2M4NA

Solution structure of the putative ras interaction domain of afd-1, isoform a from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords Protein AFD-1, isoform a
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m4nA00
4KDLB 3PRMB 1P9DU 2PEAA 4IUMB 5CHVC 2N7DA 2O6VA 3NZUA 2WX0A 1E5WA 4ZDVA 4K81A 3ZNID 4EZKA 1RLFA 4W9FA 4FBJB 1WGRA 4HPMB 2MP2A 2ZNVB 2ZPNA 1WX7A 4RM9A 4GIVA 3JW0X 3A1QB 1XD3B 1T0YA 2K8HA 3H7PB 4HLEA 4ZYNA 2M0XA 2KDBA 2KTRA 3APCA 1V86A 2MBQA 2R2QA 3TMPB 3L16A 3M63B 4WWPA 2AYOB 1NDDA 1R4NI 3ZRFA 2J0JA 3PLUA 4ANVA 4NPNA 4WAAA 4AWJA 3ZVVA 3DQVA 3PV1A 3UQBA 2C9WB 3KW5B 4HXDA 5CHFA 4ASWC 4E71A 1E8XA 3JSVB 1UH6A 1YIWA 4E74A 3L08A 2PE9A 3NOBA 2K6DB 2XK5A 2KK8A 3ZRCA 2PPHA 4TQ0A 2KTFA 4WJPA 2JZ3B 2BWES 4IC7B 4KZ0A 2K25A 4KZCA 5LXIB 1GJZA 3APDA 4NY0A 2L00B 2BYVE 4WWNA 1LXDA 3RUIB 2N9EB 3UF8A 2L7RA 1Q0WB 3PT2B 4FJYA 1WR1A 2MQJA 1KLVA 2KC2A 2GBRA 1SGHA 2Z0DB 4GGQA 2IO0B 2ZNVC 5TR5A 1WXVA 3M62B 4GSWA 1WXMA 3RZWC 3QARA 4BBNC 3ZLZA 1UELA 4FADA 5DPRA 1NI2A 1WFYA 5FR6A 3VUYA 3VDZA 3KUZA 2O2VA 3ENEA 2KMAA 4PS3A 4IW0A 2JT4B 2EMSA 2KDFB 3TCAA 4X57B 1L7YA 3HHMA 1XQQA 3DVGY 3WIMA 3NS8A 4EKUA 2A5UA 1WJ4A 4ZRKA 2KC1A 4EOYA 3B0AA 4M0WB 1ISNA 2MCNB 3VUXA 3WAPA 1OTRB 2D3GA 2FAZA 3ZTCA 4EZLA 3HIZA 5CX3A 3UINB 4MEMA 3M3JA 3GZNI 2BYEA 2KX0A 2DHZA 3C0RB 2LASA 1IYFA 3CSTA 4XZ4A 4FA6A 3NZSA 2BPSA 2MBHA 1CMXB 4E3CA 1YD8U 3AULA 1IP9A 2L0FA 1M94A 4BKTA 3TJPA 3ZW3A 1HE8A 1KM7A 3W1YA 1GC6A 1UBQA 2FCMA 1P1AA 2JVCA 1E8YA 5D7GA 2V4LA 3EHVA 5GMVA 5J18A 4ZRJA 4ZRIA 4IWOA 3UQAA 2NPTA 2NVUI 4GU2A 2NPTB 4WWOA 1KOTA 4TV3A 4EEWA 1WJNA 3PZDA 4JLCA 3TIXA 1S1QB 2V3SA 4K7SA 1EF1A 2LWPA 2O6VB 2HTHA 4FHJA 4DK5A 3DOWA 3JSVA 4PS7A 1UD7A 1WIAA 4KIKB 1OGWA 3EC8A 1SIFA 2KXJA 3ZDTA 3PREA 2LZ6A 1WZ0A 3AXCA 4K7WA 2ZEQA 3A4RA 1K8RB 2JXXA 2LD9A 2ZVNA 2KFJA 1E8WA 2DZKA 4EFOA 3QC8B 4G11A 1WZ3A 4WJNA 5KHQA 2M4NA 1JRUA 2GBJA 3QCAA 4NAWA 3OAWA 1FXTB 2KVRA 3ZNGC 2G3QB 1UZXB 5G55A 1L2NA 2RGFA 2G4DB 2OOBB 4DWFA 1H4RA 2LI5A 1ZGUB 2AL3A 4I6NB 1C1YB 2MSED 4LDTB 4NJ7A 4FLHA 1WGGA 1TZ1A 4FN2A 4ANUA 1C3TA 1RRBA 3K9PB 2KLGA 2CHXA 2KKCA 1WM2A 2KHWB 2KJ6A 3DBSA 3WA0A 2C7MB 3I3TB 1TBEA 1V49A 3L54A 2K8BA 3A9JA 3AU4A 2MWSB 2DYBA 5DPSA 4DXAB 3BY4B 3RULA 3QWZB 1WRDB 1U4AA 4W9LA 3JYUA 2JWZA 3JVZX 3VAWA 2KOXA 4W9GA 2KWUB 2L8JA 4MGKE 2CKHB 2EKEC 2LVQA 4BFRA 1WGDA 4GOCA 3DPDA 1WXSA 2KQ7A 4RM8A 4BVUC 4MJSB 4W9KA 2KLCA 4GDLA 5D2MB 4PS8A 3IFWB 5J17A 2ASQA 2G4SA 3S2AA 2KWVB 3HM3A 4BBNF 2REXA 4PYZA 5E6OA 3TL5A 4MH0E 3VTVA 2IO3B 3H1UA 5JH5C 2L0TA 3SHQA 2LRUA 3PSEB 3RD2A 3QJZA 3N30A 2WYQA 1H8CA 2LUEA 4A20A 2FIDA 2BYFA 2HJ8A 2KMCA 4BOSC 4N9F4 4BKSD 4PYUA 4KV2A 2IYDB 3PRZA 4GDKA 2M17A 1LM8B 2A4ZA 5C1ZA 3QA8A 2BWFA 3HK0A 2KFKA 4NJ6A 4AP4C 3A9KB 4XX5A 3L17A 2KX3A 4RMAA 2FIFA 4KDIC 1WMHB 1WE6A 2KFKB 1V80A 1V9JA 3V60A 3QX1A 4B6WA 3VUWA 2ZCBA 5D6JB 2K8CA 1Y8RC 2DAJA 4CYEA 3ZNHB 2RSUA 1KJTA 3V61A 1TTNA 3DDCB 3WAOA 3QIJA 2YLMA 4JL9A 3PLVA 2KD0A 2ZVOA 4W9CA 4HVBA 1LFDA 2JUOA 2DZIA 2C5LC 2IY0B 3A33B 3H7PA 2D10A 4IWQA 3QHTA 2D07B 2M1MA 4KVGB 3VFKA 5AZGA 2MLBA 4URKA 1OQYA 2GBNA 2NCNA 2J7QB 2KN5A 4FJZA 4NNJB 2LJ5A 3WAMA 1RAXA 2I1JA 2BKRB 3R66C 4FJVB 4AOFA 1WGHA 4AJWA 4I6LB 2KANA 2CU1A 2UYZB 3VXWA 4LCDE 3ML9A 1G6JA 2XEWA 5CTRC 1WI0A 2LXCA 3VH4B 5EDSA 2MRPA 1WX9A 1V5TA 1V6EA 2JY6A 3LDZE 2BKFA 1J0GA 2J0MA 3ZTDA 2D11A 5IA7A 4WJOA 3B1LX 5CHWA 3OLMD 5HKHA 2C60A 4B9KA 2JRIB 4P7IA 5AZFA 3DVNV 4GB9A 2M8SA 3VHTC 4HJKA 4HDOA 2GOWA 3UGBB 2GMIC 1TGZB 2PJHA 3CSFA 1S3SG 4HDQA 3L13A 1J19A 4MSMB 3UIPB 2IO2B 2W9NA 2BGFA 2K39A 2MX2A 2V1YA 1P98A 4IM0A 4WJQA 1GG3A 3H6NA 3KH0A 3DCGA 4WQOB 2K6QA 4JQWC 3R7QA 3Q3FA 2RPQA 4MDKE 4W9EA 4B95A 2RR9A 3PTFC 4YL8A 1WYWB 3AU5A 3PPAA 2N1WA 2AEHA 2DENB 2GBMA 1MG8A 5JHBA 1WGYA 2CS4A 4G3XB 1Q1OA 4DDGD 4F7ZA 3IHPC 3MHSD 1WH3A 4DHZB 5E6NA 3DVGX 3PHWB 3M95A 2KO3A 2IZVB 2DAFA 2KDIA 2C7HA 2KJHB 3D32A 2UWQA 4OVUA 4XC2A 1AARA 2ZJDA 3N3KB 3SDLC 2WDTB 3A1QA 2FNJB 3DVNU 4I6PA 4BKSA 4DDID 1E7VA 3CF6E 2N4FA 5DCNA 5AZHA 3VTWA 3IG3A 3QAQA 4ANWA 1IPGA 1Z5SB 3T8MA 4GDLB 1LQBA 1EF5A 2N1VA 3SU8X 2MBEA 2MA9B 1UBIA 4IM2A 4J6IA 2CHZA 3O65B 3KUCB 2N9XA 2FCQA 4NQKE 1E7UA 2FCNA 2O2VB 3KYCD 4OVVA 2O6VD 2YVCA 3KUDB 3ZUNA 4DHJD 5J2RA 1GUAB 3KVFB 5BO4B 2Y5BB 1WE7A 4W9IA 5G2NA 3IBEA 1WMHA 1WJUA 3RZFA 3K9OB 4K7UA 4W9JA 1E8ZA 1WM3A 4LJPB 1YJ1A 3V6EB 3EECA 1RFAA 4GN1A 4CHKA 4IWPA 3ECIA 3VQIA 3LJ3A 4W9DA 3R3MA 1V81A 2LVOA 2R2OA 2N7EA 3N32A 4HK2A 4M8NA 4HCNB 3X23A 4F1SA 4II2B 2LXAA 1XT9B 1YX5B 4KSLC 4BKGA 2Z59B 3PGEA 2DYMA 5D94A 5IAAC 3T9LA 4LDTD 1F9JA 1PQSA 2DZMA 4K1RB 5JZEB 2MW5A 4MJSA 2IY1B 2D2QA 1ZKHA 2NBUA 2DZJA 4HWIB 3BINA 3B08A 1V5OA 3H9DA 3WALA 1UGMA 1P0RA 4GMVA 5C23A 3RT3B 2KJRA 3EFUA 2ZCCA 3HM6X 4II3B 4MSQB 1WXAA 3OJ4B 3PHXB 3U30A 2KZRA 4AUQC 5DPWA 1WJ6A 3ZO5B 3VH3B 2KQSA 3VVWB 2G45B 3ALBA 4TKNA 2PE6B 4W9HA 5JHAA 3VTUA 3V6CB 3GOEA 2L76A 2ZPYA 3QK0A 3P2BA 4MELA 4BOZB 2N9PC 2AWTA 2NBVB 5KHOA 2DYOA 2KNBA 3ZKJC 2LGYA 3U8ZA 3NHEB 1WX8A 3V62A 5L95C 3DBLI 1Z2MA 3WANA 3W1SA 4MM3A 4M8MA 1V2YA 4NQLB 2HD5B 5AEKB 1I35A 1GC7A 2KTRB 3DBHI 2Z0EB 2L05A 3A9KA 4KIKA 2LGDA 3RCZA 3MTNB 3TBLD 1YX6B 1X1MA 1R4MI 2LVPA 2B3AA 5E6PA 3ONSA 3Q3JA 2MP2B 3W1SC 1NBFC 1VD2A 2WX1A 3NY5A 4EZJA 3ZNZB 4CO7A 2CR5A 3L0WB 1D3ZA 2CHWA 4HCPB 3CMMB 4DHZE 3X0WA 2C7NB 4GXBA 4NAWB 4AJYB 3DBRI 5DPTA 2XK5B 2XBBC 2K1FA 1GNUA 5LLIA 2LGXA 3APFA 4ICUA 3PS6A 4FHKA 1BT0A 4ICVA 1Q5WB 3ML8A 4IM3A 1WY8A 2LRWA 3PVLA 3R7RA 2IO1B 3IVFA 4MGYE 4DBGA 2RD0A 2VRRB 1E90A 2MBBB 4MGZE 3MJWA 4KSKC 4A3PA 4JGHB 4TUUA 2BF8B 3A9JB 1P3QU 3L10B 4HPLB 2JZZA 3H7SA 3AI5A 3UIOB 1OEYA 4GDKB 2IBIB 5LXHA 4EUTA 2OJRA 5L83A 1EUVB 3ZDMC 3SD5A 1WF9A 2J0KA 2FCSA 2HE7A 3ZIMA 2NR2A 2NS5A 4LJOB 3A4SC 4F8CB 2EMTA 2ZZPB 3OJ3A 4A3OA 3PRPB 1VCBA 2QHOA 2KDEB 2WWZA 4ANXA 4FULA 2KWCA 1YQBA 1OEYJ 1SE9A 1EO6A 2FUHB 3KYDD 1J8CA 2AL6A 2DX5B 1A5RA 3U7DA 2MBOA 2L3ZA 3QQ8B 4DHJB 2JPHA 2JRHA 1QZEA 2I1KA 1ZW7A 4TQ1A 3RYTA 1WR6E 1I42A 2GBKA 4JIOU 2NBWB 4IG7B 2JF5A 4G50A 4MGIE 4G0NB
chains in the Genus database with same CATH superfamily
4KDLB 4IUMB 3BYYB 1T0SC 3Q3NC 1EWYC 4ZDVA 4K3CA 1ZPSA 4AQ7A 4HJGE 4HPMB 1BUIC 1WX7A 3JW0X 1QILA 1XD3B 4KX6B 1SSNA 4LTUA 2MBQA 4L23A 3L16A 1IBXA 1E9MA 1J7BA 1L0XB 1R4NI 4ANVA 3DQVA 3KW5B 3NOBA 3AE4B 2BWES 4KZ0A 1SE4A 4KZCA 3TEXA 3RUIB 3I9V1 4LNIA 1TY2A 3GP7A 3U52E 2XNAC 4FJYA 4NZLB 1WR1A 1KLVA 2Z0DB 2IO0B 1VZ6A 2ZNVC 1IUEA 3M62B 1WXMA 3RZWC 4BBNC 1D4BA 3AH7A 1WXQA 2CJNA 1EM7A 1E6EB 2O2VA 2KMAA 2WU5B 4PS3A 2JT4B 2KDFB 3TCAA 2INDC 4X57B 3DVGY 5HG2A 4ZRKA 4HROA 3B0AA 2MCNB 1OTRB 2D3GA 2FAZA 2GI9A 1KTKA 3DWMA 3GZNI 2BYEA 2KX0A 2DHZA 3E9SA 3CSTA 3NZSA 2BPSA 4E3CA 2IGGA 1IP9A 2HDEA 4BKTA 2IDYA 1JCKB 4D2KA 3ZW3A 1HE8A 3GB1A 3RNGC 3W1YA 3OG5A 1AWDA 1E8YA 4EE2A 3U7ZA 4ZRJA 4S17A 4IWOA 3UQAA 2NPTA 4WWOA 4TV3A 4EEWA 2V3SA 4K7SA 2WDQB 4DXGA 5IO9A 2PKOA 3JSVA 2QCZA 1UD7A 3L4PA 3LYYA 2KXJA 1DOIA 3ZDTA 1FXIA 5HFYA 3AXCA 2LD9A 2JXXA 2ZVNA 3RFZB 1E8WA 4EFOA 4WJNA 1JRUA 3OAWA 2KVRA 1IGCA 3HVZA 2RGFA 2G4DB 2OJWA 1KF6B 2LI5A 1WGGA 2TSSA 2CHXA 2KKCA 1WM2A 1UWXA 2C7MB 3L54A 1QOGA 1FRRA 4ZRPA 1L4DB 2SEBD 3MP9A 4DXAB 1WRDB 4R3DA 4W9LA 2BW2A 1D5XC 1ZE3D 4WQMA 4OHJA 1TS4A 4W9GA 1T0RC 2L8JA 4BFRA 4GOCA 1WXSA 1WSPA 2AX5A 2MJEA 4MJSB 2KLCA 3IFWB 5J17A 2ASQA 2KWVB 3HM3A 4BBNF 4PYZA 2JYTA 3H1UA 3SHQA 2LRUA 1MPEA 3QJZA 2WXKA 2WYQA 1H8CA 2N9KA 1HXYD 2FIDA 2HJ8A 2KMCA 4BOSC 4N9F4 4BKSD 4PYUA 4KV2A 2IYDB 4XYCA 3AE7B 4GDKA 2M17A 1LM8B 2A4ZA 2BWFA 5BMHA 1NVID 4XX5A 1UGJA 2FIFA 3P1MA 1QLBB 1TZOA 2BQQA 2KFKB 2PVGC 1FEHA 2INPE 3DBRB 1Y8RC 1DOYA 3ZNHB 1YN5A 1XCQL 3DDCB 1YJJA 3QIJA 2KD0A 2ZVOA 4W9CA 3W5VB 2DZIA 2IY0B 4B0MA 1FCLA 2M1MA 4HRSA 5AZGA 4URKA 3AE9B 2KN5A 1JW9D 3PO0A 3WAMA 2INCC 4XDCA 2BKRB 4AOFA 3VXWA 4LCDE 4L1BA 3VH4B 2MRPA 1WX9A 1OQQA 2K5PA 2R61A 2JY6A 3LDZE 2BKFA 1J0GA 3ZTDA 4WJOA 5HKHA 4B9KA 3DVNV 2BBCA 1F77A 1HQRD 3UGBB 1TGZB 2PJHA 3RNAC 3L13A 1J19A 2AQ3B 4MSMB 2K39A 2MX2A 4IM0A 5I4DA 4WJQA 2K6QA 4MDKE 4W9EA 5FK9C 3PTFC 1MFWA 2GBMA 1N5XA 5BYRA 4YTPB 3DVGX 1ZDVA 1B1ZA 2IZVB 1SF0A 2UWQA 2ZJDA 4DDID 2WDTB 3A1QA 3FAHA 4I6PA 3CF6E 5DCNA 3QAQA 1L4ZB 3V05A 1RYJA 1UBIA 2FCQA 4YSXB 3NZ3A 1WE7A 3IBEA 1WJUA 1PDXA 1HZ6A 1E8ZA 1WM3A 3V6EB 3EECA 4IWPA 3LJ3A 4FXCA 1V81A 1XLNA 1DYQA 2LVOA 4M8NA 2B76B 1KLUD 1YX5B 2Z59B 2KYWA 1NYRA 2DZMA 2MW5A 2IY1B 1ZKHA 4HWIB 2X8XX 3BINA 3B08A 3ZJUA 4GMVA 2L32A 1VZ8A 2KJRA 3AMZA 4II3B 3OJ4B 2PMVA 3CIRB 5DPWA 1F0ZA 3VH3B 2H88B 3VTUA 3V6CB 2PTLA 1ROEA 2G1EA 3GE3C 3TEYA 3DBLI 2KMMA 3P42A 2HJ1A 4B0EA 2D3CA 4M8MA 4YXDB 2BTEA 4KKJA 4MACA 1JWUD 1XO3A 2Z0EB 3N1XC 2LGDA 3RCZA 4C4VB 3MTNB 1R4MI 2B3AA 1VD2A 3NY5A 2J52A 4EZJA 3ZNZB 4CO7A 1GB1A 3CMMB 1AN8A 4GXBA 2W54A 2WXLA 3DBRI 2K1FA 1GNUA 3AEEB 5IOIA 1BT0A 4ICVA 4IM3A 1WY8A 2IO1B 4DBGA 4A3PA 4JGHB 2BF8B 2JZZA 2D5GA 1OEYA 2IBIB 2X38A 1EUVB 3ZDMC 3SD5A 3ZIMA 2NS5A 2ZZPB 2QHOA 3BVGA 1FIQA 4ITKA 2FUHB 1FNUA 2AL6A 3MC9A 3LXFA 3SFDB 2L3ZA 3QQ8B 1QZEA 1ENFA 4MM3B 2OEDA 4MGIE 3GZNB 4G0NB 3PRMB 2PEAA 3AV8A 2O6VA 1QT9A 2LEKA 3ZNID 4EZKA 1JROA 1KFYB 2BT6A 3Q8AA 2ZPNA 2Z8LA 3RNEC 3GE8C 4GIVA 1VRAB 2ICIA 2GB1A 2RDBC 1V86A 3DWGC 4WWPA 2AYOB 3ZRFA 4LLGM 3AN1A 4WIPA 2C9WB 4HXDA 1KH0A 1E8XA 4E74A 4RF1A 2PE9A 2KK8A 4TQ0A 1QQRA 3ZJTA 4C7ZA 1P7EA 4IC7B 2K25A 2BS2B 5LXIB 1PGBA 2WGSA 4NY0A 2IJ0A 2BYVE 3P63A 1Q0WB 3PT2B 3TEWA 4OZBA 5TR5A 3QARA 1SJHD 2ACZB 3ZLZA 1UELA 4FADA 1WFYA 3VUYA 4M02A 3NVVA 1A70A 1TKEA 4HKZE 1FMAD 3BWUD 1YJIA 1L7YA 4ZYSA 4GLSC 2A5UA 1WWTA 4YSYB 4EOYA 1ISNA 2WP9B 1TJEA 3FC4A 3HIZA 1MI0A 3Q8FA 4FA6A 3NJTA 4RGNA 1CMXB 1SEBD 2IPKD 1M94A 3TJPA 1KM7A 4RGOS 1ZXHA 3MFGA 1P1AA 5D7GA 1MG4A 3DBLB 3EHVA 5GMVA 4ZRIA 2DLBA 2NVUI 2NPTB 3BIID 3IAM1 1KOTA 1DGJA 1V97A 3PZDA 1S1QB 1EF1A 2LWPA 1L6VA 3I63C 4FHJA 2HTHA 1WRIA 3DOWA 4PS7A 4LNNA 3EC8A 1SIFA 4RH6A 1WZ0A 4P1CC 4K7WA 2ZEQA 1WYGA 3W5UB 1YMHE 2LMCA 2DZKA 3QC8B 1SXTA 3QCAA 3VR8B 4BAXA 2IGHA 2ZW0A 2JSVX 2JWUA 2BS3B 1H4RA 1NI3A 1TS2A 3RPFC 4I6NB 1ZGUB 1C1YB 2MSED 4ANUA 1XLPA 1C3TA 1R4MB 2KLGA 2KHWB 2KJ6A 2WXRA 3TEZA 3I3TB 1V49A 3MC0B 1TKGA 2DYBA 2XN9C 3U4EG 3JYUA 2CKHB 2EKEC 2Y3AA 2KQ7A 1L5PA 4BVUC 2DWQA 4GDLA 5D2MB 2G4SA 3ETRA 3BYTB 3VR9B 5FKAC 5IN7A 2LUEA 3DBHB 2LJIA 2D3BA 5C1ZA 4C7YA 3QA8A 3HK0A 2KFKA 4AP4C 3W2DA 4RMAA 2KX3A 1L0YB 1WE6A 1R4NB 1ET9A 1NYQA 3VUWA 5D6JB 2DAJA 4CYEA 1C78A 2YLMA 3PLVA 2JUOA 4US8A 4YTMB 2MLBA 1OQYA 2GBNA 2NCNA 2VZKB 4NNJB 1R7SA 3ABVB 5TSSA 4XDDA 4WURA 2CU1A 2DNFA 5EE9A 1LO5D 1JALA 4ZHPA 2XEWA 5CTRC 1I4QA 3IT4B 1V6EA 3P4QB 3ZQ4A 2J0MA 5AUIA 5IA7A 2M8SA 1I7HA 4HJKA 4HDOA 4NJCA 2GMIC 3IT6B 3E56A 3NG0A 1YQ4B 2LHEA 4HDQA 4XGAB 1MVKA 3UIPB 2W9NA 4WQOB 4YTNB 4JQWC 3RNCC 3DHIC 3P4SB 4YL8A 4LNKA 4OVZA 3EUB2 1WGYA 2CS4A 4G3XB 1Q1OA 4F7ZA 1E10A 3IHPC 2KO3A 4A55A 4ARCA 2DAFA 4OVUA 3SDLC 2J42A 2N4FA 5AZHA 4ANWA 4PK1A 1Z5SB 2I38A 3T8MA 1LQBA 1EF5A 2L83A 2MA9B 4YT0B 3B2FA 4J6IA 4IM2A 4XWWA 1E7UA 1OQRA 1HEZE 3KWLA 4H2AA 1KRHA 1N61A 2O6VD 3KQ4A 5J2RA 5G2NA 4LJPB 1YJ1A 2RDGA 3R3MA 1EU4A 2N7EA 4HCNB 3X23A 4F1SA 2WDVB 4BKGA 1TYGB 3PGEA 5IAAC 3T9LA 4JX1C 4REZA 1FFUA 4LDTD 1F9JA 3DHGC 1QKZA 3H9DA 3SEBA 1UGMA 4XE0A 5C23A 3EFUA 3HM6X 1YQ3B 3PHXB 4LK0M 5BMIA 2JU6X 3ZJVA 1FRDA 3N20C 4TKNA 3NUHB 4W9HA 2L76A 2ZPYA 3P2BA 2NTTA 4MELA 1K50A 2KNBA 2RMMA 2QIEB 2HD5B 4USAA 3DBHI 3DHHC 1F1HA 5G5GA 1X1MA 4QAYA 2LHDA 5E6PA 4A8XC 1VZ7A 2MP2B 2K0PA 2CR5A 1VJKA 3L0WB 2E6XA 3AEBB 3X0WA 2C7NB 4NAWB 5HI1A 3APFA 3NVWA 1C4AA 3PZ7A 3PVLA 3R7RA 1QOAA 2KACA 3IVFA 4MGYE 2W3SA 2RD0A 2VRRB 1I4PA 3MJWA 4RFBA 2N0SB 1FO4A 3A9JB 1P3QU 4HPLB 3H7SA 3AI5A 2LGIA 5L83A 3N1ZC 2WXJA 2WHIA 3A4SC 2LUMA 3OJ3A 1VCBA 1CQVA 1PUTA 4ANXA 2WWZA 3RNFC 1YQBA 1OEYJ 1SE9A 1EO6A 3KYDD 1FCCC 1FXAA 2I1KA 4TQ1A 3I57A 2JQRB 2JF5A 5BYQA 1Y56A 1P9DU 5CHVC 2N7DA 2WX0A 2W3RA 1E5WA 1RLFA 1WGRA 2MP2A 2ZNVB 1TS5A 2K9XA 3A1QB 1T0YA 2K8HA 2M19A 4Q2JA 4ZYNA 3ZYYX 2KDBA 1JQ4A 3APCA 4ZOHC 2R2QA 3TMPB 1NDDA 2J0JA 3ZVVA 3ZGZA 4J3OD 3UQBA 4E71A 4XWTA 5CHFA 4P1BC 3JSVB 1UH6A 1JRPA 3VRAB 1WGKA 4MH8A 1FFVA 1GJZA 3APDA 3AE6B 4JE3B 1LXDA 3UF8A 1Q10A 2L7RA 2L52A 2JYEA 4ZHOA 1SGHA 1C9FA 5LNK1 3V3XA 1VDVA 2GRIA 1NI2A 5FR6A 1I4XA 5T8IA 2G9HD 3KUZA 3ENEA 1AW7A 2RPVA 2KDMA 1F52A 1XLOA 1XQQA 3WIMA 1SE3A 1BXTA 2KC1A 4M0WB 4K3BA 1V8CA 3UINB 4M00A 3M3JA 1RM6C 3P4RB 2VH1A 1RFKA 4XZ4A 1YD8U 2DBYA 3AULA 3NRZA 1JWSD 1UBQA 2FCMA 1T6BX 3HVDA 3AE1B 3ZXVA 5D3DA 3FKYA 2MHJA 1FNVA 4DK5A 3BZDB 1WIAA 4KIKB 1OGWA 3PREA 1F2RI 1C79A 3A4RA 2KFJA 4G11A 1WZ3A 2M0AA 5KHQA 2M4NA 2GBJA 4NAWA 1FD6A 2QMTA 1ZDXA 2WXIA 3ZNGC 5G55A 1L2NA 2OOBB 4DWFA 3CWIA 4FN2A 3AEFB 3K9PB 2I2YA 2HTME 3WA0A 1TBEA 2LFIA 3A9JA 2MWSB 3P4PB 3BY4B 1I4RA 2JWZA 3JVZX 1XCTL 1ESFA 2KQ4X 3DPDA 1K52A 4PS8A 3S2AA 4S0RA 3BVZA 3OWEB 4ZRQA 3TL5A 5JH5C 3RD2A 3N30A 1XEEA 2BYFA 3KLSX 3PRZA 3T3NA 2ZW1A 3A9KB 1EU3A 4KDIC 1ET6A 1GAQB 1N5WA 1V80A 1V9JA 2Q5WD 3V60A 4B6WA 2YEPB 3AEAB 4AS1A 4HVBA 1LFDA 3H7PA 2C5LC 2FUG1 2D07B 3NVZA 3Q14C 4KVGB 3VFKA 2J7QB 4FJZA 3W9CB 5EE0A 2WLBA 4MT5A 3RI7C 2I1JA 3R66C 1P7FA 1WGHA 4AJWA 2AQ1B 2KANA 2BB6A 5BMGA 1SB3C 1WI0A 2LXCA 5EDSA 4KKIA 3RNBC 1TKYA 3HUIA 3NS1A 5AZFA 2M56B 5D3IB 2GOWA 3CSFA 3EGRA 4C00A 2V1YA 1P98A 3KH0A 3R7QA 2RPQA 4A9AA 4B95A 3PZ8A 2RR9A 3AE2B 3ZXRA 4NAMA 2AEHA 2FBWB 2ONQA 5JHBA 3BK1A 2JX5A 5E6NA 3R2TA 3M95A 1V1PA 2KDIA 2C7HA 3D32A 1AARA 3N3KB 1N63A 4OZCA 4BKSA 1E7VA 1K51A 3IG3A 3SU8X 2N1VA 4IDIA 4HEA1 3O65B 1SJED 3KUCB 2N9XA 2FCNA 2W82A 3KYCD 3Q8BA 4OVVA 2YVCA 3ZUNA 2PIAA 3KVFB 5BO4B 5G5HA 1JWBD 2QILA 4W9IA 3O13A 4K7UA 2WQYB 4W9JA 1RFAA 4CHKA 3ECIA 1GPXA 3EFCA 3Q69A 4W9DA 2R2OA 4LNOA 2LXAA 1XT9B 2RDHA 4KSLC 5D94A 1MJDA 1YN3A 4MJSA 2D2QA 2NBUA 1N62A 2DZJA 4US9A 3LB8C 1V5OA 3WALA 1P0RA 3RT3B 2ZCCA 3AEGB 3NVYA 3U30A 1AYFA 1C76A 2KQSA 3VVWB 1TY0A 1PGXA 3Q8CA 1QF6A 3RN9C 2N9PC 2NBVB 2DYOA 4RF0A 2V3NA 1C4PA 3U8ZA 3V62A 1Z2MA 3W1SA 4MM3A 4C56C 4NQLB 1YNTE 2KTRB 2PLPA 2L05A 1UUPA 4KIKA 3TBLD 4ACFA 3ONSA 1FPYA 1NBFC 2WX1A 1EWCA 1B9RA 1ZP0B 2CHWA 5DPTA 2XBBC 2J4XA 2LGXA 4ICUA 3PS6A 1ACCA 3UI3A 1VR9A 1UF0A 3AE3B 4WH4A 5EE3A 1E90A 2MBBB 4MGZE 5GXGB 1N6ZA 3FILA 2KAJA 3TSSA 1CJEA 3L10B 2N9LA 4YSZB 2MJDA 2WXHA 1STEA 2OJRA 5EE1A 1I4GA 2NR2A 3Q3MC 4F8CB 4A3OA 4HPPA 4N6EB 2KDEB 1PFDA 2KWCA 1L6UA 2WXOA 2DX5B 3MC8A 1A5RA 3U7DA 2MBOA 4DHJB 2JPHA 2ON8A 1ZW7A 1WR6E 5IP4D 2GBKA 4JIOU 4IG7B 3KWVA 4G50A 2JZPA 4FLHA 2Y5CA 2KWDA 3NZUA 3MHZA 4A6QA 4K81A 4W9FA 3GS2A 4FBJB 1V1OA 1OFFA 1QOBA 4M01A 4DQOC 3J9CA 4RM9A 4CQNA 3H7PB 4HLEA 1HTOA 2GLSA 2M0XA 2KTRA 3M63B 2SAKA 4JWSC 1SIJA 3PLUA 4NPNA 4WAAA 4AWJA 3PV1A 3C19A 4ASWC 4HKQA 1YIWA 2KT7A 3L08A 2K6DB 2XK5A 3ZRCA 2PPHA 2KTFA 4WJPA 2JZ3B 2VZKD 1LGRA 2L00B 1XLQA 4WWNA 2N9EB 1N60A 2MQJA 2KC2A 2GBRA 1D5MC 4GGQA 1GOZA 1WXVA 2Y5PA 4RGMA 4GSWA 2NMQA 2AQ2B 2QSDA 5DPRA 2W55A 4WAFA 2WNMA 3VDZA 2V0GA 2WS3B 4IW0A 2EMSA 1ZXIA 4YWGG 2LGSA 3HHMA 3NS8A 4EKUA 1WJ4A 2J53A 2QC8A 1F2RC 1PYWD 3VUXA 3WAPA 4EZLA 3ZTCA 2KVZA 5CX3A 2WXFA 3C8YA 4MEMA 2V3PA 3C0RB 2LASA 1IYFA 2MBHA 2L0FA 3AE5B 1GB4A 1GC6A 3EA6A 3MJ5A 2JVCA 2V4LA 2BS4B 4N59A 2IGDA 1SBBB 1CZPA 4P16A 5J18A 5BYSA 1D6EC 4GU2A 3SFEB 1WJNA 4JLCA 1PGAA 3TIXA 2YEPF 2O6VB 2PW9A 1FNWA 2MH7A 1XXGA 2KN4A 2LZ6A 3BK2A 3Q2AC 1BMLC 1K8RB 2INNE 1DOXA 1FXTB 3Q8EA 1C77A 2VH2A 2G3QB 1UZXB 1CK1A 3TUOA 2AL3A 3RMKC 4LDTB 4NJ7A 5C3JB 1TZ1A 1RRBA 3H8HA 5FR3A 4UDUC 5E6JA 3DBSA 5HHDG 2K8BA 3AU4A 2D3AA 5DPSA 3RULA 3QWZB 1U4AA 3FILB 3VAWA 4N58A 4TMAB 2KOXA 1T0QC 2CU3A 2KWUB 2LVQA 4MGKE 5H8YE 1J7CA 1WGDA 1VLBA 4RM8A 4W9KA 2REXA 5E6OA 4MH0E 3VTVA 2IO3B 3AB5A 2L0TA 1KLGD 3PSEB 2BYTA 4A20A 2V9HA 5AUKA 4NJ6A 3L17A 1TS3A 4RNAA 1WMHB 2CJOA 1M4VA 2QEJC 1T3QA 3QX1A 2ZCBA 1C4CA 2K8CA 2RSUA 1KJTA 3AEDB 3V61A 1TTNA 3WAOA 4JL9A 3A33B 4IWQA 2D10A 4DXFA 2NTSA 3QHTA 4PT5A 2BB5A 1SE2A 5C2TB 2LJ5A 1TT5B 1RAXA 3R8BA 4FJVB 1NENB 4C4VA 4I6LB 2UYZB 2QJLA 3ML9A 1G6JA 1V5TA 2EKIA 1K53A 2PVOD 2D11A 3B1LX 1YN4A 5CHWA 3OLMD 1JWAD 2C60A 2JRIB 4P7IA 4GB9A 3VHTC 2K3UA 1NEKB 2UU7A 5MPOA 1S3SG 2IO2B 2BGFA 2WXQA 1GG3A 3H6NA 3DCGA 3Q3FA 1E7PB 3N9YC 1WYWB 1TIFA 3AU5A 3PPAA 2N1WA 2DENB 2N7JA 1MG8A 1XF5L 4DDGD 3MHSD 1WH3A 4DHZB 2WU2B 3PHWB 4L2YA 2WXNA 3URYA 4JPSA 1RWSA 2L1AA 2KJHB 4XC2A 4A90A 2FNJB 3DVNU 4M0WA 3WCQA 3VTWA 1IPGA 3I5JC 4GDLB 3Q3OC 2MBEA 2CHZA 4NQKE 4BZAA 2O2VB 1HZ5A 2WXPA 2WXGA 3KUDB 4C80A 4DHJD 1GUAB 3AE8B 2OHFA 1J7AA 2Y5BB 1WMHA 3B9JA 3RZFA 4IOIE 3K9OB 4GN1A 3B2GA 3VQIA 3SR6A 3VRBB 2BVCA 1FM0D 3N32A 4HK2A 4II2B 2DYMA 1UWMA 1HTQA 1PQSA 4TSSA 4K1RB 5JZEB 1YOVB 4OW0A 5JXVA 2WDRB 1IBXB 4JWUC 3IXSA 4MSQB 1WXAA 4WWMA 3HRDD 2KZRA 4AUQC 1WJ6A 4RCOA 3ZO5B 4IKGA 2G45B 3ALBA 5JHAA 2PE6B 4KGSA 1I4HA 3GOEA 1JWMD 3QK0A 4BOZB 2AWTA 5KHOA 4LNFA 2WXMA 3ZKJC 2LGYA 2V4IB 4O1NA 2QDFA 4RGTA 2FE8A 2MEKA 3NHEB 3Q6BA 1WX8A 2H89B 5L95C 3BVMA 4OZAA 3WANA 1E0ZA 1V2YA 5AEKB 1I35A 1GC7A 1HA5A 3A9KA 4ARIA 3R2IA 1JMLA 1YX6B 2LVPA 1QOFA 3Q3JA 4KGTA 3W1SC 3AM9A 3U2SC 1ZUD2 1D3ZA 4HCPB 4DHZE 3IAS1 1T5XD 2E3TA 1IGDA 4AJYB 2XK5B 1D5ZC 5LLIA 4FHKA 3N1YC 1MHXA 1Q5WB 3ML8A 2LRWA 3AECB 4KGRA 3T3OA 4KSKC 4TUUA 3UIOB 4GDKB 5LXHA 4EUTA 4P6VF 1WF9A 2J0KA 2FCSA 2HE7A 4LJOB 2EMTA 3PRPB 2JXTA 5H92C 5IKCM 4FULA 1J8CA 1L0VB 1V1PB 2JRHA 2EELA 3RYTA 1I42A 1ZOYB 1MHHE 2K22A 2MJ3A 2NBWB 1UNSA
chains in the Genus database with same CATH topology
4KDLB 3PRMB 1P9DU 2PEAA 4IUMB 5CHVC 2N7DA 2O6VA 3NZUA 2WX0A 1E5WA 4ZDVA 4K81A 3ZNID 4EZKA 1RLFA 4W9FA 4FBJB 1WGRA 4HPMB 2MP2A 2ZNVB 2ZPNA 1WX7A 4RM9A 4GIVA 3JW0X 3A1QB 1XD3B 1T0YA 2K8HA 3H7PB 4HLEA 4ZYNA 2M0XA 2KDBA 2KTRA 3APCA 1V86A 2MBQA 2R2QA 3TMPB 3L16A 3M63B 4WWPA 2AYOB 1NDDA 1R4NI 3ZRFA 2J0JA 3PLUA 4ANVA 4NPNA 4WAAA 4AWJA 3ZVVA 3DQVA 3PV1A 3UQBA 2C9WB 3KW5B 4HXDA 5CHFA 4ASWC 4E71A 1E8XA 3JSVB 1UH6A 1YIWA 4E74A 3L08A 2PE9A 3NOBA 2K6DB 2XK5A 2KK8A 3ZRCA 2PPHA 4TQ0A 2KTFA 4WJPA 2JZ3B 2BWES 4IC7B 4KZ0A 2K25A 4KZCA 5LXIB 1GJZA 3APDA 4NY0A 2L00B 2BYVE 4WWNA 1LXDA 3RUIB 2N9EB 3UF8A 2L7RA 1Q0WB 3PT2B 4FJYA 1WR1A 2MQJA 1KLVA 2KC2A 2GBRA 1SGHA 2Z0DB 4GGQA 2IO0B 2ZNVC 5TR5A 1WXVA 3M62B 4GSWA 1WXMA 3RZWC 3QARA 4BBNC 3ZLZA 1UELA 4FADA 5DPRA 1NI2A 1WFYA 5FR6A 3VUYA 3VDZA 3KUZA 2O2VA 3ENEA 2KMAA 4PS3A 4IW0A 2JT4B 2EMSA 2KDFB 3TCAA 4X57B 1L7YA 3HHMA 1XQQA 3DVGY 3WIMA 3NS8A 4EKUA 2A5UA 1WJ4A 4ZRKA 2KC1A 4EOYA 3B0AA 4M0WB 1ISNA 2MCNB 3VUXA 3WAPA 1OTRB 2D3GA 2FAZA 3ZTCA 4EZLA 3HIZA 5CX3A 3UINB 4MEMA 3M3JA 3GZNI 2BYEA 2KX0A 2DHZA 3C0RB 2LASA 1IYFA 3CSTA 4XZ4A 4FA6A 3NZSA 2BPSA 2MBHA 1CMXB 4E3CA 1YD8U 3AULA 1IP9A 2L0FA 1M94A 4BKTA 3TJPA 3ZW3A 1HE8A 1KM7A 3W1YA 1GC6A 1UBQA 2FCMA 1P1AA 2JVCA 1E8YA 5D7GA 2V4LA 3EHVA 5GMVA 5J18A 4ZRJA 4ZRIA 4IWOA 3UQAA 2NPTA 2NVUI 4GU2A 2NPTB 4WWOA 1KOTA 4TV3A 4EEWA 1WJNA 3PZDA 4JLCA 3TIXA 1S1QB 2V3SA 4K7SA 1EF1A 2LWPA 2O6VB 2HTHA 4FHJA 4DK5A 3DOWA 3JSVA 4PS7A 1UD7A 1WIAA 4KIKB 1OGWA 3EC8A 1SIFA 2KXJA 3ZDTA 3PREA 2LZ6A 1WZ0A 3AXCA 4K7WA 2ZEQA 3A4RA 1K8RB 2JXXA 2LD9A 2ZVNA 2KFJA 1E8WA 2DZKA 4EFOA 3QC8B 4G11A 1WZ3A 4WJNA 5KHQA 2M4NA 1JRUA 2GBJA 3QCAA 4NAWA 3OAWA 1FXTB 2KVRA 3ZNGC 2G3QB 1UZXB 5G55A 1L2NA 2RGFA 2G4DB 2OOBB 4DWFA 1H4RA 2LI5A 1ZGUB 2AL3A 4I6NB 1C1YB 2MSED 4LDTB 4NJ7A 4FLHA 1WGGA 1TZ1A 4FN2A 4ANUA 1C3TA 1RRBA 3K9PB 2KLGA 2CHXA 2KKCA 1WM2A 2KHWB 2KJ6A 3DBSA 3WA0A 2C7MB 3I3TB 1TBEA 1V49A 3L54A 2K8BA 3A9JA 3AU4A 2MWSB 2DYBA 5DPSA 4DXAB 3BY4B 3RULA 3QWZB 1WRDB 1U4AA 4W9LA 3JYUA 2JWZA 3JVZX 3VAWA 2KOXA 4W9GA 2KWUB 2L8JA 4MGKE 2CKHB 2EKEC 2LVQA 4BFRA 1WGDA 4GOCA 3DPDA 1WXSA 2KQ7A 4RM8A 4BVUC 4MJSB 4W9KA 2KLCA 4GDLA 5D2MB 4PS8A 3IFWB 5J17A 2ASQA 2G4SA 3S2AA 2KWVB 3HM3A 4BBNF 2REXA 4PYZA 5E6OA 3TL5A 4MH0E 3VTVA 2IO3B 3H1UA 5JH5C 2L0TA 3SHQA 2LRUA 3PSEB 3RD2A 3QJZA 3N30A 2WYQA 1H8CA 2LUEA 4A20A 2FIDA 2BYFA 2HJ8A 2KMCA 4BOSC 4N9F4 4BKSD 4PYUA 4KV2A 2IYDB 3PRZA 4GDKA 2M17A 1LM8B 2A4ZA 5C1ZA 3QA8A 2BWFA 3HK0A 2KFKA 4NJ6A 4AP4C 3A9KB 4XX5A 3L17A 2KX3A 4RMAA 2FIFA 4KDIC 1WMHB 1WE6A 2KFKB 1V80A 1V9JA 3V60A 3QX1A 4B6WA 3VUWA 2ZCBA 5D6JB 2K8CA 1Y8RC 2DAJA 4CYEA 3ZNHB 2RSUA 1KJTA 3V61A 1TTNA 3DDCB 3WAOA 3QIJA 2YLMA 4JL9A 3PLVA 2KD0A 2ZVOA 4W9CA 4HVBA 1LFDA 2JUOA 2DZIA 2C5LC 2IY0B 3A33B 3H7PA 2D10A 4IWQA 3QHTA 2D07B 2M1MA 4KVGB 3VFKA 5AZGA 2MLBA 4URKA 1OQYA 2GBNA 2NCNA 2J7QB 2KN5A 4FJZA 4NNJB 2LJ5A 3WAMA 1RAXA 2I1JA 2BKRB 3R66C 4FJVB 4AOFA 1WGHA 4AJWA 4I6LB 2KANA 2CU1A 2UYZB 3VXWA 4LCDE 3ML9A 1G6JA 2XEWA 5CTRC 1WI0A 2LXCA 3VH4B 5EDSA 2MRPA 1WX9A 1V5TA 1V6EA 2JY6A 3LDZE 2BKFA 1J0GA 2J0MA 3ZTDA 2D11A 5IA7A 4WJOA 3B1LX 5CHWA 3OLMD 5HKHA 2C60A 4B9KA 2JRIB 4P7IA 5AZFA 3DVNV 4GB9A 2M8SA 3VHTC 4HJKA 4HDOA 2GOWA 3UGBB 2GMIC 1TGZB 2PJHA 3CSFA 1S3SG 4HDQA 3L13A 1J19A 4MSMB 3UIPB 2IO2B 2W9NA 2BGFA 2K39A 2MX2A 2V1YA 1P98A 4IM0A 4WJQA 1GG3A 3H6NA 3KH0A 3DCGA 4WQOB 2K6QA 4JQWC 3R7QA 3Q3FA 2RPQA 4MDKE 4W9EA 4B95A 2RR9A 3PTFC 4YL8A 1WYWB 3AU5A 3PPAA 2N1WA 2AEHA 2DENB 2GBMA 1MG8A 5JHBA 1WGYA 2CS4A 4G3XB 1Q1OA 4DDGD 4F7ZA 3IHPC 3MHSD 1WH3A 4DHZB 5E6NA 3DVGX 3PHWB 3M95A 2KO3A 2IZVB 2DAFA 2KDIA 2C7HA 2KJHB 3D32A 2UWQA 4OVUA 4XC2A 1AARA 2ZJDA 3N3KB 3SDLC 2WDTB 3A1QA 2FNJB 3DVNU 4I6PA 4BKSA 4DDID 1E7VA 3CF6E 2N4FA 5DCNA 5AZHA 3VTWA 3IG3A 3QAQA 4ANWA 1IPGA 1Z5SB 3T8MA 4GDLB 1LQBA 1EF5A 2N1VA 3SU8X 2MBEA 2MA9B 1UBIA 4IM2A 4J6IA 2CHZA 3O65B 3KUCB 2N9XA 2FCQA 4NQKE 1E7UA 2FCNA 2O2VB 3KYCD 4OVVA 2O6VD 2YVCA 3KUDB 3ZUNA 4DHJD 5J2RA 1GUAB 3KVFB 5BO4B 2Y5BB 1WE7A 4W9IA 5G2NA 3IBEA 1WMHA 1WJUA 3RZFA 3K9OB 4K7UA 4W9JA 1E8ZA 1WM3A 4LJPB 1YJ1A 3V6EB 3EECA 1RFAA 4GN1A 4CHKA 4IWPA 3ECIA 3VQIA 3LJ3A 4W9DA 3R3MA 1V81A 2LVOA 2R2OA 2N7EA 3N32A 4HK2A 4M8NA 4HCNB 3X23A 4F1SA 4II2B 2LXAA 1XT9B 1YX5B 4KSLC 4BKGA 2Z59B 3PGEA 2DYMA 5D94A 5IAAC 3T9LA 4LDTD 1F9JA 1PQSA 2DZMA 4K1RB 5JZEB 2MW5A 4MJSA 2IY1B 2D2QA 1ZKHA 2NBUA 2DZJA 4HWIB 3BINA 3B08A 1V5OA 3H9DA 3WALA 1UGMA 1P0RA 4GMVA 5C23A 3RT3B 2KJRA 3EFUA 2ZCCA 3HM6X 4II3B 4MSQB 1WXAA 3OJ4B 3PHXB 3U30A 2KZRA 4AUQC 5DPWA 1WJ6A 3ZO5B 3VH3B 2KQSA 3VVWB 2G45B 3ALBA 4TKNA 2PE6B 4W9HA 5JHAA 3VTUA 3V6CB 3GOEA 2L76A 2ZPYA 3QK0A 3P2BA 4MELA 4BOZB 2N9PC 2AWTA 2NBVB 5KHOA 2DYOA 2KNBA 3ZKJC 2LGYA 3U8ZA 3NHEB 1WX8A 3V62A 5L95C 3DBLI 1Z2MA 3WANA 3W1SA 4MM3A 4M8MA 1V2YA 4NQLB 2HD5B 5AEKB 1I35A 1GC7A 2KTRB 3DBHI 2Z0EB 2L05A 3A9KA 4KIKA 2LGDA 3RCZA 3MTNB 3TBLD 1YX6B 1X1MA 1R4MI 2LVPA 2B3AA 5E6PA 3ONSA 3Q3JA 2MP2B 3W1SC 1NBFC 1VD2A 2WX1A 3NY5A 4EZJA 3ZNZB 4CO7A 2CR5A 3L0WB 1D3ZA 2CHWA 4HCPB 3CMMB 4DHZE 3X0WA 2C7NB 4GXBA 4NAWB 4AJYB 3DBRI 5DPTA 2XK5B 2XBBC 2K1FA 1GNUA 5LLIA 2LGXA 3APFA 4ICUA 3PS6A 4FHKA 1BT0A 4ICVA 1Q5WB 3ML8A 4IM3A 1WY8A 2LRWA 3PVLA 3R7RA 2IO1B 3IVFA 4MGYE 4DBGA 2RD0A 2VRRB 1E90A 2MBBB 4MGZE 3MJWA 4KSKC 4A3PA 4JGHB 4TUUA 2BF8B 3A9JB 1P3QU 3L10B 4HPLB 2JZZA 3H7SA 3AI5A 3UIOB 1OEYA 4GDKB 2IBIB 5LXHA 4EUTA 2OJRA 5L83A 1EUVB 3ZDMC 3SD5A 1WF9A 2J0KA 2FCSA 2HE7A 3ZIMA 2NR2A 2NS5A 4LJOB 3A4SC 4F8CB 2EMTA 2ZZPB 3OJ3A 4A3OA 3PRPB 1VCBA 2QHOA 2KDEB 2WWZA 4ANXA 4FULA 2KWCA 1YQBA 1OEYJ 1SE9A 1EO6A 2FUHB 3KYDD 1J8CA 2AL6A 2DX5B 1A5RA 3U7DA 2MBOA 2L3ZA 3QQ8B 4DHJB 2JPHA 2JRHA 1QZEA 2I1KA 1ZW7A 4TQ1A 3RYTA 1WR6E 1I42A 2GBKA 4JIOU 2NBWB 4IG7B 2JF5A 4G50A 4MGIE 4G0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDL B;  3PRM B;  1P9D U;  2PEA A;  4IUM B;  5CHV C;  2N7D A;  2O6V A;  3NZU A;  2WX0 A;  1E5W A;  4ZDV A;  4K81 A;  3ZNI D;  4EZK A;  1RLF A;  4W9F A;  4FBJ B;  1WGR A;  4HPM B;  2MP2 A;  2ZNV B;  2ZPN A;  1WX7 A;  4RM9 A;  4GIV A;  3JW0 X;  3A1Q B;  1XD3 B;  1T0Y A;  2K8H A;  3H7P B;  4HLE A;  4ZYN A;  2M0X A;  2KDB A;  2KTR A;  3APC A;  1V86 A;  2MBQ A;  2R2Q A;  3TMP B;  3L16 A;  3M63 B;  4WWP A;  2AYO B;  1NDD A;  1R4N I;  3ZRF A;  2J0J A;  3PLU A;  4ANV A;  4NPN A;  4WAA A;  4AWJ A;  3ZVV A;  3DQV A;  3PV1 A;  3UQB A;  2C9W B;  3KW5 B;  4HXD A;  5CHF A;  4ASW C;  4E71 A;  1E8X A;  3JSV B;  1UH6 A;  1YIW A;  4E74 A;  3L08 A;  2PE9 A;  3NOB A;  2K6D B;  2XK5 A;  2KK8 A;  3ZRC A;  2PPH A;  4TQ0 A;  2KTF A;  4WJP A;  2JZ3 B;  2BWE S;  4IC7 B;  4KZ0 A;  2K25 A;  4KZC A;  5LXI B;  1GJZ A;  3APD A;  4NY0 A;  2L00 B;  2BYV E;  4WWN A;  1LXD A;  3RUI B;  2N9E B;  3UF8 A;  2L7R A;  1Q0W B;  3PT2 B;  4FJY A;  1WR1 A;  2MQJ A;  1KLV A;  2KC2 A;  2GBR A;  1SGH A;  2Z0D B;  4GGQ A;  2IO0 B;  2ZNV C;  5TR5 A;  1WXV A;  3M62 B;  4GSW A;  1WXM A;  3RZW C;  3QAR A;  4BBN C;  3ZLZ A;  1UEL A;  4FAD A;  5DPR A;  1NI2 A;  1WFY A;  5FR6 A;  3VUY A;  3VDZ A;  3KUZ A;  2O2V A;  3ENE A;  2KMA A;  4PS3 A;  4IW0 A;  2JT4 B;  2EMS A;  2KDF B;  3TCA A;  4X57 B;  1L7Y A;  3HHM A;  1XQQ A;  3DVG Y;  3WIM A;  3NS8 A;  4EKU A;  2A5U A;  1WJ4 A;  4ZRK A;  2KC1 A;  4EOY A;  3B0A A;  4M0W B;  1ISN A;  2MCN B;  3VUX A;  3WAP A;  1OTR B;  2D3G A;  2FAZ A;  3ZTC A;  4EZL A;  3HIZ A;  5CX3 A;  3UIN B;  4MEM A;  3M3J A;  3GZN I;  2BYE A;  2KX0 A;  2DHZ A;  3C0R B;  2LAS A;  1IYF A;  3CST A;  4XZ4 A;  4FA6 A;  3NZS A;  2BPS A;  2MBH A;  1CMX B;  4E3C A;  1YD8 U;  3AUL A;  1IP9 A;  2L0F A;  1M94 A;  4BKT A;  3TJP A;  3ZW3 A;  1HE8 A;  1KM7 A;  3W1Y A;  1GC6 A;  1UBQ A;  2FCM A;  1P1A A;  2JVC A;  1E8Y A;  5D7G A;  2V4L A;  3EHV A;  5GMV A;  5J18 A;  4ZRJ A;  4ZRI A;  4IWO A;  3UQA A;  2NPT A;  2NVU I;  4GU2 A;  2NPT B;  4WWO A;  1KOT A;  4TV3 A;  4EEW A;  1WJN A;  3PZD A;  4JLC A;  3TIX A;  1S1Q B;  2V3S A;  4K7S A;  1EF1 A;  2LWP A;  2O6V B;  2HTH A;  4FHJ A;  4DK5 A;  3DOW A;  3JSV A;  4PS7 A;  1UD7 A;  1WIA A;  4KIK B;  1OGW A;  3EC8 A;  1SIF A;  2KXJ A;  3ZDT A;  3PRE A;  2LZ6 A;  1WZ0 A;  3AXC A;  4K7W A;  2ZEQ A;  3A4R A;  1K8R B;  2JXX A;  2LD9 A;  2ZVN A;  2KFJ A;  1E8W A;  2DZK A;  4EFO A;  3QC8 B;  4G11 A;  1WZ3 A;  4WJN A;  5KHQ A;  2M4N A;  1JRU A;  2GBJ A;  3QCA A;  4NAW A;  3OAW A;  1FXT B;  2KVR A;  3ZNG C;  2G3Q B;  1UZX B;  5G55 A;  1L2N A;  2RGF A;  2G4D B;  2OOB B;  4DWF A;  1H4R A;  2LI5 A;  1ZGU B;  2AL3 A;  4I6N B;  1C1Y B;  2MSE D;  4LDT B;  4NJ7 A;  4FLH A;  1WGG A;  1TZ1 A;  4FN2 A;  4ANU A;  1C3T A;  1RRB A;  3K9P B;  2KLG A;  2CHX A;  2KKC A;  1WM2 A;  2KHW B;  2KJ6 A;  3DBS A;  3WA0 A;  2C7M B;  3I3T B;  1TBE A;  1V49 A;  3L54 A;  2K8B A;  3A9J A;  3AU4 A;  2MWS B;  2DYB A;  5DPS A;  4DXA B;  3BY4 B;  3RUL A;  3QWZ B;  1WRD B;  1U4A A;  4W9L A;  3JYU A;  2JWZ A;  3JVZ X;  3VAW A;  2KOX A;  4W9G A;  2KWU B;  2L8J A;  4MGK E;  2CKH B;  2EKE C;  2LVQ A;  4BFR A;  1WGD A;  4GOC A;  3DPD A;  1WXS A;  2KQ7 A;  4RM8 A;  4BVU C;  4MJS B;  4W9K A;  2KLC A;  4GDL A;  5D2M B;  4PS8 A;  3IFW B;  5J17 A;  2ASQ A;  2G4S A;  3S2A A;  2KWV B;  3HM3 A;  4BBN F;  2REX A;  4PYZ A;  5E6O A;  3TL5 A;  4MH0 E;  3VTV A;  2IO3 B;  3H1U A;  5JH5 C;  2L0T A;  3SHQ A;  2LRU A;  3PSE B;  3RD2 A;  3QJZ A;  3N30 A;  2WYQ A;  1H8C A;  2LUE A;  4A20 A;  2FID A;  2BYF A;  2HJ8 A;  2KMC A;  4BOS C;  4N9F 4;  4BKS D;  4PYU A;  4KV2 A;  2IYD B;  3PRZ A;  4GDK A;  2M17 A;  1LM8 B;  2A4Z A;  5C1Z A;  3QA8 A;  2BWF A;  3HK0 A;  2KFK A;  4NJ6 A;  4AP4 C;  3A9K B;  4XX5 A;  3L17 A;  2KX3 A;  4RMA A;  2FIF A;  4KDI C;  1WMH B;  1WE6 A;  2KFK B;  1V80 A;  1V9J A;  3V60 A;  3QX1 A;  4B6W A;  3VUW A;  2ZCB A;  5D6J B;  2K8C A;  1Y8R C;  2DAJ A;  4CYE A;  3ZNH B;  2RSU A;  1KJT A;  3V61 A;  1TTN A;  3DDC B;  3WAO A;  3QIJ A;  2YLM A;  4JL9 A;  3PLV A;  2KD0 A;  2ZVO A;  4W9C A;  4HVB A;  1LFD A;  2JUO A;  2DZI A;  2C5L C;  2IY0 B;  3A33 B;  3H7P A;  2D10 A;  4IWQ A;  3QHT A;  2D07 B;  2M1M A;  4KVG B;  3VFK A;  5AZG A;  2MLB A;  4URK A;  1OQY A;  2GBN A;  2NCN A;  2J7Q B;  2KN5 A;  4FJZ A;  4NNJ B;  2LJ5 A;  3WAM A;  1RAX A;  2I1J A;  2BKR B;  3R66 C;  4FJV B;  4AOF A;  1WGH A;  4AJW A;  4I6L B;  2KAN A;  2CU1 A;  2UYZ B;  3VXW A;  4LCD E;  3ML9 A;  1G6J A;  2XEW A;  5CTR C;  1WI0 A;  2LXC A;  3VH4 B;  5EDS A;  2MRP A;  1WX9 A;  1V5T A;  1V6E A;  2JY6 A;  3LDZ E;  2BKF A;  1J0G A;  2J0M A;  3ZTD A;  2D11 A;  5IA7 A;  4WJO A;  3B1L X;  5CHW A;  3OLM D;  5HKH A;  2C60 A;  4B9K A;  2JRI B;  4P7I A;  5AZF A;  3DVN V;  4GB9 A;  2M8S A;  3VHT C;  4HJK A;  4HDO A;  2GOW A;  3UGB B;  2GMI C;  1TGZ B;  2PJH A;  3CSF A;  1S3S G;  4HDQ A;  3L13 A;  1J19 A;  4MSM B;  3UIP B;  2IO2 B;  2W9N A;  2BGF A;  2K39 A;  2MX2 A;  2V1Y A;  1P98 A;  4IM0 A;  4WJQ A;  1GG3 A;  3H6N A;  3KH0 A;  3DCG A;  4WQO B;  2K6Q A;  4JQW C;  3R7Q A;  3Q3F A;  2RPQ A;  4MDK E;  4W9E A;  4B95 A;  2RR9 A;  3PTF C;  4YL8 A;  1WYW B;  3AU5 A;  3PPA A;  2N1W A;  2AEH A;  2DEN B;  2GBM A;  1MG8 A;  5JHB A;  1WGY A;  2CS4 A;  4G3X B;  1Q1O A;  4DDG D;  4F7Z A;  3IHP C;  3MHS D;  1WH3 A;  4DHZ B;  5E6N A;  3DVG X;  3PHW B;  3M95 A;  2KO3 A;  2IZV B;  2DAF A;  2KDI A;  2C7H A;  2KJH B;  3D32 A;  2UWQ A;  4OVU A;  4XC2 A;  1AAR A;  2ZJD A;  3N3K B;  3SDL C;  2WDT B;  3A1Q A;  2FNJ B;  3DVN U;  4I6P A;  4BKS A;  4DDI D;  1E7V A;  3CF6 E;  2N4F A;  5DCN A;  5AZH A;  3VTW A;  3IG3 A;  3QAQ A;  4ANW A;  1IPG A;  1Z5S B;  3T8M A;  4GDL B;  1LQB A;  1EF5 A;  2N1V A;  3SU8 X;  2MBE A;  2MA9 B;  1UBI A;  4IM2 A;  4J6I A;  2CHZ A;  3O65 B;  3KUC B;  2N9X A;  2FCQ A;  4NQK E;  1E7U A;  2FCN A;  2O2V B;  3KYC D;  4OVV A;  2O6V D;  2YVC A;  3KUD B;  3ZUN A;  4DHJ D;  5J2R A;  1GUA B;  3KVF B;  5BO4 B;  2Y5B B;  1WE7 A;  4W9I A;  5G2N A;  3IBE A;  1WMH A;  1WJU A;  3RZF A;  3K9O B;  4K7U A;  4W9J A;  1E8Z A;  1WM3 A;  4LJP B;  1YJ1 A;  3V6E B;  3EEC A;  1RFA A;  4GN1 A;  4CHK A;  4IWP A;  3ECI A;  3VQI A;  3LJ3 A;  4W9D A;  3R3M A;  1V81 A;  2LVO A;  2R2O A;  2N7E A;  3N32 A;  4HK2 A;  4M8N A;  4HCN B;  3X23 A;  4F1S A;  4II2 B;  2LXA A;  1XT9 B;  1YX5 B;  4KSL C;  4BKG A;  2Z59 B;  3PGE A;  2DYM A;  5D94 A;  5IAA C;  3T9L A;  4LDT D;  1F9J A;  1PQS A;  2DZM A;  4K1R B;  5JZE B;  2MW5 A;  4MJS A;  2IY1 B;  2D2Q A;  1ZKH A;  2NBU A;  2DZJ A;  4HWI B;  3BIN A;  3B08 A;  1V5O A;  3H9D A;  3WAL A;  1UGM A;  1P0R A;  4GMV A;  5C23 A;  3RT3 B;  2KJR A;  3EFU A;  2ZCC A;  3HM6 X;  4II3 B;  4MSQ B;  1WXA A;  3OJ4 B;  3PHX B;  3U30 A;  2KZR A;  4AUQ C;  5DPW A;  1WJ6 A;  3ZO5 B;  3VH3 B;  2KQS A;  3VVW B;  2G45 B;  3ALB A;  4TKN A;  2PE6 B;  4W9H A;  5JHA A;  3VTU A;  3V6C B;  3GOE A;  2L76 A;  2ZPY A;  3QK0 A;  3P2B A;  4MEL A;  4BOZ B;  2N9P C;  2AWT A;  2NBV B;  5KHO A;  2DYO A;  2KNB A;  3ZKJ C;  2LGY A;  3U8Z A;  3NHE B;  1WX8 A;  3V62 A;  5L95 C;  3DBL I;  1Z2M A;  3WAN A;  3W1S A;  4MM3 A;  4M8M A;  1V2Y A;  4NQL B;  2HD5 B;  5AEK B;  1I35 A;  1GC7 A;  2KTR B;  3DBH I;  2Z0E B;  2L05 A;  3A9K A;  4KIK A;  2LGD A;  3RCZ A;  3MTN B;  3TBL D;  1YX6 B;  1X1M A;  1R4M I;  2LVP A;  2B3A A;  5E6P A;  3ONS A;  3Q3J A;  2MP2 B;  3W1S C;  1NBF C;  1VD2 A;  2WX1 A;  3NY5 A;  4EZJ A;  3ZNZ B;  4CO7 A;  2CR5 A;  3L0W B;  1D3Z A;  2CHW A;  4HCP B;  3CMM B;  4DHZ E;  3X0W A;  2C7N B;  4GXB A;  4NAW B;  4AJY B;  3DBR I;  5DPT A;  2XK5 B;  2XBB C;  2K1F A;  1GNU A;  5LLI A;  2LGX A;  3APF A;  4ICU A;  3PS6 A;  4FHK A;  1BT0 A;  4ICV A;  1Q5W B;  3ML8 A;  4IM3 A;  1WY8 A;  2LRW A;  3PVL A;  3R7R A;  2IO1 B;  3IVF A;  4MGY E;  4DBG A;  2RD0 A;  2VRR B;  1E90 A;  2MBB B;  4MGZ E;  3MJW A;  4KSK C;  4A3P A;  4JGH B;  4TUU A;  2BF8 B;  3A9J B;  1P3Q U;  3L10 B;  4HPL B;  2JZZ A;  3H7S A;  3AI5 A;  3UIO B;  1OEY A;  4GDK B;  2IBI B;  5LXH A;  4EUT A;  2OJR A;  5L83 A;  1EUV B;  3ZDM C;  3SD5 A;  1WF9 A;  2J0K A;  2FCS A;  2HE7 A;  3ZIM A;  2NR2 A;  2NS5 A;  4LJO B;  3A4S C;  4F8C B;  2EMT A;  2ZZP B;  3OJ3 A;  4A3O A;  3PRP B;  1VCB A;  2QHO A;  2KDE B;  2WWZ A;  4ANX A;  4FUL A;  2KWC A;  1YQB A;  1OEY J;  1SE9 A;  1EO6 A;  2FUH B;  3KYD D;  1J8C A;  2AL6 A;  2DX5 B;  1A5R A;  3U7D A;  2MBO A;  2L3Z A;  3QQ8 B;  4DHJ B;  2JPH A;  2JRH A;  1QZE A;  2I1K A;  1ZW7 A;  4TQ1 A;  3RYT A;  1WR6 E;  1I42 A;  2GBK A;  4JIO U;  2NBW B;  4IG7 B;  2JF5 A;  4G50 A;  4MGI E;  4G0N B; 
#chains in the Genus database with same CATH topology
 4KDL B;  4IUM B;  3BYY B;  1T0S C;  3Q3N C;  1EWY C;  4ZDV A;  4K3C A;  1ZPS A;  4AQ7 A;  4HJG E;  4HPM B;  1BUI C;  1WX7 A;  3JW0 X;  1QIL A;  1XD3 B;  4KX6 B;  1SSN A;  4LTU A;  2MBQ A;  4L23 A;  3L16 A;  1IBX A;  1E9M A;  1J7B A;  1L0X B;  1R4N I;  4ANV A;  3DQV A;  3KW5 B;  3NOB A;  3AE4 B;  2BWE S;  4KZ0 A;  1SE4 A;  4KZC A;  3TEX A;  3RUI B;  3I9V 1;  4LNI A;  1TY2 A;  3GP7 A;  3U52 E;  2XNA C;  4FJY A;  4NZL B;  1WR1 A;  1KLV A;  2Z0D B;  2IO0 B;  1VZ6 A;  2ZNV C;  1IUE A;  3M62 B;  1WXM A;  3RZW C;  4BBN C;  1D4B A;  3AH7 A;  1WXQ A;  2CJN A;  1EM7 A;  1E6E B;  2O2V A;  2KMA A;  2WU5 B;  4PS3 A;  2JT4 B;  2KDF B;  3TCA A;  2IND C;  4X57 B;  3DVG Y;  5HG2 A;  4ZRK A;  4HRO A;  3B0A A;  2MCN B;  1OTR B;  2D3G A;  2FAZ A;  2GI9 A;  1KTK A;  3DWM A;  3GZN I;  2BYE A;  2KX0 A;  2DHZ A;  3E9S A;  3CST A;  3NZS A;  2BPS A;  4E3C A;  2IGG A;  1IP9 A;  2HDE A;  4BKT A;  2IDY A;  1JCK B;  4D2K A;  3ZW3 A;  1HE8 A;  3GB1 A;  3RNG C;  3W1Y A;  3OG5 A;  1AWD A;  1E8Y A;  4EE2 A;  3U7Z A;  4ZRJ A;  4S17 A;  4IWO A;  3UQA A;  2NPT A;  4WWO A;  4TV3 A;  4EEW A;  2V3S A;  4K7S A;  2WDQ B;  4DXG A;  5IO9 A;  2PKO A;  3JSV A;  2QCZ A;  1UD7 A;  3L4P A;  3LYY A;  2KXJ A;  1DOI A;  3ZDT A;  1FXI A;  5HFY A;  3AXC A;  2LD9 A;  2JXX A;  2ZVN A;  3RFZ B;  1E8W A;  4EFO A;  4WJN A;  1JRU A;  3OAW A;  2KVR A;  1IGC A;  3HVZ A;  2RGF A;  2G4D B;  2OJW A;  1KF6 B;  2LI5 A;  1WGG A;  2TSS A;  2CHX A;  2KKC A;  1WM2 A;  1UWX A;  2C7M B;  3L54 A;  1QOG A;  1FRR A;  4ZRP A;  1L4D B;  2SEB D;  3MP9 A;  4DXA B;  1WRD B;  4R3D A;  4W9L A;  2BW2 A;  1D5X C;  1ZE3 D;  4WQM A;  4OHJ A;  1TS4 A;  4W9G A;  1T0R C;  2L8J A;  4BFR A;  4GOC A;  1WXS A;  1WSP A;  2AX5 A;  2MJE A;  4MJS B;  2KLC A;  3IFW B;  5J17 A;  2ASQ A;  2KWV B;  3HM3 A;  4BBN F;  4PYZ A;  2JYT A;  3H1U A;  3SHQ A;  2LRU A;  1MPE A;  3QJZ A;  2WXK A;  2WYQ A;  1H8C A;  2N9K A;  1HXY D;  2FID A;  2HJ8 A;  2KMC A;  4BOS C;  4N9F 4;  4BKS D;  4PYU A;  4KV2 A;  2IYD B;  4XYC A;  3AE7 B;  4GDK A;  2M17 A;  1LM8 B;  2A4Z A;  2BWF A;  5BMH A;  1NVI D;  4XX5 A;  1UGJ A;  2FIF A;  3P1M A;  1QLB B;  1TZO A;  2BQQ A;  2KFK B;  2PVG C;  1FEH A;  2INP E;  3DBR B;  1Y8R C;  1DOY A;  3ZNH B;  1YN5 A;  1XCQ L;  3DDC B;  1YJJ A;  3QIJ A;  2KD0 A;  2ZVO A;  4W9C A;  3W5V B;  2DZI A;  2IY0 B;  4B0M A;  1FCL A;  2M1M A;  4HRS A;  5AZG A;  4URK A;  3AE9 B;  2KN5 A;  1JW9 D;  3PO0 A;  3WAM A;  2INC C;  4XDC A;  2BKR B;  4AOF A;  3VXW A;  4LCD E;  4L1B A;  3VH4 B;  2MRP A;  1WX9 A;  1OQQ A;  2K5P A;  2R61 A;  2JY6 A;  3LDZ E;  2BKF A;  1J0G A;  3ZTD A;  4WJO A;  5HKH A;  4B9K A;  3DVN V;  2BBC A;  1F77 A;  1HQR D;  3UGB B;  1TGZ B;  2PJH A;  3RNA C;  3L13 A;  1J19 A;  2AQ3 B;  4MSM B;  2K39 A;  2MX2 A;  4IM0 A;  5I4D A;  4WJQ A;  2K6Q A;  4MDK E;  4W9E A;  5FK9 C;  3PTF C;  1MFW A;  2GBM A;  1N5X A;  5BYR A;  4YTP B;  3DVG X;  1ZDV A;  1B1Z A;  2IZV B;  1SF0 A;  2UWQ A;  2ZJD A;  4DDI D;  2WDT B;  3A1Q A;  3FAH A;  4I6P A;  3CF6 E;  5DCN A;  3QAQ A;  1L4Z B;  3V05 A;  1RYJ A;  1UBI A;  2FCQ A;  4YSX B;  3NZ3 A;  1WE7 A;  3IBE A;  1WJU A;  1PDX A;  1HZ6 A;  1E8Z A;  1WM3 A;  3V6E B;  3EEC A;  4IWP A;  3LJ3 A;  4FXC A;  1V81 A;  1XLN A;  1DYQ A;  2LVO A;  4M8N A;  2B76 B;  1KLU D;  1YX5 B;  2Z59 B;  2KYW A;  1NYR A;  2DZM A;  2MW5 A;  2IY1 B;  1ZKH A;  4HWI B;  2X8X X;  3BIN A;  3B08 A;  3ZJU A;  4GMV A;  2L32 A;  1VZ8 A;  2KJR A;  3AMZ A;  4II3 B;  3OJ4 B;  2PMV A;  3CIR B;  5DPW A;  1F0Z A;  3VH3 B;  2H88 B;  3VTU A;  3V6C B;  2PTL A;  1ROE A;  2G1E A;  3GE3 C;  3TEY A;  3DBL I;  2KMM A;  3P42 A;  2HJ1 A;  4B0E A;  2D3C A;  4M8M A;  4YXD B;  2BTE A;  4KKJ A;  4MAC A;  1JWU D;  1XO3 A;  2Z0E B;  3N1X C;  2LGD A;  3RCZ A;  4C4V B;  3MTN B;  1R4M I;  2B3A A;  1VD2 A;  3NY5 A;  2J52 A;  4EZJ A;  3ZNZ B;  4CO7 A;  1GB1 A;  3CMM B;  1AN8 A;  4GXB A;  2W54 A;  2WXL A;  3DBR I;  2K1F A;  1GNU A;  3AEE B;  5IOI A;  1BT0 A;  4ICV A;  4IM3 A;  1WY8 A;  2IO1 B;  4DBG A;  4A3P A;  4JGH B;  2BF8 B;  2JZZ A;  2D5G A;  1OEY A;  2IBI B;  2X38 A;  1EUV B;  3ZDM C;  3SD5 A;  3ZIM A;  2NS5 A;  2ZZP B;  2QHO A;  3BVG A;  1FIQ A;  4ITK A;  2FUH B;  1FNU A;  2AL6 A;  3MC9 A;  3LXF A;  3SFD B;  2L3Z A;  3QQ8 B;  1QZE A;  1ENF A;  4MM3 B;  2OED A;  4MGI E;  3GZN B;  4G0N B;  3PRM B;  2PEA A;  3AV8 A;  2O6V A;  1QT9 A;  2LEK A;  3ZNI D;  4EZK A;  1JRO A;  1KFY B;  2BT6 A;  3Q8A A;  2ZPN A;  2Z8L A;  3RNE C;  3GE8 C;  4GIV A;  1VRA B;  2ICI A;  2GB1 A;  2RDB C;  1V86 A;  3DWG C;  4WWP A;  2AYO B;  3ZRF A;  4LLG M;  3AN1 A;  4WIP A;  2C9W B;  4HXD A;  1KH0 A;  1E8X A;  4E74 A;  4RF1 A;  2PE9 A;  2KK8 A;  4TQ0 A;  1QQR A;  3ZJT A;  4C7Z A;  1P7E A;  4IC7 B;  2K25 A;  2BS2 B;  5LXI B;  1PGB A;  2WGS A;  4NY0 A;  2IJ0 A;  2BYV E;  3P63 A;  1Q0W B;  3PT2 B;  3TEW A;  4OZB A;  5TR5 A;  3QAR A;  1SJH D;  2ACZ B;  3ZLZ A;  1UEL A;  4FAD A;  1WFY A;  3VUY A;  4M02 A;  3NVV A;  1A70 A;  1TKE A;  4HKZ E;  1FMA D;  3BWU D;  1YJI A;  1L7Y A;  4ZYS A;  4GLS C;  2A5U A;  1WWT A;  4YSY B;  4EOY A;  1ISN A;  2WP9 B;  1TJE A;  3FC4 A;  3HIZ A;  1MI0 A;  3Q8F A;  4FA6 A;  3NJT A;  4RGN A;  1CMX B;  1SEB D;  2IPK D;  1M94 A;  3TJP A;  1KM7 A;  4RGO S;  1ZXH A;  3MFG A;  1P1A A;  5D7G A;  1MG4 A;  3DBL B;  3EHV A;  5GMV A;  4ZRI A;  2DLB A;  2NVU I;  2NPT B;  3BII D;  3IAM 1;  1KOT A;  1DGJ A;  1V97 A;  3PZD A;  1S1Q B;  1EF1 A;  2LWP A;  1L6V A;  3I63 C;  4FHJ A;  2HTH A;  1WRI A;  3DOW A;  4PS7 A;  4LNN A;  3EC8 A;  1SIF A;  4RH6 A;  1WZ0 A;  4P1C C;  4K7W A;  2ZEQ A;  1WYG A;  3W5U B;  1YMH E;  2LMC A;  2DZK A;  3QC8 B;  1SXT A;  3QCA A;  3VR8 B;  4BAX A;  2IGH A;  2ZW0 A;  2JSV X;  2JWU A;  2BS3 B;  1H4R A;  1NI3 A;  1TS2 A;  3RPF C;  4I6N B;  1ZGU B;  1C1Y B;  2MSE D;  4ANU A;  1XLP A;  1C3T A;  1R4M B;  2KLG A;  2KHW B;  2KJ6 A;  2WXR A;  3TEZ A;  3I3T B;  1V49 A;  3MC0 B;  1TKG A;  2DYB A;  2XN9 C;  3U4E G;  3JYU A;  2CKH B;  2EKE C;  2Y3A A;  2KQ7 A;  1L5P A;  4BVU C;  2DWQ A;  4GDL A;  5D2M B;  2G4S A;  3ETR A;  3BYT B;  3VR9 B;  5FKA C;  5IN7 A;  2LUE A;  3DBH B;  2LJI A;  2D3B A;  5C1Z A;  4C7Y A;  3QA8 A;  3HK0 A;  2KFK A;  4AP4 C;  3W2D A;  4RMA A;  2KX3 A;  1L0Y B;  1WE6 A;  1R4N B;  1ET9 A;  1NYQ A;  3VUW A;  5D6J B;  2DAJ A;  4CYE A;  1C78 A;  2YLM A;  3PLV A;  2JUO A;  4US8 A;  4YTM B;  2MLB A;  1OQY A;  2GBN A;  2NCN A;  2VZK B;  4NNJ B;  1R7S A;  3ABV B;  5TSS A;  4XDD A;  4WUR A;  2CU1 A;  2DNF A;  5EE9 A;  1LO5 D;  1JAL A;  4ZHP A;  2XEW A;  5CTR C;  1I4Q A;  3IT4 B;  1V6E A;  3P4Q B;  3ZQ4 A;  2J0M A;  5AUI A;  5IA7 A;  2M8S A;  1I7H A;  4HJK A;  4HDO A;  4NJC A;  2GMI C;  3IT6 B;  3E56 A;  3NG0 A;  1YQ4 B;  2LHE A;  4HDQ A;  4XGA B;  1MVK A;  3UIP B;  2W9N A;  4WQO B;  4YTN B;  4JQW C;  3RNC C;  3DHI C;  3P4S B;  4YL8 A;  4LNK A;  4OVZ A;  3EUB 2;  1WGY A;  2CS4 A;  4G3X B;  1Q1O A;  4F7Z A;  1E10 A;  3IHP C;  2KO3 A;  4A55 A;  4ARC A;  2DAF A;  4OVU A;  3SDL C;  2J42 A;  2N4F A;  5AZH A;  4ANW A;  4PK1 A;  1Z5S B;  2I38 A;  3T8M A;  1LQB A;  1EF5 A;  2L83 A;  2MA9 B;  4YT0 B;  3B2F A;  4J6I A;  4IM2 A;  4XWW A;  1E7U A;  1OQR A;  1HEZ E;  3KWL A;  4H2A A;  1KRH A;  1N61 A;  2O6V D;  3KQ4 A;  5J2R A;  5G2N A;  4LJP B;  1YJ1 A;  2RDG A;  3R3M A;  1EU4 A;  2N7E A;  4HCN B;  3X23 A;  4F1S A;  2WDV B;  4BKG A;  1TYG B;  3PGE A;  5IAA C;  3T9L A;  4JX1 C;  4REZ A;  1FFU A;  4LDT D;  1F9J A;  3DHG C;  1QKZ A;  3H9D A;  3SEB A;  1UGM A;  4XE0 A;  5C23 A;  3EFU A;  3HM6 X;  1YQ3 B;  3PHX B;  4LK0 M;  5BMI A;  2JU6 X;  3ZJV A;  1FRD A;  3N20 C;  4TKN A;  3NUH B;  4W9H A;  2L76 A;  2ZPY A;  3P2B A;  2NTT A;  4MEL A;  1K50 A;  2KNB A;  2RMM A;  2QIE B;  2HD5 B;  4USA A;  3DBH I;  3DHH C;  1F1H A;  5G5G A;  1X1M A;  4QAY A;  2LHD A;  5E6P A;  4A8X C;  1VZ7 A;  2MP2 B;  2K0P A;  2CR5 A;  1VJK A;  3L0W B;  2E6X A;  3AEB B;  3X0W A;  2C7N B;  4NAW B;  5HI1 A;  3APF A;  3NVW A;  1C4A A;  3PZ7 A;  3PVL A;  3R7R A;  1QOA A;  2KAC A;  3IVF A;  4MGY E;  2W3S A;  2RD0 A;  2VRR B;  1I4P A;  3MJW A;  4RFB A;  2N0S B;  1FO4 A;  3A9J B;  1P3Q U;  4HPL B;  3H7S A;  3AI5 A;  2LGI A;  5L83 A;  3N1Z C;  2WXJ A;  2WHI A;  3A4S C;  2LUM A;  3OJ3 A;  1VCB A;  1CQV A;  1PUT A;  4ANX A;  2WWZ A;  3RNF C;  1YQB A;  1OEY J;  1SE9 A;  1EO6 A;  3KYD D;  1FCC C;  1FXA A;  2I1K A;  4TQ1 A;  3I57 A;  2JQR B;  2JF5 A;  5BYQ A;  1Y56 A;  1P9D U;  5CHV C;  2N7D A;  2WX0 A;  2W3R A;  1E5W A;  1RLF A;  1WGR A;  2MP2 A;  2ZNV B;  1TS5 A;  2K9X A;  3A1Q B;  1T0Y A;  2K8H A;  2M19 A;  4Q2J A;  4ZYN A;  3ZYY X;  2KDB A;  1JQ4 A;  3APC A;  4ZOH C;  2R2Q A;  3TMP B;  1NDD A;  2J0J A;  3ZVV A;  3ZGZ A;  4J3O D;  3UQB A;  4E71 A;  4XWT A;  5CHF A;  4P1B C;  3JSV B;  1UH6 A;  1JRP A;  3VRA B;  1WGK A;  4MH8 A;  1FFV A;  1GJZ A;  3APD A;  3AE6 B;  4JE3 B;  1LXD A;  3UF8 A;  1Q10 A;  2L7R A;  2L52 A;  2JYE A;  4ZHO A;  1SGH A;  1C9F A;  5LNK 1;  3V3X A;  1VDV A;  2GRI A;  1NI2 A;  5FR6 A;  1I4X A;  5T8I A;  2G9H D;  3KUZ A;  3ENE A;  1AW7 A;  2RPV A;  2KDM A;  1F52 A;  1XLO A;  1XQQ A;  3WIM A;  1SE3 A;  1BXT A;  2KC1 A;  4M0W B;  4K3B A;  1V8C A;  3UIN B;  4M00 A;  3M3J A;  1RM6 C;  3P4R B;  2VH1 A;  1RFK A;  4XZ4 A;  1YD8 U;  2DBY A;  3AUL A;  3NRZ A;  1JWS D;  1UBQ A;  2FCM A;  1T6B X;  3HVD A;  3AE1 B;  3ZXV A;  5D3D A;  3FKY A;  2MHJ A;  1FNV A;  4DK5 A;  3BZD B;  1WIA A;  4KIK B;  1OGW A;  3PRE A;  1F2R I;  1C79 A;  3A4R A;  2KFJ A;  4G11 A;  1WZ3 A;  2M0A A;  5KHQ A;  2M4N A;  2GBJ A;  4NAW A;  1FD6 A;  2QMT A;  1ZDX A;  2WXI A;  3ZNG C;  5G55 A;  1L2N A;  2OOB B;  4DWF A;  3CWI A;  4FN2 A;  3AEF B;  3K9P B;  2I2Y A;  2HTM E;  3WA0 A;  1TBE A;  2LFI A;  3A9J A;  2MWS B;  3P4P B;  3BY4 B;  1I4R A;  2JWZ A;  3JVZ X;  1XCT L;  1ESF A;  2KQ4 X;  3DPD A;  1K52 A;  4PS8 A;  3S2A A;  4S0R A;  3BVZ A;  3OWE B;  4ZRQ A;  3TL5 A;  5JH5 C;  3RD2 A;  3N30 A;  1XEE A;  2BYF A;  3KLS X;  3PRZ A;  3T3N A;  2ZW1 A;  3A9K B;  1EU3 A;  4KDI C;  1ET6 A;  1GAQ B;  1N5W A;  1V80 A;  1V9J A;  2Q5W D;  3V60 A;  4B6W A;  2YEP B;  3AEA B;  4AS1 A;  4HVB A;  1LFD A;  3H7P A;  2C5L C;  2FUG 1;  2D07 B;  3NVZ A;  3Q14 C;  4KVG B;  3VFK A;  2J7Q B;  4FJZ A;  3W9C B;  5EE0 A;  2WLB A;  4MT5 A;  3RI7 C;  2I1J A;  3R66 C;  1P7F A;  1WGH A;  4AJW A;  2AQ1 B;  2KAN A;  2BB6 A;  5BMG A;  1SB3 C;  1WI0 A;  2LXC A;  5EDS A;  4KKI A;  3RNB C;  1TKY A;  3HUI A;  3NS1 A;  5AZF A;  2M56 B;  5D3I B;  2GOW A;  3CSF A;  3EGR A;  4C00 A;  2V1Y A;  1P98 A;  3KH0 A;  3R7Q A;  2RPQ A;  4A9A A;  4B95 A;  3PZ8 A;  2RR9 A;  3AE2 B;  3ZXR A;  4NAM A;  2AEH A;  2FBW B;  2ONQ A;  5JHB A;  3BK1 A;  2JX5 A;  5E6N A;  3R2T A;  3M95 A;  1V1P A;  2KDI A;  2C7H A;  3D32 A;  1AAR A;  3N3K B;  1N63 A;  4OZC A;  4BKS A;  1E7V A;  1K51 A;  3IG3 A;  3SU8 X;  2N1V A;  4IDI A;  4HEA 1;  3O65 B;  1SJE D;  3KUC B;  2N9X A;  2FCN A;  2W82 A;  3KYC D;  3Q8B A;  4OVV A;  2YVC A;  3ZUN A;  2PIA A;  3KVF B;  5BO4 B;  5G5H A;  1JWB D;  2QIL A;  4W9I A;  3O13 A;  4K7U A;  2WQY B;  4W9J A;  1RFA A;  4CHK A;  3ECI A;  1GPX A;  3EFC A;  3Q69 A;  4W9D A;  2R2O A;  4LNO A;  2LXA A;  1XT9 B;  2RDH A;  4KSL C;  5D94 A;  1MJD A;  1YN3 A;  4MJS A;  2D2Q A;  2NBU A;  1N62 A;  2DZJ A;  4US9 A;  3LB8 C;  1V5O A;  3WAL A;  1P0R A;  3RT3 B;  2ZCC A;  3AEG B;  3NVY A;  3U30 A;  1AYF A;  1C76 A;  2KQS A;  3VVW B;  1TY0 A;  1PGX A;  3Q8C A;  1QF6 A;  3RN9 C;  2N9P C;  2NBV B;  2DYO A;  4RF0 A;  2V3N A;  1C4P A;  3U8Z A;  3V62 A;  1Z2M A;  3W1S A;  4MM3 A;  4C56 C;  4NQL B;  1YNT E;  2KTR B;  2PLP A;  2L05 A;  1UUP A;  4KIK A;  3TBL D;  4ACF A;  3ONS A;  1FPY A;  1NBF C;  2WX1 A;  1EWC A;  1B9R A;  1ZP0 B;  2CHW A;  5DPT A;  2XBB C;  2J4X A;  2LGX A;  4ICU A;  3PS6 A;  1ACC A;  3UI3 A;  1VR9 A;  1UF0 A;  3AE3 B;  4WH4 A;  5EE3 A;  1E90 A;  2MBB B;  4MGZ E;  5GXG B;  1N6Z A;  3FIL A;  2KAJ A;  3TSS A;  1CJE A;  3L10 B;  2N9L A;  4YSZ B;  2MJD A;  2WXH A;  1STE A;  2OJR A;  5EE1 A;  1I4G A;  2NR2 A;  3Q3M C;  4F8C B;  4A3O A;  4HPP A;  4N6E B;  2KDE B;  1PFD A;  2KWC A;  1L6U A;  2WXO A;  2DX5 B;  3MC8 A;  1A5R A;  3U7D A;  2MBO A;  4DHJ B;  2JPH A;  2ON8 A;  1ZW7 A;  1WR6 E;  5IP4 D;  2GBK A;  4JIO U;  4IG7 B;  3KWV A;  4G50 A;  2JZP A;  4FLH A;  2Y5C A;  2KWD A;  3NZU A;  3MHZ A;  4A6Q A;  4K81 A;  4W9F A;  3GS2 A;  4FBJ B;  1V1O A;  1OFF A;  1QOB A;  4M01 A;  4DQO C;  3J9C A;  4RM9 A;  4CQN A;  3H7P B;  4HLE A;  1HTO A;  2GLS A;  2M0X A;  2KTR A;  3M63 B;  2SAK A;  4JWS C;  1SIJ A;  3PLU A;  4NPN A;  4WAA A;  4AWJ A;  3PV1 A;  3C19 A;  4ASW C;  4HKQ A;  1YIW A;  2KT7 A;  3L08 A;  2K6D B;  2XK5 A;  3ZRC A;  2PPH A;  2KTF A;  4WJP A;  2JZ3 B;  2VZK D;  1LGR A;  2L00 B;  1XLQ A;  4WWN A;  2N9E B;  1N60 A;  2MQJ A;  2KC2 A;  2GBR A;  1D5M C;  4GGQ A;  1GOZ A;  1WXV A;  2Y5P A;  4RGM A;  4GSW A;  2NMQ A;  2AQ2 B;  2QSD A;  5DPR A;  2W55 A;  4WAF A;  2WNM A;  3VDZ A;  2V0G A;  2WS3 B;  4IW0 A;  2EMS A;  1ZXI A;  4YWG G;  2LGS A;  3HHM A;  3NS8 A;  4EKU A;  1WJ4 A;  2J53 A;  2QC8 A;  1F2R C;  1PYW D;  3VUX A;  3WAP A;  4EZL A;  3ZTC A;  2KVZ A;  5CX3 A;  2WXF A;  3C8Y A;  4MEM A;  2V3P A;  3C0R B;  2LAS A;  1IYF A;  2MBH A;  2L0F A;  3AE5 B;  1GB4 A;  1GC6 A;  3EA6 A;  3MJ5 A;  2JVC A;  2V4L A;  2BS4 B;  4N59 A;  2IGD A;  1SBB B;  1CZP A;  4P16 A;  5J18 A;  5BYS A;  1D6E C;  4GU2 A;  3SFE B;  1WJN A;  4JLC A;  1PGA A;  3TIX A;  2YEP F;  2O6V B;  2PW9 A;  1FNW A;  2MH7 A;  1XXG A;  2KN4 A;  2LZ6 A;  3BK2 A;  3Q2A C;  1BML C;  1K8R B;  2INN E;  1DOX A;  1FXT B;  3Q8E A;  1C77 A;  2VH2 A;  2G3Q B;  1UZX B;  1CK1 A;  3TUO A;  2AL3 A;  3RMK C;  4LDT B;  4NJ7 A;  5C3J B;  1TZ1 A;  1RRB A;  3H8H A;  5FR3 A;  4UDU C;  5E6J A;  3DBS A;  5HHD G;  2K8B A;  3AU4 A;  2D3A A;  5DPS A;  3RUL A;  3QWZ B;  1U4A A;  3FIL B;  3VAW A;  4N58 A;  4TMA B;  2KOX A;  1T0Q C;  2CU3 A;  2KWU B;  2LVQ A;  4MGK E;  5H8Y E;  1J7C A;  1WGD A;  1VLB A;  4RM8 A;  4W9K A;  2REX A;  5E6O A;  4MH0 E;  3VTV A;  2IO3 B;  3AB5 A;  2L0T A;  1KLG D;  3PSE B;  2BYT A;  4A20 A;  2V9H A;  5AUK A;  4NJ6 A;  3L17 A;  1TS3 A;  4RNA A;  1WMH B;  2CJO A;  1M4V A;  2QEJ C;  1T3Q A;  3QX1 A;  2ZCB A;  1C4C A;  2K8C A;  2RSU A;  1KJT A;  3AED B;  3V61 A;  1TTN A;  3WAO A;  4JL9 A;  3A33 B;  4IWQ A;  2D10 A;  4DXF A;  2NTS A;  3QHT A;  4PT5 A;  2BB5 A;  1SE2 A;  5C2T B;  2LJ5 A;  1TT5 B;  1RAX A;  3R8B A;  4FJV B;  1NEN B;  4C4V A;  4I6L B;  2UYZ B;  2QJL A;  3ML9 A;  1G6J A;  1V5T A;  2EKI A;  1K53 A;  2PVO D;  2D11 A;  3B1L X;  1YN4 A;  5CHW A;  3OLM D;  1JWA D;  2C60 A;  2JRI B;  4P7I A;  4GB9 A;  3VHT C;  2K3U A;  1NEK B;  2UU7 A;  5MPO A;  1S3S G;  2IO2 B;  2BGF A;  2WXQ A;  1GG3 A;  3H6N A;  3DCG A;  3Q3F A;  1E7P B;  3N9Y C;  1WYW B;  1TIF A;  3AU5 A;  3PPA A;  2N1W A;  2DEN B;  2N7J A;  1MG8 A;  1XF5 L;  4DDG D;  3MHS D;  1WH3 A;  4DHZ B;  2WU2 B;  3PHW B;  4L2Y A;  2WXN A;  3URY A;  4JPS A;  1RWS A;  2L1A A;  2KJH B;  4XC2 A;  4A90 A;  2FNJ B;  3DVN U;  4M0W A;  3WCQ A;  3VTW A;  1IPG A;  3I5J C;  4GDL B;  3Q3O C;  2MBE A;  2CHZ A;  4NQK E;  4BZA A;  2O2V B;  1HZ5 A;  2WXP A;  2WXG A;  3KUD B;  4C80 A;  4DHJ D;  1GUA B;  3AE8 B;  2OHF A;  1J7A A;  2Y5B B;  1WMH A;  3B9J A;  3RZF A;  4IOI E;  3K9O B;  4GN1 A;  3B2G A;  3VQI A;  3SR6 A;  3VRB B;  2BVC A;  1FM0 D;  3N32 A;  4HK2 A;  4II2 B;  2DYM A;  1UWM A;  1HTQ A;  1PQS A;  4TSS A;  4K1R B;  5JZE B;  1YOV B;  4OW0 A;  5JXV A;  2WDR B;  1IBX B;  4JWU C;  3IXS A;  4MSQ B;  1WXA A;  4WWM A;  3HRD D;  2KZR A;  4AUQ C;  1WJ6 A;  4RCO A;  3ZO5 B;  4IKG A;  2G45 B;  3ALB A;  5JHA A;  2PE6 B;  4KGS A;  1I4H A;  3GOE A;  1JWM D;  3QK0 A;  4BOZ B;  2AWT A;  5KHO A;  4LNF A;  2WXM A;  3ZKJ C;  2LGY A;  2V4I B;  4O1N A;  2QDF A;  4RGT A;  2FE8 A;  2MEK A;  3NHE B;  3Q6B A;  1WX8 A;  2H89 B;  5L95 C;  3BVM A;  4OZA A;  3WAN A;  1E0Z A;  1V2Y A;  5AEK B;  1I35 A;  1GC7 A;  1HA5 A;  3A9K A;  4ARI A;  3R2I A;  1JML A;  1YX6 B;  2LVP A;  1QOF A;  3Q3J A;  4KGT A;  3W1S C;  3AM9 A;  3U2S C;  1ZUD 2;  1D3Z A;  4HCP B;  4DHZ E;  3IAS 1;  1T5X D;  2E3T A;  1IGD A;  4AJY B;  2XK5 B;  1D5Z C;  5LLI A;  4FHK A;  3N1Y C;  1MHX A;  1Q5W B;  3ML8 A;  2LRW A;  3AEC B;  4KGR A;  3T3O A;  4KSK C;  4TUU A;  3UIO B;  4GDK B;  5LXH A;  4EUT A;  4P6V F;  1WF9 A;  2J0K A;  2FCS A;  2HE7 A;  4LJO B;  2EMT A;  3PRP B;  2JXT A;  5H92 C;  5IKC M;  4FUL A;  1J8C A;  1L0V B;  1V1P B;  2JRH A;  2EEL A;  3RYT A;  1I42 A;  1ZOY B;  1MHH E;  2K22 A;  2MJ3 A;  2NBW B;  1UNS A; 
#chains in the Genus database with same CATH homology
 4KDL B;  3PRM B;  1P9D U;  2PEA A;  4IUM B;  5CHV C;  2N7D A;  2O6V A;  3NZU A;  2WX0 A;  1E5W A;  4ZDV A;  4K81 A;  3ZNI D;  4EZK A;  1RLF A;  4W9F A;  4FBJ B;  1WGR A;  4HPM B;  2MP2 A;  2ZNV B;  2ZPN A;  1WX7 A;  4RM9 A;  4GIV A;  3JW0 X;  3A1Q B;  1XD3 B;  1T0Y A;  2K8H A;  3H7P B;  4HLE A;  4ZYN A;  2M0X A;  2KDB A;  2KTR A;  3APC A;  1V86 A;  2MBQ A;  2R2Q A;  3TMP B;  3L16 A;  3M63 B;  4WWP A;  2AYO B;  1NDD A;  1R4N I;  3ZRF A;  2J0J A;  3PLU A;  4ANV A;  4NPN A;  4WAA A;  4AWJ A;  3ZVV A;  3DQV A;  3PV1 A;  3UQB A;  2C9W B;  3KW5 B;  4HXD A;  5CHF A;  4ASW C;  4E71 A;  1E8X A;  3JSV B;  1UH6 A;  1YIW A;  4E74 A;  3L08 A;  2PE9 A;  3NOB A;  2K6D B;  2XK5 A;  2KK8 A;  3ZRC A;  2PPH A;  4TQ0 A;  2KTF A;  4WJP A;  2JZ3 B;  2BWE S;  4IC7 B;  4KZ0 A;  2K25 A;  4KZC A;  5LXI B;  1GJZ A;  3APD A;  4NY0 A;  2L00 B;  2BYV E;  4WWN A;  1LXD A;  3RUI B;  2N9E B;  3UF8 A;  2L7R A;  1Q0W B;  3PT2 B;  4FJY A;  1WR1 A;  2MQJ A;  1KLV A;  2KC2 A;  2GBR A;  1SGH A;  2Z0D B;  4GGQ A;  2IO0 B;  2ZNV C;  5TR5 A;  1WXV A;  3M62 B;  4GSW A;  1WXM A;  3RZW C;  3QAR A;  4BBN C;  3ZLZ A;  1UEL A;  4FAD A;  5DPR A;  1NI2 A;  1WFY A;  5FR6 A;  3VUY A;  3VDZ A;  3KUZ A;  2O2V A;  3ENE A;  2KMA A;  4PS3 A;  4IW0 A;  2JT4 B;  2EMS A;  2KDF B;  3TCA A;  4X57 B;  1L7Y A;  3HHM A;  1XQQ A;  3DVG Y;  3WIM A;  3NS8 A;  4EKU A;  2A5U A;  1WJ4 A;  4ZRK A;  2KC1 A;  4EOY A;  3B0A A;  4M0W B;  1ISN A;  2MCN B;  3VUX A;  3WAP A;  1OTR B;  2D3G A;  2FAZ A;  3ZTC A;  4EZL A;  3HIZ A;  5CX3 A;  3UIN B;  4MEM A;  3M3J A;  3GZN I;  2BYE A;  2KX0 A;  2DHZ A;  3C0R B;  2LAS A;  1IYF A;  3CST A;  4XZ4 A;  4FA6 A;  3NZS A;  2BPS A;  2MBH A;  1CMX B;  4E3C A;  1YD8 U;  3AUL A;  1IP9 A;  2L0F A;  1M94 A;  4BKT A;  3TJP A;  3ZW3 A;  1HE8 A;  1KM7 A;  3W1Y A;  1GC6 A;  1UBQ A;  2FCM A;  1P1A A;  2JVC A;  1E8Y A;  5D7G A;  2V4L A;  3EHV A;  5GMV A;  5J18 A;  4ZRJ A;  4ZRI A;  4IWO A;  3UQA A;  2NPT A;  2NVU I;  4GU2 A;  2NPT B;  4WWO A;  1KOT A;  4TV3 A;  4EEW A;  1WJN A;  3PZD A;  4JLC A;  3TIX A;  1S1Q B;  2V3S A;  4K7S A;  1EF1 A;  2LWP A;  2O6V B;  2HTH A;  4FHJ A;  4DK5 A;  3DOW A;  3JSV A;  4PS7 A;  1UD7 A;  1WIA A;  4KIK B;  1OGW A;  3EC8 A;  1SIF A;  2KXJ A;  3ZDT A;  3PRE A;  2LZ6 A;  1WZ0 A;  3AXC A;  4K7W A;  2ZEQ A;  3A4R A;  1K8R B;  2JXX A;  2LD9 A;  2ZVN A;  2KFJ A;  1E8W A;  2DZK A;  4EFO A;  3QC8 B;  4G11 A;  1WZ3 A;  4WJN A;  5KHQ A;  2M4N A;  1JRU A;  2GBJ A;  3QCA A;  4NAW A;  3OAW A;  1FXT B;  2KVR A;  3ZNG C;  2G3Q B;  1UZX B;  5G55 A;  1L2N A;  2RGF A;  2G4D B;  2OOB B;  4DWF A;  1H4R A;  2LI5 A;  1ZGU B;  2AL3 A;  4I6N B;  1C1Y B;  2MSE D;  4LDT B;  4NJ7 A;  4FLH A;  1WGG A;  1TZ1 A;  4FN2 A;  4ANU A;  1C3T A;  1RRB A;  3K9P B;  2KLG A;  2CHX A;  2KKC A;  1WM2 A;  2KHW B;  2KJ6 A;  3DBS A;  3WA0 A;  2C7M B;  3I3T B;  1TBE A;  1V49 A;  3L54 A;  2K8B A;  3A9J A;  3AU4 A;  2MWS B;  2DYB A;  5DPS A;  4DXA B;  3BY4 B;  3RUL A;  3QWZ B;  1WRD B;  1U4A A;  4W9L A;  3JYU A;  2JWZ A;  3JVZ X;  3VAW A;  2KOX A;  4W9G A;  2KWU B;  2L8J A;  4MGK E;  2CKH B;  2EKE C;  2LVQ A;  4BFR A;  1WGD A;  4GOC A;  3DPD A;  1WXS A;  2KQ7 A;  4RM8 A;  4BVU C;  4MJS B;  4W9K A;  2KLC A;  4GDL A;  5D2M B;  4PS8 A;  3IFW B;  5J17 A;  2ASQ A;  2G4S A;  3S2A A;  2KWV B;  3HM3 A;  4BBN F;  2REX A;  4PYZ A;  5E6O A;  3TL5 A;  4MH0 E;  3VTV A;  2IO3 B;  3H1U A;  5JH5 C;  2L0T A;  3SHQ A;  2LRU A;  3PSE B;  3RD2 A;  3QJZ A;  3N30 A;  2WYQ A;  1H8C A;  2LUE A;  4A20 A;  2FID A;  2BYF A;  2HJ8 A;  2KMC A;  4BOS C;  4N9F 4;  4BKS D;  4PYU A;  4KV2 A;  2IYD B;  3PRZ A;  4GDK A;  2M17 A;  1LM8 B;  2A4Z A;  5C1Z A;  3QA8 A;  2BWF A;  3HK0 A;  2KFK A;  4NJ6 A;  4AP4 C;  3A9K B;  4XX5 A;  3L17 A;  2KX3 A;  4RMA A;  2FIF A;  4KDI C;  1WMH B;  1WE6 A;  2KFK B;  1V80 A;  1V9J A;  3V60 A;  3QX1 A;  4B6W A;  3VUW A;  2ZCB A;  5D6J B;  2K8C A;  1Y8R C;  2DAJ A;  4CYE A;  3ZNH B;  2RSU A;  1KJT A;  3V61 A;  1TTN A;  3DDC B;  3WAO A;  3QIJ A;  2YLM A;  4JL9 A;  3PLV A;  2KD0 A;  2ZVO A;  4W9C A;  4HVB A;  1LFD A;  2JUO A;  2DZI A;  2C5L C;  2IY0 B;  3A33 B;  3H7P A;  2D10 A;  4IWQ A;  3QHT A;  2D07 B;  2M1M A;  4KVG B;  3VFK A;  5AZG A;  2MLB A;  4URK A;  1OQY A;  2GBN A;  2NCN A;  2J7Q B;  2KN5 A;  4FJZ A;  4NNJ B;  2LJ5 A;  3WAM A;  1RAX A;  2I1J A;  2BKR B;  3R66 C;  4FJV B;  4AOF A;  1WGH A;  4AJW A;  4I6L B;  2KAN A;  2CU1 A;  2UYZ B;  3VXW A;  4LCD E;  3ML9 A;  1G6J A;  2XEW A;  5CTR C;  1WI0 A;  2LXC A;  3VH4 B;  5EDS A;  2MRP A;  1WX9 A;  1V5T A;  1V6E A;  2JY6 A;  3LDZ E;  2BKF A;  1J0G A;  2J0M A;  3ZTD A;  2D11 A;  5IA7 A;  4WJO A;  3B1L X;  5CHW A;  3OLM D;  5HKH A;  2C60 A;  4B9K A;  2JRI B;  4P7I A;  5AZF A;  3DVN V;  4GB9 A;  2M8S A;  3VHT C;  4HJK A;  4HDO A;  2GOW A;  3UGB B;  2GMI C;  1TGZ B;  2PJH A;  3CSF A;  1S3S G;  4HDQ A;  3L13 A;  1J19 A;  4MSM B;  3UIP B;  2IO2 B;  2W9N A;  2BGF A;  2K39 A;  2MX2 A;  2V1Y A;  1P98 A;  4IM0 A;  4WJQ A;  1GG3 A;  3H6N A;  3KH0 A;  3DCG A;  4WQO B;  2K6Q A;  4JQW C;  3R7Q A;  3Q3F A;  2RPQ A;  4MDK E;  4W9E A;  4B95 A;  2RR9 A;  3PTF C;  4YL8 A;  1WYW B;  3AU5 A;  3PPA A;  2N1W A;  2AEH A;  2DEN B;  2GBM A;  1MG8 A;  5JHB A;  1WGY A;  2CS4 A;  4G3X B;  1Q1O A;  4DDG D;  4F7Z A;  3IHP C;  3MHS D;  1WH3 A;  4DHZ B;  5E6N A;  3DVG X;  3PHW B;  3M95 A;  2KO3 A;  2IZV B;  2DAF A;  2KDI A;  2C7H A;  2KJH B;  3D32 A;  2UWQ A;  4OVU A;  4XC2 A;  1AAR A;  2ZJD A;  3N3K B;  3SDL C;  2WDT B;  3A1Q A;  2FNJ B;  3DVN U;  4I6P A;  4BKS A;  4DDI D;  1E7V A;  3CF6 E;  2N4F A;  5DCN A;  5AZH A;  3VTW A;  3IG3 A;  3QAQ A;  4ANW A;  1IPG A;  1Z5S B;  3T8M A;  4GDL B;  1LQB A;  1EF5 A;  2N1V A;  3SU8 X;  2MBE A;  2MA9 B;  1UBI A;  4IM2 A;  4J6I A;  2CHZ A;  3O65 B;  3KUC B;  2N9X A;  2FCQ A;  4NQK E;  1E7U A;  2FCN A;  2O2V B;  3KYC D;  4OVV A;  2O6V D;  2YVC A;  3KUD B;  3ZUN A;  4DHJ D;  5J2R A;  1GUA B;  3KVF B;  5BO4 B;  2Y5B B;  1WE7 A;  4W9I A;  5G2N A;  3IBE A;  1WMH A;  1WJU A;  3RZF A;  3K9O B;  4K7U A;  4W9J A;  1E8Z A;  1WM3 A;  4LJP B;  1YJ1 A;  3V6E B;  3EEC A;  1RFA A;  4GN1 A;  4CHK A;  4IWP A;  3ECI A;  3VQI A;  3LJ3 A;  4W9D A;  3R3M A;  1V81 A;  2LVO A;  2R2O A;  2N7E A;  3N32 A;  4HK2 A;  4M8N A;  4HCN B;  3X23 A;  4F1S A;  4II2 B;  2LXA A;  1XT9 B;  1YX5 B;  4KSL C;  4BKG A;  2Z59 B;  3PGE A;  2DYM A;  5D94 A;  5IAA C;  3T9L A;  4LDT D;  1F9J A;  1PQS A;  2DZM A;  4K1R B;  5JZE B;  2MW5 A;  4MJS A;  2IY1 B;  2D2Q A;  1ZKH A;  2NBU A;  2DZJ A;  4HWI B;  3BIN A;  3B08 A;  1V5O A;  3H9D A;  3WAL A;  1UGM A;  1P0R A;  4GMV A;  5C23 A;  3RT3 B;  2KJR A;  3EFU A;  2ZCC A;  3HM6 X;  4II3 B;  4MSQ B;  1WXA A;  3OJ4 B;  3PHX B;  3U30 A;  2KZR A;  4AUQ C;  5DPW A;  1WJ6 A;  3ZO5 B;  3VH3 B;  2KQS A;  3VVW B;  2G45 B;  3ALB A;  4TKN A;  2PE6 B;  4W9H A;  5JHA A;  3VTU A;  3V6C B;  3GOE A;  2L76 A;  2ZPY A;  3QK0 A;  3P2B A;  4MEL A;  4BOZ B;  2N9P C;  2AWT A;  2NBV B;  5KHO A;  2DYO A;  2KNB A;  3ZKJ C;  2LGY A;  3U8Z A;  3NHE B;  1WX8 A;  3V62 A;  5L95 C;  3DBL I;  1Z2M A;  3WAN A;  3W1S A;  4MM3 A;  4M8M A;  1V2Y A;  4NQL B;  2HD5 B;  5AEK B;  1I35 A;  1GC7 A;  2KTR B;  3DBH I;  2Z0E B;  2L05 A;  3A9K A;  4KIK A;  2LGD A;  3RCZ A;  3MTN B;  3TBL D;  1YX6 B;  1X1M A;  1R4M I;  2LVP A;  2B3A A;  5E6P A;  3ONS A;  3Q3J A;  2MP2 B;  3W1S C;  1NBF C;  1VD2 A;  2WX1 A;  3NY5 A;  4EZJ A;  3ZNZ B;  4CO7 A;  2CR5 A;  3L0W B;  1D3Z A;  2CHW A;  4HCP B;  3CMM B;  4DHZ E;  3X0W A;  2C7N B;  4GXB A;  4NAW B;  4AJY B;  3DBR I;  5DPT A;  2XK5 B;  2XBB C;  2K1F A;  1GNU A;  5LLI A;  2LGX A;  3APF A;  4ICU A;  3PS6 A;  4FHK A;  1BT0 A;  4ICV A;  1Q5W B;  3ML8 A;  4IM3 A;  1WY8 A;  2LRW A;  3PVL A;  3R7R A;  2IO1 B;  3IVF A;  4MGY E;  4DBG A;  2RD0 A;  2VRR B;  1E90 A;  2MBB B;  4MGZ E;  3MJW A;  4KSK C;  4A3P A;  4JGH B;  4TUU A;  2BF8 B;  3A9J B;  1P3Q U;  3L10 B;  4HPL B;  2JZZ A;  3H7S A;  3AI5 A;  3UIO B;  1OEY A;  4GDK B;  2IBI B;  5LXH A;  4EUT A;  2OJR A;  5L83 A;  1EUV B;  3ZDM C;  3SD5 A;  1WF9 A;  2J0K A;  2FCS A;  2HE7 A;  3ZIM A;  2NR2 A;  2NS5 A;  4LJO B;  3A4S C;  4F8C B;  2EMT A;  2ZZP B;  3OJ3 A;  4A3O A;  3PRP B;  1VCB A;  2QHO A;  2KDE B;  2WWZ A;  4ANX A;  4FUL A;  2KWC A;  1YQB A;  1OEY J;  1SE9 A;  1EO6 A;  2FUH B;  3KYD D;  1J8C A;  2AL6 A;  2DX5 B;  1A5R A;  3U7D A;  2MBO A;  2L3Z A;  3QQ8 B;  4DHJ B;  2JPH A;  2JRH A;  1QZE A;  2I1K A;  1ZW7 A;  4TQ1 A;  3RYT A;  1WR6 E;  1I42 A;  2GBK A;  4JIO U;  2NBW B;  4IG7 B;  2JF5 A;  4G50 A;  4MGI E;  4G0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...