1AN8A

Crystal structure of the streptococcal superantigen spe-c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the streptococcal superantigen SPE-C: dimerization and zinc binding suggest a novel mode of interaction with MHC class II molecules.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Bacterial superantigen
molecule keywords STREPTOCOCCAL PYROGENIC EXOTOXIN C
total genus 66
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1an8A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1an8A01
1L0XB 3GP7A 2IJ0A 4Z9CB 5ELDA 1M4VA 1KLGD 1S5CD 1V1OA 1PRTF 1AN8A 1EU3A 1I4GA 3DWPA 2AQ1B 1RDPD 1B44D 2XN9C 4RH6A 5ELCA 1D6EC 4ZYSA 1ET9A 1F77A 1XTCD 1LTBD 4RFBA 2WV6D 3CHBD 4RHSA 5D3IB 4RGMA 3MFGA 2QEJC 1LTGD 1G8ZD 1HXYD 1QILA 1YN5A 1EEID 1D5MC 1S5DD 2XRQD 3BVMA 1PTOC 1LTTD 1JCKB 3R2TA 2TSSA 3MC0B 1HQRD 3DWQA 3TSSA 1FNWA 3KLSX 5D3DA 1V1PA 1STEA 2R61A 1LO5D 4OHJA 4RGOS 1EWCA 2ICIA 1SE4A 2O2LD 1CK1A 4NZLB 1KLUD 1FD7D 1I4PA 2IPKD 1PRTC 2QILA 4TSSA 4RGNA 1BXTA 1FNVA 1TS3A 1RD9D 1CQVA 3BVZA 1TS2A 4C56C 1HTLD 1LT5D 1PTOH 4DXGA 1JWUD 1I4RA 4BWGB 5ELFA 1LTID 4RHRA 1LTRD 3URYA 1RF2D 5ELEA 1I4QA 2NTTA 4O1NA 1LLRD 1PRTB 1S5BD 1HA5A 4UDUC 1PYWD 3DWAA 1PZJD 1SJED 2XRSD 1S5FD 1PZID 4L6TB 1JQYD 1TY2A 2NTSA 2RDGA 1LTSD 1DJRD 1PTOF 1S5ED 1UUPA 1CHQD 1EEFD 5FKAC 2RDHA 4RCOA 1BCPB 1I4HA 4RGTA 2G9HD 1BCPD 1D5ZC 1D5XC 2SEBD 2CHBD 1EU4A 1PTOB 5I4DA 1SE2A 1FNUA 1TS4A 3BVGA 1CT1D 3EA6A 5FK9C 3R8BA 3BYYB 3O13A 1FGBD 2J4XA 5TSSA 1SBBB 1I4XA 1L0YB 3W2DA 1TS5A 1TY0A 1UNSA 1EFID 2XNAC 1PTOD 3V05A 5ELBA 1LT4D 1BCPC 1ET6A 1SE3A 1V1PB 3OWEB 2Z8LA 1KTKA 1JWSD 1ESFA 3BZDB 1SEBD 4L63B 3SEBA 1T5XD 1JWMD 1LT6D 1CHPD 3EFXD 1BCPF 1RCVD 1SXTA 1LTAD 2AQ3B 1AW7A 1SJHD 4DXFA 4K6LA 1ENFA 1GOZA 1LT3D 2AQ2B 1PZKD 3BYTB 1YN3A 1B1ZA 1XXGA 1DYQA 3R2IA 1MD2D 1JR0D 1YN4A 1PRTD
chains in the Genus database with same CATH superfamily
3ABVB 5D94A 2L00B 1X6OA 1P7EA 2RHSB 3F2BA 1EY5A 3FC4A 1B44D 2CU3A 3FAHA 1B9MA 1AYFA 1IKLA 2KACA 4Q2JA 4DU9A 2NBWB 5HKHA 1YJJA 1XMOQ 3CHBD 4KLKA 4NXNQ 1QOFA 2JA7G 3F8TA 2R7DA 2MPMA 1LYLA 4GOPB 3MC8A 3ZJTA 4GKKQ 5LMNW 2EVBA 4FHKA 4DK0A 4A75A 3QK0A 4HCPB 2JYOA 1H95A 5AUIA 4FVMA 1IL2A 4AYBG 3TDQA 2MBHA 3T8MA 1K8GA 2WU5B 2NUCA 3NENA 5K36G 2I5HA 3NK9A 4KY6A 1W6KA 5EGTA 3K80C 5D3DA 5IE8A 1EIGA 5KIXA 2BF8B 4HDOA 2L55A 5EKKA 2CQOA 4W9DA 1KDBA 5IGFA 4ACFA 4NQLB 2MNAA 4F88A 3E3XA 4B3ML 2O2LD 3AH7A 4GOPC 2MO0A 1WJ6A 3B0AA 3VYSA 2PTLA 2JZZA 4HEDA 1B3AA 5BR8Q 1YNXA 2YTYA 5A2QL 2AUJD 2JN4A 1MG8A 4HPPA 4A3PA 3Q3MC 5I2YA 1G6PA 4LF9L 2NPTA 2J53A 2IO0B 3AE8B 2C9OA 2A69D 4DR5L 1WD1A 1MPEA 3PT2B 5IN7A 1QCBD 1S1QB 3ZW3A 2M9VA 3AYHB 1PTOH 2F0LA 1BR9A 4C56C 1HA6A 3ZTCA 2WXKA 4ZHOA 2K5QA 2IWHA 3PO3G 1YOVB 1FCCC 5C1ZA 2KDMA 3CXCA 2K5PA 3NHEB 4HIKA 2FE8A 3W9CB 3OW2A 1X56A 1I4QA 2UUAL 4O1NA 1CKMA 2V1CC 2B8GA 1S5BD 4JI3L 1F52A 2MHVA 1NMFA 2MJ3A 2FCQA 1QF6A 2N9EB 5CHWA 4A3FG 1HNXQ 4PMBA 2F0PA 4DV1L 2O2VB 3RCZA 1PZID 1K73C 4ZK9B 4DR4Q 4J1MA 4K7UA 4DXAB 2NN6G 4ZRKA 2FCSA 4KGRA 3N32A 1HTPA 2CCZA 1E1OA 2BYEA 4B0EA 2NZOA 4A3FB 4CHTB 1BCPD 4JLCA 3FPUB 4PS3A 3Q6SA 4HJ8A 2G3QB 4TV3A 3JAMc 3DBHB 1WYWB 2J0MA 3OLMD 1J8CA 1S4ZA 1L0YB 4JI1Q 4A3EG 1A0IA 1GKHA 4FJZA 3U2SC 4LNOA 4A3OA 1UNSA 4EGVA 2LXJA 1J5EQ 4A3MG 3DM1A 3KBXA 3V05A 2LHEA 2WKCA 3IAYA 5E6JA 2ALYB 2R92B 4H2AA 5CHVC 4YTNB 3RLFA 1N36Q 2ID0A 2E2IH 5GAGC 1V1QA 1CZPA 2K22A 3D4RA 2C60A 1OTCA 2MRPA 4P1BC 1N63A 2KXJA 2WYQA 5AZFA 4A55A 4JI8Q 1DD2A 4CBVA 2GVBA 1OO9B 3Q6BA 2IL8A 4BBSH 1SNPA 4L5SA 4UP7A 4DV0L 3S2HB 3SU8X 1E2VA 3L0OA 1VQ8A 5IOIA 4GLAC 2NVUI 4NXMQ 1JICA 2DX5B 1IZ6A 3A0JA 4ZUIA 4B3SL 1JR0D 1RAXA 4D2KA 5LL6S 1N34L 4LF4Q 1WVLA 1TWHB 1X32A 2L1BA 1MSHA 5FLXE 1N33Q 2WXPA 1EY0A 3J80c 5HI1A 1OXSC 1RODA 2IY5B 2D3AA 1C9FA 3B2GA 3K5NA 1XLPA 3LYYA 1ET9A 1F77A 1XTCD 3GO5A 3NP8A 5D3IB 1IYVA 3BG3A 3GTOB 1H4RA 4RGMA 4M0WB 2GB1A 1E22A 2K5NA 1V8QA 1AZPA 1YN5A 2ENBA 3JC66 2IO3B 2XEWA 3I5JC 3JYUA 4DNTB 4YXDB 4YCUA 1PTOC 4HN7A 4G7OC 3QX1A 1EYAA 1E9MA 4HXDA 5M3FH 1SGHA 4DV5Q 1CA6A 2R7ZB 2B2YC 3SE0A 4EQNA 3RUZA 1B9NA 1E24A 2RSNA 2M17A 3EVQA 5G5HA 2EYHA 1CK1A 5I2XA 2L1AA 3CMMB 4K2LA 4DV6L 2HTME 1CSQA 1S3OA 3JAME 2JX5A 5COYA 4P71A 5C0XG 2HDEA 5IT9E 2XSCA 1YX6B 3BIID 2A4ZA 3U7ZA 5EBDA 3SHQA 1E10A 1IBXA 2BW2A 2Z0DB 2ZXOA 5IO9A 1KRSA 3UINB 3DUZA 3Q0AA 3AB9A 2KWVB 4W9JA 1LM0A 4Y7NH 3HOXG 4DR6L 4A3CG 3AM9A 1PH3A 3PRPB 2OJRA 4LCDE 5ELEA 3HOUB 3NVYA 4RF0A 3ZJVA 1AE3A 2JU6X 4IPCA 1WFQA 1LXDA 3OG5A 1DXMA 2LGYA 1C4PA 4HPMB 2QMTA 1WTHA 4B08A 4DR7Q 3AECB 2B2YA 3CCLA 1WJNA 3IFWB 1WY8A 1KAWA 1RFAA 2VW9A 2KUMA 4S3SA 1Q90A 1S72A 5D7GA 3V61A 3A9KB 1DOLA 4IOIE 3DBHI 4H13C 1HZ5A 1MG4A 4DBGA 1KFYB 4RCOA 3PMFA 2FINB 1WXSA 5JEAH 1J7AA 2A1AA 1DGSA 1BO0A 3LWEA 3PIOA 1E7ZA 4LF8Q 2L32A 1VQGA 1PTOB 1X55A 4GN4B 1LM8B 3JW0X 4YY3L 1XEEA 1G2TA 2EMSA 4ARIA 4R1JA 1WRDB 1WXQA 1SBBB 2INDC 1EOTA 2W3RA 2UUBL 4NXML 2IY1B 1U4PA 2LMCB 1YHBA 1XJVA 1EUVB 1M8AA 2N49A 2M2LA 1PTOD 2PMZB 2WXIA 4IWPA 1KDAA 1PYSB 3H9DA 1ILQA 1N6ZA 1KRHA 1RJTA 5BN3A 3KYDD 5HHDG 4KV2A 1K8OA 5AZGA 4BKSA 2UYZB 4KV6A 4YTMB 2PO4A 4X62L 4LF5Q 1RCVD 2JA7B 1QVGA 5IGEA 1L4ZB 4MGIE 1E7VA 3MJ5A 3RUIB 3T3OA 5DEHA 2AQ2B 4BY1B 1LT3D 4MM3A 2PYKA 5EQ0A 3ZJYC 4DK1A 1A8VA 1K8AC 3I4MG 2IGDA 2V1YA 4IFDI 2ZNVC 1EY8A 3K9OB 1S5CD 1EM7A 4DPGA 1F2YA 3L3OC 2AQ1B 1FFVA 2KD0A 4XQNA 3PS6A 2B2WA 1OQQA 3STBD 2PVGC 2B3AA 4C2MB 4DV7L 1HE8A 2QCPX 3KF6B 3LGJA 2QHOA 1HZAA 2P5ZX 2NCNA 2EJMA 1SYBA 1JC7A 2DBYA 5C0XI 2LGXA 3H3VI 2TSSA 4XTCS 4B95A 4B6WA 3K7AB 5CGKA 1VD2A 4LFBL 2UXBL 4TQ1A 4O2DA 4NJ6A 1WXMA 1SNMA 3E5SA 3Q3JA 5JOBA 3TS0A 2PI2E 4DR5Q 1Y1VB 3HKSA 1QOGA 3VDYA 2LEKA 2PVOD 1I5FA 1EWIA 4ANVA 2UU7A 4DNIA 3PPAA 1WMHB 2N9PC 4YWGG 1KLUD 4K6DA 4PQXA 2K3UA 4B3MQ 1GUAB 3A8JE 2WX1A 3T3NA 1D3ZA 2E76C 2K6AA 2ZT9C 3PUXA 3DHGC 1XPUA 3PLUA 1QNUA 1F2MA 2F0HA 1FJGQ 1HNWL 4USAA 2PQEA 4J15A 3KJOA 2F0VA 1R9TB 4MSQB 3GZNI 4GNXA 3K0XA 2LD9A 2JY6A 1VQ5A 1ZDXA 1BDOA 1ZKHA 5GAHC 3URYA 1C78A 3KWLA 3N52A 4A3KH 4GXBA 3P2BA 2ICEC 2E2HB 1GC6A 2KYWA 4B0MA 4G7HC 1PLFA 1VQOA 1XMQQ 1XMOL 2UXBQ 2K75A 3NBHB 5M3MB 2KHJA 1HZ6A 2XIWA 1XQQA 1IBLL 1NCVA 1EF1A 3H15A 3QARA 2BTEA 2V3PA 1FRDA 2LVQA 4LTUA 2O6VD 1DJRD 3CCMA 4A3MB 2L0TA 3IT4B 1S5ED 1K52A 3HOYB 2ZJPA 5C3EG 2JP1A 4WQMA 2NB0A 2ZXPA 4QL5A 4UAIA 1T3QA 1D4BA 3KBGA 2KK8A 3R8BA 4QJFA 3EA6A 2RKSA 2WXOA 2B2UA 4TVAB 1K9MC 1XNQQ 4DAMA 2ZJDA 4HSPA 4GN5A 3H0GH 1TY0A 4ABNA 2CJNA 3FPPA 4X3TA 2C5CA 1Y56A 4JCVE 3RN2A 2QC8A 2VH2A 4I6LB 5LNK1 4HRSA 2Z8LA 1CTMA 3HM3A 1SDFA 2Q2TA 2VQEQ 2FIDA 4DV3L 2RQXA 4JWSC 2KLCA 3TJPA 2I46A 2KHSA 1OXXK 5IP7G 2AL3A 1LTAD 4BS9A 5BMHA 2B63G 3T1YQ 1W3SA 3KF6A 4DUZL 3QWZB 1YD8U 1EYGA 2ACZB 4M8NA 5AEKB 4LAAA 3TP8A 4GB9A 3BWUD 3LDZE 3SK6A 3RZOB 4WWMA 4NQKE 4AJYB 4DK5A 5FLXL 3UDGA 4C3JB 2FFKB 3GTMB 1XYIA 2UXCQ 3ML9A 3QIJA 5IYBG 1V1OA 3ENEA 4KKUA 2Y0SB 2BYVE 5C4XG 3M3YH 2HD3A 1JOQA 2UU9Q 2BS2B 2DZIA 3CCUA 1NYRA 2O6VB 4RNAA 4RHSA 2KENA 3FKIB 4OIKA 1SYDA 4BBRG 3OJ3A 2N88A 4BY1H 2KWUB 5C23A 2WB1B 4DV2Q 4OW0A 4YWLA 1V6EA 1QILA 1G8ZD 3UGBB 1PH7A 2HJ8A 1QG7A 4ZUJA 4JI6Q 2BWFA 1D5MC 2B8FA 4A3GH 4LFAQ 4X65L 2DJFC 5M3MG 2PW7A 2VZKD 2ZPYA 3UIPB 4DAYA 2E75C 2IO2B 5C2TB 3CWIA 3RNEC 2A5HA 3U30A 2IZVB 1JQ4A 1N33L 3PGZA 2Q8RE 5H1SE 4EFOA 4GZYC 1F2ZA 1GG3A 3FVQA 1BQQT 4BKTA 1AH9A 3VFKA 4AYBB 1IPGA 5FLXc 3ERQA 2LFIA 4JX1C 5IA7A 3HOZG 3SR1A 4I6NB 1PUTA 4M0WA 3P1HA 5IT9L 3IHPC 3NEMA 2R3ZA 3EBEA 3E56A 1X3FA 1KRTA 3BVZA 5H8YE 2O5JC 1N36L 2YU9H 1HTLD 1LT5D 1B7YB 3VR6A 4BA1I 3D6CA 4DXGA 2M0AA 3AE6B 2PMZE 1FIQA 1AE2A 4DV6Q 4IUMB 1WTXA 3WOFA 1VDVA 1UE7A 5IYCH 1A2UA 1J19A 1FXAA 3EHVA 2W55A 5C3WA 1SFOB 3H7PA 5KHQA 3K7AH 3CCQA 1IYFA 3GTGB 1GUSA 1LGRA 5DPTA 4M8AA 3QAQA 2WXHA 1E2ZA 2WLBA 2PJHA 3U4VA 1XLOA 3H91A 5ELNA 3A8IE 3HOVG 2EPBA 2L9HA 1WTWA 1R9TH 2JA8G 2PIAA 1GJXA 3C19A 5JEAJ 2DZJA 2L12A 1GUGA 3T1HQ 4XWWA 3N1ZC 4XIGS 2BKFA 2KZRA 3TEZA 2ZEQA 2I2YA 4KHPQ 4ZDVA 4B9KA 1I4HA 1K51A 2M8SA 4YTPB 4FLHA 4EQ5A 2EYOA 1ZKOA 2JSOA 4I7ZC 5IP9G 4IJLA 1OQRA 4IFDJ 1YQBA 4WFN3 2X6GA 2ON8A 3AMUA 1WD0A 4C1NK 2KT7A 4K14A 1I4XA 3W2DA 3AE5B 2JPHA 4OXPA 1A3UA 2F0IA 5A2QE 2JZPA 3M9BA 3M62B 2K25A 4W9HA 2HIVA 1V1PB 4MDKE 5D14A 1C77A 1ROEA 3P1MA 2DHZA 3FEWX 1SEBD 1TWFH 2D5DA 1T5XD 3D0FA 4K3CA 4X64L 3DVGY 4K5VA 4OZCA 1GVPA 1HNZL 4DNRB 1Y8PB 1B2TA 1AW7A 5DAUA 3QCAA 4GLSC 4PG3A 1SJHD 4PZ8A 3ZUNA 3OIPA 1ZP0B 3L10B 1X3QA 2N9XA 3VQIA 2F0JA 1YEZA 1PRTD 3M85A 5IGCA 5EDSA 2IJ0A 3N6RA 4R4CA 1K28A 5FLMH 3Q8FA 4LFBQ 3AULA 1EU3A 2F52A 3OW7A 3KUCB 5JPMC 3IL8A 1ISNA 1WX9A 3WAPA 1PDXA 2KOXA 2DY8A 3A5UA 1QJOA 1IKMA 2J0KA 2FIFA 4RFBA 2MFIA 1P0RA 2J42A 1M94A 1P1AA 3AU7A 1E7PB 2DENB 5DPSA 4K5WA 3TP6A 2FUG1 4G0NB 4KSLC 1LTGD 3UQAA 3S14H 3BZCA 1Y1WB 1G6ZA 4IPGA 5EAYA 1PV4A 3N1YC 4DR4L 4PYUA 2KVRA 2VZKB 4XDXA 3AEDB 1PA6A 1SE9A 2NVQB 4MJSA 3CCEA 3AU5A 4JI5Q 1ZW7A 2AWTA 5DCNA 1UZXB 1TKYA 2CFMA 5ELOA 3UI2A 1K0RA 1JRUA 4WJPA 3IKJA 4NDXA 4ZOHC 2MGSA 3VA5A 2FNJB 2K14A 2WWZA 2KVMA 2KJXA 4MN3A 4X3KA 1FPYA 3S16H 4H02A 2KFJA 1BT0A 4M1UB 3KH0A 3Q14C 2PW5A 3UIOB 3L0WB 1RIPA 2DNCA 2ASQA 3DCGA 3FKIH 2DYBA 1XNQL 3KYCD 4LK0M 3A55A 3PUYA 3MTNB 1TVXA 4PMWA 5GAEC 2KA7A 4WJ4A 1YNND 5ISRA 4OONA 2Q8TA 5EPLA 5T8IA 3JAMi 2A6EC 3K58A 3CU7A 1DOIA 3CPFA 2XK5A 3A54A 2FJ2A 2JQRB 5BN5A 1EL0A 3H0GB 3L7ZC 2QW7A 4LF7Q 2PZTA 1EQVA 2OCEA 2F0OA 3GS2A 4YL8A 2F4IA 3NVWA 4NP5A 5I6YA 4KKJA 3DVNV 3OOCA 3PIPA 3G48A 2EMTA 3I4MB 1FO4A 3RN9C 4RM9A 1SSOA 2L8JA 1FL0A 1JJCB 1QE6A 4HJ9A 3A7LA 2YYZA 5C3XA 1EFWA 4IALA 4JGHB 4M02A 1GB1A 1YHAA 1YJNA 3MTSA 4H0LC 1P9DU 1MIUA 3TEHB 1EOVA 2RVLA 1YQ4B 2FAZA 2RHQB 4DHZE 2MJ8A 1Z2MA 4P16A 4MSMB 1FNUA 4W9EA 1F9RA 1A70A 1A3VA 2EY6A 3MEHA 1LQBA 3ZVVA 2ZW0A 2B2TA 2DAJA 1VQPA 2FMCA 2NBVB 2Z6KC 3X3MA 1NUCA 2IX1A 4RMFA 3B6YA 4DGZA 1YVCA 2PW9A 2M1MA 3JAML 2KQ7A 3AEAB 2LUEA 2C7MB 2EY2A 4DV4Q 1OQYA 1N5XA 4CJ1B 5IGGA 4FNFA 2KECA 1UGMA 2WNMA 1ICWA 3S16B 1ACCA 4FJYA 3P4PB 2CW0D 1MHWC 1WCMH 4W9IA 2CHZA 2QDLA 2AHOB 3TZUA 1BMLC 4A93H 3FMCA 3F2DA 3L54A 4J8QA 4OELB 1WM3A 4PT5A 3I4LA 1YIWA 2JXTA 2QJLA 2N55A 3FRPB 5IYDG 1FR3A 2Z59B 3MVVA 2EZVA 2F0MA 4PNYA 3A4SC 3Q3OC 2OHFA 1L0XB 3UQBA 3EJIA 4AJWA 4DV5L 4F7XA 1U4AA 3EECA 4F1SA 3PRMB 1PRTF 3DWPA 3P63A 3ALBA 3T56B 2W9NA 1WXAA 1QKZA 2KMAA 2NMQA 3MP9A 1YNNC 2KHWB 5IWAQ 2L4NA 3DVGX 2F1MA 4G57A 4P72A 4AIMA 4KTAA 1Z47A 3GB1A 4DR2L 4A4IA 2RD0A 1CKNA 4C4VA 4A3LH 2QEJC 2VZAA 5NUCA 4C3HH 2BH8A 4OVUA 1S5DD 4W9FA 4A3DH 1X3PA 4PZ6A 4K0KL 2F3WA 5KEEA 2JXXA 1C79A 3W1SA 5LXHA 1HQRD 2KKCA 4N58A 4NW2A 4A90A 3PO2G 1STEA 2CR5A 4DR1L 1H9KA 5C5LA 3TMEA 5KNDA 4HIMA 4OO1I 4QQBX 2KJHB 2ASBA 3DVNU 4B3SQ 5E7NA 1S40A 4Y7NB 1SE4A 1UBIA 2D62A 1JJGA 3JSVB 5EKLA 3GTQB 1PGBA 4R4OA 3ML8A 4HWIB 4DDID 1F9SA 2RCFA 4GN3B 4DV0Q 4EZJA 3J7ZC 4US8A 1I4PA 3RFZB 4TSSA 3R7RA 1G291 2VUMB 1DCZA 1TS3A 1IBXB 2D10A 2DLBA 4GLVB 1O7ZA 3RNBC 3S14B 3KK7A 2KQ4X 1K83B 2NBUA 1N8RC 1NAPA 3FP9A 3PZ7A 2B29A 2KFKB 2PEAA 5IAAC 5LMNL 4C3JH 3GTMH 1AFPA 1RF2D 1J8IA 1T9HA 2I5LX 2JQOA 4KMUC 1Q46A 1OEYA 1WI5A 2JE6I 1PQSA 4PS8A 4CKEA 5E4XA 4DR1Q 3S15H 5C4XB 3ULLA 2D3GA 2CW0C 2DJGC 1ZXIA 4HKQA 4KJNA 4W9GA 2DY7A 3K5OA 4XC2A 4KI0A 2GRIA 3RZDB 2CKHB 2LHDA 2LMCA 4L6TB 4A3BG 1FRRA 2NTSA 3GOEA 3VYTA 1B70B 2LUMA 3TEWA 5G3LD 3BY4B 1CHQD 4HJKA 4FXGC 3TEXA 2YV5A 1SF0A 5GXGB 2V4IB 2WB1G 1C9OA 4ZAIA 4DV1Q 4DR6Q 4EOYA 4K5XA 2LY7A 3PF4A 2V9HA 4YSXB 2IYDB 2NVTH 2F0WA 3BJUA 3BU2A 2R92G 1NDDA 2BPSA 1QVCA 3E9HA 1NVID 2G5DA 2WDTB 1F0ZA 3AXCA 2I1JA 3P4RB 1WX7A 3QA8A 4MGKE 2K50A 4A3IB 4HCNB 4ZRJA 3Q22A 4IM0A 1SE3A 5HGQA 4MH0E 4KX6B 1U4RA 2IGHA 4HPLB 5J18A 2O6VA 3SVMA 2XWJB 1YZ6A 2HHHQ 5JJKA 1L6VA 2LGSA 3S2AA 3L9AX 3G6JB 1SXTA 2JA6G 1ZXTA 4R3DA 2WDRB 3HKZG 2BS3B 1Z7TA 1HCZA 1N62A 3K9PB 1TWCH 2CH4W 4DXFA 3W3AA 3JVZX 4JL9A 3M4OB 2MP2A 1Q8IA 3S1MH 1B1ZA 1K83H 1XXGA 4C2MH 2N9LA 4RMAA 2RCNA 2NWGA 3R3OA 2IO1B 3BDLA 2H88B 2A19A 1QVFA 1YN4A 4JV5L 4NNJB 5LL6X 2REXA 2AX5A 1KLGD 2PKOA 3C0RB 4QCLA 3DEOA 2UU9L 1U4MA 4QIWE 3B08A 2WIIB 4EVOA 4YWKA 1SYEA 2KTFA 1DGJA 2VS1A 3PO0A 2A68C 3CRLC 3PUZA 3PO3B 3M4PA 3TS2A 2LASA 2YVCA 3JSVA 4A76A 4GKKL 1L2NA 1N61A 3MFGA 1HFNA 2L15A 5J1ZA 1EEID 3UDFA 3H3VH 2VQFL 2JUOA 1S3SG 3ONSA 3CRKC 4R4IA 1PFBA 1JOOA 2AKWB 3I2ZA 2N0SB 3T1YL 1YITA 3ZO5B 2MBOA 3K59A 3GV3A 4A3KG 4HROA 5IP4D 2KJ6A 1E3PA 2JF5A 4JV5Q 3KF8B 5LXIB 2VY3A 4A3JH 2KX0A 3M63B 5D6JB 3I4NG 3GTLB 4UP9A 1ZYRD 1E2WA 2F3IA 3U8ZA 4HSVA 2PE6B 2M56B 3I3CA 3IG3A 3AEVA 2MEKA 3ZRCA 5C3EH 2N3SA 3F2CA 1V43A 4GS3A 4K1RB 1OEYJ 3CQZB 4LW1A 1JROA 1WGKA 3WDNA 4BXXG 4KDLB 1BOSA 3U4ZA 1SMYD 1STAA 3GQBA 3S1QH 4KZ0A 1I4RA 2HTHA 3ZJUA 4IURA 3IRBA 3HRZC 3I7FA 4ZQ3A 2QIEB 4ALPA 4OGQC 5DPRA 3RD4A 1FYCA 2J7ZA 5JVH3 1Y1WG 4KD4A 2K04A 3S1MB 3L2PA 5BYSA 4Q5VA 1HR0Q 2WHIA 1GAQB 5GMVA 4ULLA 3MXNB 1N9WA 5JJZA 1ASZA 3WAMA 1PYWD 3DWAA 1IYJB 1VZ6A 2D07B 4DAYB 2KEEA 1SIFA 4CQNA 1N5WA 3WALA 5FR3A 5HY6A 4DR3Q 3ITPA 4B3TQ 3J7AF 1AARA 1YQ3B 1A2TA 3B9JA 1WYGA 2BE5C 5IP7H 4HEA1 4AOFA 2B2WC 1MI0A 1PFNA 4BZAA 4L1BA 5I4DA 5D2MB 5G3LF 5CHFA 4ZRIA 1CZGA 4LF5L 3O13A 3RNAC 1WYDA 2DYMA 1X3EA 2V3NA 3NY5A 3HOVB 4LMQD 3STBC 3P20A 4IUVA 1UEBA 1VQDA 2R7ZG 3HVDA 5C4XH 3EGRA 2BBCA 2FXQA 2FCMA 4LWCA 1XNRL 5IKCM 4G4KA 2KC2A 1RFKA 3C1FA 4BY1G 1KTKA 1FD6A 3CIRB 2OTJA 5BYQA 4WAAA 1C0AA 2EQSA 1WM2A 1ZXHA 1WTQA 2D2QA 3M3YB 5JXVA 1E6EB 1H9SB 2YTXA 2EYFA 5JHBA 3HEJA 1GUTA 4ZKCB 1WRIA 2DZMA 4K6LA 4YT0B 3H8HA 2O2VA 4KIKA 2KCCA 5GROA 2A69C 3J7AV 1YNJD 1Q8KA 1IBKL 1HUNA 4JWUC 3MC9A 2R6GA 4XX5A 4BVUC 2NVXB 4OO1H 2ZCBA 2CKZB 1JMCA 2I07B 3O65B 4QAYA 2DNEA 2CU1A 4M8MA 4KZCA 3M7NA 4KY5A 4WH4A 2KDEB 3K5MA 3M4QA 1XPRA 1V5TA 4FHJA 4OWTB 3HGBA 1FXTB 2M19A 1TYGB 1HQMC 3TN2A 3J7YW 1XLNA 1WOCA 1Y69U 1CZWA 3KW5B 3HP3A 1RTOA 2BDOA 4ZRZA 1L4DB 3OAWA 5CMDA 2HQEA 3T1HL 4GKJL 1C4QA 3AB5A 2XRQD 2WKDA 3PQIA 4UHVA 4WJQA 1GHKA 1E8YA 1EZ6A 4PS7A 3AE1B 1V9PA 3GTOH 2NPTB 1ZYRC 2N9KA 4L5QA 3GTQH 2LFNA 3GDEA 1NSNS 2K33A 1J7CA 1K50A 2ZJQA 1IBKQ 3U58A 4YHHL 1X1MA 1KXLA 2WXNA 1UAPA 5M3FB 2OXPA 3Q8EA 4DWFA 2I38A 4WJWA 2K5VA 2KCTA 3U9SA 2JA8H 1IGCA 4URKA 2N8NA 3TEYA 2IPKD 5FJ8H 4TQUS 1KLVA 1HH2P 3HG9A 3VR2A 4AQ7A 2IT1A 2ONQA 1MJCA 3A9JA 2OJWA 2MO1A 4QY7A 2WDQB 2WFWA 2WP9B 3VAWA 1NMGA 3NG0A 5G5GA 3KQ4A 3L17A 2FUHB 1IUEA 4ODGA 4QMGA 4X66Q 1BF4A 1MJDA 4LFAL 2B2VC 3H7PB 1XF5L 3DBLI 2KTRB 1TGZB 3UDIA 4BOSC 2Z0SA 4CGYB 4DV2L 4WWOA 5DPWA 1QB5D 3PHXB 4GN1A 4NJCA 2IW3A 1KDCA 2Y3AA 3L16A 1NI2A 4GDLB 2RPVA 4ZKBB 3MHZA 3DBLB 4GLXA 3DDCB 1FGUA 1VS0A 5I6WA 1V80A 2IY0B 2L11A 4ME3A 2Q8IB 2NVXH 1DONA 4XQJA 3A33B 2RGFA 2E2DC 2XRSD 4K0KQ 1S5FD 5I9OA 4X65Q 1ZDVA 2PZUA 2QSDA 2K39A 3D6WA 2K9XA 5E3FA 1ESRA 1K53A 1WWTA 1UUPA 4HMJA 4A3DB 3A9KA 4P73A 3Q8CA 1NR2A 3F2UA 4HCSA 3RLNA 2NVTB 5G55A 2MJEA 3MHBA 4P6VF 1NE3A 5K5PA 3LWUA 2XK5B 2SEBD 1JJ2A 3H1UA 3V6CB 2IDYA 3E0JA 1ML0D 1VCIA 2D3CA 4C3IH 3PIP3 2GBMA 2J4XA 5DM63 4ILWA 3T4AC 4LFCQ 4JOIC 1QUQA 3APDA 3OIQA 3J80i 2LI5A 3T53B 2Q2IA 3PO3H 2MUYA 3AMZA 2UWQA 1Y1VG 5A35A 2RMMA 4G50A 2LXCA 5C4JH 1E5WA 1V9JA 2J52A 2I1KA 5HGTA 2EY5A 1JWMD 1X3GA 3PUVA 1G2SA 1EUJA 1EWYC 4PV1C 3I90A 2AQ3B 5H92C 1L1OC 1R4PB 2HT1A 3HOWH 1NJIC 3HRDD 2HUGA 1O78A 1F1HA 2OWOA 2M00A 3ZTDA 3IT6B 4POFA 2N7DA 3L08A 1WGGA 3S15B 3CPWA 3D3RA 1N32L 5EJWA 3Q8BA 5IOCA 3VXWA 3GTLH 4HAEA 4BBRB 4YSZB 4LJPB 2B76B 1H9RA 3LJ3A 2PLPA 1D7QA 1KH0A 3G6EA 1TWGH 3S2DB 3RMKC 4JI0L 2HDMA 4JPBW 1XLQA 3E9IA 4NAMA 4R4QA 2A6HD 2RF4A 5I9PA 4JI3Q 1Q1EA 4KK7A 2N1VA 4WWNA 2K01A 1KNAA 4A3EH 2UUAQ 4IDIA 2D3BA 1UWVA 1SNOA 1A62A 3QOLA 4A3IG 5CV6A 3X23A 4EZKA 3A9JB 4J6IA 2RSUA 1EYDA 5JHAA 4JI7Q 2L0CA 4BY7H 3TSSA 2RPQA 3IXSA 3KLSX 3GD7A 5EBCA 1JORA 1U4LA 3KDFB 2EYPA 5CYUA 4JI8L 3VRBB 3ZNHB 2PZWA 3OMCA 1CUKA 4HR7B 1HRJA 4WURA 3KVFB 1EWCA 1U0LA 2DGYA 4DN4M 4OVVA 5C3EB 3GTJH 2R2OA 2CS4A 2C7HA 4LNFA 3SK8A 2GBNA 4EQPA 3MXUA 1HNWQ 2HHHL 2KQ3A 3VTUA 1RD9D 4X57B 3VH4B 3PTFC 1K8RB 5D65A 1SFOH 1TTNA 1K0SA 1VCBA 4II2B 3EIVA 4LJZC 2K0PA 3HIZA 3OYYA 2K1BA 1LTRD 1NR4A 1T0SC 4TQ0A 3NQTA 1J9OA 3X0WA 3PLVA 1IHZA 2WINB 2LSSA 3EROA 3K0YA 4B3TL 1X65A 2SAKA 4P75A 2JEBI 2D5GA 2CHXA 1WIAA 3TBIB 3ZNZB 3T9LA 2A8VA 4JIOU 3OSOA 2G9DA 2V4LA 3PGEA 3DXJC 2R93H 1UD7A 2HD5B 3I9V1 1I7HA 4DAVA 1EYCA 3GTKH 2G4DB 1LTSD 1HR0L 3DM3A 3MZ5A 1D1IA 2JEAI 1BBXC 4KHPL 3AEBB 1EO6A 1WZ3A 4GIVA 5EE1A 4P7IA 1BVSA 3RR5A 3VYRA 3GTPH 4WAFA 1WGRA 1MI2A 4NKLA 2N78A 4RGTA 1D5ZC 4A3BB 1VQJA 1NYQA 3ZLZA 1TWAB 3OMGA 2K6DB 5C0XH 4JW0A 5IYDH 4GOCA 1CKNB 1PHJA 2KQSA 5KRUA 4X62Q 2LVOA 4C4VB 1HUMA 3ER0A 1SYFA 2QDBA 2DUDA 3WOEA 2ATWA 3VR3A 1ENAA 3HOXB 2NBFA 3TMPB 1QWYA 1PH4A 4A3CH 1WGYA 4YCVA 1ET6A 3PZ8A 3UF8A 4E3CA 1HNZQ 1A15A 3IFTA 3GZNB 1JWSD 2UUBQ 1ESFA 3BZDB 2X8XX 4L63B 4C3HG 3V62A 1Q12A 1QOHA 2EE1A 3U50C 1YNJC 3EFXD 4S0RA 3ETRA 2K5DA 4RAUC 3NWTA 5M5WH 2GBJA 4JE3B 3P4SB 3MHSD 2F0SA 4XYQA 4N8FA 2BGFA 2EKEC 4MNOA 4C3HB 4MM3B 3R2IA 3RNUA 3VHTC 4AQYQ 1IBML 1YMHE 3OHXC 1ZGUB 1QZHA 4KHZA 3GP7A 3KUPA 2JA6B 1TZOA 3SK4A 2MH7A 3M95A 3VTWA 4JVZA 5JVG3 1NY4A 4KN4C 4LUZA 4XYCA 4RH6A 4XWTA 1GB4A 1D6EC 1C7YA 1LTBD 4KHVA 3AEGB 3APFA 4JI6L 3VR9B 1STHA 2CH4A 3W1BA 3I55A 4ANUA 1M1KC 2HCIA 4V190 1VQAA 4FP5D 5CC4A 3CCSA 1CJEA 3NBHA 4DR2Q 1UE1A 2KO3A 2K6QA 4IG7B 2WXFA 5KYLA 3FKYA 2QCZA 2E5LL 1W2BA 4DR7L 3MC0B 1WR1A 1IXRA 1EQQA 1H9JA 5EPKA 3T16A 4P2CB 1HTOA 2MHJA 2NN6H 2O5IC 3RD2A 2KBNA 3CMEA 2ICIA 3NQIA 4R8NA 4HJGE 5JPNC 3NBIA 1P3QU 2LVPA 3ONAB 2DNFA 1P7FA 5C3JB 4NZLB 3MFYA 1JALA 2O4XA 2GLSA 3VVWB 4IO9A 3QC8B 2L83A 4LF6L 2JRIB 2QEXA 1Y14B 1WGHA 1TS2A 1RL2A 4FULA 3I8ZA 2JSVX 4M00A 3SDLC 1RLFA 1RHPA 3QO2A 2Y0SE 1TBEA 3N9YC 3NS8A 3CP0A 2K5HA 2F0KA 2K28A 2OQ0A 1R4NB 2GMIC 3A7AB 3M7GA 2LXKA 3CKIB 2SDFA 5T1IA 2BB5A 5JH5C 2WB1E 1N60A 4DDGD 4DKAC 1HA5A 2YTVA 2LZ6A 3ZRFA 1WF9A 1J6QA 1SJED 4B9WA 4LDTB 3CCJA 3QG1A 3SXHA 4ZLTF 3I56A 1B8AA 4KJOA 4FO2A 1VQBA 3I70A 4HTHA 4MIUA 5AFWA 4X6AH 3NE5B 1OFFA 3BK2A 3RNGC 3GE8C 3N3KB 5F2DA 2MP1A 2D9UA 2JA9A 3IFDA 3RZWC 3NUCA 1J7BA 2Z4HA 3A8KE 3LB8C 5TR5A 4AWJA 3UE1A 2YU9B 1EU4A 2WGSA 2UXDL 2IHEA 4TKOB 2WQYB 2DYOA 3TQYA 2D2CC 4CKBA 3MXNA 1N34Q 4LF4L 4LF7L 4FF2A 5LHY1 3DHHC 2R7FA 1TWGB 2LRWA 5IODA 2JA8B 2N4FA 5CX3A 2E2JH 2EELA 2Z6BA 1EFID 1XNRQ 2CHWA 3VH3B 4KKSA 4J6HA 2VB2X 2JVCA 5M3FG 3ZIMA 4AS1A 1OXTA 1LACA 2VQEL 1E8WA 1UGJA 1DOYA 1XCQL 2BB6A 3EC8A 3KOJA 4K8JA 2NZHA 1KJTA 2HJ1A 4IFDG 1ZEQX 1WXVA 2G1EA 5CV8A 1PMRA 4CKCA 4JBMA 5BN4A 3H6MA 4UY8C 1PYBA 4X3SA 1GOZA 3E0EA 2HE7A 3UI3A 3AE3B 1LABA 2W54A 1YIJA 3MA2B 5E4WC 2KN4A 1TQOA 1DYQA 2WDVB 4KIKB 4A3JG 4KKTA 2N1WA 3I4NH 4G11A 3KF8A 2EJFC 3J81c 2KC1A 4N9F4 1AZQA 1B4OA 1HNXL 3QJYA 3Q69A 3S17B 1I6HB 4TMAB 1MKHA 2W3SA 3Q23A 2MX2A 3HOXH 4HKZE 4B3RQ 2F4VQ 2LGIA 2EKIA 2EIFA 1YJIA 1L1OB 1GHJA 5L37A 1C3TA 3WANA 3EQLC 4K2KA 1RKNA 4EQOA 4BXXH 2EJGC 1IW7C 1UH6A 2A68D 1SN8A 2Z6KA 2VUMG 4APVA 1JCKB 3R2TA 2BWES 4PYZA 3CAMA 1QOAA 1CM9A 3MAQA 4EUTA 1F2LA 1PGAA 4GMVA 1I42A 1XMQL 3FILA 2R61A 4FF3A 3LX0A 2BE5D 4FADA 2L5TA 1VF7A 4PZ7A 4IJHA 3HK0A 4ICUA 2C35B 5JJIA 3VUWA 1PFMA 1B3QA 1WJUA 1VMPA 1PH5A 4XGAB 2RBMA 5AJ3Q 2ZTDA 4BBNF 3IVFA 1CQVA 3CSTA 3QHTA 3ULJA 2KCNA 1C4CA 2B2TC 4LF9Q 3CW2C 3AU4A 3CF5A 1QLBB 1KABA 4JOIA 4HVBA 5FO8B 4JI7L 4DHZB 3ZKJC 1AP0A 2JWZA 4N6EB 1TR5A 1YJ9A 1WFYA 2H89B 4DHJD 1EIFA 4A93B 4BBRH 1FMAD 1P98A 5E1FA 2RDFA 5E6PA 1LUZA 2WXQA 4HMIA 3K6OA 4L8JA 3LXFA 4RCNA 3NTHA 2F03A 3GTKB 2N7EA 4MT5A 1LLRD 1KAAA 2X38A 3ZNGC 3GTPB 4MTKA 5E6NA 2NYZD 1EY7A 1PFDA 3V6EB 4MJSB 3W1YA 2L52A 3TP7A 3VR8B 3W1SC 2JA5G 4LK1C 1GD7A 5FKAC 1N32Q 4OEMB 1PVOA 2PCFB 2G9HD 1JB7A 4IUPA 1E90A 5BO4B 3RNCC 3SDZA 3R66C 2ZZPB 3RZFA 1UBQA 2CHBD 3A5ZB 2JWUA 4GGQA 1GXDC 4AP4C 4IUNA 1CT1D 4YSYB 5C4HA 3CC7A 1A6XA 1DZ1A 3BYYB 4S17A 3HOYG 1FGBD 1JMLA 1IYUA 4FDBA 3NVZA 5DM73 4F8MA 3U52E 2NVYB 2Z4IA 2G45B 3BDCA 3P4QB 5CTRC 3J81i 1EIHA 2LXAA 3L4PA 4A6QA 1UEAB 5FR6A 2GVAA 2KCMA 4NPNA 5KYIA 5IYCG 3OWEB 4IN3A 1GUWA 3MJWA 4YIJA 3PIO3 3SEBA 1FFUA 3X3NA 1WE7A 3V96A 1LT6D 3NTIA 5CV9A 1BCPF 3H3VC 1VF5C 1MJEA 2LJIA 3V60A 1EZ8A 3HOVH 1NENB 1GUOA 1MHHE 2MLBA 4CJ0B 2MBBB 1NTGA 2PMVA 2L05A 2K4KA 1QUQB 3J81j 2VQFQ 3AE9B 1Q81C 1R7SA 2K5WA 3A56A 1PH9A 2MQHA 5JJLA 1IP9A 2K52A 4E6IA 4QUCA 5J39A 2NVQH 2F0QA 1LFDA 1E0ZA 5IP9H 2HCCA 1WGDA 2VRRB 4HJ5A 2R2QA 1I50H 1ICFB 4YCWA 4ZYSA 1RRBA 3DEPA 1GM5A 2NS5A 2BH2A 3AV8A 1PXUA 3M4YA 1Y8OB 3SHLA 4U673 5BMIA 2BYTA 2BDNA 4ICVA 5KHOA 3A4RA 2B2UC 4OL7A 2OTLA 2KWCA 2C5LC 2AWNA 1LTTD 1VQIA 4I65A 3VR4A 4JYAQ 3B1LX 3SK5A 1RM6C 3S1RH 4QB4A 4ANXA 4JQWC 4JBWA 3AQQA 2ZCCA 2MJDA 4RGOS 3G71A 1XT9B 3P7JA 1VQHA 3KYHC 4WJOA 4KY7A 2V0GA 2WAQB 2ZM6L 4BY7B 2CJOA 4REZA 2PNRC 2KLGA 1YJWA 3HVZA 1OTRB 4X3UA 1JT8A 1L0WA 1FD7D 1V86A 3DBRB 3IAM1 4DFAA 2HQLA 3NOBA 1BUVT 4RGNA 3C3LA 5EE9A 4YHHQ 2EYJA 3VA7A 1F2RC 5M5WB 5GADC 1G91A 1Z9FA 2H4OA 3A1QB 1SR3A 4JI4Q 2KN5A 4MGYE 4Q0FA 4EKUA 2K32A 3HOZB 3APCA 3HUIA 4BAXA 3D4DA 2PQAB 4CDEC 4OX9Q 5CR3A 2MQJA 4A20A 1I6VC 1SAPA 4IQZA 3C2PA 3D32A 4XDCA 2AYOB 1TWHH 1UE5A 2IBIB 3MWYW 3V3XA 4GKJQ 1I35A 2NTTA 5C44H 2GN5A 1EIYB 4K81A 1VZ8A 1SIJA 3NZUA 4HIDA 1Y1VH 1TT2A 3VDZA 2B63H 2A73B 3D31A 1JQYD 1TY2A 3S9WA 4RG1A 3KWVA 2MBEA 2FMMA 3PRZA 4MHEA 1ILPA 2JT4B 2JK8A 3Q2AC 1STGA 4O42A 1E8ZA 1BCPB 3HOWG 4ASWC 3CCVA 4OX9L 1PH2A 1NI3A 1IBLQ 1SE2A 4DUYL 1G6JA 1SSNA 2F0NA 4I7AA 4JI4L 3DBSA 1L0VB 3J80L 4C00A 2GBRA 2SNMA 3FKIG 2K1FA 2W82A 3HOWB 1V49A 3Q8AA 4ITKA 4XT3B 4YWMA 5KNBA 2MCNB 2F0GA 1F9JA 4C7ZA 2D0PA 1PFSA 4ID6A 1WZ0A 5CV5A 4MGZE 4E74A 4MZ9A 1BCPC 1CMXB 2KMCA 1NBFC 4N9PA 2AUKA 2IX0A 4DHJB 4E71A 3HOUG 3Q8DA 1FJGL 2JYTA 2MW5A 2KOLA 4K7WA 4JPSA 4PMCA 4A9AA 4PK1A 1YI2A 5J22A 1KNEA 4A3IH 5J2RA 4IM3A 2BA1A 2KANA 2H5XA 4QUFA 1ZOYB 5BR8L 2WAQG 4BY7G 4JG2A 2AL6A 1MFWA 1ENFA 1J5EL 1OXVA 3HOZH 2BA0A 4L5TA 1C1YB 2EXDA 1CKOA 2VL6A 3OJ4B 3CD6A 3PSEB 3V2TA 1GC7A 2K8CA 3K5LA 4Z9CB 4L5RC 4IC7B 3SFDB 3L13A 4DK3C 5JAVA 1DM0B 4OWXB 3M4OH 4BFRA 1HJPA 3CMAA 3A74A 1O7IA 1T0RC 3TZDA 3DPDA 2OQKA 4IWOA 4CDFC 1SRUA 1UE6A 2F0UA 2WV6D 1TKGA 3K57A 4DV7Q 2RDBC 4BKGA 4XZ4A 3U9OA 1Q5WB 1VR9A 5FOBB 1YJ1A 1B53A 4W9KA 4C1NI 4H44C 2F4VL 5M5YB 3OWFA 5KNCA 2KWDA 1XPOA 4JI0Q 4LNQA 2IHFA 4R9WA 1UELA 3GE3C 1PH8A 3QR8A 3QQ8B 4IOCA 1FNWA 3KDFA 4QGUA 2C7NB 1VQKA 4WQOB 2F0FA 2V4DA 1WCMG 5AZHA 3NSWA 4FN2A 1WH3A 2KX3A 1WJJA 3N30A 3FDTA 3CC4A 2B3GA 3AI5A 2F0DA 2KDFB 2R93G 3RMHA 4LNNA 3PHWB 3AE7B 1FVIA 1WMHA 1WR6E 3KUZA 2BT6A 1WJ4A 2KAJA 1BXTA 2ZNVB 1X9NA 3S1RB 1FNVA 2VB3X 2JA7H 3J9CA 4MACA 1D8LA 4JI5L 1VRAB 1JWUD 4DAPA 2Z1CA 3I91A 1AEXA 1HZ9A 1XTDA 1VQNA 4KDIC 2IX3A 2X6LA 2NVYH 3RNFC 1CI3M 3NWSA 3GTJB 5K36H 3VRAB 2V3SA 3I4NB 1TZ1A 3W5UB 4A3LG 3GV6A 1L1OA 1SNCA 3MEFA 4A3DG 4A3JB 4ME5A 1KOTA 1JE5A 2XWBB 1ZE3D 1F9PA 4JI2L 1VQ7A 1UF0A 2LRUA 1OGWA 3NPPA 3CF6E 4DF7A 5DLQE 4OVZA 1XCTL 3PV0A 3RT3B 3NVVA 2PNHA 3W1GA 1EEFD 3P42A 1NNXA 3ZGZA 4KGTA 2XTIA 3OTOL 5FLMG 2WX0A 5HFYA 1C48A 4RKLA 5DNFA 3ZXRA 3T13A 2ZTCA 5LMUQ 1BBUA 4B9XA 5M5YH 4F87A 2E6XA 2JZ3B 2B63B 4LUVA 1T6BX 4X64Q 4QF4A 5TSSA 1MGSA 2WXLA 1JWAD 4GNXC 3TP5A 3J80E 1JB3A 1TWCB 1Q7YC 5C44B 2XNAC 4WRDA 4K3BA 4L2YA 5J3BA 3GTGH 3ND8A 2E3TA 3FHWA 3C46A 1PGXA 4A3FH 1T0YA 1H8CA 4WJNA 2X69A 5CBEE 2GBKA 4LLGM 4M01A 3D8GA 3LNNA 4Y52H 2Y0SG 2L0FA 1Z5SB 1ONLA 4IUUA 2B2VA 4ARCA 2BS4B 1R4NI 4MH8A 2LS01 2KJRA 1V97A 4GDLA 1Y8RC 4IOAA 3KUDB 3ULPA 4GOPA 1O7LA 5M9OA 3AE4B 2MP2B 3I57A 4L23A 4O0AA 3H94A 3PCOB 4WORA 1DOMA 4LFCL 1H9MA 1P16A 1RYJA 1A3TA 5HURA 4V0BA 2F0TA 3ZYYX 3RZDH 2E2IB 2I0QA 5E6OA 3ZDTA 1E8XA 4B3RL 2A6ED 1O7YA 4C80A 4I6PA 1WX8A 5ELCA 4A3MH 4BKSD 1QNKA 3BZKA 2OEDA 3E9SA 3TREA 2GA4B 3CQZH 1F2RI 2M4NA 1K3BC 4RF1A 2QKIC 4HDQA 2LWPA 4CJ2C 1PDQA 2H1EA 3AEFB 5LMNQ 2XGTA 1E1TA 4BBSG 2AMCB 5CORA 2QDFA 2A74C 1JRPA 2ZXRA 3KLRA 1V1PA 1AWDA 3J7A5 2JXMB 4IUTA 1EF5A 1QZEA 2L3ZA 4EX5A 2WXRA 2BQQA 1ENCA 4BOZB 2UUCL 4N59A 1CA5A 3IBEA 3T51B 1HTQA 4IM2A 1E7UA 1V8CA 1KIXA 4K8IA 2KDBA 1BNZA 1K3RA 3S24A 2QILA 3PSIA 3CC2A 3I73A 3SFEB 1TIFA 2ZVOA 1FXIA 5C4JB 1EY4A 1C8CA 1WI0A 3SR6A 5EE3A 4YY3Q 3UDXA 2M0XA 3VYUA 3CCRA 1X54A 2KVZA 3ZXVA 3I3TB 4HK2A 3NJTA 4RHRA 1VQCA 1I3QB 1KQSA 4P1CC 3NS1A 1XWEA 3TBLD 1VQ4A 1UWMA 1B50A 4G3XB 4ANWA 3WWVA 4W9LA 2J0JA 2BKRB 4W9CA 1H9SA 1PRTB 2BOSA 2JRHA 5EE0A 2ZTEA 2K8BA 4JBKA 5C6AA 2K03A 1XD3B 1WTRA 4A93G 2PPHA 3R93A 3AN1A 2BVCA 4GU2A 1VMCA 3MXPA 4HJAA 1JWBD 3VR5A 3S1NH 1YNTE 4AUQC 2UXCL 3RI7C 1PTOF 2E2JB 1B9RA 2HIXA 5IY0A 1KL9A 3U4EG 3AEEB 2RDHA 5CV4A 1EQRA 4IZ8A 2OEOA 4G7ZC 4IFDH 2PE9A 2WP8J 3NZ3A 3SD5A 2ES2A 1D5XC 4DUZQ 1TIID 2KTRA 1TS4A 4FXCA 2C9WB 2TMPA 1Q1OA 1GJZA 1SROA 3TL5A 3N1XC 3DLLA 1J0GA 3HFZB 1L2FA 1HZCA 1SYGA 4JC0A 1VQMA 1RWSA 5IIFA 1FEHA 2F0EA 3ZDMC 3DQVA 2D11A 5AUKA 4XE0A 1WSPA 2E74C 2B39A 2SOBA 4BBSB 4CDDC 3SGIA 1G51A 3WAOA 1Y1WH 4XDDA 1LV9A 3PO2H 3NRZA 4CO7A 3S1QB 3ERSX 4DK6C 3RN5A 1Z6HA 4XYOA 2VUMH 5JEAG 2Q2UA 1EQTA 1NEKB 1VJKA 5J17A 1U5KA 4FA6A 4JYAL 1HZBA 3KLSA 5MPOA 1YN3A 1SE8A 4FXKC 1MD2D 2INNE 3U7DA 1EY6A 3NELA 2KMMA 4BA2I 5C0XJ 4WJ3M 4HIOA 4KVGB 2D0OA 4UPAA 2BCOA 4MEMA 3G4SA 1SB3C 1M4VA 3Q3NC 4CYEA 2Z9HA 5LMUL 1RDPD 1VLBA 3FILB 2Y5BB 2GOWA 5G2NA 3EN2A 3WIMA 2MBQA 2EY1A 4C3JG 3TUOA 4XT1B 4RM8A 3MXGA 4NMZA 1L6UA 4AQYL 1IBMQ 3WCQA 3QWNA 2KNBA 2WXJA 4GDKA 4NXNL 2R7ZH 1SNDA 1R4MI 2DN8A 5M5XB 3KFUA 2OOBB 3NZSA 2LJ5A 4LJOB 1R4QB 4R4TA 2N7JA 4JI2Q 2EDGA 2JJQA 2VXWA 4A3BH 1MSGA 4F7ZA 1GUNA 2AWOA 2PQAA 1LO5D 3I4MH 3G7LA 2RA4A 1Q82C 2J7QB 4K7SA 5HG2A 4EZLA 3BS1A 4FBJB 2MSED 2YLMA 3NXWA 2CWPA 2JYEA 3ND9A 4A3KB 2Y5CA 3PREA 3PZDA 4RWSC 2RSOA 1VQ6A 3TIXA 1W6JA 4JBJA 1STNA 4JI1L 2JA5H 2EXZA 2OF1A 4UP8A 3ZQ4A 2R92H 3R7QA 1CFMA 2Q2HA 4NB3A 4OZBA 4US9A 1STBA 3RULA 1TJEA 1ASYA 2NR2A 3DWGC 4TKNA 3E6ZX 1IGDA 4C7YA 3RYTA 2HDLA 1LTID 1VQLA 4NAWB 4A8XC 3HOYH 5L83A 2ZVNA 2K8HA 2OT2A 2E8GA 1JW9D 3KLWA 3NHHA 4HCEA 1I94Q 4KKIA 1SMXA 4AH6A 1P8LA 2WU2B 3BDOA 3DWMA 1HPCA 4JK1C 2JA6H 2KHIA 2CVRA 4LDTD 1JE4A 4ZRPA 2MWSB 3TCAA 3B2FA 1HEZE 1NBWA 1Q1BA 1TU2B 5CBAE 1PH1A 2RDGA 3A1QA 1YX5B 1WCMB 3HM6X 3DMUA 1C76A 4KSKC 3I63C 1QOBA 4NAWA 2KDIA 4HLEA 1ZPSA 4KN7C 5IGDA 3HS0C 4R8IA 3DHIC 1Y8NB 3HHMA 4NJ7A 3D4WA 1GPXA 3H09A 3WA0A 3AFPA 2IGGA 2ZJRA 2PI2A 4LUOA 5FK9C 3QOJA 1WTOA 1L5PA 3J81L 5BYRA 1V5OA 2EOTA 3W5OA 4IKGA 5L95C 5AJ3L 3C8YA 1FCLA 1VQFA 4RKBA 2QA4A 1TS5A 1QZGA 1BUIC 4X66L 4XXEA 2DWQA 1GO3E 1TKWB 3M3JA 1Q3LA 3RZOH 1T0QC 4DQOC 3W5VB 2R93B 3DOWA 1II3A 1IL8A 2K7VA 4OIJA 4KGSA 4J3OD 3S1NB 1CHPD 3P75A 2MA9B 3I4OA 3HZXA 5KGUA 4DUYQ 4IW0A 2XVSA 1WE6A 4GDKB 2PPBC 1KF6B 4ZYNA 1PZKD 4A3EB 2EYMA 1HHVA 4GSWA 5JZEB 2F3VA 4CHKA 5BMGA 2WXGA 4EEWA 2FBWB 1SMYC 4ZRQA 3K81C 1DOKA 1WTVA 5ELDA 2YEPB 3PO2B 1SYCA 1AN8A 1I4GA 3H0GG 2LKVA 4MELA 1A63A 2XN9C 4NY0A 5EPJA 4FXDA 2SNSA 4C3IG 1YHQA 2QF7A 2NN6I 1R4MB 1VZ7A 2VNUD 2L7RA 1YBYA 1E0BA 3DHQA 2QGQA 5IGBA 3F1ZA 3RLOA 4FYDA 2WS3B 1HXYD 1KD1C 4EE2A 3BVMA 4WIPA 1PH6A 3ZNID 2WXMA 1QT9A 4C3IB 1KM7A 4OWWB 4N8X1 3DWQA 2XBBC 3BINA 5C5MA 2WACA 2I5MX 4DA2A 5C44G 1TT5B 2L76A 1JOKA 3ECIA 4OHJA 5IT9c 1SNQA 1IW7D 4GNXB 5LLIA 3QB3A 4TUUA 1XX8A 3H7SA 4H7BA 4LF6Q 3PVLA 5IYBH 4IUQA 4LNKA 4IPDA 2ZW1A 4A3GB 1T5EA 4IWQA 3C1EA 4TRDA 5M5XH 1UWXA 1PRTC 2ZM6Q 3Q24A 3HKZE 1MVKA 3RPFC 1KHIA 1D1KA 1Q86C 4IPHA 2FCNA 2INCC 2ZPNA 1V81A 1XO3A 2DZKA 2RR9A 2Z0EB 1EWHA 3ICEA 2E2HH 5FO7B 1STYA 1TWAH 1I50B 4A3GG 4DV4L 2UXDQ 2A5UA 2GI9A 3NTKA 4MTNA 4BWGB 5ELFA 4LF8L 1A5RA 5FO9B 5M3MH 4BBNC 2UUCQ 3TRZA 4LNIA 2A6HC 3S2DH 2EYLA 2JA5B 4F8CB 3BK1A 4ZCKA 4WWPA 4U68A 1VQEA 4UDUC 4FF1A 3KJPA 1PZJD 1FM0D 1BBWA 4QIWB 4FF4A 3HOUH 2J0TD 2LGDA 2CQAA 3OTOQ 3K8AA 5T1GA 3VUYA 3S17H 1I6HH 3Q3FA 4N9TA 3UE0A 1M90C 5GQOA 2KFKA 1TKEA 3VTVA 4DR3L 3OPOA 1C4AA 1V2YA 3QIAA 4OO1G 2G4SA 3EUB2 5IWAL 1RTNA 3QJZA 3N20C 1LTLA 2INPE 3VUXA 3CSFA 1TWFB 2BYFA 3BVGA 3PF5A 2CWAA 5C4ZA 1BKBA 1O80A 3HKZB 2DAFA 1OXUA 3AE2B 1I94L 3PUWA 3NUHB 3PV1A 1QQRA 1L7YA 1WTPA 2FHTA 2WAQE 1SLJA 4CDCC 3J81E 4XQQA 1MHXA 1Q0WB 2Y5PA 3S2HH 3AFQA 2YEPF 3I72A 1CSPA 4OZAA 1U9RA 4FJVB 5ELBA 1LT4D 1CQFA 1HFGA 5EKIA 4POGA 3IAS1 4P74A 4DV3Q 4RA8A 1D2BA 2K05A 4II3B 3R3MA 2Q5WD 4ZHPA 5CV7A 4AYBE 1GNUA 1MBYA 1ZUD2 2VH1A 1I3QH 1F9QA 1KC8C 1VQ9A 2AEHA 1TXYA 1EY9A 2E5LQ 4KD3A 3DBRI 3EFCA 1DOXA 3BYTB 1Q10A 3H6NA 2NZ1D 1K8MA 5FJ8G 2KEDA 4HJ7A 4NPSA 1VDZA 3K7UC 1HR0W 3EFUA
chains in the Genus database with same CATH topology
3ABVB 1P7EA 1EY5A 3FC4A 1B44D 2CU3A 3FAHA 1B9MA 1AYFA 1IKLA 2KACA 4Q2JA 4DU9A 1YJJA 3CHBD 1QOFA 2MPMA 3ZJTA 2EVBA 4DK0A 2JYOA 5AUIA 4FVMA 3TDQA 2WU5B 2NUCA 5K36G 3NK9A 4KY6A 1W6KA 5EGTA 5KIXA 5D3DA 1EIGA 2L55A 5EKKA 1KDBA 5IGFA 4F88A 2O2LD 3AH7A 3VYSA 2PTLA 4HEDA 1B3AA 5A2QL 2AUJD 5I2YA 2J53A 3AE8B 2C9OA 2A69D 1MPEA 1WD1A 1QCBD 2M9VA 4C56C 1PTOH 2F0LA 1BR9A 1HA6A 2WXKA 4ZHOA 2K5QA 2IWHA 1FCCC 2KDMA 2K5PA 2FE8A 3W9CB 1I4QA 4O1NA 2B8GA 1S5BD 2MHVA 2MJ3A 1QF6A 4PMBA 2F0PA 1PZID 4ZK9B 4J1MA 2NN6G 4KGRA 1HTPA 4B0EA 4A3FB 4CHTB 1BCPD 3FPUB 3Q6SA 1S4ZA 1L0YB 3U2SC 1UNSA 4EGVA 2LHEA 3DM1A 3KBXA 3V05A 2WKCA 3IAYA 5E6JA 4H2AA 2R92B 4YTNB 3RLFA 2K22A 2ID0A 1CZPA 3D4RA 1N63A 4A55A 1DD2A 4CBVA 1OO9B 2IL8A 1SNPA 3S2HB 1E2VA 1JICA 4ZUIA 1JR0D 4D2KA 5LL6S 1WVLA 1TWHB 1X32A 2L1BA 1MSHA 5FLXE 2WXPA 1EY0A 5HI1A 1OXSC 1RODA 1C9FA 3B2GA 3K5NA 1XLPA 3LYYA 1ET9A 1F77A 1XTCD 3GO5A 3NP8A 5D3IB 1IYVA 3BG3A 3GTOB 4RGMA 2GB1A 1AZPA 1V8QA 1YN5A 2ENBA 4YXDB 4DNTB 1PTOC 4HN7A 4G7OC 1EYAA 1E9MA 1CA6A 2R7ZB 2B2YC 3SE0A 4EQNA 3RUZA 1B9NA 2RSNA 5G5HA 3EVQA 2EYHA 1CK1A 5I2XA 2L1AA 4K2LA 2HTME 2JX5A 3JAME 5COYA 5C0XG 2HDEA 5IT9E 2XSCA 3BIID 3U7ZA 5EBDA 1E10A 1IBXA 2BW2A 2ZXOA 3DUZA 3Q0AA 3AB9A 3AM9A 5ELEA 3HOUB 3NVYA 4RF0A 3ZJVA 2JU6X 1DXMA 1C4PA 2QMTA 4B08A 3AECB 2B2YA 2KUMA 4S3SA 1Q90A 5D7GA 1DOLA 4IOIE 4H13C 1HZ5A 1KFYB 4RCOA 3PMFA 2FINB 5JEAH 1J7AA 1BO0A 3LWEA 2L32A 1PTOB 1XEEA 1G2TA 4ARIA 1WXQA 1SBBB 1EOTA 2W3RA 1U4PA 2LMCB 1M8AA 2M2LA 1PTOD 2PMZB 2WXIA 1KDAA 1ILQA 1KRHA 1RJTA 5BN3A 5HHDG 1K8OA 4KV6A 4YTMB 2PO4A 1RCVD 2JA7B 5IGEA 1L4ZB 3MJ5A 3T3OA 5DEHA 2AQ2B 4BY1B 1LT3D 2PYKA 5EQ0A 4DK1A 2IGDA 4IFDI 1EY8A 1S5CD 1EM7A 1F2YA 3L3OC 2AQ1B 1FFVA 4XQNA 2B2WA 1OQQA 2PVGC 4C2MB 2QCPX 2EJMA 1SYBA 1JC7A 2DBYA 5C0XI 2TSSA 4XTCS 3K7AB 5CGKA 4TQ1A 1SNMA 3E5SA 5JOBA 1QOGA 1Y1VB 2LEKA 2PVOD 4YWGG 1KLUD 4K6DA 4PQXA 2K3UA 3A8JE 3T3NA 2E76C 2K6AA 2ZT9C 3PUXA 1QNUA 1F2MA 2F0HA 4USAA 2PQEA 2F0VA 1R9TB 1ZDXA 1BDOA 3KWLA 1C78A 3URYA 3N52A 2ICEC 2E2HB 4B0MA 4G7HC 1PLFA 5M3MB 1HZ6A 2XIWA 2BTEA 1NCVA 2V3PA 1FRDA 4LTUA 1DJRD 4A3MB 3IT4B 1S5ED 1K52A 3HOYB 2JP1A 4WQMA 2NB0A 2ZXPA 4UAIA 1T3QA 1D4BA 3KBGA 3R8BA 3EA6A 2RKSA 2WXOA 2B2UA 4HSPA 1TY0A 4ABNA 2CJNA 3FPPA 4X3TA 2C5CA 1Y56A 5LNK1 4HRSA 2Z8LA 1CTMA 1SDFA 2RQXA 4JWSC 2I46A 2KHSA 1OXXK 1LTAD 4BS9A 5BMHA 2ACZB 4LAAA 3TP8A 3BWUD 3SK6A 3RZOB 4WWMA 5FLXL 4C3JB 2FFKB 3GTMB 1XYIA 1V1OA 4KKUA 2Y0SB 1JOQA 4RNAA 2BS2B 1NYRA 4RHSA 4OIKA 1SYDA 3FKIB 2N88A 2WB1B 4OW0A 1QILA 1G8ZD 1QG7A 4ZUJA 1D5MC 2B8FA 2PW7A 2VZKD 4DAYA 2E75C 5C2TB 3CWIA 2A5HA 1JQ4A 2Q8RE 4GZYC 1F2ZA 3FVQA 1BQQT 4AYBB 3ERQA 2LFIA 4JX1C 3SR1A 4M0WA 1PUTA 3P1HA 5IT9L 3E56A 2R3ZA 3BVZA 5H8YE 2O5JC 1HTLD 1LT5D 3VR6A 4BA1I 4DXGA 3D6CA 2M0AA 3AE6B 1FIQA 1WTXA 3WOFA 1VDVA 1A2UA 1FXAA 2W55A 5C3WA 1SFOB 3GTGB 1GUSA 4M8AA 2WXHA 1E2ZA 2WLBA 1XLOA 3H91A 3A8IE 2EPBA 1WTWA 2L9HA 2PIAA 1GJXA 5JEAJ 2L12A 1GUGA 4XWWA 4XIGS 3TEZA 2I2YA 1I4HA 1K51A 4YTPB 2EYOA 1ZKOA 2JSOA 4I7ZC 1OQRA 4IFDJ 4WFN3 2X6GA 2ON8A 3AMUA 1WD0A 4C1NK 4K14A 1I4XA 3W2DA 1A3UA 2F0IA 5A2QE 2JZPA 1V1PB 5D14A 1C77A 1ROEA 3P1MA 3FEWX 1SEBD 2D5DA 1T5XD 4OZCA 4K5VA 4DNRB 1Y8PB 1B2TA 1AW7A 5DAUA 4GLSC 1SJHD 3OIPA 1ZP0B 1X3QA 3VQIA 2F0JA 1PRTD 3M85A 5IGCA 2IJ0A 3N6RA 3Q8FA 1EU3A 3OW7A 5JPMC 3IL8A 1PDXA 2DY8A 1QJOA 1IKMA 4RFBA 2J42A 3AU7A 1E7PB 4K5WA 3TP6A 2FUG1 1LTGD 1Y1WB 1G6ZA 2VZKB 3AEDB 4XDXA 2NVQB 1TKYA 3UI2A 3IKJA 4NDXA 4ZOHC 2MGSA 3VA5A 2KVMA 2KJXA 4MN3A 4X3KA 4M1UB 2PW5A 2DNCA 4LK0M 3A55A 3PUYA 1TVXA 4PMWA 2KA7A 1YNND 5ISRA 2Q8TA 5EPLA 5T8IA 2A6EC 3K58A 3CU7A 1DOIA 3A54A 2FJ2A 2JQRB 5BN5A 1EL0A 3H0GB 3L7ZC 2PZTA 1EQVA 2F0OA 3GS2A 2F4IA 3NVWA 4NP5A 5I6YA 4KKJA 3OOCA 3I4MB 1FO4A 1SSOA 1QE6A 3A7LA 2YYZA 5C3XA 4IALA 1GB1A 3MTSA 4H0LC 2RVLA 1YQ4B 2MJ8A 4P16A 1FNUA 1F9RA 1A70A 1A3VA 2EY6A 3MEHA 2ZW0A 2B2TA 2FMCA 3X3MA 1NUCA 2IX1A 4DGZA 2PW9A 3JAML 3AEAB 2EY2A 1N5XA 4CJ1B 5IGGA 2KECA 4FNFA 2WNMA 1ICWA 3S16B 1ACCA 3P4PB 2CW0D 3TZUA 1BMLC 3FMCA 4J8QA 4PT5A 3I4LA 2QJLA 2JXTA 2N55A 3FRPB 1FR3A 3MVVA 2EZVA 2F0MA 4PNYA 2OHFA 1L0XB 3EJIA 4F7XA 1PRTF 3DWPA 3P63A 3T56B 3MP9A 1QKZA 2NMQA 1YNNC 2L4NA 2F1MA 4G57A 4KTAA 1Z47A 3GB1A 2QEJC 5NUCA 1S5DD 1X3PA 2F3WA 5KEEA 1C79A 3W1SA 1HQRD 4N58A 4NW2A 4A90A 1STEA 1H9KA 5C5LA 3TMEA 5KNDA 4OO1I 4Y7NB 1SE4A 2D62A 5EKLA 3GTQB 1PGBA 3RFZB 1F9SA 4US8A 1I4PA 4TSSA 1G291 2VUMB 1DCZA 1TS3A 1IBXB 2DLBA 1O7ZA 3S14B 3KK7A 2KQ4X 1K83B 1NAPA 3PZ7A 1AFPA 1RF2D 1J8IA 4KMUC 2JE6I 4CKEA 5E4XA 5C4XB 2CW0C 1ZXIA 4HKQA 4KJNA 2DY7A 3K5OA 4KI0A 2GRIA 3RZDB 2LHDA 2LMCA 4L6TB 1FRRA 2NTSA 3VYTA 2LUMA 3TEWA 5G3LD 1CHQD 4FXGC 3TEXA 1SF0A 5GXGB 2V4IB 4ZAIA 4K5XA 2LY7A 4YSXB 2F0WA 1F0ZA 1NVID 3P4RB 4A3IB 3Q22A 1SE3A 4KX6B 1U4RA 2IGHA 3SVMA 2XWJB 1L6VA 3L9AX 3G6JB 1SXTA 1ZXTA 4R3DA 2WDRB 2BS3B 1Z7TA 1HCZA 1N62A 4DXFA 3W3AA 3M4OB 1Q8IA 1B1ZA 1XXGA 2N9LA 2NWGA 3R3OA 3BDLA 2H88B 1YN4A 5LL6X 2AX5A 1KLGD 2PKOA 4QCLA 3DEOA 1U4MA 2WIIB 4EVOA 1SYEA 3PO0A 1DGJA 2A68C 3CRLC 3PUZA 3PO3B 1N61A 3MFGA 1HFNA 5J1ZA 1EEID 3CRKC 1PFBA 1JOOA 2N0SB 4HROA 3K59A 3GV3A 3GTLB 1ZYRD 1E2WA 4HSVA 2M56B 3I3CA 2MEKA 1V43A 3CQZB 1JROA 1WGKA 3WDNA 1BOSA 1SMYD 1STAA 3GQBA 1I4RA 3ZJUA 4IURA 3HRZC 4ZQ3A 2QIEB 4OGQC 3RD4A 1FYCA 2J7ZA 5JVH3 4KD4A 2K04A 3S1MB 5BYSA 4Q5VA 1GAQB 4ULLA 5JJZA 1PYWD 3DWAA 1VZ6A 2KEEA 4CQNA 1N5WA 5FR3A 3J7AF 3ITPA 1YQ3B 3B9JA 1A2TA 1WYGA 2BE5C 4HEA1 2B2WC 1MI0A 1PFNA 4L1BA 5I4DA 5G3LF 1CZGA 3O13A 2DYMA 2V3NA 3HOVB 4LMQD 3P20A 4IUVA 3HVDA 3EGRA 2BBCA 4G4KA 1RFKA 3C1FA 1KTKA 1FD6A 3CIRB 5BYQA 1ZXHA 1WTQA 3M3YB 5JXVA 1E6EB 1H9SB 2EYFA 3HEJA 1GUTA 4ZKCB 1WRIA 4K6LA 4YT0B 3H8HA 2KCCA 2A69C 3J7AV 1YNJD 1HUNA 4JWUC 2R6GA 2NVXB 4OO1H 2I07B 2DNEA 3M7NA 4KY5A 4WH4A 3K5MA 3HGBA 2M19A 1TYGB 1HQMC 3TN2A 3J7YW 1XLNA 1Y69U 1CZWA 1RTOA 2BDOA 3HP3A 4ZRZA 1L4DB 5CMDA 2HQEA 1C4QA 3AB5A 2XRQD 2WKDA 1GHKA 1EZ6A 3AE1B 1ZYRC 2N9KA 2LFNA 1NSNS 2K33A 1J7CA 1K50A 2WXNA 1UAPA 5M3FB 2OXPA 3Q8EA 2I38A 4WJWA 1IGCA 3U9SA 3TEYA 2IPKD 4TQUS 3VR2A 3HG9A 4AQ7A 2IT1A 2ONQA 2WP9B 2WDQB 5G5GA 3KQ4A 1IUEA 4ODGA 4QMGA 1BF4A 2B2VC 1XF5L 4CGYB 1QB5D 4NJCA 2IW3A 1KDCA 2Y3AA 4GDLB 2RPVA 4ZKBB 3MHZA 5I6WA 2L11A 2Q8IB 1DONA 4XQJA 2E2DC 2XRSD 2QSDA 1S5FD 5I9OA 1ZDVA 2PZUA 3D6WA 2K9XA 5E3FA 1ESRA 1K53A 1WWTA 1UUPA 4HMJA 4A3DB 3Q8CA 1NR2A 3F2UA 4HCSA 2NVTB 2MJEA 3MHBA 4P6VF 5K5PA 3LWUA 2SEBD 2IDYA 3E0JA 1ML0D 1VCIA 3PIP3 5DM63 2J4XA 4ILWA 3T4AC 3OIQA 3T53B 2MUYA 3AMZA 5A35A 2RMMA 2J52A 5HGTA 2EY5A 1JWMD 3PUVA 1G2SA 1EWYC 4PV1C 3I90A 2AQ3B 5H92C 1R4PB 3HRDD 2HUGA 1O78A 2M00A 3IT6B 3S15B 3D3RA 3Q8BA 5EJWA 5IOCA 4HAEA 4BBRB 4YSZB 2B76B 1H9RA 2PLPA 1KH0A 3S2DB 2HDMA 4NAMA 1XLQA 2A6HD 5I9PA 1Q1EA 4KK7A 2K01A 1KNAA 4IDIA 1SNOA 3QOLA 5CV6A 1EYDA 2L0CA 3TSSA 3IXSA 3KLSX 3GD7A 5EBCA 1JORA 1U4LA 2EYPA 5CYUA 3VRBB 2PZWA 3OMCA 4HR7B 1HRJA 4WURA 1EWCA 4DN4M 5C3EB 3SK8A 4EQPA 3MXUA 2KQ3A 1RD9D 5D65A 4LJZC 2K0PA 2K1BA 1LTRD 1NR4A 3NQTA 1J9OA 1IHZA 2WINB 3EROA 3K0YA 2SAKA 2JEBI 2D5GA 3TBIB 3OSOA 2G9DA 3DXJC 3I9V1 1I7HA 4DAVA 1EYCA 1LTSD 3MZ5A 2JEAI 1D1IA 3AEBB 1BBXC 5EE1A 3VYRA 4WAFA 1MI2A 4NKLA 4RGTA 1D5ZC 4A3BB 1NYQA 1TWAB 3OMGA 5C0XH 5KRUA 1HUMA 1SYFA 2QDBA 3WOEA 3VR3A 1ENAA 3HOXB 2NBFA 1QWYA 3PZ8A 1ET6A 1A15A 3IFTA 1JWSD 1ESFA 3BZDB 4L63B 4C3HG 1Q12A 1QOHA 2EE1A 1YNJC 3EFXD 3ETRA 2K5DA 4RAUC 3NWTA 4JE3B 3P4SB 2F0SA 4XYQA 4C3HB 4MM3B 3R2IA 1YMHE 3OHXC 3GP7A 4KHZA 3KUPA 2JA6B 1TZOA 3SK4A 2MH7A 5JVG3 4KN4C 4RH6A 4XWTA 1GB4A 1D6EC 1LTBD 4KHVA 3AEGB 3VR9B 1STHA 2HCIA 4V190 4FP5D 5CC4A 1CJEA 3NBHA 2WXFA 5KYLA 3MC0B 1H9JA 5EPKA 3T16A 4P2CB 2NN6H 2O5IC 2ICIA 3NQIA 4R8NA 4HJGE 5JPNC 3NBIA 3ONAB 1P7FA 5C3JB 4NZLB 3MFYA 1JALA 2O4XA 2L83A 1TS2A 3I8ZA 2JSVX 1RHPA 3QO2A 3N9YC 2F0KA 2K28A 3A7AB 3M7GA 3CKIB 2SDFA 5T1IA 2BB5A 1N60A 1HA5A 4B9WA 1SJED 3QG1A 3SXHA 4ZLTF 4KJOA 4FO2A 3I70A 4HTHA 4MIUA 5AFWA 1OFFA 3NE5B 3BK2A 5F2DA 2MP1A 2D9UA 3IFDA 3NUCA 1J7BA 2Z4HA 3A8KE 3LB8C 2YU9B 1EU4A 4TKOB 2WQYB 2DYOA 4FF2A 2D2CC 4CKBA 3MXNA 5LHY1 1TWGB 5IODA 2JA8B 2EELA 1EFID 4KKSA 4J6HA 2VB2X 4AS1A 1OXTA 1LACA 1UGJA 1DOYA 1XCQL 2BB6A 4K8JA 4IFDG 1ZEQX 2G1EA 5CV8A 1PMRA 4CKCA 5BN4A 3H6MA 4X3SA 1GOZA 3UI3A 3AE3B 1LABA 2W54A 3MA2B 5E4WC 2KN4A 1TQOA 1DYQA 2WDVB 4KKTA 3KF8A 2EJFC 1AZQA 1B4OA 3QJYA 3Q69A 3S17B 1I6HB 4TMAB 2W3SA 3Q23A 4HKZE 2LGIA 2EKIA 1YJIA 1GHJA 3EQLC 4K2KA 1RKNA 4EQOA 2EJGC 1IW7C 2A68D 1JCKB 3R2TA 1QOAA 1CM9A 3MAQA 1F2LA 1PGAA 3FILA 2R61A 4FF3A 3LX0A 2BE5D 2L5TA 1VF7A 1PFMA 1VMPA 2RBMA 1CQVA 2KCNA 1C4CA 2B2TC 1QLBB 1KABA 5FO8B 1AP0A 4N6EB 1TR5A 2H89B 4A93B 1FMAD 5E1FA 2RDFA 2WXQA 4HMIA 3K6OA 4L8JA 3LXFA 4RCNA 3NTHA 3GTKB 2F03A 4MT5A 1LLRD 1KAAA 2X38A 3GTPB 2NYZD 1EY7A 1PFDA 2L52A 3TP7A 3VR8B 4LK1C 5FKAC 2PCFB 2G9HD 4IUPA 3SDZA 2CHBD 2JWUA 1GXDC 4IUNA 1CT1D 4YSYB 5C4HA 1A6XA 1DZ1A 3BYYB 1FGBD 1JMLA 1IYUA 3NVZA 5DM73 4F8MA 3U52E 2NVYB 2Z4IA 3P4QB 3BDCA 1EIHA 3L4PA 4A6QA 1UEAB 5KYIA 3OWEB 4IN3A 1GUWA 4YIJA 3PIO3 3SEBA 1FFUA 3X3NA 3V96A 1LT6D 3NTIA 5CV9A 1BCPF 3H3VC 1VF5C 2LJIA 1EZ8A 1NENB 1GUOA 1MHHE 4CJ0B 2PMVA 3AE9B 1R7SA 2K5WA 3A56A 4E6IA 4QUCA 5J39A 2F0QA 1E0ZA 2HCCA 4ZYSA 3DEPA 3AV8A 1PXUA 3M4YA 1Y8OB 3SHLA 4U673 5BMIA 2BYTA 2BDNA 2B2UC 4OL7A 2AWNA 1LTTD 4I65A 3VR4A 3SK5A 1RM6C 4QB4A 4JBWA 2MJDA 4RGOS 3P7JA 4KY7A 2V0GA 2WAQB 4BY7B 2CJOA 4REZA 2PNRC 3HVZA 4X3UA 3IAM1 1FD7D 4DFAA 1BUVT 4RGNA 3C3LA 5EE9A 2EYJA 3VA7A 1F2RC 5M5WB 1G91A 2H4OA 4Q0FA 2K32A 3HOZB 3HUIA 3D4DA 5CR3A 1I6VC 1SAPA 4IQZA 3C2PA 4XDCA 3MWYW 3V3XA 2NTTA 1VZ8A 1SIJA 1TT2A 2A73B 3D31A 1JQYD 1TY2A 3S9WA 3KWVA 2FMMA 4MHEA 1ILPA 1STGA 4O42A 1BCPB 1NI3A 1SE2A 1SSNA 2F0NA 1L0VB 3J80L 2SNMA 3Q8AA 2W82A 3HOWB 4ITKA 4XT3B 5KNBA 2F0GA 4C7ZA 4ID6A 5CV5A 1BCPC 4N9PA 2AUKA 2IX0A 2JYTA 4A9AA 2KOLA 4JPSA 4PMCA 5J22A 1KNEA 2BA1A 4QUFA 1ZOYB 1ENFA 1OXVA 2BA0A 3V2TA 3K5LA 4Z9CB 3SFDB 5JAVA 1DM0B 3TZDA 2F0UA 2WV6D 1TKGA 3K57A 3U9OA 1VR9A 5FOBB 1B53A 4C1NI 4H44C 5M5YB 3OWFA 5KNCA 2KWDA 4R9WA 1FNWA 2F0FA 2V4DA 3NSWA 3FDTA 2F0DA 3RMHA 3AE7B 2BT6A 2KAJA 1BXTA 3S1RB 1FNVA 2VB3X 3J9CA 4MACA 1VRAB 1JWUD 4DAPA 2Z1CA 3I91A 1AEXA 2IX3A 2X6LA 1CI3M 3NWSA 3GTJB 5K36H 3VRAB 3I4NB 3W5UB 3GV6A 1SNCA 4A3JB 4ME5A 2XWBB 1ZE3D 1F9PA 3NPPA 4DF7A 4OVZA 1XCTL 3PV0A 3NVVA 1EEFD 3P42A 3ZGZA 4KGTA 5HFYA 1C48A 4RKLA 5DNFA 3T13A 4B9XA 4F87A 2E6XA 2B63B 1T6BX 4QF4A 5TSSA 1MGSA 2WXLA 1JWAD 3TP5A 3J80E 1JB3A 1TWCB 5C44B 2XNAC 4WRDA 4L2YA 3ND8A 2E3TA 3C46A 1PGXA 2X69A 5CBEE 4LLGM 3D8GA 3LNNA 1ONLA 4IUUA 2B2VA 4ARCA 2BS4B 4MH8A 2LS01 1V97A 1O7LA 5M9OA 3AE4B 3I57A 4L23A 3H94A 4WORA 1DOMA 1H9MA 1RYJA 1A3TA 5HURA 4V0BA 2F0TA 3ZYYX 2E2IB 2A6ED 1O7YA 4C80A 5ELCA 1QNKA 2OEDA 3E9SA 2GA4B 1F2RI 4RF1A 2QKIC 4CJ2C 1PDQA 2H1EA 3AEFB 5CORA 2A74C 1JRPA 2ZXRA 3KLRA 1V1PA 1AWDA 2JXMB 4IUTA 2WXRA 1ENCA 4N59A 1CA5A 3T51B 1V8CA 4K8IA 1BNZA 2QILA 3SFEB 3I73A 1FXIA 5C4JB 1EY4A 1C8CA 3SR6A 5EE3A 3VYUA 4RHRA 1I3QB 3NS1A 1XWEA 1UWMA 1B50A 1H9SA 1PRTB 2BOSA 5EE0A 5C6AA 2K03A 1WTRA 3AN1A 3R93A 1VMCA 3MXPA 1JWBD 3VR5A 1YNTE 1PTOF 2E2JB 1B9RA 3U4EG 3AEEB 5CV4A 2RDHA 2OEOA 4G7ZC 4IZ8A 4IFDH 2WP8J 3NZ3A 1D5XC 1TIID 1TS4A 4FXCA 2TMPA 1SYGA 1RWSA 5IIFA 1FEHA 2F0EA 5AUKA 4XE0A 1WSPA 2E74C 2B39A 2SOBA 4BBSB 4XDDA 1LV9A 3NRZA 3S1QB 1Z6HA 4XYOA 5JEAG 1NEKB 1EQTA 1VJKA 3KLSA 5MPOA 1YN3A 4FXKC 1MD2D 2INNE 1EY6A 2KMMA 4BA2I 5C0XJ 2BCOA 1SB3C 1M4VA 1RDPD 1VLBA 3FILB 2EY1A 4C3JG 3TUOA 4XT1B 3MXGA 4NMZA 1L6UA 3WCQA 3QWNA 2WXJA 1SNDA 2DN8A 5M5XB 1R4QB 2N7JA 2EDGA 2VXWA 1MSGA 1GUNA 2AWOA 1LO5D 3G7LA 2RA4A 5HG2A 3BS1A 3NXWA 2JYEA 3ND9A 4A3KB 2Y5CA 4RWSC 2RSOA 1W6JA 1STNA 2EXZA 2OF1A 3ZQ4A 1CFMA 4OZBA 4US9A 1STBA 1TJEA 3DWGC 3E6ZX 1IGDA 4C7YA 2HDLA 1LTID 4NAWB 4A8XC 2OT2A 1JW9D 3NHHA 4HCEA 4KKIA 2WU2B 3BDOA 3DWMA 1HPCA 4JK1C 4ZRPA 2CVRA 1JE4A 3B2FA 1HEZE 1Q1BA 1TU2B 5CBAE 2RDGA 1WCMB 3DMUA 1C76A 1QOBA 1ZPSA 4KN7C 5IGDA 3HS0C 4R8IA 1Y8NB 3D4WA 1GPXA 3H09A 2IGGA 5FK9C 3QOJA 1WTOA 1L5PA 3J81L 5BYRA 2EOTA 4IKGA 3C8YA 1FCLA 4RKBA 1TS5A 1BUIC 2DWQA 4XXEA 1TKWB 1Q3LA 4DQOC 3W5VB 2R93B 1II3A 1IL8A 2K7VA 4OIJA 4KGSA 4J3OD 3S1NB 1CHPD 3P75A 3HZXA 5KGUA 2XVSA 4GDKB 2PPBC 1KF6B 1PZKD 4A3EB 2EYMA 1HHVA 2F3VA 5BMGA 2WXGA 2FBWB 1SMYC 4ZRQA 1DOKA 1WTVA 5ELDA 2YEPB 3PO2B 1SYCA 1AN8A 1I4GA 2LKVA 2XN9C 5EPJA 4FXDA 2SNSA 4C3IG 2QF7A 2NN6I 1VZ7A 2VNUD 1E0BA 3DHQA 5IGBA 4FYDA 2WS3B 1HXYD 4EE2A 3BVMA 4WIPA 2WXMA 1QT9A 4C3IB 3DWQA 5C5MA 2WACA 4DA2A 1JOKA 4OHJA 1SNQA 1IW7D 3QB3A 1XX8A 4H7BA 4IUQA 2ZW1A 4A3GB 1T5EA 3C1EA 4TRDA 1UWXA 1PRTC 3Q24A 1MVKA 3RPFC 1D1KA 1XO3A 1EWHA 5FO7B 1STYA 2GI9A 3NTKA 4BWGB 5ELFA 5FO9B 2A6HC 2EYLA