2N9EB

Structure of sumo-2 bound to phosphorylated rap80 sim
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords BRCA1-A complex subunit RAP80
publication title Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9eB01
3U30A 3KVFB 4X57B 2KVRA 2WYQA 3TMPB 3M95A 2J0KA 4K7SA 4LJOB 3U7DA 5HKHA 4HDQA 2G45B 3DBLI 3OLMD 1V5TA 4BKGA 4F1SA 4EUTA 2NPTB 2ZNVB 2KQSA 1P0RA 3EHVA 2BYFA 5L95C 3VFKA 2ZCCA 2WX0A 4FJZA 4K7UA 3SD5A 3QHTA 5CHVC 1Z2MA 2ZJDA 2VRRB 1V49A 2LVPA 4DWFA 3HHMA 3KUDB 4IC7B 5AEKB 2N7DA 3ZW3A 2A5UA 2DZKA 1WZ0A 4WJQA 2KDBA 5J17A 3V6EB 5AZGA 4BVUC 2K25A 3JSVB 2N7EA 3L08A 4GXBA 4KDIC 4B9KA 3PRZA 3LDZE 2FIFA 1IPGA 3LJ3A 4BKSD 1V80A 2OOBB 2JZ3B 2ZZPB 2BYEA 3APCA 4AWJA 3M62B 2CS4A 3EC8A 3TCAA 4KIKA 2LI5A 1V81A 4G11A 4W9IA 4IM0A 4BFRA 4KVGB 3UIOB 3W1SA 4KZ0A 2DX5B 2BPSA 2XK5A 3DVNU 1LFDA 3IFWB 2KN5A 3PS6A 4WWPA 1OEYA 5AZFA 3DVGY 1V6EA 3VTWA 2FAZA 2GBRA 1WX9A 1GC7A 2FNJB 3ECIA 2FIDA 2D2QA 3IG3A 2O6VB 2O6VD 2LWPA 3N32A 1RFAA 3ZTCA 5DPTA 1WGYA 2REXA 3PT2B 2DENB 3ZO5B 1HE8A 3U8ZA 2CHZA 4XC2A 3JW0X 1Z5SB 3VTVA 4DDGD 2NPTA 2JVCA 3NS8A 3AI5A 1ISNA 2ZCBA 4I6LB 3KH0A 4W9HA 3ZDMC 4A3PA 2K6QA 1I35A 3K9OB 3R66C 4FJVB 2DZIA 2J0JA 3K9PB 1D3ZA 2C7NB 3N30A 1GJZA 1RAXA 2MW5A 4N9F4 2JT4B 1E7UA 2GMIC 3AXCA 3DQVA 3H7PB 4DHZB 4FHKA 4PS3A 1OQYA 3W1SC 3SU8X 1TTNA 2L7RA 3UQAA 4MEMA 2KO3A 4ANUA 1GG3A 2ZPYA 2RGFA 2IYDB 2O2VB 3IVFA 4FBJB 2MWSB 2KANA 2YVCA 1K8RB 4TUUA 2B3AA 5DPWA 4P7IA 3X23A 1X1MA 2M8SA 3CSTA 3JSVA 1WXMA 4FA6A 4FJYA 1V5OA 1P9DU 2KJRA 4LDTD 5EDSA 2C5LC 4AJYB 3L10B 3VXWA 4ICVA 4WJNA 3RT3B 2KC1A 1KM7A 4AOFA 3A4RA 3TBLD 4ZYNA 3PTFC 5J18A 2N1VA 1Q1OA 2M0XA 4JLCA 2ZNVC 4PS8A 1Q0WB 4W9GA 4YL8A 4G0NB 2KDIA 5GMVA 3ZKJC 1UELA 4KZCA 3V61A 2LRUA 4A3OA 5D6JB 4NY0A 2KFKB 2KWCA 4GB9A 4DBGA 3L16A 3VHTC 1UGMA 2FCMA 2O6VA 3BY4B 4I6PA 1UBQA 4EOYA 2ZEQA 2PE9A 2C9WB 1SE9A 3A33B 1WZ3A 3R3MA 4J6IA 2M1MA 4HJKA 5IAAC 3WA0A 2RR9A 4M0WB 5FR6A 3NHEB 5D7GA 4E71A 3AU4A 4EEWA 2CHWA 2C7HA 1WR1A 3CSFA 1RLFA 3V60A 3L17A 3W1YA 3R7QA 2J0MA 4PS7A 3H6NA 2IBIB 1E8ZA 3KUZA 3JVZX 2ZVNA 2G3QB 1UBIA 3VAWA 2KHWB 2ZVOA 2NBUA 2MCNB 4DXAB 2BYVE 1YX5B 2K6DB 3ENEA 4GIVA 4W9KA 3H7PA 2FCNA 4AJWA 2L0TA 1KLVA 2AL3A 2KDFB 2N9EB 2K8BA 3A9JB 4GOCA 4KDLB 4MELA 1EO6A 3P2BA 4HVBA 3MHSD 4WWNA 3B1LX 1MG8A 2L3ZA 2CKHB 2KX3A 2RPQA 2WWZA 3PGEA 3DPDA 4ZRIA 4TKNA 4A20A 2O2VA 1WGDA 2K1FA 5CHWA 2GBNA 2I1KA 4NNJB 4GMVA 1LM8B 2ZPNA 3KW5B 3RD2A 1GNUA 1SIFA 1WF9A 1GUAB 1XT9B 3HK0A 3IBEA 3M63B 2N1WA 2GBKA 3VUXA 3ZNHB 3WIMA 5JHAA 4GSWA 2J7QB 2FCSA 3QARA 2JF5A 1V2YA 2AWTA 2NBWB 3B08A 4GDLB 4ZRJA 2K8CA 4K7WA 2KFJA 3HM6X 2XBBC 4HXDA 2KNBA 5D94A 3QK0A 2HTHA 2HD5B 2CU1A 2OJRA 3APFA 3H9DA 2JY6A 2KFKA 3MJWA 2EMTA 3C0RB 3ML9A 2KWVB 3QJZA 4HK2A 4ZDVA 4I6NB 5KHQA 1XQQA 4DK5A 2IY1B 3NOBA 3PHWB 3PZDA 4HDOA 3UQBA 4W9JA 3RULA 1J0GA 2JWZA 2M17A 1NBFC 4FADA 4W9DA 2K39A 4K81A 3ML8A 5TR5A 1EF5A 1WM2A 3AU5A 4EZJA 4EZKA 4ANXA 4E74A 1RRBA 3KUCB 1E5WA 1E90A 1WE7A 4RM8A 1EF1A 3R7RA 1IYFA 3WANA 1LQBA 3RCZA 2C7MB 3A1QB 2DYOA 3BINA 4GU2A 3DBHI 4HLEA 2L76A 3GOEA 3QC8B 1AARA 3ZTDA 4MM3A 3SHQA 1G6JA 5DPSA 4ANWA 2KTFA 1J19A 3TIXA 3A9KB 3WALA 3QIJA 1TZ1A 1OTRB 3RZWC 3UF8A 4K1RB 3OJ3A 3JYUA 4MGZE 4XZ4A 1ZKHA 2D3GA 1V86A 2IO3B 2NVUI 2KMAA 4PYZA 3VH4B 2GOWA 5LXIB 2DYBA 1WMHB 3NY5A 2V4LA 3QAQA 4WAAA 3QQ8B 4HPLB 4WJOA 2GBMA 3VTUA 3DCGA 5G2NA 1KOTA 4KV2A 4G50A 4IM2A 2Z0EB 2KZRA 4XX5A 2MBBB 1WI0A 4GDKB 4JIOU 4MGYE 4MGKE 3PLUA 2L00B 2BKFA 5J2RA 3NZUA 4CYEA 4MSMB 2IO1B 1TGZB 2IZVB 5JZEB 2Z59B 2AL6A 2YLMA 3ZNZB 1WRDB 2KQ7A 1E8YA 3B0AA 4NPNA 4MSQB 4OVUA 2KOXA 1WYWB 2PPHA 1EUVB 1P3QU 2KC2A 2MA9B 1ZW7A 2R2OA 4RM9A 3APDA 4EZLA 3WAOA 1QZEA 1S3SG 4M8NA 1P1AA 3GZNI 3PV1A 2DAFA 2LGDA 4AP4C 5DCNA 3PPAA 2BWFA 3WAMA 3ALBA 3PRPB 4RMAA 1U4AA 1P98A 1L7YA 1I42A 3AULA 2DAJA 3RUIB 5L83A 2Y5BB 1WJ6A 5LXHA 2MBHA 2JPHA 5JH5C 2HE7A 3VVWB 4BBNF 2N9XA 2NS5A 3V6CB 3A1QA 3PSEB 3RYTA 4HPMB 1WGGA 1YJ1A 2DZJA 2DZMA 4W9FA 4MJSB 2L05A 4W9EA 1T0YA 4II2B 1YIWA 3PREA 4BOSC 4IWOA 2WDTB 1WGRA 2KWUB 2W9NA 1E8WA 1H4RA 1NI2A 2AYOB 1VD2A 3A9KA 2AEHA 4LJPB 3VDZA 1BT0A 1WJUA 2MBOA 4NAWB 1OEYJ 2DHZA 2MP2B 4TQ0A 3TL5A 2LASA 1WXAA 3HM3A 4ICUA 1WFYA 3N3KB 2LGXA 1WE6A 2ASQA 4G3XB 4F7ZA 1WMHA 3RZFA 2NR2A 1TBEA 3OAWA 3A4SC 1VCBA 2V3SA 3QX1A 1YX6B 5E6NA 3V62A 2MX2A 2C60A 2JXXA 1A5RA 4W9CA 4GDKA 3UIPB 2KDEB 4PYUA 4CHKA 3VH3B 2MSED 1E7VA 2RD0A 1UZXB 4GGQA 2MRPA 5E6PA 2UWQA 4IUMB 5CTRC 2KTRB 2FUHB 2MLBA 4BOZB 3DOWA 2IY0B 4FLHA 3EECA 3L0WB 1YQBA 5G55A 3H1UA 2MQJA 3H7SA 4ANVA 1WJNA 2PE6B 2KKCA 2LJ5A 3ZNGC 3ZNID 2LZ6A 4M8MA 4IWPA 2LUEA 1J8CA 2MBQA 2LGYA 4JGHB 3IHPC 2I1JA 1NDDA 1L2NA 3CMMB 3KYDD 1WY8A 2LVOA 2L8JA 1PQSA 2D07B 2KK8A 3L54A 2KJHB 3NZSA 4JL9A 4FN2A 4BBNC 4EKUA 2KMCA 4CO7A 3T8MA 4ZRKA 1YD8U 2BF8B 4DHJB 4DHJD 1GC6A 3MTNB 3ZIMA 3ZRFA 3DBSA 4MJSA 2D11A 2KLCA 1WJ4A 1WR6E 4TQ1A 3QCAA 2L0FA 3QA8A 4HCPB 1WXSA 2V1YA 3ZUNA 5DPRA 4KSLC 4WWOA 3DVNV 3HIZA 3M3JA 1V9JA 1ZGUB 3PRMB 4DHZE 2LD9A 2MP2A 1M94A 1WH3A 4NAWA 2IO2B 5JHBA 4E3CA 3SDLC 5C1ZA 3I3TB 4WQOB 3A9JA 1R4NI 2BWES 5E6OA 1KJTA 3KYCD 3O65B 2DYMA 5LLIA 4IG7B 4BKTA 3TJPA 2M4NA 1UD7A 3ZDTA 4ASWC 2LXCA 2G4DB 4DDID 2WX1A 1IP9A 3D32A 2A4ZA 2KTRA 3PVLA 2KXJA 2R2QA 4EFOA 4F8CB 2JRIB 2CHXA 3DDCB 2JRHA 4GDLA 4WJPA 1UH6A 2NCNA 4B95A 2CR5A 3CF6E 3QWZB 1S1QB 3EFUA 2KJ6A 2G4SA 1WGHA 3Q3JA 3ZVVA 4HCNB 5IA7A 4NJ6A 3T9LA 2D10A 4MGIE 1C3TA 2N9PC 4B6WA 3L13A 3DBRI 2QHOA 2UYZB 4LCDE 4IM3A 1H8CA 1WIAA 4MH0E 3WAPA 2LVQA 2MBEA 2GBJA 5CX3A 3S2AA 2JUOA 5D2MB 4IW0A 3VUYA 5CHFA 3ZLZA 3PLVA 4LDTB 4NQKE 3VUWA 3DVGX 4BKSA 2FCQA 4AUQC 4MDKE 2JZZA 1R4MI 4FHJA 1F9JA 4II3B 2LRWA 2PEAA 3ONSA 3Q3FA 4NQLB 1Y8RC 4W9LA 4IWQA 4FULA 1WX7A 2LXAA 2EKEC 3UGBB 2EMSA 4URKA 2BGFA 1CMXB 1XD3B 2N4FA 2IO0B 4KSKC 3UINB 2KLGA 1SGHA 2BKRB 2XEWA 4JQWC 3X0WA 2RSUA 4OVVA 4KIKB 4HWIB 5C23A 3VQIA 2HJ8A 5BO4B 1WXVA 4NJ7A 1WM3A 2NBVB 5KHOA 3PHXB 2Z0DB 2XK5B 1C1YB 5AZHA 3ZRCA 2KD0A 3OJ4B 2PJHA 1E8XA 1OGWA 1WX8A 1FXTB 1LXDA 1JRUA 1Q5WB 2K8HA 2KX0A 4TV3A 4GN1A
chains in the Genus database with same CATH superfamily
4EE2A 1OQQA 5EE0A 2G45B 3NS1A 4LNKA 4PK1A 2VH1A 1E9MA 1HA5A 4ITKA 4K7UA 1IUEA 1E10A 3MJ5A 3HHMA 4IC7B 2WNMA 3ZW3A 1KFYB 1TKGA 4N6EB 1VLBA 1C4AA 4BVUC 1NVID 3JSVB 4B9KA 3BVZA 3DWGC 1IPGA 1XLPA 2JZ3B 2ZZPB 1ZPSA 2BYEA 3M62B 4KIKA 2LI5A 3AEDB 4G11A 2BPSA 3DVNU 3DVGY 1V6EA 3VTWA 2FAZA 4S17A 2GBRA 1WX9A 4K3CA 2D2QA 3IG3A 2O6VB 2LWPA 3TEXA 1MG4A 3N1YC 1WGYA 1K52A 2DENB 1I7HA 2W82A 1ZXIA 5H8YE 4XC2A 4DDGD 3AI5A 1WSPA 1ISNA 1UGJA 4I6LB 3ETRA 3K9OB 3K9PB 2C7NB 1GJZA 3NVVA 2GMIC 3NG0A 4DHZB 2J42A 1KH0A 4B0MA 3U2SC 1TTNA 3DBRB 2IYDB 2L1AA 1WXQA 4RF0A 5DPWA 1X1MA 3CSTA 1WXMA 4YWGG 3IT6B 4FJYA 4LDTD 1P9DU 5EDSA 1YQ4B 2WU2B 4US9A 3BZDB 4G0NB 1XLNA 2LJIA 2HDEA 2KFKB 3NVYA 1ZDXA 3VHTC 4JWUC 1XCQL 3AEAB 1ZXHA 2PE9A 2C9WB 3A33B 5IAAC 2QILA 2M1MA 5FR6A 5D7GA 2CHWA 1WR1A 3DHHC 2WXGA 1UWXA 1E8ZA 2ZVNA 3VAWA 2WDRB 3TEZA 2MCNB 3TEYA 2BYVE 5IP4D 1YX5B 2WHIA 4W9KA 1TKYA 2FCNA 1N63A 2PTLA 4AJWA 1KLVA 2AL3A 1KLGD 3A9JB 2K8BA 4HVBA 3MHSD 2RPQA 1FRRA 2K1FA 4CQNA 4NNJB 5JXVA 2ONQA 3IAM1 2ZPNA 1VZ7A 3IT4B 1GNUA 1T0SC 1YNTE 1GUAB 1XT9B 3M63B 3ZNHB 4P1BC 2BS3B 3WIMA 4WH4A 3QARA 2JF5A 2NBWB 4ZRJA 2KFJA 3MP9A 2HJ1A 4IDIA 2LEKA 3H9DA 2YEPF 3APFA 5EE1A 4DK5A 1C3TA 3NOBA 3PZDA 3UQBA 4RCOA 2J52A 3HUIA 1DGJA 4FADA 4K81A 4EZJA 4ANXA 4E74A 1E5WA 1HQRD 2N9LA 2ON8A 3AEFB 4YTPB 3WANA 1FEHA 1NI3A 3RCZA 1T5XD 2DYOA 4GU2A 4HLEA 3ZTDA 4JWSC 3R8BA 1TS4A 1G6JA 2N0SB 5DPSA 4ANWA 2KTFA 4L23A 3QIJA 3UF8A 4K1RB 4LTUA 2NVUI 2K9XA 1FXAA 3AE8B 2WXLA 3NY5A 2V4LA 3QAQA 4WJOA 3VTUA 5I4DA 3W5VB 3DCGA 4IM2A 4RH6A 4XX5A 2ZW1A 4ARIA 2L00B 4MSMB 4MT5A 1HXYD 1WRDB 1RYJA 1EUVB 2BQQA 1XLQA 1S3SG 2DAFA 2BW2A 5DCNA 2BWFA 5HI1A 4C4VB 3PRPB 1U4AA 1P98A 1MFWA 1K50A 1ZP0B 1I4QA 2MBHA 3VVWB 2N9XA 3A1QA 5AUKA 2WDVB 1YIWA 3PREA 2WDTB 1B1ZA 1WGRA 1GB1A 2G9HD 1OEYJ 1XLOA 2D3AA 2LASA 3ZJUA 1WFYA 1WE6A 5IO9A 1L6VA 1YN5A 1TBEA 3QX1A 1YX6B 1SJED 4W9CA 4XDDA 2AX5A 1T6BX 2G1EA 1E7VA 4HEA1 3GS2A 1P7FA 2MRPA 3SEBA 2UWQA 1BUIC 1HZ6A 2IY0B 3L0WB 3H1UA 2MQJA 4ARCA 4ANVA 1L4ZB 2PE6B 5BYQA 1NYRA 2K22A 4HKZE 4KKIA 2LGYA 4O1NA 4JGHB 1NDDA 3CMMB 3ZJTA 3NZSA 2D07B 4EKUA 4ZRQA 1I4GA 2FUG1 4ZRKA 5C2TB 4DHJD 3MC8A 1WGKA 2L0FA 1FCCC 2V1YA 3ZUNA 3P63A 5FR3A 4KSLC 3M3JA 3HIZA 3NUHB 1HEZE 4M00A 1M94A 4E3CA 1ET6A 2WGSA 4RGNA 3O65B 3NVWA 2DYMA 3MHZA 2V4IB 4BKTA 1SB3C 3ZXVA 2G4DB 2WX1A 3D32A 3AE7B 2PW9A 2CHXA 3DDCB 2JRHA 1XXGA 4B95A 2CR5A 3QWZB 1UUPA 3MFGA 2KJ6A 2G4SA 3BWUD 3BYTB 1WGHA 3ZVVA 5IA7A 2SAKA 2N9PC 4A6QA 4B6WA 1V1PB 3L13A 4IM3A 2IGDA 1WIAA 1TZOA 1J7AA 2LVQA 5CX3A 3UI3A 1RWSA 3VUYA 1D5MC 3DVGX 2NTTA 2JZZA 3B9JA 3Q3FA 2ZW0A 2INCC 1SXTA 1SGHA 1HTOA 1VR9A 2OHFA 2HJ8A 2AQ3B 5BO4B 4NJ7A 1WM3A 2M19A 2KVZA 5KHOA 2RDHA 3J9CA 2KD0A 3OJ4B 2PJHA 1Q5WB 2H88B 3KVFB 2IDYA 4LJOB 5HKHA 4HDQA 2L32A 4A55A 3OLMD 1GAQB 4F1SA 4EUTA 2IPKD 3EHVA 5IKCM 2WX0A 3NRZA 4FJZA 1F1HA 1QKZA 3QHTA 5CHVC 1F2RC 1Z2MA 2ZJDA 2MJDA 1SBBB 2PKOA 4DWFA 5E6JA 2WP9B 4RGOS 3VRAB 1MHHE 2A5UA 2VH2A 5J17A 4KX6B 2N7EA 3LDZE 3PZ8A 2FIFA 3Q8BA 5BMHA 2OOBB 3APCA 4AWJA 2CS4A 3EC8A 3TCAA 3AE2B 4L1BA 4W9IA 1SSNA 1DOYA 3AECB 1PDXA 3SFEB 4C7ZA 3CIRB 2XK5A 1ENFA 3IFWB 4WWPA 4A90A 2DWQA 2FIDA 1QOFA 3URYA 2KYWA 2REXA 3GE3C 1PGAA 3ZO5B 1HE8A 1N5XA 3JW0X 1YMHE 3NS8A 1TIFA 2NMQA 2K3UA 4W9HA 3ZDMC 1I35A 2K6QA 3R66C 4FJVB 2J0JA 2M0AA 3AM9A 2MW5A 4N9F4 3H7PB 1E7UA 2L52A 3I57A 2L7RA 3UQAA 1V8CA 3ZJVA 2RGFA 2O2VB 2KANA 1K8RB 4WAFA 3X23A 3JSVA 3LB8C 1JCKB 2QIEB 4ICVA 2I38A 2KC1A 1KM7A 3A4RA 1MHXA 1QILA 1L0VB 4TMAB 4YL8A 4KZCA 3B2FA 4A3OA 5D6JB 1I4HA 4YSXB 4GB9A 2PLPA 3L16A 3RNAC 1PFDA 2O6VA 3BY4B 1UBQA 4I6PA 3PZ7A 1WZ3A 3R3MA 1D5ZC 3NHEB 3AU4A 2E6XA 1RLFA 3L17A 3W1YA 3R7QA 5C3JB 2YEPB 1SEBD 2K0PA 2KT7A 2G3QB 1UBIA 2WU5B 1PGBA 2NBUA 4MM3B 3ENEA 2K6DB 4XE0A 2PIAA 5HG2A 2L0TA 2KDFB 2N9EB 3R2IA 4GOCA 4MELA 3P2BA 3B1LX 2CKHB 3AV8A 3Q8CA 4TKNA 1WGDA 1YN3A 3HRDD 4LK0M 2I1KA 3IXSA 5BMIA 4GMVA 1AYFA 2GBKA 3V3XA 2J7QB 2WXHA 1SIJA 2AWTA 2SEBD 3B2GA 2OJRA 3BIID 2KFKA 3C0RB 1K53A 4I6NB 3PHWB 4W9JA 3RULA 4LNOA 3CWIA 2JWZA 3ML8A 3W2DA 1EF5A 1E90A 3R7RA 1K51A 1ZE3D 1N5WA 2OJWA 3Q8EA 4JPSA 2VZKB 4TSSA 2L76A 5EE3A 2QEJC 3TIXA 2BYTA 1TZ1A 4YT0B 2WXMA 4XZ4A 2D3CA 2R61A 4PYZA 3ZYYX 2EELA 1SE4A 2AQ1B 2GOWA 4WAAA 3OG5A 4HPLB 5BYRA 4KV2A 2KZRA 2MBBB 1JWBD 1WI0A 3Q14C 4MGYE 3PLUA 1N61A 1F0ZA 2IO1B 1TGZB 2WXQA 2Z59B 2W3RA 4M01A 1WYWB 1SE3A 2PPHA 1P3QU 2MA9B 1ZW7A 4EZLA 1QZEA 4REZA 1T3QA 1P1AA 3GZNI 1D5XC 3PPAA 3ALBA 2TSSA 4UDUC 3AULA 1XO3A 3RUIB 2Y5BB 1WJ6A 2W54A 2BT6A 3MC9A 2NS5A 3AB5A 4P1CC 1WGGA 1YJ1A 4BOSC 1KRHA 2L05A 4MJSB 1T0YA 4II2B 4W9EA 1BXTA 4IWOA 2WXNA 2AYOB 2MBOA 2J4XA 4NAWB 2DHZA 2MP2B 4TQ0A 1WXAA 3N3KB 2JXTA 4YSZB 3VR9B 3A4SC 1JQ4A 1VCBA 3N1XC 1A5RA 3UIPB 2KDEB 4CHKA 5HHDG 2JSVX 2RD0A 1UZXB 2GLSA 2FUHB 3DOWA 4FLHA 2JWUA 1MVKA 3EUB2 3H7SA 1QT9A 1WJNA 5T8IA 2LJ5A 3ZNID 4IWPA 2LUEA 2DLBA 3P42A 4KGRA 2I1JA 4LNFA 4C4VA 3FILB 1WY8A 2LVOA 3L54A 2KK8A 2KMCA 4CO7A 2JX5A 1HZ5A 3Q8FA 2BF8B 4DHJB 3DBSA 1WR6E 1XF5L 4D2KA 3QA8A 1WXSA 2RDBC 2VZKD 4P6VF 1GOZA 3PRMB 3P1MA 1WH3A 2KN4A 3HVDA 5C1ZA 2WDQB 3EGRA 2BB6A 1R4NI 4Q2JA 3E56A 4ZRPA 5LLIA 1IBXB 2WQYB 2Y5PA 3ZXRA 3Q3MC 2LUMA 4GLSC 1KTKA 2KXJA 2R2QA 4EFOA 4GDLA 2ICIA 4WJPA 3CF6E 2PMVA 1S1QB 3AMZA 3Q3JA 3IAS1 1L6UA 3RNCC 3T9LA 2D10A 2WXJA 2QHOA 3WAPA 1WYGA 2JU6X 1NEKB 1JWAD 1E7PB 3PLVA 4NQKE 3VUWA 5HFYA 2FCQA 4AUQC 4C80A 4MDKE 4FHJA 4KKJA 4LNNA 2MHJA 1JWSD 2PEAA 1Y8RC 4IWQA 3AE5B 1L0XB 1WX7A 1I4PA 3BYYB 2N4FA 2IO0B 2LHEA 3RMKC 2XEWA 2RSUA 5C23A 2Z0DB 3ZRCA 4N59A 1E8XA 3C8YA 3EFCA 5IOIA 1CJEA 2K8HA 2Q5WD 3U30A 1TS2A 4X57B 2WYQA 3TMPB 3M95A 2KMMA 3U7DA 3Q2AC 2H89B 3DBLI 1V5TA 4BKGA 3V05A 2NPTB 2ZNVB 2KQSA 1P0RA 5L95C 3KWVA 3AN1A 1KF6B 2ZCCA 3P4QB 1VDVA 3SD5A 5AUIA 1V1PA 2MJEA 2XNAC 2LVPA 3AEEB 5AEKB 3VR8B 2N7DA 1D6EC 5BMGA 4YTMB 3V6EB 2K25A 4GXBA 3PRZA 4OZBA 4YXDB 3LJ3A 5FK9C 4BKSD 1FNUA 4KGSA 1FFUA 1FNWA 3AH7A 1V81A 1RM6C 4BFRA 4KVGB 4RNAA 3UIOB 2DX5B 3E9SA 2KN5A 2WS3B 1FD6A 2FNJB 3ECIA 3RPFC 1QOAA 2OEDA 3W9CB 1RFAA 2QSDA 3ZTCA 1FO4A 3KLSX 3Q69A 1VRAB 1TJEA 3P4PB 2HTME 2NTSA 4JX1C 3N30A 1XCTL 1RAXA 4K3BA 1MI0A 3AXCA 4FHKA 3W1SC 1ESFA 1AW7A 3SU8X 2KO3A 4ANUA 5GXGB 1YJJA 3U52E 2D5GA 2MWSB 2YVCA 1AN8A 1TY2A 2B3AA 2M8SA 4FA6A 2IJ0A 2C5LC 2PVOD 3L10B 3RT3B 4WJNA 4AOFA 2M0XA 4W9GA 2ZNVC 4PS8A 1Q0WB 4RGTA 3ZKJC 3V61A 2LRUA 4NY0A 2KWCA 2WLBA 2FCMA 4XWWA 2ZEQA 4J6IA 2RMMA 2RR9A 3R2TA 4M0WB 4S0RA 4E71A 4EEWA 1MPEA 2J0MA 2RDGA 3VRBB 2QDFA 1CQVA 4XWTA 2Z8LA 2KHWB 2ZVOA 4GIVA 1ACCA 3H7PA 1UNSA 1C79A 3KQ4A 4KDLB 1MG8A 2FE8A 2KX3A 2L3ZA 2WWZA 4ZRIA 3DPDA 2O2VA 2LHDA 2WXIA 1V1OA 4M02A 3KW5B 2DBYA 4MACA 3ZQ4A 1SIFA 3HK0A 3VUXA 4GSWA 1OQRA 2FCSA 3RNBC 1JMLA 2GB1A 3B08A 2AQ2B 1C4CA 3I5JC 3GP7A 3O13A 3P4RB 4HXDA 2KNBA 2EKIA 2JZPA 5D94A 3QK0A 2CU1A 3ML9A 3MJWA 2EMTA 3QJZA 2KWVB 1QQRA 2WXOA 5KHQA 3FAHA 1J0GA 1NBFC 3L4PA 2INNE 2JYEA 1XEEA 1VJKA 1STEA 1WM2A 3AU5A 1EWYC 4EZKA 2CU3A 4C7YA 1WE7A 4L2YA 1JROA 1EF1A 1IYFA 1LQBA 3NVZA 4HPPA 3DBHI 3GOEA 2QMTA 4MM3A 3DHIC 4RGMA 3A9KB 3N20C 2INDC 3RNFC 1ZKHA 2D3GA 1V86A 1EM7A 3LXFA 5D3DA 3N9YC 3VH4B 5LXIB 2DYBA 2QCZA 1WMHB 1AWDA 1GPXA 1R7SA 4GDKB 4YTNB 4MGKE 2BKFA 5J2RA 2WXPA 5EE9A 4CYEA 1FIQA 2IZVB 2KACA 1R4MB 3ZNZB 3P4SB 2KQ7A 1F77A 2BS4B 3B0AA 4MSQB 4NPNA 4OVUA 5LNK1 1OFFA 3KWLA 2KC2A 3PO0A 4RM9A 3T3NA 3BVGA 4M8NA 2LGDA 4AP4C 1VZ6A 3RNEC 3WAMA 1L7YA 5L83A 5LXHA 2JPHA 4BBNF 3V6CB 5H92C 1JW9D 1J7BA 3RYTA 4HPMB 2DZJA 3N1ZC 2WXRA 2KWUB 1E8WA 1H4RA 2AEHA 3VDZA 1FRDA 1BT0A 3HM3A 4ICUA 2MEKA 2LGXA 2ASQA 1PGXA 3RZFA 2NR2A 2I2YA 2J53A 3OAWA 2MJ3A 3RNGC 2V3SA 3V62A 4PYUA 4YSYB 3VH3B 1A70A 4QAYA 4GGQA 3U7ZA 5CTRC 2KTRB 2BBCA 1TY0A 2MLBA 4BOZB 5G55A 3MC0B 3ZNGC 2LZ6A 4M8MA 3NJTA 3I9V1 2MBQA 3NZ3A 3IHPC 1L2NA 3KYDD 2L8JA 1PQSA 2KJHB 1C78A 1YD8U 4ZOHC 4HJGE 1D4BA 1GC6A 3MTNB 3ZIMA 2QC8A 3ZRFA 4MJSA 2D11A 2KLCA 1WJ4A 2X8XX 2XN9C 4TQ1A 4HCPB 5DPRA 2WXKA 4WWOA 2LMCA 1V9JA 1ZGUB 4IKGA 4DHZE 2LD9A 2MP2A 4NAWA 2IO2B 5JHBA 1PUTA 4WQOB 3A9JA 1E0ZA 1T0QC 2BWES 1KJTA 3KYCD 2BB5A 4AQ7A 4P16A 1ROEA 1YN4A 2LXCA 4PT5A 3FC4A 4DDID 3Q8AA 1IP9A 2GRIA 2N9KA 4NAMA 1UH6A 1JWMD 2NCNA 2CJOA 4HCNB 2KDMA 1P7EA 3FILA 1YQ3B 3DBRI 2UYZB 4LCDE 3RFZB 1FMAD 3GZNB 3AEBB 4MH0E 2MBEA 2GBJA 4DXGA 1FNVA 1ZOYB 2JUOA 5CHFA 4BKSA 3BK1A 1MJDA 5G5HA 1F9JA 2LRWA 3ONSA 4W9LA 4FULA 1C76A 2LXAA 2EKEC 2EMSA 4URKA 4KGTA 2BGFA 1CMXB 1PYWD 1L4DB 3UINB 4JQWC 1B9RA 3X0WA 4KIKB 2INPE 1I4XA 1YOVB 4NZLB 2E3TA 1L5PA 1IBXA 1C1YB 5MPOA 1WX8A 1EWCA 3GE8C 1JRUA 1I4RA 4OZAA 4R3DA 1SF0A 4H2AA 4TV3A 3U4EG 4J3OD 2N7JA 2KVRA 2J0KA 4K7SA 4OHJA 3WCQA 2GI9A 2BYFA 2WXFA 3VFKA 1C77A 2DNFA 2VRRB 1V49A 1IGDA 1TYGB 3KUDB 2DZKA 1WZ0A 2V9HA 4WJQA 2KDBA 1SE2A 5AZGA 4A8XC 3L08A 4KDIC 4C56C 4DQOC 3OWEB 2KAJA 1V80A 2IGGA 1NYQA 4IM0A 3ABVB 3W1SA 4KZ0A 1LO5D 1LFDA 3T3OA 2KQ4X 3PS6A 5AZFA 1OEYA 2X38A 1R4NB 1GC7A 1C4PA 2O6VD 3N32A 1QLBB 3TEWA 5DPTA 3PT2B 5BYSA 4N58A 1T0RC 3U8ZA 2CHZA 1E6EB 1EU4A 1Z5SB 3VTVA 2NPTA 2JVCA 1VZ8A 2ZCBA 3FKYA 3KH0A 4A3PA 1DOXA 2DZIA 1D3ZA 2JT4B 3DQVA 4PS3A 1IGCA 1OQYA 4MEMA 1GG3A 2ZPYA 3IVFA 4FBJB 3Q3NC 4TUUA 4P7IA 2RPVA 1V5OA 2KJRA 4AJYB 3VXWA 1N60A 3TBLD 4ZYNA 3PTFC 5J18A 1QOBA 2N1VA 1Q1OA 4JLCA 2KDIA 5GMVA 1UELA 4ZHOA 3BK2A 4DBGA 4JE3B 1UGMA 1EU3A 4EOYA 4USAA 1SE9A 1JALA 4RFBA 3WA0A 4HJKA 1WWTA 3LYYA 4WQMA 2C7HA 3CSFA 4MH8A 3V60A 1TT5B 4PS7A 4BAXA 3H6NA 4WIPA 4LNIA 2IBIB 3KUZA 3JVZX 4LLGM 3DBLB 3Q6BA 2BS2B 4DXAB 3I63C 2JQRB 3AE3B 3SFDB 1HTQA 1EO6A 4WWNA 3PGEA 1TS3A 4A20A 5CHWA 2GBNA 1BMLC 1LM8B 2PVGC 1JWUD 5D3IB 5G5GA 3RD2A 1WF9A 3IBEA 2N1WA 5JHAA 1V2YA 4GDLB 1LGRA 2K8CA 4K7WA 3HM6X 4HKQA 4XGAB 2XBBC 2K5PA 2HTHA 2HD5B 2JY6A 4ZDVA 4HK2A 1XQQA 2IY1B 4HDOA 1L0YB 4OW0A 2M17A 4W9DA 2K39A 2LFIA 5TR5A 3TUOA 4M0WA 1DOIA 5TSSA 1RRBA 3KUCB 4RM8A 1N6ZA 3SR6A 4B0EA 3AE1B 3EA6A 2C7MB 2V3PA 3A1QB 3BINA 3QC8B 4IOIE 1AARA 4OZCA 3SHQA 1F2RI 1J19A 3WALA 2FBWB 1OTRB 3RZWC 3OJ3A 3JYUA 4XDCA 4MGZE 2IO3B 1F52A 2KMAA 3RI7C 3GB1A 2JYTA 4RF1A 3QQ8B 2GBMA 5G2NA 4A9AA 1KOTA 4G50A 2LGIA 2Z0EB 4JIOU 3AE9B 2UU7A 3NZUA 1N62A 5JZEB 2AL6A 2YLMA 1E8YA 1WRIA 2KOXA 1SJHD 4ZYSA 2R2OA 3APDA 3WAOA 3PV1A 2QJLA 3W5UB 2LGSA 1DYQA 1ZDVA 4ACFA 4RMAA 1KLUD 1UWMA 1I42A 2DAJA 5JH5C 2HE7A 3PSEB 2Y5CA 4W9FA 2DZMA 4BZAA 1UF0A 3DWMA 1FCLA 2MH7A 2W9NA 1ZUD2 1NI2A 1VD2A 1CK1A 3A9KA 4HRSA 4LJPB 2CJNA 1WJUA 1Y56A 3TL5A 3BVMA 4DXFA 4G3XB 4F7ZA 1WMHA 5E6NA 2D3BA 2MX2A 2C60A 2JXXA 2BTEA 4GDKA 1RFKA 4C00A 2MSED 1FFVA 1FXIA 5E6PA 4IUMB 2V0GA 3EECA 1NENB 2V3NA 1YQBA 2KKCA 1J8CA 2Y3AA 1FPYA 2W3SA 2M56B 4JL9A 4FN2A 4WURA 4BBNC 3T8MA 3AEGB 3H8HA 1C9FA 3DHGC 2IGHA 5IN7A 1M4VA 3QCAA 4NJCA 4AS1A 3AE4B 1V97A 1J7CA 3DVNV 3DBHB 3AE6B 3SDLC 2KWDA 1CZPA 3I3TB 1YJIA 5E6OA 1TS5A 4OVZA 1QF6A 2B76B 4IG7B 3TJPA 2M4NA 1UD7A 3ZDTA 4ASWC 5FKAC 2A4ZA 2KTRA 3PVLA 4WWMA 4F8CB 2JRIB 1FM0D 3EFUA 3Q3OC 3HVZA 4XYCA 4NJ6A 4MGIE 1Q10A 2ACZB 1H8CA 3S2AA 4US8A 3TSSA 5D2MB 4IW0A 3ZLZA 4LDTB 2BVCA 1R4MI 4II3B 4NQLB 3ZGZA 3UGBB 1XD3B 1QOGA 4KSKC 2KLGA 2W55A 2BKRB 4FXCA 4OVVA 1ET9A 4HWIB 1JRPA 3VQIA 3C19A 1WXVA 2NBVB 2L83A 3PHXB 4ZHPA 2XK5B 4HROA 5AZHA 3RN9C 1OGWA 1FXTB 1GB4A 1LXDA 2KX0A 1TKEA 4GN1A
chains in the Genus database with same CATH topology
3U30A 3KVFB 4X57B 2KVRA 2WYQA 3TMPB 3M95A 2J0KA 4K7SA 4LJOB 3U7DA 5HKHA 4HDQA 2G45B 3DBLI 3OLMD 1V5TA 4BKGA 4F1SA 4EUTA 2NPTB 2ZNVB 2KQSA 1P0RA 3EHVA 2BYFA 5L95C 3VFKA 2ZCCA 2WX0A 4FJZA 4K7UA 3SD5A 3QHTA 5CHVC 1Z2MA 2ZJDA 2VRRB 1V49A 2LVPA 4DWFA 3HHMA 3KUDB 4IC7B 5AEKB 2N7DA 3ZW3A 2A5UA 2DZKA 1WZ0A 4WJQA 2KDBA 5J17A 3V6EB 5AZGA 4BVUC 2K25A 3JSVB 2N7EA 3L08A 4GXBA 4KDIC 4B9KA 3PRZA 3LDZE 2FIFA 1IPGA 3LJ3A 4BKSD 1V80A 2OOBB 2JZ3B 2ZZPB 2BYEA 3APCA 4AWJA 3M62B 2CS4A 3EC8A 3TCAA 4KIKA 2LI5A 1V81A 4G11A 4W9IA 4IM0A 4BFRA 4KVGB 3UIOB 3W1SA 4KZ0A 2DX5B 2BPSA 2XK5A 3DVNU 1LFDA 3IFWB 2KN5A 3PS6A 4WWPA 1OEYA 5AZFA 3DVGY 1V6EA 3VTWA 2FAZA 2GBRA 1WX9A 1GC7A 2FNJB 3ECIA 2FIDA 2D2QA 3IG3A 2O6VB 2O6VD 2LWPA 3N32A 1RFAA 3ZTCA 5DPTA 1WGYA 2REXA 3PT2B 2DENB 3ZO5B 1HE8A 3U8ZA 2CHZA 4XC2A 3JW0X 1Z5SB 3VTVA 4DDGD 2NPTA 2JVCA 3NS8A 3AI5A 1ISNA 2ZCBA 4I6LB 3KH0A 4W9HA 3ZDMC 4A3PA 2K6QA 1I35A 3K9OB 3R66C 4FJVB 2DZIA 2J0JA 3K9PB 1D3ZA 2C7NB 3N30A 1GJZA 1RAXA 2MW5A 4N9F4 2JT4B 1E7UA 2GMIC 3AXCA 3DQVA 3H7PB 4DHZB 4FHKA 4PS3A 1OQYA 3W1SC 3SU8X 1TTNA 2L7RA 3UQAA 4MEMA 2KO3A 4ANUA 1GG3A 2ZPYA 2RGFA 2IYDB 2O2VB 3IVFA 4FBJB 2MWSB 2KANA 2YVCA 1K8RB 4TUUA 2B3AA 5DPWA 4P7IA 3X23A 1X1MA 2M8SA 3CSTA 3JSVA 1WXMA 4FA6A 4FJYA 1V5OA 1P9DU 2KJRA 4LDTD 5EDSA 2C5LC 4AJYB 3L10B 3VXWA 4ICVA 4WJNA 3RT3B 2KC1A 1KM7A 4AOFA 3A4RA 3TBLD 4ZYNA 3PTFC 5J18A 2N1VA 1Q1OA 2M0XA 4JLCA 2ZNVC 4PS8A 1Q0WB 4W9GA 4YL8A 4G0NB 2KDIA 5GMVA 3ZKJC 1UELA 4KZCA 3V61A 2LRUA 4A3OA 5D6JB 4NY0A 2KFKB 2KWCA 4GB9A 4DBGA 3L16A 3VHTC 1UGMA 2FCMA 2O6VA 3BY4B 4I6PA 1UBQA 4EOYA 2ZEQA 2PE9A 2C9WB 1SE9A 3A33B 1WZ3A 3R3MA 4J6IA 2M1MA 4HJKA 5IAAC 3WA0A 2RR9A 4M0WB 5FR6A 3NHEB 5D7GA 4E71A 3AU4A 4EEWA 2CHWA 2C7HA 1WR1A 3CSFA 1RLFA 3V60A 3L17A 3W1YA 3R7QA 2J0MA 4PS7A 3H6NA 2IBIB 1E8ZA 3KUZA 3JVZX 2ZVNA 2G3QB 1UBIA 3VAWA 2KHWB 2ZVOA 2NBUA 2MCNB 4DXAB 2BYVE 1YX5B 2K6DB 3ENEA 4GIVA 4W9KA 3H7PA 2FCNA 4AJWA 2L0TA 1KLVA 2AL3A 2KDFB 2N9EB 2K8BA 3A9JB 4GOCA 4KDLB 4MELA 1EO6A 3P2BA 4HVBA 3MHSD 4WWNA 3B1LX 1MG8A 2L3ZA 2CKHB 2KX3A 2RPQA 2WWZA 3PGEA 3DPDA 4ZRIA 4TKNA 4A20A 2O2VA 1WGDA 2K1FA 5CHWA 2GBNA 2I1KA 4NNJB 4GMVA 1LM8B 2ZPNA 3KW5B 3RD2A 1GNUA 1SIFA 1WF9A 1GUAB 1XT9B 3HK0A 3IBEA 3M63B 2N1WA 2GBKA 3VUXA 3ZNHB 3WIMA 5JHAA 4GSWA 2J7QB 2FCSA 3QARA 2JF5A 1V2YA 2AWTA 2NBWB 3B08A 4GDLB 4ZRJA 2K8CA 4K7WA 2KFJA 3HM6X 2XBBC 4HXDA 2KNBA 5D94A 3QK0A 2HTHA 2HD5B 2CU1A 2OJRA 3APFA 3H9DA 2JY6A 2KFKA 3MJWA 2EMTA 3C0RB 3ML9A 2KWVB 3QJZA 4HK2A 4ZDVA 4I6NB 5KHQA 1XQQA 4DK5A 2IY1B 3NOBA 3PHWB 3PZDA 4HDOA 3UQBA 4W9JA 3RULA 1J0GA 2JWZA 2M17A 1NBFC 4FADA 4W9DA 2K39A 4K81A 3ML8A 5TR5A 1EF5A 1WM2A 3AU5A 4EZJA 4EZKA 4ANXA 4E74A 1RRBA 3KUCB 1E5WA 1E90A 1WE7A 4RM8A 1EF1A 3R7RA 1IYFA 3WANA 1LQBA 3RCZA 2C7MB 3A1QB 2DYOA 3BINA 4GU2A 3DBHI 4HLEA 2L76A 3GOEA 3QC8B 1AARA 3ZTDA 4MM3A 3SHQA 1G6JA 5DPSA 4ANWA 2KTFA 1J19A 3TIXA 3A9KB 3WALA 3QIJA 1TZ1A 1OTRB 3RZWC 3UF8A 4K1RB 3OJ3A 3JYUA 4MGZE 4XZ4A 1ZKHA 2D3GA 1V86A 2IO3B 2NVUI 2KMAA 4PYZA 3VH4B 2GOWA 5LXIB 2DYBA 1WMHB 3NY5A 2V4LA 3QAQA 4WAAA 3QQ8B 4HPLB 4WJOA 2GBMA 3VTUA 3DCGA 5G2NA 1KOTA 4KV2A 4G50A 4IM2A 2Z0EB 2KZRA 4XX5A 2MBBB 1WI0A 4GDKB 4JIOU 4MGYE 4MGKE 3PLUA 2L00B 2BKFA 5J2RA 3NZUA 4CYEA 4MSMB 2IO1B 1TGZB 2IZVB 5JZEB 2Z59B 2AL6A 2YLMA 3ZNZB 1WRDB 2KQ7A 1E8YA 3B0AA 4NPNA 4MSQB 4OVUA 2KOXA 1WYWB 2PPHA 1EUVB 1P3QU 2KC2A 2MA9B 1ZW7A 2R2OA 4RM9A 3APDA 4EZLA 3WAOA 1QZEA 1S3SG 4M8NA 1P1AA 3GZNI 3PV1A 2DAFA 2LGDA 4AP4C 5DCNA 3PPAA 2BWFA 3WAMA 3ALBA 3PRPB 4RMAA 1U4AA 1P98A 1L7YA 1I42A 3AULA 2DAJA 3RUIB 5L83A 2Y5BB 1WJ6A 5LXHA 2MBHA 2JPHA 5JH5C 2HE7A 3VVWB 4BBNF 2N9XA 2NS5A 3V6CB 3A1QA 3PSEB 3RYTA 4HPMB 1WGGA 1YJ1A 2DZJA 2DZMA 4W9FA 4MJSB 2L05A 4W9EA 1T0YA 4II2B 1YIWA 3PREA 4BOSC 4IWOA 2WDTB 1WGRA 2KWUB 2W9NA 1E8WA 1H4RA 1NI2A 2AYOB 1VD2A 3A9KA 2AEHA 4LJPB 3VDZA 1BT0A 1WJUA 2MBOA 4NAWB 1OEYJ 2DHZA 2MP2B 4TQ0A 3TL5A 2LASA 1WXAA 3HM3A 4ICUA 1WFYA 3N3KB 2LGXA 1WE6A 2ASQA 4G3XB 4F7ZA 1WMHA 3RZFA 2NR2A 1TBEA 3OAWA 3A4SC 1VCBA 2V3SA 3QX1A 1YX6B 5E6NA 3V62A 2MX2A 2C60A 2JXXA 1A5RA 4W9CA 4GDKA 3UIPB 2KDEB 4PYUA 4CHKA 3VH3B 2MSED 1E7VA 2RD0A 1UZXB 4GGQA 2MRPA 5E6PA 2UWQA 4IUMB 5CTRC 2KTRB 2FUHB 2MLBA 4BOZB 3DOWA 2IY0B 4FLHA 3EECA 3L0WB 1YQBA 5G55A 3H1UA 2MQJA 3H7SA 4ANVA 1WJNA 2PE6B 2KKCA 2LJ5A 3ZNGC 3ZNID 2LZ6A 4M8MA 4IWPA 2LUEA 1J8CA 2MBQA 2LGYA 4JGHB 3IHPC 2I1JA 1NDDA 1L2NA 3CMMB 3KYDD 1WY8A 2LVOA 2L8JA 1PQSA 2D07B 2KK8A 3L54A 2KJHB 3NZSA 4JL9A 4FN2A 4BBNC 4EKUA 2KMCA 4CO7A 3T8MA 4ZRKA 1YD8U 2BF8B 4DHJB 4DHJD 1GC6A 3MTNB 3ZIMA 3ZRFA 3DBSA 4MJSA 2D11A 2KLCA 1WJ4A 1WR6E 4TQ1A 3QCAA 2L0FA 3QA8A 4HCPB 1WXSA 2V1YA 3ZUNA 5DPRA 4KSLC 4WWOA 3DVNV 3HIZA 3M3JA 1V9JA 1ZGUB 3PRMB 4DHZE 2LD9A 2MP2A 1M94A 1WH3A 4NAWA 2IO2B 5JHBA 4E3CA 3SDLC 5C1ZA 3I3TB 4WQOB 3A9JA 1R4NI 2BWES 5E6OA 1KJTA 3KYCD 3O65B 2DYMA 5LLIA 4IG7B 4BKTA 3TJPA 2M4NA 1UD7A 3ZDTA 4ASWC 2LXCA 2G4DB 4DDID 2WX1A 1IP9A 3D32A 2A4ZA 2KTRA 3PVLA 2KXJA 2R2QA 4EFOA 4F8CB 2JRIB 2CHXA 3DDCB 2JRHA 4GDLA 4WJPA 1UH6A 2NCNA 4B95A 2CR5A 3CF6E 3QWZB 1S1QB 3EFUA 2KJ6A 2G4SA 1WGHA 3Q3JA 3ZVVA 4HCNB 5IA7A 4NJ6A 3T9LA 2D10A 4MGIE 1C3TA 2N9PC 4B6WA 3L13A 3DBRI 2QHOA 2UYZB 4LCDE 4IM3A 1H8CA 1WIAA 4MH0E 3WAPA 2LVQA 2MBEA 2GBJA 5CX3A 3S2AA 2JUOA 5D2MB 4IW0A 3VUYA 5CHFA 3ZLZA 3PLVA 4LDTB 4NQKE 3VUWA 3DVGX 4BKSA 2FCQA 4AUQC 4MDKE 2JZZA 1R4MI 4FHJA 1F9JA 4II3B 2LRWA 2PEAA 3ONSA 3Q3FA 4NQLB 1Y8RC 4W9LA 4IWQA 4FULA 1WX7A 2LXAA 2EKEC 3UGBB 2EMSA 4URKA 2BGFA 1CMXB 1XD3B 2N4FA 2IO0B 4KSKC 3UINB 2KLGA 1SGHA 2BKRB 2XEWA 4JQWC 3X0WA 2RSUA 4OVVA 4KIKB 4HWIB 5C23A 3VQIA 2HJ8A 5BO4B 1WXVA 4NJ7A 1WM3A 2NBVB 5KHOA 3PHXB 2Z0DB 2XK5B 1C1YB 5AZHA 3ZRCA 2KD0A 3OJ4B 2PJHA 1E8XA 1OGWA 1WX8A 1FXTB 1LXDA 1JRUA 1Q5WB 2K8HA 2KX0A 4TV3A 4GN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U30 A;  3KVF B;  4X57 B;  2KVR A;  2WYQ A;  3TMP B;  3M95 A;  2J0K A;  4K7S A;  4LJO B;  3U7D A;  5HKH A;  4HDQ A;  2G45 B;  3DBL I;  3OLM D;  1V5T A;  4BKG A;  4F1S A;  4EUT A;  2NPT B;  2ZNV B;  2KQS A;  1P0R A;  3EHV A;  2BYF A;  5L95 C;  3VFK A;  2ZCC A;  2WX0 A;  4FJZ A;  4K7U A;  3SD5 A;  3QHT A;  5CHV C;  1Z2M A;  2ZJD A;  2VRR B;  1V49 A;  2LVP A;  4DWF A;  3HHM A;  3KUD B;  4IC7 B;  5AEK B;  2N7D A;  3ZW3 A;  2A5U A;  2DZK A;  1WZ0 A;  4WJQ A;  2KDB A;  5J17 A;  3V6E B;  5AZG A;  4BVU C;  2K25 A;  3JSV B;  2N7E A;  3L08 A;  4GXB A;  4KDI C;  4B9K A;  3PRZ A;  3LDZ E;  2FIF A;  1IPG A;  3LJ3 A;  4BKS D;  1V80 A;  2OOB B;  2JZ3 B;  2ZZP B;  2BYE A;  3APC A;  4AWJ A;  3M62 B;  2CS4 A;  3EC8 A;  3TCA A;  4KIK A;  2LI5 A;  1V81 A;  4G11 A;  4W9I A;  4IM0 A;  4BFR A;  4KVG B;  3UIO B;  3W1S A;  4KZ0 A;  2DX5 B;  2BPS A;  2XK5 A;  3DVN U;  1LFD A;  3IFW B;  2KN5 A;  3PS6 A;  4WWP A;  1OEY A;  5AZF A;  3DVG Y;  1V6E A;  3VTW A;  2FAZ A;  2GBR A;  1WX9 A;  1GC7 A;  2FNJ B;  3ECI A;  2FID A;  2D2Q A;  3IG3 A;  2O6V B;  2O6V D;  2LWP A;  3N32 A;  1RFA A;  3ZTC A;  5DPT A;  1WGY A;  2REX A;  3PT2 B;  2DEN B;  3ZO5 B;  1HE8 A;  3U8Z A;  2CHZ A;  4XC2 A;  3JW0 X;  1Z5S B;  3VTV A;  4DDG D;  2NPT A;  2JVC A;  3NS8 A;  3AI5 A;  1ISN A;  2ZCB A;  4I6L B;  3KH0 A;  4W9H A;  3ZDM C;  4A3P A;  2K6Q A;  1I35 A;  3K9O B;  3R66 C;  4FJV B;  2DZI A;  2J0J A;  3K9P B;  1D3Z A;  2C7N B;  3N30 A;  1GJZ A;  1RAX A;  2MW5 A;  4N9F 4;  2JT4 B;  1E7U A;  2GMI C;  3AXC A;  3DQV A;  3H7P B;  4DHZ B;  4FHK A;  4PS3 A;  1OQY A;  3W1S C;  3SU8 X;  1TTN A;  2L7R A;  3UQA A;  4MEM A;  2KO3 A;  4ANU A;  1GG3 A;  2ZPY A;  2RGF A;  2IYD B;  2O2V B;  3IVF A;  4FBJ B;  2MWS B;  2KAN A;  2YVC A;  1K8R B;  4TUU A;  2B3A A;  5DPW A;  4P7I A;  3X23 A;  1X1M A;  2M8S A;  3CST A;  3JSV A;  1WXM A;  4FA6 A;  4FJY A;  1V5O A;  1P9D U;  2KJR A;  4LDT D;  5EDS A;  2C5L C;  4AJY B;  3L10 B;  3VXW A;  4ICV A;  4WJN A;  3RT3 B;  2KC1 A;  1KM7 A;  4AOF A;  3A4R A;  3TBL D;  4ZYN A;  3PTF C;  5J18 A;  2N1V A;  1Q1O A;  2M0X A;  4JLC A;  2ZNV C;  4PS8 A;  1Q0W B;  4W9G A;  4YL8 A;  4G0N B;  2KDI A;  5GMV A;  3ZKJ C;  1UEL A;  4KZC A;  3V61 A;  2LRU A;  4A3O A;  5D6J B;  4NY0 A;  2KFK B;  2KWC A;  4GB9 A;  4DBG A;  3L16 A;  3VHT C;  1UGM A;  2FCM A;  2O6V A;  3BY4 B;  4I6P A;  1UBQ A;  4EOY A;  2ZEQ A;  2PE9 A;  2C9W B;  1SE9 A;  3A33 B;  1WZ3 A;  3R3M A;  4J6I A;  2M1M A;  4HJK A;  5IAA C;  3WA0 A;  2RR9 A;  4M0W B;  5FR6 A;  3NHE B;  5D7G A;  4E71 A;  3AU4 A;  4EEW A;  2CHW A;  2C7H A;  1WR1 A;  3CSF A;  1RLF A;  3V60 A;  3L17 A;  3W1Y A;  3R7Q A;  2J0M A;  4PS7 A;  3H6N A;  2IBI B;  1E8Z A;  3KUZ A;  3JVZ X;  2ZVN A;  2G3Q B;  1UBI A;  3VAW A;  2KHW B;  2ZVO A;  2NBU A;  2MCN B;  4DXA B;  2BYV E;  1YX5 B;  2K6D B;  3ENE A;  4GIV A;  4W9K A;  3H7P A;  2FCN A;  4AJW A;  2L0T A;  1KLV A;  2AL3 A;  2KDF B;  2N9E B;  2K8B A;  3A9J B;  4GOC A;  4KDL B;  4MEL A;  1EO6 A;  3P2B A;  4HVB A;  3MHS D;  4WWN A;  3B1L X;  1MG8 A;  2L3Z A;  2CKH B;  2KX3 A;  2RPQ A;  2WWZ A;  3PGE A;  3DPD A;  4ZRI A;  4TKN A;  4A20 A;  2O2V A;  1WGD A;  2K1F A;  5CHW A;  2GBN A;  2I1K A;  4NNJ B;  4GMV A;  1LM8 B;  2ZPN A;  3KW5 B;  3RD2 A;  1GNU A;  1SIF A;  1WF9 A;  1GUA B;  1XT9 B;  3HK0 A;  3IBE A;  3M63 B;  2N1W A;  2GBK A;  3VUX A;  3ZNH B;  3WIM A;  5JHA A;  4GSW A;  2J7Q B;  2FCS A;  3QAR A;  2JF5 A;  1V2Y A;  2AWT A;  2NBW B;  3B08 A;  4GDL B;  4ZRJ A;  2K8C A;  4K7W A;  2KFJ A;  3HM6 X;  2XBB C;  4HXD A;  2KNB A;  5D94 A;  3QK0 A;  2HTH A;  2HD5 B;  2CU1 A;  2OJR A;  3APF A;  3H9D A;  2JY6 A;  2KFK A;  3MJW A;  2EMT A;  3C0R B;  3ML9 A;  2KWV B;  3QJZ A;  4HK2 A;  4ZDV A;  4I6N B;  5KHQ A;  1XQQ A;  4DK5 A;  2IY1 B;  3NOB A;  3PHW B;  3PZD A;  4HDO A;  3UQB A;  4W9J A;  3RUL A;  1J0G A;  2JWZ A;  2M17 A;  1NBF C;  4FAD A;  4W9D A;  2K39 A;  4K81 A;  3ML8 A;  5TR5 A;  1EF5 A;  1WM2 A;  3AU5 A;  4EZJ A;  4EZK A;  4ANX A;  4E74 A;  1RRB A;  3KUC B;  1E5W A;  1E90 A;  1WE7 A;  4RM8 A;  1EF1 A;  3R7R A;  1IYF A;  3WAN A;  1LQB A;  3RCZ A;  2C7M B;  3A1Q B;  2DYO A;  3BIN A;  4GU2 A;  3DBH I;  4HLE A;  2L76 A;  3GOE A;  3QC8 B;  1AAR A;  3ZTD A;  4MM3 A;  3SHQ A;  1G6J A;  5DPS A;  4ANW A;  2KTF A;  1J19 A;  3TIX A;  3A9K B;  3WAL A;  3QIJ A;  1TZ1 A;  1OTR B;  3RZW C;  3UF8 A;  4K1R B;  3OJ3 A;  3JYU A;  4MGZ E;  4XZ4 A;  1ZKH A;  2D3G A;  1V86 A;  2IO3 B;  2NVU I;  2KMA A;  4PYZ A;  3VH4 B;  2GOW A;  5LXI B;  2DYB A;  1WMH B;  3NY5 A;  2V4L A;  3QAQ A;  4WAA A;  3QQ8 B;  4HPL B;  4WJO A;  2GBM A;  3VTU A;  3DCG A;  5G2N A;  1KOT A;  4KV2 A;  4G50 A;  4IM2 A;  2Z0E B;  2KZR A;  4XX5 A;  2MBB B;  1WI0 A;  4GDK B;  4JIO U;  4MGY E;  4MGK E;  3PLU A;  2L00 B;  2BKF A;  5J2R A;  3NZU A;  4CYE A;  4MSM B;  2IO1 B;  1TGZ B;  2IZV B;  5JZE B;  2Z59 B;  2AL6 A;  2YLM A;  3ZNZ B;  1WRD B;  2KQ7 A;  1E8Y A;  3B0A A;  4NPN A;  4MSQ B;  4OVU A;  2KOX A;  1WYW B;  2PPH A;  1EUV B;  1P3Q U;  2KC2 A;  2MA9 B;  1ZW7 A;  2R2O A;  4RM9 A;  3APD A;  4EZL A;  3WAO A;  1QZE A;  1S3S G;  4M8N A;  1P1A A;  3GZN I;  3PV1 A;  2DAF A;  2LGD A;  4AP4 C;  5DCN A;  3PPA A;  2BWF A;  3WAM A;  3ALB A;  3PRP B;  4RMA A;  1U4A A;  1P98 A;  1L7Y A;  1I42 A;  3AUL A;  2DAJ A;  3RUI B;  5L83 A;  2Y5B B;  1WJ6 A;  5LXH A;  2MBH A;  2JPH A;  5JH5 C;  2HE7 A;  3VVW B;  4BBN F;  2N9X A;  2NS5 A;  3V6C B;  3A1Q A;  3PSE B;  3RYT A;  4HPM B;  1WGG A;  1YJ1 A;  2DZJ A;  2DZM A;  4W9F A;  4MJS B;  2L05 A;  4W9E A;  1T0Y A;  4II2 B;  1YIW A;  3PRE A;  4BOS C;  4IWO A;  2WDT B;  1WGR A;  2KWU B;  2W9N A;  1E8W A;  1H4R A;  1NI2 A;  2AYO B;  1VD2 A;  3A9K A;  2AEH A;  4LJP B;  3VDZ A;  1BT0 A;  1WJU A;  2MBO A;  4NAW B;  1OEY J;  2DHZ A;  2MP2 B;  4TQ0 A;  3TL5 A;  2LAS A;  1WXA A;  3HM3 A;  4ICU A;  1WFY A;  3N3K B;  2LGX A;  1WE6 A;  2ASQ A;  4G3X B;  4F7Z A;  1WMH A;  3RZF A;  2NR2 A;  1TBE A;  3OAW A;  3A4S C;  1VCB A;  2V3S A;  3QX1 A;  1YX6 B;  5E6N A;  3V62 A;  2MX2 A;  2C60 A;  2JXX A;  1A5R A;  4W9C A;  4GDK A;  3UIP B;  2KDE B;  4PYU A;  4CHK A;  3VH3 B;  2MSE D;  1E7V A;  2RD0 A;  1UZX B;  4GGQ A;  2MRP A;  5E6P A;  2UWQ A;  4IUM B;  5CTR C;  2KTR B;  2FUH B;  2MLB A;  4BOZ B;  3DOW A;  2IY0 B;  4FLH A;  3EEC A;  3L0W B;  1YQB A;  5G55 A;  3H1U A;  2MQJ A;  3H7S A;  4ANV A;  1WJN A;  2PE6 B;  2KKC A;  2LJ5 A;  3ZNG C;  3ZNI D;  2LZ6 A;  4M8M A;  4IWP A;  2LUE A;  1J8C A;  2MBQ A;  2LGY A;  4JGH B;  3IHP C;  2I1J A;  1NDD A;  1L2N A;  3CMM B;  3KYD D;  1WY8 A;  2LVO A;  2L8J A;  1PQS A;  2D07 B;  2KK8 A;  3L54 A;  2KJH B;  3NZS A;  4JL9 A;  4FN2 A;  4BBN C;  4EKU A;  2KMC A;  4CO7 A;  3T8M A;  4ZRK A;  1YD8 U;  2BF8 B;  4DHJ B;  4DHJ D;  1GC6 A;  3MTN B;  3ZIM A;  3ZRF A;  3DBS A;  4MJS A;  2D11 A;  2KLC A;  1WJ4 A;  1WR6 E;  4TQ1 A;  3QCA A;  2L0F A;  3QA8 A;  4HCP B;  1WXS A;  2V1Y A;  3ZUN A;  5DPR A;  4KSL C;  4WWO A;  3DVN V;  3HIZ A;  3M3J A;  1V9J A;  1ZGU B;  3PRM B;  4DHZ E;  2LD9 A;  2MP2 A;  1M94 A;  1WH3 A;  4NAW A;  2IO2 B;  5JHB A;  4E3C A;  3SDL C;  5C1Z A;  3I3T B;  4WQO B;  3A9J A;  1R4N I;  2BWE S;  5E6O A;  1KJT A;  3KYC D;  3O65 B;  2DYM A;  5LLI A;  4IG7 B;  4BKT A;  3TJP A;  2M4N A;  1UD7 A;  3ZDT A;  4ASW C;  2LXC A;  2G4D B;  4DDI D;  2WX1 A;  1IP9 A;  3D32 A;  2A4Z A;  2KTR A;  3PVL A;  2KXJ A;  2R2Q A;  4EFO A;  4F8C B;  2JRI B;  2CHX A;  3DDC B;  2JRH A;  4GDL A;  4WJP A;  1UH6 A;  2NCN A;  4B95 A;  2CR5 A;  3CF6 E;  3QWZ B;  1S1Q B;  3EFU A;  2KJ6 A;  2G4S A;  1WGH A;  3Q3J A;  3ZVV A;  4HCN B;  5IA7 A;  4NJ6 A;  3T9L A;  2D10 A;  4MGI E;  1C3T A;  2N9P C;  4B6W A;  3L13 A;  3DBR I;  2QHO A;  2UYZ B;  4LCD E;  4IM3 A;  1H8C A;  1WIA A;  4MH0 E;  3WAP A;  2LVQ A;  2MBE A;  2GBJ A;  5CX3 A;  3S2A A;  2JUO A;  5D2M B;  4IW0 A;  3VUY A;  5CHF A;  3ZLZ A;  3PLV A;  4LDT B;  4NQK E;  3VUW A;  3DVG X;  4BKS A;  2FCQ A;  4AUQ C;  4MDK E;  2JZZ A;  1R4M I;  4FHJ A;  1F9J A;  4II3 B;  2LRW A;  2PEA A;  3ONS A;  3Q3F A;  4NQL B;  1Y8R C;  4W9L A;  4IWQ A;  4FUL A;  1WX7 A;  2LXA A;  2EKE C;  3UGB B;  2EMS A;  4URK A;  2BGF A;  1CMX B;  1XD3 B;  2N4F A;  2IO0 B;  4KSK C;  3UIN B;  2KLG A;  1SGH A;  2BKR B;  2XEW A;  4JQW C;  3X0W A;  2RSU A;  4OVV A;  4KIK B;  4HWI B;  5C23 A;  3VQI A;  2HJ8 A;  5BO4 B;  1WXV A;  4NJ7 A;  1WM3 A;  2NBV B;  5KHO A;  3PHX B;  2Z0D B;  2XK5 B;  1C1Y B;  5AZH A;  3ZRC A;  2KD0 A;  3OJ4 B;  2PJH A;  1E8X A;  1OGW A;  1WX8 A;  1FXT B;  1LXD A;  1JRU A;  1Q5W B;  2K8H A;  2KX0 A;  4TV3 A;  4GN1 A; 
#chains in the Genus database with same CATH topology
 4EE2 A;  1OQQ A;  5EE0 A;  2G45 B;  3NS1 A;  4LNK A;  4PK1 A;  2VH1 A;  1E9M A;  1HA5 A;  4ITK A;  4K7U A;  1IUE A;  1E10 A;  3MJ5 A;  3HHM A;  4IC7 B;  2WNM A;  3ZW3 A;  1KFY B;  1TKG A;  4N6E B;  1VLB A;  1C4A A;  4BVU C;  1NVI D;  3JSV B;  4B9K A;  3BVZ A;  3DWG C;  1IPG A;  1XLP A;  2JZ3 B;  2ZZP B;  1ZPS A;  2BYE A;  3M62 B;  4KIK A;  2LI5 A;  3AED B;  4G11 A;  2BPS A;  3DVN U;  3DVG Y;  1V6E A;  3VTW A;  2FAZ A;  4S17 A;  2GBR A;  1WX9 A;  4K3C A;  2D2Q A;  3IG3 A;  2O6V B;  2LWP A;  3TEX A;  1MG4 A;  3N1Y C;  1WGY A;  1K52 A;  2DEN B;  1I7H A;  2W82 A;  1ZXI A;  5H8Y E;  4XC2 A;  4DDG D;  3AI5 A;  1WSP A;  1ISN A;  1UGJ A;  4I6L B;  3ETR A;  3K9O B;  3K9P B;  2C7N B;  1GJZ A;  3NVV A;  2GMI C;  3NG0 A;  4DHZ B;  2J42 A;  1KH0 A;  4B0M A;  3U2S C;  1TTN A;  3DBR B;  2IYD B;  2L1A A;  1WXQ A;  4RF0 A;  5DPW A;  1X1M A;  3CST A;  1WXM A;  4YWG G;  3IT6 B;  4FJY A;  4LDT D;  1P9D U;  5EDS A;  1YQ4 B;  2WU2 B;  4US9 A;  3BZD B;  4G0N B;  1XLN A;  2LJI A;  2HDE A;  2KFK B;  3NVY A;  1ZDX A;  3VHT C;  4JWU C;  1XCQ L;  3AEA B;  1ZXH A;  2PE9 A;  2C9W B;  3A33 B;  5IAA C;  2QIL A;  2M1M A;  5FR6 A;  5D7G A;  2CHW A;  1WR1 A;  3DHH C;  2WXG A;  1UWX A;  1E8Z A;  2ZVN A;  3VAW A;  2WDR B;  3TEZ A;  2MCN B;  3TEY A;  2BYV E;  5IP4 D;  1YX5 B;  2WHI A;  4W9K A;  1TKY A;  2FCN A;  1N63 A;  2PTL A;  4AJW A;  1KLV A;  2AL3 A;  1KLG D;  3A9J B;  2K8B A;  4HVB A;  3MHS D;  2RPQ A;  1FRR A;  2K1F A;  4CQN A;  4NNJ B;  5JXV A;  2ONQ A;  3IAM 1;  2ZPN A;  1VZ7 A;  3IT4 B;  1GNU A;  1T0S C;  1YNT E;  1GUA B;  1XT9 B;  3M63 B;  3ZNH B;  4P1B C;  2BS3 B;  3WIM A;  4WH4 A;  3QAR A;  2JF5 A;  2NBW B;  4ZRJ A;  2KFJ A;  3MP9 A;  2HJ1 A;  4IDI A;  2LEK A;  3H9D A;  2YEP F;  3APF A;  5EE1 A;  4DK5 A;  1C3T A;  3NOB A;  3PZD A;  3UQB A;  4RCO A;  2J52 A;  3HUI A;  1DGJ A;  4FAD A;  4K81 A;  4EZJ A;  4ANX A;  4E74 A;  1E5W A;  1HQR D;  2N9L A;  2ON8 A;  3AEF B;  4YTP B;  3WAN A;  1FEH A;  1NI3 A;  3RCZ A;  1T5X D;  2DYO A;  4GU2 A;  4HLE A;  3ZTD A;  4JWS C;  3R8B A;  1TS4 A;  1G6J A;  2N0S B;  5DPS A;  4ANW A;  2KTF A;  4L23 A;  3QIJ A;  3UF8 A;  4K1R B;  4LTU A;  2NVU I;  2K9X A;  1FXA A;  3AE8 B;  2WXL A;  3NY5 A;  2V4L A;  3QAQ A;  4WJO A;  3VTU A;  5I4D A;  3W5V B;  3DCG A;  4IM2 A;  4RH6 A;  4XX5 A;  2ZW1 A;  4ARI A;  2L00 B;  4MSM B;  4MT5 A;  1HXY D;  1WRD B;  1RYJ A;  1EUV B;  2BQQ A;  1XLQ A;  1S3S G;  2DAF A;  2BW2 A;  5DCN A;  2BWF A;  5HI1 A;  4C4V B;  3PRP B;  1U4A A;  1P98 A;  1MFW A;  1K50 A;  1ZP0 B;  1I4Q A;  2MBH A;  3VVW B;  2N9X A;  3A1Q A;  5AUK A;  2WDV B;  1YIW A;  3PRE A;  2WDT B;  1B1Z A;  1WGR A;  1GB1 A;  2G9H D;  1OEY J;  1XLO A;  2D3A A;  2LAS A;  3ZJU A;  1WFY A;  1WE6 A;  5IO9 A;  1L6V A;  1YN5 A;  1TBE A;  3QX1 A;  1YX6 B;  1SJE D;  4W9C A;  4XDD A;  2AX5 A;  1T6B X;  2G1E A;  1E7V A;  4HEA 1;  3GS2 A;  1P7F A;  2MRP A;  3SEB A;  2UWQ A;  1BUI C;  1HZ6 A;  2IY0 B;  3L0W B;  3H1U A;  2MQJ A;  4ARC A;  4ANV A;  1L4Z B;  2PE6 B;  5BYQ A;  1NYR A;  2K22 A;  4HKZ E;  4KKI A;  2LGY A;  4O1N A;  4JGH B;  1NDD A;  3CMM B;  3ZJT A;  3NZS A;  2D07 B;  4EKU A;  4ZRQ A;  1I4G A;  2FUG 1;  4ZRK A;  5C2T B;  4DHJ D;  3MC8 A;  1WGK A;  2L0F A;  1FCC C;  2V1Y A;  3ZUN A;  3P63 A;  5FR3 A;  4KSL C;  3M3J A;  3HIZ A;  3NUH B;  1HEZ E;  4M00 A;  1M94 A;  4E3C A;  1ET6 A;  2WGS A;  4RGN A;  3O65 B;  3NVW A;  2DYM A;  3MHZ A;  2V4I B;  4BKT A;  1SB3 C;  3ZXV A;  2G4D B;  2WX1 A;  3D32 A;  3AE7 B;  2PW9 A;  2CHX A;  3DDC B;  2JRH A;  1XXG A;  4B95 A;  2CR5 A;  3QWZ B;  1UUP A;  3MFG A;  2KJ6 A;  2G4S A;  3BWU D;  3BYT B;  1WGH A;  3ZVV A;  5IA7 A;  2SAK A;  2N9P C;  4A6Q A;  4B6W A;  1V1P B;  3L13 A;  4IM3 A;  2IGD A;  1WIA A;  1TZO A;  1J7A A;  2LVQ A;  5CX3 A;  3UI3 A;  1RWS A;  3VUY A;  1D5M C;  3DVG X;  2NTT A;  2JZZ A;  3B9J A;  3Q3F A;  2ZW0 A;  2INC C;  1SXT A;  1SGH A;  1HTO A;  1VR9 A;  2OHF A;  2HJ8 A;  2AQ3 B;  5BO4 B;  4NJ7 A;  1WM3 A;  2M19 A;  2KVZ A;  5KHO A;  2RDH A;  3J9C A;  2KD0 A;  3OJ4 B;  2PJH A;  1Q5W B;  2H88 B;  3KVF B;  2IDY A;  4LJO B;  5HKH A;  4HDQ A;  2L32 A;  4A55 A;  3OLM D;  1GAQ B;  4F1S A;  4EUT A;  2IPK D;  3EHV A;  5IKC M;  2WX0 A;  3NRZ A;  4FJZ A;  1F1H A;  1QKZ A;  3QHT A;  5CHV C;  1F2R C;  1Z2M A;  2ZJD A;  2MJD A;  1SBB B;  2PKO A;  4DWF A;  5E6J A;  2WP9 B;  4RGO S;  3VRA B;  1MHH E;  2A5U A;  2VH2 A;  5J17 A;  4KX6 B;  2N7E A;  3LDZ E;  3PZ8 A;  2FIF A;  3Q8B A;  5BMH A;  2OOB B;  3APC A;  4AWJ A;  2CS4 A;  3EC8 A;  3TCA A;  3AE2 B;  4L1B A;  4W9I A;  1SSN A;  1DOY A;  3AEC B;  1PDX A;  3SFE B;  4C7Z A;  3CIR B;  2XK5 A;  1ENF A;  3IFW B;  4WWP A;  4A90 A;  2DWQ A;  2FID A;  1QOF A;  3URY A;  2KYW A;  2REX A;  3GE3 C;  1PGA A;  3ZO5 B;  1HE8 A;  1N5X A;  3JW0 X;  1YMH E;  3NS8 A;  1TIF A;  2NMQ A;  2K3U A;  4W9H A;  3ZDM C;  1I35 A;  2K6Q A;  3R66 C;  4FJV B;  2J0J A;  2M0A A;  3AM9 A;  2MW5 A;  4N9F 4;  3H7P B;  1E7U A;  2L52 A;  3I57 A;  2L7R A;  3UQA A;  1V8C A;  3ZJV A;  2RGF A;  2O2V B;  2KAN A;  1K8R B;  4WAF A;  3X23 A;  3JSV A;  3LB8 C;  1JCK B;  2QIE B;  4ICV A;  2I38 A;  2KC1 A;  1KM7 A;  3A4R A;  1MHX A;  1QIL A;  1L0V B;  4TMA B;  4YL8 A;  4KZC A;  3B2F A;  4A3O A;  5D6J B;  1I4H A;  4YSX B;  4GB9 A;  2PLP A;  3L16 A;  3RNA C;  1PFD A;  2O6V A;  3BY4 B;  1UBQ A;  4I6P A;  3PZ7 A;  1WZ3 A;  3R3M A;  1D5Z C;  3NHE B;  3AU4 A;  2E6X A;  1RLF A;  3L17 A;  3W1Y A;  3R7Q A;  5C3J B;  2YEP B;  1SEB D;  2K0P A;  2KT7 A;  2G3Q B;  1UBI A;  2WU5 B;  1PGB A;  2NBU A;  4MM3 B;  3ENE A;  2K6D B;  4XE0 A;  2PIA A;  5HG2 A;  2L0T A;  2KDF B;  2N9E B;  3R2I A;  4GOC A;  4MEL A;  3P2B A;  3B1L X;  2CKH B;  3AV8 A;  3Q8C A;  4TKN A;  1WGD A;  1YN3 A;  3HRD D;  4LK0 M;  2I1K A;  3IXS A;  5BMI A;  4GMV A;  1AYF A;  2GBK A;  3V3X A;  2J7Q B;  2WXH A;  1SIJ A;  2AWT A;  2SEB D;  3B2G A;  2OJR A;  3BII D;  2KFK A;  3C0R B;  1K53 A;  4I6N B;  3PHW B;  4W9J A;  3RUL A;  4LNO A;  3CWI A;  2JWZ A;  3ML8 A;  3W2D A;  1EF5 A;  1E90 A;  3R7R A;  1K51 A;  1ZE3 D;  1N5W A;  2OJW A;  3Q8E A;  4JPS A;  2VZK B;  4TSS A;  2L76 A;  5EE3 A;  2QEJ C;  3TIX A;  2BYT A;  1TZ1 A;  4YT0 B;  2WXM A;  4XZ4 A;  2D3C A;  2R61 A;  4PYZ A;  3ZYY X;  2EEL A;  1SE4 A;  2AQ1 B;  2GOW A;  4WAA A;  3OG5 A;  4HPL B;  5BYR A;  4KV2 A;  2KZR A;  2MBB B;  1JWB D;  1WI0 A;  3Q14 C;  4MGY E;  3PLU A;  1N61 A;  1F0Z A;  2IO1 B;  1TGZ B;  2WXQ A;  2Z59 B;  2W3R A;  4M01 A;  1WYW B;  1SE3 A;  2PPH A;  1P3Q U;  2MA9 B;  1ZW7 A;  4EZL A;  1QZE A;  4REZ A;  1T3Q A;  1P1A A;  3GZN I;  1D5X C;  3PPA A;  3ALB A;  2TSS A;  4UDU C;  3AUL A;  1XO3 A;  3RUI B;  2Y5B B;  1WJ6 A;  2W54 A;  2BT6 A;  3MC9 A;  2NS5 A;  3AB5 A;  4P1C C;  1WGG A;  1YJ1 A;  4BOS C;  1KRH A;  2L05 A;  4MJS B;  1T0Y A;  4II2 B;  4W9E A;  1BXT A;  4IWO A;  2WXN A;  2AYO B;  2MBO A;  2J4X A;  4NAW B;  2DHZ A;  2MP2 B;  4TQ0 A;  1WXA A;  3N3K B;  2JXT A;  4YSZ B;  3VR9 B;  3A4S C;  1JQ4 A;  1VCB A;  3N1X C;  1A5R A;  3UIP B;  2KDE B;  4CHK A;  5HHD G;  2JSV X;  2RD0 A;  1UZX B;  2GLS A;  2FUH B;  3DOW A;  4FLH A;  2JWU A;  1MVK A;  3EUB 2;  3H7S A;  1QT9 A;  1WJN A;  5T8I A;  2LJ5 A;  3ZNI D;  4IWP A;  2LUE A;  2DLB A;  3P42 A;  4KGR A;  2I1J A;  4LNF A;  4C4V A;  3FIL B;  1WY8 A;  2LVO A;  3L54 A;  2KK8 A;  2KMC A;  4CO7 A;  2JX5 A;  1HZ5 A;  3Q8F A;  2BF8 B;  4DHJ B;  3DBS A;  1WR6 E;  1XF5 L;  4D2K A;  3QA8 A;  1WXS A;  2RDB C;  2VZK D;  4P6V F;  1GOZ A;  3PRM B;  3P1M A;  1WH3 A;  2KN4 A;  3HVD A;  5C1Z A;  2WDQ B;  3EGR A;  2BB6 A;  1R4N I;  4Q2J A;  3E56 A;  4ZRP A;  5LLI A;  1IBX B;  2WQY B;  2Y5P A;  3ZXR A;  3Q3M C;  2LUM A;  4GLS C;  1KTK A;  2KXJ A;  2R2Q A;  4EFO A;  4GDL A;  2ICI A;  4WJP A;  3CF6 E;  2PMV A;  1S1Q B;  3AMZ A;  3Q3J A;  3IAS 1;  1L6U A;  3RNC C;  3T9L A;  2D10 A;  2WXJ A;  2QHO A;  3WAP A;  1WYG A;  2JU6 X;  1NEK B;  1JWA D;  1E7P B;  3PLV A;  4NQK E;  3VUW A;  5HFY A;  2FCQ A;  4AUQ C;  4C80 A;  4MDK E;  4FHJ A;  4KKJ A;  4LNN A;  2MHJ A;  1JWS D;  2PEA A;  1Y8R C;  4IWQ A;  3AE5 B;  1L0X B;  1WX7 A;  1I4P A;  3BYY B;  2N4F A;  2IO0 B;  2LHE A;  3RMK C;  2XEW A;  2RSU A;  5C23 A;  2Z0D B;  3ZRC A;  4N59 A;  1E8X A;  3C8Y A;  3EFC A;  5IOI A;  1CJE A;  2K8H A;  2Q5W D;  3U30 A;  1TS2 A;  4X57 B;  2WYQ A;  3TMP B;  3M95 A;  2KMM A;  3U7D A;  3Q2A C;  2H89 B;  3DBL I;  1V5T A;  4BKG A;  3V05 A;  2NPT B;  2ZNV B;  2KQS A;  1P0R A;  5L95 C;  3KWV A;  3AN1 A;  1KF6 B;  2ZCC A;  3P4Q B;  1VDV A;  3SD5 A;  5AUI A;  1V1P A;  2MJE A;  2XNA C;  2LVP A;  3AEE B;  5AEK B;  3VR8 B;  2N7D A;  1D6E C;  5BMG A;  4YTM B;  3V6E B;  2K25 A;  4GXB A;  3PRZ A;  4OZB A;  4YXD B;  3LJ3 A;  5FK9 C;  4BKS D;  1FNU A;  4KGS A;  1FFU A;  1FNW A;  3AH7 A;  1V81 A;  1RM6 C;  4BFR A;  4KVG B;  4RNA A;  3UIO B;  2DX5 B;  3E9S A;  2KN5 A;  2WS3 B;  1FD6 A;  2FNJ B;  3ECI A;  3RPF C;  1QOA A;  2OED A;  3W9C B;  1RFA A;  2QSD A;  3ZTC A;  1FO4 A;  3KLS X;  3Q69 A;  1VRA B;  1TJE A;  3P4P B;  2HTM E;  2NTS A;  4JX1 C;  3N30 A;  1XCT L;  1RAX A;  4K3B A;  1MI0 A;  3AXC A;  4FHK A;  3W1S C;  1ESF A;  1AW7 A;  3SU8 X;  2KO3 A;  4ANU A;  5GXG B;  1YJJ A;  3U52 E;  2D5G A;  2MWS B;  2YVC A;  1AN8 A;  1TY2 A;  2B3A A;  2M8S A;  4FA6 A;  2IJ0 A;  2C5L C;  2PVO D;  3L10 B;  3RT3 B;  4WJN A;  4AOF A;  2M0X A;  4W9G A;  2ZNV C;  4PS8 A;  1Q0W B;  4RGT A;  3ZKJ C;  3V61 A;  2LRU A;  4NY0 A;  2KWC A;  2WLB A;  2FCM A;  4XWW A;  2ZEQ A;  4J6I A;  2RMM A;  2RR9 A;  3R2T A;  4M0W B;  4S0R A;  4E71 A;  4EEW A;  1MPE A;  2J0M A;  2RDG A;  3VRB B;  2QDF A;  1CQV A;  4XWT A;  2Z8L A;  2KHW B;  2ZVO A;  4GIV A;  1ACC A;  3H7P A;  1UNS A;  1C79 A;  3KQ4 A;  4KDL B;  1MG8 A;  2FE8 A;  2KX3 A;  2L3Z A;  2WWZ A;  4ZRI A;  3DPD A;  2O2V A;  2LHD A;  2WXI A;  1V1O A;  4M02 A;  3KW5 B;  2DBY A;  4MAC A;  3ZQ4 A;  1SIF A;  3HK0 A;  3VUX A;  4GSW A;  1OQR A;  2FCS A;  3RNB C;  1JML A;  2GB1 A;  3B08 A;  2AQ2 B;  1C4C A;  3I5J C;  3GP7 A;  3O13 A;  3P4R B;  4HXD A;  2KNB A;  2EKI A;  2JZP A;  5D94 A;  3QK0 A;  2CU1 A;  3ML9 A;  3MJW A;  2EMT A;  3QJZ A;  2KWV B;  1QQR A;  2WXO A;  5KHQ A;  3FAH A;  1J0G A;  1NBF C;  3L4P A;  2INN E;  2JYE A;  1XEE A;  1VJK A;  1STE A;  1WM2 A;  3AU5 A;  1EWY C;  4EZK A;  2CU3 A;  4C7Y A;  1WE7 A;  4L2Y A;  1JRO A;  1EF1 A;  1IYF A;  1LQB A;  3NVZ A;  4HPP A;  3DBH I;  3GOE A;  2QMT A;  4MM3 A;  3DHI C;  4RGM A;  3A9K B;  3N20 C;  2IND C;  3RNF C;  1ZKH A;  2D3G A;  1V86 A;  1EM7 A;  3LXF A;  5D3D A;  3N9Y C;  3VH4 B;  5LXI B;  2DYB A;  2QCZ A;  1WMH B;  1AWD A;  1GPX A;  1R7S A;  4GDK B;  4YTN B;  4MGK E;  2BKF A;  5J2R A;  2WXP A;  5EE9 A;  4CYE A;  1FIQ A;  2IZV B;  2KAC A;  1R4M B;  3ZNZ B;  3P4S B;  2KQ7 A;  1F77 A;  2BS4 B;  3B0A A;  4MSQ B;  4NPN A;  4OVU A;  5LNK 1;  1OFF A;  3KWL A;  2KC2 A;  3PO0 A;  4RM9 A;  3T3N A;  3BVG A;  4M8N A;  2LGD A;  4AP4 C;  1VZ6 A;  3RNE C;  3WAM A;  1L7Y A;  5L83 A;  5LXH A;  2JPH A;  4BBN F;  3V6C B;  5H92 C;  1JW9 D;  1J7B A;  3RYT A;  4HPM B;  2DZJ A;  3N1Z C;  2WXR A;  2KWU B;  1E8W A;  1H4R A;  2AEH A;  3VDZ A;  1FRD A;  1BT0 A;  3HM3 A;  4ICU A;  2MEK A;  2LGX A;  2ASQ A;  1PGX A;  3RZF A;  2NR2 A;  2I2Y A;  2J53 A;  3OAW A;  2MJ3 A;  3RNG C;  2V3S A;  3V62 A;  4PYU A;  4YSY B;  3VH3 B;  1A70 A;  4QAY A;  4GGQ A;  3U7Z A;  5CTR C;  2KTR B;  2BBC A;  1TY0 A;  2MLB A;  4BOZ B;  5G55 A;  3MC0 B;  3ZNG C;  2LZ6 A;  4M8M A;  3NJT A;  3I9V 1;  2MBQ A;  3NZ3 A;  3IHP C;  1L2N A;  3KYD D;  2L8J A;  1PQS A;  2KJH B;  1C78 A;  1YD8 U;  4ZOH C;  4HJG E;  1D4B A;  1GC6 A;  3MTN B;  3ZIM A;  2QC8 A;  3ZRF A;  4MJS A;  2D11 A;  2KLC A;  1WJ4 A;  2X8X X;  2XN9 C;  4TQ1 A;  4HCP B;  5DPR A;  2WXK A;  4WWO A;  2LMC A;  1V9J A;  1ZGU B;  4IKG A;  4DHZ E;  2LD9 A;  2MP2 A;  4NAW A;  2IO2 B;  5JHB A;  1PUT A;  4WQO B;  3A9J A;  1E0Z A;  1T0Q C;  2BWE S;  1KJT A;  3KYC D;  2BB5 A;  4AQ7 A;  4P16 A;  1ROE A;  1YN4 A;  2LXC A;  4PT5 A;  3FC4 A;  4DDI D;  3Q8A A;  1IP9 A;  2GRI A;  2N9K A;  4NAM A;  1UH6 A;  1JWM D;  2NCN A;  2CJO A;  4HCN B;  2KDM A;  1P7E A;  3FIL A;  1YQ3 B;  3DBR I;  2UYZ B;  4LCD E;  3RFZ B;  1FMA D;  3GZN B;  3AEB B;  4MH0 E;  2MBE A;  2GBJ A;  4DXG A;  1FNV A;  1ZOY B;  2JUO A;  5CHF A;  4BKS A;  3BK1 A;  1MJD A;  5G5H A;  1F9J A;  2LRW A;  3ONS A;  4W9L A;  4FUL A;  1C76 A;  2LXA A;  2EKE C;  2EMS A;  4URK A;  4KGT A;  2BGF A;  1CMX B;  1PYW D;  1L4D B;  3UIN B;  4JQW C;  1B9R A;  3X0W A;  4KIK B;  2INP E;  1I4X A;  1YOV B;  4NZL B;  2E3T A;  1L5P A;  1IBX A;  1C1Y B;  5MPO A;  1WX8 A;  1EWC A;  3GE8 C;  1JRU A;  1I4R A;  4OZA A;  4R3D A;  1SF0 A;  4H2A A;  4TV3 A;  3U4E G;  4J3O D;  2N7J A;  2KVR A;  2J0K A;  4K7S A;  4OHJ A;  3WCQ A;  2GI9 A;  2BYF A;  2WXF A;  3VFK A;  1C77 A;  2DNF A;  2VRR B;  1V49 A;  1IGD A;  1TYG B;  3KUD B;  2DZK A;  1WZ0 A;  2V9H A;  4WJQ A;  2KDB A;  1SE2 A;  5AZG A;  4A8X C;  3L08 A;  4KDI C;  4C56 C;  4DQO C;  3OWE B;  2KAJ A;  1V80 A;  2IGG A;  1NYQ A;  4IM0 A;  3ABV B;  3W1S A;  4KZ0 A;  1LO5 D;  1LFD A;  3T3O A;  2KQ4 X;  3PS6 A;  5AZF A;  1OEY A;  2X38 A;  1R4N B;  1GC7 A;  1C4P A;  2O6V D;  3N32 A;  1QLB B;  3TEW A;  5DPT A;  3PT2 B;  5BYS A;  4N58 A;  1T0R C;  3U8Z A;  2CHZ A;  1E6E B;  1EU4 A;  1Z5S B;  3VTV A;  2NPT A;  2JVC A;  1VZ8 A;  2ZCB A;  3FKY A;  3KH0 A;  4A3P A;  1DOX A;  2DZI A;  1D3Z A;  2JT4 B;  3DQV A;  4PS3 A;  1IGC A;  1OQY A;  4MEM A;  1GG3 A;  2ZPY A;  3IVF A;  4FBJ B;  3Q3N C;  4TUU A;  4P7I A;  2RPV A;  1V5O A;  2KJR A;  4AJY B;  3VXW A;  1N60 A;  3TBL D;  4ZYN A;  3PTF C;  5J18 A;  1QOB A;  2N1V A;  1Q1O A;  4JLC A;  2KDI A;  5GMV A;  1UEL A;  4ZHO A;  3BK2 A;  4DBG A;  4JE3 B;  1UGM A;  1EU3 A;  4EOY A;  4USA A;  1SE9 A;  1JAL A;  4RFB A;  3WA0 A;  4HJK A;  1WWT A;  3LYY A;  4WQM A;  2C7H A;  3CSF A;  4MH8 A;  3V60 A;  1TT5 B;  4PS7 A;  4BAX A;  3H6N A;  4WIP A;  4LNI A;  2IBI B;  3KUZ A;  3JVZ X;  4LLG M;  3DBL B;  3Q6B A;  2BS2 B;  4DXA B;  3I63 C;  2JQR B;  3AE3 B;  3SFD B;  1HTQ A;  1EO6 A;  4WWN A;  3PGE A;  1TS3 A;  4A20 A;  5CHW A;  2GBN A;  1BML C;  1LM8 B;  2PVG C;  1JWU D;  5D3I B;  5G5G A;  3RD2 A;  1WF9 A;  3IBE A;  2N1W A;  5JHA A;  1V2Y A;  4GDL B;  1LGR A;  2K8C A;  4K7W A;  3HM6 X;  4HKQ A;  4XGA B;  2XBB C;  2K5P A;  2HTH A;  2HD5 B;  2JY6 A;  4ZDV A;  4HK2 A;  1XQQ A;  2IY1 B;  4HDO A;  1L0Y B;  4OW0 A;  2M17 A;  4W9D A;  2K39 A;  2LFI A;  5TR5 A;  3TUO A;  4M0W A;  1DOI A;  5TSS A;  1RRB A;  3KUC B;  4RM8 A;  1N6Z A;  3SR6 A;  4B0E A;  3AE1 B;  3EA6 A;  2C7M B;  2V3P A;  3A1Q B;  3BIN A;  3QC8 B;  4IOI E;  1AAR A;  4OZC A;  3SHQ A;  1F2R I;  1J19 A;  3WAL A;  2FBW B;  1OTR B;  3RZW C;  3OJ3 A;  3JYU A;  4XDC A;  4MGZ E;  2IO3 B;  1F52 A;  2KMA A;  3RI7 C;  3GB1 A;  2JYT A;  4RF1 A;  3QQ8 B;  2GBM A;  5G2N A;  4A9A A;  1KOT A;  4G50 A;  2LGI A;  2Z0E B;  4JIO U;  3AE9 B;  2UU7 A;  3NZU A;  1N62 A;  5JZE B;  2AL6 A;  2YLM A;  1E8Y A;  1WRI A;  2KOX A;  1SJH D;  4ZYS A;  2R2O A;  3APD A;  3WAO A;  3PV1 A;  2QJL A;  3W5U B;  2LGS A;  1DYQ A;  1ZDV A;  4ACF A;  4RMA A;  1KLU D;  1UWM A;  1I42 A;  2DAJ A;  5JH5 C;  2HE7 A;  3PSE B;  2Y5C A;  4W9F A;  2DZM A;  4BZA A;  1UF0 A;  3DWM A;  1FCL A;  2MH7 A;  2W9N A;  1ZUD 2;  1NI2 A;  1VD2 A;  1CK1 A;  3A9K A;  4HRS A;  4LJP B;  2CJN A;  1WJU A;  1Y56 A;  3TL5 A;  3BVM A;  4DXF A;  4G3X B;  4F7Z A;  1WMH A;  5E6N A;  2D3B A;  2MX2 A;  2C60 A;  2JXX A;  2BTE A;  4GDK A;  1RFK A;  4C00 A;  2MSE D;  1FFV A;  1FXI A;  5E6P A;  4IUM B;  2V0G A;  3EEC A;  1NEN B;  2V3N A;  1YQB A;  2KKC A;  1J8C A;  2Y3A A;  1FPY A;  2W3S A;  2M56 B;  4JL9 A;  4FN2 A;  4WUR A;  4BBN C;  3T8M A;  3AEG B;  3H8H A;  1C9F A;  3DHG C;  2IGH A;  5IN7 A;  1M4V A;  3QCA A;  4NJC A;  4AS1 A;  3AE4 B;  1V97 A;  1J7C A;  3DVN V;  3DBH B;  3AE6 B;  3SDL C;  2KWD A;  1CZP A;  3I3T B;  1YJI A;  5E6O A;  1TS5 A;  4OVZ A;  1QF6 A;  2B76 B;  4IG7 B;  3TJP A;  2M4N A;  1UD7 A;  3ZDT A;  4ASW C;  5FKA C;  2A4Z A;  2KTR A;  3PVL A;  4WWM A;  4F8C B;  2JRI B;  1FM0 D;  3EFU A;  3Q3O C;  3HVZ A;  4XYC A;  4NJ6 A;  4MGI E;  1Q10 A;  2ACZ B;  1H8C A;  3S2A A;  4US8 A;  3TSS A;  5D2M B;  4IW0 A;  3ZLZ A;  4LDT B;  2BVC A;  1R4M I;  4II3 B;  4NQL B;  3ZGZ A;  3UGB B;  1XD3 B;  1QOG A;  4KSK C;  2KLG A;  2W55 A;  2BKR B;  4FXC A;  4OVV A;  1ET9 A;  4HWI B;  1JRP A;  3VQI A;  3C19 A;  1WXV A;  2NBV B;  2L83 A;  3PHX B;  4ZHP A;  2XK5 B;  4HRO A;  5AZH A;  3RN9 C;  1OGW A;  1FXT B;  1GB4 A;  1LXD A;  2KX0 A;  1TKE A;  4GN1 A; 
#chains in the Genus database with same CATH homology
 3U30 A;  3KVF B;  4X57 B;  2KVR A;  2WYQ A;  3TMP B;  3M95 A;  2J0K A;  4K7S A;  4LJO B;  3U7D A;  5HKH A;  4HDQ A;  2G45 B;  3DBL I;  3OLM D;  1V5T A;  4BKG A;  4F1S A;  4EUT A;  2NPT B;  2ZNV B;  2KQS A;  1P0R A;  3EHV A;  2BYF A;  5L95 C;  3VFK A;  2ZCC A;  2WX0 A;  4FJZ A;  4K7U A;  3SD5 A;  3QHT A;  5CHV C;  1Z2M A;  2ZJD A;  2VRR B;  1V49 A;  2LVP A;  4DWF A;  3HHM A;  3KUD B;  4IC7 B;  5AEK B;  2N7D A;  3ZW3 A;  2A5U A;  2DZK A;  1WZ0 A;  4WJQ A;  2KDB A;  5J17 A;  3V6E B;  5AZG A;  4BVU C;  2K25 A;  3JSV B;  2N7E A;  3L08 A;  4GXB A;  4KDI C;  4B9K A;  3PRZ A;  3LDZ E;  2FIF A;  1IPG A;  3LJ3 A;  4BKS D;  1V80 A;  2OOB B;  2JZ3 B;  2ZZP B;  2BYE A;  3APC A;  4AWJ A;  3M62 B;  2CS4 A;  3EC8 A;  3TCA A;  4KIK A;  2LI5 A;  1V81 A;  4G11 A;  4W9I A;  4IM0 A;  4BFR A;  4KVG B;  3UIO B;  3W1S A;  4KZ0 A;  2DX5 B;  2BPS A;  2XK5 A;  3DVN U;  1LFD A;  3IFW B;  2KN5 A;  3PS6 A;  4WWP A;  1OEY A;  5AZF A;  3DVG Y;  1V6E A;  3VTW A;  2FAZ A;  2GBR A;  1WX9 A;  1GC7 A;  2FNJ B;  3ECI A;  2FID A;  2D2Q A;  3IG3 A;  2O6V B;  2O6V D;  2LWP A;  3N32 A;  1RFA A;  3ZTC A;  5DPT A;  1WGY A;  2REX A;  3PT2 B;  2DEN B;  3ZO5 B;  1HE8 A;  3U8Z A;  2CHZ A;  4XC2 A;  3JW0 X;  1Z5S B;  3VTV A;  4DDG D;  2NPT A;  2JVC A;  3NS8 A;  3AI5 A;  1ISN A;  2ZCB A;  4I6L B;  3KH0 A;  4W9H A;  3ZDM C;  4A3P A;  2K6Q A;  1I35 A;  3K9O B;  3R66 C;  4FJV B;  2DZI A;  2J0J A;  3K9P B;  1D3Z A;  2C7N B;  3N30 A;  1GJZ A;  1RAX A;  2MW5 A;  4N9F 4;  2JT4 B;  1E7U A;  2GMI C;  3AXC A;  3DQV A;  3H7P B;  4DHZ B;  4FHK A;  4PS3 A;  1OQY A;  3W1S C;  3SU8 X;  1TTN A;  2L7R A;  3UQA A;  4MEM A;  2KO3 A;  4ANU A;  1GG3 A;  2ZPY A;  2RGF A;  2IYD B;  2O2V B;  3IVF A;  4FBJ B;  2MWS B;  2KAN A;  2YVC A;  1K8R B;  4TUU A;  2B3A A;  5DPW A;  4P7I A;  3X23 A;  1X1M A;  2M8S A;  3CST A;  3JSV A;  1WXM A;  4FA6 A;  4FJY A;  1V5O A;  1P9D U;  2KJR A;  4LDT D;  5EDS A;  2C5L C;  4AJY B;  3L10 B;  3VXW A;  4ICV A;  4WJN A;  3RT3 B;  2KC1 A;  1KM7 A;  4AOF A;  3A4R A;  3TBL D;  4ZYN A;  3PTF C;  5J18 A;  2N1V A;  1Q1O A;  2M0X A;  4JLC A;  2ZNV C;  4PS8 A;  1Q0W B;  4W9G A;  4YL8 A;  4G0N B;  2KDI A;  5GMV A;  3ZKJ C;  1UEL A;  4KZC A;  3V61 A;  2LRU A;  4A3O A;  5D6J B;  4NY0 A;  2KFK B;  2KWC A;  4GB9 A;  4DBG A;  3L16 A;  3VHT C;  1UGM A;  2FCM A;  2O6V A;  3BY4 B;  4I6P A;  1UBQ A;  4EOY A;  2ZEQ A;  2PE9 A;  2C9W B;  1SE9 A;  3A33 B;  1WZ3 A;  3R3M A;  4J6I A;  2M1M A;  4HJK A;  5IAA C;  3WA0 A;  2RR9 A;  4M0W B;  5FR6 A;  3NHE B;  5D7G A;  4E71 A;  3AU4 A;  4EEW A;  2CHW A;  2C7H A;  1WR1 A;  3CSF A;  1RLF A;  3V60 A;  3L17 A;  3W1Y A;  3R7Q A;  2J0M A;  4PS7 A;  3H6N A;  2IBI B;  1E8Z A;  3KUZ A;  3JVZ X;  2ZVN A;  2G3Q B;  1UBI A;  3VAW A;  2KHW B;  2ZVO A;  2NBU A;  2MCN B;  4DXA B;  2BYV E;  1YX5 B;  2K6D B;  3ENE A;  4GIV A;  4W9K A;  3H7P A;  2FCN A;  4AJW A;  2L0T A;  1KLV A;  2AL3 A;  2KDF B;  2N9E B;  2K8B A;  3A9J B;  4GOC A;  4KDL B;  4MEL A;  1EO6 A;  3P2B A;  4HVB A;  3MHS D;  4WWN A;  3B1L X;  1MG8 A;  2L3Z A;  2CKH B;  2KX3 A;  2RPQ A;  2WWZ A;  3PGE A;  3DPD A;  4ZRI A;  4TKN A;  4A20 A;  2O2V A;  1WGD A;  2K1F A;  5CHW A;  2GBN A;  2I1K A;  4NNJ B;  4GMV A;  1LM8 B;  2ZPN A;  3KW5 B;  3RD2 A;  1GNU A;  1SIF A;  1WF9 A;  1GUA B;  1XT9 B;  3HK0 A;  3IBE A;  3M63 B;  2N1W A;  2GBK A;  3VUX A;  3ZNH B;  3WIM A;  5JHA A;  4GSW A;  2J7Q B;  2FCS A;  3QAR A;  2JF5 A;  1V2Y A;  2AWT A;  2NBW B;  3B08 A;  4GDL B;  4ZRJ A;  2K8C A;  4K7W A;  2KFJ A;  3HM6 X;  2XBB C;  4HXD A;  2KNB A;  5D94 A;  3QK0 A;  2HTH A;  2HD5 B;  2CU1 A;  2OJR A;  3APF A;  3H9D A;  2JY6 A;  2KFK A;  3MJW A;  2EMT A;  3C0R B;  3ML9 A;  2KWV B;  3QJZ A;  4HK2 A;  4ZDV A;  4I6N B;  5KHQ A;  1XQQ A;  4DK5 A;  2IY1 B;  3NOB A;  3PHW B;  3PZD A;  4HDO A;  3UQB A;  4W9J A;  3RUL A;  1J0G A;  2JWZ A;  2M17 A;  1NBF C;  4FAD A;  4W9D A;  2K39 A;  4K81 A;  3ML8 A;  5TR5 A;  1EF5 A;  1WM2 A;  3AU5 A;  4EZJ A;  4EZK A;  4ANX A;  4E74 A;  1RRB A;  3KUC B;  1E5W A;  1E90 A;  1WE7 A;  4RM8 A;  1EF1 A;  3R7R A;  1IYF A;  3WAN A;  1LQB A;  3RCZ A;  2C7M B;  3A1Q B;  2DYO A;  3BIN A;  4GU2 A;  3DBH I;  4HLE A;  2L76 A;  3GOE A;  3QC8 B;  1AAR A;  3ZTD A;  4MM3 A;  3SHQ A;  1G6J A;  5DPS A;  4ANW A;  2KTF A;  1J19 A;  3TIX A;  3A9K B;  3WAL A;  3QIJ A;  1TZ1 A;  1OTR B;  3RZW C;  3UF8 A;  4K1R B;  3OJ3 A;  3JYU A;  4MGZ E;  4XZ4 A;  1ZKH A;  2D3G A;  1V86 A;  2IO3 B;  2NVU I;  2KMA A;  4PYZ A;  3VH4 B;  2GOW A;  5LXI B;  2DYB A;  1WMH B;  3NY5 A;  2V4L A;  3QAQ A;  4WAA A;  3QQ8 B;  4HPL B;  4WJO A;  2GBM A;  3VTU A;  3DCG A;  5G2N A;  1KOT A;  4KV2 A;  4G50 A;  4IM2 A;  2Z0E B;  2KZR A;  4XX5 A;  2MBB B;  1WI0 A;  4GDK B;  4JIO U;  4MGY E;  4MGK E;  3PLU A;  2L00 B;  2BKF A;  5J2R A;  3NZU A;  4CYE A;  4MSM B;  2IO1 B;  1TGZ B;  2IZV B;  5JZE B;  2Z59 B;  2AL6 A;  2YLM A;  3ZNZ B;  1WRD B;  2KQ7 A;  1E8Y A;  3B0A A;  4NPN A;  4MSQ B;  4OVU A;  2KOX A;  1WYW B;  2PPH A;  1EUV B;  1P3Q U;  2KC2 A;  2MA9 B;  1ZW7 A;  2R2O A;  4RM9 A;  3APD A;  4EZL A;  3WAO A;  1QZE A;  1S3S G;  4M8N A;  1P1A A;  3GZN I;  3PV1 A;  2DAF A;  2LGD A;  4AP4 C;  5DCN A;  3PPA A;  2BWF A;  3WAM A;  3ALB A;  3PRP B;  4RMA A;  1U4A A;  1P98 A;  1L7Y A;  1I42 A;  3AUL A;  2DAJ A;  3RUI B;  5L83 A;  2Y5B B;  1WJ6 A;  5LXH A;  2MBH A;  2JPH A;  5JH5 C;  2HE7 A;  3VVW B;  4BBN F;  2N9X A;  2NS5 A;  3V6C B;  3A1Q A;  3PSE B;  3RYT A;  4HPM B;  1WGG A;  1YJ1 A;  2DZJ A;  2DZM A;  4W9F A;  4MJS B;  2L05 A;  4W9E A;  1T0Y A;  4II2 B;  1YIW A;  3PRE A;  4BOS C;  4IWO A;  2WDT B;  1WGR A;  2KWU B;  2W9N A;  1E8W A;  1H4R A;  1NI2 A;  2AYO B;  1VD2 A;  3A9K A;  2AEH A;  4LJP B;  3VDZ A;  1BT0 A;  1WJU A;  2MBO A;  4NAW B;  1OEY J;  2DHZ A;  2MP2 B;  4TQ0 A;  3TL5 A;  2LAS A;  1WXA A;  3HM3 A;  4ICU A;  1WFY A;  3N3K B;  2LGX A;  1WE6 A;  2ASQ A;  4G3X B;  4F7Z A;  1WMH A;  3RZF A;  2NR2 A;  1TBE A;  3OAW A;  3A4S C;  1VCB A;  2V3S A;  3QX1 A;  1YX6 B;  5E6N A;  3V62 A;  2MX2 A;  2C60 A;  2JXX A;  1A5R A;  4W9C A;  4GDK A;  3UIP B;  2KDE B;  4PYU A;  4CHK A;  3VH3 B;  2MSE D;  1E7V A;  2RD0 A;  1UZX B;  4GGQ A;  2MRP A;  5E6P A;  2UWQ A;  4IUM B;  5CTR C;  2KTR B;  2FUH B;  2MLB A;  4BOZ B;  3DOW A;  2IY0 B;  4FLH A;  3EEC A;  3L0W B;  1YQB A;  5G55 A;  3H1U A;  2MQJ A;  3H7S A;  4ANV A;  1WJN A;  2PE6 B;  2KKC A;  2LJ5 A;  3ZNG C;  3ZNI D;  2LZ6 A;  4M8M A;  4IWP A;  2LUE A;  1J8C A;  2MBQ A;  2LGY A;  4JGH B;  3IHP C;  2I1J A;  1NDD A;  1L2N A;  3CMM B;  3KYD D;  1WY8 A;  2LVO A;  2L8J A;  1PQS A;  2D07 B;  2KK8 A;  3L54 A;  2KJH B;  3NZS A;  4JL9 A;  4FN2 A;  4BBN C;  4EKU A;  2KMC A;  4CO7 A;  3T8M A;  4ZRK A;  1YD8 U;  2BF8 B;  4DHJ B;  4DHJ D;  1GC6 A;  3MTN B;  3ZIM A;  3ZRF A;  3DBS A;  4MJS A;  2D11 A;  2KLC A;  1WJ4 A;  1WR6 E;  4TQ1 A;  3QCA A;  2L0F A;  3QA8 A;  4HCP B;  1WXS A;  2V1Y A;  3ZUN A;  5DPR A;  4KSL C;  4WWO A;  3DVN V;  3HIZ A;  3M3J A;  1V9J A;  1ZGU B;  3PRM B;  4DHZ E;  2LD9 A;  2MP2 A;  1M94 A;  1WH3 A;  4NAW A;  2IO2 B;  5JHB A;  4E3C A;  3SDL C;  5C1Z A;  3I3T B;  4WQO B;  3A9J A;  1R4N I;  2BWE S;  5E6O A;  1KJT A;  3KYC D;  3O65 B;  2DYM A;  5LLI A;  4IG7 B;  4BKT A;  3TJP A;  2M4N A;  1UD7 A;  3ZDT A;  4ASW C;  2LXC A;  2G4D B;  4DDI D;  2WX1 A;  1IP9 A;  3D32 A;  2A4Z A;  2KTR A;  3PVL A;  2KXJ A;  2R2Q A;  4EFO A;  4F8C B;  2JRI B;  2CHX A;  3DDC B;  2JRH A;  4GDL A;  4WJP A;  1UH6 A;  2NCN A;  4B95 A;  2CR5 A;  3CF6 E;  3QWZ B;  1S1Q B;  3EFU A;  2KJ6 A;  2G4S A;  1WGH A;  3Q3J A;  3ZVV A;  4HCN B;  5IA7 A;  4NJ6 A;  3T9L A;  2D10 A;  4MGI E;  1C3T A;  2N9P C;  4B6W A;  3L13 A;  3DBR I;  2QHO A;  2UYZ B;  4LCD E;  4IM3 A;  1H8C A;  1WIA A;  4MH0 E;  3WAP A;  2LVQ A;  2MBE A;  2GBJ A;  5CX3 A;  3S2A A;  2JUO A;  5D2M B;  4IW0 A;  3VUY A;  5CHF A;  3ZLZ A;  3PLV A;  4LDT B;  4NQK E;  3VUW A;  3DVG X;  4BKS A;  2FCQ A;  4AUQ C;  4MDK E;  2JZZ A;  1R4M I;  4FHJ A;  1F9J A;  4II3 B;  2LRW A;  2PEA A;  3ONS A;  3Q3F A;  4NQL B;  1Y8R C;  4W9L A;  4IWQ A;  4FUL A;  1WX7 A;  2LXA A;  2EKE C;  3UGB B;  2EMS A;  4URK A;  2BGF A;  1CMX B;  1XD3 B;  2N4F A;  2IO0 B;  4KSK C;  3UIN B;  2KLG A;  1SGH A;  2BKR B;  2XEW A;  4JQW C;  3X0W A;  2RSU A;  4OVV A;  4KIK B;  4HWI B;  5C23 A;  3VQI A;  2HJ8 A;  5BO4 B;  1WXV A;  4NJ7 A;  1WM3 A;  2NBV B;  5KHO A;  3PHX B;  2Z0D B;  2XK5 B;  1C1Y B;  5AZH A;  3ZRC A;  2KD0 A;  3OJ4 B;  2PJH A;  1E8X A;  1OGW A;  1WX8 A;  1FXT B;  1LXD A;  1JRU A;  1Q5W B;  2K8H A;  2KX0 A;  4TV3 A;  4GN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...