2M4NA

Solution structure of the putative ras interaction domain of afd-1, isoform a from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AFD-1, isoform a
publication title Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m4nA00
3PZDA 2C7MB 3VXWA 4MELA 1WMHA 2PE9A 2KANA 3OJ3A 1WM2A 2FAZA 4W9IA 1YD8U 4LDTB 4MGZE 2AYOB 3W1SC 1GUAB 2RSUA 5IAAC 1TTNA 1R4NI 3VTWA 3UIOB 4TV3A 3NZSA 2BF8B 4XZ4A 3H7SA 5D6JB 4PYUA 1NBFC 2C5LC 3R7QA 4HXDA 1FXTB 2DZIA 3VFKA 4JGHB 4FADA 4G50A 3VH3B 1WXMA 2HTHA 4B9KA 1V81A 3LDZE 2JPHA 3B1LX 3WAOA 2IYDB 2RD0A 3N32A 5L83A 3DVNV 1WYWB 3K9PB 4FULA 4I6LB 1J19A 4MDKE 2AWTA 4G0NB 3WALA 3IHPC 4FJVB 2WDTB 1SIFA 1WRDB 2GBJA 2JRIB 3JSVA 3VDZA 1C3TA 5G2NA 4DDGD 4NQLB 5BO4B 1E8XA 1P1AA 4ZRJA 3R7RA 1UZXB 1YX6B 4KDIC 4NPNA 1PQSA 2N9XA 3NS8A 2AL6A 2K6DB 1YX5B 2I1JA 3VUWA 2O6VB 5C1ZA 3NOBA 2W9NA 2GBMA 4W9GA 2N1VA 4MJSA 3A33B 3WIMA 4K1RB 3QJZA 3TJPA 5CTRC 1U4AA 4ICUA 3N30A 1WX7A 4FHKA 4K81A 3KUZA 1WJNA 2N9EB 4MGKE 2RR9A 3L54A 1P0RA 4I6NB 4BKSA 3V62A 4EZJA 1AARA 3EECA 2KWUB 4KSKC 2BWES 4W9KA 3CSFA 2DENB 1E90A 2QHOA 3VH4B 2M0XA 2N7EA 2KFJA 3ZO5B 2LZ6A 2MP2A 3QK0A 2MBBB 4M8MA 3HIZA 4GDLA 3H1UA 2D07B 5E6PA 5EDSA 1E7VA 3QA8A 1X1MA 2NS5A 3QX1A 4WWNA 3HM3A 4IM3A 2KLGA 3O65B 4RMAA 4W9EA 1T0YA 3DBRI 2KMAA 1WJ6A 2NCNA 3D32A 2LI5A 5D2MB 1UGMA 4OVUA 3R3MA 1SE9A 2KDEB 5E6NA 5CHWA 4W9HA 2C9WB 3RZFA 1WR6E 4GB9A 4MM3A 4WAAA 4HLEA 1WMHB 2JUOA 3UGBB 4W9CA 2D3GA 1IYFA 1UELA 4KZ0A 1EUVB 2DAFA 3M95A 2DAJA 4IC7B 2JWZA 5DPRA 5C23A 2ZNVC 4MEMA 4PS8A 3V6CB 4TQ1A 2D2QA 4WWOA 2MX2A 4NJ7A 2M4NA 4LJPB 2L8JA 2CR5A 2KJHB 2UWQA 2FCSA 2IY0B 2HE7A 2AEHA 5KHQA 4BOSC 2CHZA 3AXCA 1K8RB 4KIKA 2BGFA 4JL9A 2MA9B 2LWPA 3APFA 5J2RA 4PS3A 3SU8X 3CMMB 3PLVA 4KZCA 2DZJA 4JQWC 2GBRA 1XQQA 2LGXA 5D94A 1GC7A 3JSVB 2LD9A 2G45B 3HHMA 3VHTC 4BKSD 5JHBA 1WX8A 2L00B 5CX3A 4WJQA 3ML9A 4LCDE 4WJPA 3GOEA 1KOTA 1L7YA 4BKGA 2LRUA 3CF6E 3ZRFA 3VUXA 4ZRKA 3EC8A 1TGZB 1Q0WB 3QIJA 2DX5B 1WM3A 2JZZA 4K7WA 4W9JA 2N9PC 4MJSB 4IUMB 4A3OA 2KZRA 1WGGA 1L2NA 1WGYA 3A9KA 3UINB 1I35A 3PPAA 2ZPYA 3PRPB 4KDLB 3DBLI 4DHZB 4TQ0A 2JF5A 3DOWA 2KXJA 2HD5B 4GSWA 3V6EB 4MH0E 3H6NA 1UH6A 4AOFA 2LUEA 1V5OA 2KC2A 3HM6X 4ANWA 4IWPA 3WANA 3IBEA 4RM8A 3T8MA 5JZEB 3PRMB 4DK5A 3DVGX 5DPSA 2WX1A 2MP2B 4GIVA 3PT2B 4MSQB 4GDLB 4HDOA 5JHAA 3PSEB 1YJ1A 2I1KA 1I42A 4HK2A 3I3TB 4N9F4 3P2BA 2GBNA 4JIOU 2ZZPB 4AJWA 3ONSA 2JZ3B 3OJ4B 2DHZA 1NDDA 4KVGB 4M0WB 2PEAA 4ZRIA 4HPLB 3S2AA 1VCBA 3ZTDA 3VTUA 2K6QA 4EZKA 3ZNGC 4F7ZA 2C7NB 2N7DA 2K39A 2PJHA 2LRWA 3A4RA 2BYFA 3DPDA 1D3ZA 1Z2MA 2IZVB 1S3SG 2MBQA 4W9LA 4RM9A 4IWOA 2KN5A 1WGHA 3APDA 2V4LA 5TR5A 1J8CA 1KM7A 2C7HA 2J0MA 2RGFA 4WWPA 4DHJD 4DXAB 2DYOA 2GMIC 5D7GA 4CHKA 2IBIB 4BKTA 4KIKB 3CSTA 3PLUA 3PREA 2G4SA 2M1MA 3K9OB 2OJRA 2O2VA 2KX0A 4GXBA 1GNUA 4WQOB 3ZRCA 3V61A 2KDFB 2CU1A 2YLMA 5LXHA 1RFAA 3KH0A 2YVCA 3X23A 4MGIE 2KOXA 2G3QB 1OGWA 2K8HA 2KHWB 1WJ4A 3L16A 3QC8B 2KWCA 3MJWA 4K7SA 3AI5A 1WJUA 4MSMB 5AZFA 3KW5B 2KLCA 2KJ6A 4B95A 3NY5A 3PHWB 1VD2A 3A9KB 3QWZB 1IPGA 3EHVA 4GN1A 4EUTA 2L05A 3U30A 3PS6A 4J6IA 2K8BA 2NVUI 3RUIB 5JH5C 1RAXA 4EOYA 1KJTA 4HWIB 2KVRA 4MGYE 3JW0X 2IO3B 3L10B 4OVVA 4ANXA 1V86A 2BYVE 1E7UA 4XC2A 3W1SA 3SHQA 4BOZB 2D10A 3UIPB 1P3QU 3TMPB 1G6JA 1LQBA 4E74A 5FR6A 2LVQA 4ANUA 5LXIB 4NAWA 2MW5A 2J0KA 1SGHA 3IVFA 4FN2A 3ALBA 1WZ0A 2DYBA 4G3XB 4HJKA 4BBNF 4URKA 3H7PA 3TL5A 2XEWA 1WXVA 3UQBA 2LVOA 3WAPA 2LGDA 4BBNC 3L0WB 4ZDVA 1S1QB 4F1SA 3SDLC 2JRHA 4EZLA 1E8ZA 3B0AA 4E3CA 1WF9A 3R66C 3VQIA 1V9JA 2KKCA 1WZ3A 3DDCB 4B6WA 3AU4A 4IM2A 1V49A 2NBVB 3WA0A 2JT4B 1TZ1A 3TBLD 3DCGA 4NQKE 3KUCB 4GDKA 4W9FA 3LJ3A 4NY0A 3BY4B 1E8YA 5E6OA 2LGYA 3VAWA 2FUHB 5J18A 2KD0A 2HJ8A 3ZKJC 2NPTA 2L3ZA 1WH3A 2MBOA 2DYMA 2R2OA 4F8CB 2KK8A 4HDQA 3ZDTA 4AJYB 4BFRA 4EEWA 4GOCA 2MSED 4LDTD 3MTNB 1LXDA 1RRBA 3B08A 4IG7B 2G4DB 2MCNB 2MLBA 4IWQA 2IY1B 1EF1A 1ZGUB 2KTFA 2KWVB 4XX5A 2O2VB 2J7QB 3JYUA 1BT0A 2M8SA 3ZTCA 3KYDD 1Y8RC 2IO2B 4ASWC 1NI2A 1WE6A 2NR2A 4II2B 4AUQC 2N4FA 1P9DU 2EKEC 1Q5WB 3L13A 3ML8A 2ASQA 4KSLC 4EKUA 4YL8A 2OOBB 2Z59B 3KYCD 1OEYJ 2K8CA 5LLIA 2Z0DB 2BWFA 2ZJDA 3PGEA 4A3PA 4EFOA 3A9JA 1KLVA 5DCNA 3V60A 2CHXA 3ZNHB 1CMXB 2DZKA 2FNJB 2M17A 2KQ7A 2IO1B 2LXAA 3IFWB 3DVNU 2XK5A 4CO7A 1J0GA 2KDIA 1MG8A 1A5RA 1C1YB 2FCMA 3APCA 2O6VD 2V3SA 2KFKA 3X0WA 3ZNZB 3A1QA 1UBQA 1WE7A 3RYTA 3QQ8B 2MBHA 5AZGA 4FBJB 3UQAA 4GU2A 2ZVOA 2JXXA 2L0TA 4I6PA 3U8ZA 2KTRA 2ZCCA 4NAWB 4CYEA 1H8CA 2KC1A 5J17A 3H7PB 4M8NA 3RCZA 2KX3A 2Z0EB 2L0FA 2RPQA 3C0RB 3U7DA 2BYEA 5GMVA 3ZVVA 4DHZE 5CHVC 2R2QA 1YIWA 4NNJB 2N1WA 2NBWB 4GGQA 4DDID 2V1YA 2ZPNA 4IW0A 3PRZA 3OAWA 3EFUA 5IA7A 4KV2A 1P98A 1RLFA 1WX9A 4K7UA 3IG3A 1OEYA 1OQYA 4FA6A 3M62B 5KHOA 2FCQA 4GMVA 3DQVA 4AP4C 1V2YA 1GC6A 2REXA 3ENEA 3PVLA 3VUYA 4GDKB 2C60A 4HCNB 2CHWA 1V80A 4II3B 3VVWB 4X57B 1YQBA 3T9LA 2GOWA 4ZYNA 1M94A 3ZW3A 2NPTB 4DHJB 4HVBA 2FIDA 4ICVA 4AWJA 1Q1OA 5AEKB 1WIAA 3KUDB 3ZLZA 2BPSA 1H4RA 5L95C 2KMCA 3PHXB 4IM0A 4ANVA 4TUUA 2JY6A 2FCNA 4PYZA 3HK0A 3QCAA 3TIXA 3UF8A 4HCPB 2J0JA 4WJOA 5HKHA 3H9DA 1F9JA 2LASA 1V5TA 2MWSB 2LJ5A 3RZWC 3NHEB 2KNBA 3SD5A 3W1YA 2DZMA 2CS4A 3DBHI 2K1FA 2WX0A 1UD7A 1GJZA 3VTVA 3ZUNA 4E71A 2KDBA 4P7IA 2MRPA 3NZUA 3DVGY 2KQSA 2Y5BB 2PE6B 1GG3A 4G11A 1HE8A 2PPHA 3ZNID 2EMSA 1XT9B 2BKRB 4NJ6A 1R4MI 3KVFB 2ZVNA 1OTRB 3PV1A 3RULA 2IO0B 3MHSD 3A9JB 2ZEQA 3L08A 3QAQA 4W9DA 4WJNA 3JVZX 1WY8A 2B3AA 4HPMB 3RD2A 3Q3FA 1WXSA 3Q3JA 1WXAA 2L7RA 1Z5SB 2O6VA 2XK5B 5DPTA 3M3JA 3WAMA 2L76A 4DWFA 2LXCA 2WWZA 3PTFC 5G55A 3RT3B 4TKNA 1WFYA 1ZW7A 2KFKB 2GBKA 2WYQA 1V6EA 3DBSA 2JVCA 2MBEA 1ZKHA 1LM8B 2XBBC 3A1QB 3OLMD 4FJYA 3ZIMA 2KJRA 4A20A 1EO6A 1ISNA 1QZEA 1WGRA 2ZNVB 3AULA 3ZDMC 2AL3A 3BINA 2D11A 4FLHA 4LJOB 4BVUC 3TCAA 2BKFA 2KTRB 4PS7A 3N3KB 1E5WA 3M63B 1UBIA 1EF5A 5CHFA 3A4SC 1JRUA 3QHTA 1WR1A 4FHJA 2K25A 3AU5A 4FJZA 2UYZB 2EMTA 3GZNI 3QARA 2A4ZA 4JLCA 1WGDA 1XD3B 2VRRB 5AZHA 5DPWA 2LVPA 3L17A 2FIFA 3ECIA 2NBUA 1WI0A 1E8WA 4DBGA 1IP9A 1LFDA 2KO3A 2MQJA 2ZCBA 1TBEA 2CKHB 2A5UA
chains in the Genus database with same CATH superfamily
3PZDA 2DNFA 1GAQB 4MELA 3Q6BA 3OJ3A 4LDTB 2LEKA 2AYOB 4MGZE 3W1SC 1KRHA 1FMAD 2RSUA 1TTNA 3UIOB 4BZAA 1WGKA 1L6VA 3NZSA 3TSSA 5D6JB 2C5LC 4HXDA 1FXTB 1NVID 1VLBA 4FADA 1WXMA 1R4MB 3B1LX 3WAOA 3N32A 3K9PB 4MDKE 2IDYA 4G0NB 1OFFA 4FJVB 3JSVA 4DDGD 1MHHE 2N9KA 1P1AA 2SAKA 4L1BA 3R7RA 4KDIC 1YX6B 4P1CC 1FCCC 2INDC 4NPNA 3R2TA 2O6VB 2W9NA 3V3XA 4WH4A 2QIEB 3DWMA 4KGTA 1ZDXA 1PFDA 1FNWA 1P0RA 3L54A 2FUG1 3RNCC 2BWES 4W9KA 4P16A 1E90A 3RNBC 2VH1A 3EFCA 2M0AA 3W9CB 2KFJA 1VJKA 3QK0A 2BQQA 5BYQA 1E7VA 3QA8A 3HM3A 3BZDB 4YSXB 3DBRI 1T0YA 2D3BA 2NCNA 1QOFA 3AE6B 5D2MB 3URYA 5CHWA 1HEZE 3I5JC 3ZGZA 4HLEA 1WMHB 1F77A 1IYFA 1UELA 3MJ5A 1UNSA 2BW2A 5G5GA 2DAJA 2JWZA 5D3DA 2ZNVC 5EE9A 4MEMA 4ZOHC 1IBXB 2M4NA 4LJPB 1F1HA 2KJHB 5KHQA 3NJTA 4BOSC 3APFA 1AWDA 3SU8X 3PLVA 4B0MA 4JQWC 1HA5A 2GBRA 5D94A 1GC7A 2G45B 1QOBA 1OQQA 5CX3A 3Q8BA 1FNVA 1FPYA 3BVGA 3CF6E 3ZRFA 3RI7C 3VUXA 1V8CA 3P63A 1C78A 3QIJA 4K7WA 4ITKA 2JZZA 4NJCA 4Q2JA 3UINB 4XWTA 2JF5A 1TJEA 3IT4B 3TEXA 2KXJA 2WLBA 2J42A 2QC8A 1D6EC 1ZXHA 1ZPSA 1HZ6A 2INCC 4LLGM 1V5OA 3U4EG 3HM6X 4ANWA 5FK9C 5JZEB 3IBEA 1J7BA 1PGXA 3DVGX 2WX1A 2MP2B 3PT2B 2I1KA 1XLQA 4HK2A 3I3TB 2GBNA 4JIOU 4AJWA 2JZ3B 3O13A 1HZ5A 4A90A 4ZRIA 1JQ4A 5H92C 2KN4A 1FRRA 1HQRD 4IDIA 1ENFA 2K39A 5BMIA 3A4RA 2WDVB 2BYFA 1N5XA 1Z2MA 4N59A 2V0GA 4LK0M 4WWPA 4DHJD 4DXAB 3NRZA 1R7SA 2IBIB 3B2FA 4USAA 3PREA 2M1MA 3BVZA 2O2VA 1GNUA 2CU1A 2K22A 2YVCA 3AE9B 2BYTA 2G3QB 3BVMA 2V9HA 2H89B 3NVWA 3EA6A 1JW9D 3AI5A 1WJUA 1ROEA 4BAXA 1TKGA 1XO3A 3PHWB 1VD2A 3QWZB 1JWUD 4MH8A 3U30A 1WXQA 4J6IA 1KLGD 5JH5C 1RAXA 2JX5A 1MPEA 1KJTA 2KVRA 2IO3B 2BYVE 4P1BC 4XC2A 1E9MA 4BOZB 1JWMD 4YWGG 4OW0A 5FR3A 4NAWA 2MW5A 2BBCA 2LUMA 1WZ0A 3MC8A 4BBNF 3TL5A 2HJ1A 1WXVA 2XEWA 3UQBA 3KWLA 5G5HA 1VZ6A 4A6QA 1QKZA 1WF9A 2KKCA 3WA0A 1Y56A 3RNGC 2W82A 3DCGA 4NQKE 4NY0A 1YMHE 3VAWA 3ZKJC 4B0EA 2KK8A 3ZQ4A 1XCTL 3MTNB 3B08A 1RRBA 4IG7B 4ZRQA 2KWVB 4YXDB 2E6XA 1BT0A 3ZTCA 1Y8RC 4AUQC 2N4FA 1P9DU 4P6VF 3I57A 3P1MA 3NZ3A 4MT5A 3AEAB 3Q69A 5BYRA 2K8CA 2BWFA 2ZJDA 1BMLC 4EFOA 1L0XB 1PGBA 5DCNA 1E0ZA 2PKOA 2CHXA 3ZNHB 2V3PA 3NUHB 2KQ4X 2XK5A 2OHFA 3LB8C 2Y5CA 4A55A 5FKAC 4C7ZA 1C1YB 3Q3OC 2ZW0A 2KFKA 3X0WA 2QDFA 1UBQA 1WE7A 3RYTA 3UQAA 2ZVOA 2J4XA 1JWBD 3FILB 1DOXA 1YQ3B 4CYEA 5J17A 4M8NA 2H88B 1HXYD 2W3SA 1F2RC 2N1WA 4DDID 2ONQA 2KT7A 3BK1A 2PVOD 4JE3B 3OAWA 2MHJA 2WU2B 4K7UA 4FA6A 2L83A 4GMVA 1YN3A 3DQVA 1SJED 3IAS1 2C60A 4K3BA 4X57B 2KMMA 4ZYNA 1M94A 4DHJB 3TUOA 4ICVA 2RMMA 4AWJA 3SFDB 4D2KA 2BPSA 1H4RA 2E3TA 2FE8A 3PHXB 4TUUA 3ZJUA 3AV8A 2V4IB 2LASA 2MWSB 2LJ5A 3DWGC 1QT9A 3AE1B 3N1ZC 1KF6B 2WX0A 3ZUNA 2KDBA 2KDMA 3NZUA 1ESFA 2Y5BB 4LNFA 1J7CA 1GG3A 4G11A 1FRDA 3WCQA 3ZNID 2JYEA 1XT9B 1VZ8A 4ACFA 3KVFB 2ZVNA 3JVZX 3RD2A 3Q3FA 2JSVX 1WXSA 1WXAA 5DPTA 1E6EB 3PTFC 1ZW7A 1JALA 3OLMD 3BIID 2JVCA 2XBBC 1L0VB 2KJRA 2UU7A 1K53A 2KYWA 2ZNVB 3AULA 4FLHA 4BVUC 3TCAA 2BKFA 3AEDB 1E5WA 3M63B 1PGAA 2PIAA 2WHIA 3ZXVA 3A4SC 3QHTA 1WR1A 4RCOA 1SSNA 2EMTA 2QMTA 1NENB 2LVPA 3L17A 2FIFA 2NBUA 3PO0A 1ACCA 2CKHB 2A5UA 2C7MB 4AS1A 3VXWA 1NI3A 2FAZA 2SEBD 1WSPA 1YN4A 4C56C 1YD8U 4S17A 2INNE 4YSZB 1NBFC 3R7QA 2DZIA 4JGHB 4G50A 2IYDB 1VDVA 1C4PA 2RPVA 4DXFA 5L83A 1WYGA 1WYWB 1WRIA 1J19A 2AWTA 3IHPC 5C3JB 1SIFA 2JRIB 1C3TA 1I4RA 1ZUD2 1I4GA 2L52A 2W3RA 1FD6A 1E8XA 4DXGA 2AX5A 1YX5B 3VUWA 5C1ZA 2GBMA 3IT6B 3WIMA 3Q8EA 3TJPA 1U4AA 4ICUA 4K81A 1SE3A 2WXGA 1EM7A 1WJNA 2N9EB 1EU4A 1T0SC 4PT5A 3CSFA 1FXAA 3ABVB 2M0XA 1IUEA 3AE4B 3ZO5B 2MBBB 4M8MA 4GDLA 1D5XC 2D07B 5EDSA 2XNAC 1ZXIA 3QX1A 2KLGA 3O65B 2MJ3A 4RMAA 3D32A 4M0WA 2R61A 1UGMA 3R3MA 1SE9A 2KDEB 4YT0B 5E6NA 2C9WB 4MM3A 2JUOA 2D3GA 3M95A 4IC7B 5DPRA 5C23A 1C77A 4L2YA 3MP9A 3CIRB 4HPPA 2Y3AA 2M56B 3BWUD 4WWOA 4NJ7A 2UWQA 2IY0B 3AE3B 3AM9A 1GOZA 3PZ8A 2Z8LA 4KIKA 4PS3A 3CMMB 2DZJA 1AYFA 4HEA1 1XQQA 1L5PA 4BKSD 4WJPA 1SIJA 1XCQL 1WWTA 3R2IA 3R8BA 1ET6A 4ZRKA 3RN9C 3EC8A 1Q0WB 1WM3A 4MJSB 4IUMB 3PRPB 5HG2A 4DHZB 3DBLI 4TQ0A 1JCKB 2HD5B 3V6EB 4MH0E 3H6NA 1UH6A 3SR6A 4XE0A 2WXQA 2WNMA 1T3QA 1F0ZA 4RM8A 2N9LA 3T8MA 3SFEB 5JHAA 4HDOA 2IGGA 1YJJA 4HRSA 1J7AA 1HTOA 3ONSA 4KVGB 2PEAA 4WQMA 2LRWA 1D3ZA 2MBQA 4W9LA 4RM9A 4IWOA 3APDA 1WGHA 2J0MA 2RGFA 1V1PA 4BKTA 4YSYB 2W54A 3PLUA 5IN7A 1TS4A 2KX0A 4WQOB 2I38A 3HVDA 3ZRCA 4XDDA 1CJEA 2KDFB 2YLMA 1RFAA 1OGWA 2K8HA 2KHWB 3AE8B 3VR8B 4RGOS 4K7SA 4C4VA 4MSMB 5AZFA 1P7FA 1P7EA 3AEFB 3A9KB 3Q2AC 4EUTA 2L05A 4LTUA 2K8BA 3RUIB 3AE2B 1XXGA 4ANXA 1E7UA 1P3QU 2K3UA 1G6JA 5FR6A 4ANUA 4FN2A 2J0KA 3IVFA 2DYBA 4URKA 2AQ1B 4ZDVA 1S1QB 3SDLC 2JRHA 3MC0B 4EZLA 3B0AA 1WZ3A 2WP9B 3DDCB 4IM2A 1V49A 2WXPA 2I2YA 3TBLD 3KUCB 1N6ZA 3BY4B 5E6OA 1L4DB 2FUHB 2HJ8A 1RYJA 1FXIA 1XLPA 4F8CB 1YQ4B 3ZDTA 4XYCA 4GOCA 2DWQA 2JQRB 2K9XA 2MEKA 2G4DB 2MLBA 2KTFA 1ZGUB 3N1XC 4ASWC 1NI2A 4II2B 4MACA 2WXRA 2EKEC 4RF1A 1Q5WB 3L13A 3NVVA 4EKUA 1C76A 4ARIA 3AH7A 1OEYJ 1UWXA 1EWCA 4A3PA 3A9JA 3V60A 2TSSA 4KKJA 2DZKA 2IO1B 2LXAA 4CO7A 1TT5B 2KDIA 4JPSA 2FCMA 3APCA 1ZE3D 3QQ8B 4GU2A 3GP7A 2KTRA 1H8CA 2KC1A 3H7PB 2KX3A 2Z0EB 3RNFC 3C0RB 3ZVVA 2BS4B 5GMVA 2JYTA 1Q10A 2R2QA 1YIWA 1FEHA 4GGQA 5C2TB 2V1YA 2ZPNA 4IW0A 4XDCA 1P98A 1RLFA 1OEYA 1OQYA 2J52A 2FCQA 4AP4C 3VUYA 4GDKB 3T9LA 2YEPB 2NPTB 1Q1OA 5AEKB 1TS3A 4PK1A 4PYZA 2FCNA 4HCPB 4WJOA 1C9FA 1I4XA 3H9DA 4NZLB 1V5TA 2KNBA 5AUKA 2DZMA 1GJZA 1SXTA 4E71A 2MRPA 1HE8A 1TY2A 3PV1A 1R4MI 2LMCA 1OTRB 2Q5WD 3MHSD 2ZEQA 3QAQA 2JZPA 3Q8AA 2O6VA 2BS3B 2XN9C 2L76A 1TY0A 2K0PA 5G55A 1JRPA 1WFYA 2WYQA 1V6EA 1ZKHA 3DHGC 3A1QB 2KAJA 1ISNA 3ZDMC 2D11A 3ZYYX 1UBIA 3ETRA 3GE8C 5IO9A 1JRUA 2IGHA 2KWDA 1B9RA 3MC9A 1L0YB 3QARA 2WU5B 2A4ZA 2EKIA 1KLUD 3I9V1 1WI0A 2KVZA 2WDQB 3TEWA 3RMKC 3AE5B 2WXHA 1WMHA 2PE9A 1E10A 1GUAB 5IAAC 3VTWA 2D3CA 3LXFA 1IBXA 3VRAB 1I4HA 4PYUA 2KACA 1AN8A 2CJNA 2FBWB 3VFKA 4TSSA 1V81A 3LDZE 1QOAA 1SF0A 4HKZE 3DVNV 3TEZA 3WALA 2GRIA 2LGIA 1WRDB 3VDZA 1E7PB 4GLSC 4NQLB 1I7HA 3AEBB 5BO4B 4C7YA 1PQSA 3NS8A 2K6DB 4A8XC 4C00A 2QILA 3NOBA 5BYSA 2LGSA 1VZ7A 4RFBA 3A33B 4K1RB 2CU3A 5CTRC 3N30A 3FC4A 2MJDA 3GZNB 2RR9A 4HJGE 4I6NB 4BKSA 4EZJA 1AARA 3EECA 2KWUB 4KSKC 1GB1A 2N7EA 2LZ6A 2MP2A 3HIZA 3H1UA 5E6PA 1FCLA 3OG5A 4IM3A 2BVCA 4FXCA 2ICIA 3TEYA 4OVUA 3RPFC 3RZFA 3OWEB 4ZHPA 4GB9A 4WAAA 1V97A 3UGBB 4W9CA 4KZ0A 1EUVB 4PS8A 3T3OA 2D2QA 4M01A 2CR5A 2FCSA 3P4QB 2AEHA 1QOGA 2WXNA 2CHZA 1K8RB 2BGFA 3DHHC 3H8HA 2LGXA 3JSVB 2LD9A 3ZXRA 1WX8A 2L00B 4ARCA 3NVYA 3ML9A 3AN1A 4LCDE 3AEGB 3GOEA 1KOTA 1CZPA 4BKGA 2LRUA 4XWWA 1TGZB 2DX5B 2N7JA 2N9PC 1L2NA 1WGYA 1I35A 3PPAA 3Q14C 4KDLB 1UWMA 3DOWA 1BUIC 4GSWA 2EELA 3DBHB 4AOFA 1FM0D 2KC2A 4N58A 3DBRB 2QCZA 3L4PA 5DPSA 4GIVA 2GLSA 1YJ1A 4N9F4 3P2BA 2ZZPB 2HDEA 1YJIA 2DHZA 1NDDA 4JWSC 3RNAC 1C79A 1UF0A 4HPLB 3ZTDA 4EZKA 3ZNGC 4YTNB 4R3DA 1UUPA 2N7DA 3P4RB 2WXFA 2LHEA 3DPDA 1S3SG 3U7ZA 3HRDD 2V4LA 5TR5A 1QF6A 1J8CA 2C7HA 1ET9A 2WQYB 1EU3A 1XF5L 1MFWA 1TS5A 4CHKA 2G4SA 3K9OB 5JXVA 4HROA 4RH6A 5LXHA 4CQNA 3KH0A 2KOXA 1I4PA 3N20C 3L16A 4LNIA 3QC8B 3MJWA 2MH7A 3KW5B 2KLCA 2KJ6A 2J53A 4TMAB 1R4NB 2JWUA 2NVUI 3P4PB 1VR9A 5MPOA 4HWIB 1MI0A 2GI9A 3L10B 4MGYE 1V86A 3W1SA 3SHQA 3TMPB 2LVQA 2VH2A 3FILA 5LXIB 4G3XB 2LVOA 3WAPA 4BBNC 3L0WB 1MHXA 4L23A 2Y5PA 5EE0A 1JWAD 1ZDVA 3FAHA 1V9JA 3AU4A 2JT4B 3U2SC 4W9FA 1SB3C 4OZBA 1SE4A 1B1ZA 1TZOA 2WXLA 5J18A 2L3ZA 3EUB2 2MBOA 5GXGB 2D3AA 2L32A 2MSED 1SEBD 4IWQA 2IY1B 2O2VB 2HTME 2M8SA 2IO2B 2NR2A 3ZJVA 3AE7B 4RGMA 3ML8A 2ASQA 4YL8A 4US8A 1N60A 3PGEA 1KLVA 3Q8CA 3GS2A 1CMXB 2WGSA 2M17A 3IFWB 3DVNU 4A9AA 1MG8A 1JROA 3ZNZB 2B76B 4RGTA 4WWMA 2RDHA 4FBJB 2MBHA 5AZGA 3LYYA 2L0TA 3U8ZA 2ZCCA 4NAWB 4RGNA 2RPQA 3U7DA 4DHZE 1C4AA 4OZCA 4NNJB 2NBWB 4WURA 1TIFA 3PRZA 1RWSA 3EFUA 3AEEB 3IG3A 3N9YC 1T0RC 5LNK1 5IKCM 4K3CA 2REXA 3PVLA 4RNAA 1IGDA 2CHWA 1V80A 1CQVA 1YQBA 2GOWA 2WXOA 3ZW3A 4HVBA 3MHZA 4LNKA 4H2AA 5L95C 2KMCA 2NMQA 4IM0A 4ANVA 3T3NA 4KX6B 2JXTA 3HK0A 3QCAA 1NYRA 2J0JA 2QSDA 3W1YA 3NHEB 2K5PA 3NS1A 2CS4A 3DBHI 2K1FA 3NVZA 2X8XX 1EWYC 1UD7A 4HKQA 3AMZA 4P7IA 3DVGY 2EMSA 3BYTB 2DLBA 3RULA 2N0SB 1WY8A 2B3AA 2VZKD 4HPMB 4LNOA 3Q3JA 2L7RA 1Z5SB 2XK5B 1MVKA 3Q8FA 4DWFA 2LXCA 2WWZA 3VVWB 2KFKB 3DBSA 1N63A 2MBEA 1LM8B 3Q3NC 3UI3A 1WGRA 2AL3A 1FFUA 4PS7A 1EF5A 4KGRA 1KH0A 2PW9A 1T5XD 2NTTA 4FHJA 3AU5A 1JMLA 5BMHA 4FJZA 2UYZB 3P42A 1WGDA 1XD3B 2VRRB 3ECIA 1RM6C 5IP4D 4DBGA 4WAFA 4WIPA 2KO3A 1T0QC 3DHIC 4OHJA 2MQJA 1TBEA 3CWIA 2WXIA 5CHFA 1ZOYB 3EGRA 4KGSA 1PDXA 2BT6A 4KKIA 2KANA 1WM2A 5HHDG 4W9IA 2BB6A 1TKYA 1R4NI 4O1NA 4TV3A 2BF8B 4XZ4A 3H7SA 2ON8A 1FIQA 3VH3B 2HTHA 2G1EA 3N1YC 4B9KA 2JPHA 2RD0A 4FULA 4I6LB 2WDTB 2GBJA 1TKEA 5G2NA 1CK1A 4ZRJA 2YEPF 1UZXB 3FKYA 1L4ZB 2N9XA 2AL6A 2I1JA 1ZP0B 4W9GA 2N1VA 4MJSA 1QILA 3QJZA 1KFYB 5IOIA 1WX7A 4FHKA 3KUZA 1NYQA 1XLOA 4MGKE 3W2DA 2PLPA 3V62A 5EE1A 2ACZB 4IOIE 2QEJC 2DENB 3VH4B 2QHOA 1I4QA 2WXJA 3J9CA 4RF0A 2MJEA 2PVGC 2ZW1A 2WXKA 1X1MA 4US9A 2NS5A 4WWNA 4W9EA 2KMAA 1WJ6A 2LI5A 5EE3A 4W9HA 3ZJTA 1WR6E 4YTMB 4LNNA 2DAFA 5D3IB 1AW7A 3C8YA 3V6CB 1MG4A 4TQ1A 2MX2A 2L8JA 2HE7A 3BYYB 3AXCA 4JL9A 2MA9B 2LWPA 5J2RA 4KZCA 4E74A 3IXSA 3HHMA 2WXMA 3VHTC 1TYGB 5TSSA 5JHBA 2VZKB 4WJQA 4OVZA 1SE2A 1C4CA 1L7YA 1VRAB 2LFIA 4DQOC 3E9SA 4W9JA 4A3OA 2KZRA 1WGGA 1F2RI 2INPE 3A9KA 2ZPYA 1GB4A 2JU6X 3AECB 2IGDA 2LUEA 1IGCA 1PUTA 4IWPA 1FFVA 3WANA 5I4DA 3PRMB 4DK5A 4M00A 1K52A 1QLBB 4MSQB 4GDLB 4ZRPA 3PSEB 1I42A 2DBYA 4EE2A 3OJ4B 4REZA 4M0WB 3S2AA 3B9JA 1VCBA 3VTUA 2K6QA 4MM3B 2LHDA 4F7ZA 1LGRA 2C7NB 2PJHA 1JWSD 2IZVB 4YTPB 1V1OA 3PZ7A 2KN5A 2BS2B 2OEDA 1YOVB 3VRBB 1DOIA 1KM7A 2RDBC 2DYOA 2GMIC 2BTEA 5D7GA 4KIKB 3CSTA 3SEBA 2OJRA 2X38A 2WS3B 4GXBA 3RFZB 3V61A 2CJOA 4N6EB 3X23A 4MGIE 1BXTA 2IJ0A 3AB5A 1L6UA 1WJ4A 3DBLB 1D5MC 2KWCA 1STEA 2PMVA 3E56A 3IAM1 4B95A 2BB5A 5BMGA 3NY5A 2D5GA 3GE3C 1LO5D 1IPGA 3EHVA 4GN1A 4ZYSA 3PS6A 4XGAB 1XEEA 4EOYA 2RDGA 3W5UB 3JW0X 4OVVA 3BK2A 2D10A 3UIPB 1LQBA 2AQ3B 2NTSA 4HJKA 1SGHA 3ALBA 3H7PA 2LGDA 4F1SA 1E8ZA 4E3CA 1OQRA 3R66C 3VQIA 4B6WA 2NBVB 2G9HD 1SJHD 2IPKD 1TZ1A 1K51A 1RFKA 4GDKA 3LJ3A 1DGJA 1E8YA 2LGYA 2KD0A 2NPTA 1WH3A 1YN5A 2DYMA 2R2OA 1T6BX 1N5WA 4HDQA 4AJYB 4BFRA 4EEWA 3V05A 4LDTD 1V1PB 1LXDA 2MCNB 4XX5A 1EF1A 1XLNA 2J7QB 3JYUA 3HUIA 2AQ2B 3KYDD 1MJDA 3I63C 1WE6A 2QJLA 4KSLC 2OOBB 2Z59B 3HVZA 4C4VB 3KYCD 5LLIA 2Z0DB 2FNJB 2KQ7A 4JWUC 1N61A 1J0GA 1A5RA 2O6VD 2V3SA 1PYWD 3A1QA 2JXXA 4I6PA 4ZHOA 4OZAA 3KLSX 1DYQA 3RCZA 4AQ7A 2L0FA 2BYEA 5CHVC 5H8YE 4QAYA 3KWVA 4S0RA 5IA7A 4KV2A 1WX9A 4IKGA 3W5VB 3M62B 5KHOA 1V2YA 1GC6A 3ENEA 2OJWA 2W55A 4HCNB 3NG0A 4II3B 4JX1C 2FIDA 1QQRA 2V3NA 1K50A 1WIAA 3KUDB 1YNTE 3ZLZA 4NAMA 1D5ZC 2JY6A 3TIXA 3UF8A 5HKHA 1F9JA 1FNUA 3RZWC 3SD5A 3B2GA 1UGJA 1KTKA 3VTVA 5T8IA 1FO4A 4J3OD 2KQSA 1TS2A 2PE6B 2PPHA 3Q3MC 2BKRB 3P4SB 4NJ6A 2IO0B 3A9JB 3L08A 4W9DA 4WJNA 3RNEC 1DOYA 4UDUC 1NEKB 3M3JA 3WAMA 2M19A 4M02A 2PTLA 3RT3B 4TKNA 2GBKA 2LJIA 4FJYA 3ZIMA 4A20A 1EO6A 1QZEA 3BINA 4LJOB 4C80A 2KTRB 3N3KB 1F52A 1A70A 5AUIA 1N62A 2GB1A 1HTQA 5E6JA 2L1AA 2K25A 3VR9B 3GZNI 3C19A 4JLCA 3U52E 5AZHA 5DPWA 3KQ4A 1E8WA 1GPXA 1SBBB 5HI1A 1IP9A 1LFDA 2WDRB 1M4VA 3GB1A 3MFGA 1D4BA 2ZCBA 5HFYA
chains in the Genus database with same CATH topology
3PZDA 2C7MB 3VXWA 4MELA 1WMHA 2PE9A 2KANA 3OJ3A 1WM2A 2FAZA 4W9IA 1YD8U 4LDTB 4MGZE 2AYOB 3W1SC 1GUAB 2RSUA 5IAAC 1TTNA 1R4NI 3VTWA 3UIOB 4TV3A 3NZSA 2BF8B 4XZ4A 3H7SA 5D6JB 4PYUA 1NBFC 2C5LC 3R7QA 4HXDA 1FXTB 2DZIA 3VFKA 4JGHB 4FADA 4G50A 3VH3B 1WXMA 2HTHA 4B9KA 1V81A 3LDZE 2JPHA 3B1LX 3WAOA 2IYDB 2RD0A 3N32A 5L83A 3DVNV 1WYWB 3K9PB 4FULA 4I6LB 1J19A 4MDKE 2AWTA 4G0NB 3WALA 3IHPC 4FJVB 2WDTB 1SIFA 1WRDB 2GBJA 2JRIB 3JSVA 3VDZA 1C3TA 5G2NA 4DDGD 4NQLB 5BO4B 1E8XA 1P1AA 4ZRJA 3R7RA 1UZXB 1YX6B 4KDIC 4NPNA 1PQSA 2N9XA 3NS8A 2AL6A 2K6DB 1YX5B 2I1JA 3VUWA 2O6VB 5C1ZA 3NOBA 2W9NA 2GBMA 4W9GA 2N1VA 4MJSA 3A33B 3WIMA 4K1RB 3QJZA 3TJPA 5CTRC 1U4AA 4ICUA 3N30A 1WX7A 4FHKA 4K81A 3KUZA 1WJNA 2N9EB 4MGKE 2RR9A 3L54A 1P0RA 4I6NB 4BKSA 3V62A 4EZJA 1AARA 3EECA 2KWUB 4KSKC 2BWES 4W9KA 3CSFA 2DENB 1E90A 2QHOA 3VH4B 2M0XA 2N7EA 2KFJA 3ZO5B 2LZ6A 2MP2A 3QK0A 2MBBB 4M8MA 3HIZA 4GDLA 3H1UA 2D07B 5E6PA 5EDSA 1E7VA 3QA8A 1X1MA 2NS5A 3QX1A 4WWNA 3HM3A 4IM3A 2KLGA 3O65B 4RMAA 4W9EA 1T0YA 3DBRI 2KMAA 1WJ6A 2NCNA 3D32A 2LI5A 5D2MB 1UGMA 4OVUA 3R3MA 1SE9A 2KDEB 5E6NA 5CHWA 4W9HA 2C9WB 3RZFA 1WR6E 4GB9A 4MM3A 4WAAA 4HLEA 1WMHB 2JUOA 3UGBB 4W9CA 2D3GA 1IYFA 1UELA 4KZ0A 1EUVB 2DAFA 3M95A 2DAJA 4IC7B 2JWZA 5DPRA 5C23A 2ZNVC 4MEMA 4PS8A 3V6CB 4TQ1A 2D2QA 4WWOA 2MX2A 4NJ7A 2M4NA 4LJPB 2L8JA 2CR5A 2KJHB 2UWQA 2FCSA 2IY0B 2HE7A 2AEHA 5KHQA 4BOSC 2CHZA 3AXCA 1K8RB 4KIKA 2BGFA 4JL9A 2MA9B 2LWPA 3APFA 5J2RA 4PS3A 3SU8X 3CMMB 3PLVA 4KZCA 2DZJA 4JQWC 2GBRA 1XQQA 2LGXA 5D94A 1GC7A 3JSVB 2LD9A 2G45B 3HHMA 3VHTC 4BKSD 5JHBA 1WX8A 2L00B 5CX3A 4WJQA 3ML9A 4LCDE 4WJPA 3GOEA 1KOTA 1L7YA 4BKGA 2LRUA 3CF6E 3ZRFA 3VUXA 4ZRKA 3EC8A 1TGZB 1Q0WB 3QIJA 2DX5B 1WM3A 2JZZA 4K7WA 4W9JA 2N9PC 4MJSB 4IUMB 4A3OA 2KZRA 1WGGA 1L2NA 1WGYA 3A9KA 3UINB 1I35A 3PPAA 2ZPYA 3PRPB 4KDLB 3DBLI 4DHZB 4TQ0A 2JF5A 3DOWA 2KXJA 2HD5B 4GSWA 3V6EB 4MH0E 3H6NA 1UH6A 4AOFA 2LUEA 1V5OA 2KC2A 3HM6X 4ANWA 4IWPA 3WANA 3IBEA 4RM8A 3T8MA 5JZEB 3PRMB 4DK5A 3DVGX 5DPSA 2WX1A 2MP2B 4GIVA 3PT2B 4MSQB 4GDLB 4HDOA 5JHAA 3PSEB 1YJ1A 2I1KA 1I42A 4HK2A 3I3TB 4N9F4 3P2BA 2GBNA 4JIOU 2ZZPB 4AJWA 3ONSA 2JZ3B 3OJ4B 2DHZA 1NDDA 4KVGB 4M0WB 2PEAA 4ZRIA 4HPLB 3S2AA 1VCBA 3ZTDA 3VTUA 2K6QA 4EZKA 3ZNGC 4F7ZA 2C7NB 2N7DA 2K39A 2PJHA 2LRWA 3A4RA 2BYFA 3DPDA 1D3ZA 1Z2MA 2IZVB 1S3SG 2MBQA 4W9LA 4RM9A 4IWOA 2KN5A 1WGHA 3APDA 2V4LA 5TR5A 1J8CA 1KM7A 2C7HA 2J0MA 2RGFA 4WWPA 4DHJD 4DXAB 2DYOA 2GMIC 5D7GA 4CHKA 2IBIB 4BKTA 4KIKB 3CSTA 3PLUA 3PREA 2G4SA 2M1MA 3K9OB 2OJRA 2O2VA 2KX0A 4GXBA 1GNUA 4WQOB 3ZRCA 3V61A 2KDFB 2CU1A 2YLMA 5LXHA 1RFAA 3KH0A 2YVCA 3X23A 4MGIE 2KOXA 2G3QB 1OGWA 2K8HA 2KHWB 1WJ4A 3L16A 3QC8B 2KWCA 3MJWA 4K7SA 3AI5A 1WJUA 4MSMB 5AZFA 3KW5B 2KLCA 2KJ6A 4B95A 3NY5A 3PHWB 1VD2A 3A9KB 3QWZB 1IPGA 3EHVA 4GN1A 4EUTA 2L05A 3U30A 3PS6A 4J6IA 2K8BA 2NVUI 3RUIB 5JH5C 1RAXA 4EOYA 1KJTA 4HWIB 2KVRA 4MGYE 3JW0X 2IO3B 3L10B 4OVVA 4ANXA 1V86A 2BYVE 1E7UA 4XC2A 3W1SA 3SHQA 4BOZB 2D10A 3UIPB 1P3QU 3TMPB 1G6JA 1LQBA 4E74A 5FR6A 2LVQA 4ANUA 5LXIB 4NAWA 2MW5A 2J0KA 1SGHA 3IVFA 4FN2A 3ALBA 1WZ0A 2DYBA 4G3XB 4HJKA 4BBNF 4URKA 3H7PA 3TL5A 2XEWA 1WXVA 3UQBA 2LVOA 3WAPA 2LGDA 4BBNC 3L0WB 4ZDVA 1S1QB 4F1SA 3SDLC 2JRHA 4EZLA 1E8ZA 3B0AA 4E3CA 1WF9A 3R66C 3VQIA 1V9JA 2KKCA 1WZ3A 3DDCB 4B6WA 3AU4A 4IM2A 1V49A 2NBVB 3WA0A 2JT4B 1TZ1A 3TBLD 3DCGA 4NQKE 3KUCB 4GDKA 4W9FA 3LJ3A 4NY0A 3BY4B 1E8YA 5E6OA 2LGYA 3VAWA 2FUHB 5J18A 2KD0A 2HJ8A 3ZKJC 2NPTA 2L3ZA 1WH3A 2MBOA 2DYMA 2R2OA 4F8CB 2KK8A 4HDQA 3ZDTA 4AJYB 4BFRA 4EEWA 4GOCA 2MSED 4LDTD 3MTNB 1LXDA 1RRBA 3B08A 4IG7B 2G4DB 2MCNB 2MLBA 4IWQA 2IY1B 1EF1A 1ZGUB 2KTFA 2KWVB 4XX5A 2O2VB 2J7QB 3JYUA 1BT0A 2M8SA 3ZTCA 3KYDD 1Y8RC 2IO2B 4ASWC 1NI2A 1WE6A 2NR2A 4II2B 4AUQC 2N4FA 1P9DU 2EKEC 1Q5WB 3L13A 3ML8A 2ASQA 4KSLC 4EKUA 4YL8A 2OOBB 2Z59B 3KYCD 1OEYJ 2K8CA 5LLIA 2Z0DB 2BWFA 2ZJDA 3PGEA 4A3PA 4EFOA 3A9JA 1KLVA 5DCNA 3V60A 2CHXA 3ZNHB 1CMXB 2DZKA 2FNJB 2M17A 2KQ7A 2IO1B 2LXAA 3IFWB 3DVNU 2XK5A 4CO7A 1J0GA 2KDIA 1MG8A 1A5RA 1C1YB 2FCMA 3APCA 2O6VD 2V3SA 2KFKA 3X0WA 3ZNZB 3A1QA 1UBQA 1WE7A 3RYTA 3QQ8B 2MBHA 5AZGA 4FBJB 3UQAA 4GU2A 2ZVOA 2JXXA 2L0TA 4I6PA 3U8ZA 2KTRA 2ZCCA 4NAWB 4CYEA 1H8CA 2KC1A 5J17A 3H7PB 4M8NA 3RCZA 2KX3A 2Z0EB 2L0FA 2RPQA 3C0RB 3U7DA 2BYEA 5GMVA 3ZVVA 4DHZE 5CHVC 2R2QA 1YIWA 4NNJB 2N1WA 2NBWB 4GGQA 4DDID 2V1YA 2ZPNA 4IW0A 3PRZA 3OAWA 3EFUA 5IA7A 4KV2A 1P98A 1RLFA 1WX9A 4K7UA 3IG3A 1OEYA 1OQYA 4FA6A 3M62B 5KHOA 2FCQA 4GMVA 3DQVA 4AP4C 1V2YA 1GC6A 2REXA 3ENEA 3PVLA 3VUYA 4GDKB 2C60A 4HCNB 2CHWA 1V80A 4II3B 3VVWB 4X57B 1YQBA 3T9LA 2GOWA 4ZYNA 1M94A 3ZW3A 2NPTB 4DHJB 4HVBA 2FIDA 4ICVA 4AWJA 1Q1OA 5AEKB 1WIAA 3KUDB 3ZLZA 2BPSA 1H4RA 5L95C 2KMCA 3PHXB 4IM0A 4ANVA 4TUUA 2JY6A 2FCNA 4PYZA 3HK0A 3QCAA 3TIXA 3UF8A 4HCPB 2J0JA 4WJOA 5HKHA 3H9DA 1F9JA 2LASA 1V5TA 2MWSB 2LJ5A 3RZWC 3NHEB 2KNBA 3SD5A 3W1YA 2DZMA 2CS4A 3DBHI 2K1FA 2WX0A 1UD7A 1GJZA 3VTVA 3ZUNA 4E71A 2KDBA 4P7IA 2MRPA 3NZUA 3DVGY 2KQSA 2Y5BB 2PE6B 1GG3A 4G11A 1HE8A 2PPHA 3ZNID 2EMSA 1XT9B 2BKRB 4NJ6A 1R4MI 3KVFB 2ZVNA 1OTRB 3PV1A 3RULA 2IO0B 3MHSD 3A9JB 2ZEQA 3L08A 3QAQA 4W9DA 4WJNA 3JVZX 1WY8A 2B3AA 4HPMB 3RD2A 3Q3FA 1WXSA 3Q3JA 1WXAA 2L7RA 1Z5SB 2O6VA 2XK5B 5DPTA 3M3JA 3WAMA 2L76A 4DWFA 2LXCA 2WWZA 3PTFC 5G55A 3RT3B 4TKNA 1WFYA 1ZW7A 2KFKB 2GBKA 2WYQA 1V6EA 3DBSA 2JVCA 2MBEA 1ZKHA 1LM8B 2XBBC 3A1QB 3OLMD 4FJYA 3ZIMA 2KJRA 4A20A 1EO6A 1ISNA 1QZEA 1WGRA 2ZNVB 3AULA 3ZDMC 2AL3A 3BINA 2D11A 4FLHA 4LJOB 4BVUC 3TCAA 2BKFA 2KTRB 4PS7A 3N3KB 1E5WA 3M63B 1UBIA 1EF5A 5CHFA 3A4SC 1JRUA 3QHTA 1WR1A 4FHJA 2K25A 3AU5A 4FJZA 2UYZB 2EMTA 3GZNI 3QARA 2A4ZA 4JLCA 1WGDA 1XD3B 2VRRB 5AZHA 5DPWA 2LVPA 3L17A 2FIFA 3ECIA 2NBUA 1WI0A 1E8WA 4DBGA 1IP9A 1LFDA 2KO3A 2MQJA 2ZCBA 1TBEA 2CKHB 2A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  2C7M B;  3VXW A;  4MEL A;  1WMH A;  2PE9 A;  2KAN A;  3OJ3 A;  1WM2 A;  2FAZ A;  4W9I A;  1YD8 U;  4LDT B;  4MGZ E;  2AYO B;  3W1S C;  1GUA B;  2RSU A;  5IAA C;  1TTN A;  1R4N I;  3VTW A;  3UIO B;  4TV3 A;  3NZS A;  2BF8 B;  4XZ4 A;  3H7S A;  5D6J B;  4PYU A;  1NBF C;  2C5L C;  3R7Q A;  4HXD A;  1FXT B;  2DZI A;  3VFK A;  4JGH B;  4FAD A;  4G50 A;  3VH3 B;  1WXM A;  2HTH A;  4B9K A;  1V81 A;  3LDZ E;  2JPH A;  3B1L X;  3WAO A;  2IYD B;  2RD0 A;  3N32 A;  5L83 A;  3DVN V;  1WYW B;  3K9P B;  4FUL A;  4I6L B;  1J19 A;  4MDK E;  2AWT A;  4G0N B;  3WAL A;  3IHP C;  4FJV B;  2WDT B;  1SIF A;  1WRD B;  2GBJ A;  2JRI B;  3JSV A;  3VDZ A;  1C3T A;  5G2N A;  4DDG D;  4NQL B;  5BO4 B;  1E8X A;  1P1A A;  4ZRJ A;  3R7R A;  1UZX B;  1YX6 B;  4KDI C;  4NPN A;  1PQS A;  2N9X A;  3NS8 A;  2AL6 A;  2K6D B;  1YX5 B;  2I1J A;  3VUW A;  2O6V B;  5C1Z A;  3NOB A;  2W9N A;  2GBM A;  4W9G A;  2N1V A;  4MJS A;  3A33 B;  3WIM A;  4K1R B;  3QJZ A;  3TJP A;  5CTR C;  1U4A A;  4ICU A;  3N30 A;  1WX7 A;  4FHK A;  4K81 A;  3KUZ A;  1WJN A;  2N9E B;  4MGK E;  2RR9 A;  3L54 A;  1P0R A;  4I6N B;  4BKS A;  3V62 A;  4EZJ A;  1AAR A;  3EEC A;  2KWU B;  4KSK C;  2BWE S;  4W9K A;  3CSF A;  2DEN B;  1E90 A;  2QHO A;  3VH4 B;  2M0X A;  2N7E A;  2KFJ A;  3ZO5 B;  2LZ6 A;  2MP2 A;  3QK0 A;  2MBB B;  4M8M A;  3HIZ A;  4GDL A;  3H1U A;  2D07 B;  5E6P A;  5EDS A;  1E7V A;  3QA8 A;  1X1M A;  2NS5 A;  3QX1 A;  4WWN A;  3HM3 A;  4IM3 A;  2KLG A;  3O65 B;  4RMA A;  4W9E A;  1T0Y A;  3DBR I;  2KMA A;  1WJ6 A;  2NCN A;  3D32 A;  2LI5 A;  5D2M B;  1UGM A;  4OVU A;  3R3M A;  1SE9 A;  2KDE B;  5E6N A;  5CHW A;  4W9H A;  2C9W B;  3RZF A;  1WR6 E;  4GB9 A;  4MM3 A;  4WAA A;  4HLE A;  1WMH B;  2JUO A;  3UGB B;  4W9C A;  2D3G A;  1IYF A;  1UEL A;  4KZ0 A;  1EUV B;  2DAF A;  3M95 A;  2DAJ A;  4IC7 B;  2JWZ A;  5DPR A;  5C23 A;  2ZNV C;  4MEM A;  4PS8 A;  3V6C B;  4TQ1 A;  2D2Q A;  4WWO A;  2MX2 A;  4NJ7 A;  2M4N A;  4LJP B;  2L8J A;  2CR5 A;  2KJH B;  2UWQ A;  2FCS A;  2IY0 B;  2HE7 A;  2AEH A;  5KHQ A;  4BOS C;  2CHZ A;  3AXC A;  1K8R B;  4KIK A;  2BGF A;  4JL9 A;  2MA9 B;  2LWP A;  3APF A;  5J2R A;  4PS3 A;  3SU8 X;  3CMM B;  3PLV A;  4KZC A;  2DZJ A;  4JQW C;  2GBR A;  1XQQ A;  2LGX A;  5D94 A;  1GC7 A;  3JSV B;  2LD9 A;  2G45 B;  3HHM A;  3VHT C;  4BKS D;  5JHB A;  1WX8 A;  2L00 B;  5CX3 A;  4WJQ A;  3ML9 A;  4LCD E;  4WJP A;  3GOE A;  1KOT A;  1L7Y A;  4BKG A;  2LRU A;  3CF6 E;  3ZRF A;  3VUX A;  4ZRK A;  3EC8 A;  1TGZ B;  1Q0W B;  3QIJ A;  2DX5 B;  1WM3 A;  2JZZ A;  4K7W A;  4W9J A;  2N9P C;  4MJS B;  4IUM B;  4A3O A;  2KZR A;  1WGG A;  1L2N A;  1WGY A;  3A9K A;  3UIN B;  1I35 A;  3PPA A;  2ZPY A;  3PRP B;  4KDL B;  3DBL I;  4DHZ B;  4TQ0 A;  2JF5 A;  3DOW A;  2KXJ A;  2HD5 B;  4GSW A;  3V6E B;  4MH0 E;  3H6N A;  1UH6 A;  4AOF A;  2LUE A;  1V5O A;  2KC2 A;  3HM6 X;  4ANW A;  4IWP A;  3WAN A;  3IBE A;  4RM8 A;  3T8M A;  5JZE B;  3PRM B;  4DK5 A;  3DVG X;  5DPS A;  2WX1 A;  2MP2 B;  4GIV A;  3PT2 B;  4MSQ B;  4GDL B;  4HDO A;  5JHA A;  3PSE B;  1YJ1 A;  2I1K A;  1I42 A;  4HK2 A;  3I3T B;  4N9F 4;  3P2B A;  2GBN A;  4JIO U;  2ZZP B;  4AJW A;  3ONS A;  2JZ3 B;  3OJ4 B;  2DHZ A;  1NDD A;  4KVG B;  4M0W B;  2PEA A;  4ZRI A;  4HPL B;  3S2A A;  1VCB A;  3ZTD A;  3VTU A;  2K6Q A;  4EZK A;  3ZNG C;  4F7Z A;  2C7N B;  2N7D A;  2K39 A;  2PJH A;  2LRW A;  3A4R A;  2BYF A;  3DPD A;  1D3Z A;  1Z2M A;  2IZV B;  1S3S G;  2MBQ A;  4W9L A;  4RM9 A;  4IWO A;  2KN5 A;  1WGH A;  3APD A;  2V4L A;  5TR5 A;  1J8C A;  1KM7 A;  2C7H A;  2J0M A;  2RGF A;  4WWP A;  4DHJ D;  4DXA B;  2DYO A;  2GMI C;  5D7G A;  4CHK A;  2IBI B;  4BKT A;  4KIK B;  3CST A;  3PLU A;  3PRE A;  2G4S A;  2M1M A;  3K9O B;  2OJR A;  2O2V A;  2KX0 A;  4GXB A;  1GNU A;  4WQO B;  3ZRC A;  3V61 A;  2KDF B;  2CU1 A;  2YLM A;  5LXH A;  1RFA A;  3KH0 A;  2YVC A;  3X23 A;  4MGI E;  2KOX A;  2G3Q B;  1OGW A;  2K8H A;  2KHW B;  1WJ4 A;  3L16 A;  3QC8 B;  2KWC A;  3MJW A;  4K7S A;  3AI5 A;  1WJU A;  4MSM B;  5AZF A;  3KW5 B;  2KLC A;  2KJ6 A;  4B95 A;  3NY5 A;  3PHW B;  1VD2 A;  3A9K B;  3QWZ B;  1IPG A;  3EHV A;  4GN1 A;  4EUT A;  2L05 A;  3U30 A;  3PS6 A;  4J6I A;  2K8B A;  2NVU I;  3RUI B;  5JH5 C;  1RAX A;  4EOY A;  1KJT A;  4HWI B;  2KVR A;  4MGY E;  3JW0 X;  2IO3 B;  3L10 B;  4OVV A;  4ANX A;  1V86 A;  2BYV E;  1E7U A;  4XC2 A;  3W1S A;  3SHQ A;  4BOZ B;  2D10 A;  3UIP B;  1P3Q U;  3TMP B;  1G6J A;  1LQB A;  4E74 A;  5FR6 A;  2LVQ A;  4ANU A;  5LXI B;  4NAW A;  2MW5 A;  2J0K A;  1SGH A;  3IVF A;  4FN2 A;  3ALB A;  1WZ0 A;  2DYB A;  4G3X B;  4HJK A;  4BBN F;  4URK A;  3H7P A;  3TL5 A;  2XEW A;  1WXV A;  3UQB A;  2LVO A;  3WAP A;  2LGD A;  4BBN C;  3L0W B;  4ZDV A;  1S1Q B;  4F1S A;  3SDL C;  2JRH A;  4EZL A;  1E8Z A;  3B0A A;  4E3C A;  1WF9 A;  3R66 C;  3VQI A;  1V9J A;  2KKC A;  1WZ3 A;  3DDC B;  4B6W A;  3AU4 A;  4IM2 A;  1V49 A;  2NBV B;  3WA0 A;  2JT4 B;  1TZ1 A;  3TBL D;  3DCG A;  4NQK E;  3KUC B;  4GDK A;  4W9F A;  3LJ3 A;  4NY0 A;  3BY4 B;  1E8Y A;  5E6O A;  2LGY A;  3VAW A;  2FUH B;  5J18 A;  2KD0 A;  2HJ8 A;  3ZKJ C;  2NPT A;  2L3Z A;  1WH3 A;  2MBO A;  2DYM A;  2R2O A;  4F8C B;  2KK8 A;  4HDQ A;  3ZDT A;  4AJY B;  4BFR A;  4EEW A;  4GOC A;  2MSE D;  4LDT D;  3MTN B;  1LXD A;  1RRB A;  3B08 A;  4IG7 B;  2G4D B;  2MCN B;  2MLB A;  4IWQ A;  2IY1 B;  1EF1 A;  1ZGU B;  2KTF A;  2KWV B;  4XX5 A;  2O2V B;  2J7Q B;  3JYU A;  1BT0 A;  2M8S A;  3ZTC A;  3KYD D;  1Y8R C;  2IO2 B;  4ASW C;  1NI2 A;  1WE6 A;  2NR2 A;  4II2 B;  4AUQ C;  2N4F A;  1P9D U;  2EKE C;  1Q5W B;  3L13 A;  3ML8 A;  2ASQ A;  4KSL C;  4EKU A;  4YL8 A;  2OOB B;  2Z59 B;  3KYC D;  1OEY J;  2K8C A;  5LLI A;  2Z0D B;  2BWF A;  2ZJD A;  3PGE A;  4A3P A;  4EFO A;  3A9J A;  1KLV A;  5DCN A;  3V60 A;  2CHX A;  3ZNH B;  1CMX B;  2DZK A;  2FNJ B;  2M17 A;  2KQ7 A;  2IO1 B;  2LXA A;  3IFW B;  3DVN U;  2XK5 A;  4CO7 A;  1J0G A;  2KDI A;  1MG8 A;  1A5R A;  1C1Y B;  2FCM A;  3APC A;  2O6V D;  2V3S A;  2KFK A;  3X0W A;  3ZNZ B;  3A1Q A;  1UBQ A;  1WE7 A;  3RYT A;  3QQ8 B;  2MBH A;  5AZG A;  4FBJ B;  3UQA A;  4GU2 A;  2ZVO A;  2JXX A;  2L0T A;  4I6P A;  3U8Z A;  2KTR A;  2ZCC A;  4NAW B;  4CYE A;  1H8C A;  2KC1 A;  5J17 A;  3H7P B;  4M8N A;  3RCZ A;  2KX3 A;  2Z0E B;  2L0F A;  2RPQ A;  3C0R B;  3U7D A;  2BYE A;  5GMV A;  3ZVV A;  4DHZ E;  5CHV C;  2R2Q A;  1YIW A;  4NNJ B;  2N1W A;  2NBW B;  4GGQ A;  4DDI D;  2V1Y A;  2ZPN A;  4IW0 A;  3PRZ A;  3OAW A;  3EFU A;  5IA7 A;  4KV2 A;  1P98 A;  1RLF A;  1WX9 A;  4K7U A;  3IG3 A;  1OEY A;  1OQY A;  4FA6 A;  3M62 B;  5KHO A;  2FCQ A;  4GMV A;  3DQV A;  4AP4 C;  1V2Y A;  1GC6 A;  2REX A;  3ENE A;  3PVL A;  3VUY A;  4GDK B;  2C60 A;  4HCN B;  2CHW A;  1V80 A;  4II3 B;  3VVW B;  4X57 B;  1YQB A;  3T9L A;  2GOW A;  4ZYN A;  1M94 A;  3ZW3 A;  2NPT B;  4DHJ B;  4HVB A;  2FID A;  4ICV A;  4AWJ A;  1Q1O A;  5AEK B;  1WIA A;  3KUD B;  3ZLZ A;  2BPS A;  1H4R A;  5L95 C;  2KMC A;  3PHX B;  4IM0 A;  4ANV A;  4TUU A;  2JY6 A;  2FCN A;  4PYZ A;  3HK0 A;  3QCA A;  3TIX A;  3UF8 A;  4HCP B;  2J0J A;  4WJO A;  5HKH A;  3H9D A;  1F9J A;  2LAS A;  1V5T A;  2MWS B;  2LJ5 A;  3RZW C;  3NHE B;  2KNB A;  3SD5 A;  3W1Y A;  2DZM A;  2CS4 A;  3DBH I;  2K1F A;  2WX0 A;  1UD7 A;  1GJZ A;  3VTV A;  3ZUN A;  4E71 A;  2KDB A;  4P7I A;  2MRP A;  3NZU A;  3DVG Y;  2KQS A;  2Y5B B;  2PE6 B;  1GG3 A;  4G11 A;  1HE8 A;  2PPH A;  3ZNI D;  2EMS A;  1XT9 B;  2BKR B;  4NJ6 A;  1R4M I;  3KVF B;  2ZVN A;  1OTR B;  3PV1 A;  3RUL A;  2IO0 B;  3MHS D;  3A9J B;  2ZEQ A;  3L08 A;  3QAQ A;  4W9D A;  4WJN A;  3JVZ X;  1WY8 A;  2B3A A;  4HPM B;  3RD2 A;  3Q3F A;  1WXS A;  3Q3J A;  1WXA A;  2L7R A;  1Z5S B;  2O6V A;  2XK5 B;  5DPT A;  3M3J A;  3WAM A;  2L76 A;  4DWF A;  2LXC A;  2WWZ A;  3PTF C;  5G55 A;  3RT3 B;  4TKN A;  1WFY A;  1ZW7 A;  2KFK B;  2GBK A;  2WYQ A;  1V6E A;  3DBS A;  2JVC A;  2MBE A;  1ZKH A;  1LM8 B;  2XBB C;  3A1Q B;  3OLM D;  4FJY A;  3ZIM A;  2KJR A;  4A20 A;  1EO6 A;  1ISN A;  1QZE A;  1WGR A;  2ZNV B;  3AUL A;  3ZDM C;  2AL3 A;  3BIN A;  2D11 A;  4FLH A;  4LJO B;  4BVU C;  3TCA A;  2BKF A;  2KTR B;  4PS7 A;  3N3K B;  1E5W A;  3M63 B;  1UBI A;  1EF5 A;  5CHF A;  3A4S C;  1JRU A;  3QHT A;  1WR1 A;  4FHJ A;  2K25 A;  3AU5 A;  4FJZ A;  2UYZ B;  2EMT A;  3GZN I;  3QAR A;  2A4Z A;  4JLC A;  1WGD A;  1XD3 B;  2VRR B;  5AZH A;  5DPW A;  2LVP A;  3L17 A;  2FIF A;  3ECI A;  2NBU A;  1WI0 A;  1E8W A;  4DBG A;  1IP9 A;  1LFD A;  2KO3 A;  2MQJ A;  2ZCB A;  1TBE A;  2CKH B;  2A5U A; 
#chains in the Genus database with same CATH topology
 3PZD A;  2DNF A;  1GAQ B;  4MEL A;  3Q6B A;  3OJ3 A;  4LDT B;  2LEK A;  2AYO B;  4MGZ E;  3W1S C;  1KRH A;  1FMA D;  2RSU A;  1TTN A;  3UIO B;  4BZA A;  1WGK A;  1L6V A;  3NZS A;  3TSS A;  5D6J B;  2C5L C;  4HXD A;  1FXT B;  1NVI D;  1VLB A;  4FAD A;  1WXM A;  1R4M B;  3B1L X;  3WAO A;  3N32 A;  3K9P B;  4MDK E;  2IDY A;  4G0N B;  1OFF A;  4FJV B;  3JSV A;  4DDG D;  1MHH E;  2N9K A;  1P1A A;  2SAK A;  4L1B A;  3R7R A;  4KDI C;  1YX6 B;  4P1C C;  1FCC C;  2IND C;  4NPN A;  3R2T A;  2O6V B;  2W9N A;  3V3X A;  4WH4 A;  2QIE B;  3DWM A;  4KGT A;  1ZDX A;  1PFD A;  1FNW A;  1P0R A;  3L54 A;  2FUG 1;  3RNC C;  2BWE S;  4W9K A;  4P16 A;  1E90 A;  3RNB C;  2VH1 A;  3EFC A;  2M0A A;  3W9C B;  2KFJ A;  1VJK A;  3QK0 A;  2BQQ A;  5BYQ A;  1E7V A;  3QA8 A;  3HM3 A;  3BZD B;  4YSX B;  3DBR I;  1T0Y A;  2D3B A;  2NCN A;  1QOF A;  3AE6 B;  5D2M B;  3URY A;  5CHW A;  1HEZ E;  3I5J C;  3ZGZ A;  4HLE A;  1WMH B;  1F77 A;  1IYF A;  1UEL A;  3MJ5 A;  1UNS A;  2BW2 A;  5G5G A;  2DAJ A;  2JWZ A;  5D3D A;  2ZNV C;  5EE9 A;  4MEM A;  4ZOH C;  1IBX B;  2M4N A;  4LJP B;  1F1H A;  2KJH B;  5KHQ A;  3NJT A;  4BOS C;  3APF A;  1AWD A;  3SU8 X;  3PLV A;  4B0M A;  4JQW C;  1HA5 A;  2GBR A;  5D94 A;  1GC7 A;  2G45 B;  1QOB A;  1OQQ A;  5CX3 A;  3Q8B A;  1FNV A;  1FPY A;  3BVG A;  3CF6 E;  3ZRF A;  3RI7 C;  3VUX A;  1V8C A;  3P63 A;  1C78 A;  3QIJ A;  4K7W A;  4ITK A;  2JZZ A;  4NJC A;  4Q2J A;  3UIN B;  4XWT A;  2JF5 A;  1TJE A;  3IT4 B;  3TEX A;  2KXJ A;  2WLB A;  2J42 A;  2QC8 A;  1D6E C;  1ZXH A;  1ZPS A;  1HZ6 A;  2INC C;  4LLG M;  1V5O A;  3U4E G;  3HM6 X;  4ANW A;  5FK9 C;  5JZE B;  3IBE A;  1J7B A;  1PGX A;  3DVG X;  2WX1 A;  2MP2 B;  3PT2 B;  2I1K A;  1XLQ A;  4HK2 A;  3I3T B;  2GBN A;  4JIO U;  4AJW A;  2JZ3 B;  3O13 A;  1HZ5 A;  4A90 A;  4ZRI A;  1JQ4 A;  5H92 C;  2KN4 A;  1FRR A;  1HQR D;  4IDI A;  1ENF A;  2K39 A;  5BMI A;  3A4R A;  2WDV B;  2BYF A;  1N5X A;  1Z2M A;  4N59 A;  2V0G A;  4LK0 M;  4WWP A;  4DHJ D;  4DXA B;  3NRZ A;  1R7S A;  2IBI B;  3B2F A;  4USA A;  3PRE A;  2M1M A;  3BVZ A;  2O2V A;  1GNU A;  2CU1 A;  2K22 A;  2YVC A;  3AE9 B;  2BYT A;  2G3Q B;  3BVM A;  2V9H A;  2H89 B;  3NVW A;  3EA6 A;  1JW9 D;  3AI5 A;  1WJU A;  1ROE A;  4BAX A;  1TKG A;  1XO3 A;  3PHW B;  1VD2 A;  3QWZ B;  1JWU D;  4MH8 A;  3U30 A;  1WXQ A;  4J6I A;  1KLG D;  5JH5 C;  1RAX A;  2JX5 A;  1MPE A;  1KJT A;  2KVR A;  2IO3 B;  2BYV E;  4P1B C;  4XC2 A;  1E9M A;  4BOZ B;  1JWM D;  4YWG G;  4OW0 A;  5FR3 A;  4NAW A;  2MW5 A;  2BBC A;  2LUM A;  1WZ0 A;  3MC8 A;  4BBN F;  3TL5 A;  2HJ1 A;  1WXV A;  2XEW A;  3UQB A;  3KWL A;  5G5H A;  1VZ6 A;  4A6Q A;  1QKZ A;  1WF9 A;  2KKC A;  3WA0 A;  1Y56 A;  3RNG C;  2W82 A;  3DCG A;  4NQK E;  4NY0 A;  1YMH E;  3VAW A;  3ZKJ C;  4B0E A;  2KK8 A;  3ZQ4 A;  1XCT L;  3MTN B;  3B08 A;  1RRB A;  4IG7 B;  4ZRQ A;  2KWV B;  4YXD B;  2E6X A;  1BT0 A;  3ZTC A;  1Y8R C;  4AUQ C;  2N4F A;  1P9D U;  4P6V F;  3I57 A;  3P1M A;  3NZ3 A;  4MT5 A;  3AEA B;  3Q69 A;  5BYR A;  2K8C A;  2BWF A;  2ZJD A;  1BML C;  4EFO A;  1L0X B;  1PGB A;  5DCN A;  1E0Z A;  2PKO A;  2CHX A;  3ZNH B;  2V3P A;  3NUH B;  2KQ4 X;  2XK5 A;  2OHF A;  3LB8 C;  2Y5C A;  4A55 A;  5FKA C;  4C7Z A;  1C1Y B;  3Q3O C;  2ZW0 A;  2KFK A;  3X0W A;  2QDF A;  1UBQ A;  1WE7 A;  3RYT A;  3UQA A;  2ZVO A;  2J4X A;  1JWB D;  3FIL B;  1DOX A;  1YQ3 B;  4CYE A;  5J17 A;  4M8N A;  2H88 B;  1HXY D;  2W3S A;  1F2R C;  2N1W A;  4DDI D;  2ONQ A;  2KT7 A;  3BK1 A;  2PVO D;  4JE3 B;  3OAW A;  2MHJ A;  2WU2 B;  4K7U A;  4FA6 A;  2L83 A;  4GMV A;  1YN3 A;  3DQV A;  1SJE D;  3IAS 1;  2C60 A;  4K3B A;  4X57 B;  2KMM A;  4ZYN A;  1M94 A;  4DHJ B;  3TUO A;  4ICV A;  2RMM A;  4AWJ A;  3SFD B;  4D2K A;  2BPS A;  1H4R A;  2E3T A;  2FE8 A;  3PHX B;  4TUU A;  3ZJU A;  3AV8 A;  2V4I B;  2LAS A;  2MWS B;  2LJ5 A;  3DWG C;  1QT9 A;  3AE1 B;  3N1Z C;  1KF6 B;  2WX0 A;  3ZUN A;  2KDB A;  2KDM A;  3NZU A;  1ESF A;  2Y5B B;  4LNF A;  1J7C A;  1GG3 A;  4G11 A;  1FRD A;  3WCQ A;  3ZNI D;  2JYE A;  1XT9 B;  1VZ8 A;  4ACF A;  3KVF B;  2ZVN A;  3JVZ X;  3RD2 A;  3Q3F A;  2JSV X;  1WXS A;  1WXA A;  5DPT A;  1E6E B;  3PTF C;  1ZW7 A;  1JAL A;  3OLM D;  3BII D;  2JVC A;  2XBB C;  1L0V B;  2KJR A;  2UU7 A;  1K53 A;  2KYW A;  2ZNV B;  3AUL A;  4FLH A;  4BVU C;  3TCA A;  2BKF A;  3AED B;  1E5W A;  3M63 B;  1PGA A;  2PIA A;  2WHI A;  3ZXV A;  3A4S C;  3QHT A;  1WR1 A;  4RCO A;  1SSN A;  2EMT A;  2QMT A;  1NEN B;  2LVP A;  3L17 A;  2FIF A;  2NBU A;  3PO0 A;  1ACC A;  2CKH B;  2A5U A;  2C7M B;  4AS1 A;  3VXW A;  1NI3 A;  2FAZ A;  2SEB D;  1WSP A;  1YN4 A;  4C56 C;  1YD8 U;  4S17 A;  2INN E;  4YSZ B;  1NBF C;  3R7Q A;  2DZI A;  4JGH B;  4G50 A;  2IYD B;  1VDV A;  1C4P A;  2RPV A;  4DXF A;  5L83 A;  1WYG A;  1WYW B;  1WRI A;  1J19 A;  2AWT A;  3IHP C;  5C3J B;  1SIF A;  2JRI B;  1C3T A;  1I4R A;  1ZUD 2;  1I4G A;  2L52 A;  2W3R A;  1FD6 A;  1E8X A;  4DXG A;  2AX5 A;  1YX5 B;  3VUW A;  5C1Z A;  2GBM A;  3IT6 B;  3WIM A;  3Q8E A;  3TJP A;  1U4A A;  4ICU A;  4K81 A;  1SE3 A;  2WXG A;  1EM7 A;  1WJN A;  2N9E B;  1EU4 A;  1T0S C;  4PT5 A;  3CSF A;  1FXA A;  3ABV B;  2M0X A;  1IUE A;  3AE4 B;  3ZO5 B;  2MBB B;  4M8M A;  4GDL A;  1D5X C;  2D07 B;  5EDS A;  2XNA C;  1ZXI A;  3QX1 A;  2KLG A;  3O65 B;  2MJ3 A;  4RMA A;  3D32 A;  4M0W A;  2R61 A;  1UGM A;  3R3M A;  1SE9 A;  2KDE B;  4YT0 B;  5E6N A;  2C9W B;  4MM3 A;  2JUO A;  2D3G A;  3M95 A;  4IC7 B;  5DPR A;  5C23 A;  1C77 A;  4L2Y A;  3MP9 A;  3CIR B;  4HPP A;  2Y3A A;  2M56 B;  3BWU D;  4WWO A;  4NJ7 A;  2UWQ A;  2IY0 B;  3AE3 B;  3AM9 A;  1GOZ A;  3PZ8 A;  2Z8L A;  4KIK A;  4PS3 A;  3CMM B;  2DZJ A;  1AYF A;  4HEA 1;  1XQQ A;  1L5P A;  4BKS D;  4WJP A;  1SIJ A;  1XCQ L;  1WWT A;  3R2I A;  3R8B A;  1ET6 A;  4ZRK A;  3RN9 C;  3EC8 A;  1Q0W B;  1WM3 A;  4MJS B;  4IUM B;  3PRP B;  5HG2 A;  4DHZ B;  3DBL I;  4TQ0 A;  1JCK B;  2HD5 B;  3V6E B;  4MH0 E;  3H6N A;  1UH6 A;  3SR6 A;  4XE0 A;  2WXQ A;  2WNM A;  1T3Q A;  1F0Z A;  4RM8 A;  2N9L A;  3T8M A;  3SFE B;  5JHA A;  4HDO A;  2IGG A;  1YJJ A;  4HRS A;  1J7A A;  1HTO A;  3ONS A;  4KVG B;  2PEA A;  4WQM A;  2LRW A;  1D3Z A;  2MBQ A;  4W9L A;  4RM9 A;  4IWO A;  3APD A;  1WGH A;  2J0M A;  2RGF A;  1V1P A;  4BKT A;  4YSY B;  2W54 A;  3PLU A;  5IN7 A;  1TS4 A;  2KX0 A;  4WQO B;  2I38 A;  3HVD A;  3ZRC A;  4XDD A;  1CJE A;  2KDF B;  2YLM A;  1RFA A;  1OGW A;  2K8H A;  2KHW B;  3AE8 B;  3VR8 B;  4RGO S;  4K7S A;  4C4V A;  4MSM B;  5AZF A;  1P7F A;  1P7E A;  3AEF B;  3A9K B;  3Q2A C;  4EUT A;  2L05 A;  4LTU A;  2K8B A;  3RUI B;  3AE2 B;  1XXG A;  4ANX A;  1E7U A;  1P3Q U;  2K3U A;  1G6J A;  5FR6 A;  4ANU A;  4FN2 A;  2J0K A;  3IVF A;  2DYB A;  4URK A;  2AQ1 B;  4ZDV A;  1S1Q B;  3SDL C;  2JRH A;  3MC0 B;  4EZL A;  3B0A A;  1WZ3 A;  2WP9 B;  3DDC B;  4IM2 A;  1V49 A;  2WXP A;  2I2Y A;  3TBL D;  3KUC B;  1N6Z A;  3BY4 B;  5E6O A;  1L4D B;  2FUH B;  2HJ8 A;  1RYJ A;  1FXI A;  1XLP A;  4F8C B;  1YQ4 B;  3ZDT A;  4XYC A;  4GOC A;  2DWQ A;  2JQR B;  2K9X A;  2MEK A;  2G4D B;  2MLB A;  2KTF A;  1ZGU B;  3N1X C;  4ASW C;  1NI2 A;  4II2 B;  4MAC A;  2WXR A;  2EKE C;  4RF1 A;  1Q5W B;  3L13 A;  3NVV A;  4EKU A;  1C76 A;  4ARI A;  3AH7 A;  1OEY J;  1UWX A;  1EWC A;  4A3P A;  3A9J A;  3V60 A;  2TSS A;  4KKJ A;  2DZK A;  2IO1 B;  2LXA A;  4CO7 A;  1TT5 B;  2KDI A;  4JPS A;  2FCM A;  3APC A;  1ZE3 D;  3QQ8 B;  4GU2 A;  3GP7 A;  2KTR A;  1H8C A;  2KC1 A;  3H7P B;  2KX3 A;  2Z0E B;  3RNF C;  3C0R B;  3ZVV A;  2BS4 B;  5GMV A;  2JYT A;  1Q10 A;  2R2Q A;  1YIW A;  1FEH A;  4GGQ A;  5C2T B;  2V1Y A;  2ZPN A;  4IW0 A;  4XDC A;  1P98 A;  1RLF A;  1OEY A;  1OQY A;  2J52 A;  2FCQ A;  4AP4 C;  3VUY A;  4GDK B;  3T9L A;  2YEP B;  2NPT B;  1Q1O A;  5AEK B;  1TS3 A;  4PK1 A;  4PYZ A;  2FCN A;  4HCP B;  4WJO A;  1C9F A;  1I4X A;  3H9D A;  4NZL B;  1V5T A;  2KNB A;  5AUK A;  2DZM A;  1GJZ A;  1SXT A;  4E71 A;  2MRP A;  1HE8 A;  1TY2 A;  3PV1 A;  1R4M I;  2LMC A;  1OTR B;  2Q5W D;  3MHS D;  2ZEQ A;  3QAQ A;  2JZP A;  3Q8A A;  2O6V A;  2BS3 B;  2XN9 C;  2L76 A;  1TY0 A;  2K0P A;  5G55 A;  1JRP A;  1WFY A;  2WYQ A;  1V6E A;  1ZKH A;  3DHG C;  3A1Q B;  2KAJ A;  1ISN A;  3ZDM C;  2D11 A;  3ZYY X;  1UBI A;  3ETR A;  3GE8 C;  5IO9 A;  1JRU A;  2IGH A;  2KWD A;  1B9R A;  3MC9 A;  1L0Y B;  3QAR A;  2WU5 B;  2A4Z A;  2EKI A;  1KLU D;  3I9V 1;  1WI0 A;  2KVZ A;  2WDQ B;  3TEW A;  3RMK C;  3AE5 B;  2WXH A;  1WMH A;  2PE9 A;  1E10 A;  1GUA B;  5IAA C;  3VTW A;  2D3C A;  3LXF A;  1IBX A;  3VRA B;  1I4H A;  4PYU A;  2KAC A;  1AN8 A;  2CJN A;  2FBW B;  3VFK A;  4TSS A;  1V81 A;  3LDZ E;  1QOA A;  1SF0 A;  4HKZ E;  3DVN V;  3TEZ A;  3WAL A;  2GRI A;  2LGI A;  1WRD B;  3VDZ A;  1E7P B;  4GLS C;  4NQL B;  1I7H A;  3AEB B;  5BO4 B;  4C7Y A;  1PQS A;  3NS8 A;  2K6D B;  4A8X C;  4C00 A;  2QIL A;  3NOB A;  5BYS A;  2LGS A;  1VZ7 A;  4RFB A;  3A33 B;  4K1R B;  2CU3 A;  5CTR C;  3N30 A;  3FC4 A;  2MJD A;  3GZN B;  2RR9 A;  4HJG E;  4I6N B;  4BKS A;  4EZJ A;  1AAR A;  3EEC A;  2KWU B;  4KSK C;  1GB1 A;  2N7E A;  2LZ6 A;  2MP2 A;  3HIZ A;  3H1U A;  5E6P A;  1FCL A;  3OG5 A;  4IM3 A;  2BVC A;  4FXC A;  2ICI A;  3TEY A;  4OVU A;  3RPF C;  3RZF A;  3OWE B;  4ZHP A;  4GB9 A;  4WAA A;  1V97 A;  3UGB B;  4W9C A;  4KZ0 A;  1EUV B;  4PS8 A;  3T3O A;  2D2Q A;  4M01 A;  2CR5 A;  2FCS A;  3P4Q B;  2AEH A;  1QOG A;  2WXN A;  2CHZ A;  1K8R B;  2BGF A;  3DHH C;  3H8H A;  2LGX A;  3JSV B;  2LD9 A;  3ZXR A;  1WX8 A;  2L00 B;  4ARC A;  3NVY A;  3ML9 A;  3AN1 A;  4LCD E;  3AEG B;  3GOE A;  1KOT A;  1CZP A;  4BKG A;  2LRU A;  4XWW A;  1TGZ B;  2DX5 B;  2N7J A;  2N9P C;  1L2N A;  1WGY A;  1I35 A;  3PPA A;  3Q14 C;  4KDL B;  1UWM A;  3DOW A;  1BUI C;  4GSW A;  2EEL A;  3DBH B;  4AOF A;  1FM0 D;  2KC2 A;  4N58 A;  3DBR B;  2QCZ A;  3L4P A;  5DPS A;  4GIV A;  2GLS A;  1YJ1 A;  4N9F 4;  3P2B A;  2ZZP B;  2HDE A;  1YJI A;  2DHZ A;  1NDD A;  4JWS C;  3RNA C;  1C79 A;  1UF0 A;  4HPL B;  3ZTD A;  4EZK A;  3ZNG C;  4YTN B;  4R3D A;  1UUP A;  2N7D A;  3P4R B;  2WXF A;  2LHE A;  3DPD A;  1S3S G;  3U7Z A;  3HRD D;  2V4L A;  5TR5 A;  1QF6 A;  1J8C A;  2C7H A;  1ET9 A;  2WQY B;  1EU3 A;  1XF5 L;  1MFW A;  1TS5 A;  4CHK A;  2G4S A;  3K9O B;  5JXV A;  4HRO A;  4RH6 A;  5LXH A;  4CQN A;  3KH0 A;  2KOX A;  1I4P A;  3N20 C;  3L16 A;  4LNI A;  3QC8 B;  3MJW A;  2MH7 A;  3KW5 B;  2KLC A;  2KJ6 A;  2J53 A;  4TMA B;  1R4N B;  2JWU A;  2NVU I;  3P4P B;  1VR9 A;  5MPO A;  4HWI B;  1MI0 A;  2GI9 A;  3L10 B;  4MGY E;  1V86 A;  3W1S A;  3SHQ A;  3TMP B;  2LVQ A;  2VH2 A;  3FIL A;  5LXI B;  4G3X B;  2LVO A;  3WAP A;  4BBN C;  3L0W B;  1MHX A;  4L23 A;  2Y5P A;  5EE0 A;  1JWA D;  1ZDV A;  3FAH A;  1V9J A;  3AU4 A;  2JT4 B;  3U2S C;  4W9F A;  1SB3 C;  4OZB A;  1SE4 A;  1B1Z A;  1TZO A;  2WXL A;  5J18 A;  2L3Z A;  3EUB 2;  2MBO A;  5GXG B;  2D3A A;  2L32 A;  2MSE D;  1SEB D;  4IWQ A;  2IY1 B;  2O2V B;  2HTM E;  2M8S A;  2IO2 B;  2NR2 A;  3ZJV A;  3AE7 B;  4RGM A;  3ML8 A;  2ASQ A;  4YL8 A;  4US8 A;  1N60 A;  3PGE A;  1KLV A;  3Q8C A;  3GS2 A;  1CMX B;  2WGS A;  2M17 A;  3IFW B;  3DVN U;  4A9A A;  1MG8 A;  1JRO A;  3ZNZ B;  2B76 B;  4RGT A;  4WWM A;  2RDH A;  4FBJ B;  2MBH A;  5AZG A;  3LYY A;  2L0T A;  3U8Z A;  2ZCC A;  4NAW B;  4RGN A;  2RPQ A;  3U7D A;  4DHZ E;  1C4A A;  4OZC A;  4NNJ B;  2NBW B;  4WUR A;  1TIF A;  3PRZ A;  1RWS A;  3EFU A;  3AEE B;  3IG3 A;  3N9Y C;  1T0R C;  5LNK 1;  5IKC M;  4K3C A;  2REX A;  3PVL A;  4RNA A;  1IGD A;  2CHW A;  1V80 A;  1CQV A;  1YQB A;  2GOW A;  2WXO A;  3ZW3 A;  4HVB A;  3MHZ A;  4LNK A;  4H2A A;  5L95 C;  2KMC A;  2NMQ A;  4IM0 A;  4ANV A;  3T3N A;  4KX6 B;  2JXT A;  3HK0 A;  3QCA A;  1NYR A;  2J0J A;  2QSD A;  3W1Y A;  3NHE B;  2K5P A;  3NS1 A;  2CS4 A;  3DBH I;  2K1F A;  3NVZ A;  2X8X X;  1EWY C;  1UD7 A;  4HKQ A;  3AMZ A;  4P7I A;  3DVG Y;  2EMS A;  3BYT B;  2DLB A;  3RUL A;  2N0S B;  1WY8 A;  2B3A A;  2VZK D;  4HPM B;  4LNO A;  3Q3J A;  2L7R A;  1Z5S B;  2XK5 B;  1MVK A;  3Q8F A;  4DWF A;  2LXC A;  2WWZ A;  3VVW B;  2KFK B;  3DBS A;  1N63 A;  2MBE A;  1LM8 B;  3Q3N C;  3UI3 A;  1WGR A;  2AL3 A;  1FFU A;  4PS7 A;  1EF5 A;  4KGR A;  1KH0 A;  2PW9 A;  1T5X D;  2NTT A;  4FHJ A;  3AU5 A;  1JML A;  5BMH A;  4FJZ A;  2UYZ B;  3P42 A;  1WGD A;  1XD3 B;  2VRR B;  3ECI A;  1RM6 C;  5IP4 D;  4DBG A;  4WAF A;  4WIP A;  2KO3 A;  1T0Q C;  3DHI C;  4OHJ A;  2MQJ A;  1TBE A;  3CWI A;  2WXI A;  5CHF A;  1ZOY B;  3EGR A;  4KGS A;  1PDX A;  2BT6 A;  4KKI A;  2KAN A;  1WM2 A;  5HHD G;  4W9I A;  2BB6 A;  1TKY A;  1R4N I;  4O1N A;  4TV3 A;  2BF8 B;  4XZ4 A;  3H7S A;  2ON8 A;  1FIQ A;  3VH3 B;  2HTH A;  2G1E A;  3N1Y C;  4B9K A;  2JPH A;  2RD0 A;  4FUL A;  4I6L B;  2WDT B;  2GBJ A;  1TKE A;  5G2N A;  1CK1 A;  4ZRJ A;  2YEP F;  1UZX B;  3FKY A;  1L4Z B;  2N9X A;  2AL6 A;  2I1J A;  1ZP0 B;  4W9G A;  2N1V A;  4MJS A;  1QIL A;  3QJZ A;  1KFY B;  5IOI A;  1WX7 A;  4FHK A;  3KUZ A;  1NYQ A;  1XLO A;  4MGK E;  3W2D A;  2PLP A;  3V62 A;  5EE1 A;  2ACZ B;  4IOI E;  2QEJ C;  2DEN B;  3VH4 B;  2QHO A;  1I4Q A;  2WXJ A;  3J9C A;  4RF0 A;  2MJE A;  2PVG C;  2ZW1 A;  2WXK A;  1X1M A;  4US9 A;  2NS5 A;  4WWN A;  4W9E A;  2KMA A;  1WJ6 A;  2LI5 A;  5EE3 A;  4W9H A;  3ZJT A;  1WR6 E;  4YTM B;  4LNN A;  2DAF A;  5D3I B;  1AW7 A;  3C8Y A;  3V6C B;  1MG4 A;  4TQ1 A;  2MX2 A;  2L8J A;  2HE7 A;  3BYY B;  3AXC A;  4JL9 A;  2MA9 B;  2LWP A;  5J2R A;  4KZC A;  4E74 A;  3IXS A;  3HHM A;  2WXM A;  3VHT C;  1TYG B;  5TSS A;  5JHB A;  2VZK B;  4WJQ A;  4OVZ A;  1SE2 A;  1C4C A;  1L7Y A;  1VRA B;  2LFI A;  4DQO C;  3E9S A;  4W9J A;  4A3O A;  2KZR A;  1WGG A;  1F2R I;  2INP E;  3A9K A;  2ZPY A;  1GB4 A;  2JU6 X;  3AEC B;  2IGD A;  2LUE A;  1IGC A;  1PUT A;  4IWP A;  1FFV A;  3WAN A;  5I4D A;  3PRM B;  4DK5 A;  4M00 A;  1K52 A;  1QLB B;  4MSQ B;  4GDL B;  4ZRP A;  3PSE B;  1I42 A;  2DBY A;  4EE2 A;  3OJ4 B;  4REZ A;  4M0W B;  3S2A A;  3B9J A;  1VCB A;  3VTU A;  2K6Q A;  4MM3 B;  2LHD A;  4F7Z A;  1LGR A;  2C7N B;  2PJH A;  1JWS D;  2IZV B;  4YTP B;  1V1O A;  3PZ7 A;  2KN5 A;  2BS2 B;  2OED A;  1YOV B;  3VRB B;  1DOI A;  1KM7 A;  2RDB C;  2DYO A;  2GMI C;  2BTE A;  5D7G A;  4KIK B;  3CST A;  3SEB A;  2OJR A;  2X38 A;  2WS3 B;  4GXB A;  3RFZ B;  3V61 A;  2CJO A;  4N6E B;  3X23 A;  4MGI E;  1BXT A;  2IJ0 A;  3AB5 A;  1L6U A;  1WJ4 A;  3DBL B;  1D5M C;  2KWC A;  1STE A;  2PMV A;  3E56 A;  3IAM 1;  4B95 A;  2BB5 A;  5BMG A;  3NY5 A;  2D5G A;  3GE3 C;  1LO5 D;  1IPG A;  3EHV A;  4GN1 A;  4ZYS A;  3PS6 A;  4XGA B;  1XEE A;  4EOY A;  2RDG A;  3W5U B;  3JW0 X;  4OVV A;  3BK2 A;  2D10 A;  3UIP B;  1LQB A;  2AQ3 B;  2NTS A;  4HJK A;  1SGH A;  3ALB A;  3H7P A;  2LGD A;  4F1S A;  1E8Z A;  4E3C A;  1OQR A;  3R66 C;  3VQI A;  4B6W A;  2NBV B;  2G9H D;  1SJH D;  2IPK D;  1TZ1 A;  1K51 A;  1RFK A;  4GDK A;  3LJ3 A;  1DGJ A;  1E8Y A;  2LGY A;  2KD0 A;  2NPT A;  1WH3 A;  1YN5 A;  2DYM A;  2R2O A;  1T6B X;  1N5W A;  4HDQ A;  4AJY B;  4BFR A;  4EEW A;  3V05 A;  4LDT D;  1V1P B;  1LXD A;  2MCN B;  4XX5 A;  1EF1 A;  1XLN A;  2J7Q B;  3JYU A;  3HUI A;  2AQ2 B;  3KYD D;  1MJD A;  3I63 C;  1WE6 A;  2QJL A;  4KSL C;  2OOB B;  2Z59 B;  3HVZ A;  4C4V B;  3KYC D;  5LLI A;  2Z0D B;  2FNJ B;  2KQ7 A;  4JWU C;  1N61 A;  1J0G A;  1A5R A;  2O6V D;  2V3S A;  1PYW D;  3A1Q A;  2JXX A;  4I6P A;  4ZHO A;  4OZA A;  3KLS X;  1DYQ A;  3RCZ A;  4AQ7 A;  2L0F A;  2BYE A;  5CHV C;  5H8Y E;  4QAY A;  3KWV A;  4S0R A;  5IA7 A;  4KV2 A;  1WX9 A;  4IKG A;  3W5V B;  3M62 B;  5KHO A;  1V2Y A;  1GC6 A;  3ENE A;  2OJW A;  2W55 A;  4HCN B;  3NG0 A;  4II3 B;  4JX1 C;  2FID A;  1QQR A;  2V3N A;  1K50 A;  1WIA A;  3KUD B;  1YNT E;  3ZLZ A;  4NAM A;  1D5Z C;  2JY6 A;  3TIX A;  3UF8 A;  5HKH A;  1F9J A;  1FNU A;  3RZW C;  3SD5 A;  3B2G A;  1UGJ A;  1KTK A;  3VTV A;  5T8I A;  1FO4 A;  4J3O D;  2KQS A;  1TS2 A;  2PE6 B;  2PPH A;  3Q3M C;  2BKR B;  3P4S B;  4NJ6 A;  2IO0 B;  3A9J B;  3L08 A;  4W9D A;  4WJN A;  3RNE C;  1DOY A;  4UDU C;  1NEK B;  3M3J A;  3WAM A;  2M19 A;  4M02 A;  2PTL A;  3RT3 B;  4TKN A;  2GBK A;  2LJI A;  4FJY A;  3ZIM A;  4A20 A;  1EO6 A;  1QZE A;  3BIN A;  4LJO B;  4C80 A;  2KTR B;  3N3K B;  1F52 A;  1A70 A;  5AUI A;  1N62 A;  2GB1 A;  1HTQ A;  5E6J A;  2L1A A;  2K25 A;  3VR9 B;  3GZN I;  3C19 A;  4JLC A;  3U52 E;  5AZH A;  5DPW A;  3KQ4 A;  1E8W A;  1GPX A;  1SBB B;  5HI1 A;  1IP9 A;  1LFD A;  2WDR B;  1M4V A;  3GB1 A;  3MFG A;  1D4B A;  2ZCB A;  5HFY A; 
#chains in the Genus database with same CATH homology
 3PZD A;  2C7M B;  3VXW A;  4MEL A;  1WMH A;  2PE9 A;  2KAN A;  3OJ3 A;  1WM2 A;  2FAZ A;  4W9I A;  1YD8 U;  4LDT B;  4MGZ E;  2AYO B;  3W1S C;  1GUA B;  2RSU A;  5IAA C;  1TTN A;  1R4N I;  3VTW A;  3UIO B;  4TV3 A;  3NZS A;  2BF8 B;  4XZ4 A;  3H7S A;  5D6J B;  4PYU A;  1NBF C;  2C5L C;  3R7Q A;  4HXD A;  1FXT B;  2DZI A;  3VFK A;  4JGH B;  4FAD A;  4G50 A;  3VH3 B;  1WXM A;  2HTH A;  4B9K A;  1V81 A;  3LDZ E;  2JPH A;  3B1L X;  3WAO A;  2IYD B;  2RD0 A;  3N32 A;  5L83 A;  3DVN V;  1WYW B;  3K9P B;  4FUL A;  4I6L B;  1J19 A;  4MDK E;  2AWT A;  4G0N B;  3WAL A;  3IHP C;  4FJV B;  2WDT B;  1SIF A;  1WRD B;  2GBJ A;  2JRI B;  3JSV A;  3VDZ A;  1C3T A;  5G2N A;  4DDG D;  4NQL B;  5BO4 B;  1E8X A;  1P1A A;  4ZRJ A;  3R7R A;  1UZX B;  1YX6 B;  4KDI C;  4NPN A;  1PQS A;  2N9X A;  3NS8 A;  2AL6 A;  2K6D B;  1YX5 B;  2I1J A;  3VUW A;  2O6V B;  5C1Z A;  3NOB A;  2W9N A;  2GBM A;  4W9G A;  2N1V A;  4MJS A;  3A33 B;  3WIM A;  4K1R B;  3QJZ A;  3TJP A;  5CTR C;  1U4A A;  4ICU A;  3N30 A;  1WX7 A;  4FHK A;  4K81 A;  3KUZ A;  1WJN A;  2N9E B;  4MGK E;  2RR9 A;  3L54 A;  1P0R A;  4I6N B;  4BKS A;  3V62 A;  4EZJ A;  1AAR A;  3EEC A;  2KWU B;  4KSK C;  2BWE S;  4W9K A;  3CSF A;  2DEN B;  1E90 A;  2QHO A;  3VH4 B;  2M0X A;  2N7E A;  2KFJ A;  3ZO5 B;  2LZ6 A;  2MP2 A;  3QK0 A;  2MBB B;  4M8M A;  3HIZ A;  4GDL A;  3H1U A;  2D07 B;  5E6P A;  5EDS A;  1E7V A;  3QA8 A;  1X1M A;  2NS5 A;  3QX1 A;  4WWN A;  3HM3 A;  4IM3 A;  2KLG A;  3O65 B;  4RMA A;  4W9E A;  1T0Y A;  3DBR I;  2KMA A;  1WJ6 A;  2NCN A;  3D32 A;  2LI5 A;  5D2M B;  1UGM A;  4OVU A;  3R3M A;  1SE9 A;  2KDE B;  5E6N A;  5CHW A;  4W9H A;  2C9W B;  3RZF A;  1WR6 E;  4GB9 A;  4MM3 A;  4WAA A;  4HLE A;  1WMH B;  2JUO A;  3UGB B;  4W9C A;  2D3G A;  1IYF A;  1UEL A;  4KZ0 A;  1EUV B;  2DAF A;  3M95 A;  2DAJ A;  4IC7 B;  2JWZ A;  5DPR A;  5C23 A;  2ZNV C;  4MEM A;  4PS8 A;  3V6C B;  4TQ1 A;  2D2Q A;  4WWO A;  2MX2 A;  4NJ7 A;  2M4N A;  4LJP B;  2L8J A;  2CR5 A;  2KJH B;  2UWQ A;  2FCS A;  2IY0 B;  2HE7 A;  2AEH A;  5KHQ A;  4BOS C;  2CHZ A;  3AXC A;  1K8R B;  4KIK A;  2BGF A;  4JL9 A;  2MA9 B;  2LWP A;  3APF A;  5J2R A;  4PS3 A;  3SU8 X;  3CMM B;  3PLV A;  4KZC A;  2DZJ A;  4JQW C;  2GBR A;  1XQQ A;  2LGX A;  5D94 A;  1GC7 A;  3JSV B;  2LD9 A;  2G45 B;  3HHM A;  3VHT C;  4BKS D;  5JHB A;  1WX8 A;  2L00 B;  5CX3 A;  4WJQ A;  3ML9 A;  4LCD E;  4WJP A;  3GOE A;  1KOT A;  1L7Y A;  4BKG A;  2LRU A;  3CF6 E;  3ZRF A;  3VUX A;  4ZRK A;  3EC8 A;  1TGZ B;  1Q0W B;  3QIJ A;  2DX5 B;  1WM3 A;  2JZZ A;  4K7W A;  4W9J A;  2N9P C;  4MJS B;  4IUM B;  4A3O A;  2KZR A;  1WGG A;  1L2N A;  1WGY A;  3A9K A;  3UIN B;  1I35 A;  3PPA A;  2ZPY A;  3PRP B;  4KDL B;  3DBL I;  4DHZ B;  4TQ0 A;  2JF5 A;  3DOW A;  2KXJ A;  2HD5 B;  4GSW A;  3V6E B;  4MH0 E;  3H6N A;  1UH6 A;  4AOF A;  2LUE A;  1V5O A;  2KC2 A;  3HM6 X;  4ANW A;  4IWP A;  3WAN A;  3IBE A;  4RM8 A;  3T8M A;  5JZE B;  3PRM B;  4DK5 A;  3DVG X;  5DPS A;  2WX1 A;  2MP2 B;  4GIV A;  3PT2 B;  4MSQ B;  4GDL B;  4HDO A;  5JHA A;  3PSE B;  1YJ1 A;  2I1K A;  1I42 A;  4HK2 A;  3I3T B;  4N9F 4;  3P2B A;  2GBN A;  4JIO U;  2ZZP B;  4AJW A;  3ONS A;  2JZ3 B;  3OJ4 B;  2DHZ A;  1NDD A;  4KVG B;  4M0W B;  2PEA A;  4ZRI A;  4HPL B;  3S2A A;  1VCB A;  3ZTD A;  3VTU A;  2K6Q A;  4EZK A;  3ZNG C;  4F7Z A;  2C7N B;  2N7D A;  2K39 A;  2PJH A;  2LRW A;  3A4R A;  2BYF A;  3DPD A;  1D3Z A;  1Z2M A;  2IZV B;  1S3S G;  2MBQ A;  4W9L A;  4RM9 A;  4IWO A;  2KN5 A;  1WGH A;  3APD A;  2V4L A;  5TR5 A;  1J8C A;  1KM7 A;  2C7H A;  2J0M A;  2RGF A;  4WWP A;  4DHJ D;  4DXA B;  2DYO A;  2GMI C;  5D7G A;  4CHK A;  2IBI B;  4BKT A;  4KIK B;  3CST A;  3PLU A;  3PRE A;  2G4S A;  2M1M A;  3K9O B;  2OJR A;  2O2V A;  2KX0 A;  4GXB A;  1GNU A;  4WQO B;  3ZRC A;  3V61 A;  2KDF B;  2CU1 A;  2YLM A;  5LXH A;  1RFA A;  3KH0 A;  2YVC A;  3X23 A;  4MGI E;  2KOX A;  2G3Q B;  1OGW A;  2K8H A;  2KHW B;  1WJ4 A;  3L16 A;  3QC8 B;  2KWC A;  3MJW A;  4K7S A;  3AI5 A;  1WJU A;  4MSM B;  5AZF A;  3KW5 B;  2KLC A;  2KJ6 A;  4B95 A;  3NY5 A;  3PHW B;  1VD2 A;  3A9K B;  3QWZ B;  1IPG A;  3EHV A;  4GN1 A;  4EUT A;  2L05 A;  3U30 A;  3PS6 A;  4J6I A;  2K8B A;  2NVU I;  3RUI B;  5JH5 C;  1RAX A;  4EOY A;  1KJT A;  4HWI B;  2KVR A;  4MGY E;  3JW0 X;  2IO3 B;  3L10 B;  4OVV A;  4ANX A;  1V86 A;  2BYV E;  1E7U A;  4XC2 A;  3W1S A;  3SHQ A;  4BOZ B;  2D10 A;  3UIP B;  1P3Q U;  3TMP B;  1G6J A;  1LQB A;  4E74 A;  5FR6 A;  2LVQ A;  4ANU A;  5LXI B;  4NAW A;  2MW5 A;  2J0K A;  1SGH A;  3IVF A;  4FN2 A;  3ALB A;  1WZ0 A;  2DYB A;  4G3X B;  4HJK A;  4BBN F;  4URK A;  3H7P A;  3TL5 A;  2XEW A;  1WXV A;  3UQB A;  2LVO A;  3WAP A;  2LGD A;  4BBN C;  3L0W B;  4ZDV A;  1S1Q B;  4F1S A;  3SDL C;  2JRH A;  4EZL A;  1E8Z A;  3B0A A;  4E3C A;  1WF9 A;  3R66 C;  3VQI A;  1V9J A;  2KKC A;  1WZ3 A;  3DDC B;  4B6W A;  3AU4 A;  4IM2 A;  1V49 A;  2NBV B;  3WA0 A;  2JT4 B;  1TZ1 A;  3TBL D;  3DCG A;  4NQK E;  3KUC B;  4GDK A;  4W9F A;  3LJ3 A;  4NY0 A;  3BY4 B;  1E8Y A;  5E6O A;  2LGY A;  3VAW A;  2FUH B;  5J18 A;  2KD0 A;  2HJ8 A;  3ZKJ C;  2NPT A;  2L3Z A;  1WH3 A;  2MBO A;  2DYM A;  2R2O A;  4F8C B;  2KK8 A;  4HDQ A;  3ZDT A;  4AJY B;  4BFR A;  4EEW A;  4GOC A;  2MSE D;  4LDT D;  3MTN B;  1LXD A;  1RRB A;  3B08 A;  4IG7 B;  2G4D B;  2MCN B;  2MLB A;  4IWQ A;  2IY1 B;  1EF1 A;  1ZGU B;  2KTF A;  2KWV B;  4XX5 A;  2O2V B;  2J7Q B;  3JYU A;  1BT0 A;  2M8S A;  3ZTC A;  3KYD D;  1Y8R C;  2IO2 B;  4ASW C;  1NI2 A;  1WE6 A;  2NR2 A;  4II2 B;  4AUQ C;  2N4F A;  1P9D U;  2EKE C;  1Q5W B;  3L13 A;  3ML8 A;  2ASQ A;  4KSL C;  4EKU A;  4YL8 A;  2OOB B;  2Z59 B;  3KYC D;  1OEY J;  2K8C A;  5LLI A;  2Z0D B;  2BWF A;  2ZJD A;  3PGE A;  4A3P A;  4EFO A;  3A9J A;  1KLV A;  5DCN A;  3V60 A;  2CHX A;  3ZNH B;  1CMX B;  2DZK A;  2FNJ B;  2M17 A;  2KQ7 A;  2IO1 B;  2LXA A;  3IFW B;  3DVN U;  2XK5 A;  4CO7 A;  1J0G A;  2KDI A;  1MG8 A;  1A5R A;  1C1Y B;  2FCM A;  3APC A;  2O6V D;  2V3S A;  2KFK A;  3X0W A;  3ZNZ B;  3A1Q A;  1UBQ A;  1WE7 A;  3RYT A;  3QQ8 B;  2MBH A;  5AZG A;  4FBJ B;  3UQA A;  4GU2 A;  2ZVO A;  2JXX A;  2L0T A;  4I6P A;  3U8Z A;  2KTR A;  2ZCC A;  4NAW B;  4CYE A;  1H8C A;  2KC1 A;  5J17 A;  3H7P B;  4M8N A;  3RCZ A;  2KX3 A;  2Z0E B;  2L0F A;  2RPQ A;  3C0R B;  3U7D A;  2BYE A;  5GMV A;  3ZVV A;  4DHZ E;  5CHV C;  2R2Q A;  1YIW A;  4NNJ B;  2N1W A;  2NBW B;  4GGQ A;  4DDI D;  2V1Y A;  2ZPN A;  4IW0 A;  3PRZ A;  3OAW A;  3EFU A;  5IA7 A;  4KV2 A;  1P98 A;  1RLF A;  1WX9 A;  4K7U A;  3IG3 A;  1OEY A;  1OQY A;  4FA6 A;  3M62 B;  5KHO A;  2FCQ A;  4GMV A;  3DQV A;  4AP4 C;  1V2Y A;  1GC6 A;  2REX A;  3ENE A;  3PVL A;  3VUY A;  4GDK B;  2C60 A;  4HCN B;  2CHW A;  1V80 A;  4II3 B;  3VVW B;  4X57 B;  1YQB A;  3T9L A;  2GOW A;  4ZYN A;  1M94 A;  3ZW3 A;  2NPT B;  4DHJ B;  4HVB A;  2FID A;  4ICV A;  4AWJ A;  1Q1O A;  5AEK B;  1WIA A;  3KUD B;  3ZLZ A;  2BPS A;  1H4R A;  5L95 C;  2KMC A;  3PHX B;  4IM0 A;  4ANV A;  4TUU A;  2JY6 A;  2FCN A;  4PYZ A;  3HK0 A;  3QCA A;  3TIX A;  3UF8 A;  4HCP B;  2J0J A;  4WJO A;  5HKH A;  3H9D A;  1F9J A;  2LAS A;  1V5T A;  2MWS B;  2LJ5 A;  3RZW C;  3NHE B;  2KNB A;  3SD5 A;  3W1Y A;  2DZM A;  2CS4 A;  3DBH I;  2K1F A;  2WX0 A;  1UD7 A;  1GJZ A;  3VTV A;  3ZUN A;  4E71 A;  2KDB A;  4P7I A;  2MRP A;  3NZU A;  3DVG Y;  2KQS A;  2Y5B B;  2PE6 B;  1GG3 A;  4G11 A;  1HE8 A;  2PPH A;  3ZNI D;  2EMS A;  1XT9 B;  2BKR B;  4NJ6 A;  1R4M I;  3KVF B;  2ZVN A;  1OTR B;  3PV1 A;  3RUL A;  2IO0 B;  3MHS D;  3A9J B;  2ZEQ A;  3L08 A;  3QAQ A;  4W9D A;  4WJN A;  3JVZ X;  1WY8 A;  2B3A A;  4HPM B;  3RD2 A;  3Q3F A;  1WXS A;  3Q3J A;  1WXA A;  2L7R A;  1Z5S B;  2O6V A;  2XK5 B;  5DPT A;  3M3J A;  3WAM A;  2L76 A;  4DWF A;  2LXC A;  2WWZ A;  3PTF C;  5G55 A;  3RT3 B;  4TKN A;  1WFY A;  1ZW7 A;  2KFK B;  2GBK A;  2WYQ A;  1V6E A;  3DBS A;  2JVC A;  2MBE A;  1ZKH A;  1LM8 B;  2XBB C;  3A1Q B;  3OLM D;  4FJY A;  3ZIM A;  2KJR A;  4A20 A;  1EO6 A;  1ISN A;  1QZE A;  1WGR A;  2ZNV B;  3AUL A;  3ZDM C;  2AL3 A;  3BIN A;  2D11 A;  4FLH A;  4LJO B;  4BVU C;  3TCA A;  2BKF A;  2KTR B;  4PS7 A;  3N3K B;  1E5W A;  3M63 B;  1UBI A;  1EF5 A;  5CHF A;  3A4S C;  1JRU A;  3QHT A;  1WR1 A;  4FHJ A;  2K25 A;  3AU5 A;  4FJZ A;  2UYZ B;  2EMT A;  3GZN I;  3QAR A;  2A4Z A;  4JLC A;  1WGD A;  1XD3 B;  2VRR B;  5AZH A;  5DPW A;  2LVP A;  3L17 A;  2FIF A;  3ECI A;  2NBU A;  1WI0 A;  1E8W A;  4DBG A;  1IP9 A;  1LFD A;  2KO3 A;  2MQJ A;  2ZCB A;  1TBE A;  2CKH B;  2A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...