2N4FA

Ec-nmr structure of arabidopsis thaliana at2g32350 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ar3433a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
AAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein AR3433A
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n4fA01
4CYEA 3A9KA 3PPAA 3QWZB 2JZ3B 3UF8A 2V4LA 2J0KA 2MP2B 3GOEA 2B3AA 3L16A 3PHXB 4FULA 4JIOU 4WJNA 4M8NA 5E6NA 2LXAA 2Z0EB 2WDTB 1UH6A 4LDTB 4HVBA 2O6VD 2KTRB 3M95A 1FXTB 2BKRB 2N4FA 3U30A 5BO4B 3WA0A 5JHAA 1VCBA 1KOTA 4E74A 3A1QA 3BY4B 3M3JA 1H8CA 4HDQA 2MBHA 2LGDA 3L13A 5D2MB 4KZCA 4J6IA 4RM9A 3QA8A 3U7DA 2PEAA 5EDSA 4JQWC 4DHZB 2MRPA 4ZDVA 3ZDMC 2I1KA 1GC6A 2FCQA 3TCAA 4GIVA 4B9KA 1L2NA 3H7PA 4EKUA 1UD7A 4RM8A 2KDIA 3A9KB 3CF6E 4DHJD 1R4MI 1WIAA 2DAFA 4AJWA 4GB9A 3IHPC 2L05A 5CX3A 4ZRIA 1RFAA 2KKCA 1WGRA 2GBNA 5E6OA 2KDFB 3TIXA 2KTRA 4ZRJA 4FADA 1LM8B 1WFYA 1G6JA 1KM7A 4GGQA 2JUOA 4W9CA 1GG3A 1OEYJ 4IM2A 2NCNA 2K39A 1Z5SB 3VQIA 5D7GA 4ANUA 1EO6A 3QK0A 4TKNA 2PPHA 2K8CA 3VAWA 1RAXA 2M17A 2G45B 4I6PA 1TZ1A 2KX0A 5C23A 2DYOA 3H7PB 3K9PB 4FJYA 2GBKA 4EZJA 3V6CB 5DCNA 2IY0B 1WX8A 4GDLB 4G11A 4NAWA 2L0FA 3QHTA 4MGYE 2L8JA 4PS7A 4GMVA 3L10B 4WAAA 5DPSA 1NI2A 2PJHA 3NS8A 2NPTA 4DDID 4EZKA 1LFDA 2I1JA 2BF8B 4WWOA 1ZKHA 4KSLC 4K1RB 2RPQA 1V49A 4G3XB 3ZW3A 4BBNC 4PS8A 2MBOA 3PRZA 4JLCA 1WGHA 2LXCA 3AXCA 2A4ZA 3VUYA 2OOBB 4FLHA 4IG7B 1TGZB 1A5RA 2BGFA 3H9DA 3B08A 4MGZE 3VTVA 4IWOA 4DHJB 2LRWA 5CHWA 3TL5A 3ZTDA 1WH3A 3VTUA 1E5WA 2KC1A 3R7QA 3PT2B 4KDLB 3WANA 3ZNGC 4EZLA 4MSMB 3DDCB 5LLIA 2HE7A 2N7DA 4IM3A 4DWFA 3AU5A 1LQBA 2MW5A 3VDZA 4EOYA 2LUEA 4ICUA 1MG8A 2C7NB 4GU2A 2IO0B 1WJ4A 2PE9A 4MM3A 3UIPB 4IUMB 5CHFA 3VXWA 4A3PA 4RMAA 5C1ZA 1L7YA 2D11A 2AWTA 5JZEB 1ZGUB 1YX6B 3RUIB 2HJ8A 3JSVA 4W9KA 1V81A 2DYMA 3IBEA 4WJQA 2L00B 4WWNA 3S2AA 2DZJA 2WYQA 1WR1A 2XBBC 2KLGA 4HWIB 2LVOA 3R7RA 2IO2B 2KWCA 4F1SA 2EMTA 4IW0A 4OVUA 2MWSB 4MJSA 3TBLD 1WGDA 2KOXA 4EEWA 3ZUNA 3A33B 5DPRA 4W9EA 4GDKB 2ASQA 1HE8A 3CSFA 3L0WB 1E8ZA 2K6DB 3D32A 3DCGA 3AU4A 2BYFA 3A4SC 4FJVB 5DPWA 3C0RB 2KFKA 3ML8A 3LDZE 2WX1A 3EHVA 3JVZX 2MA9B 1KJTA 2N1VA 3ZO5B 2AL3A 1WE6A 2GBMA 1E8YA 2JRHA 1V5OA 3ZIMA 2GMIC 5TR5A 2ZNVB 3H1UA 4NJ7A 3EC8A 2FAZA 4IM0A 2JRIB 3DPDA 2DAJA 2DZIA 2N9XA 2O2VA 2BPSA 3EFUA 4BKTA 3WAPA 2LJ5A 1F9JA 2CKHB 2KZRA 3VUWA 4DBGA 3V62A 1QZEA 2C60A 2IO1B 3ZTCA 2O6VA 4W9JA 2IYDB 2D07B 2ZZPB 3QJZA 3PZDA 1VD2A 2JVCA 1GJZA 3HHMA 3JYUA 3NHEB 2ZJDA 4IWPA 1WJNA 2KDEB 1OGWA 1WMHA 2KDBA 4G0NB 3SD5A 4ICVA 2REXA 3RULA 4ZRKA 1T0YA 2MSED 2DZMA 3NZUA 4W9IA 2JPHA 3WALA 3HK0A 2CHXA 3PLUA 2XK5B 4XC2A 3X0WA 4WQOB 3APCA 3P2BA 3WAMA 1WJ6A 1Q5WB 4NQKE 1V5TA 2FNJB 2HTHA 3V60A 3PLVA 3PVLA 3PRMB 4FJZA 2KWUB 1YJ1A 1S3SG 2WX0A 4NJ6A 4KDIC 5CHVC 1WY8A 5J18A 2YLMA 2QHOA 4B6WA 1P3QU 1WYWB 1P98A 2RSUA 5J2RA 3M63B 2FCNA 1OQYA 2AL6A 4G50A 3PSEB 3WAOA 1P1AA 1XD3B 2BWES 2VRRB 2MP2A 3DBRI 2JZZA 1E7UA 1P9DU 2KMAA 2MLBA 4FN2A 2FIDA 1K8RB 3QQ8B 4B95A 4TV3A 1ISNA 4NNJB 2LGXA 2IZVB 4NAWB 4HPLB 5DPTA 3UQBA 4MDKE 2MX2A 3AI5A 3MJWA 4GN1A 4MGKE 4NY0A 3A1QB 1GUAB 4W9DA 2NR2A 3RT3B 3A4RA 2FUHB 3SHQA 3IVFA 2DYBA 3UGBB 3ZNZB 3JW0X 1LXDA 5E6PA 3N30A 2M4NA 3B0AA 4HXDA 4A3OA 1WI0A 4BKSA 1J0GA 1RRBA 2KWVB 4LCDE 5IAAC 2EMSA 4FHKA 1WR6E 1XT9B 2R2QA 2ZNVC 1OTRB 1UBIA 2UWQA 1C1YB 1WZ3A 2N7EA 2DENB 2LI5A 3IFWB 4TQ1A 5AZFA 4K7WA 2L3ZA 4BFRA 3MTNB 3DVGX 3I3TB 2D3GA 2XEWA 2KLCA 1GC7A 2IY1B 2N9PC 2KD0A 3GZNI 4TQ0A 1Y8RC 2JT4B 3CMMB 3HIZA 1IYFA 3UINB 2G3QB 1WE7A 3H7SA 3U8ZA 2KMCA 3VUXA 2BWFA 2KN5A 3ALBA 4N9F4 1JRUA 2MCNB 2MQJA 2KHWB 4E3CA 2ZVNA 3L08A 3RD2A 2KJRA 2M0XA 4WJPA 1UBQA 2ZPNA 3PV1A 4PYUA 4IC7B 1KLVA 1TBEA 1V6EA 4KVGB 3UIOB 4AOFA 2ZPYA 3NZSA 2KNBA 5L83A 3QIJA 2RR9A 1J19A 3EECA 3ZRFA 5HKHA 2A5UA 2MBQA 1X1MA 3VHTC 4AWJA 3MHSD 4FHJA 3KUCB 3PREA 4PYZA 2M1MA 2KX3A 1BT0A 1E90A 3RYTA 4DXAB 2ZCBA 3AULA 4W9LA 4DHZE 2KVRA 2CHZA 2J0JA 2BYEA 1WF9A 2FIFA 3PHWB 3QCAA 4W9HA 2L76A 1UGMA 2O2VB 1NDDA 2FCMA 2LASA 2KFJA 1RLFA 1E7VA 4CHKA 1WX9A 4CO7A 4F7ZA 2DZKA 3O65B 3A9JA 2LVQA 1V9JA 1Z2MA 2MBEA 3ZDTA 5JH5C 2LVPA 4DK5A 2RD0A 2KJ6A 1YD8U 3LJ3A 4PS3A 2K1FA 3ZKJC 4MELA 5LXHA 1J8CA 5AZGA 3APFA 2CU1A 5KHQA 2KJHB 2KQ7A 4GSWA 3ZVVA 4KZ0A 4KIKA 1WMHB 4IWQA 3QX1A 2KANA 3DVNV 3BINA 3OLMD 3Q3FA 3TJPA 1WM3A 3APDA 2CS4A 5GMVA 4HCNB 1U4AA 3PGEA 3R66C 5IA7A 2N9EB 3JSVB 1V86A 1WXVA 3VH3B 4BKGA 2KO3A 1EF1A 2J7QB 2Y5BB 3M62B 4P7IA 4BVUC 5L95C 1GNUA 2CHWA 4XZ4A 2LZ6A 2YVCA 3RCZA 2NPTB 3KH0A 3DVNU 3KYCD 4EFOA 2C9WB 5AZHA 5J17A 3ENEA 1ZW7A 2G4SA 4GDKA 3SDLC 2BKFA 1WM2A 3VVWB 2MBBB 2KQSA 4ANWA 4BBNF 2HD5B 4MGIE 3OJ4B 3ZRCA 3DBSA 1D3ZA 1IPGA 2V1YA 3KW5B 1E8XA 2WWZA 3L17A 3KUZA 4JL9A 1WJUA 2OJRA 4YL8A 5D6JB 2JWZA 5JHBA 4JGHB 5G55A 3SU8X 3RZWC 2GOWA 1WZ0A 3N32A 3PTFC 4BOSC 4MEMA 3VH4B 1M94A 2NBWB 2D2QA 4WWPA 3RZFA 2N1WA 3PRPB 4ANXA 4W9GA 1TTNA 4WJOA 4OVVA 4LJOB 5FR6A 4EUTA 4E71A 3UQAA 3DQVA 2IBIB 2Z59B 1WGGA 4FA6A 4A20A 2R2OA 3T8MA 2O6VB 5G2NA 4LDTD 2JXXA 3KVFB 2LD9A 4II3B 3VTWA 3R3MA 4XX5A 1I42A 4GXBA 1V80A 2FCSA 4NPNA 3X23A 4HDOA 3QAQA 3HM6X 4K81A 2K8BA 4II2B 1SIFA 2LGYA 2NVUI 5CTRC 3DOWA 4KV2A 4HPMB 2W9NA 3QARA 1WXSA 3W1SC 4HLEA 3ZLZA 3T9LA 4GDLA 3KYDD 5LXIB 2L0TA 4FBJB 4GOCA 2BYVE 3WIMA 3HM3A 1H4RA 2J0MA 2KTFA 2LRUA 2AEHA 2NBVB 1WXMA 2M8SA 4M8MA 2G4DB 1AARA 2K8HA 2KC2A 3KUDB 4HJKA 5D94A 4DDGD 5AEKB 1PQSA 4W9FA 2GBRA 2K6QA 2C5LC 4TUUA 2CR5A 2PE6B 3VFKA 4K7UA 4M0WB 1YIWA 2JF5A 3NY5A 3ONSA 2JY6A 1V2YA 2C7HA 2V3SA 4K7SA 1EUVB 1SGHA 2ZCCA 3DVGY 3OAWA 4URKA 1Q0WB 3IG3A 3DBLI 3OJ3A 4NQLB 3V61A 1YX5B 1UZXB 2L7RA 3K9OB 4AUQC 2AYOB 1R4NI 4HCPB 5KHOA 1I35A 1WGYA 2D10A 1CMXB 2EKEC 1YQBA 4BOZB 2DHZA 2ZEQA 1P0RA 3ECIA 4X57B 4F8CB 4MH0E 4KSKC 2Z0DB 4AJYB 3Q3JA 3DBHI 3ML9A 1UELA 2DX5B 2KK8A 3B1LX 2KXJA 4MJSB 1OEYA 3W1SA 1XQQA 3V6EB 3L54A 3H6NA 2IO3B 3CSTA 2XK5A 4I6LB 3PS6A 4I6NB 4LJPB 4MSQB 1Q1OA 3ZNID 4AP4C 1E8WA 2K25A 2KFKB 2ZVOA 1S1QB 3NOBA 3TMPB 3A9JB 1WXAA 1C3TA 2NBUA 2C7MB 3W1YA 1IP9A 2GBJA 3N3KB 4KIKB 2RGFA 1NBFC 1EF5A 2UYZB 2NS5A 3QC8B 1WRDB 4HK2A 4ANVA 3ZNHB 1SE9A 4BKSD 4ZYNA 2LWPA 1WX7A 4ASWC
chains in the Genus database with same CATH superfamily
2VH1A 3PPAA 1UNSA 3UF8A 2MP2B 2B3AA 3L16A 3PHXB 4JWSC 1HA5A 4B0MA 2LXAA 1I4XA 3M95A 2PKOA 3U30A 5BO4B 3KLSX 3FILA 1KF6B 5D2MB 3L13A 4KZCA 3U7DA 4RM9A 1KH0A 4DHZB 1HQRD 3ZDMC 1NYRA 3Q8AA 4B9KA 2L32A 3SFDB 3CF6E 1PDXA 2DAFA 1WIAA 4GB9A 5CX3A 1LM8B 3RNGC 1NENB 4IM2A 2K39A 4XYCA 4B0EA 3Q8BA 4LNOA 1AW7A 4I6PA 2BT6A 3ZQ4A 1TZ1A 3U7ZA 3Q6BA 2DYOA 2KVZA 3K9PB 5AUIA 3OWEB 1PFDA 2IY0B 2L8JA 4GMVA 5DPSA 1NI2A 2PJHA 2NPTA 4DDID 4RNAA 1LFDA 2I1JA 2V3PA 4NJCA 4IKGA 2RPQA 3P1MA 1N62A 3AE3B 4YSZB 3NRZA 2OOBB 4IG7B 2BGFA 3W9CB 1I4QA 4DHJB 2LRWA 2RDBC 2KWDA 1WH3A 3AE4B 3BK1A 3R7QA 4M0WA 3AU5A 4EOYA 1MG8A 2IO0B 1L7YA 2D11A 2AWTA 2ICIA 5JZEB 2K5PA 4WJQA 1CQVA 1ZUD2 2UU7A 2XBBC 3R7RA 4F1SA 4IW0A 5BYSA 4OVUA 2V4IB 1DOXA 1WGDA 3ZUNA 3A33B 1IGCA 4AS1A 1HE8A 3L0WB 4ZYSA 2KFKA 3ML8A 1N61A 3B2GA 4M01A 1N6ZA 1SB3C 1KJTA 2VH2A 3ZXVA 2WDRB 2JRHA 3NUHB 3ZIMA 2GMIC 5TR5A 4ZOHC 2H88B 2DLBA 3EC8A 3RN9C 2JRIB 2DAJA 2DZIA 3WAPA 2LJ5A 2CKHB 3P4RB 1D5MC 3WCQA 1QZEA 2O6VA 2ZZPB 4K3CA 3QJZA 1IUEA 1CJEA 1GJZA 3HHMA 3BYYB 1L4DB 4IWPA 1YNTE 5EE1A 4ICVA 1OQRA 1JWAD 2K3UA 2WNMA 2YEPF 3P4PB 1T0YA 3NZUA 1FNVA 1XCTL 3WALA 3PLUA 4WQOB 3P2BA 3WAMA 1Q5WB 3TUOA 2NMQA 3PVLA 2JYTA 4FJZA 2J52A 1WYWB 5J2RA 1YN3A 2ZW0A 1M4VA 1FEHA 3WAOA 2INPE 2QSDA 1XD3B 2FE8A 1SEBD 4B95A 2GRIA 5C3JB 4NAWB 3LYYA 1V1OA 4S0RA 4MGKE 4NY0A 3A1QB 2NR2A 2FBWB 2Z8LA 5G5GA 3ZNZB 2M4NA 3B0AA 2OEDA 1WI0A 1A70A 4BKSA 3AEDB 1J0GA 4LCDE 2EMSA 1LGRA 2ZNVC 4KKIA 1UBIA 2N7EA 2WU2B 3CWIA 1D4BA 4K7WA 2L3ZA 4YSXB 2JX5A 3NS1A 3MJ5A 4C4VA 1EWCA 1I7HA 2QCZA 2N9PC 2WXRA 1UGJA 3RNBC 3UINB 1JALA 2WXMA 3VUXA 4GLSC 1F0ZA 1KLVA 1L0VB 3HVDA 4OW0A 1QOAA 4KVGB 3T3NA 3HRDD 3P42A 2KNBA 5L83A 3TEWA 3EECA 1OFFA 3ZRFA 1JWUD 1YQ3B 3GB1A 3VHTC 3KUCB 2KX3A 1BT0A 2AX5A 4HEA1 4RF0A 4W9LA 1E9MA 2BYEA 4W9HA 3N20C 4L23A 4PT5A 1NEKB 1E7VA 1TS2A 3O65B 3A9JA 3ZDTA 2WU5B 3ETRA 3LJ3A 5LXHA 4LNFA 1J8CA 5AZGA 4OZCA 2KQ7A 1WMHB 1P7FA 3Q3FA 3FKYA 3ZJVA 3AEBB 2GLSA 1ET9A 1T0RC 2PW9A 3RNCC 3VH3B 4BVUC 1C4PA 1TKGA 3DVNU 1YJJA 3AEGB 3KYCD 5AZHA 1ZW7A 4GDKA 2BKFA 4JE3B 1FPYA 2KQSA 1BXTA 3KW5B 3I57A 4KGRA 5FR3A 1F2RC 1WJUA 5D6JB 3SFEB 5LNK1 3O13A 1ZXIA 4BOSC 4MEMA 3VH4B 4WWPA 4RH6A 3RZFA 1QQRA 2DNFA 4ANXA 2Z59B 1WGGA 4A20A 2I2YA 3TEYA 1JRPA 1CZPA 1SJED 4O1NA 4II3B 4XX5A 2FCSA 1FNUA 4NAMA 4K81A 2IGGA 1QILA 4KV2A 3W1SC 2W9NA 1L6UA 1FO4A 2N9KA 3KYDD 2M56B 4FBJB 4GOCA 1EM7A 3HM3A 1H4RA 2KTFA 2LRUA 3GP7A 4M8MA 4C7YA 2WLBA 1TY2A 3BIID 2BW2A 1N60A 2GBRA 2J4XA 2PE6B 1TS4A 1KLUD 3DHIC 1YIWA 3ONSA 1V2YA 2LMCA 3OJ3A 3V61A 3DBLI 4NQLB 1UZXB 4R3DA 1FD6A 4EE2A 4KSKC 3MC9A 2LUMA 3ML9A 2KK8A 3B1LX 1MJDA 3DBRB 1XQQA 3V6EB 3H6NA 2IO3B 1Q1OA 3ZNID 2KFKB 3NG0A 2RDHA 1C3TA 2NBUA 3W1YA 4KIKB 2UYZB 3IAS1 2NS5A 1WRDB 4ANVA 2AQ3B 2XN9C 2LWPA 1WZ0A 4ASWC 4CYEA 2JZ3B 5H8YE 2J0KA 4JIOU 1ACCA 3EFCA 4LDTB 4HVBA 1ZXHA 3WA0A 1VCBA 3SEBA 3M3JA 1DOIA 4J6IA 4JPSA 1V8CA 2MRPA 4ZDVA 3TEZA 2I1KA 3TCAA 3H7PA 4EKUA 2KDIA 3A9KB 4AJWA 3MHZA 3IHPC 4ZRIA 1WGRA 2GBNA 2KDFB 4FADA 4YWGG 1ZDVA 4HKQA 3RPFC 3VQIA 5D7GA 1TJEA 1FRRA 1EU4A 2ON8A 4FXCA 1I4HA 2M17A 2G45B 2KX0A 5C23A 2LHEA 4EZJA 3V6CB 5DCNA 4G11A 4NAWA 3QHTA 1XLQA 3P4SB 4EZKA 4WWOA 4K1RB 1SBBB 1HZ5A 1C79A 4PS8A 4US9A 2BTEA 2MBOA 3AXCA 2A4ZA 1FNWA 3VUYA 1YMHE 4D2KA 3ZTDA 1HXYD 3VTUA 1E5WA 2INCC 2KC1A 1KRHA 1XXGA 4KDLB 3ZNGC 4DWFA 2HE7A 2N7DA 4IM3A 3VDZA 3UIPB 4A3PA 1BUIC 4RMAA 3NVZA 4HPPA 3JSVA 1J7AA 1V81A 3IBEA 2L00B 2DZJA 2LVOA 2WDVB 3RNEC 2EMTA 3N1XC 2MWSB 4USAA 1K53A 2KOXA 2ASQA 4RGTA 3CSFA 1E8ZA 3AU4A 3OG5A 3C0RB 4IDIA 3LDZE 2WX1A 5T8IA 3ZJTA 3I5JC 2AL3A 2GBMA 4IM0A 1GB1A 3DPDA 5I4DA 2WGSA 3Q3OC 1F9JA 4LNIA 4XWTA 1IBXB 2C60A 1V1PA 3Q3MC 2IYDB 1JWBD 2D07B 3PZDA 5D3DA 2JVCA 3JYUA 3NHEB 3E56A 4YTPB 2BVCA 1TKEA 1WGKA 3EUB2 3P63A 1WJNA 3BZDB 4G0NB 3SD5A 1QKZA 3KQ4A 2QEJC 1QOFA 4W9IA 2JPHA 4ITKA 3HK0A 2ACZB 1QF6A 5BYQA 2CU3A 1V5TA 2FNJB 1TZOA 2KWUB 1S3SG 4NJ6A 4KDIC 5BMHA 5J18A 2RDGA 1P98A 4RGOS 2RSUA 3RMKC 4US8A 3PSEB 2RMMA 3U4EG 1P1AA 2MP2A 3DBRI 5HI1A 4FN2A 2FIDA 2D3CA 2J53A 2PLPA 4TV3A 3URYA 1ISNA 3BYTB 1RWSA 4GN1A 2LJIA 1NVID 3RT3B 3Q69A 3AV8A 3IVFA 3UGBB 1LXDA 5E6PA 3N30A 4HXDA 1E7PB 4FHKA 2R2QA 1C1YB 4ARCA 2LI5A 4TQ1A 2WDQB 5AZFA 2CJOA 4BFRA 3MTNB 2QDFA 2D3GA 2XEWA 2KLCA 3DBLB 2IY1B 2KD0A 3GZNI 4TQ0A 2JT4B 3HIZA 3CMMB 1IYFA 1R7SA 1WE7A 2G3QB 3U8ZA 2KN5A 5IP4D 2MCNB 2MQJA 3IT4B 1TS5A 4E3CA 2ZVNA 1J7BA 1MI0A 1UBQA 1QT9A 3AE1B 1JWSD 3MFGA 3UIOB 4AOFA 4KKJA 1DGJA 1N63A 3BK2A 5HKHA 2JZPA 2A5UA 2MBQA 1X1MA 3MHSD 4C4VB 1E90A 2ZCBA 2G9HD 4DXFA 2GB1A 3RI7C 3PHWB 3QCAA 2WQYB 1SE2A 2L76A 2O2VB 2WXQA 2FCMA 2JXTA 1D5XC 2KFJA 5BYRA 4CHKA 4CO7A 3DBHB 1Z2MA 2GI9A 2LVPA 2NTSA 3ZKJC 2V0GA 1XLOA 5KHQA 2KJHB 2D5GA 1T3QA 1VDVA 4KIKA 2KANA 3AE8B 1AYFA 3DVNV 1WM3A 2E3TA 4HCNB 3JSVB 1E0ZA 2J7QB 5L95C 2CHWA 2YVCA 4A55A 3KH0A 3EA6A 2G4SA 2WXLA 1WM2A 3VVWB 2MBBB 2HD5B 3ZGZA 3DBSA 3L17A 3RNFC 4JL9A 2OJRA 1MFWA 5JHBA 1STEA 3DWGC 3SU8X 3PTFC 2NBWB 2N1WA 1TTNA 2IBIB 4XE0A 5G2NA 1DOYA 1RM6C 3KVFB 3CIRB 3VTWA 1I42A 3VRAB 3X23A 1R4MB 4REZA 3HM6X 4S17A 4II2B 2PVGC 2WXPA 1SIFA 1TKYA 4HPMB 1WXSA 3ZLZA 3T9LA 5EE9A 3ZJUA 5LXIB 2BYVE 2H89B 4PK1A 2NBVB 2JQRB 4HJKA 1AARA 2K8HA 2KC2A 4LTUA 1GB4A 3LXFA 2JF5A 3NY5A 1VRAB 2JY6A 1HTQA 1D5ZC 1SGHA 3DVGY 3OAWA 2CJNA 4AUQC 3K9OB 1R4NI 2QILA 5KHOA 1WGYA 1YQBA 1HEZE 4X57B 3H8HA 2Z0DB 3Q3JA 1UELA 5HFYA 1UWMA 4XWWA 3DHGC 2XK5A 2PIAA 4AP4C 2G1EA 2K25A 1S1QB 3TMPB 1ESFA 3B2FA 1WXAA 2B76B 2LFIA 1MVKA 2C7MB 2W3RA 1L4ZB 3QC8B 3ZNHB 1SE9A 1KLGD 3A9KA 3QWZB 1FXIA 2V4LA 3GOEA 4FULA 4WJNA 4QAYA 2Z0EB 2LHDA 1UH6A 2WDTB 5IKCM 2O6VD 4A9AA 3ZXRA 1F52A 1FXTB 2BKRB 2N4FA 5IO9A 2N0SB 1JMLA 4HKZE 1KOTA 4E74A 3BY4B 1H8CA 4HDQA 1QOGA 2LGDA 3AECB 2SAKA 4C00A 1V1PB 2WXOA 1GC6A 2FCQA 4GIVA 4J3OD 1L2NA 4RM8A 5AUKA 1QLBB 1RFAA 1K52A 2KKCA 1C76A 3TIXA 2IGHA 2KTRA 4ZRJA 4RGMA 2JUOA 1GG3A 1SE4A 1OEYJ 3FILB 2NCNA 1Z5SB 1EO6A 1VZ6A 3QK0A 4YT0B 2WXFA 2PPHA 2K8CA 4ACFA 1RAXA 4ZHPA 1SE3A 4FJYA 1T5XD 1WX8A 4MGYE 4PS7A 4C56C 4HJGE 1ZKHA 1TYGB 1V49A 3ZW3A 1E6EB 4JLCA 1WGHA 5FK9C 4FLHA 2L83A 5HHDG 1A5RA 4IWOA 1PGAA 1WSPA 4CQNA 3PT2B 2QIEB 3WANA 4IOIE 2BS2B 5LLIA 4JWUC 2LUEA 1ZPSA 2WS3B 2KN4A 1R4NB 5CHFA 3VXWA 1SIJA 1ZGUB 3SR6A 5H92C 2HJ8A 4W9KA 2DYMA 3S2AA 4WWNA 2KLGA 2KWCA 4MJSA 1IBXA 1FRDA 3N1ZC 4EEWA 5DPRA 3AE9B 4W9EA 3DCGA 2BYFA 3A4SC 4FJVB 1I4RA 4KGSA 1WWTA 2D3AA 1EU3A 3EHVA 3JVZX 2N1VA 4LNNA 1E8YA 2ZNVB 3H1UA 2MHJA 3R2IA 1RFKA 2BYTA 3VUWA 4DBGA 2IO1B 3ZTCA 4W9JA 1VLBA 1VD2A 2OHFA 1AWDA 2ZJDA 1XEEA 2PMVA 3ZYYX 3Q8CA 3UI3A 1OGWA 1E10A 1T0SC 4ZRKA 3FC4A 3X0WA 5IN7A 2JU6X 2BB5A 1YJ1A 2WX0A 2BQQA 2YLMA 4B6WA 1P3QU 2W54A 3DWMA 3M63B 5FKAC 4G50A 1XLNA 3HVZA 3AM9A 1JROA 2VRRB 2BWES 3PO0A 3Q14C 2KMAA 2MLBA 1K8RB 3QQ8B 4NNJB 2LGXA 2IZVB 3UQBA 4MDKE 1V97A 3AI5A 4W9DA 2FUHB 3SHQA 4AQ7A 2DYBA 3JW0X 4YTMB 4A3OA 1VJKA 2N9LA 4ZRPA 2KWVB 5IAAC 1XT9B 3BVGA 1OTRB 1Q10A 1WZ3A 2DENB 3IFWB 3I3TB 1GC7A 1C9FA 2V9HA 1HZ6A 2WXJA 1Y8RC 3NJTA 2PVOD 3ALBA 4A90A 4N59A 2WXKA 3TSSA 3Q8FA 4IC7B 1IGDA 3AE5B 4LK0M 1V6EA 1MG4A 4M00A 3BVZA 2ZPYA 3TEXA 1ET6A 4OZBA 2ZW1A 3QIJA 2RR9A 1C78A 4AWJA 4FHJA 4ZHOA 2M1MA 1I4GA 3RYTA 3NVWA 1YN5A 2KVRA 2J0JA 1JQ4A 5JXVA 2LASA 1RLFA 1WX9A 1WYGA 2DZKA 4HRSA 1F2RI 2E6XA 1V9JA 2LVQA 2MBEA 4DK5A 4XDDA 1YD8U 4PS3A 2K1FA 4MELA 1GPXA 1EWYC 1ZP0B 1XO3A 2CU1A 2IPKD 4GSWA 3ZVVA 4KZ0A 4IWQA 3B9JA 4MM3B 3BINA 3OLMD 1XLPA 3APDA 4WWMA 2WXHA 5GMVA 1U4AA 2X8XX 3GE3C 4N58A 3R66C 5IA7A 2N9EB 1WXVA 4BKGA 5MPOA 4LNKA 3M62B 1EF1A 2AQ2B 2LZ6A 2NPTB 4EFOA 2JYEA 2C9WB 4KX6B 1MHXA 3ENEA 3SDLC 3IT6B 4ANWA 3OJ4B 3ZRCA 3RNAC 2V1YA 1E8XA 1TY0A 5GXGB 3VRBB 4YL8A 2JWZA 3RZWC 2M19A 1M94A 2BS3B 2D2QA 1FMAD 4WJOA 2HTME 2INDC 5FR6A 4LJOB 4MT5A 4A6QA 4FA6A 3T8MA 2O6VB 1JCKB 3AH7A 2VZKB 5TSSA 3AEAB 1FM0D 4GXBA 4NPNA 3FAHA 2K8BA 3L4PA 2I38A 2LGYA 1VZ7A 2NVUI 3DOWA 3QARA 1MPEA 3N9YC 5EE0A 2Y5PA 4YTNB 4GDLA 3IXSA 4H2AA 3AMZA 2J0MA 3C8YA 1J7CA 2AEHA 1WXMA 2M8SA 4DDGD 3KUDB 5D94A 5AEKB 1PQSA 4MH8A 2K6QA 2C5LC 4TUUA 2CR5A 3AEEB 3VFKA 4K7UA 1K51A 1KTKA 4M0WB 1UUPA 2WXIA 3N1YC 2SEBD 1EUVB 4URKA 2ZCCA 1Q0WB 3IG3A 1PYWD 1YX5B 1T6BX 2AYOB 4HCPB 1CMXB 4BOZB 2DHZA 4F8CB 4MH0E 3DBHI 2DWQA 1JWMD 2KXJA 2MJEA 2RPVA 4MJSB 3W1SA 2LGIA 1FFUA 3L54A 3CSTA 1Y56A 1N5WA 3W5UB 4I6NB 4LJPB 4MSQB 2FUG1 3NOBA 1IP9A 2GBJA 3N3KB 2RGFA 3VR8B 3PZ7A 4ZYNA 2DBYA 2LEKA 2HJ1A 4WAFA 2W3SA 1FIQA 4M8NA 5E6NA 2X38A 2KTRB 1YOVB 2MEKA 2Q5WD 2R61A 5JHAA 3A1QA 1L0YB 2MBHA 1AN8A 3QA8A 2PEAA 1VZ8A 1L0XB 5EDSA 4JQWC 3U2SC 1UD7A 1YJIA 4DHJD 1R4MI 2L05A 3Q2AC 5E6OA 4WH4A 3RFZB 1WFYA 1G6JA 1KM7A 4GGQA 5C2TB 4W9CA 1NYQA 1JW9D 4ANUA 4TKNA 3VAWA 2MH7A 3AB5A 2KDMA 3C19A 1C4AA 3H7PB 2KYWA 2GBKA 3GE8C 2KAJA 4L1BA 5G5HA 4GDLB 2L0FA 2K9XA 5HG2A 4WAAA 3L10B 3NS8A 2BF8B 4KSLC 4G3XB 4BBNC 3PRZA 2LXCA 1FCCC 4WQMA 5D3IB 5EE3A 1TGZB 3H9DA 1FCLA 3B08A 4MGZE 3VTVA 4XDCA 1FXAA 5CHWA 3TL5A 3PZ8A 4EZLA 4RFBA 4MSMB 2K22A 3DDCB 2KT7A 1LQBA 2MW5A 4ICUA 2C7NB 4GU2A 4RGNA 1WJ4A 2PE9A 4MM3A 5C1ZA 4IUMB 3P4QB 3IAM1 2VZKD 4BZAA 1PGXA 1YX6B 3RUIB 3KWVA 2WYQA 1WR1A 4HWIB 4RCOA 2IO2B 3R8BA 3TBLD 3AE7B 4GDKB 2K6DB 3D32A 2ONQA 4P16A 2XNAC 2BB6A 5DPWA 3EGRA 3AN1A 1QOBA 1TT5B 4WURA 2MA9B 3ZO5B 2IJ0A 1WE6A 3MP9A 4TSSA 3W2DA 1V5OA 2EKIA 4RF1A 4NJ7A 2FAZA 2JSVX 3T3OA 3BWUD 2O2VA 2N9XA 3EFUA 2BPSA 4BKTA 4YSYB 1OQQA 2KZRA 1DYQA 1SF0A 2WXGA 3V62A 1XCQL 4P1CC 3V05A 3DHHC 1T0QC 4KGTA 1ZDXA 2HDEA 3HUIA 2Y3AA 2K0PA 2KDEB 2KDBA 1WMHA 2Y5CA 2LGSA 2IDYA 2REXA 3RULA 2MSED 2DZMA 2CHXA 4XC2A 2XK5B 1UWXA 3APCA 2INNE 1VR9A 1YN4A 1WJ6A 4NQKE 2HTHA 3V60A 3PLVA 4NZLB 3PRMB 3GS2A 5CHVC 1WY8A 1FFVA 2QHOA 2EELA 2FCNA 2KMMA 1OQYA 2AL6A 2OJWA 3AEFB 4UDUC 2JZZA 3KWLA 1E7UA 1P9DU 1WXQA 3MC8A 2WXNA 2V3NA 2BBCA 1C4CA 1N5XA 4HPLB 5DPTA 1UF0A 1WRIA 2MX2A 2M0AA 3MJWA 1GUAB 4DQOC 3A4RA 1RRBA 1WR6E 2UWQA 1GOZA 2QMTA 1B1ZA 3DVGX 1MHHE 4A8XC 3V3XA 3NZ3A 3H7SA 2KMCA 2BWFA 5E6JA 4N9F4 1JRUA 2L52A 1HTOA 2KHWB 3L08A 3RD2A 3I9V1 2KJRA 1L5PA 2M0XA 4WJPA 4BAXA 1RYJA 2ZPNA 3PV1A 4PYUA 1TBEA 4M02A 3NZSA 3Q8EA 1J19A 4LLGM 3PREA 4TMAB 1F1HA 4DXAB 3AULA 4HROA 4DHZE 2CHZA 1TS3A 1WF9A 1C77A 2FIFA 2JWUA 5BMGA 1UGMA 1NDDA 2J42A 4F7ZA 4OHJA 4ZRQA 2KACA 5JH5C 2D3BA 3E9SA 4Q2JA 2RD0A 1P7EA 2KJ6A 2MJDA 1LO5D 4K3BA 1BMLC 3APFA 3GZNB 4JX1C 4ARIA 3QX1A 3TJPA 2AQ1B 2IGDA 2CS4A 3PGEA 4OVZA 1V86A 3W5VB 2KO3A 2Y5BB 4P7IA 1TIFA 1GNUA 3RCZA 4XZ4A 4N6EB 5J17A 4P6VF 1CK1A 4BBNF 4MGIE 2L1AA 1D6EC 2TSSA 2KQ4X 5BMIA 1D3ZA 1IPGA 2W82A 1PUTA 2WWZA 3KUZA 4JGHB 5IOIA 5G55A 2N7JA 2GOWA 3N32A 3Q3NC 4WIPA 1SXTA 3PRPB 4W9GA 3NVVA 4OVVA 4EUTA 4E71A 3UQAA 3DQVA 2QJLA 2MJ3A 2R2OA 4LDTD 4DXGA 1SJHD 2JXXA 3AE2B 2LD9A 3R3MA 1V80A 4HDOA 3QAQA 1ZE3D 1KFYB 4XGAB 1ENFA 5CTRC 1K50A 2YEPB 4HLEA 1YQ4B 1ZOYB 3NVYA 2L0TA 3WIMA 3U52E 4C7ZA 2G4DB 2QC8A 4W9FA 1XF5L 3R2TA 1L6VA 2WHIA 2W55A 3ABVB 1I4PA 2C7HA 2V3SA 4K7SA 3I63C 2L7RA 4OZAA 1PGBA 4YXDB 1I35A 2D10A 2EKEC 2NTTA 2ZEQA 1F77A 1P0RA 3ECIA 2BS4B 4AJYB 3LB8C 2DX5B 3BVMA 4P1BC 1OEYA 1GAQB 3J9CA 4C80A 4MACA 1B9RA 4I6LB 3AE6B 3PS6A 1E8WA 2ZVOA 2PTLA 3A9JB 3VR9B 1NI3A 1NBFC 1EF5A 2WP9B 1SSNA 1ROEA 4HK2A 3MC0B 4BKSD 4L2YA 4PYZA 1WX7A
chains in the Genus database with same CATH topology
4CYEA 3A9KA 3PPAA 3QWZB 2JZ3B 3UF8A 2V4LA 2J0KA 2MP2B 3GOEA 2B3AA 3L16A 3PHXB 4FULA 4JIOU 4WJNA 4M8NA 5E6NA 2LXAA 2Z0EB 2WDTB 1UH6A 4LDTB 4HVBA 2O6VD 2KTRB 3M95A 1FXTB 2BKRB 2N4FA 3U30A 5BO4B 3WA0A 5JHAA 1VCBA 1KOTA 4E74A 3A1QA 3BY4B 3M3JA 1H8CA 4HDQA 2MBHA 2LGDA 3L13A 5D2MB 4KZCA 4J6IA 4RM9A 3QA8A 3U7DA 2PEAA 5EDSA 4JQWC 4DHZB 2MRPA 4ZDVA 3ZDMC 2I1KA 1GC6A 2FCQA 3TCAA 4GIVA 4B9KA 1L2NA 3H7PA 4EKUA 1UD7A 4RM8A 2KDIA 3A9KB 3CF6E 4DHJD 1R4MI 1WIAA 2DAFA 4AJWA 4GB9A 3IHPC 2L05A 5CX3A 4ZRIA 1RFAA 2KKCA 1WGRA 2GBNA 5E6OA 2KDFB 3TIXA 2KTRA 4ZRJA 4FADA 1LM8B 1WFYA 1G6JA 1KM7A 4GGQA 2JUOA 4W9CA 1GG3A 1OEYJ 4IM2A 2NCNA 2K39A 1Z5SB 3VQIA 5D7GA 4ANUA 1EO6A 3QK0A 4TKNA 2PPHA 2K8CA 3VAWA 1RAXA 2M17A 2G45B 4I6PA 1TZ1A 2KX0A 5C23A 2DYOA 3H7PB 3K9PB 4FJYA 2GBKA 4EZJA 3V6CB 5DCNA 2IY0B 1WX8A 4GDLB 4G11A 4NAWA 2L0FA 3QHTA 4MGYE 2L8JA 4PS7A 4GMVA 3L10B 4WAAA 5DPSA 1NI2A 2PJHA 3NS8A 2NPTA 4DDID 4EZKA 1LFDA 2I1JA 2BF8B 4WWOA 1ZKHA 4KSLC 4K1RB 2RPQA 1V49A 4G3XB 3ZW3A 4BBNC 4PS8A 2MBOA 3PRZA 4JLCA 1WGHA 2LXCA 3AXCA 2A4ZA 3VUYA 2OOBB 4FLHA 4IG7B 1TGZB 1A5RA 2BGFA 3H9DA 3B08A 4MGZE 3VTVA 4IWOA 4DHJB 2LRWA 5CHWA 3TL5A 3ZTDA 1WH3A 3VTUA 1E5WA 2KC1A 3R7QA 3PT2B 4KDLB 3WANA 3ZNGC 4EZLA 4MSMB 3DDCB 5LLIA 2HE7A 2N7DA 4IM3A 4DWFA 3AU5A 1LQBA 2MW5A 3VDZA 4EOYA 2LUEA 4ICUA 1MG8A 2C7NB 4GU2A 2IO0B 1WJ4A 2PE9A 4MM3A 3UIPB 4IUMB 5CHFA 3VXWA 4A3PA 4RMAA 5C1ZA 1L7YA 2D11A 2AWTA 5JZEB 1ZGUB 1YX6B 3RUIB 2HJ8A 3JSVA 4W9KA 1V81A 2DYMA 3IBEA 4WJQA 2L00B 4WWNA 3S2AA 2DZJA 2WYQA 1WR1A 2XBBC 2KLGA 4HWIB 2LVOA 3R7RA 2IO2B 2KWCA 4F1SA 2EMTA 4IW0A 4OVUA 2MWSB 4MJSA 3TBLD 1WGDA 2KOXA 4EEWA 3ZUNA 3A33B 5DPRA 4W9EA 4GDKB 2ASQA 1HE8A 3CSFA 3L0WB 1E8ZA 2K6DB 3D32A 3DCGA 3AU4A 2BYFA 3A4SC 4FJVB 5DPWA 3C0RB 2KFKA 3ML8A 3LDZE 2WX1A 3EHVA 3JVZX 2MA9B 1KJTA 2N1VA 3ZO5B 2AL3A 1WE6A 2GBMA 1E8YA 2JRHA 1V5OA 3ZIMA 2GMIC 5TR5A 2ZNVB 3H1UA 4NJ7A 3EC8A 2FAZA 4IM0A 2JRIB 3DPDA 2DAJA 2DZIA 2N9XA 2O2VA 2BPSA 3EFUA 4BKTA 3WAPA 2LJ5A 1F9JA 2CKHB 2KZRA 3VUWA 4DBGA 3V62A 1QZEA 2C60A 2IO1B 3ZTCA 2O6VA 4W9JA 2IYDB 2D07B 2ZZPB 3QJZA 3PZDA 1VD2A 2JVCA 1GJZA 3HHMA 3JYUA 3NHEB 2ZJDA 4IWPA 1WJNA 2KDEB 1OGWA 1WMHA 2KDBA 4G0NB 3SD5A 4ICVA 2REXA 3RULA 4ZRKA 1T0YA 2MSED 2DZMA 3NZUA 4W9IA 2JPHA 3WALA 3HK0A 2CHXA 3PLUA 2XK5B 4XC2A 3X0WA 4WQOB 3APCA 3P2BA 3WAMA 1WJ6A 1Q5WB 4NQKE 1V5TA 2FNJB 2HTHA 3V60A 3PLVA 3PVLA 3PRMB 4FJZA 2KWUB 1YJ1A 1S3SG 2WX0A 4NJ6A 4KDIC 5CHVC 1WY8A 5J18A 2YLMA 2QHOA 4B6WA 1P3QU 1WYWB 1P98A 2RSUA 5J2RA 3M63B 2FCNA 1OQYA 2AL6A 4G50A 3PSEB 3WAOA 1P1AA 1XD3B 2BWES 2VRRB 2MP2A 3DBRI 2JZZA 1E7UA 1P9DU 2KMAA 2MLBA 4FN2A 2FIDA 1K8RB 3QQ8B 4B95A 4TV3A 1ISNA 4NNJB 2LGXA 2IZVB 4NAWB 4HPLB 5DPTA 3UQBA 4MDKE 2MX2A 3AI5A 3MJWA 4GN1A 4MGKE 4NY0A 3A1QB 1GUAB 4W9DA 2NR2A 3RT3B 3A4RA 2FUHB 3SHQA 3IVFA 2DYBA 3UGBB 3ZNZB 3JW0X 1LXDA 5E6PA 3N30A 2M4NA 3B0AA 4HXDA 4A3OA 1WI0A 4BKSA 1J0GA 1RRBA 2KWVB 4LCDE 5IAAC 2EMSA 4FHKA 1WR6E 1XT9B 2R2QA 2ZNVC 1OTRB 1UBIA 2UWQA 1C1YB 1WZ3A 2N7EA 2DENB 2LI5A 3IFWB 4TQ1A 5AZFA 4K7WA 2L3ZA 4BFRA 3MTNB 3DVGX 3I3TB 2D3GA 2XEWA 2KLCA 1GC7A 2IY1B 2N9PC 2KD0A 3GZNI 4TQ0A 1Y8RC 2JT4B 3CMMB 3HIZA 1IYFA 3UINB 2G3QB 1WE7A 3H7SA 3U8ZA 2KMCA 3VUXA 2BWFA 2KN5A 3ALBA 4N9F4 1JRUA 2MCNB 2MQJA 2KHWB 4E3CA 2ZVNA 3L08A 3RD2A 2KJRA 2M0XA 4WJPA 1UBQA 2ZPNA 3PV1A 4PYUA 4IC7B 1KLVA 1TBEA 1V6EA 4KVGB 3UIOB 4AOFA 2ZPYA 3NZSA 2KNBA 5L83A 3QIJA 2RR9A 1J19A 3EECA 3ZRFA 5HKHA 2A5UA 2MBQA 1X1MA 3VHTC 4AWJA 3MHSD 4FHJA 3KUCB 3PREA 4PYZA 2M1MA 2KX3A 1BT0A 1E90A 3RYTA 4DXAB 2ZCBA 3AULA 4W9LA 4DHZE 2KVRA 2CHZA 2J0JA 2BYEA 1WF9A 2FIFA 3PHWB 3QCAA 4W9HA 2L76A 1UGMA 2O2VB 1NDDA 2FCMA 2LASA 2KFJA 1RLFA 1E7VA 4CHKA 1WX9A 4CO7A 4F7ZA 2DZKA 3O65B 3A9JA 2LVQA 1V9JA 1Z2MA 2MBEA 3ZDTA 5JH5C 2LVPA 4DK5A 2RD0A 2KJ6A 1YD8U 3LJ3A 4PS3A 2K1FA 3ZKJC 4MELA 5LXHA 1J8CA 5AZGA 3APFA 2CU1A 5KHQA 2KJHB 2KQ7A 4GSWA 3ZVVA 4KZ0A 4KIKA 1WMHB 4IWQA 3QX1A 2KANA 3DVNV 3BINA 3OLMD 3Q3FA 3TJPA 1WM3A 3APDA 2CS4A 5GMVA 4HCNB 1U4AA 3PGEA 3R66C 5IA7A 2N9EB 3JSVB 1V86A 1WXVA 3VH3B 4BKGA 2KO3A 1EF1A 2J7QB 2Y5BB 3M62B 4P7IA 4BVUC 5L95C 1GNUA 2CHWA 4XZ4A 2LZ6A 2YVCA 3RCZA 2NPTB 3KH0A 3DVNU 3KYCD 4EFOA 2C9WB 5AZHA 5J17A 3ENEA 1ZW7A 2G4SA 4GDKA 3SDLC 2BKFA 1WM2A 3VVWB 2MBBB 2KQSA 4ANWA 4BBNF 2HD5B 4MGIE 3OJ4B 3ZRCA 3DBSA 1D3ZA 1IPGA 2V1YA 3KW5B 1E8XA 2WWZA 3L17A 3KUZA 4JL9A 1WJUA 2OJRA 4YL8A 5D6JB 2JWZA 5JHBA 4JGHB 5G55A 3SU8X 3RZWC 2GOWA 1WZ0A 3N32A 3PTFC 4BOSC 4MEMA 3VH4B 1M94A 2NBWB 2D2QA 4WWPA 3RZFA 2N1WA 3PRPB 4ANXA 4W9GA 1TTNA 4WJOA 4OVVA 4LJOB 5FR6A 4EUTA 4E71A 3UQAA 3DQVA 2IBIB 2Z59B 1WGGA 4FA6A 4A20A 2R2OA 3T8MA 2O6VB 5G2NA 4LDTD 2JXXA 3KVFB 2LD9A 4II3B 3VTWA 3R3MA 4XX5A 1I42A 4GXBA 1V80A 2FCSA 4NPNA 3X23A 4HDOA 3QAQA 3HM6X 4K81A 2K8BA 4II2B 1SIFA 2LGYA 2NVUI 5CTRC 3DOWA 4KV2A 4HPMB 2W9NA 3QARA 1WXSA 3W1SC 4HLEA 3ZLZA 3T9LA 4GDLA 3KYDD 5LXIB 2L0TA 4FBJB 4GOCA 2BYVE 3WIMA 3HM3A 1H4RA 2J0MA 2KTFA 2LRUA 2AEHA 2NBVB 1WXMA 2M8SA 4M8MA 2G4DB 1AARA 2K8HA 2KC2A 3KUDB 4HJKA 5D94A 4DDGD 5AEKB 1PQSA 4W9FA 2GBRA 2K6QA 2C5LC 4TUUA 2CR5A 2PE6B 3VFKA 4K7UA 4M0WB 1YIWA 2JF5A 3NY5A 3ONSA 2JY6A 1V2YA 2C7HA 2V3SA 4K7SA 1EUVB 1SGHA 2ZCCA 3DVGY 3OAWA 4URKA 1Q0WB 3IG3A 3DBLI 3OJ3A 4NQLB 3V61A 1YX5B 1UZXB 2L7RA 3K9OB 4AUQC 2AYOB 1R4NI 4HCPB 5KHOA 1I35A 1WGYA 2D10A 1CMXB 2EKEC 1YQBA 4BOZB 2DHZA 2ZEQA 1P0RA 3ECIA 4X57B 4F8CB 4MH0E 4KSKC 2Z0DB 4AJYB 3Q3JA 3DBHI 3ML9A 1UELA 2DX5B 2KK8A 3B1LX 2KXJA 4MJSB 1OEYA 3W1SA 1XQQA 3V6EB 3L54A 3H6NA 2IO3B 3CSTA 2XK5A 4I6LB 3PS6A 4I6NB 4LJPB 4MSQB 1Q1OA 3ZNID 4AP4C 1E8WA 2K25A 2KFKB 2ZVOA 1S1QB 3NOBA 3TMPB 3A9JB 1WXAA 1C3TA 2NBUA 2C7MB 3W1YA 1IP9A 2GBJA 3N3KB 4KIKB 2RGFA 1NBFC 1EF5A 2UYZB 2NS5A 3QC8B 1WRDB 4HK2A 4ANVA 3ZNHB 1SE9A 4BKSD 4ZYNA 2LWPA 1WX7A 4ASWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  3A9K A;  3PPA A;  3QWZ B;  2JZ3 B;  3UF8 A;  2V4L A;  2J0K A;  2MP2 B;  3GOE A;  2B3A A;  3L16 A;  3PHX B;  4FUL A;  4JIO U;  4WJN A;  4M8N A;  5E6N A;  2LXA A;  2Z0E B;  2WDT B;  1UH6 A;  4LDT B;  4HVB A;  2O6V D;  2KTR B;  3M95 A;  1FXT B;  2BKR B;  2N4F A;  3U30 A;  5BO4 B;  3WA0 A;  5JHA A;  1VCB A;  1KOT A;  4E74 A;  3A1Q A;  3BY4 B;  3M3J A;  1H8C A;  4HDQ A;  2MBH A;  2LGD A;  3L13 A;  5D2M B;  4KZC A;  4J6I A;  4RM9 A;  3QA8 A;  3U7D A;  2PEA A;  5EDS A;  4JQW C;  4DHZ B;  2MRP A;  4ZDV A;  3ZDM C;  2I1K A;  1GC6 A;  2FCQ A;  3TCA A;  4GIV A;  4B9K A;  1L2N A;  3H7P A;  4EKU A;  1UD7 A;  4RM8 A;  2KDI A;  3A9K B;  3CF6 E;  4DHJ D;  1R4M I;  1WIA A;  2DAF A;  4AJW A;  4GB9 A;  3IHP C;  2L05 A;  5CX3 A;  4ZRI A;  1RFA A;  2KKC A;  1WGR A;  2GBN A;  5E6O A;  2KDF B;  3TIX A;  2KTR A;  4ZRJ A;  4FAD A;  1LM8 B;  1WFY A;  1G6J A;  1KM7 A;  4GGQ A;  2JUO A;  4W9C A;  1GG3 A;  1OEY J;  4IM2 A;  2NCN A;  2K39 A;  1Z5S B;  3VQI A;  5D7G A;  4ANU A;  1EO6 A;  3QK0 A;  4TKN A;  2PPH A;  2K8C A;  3VAW A;  1RAX A;  2M17 A;  2G45 B;  4I6P A;  1TZ1 A;  2KX0 A;  5C23 A;  2DYO A;  3H7P B;  3K9P B;  4FJY A;  2GBK A;  4EZJ A;  3V6C B;  5DCN A;  2IY0 B;  1WX8 A;  4GDL B;  4G11 A;  4NAW A;  2L0F A;  3QHT A;  4MGY E;  2L8J A;  4PS7 A;  4GMV A;  3L10 B;  4WAA A;  5DPS A;  1NI2 A;  2PJH A;  3NS8 A;  2NPT A;  4DDI D;  4EZK A;  1LFD A;  2I1J A;  2BF8 B;  4WWO A;  1ZKH A;  4KSL C;  4K1R B;  2RPQ A;  1V49 A;  4G3X B;  3ZW3 A;  4BBN C;  4PS8 A;  2MBO A;  3PRZ A;  4JLC A;  1WGH A;  2LXC A;  3AXC A;  2A4Z A;  3VUY A;  2OOB B;  4FLH A;  4IG7 B;  1TGZ B;  1A5R A;  2BGF A;  3H9D A;  3B08 A;  4MGZ E;  3VTV A;  4IWO A;  4DHJ B;  2LRW A;  5CHW A;  3TL5 A;  3ZTD A;  1WH3 A;  3VTU A;  1E5W A;  2KC1 A;  3R7Q A;  3PT2 B;  4KDL B;  3WAN A;  3ZNG C;  4EZL A;  4MSM B;  3DDC B;  5LLI A;  2HE7 A;  2N7D A;  4IM3 A;  4DWF A;  3AU5 A;  1LQB A;  2MW5 A;  3VDZ A;  4EOY A;  2LUE A;  4ICU A;  1MG8 A;  2C7N B;  4GU2 A;  2IO0 B;  1WJ4 A;  2PE9 A;  4MM3 A;  3UIP B;  4IUM B;  5CHF A;  3VXW A;  4A3P A;  4RMA A;  5C1Z A;  1L7Y A;  2D11 A;  2AWT A;  5JZE B;  1ZGU B;  1YX6 B;  3RUI B;  2HJ8 A;  3JSV A;  4W9K A;  1V81 A;  2DYM A;  3IBE A;  4WJQ A;  2L00 B;  4WWN A;  3S2A A;  2DZJ A;  2WYQ A;  1WR1 A;  2XBB C;  2KLG A;  4HWI B;  2LVO A;  3R7R A;  2IO2 B;  2KWC A;  4F1S A;  2EMT A;  4IW0 A;  4OVU A;  2MWS B;  4MJS A;  3TBL D;  1WGD A;  2KOX A;  4EEW A;  3ZUN A;  3A33 B;  5DPR A;  4W9E A;  4GDK B;  2ASQ A;  1HE8 A;  3CSF A;  3L0W B;  1E8Z A;  2K6D B;  3D32 A;  3DCG A;  3AU4 A;  2BYF A;  3A4S C;  4FJV B;  5DPW A;  3C0R B;  2KFK A;  3ML8 A;  3LDZ E;  2WX1 A;  3EHV A;  3JVZ X;  2MA9 B;  1KJT A;  2N1V A;  3ZO5 B;  2AL3 A;  1WE6 A;  2GBM A;  1E8Y A;  2JRH A;  1V5O A;  3ZIM A;  2GMI C;  5TR5 A;  2ZNV B;  3H1U A;  4NJ7 A;  3EC8 A;  2FAZ A;  4IM0 A;  2JRI B;  3DPD A;  2DAJ A;  2DZI A;  2N9X A;  2O2V A;  2BPS A;  3EFU A;  4BKT A;  3WAP A;  2LJ5 A;  1F9J A;  2CKH B;  2KZR A;  3VUW A;  4DBG A;  3V62 A;  1QZE A;  2C60 A;  2IO1 B;  3ZTC A;  2O6V A;  4W9J A;  2IYD B;  2D07 B;  2ZZP B;  3QJZ A;  3PZD A;  1VD2 A;  2JVC A;  1GJZ A;  3HHM A;  3JYU A;  3NHE B;  2ZJD A;  4IWP A;  1WJN A;  2KDE B;  1OGW A;  1WMH A;  2KDB A;  4G0N B;  3SD5 A;  4ICV A;  2REX A;  3RUL A;  4ZRK A;  1T0Y A;  2MSE D;  2DZM A;  3NZU A;  4W9I A;  2JPH A;  3WAL A;  3HK0 A;  2CHX A;  3PLU A;  2XK5 B;  4XC2 A;  3X0W A;  4WQO B;  3APC A;  3P2B A;  3WAM A;  1WJ6 A;  1Q5W B;  4NQK E;  1V5T A;  2FNJ B;  2HTH A;  3V60 A;  3PLV A;  3PVL A;  3PRM B;  4FJZ A;  2KWU B;  1YJ1 A;  1S3S G;  2WX0 A;  4NJ6 A;  4KDI C;  5CHV C;  1WY8 A;  5J18 A;  2YLM A;  2QHO A;  4B6W A;  1P3Q U;  1WYW B;  1P98 A;  2RSU A;  5J2R A;  3M63 B;  2FCN A;  1OQY A;  2AL6 A;  4G50 A;  3PSE B;  3WAO A;  1P1A A;  1XD3 B;  2BWE S;  2VRR B;  2MP2 A;  3DBR I;  2JZZ A;  1E7U A;  1P9D U;  2KMA A;  2MLB A;  4FN2 A;  2FID A;  1K8R B;  3QQ8 B;  4B95 A;  4TV3 A;  1ISN A;  4NNJ B;  2LGX A;  2IZV B;  4NAW B;  4HPL B;  5DPT A;  3UQB A;  4MDK E;  2MX2 A;  3AI5 A;  3MJW A;  4GN1 A;  4MGK E;  4NY0 A;  3A1Q B;  1GUA B;  4W9D A;  2NR2 A;  3RT3 B;  3A4R A;  2FUH B;  3SHQ A;  3IVF A;  2DYB A;  3UGB B;  3ZNZ B;  3JW0 X;  1LXD A;  5E6P A;  3N30 A;  2M4N A;  3B0A A;  4HXD A;  4A3O A;  1WI0 A;  4BKS A;  1J0G A;  1RRB A;  2KWV B;  4LCD E;  5IAA C;  2EMS A;  4FHK A;  1WR6 E;  1XT9 B;  2R2Q A;  2ZNV C;  1OTR B;  1UBI A;  2UWQ A;  1C1Y B;  1WZ3 A;  2N7E A;  2DEN B;  2LI5 A;  3IFW B;  4TQ1 A;  5AZF A;  4K7W A;  2L3Z A;  4BFR A;  3MTN B;  3DVG X;  3I3T B;  2D3G A;  2XEW A;  2KLC A;  1GC7 A;  2IY1 B;  2N9P C;  2KD0 A;  3GZN I;  4TQ0 A;  1Y8R C;  2JT4 B;  3CMM B;  3HIZ A;  1IYF A;  3UIN B;  2G3Q B;  1WE7 A;  3H7S A;  3U8Z A;  2KMC A;  3VUX A;  2BWF A;  2KN5 A;  3ALB A;  4N9F 4;  1JRU A;  2MCN B;  2MQJ A;  2KHW B;  4E3C A;  2ZVN A;  3L08 A;  3RD2 A;  2KJR A;  2M0X A;  4WJP A;  1UBQ A;  2ZPN A;  3PV1 A;  4PYU A;  4IC7 B;  1KLV A;  1TBE A;  1V6E A;  4KVG B;  3UIO B;  4AOF A;  2ZPY A;  3NZS A;  2KNB A;  5L83 A;  3QIJ A;  2RR9 A;  1J19 A;  3EEC A;  3ZRF A;  5HKH A;  2A5U A;  2MBQ A;  1X1M A;  3VHT C;  4AWJ A;  3MHS D;  4FHJ A;  3KUC B;  3PRE A;  4PYZ A;  2M1M A;  2KX3 A;  1BT0 A;  1E90 A;  3RYT A;  4DXA B;  2ZCB A;  3AUL A;  4W9L A;  4DHZ E;  2KVR A;  2CHZ A;  2J0J A;  2BYE A;  1WF9 A;  2FIF A;  3PHW B;  3QCA A;  4W9H A;  2L76 A;  1UGM A;  2O2V B;  1NDD A;  2FCM A;  2LAS A;  2KFJ A;  1RLF A;  1E7V A;  4CHK A;  1WX9 A;  4CO7 A;  4F7Z A;  2DZK A;  3O65 B;  3A9J A;  2LVQ A;  1V9J A;  1Z2M A;  2MBE A;  3ZDT A;  5JH5 C;  2LVP A;  4DK5 A;  2RD0 A;  2KJ6 A;  1YD8 U;  3LJ3 A;  4PS3 A;  2K1F A;  3ZKJ C;  4MEL A;  5LXH A;  1J8C A;  5AZG A;  3APF A;  2CU1 A;  5KHQ A;  2KJH B;  2KQ7 A;  4GSW A;  3ZVV A;  4KZ0 A;  4KIK A;  1WMH B;  4IWQ A;  3QX1 A;  2KAN A;  3DVN V;  3BIN A;  3OLM D;  3Q3F A;  3TJP A;  1WM3 A;  3APD A;  2CS4 A;  5GMV A;  4HCN B;  1U4A A;  3PGE A;  3R66 C;  5IA7 A;  2N9E B;  3JSV B;  1V86 A;  1WXV A;  3VH3 B;  4BKG A;  2KO3 A;  1EF1 A;  2J7Q B;  2Y5B B;  3M62 B;  4P7I A;  4BVU C;  5L95 C;  1GNU A;  2CHW A;  4XZ4 A;  2LZ6 A;  2YVC A;  3RCZ A;  2NPT B;  3KH0 A;  3DVN U;  3KYC D;  4EFO A;  2C9W B;  5AZH A;  5J17 A;  3ENE A;  1ZW7 A;  2G4S A;  4GDK A;  3SDL C;  2BKF A;  1WM2 A;  3VVW B;  2MBB B;  2KQS A;  4ANW A;  4BBN F;  2HD5 B;  4MGI E;  3OJ4 B;  3ZRC A;  3DBS A;  1D3Z A;  1IPG A;  2V1Y A;  3KW5 B;  1E8X A;  2WWZ A;  3L17 A;  3KUZ A;  4JL9 A;  1WJU A;  2OJR A;  4YL8 A;  5D6J B;  2JWZ A;  5JHB A;  4JGH B;  5G55 A;  3SU8 X;  3RZW C;  2GOW A;  1WZ0 A;  3N32 A;  3PTF C;  4BOS C;  4MEM A;  3VH4 B;  1M94 A;  2NBW B;  2D2Q A;  4WWP A;  3RZF A;  2N1W A;  3PRP B;  4ANX A;  4W9G A;  1TTN A;  4WJO A;  4OVV A;  4LJO B;  5FR6 A;  4EUT A;  4E71 A;  3UQA A;  3DQV A;  2IBI B;  2Z59 B;  1WGG A;  4FA6 A;  4A20 A;  2R2O A;  3T8M A;  2O6V B;  5G2N A;  4LDT D;  2JXX A;  3KVF B;  2LD9 A;  4II3 B;  3VTW A;  3R3M A;  4XX5 A;  1I42 A;  4GXB A;  1V80 A;  2FCS A;  4NPN A;  3X23 A;  4HDO A;  3QAQ A;  3HM6 X;  4K81 A;  2K8B A;  4II2 B;  1SIF A;  2LGY A;  2NVU I;  5CTR C;  3DOW A;  4KV2 A;  4HPM B;  2W9N A;  3QAR A;  1WXS A;  3W1S C;  4HLE A;  3ZLZ A;  3T9L A;  4GDL A;  3KYD D;  5LXI B;  2L0T A;  4FBJ B;  4GOC A;  2BYV E;  3WIM A;  3HM3 A;  1H4R A;  2J0M A;  2KTF A;  2LRU A;  2AEH A;  2NBV B;  1WXM A;  2M8S A;  4M8M A;  2G4D B;  1AAR A;  2K8H A;  2KC2 A;  3KUD B;  4HJK A;  5D94 A;  4DDG D;  5AEK B;  1PQS A;  4W9F A;  2GBR A;  2K6Q A;  2C5L C;  4TUU A;  2CR5 A;  2PE6 B;  3VFK A;  4K7U A;  4M0W B;  1YIW A;  2JF5 A;  3NY5 A;  3ONS A;  2JY6 A;  1V2Y A;  2C7H A;  2V3S A;  4K7S A;  1EUV B;  1SGH A;  2ZCC A;  3DVG Y;  3OAW A;  4URK A;  1Q0W B;  3IG3 A;  3DBL I;  3OJ3 A;  4NQL B;  3V61 A;  1YX5 B;  1UZX B;  2L7R A;  3K9O B;  4AUQ C;  2AYO B;  1R4N I;  4HCP B;  5KHO A;  1I35 A;  1WGY A;  2D10 A;  1CMX B;  2EKE C;  1YQB A;  4BOZ B;  2DHZ A;  2ZEQ A;  1P0R A;  3ECI A;  4X57 B;  4F8C B;  4MH0 E;  4KSK C;  2Z0D B;  4AJY B;  3Q3J A;  3DBH I;  3ML9 A;  1UEL A;  2DX5 B;  2KK8 A;  3B1L X;  2KXJ A;  4MJS B;  1OEY A;  3W1S A;  1XQQ A;  3V6E B;  3L54 A;  3H6N A;  2IO3 B;  3CST A;  2XK5 A;  4I6L B;  3PS6 A;  4I6N B;  4LJP B;  4MSQ B;  1Q1O A;  3ZNI D;  4AP4 C;  1E8W A;  2K25 A;  2KFK B;  2ZVO A;  1S1Q B;  3NOB A;  3TMP B;  3A9J B;  1WXA A;  1C3T A;  2NBU A;  2C7M B;  3W1Y A;  1IP9 A;  2GBJ A;  3N3K B;  4KIK B;  2RGF A;  1NBF C;  1EF5 A;  2UYZ B;  2NS5 A;  3QC8 B;  1WRD B;  4HK2 A;  4ANV A;  3ZNH B;  1SE9 A;  4BKS D;  4ZYN A;  2LWP A;  1WX7 A;  4ASW C; 
#chains in the Genus database with same CATH topology
 2VH1 A;  3PPA A;  1UNS A;  3UF8 A;  2MP2 B;  2B3A A;  3L16 A;  3PHX B;  4JWS C;  1HA5 A;  4B0M A;  2LXA A;  1I4X A;  3M95 A;  2PKO A;  3U30 A;  5BO4 B;  3KLS X;  3FIL A;  1KF6 B;  5D2M B;  3L13 A;  4KZC A;  3U7D A;  4RM9 A;  1KH0 A;  4DHZ B;  1HQR D;  3ZDM C;  1NYR A;  3Q8A A;  4B9K A;  2L32 A;  3SFD B;  3CF6 E;  1PDX A;  2DAF A;  1WIA A;  4GB9 A;  5CX3 A;  1LM8 B;  3RNG C;  1NEN B;  4IM2 A;  2K39 A;  4XYC A;  4B0E A;  3Q8B A;  4LNO A;  1AW7 A;  4I6P A;  2BT6 A;  3ZQ4 A;  1TZ1 A;  3U7Z A;  3Q6B A;  2DYO A;  2KVZ A;  3K9P B;  5AUI A;  3OWE B;  1PFD A;  2IY0 B;  2L8J A;  4GMV A;  5DPS A;  1NI2 A;  2PJH A;  2NPT A;  4DDI D;  4RNA A;  1LFD A;  2I1J A;  2V3P A;  4NJC A;  4IKG A;  2RPQ A;  3P1M A;  1N62 A;  3AE3 B;  4YSZ B;  3NRZ A;  2OOB B;  4IG7 B;  2BGF A;  3W9C B;  1I4Q A;  4DHJ B;  2LRW A;  2RDB C;  2KWD A;  1WH3 A;  3AE4 B;  3BK1 A;  3R7Q A;  4M0W A;  3AU5 A;  4EOY A;  1MG8 A;  2IO0 B;  1L7Y A;  2D11 A;  2AWT A;  2ICI A;  5JZE B;  2K5P A;  4WJQ A;  1CQV A;  1ZUD 2;  2UU7 A;  2XBB C;  3R7R A;  4F1S A;  4IW0 A;  5BYS A;  4OVU A;  2V4I B;  1DOX A;  1WGD A;  3ZUN A;  3A33 B;  1IGC A;  4AS1 A;  1HE8 A;  3L0W B;  4ZYS A;  2KFK A;  3ML8 A;  1N61 A;  3B2G A;  4M01 A;  1N6Z A;  1SB3 C;  1KJT A;  2VH2 A;  3ZXV A;  2WDR B;  2JRH A;  3NUH B;  3ZIM A;  2GMI C;  5TR5 A;  4ZOH C;  2H88 B;  2DLB A;  3EC8 A;  3RN9 C;  2JRI B;  2DAJ A;  2DZI A;  3WAP A;  2LJ5 A;  2CKH B;  3P4R B;  1D5M C;  3WCQ A;  1QZE A;  2O6V A;  2ZZP B;  4K3C A;  3QJZ A;  1IUE A;  1CJE A;  1GJZ A;  3HHM A;  3BYY B;  1L4D B;  4IWP A;  1YNT E;  5EE1 A;  4ICV A;  1OQR A;  1JWA D;  2K3U A;  2WNM A;  2YEP F;  3P4P B;  1T0Y A;  3NZU A;  1FNV A;  1XCT L;  3WAL A;  3PLU A;  4WQO B;  3P2B A;  3WAM A;  1Q5W B;  3TUO A;  2NMQ A;  3PVL A;  2JYT A;  4FJZ A;  2J52 A;  1WYW B;  5J2R A;  1YN3 A;  2ZW0 A;  1M4V A;  1FEH A;  3WAO A;  2INP E;  2QSD A;  1XD3 B;  2FE8 A;  1SEB D;  4B95 A;  2GRI A;  5C3J B;  4NAW B;  3LYY A;  1V1O A;  4S0R A;  4MGK E;  4NY0 A;  3A1Q B;  2NR2 A;  2FBW B;  2Z8L A;  5G5G A;  3ZNZ B;  2M4N A;  3B0A A;  2OED A;  1WI0 A;  1A70 A;  4BKS A;  3AED B;  1J0G A;  4LCD E;  2EMS A;  1LGR A;  2ZNV C;  4KKI A;  1UBI A;  2N7E A;  2WU2 B;  3CWI A;  1D4B A;  4K7W A;  2L3Z A;  4YSX B;  2JX5 A;  3NS1 A;  3MJ5 A;  4C4V A;  1EWC A;  1I7H A;  2QCZ A;  2N9P C;  2WXR A;  1UGJ A;  3RNB C;  3UIN B;  1JAL A;  2WXM A;  3VUX A;  4GLS C;  1F0Z A;  1KLV A;  1L0V B;  3HVD A;  4OW0 A;  1QOA A;  4KVG B;  3T3N A;  3HRD D;  3P42 A;  2KNB A;  5L83 A;  3TEW A;  3EEC A;  1OFF A;  3ZRF A;  1JWU D;  1YQ3 B;  3GB1 A;  3VHT C;  3KUC B;  2KX3 A;  1BT0 A;  2AX5 A;  4HEA 1;  4RF0 A;  4W9L A;  1E9M A;  2BYE A;  4W9H A;  3N20 C;  4L23 A;  4PT5 A;  1NEK B;  1E7V A;  1TS2 A;  3O65 B;  3A9J A;  3ZDT A;  2WU5 B;  3ETR A;  3LJ3 A;  5LXH A;  4LNF A;  1J8C A;  5AZG A;  4OZC A;  2KQ7 A;  1WMH B;  1P7F A;  3Q3F A;  3FKY A;  3ZJV A;  3AEB B;  2GLS A;  1ET9 A;  1T0R C;  2PW9 A;  3RNC C;  3VH3 B;  4BVU C;  1C4P A;  1TKG A;  3DVN U;  1YJJ A;  3AEG B;  3KYC D;  5AZH A;  1ZW7 A;  4GDK A;  2BKF A;  4JE3 B;  1FPY A;  2KQS A;  1BXT A;  3KW5 B;  3I57 A;  4KGR A;  5FR3 A;  1F2R C;  1WJU A;  5D6J B;  3SFE B;  5LNK 1;  3O13 A;  1ZXI A;  4BOS C;  4MEM A;  3VH4 B;  4WWP A;  4RH6 A;  3RZF A;  1QQR A;  2DNF A;  4ANX A;  2Z59 B;  1WGG A;  4A20 A;  2I2Y A;  3TEY A;  1JRP A;  1CZP A;  1SJE D;  4O1N A;  4II3 B;  4XX5 A;  2FCS A;  1FNU A;  4NAM A;  4K81 A;  2IGG A;  1QIL A;  4KV2 A;  3W1S C;  2W9N A;  1L6U A;  1FO4 A;  2N9K A;  3KYD D;  2M56 B;  4FBJ B;  4GOC A;  1EM7 A;  3HM3 A;  1H4R A;  2KTF A;  2LRU A;  3GP7 A;  4M8M A;  4C7Y A;  2WLB A;  1TY2 A;  3BII D;  2BW2 A;  1N60 A;  2GBR A;  2J4X A;  2PE6 B;  1TS4 A;  1KLU D;  3DHI C;  1YIW A;  3ONS A;  1V2Y A;  2LMC A;  3OJ3 A;  3V61 A;  3DBL I;  4NQL B;  1UZX B;  4R3D A;  1FD6 A;  4EE2 A;  4KSK C;  3MC9 A;  2LUM A;  3ML9 A;  2KK8 A;  3B1L X;  1MJD A;  3DBR B;  1XQQ A;  3V6E B;  3H6N A;  2IO3 B;  1Q1O A;  3ZNI D;  2KFK B;  3NG0 A;  2RDH A;  1C3T A;  2NBU A;  3W1Y A;  4KIK B;  2UYZ B;  3IAS 1;  2NS5 A;  1WRD B;  4ANV A;  2AQ3 B;  2XN9 C;  2LWP A;  1WZ0 A;  4ASW C;  4CYE A;  2JZ3 B;  5H8Y E;  2J0K A;  4JIO U;  1ACC A;  3EFC A;  4LDT B;  4HVB A;  1ZXH A;  3WA0 A;  1VCB A;  3SEB A;  3M3J A;  1DOI A;  4J6I A;  4JPS A;  1V8C A;  2MRP A;  4ZDV A;  3TEZ A;  2I1K A;  3TCA A;  3H7P A;  4EKU A;  2KDI A;  3A9K B;  4AJW A;  3MHZ A;  3IHP C;  4ZRI A;  1WGR A;  2GBN A;  2KDF B;  4FAD A;  4YWG G;  1ZDV A;  4HKQ A;  3RPF C;  3VQI A;  5D7G A;  1TJE A;  1FRR A;  1EU4 A;  2ON8 A;  4FXC A;  1I4H A;  2M17 A;  2G45 B;  2KX0 A;  5C23 A;  2LHE A;  4EZJ A;  3V6C B;  5DCN A;  4G11 A;  4NAW A;  3QHT A;  1XLQ A;  3P4S B;  4EZK A;  4WWO A;  4K1R B;  1SBB B;  1HZ5 A;  1C79 A;  4PS8 A;  4US9 A;  2BTE A;  2MBO A;  3AXC A;  2A4Z A;  1FNW A;  3VUY A;  1YMH E;  4D2K A;  3ZTD A;  1HXY D;  3VTU A;  1E5W A;  2INC C;  2KC1 A;  1KRH A;  1XXG A;  4KDL B;  3ZNG C;  4DWF A;  2HE7 A;  2N7D A;  4IM3 A;  3VDZ A;  3UIP B;  4A3P A;  1BUI C;  4RMA A;  3NVZ A;  4HPP A;  3JSV A;  1J7A A;  1V81 A;  3IBE A;  2L00 B;  2DZJ A;  2LVO A;  2WDV B;  3RNE C;  2EMT A;  3N1X C;  2MWS B;  4USA A;  1K53 A;  2KOX A;  2ASQ A;  4RGT A;  3CSF A;  1E8Z A;  3AU4 A;  3OG5 A;  3C0R B;  4IDI A;  3LDZ E;  2WX1 A;  5T8I A;  3ZJT A;  3I5J C;  2AL3 A;  2GBM A;  4IM0 A;  1GB1 A;  3DPD A;  5I4D A;  2WGS A;  3Q3O C;  1F9J A;  4LNI A;  4XWT A;  1IBX B;  2C60 A;  1V1P A;  3Q3M C;  2IYD B;  1JWB D;  2D07 B;  3PZD A;  5D3D A;  2JVC A;  3JYU A;  3NHE B;  3E56 A;  4YTP B;  2BVC A;  1TKE A;  1WGK A;  3EUB 2;  3P63 A;  1WJN A;  3BZD B;  4G0N B;  3SD5 A;  1QKZ A;  3KQ4 A;  2QEJ C;  1QOF A;  4W9I A;  2JPH A;  4ITK A;  3HK0 A;  2ACZ B;  1QF6 A;  5BYQ A;  2CU3 A;  1V5T A;  2FNJ B;  1TZO A;  2KWU B;  1S3S G;  4NJ6 A;  4KDI C;  5BMH A;  5J18 A;  2RDG A;  1P98 A;  4RGO S;  2RSU A;  3RMK C;  4US8 A;  3PSE B;  2RMM A;  3U4E G;  1P1A A;  2MP2 A;  3DBR I;  5HI1 A;  4FN2 A;  2FID A;  2D3C A;  2J53 A;  2PLP A;  4TV3 A;  3URY A;  1ISN A;  3BYT B;  1RWS A;  4GN1 A;  2LJI A;  1NVI D;  3RT3 B;  3Q69 A;  3AV8 A;  3IVF A;  3UGB B;  1LXD A;  5E6P A;  3N30 A;  4HXD A;  1E7P B;  4FHK A;  2R2Q A;  1C1Y B;  4ARC A;  2LI5 A;  4TQ1 A;  2WDQ B;  5AZF A;  2CJO A;  4BFR A;  3MTN B;  2QDF A;  2D3G A;  2XEW A;  2KLC A;  3DBL B;  2IY1 B;  2KD0 A;  3GZN I;  4TQ0 A;  2JT4 B;  3HIZ A;  3CMM B;  1IYF A;  1R7S A;  1WE7 A;  2G3Q B;  3U8Z A;  2KN5 A;  5IP4 D;  2MCN B;  2MQJ A;  3IT4 B;  1TS5 A;  4E3C A;  2ZVN A;  1J7B A;  1MI0 A;  1UBQ A;  1QT9 A;  3AE1 B;  1JWS D;  3MFG A;  3UIO B;  4AOF A;  4KKJ A;  1DGJ A;  1N63 A;  3BK2 A;  5HKH A;  2JZP A;  2A5U A;  2MBQ A;  1X1M A;  3MHS D;  4C4V B;  1E90 A;  2ZCB A;  2G9H D;  4DXF A;  2GB1 A;  3RI7 C;  3PHW B;  3QCA A;  2WQY B;  1SE2 A;  2L76 A;  2O2V B;  2WXQ A;  2FCM A;  2JXT A;  1D5X C;  2KFJ A;  5BYR A;  4CHK A;  4CO7 A;  3DBH B;  1Z2M A;  2GI9 A;  2LVP A;  2NTS A;  3ZKJ C;  2V0G A;  1XLO A;  5KHQ A;  2KJH B;  2D5G A;  1T3Q A;  1VDV A;  4KIK A;  2KAN A;  3AE8 B;  1AYF A;  3DVN V;  1WM3 A;  2E3T A;  4HCN B;  3JSV B;  1E0Z A;  2J7Q B;  5L95 C;  2CHW A;  2YVC A;  4A55 A;  3KH0 A;  3EA6 A;  2G4S A;  2WXL A;  1WM2 A;  3VVW B;  2MBB B;  2HD5 B;  3ZGZ A;  3DBS A;  3L17 A;  3RNF C;  4JL9 A;  2OJR A;  1MFW A;  5JHB A;  1STE A;  3DWG C;  3SU8 X;  3PTF C;  2NBW B;  2N1W A;  1TTN A;  2IBI B;  4XE0 A;  5G2N A;  1DOY A;  1RM6 C;  3KVF B;  3CIR B;  3VTW A;  1I42 A;  3VRA B;  3X23 A;  1R4M B;  4REZ A;  3HM6 X;  4S17 A;  4II2 B;  2PVG C;  2WXP A;  1SIF A;  1TKY A;  4HPM B;  1WXS A;  3ZLZ A;  3T9L A;  5EE9 A;  3ZJU A;  5LXI B;  2BYV E;  2H89 B;  4PK1 A;  2NBV B;  2JQR B;  4HJK A;  1AAR A;  2K8H A;  2KC2 A;  4LTU A;  1GB4 A;  3LXF A;  2JF5 A;  3NY5 A;  1VRA B;  2JY6 A;  1HTQ A;  1D5Z C;  1SGH A;  3DVG Y;  3OAW A;  2CJN A;  4AUQ C;  3K9O B;  1R4N I;  2QIL A;  5KHO A;  1WGY A;  1YQB A;  1HEZ E;  4X57 B;  3H8H A;  2Z0D B;  3Q3J A;  1UEL A;  5HFY A;  1UWM A;  4XWW A;  3DHG C;  2XK5 A;  2PIA A;  4AP4 C;  2G1E A;  2K25 A;  1S1Q B;  3TMP B;  1ESF A;  3B2F A;  1WXA A;  2B76 B;  2LFI A;  1MVK A;  2C7M B;  2W3R A;  1L4Z B;  3QC8 B;  3ZNH B;  1SE9 A;  1KLG D;  3A9K A;  3QWZ B;  1FXI A;  2V4L A;  3GOE A;  4FUL A;  4WJN A;  4QAY A;  2Z0E B;  2LHD A;  1UH6 A;  2WDT B;  5IKC M;  2O6V D;  4A9A A;  3ZXR A;  1F52 A;  1FXT B;  2BKR B;  2N4F A;  5IO9 A;  2N0S B;  1JML A;  4HKZ E;  1KOT A;  4E74 A;  3BY4 B;  1H8C A;  4HDQ A;  1QOG A;  2LGD A;  3AEC B;  2SAK A;  4C00 A;  1V1P B;  2WXO A;  1GC6 A;  2FCQ A;  4GIV A;  4J3O D;  1L2N A;  4RM8 A;  5AUK A;  1QLB B;  1RFA A;  1K52 A;  2KKC A;  1C76 A;  3TIX A;  2IGH A;  2KTR A;  4ZRJ A;  4RGM A;  2JUO A;  1GG3 A;  1SE4 A;  1OEY J;  3FIL B;  2NCN A;  1Z5S B;  1EO6 A;  1VZ6 A;  3QK0 A;  4YT0 B;  2WXF A;  2PPH A;  2K8C A;  4ACF A;  1RAX A;  4ZHP A;  1SE3 A;  4FJY A;  1T5X D;  1WX8 A;  4MGY E;  4PS7 A;  4C56 C;  4HJG E;  1ZKH A;  1TYG B;  1V49 A;  3ZW3 A;  1E6E B;  4JLC A;  1WGH A;  5FK9 C;  4FLH A;  2L83 A;  5HHD G;  1A5R A;  4IWO A;  1PGA A;  1WSP A;  4CQN A;  3PT2 B;  2QIE B;  3WAN A;  4IOI E;  2BS2 B;  5LLI A;  4JWU C;  2LUE A;  1ZPS A;  2WS3 B;  2KN4 A;  1R4N B;  5CHF A;  3VXW A;  1SIJ A;  1ZGU B;  3SR6 A;  5H92 C;  2HJ8 A;  4W9K A;  2DYM A;  3S2A A;  4WWN A;  2KLG A;  2KWC A;  4MJS A;  1IBX A;  1FRD A;  3N1Z C;  4EEW A;  5DPR A;  3AE9 B;  4W9E A;  3DCG A;  2BYF A;  3A4S C;  4FJV B;  1I4R A;  4KGS A;  1WWT A;  2D3A A;  1EU3 A;  3EHV A;  3JVZ X;  2N1V A;  4LNN A;  1E8Y A;  2ZNV B;  3H1U A;  2MHJ A;  3R2I A;  1RFK A;  2BYT A;  3VUW A;  4DBG A;  2IO1 B;  3ZTC A;  4W9J A;  1VLB A;  1VD2 A;  2OHF A;  1AWD A;  2ZJD A;  1XEE A;  2PMV A;  3ZYY X;  3Q8C A;  3UI3 A;  1OGW A;  1E10 A;  1T0S C;  4ZRK A;  3FC4 A;  3X0W A;  5IN7 A;  2JU6 X;  2BB5 A;  1YJ1 A;  2WX0 A;  2BQQ A;  2YLM A;  4B6W A;  1P3Q U;  2W54 A;  3DWM A;  3M63 B;  5FKA C;  4G50 A;  1XLN A;  3HVZ A;  3AM9 A;  1JRO A;  2VRR B;  2BWE S;  3PO0 A;  3Q14 C;  2KMA A;  2MLB A;  1K8R B;  3QQ8 B;  4NNJ B;  2LGX A;  2IZV B;  3UQB A;  4MDK E;  1V97 A;  3AI5 A;  4W9D A;  2FUH B;  3SHQ A;  4AQ7 A;  2DYB A;  3JW0 X;  4YTM B;  4A3O A;  1VJK A;  2N9L A;  4ZRP A;  2KWV B;  5IAA C;  1XT9 B;  3BVG A;  1OTR B;  1Q10 A;  1WZ3 A;  2DEN B;  3IFW B;  3I3T B;  1GC7 A;  1C9F A;  2V9H A;  1HZ6 A;  2WXJ A;  1Y8R C;  3NJT A;  2PVO D;  3ALB A;  4A90 A;  4N59 A;  2WXK A;  3TSS A;  3Q8F A;  4IC7 B;  1IGD A;  3AE5 B;  4LK0 M;  1V6E A;  1MG4 A;  4M00 A;  3BVZ A;  2ZPY A;  3TEX A;  1ET6 A;  4OZB A;  2ZW1 A;  3QIJ A;  2RR9 A;  1C78 A;  4AWJ A;  4FHJ A;  4ZHO A;  2M1M A;  1I4G A;  3RYT A;  3NVW A;  1YN5 A;  2KVR A;  2J0J A;  1JQ4 A;  5JXV A;  2LAS A;  1RLF A;  1WX9 A;  1WYG A;  2DZK A;  4HRS A;  1F2R I;  2E6X A;  1V9J A;  2LVQ A;  2MBE A;  4DK5 A;  4XDD A;  1YD8 U;  4PS3 A;  2K1F A;  4MEL A;  1GPX A;  1EWY C;  1ZP0 B;  1XO3 A;  2CU1 A;  2IPK D;  4GSW A;  3ZVV A;  4KZ0 A;  4IWQ A;  3B9J A;  4MM3 B;  3BIN A;  3OLM D;  1XLP A;  3APD A;  4WWM A;  2WXH A;  5GMV A;  1U4A A;  2X8X X;  3GE3 C;  4N58 A;  3R66 C;  5IA7 A;  2N9E B;  1WXV A;  4BKG A;  5MPO A;  4LNK A;  3M62 B;  1EF1 A;  2AQ2 B;  2LZ6 A;  2NPT B;  4EFO A;  2JYE A;  2C9W B;  4KX6 B;  1MHX A;  3ENE A;  3SDL C;  3IT6 B;  4ANW A;  3OJ4 B;  3ZRC A;  3RNA C;  2V1Y A;  1E8X A;  1TY0 A;  5GXG B;  3VRB B;  4YL8 A;  2JWZ A;  3RZW C;  2M19 A;  1M94 A;  2BS3 B;  2D2Q A;  1FMA D;  4WJO A;  2HTM E;  2IND C;  5FR6 A;  4LJO B;  4MT5 A;  4A6Q A;  4FA6 A;  3T8M A;  2O6V B;  1JCK B;  3AH7 A;  2VZK B;  5TSS A;  3AEA B;  1FM0 D;  4GXB A;  4NPN A;  3FAH A;  2K8B A;  3L4P A;  2I38 A;  2LGY A;  1VZ7 A;  2NVU I;  3DOW A;  3QAR A;  1MPE A;  3N9Y C;  5EE0 A;  2Y5P A;  4YTN B;  4GDL A;  3IXS A;  4H2A A;  3AMZ A;  2J0M A;  3C8Y A;  1J7C A;  2AEH A;  1WXM A;  2M8S A;  4DDG D;  3KUD B;  5D94 A;  5AEK B;  1PQS A;  4MH8 A;  2K6Q A;  2C5L C;  4TUU A;  2CR5 A;  3AEE B;  3VFK A;  4K7U A;  1K51 A;  1KTK A;  4M0W B;  1UUP A;  2WXI A;  3N1Y C;  2SEB D;  1EUV B;  4URK A;  2ZCC A;  1Q0W B;  3IG3 A;  1PYW D;  1YX5 B;  1T6B X;  2AYO B;  4HCP B;  1CMX B;  4BOZ B;  2DHZ A;  4F8C B;  4MH0 E;  3DBH I;  2DWQ A;  1JWM D;  2KXJ A;  2MJE A;  2RPV A;  4MJS B;  3W1S A;  2LGI A;  1FFU A;  3L54 A;  3CST A;  1Y56 A;  1N5W A;  3W5U B;  4I6N B;  4LJP B;  4MSQ B;  2FUG 1;  3NOB A;  1IP9 A;  2GBJ A;  3N3K B;  2RGF A;  3VR8 B;  3PZ7 A;  4ZYN A;  2DBY A;  2LEK A;  2HJ1 A;  4WAF A;  2W3S A;  1FIQ A;  4M8N A;  5E6N A;  2X38 A;  2KTR B;  1YOV B;  2MEK A;  2Q5W D;  2R61 A;  5JHA A;  3A1Q A;  1L0Y B;  2MBH A;  1AN8 A;  3QA8 A;  2PEA A;  1VZ8 A;  1L0X B;  5EDS A;  4JQW C;  3U2S C;  1UD7 A;  1YJI A;  4DHJ D;  1R4M I;  2L05 A;  3Q2A C;  5E6O A;  4WH4 A;  3RFZ B;  1WFY A;  1G6J A;  1KM7 A;  4GGQ A;  5C2T B;  4W9C A;  1NYQ A;  1JW9 D;  4ANU A;  4TKN A;  3VAW A;  2MH7 A;  3AB5 A;  2KDM A;  3C19 A;  1C4A A;  3H7P B;  2KYW A;  2GBK A;  3GE8 C;  2KAJ A;  4L1B A;  5G5H A;  4GDL B;  2L0F A;  2K9X A;  5HG2 A;  4WAA A;  3L10 B;  3NS8 A;  2BF8 B;  4KSL C;  4G3X B;  4BBN C;  3PRZ A;  2LXC A;  1FCC C;  4WQM A;  5D3I B;  5EE3 A;  1TGZ B;  3H9D A;  1FCL A;  3B08 A;  4MGZ E;  3VTV A;  4XDC A;  1FXA A;  5CHW A;  3TL5 A;  3PZ8 A;  4EZL A;  4RFB A;  4MSM B;  2K22 A;  3DDC B;  2KT7 A;  1LQB A;  2MW5 A;  4ICU A;  2C7N B;  4GU2 A;  4RGN A;  1WJ4 A;  2PE9 A;  4MM3 A;  5C1Z A;  4IUM B;  3P4Q B;  3IAM 1;  2VZK D;  4BZA A;  1PGX A;  1YX6 B;  3RUI B;  3KWV A;  2WYQ A;  1WR1 A;  4HWI B;  4RCO A;  2IO2 B;  3R8B A;  3TBL D;  3AE7 B;  4GDK B;  2K6D B;  3D32 A;  2ONQ A;  4P16 A;  2XNA C;  2BB6 A;  5DPW A;  3EGR A;  3AN1 A;  1QOB A;  1TT5 B;  4WUR A;  2MA9 B;  3ZO5 B;  2IJ0 A;  1WE6 A;  3MP9 A;  4TSS A;  3W2D A;  1V5O A;  2EKI A;  4RF1 A;  4NJ7 A;  2FAZ A;  2JSV X;  3T3O A;  3BWU D;  2O2V A;  2N9X A;  3EFU A;  2BPS A;  4BKT A;  4YSY B;  1OQQ A;  2KZR A;  1DYQ A;  1SF0 A;  2WXG A;  3V62 A;  1XCQ L;  4P1C C;  3V05 A;  3DHH C;  1T0Q C;  4KGT A;  1ZDX A;  2HDE A;  3HUI A;  2Y3A A;  2K0P A;  2KDE B;  2KDB A;  1WMH A;  2Y5C A;  2LGS A;  2IDY A;  2REX A;  3RUL A;  2MSE D;  2DZM A;  2CHX A;  4XC2 A;  2XK5 B;  1UWX A;  3APC A;  2INN E;  1VR9 A;  1YN4 A;  1WJ6 A;  4NQK E;  2HTH A;  3V60 A;  3PLV A;  4NZL B;  3PRM B;  3GS2 A;  5CHV C;  1WY8 A;  1FFV A;  2QHO A;  2EEL A;  2FCN A;  2KMM A;  1OQY A;  2AL6 A;  2OJW A;  3AEF B;  4UDU C;  2JZZ A;  3KWL A;  1E7U A;  1P9D U;  1WXQ A;  3MC8 A;  2WXN A;  2V3N A;  2BBC A;  1C4C A;  1N5X A;  4HPL B;  5DPT A;  1UF0 A;  1WRI A;  2MX2 A;  2M0A A;  3MJW A;  1GUA B;  4DQO C;  3A4R A;  1RRB A;  1WR6 E;  2UWQ A;  1GOZ A;  2QMT A;  1B1Z A;  3DVG X;  1MHH E;  4A8X C;  3V3X A;  3NZ3 A;  3H7S A;  2KMC A;  2BWF A;  5E6J A;  4N9F 4;  1JRU A;  2L52 A;  1HTO A;  2KHW B;  3L08 A;  3RD2 A;  3I9V 1;  2KJR A;  1L5P A;  2M0X A;  4WJP A;  4BAX A;  1RYJ A;  2ZPN A;  3PV1 A;  4PYU A;  1TBE A;  4M02 A;  3NZS A;  3Q8E A;  1J19 A;  4LLG M;  3PRE A;  4TMA B;  1F1H A;  4DXA B;  3AUL A;  4HRO A;  4DHZ E;  2CHZ A;  1TS3 A;  1WF9 A;  1C77 A;  2FIF A;  2JWU A;  5BMG A;  1UGM A;  1NDD A;  2J42 A;  4F7Z A;  4OHJ A;  4ZRQ A;  2KAC A;  5JH5 C;  2D3B A;  3E9S A;  4Q2J A;  2RD0 A;  1P7E A;  2KJ6 A;  2MJD A;  1LO5 D;  4K3B A;  1BML C;  3APF A;  3GZN B;  4JX1 C;  4ARI A;  3QX1 A;  3TJP A;  2AQ1 B;  2IGD A;  2CS4 A;  3PGE A;  4OVZ A;  1V86 A;  3W5V B;  2KO3 A;  2Y5B B;  4P7I A;  1TIF A;  1GNU A;  3RCZ A;  4XZ4 A;  4N6E B;  5J17 A;  4P6V F;  1CK1 A;  4BBN F;  4MGI E;  2L1A A;  1D6E C;  2TSS A;  2KQ4 X;  5BMI A;  1D3Z A;  1IPG A;  2W82 A;  1PUT A;  2WWZ A;  3KUZ A;  4JGH B;  5IOI A;  5G55 A;  2N7J A;  2GOW A;  3N32 A;  3Q3N C;  4WIP A;  1SXT A;  3PRP B;  4W9G A;  3NVV A;  4OVV A;  4EUT A;  4E71 A;  3UQA A;  3DQV A;  2QJL A;  2MJ3 A;  2R2O A;  4LDT D;  4DXG A;  1SJH D;  2JXX A;  3AE2 B;  2LD9 A;  3R3M A;  1V80 A;  4HDO A;  3QAQ A;  1ZE3 D;  1KFY B;  4XGA B;  1ENF A;  5CTR C;  1K50 A;  2YEP B;  4HLE A;  1YQ4 B;  1ZOY B;  3NVY A;  2L0T A;  3WIM A;  3U52 E;  4C7Z A;  2G4D B;  2QC8 A;  4W9F A;  1XF5 L;  3R2T A;  1L6V A;  2WHI A;  2W55 A;  3ABV B;  1I4P A;  2C7H A;  2V3S A;  4K7S A;  3I63 C;  2L7R A;  4OZA A;  1PGB A;  4YXD B;  1I35 A;  2D10 A;  2EKE C;  2NTT A;  2ZEQ A;  1F77 A;  1P0R A;  3ECI A;  2BS4 B;  4AJY B;  3LB8 C;  2DX5 B;  3BVM A;  4P1B C;  1OEY A;  1GAQ B;  3J9C A;  4C80 A;  4MAC A;  1B9R A;  4I6L B;  3AE6 B;  3PS6 A;  1E8W A;  2ZVO A;  2PTL A;  3A9J B;  3VR9 B;  1NI3 A;  1NBF C;  1EF5 A;  2WP9 B;  1SSN A;  1ROE A;  4HK2 A;  3MC0 B;  4BKS D;  4L2Y A;  4PYZ A;  1WX7 A; 
#chains in the Genus database with same CATH homology
 4CYE A;  3A9K A;  3PPA A;  3QWZ B;  2JZ3 B;  3UF8 A;  2V4L A;  2J0K A;  2MP2 B;  3GOE A;  2B3A A;  3L16 A;  3PHX B;  4FUL A;  4JIO U;  4WJN A;  4M8N A;  5E6N A;  2LXA A;  2Z0E B;  2WDT B;  1UH6 A;  4LDT B;  4HVB A;  2O6V D;  2KTR B;  3M95 A;  1FXT B;  2BKR B;  2N4F A;  3U30 A;  5BO4 B;  3WA0 A;  5JHA A;  1VCB A;  1KOT A;  4E74 A;  3A1Q A;  3BY4 B;  3M3J A;  1H8C A;  4HDQ A;  2MBH A;  2LGD A;  3L13 A;  5D2M B;  4KZC A;  4J6I A;  4RM9 A;  3QA8 A;  3U7D A;  2PEA A;  5EDS A;  4JQW C;  4DHZ B;  2MRP A;  4ZDV A;  3ZDM C;  2I1K A;  1GC6 A;  2FCQ A;  3TCA A;  4GIV A;  4B9K A;  1L2N A;  3H7P A;  4EKU A;  1UD7 A;  4RM8 A;  2KDI A;  3A9K B;  3CF6 E;  4DHJ D;  1R4M I;  1WIA A;  2DAF A;  4AJW A;  4GB9 A;  3IHP C;  2L05 A;  5CX3 A;  4ZRI A;  1RFA A;  2KKC A;  1WGR A;  2GBN A;  5E6O A;  2KDF B;  3TIX A;  2KTR A;  4ZRJ A;  4FAD A;  1LM8 B;  1WFY A;  1G6J A;  1KM7 A;  4GGQ A;  2JUO A;  4W9C A;  1GG3 A;  1OEY J;  4IM2 A;  2NCN A;  2K39 A;  1Z5S B;  3VQI A;  5D7G A;  4ANU A;  1EO6 A;  3QK0 A;  4TKN A;  2PPH A;  2K8C A;  3VAW A;  1RAX A;  2M17 A;  2G45 B;  4I6P A;  1TZ1 A;  2KX0 A;  5C23 A;  2DYO A;  3H7P B;  3K9P B;  4FJY A;  2GBK A;  4EZJ A;  3V6C B;  5DCN A;  2IY0 B;  1WX8 A;  4GDL B;  4G11 A;  4NAW A;  2L0F A;  3QHT A;  4MGY E;  2L8J A;  4PS7 A;  4GMV A;  3L10 B;  4WAA A;  5DPS A;  1NI2 A;  2PJH A;  3NS8 A;  2NPT A;  4DDI D;  4EZK A;  1LFD A;  2I1J A;  2BF8 B;  4WWO A;  1ZKH A;  4KSL C;  4K1R B;  2RPQ A;  1V49 A;  4G3X B;  3ZW3 A;  4BBN C;  4PS8 A;  2MBO A;  3PRZ A;  4JLC A;  1WGH A;  2LXC A;  3AXC A;  2A4Z A;  3VUY A;  2OOB B;  4FLH A;  4IG7 B;  1TGZ B;  1A5R A;  2BGF A;  3H9D A;  3B08 A;  4MGZ E;  3VTV A;  4IWO A;  4DHJ B;  2LRW A;  5CHW A;  3TL5 A;  3ZTD A;  1WH3 A;  3VTU A;  1E5W A;  2KC1 A;  3R7Q A;  3PT2 B;  4KDL B;  3WAN A;  3ZNG C;  4EZL A;  4MSM B;  3DDC B;  5LLI A;  2HE7 A;  2N7D A;  4IM3 A;  4DWF A;  3AU5 A;  1LQB A;  2MW5 A;  3VDZ A;  4EOY A;  2LUE A;  4ICU A;  1MG8 A;  2C7N B;  4GU2 A;  2IO0 B;  1WJ4 A;  2PE9 A;  4MM3 A;  3UIP B;  4IUM B;  5CHF A;  3VXW A;  4A3P A;  4RMA A;  5C1Z A;  1L7Y A;  2D11 A;  2AWT A;  5JZE B;  1ZGU B;  1YX6 B;  3RUI B;  2HJ8 A;  3JSV A;  4W9K A;  1V81 A;  2DYM A;  3IBE A;  4WJQ A;  2L00 B;  4WWN A;  3S2A A;  2DZJ A;  2WYQ A;  1WR1 A;  2XBB C;  2KLG A;  4HWI B;  2LVO A;  3R7R A;  2IO2 B;  2KWC A;  4F1S A;  2EMT A;  4IW0 A;  4OVU A;  2MWS B;  4MJS A;  3TBL D;  1WGD A;  2KOX A;  4EEW A;  3ZUN A;  3A33 B;  5DPR A;  4W9E A;  4GDK B;  2ASQ A;  1HE8 A;  3CSF A;  3L0W B;  1E8Z A;  2K6D B;  3D32 A;  3DCG A;  3AU4 A;  2BYF A;  3A4S C;  4FJV B;  5DPW A;  3C0R B;  2KFK A;  3ML8 A;  3LDZ E;  2WX1 A;  3EHV A;  3JVZ X;  2MA9 B;  1KJT A;  2N1V A;  3ZO5 B;  2AL3 A;  1WE6 A;  2GBM A;  1E8Y A;  2JRH A;  1V5O A;  3ZIM A;  2GMI C;  5TR5 A;  2ZNV B;  3H1U A;  4NJ7 A;  3EC8 A;  2FAZ A;  4IM0 A;  2JRI B;  3DPD A;  2DAJ A;  2DZI A;  2N9X A;  2O2V A;  2BPS A;  3EFU A;  4BKT A;  3WAP A;  2LJ5 A;  1F9J A;  2CKH B;  2KZR A;  3VUW A;  4DBG A;  3V62 A;  1QZE A;  2C60 A;  2IO1 B;  3ZTC A;  2O6V A;  4W9J A;  2IYD B;  2D07 B;  2ZZP B;  3QJZ A;  3PZD A;  1VD2 A;  2JVC A;  1GJZ A;  3HHM A;  3JYU A;  3NHE B;  2ZJD A;  4IWP A;  1WJN A;  2KDE B;  1OGW A;  1WMH A;  2KDB A;  4G0N B;  3SD5 A;  4ICV A;  2REX A;  3RUL A;  4ZRK A;  1T0Y A;  2MSE D;  2DZM A;  3NZU A;  4W9I A;  2JPH A;  3WAL A;  3HK0 A;  2CHX A;  3PLU A;  2XK5 B;  4XC2 A;  3X0W A;  4WQO B;  3APC A;  3P2B A;  3WAM A;  1WJ6 A;  1Q5W B;  4NQK E;  1V5T A;  2FNJ B;  2HTH A;  3V60 A;  3PLV A;  3PVL A;  3PRM B;  4FJZ A;  2KWU B;  1YJ1 A;  1S3S G;  2WX0 A;  4NJ6 A;  4KDI C;  5CHV C;  1WY8 A;  5J18 A;  2YLM A;  2QHO A;  4B6W A;  1P3Q U;  1WYW B;  1P98 A;  2RSU A;  5J2R A;  3M63 B;  2FCN A;  1OQY A;  2AL6 A;  4G50 A;  3PSE B;  3WAO A;  1P1A A;  1XD3 B;  2BWE S;  2VRR B;  2MP2 A;  3DBR I;  2JZZ A;  1E7U A;  1P9D U;  2KMA A;  2MLB A;  4FN2 A;  2FID A;  1K8R B;  3QQ8 B;  4B95 A;  4TV3 A;  1ISN A;  4NNJ B;  2LGX A;  2IZV B;  4NAW B;  4HPL B;  5DPT A;  3UQB A;  4MDK E;  2MX2 A;  3AI5 A;  3MJW A;  4GN1 A;  4MGK E;  4NY0 A;  3A1Q B;  1GUA B;  4W9D A;  2NR2 A;  3RT3 B;  3A4R A;  2FUH B;  3SHQ A;  3IVF A;  2DYB A;  3UGB B;  3ZNZ B;  3JW0 X;  1LXD A;  5E6P A;  3N30 A;  2M4N A;  3B0A A;  4HXD A;  4A3O A;  1WI0 A;  4BKS A;  1J0G A;  1RRB A;  2KWV B;  4LCD E;  5IAA C;  2EMS A;  4FHK A;  1WR6 E;  1XT9 B;  2R2Q A;  2ZNV C;  1OTR B;  1UBI A;  2UWQ A;  1C1Y B;  1WZ3 A;  2N7E A;  2DEN B;  2LI5 A;  3IFW B;  4TQ1 A;  5AZF A;  4K7W A;  2L3Z A;  4BFR A;  3MTN B;  3DVG X;  3I3T B;  2D3G A;  2XEW A;  2KLC A;  1GC7 A;  2IY1 B;  2N9P C;  2KD0 A;  3GZN I;  4TQ0 A;  1Y8R C;  2JT4 B;  3CMM B;  3HIZ A;  1IYF A;  3UIN B;  2G3Q B;  1WE7 A;  3H7S A;  3U8Z A;  2KMC A;  3VUX A;  2BWF A;  2KN5 A;  3ALB A;  4N9F 4;  1JRU A;  2MCN B;  2MQJ A;  2KHW B;  4E3C A;  2ZVN A;  3L08 A;  3RD2 A;  2KJR A;  2M0X A;  4WJP A;  1UBQ A;  2ZPN A;  3PV1 A;  4PYU A;  4IC7 B;  1KLV A;  1TBE A;  1V6E A;  4KVG B;  3UIO B;  4AOF A;  2ZPY A;  3NZS A;  2KNB A;  5L83 A;  3QIJ A;  2RR9 A;  1J19 A;  3EEC A;  3ZRF A;  5HKH A;  2A5U A;  2MBQ A;  1X1M A;  3VHT C;  4AWJ A;  3MHS D;  4FHJ A;  3KUC B;  3PRE A;  4PYZ A;  2M1M A;  2KX3 A;  1BT0 A;  1E90 A;  3RYT A;  4DXA B;  2ZCB A;  3AUL A;  4W9L A;  4DHZ E;  2KVR A;  2CHZ A;  2J0J A;  2BYE A;  1WF9 A;  2FIF A;  3PHW B;  3QCA A;  4W9H A;  2L76 A;  1UGM A;  2O2V B;  1NDD A;  2FCM A;  2LAS A;  2KFJ A;  1RLF A;  1E7V A;  4CHK A;  1WX9 A;  4CO7 A;  4F7Z A;  2DZK A;  3O65 B;  3A9J A;  2LVQ A;  1V9J A;  1Z2M A;  2MBE A;  3ZDT A;  5JH5 C;  2LVP A;  4DK5 A;  2RD0 A;  2KJ6 A;  1YD8 U;  3LJ3 A;  4PS3 A;  2K1F A;  3ZKJ C;  4MEL A;  5LXH A;  1J8C A;  5AZG A;  3APF A;  2CU1 A;  5KHQ A;  2KJH B;  2KQ7 A;  4GSW A;  3ZVV A;  4KZ0 A;  4KIK A;  1WMH B;  4IWQ A;  3QX1 A;  2KAN A;  3DVN V;  3BIN A;  3OLM D;  3Q3F A;  3TJP A;  1WM3 A;  3APD A;  2CS4 A;  5GMV A;  4HCN B;  1U4A A;  3PGE A;  3R66 C;  5IA7 A;  2N9E B;  3JSV B;  1V86 A;  1WXV A;  3VH3 B;  4BKG A;  2KO3 A;  1EF1 A;  2J7Q B;  2Y5B B;  3M62 B;  4P7I A;  4BVU C;  5L95 C;  1GNU A;  2CHW A;  4XZ4 A;  2LZ6 A;  2YVC A;  3RCZ A;  2NPT B;  3KH0 A;  3DVN U;  3KYC D;  4EFO A;  2C9W B;  5AZH A;  5J17 A;  3ENE A;  1ZW7 A;  2G4S A;  4GDK A;  3SDL C;  2BKF A;  1WM2 A;  3VVW B;  2MBB B;  2KQS A;  4ANW A;  4BBN F;  2HD5 B;  4MGI E;  3OJ4 B;  3ZRC A;  3DBS A;  1D3Z A;  1IPG A;  2V1Y A;  3KW5 B;  1E8X A;  2WWZ A;  3L17 A;  3KUZ A;  4JL9 A;  1WJU A;  2OJR A;  4YL8 A;  5D6J B;  2JWZ A;  5JHB A;  4JGH B;  5G55 A;  3SU8 X;  3RZW C;  2GOW A;  1WZ0 A;  3N32 A;  3PTF C;  4BOS C;  4MEM A;  3VH4 B;  1M94 A;  2NBW B;  2D2Q A;  4WWP A;  3RZF A;  2N1W A;  3PRP B;  4ANX A;  4W9G A;  1TTN A;  4WJO A;  4OVV A;  4LJO B;  5FR6 A;  4EUT A;  4E71 A;  3UQA A;  3DQV A;  2IBI B;  2Z59 B;  1WGG A;  4FA6 A;  4A20 A;  2R2O A;  3T8M A;  2O6V B;  5G2N A;  4LDT D;  2JXX A;  3KVF B;  2LD9 A;  4II3 B;  3VTW A;  3R3M A;  4XX5 A;  1I42 A;  4GXB A;  1V80 A;  2FCS A;  4NPN A;  3X23 A;  4HDO A;  3QAQ A;  3HM6 X;  4K81 A;  2K8B A;  4II2 B;  1SIF A;  2LGY A;  2NVU I;  5CTR C;  3DOW A;  4KV2 A;  4HPM B;  2W9N A;  3QAR A;  1WXS A;  3W1S C;  4HLE A;  3ZLZ A;  3T9L A;  4GDL A;  3KYD D;  5LXI B;  2L0T A;  4FBJ B;  4GOC A;  2BYV E;  3WIM A;  3HM3 A;  1H4R A;  2J0M A;  2KTF A;  2LRU A;  2AEH A;  2NBV B;  1WXM A;  2M8S A;  4M8M A;  2G4D B;  1AAR A;  2K8H A;  2KC2 A;  3KUD B;  4HJK A;  5D94 A;  4DDG D;  5AEK B;  1PQS A;  4W9F A;  2GBR A;  2K6Q A;  2C5L C;  4TUU A;  2CR5 A;  2PE6 B;  3VFK A;  4K7U A;  4M0W B;  1YIW A;  2JF5 A;  3NY5 A;  3ONS A;  2JY6 A;  1V2Y A;  2C7H A;  2V3S A;  4K7S A;  1EUV B;  1SGH A;  2ZCC A;  3DVG Y;  3OAW A;  4URK A;  1Q0W B;  3IG3 A;  3DBL I;  3OJ3 A;  4NQL B;  3V61 A;  1YX5 B;  1UZX B;  2L7R A;  3K9O B;  4AUQ C;  2AYO B;  1R4N I;  4HCP B;  5KHO A;  1I35 A;  1WGY A;  2D10 A;  1CMX B;  2EKE C;  1YQB A;  4BOZ B;  2DHZ A;  2ZEQ A;  1P0R A;  3ECI A;  4X57 B;  4F8C B;  4MH0 E;  4KSK C;  2Z0D B;  4AJY B;  3Q3J A;  3DBH I;  3ML9 A;  1UEL A;  2DX5 B;  2KK8 A;  3B1L X;  2KXJ A;  4MJS B;  1OEY A;  3W1S A;  1XQQ A;  3V6E B;  3L54 A;  3H6N A;  2IO3 B;  3CST A;  2XK5 A;  4I6L B;  3PS6 A;  4I6N B;  4LJP B;  4MSQ B;  1Q1O A;  3ZNI D;  4AP4 C;  1E8W A;  2K25 A;  2KFK B;  2ZVO A;  1S1Q B;  3NOB A;  3TMP B;  3A9J B;  1WXA A;  1C3T A;  2NBU A;  2C7M B;  3W1Y A;  1IP9 A;  2GBJ A;  3N3K B;  4KIK B;  2RGF A;  1NBF C;  1EF5 A;  2UYZ B;  2NS5 A;  3QC8 B;  1WRD B;  4HK2 A;  4ANV A;  3ZNH B;  1SE9 A;  4BKS D;  4ZYN A;  2LWP A;  1WX7 A;  4ASW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...