2RPQA

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 2
publication title Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rpqA00
2V1YA 3PPAA 1XT9B 3JW0X 4I6PA 2KO3A 4NJ7A 4NAWB 1V5TA 3VQIA 1E7VA 4HPMB 1TTNA 3D32A 4JGHB 4JLCA 1HE8A 4G50A 1P9DU 2JVCA 2KFKB 2MP2A 4KZ0A 4CO7A 2R2QA 3N3KB 4W9LA 1SIFA 3EECA 1YJ1A 1YQBA 3L08A 3APFA 4IW0A 1WXAA 4BFRA 1R4NI 2N7DA 2N9XA 3R66C 2HJ8A 5L83A 4E71A 1WXMA 3VVWB 4CYEA 1WMHA 4NNJB 4A20A 2JPHA 2ZVNA 1EUVB 5E6PA 3S2AA 1WR1A 2BWFA 4A3PA 4TUUA 3WA0A 1FXTB 2Y5BB 4HCPB 2LRWA 2AL6A 2DZMA 3U30A 3VTWA 4GDLB 2CHXA 2LGDA 3A9KB 2DZIA 2DYMA 4FADA 2JXXA 3WALA 3CSTA 5AZHA 4LCDE 4GSWA 2RD0A 4W9GA 1D3ZA 3H7PA 3L13A 4EUTA 4XC2A 3ZRFA 3Q3FA 3RD2A 2BPSA 4FHJA 2KWCA 4HK2A 4TQ1A 5IAAC 2O6VA 3KW5B 4MM3A 1PQSA 2J0JA 3ML8A 1WFYA 3MJWA 4HXDA 3WAOA 4M0WB 2LVOA 4MGYE 4W9HA 4W9FA 3ZW3A 2L76A 1WF9A 4KIKA 4F1SA 1WM3A 3KVFB 4KSKC 2L7RA 3V6CB 3ZRCA 2L8JA 1V49A 2NPTB 3VH4B 2LASA 3CSFA 5BO4B 2PE6B 2JZZA 3ALBA 3PSEB 4W9KA 4XZ4A 1LXDA 1LQBA 3KUDB 4BKSA 4JL9A 3DQVA 3MTNB 2KWUB 3DVNU 3KYDD 1EO6A 2IO2B 1BT0A 2KDBA 2KJRA 4BVUC 4EOYA 4ICUA 2KX0A 4DWFA 4GIVA 3IBEA 1YD8U 2RR9A 3SU8X 5LXHA 1R4MI 1WGRA 4BKTA 3NS8A 1OGWA 2M4NA 4GU2A 1H4RA 3HHMA 2MWSB 2KN5A 4DDGD 2MCNB 4F7ZA 1S1QB 2LXAA 3WAPA 2LJ5A 4LDTD 3M63B 1UBQA 3QARA 4FJYA 3A33B 1E8YA 2D3GA 2ZPNA 4NQKE 4WQOB 1WXVA 3HIZA 2KWVB 2K1FA 1GC7A 1IPGA 3DBSA 1Z5SB 2L0FA 1GNUA 2LWPA 3EHVA 3NOBA 5CHVC 4EEWA 2ZPYA 2MBEA 4N9F4 2C7NB 5CTRC 5FR6A 1EF1A 4ZYNA 4JQWC 1IP9A 3A9JA 3T8MA 2K25A 4HDOA 3PGEA 4MJSB 1E7UA 1SE9A 4WJOA 3TMPB 3V61A 4GB9A 4LJOB 1GG3A 2C5LC 2KQSA 2N1WA 1KM7A 2WWZA 3BY4B 2KX3A 3VUXA 5AZFA 1F9JA 3A1QA 3PV1A 4K7UA 1KOTA 1UGMA 2G4DB 4B6WA 3QJZA 3AU4A 1J0GA 1WYWB 4F8CB 4URKA 1JRUA 3W1YA 3H1UA 3UF8A 5JHBA 4WWNA 3X0WA 4WWPA 1QZEA 3W1SA 2WDTB 3EFUA 2WX0A 4AJYB 2IO0B 3QHTA 2NCNA 2V4LA 2KLCA 3Q3JA 1J19A 3U8ZA 2AWTA 3PREA 4IG7B 4RM8A 3T9LA 2G45B 3RZWC 2NVUI 1UZXB 3DDCB 3PVLA 3JYUA 2IO1B 4II2B 3UIPB 3R7RA 3R7QA 2KNBA 3A4RA 4W9CA 2KTFA 1UH6A 3ZNID 2OJRA 3NY5A 4IC7B 3RZFA 1XD3B 2BYFA 3EC8A 2ZCCA 4W9DA 4I6LB 4MSQB 3OJ3A 2KD0A 4M8MA 5KHOA 2AL3A 4ANUA 4I6NB 2K39A 2WX1A 5HKHA 3L17A 4FLHA 5DCNA 4FA6A 3NZSA 3TBLD 1J8CA 4K7SA 4MH0E 3BINA 3JSVB 4A3OA 3OJ4B 2XK5B 1CMXB 1ZKHA 4GMVA 2MRPA 3UGBB 1UD7A 3CMMB 3DVGX 1OTRB 2V3SA 2BKRB 4MSMB 1V86A 1WGYA 2JZ3B 3IFWB 4KV2A 5CX3A 2L05A 3RT3B 3WANA 2KVRA 3N32A 4OVUA 2K6QA 3VXWA 2BYVE 1E90A 2NBVB 4GDKA 4MELA 4NQLB 3ZNGC 3ZVVA 5J18A 1WGHA 2D2QA 4KVGB 5TR5A 4KDLB 1A5RA 3RCZA 1OEYJ 2KXJA 3KYCD 3SDLC 2DENB 2JRIB 1RFAA 1V5OA 4E3CA 2JF5A 2A5UA 2ZCBA 2ZVOA 1C1YB 2M0XA 4K7WA 3ZIMA 4BKGA 4BBNC 2NBUA 4NAWA 3I3TB 4EZKA 4HLEA 4TV3A 3UQAA 4ZDVA 2DHZA 2CHZA 4DHJB 4RMAA 5L95C 2KFKA 4ZRKA 4FJVB 3QQ8B 1NI2A 2RSUA 2LXCA 1WGDA 2KC1A 1TGZB 4HJKA 3VFKA 1ISNA 2NR2A 4G0NB 4MGIE 5DPSA 3ZTDA 3IVFA 2IYDB 3DPDA 4BBNF 1E8WA 3QK0A 5JH5C 1SGHA 3DVNV 3ZKJC 2LUEA 5DPWA 3DBHI 4GDLA 3A9KA 4IWQA 2G3QB 4W9JA 3VDZA 3V62A 2FCSA 4E74A 3LJ3A 1WJUA 2K8CA 2OOBB 2FIFA 2HE7A 2DZJA 1WJ4A 2A4ZA 3PZDA 3QCAA 2O2VB 2UWQA 2KK8A 2N9EB 2MLBA 4EKUA 2W9NA 2ZEQA 4B9KA 4HCNB 2LRUA 2KTRB 3NZUA 4KSLC 2FCNA 4PS8A 1Q1OA 2J0MA 3HM6X 2KMAA 4G3XB 1WE6A 3QIJA 2XBBC 2XEWA 2N7EA 2LD9A 3ZO5B 1WI0A 4DHZB 4CHKA 3KH0A 5D7GA 2D07B 4J6IA 4X57B 2KLGA 3ZNZB 3L10B 2NPTA 3TL5A 2DAFA 1UBIA 2BWES 5AZGA 3VHTC 2J7QB 3GOEA 3K9PB 2CR5A 3U7DA 5AEKB 2L00B 2RPQA 2BKFA 4IM3A 1GC6A 4NY0A 3WIMA 4ANWA 1TZ1A 1K8RB 1V2YA 2KANA 4TKNA 1S3SG 2IBIB 2MP2B 2N1VA 3C0RB 3LDZE 4MEMA 4IUMB 3SD5A 4WWOA 2IY0B 2JT4B 2N4FA 2C60A 1RLFA 2ASQA 3JVZX 1P0RA 4MGZE 4LJPB 1P1AA 3IG3A 1WX8A 4II3B 4P7IA 1TBEA 3QC8B 3TIXA 1NBFC 1Y8RC 3APCA 2M17A 4MDKE 1WMHB 1V6EA 2DZKA 3AXCA 2D10A 3O65B 4GGQA 4KDIC 1U4AA 4IM0A 2MA9B 2WYQA 3PLUA 3VTVA 2FCMA 2Z0DB 3TCAA 2LI5A 5JHAA 1P3QU 3W1SC 4FHKA 1EF5A 4IM2A 5E6NA 1I42A 3HK0A 3NHEB 4NJ6A 2PE9A 3L0WB 5C23A 3VAWA 2CKHB 2Z59B 3M3JA 2IZVB 2FCQA 4IWOA 3M62B 3H7PB 3CF6E 2JY6A 4ZRIA 2O6VB 2DAJA 3KUCB 1ZW7A 2BGFA 2AEHA 2B3AA 3PS6A 3ML9A 4B95A 4KIKB 1X1MA 3MHSD 2GBKA 3WAMA 2EMTA 2PEAA 1V81A 1L2NA 3VUWA 1VD2A 1AARA 1WR6E 2KQ7A 1P98A 2KKCA 2REXA 2J0KA 4KZCA 4MJSA 4PS3A 4DHJD 5CHFA 1YX5B 4GN1A 1KJTA 1OEYA 2JRHA 2MBOA 2ZJDA 2LGYA 4WJQA 1WZ0A 4XX5A 2I1KA 4AJWA 4FBJB 1WIAA 4ASWC 5LXIB 2GBNA 1UELA 3L16A 4PYUA 3PHXB 3N30A 3HM3A 3ZDMC 2EMSA 2KDEB 1YIWA 2D11A 4G11A 1WE7A 1WX9A 2N9PC 3QA8A 2HD5B 2C7MB 4YL8A 1V80A 1WXSA 1E8ZA 2GMIC 4GXBA 2KDFB 4EZJA 1KLVA 2PPHA 4JIOU 2ZZPB 4BOSC 3V60A 3AI5A 1WRDB 2L3ZA 3ZLZA 4ICVA 2C7HA 4AOFA 2GBRA 5KHQA 2ZNVC 5DPRA 4BOZB 1H8CA 4GOCA 2VRRB 1WJ6A 2CU1A 2HTHA 3A4SC 2YVCA 1E8XA 1LM8B 3PT2B 2CHWA 3DVGY 3PTFC 5G2NA 3PLVA 2I1JA 2PJHA 1VCBA 2KOXA 1T0YA 2QHOA 2KMCA 3DOWA 3B08A 4ANVA 5EDSA 3H9DA 4W9EA 2UYZB 1WJNA 4TQ0A 4M8NA 3ENEA 1L7YA 2KJ6A 3DBRI 4FJZA 1RAXA 1MG8A 2KC2A 4DK5A 5E6OA 4AUQC 2BYEA 4WJPA 2EKEC 2JUOA 3UINB 1V9JA 1M94A 1I35A 2GBJA 3A9JB 4PYZA 2MBQA 2MW5A 4IWPA 5GMVA 2MBHA 1WX7A 3JSVA 2RGFA 1Z2MA 2IO3B 4AP4C 2XK5A 3P2BA 4DDID 3M95A 2K6DB 3A1QB 4MGKE 2MSED 4FULA 1WZ3A 1GJZA 5LLIA 3UQBA 3OLMD 3QX1A 3VH3B 4DXAB 2YLMA 3ECIA 1GUAB 2LVQA 3X23A 2K8BA 3OAWA 5D2MB 3AULA 3SHQA 3QWZB 5D94A 2FIDA 3GZNI 4WAAA 2GBMA 2LZ6A 2L0TA 2MQJA 3APDA 2G4SA 2C9WB 4ANXA 3K9OB 2AYOB 3ZTCA 3H6NA 2LGXA 3ZUNA 2FNJB 1YX6B 1C3TA 4RM9A 5C1ZA 3H7SA 4OVVA 5CHWA 2MBBB 2O6VD 3ZDTA 1G6JA 2BF8B 3DBLI 3RUIB 3UIOB 3KUZA 4NPNA 3B0AA 2KFJA 4K1RB 3VUYA 3ZNHB 4DHZE 3PRZA 4FN2A 4EZLA 4ZRJA 1OQYA 1RRBA 1NDDA 1Q0WB 3RYTA 2CS4A 3TJPA 2R2OA 2KZRA 5D6JB 3V6EB 5JZEB 5J2RA 5DPTA 3R3MA 4HWIB 4WJNA 4DBGA 2K8HA 3ONSA 4BKSD 1E5WA 2KJHB 1ZGUB 1IYFA 3DCGA 2DX5B 3QAQA 5J17A 2M8SA 3PHWB 4AWJA 2LVPA 1WM2A 1Q5WB 2Z0EB 1LFDA 2FAZA 1WY8A 2NBWB 3AU5A 2DYOA 2MX2A 2DYBA 2O2VA 2GOWA 4GDKB 4LDTB 4EFOA 2IY1B 5G55A 2KTRA 2FUHB 3L54A 3RULA 2M1MA 3B1LX 3IHPC 4HDQA 2NS5A 4K81A 5IA7A 2ZNVB 2KHWB 1WGGA 3PRMB 1XQQA 2JWZA 4HPLB 4PS7A 4W9IA 4HVBA 3VTUA 3PRPB 1WH3A 2KDIA
chains in the Genus database with same CATH superfamily
3PPAA 3AE1B 4WIPA 1FFVA 5HI1A 3DBHB 1TTNA 2LEKA 4JLCA 2MP2A 1ENFA 4CO7A 2R2QA 1YQBA 2D3CA 4BFRA 4YSZB 1ZE3D 1R4NI 1SE3A 2HJ8A 3DHIC 2WLBA 1L0YB 1HTQA 1EUVB 3ZGZA 1PYWD 2CHXA 2DYMA 1JWAD 3CSTA 1D3ZA 3H7PA 4TQ1A 3KW5B 1WFYA 4MGYE 4W9HA 2L7RA 3Q8EA 2L8JA 3W5VB 1SJHD 2L83A 3PSEB 4XZ4A 1LXDA 2LUMA 4BKSA 2OEDA 3DVNU 2IO2B 2KDBA 2KJRA 4EOYA 1CJEA 2KX0A 4DWFA 4GIVA 2RR9A 1R4MI 3BK2A 2M19A 4NJCA 2LGSA 1I4RA 3HHMA 5FK9C 3CWIA 1KRHA 5HHDG 4LDTD 1XLQA 3QARA 2WXMA 2D3GA 2LMCA 2J53A 3NVVA 2KWVB 1N60A 2LGIA 2L0FA 2WXFA 2WU2B 3EHVA 4ACFA 4EEWA 3Q3OC 2C7NB 3EFCA 5CTRC 2INDC 5FR6A 2INPE 3MJ5A 2I2YA 4ZYNA 4JQWC 3A9JA 3Q8FA 4MJSB 4GB9A 2KQSA 2N1WA 5AZFA 1V1PB 1MJDA 4B6WA 4LNIA 1UNSA 1WYWB 3TEXA 2WXPA 5JHBA 1FFUA 3EFUA 4AJYB 2V4LA 3Q3JA 1J19A 3PREA 3Q69A 2G45B 3RZWC 1TIFA 3R7QA 3A4RA 2KTFA 4ZOHC 3ZNID 1VRAB 3AEDB 3NY5A 1VZ8A 3C19A 3RZFA 2BYFA 2ZCCA 4I6LB 4MSQB 3R8BA 5KHOA 1XLOA 2UU7A 4I6NB 2LFIA 2K39A 2KDMA 2RPVA 4FLHA 3TBLD 4J3OD 1TKGA 3AE5B 4GMVA 2MRPA 3DVGX 3BZDB 3O13A 3DBLB 3IFWB 3RT3B 2Y5PA 4GDKA 4NQLB 3DHGC 2D2QA 4BZAA 4KDLB 3RCZA 2KXJA 2DENB 1LO5D 1NVID 1C1YB 2M0XA 3IAM1 4RGMA 1WXQA 3BK1A 2NBUA 4NAWA 4EZKA 4HLEA 3UQAA 2IPKD 3BVGA 2CHZA 3WCQA 1CK1A 1QILA 2KFKA 3E56A 4FJVB 4ZRKA 1NI2A 3FILA 4RF0A 3MHZA 3AEGB 2IYDB 3ZKJC 2LUEA 3RMKC 4RFBA 4C00A 2K0PA 4XDCA 2BVCA 3QCAA 2O2VB 2KK8A 2N9EB 2W9NA 1I4XA 2AQ3B 4HCNB 1ET9A 1VZ6A 3HM6X 4G3XB 1WE6A 4HPPA 2N7EA 1R4NB 4DHZB 3URYA 2D07B 1MG4A 3L10B 2NPTA 1UBIA 2BWES 4LNOA 3U7DA 4N59A 2CR5A 5AEKB 2BKFA 4IM3A 4NY0A 3NZ3A 1V2YA 2MHJA 2N1VA 3C0RB 4YSXB 4MEMA 2N4FA 2C60A 1RLFA 1P0RA 1JWMD 1P1AA 3TIXA 1DYQA 2DWQA 2BW2A 2KQ4X 1Y8RC 3NVZA 2AX5A 2SAKA 4HJGE 4WAFA 3AXCA 3O65B 4KDIC 3VTVA 2LI5A 5AUKA 4O1NA 5G5GA 3W1SC 4FHKA 1EF5A 3L0WB 5C23A 2Z59B 3M3JA 1I4GA 4YWGG 2FCQA 3CF6E 2JY6A 1AWDA 2DAJA 2BGFA 4N58A 2B3AA 3PS6A 4LNFA 1N5WA 4KIKB 1SJED 1HZ6A 3MHSD 3PZ7A 2QDFA 2PEAA 1R4MB 3VUWA 5E6JA 3HUIA 2KQ7A 4KZCA 4PS3A 3RN9C 2ZJDA 5EE1A 4FBJB 1WZ0A 4IDIA 5LXIB 3L16A 4JPSA 1FEHA 3PHXB 5MPOA 4LTUA 2KDEB 1YIWA 4XWWA 4G11A 1WE7A 2N9PC 3QA8A 3ZXRA 3V05A 4YL8A 1V80A 1E8ZA 2PPHA 4BOSC 2MH7A 2C7HA 1NEKB 1UWMA 2GBRA 1H8CA 4BOZB 4GOCA 1WJ6A 2CU1A 2HTHA 2CU3A 4US9A 2BYTA 3PT2B 2CHWA 3DVGY 3PTFC 5G2NA 3RNBC 4IOIE 2KOXA 1T0YA 3DOWA 5EDSA 2UYZB 4M8NA 2KJ6A 4OZCA 2HTME 1MG8A 5E6OA 4WJPA 2JUOA 2WXLA 1I35A 2GBJA 2PVGC 2MBQA 1SEBD 1QQRA 2IO3B 2XK5A 2L1AA 5BYQA 2K6DB 2WXKA 3QX1A 3VH3B 1MHXA 2ZW0A 4EE2A 1GUAB 3OAWA 3U7ZA 2FIDA 4C4VB 4RCOA 3K9OB 2AYOB 2LGXA 1YX6B 4IKGA 4RM9A 4XGAB 3GE8C 1FD6A 3ZDTA 4YXDB 2QILA 3NJTA 4DQOC 1EWYC 2VH2A 3VRBB 1E10A 1K50A 4XDDA 4LLGM 3N1YC 2J4XA 5DPTA 4HWIB 3BVZA 1IBXB 2K3UA 3QAQA 4HKQA 1WM2A 2V3NA 4AQ7A 2Z0EB 3AN1A 1JQ4A 4YT0B 1LFDA 2DYBA 4LDTB 1MFWA 1HXYD 3TSSA 2FUHB 5IN7A 2M1MA 4WURA 3IHPC 4K81A 3E9SA 3B2GA 4HVBA 3NRZA 3JW0X 4C80A 2RDHA 4I6PA 4L1BA 1SF0A 2LHDA 1V5TA 3VQIA 2WS3B 3EA6A 1P9DU 1SSNA 3BVMA 1SIFA 2FUG1 2K22A 5I4DA 4IW0A 1TZOA 4YTPB 2N7DA 5L83A 1N61A 1XF5L 1WMHA 1ZDVA 1ZUD2 3ZXVA 1HEZE 2JPHA 5E6PA 1WR1A 2BWFA 4TUUA 4HCPB 3VTWA 2DZIA 2OJWA 2RD0A 3Q3FA 2BPSA 4FHJA 5IAAC 2O6VA 4MM3A 2J0JA 3FC4A 3ML8A 3W5UB 2DBYA 3KWVA 4M0WB 2G1EA 2LVOA 3ZW3A 4F1SA 4HRSA 1WF9A 1WM3A 3KVFB 3AE9B 2JZPA 1ZOYB 2LASA 2CJOA 5BO4B 3ZYYX 1EO6A 4D2KA 2E6XA 4ICUA 2V0GA 1D5XC 1TY2A 3RNAC 1YD8U 1BUIC 4ZRPA 3SU8X 2KWDA 3U52E 1J7BA 4US8A 1NYRA 1PGBA 4DDGD 2MCNB 1KFYB 4F7ZA 1S1QB 1UBQA 3L4PA 2ZPNA 4NQKE 4WQOB 2K1FA 1Z5SB 2D5GA 4RGNA 2QCZA 2ZPYA 4N9F4 1T0RC 1AN8A 2JXTA 3TMPB 1SE9A 1GG3A 2V9HA 1QOFA 1KM7A 2WWZA 3ZJVA 3A1QA 3PV1A 1UGMA 2RDBC 4F8CB 4URKA 4RH6A 1JRUA 3W1YA 4WWPA 1QZEA 1ZPSA 1WWTA 4P1CC 2NCNA 2KLCA 1SE4A 1HZ5A 2AWTA 5C3JB 4IG7B 2WNMA 2NVUI 1UZXB 3DDCB 3PVLA 3JYUA 3UIPB 1NYQA 3RNGC 2KNBA 3N1ZC 4W9CA 1NI3A 1YNTE 3BYTB 1YJIA 2HDEA 4WQMA 1GAQB 4ANUA 2JX5A 5DCNA 4K7SA 3I9V1 1VJKA 4MT5A 3CIRB 2Q5WD 3CMMB 1OTRB 2JYEA 4C7YA 4MSMB 1XEEA 1WGYA 2JZ3B 3WANA 4YTNB 1F77A 3N32A 4OVUA 2NBVB 1WGHA 5TR5A 1OEYJ 1AW7A 2CJNA 2JYTA 2JRIB 1V5OA 2ZCBA 1Q10A 2NTSA 3AV8A 2GB1A 4ZDVA 2DHZA 1E0ZA 1D6EC 4Q2JA 4TMAB 5L95C 1A70A 2WXOA 3MFGA 2LXCA 1WGDA 2KC1A 3AE3B 3VFKA 1ISNA 1CQVA 4MGIE 2BQQA 5DPSA 1N6ZA 2WU5B 3ZTDA 2QEJC 5HG2A 1FMAD 4BBNF 4ITKA 5JH5C 2BB6A 4W9JA 4IWQA 2G3QB 1I7HA 4E74A 2K8CA 1YQ3B 2OOBB 4B0EA 3GB1A 4K3BA 1YMHE 3AEAB 2ZEQA 2LRUA 2KTRB 2H88B 4WWMA 1Q1OA 3AE7B 2XBBC 2XEWA 2L52A 1F1HA 3SEBA 1DOYA 2Y3AA 3TL5A 5AZGA 3VHTC 1OFFA 2J7QB 2DNFA 2R61A 2L00B 4P6VF 4TKNA 3SD5A 2ASQA 2KVZA 3W9CB 4LJPB 1K52A 2QIEB 1WX8A 2V3PA 2Y5CA 1FPYA 1F2RI 1F52A 2M17A 4GGQA 4IM0A 2WYQA 3TCAA 4OHJA 1I42A 4M00A 4NJ6A 2PE9A 2CKHB 1WYGA 4IWOA 1L6UA 4ZRIA 1C4PA 4A55A 2IJ0A 1XXGA 3RFZB 3ML9A 4B95A 3VR8B 1YN5A 1L2NA 4HKZE 1WR6E 2N7JA 4MJSA 2J0KA 4DHJD 2WXIA 1WGKA 1TT5B 5CHFA 1YX5B 4WJQA 2MBOA 3AEBB 3TEWA 1V1PA 2MEKA 3TEZA 2GBNA 2D3AA 4PYUA 1WSPA 2W55A 3N30A 3HM3A 1TS3A 4K3CA 2D11A 1L4ZB 1WX9A 2HD5B 1WXSA 3RNEC 1M4VA 1KLVA 4GXBA 3U4EG 1C4CA 2QSDA 2L3ZA 1N63A 3ZLZA 2ZNVC 1FM0D 3A4SC 1E8XA 3I57A 1VCBA 2QHOA 3R2IA 2KYWA 4B0MA 4W9EA 1L6VA 1N62A 2XNAC 1QLBB 2H89B 3ENEA 3DBRI 2M56B 2GI9A 4ZHOA 4DK5A 2BYEA 2EKEC 1QKZA 2J42A 1V9JA 1M94A 5H92C 3UINB 2MW5A 1WX7A 4DDID 4R3DA 1QOGA 2WHIA 3OLMD 2GLSA 4P1BC 4DXAB 3ECIA 5H8YE 5C2TB 5D2MB 3AULA 3SHQA 4NAMA 1C4AA 2MJEA 1GB4A 2G4SA 3H6NA 3C8YA 2FNJB 1F2RC 5C1ZA 4OVVA 3NVWA 5IOIA 3RUIB 2WDVB 3GE3C 3ZNHB 4FN2A 4ZRJA 1OQYA 1OQQA 1LGRA 2QC8A 5D6JB 4PT5A 3V6EB 5J2RA 4RGOS 2JWUA 3P4RB 1SXTA 2K8HA 3ZJUA 4BKSD 4GLSC 1E5WA 1HA5A 3P42A 4REZA 2M8SA 3PHWB 4AWJA 1R7SA 1VZ7A 1E9MA 4M02A 1J7CA 3VR9B 2FAZA 4UDUC 2DYOA 2O2VA 4EFOA 4KGRA 3Q3MC 3RULA 3W2DA 2NS5A 3SFDB 2ZNVB 2KHWB 4W9IA 1XQQA 4HPLB 2N9KA 4JWSC 2KDIA 4OVZA 2V1YA 1XT9B 2KO3A 1L5PA 4HPMB 4JGHB 2RMMA 4G50A 4KZ0A 3N20C 4NZLB 3U2SC 4W9LA 3N3KB 1SB3C 3EECA 1XO3A 3APFA 1WXAA 2WP9B 4MACA 1WXMA 3VVWB 4A3PA 3BWUD 3WA0A 5J18A 3U30A 4GDLB 3A9KB 1GPXA 4FADA 2JXXA 2QJLA 3WALA 2WXQA 3IAS1 4LCDE 1JWBD 3ZRFA 2KWCA 2DLBA 1PQSA 4W9FA 4KIKA 4C56C 3V6CB 1NENB 1V49A 3VH4B 3CSFA 2HJ1A 3AE4B 2WXRA 3ALBA 2PW9A 4W9KA 1ESFA 1BMLC 3KUDB 2PLPA 4L2YA 2YEPB 3DQVA 2KWUB 3KYDD 1JRPA 1BT0A 4BVUC 3BIID 1PGXA 3ETRA 5D3DA 2E3TA 2JSVX 5LXHA 1CZPA 1OGWA 2M4NA 2MWSB 4ZYSA 3WAPA 3M63B 2PKOA 1E8YA 3GS2A 3DBSA 4HEA1 5LNK1 1I4QA 3AEEB 1IP9A 4DXGA 3PGEA 2FBWB 3V61A 4LJOB 4MH8A 3BY4B 3AE2B 2PIAA 1I4HA 2G4DB 1TS5A 3AU4A 2YEPF 1RYJA 4YTMB 4XWTA 3T3NA 1J0GA 1EM7A 3SFEB 3H1UA 3IT6B 2PTLA 3X0WA 3DBRB 4LNKA 3W1SA 2K9XA 2WDTB 2WX0A 4C4VA 2IO0B 5AUIA 3T9LA 2WXJA 3AEFB 4II2B 3R7RA 2OJRA 1FO4A 4IC7B 4CQNA 1PDXA 1FCCC 4W9DA 3OJ3A 2KD0A 3AH7A 4M8MA 2AL3A 2KACA 2X38A 2WX1A 3Q6BA 1TKYA 3L17A 1IBXA 4FA6A 3NZSA 1ACCA 4MH0E 1JCKB 3BINA 3JSVB 1CMXB 1ZKHA 4H2AA 2IGGA 2V3SA 4ZRQA 1V86A 1FNUA 2L32A 4YSYB 5CX3A 2L05A 2K6QA 3VXWA 1E90A 3ZNGC 2PMVA 1A5RA 1P7EA 4E3CA 2JF5A 2ZVOA 4K7WA 4BKGA 4BBNC 4TV3A 4DHJB 2WXHA 3QQ8B 2NTTA 3B2FA 3BYYB 2JQRB 3IVFA 1QF6A 1FRDA 3DPDA 1E8WA 1SGHA 1AYFA 3VDZA 3V62A 2ICIA 5BYRA 2FIFA 2HE7A 3PZDA 1WJ4A 2A4ZA 1F0ZA 1FRRA 1RFKA 2IGDA 1FNVA 2UWQA 1EWCA 4S17A 4B9KA 1P7FA 3NZUA 2XN9C 2KMAA 4M0WA 3QIJA 3ZO5B 4J6IA 2QMTA 3OWEB 1FIQA 2B76B 3GOEA 1TJEA 1GC6A 4ANWA 1K8RB 1S3SG 2IBIB 2MP2B 2JT4B 3MC9A 3NVYA 4MGZE 3N1XC 3IG3A 4II3B 4P7IA 1TBEA 1JALA 3APCA 3P63A 4C7ZA 2DZKA 3ZNZB 1U4AA 5JHAA 2FCMA 2Z0DB 1YN4A 1PFDA 5E6NA 4IM2A 1IUEA 3HK0A 1UUPA 3H7PB 2VH1A 1DGJA 2GRIA 1IGCA 3Q2AC 1UGJA 1X1MA 1V81A 1T5XD 2OHFA 3AE6B 1WRIA 2REXA 3NUHB 2KMMA 1SIJA 4KKJA 1KJTA 2JRHA 2I1KA 4AJWA 3RNFC 4ASWC 1UELA 1PGAA 1ZXHA 2EMSA 1JWSD 2BS3B 4BAXA 2C7MB 3Q14C 4EZJA 2GMIC 3RNCC 3V60A 3AI5A 2WXNA 1QOBA 3DHHC 5DPRA 2VRRB 2YVCA 3LB8C 3ZJTA 1LM8B 2I1JA 2PJHA 4ANVA 4RGTA 3H9DA 1WJNA 1L7YA 1RAXA 2BS2B 2KC2A 4HROA 4AUQC 1VDVA 3I63C 1ZDXA 3A9JB 2X8XX 4IWPA 2MBHA 1Z2MA 1EU4A 4AP4C 4JWUC 4MGKE 2MSED 4FULA 3UQBA 2YLMA 2LVQA 3X23A 3EGRA 3RPFC 5G5HA 1L4DB 3GZNI 2GBMA 4RNAA 2L0TA 1MI0A 3TUOA 1L0XB 3ZUNA 2O6VD 1G6JA 2BF8B 2WXGA 3PO0A 3UIOB 3KUZA 4NPNA 3B0AA 2KFJA 4K1RB 3VUYA 3PRZA 1RRBA 2KAJA 1NDDA 1Q0WB 1IGDA 2ZW1A 4JX1C 3MC8A 5JZEB 3ABVB 1V8CA 1ZGUB 2DX5B 1TS4A 2LVPA 1Q5WB 5EE9A 1KLUD 4ARIA 2BTEA 1SE2A 1WY8A 2NBWB 3Q8AA 4GDKB 1GB1A 1E7PB 2IY1B 5G55A 2KTRA 3RI7C 3L54A 3B1LX 1WGGA 2MJDA 2JWZA 4PS7A 3VTUA 3IXSA 3PRPB 1WH3A 3HRDD 1HQRD 4NJ7A 4NAWB 4KGTA 1E7VA 3D32A 1HE8A 2JVCA 1JMLA 2KFKB 2G9HD 1FXIA 3R2TA 1YJ1A 2RDGA 3FILB 3L08A 2VZKD 2N9XA 3R66C 3Q3NC 4E71A 1C79A 4CYEA 4NNJB 5D3IB 4A20A 2ZVNA 3S2AA 4WH4A 1FXTB 2Y5BB 2LRWA 2AL6A 2DZMA 2LGDA 1JWUD 5AZHA 4A6QA 4GSWA 4W9GA 4LNNA 1TY0A 3L13A 3PZ8A 4XC2A 4EUTA 3RD2A 1DOXA 1V97A 4HK2A 3MJWA 4HXDA 3WAOA 3Q8CA 2L76A 4KSKC 4KX6B 3ZRCA 1KLGD 4A9AA 2NPTB 2WDQB 2PE6B 3HVZA 2JZZA 2BBCA 1LQBA 4JL9A 3MTNB 3Q8BA 2M0AA 4N6EB 1TS2A 3IBEA 3AM9A 1WGRA 4BKTA 3NS8A 4GU2A 1H4RA 2IGHA 4OZAA 2KN5A 1YJJA 2LXAA 4A90A 2LJ5A 3P1MA 2LHEA 4FJYA 3A33B 1WXVA 3KLSX 3HIZA 3DWGC 1GC7A 4LK0M 1IPGA 1GNUA 3NOBA 2LWPA 5CHVC 1XLNA 1K53A 2MBEA 3P4SB 5T8IA 1YQ4B 1EF1A 5EE0A 3T8MA 2K25A 4HDOA 1E7UA 4WJOA 3FKYA 4KGSA 4XE0A 2C5LC 2NMQA 2KX3A 3VUXA 1TKEA 1F9JA 5GXGB 2D3BA 4K7UA 4QAYA 1KOTA 3QJZA 1SBBB 2W82A 1QT9A 3NS1A 3UF8A 2J52A 4WWNA 3P4QB 3QHTA 3U8ZA 2ON8A 3MC0B 4RM8A 1C78A 2IO1B 1UH6A 4RF1A 2BS4B 3HVDA 3SR6A 4KKIA 1KH0A 1XD3B 4AS1A 3EC8A 2WGSA 3ZQ4A 1OQRA 3GZNB 5HKHA 5EE3A 1JROA 1J8CA 1MPEA 5BMIA 4A3OA 3OJ4B 2XK5B 3UGBB 3MP9A 1UD7A 3OG5A 2BKRB 4KV2A 2KVRA 2W3SA 1YN3A 2BYVE 3P4PB 4MELA 3ZVVA 4KVGB 3KYCD 3SDLC 1RFAA 2A5UA 5IKCM 4ARCA 5IO9A 1RWSA 3ZIMA 3AE8B 3I3TB 2N0SB 4RMAA 2BB5A 2N9LA 3LXFA 3N9YC 4USAA 2RSUA 3AECB 1KF6B 3AMZA 1TGZB 4HJKA 1MHHE 2NR2A 4G0NB 2Z8LA 1I4PA 3QK0A 3DVNV 1TYGB 2FE8A 1DOIA 5DPWA 3DBHI 4GDLA 3A9KA 4L23A 2FCSA 3LJ3A 1WJUA 2DZJA 4FXCA 2KN4A 2MLBA 4EKUA 4PS8A 4KSLC 2FCNA 3FAHA 2J0MA 3J9CA 3NG0A 1VR9A 5FR3A 2LD9A 1WI0A 5BYSA 4CHKA 3KH0A 2JU6X 5D7GA 4X57B 2KLGA 1VLBA 1D5MC 2DAFA 4DXFA 3K9PB 2ACZB 2RPQA 3KQ4A 3WIMA 1TZ1A 2KANA 3LDZE 4IUMB 4WWOA 2IY0B 1N5XA 2EKIA 4ZHPA 2LJIA 3JVZX 3QC8B 1NBFC 4MDKE 2INCC 1WMHB 1V6EA 2D10A 2WDRB 2MA9B 3PLUA 4OZBA 1P3QU 3NHEB 1ET6A 1GOZA 3VAWA 4OW0A 2SEBD 1KTKA 1T3QA 3H8HA 1PUTA 2IZVB 2ONQA 1FNWA 4S0RA 3M62B 2IDYA 1K51A 3VRAB 2O6VB 4MM3B 3KUCB 1ZW7A 2AEHA 3LYYA 4PK1A 2PVOD 2AQ2B 3KWLA 5HFYA 1D5ZC 2GBKA 3WAMA 2EMTA 3V3XA 1T6BX 1T0SC 1VD2A 1AARA 1P98A 2KKCA 3UI3A 1V1OA 5BMHA 4GN1A 1OEYA 4XX5A 2LGYA 3TEYA 1WIAA 3IT4B 1EU3A 1ROEA 3ZDMC 1FXAA 1FCLA 2KDFB 4JIOU 2ZZPB 2W3RA 1WRDB 4ICVA 4AOFA 5KHQA 5JXVA 2V4IB 1MVKA 1E6EB 3PLVA 1ZP0B 2KMCA 3B08A 2K5PA 4TQ0A 3DWMA 4FJZA 2MJ3A 1RM6C 4PYZA 1Y56A 1L0VB 2VZKB 1C9FA 2WQYB 5GMVA 2W54A 3JSVA 2RGFA 1JW9D 3GP7A 3P2BA 3M95A 1STEA 3A1QB 1QOAA 1UWXA 1ZXIA 1WZ3A 1GJZA 5LLIA 2KT7A 5IP4D 4TSSA 4P16A 2I38A 2K8BA 2TSSA 1XCTL 4A8XC 3QWZB 5D94A 4WAAA 2LZ6A 4XYCA 2MQJA 3B9JA 3APDA 2AQ1B 2C9WB 4ANXA 4M01A 3ZTCA 1C3TA 1C77A 3H7SA 1XLPA 5CHWA 2MBBB 3AB5A 3DBLI 1YOVB 4DHZE 5FKAC 1UF0A 4EZLA 1C76A 2BT6A 3RYTA 1T0QC 2CS4A 3TJPA 2R2OA 2KZRA 1D4BA 3R3MA 4WJNA 4DBGA 3ONSA 1J7AA 2KJHB 1IYFA 3DCGA 5J17A 5BMGA 1B9RA 5TSSA 2INNE 1XCQL 2EELA 3AU5A 3T3OA 2MX2A 1B1ZA 2GOWA 3EUB2 1HTOA 4HDQA 5IA7A 3PRMB 4JE3B 3I5JC 1BXTA
chains in the Genus database with same CATH topology
2V1YA 3PPAA 1XT9B 3JW0X 4I6PA 2KO3A 4NJ7A 4NAWB 1V5TA 3VQIA 1E7VA 4HPMB 1TTNA 3D32A 4JGHB 4JLCA 1HE8A 4G50A 1P9DU 2JVCA 2KFKB 2MP2A 4KZ0A 4CO7A 2R2QA 3N3KB 4W9LA 1SIFA 3EECA 1YJ1A 1YQBA 3L08A 3APFA 4IW0A 1WXAA 4BFRA 1R4NI 2N7DA 2N9XA 3R66C 2HJ8A 5L83A 4E71A 1WXMA 3VVWB 4CYEA 1WMHA 4NNJB 4A20A 2JPHA 2ZVNA 1EUVB 5E6PA 3S2AA 1WR1A 2BWFA 4A3PA 4TUUA 3WA0A 1FXTB 2Y5BB 4HCPB 2LRWA 2AL6A 2DZMA 3U30A 3VTWA 4GDLB 2CHXA 2LGDA 3A9KB 2DZIA 2DYMA 4FADA 2JXXA 3WALA 3CSTA 5AZHA 4LCDE 4GSWA 2RD0A 4W9GA 1D3ZA 3H7PA 3L13A 4EUTA 4XC2A 3ZRFA 3Q3FA 3RD2A 2BPSA 4FHJA 2KWCA 4HK2A 4TQ1A 5IAAC 2O6VA 3KW5B 4MM3A 1PQSA 2J0JA 3ML8A 1WFYA 3MJWA 4HXDA 3WAOA 4M0WB 2LVOA 4MGYE 4W9HA 4W9FA 3ZW3A 2L76A 1WF9A 4KIKA 4F1SA 1WM3A 3KVFB 4KSKC 2L7RA 3V6CB 3ZRCA 2L8JA 1V49A 2NPTB 3VH4B 2LASA 3CSFA 5BO4B 2PE6B 2JZZA 3ALBA 3PSEB 4W9KA 4XZ4A 1LXDA 1LQBA 3KUDB 4BKSA 4JL9A 3DQVA 3MTNB 2KWUB 3DVNU 3KYDD 1EO6A 2IO2B 1BT0A 2KDBA 2KJRA 4BVUC 4EOYA 4ICUA 2KX0A 4DWFA 4GIVA 3IBEA 1YD8U 2RR9A 3SU8X 5LXHA 1R4MI 1WGRA 4BKTA 3NS8A 1OGWA 2M4NA 4GU2A 1H4RA 3HHMA 2MWSB 2KN5A 4DDGD 2MCNB 4F7ZA 1S1QB 2LXAA 3WAPA 2LJ5A 4LDTD 3M63B 1UBQA 3QARA 4FJYA 3A33B 1E8YA 2D3GA 2ZPNA 4NQKE 4WQOB 1WXVA 3HIZA 2KWVB 2K1FA 1GC7A 1IPGA 3DBSA 1Z5SB 2L0FA 1GNUA 2LWPA 3EHVA 3NOBA 5CHVC 4EEWA 2ZPYA 2MBEA 4N9F4 2C7NB 5CTRC 5FR6A 1EF1A 4ZYNA 4JQWC 1IP9A 3A9JA 3T8MA 2K25A 4HDOA 3PGEA 4MJSB 1E7UA 1SE9A 4WJOA 3TMPB 3V61A 4GB9A 4LJOB 1GG3A 2C5LC 2KQSA 2N1WA 1KM7A 2WWZA 3BY4B 2KX3A 3VUXA 5AZFA 1F9JA 3A1QA 3PV1A 4K7UA 1KOTA 1UGMA 2G4DB 4B6WA 3QJZA 3AU4A 1J0GA 1WYWB 4F8CB 4URKA 1JRUA 3W1YA 3H1UA 3UF8A 5JHBA 4WWNA 3X0WA 4WWPA 1QZEA 3W1SA 2WDTB 3EFUA 2WX0A 4AJYB 2IO0B 3QHTA 2NCNA 2V4LA 2KLCA 3Q3JA 1J19A 3U8ZA 2AWTA 3PREA 4IG7B 4RM8A 3T9LA 2G45B 3RZWC 2NVUI 1UZXB 3DDCB 3PVLA 3JYUA 2IO1B 4II2B 3UIPB 3R7RA 3R7QA 2KNBA 3A4RA 4W9CA 2KTFA 1UH6A 3ZNID 2OJRA 3NY5A 4IC7B 3RZFA 1XD3B 2BYFA 3EC8A 2ZCCA 4W9DA 4I6LB 4MSQB 3OJ3A 2KD0A 4M8MA 5KHOA 2AL3A 4ANUA 4I6NB 2K39A 2WX1A 5HKHA 3L17A 4FLHA 5DCNA 4FA6A 3NZSA 3TBLD 1J8CA 4K7SA 4MH0E 3BINA 3JSVB 4A3OA 3OJ4B 2XK5B 1CMXB 1ZKHA 4GMVA 2MRPA 3UGBB 1UD7A 3CMMB 3DVGX 1OTRB 2V3SA 2BKRB 4MSMB 1V86A 1WGYA 2JZ3B 3IFWB 4KV2A 5CX3A 2L05A 3RT3B 3WANA 2KVRA 3N32A 4OVUA 2K6QA 3VXWA 2BYVE 1E90A 2NBVB 4GDKA 4MELA 4NQLB 3ZNGC 3ZVVA 5J18A 1WGHA 2D2QA 4KVGB 5TR5A 4KDLB 1A5RA 3RCZA 1OEYJ 2KXJA 3KYCD 3SDLC 2DENB 2JRIB 1RFAA 1V5OA 4E3CA 2JF5A 2A5UA 2ZCBA 2ZVOA 1C1YB 2M0XA 4K7WA 3ZIMA 4BKGA 4BBNC 2NBUA 4NAWA 3I3TB 4EZKA 4HLEA 4TV3A 3UQAA 4ZDVA 2DHZA 2CHZA 4DHJB 4RMAA 5L95C 2KFKA 4ZRKA 4FJVB 3QQ8B 1NI2A 2RSUA 2LXCA 1WGDA 2KC1A 1TGZB 4HJKA 3VFKA 1ISNA 2NR2A 4G0NB 4MGIE 5DPSA 3ZTDA 3IVFA 2IYDB 3DPDA 4BBNF 1E8WA 3QK0A 5JH5C 1SGHA 3DVNV 3ZKJC 2LUEA 5DPWA 3DBHI 4GDLA 3A9KA 4IWQA 2G3QB 4W9JA 3VDZA 3V62A 2FCSA 4E74A 3LJ3A 1WJUA 2K8CA 2OOBB 2FIFA 2HE7A 2DZJA 1WJ4A 2A4ZA 3PZDA 3QCAA 2O2VB 2UWQA 2KK8A 2N9EB 2MLBA 4EKUA 2W9NA 2ZEQA 4B9KA 4HCNB 2LRUA 2KTRB 3NZUA 4KSLC 2FCNA 4PS8A 1Q1OA 2J0MA 3HM6X 2KMAA 4G3XB 1WE6A 3QIJA 2XBBC 2XEWA 2N7EA 2LD9A 3ZO5B 1WI0A 4DHZB 4CHKA 3KH0A 5D7GA 2D07B 4J6IA 4X57B 2KLGA 3ZNZB 3L10B 2NPTA 3TL5A 2DAFA 1UBIA 2BWES 5AZGA 3VHTC 2J7QB 3GOEA 3K9PB 2CR5A 3U7DA 5AEKB 2L00B 2RPQA 2BKFA 4IM3A 1GC6A 4NY0A 3WIMA 4ANWA 1TZ1A 1K8RB 1V2YA 2KANA 4TKNA 1S3SG 2IBIB 2MP2B 2N1VA 3C0RB 3LDZE 4MEMA 4IUMB 3SD5A 4WWOA 2IY0B 2JT4B 2N4FA 2C60A 1RLFA 2ASQA 3JVZX 1P0RA 4MGZE 4LJPB 1P1AA 3IG3A 1WX8A 4II3B 4P7IA 1TBEA 3QC8B 3TIXA 1NBFC 1Y8RC 3APCA 2M17A 4MDKE 1WMHB 1V6EA 2DZKA 3AXCA 2D10A 3O65B 4GGQA 4KDIC 1U4AA 4IM0A 2MA9B 2WYQA 3PLUA 3VTVA 2FCMA 2Z0DB 3TCAA 2LI5A 5JHAA 1P3QU 3W1SC 4FHKA 1EF5A 4IM2A 5E6NA 1I42A 3HK0A 3NHEB 4NJ6A 2PE9A 3L0WB 5C23A 3VAWA 2CKHB 2Z59B 3M3JA 2IZVB 2FCQA 4IWOA 3M62B 3H7PB 3CF6E 2JY6A 4ZRIA 2O6VB 2DAJA 3KUCB 1ZW7A 2BGFA 2AEHA 2B3AA 3PS6A 3ML9A 4B95A 4KIKB 1X1MA 3MHSD 2GBKA 3WAMA 2EMTA 2PEAA 1V81A 1L2NA 3VUWA 1VD2A 1AARA 1WR6E 2KQ7A 1P98A 2KKCA 2REXA 2J0KA 4KZCA 4MJSA 4PS3A 4DHJD 5CHFA 1YX5B 4GN1A 1KJTA 1OEYA 2JRHA 2MBOA 2ZJDA 2LGYA 4WJQA 1WZ0A 4XX5A 2I1KA 4AJWA 4FBJB 1WIAA 4ASWC 5LXIB 2GBNA 1UELA 3L16A 4PYUA 3PHXB 3N30A 3HM3A 3ZDMC 2EMSA 2KDEB 1YIWA 2D11A 4G11A 1WE7A 1WX9A 2N9PC 3QA8A 2HD5B 2C7MB 4YL8A 1V80A 1WXSA 1E8ZA 2GMIC 4GXBA 2KDFB 4EZJA 1KLVA 2PPHA 4JIOU 2ZZPB 4BOSC 3V60A 3AI5A 1WRDB 2L3ZA 3ZLZA 4ICVA 2C7HA 4AOFA 2GBRA 5KHQA 2ZNVC 5DPRA 4BOZB 1H8CA 4GOCA 2VRRB 1WJ6A 2CU1A 2HTHA 3A4SC 2YVCA 1E8XA 1LM8B 3PT2B 2CHWA 3DVGY 3PTFC 5G2NA 3PLVA 2I1JA 2PJHA 1VCBA 2KOXA 1T0YA 2QHOA 2KMCA 3DOWA 3B08A 4ANVA 5EDSA 3H9DA 4W9EA 2UYZB 1WJNA 4TQ0A 4M8NA 3ENEA 1L7YA 2KJ6A 3DBRI 4FJZA 1RAXA 1MG8A 2KC2A 4DK5A 5E6OA 4AUQC 2BYEA 4WJPA 2EKEC 2JUOA 3UINB 1V9JA 1M94A 1I35A 2GBJA 3A9JB 4PYZA 2MBQA 2MW5A 4IWPA 5GMVA 2MBHA 1WX7A 3JSVA 2RGFA 1Z2MA 2IO3B 4AP4C 2XK5A 3P2BA 4DDID 3M95A 2K6DB 3A1QB 4MGKE 2MSED 4FULA 1WZ3A 1GJZA 5LLIA 3UQBA 3OLMD 3QX1A 3VH3B 4DXAB 2YLMA 3ECIA 1GUAB 2LVQA 3X23A 2K8BA 3OAWA 5D2MB 3AULA 3SHQA 3QWZB 5D94A 2FIDA 3GZNI 4WAAA 2GBMA 2LZ6A 2L0TA 2MQJA 3APDA 2G4SA 2C9WB 4ANXA 3K9OB 2AYOB 3ZTCA 3H6NA 2LGXA 3ZUNA 2FNJB 1YX6B 1C3TA 4RM9A 5C1ZA 3H7SA 4OVVA 5CHWA 2MBBB 2O6VD 3ZDTA 1G6JA 2BF8B 3DBLI 3RUIB 3UIOB 3KUZA 4NPNA 3B0AA 2KFJA 4K1RB 3VUYA 3ZNHB 4DHZE 3PRZA 4FN2A 4EZLA 4ZRJA 1OQYA 1RRBA 1NDDA 1Q0WB 3RYTA 2CS4A 3TJPA 2R2OA 2KZRA 5D6JB 3V6EB 5JZEB 5J2RA 5DPTA 3R3MA 4HWIB 4WJNA 4DBGA 2K8HA 3ONSA 4BKSD 1E5WA 2KJHB 1ZGUB 1IYFA 3DCGA 2DX5B 3QAQA 5J17A 2M8SA 3PHWB 4AWJA 2LVPA 1WM2A 1Q5WB 2Z0EB 1LFDA 2FAZA 1WY8A 2NBWB 3AU5A 2DYOA 2MX2A 2DYBA 2O2VA 2GOWA 4GDKB 4LDTB 4EFOA 2IY1B 5G55A 2KTRA 2FUHB 3L54A 3RULA 2M1MA 3B1LX 3IHPC 4HDQA 2NS5A 4K81A 5IA7A 2ZNVB 2KHWB 1WGGA 3PRMB 1XQQA 2JWZA 4HPLB 4PS7A 4W9IA 4HVBA 3VTUA 3PRPB 1WH3A 2KDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Y A;  3PPA A;  1XT9 B;  3JW0 X;  4I6P A;  2KO3 A;  4NJ7 A;  4NAW B;  1V5T A;  3VQI A;  1E7V A;  4HPM B;  1TTN A;  3D32 A;  4JGH B;  4JLC A;  1HE8 A;  4G50 A;  1P9D U;  2JVC A;  2KFK B;  2MP2 A;  4KZ0 A;  4CO7 A;  2R2Q A;  3N3K B;  4W9L A;  1SIF A;  3EEC A;  1YJ1 A;  1YQB A;  3L08 A;  3APF A;  4IW0 A;  1WXA A;  4BFR A;  1R4N I;  2N7D A;  2N9X A;  3R66 C;  2HJ8 A;  5L83 A;  4E71 A;  1WXM A;  3VVW B;  4CYE A;  1WMH A;  4NNJ B;  4A20 A;  2JPH A;  2ZVN A;  1EUV B;  5E6P A;  3S2A A;  1WR1 A;  2BWF A;  4A3P A;  4TUU A;  3WA0 A;  1FXT B;  2Y5B B;  4HCP B;  2LRW A;  2AL6 A;  2DZM A;  3U30 A;  3VTW A;  4GDL B;  2CHX A;  2LGD A;  3A9K B;  2DZI A;  2DYM A;  4FAD A;  2JXX A;  3WAL A;  3CST A;  5AZH A;  4LCD E;  4GSW A;  2RD0 A;  4W9G A;  1D3Z A;  3H7P A;  3L13 A;  4EUT A;  4XC2 A;  3ZRF A;  3Q3F A;  3RD2 A;  2BPS A;  4FHJ A;  2KWC A;  4HK2 A;  4TQ1 A;  5IAA C;  2O6V A;  3KW5 B;  4MM3 A;  1PQS A;  2J0J A;  3ML8 A;  1WFY A;  3MJW A;  4HXD A;  3WAO A;  4M0W B;  2LVO A;  4MGY E;  4W9H A;  4W9F A;  3ZW3 A;  2L76 A;  1WF9 A;  4KIK A;  4F1S A;  1WM3 A;  3KVF B;  4KSK C;  2L7R A;  3V6C B;  3ZRC A;  2L8J A;  1V49 A;  2NPT B;  3VH4 B;  2LAS A;  3CSF A;  5BO4 B;  2PE6 B;  2JZZ A;  3ALB A;  3PSE B;  4W9K A;  4XZ4 A;  1LXD A;  1LQB A;  3KUD B;  4BKS A;  4JL9 A;  3DQV A;  3MTN B;  2KWU B;  3DVN U;  3KYD D;  1EO6 A;  2IO2 B;  1BT0 A;  2KDB A;  2KJR A;  4BVU C;  4EOY A;  4ICU A;  2KX0 A;  4DWF A;  4GIV A;  3IBE A;  1YD8 U;  2RR9 A;  3SU8 X;  5LXH A;  1R4M I;  1WGR A;  4BKT A;  3NS8 A;  1OGW A;  2M4N A;  4GU2 A;  1H4R A;  3HHM A;  2MWS B;  2KN5 A;  4DDG D;  2MCN B;  4F7Z A;  1S1Q B;  2LXA A;  3WAP A;  2LJ5 A;  4LDT D;  3M63 B;  1UBQ A;  3QAR A;  4FJY A;  3A33 B;  1E8Y A;  2D3G A;  2ZPN A;  4NQK E;  4WQO B;  1WXV A;  3HIZ A;  2KWV B;  2K1F A;  1GC7 A;  1IPG A;  3DBS A;  1Z5S B;  2L0F A;  1GNU A;  2LWP A;  3EHV A;  3NOB A;  5CHV C;  4EEW A;  2ZPY A;  2MBE A;  4N9F 4;  2C7N B;  5CTR C;  5FR6 A;  1EF1 A;  4ZYN A;  4JQW C;  1IP9 A;  3A9J A;  3T8M A;  2K25 A;  4HDO A;  3PGE A;  4MJS B;  1E7U A;  1SE9 A;  4WJO A;  3TMP B;  3V61 A;  4GB9 A;  4LJO B;  1GG3 A;  2C5L C;  2KQS A;  2N1W A;  1KM7 A;  2WWZ A;  3BY4 B;  2KX3 A;  3VUX A;  5AZF A;  1F9J A;  3A1Q A;  3PV1 A;  4K7U A;  1KOT A;  1UGM A;  2G4D B;  4B6W A;  3QJZ A;  3AU4 A;  1J0G A;  1WYW B;  4F8C B;  4URK A;  1JRU A;  3W1Y A;  3H1U A;  3UF8 A;  5JHB A;  4WWN A;  3X0W A;  4WWP A;  1QZE A;  3W1S A;  2WDT B;  3EFU A;  2WX0 A;  4AJY B;  2IO0 B;  3QHT A;  2NCN A;  2V4L A;  2KLC A;  3Q3J A;  1J19 A;  3U8Z A;  2AWT A;  3PRE A;  4IG7 B;  4RM8 A;  3T9L A;  2G45 B;  3RZW C;  2NVU I;  1UZX B;  3DDC B;  3PVL A;  3JYU A;  2IO1 B;  4II2 B;  3UIP B;  3R7R A;  3R7Q A;  2KNB A;  3A4R A;  4W9C A;  2KTF A;  1UH6 A;  3ZNI D;  2OJR A;  3NY5 A;  4IC7 B;  3RZF A;  1XD3 B;  2BYF A;  3EC8 A;  2ZCC A;  4W9D A;  4I6L B;  4MSQ B;  3OJ3 A;  2KD0 A;  4M8M A;  5KHO A;  2AL3 A;  4ANU A;  4I6N B;  2K39 A;  2WX1 A;  5HKH A;  3L17 A;  4FLH A;  5DCN A;  4FA6 A;  3NZS A;  3TBL D;  1J8C A;  4K7S A;  4MH0 E;  3BIN A;  3JSV B;  4A3O A;  3OJ4 B;  2XK5 B;  1CMX B;  1ZKH A;  4GMV A;  2MRP A;  3UGB B;  1UD7 A;  3CMM B;  3DVG X;  1OTR B;  2V3S A;  2BKR B;  4MSM B;  1V86 A;  1WGY A;  2JZ3 B;  3IFW B;  4KV2 A;  5CX3 A;  2L05 A;  3RT3 B;  3WAN A;  2KVR A;  3N32 A;  4OVU A;  2K6Q A;  3VXW A;  2BYV E;  1E90 A;  2NBV B;  4GDK A;  4MEL A;  4NQL B;  3ZNG C;  3ZVV A;  5J18 A;  1WGH A;  2D2Q A;  4KVG B;  5TR5 A;  4KDL B;  1A5R A;  3RCZ A;  1OEY J;  2KXJ A;  3KYC D;  3SDL C;  2DEN B;  2JRI B;  1RFA A;  1V5O A;  4E3C A;  2JF5 A;  2A5U A;  2ZCB A;  2ZVO A;  1C1Y B;  2M0X A;  4K7W A;  3ZIM A;  4BKG A;  4BBN C;  2NBU A;  4NAW A;  3I3T B;  4EZK A;  4HLE A;  4TV3 A;  3UQA A;  4ZDV A;  2DHZ A;  2CHZ A;  4DHJ B;  4RMA A;  5L95 C;  2KFK A;  4ZRK A;  4FJV B;  3QQ8 B;  1NI2 A;  2RSU A;  2LXC A;  1WGD A;  2KC1 A;  1TGZ B;  4HJK A;  3VFK A;  1ISN A;  2NR2 A;  4G0N B;  4MGI E;  5DPS A;  3ZTD A;  3IVF A;  2IYD B;  3DPD A;  4BBN F;  1E8W A;  3QK0 A;  5JH5 C;  1SGH A;  3DVN V;  3ZKJ C;  2LUE A;  5DPW A;  3DBH I;  4GDL A;  3A9K A;  4IWQ A;  2G3Q B;  4W9J A;  3VDZ A;  3V62 A;  2FCS A;  4E74 A;  3LJ3 A;  1WJU A;  2K8C A;  2OOB B;  2FIF A;  2HE7 A;  2DZJ A;  1WJ4 A;  2A4Z A;  3PZD A;  3QCA A;  2O2V B;  2UWQ A;  2KK8 A;  2N9E B;  2MLB A;  4EKU A;  2W9N A;  2ZEQ A;  4B9K A;  4HCN B;  2LRU A;  2KTR B;  3NZU A;  4KSL C;  2FCN A;  4PS8 A;  1Q1O A;  2J0M A;  3HM6 X;  2KMA A;  4G3X B;  1WE6 A;  3QIJ A;  2XBB C;  2XEW A;  2N7E A;  2LD9 A;  3ZO5 B;  1WI0 A;  4DHZ B;  4CHK A;  3KH0 A;  5D7G A;  2D07 B;  4J6I A;  4X57 B;  2KLG A;  3ZNZ B;  3L10 B;  2NPT A;  3TL5 A;  2DAF A;  1UBI A;  2BWE S;  5AZG A;  3VHT C;  2J7Q B;  3GOE A;  3K9P B;  2CR5 A;  3U7D A;  5AEK B;  2L00 B;  2RPQ A;  2BKF A;  4IM3 A;  1GC6 A;  4NY0 A;  3WIM A;  4ANW A;  1TZ1 A;  1K8R B;  1V2Y A;  2KAN A;  4TKN A;  1S3S G;  2IBI B;  2MP2 B;  2N1V A;  3C0R B;  3LDZ E;  4MEM A;  4IUM B;  3SD5 A;  4WWO A;  2IY0 B;  2JT4 B;  2N4F A;  2C60 A;  1RLF A;  2ASQ A;  3JVZ X;  1P0R A;  4MGZ E;  4LJP B;  1P1A A;  3IG3 A;  1WX8 A;  4II3 B;  4P7I A;  1TBE A;  3QC8 B;  3TIX A;  1NBF C;  1Y8R C;  3APC A;  2M17 A;  4MDK E;  1WMH B;  1V6E A;  2DZK A;  3AXC A;  2D10 A;  3O65 B;  4GGQ A;  4KDI C;  1U4A A;  4IM0 A;  2MA9 B;  2WYQ A;  3PLU A;  3VTV A;  2FCM A;  2Z0D B;  3TCA A;  2LI5 A;  5JHA A;  1P3Q U;  3W1S C;  4FHK A;  1EF5 A;  4IM2 A;  5E6N A;  1I42 A;  3HK0 A;  3NHE B;  4NJ6 A;  2PE9 A;  3L0W B;  5C23 A;  3VAW A;  2CKH B;  2Z59 B;  3M3J A;  2IZV B;  2FCQ A;  4IWO A;  3M62 B;  3H7P B;  3CF6 E;  2JY6 A;  4ZRI A;  2O6V B;  2DAJ A;  3KUC B;  1ZW7 A;  2BGF A;  2AEH A;  2B3A A;  3PS6 A;  3ML9 A;  4B95 A;  4KIK B;  1X1M A;  3MHS D;  2GBK A;  3WAM A;  2EMT A;  2PEA A;  1V81 A;  1L2N A;  3VUW A;  1VD2 A;  1AAR A;  1WR6 E;  2KQ7 A;  1P98 A;  2KKC A;  2REX A;  2J0K A;  4KZC A;  4MJS A;  4PS3 A;  4DHJ D;  5CHF A;  1YX5 B;  4GN1 A;  1KJT A;  1OEY A;  2JRH A;  2MBO A;  2ZJD A;  2LGY A;  4WJQ A;  1WZ0 A;  4XX5 A;  2I1K A;  4AJW A;  4FBJ B;  1WIA A;  4ASW C;  5LXI B;  2GBN A;  1UEL A;  3L16 A;  4PYU A;  3PHX B;  3N30 A;  3HM3 A;  3ZDM C;  2EMS A;  2KDE B;  1YIW A;  2D11 A;  4G11 A;  1WE7 A;  1WX9 A;  2N9P C;  3QA8 A;  2HD5 B;  2C7M B;  4YL8 A;  1V80 A;  1WXS A;  1E8Z A;  2GMI C;  4GXB A;  2KDF B;  4EZJ A;  1KLV A;  2PPH A;  4JIO U;  2ZZP B;  4BOS C;  3V60 A;  3AI5 A;  1WRD B;  2L3Z A;  3ZLZ A;  4ICV A;  2C7H A;  4AOF A;  2GBR A;  5KHQ A;  2ZNV C;  5DPR A;  4BOZ B;  1H8C A;  4GOC A;  2VRR B;  1WJ6 A;  2CU1 A;  2HTH A;  3A4S C;  2YVC A;  1E8X A;  1LM8 B;  3PT2 B;  2CHW A;  3DVG Y;  3PTF C;  5G2N A;  3PLV A;  2I1J A;  2PJH A;  1VCB A;  2KOX A;  1T0Y A;  2QHO A;  2KMC A;  3DOW A;  3B08 A;  4ANV A;  5EDS A;  3H9D A;  4W9E A;  2UYZ B;  1WJN A;  4TQ0 A;  4M8N A;  3ENE A;  1L7Y A;  2KJ6 A;  3DBR I;  4FJZ A;  1RAX A;  1MG8 A;  2KC2 A;  4DK5 A;  5E6O A;  4AUQ C;  2BYE A;  4WJP A;  2EKE C;  2JUO A;  3UIN B;  1V9J A;  1M94 A;  1I35 A;  2GBJ A;  3A9J B;  4PYZ A;  2MBQ A;  2MW5 A;  4IWP A;  5GMV A;  2MBH A;  1WX7 A;  3JSV A;  2RGF A;  1Z2M A;  2IO3 B;  4AP4 C;  2XK5 A;  3P2B A;  4DDI D;  3M95 A;  2K6D B;  3A1Q B;  4MGK E;  2MSE D;  4FUL A;  1WZ3 A;  1GJZ A;  5LLI A;  3UQB A;  3OLM D;  3QX1 A;  3VH3 B;  4DXA B;  2YLM A;  3ECI A;  1GUA B;  2LVQ A;  3X23 A;  2K8B A;  3OAW A;  5D2M B;  3AUL A;  3SHQ A;  3QWZ B;  5D94 A;  2FID A;  3GZN I;  4WAA A;  2GBM A;  2LZ6 A;  2L0T A;  2MQJ A;  3APD A;  2G4S A;  2C9W B;  4ANX A;  3K9O B;  2AYO B;  3ZTC A;  3H6N A;  2LGX A;  3ZUN A;  2FNJ B;  1YX6 B;  1C3T A;  4RM9 A;  5C1Z A;  3H7S A;  4OVV A;  5CHW A;  2MBB B;  2O6V D;  3ZDT A;  1G6J A;  2BF8 B;  3DBL I;  3RUI B;  3UIO B;  3KUZ A;  4NPN A;  3B0A A;  2KFJ A;  4K1R B;  3VUY A;  3ZNH B;  4DHZ E;  3PRZ A;  4FN2 A;  4EZL A;  4ZRJ A;  1OQY A;  1RRB A;  1NDD A;  1Q0W B;  3RYT A;  2CS4 A;  3TJP A;  2R2O A;  2KZR A;  5D6J B;  3V6E B;  5JZE B;  5J2R A;  5DPT A;  3R3M A;  4HWI B;  4WJN A;  4DBG A;  2K8H A;  3ONS A;  4BKS D;  1E5W A;  2KJH B;  1ZGU B;  1IYF A;  3DCG A;  2DX5 B;  3QAQ A;  5J17 A;  2M8S A;  3PHW B;  4AWJ A;  2LVP A;  1WM2 A;  1Q5W B;  2Z0E B;  1LFD A;  2FAZ A;  1WY8 A;  2NBW B;  3AU5 A;  2DYO A;  2MX2 A;  2DYB A;  2O2V A;  2GOW A;  4GDK B;  4LDT B;  4EFO A;  2IY1 B;  5G55 A;  2KTR A;  2FUH B;  3L54 A;  3RUL A;  2M1M A;  3B1L X;  3IHP C;  4HDQ A;  2NS5 A;  4K81 A;  5IA7 A;  2ZNV B;  2KHW B;  1WGG A;  3PRM B;  1XQQ A;  2JWZ A;  4HPL B;  4PS7 A;  4W9I A;  4HVB A;  3VTU A;  3PRP B;  1WH3 A;  2KDI A; 
#chains in the Genus database with same CATH topology
 3PPA A;  3AE1 B;  4WIP A;  1FFV A;  5HI1 A;  3DBH B;  1TTN A;  2LEK A;  4JLC A;  2MP2 A;  1ENF A;  4CO7 A;  2R2Q A;  1YQB A;  2D3C A;  4BFR A;  4YSZ B;  1ZE3 D;  1R4N I;  1SE3 A;  2HJ8 A;  3DHI C;  2WLB A;  1L0Y B;  1HTQ A;  1EUV B;  3ZGZ A;  1PYW D;  2CHX A;  2DYM A;  1JWA D;  3CST A;  1D3Z A;  3H7P A;  4TQ1 A;  3KW5 B;  1WFY A;  4MGY E;  4W9H A;  2L7R A;  3Q8E A;  2L8J A;  3W5V B;  1SJH D;  2L83 A;  3PSE B;  4XZ4 A;  1LXD A;  2LUM A;  4BKS A;  2OED A;  3DVN U;  2IO2 B;  2KDB A;  2KJR A;  4EOY A;  1CJE A;  2KX0 A;  4DWF A;  4GIV A;  2RR9 A;  1R4M I;  3BK2 A;  2M19 A;  4NJC A;  2LGS A;  1I4R A;  3HHM A;  5FK9 C;  3CWI A;  1KRH A;  5HHD G;  4LDT D;  1XLQ A;  3QAR A;  2WXM A;  2D3G A;  2LMC A;  2J53 A;  3NVV A;  2KWV B;  1N60 A;  2LGI A;  2L0F A;  2WXF A;  2WU2 B;  3EHV A;  4ACF A;  4EEW A;  3Q3O C;  2C7N B;  3EFC A;  5CTR C;  2IND C;  5FR6 A;  2INP E;  3MJ5 A;  2I2Y A;  4ZYN A;  4JQW C;  3A9J A;  3Q8F A;  4MJS B;  4GB9 A;  2KQS A;  2N1W A;  5AZF A;  1V1P B;  1MJD A;  4B6W A;  4LNI A;  1UNS A;  1WYW B;  3TEX A;  2WXP A;  5JHB A;  1FFU A;  3EFU A;  4AJY B;  2V4L A;  3Q3J A;  1J19 A;  3PRE A;  3Q69 A;  2G45 B;  3RZW C;  1TIF A;  3R7Q A;  3A4R A;  2KTF A;  4ZOH C;  3ZNI D;  1VRA B;  3AED B;  3NY5 A;  1VZ8 A;  3C19 A;  3RZF A;  2BYF A;  2ZCC A;  4I6L B;  4MSQ B;  3R8B A;  5KHO A;  1XLO A;  2UU7 A;  4I6N B;  2LFI A;  2K39 A;  2KDM A;  2RPV A;  4FLH A;  3TBL D;  4J3O D;  1TKG A;  3AE5 B;  4GMV A;  2MRP A;  3DVG X;  3BZD B;  3O13 A;  3DBL B;  3IFW B;  3RT3 B;  2Y5P A;  4GDK A;  4NQL B;  3DHG C;  2D2Q A;  4BZA A;  4KDL B;  3RCZ A;  2KXJ A;  2DEN B;  1LO5 D;  1NVI D;  1C1Y B;  2M0X A;  3IAM 1;  4RGM A;  1WXQ A;  3BK1 A;  2NBU A;  4NAW A;  4EZK A;  4HLE A;  3UQA A;  2IPK D;  3BVG A;  2CHZ A;  3WCQ A;  1CK1 A;  1QIL A;  2KFK A;  3E56 A;  4FJV B;  4ZRK A;  1NI2 A;  3FIL A;  4RF0 A;  3MHZ A;  3AEG B;  2IYD B;  3ZKJ C;  2LUE A;  3RMK C;  4RFB A;  4C00 A;  2K0P A;  4XDC A;  2BVC A;  3QCA A;  2O2V B;  2KK8 A;  2N9E B;  2W9N A;  1I4X A;  2AQ3 B;  4HCN B;  1ET9 A;  1VZ6 A;  3HM6 X;  4G3X B;  1WE6 A;  4HPP A;  2N7E A;  1R4N B;  4DHZ B;  3URY A;  2D07 B;  1MG4 A;  3L10 B;  2NPT A;  1UBI A;  2BWE S;  4LNO A;  3U7D A;  4N59 A;  2CR5 A;  5AEK B;  2BKF A;  4IM3 A;  4NY0 A;  3NZ3 A;  1V2Y A;  2MHJ A;  2N1V A;  3C0R B;  4YSX B;  4MEM A;  2N4F A;  2C60 A;  1RLF A;  1P0R A;  1JWM D;  1P1A A;  3TIX A;  1DYQ A;  2DWQ A;  2BW2 A;  2KQ4 X;  1Y8R C;  3NVZ A;  2AX5 A;  2SAK A;  4HJG E;  4WAF A;  3AXC A;  3O65 B;  4KDI C;  3VTV A;  2LI5 A;  5AUK A;  4O1N A;  5G5G A;  3W1S C;  4FHK A;  1EF5 A;  3L0W B;  5C23 A;  2Z59 B;  3M3J A;  1I4G A;  4YWG G;  2FCQ A;  3CF6 E;  2JY6 A;  1AWD A;  2DAJ A;  2BGF A;  4N58 A;  2B3A A;  3PS6 A;  4LNF A;  1N5W A;  4KIK B;  1SJE D;  1HZ6 A;  3MHS D;  3PZ7 A;  2QDF A;  2PEA A;  1R4M B;  3VUW A;  5E6J A;  3HUI A;  2KQ7 A;  4KZC A;  4PS3 A;  3RN9 C;  2ZJD A;  5EE1 A;  4FBJ B;  1WZ0 A;  4IDI A;  5LXI B;  3L16 A;  4JPS A;  1FEH A;  3PHX B;  5MPO A;  4LTU A;  2KDE B;  1YIW A;  4XWW A;  4G11 A;  1WE7 A;  2N9P C;  3QA8 A;  3ZXR A;  3V05 A;  4YL8 A;  1V80 A;  1E8Z A;  2PPH A;  4BOS C;  2MH7 A;  2C7H A;  1NEK B;  1UWM A;  2GBR A;  1H8C A;  4BOZ B;  4GOC A;  1WJ6 A;  2CU1 A;  2HTH A;  2CU3 A;  4US9 A;  2BYT A;  3PT2 B;  2CHW A;  3DVG Y;  3PTF C;  5G2N A;  3RNB C;  4IOI E;  2KOX A;  1T0Y A;  3DOW A;  5EDS A;  2UYZ B;  4M8N A;  2KJ6 A;  4OZC A;  2HTM E;  1MG8 A;  5E6O A;  4WJP A;  2JUO A;  2WXL A;  1I35 A;  2GBJ A;  2PVG C;  2MBQ A;  1SEB D;  1QQR A;  2IO3 B;  2XK5 A;  2L1A A;  5BYQ A;  2K6D B;  2WXK A;  3QX1 A;  3VH3 B;  1MHX A;  2ZW0 A;  4EE2 A;  1GUA B;  3OAW A;  3U7Z A;  2FID A;  4C4V B;  4RCO A;  3K9O B;  2AYO B;  2LGX A;  1YX6 B;  4IKG A;  4RM9 A;  4XGA B;  3GE8 C;  1FD6 A;  3ZDT A;  4YXD B;  2QIL A;  3NJT A;  4DQO C;  1EWY C;  2VH2 A;  3VRB B;  1E10 A;  1K50 A;  4XDD A;  4LLG M;  3N1Y C;  2J4X A;  5DPT A;  4HWI B;  3BVZ A;  1IBX B;  2K3U A;  3QAQ A;  4HKQ A;  1WM2 A;  2V3N A;  4AQ7 A;  2Z0E B;  3AN1 A;  1JQ4 A;  4YT0 B;  1LFD A;  2DYB A;  4LDT B;  1MFW A;  1HXY D;  3TSS A;  2FUH B;  5IN7 A;  2M1M A;  4WUR A;  3IHP C;  4K81 A;  3E9S A;  3B2G A;  4HVB A;  3NRZ A;  3JW0 X;  4C80 A;  2RDH A;  4I6P A;  4L1B A;  1SF0 A;  2LHD A;  1V5T A;  3VQI A;  2WS3 B;  3EA6 A;  1P9D U;  1SSN A;  3BVM A;  1SIF A;  2FUG 1;  2K22 A;  5I4D A;  4IW0 A;  1TZO A;  4YTP B;  2N7D A;  5L83 A;  1N61 A;  1XF5 L;  1WMH A;  1ZDV A;  1ZUD 2;  3ZXV A;  1HEZ E;  2JPH A;  5E6P A;  1WR1 A;  2BWF A;  4TUU A;  4HCP B;  3VTW A;  2DZI A;  2OJW A;  2RD0 A;  3Q3F A;  2BPS A;  4FHJ A;  5IAA C;  2O6V A;  4MM3 A;  2J0J A;  3FC4 A;  3ML8 A;  3W5U B;  2DBY A;  3KWV A;  4M0W B;  2G1E A;  2LVO A;  3ZW3 A;  4F1S A;  4HRS A;  1WF9 A;  1WM3 A;  3KVF B;  3AE9 B;  2JZP A;  1ZOY B;  2LAS A;  2CJO A;  5BO4 B;  3ZYY X;  1EO6 A;  4D2K A;  2E6X A;  4ICU A;  2V0G A;  1D5X C;  1TY2 A;  3RNA C;  1YD8 U;  1BUI C;  4ZRP A;  3SU8 X;  2KWD A;  3U52 E;  1J7B A;  4US8 A;  1NYR A;  1PGB A;  4DDG D;  2MCN B;  1KFY B;  4F7Z A;  1S1Q B;  1UBQ A;  3L4P A;  2ZPN A;  4NQK E;  4WQO B;  2K1F A;  1Z5S B;  2D5G A;  4RGN A;  2QCZ A;  2ZPY A;  4N9F 4;  1T0R C;  1AN8 A;  2JXT A;  3TMP B;  1SE9 A;  1GG3 A;  2V9H A;  1QOF A;  1KM7 A;  2WWZ A;  3ZJV A;  3A1Q A;  3PV1 A;  1UGM A;  2RDB C;  4F8C B;  4URK A;  4RH6 A;  1JRU A;  3W1Y A;  4WWP A;  1QZE A;  1ZPS A;  1WWT A;  4P1C C;  2NCN A;  2KLC A;  1SE4 A;  1HZ5 A;  2AWT A;  5C3J B;  4IG7 B;  2WNM A;  2NVU I;  1UZX B;  3DDC B;  3PVL A;  3JYU A;  3UIP B;  1NYQ A;  3RNG C;  2KNB A;  3N1Z C;  4W9C A;  1NI3 A;  1YNT E;  3BYT B;  1YJI A;  2HDE A;  4WQM A;  1GAQ B;  4ANU A;  2JX5 A;  5DCN A;  4K7S A;  3I9V 1;  1VJK A;  4MT5 A;  3CIR B;  2Q5W D;  3CMM B;  1OTR B;  2JYE A;  4C7Y A;  4MSM B;  1XEE A;  1WGY A;  2JZ3 B;  3WAN A;  4YTN B;  1F77 A;  3N32 A;  4OVU A;  2NBV B;  1WGH A;  5TR5 A;  1OEY J;  1AW7 A;  2CJN A;  2JYT A;  2JRI B;  1V5O A;  2ZCB A;  1Q10 A;  2NTS A;  3AV8 A;  2GB1 A;  4ZDV A;  2DHZ A;  1E0Z A;  1D6E C;  4Q2J A;  4TMA B;  5L95 C;  1A70 A;  2WXO A;  3MFG A;  2LXC A;  1WGD A;  2KC1 A;  3AE3 B;  3VFK A;  1ISN A;  1CQV A;  4MGI E;  2BQQ A;  5DPS A;  1N6Z A;  2WU5 B;  3ZTD A;  2QEJ C;  5HG2 A;  1FMA D;  4BBN F;  4ITK A;  5JH5 C;  2BB6 A;  4W9J A;  4IWQ A;  2G3Q B;  1I7H A;  4E74 A;  2K8C A;  1YQ3 B;  2OOB B;  4B0E A;  3GB1 A;  4K3B A;  1YMH E;  3AEA B;  2ZEQ A;  2LRU A;  2KTR B;  2H88 B;  4WWM A;  1Q1O A;  3AE7 B;  2XBB C;  2XEW A;  2L52 A;  1F1H A;  3SEB A;  1DOY A;  2Y3A A;  3TL5 A;  5AZG A;  3VHT C;  1OFF A;  2J7Q B;  2DNF A;  2R61 A;  2L00 B;  4P6V F;  4TKN A;  3SD5 A;  2ASQ A;  2KVZ A;  3W9C B;  4LJP B;  1K52 A;  2QIE B;  1WX8 A;  2V3P A;  2Y5C A;  1FPY A;  1F2R I;  1F52 A;  2M17 A;  4GGQ A;  4IM0 A;  2WYQ A;  3TCA A;  4OHJ A;  1I42 A;  4M00 A;  4NJ6 A;  2PE9 A;  2CKH B;  1WYG A;  4IWO A;  1L6U A;  4ZRI A;  1C4P A;  4A55 A;  2IJ0 A;  1XXG A;  3RFZ B;  3ML9 A;  4B95 A;  3VR8 B;  1YN5 A;  1L2N A;  4HKZ E;  1WR6 E;  2N7J A;  4MJS A;  2J0K A;  4DHJ D;  2WXI A;  1WGK A;  1TT5 B;  5CHF A;  1YX5 B;  4WJQ A;  2MBO A;  3AEB B;  3TEW A;  1V1P A;  2MEK A;  3TEZ A;  2GBN A;  2D3A A;  4PYU A;  1WSP A;  2W55 A;  3N30 A;  3HM3 A;  1TS3 A;  4K3C A;  2D11 A;  1L4Z B;  1WX9 A;  2HD5 B;  1WXS A;  3RNE C;  1M4V A;  1KLV A;  4GXB A;  3U4E G;  1C4C A;  2QSD A;  2L3Z A;  1N63 A;  3ZLZ A;  2ZNV C;  1FM0 D;  3A4S C;  1E8X A;  3I57 A;  1VCB A;  2QHO A;  3R2I A;  2KYW A;  4B0M A;  4W9E A;  1L6V A;  1N62 A;  2XNA C;  1QLB B;  2H89 B;  3ENE A;  3DBR I;  2M56 B;  2GI9 A;  4ZHO A;  4DK5 A;  2BYE A;  2EKE C;  1QKZ A;  2J42 A;  1V9J A;  1M94 A;  5H92 C;  3UIN B;  2MW5 A;  1WX7 A;  4DDI D;  4R3D A;  1QOG A;  2WHI A;  3OLM D;  2GLS A;  4P1B C;  4DXA B;  3ECI A;  5H8Y E;  5C2T B;  5D2M B;  3AUL A;  3SHQ A;  4NAM A;  1C4A A;  2MJE A;  1GB4 A;  2G4S A;  3H6N A;  3C8Y A;  2FNJ B;  1F2R C;  5C1Z A;  4OVV A;  3NVW A;  5IOI A;  3RUI B;  2WDV B;  3GE3 C;  3ZNH B;  4FN2 A;  4ZRJ A;  1OQY A;  1OQQ A;  1LGR A;  2QC8 A;  5D6J B;  4PT5 A;  3V6E B;  5J2R A;  4RGO S;  2JWU A;  3P4R B;  1SXT A;  2K8H A;  3ZJU A;  4BKS D;  4GLS C;  1E5W A;  1HA5 A;  3P42 A;  4REZ A;  2M8S A;  3PHW B;  4AWJ A;  1R7S A;  1VZ7 A;  1E9M A;  4M02 A;  1J7C A;  3VR9 B;  2FAZ A;  4UDU C;  2DYO A;  2O2V A;  4EFO A;  4KGR A;  3Q3M C;  3RUL A;  3W2D A;  2NS5 A;  3SFD B;  2ZNV B;  2KHW B;  4W9I A;  1XQQ A;  4HPL B;  2N9K A;  4JWS C;  2KDI A;  4OVZ A;  2V1Y A;  1XT9 B;  2KO3 A;  1L5P A;  4HPM B;  4JGH B;  2RMM A;  4G50 A;  4KZ0 A;  3N20 C;  4NZL B;  3U2S C;  4W9L A;  3N3K B;  1SB3 C;  3EEC A;  1XO3 A;  3APF A;  1WXA A;  2WP9 B;  4MAC A;  1WXM A;  3VVW B;  4A3P A;  3BWU D;  3WA0 A;  5J18 A;  3U30 A;  4GDL B;  3A9K B;  1GPX A;  4FAD A;  2JXX A;  2QJL A;  3WAL A;  2WXQ A;  3IAS 1;  4LCD E;  1JWB D;  3ZRF A;  2KWC A;  2DLB A;  1PQS A;  4W9F A;  4KIK A;  4C56 C;  3V6C B;  1NEN B;  1V49 A;  3VH4 B;  3CSF A;  2HJ1 A;  3AE4 B;  2WXR A;  3ALB A;  2PW9 A;  4W9K A;  1ESF A;  1BML C;  3KUD B;  2PLP A;  4L2Y A;  2YEP B;  3DQV A;  2KWU B;  3KYD D;  1JRP A;  1BT0 A;  4BVU C;  3BII D;  1PGX A;  3ETR A;  5D3D A;  2E3T A;  2JSV X;  5LXH A;  1CZP A;  1OGW A;  2M4N A;  2MWS B;  4ZYS A;  3WAP A;  3M63 B;  2PKO A;  1E8Y A;  3GS2 A;  3DBS A;  4HEA 1;  5LNK 1;  1I4Q A;  3AEE B;  1IP9 A;  4DXG A;  3PGE A;  2FBW B;  3V61 A;  4LJO B;  4MH8 A;  3BY4 B;  3AE2 B;  2PIA A;  1I4H A;  2G4D B;  1TS5 A;  3AU4 A;  2YEP F;  1RYJ A;  4YTM B;  4XWT A;  3T3N A;  1J0G A;  1EM7 A;  3SFE B;  3H1U A;  3IT6 B;  2PTL A;  3X0W A;  3DBR B;  4LNK A;  3W1S A;  2K9X A;  2WDT B;  2WX0 A;  4C4V A;  2IO0 B;  5AUI A;  3T9L A;  2WXJ A;  3AEF B;  4II2 B;  3R7R A;  2OJR A;  1FO4 A;  4IC7 B;  4CQN A;  1PDX A;  1FCC C;  4W9D A;  3OJ3 A;  2KD0 A;  3AH7 A;  4M8M A;  2AL3 A;  2KAC A;  2X38 A;  2WX1 A;  3Q6B A;  1TKY A;  3L17 A;  1IBX A;  4FA6 A;  3NZS A;  1ACC A;  4MH0 E;  1JCK B;  3BIN A;  3JSV B;  1CMX B;  1ZKH A;  4H2A A;  2IGG A;  2V3S A;  4ZRQ A;  1V86 A;  1FNU A;  2L32 A;  4YSY B;  5CX3 A;  2L05 A;  2K6Q A;  3VXW A;  1E90 A;  3ZNG C;  2PMV A;  1A5R A;  1P7E A;  4E3C A;  2JF5 A;  2ZVO A;  4K7W A;  4BKG A;  4BBN C;  4TV3 A;  4DHJ B;  2WXH A;  3QQ8 B;  2NTT A;  3B2F A;  3BYY B;  2JQR B;  3IVF A;  1QF6 A;  1FRD A;  3DPD A;  1E8W A;  1SGH A;  1AYF A;  3VDZ A;  3V62 A;  2ICI A;  5BYR A;  2FIF A;  2HE7 A;  3PZD A;  1WJ4 A;  2A4Z A;  1F0Z A;  1FRR A;  1RFK A;  2IGD A;  1FNV A;  2UWQ A;  1EWC A;  4S17 A;  4B9K A;  1P7F A;  3NZU A;  2XN9 C;  2KMA A;  4M0W A;  3QIJ A;  3ZO5 B;  4J6I A;  2QMT A;  3OWE B;  1FIQ A;  2B76 B;  3GOE A;  1TJE A;  1GC6 A;  4ANW A;  1K8R B;  1S3S G;  2IBI B;  2MP2 B;  2JT4 B;  3MC9 A;  3NVY A;  4MGZ E;  3N1X C;  3IG3 A;  4II3 B;  4P7I A;  1TBE A;  1JAL A;  3APC A;  3P63 A;  4C7Z A;  2DZK A;  3ZNZ B;  1U4A A;  5JHA A;  2FCM A;  2Z0D B;  1YN4 A;  1PFD A;  5E6N A;  4IM2 A;  1IUE A;  3HK0 A;  1UUP A;  3H7P B;  2VH1 A;  1DGJ A;  2GRI A;  1IGC A;  3Q2A C;  1UGJ A;  1X1M A;  1V81 A;  1T5X D;  2OHF A;  3AE6 B;  1WRI A;  2REX A;  3NUH B;  2KMM A;  1SIJ A;  4KKJ A;  1KJT A;  2JRH A;  2I1K A;  4AJW A;  3RNF C;  4ASW C;  1UEL A;  1PGA A;  1ZXH A;  2EMS A;  1JWS D;  2BS3 B;  4BAX A;  2C7M B;  3Q14 C;  4EZJ A;  2GMI C;  3RNC C;  3V60 A;  3AI5 A;  2WXN A;  1QOB A;  3DHH C;  5DPR A;  2VRR B;  2YVC A;  3LB8 C;  3ZJT A;  1LM8 B;  2I1J A;  2PJH A;  4ANV A;  4RGT A;  3H9D A;  1WJN A;  1L7Y A;  1RAX A;  2BS2 B;  2KC2 A;  4HRO A;  4AUQ C;  1VDV A;  3I63 C;  1ZDX A;  3A9J B;  2X8X X;  4IWP A;  2MBH A;  1Z2M A;  1EU4 A;  4AP4 C;  4JWU C;  4MGK E;  2MSE D;  4FUL A;  3UQB A;  2YLM A;  2LVQ A;  3X23 A;  3EGR A;  3RPF C;  5G5H A;  1L4D B;  3GZN I;  2GBM A;  4RNA A;  2L0T A;  1MI0 A;  3TUO A;  1L0X B;  3ZUN A;  2O6V D;  1G6J A;  2BF8 B;  2WXG A;  3PO0 A;  3UIO B;  3KUZ A;  4NPN A;  3B0A A;  2KFJ A;  4K1R B;  3VUY A;  3PRZ A;  1RRB A;  2KAJ A;  1NDD A;  1Q0W B;  1IGD A;  2ZW1 A;  4JX1 C;  3MC8 A;  5JZE B;  3ABV B;  1V8C A;  1ZGU B;  2DX5 B;  1TS4 A;  2LVP A;  1Q5W B;  5EE9 A;  1KLU D;  4ARI A;  2BTE A;  1SE2 A;  1WY8 A;  2NBW B;  3Q8A A;  4GDK B;  1GB1 A;  1E7P B;  2IY1 B;  5G55 A;  2KTR A;  3RI7 C;  3L54 A;  3B1L X;  1WGG A;  2MJD A;  2JWZ A;  4PS7 A;  3VTU A;  3IXS A;  3PRP B;  1WH3 A;  3HRD D;  1HQR D;  4NJ7 A;  4NAW B;  4KGT A;  1E7V A;  3D32 A;  1HE8 A;  2JVC A;  1JML A;  2KFK B;  2G9H D;  1FXI A;  3R2T A;  1YJ1 A;  2RDG A;  3FIL B;  3L08 A;  2VZK D;  2N9X A;  3R66 C;  3Q3N C;  4E71 A;  1C79 A;  4CYE A;  4NNJ B;  5D3I B;  4A20 A;  2ZVN A;  3S2A A;  4WH4 A;  1FXT B;  2Y5B B;  2LRW A;  2AL6 A;  2DZM A;  2LGD A;  1JWU D;  5AZH A;  4A6Q A;  4GSW A;  4W9G A;  4LNN A;  1TY0 A;  3L13 A;  3PZ8 A;  4XC2 A;  4EUT A;  3RD2 A;  1DOX A;  1V97 A;  4HK2 A;  3MJW A;  4HXD A;  3WAO A;  3Q8C A;  2L76 A;  4KSK C;  4KX6 B;  3ZRC A;  1KLG D;  4A9A A;  2NPT B;  2WDQ B;  2PE6 B;  3HVZ A;  2JZZ A;  2BBC A;  1LQB A;  4JL9 A;  3MTN B;  3Q8B A;  2M0A A;  4N6E B;  1TS2 A;  3IBE A;  3AM9 A;  1WGR A;  4BKT A;  3NS8 A;  4GU2 A;  1H4R A;  2IGH A;  4OZA A;  2KN5 A;  1YJJ A;  2LXA A;  4A90 A;  2LJ5 A;  3P1M A;  2LHE A;  4FJY A;  3A33 B;  1WXV A;  3KLS X;  3HIZ A;  3DWG C;  1GC7 A;  4LK0 M;  1IPG A;  1GNU A;  3NOB A;  2LWP A;  5CHV C;  1XLN A;  1K53 A;  2MBE A;  3P4S B;  5T8I A;  1YQ4 B;  1EF1 A;  5EE0 A;  3T8M A;  2K25 A;  4HDO A;  1E7U A;  4WJO A;  3FKY A;  4KGS A;  4XE0 A;  2C5L C;  2NMQ A;  2KX3 A;  3VUX A;  1TKE A;  1F9J A;  5GXG B;  2D3B A;  4K7U A;  4QAY A;  1KOT A;  3QJZ A;  1SBB B;  2W82 A;  1QT9 A;  3NS1 A;  3UF8 A;  2J52 A;  4WWN A;  3P4Q B;  3QHT A;  3U8Z A;  2ON8 A;  3MC0 B;  4RM8 A;  1C78 A;  2IO1 B;  1UH6 A;  4RF1 A;  2BS4 B;  3HVD A;  3SR6 A;  4KKI A;  1KH0 A;  1XD3 B;  4AS1 A;  3EC8 A;  2WGS A;  3ZQ4 A;  1OQR A;  3GZN B;  5HKH A;  5EE3 A;  1JRO A;  1J8C A;  1MPE A;  5BMI A;  4A3O A;  3OJ4 B;  2XK5 B;  3UGB B;  3MP9 A;  1UD7 A;  3OG5 A;  2BKR B;  4KV2 A;  2KVR A;  2W3S A;  1YN3 A;  2BYV E;  3P4P B;  4MEL A;  3ZVV A;  4KVG B;  3KYC D;  3SDL C;  1RFA A;  2A5U A;  5IKC M;  4ARC A;  5IO9 A;  1RWS A;  3ZIM A;  3AE8 B;  3I3T B;  2N0S B;  4RMA A;  2BB5 A;  2N9L A;  3LXF A;  3N9Y C;  4USA A;  2RSU A;  3AEC B;  1KF6 B;  3AMZ A;  1TGZ B;  4HJK A;  1MHH E;  2NR2 A;  4G0N B;  2Z8L A;  1I4P A;  3QK0 A;  3DVN V;  1TYG B;  2FE8 A;  1DOI A;  5DPW A;  3DBH I;  4GDL A;  3A9K A;  4L23 A;  2FCS A;  3LJ3 A;  1WJU A;  2DZJ A;  4FXC A;  2KN4 A;  2MLB A;  4EKU A;  4PS8 A;  4KSL C;  2FCN A;  3FAH A;  2J0M A;  3J9C A;  3NG0 A;  1VR9 A;  5FR3 A;  2LD9 A;  1WI0 A;  5BYS A;  4CHK A;  3KH0 A;  2JU6 X;  5D7G A;  4X57 B;  2KLG A;  1VLB A;  1D5M C;  2DAF A;  4DXF A;  3K9P B;  2ACZ B;  2RPQ A;  3KQ4 A;  3WIM A;  1TZ1 A;  2KAN A;  3LDZ E;  4IUM B;  4WWO A;  2IY0 B;  1N5X A;  2EKI A;  4ZHP A;  2LJI A;  3JVZ X;  3QC8 B;  1NBF C;  4MDK E;  2INC C;  1WMH B;  1V6E A;  2D10 A;  2WDR B;  2MA9 B;  3PLU A;  4OZB A;  1P3Q U;  3NHE B;  1ET6 A;  1GOZ A;  3VAW A;  4OW0 A;  2SEB D;  1KTK A;  1T3Q A;  3H8H A;  1PUT A;  2IZV B;  2ONQ A;  1FNW A;  4S0R A;  3M62 B;  2IDY A;  1K51 A;  3VRA B;  2O6V B;  4MM3 B;  3KUC B;  1ZW7 A;  2AEH A;  3LYY A;  4PK1 A;  2PVO D;  2AQ2 B;  3KWL A;  5HFY A;  1D5Z C;  2GBK A;  3WAM A;  2EMT A;  3V3X A;  1T6B X;  1T0S C;  1VD2 A;  1AAR A;  1P98 A;  2KKC A;  3UI3 A;  1V1O A;  5BMH A;  4GN1 A;  1OEY A;  4XX5 A;  2LGY A;  3TEY A;  1WIA A;  3IT4 B;  1EU3 A;  1ROE A;  3ZDM C;  1FXA A;  1FCL A;  2KDF B;  4JIO U;  2ZZP B;  2W3R A;  1WRD B;  4ICV A;  4AOF A;  5KHQ A;  5JXV A;  2V4I B;  1MVK A;  1E6E B;  3PLV A;  1ZP0 B;  2KMC A;  3B08 A;  2K5P A;  4TQ0 A;  3DWM A;  4FJZ A;  2MJ3 A;  1RM6 C;  4PYZ A;  1Y56 A;  1L0V B;  2VZK B;  1C9F A;  2WQY B;  5GMV A;  2W54 A;  3JSV A;  2RGF A;  1JW9 D;  3GP7 A;  3P2B A;  3M95 A;  1STE A;  3A1Q B;  1QOA A;  1UWX A;  1ZXI A;  1WZ3 A;  1GJZ A;  5LLI A;  2KT7 A;  5IP4 D;  4TSS A;  4P16 A;  2I38 A;  2K8B A;  2TSS A;  1XCT L;  4A8X C;  3QWZ B;  5D94 A;  4WAA A;  2LZ6 A;  4XYC A;  2MQJ A;  3B9J A;  3APD A;  2AQ1 B;  2C9W B;  4ANX A;  4M01 A;  3ZTC A;  1C3T A;  1C77 A;  3H7S A;  1XLP A;  5CHW A;  2MBB B;  3AB5 A;  3DBL I;  1YOV B;  4DHZ E;  5FKA C;  1UF0 A;  4EZL A;  1C76 A;  2BT6 A;  3RYT A;  1T0Q C;  2CS4 A;  3TJP A;  2R2O A;  2KZR A;  1D4B A;  3R3M A;  4WJN A;  4DBG A;  3ONS A;  1J7A A;  2KJH B;  1IYF A;  3DCG A;  5J17 A;  5BMG A;  1B9R A;  5TSS A;  2INN E;  1XCQ L;  2EEL A;  3AU5 A;  3T3O A;  2MX2 A;  1B1Z A;  2GOW A;  3EUB 2;  1HTO A;  4HDQ A;  5IA7 A;  3PRM B;  4JE3 B;  3I5J C;  1BXT A; 
#chains in the Genus database with same CATH homology
 2V1Y A;  3PPA A;  1XT9 B;  3JW0 X;  4I6P A;  2KO3 A;  4NJ7 A;  4NAW B;  1V5T A;  3VQI A;  1E7V A;  4HPM B;  1TTN A;  3D32 A;  4JGH B;  4JLC A;  1HE8 A;  4G50 A;  1P9D U;  2JVC A;  2KFK B;  2MP2 A;  4KZ0 A;  4CO7 A;  2R2Q A;  3N3K B;  4W9L A;  1SIF A;  3EEC A;  1YJ1 A;  1YQB A;  3L08 A;  3APF A;  4IW0 A;  1WXA A;  4BFR A;  1R4N I;  2N7D A;  2N9X A;  3R66 C;  2HJ8 A;  5L83 A;  4E71 A;  1WXM A;  3VVW B;  4CYE A;  1WMH A;  4NNJ B;  4A20 A;  2JPH A;  2ZVN A;  1EUV B;  5E6P A;  3S2A A;  1WR1 A;  2BWF A;  4A3P A;  4TUU A;  3WA0 A;  1FXT B;  2Y5B B;  4HCP B;  2LRW A;  2AL6 A;  2DZM A;  3U30 A;  3VTW A;  4GDL B;  2CHX A;  2LGD A;  3A9K B;  2DZI A;  2DYM A;  4FAD A;  2JXX A;  3WAL A;  3CST A;  5AZH A;  4LCD E;  4GSW A;  2RD0 A;  4W9G A;  1D3Z A;  3H7P A;  3L13 A;  4EUT A;  4XC2 A;  3ZRF A;  3Q3F A;  3RD2 A;  2BPS A;  4FHJ A;  2KWC A;  4HK2 A;  4TQ1 A;  5IAA C;  2O6V A;  3KW5 B;  4MM3 A;  1PQS A;  2J0J A;  3ML8 A;  1WFY A;  3MJW A;  4HXD A;  3WAO A;  4M0W B;  2LVO A;  4MGY E;  4W9H A;  4W9F A;  3ZW3 A;  2L76 A;  1WF9 A;  4KIK A;  4F1S A;  1WM3 A;  3KVF B;  4KSK C;  2L7R A;  3V6C B;  3ZRC A;  2L8J A;  1V49 A;  2NPT B;  3VH4 B;  2LAS A;  3CSF A;  5BO4 B;  2PE6 B;  2JZZ A;  3ALB A;  3PSE B;  4W9K A;  4XZ4 A;  1LXD A;  1LQB A;  3KUD B;  4BKS A;  4JL9 A;  3DQV A;  3MTN B;  2KWU B;  3DVN U;  3KYD D;  1EO6 A;  2IO2 B;  1BT0 A;  2KDB A;  2KJR A;  4BVU C;  4EOY A;  4ICU A;  2KX0 A;  4DWF A;  4GIV A;  3IBE A;  1YD8 U;  2RR9 A;  3SU8 X;  5LXH A;  1R4M I;  1WGR A;  4BKT A;  3NS8 A;  1OGW A;  2M4N A;  4GU2 A;  1H4R A;  3HHM A;  2MWS B;  2KN5 A;  4DDG D;  2MCN B;  4F7Z A;  1S1Q B;  2LXA A;  3WAP A;  2LJ5 A;  4LDT D;  3M63 B;  1UBQ A;  3QAR A;  4FJY A;  3A33 B;  1E8Y A;  2D3G A;  2ZPN A;  4NQK E;  4WQO B;  1WXV A;  3HIZ A;  2KWV B;  2K1F A;  1GC7 A;  1IPG A;  3DBS A;  1Z5S B;  2L0F A;  1GNU A;  2LWP A;  3EHV A;  3NOB A;  5CHV C;  4EEW A;  2ZPY A;  2MBE A;  4N9F 4;  2C7N B;  5CTR C;  5FR6 A;  1EF1 A;  4ZYN A;  4JQW C;  1IP9 A;  3A9J A;  3T8M A;  2K25 A;  4HDO A;  3PGE A;  4MJS B;  1E7U A;  1SE9 A;  4WJO A;  3TMP B;  3V61 A;  4GB9 A;  4LJO B;  1GG3 A;  2C5L C;  2KQS A;  2N1W A;  1KM7 A;  2WWZ A;  3BY4 B;  2KX3 A;  3VUX A;  5AZF A;  1F9J A;  3A1Q A;  3PV1 A;  4K7U A;  1KOT A;  1UGM A;  2G4D B;  4B6W A;  3QJZ A;  3AU4 A;  1J0G A;  1WYW B;  4F8C B;  4URK A;  1JRU A;  3W1Y A;  3H1U A;  3UF8 A;  5JHB A;  4WWN A;  3X0W A;  4WWP A;  1QZE A;  3W1S A;  2WDT B;  3EFU A;  2WX0 A;  4AJY B;  2IO0 B;  3QHT A;  2NCN A;  2V4L A;  2KLC A;  3Q3J A;  1J19 A;  3U8Z A;  2AWT A;  3PRE A;  4IG7 B;  4RM8 A;  3T9L A;  2G45 B;  3RZW C;  2NVU I;  1UZX B;  3DDC B;  3PVL A;  3JYU A;  2IO1 B;  4II2 B;  3UIP B;  3R7R A;  3R7Q A;  2KNB A;  3A4R A;  4W9C A;  2KTF A;  1UH6 A;  3ZNI D;  2OJR A;  3NY5 A;  4IC7 B;  3RZF A;  1XD3 B;  2BYF A;  3EC8 A;  2ZCC A;  4W9D A;  4I6L B;  4MSQ B;  3OJ3 A;  2KD0 A;  4M8M A;  5KHO A;  2AL3 A;  4ANU A;  4I6N B;  2K39 A;  2WX1 A;  5HKH A;  3L17 A;  4FLH A;  5DCN A;  4FA6 A;  3NZS A;  3TBL D;  1J8C A;  4K7S A;  4MH0 E;  3BIN A;  3JSV B;  4A3O A;  3OJ4 B;  2XK5 B;  1CMX B;  1ZKH A;  4GMV A;  2MRP A;  3UGB B;  1UD7 A;  3CMM B;  3DVG X;  1OTR B;  2V3S A;  2BKR B;  4MSM B;  1V86 A;  1WGY A;  2JZ3 B;  3IFW B;  4KV2 A;  5CX3 A;  2L05 A;  3RT3 B;  3WAN A;  2KVR A;  3N32 A;  4OVU A;  2K6Q A;  3VXW A;  2BYV E;  1E90 A;  2NBV B;  4GDK A;  4MEL A;  4NQL B;  3ZNG C;  3ZVV A;  5J18 A;  1WGH A;  2D2Q A;  4KVG B;  5TR5 A;  4KDL B;  1A5R A;  3RCZ A;  1OEY J;  2KXJ A;  3KYC D;  3SDL C;  2DEN B;  2JRI B;  1RFA A;  1V5O A;  4E3C A;  2JF5 A;  2A5U A;  2ZCB A;  2ZVO A;  1C1Y B;  2M0X A;  4K7W A;  3ZIM A;  4BKG A;  4BBN C;  2NBU A;  4NAW A;  3I3T B;  4EZK A;  4HLE A;  4TV3 A;  3UQA A;  4ZDV A;  2DHZ A;  2CHZ A;  4DHJ B;  4RMA A;  5L95 C;  2KFK A;  4ZRK A;  4FJV B;  3QQ8 B;  1NI2 A;  2RSU A;  2LXC A;  1WGD A;  2KC1 A;  1TGZ B;  4HJK A;  3VFK A;  1ISN A;  2NR2 A;  4G0N B;  4MGI E;  5DPS A;  3ZTD A;  3IVF A;  2IYD B;  3DPD A;  4BBN F;  1E8W A;  3QK0 A;  5JH5 C;  1SGH A;  3DVN V;  3ZKJ C;  2LUE A;  5DPW A;  3DBH I;  4GDL A;  3A9K A;  4IWQ A;  2G3Q B;  4W9J A;  3VDZ A;  3V62 A;  2FCS A;  4E74 A;  3LJ3 A;  1WJU A;  2K8C A;  2OOB B;  2FIF A;  2HE7 A;  2DZJ A;  1WJ4 A;  2A4Z A;  3PZD A;  3QCA A;  2O2V B;  2UWQ A;  2KK8 A;  2N9E B;  2MLB A;  4EKU A;  2W9N A;  2ZEQ A;  4B9K A;  4HCN B;  2LRU A;  2KTR B;  3NZU A;  4KSL C;  2FCN A;  4PS8 A;  1Q1O A;  2J0M A;  3HM6 X;  2KMA A;  4G3X B;  1WE6 A;  3QIJ A;  2XBB C;  2XEW A;  2N7E A;  2LD9 A;  3ZO5 B;  1WI0 A;  4DHZ B;  4CHK A;  3KH0 A;  5D7G A;  2D07 B;  4J6I A;  4X57 B;  2KLG A;  3ZNZ B;  3L10 B;  2NPT A;  3TL5 A;  2DAF A;  1UBI A;  2BWE S;  5AZG A;  3VHT C;  2J7Q B;  3GOE A;  3K9P B;  2CR5 A;  3U7D A;  5AEK B;  2L00 B;  2RPQ A;  2BKF A;  4IM3 A;  1GC6 A;  4NY0 A;  3WIM A;  4ANW A;  1TZ1 A;  1K8R B;  1V2Y A;  2KAN A;  4TKN A;  1S3S G;  2IBI B;  2MP2 B;  2N1V A;  3C0R B;  3LDZ E;  4MEM A;  4IUM B;  3SD5 A;  4WWO A;  2IY0 B;  2JT4 B;  2N4F A;  2C60 A;  1RLF A;  2ASQ A;  3JVZ X;  1P0R A;  4MGZ E;  4LJP B;  1P1A A;  3IG3 A;  1WX8 A;  4II3 B;  4P7I A;  1TBE A;  3QC8 B;  3TIX A;  1NBF C;  1Y8R C;  3APC A;  2M17 A;  4MDK E;  1WMH B;  1V6E A;  2DZK A;  3AXC A;  2D10 A;  3O65 B;  4GGQ A;  4KDI C;  1U4A A;  4IM0 A;  2MA9 B;  2WYQ A;  3PLU A;  3VTV A;  2FCM A;  2Z0D B;  3TCA A;  2LI5 A;  5JHA A;  1P3Q U;  3W1S C;  4FHK A;  1EF5 A;  4IM2 A;  5E6N A;  1I42 A;  3HK0 A;  3NHE B;  4NJ6 A;  2PE9 A;  3L0W B;  5C23 A;  3VAW A;  2CKH B;  2Z59 B;  3M3J A;  2IZV B;  2FCQ A;  4IWO A;  3M62 B;  3H7P B;  3CF6 E;  2JY6 A;  4ZRI A;  2O6V B;  2DAJ A;  3KUC B;  1ZW7 A;  2BGF A;  2AEH A;  2B3A A;  3PS6 A;  3ML9 A;  4B95 A;  4KIK B;  1X1M A;  3MHS D;  2GBK A;  3WAM A;  2EMT A;  2PEA A;  1V81 A;  1L2N A;  3VUW A;  1VD2 A;  1AAR A;  1WR6 E;  2KQ7 A;  1P98 A;  2KKC A;  2REX A;  2J0K A;  4KZC A;  4MJS A;  4PS3 A;  4DHJ D;  5CHF A;  1YX5 B;  4GN1 A;  1KJT A;  1OEY A;  2JRH A;  2MBO A;  2ZJD A;  2LGY A;  4WJQ A;  1WZ0 A;  4XX5 A;  2I1K A;  4AJW A;  4FBJ B;  1WIA A;  4ASW C;  5LXI B;  2GBN A;  1UEL A;  3L16 A;  4PYU A;  3PHX B;  3N30 A;  3HM3 A;  3ZDM C;  2EMS A;  2KDE B;  1YIW A;  2D11 A;  4G11 A;  1WE7 A;  1WX9 A;  2N9P C;  3QA8 A;  2HD5 B;  2C7M B;  4YL8 A;  1V80 A;  1WXS A;  1E8Z A;  2GMI C;  4GXB A;  2KDF B;  4EZJ A;  1KLV A;  2PPH A;  4JIO U;  2ZZP B;  4BOS C;  3V60 A;  3AI5 A;  1WRD B;  2L3Z A;  3ZLZ A;  4ICV A;  2C7H A;  4AOF A;  2GBR A;  5KHQ A;  2ZNV C;  5DPR A;  4BOZ B;  1H8C A;  4GOC A;  2VRR B;  1WJ6 A;  2CU1 A;  2HTH A;  3A4S C;  2YVC A;  1E8X A;  1LM8 B;  3PT2 B;  2CHW A;  3DVG Y;  3PTF C;  5G2N A;  3PLV A;  2I1J A;  2PJH A;  1VCB A;  2KOX A;  1T0Y A;  2QHO A;  2KMC A;  3DOW A;  3B08 A;  4ANV A;  5EDS A;  3H9D A;  4W9E A;  2UYZ B;  1WJN A;  4TQ0 A;  4M8N A;  3ENE A;  1L7Y A;  2KJ6 A;  3DBR I;  4FJZ A;  1RAX A;  1MG8 A;  2KC2 A;  4DK5 A;  5E6O A;  4AUQ C;  2BYE A;  4WJP A;  2EKE C;  2JUO A;  3UIN B;  1V9J A;  1M94 A;  1I35 A;  2GBJ A;  3A9J B;  4PYZ A;  2MBQ A;  2MW5 A;  4IWP A;  5GMV A;  2MBH A;  1WX7 A;  3JSV A;  2RGF A;  1Z2M A;  2IO3 B;  4AP4 C;  2XK5 A;  3P2B A;  4DDI D;  3M95 A;  2K6D B;  3A1Q B;  4MGK E;  2MSE D;  4FUL A;  1WZ3 A;  1GJZ A;  5LLI A;  3UQB A;  3OLM D;  3QX1 A;  3VH3 B;  4DXA B;  2YLM A;  3ECI A;  1GUA B;  2LVQ A;  3X23 A;  2K8B A;  3OAW A;  5D2M B;  3AUL A;  3SHQ A;  3QWZ B;  5D94 A;  2FID A;  3GZN I;  4WAA A;  2GBM A;  2LZ6 A;  2L0T A;  2MQJ A;  3APD A;  2G4S A;  2C9W B;  4ANX A;  3K9O B;  2AYO B;  3ZTC A;  3H6N A;  2LGX A;  3ZUN A;  2FNJ B;  1YX6 B;  1C3T A;  4RM9 A;  5C1Z A;  3H7S A;  4OVV A;  5CHW A;  2MBB B;  2O6V D;  3ZDT A;  1G6J A;  2BF8 B;  3DBL I;  3RUI B;  3UIO B;  3KUZ A;  4NPN A;  3B0A A;  2KFJ A;  4K1R B;  3VUY A;  3ZNH B;  4DHZ E;  3PRZ A;  4FN2 A;  4EZL A;  4ZRJ A;  1OQY A;  1RRB A;  1NDD A;  1Q0W B;  3RYT A;  2CS4 A;  3TJP A;  2R2O A;  2KZR A;  5D6J B;  3V6E B;  5JZE B;  5J2R A;  5DPT A;  3R3M A;  4HWI B;  4WJN A;  4DBG A;  2K8H A;  3ONS A;  4BKS D;  1E5W A;  2KJH B;  1ZGU B;  1IYF A;  3DCG A;  2DX5 B;  3QAQ A;  5J17 A;  2M8S A;  3PHW B;  4AWJ A;  2LVP A;  1WM2 A;  1Q5W B;  2Z0E B;  1LFD A;  2FAZ A;  1WY8 A;  2NBW B;  3AU5 A;  2DYO A;  2MX2 A;  2DYB A;  2O2V A;  2GOW A;  4GDK B;  4LDT B;  4EFO A;  2IY1 B;  5G55 A;  2KTR A;  2FUH B;  3L54 A;  3RUL A;  2M1M A;  3B1L X;  3IHP C;  4HDQ A;  2NS5 A;  4K81 A;  5IA7 A;  2ZNV B;  2KHW B;  1WGG A;  3PRM B;  1XQQ A;  2JWZ A;  4HPL B;  4PS7 A;  4W9I A;  4HVB A;  3VTU A;  3PRP B;  1WH3 A;  2KDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...