2N4FA

Ec-nmr structure of arabidopsis thaliana at2g32350 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ar3433a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
AAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein AR3433A
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n4fA01
2J7QB 4DK5A 2NPTB 2RGFA 4N9F4 3TL5A 2RD0A 2I1JA 2ZZPB 1P98A 4ZRJA 1JRUA 2FUHB 3QWZB 3VQIA 3IVFA 2FIFA 4GGQA 1WX7A 4PYUA 2RR9A 4AP4C 4F8CB 1HE8A 1WMHA 2K6QA 2Y5BB 2HTHA 1P9DU 3VDZA 3WALA 4WWOA 2I1KA 3PGEA 2LD9A 2MBHA 3R3MA 2JZZA 4DHZE 1WM2A 2LGDA 1WJUA 4W9LA 1NI2A 1KOTA 1UGMA 4URKA 2IBIB 3A4SC 2NBUA 4GDLB 5DPWA 1CMXB 1V2YA 4FADA 4NY0A 2BYVE 2GMIC 3PPAA 4G3XB 2YLMA 3WIMA 2LVOA 1OEYJ 4W9CA 3HIZA 4MDKE 3CMMB 3X23A 4GSWA 1TZ1A 4NQKE 3T8MA 4HWIB 4ZDVA 1E5WA 4TQ1A 3RT3B 3U7DA 4FULA 3HM3A 1LFDA 1WXVA 3OJ3A 3WAOA 3L10B 4GDKB 1R4MI 2IO3B 2ZVNA 1Q5WB 4DXAB 2ZCBA 4GXBA 4DHJB 1XQQA 2R2OA 3TCAA 2O6VB 3D32A 2KN5A 3PHXB 4AUQC 2XK5A 3DBSA 3JSVB 3SDLC 1WI0A 4BBNC 5C23A 1PQSA 4KSLC 3ZRCA 4JIOU 3TIXA 3KH0A 4BKGA 4MSMB 1WZ3A 1V9JA 1X1MA 4NAWB 4DHJD 3DCGA 1H8CA 3PVLA 1GNUA 1IPGA 5J17A 2PPHA 2IO2B 5J2RA 2KHWB 4PS8A 3WANA 5JZEB 5AZHA 4AJWA 3APFA 1TBEA 4KIKA 3VTWA 1V80A 1SE9A 1E8ZA 2D07B 4KDIC 3V6EB 1SIFA 3T9LA 3V61A 3A1QA 3A9KB 3SD5A 4FBJB 1TGZB 3KUZA 5JHAA 5KHOA 2DYOA 4PS7A 1U4AA 5D6JB 3VAWA 2N9PC 2N9XA 2NS5A 3VTVA 4KZCA 2G4DB 3M3JA 2DAJA 1WX8A 1TTNA 1NBFC 3PTFC 4TV3A 3DBLI 4E74A 2FCNA 4W9EA 2AWTA 2DZMA 2L3ZA 2NCNA 1WJ6A 3L13A 2KFKA 3PHWB 3RUIB 2HJ8A 2DYBA 5BO4B 4AJYB 2MQJA 4W9FA 4WJOA 1WXAA 2ZEQA 2ZPYA 2DZKA 2LASA 4XZ4A 3N3KB 5DPTA 2BKFA 2ZNVB 5E6OA 1V81A 2GOWA 2KD0A 4MJSB 5G55A 1S1QB 2L0TA 1WXSA 2N4FA 1Y8RC 3AU4A 3NOBA 1L2NA 2FCSA 2HE7A 3PREA 2LWPA 2K8CA 2EMSA 3TBLD 2LI5A 3KYCD 5FR6A 2XEWA 2WWZA 3DVNV 1GC6A 5CTRC 3VUXA 3A33B 2JF5A 3DQVA 1FXTB 3L0WB 4G0NB 3PV1A 2KOXA 2KQ7A 3W1SC 4IWPA 1WR1A 2PE9A 1NDDA 2JRHA 3RYTA 4K7UA 2C7MB 2MCNB 4WWPA 2C7HA 2AL3A 2RSUA 3ZO5B 3VUYA 2M4NA 3JW0X 2LRWA 3RZWC 2OJRA 1EF5A 4YL8A 1WMHB 3UGBB 4II2B 2WX0A 2MP2B 4IWOA 4EZLA 3IHPC 4GB9A 3B0AA 3VTUA 2K1FA 2MBBB 2EMTA 2NBWB 2V3SA 2K6DB 2Z0DB 5E6PA 3WAMA 2JT4B 1RLFA 3CSTA 2A5UA 4JLCA 4KSKC 4FHKA 4B95A 1WFYA 3UIOB 3M63B 3EFUA 3A1QB 4F7ZA 4ZRIA 3H7SA 1WXMA 4MGKE 2IY0B 3UIPB 2KWVB 1V5OA 4MGYE 3KYDD 2N9EB 1L7YA 3QHTA 4MGIE 4IUMB 3MHSD 2JZ3B 4KZ0A 2BKRB 3MTNB 1ZGUB 3I3TB 1D3ZA 2BYEA 3VXWA 3QARA 1KM7A 3K9PB 1K8RB 3TMPB 4XC2A 4NNJB 4RM9A 1E8YA 2XK5B 4GMVA 3EHVA 4G50A 4HPLB 2IO1B 1RRBA 2C7NB 2L7RA 2ZPNA 2KX0A 1LXDA 1OTRB 2G4SA 1E7VA 1ZKHA 4NAWA 1EF1A 3ZLZA 1WR6E 3HK0A 1WH3A 4AWJA 1I35A 3H7PA 2M0XA 1T0YA 3DPDA 4HK2A 4KIKB 3QAQA 3ZTCA 2C9WB 4K81A 5KHQA 1OEYA 4TKNA 2Z59B 5LLIA 4E71A 2J0JA 1EUVB 4I6NB 4A3OA 2AYOB 1YX6B 4KDLB 1V86A 3R66C 4LDTD 5AZGA 2DAFA 4MELA 2KDEB 3A9JA 2JPHA 4IM3A 1J19A 3L17A 2DYMA 3WA0A 3EECA 3UQAA 2EKEC 2MSED 2DZIA 3NS8A 3KW5B 3O65B 1RAXA 3DVGY 3QJZA 2KWCA 2KC2A 2K8BA 2LGYA 2KDIA 2ZVOA 3ZDMC 5EDSA 2O2VA 2CS4A 3NZUA 2V4LA 2HD5B 2A4ZA 2GBRA 4ANVA 2KFJA 4HVBA 4W9GA 2KLGA 3H1UA 4WWNA 3QQ8B 2G3QB 3GZNI 2FCMA 5DPSA 2DZJA 4MGZE 5TR5A 3ALBA 3GOEA 2MWSB 4FA6A 3JYUA 1Q0WB 2D11A 3BINA 2D3GA 3W1YA 4TQ0A 3ZNHB 2N7EA 4NPNA 3TJPA 2KNBA 2IY1B 1VCBA 3ECIA 2ASQA 4LDTB 2M8SA 4NQLB 1C1YB 3JSVA 3VUWA 1BT0A 1V6EA 2M17A 3RZFA 4EZJA 5C1ZA 1UH6A 4FJVB 4K1RB 1M94A 4F1SA 4FLHA 1XT9B 2PJHA 4EOYA 1SGHA 3AU5A 3DDCB 2MBOA 2KTRA 5CHVC 1P3QU 2KJHB 2BF8B 2XBBC 4NJ7A 4GDKA 4HPMB 3PRMB 4W9IA 4M8MA 1YD8U 4LJPB 2KLCA 4IC7B 4WQOB 3VH3B 3PRZA 2IZVB 2O6VA 1GUAB 2CR5A 4FJYA 3JVZX 1ISNA 2KTFA 3Q3JA 2DHZA 1WGRA 4OVUA 3DBRI 4I6LB 1WGYA 2CHXA 1UBQA 3L08A 2LRUA 2AEHA 3L54A 2C5LC 3UINB 3R7RA 3B1LX 3VFKA 3RCZA 2FAZA 4JGHB 1KLVA 2D10A 2JRIB 4A3PA 2WX1A 3DOWA 4ANUA 2AL6A 1R4NI 4JQWC 4ZRKA 1XD3B 4OVVA 2NR2A 5D94A 4RM8A 3V62A 4TUUA 2NVUI 1LM8B 4GDLA 3A9JB 3ML9A 2O6VD 2VRRB 3A9KA 3PRPB 2JWZA 3NY5A 5LXIB 2KQSA 2C60A 2UWQA 1WGGA 4BKSD 1IP9A 3OAWA 3PSEB 4DDID 3PLVA 4IG7B 3ZDTA 4B9KA 3Q3FA 4PS3A 4DHZB 2CHZA 4MJSA 3VHTC 4BVUC 1Z5SB 3DVGX 2DENB 2LVQA 3ZUNA 3PZDA 4W9JA 2JY6A 4BOSC 2W9NA 1WY8A 4IW0A 4EUTA 2UYZB 2KANA 3AULA 3U8ZA 3DVNU 4HDQA 2ZCCA 5IA7A 3W1SA 4BKSA 2ZJDA 1YX5B 2G45B 2BYFA 2FNJB 1C3TA 4HXDA 2FCQA 5D2MB 4B6WA 2FIDA 2NBVB 2L00B 2L76A 1P1AA 2IYDB 4IM2A 2LVPA 2BWFA 2WDTB 1QZEA 1YQBA 2KFKB 4W9DA 4WAAA 1E7UA 1V49A 2YVCA 4LCDE 4PYZA 1J8CA 5AEKB 4WJNA 5CHWA 4NJ6A 1YIWA 3ZNGC 3PLUA 2NPTA 4J6IA 4KVGB 3NZSA 3C0RB 3A4RA 2JUOA 5LXHA 1J0GA 3N32A 2GBJA 3OJ4B 2KMCA 4GOCA 5J18A 2N1VA 1S3SG 2KXJA 1G6JA 3QC8B 4ZYNA 1UBIA 4M8NA 2K25A 4GN1A 5L83A 2KKCA 2B3AA 2LZ6A 2Z0EB 3MJWA 4ICUA 2MLBA 1E90A 3UF8A 1I42A 2J0KA 1WIAA 1WGHA 5L95C 4W9KA 1IYFA 3M95A 2CKHB 1UZXB 3QX1A 1MG8A 3KUDB 4EFOA 4HJKA 4HCNB 4GU2A 4IM0A 1GJZA 3LDZE 4BFRA 1WGDA 2MP2A 1WF9A 2DX5B 2N7DA 2MRPA 3KVFB 5IAAC 1LQBA 2OOBB 3ENEA 4DBGA 4P7IA 1WRDB 4EZKA 5JHBA 3RULA 2WYQA 2KO3A 2KWUB 3HM6X 2K8HA 4HCPB 2KJRA 4LJOB 1WX9A 4MEMA 3ZNZB 1AARA 4AOFA 2N1WA 5CHFA 4DDGD 2PEAA 1E8XA 4W9HA 4MH0E 3VH4B 4DWFA 1OGWA 4CYEA 2L05A 3ZNID 2GBKA 2RPQA 2LXCA 4MM3A 1WM3A 5D7GA 3ZKJC 4HLEA 5GMVA 2MX2A 3ZW3A 3ZTDA 3H9DA 3UQBA 1WJ4A 1OQYA 2K39A 1VD2A 2M1MA 2PE6B 3CF6E 3IG3A 3PS6A 3HHMA 1Z2MA 4WJQA 4K7WA 4CHKA 2KDBA 3AXCA 3U30A 2LXAA 5DPRA 3ML8A 1WJNA 2LJ5A 2KVRA 2MBEA 2IO0B 3IBEA 4BKTA 2KMAA 2LUEA 1H4RA 2JVCA 4GIVA 4XX5A 5JH5C 4BOZB 3QCAA 2GBNA 3BY4B 4IWQA 4A20A 1GG3A 2BGFA 1KJTA 5E6NA 3APCA 2ZNVC 4I6PA 3H7PB 1Q1OA 3P2BA 2REXA 2BPSA 1UD7A 3S2AA 4FN2A 5AZFA 3V6CB 3WAPA 1F9JA 4KV2A 4FJZA 1EO6A 4X57B 3ZIMA 3H6NA 2O2VB 3V60A 2KK8A 2BWES 2KJ6A 3ZVVA 3EC8A 4EEWA 5CX3A 4E3CA 1WYWB 4BBNF 2CU1A 2GBMA 2CHWA 3B08A 3M62B 3AI5A 3KUCB 4ICVA 3SHQA 2L0FA 4K7SA 3APDA 2KZRA 4II3B 3CSFA 4RMAA 2V1YA 3L16A 4FHJA 4ANWA 2MBQA 4HDOA 1E8WA 3ONSA 1P0RA 3LJ3A 3OLMD 3SU8X 1WE6A 4MSQB 1GC7A 5G2NA 1WE7A 4CO7A 5HKHA 2R2QA 3NHEB 2D2QA 4M0WB 4WJPA 2KC1A 2KX3A 3DBHI 3K9OB 2J0MA 1A5RA 4ASWC 3IFWB 2LGXA 3R7QA 4JL9A 2JXXA 1V5TA 3X0WA 4ANXA 1YJ1A 3VVWB 3RD2A 4G11A 2QHOA 3QK0A 1ZW7A 2L8JA 1UELA 3ZRFA 4EKUA 2KTRB 3QIJA 1WZ0A 2MW5A 3PT2B 3QA8A 5DCNA 2KDFB 1RFAA 3N30A 2MA9B
chains in the Genus database with same CATH superfamily
2NPTB 4YXDB 2ZZPB 1FRRA 1JRUA 3QWZB 3IVFA 4PYUA 1WX7A 2BT6A 3AE6B 3VDZA 2ACZB 2I1KA 3B2FA 5E6JA 1NI2A 1KOTA 1C78A 2IBIB 1CMXB 4WWMA 1YQ3B 2BYVE 2GMIC 2YLMA 3AE2B 4ZRPA 1OEYJ 4MDKE 3VRAB 5H92C 4C00A 2JYEA 1R4MI 4ZYSA 2INPE 3UI3A 1XQQA 3TCAA 3D32A 1RYJA 4AUQC 3DBSA 3JSVB 4BBNC 3W5UB 1HQRD 4JIOU 3KH0A 2WXKA 3AEDB 3KWVA 1WZ3A 1ESFA 2VH1A 1V8CA 4C7ZA 3DCGA 5J17A 2KHWB 4LTUA 4PS8A 3WANA 1YN4A 5AZHA 4AJWA 2AX5A 2FBWB 3RMKC 1AN8A 2VZKB 1SIFA 3T9LA 1N5XA 3A9KB 3MP9A 1BMLC 1ZP0B 5KHOA 1FFVA 2N9PC 1FXAA 3FILA 2NS5A 3VTVA 1JCKB 2DAJA 4TV3A 2AWTA 3KLSX 3L13A 2K22A 1I4QA 1FPYA 2K0PA 4AQ7A 4AJYB 2MQJA 2WNMA 4W9FA 2IPKD 4B0EA 3Q8CA 4RH6A 1YQ4B 3ABVB 1UGJA 2JYTA 3AE4B 5G55A 1WXSA 1Y8RC 2JU6X 3NOBA 3NVVA 2EMSA 4JWUC 3TBLD 1TKEA 3KYCD 5FR6A 3ZXRA 3GE8C 2ONQA 2XEWA 2JF5A 1FXTB 2EKIA 3PV1A 3W1SC 4A90A 2Y3AA 2MCNB 4L2YA 1SJHD 2AL3A 2RSUA 3VUYA 2M4NA 2V9HA 4NZLB 4A55A 5BYQA 4EZLA 1K53A 3P4QB 5E6PA 2V3SA 1L6VA 1VZ8A 4FHKA 1QOAA 3EFUA 3A1QB 4UDUC 4F7ZA 5GXGB 4RCOA 2KWVB 1L7YA 3RPFC 4YTMB 3Q14C 3VXWA 1SJED 4HPPA 1KM7A 1TT5B 3TMPB 1I4RA 1NYRA 1RRBA 5BMIA 4NAWA 2IGGA 1WR6E 4DXGA 4AWJA 3BK2A 5BMGA 1J7BA 1I35A 3DPDA 3GS2A 1T0QC 4TMAB 4K81A 4E71A 4A3OA 2VZKD 1YX6B 3R66C 3BVZA 4MELA 2KDEB 4ARCA 3MFGA 3UQAA 2WXFA 3NS8A 3AH7A 2KWCA 1B1ZA 1QOFA 3ZDMC 3OG5A 2CS4A 1OFFA 2PW9A 3NZUA 4KKIA 2A4ZA 2GBRA 1F52A 2E3TA 2YEPB 2MWSB 4M02A 4TQ0A 3ZNHB 4NPNA 2ASQA 1C1YB 5HI1A 4FJVB 1VZ7A 1LO5D 1XT9B 3DDCB 3ZJTA 2IGHA 2MBOA 1SBBB 2KTRA 5CHVC 2BF8B 5I4DA 3DHIC 1YD8U 4ZRQA 5IKCM 1ISNA 1SE2A 2KTFA 2BYTA 3DBRI 2LHDA 1FIQA 1QOGA 3N20C 4JGHB 3DWGC 3DOWA 2AL6A 1R4NI 4JQWC 1QILA 4OVVA 4RM8A 5HG2A 1LM8B 1SEBD 3A9JB 3A9KA 2WU5B 1PYWD 3BZDB 4RF1A 5C3JB 3PSEB 3Q8AA 1QF6A 2GB1A 3ZDTA 3AB5A 2RDHA 1XF5L 3DVGX 3PZDA 2JY6A 4IW0A 4EUTA 3P4RB 2KANA 1WRIA 4OVZA 4OZCA 5IA7A 2QEJC 3W1SA 1YX5B 2L52A 3NVWA 2FNJB 1E6EB 1T0SC 5D2MB 3PO0A 2KMMA 1SF0A 1V49A 4LCDE 1SIJA 5AEKB 2ZW0A 4Q2JA 2AQ3B 1Y56A 4TSSA 3BYTB 4HJGE 1GPXA 4J6IA 2JUOA 5LXHA 3N32A 4GOCA 2N1VA 4M00A 2K25A 2BS3B 3RNBC 2HTME 4WIPA 4ICUA 2MLBA 5EE3A 5L95C 2CKHB 1E9MA 3NRZA 2N7JA 2SAKA 3N1ZC 4HJKA 3SR6A 2MRPA 3KVFB 3BVGA 1ZDXA 2OOBB 3ENEA 4DBGA 4P7IA 4EZKA 1D5MC 4IOIE 1LGRA 3HM6X 1E7PB 4HCPB 4AOFA 4W9HA 2NTSA 4DWFA 2DNFA 2QCZA 1OGWA 3IT6B 3ZKJC 4HLEA 2FE8A 3ZW3A 3N1XC 4CHKA 3HHMA 4K7WA 2M0AA 3Q8EA 4CQNA 2LXAA 3ZGZA 1WJNA 3Q3NC 3GB1A 4HEA1 2JVCA 1C4PA 1JWAD 1TKYA 2WDVB 3I63C 4I6PA 2MJEA 1XLQA 1KRHA 3R2TA 4XWTA 5AZFA 2LHEA 1F9JA 4S0RA 4FJZA 4X57B 1WWTA 2AQ1B 4E3CA 1MI0A 4ICVA 4RFBA 3APDA 2KZRA 1FRDA 3L16A 1L5PA 3ONSA 3P1MA 3SU8X 4MSQB 1WE7A 5HHDG 5BYRA 3EFCA 3K9OB 3GE3C 1A5RA 4ASWC 4REZA 3AE3B 4ANXA 2IDYA 3I9V1 3RD2A 3AMZA 3QK0A 2L8JA 3HRDD 1UELA 5JXVA 1CZPA 2MW5A 3PT2B 3QA8A 5DCNA 1PFDA 1RFKA 2J7QB 4DK5A 2RGFA 2RD0A 1D5ZC 1P98A 3FC4A 4ZOHC 4ZRJA 4L1BA 4GGQA 2RR9A 3DHGC 3SEBA 3MC8A 1HE8A 1P9DU 3AM9A 3R8BA 4WWOA 2LD9A 1J7CA 1WM2A 4RF0A 1DYQA 2LGDA 1AYFA 3NG0A 4URKA 1N61A 3N1YC 4NY0A 5EE1A 1ZDVA 3PZ8A 1TZ1A 2HDEA 1E0ZA 3HM3A 1LFDA 4A9AA 1YJIA 2IJ0A 1Q5WB 2I38A 1FO4A 3PHXB 2XK5A 3RNGC 5C23A 2WQYB 4KSLC 4FXCA 3LB8C 5BYSA 1H8CA 1GNUA 2PVOD 5TSSA 2D07B 4KDIC 3V61A 1TGZB 1F1HA 5JHAA 4XE0A 1U4AA 5D6JB 4J3OD 4YSYB 2G4DB 3M3JA 1NBFC 4WQMA 4E74A 2KVZA 1WJ6A 2K5PA 2Y5PA 5FK9C 2KFKA 3RUIB 2HJ8A 4WJOA 1WXAA 2ZPYA 2LASA 1E10A 4NAMA 2ZNVB 1S1QB 2N4FA 2WP9B 4HKQA 3CWIA 3PREA 3VR8B 3AEFB 1MHXA 2E6XA 2WDRB 1ENFA 2HJ1A 2KOXA 2KQ7A 4IWPA 2PE9A 4RNAA 1UWMA 3RYTA 2C7MB 2WDQB 3JW0X 4HROA 3RZWC 4OZAA 4GB9A 2Z0DB 2N9KA 3WAMA 3AECB 3CSTA 3AN1A 4JLCA 4B95A 1WFYA 3AV8A 2Q5WD 4MGKE 1V1PA 3KYDD 2N9EB 1CQVA 1HXYD 3MTNB 1ZGUB 3C19A 1RM6C 3K9PB 5AUKA 4RM9A 1XEEA 2KWDA 4YT0B 3KQ4A 4H2AA 4EE2A 1YN5A 2IO1B 1ET6A 2C7NB 2W54A 3MC9A 2KX0A 1LXDA 2G4SA 1ZKHA 2NTTA 1EF1A 1DOIA 4LNOA 3HK0A 1WH3A 2M0XA 1T0YA 4ZHPA 2M19A 2BW2A 1P7EA 2C9WB 5KHQA 4TKNA 1XCTL 5LLIA 2OJWA 4I6NB 1F2RI 3IAS1 3NVYA 1D4BA 1PDXA 1IBXB 1ZOYB 3IXSA 3WA0A 2DYMA 3BIID 5EE9A 2RDBC 1ZXIA 3KW5B 3DVGY 2PLPA 2KAJA 4US8A 1F2RC 2KDIA 2O2VA 5FR3A 2KFJA 2KLGA 3QQ8B 2G3QB 5DPSA 4MGZE 4XYCA 1SE3A 2QMTA 2D3GA 3W1YA 1KF6B 3TJPA 1CK1A 3ECIA 3SFEB 2M8SA 1I4PA 2MEKA 3JSVA 3RZFA 1V6EA 5C1ZA 4K1RB 1XCQL 4F1SA 3E9SA 2PJHA 4M01A 1JWSD 4LNNA 4NJ7A 1C4AA 4HPMB 4AS1A 3NJTA 4IC7B 3WCQA 3DBRB 2CR5A 4FJYA 1WGRA 4OVUA 4YSZB 2CHXA 3L08A 1ACCA 3VFKA 1UF0A 3B1LX 4KGTA 1AW7A 2JRIB 4ANUA 2JXTA 1XD3B 5D94A 3V62A 4GDLA 2O6VD 2VRRB 1EWYC 2C60A 2WXNA 3ZJVA 3OAWA 1NVID 1DGJA 2CHZA 3GP7A 2LVQA 1FNVA 1HZ5A 1HA5A 3P63A 3O13A 4HDQA 2MH7A 2ZCCA 4BKSA 2FCQA 1ZUD2 1C4CA 1QLBB 4IM2A 5FKAC 2WDTB 1QZEA 1T6BX 4YTNB 2I2YA 2KFKB 4W9DA 1E7UA 1J8CA 2JX5A 4WJNA 2PVGC 4KVGB 1J0GA 3A4RA 2GBJA 3OJ4B 1G6JA 1WSPA 3QC8B 3BVMA 1WXQA 1UBIA 1ET9A 4IKGA 1MHHE 2KKCA 1VR9A 3MJWA 2Z0EB 1JMLA 1WGHA 1IYFA 3KUDB 1F77A 1GJZA 4GU2A 3LDZE 1WGDA 2MP2A 1WF9A 2DX5B 4KGSA 1LQBA 3AE9B 3RULA 2WYQA 3ZNZB 3DBLB 1WGKA 1R7SA 2M56B 3CIRB 4CYEA 2L05A 3Q6BA 1D5XC 2LGIA 5D7GA 3SFDB 2MX2A 3UQBA 3H9DA 2PE6B 3IG3A 3PS6A 3P42A 4WJQA 2KDBA 3AXCA 2OHFA 2QILA 3IBEA 3Q3OC 4BKTA 4BZAA 2KMAA 1H4RA 3U7ZA 1A70A 4XX5A 2GBNA 1GG3A 1KJTA 2ZW1A 1C9FA 1T0RC 1Q1OA 2REXA 3ZYYX 3DHHC 1EO6A 3OWEB 5HFYA 2L32A 2J53A 2BB5A 5CX3A 4BBNF 2CU1A 2LUMA 3M62B 1XLNA 3AI5A 3SHQA 2MHJA 4RMAA 1QKZA 2V1YA 4FHJA 4ANWA 4HDOA 1E8WA 4A8XC 2ICIA 5HKHA 2W3SA 4WJPA 3RI7C 1NYQA 1EU4A 2J0MA 4XWWA 3AE8B 1P7FA 4JL9A 2JXXA 1YJ1A 2JSVX 1OQRA 2KTRB 1WZ0A 4N58A 1JW9D 1KLUD 4QAYA 5H8YE 4N9F4 2I1JA 4BAXA 3VQIA 2FIFA 5IN7A 4AP4C 4F8CB 4OHJA 2K6QA 3LXFA 2HTHA 4JPSA 2D3AA 3R3MA 3FKYA 2JZZA 4DHZE 2TSSA 4W9LA 2J42A 1IGDA 1V2YA 4FADA 1ZPSA 2X38A 2WXMA 2X8XX 3HIZA 1MPEA 3KWLA 4ZDVA 3RT3B 4C4VB 3U7DA 3WAOA 3W5VB 4XDCA 3V05A 2ZCBA 3TEYA 1V1OA 4GXBA 2R2OA 4DHJB 1N5WA 2KN5A 3RFZB 3SDLC 1WI0A 2V3NA 3ZRCA 3TIXA 4BKGA 1V9JA 4DHJD 3PVLA 1IPGA 3RNEC 1K52A 5J2RA 2WXOA 4M0WA 5JZEB 1TBEA 4KIKA 1FNWA 3W2DA 3V6EB 3H8HA 3SD5A 3KUZA 2CJOA 3VAWA 2N9XA 1WX8A 3RNFC 3PTFC 2PTLA 1FXIA 2L3ZA 2NCNA 2L83A 2GLSA 1FD6A 2KDMA 1YOVB 2N0SB 4R3DA 3PHWB 4KX6B 4LNIA 2DYBA 1YNTE 2QSDA 2DZKA 1GOZA 5DPTA 4A6QA 4S17A 1V81A 5E6OA 4MJSB 2XN9C 1L2NA 2FCSA 2HE7A 2VH2A 2LWPA 3VRBB 2LI5A 2WWZA 5CTRC 1FCLA 3DQVA 1VZ6A 2K9XA 4HRSA 3EUB2 1NDDA 4RGNA 1JALA 4K7UA 3BWUD 2R61A 4WWPA 3Q3MC 2C7HA 3B9JA 2H89B 2LRWA 4LK0M 1EF5A 4YL8A 4II2B 1GB1A 4WH4A 2WX0A 2MP2B 3W9CB 1JROA 3IHPC 2K1FA 2MBBB 2EMTA 1T3QA 1RLFA 1I4HA 2A5UA 4MH8A 4KSKC 1SE4A 3UIOB 3M63B 2GRIA 4ZRIA 1V5OA 1XXGA 1T5XD 4MGIE 4KZ0A 1NI3A 1K8RB 3LYYA 4NNJB 1E8YA 2XK5B 3EHVA 4G50A 4HPLB 3ZQ4A 1OTRB 2Z8LA 1L0YB 1L6UA 1WYGA 3RNCC 4OZBA 1EWCA 2Z59B 3TEZA 2N9LA 5G5HA 2INDC 1QOBA 5AZGA 1HTQA 3ZXVA 2PKOA 1QQRA 2BVCA 2DAFA 3A9JA 3L17A 3EECA 2EKEC 2MSED 5G5GA 3O65B 4YWGG 4ACFA 3L4PA 3QJZA 1MFWA 2KC2A 1L4ZB 2K8BA 3T3NA 2LGYA 2INCC 2V4LA 4ANVA 4HVBA 4WWNA 2FCMA 2DZJA 5TR5A 4C4VA 3ALBA 4P6VF 3C8YA 4WURA 3JYUA 2D11A 4C56C 3AEAB 1FMAD 1TZOA 1VCBA 3VUWA 2M17A 1F0ZA 3IAM1 1NEKB 1TKGA 1UH6A 2DBYA 4EOYA 1GAQB 3AU5A 3TSSA 2GI9A 2XBBC 4MM3B 4W9IA 4M8MA 2KLCA 4WQOB 3VH3B 3PRZA 2IZVB 2CU3A 3AEBB 2INNE 1WGYA 4ARIA 1QT9A 1Q10A 1VRAB 2AEHA 1V97A 2PIAA 3L54A 2C5LC 3UINB 4PT5A 1VLBA 2D10A 4A3PA 2WX1A 2WXIA 1B9RA 3VR9B 4ZRKA 2NR2A 1JWMD 2D3CA 1DOYA 3R2IA 3ML9A 4RGTA 2JWZA 3NY5A 2KQSA 2UWQA 1UUPA 4C7YA 3PLVA 3Q3FA 4P16A 1ZE3D 3J9CA 4DHZB 2V0GA 4MJSA 3VHTC 1C79A 4BVUC 4JX1C 2DENB 1WY8A 2UYZB 3AULA 3U8ZA 3AEGB 1ZXHA 2ZJDA 3MHZA 2G45B 2BYFA 1C3TA 4P1BC 4B6WA 3NZ3A 2FIDA 1HTOA 2L00B 2L76A 1L0VB 4PYZA 5C2TB 1PGXA 1C76A 1YIWA 3PLUA 2J4XA 2NPTA 2WXJA 1K50A 3C0RB 3TEWA 5BMHA 5J18A 1MG4A 1S3SG 1YN3A 4M8NA 1V1PB 4MT5A 4YTPB 2PMVA 1E90A 3UF8A 3T3OA 2J0KA 2JZPA 3HVDA 3QX1A 4N59A 4EFOA 3I5JC 4IM0A 1CJEA 2RMMA 2N7DA 2G9HD 5IAAC 1SSNA 1WRDB 5JHBA 2KWUB 1N63A 2K8HA 4LJOB 4MEMA 3ZJUA 1AARA 2BS2B 2N1WA 5CHFA 1E8XA 3VH4B 4MM3A 1WM3A 2AQ2B 3ZTDA 4P1CC 1WJ4A 2JQRB 2LMCA 3CF6E 2SEBD 2MJDA 3U4EG 5IOIA 3U30A 5DPRA 2LJ5A 2KVRA 1D6EC 2LUEA 1TS5A 3Q8BA 2RDGA 3MJ5A 4BOZB 3QCAA 5JH5C 4NJCA 2BGFA 1GB4A 3APCA 3P2BA 5AUIA 4DQOC 2DWQA 4FN2A 3ETRA 1ROEA 1TY2A 3WAPA 3H6NA 2O2VB 3V60A 1FM0D 4B0MA 2KJ6A 1XO3A 3EC8A 4EEWA 1WYWB 2WHIA 3KUCB 4USAA 3AE1B 4WAFA 3E56A 5IO9A 1GC7A 1N6ZA 2D2QA 2BS4B 2KX3A 1KH0A 3IFWB 2LGXA 2V3PA 3Q8FA 4LNFA 3X0WA 3VVWB 4G11A 2QHOA 4EKUA 1ZW7A 2QDFA 3QIJA 2WS3B 2G1EA 2KDFB 3HVZA 1RFAA 3N30A 1FCCC 3TL5A 5MPOA 2FUHB 3AE7B 1WMHA 2Y5BB 3WALA 3PGEA 4YSXB 2MBHA 4JE3B 1WJUA 1UGMA 3A4SC 2NBUA 4GDLB 5DPWA 3PPAA 4G3XB 1M4VA 3WIMA 2LVOA 3TEXA 2KN4A 3B2GA 4W9CA 3CMMB 3X23A 4GSWA 4NQKE 1R4MB 3T8MA 4HWIB 1SB3C 1E5WA 4TQ1A 4FULA 2L1AA 1WXVA 3OJ3A 3L10B 4GDKB 2IO3B 2ZVNA 4DXAB 2O6VB 4KKJA 2QIEB 2MJ3A 2BTEA 1PQSA 1AWDA 4MSMB 5LNK1 1X1MA 4NAWB 2KT7A 2PPHA 2IO2B 2BQQA 3IT4B 1KLGD 3APFA 3VTWA 1V80A 1SE9A 1E8ZA 2WU2B 2WXRA 3V3XA 2B76B 3A1QA 4FBJB 2RPVA 2DYOA 4PS7A 1JWUD 1EM7A 3DBHB 4KZCA 2WXPA 1TTNA 3AE5B 1I4XA 3DBLI 2FCNA 2V4IB 4W9EA 2IGDA 2DZMA 1KTKA 4XDDA 1PGBA 2KQ4X 3Q2AC 5BO4B 1TY0A 2Y5CA 2ZEQA 1I7HA 4XZ4A 3N3KB 2BKFA 5T8IA 2GOWA 2KD0A 2OEDA 2L0TA 4IDIA 3AU4A 1SXTA 1STEA 2BBCA 2K8CA 3P4PB 4RGMA 3VUXA 3DVNV 1GC6A 1N62A 2KACA 3A33B 1IBXA 3L0WB 4G0NB 1FNUA 1EU3A 1WR1A 4K3CA 2JRHA 1JQ4A 1TS2A 3ZO5B 1VDVA 2OJRA 1KFYB 1WMHB 3BYYB 3UGBB 4IWOA 4HKZE 3VTUA 3B0AA 2NBWB 2K6DB 2JT4B 1J7AA 1JWBD 3TUOA 3H7SA 1WXMA 2IY0B 3UIPB 4MGYE 3QHTA 4IUMB 3MHSD 2JZ3B 2BKRB 3I3TB 1D3ZA 2BYEA 3QARA 2LGSA 1BUIC 4XC2A 2D3BA 4GMVA 2BB6A 1XLPA 2L7RA 2ZPNA 3DWMA 1VJKA 1E7VA 3ZLZA 1YMHE 3H7PA 4HK2A 4KIKB 3QAQA 1YJJA 3ZTCA 1HEZE 1OEYA 2D5GA 2J0JA 1EUVB 3Q69A 3URYA 2AYOB 1TS4A 4KDLB 1V86A 3NS1A 4LDTD 2WXQA 4KGRA 5D3IB 2LFIA 2W55A 4GLSC 1R4NB 2W82A 2JPHA 4IM3A 1J19A 4US9A 2WXLA 2DZIA 1RAXA 2ZVOA 2YEPF 5EDSA 2HD5B 4W9GA 3H1UA 3GZNI 2WXHA 4PK1A 1N60A 3GOEA 4FA6A 3P4SB 1Q0WB 3BINA 2UU7A 3HUIA 2N7EA 2KNBA 2IY1B 4NQLB 4LDTB 1NENB 1BT0A 4EZJA 1M94A 4FLHA 1MVKA 2XNAC 1SGHA 2J52A 1P3QU 2KJHB 4GDKA 3PRMB 4LJPB 2O6VA 1GUAB 4K3BA 3JVZX 4OW0A 3Q3JA 2DHZA 1IUEA 4N6EB 4I6LB 3PZ7A 1UBQA 2LRUA 3R7RA 3RCZA 2FAZA 1KLVA 2KYWA 4TUUA 1L0XB 2NVUI 2QC8A 3PRPB 4L23A 3RNAC 5LXIB 5EE0A 1IGCA 1WGGA 1MJDA 4BKSD 5IP4D 1IP9A 4XGAB 2FUG1 4DDID 4IG7B 4B9KA 4PS3A 3GZNB 4D2KA 1Z5SB 1FFUA 1RWSA 3ZUNA 4LNKA 4W9JA 1C77A 4BOSC 2W9NA 1TYGB 3FILB 3DVNU 2W3RA 4O1NA 4HXDA 2NBVB 2ON8A 1UNSA 1P1AA 2IYDB 2LVPA 2BWFA 1YQBA 4WAAA 2YVCA 5CHWA 4NJ6A 3ZNGC 2LEKA 1OQQA 3NZSA 3EA6A 2KMCA 1DOXA 2KXJA 1TJEA 4LLGM 4ZYNA 4GN1A 5L83A 2QJLA 1HZ6A 2B3AA 1PUTA 1XLOA 2LZ6A 1I42A 2EELA 1WIAA 4W9KA 3M95A 1UZXB 1MG8A 3BK1A 3I57A 2CJNA 4HCNB 4BFRA 4MACA 5D3DA 2KO3A 2KJRA 1WX9A 2H88B 2WGSA 2K3UA 4DDGD 2PEAA 4MH0E 4ZHOA 3NVZA 3U52E 3ZNID 2GBKA 1TS3A 2LXCA 2RPQA 5GMVA 1OQYA 2K39A 1VD2A 2M1MA 1Z2MA 4DXFA 3NUHB 3ML8A 2MBEA 2IO0B 3RN9C 4GIVA 4C80A 1K51A 3BY4B 4IWQA 4A20A 2JWUA 4RGOS 5E6NA 2ZNVC 3H7PB 1FEHA 2BPSA 1UD7A 3S2AA 3N9YC 1BXTA 3V6CB 1I4GA 3U2SC 4JWSC 4KV2A 3ZIMA 2KK8A 2BWES 3EGRA 3FAHA 3ZVVA 2DLBA 2NMQA 2LJIA 2WXGA 2GBMA 2CHWA 3B08A 2L0FA 4K7SA 4II3B 3CSFA 4ITKA 2MBQA 1P0RA 3LJ3A 3OLMD 1WE6A 3AEEB 3MC0B 5G2NA 1PGAA 1TIFA 4CO7A 2R2QA 3NHEB 4M0WB 2KC1A 3DBHI 1JRPA 1L4DB 3R7QA 1UWXA 1V5TA 3ZRFA 2WLBA 2MA9B
chains in the Genus database with same CATH topology
2J7QB 4DK5A 2NPTB 2RGFA 4N9F4 3TL5A 2RD0A 2I1JA 2ZZPB 1P98A 4ZRJA 1JRUA 2FUHB 3QWZB 3VQIA 3IVFA 2FIFA 4GGQA 1WX7A 4PYUA 2RR9A 4AP4C 4F8CB 1HE8A 1WMHA 2K6QA 2Y5BB 2HTHA 1P9DU 3VDZA 3WALA 4WWOA 2I1KA 3PGEA 2LD9A 2MBHA 3R3MA 2JZZA 4DHZE 1WM2A 2LGDA 1WJUA 4W9LA 1NI2A 1KOTA 1UGMA 4URKA 2IBIB 3A4SC 2NBUA 4GDLB 5DPWA 1CMXB 1V2YA 4FADA 4NY0A 2BYVE 2GMIC 3PPAA 4G3XB 2YLMA 3WIMA 2LVOA 1OEYJ 4W9CA 3HIZA 4MDKE 3CMMB 3X23A 4GSWA 1TZ1A 4NQKE 3T8MA 4HWIB 4ZDVA 1E5WA 4TQ1A 3RT3B 3U7DA 4FULA 3HM3A 1LFDA 1WXVA 3OJ3A 3WAOA 3L10B 4GDKB 1R4MI 2IO3B 2ZVNA 1Q5WB 4DXAB 2ZCBA 4GXBA 4DHJB 1XQQA 2R2OA 3TCAA 2O6VB 3D32A 2KN5A 3PHXB 4AUQC 2XK5A 3DBSA 3JSVB 3SDLC 1WI0A 4BBNC 5C23A 1PQSA 4KSLC 3ZRCA 4JIOU 3TIXA 3KH0A 4BKGA 4MSMB 1WZ3A 1V9JA 1X1MA 4NAWB 4DHJD 3DCGA 1H8CA 3PVLA 1GNUA 1IPGA 5J17A 2PPHA 2IO2B 5J2RA 2KHWB 4PS8A 3WANA 5JZEB 5AZHA 4AJWA 3APFA 1TBEA 4KIKA 3VTWA 1V80A 1SE9A 1E8ZA 2D07B 4KDIC 3V6EB 1SIFA 3T9LA 3V61A 3A1QA 3A9KB 3SD5A 4FBJB 1TGZB 3KUZA 5JHAA 5KHOA 2DYOA 4PS7A 1U4AA 5D6JB 3VAWA 2N9PC 2N9XA 2NS5A 3VTVA 4KZCA 2G4DB 3M3JA 2DAJA 1WX8A 1TTNA 1NBFC 3PTFC 4TV3A 3DBLI 4E74A 2FCNA 4W9EA 2AWTA 2DZMA 2L3ZA 2NCNA 1WJ6A 3L13A 2KFKA 3PHWB 3RUIB 2HJ8A 2DYBA 5BO4B 4AJYB 2MQJA 4W9FA 4WJOA 1WXAA 2ZEQA 2ZPYA 2DZKA 2LASA 4XZ4A 3N3KB 5DPTA 2BKFA 2ZNVB 5E6OA 1V81A 2GOWA 2KD0A 4MJSB 5G55A 1S1QB 2L0TA 1WXSA 2N4FA 1Y8RC 3AU4A 3NOBA 1L2NA 2FCSA 2HE7A 3PREA 2LWPA 2K8CA 2EMSA 3TBLD 2LI5A 3KYCD 5FR6A 2XEWA 2WWZA 3DVNV 1GC6A 5CTRC 3VUXA 3A33B 2JF5A 3DQVA 1FXTB 3L0WB 4G0NB 3PV1A 2KOXA 2KQ7A 3W1SC 4IWPA 1WR1A 2PE9A 1NDDA 2JRHA 3RYTA 4K7UA 2C7MB 2MCNB 4WWPA 2C7HA 2AL3A 2RSUA 3ZO5B 3VUYA 2M4NA 3JW0X 2LRWA 3RZWC 2OJRA 1EF5A 4YL8A 1WMHB 3UGBB 4II2B 2WX0A 2MP2B 4IWOA 4EZLA 3IHPC 4GB9A 3B0AA 3VTUA 2K1FA 2MBBB 2EMTA 2NBWB 2V3SA 2K6DB 2Z0DB 5E6PA 3WAMA 2JT4B 1RLFA 3CSTA 2A5UA 4JLCA 4KSKC 4FHKA 4B95A 1WFYA 3UIOB 3M63B 3EFUA 3A1QB 4F7ZA 4ZRIA 3H7SA 1WXMA 4MGKE 2IY0B 3UIPB 2KWVB 1V5OA 4MGYE 3KYDD 2N9EB 1L7YA 3QHTA 4MGIE 4IUMB 3MHSD 2JZ3B 4KZ0A 2BKRB 3MTNB 1ZGUB 3I3TB 1D3ZA 2BYEA 3VXWA 3QARA 1KM7A 3K9PB 1K8RB 3TMPB 4XC2A 4NNJB 4RM9A 1E8YA 2XK5B 4GMVA 3EHVA 4G50A 4HPLB 2IO1B 1RRBA 2C7NB 2L7RA 2ZPNA 2KX0A 1LXDA 1OTRB 2G4SA 1E7VA 1ZKHA 4NAWA 1EF1A 3ZLZA 1WR6E 3HK0A 1WH3A 4AWJA 1I35A 3H7PA 2M0XA 1T0YA 3DPDA 4HK2A 4KIKB 3QAQA 3ZTCA 2C9WB 4K81A 5KHQA 1OEYA 4TKNA 2Z59B 5LLIA 4E71A 2J0JA 1EUVB 4I6NB 4A3OA 2AYOB 1YX6B 4KDLB 1V86A 3R66C 4LDTD 5AZGA 2DAFA 4MELA 2KDEB 3A9JA 2JPHA 4IM3A 1J19A 3L17A 2DYMA 3WA0A 3EECA 3UQAA 2EKEC 2MSED 2DZIA 3NS8A 3KW5B 3O65B 1RAXA 3DVGY 3QJZA 2KWCA 2KC2A 2K8BA 2LGYA 2KDIA 2ZVOA 3ZDMC 5EDSA 2O2VA 2CS4A 3NZUA 2V4LA 2HD5B 2A4ZA 2GBRA 4ANVA 2KFJA 4HVBA 4W9GA 2KLGA 3H1UA 4WWNA 3QQ8B 2G3QB 3GZNI 2FCMA 5DPSA 2DZJA 4MGZE 5TR5A 3ALBA 3GOEA 2MWSB 4FA6A 3JYUA 1Q0WB 2D11A 3BINA 2D3GA 3W1YA 4TQ0A 3ZNHB 2N7EA 4NPNA 3TJPA 2KNBA 2IY1B 1VCBA 3ECIA 2ASQA 4LDTB 2M8SA 4NQLB 1C1YB 3JSVA 3VUWA 1BT0A 1V6EA 2M17A 3RZFA 4EZJA 5C1ZA 1UH6A 4FJVB 4K1RB 1M94A 4F1SA 4FLHA 1XT9B 2PJHA 4EOYA 1SGHA 3AU5A 3DDCB 2MBOA 2KTRA 5CHVC 1P3QU 2KJHB 2BF8B 2XBBC 4NJ7A 4GDKA 4HPMB 3PRMB 4W9IA 4M8MA 1YD8U 4LJPB 2KLCA 4IC7B 4WQOB 3VH3B 3PRZA 2IZVB 2O6VA 1GUAB 2CR5A 4FJYA 3JVZX 1ISNA 2KTFA 3Q3JA 2DHZA 1WGRA 4OVUA 3DBRI 4I6LB 1WGYA 2CHXA 1UBQA 3L08A 2LRUA 2AEHA 3L54A 2C5LC 3UINB 3R7RA 3B1LX 3VFKA 3RCZA 2FAZA 4JGHB 1KLVA 2D10A 2JRIB 4A3PA 2WX1A 3DOWA 4ANUA 2AL6A 1R4NI 4JQWC 4ZRKA 1XD3B 4OVVA 2NR2A 5D94A 4RM8A 3V62A 4TUUA 2NVUI 1LM8B 4GDLA 3A9JB 3ML9A 2O6VD 2VRRB 3A9KA 3PRPB 2JWZA 3NY5A 5LXIB 2KQSA 2C60A 2UWQA 1WGGA 4BKSD 1IP9A 3OAWA 3PSEB 4DDID 3PLVA 4IG7B 3ZDTA 4B9KA 3Q3FA 4PS3A 4DHZB 2CHZA 4MJSA 3VHTC 4BVUC 1Z5SB 3DVGX 2DENB 2LVQA 3ZUNA 3PZDA 4W9JA 2JY6A 4BOSC 2W9NA 1WY8A 4IW0A 4EUTA 2UYZB 2KANA 3AULA 3U8ZA 3DVNU 4HDQA 2ZCCA 5IA7A 3W1SA 4BKSA 2ZJDA 1YX5B 2G45B 2BYFA 2FNJB 1C3TA 4HXDA 2FCQA 5D2MB 4B6WA 2FIDA 2NBVB 2L00B 2L76A 1P1AA 2IYDB 4IM2A 2LVPA 2BWFA 2WDTB 1QZEA 1YQBA 2KFKB 4W9DA 4WAAA 1E7UA 1V49A 2YVCA 4LCDE 4PYZA 1J8CA 5AEKB 4WJNA 5CHWA 4NJ6A 1YIWA 3ZNGC 3PLUA 2NPTA 4J6IA 4KVGB 3NZSA 3C0RB 3A4RA 2JUOA 5LXHA 1J0GA 3N32A 2GBJA 3OJ4B 2KMCA 4GOCA 5J18A 2N1VA 1S3SG 2KXJA 1G6JA 3QC8B 4ZYNA 1UBIA 4M8NA 2K25A 4GN1A 5L83A 2KKCA 2B3AA 2LZ6A 2Z0EB 3MJWA 4ICUA 2MLBA 1E90A 3UF8A 1I42A 2J0KA 1WIAA 1WGHA 5L95C 4W9KA 1IYFA 3M95A 2CKHB 1UZXB 3QX1A 1MG8A 3KUDB 4EFOA 4HJKA 4HCNB 4GU2A 4IM0A 1GJZA 3LDZE 4BFRA 1WGDA 2MP2A 1WF9A 2DX5B 2N7DA 2MRPA 3KVFB 5IAAC 1LQBA 2OOBB 3ENEA 4DBGA 4P7IA 1WRDB 4EZKA 5JHBA 3RULA 2WYQA 2KO3A 2KWUB 3HM6X 2K8HA 4HCPB 2KJRA 4LJOB 1WX9A 4MEMA 3ZNZB 1AARA 4AOFA 2N1WA 5CHFA 4DDGD 2PEAA 1E8XA 4W9HA 4MH0E 3VH4B 4DWFA 1OGWA 4CYEA 2L05A 3ZNID 2GBKA 2RPQA 2LXCA 4MM3A 1WM3A 5D7GA 3ZKJC 4HLEA 5GMVA 2MX2A 3ZW3A 3ZTDA 3H9DA 3UQBA 1WJ4A 1OQYA 2K39A 1VD2A 2M1MA 2PE6B 3CF6E 3IG3A 3PS6A 3HHMA 1Z2MA 4WJQA 4K7WA 4CHKA 2KDBA 3AXCA 3U30A 2LXAA 5DPRA 3ML8A 1WJNA 2LJ5A 2KVRA 2MBEA 2IO0B 3IBEA 4BKTA 2KMAA 2LUEA 1H4RA 2JVCA 4GIVA 4XX5A 5JH5C 4BOZB 3QCAA 2GBNA 3BY4B 4IWQA 4A20A 1GG3A 2BGFA 1KJTA 5E6NA 3APCA 2ZNVC 4I6PA 3H7PB 1Q1OA 3P2BA 2REXA 2BPSA 1UD7A 3S2AA 4FN2A 5AZFA 3V6CB 3WAPA 1F9JA 4KV2A 4FJZA 1EO6A 4X57B 3ZIMA 3H6NA 2O2VB 3V60A 2KK8A 2BWES 2KJ6A 3ZVVA 3EC8A 4EEWA 5CX3A 4E3CA 1WYWB 4BBNF 2CU1A 2GBMA 2CHWA 3B08A 3M62B 3AI5A 3KUCB 4ICVA 3SHQA 2L0FA 4K7SA 3APDA 2KZRA 4II3B 3CSFA 4RMAA 2V1YA 3L16A 4FHJA 4ANWA 2MBQA 4HDOA 1E8WA 3ONSA 1P0RA 3LJ3A 3OLMD 3SU8X 1WE6A 4MSQB 1GC7A 5G2NA 1WE7A 4CO7A 5HKHA 2R2QA 3NHEB 2D2QA 4M0WB 4WJPA 2KC1A 2KX3A 3DBHI 3K9OB 2J0MA 1A5RA 4ASWC 3IFWB 2LGXA 3R7QA 4JL9A 2JXXA 1V5TA 3X0WA 4ANXA 1YJ1A 3VVWB 3RD2A 4G11A 2QHOA 3QK0A 1ZW7A 2L8JA 1UELA 3ZRFA 4EKUA 2KTRB 3QIJA 1WZ0A 2MW5A 3PT2B 3QA8A 5DCNA 2KDFB 1RFAA 3N30A 2MA9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q B;  4DK5 A;  2NPT B;  2RGF A;  4N9F 4;  3TL5 A;  2RD0 A;  2I1J A;  2ZZP B;  1P98 A;  4ZRJ A;  1JRU A;  2FUH B;  3QWZ B;  3VQI A;  3IVF A;  2FIF A;  4GGQ A;  1WX7 A;  4PYU A;  2RR9 A;  4AP4 C;  4F8C B;  1HE8 A;  1WMH A;  2K6Q A;  2Y5B B;  2HTH A;  1P9D U;  3VDZ A;  3WAL A;  4WWO A;  2I1K A;  3PGE A;  2LD9 A;  2MBH A;  3R3M A;  2JZZ A;  4DHZ E;  1WM2 A;  2LGD A;  1WJU A;  4W9L A;  1NI2 A;  1KOT A;  1UGM A;  4URK A;  2IBI B;  3A4S C;  2NBU A;  4GDL B;  5DPW A;  1CMX B;  1V2Y A;  4FAD A;  4NY0 A;  2BYV E;  2GMI C;  3PPA A;  4G3X B;  2YLM A;  3WIM A;  2LVO A;  1OEY J;  4W9C A;  3HIZ A;  4MDK E;  3CMM B;  3X23 A;  4GSW A;  1TZ1 A;  4NQK E;  3T8M A;  4HWI B;  4ZDV A;  1E5W A;  4TQ1 A;  3RT3 B;  3U7D A;  4FUL A;  3HM3 A;  1LFD A;  1WXV A;  3OJ3 A;  3WAO A;  3L10 B;  4GDK B;  1R4M I;  2IO3 B;  2ZVN A;  1Q5W B;  4DXA B;  2ZCB A;  4GXB A;  4DHJ B;  1XQQ A;  2R2O A;  3TCA A;  2O6V B;  3D32 A;  2KN5 A;  3PHX B;  4AUQ C;  2XK5 A;  3DBS A;  3JSV B;  3SDL C;  1WI0 A;  4BBN C;  5C23 A;  1PQS A;  4KSL C;  3ZRC A;  4JIO U;  3TIX A;  3KH0 A;  4BKG A;  4MSM B;  1WZ3 A;  1V9J A;  1X1M A;  4NAW B;  4DHJ D;  3DCG A;  1H8C A;  3PVL A;  1GNU A;  1IPG A;  5J17 A;  2PPH A;  2IO2 B;  5J2R A;  2KHW B;  4PS8 A;  3WAN A;  5JZE B;  5AZH A;  4AJW A;  3APF A;  1TBE A;  4KIK A;  3VTW A;  1V80 A;  1SE9 A;  1E8Z A;  2D07 B;  4KDI C;  3V6E B;  1SIF A;  3T9L A;  3V61 A;  3A1Q A;  3A9K B;  3SD5 A;  4FBJ B;  1TGZ B;  3KUZ A;  5JHA A;  5KHO A;  2DYO A;  4PS7 A;  1U4A A;  5D6J B;  3VAW A;  2N9P C;  2N9X A;  2NS5 A;  3VTV A;  4KZC A;  2G4D B;  3M3J A;  2DAJ A;  1WX8 A;  1TTN A;  1NBF C;  3PTF C;  4TV3 A;  3DBL I;  4E74 A;  2FCN A;  4W9E A;  2AWT A;  2DZM A;  2L3Z A;  2NCN A;  1WJ6 A;  3L13 A;  2KFK A;  3PHW B;  3RUI B;  2HJ8 A;  2DYB A;  5BO4 B;  4AJY B;  2MQJ A;  4W9F A;  4WJO A;  1WXA A;  2ZEQ A;  2ZPY A;  2DZK A;  2LAS A;  4XZ4 A;  3N3K B;  5DPT A;  2BKF A;  2ZNV B;  5E6O A;  1V81 A;  2GOW A;  2KD0 A;  4MJS B;  5G55 A;  1S1Q B;  2L0T A;  1WXS A;  2N4F A;  1Y8R C;  3AU4 A;  3NOB A;  1L2N A;  2FCS A;  2HE7 A;  3PRE A;  2LWP A;  2K8C A;  2EMS A;  3TBL D;  2LI5 A;  3KYC D;  5FR6 A;  2XEW A;  2WWZ A;  3DVN V;  1GC6 A;  5CTR C;  3VUX A;  3A33 B;  2JF5 A;  3DQV A;  1FXT B;  3L0W B;  4G0N B;  3PV1 A;  2KOX A;  2KQ7 A;  3W1S C;  4IWP A;  1WR1 A;  2PE9 A;  1NDD A;  2JRH A;  3RYT A;  4K7U A;  2C7M B;  2MCN B;  4WWP A;  2C7H A;  2AL3 A;  2RSU A;  3ZO5 B;  3VUY A;  2M4N A;  3JW0 X;  2LRW A;  3RZW C;  2OJR A;  1EF5 A;  4YL8 A;  1WMH B;  3UGB B;  4II2 B;  2WX0 A;  2MP2 B;  4IWO A;  4EZL A;  3IHP C;  4GB9 A;  3B0A A;  3VTU A;  2K1F A;  2MBB B;  2EMT A;  2NBW B;  2V3S A;  2K6D B;  2Z0D B;  5E6P A;  3WAM A;  2JT4 B;  1RLF A;  3CST A;  2A5U A;  4JLC A;  4KSK C;  4FHK A;  4B95 A;  1WFY A;  3UIO B;  3M63 B;  3EFU A;  3A1Q B;  4F7Z A;  4ZRI A;  3H7S A;  1WXM A;  4MGK E;  2IY0 B;  3UIP B;  2KWV B;  1V5O A;  4MGY E;  3KYD D;  2N9E B;  1L7Y A;  3QHT A;  4MGI E;  4IUM B;  3MHS D;  2JZ3 B;  4KZ0 A;  2BKR B;  3MTN B;  1ZGU B;  3I3T B;  1D3Z A;  2BYE A;  3VXW A;  3QAR A;  1KM7 A;  3K9P B;  1K8R B;  3TMP B;  4XC2 A;  4NNJ B;  4RM9 A;  1E8Y A;  2XK5 B;  4GMV A;  3EHV A;  4G50 A;  4HPL B;  2IO1 B;  1RRB A;  2C7N B;  2L7R A;  2ZPN A;  2KX0 A;  1LXD A;  1OTR B;  2G4S A;  1E7V A;  1ZKH A;  4NAW A;  1EF1 A;  3ZLZ A;  1WR6 E;  3HK0 A;  1WH3 A;  4AWJ A;  1I35 A;  3H7P A;  2M0X A;  1T0Y A;  3DPD A;  4HK2 A;  4KIK B;  3QAQ A;  3ZTC A;  2C9W B;  4K81 A;  5KHQ A;  1OEY A;  4TKN A;  2Z59 B;  5LLI A;  4E71 A;  2J0J A;  1EUV B;  4I6N B;  4A3O A;  2AYO B;  1YX6 B;  4KDL B;  1V86 A;  3R66 C;  4LDT D;  5AZG A;  2DAF A;  4MEL A;  2KDE B;  3A9J A;  2JPH A;  4IM3 A;  1J19 A;  3L17 A;  2DYM A;  3WA0 A;  3EEC A;  3UQA A;  2EKE C;  2MSE D;  2DZI A;  3NS8 A;  3KW5 B;  3O65 B;  1RAX A;  3DVG Y;  3QJZ A;  2KWC A;  2KC2 A;  2K8B A;  2LGY A;  2KDI A;  2ZVO A;  3ZDM C;  5EDS A;  2O2V A;  2CS4 A;  3NZU A;  2V4L A;  2HD5 B;  2A4Z A;  2GBR A;  4ANV A;  2KFJ A;  4HVB A;  4W9G A;  2KLG A;  3H1U A;  4WWN A;  3QQ8 B;  2G3Q B;  3GZN I;  2FCM A;  5DPS A;  2DZJ A;  4MGZ E;  5TR5 A;  3ALB A;  3GOE A;  2MWS B;  4FA6 A;  3JYU A;  1Q0W B;  2D11 A;  3BIN A;  2D3G A;  3W1Y A;  4TQ0 A;  3ZNH B;  2N7E A;  4NPN A;  3TJP A;  2KNB A;  2IY1 B;  1VCB A;  3ECI A;  2ASQ A;  4LDT B;  2M8S A;  4NQL B;  1C1Y B;  3JSV A;  3VUW A;  1BT0 A;  1V6E A;  2M17 A;  3RZF A;  4EZJ A;  5C1Z A;  1UH6 A;  4FJV B;  4K1R B;  1M94 A;  4F1S A;  4FLH A;  1XT9 B;  2PJH A;  4EOY A;  1SGH A;  3AU5 A;  3DDC B;  2MBO A;  2KTR A;  5CHV C;  1P3Q U;  2KJH B;  2BF8 B;  2XBB C;  4NJ7 A;  4GDK A;  4HPM B;  3PRM B;  4W9I A;  4M8M A;  1YD8 U;  4LJP B;  2KLC A;  4IC7 B;  4WQO B;  3VH3 B;  3PRZ A;  2IZV B;  2O6V A;  1GUA B;  2CR5 A;  4FJY A;  3JVZ X;  1ISN A;  2KTF A;  3Q3J A;  2DHZ A;  1WGR A;  4OVU A;  3DBR I;  4I6L B;  1WGY A;  2CHX A;  1UBQ A;  3L08 A;  2LRU A;  2AEH A;  3L54 A;  2C5L C;  3UIN B;  3R7R A;  3B1L X;  3VFK A;  3RCZ A;  2FAZ A;  4JGH B;  1KLV A;  2D10 A;  2JRI B;  4A3P A;  2WX1 A;  3DOW A;  4ANU A;  2AL6 A;  1R4N I;  4JQW C;  4ZRK A;  1XD3 B;  4OVV A;  2NR2 A;  5D94 A;  4RM8 A;  3V62 A;  4TUU A;  2NVU I;  1LM8 B;  4GDL A;  3A9J B;  3ML9 A;  2O6V D;  2VRR B;  3A9K A;  3PRP B;  2JWZ A;  3NY5 A;  5LXI B;  2KQS A;  2C60 A;  2UWQ A;  1WGG A;  4BKS D;  1IP9 A;  3OAW A;  3PSE B;  4DDI D;  3PLV A;  4IG7 B;  3ZDT A;  4B9K A;  3Q3F A;  4PS3 A;  4DHZ B;  2CHZ A;  4MJS A;  3VHT C;  4BVU C;  1Z5S B;  3DVG X;  2DEN B;  2LVQ A;  3ZUN A;  3PZD A;  4W9J A;  2JY6 A;  4BOS C;  2W9N A;  1WY8 A;  4IW0 A;  4EUT A;  2UYZ B;  2KAN A;  3AUL A;  3U8Z A;  3DVN U;  4HDQ A;  2ZCC A;  5IA7 A;  3W1S A;  4BKS A;  2ZJD A;  1YX5 B;  2G45 B;  2BYF A;  2FNJ B;  1C3T A;  4HXD A;  2FCQ A;  5D2M B;  4B6W A;  2FID A;  2NBV B;  2L00 B;  2L76 A;  1P1A A;  2IYD B;  4IM2 A;  2LVP A;  2BWF A;  2WDT B;  1QZE A;  1YQB A;  2KFK B;  4W9D A;  4WAA A;  1E7U A;  1V49 A;  2YVC A;  4LCD E;  4PYZ A;  1J8C A;  5AEK B;  4WJN A;  5CHW A;  4NJ6 A;  1YIW A;  3ZNG C;  3PLU A;  2NPT A;  4J6I A;  4KVG B;  3NZS A;  3C0R B;  3A4R A;  2JUO A;  5LXH A;  1J0G A;  3N32 A;  2GBJ A;  3OJ4 B;  2KMC A;  4GOC A;  5J18 A;  2N1V A;  1S3S G;  2KXJ A;  1G6J A;  3QC8 B;  4ZYN A;  1UBI A;  4M8N A;  2K25 A;  4GN1 A;  5L83 A;  2KKC A;  2B3A A;  2LZ6 A;  2Z0E B;  3MJW A;  4ICU A;  2MLB A;  1E90 A;  3UF8 A;  1I42 A;  2J0K A;  1WIA A;  1WGH A;  5L95 C;  4W9K A;  1IYF A;  3M95 A;  2CKH B;  1UZX B;  3QX1 A;  1MG8 A;  3KUD B;  4EFO A;  4HJK A;  4HCN B;  4GU2 A;  4IM0 A;  1GJZ A;  3LDZ E;  4BFR A;  1WGD A;  2MP2 A;  1WF9 A;  2DX5 B;  2N7D A;  2MRP A;  3KVF B;  5IAA C;  1LQB A;  2OOB B;  3ENE A;  4DBG A;  4P7I A;  1WRD B;  4EZK A;  5JHB A;  3RUL A;  2WYQ A;  2KO3 A;  2KWU B;  3HM6 X;  2K8H A;  4HCP B;  2KJR A;  4LJO B;  1WX9 A;  4MEM A;  3ZNZ B;  1AAR A;  4AOF A;  2N1W A;  5CHF A;  4DDG D;  2PEA A;  1E8X A;  4W9H A;  4MH0 E;  3VH4 B;  4DWF A;  1OGW A;  4CYE A;  2L05 A;  3ZNI D;  2GBK A;  2RPQ A;  2LXC A;  4MM3 A;  1WM3 A;  5D7G A;  3ZKJ C;  4HLE A;  5GMV A;  2MX2 A;  3ZW3 A;  3ZTD A;  3H9D A;  3UQB A;  1WJ4 A;  1OQY A;  2K39 A;  1VD2 A;  2M1M A;  2PE6 B;  3CF6 E;  3IG3 A;  3PS6 A;  3HHM A;  1Z2M A;  4WJQ A;  4K7W A;  4CHK A;  2KDB A;  3AXC A;  3U30 A;  2LXA A;  5DPR A;  3ML8 A;  1WJN A;  2LJ5 A;  2KVR A;  2MBE A;  2IO0 B;  3IBE A;  4BKT A;  2KMA A;  2LUE A;  1H4R A;  2JVC A;  4GIV A;  4XX5 A;  5JH5 C;  4BOZ B;  3QCA A;  2GBN A;  3BY4 B;  4IWQ A;  4A20 A;  1GG3 A;  2BGF A;  1KJT A;  5E6N A;  3APC A;  2ZNV C;  4I6P A;  3H7P B;  1Q1O A;  3P2B A;  2REX A;  2BPS A;  1UD7 A;  3S2A A;  4FN2 A;  5AZF A;  3V6C B;  3WAP A;  1F9J A;  4KV2 A;  4FJZ A;  1EO6 A;  4X57 B;  3ZIM A;  3H6N A;  2O2V B;  3V60 A;  2KK8 A;  2BWE S;  2KJ6 A;  3ZVV A;  3EC8 A;  4EEW A;  5CX3 A;  4E3C A;  1WYW B;  4BBN F;  2CU1 A;  2GBM A;  2CHW A;  3B08 A;  3M62 B;  3AI5 A;  3KUC B;  4ICV A;  3SHQ A;  2L0F A;  4K7S A;  3APD A;  2KZR A;  4II3 B;  3CSF A;  4RMA A;  2V1Y A;  3L16 A;  4FHJ A;  4ANW A;  2MBQ A;  4HDO A;  1E8W A;  3ONS A;  1P0R A;  3LJ3 A;  3OLM D;  3SU8 X;  1WE6 A;  4MSQ B;  1GC7 A;  5G2N A;  1WE7 A;  4CO7 A;  5HKH A;  2R2Q A;  3NHE B;  2D2Q A;  4M0W B;  4WJP A;  2KC1 A;  2KX3 A;  3DBH I;  3K9O B;  2J0M A;  1A5R A;  4ASW C;  3IFW B;  2LGX A;  3R7Q A;  4JL9 A;  2JXX A;  1V5T A;  3X0W A;  4ANX A;  1YJ1 A;  3VVW B;  3RD2 A;  4G11 A;  2QHO A;  3QK0 A;  1ZW7 A;  2L8J A;  1UEL A;  3ZRF A;  4EKU A;  2KTR B;  3QIJ A;  1WZ0 A;  2MW5 A;  3PT2 B;  3QA8 A;  5DCN A;  2KDF B;  1RFA A;  3N30 A;  2MA9 B; 
#chains in the Genus database with same CATH topology
 2NPT B;  4YXD B;  2ZZP B;  1FRR A;  1JRU A;  3QWZ B;  3IVF A;  4PYU A;  1WX7 A;  2BT6 A;  3AE6 B;  3VDZ A;  2ACZ B;  2I1K A;  3B2F A;  5E6J A;  1NI2 A;  1KOT A;  1C78 A;  2IBI B;  1CMX B;  4WWM A;  1YQ3 B;  2BYV E;  2GMI C;  2YLM A;  3AE2 B;  4ZRP A;  1OEY J;  4MDK E;  3VRA B;  5H92 C;  4C00 A;  2JYE A;  1R4M I;  4ZYS A;  2INP E;  3UI3 A;  1XQQ A;  3TCA A;  3D32 A;  1RYJ A;  4AUQ C;  3DBS A;  3JSV B;  4BBN C;  3W5U B;  1HQR D;  4JIO U;  3KH0 A;  2WXK A;  3AED B;  3KWV A;  1WZ3 A;  1ESF A;  2VH1 A;  1V8C A;  4C7Z A;  3DCG A;  5J17 A;  2KHW B;  4LTU A;  4PS8 A;  3WAN A;  1YN4 A;  5AZH A;  4AJW A;  2AX5 A;  2FBW B;  3RMK C;  1AN8 A;  2VZK B;  1SIF A;  3T9L A;  1N5X A;  3A9K B;  3MP9 A;  1BML C;  1ZP0 B;  5KHO A;  1FFV A;  2N9P C;  1FXA A;  3FIL A;  2NS5 A;  3VTV A;  1JCK B;  2DAJ A;  4TV3 A;  2AWT A;  3KLS X;  3L13 A;  2K22 A;  1I4Q A;  1FPY A;  2K0P A;  4AQ7 A;  4AJY B;  2MQJ A;  2WNM A;  4W9F A;  2IPK D;  4B0E A;  3Q8C A;  4RH6 A;  1YQ4 B;  3ABV B;  1UGJ A;  2JYT A;  3AE4 B;  5G55 A;  1WXS A;  1Y8R C;  2JU6 X;  3NOB A;  3NVV A;  2EMS A;  4JWU C;  3TBL D;  1TKE A;  3KYC D;  5FR6 A;  3ZXR A;  3GE8 C;  2ONQ A;  2XEW A;  2JF5 A;  1FXT B;  2EKI A;  3PV1 A;  3W1S C;  4A90 A;  2Y3A A;  2MCN B;  4L2Y A;  1SJH D;  2AL3 A;  2RSU A;  3VUY A;  2M4N A;  2V9H A;  4NZL B;  4A55 A;  5BYQ A;  4EZL A;  1K53 A;  3P4Q B;  5E6P A;  2V3S A;  1L6V A;  1VZ8 A;  4FHK A;  1QOA A;  3EFU A;  3A1Q B;  4UDU C;  4F7Z A;  5GXG B;  4RCO A;  2KWV B;  1L7Y A;  3RPF C;  4YTM B;  3Q14 C;  3VXW A;  1SJE D;  4HPP A;  1KM7 A;  1TT5 B;  3TMP B;  1I4R A;  1NYR A;  1RRB A;  5BMI A;  4NAW A;  2IGG A;  1WR6 E;  4DXG A;  4AWJ A;  3BK2 A;  5BMG A;  1J7B A;  1I35 A;  3DPD A;  3GS2 A;  1T0Q C;  4TMA B;  4K81 A;  4E71 A;  4A3O A;  2VZK D;  1YX6 B;  3R66 C;  3BVZ A;  4MEL A;  2KDE B;  4ARC A;  3MFG A;  3UQA A;  2WXF A;  3NS8 A;  3AH7 A;  2KWC A;  1B1Z A;  1QOF A;  3ZDM C;  3OG5 A;  2CS4 A;  1OFF A;  2PW9 A;  3NZU A;  4KKI A;  2A4Z A;  2GBR A;  1F52 A;  2E3T A;  2YEP B;  2MWS B;  4M02 A;  4TQ0 A;  3ZNH B;  4NPN A;  2ASQ A;  1C1Y B;  5HI1 A;  4FJV B;  1VZ7 A;  1LO5 D;  1XT9 B;  3DDC B;  3ZJT A;  2IGH A;  2MBO A;  1SBB B;  2KTR A;  5CHV C;  2BF8 B;  5I4D A;  3DHI C;  1YD8 U;  4ZRQ A;  5IKC M;  1ISN A;  1SE2 A;  2KTF A;  2BYT A;  3DBR I;  2LHD A;  1FIQ A;  1QOG A;  3N20 C;  4JGH B;  3DWG C;  3DOW A;  2AL6 A;  1R4N I;  4JQW C;  1QIL A;  4OVV A;  4RM8 A;  5HG2 A;  1LM8 B;  1SEB D;  3A9J B;  3A9K A;  2WU5 B;  1PYW D;  3BZD B;  4RF1 A;  5C3J B;  3PSE B;  3Q8A A;  1QF6 A;  2GB1 A;  3ZDT A;  3AB5 A;  2RDH A;  1XF5 L;  3DVG X;  3PZD A;  2JY6 A;  4IW0 A;  4EUT A;  3P4R B;  2KAN A;  1WRI A;  4OVZ A;  4OZC A;  5IA7 A;  2QEJ C;  3W1S A;  1YX5 B;  2L52 A;  3NVW A;  2FNJ B;  1E6E B;  1T0S C;  5D2M B;  3PO0 A;  2KMM A;  1SF0 A;  1V49 A;  4LCD E;  1SIJ A;  5AEK B;  2ZW0 A;  4Q2J A;  2AQ3 B;  1Y56 A;  4TSS A;  3BYT B;  4HJG E;  1GPX A;  4J6I A;  2JUO A;  5LXH A;  3N32 A;  4GOC A;  2N1V A;  4M00 A;  2K25 A;  2BS3 B;  3RNB C;  2HTM E;  4WIP A;  4ICU A;  2MLB A;  5EE3 A;  5L95 C;  2CKH B;  1E9M A;  3NRZ A;  2N7J A;  2SAK A;  3N1Z C;  4HJK A;  3SR6 A;  2MRP A;  3KVF B;  3BVG A;  1ZDX A;  2OOB B;  3ENE A;  4DBG A;  4P7I A;  4EZK A;  1D5M C;  4IOI E;  1LGR A;  3HM6 X;  1E7P B;  4HCP B;  4AOF A;  4W9H A;  2NTS A;  4DWF A;  2DNF A;  2QCZ A;  1OGW A;  3IT6 B;  3ZKJ C;  4HLE A;  2FE8 A;  3ZW3 A;  3N1X C;  4CHK A;  3HHM A;  4K7W A;  2M0A A;  3Q8E A;  4CQN A;  2LXA A;  3ZGZ A;  1WJN A;  3Q3N C;  3GB1 A;  4HEA 1;  2JVC A;  1C4P A;  1JWA D;  1TKY A;  2WDV B;  3I63 C;  4I6P A;  2MJE A;  1XLQ A;  1KRH A;  3R2T A;  4XWT A;  5AZF A;  2LHE A;  1F9J A;  4S0R A;  4FJZ A;  4X57 B;  1WWT A;  2AQ1 B;  4E3C A;  1MI0 A;  4ICV A;  4RFB A;  3APD A;  2KZR A;  1FRD A;  3L16 A;  1L5P A;  3ONS A;  3P1M A;  3SU8 X;  4MSQ B;  1WE7 A;  5HHD G;  5BYR A;  3EFC A;  3K9O B;  3GE3 C;  1A5R A;  4ASW C;  4REZ A;  3AE3 B;  4ANX A;  2IDY A;  3I9V 1;  3RD2 A;  3AMZ A;  3QK0 A;  2L8J A;  3HRD D;  1UEL A;  5JXV A;  1CZP A;  2MW5 A;  3PT2 B;  3QA8 A;  5DCN A;  1PFD A;  1RFK A;  2J7Q B;  4DK5 A;  2RGF A;  2RD0 A;  1D5Z C;  1P98 A;  3FC4 A;  4ZOH C;  4ZRJ A;  4L1B A;  4GGQ A;  2RR9 A;  3DHG C;  3SEB A;  3MC8 A;  1HE8 A;  1P9D U;  3AM9 A;  3R8B A;  4WWO A;  2LD9 A;  1J7C A;  1WM2 A;  4RF0 A;  1DYQ A;  2LGD A;  1AYF A;  3NG0 A;  4URK A;  1N61 A;  3N1Y C;  4NY0 A;  5EE1 A;  1ZDV A;  3PZ8 A;  1TZ1 A;  2HDE A;  1E0Z A;  3HM3 A;  1LFD A;  4A9A A;  1YJI A;  2IJ0 A;  1Q5W B;  2I38 A;  1FO4 A;  3PHX B;  2XK5 A;  3RNG C;  5C23 A;  2WQY B;  4KSL C;  4FXC A;  3LB8 C;  5BYS A;  1H8C A;  1GNU A;  2PVO D;  5TSS A;  2D07 B;  4KDI C;  3V61 A;  1TGZ B;  1F1H A;  5JHA A;  4XE0 A;  1U4A A;  5D6J B;  4J3O D;  4YSY B;  2G4D B;  3M3J A;  1NBF C;  4WQM A;  4E74 A;  2KVZ A;  1WJ6 A;  2K5P A;  2Y5P A;  5FK9 C;  2KFK A;  3RUI B;  2HJ8 A;  4WJO A;  1WXA A;  2ZPY A;  2LAS A;  1E10 A;  4NAM A;  2ZNV B;  1S1Q B;  2N4F A;  2WP9 B;  4HKQ A;  3CWI A;  3PRE A;  3VR8 B;  3AEF B;  1MHX A;  2E6X A;  2WDR B;  1ENF A;  2HJ1 A;  2KOX A;  2KQ7 A;  4IWP A;  2PE9 A;  4RNA A;  1UWM A;  3RYT A;  2C7M B;  2WDQ B;  3JW0 X;  4HRO A;  3RZW C;  4OZA A;  4GB9 A;  2Z0D B;  2N9K A;  3WAM A;  3AEC B;  3CST A;  3AN1 A;  4JLC A;  4B95 A;  1WFY A;  3AV8 A;  2Q5W D;  4MGK E;  1V1P A;  3KYD D;  2N9E B;  1CQV A;  1HXY D;  3MTN B;  1ZGU B;  3C19 A;  1RM6 C;  3K9P B;  5AUK A;  4RM9 A;  1XEE A;  2KWD A;  4YT0 B;  3KQ4 A;  4H2A A;  4EE2 A;  1YN5 A;  2IO1 B;  1ET6 A;  2C7N B;  2W54 A;  3MC9 A;  2KX0 A;  1LXD A;  2G4S A;  1ZKH A;  2NTT A;  1EF1 A;  1DOI A;  4LNO A;  3HK0 A;  1WH3 A;  2M0X A;  1T0Y A;  4ZHP A;  2M19 A;  2BW2 A;  1P7E A;  2C9W B;  5KHQ A;  4TKN A;  1XCT L;  5LLI A;  2OJW A;  4I6N B;  1F2R I;  3IAS 1;  3NVY A;  1D4B A;  1PDX A;  1IBX B;  1ZOY B;  3IXS A;  3WA0 A;  2DYM A;  3BII D;  5EE9 A;  2RDB C;  1ZXI A;  3KW5 B;  3DVG Y;  2PLP A;  2KAJ A;  4US8 A;  1F2R C;  2KDI A;  2O2V A;  5FR3 A;  2KFJ A;  2KLG A;  3QQ8 B;  2G3Q B;  5DPS A;  4MGZ E;  4XYC A;  1SE3 A;  2QMT A;  2D3G A;  3W1Y A;  1KF6 B;  3TJP A;  1CK1 A;  3ECI A;  3SFE B;  2M8S A;  1I4P A;  2MEK A;  3JSV A;  3RZF A;  1V6E A;  5C1Z A;  4K1R B;  1XCQ L;  4F1S A;  3E9S A;  2PJH A;  4M01 A;  1JWS D;  4LNN A;  4NJ7 A;  1C4A A;  4HPM B;  4AS1 A;  3NJT A;  4IC7 B;  3WCQ A;  3DBR B;  2CR5 A;  4FJY A;  1WGR A;  4OVU A;  4YSZ B;  2CHX A;  3L08 A;  1ACC A;  3VFK A;  1UF0 A;  3B1L X;  4KGT A;  1AW7 A;  2JRI B;  4ANU A;  2JXT A;  1XD3 B;  5D94 A;  3V62 A;  4GDL A;  2O6V D;  2VRR B;  1EWY C;  2C60 A;  2WXN A;  3ZJV A;  3OAW A;  1NVI D;  1DGJ A;  2CHZ A;  3GP7 A;  2LVQ A;  1FNV A;  1HZ5 A;  1HA5 A;  3P63 A;  3O13 A;  4HDQ A;  2MH7 A;  2ZCC A;  4BKS A;  2FCQ A;  1ZUD 2;  1C4C A;  1QLB B;  4IM2 A;  5FKA C;  2WDT B;  1QZE A;  1T6B X;  4YTN B;  2I2Y A;  2KFK B;  4W9D A;  1E7U A;  1J8C A;  2JX5 A;  4WJN A;  2PVG C;  4KVG B;  1J0G A;  3A4R A;  2GBJ A;  3OJ4 B;  1G6J A;  1WSP A;  3QC8 B;  3BVM A;  1WXQ A;  1UBI A;  1ET9 A;  4IKG A;  1MHH E;  2KKC A;  1VR9 A;  3MJW A;  2Z0E B;  1JML A;  1WGH A;  1IYF A;  3KUD B;  1F77 A;  1GJZ A;  4GU2 A;  3LDZ E;  1WGD A;  2MP2 A;  1WF9 A;  2DX5 B;  4KGS A;  1LQB A;  3AE9 B;  3RUL A;  2WYQ A;  3ZNZ B;  3DBL B;  1WGK A;  1R7S A;  2M56 B;  3CIR B;  4CYE A;  2L05 A;  3Q6B A;  1D5X C;  2LGI A;  5D7G A;  3SFD B;  2MX2 A;  3UQB A;  3H9D A;  2PE6 B;  3IG3 A;  3PS6 A;  3P42 A;  4WJQ A;  2KDB A;  3AXC A;  2OHF A;  2QIL A;  3IBE A;  3Q3O C;  4BKT A;  4BZA A;  2KMA A;  1H4R A;  3U7Z A;  1A70 A;  4XX5 A;  2GBN A;  1GG3 A;  1KJT A;  2ZW1 A;  1C9F A;  1T0R C;  1Q1O A;  2REX A;  3ZYY X;  3DHH C;  1EO6 A;  3OWE B;  5HFY A;  2L32 A;  2J53 A;  2BB5 A;  5CX3 A;  4BBN F;  2CU1 A;  2LUM A;  3M62 B;  1XLN A;  3AI5 A;  3SHQ A;  2MHJ A;  4RMA A;  1QKZ A;  2V1Y A;  4FHJ A;  4ANW A;  4HDO A;  1E8W A;  4A8X C;  2ICI A;  5HKH A;  2W3S A;  4WJP A;  3RI7 C;  1NYQ A;  1EU4 A;  2J0M A;  4XWW A;  3AE8 B;  1P7F A;  4JL9 A;  2JXX A;  1YJ1 A;  2JSV X;  1OQR A;  2KTR B;  1WZ0 A;  4N58 A;  1JW9 D;  1KLU D;  4QAY A;  5H8Y E;  4N9F 4;  2I1J A;  4BAX A;  3VQI A;  2FIF A;  5IN7 A;  4AP4 C;  4F8C B;  4OHJ A;  2K6Q A;  3LXF A;  2HTH A;  4JPS A;  2D3A A;  3R3M A;  3FKY A;  2JZZ A;  4DHZ E;  2TSS A;  4W9L A;  2J42 A;  1IGD A;  1V2Y A;  4FAD A;  1ZPS A;  2X38 A;  2WXM A;  2X8X X;  3HIZ A;  1MPE A;  3KWL A;  4ZDV A;  3RT3 B;  4C4V B;  3U7D A;  3WAO A;  3W5V B;  4XDC A;  3V05 A;  2ZCB A;  3TEY A;  1V1O A;  4GXB A;  2R2O A;  4DHJ B;  1N5W A;  2KN5 A;  3RFZ B;  3SDL C;  1WI0 A;  2V3N A;  3ZRC A;  3TIX A;  4BKG A;  1V9J A;  4DHJ D;  3PVL A;  1IPG A;  3RNE C;  1K52 A;  5J2R A;  2WXO A;  4M0W A;  5JZE B;  1TBE A;  4KIK A;  1FNW A;  3W2D A;  3V6E B;  3H8H A;  3SD5 A;  3KUZ A;  2CJO A;  3VAW A;  2N9X A;  1WX8 A;  3RNF C;  3PTF C;  2PTL A;  1FXI A;  2L3Z A;  2NCN A;  2L83 A;  2GLS A;  1FD6 A;  2KDM A;  1YOV B;  2N0S B;  4R3D A;  3PHW B;  4KX6 B;  4LNI A;  2DYB A;  1YNT E;  2QSD A;  2DZK A;  1GOZ A;  5DPT A;  4A6Q A;  4S17 A;  1V81 A;  5E6O A;  4MJS B;  2XN9 C;  1L2N A;  2FCS A;  2HE7 A;  2VH2 A;  2LWP A;  3VRB B;  2LI5 A;  2WWZ A;  5CTR C;  1FCL A;  3DQV A;  1VZ6 A;  2K9X A;  4HRS A;  3EUB 2;  1NDD A;  4RGN A;  1JAL A;  4K7U A;  3BWU D;  2R61 A;  4WWP A;  3Q3M C;  2C7H A;  3B9J A;  2H89 B;  2LRW A;  4LK0 M;  1EF5 A;  4YL8 A;  4II2 B;  1GB1 A;  4WH4 A;  2WX0 A;  2MP2 B;  3W9C B;  1JRO A;  3IHP C;  2K1F A;  2MBB B;  2EMT A;  1T3Q A;  1RLF A;  1I4H A;  2A5U A;  4MH8 A;  4KSK C;  1SE4 A;  3UIO B;  3M63 B;  2GRI A;  4ZRI A;  1V5O A;  1XXG A;  1T5X D;  4MGI E;  4KZ0 A;  1NI3 A;  1K8R B;  3LYY A;  4NNJ B;  1E8Y A;  2XK5 B;  3EHV A;  4G50 A;  4HPL B;  3ZQ4 A;  1OTR B;  2Z8L A;  1L0Y B;  1L6U A;  1WYG A;  3RNC C;  4OZB A;  1EWC A;  2Z59 B;  3TEZ A;  2N9L A;  5G5H A;  2IND C;  1QOB A;  5AZG A;  1HTQ A;  3ZXV A;  2PKO A;  1QQR A;  2BVC A;  2DAF A;  3A9J A;  3L17 A;  3EEC A;  2EKE C;  2MSE D;  5G5G A;  3O65 B;  4YWG G;  4ACF A;  3L4P A;  3QJZ A;  1MFW A;  2KC2 A;  1L4Z B;  2K8B A;  3T3N A;  2LGY A;  2INC C;  2V4L A;  4ANV A;  4HVB A;  4WWN A;  2FCM A;  2DZJ A;  5TR5 A;  4C4V A;  3ALB A;  4P6V F;  3C8Y A;  4WUR A;  3JYU A;  2D11 A;  4C56 C;  3AEA B;  1FMA D;  1TZO A;  1VCB A;  3VUW A;  2M17 A;  1F0Z A;  3IAM 1;  1NEK B;  1TKG A;  1UH6 A;  2DBY A;  4EOY A;  1GAQ B;  3AU5 A;  3TSS A;  2GI9 A;  2XBB C;  4MM3 B;  4W9I A;  4M8M A;  2KLC A;  4WQO B;  3VH3 B;  3PRZ A;  2IZV B;  2CU3 A;  3AEB B;  2INN E;  1WGY A;  4ARI A;  1QT9 A;  1Q10 A;  1VRA B;  2AEH A;  1V97 A;  2PIA A;  3L54 A;  2C5L C;  3UIN B;  4PT5 A;  1VLB A;  2D10 A;  4A3P A;  2WX1 A;  2WXI A;  1B9R A;  3VR9 B;  4ZRK A;  2NR2 A;  1JWM D;  2D3C A;  1DOY A;  3R2I A;  3ML9 A;  4RGT A;  2JWZ A;  3NY5 A;  2KQS A;  2UWQ A;  1UUP A;  4C7Y A;  3PLV A;  3Q3F A;  4P16 A;  1ZE3 D;  3J9C A;  4DHZ B;  2V0G A;  4MJS A;  3VHT C;  1C79 A;  4BVU C;  4JX1 C;  2DEN B;  1WY8 A;  2UYZ B;  3AUL A;  3U8Z A;  3AEG B;  1ZXH A;  2ZJD A;  3MHZ A;  2G45 B;  2BYF A;  1C3T A;  4P1B C;  4B6W A;  3NZ3 A;  2FID A;  1HTO A;  2L00 B;  2L76 A;  1L0V B;  4PYZ A;  5C2T B;  1PGX A;  1C76 A;  1YIW A;  3PLU A;  2J4X A;  2NPT A;  2WXJ A;  1K50 A;  3C0R B;  3TEW A;  5BMH A;  5J18 A;  1MG4 A;  1S3S G;  1YN3 A;  4M8N A;  1V1P B;  4MT5 A;  4YTP B;  2PMV A;  1E90 A;  3UF8 A;  3T3O A;  2J0K A;  2JZP A;  3HVD A;  3QX1 A;  4N59 A;  4EFO A;  3I5J C;  4IM0 A;  1CJE A;  2RMM A;  2N7D A;  2G9H D;  5IAA C;  1SSN A;  1WRD B;  5JHB A;  2KWU B;  1N63 A;  2K8H A;  4LJO B;  4MEM A;  3ZJU A;  1AAR A;  2BS2 B;  2N1W A;  5CHF A;  1E8X A;  3VH4 B;  4MM3 A;  1WM3 A;  2AQ2 B;  3ZTD A;  4P1C C;  1WJ4 A;  2JQR B;  2LMC A;  3CF6 E;  2SEB D;  2MJD A;  3U4E G;  5IOI A;  3U30 A;  5DPR A;  2LJ5 A;  2KVR A;  1D6E C;  2LUE A;  1TS5 A;  3Q8B A;  2RDG A;  3MJ5 A;  4BOZ B;  3QCA A;  5JH5 C;  4NJC A;  2BGF A;  1GB4 A;  3APC A;  3P2B A;  5AUI A;  4DQO C;  2DWQ A;  4FN2 A;  3ETR A;  1ROE A;  1TY2 A;  3WAP A;  3H6N A;  2O2V B;  3V60 A;  1FM0 D;  4B0M A;  2KJ6 A;  1XO3 A;  3EC8 A;  4EEW A;  1WYW B;  2WHI A;  3KUC B;  4USA A;  3AE1 B;  4WAF A;  3E56 A;  5IO9 A;  1GC7 A;  1N6Z A;  2D2Q A;  2BS4 B;  2KX3 A;  1KH0 A;  3IFW B;  2LGX A;  2V3P A;  3Q8F A;  4LNF A;  3X0W A;  3VVW B;  4G11 A;  2QHO A;  4EKU A;  1ZW7 A;  2QDF A;  3QIJ A;  2WS3 B;  2G1E A;  2KDF B;  3HVZ A;  1RFA A;  3N30 A;  1FCC C;  3TL5 A;  5MPO A;  2FUH B;  3AE7 B;  1WMH A;  2Y5B B;  3WAL A;  3PGE A;  4YSX B;  2MBH A;  4JE3 B;  1WJU A;  1UGM A;  3A4S C;  2NBU A;  4GDL B;  5DPW A;  3PPA A;  4G3X B;  1M4V A;  3WIM A;  2LVO A;  3TEX A;  2KN4 A;  3B2G A;  4W9C A;  3CMM B;  3X23 A;  4GSW A;  4NQK E;  1R4M B;  3T8M A;  4HWI B;  1SB3 C;  1E5W A;  4TQ1 A;  4FUL A;  2L1A A;  1WXV A;  3OJ3 A;  3L10 B;  4GDK B;  2IO3 B;  2ZVN A;  4DXA B;  2O6V B;  4KKJ A;  2QIE B;  2MJ3 A;  2BTE A;  1PQS A;  1AWD A;  4MSM B;  5LNK 1;  1X1M A;  4NAW B;  2KT7 A;  2PPH A;  2IO2 B;  2BQQ A;  3IT4 B;  1KLG D;  3APF A;  3VTW A;  1V80 A;  1SE9 A;  1E8Z A;  2WU2 B;  2WXR A;  3V3X A;  2B76 B;  3A1Q A;  4FBJ B;  2RPV A;  2DYO A;  4PS7 A;  1JWU D;  1EM7 A;  3DBH B;  4KZC A;  2WXP A;  1TTN A;  3AE5 B;  1I4X A;  3DBL I;  2FCN A;  2V4I B;  4W9E A;  2IGD A;  2DZM A;  1KTK A;  4XDD A;  1PGB A;  2KQ4 X;  3Q2A C;  5BO4 B;  1TY0 A;  2Y5C A;  2ZEQ A;  1I7H A;  4XZ4 A;  3N3K B;  2BKF A;  5T8I A;  2GOW A;  2KD0 A;  2OED A;  2L0T A;  4IDI A;  3AU4 A;  1SXT A;  1STE A;  2BBC A;  2K8C A;  3P4P B;  4RGM A;  3VUX A;  3DVN V;  1GC6 A;  1N62 A;  2KAC A;  3A33 B;  1IBX A;  3L0W B;  4G0N B;  1FNU A;  1EU3 A;  1WR1 A;  4K3C A;  2JRH A;  1JQ4 A;  1TS2 A;  3ZO5 B;  1VDV A;  2OJR A;  1KFY B;  1WMH B;  3BYY B;  3UGB B;  4IWO A;  4HKZ E;  3VTU A;  3B0A A;  2NBW B;  2K6D B;  2JT4 B;  1J7A A;  1JWB D;  3TUO A;  3H7S A;  1WXM A;  2IY0 B;  3UIP B;  4MGY E;  3QHT A;  4IUM B;  3MHS D;  2JZ3 B;  2BKR B;  3I3T B;  1D3Z A;  2BYE A;  3QAR A;  2LGS A;  1BUI C;  4XC2 A;  2D3B A;  4GMV A;  2BB6 A;  1XLP A;  2L7R A;  2ZPN A;  3DWM A;  1VJK A;  1E7V A;  3ZLZ A;  1YMH E;  3H7P A;  4HK2 A;  4KIK B;  3QAQ A;  1YJJ A;  3ZTC A;  1HEZ E;  1OEY A;  2D5G A;  2J0J A;  1EUV B;  3Q69 A;  3URY A;  2AYO B;  1TS4 A;  4KDL B;  1V86 A;  3NS1 A;  4LDT D;  2WXQ A;  4KGR A;  5D3I B;  2LFI A;  2W55 A;  4GLS C;  1R4N B;  2W82 A;  2JPH A;  4IM3 A;  1J19 A;  4US9 A;  2WXL A;  2DZI A;  1RAX A;  2ZVO A;  2YEP F;  5EDS A;  2HD5 B;  4W9G A;  3H1U A;  3GZN I;  2WXH A;  4PK1 A;  1N60 A;  3GOE A;  4FA6 A;  3P4S B;  1Q0W B;  3BIN A;  2UU7 A;  3HUI A;  2N7E A;  2KNB A;  2IY1 B;  4NQL B;  4LDT B;  1NEN B;  1BT0 A;  4EZJ A;  1M94 A;  4FLH A;  1MVK A;  2XNA C;  1SGH A;  2J52 A;  1P3Q U;  2KJH B;  4GDK A;  3PRM B;  4LJP B;  2O6V A;  1GUA B;  4K3B A;  3JVZ X;  4OW0 A;  3Q3J A;  2DHZ A;  1IUE A;  4N6E B;  4I6L B;  3PZ7 A;  1UBQ A;  2LRU A;  3R7R A;  3RCZ A;  2FAZ A;  1KLV A;  2KYW A;  4TUU A;  1L0X B;  2NVU I;  2QC8 A;  3PRP B;  4L23 A;  3RNA C;  5LXI B;  5EE0 A;  1IGC A;  1WGG A;  1MJD A;  4BKS D;  5IP4 D;  1IP9 A;  4XGA B;  2FUG 1;  4DDI D;  4IG7 B;  4B9K A;  4PS3 A;  3GZN B;  4D2K A;  1Z5S B;  1FFU A;  1RWS A;  3ZUN A;  4LNK A;  4W9J A;  1C77 A;  4BOS C;  2W9N A;  1TYG B;  3FIL B;  3DVN U;  2W3R A;  4O1N A;  4HXD A;  2NBV B;  2ON8 A;  1UNS A;  1P1A A;  2IYD B;  2LVP A;  2BWF A;  1YQB A;  4WAA A;  2YVC A;  5CHW A;  4NJ6 A;  3ZNG C;  2LEK A;  1OQQ A;  3NZS A;  3EA6 A;  2KMC A;  1DOX A;  2KXJ A;  1TJE A;  4LLG M;  4ZYN A;  4GN1 A;  5L83 A;  2QJL A;  1HZ6 A;  2B3A A;  1PUT A;  1XLO A;  2LZ6 A;  1I42 A;  2EEL A;  1WIA A;  4W9K A;  3M95 A;  1UZX B;  1MG8 A;  3BK1 A;  3I57 A;  2CJN A;  4HCN B;  4BFR A;  4MAC A;  5D3D A;  2KO3 A;  2KJR A;  1WX9 A;  2H88 B;  2WGS A;  2K3U A;  4DDG D;  2PEA A;  4MH0 E;  4ZHO A;  3NVZ A;  3U52 E;  3ZNI D;  2GBK A;  1TS3 A;  2LXC A;  2RPQ A;  5GMV A;  1OQY A;  2K39 A;  1VD2 A;  2M1M A;  1Z2M A;  4DXF A;  3NUH B;  3ML8 A;  2MBE A;  2IO0 B;  3RN9 C;  4GIV A;  4C80 A;  1K51 A;  3BY4 B;  4IWQ A;  4A20 A;  2JWU A;  4RGO S;  5E6N A;  2ZNV C;  3H7P B;  1FEH A;  2BPS A;  1UD7 A;  3S2A A;  3N9Y C;  1BXT A;  3V6C B;  1I4G A;  3U2S C;  4JWS C;  4KV2 A;  3ZIM A;  2KK8 A;  2BWE S;  3EGR A;  3FAH A;  3ZVV A;  2DLB A;  2NMQ A;  2LJI A;  2WXG A;  2GBM A;  2CHW A;  3B08 A;  2L0F A;  4K7S A;  4II3 B;  3CSF A;  4ITK A;  2MBQ A;  1P0R A;  3LJ3 A;  3OLM D;  1WE6 A;  3AEE B;  3MC0 B;  5G2N A;  1PGA A;  1TIF A;  4CO7 A;  2R2Q A;  3NHE B;  4M0W B;  2KC1 A;  3DBH I;  1JRP A;  1L4D B;  3R7Q A;  1UWX A;  1V5T A;  3ZRF A;  2WLB A;  2MA9 B; 
#chains in the Genus database with same CATH homology
 2J7Q B;  4DK5 A;  2NPT B;  2RGF A;  4N9F 4;  3TL5 A;  2RD0 A;  2I1J A;  2ZZP B;  1P98 A;  4ZRJ A;  1JRU A;  2FUH B;  3QWZ B;  3VQI A;  3IVF A;  2FIF A;  4GGQ A;  1WX7 A;  4PYU A;  2RR9 A;  4AP4 C;  4F8C B;  1HE8 A;  1WMH A;  2K6Q A;  2Y5B B;  2HTH A;  1P9D U;  3VDZ A;  3WAL A;  4WWO A;  2I1K A;  3PGE A;  2LD9 A;  2MBH A;  3R3M A;  2JZZ A;  4DHZ E;  1WM2 A;  2LGD A;  1WJU A;  4W9L A;  1NI2 A;  1KOT A;  1UGM A;  4URK A;  2IBI B;  3A4S C;  2NBU A;  4GDL B;  5DPW A;  1CMX B;  1V2Y A;  4FAD A;  4NY0 A;  2BYV E;  2GMI C;  3PPA A;  4G3X B;  2YLM A;  3WIM A;  2LVO A;  1OEY J;  4W9C A;  3HIZ A;  4MDK E;  3CMM B;  3X23 A;  4GSW A;  1TZ1 A;  4NQK E;  3T8M A;  4HWI B;  4ZDV A;  1E5W A;  4TQ1 A;  3RT3 B;  3U7D A;  4FUL A;  3HM3 A;  1LFD A;  1WXV A;  3OJ3 A;  3WAO A;  3L10 B;  4GDK B;  1R4M I;  2IO3 B;  2ZVN A;  1Q5W B;  4DXA B;  2ZCB A;  4GXB A;  4DHJ B;  1XQQ A;  2R2O A;  3TCA A;  2O6V B;  3D32 A;  2KN5 A;  3PHX B;  4AUQ C;  2XK5 A;  3DBS A;  3JSV B;  3SDL C;  1WI0 A;  4BBN C;  5C23 A;  1PQS A;  4KSL C;  3ZRC A;  4JIO U;  3TIX A;  3KH0 A;  4BKG A;  4MSM B;  1WZ3 A;  1V9J A;  1X1M A;  4NAW B;  4DHJ D;  3DCG A;  1H8C A;  3PVL A;  1GNU A;  1IPG A;  5J17 A;  2PPH A;  2IO2 B;  5J2R A;  2KHW B;  4PS8 A;  3WAN A;  5JZE B;  5AZH A;  4AJW A;  3APF A;  1TBE A;  4KIK A;  3VTW A;  1V80 A;  1SE9 A;  1E8Z A;  2D07 B;  4KDI C;  3V6E B;  1SIF A;  3T9L A;  3V61 A;  3A1Q A;  3A9K B;  3SD5 A;  4FBJ B;  1TGZ B;  3KUZ A;  5JHA A;  5KHO A;  2DYO A;  4PS7 A;  1U4A A;  5D6J B;  3VAW A;  2N9P C;  2N9X A;  2NS5 A;  3VTV A;  4KZC A;  2G4D B;  3M3J A;  2DAJ A;  1WX8 A;  1TTN A;  1NBF C;  3PTF C;  4TV3 A;  3DBL I;  4E74 A;  2FCN A;  4W9E A;  2AWT A;  2DZM A;  2L3Z A;  2NCN A;  1WJ6 A;  3L13 A;  2KFK A;  3PHW B;  3RUI B;  2HJ8 A;  2DYB A;  5BO4 B;  4AJY B;  2MQJ A;  4W9F A;  4WJO A;  1WXA A;  2ZEQ A;  2ZPY A;  2DZK A;  2LAS A;  4XZ4 A;  3N3K B;  5DPT A;  2BKF A;  2ZNV B;  5E6O A;  1V81 A;  2GOW A;  2KD0 A;  4MJS B;  5G55 A;  1S1Q B;  2L0T A;  1WXS A;  2N4F A;  1Y8R C;  3AU4 A;  3NOB A;  1L2N A;  2FCS A;  2HE7 A;  3PRE A;  2LWP A;  2K8C A;  2EMS A;  3TBL D;  2LI5 A;  3KYC D;  5FR6 A;  2XEW A;  2WWZ A;  3DVN V;  1GC6 A;  5CTR C;  3VUX A;  3A33 B;  2JF5 A;  3DQV A;  1FXT B;  3L0W B;  4G0N B;  3PV1 A;  2KOX A;  2KQ7 A;  3W1S C;  4IWP A;  1WR1 A;  2PE9 A;  1NDD A;  2JRH A;  3RYT A;  4K7U A;  2C7M B;  2MCN B;  4WWP A;  2C7H A;  2AL3 A;  2RSU A;  3ZO5 B;  3VUY A;  2M4N A;  3JW0 X;  2LRW A;  3RZW C;  2OJR A;  1EF5 A;  4YL8 A;  1WMH B;  3UGB B;  4II2 B;  2WX0 A;  2MP2 B;  4IWO A;  4EZL A;  3IHP C;  4GB9 A;  3B0A A;  3VTU A;  2K1F A;  2MBB B;  2EMT A;  2NBW B;  2V3S A;  2K6D B;  2Z0D B;  5E6P A;  3WAM A;  2JT4 B;  1RLF A;  3CST A;  2A5U A;  4JLC A;  4KSK C;  4FHK A;  4B95 A;  1WFY A;  3UIO B;  3M63 B;  3EFU A;  3A1Q B;  4F7Z A;  4ZRI A;  3H7S A;  1WXM A;  4MGK E;  2IY0 B;  3UIP B;  2KWV B;  1V5O A;  4MGY E;  3KYD D;  2N9E B;  1L7Y A;  3QHT A;  4MGI E;  4IUM B;  3MHS D;  2JZ3 B;  4KZ0 A;  2BKR B;  3MTN B;  1ZGU B;  3I3T B;  1D3Z A;  2BYE A;  3VXW A;  3QAR A;  1KM7 A;  3K9P B;  1K8R B;  3TMP B;  4XC2 A;  4NNJ B;  4RM9 A;  1E8Y A;  2XK5 B;  4GMV A;  3EHV A;  4G50 A;  4HPL B;  2IO1 B;  1RRB A;  2C7N B;  2L7R A;  2ZPN A;  2KX0 A;  1LXD A;  1OTR B;  2G4S A;  1E7V A;  1ZKH A;  4NAW A;  1EF1 A;  3ZLZ A;  1WR6 E;  3HK0 A;  1WH3 A;  4AWJ A;  1I35 A;  3H7P A;  2M0X A;  1T0Y A;  3DPD A;  4HK2 A;  4KIK B;  3QAQ A;  3ZTC A;  2C9W B;  4K81 A;  5KHQ A;  1OEY A;  4TKN A;  2Z59 B;  5LLI A;  4E71 A;  2J0J A;  1EUV B;  4I6N B;  4A3O A;  2AYO B;  1YX6 B;  4KDL B;  1V86 A;  3R66 C;  4LDT D;  5AZG A;  2DAF A;  4MEL A;  2KDE B;  3A9J A;  2JPH A;  4IM3 A;  1J19 A;  3L17 A;  2DYM A;  3WA0 A;  3EEC A;  3UQA A;  2EKE C;  2MSE D;  2DZI A;  3NS8 A;  3KW5 B;  3O65 B;  1RAX A;  3DVG Y;  3QJZ A;  2KWC A;  2KC2 A;  2K8B A;  2LGY A;  2KDI A;  2ZVO A;  3ZDM C;  5EDS A;  2O2V A;  2CS4 A;  3NZU A;  2V4L A;  2HD5 B;  2A4Z A;  2GBR A;  4ANV A;  2KFJ A;  4HVB A;  4W9G A;  2KLG A;  3H1U A;  4WWN A;  3QQ8 B;  2G3Q B;  3GZN I;  2FCM A;  5DPS A;  2DZJ A;  4MGZ E;  5TR5 A;  3ALB A;  3GOE A;  2MWS B;  4FA6 A;  3JYU A;  1Q0W B;  2D11 A;  3BIN A;  2D3G A;  3W1Y A;  4TQ0 A;  3ZNH B;  2N7E A;  4NPN A;  3TJP A;  2KNB A;  2IY1 B;  1VCB A;  3ECI A;  2ASQ A;  4LDT B;  2M8S A;  4NQL B;  1C1Y B;  3JSV A;  3VUW A;  1BT0 A;  1V6E A;  2M17 A;  3RZF A;  4EZJ A;  5C1Z A;  1UH6 A;  4FJV B;  4K1R B;  1M94 A;  4F1S A;  4FLH A;  1XT9 B;  2PJH A;  4EOY A;  1SGH A;  3AU5 A;  3DDC B;  2MBO A;  2KTR A;  5CHV C;  1P3Q U;  2KJH B;  2BF8 B;  2XBB C;  4NJ7 A;  4GDK A;  4HPM B;  3PRM B;  4W9I A;  4M8M A;  1YD8 U;  4LJP B;  2KLC A;  4IC7 B;  4WQO B;  3VH3 B;  3PRZ A;  2IZV B;  2O6V A;  1GUA B;  2CR5 A;  4FJY A;  3JVZ X;  1ISN A;  2KTF A;  3Q3J A;  2DHZ A;  1WGR A;  4OVU A;  3DBR I;  4I6L B;  1WGY A;  2CHX A;  1UBQ A;  3L08 A;  2LRU A;  2AEH A;  3L54 A;  2C5L C;  3UIN B;  3R7R A;  3B1L X;  3VFK A;  3RCZ A;  2FAZ A;  4JGH B;  1KLV A;  2D10 A;  2JRI B;  4A3P A;  2WX1 A;  3DOW A;  4ANU A;  2AL6 A;  1R4N I;  4JQW C;  4ZRK A;  1XD3 B;  4OVV A;  2NR2 A;  5D94 A;  4RM8 A;  3V62 A;  4TUU A;  2NVU I;  1LM8 B;  4GDL A;  3A9J B;  3ML9 A;  2O6V D;  2VRR B;  3A9K A;  3PRP B;  2JWZ A;  3NY5 A;  5LXI B;  2KQS A;  2C60 A;  2UWQ A;  1WGG A;  4BKS D;  1IP9 A;  3OAW A;  3PSE B;  4DDI D;  3PLV A;  4IG7 B;  3ZDT A;  4B9K A;  3Q3F A;  4PS3 A;  4DHZ B;  2CHZ A;  4MJS A;  3VHT C;  4BVU C;  1Z5S B;  3DVG X;  2DEN B;  2LVQ A;  3ZUN A;  3PZD A;  4W9J A;  2JY6 A;  4BOS C;  2W9N A;  1WY8 A;  4IW0 A;  4EUT A;  2UYZ B;  2KAN A;  3AUL A;  3U8Z A;  3DVN U;  4HDQ A;  2ZCC A;  5IA7 A;  3W1S A;  4BKS A;  2ZJD A;  1YX5 B;  2G45 B;  2BYF A;  2FNJ B;  1C3T A;  4HXD A;  2FCQ A;  5D2M B;  4B6W A;  2FID A;  2NBV B;  2L00 B;  2L76 A;  1P1A A;  2IYD B;  4IM2 A;  2LVP A;  2BWF A;  2WDT B;  1QZE A;  1YQB A;  2KFK B;  4W9D A;  4WAA A;  1E7U A;  1V49 A;  2YVC A;  4LCD E;  4PYZ A;  1J8C A;  5AEK B;  4WJN A;  5CHW A;  4NJ6 A;  1YIW A;  3ZNG C;  3PLU A;  2NPT A;  4J6I A;  4KVG B;  3NZS A;  3C0R B;  3A4R A;  2JUO A;  5LXH A;  1J0G A;  3N32 A;  2GBJ A;  3OJ4 B;  2KMC A;  4GOC A;  5J18 A;  2N1V A;  1S3S G;  2KXJ A;  1G6J A;  3QC8 B;  4ZYN A;  1UBI A;  4M8N A;  2K25 A;  4GN1 A;  5L83 A;  2KKC A;  2B3A A;  2LZ6 A;  2Z0E B;  3MJW A;  4ICU A;  2MLB A;  1E90 A;  3UF8 A;  1I42 A;  2J0K A;  1WIA A;  1WGH A;  5L95 C;  4W9K A;  1IYF A;  3M95 A;  2CKH B;  1UZX B;  3QX1 A;  1MG8 A;  3KUD B;  4EFO A;  4HJK A;  4HCN B;  4GU2 A;  4IM0 A;  1GJZ A;  3LDZ E;  4BFR A;  1WGD A;  2MP2 A;  1WF9 A;  2DX5 B;  2N7D A;  2MRP A;  3KVF B;  5IAA C;  1LQB A;  2OOB B;  3ENE A;  4DBG A;  4P7I A;  1WRD B;  4EZK A;  5JHB A;  3RUL A;  2WYQ A;  2KO3 A;  2KWU B;  3HM6 X;  2K8H A;  4HCP B;  2KJR A;  4LJO B;  1WX9 A;  4MEM A;  3ZNZ B;  1AAR A;  4AOF A;  2N1W A;  5CHF A;  4DDG D;  2PEA A;  1E8X A;  4W9H A;  4MH0 E;  3VH4 B;  4DWF A;  1OGW A;  4CYE A;  2L05 A;  3ZNI D;  2GBK A;  2RPQ A;  2LXC A;  4MM3 A;  1WM3 A;  5D7G A;  3ZKJ C;  4HLE A;  5GMV A;  2MX2 A;  3ZW3 A;  3ZTD A;  3H9D A;  3UQB A;  1WJ4 A;  1OQY A;  2K39 A;  1VD2 A;  2M1M A;  2PE6 B;  3CF6 E;  3IG3 A;  3PS6 A;  3HHM A;  1Z2M A;  4WJQ A;  4K7W A;  4CHK A;  2KDB A;  3AXC A;  3U30 A;  2LXA A;  5DPR A;  3ML8 A;  1WJN A;  2LJ5 A;  2KVR A;  2MBE A;  2IO0 B;  3IBE A;  4BKT A;  2KMA A;  2LUE A;  1H4R A;  2JVC A;  4GIV A;  4XX5 A;  5JH5 C;  4BOZ B;  3QCA A;  2GBN A;  3BY4 B;  4IWQ A;  4A20 A;  1GG3 A;  2BGF A;  1KJT A;  5E6N A;  3APC A;  2ZNV C;  4I6P A;  3H7P B;  1Q1O A;  3P2B A;  2REX A;  2BPS A;  1UD7 A;  3S2A A;  4FN2 A;  5AZF A;  3V6C B;  3WAP A;  1F9J A;  4KV2 A;  4FJZ A;  1EO6 A;  4X57 B;  3ZIM A;  3H6N A;  2O2V B;  3V60 A;  2KK8 A;  2BWE S;  2KJ6 A;  3ZVV A;  3EC8 A;  4EEW A;  5CX3 A;  4E3C A;  1WYW B;  4BBN F;  2CU1 A;  2GBM A;  2CHW A;  3B08 A;  3M62 B;  3AI5 A;  3KUC B;  4ICV A;  3SHQ A;  2L0F A;  4K7S A;  3APD A;  2KZR A;  4II3 B;  3CSF A;  4RMA A;  2V1Y A;  3L16 A;  4FHJ A;  4ANW A;  2MBQ A;  4HDO A;  1E8W A;  3ONS A;  1P0R A;  3LJ3 A;  3OLM D;  3SU8 X;  1WE6 A;  4MSQ B;  1GC7 A;  5G2N A;  1WE7 A;  4CO7 A;  5HKH A;  2R2Q A;  3NHE B;  2D2Q A;  4M0W B;  4WJP A;  2KC1 A;  2KX3 A;  3DBH I;  3K9O B;  2J0M A;  1A5R A;  4ASW C;  3IFW B;  2LGX A;  3R7Q A;  4JL9 A;  2JXX A;  1V5T A;  3X0W A;  4ANX A;  1YJ1 A;  3VVW B;  3RD2 A;  4G11 A;  2QHO A;  3QK0 A;  1ZW7 A;  2L8J A;  1UEL A;  3ZRF A;  4EKU A;  2KTR B;  3QIJ A;  1WZ0 A;  2MW5 A;  3PT2 B;  3QA8 A;  5DCN A;  2KDF B;  1RFA A;  3N30 A;  2MA9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...