2M4NA

Solution structure of the putative ras interaction domain of afd-1, isoform a from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein AFD-1, isoform a
publication title Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m4nA00
5TR5A 2JXXA 1UELA 3A4RA 3VTUA 4ICUA 1P98A 2KDBA 2LRUA 4LJPB 1WGGA 3KUDB 4KZ0A 3LJ3A 2KLCA 1KJTA 3L17A 3IVFA 1J0GA 2AEHA 4WAAA 3ZNGC 2MW5A 2KTRB 3P2BA 1SGHA 4NPNA 3ZDMC 1CMXB 1LM8B 1XT9B 2O2VA 3KVFB 2UYZB 1TGZB 4K1RB 5LLIA 4EUTA 1ZGUB 2NR2A 1OEYJ 2IO2B 3QJZA 2NPTA 4FULA 2KC1A 2DZMA 3IG3A 4CO7A 4DHZB 2ZEQA 3VTWA 2MQJA 1BT0A 2BYVE 2FCQA 2LUEA 2MLBA 5E6NA 4AP4C 3V6EB 1D3ZA 2XBBC 4FLHA 1J19A 3HK0A 3ZKJC 2N9EB 2GBNA 2YLMA 4TUUA 2V4LA 2KXJA 5CX3A 2FCSA 5JZEB 4BBNC 2IO0B 4GIVA 1E8YA 1WF9A 1G6JA 2PPHA 5CTRC 4CYEA 2K8BA 5JHAA 2I1KA 2FUHB 2MBQA 3APCA 4HJKA 2IY0B 3ENEA 2D10A 2DYBA 4E74A 2O6VD 3KW5B 1E8ZA 1E8XA 3IHPC 3QARA 3UINB 3DVNV 3ZRFA 2BF8B 3M63B 3DBLI 2AL6A 3L54A 3ONSA 1V2YA 4PYUA 3DDCB 3WAPA 4MM3A 3QAQA 3VXWA 2D11A 4AWJA 3PLUA 1KOTA 3EHVA 5JHBA 1WR1A 4IM3A 1WGYA 4W9FA 3DVGY 3U8ZA 4KIKB 4JIOU 1VCBA 3B1LX 3NS8A 4NJ6A 3NZSA 3H7SA 5LXIB 3RCZA 3CMMB 1Q1OA 1K8RB 4PS8A 2IYDB 3UIPB 2NVUI 4MSQB 2L8JA 3JVZX 4GU2A 4MJSB 3ZUNA 1V86A 4W9LA 3A9KA 2N4FA 3OJ4B 2N7DA 2KJRA 2BWFA 3DCGA 2IO1B 1LQBA 5J17A 4ANWA 3U7DA 3RD2A 3QQ8B 2EMSA 2KDEB 2LD9A 1P0RA 4B6WA 3PLVA 2LXAA 3KH0A 1WXMA 5DPWA 2ZCCA 4JGHB 5AZGA 2A4ZA 3HM6X 3PRZA 4HPLB 2IZVB 3APDA 1Q0WB 4NQLB 4DK5A 2KD0A 1WJUA 3GOEA 3Q3JA 2XEWA 4PYZA 3A9JA 2KTFA 3V62A 1WZ3A 5E6OA 4KVGB 3B08A 3QX1A 3EECA 2QHOA 3QCAA 4HLEA 3DPDA 4DXAB 2JY6A 2KJHB 3MJWA 4BOZB 4ZDVA 2MRPA 4BBNF 4HVBA 1A5RA 1TTNA 2C9WB 5E6PA 2L0FA 3X23A 2ZJDA 2M4NA 3ML8A 2D3GA 3HIZA 3AI5A 3R7QA 2KKCA 4WJNA 2NS5A 4YL8A 3L0WB 2BKRB 4FHJA 3ZNID 3SHQA 2KWUB 2PE9A 3OLMD 4GOCA 3RZFA 2K6DB 1SE9A 1KLVA 3UGBB 2K8HA 3VDZA 3IFWB 1WMHB 3PVLA 3L13A 4LDTB 5L95C 2G45B 2LRWA 5HKHA 5D2MB 2FAZA 4N9F4 2FCNA 5DPTA 4FA6A 1AARA 1R4MI 2KMAA 4KSKC 3RT3B 3DBRI 3TMPB 4BFRA 1IP9A 3DOWA 1T0YA 3ZVVA 3M3JA 4TV3A 1V9JA 2NCNA 1YIWA 3VAWA 1WX7A 4MELA 3SDLC 1E8WA 3VUYA 3UQBA 1GC6A 2AYOB 1UZXB 2J0KA 2L3ZA 1Z2MA 4HDQA 4IM0A 4GGQA 4M8MA 4FBJB 5C23A 2XK5B 2R2QA 3WAOA 2KFKB 3PTFC 2DYMA 3N30A 4NJ7A 3TIXA 3VVWB 3TBLD 1WH3A 2NBWB 3NY5A 4GDLB 1YQBA 2NBUA 2JF5A 2KQ7A 4GXBA 4IW0A 3MHSD 5EDSA 4HPMB 4CHKA 2JRHA 2JWZA 4PS3A 1WY8A 3QHTA 4E3CA 2W9NA 1S1QB 2MBOA 2V3SA 3PZDA 4NAWB 2N9XA 2L05A 2KNBA 3VTVA 4AJYB 4WJQA 3W1SA 4A3PA 4FN2A 4W9IA 2RD0A 2DX5B 4WWOA 2CKHB 3PRMB 1U4AA 4JLCA 4M0WB 4GDKA 2J7QB 4IG7B 2N9PC 2O6VA 1WM2A 2PJHA 3PS6A 4MSMB 4AOFA 4TKNA 4BOSC 2DZIA 3H9DA 2DAJA 3L10B 3QA8A 3V60A 4MGZE 1I42A 1WX9A 2KWCA 3PT2B 4MGKE 2KJ6A 1XD3B 2KO3A 3NOBA 4NNJB 1YX5B 2WX0A 1WGHA 1V81A 3PRPB 4ICVA 3N32A 2N7EA 1E90A 2K25A 4IWQA 3ECIA 2KN5A 3V61A 2A5UA 3ZDTA 2ZZPB 2LGXA 2LVPA 1UGMA 4ANVA 5KHOA 1MG8A 1WXVA 1ZKHA 4W9CA 3DBHI 3WANA 1ZW7A 3QK0A 3JYUA 3QIJA 3JSVA 3H6NA 3JW0X 2MP2A 1UBIA 5IA7A 3HHMA 4WJPA 5CHVC 4K7WA 2CHWA 2N1WA 4HXDA 2FCMA 2V1YA 4KSLC 4X57B 4ZYNA 4BKSA 5AZHA 2Y5BB 4EKUA 4OVVA 2WWZA 4GB9A 3PHXB 3DBSA 4EZLA 3PREA 1H4RA 2O2VB 3KUZA 2MWSB 4HDOA 1OEYA 3DVNU 2LVOA 2NPTB 4ANXA 5CHFA 3ZTCA 1C1YB 1HE8A 1V6EA 5GMVA 3UQAA 2MCNB 3RUIB 5AEKB 4LDTD 5DPSA 4GDKB 4RM9A 2K6QA 1NBFC 2KWVB 4RMAA 4OVUA 4W9HA 4GN1A 4II2B 3U30A 4GSWA 2MBBB 2MBEA 2M1MA 1WZ0A 4HCPB 5J2RA 2B3AA 4E71A 3AU4A 2KVRA 2J0JA 3VHTC 1UD7A 2C7MB 2KHWB 1LXDA 3X0WA 1KM7A 2YVCA 4W9JA 3M95A 1EF5A 2FIFA 2GBMA 2MSED 3WAMA 4P7IA 4DBGA 2IY1B 2ZNVB 3EC8A 4DWFA 2KTRA 2AWTA 3PSEB 4W9GA 3ZO5B 2GBKA 4G0NB 2JRIB 5C1ZA 1SIFA 2LGYA 4M8NA 4RM8A 3OAWA 2BGFA 2L0TA 1EO6A 2WDTB 2WX1A 2JVCA 3O65B 4LCDE 1Q5WB 1TZ1A 4ZRIA 3VFKA 1J8CA 2HTHA 2KK8A 4KDLB 3VUXA 2KX0A 2LASA 2AL3A 4FJVB 2BYEA 1RLFA 2DENB 3K9OB 1IPGA 2EMTA 3PV1A 3RZWC 4AUQC 3K9PB 2G4SA 3A9KB 4F8CB 1F9JA 1V5OA 2D2QA 2RGFA 1WIAA 3QWZB 1WXSA 2CU1A 2LGDA 3V6CB 4TQ1A 2PEAA 5CHWA 4J6IA 4F1SA 3W1YA 3APFA 4ANUA 2LJ5A 2RPQA 5D94A 3ZRCA 1V5TA 4W9DA 4URKA 5DCNA 1ISNA 3TL5A 1L2NA 4KDIC 4XZ4A 2KDFB 2Z59B 2K39A 2ZVNA 1X1MA 3A4SC 3A9JB 4KV2A 4MDKE 5G2NA 4NQKE 2L76A 2IO3B 3B0AA 4KIKA 5D6JB 2HE7A 2DZJA 2KLGA 2Z0DB 5FR6A 3CSFA 4IUMB 3MTNB 4HWIB 3R66C 1M94A 4ZRKA 4DHJB 1EUVB 1WM3A 1NDDA 4WJOA 2CR5A 2J0MA 2KX3A 4MJSA 1P1AA 1RAXA 1WJ4A 2L00B 3AULA 3R7RA 1WE6A 3TCAA 3WIMA 1FXTB 2MBHA 2KMCA 1WXAA 3M62B 3L16A 3CF6E 3I3TB 4K81A 3AXCA 2HD5B 1VD2A 1I35A 1TBEA 2LZ6A 3T9LA 2R2OA 2I1JA 3CSTA 3UIOB 2D07B 2DHZA 4K7UA 2VRRB 3NZUA 3ZNZB 2C5LC 4I6LB 1OTRB 3KUCB 4MEMA 3WA0A 1R4NI 2GOWA 3WALA 5BO4B 4WQOB 2RSUA 1GJZA 2KZRA 2M8SA 4I6PA 3PPAA 4KZCA 2KC2A 3A1QA 4WWNA 2KDIA 4FADA 4WWPA 3OJ3A 1WRDB 1IYFA 2L7RA 2DYOA 3QC8B 4A20A 4ZRJA 4EFOA 2BKFA 3KYDD 1C3TA 1GUAB 2IBIB 2GMIC 5J18A 4AJWA 2EKEC 3NHEB 3TJPA 1WGDA 2C60A 2FNJB 2JUOA 4II3B 5D7GA 3VQIA 2BWES 1WGRA 2PE6B 3VUWA 4JL9A 2ZPYA 4HK2A 2M17A 5DPRA 3GZNI 1WMHA 3ZNHB 3ZW3A 4W9KA 4DHZE 1NI2A 2GBJA 2JZ3B 1UH6A 4EOYA 3H7PA 2WYQA 3D32A 4FJYA 5AZFA 1JRUA 1YD8U 2ZCBA 3SD5A 2KFJA 2CHXA 3A33B 4TQ0A 1RFAA 2OJRA 1H8CA 1Z5SB 2N1VA 3PGEA 4MGYE 3ZIMA 2JZZA 2HJ8A 4EZJA 2O6VB 3BINA 4FJZA 4ASWC 1E7UA 3AU5A 3DQVA 1OGWA 2XK5A 4XX5A 3UF8A 4IWOA 2KOXA 2M0XA 2KFKA 4FHKA 2G3QB 3PHWB 1WYWB 1WI0A 4I6NB 4BVUC 2MA9B 3ML9A 2C7HA 2ZPNA 3Q3FA 4B9KA 1WR6E 1S3SG 2KANA 4GDLA 1LFDA 1Y8RC 1UBQA 4PS7A 3KYCD 4BKSD 3RYTA 1WE7A 2BYFA 3ALBA 1GNUA 1GC7A 3L08A 3ZTDA 1V80A 1E5WA 2C7NB 3LDZE 4NY0A 4G11A 1GG3A 3H1UA 4G50A 4K7SA 3A1QB 3HM3A 1WFYA 4NAWA 2BPSA 3SU8X 2ZVOA 5G55A 5L83A 2G4DB 5IAAC 4HCNB 3IBEA 2DAFA 2JPHA 1EF1A 3BY4B 1YX6B 1WX8A 2ASQA 1QZEA 2LI5A 3JSVB 2MP2B 1WJ6A 1E7VA 2REXA 4DHJD 3W1SC 2JT4B 3ZLZA 4A3OA 2KQSA 1YJ1A 4G3XB 1P9DU 4B95A 4BKGA 4F7ZA 5LXHA 4DDID 4GMVA 3VH3B 2CS4A 3RULA 2DZKA 3H7PB 4W9EA 2LVQA 4EEWA 1V49A 1RRBA 4IM2A 3VH4B 2Z0EB 4XC2A 3EFUA 2K8CA 2FIDA 4DDGD 5KHQA 1P3QU 3R3MA 3S2AA 4MH0E 2LWPA 3C0RB 4EZKA 5JH5C 4LJOB 3DVGX 2K1FA 2ZNVC 4MGIE 2RR9A 1OQYA 2LXCA 2NBVB 2CHZA 2OOBB 2GBRA 1PQSA 3N3KB 4IC7B 2UWQA 4IWPA 3T8MA 4BKTA 2MX2A 1L7YA 4JQWC 1XQQA 1WJNA
chains in the Genus database with same CATH superfamily
5TR5A 1UELA 1ZPSA 3BWUD 3U4EG 1J0GA 3ZNGC 1FD6A 1KH0A 5IP4D 1LM8B 4EUTA 1OEYJ 3QJZA 2KC1A 2DZMA 4DHZB 1FXIA 1FFVA 2MLBA 5E6NA 2JU6X 3V6EB 1D3ZA 2XBBC 1YJJA 1J19A 3HK0A 2N9EB 4TUUA 2V4LA 1ZE3D 4GIVA 2JWUA 5JHAA 4CYEA 1FIQA 3W2DA 2WP9B 1QT9A 2DYBA 4E74A 3U52E 2MJ3A 1E8ZA 3QARA 3UINB 3DVNV 3ZRFA 2BF8B 3L54A 1SB3C 4PYUA 1F52A 1SF0A 4MM3A 3TSSA 4AWJA 3IT4B 4XDCA 4IM3A 1WGYA 4W9FA 5G5GA 1BXTA 1JWMD 1E10A 3W5UB 4MSQB 2AQ2B 3AEEB 1FRDA 4MJSB 3OJ4B 2WNMA 2BWFA 1P0RA 2LXAA 4JGHB 1V97A 3HM6X 4KKIA 2IZVB 2INPE 1Q0WB 2KD0A 3NJTA 3A9JA 3SFEB 3EECA 1T5XD 3IT6B 2KJHB 2V4IB 4HVBA 4BBNF 4KGRA 3ML8A 1ZOYB 2NS5A 2BKRB 1DOYA 2KWUB 4S0RA 1HZ6A 1D5ZC 3VDZA 3PVLA 3L13A 4LDTB 5L95C 1L0VB 3GE8C 5EE1A 1JWBD 1MJDA 1AARA 3RT3B 1C4PA 3DOWA 1T0YA 1N6ZA 4N59A 1YIWA 3EFCA 1GC6A 1T0SC 3AEFB 1QOAA 4C4VB 3PZ8A 2KFKB 4NJ7A 3TBLD 1V1PB 1YQBA 1C77A 1D6EC 3AN1A 3NG0A 4CHKA 2JRHA 2RPVA 3H8HA 4YSYB 1WY8A 2MBOA 4NAWB 3PZDA 4WURA 4AJYB 3W1SA 3N9YC 4FN2A 4WWOA 3PRMB 4ZOHC 3KLSX 3Q6BA 3C19A 4IG7B 1MG4A 2N9PC 2PJHA 3PS6A 2J52A 2ZW0A 1KLUD 4BOSC 3ZXRA 4M00A 4MGZE 1JALA 3PT2B 1XD3B 3NOBA 1YX5B 3DWGC 2L52A 1PGAA 4CQNA 2N7EA 1E90A 1DOXA 2ZZPB 2LVPA 1UGMA 1XLPA 3DBHI 1XLQA 1FCLA 2CJOA 3JW0X 4LTUA 2BQQA 3KWVA 3NUHB 5CHVC 2WDRB 2V1YA 5MPOA 5AZHA 1I4RA 1YN4A 4EKUA 1ROEA 2WWZA 2INNE 3HUIA 2LVOA 2NPTB 4XGAB 2HTME 2MCNB 4LDTD 1FNVA 2KWVB 4ARIA 4OVUA 3U30A 4II2B 1PUTA 5BYSA 4R3DA 3SFDB 2M1MA 1E7PB 1WZ0A 1AW7A 2ON8A 3X0WA 1KM7A 3BVMA 3M95A 2GBMA 2QILA 3V3XA 3EC8A 1FRRA 2NTTA 1TJEA 2H89B 2GLSA 3ZO5B 5C1ZA 1SIFA 4HROA 2KVZA 4M8NA 4YSXB 3OAWA 2FBWB 1EO6A 2JVCA 3O65B 3ZQ4A 4ZRIA 2KAJA 4WQMA 2KX0A 4FJVB 1VLBA 2EELA 2Y3AA 2IDYA 1F9JA 4F8CB 3BZDB 2D2QA 1WXSA 3V6CB 3LYYA 4TQ1A 4J6IA 4LNFA 2KMMA 1QOFA 2RPQA 1XF5L 1YN3A 4P16A 2ZVNA 2LUMA 2L76A 1V8CA 4KIKA 4L23A 1JW9D 2V9HA 5FR6A 4IUMB 3MTNB 3ZJVA 3R66C 1M94A 4ZRKA 4DHJB 4JE3B 2PVGC 2L00B 3R7RA 1WE6A 3WIMA 2MBHA 3KQ4A 4K81A 1I35A 3T9LA 2R2OA 1HTOA 2I1JA 3Q8EA 3UIOB 3NZUA 3ZNZB 4NZLB 3WALA 1YMHE 2GOWA 5BMGA 1ET6A 5BO4B 1GJZA 2M8SA 3Q8BA 5JXVA 3PPAA 4WWNA 2KDIA 3I5JC 1ZXIA 4FADA 3OJ3A 1IYFA 3QC8B 4N58A 1C3TA 1GUAB 2V3PA 3NS1A 2M56B 4OZBA 5J18A 4AJWA 2EKEC 3NHEB 2C60A 1D4BA 2YEPF 3VQIA 1WGRA 2BTEA 1F2RC 2ZPYA 3AE3B 1NI2A 4O1NA 2QSDA 2ZCBA 2CHXA 5IKCM 3AE2B 1N5XA 4MGYE 4HKZE 3AU5A 3DQVA 1OGWA 2XK5A 2M0XA 4FHKA 3U2SC 2MA9B 3V05A 1IBXB 1FFUA 1Y8RC 2FUG1 1R4NB 3ZTDA 3FAHA 1E5WA 1SSNA 3LDZE 1VR9A 3HM3A 3EUB2 2ZVOA 2IGHA 2DAFA 2JPHA 1QZEA 4M0WA 3JSVB 2UU7A 2MP2B 4DHJD 3W1SC 2MJEA 4A3OA 2QJLA 3GB1A 2WXLA 2AX5A 2MH7A 5LXHA 3MFGA 2CS4A 3RULA 4A55A 4M01A 2LVQA 2BS3B 1V49A 3VH4B 2Z0EB 4XC2A 2K8CA 3ETRA 5BYRA 1PGXA 3R3MA 3AE7B 3C0RB 1ZP0B 4US8A 4K3BA 3N3KB 2GBRA 1I7HA 2UWQA 2WHIA 2Q5WD 2K3UA 1XQQA 3ZUNA 3A4RA 3VTUA 3AE5B 1N60A 2LRUA 3NVWA 4LJPB 1WGGA 1WGKA 2N7JA 3KUDB 2AEHA 4WAAA 3WCQA 2KTRB 4NPNA 3ZDMC 1JCKB 3KVFB 2J4XA 1ZGUB 4GLSC 4FULA 3IG3A 3BYTB 2MQJA 1TYGB 1BT0A 3AM9A 2PVOD 2GBNA 2FCSA 4DQOC 5JZEB 2IO0B 2FUHB 4M02A 1VZ8A 3APCA 2BS2B 2WXJA 4HJKA 3KW5B 4JX1C 3N1YC 2W82A 1N5WA 4KGTA 3EGRA 3M63B 1V1OA 3ONSA 1WRIA 1BUIC 2AL6A 1TKYA 3DDCB 4L2YA 3WAPA 2QDFA 1WXQA 1MHHE 3EHVA 5JHBA 1WR1A 3DVGY 3DHHC 3U8ZA 3Q2AC 4A6QA 1VCBA 1ET9A 3H7SA 1EU4A 2GI9A 1K8RB 1QLBB 3R2IA 2NVUI 4GU2A 3DHGC 3A9KA 2QC8A 2MHJA 3Q14C 2JZPA 5J17A 3RD2A 1QQRA 2LD9A 1N63A 1WXMA 4ZHPA 3PRZA 4HPLB 3BVGA 4NQLB 4DK5A 1SIJA 5IO9A 1WZ3A 1ZXHA 3B08A 3QCAA 1T3QA 4BOZB 4ZDVA 1TTNA 5E6PA 1F2RI 3X23A 1C4CA 2ZJDA 1Y56A 4LNNA 2D3GA 3R7QA 4WJNA 3TEZA 4YL8A 3L0WB 2W3RA 1ENFA 3OLMD 4GOCA 3RZFA 1OQQA 2K6DB 1SE9A 2LRWA 2FAZA 2FCNA 4FA6A 2KMAA 4BFRA 2CU3A 3ZVVA 4KGSA 1FNWA 3RNCC 1WX7A 4MELA 3SDLC 5I4DA 1FNUA 3UQBA 4H2AA 1UZXB 2J0KA 5HI1A 1Z2MA 4RNAA 1N61A 3WAOA 4TMAB 3PTFC 2DYMA 3N30A 3TIXA 3R2TA 2NBUA 2JF5A 4NJCA 1SE2A 2FE8A 2JWZA 3SEBA 3GS2A 2LGSA 3QHTA 2WXGA 2W9NA 2V3SA 2L05A 1ZDVA 1SEBD 4W9IA 2DX5B 1EWCA 3RMKC 2CKHB 2WU5B 1GAQB 2J7QB 2O6VA 1WM2A 4S17A 1J7CA 4MSMB 4YTPB 1KTKA 4AOFA 1FO4A 1UWXA 3AE9B 3QA8A 3V60A 5H92C 2KWCA 2IJ0A 3EA6A 2W54A 3N32A 1NI3A 4DXGA 3ECIA 2KN5A 3ZDTA 2N0SB 4YXDB 2VH1A 1K53A 3J9CA 3W5VB 4QAYA 3H6NA 5BMIA 2INDC 3HHMA 4WJPA 4XDDA 2WXFA 2N1WA 2FCMA 2BBCA 4C7ZA 1Q10A 3HVZA 2WXQA 1NYRA 4GB9A 1KLGD 3RPFC 4AS1A 1H4RA 4HDOA 5FKAC 1J7BA 2JSVX 4A90A 3NVZA 5AEKB 4RM9A 5FR3A 1NBFC 4N6EB 1VDVA 4GSWA 3OG5A 1CK1A 1PDXA 4E71A 3AU4A 3Q3NC 2KHWB 1LXDA 2YVCA 1MI0A 1JMLA 4W9JA 2OEDA 2KDMA 4DBGA 1KFYB 1OQRA 1JWAD 4MM3B 4G0NB 1XCTL 1D5MC 2BGFA 3Q3OC 2L0TA 3LB8C 1Q5WB 4RF0A 3K9OB 1QILA 1OFFA 1IPGA 3AMZA 3K9PB 3ZJTA 1WIAA 3NRZA 1FCCC 5CHWA 1ZUD2 1QOGA 4F1SA 1QF6A 2OHFA 2W3SA 2D3BA 4W9DA 4LK0M 5DCNA 2SEBD 3TL5A 4KDIC 3A4SC 4KV2A 2WXKA 3A9JB 5G2NA 1YQ4B 5D6JB 1E6EB 1I4XA 2G1EA 4HWIB 2W55A 1NDDA 2CR5A 1P1AA 1RAXA 1WJ4A 2N9LA 2WU2B 1FXTB 3I9V1 3OWEB 4LNOA 3M62B 3N1ZC 3CF6E 2HD5B 2BYTA 1TBEA 5T8IA 1QKZA 3T3NA 1NENB 1AWDA 4K7UA 4OZCA 1LO5D 4I6LB 2WXRA 3KUCB 5HG2A 3WA0A 1R4NI 4KX6B 2RSUA 4I6PA 1PYWD 2KC2A 3PZ7A 1WRDB 2L7RA 1GB4A 1MPEA 2DLBA 2LEKA 4YTMB 3RI7C 2GMIC 1WGDA 3AEBB 4II3B 5D7GA 4PK1A 5LNK1 2BWES 4JL9A 2DNFA 3AEAB 1A70A 4BAXA 1WMHA 3ZW3A 3TEWA 3NVYA 4EOYA 2WYQA 4FJYA 2Z8LA 5AZFA 2LGIA 1YD8U 1TS3A 3A33B 4TQ0A 3FILA 1RFAA 3PO0A 3PGEA 4EZJA 2KWDA 3FKYA 3B2FA 4ASWC 4XX5A 4IWOA 1XXGA 1SE3A 4BVUC 4L1BA 3ML9A 2ZPNA 3Q3FA 1WR6E 4GDLA 1LFDA 1UBQA 4PS7A 3KYCD 1WE7A 2BYFA 1GC7A 3L08A 1NEKB 2C7NB 4NY0A 4G11A 3H1UA 5L83A 3RNEC 5IAAC 4HCNB 3BY4B 1WX8A 2LI5A 1WJ6A 2K9XA 4Q2JA 1L6VA 2M0AA 4G3XB 1HXYD 2DZKA 1AN8A 3URYA 2IGGA 1HTQA 4EEWA 2FIDA 4DDGD 2ACZB 3S2AA 4AQ7A 2PMVA 2LWPA 4YSZB 4EZKA 5JH5C 4XE0A 2LMCA 1RM6C 4IWPA 2J53A 4JQWC 1WJNA 5IN7A 2JXXA 1TKGA 3LJ3A 1IUEA 3NZ3A 3L17A 3IVFA 3AE4B 2MW5A 1SGHA 1CMXB 1XT9B 2O2VA 3NVVA 2IO2B 4B0EA 2ZEQA 2QIEB 1HEZE 2BYVE 4AP4C 3ZGZA 4ZHOA 1RYJA 2YLMA 4USAA 1SJHD 4BBNC 1E8YA 1G6JA 2I1KA 2MBQA 2PTLA 1NVID 3ENEA 3AECB 1E8XA 3IHPC 4NAMA 3O13A 3QAQA 3VXWA 2NMQA 1RFKA 3PLUA 4LNIA 1MHXA 2WQYB 4KIKB 2LHEA 4PT5A 3RCZA 3CMMB 1SXTA 1Q1OA 4PS8A 2L8JA 2GRIA 4W9LA 1MFWA 2N7DA 2DWQA 2WXOA 2KJRA 4RGTA 5E6JA 4ANWA 3U7DA 4B6WA 2I38A 2KDEB 3KH0A 5DPWA 2ZCCA 5AZGA 1F0ZA 3APDA 2JXTA 2XEWA 2RMMA 4PYZA 2KTFA 4MACA 4KVGB 4C56C 3QX1A 1STEA 2BVCA 2JYEA 2QHOA 1EM7A 1K50A 2NTSA 2YEPB 2L83A 2LFIA 3MJWA 2MRPA 1A5RA 4JWSC 2C9WB 3KWLA 2GB1A 2L0FA 4DXFA 3SR6A 1HA5A 2WGSA 3HIZA 5TSSA 2KKCA 2DBYA 4FXCA 4YT0B 3ZNID 3DBLB 3SHQA 2PE9A 1QOBA 1M4VA 1KLVA 2K8HA 3IFWB 5HKHA 4N9F4 2BS4B 4KSKC 3DBRI 2BB6A 3TMPB 1IP9A 3BYYB 4TV3A 2R61A 1V9JA 2E6XA 1FXAA 2WDVB 3VAWA 2L1AA 2LHDA 5EE0A 3VUYA 1DOIA 2AYOB 2L3ZA 3TEXA 4FBJB 5C23A 1XLOA 2XK5B 3AEGB 2PLPA 3RN9C 3AE8B 3MHSD 5EDSA 4US9A 5FK9C 4PS3A 2KN4A 5BYQA 3CIRB 2OJWA 1U4AA 3MJ5A 3E9SA 4M0WB 1P7FA 2DZIA 3L10B 1I42A 4J3OD 1WX9A 3L4PA 4MGKE 2KJ6A 3W9CB 1R4MB 2WX0A 3PRPB 2K25A 1ESFA 4YTNB 1ZKHA 1FEHA 1N62A 4W9CA 3WANA 3Q8AA 3QK0A 2PW9A 5IA7A 5AUIA 4KSLC 4ARCA 1C76A 2K22A 4BKSA 4EE2A 1L0YB 2XN9C 3PHXB 4EZLA 1LGRA 3PREA 3KUZA 1OEYA 3DVNU 4ANXA 1V6EA 3RUIB 4ZYSA 1PFDA 5DPSA 2K6QA 4W9HA 4GN1A 4HCPB 2B3AA 2KVRA 1UD7A 2C7MB 2BB5A 2BT6A 3AV8A 1TS4A 3WAMA 2WLBA 2IY1B 2ZNVB 2AWTA 3PSEB 4W9GA 1YNTE 1UGJA 1C9FA 2LGYA 4RM8A 2RDGA 2WDTB 1TZOA 1AYFA 2L32A 2HTHA 4KDLB 3VUXA 1IGCA 1JWUD 2AL3A 2BYEA 2DENB 2EKIA 3PV1A 3RZWC 3A9KB 2QEJC 3Q8FA 3RNAC 2JYTA 2RGFA 2CU1A 4LNKA 2LGDA 3Q8CA 2PEAA 4A9AA 3W1YA 2PKOA 3APFA 2IGDA 2LJ5A 5D3DA 3ZRCA 1ISNA 3I57A 4XZ4A 2K0PA 2K39A 1X1MA 1XCQL 4MDKE 4NQKE 3B0AA 2IO3B 2AQ3B 2DZJA 2KLGA 2Z0DB 3CSFA 1EUVB 1WM3A 4WJOA 5D3IB 2KX3A 4MJSA 3AULA 2KT7A 1WXAA 3L16A 2WXIA 3E56A 3AXCA 3ZYYX 1L6UA 1ZDXA 2LZ6A 4OW0A 2DHZA 2C5LC 4MEMA 3DBRB 4WQOB 4BZAA 4B0MA 4KZCA 3A1QA 4ITKA 4HPPA 4WWPA 2DYOA 4EFOA 2BKFA 3KYDD 4RGMA 2QMTA 3MC9A 2FNJB 2H88B 4MT5A 1CJEA 1SBBB 4MH8A 2PE6B 5DPRA 1WWTA 2GBJA 5GXGB 1XLNA 3D32A 5C2TB 3TEYA 2OJRA 1H8CA 1Z5SB 2N1VA 4IDIA 3P42A 2O6VB 4FJZA 4C4VA 3UF8A 4HEA1 1WYGA 1RWSA 2KOXA 2KFKA 3B2GA 1TS2A 1WYWB 1WI0A 3PHWB 4I6NB 5C3JB 2C7HA 1VZ6A 1V1PA 2KANA 4BKSD 3ALBA 1GNUA 1V80A 3MP9A 4G50A 3A1QB 1WFYA 4NAWA 3R8BA 1MVKA 3SU8X 5G55A 5G5HA 2G4DB 2RDBC 4C7YA 1YX6B 2ASQA 3GE3C 2E3TA 3ZLZA 1YJ1A 1P9DU 4B95A 3ZJUA 4BKGA 4RCOA 3GZNB 4F7ZA 4DDID 4GMVA 1YQ3B 3IXSA 4RF1A 3EFUA 5KHQA 4LLGM 1R7SA 2K1FA 2ZNVC 3N20C 1OQYA 2NBVB 2CHZA 2OOBB 1YOVB 1TY2A 2QCZA 3AE1B 3P4QB 4ICUA 1P98A 2KDBA 2WS3B 4KZ0A 2KLCA 1KJTA 3VR9B 3P2BA 3B9JA 4K1RB 5LLIA 1VRAB 2UYZB 1TGZB 3UI3A 5HFYA 2NR2A 2NPTA 1TS5A 4CO7A 1FM0D 3VTWA 1J7AA 2FCQA 1NYQA 2LUEA 4YWGG 4FLHA 3ZKJC 1TY0A 5CX3A 2KXJA 1HZ5A 1TT5B 1C4AA 1WF9A 1KRHA 2PPHA 5CTRC 2K8BA 1FMAD 1B1ZA 4XWWA 2D3AA 2IY0B 2B76B 2D10A 2O6VD 3IAM1 3DWMA 3P4PB 3DBLI 3Q3MC 1V2YA 2ZW1A 2D11A 1KOTA 1CZPA 3FC4A 4JIOU 3B1LX 3NS8A 4NJ6A 3NZSA 5LXIB 2IYDB 3UIPB 3JVZX 1V86A 1SE4A 2N4FA 3HRDD 2LJIA 4XYCA 3DCGA 2IO1B 1YN5A 1LQBA 3QQ8B 2EMSA 3PLVA 4ACFA 2N9KA 2A4ZA 3VRBB 2WXMA 4C80A 1WJUA 3GOEA 1UUPA 3Q3JA 3V62A 5EE9A 5E6OA 3TUOA 4HLEA 2I2YA 3DPDA 4DXAB 1GPXA 2JY6A 1EU3A 3ABVB 2M4NA 1P7EA 3AI5A 1ACCA 4FHJA 1E9MA 2XNAC 3VRAB 1SJED 3UGBB 4HJGE 1WMHB 2G45B 3P63A 4RGNA 5D2MB 5DPTA 1R4MI 4KKJA 1FPYA 1L5PA 3M3JA 3FILB 2NCNA 1E8WA 1E0ZA 1PGBA 4HDQA 4IM0A 4GGQA 1L4ZB 4M8MA 2R2QA 3C8YA 3VVWB 4D2KA 1WH3A 2NBWB 3NY5A 4GDLB 2KQ7A 4GXBA 4IW0A 4HPMB 2KACA 1JROA 4E3CA 4UDUC 1S1QB 2N9XA 2KNBA 3VTVA 4WJQA 2PIAA 4A3PA 2TSSA 2RD0A 4JLCA 2M19A 3BK1A 5BMHA 1T6BX 4GDKA 3RNGC 1I4GA 2JX5A 4TKNA 1TKEA 1IBXA 3H9DA 2DAJA 3T3OA 3N1XC 2VZKB 2X8XX 2KO3A 3P4SB 2G9HD 4XWTA 4NNJB 1WGHA 1V81A 4ICVA 2Y5CA 4IWQA 3V61A 2A5UA 2LGXA 4ANVA 2AQ1B 5KHOA 1MG8A 1WXVA 2WDQB 1ZW7A 3JYUA 1JRPA 2MJDA 3QIJA 3JSVA 2MP2A 1UBIA 4K7WA 4JPSA 2CHWA 1DGJA 3ZXVA 4HXDA 4ZYNA 4X57B 3GP7A 3DHIC 4IOIE 2Y5BB 1KF6B 3MC8A 4OVVA 3DBSA 3Q69A 1C79A 2O2VB 4JWUC 2MWSB 1HQRD 3P4RB 5CHFA 3ZTCA 1C1YB 1HE8A 5GMVA 3UQAA 4OHJA 1K52A 4GDKB 4RGOS 2WXNA 4RMAA 2MBBB 1GB1A 2HDEA 2MBEA 2MEKA 5J2RA 4RH6A 3MC0B 2J0JA 3VHTC 4C00A 2CJNA 4K3CA 2Y5PA 1EF5A 2FIFA 1YJIA 2KQ4X 3CWIA 2MSED 4P7IA 4P6VF 4DWFA 2KTRA 1B9RA 2KYWA 4HKQA 4ZRPA 2GBKA 2JRIB 2J42A 2WX1A 4LCDE 2INCC 1TZ1A 3DBHB 5HHDG 3VFKA 3I63C 2KK8A 1J8CA 3P1MA 2LASA 1RLFA 2EMTA 4TSSA 4AUQC 2G4SA 1V5OA 3QWZB 1K51A 2SAKA 3HVDA 1JWSD 1D5XC 2V0GA 4ANUA 5D94A 1CQVA 1V5TA 4URKA 1L2NA 2KDFB 2Z59B 2VZKD 2BW2A 2IPKD 4P1CC 2HE7A 1I4PA 3AH7A 2ONQA 3U7ZA 1GOZA 2J0MA 3TCAA 2KMCA 4A8XC 1UWMA 5IOIA 3I3TB 1VD2A 3CSTA 2D07B 4WIPA 2VRRB 2X38A 2V3NA 1L4DB 1OTRB 4OZAA 2KZRA 4P1BC 1TIFA 3VR8B 4IKGA 1I4QA 4A20A 4ZRJA 3BK2A 2IBIB 1JQ4A 3TJPA 2JUOA 2WXHA 3RNBC 3RNFC 2HJ1A 3VUWA 4HK2A 2M17A 1UF0A 3AE6B 3GZNI 4ZRQA 2VH2A 3ZNHB 1F1HA 4W9KA 4DHZE 2JZ3B 1UH6A 1EWYC 3H7PA 1JRUA 3SD5A 2KFJA 1VZ7A 4REZA 4WWMA 3ZIMA 1T0RC 5EE3A 2JZZA 2HJ8A 3BINA 3LXFA 1C78A 1E7UA 1UNSA 2K5PA 3BVZA 2G3QB 4B9KA 1S3SG 3RYTA 4WH4A 3BIID 1I4HA 2WXPA 2RDHA 4K7SA 1GG3A 1DYQA 2BPSA 3IBEA 2D5GA 2ICIA 1EF1A 1T0QC 3AEDB 1F77A 3RFZB 1E7VA 2REXA 1IGDA 4OVZA 2JT4B 2KQSA 5AUKA 4RFBA 1BMLC 3VH3B 4WAFA 3IAS1 3H7PB 4W9EA 1VJKA 3AB5A 4IM2A 1RRBA 2D3CA 5H8YE 1P3QU 4HRSA 4MH0E 1XO3A 4LJOB 3DVGX 1L0XB 4MGIE 2RR9A 2LXCA 4IC7B 1WSPA 3T8MA 1PQSA 4BKTA 3MHZA 2MX2A 1XEEA 1L7YA 2JQRB
chains in the Genus database with same CATH topology
5TR5A 2JXXA 1UELA 3A4RA 3VTUA 4ICUA 1P98A 2KDBA 2LRUA 4LJPB 1WGGA 3KUDB 4KZ0A 3LJ3A 2KLCA 1KJTA 3L17A 3IVFA 1J0GA 2AEHA 4WAAA 3ZNGC 2MW5A 2KTRB 3P2BA 1SGHA 4NPNA 3ZDMC 1CMXB 1LM8B 1XT9B 2O2VA 3KVFB 2UYZB 1TGZB 4K1RB 5LLIA 4EUTA 1ZGUB 2NR2A 1OEYJ 2IO2B 3QJZA 2NPTA 4FULA 2KC1A 2DZMA 3IG3A 4CO7A 4DHZB 2ZEQA 3VTWA 2MQJA 1BT0A 2BYVE 2FCQA 2LUEA 2MLBA 5E6NA 4AP4C 3V6EB 1D3ZA 2XBBC 4FLHA 1J19A 3HK0A 3ZKJC 2N9EB 2GBNA 2YLMA 4TUUA 2V4LA 2KXJA 5CX3A 2FCSA 5JZEB 4BBNC 2IO0B 4GIVA 1E8YA 1WF9A 1G6JA 2PPHA 5CTRC 4CYEA 2K8BA 5JHAA 2I1KA 2FUHB 2MBQA 3APCA 4HJKA 2IY0B 3ENEA 2D10A 2DYBA 4E74A 2O6VD 3KW5B 1E8ZA 1E8XA 3IHPC 3QARA 3UINB 3DVNV 3ZRFA 2BF8B 3M63B 3DBLI 2AL6A 3L54A 3ONSA 1V2YA 4PYUA 3DDCB 3WAPA 4MM3A 3QAQA 3VXWA 2D11A 4AWJA 3PLUA 1KOTA 3EHVA 5JHBA 1WR1A 4IM3A 1WGYA 4W9FA 3DVGY 3U8ZA 4KIKB 4JIOU 1VCBA 3B1LX 3NS8A 4NJ6A 3NZSA 3H7SA 5LXIB 3RCZA 3CMMB 1Q1OA 1K8RB 4PS8A 2IYDB 3UIPB 2NVUI 4MSQB 2L8JA 3JVZX 4GU2A 4MJSB 3ZUNA 1V86A 4W9LA 3A9KA 2N4FA 3OJ4B 2N7DA 2KJRA 2BWFA 3DCGA 2IO1B 1LQBA 5J17A 4ANWA 3U7DA 3RD2A 3QQ8B 2EMSA 2KDEB 2LD9A 1P0RA 4B6WA 3PLVA 2LXAA 3KH0A 1WXMA 5DPWA 2ZCCA 4JGHB 5AZGA 2A4ZA 3HM6X 3PRZA 4HPLB 2IZVB 3APDA 1Q0WB 4NQLB 4DK5A 2KD0A 1WJUA 3GOEA 3Q3JA 2XEWA 4PYZA 3A9JA 2KTFA 3V62A 1WZ3A 5E6OA 4KVGB 3B08A 3QX1A 3EECA 2QHOA 3QCAA 4HLEA 3DPDA 4DXAB 2JY6A 2KJHB 3MJWA 4BOZB 4ZDVA 2MRPA 4BBNF 4HVBA 1A5RA 1TTNA 2C9WB 5E6PA 2L0FA 3X23A 2ZJDA 2M4NA 3ML8A 2D3GA 3HIZA 3AI5A 3R7QA 2KKCA 4WJNA 2NS5A 4YL8A 3L0WB 2BKRB 4FHJA 3ZNID 3SHQA 2KWUB 2PE9A 3OLMD 4GOCA 3RZFA 2K6DB 1SE9A 1KLVA 3UGBB 2K8HA 3VDZA 3IFWB 1WMHB 3PVLA 3L13A 4LDTB 5L95C 2G45B 2LRWA 5HKHA 5D2MB 2FAZA 4N9F4 2FCNA 5DPTA 4FA6A 1AARA 1R4MI 2KMAA 4KSKC 3RT3B 3DBRI 3TMPB 4BFRA 1IP9A 3DOWA 1T0YA 3ZVVA 3M3JA 4TV3A 1V9JA 2NCNA 1YIWA 3VAWA 1WX7A 4MELA 3SDLC 1E8WA 3VUYA 3UQBA 1GC6A 2AYOB 1UZXB 2J0KA 2L3ZA 1Z2MA 4HDQA 4IM0A 4GGQA 4M8MA 4FBJB 5C23A 2XK5B 2R2QA 3WAOA 2KFKB 3PTFC 2DYMA 3N30A 4NJ7A 3TIXA 3VVWB 3TBLD 1WH3A 2NBWB 3NY5A 4GDLB 1YQBA 2NBUA 2JF5A 2KQ7A 4GXBA 4IW0A 3MHSD 5EDSA 4HPMB 4CHKA 2JRHA 2JWZA 4PS3A 1WY8A 3QHTA 4E3CA 2W9NA 1S1QB 2MBOA 2V3SA 3PZDA 4NAWB 2N9XA 2L05A 2KNBA 3VTVA 4AJYB 4WJQA 3W1SA 4A3PA 4FN2A 4W9IA 2RD0A 2DX5B 4WWOA 2CKHB 3PRMB 1U4AA 4JLCA 4M0WB 4GDKA 2J7QB 4IG7B 2N9PC 2O6VA 1WM2A 2PJHA 3PS6A 4MSMB 4AOFA 4TKNA 4BOSC 2DZIA 3H9DA 2DAJA 3L10B 3QA8A 3V60A 4MGZE 1I42A 1WX9A 2KWCA 3PT2B 4MGKE 2KJ6A 1XD3B 2KO3A 3NOBA 4NNJB 1YX5B 2WX0A 1WGHA 1V81A 3PRPB 4ICVA 3N32A 2N7EA 1E90A 2K25A 4IWQA 3ECIA 2KN5A 3V61A 2A5UA 3ZDTA 2ZZPB 2LGXA 2LVPA 1UGMA 4ANVA 5KHOA 1MG8A 1WXVA 1ZKHA 4W9CA 3DBHI 3WANA 1ZW7A 3QK0A 3JYUA 3QIJA 3JSVA 3H6NA 3JW0X 2MP2A 1UBIA 5IA7A 3HHMA 4WJPA 5CHVC 4K7WA 2CHWA 2N1WA 4HXDA 2FCMA 2V1YA 4KSLC 4X57B 4ZYNA 4BKSA 5AZHA 2Y5BB 4EKUA 4OVVA 2WWZA 4GB9A 3PHXB 3DBSA 4EZLA 3PREA 1H4RA 2O2VB 3KUZA 2MWSB 4HDOA 1OEYA 3DVNU 2LVOA 2NPTB 4ANXA 5CHFA 3ZTCA 1C1YB 1HE8A 1V6EA 5GMVA 3UQAA 2MCNB 3RUIB 5AEKB 4LDTD 5DPSA 4GDKB 4RM9A 2K6QA 1NBFC 2KWVB 4RMAA 4OVUA 4W9HA 4GN1A 4II2B 3U30A 4GSWA 2MBBB 2MBEA 2M1MA 1WZ0A 4HCPB 5J2RA 2B3AA 4E71A 3AU4A 2KVRA 2J0JA 3VHTC 1UD7A 2C7MB 2KHWB 1LXDA 3X0WA 1KM7A 2YVCA 4W9JA 3M95A 1EF5A 2FIFA 2GBMA 2MSED 3WAMA 4P7IA 4DBGA 2IY1B 2ZNVB 3EC8A 4DWFA 2KTRA 2AWTA 3PSEB 4W9GA 3ZO5B 2GBKA 4G0NB 2JRIB 5C1ZA 1SIFA 2LGYA 4M8NA 4RM8A 3OAWA 2BGFA 2L0TA 1EO6A 2WDTB 2WX1A 2JVCA 3O65B 4LCDE 1Q5WB 1TZ1A 4ZRIA 3VFKA 1J8CA 2HTHA 2KK8A 4KDLB 3VUXA 2KX0A 2LASA 2AL3A 4FJVB 2BYEA 1RLFA 2DENB 3K9OB 1IPGA 2EMTA 3PV1A 3RZWC 4AUQC 3K9PB 2G4SA 3A9KB 4F8CB 1F9JA 1V5OA 2D2QA 2RGFA 1WIAA 3QWZB 1WXSA 2CU1A 2LGDA 3V6CB 4TQ1A 2PEAA 5CHWA 4J6IA 4F1SA 3W1YA 3APFA 4ANUA 2LJ5A 2RPQA 5D94A 3ZRCA 1V5TA 4W9DA 4URKA 5DCNA 1ISNA 3TL5A 1L2NA 4KDIC 4XZ4A 2KDFB 2Z59B 2K39A 2ZVNA 1X1MA 3A4SC 3A9JB 4KV2A 4MDKE 5G2NA 4NQKE 2L76A 2IO3B 3B0AA 4KIKA 5D6JB 2HE7A 2DZJA 2KLGA 2Z0DB 5FR6A 3CSFA 4IUMB 3MTNB 4HWIB 3R66C 1M94A 4ZRKA 4DHJB 1EUVB 1WM3A 1NDDA 4WJOA 2CR5A 2J0MA 2KX3A 4MJSA 1P1AA 1RAXA 1WJ4A 2L00B 3AULA 3R7RA 1WE6A 3TCAA 3WIMA 1FXTB 2MBHA 2KMCA 1WXAA 3M62B 3L16A 3CF6E 3I3TB 4K81A 3AXCA 2HD5B 1VD2A 1I35A 1TBEA 2LZ6A 3T9LA 2R2OA 2I1JA 3CSTA 3UIOB 2D07B 2DHZA 4K7UA 2VRRB 3NZUA 3ZNZB 2C5LC 4I6LB 1OTRB 3KUCB 4MEMA 3WA0A 1R4NI 2GOWA 3WALA 5BO4B 4WQOB 2RSUA 1GJZA 2KZRA 2M8SA 4I6PA 3PPAA 4KZCA 2KC2A 3A1QA 4WWNA 2KDIA 4FADA 4WWPA 3OJ3A 1WRDB 1IYFA 2L7RA 2DYOA 3QC8B 4A20A 4ZRJA 4EFOA 2BKFA 3KYDD 1C3TA 1GUAB 2IBIB 2GMIC 5J18A 4AJWA 2EKEC 3NHEB 3TJPA 1WGDA 2C60A 2FNJB 2JUOA 4II3B 5D7GA 3VQIA 2BWES 1WGRA 2PE6B 3VUWA 4JL9A 2ZPYA 4HK2A 2M17A 5DPRA 3GZNI 1WMHA 3ZNHB 3ZW3A 4W9KA 4DHZE 1NI2A 2GBJA 2JZ3B 1UH6A 4EOYA 3H7PA 2WYQA 3D32A 4FJYA 5AZFA 1JRUA 1YD8U 2ZCBA 3SD5A 2KFJA 2CHXA 3A33B 4TQ0A 1RFAA 2OJRA 1H8CA 1Z5SB 2N1VA 3PGEA 4MGYE 3ZIMA 2JZZA 2HJ8A 4EZJA 2O6VB 3BINA 4FJZA 4ASWC 1E7UA 3AU5A 3DQVA 1OGWA 2XK5A 4XX5A 3UF8A 4IWOA 2KOXA 2M0XA 2KFKA 4FHKA 2G3QB 3PHWB 1WYWB 1WI0A 4I6NB 4BVUC 2MA9B 3ML9A 2C7HA 2ZPNA 3Q3FA 4B9KA 1WR6E 1S3SG 2KANA 4GDLA 1LFDA 1Y8RC 1UBQA 4PS7A 3KYCD 4BKSD 3RYTA 1WE7A 2BYFA 3ALBA 1GNUA 1GC7A 3L08A 3ZTDA 1V80A 1E5WA 2C7NB 3LDZE 4NY0A 4G11A 1GG3A 3H1UA 4G50A 4K7SA 3A1QB 3HM3A 1WFYA 4NAWA 2BPSA 3SU8X 2ZVOA 5G55A 5L83A 2G4DB 5IAAC 4HCNB 3IBEA 2DAFA 2JPHA 1EF1A 3BY4B 1YX6B 1WX8A 2ASQA 1QZEA 2LI5A 3JSVB 2MP2B 1WJ6A 1E7VA 2REXA 4DHJD 3W1SC 2JT4B 3ZLZA 4A3OA 2KQSA 1YJ1A 4G3XB 1P9DU 4B95A 4BKGA 4F7ZA 5LXHA 4DDID 4GMVA 3VH3B 2CS4A 3RULA 2DZKA 3H7PB 4W9EA 2LVQA 4EEWA 1V49A 1RRBA 4IM2A 3VH4B 2Z0EB 4XC2A 3EFUA 2K8CA 2FIDA 4DDGD 5KHQA 1P3QU 3R3MA 3S2AA 4MH0E 2LWPA 3C0RB 4EZKA 5JH5C 4LJOB 3DVGX 2K1FA 2ZNVC 4MGIE 2RR9A 1OQYA 2LXCA 2NBVB 2CHZA 2OOBB 2GBRA 1PQSA 3N3KB 4IC7B 2UWQA 4IWPA 3T8MA 4BKTA 2MX2A 1L7YA 4JQWC 1XQQA 1WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TR5 A;  2JXX A;  1UEL A;  3A4R A;  3VTU A;  4ICU A;  1P98 A;  2KDB A;  2LRU A;  4LJP B;  1WGG A;  3KUD B;  4KZ0 A;  3LJ3 A;  2KLC A;  1KJT A;  3L17 A;  3IVF A;  1J0G A;  2AEH A;  4WAA A;  3ZNG C;  2MW5 A;  2KTR B;  3P2B A;  1SGH A;  4NPN A;  3ZDM C;  1CMX B;  1LM8 B;  1XT9 B;  2O2V A;  3KVF B;  2UYZ B;  1TGZ B;  4K1R B;  5LLI A;  4EUT A;  1ZGU B;  2NR2 A;  1OEY J;  2IO2 B;  3QJZ A;  2NPT A;  4FUL A;  2KC1 A;  2DZM A;  3IG3 A;  4CO7 A;  4DHZ B;  2ZEQ A;  3VTW A;  2MQJ A;  1BT0 A;  2BYV E;  2FCQ A;  2LUE A;  2MLB A;  5E6N A;  4AP4 C;  3V6E B;  1D3Z A;  2XBB C;  4FLH A;  1J19 A;  3HK0 A;  3ZKJ C;  2N9E B;  2GBN A;  2YLM A;  4TUU A;  2V4L A;  2KXJ A;  5CX3 A;  2FCS A;  5JZE B;  4BBN C;  2IO0 B;  4GIV A;  1E8Y A;  1WF9 A;  1G6J A;  2PPH A;  5CTR C;  4CYE A;  2K8B A;  5JHA A;  2I1K A;  2FUH B;  2MBQ A;  3APC A;  4HJK A;  2IY0 B;  3ENE A;  2D10 A;  2DYB A;  4E74 A;  2O6V D;  3KW5 B;  1E8Z A;  1E8X A;  3IHP C;  3QAR A;  3UIN B;  3DVN V;  3ZRF A;  2BF8 B;  3M63 B;  3DBL I;  2AL6 A;  3L54 A;  3ONS A;  1V2Y A;  4PYU A;  3DDC B;  3WAP A;  4MM3 A;  3QAQ A;  3VXW A;  2D11 A;  4AWJ A;  3PLU A;  1KOT A;  3EHV A;  5JHB A;  1WR1 A;  4IM3 A;  1WGY A;  4W9F A;  3DVG Y;  3U8Z A;  4KIK B;  4JIO U;  1VCB A;  3B1L X;  3NS8 A;  4NJ6 A;  3NZS A;  3H7S A;  5LXI B;  3RCZ A;  3CMM B;  1Q1O A;  1K8R B;  4PS8 A;  2IYD B;  3UIP B;  2NVU I;  4MSQ B;  2L8J A;  3JVZ X;  4GU2 A;  4MJS B;  3ZUN A;  1V86 A;  4W9L A;  3A9K A;  2N4F A;  3OJ4 B;  2N7D A;  2KJR A;  2BWF A;  3DCG A;  2IO1 B;  1LQB A;  5J17 A;  4ANW A;  3U7D A;  3RD2 A;  3QQ8 B;  2EMS A;  2KDE B;  2LD9 A;  1P0R A;  4B6W A;  3PLV A;  2LXA A;  3KH0 A;  1WXM A;  5DPW A;  2ZCC A;  4JGH B;  5AZG A;  2A4Z A;  3HM6 X;  3PRZ A;  4HPL B;  2IZV B;  3APD A;  1Q0W B;  4NQL B;  4DK5 A;  2KD0 A;  1WJU A;  3GOE A;  3Q3J A;  2XEW A;  4PYZ A;  3A9J A;  2KTF A;  3V62 A;  1WZ3 A;  5E6O A;  4KVG B;  3B08 A;  3QX1 A;  3EEC A;  2QHO A;  3QCA A;  4HLE A;  3DPD A;  4DXA B;  2JY6 A;  2KJH B;  3MJW A;  4BOZ B;  4ZDV A;  2MRP A;  4BBN F;  4HVB A;  1A5R A;  1TTN A;  2C9W B;  5E6P A;  2L0F A;  3X23 A;  2ZJD A;  2M4N A;  3ML8 A;  2D3G A;  3HIZ A;  3AI5 A;  3R7Q A;  2KKC A;  4WJN A;  2NS5 A;  4YL8 A;  3L0W B;  2BKR B;  4FHJ A;  3ZNI D;  3SHQ A;  2KWU B;  2PE9 A;  3OLM D;  4GOC A;  3RZF A;  2K6D B;  1SE9 A;  1KLV A;  3UGB B;  2K8H A;  3VDZ A;  3IFW B;  1WMH B;  3PVL A;  3L13 A;  4LDT B;  5L95 C;  2G45 B;  2LRW A;  5HKH A;  5D2M B;  2FAZ A;  4N9F 4;  2FCN A;  5DPT A;  4FA6 A;  1AAR A;  1R4M I;  2KMA A;  4KSK C;  3RT3 B;  3DBR I;  3TMP B;  4BFR A;  1IP9 A;  3DOW A;  1T0Y A;  3ZVV A;  3M3J A;  4TV3 A;  1V9J A;  2NCN A;  1YIW A;  3VAW A;  1WX7 A;  4MEL A;  3SDL C;  1E8W A;  3VUY A;  3UQB A;  1GC6 A;  2AYO B;  1UZX B;  2J0K A;  2L3Z A;  1Z2M A;  4HDQ A;  4IM0 A;  4GGQ A;  4M8M A;  4FBJ B;  5C23 A;  2XK5 B;  2R2Q A;  3WAO A;  2KFK B;  3PTF C;  2DYM A;  3N30 A;  4NJ7 A;  3TIX A;  3VVW B;  3TBL D;  1WH3 A;  2NBW B;  3NY5 A;  4GDL B;  1YQB A;  2NBU A;  2JF5 A;  2KQ7 A;  4GXB A;  4IW0 A;  3MHS D;  5EDS A;  4HPM B;  4CHK A;  2JRH A;  2JWZ A;  4PS3 A;  1WY8 A;  3QHT A;  4E3C A;  2W9N A;  1S1Q B;  2MBO A;  2V3S A;  3PZD A;  4NAW B;  2N9X A;  2L05 A;  2KNB A;  3VTV A;  4AJY B;  4WJQ A;  3W1S A;  4A3P A;  4FN2 A;  4W9I A;  2RD0 A;  2DX5 B;  4WWO A;  2CKH B;  3PRM B;  1U4A A;  4JLC A;  4M0W B;  4GDK A;  2J7Q B;  4IG7 B;  2N9P C;  2O6V A;  1WM2 A;  2PJH A;  3PS6 A;  4MSM B;  4AOF A;  4TKN A;  4BOS C;  2DZI A;  3H9D A;  2DAJ A;  3L10 B;  3QA8 A;  3V60 A;  4MGZ E;  1I42 A;  1WX9 A;  2KWC A;  3PT2 B;  4MGK E;  2KJ6 A;  1XD3 B;  2KO3 A;  3NOB A;  4NNJ B;  1YX5 B;  2WX0 A;  1WGH A;  1V81 A;  3PRP B;  4ICV A;  3N32 A;  2N7E A;  1E90 A;  2K25 A;  4IWQ A;  3ECI A;  2KN5 A;  3V61 A;  2A5U A;  3ZDT A;  2ZZP B;  2LGX A;  2LVP A;  1UGM A;  4ANV A;  5KHO A;  1MG8 A;  1WXV A;  1ZKH A;  4W9C A;  3DBH I;  3WAN A;  1ZW7 A;  3QK0 A;  3JYU A;  3QIJ A;  3JSV A;  3H6N A;  3JW0 X;  2MP2 A;  1UBI A;  5IA7 A;  3HHM A;  4WJP A;  5CHV C;  4K7W A;  2CHW A;  2N1W A;  4HXD A;  2FCM A;  2V1Y A;  4KSL C;  4X57 B;  4ZYN A;  4BKS A;  5AZH A;  2Y5B B;  4EKU A;  4OVV A;  2WWZ A;  4GB9 A;  3PHX B;  3DBS A;  4EZL A;  3PRE A;  1H4R A;  2O2V B;  3KUZ A;  2MWS B;  4HDO A;  1OEY A;  3DVN U;  2LVO A;  2NPT B;  4ANX A;  5CHF A;  3ZTC A;  1C1Y B;  1HE8 A;  1V6E A;  5GMV A;  3UQA A;  2MCN B;  3RUI B;  5AEK B;  4LDT D;  5DPS A;  4GDK B;  4RM9 A;  2K6Q A;  1NBF C;  2KWV B;  4RMA A;  4OVU A;  4W9H A;  4GN1 A;  4II2 B;  3U30 A;  4GSW A;  2MBB B;  2MBE A;  2M1M A;  1WZ0 A;  4HCP B;  5J2R A;  2B3A A;  4E71 A;  3AU4 A;  2KVR A;  2J0J A;  3VHT C;  1UD7 A;  2C7M B;  2KHW B;  1LXD A;  3X0W A;  1KM7 A;  2YVC A;  4W9J A;  3M95 A;  1EF5 A;  2FIF A;  2GBM A;  2MSE D;  3WAM A;  4P7I A;  4DBG A;  2IY1 B;  2ZNV B;  3EC8 A;  4DWF A;  2KTR A;  2AWT A;  3PSE B;  4W9G A;  3ZO5 B;  2GBK A;  4G0N B;  2JRI B;  5C1Z A;  1SIF A;  2LGY A;  4M8N A;  4RM8 A;  3OAW A;  2BGF A;  2L0T A;  1EO6 A;  2WDT B;  2WX1 A;  2JVC A;  3O65 B;  4LCD E;  1Q5W B;  1TZ1 A;  4ZRI A;  3VFK A;  1J8C A;  2HTH A;  2KK8 A;  4KDL B;  3VUX A;  2KX0 A;  2LAS A;  2AL3 A;  4FJV B;  2BYE A;  1RLF A;  2DEN B;  3K9O B;  1IPG A;  2EMT A;  3PV1 A;  3RZW C;  4AUQ C;  3K9P B;  2G4S A;  3A9K B;  4F8C B;  1F9J A;  1V5O A;  2D2Q A;  2RGF A;  1WIA A;  3QWZ B;  1WXS A;  2CU1 A;  2LGD A;  3V6C B;  4TQ1 A;  2PEA A;  5CHW A;  4J6I A;  4F1S A;  3W1Y A;  3APF A;  4ANU A;  2LJ5 A;  2RPQ A;  5D94 A;  3ZRC A;  1V5T A;  4W9D A;  4URK A;  5DCN A;  1ISN A;  3TL5 A;  1L2N A;  4KDI C;  4XZ4 A;  2KDF B;  2Z59 B;  2K39 A;  2ZVN A;  1X1M A;  3A4S C;  3A9J B;  4KV2 A;  4MDK E;  5G2N A;  4NQK E;  2L76 A;  2IO3 B;  3B0A A;  4KIK A;  5D6J B;  2HE7 A;  2DZJ A;  2KLG A;  2Z0D B;  5FR6 A;  3CSF A;  4IUM B;  3MTN B;  4HWI B;  3R66 C;  1M94 A;  4ZRK A;  4DHJ B;  1EUV B;  1WM3 A;  1NDD A;  4WJO A;  2CR5 A;  2J0M A;  2KX3 A;  4MJS A;  1P1A A;  1RAX A;  1WJ4 A;  2L00 B;  3AUL A;  3R7R A;  1WE6 A;  3TCA A;  3WIM A;  1FXT B;  2MBH A;  2KMC A;  1WXA A;  3M62 B;  3L16 A;  3CF6 E;  3I3T B;  4K81 A;  3AXC A;  2HD5 B;  1VD2 A;  1I35 A;  1TBE A;  2LZ6 A;  3T9L A;  2R2O A;  2I1J A;  3CST A;  3UIO B;  2D07 B;  2DHZ A;  4K7U A;  2VRR B;  3NZU A;  3ZNZ B;  2C5L C;  4I6L B;  1OTR B;  3KUC B;  4MEM A;  3WA0 A;  1R4N I;  2GOW A;  3WAL A;  5BO4 B;  4WQO B;  2RSU A;  1GJZ A;  2KZR A;  2M8S A;  4I6P A;  3PPA A;  4KZC A;  2KC2 A;  3A1Q A;  4WWN A;  2KDI A;  4FAD A;  4WWP A;  3OJ3 A;  1WRD B;  1IYF A;  2L7R A;  2DYO A;  3QC8 B;  4A20 A;  4ZRJ A;  4EFO A;  2BKF A;  3KYD D;  1C3T A;  1GUA B;  2IBI B;  2GMI C;  5J18 A;  4AJW A;  2EKE C;  3NHE B;  3TJP A;  1WGD A;  2C60 A;  2FNJ B;  2JUO A;  4II3 B;  5D7G A;  3VQI A;  2BWE S;  1WGR A;  2PE6 B;  3VUW A;  4JL9 A;  2ZPY A;  4HK2 A;  2M17 A;  5DPR A;  3GZN I;  1WMH A;  3ZNH B;  3ZW3 A;  4W9K A;  4DHZ E;  1NI2 A;  2GBJ A;  2JZ3 B;  1UH6 A;  4EOY A;  3H7P A;  2WYQ A;  3D32 A;  4FJY A;  5AZF A;  1JRU A;  1YD8 U;  2ZCB A;  3SD5 A;  2KFJ A;  2CHX A;  3A33 B;  4TQ0 A;  1RFA A;  2OJR A;  1H8C A;  1Z5S B;  2N1V A;  3PGE A;  4MGY E;  3ZIM A;  2JZZ A;  2HJ8 A;  4EZJ A;  2O6V B;  3BIN A;  4FJZ A;  4ASW C;  1E7U A;  3AU5 A;  3DQV A;  1OGW A;  2XK5 A;  4XX5 A;  3UF8 A;  4IWO A;  2KOX A;  2M0X A;  2KFK A;  4FHK A;  2G3Q B;  3PHW B;  1WYW B;  1WI0 A;  4I6N B;  4BVU C;  2MA9 B;  3ML9 A;  2C7H A;  2ZPN A;  3Q3F A;  4B9K A;  1WR6 E;  1S3S G;  2KAN A;  4GDL A;  1LFD A;  1Y8R C;  1UBQ A;  4PS7 A;  3KYC D;  4BKS D;  3RYT A;  1WE7 A;  2BYF A;  3ALB A;  1GNU A;  1GC7 A;  3L08 A;  3ZTD A;  1V80 A;  1E5W A;  2C7N B;  3LDZ E;  4NY0 A;  4G11 A;  1GG3 A;  3H1U A;  4G50 A;  4K7S A;  3A1Q B;  3HM3 A;  1WFY A;  4NAW A;  2BPS A;  3SU8 X;  2ZVO A;  5G55 A;  5L83 A;  2G4D B;  5IAA C;  4HCN B;  3IBE A;  2DAF A;  2JPH A;  1EF1 A;  3BY4 B;  1YX6 B;  1WX8 A;  2ASQ A;  1QZE A;  2LI5 A;  3JSV B;  2MP2 B;  1WJ6 A;  1E7V A;  2REX A;  4DHJ D;  3W1S C;  2JT4 B;  3ZLZ A;  4A3O A;  2KQS A;  1YJ1 A;  4G3X B;  1P9D U;  4B95 A;  4BKG A;  4F7Z A;  5LXH A;  4DDI D;  4GMV A;  3VH3 B;  2CS4 A;  3RUL A;  2DZK A;  3H7P B;  4W9E A;  2LVQ A;  4EEW A;  1V49 A;  1RRB A;  4IM2 A;  3VH4 B;  2Z0E B;  4XC2 A;  3EFU A;  2K8C A;  2FID A;  4DDG D;  5KHQ A;  1P3Q U;  3R3M A;  3S2A A;  4MH0 E;  2LWP A;  3C0R B;  4EZK A;  5JH5 C;  4LJO B;  3DVG X;  2K1F A;  2ZNV C;  4MGI E;  2RR9 A;  1OQY A;  2LXC A;  2NBV B;  2CHZ A;  2OOB B;  2GBR A;  1PQS A;  3N3K B;  4IC7 B;  2UWQ A;  4IWP A;  3T8M A;  4BKT A;  2MX2 A;  1L7Y A;  4JQW C;  1XQQ A;  1WJN A; 
#chains in the Genus database with same CATH topology
 5TR5 A;  1UEL A;  1ZPS A;  3BWU D;  3U4E G;  1J0G A;  3ZNG C;  1FD6 A;  1KH0 A;  5IP4 D;  1LM8 B;  4EUT A;  1OEY J;  3QJZ A;  2KC1 A;  2DZM A;  4DHZ B;  1FXI A;  1FFV A;  2MLB A;  5E6N A;  2JU6 X;  3V6E B;  1D3Z A;  2XBB C;  1YJJ A;  1J19 A;  3HK0 A;  2N9E B;  4TUU A;  2V4L A;  1ZE3 D;  4GIV A;  2JWU A;  5JHA A;  4CYE A;  1FIQ A;  3W2D A;  2WP9 B;  1QT9 A;  2DYB A;  4E74 A;  3U52 E;  2MJ3 A;  1E8Z A;  3QAR A;  3UIN B;  3DVN V;  3ZRF A;  2BF8 B;  3L54 A;  1SB3 C;  4PYU A;  1F52 A;  1SF0 A;  4MM3 A;  3TSS A;  4AWJ A;  3IT4 B;  4XDC A;  4IM3 A;  1WGY A;  4W9F A;  5G5G A;  1BXT A;  1JWM D;  1E10 A;  3W5U B;  4MSQ B;  2AQ2 B;  3AEE B;  1FRD A;  4MJS B;  3OJ4 B;  2WNM A;  2BWF A;  1P0R A;  2LXA A;  4JGH B;  1V97 A;  3HM6 X;  4KKI A;  2IZV B;  2INP E;  1Q0W B;  2KD0 A;  3NJT A;  3A9J A;  3SFE B;  3EEC A;  1T5X D;  3IT6 B;  2KJH B;  2V4I B;  4HVB A;  4BBN F;  4KGR A;  3ML8 A;  1ZOY B;  2NS5 A;  2BKR B;  1DOY A;  2KWU B;  4S0R A;  1HZ6 A;  1D5Z C;  3VDZ A;  3PVL A;  3L13 A;  4LDT B;  5L95 C;  1L0V B;  3GE8 C;  5EE1 A;  1JWB D;  1MJD A;  1AAR A;  3RT3 B;  1C4P A;  3DOW A;  1T0Y A;  1N6Z A;  4N59 A;  1YIW A;  3EFC A;  1GC6 A;  1T0S C;  3AEF B;  1QOA A;  4C4V B;  3PZ8 A;  2KFK B;  4NJ7 A;  3TBL D;  1V1P B;  1YQB A;  1C77 A;  1D6E C;  3AN1 A;  3NG0 A;  4CHK A;  2JRH A;  2RPV A;  3H8H A;  4YSY B;  1WY8 A;  2MBO A;  4NAW B;  3PZD A;  4WUR A;  4AJY B;  3W1S A;  3N9Y C;  4FN2 A;  4WWO A;  3PRM B;  4ZOH C;  3KLS X;  3Q6B A;  3C19 A;  4IG7 B;  1MG4 A;  2N9P C;  2PJH A;  3PS6 A;  2J52 A;  2ZW0 A;  1KLU D;  4BOS C;  3ZXR A;  4M00 A;  4MGZ E;  1JAL A;  3PT2 B;  1XD3 B;  3NOB A;  1YX5 B;  3DWG C;  2L52 A;  1PGA A;  4CQN A;  2N7E A;  1E90 A;  1DOX A;  2ZZP B;  2LVP A;  1UGM A;  1XLP A;  3DBH I;  1XLQ A;  1FCL A;  2CJO A;  3JW0 X;  4LTU A;  2BQQ A;  3KWV A;  3NUH B;  5CHV C;  2WDR B;  2V1Y A;  5MPO A;  5AZH A;  1I4R A;  1YN4 A;  4EKU A;  1ROE A;  2WWZ A;  2INN E;  3HUI A;  2LVO A;  2NPT B;  4XGA B;  2HTM E;  2MCN B;  4LDT D;  1FNV A;  2KWV B;  4ARI A;  4OVU A;  3U30 A;  4II2 B;  1PUT A;  5BYS A;  4R3D A;  3SFD B;  2M1M A;  1E7P B;  1WZ0 A;  1AW7 A;  2ON8 A;  3X0W A;  1KM7 A;  3BVM A;  3M95 A;  2GBM A;  2QIL A;  3V3X A;  3EC8 A;  1FRR A;  2NTT A;  1TJE A;  2H89 B;  2GLS A;  3ZO5 B;  5C1Z A;  1SIF A;  4HRO A;  2KVZ A;  4M8N A;  4YSX B;  3OAW A;  2FBW B;  1EO6 A;  2JVC A;  3O65 B;  3ZQ4 A;  4ZRI A;  2KAJ A;  4WQM A;  2KX0 A;  4FJV B;  1VLB A;  2EEL A;  2Y3A A;  2IDY A;  1F9J A;  4F8C B;  3BZD B;  2D2Q A;  1WXS A;  3V6C B;  3LYY A;  4TQ1 A;  4J6I A;  4LNF A;  2KMM A;  1QOF A;  2RPQ A;  1XF5 L;  1YN3 A;  4P16 A;  2ZVN A;  2LUM A;  2L76 A;  1V8C A;  4KIK A;  4L23 A;  1JW9 D;  2V9H A;  5FR6 A;  4IUM B;  3MTN B;  3ZJV A;  3R66 C;  1M94 A;  4ZRK A;  4DHJ B;  4JE3 B;  2PVG C;  2L00 B;  3R7R A;  1WE6 A;  3WIM A;  2MBH A;  3KQ4 A;  4K81 A;  1I35 A;  3T9L A;  2R2O A;  1HTO A;  2I1J A;  3Q8E A;  3UIO B;  3NZU A;  3ZNZ B;  4NZL B;  3WAL A;  1YMH E;  2GOW A;  5BMG A;  1ET6 A;  5BO4 B;  1GJZ A;  2M8S A;  3Q8B A;  5JXV A;  3PPA A;  4WWN A;  2KDI A;  3I5J C;  1ZXI A;  4FAD A;  3OJ3 A;  1IYF A;  3QC8 B;  4N58 A;  1C3T A;  1GUA B;  2V3P A;  3NS1 A;  2M56 B;  4OZB A;  5J18 A;  4AJW A;  2EKE C;  3NHE B;  2C60 A;  1D4B A;  2YEP F;  3VQI A;  1WGR A;  2BTE A;  1F2R C;  2ZPY A;  3AE3 B;  1NI2 A;  4O1N A;  2QSD A;  2ZCB A;  2CHX A;  5IKC M;  3AE2 B;  1N5X A;  4MGY E;  4HKZ E;  3AU5 A;  3DQV A;  1OGW A;  2XK5 A;  2M0X A;  4FHK A;  3U2S C;  2MA9 B;  3V05 A;  1IBX B;  1FFU A;  1Y8R C;  2FUG 1;  1R4N B;  3ZTD A;  3FAH A;  1E5W A;  1SSN A;  3LDZ E;  1VR9 A;  3HM3 A;  3EUB 2;  2ZVO A;  2IGH A;  2DAF A;  2JPH A;  1QZE A;  4M0W A;  3JSV B;  2UU7 A;  2MP2 B;  4DHJ D;  3W1S C;  2MJE A;  4A3O A;  2QJL A;  3GB1 A;  2WXL A;  2AX5 A;  2MH7 A;  5LXH A;  3MFG A;  2CS4 A;  3RUL A;  4A55 A;  4M01 A;  2LVQ A;  2BS3 B;  1V49 A;  3VH4 B;  2Z0E B;  4XC2 A;  2K8C A;  3ETR A;  5BYR A;  1PGX A;  3R3M A;  3AE7 B;  3C0R B;  1ZP0 B;  4US8 A;  4K3B A;  3N3K B;  2GBR A;  1I7H A;  2UWQ A;  2WHI A;  2Q5W D;  2K3U A;  1XQQ A;  3ZUN A;  3A4R A;  3VTU A;  3AE5 B;  1N60 A;  2LRU A;  3NVW A;  4LJP B;  1WGG A;  1WGK A;  2N7J A;  3KUD B;  2AEH A;  4WAA A;  3WCQ A;  2KTR B;  4NPN A;  3ZDM C;  1JCK B;  3KVF B;  2J4X A;  1ZGU B;  4GLS C;  4FUL A;  3IG3 A;  3BYT B;  2MQJ A;  1TYG B;  1BT0 A;  3AM9 A;  2PVO D;  2GBN A;  2FCS A;  4DQO C;  5JZE B;  2IO0 B;  2FUH B;  4M02 A;  1VZ8 A;  3APC A;  2BS2 B;  2WXJ A;  4HJK A;  3KW5 B;  4JX1 C;  3N1Y C;  2W82 A;  1N5W A;  4KGT A;  3EGR A;  3M63 B;  1V1O A;  3ONS A;  1WRI A;  1BUI C;  2AL6 A;  1TKY A;  3DDC B;  4L2Y A;  3WAP A;  2QDF A;  1WXQ A;  1MHH E;  3EHV A;  5JHB A;  1WR1 A;  3DVG Y;  3DHH C;  3U8Z A;  3Q2A C;  4A6Q A;  1VCB A;  1ET9 A;  3H7S A;  1EU4 A;  2GI9 A;  1K8R B;  1QLB B;  3R2I A;  2NVU I;  4GU2 A;  3DHG C;  3A9K A;  2QC8 A;  2MHJ A;  3Q14 C;  2JZP A;  5J17 A;  3RD2 A;  1QQR A;  2LD9 A;  1N63 A;  1WXM A;  4ZHP A;  3PRZ A;  4HPL B;  3BVG A;  4NQL B;  4DK5 A;  1SIJ A;  5IO9 A;  1WZ3 A;  1ZXH A;  3B08 A;  3QCA A;  1T3Q A;  4BOZ B;  4ZDV A;  1TTN A;  5E6P A;  1F2R I;  3X23 A;  1C4C A;  2ZJD A;  1Y56 A;  4LNN A;  2D3G A;  3R7Q A;  4WJN A;  3TEZ A;  4YL8 A;  3L0W B;  2W3R A;  1ENF A;  3OLM D;  4GOC A;  3RZF A;  1OQQ A;  2K6D B;  1SE9 A;  2LRW A;  2FAZ A;  2FCN A;  4FA6 A;  2KMA A;  4BFR A;  2CU3 A;  3ZVV A;  4KGS A;  1FNW A;  3RNC C;  1WX7 A;  4MEL A;  3SDL C;  5I4D A;  1FNU A;  3UQB A;  4H2A A;  1UZX B;  2J0K A;  5HI1 A;  1Z2M A;  4RNA A;  1N61 A;  3WAO A;  4TMA B;  3PTF C;  2DYM A;  3N30 A;  3TIX A;  3R2T A;  2NBU A;  2JF5 A;  4NJC A;  1SE2 A;  2FE8 A;  2JWZ A;  3SEB A;  3GS2 A;  2LGS A;  3QHT A;  2WXG A;  2W9N A;  2V3S A;  2L05 A;  1ZDV A;  1SEB D;  4W9I A;  2DX5 B;  1EWC A;  3RMK C;  2CKH B;  2WU5 B;  1GAQ B;  2J7Q B;  2O6V A;  1WM2 A;  4S17 A;  1J7C A;  4MSM B;  4YTP B;  1KTK A;  4AOF A;  1FO4 A;  1UWX A;  3AE9 B;  3QA8 A;  3V60 A;  5H92 C;  2KWC A;  2IJ0 A;  3EA6 A;  2W54 A;  3N32 A;  1NI3 A;  4DXG A;  3ECI A;  2KN5 A;  3ZDT A;  2N0S B;  4YXD B;  2VH1 A;  1K53 A;  3J9C A;  3W5V B;  4QAY A;  3H6N A;  5BMI A;  2IND C;  3HHM A;  4WJP A;  4XDD A;  2WXF A;  2N1W A;  2FCM A;  2BBC A;  4C7Z A;  1Q10 A;  3HVZ A;  2WXQ A;  1NYR A;  4GB9 A;  1KLG D;  3RPF C;  4AS1 A;  1H4R A;  4HDO A;  5FKA C;  1J7B A;  2JSV X;  4A90 A;  3NVZ A;  5AEK B;  4RM9 A;  5FR3 A;  1NBF C;  4N6E B;  1VDV A;  4GSW A;  3OG5 A;  1CK1 A;  1PDX A;  4E71 A;  3AU4 A;  3Q3N C;  2KHW B;  1LXD A;  2YVC A;  1MI0 A;  1JML A;  4W9J A;  2OED A;  2KDM A;  4DBG A;  1KFY B;  1OQR A;  1JWA D;  4MM3 B;  4G0N B;  1XCT L;  1D5M C;  2BGF A;  3Q3O C;  2L0T A;  3LB8 C;  1Q5W B;  4RF0 A;  3K9O B;  1QIL A;  1OFF A;  1IPG A;  3AMZ A;  3K9P B;  3ZJT A;  1WIA A;  3NRZ A;  1FCC C;  5CHW A;  1ZUD 2;  1QOG A;  4F1S A;  1QF6 A;  2OHF A;  2W3S A;  2D3B A;  4W9D A;  4LK0 M;  5DCN A;  2SEB D;  3TL5 A;  4KDI C;  3A4S C;  4KV2 A;  2WXK A;  3A9J B;  5G2N A;  1YQ4 B;  5D6J B;  1E6E B;  1I4X A;  2G1E A;  4HWI B;  2W55 A;  1NDD A;  2CR5 A;  1P1A A;  1RAX A;  1WJ4 A;  2N9L A;  2WU2 B;  1FXT B;  3I9V 1;  3OWE B;  4LNO A;  3M62 B;  3N1Z C;  3CF6 E;  2HD5 B;  2BYT A;  1TBE A;  5T8I A;  1QKZ A;  3T3N A;  1NEN B;  1AWD A;  4K7U A;  4OZC A;  1LO5 D;  4I6L B;  2WXR A;  3KUC B;  5HG2 A;  3WA0 A;  1R4N I;  4KX6 B;  2RSU A;  4I6P A;  1PYW D;  2KC2 A;  3PZ7 A;  1WRD B;  2L7R A;  1GB4 A;  1MPE A;  2DLB A;  2LEK A;  4YTM B;  3RI7 C;  2GMI C;  1WGD A;  3AEB B;  4II3 B;  5D7G A;  4PK1 A;  5LNK 1;  2BWE S;  4JL9 A;  2DNF A;  3AEA B;  1A70 A;  4BAX A;  1WMH A;  3ZW3 A;  3TEW A;  3NVY A;  4EOY A;  2WYQ A;  4FJY A;  2Z8L A;  5AZF A;  2LGI A;  1YD8 U;  1TS3 A;  3A33 B;  4TQ0 A;  3FIL A;  1RFA A;  3PO0 A;  3PGE A;  4EZJ A;  2KWD A;  3FKY A;  3B2F A;  4ASW C;  4XX5 A;  4IWO A;  1XXG A;  1SE3 A;  4BVU C;  4L1B A;  3ML9 A;  2ZPN A;  3Q3F A;  1WR6 E;  4GDL A;  1LFD A;  1UBQ A;  4PS7 A;  3KYC D;  1WE7 A;  2BYF A;  1GC7 A;  3L08 A;  1NEK B;  2C7N B;  4NY0 A;  4G11 A;  3H1U A;  5L83 A;  3RNE C;  5IAA C;  4HCN B;  3BY4 B;  1WX8 A;  2LI5 A;  1WJ6 A;  2K9X A;  4Q2J A;  1L6V A;  2M0A A;  4G3X B;  1HXY D;  2DZK A;  1AN8 A;  3URY A;  2IGG A;  1HTQ A;  4EEW A;  2FID A;  4DDG D;  2ACZ B;  3S2A A;  4AQ7 A;  2PMV A;  2LWP A;  4YSZ B;  4EZK A;  5JH5 C;  4XE0 A;  2LMC A;  1RM6 C;  4IWP A;  2J53 A;  4JQW C;  1WJN A;  5IN7 A;  2JXX A;  1TKG A;  3LJ3 A;  1IUE A;  3NZ3 A;  3L17 A;  3IVF A;  3AE4 B;  2MW5 A;  1SGH A;  1CMX B;  1XT9 B;  2O2V A;  3NVV A;  2IO2 B;  4B0E A;  2ZEQ A;  2QIE B;  1HEZ E;  2BYV E;  4AP4 C;  3ZGZ A;  4ZHO A;  1RYJ A;  2YLM A;  4USA A;  1SJH D;  4BBN C;  1E8Y A;  1G6J A;  2I1K A;  2MBQ A;  2PTL A;  1NVI D;  3ENE A;  3AEC B;  1E8X A;  3IHP C;  4NAM A;  3O13 A;  3QAQ A;  3VXW A;  2NMQ A;  1RFK A;  3PLU A;  4LNI A;  1MHX A;  2WQY B;  4KIK B;  2LHE A;  4PT5 A;  3RCZ A;  3CMM B;  1SXT A;  1Q1O A;  4PS8 A;  2L8J A;  2GRI A;  4W9L A;  1MFW A;  2N7D A;  2DWQ A;  2WXO A;  2KJR A;  4RGT A;  5E6J A;  4ANW A;  3U7D A;  4B6W A;  2I38 A;  2KDE B;  3KH0 A;  5DPW A;  2ZCC A;  5AZG A;  1F0Z A;  3APD A;  2JXT A;  2XEW A;  2RMM A;  4PYZ A;  2KTF A;  4MAC A;  4KVG B;  4C56 C;  3QX1 A;  1STE A;  2BVC A;  2JYE A;  2QHO A;  1EM7 A;  1K50 A;  2NTS A;  2YEP B;  2L83 A;  2LFI A;  3MJW A;  2MRP A;  1A5R A;  4JWS C;  2C9W B;  3KWL A;  2GB1 A;  2L0F A;  4DXF A;  3SR6 A;  1HA5 A;  2WGS A;  3HIZ A;  5TSS A;  2KKC A;  2DBY A;  4FXC A;  4YT0 B;  3ZNI D;  3DBL B;  3SHQ A;  2PE9 A;  1QOB A;  1M4V A;  1KLV A;  2K8H A;  3IFW B;  5HKH A;  4N9F 4;  2BS4 B;  4KSK C;  3DBR I;  2BB6 A;  3TMP B;  1IP9 A;  3BYY B;  4TV3 A;  2R61 A;  1V9J A;  2E6X A;  1FXA A;  2WDV B;  3VAW A;  2L1A A;  2LHD A;  5EE0 A;  3VUY A;  1DOI A;  2AYO B;  2L3Z A;  3TEX A;  4FBJ B;  5C23 A;  1XLO A;  2XK5 B;  3AEG B;  2PLP A;  3RN9 C;  3AE8 B;  3MHS D;  5EDS A;  4US9 A;  5FK9 C;  4PS3 A;  2KN4 A;  5BYQ A;  3CIR B;  2OJW A;  1U4A A;  3MJ5 A;  3E9S A;  4M0W B;  1P7F A;  2DZI A;  3L10 B;  1I42 A;  4J3O D;  1WX9 A;  3L4P A;  4MGK E;  2KJ6 A;  3W9C B;  1R4M B;  2WX0 A;  3PRP B;  2K25 A;  1ESF A;  4YTN B;  1ZKH A;  1FEH A;  1N62 A;  4W9C A;  3WAN A;  3Q8A A;  3QK0 A;  2PW9 A;  5IA7 A;  5AUI A;  4KSL C;  4ARC A;  1C76 A;  2K22 A;  4BKS A;  4EE2 A;  1L0Y B;  2XN9 C;  3PHX B;  4EZL A;  1LGR A;  3PRE A;  3KUZ A;  1OEY A;  3DVN U;  4ANX A;  1V6E A;  3RUI B;  4ZYS A;  1PFD A;  5DPS A;  2K6Q A;  4W9H A;  4GN1 A;  4HCP B;  2B3A A;  2KVR A;  1UD7 A;  2C7M B;  2BB5 A;  2BT6 A;  3AV8 A;  1TS4 A;  3WAM A;  2WLB A;  2IY1 B;  2ZNV B;  2AWT A;  3PSE B;  4W9G A;  1YNT E;  1UGJ A;  1C9F A;  2LGY A;  4RM8 A;  2RDG A;  2WDT B;  1TZO A;  1AYF A;  2L32 A;  2HTH A;  4KDL B;  3VUX A;  1IGC A;  1JWU D;  2AL3 A;  2BYE A;  2DEN B;  2EKI A;  3PV1 A;  3RZW C;  3A9K B;  2QEJ C;  3Q8F A;  3RNA C;  2JYT A;  2RGF A;  2CU1 A;  4LNK A;  2LGD A;  3Q8C A;  2PEA A;  4A9A A;  3W1Y A;  2PKO A;  3APF A;  2IGD A;  2LJ5 A;  5D3D A;  3ZRC A;  1ISN A;  3I57 A;  4XZ4 A;  2K0P A;  2K39 A;  1X1M A;  1XCQ L;  4MDK E;  4NQK E;  3B0A A;  2IO3 B;  2AQ3 B;  2DZJ A;  2KLG A;  2Z0D B;  3CSF A;  1EUV B;  1WM3 A;  4WJO A;  5D3I B;  2KX3 A;  4MJS A;  3AUL A;  2KT7 A;  1WXA A;  3L16 A;  2WXI A;  3E56 A;  3AXC A;  3ZYY X;  1L6U A;  1ZDX A;  2LZ6 A;  4OW0 A;  2DHZ A;  2C5L C;  4MEM A;  3DBR B;  4WQO B;  4BZA A;  4B0M A;  4KZC A;  3A1Q A;  4ITK A;  4HPP A;  4WWP A;  2DYO A;  4EFO A;  2BKF A;  3KYD D;  4RGM A;  2QMT A;  3MC9 A;  2FNJ B;  2H88 B;  4MT5 A;  1CJE A;  1SBB B;  4MH8 A;  2PE6 B;  5DPR A;  1WWT A;  2GBJ A;  5GXG B;  1XLN A;  3D32 A;  5C2T B;  3TEY A;  2OJR A;  1H8C A;  1Z5S B;  2N1V A;  4IDI A;  3P42 A;  2O6V B;  4FJZ A;  4C4V A;  3UF8 A;  4HEA 1;  1WYG A;  1RWS A;  2KOX A;  2KFK A;  3B2G A;  1TS2 A;  1WYW B;  1WI0 A;  3PHW B;  4I6N B;  5C3J B;  2C7H A;  1VZ6 A;  1V1P A;  2KAN A;  4BKS D;  3ALB A;  1GNU A;  1V80 A;  3MP9 A;  4G50 A;  3A1Q B;  1WFY A;  4NAW A;  3R8B A;  1MVK A;  3SU8 X;  5G55 A;  5G5H A;  2G4D B;  2RDB C;  4C7Y A;  1YX6 B;  2ASQ A;  3GE3 C;  2E3T A;  3ZLZ A;  1YJ1 A;  1P9D U;  4B95 A;  3ZJU A;  4BKG A;  4RCO A;  3GZN B;  4F7Z A;  4DDI D;  4GMV A;  1YQ3 B;  3IXS A;  4RF1 A;  3EFU A;  5KHQ A;  4LLG M;  1R7S A;  2K1F A;  2ZNV C;  3N20 C;  1OQY A;  2NBV B;  2CHZ A;  2OOB B;  1YOV B;  1TY2 A;  2QCZ A;  3AE1 B;  3P4Q B;  4ICU A;  1P98 A;  2KDB A;  2WS3 B;  4KZ0 A;  2KLC A;  1KJT A;  3VR9 B;  3P2B A;  3B9J A;  4K1R B;  5LLI A;  1VRA B;  2UYZ B;  1TGZ B;  3UI3 A;  5HFY A;  2NR2 A;  2NPT A;  1TS5 A;  4CO7 A;  1FM0 D;  3VTW A;  1J7A A;  2FCQ A;  1NYQ A;  2LUE A;  4YWG G;  4FLH A;  3ZKJ C;  1TY0 A;  5CX3 A;  2KXJ A;  1HZ5 A;  1TT5 B;  1C4A A;  1WF9 A;  1KRH A;  2PPH A;  5CTR C;  2K8B A;  1FMA D;  1B1Z A;  4XWW A;  2D3A A;  2IY0 B;  2B76 B;  2D10 A;  2O6V D;  3IAM 1;  3DWM A;  3P4P B;  3DBL I;  3Q3M C;  1V2Y A;  2ZW1 A;  2D11 A;  1KOT A;  1CZP A;  3FC4 A;  4JIO U;  3B1L X;  3NS8 A;  4NJ6 A;  3NZS A;  5LXI B;  2IYD B;  3UIP B;  3JVZ X;  1V86 A;  1SE4 A;  2N4F A;  3HRD D;  2LJI A;  4XYC A;  3DCG A;  2IO1 B;  1YN5 A;  1LQB A;  3QQ8 B;  2EMS A;  3PLV A;  4ACF A;  2N9K A;  2A4Z A;  3VRB B;  2WXM A;  4C80 A;  1WJU A;  3GOE A;  1UUP A;  3Q3J A;  3V62 A;  5EE9 A;  5E6O A;  3TUO A;  4HLE A;  2I2Y A;  3DPD A;  4DXA B;  1GPX A;  2JY6 A;  1EU3 A;  3ABV B;  2M4N A;  1P7E A;  3AI5 A;  1ACC A;  4FHJ A;  1E9M A;  2XNA C;  3VRA B;  1SJE D;  3UGB B;  4HJG E;  1WMH B;  2G45 B;  3P63 A;  4RGN A;  5D2M B;  5DPT A;  1R4M I;  4KKJ A;  1FPY A;  1L5P A;  3M3J A;  3FIL B;  2NCN A;  1E8W A;  1E0Z A;  1PGB A;  4HDQ A;  4IM0 A;  4GGQ A;  1L4Z B;  4M8M A;  2R2Q A;  3C8Y A;  3VVW B;  4D2K A;  1WH3 A;  2NBW B;  3NY5 A;  4GDL B;  2KQ7 A;  4GXB A;  4IW0 A;  4HPM B;  2KAC A;  1JRO A;  4E3C A;  4UDU C;  1S1Q B;  2N9X A;  2KNB A;  3VTV A;  4WJQ A;  2PIA A;  4A3P A;  2TSS A;  2RD0 A;  4JLC A;  2M19 A;  3BK1 A;  5BMH A;  1T6B X;  4GDK A;  3RNG C;  1I4G A;  2JX5 A;  4TKN A;  1TKE A;  1IBX A;  3H9D A;  2DAJ A;  3T3O A;  3N1X C;  2VZK B;  2X8X X;  2KO3 A;  3P4S B;  2G9H D;  4XWT A;  4NNJ B;  1WGH A;  1V81 A;  4ICV A;  2Y5C A;  4IWQ A;  3V61 A;  2A5U A;  2LGX A;  4ANV A;  2AQ1 B;  5KHO A;  1MG8 A;  1WXV A;  2WDQ B;  1ZW7 A;  3JYU A;  1JRP A;  2MJD A;  3QIJ A;  3JSV A;  2MP2 A;  1UBI A;  4K7W A;  4JPS A;  2CHW A;  1DGJ A;  3ZXV A;  4HXD A;  4ZYN A;  4X57 B;  3GP7 A;  3DHI C;  4IOI E;  2Y5B B;  1KF6 B;  3MC8 A;  4OVV A;  3DBS A;  3Q69 A;  1C79 A;  2O2V B;  4JWU C;  2MWS B;  1HQR D;  3P4R B;  5CHF A;  3ZTC A;  1C1Y B;  1HE8 A;  5GMV A;  3UQA A;  4OHJ A;  1K52 A;  4GDK B;  4RGO S;  2WXN A;  4RMA A;  2MBB B;  1GB1 A;  2HDE A;  2MBE A;  2MEK A;  5J2R A;  4RH6 A;  3MC0 B;  2J0J A;  3VHT C;  4C00 A;  2CJN A;  4K3C A;  2Y5P A;  1EF5 A;  2FIF A;  1YJI A;  2KQ4 X;  3CWI A;  2MSE D;  4P7I A;  4P6V F;  4DWF A;  2KTR A;  1B9R A;  2KYW A;  4HKQ A;  4ZRP A;  2GBK A;  2JRI B;  2J42 A;  2WX1 A;  4LCD E;  2INC C;  1TZ1 A;  3DBH B;  5HHD G;  3VFK A;  3I63 C;  2KK8 A;  1J8C A;  3P1M A;  2LAS A;  1RLF A;  2EMT A;  4TSS A;  4AUQ C;  2G4S A;  1V5O A;  3QWZ B;  1K51 A;  2SAK A;  3HVD A;  1JWS D;  1D5X C;  2V0G A;  4ANU A;  5D94 A;  1CQV A;  1V5T A;  4URK A;  1L2N A;  2KDF B;  2Z59 B;  2VZK D;  2BW2 A;  2IPK D;  4P1C C;  2HE7 A;  1I4P A;  3AH7 A;  2ONQ A;  3U7Z A;  1GOZ A;  2J0M A;  3TCA A;  2KMC A;  4A8X C;  1UWM A;  5IOI A;  3I3T B;  1VD2 A;  3CST A;  2D07 B;  4WIP A;  2VRR B;  2X38 A;  2V3N A;  1L4D B;  1OTR B;  4OZA A;  2KZR A;  4P1B C;  1TIF A;  3VR8 B;  4IKG A;  1I4Q A;  4A20 A;  4ZRJ A;  3BK2 A;  2IBI B;  1JQ4 A;  3TJP A;  2JUO A;  2WXH A;  3RNB C;  3RNF C;  2HJ1 A;  3VUW A;  4HK2 A;  2M17 A;  1UF0 A;  3AE6 B;  3GZN I;  4ZRQ A;  2VH2 A;  3ZNH B;  1F1H A;  4W9K A;  4DHZ E;  2JZ3 B;  1UH6 A;  1EWY C;  3H7P A;  1JRU A;  3SD5 A;  2KFJ A;  1VZ7 A;  4REZ A;  4WWM A;  3ZIM A;  1T0R C;  5EE3 A;  2JZZ A;  2HJ8 A;  3BIN A;  3LXF A;  1C78 A;  1E7U A;  1UNS A;  2K5P A;  3BVZ A;  2G3Q B;  4B9K A;  1S3S G;  3RYT A;  4WH4 A;  3BII D;  1I4H A;  2WXP A;  2RDH A;  4K7S A;  1GG3 A;  1DYQ A;  2BPS A;  3IBE A;  2D5G A;  2ICI A;  1EF1 A;  1T0Q C;  3AED B;  1F77 A;  3RFZ B;  1E7V A;  2REX A;  1IGD A;  4OVZ A;  2JT4 B;  2KQS A;  5AUK A;  4RFB A;  1BML C;  3VH3 B;  4WAF A;  3IAS 1;  3H7P B;  4W9E A;  1VJK A;  3AB5 A;  4IM2 A;  1RRB A;  2D3C A;  5H8Y E;  1P3Q U;  4HRS A;  4MH0 E;  1XO3 A;  4LJO B;  3DVG X;  1L0X B;  4MGI E;  2RR9 A;  2LXC A;  4IC7 B;  1WSP A;  3T8M A;  1PQS A;  4BKT A;  3MHZ A;  2MX2 A;  1XEE A;  1L7Y A;  2JQR B; 
#chains in the Genus database with same CATH homology
 5TR5 A;  2JXX A;  1UEL A;  3A4R A;  3VTU A;  4ICU A;  1P98 A;  2KDB A;  2LRU A;  4LJP B;  1WGG A;  3KUD B;  4KZ0 A;  3LJ3 A;  2KLC A;  1KJT A;  3L17 A;  3IVF A;  1J0G A;  2AEH A;  4WAA A;  3ZNG C;  2MW5 A;  2KTR B;  3P2B A;  1SGH A;  4NPN A;  3ZDM C;  1CMX B;  1LM8 B;  1XT9 B;  2O2V A;  3KVF B;  2UYZ B;  1TGZ B;  4K1R B;  5LLI A;  4EUT A;  1ZGU B;  2NR2 A;  1OEY J;  2IO2 B;  3QJZ A;  2NPT A;  4FUL A;  2KC1 A;  2DZM A;  3IG3 A;  4CO7 A;  4DHZ B;  2ZEQ A;  3VTW A;  2MQJ A;  1BT0 A;  2BYV E;  2FCQ A;  2LUE A;  2MLB A;  5E6N A;  4AP4 C;  3V6E B;  1D3Z A;  2XBB C;  4FLH A;  1J19 A;  3HK0 A;  3ZKJ C;  2N9E B;  2GBN A;  2YLM A;  4TUU A;  2V4L A;  2KXJ A;  5CX3 A;  2FCS A;  5JZE B;  4BBN C;  2IO0 B;  4GIV A;  1E8Y A;  1WF9 A;  1G6J A;  2PPH A;  5CTR C;  4CYE A;  2K8B A;  5JHA A;  2I1K A;  2FUH B;  2MBQ A;  3APC A;  4HJK A;  2IY0 B;  3ENE A;  2D10 A;  2DYB A;  4E74 A;  2O6V D;  3KW5 B;  1E8Z A;  1E8X A;  3IHP C;  3QAR A;  3UIN B;  3DVN V;  3ZRF A;  2BF8 B;  3M63 B;  3DBL I;  2AL6 A;  3L54 A;  3ONS A;  1V2Y A;  4PYU A;  3DDC B;  3WAP A;  4MM3 A;  3QAQ A;  3VXW A;  2D11 A;  4AWJ A;  3PLU A;  1KOT A;  3EHV A;  5JHB A;  1WR1 A;  4IM3 A;  1WGY A;  4W9F A;  3DVG Y;  3U8Z A;  4KIK B;  4JIO U;  1VCB A;  3B1L X;  3NS8 A;  4NJ6 A;  3NZS A;  3H7S A;  5LXI B;  3RCZ A;  3CMM B;  1Q1O A;  1K8R B;  4PS8 A;  2IYD B;  3UIP B;  2NVU I;  4MSQ B;  2L8J A;  3JVZ X;  4GU2 A;  4MJS B;  3ZUN A;  1V86 A;  4W9L A;  3A9K A;  2N4F A;  3OJ4 B;  2N7D A;  2KJR A;  2BWF A;  3DCG A;  2IO1 B;  1LQB A;  5J17 A;  4ANW A;  3U7D A;  3RD2 A;  3QQ8 B;  2EMS A;  2KDE B;  2LD9 A;  1P0R A;  4B6W A;  3PLV A;  2LXA A;  3KH0 A;  1WXM A;  5DPW A;  2ZCC A;  4JGH B;  5AZG A;  2A4Z A;  3HM6 X;  3PRZ A;  4HPL B;  2IZV B;  3APD A;  1Q0W B;  4NQL B;  4DK5 A;  2KD0 A;  1WJU A;  3GOE A;  3Q3J A;  2XEW A;  4PYZ A;  3A9J A;  2KTF A;  3V62 A;  1WZ3 A;  5E6O A;  4KVG B;  3B08 A;  3QX1 A;  3EEC A;  2QHO A;  3QCA A;  4HLE A;  3DPD A;  4DXA B;  2JY6 A;  2KJH B;  3MJW A;  4BOZ B;  4ZDV A;  2MRP A;  4BBN F;  4HVB A;  1A5R A;  1TTN A;  2C9W B;  5E6P A;  2L0F A;  3X23 A;  2ZJD A;  2M4N A;  3ML8 A;  2D3G A;  3HIZ A;  3AI5 A;  3R7Q A;  2KKC A;  4WJN A;  2NS5 A;  4YL8 A;  3L0W B;  2BKR B;  4FHJ A;  3ZNI D;  3SHQ A;  2KWU B;  2PE9 A;  3OLM D;  4GOC A;  3RZF A;  2K6D B;  1SE9 A;  1KLV A;  3UGB B;  2K8H A;  3VDZ A;  3IFW B;  1WMH B;  3PVL A;  3L13 A;  4LDT B;  5L95 C;  2G45 B;  2LRW A;  5HKH A;  5D2M B;  2FAZ A;  4N9F 4;  2FCN A;  5DPT A;  4FA6 A;  1AAR A;  1R4M I;  2KMA A;  4KSK C;  3RT3 B;  3DBR I;  3TMP B;  4BFR A;  1IP9 A;  3DOW A;  1T0Y A;  3ZVV A;  3M3J A;  4TV3 A;  1V9J A;  2NCN A;  1YIW A;  3VAW A;  1WX7 A;  4MEL A;  3SDL C;  1E8W A;  3VUY A;  3UQB A;  1GC6 A;  2AYO B;  1UZX B;  2J0K A;  2L3Z A;  1Z2M A;  4HDQ A;  4IM0 A;  4GGQ A;  4M8M A;  4FBJ B;  5C23 A;  2XK5 B;  2R2Q A;  3WAO A;  2KFK B;  3PTF C;  2DYM A;  3N30 A;  4NJ7 A;  3TIX A;  3VVW B;  3TBL D;  1WH3 A;  2NBW B;  3NY5 A;  4GDL B;  1YQB A;  2NBU A;  2JF5 A;  2KQ7 A;  4GXB A;  4IW0 A;  3MHS D;  5EDS A;  4HPM B;  4CHK A;  2JRH A;  2JWZ A;  4PS3 A;  1WY8 A;  3QHT A;  4E3C A;  2W9N A;  1S1Q B;  2MBO A;  2V3S A;  3PZD A;  4NAW B;  2N9X A;  2L05 A;  2KNB A;  3VTV A;  4AJY B;  4WJQ A;  3W1S A;  4A3P A;  4FN2 A;  4W9I A;  2RD0 A;  2DX5 B;  4WWO A;  2CKH B;  3PRM B;  1U4A A;  4JLC A;  4M0W B;  4GDK A;  2J7Q B;  4IG7 B;  2N9P C;  2O6V A;  1WM2 A;  2PJH A;  3PS6 A;  4MSM B;  4AOF A;  4TKN A;  4BOS C;  2DZI A;  3H9D A;  2DAJ A;  3L10 B;  3QA8 A;  3V60 A;  4MGZ E;  1I42 A;  1WX9 A;  2KWC A;  3PT2 B;  4MGK E;  2KJ6 A;  1XD3 B;  2KO3 A;  3NOB A;  4NNJ B;  1YX5 B;  2WX0 A;  1WGH A;  1V81 A;  3PRP B;  4ICV A;  3N32 A;  2N7E A;  1E90 A;  2K25 A;  4IWQ A;  3ECI A;  2KN5 A;  3V61 A;  2A5U A;  3ZDT A;  2ZZP B;  2LGX A;  2LVP A;  1UGM A;  4ANV A;  5KHO A;  1MG8 A;  1WXV A;  1ZKH A;  4W9C A;  3DBH I;  3WAN A;  1ZW7 A;  3QK0 A;  3JYU A;  3QIJ A;  3JSV A;  3H6N A;  3JW0 X;  2MP2 A;  1UBI A;  5IA7 A;  3HHM A;  4WJP A;  5CHV C;  4K7W A;  2CHW A;  2N1W A;  4HXD A;  2FCM A;  2V1Y A;  4KSL C;  4X57 B;  4ZYN A;  4BKS A;  5AZH A;  2Y5B B;  4EKU A;  4OVV A;  2WWZ A;  4GB9 A;  3PHX B;  3DBS A;  4EZL A;  3PRE A;  1H4R A;  2O2V B;  3KUZ A;  2MWS B;  4HDO A;  1OEY A;  3DVN U;  2LVO A;  2NPT B;  4ANX A;  5CHF A;  3ZTC A;  1C1Y B;  1HE8 A;  1V6E A;  5GMV A;  3UQA A;  2MCN B;  3RUI B;  5AEK B;  4LDT D;  5DPS A;  4GDK B;  4RM9 A;  2K6Q A;  1NBF C;  2KWV B;  4RMA A;  4OVU A;  4W9H A;  4GN1 A;  4II2 B;  3U30 A;  4GSW A;  2MBB B;  2MBE A;  2M1M A;  1WZ0 A;  4HCP B;  5J2R A;  2B3A A;  4E71 A;  3AU4 A;  2KVR A;  2J0J A;  3VHT C;  1UD7 A;  2C7M B;  2KHW B;  1LXD A;  3X0W A;  1KM7 A;  2YVC A;  4W9J A;  3M95 A;  1EF5 A;  2FIF A;  2GBM A;  2MSE D;  3WAM A;  4P7I A;  4DBG A;  2IY1 B;  2ZNV B;  3EC8 A;  4DWF A;  2KTR A;  2AWT A;  3PSE B;  4W9G A;  3ZO5 B;  2GBK A;  4G0N B;  2JRI B;  5C1Z A;  1SIF A;  2LGY A;  4M8N A;  4RM8 A;  3OAW A;  2BGF A;  2L0T A;  1EO6 A;  2WDT B;  2WX1 A;  2JVC A;  3O65 B;  4LCD E;  1Q5W B;  1TZ1 A;  4ZRI A;  3VFK A;  1J8C A;  2HTH A;  2KK8 A;  4KDL B;  3VUX A;  2KX0 A;  2LAS A;  2AL3 A;  4FJV B;  2BYE A;  1RLF A;  2DEN B;  3K9O B;  1IPG A;  2EMT A;  3PV1 A;  3RZW C;  4AUQ C;  3K9P B;  2G4S A;  3A9K B;  4F8C B;  1F9J A;  1V5O A;  2D2Q A;  2RGF A;  1WIA A;  3QWZ B;  1WXS A;  2CU1 A;  2LGD A;  3V6C B;  4TQ1 A;  2PEA A;  5CHW A;  4J6I A;  4F1S A;  3W1Y A;  3APF A;  4ANU A;  2LJ5 A;  2RPQ A;  5D94 A;  3ZRC A;  1V5T A;  4W9D A;  4URK A;  5DCN A;  1ISN A;  3TL5 A;  1L2N A;  4KDI C;  4XZ4 A;  2KDF B;  2Z59 B;  2K39 A;  2ZVN A;  1X1M A;  3A4S C;  3A9J B;  4KV2 A;  4MDK E;  5G2N A;  4NQK E;  2L76 A;  2IO3 B;  3B0A A;  4KIK A;  5D6J B;  2HE7 A;  2DZJ A;  2KLG A;  2Z0D B;  5FR6 A;  3CSF A;  4IUM B;  3MTN B;  4HWI B;  3R66 C;  1M94 A;  4ZRK A;  4DHJ B;  1EUV B;  1WM3 A;  1NDD A;  4WJO A;  2CR5 A;  2J0M A;  2KX3 A;  4MJS A;  1P1A A;  1RAX A;  1WJ4 A;  2L00 B;  3AUL A;  3R7R A;  1WE6 A;  3TCA A;  3WIM A;  1FXT B;  2MBH A;  2KMC A;  1WXA A;  3M62 B;  3L16 A;  3CF6 E;  3I3T B;  4K81 A;  3AXC A;  2HD5 B;  1VD2 A;  1I35 A;  1TBE A;  2LZ6 A;  3T9L A;  2R2O A;  2I1J A;  3CST A;  3UIO B;  2D07 B;  2DHZ A;  4K7U A;  2VRR B;  3NZU A;  3ZNZ B;  2C5L C;  4I6L B;  1OTR B;  3KUC B;  4MEM A;  3WA0 A;  1R4N I;  2GOW A;  3WAL A;  5BO4 B;  4WQO B;  2RSU A;  1GJZ A;  2KZR A;  2M8S A;  4I6P A;  3PPA A;  4KZC A;  2KC2 A;  3A1Q A;  4WWN A;  2KDI A;  4FAD A;  4WWP A;  3OJ3 A;  1WRD B;  1IYF A;  2L7R A;  2DYO A;  3QC8 B;  4A20 A;  4ZRJ A;  4EFO A;  2BKF A;  3KYD D;  1C3T A;  1GUA B;  2IBI B;  2GMI C;  5J18 A;  4AJW A;  2EKE C;  3NHE B;  3TJP A;  1WGD A;  2C60 A;  2FNJ B;  2JUO A;  4II3 B;  5D7G A;  3VQI A;  2BWE S;  1WGR A;  2PE6 B;  3VUW A;  4JL9 A;  2ZPY A;  4HK2 A;  2M17 A;  5DPR A;  3GZN I;  1WMH A;  3ZNH B;  3ZW3 A;  4W9K A;  4DHZ E;  1NI2 A;  2GBJ A;  2JZ3 B;  1UH6 A;  4EOY A;  3H7P A;  2WYQ A;  3D32 A;  4FJY A;  5AZF A;  1JRU A;  1YD8 U;  2ZCB A;  3SD5 A;  2KFJ A;  2CHX A;  3A33 B;  4TQ0 A;  1RFA A;  2OJR A;  1H8C A;  1Z5S B;  2N1V A;  3PGE A;  4MGY E;  3ZIM A;  2JZZ A;  2HJ8 A;  4EZJ A;  2O6V B;  3BIN A;  4FJZ A;  4ASW C;  1E7U A;  3AU5 A;  3DQV A;  1OGW A;  2XK5 A;  4XX5 A;  3UF8 A;  4IWO A;  2KOX A;  2M0X A;  2KFK A;  4FHK A;  2G3Q B;  3PHW B;  1WYW B;  1WI0 A;  4I6N B;  4BVU C;  2MA9 B;  3ML9 A;  2C7H A;  2ZPN A;  3Q3F A;  4B9K A;  1WR6 E;  1S3S G;  2KAN A;  4GDL A;  1LFD A;  1Y8R C;  1UBQ A;  4PS7 A;  3KYC D;  4BKS D;  3RYT A;  1WE7 A;  2BYF A;  3ALB A;  1GNU A;  1GC7 A;  3L08 A;  3ZTD A;  1V80 A;  1E5W A;  2C7N B;  3LDZ E;  4NY0 A;  4G11 A;  1GG3 A;  3H1U A;  4G50 A;  4K7S A;  3A1Q B;  3HM3 A;  1WFY A;  4NAW A;  2BPS A;  3SU8 X;  2ZVO A;  5G55 A;  5L83 A;  2G4D B;  5IAA C;  4HCN B;  3IBE A;  2DAF A;  2JPH A;  1EF1 A;  3BY4 B;  1YX6 B;  1WX8 A;  2ASQ A;  1QZE A;  2LI5 A;  3JSV B;  2MP2 B;  1WJ6 A;  1E7V A;  2REX A;  4DHJ D;  3W1S C;  2JT4 B;  3ZLZ A;  4A3O A;  2KQS A;  1YJ1 A;  4G3X B;  1P9D U;  4B95 A;  4BKG A;  4F7Z A;  5LXH A;  4DDI D;  4GMV A;  3VH3 B;  2CS4 A;  3RUL A;  2DZK A;  3H7P B;  4W9E A;  2LVQ A;  4EEW A;  1V49 A;  1RRB A;  4IM2 A;  3VH4 B;  2Z0E B;  4XC2 A;  3EFU A;  2K8C A;  2FID A;  4DDG D;  5KHQ A;  1P3Q U;  3R3M A;  3S2A A;  4MH0 E;  2LWP A;  3C0R B;  4EZK A;  5JH5 C;  4LJO B;  3DVG X;  2K1F A;  2ZNV C;  4MGI E;  2RR9 A;  1OQY A;  2LXC A;  2NBV B;  2CHZ A;  2OOB B;  2GBR A;  1PQS A;  3N3K B;  4IC7 B;  2UWQ A;  4IWP A;  3T8M A;  4BKT A;  2MX2 A;  1L7Y A;  4JQW C;  1XQQ A;  1WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...