2RPQA

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 2
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rpqA00
3VHTC 5JHAA 1V5OA 4GDLB 4AJYB 3B0AA 3PHWB 4II2B 4BKSD 1WMHB 4BBNF 1J8CA 5CHWA 2I1JA 5KHOA 1TBEA 4BOSC 2IY1B 3ZLZA 3ML8A 1JRUA 2AYOB 2V3SA 4W9FA 4F8CB 2OOBB 4KZ0A 3ZNGC 4KSKC 3AXCA 3WAPA 1WGHA 1S1QB 3RULA 2NBVB 1E8WA 1EO6A 1WX8A 2IY0B 4MJSB 3ZKJC 2NPTA 3CSFA 4EOYA 4MH0E 1LQBA 2MBEA 2L8JA 2YLMA 3SHQA 3DVGY 2GMIC 1XT9B 3KUZA 1MG8A 3A33B 4ANUA 1UBIA 1V86A 4NJ6A 2HD5B 2MBHA 4EZLA 3PLUA 4GIVA 2V4LA 2KWVB 1WIAA 2PJHA 2R2QA 4NJ7A 4NQLB 4I6PA 1WF9A 3WALA 5JH5C 3KYCD 3JSVA 2KLCA 2WDTB 1RLFA 2ZPYA 1R4MI 1WR1A 3N3KB 3SU8X 3UF8A 1OQYA 1J0GA 3QCAA 4KZCA 2DYOA 4M8NA 1T0YA 1TTNA 4AP4C 4J6IA 5AZGA 1C1YB 3A1QB 3VTVA 3B08A 3ENEA 3JYUA 4RM8A 3DVGX 2LGDA 4W9DA 1IPGA 1Z5SB 5CHFA 1WX9A 2FIDA 4TQ1A 4K7WA 2KJRA 5DPTA 2BGFA 3ALBA 4PS3A 5G2NA 2KXJA 1WRDB 3DBHI 4NQKE 4AJWA 4KIKB 3AULA 2JZZA 3N32A 1WZ0A 4TKNA 1Q1OA 2O6VB 3HHMA 5CX3A 4GGQA 3L16A 4KDIC 3VTWA 4LJOB 2BF8B 2KMCA 2OJRA 4W9LA 3VXWA 2N9EB 3H9DA 3PGEA 4GU2A 2J0KA 3ZUNA 2C9WB 4W9GA 4LCDE 4OVVA 3K9PB 2V1YA 2AL3A 2N1VA 4FJYA 1GJZA 1WXAA 5JHBA 2KJ6A 4RMAA 1WM2A 1WM3A 2JRIB 2HE7A 4FN2A 2PEAA 4IM0A 2CHZA 3RZFA 4HDOA 2Z0EB 2PE9A 4IM2A 3V61A 3V6EB 4KSLC 3I3TB 5FR6A 2LRUA 2KWUB 3QA8A 3BINA 4HJKA 5LLIA 2G4DB 2MRPA 2ZNVB 4FJVB 4GDKA 1CMXB 1QZEA 3JSVB 4EZJA 2CR5A 2BYEA 2AWTA 2KVRA 3IFWB 3H7SA 4G3XB 3WIMA 2Z59B 3PZDA 3ZO5B 4DK5A 4HCPB 1GG3A 5E6PA 2KZRA 2C60A 2NVUI 3ZDTA 1E7UA 4ANWA 1OEYA 2K6QA 3TCAA 1OEYJ 4BKSA 2KHWB 2EMTA 2L76A 1XQQA 5D7GA 1OTRB 1A5RA 1TGZB 4K7UA 2ZPNA 3K9OB 1WXMA 4ZRIA 3UIOB 3PSEB 1WJ4A 1ZW7A 4JL9A 4MELA 3W1SA 3M3JA 2MA9B 2GBMA 2K1FA 2MX2A 2MCNB 3CSTA 3ZTCA 3LJ3A 2M1MA 4FHJA 2CU1A 3S2AA 3C0RB 4EFOA 3APDA 3KW5B 2ZEQA 5TR5A 4I6LB 3IG3A 1X1MA 4IW0A 3H7PA 3RD2A 4BOZB 2RGFA 2KQSA 3JVZX 2MW5A 3MTNB 3UGBB 4ASWC 3DVNU 2NPTB 2WX0A 5E6OA 5G55A 2MP2B 2BKRB 4ZRKA 1AARA 3W1SC 4B6WA 2JPHA 3VDZA 3NS8A 3WAOA 3OLMD 2KDBA 3KYDD 3PLVA 2DZIA 2L00B 1E8ZA 2XK5B 2MWSB 3QX1A 3TMPB 2KTFA 2K8BA 2DX5B 2J0JA 1XD3B 5D94A 3GOEA 2M4NA 4HLEA 4ZYNA 2ASQA 1WE7A 2KFKA 2AEHA 3TIXA 4FLHA 2UWQA 2IO1B 2NR2A 3A4SC 4F1SA 1ZKHA 4IM3A 3OJ4B 4WJQA 5D6JB 2Y5BB 4DDGD 1TZ1A 5DPSA 2NBWB 3ZW3A 5C23A 2CHXA 2PPHA 2DAJA 2DZKA 1WGGA 2KN5A 2ZNVC 2MBQA 4MSQB 4JQWC 4HDQA 2MP2A 3VQIA 2FCNA 2KK8A 2KX3A 1WGYA 4PS8A 4A20A 4KDLB 4WWOA 1WYWB 2PE6B 1M94A 2ZZPB 5C1ZA 2KTRB 1KOTA 3UINB 4FBJB 4FULA 2C7MB 5AZHA 3RYTA 2C7HA 2KX0A 3P2BA 1WZ3A 2IO2B 2ZJDA 2D10A 3ZNHB 5LXHA 4ICUA 4K1RB 4CHKA 2IO0B 2M17A 4XC2A 1LXDA 3IBEA 2N1WA 4HPLB 1EUVB 1Z2MA 1L2NA 3V62A 5KHQA 2WWZA 4MSMB 2KFJA 2KDFB 3ZTDA 1GUAB 2N7DA 3QK0A 1V49A 5IA7A 1E7VA 3R66C 1IYFA 1YJ1A 4GDKB 2DHZA 3APCA 4TV3A 2JUOA 1L7YA 2KFKB 2LVQA 3QQ8B 4GMVA 5AEKB 3A9JA 4GOCA 4XX5A 2DYBA 2CS4A 3NZSA 1IP9A 2KJHB 1R4NI 1RAXA 1V5TA 4GB9A 4JIOU 2LXCA 3PRZA 1UH6A 2JY6A 3QAQA 2KO3A 1SIFA 4N9F4 2KKCA 4TUUA 4E74A 2QHOA 1UBQA 3Q3JA 2MLBA 4FA6A 2JZ3B 5L95C 1EF1A 1NDDA 2DZJA 3ONSA 2DENB 1GC7A 1WY8A 3L17A 2W9NA 4OVUA 3RUIB 2KWCA 2FCMA 3ZNZB 4B95A 3HM6X 3X23A 3KUDB 4NY0A 2N7EA 4EEWA 1Q0WB 3NY5A 3VUYA 3TBLD 5LXIB 3H7PB 2HJ8A 2GOWA 1WGRA 1H8CA 2KC2A 2WYQA 4W9KA 1WFYA 2CKHB 1F9JA 1WE6A 2L7RA 1V80A 2K8CA 3HM3A 4BFRA 4IWQA 2LGXA 2BYFA 2B3AA 3OJ3A 3L54A 2NS5A 1H4RA 4YL8A 4KIKA 4EUTA 3PREA 1GC6A 3WAMA 4LDTB 1WXSA 3KUCB 3T8MA 2FNJB 3VUWA 2R2OA 1C3TA 3IHPC 3L13A 3T9LA 3PHXB 2HTHA 4DBGA 2LJ5A 3RCZA 4GDLA 2DAFA 2BWFA 2DYMA 4W9HA 4FHKA 3V6CB 3KVFB 1UGMA 3A9KA 2M8SA 3QHTA 1WXVA 2XEWA 3A4RA 4KVGB 4E71A 2AL6A 2KC1A 3UIPB 2FCSA 3R7QA 3ML9A 4ZDVA 2GBRA 3DQVA 4W9IA 4I6NB 3VTUA 3DBLI 1SGHA 2JWZA 2O6VD 2RSUA 2D3GA 3ZRCA 4EKUA 2REXA 3DBSA 3OAWA 1J19A 2A4ZA 4M8MA 4HPMB 4JGHB 3NHEB 4PYUA 2N9PC 3O65B 1K8RB 1ZGUB 3CF6E 3D32A 2D11A 4FADA 1VD2A 2RPQA 3AU5A 2XK5A 4AOFA 3L0WB 2O2VB 3DDCB 1P1AA 2J0MA 2LASA 3VH4B 4W9CA 4DXAB 3W1YA 4AWJA 3DCGA 3BY4B 4ANXA 4ANVA 3QC8B 2GBKA 1FXTB 3PVLA 3UQBA 3VVWB 2FAZA 2XBBC 3QWZB 5HKHA 5EDSA 2JT4B 4DDID 2ZCCA 2K8HA 4GN1A 3H1UA 2C7NB 4II3B 3R3MA 3QIJA 4DHJB 1Y8RC 2LI5A 4BVUC 2LZ6A 1I35A 4P7IA 4CO7A 1S3SG 1U4AA 4EZKA 1E8YA 4GSWA 2GBJA 1V81A 2RR9A 3KH0A 2KTRA 3PV1A 5IAAC 3M63B 3VFKA 4LDTD 2NBUA 2D07B 2O2VA 2JF5A 2K6DB 4HXDA 3TL5A 1LM8B 4PYZA 3ZDMC 2JRHA 2L0TA 4MJSA 3X0WA 4DHJD 3DBRI 3L08A 1I42A 1WJNA 2K25A 2UYZB 2KDEB 2LWPA 2FIFA 1WI0A 3EHVA 3M95A 3PPAA 1GNUA 3AI5A 4WAAA 4DHZE 1NBFC 2MQJA 4ICVA 1V6EA 2Z0DB 2FUHB 3LDZE 4DWFA 2JXXA 3ECIA 2G4SA 5J17A 3APFA 2DZMA 3R7RA 4IC7B 5BO4B 4DHZB 4MEMA 4NAWA 2WX1A 4IWPA 4GXBA 4BKTA 1YIWA 2KQ7A 2MBOA 3QJZA 1WJ6A 4G0NB 4MDKE 2NCNA 2RD0A 3DVNV 5L83A 5D2MB 3EECA 3PRPB 1P0RA 1PQSA 4IG7B 2LVPA 2KOXA 1WJUA 1VCBA 3CMMB 2IBIB 4JLCA 1NI2A 1Q5WB 3MJWA 3PTFC 1E5WA 1SE9A 2IZVB 2J7QB 4NNJB 4NPNA 4LJPB 4F7ZA 4WQOB 2A5UA 4WJOA 4HCNB 2C5LC 2I1KA 4X57B 2JVCA 1KLVA 3ZRFA 1ISNA 4MGIE 5GMVA 1UD7A 4IWOA 4XZ4A 2EKEC 4K81A 2G3QB 5DPWA 3EC8A 2M0XA 2CHWA 2O6VA 2ZVNA 2BPSA 3Q3FA 3HK0A 4FJZA 4MGYE 1KJTA 4ZRJA 4HK2A 1OGWA 3RT3B 4A3PA 5DPRA 2L0FA 1WR6E 4MGKE 3NOBA 3WA0A 4E3CA 3H6NA 2LXAA 2D2QA 4HWIB 4WWNA 4G11A 4B9KA 3TJPA 3A9KB 3JW0X 4PS7A 3DOWA 3U7DA 1UZXB 3N30A 2VRRB 2KLGA 2L3ZA 2ZVOA 4TQ0A 3A1QA 3M62B 5AZFA 2BWES 4K7SA 2BKFA 4WJNA 4AUQC 1D3ZA 2MBBB 2EMSA 3NZUA 3V60A 4MM3A 3ZVVA 1P3QU 3SD5A 3RZWC 1V9JA 1YQBA 1WMHA 2MSED 2YVCA 3HIZA 3PS6A 3ZIMA 4M0WB 4RM9A 1WH3A 1YX6B 2KD0A 1E90A 4KV2A 5J2RA 3GZNI 3A9JB 1RRBA 3PT2B 1RFAA 1WX7A 1YD8U 3QARA 2LGYA 2IO3B 2LRWA 3PRMB 4BBNC 3UQAA 4IUMB 3L10B 4W9EA 3WANA 3VAWA 4HVBA 2N9XA 5JZEB 2N4FA 4G50A 5CTRC 2IYDB 1KM7A 3EFUA 2KDIA 4MGZE 2L05A 3MHSD 1HE8A 2LD9A 4W9JA 5E6NA 5J18A 4BKGA 5DCNA 2LVOA 1P9DU 1V2YA 5CHVC 1EF5A 2KNBA 4NAWB 3B1LX 3U8ZA 4WWPA 4CYEA 3U30A 3DPDA 2GBNA 2FCQA 2K39A 3SDLC 1G6JA 2BYVE 2ZCBA 1BT0A 1UELA 3ZNID 4A3OA 2G45B 3AU4A 3IVFA 2LUEA 1P98A 1WGDA 1E8XA 2KMAA 2KANA 1LFDA 3VUXA 4WJPA 4URKA 3VH3B 1YX5B
chains in the Genus database with same CATH superfamily
5H92C 1IUEA 3B0AA 1L6VA 1WMHB 2TSSA 1ROEA 1OQQA 2W55A 4F8CB 4KSKC 1WGHA 3RULA 2NBVB 1WX8A 1EO6A 2IY0B 2NPTA 3CSFA 4MH0E 3ZQ4A 2MBEA 2L8JA 2YLMA 3SHQA 2GMIC 1XT9B 1L5PA 2D5GA 1UBIA 1V86A 4NJ6A 1J7BA 2V4LA 2DNFA 3WALA 2W82A 3JSVA 3IAM1 2KLCA 4JPSA 3RMKC 2KDMA 1TIFA 2DYOA 3H8HA 3VTVA 1E10A 3Q2AC 2KQ4X 1WX9A 4TQ1A 2WNMA 1JWUD 1VJKA 2KXJA 1TKGA 1WRDB 3CWIA 4NQKE 4K3BA 1VZ7A 1Q1OA 3HVDA 1SJED 3SR6A 4XE0A 2BTEA 5CX3A 4GGQA 4ARCA 3VTWA 2PVGC 4LJOB 2OJRA 2N9EB 4GU2A 4NJCA 2C9WB 4W9GA 4OVVA 4OW0A 4FJYA 2WXJA 1XLPA 1GJZA 1I4PA 1WM3A 2HE7A 2PEAA 3V05A 1F2RI 1QKZA 2WDQB 2Z0EB 2LRUA 2KWUB 3QA8A 5LLIA 2G4DB 2ZNVB 1QZEA 3P4RB 3ZO5B 2KVRA 3IFWB 4G3XB 3PZDA 1YJJA 4HCPB 5FK9C 1XLOA 4HROA 3VRAB 3IT6B 3I9V1 2OJWA 3ZDTA 1E7UA 3BYTB 4BKSA 1I4GA 1JWMD 1NYRA 3UIOB 3GE3C 2MJEA 3IAS1 1ZP0B 2K1FA 2MCNB 3V3XA 1T5XD 2D3CA 1X1MA 2INDC 4ZOHC 2RGFA 2MW5A 1DGJA 2D3BA 3DVNU 3RPFC 2BKRB 2NTTA 2LGSA 2KT7A 2JPHA 5EE1A 2IGGA 3VDZA 1RYJA 1QLBB 2KTFA 2IPKD 2M4NA 5HG2A 2ZW1A 1ZKHA 4RF1A 2LUMA 4YSXB 1YQ4B 1N6ZA 1UWMA 4LNFA 3DBHB 4YTMB 2DWQA 4WURA 5HI1A 4WWOA 2HJ1A 4B0MA 3U4EG 2KTRB 2QSDA 1CQVA 4FULA 4C00A 4YT0B 1QILA 3P2BA 4DQOC 3TUOA 2L1AA 3ZNHB 4ICUA 2M17A 2PKOA 2N1WA 1F2RC 2KDFB 3ZGZA 2WU2B 3W2DA 3R8BA 1ET9A 3AE6B 4GDKB 1DYQA 2JUOA 4OZCA 4GMVA 4GOCA 4XX5A 2DYBA 4HRSA 3FKYA 3NZSA 4RF0A 3N9YC 2KJHB 1HTOA 3ABVB 4JIOU 1C78A 1UH6A 3AE5B 1T0SC 3HUIA 1UBQA 3MC0B 2J52A 5L95C 1EF1A 1NDDA 1B1ZA 2DZJA 3ZTDA 1WY8A 3HM6X 4EEWA 2WGSA 1Q0WB 2WP9B 3NY5A 2HJ8A 4RCOA 2KC2A 2WYQA 1RM6C 2LGXA 3OJ3A 4KIKA 4EUTA 4C4VA 1TS2A 1DOYA 1AYFA 3R2IA 1HTQA 1C3TA 4DBGA 3L13A 3PHXB 2HTHA 1UNSA 1J7CA 3RCZA 4GDLA 2BWFA 4FHKA 3V6CB 3KVFB 1WRIA 3A4RA 1TS4A 2WXLA 2KC1A 3AE3B 3UIPB 3R7QA 4ZDVA 4W9IA 1L6UA 3DBLI 3KQ4A 2A4ZA 4M8MA 3AV8A 1AN8A 4RFBA 4JGHB 3NHEB 5IP4D 1K8RB 3Q3NC 3I57A 1VD2A 2RPQA 3AU5A 2PW9A 2J0MA 1ZE3D 4W9CA 1YN5A 4DXAB 4ANVA 4KGTA 1FFVA 1QOGA 1JQ4A 1CK1A 1SJHD 2DLBA 4DHJB 4WWMA 3FILB 1E8YA 4EZKA 2INNE 3LB8C 5IAAC 4WQMA 4LDTD 5C2TB 2O2VA 2JF5A 2AQ1B 3TL5A 4PYZA 1WWTA 3VRBB 1WJNA 1C79A 1PUTA 2FIFA 2XNAC 4DHZE 3RNBC 3BVZA 2FUHB 3PO0A 2JXXA 5J17A 4DHZB 4GXBA 1L4DB 4BKTA 1SB3C 2BS3B 2NCNA 4CQNA 5L83A 3RNAC 3PRPB 1PQSA 1MHXA 2KOXA 2IBIB 1NI2A 4WQOB 2A5UA 4C7YA 5EE3A 3ZRFA 4IWOA 1L0VB 1J7AA 2O6VA 2BPSA 3HK0A 4FJZA 1KJTA 4HK2A 2L0FA 3NOBA 4KKIA 3WA0A 2MH7A 3RFZB 4G11A 3NRZA 3A9KB 4H2AA 1YN4A 2FBWB 1ACCA 2MBBB 1GAQB 1EWYC 4C80A 1YQBA 1HZ5A 1WMHA 3HIZA 4XGAB 2AX5A 4M0WB 1WH3A 4KV2A 2NMQA 1HA5A 4HJGE 1FNWA 2LRWA 2OEDA 3PRMB 4BBNC 3L10B 3MC8A 4P1CC 4G50A 1QT9A 4RGNA 5FKAC 1I4XA 1N63A 4DXGA 4WWPA 3R2TA 1WGKA 2GBNA 2BS4B 2K39A 1G6JA 2BYVE 3ZNID 1XF5L 4A3OA 2KVZA 2LUEA 1VR9A 3GE8C 4A90A 1TZOA 1TKYA 4URKA 4G0NB 4II2B 1FMAD 3N20C 1J8CA 5CHWA 1TBEA 2IY1B 5HFYA 1VZ8A 2OHFA 1JRUA 2QJLA 4W9FA 2OOBB 3WAPA 1S1QB 4MJSB 3ZKJC 2WQYB 3DVGY 3KUZA 1MG8A 3A33B 5IOIA 2LGIA 2HD5B 2MBHA 4EZLA 3PLUA 1WIAA 4NQLB 3AEFB 5JH5C 1N5XA 2WDTB 1WR1A 3SU8X 3UF8A 3BZDB 4R3DA 5AZGA 3ENEA 4RM8A 3Q8EA 2LGDA 1Z5SB 5CHFA 2WXFA 1TYGB 5DPTA 2E3TA 2RMMA 2MEKA 2UU7A 2WXIA 3DBHI 4KIKB 3AULA 3NVYA 3N32A 2O6VB 2WS3B 3BK1A 2AQ2B 1ET6A 2Q5WD 4W9LA 5BMGA 3H9DA 3PGEA 2LHDA 4LCDE 3K9PB 1NVID 2KJ6A 2N9KA 4Q2JA 3P63A 4FN2A 2WXNA 2CHZA 4ZYSA 3V61A 2JYTA 5FR6A 2MRPA 2QMTA 1CMXB 2VZKB 5MPOA 1T0QC 4L2YA 3H7SA 1BUIC 2C60A 3DBLB 2CJNA 4ANWA 1OEYA 5T8IA 4ZHPA 2WXPA 3TCAA 4RNAA 2KHWB 3B2FA 5BYQA 2L76A 1UWXA 5BMIA 4K7UA 3K9OB 1WXMA 4RH6A 1ZW7A 1ZXHA 3W1SA 3KWVA 3DWMA 3CSTA 1I7HA 1OFFA 4FHJA 2CU1A 4PT5A 3C0RB 4EFOA 4KX6B 3KW5B 5TR5A 4M01A 3IG3A 3RD2A 4IW0A 3JVZX 1GPXA 3MTNB 3UGBB 2NPTB 4ZRKA 1AARA 4B6WA 4HKQA 3OWEB 1E8ZA 3TMPB 1FNUA 2J0JA 3AE8B 4HLEA 4ZYNA 2N0SB 1T3QA 4IM3A 3OJ4B 4WJQA 2WXKA 5D6JB 2ON8A 3ZW3A 5C23A 4ITKA 1WGGA 3N1XC 2ZNVC 4JQWC 2MP2A 4HEA1 2PE6B 1M94A 2X38A 5C1ZA 4O1NA 3AE9B 1C4PA 2IO2B 4XWTA 4CHKA 1ZOYB 1LXDA 2RPVA 4HPLB 1L2NA 5KHQA 2WWZA 1SXTA 3I63C 4KGRA 3ZJUA 1PGBA 2KFKB 5AEKB 2CU3A 2VH2A 3DHHC 1SE4A 1OQRA 3AEBB 1V5TA 3T3NA 5FR3A 2JY6A 1RWSA 1JWAD 4N9F4 2KKCA 3CIRB 3Q3JA 3C19A 3RUIB 2KWCA 1IBXB 5EE0A 3X23A 2V0GA 3VUYA 2DBYA 1Q10A 4W9KA 1WFYA 1F9JA 1V80A 2K8CA 1WYGA 1XCQL 5HHDG 4PK1A 3SFEB 4YL8A 2ZW0A 1GC6A 4LDTB 1MI0A 1FCCC 3KUCB 3T8MA 2R2OA 3T9LA 2LJ5A 1ZDVA 4W9HA 4IDIA 1UGMA 3BWUD 3NS1A 2M8SA 2XEWA 3EUB2 1N60A 4KVGB 3BYYB 3AE7B 3ML9A 3DQVA 1SGHA 4MT5A 1CJEA 2D3GA 4LK0M 4EKUA 2REXA 4LLGM 3W5UB 3EA6A 1F0ZA 5G5GA 1ZGUB 3W9CB 3CF6E 4FADA 2XK5A 2O2VB 3DDCB 2K3UA 4RGOS 3BY4B 4ANXA 1FXTB 1V97A 3PVLA 3Q8AA 4RGMA 3HRDD 5EDSA 2HDEA 2ZCCA 4GN1A 4GLSC 2FE8A 4IKGA 4II3B 3R3MA 1Y8RC 1I35A 1YQ3B 4CO7A 1S3SG 1U4AA 1UF0A 2WXOA 2JQRB 2QDFA 3KH0A 3M63B 3ZDMC 4LNIA 3X0WA 1I42A 2K25A 2UYZB 3EHVA 2IDYA 2MQJA 3NZ3A 1I4QA 4A6QA 4REZA 3ECIA 2DZMA 2PIAA 4MH8A 4IOIE 1ZPSA 2HTME 2IJ0A 2JZPA 3BIID 1JALA 3ETRA 2FUG1 2LVPA 1WJUA 4XDDA 4OZAA 2D3AA 2IZVB 2GB1A 3AEDB 4NNJB 4ZRQA 4F7ZA 1LGRA 4WJOA 1ISNA 1ZDXA 2EKEC 4YWGG 2M0XA 2CHWA 2L52A 2ZVNA 3Q3FA 4MGYE 1OGWA 3GZNB 5DPRA 1D6EC 1WR6E 3NVVA 3J9CA 3H6NA 4HWIB 4PS7A 3DOWA 1TJEA 1UZXB 2RDBC 2KLGA 4TQ0A 3M62B 5AZFA 3GP7A 3NZUA 1E6EB 2IGDA 3V60A 2J4XA 2LHEA 2K22A 3RZWC 2MSED 3ZIMA 3PS6A 3VR9B 1MHHE 1YX6B 2KD0A 1WX7A 3QARA 1TKEA 4IUMB 1N61A 3U52E 2JWUA 4HVBA 2N9XA 5IN7A 1HE8A 2R61A 5LNK1 4KKJA 1PGXA 2LVOA 1V2YA 2PLPA 1EF5A 4CYEA 1HQRD 2M56B 4LTUA 1UELA 2KWDA 2G45B 2WLBA 4S0RA 3IVFA 1P98A 2N7JA 4C4VB 1WGDA 2KMAA 3B2GA 1V1PA 1JCKB 4WJPA 3I5JC 4AJYB 4P6VF 1K52A 4BBNF 2I1JA 3UI3A 3ZLZA 3ML8A 2LMCA 2AYOB 3U7ZA 2V3SA 3ZNGC 4KZ0A 4XDCA 3AXCA 3MC9A 1AW7A 3Q3OC 1C77A 1VZ6A 4GIVA 2YEPF 2J42A 2KWVB 2R2QA 2WU5B 4I6PA 1V1OA 3N3KB 1J0GA 2JYEA 4USAA 3QCAA 4KZCA 4M8NA 4J6IA 3B08A 3JYUA 2KJRA 2BGFA 3RNCC 3ALBA 1XLNA 5G2NA 3ZJVA 1E0ZA 2BBCA 1NI3A 3HHMA 4P1BC 3E9SA 1XXGA 2BF8B 2KMCA 2V9HA 1B9RA 2V1YA 4BAXA 3Q8BA 1WXAA 4RMAA 1I4HA 2JRIB 4XYCA 3V6EB 4KSLC 3BINA 1L0XB 4HJKA 4LNOA 2ACZB 2BYEA 4DK5A 3ZXVA 1GG3A 1XLQA 5E6PA 2NVUI 3KLSX 1FIQA 3EFCA 4A55A 2H89B 1A5RA 1TGZB 3LXFA 4ZRIA 4ACFA 2SEBD 1WJ4A 3PSEB 4JL9A 3MJ5A 2MJ3A 4MELA 4TSSA 1QOFA 3P4PB 2MA9B 3M3JA 2Y3AA 2CJOA 3HVZA 3S2AA 4MACA 1FPYA 3H7PA 3EGRA 2QCZA 1UGJA 2WXQA 1MFWA 4ASWC 5E6OA 2MP2B 1BMLC 1FRRA 3W1SC 4US8A 3NS8A 1TY2A 3OLMD 2L83A 4J3OD 2KMMA 2DZIA 4OHJA 3Q8CA 2MWSB 1HXYD 1XD3B 5D94A 2ASQA 3W5VB 2KFKA 3GB1A 2AEHA 2BVCA 4FLHA 2IO1B 5JXVA 2M0AA 4WH4A 3L4PA 1SE3A 1K53A 5DPSA 2EKIA 2CHXA 2KN5A 3TEXA 2MBQA 5E6JA 4MSQB 2WXGA 3RNEC 4ZRPA 3VQIA 2KK8A 2KX3A 1WGYA 1NENB 3BVMA 4KDLB 1SSNA 4P16A 1WYWB 1KOTA 3UINB 2M19A 4FBJB 5AZHA 1STEA 3RYTA 2KX0A 2MJDA 3BVGA 3N1YC 5LXHA 2IO0B 3ZXRA 1D5XC 1Z2MA 3V62A 4JE3B 1D5MC 1JW9D 2N7DA 1F52A 5EE9A 2X8XX 4BZAA 3QK0A 1TS3A 1V49A 1E7VA 3R66C 4L23A 2JU6X 1IYFA 3APCA 4TV3A 3TSSA 3QQ8B 2KN4A 3A9JA 2KAJA 2CS4A 1IP9A 1KF6B 4GB9A 1RAXA 3PRZA 2BB5A 2AQ3B 4FA6A 1FCLA 2MLBA 1HZ6A 2BT6A 4AJWA 3ONSA 4OVUA 3ZNZB 3AECB 2GRIA 4B95A 2K9XA 3KUDB 2N7EA 2QC8A 3TBLD 3H7PB 1SBBB 1WGRA 2GI9A 1H8CA 1IGCA 2CKHB 5AUKA 1FM0D 1WE6A 4BFRA 3HM3A 3RNFC 2BYFA 1ZUD2 1H4RA 2INCC 3AM9A 4KGSA 3WAMA 1WXSA 1QOBA 3VUWA 1GB1A 3FILA 4N59A 3A9KA 1CZPA 3QHTA 1WXVA 2GBRA 4I6NB 3VTUA 3TEZA 2QIEB 2JWZA 2RSUA 3E56A 2KACA 3DBSA 1FO4A 1J19A 1NEKB 2N9PC 2JX5A 1SE2A 2D11A 4MM3B 4AOFA 2VH1A 2BW2A 3AE2B 3BK2A 2W3RA 4AWJA 3DCGA 3KWLA 4D2KA 3QC8B 3IXSA 3VVWB 1JROA 2XBBC 3QWZB 3AE4B 3DBRB 4DDID 2XN9C 2K8HA 3AN1A 2C7NB 4HPPA 3SFDB 2LZ6A 3FC4A 2QILA 4GSWA 1V81A 2KTRA 1KRHA 3VFKA 2NBUA 1JWBD 1EU4A 4HXDA 2JRHA 3PZ7A 3L08A 2JSVX 2KDEB 1WI0A 3AMZA 3PPAA 3AI5A 1R4MB 1NBFC 2BQQA 1P7FA 4ICVA 1V6EA 2Z0DB 2ICIA 4DWFA 3R7RA 4MEMA 4NAWA 4M0WA 3VR8B 1YIWA 2KQ7A 1TT5B 2RD0A 3DVNV 3EECA 1P0RA 1ZXIA 4IG7B 1FEHA 4JLCA 3MJWA 2J7QB 4S17A 3U2SC 4C7ZA 4HCNB 4X57B 1KLVA 3NUHB 4MGIE 5GMVA 4YSYB 1UD7A 4XZ4A 4K81A 5DPWA 3RT3B 4B9KA 3Q3MC 3TJPA 3U7DA 1DOXA 4M02A 2VRRB 1WXQA 3A1QA 2BWES 4AUQC 2BKFA 4WJNA 4MM3A 3SEBA 1V9JA 2YVCA 4EE2A 2IGHA 4RM9A 2K5PA 3GZNI 3P4SB 1RRBA 3PT2B 3TEWA 1RFAA 2MHJA 2IO3B 1L0YB 1V1PB 3LYYA 1F77A 3VAWA 2WXMA 2N4FA 2IYDB 3AE1B 2KDIA 2LD9A 2W3SA 5E6NA 1VDVA 4BKGA 2NTSA 2RDHA 1KFYB 2KNBA 4NAWB 3B1LX 3U8ZA 3SDLC 2ZCBA 2G1EA 3AU4A 4YSZB 1K50A 1E8XA 2KANA 1LFDA 3VUXA 3VH3B 3VHTC 5JHAA 1V5OA 4GDLB 4BKSD 3PHWB 3B9JA 5KHOA 4BOSC 4ZHOA 5D3DA 2WDRB 1E8WA 4EOYA 1LQBA 5BYRA 2I2YA 1MPEA 4ANUA 3AEAB 2PJHA 4NJ7A 1WF9A 3KYCD 1RLFA 2ZPYA 1R4MI 1E9MA 4NZLB 1OQYA 4AP4C 1T0YA 1TTNA 1FFUA 4N6EB 1C1YB 3A1QB 2JXTA 2I38A 4W9DA 3DVGX 5BMHA 1IPGA 1YNTE 2FIDA 1R4NB 3DHGC 4K7WA 1DOIA 4PS3A 3NVWA 2JZZA 1WZ0A 4TKNA 3L16A 1FXAA 4KDIC 4YXDB 3VXWA 4AS1A 2KYWA 3ZUNA 2J0KA 1RFKA 2AL3A 2N1VA 4A9AA 2V3PA 5JHBA 2BS2B 1WM2A 3MFGA 4IM0A 2G9HD 3RZFA 4HDOA 2PE9A 4IM2A 3I3TB 4GDKA 1LO5D 4FJVB 5IKCM 3JSVB 4EZJA 2CR5A 3WIMA 2AWTA 2Z59B 1D4BA 1YN3A 2KZRA 3FAHA 2BB6A 2J53A 1WSPA 4A8XC 1PDXA 3AEGB 1N62A 2K6QA 1OEYJ 5D3IB 2EMTA 1XQQA 1FRDA 1OTRB 5D7GA 3GS2A 2ZPNA 1IBXA 1PGAA 2PTLA 3DWGC 4JX1C 1EM7A 5C3JB 2GBMA 2MX2A 1JWSD 1MG4A 3ZTCA 3LJ3A 2M1MA 3APDA 2ZEQA 4UDUC 2WXHA 4I6LB 4BOZB 1KLUD 2KQSA 2E6XA 1UUPA 3NVZA 2WX0A 5G55A 5BYSA 1MVKA 3WAOA 2KDBA 3KYDD 3PLVA 2L00B 2XK5B 2PVOD 3QX1A 2V3NA 2K8BA 2DX5B 1VLBA 3GOEA 1WE7A 1C4AA 3TIXA 2UWQA 1TY0A 1HEZE 2NR2A 3A4SC 4F1SA 2Y5BB 4DDGD 1TZ1A 2NBWB 1I4RA 3Q14C 2PPHA 2DAJA 2DZKA 2Y5PA 4HDQA 2FCNA 4PS8A 4A20A 2ZZPB 2WDVB 4C56C 1M4VA 2C7MB 2C7HA 1QQRA 1WZ3A 2INPE 2ZJDA 2D10A 4K1RB 4XC2A 3IBEA 1EUVB 4MSMB 2KFJA 1VRAB 1GUAB 4ARIA 5IA7A 1YJ1A 2DHZA 3P42A 1D5ZC 2BYTA 5GXGB 1L7YA 2LVQA 5TSSA 4WAFA 1FNVA 1R4NI 2LXCA 3QAQA 2KO3A 1SIFA 4TUUA 4E74A 2QHOA 2JZ3B 2LFIA 2DENB 1GC7A 3L17A 1C9FA 2W9NA 2FCMA 3WCQA 2V4IB 1A70A 4NY0A 1SF0A 5LXIB 1GB4A 2GOWA 1T6BX 1V8CA 2SAKA 2L7RA 3AB5A 2PMVA 4IWQA 2L32A 2B3AA 3L54A 2NS5A 3RN9C 3PREA 1YMHE 1F1HA 1YOVB 5G5HA 2FNJB 2ONQA 3IHPC 2DAFA 2DYMA 1NYQA 2W54A 4E71A 4HKZE 2AL6A 1ENFA 2FCSA 5H8YE 4RGTA 3OG5A 2QEJC 1K51A 2O6VD 5I4DA 4JWUC 3ZRCA 3OAWA 4AQ7A 3Q6BA 3Q69A 4HPMB 1XCTL 4PYUA 3O65B 4YTNB 1KLGD 3D32A 1JRPA 3L0WB 1P7EA 1P1AA 2LASA 3VH4B 3W1YA 3C8YA 3PZ8A 4OVZA 2GBKA 1SEBD 1L4ZB 2VZKD 3UQBA 2FAZA 1QOAA 5HKHA 4YTPB 2JT4B 1JMLA 3H1UA 4LNKA 1QF6A 4TMAB 3URYA 3QIJA 4L1BA 2LI5A 4BVUC 4P7IA 4US9A 3NG0A 2GBJA 2RR9A 3PV1A 2GLSA 2D07B 3P1MA 2K6DB 3RI7C 3ZYYX 5AUIA 1LM8B 4WIPA 1KH0A 2L0TA 4MJSA 4NAMA 4DHJD 3DBRI 2LJIA 3M95A 2LWPA 3RNGC 1GNUA 4WAAA 2WHIA 2WXRA 3N1ZC 4OZBA 3LDZE 1KTKA 2G4SA 3APFA 1MJDA 4IC7B 5BO4B 1AWDA 2WX1A 3Q8FA 4IWPA 3QJZA 2MBOA 1WJ6A 4MDKE 3P4QB 3T3OA 5D2MB 4LNNA 1VCBA 3CMMB 1PYWD 1Q5WB 3PTFC 4K3CA 4B0EA 1E5WA 1SE9A 1XEEA 2N9LA 1N5WA 4NPNA 4LJPB 3IT4B 2C5LC 2I1KA 2JVCA 2EELA 4JWSC 4FXCA 4M00A 5IO9A 1FXIA 2G3QB 3EC8A 4N58A 4ZRJA 2K0PA 1EU3A 4A3PA 4MGKE 4E3CA 1C4CA 2LXAA 2D2QA 4WWNA 1BXTA 3JW0X 4DXFA 3N30A 2RDGA 2L3ZA 2ZVOA 1ESFA 1XO3A 4K7SA 1D3ZA 2EMSA 2YEPB 1EWCA 3ZVVA 1C76A 1P3QU 3SD5A 1TS5A 1E90A 5J2RA 3A9JB 1FD6A 1YD8U 2LGYA 3AEEB 3UQAA 2Z8LA 3NJTA 4W9EA 3WANA 3O13A 5JZEB 5CTRC 1PFDA 3AH7A 1KM7A 3EFUA 4MGZE 2L05A 2LEKA 1Y56A 3MHSD 4W9JA 1YJIA 5J18A 5DCNA 1E7PB 1P9DU 5CHVC 2H88B 1SIJA 1GOZA 3U30A 1IGDA 3DPDA 4XWWA 2FCQA 1BT0A 3MP9A 3MHZA 2Y5CA 3DHIC 1R7SA 1T0RC 2B76B 4QAYA 3ZJTA 3TEYA 1YX5B
chains in the Genus database with same CATH topology
3VHTC 5JHAA 1V5OA 4GDLB 4AJYB 3B0AA 3PHWB 4II2B 4BKSD 1WMHB 4BBNF 1J8CA 5CHWA 2I1JA 5KHOA 1TBEA 4BOSC 2IY1B 3ZLZA 3ML8A 1JRUA 2AYOB 2V3SA 4W9FA 4F8CB 2OOBB 4KZ0A 3ZNGC 4KSKC 3AXCA 3WAPA 1WGHA 1S1QB 3RULA 2NBVB 1E8WA 1EO6A 1WX8A 2IY0B 4MJSB 3ZKJC 2NPTA 3CSFA 4EOYA 4MH0E 1LQBA 2MBEA 2L8JA 2YLMA 3SHQA 3DVGY 2GMIC 1XT9B 3KUZA 1MG8A 3A33B 4ANUA 1UBIA 1V86A 4NJ6A 2HD5B 2MBHA 4EZLA 3PLUA 4GIVA 2V4LA 2KWVB 1WIAA 2PJHA 2R2QA 4NJ7A 4NQLB 4I6PA 1WF9A 3WALA 5JH5C 3KYCD 3JSVA 2KLCA 2WDTB 1RLFA 2ZPYA 1R4MI 1WR1A 3N3KB 3SU8X 3UF8A 1OQYA 1J0GA 3QCAA 4KZCA 2DYOA 4M8NA 1T0YA 1TTNA 4AP4C 4J6IA 5AZGA 1C1YB 3A1QB 3VTVA 3B08A 3ENEA 3JYUA 4RM8A 3DVGX 2LGDA 4W9DA 1IPGA 1Z5SB 5CHFA 1WX9A 2FIDA 4TQ1A 4K7WA 2KJRA 5DPTA 2BGFA 3ALBA 4PS3A 5G2NA 2KXJA 1WRDB 3DBHI 4NQKE 4AJWA 4KIKB 3AULA 2JZZA 3N32A 1WZ0A 4TKNA 1Q1OA 2O6VB 3HHMA 5CX3A 4GGQA 3L16A 4KDIC 3VTWA 4LJOB 2BF8B 2KMCA 2OJRA 4W9LA 3VXWA 2N9EB 3H9DA 3PGEA 4GU2A 2J0KA 3ZUNA 2C9WB 4W9GA 4LCDE 4OVVA 3K9PB 2V1YA 2AL3A 2N1VA 4FJYA 1GJZA 1WXAA 5JHBA 2KJ6A 4RMAA 1WM2A 1WM3A 2JRIB 2HE7A 4FN2A 2PEAA 4IM0A 2CHZA 3RZFA 4HDOA 2Z0EB 2PE9A 4IM2A 3V61A 3V6EB 4KSLC 3I3TB 5FR6A 2LRUA 2KWUB 3QA8A 3BINA 4HJKA 5LLIA 2G4DB 2MRPA 2ZNVB 4FJVB 4GDKA 1CMXB 1QZEA 3JSVB 4EZJA 2CR5A 2BYEA 2AWTA 2KVRA 3IFWB 3H7SA 4G3XB 3WIMA 2Z59B 3PZDA 3ZO5B 4DK5A 4HCPB 1GG3A 5E6PA 2KZRA 2C60A 2NVUI 3ZDTA 1E7UA 4ANWA 1OEYA 2K6QA 3TCAA 1OEYJ 4BKSA 2KHWB 2EMTA 2L76A 1XQQA 5D7GA 1OTRB 1A5RA 1TGZB 4K7UA 2ZPNA 3K9OB 1WXMA 4ZRIA 3UIOB 3PSEB 1WJ4A 1ZW7A 4JL9A 4MELA 3W1SA 3M3JA 2MA9B 2GBMA 2K1FA 2MX2A 2MCNB 3CSTA 3ZTCA 3LJ3A 2M1MA 4FHJA 2CU1A 3S2AA 3C0RB 4EFOA 3APDA 3KW5B 2ZEQA 5TR5A 4I6LB 3IG3A 1X1MA 4IW0A 3H7PA 3RD2A 4BOZB 2RGFA 2KQSA 3JVZX 2MW5A 3MTNB 3UGBB 4ASWC 3DVNU 2NPTB 2WX0A 5E6OA 5G55A 2MP2B 2BKRB 4ZRKA 1AARA 3W1SC 4B6WA 2JPHA 3VDZA 3NS8A 3WAOA 3OLMD 2KDBA 3KYDD 3PLVA 2DZIA 2L00B 1E8ZA 2XK5B 2MWSB 3QX1A 3TMPB 2KTFA 2K8BA 2DX5B 2J0JA 1XD3B 5D94A 3GOEA 2M4NA 4HLEA 4ZYNA 2ASQA 1WE7A 2KFKA 2AEHA 3TIXA 4FLHA 2UWQA 2IO1B 2NR2A 3A4SC 4F1SA 1ZKHA 4IM3A 3OJ4B 4WJQA 5D6JB 2Y5BB 4DDGD 1TZ1A 5DPSA 2NBWB 3ZW3A 5C23A 2CHXA 2PPHA 2DAJA 2DZKA 1WGGA 2KN5A 2ZNVC 2MBQA 4MSQB 4JQWC 4HDQA 2MP2A 3VQIA 2FCNA 2KK8A 2KX3A 1WGYA 4PS8A 4A20A 4KDLB 4WWOA 1WYWB 2PE6B 1M94A 2ZZPB 5C1ZA 2KTRB 1KOTA 3UINB 4FBJB 4FULA 2C7MB 5AZHA 3RYTA 2C7HA 2KX0A 3P2BA 1WZ3A 2IO2B 2ZJDA 2D10A 3ZNHB 5LXHA 4ICUA 4K1RB 4CHKA 2IO0B 2M17A 4XC2A 1LXDA 3IBEA 2N1WA 4HPLB 1EUVB 1Z2MA 1L2NA 3V62A 5KHQA 2WWZA 4MSMB 2KFJA 2KDFB 3ZTDA 1GUAB 2N7DA 3QK0A 1V49A 5IA7A 1E7VA 3R66C 1IYFA 1YJ1A 4GDKB 2DHZA 3APCA 4TV3A 2JUOA 1L7YA 2KFKB 2LVQA 3QQ8B 4GMVA 5AEKB 3A9JA 4GOCA 4XX5A 2DYBA 2CS4A 3NZSA 1IP9A 2KJHB 1R4NI 1RAXA 1V5TA 4GB9A 4JIOU 2LXCA 3PRZA 1UH6A 2JY6A 3QAQA 2KO3A 1SIFA 4N9F4 2KKCA 4TUUA 4E74A 2QHOA 1UBQA 3Q3JA 2MLBA 4FA6A 2JZ3B 5L95C 1EF1A 1NDDA 2DZJA 3ONSA 2DENB 1GC7A 1WY8A 3L17A 2W9NA 4OVUA 3RUIB 2KWCA 2FCMA 3ZNZB 4B95A 3HM6X 3X23A 3KUDB 4NY0A 2N7EA 4EEWA 1Q0WB 3NY5A 3VUYA 3TBLD 5LXIB 3H7PB 2HJ8A 2GOWA 1WGRA 1H8CA 2KC2A 2WYQA 4W9KA 1WFYA 2CKHB 1F9JA 1WE6A 2L7RA 1V80A 2K8CA 3HM3A 4BFRA 4IWQA 2LGXA 2BYFA 2B3AA 3OJ3A 3L54A 2NS5A 1H4RA 4YL8A 4KIKA 4EUTA 3PREA 1GC6A 3WAMA 4LDTB 1WXSA 3KUCB 3T8MA 2FNJB 3VUWA 2R2OA 1C3TA 3IHPC 3L13A 3T9LA 3PHXB 2HTHA 4DBGA 2LJ5A 3RCZA 4GDLA 2DAFA 2BWFA 2DYMA 4W9HA 4FHKA 3V6CB 3KVFB 1UGMA 3A9KA 2M8SA 3QHTA 1WXVA 2XEWA 3A4RA 4KVGB 4E71A 2AL6A 2KC1A 3UIPB 2FCSA 3R7QA 3ML9A 4ZDVA 2GBRA 3DQVA 4W9IA 4I6NB 3VTUA 3DBLI 1SGHA 2JWZA 2O6VD 2RSUA 2D3GA 3ZRCA 4EKUA 2REXA 3DBSA 3OAWA 1J19A 2A4ZA 4M8MA 4HPMB 4JGHB 3NHEB 4PYUA 2N9PC 3O65B 1K8RB 1ZGUB 3CF6E 3D32A 2D11A 4FADA 1VD2A 2RPQA 3AU5A 2XK5A 4AOFA 3L0WB 2O2VB 3DDCB 1P1AA 2J0MA 2LASA 3VH4B 4W9CA 4DXAB 3W1YA 4AWJA 3DCGA 3BY4B 4ANXA 4ANVA 3QC8B 2GBKA 1FXTB 3PVLA 3UQBA 3VVWB 2FAZA 2XBBC 3QWZB 5HKHA 5EDSA 2JT4B 4DDID 2ZCCA 2K8HA 4GN1A 3H1UA 2C7NB 4II3B 3R3MA 3QIJA 4DHJB 1Y8RC 2LI5A 4BVUC 2LZ6A 1I35A 4P7IA 4CO7A 1S3SG 1U4AA 4EZKA 1E8YA 4GSWA 2GBJA 1V81A 2RR9A 3KH0A 2KTRA 3PV1A 5IAAC 3M63B 3VFKA 4LDTD 2NBUA 2D07B 2O2VA 2JF5A 2K6DB 4HXDA 3TL5A 1LM8B 4PYZA 3ZDMC 2JRHA 2L0TA 4MJSA 3X0WA 4DHJD 3DBRI 3L08A 1I42A 1WJNA 2K25A 2UYZB 2KDEB 2LWPA 2FIFA 1WI0A 3EHVA 3M95A 3PPAA 1GNUA 3AI5A 4WAAA 4DHZE 1NBFC 2MQJA 4ICVA 1V6EA 2Z0DB 2FUHB 3LDZE 4DWFA 2JXXA 3ECIA 2G4SA 5J17A 3APFA 2DZMA 3R7RA 4IC7B 5BO4B 4DHZB 4MEMA 4NAWA 2WX1A 4IWPA 4GXBA 4BKTA 1YIWA 2KQ7A 2MBOA 3QJZA 1WJ6A 4G0NB 4MDKE 2NCNA 2RD0A 3DVNV 5L83A 5D2MB 3EECA 3PRPB 1P0RA 1PQSA 4IG7B 2LVPA 2KOXA 1WJUA 1VCBA 3CMMB 2IBIB 4JLCA 1NI2A 1Q5WB 3MJWA 3PTFC 1E5WA 1SE9A 2IZVB 2J7QB 4NNJB 4NPNA 4LJPB 4F7ZA 4WQOB 2A5UA 4WJOA 4HCNB 2C5LC 2I1KA 4X57B 2JVCA 1KLVA 3ZRFA 1ISNA 4MGIE 5GMVA 1UD7A 4IWOA 4XZ4A 2EKEC 4K81A 2G3QB 5DPWA 3EC8A 2M0XA 2CHWA 2O6VA 2ZVNA 2BPSA 3Q3FA 3HK0A 4FJZA 4MGYE 1KJTA 4ZRJA 4HK2A 1OGWA 3RT3B 4A3PA 5DPRA 2L0FA 1WR6E 4MGKE 3NOBA 3WA0A 4E3CA 3H6NA 2LXAA 2D2QA 4HWIB 4WWNA 4G11A 4B9KA 3TJPA 3A9KB 3JW0X 4PS7A 3DOWA 3U7DA 1UZXB 3N30A 2VRRB 2KLGA 2L3ZA 2ZVOA 4TQ0A 3A1QA 3M62B 5AZFA 2BWES 4K7SA 2BKFA 4WJNA 4AUQC 1D3ZA 2MBBB 2EMSA 3NZUA 3V60A 4MM3A 3ZVVA 1P3QU 3SD5A 3RZWC 1V9JA 1YQBA 1WMHA 2MSED 2YVCA 3HIZA 3PS6A 3ZIMA 4M0WB 4RM9A 1WH3A 1YX6B 2KD0A 1E90A 4KV2A 5J2RA 3GZNI 3A9JB 1RRBA 3PT2B 1RFAA 1WX7A 1YD8U 3QARA 2LGYA 2IO3B 2LRWA 3PRMB 4BBNC 3UQAA 4IUMB 3L10B 4W9EA 3WANA 3VAWA 4HVBA 2N9XA 5JZEB 2N4FA 4G50A 5CTRC 2IYDB 1KM7A 3EFUA 2KDIA 4MGZE 2L05A 3MHSD 1HE8A 2LD9A 4W9JA 5E6NA 5J18A 4BKGA 5DCNA 2LVOA 1P9DU 1V2YA 5CHVC 1EF5A 2KNBA 4NAWB 3B1LX 3U8ZA 4WWPA 4CYEA 3U30A 3DPDA 2GBNA 2FCQA 2K39A 3SDLC 1G6JA 2BYVE 2ZCBA 1BT0A 1UELA 3ZNID 4A3OA 2G45B 3AU4A 3IVFA 2LUEA 1P98A 1WGDA 1E8XA 2KMAA 2KANA 1LFDA 3VUXA 4WJPA 4URKA 3VH3B 1YX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT C;  5JHA A;  1V5O A;  4GDL B;  4AJY B;  3B0A A;  3PHW B;  4II2 B;  4BKS D;  1WMH B;  4BBN F;  1J8C A;  5CHW A;  2I1J A;  5KHO A;  1TBE A;  4BOS C;  2IY1 B;  3ZLZ A;  3ML8 A;  1JRU A;  2AYO B;  2V3S A;  4W9F A;  4F8C B;  2OOB B;  4KZ0 A;  3ZNG C;  4KSK C;  3AXC A;  3WAP A;  1WGH A;  1S1Q B;  3RUL A;  2NBV B;  1E8W A;  1EO6 A;  1WX8 A;  2IY0 B;  4MJS B;  3ZKJ C;  2NPT A;  3CSF A;  4EOY A;  4MH0 E;  1LQB A;  2MBE A;  2L8J A;  2YLM A;  3SHQ A;  3DVG Y;  2GMI C;  1XT9 B;  3KUZ A;  1MG8 A;  3A33 B;  4ANU A;  1UBI A;  1V86 A;  4NJ6 A;  2HD5 B;  2MBH A;  4EZL A;  3PLU A;  4GIV A;  2V4L A;  2KWV B;  1WIA A;  2PJH A;  2R2Q A;  4NJ7 A;  4NQL B;  4I6P A;  1WF9 A;  3WAL A;  5JH5 C;  3KYC D;  3JSV A;  2KLC A;  2WDT B;  1RLF A;  2ZPY A;  1R4M I;  1WR1 A;  3N3K B;  3SU8 X;  3UF8 A;  1OQY A;  1J0G A;  3QCA A;  4KZC A;  2DYO A;  4M8N A;  1T0Y A;  1TTN A;  4AP4 C;  4J6I A;  5AZG A;  1C1Y B;  3A1Q B;  3VTV A;  3B08 A;  3ENE A;  3JYU A;  4RM8 A;  3DVG X;  2LGD A;  4W9D A;  1IPG A;  1Z5S B;  5CHF A;  1WX9 A;  2FID A;  4TQ1 A;  4K7W A;  2KJR A;  5DPT A;  2BGF A;  3ALB A;  4PS3 A;  5G2N A;  2KXJ A;  1WRD B;  3DBH I;  4NQK E;  4AJW A;  4KIK B;  3AUL A;  2JZZ A;  3N32 A;  1WZ0 A;  4TKN A;  1Q1O A;  2O6V B;  3HHM A;  5CX3 A;  4GGQ A;  3L16 A;  4KDI C;  3VTW A;  4LJO B;  2BF8 B;  2KMC A;  2OJR A;  4W9L A;  3VXW A;  2N9E B;  3H9D A;  3PGE A;  4GU2 A;  2J0K A;  3ZUN A;  2C9W B;  4W9G A;  4LCD E;  4OVV A;  3K9P B;  2V1Y A;  2AL3 A;  2N1V A;  4FJY A;  1GJZ A;  1WXA A;  5JHB A;  2KJ6 A;  4RMA A;  1WM2 A;  1WM3 A;  2JRI B;  2HE7 A;  4FN2 A;  2PEA A;  4IM0 A;  2CHZ A;  3RZF A;  4HDO A;  2Z0E B;  2PE9 A;  4IM2 A;  3V61 A;  3V6E B;  4KSL C;  3I3T B;  5FR6 A;  2LRU A;  2KWU B;  3QA8 A;  3BIN A;  4HJK A;  5LLI A;  2G4D B;  2MRP A;  2ZNV B;  4FJV B;  4GDK A;  1CMX B;  1QZE A;  3JSV B;  4EZJ A;  2CR5 A;  2BYE A;  2AWT A;  2KVR A;  3IFW B;  3H7S A;  4G3X B;  3WIM A;  2Z59 B;  3PZD A;  3ZO5 B;  4DK5 A;  4HCP B;  1GG3 A;  5E6P A;  2KZR A;  2C60 A;  2NVU I;  3ZDT A;  1E7U A;  4ANW A;  1OEY A;  2K6Q A;  3TCA A;  1OEY J;  4BKS A;  2KHW B;  2EMT A;  2L76 A;  1XQQ A;  5D7G A;  1OTR B;  1A5R A;  1TGZ B;  4K7U A;  2ZPN A;  3K9O B;  1WXM A;  4ZRI A;  3UIO B;  3PSE B;  1WJ4 A;  1ZW7 A;  4JL9 A;  4MEL A;  3W1S A;  3M3J A;  2MA9 B;  2GBM A;  2K1F A;  2MX2 A;  2MCN B;  3CST A;  3ZTC A;  3LJ3 A;  2M1M A;  4FHJ A;  2CU1 A;  3S2A A;  3C0R B;  4EFO A;  3APD A;  3KW5 B;  2ZEQ A;  5TR5 A;  4I6L B;  3IG3 A;  1X1M A;  4IW0 A;  3H7P A;  3RD2 A;  4BOZ B;  2RGF A;  2KQS A;  3JVZ X;  2MW5 A;  3MTN B;  3UGB B;  4ASW C;  3DVN U;  2NPT B;  2WX0 A;  5E6O A;  5G55 A;  2MP2 B;  2BKR B;  4ZRK A;  1AAR A;  3W1S C;  4B6W A;  2JPH A;  3VDZ A;  3NS8 A;  3WAO A;  3OLM D;  2KDB A;  3KYD D;  3PLV A;  2DZI A;  2L00 B;  1E8Z A;  2XK5 B;  2MWS B;  3QX1 A;  3TMP B;  2KTF A;  2K8B A;  2DX5 B;  2J0J A;  1XD3 B;  5D94 A;  3GOE A;  2M4N A;  4HLE A;  4ZYN A;  2ASQ A;  1WE7 A;  2KFK A;  2AEH A;  3TIX A;  4FLH A;  2UWQ A;  2IO1 B;  2NR2 A;  3A4S C;  4F1S A;  1ZKH A;  4IM3 A;  3OJ4 B;  4WJQ A;  5D6J B;  2Y5B B;  4DDG D;  1TZ1 A;  5DPS A;  2NBW B;  3ZW3 A;  5C23 A;  2CHX A;  2PPH A;  2DAJ A;  2DZK A;  1WGG A;  2KN5 A;  2ZNV C;  2MBQ A;  4MSQ B;  4JQW C;  4HDQ A;  2MP2 A;  3VQI A;  2FCN A;  2KK8 A;  2KX3 A;  1WGY A;  4PS8 A;  4A20 A;  4KDL B;  4WWO A;  1WYW B;  2PE6 B;  1M94 A;  2ZZP B;  5C1Z A;  2KTR B;  1KOT A;  3UIN B;  4FBJ B;  4FUL A;  2C7M B;  5AZH A;  3RYT A;  2C7H A;  2KX0 A;  3P2B A;  1WZ3 A;  2IO2 B;  2ZJD A;  2D10 A;  3ZNH B;  5LXH A;  4ICU A;  4K1R B;  4CHK A;  2IO0 B;  2M17 A;  4XC2 A;  1LXD A;  3IBE A;  2N1W A;  4HPL B;  1EUV B;  1Z2M A;  1L2N A;  3V62 A;  5KHQ A;  2WWZ A;  4MSM B;  2KFJ A;  2KDF B;  3ZTD A;  1GUA B;  2N7D A;  3QK0 A;  1V49 A;  5IA7 A;  1E7V A;  3R66 C;  1IYF A;  1YJ1 A;  4GDK B;  2DHZ A;  3APC A;  4TV3 A;  2JUO A;  1L7Y A;  2KFK B;  2LVQ A;  3QQ8 B;  4GMV A;  5AEK B;  3A9J A;  4GOC A;  4XX5 A;  2DYB A;  2CS4 A;  3NZS A;  1IP9 A;  2KJH B;  1R4N I;  1RAX A;  1V5T A;  4GB9 A;  4JIO U;  2LXC A;  3PRZ A;  1UH6 A;  2JY6 A;  3QAQ A;  2KO3 A;  1SIF A;  4N9F 4;  2KKC A;  4TUU A;  4E74 A;  2QHO A;  1UBQ A;  3Q3J A;  2MLB A;  4FA6 A;  2JZ3 B;  5L95 C;  1EF1 A;  1NDD A;  2DZJ A;  3ONS A;  2DEN B;  1GC7 A;  1WY8 A;  3L17 A;  2W9N A;  4OVU A;  3RUI B;  2KWC A;  2FCM A;  3ZNZ B;  4B95 A;  3HM6 X;  3X23 A;  3KUD B;  4NY0 A;  2N7E A;  4EEW A;  1Q0W B;  3NY5 A;  3VUY A;  3TBL D;  5LXI B;  3H7P B;  2HJ8 A;  2GOW A;  1WGR A;  1H8C A;  2KC2 A;  2WYQ A;  4W9K A;  1WFY A;  2CKH B;  1F9J A;  1WE6 A;  2L7R A;  1V80 A;  2K8C A;  3HM3 A;  4BFR A;  4IWQ A;  2LGX A;  2BYF A;  2B3A A;  3OJ3 A;  3L54 A;  2NS5 A;  1H4R A;  4YL8 A;  4KIK A;  4EUT A;  3PRE A;  1GC6 A;  3WAM A;  4LDT B;  1WXS A;  3KUC B;  3T8M A;  2FNJ B;  3VUW A;  2R2O A;  1C3T A;  3IHP C;  3L13 A;  3T9L A;  3PHX B;  2HTH A;  4DBG A;  2LJ5 A;  3RCZ A;  4GDL A;  2DAF A;  2BWF A;  2DYM A;  4W9H A;  4FHK A;  3V6C B;  3KVF B;  1UGM A;  3A9K A;  2M8S A;  3QHT A;  1WXV A;  2XEW A;  3A4R A;  4KVG B;  4E71 A;  2AL6 A;  2KC1 A;  3UIP B;  2FCS A;  3R7Q A;  3ML9 A;  4ZDV A;  2GBR A;  3DQV A;  4W9I A;  4I6N B;  3VTU A;  3DBL I;  1SGH A;  2JWZ A;  2O6V D;  2RSU A;  2D3G A;  3ZRC A;  4EKU A;  2REX A;  3DBS A;  3OAW A;  1J19 A;  2A4Z A;  4M8M A;  4HPM B;  4JGH B;  3NHE B;  4PYU A;  2N9P C;  3O65 B;  1K8R B;  1ZGU B;  3CF6 E;  3D32 A;  2D11 A;  4FAD A;  1VD2 A;  2RPQ A;  3AU5 A;  2XK5 A;  4AOF A;  3L0W B;  2O2V B;  3DDC B;  1P1A A;  2J0M A;  2LAS A;  3VH4 B;  4W9C A;  4DXA B;  3W1Y A;  4AWJ A;  3DCG A;  3BY4 B;  4ANX A;  4ANV A;  3QC8 B;  2GBK A;  1FXT B;  3PVL A;  3UQB A;  3VVW B;  2FAZ A;  2XBB C;  3QWZ B;  5HKH A;  5EDS A;  2JT4 B;  4DDI D;  2ZCC A;  2K8H A;  4GN1 A;  3H1U A;  2C7N B;  4II3 B;  3R3M A;  3QIJ A;  4DHJ B;  1Y8R C;  2LI5 A;  4BVU C;  2LZ6 A;  1I35 A;  4P7I A;  4CO7 A;  1S3S G;  1U4A A;  4EZK A;  1E8Y A;  4GSW A;  2GBJ A;  1V81 A;  2RR9 A;  3KH0 A;  2KTR A;  3PV1 A;  5IAA C;  3M63 B;  3VFK A;  4LDT D;  2NBU A;  2D07 B;  2O2V A;  2JF5 A;  2K6D B;  4HXD A;  3TL5 A;  1LM8 B;  4PYZ A;  3ZDM C;  2JRH A;  2L0T A;  4MJS A;  3X0W A;  4DHJ D;  3DBR I;  3L08 A;  1I42 A;  1WJN A;  2K25 A;  2UYZ B;  2KDE B;  2LWP A;  2FIF A;  1WI0 A;  3EHV A;  3M95 A;  3PPA A;  1GNU A;  3AI5 A;  4WAA A;  4DHZ E;  1NBF C;  2MQJ A;  4ICV A;  1V6E A;  2Z0D B;  2FUH B;  3LDZ E;  4DWF A;  2JXX A;  3ECI A;  2G4S A;  5J17 A;  3APF A;  2DZM A;  3R7R A;  4IC7 B;  5BO4 B;  4DHZ B;  4MEM A;  4NAW A;  2WX1 A;  4IWP A;  4GXB A;  4BKT A;  1YIW A;  2KQ7 A;  2MBO A;  3QJZ A;  1WJ6 A;  4G0N B;  4MDK E;  2NCN A;  2RD0 A;  3DVN V;  5L83 A;  5D2M B;  3EEC A;  3PRP B;  1P0R A;  1PQS A;  4IG7 B;  2LVP A;  2KOX A;  1WJU A;  1VCB A;  3CMM B;  2IBI B;  4JLC A;  1NI2 A;  1Q5W B;  3MJW A;  3PTF C;  1E5W A;  1SE9 A;  2IZV B;  2J7Q B;  4NNJ B;  4NPN A;  4LJP B;  4F7Z A;  4WQO B;  2A5U A;  4WJO A;  4HCN B;  2C5L C;  2I1K A;  4X57 B;  2JVC A;  1KLV A;  3ZRF A;  1ISN A;  4MGI E;  5GMV A;  1UD7 A;  4IWO A;  4XZ4 A;  2EKE C;  4K81 A;  2G3Q B;  5DPW A;  3EC8 A;  2M0X A;  2CHW A;  2O6V A;  2ZVN A;  2BPS A;  3Q3F A;  3HK0 A;  4FJZ A;  4MGY E;  1KJT A;  4ZRJ A;  4HK2 A;  1OGW A;  3RT3 B;  4A3P A;  5DPR A;  2L0F A;  1WR6 E;  4MGK E;  3NOB A;  3WA0 A;  4E3C A;  3H6N A;  2LXA A;  2D2Q A;  4HWI B;  4WWN A;  4G11 A;  4B9K A;  3TJP A;  3A9K B;  3JW0 X;  4PS7 A;  3DOW A;  3U7D A;  1UZX B;  3N30 A;  2VRR B;  2KLG A;  2L3Z A;  2ZVO A;  4TQ0 A;  3A1Q A;  3M62 B;  5AZF A;  2BWE S;  4K7S A;  2BKF A;  4WJN A;  4AUQ C;  1D3Z A;  2MBB B;  2EMS A;  3NZU A;  3V60 A;  4MM3 A;  3ZVV A;  1P3Q U;  3SD5 A;  3RZW C;  1V9J A;  1YQB A;  1WMH A;  2MSE D;  2YVC A;  3HIZ A;  3PS6 A;  3ZIM A;  4M0W B;  4RM9 A;  1WH3 A;  1YX6 B;  2KD0 A;  1E90 A;  4KV2 A;  5J2R A;  3GZN I;  3A9J B;  1RRB A;  3PT2 B;  1RFA A;  1WX7 A;  1YD8 U;  3QAR A;  2LGY A;  2IO3 B;  2LRW A;  3PRM B;  4BBN C;  3UQA A;  4IUM B;  3L10 B;  4W9E A;  3WAN A;  3VAW A;  4HVB A;  2N9X A;  5JZE B;  2N4F A;  4G50 A;  5CTR C;  2IYD B;  1KM7 A;  3EFU A;  2KDI A;  4MGZ E;  2L05 A;  3MHS D;  1HE8 A;  2LD9 A;  4W9J A;  5E6N A;  5J18 A;  4BKG A;  5DCN A;  2LVO A;  1P9D U;  1V2Y A;  5CHV C;  1EF5 A;  2KNB A;  4NAW B;  3B1L X;  3U8Z A;  4WWP A;  4CYE A;  3U30 A;  3DPD A;  2GBN A;  2FCQ A;  2K39 A;  3SDL C;  1G6J A;  2BYV E;  2ZCB A;  1BT0 A;  1UEL A;  3ZNI D;  4A3O A;  2G45 B;  3AU4 A;  3IVF A;  2LUE A;  1P98 A;  1WGD A;  1E8X A;  2KMA A;  2KAN A;  1LFD A;  3VUX A;  4WJP A;  4URK A;  3VH3 B;  1YX5 B; 
#chains in the Genus database with same CATH topology
 5H92 C;  1IUE A;  3B0A A;  1L6V A;  1WMH B;  2TSS A;  1ROE A;  1OQQ A;  2W55 A;  4F8C B;  4KSK C;  1WGH A;  3RUL A;  2NBV B;  1WX8 A;  1EO6 A;  2IY0 B;  2NPT A;  3CSF A;  4MH0 E;  3ZQ4 A;  2MBE A;  2L8J A;  2YLM A;  3SHQ A;  2GMI C;  1XT9 B;  1L5P A;  2D5G A;  1UBI A;  1V86 A;  4NJ6 A;  1J7B A;  2V4L A;  2DNF A;  3WAL A;  2W82 A;  3JSV A;  3IAM 1;  2KLC A;  4JPS A;  3RMK C;  2KDM A;  1TIF A;  2DYO A;  3H8H A;  3VTV A;  1E10 A;  3Q2A C;  2KQ4 X;  1WX9 A;  4TQ1 A;  2WNM A;  1JWU D;  1VJK A;  2KXJ A;  1TKG A;  1WRD B;  3CWI A;  4NQK E;  4K3B A;  1VZ7 A;  1Q1O A;  3HVD A;  1SJE D;  3SR6 A;  4XE0 A;  2BTE A;  5CX3 A;  4GGQ A;  4ARC A;  3VTW A;  2PVG C;  4LJO B;  2OJR A;  2N9E B;  4GU2 A;  4NJC A;  2C9W B;  4W9G A;  4OVV A;  4OW0 A;  4FJY A;  2WXJ A;  1XLP A;  1GJZ A;  1I4P A;  1WM3 A;  2HE7 A;  2PEA A;  3V05 A;  1F2R I;  1QKZ A;  2WDQ B;  2Z0E B;  2LRU A;  2KWU B;  3QA8 A;  5LLI A;  2G4D B;  2ZNV B;  1QZE A;  3P4R B;  3ZO5 B;  2KVR A;  3IFW B;  4G3X B;  3PZD A;  1YJJ A;  4HCP B;  5FK9 C;  1XLO A;  4HRO A;  3VRA B;  3IT6 B;  3I9V 1;  2OJW A;  3ZDT A;  1E7U A;  3BYT B;  4BKS A;  1I4G A;  1JWM D;  1NYR A;  3UIO B;  3GE3 C;  2MJE A;  3IAS 1;  1ZP0 B;  2K1F A;  2MCN B;  3V3X A;  1T5X D;  2D3C A;  1X1M A;  2IND C;  4ZOH C;  2RGF A;  2MW5 A;  1DGJ A;  2D3B A;  3DVN U;  3RPF C;  2BKR B;  2NTT A;  2LGS A;  2KT7 A;  2JPH A;  5EE1 A;  2IGG A;  3VDZ A;  1RYJ A;  1QLB B;  2KTF A;  2IPK D;  2M4N A;  5HG2 A;  2ZW1 A;  1ZKH A;  4RF1 A;  2LUM A;  4YSX B;  1YQ4 B;  1N6Z A;  1UWM A;  4LNF A;  3DBH B;  4YTM B;  2DWQ A;  4WUR A;  5HI1 A;  4WWO A;  2HJ1 A;  4B0M A;  3U4E G;  2KTR B;  2QSD A;  1CQV A;  4FUL A;  4C00 A;  4YT0 B;  1QIL A;  3P2B A;  4DQO C;  3TUO A;  2L1A A;  3ZNH B;  4ICU A;  2M17 A;  2PKO A;  2N1W A;  1F2R C;  2KDF B;  3ZGZ A;  2WU2 B;  3W2D A;  3R8B A;  1ET9 A;  3AE6 B;  4GDK B;  1DYQ A;  2JUO A;  4OZC A;  4GMV A;  4GOC A;  4XX5 A;  2DYB A;  4HRS A;  3FKY A;  3NZS A;  4RF0 A;  3N9Y C;  2KJH B;  1HTO A;  3ABV B;  4JIO U;  1C78 A;  1UH6 A;  3AE5 B;  1T0S C;  3HUI A;  1UBQ A;  3MC0 B;  2J52 A;  5L95 C;  1EF1 A;  1NDD A;  1B1Z A;  2DZJ A;  3ZTD A;  1WY8 A;  3HM6 X;  4EEW A;  2WGS A;  1Q0W B;  2WP9 B;  3NY5 A;  2HJ8 A;  4RCO A;  2KC2 A;  2WYQ A;  1RM6 C;  2LGX A;  3OJ3 A;  4KIK A;  4EUT A;  4C4V A;  1TS2 A;  1DOY A;  1AYF A;  3R2I A;  1HTQ A;  1C3T A;  4DBG A;  3L13 A;  3PHX B;  2HTH A;  1UNS A;  1J7C A;  3RCZ A;  4GDL A;  2BWF A;  4FHK A;  3V6C B;  3KVF B;  1WRI A;  3A4R A;  1TS4 A;  2WXL A;  2KC1 A;  3AE3 B;  3UIP B;  3R7Q A;  4ZDV A;  4W9I A;  1L6U A;  3DBL I;  3KQ4 A;  2A4Z A;  4M8M A;  3AV8 A;  1AN8 A;  4RFB A;  4JGH B;  3NHE B;  5IP4 D;  1K8R B;  3Q3N C;  3I57 A;  1VD2 A;  2RPQ A;  3AU5 A;  2PW9 A;  2J0M A;  1ZE3 D;  4W9C A;  1YN5 A;  4DXA B;  4ANV A;  4KGT A;  1FFV A;  1QOG A;  1JQ4 A;  1CK1 A;  1SJH D;  2DLB A;  4DHJ B;  4WWM A;  3FIL B;  1E8Y A;  4EZK A;  2INN E;  3LB8 C;  5IAA C;  4WQM A;  4LDT D;  5C2T B;  2O2V A;  2JF5 A;  2AQ1 B;  3TL5 A;  4PYZ A;  1WWT A;  3VRB B;  1WJN A;  1C79 A;  1PUT A;  2FIF A;  2XNA C;  4DHZ E;  3RNB C;  3BVZ A;  2FUH B;  3PO0 A;  2JXX A;  5J17 A;  4DHZ B;  4GXB A;  1L4D B;  4BKT A;  1SB3 C;  2BS3 B;  2NCN A;  4CQN A;  5L83 A;  3RNA C;  3PRP B;  1PQS A;  1MHX A;  2KOX A;  2IBI B;  1NI2 A;  4WQO B;  2A5U A;  4C7Y A;  5EE3 A;  3ZRF A;  4IWO A;  1L0V B;  1J7A A;  2O6V A;  2BPS A;  3HK0 A;  4FJZ A;  1KJT A;  4HK2 A;  2L0F A;  3NOB A;  4KKI A;  3WA0 A;  2MH7 A;  3RFZ B;  4G11 A;  3NRZ A;  3A9K B;  4H2A A;  1YN4 A;  2FBW B;  1ACC A;  2MBB B;  1GAQ B;  1EWY C;  4C80 A;  1YQB A;  1HZ5 A;  1WMH A;  3HIZ A;  4XGA B;  2AX5 A;  4M0W B;  1WH3 A;  4KV2 A;  2NMQ A;  1HA5 A;  4HJG E;  1FNW A;  2LRW A;  2OED A;  3PRM B;  4BBN C;  3L10 B;  3MC8 A;  4P1C C;  4G50 A;  1QT9 A;  4RGN A;  5FKA C;  1I4X A;  1N63 A;  4DXG A;  4WWP A;  3R2T A;  1WGK A;  2GBN A;  2BS4 B;  2K39 A;  1G6J A;  2BYV E;  3ZNI D;  1XF5 L;  4A3O A;  2KVZ A;  2LUE A;  1VR9 A;  3GE8 C;  4A90 A;  1TZO A;  1TKY A;  4URK A;  4G0N B;  4II2 B;  1FMA D;  3N20 C;  1J8C A;  5CHW A;  1TBE A;  2IY1 B;  5HFY A;  1VZ8 A;  2OHF A;  1JRU A;  2QJL A;  4W9F A;  2OOB B;  3WAP A;  1S1Q B;  4MJS B;  3ZKJ C;  2WQY B;  3DVG Y;  3KUZ A;  1MG8 A;  3A33 B;  5IOI A;  2LGI A;  2HD5 B;  2MBH A;  4EZL A;  3PLU A;  1WIA A;  4NQL B;  3AEF B;  5JH5 C;  1N5X A;  2WDT B;  1WR1 A;  3SU8 X;  3UF8 A;  3BZD B;  4R3D A;  5AZG A;  3ENE A;  4RM8 A;  3Q8E A;  2LGD A;  1Z5S B;  5CHF A;  2WXF A;  1TYG B;  5DPT A;  2E3T A;  2RMM A;  2MEK A;  2UU7 A;  2WXI A;  3DBH I;  4KIK B;  3AUL A;  3NVY A;  3N32 A;  2O6V B;  2WS3 B;  3BK1 A;  2AQ2 B;  1ET6 A;  2Q5W D;  4W9L A;  5BMG A;  3H9D A;  3PGE A;  2LHD A;  4LCD E;  3K9P B;  1NVI D;  2KJ6 A;  2N9K A;  4Q2J A;  3P63 A;  4FN2 A;  2WXN A;  2CHZ A;  4ZYS A;  3V61 A;  2JYT A;  5FR6 A;  2MRP A;  2QMT A;  1CMX B;  2VZK B;  5MPO A;  1T0Q C;  4L2Y A;  3H7S A;  1BUI C;  2C60 A;  3DBL B;  2CJN A;  4ANW A;  1OEY A;  5T8I A;  4ZHP A;  2WXP A;  3TCA A;  4RNA A;  2KHW B;  3B2F A;  5BYQ A;  2L76 A;  1UWX A;  5BMI A;  4K7U A;  3K9O B;  1WXM A;  4RH6 A;  1ZW7 A;  1ZXH A;  3W1S A;  3KWV A;  3DWM A;  3CST A;  1I7H A;  1OFF A;  4FHJ A;  2CU1 A;  4PT5 A;  3C0R B;  4EFO A;  4KX6 B;  3KW5 B;  5TR5 A;  4M01 A;  3IG3 A;  3RD2 A;  4IW0 A;  3JVZ X;  1GPX A;  3MTN B;  3UGB B;  2NPT B;  4ZRK A;  1AAR A;  4B6W A;  4HKQ A;  3OWE B;  1E8Z A;  3TMP B;  1FNU A;  2J0J A;  3AE8 B;  4HLE A;  4ZYN A;  2N0S B;  1T3Q A;  4IM3 A;  3OJ4 B;  4WJQ A;  2WXK A;  5D6J B;  2ON8 A;  3ZW3 A;  5C23 A;  4ITK A;  1WGG A;  3N1X C;  2ZNV C;  4JQW C;  2MP2 A;  4HEA 1;  2PE6 B;  1M94 A;  2X38 A;  5C1Z A;  4O1N A;  3AE9 B;  1C4P A;  2IO2 B;  4XWT A;  4CHK A;  1ZOY B;  1LXD A;  2RPV A;  4HPL B;  1L2N A;  5KHQ A;  2WWZ A;  1SXT A;  3I63 C;  4KGR A;  3ZJU A;  1PGB A;  2KFK B;  5AEK B;  2CU3 A;  2VH2 A;  3DHH C;  1SE4 A;  1OQR A;  3AEB B;  1V5T A;  3T3N A;  5FR3 A;  2JY6 A;  1RWS A;  1JWA D;  4N9F 4;  2KKC A;  3CIR B;  3Q3J A;  3C19 A;  3RUI B;  2KWC A;  1IBX B;  5EE0 A;  3X23 A;  2V0G A;  3VUY A;  2DBY A;  1Q10 A;  4W9K A;  1WFY A;  1F9J A;  1V80 A;  2K8C A;  1WYG A;  1XCQ L;  5HHD G;  4PK1 A;  3SFE B;  4YL8 A;  2ZW0 A;  1GC6 A;  4LDT B;  1MI0 A;  1FCC C;  3KUC B;  3T8M A;  2R2O A;  3T9L A;  2LJ5 A;  1ZDV A;  4W9H A;  4IDI A;  1UGM A;  3BWU D;  3NS1 A;  2M8S A;  2XEW A;  3EUB 2;  1N60 A;  4KVG B;  3BYY B;  3AE7 B;  3ML9 A;  3DQV A;  1SGH A;  4MT5 A;  1CJE A;  2D3G A;  4LK0 M;  4EKU A;  2REX A;  4LLG M;  3W5U B;  3EA6 A;  1F0Z A;  5G5G A;  1ZGU B;  3W9C B;  3CF6 E;  4FAD A;  2XK5 A;  2O2V B;  3DDC B;  2K3U A;  4RGO S;  3BY4 B;  4ANX A;  1FXT B;  1V97 A;  3PVL A;  3Q8A A;  4RGM A;  3HRD D;  5EDS A;  2HDE A;  2ZCC A;  4GN1 A;  4GLS C;  2FE8 A;  4IKG A;  4II3 B;  3R3M A;  1Y8R C;  1I35 A;  1YQ3 B;  4CO7 A;  1S3S G;  1U4A A;  1UF0 A;  2WXO A;  2JQR B;  2QDF A;  3KH0 A;  3M63 B;  3ZDM C;  4LNI A;  3X0W A;  1I42 A;  2K25 A;  2UYZ B;  3EHV A;  2IDY A;  2MQJ A;  3NZ3 A;  1I4Q A;  4A6Q A;  4REZ A;  3ECI A;  2DZM A;  2PIA A;  4MH8 A;  4IOI E;  1ZPS A;  2HTM E;  2IJ0 A;  2JZP A;  3BII D;  1JAL A;  3ETR A;  2FUG 1;  2LVP A;  1WJU A;  4XDD A;  4OZA A;  2D3A A;  2IZV B;  2GB1 A;  3AED B;  4NNJ B;  4ZRQ A;  4F7Z A;  1LGR A;  4WJO A;  1ISN A;  1ZDX A;  2EKE C;  4YWG G;  2M0X A;  2CHW A;  2L52 A;  2ZVN A;  3Q3F A;  4MGY E;  1OGW A;  3GZN B;  5DPR A;  1D6E C;  1WR6 E;  3NVV A;  3J9C A;  3H6N A;  4HWI B;  4PS7 A;  3DOW A;  1TJE A;  1UZX B;  2RDB C;  2KLG A;  4TQ0 A;  3M62 B;  5AZF A;  3GP7 A;  3NZU A;  1E6E B;  2IGD A;  3V60 A;  2J4X A;  2LHE A;  2K22 A;  3RZW C;  2MSE D;  3ZIM A;  3PS6 A;  3VR9 B;  1MHH E;  1YX6 B;  2KD0 A;  1WX7 A;  3QAR A;  1TKE A;  4IUM B;  1N61 A;  3U52 E;  2JWU A;  4HVB A;  2N9X A;  5IN7 A;  1HE8 A;  2R61 A;  5LNK 1;  4KKJ A;  1PGX A;  2LVO A;  1V2Y A;  2PLP A;  1EF5 A;  4CYE A;  1HQR D;  2M56 B;  4LTU A;  1UEL A;  2KWD A;  2G45 B;  2WLB A;  4S0R A;  3IVF A;  1P98 A;  2N7J A;  4C4V B;  1WGD A;  2KMA A;  3B2G A;  1V1P A;  1JCK B;  4WJP A;  3I5J C;  4AJY B;  4P6V F;  1K52 A;  4BBN F;  2I1J A;  3UI3 A;  3ZLZ A;  3ML8 A;  2LMC A;  2AYO B;  3U7Z A;  2V3S A;  3ZNG C;  4KZ0 A;  4XDC A;  3AXC A;  3MC9 A;  1AW7 A;  3Q3O C;  1C77 A;  1VZ6 A;  4GIV A;  2YEP F;  2J42 A;  2KWV B;  2R2Q A;  2WU5 B;  4I6P A;  1V1O A;  3N3K B;  1J0G A;  2JYE A;  4USA A;  3QCA A;  4KZC A;  4M8N A;  4J6I A;  3B08 A;  3JYU A;  2KJR A;  2BGF A;  3RNC C;  3ALB A;  1XLN A;  5G2N A;  3ZJV A;  1E0Z A;  2BBC A;  1NI3 A;  3HHM A;  4P1B C;  3E9S A;  1XXG A;  2BF8 B;  2KMC A;  2V9H A;  1B9R A;  2V1Y A;  4BAX A;  3Q8B A;  1WXA A;  4RMA A;  1I4H A;  2JRI B;  4XYC A;  3V6E B;  4KSL C;  3BIN A;  1L0X B;  4HJK A;  4LNO A;  2ACZ B;  2BYE A;  4DK5 A;  3ZXV A;  1GG3 A;  1XLQ A;  5E6P A;  2NVU I;  3KLS X;  1FIQ A;  3EFC A;  4A55 A;  2H89 B;  1A5R A;  1TGZ B;  3LXF A;  4ZRI A;  4ACF A;  2SEB D;  1WJ4 A;  3PSE B;  4JL9 A;  3MJ5 A;  2MJ3 A;  4MEL A;  4TSS A;  1QOF A;  3P4P B;  2MA9 B;  3M3J A;  2Y3A A;  2CJO A;  3HVZ A;  3S2A A;  4MAC A;  1FPY A;  3H7P A;  3EGR A;  2QCZ A;  1UGJ A;  2WXQ A;  1MFW A;  4ASW C;  5E6O A;  2MP2 B;  1BML C;  1FRR A;  3W1S C;  4US8 A;  3NS8 A;  1TY2 A;  3OLM D;  2L83 A;  4J3O D;  2KMM A;  2DZI A;  4OHJ A;  3Q8C A;  2MWS B;  1HXY D;  1XD3 B;  5D94 A;  2ASQ A;  3W5V B;  2KFK A;  3GB1 A;  2AEH A;  2BVC A;  4FLH A;  2IO1 B;  5JXV A;  2M0A A;  4WH4 A;  3L4P A;  1SE3 A;  1K53 A;  5DPS A;  2EKI A;  2CHX A;  2KN5 A;  3TEX A;  2MBQ A;  5E6J A;  4MSQ B;  2WXG A;  3RNE C;  4ZRP A;  3VQI A;  2KK8 A;  2KX3 A;  1WGY A;  1NEN B;  3BVM A;  4KDL B;  1SSN A;  4P16 A;  1WYW B;  1KOT A;  3UIN B;  2M19 A;  4FBJ B;  5AZH A;  1STE A;  3RYT A;  2KX0 A;  2MJD A;  3BVG A;  3N1Y C;  5LXH A;  2IO0 B;  3ZXR A;  1D5X C;  1Z2M A;  3V62 A;  4JE3 B;  1D5M C;  1JW9 D;  2N7D A;  1F52 A;  5EE9 A;  2X8X X;  4BZA A;  3QK0 A;  1TS3 A;  1V49 A;  1E7V A;  3R66 C;  4L23 A;  2JU6 X;  1IYF A;  3APC A;  4TV3 A;  3TSS A;  3QQ8 B;  2KN4 A;  3A9J A;  2KAJ A;  2CS4 A;  1IP9 A;  1KF6 B;  4GB9 A;  1RAX A;  3PRZ A;  2BB5 A;  2AQ3 B;  4FA6 A;  1FCL A;  2MLB A;  1HZ6 A;  2BT6 A;  4AJW A;  3ONS A;  4OVU A;  3ZNZ B;  3AEC B;  2GRI A;  4B95 A;  2K9X A;  3KUD B;  2N7E A;  2QC8 A;  3TBL D;  3H7P B;  1SBB B;  1WGR A;  2GI9 A;  1H8C A;  1IGC A;  2CKH B;  5AUK A;  1FM0 D;  1WE6 A;  4BFR A;  3HM3 A;  3RNF C;  2BYF A;  1ZUD 2;  1H4R A;  2INC C;  3AM9 A;  4KGS A;  3WAM A;  1WXS A;  1QOB A;  3VUW A;  1GB1 A;  3FIL A;  4N59 A;  3A9K A;  1CZP A;  3QHT A;  1WXV A;  2GBR A;  4I6N B;  3VTU A;  3TEZ A;  2QIE B;  2JWZ A;  2RSU A;  3E56 A;  2KAC A;  3DBS A;  1FO4 A;  1J19 A;  1NEK B;  2N9P C;  2JX5 A;  1SE2 A;  2D11 A;  4MM3 B;  4AOF A;  2VH1 A;  2BW2 A;  3AE2 B;  3BK2 A;  2W3R A;  4AWJ A;  3DCG A;  3KWL A;  4D2K A;  3QC8 B;  3IXS A;  3VVW B;  1JRO A;  2XBB C;  3QWZ B;  3AE4 B;  3DBR B;  4DDI D;  2XN9 C;  2K8H A;  3AN1 A;  2C7N B;  4HPP A;  3SFD B;  2LZ6 A;  3FC4 A;  2QIL A;  4GSW A;  1V81 A;  2KTR A;  1KRH A;  3VFK A;  2NBU A;  1JWB D;  1EU4 A;  4HXD A;  2JRH A;  3PZ7 A;  3L08 A;  2JSV X;  2KDE B;  1WI0 A;  3AMZ A;  3PPA A;  3AI5 A;  1R4M B;  1NBF C;  2BQQ A;  1P7F A;  4ICV A;  1V6E A;  2Z0D B;  2ICI A;  4DWF A;  3R7R A;  4MEM A;  4NAW A;  4M0W A;  3VR8 B;  1YIW A;  2KQ7 A;  1TT5 B;  2RD0 A;  3DVN V;  3EEC A;  1P0R A;  1ZXI A;  4IG7 B;  1FEH A;  4JLC A;  3MJW A;  2J7Q B;  4S17 A;  3U2S C;  4C7Z A;  4HCN B;  4X57 B;  1KLV A;  3NUH B;  4MGI E;  5GMV A;  4YSY B;  1UD7 A;  4XZ4 A;  4K81 A;  5DPW A;  3RT3 B;  4B9K A;  3Q3M C;  3TJP A;  3U7D A;  1DOX A;  4M02 A;  2VRR B;  1WXQ A;  3A1Q A;  2BWE S;  4AUQ C;  2BKF A;  4WJN A;  4MM3 A;  3SEB A;  1V9J A;  2YVC A;  4EE2 A;  2IGH A;  4RM9 A;  2K5P A;  3GZN I;  3P4S B;  1RRB A;  3PT2 B;  3TEW A;  1RFA A;  2MHJ A;  2IO3 B;  1L0Y B;  1V1P B;  3LYY A;  1F77 A;  3VAW A;  2WXM A;  2N4F A;  2IYD B;  3AE1 B;  2KDI A;  2LD9 A;  2W3S A;  5E6N A;  1VDV A;  4BKG A;  2NTS A;  2RDH A;  1KFY B;  2KNB A;  4NAW B;  3B1L X;  3U8Z A;  3SDL C;  2ZCB A;  2G1E A;  3AU4 A;  4YSZ B;  1K50 A;  1E8X A;  2KAN A;  1LFD A;  3VUX A;  3VH3 B;  3VHT C;  5JHA A;  1V5O A;  4GDL B;  4BKS D;  3PHW B;  3B9J A;  5KHO A;  4BOS C;  4ZHO A;  5D3D A;  2WDR B;  1E8W A;  4EOY A;  1LQB A;  5BYR A;  2I2Y A;  1MPE A;  4ANU A;  3AEA B;  2PJH A;  4NJ7 A;  1WF9 A;  3KYC D;  1RLF A;  2ZPY A;  1R4M I;  1E9M A;  4NZL B;  1OQY A;  4AP4 C;  1T0Y A;  1TTN A;  1FFU A;  4N6E B;  1C1Y B;  3A1Q B;  2JXT A;  2I38 A;  4W9D A;  3DVG X;  5BMH A;  1IPG A;  1YNT E;  2FID A;  1R4N B;  3DHG C;  4K7W A;  1DOI A;  4PS3 A;  3NVW A;  2JZZ A;  1WZ0 A;  4TKN A;  3L16 A;  1FXA A;  4KDI C;  4YXD B;  3VXW A;  4AS1 A;  2KYW A;  3ZUN A;  2J0K A;  1RFK A;  2AL3 A;  2N1V A;  4A9A A;  2V3P A;  5JHB A;  2BS2 B;  1WM2 A;  3MFG A;  4IM0 A;  2G9H D;  3RZF A;  4HDO A;  2PE9 A;  4IM2 A;  3I3T B;  4GDK A;  1LO5 D;  4FJV B;  5IKC M;  3JSV B;  4EZJ A;  2CR5 A;  3WIM A;  2AWT A;  2Z59 B;  1D4B A;  1YN3 A;  2KZR A;  3FAH A;  2BB6 A;  2J53 A;  1WSP A;  4A8X C;  1PDX A;  3AEG B;  1N62 A;  2K6Q A;  1OEY J;  5D3I B;  2EMT A;  1XQQ A;  1FRD A;  1OTR B;  5D7G A;  3GS2 A;  2ZPN A;  1IBX A;  1PGA A;  2PTL A;  3DWG C;  4JX1 C;  1EM7 A;  5C3J B;  2GBM A;  2MX2 A;  1JWS D;  1MG4 A;  3ZTC A;  3LJ3 A;  2M1M A;  3APD A;  2ZEQ A;  4UDU C;  2WXH A;  4I6L B;  4BOZ B;  1KLU D;  2KQS A;  2E6X A;  1UUP A;  3NVZ A;  2WX0 A;  5G55 A;  5BYS A;  1MVK A;  3WAO A;  2KDB A;  3KYD D;  3PLV A;  2L00 B;  2XK5 B;  2PVO D;  3QX1 A;  2V3N A;  2K8B A;  2DX5 B;  1VLB A;  3GOE A;  1WE7 A;  1C4A A;  3TIX A;  2UWQ A;  1TY0 A;  1HEZ E;  2NR2 A;  3A4S C;  4F1S A;  2Y5B B;  4DDG D;  1TZ1 A;  2NBW B;  1I4R A;  3Q14 C;  2PPH A;  2DAJ A;  2DZK A;  2Y5P A;  4HDQ A;  2FCN A;  4PS8 A;  4A20 A;  2ZZP B;  2WDV B;  4C56 C;  1M4V A;  2C7M B;  2C7H A;  1QQR A;  1WZ3 A;  2INP E;  2ZJD A;  2D10 A;  4K1R B;  4XC2 A;  3IBE A;  1EUV B;  4MSM B;  2KFJ A;  1VRA B;  1GUA B;  4ARI A;  5IA7 A;  1YJ1 A;  2DHZ A;  3P42 A;  1D5Z C;  2BYT A;  5GXG B;  1L7Y A;  2LVQ A;  5TSS A;  4WAF A;  1FNV A;  1R4N I;  2LXC A;  3QAQ A;  2KO3 A;  1SIF A;  4TUU A;  4E74 A;  2QHO A;  2JZ3 B;  2LFI A;  2DEN B;  1GC7 A;  3L17 A;  1C9F A;  2W9N A;  2FCM A;  3WCQ A;  2V4I B;  1A70 A;  4NY0 A;  1SF0 A;  5LXI B;  1GB4 A;  2GOW A;  1T6B X;  1V8C A;  2SAK A;  2L7R A;  3AB5 A;  2PMV A;  4IWQ A;  2L32 A;  2B3A A;  3L54 A;  2NS5 A;  3RN9 C;  3PRE A;  1YMH E;  1F1H A;  1YOV B;  5G5H A;  2FNJ B;  2ONQ A;  3IHP C;  2DAF A;  2DYM A;  1NYQ A;  2W54 A;  4E71 A;  4HKZ E;  2AL6 A;  1ENF A;  2FCS A;  5H8Y E;  4RGT A;  3OG5 A;  2QEJ C;  1K51 A;  2O6V D;  5I4D A;  4JWU C;  3ZRC A;  3OAW A;  4AQ7 A;  3Q6B A;  3Q69 A;  4HPM B;  1XCT L;  4PYU A;  3O65 B;  4YTN B;  1KLG D;  3D32 A;  1JRP A;  3L0W B;  1P7E A;  1P1A A;  2LAS A;  3VH4 B;  3W1Y A;  3C8Y A;  3PZ8 A;  4OVZ A;  2GBK A;  1SEB D;  1L4Z B;  2VZK D;  3UQB A;  2FAZ A;  1QOA A;  5HKH A;  4YTP B;  2JT4 B;  1JML A;  3H1U A;  4LNK A;  1QF6 A;  4TMA B;  3URY A;  3QIJ A;  4L1B A;  2LI5 A;  4BVU C;  4P7I A;  4US9 A;  3NG0 A;  2GBJ A;  2RR9 A;  3PV1 A;  2GLS A;  2D07 B;  3P1M A;  2K6D B;  3RI7 C;  3ZYY X;  5AUI A;  1LM8 B;  4WIP A;  1KH0 A;  2L0T A;  4MJS A;  4NAM A;  4DHJ D;  3DBR I;  2LJI A;  3M95 A;  2LWP A;  3RNG C;  1GNU A;  4WAA A;  2WHI A;  2WXR A;  3N1Z C;  4OZB A;  3LDZ E;  1KTK A;  2G4S A;  3APF A;  1MJD A;  4IC7 B;  5BO4 B;  1AWD A;  2WX1 A;  3Q8F A;  4IWP A;  3QJZ A;  2MBO A;  1WJ6 A;  4MDK E;  3P4Q B;  3T3O A;  5D2M B;  4LNN A;  1VCB A;  3CMM B;  1PYW D;  1Q5W B;  3PTF C;  4K3C A;  4B0E A;  1E5W A;  1SE9 A;  1XEE A;  2N9L A;  1N5W A;  4NPN A;  4LJP B;  3IT4 B;  2C5L C;  2I1K A;  2JVC A;  2EEL A;  4JWS C;  4FXC A;  4M00 A;  5IO9 A;  1FXI A;  2G3Q B;  3EC8 A;  4N58 A;  4ZRJ A;  2K0P A;  1EU3 A;  4A3P A;  4MGK E;  4E3C A;  1C4C A;  2LXA A;  2D2Q A;  4WWN A;  1BXT A;  3JW0 X;  4DXF A;  3N30 A;  2RDG A;  2L3Z A;  2ZVO A;  1ESF A;  1XO3 A;  4K7S A;  1D3Z A;  2EMS A;  2YEP B;  1EWC A;  3ZVV A;  1C76 A;  1P3Q U;  3SD5 A;  1TS5 A;  1E90 A;  5J2R A;  3A9J B;  1FD6 A;  1YD8 U;  2LGY A;  3AEE B;  3UQA A;  2Z8L A;  3NJT A;  4W9E A;  3WAN A;  3O13 A;  5JZE B;  5CTR C;  1PFD A;  3AH7 A;  1KM7 A;  3EFU A;  4MGZ E;  2L05 A;  2LEK A;  1Y56 A;  3MHS D;  4W9J A;  1YJI A;  5J18 A;  5DCN A;  1E7P B;  1P9D U;  5CHV C;  2H88 B;  1SIJ A;  1GOZ A;  3U30 A;  1IGD A;  3DPD A;  4XWW A;  2FCQ A;  1BT0 A;  3MP9 A;  3MHZ A;  2Y5C A;  3DHI C;  1R7S A;  1T0R C;  2B76 B;  4QAY A;  3ZJT A;  3TEY A;  1YX5 B; 
#chains in the Genus database with same CATH homology
 3VHT C;  5JHA A;  1V5O A;  4GDL B;  4AJY B;  3B0A A;  3PHW B;  4II2 B;  4BKS D;  1WMH B;  4BBN F;  1J8C A;  5CHW A;  2I1J A;  5KHO A;  1TBE A;  4BOS C;  2IY1 B;  3ZLZ A;  3ML8 A;  1JRU A;  2AYO B;  2V3S A;  4W9F A;  4F8C B;  2OOB B;  4KZ0 A;  3ZNG C;  4KSK C;  3AXC A;  3WAP A;  1WGH A;  1S1Q B;  3RUL A;  2NBV B;  1E8W A;  1EO6 A;  1WX8 A;  2IY0 B;  4MJS B;  3ZKJ C;  2NPT A;  3CSF A;  4EOY A;  4MH0 E;  1LQB A;  2MBE A;  2L8J A;  2YLM A;  3SHQ A;  3DVG Y;  2GMI C;  1XT9 B;  3KUZ A;  1MG8 A;  3A33 B;  4ANU A;  1UBI A;  1V86 A;  4NJ6 A;  2HD5 B;  2MBH A;  4EZL A;  3PLU A;  4GIV A;  2V4L A;  2KWV B;  1WIA A;  2PJH A;  2R2Q A;  4NJ7 A;  4NQL B;  4I6P A;  1WF9 A;  3WAL A;  5JH5 C;  3KYC D;  3JSV A;  2KLC A;  2WDT B;  1RLF A;  2ZPY A;  1R4M I;  1WR1 A;  3N3K B;  3SU8 X;  3UF8 A;  1OQY A;  1J0G A;  3QCA A;  4KZC A;  2DYO A;  4M8N A;  1T0Y A;  1TTN A;  4AP4 C;  4J6I A;  5AZG A;  1C1Y B;  3A1Q B;  3VTV A;  3B08 A;  3ENE A;  3JYU A;  4RM8 A;  3DVG X;  2LGD A;  4W9D A;  1IPG A;  1Z5S B;  5CHF A;  1WX9 A;  2FID A;  4TQ1 A;  4K7W A;  2KJR A;  5DPT A;  2BGF A;  3ALB A;  4PS3 A;  5G2N A;  2KXJ A;  1WRD B;  3DBH I;  4NQK E;  4AJW A;  4KIK B;  3AUL A;  2JZZ A;  3N32 A;  1WZ0 A;  4TKN A;  1Q1O A;  2O6V B;  3HHM A;  5CX3 A;  4GGQ A;  3L16 A;  4KDI C;  3VTW A;  4LJO B;  2BF8 B;  2KMC A;  2OJR A;  4W9L A;  3VXW A;  2N9E B;  3H9D A;  3PGE A;  4GU2 A;  2J0K A;  3ZUN A;  2C9W B;  4W9G A;  4LCD E;  4OVV A;  3K9P B;  2V1Y A;  2AL3 A;  2N1V A;  4FJY A;  1GJZ A;  1WXA A;  5JHB A;  2KJ6 A;  4RMA A;  1WM2 A;  1WM3 A;  2JRI B;  2HE7 A;  4FN2 A;  2PEA A;  4IM0 A;  2CHZ A;  3RZF A;  4HDO A;  2Z0E B;  2PE9 A;  4IM2 A;  3V61 A;  3V6E B;  4KSL C;  3I3T B;  5FR6 A;  2LRU A;  2KWU B;  3QA8 A;  3BIN A;  4HJK A;  5LLI A;  2G4D B;  2MRP A;  2ZNV B;  4FJV B;  4GDK A;  1CMX B;  1QZE A;  3JSV B;  4EZJ A;  2CR5 A;  2BYE A;  2AWT A;  2KVR A;  3IFW B;  3H7S A;  4G3X B;  3WIM A;  2Z59 B;  3PZD A;  3ZO5 B;  4DK5 A;  4HCP B;  1GG3 A;  5E6P A;  2KZR A;  2C60 A;  2NVU I;  3ZDT A;  1E7U A;  4ANW A;  1OEY A;  2K6Q A;  3TCA A;  1OEY J;  4BKS A;  2KHW B;  2EMT A;  2L76 A;  1XQQ A;  5D7G A;  1OTR B;  1A5R A;  1TGZ B;  4K7U A;  2ZPN A;  3K9O B;  1WXM A;  4ZRI A;  3UIO B;  3PSE B;  1WJ4 A;  1ZW7 A;  4JL9 A;  4MEL A;  3W1S A;  3M3J A;  2MA9 B;  2GBM A;  2K1F A;  2MX2 A;  2MCN B;  3CST A;  3ZTC A;  3LJ3 A;  2M1M A;  4FHJ A;  2CU1 A;  3S2A A;  3C0R B;  4EFO A;  3APD A;  3KW5 B;  2ZEQ A;  5TR5 A;  4I6L B;  3IG3 A;  1X1M A;  4IW0 A;  3H7P A;  3RD2 A;  4BOZ B;  2RGF A;  2KQS A;  3JVZ X;  2MW5 A;  3MTN B;  3UGB B;  4ASW C;  3DVN U;  2NPT B;  2WX0 A;  5E6O A;  5G55 A;  2MP2 B;  2BKR B;  4ZRK A;  1AAR A;  3W1S C;  4B6W A;  2JPH A;  3VDZ A;  3NS8 A;  3WAO A;  3OLM D;  2KDB A;  3KYD D;  3PLV A;  2DZI A;  2L00 B;  1E8Z A;  2XK5 B;  2MWS B;  3QX1 A;  3TMP B;  2KTF A;  2K8B A;  2DX5 B;  2J0J A;  1XD3 B;  5D94 A;  3GOE A;  2M4N A;  4HLE A;  4ZYN A;  2ASQ A;  1WE7 A;  2KFK A;  2AEH A;  3TIX A;  4FLH A;  2UWQ A;  2IO1 B;  2NR2 A;  3A4S C;  4F1S A;  1ZKH A;  4IM3 A;  3OJ4 B;  4WJQ A;  5D6J B;  2Y5B B;  4DDG D;  1TZ1 A;  5DPS A;  2NBW B;  3ZW3 A;  5C23 A;  2CHX A;  2PPH A;  2DAJ A;  2DZK A;  1WGG A;  2KN5 A;  2ZNV C;  2MBQ A;  4MSQ B;  4JQW C;  4HDQ A;  2MP2 A;  3VQI A;  2FCN A;  2KK8 A;  2KX3 A;  1WGY A;  4PS8 A;  4A20 A;  4KDL B;  4WWO A;  1WYW B;  2PE6 B;  1M94 A;  2ZZP B;  5C1Z A;  2KTR B;  1KOT A;  3UIN B;  4FBJ B;  4FUL A;  2C7M B;  5AZH A;  3RYT A;  2C7H A;  2KX0 A;  3P2B A;  1WZ3 A;  2IO2 B;  2ZJD A;  2D10 A;  3ZNH B;  5LXH A;  4ICU A;  4K1R B;  4CHK A;  2IO0 B;  2M17 A;  4XC2 A;  1LXD A;  3IBE A;  2N1W A;  4HPL B;  1EUV B;  1Z2M A;  1L2N A;  3V62 A;  5KHQ A;  2WWZ A;  4MSM B;  2KFJ A;  2KDF B;  3ZTD A;  1GUA B;  2N7D A;  3QK0 A;  1V49 A;  5IA7 A;  1E7V A;  3R66 C;  1IYF A;  1YJ1 A;  4GDK B;  2DHZ A;  3APC A;  4TV3 A;  2JUO A;  1L7Y A;  2KFK B;  2LVQ A;  3QQ8 B;  4GMV A;  5AEK B;  3A9J A;  4GOC A;  4XX5 A;  2DYB A;  2CS4 A;  3NZS A;  1IP9 A;  2KJH B;  1R4N I;  1RAX A;  1V5T A;  4GB9 A;  4JIO U;  2LXC A;  3PRZ A;  1UH6 A;  2JY6 A;  3QAQ A;  2KO3 A;  1SIF A;  4N9F 4;  2KKC A;  4TUU A;  4E74 A;  2QHO A;  1UBQ A;  3Q3J A;  2MLB A;  4FA6 A;  2JZ3 B;  5L95 C;  1EF1 A;  1NDD A;  2DZJ A;  3ONS A;  2DEN B;  1GC7 A;  1WY8 A;  3L17 A;  2W9N A;  4OVU A;  3RUI B;  2KWC A;  2FCM A;  3ZNZ B;  4B95 A;  3HM6 X;  3X23 A;  3KUD B;  4NY0 A;  2N7E A;  4EEW A;  1Q0W B;  3NY5 A;  3VUY A;  3TBL D;  5LXI B;  3H7P B;  2HJ8 A;  2GOW A;  1WGR A;  1H8C A;  2KC2 A;  2WYQ A;  4W9K A;  1WFY A;  2CKH B;  1F9J A;  1WE6 A;  2L7R A;  1V80 A;  2K8C A;  3HM3 A;  4BFR A;  4IWQ A;  2LGX A;  2BYF A;  2B3A A;  3OJ3 A;  3L54 A;  2NS5 A;  1H4R A;  4YL8 A;  4KIK A;  4EUT A;  3PRE A;  1GC6 A;  3WAM A;  4LDT B;  1WXS A;  3KUC B;  3T8M A;  2FNJ B;  3VUW A;  2R2O A;  1C3T A;  3IHP C;  3L13 A;  3T9L A;  3PHX B;  2HTH A;  4DBG A;  2LJ5 A;  3RCZ A;  4GDL A;  2DAF A;  2BWF A;  2DYM A;  4W9H A;  4FHK A;  3V6C B;  3KVF B;  1UGM A;  3A9K A;  2M8S A;  3QHT A;  1WXV A;  2XEW A;  3A4R A;  4KVG B;  4E71 A;  2AL6 A;  2KC1 A;  3UIP B;  2FCS A;  3R7Q A;  3ML9 A;  4ZDV A;  2GBR A;  3DQV A;  4W9I A;  4I6N B;  3VTU A;  3DBL I;  1SGH A;  2JWZ A;  2O6V D;  2RSU A;  2D3G A;  3ZRC A;  4EKU A;  2REX A;  3DBS A;  3OAW A;  1J19 A;  2A4Z A;  4M8M A;  4HPM B;  4JGH B;  3NHE B;  4PYU A;  2N9P C;  3O65 B;  1K8R B;  1ZGU B;  3CF6 E;  3D32 A;  2D11 A;  4FAD A;  1VD2 A;  2RPQ A;  3AU5 A;  2XK5 A;  4AOF A;  3L0W B;  2O2V B;  3DDC B;  1P1A A;  2J0M A;  2LAS A;  3VH4 B;  4W9C A;  4DXA B;  3W1Y A;  4AWJ A;  3DCG A;  3BY4 B;  4ANX A;  4ANV A;  3QC8 B;  2GBK A;  1FXT B;  3PVL A;  3UQB A;  3VVW B;  2FAZ A;  2XBB C;  3QWZ B;  5HKH A;  5EDS A;  2JT4 B;  4DDI D;  2ZCC A;  2K8H A;  4GN1 A;  3H1U A;  2C7N B;  4II3 B;  3R3M A;  3QIJ A;  4DHJ B;  1Y8R C;  2LI5 A;  4BVU C;  2LZ6 A;  1I35 A;  4P7I A;  4CO7 A;  1S3S G;  1U4A A;  4EZK A;  1E8Y A;  4GSW A;  2GBJ A;  1V81 A;  2RR9 A;  3KH0 A;  2KTR A;  3PV1 A;  5IAA C;  3M63 B;  3VFK A;  4LDT D;  2NBU A;  2D07 B;  2O2V A;  2JF5 A;  2K6D B;  4HXD A;  3TL5 A;  1LM8 B;  4PYZ A;  3ZDM C;  2JRH A;  2L0T A;  4MJS A;  3X0W A;  4DHJ D;  3DBR I;  3L08 A;  1I42 A;  1WJN A;  2K25 A;  2UYZ B;  2KDE B;  2LWP A;  2FIF A;  1WI0 A;  3EHV A;  3M95 A;  3PPA A;  1GNU A;  3AI5 A;  4WAA A;  4DHZ E;  1NBF C;  2MQJ A;  4ICV A;  1V6E A;  2Z0D B;  2FUH B;  3LDZ E;  4DWF A;  2JXX A;  3ECI A;  2G4S A;  5J17 A;  3APF A;  2DZM A;  3R7R A;  4IC7 B;  5BO4 B;  4DHZ B;  4MEM A;  4NAW A;  2WX1 A;  4IWP A;  4GXB A;  4BKT A;  1YIW A;  2KQ7 A;  2MBO A;  3QJZ A;  1WJ6 A;  4G0N B;  4MDK E;  2NCN A;  2RD0 A;  3DVN V;  5L83 A;  5D2M B;  3EEC A;  3PRP B;  1P0R A;  1PQS A;  4IG7 B;  2LVP A;  2KOX A;  1WJU A;  1VCB A;  3CMM B;  2IBI B;  4JLC A;  1NI2 A;  1Q5W B;  3MJW A;  3PTF C;  1E5W A;  1SE9 A;  2IZV B;  2J7Q B;  4NNJ B;  4NPN A;  4LJP B;  4F7Z A;  4WQO B;  2A5U A;  4WJO A;  4HCN B;  2C5L C;  2I1K A;  4X57 B;  2JVC A;  1KLV A;  3ZRF A;  1ISN A;  4MGI E;  5GMV A;  1UD7 A;  4IWO A;  4XZ4 A;  2EKE C;  4K81 A;  2G3Q B;  5DPW A;  3EC8 A;  2M0X A;  2CHW A;  2O6V A;  2ZVN A;  2BPS A;  3Q3F A;  3HK0 A;  4FJZ A;  4MGY E;  1KJT A;  4ZRJ A;  4HK2 A;  1OGW A;  3RT3 B;  4A3P A;  5DPR A;  2L0F A;  1WR6 E;  4MGK E;  3NOB A;  3WA0 A;  4E3C A;  3H6N A;  2LXA A;  2D2Q A;  4HWI B;  4WWN A;  4G11 A;  4B9K A;  3TJP A;  3A9K B;  3JW0 X;  4PS7 A;  3DOW A;  3U7D A;  1UZX B;  3N30 A;  2VRR B;  2KLG A;  2L3Z A;  2ZVO A;  4TQ0 A;  3A1Q A;  3M62 B;  5AZF A;  2BWE S;  4K7S A;  2BKF A;  4WJN A;  4AUQ C;  1D3Z A;  2MBB B;  2EMS A;  3NZU A;  3V60 A;  4MM3 A;  3ZVV A;  1P3Q U;  3SD5 A;  3RZW C;  1V9J A;  1YQB A;  1WMH A;  2MSE D;  2YVC A;  3HIZ A;  3PS6 A;  3ZIM A;  4M0W B;  4RM9 A;  1WH3 A;  1YX6 B;  2KD0 A;  1E90 A;  4KV2 A;  5J2R A;  3GZN I;  3A9J B;  1RRB A;  3PT2 B;  1RFA A;  1WX7 A;  1YD8 U;  3QAR A;  2LGY A;  2IO3 B;  2LRW A;  3PRM B;  4BBN C;  3UQA A;  4IUM B;  3L10 B;  4W9E A;  3WAN A;  3VAW A;  4HVB A;  2N9X A;  5JZE B;  2N4F A;  4G50 A;  5CTR C;  2IYD B;  1KM7 A;  3EFU A;  2KDI A;  4MGZ E;  2L05 A;  3MHS D;  1HE8 A;  2LD9 A;  4W9J A;  5E6N A;  5J18 A;  4BKG A;  5DCN A;  2LVO A;  1P9D U;  1V2Y A;  5CHV C;  1EF5 A;  2KNB A;  4NAW B;  3B1L X;  3U8Z A;  4WWP A;  4CYE A;  3U30 A;  3DPD A;  2GBN A;  2FCQ A;  2K39 A;  3SDL C;  1G6J A;  2BYV E;  2ZCB A;  1BT0 A;  1UEL A;  3ZNI D;  4A3O A;  2G45 B;  3AU4 A;  3IVF A;  2LUE A;  1P98 A;  1WGD A;  1E8X A;  2KMA A;  2KAN A;  1LFD A;  3VUX A;  4WJP A;  4URK A;  3VH3 B;  1YX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...