRZ A;  1PGX A;  2MBE A;  5GMV A;  3IFW B;  4LNO A;  2JZP A;  3IBE A;  1GB1 A;  1T0Q C;  1V81 A;  2XBB C;  4DDI D;  1I4P A;  4K7U A;  3M3J A;  4EUT A;  3TEZ A;  3IHP C;  5I4D A;  4G0N B;  1UGJ A;  3WAO A;  3BWU D;  3L08 A;  1NEK B;  3PVL A;  4IM2 A;  1MHH E;  5DPR A;  4ZYS A;  1DYQ A;  2L83 A;  2Y5B B;  1V80 A;  3ZJT A;  4TKN A;  4OW0 A;  1H8C A;  4JLC A;  2PEA A;  2DZI A;  2YVC A;  3HK0 A;  4ZOH C;  1G6J A;  3DWG C;  3ZRC A;  4HK2 A;  4FUL A;  3ZYY X;  3AED B;  1TKY A;  4NQL B;  4L23 A;  3RI7 C;  5E6J A;  2V3N A;  2LZ6 A;  4NZL B;  1XO3 A;  3U7Z A;  1V1O A;  2BS2 B;  4MT5 A;  3PRM B;  4A90 A;  3PPA A;  1E7U A;  2GBJ A;  1DOX A;  1WGK A;  1L6U A;  2D2Q A;  1E8Z A;  3R7R A;  5IKC M;  1QZE A;  4ITK A;  2GMI C;  3AE7 B;  4C4V A;  1UWM A;  3Q3F A;  3Q14 C;  2BKF A;  1JWM D;  4XE0 A;  2WXQ A;  1V8C A;  1LQB A;  1NEN B;  5D3I B;  5HFY A;  4M8N A;  1EO6 A;  3NG0 A;  1VDV A;  4YSY B;  2O6V B;  1J0G A;  5FK9 C;  5IO9 A;  1PDX A;  2BPS A;  1R4M B;  2EKE C;  3D32 A;  5T8I A;  1E5W A;  1UBQ A;  2FCN A;  3NOB A;  1NBF C;  3R3M A;  4RFB A;  4K1R B;  2Z0E B;  2CU1 A;  1HXY D;  3AM9 A;  4WJQ A;  2KFK B;  4A55 A;  1SJE D;  4ZYN A;  1E9M A;  2FUG 1;  4US8 A;  2KC1 A;  1CK1 A;  3W1S C;  4ASW C;  3Q8A A;  1X1M A;  3ZQ4 A;  4HEA 1;  1VLB A;  4HPL B;  4ZHO A;  2WGS A;  2JWU A;  1WSP A;  4DXA B;  4FA6 A;  1WJ6 A;  1BUI C;  2IO2 B;  4WQM A;  3NZS A;  2G45 B;  3T3O A;  1QF6 A;  2ZEQ A;  2O2V A;  3IAM 1;  4F1S A;  3GB1 A;  4FN2 A;  2J7Q B;  1AW7 A;  4MH8 A;  1T5X D;  3B2F A;  4FJZ A;  3A1Q A;  1WGH A;  3O13 A;  3ZO5 B;  1WWT A;  2ZVO A;  2FBW B;  4KSK C;  4WH4 A;  1E8X A;  4I6L B;  4E71 A;  2X38 A;  2I38 A;  1HQR D;  2MP2 B;  1L0Y B;  3P63 A;  3IT6 B;  1L6V A;  4N9F 4;  1ACC A;  1WR1 A;  1B9R A;  2IO0 B;  3VXW A;  3L16 A;  4L1B A;  3EC8 A;  4UDU C;  2D3G A;  3LB8 C;  1P98 A;  1V86 A;  1GUA B;  2KVR A;  5AZH A;  2DZM A;  2JT4 B;  4ACF A;  1E8W A;  2H89 B;  3HRD D;  2DLB A;  1SIJ A;  1VRA B;  3A9J B;  1D5X C;  2CHX A;  3VFK A;  4AJW A;  2AL6 A;  2JF5 A;  2BYV E;  3AH7 A;  2D3A A;  2CKH B;  4IM3 A;  3B9J A;  2CU3 A;  4M00 A;  3QJZ A;  4OVZ A;  3U52 E;  1IUE A;  2L05 A;  1JRP A;  4YSX B;  5IN7 A;  2WU5 B;  1TZO A;  3SDL C;  4P16 A;  1WX8 A;  1SE4 A;  2HTM E;  4O1N A;  2XNA C;  4W9J A;  3RFZ B;  4JWU C;  2JRH A;  2KNB A;  1AWD A;  1WXS A;  3KYD D;  3PLU A;  4LK0 M;  3VTU A;  1KM7 A;  3E56 A;  1I4G A;  2ICI A;  1V1P B;  1WYG A;  4EZL A;  1YOV B;  5BMH A;  2PE9 A;  3ENE A;  3TCA A;  4RF1 A;  1RFK A;  3UIO B;  1N5W A;  4HXD A;  1J7C A;  3R8B A;  1TBE A;  4LDT D;  3Q3J A;  1TZ1 A;  1WX9 A;  2BGF A;  4ANU A;  2JU6 X;  3DBR I;  2LJ5 A;  1YQ3 B;  3QHT A;  4DQO C;  2SEB D;  4M8M A;  3RUL A;  2DX5 B;  4W9I A;  1YQ4 B;  2WWZ A;  5AUK A;  1J8C A;  3I63 C;  1C9F A;  1I4X A;  4AUQ C;  3PZ8 A;  3TMP B;  2WDT B;  2BQQ A;  1PFD A;  2BBC A;  4XDC A;  1NYQ A;  3AMZ A;  2GBN A;  2BB6 A;  2KJH B;  4P1B C;  1WJU A;  1EF5 A;  2REX A;  3NHE B;  3QCA A;  1SE2 A;  2DZJ A;  1C76 A;  2MBH A;  3P4P B;  3A4R A;  2KDM A;  1MHX A;  3AEA B;  2G9H D;  4YT0 B;  2WXF A;  3FC4 A;  2DYM A;  3RCZ A;  4XYC A;  4RF0 A;  1ZDX A;  1EWY C;  2BVC A;  1U4A A;  2DNF A;  2PVO D;  1EF1 A;  2K6D B;  3HVZ A;  3RPF C;  4KKI A;  4TMA B;  4KX6 B;  4W9H A;  1TY2 A;  4G50 A;  5D2M B;  1F52 A;  1BT0 A;  1YQB A;  5C23 A;  1V5O A;  1S1Q B;  1KLU D;  3AE2 B;  4DXF A;  1AAR A;  2KJ6 A;  2D5G A;  2JSV X;  2XN9 C;  1UUP A;  2NR2 A;  1XCT L;  4PS3 A;  4RGM A;  3QQ8 B;  2AQ1 B;  3DWM A;  1XLN A;  2YLM A;  2ZNV C;  2H88 B;  4D2K A;  3TEW A;  1EWC A;  1K50 A;  4C4V B;  1C78 A;  2RR9 A;  3EEC A;  1F0Z A;  2KX0 A;  5H8Y E;  1CZP A;  2OHF A;  4EZK A;  5LNK 1;  3VUX A;  2KWU B;  2N0S B;  1WH3 A;  4GN1 A;  3DBL I;  1BML C;  3AB5 A;  4A6Q A;  1ESF A;  2MJ3 A;  3A4S C;  4HCP B;  2K1F A;  3V3X A;  1JQ4 A;  1XT9 B;  2J42 A;  1TY0 A;  2KMC A;  3ZDT A;  2QCZ A;  2G4D B;  1XXG A;  3QAR A;  3VTW A;  4DBG A;  3AEC B;  5D6J B;  4K7S A;  4M0W B;  1LXD A;  5DCN A;  3EFU A;  1KLV A;  3M95 A;  5EE3 A;  2DEN B;  1FPY A;  3N9Y C;  1IYF A;  1YIW A;  1E7P B;  1UD7 A;  3Q2A C;  5JXV A;  2W55 A;  5L95 C;  2X8X X;  1N6Z A;  2KLC A;  2B76 B;  1WE6 A;  4BFR A;  2AQ3 B;  3IAS 1;  4RM9 A;  2INP E;  2FE8 A;  2L1A A;  3ZUN A;  2GOW A;  2AL3 A;  2BWF A;  4LNN A;  4LJO B;  4PYZ A;  2C7H A;  2O2V B;  3BYY B;  3DQV A;  2KAN A;  4NJC A;  2JXX A;  3GP7 A;  5JHB A;  2J0M A;  1RAX A;  4PYU A;  3A1Q B;  1WM3 A;  1CQV A;  1HE8 A;  3JYU A;  4XGA B;  4GXB A;  2JXT A;  1QOF A;  3MC8 A;  1UZX B;  2LXA A;  3UQB A;  4JIO U;  2KMM A;  3Q8F A;  3S2A A;  2YEP B;  2L00 B;  2MHJ A;  1TGZ B;  1E7V A;  3M62 B;  4II2 B;  2D07 B;  2KHW B;  3JSV B;  5BMG A;  3PRE A;  4H2A A;  1WIA A;  3ML9 A;  3AN1 A;  4P1C C;  4Q2J A;  3DPD A;  5IP4 D;  2GBR A;  4ANV A;  4AP4 C;  4WWM A;  2V4I B;  1SGH A;  2MWS B;  4CHK A;  2WX1 A;  5FKA C;  3AE1 B;  1E10 A;  2WXI A;  3EUB 2;  5EDS A;  1SJH D;  3AE5 B;  4W9F A;  1GJZ A;  2OED A;  2BS3 B;  2W3R A;  5KHQ A;  1JAL A;  1F2R I;  3NS1 A;  4WAA A;  3QC8 B;  4K81 A;  4MM3 A;  5GXG B;  2AEH A;  5DPT A;  1MVK A;  1OFF A;  1OEY J;  2KWD A;  2K22 A;  4B6W A;  1TTN A;  5IAA C;  3RYT A;  3H7P A;  2JZZ A;  3AE9 B;  2V4L A;  4GDK A;  4HRO A;  3VDZ A;  4WAF A;  4B0M A;  3PV1 A;  3DBS A;  1J7A A;  1WMH B;  2EMT A;  2O6V D;  4IW0 A;  3ZVV A;  3RNA C;  1XF5 L;  1N60 A;  1WFY A;  1ZP0 B;  1WXM A;  5D7G A;  2WXR A;  4RM8 A;  3I3T B;  4LNI A;  4YTP B;  3N32 A;  3L54 A;  3WAP A;  3R2I A;  3RNE C;  3RMK C;  3GE3 C;  3PS6 A;  1JW9 D;  1M94 A;  3ZJU A;  4OVU A;  1BXT A;  4AS1 A;  2R2Q A;  3CSF A;  1C4A A;  1WJN A;  3J9C A;  2CHZ A;  2HD5 B;  2DHZ A;  3UGB B;  3GOE A;  4ZRP A;  2IZV B;  4JE3 B;  1WGR A;  2L0T A;  3DBL B;  2JY6 A;  2L32 A;  4RGT A;  2UYZ B;  1GB4 A; 
#chains in the Genus database with same CATH homology
 4KV2 A;  4FJZ A;  3A1Q A;  3PHX B;  1WGH A;  3PSE B;  4F8C B;  3ZO5 B;  2ASQ A;  2ZVO A;  4KSK C;  4EEW A;  1FXT B;  4HDO A;  1E8X A;  2V3S A;  2LAS A;  4I6L B;  4E71 A;  1V2Y A;  4AOF A;  3V60 A;  2N1V A;  4MSM B;  4GGQ A;  5G2N A;  2MP2 A;  4TQ1 A;  3BY4 B;  1A5R A;  4E3C A;  2MP2 B;  4WWN A;  5TR5 A;  3SU8 X;  4A3O A;  4N9F 4;  3ZTC A;  1WF9 A;  2K6Q A;  1EUV B;  3K9O B;  3R66 C;  1WR1 A;  3H7S A;  2IO0 B;  2MX2 A;  3O65 B;  3VXW A;  4TQ0 A;  2FCS A;  3L16 A;  3EC8 A;  4GDL A;  3DCG A;  4MGY E;  2KD0 A;  4GDL B;  2D3G A;  4IM0 A;  4OVV A;  1PQS A;  3A9K A;  1P98 A;  1V86 A;  2MBQ A;  4JL9 A;  1GUA B;  3A9K B;  2KVR A;  5AZH A;  2DZM A;  4CYE A;  2FID A;  2HJ8 A;  2JT4 B;  5AEK B;  1E8W A;  3B0A A;  5AZF A;  2LGX A;  4NY0 A;  1OEY A;  4GU2 A;  5LXH A;  3A9J A;  4WWO A;  4YL8 A;  3A9J B;  1Q0W B;  2K8C A;  2LI5 A;  2CHX A;  4TV3 A;  1V49 A;  3VFK A;  5FR6 A;  1MG8 A;  2BKR B;  4RMA A;  4AJW A;  1VD2 A;  2AL6 A;  3ZKJ C;  2XEW A;  2LGD A;  2JF5 A;  4GMV A;  1H4R A;  2BYV E;  3ZNG C;  2CKH B;  4IM3 A;  3DVN V;  4GIV A;  4PS7 A;  3QA8 A;  2IY1 B;  2LRW A;  3B1L X;  3QJZ A;  2N7D A;  2M0X A;  4DHZ E;  3ZDM C;  1WJ4 A;  3VH4 B;  1E90 A;  1OQY A;  2DYO A;  2XK5 B;  2O6V A;  2L05 A;  2Z0D B;  4B9K A;  2MCN B;  2IO3 B;  3ZLZ A;  4MGZ E;  1Y8R C;  4NAW A;  1NI2 A;  3H1U A;  3SDL C;  1SIF A;  3DVG Y;  4NAW B;  1WZ3 A;  1WX8 A;  4HVB A;  3L10 B;  1OGW A;  3BIN A;  3H9D A;  1WR6 E;  2GBK A;  3WAL A;  3WAN A;  2L0F A;  3OJ4 B;  2D10 A;  4HCN B;  3LJ3 A;  2A5U A;  2IYD B;  2AYO B;  3APF A;  4W9J A;  4A20 A;  3UIP B;  2KXJ A;  1WGD A;  3ZNZ B;  2JRH A;  2KNB A;  3R7Q A;  1C1Y B;  1WXS A;  4JGH B;  4LDT B;  2KJR A;  4DDG D;  1WI0 A;  4MH0 E;  3ZRF A;  2DYB A;  2JRI B;  5L83 A;  3KYD D;  3PLU A;  4JQW C;  3AUL A;  2BYE A;  2LD9 A;  3KW5 B;  4MDK E;  4WJO A;  4KZC A;  3ZTD A;  2CR5 A;  4DWF A;  5E6N A;  4BBN F;  3T8M A;  2KFK A;  1KM7 A;  3VTU A;  2FNJ B;  4MGI E;  1IP9 A;  4FBJ B;  2BWE S;  1C3T A;  3PRZ A;  1J19 A;  3IG3 A;  4KVG B;  2KKC A;  1V6E A;  2C9W B;  5D94 A;  4DHZ B;  2ZNV B;  4AWJ A;  2ZPN A;  2N7E A;  1V5T A;  1F9J A;  1YX6 B;  4IWQ A;  3X23 A;  4EZL A;  2KQ7 A;  5CHV C;  4BOZ B;  2M4N A;  1WXV A;  2PE9 A;  4GOC A;  4XX5 A;  3ENE A;  3OAW A;  3TCA A;  3ML8 A;  4KDL B;  2KZR A;  1D3Z A;  3UIO B;  3PLV A;  4X57 B;  3APD A;  2KK8 A;  4HXD A;  4KDI C;  2A4Z A;  3PHW B;  1TBE A;  3DOW A;  4FAD A;  3AXC A;  2C7M B;  4IG7 B;  4FHJ A;  2IY0 B;  3B08 A;  4LDT D;  1RRB A;  2FUH B;  3CF6 E;  3Q3J A;  2KDB A;  2LXC A;  2NCN A;  4KSL C;  3ZNH B;  1TZ1 A;  3QAQ A;  1WX9 A;  2NPT B;  2BYF A;  2BGF A;  2K39 A;  2KTR A;  3UIN B;  1ZGU B;  4ANU A;  3DBR I;  3KUZ A;  3RZF A;  2FIF A;  2LJ5 A;  3QHT A;  4M8M A;  3RUL A;  2DX5 B;  3SHQ A;  4W9I A;  2MQJ A;  2K8H A;  2HE7 A;  2WWZ A;  4FLH A;  1J8C A;  3KUC B;  2AWT A;  3VAW A;  2J0J A;  1YX5 B;  5HKH A;  5JH5 C;  2DAF A;  4AUQ C;  3APC A;  3JVZ X;  1Q1O A;  3RT3 B;  3TMP B;  2KDE B;  1GG3 A;  2WDT B;  4WWP A;  2MRP A;  5BO4 B;  2MW5 A;  2GBN A;  2M1M A;  2LWP A;  2KJH B;  4W9D A;  2JUO A;  4W9G A;  1WJU A;  4XC2 A;  1EF5 A;  3EHV A;  4G11 A;  4MJS A;  2LVO A;  2REX A;  5JZE B;  3NHE B;  4MJS B;  1P3Q U;  3V61 A;  2LUE A;  3QCA A;  2DZJ A;  1Q5W B;  3OJ3 A;  2MBH A;  2I1K A;  4DHJ B;  3A4R A;  4LJP B;  2NBV B;  2CS4 A;  3VTV A;  3HM3 A;  2Z59 B;  1IPG A;  3MTN B;  4PS8 A;  1R4M I;  3VQI A;  2DYM A;  3RCZ A;  4W9L A;  1U4A A;  4MGK E;  1JRU A;  1EF1 A;  2K6D B;  4W9C A;  3VVW B;  3LDZ E;  3WAM A;  4W9H A;  2D11 A;  3K9P B;  3PTF C;  4XZ4 A;  2BF8 B;  2NVU I;  3MJW A;  4G50 A;  4LCD E;  5D2M B;  4KZ0 A;  4HJK A;  3TIX A;  3VUY A;  2UWQ A;  4WQO B;  1P0R A;  3QX1 A;  4MSQ B;  3NY5 A;  4P7I A;  1BT0 A;  3RUI B;  1WZ0 A;  1GC7 A;  1YQB A;  5C23 A;  1V5O A;  3NZU A;  1VCB A;  2EMS A;  1S1Q B;  2FCM A;  2RSU A;  3IVF A;  1R4N I;  2WYQ A;  3PT2 B;  3QWZ B;  3V6C B;  3RZW C;  4DHJ D;  5E6O A;  5LXI B;  3AI5 A;  4BKS D;  2NS5 A;  1AAR A;  2KJ6 A;  2OJR A;  1CMX B;  2MLB A;  2N4F A;  2K8B A;  2NR2 A;  3V6E B;  4PS3 A;  3QQ8 B;  1I42 A;  3WIM A;  2YLM A;  2RGF A;  2G4S A;  2XK5 A;  2ZNV C;  2WX0 A;  4EFO A;  3QK0 A;  4A3P A;  2PJH A;  5G55 A;  2N9E B;  3KH0 A;  4II3 B;  4URK A;  5CTR C;  5J2R A;  1WRD B;  1E8Y A;  2C5L C;  2RR9 A;  3EEC A;  2KX0 A;  4EZK A;  3N3K B;  2N9P C;  3VUX A;  3DVN U;  2B3A A;  3NS8 A;  1OTR B;  2KWU B;  2FAZ A;  2L7R A;  3SD5 A;  1NDD A;  1WH3 A;  1I35 A;  4GN1 A;  2LGY A;  3DBL I;  2JPH A;  3AU5 A;  4G3X B;  4BVU C;  3U8Z A;  3HHM A;  3V62 A;  4NNJ B;  2NBW B;  2JZ3 B;  4WJP A;  3DDC B;  5DPW A;  3A4S C;  4HCP B;  2K1F A;  1WY8 A;  1L7Y A;  1XT9 B;  4HDQ A;  2FCQ A;  2KQS A;  2KMC A;  3AU4 A;  1WX7 A;  1YJ1 A;  3C0R B;  1WGG A;  3ZDT A;  4HLE A;  1XQQ A;  2G4D B;  4BOS C;  2HTH A;  4DK5 A;  2G3Q B;  3QAR A;  4W9E A;  1GNU A;  2GBM A;  3VTW A;  3U7D A;  4DBG A;  2VRR B;  3X0W A;  1ISN A;  4BKG A;  3UQA A;  2C60 A;  1T0Y A;  5D6J B;  3U30 A;  4ZRK A;  2ZPY A;  1KOT A;  2LRU A;  1LM8 B;  3H7P B;  4ANX A;  4K7S A;  4M0W B;  1LXD A;  2N1W A;  4GDK B;  3EFU A;  3ECI A;  2MBE A;  2M8S A;  5DCN A;  4NJ7 A;  5GMV A;  4B95 A;  1KLV A;  3IFW B;  3M95 A;  3IBE A;  1V81 A;  4GSW A;  5C1Z A;  2DEN B;  2XBB C;  4DDI D;  4AJY B;  3L0W B;  2NPT A;  1IYF A;  1WYW B;  4EOY A;  2ZVN A;  2KC2 A;  5IA7 A;  2ZCC A;  1YIW A;  3M3J A;  2KMA A;  4K7U A;  1UD7 A;  4EUT A;  3IHP C;  2CHW A;  4IC7 B;  2MBO A;  5L95 C;  3QIJ A;  2KLC A;  3ZW3 A;  4G0N B;  5LLI A;  2KOX A;  3ZNI D;  3M63 B;  5CHF A;  3PRP B;  1WE6 A;  3JW0 X;  1LFD A;  3WAO A;  4BFR A;  4KIK B;  4FJY A;  1K8R B;  2V1Y A;  1GC6 A;  3L08 A;  5E6P A;  2PPH A;  1WXA A;  3DVG X;  4RM9 A;  2NBU A;  5CHW A;  3PVL A;  2OOB B;  4IM2 A;  4J6I A;  3RD2 A;  3ZUN A;  5DPR A;  4BKS A;  2GOW A;  2AL3 A;  2BWF A;  5JHA A;  1V9J A;  4LJO B;  4PYZ A;  2Y5B B;  2C7H A;  1V80 A;  2MSE D;  2O2V B;  3DQV A;  4TKN A;  2W9N A;  2KAN A;  2JXX A;  1H8C A;  4JLC A;  2PEA A;  5JHB A;  2J0M A;  1RAX A;  2DZI A;  4IUM B;  2YVC A;  4IWO A;  4PYU A;  3A1Q B;  3HK0 A;  4BKT A;  3W1S A;  2QHO A;  1WM3 A;  1G6J A;  5AZG A;  1ZKH A;  3HIZ A;  2MBB B;  3ZRC A;  1HE8 A;  3JYU A;  2ZZP B;  4HK2 A;  4FUL A;  4GXB A;  3VUW A;  2RD0 A;  3W1Y A;  1P9D U;  1UGM A;  1UZX B;  3ONS A;  4K7W A;  2LXA A;  4ICU A;  4NQL B;  4FHK A;  3UQB A;  4JIO U;  1RLF A;  4ZRI A;  3UF8 A;  2LZ6 A;  3GZN I;  3S2A A;  5J18 A;  1UH6 A;  2L00 B;  4CO7 A;  1TGZ B;  1E7V A;  4MEM A;  3ALB A;  2KDF B;  3PRM B;  4NPN A;  3M62 B;  4II2 B;  3N30 A;  3KVF B;  1S3S G;  3PPA A;  1E7U A;  2GBJ A;  2D07 B;  2DAJ A;  3JSV A;  3TJP A;  2KHW B;  3JSV B;  2KWC A;  2D2Q A;  1E8Z A;  3WA0 A;  3MHS D;  3R7R A;  3PRE A;  2KLG A;  2C7N B;  2L76 A;  1WIA A;  3ML9 A;  1QZE A;  3OLM D;  3DPD A;  1KJT A;  2GBR A;  3KYC D;  4ANV A;  4AP4 C;  2GMI C;  1P1A A;  3Q3F A;  4ZRJ A;  2BKF A;  2KX3 A;  3DBH I;  2KWV B;  1SGH A;  3A33 B;  2MWS B;  4ANW A;  4CHK A;  4EKU A;  2WX1 A;  2ZCB A;  4TUU A;  5CX3 A;  1LQB A;  3L17 A;  4FJV B;  5DPS A;  3ZIM A;  4M8N A;  5EDS A;  1EO6 A;  2ZJD A;  1L2N A;  4ZDV A;  4W9F A;  4NQK E;  1GJZ A;  1WE7 A;  2KDI A;  2O6V B;  4I6N B;  5KHQ A;  1J0G A;  2JWZ A;  2KFJ A;  2L8J A;  4WAA A;  2J0K A;  4F7Z A;  3QC8 B;  1YD8 U;  2BPS A;  2EKE C;  3D32 A;  4K81 A;  1E5W A;  4MM3 A;  4MEL A;  1UBQ A;  2AEH A;  3TL5 A;  2FCN A;  1UBI A;  5DPT A;  3NOB A;  1NBF C;  2DZK A;  3TBL D;  5J17 A;  2IO1 B;  1OEY J;  3KUD B;  3R3M A;  4K1R B;  2M17 A;  2Z0E B;  3L13 A;  4B6W A;  3VHT C;  3VH3 B;  2CU1 A;  1TTN A;  5IAA C;  3RYT A;  2R2O A;  3PGE A;  4ICV A;  2JVC A;  3H7P A;  2N9X A;  3H6N A;  4HWI B;  2JZZ A;  2V4L A;  4GDK A;  1WGY A;  1ZW7 A;  1RFA A;  2IBI B;  3VDZ A;  4WJQ A;  2KFK B;  3PV1 A;  3DBS A;  4I6P A;  1WMH A;  1Z5S B;  4ZYN A;  1WMH B;  2EMT A;  2O6V D;  2KTF A;  4BBN C;  2KC1 A;  4IW0 A;  3ZVV A;  3W1S C;  4ASW C;  2KO3 A;  5KHO A;  1X1M A;  1WFY A;  4HPL B;  1WM2 A;  1WXM A;  3P2B A;  5D7G A;  3HM6 X;  4EZJ A;  2K25 A;  4RM8 A;  3I3T B;  3N32 A;  3L54 A;  3WAP A;  4WJN A;  4DXA B;  3CST A;  1UEL A;  4IWP A;  2KN5 A;  4NJ6 A;  4FA6 A;  3PS6 A;  4KIK A;  1WJ6 A;  2RPQ A;  1M94 A;  2IO2 B;  2LVQ A;  4OVU A;  2R2Q A;  2PE6 B;  2I1J A;  3CSF A;  3NZS A;  1WJN A;  2G45 B;  2L3Z A;  2KTR B;  2CHZ A;  2HD5 B;  2DHZ A;  4HPM B;  2LVP A;  4E74 A;  3UGB B;  4W9K A;  3GOE A;  1Z2M A;  2MA9 B;  2O2V A;  2ZEQ A;  4F1S A;  4GB9 A;  2IZV B;  3PZD A;  1WGR A;  2L0T A;  3CMM B;  3T9L A;  1XD3 B;  2JY6 A;  2UYZ B;  4FN2 A;  2J7Q B;  1SE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...