5J18A

Solution structure of ras binding domain (rbd) of b-raf complexed with rigosertib (complex i)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j18A01
4F1SA 4GDKB 1WR6E 3ALBA 4A3PA 1V2YA 2D10A 2N1WA 4IM3A 5CTRC 5FR6A 2KQ7A 3ONSA 1GG3A 4ZRKA 3AXCA 1V9JA 4LDTB 5AZFA 2IY0B 2CHXA 2WDTB 1WGDA 1WMHB 2LXCA 2O2VB 3PHWB 2KX0A 5LXIB 2L00B 1WXAA 2FNJB 2ZCCA 3ZNGC 2EMSA 4F7ZA 2C60A 4PS3A 3P2BA 1LFDA 4DXAB 2Z0DB 1WGYA 3ZVVA 3JSVB 4IWPA 2KWCA 4TUUA 1EF5A 2KLGA 2MBEA 1QZEA 3ZDTA 1WFYA 2PJHA 1WIAA 1V6EA 3SDLC 1L7YA 4II3B 3VXWA 5J18A 2DYOA 4WWPA 2MA9B 3NZSA 2CS4A 2XEWA 4MGYE 1ZGUB 2FCMA 1P0RA 4ICUA 1WXVA 3MTNB 3VHTC 1WRDB 1V5TA 3HM3A 3PPAA 5CHVC 1KM7A 1X1MA 4W9EA 1I42A 4IM0A 2KLCA 4W9JA 3PS6A 1WX8A 4MDKE 2EMTA 4NJ7A 3VVWB 4TQ0A 3OJ3A 4DHZE 1F9JA 3NS8A 2JZ3B 1YX5B 2IO0B 3JW0X 5KHQA 4KDIC 5L83A 2MW5A 4EZLA 2L76A 3A9JA 4JQWC 1HE8A 4FLHA 2LJ5A 1YQBA 3DVNV 3ECIA 4KIKA 4RM9A 5JZEB 2JT4B 4MSQB 1GJZA 2G4SA 1E5WA 4A20A 1WE6A 1WX9A 2V3SA 3EECA 2YLMA 2MBHA 4HCPB 4BKGA 5GMVA 5E6OA 3KUCB 4G3XB 5JHAA 1GUAB 2KJRA 2J0JA 4W9LA 3ZNHB 2HD5B 2N9EB 1EF1A 3DBSA 4MJSB 3ML8A 1J0GA 4GDLA 4GU2A 4GB9A 1IPGA 4JLCA 5IA7A 1T0YA 2LVQA 3L54A 1V81A 3U30A 2GBJA 4HCNB 4WJNA 3IFWB 2J7QB 2G3QB 3QIJA 2KD0A 4B6WA 3WANA 4TQ1A 3V6EB 2DAFA 3ZRCA 2BYEA 3V62A 3VQIA 2NR2A 1E7VA 2M0XA 1ZW7A 4HK2A 5E6NA 1NI2A 3PRZA 5IAAC 3PSEB 4DHJB 5EDSA 4TKNA 4GOCA 3DBRI 2NBVB 3B0AA 2J0MA 2BWFA 4W9CA 4ANUA 4OVUA 3LDZE 1SE9A 3DDCB 4RM8A 2K6DB 4IC7B 3QX1A 3DOWA 1S3SG 4P7IA 2NCNA 2KTRA 4YL8A 3PGEA 2KC1A 2B3AA 2NVUI 1UZXB 2WYQA 2IYDB 4GSWA 3HIZA 1CMXB 3A1QA 2L3ZA 5CHFA 5BO4B 5C23A 3DPDA 1P3QU 2GBMA 2N7DA 4KZ0A 2BPSA 2AEHA 2C7HA 1S1QB 2MSED 2IO1B 2K8HA 3X0WA 3K9PB 1Q1OA 2FCQA 1J19A 2DZMA 2CKHB 2LASA 2LGYA 2C9WB 2UWQA 2LZ6A 3RT3B 1XT9B 2A5UA 3N30A 3U7DA 2D07B 4NJ6A 4NNJB 3ENEA 2J0KA 1OEYA 4JGHB 4MM3A 4WQOB 2PPHA 3APFA 2CU1A 4HPMB 3QA8A 1KLVA 4EZKA 3CF6E 4DDID 1WY8A 1AARA 3A9JB 4K7WA 3L13A 3ZLZA 2LVPA 5AZGA 3ZO5B 2QHOA 2NS5A 3NY5A 3QWZB 4HPLB 2AYOB 4IW0A 4KSLC 1WI0A 3DBLI 2KO3A 4HWIB 4KIKB 4HLEA 4G0NB 4AWJA 4GN1A 3B08A 1WGRA 5DPTA 2AWTA 4GXBA 4NAWA 3VUXA 3ZTCA 1WGHA 4MGKE 2K8CA 3IG3A 2IY1B 3QQ8B 3LJ3A 4IWQA 4FADA 2MWSB 4M0WB 4GIVA 3C0RB 3CSTA 1C3TA 4KZCA 4FA6A 2KVRA 4HJKA 1TBEA 4GDLB 3QCAA 1J8CA 2JY6A 4G11A 4NQLB 1E7UA 1P9DU 1GC7A 4KV2A 5D2MB 3N32A 5DPRA 2KNBA 4XZ4A 4ANWA 4DK5A 3KYDD 2D3GA 5DPSA 3TJPA 2I1KA 2R2QA 4OVVA 3QC8B 3L17A 4KVGB 1BT0A 2I1JA 3VAWA 4MGZE 1KJTA 4II2B 4M8NA 5JHBA 1UGMA 2KDEB 2KMAA 3WAPA 2JF5A 1UD7A 2XK5A 4HXDA 3QHTA 4W9HA 1RAXA 2C5LC 3DQVA 2A4ZA 4WJPA 3A4RA 2L0FA 3L0WB 4WJQA 2N4FA 3MJWA 5J17A 3NOBA 5CHWA 3WALA 2IO3B 5CX3A 2L05A 3WAOA 4W9IA 1WX7A 2DZIA 2DYMA 3VUWA 2M1MA 4WWNA 2M4NA 3IVFA 3A9KA 1WYWB 5DPWA 1D3ZA 2KHWB 3AULA 2K39A 2KKCA 2NPTA 2UYZB 3H1UA 3TIXA 2KMCA 1XQQA 1TTNA 3R3MA 3VFKA 2ZNVB 3A1QB 2JZZA 2ASQA 4DWFA 3TCAA 1WJ4A 2MLBA 1PQSA 3OJ4B 4URKA 4JIOU 2JVCA 4DDGD 3L16A 1TZ1A 4G50A 4BVUC 4LJOB 2LGXA 2M17A 1MG8A 2ZVOA 2GMIC 4K1RB 2MX2A 4ANVA 3X23A 1OTRB 1E8YA 1TGZB 4IWOA 2LXAA 3O65B 4CHKA 3B1LX 1WF9A 4HVBA 4I6LB 2G45B 2KFJA 2RPQA 2O6VA 2VRRB 1OEYJ 3D32A 3RCZA 3VUYA 3JYUA 3IBEA 2WX0A 2GBRA 1A5RA 1Z5SB 1E8WA 2O6VD 2K1FA 4BBNC 4FHJA 3L08A 2LD9A 4FHKA 3UQAA 1WM2A 4W9GA 4E71A 2PE9A 3Q3JA 3VH3B 3VH4B 4LDTD 3AU4A 5D7GA 4F8CB 5HKHA 4I6NB 5AZHA 3U8ZA 1OGWA 3K9OB 2JUOA 1RLFA 2LVOA 3M63B 4NY0A 2BYFA 2MCNB 5LLIA 4NAWB 4IM2A 1V5OA 2JRIB 3ZUNA 3ZNZB 2BKRB 3KH0A 3KUZA 2BWES 3ZRFA 4FN2A 3NHEB 3PTFC 2KFKA 2PE6B 2OOBB 3I3TB 4WAAA 1H8CA 3UQBA 3UIOB 2BYVE 2GBNA 1WJNA 3PLVA 3DVGX 3QJZA 3W1SC 4MEMA 1LM8B 2MRPA 4E3CA 1WJUA 4EUTA 3M95A 2R2OA 4ZRJA 3ZDMC 4CO7A 2JRHA 2KZRA 3HK0A 4IUMB 1WM3A 3HHMA 3PV1A 3V60A 4AJYB 5D6JB 1UELA 3GZNI 3JVZX 2AL3A 2FIDA 4W9FA 3ZTDA 2XK5B 2ZPNA 4ZRIA 4MH0E 3HM6X 1C1YB 1UBIA 2LRUA 2KJHB 2K8BA 4AJWA 2KDBA 2YVCA 2G4DB 4J6IA 3RYTA 3PHXB 4FJVB 2N9PC 4LJPB 3APDA 3PT2B 3A9KB 3AI5A 3DCGA 3PRMB 1V49A 3PREA 2OJRA 4HDQA 2JWZA 2HE7A 2NPTB 4EEWA 3PVLA 2JPHA 4ANXA 3RZWC 4FULA 2N7EA 1UH6A 3CSFA 2KXJA 4FJZA 3S2AA 1H4RA 1WH3A 1WXSA 4AOFA 2GOWA 3EHVA 5L95C 2MBBB 4MJSA 1WJ6A 1WR1A 1M94A 2DYBA 3ZNID 4EOYA 2FAZA 3SD5A 2RGFA 4MELA 1WGGA 1Q0WB 2EKEC 1V80A 4BOSC 1WZ3A 3ML9A 3BY4B 1LQBA 2O6VB 3PZDA 3WIMA 2L0TA 4AP4C 4ZDVA 3A4SC 2RSUA 1Q5WB 2W9NA 1U4AA 2C7MB 1SIFA 3KVFB 4MGIE 3TL5A 3EC8A 4ZYNA 4ICVA 4DHJD 3M62B 1EUVB 1E8XA 3AU5A 4NPNA 1IYFA 2LUEA 4W9DA 3L10B 4WWOA 2KDFB 5G2NA 3RD2A 1I35A 2N1VA 1NBFC 4K7UA 5DCNA 4PYUA 4NQKE 5TR5A 2CHZA 1E90A 2V1YA 4JL9A 4FBJB 2REXA 2FCNA 2ZZPB 2DHZA 2KFKB 1V86A 3ZW3A 3RUIB 3QAQA 2CR5A 2DENB 1YIWA 2KTRB 2Y5BB 4XX5A 4BOZB 2LI5A 2LRWA 4EKUA 4PYZA 4DBGA 1SGHA 3V61A 2Z0EB 5KHOA 3RULA 2XBBC 3TMPB 5C1ZA 2KX3A 2GBKA 2MP2A 3NZUA 3VTVA 2MQJA 4W9KA 4EZJA 3EFUA 3H7PA 3H6NA 2KC2A 4A3OA 1L2NA 4RMAA 3RZFA 3ZIMA 2V4LA 2ZJDA 2KQSA 4BFRA 3V6CB 1P1AA 4GDKA 3UIPB 2KTFA 1WE7A 1P98A 2DZKA 4CYEA 4HDOA 3UINB 3WA0A 1YX6B 4K7SA 4BKSA 2KN5A 2MBOA 3KUDB 4X57B 1OQYA 2Z59B 1ISNA 1R4MI 1VCBA 4ASWC 5G55A 5J2RA 1FXTB 4BKSD 2KOXA 1WZ0A 3PRPB 1WMHA 2O2VA 4FJYA 2JXXA 3QK0A 4B95A 1YD8U 2FIFA 4PS8A 5AEKB 3IHPC 2LWPA 2DZJA 4GGQA 2KDIA 4AUQC 2M8SA 2ZVNA 2RR9A 3ZKJC 4I6PA 2C7NB 4K81A 4KDLB 3DBHI 3TBLD 3W1YA 2IO2B 2FUHB 2ZCBA 3JSVA 3QARA 5LXHA 4XC2A 3H9DA 1Z2MA 1E8ZA 4MSMB 4BBNF 4M8MA 4TV3A 1GNUA 2BGFA 5E6PA 3VTWA 3APCA 2K6QA 2N9XA 1VD2A 2HJ8A 1YJ1A 2IBIB 2KWUB 4KSKC 3R7QA 2LGDA 2NBUA 3T8MA 3SHQA 1K8RB 1WXMA 3R7RA 3MHSD 2KANA 1RFAA 4E74A 4N9F4 5D94A 2KJ6A 1G6JA 3M3JA 2MBQA 3UF8A 1KOTA 2IZVB 4EFOA 2NBWB 3UGBB 2D11A 3W1SA 2DAJA 5JH5C 3A33B 2K25A 2WX1A 3OLMD 3VDZA 4GMVA 3KYCD 2ZNVC 4PS7A 1Y8RC 3Q3FA 3CMMB 1LXDA 1RRBA 2HTHA 4LCDE 2PEAA 3DVNU 4IG7B 3OAWA 3WAMA 3GOEA 1ZKHA 3SU8X 1EO6A 1NDDA 2L8JA 4WJOA 4DHZB 3PLUA 2ZPYA 2ZEQA 4BKTA 1JRUA 2KWVB 2RD0A 3BINA 4B9KA 2AL6A 1GC6A 1XD3B 2D2QA 2MP2B 2BF8B 3VTUA 2FCSA 2DX5B 1R4NI 3DVGY 1UBQA 3KW5B 3N3KB 3H7PB 2L7RA 3H7SA 1IP9A 2WWZA 2CHWA 3T9LA 3R66C 2BKFA 2KK8A
chains in the Genus database with same CATH superfamily
2QMTA 1SBBB 1NENB 2D10A 2N1WA 3MFGA 4IM3A 5FR6A 2BTEA 1GG3A 1Q10A 5AZFA 4LDTB 2IY0B 2WDTB 4HRSA 4YWGG 3PHWB 2KX0A 3VR9B 2FNJB 2J52A 2K9XA 2EMSA 1TZOA 4F7ZA 4TUUA 2PJHA 5FKAC 1WIAA 4YSZB 1MFWA 3GE8C 3Q8EA 3SDLC 1QOAA 4II3B 5J18A 1K50A 2DYOA 4MGYE 2X38A 3VHTC 1I42A 1KM7A 1K52A 4IM0A 4L1BA 1T5XD 3OJ3A 1XLNA 4DHZE 2JSVX 2AQ1B 2JZ3B 3JW0X 1N60A 2LMCA 3V05A 2MW5A 2JQRB 1ZDXA 1AWDA 2LJ5A 1F2RC 1YQBA 4BZAA 1QLBB 5JZEB 2JT4B 3N1ZC 3HUIA 4A20A 1E5WA 2HTME 3SEBA 2MBHA 3BVGA 4HCPB 1YN5A 1JQ4A 3Q69A 1QILA 2HD5B 1EF1A 1IPGA 2LVQA 1YN3A 3L54A 4WWMA 5EE1A 2SAKA 4JX1C 2J7QB 2WXQA 3WANA 3V6EB 3V62A 3VQIA 5EDSA 1L4DB 3BK2A 2BWFA 4S17A 4W9CA 1GB4A 3ZJUA 1SE9A 2QSDA 4IC7B 3QX1A 3DOWA 1S3SG 4P7IA 4XE0A 4RNAA 2NVUI 1UZXB 1C76A 4GSWA 1CMXB 3A1QA 2L3ZA 3DPDA 2WXHA 4NZLB 5AUKA 2N7DA 4HKZE 2AEHA 2C7HA 1FMAD 1QOBA 1D5XC 1EM7A 1Q1OA 2FCQA 1J19A 2UWQA 3U7DA 4ZRPA 4MM3A 4JGHB 1OEYA 2PPHA 3APFA 2Y5CA 4N59A 4DDID 3ZLZA 2L52A 2NS5A 3QWZB 4HPLB 4IW0A 1I4RA 4JPSA 1KH0A 3AB5A 1P7EA 4G0NB 3B08A 5DPTA 3U2SC 3VR8B 1FRRA 3AMZA 2BT6A 3QQ8B 3AN1A 3LJ3A 1ZP0B 2WXLA 3Q8FA 4FADA 1TBEA 3E9SA 4G11A 5D2MB 5IN7A 5DPRA 1XLQA 4XZ4A 1E9MA 3KYDD 2LFIA 2I1KA 3QC8B 4MGZE 1V1OA 2JF5A 3DQVA 4PT5A 2A4ZA 3L0WB 2V0GA 3NOBA 5CHWA 3WALA 4M02A 3WAOA 1N61A 2IGHA 2DZIA 4RCOA 2JXTA 4UDUC 2INPE 3AE2B 2K39A 5IOIA 1JW9D 2NPTA 4YTMB 1TTNA 2ZNVB 3C8YA 4DWFA 4NAMA 2MEKA 1N5XA 4M00A 3L16A 2WXNA 1MG8A 2ZVOA 2GMIC 4ANVA 3NVVA 1OTRB 4JWUC 3O65B 3N20C 3RNEC 3WAPA 3VUYA 2VRRB 2VZKD 2GBRA 4LLGM 1LGRA 1A5RA 4FHJA 3L08A 2KAJA 1TKEA 4W9GA 2PE9A 3VH4B 4I6NB 3DWMA 2W3SA 3NZ3A 4NAWB 3KH0A 3KUZA 2BWES 3ZYYX 2GBNA 2NTTA 3QJZA 2QC8A 1V8CA 1L0VB 2LGSA 2KZRA 3HK0A 3V60A 5D6JB 3BYYB 3JVZX 4OVZA 5BMIA 2E3TA 3N1XC 2XK5B 1FCLA 2LRUA 2CJOA 2K8BA 3AECB 1TKGA 2KWDA 3PHXB 2N9PC 4FJVB 4LJPB 3W2DA 3DCGA 1V49A 3PREA 2JWZA 3RNGC 3AV8A 2I38A 3Q14C 4FULA 1YJJA 3EHVA 2MBBB 2RGFA 1WGGA 1N63A 2O6VB 2E6XA 3SR6A 4ZDVA 1U4AA 3W5UB 4ICVA 3RNFC 1E8XA 2RDBC 2LUEA 2RDGA 4XDDA 3RD2A 3DHIC 2N1VA 1NBFC 4XWTA 1OFFA 1PGAA 1E90A 1TS5A 3PZ7A 2REXA 1I4XA 2WLBA 1V86A 1N62A 1GAQB 2CR5A 4EKUA 4DBGA 1SGHA 2Z0EB 2QCZA 3NUHB 2I2YA 2MP2A 1ENFA 3NZUA 4OW0A 3IAM1 3H7PA 1L2NA 1IBXA 4RMAA 3RZFA 2ZJDA 4JWSC 3UIPB 2QILA 1P98A 3ZXRA 1C77A 4K7SA 4MM3B 3IT6B 2Z59B 1ISNA 1F77A 3AH7A 2KOXA 2IJ0A 1WZ0A 5AUIA 3QK0A 2GB1A 3IHPC 4WIPA 4AUQC 2M8SA 1JMLA 3ZKJC 4M0WA 3TBLD 1LO5D 1Z2MA 1E8ZA 4XDCA 4M8MA 1GNUA 4C4VB 3KLSX 1ZPSA 4OZCA 2N9XA 2HJ8A 3R7QA 2LGDA 2MHJA 2NMQA 3C19A 1FPYA 1ZUD2 4B0EA 3Q8CA 4N9F4 3U4EG 2KJ6A 2PVGC 3UF8A 1B1ZA 1JCKB 4ZOHC 4EFOA 3UGBB 3W1SA 1KLUD 4PS7A 1SE3A 2L83A 1DGJA 1V97A 1HEZE 3DBRB 1SE2A 4Q2JA 2ZPYA 2ZEQA 1JRUA 2RD0A 3Q3MC 1ET9A 1GC6A 5D3IB 1MVKA 3TEWA 4ACFA 2CHWA 1NYQA 4A90A 2SEBD 2BKFA 4EEWA 1XCQL 1DYQA 2VZKB 1C9FA 3GZNB 1TKYA 4ARIA 5CTRC 2KVZA 3ONSA 4ZRKA 2CHXA 2WGSA 2O2VB 3Q2AC 2L00B 2ZCCA 3P63A 3ZNGC 1LFDA 1TS3A 2BS4B 1WGYA 1YOVB 1EF5A 2MBEA 3DBLB 1CK1A 1L7YA 1SJHD 5BYQA 4WWPA 1HZ6A 2CS4A 1ZGUB 1P0RA 1SE4A 1QT9A 2GLSA 3P4PB 1VZ6A 2K5PA 1Y56A 4W9JA 1WX8A 4MDKE 4REZA 3P4SB 1YX5B 2IO0B 5KHQA 5L83A 2L76A 3ECIA 3DVNV 3RPFC 1KFYB 1GJZA 2WXGA 1WSPA 5EE9A 4BKGA 4NJCA 1T0QC 4G3XB 5JHAA 2J0JA 4W9LA 2N9EB 1NI3A 1J0GA 1KLGD 4GU2A 3PZ8A 4JLCA 3OG5A 1PFDA 3U30A 4WJNA 4KKJA 2G3QB 3QIJA 1MJDA 2KD0A 2FUG1 1QOFA 3PRZA 5IAAC 3B9JA 4TKNA 4GOCA 5G5HA 4ANUA 3DDCB 4RM8A 4XYCA 1DOYA 4RH6A 1ZXIA 3EFCA 5BO4B 2GBMA 2BPSA 2MSED 2Z8LA 2K8HA 1WXQA 2LGYA 2CKHB 1XT9B 2A5UA 3ENEA 3W9CB 4WQOB 2K3UA 4EZKA 3BK1A 1WY8A 1AARA 1ZDVA 3A9JB 4K7WA 3L13A 3Q3NC 5AZGA 5HFYA 4KSLC 1WI0A 4AWJA 3TEXA 4NAWA 3ZTCA 3AE7B 2IY1B 4B0MA 4M0WB 4GIVA 3C0RB 3CSTA 4FA6A 4HJKA 3QCAA 1P9DU 5I4DA 2KNBA 1NVID 2KYWA 2IPKD 1UD7A 2XK5A 4HXDA 1VDVA 3QHTA 4W9HA 4YSYB 4US9A 5H8YE 3P4QB 2HDEA 3HRDD 3RN9C 1WX7A 3VUWA 2M1MA 4WWNA 1B9RA 1WYWB 1D3ZA 2KHWB 3AULA 3H1UA 2KMCA 1XQQA 3B2FA 1C4AA 2JZZA 4IOIE 1MHHE 3TCAA 4HROA 1PGBA 1PQSA 3OJ4B 1RWSA 4URKA 4JIOU 4DDGD 4LJOB 2D5GA 3X23A 4LNNA 1YJIA 1E8YA 3BVZA 4IWOA 3T3NA 4CHKA 3B1LX 2WU5B 1WF9A 3FILB 2RPQA 2KFJA 4HVBA 2O6VA 3Q6BA 3D32A 1E10A 3IBEA 1Z5SB 1E8WA 3CWIA 2O6VD 4BBNC 2VH2A 1JWMD 3AEDB 4FHKA 1FXAA 1L0YB 3VRAB 4E71A 3Q3JA 4F8CB 3AU4A 5HKHA 2EELA 5AZHA 3K9OB 2LVOA 5LLIA 1FD6A 2JRIB 2BKRB 2DBYA 1E0ZA 4OHJA 3ZRFA 4FN2A 3NHEB 3UQBA 1L6UA 2BYVE 1WJNA 1T0SC 3W1SC 2MRPA 4E3CA 1WJUA 3M95A 2R2OA 4ZRJA 3ZDMC 4CO7A 4IUMB 3DBHB 1WM3A 3HHMA 1UELA 3MC9A 1TS4A 2KACA 3URYA 4HPPA 4LK0M 3ZTDA 4ZRIA 2V3PA 1C1YB 1UBIA 3NRZA 2WXMA 3RYTA 3APDA 1NEKB 3V3XA 3A9KB 3AI5A 3PRMB 4USAA 2JPHA 4ANXA 2W55A 3CSFA 4AOFA 4MJSA 1WR1A 3EGRA 3ZNID 2RMMA 4C4VA 4BOSC 4RGOS 3BY4B 1LQBA 3PZDA 1GPXA 1Q5WB 4MGIE 3EC8A 1R4NB 2ON8A 4DHJD 2CJNA 1IYFA 4WH4A 3BVMA 1TY2A 2KDFB 5DCNA 5TR5A 2M0AA 2V1YA 4JL9A 2FCNA 2H89B 5MPOA 2WXFA 3RUIB 2DENB 2LI5A 2LRWA 4PYZA 2WP9B 1XXGA 4C7YA 3RULA 1FFVA 3DWGC 3VTVA 2MQJA 1JROA 4W9KA 2KC2A 2RPVA 2WDQB 2V4LA 1V1PA 2X8XX 3V6CB 1P1AA 2KTFA 1IGCA 3UINB 3WA0A 1YNTE 4BKSA 2KN5A 5BMHA 3KUDB 4X57B 1OQQA 3GS2A 4RF1A 1VCBA 4RGTA 5G55A 5J2RA 4BKSD 4ITKA 2O2VA 2N9KA 5AEKB 2FIFA 2LWPA 3IT4B 2ZVNA 3W1YA 4KDLB 1AN8A 4D2KA 2ZCBA 5IO9A 2JX5A 3DHHC 1TT5B 5E6PA 3APCA 2K6QA 1BMLC 2PW9A 1VD2A 4C80A 2IBIB 4KSKC 2NBUA 1NYRA 3P1MA 1K8RB 1HTOA 4JE3B 1QOGA 2KANA 3M3JA 2MBQA 4DQOC 1XCTL 3VDZA 2ZNVC 1Y8RC 1LXDA 4J3OD 1RRBA 3AEEB 1JRPA 3WAMA 1ZKHA 1EO6A 1NDDA 4M01A 2KWVB 2WQYB 1ZOYB 3BINA 2AL6A 1L4ZB 1UWXA 2FCSA 3HVDA 3RNBC 3I9V1 1VZ8A 2L7RA 2INNE 4F1SA 4GDKB 1I4HA 3ALBA 4A3PA 1SF0A 1D5ZC 1MI0A 2INDC 3AXCA 2TSSA 1IUEA 1WMHB 2LXCA 5LXIB 2WHIA 1WXAA 2JYEA 5HI1A 1DOIA 2C60A 1D5MC 2LHEA 2OHFA 4PS3A 3P2BA 3AE5B 4DXAB 3ZVVA 5GXGB 3JSVB 4IWPA 3RNAC 2KLGA 5TSSA 1QZEA 4WAFA 1WFYA 4BAXA 3NZSA 1FNUA 2FCMA 1WXVA 3MTNB 1WRDB 1V5TA 3HM3A 3PPAA 5CHVC 1X1MA 3I57A 3ZJTA 2INCC 4NJ7A 4TQ0A 2BQQA 1F9JA 3NS8A 1FNVA 2QIEB 2N7JA 3FC4A 4KDIC 4EZLA 3A9JA 3Q8AA 4AQ7A 4A6QA 4JQWC 3N9YC 4FLHA 5IP4D 4RM9A 4MSQB 1YQ3B 3EECA 1WX9A 2YLMA 1C78A 2V9HA 4A55A 5E6OA 1C4PA 3LYYA 4MJSB 3ML8A 3Q8BA 5IA7A 2D3CA 1V81A 4HCNB 1D4BA 3IFWB 1MPEA 4TQ1A 3ZRCA 2BYEA 1E7VA 2M0XA 3BZDB 1ZW7A 3NVWA 4HK2A 5E6NA 4KGSA 4DHJB 3DBRI 1ZE3D 2J0MA 3ETRA 3MC8A 1HXYD 3LDZE 1I4GA 4GLSC 1JWBD 3GP7A 1CZPA 2KC1A 4YXDB 3AE8B 3ZXVA 1P3QU 4KZ0A 1TJEA 1A70A 3TEYA 3HVZA 1F1HA 3X0WA 3K9PB 1SIJA 2PVOD 2LASA 3SFEB 2XN9C 3RT3B 1IGDA 2D07B 3FILA 4NNJB 2J0KA 1V1PB 2CU1A 2FE8A 3QA8A 1UWMA 1KLVA 4KKIA 2BW2A 3RFZB 2WXIA 1PDXA 2AYOB 5C2TB 3DBLI 4HWIB 4KIKB 2XNAC 1WGRA 2AWTA 4GXBA 4A8XC 4K3CA 1WGHA 4MGKE 2K8CA 3IG3A 3KQ4A 1TY0A 2MWSB 1C3TA 1P7FA 3MP9A 1QKZA 2KVRA 4GDLB 1J8CA 2JY6A 4NQLB 1E7UA 3N32A 4ANWA 3TJPA 1MHXA 3U7ZA 4YTNB 3L17A 3BYTB 1BT0A 1FM0D 3VAWA 2LHDA 3H8HA 1MG4A 5JHBA 1UGMA 2KDEB 2KMAA 2C5LC 4WJPA 3A4RA 4KGTA 3MJWA 4S0RA 2IO3B 5EE3A 4W9IA 2DYMA 4MH8A 1ESFA 3A9KA 1CJEA 2KKCA 2UYZB 1VJKA 4ZHOA 3ABVB 3AE6B 3R3MA 3VFKA 2Q5WD 4TMAB 1WJ4A 4ARCA 3R2IA 2JVCA 1HQRD 1TZ1A 4G50A 3UI3A 2PMVA 2M17A 4K1RB 3OWEB 1AYFA 2LXAA 3RI7C 3I63C 4N6EB 1SXTA 2MJDA 1DOXA 2R61A 4L23A 1BXTA 3AM9A 3JYUA 1XLPA 2WX0A 5EE0A 4L2YA 1FEHA 3N1YC 2LD9A 3UQAA 2WXPA 1HZ5A 1OGWA 2JUOA 4YT0B 3M63B 4NY0A 2MCNB 2KN4A 1CQVA 1R4MB 4XWWA 3PTFC 3I3TB 4WAAA 2OEDA 2J53A 3DVGX 4MEMA 1STEA 2ONQA 4IDIA 2JRHA 3FKYA 3PV1A 1YQ4B 4AS1A 2FIDA 1UNSA 4MACA 3HM6X 2JYTA 2KJHB 4RF0A 2EKIA 1K53A 2V4IB 2G4DB 4HDQA 2HE7A 2WXOA 3W5VB 4EE2A 1UH6A 1WYGA 2KXJA 1WXSA 1WH3A 5L95C 1WJ6A 1XO3A 4EOYA 1GB1A 2V3NA 1Q0WB 1V80A 4XGAB 1WZ3A 3ML9A 4AP4C 3WIMA 2Y5PA 2L0TA 4YSXB 1EWYC 3KVFB 1SIFA 2JWUA 2W82A 4ZYNA 2CU3A 2AQ3B 5T8IA 5FK9C 3M62B 1EUVB 4NPNA 1RM6C 3ZQ4A 2D3BA 1E6EB 5G2NA 4K7UA 3WCQA 4PYUA 2MJEA 4FBJB 2ZW0A 2WXKA 2ZZPB 2N9LA 2DHZA 2KFKB 3ZW3A 2Y3AA 1UUPA 3QAQA 2WDVB 4XX5A 3V61A 3AE1B 5KHOA 4P1CC 3TMPB 4EZJA 3H6NA 1ROEA 1I4QA 2KQSA 4LNFA 4BFRA 4GDKA 2DZKA 4CYEA 2DNFA 3AE3B 4ASWC 1FXTB 1R7SA 4A9AA 1SSNA 1WGKA 1WMHA 2ICIA 1N5WA 4FJYA 4PS8A 2KDIA 2W3RA 2RR9A 4I6PA 2C7NB 4K81A 3DBHI 3SFDB 4LNIA 2IO2B 2FUHB 2BBCA 3JSVA 2HJ1A 3QARA 5LXHA 4XC2A 3H9DA 4MSMB 2LUMA 3RMKC 2PIAA 2GRIA 3T8MA 1RYJA 1XF5L 3R7RA 1RFAA 4E74A 3U52E 3AE9B 1G6JA 1KOTA 2IZVB 2D11A 5JH5C 1J7CA 3A33B 2K25A 3OLMD 3E56A 1ET6A 2WXJA 4ZRQA 3Q3FA 3CMMB 1I4PA 2HTHA 1FCCC 2PEAA 1T6BX 4LCDE 2J42A 3SU8X 1YN4A 3MC0B 5BYSA 2L8JA 4WJOA 4DHZB 3R8BA 4R3DA 2RDHA 1PYWD 3FAHA 4BKTA 4P1BC 2AX5A 1GOZA 4B9KA 1XD3B 2D2QA 2WU2B 2BF8B 3VTUA 2DX5B 1R4NI 1UBQA 3KW5B 1IP9A 3H7SA 1KTKA 2YEPF 1FXIA 3T9LA 4B6WA 3PRPB 2KK8A 1WR6E 4KGRA 1HA5A 3NJTA 1V2YA 2LJIA 4LNKA 2KQ7A 1V9JA 3IAS1 3MJ5A 1TIFA 1WGDA 5E6JA 4PK1A 1TYGB 2QJLA 2Z0DB 3J9CA 2IDYA 2KWCA 3ZDTA 1V6EA 3AEFB 3VXWA 2MA9B 2VH1A 1C79A 2XEWA 3R2TA 4IKGA 4ICUA 4OZAA 4P6VF 1SEBD 5BYRA 2KDMA 4W9EA 3AEGB 2KLCA 3PS6A 3NG0A 2EMTA 3VVWB 4LNOA 2WS3B 3BWUD 1HE8A 1VLBA 1RFKA 1ACCA 4KIKA 1EU3A 3KWVA 3NVZA 4P16A 2G4SA 1WE6A 2V3SA 1KF6B 5GMVA 2YEPB 3KUCB 1GUAB 2KJRA 3ZNHB 3DBSA 2QDFA 4GDLA 4GB9A 1T0YA 2GBJA 2PKOA 2IGGA 2DAFA 2G1EA 2NR2A 2KMMA 2K22A 1NI2A 3PSEB 1K51A 2JZPA 1J7AA 1M4VA 2NBVB 3B0AA 3GB1A 2PLPA 4OVUA 1PGXA 3BIID 2K6DB 3ZGZA 2NCNA 4TSSA 2KTRA 2WDRB 4YL8A 3PGEA 1FO4A 2KQ4X 2B3AA 1C4CA 2BS2B 4CQNA 2WYQA 2IYDB 3HIZA 5CHFA 5C23A 3TSSA 3IXSA 1S1QB 2IO1B 2DZMA 1SB3C 5IKCM 2C9WB 2LZ6A 3N30A 1JWUD 4NJ6A 4RGMA 4WURA 4HPMB 2G9HD 3CF6E 1XLOA 2BB6A 2LVPA 3ZO5B 2B76B 2KT7A 2QHOA 3NY5A 4C56C 3I5JC 3GE3C 2KO3A 3PO0A 4C00A 4HLEA 3KWLA 4GN1A 2PTLA 3VUXA 2BYTA 3ZJVA 5LNK1 4IWQA 1OQRA 2DLBA 4KZCA 1D6EC 1XEEA 4KV2A 1GC7A 2L32A 4DK5A 4O1NA 2D3GA 5DPSA 1AW7A 2R2QA 4OVVA 4KVGB 1QQRA 2I1JA 3TUOA 1KJTA 4II2B 4M8NA 5HG2A 1EU4A 4DXGA 1RAXA 2L0FA 4HJGE 4WJQA 2N4FA 5C3JB 5J17A 2JU6X 5CX3A 2L05A 2WXRA 3B2GA 2M4NA 3IVFA 1FRDA 3MHZA 5DPWA 2WNMA 3TIXA 3LB8C 4K3BA 2MH7A 2ACZB 3A1QB 2ASQA 1VR9A 2MLBA 5FR3A 3EA6A 4BVUC 2LGXA 1UGJA 2MX2A 1TGZB 1FNWA 1PUTA 4I6LB 2G45B 3Q3OC 1OEYJ 3RCZA 2QEJC 2W54A 1HTQA 2K1FA 1WM2A 1WRIA 3VH3B 4LDTD 5D7GA 3U8ZA 1L6VA 1RLFA 3LXFA 1N6ZA 2BYFA 4IM2A 1V5OA 3ZUNA 3NS1A 3ZNZB 2D3AA 3O13A 2KFKA 2PE6B 2OOBB 1QF6A 1T3QA 1H8CA 3UIOB 3PLVA 2LEKA 4WQMA 1LM8B 4EUTA 2H88B 2N0SB 3EUB2 4AJYB 1J7BA 3GZNI 3RNCC 2AL3A 4W9FA 2ZPNA 4MH0E 5H92C 5G5GA 4AJWA 2KDBA 2YVCA 4RFBA 4J6IA 3PT2B 5JXVA 2K0PA 1F0ZA 1L5PA 2OJRA 2NPTB 4ZYSA 3PVLA 1T0RC 3RZWC 4H2AA 2N7EA 2NTSA 4FJZA 3S2AA 1H4RA 2GOWA 3NVYA 2BVCA 1F52A 1M94A 2DYBA 4OZBA 2FAZA 3SD5A 4MELA 2EKEC 2M19A 2DWQA 2M56B 1VZ7A 2J4XA 3A4SC 2RSUA 2BB5A 2W9NA 2C7MB 3TL5A 3DHGC 4KX6B 3AU5A 1L0XB 4W9DA 3L10B 4WWOA 1I35A 2OJWA 4NQKE 3P4RB 2CHZA 1EWCA 2ZW1A 4LTUA 1BUIC 3CIRB 1YIWA 2KTRB 2Y5BB 4BOZB 1JALA 1JWAD 2MJ3A 1FFUA 2XBBC 5C1ZA 2IGDA 2KX3A 2GBKA 3T3OA 1FIQA 1ZXHA 3EFUA 2GI9A 4A3OA 5D3DA 3AE4B 3ZIMA 3AEAB 1WE7A 1VRAB 4HDOA 1YX6B 2MBOA 1OQYA 4RGNA 1R4MI 1KRHA 1JWSD 5BMGA 3AEBB 1I7HA 2AQ2B 2JXXA 4B95A 1YD8U 4GGQA 2DZJA 3TEZA 5HHDG 4US8A 4QAYA 2LGIA 4C7ZA 4FXCA 4BBNF 4TV3A 2BGFA 3VTWA 1WWTA 1TS2A 4ZHPA 3P42A 2KWUB 1YJ1A 4HKQA 3SHQA 4N58A 1WXMA 3L4PA 4YTPB 3MHSD 2L1AA 5D94A 2NBWB 2DAJA 2WX1A 4GMVA 2BS3B 3KYCD 3VRBB 3DVNU 4IG7B 3OAWA 1F2RI 3GOEA 1SJED 4HEA1 4DXFA 3PLUA 2FBWB 2UU7A 4MT5A 2MP2B 1UF0A 1YMHE 3DVGY 3N3KB 3H7PB 2WWZA 1IBXB 1E7PB 3R66C
chains in the Genus database with same CATH topology
4F1SA 4GDKB 1WR6E 3ALBA 4A3PA 1V2YA 2D10A 2N1WA 4IM3A 5CTRC 5FR6A 2KQ7A 3ONSA 1GG3A 4ZRKA 3AXCA 1V9JA 4LDTB 5AZFA 2IY0B 2CHXA 2WDTB 1WGDA 1WMHB 2LXCA 2O2VB 3PHWB 2KX0A 5LXIB 2L00B 1WXAA 2FNJB 2ZCCA 3ZNGC 2EMSA 4F7ZA 2C60A 4PS3A 3P2BA 1LFDA 4DXAB 2Z0DB 1WGYA 3ZVVA 3JSVB 4IWPA 2KWCA 4TUUA 1EF5A 2KLGA 2MBEA 1QZEA 3ZDTA 1WFYA 2PJHA 1WIAA 1V6EA 3SDLC 1L7YA 4II3B 3VXWA 5J18A 2DYOA 4WWPA 2MA9B 3NZSA 2CS4A 2XEWA 4MGYE 1ZGUB 2FCMA 1P0RA 4ICUA 1WXVA 3MTNB 3VHTC 1WRDB 1V5TA 3HM3A 3PPAA 5CHVC 1KM7A 1X1MA 4W9EA 1I42A 4IM0A 2KLCA 4W9JA 3PS6A 1WX8A 4MDKE 2EMTA 4NJ7A 3VVWB 4TQ0A 3OJ3A 4DHZE 1F9JA 3NS8A 2JZ3B 1YX5B 2IO0B 3JW0X 5KHQA 4KDIC 5L83A 2MW5A 4EZLA 2L76A 3A9JA 4JQWC 1HE8A 4FLHA 2LJ5A 1YQBA 3DVNV 3ECIA 4KIKA 4RM9A 5JZEB 2JT4B 4MSQB 1GJZA 2G4SA 1E5WA 4A20A 1WE6A 1WX9A 2V3SA 3EECA 2YLMA 2MBHA 4HCPB 4BKGA 5GMVA 5E6OA 3KUCB 4G3XB 5JHAA 1GUAB 2KJRA 2J0JA 4W9LA 3ZNHB 2HD5B 2N9EB 1EF1A 3DBSA 4MJSB 3ML8A 1J0GA 4GDLA 4GU2A 4GB9A 1IPGA 4JLCA 5IA7A 1T0YA 2LVQA 3L54A 1V81A 3U30A 2GBJA 4HCNB 4WJNA 3IFWB 2J7QB 2G3QB 3QIJA 2KD0A 4B6WA 3WANA 4TQ1A 3V6EB 2DAFA 3ZRCA 2BYEA 3V62A 3VQIA 2NR2A 1E7VA 2M0XA 1ZW7A 4HK2A 5E6NA 1NI2A 3PRZA 5IAAC 3PSEB 4DHJB 5EDSA 4TKNA 4GOCA 3DBRI 2NBVB 3B0AA 2J0MA 2BWFA 4W9CA 4ANUA 4OVUA 3LDZE 1SE9A 3DDCB 4RM8A 2K6DB 4IC7B 3QX1A 3DOWA 1S3SG 4P7IA 2NCNA 2KTRA 4YL8A 3PGEA 2KC1A 2B3AA 2NVUI 1UZXB 2WYQA 2IYDB 4GSWA 3HIZA 1CMXB 3A1QA 2L3ZA 5CHFA 5BO4B 5C23A 3DPDA 1P3QU 2GBMA 2N7DA 4KZ0A 2BPSA 2AEHA 2C7HA 1S1QB 2MSED 2IO1B 2K8HA 3X0WA 3K9PB 1Q1OA 2FCQA 1J19A 2DZMA 2CKHB 2LASA 2LGYA 2C9WB 2UWQA 2LZ6A 3RT3B 1XT9B 2A5UA 3N30A 3U7DA 2D07B 4NJ6A 4NNJB 3ENEA 2J0KA 1OEYA 4JGHB 4MM3A 4WQOB 2PPHA 3APFA 2CU1A 4HPMB 3QA8A 1KLVA 4EZKA 3CF6E 4DDID 1WY8A 1AARA 3A9JB 4K7WA 3L13A 3ZLZA 2LVPA 5AZGA 3ZO5B 2QHOA 2NS5A 3NY5A 3QWZB 4HPLB 2AYOB 4IW0A 4KSLC 1WI0A 3DBLI 2KO3A 4HWIB 4KIKB 4HLEA 4G0NB 4AWJA 4GN1A 3B08A 1WGRA 5DPTA 2AWTA 4GXBA 4NAWA 3VUXA 3ZTCA 1WGHA 4MGKE 2K8CA 3IG3A 2IY1B 3QQ8B 3LJ3A 4IWQA 4FADA 2MWSB 4M0WB 4GIVA 3C0RB 3CSTA 1C3TA 4KZCA 4FA6A 2KVRA 4HJKA 1TBEA 4GDLB 3QCAA 1J8CA 2JY6A 4G11A 4NQLB 1E7UA 1P9DU 1GC7A 4KV2A 5D2MB 3N32A 5DPRA 2KNBA 4XZ4A 4ANWA 4DK5A 3KYDD 2D3GA 5DPSA 3TJPA 2I1KA 2R2QA 4OVVA 3QC8B 3L17A 4KVGB 1BT0A 2I1JA 3VAWA 4MGZE 1KJTA 4II2B 4M8NA 5JHBA 1UGMA 2KDEB 2KMAA 3WAPA 2JF5A 1UD7A 2XK5A 4HXDA 3QHTA 4W9HA 1RAXA 2C5LC 3DQVA 2A4ZA 4WJPA 3A4RA 2L0FA 3L0WB 4WJQA 2N4FA 3MJWA 5J17A 3NOBA 5CHWA 3WALA 2IO3B 5CX3A 2L05A 3WAOA 4W9IA 1WX7A 2DZIA 2DYMA 3VUWA 2M1MA 4WWNA 2M4NA 3IVFA 3A9KA 1WYWB 5DPWA 1D3ZA 2KHWB 3AULA 2K39A 2KKCA 2NPTA 2UYZB 3H1UA 3TIXA 2KMCA 1XQQA 1TTNA 3R3MA 3VFKA 2ZNVB 3A1QB 2JZZA 2ASQA 4DWFA 3TCAA 1WJ4A 2MLBA 1PQSA 3OJ4B 4URKA 4JIOU 2JVCA 4DDGD 3L16A 1TZ1A 4G50A 4BVUC 4LJOB 2LGXA 2M17A 1MG8A 2ZVOA 2GMIC 4K1RB 2MX2A 4ANVA 3X23A 1OTRB 1E8YA 1TGZB 4IWOA 2LXAA 3O65B 4CHKA 3B1LX 1WF9A 4HVBA 4I6LB 2G45B 2KFJA 2RPQA 2O6VA 2VRRB 1OEYJ 3D32A 3RCZA 3VUYA 3JYUA 3IBEA 2WX0A 2GBRA 1A5RA 1Z5SB 1E8WA 2O6VD 2K1FA 4BBNC 4FHJA 3L08A 2LD9A 4FHKA 3UQAA 1WM2A 4W9GA 4E71A 2PE9A 3Q3JA 3VH3B 3VH4B 4LDTD 3AU4A 5D7GA 4F8CB 5HKHA 4I6NB 5AZHA 3U8ZA 1OGWA 3K9OB 2JUOA 1RLFA 2LVOA 3M63B 4NY0A 2BYFA 2MCNB 5LLIA 4NAWB 4IM2A 1V5OA 2JRIB 3ZUNA 3ZNZB 2BKRB 3KH0A 3KUZA 2BWES 3ZRFA 4FN2A 3NHEB 3PTFC 2KFKA 2PE6B 2OOBB 3I3TB 4WAAA 1H8CA 3UQBA 3UIOB 2BYVE 2GBNA 1WJNA 3PLVA 3DVGX 3QJZA 3W1SC 4MEMA 1LM8B 2MRPA 4E3CA 1WJUA 4EUTA 3M95A 2R2OA 4ZRJA 3ZDMC 4CO7A 2JRHA 2KZRA 3HK0A 4IUMB 1WM3A 3HHMA 3PV1A 3V60A 4AJYB 5D6JB 1UELA 3GZNI 3JVZX 2AL3A 2FIDA 4W9FA 3ZTDA 2XK5B 2ZPNA 4ZRIA 4MH0E 3HM6X 1C1YB 1UBIA 2LRUA 2KJHB 2K8BA 4AJWA 2KDBA 2YVCA 2G4DB 4J6IA 3RYTA 3PHXB 4FJVB 2N9PC 4LJPB 3APDA 3PT2B 3A9KB 3AI5A 3DCGA 3PRMB 1V49A 3PREA 2OJRA 4HDQA 2JWZA 2HE7A 2NPTB 4EEWA 3PVLA 2JPHA 4ANXA 3RZWC 4FULA 2N7EA 1UH6A 3CSFA 2KXJA 4FJZA 3S2AA 1H4RA 1WH3A 1WXSA 4AOFA 2GOWA 3EHVA 5L95C 2MBBB 4MJSA 1WJ6A 1WR1A 1M94A 2DYBA 3ZNID 4EOYA 2FAZA 3SD5A 2RGFA 4MELA 1WGGA 1Q0WB 2EKEC 1V80A 4BOSC 1WZ3A 3ML9A 3BY4B 1LQBA 2O6VB 3PZDA 3WIMA 2L0TA 4AP4C 4ZDVA 3A4SC 2RSUA 1Q5WB 2W9NA 1U4AA 2C7MB 1SIFA 3KVFB 4MGIE 3TL5A 3EC8A 4ZYNA 4ICVA 4DHJD 3M62B 1EUVB 1E8XA 3AU5A 4NPNA 1IYFA 2LUEA 4W9DA 3L10B 4WWOA 2KDFB 5G2NA 3RD2A 1I35A 2N1VA 1NBFC 4K7UA 5DCNA 4PYUA 4NQKE 5TR5A 2CHZA 1E90A 2V1YA 4JL9A 4FBJB 2REXA 2FCNA 2ZZPB 2DHZA 2KFKB 1V86A 3ZW3A 3RUIB 3QAQA 2CR5A 2DENB 1YIWA 2KTRB 2Y5BB 4XX5A 4BOZB 2LI5A 2LRWA 4EKUA 4PYZA 4DBGA 1SGHA 3V61A 2Z0EB 5KHOA 3RULA 2XBBC 3TMPB 5C1ZA 2KX3A 2GBKA 2MP2A 3NZUA 3VTVA 2MQJA 4W9KA 4EZJA 3EFUA 3H7PA 3H6NA 2KC2A 4A3OA 1L2NA 4RMAA 3RZFA 3ZIMA 2V4LA 2ZJDA 2KQSA 4BFRA 3V6CB 1P1AA 4GDKA 3UIPB 2KTFA 1WE7A 1P98A 2DZKA 4CYEA 4HDOA 3UINB 3WA0A 1YX6B 4K7SA 4BKSA 2KN5A 2MBOA 3KUDB 4X57B 1OQYA 2Z59B 1ISNA 1R4MI 1VCBA 4ASWC 5G55A 5J2RA 1FXTB 4BKSD 2KOXA 1WZ0A 3PRPB 1WMHA 2O2VA 4FJYA 2JXXA 3QK0A 4B95A 1YD8U 2FIFA 4PS8A 5AEKB 3IHPC 2LWPA 2DZJA 4GGQA 2KDIA 4AUQC 2M8SA 2ZVNA 2RR9A 3ZKJC 4I6PA 2C7NB 4K81A 4KDLB 3DBHI 3TBLD 3W1YA 2IO2B 2FUHB 2ZCBA 3JSVA 3QARA 5LXHA 4XC2A 3H9DA 1Z2MA 1E8ZA 4MSMB 4BBNF 4M8MA 4TV3A 1GNUA 2BGFA 5E6PA 3VTWA 3APCA 2K6QA 2N9XA 1VD2A 2HJ8A 1YJ1A 2IBIB 2KWUB 4KSKC 3R7QA 2LGDA 2NBUA 3T8MA 3SHQA 1K8RB 1WXMA 3R7RA 3MHSD 2KANA 1RFAA 4E74A 4N9F4 5D94A 2KJ6A 1G6JA 3M3JA 2MBQA 3UF8A 1KOTA 2IZVB 4EFOA 2NBWB 3UGBB 2D11A 3W1SA 2DAJA 5JH5C 3A33B 2K25A 2WX1A 3OLMD 3VDZA 4GMVA 3KYCD 2ZNVC 4PS7A 1Y8RC 3Q3FA 3CMMB 1LXDA 1RRBA 2HTHA 4LCDE 2PEAA 3DVNU 4IG7B 3OAWA 3WAMA 3GOEA 1ZKHA 3SU8X 1EO6A 1NDDA 2L8JA 4WJOA 4DHZB 3PLUA 2ZPYA 2ZEQA 4BKTA 1JRUA 2KWVB 2RD0A 3BINA 4B9KA 2AL6A 1GC6A 1XD3B 2D2QA 2MP2B 2BF8B 3VTUA 2FCSA 2DX5B 1R4NI 3DVGY 1UBQA 3KW5B 3N3KB 3H7PB 2L7RA 3H7SA 1IP9A 2WWZA 2CHWA 3T9LA 3R66C 2BKFA 2KK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1S A;  4GDK B;  1WR6 E;  3ALB A;  4A3P A;  1V2Y A;  2D10 A;  2N1W A;  4IM3 A;  5CTR C;  5FR6 A;  2KQ7 A;  3ONS A;  1GG3 A;  4ZRK A;  3AXC A;  1V9J A;  4LDT B;  5AZF A;  2IY0 B;  2CHX A;  2WDT B;  1WGD A;  1WMH B;  2LXC A;  2O2V B;  3PHW B;  2KX0 A;  5LXI B;  2L00 B;  1WXA A;  2FNJ B;  2ZCC A;  3ZNG C;  2EMS A;  4F7Z A;  2C60 A;  4PS3 A;  3P2B A;  1LFD A;  4DXA B;  2Z0D B;  1WGY A;  3ZVV A;  3JSV B;  4IWP A;  2KWC A;  4TUU A;  1EF5 A;  2KLG A;  2MBE A;  1QZE A;  3ZDT A;  1WFY A;  2PJH A;  1WIA A;  1V6E A;  3SDL C;  1L7Y A;  4II3 B;  3VXW A;  5J18 A;  2DYO A;  4WWP A;  2MA9 B;  3NZS A;  2CS4 A;  2XEW A;  4MGY E;  1ZGU B;  2FCM A;  1P0R A;  4ICU A;  1WXV A;  3MTN B;  3VHT C;  1WRD B;  1V5T A;  3HM3 A;  3PPA A;  5CHV C;  1KM7 A;  1X1M A;  4W9E A;  1I42 A;  4IM0 A;  2KLC A;  4W9J A;  3PS6 A;  1WX8 A;  4MDK E;  2EMT A;  4NJ7 A;  3VVW B;  4TQ0 A;  3OJ3 A;  4DHZ E;  1F9J A;  3NS8 A;  2JZ3 B;  1YX5 B;  2IO0 B;  3JW0 X;  5KHQ A;  4KDI C;  5L83 A;  2MW5 A;  4EZL A;  2L76 A;  3A9J A;  4JQW C;  1HE8 A;  4FLH A;  2LJ5 A;  1YQB A;  3DVN V;  3ECI A;  4KIK A;  4RM9 A;  5JZE B;  2JT4 B;  4MSQ B;  1GJZ A;  2G4S A;  1E5W A;  4A20 A;  1WE6 A;  1WX9 A;  2V3S A;  3EEC A;  2YLM A;  2MBH A;  4HCP B;  4BKG A;  5GMV A;  5E6O A;  3KUC B;  4G3X B;  5JHA A;  1GUA B;  2KJR A;  2J0J A;  4W9L A;  3ZNH B;  2HD5 B;  2N9E B;  1EF1 A;  3DBS A;  4MJS B;  3ML8 A;  1J0G A;  4GDL A;  4GU2 A;  4GB9 A;  1IPG A;  4JLC A;  5IA7 A;  1T0Y A;  2LVQ A;  3L54 A;  1V81 A;  3U30 A;  2GBJ A;  4HCN B;  4WJN A;  3IFW B;  2J7Q B;  2G3Q B;  3QIJ A;  2KD0 A;  4B6W A;  3WAN A;  4TQ1 A;  3V6E B;  2DAF A;  3ZRC A;  2BYE A;  3V62 A;  3VQI A;  2NR2 A;  1E7V A;  2M0X A;  1ZW7 A;  4HK2 A;  5E6N A;  1NI2 A;  3PRZ A;  5IAA C;  3PSE B;  4DHJ B;  5EDS A;  4TKN A;  4GOC A;  3DBR I;  2NBV B;  3B0A A;  2J0M A;  2BWF A;  4W9C A;  4ANU A;  4OVU A;  3LDZ E;  1SE9 A;  3DDC B;  4RM8 A;  2K6D B;  4IC7 B;  3QX1 A;  3DOW A;  1S3S G;  4P7I A;  2NCN A;  2KTR A;  4YL8 A;  3PGE A;  2KC1 A;  2B3A A;  2NVU I;  1UZX B;  2WYQ A;  2IYD B;  4GSW A;  3HIZ A;  1CMX B;  3A1Q A;  2L3Z A;  5CHF A;  5BO4 B;  5C23 A;  3DPD A;  1P3Q U;  2GBM A;  2N7D A;  4KZ0 A;  2BPS A;  2AEH A;  2C7H A;  1S1Q B;  2MSE D;  2IO1 B;  2K8H A;  3X0W A;  3K9P B;  1Q1O A;  2FCQ A;  1J19 A;  2DZM A;  2CKH B;  2LAS A;  2LGY A;  2C9W B;  2UWQ A;  2LZ6 A;  3RT3 B;  1XT9 B;  2A5U A;  3N30 A;  3U7D A;  2D07 B;  4NJ6 A;  4NNJ B;  3ENE A;  2J0K A;  1OEY A;  4JGH B;  4MM3 A;  4WQO B;  2PPH A;  3APF A;  2CU1 A;  4HPM B;  3QA8 A;  1KLV A;  4EZK A;  3CF6 E;  4DDI D;  1WY8 A;  1AAR A;  3A9J B;  4K7W A;  3L13 A;  3ZLZ A;  2LVP A;  5AZG A;  3ZO5 B;  2QHO A;  2NS5 A;  3NY5 A;  3QWZ B;  4HPL B;  2AYO B;  4IW0 A;  4KSL C;  1WI0 A;  3DBL I;  2KO3 A;  4HWI B;  4KIK B;  4HLE A;  4G0N B;  4AWJ A;  4GN1 A;  3B08 A;  1WGR A;  5DPT A;  2AWT A;  4GXB A;  4NAW A;  3VUX A;  3ZTC A;  1WGH A;  4MGK E;  2K8C A;  3IG3 A;  2IY1 B;  3QQ8 B;  3LJ3 A;  4IWQ A;  4FAD A;  2MWS B;  4M0W B;  4GIV A;  3C0R B;  3CST A;  1C3T A;  4KZC A;  4FA6 A;  2KVR A;  4HJK A;  1TBE A;  4GDL B;  3QCA A;  1J8C A;  2JY6 A;  4G11 A;  4NQL B;  1E7U A;  1P9D U;  1GC7 A;  4KV2 A;  5D2M B;  3N32 A;  5DPR A;  2KNB A;  4XZ4 A;  4ANW A;  4DK5 A;  3KYD D;  2D3G A;  5DPS A;  3TJP A;  2I1K A;  2R2Q A;  4OVV A;  3QC8 B;  3L17 A;  4KVG B;  1BT0 A;  2I1J A;  3VAW A;  4MGZ E;  1KJT A;  4II2 B;  4M8N A;  5JHB A;  1UGM A;  2KDE B;  2KMA A;  3WAP A;  2JF5 A;  1UD7 A;  2XK5 A;  4HXD A;  3QHT A;  4W9H A;  1RAX A;  2C5L C;  3DQV A;  2A4Z A;  4WJP A;  3A4R A;  2L0F A;  3L0W B;  4WJQ A;  2N4F A;  3MJW A;  5J17 A;  3NOB A;  5CHW A;  3WAL A;  2IO3 B;  5CX3 A;  2L05 A;  3WAO A;  4W9I A;  1WX7 A;  2DZI A;  2DYM A;  3VUW A;  2M1M A;  4WWN A;  2M4N A;  3IVF A;  3A9K A;  1WYW B;  5DPW A;  1D3Z A;  2KHW B;  3AUL A;  2K39 A;  2KKC A;  2NPT A;  2UYZ B;  3H1U A;  3TIX A;  2KMC A;  1XQQ A;  1TTN A;  3R3M A;  3VFK A;  2ZNV B;  3A1Q B;  2JZZ A;  2ASQ A;  4DWF A;  3TCA A;  1WJ4 A;  2MLB A;  1PQS A;  3OJ4 B;  4URK A;  4JIO U;  2JVC A;  4DDG D;  3L16 A;  1TZ1 A;  4G50 A;  4BVU C;  4LJO B;  2LGX A;  2M17 A;  1MG8 A;  2ZVO A;  2GMI C;  4K1R B;  2MX2 A;  4ANV A;  3X23 A;  1OTR B;  1E8Y A;  1TGZ B;  4IWO A;  2LXA A;  3O65 B;  4CHK A;  3B1L X;  1WF9 A;  4HVB A;  4I6L B;  2G45 B;  2KFJ A;  2RPQ A;  2O6V A;  2VRR B;  1OEY J;  3D32 A;  3RCZ A;  3VUY A;  3JYU A;  3IBE A;  2WX0 A;  2GBR A;  1A5R A;  1Z5S B;  1E8W A;  2O6V D;  2K1F A;  4BBN C;  4FHJ A;  3L08 A;  2LD9 A;  4FHK A;  3UQA A;  1WM2 A;  4W9G A;  4E71 A;  2PE9 A;  3Q3J A;  3VH3 B;  3VH4 B;  4LDT D;  3AU4 A;  5D7G A;  4F8C B;  5HKH A;  4I6N B;  5AZH A;  3U8Z A;  1OGW A;  3K9O B;  2JUO A;  1RLF A;  2LVO A;  3M63 B;  4NY0 A;  2BYF A;  2MCN B;  5LLI A;  4NAW B;  4IM2 A;  1V5O A;  2JRI B;  3ZUN A;  3ZNZ B;  2BKR B;  3KH0 A;  3KUZ A;  2BWE S;  3ZRF A;  4FN2 A;  3NHE B;  3PTF C;  2KFK A;  2PE6 B;  2OOB B;  3I3T B;  4WAA A;  1H8C A;  3UQB A;  3UIO B;  2BYV E;  2GBN A;  1WJN A;  3PLV A;  3DVG X;  3QJZ A;  3W1S C;  4MEM A;  1LM8 B;  2MRP A;  4E3C A;  1WJU A;  4EUT A;  3M95 A;  2R2O A;  4ZRJ A;  3ZDM C;  4CO7 A;  2JRH A;  2KZR A;  3HK0 A;  4IUM B;  1WM3 A;  3HHM A;  3PV1 A;  3V60 A;  4AJY B;  5D6J B;  1UEL A;  3GZN I;  3JVZ X;  2AL3 A;  2FID A;  4W9F A;  3ZTD A;  2XK5 B;  2ZPN A;  4ZRI A;  4MH0 E;  3HM6 X;  1C1Y B;  1UBI A;  2LRU A;  2KJH B;  2K8B A;  4AJW A;  2KDB A;  2YVC A;  2G4D B;  4J6I A;  3RYT A;  3PHX B;  4FJV B;  2N9P C;  4LJP B;  3APD A;  3PT2 B;  3A9K B;  3AI5 A;  3DCG A;  3PRM B;  1V49 A;  3PRE A;  2OJR A;  4HDQ A;  2JWZ A;  2HE7 A;  2NPT B;  4EEW A;  3PVL A;  2JPH A;  4ANX A;  3RZW C;  4FUL A;  2N7E A;  1UH6 A;  3CSF A;  2KXJ A;  4FJZ A;  3S2A A;  1H4R A;  1WH3 A;  1WXS A;  4AOF A;  2GOW A;  3EHV A;  5L95 C;  2MBB B;  4MJS A;  1WJ6 A;  1WR1 A;  1M94 A;  2DYB A;  3ZNI D;  4EOY A;  2FAZ A;  3SD5 A;  2RGF A;  4MEL A;  1WGG A;  1Q0W B;  2EKE C;  1V80 A;  4BOS C;  1WZ3 A;  3ML9 A;  3BY4 B;  1LQB A;  2O6V B;  3PZD A;  3WIM A;  2L0T A;  4AP4 C;  4ZDV A;  3A4S C;  2RSU A;  1Q5W B;  2W9N A;  1U4A A;  2C7M B;  1SIF A;  3KVF B;  4MGI E;  3TL5 A;  3EC8 A;  4ZYN A;  4ICV A;  4DHJ D;  3M62 B;  1EUV B;  1E8X A;  3AU5 A;  4NPN A;  1IYF A;  2LUE A;  4W9D A;  3L10 B;  4WWO A;  2KDF B;  5G2N A;  3RD2 A;  1I35 A;  2N1V A;  1NBF C;  4K7U A;  5DCN A;  4PYU A;  4NQK E;  5TR5 A;  2CHZ A;  1E90 A;  2V1Y A;  4JL9 A;  4FBJ B;  2REX A;  2FCN A;  2ZZP B;  2DHZ A;  2KFK B;  1V86 A;  3ZW3 A;  3RUI B;  3QAQ A;  2CR5 A;  2DEN B;  1YIW A;  2KTR B;  2Y5B B;  4XX5 A;  4BOZ B;  2LI5 A;  2LRW A;  4EKU A;  4PYZ A;  4DBG A;  1SGH A;  3V61 A;  2Z0E B;  5KHO A;  3RUL A;  2XBB C;  3TMP B;  5C1Z A;  2KX3 A;  2GBK A;  2MP2 A;  3NZU A;  3VTV A;  2MQJ A;  4W9K A;  4EZJ A;  3EFU A;  3H7P A;  3H6N A;  2KC2 A;  4A3O A;  1L2N A;  4RMA A;  3RZF A;  3ZIM A;  2V4L A;  2ZJD A;  2KQS A;  4BFR A;  3V6C B;  1P1A A;  4GDK A;  3UIP B;  2KTF A;  1WE7 A;  1P98 A;  2DZK A;  4CYE A;  4HDO A;  3UIN B;  3WA0 A;  1YX6 B;  4K7S A;  4BKS A;  2KN5 A;  2MBO A;  3KUD B;  4X57 B;  1OQY A;  2Z59 B;  1ISN A;  1R4M I;  1VCB A;  4ASW C;  5G55 A;  5J2R A;  1FXT B;  4BKS D;  2KOX A;  1WZ0 A;  3PRP B;  1WMH A;  2O2V A;  4FJY A;  2JXX A;  3QK0 A;  4B95 A;  1YD8 U;  2FIF A;  4PS8 A;  5AEK B;  3IHP C;  2LWP A;  2DZJ A;  4GGQ A;  2KDI A;  4AUQ C;  2M8S A;  2ZVN A;  2RR9 A;  3ZKJ C;  4I6P A;  2C7N B;  4K81 A;  4KDL B;  3DBH I;  3TBL D;  3W1Y A;  2IO2 B;  2FUH B;  2ZCB A;  3JSV A;  3QAR A;  5LXH A;  4XC2 A;  3H9D A;  1Z2M A;  1E8Z A;  4MSM B;  4BBN F;  4M8M A;  4TV3 A;  1GNU A;  2BGF A;  5E6P A;  3VTW A;  3APC A;  2K6Q A;  2N9X A;  1VD2 A;  2HJ8 A;  1YJ1 A;  2IBI B;  2KWU B;  4KSK C;  3R7Q A;  2LGD A;  2NBU A;  3T8M A;  3SHQ A;  1K8R B;  1WXM A;  3R7R A;  3MHS D;  2KAN A;  1RFA A;  4E74 A;  4N9F 4;  5D94 A;  2KJ6 A;  1G6J A;  3M3J A;  2MBQ A;  3UF8 A;  1KOT A;  2IZV B;  4EFO A;  2NBW B;  3UGB B;  2D11 A;  3W1S A;  2DAJ A;  5JH5 C;  3A33 B;  2K25 A;  2WX1 A;  3OLM D;  3VDZ A;  4GMV A;  3KYC D;  2ZNV C;  4PS7 A;  1Y8R C;  3Q3F A;  3CMM B;  1LXD A;  1RRB A;  2HTH A;  4LCD E;  2PEA A;  3DVN U;  4IG7 B;  3OAW A;  3WAM A;  3GOE A;  1ZKH A;  3SU8 X;  1EO6 A;  1NDD A;  2L8J A;  4WJO A;  4DHZ B;  3PLU A;  2ZPY A;  2ZEQ A;  4BKT A;  1JRU A;  2KWV B;  2RD0 A;  3BIN A;  4B9K A;  2AL6 A;  1GC6 A;  1XD3 B;  2D2Q A;  2MP2 B;  2BF8 B;  3VTU A;  2FCS A;  2DX5 B;  1R4N I;  3DVG Y;  1UBQ A;  3KW5 B;  3N3K B;  3H7P B;  2L7R A;  3H7S A;  1IP9 A;  2WWZ A;  2CHW A;  3T9L A;  3R66 C;  2BKF A;  2KK8 A; 
#chains in the Genus database with same CATH topology
 2QMT A;  1SBB B;  1NEN B;  2D10 A;  2N1W A;  3MFG A;  4IM3 A;  5FR6 A;  2BTE A;  1GG3 A;  1Q10 A;  5AZF A;  4LDT B;  2IY0 B;  2WDT B;  4HRS A;  4YWG G;  3PHW B;  2KX0 A;  3VR9 B;  2FNJ B;  2J52 A;  2K9X A;  2EMS A;  1TZO A;  4F7Z A;  4TUU A;  2PJH A;  5FKA C;  1WIA A;  4YSZ B;  1MFW A;  3GE8 C;  3Q8E A;  3SDL C;  1QOA A;  4II3 B;  5J18 A;  1K50 A;  2DYO A;  4MGY E;  2X38 A;  3VHT C;  1I42 A;  1KM7 A;  1K52 A;  4IM0 A;  4L1B A;  1T5X D;  3OJ3 A;  1XLN A;  4DHZ E;  2JSV X;  2AQ1 B;  2JZ3 B;  3JW0 X;  1N60 A;  2LMC A;  3V05 A;  2MW5 A;  2JQR B;  1ZDX A;  1AWD A;  2LJ5 A;  1F2R C;  1YQB A;  4BZA A;  1QLB B;  5JZE B;  2JT4 B;  3N1Z C;  3HUI A;  4A20 A;  1E5W A;  2HTM E;  3SEB A;  2MBH A;  3BVG A;  4HCP B;  1YN5 A;  1JQ4 A;  3Q69 A;  1QIL A;  2HD5 B;  1EF1 A;  1IPG A;  2LVQ A;  1YN3 A;  3L54 A;  4WWM A;  5EE1 A;  2SAK A;  4JX1 C;  2J7Q B;  2WXQ A;  3WAN A;  3V6E B;  3V62 A;  3VQI A;  5EDS A;  1L4D B;  3BK2 A;  2BWF A;  4S17 A;  4W9C A;  1GB4 A;  3ZJU A;  1SE9 A;  2QSD A;  4IC7 B;  3QX1 A;  3DOW A;  1S3S G;  4P7I A;  4XE0 A;  4RNA A;  2NVU I;  1UZX B;  1C76 A;  4GSW A;  1CMX B;  3A1Q A;  2L3Z A;  3DPD A;  2WXH A;  4NZL B;  5AUK A;  2N7D A;  4HKZ E;  2AEH A;  2C7H A;  1FMA D;  1QOB A;  1D5X C;  1EM7 A;  1Q1O A;  2FCQ A;  1J19 A;  2UWQ A;  3U7D A;  4ZRP A;  4MM3 A;  4JGH B;  1OEY A;  2PPH A;  3APF A;  2Y5C A;  4N59 A;  4DDI D;  3ZLZ A;  2L52 A;  2NS5 A;  3QWZ B;  4HPL B;  4IW0 A;  1I4R A;  4JPS A;  1KH0 A;  3AB5 A;  1P7E A;  4G0N B;  3B08 A;  5DPT A;  3U2S C;  3VR8 B;  1FRR A;  3AMZ A;  2BT6 A;  3QQ8 B;  3AN1 A;  3LJ3 A;  1ZP0 B;  2WXL A;  3Q8F A;  4FAD A;  1TBE A;  3E9S A;  4G11 A;  5D2M B;  5IN7 A;  5DPR A;  1XLQ A;  4XZ4 A;  1E9M A;  3KYD D;  2LFI A;  2I1K A;  3QC8 B;  4MGZ E;  1V1O A;  2JF5 A;  3DQV A;  4PT5 A;  2A4Z A;  3L0W B;  2V0G A;  3NOB A;  5CHW A;  3WAL A;  4M02 A;  3WAO A;  1N61 A;  2IGH A;  2DZI A;  4RCO A;  2JXT A;  4UDU C;  2INP E;  3AE2 B;  2K39 A;  5IOI A;  1JW9 D;  2NPT A;  4YTM B;  1TTN A;  2ZNV B;  3C8Y A;  4DWF A;  4NAM A;  2MEK A;  1N5X A;  4M00 A;  3L16 A;  2WXN A;  1MG8 A;  2ZVO A;  2GMI C;  4ANV A;  3NVV A;  1OTR B;  4JWU C;  3O65 B;  3N20 C;  3RNE C;  3WAP A;  3VUY A;  2VRR B;  2VZK D;  2GBR A;  4LLG M;  1LGR A;  1A5R A;  4FHJ A;  3L08 A;  2KAJ A;  1TKE A;  4W9G A;  2PE9 A;  3VH4 B;  4I6N B;  3DWM A;  2W3S A;  3NZ3 A;  4NAW B;  3KH0 A;  3KUZ A;  2BWE S;  3ZYY X;  2GBN A;  2NTT A;  3QJZ A;  2QC8 A;  1V8C A;  1L0V B;  2LGS A;  2KZR A;  3HK0 A;  3V60 A;  5D6J B;  3BYY B;  3JVZ X;  4OVZ A;  5BMI A;  2E3T A;  3N1X C;  2XK5 B;  1FCL A;  2LRU A;  2CJO A;  2K8B A;  3AEC B;  1TKG A;  2KWD A;  3PHX B;  2N9P C;  4FJV B;  4LJP B;  3W2D A;  3DCG A;  1V49 A;  3PRE A;  2JWZ A;  3RNG C;  3AV8 A;  2I38 A;  3Q14 C;  4FUL A;  1YJJ A;  3EHV A;  2MBB B;  2RGF A;  1WGG A;  1N63 A;  2O6V B;  2E6X A;  3SR6 A;  4ZDV A;  1U4A A;  3W5U B;  4ICV A;  3RNF C;  1E8X A;  2RDB C;  2LUE A;  2RDG A;  4XDD A;  3RD2 A;  3DHI C;  2N1V A;  1NBF C;  4XWT A;  1OFF A;  1PGA A;  1E90 A;  1TS5 A;  3PZ7 A;  2REX A;  1I4X A;  2WLB A;  1V86 A;  1N62 A;  1GAQ B;  2CR5 A;  4EKU A;  4DBG A;  1SGH A;  2Z0E B;  2QCZ A;  3NUH B;  2I2Y A;  2MP2 A;  1ENF A;  3NZU A;  4OW0 A;  3IAM 1;  3H7P A;  1L2N A;  1IBX A;  4RMA A;  3RZF A;  2ZJD A;  4JWS C;  3UIP B;  2QIL A;  1P98 A;  3ZXR A;  1C77 A;  4K7S A;  4MM3 B;  3IT6 B;  2Z59 B;  1ISN A;  1F77 A;  3AH7 A;  2KOX A;  2IJ0 A;  1WZ0 A;  5AUI A;  3QK0 A;  2GB1 A;  3IHP C;  4WIP A;  4AUQ C;  2M8S A;  1JML A;  3ZKJ C;  4M0W A;  3TBL D;  1LO5 D;  1Z2M A;  1E8Z A;  4XDC A;  4M8M A;  1GNU A;  4C4V B;  3KLS X;  1ZPS A;  4OZC A;  2N9X A;  2HJ8 A;  3R7Q A;  2LGD A;  2MHJ A;  2NMQ A;  3C19 A;  1FPY A;  1ZUD 2;  4B0E A;  3Q8C A;  4N9F 4;  3U4E G;  2KJ6 A;  2PVG C;  3UF8 A;  1B1Z A;  1JCK B;  4ZOH C;  4EFO A;  3UGB B;  3W1S A;  1KLU D;  4PS7 A;  1SE3 A;  2L83 A;  1DGJ A;  1V97 A;  1HEZ E;  3DBR B;  1SE2 A;  4Q2J A;  2ZPY A;  2ZEQ A;  1JRU A;  2RD0 A;  3Q3M C;  1ET9 A;  1GC6 A;  5D3I B;  1MVK A;  3TEW A;  4ACF A;  2CHW A;  1NYQ A;  4A90 A;  2SEB D;  2BKF A;  4EEW A;  1XCQ L;  1DYQ A;  2VZK B;  1C9F A;  3GZN B;  1TKY A;  4ARI A;  5CTR C;  2KVZ A;  3ONS A;  4ZRK A;  2CHX A;  2WGS A;  2O2V B;  3Q2A C;  2L00 B;  2ZCC A;  3P63 A;  3ZNG C;  1LFD A;  1TS3 A;  2BS4 B;  1WGY A;  1YOV B;  1EF5 A;  2MBE A;  3DBL B;  1CK1 A;  1L7Y A;  1SJH D;  5BYQ A;  4WWP A;  1HZ6 A;  2CS4 A;  1ZGU B;  1P0R A;  1SE4 A;  1QT9 A;  2GLS A;  3P4P B;  1VZ6 A;  2K5P A;  1Y56 A;  4W9J A;  1WX8 A;  4MDK E;  4REZ A;  3P4S B;  1YX5 B;  2IO0 B;  5KHQ A;  5L83 A;  2L76 A;  3ECI A;  3DVN V;  3RPF C;  1KFY B;  1GJZ A;  2WXG A;  1WSP A;  5EE9 A;  4BKG A;  4NJC A;  1T0Q C;  4G3X B;  5JHA A;  2J0J A;  4W9L A;  2N9E B;  1NI3 A;  1J0G A;  1KLG D;  4GU2 A;  3PZ8 A;  4JLC A;  3OG5 A;  1PFD A;  3U30 A;  4WJN A;  4KKJ A;  2G3Q B;  3QIJ A;  1MJD A;  2KD0 A;  2FUG 1;  1QOF A;  3PRZ A;  5IAA C;  3B9J A;  4TKN A;  4GOC A;  5G5H A;  4ANU A;  3DDC B;  4RM8 A;  4XYC A;  1DOY A;  4RH6 A;  1ZXI A;  3EFC A;  5BO4 B;  2GBM A;  2BPS A;  2MSE D;  2Z8L A;  2K8H A;  1WXQ A;  2LGY A;  2CKH B;  1XT9 B;  2A5U A;  3ENE A;  3W9C B;  4WQO B;  2K3U A;  4EZK A;  3BK1 A;  1WY8 A;  1AAR A;  1ZDV A;  3A9J B;  4K7W A;  3L13 A;  3Q3N C;  5AZG A;  5HFY A;  4KSL C;  1WI0 A;  4AWJ A;  3TEX A;  4NAW A;  3ZTC A;  3AE7 B;  2IY1 B;  4B0M A;  4M0W B;  4GIV A;  3C0R B;  3CST A;  4FA6 A;  4HJK A;  3QCA A;  1P9D U;  5I4D A;  2KNB A;  1NVI D;  2KYW A;  2IPK D;  1UD7 A;  2XK5 A;  4HXD A;  1VDV A;  3QHT A;  4W9H A;  4YSY B;  4US9 A;  5H8Y E;  3P4Q B;  2HDE A;  3HRD D;  3RN9 C;  1WX7 A;  3VUW A;  2M1M A;  4WWN A;  1B9R A;  1WYW B;  1D3Z A;  2KHW B;  3AUL A;  3H1U A;  2KMC A;  1XQQ A;  3B2F A;  1C4A A;  2JZZ A;  4IOI E;  1MHH E;  3TCA A;  4HRO A;  1PGB A;  1PQS A;  3OJ4 B;  1RWS A;  4URK A;  4JIO U;  4DDG D;  4LJO B;  2D5G A;  3X23 A;  4LNN A;  1YJI A;  1E8Y A;  3BVZ A;  4IWO A;  3T3N A;  4CHK A;  3B1L X;  2WU5 B;  1WF9 A;  3FIL B;  2RPQ A;  2KFJ A;  4HVB A;  2O6V A;  3Q6B A;  3D32 A;  1E10 A;  3IBE A;  1Z5S B;  1E8W A;  3CWI A;  2O6V D;  4BBN C;  2VH2 A;  1JWM D;  3AED B;  4FHK A;  1FXA A;  1L0Y B;  3VRA B;  4E71 A;  3Q3J A;  4F8C B;  3AU4 A;  5HKH A;  2EEL A;  5AZH A;  3K9O B;  2LVO A;  5LLI A;  1FD6 A;  2JRI B;  2BKR B;  2DBY A;  1E0Z A;  4OHJ A;  3ZRF A;  4FN2 A;  3NHE B;  3UQB A;  1L6U A;  2BYV E;  1WJN A;  1T0S C;  3W1S C;  2MRP A;  4E3C A;  1WJU A;  3M95 A;  2R2O A;  4ZRJ A;  3ZDM C;  4CO7 A;  4IUM B;  3DBH B;  1WM3 A;  3HHM A;  1UEL A;  3MC9 A;  1TS4 A;  2KAC A;  3URY A;  4HPP A;  4LK0 M;  3ZTD A;  4ZRI A;  2V3P A;  1C1Y B;  1UBI A;  3NRZ A;  2WXM A;  3RYT A;  3APD A;  1NEK B;  3V3X A;  3A9K B;  3AI5 A;  3PRM B;  4USA A;  2JPH A;  4ANX A;  2W55 A;  3CSF A;  4AOF A;  4MJS A;  1WR1 A;  3EGR A;  3ZNI D;  2RMM A;  4C4V A;  4BOS C;  4RGO S;  3BY4 B;  1LQB A;  3PZD A;  1GPX A;  1Q5W B;  4MGI E;  3EC8 A;  1R4N B;  2ON8 A;  4DHJ D;  2CJN A;  1IYF A;  4WH4 A;  3BVM A;  1TY2 A;  2KDF B;  5DCN A;  5TR5 A;  2M0A A;  2V1Y A;  4JL9 A;  2FCN A;  2H89 B;  5MPO A;  2WXF A;  3RUI B;  2DEN B;  2LI5 A;  2LRW A;  4PYZ A;  2WP9 B;  1XXG A;  4C7Y A;  3RUL A;  1FFV A;  3DWG C;  3VTV A;  2MQJ A;  1JRO A;  4W9K A;  2KC2 A;  2RPV A;  2WDQ B;  2V4L A;  1V1P A;  2X8X X;  3V6C B;  1P1A A;  2KTF A;  1IGC A;  3UIN B;  3WA0 A;  1YNT E;  4BKS A;  2KN5 A;  5BMH A;  3KUD B;  4X57 B;  1OQQ A;  3GS2 A;  4RF1 A;  1VCB A;  4RGT A;  5G55 A;  5J2R A;  4BKS D;  4ITK A;  2O2V A;  2N9K A;  5AEK B;  2FIF A;  2LWP A;  3IT4 B;  2ZVN A;  3W1Y A;  4KDL B;  1AN8 A;  4D2K A;  2ZCB A;  5IO9 A;  2JX5 A;  3DHH C;  1TT5 B;  5E6P A;  3APC A;  2K6Q A;  1BML C;  2PW9 A;  1VD2 A;  4C80 A;  2IBI B;  4KSK C;  2NBU A;  1NYR A;  3P1M A;  1K8R B;  1HTO A;  4JE3 B;  1QOG A;  2KAN A;  3M3J A;  2MBQ A;  4DQO C;  1XCT L;  3VDZ A;  2ZNV C;  1Y8R C;  1LXD A;  4J3O D;  1RRB A;  3AEE B;  1JRP A;  3WAM A;  1ZKH A;  1EO6 A;  1NDD A;  4M01 A;  2KWV B;  2WQY B;  1ZOY B;  3BIN A;  2AL6 A;  1L4Z B;  1UWX A;  2FCS A;  3HVD A;  3RNB C;  3I9V 1;  1VZ8 A;  2L7R A;  2INN E;  4F1S A;  4GDK B;  1I4H A;  3ALB A;  4A3P A;  1SF0 A;  1D5Z C;  1MI0 A;  2IND C;  3AXC A;  2TSS A;  1IUE A;  1WMH B;  2LXC A;  5LXI B;  2WHI A;  1WXA A;  2JYE A;  5HI1 A;  1DOI A;  2C60 A;  1D5M C;  2LHE A;  2OHF A;  4PS3 A;  3P2B A;  3AE5 B;  4DXA B;  3ZVV A;  5GXG B;  3JSV B;  4IWP A;  3RNA C;  2KLG A;  5TSS A;  1QZE A;  4WAF A;  1WFY A;  4BAX A;  3NZS A;  1FNU A;  2FCM A;  1WXV A;  3MTN B;  1WRD B;  1V5T A;  3HM3 A;  3PPA A;  5CHV C;  1X1M A;  3I57 A;  3ZJT A;  2INC C;  4NJ7 A;  4TQ0 A;  2BQQ A;  1F9J A;  3NS8 A;  1FNV A;  2QIE B;  2N7J A;  3FC4 A;  4KDI C;  4EZL A;  3A9J A;  3Q8A A;  4AQ7 A;  4A6Q A;  4JQW C;  3N9Y C;  4FLH A;  5IP4 D;  4RM9 A;  4MSQ B;  1YQ3 B;  3EEC A;  1WX9 A;  2YLM A;  1C78 A;  2V9H A;  4A55 A;  5E6O A;  1C4P A;  3LYY A;  4MJS B;  3ML8 A;  3Q8B A;  5IA7 A;  2D3C A;  1V81 A;  4HCN B;  1D4B A;  3IFW B;  1MPE A;  4TQ1 A;  3ZRC A;  2BYE A;  1E7V A;  2M0X A;  3BZD B;  1ZW7 A;  3NVW A;  4HK2 A;  5E6N A;  4KGS A;  4DHJ B;  3DBR I;  1ZE3 D;  2J0M A;  3ETR A;  3MC8 A;  1HXY D;  3LDZ E;  1I4G A;  4GLS C;  1JWB D;  3GP7 A;  1CZP A;  2KC1 A;  4YXD B;  3AE8 B;  3ZXV A;  1P3Q U;  4KZ0 A;  1TJE A;  1A70 A;  3TEY A;  3HVZ A;  1F1H A;  3X0W A;  3K9P B;  1SIJ A;  2PVO D;  2LAS A;  3SFE B;  2XN9 C;  3RT3 B;  1IGD A;  2D07 B;  3FIL A;  4NNJ B;  2J0K A;  1V1P B;  2CU1 A;  2FE8 A;  3QA8 A;  1UWM A;  1KLV A;  4KKI A;  2BW2 A;  3RFZ B;  2WXI A;  1PDX A;  2AYO B;  5C2T B;  3DBL I;  4HWI B;  4KIK B;  2XNA C;  1WGR A;  2AWT A;  4GXB A;  4A8X C;  4K3C A;  1WGH A;  4MGK E;  2K8C A;  3IG3 A;  3KQ4 A;  1TY0 A;  2MWS B;  1C3T A;  1P7F A;  3MP9 A;  1QKZ A;  2KVR A;  4GDL B;  1J8C A;  2JY6 A;  4NQL B;  1E7U A;  3N32 A;  4ANW A;  3TJP A;  1MHX A;  3U7Z A;  4YTN B;  3L17 A;  3BYT B;  1BT0 A;  1FM0 D;  3VAW A;  2LHD A;  3H8H A;  1MG4 A;  5JHB A;  1UGM A;  2KDE B;  2KMA A;  2C5L C;  4WJP A;  3A4R A;  4KGT A;  3MJW A;  4S0R A;  2IO3 B;  5EE3 A;  4W9I A;  2DYM A;  4MH8 A;  1ESF A;  3A9K A;  1CJE A;  2KKC A;  2UYZ B;  1VJK A;  4ZHO A;  3ABV B;  3AE6 B;  3R3M A;  3VFK A;  2Q5W D;  4TMA B;  1WJ4 A;  4ARC A;  3R2I A;  2JVC A;  1HQR D;  1TZ1 A;  4G50 A;  3UI3 A;  2PMV A;  2M17 A;  4K1R B;  3OWE B;  1AYF A;  2LXA A;  3RI7 C;  3I63 C;  4N6E B;  1SXT A;  2MJD A;  1DOX A;  2R61 A;  4L23 A;  1BXT A;  3AM9 A;  3JYU A;  1XLP A;  2WX0 A;  5EE0 A;  4L2Y A;  1FEH A;  3N1Y C;  2LD9 A;  3UQA A;  2WXP A;  1HZ5 A;  1OGW A;  2JUO A;  4YT0 B;  3M63 B;  4NY0 A;  2MCN B;  2KN4 A;  1CQV A;  1R4M B;  4XWW A;  3PTF C;  3I3T B;  4WAA A;  2OED A;  2J53 A;  3DVG X;  4MEM A;  1STE A;  2ONQ A;  4IDI A;  2JRH A;  3FKY A;  3PV1 A;  1YQ4 B;  4AS1 A;  2FID A;  1UNS A;  4MAC A;  3HM6 X;  2JYT A;  2KJH B;  4RF0 A;  2EKI A;  1K53 A;  2V4I B;  2G4D B;  4HDQ A;  2HE7 A;  2WXO A;  3W5V B;  4EE2 A;  1UH6 A;  1WYG A;  2KXJ A;  1WXS A;  1WH3 A;  5L95 C;  1WJ6 A;  1XO3 A;  4EOY A;  1GB1 A;  2V3N A;  1Q0W B;  1V80 A;  4XGA B;  1WZ3 A;  3ML9 A;  4AP4 C;  3WIM A;  2Y5P A;  2L0T A;  4YSX B;  1EWY C;  3KVF B;  1SIF A;  2JWU A;  2W82 A;  4ZYN A;  2CU3 A;  2AQ3 B;  5T8I A;  5FK9 C;  3M62 B;  1EUV B;  4NPN A;  1RM6 C;  3ZQ4 A;  2D3B A;  1E6E B;  5G2N A;  4K7U A;  3WCQ A;  4PYU A;  2MJE A;  4FBJ B;  2ZW0 A;  2WXK A;  2ZZP B;  2N9L A;  2DHZ A;  2KFK B;  3ZW3 A;  2Y3A A;  1UUP A;  3QAQ A;  2WDV B;  4XX5 A;  3V61 A;  3AE1 B;  5KHO A;  4P1C C;  3TMP B;  4EZJ A;  3H6N A;  1ROE A;  1I4Q A;  2KQS A;  4LNF A;  4BFR A;  4GDK A;  2DZK A;  4CYE A;  2DNF A;  3AE3 B;  4ASW C;  1FXT B;  1R7S A;  4A9A A;  1SSN A;  1WGK A;  1WMH A;  2ICI A;  1N5W A;  4FJY A;  4PS8 A;  2KDI A;  2W3R A;  2RR9 A;  4I6P A;  2C7N B;  4K81 A;  3DBH I;  3SFD B;  4LNI A;  2IO2 B;  2FUH B;  2BBC A;  3JSV A;  2HJ1 A;  3QAR A;  5LXH A;  4XC2 A;  3H9D A;  4MSM B;  2LUM A;  3RMK C;  2PIA A;  2GRI A;  3T8M A;  1RYJ A;  1XF5 L;  3R7R A;  1RFA A;  4E74 A;  3U52 E;  3AE9 B;  1G6J A;  1KOT A;  2IZV B;  2D11 A;  5JH5 C;  1J7C A;  3A33 B;  2K25 A;  3OLM D;  3E56 A;  1ET6 A;  2WXJ A;  4ZRQ A;  3Q3F A;  3CMM B;  1I4P A;  2HTH A;  1FCC C;  2PEA A;  1T6B X;  4LCD E;  2J42 A;  3SU8 X;  1YN4 A;  3MC0 B;  5BYS A;  2L8J A;  4WJO A;  4DHZ B;  3R8B A;  4R3D A;  2RDH A;  1PYW D;  3FAH A;  4BKT A;  4P1B C;  2AX5 A;  1GOZ A;  4B9K A;  1XD3 B;  2D2Q A;  2WU2 B;  2BF8 B;  3VTU A;  2DX5 B;  1R4N I;  1UBQ A;  3KW5 B;  1IP9 A;  3H7S A;  1KTK A;  2YEP F;  1FXI A;  3T9L A;  4B6W A;  3PRP B;  2KK8 A;  1WR6 E;  4KGR A;  1HA5 A;  3NJT A;  1V2Y A;  2LJI A;  4LNK A;  2KQ7 A;  1V9J A;  3IAS 1;  3MJ5 A;  1TIF A;  1WGD A;  5E6J A;  4PK1 A;  1TYG B;  2QJL A;  2Z0D B;  3J9C A;  2IDY A;  2KWC A;  3ZDT A;  1V6E A;  3AEF B;  3VXW A;  2MA9 B;  2VH1 A;  1C79 A;  2XEW A;  3R2T A;  4IKG A;  4ICU A;  4OZA A;  4P6V F;  1SEB D;  5BYR A;  2KDM A;  4W9E A;  3AEG B;  2KLC A;  3PS6 A;  3NG0 A;  2EMT A;  3VVW B;  4LNO A;  2WS3 B;  3BWU D;  1HE8 A;  1VLB A;  1RFK A;  1ACC A;  4KIK A;  1EU3 A;  3KWV A;  3NVZ A;  4P16 A;  2G4S A;  1WE6 A;  2V3S A;  1KF6 B;  5GMV A;  2YEP B;  3KUC B;  1GUA B;  2KJR A;  3ZNH B;  3DBS A;  2QDF A;  4GDL A;  4GB9 A;  1T0Y A;  2GBJ A;  2PKO A;  2IGG A;  2DAF A;  2G1E A;  2NR2 A;  2KMM A;  2K22 A;  1NI2 A;  3PSE B;  1K51 A;  2JZP A;  1J7A A;  1M4V A;  2NBV B;  3B0A A;  3GB1 A;  2PLP A;  4OVU A;  1PGX A;  3BII D;  2K6D B;  3ZGZ A;  2NCN A;  4TSS A;  2KTR A;  2WDR B;  4YL8 A;  3PGE A;  1FO4 A;  2KQ4 X;  2B3A A;  1C4C A;  2BS2 B;  4CQN A;  2WYQ A;  2IYD B;  3HIZ A;  5CHF A;  5C23 A;  3TSS A;  3IXS A;  1S1Q B;  2IO1 B;  2DZM A;  1SB3 C;  5IKC M;  2C9W B;  2LZ6 A;  3N30 A;  1JWU D;  4NJ6 A;  4RGM A;  4WUR A;  4HPM B;  2G9H D;  3CF6 E;  1XLO A;  2BB6 A;  2LVP A;  3ZO5 B;  2B76 B;  2KT7 A;  2QHO A;  3NY5 A;  4C56 C;  3I5J C;  3GE3 C;  2KO3 A;  3PO0 A;  4C00 A;  4HLE A;  3KWL A;  4GN1 A;  2PTL A;  3VUX A;  2BYT A;  3ZJV A;  5LNK 1;  4IWQ A;  1OQR A;  2DLB A;  4KZC A;  1D6E C;  1XEE A;  4KV2 A;  1GC7 A;  2L32 A;  4DK5 A;  4O1N A;  2D3G A;  5DPS A;  1AW7 A;  2R2Q A;  4OVV A;  4KVG B;  1QQR A;  2I1J A;  3TUO A;  1KJT A;  4II2 B;  4M8N A;  5HG2 A;  1EU4 A;  4DXG A;  1RAX A;  2L0F A;  4HJG E;  4WJQ A;  2N4F A;  5C3J B;  5J17 A;  2JU6 X;  5CX3 A;  2L05 A;  2WXR A;  3B2G A;  2M4N A;  3IVF A;  1FRD A;  3MHZ A;  5DPW A;  2WNM A;  3TIX A;  3LB8 C;  4K3B A;  2MH7 A;  2ACZ B;  3A1Q B;  2ASQ A;  1VR9 A;  2MLB A;  5FR3 A;  3EA6 A;  4BVU C;  2LGX A;  1UGJ A;  2MX2 A;  1TGZ B;  1FNW A;  1PUT A;  4I6L B;  2G45 B;  3Q3O C;  1OEY J;  3RCZ A;  2QEJ C;  2W54 A;  1HTQ A;  2K1F A;  1WM2 A;  1WRI A;  3VH3 B;  4LDT D;  5D7G A;  3U8Z A;  1L6V A;  1RLF A;  3LXF A;  1N6Z A;  2BYF A;  4IM2 A;  1V5O A;  3ZUN A;  3NS1 A;  3ZNZ B;  2D3A A;  3O13 A;  2KFK A;  2PE6 B;  2OOB B;  1QF6 A;  1T3Q A;  1H8C A;  3UIO B;  3PLV A;  2LEK A;  4WQM A;  1LM8 B;  4EUT A;  2H88 B;  2N0S B;  3EUB 2;  4AJY B;  1J7B A;  3GZN I;  3RNC C;  2AL3 A;  4W9F A;  2ZPN A;  4MH0 E;  5H92 C;  5G5G A;  4AJW A;  2KDB A;  2YVC A;  4RFB A;  4J6I A;  3PT2 B;  5JXV A;  2K0P A;  1F0Z A;  1L5P A;  2OJR A;  2NPT B;  4ZYS A;  3PVL A;  1T0R C;  3RZW C;  4H2A A;  2N7E A;  2NTS A;  4FJZ A;  3S2A A;  1H4R A;  2GOW A;  3NVY A;  2BVC A;  1F52 A;  1M94 A;  2DYB A;  4OZB A;  2FAZ A;  3SD5 A;  4MEL A;  2EKE C;  2M19 A;  2DWQ A;  2M56 B;  1VZ7 A;  2J4X A;  3A4S C;  2RSU A;  2BB5 A;  2W9N A;  2C7M B;  3TL5 A;  3DHG C;  4KX6 B;  3AU5 A;  1L0X B;  4W9D A;  3L10 B;  4WWO A;  1I35 A;  2OJW A;  4NQK E;  3P4R B;  2CHZ A;  1EWC A;  2ZW1 A;  4LTU A;  1BUI C;  3CIR B;  1YIW A;  2KTR B;  2Y5B B;  4BOZ B;  1JAL A;  1JWA D;  2MJ3 A;  1FFU A;  2XBB C;  5C1Z A;  2IGD A;  2KX3 A;  2GBK A;  3T3O A;  1FIQ A;  1ZXH A;  3EFU A;  2GI9 A;  4A3O A;  5D3D A;  3AE4 B;  3ZIM A;  3AEA B;  1WE7 A;  1VRA B;  4HDO A;  1YX6 B;  2MBO A;  1OQY A;  4RGN A;  1R4M I;  1KRH A;  1JWS D;  5BMG A;  3AEB B;  1I7H A;  2AQ2 B;  2JXX A;  4B95 A;  1YD8 U;  4GGQ A;  2DZJ A;  3TEZ A;  5HHD G;  4US8 A;  4QAY A;  2LGI A;  4C7Z A;  4FXC A;  4BBN F;  4TV3 A;  2BGF A;  3VTW A;  1WWT A;  1TS2 A;  4ZHP A;  3P42 A;  2KWU B;  1YJ1 A;  4HKQ A;  3SHQ A;  4N58 A;  1WXM A;  3L4P A;  4YTP B;  3MHS D;  2L1A A;  5D94 A;  2NBW B;  2DAJ A;  2WX1 A;  4GMV A;  2BS3 B;  3KYC D;  3VRB B;  3DVN U;  4IG7 B;  3OAW A;  1F2R I;  3GOE A;  1SJE D;  4HEA 1;  4DXF A;  3PLU A;  2FBW B;  2UU7 A;  4MT5 A;  2MP2 B;  1UF0 A;  1YMH E;  3DVG Y;  3N3K B;  3H7P B;  2WWZ A;  1IBX B;  1E7P B;  3R66 C; 
#chains in the Genus database with same CATH homology
 4F1S A;  4GDK B;  1WR6 E;  3ALB A;  4A3P A;  1V2Y A;  2D10 A;  2N1W A;  4IM3 A;  5CTR C;  5FR6 A;  2KQ7 A;  3ONS A;  1GG3 A;  4ZRK A;  3AXC A;  1V9J A;  4LDT B;  5AZF A;  2IY0 B;  2CHX A;  2WDT B;  1WGD A;  1WMH B;  2LXC A;  2O2V B;  3PHW B;  2KX0 A;  5LXI B;  2L00 B;  1WXA A;  2FNJ B;  2ZCC A;  3ZNG C;  2EMS A;  4F7Z A;  2C60 A;  4PS3 A;  3P2B A;  1LFD A;  4DXA B;  2Z0D B;  1WGY A;  3ZVV A;  3JSV B;  4IWP A;  2KWC A;  4TUU A;  1EF5 A;  2KLG A;  2MBE A;  1QZE A;  3ZDT A;  1WFY A;  2PJH A;  1WIA A;  1V6E A;  3SDL C;  1L7Y A;  4II3 B;  3VXW A;  5J18 A;  2DYO A;  4WWP A;  2MA9 B;  3NZS A;  2CS4 A;  2XEW A;  4MGY E;  1ZGU B;  2FCM A;  1P0R A;  4ICU A;  1WXV A;  3MTN B;  3VHT C;  1WRD B;  1V5T A;  3HM3 A;  3PPA A;  5CHV C;  1KM7 A;  1X1M A;  4W9E A;  1I42 A;  4IM0 A;  2KLC A;  4W9J A;  3PS6 A;  1WX8 A;  4MDK E;  2EMT A;  4NJ7 A;  3VVW B;  4TQ0 A;  3OJ3 A;  4DHZ E;  1F9J A;  3NS8 A;  2JZ3 B;  1YX5 B;  2IO0 B;  3JW0 X;  5KHQ A;  4KDI C;  5L83 A;  2MW5 A;  4EZL A;  2L76 A;  3A9J A;  4JQW C;  1HE8 A;  4FLH A;  2LJ5 A;  1YQB A;  3DVN V;  3ECI A;  4KIK A;  4RM9 A;  5JZE B;  2JT4 B;  4MSQ B;  1GJZ A;  2G4S A;  1E5W A;  4A20 A;  1WE6 A;  1WX9 A;  2V3S A;  3EEC A;  2YLM A;  2MBH A;  4HCP B;  4BKG A;  5GMV A;  5E6O A;  3KUC B;  4G3X B;  5JHA A;  1GUA B;  2KJR A;  2J0J A;  4W9L A;  3ZNH B;  2HD5 B;  2N9E B;  1EF1 A;  3DBS A;  4MJS B;  3ML8 A;  1J0G A;  4GDL A;  4GU2 A;  4GB9 A;  1IPG A;  4JLC A;  5IA7 A;  1T0Y A;  2LVQ A;  3L54 A;  1V81 A;  3U30 A;  2GBJ A;  4HCN B;  4WJN A;  3IFW B;  2J7Q B;  2G3Q B;  3QIJ A;  2KD0 A;  4B6W A;  3WAN A;  4TQ1 A;  3V6E B;  2DAF A;  3ZRC A;  2BYE A;  3V62 A;  3VQI A;  2NR2 A;  1E7V A;  2M0X A;  1ZW7 A;  4HK2 A;  5E6N A;  1NI2 A;  3PRZ A;  5IAA C;  3PSE B;  4DHJ B;  5EDS A;  4TKN A;  4GOC A;  3DBR I;  2NBV B;  3B0A A;  2J0M A;  2BWF A;  4W9C A;  4ANU A;  4OVU A;  3LDZ E;  1SE9 A;  3DDC B;  4RM8 A;  2K6D B;  4IC7 B;  3QX1 A;  3DOW A;  1S3S G;  4P7I A;  2NCN A;  2KTR A;  4YL8 A;  3PGE A;  2KC1 A;  2B3A A;  2NVU I;  1UZX B;  2WYQ A;  2IYD B;  4GSW A;  3HIZ A;  1CMX B;  3A1Q A;  2L3Z A;  5CHF A;  5BO4 B;  5C23 A;  3DPD A;  1P3Q U;  2GBM A;  2N7D A;  4KZ0 A;  2BPS A;  2AEH A;  2C7H A;  1S1Q B;  2MSE D;  2IO1 B;  2K8H A;  3X0W A;  3K9P B;  1Q1O A;  2FCQ A;  1J19 A;  2DZM A;  2CKH B;  2LAS A;  2LGY A;  2C9W B;  2UWQ A;  2LZ6 A;  3RT3 B;  1XT9 B;  2A5U A;  3N30 A;  3U7D A;  2D07 B;  4NJ6 A;  4NNJ B;  3ENE A;  2J0K A;  1OEY A;  4JGH B;  4MM3 A;  4WQO B;  2PPH A;  3APF A;  2CU1 A;  4HPM B;  3QA8 A;  1KLV A;  4EZK A;  3CF6 E;  4DDI D;  1WY8 A;  1AAR A;  3A9J B;  4K7W A;  3L13 A;  3ZLZ A;  2LVP A;  5AZG A;  3ZO5 B;  2QHO A;  2NS5 A;  3NY5 A;  3QWZ B;  4HPL B;  2AYO B;  4IW0 A;  4KSL C;  1WI0 A;  3DBL I;  2KO3 A;  4HWI B;  4KIK B;  4HLE A;  4G0N B;  4AWJ A;  4GN1 A;  3B08 A;  1WGR A;  5DPT A;  2AWT A;  4GXB A;  4NAW A;  3VUX A;  3ZTC A;  1WGH A;  4MGK E;  2K8C A;  3IG3 A;  2IY1 B;  3QQ8 B;  3LJ3 A;  4IWQ A;  4FAD A;  2MWS B;  4M0W B;  4GIV A;  3C0R B;  3CST A;  1C3T A;  4KZC A;  4FA6 A;  2KVR A;  4HJK A;  1TBE A;  4GDL B;  3QCA A;  1J8C A;  2JY6 A;  4G11 A;  4NQL B;  1E7U A;  1P9D U;  1GC7 A;  4KV2 A;  5D2M B;  3N32 A;  5DPR A;  2KNB A;  4XZ4 A;  4ANW A;  4DK5 A;  3KYD D;  2D3G A;  5DPS A;  3TJP A;  2I1K A;  2R2Q A;  4OVV A;  3QC8 B;  3L17 A;  4KVG B;  1BT0 A;  2I1J A;  3VAW A;  4MGZ E;  1KJT A;  4II2 B;  4M8N A;  5JHB A;  1UGM A;  2KDE B;  2KMA A;  3WAP A;  2JF5 A;  1UD7 A;  2XK5 A;  4HXD A;  3QHT A;  4W9H A;  1RAX A;  2C5L C;  3DQV A;  2A4Z A;  4WJP A;  3A4R A;  2L0F A;  3L0W B;  4WJQ A;  2N4F A;  3MJW A;  5J17 A;  3NOB A;  5CHW A;  3WAL A;  2IO3 B;  5CX3 A;  2L05 A;  3WAO A;  4W9I A;  1WX7 A;  2DZI A;  2DYM A;  3VUW A;  2M1M A;  4WWN A;  2M4N A;  3IVF A;  3A9K A;  1WYW B;  5DPW A;  1D3Z A;  2KHW B;  3AUL A;  2K39 A;  2KKC A;  2NPT A;  2UYZ B;  3H1U A;  3TIX A;  2KMC A;  1XQQ A;  1TTN A;  3R3M A;  3VFK A;  2ZNV B;  3A1Q B;  2JZZ A;  2ASQ A;  4DWF A;  3TCA A;  1WJ4 A;  2MLB A;  1PQS A;  3OJ4 B;  4URK A;  4JIO U;  2JVC A;  4DDG D;  3L16 A;  1TZ1 A;  4G50 A;  4BVU C;  4LJO B;  2LGX A;  2M17 A;  1MG8 A;  2ZVO A;  2GMI C;  4K1R B;  2MX2 A;  4ANV A;  3X23 A;  1OTR B;  1E8Y A;  1TGZ B;  4IWO A;  2LXA A;  3O65 B;  4CHK A;  3B1L X;  1WF9 A;  4HVB A;  4I6L B;  2G45 B;  2KFJ A;  2RPQ A;  2O6V A;  2VRR B;  1OEY J;  3D32 A;  3RCZ A;  3VUY A;  3JYU A;  3IBE A;  2WX0 A;  2GBR A;  1A5R A;  1Z5S B;  1E8W A;  2O6V D;  2K1F A;  4BBN C;  4FHJ A;  3L08 A;  2LD9 A;  4FHK A;  3UQA A;  1WM2 A;  4W9G A;  4E71 A;  2PE9 A;  3Q3J A;  3VH3 B;  3VH4 B;  4LDT D;  3AU4 A;  5D7G A;  4F8C B;  5HKH A;  4I6N B;  5AZH A;  3U8Z A;  1OGW A;  3K9O B;  2JUO A;  1RLF A;  2LVO A;  3M63 B;  4NY0 A;  2BYF A;  2MCN B;  5LLI A;  4NAW B;  4IM2 A;  1V5O A;  2JRI B;  3ZUN A;  3ZNZ B;  2BKR B;  3KH0 A;  3KUZ A;  2BWE S;  3ZRF A;  4FN2 A;  3NHE B;  3PTF C;  2KFK A;  2PE6 B;  2OOB B;  3I3T B;  4WAA A;  1H8C A;  3UQB A;  3UIO B;  2BYV E;  2GBN A;  1WJN A;  3PLV A;  3DVG X;  3QJZ A;  3W1S C;  4MEM A;  1LM8 B;  2MRP A;  4E3C A;  1WJU A;  4EUT A;  3M95 A;  2R2O A;  4ZRJ A;  3ZDM C;  4CO7 A;  2JRH A;  2KZR A;  3HK0 A;  4IUM B;  1WM3 A;  3HHM A;  3PV1 A;  3V60 A;  4AJY B;  5D6J B;  1UEL A;  3GZN I;  3JVZ X;  2AL3 A;  2FID A;  4W9F A;  3ZTD A;  2XK5 B;  2ZPN A;  4ZRI A;  4MH0 E;  3HM6 X;  1C1Y B;  1UBI A;  2LRU A;  2KJH B;  2K8B A;  4AJW A;  2KDB A;  2YVC A;  2G4D B;  4J6I A;  3RYT A;  3PHX B;  4FJV B;  2N9P C;  4LJP B;  3APD A;  3PT2 B;  3A9K B;  3AI5 A;  3DCG A;  3PRM B;  1V49 A;  3PRE A;  2OJR A;  4HDQ A;  2JWZ A;  2HE7 A;  2NPT B;  4EEW A;  3PVL A;  2JPH A;  4ANX A;  3RZW C;  4FUL A;  2N7E A;  1UH6 A;  3CSF A;  2KXJ A;  4FJZ A;  3S2A A;  1H4R A;  1WH3 A;  1WXS A;  4AOF A;  2GOW A;  3EHV A;  5L95 C;  2MBB B;  4MJS A;  1WJ6 A;  1WR1 A;  1M94 A;  2DYB A;  3ZNI D;  4EOY A;  2FAZ A;  3SD5 A;  2RGF A;  4MEL A;  1WGG A;  1Q0W B;  2EKE C;  1V80 A;  4BOS C;  1WZ3 A;  3ML9 A;  3BY4 B;  1LQB A;  2O6V B;  3PZD A;  3WIM A;  2L0T A;  4AP4 C;  4ZDV A;  3A4S C;  2RSU A;  1Q5W B;  2W9N A;  1U4A A;  2C7M B;  1SIF A;  3KVF B;  4MGI E;  3TL5 A;  3EC8 A;  4ZYN A;  4ICV A;  4DHJ D;  3M62 B;  1EUV B;  1E8X A;  3AU5 A;  4NPN A;  1IYF A;  2LUE A;  4W9D A;  3L10 B;  4WWO A;  2KDF B;  5G2N A;  3RD2 A;  1I35 A;  2N1V A;  1NBF C;  4K7U A;  5DCN A;  4PYU A;  4NQK E;  5TR5 A;  2CHZ A;  1E90 A;  2V1Y A;  4JL9 A;  4FBJ B;  2REX A;  2FCN A;  2ZZP B;  2DHZ A;  2KFK B;  1V86 A;  3ZW3 A;  3RUI B;  3QAQ A;  2CR5 A;  2DEN B;  1YIW A;  2KTR B;  2Y5B B;  4XX5 A;  4BOZ B;  2LI5 A;  2LRW A;  4EKU A;  4PYZ A;  4DBG A;  1SGH A;  3V61 A;  2Z0E B;  5KHO A;  3RUL A;  2XBB C;  3TMP B;  5C1Z A;  2KX3 A;  2GBK A;  2MP2 A;  3NZU A;  3VTV A;  2MQJ A;  4W9K A;  4EZJ A;  3EFU A;  3H7P A;  3H6N A;  2KC2 A;  4A3O A;  1L2N A;  4RMA A;  3RZF A;  3ZIM A;  2V4L A;  2ZJD A;  2KQS A;  4BFR A;  3V6C B;  1P1A A;  4GDK A;  3UIP B;  2KTF A;  1WE7 A;  1P98 A;  2DZK A;  4CYE A;  4HDO A;  3UIN B;  3WA0 A;  1YX6 B;  4K7S A;  4BKS A;  2KN5 A;  2MBO A;  3KUD B;  4X57 B;  1OQY A;  2Z59 B;  1ISN A;  1R4M I;  1VCB A;  4ASW C;  5G55 A;  5J2R A;  1FXT B;  4BKS D;  2KOX A;  1WZ0 A;  3PRP B;  1WMH A;  2O2V A;  4FJY A;  2JXX A;  3QK0 A;  4B95 A;  1YD8 U;  2FIF A;  4PS8 A;  5AEK B;  3IHP C;  2LWP A;  2DZJ A;  4GGQ A;  2KDI A;  4AUQ C;  2M8S A;  2ZVN A;  2RR9 A;  3ZKJ C;  4I6P A;  2C7N B;  4K81 A;  4KDL B;  3DBH I;  3TBL D;  3W1Y A;  2IO2 B;  2FUH B;  2ZCB A;  3JSV A;  3QAR A;  5LXH A;  4XC2 A;  3H9D A;  1Z2M A;  1E8Z A;  4MSM B;  4BBN F;  4M8M A;  4TV3 A;  1GNU A;  2BGF A;  5E6P A;  3VTW A;  3APC A;  2K6Q A;  2N9X A;  1VD2 A;  2HJ8 A;  1YJ1 A;  2IBI B;  2KWU B;  4KSK C;  3R7Q A;  2LGD A;  2NBU A;  3T8M A;  3SHQ A;  1K8R B;  1WXM A;  3R7R A;  3MHS D;  2KAN A;  1RFA A;  4E74 A;  4N9F 4;  5D94 A;  2KJ6 A;  1G6J A;  3M3J A;  2MBQ A;  3UF8 A;  1KOT A;  2IZV B;  4EFO A;  2NBW B;  3UGB B;  2D11 A;  3W1S A;  2DAJ A;  5JH5 C;  3A33 B;  2K25 A;  2WX1 A;  3OLM D;  3VDZ A;  4GMV A;  3KYC D;  2ZNV C;  4PS7 A;  1Y8R C;  3Q3F A;  3CMM B;  1LXD A;  1RRB A;  2HTH A;  4LCD E;  2PEA A;  3DVN U;  4IG7 B;  3OAW A;  3WAM A;  3GOE A;  1ZKH A;  3SU8 X;  1EO6 A;  1NDD A;  2L8J A;  4WJO A;  4DHZ B;  3PLU A;  2ZPY A;  2ZEQ A;  4BKT A;  1JRU A;  2KWV B;  2RD0 A;  3BIN A;  4B9K A;  2AL6 A;  1GC6 A;  1XD3 B;  2D2Q A;  2MP2 B;  2BF8 B;  3VTU A;  2FCS A;  2DX5 B;  1R4N I;  3DVG Y;  1UBQ A;  3KW5 B;  3N3K B;  3H7P B;  2L7R A;  3H7S A;  1IP9 A;  2WWZ A;  2CHW A;  3T9L A;  3R66 C;  2BKF A;  2KK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...