5J18A

Solution structure of ras binding domain (rbd) of b-raf complexed with rigosertib (complex i)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j18A01
3O65B 4LDTD 3VUYA 4HXDA 3ZIMA 4JIOU 4CHKA 3NZUA 2UWQA 2KLCA 4MM3A 2O2VA 4MH0E 4G11A 4WQOB 4NQKE 2FCNA 1S1QB 3TIXA 1Z5SB 3M62B 4IC7B 1WM3A 3H7SA 1XD3B 5CX3A 2YLMA 3IFWB 3GZNI 2R2OA 1WMHB 2I1KA 2LRWA 3D32A 4ZRIA 4AWJA 3X23A 1P9DU 3EFUA 4A3OA 4TUUA 3P2BA 4HDQA 3TBLD 2M8SA 2PJHA 2HTHA 2KVRA 3ZO5B 2G4SA 5DPSA 4NY0A 2A5UA 2ZPNA 2L0FA 2EKEC 4AP4C 1UBQA 1EUVB 4X57B 2LGYA 1C3TA 4W9DA 2KN5A 4W9IA 3A1QB 4GDKA 4FADA 3RYTA 1WE7A 4IM3A 2MX2A 3JSVB 4KZ0A 3PREA 4FJZA 3WAOA 3ZRFA 1IPGA 1P0RA 3M95A 2IO2B 4RMAA 4FN2A 3PVLA 4BKTA 3ZNHB 1WM2A 4BVUC 4I6LB 3U30A 4OVVA 1WRDB 4TV3A 4WWOA 3JYUA 2UYZB 2HJ8A 2KX3A 3WAMA 2CKHB 3VTVA 4MELA 5TR5A 4BKGA 4K81A 2OOBB 5IAAC 3NS8A 1TZ1A 4EEWA 4FJVB 2KJHB 3V61A 2MBHA 1UZXB 3UGBB 3HM3A 2KOXA 3PPAA 4NJ7A 3W1SC 2WDTB 1P1AA 4TQ1A 2JY6A 2BYEA 3PRPB 1J8CA 4K7SA 2JWZA 4ANUA 2MP2A 4MSMB 2Y5BB 2N1WA 3IBEA 2FIDA 1U4AA 1WIAA 1WX8A 2LXAA 5AEKB 3R3MA 1TBEA 3DCGA 4GDLB 3VFKA 3VTWA 3ML8A 2NR2A 3KVFB 2O6VB 2XK5B 2G4DB 3ZTDA 2DX5B 2BPSA 3L17A 3APDA 2NBWB 1WE6A 1YX6B 4W9EA 4ZDVA 2N9EB 4DXAB 1OGWA 2AWTA 4M8NA 4BKSA 4FJYA 1KM7A 2EMSA 2IO3B 5EDSA 1ZW7A 2RD0A 5E6OA 4FBJB 4WJNA 4DHZB 3U7DA 1E8WA 1CMXB 3UQBA 5DPWA 2KQSA 4DBGA 4M0WB 2MW5A 3RZWC 1WGGA 1TTNA 4II3B 2BWFA 3QHTA 3B0AA 2KDIA 1IP9A 3A9KA 2DHZA 2LVPA 3KUDB 3TL5A 1V9JA 4FA6A 1YX5B 2O6VD 3PHWB 1R4NI 4W9FA 5D94A 1RRBA 3PS6A 1WMHA 4K7WA 3HK0A 1V49A 2FCMA 4GGQA 3SHQA 2KK8A 1WJ6A 2MBEA 4WJOA 4B95A 2LXCA 2ASQA 3APFA 1WGRA 3QQ8B 4DHJB 4EZLA 3VH3B 5GMVA 2DZJA 2NPTB 3AXCA 4ICUA 4P7IA 3ECIA 4GXBA 2C7HA 3A1QA 2DAJA 3JSVA 3QJZA 1ZGUB 2BYFA 2C7MB 2IY0B 2G45B 1WZ3A 3K9PB 1E7UA 2KWCA 2MBQA 5C23A 1H8CA 4II2B 3Q3JA 2K8HA 3QWZB 2K39A 4DWFA 1GNUA 1T0YA 4MGKE 2KTRB 2M4NA 2WYQA 4MGIE 3OJ4B 4W9CA 4E74A 2N9PC 2KMAA 3ML9A 5JZEB 2PPHA 2N7EA 2WWZA 2L0TA 1E7VA 2Z0EB 4GMVA 2MSED 4DHJD 4A20A 2FCSA 2GBRA 1WI0A 3KYCD 1E5WA 2FNJB 4BBNC 1Y8RC 3CSTA 1GJZA 3H6NA 5LXIB 5G2NA 3WA0A 4MJSB 3KUCB 2JVCA 3DBLI 1I35A 2JZ3B 5JHAA 5L83A 1E8YA 1YIWA 2ZNVB 3CSFA 4GB9A 1V2YA 4BBNF 2KNBA 2JRHA 1KOTA 2KJRA 3ZW3A 3H7PB 2I1JA 5J17A 2KFJA 3UINB 2L76A 2N9XA 2DZKA 1VCBA 2IYDB 4I6PA 4ZRJA 2K25A 4GSWA 2O6VA 2XK5A 3R7RA 4ASWC 1OTRB 3DVGY 3RZFA 1WF9A 2KHWB 1WYWB 2AL6A 4NAWB 1WXMA 2LUEA 2LGXA 3NZSA 3ZRCA 4EZKA 3DQVA 1BT0A 5JHBA 1OEYA 4GIVA 1WR6E 3ZUNA 3ZVVA 3A9JA 1EO6A 3SD5A 3SU8X 2CU1A 5LXHA 3L08A 2KDBA 2KC2A 1C1YB 2Z59B 3OJ3A 4KVGB 3DPDA 2L3ZA 3NHEB 4I6NB 2LVOA 2NBVB 4PS3A 2LRUA 4KIKA 2PEAA 3N3KB 2J0JA 3DBSA 4DDID 3PLUA 1E90A 1OEYJ 3IHPC 5D7GA 5AZFA 4EKUA 3C0RB 1ZKHA 4ZRKA 3N30A 1UH6A 1V6EA 4IWQA 2Z0DB 2L00B 3ONSA 2L8JA 3JW0X 2YVCA 4HCPB 5DCNA 1E8XA 2CS4A 1NI2A 2J0KA 2JF5A 4WJQA 3T9LA 2WX0A 4E71A 2OJRA 4AJWA 2ZVOA 2D2QA 1G6JA 2O2VB 5BO4B 3L13A 3L16A 2KQ7A 2NS5A 3PT2B 3DOWA 1FXTB 4J6IA 1LQBA 3N32A 1WZ0A 2L7RA 1GC6A 3ALBA 5FR6A 3S2AA 3U8ZA 3B1LX 4IUMB 3R7QA 1E8ZA 2ZJDA 2BF8B 2NPTA 4GU2A 1VD2A 1M94A 3WIMA 4TKNA 4IM2A 3ZKJC 5C1ZA 2KKCA 4MGYE 4HK2A 1RLFA 4F1SA 2KFKB 2KWUB 3DVGX 4BOSC 3OLMD 3RCZA 2LGDA 5AZGA 2BYVE 4MDKE 3KYDD 4KSLC 5AZHA 1P98A 1GUAB 5E6NA 4HCNB 2KTRA 4G3XB 2CHZA 3L54A 4GDKB 4FLHA 2C7NB 3CF6E 2RR9A 4GN1A 4WJPA 4AOFA 1F9JA 1H4RA 3BY4B 1AARA 4LJPB 3UQAA 2AYOB 5D6JB 1TGZB 2VRRB 4HJKA 4PYUA 2MWSB 1GG3A 3AULA 1YQBA 3EC8A 2CR5A 4G50A 2DYBA 4ICVA 2C9WB 3B08A 3DVNV 3DDCB 3JVZX 2GMIC 3ZDMC 3A4SC 3IVFA 3TMPB 4TQ0A 1QZEA 2M17A 1EF1A 2NVUI 4IM0A 1WFYA 1WY8A 3VAWA 2KC1A 3NOBA 3L10B 4A3PA 3QAQA 3VUXA 2REXA 1WXVA 4MGZE 1Q5WB 2CHWA 3IG3A 3EHVA 4BFRA 2K6QA 1P3QU 2D3GA 1YJ1A 4KZCA 3ZLZA 1V81A 2KLGA 3DBHI 1PQSA 2NBUA 4LDTB 4WAAA 2KZRA 4YL8A 3QX1A 3VHTC 4MEMA 4NAWA 3VVWB 3ZDTA 2BGFA 4XZ4A 3TJPA 1WJUA 2MP2B 4HPMB 1SGHA 1WR1A 2JRIB 3PV1A 4W9LA 3PRMB 3KW5B 4HVBA 2BKFA 1V5TA 3K9OB 1EF5A 1J0GA 3R66C 2J7QB 2JXXA 2LASA 4XX5A 4PS8A 3UIPB 3PHXB 1Z2MA 1WGDA 1WJ4A 2IO1B 4F7ZA 2MBOA 5JH5C 4FHKA 4W9JA 1YD8U 5J2RA 4B9KA 1WX9A 3W1YA 3LDZE 3HIZA 3QIJA 3Q3FA 4EFOA 3X0WA 3VQIA 2MRPA 3PZDA 3RUIB 5E6PA 1OQYA 2DZMA 2LI5A 2DAFA 4NQLB 1R4MI 1NDDA 5CHVC 3BINA 3PGEA 3UIOB 3PLVA 2PE9A 2B3AA 3AU5A 2GBMA 4AUQC 4DDGD 1UGMA 2A4ZA 1WX7A 2J0MA 2KTFA 2PE6B 3QA8A 2KMCA 4KDLB 3A9KB 4GDLA 4ANWA 2ZCBA 3H9DA 2IZVB 3WAPA 1L7YA 1V86A 3V62A 1WH3A 2FUHB 1J19A 3V6CB 4PS7A 2CHXA 1MG8A 3DVNU 5L95C 1LFDA 2EMTA 2LZ6A 4G0NB 2D10A 2XBBC 3PSEB 3RT3B 2KFKA 3ZTCA 1UD7A 4BKSD 2M0XA 1Q0WB 1WXSA 2G3QB 3A4RA 2JPHA 3KH0A 2KDEB 1D3ZA 2KDFB 2N4FA 1KJTA 1WXAA 2BWES 2RPQA 3APCA 4IG7B 1IYFA 1X1MA 2R2QA 5IA7A 3PRZA 2JUOA 4LCDE 2D07B 3LJ3A 3ZNZB 3DBRI 3VDZA 1WGHA 2K8CA 4K1RB 5KHOA 2IY1B 3OAWA 4EUTA 5J18A 1A5RA 2MQJA 1LM8B 4FHJA 4W9KA 2HD5B 1ISNA 1WGYA 2MLBA 4DK5A 3HM6X 4JL9A 2N1VA 3ENEA 2MCNB 1RFAA 2KWVB 2KANA 5CTRC 2GOWA 2IO0B 2MBBB 2M1MA 3W1SA 4GOCA 1I42A 4AJYB 3RULA 4LJOB 4K7UA 4ZYNA 2L05A 4DHZE 1XQQA 3MHSD 3V6EB 4E3CA 2KXJA 4EOYA 3RD2A 2RSUA 2DZIA 2ZPYA 5DPTA 1K8RB 3UF8A 4B6WA 2ZEQA 4URKA 2GBJA 3M3JA 1KLVA 3PTFC 2V4LA 2V1YA 5G55A 4WWNA 2DYMA 4W9GA 3VUWA 4ANXA 3WANA 2K6DB 4JLCA 2IBIB 3ZNGC 3QCAA 1UELA 3AU4A 3QARA 4CYEA 2FCQA 2MA9B 4WWPA 2D11A 4PYZA 2QHOA 4N9F4 3I3TB 4CO7A 4KV2A 3VXWA 4RM8A 2HE7A 3VTUA 2DYOA 2ZVNA 4M8MA 2DENB 2ZZPB 4IWPA 3A9JB 3TCAA 2KX0A 4EZJA 4KDIC 4NPNA 3M63B 4MJSA 3KUZA 1GC7A 3V60A 4HPLB 4XC2A 3L0WB 4OVUA 4W9HA 5DPRA 1WJNA 1XT9B 4RM9A 1HE8A 4NJ6A 4MSQB 2JZZA 4KIKB 1L2NA 3H7PA 1V5OA 1JRUA 2NCNA 4ANVA 3ZNID 5CHFA 2BKRB 2XEWA 5LLIA 3HHMA 3MTNB 3QC8B 4KSKC 1S3SG 4FULA 4JGHB 2LVQA 4JQWC 2LD9A 2KD0A 2LWPA 1SE9A 2FIFA 2ZNVC 3GOEA 3MJWA 3T8MA 2KO3A 2AEHA 1SIFA 2K1FA 2C60A 4HWIB 4NNJB 4F8CB 1LXDA 4IW0A 4BOZB 3VH4B 2V3SA 3H1UA 2LJ5A 2GBKA 2FAZA 3WALA 2KJ6A 5HKHA 2W9NA 4IWOA 1UBIA 5CHWA 3AI5A 3QK0A 1V80A 2JT4B 1RAXA 1NBFC 3A33B 4HDOA 2N7DA 3NY5A 2C5LC 5D2MB 4HLEA 2RGFA 5KHQA 2GBNA 1Q1OA 2WX1A 3CMMB 3EECA 3SDLC 2ZCCA 2AL3A 2K8BA
chains in the Genus database with same CATH superfamily
3L4PA 1VZ6A 2UWQA 4MM3A 4G11A 4WQOB 4Q2JA 1YNTE 2FCNA 1WM3A 2J53A 1AN8A 1XD3B 2X38A 3GZNI 1WMHB 2I1KA 3D32A 4AWJA 2D3BA 4A3OA 3P2BA 3TBLD 2M8SA 2KVRA 4NY0A 4XDCA 4AP4C 1UBQA 1EUVB 1C4PA 4K3CA 1P7EA 4GDKA 4KZ0A 2J42A 4FJZA 1AYFA 3WAOA 1P0RA 3ZRFA 3M95A 4RMAA 3ZNHB 3LYYA 4I6LB 1L6UA 4OVVA 1WRDB 4TV3A 1TT5B 2ONQA 2HJ8A 3Q3MC 2K3UA 2BB6A 2GLSA 4MELA 2OOBB 3NS8A 4EEWA 4FJVB 1PGAA 1UZXB 3NUHB 3HM3A 4TQ1A 2WXOA 3Q8CA 3RNGC 3MHZA 2WDRB 2AQ1B 1KH0A 1WIAA 1WX8A 5T8IA 2BQQA 3DCGA 3R3MA 3VFKA 2NR2A 2XK5B 3EA6A 2G4DB 3ZTDA 3L17A 3AE5B 3OG5A 1YX6B 4ZDVA 2N9EB 4DXAB 5BYRA 2AWTA 4M8NA 2EMSA 2IO3B 3MC9A 1ZW7A 5E6OA 5IOIA 3RNFC 2KQSA 4NZLB 2MW5A 1PFDA 1JWMD 2BWFA 1YN5A 1IP9A 1LO5D 2K0PA 3PS6A 2TSSA 4K7WA 1QLBB 3SHQA 4CQNA 4WJOA 4B95A 1PGXA 2WXFA 2WDQB 2QJLA 4EZLA 2RDHA 4GXBA 1IBXB 2V0GA 2BYFA 4ZHPA 1DOYA 2KWCA 1ZP0B 1GNUA 3HRDD 2KTRB 4W9CA 3Q2AC 2GI9A 3B2FA 1E7VA 1D5XC 2Y5CA 3KYCD 2VZKB 4MJSB 2JZ3B 1HZ5A 1JMLA 1YIWA 2M0AA 1V2YA 2N7JA 3N1ZC 2LMCA 3P4QB 2L76A 2N9XA 1F2RC 2O6VA 3R7RA 1OTRB 2BS2B 4NAWB 1EU4A 4GIVA 4REZA 3ZUNA 2PTLA 3A9JA 3SD5A 1R4NB 3ZJUA 2KC2A 3C8YA 2QCZA 4NAMA 4KIKA 4MT5A 2J0JA 1D5ZC 1E90A 3N1YC 1RM6C 4EKUA 3N30A 3PO0A 2L8JA 4XYCA 3W2DA 4WJQA 2JF5A 4E71A 1FXAA 4MM3B 1G6JA 3DOWA 4J6IA 3S2AA 3N32A 1BXTA 5FR6A 2BT6A 3B1LX 4JWSC 1WRIA 2NPTA 5BMGA 1CJEA 1VD2A 1M94A 2QDFA 1T0QC 4IM2A 4MGYE 3DVGX 4OW0A 4YSYB 3RCZA 2LFIA 5AZGA 2BYVE 4MDKE 5AZHA 2K5PA 3DBLB 4GDKB 3FAHA 1IGDA 3CF6E 2RR9A 4GN1A 4WJPA 4AOFA 4WURA 4US9A 5D6JB 2VRRB 3FILA 3IAM1 3V05A 2MWSB 1GG3A 3AULA 2DYBA 1QOBA 3GP7A 3DVNV 4EE2A 4B0EA 2GMIC 1JROA 4TQ0A 1D4BA 3HVDA 2INDC 3DWMA 3VAWA 2KC1A 2AQ3B 1YN4A 2W3RA 3NVYA 1Q5WB 3IG3A 2VH2A 4BFRA 1YJ1A 4YL8A 3AE7B 4MEMA 3VVWB 2B76B 2M19A 2K9XA 3TJPA 2ZW0A 1SGHA 1WR1A 2WNMA 4L23A 1DYQA 4W9LA 1C79A 3KW5B 3K9OB 1EF5A 3R66C 2JXXA 1F2RI 1L5PA 4PS8A 1WGDA 1WJ4A 2IO1B 4RFBA 5J2RA 1T3QA 1WX9A 3HIZA 4K3BA 2W54A 5E6PA 1ZXIA 2DAFA 4YSXB 2MH7A 3PGEA 2PE9A 2B3AA 4DDGD 1QT9A 1ROEA 2J0MA 2PE6B 3QA8A 4ARCA 1YOVB 3Q8BA 4GDLA 2PLPA 2SAKA 2IPKD 2FUHB 3V6CB 1MG8A 4RF1A 1TS5A 2XBBC 2WP9B 2RDGA 3Q8EA 4BKSD 1Q0WB 2JPHA 1D3ZA 5H92C 1KJTA 1WXAA 1C77A 4LCDE 3DBRI 4M0WA 3OAWA 1FNVA 4W9KA 2MLBA 4DQOC 3HM6X 2N1VA 1V1PB 4XE0A 1T6BX 2EELA 3AEEB 3DBHB 5CTRC 2GOWA 2MBBB 3W1SA 1I42A 2W82A 4K7UA 4ZYNA 2WXIA 2KAJA 2DNFA 3V6EB 1J7CA 1B1ZA 4KGSA 2ZPYA 1VZ8A 5I4DA 2V4LA 2BS3B 2V1YA 3BYTB 1SE4A 2DYMA 3ZNGC 2IBIB 2Q5WD 3RFZB 2FCQA 3ZYYX 1E10A 4RGOS 4WWMA 1DGJA 4CO7A 3VTUA 2DENB 3A9JB 4ARIA 3O13A 4KDIC 4NPNA 3KUZA 4XC2A 5FKAC 1ET6A 3L0WB 5DPRA 4RM9A 4KIKB 1V5OA 1QOGA 1YQ3B 3ZGZA 4JQWC 3VRAB 2KD0A 3GOEA 3AH7A 3MJWA 2PVOD 3BZDB 1FCCC 1SIFA 3OWEB 4BOZB 1SSNA 2DLBA 1K52A 4RGTA 1I4HA 3H1UA 3R2IA 3WALA 3AEBB 1E7PB 2W9NA 1NEKB 3QK0A 1V80A 3A33B 2N7DA 3NY5A 3UI3A 1HTOA 2MJEA 4BAXA 2GBNA 2WX1A 3EECA 2ZCCA 4XWTA 3AE1B 4MH0E 4WH4A 1ZDVA 3TIXA 2D3AA 4IC7B 3Q3OC 5CX3A 3IFWB 1XLQA 3EFUA 4HDQA 1XEEA 2G4SA 5DPSA 4M01A 1MI0A 2L0FA 2EKEC 1C3TA 4W9IA 1WE7A 3N1XC 3JSVB 3ZQ4A 1IPGA 2IO2B 3U30A 3N9YC 1XLPA 1HZ6A 3MC8A 3WAMA 2KT7A 3VTVA 2Y3AA 4K81A 5IAAC 2WU5B 2AQ2B 3W1SC 1JWUD 2N9KA 2QMTA 2WDTB 1P1AA 2JY6A 3PRPB 2JWZA 4ANUA 2MP2A 4A8XC 2Y5BB 3IBEA 2FIDA 3AMZA 1TBEA 2QC8A 4GDLB 3RNBC 3ML8A 2N0SB 3KVFB 5IP4D 1HXYD 1NENB 4JE3B 1TYGB 3I57A 3APDA 2NBWB 4L1BA 4W9EA 3NVZA 3SFEB 3EUB2 4BKSA 1KM7A 3GZNB 1ZOYB 4WJNA 4DHZB 3U7DA 1UGJA 3RI7C 5DPWA 1A70A 4DBGA 4M0WB 2BYTA 1WGGA 1TTNA 3Q14C 3RNAC 3A9KA 1YX5B 2O6VD 3PHWB 1VJKA 2X8XX 4ITKA 4LLGM 2KK8A 1N60A 2ASQA 4GLSC 2JYTA 2DZJA 3ZXVA 4C4VB 1PYWD 3A1QA 3QJZA 2C7MB 2KN4A 2IY0B 1QF6A 1E7UA 1DOXA 4KX6B 1H8CA 3Q3JA 3QWZB 2K39A 1T0YA 4MGKE 3E56A 4MGIE 2KMAA 3ML9A 5JZEB 2M56B 2N7EA 1L4ZB 2MSED 1STEA 4A20A 1WI0A 1E5WA 3AECB 1Y8RC 1UUPA 4WQMA 1RYJA 2ACZB 5L83A 5JHAA 1P7FA 2ZNVB 2BB5A 2JRHA 2KJRA 3SFDB 2I1JA 1YJJA 3UINB 1XXGA 1SE2A 4I6PA 4ZRJA 2K25A 2CJOA 4ASWC 1WXMA 2LGXA 3ZRCA 1K51A 4A9AA 1CQVA 1BT0A 4EZKA 3SU8X 1YN3A 1EU3A 1SBBB 3OJ3A 1WYGA 1I4QA 4DDID 1OEYJ 3IHPC 4YT0B 3C0RB 1ZKHA 4IWQA 5E6JA 2L00B 2AX5A 4P1BC 1T5XD 5DCNA 2YVCA 3CWIA 3T9LA 2WX0A 4AJWA 2D2QA 2KQ7A 4OZBA 1FXTB 2N9LA 2L7RA 3ALBA 4P16A 4IUMB 1E8ZA 3FC4A 3AE4B 4ZRQA 1JQ4A 1HTQA 4TKNA 1IUEA 5C1ZA 2INCC 1VLBA 2KFKB 1SJHD 3OLMD 2OEDA 4KSLC 3URYA 3W9CB 3L54A 4FLHA 1MHHE 2KMMA 3Q8AA 1N5XA 4HJKA 1M4VA 3EC8A 4ICVA 2JSVX 1TZOA 3GS2A 4OHJA 3V3XA 3JVZX 3DHGC 3A4SC 3TMPB 2M17A 1C78A 1EF1A 2NVUI 1WFYA 1WY8A 5BMIA 1FCLA 3DWGC 4A3PA 2REXA 1WXVA 2CHWA 2K6QA 1P3QU 1PQSA 4WAAA 2KZRA 2QILA 3MP9A 4TSSA 4XZ4A 2JQRB 2MP2B 3PV1A 3NVWA 3I5JC 1GB4A 2BKFA 1Q10A 1J0GA 1ET9A 1OQRA 1QOFA 4N58A 2JZPA 1FNWA 4IDIA 4F7ZA 2WXKA 5JH5C 4FHKA 4B0MA 3QIJA 1ZE3D 3PZDA 1OQYA 2DZMA 4C7ZA 2LI5A 2L1AA 1R4MI 4LTUA 3LB8C 2GBMA 4AUQC 2A4ZA 2KTFA 4KDLB 3GE8C 2LHDA 3A9KB 4ANWA 2IZVB 1TKYA 1L7YA 4WIPA 1WH3A 2CHXA 5L95C 2E6XA 3DVNU 1LFDA 2WGSA 4G0NB 2WXNA 1FXIA 4AS1A 1E6EB 2W3SA 3KH0A 1EWYC 3LXFA 2KDFB 2IDYA 3DHHC 2D07B 3ZNZB 5BYSA 1I4RA 1WSPA 3FKYA 5FR3A 4C56C 4L2YA 1QQRA 2D3CA 2HD5B 1WGYA 4R3DA 4JL9A 3ENEA 3P42A 1ZDXA 3I63C 2IO0B 4AJYB 2ICIA 1I4GA 3MHSD 3BK1A 3Q6BA 1N6ZA 2IGDA 3Q69A 3M3JA 1KLVA 3PTFC 1JWAD 5IO9A 4WWNA 1XO3A 2WXJA 4JLCA 3QCAA 4OVZA 3QARA 2YEPF 2V3PA 4HKZE 3KWVA 3Q8FA 1I7HA 2BBCA 3VXWA 3AE8B 4RM8A 2H89B 2ZVNA 4M8MA 2ZZPB 4IWPA 5EE1A 3TCAA 1TS4A 2JU6X 4EZJA 3V60A 2HDEA 1GC7A 1JCKB 1E9MA 2JZZA 3H7PA 1JRUA 4ANVA 1SB3C 3ZNID 5CHFA 1MFWA 5LLIA 2XEWA 1KTKA 3HHMA 3MTNB 2XN9C 4HKQA 1S3SG 1KFYB 2LVQA 3PZ8A 2LD9A 1ZUD2 2LWPA 2FIFA 3DBRB 1N61A 3RNCC 3NZ3A 3T8MA 2K1FA 5HG2A 3VH4B 2V3SA 2QEJC 3W5VB 2H88B 3J9CA 1UBIA 5CHWA 3AI5A 2JT4B 2PKOA 2WXQA 1EWCA 2C5LC 4HLEA 2RGFA 1XCTL 3CMMB 3SDLC 2AL3A 3O65B 3VUYA 3ZIMA 4CHKA 3NZUA 2FUG1 2L32A 4HPPA 4N59A 2O2VA 5G5HA 4XGAB 2WDVB 1FRDA 4BZAA 4NQKE 1S1QB 4HRSA 3M62B 5EE3A 3HVZA 2LRWA 3X23A 4TUUA 2PJHA 4RNAA 3ZO5B 1C9FA 3NVVA 2ZPNA 2EKIA 4X57B 2LGYA 2WXPA 4FADA 3BVGA 5HI1A 1GOZA 3PVLA 2JWUA 3SR6A 1MJDA 1TY0A 1WWTA 2CKHB 5TR5A 1XLNA 4BKGA 1TZ1A 2E3TA 1L0XB 4RCOA 2KOXA 2KWDA 2Z8LA 2BYEA 1J8CA 3E9SA 4MSMB 1L0YB 5AEKB 3TUOA 3VTWA 2O6VB 2BW2A 4HROA 2LGSA 5C3JB 3N20C 5AUIA 2JX5A 2LEKA 3T3NA 1D6EC 3R2TA 1UWMA 1NI3A 1FD6A 1E8WA 3RZWC 4II3B 4P1CC 2KDIA 3KUDB 1V9JA 1RFKA 2WXHA 1TIFA 5D94A 1WMHA 2CJNA 1KLUD 2FCMA 4GGQA 1WJ6A 4YTMB 2LXCA 5GMVA 2NPTB 3AXCA 4ICUA 1FNUA 4USAA 2C7HA 1AW7A 1ZGUB 2KYWA 3AEDB 5IKCM 1L4DB 2MBQA 2WYQA 2M4NA 4C7YA 2PPHA 2Z0EB 3FILB 4GMVA 4DHJD 2FNJB 4BBNC 4JWUC 1GJZA 3H6NA 5LXIB 3WA0A 3TEZA 3AE9B 3KUCB 2JVCA 4D2KA 1I35A 1E8YA 1YQ4B 3CSFA 4GB9A 1DOIA 4YWGG 4BBNF 1KOTA 3ZW3A 3H7PB 5J17A 2KFJA 2KVZA 1OFFA 1FM0D 4UDUC 2DZKA 2IYDB 4GSWA 2XK5A 1K50A 3EGRA 1WYWB 2AL6A 3NZSA 3ABVB 2QIEB 1OEYA 1ZXHA 3NRZA 4RGMA 2JXTA 1WXQA 2CU1A 4ZYSA 1FMAD 4KVGB 2L3ZA 2LVOA 2NBVB 1MG4A 2LRUA 4PS3A 1UH6A 2Z0DB 1E8XA 2ZVOA 3PZ7A 2O2VB 2ON8A 3L16A 1LQBA 1GC6A 1RWSA 1JWBD 3R7QA 1YJIA 2XNAC 4LNFA 1QKZA 3WIMA 1HEZE 2KKCA 4HK2A 3C19A 4F1SA 2KWUB 4BOSC 3GB1A 1P98A 4IOIE 2KTRA 1FO4A 2FE8A 4G3XB 2R61A 1F9JA 3BY4B 1C4CA 3UQAA 1TGZB 3U52E 4PYUA 1YQBA 4G50A 2CR5A 1JRPA 1F0ZA 3RN9C 2C9WB 3B08A 5GXGB 4C80A 3IVFA 1QZEA 4IM0A 2D5GA 2Y5PA 3VR8B 3CIRB 2V3NA 3VUXA 1MHXA 3EHVA 5BYQA 4KZCA 2D3GA 2KLGA 1J7BA 4LDTB 4O1NA 1J7AA 1XLOA 5JXVA 5FK9C 4NAWA 3ZDTA 2IJ0A 1WJUA 3HUIA 3NG0A 4HPMB 1V97A 4YXDB 3PRMB 2JYEA 4ZRPA 2WLBA 1FFVA 1V5TA 1TKEA 3UIPB 5G5GA 2FBWB 2MBOA 2L83A 4B9KA 3LDZE 4EFOA 2MRPA 3RUIB 1C76A 1YMHE 4NQLB 1NDDA 1SJED 5CHVC 3UIOB 3UQBA 3PLVA 1UGMA 5EE9A 4MH8A 3V62A 1UWXA 1J19A 4PS7A 2NTTA 2D10A 3PSEB 3RT3B 3TSSA 4DXFA 3B9JA 3ZTCA 2M0XA 1WXSA 2G3QB 2KDEB 4YTNB 2RPQA 4IG7B 1IYFA 1X1MA 2R2QA 5IA7A 3PRZA 2JUOA 1WGHA 1I4PA 4EUTA 5J18A 4PK1A 2MQJA 2MJDA 3RMKC 1NVID 3BIID 2VH1A 4FHJA 3AEFB 4DK5A 2MCNB 1RFAA 2KWVB 1SEBD 2KANA 3Q3NC 1FRRA 1PDXA 2M1MA 4GOCA 4LJOB 4FXCA 1XCQL 2L05A 4E3CA 4EOYA 5TSSA 2RSUA 2DZIA 5DPTA 1K8RB 2ZEQA 2GBJA 1LGRA 3P4SB 5EE0A 1EM7A 3VUWA 4YSZB 4ANXA 3WANA 1UELA 2RMMA 4CYEA 4LNKA 1R4MB 4PYZA 5HHDG 2OHFA 2QHOA 4A55A 3IXSA 3VR9B 3IT6B 3NJTA 1TJEA 3P1MA 1NYQA 3IT4B 2KX0A 4OZCA 3M63B 1QOAA 4HPLB 4W9HA 1XT9B 4NJ6A 2MEKA 4MSQB 2NCNA 1GAQB 4TMAB 3TEXA 3QC8B 3P4RB 3DHIC 2GB1A 4J3OD 4ZHOA 1L6VA 1SE9A 2K22A 2WXMA 5H8YE 2AEHA 4NNJB 4F8CB 4HWIB 1LXDA 5C2TB 2LJ5A 2FAZA 2KJ6A 5HKHA 2MJ3A 3ZJTA 1ZPSA 1V8CA 1IGCA 5D2MB 2LHEA 1D5MC 1MVKA 1N63A 4HJGE 4LDTD 4HXDA 4JIOU 3RPFC 4DXGA 1V1PA 2BS4B 3GE3C 2KLCA 2W55A 4JPSA 4N6EB 1BUIC 1Z5SB 3H7SA 2YLMA 2R2OA 2LUMA 4ZRIA 1P9DU 2NTSA 1XF5L 2HTHA 2A5UA 4C00A 4LNIA 4W9DA 3W5UB 2KN5A 4LNNA 3A1QB 3RYTA 4IM3A 2MX2A 3ZJVA 3PREA 2G1EA 4FN2A 4BKTA 3AN1A 1WM2A 1FIQA 4BVUC 2IGHA 4WWOA 3JYUA 1BMLC 2UYZB 2KX3A 3NS1A 4RH6A 1VRAB 2KJHB 3ETRA 3V61A 2MBHA 3UGBB 2G9HD 3PPAA 4NJ7A 4AQ7A 4K7SA 2N1WA 3U4EG 1U4AA 2LXAA 1JWSD 3H8HA 4IKGA 2DX5B 2PVGC 2BPSA 1CK1A 1WE6A 1OGWA 4NJCA 5EDSA 4FJYA 4P6VF 2RD0A 3BVMA 4FBJB 1F77A 1CMXB 4KKJA 4H2AA 3QHTA 3B0AA 4A6QA 2DHZA 2LVPA 1K53A 3TL5A 4FA6A 1R4NI 4W9FA 1RRBA 3U2SC 3KQ4A 3HK0A 1V49A 2NMQA 2MBEA 2YEPB 3EFCA 3APFA 1WGRA 3QQ8B 3AB5A 4DHJB 3VH3B 1R7SA 4P7IA 3ECIA 1I4XA 1V1OA 2DAJA 3JSVA 1ENFA 1C4AA 1KLGD 2G45B 1WZ3A 3K9PB 5C23A 4II2B 5AUKA 2K8HA 4DWFA 3P63A 4E74A 3OJ4B 3I9V1 2N9PC 3BVZA 4RGNA 2WWZA 2L0TA 4PT5A 1F1HA 2PIAA 3AEAB 2FCSA 2GBRA 3CSTA 5G2NA 2I38A 1WGKA 3DBLI 2KNBA 2V4IB 4LNOA 2J4XA 4S0RA 1MPEA 1VCBA 3DVGY 4YTPB 3RZFA 1WF9A 2KHWB 2LUEA 3DQVA 5JHBA 1WR6E 1E0ZA 3ZVVA 1EO6A 3MFGA 2VZKD 3AEGB 4KGRA 5LXHA 3KWLA 3L08A 2KDBA 3KLSX 1C1YB 2Z59B 3DPDA 4I6NB 3NHEB 2WXLA 2PEAA 3N3KB 3U7ZA 3DBSA 1PGBA 3IAS1 3PLUA 1UNSA 5D7GA 5AZFA 4QAYA 4ZRKA 1V6EA 5IN7A 3ONSA 3JW0X 2UU7A 4HCPB 2CS4A 2J0KA 1NI2A 2OJRA 4XWWA 2SEBD 5BO4B 1QILA 3L13A 2WS3B 2NS5A 3PT2B 3U8ZA 1WZ0A 3TEWA 2ZJDA 2BF8B 4LK0M 4GU2A 4C4VA 3ZKJC 1B9RA 1RLFA 1FPYA 2BVCA 1KF6B 1GPXA 2LGDA 4ACFA 2KQ4X 3KYDD 2WU2B 1GUAB 5E6NA 4HCNB 1Y56A 4JX1C 2CHZA 2HJ1A 2C7NB 1H4RA 1AARA 4LJPB 2AYOB 2INNE 1GB1A 1ACCA 3B2GA 1VR9A 2RPVA 3DDCB 3MJ5A 3ZDMC 4WAFA 4RF0A 2DBYA 2CU3A 3NOBA 3L10B 2GRIA 3QAQA 4MGZE 2WQYB 1T0RC 3ZLZA 1V81A 3VHTC 3DBHI 2NBUA 3QX1A 2WXGA 2BGFA 2IGGA 3VRBB 1FEHA 2J52A 2JRIB 4HVBA 2J7QB 2LASA 4XX5A 3PHXB 5D3DA 1Z2MA 5D3IB 3RNEC 1F52A 2KDMA 4W9JA 1N62A 3TEYA 1YD8U 3W1YA 2WXRA 3Q3FA 4ZOHC 3X0WA 3VQIA 1ESFA 3AE6B 1SIJA 1TS3A 3MC0B 1HQRD 3BINA 3AU5A 2LJIA 1WX7A 2KMCA 5MPOA 2ZCBA 3BWUD 3H9DA 3WAPA 1SF0A 1V86A 5BMHA 1JALA 2EMTA 1FFUA 2LZ6A 2KFKA 2DWQA 2QSDA 1UD7A 3A4RA 2N4FA 2BWES 3APCA 3LJ3A 1JW9D 2K8CA 5KHOA 4K1RB 3VDZA 2IY1B 1A5RA 1LM8B 1L0VB 1ISNA 2KACA 3SEBA 2ZW1A 3BK2A 2BTEA 3RULA 3BYYB 4DHZE 1XQQA 2MHJA 2KXJA 3RD2A 4URKA 4B6WA 3AE2B 3UF8A 1CZPA 3AE3B 4A90A 1IBXA 3T3OA 2PMVA 5LNK1 1SE3A 1TS2A 5G55A 3AV8A 3AM9A 4XDDA 4MACA 4W9GA 4KGTA 2K6DB 3AU4A 2MA9B 1KRHA 4WWPA 2HTME 4M02A 2RDBC 2D11A 1PUTA 4N9F4 3I3TB 4KV2A 2HE7A 2DYOA 2I2YA 3ZXRA 1T0SC 2L52A 4MJSA 4S17A 1OQQA 4OVUA 1WJNA 1VDVA 1HE8A 3P4PB 1N5WA 1AWDA 1L2NA 4US8A 1TY2A 2PW9A 2BKRB 2LGIA 4OZAA 2V9HA 4KSKC 2WHIA 4FULA 4JGHB 1VZ7A 2ZNVC 1NYRA 1SXTA 2INPE 2KO3A 2C60A 4M00A 4IW0A 4KKIA 2GBKA 3R8BA 2OJWA 4IWOA 3WCQA 1RAXA 1NBFC 1TKGA 4HDOA 5HFYA 1UF0A 1HA5A 5KHQA 1Q1OA 4HEA1 2K8BA
chains in the Genus database with same CATH topology
3O65B 4LDTD 3VUYA 4HXDA 3ZIMA 4JIOU 4CHKA 3NZUA 2UWQA 2KLCA 4MM3A 2O2VA 4MH0E 4G11A 4WQOB 4NQKE 2FCNA 1S1QB 3TIXA 1Z5SB 3M62B 4IC7B 1WM3A 3H7SA 1XD3B 5CX3A 2YLMA 3IFWB 3GZNI 2R2OA 1WMHB 2I1KA 2LRWA 3D32A 4ZRIA 4AWJA 3X23A 1P9DU 3EFUA 4A3OA 4TUUA 3P2BA 4HDQA 3TBLD 2M8SA 2PJHA 2HTHA 2KVRA 3ZO5B 2G4SA 5DPSA 4NY0A 2A5UA 2ZPNA 2L0FA 2EKEC 4AP4C 1UBQA 1EUVB 4X57B 2LGYA 1C3TA 4W9DA 2KN5A 4W9IA 3A1QB 4GDKA 4FADA 3RYTA 1WE7A 4IM3A 2MX2A 3JSVB 4KZ0A 3PREA 4FJZA 3WAOA 3ZRFA 1IPGA 1P0RA 3M95A 2IO2B 4RMAA 4FN2A 3PVLA 4BKTA 3ZNHB 1WM2A 4BVUC 4I6LB 3U30A 4OVVA 1WRDB 4TV3A 4WWOA 3JYUA 2UYZB 2HJ8A 2KX3A 3WAMA 2CKHB 3VTVA 4MELA 5TR5A 4BKGA 4K81A 2OOBB 5IAAC 3NS8A 1TZ1A 4EEWA 4FJVB 2KJHB 3V61A 2MBHA 1UZXB 3UGBB 3HM3A 2KOXA 3PPAA 4NJ7A 3W1SC 2WDTB 1P1AA 4TQ1A 2JY6A 2BYEA 3PRPB 1J8CA 4K7SA 2JWZA 4ANUA 2MP2A 4MSMB 2Y5BB 2N1WA 3IBEA 2FIDA 1U4AA 1WIAA 1WX8A 2LXAA 5AEKB 3R3MA 1TBEA 3DCGA 4GDLB 3VFKA 3VTWA 3ML8A 2NR2A 3KVFB 2O6VB 2XK5B 2G4DB 3ZTDA 2DX5B 2BPSA 3L17A 3APDA 2NBWB 1WE6A 1YX6B 4W9EA 4ZDVA 2N9EB 4DXAB 1OGWA 2AWTA 4M8NA 4BKSA 4FJYA 1KM7A 2EMSA 2IO3B 5EDSA 1ZW7A 2RD0A 5E6OA 4FBJB 4WJNA 4DHZB 3U7DA 1E8WA 1CMXB 3UQBA 5DPWA 2KQSA 4DBGA 4M0WB 2MW5A 3RZWC 1WGGA 1TTNA 4II3B 2BWFA 3QHTA 3B0AA 2KDIA 1IP9A 3A9KA 2DHZA 2LVPA 3KUDB 3TL5A 1V9JA 4FA6A 1YX5B 2O6VD 3PHWB 1R4NI 4W9FA 5D94A 1RRBA 3PS6A 1WMHA 4K7WA 3HK0A 1V49A 2FCMA 4GGQA 3SHQA 2KK8A 1WJ6A 2MBEA 4WJOA 4B95A 2LXCA 2ASQA 3APFA 1WGRA 3QQ8B 4DHJB 4EZLA 3VH3B 5GMVA 2DZJA 2NPTB 3AXCA 4ICUA 4P7IA 3ECIA 4GXBA 2C7HA 3A1QA 2DAJA 3JSVA 3QJZA 1ZGUB 2BYFA 2C7MB 2IY0B 2G45B 1WZ3A 3K9PB 1E7UA 2KWCA 2MBQA 5C23A 1H8CA 4II2B 3Q3JA 2K8HA 3QWZB 2K39A 4DWFA 1GNUA 1T0YA 4MGKE 2KTRB 2M4NA 2WYQA 4MGIE 3OJ4B 4W9CA 4E74A 2N9PC 2KMAA 3ML9A 5JZEB 2PPHA 2N7EA 2WWZA 2L0TA 1E7VA 2Z0EB 4GMVA 2MSED 4DHJD 4A20A 2FCSA 2GBRA 1WI0A 3KYCD 1E5WA 2FNJB 4BBNC 1Y8RC 3CSTA 1GJZA 3H6NA 5LXIB 5G2NA 3WA0A 4MJSB 3KUCB 2JVCA 3DBLI 1I35A 2JZ3B 5JHAA 5L83A 1E8YA 1YIWA 2ZNVB 3CSFA 4GB9A 1V2YA 4BBNF 2KNBA 2JRHA 1KOTA 2KJRA 3ZW3A 3H7PB 2I1JA 5J17A 2KFJA 3UINB 2L76A 2N9XA 2DZKA 1VCBA 2IYDB 4I6PA 4ZRJA 2K25A 4GSWA 2O6VA 2XK5A 3R7RA 4ASWC 1OTRB 3DVGY 3RZFA 1WF9A 2KHWB 1WYWB 2AL6A 4NAWB 1WXMA 2LUEA 2LGXA 3NZSA 3ZRCA 4EZKA 3DQVA 1BT0A 5JHBA 1OEYA 4GIVA 1WR6E 3ZUNA 3ZVVA 3A9JA 1EO6A 3SD5A 3SU8X 2CU1A 5LXHA 3L08A 2KDBA 2KC2A 1C1YB 2Z59B 3OJ3A 4KVGB 3DPDA 2L3ZA 3NHEB 4I6NB 2LVOA 2NBVB 4PS3A 2LRUA 4KIKA 2PEAA 3N3KB 2J0JA 3DBSA 4DDID 3PLUA 1E90A 1OEYJ 3IHPC 5D7GA 5AZFA 4EKUA 3C0RB 1ZKHA 4ZRKA 3N30A 1UH6A 1V6EA 4IWQA 2Z0DB 2L00B 3ONSA 2L8JA 3JW0X 2YVCA 4HCPB 5DCNA 1E8XA 2CS4A 1NI2A 2J0KA 2JF5A 4WJQA 3T9LA 2WX0A 4E71A 2OJRA 4AJWA 2ZVOA 2D2QA 1G6JA 2O2VB 5BO4B 3L13A 3L16A 2KQ7A 2NS5A 3PT2B 3DOWA 1FXTB 4J6IA 1LQBA 3N32A 1WZ0A 2L7RA 1GC6A 3ALBA 5FR6A 3S2AA 3U8ZA 3B1LX 4IUMB 3R7QA 1E8ZA 2ZJDA 2BF8B 2NPTA 4GU2A 1VD2A 1M94A 3WIMA 4TKNA 4IM2A 3ZKJC 5C1ZA 2KKCA 4MGYE 4HK2A 1RLFA 4F1SA 2KFKB 2KWUB 3DVGX 4BOSC 3OLMD 3RCZA 2LGDA 5AZGA 2BYVE 4MDKE 3KYDD 4KSLC 5AZHA 1P98A 1GUAB 5E6NA 4HCNB 2KTRA 4G3XB 2CHZA 3L54A 4GDKB 4FLHA 2C7NB 3CF6E 2RR9A 4GN1A 4WJPA 4AOFA 1F9JA 1H4RA 3BY4B 1AARA 4LJPB 3UQAA 2AYOB 5D6JB 1TGZB 2VRRB 4HJKA 4PYUA 2MWSB 1GG3A 3AULA 1YQBA 3EC8A 2CR5A 4G50A 2DYBA 4ICVA 2C9WB 3B08A 3DVNV 3DDCB 3JVZX 2GMIC 3ZDMC 3A4SC 3IVFA 3TMPB 4TQ0A 1QZEA 2M17A 1EF1A 2NVUI 4IM0A 1WFYA 1WY8A 3VAWA 2KC1A 3NOBA 3L10B 4A3PA 3QAQA 3VUXA 2REXA 1WXVA 4MGZE 1Q5WB 2CHWA 3IG3A 3EHVA 4BFRA 2K6QA 1P3QU 2D3GA 1YJ1A 4KZCA 3ZLZA 1V81A 2KLGA 3DBHI 1PQSA 2NBUA 4LDTB 4WAAA 2KZRA 4YL8A 3QX1A 3VHTC 4MEMA 4NAWA 3VVWB 3ZDTA 2BGFA 4XZ4A 3TJPA 1WJUA 2MP2B 4HPMB 1SGHA 1WR1A 2JRIB 3PV1A 4W9LA 3PRMB 3KW5B 4HVBA 2BKFA 1V5TA 3K9OB 1EF5A 1J0GA 3R66C 2J7QB 2JXXA 2LASA 4XX5A 4PS8A 3UIPB 3PHXB 1Z2MA 1WGDA 1WJ4A 2IO1B 4F7ZA 2MBOA 5JH5C 4FHKA 4W9JA 1YD8U 5J2RA 4B9KA 1WX9A 3W1YA 3LDZE 3HIZA 3QIJA 3Q3FA 4EFOA 3X0WA 3VQIA 2MRPA 3PZDA 3RUIB 5E6PA 1OQYA 2DZMA 2LI5A 2DAFA 4NQLB 1R4MI 1NDDA 5CHVC 3BINA 3PGEA 3UIOB 3PLVA 2PE9A 2B3AA 3AU5A 2GBMA 4AUQC 4DDGD 1UGMA 2A4ZA 1WX7A 2J0MA 2KTFA 2PE6B 3QA8A 2KMCA 4KDLB 3A9KB 4GDLA 4ANWA 2ZCBA 3H9DA 2IZVB 3WAPA 1L7YA 1V86A 3V62A 1WH3A 2FUHB 1J19A 3V6CB 4PS7A 2CHXA 1MG8A 3DVNU 5L95C 1LFDA 2EMTA 2LZ6A 4G0NB 2D10A 2XBBC 3PSEB 3RT3B 2KFKA 3ZTCA 1UD7A 4BKSD 2M0XA 1Q0WB 1WXSA 2G3QB 3A4RA 2JPHA 3KH0A 2KDEB 1D3ZA 2KDFB 2N4FA 1KJTA 1WXAA 2BWES 2RPQA 3APCA 4IG7B 1IYFA 1X1MA 2R2QA 5IA7A 3PRZA 2JUOA 4LCDE 2D07B 3LJ3A 3ZNZB 3DBRI 3VDZA 1WGHA 2K8CA 4K1RB 5KHOA 2IY1B 3OAWA 4EUTA 5J18A 1A5RA 2MQJA 1LM8B 4FHJA 4W9KA 2HD5B 1ISNA 1WGYA 2MLBA 4DK5A 3HM6X 4JL9A 2N1VA 3ENEA 2MCNB 1RFAA 2KWVB 2KANA 5CTRC 2GOWA 2IO0B 2MBBB 2M1MA 3W1SA 4GOCA 1I42A 4AJYB 3RULA 4LJOB 4K7UA 4ZYNA 2L05A 4DHZE 1XQQA 3MHSD 3V6EB 4E3CA 2KXJA 4EOYA 3RD2A 2RSUA 2DZIA 2ZPYA 5DPTA 1K8RB 3UF8A 4B6WA 2ZEQA 4URKA 2GBJA 3M3JA 1KLVA 3PTFC 2V4LA 2V1YA 5G55A 4WWNA 2DYMA 4W9GA 3VUWA 4ANXA 3WANA 2K6DB 4JLCA 2IBIB 3ZNGC 3QCAA 1UELA 3AU4A 3QARA 4CYEA 2FCQA 2MA9B 4WWPA 2D11A 4PYZA 2QHOA 4N9F4 3I3TB 4CO7A 4KV2A 3VXWA 4RM8A 2HE7A 3VTUA 2DYOA 2ZVNA 4M8MA 2DENB 2ZZPB 4IWPA 3A9JB 3TCAA 2KX0A 4EZJA 4KDIC 4NPNA 3M63B 4MJSA 3KUZA 1GC7A 3V60A 4HPLB 4XC2A 3L0WB 4OVUA 4W9HA 5DPRA 1WJNA 1XT9B 4RM9A 1HE8A 4NJ6A 4MSQB 2JZZA 4KIKB 1L2NA 3H7PA 1V5OA 1JRUA 2NCNA 4ANVA 3ZNID 5CHFA 2BKRB 2XEWA 5LLIA 3HHMA 3MTNB 3QC8B 4KSKC 1S3SG 4FULA 4JGHB 2LVQA 4JQWC 2LD9A 2KD0A 2LWPA 1SE9A 2FIFA 2ZNVC 3GOEA 3MJWA 3T8MA 2KO3A 2AEHA 1SIFA 2K1FA 2C60A 4HWIB 4NNJB 4F8CB 1LXDA 4IW0A 4BOZB 3VH4B 2V3SA 3H1UA 2LJ5A 2GBKA 2FAZA 3WALA 2KJ6A 5HKHA 2W9NA 4IWOA 1UBIA 5CHWA 3AI5A 3QK0A 1V80A 2JT4B 1RAXA 1NBFC 3A33B 4HDOA 2N7DA 3NY5A 2C5LC 5D2MB 4HLEA 2RGFA 5KHQA 2GBNA 1Q1OA 2WX1A 3CMMB 3EECA 3SDLC 2ZCCA 2AL3A 2K8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O65 B;  4LDT D;  3VUY A;  4HXD A;  3ZIM A;  4JIO U;  4CHK A;  3NZU A;  2UWQ A;  2KLC A;  4MM3 A;  2O2V A;  4MH0 E;  4G11 A;  4WQO B;  4NQK E;  2FCN A;  1S1Q B;  3TIX A;  1Z5S B;  3M62 B;  4IC7 B;  1WM3 A;  3H7S A;  1XD3 B;  5CX3 A;  2YLM A;  3IFW B;  3GZN I;  2R2O A;  1WMH B;  2I1K A;  2LRW A;  3D32 A;  4ZRI A;  4AWJ A;  3X23 A;  1P9D U;  3EFU A;  4A3O A;  4TUU A;  3P2B A;  4HDQ A;  3TBL D;  2M8S A;  2PJH A;  2HTH A;  2KVR A;  3ZO5 B;  2G4S A;  5DPS A;  4NY0 A;  2A5U A;  2ZPN A;  2L0F A;  2EKE C;  4AP4 C;  1UBQ A;  1EUV B;  4X57 B;  2LGY A;  1C3T A;  4W9D A;  2KN5 A;  4W9I A;  3A1Q B;  4GDK A;  4FAD A;  3RYT A;  1WE7 A;  4IM3 A;  2MX2 A;  3JSV B;  4KZ0 A;  3PRE A;  4FJZ A;  3WAO A;  3ZRF A;  1IPG A;  1P0R A;  3M95 A;  2IO2 B;  4RMA A;  4FN2 A;  3PVL A;  4BKT A;  3ZNH B;  1WM2 A;  4BVU C;  4I6L B;  3U30 A;  4OVV A;  1WRD B;  4TV3 A;  4WWO A;  3JYU A;  2UYZ B;  2HJ8 A;  2KX3 A;  3WAM A;  2CKH B;  3VTV A;  4MEL A;  5TR5 A;  4BKG A;  4K81 A;  2OOB B;  5IAA C;  3NS8 A;  1TZ1 A;  4EEW A;  4FJV B;  2KJH B;  3V61 A;  2MBH A;  1UZX B;  3UGB B;  3HM3 A;  2KOX A;  3PPA A;  4NJ7 A;  3W1S C;  2WDT B;  1P1A A;  4TQ1 A;  2JY6 A;  2BYE A;  3PRP B;  1J8C A;  4K7S A;  2JWZ A;  4ANU A;  2MP2 A;  4MSM B;  2Y5B B;  2N1W A;  3IBE A;  2FID A;  1U4A A;  1WIA A;  1WX8 A;  2LXA A;  5AEK B;  3R3M A;  1TBE A;  3DCG A;  4GDL B;  3VFK A;  3VTW A;  3ML8 A;  2NR2 A;  3KVF B;  2O6V B;  2XK5 B;  2G4D B;  3ZTD A;  2DX5 B;  2BPS A;  3L17 A;  3APD A;  2NBW B;  1WE6 A;  1YX6 B;  4W9E A;  4ZDV A;  2N9E B;  4DXA B;  1OGW A;  2AWT A;  4M8N A;  4BKS A;  4FJY A;  1KM7 A;  2EMS A;  2IO3 B;  5EDS A;  1ZW7 A;  2RD0 A;  5E6O A;  4FBJ B;  4WJN A;  4DHZ B;  3U7D A;  1E8W A;  1CMX B;  3UQB A;  5DPW A;  2KQS A;  4DBG A;  4M0W B;  2MW5 A;  3RZW C;  1WGG A;  1TTN A;  4II3 B;  2BWF A;  3QHT A;  3B0A A;  2KDI A;  1IP9 A;  3A9K A;  2DHZ A;  2LVP A;  3KUD B;  3TL5 A;  1V9J A;  4FA6 A;  1YX5 B;  2O6V D;  3PHW B;  1R4N I;  4W9F A;  5D94 A;  1RRB A;  3PS6 A;  1WMH A;  4K7W A;  3HK0 A;  1V49 A;  2FCM A;  4GGQ A;  3SHQ A;  2KK8 A;  1WJ6 A;  2MBE A;  4WJO A;  4B95 A;  2LXC A;  2ASQ A;  3APF A;  1WGR A;  3QQ8 B;  4DHJ B;  4EZL A;  3VH3 B;  5GMV A;  2DZJ A;  2NPT B;  3AXC A;  4ICU A;  4P7I A;  3ECI A;  4GXB A;  2C7H A;  3A1Q A;  2DAJ A;  3JSV A;  3QJZ A;  1ZGU B;  2BYF A;  2C7M B;  2IY0 B;  2G45 B;  1WZ3 A;  3K9P B;  1E7U A;  2KWC A;  2MBQ A;  5C23 A;  1H8C A;  4II2 B;  3Q3J A;  2K8H A;  3QWZ B;  2K39 A;  4DWF A;  1GNU A;  1T0Y A;  4MGK E;  2KTR B;  2M4N A;  2WYQ A;  4MGI E;  3OJ4 B;  4W9C A;  4E74 A;  2N9P C;  2KMA A;  3ML9 A;  5JZE B;  2PPH A;  2N7E A;  2WWZ A;  2L0T A;  1E7V A;  2Z0E B;  4GMV A;  2MSE D;  4DHJ D;  4A20 A;  2FCS A;  2GBR A;  1WI0 A;  3KYC D;  1E5W A;  2FNJ B;  4BBN C;  1Y8R C;  3CST A;  1GJZ A;  3H6N A;  5LXI B;  5G2N A;  3WA0 A;  4MJS B;  3KUC B;  2JVC A;  3DBL I;  1I35 A;  2JZ3 B;  5JHA A;  5L83 A;  1E8Y A;  1YIW A;  2ZNV B;  3CSF A;  4GB9 A;  1V2Y A;  4BBN F;  2KNB A;  2JRH A;  1KOT A;  2KJR A;  3ZW3 A;  3H7P B;  2I1J A;  5J17 A;  2KFJ A;  3UIN B;  2L76 A;  2N9X A;  2DZK A;  1VCB A;  2IYD B;  4I6P A;  4ZRJ A;  2K25 A;  4GSW A;  2O6V A;  2XK5 A;  3R7R A;  4ASW C;  1OTR B;  3DVG Y;  3RZF A;  1WF9 A;  2KHW B;  1WYW B;  2AL6 A;  4NAW B;  1WXM A;  2LUE A;  2LGX A;  3NZS A;  3ZRC A;  4EZK A;  3DQV A;  1BT0 A;  5JHB A;  1OEY A;  4GIV A;  1WR6 E;  3ZUN A;  3ZVV A;  3A9J A;  1EO6 A;  3SD5 A;  3SU8 X;  2CU1 A;  5LXH A;  3L08 A;  2KDB A;  2KC2 A;  1C1Y B;  2Z59 B;  3OJ3 A;  4KVG B;  3DPD A;  2L3Z A;  3NHE B;  4I6N B;  2LVO A;  2NBV B;  4PS3 A;  2LRU A;  4KIK A;  2PEA A;  3N3K B;  2J0J A;  3DBS A;  4DDI D;  3PLU A;  1E90 A;  1OEY J;  3IHP C;  5D7G A;  5AZF A;  4EKU A;  3C0R B;  1ZKH A;  4ZRK A;  3N30 A;  1UH6 A;  1V6E A;  4IWQ A;  2Z0D B;  2L00 B;  3ONS A;  2L8J A;  3JW0 X;  2YVC A;  4HCP B;  5DCN A;  1E8X A;  2CS4 A;  1NI2 A;  2J0K A;  2JF5 A;  4WJQ A;  3T9L A;  2WX0 A;  4E71 A;  2OJR A;  4AJW A;  2ZVO A;  2D2Q A;  1G6J A;  2O2V B;  5BO4 B;  3L13 A;  3L16 A;  2KQ7 A;  2NS5 A;  3PT2 B;  3DOW A;  1FXT B;  4J6I A;  1LQB A;  3N32 A;  1WZ0 A;  2L7R A;  1GC6 A;  3ALB A;  5FR6 A;  3S2A A;  3U8Z A;  3B1L X;  4IUM B;  3R7Q A;  1E8Z A;  2ZJD A;  2BF8 B;  2NPT A;  4GU2 A;  1VD2 A;  1M94 A;  3WIM A;  4TKN A;  4IM2 A;  3ZKJ C;  5C1Z A;  2KKC A;  4MGY E;  4HK2 A;  1RLF A;  4F1S A;  2KFK B;  2KWU B;  3DVG X;  4BOS C;  3OLM D;  3RCZ A;  2LGD A;  5AZG A;  2BYV E;  4MDK E;  3KYD D;  4KSL C;  5AZH A;  1P98 A;  1GUA B;  5E6N A;  4HCN B;  2KTR A;  4G3X B;  2CHZ A;  3L54 A;  4GDK B;  4FLH A;  2C7N B;  3CF6 E;  2RR9 A;  4GN1 A;  4WJP A;  4AOF A;  1F9J A;  1H4R A;  3BY4 B;  1AAR A;  4LJP B;  3UQA A;  2AYO B;  5D6J B;  1TGZ B;  2VRR B;  4HJK A;  4PYU A;  2MWS B;  1GG3 A;  3AUL A;  1YQB A;  3EC8 A;  2CR5 A;  4G50 A;  2DYB A;  4ICV A;  2C9W B;  3B08 A;  3DVN V;  3DDC B;  3JVZ X;  2GMI C;  3ZDM C;  3A4S C;  3IVF A;  3TMP B;  4TQ0 A;  1QZE A;  2M17 A;  1EF1 A;  2NVU I;  4IM0 A;  1WFY A;  1WY8 A;  3VAW A;  2KC1 A;  3NOB A;  3L10 B;  4A3P A;  3QAQ A;  3VUX A;  2REX A;  1WXV A;  4MGZ E;  1Q5W B;  2CHW A;  3IG3 A;  3EHV A;  4BFR A;  2K6Q A;  1P3Q U;  2D3G A;  1YJ1 A;  4KZC A;  3ZLZ A;  1V81 A;  2KLG A;  3DBH I;  1PQS A;  2NBU A;  4LDT B;  4WAA A;  2KZR A;  4YL8 A;  3QX1 A;  3VHT C;  4MEM A;  4NAW A;  3VVW B;  3ZDT A;  2BGF A;  4XZ4 A;  3TJP A;  1WJU A;  2MP2 B;  4HPM B;  1SGH A;  1WR1 A;  2JRI B;  3PV1 A;  4W9L A;  3PRM B;  3KW5 B;  4HVB A;  2BKF A;  1V5T A;  3K9O B;  1EF5 A;  1J0G A;  3R66 C;  2J7Q B;  2JXX A;  2LAS A;  4XX5 A;  4PS8 A;  3UIP B;  3PHX B;  1Z2M A;  1WGD A;  1WJ4 A;  2IO1 B;  4F7Z A;  2MBO A;  5JH5 C;  4FHK A;  4W9J A;  1YD8 U;  5J2R A;  4B9K A;  1WX9 A;  3W1Y A;  3LDZ E;  3HIZ A;  3QIJ A;  3Q3F A;  4EFO A;  3X0W A;  3VQI A;  2MRP A;  3PZD A;  3RUI B;  5E6P A;  1OQY A;  2DZM A;  2LI5 A;  2DAF A;  4NQL B;  1R4M I;  1NDD A;  5CHV C;  3BIN A;  3PGE A;  3UIO B;  3PLV A;  2PE9 A;  2B3A A;  3AU5 A;  2GBM A;  4AUQ C;  4DDG D;  1UGM A;  2A4Z A;  1WX7 A;  2J0M A;  2KTF A;  2PE6 B;  3QA8 A;  2KMC A;  4KDL B;  3A9K B;  4GDL A;  4ANW A;  2ZCB A;  3H9D A;  2IZV B;  3WAP A;  1L7Y A;  1V86 A;  3V62 A;  1WH3 A;  2FUH B;  1J19 A;  3V6C B;  4PS7 A;  2CHX A;  1MG8 A;  3DVN U;  5L95 C;  1LFD A;  2EMT A;  2LZ6 A;  4G0N B;  2D10 A;  2XBB C;  3PSE B;  3RT3 B;  2KFK A;  3ZTC A;  1UD7 A;  4BKS D;  2M0X A;  1Q0W B;  1WXS A;  2G3Q B;  3A4R A;  2JPH A;  3KH0 A;  2KDE B;  1D3Z A;  2KDF B;  2N4F A;  1KJT A;  1WXA A;  2BWE S;  2RPQ A;  3APC A;  4IG7 B;  1IYF A;  1X1M A;  2R2Q A;  5IA7 A;  3PRZ A;  2JUO A;  4LCD E;  2D07 B;  3LJ3 A;  3ZNZ B;  3DBR I;  3VDZ A;  1WGH A;  2K8C A;  4K1R B;  5KHO A;  2IY1 B;  3OAW A;  4EUT A;  5J18 A;  1A5R A;  2MQJ A;  1LM8 B;  4FHJ A;  4W9K A;  2HD5 B;  1ISN A;  1WGY A;  2MLB A;  4DK5 A;  3HM6 X;  4JL9 A;  2N1V A;  3ENE A;  2MCN B;  1RFA A;  2KWV B;  2KAN A;  5CTR C;  2GOW A;  2IO0 B;  2MBB B;  2M1M A;  3W1S A;  4GOC A;  1I42 A;  4AJY B;  3RUL A;  4LJO B;  4K7U A;  4ZYN A;  2L05 A;  4DHZ E;  1XQQ A;  3MHS D;  3V6E B;  4E3C A;  2KXJ A;  4EOY A;  3RD2 A;  2RSU A;  2DZI A;  2ZPY A;  5DPT A;  1K8R B;  3UF8 A;  4B6W A;  2ZEQ A;  4URK A;  2GBJ A;  3M3J A;  1KLV A;  3PTF C;  2V4L A;  2V1Y A;  5G55 A;  4WWN A;  2DYM A;  4W9G A;  3VUW A;  4ANX A;  3WAN A;  2K6D B;  4JLC A;  2IBI B;  3ZNG C;  3QCA A;  1UEL A;  3AU4 A;  3QAR A;  4CYE A;  2FCQ A;  2MA9 B;  4WWP A;  2D11 A;  4PYZ A;  2QHO A;  4N9F 4;  3I3T B;  4CO7 A;  4KV2 A;  3VXW A;  4RM8 A;  2HE7 A;  3VTU A;  2DYO A;  2ZVN A;  4M8M A;  2DEN B;  2ZZP B;  4IWP A;  3A9J B;  3TCA A;  2KX0 A;  4EZJ A;  4KDI C;  4NPN A;  3M63 B;  4MJS A;  3KUZ A;  1GC7 A;  3V60 A;  4HPL B;  4XC2 A;  3L0W B;  4OVU A;  4W9H A;  5DPR A;  1WJN A;  1XT9 B;  4RM9 A;  1HE8 A;  4NJ6 A;  4MSQ B;  2JZZ A;  4KIK B;  1L2N A;  3H7P A;  1V5O A;  1JRU A;  2NCN A;  4ANV A;  3ZNI D;  5CHF A;  2BKR B;  2XEW A;  5LLI A;  3HHM A;  3MTN B;  3QC8 B;  4KSK C;  1S3S G;  4FUL A;  4JGH B;  2LVQ A;  4JQW C;  2LD9 A;  2KD0 A;  2LWP A;  1SE9 A;  2FIF A;  2ZNV C;  3GOE A;  3MJW A;  3T8M A;  2KO3 A;  2AEH A;  1SIF A;  2K1F A;  2C60 A;  4HWI B;  4NNJ B;  4F8C B;  1LXD A;  4IW0 A;  4BOZ B;  3VH4 B;  2V3S A;  3H1U A;  2LJ5 A;  2GBK A;  2FAZ A;  3WAL A;  2KJ6 A;  5HKH A;  2W9N A;  4IWO A;  1UBI A;  5CHW A;  3AI5 A;  3QK0 A;  1V80 A;  2JT4 B;  1RAX A;  1NBF C;  3A33 B;  4HDO A;  2N7D A;  3NY5 A;  2C5L C;  5D2M B;  4HLE A;  2RGF A;  5KHQ A;  2GBN A;  1Q1O A;  2WX1 A;  3CMM B;  3EEC A;  3SDL C;  2ZCC A;  2AL3 A;  2K8B A; 
#chains in the Genus database with same CATH topology
 3L4P A;  1VZ6 A;  2UWQ A;  4MM3 A;  4G11 A;  4WQO B;  4Q2J A;  1YNT E;  2FCN A;  1WM3 A;  2J53 A;  1AN8 A;  1XD3 B;  2X38 A;  3GZN I;  1WMH B;  2I1K A;  3D32 A;  4AWJ A;  2D3B A;  4A3O A;  3P2B A;  3TBL D;  2M8S A;  2KVR A;  4NY0 A;  4XDC A;  4AP4 C;  1UBQ A;  1EUV B;  1C4P A;  4K3C A;  1P7E A;  4GDK A;  4KZ0 A;  2J42 A;  4FJZ A;  1AYF A;  3WAO A;  1P0R A;  3ZRF A;  3M95 A;  4RMA A;  3ZNH B;  3LYY A;  4I6L B;  1L6U A;  4OVV A;  1WRD B;  4TV3 A;  1TT5 B;  2ONQ A;  2HJ8 A;  3Q3M C;  2K3U A;  2BB6 A;  2GLS A;  4MEL A;  2OOB B;  3NS8 A;  4EEW A;  4FJV B;  1PGA A;  1UZX B;  3NUH B;  3HM3 A;  4TQ1 A;  2WXO A;  3Q8C A;  3RNG C;  3MHZ A;  2WDR B;  2AQ1 B;  1KH0 A;  1WIA A;  1WX8 A;  5T8I A;  2BQQ A;  3DCG A;  3R3M A;  3VFK A;  2NR2 A;  2XK5 B;  3EA6 A;  2G4D B;  3ZTD A;  3L17 A;  3AE5 B;  3OG5 A;  1YX6 B;  4ZDV A;  2N9E B;  4DXA B;  5BYR A;  2AWT A;  4M8N A;  2EMS A;  2IO3 B;  3MC9 A;  1ZW7 A;  5E6O A;  5IOI A;  3RNF C;  2KQS A;  4NZL B;  2MW5 A;  1PFD A;  1JWM D;  2BWF A;  1YN5 A;  1IP9 A;  1LO5 D;  2K0P A;  3PS6 A;  2TSS A;  4K7W A;  1QLB B;  3SHQ A;  4CQN A;  4WJO A;  4B95 A;  1PGX A;  2WXF A;  2WDQ B;  2QJL A;  4EZL A;  2RDH A;  4GXB A;  1IBX B;  2V0G A;  2BYF A;  4ZHP A;  1DOY A;  2KWC A;  1ZP0 B;  1GNU A;  3HRD D;  2KTR B;  4W9C A;  3Q2A C;  2GI9 A;  3B2F A;  1E7V A;  1D5X C;  2Y5C A;  3KYC D;  2VZK B;  4MJS B;  2JZ3 B;  1HZ5 A;  1JML A;  1YIW A;  2M0A A;  1V2Y A;  2N7J A;  3N1Z C;  2LMC A;  3P4Q B;  2L76 A;  2N9X A;  1F2R C;  2O6V A;  3R7R A;  1OTR B;  2BS2 B;  4NAW B;  1EU4 A;  4GIV A;  4REZ A;  3ZUN A;  2PTL A;  3A9J A;  3SD5 A;  1R4N B;  3ZJU A;  2KC2 A;  3C8Y A;  2QCZ A;  4NAM A;  4KIK A;  4MT5 A;  2J0J A;  1D5Z C;  1E90 A;  3N1Y C;  1RM6 C;  4EKU A;  3N30 A;  3PO0 A;  2L8J A;  4XYC A;  3W2D A;  4WJQ A;  2JF5 A;  4E71 A;  1FXA A;  4MM3 B;  1G6J A;  3DOW A;  4J6I A;  3S2A A;  3N32 A;  1BXT A;  5FR6 A;  2BT6 A;  3B1L X;  4JWS C;  1WRI A;  2NPT A;  5BMG A;  1CJE A;  1VD2 A;  1M94 A;  2QDF A;  1T0Q C;  4IM2 A;  4MGY E;  3DVG X;  4OW0 A;  4YSY B;  3RCZ A;  2LFI A;  5AZG A;  2BYV E;  4MDK E;  5AZH A;  2K5P A;  3DBL B;  4GDK B;  3FAH A;  1IGD A;  3CF6 E;  2RR9 A;  4GN1 A;  4WJP A;  4AOF A;  4WUR A;  4US9 A;  5D6J B;  2VRR B;  3FIL A;  3IAM 1;  3V05 A;  2MWS B;  1GG3 A;  3AUL A;  2DYB A;  1QOB A;  3GP7 A;  3DVN V;  4EE2 A;  4B0E A;  2GMI C;  1JRO A;  4TQ0 A;  1D4B A;  3HVD A;  2IND C;  3DWM A;  3VAW A;  2KC1 A;  2AQ3 B;  1YN4 A;  2W3R A;  3NVY A;  1Q5W B;  3IG3 A;  2VH2 A;  4BFR A;  1YJ1 A;  4YL8 A;  3AE7 B;  4MEM A;  3VVW B;  2B76 B;  2M19 A;  2K9X A;  3TJP A;  2ZW0 A;  1SGH A;  1WR1 A;  2WNM A;  4L23 A;  1DYQ A;  4W9L A;  1C79 A;  3KW5 B;  3K9O B;  1EF5 A;  3R66 C;  2JXX A;  1F2R I;  1L5P A;  4PS8 A;  1WGD A;  1WJ4 A;  2IO1 B;  4RFB A;  5J2R A;  1T3Q A;  1WX9 A;  3HIZ A;  4K3B A;  2W54 A;  5E6P A;  1ZXI A;  2DAF A;  4YSX B;  2MH7 A;  3PGE A;  2PE9 A;  2B3A A;  4DDG D;  1QT9 A;  1ROE A;  2J0M A;  2PE6 B;  3QA8 A;  4ARC A;  1YOV B;  3Q8B A;  4GDL A;  2PLP A;  2SAK A;  2IPK D;  2FUH B;  3V6C B;  1MG8 A;  4RF1 A;  1TS5 A;  2XBB C;  2WP9 B;  2RDG A;  3Q8E A;  4BKS D;  1Q0W B;  2JPH A;  1D3Z A;  5H92 C;  1KJT A;  1WXA A;  1C77 A;  4LCD E;  3DBR I;  4M0W A;  3OAW A;  1FNV A;  4W9K A;  2MLB A;  4DQO C;  3HM6 X;  2N1V A;  1V1P B;  4XE0 A;  1T6B X;  2EEL A;  3AEE B;  3DBH B;  5CTR C;  2GOW A;  2MBB B;  3W1S A;  1I42 A;  2W82 A;  4K7U A;  4ZYN A;  2WXI A;  2KAJ A;  2DNF A;  3V6E B;  1J7C A;  1B1Z A;  4KGS A;  2ZPY A;  1VZ8 A;  5I4D A;  2V4L A;  2BS3 B;  2V1Y A;  3BYT B;  1SE4 A;  2DYM A;  3ZNG C;  2IBI B;  2Q5W D;  3RFZ B;  2FCQ A;  3ZYY X;  1E10 A;  4RGO S;  4WWM A;  1DGJ A;  4CO7 A;  3VTU A;  2DEN B;  3A9J B;  4ARI A;  3O13 A;  4KDI C;  4NPN A;  3KUZ A;  4XC2 A;  5FKA C;  1ET6 A;  3L0W B;  5DPR A;  4RM9 A;  4KIK B;  1V5O A;  1QOG A;  1YQ3 B;  3ZGZ A;  4JQW C;  3VRA B;  2KD0 A;  3GOE A;  3AH7 A;  3MJW A;  2PVO D;  3BZD B;  1FCC C;  1SIF A;  3OWE B;  4BOZ B;  1SSN A;  2DLB A;  1K52 A;  4RGT A;  1I4H A;  3H1U A;  3R2I A;  3WAL A;  3AEB B;  1E7P B;  2W9N A;  1NEK B;  3QK0 A;  1V80 A;  3A33 B;  2N7D A;  3NY5 A;  3UI3 A;  1HTO A;  2MJE A;  4BAX A;  2GBN A;  2WX1 A;  3EEC A;  2ZCC A;  4XWT A;  3AE1 B;  4MH0 E;  4WH4 A;  1ZDV A;  3TIX A;  2D3A A;  4IC7 B;  3Q3O C;  5CX3 A;  3IFW B;  1XLQ A;  3EFU A;  4HDQ A;  1XEE A;  2G4S A;  5DPS A;  4M01 A;  1MI0 A;  2L0F A;  2EKE C;  1C3T A;  4W9I A;  1WE7 A;  3N1X C;  3JSV B;  3ZQ4 A;  1IPG A;  2IO2 B;  3U30 A;  3N9Y C;  1XLP A;  1HZ6 A;  3MC8 A;  3WAM A;  2KT7 A;  3VTV A;  2Y3A A;  4K81 A;  5IAA C;  2WU5 B;  2AQ2 B;  3W1S C;  1JWU D;  2N9K A;  2QMT A;  2WDT B;  1P1A A;  2JY6 A;  3PRP B;  2JWZ A;  4ANU A;  2MP2 A;  4A8X C;  2Y5B B;  3IBE A;  2FID A;  3AMZ A;  1TBE A;  2QC8 A;  4GDL B;  3RNB C;  3ML8 A;  2N0S B;  3KVF B;  5IP4 D;  1HXY D;  1NEN B;  4JE3 B;  1TYG B;  3I57 A;  3APD A;  2NBW B;  4L1B A;  4W9E A;  3NVZ A;  3SFE B;  3EUB 2;  4BKS A;  1KM7 A;  3GZN B;  1ZOY B;  4WJN A;  4DHZ B;  3U7D A;  1UGJ A;  3RI7 C;  5DPW A;  1A70 A;  4DBG A;  4M0W B;  2BYT A;  1WGG A;  1TTN A;  3Q14 C;  3RNA C;  3A9K A;  1YX5 B;  2O6V D;  3PHW B;  1VJK A;  2X8X X;  4ITK A;  4LLG M;  2KK8 A;  1N60 A;  2ASQ A;  4GLS C;  2JYT A;  2DZJ A;  3ZXV A;  4C4V B;  1PYW D;  3A1Q A;  3QJZ A;  2C7M B;  2KN4 A;  2IY0 B;  1QF6 A;  1E7U A;  1DOX A;  4KX6 B;  1H8C A;  3Q3J A;  3QWZ B;  2K39 A;  1T0Y A;  4MGK E;  3E56 A;  4MGI E;  2KMA A;  3ML9 A;  5JZE B;  2M56 B;  2N7E A;  1L4Z B;  2MSE D;  1STE A;  4A20 A;  1WI0 A;  1E5W A;  3AEC B;  1Y8R C;  1UUP A;  4WQM A;  1RYJ A;  2ACZ B;  5L83 A;  5JHA A;  1P7F A;  2ZNV B;  2BB5 A;  2JRH A;  2KJR A;  3SFD B;  2I1J A;  1YJJ A;  3UIN B;  1XXG A;  1SE2 A;  4I6P A;  4ZRJ A;  2K25 A;  2CJO A;  4ASW C;  1WXM A;  2LGX A;  3ZRC A;  1K51 A;  4A9A A;  1CQV A;  1BT0 A;  4EZK A;  3SU8 X;  1YN3 A;  1EU3 A;  1SBB B;  3OJ3 A;  1WYG A;  1I4Q A;  4DDI D;  1OEY J;  3IHP C;  4YT0 B;  3C0R B;  1ZKH A;  4IWQ A;  5E6J A;  2L00 B;  2AX5 A;  4P1B C;  1T5X D;  5DCN A;  2YVC A;  3CWI A;  3T9L A;  2WX0 A;  4AJW A;  2D2Q A;  2KQ7 A;  4OZB A;  1FXT B;  2N9L A;  2L7R A;  3ALB A;  4P16 A;  4IUM B;  1E8Z A;  3FC4 A;  3AE4 B;  4ZRQ A;  1JQ4 A;  1HTQ A;  4TKN A;  1IUE A;  5C1Z A;  2INC C;  1VLB A;  2KFK B;  1SJH D;  3OLM D;  2OED A;  4KSL C;  3URY A;  3W9C B;  3L54 A;  4FLH A;  1MHH E;  2KMM A;  3Q8A A;  1N5X A;  4HJK A;  1M4V A;  3EC8 A;  4ICV A;  2JSV X;  1TZO A;  3GS2 A;  4OHJ A;  3V3X A;  3JVZ X;  3DHG C;  3A4S C;  3TMP B;  2M17 A;  1C78 A;  1EF1 A;  2NVU I;  1WFY A;  1WY8 A;  5BMI A;  1FCL A;  3DWG C;  4A3P A;  2REX A;  1WXV A;  2CHW A;  2K6Q A;  1P3Q U;  1PQS A;  4WAA A;  2KZR A;  2QIL A;  3MP9 A;  4TSS A;  4XZ4 A;  2JQR B;  2MP2 B;  3PV1 A;  3NVW A;  3I5J C;  1GB4 A;  2BKF A;  1Q10 A;  1J0G A;  1ET9 A;  1OQR A;  1QOF A;  4N58 A;  2JZP A;  1FNW A;  4IDI A;  4F7Z A;  2WXK A;  5JH5 C;  4FHK A;  4B0M A;  3QIJ A;  1ZE3 D;  3PZD A;  1OQY A;  2DZM A;  4C7Z A;  2LI5 A;  2L1A A;  1R4M I;  4LTU A;  3LB8 C;  2GBM A;  4AUQ C;  2A4Z A;  2KTF A;  4KDL B;  3GE8 C;  2LHD A;  3A9K B;  4ANW A;  2IZV B;  1TKY A;  1L7Y A;  4WIP A;  1WH3 A;  2CHX A;  5L95 C;  2E6X A;  3DVN U;  1LFD A;  2WGS A;  4G0N B;  2WXN A;  1FXI A;  4AS1 A;  1E6E B;  2W3S A;  3KH0 A;  1EWY C;  3LXF A;  2KDF B;  2IDY A;  3DHH C;  2D07 B;  3ZNZ B;  5BYS A;  1I4R A;  1WSP A;  3FKY A;  5FR3 A;  4C56 C;  4L2Y A;  1QQR A;  2D3C A;  2HD5 B;  1WGY A;  4R3D A;  4JL9 A;  3ENE A;  3P42 A;  1ZDX A;  3I63 C;  2IO0 B;  4AJY B;  2ICI A;  1I4G A;  3MHS D;  3BK1 A;  3Q6B A;  1N6Z A;  2IGD A;  3Q69 A;  3M3J A;  1KLV A;  3PTF C;  1JWA D;  5IO9 A;  4WWN A;  1XO3 A;  2WXJ A;  4JLC A;  3QCA A;  4OVZ A;  3QAR A;  2YEP F;  2V3P A;  4HKZ E;  3KWV A;  3Q8F A;  1I7H A;  2BBC A;  3VXW A;  3AE8 B;  4RM8 A;  2H89 B;  2ZVN A;  4M8M A;  2ZZP B;  4IWP A;  5EE1 A;  3TCA A;  1TS4 A;  2JU6 X;  4EZJ A;  3V60 A;  2HDE A;  1GC7 A;  1JCK B;  1E9M A;  2JZZ A;  3H7P A;  1JRU A;  4ANV A;  1SB3 C;  3ZNI D;  5CHF A;  1MFW A;  5LLI A;  2XEW A;  1KTK A;  3HHM A;  3MTN B;  2XN9 C;  4HKQ A;  1S3S G;  1KFY B;  2LVQ A;  3PZ8 A;  2LD9 A;  1ZUD 2;  2LWP A;  2FIF A;  3DBR B;  1N61 A;  3RNC C;  3NZ3 A;  3T8M A;  2K1F A;  5HG2 A;  3VH4 B;  2V3S A;  2QEJ C;  3W5V B;  2H88 B;  3J9C A;  1UBI A;  5CHW A;  3AI5 A;  2JT4 B;  2PKO A;  2WXQ A;  1EWC A;  2C5L C;  4HLE A;  2RGF A;  1XCT L;  3CMM B;  3SDL C;  2AL3 A;  3O65 B;  3VUY A;  3ZIM A;  4CHK A;  3NZU A;  2FUG 1;  2L32 A;  4HPP A;  4N59 A;  2O2V A;  5G5H A;  4XGA B;  2WDV B;  1FRD A;  4BZA A;  4NQK E;  1S1Q B;  4HRS A;  3M62 B;  5EE3 A;  3HVZ A;  2LRW A;  3X23 A;  4TUU A;  2PJH A;  4RNA A;  3ZO5 B;  1C9F A;  3NVV A;  2ZPN A;  2EKI A;  4X57 B;  2LGY A;  2WXP A;  4FAD A;  3BVG A;  5HI1 A;  1GOZ A;  3PVL A;  2JWU A;  3SR6 A;  1MJD A;  1TY0 A;  1WWT A;  2CKH B;  5TR5 A;  1XLN A;  4BKG A;  1TZ1 A;  2E3T A;  1L0X B;  4RCO A;  2KOX A;  2KWD A;  2Z8L A;  2BYE A;  1J8C A;  3E9S A;  4MSM B;  1L0Y B;  5AEK B;  3TUO A;  3VTW A;  2O6V B;  2BW2 A;  4HRO A;  2LGS A;  5C3J B;  3N20 C;  5AUI A;  2JX5 A;  2LEK A;  3T3N A;  1D6E C;  3R2T A;  1UWM A;  1NI3 A;  1FD6 A;  1E8W A;  3RZW C;  4II3 B;  4P1C C;  2KDI A;  3KUD B;  1V9J A;  1RFK A;  2WXH A;  1TIF A;  5D94 A;  1WMH A;  2CJN A;  1KLU D;  2FCM A;  4GGQ A;  1WJ6 A;  4YTM B;  2LXC A;  5GMV A;  2NPT B;  3AXC A;  4ICU A;  1FNU A;  4USA A;  2C7H A;  1AW7 A;  1ZGU B;  2KYW A;  3AED B;  5IKC M;  1L4D B;  2MBQ A;  2WYQ A;  2M4N A;  4C7Y A;  2PPH A;  2Z0E B;  3FIL B;  4GMV A;  4DHJ D;  2FNJ B;  4BBN C;  4JWU C;  1GJZ A;  3H6N A;  5LXI B;  3WA0 A;  3TEZ A;  3AE9 B;  3KUC B;  2JVC A;  4D2K A;  1I35 A;  1E8Y A;  1YQ4 B;  3CSF A;  4GB9 A;  1DOI A;  4YWG G;  4BBN F;  1KOT A;  3ZW3 A;  3H7P B;  5J17 A;  2KFJ A;  2KVZ A;  1OFF A;  1FM0 D;  4UDU C;  2DZK A;  2IYD B;  4GSW A;  2XK5 A;  1K50 A;  3EGR A;  1WYW B;  2AL6 A;  3NZS A;  3ABV B;  2QIE B;  1OEY A;  1ZXH A;  3NRZ A;  4RGM A;  2JXT A;  1WXQ A;  2CU1 A;  4ZYS A;  1FMA D;  4KVG B;  2L3Z A;  2LVO A;  2NBV B;  1MG4 A;  2LRU A;  4PS3 A;  1UH6 A;  2Z0D B;  1E8X A;  2ZVO A;  3PZ7 A;  2O2V B;  2ON8 A;  3L16 A;  1LQB A;  1GC6 A;  1RWS A;  1JWB D;  3R7Q A;  1YJI A;  2XNA C;  4LNF A;  1QKZ A;  3WIM A;  1HEZ E;  2KKC A;  4HK2 A;  3C19 A;  4F1S A;  2KWU B;  4BOS C;  3GB1 A;  1P98 A;  4IOI E;  2KTR A;  1FO4 A;  2FE8 A;  4G3X B;  2R61 A;  1F9J A;  3BY4 B;  1C4C A;  3UQA A;  1TGZ B;  3U52 E;  4PYU A;  1YQB A;  4G50 A;  2CR5 A;  1JRP A;  1F0Z A;  3RN9 C;  2C9W B;  3B08 A;  5GXG B;  4C80 A;  3IVF A;  1QZE A;  4IM0 A;  2D5G A;  2Y5P A;  3VR8 B;  3CIR B;  2V3N A;  3VUX A;  1MHX A;  3EHV A;  5BYQ A;  4KZC A;  2D3G A;  2KLG A;  1J7B A;  4LDT B;  4O1N A;  1J7A A;  1XLO A;  5JXV A;  5FK9 C;  4NAW A;  3ZDT A;  2IJ0 A;  1WJU A;  3HUI A;  3NG0 A;  4HPM B;  1V97 A;  4YXD B;  3PRM B;  2JYE A;  4ZRP A;  2WLB A;  1FFV A;  1V5T A;  1TKE A;  3UIP B;  5G5G A;  2FBW B;  2MBO A;  2L83 A;  4B9K A;  3LDZ E;  4EFO A;  2MRP A;  3RUI B;  1C76 A;  1YMH E;  4NQL B;  1NDD A;  1SJE D;  5CHV C;  3UIO B;  3UQB A;  3PLV A;  1UGM A;  5EE9 A;  4MH8 A;  3V62 A;  1UWX A;  1J19 A;  4PS7 A;  2NTT A;  2D10 A;  3PSE B;  3RT3 B;  3TSS A;  4DXF A;  3B9J A;  3ZTC A;  2M0X A;  1WXS A;  2G3Q B;  2KDE B;  4YTN B;  2RPQ A;  4IG7 B;  1IYF A;  1X1M A;  2R2Q A;  5IA7 A;  3PRZ A;  2JUO A;  1WGH A;  1I4P A;  4EUT A;  5J18 A;  4PK1 A;  2MQJ A;  2MJD A;  3RMK C;  1NVI D;  3BII D;  2VH1 A;  4FHJ A;  3AEF B;  4DK5 A;  2MCN B;  1RFA A;  2KWV B;  1SEB D;  2KAN A;  3Q3N C;  1FRR A;  1PDX A;  2M1M A;  4GOC A;  4LJO B;  4FXC A;  1XCQ L;  2L05 A;  4E3C A;  4EOY A;  5TSS A;  2RSU A;  2DZI A;  5DPT A;  1K8R B;  2ZEQ A;  2GBJ A;  1LGR A;  3P4S B;  5EE0 A;  1EM7 A;  3VUW A;  4YSZ B;  4ANX A;  3WAN A;  1UEL A;  2RMM A;  4CYE A;  4LNK A;  1R4M B;  4PYZ A;  5HHD G;  2OHF A;  2QHO A;  4A55 A;  3IXS A;  3VR9 B;  3IT6 B;  3NJT A;  1TJE A;  3P1M A;  1NYQ A;  3IT4 B;  2KX0 A;  4OZC A;  3M63 B;  1QOA A;  4HPL B;  4W9H A;  1XT9 B;  4NJ6 A;  2MEK A;  4MSQ B;  2NCN A;  1GAQ B;  4TMA B;  3TEX A;  3QC8 B;  3P4R B;  3DHI C;  2GB1 A;  4J3O D;  4ZHO A;  1L6V A;  1SE9 A;  2K22 A;  2WXM A;  5H8Y E;  2AEH A;  4NNJ B;  4F8C B;  4HWI B;  1LXD A;  5C2T B;  2LJ5 A;  2FAZ A;  2KJ6 A;  5HKH A;  2MJ3 A;  3ZJT A;  1ZPS A;  1V8C A;  1IGC A;  5D2M B;  2LHE A;  1D5M C;  1MVK A;  1N63 A;  4HJG E;  4LDT D;  4HXD A;  4JIO U;  3RPF C;  4DXG A;  1V1P A;  2BS4 B;  3GE3 C;  2KLC A;  2W55 A;  4JPS A;  4N6E B;  1BUI C;  1Z5S B;  3H7S A;  2YLM A;  2R2O A;  2LUM A;  4ZRI A;  1P9D U;  2NTS A;  1XF5 L;  2HTH A;  2A5U A;  4C00 A;  4LNI A;  4W9D A;  3W5U B;  2KN5 A;  4LNN A;  3A1Q B;  3RYT A;  4IM3 A;  2MX2 A;  3ZJV A;  3PRE A;  2G1E A;  4FN2 A;  4BKT A;  3AN1 A;  1WM2 A;  1FIQ A;  4BVU C;  2IGH A;  4WWO A;  3JYU A;  1BML C;  2UYZ B;  2KX3 A;  3NS1 A;  4RH6 A;  1VRA B;  2KJH B;  3ETR A;  3V61 A;  2MBH A;  3UGB B;  2G9H D;  3PPA A;  4NJ7 A;  4AQ7 A;  4K7S A;  2N1W A;  3U4E G;  1U4A A;  2LXA A;  1JWS D;  3H8H A;  4IKG A;  2DX5 B;  2PVG C;  2BPS A;  1CK1 A;  1WE6 A;  1OGW A;  4NJC A;  5EDS A;  4FJY A;  4P6V F;  2RD0 A;  3BVM A;  4FBJ B;  1F77 A;  1CMX B;  4KKJ A;  4H2A A;  3QHT A;  3B0A A;  4A6Q A;  2DHZ A;  2LVP A;  1K53 A;  3TL5 A;  4FA6 A;  1R4N I;  4W9F A;  1RRB A;  3U2S C;  3KQ4 A;  3HK0 A;  1V49 A;  2NMQ A;  2MBE A;  2YEP B;  3EFC A;  3APF A;  1WGR A;  3QQ8 B;  3AB5 A;  4DHJ B;  3VH3 B;  1R7S A;  4P7I A;  3ECI A;  1I4X A;  1V1O A;  2DAJ A;  3JSV A;  1ENF A;  1C4A A;  1KLG D;  2G45 B;  1WZ3 A;  3K9P B;  5C23 A;  4II2 B;  5AUK A;  2K8H A;  4DWF A;  3P63 A;  4E74 A;  3OJ4 B;  3I9V 1;  2N9P C;  3BVZ A;  4RGN A;  2WWZ A;  2L0T A;  4PT5 A;  1F1H A;  2PIA A;  3AEA B;  2FCS A;  2GBR A;  3CST A;  5G2N A;  2I38 A;  1WGK A;  3DBL I;  2KNB A;  2V4I B;  4LNO A;  2J4X A;  4S0R A;  1MPE A;  1VCB A;  3DVG Y;  4YTP B;  3RZF A;  1WF9 A;  2KHW B;  2LUE A;  3DQV A;  5JHB A;  1WR6 E;  1E0Z A;  3ZVV A;  1EO6 A;  3MFG A;  2VZK D;  3AEG B;  4KGR A;  5LXH A;  3KWL A;  3L08 A;  2KDB A;  3KLS X;  1C1Y B;  2Z59 B;  3DPD A;  4I6N B;  3NHE B;  2WXL A;  2PEA A;  3N3K B;  3U7Z A;  3DBS A;  1PGB A;  3IAS 1;  3PLU A;  1UNS A;  5D7G A;  5AZF A;  4QAY A;  4ZRK A;  1V6E A;  5IN7 A;  3ONS A;  3JW0 X;  2UU7 A;  4HCP B;  2CS4 A;  2J0K A;  1NI2 A;  2OJR A;  4XWW A;  2SEB D;  5BO4 B;  1QIL A;  3L13 A;  2WS3 B;  2NS5 A;  3PT2 B;  3U8Z A;  1WZ0 A;  3TEW A;  2ZJD A;  2BF8 B;  4LK0 M;  4GU2 A;  4C4V A;  3ZKJ C;  1B9R A;  1RLF A;  1FPY A;  2BVC A;  1KF6 B;  1GPX A;  2LGD A;  4ACF A;  2KQ4 X;  3KYD D;  2WU2 B;  1GUA B;  5E6N A;  4HCN B;  1Y56 A;  4JX1 C;  2CHZ A;  2HJ1 A;  2C7N B;  1H4R A;  1AAR A;  4LJP B;  2AYO B;  2INN E;  1GB1 A;  1ACC A;  3B2G A;  1VR9 A;  2RPV A;  3DDC B;  3MJ5 A;  3ZDM C;  4WAF A;  4RF0 A;  2DBY A;  2CU3 A;  3NOB A;  3L10 B;  2GRI A;  3QAQ A;  4MGZ E;  2WQY B;  1T0R C;  3ZLZ A;  1V81 A;  3VHT C;  3DBH I;  2NBU A;  3QX1 A;  2WXG A;  2BGF A;  2IGG A;  3VRB B;  1FEH A;  2J52 A;  2JRI B;  4HVB A;  2J7Q B;  2LAS A;  4XX5 A;  3PHX B;  5D3D A;  1Z2M A;  5D3I B;  3RNE C;  1F52 A;  2KDM A;  4W9J A;  1N62 A;  3TEY A;  1YD8 U;  3W1Y A;  2WXR A;  3Q3F A;  4ZOH C;  3X0W A;  3VQI A;  1ESF A;  3AE6 B;  1SIJ A;  1TS3 A;  3MC0 B;  1HQR D;  3BIN A;  3AU5 A;  2LJI A;  1WX7 A;  2KMC A;  5MPO A;  2ZCB A;  3BWU D;  3H9D A;  3WAP A;  1SF0 A;  1V86 A;  5BMH A;  1JAL A;  2EMT A;  1FFU A;  2LZ6 A;  2KFK A;  2DWQ A;  2QSD A;  1UD7 A;  3A4R A;  2N4F A;  2BWE S;  3APC A;  3LJ3 A;  1JW9 D;  2K8C A;  5KHO A;  4K1R B;  3VDZ A;  2IY1 B;  1A5R A;  1LM8 B;  1L0V B;  1ISN A;  2KAC A;  3SEB A;  2ZW1 A;  3BK2 A;  2BTE A;  3RUL A;  3BYY B;  4DHZ E;  1XQQ A;  2MHJ A;  2KXJ A;  3RD2 A;  4URK A;  4B6W A;  3AE2 B;  3UF8 A;  1CZP A;  3AE3 B;  4A90 A;  1IBX A;  3T3O A;  2PMV A;  5LNK 1;  1SE3 A;  1TS2 A;  5G55 A;  3AV8 A;  3AM9 A;  4XDD A;  4MAC A;  4W9G A;  4KGT A;  2K6D B;  3AU4 A;  2MA9 B;  1KRH A;  4WWP A;  2HTM E;  4M02 A;  2RDB C;  2D11 A;  1PUT A;  4N9F 4;  3I3T B;  4KV2 A;  2HE7 A;  2DYO A;  2I2Y A;  3ZXR A;  1T0S C;  2L52 A;  4MJS A;  4S17 A;  1OQQ A;  4OVU A;  1WJN A;  1VDV A;  1HE8 A;  3P4P B;  1N5W A;  1AWD A;  1L2N A;  4US8 A;  1TY2 A;  2PW9 A;  2BKR B;  2LGI A;  4OZA A;  2V9H A;  4KSK C;  2WHI A;  4FUL A;  4JGH B;  1VZ7 A;  2ZNV C;  1NYR A;  1SXT A;  2INP E;  2KO3 A;  2C60 A;  4M00 A;  4IW0 A;  4KKI A;  2GBK A;  3R8B A;  2OJW A;  4IWO A;  3WCQ A;  1RAX A;  1NBF C;  1TKG A;  4HDO A;  5HFY A;  1UF0 A;  1HA5 A;  5KHQ A;  1Q1O A;  4HEA 1;  2K8B A; 
#chains in the Genus database with same CATH homology
 3O65 B;  4LDT D;  3VUY A;  4HXD A;  3ZIM A;  4JIO U;  4CHK A;  3NZU A;  2UWQ A;  2KLC A;  4MM3 A;  2O2V A;  4MH0 E;  4G11 A;  4WQO B;  4NQK E;  2FCN A;  1S1Q B;  3TIX A;  1Z5S B;  3M62 B;  4IC7 B;  1WM3 A;  3H7S A;  1XD3 B;  5CX3 A;  2YLM A;  3IFW B;  3GZN I;  2R2O A;  1WMH B;  2I1K A;  2LRW A;  3D32 A;  4ZRI A;  4AWJ A;  3X23 A;  1P9D U;  3EFU A;  4A3O A;  4TUU A;  3P2B A;  4HDQ A;  3TBL D;  2M8S A;  2PJH A;  2HTH A;  2KVR A;  3ZO5 B;  2G4S A;  5DPS A;  4NY0 A;  2A5U A;  2ZPN A;  2L0F A;  2EKE C;  4AP4 C;  1UBQ A;  1EUV B;  4X57 B;  2LGY A;  1C3T A;  4W9D A;  2KN5 A;  4W9I A;  3A1Q B;  4GDK A;  4FAD A;  3RYT A;  1WE7 A;  4IM3 A;  2MX2 A;  3JSV B;  4KZ0 A;  3PRE A;  4FJZ A;  3WAO A;  3ZRF A;  1IPG A;  1P0R A;  3M95 A;  2IO2 B;  4RMA A;  4FN2 A;  3PVL A;  4BKT A;  3ZNH B;  1WM2 A;  4BVU C;  4I6L B;  3U30 A;  4OVV A;  1WRD B;  4TV3 A;  4WWO A;  3JYU A;  2UYZ B;  2HJ8 A;  2KX3 A;  3WAM A;  2CKH B;  3VTV A;  4MEL A;  5TR5 A;  4BKG A;  4K81 A;  2OOB B;  5IAA C;  3NS8 A;  1TZ1 A;  4EEW A;  4FJV B;  2KJH B;  3V61 A;  2MBH A;  1UZX B;  3UGB B;  3HM3 A;  2KOX A;  3PPA A;  4NJ7 A;  3W1S C;  2WDT B;  1P1A A;  4TQ1 A;  2JY6 A;  2BYE A;  3PRP B;  1J8C A;  4K7S A;  2JWZ A;  4ANU A;  2MP2 A;  4MSM B;  2Y5B B;  2N1W A;  3IBE A;  2FID A;  1U4A A;  1WIA A;  1WX8 A;  2LXA A;  5AEK B;  3R3M A;  1TBE A;  3DCG A;  4GDL B;  3VFK A;  3VTW A;  3ML8 A;  2NR2 A;  3KVF B;  2O6V B;  2XK5 B;  2G4D B;  3ZTD A;  2DX5 B;  2BPS A;  3L17 A;  3APD A;  2NBW B;  1WE6 A;  1YX6 B;  4W9E A;  4ZDV A;  2N9E B;  4DXA B;  1OGW A;  2AWT A;  4M8N A;  4BKS A;  4FJY A;  1KM7 A;  2EMS A;  2IO3 B;  5EDS A;  1ZW7 A;  2RD0 A;  5E6O A;  4FBJ B;  4WJN A;  4DHZ B;  3U7D A;  1E8W A;  1CMX B;  3UQB A;  5DPW A;  2KQS A;  4DBG A;  4M0W B;  2MW5 A;  3RZW C;  1WGG A;  1TTN A;  4II3 B;  2BWF A;  3QHT A;  3B0A A;  2KDI A;  1IP9 A;  3A9K A;  2DHZ A;  2LVP A;  3KUD B;  3TL5 A;  1V9J A;  4FA6 A;  1YX5 B;  2O6V D;  3PHW B;  1R4N I;  4W9F A;  5D94 A;  1RRB A;  3PS6 A;  1WMH A;  4K7W A;  3HK0 A;  1V49 A;  2FCM A;  4GGQ A;  3SHQ A;  2KK8 A;  1WJ6 A;  2MBE A;  4WJO A;  4B95 A;  2LXC A;  2ASQ A;  3APF A;  1WGR A;  3QQ8 B;  4DHJ B;  4EZL A;  3VH3 B;  5GMV A;  2DZJ A;  2NPT B;  3AXC A;  4ICU A;  4P7I A;  3ECI A;  4GXB A;  2C7H A;  3A1Q A;  2DAJ A;  3JSV A;  3QJZ A;  1ZGU B;  2BYF A;  2C7M B;  2IY0 B;  2G45 B;  1WZ3 A;  3K9P B;  1E7U A;  2KWC A;  2MBQ A;  5C23 A;  1H8C A;  4II2 B;  3Q3J A;  2K8H A;  3QWZ B;  2K39 A;  4DWF A;  1GNU A;  1T0Y A;  4MGK E;  2KTR B;  2M4N A;  2WYQ A;  4MGI E;  3OJ4 B;  4W9C A;  4E74 A;  2N9P C;  2KMA A;  3ML9 A;  5JZE B;  2PPH A;  2N7E A;  2WWZ A;  2L0T A;  1E7V A;  2Z0E B;  4GMV A;  2MSE D;  4DHJ D;  4A20 A;  2FCS A;  2GBR A;  1WI0 A;  3KYC D;  1E5W A;  2FNJ B;  4BBN C;  1Y8R C;  3CST A;  1GJZ A;  3H6N A;  5LXI B;  5G2N A;  3WA0 A;  4MJS B;  3KUC B;  2JVC A;  3DBL I;  1I35 A;  2JZ3 B;  5JHA A;  5L83 A;  1E8Y A;  1YIW A;  2ZNV B;  3CSF A;  4GB9 A;  1V2Y A;  4BBN F;  2KNB A;  2JRH A;  1KOT A;  2KJR A;  3ZW3 A;  3H7P B;  2I1J A;  5J17 A;  2KFJ A;  3UIN B;  2L76 A;  2N9X A;  2DZK A;  1VCB A;  2IYD B;  4I6P A;  4ZRJ A;  2K25 A;  4GSW A;  2O6V A;  2XK5 A;  3R7R A;  4ASW C;  1OTR B;  3DVG Y;  3RZF A;  1WF9 A;  2KHW B;  1WYW B;  2AL6 A;  4NAW B;  1WXM A;  2LUE A;  2LGX A;  3NZS A;  3ZRC A;  4EZK A;  3DQV A;  1BT0 A;  5JHB A;  1OEY A;  4GIV A;  1WR6 E;  3ZUN A;  3ZVV A;  3A9J A;  1EO6 A;  3SD5 A;  3SU8 X;  2CU1 A;  5LXH A;  3L08 A;  2KDB A;  2KC2 A;  1C1Y B;  2Z59 B;  3OJ3 A;  4KVG B;  3DPD A;  2L3Z A;  3NHE B;  4I6N B;  2LVO A;  2NBV B;  4PS3 A;  2LRU A;  4KIK A;  2PEA A;  3N3K B;  2J0J A;  3DBS A;  4DDI D;  3PLU A;  1E90 A;  1OEY J;  3IHP C;  5D7G A;  5AZF A;  4EKU A;  3C0R B;  1ZKH A;  4ZRK A;  3N30 A;  1UH6 A;  1V6E A;  4IWQ A;  2Z0D B;  2L00 B;  3ONS A;  2L8J A;  3JW0 X;  2YVC A;  4HCP B;  5DCN A;  1E8X A;  2CS4 A;  1NI2 A;  2J0K A;  2JF5 A;  4WJQ A;  3T9L A;  2WX0 A;  4E71 A;  2OJR A;  4AJW A;  2ZVO A;  2D2Q A;  1G6J A;  2O2V B;  5BO4 B;  3L13 A;  3L16 A;  2KQ7 A;  2NS5 A;  3PT2 B;  3DOW A;  1FXT B;  4J6I A;  1LQB A;  3N32 A;  1WZ0 A;  2L7R A;  1GC6 A;  3ALB A;  5FR6 A;  3S2A A;  3U8Z A;  3B1L X;  4IUM B;  3R7Q A;  1E8Z A;  2ZJD A;  2BF8 B;  2NPT A;  4GU2 A;  1VD2 A;  1M94 A;  3WIM A;  4TKN A;  4IM2 A;  3ZKJ C;  5C1Z A;  2KKC A;  4MGY E;  4HK2 A;  1RLF A;  4F1S A;  2KFK B;  2KWU B;  3DVG X;  4BOS C;  3OLM D;  3RCZ A;  2LGD A;  5AZG A;  2BYV E;  4MDK E;  3KYD D;  4KSL C;  5AZH A;  1P98 A;  1GUA B;  5E6N A;  4HCN B;  2KTR A;  4G3X B;  2CHZ A;  3L54 A;  4GDK B;  4FLH A;  2C7N B;  3CF6 E;  2RR9 A;  4GN1 A;  4WJP A;  4AOF A;  1F9J A;  1H4R A;  3BY4 B;  1AAR A;  4LJP B;  3UQA A;  2AYO B;  5D6J B;  1TGZ B;  2VRR B;  4HJK A;  4PYU A;  2MWS B;  1GG3 A;  3AUL A;  1YQB A;  3EC8 A;  2CR5 A;  4G50 A;  2DYB A;  4ICV A;  2C9W B;  3B08 A;  3DVN V;  3DDC B;  3JVZ X;  2GMI C;  3ZDM C;  3A4S C;  3IVF A;  3TMP B;  4TQ0 A;  1QZE A;  2M17 A;  1EF1 A;  2NVU I;  4IM0 A;  1WFY A;  1WY8 A;  3VAW A;  2KC1 A;  3NOB A;  3L10 B;  4A3P A;  3QAQ A;  3VUX A;  2REX A;  1WXV A;  4MGZ E;  1Q5W B;  2CHW A;  3IG3 A;  3EHV A;  4BFR A;  2K6Q A;  1P3Q U;  2D3G A;  1YJ1 A;  4KZC A;  3ZLZ A;  1V81 A;  2KLG A;  3DBH I;  1PQS A;  2NBU A;  4LDT B;  4WAA A;  2KZR A;  4YL8 A;  3QX1 A;  3VHT C;  4MEM A;  4NAW A;  3VVW B;  3ZDT A;  2BGF A;  4XZ4 A;  3TJP A;  1WJU A;  2MP2 B;  4HPM B;  1SGH A;  1WR1 A;  2JRI B;  3PV1 A;  4W9L A;  3PRM B;  3KW5 B;  4HVB A;  2BKF A;  1V5T A;  3K9O B;  1EF5 A;  1J0G A;  3R66 C;  2J7Q B;  2JXX A;  2LAS A;  4XX5 A;  4PS8 A;  3UIP B;  3PHX B;  1Z2M A;  1WGD A;  1WJ4 A;  2IO1 B;  4F7Z A;  2MBO A;  5JH5 C;  4FHK A;  4W9J A;  1YD8 U;  5J2R A;  4B9K A;  1WX9 A;  3W1Y A;  3LDZ E;  3HIZ A;  3QIJ A;  3Q3F A;  4EFO A;  3X0W A;  3VQI A;  2MRP A;  3PZD A;  3RUI B;  5E6P A;  1OQY A;  2DZM A;  2LI5 A;  2DAF A;  4NQL B;  1R4M I;  1NDD A;  5CHV C;  3BIN A;  3PGE A;  3UIO B;  3PLV A;  2PE9 A;  2B3A A;  3AU5 A;  2GBM A;  4AUQ C;  4DDG D;  1UGM A;  2A4Z A;  1WX7 A;  2J0M A;  2KTF A;  2PE6 B;  3QA8 A;  2KMC A;  4KDL B;  3A9K B;  4GDL A;  4ANW A;  2ZCB A;  3H9D A;  2IZV B;  3WAP A;  1L7Y A;  1V86 A;  3V62 A;  1WH3 A;  2FUH B;  1J19 A;  3V6C B;  4PS7 A;  2CHX A;  1MG8 A;  3DVN U;  5L95 C;  1LFD A;  2EMT A;  2LZ6 A;  4G0N B;  2D10 A;  2XBB C;  3PSE B;  3RT3 B;  2KFK A;  3ZTC A;  1UD7 A;  4BKS D;  2M0X A;  1Q0W B;  1WXS A;  2G3Q B;  3A4R A;  2JPH A;  3KH0 A;  2KDE B;  1D3Z A;  2KDF B;  2N4F A;  1KJT A;  1WXA A;  2BWE S;  2RPQ A;  3APC A;  4IG7 B;  1IYF A;  1X1M A;  2R2Q A;  5IA7 A;  3PRZ A;  2JUO A;  4LCD E;  2D07 B;  3LJ3 A;  3ZNZ B;  3DBR I;  3VDZ A;  1WGH A;  2K8C A;  4K1R B;  5KHO A;  2IY1 B;  3OAW A;  4EUT A;  5J18 A;  1A5R A;  2MQJ A;  1LM8 B;  4FHJ A;  4W9K A;  2HD5 B;  1ISN A;  1WGY A;  2MLB A;  4DK5 A;  3HM6 X;  4JL9 A;  2N1V A;  3ENE A;  2MCN B;  1RFA A;  2KWV B;  2KAN A;  5CTR C;  2GOW A;  2IO0 B;  2MBB B;  2M1M A;  3W1S A;  4GOC A;  1I42 A;  4AJY B;  3RUL A;  4LJO B;  4K7U A;  4ZYN A;  2L05 A;  4DHZ E;  1XQQ A;  3MHS D;  3V6E B;  4E3C A;  2KXJ A;  4EOY A;  3RD2 A;  2RSU A;  2DZI A;  2ZPY A;  5DPT A;  1K8R B;  3UF8 A;  4B6W A;  2ZEQ A;  4URK A;  2GBJ A;  3M3J A;  1KLV A;  3PTF C;  2V4L A;  2V1Y A;  5G55 A;  4WWN A;  2DYM A;  4W9G A;  3VUW A;  4ANX A;  3WAN A;  2K6D B;  4JLC A;  2IBI B;  3ZNG C;  3QCA A;  1UEL A;  3AU4 A;  3QAR A;  4CYE A;  2FCQ A;  2MA9 B;  4WWP A;  2D11 A;  4PYZ A;  2QHO A;  4N9F 4;  3I3T B;  4CO7 A;  4KV2 A;  3VXW A;  4RM8 A;  2HE7 A;  3VTU A;  2DYO A;  2ZVN A;  4M8M A;  2DEN B;  2ZZP B;  4IWP A;  3A9J B;  3TCA A;  2KX0 A;  4EZJ A;  4KDI C;  4NPN A;  3M63 B;  4MJS A;  3KUZ A;  1GC7 A;  3V60 A;  4HPL B;  4XC2 A;  3L0W B;  4OVU A;  4W9H A;  5DPR A;  1WJN A;  1XT9 B;  4RM9 A;  1HE8 A;  4NJ6 A;  4MSQ B;  2JZZ A;  4KIK B;  1L2N A;  3H7P A;  1V5O A;  1JRU A;  2NCN A;  4ANV A;  3ZNI D;  5CHF A;  2BKR B;  2XEW A;  5LLI A;  3HHM A;  3MTN B;  3QC8 B;  4KSK C;  1S3S G;  4FUL A;  4JGH B;  2LVQ A;  4JQW C;  2LD9 A;  2KD0 A;  2LWP A;  1SE9 A;  2FIF A;  2ZNV C;  3GOE A;  3MJW A;  3T8M A;  2KO3 A;  2AEH A;  1SIF A;  2K1F A;  2C60 A;  4HWI B;  4NNJ B;  4F8C B;  1LXD A;  4IW0 A;  4BOZ B;  3VH4 B;  2V3S A;  3H1U A;  2LJ5 A;  2GBK A;  2FAZ A;  3WAL A;  2KJ6 A;  5HKH A;  2W9N A;  4IWO A;  1UBI A;  5CHW A;  3AI5 A;  3QK0 A;  1V80 A;  2JT4 B;  1RAX A;  1NBF C;  3A33 B;  4HDO A;  2N7D A;  3NY5 A;  2C5L C;  5D2M B;  4HLE A;  2RGF A;  5KHQ A;  2GBN A;  1Q1O A;  2WX1 A;  3CMM B;  3EEC A;  3SDL C;  2ZCC A;  2AL3 A;  2K8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...