2N4FA

Ec-nmr structure of arabidopsis thaliana at2g32350 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ar3433a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
AAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein AR3433A
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n4fA01
1VD2A 3UINB 3EECA 1ZGUB 2V3SA 3AXCA 5AZHA 1WIAA 2KANA 2PEAA 2C7NB 1EF1A 3B1LX 4AP4C 1WXVA 2FUHB 3ZUNA 5C23A 4IWOA 1SGHA 1YX5B 2KC2A 3QC8B 3PV1A 3IVFA 2AL6A 4W9JA 4ASWC 3DDCB 2L05A 3BY4B 2RR9A 2CS4A 2J0JA 3WANA 3UF8A 4EUTA 2RD0A 3ZRFA 2GMIC 4GDLA 3H7PB 2B3AA 3QHTA 4KIKA 3N30A 3V6EB 5L83A 2EMSA 4LDTD 5JHAA 5C1ZA 3ZDTA 5D7GA 3PHWB 2WX1A 2KN5A 1PQSA 2MP2B 5LLIA 5JZEB 2A5UA 2DZJA 4BKSA 2V1YA 1TGZB 2N1VA 2N1WA 3A33B 3M62B 4GGQA 3HHMA 4PS8A 1C1YB 2G45B 2C5LC 1XT9B 2CHZA 4WJNA 4ZYNA 3A1QA 2LGXA 4MJSB 2NVUI 4K7UA 3WAMA 3QARA 4G11A 2LJ5A 2NCNA 4WJPA 2LRWA 3S2AA 3RCZA 4FULA 3KUZA 2MBBB 1WI0A 4II3B 3RULA 2IY0B 4JGHB 4GU2A 2CHXA 3CSFA 5D94A 5KHOA 2K8BA 1X1MA 3JSVA 2BKRB 2O2VA 1WJ6A 4NJ6A 2ZNVC 4I6NB 4CYEA 1WMHB 4IM3A 2JZ3B 1S3SG 1UD7A 2KZRA 2LI5A 2M1MA 2D07B 4EOYA 2K6QA 2ZCCA 2PE6B 4M8MA 1YD8U 1YIWA 4NAWA 3T8MA 2RGFA 1J0GA 1WE7A 1Y8RC 2DZKA 3ZDMC 2LWPA 3KYCD 2YVCA 4E71A 5G2NA 3UIPB 4W9FA 4MGZE 4HXDA 2EMTA 4BBNF 3QJZA 4MM3A 5CHVC 3H6NA 3JW0X 2KLGA 3ZTCA 4RM8A 3DBHI 2KMCA 4FJVB 1LM8B 1WXAA 5BO4B 3Q3FA 4AJYB 3DBLI 5D6JB 4A3PA 4F8CB 3ML9A 2AEHA 4WWOA 4GDLB 3PPAA 1WX7A 4MGKE 3DVGY 2HJ8A 3ZLZA 2MQJA 3PRZA 4KIKB 3UQAA 4LCDE 3VDZA 3ZNGC 3VAWA 5EDSA 3ZNHB 4NNJB 2C7HA 2KK8A 4KV2A 1UBQA 1WGDA 3QAQA 2CR5A 1OEYJ 4BFRA 3X23A 1WR1A 3K9OB 3WIMA 4NJ7A 2G4SA 5GMVA 4MGIE 2KO3A 2KFJA 1J19A 2UYZB 3A1QB 4RM9A 2REXA 4ZRKA 3L17A 3PSEB 4PYZA 5E6PA 3NZSA 4BKGA 2D3GA 5E6NA 2L0TA 4MGYE 2D2QA 4KDIC 1IP9A 4HDOA 2BYVE 4AUQC 2ZZPB 1OTRB 4A3OA 1F9JA 2KDIA 3SDLC 2IYDB 2KJ6A 2DHZA 2KDEB 3PS6A 3TIXA 5JH5C 4GN1A 2J7QB 2XK5A 1V9JA 2K8CA 3IBEA 3M63B 3RD2A 3VXWA 3ZRCA 2W9NA 1UZXB 2N7DA 2FIDA 4FLHA 4K7SA 1MG8A 2JY6A 2FAZA 3TCAA 4EFOA 5AEKB 2C7MB 3DCGA 2O2VB 4AWJA 4TQ0A 4J6IA 2KJRA 1TTNA 2GBRA 4K7WA 2Y5BB 2G3QB 3PVLA 4NPNA 2JXXA 2L76A 3DVGX 1E7VA 4XC2A 3IFWB 1Z5SB 4BBNC 4TV3A 1XD3B 1EF5A 3VUXA 4WWPA 5AZFA 4DHJB 4EZLA 1RRBA 1V6EA 2JVCA 4GXBA 4XZ4A 2O6VD 5DCNA 4BOSC 3CF6E 5DPWA 3N32A 4DK5A 3R66C 4W9EA 1T0YA 1KM7A 1Q1OA 4G0NB 1EUVB 1E5WA 1LFDA 4JQWC 4KZCA 3L13A 2KDBA 1LQBA 4GSWA 4GB9A 4JL9A 3UGBB 3VQIA 2KVRA 3TBLD 2KHWB 3DOWA 4RMAA 1I35A 4EKUA 3A9JA 3DVNV 2Z0EB 2N9EB 3APDA 4FJZA 1M94A 4IUMB 4ANWA 1JRUA 4OVUA 2MBOA 4AOFA 3WALA 3H9DA 2PPHA 4EZKA 1WJUA 2EKEC 2BF8B 3C0RB 3APFA 3L16A 3ZNZB 3PGEA 3L0WB 3QX1A 3ALBA 4YL8A 4ZRJA 2I1KA 2OOBB 4KDLB 2LZ6A 2KX3A 4BVUC 3N3KB 4G50A 1Z2MA 2CKHB 4PS7A 1GC6A 2DX5B 1S1QB 2BYEA 2UWQA 4PYUA 1WYWB 3P2BA 1IYFA 1NI2A 4HPMB 4E3CA 1RFAA 1BT0A 3ZTDA 4WAAA 2KQ7A 3TMPB 1SIFA 3V60A 2MX2A 2MWSB 4P7IA 2NBVB 2ZPYA 4TQ1A 3WAPA 5G55A 1NDDA 1WZ3A 2KC1A 2VRRB 4FHJA 1P9DU 3KH0A 2GBKA 4N9F4 2MA9B 1C3TA 1WF9A 2FCQA 3Q3JA 3RZWC 2NR2A 2KWVB 1TBEA 2KMAA 2LD9A 4FJYA 2MRPA 3DVNU 1WR6E 2KXJA 4GDKA 1WX9A 4W9IA 3X0WA 2JF5A 2KQSA 4TKNA 4NQKE 3AU5A 4FADA 5J18A 3VVWB 4LDTB 3OAWA 2WYQA 4WWNA 3CSTA 4G3XB 3QA8A 2MBQA 5D2MB 1V5OA 1WXMA 5J2RA 1WH3A 3UIOB 4HLEA 2NPTA 2L3ZA 3W1YA 1GJZA 3QQ8B 4BKSD 2KFKA 4IC7B 2N9XA 3ZNID 3L08A 1OEYA 3CMMB 1WRDB 1E8ZA 3PZDA 3PRMB 2K6DB 3M95A 2RPQA 4ANVA 1K8RB 4DDGD 3OLMD 4PS3A 1GUAB 2DAJA 3R3MA 4IG7B 3PLVA 1OQYA 1FXTB 4II2B 3DBRI 2DZIA 4JIOU 4CO7A 4W9GA 3PTFC 2DYBA 2IBIB 4X57B 2OJRA 3I3TB 4F1SA 4IM2A 4BOZB 4W9CA 5FR6A 2DYOA 3NHEB 3H7SA 2K25A 4TUUA 1R4NI 1E8YA 1D3ZA 4HDQA 2L0FA 3DPDA 3EHVA 4W9DA 3APCA 4BKTA 3LDZE 3AU4A 4WJOA 1GC7A 2LGYA 3PLUA 1G6JA 1E8WA 4EZJA 1CMXB 2JRHA 2O6VA 2DYMA 3HM6X 4ICUA 4DWFA 3EC8A 2GBNA 5CTRC 3B0AA 3VFKA 2A4ZA 2LRUA 4DHJD 2GBMA 2ZNVB 2KD0A 1A5RA 4A20A 4ANUA 2BGFA 1GNUA 2MBEA 1V86A 2K39A 3IHPC 2PJHA 3JSVB 4XX5A 2IY1B 1ZKHA 3KYDD 3NY5A 4IWPA 1TZ1A 2K8HA 1WGRA 4WJQA 2AWTA 3PRPB 1KLVA 1YX6B 3V61A 3VH3B 3QCAA 2ZPNA 2J0MA 4FN2A 4GDKB 2NBWB 1V49A 1WXSA 2R2QA 4MH0E 4HCPB 1V80A 1WJ4A 3H1UA 1Q0WB 4NAWB 2MCNB 4LJOB 3AULA 1WJNA 2IO2B 3KW5B 2JWZA 2RSUA 2R2OA 2FCSA 4HVBA 5HKHA 4I6LB 3R7RA 3VUWA 1WMHA 2WDTB 4IM0A 2YLMA 2NPTB 5LXHA 1WGYA 4W9HA 2PE9A 1YQBA 4IWQA 2KFKB 2KX0A 2HD5B 3KVFB 3O65B 1ZW7A 4HWIB 3VUYA 2JRIB 5CX3A 4KSLC 3PHXB 4MSMB 3UQBA 2FCMA 4ZRIA 2WWZA 2ZVNA 1H4RA 2LXAA 4B9KA 2J0KA 4FA6A 1L7YA 3B08A 2MLBA 4DHZB 1P1AA 2L7RA 3NOBA 2LVPA 4HJKA 5IAAC 3RUIB 1H8CA 4MDKE 3RYTA 4E74A 3WA0A 5CHFA 4DDID 3JVZX 2KLCA 4NY0A 3SHQA 2BYFA 2AYOB 2O6VB 2CHWA 2C60A 2KOXA 2ZEQA 3A9KA 2K1FA 3ECIA 3VH4B 4B6WA 1WX8A 4CHKA 2M0XA 3M3JA 3A4SC 2XK5B 5JHBA 2BWES 5L95C 3W1SA 3ZO5B 4DHZE 1WGGA 3AI5A 1U4AA 3V62A 4IW0A 5DPRA 2IO0B 3JYUA 1WM3A 4GIVA 4MELA 3R7QA 5KHQA 2DAFA 2M8SA 1WFYA 1RLFA 3TL5A 2XEWA 3QIJA 1V81A 3PREA 3U30A 3W1SC 2BKFA 3D32A 3ZVVA 4M8NA 2N7EA 2IO3B 1P3QU 2DZMA 2N4FA 1EO6A 3MJWA 2LVQA 3VTWA 1XQQA 2C9WB 5CHWA 2BPSA 5IA7A 2HTHA 4FBJB 1E90A 3U8ZA 1KOTA 4MSQB 2KJHB 2D10A 1WY8A 4EEWA 3BINA 1HE8A 4FHKA 2KTRA 3K9PB 1SE9A 2I1JA 5DPSA 2M4NA 5LXIB 1L2NA 1GG3A 3A4RA 4KZ0A 3A9JB 3NS8A 2LXCA 4B95A 2LVOA 1UGMA 3EFUA 4ZDVA 1P98A 5E6OA 1IPGA 3RZFA 3T9LA 4HPLB 2V4LA 3MHSD 1J8CA 4K1RB 3QK0A 2FNJB 1QZEA 3HK0A 2ZVOA 4ANXA 3NZUA 2KWUB 1UH6A 3ZKJC 2LASA 1R4MI 2JUOA 2M17A 3ONSA 2FIFA 3WAOA 3ZW3A 3VTUA 1YJ1A 3ZIMA 3H7PA 3SD5A 3MTNB 2BWFA 3HM3A 4URKA 1WGHA 1WM2A 4AJWA 1NBFC 3L54A 2KKCA 3V6CB 1VCBA 2MBHA 2KTFA 2L8JA 4GOCA 2LUEA 4W9LA 2G4DB 2IO1B 4MEMA 1V2YA 4DXAB 2KDFB 3HIZA 3DBSA 2MP2A 1UELA 3A9KB 4KSKC 3PT2B 1RAXA 2AL3A 4LJPB 2GBJA 3GZNI 1P0RA 2Z0DB 1E8XA 2L00B 3RT3B 1Q5WB 3QWZB 3U7DA 3OJ3A 4M0WB 2NS5A 1LXDA 2MW5A 3GOEA 4MJSA 4WQOB 4KVGB 2ZJDA 4HCNB 2QHOA 4GMVA 2JT4B 1OGWA 1ISNA 1AARA 2KNBA 4I6PA 4JLCA 4NQLB 1UBIA 3SU8X 3VTVA 2DENB 2JPHA 3KUDB 5AZGA 2LGDA 2CU1A 3IG3A 1E7UA 2WX0A 4W9KA 2NBUA 3ENEA 4OVVA 3ML8A 3TJPA 3KUCB 4HK2A 2IZVB 2D11A 2ASQA 2GOWA 1KJTA 1WE6A 1WZ0A 2JZZA 2ZCBA 3DQVA 3LJ3A 4ICVA 4K81A 3VHTC 4DBGA 3OJ4B 2FCNA 1V5TA 2N9PC 2XBBC 2MSED 5TR5A 2HE7A 2KTRB 5J17A 5DPTA 4F7ZA 1I42A 3L10B 2Z59B 2KWCA
chains in the Genus database with same CATH superfamily
1VD2A 1HTQA 3B2GA 1JWUD 1PGBA 2PEAA 2C7NB 4AP4C 1WXVA 2WNMA 4IWOA 2AQ2B 5IO9A 2NMQA 4HEA1 2IGGA 3DDCB 3LXFA 3EA6A 1ZUD2 4EUTA 5BMGA 3V6EB 4XDDA 3ZDTA 1PQSA 2A5UA 3Q6BA 2WDVB 1N5XA 2G45B 2C5LC 4YTNB 3A1QA 2DNFA 1QOAA 2NVUI 4K7UA 3WAMA 2WHIA 2QCZA 2EELA 1C4CA 2MBBB 1CJEA 3GE8C 4JGHB 5KHOA 3Q8CA 5H8YE 4RCOA 2HJ1A 2BVCA 2ZNVC 5AUKA 1WMHB 1UD7A 3E9SA 1V1PB 1MFWA 1JQ4A 2KMMA 3ZDMC 2YVCA 1ESFA 5G2NA 4AS1A 4MGZE 4HXDA 3QJZA 4MM3A 2KLGA 2QEJC 4FJVB 1LM8B 1WXAA 5BO4B 3Q3FA 2BS2B 5D6JB 3RNFC 4WWOA 2IGDA 3U2SC 3DVGY 3UQAA 3DBLB 3ZNGC 3VAWA 3RMKC 2C7HA 2KK8A 2AX5A 4ZHOA 1ACCA 4BFRA 2G4SA 2KWDA 2KFJA 3U4EG 2REXA 4N58A 4PYZA 5E6PA 3NZSA 4BKGA 2D3GA 4KDIC 1MJDA 1IP9A 4HDOA 2BYVE 1OTRB 4A3OA 3SDLC 2KJ6A 2KDEB 3HVZA 2J7QB 4Q2JA 1V9JA 3IBEA 3VXWA 3ZRCA 2JY6A 3TCAA 5AEKB 3DCGA 2O2VB 4AWJA 2FE8A 4TMAB 4HRSA 2Y5BB 1AN8A 2JXXA 2L76A 1Z5SB 2WGSA 3DWMA 1PGXA 4WWPA 1V6EA 4GXBA 4XZ4A 1T0YA 3VR9B 4G0NB 5BMHA 4K3BA 1MI0A 4KZCA 3AEDB 4GSWA 4JL9A 3VQIA 3A9JA 3HRDD 1L5PA 2MBOA 1HZ6A 3H9DA 2PPHA 1WJUA 3C0RB 1YJJA 3QX1A 2LFIA 2KQ4X 3P4SB 2CKHB 3L4PA 2BYEA 4PYUA 1NI3A 4E3CA 4QAYA 3IAM1 1SIFA 3RNBC 4P7IA 2ZPYA 2L32A 5T8IA 3WAPA 1JMLA 1NDDA 1WZ3A 2KN4A 3KH0A 2MA9B 2FCQA 3Q3JA 3RZWC 2NR2A 4FULA 1I4HA 2MRPA 1WR6E 1KLUD 3I5JC 4NQKE 4ZRPA 1JWSD 1NYRA 1JCKB 1WXMA 1WH3A 2OEDA 3UIOB 2M56B 2NPTA 3H8HA 1GJZA 4P1CC 2LUMA 3L08A 3NVWA 1OEYA 3CMMB 1SB3C 3AEEB 1K8RB 4PS3A 1ET9A 2DAJA 3R3MA 3PLVA 4XE0A 4JIOU 4W9GA 1T0RC 3W5UB 4BOZB 3NS1A 4TUUA 2L0FA 3EHVA 3APCA 1FNUA 4BKTA 3AU4A 1G6JA 4EZJA 4REZA 2JRHA 4ICUA 4DWFA 1FPYA 4DHJD 2KD0A 4ANUA 2BGFA 2K39A 2PJHA 3CWIA 1FXIA 2BS4B 1FXAA 2ZW1A 2K8HA 4WJQA 2INCC 4XYCA 3PRPB 2JYTA 3MP9A 3VH3B 3QCAA 1IBXB 2ZPNA 4GDKB 2NBWB 1ENFA 1F52A 3H1UA 1TS4A 4LJOB 1WJNA 2IO2B 3W9CB 2K0PA 2BYTA 2RSUA 2FCSA 4HVBA 3C8YA 4I6LB 3VUWA 1MG4A 4LNOA 2PE9A 4RGOS 1YQBA 4O1NA 4IWQA 2KX0A 1XLNA 2L1AA 3O65B 1ZW7A 3P4RB 3TEXA 5EE1A 4KSLC 3PHXB 1I4PA 2WWZA 2ZVNA 4WQMA 3ZXVA 4B9KA 2J0KA 3AE3B 1P1AA 4YT0B 3VR8B 3NOBA 2LVPA 1EWYC 5IAAC 3Q2AC 3RYTA 5CHFA 3JVZX 3PO0A 2O6VB 1WX8A 3A4SC 2XK5B 3Q3NC 3R2IA 4WAFA 4GIVA 5KHQA 4C4VB 3TL5A 3QIJA 3U30A 2QDFA 4M8NA 3MJWA 1XQQA 1XF5L 2BPSA 5IA7A 1OQQA 2HTHA 1KFYB 4FBJB 2GLSA 1KOTA 2KJHB 1D5ZC 4C7YA 1IUEA 2X8XX 1HE8A 3K9PB 1TJEA 1SF0A 5LXIB 1L2NA 1GG3A 2PVGC 1EWCA 4B95A 1UGMA 1TY0A 4YSXB 2MHJA 4WWMA 3QK0A 4KKIA 3N1XC 3NZUA 2KAJA 2KWUB 1RFKA 2KDMA 1R4MI 2FIFA 3WAOA 1YJ1A 3ZIMA 1WM2A 1NBFC 3L54A 2KKCA 2MBHA 2KTFA 2L8JA 4GOCA 2KVZA 2FBWB 3DBSA 3ZJVA 1UELA 4KSKC 3PT2B 1RAXA 2E6XA 3Q8BA 3GZNI 3RT3B 2WXKA 4M0WB 1LXDA 2MW5A 4MJSA 1TKYA 2WXFA 4KVGB 4HCNB 2LMCA 3HUIA 4OZBA 2V0GA 4KKJA 1AARA 4JLCA 2JPHA 2V3PA 2WX0A 4OVVA 3C19A 1KH0A 3KUCB 4DQOC 2ASQA 2GOWA 1KJTA 2JZZA 1WZ0A 3LJ3A 3VHTC 3ZQ4A 4DBGA 2MEKA 2FCNA 3Q69A 5J17A 2HE7A 2KTRB 2IO0B 2IGHA 4ITKA 1WWTA 5AZHA 1EF1A 3ZUNA 2FUHB 1N6ZA 3AB5A 5C23A 1L0VB 3MHZA 1JW9D 1SSNA 1F2RC 3BY4B 2J0JA 2RD0A 4GDLA 2ICIA 2BTEA 1ZPSA 3N9YC 3QHTA 1C76A 4J3OD 5JHAA 4WURA 4RGNA 1TS2A 2K3UA 4OVZA 5D7GA 2WX1A 5JZEB 3KWLA 4BKSA 1YJIA 3AE4B 2HDEA 1FRDA 4GGQA 3HHMA 1PFDA 4LK0M 1XT9B 4ZYNA 2LGXA 1LGRA 2NCNA 2PVOD 4YSYB 2LRWA 3RCZA 4S17A 4B0MA 3E56A 4II3B 1JWMD 3RPFC 1FD6A 2K8BA 1X1MA 3JSVA 1EU4A 4L23A 2WXPA 2X38A 2M1MA 4EOYA 2BT6A 2ZCCA 4M8MA 1V97A 1YD8U 4NAWA 4OZAA 3T8MA 1WE7A 2PIAA 2PMVA 2GB1A 3EFCA 1XCQL 5CHVC 3ZTCA 4RM8A 5HHDG 1L4DB 3DBLI 4A3PA 4F8CB 3RFZB 2AEHA 3DBHB 2D3CA 1A70A 1NVID 2MQJA 5BYSA 1V8CA 3Q8FA 3VDZA 5EDSA 3ZNHB 5BYRA 1UBQA 3QAQA 2XN9C 1WR1A 3K9OB 5GMVA 1K51A 1J19A 3A1QB 4RM9A 3SR6A 3L17A 2V3NA 2L0TA 4P1BC 3VRBB 4AUQC 5JH5C 2IYDB 3AEFB 3PS6A 5JXVA 2K8CA 3RD2A 1TIFA 2N7DA 4K7SA 4US9A 2FAZA 1I4GA 1ZXHA 4IKGA 4TQ0A 4J6IA 2KJRA 2GBRA 4K7WA 2WU5B 2G3QB 3RNEC 1FFUA 3DVGX 1E7VA 3IFWB 4TV3A 2OHFA 1D6EC 1I4QA 1ZE3D 5EE0A 3VUXA 1DOXA 1GB1A 4DHJB 2WXMA 1RRBA 2JVCA 4BOSC 4YSZB 2O6VD 3R66C 1KM7A 1Q1OA 1EUVB 1E5WA 3NVVA 3L13A 1BXTA 1E0ZA 2QILA 2IDYA 2KDBA 4MM3B 5FK9C 1VJKA 1T6BX 2KVRA 5FKAC 2KHWB 3DOWA 1HQRD 4EKUA 3DVNV 4XWTA 1DOYA 3ZJUA 5EE9A 1M94A 1JRUA 1N60A 4FXCA 4B0EA 4RFBA 2BF8B 3ZNZB 3L0WB 3ALBA 4YL8A 1C78A 2JYEA 2YEPF 3MFGA 2UU7A 3TEWA 4KGTA 4G50A 1Z2MA 4ZRQA 2N9LA 3P4PB 1K50A 4A55A 3ZTDA 1LO5D 3NJTA 3TEYA 2MX2A 3NVZA 2I2YA 5IP4D 2LGSA 4MT5A 2QSDA 3DHHC 1WXQA 1P9DU 4N9F4 1Y56A 1PYWD 1TBEA 2KMAA 1TS3A 1F2RI 3X0WA 3BVZA 4W9IA 1SE2A 4LDTB 2JU6X 2WYQA 3OAWA 5AUIA 3AE7B 5IOIA 3W1YA 2B76B 4BKSD 2N9XA 3V3XA 3SFEB 3MC9A 3RNAC 2K6DB 3M95A 3B9JA 2RPQA 3RNGC 3OLMD 4IG7B 2DYBA 2OJRA 4IM2A 1BUIC 2DYOA 3NHEB 2ON8A 3H7SA 1YN5A 1D3ZA 3DBRB 2NTTA 1BMLC 1WGKA 4N59A 3DPDA 4WJOA 5CTRC 3VFKA 1A5RA 2GBMA 4A20A 1ZKHA 3KYDD 1JROA 3P1MA 1VZ6A 3TSSA 2MJ3A 2JX5A 4FN2A 2R2QA 1WXSA 4LNNA 4HCPB 1T0SC 2J53A 2R2OA 1FCCC 2IPKD 3LB8C 1F77A 5EE3A 1N62A 1WMHA 2H88B 2YLMA 2NPTB 1WYGA 2HD5B 1J7AA 3KVFB 4HWIB 1OFFA 2WXLA 1SXTA 5CX3A 2WXOA 3UQBA 4ZRIA 4FA6A 4L1BA 2PLPA 1ZP0B 4HJKA 2ONQA 1GOZA 3RUIB 1QT9A 4E74A 2KLCA 2AYOB 2CHWA 2C60A 2KOXA 2ZEQA 3A9KA 2K1FA 3NRZA 4B6WA 5L95C 3AI5A 1TKEA 3V62A 1T5XD 4IW0A 3EUB2 1WM3A 4MELA 2WXHA 1WFYA 1RLFA 3W1SC 3D32A 2N7EA 2DZMA 2N4FA 1EO6A 2LVQA 2INPE 1D5XC 1M4VA 2EKIA 3IAS1 1XLPA 2BBCA 2KYWA 4MSQB 2D10A 4EEWA 3Q8EA 3BINA 1SE9A 2M4NA 4KGRA 3NS8A 2LVOA 4ZDVA 2V4IB 3T9LA 3MHSD 4HJGE 1L6VA 3HK0A 2WXNA 2MH7A 2M17A 1TKGA 1K53A 3H7PA 1GB4A 3HM3A 2DLBA 2LUEA 3AE8B 2KDFB 3AE5B 3HIZA 2MP2A 2GI9A 4ACFA 2AL3A 2Z0DB 3LYYA 2NS5A 5TSSA 4JE3B 3TEZA 2ZJDA 2K9XA 1UF0A 4GMVA 2JT4B 1ISNA 2KNBA 2LGIA 1UBIA 2WS3B 1XLQA 1SIJA 4W9KA 2NBUA 2D11A 4K81A 1HTOA 1YNTE 2YEPB 1GPXA 3L10B 2KWCA 2XNAC 1VZ8A 3UINB 3EECA 2V3SA 3AXCA 1RWSA 1L4ZB 1QOBA 2KANA 3B1LX 1ET6A 4M02A 2MJEA 1FNVA 1SGHA 1TYGB 1UGJA 1YX5B 4KX6B 2KC2A 2AL6A 4W9JA 4ASWC 2L05A 3UF8A 4D2KA 2Y5CA 3DHGC 2B3AA 4KIKA 2BB6A 1N5WA 2EMSA 3VRAB 4LDTD 3AE1B 4XDCA 3CIRB 1E10A 3PHWB 5G5GA 2KN5A 5LLIA 2J52A 2DZJA 2V1YA 1TGZB 2N1VA 2N1WA 3AE9B 3M62B 1C1YB 1JALA 4MJSB 2BS3B 5C3JB 2LJ5A 1TT5B 3S2AA 4TSSA 4R3DA 3AECB 1WI0A 1D5MC 2CHXA 5D94A 5HG2A 1WJ6A 1SE3A 1DGJA 2OJWA 4CYEA 2JZ3B 1S3SG 1YQ3B 2KZRA 2RDGA 1MHXA 2D07B 2K6QA 1VLBA 3FILB 1Q10A 5IN7A 2KT7A 2RGFA 5HI1A 4HKZE 1J0GA 2L52A 3BYYB 1Y8RC 2DZKA 3KYCD 2G9HD 4E71A 3V05A 4BBNF 2M19A 3H6NA 2JSVX 3DBHI 3N1YC 1QILA 1YN3A 1SEBD 5GXGB 1E9MA 1FRRA 1SJHD 4GDLB 3PPAA 1WX7A 4WIPA 2HJ8A 2DBYA 4LCDE 4RH6A 1YN4A 4HROA 1WGDA 1OEYJ 2QC8A 2W82A 3WIMA 4PT5A 4NJ7A 4MGIE 2LHEA 2KO3A 4KGSA 3GS2A 3PSEB 5E6NA 1QOFA 4MGYE 2KDIA 3HVDA 3IXSA 4GN1A 2XK5A 2CU3A 3M63B 2R61A 1T0QC 1UZXB 4FLHA 2FIDA 3U52E 2W3SA 2C7MB 2M0AA 1N63A 4RF1A 3RNCC 4C4VA 5I4DA 1V1OA 4XC2A 4RNAA 1K52A 2Q5WD 1EF5A 2J42A 3MJ5A 4ZHPA 4EZLA 2Z8LA 4W9EA 1C79A 1LQBA 4LLGM 2LHDA 4MACA 4RMAA 1I35A 3AE6B 2N9EB 2WXQA 1MVKA 3APDA 4IUMB 3BWUD 4ANWA 4AOFA 4LNIA 4C56C 4EZKA 4ZOHC 3APFA 3L16A 1MPEA 1VR9A 2AQ3B 4ZRJA 3T3OA 4AQ7A 2D3AA 4BVUC 5D3DA 2DWQA 1GC6A 2W54A 3P63A 2UWQA 1IYFA 1NI2A 4HPMB 1BT0A 4WAAA 4JWSC 3TMPB 1NYQA 3V60A 4TQ1A 5G55A 2Y3AA 1CQVA 2VRRB 4FHJA 3ZXRA 1IGCA 1C3TA 1WF9A 2WXJA 2TSSA 3DVNU 2JF5A 2KQSA 5J18A 4FADA 3VVWB 2E3TA 5FR3A 3CSTA 1E7PB 3QA8A 5D2MB 1V5OA 2JQRB 2L3ZA 3QQ8B 2KFKA 1I4XA 1WRDB 3PZDA 3DHIC 1L6UA 2WQYB 2SAKA 1ROEA 1GUAB 2WDQB 1QQRA 2D5GA 1OQYA 4M01A 4II2B 3DBRI 2DZIA 4JX1C 4X57B 4F1SA 4W9CA 5FR6A 1TS5A 2Y5PA 2BW2A 2WXRA 5H92C 1PGAA 3ETRA 4W9DA 4YXDB 1GC7A 2LGYA 1TY2A 1R4NB 1CMXB 3AV8A 3EC8A 3B0AA 2LRUA 1XXGA 4CQNA 3IHPC 3SEBA 2W3RA 3IT6B 4IWPA 1TZ1A 2JWUA 1WGRA 1KLVA 2CJNA 1YX6B 3RN9C 1V80A 1WJ4A 1FNWA 3P42A 2JWZA 1T3QA 5C2TB 3R7RA 1IGDA 5LXHA 1WGYA 3SFDB 2D3BA 2JRIB 1MHHE 2V9HA 1H4RA 3URYA 1L7YA 4C00A 2MLBA 4XGAB 1AWDA 4DXGA 1P7EA 1H8CA 4JWUC 4MDKE 3WA0A 1VZ7A 1HZ5A 2WP9B 4DDID 2PKOA 5BYQA 1D4BA 3SHQA 1ZXIA 1STEA 3MC8A 1C4PA 4CHKA 2M0XA 3M3JA 2BWES 3W1SA 3N20C 1WGGA 1FEHA 1QLBB 1N61A 3WCQA 2FUG1 2INDC 3JYUA 3KLSX 2DAFA 2I38A 4OZCA 2JZPA 3PREA 2BKFA 3ZVVA 2IO3B 1P3QU 3VTWA 5CHWA 1E90A 3U8ZA 1NENB 2VH1A 2N0SB 1WY8A 4HKQA 1AW7A 4FHKA 2K5PA 1WRIA 4N6EB 2WU2B 3MC0B 3NUHB 1KF6B 3Q8AA 3OWEB 1RYJA 3A4RA 4KZ0A 3A9JB 3EFUA 1R7SA 1QKZA 1J8CA 4K1RB 1B1ZA 1QZEA 2ZVOA 2AQ1B 1C4AA 2JUOA 3KQ4A 3ZW3A 3BVGA 1JWBD 2WLBA 3SD5A 3MTNB 4URKA 1WGHA 1E6EB 3V6CB 2G4DB 2IO1B 1V2YA 1UNSA 3P4QB 3FAHA 3A9KB 3GE3C 2GBJA 1E8XA 1Q5WB 3QWZB 1P7FA 3OJ3A 3U7DA 3GOEA 2L83A 1GAQB 3I57A 3SU8X 1HXYD 5AZGA 1JRPA 3TJPA 4LTUA 2IZVB 4ARCA 1EU3A 3DQVA 4UDUC 1V1PA 3OJ4B 2WXIA 2N9PC 5DPTA 4F7ZA 1I42A 4EE2A 2Z59B 4A90A 1ZGUB 1EM7A 1WIAA 1YOVB 3QC8B 3PV1A 3IVFA 2G1EA 1XEEA 2VZKD 2RR9A 2CS4A 3WANA 4C7ZA 3ZRFA 2GMIC 3H7PB 3N30A 5L83A 1SJED 5C1ZA 1L0YB 3PZ8A 2MP2B 1YQ4B 3A33B 4LNKA 3ABVB 5MPOA 4PS8A 4L2YA 2CHZA 4WJNA 4RGMA 1NEKB 4BZAA 1HA5A 3OG5A 2LEKA 3QARA 3PZ7A 4G11A 3UI3A 4WJPA 1I7HA 3N1ZC 3KUZA 4DXFA 3RULA 2IY0B 4GU2A 3CSFA 2QIEB 2BKRB 2O2VA 2VH2A 2SEBD 4NJ6A 4I6NB 4IM3A 2KACA 2LI5A 2PE6B 1YIWA 1QOGA 3AM9A 3O13A 2H89B 2LWPA 5G5HA 3UIPB 4W9FA 2EMTA 2ZW0A 4BAXA 3JW0X 2BQQA 1AYFA 2KMCA 1UWXA 2QJLA 1ZDXA 2K22A 4AJYB 2QMTA 3ML9A 3GB1A 3BK1A 4MGKE 3ZLZA 3PRZA 4KIKB 2W55A 3DWGC 4NNJB 3T3NA 4KV2A 4NJCA 2CR5A 3X23A 1FMAD 1PDXA 2UYZB 3ZGZA 4ZRKA 2D2QA 4NZLB 3U7ZA 2ZZPB 5HFYA 1F9JA 3TIXA 2DHZA 3AE2B 2W9NA 2GRIA 1MG8A 4EFOA 1VDVA 1RM6C 1TTNA 3PVLA 4A6QA 4NPNA 2HTME 4BBNC 2LJIA 1XD3B 1JWAD 5AZFA 5DCNA 4US8A 3CF6E 5DPWA 3N32A 4DK5A 1ZDVA 3W5VB 2J4XA 4JQWC 1LFDA 1DYQA 1C9FA 2WXGA 4GB9A 3UGBB 2INNE 1F0ZA 3ZYYX 3TBLD 5IKCM 3B2FA 2PTLA 4YTMB 2Z0EB 3NG0A 2IJ0A 3R8BA 4FJZA 3BK2A 4LNFA 4IDIA 4OVUA 3WALA 2EKEC 4A8XC 3PGEA 3ZJTA 2I1KA 1XCTL 2OOBB 4KDLB 2LZ6A 1XLOA 2KX3A 3N3KB 4PS7A 5LNK1 2DX5B 1S1QB 2WDRB 3Q3OC 1WYWB 3P2BA 1RFAA 2KQ7A 2MWSB 2NBVB 2KC1A 2GBKA 1IBXA 2KWVB 2LD9A 4GDKA 4FJYA 2KXJA 1WX9A 4TKNA 3AU5A 1B9RA 1F1HA 4WWNA 1KRHA 1KLGD 4G3XB 2MBQA 5J2RA 4XWWA 4HLEA 4IC7B 3KWVA 4P16A 3ZNID 3BVMA 1E8ZA 3PRMB 3IT4B 4ANVA 1FM0D 4DDGD 4OHJA 1FFVA 1FXTB 4CO7A 3PTFC 2IBIB 3I3TB 3AH7A 2K25A 1R4NI 1E8YA 3BYTB 4HDQA 1DOIA 3LDZE 3PLUA 2N7JA 1E8WA 2MJDA 2O6VA 2DYMA 3HM6X 4A9AA 2GBNA 2A4ZA 2ZNVB 4K3CA 4P6VF 2JXTA 1KTKA 3AN1A 1FIQA 4GLSC 1GNUA 2MBEA 1V86A 5D3IB 3JSVB 4XX5A 4NAMA 2IY1B 3NY5A 5E6JA 4RGTA 2AWTA 3V61A 1FCLA 2J0MA 4MH0E 3GP7A 1V49A 3NZ3A 1TZOA 3RI7C 1UUPA 1Q0WB 4NAWB 2MCNB 3AULA 3KW5B 4ARIA 5HKHA 4HPPA 2WDTB 4H2AA 4IM0A 4ZYSA 4W9HA 2ACZB 3BZDB 4MH8A 2KFKB 4RF0A 3FILA 4M00A 3VUYA 4MSMB 2RDBC 1VRAB 2FCMA 2LXAA 5BMIA 3B08A 4DHZB 2L7RA 1XO3A 3J9CA 1SE4A 3AEAB 4NY0A 4PK1A 2BYFA 3AEBB 3ECIA 3VH4B 5JHBA 3ZO5B 4DHZE 4M0WA 1U4AA 3NVYA 2VZKB 5DPRA 1CK1A 1FO4A 3FC4A 3R7QA 2M8SA 2XEWA 1V81A 1HEZE 2C9WB 1CZPA 3Q3MC 2KTRA 2NTSA 1SBBB 1J7CA 2I1JA 2RPVA 5DPSA 3BIID 1ZOYB 4IOIE 2LXCA 1P98A 5E6OA 1IPGA 3RZFA 4HPLB 1OQRA 2V4LA 4OW0A 3FKYA 3Q14C 2FNJB 4ANXA 1UH6A 3AMZA 3ZKJC 3TUOA 2LASA 2RMMA 3ONSA 3VTUA 4JPSA 4C80A 2BWFA 4AJWA 1R4MB 1J7BA 1VCBA 4W9LA 4MEMA 4DXAB 1C77A 4LJPB 1WSPA 1L0XB 1P0RA 2L00B 4WH4A 4WQOB 2RDHA 3W2DA 2QHOA 1OGWA 3GZNB 3R2TA 4USAA 4I6PA 4NQLB 4S0RA 1YMHE 3VTVA 2DENB 3KUDB 1UWMA 2LGDA 2CU1A 3IG3A 3I63C 1E7UA 3AEGB 1PUTA 2PW9A 3EGRA 3I9V1 4YWGG 3ENEA 3ML8A 4HK2A 2BB5A 4YTPB 1WE6A 4ICVA 2ZCBA 2N9KA 1V5TA 2XBBC 1QF6A 2MSED 5TR5A 1I4RA 2CJOA
chains in the Genus database with same CATH topology
1VD2A 3UINB 3EECA 1ZGUB 2V3SA 3AXCA 5AZHA 1WIAA 2KANA 2PEAA 2C7NB 1EF1A 3B1LX 4AP4C 1WXVA 2FUHB 3ZUNA 5C23A 4IWOA 1SGHA 1YX5B 2KC2A 3QC8B 3PV1A 3IVFA 2AL6A 4W9JA 4ASWC 3DDCB 2L05A 3BY4B 2RR9A 2CS4A 2J0JA 3WANA 3UF8A 4EUTA 2RD0A 3ZRFA 2GMIC 4GDLA 3H7PB 2B3AA 3QHTA 4KIKA 3N30A 3V6EB 5L83A 2EMSA 4LDTD 5JHAA 5C1ZA 3ZDTA 5D7GA 3PHWB 2WX1A 2KN5A 1PQSA 2MP2B 5LLIA 5JZEB 2A5UA 2DZJA 4BKSA 2V1YA 1TGZB 2N1VA 2N1WA 3A33B 3M62B 4GGQA 3HHMA 4PS8A 1C1YB 2G45B 2C5LC 1XT9B 2CHZA 4WJNA 4ZYNA 3A1QA 2LGXA 4MJSB 2NVUI 4K7UA 3WAMA 3QARA 4G11A 2LJ5A 2NCNA 4WJPA 2LRWA 3S2AA 3RCZA 4FULA 3KUZA 2MBBB 1WI0A 4II3B 3RULA 2IY0B 4JGHB 4GU2A 2CHXA 3CSFA 5D94A 5KHOA 2K8BA 1X1MA 3JSVA 2BKRB 2O2VA 1WJ6A 4NJ6A 2ZNVC 4I6NB 4CYEA 1WMHB 4IM3A 2JZ3B 1S3SG 1UD7A 2KZRA 2LI5A 2M1MA 2D07B 4EOYA 2K6QA 2ZCCA 2PE6B 4M8MA 1YD8U 1YIWA 4NAWA 3T8MA 2RGFA 1J0GA 1WE7A 1Y8RC 2DZKA 3ZDMC 2LWPA 3KYCD 2YVCA 4E71A 5G2NA 3UIPB 4W9FA 4MGZE 4HXDA 2EMTA 4BBNF 3QJZA 4MM3A 5CHVC 3H6NA 3JW0X 2KLGA 3ZTCA 4RM8A 3DBHI 2KMCA 4FJVB 1LM8B 1WXAA 5BO4B 3Q3FA 4AJYB 3DBLI 5D6JB 4A3PA 4F8CB 3ML9A 2AEHA 4WWOA 4GDLB 3PPAA 1WX7A 4MGKE 3DVGY 2HJ8A 3ZLZA 2MQJA 3PRZA 4KIKB 3UQAA 4LCDE 3VDZA 3ZNGC 3VAWA 5EDSA 3ZNHB 4NNJB 2C7HA 2KK8A 4KV2A 1UBQA 1WGDA 3QAQA 2CR5A 1OEYJ 4BFRA 3X23A 1WR1A 3K9OB 3WIMA 4NJ7A 2G4SA 5GMVA 4MGIE 2KO3A 2KFJA 1J19A 2UYZB 3A1QB 4RM9A 2REXA 4ZRKA 3L17A 3PSEB 4PYZA 5E6PA 3NZSA 4BKGA 2D3GA 5E6NA 2L0TA 4MGYE 2D2QA 4KDIC 1IP9A 4HDOA 2BYVE 4AUQC 2ZZPB 1OTRB 4A3OA 1F9JA 2KDIA 3SDLC 2IYDB 2KJ6A 2DHZA 2KDEB 3PS6A 3TIXA 5JH5C 4GN1A 2J7QB 2XK5A 1V9JA 2K8CA 3IBEA 3M63B 3RD2A 3VXWA 3ZRCA 2W9NA 1UZXB 2N7DA 2FIDA 4FLHA 4K7SA 1MG8A 2JY6A 2FAZA 3TCAA 4EFOA 5AEKB 2C7MB 3DCGA 2O2VB 4AWJA 4TQ0A 4J6IA 2KJRA 1TTNA 2GBRA 4K7WA 2Y5BB 2G3QB 3PVLA 4NPNA 2JXXA 2L76A 3DVGX 1E7VA 4XC2A 3IFWB 1Z5SB 4BBNC 4TV3A 1XD3B 1EF5A 3VUXA 4WWPA 5AZFA 4DHJB 4EZLA 1RRBA 1V6EA 2JVCA 4GXBA 4XZ4A 2O6VD 5DCNA 4BOSC 3CF6E 5DPWA 3N32A 4DK5A 3R66C 4W9EA 1T0YA 1KM7A 1Q1OA 4G0NB 1EUVB 1E5WA 1LFDA 4JQWC 4KZCA 3L13A 2KDBA 1LQBA 4GSWA 4GB9A 4JL9A 3UGBB 3VQIA 2KVRA 3TBLD 2KHWB 3DOWA 4RMAA 1I35A 4EKUA 3A9JA 3DVNV 2Z0EB 2N9EB 3APDA 4FJZA 1M94A 4IUMB 4ANWA 1JRUA 4OVUA 2MBOA 4AOFA 3WALA 3H9DA 2PPHA 4EZKA 1WJUA 2EKEC 2BF8B 3C0RB 3APFA 3L16A 3ZNZB 3PGEA 3L0WB 3QX1A 3ALBA 4YL8A 4ZRJA 2I1KA 2OOBB 4KDLB 2LZ6A 2KX3A 4BVUC 3N3KB 4G50A 1Z2MA 2CKHB 4PS7A 1GC6A 2DX5B 1S1QB 2BYEA 2UWQA 4PYUA 1WYWB 3P2BA 1IYFA 1NI2A 4HPMB 4E3CA 1RFAA 1BT0A 3ZTDA 4WAAA 2KQ7A 3TMPB 1SIFA 3V60A 2MX2A 2MWSB 4P7IA 2NBVB 2ZPYA 4TQ1A 3WAPA 5G55A 1NDDA 1WZ3A 2KC1A 2VRRB 4FHJA 1P9DU 3KH0A 2GBKA 4N9F4 2MA9B 1C3TA 1WF9A 2FCQA 3Q3JA 3RZWC 2NR2A 2KWVB 1TBEA 2KMAA 2LD9A 4FJYA 2MRPA 3DVNU 1WR6E 2KXJA 4GDKA 1WX9A 4W9IA 3X0WA 2JF5A 2KQSA 4TKNA 4NQKE 3AU5A 4FADA 5J18A 3VVWB 4LDTB 3OAWA 2WYQA 4WWNA 3CSTA 4G3XB 3QA8A 2MBQA 5D2MB 1V5OA 1WXMA 5J2RA 1WH3A 3UIOB 4HLEA 2NPTA 2L3ZA 3W1YA 1GJZA 3QQ8B 4BKSD 2KFKA 4IC7B 2N9XA 3ZNID 3L08A 1OEYA 3CMMB 1WRDB 1E8ZA 3PZDA 3PRMB 2K6DB 3M95A 2RPQA 4ANVA 1K8RB 4DDGD 3OLMD 4PS3A 1GUAB 2DAJA 3R3MA 4IG7B 3PLVA 1OQYA 1FXTB 4II2B 3DBRI 2DZIA 4JIOU 4CO7A 4W9GA 3PTFC 2DYBA 2IBIB 4X57B 2OJRA 3I3TB 4F1SA 4IM2A 4BOZB 4W9CA 5FR6A 2DYOA 3NHEB 3H7SA 2K25A 4TUUA 1R4NI 1E8YA 1D3ZA 4HDQA 2L0FA 3DPDA 3EHVA 4W9DA 3APCA 4BKTA 3LDZE 3AU4A 4WJOA 1GC7A 2LGYA 3PLUA 1G6JA 1E8WA 4EZJA 1CMXB 2JRHA 2O6VA 2DYMA 3HM6X 4ICUA 4DWFA 3EC8A 2GBNA 5CTRC 3B0AA 3VFKA 2A4ZA 2LRUA 4DHJD 2GBMA 2ZNVB 2KD0A 1A5RA 4A20A 4ANUA 2BGFA 1GNUA 2MBEA 1V86A 2K39A 3IHPC 2PJHA 3JSVB 4XX5A 2IY1B 1ZKHA 3KYDD 3NY5A 4IWPA 1TZ1A 2K8HA 1WGRA 4WJQA 2AWTA 3PRPB 1KLVA 1YX6B 3V61A 3VH3B 3QCAA 2ZPNA 2J0MA 4FN2A 4GDKB 2NBWB 1V49A 1WXSA 2R2QA 4MH0E 4HCPB 1V80A 1WJ4A 3H1UA 1Q0WB 4NAWB 2MCNB 4LJOB 3AULA 1WJNA 2IO2B 3KW5B 2JWZA 2RSUA 2R2OA 2FCSA 4HVBA 5HKHA 4I6LB 3R7RA 3VUWA 1WMHA 2WDTB 4IM0A 2YLMA 2NPTB 5LXHA 1WGYA 4W9HA 2PE9A 1YQBA 4IWQA 2KFKB 2KX0A 2HD5B 3KVFB 3O65B 1ZW7A 4HWIB 3VUYA 2JRIB 5CX3A 4KSLC 3PHXB 4MSMB 3UQBA 2FCMA 4ZRIA 2WWZA 2ZVNA 1H4RA 2LXAA 4B9KA 2J0KA 4FA6A 1L7YA 3B08A 2MLBA 4DHZB 1P1AA 2L7RA 3NOBA 2LVPA 4HJKA 5IAAC 3RUIB 1H8CA 4MDKE 3RYTA 4E74A 3WA0A 5CHFA 4DDID 3JVZX 2KLCA 4NY0A 3SHQA 2BYFA 2AYOB 2O6VB 2CHWA 2C60A 2KOXA 2ZEQA 3A9KA 2K1FA 3ECIA 3VH4B 4B6WA 1WX8A 4CHKA 2M0XA 3M3JA 3A4SC 2XK5B 5JHBA 2BWES 5L95C 3W1SA 3ZO5B 4DHZE 1WGGA 3AI5A 1U4AA 3V62A 4IW0A 5DPRA 2IO0B 3JYUA 1WM3A 4GIVA 4MELA 3R7QA 5KHQA 2DAFA 2M8SA 1WFYA 1RLFA 3TL5A 2XEWA 3QIJA 1V81A 3PREA 3U30A 3W1SC 2BKFA 3D32A 3ZVVA 4M8NA 2N7EA 2IO3B 1P3QU 2DZMA 2N4FA 1EO6A 3MJWA 2LVQA 3VTWA 1XQQA 2C9WB 5CHWA 2BPSA 5IA7A 2HTHA 4FBJB 1E90A 3U8ZA 1KOTA 4MSQB 2KJHB 2D10A 1WY8A 4EEWA 3BINA 1HE8A 4FHKA 2KTRA 3K9PB 1SE9A 2I1JA 5DPSA 2M4NA 5LXIB 1L2NA 1GG3A 3A4RA 4KZ0A 3A9JB 3NS8A 2LXCA 4B95A 2LVOA 1UGMA 3EFUA 4ZDVA 1P98A 5E6OA 1IPGA 3RZFA 3T9LA 4HPLB 2V4LA 3MHSD 1J8CA 4K1RB 3QK0A 2FNJB 1QZEA 3HK0A 2ZVOA 4ANXA 3NZUA 2KWUB 1UH6A 3ZKJC 2LASA 1R4MI 2JUOA 2M17A 3ONSA 2FIFA 3WAOA 3ZW3A 3VTUA 1YJ1A 3ZIMA 3H7PA 3SD5A 3MTNB 2BWFA 3HM3A 4URKA 1WGHA 1WM2A 4AJWA 1NBFC 3L54A 2KKCA 3V6CB 1VCBA 2MBHA 2KTFA 2L8JA 4GOCA 2LUEA 4W9LA 2G4DB 2IO1B 4MEMA 1V2YA 4DXAB 2KDFB 3HIZA 3DBSA 2MP2A 1UELA 3A9KB 4KSKC 3PT2B 1RAXA 2AL3A 4LJPB 2GBJA 3GZNI 1P0RA 2Z0DB 1E8XA 2L00B 3RT3B 1Q5WB 3QWZB 3U7DA 3OJ3A 4M0WB 2NS5A 1LXDA 2MW5A 3GOEA 4MJSA 4WQOB 4KVGB 2ZJDA 4HCNB 2QHOA 4GMVA 2JT4B 1OGWA 1ISNA 1AARA 2KNBA 4I6PA 4JLCA 4NQLB 1UBIA 3SU8X 3VTVA 2DENB 2JPHA 3KUDB 5AZGA 2LGDA 2CU1A 3IG3A 1E7UA 2WX0A 4W9KA 2NBUA 3ENEA 4OVVA 3ML8A 3TJPA 3KUCB 4HK2A 2IZVB 2D11A 2ASQA 2GOWA 1KJTA 1WE6A 1WZ0A 2JZZA 2ZCBA 3DQVA 3LJ3A 4ICVA 4K81A 3VHTC 4DBGA 3OJ4B 2FCNA 1V5TA 2N9PC 2XBBC 2MSED 5TR5A 2HE7A 2KTRB 5J17A 5DPTA 4F7ZA 1I42A 3L10B 2Z59B 2KWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD2 A;  3UIN B;  3EEC A;  1ZGU B;  2V3S A;  3AXC A;  5AZH A;  1WIA A;  2KAN A;  2PEA A;  2C7N B;  1EF1 A;  3B1L X;  4AP4 C;  1WXV A;  2FUH B;  3ZUN A;  5C23 A;  4IWO A;  1SGH A;  1YX5 B;  2KC2 A;  3QC8 B;  3PV1 A;  3IVF A;  2AL6 A;  4W9J A;  4ASW C;  3DDC B;  2L05 A;  3BY4 B;  2RR9 A;  2CS4 A;  2J0J A;  3WAN A;  3UF8 A;  4EUT A;  2RD0 A;  3ZRF A;  2GMI C;  4GDL A;  3H7P B;  2B3A A;  3QHT A;  4KIK A;  3N30 A;  3V6E B;  5L83 A;  2EMS A;  4LDT D;  5JHA A;  5C1Z A;  3ZDT A;  5D7G A;  3PHW B;  2WX1 A;  2KN5 A;  1PQS A;  2MP2 B;  5LLI A;  5JZE B;  2A5U A;  2DZJ A;  4BKS A;  2V1Y A;  1TGZ B;  2N1V A;  2N1W A;  3A33 B;  3M62 B;  4GGQ A;  3HHM A;  4PS8 A;  1C1Y B;  2G45 B;  2C5L C;  1XT9 B;  2CHZ A;  4WJN A;  4ZYN A;  3A1Q A;  2LGX A;  4MJS B;  2NVU I;  4K7U A;  3WAM A;  3QAR A;  4G11 A;  2LJ5 A;  2NCN A;  4WJP A;  2LRW A;  3S2A A;  3RCZ A;  4FUL A;  3KUZ A;  2MBB B;  1WI0 A;  4II3 B;  3RUL A;  2IY0 B;  4JGH B;  4GU2 A;  2CHX A;  3CSF A;  5D94 A;  5KHO A;  2K8B A;  1X1M A;  3JSV A;  2BKR B;  2O2V A;  1WJ6 A;  4NJ6 A;  2ZNV C;  4I6N B;  4CYE A;  1WMH B;  4IM3 A;  2JZ3 B;  1S3S G;  1UD7 A;  2KZR A;  2LI5 A;  2M1M A;  2D07 B;  4EOY A;  2K6Q A;  2ZCC A;  2PE6 B;  4M8M A;  1YD8 U;  1YIW A;  4NAW A;  3T8M A;  2RGF A;  1J0G A;  1WE7 A;  1Y8R C;  2DZK A;  3ZDM C;  2LWP A;  3KYC D;  2YVC A;  4E71 A;  5G2N A;  3UIP B;  4W9F A;  4MGZ E;  4HXD A;  2EMT A;  4BBN F;  3QJZ A;  4MM3 A;  5CHV C;  3H6N A;  3JW0 X;  2KLG A;  3ZTC A;  4RM8 A;  3DBH I;  2KMC A;  4FJV B;  1LM8 B;  1WXA A;  5BO4 B;  3Q3F A;  4AJY B;  3DBL I;  5D6J B;  4A3P A;  4F8C B;  3ML9 A;  2AEH A;  4WWO A;  4GDL B;  3PPA A;  1WX7 A;  4MGK E;  3DVG Y;  2HJ8 A;  3ZLZ A;  2MQJ A;  3PRZ A;  4KIK B;  3UQA A;  4LCD E;  3VDZ A;  3ZNG C;  3VAW A;  5EDS A;  3ZNH B;  4NNJ B;  2C7H A;  2KK8 A;  4KV2 A;  1UBQ A;  1WGD A;  3QAQ A;  2CR5 A;  1OEY J;  4BFR A;  3X23 A;  1WR1 A;  3K9O B;  3WIM A;  4NJ7 A;  2G4S A;  5GMV A;  4MGI E;  2KO3 A;  2KFJ A;  1J19 A;  2UYZ B;  3A1Q B;  4RM9 A;  2REX A;  4ZRK A;  3L17 A;  3PSE B;  4PYZ A;  5E6P A;  3NZS A;  4BKG A;  2D3G A;  5E6N A;  2L0T A;  4MGY E;  2D2Q A;  4KDI C;  1IP9 A;  4HDO A;  2BYV E;  4AUQ C;  2ZZP B;  1OTR B;  4A3O A;  1F9J A;  2KDI A;  3SDL C;  2IYD B;  2KJ6 A;  2DHZ A;  2KDE B;  3PS6 A;  3TIX A;  5JH5 C;  4GN1 A;  2J7Q B;  2XK5 A;  1V9J A;  2K8C A;  3IBE A;  3M63 B;  3RD2 A;  3VXW A;  3ZRC A;  2W9N A;  1UZX B;  2N7D A;  2FID A;  4FLH A;  4K7S A;  1MG8 A;  2JY6 A;  2FAZ A;  3TCA A;  4EFO A;  5AEK B;  2C7M B;  3DCG A;  2O2V B;  4AWJ A;  4TQ0 A;  4J6I A;  2KJR A;  1TTN A;  2GBR A;  4K7W A;  2Y5B B;  2G3Q B;  3PVL A;  4NPN A;  2JXX A;  2L76 A;  3DVG X;  1E7V A;  4XC2 A;  3IFW B;  1Z5S B;  4BBN C;  4TV3 A;  1XD3 B;  1EF5 A;  3VUX A;  4WWP A;  5AZF A;  4DHJ B;  4EZL A;  1RRB A;  1V6E A;  2JVC A;  4GXB A;  4XZ4 A;  2O6V D;  5DCN A;  4BOS C;  3CF6 E;  5DPW A;  3N32 A;  4DK5 A;  3R66 C;  4W9E A;  1T0Y A;  1KM7 A;  1Q1O A;  4G0N B;  1EUV B;  1E5W A;  1LFD A;  4JQW C;  4KZC A;  3L13 A;  2KDB A;  1LQB A;  4GSW A;  4GB9 A;  4JL9 A;  3UGB B;  3VQI A;  2KVR A;  3TBL D;  2KHW B;  3DOW A;  4RMA A;  1I35 A;  4EKU A;  3A9J A;  3DVN V;  2Z0E B;  2N9E B;  3APD A;  4FJZ A;  1M94 A;  4IUM B;  4ANW A;  1JRU A;  4OVU A;  2MBO A;  4AOF A;  3WAL A;  3H9D A;  2PPH A;  4EZK A;  1WJU A;  2EKE C;  2BF8 B;  3C0R B;  3APF A;  3L16 A;  3ZNZ B;  3PGE A;  3L0W B;  3QX1 A;  3ALB A;  4YL8 A;  4ZRJ A;  2I1K A;  2OOB B;  4KDL B;  2LZ6 A;  2KX3 A;  4BVU C;  3N3K B;  4G50 A;  1Z2M A;  2CKH B;  4PS7 A;  1GC6 A;  2DX5 B;  1S1Q B;  2BYE A;  2UWQ A;  4PYU A;  1WYW B;  3P2B A;  1IYF A;  1NI2 A;  4HPM B;  4E3C A;  1RFA A;  1BT0 A;  3ZTD A;  4WAA A;  2KQ7 A;  3TMP B;  1SIF A;  3V60 A;  2MX2 A;  2MWS B;  4P7I A;  2NBV B;  2ZPY A;  4TQ1 A;  3WAP A;  5G55 A;  1NDD A;  1WZ3 A;  2KC1 A;  2VRR B;  4FHJ A;  1P9D U;  3KH0 A;  2GBK A;  4N9F 4;  2MA9 B;  1C3T A;  1WF9 A;  2FCQ A;  3Q3J A;  3RZW C;  2NR2 A;  2KWV B;  1TBE A;  2KMA A;  2LD9 A;  4FJY A;  2MRP A;  3DVN U;  1WR6 E;  2KXJ A;  4GDK A;  1WX9 A;  4W9I A;  3X0W A;  2JF5 A;  2KQS A;  4TKN A;  4NQK E;  3AU5 A;  4FAD A;  5J18 A;  3VVW B;  4LDT B;  3OAW A;  2WYQ A;  4WWN A;  3CST A;  4G3X B;  3QA8 A;  2MBQ A;  5D2M B;  1V5O A;  1WXM A;  5J2R A;  1WH3 A;  3UIO B;  4HLE A;  2NPT A;  2L3Z A;  3W1Y A;  1GJZ A;  3QQ8 B;  4BKS D;  2KFK A;  4IC7 B;  2N9X A;  3ZNI D;  3L08 A;  1OEY A;  3CMM B;  1WRD B;  1E8Z A;  3PZD A;  3PRM B;  2K6D B;  3M95 A;  2RPQ A;  4ANV A;  1K8R B;  4DDG D;  3OLM D;  4PS3 A;  1GUA B;  2DAJ A;  3R3M A;  4IG7 B;  3PLV A;  1OQY A;  1FXT B;  4II2 B;  3DBR I;  2DZI A;  4JIO U;  4CO7 A;  4W9G A;  3PTF C;  2DYB A;  2IBI B;  4X57 B;  2OJR A;  3I3T B;  4F1S A;  4IM2 A;  4BOZ B;  4W9C A;  5FR6 A;  2DYO A;  3NHE B;  3H7S A;  2K25 A;  4TUU A;  1R4N I;  1E8Y A;  1D3Z A;  4HDQ A;  2L0F A;  3DPD A;  3EHV A;  4W9D A;  3APC A;  4BKT A;  3LDZ E;  3AU4 A;  4WJO A;  1GC7 A;  2LGY A;  3PLU A;  1G6J A;  1E8W A;  4EZJ A;  1CMX B;  2JRH A;  2O6V A;  2DYM A;  3HM6 X;  4ICU A;  4DWF A;  3EC8 A;  2GBN A;  5CTR C;  3B0A A;  3VFK A;  2A4Z A;  2LRU A;  4DHJ D;  2GBM A;  2ZNV B;  2KD0 A;  1A5R A;  4A20 A;  4ANU A;  2BGF A;  1GNU A;  2MBE A;  1V86 A;  2K39 A;  3IHP C;  2PJH A;  3JSV B;  4XX5 A;  2IY1 B;  1ZKH A;  3KYD D;  3NY5 A;  4IWP A;  1TZ1 A;  2K8H A;  1WGR A;  4WJQ A;  2AWT A;  3PRP B;  1KLV A;  1YX6 B;  3V61 A;  3VH3 B;  3QCA A;  2ZPN A;  2J0M A;  4FN2 A;  4GDK B;  2NBW B;  1V49 A;  1WXS A;  2R2Q A;  4MH0 E;  4HCP B;  1V80 A;  1WJ4 A;  3H1U A;  1Q0W B;  4NAW B;  2MCN B;  4LJO B;  3AUL A;  1WJN A;  2IO2 B;  3KW5 B;  2JWZ A;  2RSU A;  2R2O A;  2FCS A;  4HVB A;  5HKH A;  4I6L B;  3R7R A;  3VUW A;  1WMH A;  2WDT B;  4IM0 A;  2YLM A;  2NPT B;  5LXH A;  1WGY A;  4W9H A;  2PE9 A;  1YQB A;  4IWQ A;  2KFK B;  2KX0 A;  2HD5 B;  3KVF B;  3O65 B;  1ZW7 A;  4HWI B;  3VUY A;  2JRI B;  5CX3 A;  4KSL C;  3PHX B;  4MSM B;  3UQB A;  2FCM A;  4ZRI A;  2WWZ A;  2ZVN A;  1H4R A;  2LXA A;  4B9K A;  2J0K A;  4FA6 A;  1L7Y A;  3B08 A;  2MLB A;  4DHZ B;  1P1A A;  2L7R A;  3NOB A;  2LVP A;  4HJK A;  5IAA C;  3RUI B;  1H8C A;  4MDK E;  3RYT A;  4E74 A;  3WA0 A;  5CHF A;  4DDI D;  3JVZ X;  2KLC A;  4NY0 A;  3SHQ A;  2BYF A;  2AYO B;  2O6V B;  2CHW A;  2C60 A;  2KOX A;  2ZEQ A;  3A9K A;  2K1F A;  3ECI A;  3VH4 B;  4B6W A;  1WX8 A;  4CHK A;  2M0X A;  3M3J A;  3A4S C;  2XK5 B;  5JHB A;  2BWE S;  5L95 C;  3W1S A;  3ZO5 B;  4DHZ E;  1WGG A;  3AI5 A;  1U4A A;  3V62 A;  4IW0 A;  5DPR A;  2IO0 B;  3JYU A;  1WM3 A;  4GIV A;  4MEL A;  3R7Q A;  5KHQ A;  2DAF A;  2M8S A;  1WFY A;  1RLF A;  3TL5 A;  2XEW A;  3QIJ A;  1V81 A;  3PRE A;  3U30 A;  3W1S C;  2BKF A;  3D32 A;  3ZVV A;  4M8N A;  2N7E A;  2IO3 B;  1P3Q U;  2DZM A;  2N4F A;  1EO6 A;  3MJW A;  2LVQ A;  3VTW A;  1XQQ A;  2C9W B;  5CHW A;  2BPS A;  5IA7 A;  2HTH A;  4FBJ B;  1E90 A;  3U8Z A;  1KOT A;  4MSQ B;  2KJH B;  2D10 A;  1WY8 A;  4EEW A;  3BIN A;  1HE8 A;  4FHK A;  2KTR A;  3K9P B;  1SE9 A;  2I1J A;  5DPS A;  2M4N A;  5LXI B;  1L2N A;  1GG3 A;  3A4R A;  4KZ0 A;  3A9J B;  3NS8 A;  2LXC A;  4B95 A;  2LVO A;  1UGM A;  3EFU A;  4ZDV A;  1P98 A;  5E6O A;  1IPG A;  3RZF A;  3T9L A;  4HPL B;  2V4L A;  3MHS D;  1J8C A;  4K1R B;  3QK0 A;  2FNJ B;  1QZE A;  3HK0 A;  2ZVO A;  4ANX A;  3NZU A;  2KWU B;  1UH6 A;  3ZKJ C;  2LAS A;  1R4M I;  2JUO A;  2M17 A;  3ONS A;  2FIF A;  3WAO A;  3ZW3 A;  3VTU A;  1YJ1 A;  3ZIM A;  3H7P A;  3SD5 A;  3MTN B;  2BWF A;  3HM3 A;  4URK A;  1WGH A;  1WM2 A;  4AJW A;  1NBF C;  3L54 A;  2KKC A;  3V6C B;  1VCB A;  2MBH A;  2KTF A;  2L8J A;  4GOC A;  2LUE A;  4W9L A;  2G4D B;  2IO1 B;  4MEM A;  1V2Y A;  4DXA B;  2KDF B;  3HIZ A;  3DBS A;  2MP2 A;  1UEL A;  3A9K B;  4KSK C;  3PT2 B;  1RAX A;  2AL3 A;  4LJP B;  2GBJ A;  3GZN I;  1P0R A;  2Z0D B;  1E8X A;  2L00 B;  3RT3 B;  1Q5W B;  3QWZ B;  3U7D A;  3OJ3 A;  4M0W B;  2NS5 A;  1LXD A;  2MW5 A;  3GOE A;  4MJS A;  4WQO B;  4KVG B;  2ZJD A;  4HCN B;  2QHO A;  4GMV A;  2JT4 B;  1OGW A;  1ISN A;  1AAR A;  2KNB A;  4I6P A;  4JLC A;  4NQL B;  1UBI A;  3SU8 X;  3VTV A;  2DEN B;  2JPH A;  3KUD B;  5AZG A;  2LGD A;  2CU1 A;  3IG3 A;  1E7U A;  2WX0 A;  4W9K A;  2NBU A;  3ENE A;  4OVV A;  3ML8 A;  3TJP A;  3KUC B;  4HK2 A;  2IZV B;  2D11 A;  2ASQ A;  2GOW A;  1KJT A;  1WE6 A;  1WZ0 A;  2JZZ A;  2ZCB A;  3DQV A;  3LJ3 A;  4ICV A;  4K81 A;  3VHT C;  4DBG A;  3OJ4 B;  2FCN A;  1V5T A;  2N9P C;  2XBB C;  2MSE D;  5TR5 A;  2HE7 A;  2KTR B;  5J17 A;  5DPT A;  4F7Z A;  1I42 A;  3L10 B;  2Z59 B;  2KWC A; 
#chains in the Genus database with same CATH topology
 1VD2 A;  1HTQ A;  3B2G A;  1JWU D;  1PGB A;  2PEA A;  2C7N B;  4AP4 C;  1WXV A;  2WNM A;  4IWO A;  2AQ2 B;  5IO9 A;  2NMQ A;  4HEA 1;  2IGG A;  3DDC B;  3LXF A;  3EA6 A;  1ZUD 2;  4EUT A;  5BMG A;  3V6E B;  4XDD A;  3ZDT A;  1PQS A;  2A5U A;  3Q6B A;  2WDV B;  1N5X A;  2G45 B;  2C5L C;  4YTN B;  3A1Q A;  2DNF A;  1QOA A;  2NVU I;  4K7U A;  3WAM A;  2WHI A;  2QCZ A;  2EEL A;  1C4C A;  2MBB B;  1CJE A;  3GE8 C;  4JGH B;  5KHO A;  3Q8C A;  5H8Y E;  4RCO A;  2HJ1 A;  2BVC A;  2ZNV C;  5AUK A;  1WMH B;  1UD7 A;  3E9S A;  1V1P B;  1MFW A;  1JQ4 A;  2KMM A;  3ZDM C;  2YVC A;  1ESF A;  5G2N A;  4AS1 A;  4MGZ E;  4HXD A;  3QJZ A;  4MM3 A;  2KLG A;  2QEJ C;  4FJV B;  1LM8 B;  1WXA A;  5BO4 B;  3Q3F A;  2BS2 B;  5D6J B;  3RNF C;  4WWO A;  2IGD A;  3U2S C;  3DVG Y;  3UQA A;  3DBL B;  3ZNG C;  3VAW A;  3RMK C;  2C7H A;  2KK8 A;  2AX5 A;  4ZHO A;  1ACC A;  4BFR A;  2G4S A;  2KWD A;  2KFJ A;  3U4E G;  2REX A;  4N58 A;  4PYZ A;  5E6P A;  3NZS A;  4BKG A;  2D3G A;  4KDI C;  1MJD A;  1IP9 A;  4HDO A;  2BYV E;  1OTR B;  4A3O A;  3SDL C;  2KJ6 A;  2KDE B;  3HVZ A;  2J7Q B;  4Q2J A;  1V9J A;  3IBE A;  3VXW A;  3ZRC A;  2JY6 A;  3TCA A;  5AEK B;  3DCG A;  2O2V B;  4AWJ A;  2FE8 A;  4TMA B;  4HRS A;  2Y5B B;  1AN8 A;  2JXX A;  2L76 A;  1Z5S B;  2WGS A;  3DWM A;  1PGX A;  4WWP A;  1V6E A;  4GXB A;  4XZ4 A;  1T0Y A;  3VR9 B;  4G0N B;  5BMH A;  4K3B A;  1MI0 A;  4KZC A;  3AED B;  4GSW A;  4JL9 A;  3VQI A;  3A9J A;  3HRD D;  1L5P A;  2MBO A;  1HZ6 A;  3H9D A;  2PPH A;  1WJU A;  3C0R B;  1YJJ A;  3QX1 A;  2LFI A;  2KQ4 X;  3P4S B;  2CKH B;  3L4P A;  2BYE A;  4PYU A;  1NI3 A;  4E3C A;  4QAY A;  3IAM 1;  1SIF A;  3RNB C;  4P7I A;  2ZPY A;  2L32 A;  5T8I A;  3WAP A;  1JML A;  1NDD A;  1WZ3 A;  2KN4 A;  3KH0 A;  2MA9 B;  2FCQ A;  3Q3J A;  3RZW C;  2NR2 A;  4FUL A;  1I4H A;  2MRP A;  1WR6 E;  1KLU D;  3I5J C;  4NQK E;  4ZRP A;  1JWS D;  1NYR A;  1JCK B;  1WXM A;  1WH3 A;  2OED A;  3UIO B;  2M56 B;  2NPT A;  3H8H A;  1GJZ A;  4P1C C;  2LUM A;  3L08 A;  3NVW A;  1OEY A;  3CMM B;  1SB3 C;  3AEE B;  1K8R B;  4PS3 A;  1ET9 A;  2DAJ A;  3R3M A;  3PLV A;  4XE0 A;  4JIO U;  4W9G A;  1T0R C;  3W5U B;  4BOZ B;  3NS1 A;  4TUU A;  2L0F A;  3EHV A;  3APC A;  1FNU A;  4BKT A;  3AU4 A;  1G6J A;  4EZJ A;  4REZ A;  2JRH A;  4ICU A;  4DWF A;  1FPY A;  4DHJ D;  2KD0 A;  4ANU A;  2BGF A;  2K39 A;  2PJH A;  3CWI A;  1FXI A;  2BS4 B;  1FXA A;  2ZW1 A;  2K8H A;  4WJQ A;  2INC C;  4XYC A;  3PRP B;  2JYT A;  3MP9 A;  3VH3 B;  3QCA A;  1IBX B;  2ZPN A;  4GDK B;  2NBW B;  1ENF A;  1F52 A;  3H1U A;  1TS4 A;  4LJO B;  1WJN A;  2IO2 B;  3W9C B;  2K0P A;  2BYT A;  2RSU A;  2FCS A;  4HVB A;  3C8Y A;  4I6L B;  3VUW A;  1MG4 A;  4LNO A;  2PE9 A;  4RGO S;  1YQB A;  4O1N A;  4IWQ A;  2KX0 A;  1XLN A;  2L1A A;  3O65 B;  1ZW7 A;  3P4R B;  3TEX A;  5EE1 A;  4KSL C;  3PHX B;  1I4P A;  2WWZ A;  2ZVN A;  4WQM A;  3ZXV A;  4B9K A;  2J0K A;  3AE3 B;  1P1A A;  4YT0 B;  3VR8 B;  3NOB A;  2LVP A;  1EWY C;  5IAA C;  3Q2A C;  3RYT A;  5CHF A;  3JVZ X;  3PO0 A;  2O6V B;  1WX8 A;  3A4S C;  2XK5 B;  3Q3N C;  3R2I A;  4WAF A;  4GIV A;  5KHQ A;  4C4V B;  3TL5 A;  3QIJ A;  3U30 A;  2QDF A;  4M8N A;  3MJW A;  1XQQ A;  1XF5 L;  2BPS A;  5IA7 A;  1OQQ A;  2HTH A;  1KFY B;  4FBJ B;  2GLS A;  1KOT A;  2KJH B;  1D5Z C;  4C7Y A;  1IUE A;  2X8X X;  1HE8 A;  3K9P B;  1TJE A;  1SF0 A;  5LXI B;  1L2N A;  1GG3 A;  2PVG C;  1EWC A;  4B95 A;  1UGM A;  1TY0 A;  4YSX B;  2MHJ A;  4WWM A;  3QK0 A;  4KKI A;  3N1X C;  3NZU A;  2KAJ A;  2KWU B;  1RFK A;  2KDM A;  1R4M I;  2FIF A;  3WAO A;  1YJ1 A;  3ZIM A;  1WM2 A;  1NBF C;  3L54 A;  2KKC A;  2MBH A;  2KTF A;  2L8J A;  4GOC A;  2KVZ A;  2FBW B;  3DBS A;  3ZJV A;  1UEL A;  4KSK C;  3PT2 B;  1RAX A;  2E6X A;  3Q8B A;  3GZN I;  3RT3 B;  2WXK A;  4M0W B;  1LXD A;  2MW5 A;  4MJS A;  1TKY A;  2WXF A;  4KVG B;  4HCN B;  2LMC A;  3HUI A;  4OZB A;  2V0G A;  4KKJ A;  1AAR A;  4JLC A;  2JPH A;  2V3P A;  2WX0 A;  4OVV A;  3C19 A;  1KH0 A;  3KUC B;  4DQO C;  2ASQ A;  2GOW A;  1KJT A;  2JZZ A;  1WZ0 A;  3LJ3 A;  3VHT C;  3ZQ4 A;  4DBG A;  2MEK A;  2FCN A;  3Q69 A;  5J17 A;  2HE7 A;  2KTR B;  2IO0 B;  2IGH A;  4ITK A;  1WWT A;  5AZH A;  1EF1 A;  3ZUN A;  2FUH B;  1N6Z A;  3AB5 A;  5C23 A;  1L0V B;  3MHZ A;  1JW9 D;  1SSN A;  1F2R C;  3BY4 B;  2J0J A;  2RD0 A;  4GDL A;  2ICI A;  2BTE A;  1ZPS A;  3N9Y C;  3QHT A;  1C76 A;  4J3O D;  5JHA A;  4WUR A;  4RGN A;  1TS2 A;  2K3U A;  4OVZ A;  5D7G A;  2WX1 A;  5JZE B;  3KWL A;  4BKS A;  1YJI A;  3AE4 B;  2HDE A;  1FRD A;  4GGQ A;  3HHM A;  1PFD A;  4LK0 M;  1XT9 B;  4ZYN A;  2LGX A;  1LGR A;  2NCN A;  2PVO D;  4YSY B;  2LRW A;  3RCZ A;  4S17 A;  4B0M A;  3E56 A;  4II3 B;  1JWM D;  3RPF C;  1FD6 A;  2K8B A;  1X1M A;  3JSV A;  1EU4 A;  4L23 A;  2WXP A;  2X38 A;  2M1M A;  4EOY A;  2BT6 A;  2ZCC A;  4M8M A;  1V97 A;  1YD8 U;  4NAW A;  4OZA A;  3T8M A;  1WE7 A;  2PIA A;  2PMV A;  2GB1 A;  3EFC A;  1XCQ L;  5CHV C;  3ZTC A;  4RM8 A;  5HHD G;  1L4D B;  3DBL I;  4A3P A;  4F8C B;  3RFZ B;  2AEH A;  3DBH B;  2D3C A;  1A70 A;  1NVI D;  2MQJ A;  5BYS A;  1V8C A;  3Q8F A;  3VDZ A;  5EDS A;  3ZNH B;  5BYR A;  1UBQ A;  3QAQ A;  2XN9 C;  1WR1 A;  3K9O B;  5GMV A;  1K51 A;  1J19 A;  3A1Q B;  4RM9 A;  3SR6 A;  3L17 A;  2V3N A;  2L0T A;  4P1B C;  3VRB B;  4AUQ C;  5JH5 C;  2IYD B;  3AEF B;  3PS6 A;  5JXV A;  2K8C A;  3RD2 A;  1TIF A;  2N7D A;  4K7S A;  4US9 A;  2FAZ A;  1I4G A;  1ZXH A;  4IKG A;  4TQ0 A;  4J6I A;  2KJR A;  2GBR A;  4K7W A;  2WU5 B;  2G3Q B;  3RNE C;  1FFU A;  3DVG X;  1E7V A;  3IFW B;  4TV3 A;  2OHF A;  1D6E C;  1I4Q A;  1ZE3 D;  5EE0 A;  3VUX A;  1DOX A;  1GB1 A;  4DHJ B;  2WXM A;  1RRB A;  2JVC A;  4BOS C;  4YSZ B;  2O6V D;  3R66 C;  1KM7 A;  1Q1O A;  1EUV B;  1E5W A;  3NVV A;  3L13 A;  1BXT A;  1E0Z A;  2QIL A;  2IDY A;  2KDB A;  4MM3 B;  5FK9 C;  1VJK A;  1T6B X;  2KVR A;  5FKA C;  2KHW B;  3DOW A;  1HQR D;  4EKU A;  3DVN V;  4XWT A;  1DOY A;  3ZJU A;  5EE9 A;  1M94 A;  1JRU A;  1N60 A;  4FXC A;  4B0E A;  4RFB A;  2BF8 B;  3ZNZ B;  3L0W B;  3ALB A;  4YL8 A;  1C78 A;  2JYE A;  2YEP F;  3MFG A;  2UU7 A;  3TEW A;  4KGT A;  4G50 A;  1Z2M A;  4ZRQ A;  2N9L A;  3P4P B;  1K50 A;  4A55 A;  3ZTD A;  1LO5 D;  3NJT A;  3TEY A;  2MX2 A;  3NVZ A;  2I2Y A;  5IP4 D;  2LGS A;  4MT5 A;  2QSD A;  3DHH C;  1WXQ A;  1P9D U;  4N9F 4;  1Y56 A;  1PYW D;  1TBE A;  2KMA A;  1TS3 A;  1F2R I;  3X0W A;  3BVZ A;  4W9I A;  1SE2 A;  4LDT B;  2JU6 X;  2WYQ A;  3OAW A;  5AUI A;  3AE7 B;  5IOI A;  3W1Y A;  2B76 B;  4BKS D;  2N9X A;  3V3X A;  3SFE B;  3MC9 A;  3RNA C;  2K6D B;  3M95 A;  3B9J A;  2RPQ A;  3RNG C;  3OLM D;  4IG7 B;  2DYB A;  2OJR A;  4IM2 A;  1BUI C;  2DYO A;  3NHE B;  2ON8 A;  3H7S A;  1YN5 A;  1D3Z A;  3DBR B;  2NTT A;  1BML C;  1WGK A;  4N59 A;  3DPD A;  4WJO A;  5CTR C;  3VFK A;  1A5R A;  2GBM A;  4A20 A;  1ZKH A;  3KYD D;  1JRO A;  3P1M A;  1VZ6 A;  3TSS A;  2MJ3 A;  2JX5 A;  4FN2 A;  2R2Q A;  1WXS A;  4LNN A;  4HCP B;  1T0S C;  2J53 A;  2R2O A;  1FCC C;  2IPK D;  3LB8 C;  1F77 A;  5EE3 A;  1N62 A;  1WMH A;  2H88 B;  2YLM A;  2NPT B;  1WYG A;  2HD5 B;  1J7A A;  3KVF B;  4HWI B;  1OFF A;  2WXL A;  1SXT A;  5CX3 A;  2WXO A;  3UQB A;  4ZRI A;  4FA6 A;  4L1B A;  2PLP A;  1ZP0 B;  4HJK A;  2ONQ A;  1GOZ A;  3RUI B;  1QT9 A;  4E74 A;  2KLC A;  2AYO B;  2CHW A;  2C60 A;  2KOX A;  2ZEQ A;  3A9K A;  2K1F A;  3NRZ A;  4B6W A;  5L95 C;  3AI5 A;  1TKE A;  3V62 A;  1T5X D;  4IW0 A;  3EUB 2;  1WM3 A;  4MEL A;  2WXH A;  1WFY A;  1RLF A;  3W1S C;  3D32 A;  2N7E A;  2DZM A;  2N4F A;  1EO6 A;  2LVQ A;  2INP E;  1D5X C;  1M4V A;  2EKI A;  3IAS 1;  1XLP A;  2BBC A;  2KYW A;  4MSQ B;  2D10 A;  4EEW A;  3Q8E A;  3BIN A;  1SE9 A;  2M4N A;  4KGR A;  3NS8 A;  2LVO A;  4ZDV A;  2V4I B;  3T9L A;  3MHS D;  4HJG E;  1L6V A;  3HK0 A;  2WXN A;  2MH7 A;  2M17 A;  1TKG A;  1K53 A;  3H7P A;  1GB4 A;  3HM3 A;  2DLB A;  2LUE A;  3AE8 B;  2KDF B;  3AE5 B;  3HIZ A;  2MP2 A;  2GI9 A;  4ACF A;  2AL3 A;  2Z0D B;  3LYY A;  2NS5 A;  5TSS A;  4JE3 B;  3TEZ A;  2ZJD A;  2K9X A;  1UF0 A;  4GMV A;  2JT4 B;  1ISN A;  2KNB A;  2LGI A;  1UBI A;  2WS3 B;  1XLQ A;  1SIJ A;  4W9K A;  2NBU A;  2D11 A;  4K81 A;  1HTO A;  1YNT E;  2YEP B;  1GPX A;  3L10 B;  2KWC A;  2XNA C;  1VZ8 A;  3UIN B;  3EEC A;  2V3S A;  3AXC A;  1RWS A;  1L4Z B;  1QOB A;  2KAN A;  3B1L X;  1ET6 A;  4M02 A;  2MJE A;  1FNV A;  1SGH A;  1TYG B;  1UGJ A;  1YX5 B;  4KX6 B;  2KC2 A;  2AL6 A;  4W9J A;  4ASW C;  2L05 A;  3UF8 A;  4D2K A;  2Y5C A;  3DHG C;  2B3A A;  4KIK A;  2BB6 A;  1N5W A;  2EMS A;  3VRA B;  4LDT D;  3AE1 B;  4XDC A;  3CIR B;  1E10 A;  3PHW B;  5G5G A;  2KN5 A;  5LLI A;  2J52 A;  2DZJ A;  2V1Y A;  1TGZ B;  2N1V A;  2N1W A;  3AE9 B;  3M62 B;  1C1Y B;  1JAL A;  4MJS B;  2BS3 B;  5C3J B;  2LJ5 A;  1TT5 B;  3S2A A;  4TSS A;  4R3D A;  3AEC B;  1WI0 A;  1D5M C;  2CHX A;  5D94 A;  5HG2 A;  1WJ6 A;  1SE3 A;  1DGJ A;  2OJW A;  4CYE A;  2JZ3 B;  1S3S G;  1YQ3 B;  2KZR A;  2RDG A;  1MHX A;  2D07 B;  2K6Q A;  1VLB A;  3FIL B;  1Q10 A;  5IN7 A;  2KT7 A;  2RGF A;  5HI1 A;  4HKZ E;  1J0G A;  2L52 A;  3BYY B;  1Y8R C;  2DZK A;  3KYC D;  2G9H D;  4E71 A;  3V05 A;  4BBN F;  2M19 A;  3H6N A;  2JSV X;  3DBH I;  3N1Y C;  1QIL A;  1YN3 A;  1SEB D;  5GXG B;  1E9M A;  1FRR A;  1SJH D;  4GDL B;  3PPA A;  1WX7 A;  4WIP A;  2HJ8 A;  2DBY A;  4LCD E;  4RH6 A;  1YN4 A;  4HRO A;  1WGD A;  1OEY J;  2QC8 A;  2W82 A;  3WIM A;  4PT5 A;  4NJ7 A;  4MGI E;  2LHE A;  2KO3 A;  4KGS A;  3GS2 A;  3PSE B;  5E6N A;  1QOF A;  4MGY E;  2KDI A;  3HVD A;  3IXS A;  4GN1 A;  2XK5 A;  2CU3 A;  3M63 B;  2R61 A;  1T0Q C;  1UZX B;  4FLH A;  2FID A;  3U52 E;  2W3S A;  2C7M B;  2M0A A;  1N63 A;  4RF1 A;  3RNC C;  4C4V A;  5I4D A;  1V1O A;  4XC2 A;  4RNA A;  1K52 A;  2Q5W D;  1EF5 A;  2J42 A;  3MJ5 A;  4ZHP A;  4EZL A;  2Z8L A;  4W9E A;  1C79 A;  1LQB A;  4LLG M;  2LHD A;  4MAC A;  4RMA A;  1I35 A;  3AE6 B;  2N9E B;  2WXQ A;  1MVK A;  3APD A;  4IUM B;  3BWU D;  4ANW A;  4AOF A;  4LNI A;  4C56 C;  4EZK A;  4ZOH C;  3APF A;  3L16 A;  1MPE A;  1VR9 A;  2AQ3 B;  4ZRJ A;  3T3O A;  4AQ7 A;  2D3A A;  4BVU C;  5D3D A;  2DWQ A;  1GC6 A;  2W54 A;  3P63 A;  2UWQ A;  1IYF A;  1NI2 A;  4HPM B;  1BT0 A;  4WAA A;  4JWS C;  3TMP B;  1NYQ A;  3V60 A;  4TQ1 A;  5G55 A;  2Y3A A;  1CQV A;  2VRR B;  4FHJ A;  3ZXR A;  1IGC A;  1C3T A;  1WF9 A;  2WXJ A;  2TSS A;  3DVN U;  2JF5 A;  2KQS A;  5J18 A;  4FAD A;  3VVW B;  2E3T A;  5FR3 A;  3CST A;  1E7P B;  3QA8 A;  5D2M B;  1V5O A;  2JQR B;  2L3Z A;  3QQ8 B;  2KFK A;  1I4X A;  1WRD B;  3PZD A;  3DHI C;  1L6U A;  2WQY B;  2SAK A;  1ROE A;  1GUA B;  2WDQ B;  1QQR A;  2D5G A;  1OQY A;  4M01 A;  4II2 B;  3DBR I;  2DZI A;  4JX1 C;  4X57 B;  4F1S A;  4W9C A;  5FR6 A;  1TS5 A;  2Y5P A;  2BW2 A;  2WXR A;  5H92 C;  1PGA A;  3ETR A;  4W9D A;  4YXD B;  1GC7 A;  2LGY A;  1TY2 A;  1R4N B;  1CMX B;  3AV8 A;  3EC8 A;  3B0A A;  2LRU A;  1XXG A;  4CQN A;  3IHP C;  3SEB A;  2W3R A;  3IT6 B;  4IWP A;  1TZ1 A;  2JWU A;  1WGR A;  1KLV A;  2CJN A;  1YX6 B;  3RN9 C;  1V80 A;  1WJ4 A;  1FNW A;  3P42 A;  2JWZ A;  1T3Q A;  5C2T B;  3R7R A;  1IGD A;  5LXH A;  1WGY A;  3SFD B;  2D3B A;  2JRI B;  1MHH E;  2V9H A;  1H4R A;  3URY A;  1L7Y A;  4C00 A;  2MLB A;  4XGA B;  1AWD A;  4DXG A;  1P7E A;  1H8C A;  4JWU C;  4MDK E;  3WA0 A;  1VZ7 A;  1HZ5 A;  2WP9 B;  4DDI D;  2PKO A;  5BYQ A;  1D4B A;  3SHQ A;  1ZXI A;  1STE A;  3MC8 A;  1C4P A;  4CHK A;  2M0X A;  3M3J A;  2BWE S;  3W1S A;  3N20 C;  1WGG A;  1FEH A;  1QLB B;  1N61 A;  3WCQ A;  2FUG 1;  2IND C;  3JYU A;  3KLS X;  2DAF A;  2I38 A;  4OZC A;  2JZP A;  3PRE A;  2BKF A;  3ZVV A;  2IO3 B;  1P3Q U;  3VTW A;  5CHW A;  1E90 A;  3U8Z A;  1NEN B;  2VH1 A;  2N0S B;  1WY8 A;  4HKQ A;  1AW7 A;  4FHK A;  2K5P A;  1WRI A;  4N6E B;  2WU2 B;  3MC0 B;  3NUH B;  1KF6 B;  3Q8A A;  3OWE B;  1RYJ A;  3A4R A;  4KZ0 A;  3A9J B;  3EFU A;  1R7S A;  1QKZ A;  1J8C A;  4K1R B;  1B1Z A;  1QZE A;  2ZVO A;  2AQ1 B;  1C4A A;  2JUO A;  3KQ4 A;  3ZW3 A;  3BVG A;  1JWB D;  2WLB A;  3SD5 A;  3MTN B;  4URK A;  1WGH A;  1E6E B;  3V6C B;  2G4D B;  2IO1 B;  1V2Y A;  1UNS A;  3P4Q B;  3FAH A;  3A9K B;  3GE3 C;  2GBJ A;  1E8X A;  1Q5W B;  3QWZ B;  1P7F A;  3OJ3 A;  3U7D A;  3GOE A;  2L83 A;  1GAQ B;  3I57 A;  3SU8 X;  1HXY D;  5AZG A;  1JRP A;  3TJP A;  4LTU A;  2IZV B;  4ARC A;  1EU3 A;  3DQV A;  4UDU C;  1V1P A;  3OJ4 B;  2WXI A;  2N9P C;  5DPT A;  4F7Z A;  1I42 A;  4EE2 A;  2Z59 B;  4A90 A;  1ZGU B;  1EM7 A;  1WIA A;  1YOV B;  3QC8 B;  3PV1 A;  3IVF A;  2G1E A;  1XEE A;  2VZK D;  2RR9 A;  2CS4 A;  3WAN A;  4C7Z A;  3ZRF A;  2GMI C;  3H7P B;  3N30 A;  5L83 A;  1SJE D;  5C1Z A;  1L0Y B;  3PZ8 A;  2MP2 B;  1YQ4 B;  3A33 B;  4LNK A;  3ABV B;  5MPO A;  4PS8 A;  4L2Y A;  2CHZ A;  4WJN A;  4RGM A;  1NEK B;  4BZA A;  1HA5 A;  3OG5 A;  2LEK A;  3QAR A;  3PZ7 A;  4G11 A;  3UI3 A;  4WJP A;  1I7H A;  3N1Z C;  3KUZ A;  4DXF A;  3RUL A;  2IY0 B;  4GU2 A;  3CSF A;  2QIE B;  2BKR B;  2O2V A;  2VH2 A;  2SEB D;  4NJ6 A;  4I6N B;  4IM3 A;  2KAC A;  2LI5 A;  2PE6 B;  1YIW A;  1QOG A;  3AM9 A;  3O13 A;  2H89 B;  2LWP A;  5G5H A;  3UIP B;  4W9F A;  2EMT A;  2ZW0 A;  4BAX A;  3JW0 X;  2BQQ A;  1AYF A;  2KMC A;  1UWX A;  2QJL A;  1ZDX A;  2K22 A;  4AJY B;  2QMT A;  3ML9 A;  3GB1 A;  3BK1 A;  4MGK E;  3ZLZ A;  3PRZ A;  4KIK B;  2W55 A;  3DWG C;  4NNJ B;  3T3N A;  4KV2 A;  4NJC A;  2CR5 A;  3X23 A;  1FMA D;  1PDX A;  2UYZ B;  3ZGZ A;  4ZRK A;  2D2Q A;  4NZL B;  3U7Z A;  2ZZP B;  5HFY A;  1F9J A;  3TIX A;  2DHZ A;  3AE2 B;  2W9N A;  2GRI A;  1MG8 A;  4EFO A;  1VDV A;  1RM6 C;  1TTN A;  3PVL A;  4A6Q A;  4NPN A;  2HTM E;  4BBN C;  2LJI A;  1XD3 B;  1JWA D;  5AZF A;  5DCN A;  4US8 A;  3CF6 E;  5DPW A;  3N32 A;  4DK5 A;  1ZDV A;  3W5V B;  2J4X A;  4JQW C;  1LFD A;  1DYQ A;  1C9F A;  2WXG A;  4GB9 A;  3UGB B;  2INN E;  1F0Z A;  3ZYY X;  3TBL D;  5IKC M;  3B2F A;  2PTL A;  4YTM B;  2Z0E B;  3NG0 A;  2IJ0 A;  3R8B A;  4FJZ A;  3BK2 A;  4LNF A;  4IDI A;  4OVU A;  3WAL A;  2EKE C;  4A8X C;  3PGE A;  3ZJT A;  2I1K A;  1XCT L;  2OOB B;  4KDL B;  2LZ6 A;  1XLO A;  2KX3 A;  3N3K B;  4PS7 A;  5LNK 1;  2DX5 B;  1S1Q B;  2WDR B;  3Q3O C;  1WYW B;  3P2B A;  1RFA A;  2KQ7 A;  2MWS B;  2NBV B;  2KC1 A;  2GBK A;  1IBX A;  2KWV B;  2LD9 A;  4GDK A;  4FJY A;  2KXJ A;  1WX9 A;  4TKN A;  3AU5 A;  1B9R A;  1F1H A;  4WWN A;  1KRH A;  1KLG D;  4G3X B;  2MBQ A;  5J2R A;  4XWW A;  4HLE A;  4IC7 B;  3KWV A;  4P16 A;  3ZNI D;  3BVM A;  1E8Z A;  3PRM B;  3IT4 B;  4ANV A;  1FM0 D;  4DDG D;  4OHJ A;  1FFV A;  1FXT B;  4CO7 A;  3PTF C;  2IBI B;  3I3T B;  3AH7 A;  2K25 A;  1R4N I;  1E8Y A;  3BYT B;  4HDQ A;  1DOI A;  3LDZ E;  3PLU A;  2N7J A;  1E8W A;  2MJD A;  2O6V A;  2DYM A;  3HM6 X;  4A9A A;  2GBN A;  2A4Z A;  2ZNV B;  4K3C A;  4P6V F;  2JXT A;  1KTK A;  3AN1 A;  1FIQ A;  4GLS C;  1GNU A;  2MBE A;  1V86 A;  5D3I B;  3JSV B;  4XX5 A;  4NAM A;  2IY1 B;  3NY5 A;  5E6J A;  4RGT A;  2AWT A;  3V61 A;  1FCL A;  2J0M A;  4MH0 E;  3GP7 A;  1V49 A;  3NZ3 A;  1TZO A;  3RI7 C;  1UUP A;  1Q0W B;  4NAW B;  2MCN B;  3AUL A;  3KW5 B;  4ARI A;  5HKH A;  4HPP A;  2WDT B;  4H2A A;  4IM0 A;  4ZYS A;  4W9H A;  2ACZ B;  3BZD B;  4MH8 A;  2KFK B;  4RF0 A;  3FIL A;  4M00 A;  3VUY A;  4MSM B;  2RDB C;  1VRA B;  2FCM A;  2LXA A;  5BMI A;  3B08 A;  4DHZ B;  2L7R A;  1XO3 A;  3J9C A;  1SE4 A;  3AEA B;  4NY0 A;  4PK1 A;  2BYF A;  3AEB B;  3ECI A;  3VH4 B;  5JHB A;  3ZO5 B;  4DHZ E;  4M0W A;  1U4A A;  3NVY A;  2VZK B;  5DPR A;  1CK1 A;  1FO4 A;  3FC4 A;  3R7Q A;  2M8S A;  2XEW A;  1V81 A;  1HEZ E;  2C9W B;  1CZP A;  3Q3M C;  2KTR A;  2NTS A;  1SBB B;  1J7C A;  2I1J A;  2RPV A;  5DPS A;  3BII D;  1ZOY B;  4IOI E;  2LXC A;  1P98 A;  5E6O A;  1IPG A;  3RZF A;  4HPL B;  1OQR A;  2V4L A;  4OW0 A;  3FKY A;  3Q14 C;  2FNJ B;  4ANX A;  1UH6 A;  3AMZ A;  3ZKJ C;  3TUO A;  2LAS A;  2RMM A;  3ONS A;  3VTU A;  4JPS A;  4C80 A;  2BWF A;  4AJW A;  1R4M B;  1J7B A;  1VCB A;  4W9L A;  4MEM A;  4DXA B;  1C77 A;  4LJP B;  1WSP A;  1L0X B;  1P0R A;  2L00 B;  4WH4 A;  4WQO B;  2RDH A;  3W2D A;  2QHO A;  1OGW A;  3GZN B;  3R2T A;  4USA A;  4I6P A;  4NQL B;  4S0R A;  1YMH E;  3VTV A;  2DEN B;  3KUD B;  1UWM A;  2LGD A;  2CU1 A;  3IG3 A;  3I63 C;  1E7U A;  3AEG B;  1PUT A;  2PW9 A;  3EGR A;  3I9V 1;  4YWG G;  3ENE A;  3ML8 A;  4HK2 A;  2BB5 A;  4YTP B;  1WE6 A;  4ICV A;  2ZCB A;  2N9K A;  1V5T A;  2XBB C;  1QF6 A;  2MSE D;  5TR5 A;  1I4R A;  2CJO A; 
#chains in the Genus database with same CATH homology
 1VD2 A;  3UIN B;  3EEC A;  1ZGU B;  2V3S A;  3AXC A;  5AZH A;  1WIA A;  2KAN A;  2PEA A;  2C7N B;  1EF1 A;  3B1L X;  4AP4 C;  1WXV A;  2FUH B;  3ZUN A;  5C23 A;  4IWO A;  1SGH A;  1YX5 B;  2KC2 A;  3QC8 B;  3PV1 A;  3IVF A;  2AL6 A;  4W9J A;  4ASW C;  3DDC B;  2L05 A;  3BY4 B;  2RR9 A;  2CS4 A;  2J0J A;  3WAN A;  3UF8 A;  4EUT A;  2RD0 A;  3ZRF A;  2GMI C;  4GDL A;  3H7P B;  2B3A A;  3QHT A;  4KIK A;  3N30 A;  3V6E B;  5L83 A;  2EMS A;  4LDT D;  5JHA A;  5C1Z A;  3ZDT A;  5D7G A;  3PHW B;  2WX1 A;  2KN5 A;  1PQS A;  2MP2 B;  5LLI A;  5JZE B;  2A5U A;  2DZJ A;  4BKS A;  2V1Y A;  1TGZ B;  2N1V A;  2N1W A;  3A33 B;  3M62 B;  4GGQ A;  3HHM A;  4PS8 A;  1C1Y B;  2G45 B;  2C5L C;  1XT9 B;  2CHZ A;  4WJN A;  4ZYN A;  3A1Q A;  2LGX A;  4MJS B;  2NVU I;  4K7U A;  3WAM A;  3QAR A;  4G11 A;  2LJ5 A;  2NCN A;  4WJP A;  2LRW A;  3S2A A;  3RCZ A;  4FUL A;  3KUZ A;  2MBB B;  1WI0 A;  4II3 B;  3RUL A;  2IY0 B;  4JGH B;  4GU2 A;  2CHX A;  3CSF A;  5D94 A;  5KHO A;  2K8B A;  1X1M A;  3JSV A;  2BKR B;  2O2V A;  1WJ6 A;  4NJ6 A;  2ZNV C;  4I6N B;  4CYE A;  1WMH B;  4IM3 A;  2JZ3 B;  1S3S G;  1UD7 A;  2KZR A;  2LI5 A;  2M1M A;  2D07 B;  4EOY A;  2K6Q A;  2ZCC A;  2PE6 B;  4M8M A;  1YD8 U;  1YIW A;  4NAW A;  3T8M A;  2RGF A;  1J0G A;  1WE7 A;  1Y8R C;  2DZK A;  3ZDM C;  2LWP A;  3KYC D;  2YVC A;  4E71 A;  5G2N A;  3UIP B;  4W9F A;  4MGZ E;  4HXD A;  2EMT A;  4BBN F;  3QJZ A;  4MM3 A;  5CHV C;  3H6N A;  3JW0 X;  2KLG A;  3ZTC A;  4RM8 A;  3DBH I;  2KMC A;  4FJV B;  1LM8 B;  1WXA A;  5BO4 B;  3Q3F A;  4AJY B;  3DBL I;  5D6J B;  4A3P A;  4F8C B;  3ML9 A;  2AEH A;  4WWO A;  4GDL B;  3PPA A;  1WX7 A;  4MGK E;  3DVG Y;  2HJ8 A;  3ZLZ A;  2MQJ A;  3PRZ A;  4KIK B;  3UQA A;  4LCD E;  3VDZ A;  3ZNG C;  3VAW A;  5EDS A;  3ZNH B;  4NNJ B;  2C7H A;  2KK8 A;  4KV2 A;  1UBQ A;  1WGD A;  3QAQ A;  2CR5 A;  1OEY J;  4BFR A;  3X23 A;  1WR1 A;  3K9O B;  3WIM A;  4NJ7 A;  2G4S A;  5GMV A;  4MGI E;  2KO3 A;  2KFJ A;  1J19 A;  2UYZ B;  3A1Q B;  4RM9 A;  2REX A;  4ZRK A;  3L17 A;  3PSE B;  4PYZ A;  5E6P A;  3NZS A;  4BKG A;  2D3G A;  5E6N A;  2L0T A;  4MGY E;  2D2Q A;  4KDI C;  1IP9 A;  4HDO A;  2BYV E;  4AUQ C;  2ZZP B;  1OTR B;  4A3O A;  1F9J A;  2KDI A;  3SDL C;  2IYD B;  2KJ6 A;  2DHZ A;  2KDE B;  3PS6 A;  3TIX A;  5JH5 C;  4GN1 A;  2J7Q B;  2XK5 A;  1V9J A;  2K8C A;  3IBE A;  3M63 B;  3RD2 A;  3VXW A;  3ZRC A;  2W9N A;  1UZX B;  2N7D A;  2FID A;  4FLH A;  4K7S A;  1MG8 A;  2JY6 A;  2FAZ A;  3TCA A;  4EFO A;  5AEK B;  2C7M B;  3DCG A;  2O2V B;  4AWJ A;  4TQ0 A;  4J6I A;  2KJR A;  1TTN A;  2GBR A;  4K7W A;  2Y5B B;  2G3Q B;  3PVL A;  4NPN A;  2JXX A;  2L76 A;  3DVG X;  1E7V A;  4XC2 A;  3IFW B;  1Z5S B;  4BBN C;  4TV3 A;  1XD3 B;  1EF5 A;  3VUX A;  4WWP A;  5AZF A;  4DHJ B;  4EZL A;  1RRB A;  1V6E A;  2JVC A;  4GXB A;  4XZ4 A;  2O6V D;  5DCN A;  4BOS C;  3CF6 E;  5DPW A;  3N32 A;  4DK5 A;  3R66 C;  4W9E A;  1T0Y A;  1KM7 A;  1Q1O A;  4G0N B;  1EUV B;  1E5W A;  1LFD A;  4JQW C;  4KZC A;  3L13 A;  2KDB A;  1LQB A;  4GSW A;  4GB9 A;  4JL9 A;  3UGB B;  3VQI A;  2KVR A;  3TBL D;  2KHW B;  3DOW A;  4RMA A;  1I35 A;  4EKU A;  3A9J A;  3DVN V;  2Z0E B;  2N9E B;  3APD A;  4FJZ A;  1M94 A;  4IUM B;  4ANW A;  1JRU A;  4OVU A;  2MBO A;  4AOF A;  3WAL A;  3H9D A;  2PPH A;  4EZK A;  1WJU A;  2EKE C;  2BF8 B;  3C0R B;  3APF A;  3L16 A;  3ZNZ B;  3PGE A;  3L0W B;  3QX1 A;  3ALB A;  4YL8 A;  4ZRJ A;  2I1K A;  2OOB B;  4KDL B;  2LZ6 A;  2KX3 A;  4BVU C;  3N3K B;  4G50 A;  1Z2M A;  2CKH B;  4PS7 A;  1GC6 A;  2DX5 B;  1S1Q B;  2BYE A;  2UWQ A;  4PYU A;  1WYW B;  3P2B A;  1IYF A;  1NI2 A;  4HPM B;  4E3C A;  1RFA A;  1BT0 A;  3ZTD A;  4WAA A;  2KQ7 A;  3TMP B;  1SIF A;  3V60 A;  2MX2 A;  2MWS B;  4P7I A;  2NBV B;  2ZPY A;  4TQ1 A;  3WAP A;  5G55 A;  1NDD A;  1WZ3 A;  2KC1 A;  2VRR B;  4FHJ A;  1P9D U;  3KH0 A;  2GBK A;  4N9F 4;  2MA9 B;  1C3T A;  1WF9 A;  2FCQ A;  3Q3J A;  3RZW C;  2NR2 A;  2KWV B;  1TBE A;  2KMA A;  2LD9 A;  4FJY A;  2MRP A;  3DVN U;  1WR6 E;  2KXJ A;  4GDK A;  1WX9 A;  4W9I A;  3X0W A;  2JF5 A;  2KQS A;  4TKN A;  4NQK E;  3AU5 A;  4FAD A;  5J18 A;  3VVW B;  4LDT B;  3OAW A;  2WYQ A;  4WWN A;  3CST A;  4G3X B;  3QA8 A;  2MBQ A;  5D2M B;  1V5O A;  1WXM A;  5J2R A;  1WH3 A;  3UIO B;  4HLE A;  2NPT A;  2L3Z A;  3W1Y A;  1GJZ A;  3QQ8 B;  4BKS D;  2KFK A;  4IC7 B;  2N9X A;  3ZNI D;  3L08 A;  1OEY A;  3CMM B;  1WRD B;  1E8Z A;  3PZD A;  3PRM B;  2K6D B;  3M95 A;  2RPQ A;  4ANV A;  1K8R B;  4DDG D;  3OLM D;  4PS3 A;  1GUA B;  2DAJ A;  3R3M A;  4IG7 B;  3PLV A;  1OQY A;  1FXT B;  4II2 B;  3DBR I;  2DZI A;  4JIO U;  4CO7 A;  4W9G A;  3PTF C;  2DYB A;  2IBI B;  4X57 B;  2OJR A;  3I3T B;  4F1S A;  4IM2 A;  4BOZ B;  4W9C A;  5FR6 A;  2DYO A;  3NHE B;  3H7S A;  2K25 A;  4TUU A;  1R4N I;  1E8Y A;  1D3Z A;  4HDQ A;  2L0F A;  3DPD A;  3EHV A;  4W9D A;  3APC A;  4BKT A;  3LDZ E;  3AU4 A;  4WJO A;  1GC7 A;  2LGY A;  3PLU A;  1G6J A;  1E8W A;  4EZJ A;  1CMX B;  2JRH A;  2O6V A;  2DYM A;  3HM6 X;  4ICU A;  4DWF A;  3EC8 A;  2GBN A;  5CTR C;  3B0A A;  3VFK A;  2A4Z A;  2LRU A;  4DHJ D;  2GBM A;  2ZNV B;  2KD0 A;  1A5R A;  4A20 A;  4ANU A;  2BGF A;  1GNU A;  2MBE A;  1V86 A;  2K39 A;  3IHP C;  2PJH A;  3JSV B;  4XX5 A;  2IY1 B;  1ZKH A;  3KYD D;  3NY5 A;  4IWP A;  1TZ1 A;  2K8H A;  1WGR A;  4WJQ A;  2AWT A;  3PRP B;  1KLV A;  1YX6 B;  3V61 A;  3VH3 B;  3QCA A;  2ZPN A;  2J0M A;  4FN2 A;  4GDK B;  2NBW B;  1V49 A;  1WXS A;  2R2Q A;  4MH0 E;  4HCP B;  1V80 A;  1WJ4 A;  3H1U A;  1Q0W B;  4NAW B;  2MCN B;  4LJO B;  3AUL A;  1WJN A;  2IO2 B;  3KW5 B;  2JWZ A;  2RSU A;  2R2O A;  2FCS A;  4HVB A;  5HKH A;  4I6L B;  3R7R A;  3VUW A;  1WMH A;  2WDT B;  4IM0 A;  2YLM A;  2NPT B;  5LXH A;  1WGY A;  4W9H A;  2PE9 A;  1YQB A;  4IWQ A;  2KFK B;  2KX0 A;  2HD5 B;  3KVF B;  3O65 B;  1ZW7 A;  4HWI B;  3VUY A;  2JRI B;  5CX3 A;  4KSL C;  3PHX B;  4MSM B;  3UQB A;  2FCM A;  4ZRI A;  2WWZ A;  2ZVN A;  1H4R A;  2LXA A;  4B9K A;  2J0K A;  4FA6 A;  1L7Y A;  3B08 A;  2MLB A;  4DHZ B;  1P1A A;  2L7R A;  3NOB A;  2LVP A;  4HJK A;  5IAA C;  3RUI B;  1H8C A;  4MDK E;  3RYT A;  4E74 A;  3WA0 A;  5CHF A;  4DDI D;  3JVZ X;  2KLC A;  4NY0 A;  3SHQ A;  2BYF A;  2AYO B;  2O6V B;  2CHW A;  2C60 A;  2KOX A;  2ZEQ A;  3A9K A;  2K1F A;  3ECI A;  3VH4 B;  4B6W A;  1WX8 A;  4CHK A;  2M0X A;  3M3J A;  3A4S C;  2XK5 B;  5JHB A;  2BWE S;  5L95 C;  3W1S A;  3ZO5 B;  4DHZ E;  1WGG A;  3AI5 A;  1U4A A;  3V62 A;  4IW0 A;  5DPR A;  2IO0 B;  3JYU A;  1WM3 A;  4GIV A;  4MEL A;  3R7Q A;  5KHQ A;  2DAF A;  2M8S A;  1WFY A;  1RLF A;  3TL5 A;  2XEW A;  3QIJ A;  1V81 A;  3PRE A;  3U30 A;  3W1S C;  2BKF A;  3D32 A;  3ZVV A;  4M8N A;  2N7E A;  2IO3 B;  1P3Q U;  2DZM A;  2N4F A;  1EO6 A;  3MJW A;  2LVQ A;  3VTW A;  1XQQ A;  2C9W B;  5CHW A;  2BPS A;  5IA7 A;  2HTH A;  4FBJ B;  1E90 A;  3U8Z A;  1KOT A;  4MSQ B;  2KJH B;  2D10 A;  1WY8 A;  4EEW A;  3BIN A;  1HE8 A;  4FHK A;  2KTR A;  3K9P B;  1SE9 A;  2I1J A;  5DPS A;  2M4N A;  5LXI B;  1L2N A;  1GG3 A;  3A4R A;  4KZ0 A;  3A9J B;  3NS8 A;  2LXC A;  4B95 A;  2LVO A;  1UGM A;  3EFU A;  4ZDV A;  1P98 A;  5E6O A;  1IPG A;  3RZF A;  3T9L A;  4HPL B;  2V4L A;  3MHS D;  1J8C A;  4K1R B;  3QK0 A;  2FNJ B;  1QZE A;  3HK0 A;  2ZVO A;  4ANX A;  3NZU A;  2KWU B;  1UH6 A;  3ZKJ C;  2LAS A;  1R4M I;  2JUO A;  2M17 A;  3ONS A;  2FIF A;  3WAO A;  3ZW3 A;  3VTU A;  1YJ1 A;  3ZIM A;  3H7P A;  3SD5 A;  3MTN B;  2BWF A;  3HM3 A;  4URK A;  1WGH A;  1WM2 A;  4AJW A;  1NBF C;  3L54 A;  2KKC A;  3V6C B;  1VCB A;  2MBH A;  2KTF A;  2L8J A;  4GOC A;  2LUE A;  4W9L A;  2G4D B;  2IO1 B;  4MEM A;  1V2Y A;  4DXA B;  2KDF B;  3HIZ A;  3DBS A;  2MP2 A;  1UEL A;  3A9K B;  4KSK C;  3PT2 B;  1RAX A;  2AL3 A;  4LJP B;  2GBJ A;  3GZN I;  1P0R A;  2Z0D B;  1E8X A;  2L00 B;  3RT3 B;  1Q5W B;  3QWZ B;  3U7D A;  3OJ3 A;  4M0W B;  2NS5 A;  1LXD A;  2MW5 A;  3GOE A;  4MJS A;  4WQO B;  4KVG B;  2ZJD A;  4HCN B;  2QHO A;  4GMV A;  2JT4 B;  1OGW A;  1ISN A;  1AAR A;  2KNB A;  4I6P A;  4JLC A;  4NQL B;  1UBI A;  3SU8 X;  3VTV A;  2DEN B;  2JPH A;  3KUD B;  5AZG A;  2LGD A;  2CU1 A;  3IG3 A;  1E7U A;  2WX0 A;  4W9K A;  2NBU A;  3ENE A;  4OVV A;  3ML8 A;  3TJP A;  3KUC B;  4HK2 A;  2IZV B;  2D11 A;  2ASQ A;  2GOW A;  1KJT A;  1WE6 A;  1WZ0 A;  2JZZ A;  2ZCB A;  3DQV A;  3LJ3 A;  4ICV A;  4K81 A;  3VHT C;  4DBG A;  3OJ4 B;  2FCN A;  1V5T A;  2N9P C;  2XBB C;  2MSE D;  5TR5 A;  2HE7 A;  2KTR B;  5J17 A;  5DPT A;  4F7Z A;  1I42 A;  3L10 B;  2Z59 B;  2KWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...