2N9EB

Structure of sumo-2 bound to phosphorylated rap80 sim
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRCA1-A complex subunit RAP80
publication title Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9eB01
4DDID 2DHZA 3QARA 4GMVA 3KH0A 1SE9A 1V86A 4GDLA 1MG8A 1ZW7A 2AEHA 4ANUA 2JPHA 4ICUA 3IG3A 3KVFB 4HPLB 2RD0A 3VTWA 2NCNA 1V2YA 3DVNV 4ICVA 5E6OA 3M62B 3A9KA 3DBSA 4M0WB 4PYZA 5AZHA 4GIVA 4DWFA 4FBJB 3VHTC 3KYDD 2FAZA 4BVUC 4MJSA 4FHJA 1WJNA 2C9WB 2IO3B 2XK5A 2DYBA 3DOWA 3IBEA 2IY1B 3N30A 4IM3A 2LI5A 2IO0B 4FULA 4GSWA 3ZIMA 1NI2A 1GJZA 1WJ4A 2KQ7A 3VTUA 4JQWC 3SHQA 1GC7A 2GOWA 2MBHA 3UINB 2D10A 3PLUA 3S2AA 1V81A 2O2VA 4GXBA 4K81A 5DPTA 4BKSA 2N1VA 2J0KA 3PZDA 2CKHB 2KNBA 3M63B 2LXCA 4GB9A 4BKSD 4BFRA 2KC2A 4HDQA 4X57B 2JRIB 5IA7A 2GMIC 2J0MA 3VTVA 1Z2MA 2NS5A 3ZRCA 2KN5A 2XBBC 3L08A 3NZSA 2AL6A 4NJ7A 4E71A 2KHWB 2KWCA 3NHEB 2K8HA 1JRUA 2WX0A 1V6EA 2RSUA 3U8ZA 2JZZA 2ZPYA 4EFOA 3P2BA 5BO4B 2K1FA 2LVOA 3DVGX 4PS8A 3L0WB 2N4FA 4WJNA 3T8MA 1IYFA 2YVCA 3QA8A 2K8CA 2WYQA 2Z59B 1P0RA 2JT4B 3X0WA 4EUTA 3PGEA 1P9DU 2K8BA 2XEWA 2KO3A 2MLBA 2LASA 3RULA 3DPDA 2CHWA 2IY0B 3CMMB 3TMPB 3QQ8B 1J19A 2UWQA 4HK2A 4RM8A 3H9DA 1V5OA 4WJQA 3PRZA 4WWNA 2GBMA 5GMVA 5AZGA 1WE6A 1E8WA 2IYDB 4HLEA 1Y8RC 4W9KA 4W9CA 3ZDTA 4IW0A 4YL8A 4W9LA 2Y5BB 2ZNVB 1IP9A 1GUAB 2G45B 5AZFA 4I6PA 4KIKB 1YJ1A 1WF9A 4I6LB 3BY4B 4XZ4A 2KFJA 3VDZA 2L00B 4K7SA 2BPSA 2JVCA 3OLMD 3H6NA 2NR2A 1L7YA 2J0JA 4NPNA 5TR5A 3W1SA 4EZJA 1R4NI 2KZRA 1WJ6A 3HM6X 4IM2A 3AULA 2KFKB 2K25A 3DCGA 4HPMB 4ANWA 3JSVB 4N9F4 5D6JB 3AU4A 5J2RA 3RD2A 4FLHA 4ZRKA 4XX5A 2WX1A 1X1MA 2DZIA 4NY0A 1I42A 3OAWA 3QIJA 2XK5B 3WAPA 2CHXA 1SIFA 2L3ZA 4B6WA 1YD8U 5JHBA 4A3PA 2ZVNA 4JIOU 4KDLB 3VVWB 1WR6E 2HD5B 2KVRA 3BINA 3C0RB 4WJPA 2LWPA 2QHOA 1XD3B 4LCDE 1J8CA 4FA6A 2ZEQA 1UBIA 4MELA 4KIKA 2IBIB 1ZKHA 3ZLZA 3IVFA 2DZJA 5JH5C 1OEYJ 2ZCBA 3JW0X 1UH6A 3HM3A 3QCAA 4KDIC 1V49A 1LXDA 4IWOA 2KMCA 1C3TA 2PE6B 2FCQA 2DYMA 4JGHB 2PPHA 2Z0EB 2KFKA 3L13A 3RZWC 2MSED 3QX1A 4FJZA 3ZNZB 2ASQA 5KHQA 3JSVA 3PREA 1K8RB 3ML9A 2ZJDA 2M8SA 3QHTA 3EFUA 3NOBA 3VXWA 2KDBA 4E3CA 4G50A 2GBNA 3JVZX 1M94A 2KC1A 3NY5A 1WXSA 2JXXA 3QJZA 4LDTB 4LJPB 3H7PA 4ZYNA 3RYTA 3TIXA 4PS7A 3IFWB 1EO6A 2WDTB 2W9NA 4I6NB 4MSQB 2M4NA 2JUOA 5DPRA 3T9LA 2RGFA 2N9XA 3R7RA 2FNJB 3PVLA 3KYCD 1T0YA 1VCBA 5LXIB 2RR9A 3R3MA 2D3GA 3Q3FA 5CHFA 1E8YA 3UGBB 3CSFA 4IWQA 1YX6B 4HXDA 2B3AA 2DZMA 4G0NB 4GU2A 4W9JA 4WAAA 1TBEA 2HE7A 2NBVB 3OJ3A 1KJTA 3R66C 3PSEB 4TKNA 5JHAA 1KLVA 3L10B 2LVPA 3H1UA 4FADA 4MH0E 3UIPB 3K9OB 2KLCA 2LD9A 1LQBA 4HCPB 1WM2A 3GOEA 1RFAA 1BT0A 2C7NB 1E90A 5L83A 4B95A 1RAXA 1VD2A 1WGRA 3ZNGC 5D2MB 2KKCA 2NPTB 3U7DA 4GDKA 2CS4A 3LDZE 4LDTD 3R7QA 3ZO5B 4NJ6A 3VH3B 2YLMA 4EEWA 1WR1A 2M0XA 2FCMA 3ZNID 3V62A 2LVQA 4FJYA 1A5RA 3PHWB 2EKEC 2IO1B 5DCNA 4OVUA 4W9EA 1V80A 4ZDVA 5HKHA 4II3B 3ZTCA 3V60A 4W9GA 2MRPA 4IM0A 5CHVC 4ANVA 1WGHA 1V9JA 5DPSA 1D3ZA 1WI0A 2D2QA 4IG7B 3ZKJC 1OQYA 3QAQA 3WA0A 1UELA 2DZKA 2M1MA 1WXMA 1YIWA 3VQIA 2DAFA 1Q0WB 4E74A 2PE9A 3W1SC 2UYZB 4AJWA 4DHZB 4K7UA 2L0TA 2IO2B 4G3XB 2GBRA 1OGWA 3PLVA 3V61A 3PPAA 4TQ1A 2KK8A 4MDKE 4NNJB 4HJKA 2FCSA 4MGKE 4IWPA 2OOBB 3WALA 2NPTA 1C1YB 2BKFA 2HTHA 2BWES 3QWZB 5KHOA 1E5WA 2JWZA 2K6QA 2LJ5A 1TTNA 3B08A 3GZNI 5D94A 1P3QU 2KJHB 3HHMA 3VUWA 2D07B 2FIDA 5J17A 2LRUA 2K6DB 4EKUA 1WX9A 3ZVVA 2LRWA 3A4SC 3H7PB 4GOCA 5IAAC 4HVBA 1RLFA 2JF5A 3VAWA 2NBWB 1UD7A 1WXVA 1XQQA 3APFA 3EECA 4HCNB 1GG3A 4KVGB 4MGIE 5FR6A 3VUYA 4DK5A 4B9KA 4BBNF 2NVUI 1EUVB 3NZUA 2G4DB 2ZNVC 3I3TB 5C1ZA 4DHJB 2KJ6A 5D7GA 3SDLC 2REXA 4JL9A 1U4AA 1UGMA 4EZKA 4BOSC 4AP4C 2N7EA 2KXJA 4IC7B 5E6PA 2KD0A 2DX5B 3SD5A 1E7UA 2MBOA 2Z0DB 2N7DA 3PT2B 1L2NA 1TZ1A 3B0AA 4AWJA 4WWOA 2IZVB 4ANXA 1UBQA 3MJWA 1YX5B 2KOXA 2CR5A 5G55A 1E7VA 2R2OA 4DXAB 1FXTB 4XC2A 2MQJA 4LJOB 4DBGA 4FHKA 2MBQA 4BKGA 3UF8A 3WIMA 4A3OA 4F1SA 1WM3A 2KANA 2O6VB 2MCNB 1CMXB 2L76A 1WIAA 1WMHA 1GNUA 2FUHB 2KWUB 4CO7A 1WJUA 2RPQA 2FCNA 4GDKB 4P7IA 2D11A 3H7SA 2L05A 2A4ZA 2BWFA 2MBBB 4K1RB 2DENB 3A9JB 2G4SA 2KMAA 1R4MI 3HK0A 2EMTA 2LGYA 3TBLD 3VH4B 3PV1A 1GC6A 2KDIA 3CF6E 4F8CB 1XT9B 3PRPB 1WY8A 4OVVA 3WAMA 2A5UA 4FJVB 2MBEA 3V6EB 4DHJD 2C7HA 1J0GA 2KWVB 3Q3JA 3ZDMC 4GGQA 5CX3A 2GBKA 4AOFA 2AYOB 2MP2A 2ZCCA 3HIZA 4M8MA 2KTFA 4NAWB 4MSMB 2AL3A 4A20A 2KQSA 2KJRA 1Z5SB 2I1JA 2L7RA 3APDA 4II2B 1KM7A 3MHSD 2LZ6A 3PTFC 3L54A 2KLGA 1Q1OA 3AI5A 3ALBA 3ZUNA 4KV2A 5L95C 4TQ0A 3UIOB 2BF8B 1WYWB 4BKTA 4NQKE 2I1KA 3L16A 2LUEA 2WWZA 2BYVE 3WAOA 5DPWA 1ZGUB 2O6VA 2LGDA 2MWSB 2C5LC 4DHZE 3TCAA 2BGFA 1WFYA 2V1YA 4KZ0A 4ZRIA 3WANA 4NQLB 5JZEB 2O6VD 1ISNA 4KZCA 1I35A 5CHWA 2KTRB 4F7ZA 1WX7A 2L8JA 1UZXB 3A9JA 3ONSA 4W9HA 1Q5WB 2CU1A 2NBUA 1F9JA 2JRHA 4HWIB 4BBNC 2PJHA 3QK0A 3KUCB 3DBLI 2BYEA 3DVGY 4NAWA 1NBFC 4PS3A 2N9PC 3VUXA 3QC8B 2BKRB 2M17A 4AJYB 1SGHA 3O65B 3DBRI 3KW5B 4G11A 1S3SG 1WRDB 3M95A 2DAJA 3D32A 3UQBA 3KUZA 3ML8A 1WX8A 5LXHA 2ZZPB 3OJ4B 3X23A 3N3KB 3B1LX 1WGYA 4W9DA 2K39A 5AEKB 3ZRFA 1TGZB 2C7MB 1G6JA 1P1AA 1E8ZA 4PYUA 2KDEB 1HE8A 1H8CA 1P98A 2LXAA 3M3JA 4RMAA 4RM9A 4AUQC 4FN2A 4CHKA 3ZTDA 2KX3A 3U30A 1OEYA 1WXAA 4W9FA 3EC8A 4JLCA 2C60A 2KTRA 4ASWC 1OTRB 4HDOA 2V3SA 3EHVA 1V5TA 5CTRC 2MX2A 3RCZA 1WMHB 4MM3A 4GN1A 2L0FA 3APCA 1RRBA 3A33B 2EMSA 2MA9B 2DYOA 3ZW3A 2KDFB 3PRMB 4WWPA 4ZRJA 5G2NA 3W1YA 4IUMB 1S1QB 3A1QB 4TV3A 3ECIA 3TL5A 3SU8X 1E8XA 2BYFA 1EF5A 3AXCA 2JY6A 3MTNB 3N32A 3RUIB 1KOTA 3AU5A 1LM8B 4GDLB 3DDCB 3KUDB 3DVNU 5EDSA 3CSTA 4M8NA 3RT3B 1QZEA 2GBJA 3A9KB 2V4LA 3ZNHB 2JZ3B 4EOYA 1PQSA 2MP2B 2VRRB 3L17A 4K7WA 3TJPA 3A4RA 4MJSB 4KSLC 2ZVOA 3PHXB 3JYUA 1WE7A 2PEAA 4W9IA 2LGXA 4CYEA 1WGDA 2ZPNA 5LLIA 3V6CB 1WZ0A 1NDDA 1YQBA 2CHZA 4WJOA 3DQVA 1EF1A 3ENEA 3NS8A 2G3QB 3VFKA 2AWTA 3UQAA 4WQOB 3IHPC 2FIFA 3PS6A 2O2VB 1WGGA 2HJ8A 1H4RA 2KX0A 2MW5A 5J18A 2N9EB 4MGYE 3RZFA 4DDGD 4URKA 1LFDA 1WH3A 4KSKC 1AARA 2N1WA 3K9PB 4EZLA 2R2QA 4J6IA 1IPGA 4MEMA 4MGZE 3A1QA 3LJ3A 3DBHI 2J7QB 1WZ3A 4TUUA 5E6NA 2OJRA 5C23A 4BOZB
chains in the Genus database with same CATH superfamily
4GMVA 1SE9A 5IP4D 1ZW7A 3VR9B 3IG3A 3KVFB 1A70A 3M62B 4M0WB 4PYZA 1PGXA 2LJIA 3NRZA 4FHJA 2IO3B 2DYBA 3DOWA 3ZIMA 2IO0B 4FULA 2VH1A 4MT5A 1GJZA 4JQWC 4OZBA 1VRAB 1GC7A 2GOWA 2I2YA 2JXTA 1V81A 5DPTA 4BKSA 1SB3C 3PZDA 2W54A 3M63B 5EE1A 4OHJA 4HDQA 1QOGA 2JRIB 5IA7A 1Z2MA 2KN5A 3BK2A 4US8A 2KWCA 4M0WA 4P6VF 4C00A 3P2BA 3DVGX 1HA5A 2YVCA 2IJ0A 2JT4B 5H8YE 2KO3A 2MLBA 3DPDA 1DOIA 2CHWA 2IY0B 1BMLC 3Q8FA 1EU4A 3DWGC 3GS2A 3PRZA 3NG0A 4HLEA 4W9KA 1WGKA 4C7YA 1GUAB 2BS4B 4KIKB 1WF9A 2Y3AA 1PGBA 2L00B 4K7SA 4C4VA 2NR2A 4DXGA 4N59A 2YEPF 1YOVB 3HM6X 1SEBD 4IM2A 2WXHA 4HPMB 3RD2A 4FLHA 4XX5A 1F0ZA 1FCCC 3QIJA 1GB1A 4B6WA 2QIEB 3P4RB 5MPOA 3LYYA 4A3PA 5JHBA 4KDLB 3C0RB 4KGSA 2QHOA 2BB6A 1J8CA 4FA6A 2ZEQA 4TSSA 4KIKA 2IBIB 1OEYJ 2B76B 5IO9A 2QMTA 1TKYA 1V49A 1LXDA 4IWOA 2KMCA 3L13A 2ZJDA 2M8SA 3QHTA 3VXWA 2KDBA 2BYTA 1M94A 1WXSA 4LJPB 1KTKA 2KWDA 3TIXA 4PS7A 1YJJA 3IFWB 4OW0A 1TS5A 2W82A 2WDTB 2BTEA 2FNJB 3KYCD 2D3GA 4HRSA 1VZ6A 2JSVX 4M02A 3UGBB 2GLSA 3CSFA 4AS1A 4HXDA 1E9MA 4W9JA 1C4CA 2Q5WD 1B1ZA 4TKNA 1D5MC 5JHAA 4RH6A 4JX1C 3L10B 4MH0E 2WXNA 2LD9A 4FXCA 1WM2A 2QEJC 2D3BA 3GOEA 4ZRQA 1RFAA 2WXIA 3ZNGC 2H88B 3EUB2 4GDKA 2DNFA 3R7QA 3VH3B 4REZA 2YLMA 4EEWA 3AE2B 3N9YC 1E0ZA 1A5RA 4OVUA 3V60A 2TSSA 2D2QA 3ZJUA 1OQYA 1TS2A 3WA0A 4L2YA 2L1AA 1KF6B 1YIWA 3BVMA 2DAFA 1Q0WB 4K7UA 2L0TA 4G3XB 3PLVA 1FNWA 4MDKE 4HJKA 2FCSA 1C9FA 4MGKE 1P7EA 3AEFB 2ZW0A 2HTHA 1I4PA 3NUHB 4A8XC 3B08A 2KJHB 3VUWA 2D07B 1I4XA 2K6DB 1WX9A 2LRWA 3A4SC 1GPXA 4KVGB 4S0RA 4JWSC 2ICIA 4BBNF 2NVUI 4OZAA 1YNTE 3I3TB 4DHJB 2INCC 2KJ6A 2L52A 5BYQA 4EZKA 2WXMA 2N7EA 4IC7B 3TSSA 2MBOA 2IZVB 1N61A 3P4QB 3MJWA 1TIFA 4M01A 4DXAB 2MQJA 1JWBD 2OHFA 4DBGA 4BKGA 1FM0D 3WIMA 2KQ4X 3IT4B 4WH4A 1WMHA 2KWUB 2GB1A 1FMAD 2OEDA 3MFGA 4P7IA 3VR8B 3Q6BA 1R4MI 2LGYA 3PV1A 1XT9B 3PRPB 1WY8A 1TJEA 2KWVB 5EDSA 5CX3A 2AYOB 2D3CA 3B2GA 4WQMA 4LNOA 4ZYSA 1PFDA 3APDA 3LB8C 1Q1OA 2PTLA 3AI5A 2KVZA 2AQ2B 2KYWA 2MJDA 2QCZA 5L95C 1C4AA 4TQ0A 5LNK1 3T3NA 3UIOB 1T0RC 1NYQA 3Q69A 1WYWB 1WSPA 2WLBA 4YXDB 2MWSB 2H89B 3MC0B 3SEBA 1WFYA 2WXPA 4NQLB 2O6VD 1K50A 1I35A 3IAM1 3ONSA 4HROA 1UF0A 4MM3B 2W3SA 2IPKD 2VH2A 4WURA 3GE3C 1F1HA 4HEA1 3GZNB 3N20C 4HKQA 1UWMA 3VUXA 4HJGE 2PW9A 4XWTA 2M17A 4G11A 3MJ5A 2HDEA 2INDC 3N3KB 4W9DA 3ZRFA 1MVKA 1TGZB 1G6JA 4PYUA 2KDEB 3ZTDA 1YMHE 1OEYA 4JLCA 2KAJA 2C60A 2M0AA 4HDOA 1R7SA 1QT9A 1EU3A 4RGOS 1V5TA 4MM3A 3AE4B 5FR3A 2DYOA 3E9SA 3ZW3A 2KDFB 3LXFA 1VLBA 1S1QB 3A1QB 1ROEA 3TL5A 4C56C 3MTNB 5HI1A 1ZE3D 3CSTA 1QZEA 3Q3NC 2GBJA 2JZ3B 2VRRB 2LGIA 3L17A 4RCOA 4K7WA 3TJPA 1CZPA 3A4RA 3PHXB 2G9HD 2LGXA 4CYEA 5LLIA 1WZ0A 1NDDA 3O13A 3DQVA 3ENEA 3NS8A 2G3QB 2AWTA 3UQAA 4O1NA 2BS3B 2EKIA 2LGSA 4LNNA 3PS6A 1WGGA 4RNAA 1H4RA 1D5ZC 1SE4A 1WH3A 2INPE 4GLSC 4EZLA 2R2QA 2AX5A 1YJIA 3Q3MC 4MGZE 3TEZA 3A1QA 4RGTA 3UF8A 4DDID 2JX5A 2DHZA 1K53A 3KH0A 3RNEC 2AEHA 4ANUA 4HPLB 3U52E 1N5WA 3DVNV 1V2YA 3VTWA 4ICVA 4FBJB 1ESFA 3KWVA 4BVUC 2C9WB 1FFVA 2XK5A 1IBXB 5AUIA 3DHIC 1NI2A 1WJ4A 1UWXA 1I4HA 4GXBA 4K81A 1FRDA 3AN1A 2N1VA 2J0KA 3AMZA 2CKHB 3EFCA 4GB9A 3P4SB 4X57B 1JALA 3SR6A 2FUG1 2RDHA 2AL6A 2K8HA 2WX0A 2RSUA 1BXTA 4EFOA 4NAMA 5BO4B 2CU3A 1IUEA 3L0WB 2N4FA 1IBXA 1IYFA 1P0RA 3X0WA 2ONQA 4EUTA 3PGEA 2M19A 2D3AA 1HQRD 4HK2A 3H9DA 4C80A 4WJQA 2IYDB 4YSZB 5HG2A 4W9CA 3ZDTA 4IW0A 4W9LA 2LEKA 2PVOD 1IP9A 4KKIA 2G45B 1GB4A 4I6LB 1AW7A 3BY4B 4XZ4A 1KFYB 1FRRA 2BPSA 3OLMD 1OFFA 1JQ4A 3IXSA 1R4NI 2KZRA 2V0GA 4WAFA 3RPFC 3AULA 2KFKB 4PK1A 2K25A 3DCGA 2NTSA 3JSVB 3AU4A 1X1MA 2DZIA 4US9A 4YTPB 1I42A 1TS4A 3WAPA 1SIFA 3CIRB 2HD5B 2KVRA 2LWPA 2SEBD 1Q10A 1ZP0B 2MH7A 4ZHPA 1UBIA 2LHEA 4MELA 2M56B 4BAXA 5JH5C 2WXFA 1AYFA 1TKGA 4KDIC 2FCQA 2DYMA 4JGHB 2KFKA 3ZNZB 5KHQA 1QOAA 3JSVA 3PREA 2CJNA 3ML9A 3PZ8A 4ZHOA 3NOBA 2R61A 2GBNA 5DPSA 1F2RI 4LDTB 2JXXA 3ZJTA 4K3BA 3H7PA 5C3JB 1WXQA 1YQ3B 5DPRA 3T9LA 1TT5B 3C8YA 4ARIA 3AH7A 2BW2A 1E8YA 4IWQA 1YX6B 4G0NB 4GU2A 3AM9A 1TBEA 4NZLB 2HE7A 2NBVB 5G5HA 1KJTA 1WWTA 3R2IA 4KGRA 2LVPA 2V9HA 4C4VB 2N9LA 5JXVA 1QKZA 1UGJA 1STEA 1SE3A 1NENB 5D2MB 2KKCA 1I4QA 3URYA 3ZO5B 4NJ6A 1WR1A 3V05A 2M0XA 2LVQA 4FJYA 1N6ZA 3PHWB 2EKEC 2IO1B 5DCNA 4W9GA 2INNE 1V9JA 1D3ZA 3KLSX 4IG7B 1C76A 4LNFA 1ET9A 1UELA 2EELA 3VQIA 1WXMA 1F52A 1VZ8A 4E74A 3W1SC 1YN5A 2GBRA 1NVID 3V61A 2DWQA 3W2DA 3MC9A 4IWPA 3U7ZA 1C1YB 2BKFA 5KHOA 2LJ5A 5D94A 4H2AA 2FIDA 4WWMA 1AN8A 3ZVVA 3HVZA 1QILA 4OVZA 4HVBA 5BYSA 2NBWB 1T0QC 3BVGA 4MGIE 3APFA 3VUYA 2RDGA 1LO5D 1ZXHA 4WIPA 3W5UB 4M00A 2JYEA 3C19A 3SDLC 5D7GA 2REXA 4IDIA 3I63C 1UGMA 2KACA 4L1BA 4BOSC 1N5XA 5E6PA 2KD0A 2DX5B 3SD5A 1XLNA 1L2NA 1UUPA 3B0AA 4AWJA 3P1MA 3HUIA 2L32A 1YX5B 5G55A 1E7VA 1FXTB 4S17A 1WM3A 2KANA 3B2FA 2RPQA 2QILA 2FCNA 4GDKB 3H7SA 1N63A 2A4ZA 2BWFA 3NJTA 1SXTA 2KMAA 2KMMA 2EMTA 3TBLD 1GC6A 3CF6E 5G5GA 4F8CB 4OVVA 2A5UA 2MBEA 1L5PA 1J0GA 2PIAA 4GGQA 1C4PA 2GBKA 2ZCCA 3HIZA 2KTFA 4A20A 1Z5SB 2JWUA 2I1JA 1KM7A 3BIID 3MHSD 3L54A 2KLGA 2XNAC 4KV2A 1XLQA 2IGDA 4A6QA 2LUEA 2WWZA 5DPWA 1ZGUB 3Q8AA 2C5LC 4DHZE 4ZOHC 2WGSA 4KZCA 3NS1A 1WX7A 2L8JA 1FXAA 4LTUA 2NBUA 5BMGA 1DOXA 4XGAB 4BBNC 3KUCB 1FFUA 4RFBA 3DBLI 1NBFC 4PS3A 2N9PC 4IKGA 1HXYD 2WDQB 1FD6A 3DBRI 1S3SG 1WRDB 3UQBA 3N1XC 3KUZA 5EE0A 3IAS1 3OJ4B 2N0SB 1WGYA 5AEKB 1V1OA 2C7MB 1I4GA 1E8ZA 3FC4A 2X8XX 1P98A 4RM9A 4AUQC 5D3IB 4CHKA 2KX3A 1SIJA 2MHJA 1WXAA 3EC8A 3BYTB 2V3SA 2QDFA 3RCZA 1WMHB 4GN1A 2BT6A 2L0FA 3APCA 3A33B 1WRIA 5G2NA 1EM7A 3RUIB 1KOTA 3AXCA 3W5VB 3AU5A 2X38A 3DDCB 3KUDB 1M4VA 3NVYA 3BZDB 4EOYA 2LFIA 2ZVOA 4W9IA 1WE7A 2PEAA 1R4MB 1WGDA 2CJOA 2ZPNA 1TZOA 1YQBA 2G1EA 3ETRA 2FIFA 2O2VB 2HJ8A 3NVWA 1FO4A 2MW5A 1IGCA 5J18A 4MGYE 4URKA 1LFDA 1AARA 4KGTA 1F2RC 3LJ3A 3DBHI 1WZ3A 3SHQA 5C23A 4ARCA 1XCTL 1MG8A 2JPHA 1D4BA 2NCNA 2PVGC 5E6OA 5AZHA 3L4PA 4DWFA 3VHTC 2FAZA 2RPVA 2YEPB 1WJNA 3IBEA 2IY1B 3DHHC 4IM3A 2LI5A 3P4PB 4GSWA 1T5XD 2D10A 1P7FA 2N9KA 3S2AA 2O2VA 2VZKB 3E56A 3RN9C 4YTNB 1L6UA 2KNBA 2LXCA 4BKSD 2GMIC 2HJ1A 2J0MA 3VTVA 1KH0A 2NS5A 4N58A 3ZRCA 1QQRA 3L08A 4UDUC 3NZSA 3P63A 3NHEB 3U8ZA 4TMAB 5EE3A 2PMVA 2K1FA 3T8MA 3EA6A 4LK0M 3QA8A 2K8CA 2WYQA 4NJCA 1P9DU 2K8BA 3RULA 3VRBB 1SJHD 5AUKA 3TMPB 3AV8A 3QQ8B 2UWQA 1V5OA 5GMVA 2GBMA 1XO3A 2Y5BB 1JROA 4I6PA 3ZYYX 1YJ1A 2Z8LA 3VRAB 4L23A 2KFJA 1AWDA 3VDZA 4CQNA 1SSNA 1DOYA 3W1SA 1L7YA 2J0JA 1QOFA 1E10A 1EWCA 4ANWA 1JMLA 4N9F4 5TSSA 4ZRKA 3ZQ4A 1ZXIA 2K22A 2LMCA 2WX1A 1DYQA 1HTOA 3OAWA 2XK5B 2MEKA 1YD8U 1T3QA 2ZVNA 1WR6E 4WJPA 1XEEA 1XD3B 1OQRA 2WS3B 4YT0B 4JE3B 1ZKHA 2NTTA 1EWYC 2V3NA 3SFDB 1NEKB 3NZ3A 2PE6B 2N7JA 2PPHA 2Z0EB 3RZWC 2MSED 3AE7B 3QX1A 4FJZA 2GRIA 1IGDA 2W3RA 4LLGM 4E3CA 3QJZA 2KC1A 3RYTA 4ZYNA 2JYTA 2W9NA 2RGFA 1KLGD 5EE9A 4Q2JA 5LXIB 2RR9A 3Q3FA 2WU5B 1F77A 1NYRA 5CHFA 1SF0A 1YN4A 1SE2A 2DZMA 4WAAA 1FPYA 4AQ7A 3PSEB 3Q8CA 1KLVA 1L0XB 1RM6C 3AB5A 4FADA 3UIPB 3K9OB 1VD2A 3AE9B 3LDZE 4A55A 2WXKA 2ON8A 4JPSA 2FCMA 1QOBA 1R4NB 2E3TA 1V80A 4ZDVA 5HKHA 3ZTCA 2BB5A 2IDYA 2MRPA 5CHVC 4ANVA 1HZ5A 1WGHA 1WI0A 3ZKJC 3QAQA 1HZ6A 3AECB 2DZKA 3FKYA 4ITKA 2UYZB 2IO2B 4R3DA 3PPAA 3R8BA 3FAHA 2RMMA 1L0VB 4N6EB 4XDDA 3Q3OC 4C7ZA 1KRHA 2OOBB 3WALA 4KKJA 3QWZB 1ZDXA 1E5WA 2WHIA 1FXIA 2BQQA 1N62A 3MP9A 4EKUA 5IAAC 3H7PB 2WDVB 3VAWA 4K3CA 4HCNB 1WXVA 1GG3A 1B9RA 1HTQA 1EUVB 3NZUA 1WYGA 2ZNVC 2JQRB 4RGMA 1U4AA 1TY2A 1E7UA 2Z0DB 3PT2B 1TZ1A 4WWOA 2WXLA 4ANXA 1D6EC 1UBQA 1Y56A 2KOXA 2R2OA 4XC2A 4KX6B 4LJOB 4FHKA 2MBQA 4A3OA 4F1SA 2O6VB 2L76A 1WIAA 1GNUA 2FUHB 4CO7A 5I4DA 1T0SC 3AEAB 4K1RB 2DENB 2I38A 4J3OD 3HK0A 3VH4B 2QSDA 3I5JC 2KDIA 1FIQA 3V6EB 2BS2B 4DHJD 3Q3JA 3ZDMC 4AOFA 2BBCA 2MP2A 4M8MA 2AL3A 2KQSA 2RDBC 1C78A 4II2B 3V3XA 2LZ6A 1C77A 1FNVA 3RNAC 3TEXA 1K51A 1V8CA 4IOIE 4BKTA 4NQKE 1L4DB 1J7AA 2BYVE 3WAOA 2O6VA 2LGDA 1VZ7A 2WXOA 1JRPA 2BGFA 4KZ0A 3WANA 5JZEB 1ISNA 2DBYA 2JU6X 1RWSA 5CHWA 2LUMA 1TS3A 2Y5CA 4W9HA 1Q5WB 2CU1A 2KT7A 1F9JA 2JRHA 3KWLA 4HWIB 5BMHA 2PJHA 1RYJA 3DVGY 1FEHA 4AJYB 3O65B 3KW5B 2AQ3B 2DAJA 3D32A 3NVVA 3ML8A 3Q2AC 1WX8A 2ZZPB 1CJEA 3AEEB 1H8CA 1HE8A 2LXAA 3M3JA 4A90A 4FN2A 3U30A 1MPEA 2VZKD 3AE1B 4W9FA 2WXQA 4ASWC 4P1BC 3EHVA 1ZDVA 1L6VA 2MX2A 1RRBA 1MHHE 2K5PA 3PRMB 3W1YA 4WWPA 4IUMB 1FNUA 4TV3A 2DLBA 3ECIA 1EF5A 2JY6A 1RFKA 4XDCA 1LM8B 4GDLB 2WXRA 1ENFA 4QAYA 5FKAC 3RT3B 3ZNHB 3A9KB 2V4LA 3BVZA 1C79A 4KSLC 4MJSB 3JYUA 1XF5L 2ACZB 3V6CB 5E6JA 2CHZA 4WJOA 3VFKA 3MC8A 4WQOB 3AE3B 1JWUD 1OQQA 1J7BA 4RF0A 3RZFA 4KSKC 2N1WA 4MEMA 2J7QB 4DK5A 3QARA 1V86A 3OG5A 4GDLA 1PDXA 4ICUA 2RD0A 3A9KA 3DBSA 4GIVA 3KYDD 4MJSA 1JWMD 3N30A 2UU7A 2KQ7A 3VTUA 3B9JA 1PYWD 2MBHA 3DBLB 3UINB 3PLUA 2OJWA 3ZJVA 1BUIC 4ACFA 1V1PB 3DBRB 4LNKA 4DXFA 4BFRA 2KC2A 4RGNA 3AEGB 2WP9B 2XBBC 4NJ7A 2K3UA 2KHWB 1JRUA 1V6EA 1LGRA 2JZZA 2ZPYA 1KLUD 2GI9A 2WXGA 1YN3A 2LVOA 4PS8A 4WJNA 4B0MA 2W55A 1QF6A 3WCQA 4YSXB 2Z59B 4MACA 4PT5A 2XEWA 1N60A 2LASA 1DGJA 3TUOA 3BWUD 3CMMB 1J19A 4RM8A 1V1PA 4B0EA 2V4IB 5T8IA 4WWNA 5AZGA 1WE6A 1E8WA 1K52A 1Y8RC 3AEBB 4YL8A 2ZNVB 5AZFA 4A9AA 1MFWA 1VJKA 4JWUC 2MJEA 2JVCA 3H6NA 4EZJA 3Q8BA 4NPNA 5TR5A 1WJ6A 5D6JB 2QJLA 5J2RA 3AE6B 2BVCA 1SJED 2NMQA 3DBHB 3ZXRA 4NY0A 2CHXA 2LHDA 2L3ZA 2IGHA 4JIOU 3RMKC 3VVWB 3BINA 5FK9C 4LCDE 2WDRB 3GB1A 1E6EB 2WXJA 3ZLZA 3KQ4A 3ABVB 2DZJA 2J4XA 2WU2B 3IVFA 1CQVA 2ZCBA 1YQ4B 3R2TA 3JW0X 1UH6A 3HM3A 3QCAA 1C3TA 3FILB 4XWWA 2ASQA 4HKZE 1K8RB 3EFUA 4G50A 2FE8A 3JVZX 3NY5A 1XLOA 1J7CA 1MJDA 3Q8EA 2K0PA 1EO6A 4I6NB 4MSQB 2M4NA 2JUOA 2K9XA 1I7HA 2N9XA 3R7RA 5IN7A 3PVLA 1T0YA 1VCBA 3R3MA 1I4RA 2B3AA 4YWGG 2J53A 4MH8A 2L83A 3OJ3A 3HRDD 2KN4A 3R66C 4YTMB 3PZ7A 3FILA 3H1UA 2KLCA 1LQBA 4HCPB 3GP7A 1BT0A 1JWAD 2E6XA 2C7NB 1E90A 1MI0A 5L83A 4B95A 1RAXA 1TY0A 1WGRA 3I9V1 1L0YB 2NPTB 3U7DA 2CS4A 2SAKA 4LDTD 2Y5PA 1D5XC 4OZCA 3ZNID 3V62A 3RFZB 1E7PB 2V3PA 4W9EA 4II3B 4IM0A 1QLBB 3GE8C 2MJ3A 1TYGB 3RNCC 3AE8B 3W9CB 2M1MA 4P1CC 2PE9A 4AJWA 4LNIA 4DHZB 2JZPA 3OWEB 1OGWA 4TQ1A 2KK8A 4NNJB 3TEYA 1JW9D 1XCQL 2NPTA 1PGAA 2BWES 2JWZA 2K6QA 1TTNA 3GZNI 1P3QU 3HHMA 5J17A 4YSYB 2LRUA 4GOCA 1RLFA 2JF5A 2J52A 4ZRPA 5BMIA 1UD7A 1XQQA 2WQYB 4E71A 3EECA 1CK1A 5FR6A 4B9KA 3CWIA 2G4DB 5C1ZA 5IOIA 1ET6A 4JL9A 3AEDB 4AP4C 2KXJA 3TEWA 2N7DA 1SBBB 4DQOC 2CR5A 1PUTA 2FBWB 1GAQB 2MCNB 1CMXB 3U2SC 5GXGB 1WJUA 5BYRA 2D11A 2L05A 3NVZA 2MBBB 1NI3A 3A9JB 2G4SA 3SFEB 4BZAA 2ZW1A 3WAMA 4FJVB 1GOZA 2C7HA 3UI3A 2IGGA 4NAWB 4MSMB 4D2KA 2KJRA 2L7RA 3HVDA 3PTFC 3J9CA 3ALBA 3ZUNA 3P42A 2BF8B 3ZGZA 1ZOYB 2I1KA 3L16A 1JWSD 2PKOA 3H8HA 3AE5B 1UNSA 1HEZE 3TCAA 2V1YA 4ZRIA 1L4ZB 2WNMA 2KTRB 4F7ZA 1UZXB 3A9JA 4XYCA 3ZXVA 2AQ1B 2XN9C 1MG4A 5HHDG 1FCLA 3QK0A 3BYYB 1MHXA 2BYEA 5C2TB 4NAWA 1JCKB 3QC8B 3DWMA 2BKRB 1SGHA 3M95A 3PO0A 5LXHA 4RF1A 3RI7C 3X23A 3I57A 3B1LX 2K39A 2PLPA 1P1AA 1ACCA 3T3OA 1ZPSA 4RMAA 1VDVA 2KDMA 3EGRA 5HFYA 5D3DA 2KTRA 1V97A 1OTRB 5H92C 3N1YC 1T6BX 4HPPA 2HTME 5CTRC 1VR9A 2EMSA 2MA9B 4USAA 4ZRJA 3BK1A 3MHZA 1E8XA 2BYFA 3N32A 4P16A 3SU8X 5IKCM 2J42A 3DVNU 4M8NA 4EE2A 3RNBC 3DHGC 1PQSA 2MP2B 4XE0A 1TKEA 1EF1A 3IT6B 3IHPC 3Q14C 3U4EG 1XXGA 3RNFC 2KX0A 3N1ZC 2N9EB 1XLPA 2D5GA 4DDGD 1ZUD2 3RNGC 3K9PB 4J6IA 1IPGA 2QC8A 4TUUA 5E6NA 2OJRA 4BOZB
chains in the Genus database with same CATH topology
4DDID 2DHZA 3QARA 4GMVA 3KH0A 1SE9A 1V86A 4GDLA 1MG8A 1ZW7A 2AEHA 4ANUA 2JPHA 4ICUA 3IG3A 3KVFB 4HPLB 2RD0A 3VTWA 2NCNA 1V2YA 3DVNV 4ICVA 5E6OA 3M62B 3A9KA 3DBSA 4M0WB 4PYZA 5AZHA 4GIVA 4DWFA 4FBJB 3VHTC 3KYDD 2FAZA 4BVUC 4MJSA 4FHJA 1WJNA 2C9WB 2IO3B 2XK5A 2DYBA 3DOWA 3IBEA 2IY1B 3N30A 4IM3A 2LI5A 2IO0B 4FULA 4GSWA 3ZIMA 1NI2A 1GJZA 1WJ4A 2KQ7A 3VTUA 4JQWC 3SHQA 1GC7A 2GOWA 2MBHA 3UINB 2D10A 3PLUA 3S2AA 1V81A 2O2VA 4GXBA 4K81A 5DPTA 4BKSA 2N1VA 2J0KA 3PZDA 2CKHB 2KNBA 3M63B 2LXCA 4GB9A 4BKSD 4BFRA 2KC2A 4HDQA 4X57B 2JRIB 5IA7A 2GMIC 2J0MA 3VTVA 1Z2MA 2NS5A 3ZRCA 2KN5A 2XBBC 3L08A 3NZSA 2AL6A 4NJ7A 4E71A 2KHWB 2KWCA 3NHEB 2K8HA 1JRUA 2WX0A 1V6EA 2RSUA 3U8ZA 2JZZA 2ZPYA 4EFOA 3P2BA 5BO4B 2K1FA 2LVOA 3DVGX 4PS8A 3L0WB 2N4FA 4WJNA 3T8MA 1IYFA 2YVCA 3QA8A 2K8CA 2WYQA 2Z59B 1P0RA 2JT4B 3X0WA 4EUTA 3PGEA 1P9DU 2K8BA 2XEWA 2KO3A 2MLBA 2LASA 3RULA 3DPDA 2CHWA 2IY0B 3CMMB 3TMPB 3QQ8B 1J19A 2UWQA 4HK2A 4RM8A 3H9DA 1V5OA 4WJQA 3PRZA 4WWNA 2GBMA 5GMVA 5AZGA 1WE6A 1E8WA 2IYDB 4HLEA 1Y8RC 4W9KA 4W9CA 3ZDTA 4IW0A 4YL8A 4W9LA 2Y5BB 2ZNVB 1IP9A 1GUAB 2G45B 5AZFA 4I6PA 4KIKB 1YJ1A 1WF9A 4I6LB 3BY4B 4XZ4A 2KFJA 3VDZA 2L00B 4K7SA 2BPSA 2JVCA 3OLMD 3H6NA 2NR2A 1L7YA 2J0JA 4NPNA 5TR5A 3W1SA 4EZJA 1R4NI 2KZRA 1WJ6A 3HM6X 4IM2A 3AULA 2KFKB 2K25A 3DCGA 4HPMB 4ANWA 3JSVB 4N9F4 5D6JB 3AU4A 5J2RA 3RD2A 4FLHA 4ZRKA 4XX5A 2WX1A 1X1MA 2DZIA 4NY0A 1I42A 3OAWA 3QIJA 2XK5B 3WAPA 2CHXA 1SIFA 2L3ZA 4B6WA 1YD8U 5JHBA 4A3PA 2ZVNA 4JIOU 4KDLB 3VVWB 1WR6E 2HD5B 2KVRA 3BINA 3C0RB 4WJPA 2LWPA 2QHOA 1XD3B 4LCDE 1J8CA 4FA6A 2ZEQA 1UBIA 4MELA 4KIKA 2IBIB 1ZKHA 3ZLZA 3IVFA 2DZJA 5JH5C 1OEYJ 2ZCBA 3JW0X 1UH6A 3HM3A 3QCAA 4KDIC 1V49A 1LXDA 4IWOA 2KMCA 1C3TA 2PE6B 2FCQA 2DYMA 4JGHB 2PPHA 2Z0EB 2KFKA 3L13A 3RZWC 2MSED 3QX1A 4FJZA 3ZNZB 2ASQA 5KHQA 3JSVA 3PREA 1K8RB 3ML9A 2ZJDA 2M8SA 3QHTA 3EFUA 3NOBA 3VXWA 2KDBA 4E3CA 4G50A 2GBNA 3JVZX 1M94A 2KC1A 3NY5A 1WXSA 2JXXA 3QJZA 4LDTB 4LJPB 3H7PA 4ZYNA 3RYTA 3TIXA 4PS7A 3IFWB 1EO6A 2WDTB 2W9NA 4I6NB 4MSQB 2M4NA 2JUOA 5DPRA 3T9LA 2RGFA 2N9XA 3R7RA 2FNJB 3PVLA 3KYCD 1T0YA 1VCBA 5LXIB 2RR9A 3R3MA 2D3GA 3Q3FA 5CHFA 1E8YA 3UGBB 3CSFA 4IWQA 1YX6B 4HXDA 2B3AA 2DZMA 4G0NB 4GU2A 4W9JA 4WAAA 1TBEA 2HE7A 2NBVB 3OJ3A 1KJTA 3R66C 3PSEB 4TKNA 5JHAA 1KLVA 3L10B 2LVPA 3H1UA 4FADA 4MH0E 3UIPB 3K9OB 2KLCA 2LD9A 1LQBA 4HCPB 1WM2A 3GOEA 1RFAA 1BT0A 2C7NB 1E90A 5L83A 4B95A 1RAXA 1VD2A 1WGRA 3ZNGC 5D2MB 2KKCA 2NPTB 3U7DA 4GDKA 2CS4A 3LDZE 4LDTD 3R7QA 3ZO5B 4NJ6A 3VH3B 2YLMA 4EEWA 1WR1A 2M0XA 2FCMA 3ZNID 3V62A 2LVQA 4FJYA 1A5RA 3PHWB 2EKEC 2IO1B 5DCNA 4OVUA 4W9EA 1V80A 4ZDVA 5HKHA 4II3B 3ZTCA 3V60A 4W9GA 2MRPA 4IM0A 5CHVC 4ANVA 1WGHA 1V9JA 5DPSA 1D3ZA 1WI0A 2D2QA 4IG7B 3ZKJC 1OQYA 3QAQA 3WA0A 1UELA 2DZKA 2M1MA 1WXMA 1YIWA 3VQIA 2DAFA 1Q0WB 4E74A 2PE9A 3W1SC 2UYZB 4AJWA 4DHZB 4K7UA 2L0TA 2IO2B 4G3XB 2GBRA 1OGWA 3PLVA 3V61A 3PPAA 4TQ1A 2KK8A 4MDKE 4NNJB 4HJKA 2FCSA 4MGKE 4IWPA 2OOBB 3WALA 2NPTA 1C1YB 2BKFA 2HTHA 2BWES 3QWZB 5KHOA 1E5WA 2JWZA 2K6QA 2LJ5A 1TTNA 3B08A 3GZNI 5D94A 1P3QU 2KJHB 3HHMA 3VUWA 2D07B 2FIDA 5J17A 2LRUA 2K6DB 4EKUA 1WX9A 3ZVVA 2LRWA 3A4SC 3H7PB 4GOCA 5IAAC 4HVBA 1RLFA 2JF5A 3VAWA 2NBWB 1UD7A 1WXVA 1XQQA 3APFA 3EECA 4HCNB 1GG3A 4KVGB 4MGIE 5FR6A 3VUYA 4DK5A 4B9KA 4BBNF 2NVUI 1EUVB 3NZUA 2G4DB 2ZNVC 3I3TB 5C1ZA 4DHJB 2KJ6A 5D7GA 3SDLC 2REXA 4JL9A 1U4AA 1UGMA 4EZKA 4BOSC 4AP4C 2N7EA 2KXJA 4IC7B 5E6PA 2KD0A 2DX5B 3SD5A 1E7UA 2MBOA 2Z0DB 2N7DA 3PT2B 1L2NA 1TZ1A 3B0AA 4AWJA 4WWOA 2IZVB 4ANXA 1UBQA 3MJWA 1YX5B 2KOXA 2CR5A 5G55A 1E7VA 2R2OA 4DXAB 1FXTB 4XC2A 2MQJA 4LJOB 4DBGA 4FHKA 2MBQA 4BKGA 3UF8A 3WIMA 4A3OA 4F1SA 1WM3A 2KANA 2O6VB 2MCNB 1CMXB 2L76A 1WIAA 1WMHA 1GNUA 2FUHB 2KWUB 4CO7A 1WJUA 2RPQA 2FCNA 4GDKB 4P7IA 2D11A 3H7SA 2L05A 2A4ZA 2BWFA 2MBBB 4K1RB 2DENB 3A9JB 2G4SA 2KMAA 1R4MI 3HK0A 2EMTA 2LGYA 3TBLD 3VH4B 3PV1A 1GC6A 2KDIA 3CF6E 4F8CB 1XT9B 3PRPB 1WY8A 4OVVA 3WAMA 2A5UA 4FJVB 2MBEA 3V6EB 4DHJD 2C7HA 1J0GA 2KWVB 3Q3JA 3ZDMC 4GGQA 5CX3A 2GBKA 4AOFA 2AYOB 2MP2A 2ZCCA 3HIZA 4M8MA 2KTFA 4NAWB 4MSMB 2AL3A 4A20A 2KQSA 2KJRA 1Z5SB 2I1JA 2L7RA 3APDA 4II2B 1KM7A 3MHSD 2LZ6A 3PTFC 3L54A 2KLGA 1Q1OA 3AI5A 3ALBA 3ZUNA 4KV2A 5L95C 4TQ0A 3UIOB 2BF8B 1WYWB 4BKTA 4NQKE 2I1KA 3L16A 2LUEA 2WWZA 2BYVE 3WAOA 5DPWA 1ZGUB 2O6VA 2LGDA 2MWSB 2C5LC 4DHZE 3TCAA 2BGFA 1WFYA 2V1YA 4KZ0A 4ZRIA 3WANA 4NQLB 5JZEB 2O6VD 1ISNA 4KZCA 1I35A 5CHWA 2KTRB 4F7ZA 1WX7A 2L8JA 1UZXB 3A9JA 3ONSA 4W9HA 1Q5WB 2CU1A 2NBUA 1F9JA 2JRHA 4HWIB 4BBNC 2PJHA 3QK0A 3KUCB 3DBLI 2BYEA 3DVGY 4NAWA 1NBFC 4PS3A 2N9PC 3VUXA 3QC8B 2BKRB 2M17A 4AJYB 1SGHA 3O65B 3DBRI 3KW5B 4G11A 1S3SG 1WRDB 3M95A 2DAJA 3D32A 3UQBA 3KUZA 3ML8A 1WX8A 5LXHA 2ZZPB 3OJ4B 3X23A 3N3KB 3B1LX 1WGYA 4W9DA 2K39A 5AEKB 3ZRFA 1TGZB 2C7MB 1G6JA 1P1AA 1E8ZA 4PYUA 2KDEB 1HE8A 1H8CA 1P98A 2LXAA 3M3JA 4RMAA 4RM9A 4AUQC 4FN2A 4CHKA 3ZTDA 2KX3A 3U30A 1OEYA 1WXAA 4W9FA 3EC8A 4JLCA 2C60A 2KTRA 4ASWC 1OTRB 4HDOA 2V3SA 3EHVA 1V5TA 5CTRC 2MX2A 3RCZA 1WMHB 4MM3A 4GN1A 2L0FA 3APCA 1RRBA 3A33B 2EMSA 2MA9B 2DYOA 3ZW3A 2KDFB 3PRMB 4WWPA 4ZRJA 5G2NA 3W1YA 4IUMB 1S1QB 3A1QB 4TV3A 3ECIA 3TL5A 3SU8X 1E8XA 2BYFA 1EF5A 3AXCA 2JY6A 3MTNB 3N32A 3RUIB 1KOTA 3AU5A 1LM8B 4GDLB 3DDCB 3KUDB 3DVNU 5EDSA 3CSTA 4M8NA 3RT3B 1QZEA 2GBJA 3A9KB 2V4LA 3ZNHB 2JZ3B 4EOYA 1PQSA 2MP2B 2VRRB 3L17A 4K7WA 3TJPA 3A4RA 4MJSB 4KSLC 2ZVOA 3PHXB 3JYUA 1WE7A 2PEAA 4W9IA 2LGXA 4CYEA 1WGDA 2ZPNA 5LLIA 3V6CB 1WZ0A 1NDDA 1YQBA 2CHZA 4WJOA 3DQVA 1EF1A 3ENEA 3NS8A 2G3QB 3VFKA 2AWTA 3UQAA 4WQOB 3IHPC 2FIFA 3PS6A 2O2VB 1WGGA 2HJ8A 1H4RA 2KX0A 2MW5A 5J18A 2N9EB 4MGYE 3RZFA 4DDGD 4URKA 1LFDA 1WH3A 4KSKC 1AARA 2N1WA 3K9PB 4EZLA 2R2QA 4J6IA 1IPGA 4MEMA 4MGZE 3A1QA 3LJ3A 3DBHI 2J7QB 1WZ3A 4TUUA 5E6NA 2OJRA 5C23A 4BOZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DDI D;  2DHZ A;  3QAR A;  4GMV A;  3KH0 A;  1SE9 A;  1V86 A;  4GDL A;  1MG8 A;  1ZW7 A;  2AEH A;  4ANU A;  2JPH A;  4ICU A;  3IG3 A;  3KVF B;  4HPL B;  2RD0 A;  3VTW A;  2NCN A;  1V2Y A;  3DVN V;  4ICV A;  5E6O A;  3M62 B;  3A9K A;  3DBS A;  4M0W B;  4PYZ A;  5AZH A;  4GIV A;  4DWF A;  4FBJ B;  3VHT C;  3KYD D;  2FAZ A;  4BVU C;  4MJS A;  4FHJ A;  1WJN A;  2C9W B;  2IO3 B;  2XK5 A;  2DYB A;  3DOW A;  3IBE A;  2IY1 B;  3N30 A;  4IM3 A;  2LI5 A;  2IO0 B;  4FUL A;  4GSW A;  3ZIM A;  1NI2 A;  1GJZ A;  1WJ4 A;  2KQ7 A;  3VTU A;  4JQW C;  3SHQ A;  1GC7 A;  2GOW A;  2MBH A;  3UIN B;  2D10 A;  3PLU A;  3S2A A;  1V81 A;  2O2V A;  4GXB A;  4K81 A;  5DPT A;  4BKS A;  2N1V A;  2J0K A;  3PZD A;  2CKH B;  2KNB A;  3M63 B;  2LXC A;  4GB9 A;  4BKS D;  4BFR A;  2KC2 A;  4HDQ A;  4X57 B;  2JRI B;  5IA7 A;  2GMI C;  2J0M A;  3VTV A;  1Z2M A;  2NS5 A;  3ZRC A;  2KN5 A;  2XBB C;  3L08 A;  3NZS A;  2AL6 A;  4NJ7 A;  4E71 A;  2KHW B;  2KWC A;  3NHE B;  2K8H A;  1JRU A;  2WX0 A;  1V6E A;  2RSU A;  3U8Z A;  2JZZ A;  2ZPY A;  4EFO A;  3P2B A;  5BO4 B;  2K1F A;  2LVO A;  3DVG X;  4PS8 A;  3L0W B;  2N4F A;  4WJN A;  3T8M A;  1IYF A;  2YVC A;  3QA8 A;  2K8C A;  2WYQ A;  2Z59 B;  1P0R A;  2JT4 B;  3X0W A;  4EUT A;  3PGE A;  1P9D U;  2K8B A;  2XEW A;  2KO3 A;  2MLB A;  2LAS A;  3RUL A;  3DPD A;  2CHW A;  2IY0 B;  3CMM B;  3TMP B;  3QQ8 B;  1J19 A;  2UWQ A;  4HK2 A;  4RM8 A;  3H9D A;  1V5O A;  4WJQ A;  3PRZ A;  4WWN A;  2GBM A;  5GMV A;  5AZG A;  1WE6 A;  1E8W A;  2IYD B;  4HLE A;  1Y8R C;  4W9K A;  4W9C A;  3ZDT A;  4IW0 A;  4YL8 A;  4W9L A;  2Y5B B;  2ZNV B;  1IP9 A;  1GUA B;  2G45 B;  5AZF A;  4I6P A;  4KIK B;  1YJ1 A;  1WF9 A;  4I6L B;  3BY4 B;  4XZ4 A;  2KFJ A;  3VDZ A;  2L00 B;  4K7S A;  2BPS A;  2JVC A;  3OLM D;  3H6N A;  2NR2 A;  1L7Y A;  2J0J A;  4NPN A;  5TR5 A;  3W1S A;  4EZJ A;  1R4N I;  2KZR A;  1WJ6 A;  3HM6 X;  4IM2 A;  3AUL A;  2KFK B;  2K25 A;  3DCG A;  4HPM B;  4ANW A;  3JSV B;  4N9F 4;  5D6J B;  3AU4 A;  5J2R A;  3RD2 A;  4FLH A;  4ZRK A;  4XX5 A;  2WX1 A;  1X1M A;  2DZI A;  4NY0 A;  1I42 A;  3OAW A;  3QIJ A;  2XK5 B;  3WAP A;  2CHX A;  1SIF A;  2L3Z A;  4B6W A;  1YD8 U;  5JHB A;  4A3P A;  2ZVN A;  4JIO U;  4KDL B;  3VVW B;  1WR6 E;  2HD5 B;  2KVR A;  3BIN A;  3C0R B;  4WJP A;  2LWP A;  2QHO A;  1XD3 B;  4LCD E;  1J8C A;  4FA6 A;  2ZEQ A;  1UBI A;  4MEL A;  4KIK A;  2IBI B;  1ZKH A;  3ZLZ A;  3IVF A;  2DZJ A;  5JH5 C;  1OEY J;  2ZCB A;  3JW0 X;  1UH6 A;  3HM3 A;  3QCA A;  4KDI C;  1V49 A;  1LXD A;  4IWO A;  2KMC A;  1C3T A;  2PE6 B;  2FCQ A;  2DYM A;  4JGH B;  2PPH A;  2Z0E B;  2KFK A;  3L13 A;  3RZW C;  2MSE D;  3QX1 A;  4FJZ A;  3ZNZ B;  2ASQ A;  5KHQ A;  3JSV A;  3PRE A;  1K8R B;  3ML9 A;  2ZJD A;  2M8S A;  3QHT A;  3EFU A;  3NOB A;  3VXW A;  2KDB A;  4E3C A;  4G50 A;  2GBN A;  3JVZ X;  1M94 A;  2KC1 A;  3NY5 A;  1WXS A;  2JXX A;  3QJZ A;  4LDT B;  4LJP B;  3H7P A;  4ZYN A;  3RYT A;  3TIX A;  4PS7 A;  3IFW B;  1EO6 A;  2WDT B;  2W9N A;  4I6N B;  4MSQ B;  2M4N A;  2JUO A;  5DPR A;  3T9L A;  2RGF A;  2N9X A;  3R7R A;  2FNJ B;  3PVL A;  3KYC D;  1T0Y A;  1VCB A;  5LXI B;  2RR9 A;  3R3M A;  2D3G A;  3Q3F A;  5CHF A;  1E8Y A;  3UGB B;  3CSF A;  4IWQ A;  1YX6 B;  4HXD A;  2B3A A;  2DZM A;  4G0N B;  4GU2 A;  4W9J A;  4WAA A;  1TBE A;  2HE7 A;  2NBV B;  3OJ3 A;  1KJT A;  3R66 C;  3PSE B;  4TKN A;  5JHA A;  1KLV A;  3L10 B;  2LVP A;  3H1U A;  4FAD A;  4MH0 E;  3UIP B;  3K9O B;  2KLC A;  2LD9 A;  1LQB A;  4HCP B;  1WM2 A;  3GOE A;  1RFA A;  1BT0 A;  2C7N B;  1E90 A;  5L83 A;  4B95 A;  1RAX A;  1VD2 A;  1WGR A;  3ZNG C;  5D2M B;  2KKC A;  2NPT B;  3U7D A;  4GDK A;  2CS4 A;  3LDZ E;  4LDT D;  3R7Q A;  3ZO5 B;  4NJ6 A;  3VH3 B;  2YLM A;  4EEW A;  1WR1 A;  2M0X A;  2FCM A;  3ZNI D;  3V62 A;  2LVQ A;  4FJY A;  1A5R A;  3PHW B;  2EKE C;  2IO1 B;  5DCN A;  4OVU A;  4W9E A;  1V80 A;  4ZDV A;  5HKH A;  4II3 B;  3ZTC A;  3V60 A;  4W9G A;  2MRP A;  4IM0 A;  5CHV C;  4ANV A;  1WGH A;  1V9J A;  5DPS A;  1D3Z A;  1WI0 A;  2D2Q A;  4IG7 B;  3ZKJ C;  1OQY A;  3QAQ A;  3WA0 A;  1UEL A;  2DZK A;  2M1M A;  1WXM A;  1YIW A;  3VQI A;  2DAF A;  1Q0W B;  4E74 A;  2PE9 A;  3W1S C;  2UYZ B;  4AJW A;  4DHZ B;  4K7U A;  2L0T A;  2IO2 B;  4G3X B;  2GBR A;  1OGW A;  3PLV A;  3V61 A;  3PPA A;  4TQ1 A;  2KK8 A;  4MDK E;  4NNJ B;  4HJK A;  2FCS A;  4MGK E;  4IWP A;  2OOB B;  3WAL A;  2NPT A;  1C1Y B;  2BKF A;  2HTH A;  2BWE S;  3QWZ B;  5KHO A;  1E5W A;  2JWZ A;  2K6Q A;  2LJ5 A;  1TTN A;  3B08 A;  3GZN I;  5D94 A;  1P3Q U;  2KJH B;  3HHM A;  3VUW A;  2D07 B;  2FID A;  5J17 A;  2LRU A;  2K6D B;  4EKU A;  1WX9 A;  3ZVV A;  2LRW A;  3A4S C;  3H7P B;  4GOC A;  5IAA C;  4HVB A;  1RLF A;  2JF5 A;  3VAW A;  2NBW B;  1UD7 A;  1WXV A;  1XQQ A;  3APF A;  3EEC A;  4HCN B;  1GG3 A;  4KVG B;  4MGI E;  5FR6 A;  3VUY A;  4DK5 A;  4B9K A;  4BBN F;  2NVU I;  1EUV B;  3NZU A;  2G4D B;  2ZNV C;  3I3T B;  5C1Z A;  4DHJ B;  2KJ6 A;  5D7G A;  3SDL C;  2REX A;  4JL9 A;  1U4A A;  1UGM A;  4EZK A;  4BOS C;  4AP4 C;  2N7E A;  2KXJ A;  4IC7 B;  5E6P A;  2KD0 A;  2DX5 B;  3SD5 A;  1E7U A;  2MBO A;  2Z0D B;  2N7D A;  3PT2 B;  1L2N A;  1TZ1 A;  3B0A A;  4AWJ A;  4WWO A;  2IZV B;  4ANX A;  1UBQ A;  3MJW A;  1YX5 B;  2KOX A;  2CR5 A;  5G55 A;  1E7V A;  2R2O A;  4DXA B;  1FXT B;  4XC2 A;  2MQJ A;  4LJO B;  4DBG A;  4FHK A;  2MBQ A;  4BKG A;  3UF8 A;  3WIM A;  4A3O A;  4F1S A;  1WM3 A;  2KAN A;  2O6V B;  2MCN B;  1CMX B;  2L76 A;  1WIA A;  1WMH A;  1GNU A;  2FUH B;  2KWU B;  4CO7 A;  1WJU A;  2RPQ A;  2FCN A;  4GDK B;  4P7I A;  2D11 A;  3H7S A;  2L05 A;  2A4Z A;  2BWF A;  2MBB B;  4K1R B;  2DEN B;  3A9J B;  2G4S A;  2KMA A;  1R4M I;  3HK0 A;  2EMT A;  2LGY A;  3TBL D;  3VH4 B;  3PV1 A;  1GC6 A;  2KDI A;  3CF6 E;  4F8C B;  1XT9 B;  3PRP B;  1WY8 A;  4OVV A;  3WAM A;  2A5U A;  4FJV B;  2MBE A;  3V6E B;  4DHJ D;  2C7H A;  1J0G A;  2KWV B;  3Q3J A;  3ZDM C;  4GGQ A;  5CX3 A;  2GBK A;  4AOF A;  2AYO B;  2MP2 A;  2ZCC A;  3HIZ A;  4M8M A;  2KTF A;  4NAW B;  4MSM B;  2AL3 A;  4A20 A;  2KQS A;  2KJR A;  1Z5S B;  2I1J A;  2L7R A;  3APD A;  4II2 B;  1KM7 A;  3MHS D;  2LZ6 A;  3PTF C;  3L54 A;  2KLG A;  1Q1O A;  3AI5 A;  3ALB A;  3ZUN A;  4KV2 A;  5L95 C;  4TQ0 A;  3UIO B;  2BF8 B;  1WYW B;  4BKT A;  4NQK E;  2I1K A;  3L16 A;  2LUE A;  2WWZ A;  2BYV E;  3WAO A;  5DPW A;  1ZGU B;  2O6V A;  2LGD A;  2MWS B;  2C5L C;  4DHZ E;  3TCA A;  2BGF A;  1WFY A;  2V1Y A;  4KZ0 A;  4ZRI A;  3WAN A;  4NQL B;  5JZE B;  2O6V D;  1ISN A;  4KZC A;  1I35 A;  5CHW A;  2KTR B;  4F7Z A;  1WX7 A;  2L8J A;  1UZX B;  3A9J A;  3ONS A;  4W9H A;  1Q5W B;  2CU1 A;  2NBU A;  1F9J A;  2JRH A;  4HWI B;  4BBN C;  2PJH A;  3QK0 A;  3KUC B;  3DBL I;  2BYE A;  3DVG Y;  4NAW A;  1NBF C;  4PS3 A;  2N9P C;  3VUX A;  3QC8 B;  2BKR B;  2M17 A;  4AJY B;  1SGH A;  3O65 B;  3DBR I;  3KW5 B;  4G11 A;  1S3S G;  1WRD B;  3M95 A;  2DAJ A;  3D32 A;  3UQB A;  3KUZ A;  3ML8 A;  1WX8 A;  5LXH A;  2ZZP B;  3OJ4 B;  3X23 A;  3N3K B;  3B1L X;  1WGY A;  4W9D A;  2K39 A;  5AEK B;  3ZRF A;  1TGZ B;  2C7M B;  1G6J A;  1P1A A;  1E8Z A;  4PYU A;  2KDE B;  1HE8 A;  1H8C A;  1P98 A;  2LXA A;  3M3J A;  4RMA A;  4RM9 A;  4AUQ C;  4FN2 A;  4CHK A;  3ZTD A;  2KX3 A;  3U30 A;  1OEY A;  1WXA A;  4W9F A;  3EC8 A;  4JLC A;  2C60 A;  2KTR A;  4ASW C;  1OTR B;  4HDO A;  2V3S A;  3EHV A;  1V5T A;  5CTR C;  2MX2 A;  3RCZ A;  1WMH B;  4MM3 A;  4GN1 A;  2L0F A;  3APC A;  1RRB A;  3A33 B;  2EMS A;  2MA9 B;  2DYO A;  3ZW3 A;  2KDF B;  3PRM B;  4WWP A;  4ZRJ A;  5G2N A;  3W1Y A;  4IUM B;  1S1Q B;  3A1Q B;  4TV3 A;  3ECI A;  3TL5 A;  3SU8 X;  1E8X A;  2BYF A;  1EF5 A;  3AXC A;  2JY6 A;  3MTN B;  3N32 A;  3RUI B;  1KOT A;  3AU5 A;  1LM8 B;  4GDL B;  3DDC B;  3KUD B;  3DVN U;  5EDS A;  3CST A;  4M8N A;  3RT3 B;  1QZE A;  2GBJ A;  3A9K B;  2V4L A;  3ZNH B;  2JZ3 B;  4EOY A;  1PQS A;  2MP2 B;  2VRR B;  3L17 A;  4K7W A;  3TJP A;  3A4R A;  4MJS B;  4KSL C;  2ZVO A;  3PHX B;  3JYU A;  1WE7 A;  2PEA A;  4W9I A;  2LGX A;  4CYE A;  1WGD A;  2ZPN A;  5LLI A;  3V6C B;  1WZ0 A;  1NDD A;  1YQB A;  2CHZ A;  4WJO A;  3DQV A;  1EF1 A;  3ENE A;  3NS8 A;  2G3Q B;  3VFK A;  2AWT A;  3UQA A;  4WQO B;  3IHP C;  2FIF A;  3PS6 A;  2O2V B;  1WGG A;  2HJ8 A;  1H4R A;  2KX0 A;  2MW5 A;  5J18 A;  2N9E B;  4MGY E;  3RZF A;  4DDG D;  4URK A;  1LFD A;  1WH3 A;  4KSK C;  1AAR A;  2N1W A;  3K9P B;  4EZL A;  2R2Q A;  4J6I A;  1IPG A;  4MEM A;  4MGZ E;  3A1Q A;  3LJ3 A;  3DBH I;  2J7Q B;  1WZ3 A;  4TUU A;  5E6N A;  2OJR A;  5C23 A;  4BOZ B; 
#chains in the Genus database with same CATH topology
 4GMV A;  1SE9 A;  5IP4 D;  1ZW7 A;  3VR9 B;  3IG3 A;  3KVF B;  1A70 A;  3M62 B;  4M0W B;  4PYZ A;  1PGX A;  2LJI A;  3NRZ A;  4FHJ A;  2IO3 B;  2DYB A;  3DOW A;  3ZIM A;  2IO0 B;  4FUL A;  2VH1 A;  4MT5 A;  1GJZ A;  4JQW C;  4OZB A;  1VRA B;  1GC7 A;  2GOW A;  2I2Y A;  2JXT A;  1V81 A;  5DPT A;  4BKS A;  1SB3 C;  3PZD A;  2W54 A;  3M63 B;  5EE1 A;  4OHJ A;  4HDQ A;  1QOG A;  2JRI B;  5IA7 A;  1Z2M A;  2KN5 A;  3BK2 A;  4US8 A;  2KWC A;  4M0W A;  4P6V F;  4C00 A;  3P2B A;  3DVG X;  1HA5 A;  2YVC A;  2IJ0 A;  2JT4 B;  5H8Y E;  2KO3 A;  2MLB A;  3DPD A;  1DOI A;  2CHW A;  2IY0 B;  1BML C;  3Q8F A;  1EU4 A;  3DWG C;  3GS2 A;  3PRZ A;  3NG0 A;  4HLE A;  4W9K A;  1WGK A;  4C7Y A;  1GUA B;  2BS4 B;  4KIK B;  1WF9 A;  2Y3A A;  1PGB A;  2L00 B;  4K7S A;  4C4V A;  2NR2 A;  4DXG A;  4N59 A;  2YEP F;  1YOV B;  3HM6 X;  1SEB D;  4IM2 A;  2WXH A;  4HPM B;  3RD2 A;  4FLH A;  4XX5 A;  1F0Z A;  1FCC C;  3QIJ A;  1GB1 A;  4B6W A;  2QIE B;  3P4R B;  5MPO A;  3LYY A;  4A3P A;  5JHB A;  4KDL B;  3C0R B;  4KGS A;  2QHO A;  2BB6 A;  1J8C A;  4FA6 A;  2ZEQ A;  4TSS A;  4KIK A;  2IBI B;  1OEY J;  2B76 B;  5IO9 A;  2QMT A;  1TKY A;  1V49 A;  1LXD A;  4IWO A;  2KMC A;  3L13 A;  2ZJD A;  2M8S A;  3QHT A;  3VXW A;  2KDB A;  2BYT A;  1M94 A;  1WXS A;  4LJP B;  1KTK A;  2KWD A;  3TIX A;  4PS7 A;  1YJJ A;  3IFW B;  4OW0 A;  1TS5 A;  2W82 A;  2WDT B;  2BTE A;  2FNJ B;  3KYC D;  2D3G A;  4HRS A;  1VZ6 A;  2JSV X;  4M02 A;  3UGB B;  2GLS A;  3CSF A;  4AS1 A;  4HXD A;  1E9M A;  4W9J A;  1C4C A;  2Q5W D;  1B1Z A;  4TKN A;  1D5M C;  5JHA A;  4RH6 A;  4JX1 C;  3L10 B;  4MH0 E;  2WXN A;  2LD9 A;  4FXC A;  1WM2 A;  2QEJ C;  2D3B A;  3GOE A;  4ZRQ A;  1RFA A;  2WXI A;  3ZNG C;  2H88 B;  3EUB 2;  4GDK A;  2DNF A;  3R7Q A;  3VH3 B;  4REZ A;  2YLM A;  4EEW A;  3AE2 B;  3N9Y C;  1E0Z A;  1A5R A;  4OVU A;  3V60 A;  2TSS A;  2D2Q A;  3ZJU A;  1OQY A;  1TS2 A;  3WA0 A;  4L2Y A;  2L1A A;  1KF6 B;  1YIW A;  3BVM A;  2DAF A;  1Q0W B;  4K7U A;  2L0T A;  4G3X B;  3PLV A;  1FNW A;  4MDK E;  4HJK A;  2FCS A;  1C9F A;  4MGK E;  1P7E A;  3AEF B;  2ZW0 A;  2HTH A;  1I4P A;  3NUH B;  4A8X C;  3B08 A;  2KJH B;  3VUW A;  2D07 B;  1I4X A;  2K6D B;  1WX9 A;  2LRW A;  3A4S C;  1GPX A;  4KVG B;  4S0R A;  4JWS C;  2ICI A;  4BBN F;  2NVU I;  4OZA A;  1YNT E;  3I3T B;  4DHJ B;  2INC C;  2KJ6 A;  2L52 A;  5BYQ A;  4EZK A;  2WXM A;  2N7E A;  4IC7 B;  3TSS A;  2MBO A;  2IZV B;  1N61 A;  3P4Q B;  3MJW A;  1TIF A;  4M01 A;  4DXA B;  2MQJ A;  1JWB D;  2OHF A;  4DBG A;  4BKG A;  1FM0 D;  3WIM A;  2KQ4 X;  3IT4 B;  4WH4 A;  1WMH A;  2KWU B;  2GB1 A;  1FMA D;  2OED A;  3MFG A;  4P7I A;  3VR8 B;  3Q6B A;  1R4M I;  2LGY A;  3PV1 A;  1XT9 B;  3PRP B;  1WY8 A;  1TJE A;  2KWV B;  5EDS A;  5CX3 A;  2AYO B;  2D3C A;  3B2G A;  4WQM A;  4LNO A;  4ZYS A;  1PFD A;  3APD A;  3LB8 C;  1Q1O A;  2PTL A;  3AI5 A;  2KVZ A;  2AQ2 B;  2KYW A;  2MJD A;  2QCZ A;  5L95 C;  1C4A A;  4TQ0 A;  5LNK 1;  3T3N A;  3UIO B;  1T0R C;  1NYQ A;  3Q69 A;  1WYW B;  1WSP A;  2WLB A;  4YXD B;  2MWS B;  2H89 B;  3MC0 B;  3SEB A;  1WFY A;  2WXP A;  4NQL B;  2O6V D;  1K50 A;  1I35 A;  3IAM 1;  3ONS A;  4HRO A;  1UF0 A;  4MM3 B;  2W3S A;  2IPK D;  2VH2 A;  4WUR A;  3GE3 C;  1F1H A;  4HEA 1;  3GZN B;  3N20 C;  4HKQ A;  1UWM A;  3VUX A;  4HJG E;  2PW9 A;  4XWT A;  2M17 A;  4G11 A;  3MJ5 A;  2HDE A;  2IND C;  3N3K B;  4W9D A;  3ZRF A;  1MVK A;  1TGZ B;  1G6J A;  4PYU A;  2KDE B;  3ZTD A;  1YMH E;  1OEY A;  4JLC A;  2KAJ A;  2C60 A;  2M0A A;  4HDO A;  1R7S A;  1QT9 A;  1EU3 A;  4RGO S;  1V5T A;  4MM3 A;  3AE4 B;  5FR3 A;  2DYO A;  3E9S A;  3ZW3 A;  2KDF B;  3LXF A;  1VLB A;  1S1Q B;  3A1Q B;  1ROE A;  3TL5 A;  4C56 C;  3MTN B;  5HI1 A;  1ZE3 D;  3CST A;  1QZE A;  3Q3N C;  2GBJ A;  2JZ3 B;  2VRR B;  2LGI A;  3L17 A;  4RCO A;  4K7W A;  3TJP A;  1CZP A;  3A4R A;  3PHX B;  2G9H D;  2LGX A;  4CYE A;  5LLI A;  1WZ0 A;  1NDD A;  3O13 A;  3DQV A;  3ENE A;  3NS8 A;  2G3Q B;  2AWT A;  3UQA A;  4O1N A;  2BS3 B;  2EKI A;  2LGS A;  4LNN A;  3PS6 A;  1WGG A;  4RNA A;  1H4R A;  1D5Z C;  1SE4 A;  1WH3 A;  2INP E;  4GLS C;  4EZL A;  2R2Q A;  2AX5 A;  1YJI A;  3Q3M C;  4MGZ E;  3TEZ A;  3A1Q A;  4RGT A;  3UF8 A;  4DDI D;  2JX5 A;  2DHZ A;  1K53 A;  3KH0 A;  3RNE C;  2AEH A;  4ANU A;  4HPL B;  3U52 E;  1N5W A;  3DVN V;  1V2Y A;  3VTW A;  4ICV A;  4FBJ B;  1ESF A;  3KWV A;  4BVU C;  2C9W B;  1FFV A;  2XK5 A;  1IBX B;  5AUI A;  3DHI C;  1NI2 A;  1WJ4 A;  1UWX A;  1I4H A;  4GXB A;  4K81 A;  1FRD A;  3AN1 A;  2N1V A;  2J0K A;  3AMZ A;  2CKH B;  3EFC A;  4GB9 A;  3P4S B;  4X57 B;  1JAL A;  3SR6 A;  2FUG 1;  2RDH A;  2AL6 A;  2K8H A;  2WX0 A;  2RSU A;  1BXT A;  4EFO A;  4NAM A;  5BO4 B;  2CU3 A;  1IUE A;  3L0W B;  2N4F A;  1IBX A;  1IYF A;  1P0R A;  3X0W A;  2ONQ A;  4EUT A;  3PGE A;  2M19 A;  2D3A A;  1HQR D;  4HK2 A;  3H9D A;  4C80 A;  4WJQ A;  2IYD B;  4YSZ B;  5HG2 A;  4W9C A;  3ZDT A;  4IW0 A;  4W9L A;  2LEK A;  2PVO D;  1IP9 A;  4KKI A;  2G45 B;  1GB4 A;  4I6L B;  1AW7 A;  3BY4 B;  4XZ4 A;  1KFY B;  1FRR A;  2BPS A;  3OLM D;  1OFF A;  1JQ4 A;  3IXS A;  1R4N I;  2KZR A;  2V0G A;  4WAF A;  3RPF C;  3AUL A;  2KFK B;  4PK1 A;  2K25 A;  3DCG A;  2NTS A;  3JSV B;  3AU4 A;  1X1M A;  2DZI A;  4US9 A;  4YTP B;  1I42 A;  1TS4 A;  3WAP A;  1SIF A;  3CIR B;  2HD5 B;  2KVR A;  2LWP A;  2SEB D;  1Q10 A;  1ZP0 B;  2MH7 A;  4ZHP A;  1UBI A;  2LHE A;  4MEL A;  2M56 B;  4BAX A;  5JH5 C;  2WXF A;  1AYF A;  1TKG A;  4KDI C;  2FCQ A;  2DYM A;  4JGH B;  2KFK A;  3ZNZ B;  5KHQ A;  1QOA A;  3JSV A;  3PRE A;  2CJN A;  3ML9 A;  3PZ8 A;  4ZHO A;  3NOB A;  2R61 A;  2GBN A;  5DPS A;  1F2R I;  4LDT B;  2JXX A;  3ZJT A;  4K3B A;  3H7P A;  5C3J B;  1WXQ A;  1YQ3 B;  5DPR A;  3T9L A;  1TT5 B;  3C8Y A;  4ARI A;  3AH7 A;  2BW2 A;  1E8Y A;  4IWQ A;  1YX6 B;  4G0N B;  4GU2 A;  3AM9 A;  1TBE A;  4NZL B;  2HE7 A;  2NBV B;  5G5H A;  1KJT A;  1WWT A;  3R2I A;  4KGR A;  2LVP A;  2V9H A;  4C4V B;  2N9L A;  5JXV A;  1QKZ A;  1UGJ A;  1STE A;  1SE3 A;  1NEN B;  5D2M B;  2KKC A;  1I4Q A;  3URY A;  3ZO5 B;  4NJ6 A;  1WR1 A;  3V05 A;  2M0X A;  2LVQ A;  4FJY A;  1N6Z A;  3PHW B;  2EKE C;  2IO1 B;  5DCN A;  4W9G A;  2INN E;  1V9J A;  1D3Z A;  3KLS X;  4IG7 B;  1C76 A;  4LNF A;  1ET9 A;  1UEL A;  2EEL A;  3VQI A;  1WXM A;  1F52 A;  1VZ8 A;  4E74 A;  3W1S C;  1YN5 A;  2GBR A;  1NVI D;  3V61 A;  2DWQ A;  3W2D A;  3MC9 A;  4IWP A;  3U7Z A;  1C1Y B;  2BKF A;  5KHO A;  2LJ5 A;  5D94 A;  4H2A A;  2FID A;  4WWM A;  1AN8 A;  3ZVV A;  3HVZ A;  1QIL A;  4OVZ A;  4HVB A;  5BYS A;  2NBW B;  1T0Q C;  3BVG A;  4MGI E;  3APF A;  3VUY A;  2RDG A;  1LO5 D;  1ZXH A;  4WIP A;  3W5U B;  4M00 A;  2JYE A;  3C19 A;  3SDL C;  5D7G A;  2REX A;  4IDI A;  3I63 C;  1UGM A;  2KAC A;  4L1B A;  4BOS C;  1N5X A;  5E6P A;  2KD0 A;  2DX5 B;  3SD5 A;  1XLN A;  1L2N A;  1UUP A;  3B0A A;  4AWJ A;  3P1M A;  3HUI A;  2L32 A;  1YX5 B;  5G55 A;  1E7V A;  1FXT B;  4S17 A;  1WM3 A;  2KAN A;  3B2F A;  2RPQ A;  2QIL A;  2FCN A;  4GDK B;  3H7S A;  1N63 A;  2A4Z A;  2BWF A;  3NJT A;  1SXT A;  2KMA A;  2KMM A;  2EMT A;  3TBL D;  1GC6 A;  3CF6 E;  5G5G A;  4F8C B;  4OVV A;  2A5U A;  2MBE A;  1L5P A;  1J0G A;  2PIA A;  4GGQ A;  1C4P A;  2GBK A;  2ZCC A;  3HIZ A;  2KTF A;  4A20 A;  1Z5S B;  2JWU A;  2I1J A;  1KM7 A;  3BII D;  3MHS D;  3L54 A;  2KLG A;  2XNA C;  4KV2 A;  1XLQ A;  2IGD A;  4A6Q A;  2LUE A;  2WWZ A;  5DPW A;  1ZGU B;  3Q8A A;  2C5L C;  4DHZ E;  4ZOH C;  2WGS A;  4KZC A;  3NS1 A;  1WX7 A;  2L8J A;  1FXA A;  4LTU A;  2NBU A;  5BMG A;  1DOX A;  4XGA B;  4BBN C;  3KUC B;  1FFU A;  4RFB A;  3DBL I;  1NBF C;  4PS3 A;  2N9P C;  4IKG A;  1HXY D;  2WDQ B;  1FD6 A;  3DBR I;  1S3S G;  1WRD B;  3UQB A;  3N1X C;  3KUZ A;  5EE0 A;  3IAS 1;  3OJ4 B;  2N0S B;  1WGY A;  5AEK B;  1V1O A;  2C7M B;  1I4G A;  1E8Z A;  3FC4 A;  2X8X X;  1P98 A;  4RM9 A;  4AUQ C;  5D3I B;  4CHK A;  2KX3 A;  1SIJ A;  2MHJ A;  1WXA A;  3EC8 A;  3BYT B;  2V3S A;  2QDF A;  3RCZ A;  1WMH B;  4GN1 A;  2BT6 A;  2L0F A;  3APC A;  3A33 B;  1WRI A;  5G2N A;  1EM7 A;  3RUI B;  1KOT A;  3AXC A;  3W5V B;  3AU5 A;  2X38 A;  3DDC B;  3KUD B;  1M4V A;  3NVY A;  3BZD B;  4EOY A;  2LFI A;  2ZVO A;  4W9I A;  1WE7 A;  2PEA A;  1R4M B;  1WGD A;  2CJO A;  2ZPN A;  1TZO A;  1YQB A;  2G1E A;  3ETR A;  2FIF A;  2O2V B;  2HJ8 A;  3NVW A;  1FO4 A;  2MW5 A;  1IGC A;  5J18 A;  4MGY E;  4URK A;  1LFD A;  1AAR A;  4KGT A;  1F2R C;  3LJ3 A;  3DBH I;  1WZ3 A;  3SHQ A;  5C23 A;  4ARC A;  1XCT L;  1MG8 A;  2JPH A;  1D4B A;  2NCN A;  2PVG C;  5E6O A;  5AZH A;  3L4P A;  4DWF A;  3VHT C;  2FAZ A;  2RPV A;  2YEP B;  1WJN A;  3IBE A;  2IY1 B;  3DHH C;  4IM3 A;  2LI5 A;  3P4P B;  4GSW A;  1T5X D;  2D10 A;  1P7F A;  2N9K A;  3S2A A;  2O2V A;  2VZK B;  3E56 A;  3RN9 C;  4YTN B;  1L6U A;  2KNB A;  2LXC A;  4BKS D;  2GMI C;  2HJ1 A;  2J0M A;  3VTV A;  1KH0 A;  2NS5 A;  4N58 A;  3ZRC A;  1QQR A;  3L08 A;  4UDU C;  3NZS A;  3P63 A;  3NHE B;  3U8Z A;  4TMA B;  5EE3 A;  2PMV A;  2K1F A;  3T8M A;  3EA6 A;  4LK0 M;  3QA8 A;  2K8C A;  2WYQ A;  4NJC A;  1P9D U;  2K8B A;  3RUL A;  3VRB B;  1SJH D;  5AUK A;  3TMP B;  3AV8 A;  3QQ8 B;  2UWQ A;  1V5O A;  5GMV A;  2GBM A;  1XO3 A;  2Y5B B;  1JRO A;  4I6P A;  3ZYY X;  1YJ1 A;  2Z8L A;  3VRA B;  4L23 A;  2KFJ A;  1AWD A;  3VDZ A;  4CQN A;  1SSN A;  1DOY A;  3W1S A;  1L7Y A;  2J0J A;  1QOF A;  1E10 A;  1EWC A;  4ANW A;  1JML A;  4N9F 4;  5TSS A;  4ZRK A;  3ZQ4 A;  1ZXI A;  2K22 A;  2LMC A;  2WX1 A;  1DYQ A;  1HTO A;  3OAW A;  2XK5 B;  2MEK A;  1YD8 U;  1T3Q A;  2ZVN A;  1WR6 E;  4WJP A;  1XEE A;  1XD3 B;  1OQR A;  2WS3 B;  4YT0 B;  4JE3 B;  1ZKH A;  2NTT A;  1EWY C;  2V3N A;  3SFD B;  1NEK B;  3NZ3 A;  2PE6 B;  2N7J A;  2PPH A;  2Z0E B;  3RZW C;  2MSE D;  3AE7 B;  3QX1 A;  4FJZ A;  2GRI A;  1IGD A;  2W3R A;  4LLG M;  4E3C A;  3QJZ A;  2KC1 A;  3RYT A;  4ZYN A;  2JYT A;  2W9N A;  2RGF A;  1KLG D;  5EE9 A;  4Q2J A;  5LXI B;  2RR9 A;  3Q3F A;  2WU5 B;  1F77 A;  1NYR A;  5CHF A;  1SF0 A;  1YN4 A;  1SE2 A;  2DZM A;  4WAA A;  1FPY A;  4AQ7 A;  3PSE B;  3Q8C A;  1KLV A;  1L0X B;  1RM6 C;  3AB5 A;  4FAD A;  3UIP B;  3K9O B;  1VD2 A;  3AE9 B;  3LDZ E;  4A55 A;  2WXK A;  2ON8 A;  4JPS A;  2FCM A;  1QOB A;  1R4N B;  2E3T A;  1V80 A;  4ZDV A;  5HKH A;  3ZTC A;  2BB5 A;  2IDY A;  2MRP A;  5CHV C;  4ANV A;  1HZ5 A;  1WGH A;  1WI0 A;  3ZKJ C;  3QAQ A;  1HZ6 A;  3AEC B;  2DZK A;  3FKY A;  4ITK A;  2UYZ B;  2IO2 B;  4R3D A;  3PPA A;  3R8B A;  3FAH A;  2RMM A;  1L0V B;  4N6E B;  4XDD A;  3Q3O C;  4C7Z A;  1KRH A;  2OOB B;  3WAL A;  4KKJ A;  3QWZ B;  1ZDX A;  1E5W A;  2WHI A;  1FXI A;  2BQQ A;  1N62 A;  3MP9 A;  4EKU A;  5IAA C;  3H7P B;  2WDV B;  3VAW A;  4K3C A;  4HCN B;  1WXV A;  1GG3 A;  1B9R A;  1HTQ A;  1EUV B;  3NZU A;  1WYG A;  2ZNV C;  2JQR B;  4RGM A;  1U4A A;  1TY2 A;  1E7U A;  2Z0D B;  3PT2 B;  1TZ1 A;  4WWO A;  2WXL A;  4ANX A;  1D6E C;  1UBQ A;  1Y56 A;  2KOX A;  2R2O A;  4XC2 A;  4KX6 B;  4LJO B;  4FHK A;  2MBQ A;  4A3O A;  4F1S A;  2O6V B;  2L76 A;  1WIA A;  1GNU A;  2FUH B;  4CO7 A;  5I4D A;  1T0S C;  3AEA B;  4K1R B;  2DEN B;  2I38 A;  4J3O D;  3HK0 A;  3VH4 B;  2QSD A;  3I5J C;  2KDI A;  1FIQ A;  3V6E B;  2BS2 B;  4DHJ D;  3Q3J A;  3ZDM C;  4AOF A;  2BBC A;  2MP2 A;  4M8M A;  2AL3 A;  2KQS A;  2RDB C;  1C78 A;  4II2 B;  3V3X A;  2LZ6 A;  1C77 A;  1FNV A;  3RNA C;  3TEX A;  1K51 A;  1V8C A;  4IOI E;  4BKT A;  4NQK E;  1L4D B;  1J7A A;  2BYV E;  3WAO A;  2O6V A;  2LGD A;  1VZ7 A;  2WXO A;  1JRP A;  2BGF A;  4KZ0 A;  3WAN A;  5JZE B;  1ISN A;  2DBY A;  2JU6 X;  1RWS A;  5CHW A;  2LUM A;  1TS3 A;  2Y5C A;  4W9H A;  1Q5W B;  2CU1 A;  2KT7 A;  1F9J A;  2JRH A;  3KWL A;  4HWI B;  5BMH A;  2PJH A;  1RYJ A;  3DVG Y;  1FEH A;  4AJY B;  3O65 B;  3KW5 B;  2AQ3 B;  2DAJ A;  3D32 A;  3NVV A;  3ML8 A;  3Q2A C;  1WX8 A;  2ZZP B;  1CJE A;  3AEE B;  1H8C A;  1HE8 A;  2LXA A;  3M3J A;  4A90 A;  4FN2 A;  3U30 A;  1MPE A;  2VZK D;  3AE1 B;  4W9F A;  2WXQ A;  4ASW C;  4P1B C;  3EHV A;  1ZDV A;  1L6V A;  2MX2 A;  1RRB A;  1MHH E;  2K5P A;  3PRM B;  3W1Y A;  4WWP A;  4IUM B;  1FNU A;  4TV3 A;  2DLB A;  3ECI A;  1EF5 A;  2JY6 A;  1RFK A;  4XDC A;  1LM8 B;  4GDL B;  2WXR A;  1ENF A;  4QAY A;  5FKA C;  3RT3 B;  3ZNH B;  3A9K B;  2V4L A;  3BVZ A;  1C79 A;  4KSL C;  4MJS B;  3JYU A;  1XF5 L;  2ACZ B;  3V6C B;  5E6J A;  2CHZ A;  4WJO A;  3VFK A;  3MC8 A;  4WQO B;  3AE3 B;  1JWU D;  1OQQ A;  1J7B A;  4RF0 A;  3RZF A;  4KSK C;  2N1W A;  4MEM A;  2J7Q B;  4DK5 A;  3QAR A;  1V86 A;  3OG5 A;  4GDL A;  1PDX A;  4ICU A;  2RD0 A;  3A9K A;  3DBS A;  4GIV A;  3KYD D;  4MJS A;  1JWM D;  3N30 A;  2UU7 A;  2KQ7 A;  3VTU A;  3B9J A;  1PYW D;  2MBH A;  3DBL B;  3UIN B;  3PLU A;  2OJW A;  3ZJV A;  1BUI C;  4ACF A;  1V1P B;  3DBR B;  4LNK A;  4DXF A;  4BFR A;  2KC2 A;  4RGN A;  3AEG B;  2WP9 B;  2XBB C;  4NJ7 A;  2K3U A;  2KHW B;  1JRU A;  1V6E A;  1LGR A;  2JZZ A;  2ZPY A;  1KLU D;  2GI9 A;  2WXG A;  1YN3 A;  2LVO A;  4PS8 A;  4WJN A;  4B0M A;  2W55 A;  1QF6 A;  3WCQ A;  4YSX B;  2Z59 B;  4MAC A;  4PT5 A;  2XEW A;  1N60 A;  2LAS A;  1DGJ A;  3TUO A;  3BWU D;  3CMM B;  1J19 A;  4RM8 A;  1V1P A;  4B0E A;  2V4I B;  5T8I A;  4WWN A;  5AZG A;  1WE6 A;  1E8W A;  1K52 A;  1Y8R C;  3AEB B;  4YL8 A;  2ZNV B;  5AZF A;  4A9A A;  1MFW A;  1VJK A;  4JWU C;  2MJE A;  2JVC A;  3H6N A;  4EZJ A;  3Q8B A;  4NPN A;  5TR5 A;  1WJ6 A;  5D6J B;  2QJL A;  5J2R A;  3AE6 B;  2BVC A;  1SJE D;  2NMQ A;  3DBH B;  3ZXR A;  4NY0 A;  2CHX A;  2LHD A;  2L3Z A;  2IGH A;  4JIO U;  3RMK C;  3VVW B;  3BIN A;  5FK9 C;  4LCD E;  2WDR B;  3GB1 A;  1E6E B;  2WXJ A;  3ZLZ A;  3KQ4 A;  3ABV B;  2DZJ A;  2J4X A;  2WU2 B;  3IVF A;  1CQV A;  2ZCB A;  1YQ4 B;  3R2T A;  3JW0 X;  1UH6 A;  3HM3 A;  3QCA A;  1C3T A;  3FIL B;  4XWW A;  2ASQ A;  4HKZ E;  1K8R B;  3EFU A;  4G50 A;  2FE8 A;  3JVZ X;  3NY5 A;  1XLO A;  1J7C A;  1MJD A;  3Q8E A;  2K0P A;  1EO6 A;  4I6N B;  4MSQ B;  2M4N A;  2JUO A;  2K9X A;  1I7H A;  2N9X A;  3R7R A;  5IN7 A;  3PVL A;  1T0Y A;  1VCB A;  3R3M A;  1I4R A;  2B3A A;  4YWG G;  2J53 A;  4MH8 A;  2L83 A;  3OJ3 A;  3HRD D;  2KN4 A;  3R66 C;  4YTM B;  3PZ7 A;  3FIL A;  3H1U A;  2KLC A;  1LQB A;  4HCP B;  3GP7 A;  1BT0 A;  1JWA D;  2E6X A;  2C7N B;  1E90 A;  1MI0 A;  5L83 A;  4B95 A;  1RAX A;  1TY0 A;  1WGR A;  3I9V 1;  1L0Y B;  2NPT B;  3U7D A;  2CS4 A;  2SAK A;  4LDT D;  2Y5P A;  1D5X C;  4OZC A;  3ZNI D;  3V62 A;  3RFZ B;  1E7P B;  2V3P A;  4W9E A;  4II3 B;  4IM0 A;  1QLB B;  3GE8 C;  2MJ3 A;  1TYG B;  3RNC C;  3AE8 B;  3W9C B;  2M1M A;  4P1C C;  2PE9 A;  4AJW A;  4LNI A;  4DHZ B;  2JZP A;  3OWE B;  1OGW A;  4TQ1 A;  2KK8 A;  4NNJ B;  3TEY A;  1JW9 D;  1XCQ L;  2NPT A;  1PGA A;  2BWE S;  2JWZ A;  2K6Q A;  1TTN A;  3GZN I;  1P3Q U;  3HHM A;  5J17 A;  4YSY B;  2LRU A;  4GOC A;  1RLF A;  2JF5 A;  2J52 A;  4ZRP A;  5BMI A;  1UD7 A;  1XQQ A;  2WQY B;  4E71 A;  3EEC A;  1CK1 A;  5FR6 A;  4B9K A;  3CWI A;  2G4D B;  5C1Z A;  5IOI A;  1ET6 A;  4JL9 A;  3AED B;  4AP4 C;  2KXJ A;  3TEW A;  2N7D A;  1SBB B;  4DQO C;  2CR5 A;  1PUT A;  2FBW B;  1GAQ B;  2MCN B;  1CMX B;  3U2S C;  5GXG B;  1WJU A;  5BYR A;  2D11 A;  2L05 A;  3NVZ A;  2MBB B;  1NI3 A;  3A9J B;  2G4S A;  3SFE B;  4BZA A;  2ZW1 A;  3WAM A;  4FJV B;  1GOZ A;  2C7H A;  3UI3 A;  2IGG A;  4NAW B;  4MSM B;  4D2K A;  2KJR A;  2L7R A;  3HVD A;  3PTF C;  3J9C A;  3ALB A;  3ZUN A;  3P42 A;  2BF8 B;  3ZGZ A;  1ZOY B;  2I1K A;  3L16 A;  1JWS D;  2PKO A;  3H8H A;  3AE5 B;  1UNS A;  1HEZ E;  3TCA A;  2V1Y A;  4ZRI A;  1L4Z B;  2WNM A;  2KTR B;  4F7Z A;  1UZX B;  3A9J A;  4XYC A;  3ZXV A;  2AQ1 B;  2XN9 C;  1MG4 A;  5HHD G;  1FCL A;  3QK0 A;  3BYY B;  1MHX A;  2BYE A;  5C2T B;  4NAW A;  1JCK B;  3QC8 B;  3DWM A;  2BKR B;  1SGH A;  3M95 A;  3PO0 A;  5LXH A;  4RF1 A;  3RI7 C;  3X23 A;  3I57 A;  3B1L X;  2K39 A;  2PLP A;  1P1A A;  1ACC A;  3T3O A;  1ZPS A;  4RMA A;  1VDV A;  2KDM A;  3EGR A;  5HFY A;  5D3D A;  2KTR A;  1V97 A;  1OTR B;  5H92 C;  3N1Y C;  1T6B X;  4HPP A;  2HTM E;  5CTR C;  1VR9 A;  2EMS A;  2MA9 B;  4USA A;  4ZRJ A;  3BK1 A;  3MHZ A;  1E8X A;  2BYF A;  3N32 A;  4P16 A;  3SU8 X;  5IKC M;  2J42 A;  3DVN U;  4M8N A;  4EE2 A;  3RNB C;  3DHG C;  1PQS A;  2MP2 B;  4XE0 A;  1TKE A;  1EF1 A;  3IT6 B;  3IHP C;  3Q14 C;  3U4E G;  1XXG A;  3RNF C;  2KX0 A;  3N1Z C;  2N9E B;  1XLP A;  2D5G A;  4DDG D;  1ZUD 2;  3RNG C;  3K9P B;  4J6I A;  1IPG A;  2QC8 A;  4TUU A;  5E6N A;  2OJR A;  4BOZ B; 
#chains in the Genus database with same CATH homology
 4DDI D;  2DHZ A;  3QAR A;  4GMV A;  3KH0 A;  1SE9 A;  1V86 A;  4GDL A;  1MG8 A;  1ZW7 A;  2AEH A;  4ANU A;  2JPH A;  4ICU A;  3IG3 A;  3KVF B;  4HPL B;  2RD0 A;  3VTW A;  2NCN A;  1V2Y A;  3DVN V;  4ICV A;  5E6O A;  3M62 B;  3A9K A;  3DBS A;  4M0W B;  4PYZ A;  5AZH A;  4GIV A;  4DWF A;  4FBJ B;  3VHT C;  3KYD D;  2FAZ A;  4BVU C;  4MJS A;  4FHJ A;  1WJN A;  2C9W B;  2IO3 B;  2XK5 A;  2DYB A;  3DOW A;  3IBE A;  2IY1 B;  3N30 A;  4IM3 A;  2LI5 A;  2IO0 B;  4FUL A;  4GSW A;  3ZIM A;  1NI2 A;  1GJZ A;  1WJ4 A;  2KQ7 A;  3VTU A;  4JQW C;  3SHQ A;  1GC7 A;  2GOW A;  2MBH A;  3UIN B;  2D10 A;  3PLU A;  3S2A A;  1V81 A;  2O2V A;  4GXB A;  4K81 A;  5DPT A;  4BKS A;  2N1V A;  2J0K A;  3PZD A;  2CKH B;  2KNB A;  3M63 B;  2LXC A;  4GB9 A;  4BKS D;  4BFR A;  2KC2 A;  4HDQ A;  4X57 B;  2JRI B;  5IA7 A;  2GMI C;  2J0M A;  3VTV A;  1Z2M A;  2NS5 A;  3ZRC A;  2KN5 A;  2XBB C;  3L08 A;  3NZS A;  2AL6 A;  4NJ7 A;  4E71 A;  2KHW B;  2KWC A;  3NHE B;  2K8H A;  1JRU A;  2WX0 A;  1V6E A;  2RSU A;  3U8Z A;  2JZZ A;  2ZPY A;  4EFO A;  3P2B A;  5BO4 B;  2K1F A;  2LVO A;  3DVG X;  4PS8 A;  3L0W B;  2N4F A;  4WJN A;  3T8M A;  1IYF A;  2YVC A;  3QA8 A;  2K8C A;  2WYQ A;  2Z59 B;  1P0R A;  2JT4 B;  3X0W A;  4EUT A;  3PGE A;  1P9D U;  2K8B A;  2XEW A;  2KO3 A;  2MLB A;  2LAS A;  3RUL A;  3DPD A;  2CHW A;  2IY0 B;  3CMM B;  3TMP B;  3QQ8 B;  1J19 A;  2UWQ A;  4HK2 A;  4RM8 A;  3H9D A;  1V5O A;  4WJQ A;  3PRZ A;  4WWN A;  2GBM A;  5GMV A;  5AZG A;  1WE6 A;  1E8W A;  2IYD B;  4HLE A;  1Y8R C;  4W9K A;  4W9C A;  3ZDT A;  4IW0 A;  4YL8 A;  4W9L A;  2Y5B B;  2ZNV B;  1IP9 A;  1GUA B;  2G45 B;  5AZF A;  4I6P A;  4KIK B;  1YJ1 A;  1WF9 A;  4I6L B;  3BY4 B;  4XZ4 A;  2KFJ A;  3VDZ A;  2L00 B;  4K7S A;  2BPS A;  2JVC A;  3OLM D;  3H6N A;  2NR2 A;  1L7Y A;  2J0J A;  4NPN A;  5TR5 A;  3W1S A;  4EZJ A;  1R4N I;  2KZR A;  1WJ6 A;  3HM6 X;  4IM2 A;  3AUL A;  2KFK B;  2K25 A;  3DCG A;  4HPM B;  4ANW A;  3JSV B;  4N9F 4;  5D6J B;  3AU4 A;  5J2R A;  3RD2 A;  4FLH A;  4ZRK A;  4XX5 A;  2WX1 A;  1X1M A;  2DZI A;  4NY0 A;  1I42 A;  3OAW A;  3QIJ A;  2XK5 B;  3WAP A;  2CHX A;  1SIF A;  2L3Z A;  4B6W A;  1YD8 U;  5JHB A;  4A3P A;  2ZVN A;  4JIO U;  4KDL B;  3VVW B;  1WR6 E;  2HD5 B;  2KVR A;  3BIN A;  3C0R B;  4WJP A;  2LWP A;  2QHO A;  1XD3 B;  4LCD E;  1J8C A;  4FA6 A;  2ZEQ A;  1UBI A;  4MEL A;  4KIK A;  2IBI B;  1ZKH A;  3ZLZ A;  3IVF A;  2DZJ A;  5JH5 C;  1OEY J;  2ZCB A;  3JW0 X;  1UH6 A;  3HM3 A;  3QCA A;  4KDI C;  1V49 A;  1LXD A;  4IWO A;  2KMC A;  1C3T A;  2PE6 B;  2FCQ A;  2DYM A;  4JGH B;  2PPH A;  2Z0E B;  2KFK A;  3L13 A;  3RZW C;  2MSE D;  3QX1 A;  4FJZ A;  3ZNZ B;  2ASQ A;  5KHQ A;  3JSV A;  3PRE A;  1K8R B;  3ML9 A;  2ZJD A;  2M8S A;  3QHT A;  3EFU A;  3NOB A;  3VXW A;  2KDB A;  4E3C A;  4G50 A;  2GBN A;  3JVZ X;  1M94 A;  2KC1 A;  3NY5 A;  1WXS A;  2JXX A;  3QJZ A;  4LDT B;  4LJP B;  3H7P A;  4ZYN A;  3RYT A;  3TIX A;  4PS7 A;  3IFW B;  1EO6 A;  2WDT B;  2W9N A;  4I6N B;  4MSQ B;  2M4N A;  2JUO A;  5DPR A;  3T9L A;  2RGF A;  2N9X A;  3R7R A;  2FNJ B;  3PVL A;  3KYC D;  1T0Y A;  1VCB A;  5LXI B;  2RR9 A;  3R3M A;  2D3G A;  3Q3F A;  5CHF A;  1E8Y A;  3UGB B;  3CSF A;  4IWQ A;  1YX6 B;  4HXD A;  2B3A A;  2DZM A;  4G0N B;  4GU2 A;  4W9J A;  4WAA A;  1TBE A;  2HE7 A;  2NBV B;  3OJ3 A;  1KJT A;  3R66 C;  3PSE B;  4TKN A;  5JHA A;  1KLV A;  3L10 B;  2LVP A;  3H1U A;  4FAD A;  4MH0 E;  3UIP B;  3K9O B;  2KLC A;  2LD9 A;  1LQB A;  4HCP B;  1WM2 A;  3GOE A;  1RFA A;  1BT0 A;  2C7N B;  1E90 A;  5L83 A;  4B95 A;  1RAX A;  1VD2 A;  1WGR A;  3ZNG C;  5D2M B;  2KKC A;  2NPT B;  3U7D A;  4GDK A;  2CS4 A;  3LDZ E;  4LDT D;  3R7Q A;  3ZO5 B;  4NJ6 A;  3VH3 B;  2YLM A;  4EEW A;  1WR1 A;  2M0X A;  2FCM A;  3ZNI D;  3V62 A;  2LVQ A;  4FJY A;  1A5R A;  3PHW B;  2EKE C;  2IO1 B;  5DCN A;  4OVU A;  4W9E A;  1V80 A;  4ZDV A;  5HKH A;  4II3 B;  3ZTC A;  3V60 A;  4W9G A;  2MRP A;  4IM0 A;  5CHV C;  4ANV A;  1WGH A;  1V9J A;  5DPS A;  1D3Z A;  1WI0 A;  2D2Q A;  4IG7 B;  3ZKJ C;  1OQY A;  3QAQ A;  3WA0 A;  1UEL A;  2DZK A;  2M1M A;  1WXM A;  1YIW A;  3VQI A;  2DAF A;  1Q0W B;  4E74 A;  2PE9 A;  3W1S C;  2UYZ B;  4AJW A;  4DHZ B;  4K7U A;  2L0T A;  2IO2 B;  4G3X B;  2GBR A;  1OGW A;  3PLV A;  3V61 A;  3PPA A;  4TQ1 A;  2KK8 A;  4MDK E;  4NNJ B;  4HJK A;  2FCS A;  4MGK E;  4IWP A;  2OOB B;  3WAL A;  2NPT A;  1C1Y B;  2BKF A;  2HTH A;  2BWE S;  3QWZ B;  5KHO A;  1E5W A;  2JWZ A;  2K6Q A;  2LJ5 A;  1TTN A;  3B08 A;  3GZN I;  5D94 A;  1P3Q U;  2KJH B;  3HHM A;  3VUW A;  2D07 B;  2FID A;  5J17 A;  2LRU A;  2K6D B;  4EKU A;  1WX9 A;  3ZVV A;  2LRW A;  3A4S C;  3H7P B;  4GOC A;  5IAA C;  4HVB A;  1RLF A;  2JF5 A;  3VAW A;  2NBW B;  1UD7 A;  1WXV A;  1XQQ A;  3APF A;  3EEC A;  4HCN B;  1GG3 A;  4KVG B;  4MGI E;  5FR6 A;  3VUY A;  4DK5 A;  4B9K A;  4BBN F;  2NVU I;  1EUV B;  3NZU A;  2G4D B;  2ZNV C;  3I3T B;  5C1Z A;  4DHJ B;  2KJ6 A;  5D7G A;  3SDL C;  2REX A;  4JL9 A;  1U4A A;  1UGM A;  4EZK A;  4BOS C;  4AP4 C;  2N7E A;  2KXJ A;  4IC7 B;  5E6P A;  2KD0 A;  2DX5 B;  3SD5 A;  1E7U A;  2MBO A;  2Z0D B;  2N7D A;  3PT2 B;  1L2N A;  1TZ1 A;  3B0A A;  4AWJ A;  4WWO A;  2IZV B;  4ANX A;  1UBQ A;  3MJW A;  1YX5 B;  2KOX A;  2CR5 A;  5G55 A;  1E7V A;  2R2O A;  4DXA B;  1FXT B;  4XC2 A;  2MQJ A;  4LJO B;  4DBG A;  4FHK A;  2MBQ A;  4BKG A;  3UF8 A;  3WIM A;  4A3O A;  4F1S A;  1WM3 A;  2KAN A;  2O6V B;  2MCN B;  1CMX B;  2L76 A;  1WIA A;  1WMH A;  1GNU A;  2FUH B;  2KWU B;  4CO7 A;  1WJU A;  2RPQ A;  2FCN A;  4GDK B;  4P7I A;  2D11 A;  3H7S A;  2L05 A;  2A4Z A;  2BWF A;  2MBB B;  4K1R B;  2DEN B;  3A9J B;  2G4S A;  2KMA A;  1R4M I;  3HK0 A;  2EMT A;  2LGY A;  3TBL D;  3VH4 B;  3PV1 A;  1GC6 A;  2KDI A;  3CF6 E;  4F8C B;  1XT9 B;  3PRP B;  1WY8 A;  4OVV A;  3WAM A;  2A5U A;  4FJV B;  2MBE A;  3V6E B;  4DHJ D;  2C7H A;  1J0G A;  2KWV B;  3Q3J A;  3ZDM C;  4GGQ A;  5CX3 A;  2GBK A;  4AOF A;  2AYO B;  2MP2 A;  2ZCC A;  3HIZ A;  4M8M A;  2KTF A;  4NAW B;  4MSM B;  2AL3 A;  4A20 A;  2KQS A;  2KJR A;  1Z5S B;  2I1J A;  2L7R A;  3APD A;  4II2 B;  1KM7 A;  3MHS D;  2LZ6 A;  3PTF C;  3L54 A;  2KLG A;  1Q1O A;  3AI5 A;  3ALB A;  3ZUN A;  4KV2 A;  5L95 C;  4TQ0 A;  3UIO B;  2BF8 B;  1WYW B;  4BKT A;  4NQK E;  2I1K A;  3L16 A;  2LUE A;  2WWZ A;  2BYV E;  3WAO A;  5DPW A;  1ZGU B;  2O6V A;  2LGD A;  2MWS B;  2C5L C;  4DHZ E;  3TCA A;  2BGF A;  1WFY A;  2V1Y A;  4KZ0 A;  4ZRI A;  3WAN A;  4NQL B;  5JZE B;  2O6V D;  1ISN A;  4KZC A;  1I35 A;  5CHW A;  2KTR B;  4F7Z A;  1WX7 A;  2L8J A;  1UZX B;  3A9J A;  3ONS A;  4W9H A;  1Q5W B;  2CU1 A;  2NBU A;  1F9J A;  2JRH A;  4HWI B;  4BBN C;  2PJH A;  3QK0 A;  3KUC B;  3DBL I;  2BYE A;  3DVG Y;  4NAW A;  1NBF C;  4PS3 A;  2N9P C;  3VUX A;  3QC8 B;  2BKR B;  2M17 A;  4AJY B;  1SGH A;  3O65 B;  3DBR I;  3KW5 B;  4G11 A;  1S3S G;  1WRD B;  3M95 A;  2DAJ A;  3D32 A;  3UQB A;  3KUZ A;  3ML8 A;  1WX8 A;  5LXH A;  2ZZP B;  3OJ4 B;  3X23 A;  3N3K B;  3B1L X;  1WGY A;  4W9D A;  2K39 A;  5AEK B;  3ZRF A;  1TGZ B;  2C7M B;  1G6J A;  1P1A A;  1E8Z A;  4PYU A;  2KDE B;  1HE8 A;  1H8C A;  1P98 A;  2LXA A;  3M3J A;  4RMA A;  4RM9 A;  4AUQ C;  4FN2 A;  4CHK A;  3ZTD A;  2KX3 A;  3U30 A;  1OEY A;  1WXA A;  4W9F A;  3EC8 A;  4JLC A;  2C60 A;  2KTR A;  4ASW C;  1OTR B;  4HDO A;  2V3S A;  3EHV A;  1V5T A;  5CTR C;  2MX2 A;  3RCZ A;  1WMH B;  4MM3 A;  4GN1 A;  2L0F A;  3APC A;  1RRB A;  3A33 B;  2EMS A;  2MA9 B;  2DYO A;  3ZW3 A;  2KDF B;  3PRM B;  4WWP A;  4ZRJ A;  5G2N A;  3W1Y A;  4IUM B;  1S1Q B;  3A1Q B;  4TV3 A;  3ECI A;  3TL5 A;  3SU8 X;  1E8X A;  2BYF A;  1EF5 A;  3AXC A;  2JY6 A;  3MTN B;  3N32 A;  3RUI B;  1KOT A;  3AU5 A;  1LM8 B;  4GDL B;  3DDC B;  3KUD B;  3DVN U;  5EDS A;  3CST A;  4M8N A;  3RT3 B;  1QZE A;  2GBJ A;  3A9K B;  2V4L A;  3ZNH B;  2JZ3 B;  4EOY A;  1PQS A;  2MP2 B;  2VRR B;  3L17 A;  4K7W A;  3TJP A;  3A4R A;  4MJS B;  4KSL C;  2ZVO A;  3PHX B;  3JYU A;  1WE7 A;  2PEA A;  4W9I A;  2LGX A;  4CYE A;  1WGD A;  2ZPN A;  5LLI A;  3V6C B;  1WZ0 A;  1NDD A;  1YQB A;  2CHZ A;  4WJO A;  3DQV A;  1EF1 A;  3ENE A;  3NS8 A;  2G3Q B;  3VFK A;  2AWT A;  3UQA A;  4WQO B;  3IHP C;  2FIF A;  3PS6 A;  2O2V B;  1WGG A;  2HJ8 A;  1H4R A;  2KX0 A;  2MW5 A;  5J18 A;  2N9E B;  4MGY E;  3RZF A;  4DDG D;  4URK A;  1LFD A;  1WH3 A;  4KSK C;  1AAR A;  2N1W A;  3K9P B;  4EZL A;  2R2Q A;  4J6I A;  1IPG A;  4MEM A;  4MGZ E;  3A1Q A;  3LJ3 A;  3DBH I;  2J7Q B;  1WZ3 A;  4TUU A;  5E6N A;  2OJR A;  5C23 A;  4BOZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...