1AN8A

Crystal structure of the streptococcal superantigen spe-c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOCOCCAL PYROGENIC EXOTOXIN C
publication title Crystal structure of the streptococcal superantigen SPE-C: dimerization and zinc binding suggest a novel mode of interaction with MHC class II molecules.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Bacterial superantigen
total genus 66
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1an8A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1an8A01
2AQ2B 1LTID 1SEBD 1TS4A 1STEA 4L63B 2AQ1B 1ENFA 1UNSA 1KLUD 3O13A 1HQRD 2XRQD 4Z9CB 2RDHA 5TSSA 1V1PB 2XNAC 4RGOS 4RGMA 1CT1D 1PRTB 1S5DD 1EU4A 1G8ZD 1LT3D 1EU3A 1B1ZA 5I4DA 1L0YB 4O1NA 1L0XB 3R2IA 5ELCA 1FNUA 1RD9D 5D3IB 1LTAD 2XN9C 3R8BA 1SJHD 1HA5A 4RHSA 1CQVA 2CHBD 4UDUC 1I4HA 1YN3A 5FKAC 2R61A 1PTOB 1RDPD 1RF2D 1LTSD 1LT6D 5ELDA 2J4XA 3EFXD 3BVZA 5ELBA 2G9HD 1SBBB 1JQYD 1BCPF 3BYYB 4TSSA 1FNWA 1GOZA 2NTSA 3DWQA 1JWMD 1S5ED 1V1PA 1PTOH 2O2LD 1BXTA 2NTTA 2QILA 1AW7A 3W2DA 1DJRD 5FK9C 1DYQA 1I4QA 1YN5A 1TY2A 1S5BD 5ELFA 1PYWD 1SE4A 2IJ0A 2SEBD 1D5ZC 1S5CD 1M4VA 1TS3A 1TS2A 1SE3A 1LTBD 4RGNA 1QILA 1SE2A 3EA6A 1EEID 3KLSX 4DXGA 2XRSD 1XXGA 1FD7D 1LLRD 1ET9A 2AQ3B 1PRTF 1UUPA 3BVGA 2WV6D 1PZKD 3BYTB 2ICIA 1D6EC 1JWUD 1KLGD 3GP7A 4L6TB 3TSSA 2RDGA 1SXTA 1PTOF 1I4XA 2IPKD 2QEJC 3DWAA 1B44D 4BWGB 1RCVD 3URYA 4ZYSA 1SJED 4DXFA 1LO5D 1LT5D 1LTGD 1MD2D 1EEFD 1JCKB 1D5MC 4RGTA 1PRTC 1YN4A 1V1OA 1CHPD 1PZJD 4RH6A 1EFID 1AN8A 1CK1A 1LTRD 1PZID 3DWPA 4RHRA 4RCOA 4NZLB 1BCPC 1FNVA 1JWSD 3BVMA 1HTLD 1HXYD 1CHQD 1PRTD 1TS5A 1ET6A 1JR0D 1LT4D 1FGBD 1S5FD 1T5XD 4OHJA 1PTOC 1KTKA 3OWEB 1EWCA 1BCPD 1LTTD 1TY0A 3CHBD 3MC0B 5D3DA 1I4PA 3R2TA 1PTOD 1I4RA 1I4GA 3V05A 2TSSA 1ESFA 1XTCD 1BCPB 4K6LA 3MFGA 2Z8LA 4RFBA 1D5XC 3SEBA 4C56C 3BZDB 1F77A 5ELEA
chains in the Genus database with same CATH superfamily
2JN4A 2B8GA 1T0SC 2REXA 4REZA 4PS7A 1CZPA 3T1HQ 2KWVB 3V62A 2R2OA 1EY6A 4DA2A 2R7ZB 1IKLA 1UNSA 2L4NA 1D3ZA 2YLMA 4A3DG 2RQXA 5IN7A 1QVGA 1TKYA 3OLMD 2FUHB 1X3EA 4DXAB 2PZTA 2K4KA 1IGCA 5JJKA 1VMCA 4QB4A 1WXQA 3VH3B 4BY1H 2JA9A 1WM2A 4EEWA 1YQBA 1L0YB 1X3GA 2IYDB 2PPHA 2DY8A 3L54A 3TZUA 4PYUA 1SROA 2KWUB 2C7MB 1E7PB 1E7UA 4PZ6A 5JPNC 3OPOA 4HJAA 2R93H 1MG8A 2KLCA 2SDFA 1HA5A 5I6YA 3ZVVA 4QL5A 4UDUC 2VY3A 3K7AH 3PUZA 4K1RB 1A3VA 3Q3MC 1Y8PB 2WP8J 5ELDA 2M9VA 3FKIG 2EJMA 4OWTB 4LLGM 2DJGC 2HDLA 3PUYA 1SE9A 1SBBB 3RULA 3SDLC 1H95A 5G5HA 3Q3OC 1EY4A 5DPSA 2KQ4X 2LGYA 1PUTA 3NBIA 2QA4A 1WI5A 2UUAL 2B2UA 1JWMD 3V2TA 3N1XC 5CV7A 1V1PA 2BWES 2O2VB 3Q14C 4NAWB 2O2LD 1IYVA 2NTTA 4IPCA 4R4QA 4UY8C 4YTPB 1UE6A 2MO0A 2VQFQ 3HOVG 1HTPA 3X3NA 1F2LA 2CWAA 2IJ0A 4KD3A 1WTPA 3UGBB 3M62B 4OWWB 2KXJA 3X3MA 1N9WA 1LTBD 4XIGS 5FLXc 1FRDA 3ZXVA 4CKCA 2AYOB 4DNTB 4GN4B 1WF9A 2B2VC 4OO1H 4YSYB 4QQBX 2I1KA 2NBVB 1QOBA 1KAWA 3S2AA 5HY6A 2R7DA 1N62A 2XWJB 2RDBC 4EZLA 4P7IA 4TV3A 1UUPA 3QQ8B 5C2TB 1GUNA 1H8CA 1YI2A 3AEGB 2K8HA 1K83B 2Q2TA 5IGFA 1BBXC 1ZYRC 3KDFB 4L6TB 2WFWA 4NNJB 4FP5D 1WWTA 5E7NA 1Z9FA 4A3MG 4K14A 4DR4Q 5LL6X 1Q8IA 4HMIA 2EY5A 3H94A 3PQIA 3URYA 1P98A 1YMHE 4H7BA 4B0EA 4B6WA 1GO3E 4IW0A 2MX2A 1W3SA 2Z1CA 3VH4B 1ZXHA 2JA6B 2MBHA 1JJCB 2I5HA 3W1SC 1V1OA 4HN7A 1A63A 1WGHA 1Q90A 3ENEA 3HFZB 1XEEA 5K36G 2KK8A 3I4LA 3APFA 1NR4A 1JWSD 4HIMA 2L05A 4DV1Q 3ABVB 2EQSA 1YQ4B 3N6RA 1TS5A 2CS4A 1JR0D 1D2BA 2NCNA 5J22A 3HZXA 3KVFB 2E2JH 3MA2B 2O6VD 3R3MA 5HHDG 1O7ZA 5A35A 3AE8B 3UDGA 1FIQA 2FE8A 3H0GB 4FF4A 3AI5A 1B3QA 1WCMB 2I07B 4PMWA 2I0QA 2FAZA 4BY7H 1VQBA 1PTOD 5IGBA 4ZAIA 4AOFA 1STGA 5J1ZA 2LASA 4K8JA 2BWFA 3EUB2 3EROA 3MFGA 5IP4D 1F77A 2EOTA 4NMZA 2ZXRA 3E5SA 4B3TQ 4DR6Q 2OOBB 4GN5A 5AZFA 1IUEA 1LTID 2KCNA 3AE7B 4DHZE 5IWAQ 4KDLB 5FJ8G 5L83A 1ZEQX 1YX5B 3U7ZA 1STBA 4W9JA 4G7ZC 3K5NA 3S2DB 4A3EG 4IUMB 2J0TD 3R93A 1V1PB 4LUOA 4DAPA 2JY6A 2L3ZA 3PZ7A 1VS0A 2K7VA 1YNJC 2NVXB 2JA7B 1GUGA 4GOCA 4JI1L 1E6EB 3C0RB 3NENA 1CT1D 3KWLA 3VUYA 2UXCL 3PO2B 1OGWA 5BYQA 2BOSA 2HCIA 3UQAA 3Q22A 4GZYC 2F0UA 2SAKA 1LABA 3GS2A 3NUHB 4IWOA 1FNUA 1FVIA 4LUZA 2FIDA 4AQ7A 3APCA 5C44H 1WTRA 1DCZA 2Z6BA 4JPSA 1BDOA 5M3FB 2ES2A 2KMMA 2J7ZA 2UUCQ 2M4NA 2MBOA 1LT6D 4O2DA 1XO3A 3NUCA 3U58A 2INDC 2D3BA 2VQEL 1NCVA 3QOJA 3MTNB 4EE2A 2BS2B 4BAXA 2M00A 2L7RA 3DEPA 3DWQA 3KJOA 1SR3A 3K9PB 3HOZH 1WVLA 3HOYH 3GTLB 2BT6A 3AQQA 3U4VA 4HIOA 2W9NA 3R3OA 3TEHB 5HKHA 1E1TA 2HDMA 4ULLA 1E0BA 1TY2A 5CV6A 1R4NB 1X3PA 4GSWA 4BOZB 4J3OD 4EQOA 4YXDB 3RZDH 4WWMA 3SGIA 2NN6I 1X54A 4BFRA 2K1FA 3I56A 4DAMA 2B3AA 1I3QH 2LXAA 4KD4A 4BXXG 1BMLC 1QKZA 4KV2A 2WKCA 4I65A 1RAXA 5CR3A 4HVBA 2ALYB 2NMQA 3RT3B 1I6VC 3D31A 5CV9A 2RGFA 1UWVA 2HIXA 3VR6A 5BR8L 3D6WA 4DK0A 4H44C 4C1NK 2LY7A 2WXLA 4G7HC 1EQVA 4BZAA 1YNXA 1UGJA 2A6EC 3I57A 2RDFA 5FLMG 2JK8A 1NE3A 3HOVB 3A55A 4F7XA 2F3VA 2YU9H 2K8BA 4XYCA 2W3SA 3RNBC 5KIXA 2I5LX 3DHQA 3PT2B 1OXVA 1JCKB 1K8RB 2V4IB 2J0KA 4GMVA 2V4LA 2M56B 4RH6A 1A3UA 2HTME 3GTJH 1I5FA 4FULA 1PZID 4RHRA 2J7QB 5E6JA 4DU9A 4GB9A 1WTWA 3CW2C 3AULA 2XTIA 2QHOA 4LNOA 2MHVA 1TZ1A 1L2FA 2KCMA 2JQRB 2PEAA 1KTKA 4UP9A 1K3BC 3M85A 4IOIE 3L3OC 4WIPA 2LKVA 4A3FG 1QUQB 3Q69A 2JA8B 1CA6A 2IGGA 1UWXA 3Q2AC 4IQZA 3T3OA 3Q8DA 1JQ4A 2B2UC 3RNGC 1HR0L 2A19A 2DYOA 2FCNA 4OO1I 1XTCD 5IYCG 2CWPA 1H4RA 2AWOA 2BYTA 3WAPA 5C4ZA 5BO4B 2BPSA 2L0CA 4AH6A 3OJ4B 4ZUIA 1TT2A 4EVOA 4A93B 2LXCA 4TQ1A 2K6QA 1E9MA 2PE6B 3AEDB 1XF5L 4L63B 1K73C 2KC2A 3KUCB 2K39A 3T53B 1J5EQ 5I9OA 4V190 3AMUA 4GLVB 3D4DA 3GTGH 5IT9E 1B70B 3WOEA 5CV5A 4B3RQ 3GZNI 1SNPA 3PRMB 4BBNF 2KN5A 4Q5VA 2F4VL 2ZEQA 1QZEA 3NVWA 4NJ7A 4OIJA 1XNQL 5C4XG 4RGOS 1AZQA 3UI3A 2L5TA 3ZNGC 1TBEA 3RZWC 1U4RA 1X1MA 4N59A 2DZJA 3B2FA 3AEAB 2ZVOA 3EIVA 2V3PA 2KTRA 3A5UA 2A6HC 4CJ0B 2F0VA 3OIQA 3DM1A 1Q12A 4LCDE 3KLSA 3M4OH 1KDAA 1FXTB 1YN3A 1JE5A 2MLBA 4C4VA 2EYLA 1KABA 1LTSD 5IO9A 2B2WC 2JXMB 4JI1Q 4BA1I 1NR2A 2GMIC 3NVVA 2G9HD 3V3XA 4C7ZA 1B7YB 4ZK9B 3JAMi 4GLAC 1UD7A 2PTLA 2B39A 2B2YC 4A3IH 2Z6KA 1PH7A 2KBNA 2WB1B 3B0AA 1I35A 2BF8B 4JX1C 4MIUA 4DUYQ 4ACFA 5JH5C 1DJRD 5E4XA 4C3JH 1UE5A 1PGAA 2N9LA 3AE1B 2SNMA 5H8YE 1ZW7A 2FCSA 4HLEA 3F2UA 3NEMA 1TZOA 3MC8A 4M01A 3PO0A 3I7FA 1O7LA 2IHEA 2PQEA 4W9KA 2VQEQ 4US8A 3SU8X 3AE2B 1SE2A 1KD1C 3EA6A 2MH7A 3HOXB 4LK1C 1VLBA 4C80A 4JI6Q 4WJ4A 3CRKC 4OIKA 5FLXL 1KC8C 1G6ZA 2AQ3B 2AL6A 5EE0A 1SN8A 1WTQA 4BBNC 1RL2A 1WMHA 2OT2A 2VZKD 4KGSA 1EF1A 3GTOB 2INNE 5HI1A 4HKZE 4R4IA 3NVZA 4X66L 2C35B 4LFAL 2EYFA 3KLWA 1BT0A 2D5GA 3KF8A 4XWTA 2RDGA 1P3QU 2LUEA 2MBQA 4GDKA 1D8LA 4ICVA 1DD2A 4ZYSA 3NWSA 1Y8NB 4A3JG 5IYDH 1WXMA 1B8AA 3MXGA 1MD2D 1L4DB 3AN1A 3FKYA 2QF7A 1KRTA 2NR2A 3H1UA 4ICUA 2K22A 5C3XA 1FXIA 2GBNA 1GB4A 4A3GH 3S1NH 1BF4A 1RFKA 1XJVA 2FFKB 3ZNZB 4S3SA 4DV6Q 3BVMA 1J7CA 3CMAA 2C9OA 1CHQD 2PKOA 1TWFB 1EY7A 5M5YB 3NG0A 2X6LA 5T1GA 1N33L 5MPOA 1HUNA 1IL8A 2F3WA 2GN5A 3PIPA 2LGDA 3S9WA 1F52A 3UI2A 2O5IC 1CJEA 1Z2MA 2N9XA 4BVUC 4JYAQ 4BS9A 1NI2A 1J6QA 1NUCA 3BK1A 1K83H 3HG9A 4B08A 5C4HA 1QWYA 3U30A 3SEBA 5IY0A 2FCQA 2C7HA 3BZDB 4WJOA 4DR1L 2VZAA 2A5UA 5ELEA 2D3CA 4C4VB 1XNRL 2KAJA 5JZEB 3PCOB 3B9JA 3HKZG 1SYFA 2Y0SB 1GC7A 3IAS1 4EZJA 1JWBD 2IGHA 4LMQD 1U0LA 1HR0Q 2JA6H 2GA4B 1G6PA 1M8AA 1KM7A 3RD4A 1LACA 2IWHA 1GUOA 2R93B 5JJZA 1FRRA 3B1LX 2VW9A 4AQYQ 5HURA 2KOLA 3ULLA 4FXKC 3AFPA 1PH2A 3N52A 1TTNA 1PRTB 2QDBA 1SFOH 2KJHB 1ILQA 3PTFC 2KMCA 5D3IB 1EIHA 5J39A 1U4PA 2YYZA 1HA6A 2LHEA 1SJHD 4RHSA 4LF4L 3DHHC 4RF1A 1CQVA 5M9OA 1V80A 2QCPX 1EF5A 5IODA 1RDPD 1IKMA 1VJKA 3CC2A 4UPAA 2I1JA 1WMHB 4X65Q 4B9XA 3MJWA 1KDBA 3C1EA 5DAUA 1VQ4A 1CKMA 4N9PA 4R4TA 1CQFA 3AB5A 2A68C 3P1MA 3NBHA 1C0AA 2ZZPB 1FFUA 5DPTA 3KF8B 1HTOA 4GDKB 1UELA 4MELA 1X55A 3HK0A 3GE3C 2B63G 4ARIA 1S5BD 1T5EA 3S2DH 2JPHA 5L95C 2WAQG 3DEOA 2VUMH 2JE6I 1TKGA 5TR5A 4W9IA 4JG2A 4RGNA 3CF6E 2KO3A 1FCCC 2KJ6A 3I4MG 3LWEA 4G50A 3TP5A 1LXDA 1PRTF 4C7YA 5CBAE 3P7JA 1Y69U 4ZKCB 1STYA 2PYKA 2HJ1A 2K5QA 1VCIA 1QVCA 1D4BA 2V9HA 3GP7A 2DJFC 2W3RA 2RSNA 1SNOA 3G71A 3J9CA 4I6NB 2G45B 1GUWA 2EIFA 2B2TA 2QEJC 2WB1E 2OTJA 2KANA 1B2TA 2Z4IA 1E0ZA 3CSTA 4C3HG 3VRBB 2E2JB 3AV8A 1PZJD 3F2DA 3RN2A 1G51A 1WGGA 1YOVB 4RAUC 1EFID 4QY7A 4NZLB 1V2YA 4GNXC 3TZDA 4ZQ3A 4C3IG 1L6UA 1MPEA 4BY7B 1SYDA 4HCEA 2UU7A 1T5XD 3W3AA 4O0AA 2HT1A 4JIOU 4AYBB 4K5WA 4HJKA 1VQOA 2RKSA 3FHWA 3I4NG 1H9MA 2KQSA 2JJQA 3VA7A 4XDXA 3C19A 4LFCL 5DCNA 1UAPA 3KUZA 5BYRA 1Q81C 5IP7G 2NB0A 2L9HA 1IBKL 3FKIH 2ICEC 3MP9A 3A74A 5H92C 3S16H 1Q5WB 3TJPA 1WJ4A 3F2BA 4B0MA 3K81C 4A20A 1W6KA 3PUXA 1HNZQ 4NXNL 1BCPB 2EE1A 2EZVA 2PQAB 2Z8LA 4KK7A 2Q8RE 3U50C 3VDYA 1JRPA 4C56C 1WX8A 3J7ZC 2LS01 2HE7A 1N36Q 1EQTA 1HCZA 3PIP3 3HOVH 4KY7A 3RMHA 4ODGA 1TS4A 3DDCB 1STEA 3KK7A 1SNCA 1YVCA 4FVMA 4FJZA 3ZW3A 5GAGC 2MJEA 5C0XG 3QJYA 1V97A 4WQMA 2KWDA 1XWEA 1EQQA 2KHSA 2XNAC 3CC4A 1GUTA 5C23A 1E5WA 2M0XA 1A62A 1XNRQ 1Q1EA 2MA9B 4FBJB 1KLVA 3Q23A 1I6HH 2B2VA 3DBSA 1GHJA 2BE5C 2F0EA 3QB3A 1EY9A 4MH8A 1F2YA 5LL6S 1M94A 2NBWB 1IGDA 5EGTA 1A2TA 3ONAB 5C3EG 3ONSA 2JA8H 4W9DA 3UDFA 2ZCBA 3QCAA 2VB3X 1K51A 2VB2X 3HOZB 2QC8A 3HOYB 3I9V1 4HEA1 3K5MA 2DHZA 1ZE3D 3BVZA 1QOGA 1MVKA 1XX8A 2N7DA 2AL3A 2AWTA 5KYLA 2M1MA 2N55A 2CJNA 1BCPF 3RZDB 2NZ1D 2Y0SE 1IXRA 1G291 4A3BG 4Q0FA 3RLFA 1TKEA 3DUZA 3AE4B 1BXTA 1AFPA 4YWGG 1YNND 3VUXA 4CO7A 1PHJA 3ML9A 2IZVB 2KVMA 3TEZA 1K0RA 2L76A 2J0JA 4BKTA 3CKIB 3CP0A 5C3WA 3J80c 2D0OA 5JVH3 2N1VA 1Y56A 3SK6A 4JK1C 3TRZA 4IFDG 3VDZA 4L5SA 2Z0EB 4KX6B 2QKIC 3QIJA 1N63A 1IW7D 2RPQA 3I8ZA 2KD0A 3EFUA 2YU9B 4MJSB 3L16A 3E9HA 1B9RA 2K5HA 3EHVA 1SLJA 1J7BA 2FMCA 2E6XA 3NS8A 4M8AA 4QUFA 1KLGD 2KVZA 2MEKA 1HZCA 3Q3JA 2L8JA 3VR4A 5KHQA 1EYGA 1SXTA 3ND8A 5FJ8H 2JYOA 4CDCC 3GTJB 2LUMA 4EFOA 4LJOB 1P16A 5E1FA 1T3QA 2CKHB 4G7OC 1MFWA 2D07B 3WIMA 2WAQB 1LM8B 2QGQA 4ABNA 1RHPA 2L55A 2ZCCA 4WURA 5AZGA 3AEVA 3AEFB 1QF6A 3SHLA 2OF1A 1BCPC 1Z6HA 3Q8EA 3GTKB 4M1UB 1HNWL 1NBWA 1D7QA 4L23A 2JVCA 4WORA 4XDDA 3X0WA 3NXWA 1YQ3B 3L10B 2WXMA 5LLIA 4IUUA 4J8QA 1ILPA 1WGDA 3J81E 1L6VA 2WLBA 5AFWA 5ELNA 4LF8Q 5GROA 2O2VA 3P2BA 1TJEA 3TIXA 5LXHA 1I4PA 4URKA 2O4XA 3ML8A 4WAFA 5D14A 2HQEA 4IPHA 1L4ZB 4NP5A 3G7LA 1QOAA 1L0WA 4EGVA 2INCC 3AFQA 3I70A 3BWUD 3TL5A 1Q7YC 3CMMB 3BG3A 3FILA 3U8ZA 4II2B 4KIKB 1IP9A 4WQOB 5EKIA 4A3CH 3UINB 3MZ5A 4GGQA 4LFCQ 2ON8A 1Y1WB 1HZ5A 3AM9A 1IBKQ 2G3QB 4KSKC 2WP9B 3AE3B 4LJZC 4KJOA 4PZ8A 2JSVX 2KX0A 1WZ3A 3MC9A 5KEEA 3HOUG 4NXNQ 1NI3A 4A6QA 4KMUC 1VQGA 5TSSA 4BXXH 5LMNW 4JBKA 3L08A 5EKLA 4GN3B 2Z0SA 2Z9HA 4AYBE 2UYZB 4G0NB 1M1KC 2D3AA 2IGDA 1L2NA 4LF9L 1XT9B 1J19A 4HPLB 2HJ8A 1UE1A 2F0KA 3FC4A 1K28A 5LMNQ 5ELOA 1RD9D 4MNOA 1MSGA 4GLXA 2XN9C 4DHJD 1R4NI 5EQ0A 2R92G 5FLMH 2CHBD 2KJRA 2BBCA 1SE8A 1QG7A 1EUJA 3P4SB 1JC7A 4M8NA 1L1OB 1SAPA 2GBRA 3VRAB 1BNZA 3VUWA 3ICEA 1EM7A 4IUNA 1GHKA 4C3JB 2Q2IA 1YITA 1LQBA 3ZYYX 3CSFA 1H9JA 2KQ7A 2KOXA 2E2HB 3IRBA 4A8XC 2WQYB 1S5ED 2CW0D 2D2QA 2WYQA 4FXDA 4U673 5DM63 3ZRFA 1AW7A 2WIIB 4W9HA 5D94A 2LEKA 3K6OA 4FNFA 1PDQA 3KBGA 3T13A 1PH4A 5AUKA 2K04A 1HTQA 4AUQC 1UE7A 3W5VB 1EEID 2I2YA 4K8IA 3A1QB 3N1ZC 4YCUA 2KHJA 1TYGB 4GXBA 4K0KL 1R4MB 2RD0A 3DXJC 2E5LL 4USAA 4XZ4A 3DMUA 2WNMA 1PV4A 4QCLA 3LWUA 1YHAA 3MXUA 3AE9B 5IYCH 4TQ0A 4LNNA 4ANVA 1KRHA 1NY4A 1FR3A 4CJ1B 4PMBA 1PH3A 1E2ZA 4WJWA 1RKNA 2MGSA 3PLUA 1TR5A 2C5LC 1LM0A 2WX0A 4IJLA 4JWSC 4D2KA 3TQYA 4A3GB 3S1NB 2RPVA 1RCVD 2H4OA 2B76B 2YTVA 4L1BA 5I2XA 1G2SA 3DWMA 4YTMB 1SJED 4DXFA 4ANWA 1EY5A 3HP3A 2FUG1 3FILB 1F9PA 2KDBA 2IW3A 1SYGA 3D6CA 1KHIA 2KHWB 1CHPD 1Q46A 2J0MA 3I4OA 1TWCH 4IFDJ 4NJCA 3OW7A 4UHVA 3Q6SA 2F0OA 4DV5Q 2P5ZX 4LNKA 1V43A 2FHTA 1WYWB 3TBLD 2PNRC 4W9EA 4US9A 3HEJA 2RCFA 1EY0A 1M90C 3TEXA 1HZ6A 4ZHPA 4X3UA 5EPJA 3NS1A 2A8VA 3RNAC 3LYYA 5EE3A 1WYGA 1SNQA 3F2CA 1G91A 2RF4A 2F0LA 1QE6A 4CDDC 2Z59B 3HVDA 4IALA 3IBEA 3OJ3A 4DV2L 3GD7A 2RSUA 4IUVA 1VQHA 2O6VB 2NPTA 4LW1A 3SFDB 1X32A 2MRPA 2JU6X 2BKFA 2B2WA 2KHIA 3PRPB 1X3QA 4JE3B 1KOTA 1E8ZA 2AQ2B 1SEBD 5IP9G 2B2YA 2MBBB 1WE6A 2KFKA 1Y1VG 5DEHA 1SFOB 1KFYB 2W54A 1HQRD 2K5WA 1WIAA 1HFNA 2KEDA 4KKSA 1U9RA 4N8FA 3S2HB 3TMPB 4RG1A 3ZJVA 1L1OC 2KZRA 3CMEA 4PNYA 2GBJA 1C48A 3C3LA 3DQVA 2ZXPA 1ISNA 5CX3A 5C5LA 3L17A 3ND9A 1FEHA 2A1AA 2Z0DB 4EQNA 4X64L 1B1ZA 1TU2B 4GOPC 2L15A 4MM3A 5ELCA 3BS1A 2WDTB 1MKHA 1LTAD 3CPFA 4NJ6A 5AJ3L 2DAFA 3SK8A 4DV4Q 4K3BA 3H6MA 2LSSA 4YWMA 3M4YA 2EKEC 5E6OA 2DWQA 2UXBL 2X69A 3QWZB 4FJVB 1R4QB 2L00B 3EFXD 2WXKA 4A3JH 4JGHB 2HTHA 2LRWA 3A9KA 1R4PB 2DENB 1XLNA 2V1CC 1VMPA 4KKTA 4M02A 2VUMB 2Y5PA 2K3UA 3K9OB 1AE3A 4ZCKA 3V96A 1N8RC 3IXSA 3VTUA 2V0GA 2C5CA 1EL0A 5E3FA 1QUQA 3OTOL 3L4PA 3VTWA 3HIZA 3J7AF 1U4LA 4IUQA 4ANXA 3T3NA 2LD9A 3VYTA 1KIXA 1G6JA 1SMXA 2RHQB 1CUKA 4DV3L 3FMCA 1QILA 4RMFA 1XXGA 3FRPB 3NHEB 1DOIA 3J80L 3P63A 2WGSA 3RZFA 5K5PA 4ANUA 4X6AH 4HWIB 4A3DB 4CKEA 2AUKA 3C1FA 1F2MA 2ICIA 1NYQA 1KJTA 1WM3A 2GI9A 3PZDA 2KTFA 1D6EC 3NHHA 3PUWA 2WXQA 3C8YA 4KKJA 2WXFA 2EY2A 1I4XA 1JB7A 3T4AC 1XMOL 4K0KQ 3UDIA 2JA5G 5KHOA 4CHKA 4F87A 3HRZC 3PO3G 2NPTB 5LNK1 4WRDA 4L5TA 3I91A 2NYZD 4A3PA 2ASQA 4K81A 1C79A 5HFYA 1D1KA 4M8MA 4KHPL 4LDTB 4CDEC 3PS6A 4WWNA 2UUAQ 3DVGY 3CQZB 3QK0A 5G2NA 1W2BA 3FKIB 3D4RA 3F1ZA 4JI2L 1ZKHA 3S16B 2KFKB 4XGAB 4F8CB 4XYOA 1PTOC 1VCBA 1PGBA 1MI0A 3T1YL 1X6OA 3JC66 4KKUA 2R6GA 2YTXA 4BA2I 1A6XA 1IZ6A 1VQFA 4CBVA 1V5TA 2YV5A 3V60A 2KA7A 3P42A 2TSSA 3ZIMA 4DK5A 1MJCA 2QMTA 1PH1A 2V3SA 4GLSC 2VNUD 4MM3B 5IGCA 1K50A 4L2YA 1JOKA 3PSIA 1VD2A 4JW0A 4TVAB 4UP8A 2K0PA 3IHPC 2VXWA 3C2PA 3OSOA 5J3BA 2F0IA 5IIFA 4B3SL 2WXPA 1C3TA 1L5PA 1JORA 2ZW0A 4A55A 4K5XA 4C2MB 3AE6B 4ZRQA 2PW5A 2RSOA 3A9KB 1YJJA 3J7A5 5JJLA 1I6HB 4R3DA 2RDHA 2KNBA 3K57A 3I4MH 4JBMA 1FO4A 4LTUA 4AS1A 2NN6G 4A3MB 4RGMA 2PPBC 3GTKH 2IDYA 3E56A 1EIFA 1QB5D 5C1ZA 3MHBA 3I3CA 2UUBL 1EU4A 3FAHA 1EU3A 3PVLA 4W9FA 2MFIA 2K33A 4ME5A 4XT1B 2MHJA 5D2MB 2N7EA 2JXTA 2QJLA 3O65B 3U4EG 1I42A 3KUDB 1VQ5A 2BYFA 4A90A 2L32A 4FF2A 1JALA 4DBGA 1I4HA 1RODA 1YBYA 4GDLA 4BY1G 3SFEB 3HGBA 4WJ3M 1O7IA 4K7WA 5KNDA 4X62L 3DCGA 4WAAA 3A5ZB 3OOCA 4EUTA 2K5PA 4C3HH 3RR5A 4JWUC 1C4PA 4LF5L 4LK0M 1IBXA 1PVOA 3VTVA 2IL8A 4YY3L 2KKCA 3M7GA 1WFYA 2KENA 2K52A 4KN4C 2MJDA 4JI5L 4B9KA 3ZXRA 1Y1WH 3JAME 1E7ZA 3IAM1 2H89B 1KNEA 1I4QA 5ELFA 1YN5A 1PFNA 2I38A 4GNXA 3I4NH 1TS2A 3QOLA 4DV7L 1EWYC 1JB3A 4M0WB 3U4ZA 3IVFA 4ZRIA 5T8IA 2WU2B 1K8MA 2ZTCA 3LGJA 1SNDA 1MGSA 3ERQA 3BDCA 3S1QH 2D5DA 2X38A 2K5VA 5JEAG 2UXCQ 2E74C 4YCVA 1HH2P 4Y7NB 5M5XB 4DR7L 1N32L 4A3EB 4V0BA 3RLOA 1E22A 3MXNB 1YZ6A 3Q8AA 2KDFB 2JRHA 3BDOA 2K50A 4XYQA 4MHEA 3D4WA 1DXMA 3KH0A 2JYEA 2VZKB 4OZAA 2MQJA 3NQTA 3CCRA 4K7SA 2E2HH 3RYTA 1L7YA 4RGTA 1S3SG 2IO2B 2IX0A 2MBEA 3N3KB 1DZ1A 1ONLA 4KTAA 1JT8A 2DNCA 3CXCA 4EQPA 3PGEA 4RCOA 2LMCB 1K8OA 2EYOA 3E6ZX 1HTLD 2KEEA 3UIPB 5EE9A 3QHTA 4ZKBB 1EFWA 5EPKA 1ET6A 1LT4D 1YIWA 2BQQA 2XGTA 5IYBG 1I7HA 1TY0A 4HJ9A 2JZZA 2VH2A 1PGXA 4KHPQ 1YNTE 4NB3A 1YX6B 2F0MA 2H1EA 1VF5C 2BB6A 4JVZA 4A4IA 1MG4A 4H0LC 2Q8TA 4J1MA 4JI2Q 3VR5A 1N5XA 2FIFA 4FHKA 4NXML 2B3GA 2OWOA 1E8WA 4A3BH 2EELA 4FF3A 2HD5B 5BR8Q 1DGSA 2XEWA 3NZUA 2W82A 4GDLB 2PZWA 2AQ1B 3A0JA 3K8AA 4JV5L 1EWIA 4A3KG 4MZ9A 1SNMA 4IFDH 1EO6A 1IBXB 3WAMA 1IHZA 2K14A 1K8AC 1J8CA 1WYDA 2XWBB 4BOSC 1QT9A 1CZGA 4HSVA 3K0XA 2RMMA 1FJGL 2ZTEA 1TWAH 2CQOA 2NBFA 4B3SQ 4R9WA 1F9JA 1SRUA 4OVUA 2ZM6L 2CJOA 2L0TA 4IOAA 4WJPA 1J7AA 4GNXB 2N49A 4PV1C 4U68A 1NBFC 2ZPYA 3AXCA 2ZJDA 3MEHA 4DUZL 2K9XA 5I9PA 1WR1A 3W5UB 3SVMA 1HNXL 1HR0W 5FKAC 2FMMA 3BJUA 2IO3B 4WWOA 4QIWB 3ZQ4A 3D32A 4Q2JA 5ELBA 2GLSA 1LYLA 1T0QC 3VFKA 3K58A 2WKDA 1A15A 2N7JA 3PLVA 4HCPB 2IBIB 3QO2A 2HD3A 5F2DA 5C44G 2INPE 1PTOH 4A3FB 5EPLA 2LVQA 2UXDL 1JE4A 5DNFA 1SMYD 2CVRA 2QDLA 1L0VB 5IGGA 3DVNU 1GUSA 3PPAA 2NVYB 2A69D 3ETRA 3DVGX 2EVBA 2ASBA 3S2HH 1F9QA 2K28A 3CC7A 2DZKA 4ZOHC 1V1QA 3X23A 1HE8A 2PQAA 4RF0A 1A0IA 2GB1A 1FD7D 4MGZE 3IKJA 2F4VQ 4JI7L 2NVQH 1ZOYB 3WCQA 1U4MA 1XNQQ 3M3YB 1TWHB 5G3LD 3PV1A 2BVCA 3HVZA 2XVSA 3NELA 3ZUNA 1PZKD 3K80C 5C4JH 3ALBA 2JZPA 1YJ1A 4IZ8A 2YEPB 4NPNA 1U5KA 2TMPA 5JPMC 3S14H 1GKHA 3M63B 2EY6A 1FFVA 3QA8A 5C4XB 1VQKA 1ZDXA 3V61A 1TWCB 1N5WA 1NEKB 4N8X1 1V6EA 1VRAB 2KT7A 4FLHA 4JOIC 1WRDB 2ZNVB 1ZXTA 3BIID 4CQNA 3HOUH 3MHSD 5CV4A 2ONQA 2KLGA 1MHHE 1YN4A 1HUMA 4FJYA 1JMCA 4DR7Q 5J18A 1AE2A 2CQAA 2G5DA 3WWVA 4IG7B 4WH4A 1WXAA 3M4PA 2PI2A 1IBLL 2NZHA 1PRTD 3QAQA 4P72A 5LMUL 2N3SA 3I55A 3VR9B 2R92H 2LGXA 1A5RA 1H9KA 4FDBA 3BDLA 4HCNB 5C3JB 3VR3A 1LTTD 5GADC 4A3LG 2NVTH 3AU4A 3LDZE 2F0QA 5D3DA 1OO9B 3MWYW 4JPBW 3P4PB 3QX1A 1VQPA 4A3OA 1VQDA 1XD3B 2JYTA 2PVOD 5EJWA 1Q10A 2AKWB 3OMCA 4K6LA 3S1RB 4A3DH 1WGYA 2N9PC 3B2GA 3M95A 4XT3B 2MNAA 4L5QA 1EY8A 2YEPF 3KQ4A 4RMAA 4YT0B 2H5XA 2K6DB 1KAAA 3M7NA 4X66Q 4NY0A 4AIMA 1GG3A 4LFAQ 2AEHA 1FM0D 1YIJA 1LGRA 1H9RA 5IAAC 3ZKJC 2GRIA 3S15H 3APDA 4DGZA 4MJSA 3UQBA 1BQQT 1BBWA 1JJ2A 3GTMH 4HR7B 4NXMQ 4BBRG 3K7UC 2ATWA 2KJXA 3QC8B 4W9GA 2K01A 2OQ0A 4P74A 3FPPA 4IM0A 5J17A 2N88A 2PMZB 3CQZH 1B9NA 4HIDA 1IBML 3G6EA 1EIYB 1VZ7A 2G1EA 2Q5WD 1BUVT 3DPDA 5D7GA 3KLRA 3STBD 4E3CA 2BCOA 5FR6A 4A3JB 2KWCA 1L0XB 1S4ZA 1DOLA 4JV5Q 2VH1A 2FNJB 4OXPA 3BZCA 1N33Q 3UF8A 3I90A 4XE0A 4AJYB 1P7FA 4HCSA 3PV0A 1C9OA 1Z7TA 2L1BA 4LJPB 4BBSG 2J4XA 2WINB 1XMQL 4NQKE 3MXPA 2F1MA 4F8MA 2M8SA 1CTMA 1EWHA 1R4MI 2ZM6Q 3CD6A 4MTNA 5GMVA 3UE0A 1S72A 2MP2B 2D62A 1WR6E 3RZOH 2O5JC 5G5GA 1GD7A 1EYAA 1OXTA 1OXXK 1SIFA 2KDIA 1MJEA 4DR1Q 2EYJA 1TWGH 5FK9C 1HNXQ 2L1AA 3IFWB 1II3A 3HOWG 1GJXA 4C2MH 3UDXA 2A4ZA 2OJWA 1SE4A 3T56B 3RNCC 2SEBD 1S5CD 2CKZB 3KWVA 3V6EB 2MUYA 1P9DU 2BKRB 3J81c 1M4VA 2IY1B 3Q8FA 2PE9A 4JI4L 4A3IG 3TEWA 4XQNA 3RUZA 3JSVA 3A56A 1B50A 4KIKA 4ZLTF 4A3MH 1UF0A 2ZNVC 3S1MH 2WXNA 2GVBA 3HKZB 4EX5A 3PUVA 1PXUA 2EJFC 2R7ZG 4IFDI 2UXDQ 1BVSA 2LVOA 2LGSA 4QIWE 1ACCA 2M17A 3N20C 4PMCA 1WJNA 3UIOB 2DYBA 5K36H 2GBMA 5IP9H 3RLNA 2F0TA 4LF4Q 1FL0A 2KCTA 5L37A 2WWZA 5BN3A 2WXRA 5BMIA 3I3TB 4B9WA 1MIUA 3I2ZA 1T0YA 5DM73 3K5LA 1K9MC 1V49A 1X65A 3U9OA 2UWQA 4LAAA 4PG3A 3RNEC 3ZGZA 1ICWA 1CK1A 2F0SA 2B29A 2PNHA 1R9TH 3SXHA 4KGTA 4TKNA 1L1OA 5HG2A 4AWJA 1XLQA 4ALPA 1NMGA 1YJWA 3LNNA 2AX5A 1LFDA 3KYCD 3GE8C 3W1YA 3H7PB 2C9WB 1UH6A 3ULPA 3CHBD 3SK5A 3PRZA 4GOPA 1C77A 2KUMA 1EOVA 2VL6A 2NWGA 2CU3A 1T6BX 1I50H 1NTGA 3NY5A 4OZBA 1CI3M 4BKSD 4P6VF 3L2PA 2B63B 3KF6A 2G4SA 3ZJTA 3ZRCA 1ESFA 3J7AV 3U7DA 2HHHL 1UZXB 5M5XH 4Y7NH 3IFTA 4G11A 1FD6A 4A3EH 5CV8A 4MSQB 3RMKC 3TS0A 4WWPA 4GKKL 3IT4B 4DV0L 4G57A 3BZKA 1PH9A 3QG1A 3A4RA 1FGUA 1B4OA 1PLFA 1KQSA 3I4MB 3A1QA 1CSPA 2AWNA 1Q1OA 1O80A 4K2LA 3EECA 1B3AA 2JF5A 3O13A 1E24A 1RYJA 4R4OA 3CF5A 5CBEE 5FR3A 1OXUA 4GIVA 3Q0AA 2D2CC 2X6GA 1VF7A 4P75A 1MJDA 3Q8BA 3CCQA 1S5DD 2QSDA 2Z4HA 1KH0A 1TIFA 5M3MG 1Q0WB 3H09A 4O1NA 2DY7A 1OXSC 2K5DA 4YHHL 2JA6G 1P7EA 4C3HB 3R8BA 3OWFA 4DR4L 4DAVA 3JSVB 2DNFA 3ULJA 3NOBA 1YJ9A 4KVGB 3CU7A 2R61A 2XK5B 3I5JC 1RJTA 4C3IB 4LNQA 1IPGA 2ENBA 3KBXA 2JA5H 2JXXA 3GV6A 3PO3H 1YNNC 4R1JA 1JQYD 2MSED 1BBUA 5M5WH 3R7QA 2UU9L 1FNWA 1WJUA 1AP0A 3I4NB 4XTCS 4K3CA 2XSCA 3H0GG 1WTXA 2Y5CA 1WCMG 2VRRB 4OL7A 4W9LA 3W1BA 3RNFC 1JMLA 1CKNB 2JUOA 1A3TA 4QGUA 2DX5B 2CFMA 2E2IB 2Q8IB 3GQBA 4IOCA 1JOQA 4P71A 1YHBA 2H88B 1XMQQ 2LI5A 2PMZE 1IL2A 3S1QB 1IW7C 1F2RC 2O6VA 2YTYA 2OEDA 5CHVC 1TS3A 2K8CA 1Q3LA 2OEOA 4W9CA 1C8CA 3FVQA 2XRSD 3J81i 4H13C 3I63C 2ZVNA 4L5RC 3DBLI 3QWNA 3WAOA 1P0RA 1GVPA 1C78A 5IE8A 4DK1A 2PZUA 4R8NA 1AARA 1XCTL 4TQUS 1E2VA 1F9SA 4B3TL 1JICA 2SNSA 2KQ3A 5C0XJ 2YVCA 4EZKA 2HIVA 1Q1BA 4NQLB 3HKSA 2L83A 4JI4Q 2JA7G 5IWAL 2KECA 4GOPB 4IWPA 3L7ZC 2WX1A 1OTCA 1VQNA 3PO2G 2PVGC 4YSZB 3KF6B 1ZYRD 2CHXA 4XC2A 3KYHC 3GO5A 4F88A 1OQYA 1QQRA 4KDIC 3AECB 2F0GA 2JT4B 1LT5D 4ZRZA 2J42A 1EEFD 3RPFC 1D5MC 2E2DC 5I6WA 2MWSB 2R2QA 3KJPA 4KZCA 1PQSA 4A3FH 3QR8A 2NN6H 5C3EB 1ENCA 1CFMA 4MTKA 5M3FG 1AN8A 3DWPA 1C4CA 1CMXB 3E0JA 2JRIB 3J80i 1RIPA 2NVYH 3OIPA 4PK1A 4N58A 3IFDA 3E3XA 2ZT9C 3EFCA 1KRSA 1QJOA 1GUAB 2DYMA 1PFMA 2PI2E 3HKZE 3H3VC 3VXWA 4DR2L 4DN4M 2EMTA 2UUCL 4HSPA 4ILWA 4A3BB 2KYWA 4TMAB 4YSXB 5CMDA 3M3YH 3NZSA 1TWHH 5A2QL 2C60A 1I4GA 4ARCA 4TUUA 1SSOA 1WTVA 1SYCA 1NENB 4RM9A 2G9DA 1NNXA 2F52A 1V5OA 3NWTA 4CKBA 2R3ZA 2RR9A 3A8KE 4PYZA 4X3SA 1OEYJ 4A76A 3TS2A 5C4XH 4NDXA 1W6JA 3CCUA 5G55A 2EYPA 1HEZE 1GPXA 2L52A 3ITPA 5FO9B 2JEAI 5T1IA 1TWAB 1KXLA 1S40A 2PJHA 3U52E 5LHY1 1AYFA 2LVPA 5CGKA 2HHHQ 3RD2A 2JP1A 1UBIA 4MH0E 4GKKQ 4DV0Q 2CR5A 4POGA 3W5OA 1LT3D 3EC8A 4JBJA 5JEAH 5I4DA 3RUIB 1QVFA 4RKLA 4OX9L 1NVID 1HNWQ 1YNJD 5EBCA 2Q2UA 4JLCA 5BYSA 1F0ZA 5IGDA 1V86A 2WU5B 4X57B 4EKUA 2BTEA 4LF6L 1SB3C 1ICFB 4PS8A 2WAQE 1RLFA 1PTOB 3CWIA 1FXAA 3G4SA 4RCNA 3ZJYC 1STHA 2CW0C 4R8IA 3S1RH 2Y3AA 1PYSB 3JW0X 2EJGC 3S24A 3CRLC 1AZPA 3T8MA 4YHHQ 4FHJA 1XYIA 1Z5SB 1EIGA 2JA8G 4OELB 2WXGA 2Y5BB 2QILA 3VAWA 4XWWA 2E76C 2IO1B 4AP4C 1EYDA 2NVQB 3SR1A 4KKIA 2NBUA 5M3MB 3FDTA 4DKAC 3K5OA 3LX0A 1X56A 1DOMA 1LTLA 5IYBH 3IL8A 1WD0A 1WJ6A 3SD5A 5IA7A 3DWGC 3CAMA 5C4JB 4JI0L 2GBKA 3R66C 2UU9Q 2D9UA 4A93G 4DDID 3J81L 3S14B 2KFJA 2QCZA 3DLLA 3GTPH 1VQJA 3MJ5A 2NZOA 3FEWX 3NTHA 3ZNHB 5EAYA 4LF9Q 3BYTB 2J52A 2XIWA 2MPMA 2V3NA 3A7LA 3HOUB 2M2LA 2RHSB 3WA0A 3TSSA 3G6JB 3HS0C 3CPWA 3VQIA 1PH8A 1J5EL 2G4DB 1E10A 3HM6X 1PTOF 2XBBC 4X3KA 1B44D 2WACA 1J8IA 4B3RL 3CCEA 4A3KH 2K5NA 3GTQB 4FXGC 1D1IA 4J6HA 4FN2A 4N9TA 1E8YA 4YCWA 2A6ED 1ZP0B 3EQLC 2EY1A 2RVLA 1C76A 2R92B 4ZRKA 1V9PA 1PMRA 4A9AA 4NKLA 2NVTB 2WXJA 1FNVA 2KCCA 1HRJA 3UE1A 1VQEA 4LNIA 3WDNA 4H2AA 4QJFA 1FGBD 3SDZA 4WJNA 4FADA 1EUVB 4MEMA 4WJQA 1EWCA 1HQMC 3ZTCA 1CA5A 2WB1G 1ASZA 4HAEA 5FLXE 3B08A 3TBIB 3MC0B 1QLBB 4DAYA 1VQ6A 5AZHA 1DOXA 5JHAA 4HRSA 2QEXA 4E71A 1PA6A 4IUPA 5IGEA 3JYUA 5IT9c 1EQRA 2F03A 2E5LQ 5E6PA 2CH4W 3S15B 4DUYL 2HUGA 3DBLB 4CHTB 1MHXA 3HOXG 3NP8A 3GTMB 1KDCA 1SIJA 4DR2Q 3IT6B 4M00A 4HMJA 3JAMc 4M0WA 2OJRA 4GKJL 4A75A 1CM9A 2LJIA 2MQHA 5CTRC 1JRUA 1WE7A 4ITKA 1ENFA 1MBYA 4DPGA 3DBHI 1J0GA 2M19A 1FCLA 4HJ5A 3VVWB 2F0NA 3MVVA 1NAPA 4JI6L 1U4AA 1WFQA 3LB8C 3MXNA 2A5HA 4A3CG 4XDCA 1ZPSA 3OYYA 4HPPA 1YJNA 2KN4A 3HM3A 4TRDA 2ZJPA 3J81j 2ACZB 3NVYA 4ZRJA 1UWMA 4QF4A 3C46A 5AUIA 1ZUD2 3VR2A 3F8TA 4HDOA 4OWXB 1SGHA 3R7RA 1MHWC 1XLOA 5KGUA 2BS4B 3RZOB 1HZAA 2X8XX 1GAQB 1VQCA 2B63H 2DBYA 2A6HD 2LMCA 2NS5A 1TWGB 4OEMB 5E4WC 4DV2Q 1SF0A 3A9JA 1TGZB 3N9YC 2L12A 1WY8A 4OX9Q 3BYYB 3I72A 4TSSA 3LXFA 2MJ8A 1JROA 3ZNID 4CJ2C 2JSOA 4JOIA 4IJHA 4DV6L 3RNUA 1VR9A 3H3VH 1O7YA 3U9SA 4YTNB 1E90A 4LF6Q 2LXKA 3ZDMC 1DYQA 3NSWA 4C1NI 3S1MB 1JWAD 4E6IA 4I6PA 1VDZA 4ZHOA 4A3LH 2ZJRA 1BR9A 3ZJUA 1HHVA 3HRDD 3ZTDA 4JYAL 4RKBA 2J53A 1GNUA 1XPRA 1ET9A 3SE0A 3IG3A 4DK6C 1H9SA 2Y0SG 2MW5A 1Y1VB 4KN7C 2JWUA 2WV6D 4ZUJA 3WANA 4X3TA 2ZJQA 4X64Q 1S1QB 2R93G 4OVZA 1XQQA 4JI0Q 3P20A 4DAYB 5AJ3Q 2E75C 3KFUA 4C3IH 3RI7C 4ASWC 3L0WB 1Y8RC 2IPKD 3DWAA 1DOKA 1WX7A 2UXBQ 1R9TB 3B6YA 2ID0A 4C00A 5GXGB 1LTGD 3A7AB 4JCVE 2DN8A 4BBRH 4AQYL 2MCNB 2F3IA 1V8QA 1PFDA 2E3TA 4HJGE 4RM8A 5FO8B 3A33B 4LWCA 1PFSA 3VA5A 5IP7H 3FP9A 3NJTA 3RCZA 4RWSC 3H7SA 5J2RA 1TIID 4KI0A 4JI8L 2FXQA 1UGMA 1I50B 4LUVA 2E2IH 4UAIA 3OTOQ 1IYFA 1S5FD 2FINB 4CDFC 3DOWA 3P4RB 1RFAA 3DBRI 2D11A 2IO0B 3CCMA 4FXCA 1SYEA 1IYJB 4JI3L 4DV3Q 4X65L 4BBSH 4OO1G 3D0FA 3DHIC 2CH4A 4QUCA 3H8HA 3OAWA 3PIOA 1CKOA 5C0XH 1WGKA 1ENAA 1IYUA 3D8GA 1HJPA 1PFBA 1HZ9A 3S17B 5H1SE 4J6IA 4OGQC 3IAYA 2QIEB 4NW2A 1XCQL 4N6EB 3GV3A 3HOWH 5CHWA 2WXIA 1TT5B 5BN5A 1WSPA 1KLUD 3A9JB 2BA1A 1Y8OB 1XMOQ 2L11A 2B8FA 2PCFB 2DUDA 1HFGA 4PQXA 3MEFA 5C3EH 4LF7L 4HJ7A 2R7ZH 2BYVE 4GKJQ 5COYA 2CHWA 1TXYA 2K05A 3OG5A 2JA5B 2CHZA 1VQLA 3EGRA 1KNAA 2WHIA 3R2IA 3PO3B 3W1GA 3AH7A 3LJ3A 4MGYE 1YD8U 1N34L 2AUJD 5M5WB 4GS3A 4GU2A 2QDFA 4IKGA 5FOBB 2WXHA 3T1YQ 2KDMA 3SR6A 3JVZX 4GN1A 4MT5A 4KJNA 1H9SB 1QNUA 2LXJA 4BY7G 4IWQA 3A54A 2VS1A 5JAVA 2K6AA 3VHTC 4FO2A 2CCZA 2N4FA 4AYBG 3MAQA 2NUCA 4G4KA 4NPSA 2N1WA 1ASYA 3NRZA 3QJZA 1B53A 3Q24A 5LXIB 1GXDC 1JW9D 1E8XA 1VQAA 3H91A 4IO9A 4K2KA 4YIJA 2LRUA 4OZCA 3T9LA 1QNKA 5JXVA 4DNRB 2WS3B 3E0EA 5NUCA 1ML0D 4K6DA 3TP6A 1AH9A 4HPMB 1F2RI 2A68D 1V9JA 2N9KA 2ZXOA 4PZ7A 4XXEA 3TUOA 3KLSX 3N1YC 4OONA 4HJ8A 4Y52H 1LLRD 2DNEA 3DBHB 4KSLC 2IY5B 4DR5L 3TP8A 2OHFA 1HNZL 1VZ8A 4DR3L 1RWSA 2UUBQ 1N36L 1P1AA 4P16A 4MN3A 1WRIA 2EDGA 3SK4A 1S3OA 1FYCA 1TKWB 2KX3A 3DM3A 4IPGA 1T9HA 1KL9A 3KYDD 1XPUA 1E2WA 1K0SA 1EOTA 1ESRA 1AEXA 3NTKA 1F1HA 2KTRB 3RFZB 2GOWA 4X62Q 4F1SA 2F0WA 4IUTA 1ZXIA 3AEBB 2JWZA 1C1YB 2F0HA 2M0AA 2JZ3B 2I46A 4LF5Q 4EOYA 2N8NA 3H15A 1BUIC 5EKKA 3HOZG 2K25A 3HOYG 1QOFA 3M9BA 4YY3Q 2LWPA 3PHXB 2WDVB 1UEAB 4LDTD 3VYSA 5CHFA 4BY1B 1HXYD 3CCLA 5M3MH 4JI5Q 4DDGD 4B3ML 3H3VI 1YHQA 2BGFA 3ZDTA 3AEEB 1C7YA 4FF1A 1UBQA 2K75A 2N9EB 5JOBA 5GAEC 1YJIA 2DAJA 2MP2A 4F7ZA 4DV7Q 3N32A 4POFA 3GOEA 2MJ3A 3K7AB 3R2TA 4LFBL 2LGIA 4XQQA 1I4RA 4J15A 1B9MA 4DF7A 2F0PA 1CZWA 1Q8KA 4JI8Q 1OTRB 5KNCA 2OTLA 1A2UA 1D5XC 3H0GH 2ZTDA 1K52A 1WCMH 2AMCB 5IT9L 1N32Q 1WXSA 5AEKB 3TP7A 2Q2HA 5G3LF 4JI3Q 4II3B 4KY5A 2FBWB 1N6ZA 2BH8A 3GTQH 3AU7A 3NE5B 1FPYA 1VDVA 3JAML 3PIO3 5KRUA 5FO7B 2KMAA 3TDQA 3DVNV 1P8LA 1PDXA 5JEAJ 3KUPA 1NDDA 3Q3NC 1VQMA 1QOHA 3RN5A 4JQWC 3PZ8A 4FA6A 3TMEA 1GC6A 2PMVA 3M3JA 4IM3A 3WOFA 3P1HA 3CCJA 1I94L 2EXZA 4KV6A 4MGIE 3MHZA 4KZ0A 3V6CB 3E9IA 2JA7H 2NVXH 4ME3A 5D65A 3ZLZA 1J9OA 1WGRA 3CCSA 3MFYA 4LNFA 3A8IE 2PLPA 4ID6A 3PO2H 2CU1A 2BE5D 4BKSA 4LF7Q 1NYRA 1LUZA 1E7VA 3GZNB 4ZRPA 4L8JA 3J7YW 4JBWA 3DBRB 2RBMA 4BKGA 1Q82C 3EJIA 3RN9C 1E3PA 1SMYC 4IN3A 2KC1A 1GOZA 2NTSA 1X9NA 2A69C 3AMZA 5M3FH 3NZ3A 4G3XB 4MACA 5JJIA 5C0XI 1N34Q 3BY4B 3H7PA 3WALA 1QCBD 3W2DA 1STNA 3H6NA 3TN2A 5C5MA 2V4DA 1OQQA 1EZ8A 5ISRA 3W9CB 3GTPB 5CC4A 3Q6BA 2WDQB 4DQOC 4LF8L 1SE3A 3GTLH 3D3RA 2EKIA 2DZMA 1TQOA 4DXGA 1RM6C 2IT1A 2OXPA 1Y1WG 3Q3FA 1C4AA 1VQIA 3OW2A 2DLBA 4I7AA 4HROA 1FJGQ 3E9SA 1HZBA 4A3KB 4I6LB 4MGKE 4O42A 2D3GA 5EE1A 3TREA 3QARA 1C4QA 1XTDA 3T16A 1LV9A 1WTOA 1PH6A 3PF4A 5CYUA 4DUZQ 1ZDVA 4N9F4 1F2ZA 4TKOB 1F9RA 2Z6KC 3H9DA 1FMAD 4DR5Q 5DLQE 4DR3Q 1WOCA 3L13A 4KLKA 1N61A 4KY6A 1PRTC 1SDFA 3TCAA 1R7SA 5IOCA 1RTOA 4B95A 1LTRD 4DWFA 2V1YA 3VR8B 4K7UA 2XK5A 2K32A 5LMNL 2ZW1A 5DPRA 2GVAA 4C3JG 4ZYNA 1EZ6A 3PMFA 4S0RA 1OFFA 3SHQA 5C6AA 4OHJA 2PW7A 4UP7A 3OWEB 1NJIC 2KDEB 5D6JB 1BCPD 2MP1A 3NBHB 5HGTA 3M4QA 5GQOA 5BN4A 5C44B 3T1HL 2IX1A 1V81A 4R4CA 5DPWA 4AJWA 1CKNA 5E6NA 2BH2A 1Y1VH 3V05A 1DM0B 2RA4A 2SOBA 3EBEA 4JI7Q 2W55A 2WDRB 3K0YA 1JJGA 1SSNA 3BK2A 4IDIA 3QIAA 4B3MQ 1BOSA 4MSMB 2BDNA 3AYHB 2EPBA 2BDOA 4RFBA 1YEZA 5A2QE 3A8JE 1BO0A 1GM5A 3VYUA 4WFN3 1RRBA 3N30A 2BA0A 1VQ9A 3VYRA 4OW0A 2K1BA 1ZGUB 3T51B 3AU5A 3HHMA 1WJJA 2KVRA 2E8GA 3CIRB 1O78A 2FJ2A 2ZPNA 4LFBQ 2LFNA 4HTHA 2JEBI 3OHXC 3ZO5B 3L0OA 1GB1A 2BB5A 2XRQD 4Z9CB 5IYDG 3GB1A 2HCCA 2HQLA 5GAHC 3STBC 3PHWB 2F0FA 1TVXA 1I3QB 4A93H 2HDEA 3A4SC 4I7ZC 5KYIA 4JL9A 4XQJA 1QZGA 4A3GG 2F0JA 1A70A 3W1SA 1T0RC 1G8ZD 2DGYA 1NSNS 2IHFA 1K53A 1XLPA 3PREA 3TEYA 4QMGA 1MSHA 1K3RA 1WTHA 2N78A 5JVG3 1IBLQ 3P75A 3DHGC 1N60A 4P1BC 4PT5A 4HDQA 5LMUQ 4RA8A 3PGZA 2QW7A 3Q8CA 3ECIA 2VQFL 2BW2A 4P2CB 1VQ8A 1RTNA 2EYMA 4HKQA 1RF2D 3EN2A 4MDKE 1SYBA 1X3FA 3OMGA 4S17A 5BMHA 1GJZA 2R7FA 1QZHA 4FYDA 2FCMA 4KGRA 4P1CC 2AHOB 3S17H 3CCVA 4DK3C 1Y14B 4DFAA 1MI2A 1ROEA 1E1OA 2F4IA 1I94Q 4DV5L 2K03A 2LJ5A 3BU2A 3KOJA 3NPPA 1C9FA 2EYHA 1Q86C 1WXVA 4OVVA 2F0DA 3L9AX 1A8VA 4APVA 1WD1A 1STAA 3AE5B 1PYWD 2KACA 4HEDA 2DZIA 4QAYA 1VQ7A 1WH3A 1D5ZC 4RNAA 1PH5A 1Z47A 3HUIA 5EBDA 1OEYA 4YWKA 2IX3A 4H02A 2OCEA 4ZDVA 4CGYB 5IOIA 2WXOA 1WI0A 4IPDA 5IKCM 3PF5A 2LZ6A 1DONA 3PSEB 3ERSX 2BS3B 1PYBA 1EYCA 3NK9A 1NMFA 4YWLA 3BINA 2PIAA 1HPCA 2JQOA 3BVGA 5I2YA 1IBMQ 3AB9A 3NQIA 4DNIA 2LHDA 4EQ5A 4DHJB 4KHZA 5BMGA 2I5MX 3MTSA 5HGQA 3HOXH 1JOOA 1JWUD 3NTIA 4BBRB 4NAWA 4HIKA 3U2SC 3P4QB 5EDSA 4IURA 4DV1L 1BKBA 4YL8A 1ZKOA 4BWGB 1K8GA 4CYEA 2N0SB 5KNBA 4P73A 3GTOH 2MO1A 1G2TA 3GTGB 5CORA 2JX5A 2OQKA 2D10A 4HXDA 1LO5D 1CSQA 2NVUI 4DHZB 2A73B 2LFIA 1UEBA 3G48A 1WZ0A 2BYEA 4HK2A 2D0PA 2PW9A 2IY0B 1OQRA 2PO4A 4BBSB 1AWDA 4PS3A 3ER0A 3K59A 4DV4L 1V8CA 2VUMG 3KW5B 1DOYA 4DR6L 2EXDA 3KDFA 1XPOA 3J80E 3GDEA 4IC7B 4NAMA 4JC0A 3M4OB 5JHBA 2A74C 3FPUB 3EVQA 2C7NB 4XX5A 1DGJA 2L0FA 1TWFH 4E74A 2RCNA 1KF6B 4K5VA 5M5YH 4KHVA 3HOWB 1WX9A 1VZ6A 2B2TC 4IM2A 3I73A 2EMSA 4A3IB
chains in the Genus database with same CATH topology
2B8GA 4REZA 1CZPA 1EY6A 4DA2A 2R7ZB 1IKLA 1UNSA 2L4NA 2RQXA 1TKYA 2PZTA 1IGCA 1VMCA 4QB4A 1WXQA 1L0YB 2DY8A 3TZUA 1E7PB 5JPNC 3OPOA 2SDFA 1HA5A 5I6YA 4UDUC 3PUZA 1A3VA 1Y8PB 2WP8J 5ELDA 2M9VA 2EJMA 4LLGM 2HDLA 3PUYA 1SBBB 5G5HA 1EY4A 2KQ4X 1PUTA 3NBIA 2B2UA 1JWMD 3V2TA 5CV7A 1V1PA 4NAWB 2O2LD 1IYVA 2NTTA 4YTPB 1HTPA 3X3NA 1F2LA 4KD3A 2IJ0A 1WTPA 3X3MA 1LTBD 4XIGS 1FRDA 4CKCA 4DNTB 4YSYB 2B2VC 4OO1H 1QOBA 1N62A 2XWJB 1UUPA 5C2TB 1GUNA 3AEGB 1K83B 5IGFA 1BBXC 1ZYRC 4L6TB 4FP5D 1WWTA 4K14A 5LL6X 1Q8IA 4HMIA 2EY5A 3H94A 3URYA 4B0EA 1YMHE 4H7BA 2Z1CA 1ZXHA 2JA6B 1V1OA 4HN7A 1Q90A 1XEEA 5K36G 3I4LA 1NR4A 1JWSD 3ABVB 1YQ4B 3N6RA 1TS5A 1JR0D 1D2BA 5J22A 3HZXA 3MA2B 5HHDG 1O7ZA 5A35A 3AE8B 1FIQA 2FE8A 3H0GB 4FF4A 1WCMB 2I07B 4PMWA 1PTOD 5IGBA 4ZAIA 1STGA 5J1ZA 4K8JA 3EUB2 3EROA 3MFGA 1F77A 2EOTA 4NMZA 2ZXRA 3E5SA 1IUEA 1LTID 2KCNA 3AE7B 1ZEQX 3U7ZA 1STBA 4G7ZC 3K5NA 3S2DB 2J0TD 3R93A 1V1PB 4DAPA 3PZ7A 2JA7B 2K7VA 1YNJC 2NVXB 1GUGA 1E6EB 3KWLA 1CT1D 3PO2B 5BYQA 2BOSA 2HCIA 3Q22A 4GZYC 2F0UA 2SAKA 1LABA 3NUHB 1FNUA 4AQ7A 1WTRA 1DCZA 4JPSA 1BDOA 5M3FB 2KMMA 2J7ZA 1LT6D 1XO3A 3NUCA 1NCVA 3QOJA 4EE2A 2BS2B 2M00A 3DEPA 3DWQA 1WVLA 3GTLB 2BT6A 3R3OA 2HDMA 4ULLA 1E0BA 1TY2A 5CV6A 4YXDB 1X3PA 4J3OD 4EQOA 4WWMA 2NN6I 4KD4A 1BMLC 1QKZA 2WKCA 4I65A 5CR3A 2NMQA 1I6VC 3D31A 5CV9A 3VR6A 3D6WA 4DK0A 4H44C 4C1NK 2LY7A 2WXLA 4G7HC 1EQVA 1UGJA 2A6EC 3I57A 2RDFA 3HOVB 3A55A 4F7XA 2F3VA 2W3SA 5KIXA 3DHQA 1OXVA 1JCKB 2V4IB 2M56B 4RH6A 1A3UA 2HTME 1PZID 4RHRA 5E6JA 4DU9A 1WTWA 2MHVA 2JQRB 1KTKA 3M85A 4IOIE 3L3OC 4WIPA 2LKVA 3Q69A 3T3OA 2JA8B 1CA6A 2IGGA 1UWXA 4IQZA 1JQ4A 2B2UC 2DYOA 4OO1I 1XTCD 2AWOA 2BYTA 5C4ZA 2L0CA 4ZUIA 1TT2A 4EVOA 4A93B 4TQ1A 1E9MA 3AEDB 1XF5L 4L63B 3T53B 5I9OA 4V190 3AMUA 3D4DA 5IT9E 3WOEA 5CV5A 1SNPA 4Q5VA 3NVWA 4OIJA 3UI3A 4RGOS 1AZQA 2L5TA 1U4RA 4N59A 3B2FA 3AEAB 2V3PA 2A6HC 4CJ0B 2F0VA 3OIQA 3DM1A 1Q12A 3KLSA 1KDAA 1YN3A 2EYLA 1KABA 1LTSD 2B2WC 2JXMB 3NVVA 4BA1I 1NR2A 3V3XA 2G9HD 4C7ZA 4ZK9B 2PTLA 2B39A 2B2YC 2WB1B 4JX1C 4MIUA 1DJRD 5E4XA 1PGAA 2N9LA 3AE1B 2SNMA 5H8YE 3F2UA 1TZOA 3PO0A 4US8A 1O7LA 2PQEA 3AE2B 1SE2A 3EA6A 2MH7A 3HOXB 4LK1C 1VLBA 4C80A 3CRKC 4OIKA 5FLXL 1G6ZA 5EE0A 2AQ3B 1WTQA 2OT2A 2VZKD 4KGSA 5HI1A 3GTOB 2INNE 4HKZE 3NVZA 2EYFA 2D5GA 3KF8A 4XWTA 2RDGA 1DD2A 4ZYSA 3NWSA 1Y8NB 3MXGA 1MD2D 1L4DB 3AN1A 2QF7A 2K22A 5C3XA 1FXIA 1GB4A 1BF4A 1RFKA 2FFKB 4S3SA 1J7CA 3BVMA 2C9OA 1CHQD 2PKOA 1TWFB 1EY7A 5M5YB 2X6LA 5T1GA 5MPOA 1HUNA 1IL8A 2F3WA 3S9WA 3UI2A 2O5IC 1CJEA 4BS9A 1NUCA 3BK1A 3HG9A 4B08A 5C4HA 1QWYA 3SEBA 3BZDB 5ELEA 2KAJA 3B9JA 1SYFA 2Y0SB 3IAS1 1JWBD 2IGHA 4LMQD 2GA4B 1M8AA 3RD4A 1LACA 2IWHA 1GUOA 2R93B 5JJZA 1FRRA 5HURA 2KOLA 4FXKC 3N52A 1PRTB 2QDBA 1ILQA 5D3IB 1EIHA 5J39A 1U4PA 2YYZA 1HA6A 2LHEA 1SJHD 4RHSA 4RF1A 1CQVA 5M9OA 2QCPX 5IODA 1RDPD 1IKMA 1VJKA 4B9XA 1KDBA 3C1EA 5DAUA 4N9PA 1CQFA 3AB5A 2A68C 3P1MA 3NBHA 1FFUA 4GDKB 4ARIA 1S5BD 1T5EA 3DEOA 2JE6I 1TKGA 4RGNA 1FCCC 3LWEA 3TP5A 1PRTF 5CBAE 3P7JA 1Y69U 4ZKCB 1STYA 2PYKA 2K5QA 1VCIA 1D4BA 3GP7A 2W3RA 2RSNA 1SNOA 3J9CA 1GUWA 2QEJC 2B2TA 1B2TA 2Z4IA 1E0ZA 4C3HG 3VRBB 2E2JB 3AV8A 1PZJD 4RAUC 1EFID 4NZLB 3TZDA 4ZQ3A 4C3IG 1L6UA 1MPEA 4BY7B 1SYDA 4HCEA 1T5XD 3W3AA 4AYBB 4K5WA 2RKSA 1H9MA 3VA7A 4XDXA 1UAPA 5BYRA 2NB0A 2L9HA 3MP9A 2ICEC 5H92C 4B0MA 1W6KA 3PUXA 1BCPB 2EE1A 2EZVA 2Z8LA 4KK7A 2Q8RE 1JRPA 4C56C 2LS01 1EQTA 1HCZA 3PIP3 4KY7A 3RMHA 4ODGA 1TS4A 1STEA 3KK7A 1SNCA 4FVMA 2MJEA 5C0XG 3QJYA 1V97A 4WQMA 2KWDA 1XWEA 2KHSA 2XNAC 1GUTA 1Q1EA 3Q23A 2B2VA 1GHJA 2BE5C 2F0EA 3QB3A 1EY9A 4MH8A 1F2YA 5LL6S 1IGDA 5EGTA 1A2TA 3ONAB 2VB3X 1K51A 2VB2X 3HOZB 3I9V1 3HOYB 4HEA1 3K5MA 1ZE3D 3BVZA 1QOGA 1MVKA 1XX8A 5KYLA 2N55A 2CJNA 1BCPF 3RZDB 2NZ1D 1G291 1TKEA 4Q0FA 3RLFA 3AE4B 3DUZA 4YWGG 1BXTA 1AFPA 1YNND 2KVMA 3TEZA 3CKIB 5C3WA 5JVH3 1Y56A 3SK6A 4JK1C 4IFDG 4KX6B 2QKIC 1N63A 1IW7D 3I8ZA 2YU9B 1B9RA 1J7BA 2FMCA 2E6XA 4M8AA 4QUFA 1KLGD 2MEKA 3VR4A 1SXTA 3ND8A 3GTJB 2JYOA 2LUMA 5E1FA 1T3QA 4G7OC 2WAQB 4ABNA 1RHPA 2L55A 4WURA 3AEFB 1QF6A 3SHLA 2OF1A 1BCPC 1Z6HA 3Q8EA 3GTKB 4M1UB 4L23A 4XDDA 4WORA 3NXWA 1YQ3B 2WXMA 4IUUA 4J8QA 1ILPA 3J81E 1L6VA 2WLBA 5AFWA 1TJEA 1I4PA 2O4XA 4WAFA 5D14A 2HQEA 1L4ZB 4NP5A 3G7LA 1QOAA 4EGVA 3I70A 3BWUD 3FILA 3BG3A 5EKIA 3MZ5A 2ON8A 1Y1WB 1HZ5A 3AM9A 2WP9B 3AE3B 4LJZC 4KJOA 2JSVX 5KEEA 1NI3A 4A6QA 4KMUC 5TSSA 5EKLA 2IGDA 2F0KA 3FC4A 1RD9D 1MSGA 2XN9C 5EQ0A 2CHBD 2BBCA 1QG7A 3P4SB 1JC7A 1SAPA 3VRAB 1BNZA 1EM7A 4IUNA 1GHKA 4C3JB 3ZYYX 1H9JA 2E2HB 4A8XC 2WQYB 1S5ED 2CW0D 4FXDA 4U673 5DM63 1AW7A 2WIIB 2LEKA 3K6OA 4FNFA 1PDQA 3KBGA 3T13A 5AUKA 2K04A 3W5VB 1EEID 2I2YA 4K8IA 1TYGB 3DXJC 4USAA 3DMUA 2WNMA 4QCLA 3AE9B 3LWUA 3MXUA 4TQ0A 1KRHA 4CJ1B 1FR3A 4PMBA 1E2ZA 4WJWA 1RKNA 2MGSA 1TR5A 4JWSC 4D2KA 4A3GB 3S1NB 2RPVA 1RCVD 2H4OA 2B76B 4YTMB 4L1BA 5I2XA 1G2SA 3DWMA 1SJED 4DXFA 1EY5A 3HP3A 2FUG1 3FILB 1F9PA 2IW3A 1SYGA 3D6CA 1CHPD 4IFDJ 4NJCA 3OW7A 3Q6SA 2F0OA 1V43A 2FHTA 2PNRC 4US9A 3HEJA 1EY0A 3TEXA 4ZHPA 1HZ6A 4X3UA 5EPJA 3NS1A 3LYYA 5EE3A 1WYGA 1SNQA 1G91A 2F0LA 1QE6A 3HVDA 4IALA 3GD7A 4IUVA 3SFDB 1X32A 2JU6X 2B2WA 1X3QA 4JE3B 2AQ2B 1SEBD 2B2YA 5DEHA 1SFOB 1KFYB 2W54A 1HQRD 2K5WA 1HFNA 2KEDA 4KKSA 1U9RA 3S2HB 3ZJVA 4PNYA 1C48A 3C3LA 2ZXPA 5C5LA 3ND9A 1FEHA 4EQNA 1B1ZA 1TU2B 5ELCA 3BS1A 1LTAD 3SK8A 3H6MA 3M4YA 2DWQA 2X69A 1R4QB 3EFXD 2WXKA 1R4PB 1XLNA 1VMPA 4KKTA 2VUMB 2Y5PA 2K3UA 3V96A 2V0GA 3IXSA 2C5CA 1EL0A 5E3FA 3L4PA 3J7AF 1U4LA 4IUQA 3T3NA 3VYTA 3FMCA 1QILA 1XXGA 3FRPB 1DOIA 3J80L 3P63A 5K5PA 4A3DB 4CKEA 2AUKA 3C1FA 1F2MA 2ICIA 1NYQA 2GI9A 1D6EC 3NHHA 3PUWA 2WXQA 3C8YA 4KKJA 2WXFA 2EY2A 1I4XA 3T4AC 4F87A 3HRZC 5LNK1 4WRDA 3I91A 2NYZD 1C79A 5HFYA 1D1KA 3CQZB 3FKIB 3D4RA 3S16B 4XYOA 1PTOC 1PGBA 1MI0A 4KKUA 2R6GA 4BA2I 1A6XA 4CBVA 2KA7A 3P42A 2TSSA 2QMTA 4GLSC 2VNUD 4MM3B 5IGCA 1K50A 4L2YA 1JOKA 2K0PA 2VXWA 3C2PA 3OSOA 5IIFA 2F0IA 2WXPA 1L5PA 1JORA 2ZW0A 4A55A 4K5XA 4C2MB 3AE6B 4ZRQA 2PW5A 2RSOA 1YJJA 1I6HB 4R3DA 2RDHA 3K57A 1FO4A 4LTUA 4AS1A 2NN6G 4A3MB 4RGMA 2PPBC 2IDYA 3E56A 1QB5D 3MHBA 3I3CA 3FAHA 1EU4A 1EU3A 4ME5A 2K33A 4XT1B 3U4EG 2JXTA 2QJLA 4A90A 2L32A 4FF2A 1JALA 1I4HA 1RODA 3SFEB 3HGBA 5KNDA 3OOCA 2K5PA 4JWUC 1C4PA 4LK0M 1IBXA 2IL8A 3M7GA 4KN4C 2MJDA 3JAME 3IAM1 2H89B 1KNEA 1I4QA 5ELFA 1YN5A 1PFNA 2I38A 1TS2A 3QOLA 1EWYC 1JB3A 5T8IA 2WU2B 1K8MA 1SNDA 1MGSA 3ERQA 3BDCA 2D5DA 2X38A 5JEAG 2E74C 4Y7NB 5M5XB 4A3EB 4V0BA 3Q8AA 3BDOA 4XYQA 4MHEA 3D4WA 1DXMA 2JYEA 2VZKB 4OZAA 3NQTA 4RGTA 2IX0A 1DZ1A 1ONLA 4KTAA 2DNCA 4EQPA 4RCOA 2LMCB 1K8OA 2EYOA 3E6ZX 1HTLD 2KEEA 5EE9A 4ZKBB 5EPKA 1ET6A 1LT4D 1I7HA 1TY0A 1PGXA 1YNTE 2F0MA 2H1EA 1VF5C 2BB6A 4H0LC 2Q8TA 4J1MA 3VR5A 1N5XA 2EELA 4FF3A 2W82A 4GDLB 2PZWA 2AQ1B 1SNMA 4IFDH 1IBXB 1IHZA 2XWBB 1QT9A 1CZGA 4HSVA 2RMMA 2NBFA 4R9WA 2CJOA 1J7AA 4PV1C 4U68A 3MEHA 2K9XA 5I9PA 3W5UB 3SVMA 5FKAC 2FMMA 3ZQ4A 4QIWB 4Q2JA 5ELBA 3K58A 2WKDA 1A15A 2N7JA 3QO2A 5F2DA 2INPE 1PTOH 4A3FB 5EPLA 1JE4A 5DNFA 1SMYD 2CVRA 1L0VB 5IGGA 1GUSA 2NVYB 2A69D 3ETRA 2EVBA 4ZOHC 1F9QA 2K28A 4RF0A 2GB1A 1FD7D 3IKJA 1ZOYB 3WCQA 1U4MA 3M3YB 1TWHB 5G3LD 3HVZA 2XVSA 1PZKD 2JZPA 4IZ8A 2YEPB 2TMPA 5JPMC 2EY6A 1FFVA 5C4XB 1ZDXA 1TWCB 1N5WA 1NEKB 1VRAB 1ZXTA 5CV4A 2ONQA 1MHHE 1YN4A 1HUMA 2CQAA 4WH4A 1PRTD 3VR9B 1H9KA 3BDLA 5C3JB 3VR3A 1LTTD 2F0QA 5D3DA 1OO9B 3MWYW 3P4PB 2JYTA 2PVOD 5EJWA 1Q10A 3OMCA 4K6LA 3S1RB 3B2GA 4XT3B 4YT0B 1EY8A 2YEPF 3KQ4A 1KAAA 3M7NA 1FM0D 1H9RA 2GRIA 4DGZA 1BQQT 4HR7B 2KJXA 2K01A 3FPPA 2N88A 2PMZB 1B9NA 2G1EA 1VZ7A 2Q5WD 5D7GA 1BUVT 3KLRA 2BCOA 4A3JB 1L0XB 1S4ZA 1DOLA 3I90A 4XE0A 1P7FA 4HCSA 3PV0A 1Z7TA 2L1BA 2J4XA 2WINB 3MXPA 2F1MA 4F8MA 1CTMA 1EWHA 2D62A 2O5JC 5G5GA 1OXXK 1EYAA 1OXTA 2EYJA 5FK9C 2L1AA 1II3A 1GJXA 1SE4A 3T56B 2SEBD 1S5CD 4C7YA 3KWVA 2MUYA 3Q8FA 1M4VA 3TEWA 4XQNA 3RUZA 3A56A 1B50A 4ZLTF 2WXNA 4IFDI 3HKZB 3PUVA 1PXUA 2EJFC 1ACCA 4PMCA 5K36H 2F0TA 2WXRA 5BN3A 5BMIA 4B9WA 5DM73 3K5LA 3U9OA 4LAAA 3ZGZA 1ICWA 1CK1A 2F0SA 4KGTA 3SXHA 5HG2A 1XLQA 3LNNA 2AX5A 3CHBD 3SK5A 1C77A 2KUMA 2NWGA 2CU3A 1T6BX 4OZBA 1CI3M 4P6VF 2B63B 3ZJTA 1ESFA 3J7AV 1FD6A 3IFTA 5CV8A 3IT4B 4G57A 3QG1A 3I4MB 1B4OA 1PLFA 2AWNA 1O80A 4K2LA 1B3AA 3O13A 1RYJA 5CBEE 5FR3A 1OXUA 3Q0AA 2D2CC 2X6GA 1VF7A 3Q8BA 1S5DD 2QSDA 2Z4HA 1KH0A 3H09A 4O1NA 2DY7A 1OXSC 2K5DA 1P7EA 4C3HB 3R8BA 3OWFA 4DAVA 3CU7A 2R61A 1RJTA 4C3IB 2ENBA 3KBXA 3GV6A 1YNNC 1JQYD 1FNWA 1AP0A 3I4NB 4XTCS 2XSCA 1WTXA 2Y5CA 4OL7A 1JMLA 1A3TA 2E2IB 2Q8IB 3GQBA 1JOQA 2H88B 3S1QB 1F2RC 1IW7C 2OEDA 1TS3A 1Q3LA 2OEOA 1C8CA 3FVQA 2XRSD 4H13C 3QWNA 1C78A 4DK1A 2PZUA 4R8NA 1XCTL 4TQUS 1E2VA 1F9SA 1JICA 2SNSA 2KQ3A 5C0XJ 1Q1BA 2L83A 2KECA 3L7ZC 2PVGC 4YSZB 1ZYRD 3GO5A 4F88A 1QQRA 3AECB 2F0GA 1LT5D 4ZRZA 2J42A 1EEFD 3RPFC 1D5MC 2E2DC 5I6WA 2NN6H 5C3EB 1ENCA 1CFMA 1C4CA 1AN8A 3DWPA 3E0JA 3OIPA 4N58A 3IFDA 2ZT9C 1QJOA 2DYMA 1PFMA 3H3VC 4DN4M 4HSPA 4ILWA 4A3BB 4TMAB 4YSXB 5CMDA 5A2QL 1I4GA 4ARCA 1SSOA 1WTVA 1SYCA 1NENB 2G9DA 4CKBA 3NWTA 2R3ZA 4CQNA 3A8KE 4X3SA 4NDXA 1W6JA 2EYPA 1HEZE 1GPXA 2L52A 3ITPA 5FO9B 2JEAI 5T1IA 1TWAB 3U52E 5LHY1 1AYFA 5CGKA 2JP1A 1LT3D 5JEAH 5I4DA 4RKLA 1NVID 1YNJD 5EBCA 5BYSA 1F0ZA 5IGDA 2WU5B 2BTEA 1SB3C 1PTOB 3CWIA 1FXAA 4RCNA 1STHA 2CW0C 4R8IA 2Y3AA 2EJGC 3CRLC 1AZPA 1XYIA 1EIGA 2WXGA 2QILA 4XWWA 2E76C 1EYDA 2NVQB 3SR1A 4KKIA 5M3MB 3FDTA 3K5OA 3LX0A 1DOMA 1WD0A 3IL8A 3DWGC 5C4JB 2D9UA 3J81L 3S14B 3MJ5A 3FEWX 3NTHA 3BYTB 2J52A 2XIWA 2MPMA 2V3NA 3A7LA 3HOUB 2M2LA 3TSSA 3G6JB 3HS0C 3VQIA 1E10A 1PTOF 4X3KA 1B44D 2WACA 1J8IA 3GTQB 4FXGC 1D1IA 4J6HA 4N9TA 2A6ED 1ZP0B 3EQLC 2EY1A 2RVLA 1C76A 2R92B 1PMRA 4A9AA 4NKLA 2NVTB 2WXJA 1FNVA 2KCCA 1HRJA 3WDNA 4H2AA 1FGBD 3SDZA 1EWCA 1HQMC 1CA5A 4HAEA 5FLXE 3TBIB 3MC0B 1QLBB 4DAYA 1DOXA 4HRSA 4IUPA 5IGEA 2F03A 3S15B 2HUGA 4CHTB 1MHXA 3NP8A 3GTMB 1KDCA 1SIJA 3IT6B 4HMJA 4M0WA 1CM9A 2LJIA 4ITKA 1ENFA 1MBYA 2M19A 1FCLA 2F0NA 3MVVA 1NAPA 3LB8C 3MXNA 2A5HA 4XDCA 1ZPSA 2KN4A 4TRDA 3NVYA 2ACZB 1UWMA 4QF4A 3C46A 1ZUD2 3VR2A 1XLOA 5KGUA 2BS4B 3RZOB 1GAQB 2DBYA 2A6HD 2LMCA 1TWGB 5E4WC 1SF0A 3N9YC 2L12A 3BYYB 3I72A 4TSSA 3LXFA 2MJ8A 1JROA 4CJ2C 2JSOA 1VR9A 4YTNB 1O7YA 3U9SA 1DYQA 3NSWA 4C1NI 3S1MB 1JWAD 4E6IA 1VDZA 4ZHOA 1BR9A 3ZJUA 1HHVA 3HRDD 4RKBA 2J53A 1ET9A 3SE0A 1H9SA 1Y1VB 4KN7C 2JWUA 2WV6D 4ZUJA 4X3TA 4OVZA 3P20A 2E75C 2IPKD 3DWAA 1DOKA 1R9TB 2ID0A 5GXGB 1LTGD 3A7AB 2DN8A 1V8QA 1PFDA 2E3TA 4HJGE 5FO8B 3VA5A 4RWSC 1TIID 4KI0A 1I50B 4UAIA 1S5FD 2FINB 3P4RB 4FXCA 1SYEA 4OO1G 4QUCA 3H8HA 1WGKA 5C0XH 1ENAA 1IYUA 3D8GA 1PFBA 3S17B 4OGQC 3IAYA 2QIEB 4NW2A 1XCQL 4N6EB 3GV3A 2WXIA 5BN5A 1WSPA 1KLUD 2BA1A 1Y8OB 2L11A 2B8FA 2PCFB 4PQXA 1HFGA 5COYA 2K05A 2JA5B 3EGRA 1KNAA 3R2IA 3PO3B 3AH7A 2AUJD 5M5WB 4IKGA 5FOBB 2WXHA 2KDMA 3SR6A 4MT5A 4KJNA 1H9SB 1QNUA 3A54A 5JAVA 2K6AA 4FO2A 3MAQA 2NUCA 4G4KA 3NRZA 1B53A 3Q24A 1GXDC 1JW9D 3H91A 4K2KA 4YIJA 4OZCA 1QNKA 5JXVA 4DNRB 2WS3B 5NUCA 1ML0D 4K6DA 3TP6A 1F2RI 2A68D 2N9KA 2ZXOA 4XXEA 3TUOA 3KLSX 1LLRD 2DNEA 2OHFA 3TP8A 1VZ8A 1RWSA 4P16A 4MN3A 1WRIA 2EDGA 3SK4A 1FYCA 1TKWB 1E2WA 1EOTA 1ESRA 1AEXA 3NTKA 3RFZB 2F0WA 4IUTA 1ZXIA 3AEBB 2F0HA 2M0AA 2I46A 1BUIC 5EKKA 1QOFA 2WDVB 1UEAB 3VYSA 4BY1B 1HXYD 3AEEB 4FF1A 5JOBA 1YJIA 2MJ3A 3K7AB 3R2TA 2LGIA 4XQQA 1I4RA 1B9MA 4DF7A 2F0PA 1CZWA 5KNCA 1A2UA 1D5XC 1K52A 5IT9L 3TP7A 5G3LF 4KY5A 2FBWB 3AU7A 3NE5B 1VDVA 3JAML 3PIO3 5KRUA 5FO7B 3TDQA 1PDXA 5JEAJ 3KUPA 1QOHA 3PZ8A 3TMEA 2PMVA 3WOFA 3P1HA 2EXZA 4KV6A 3MHZA 5D65A 1J9OA 5AUIA 3MFYA 3A8IE 2PLPA 4ID6A 2BE5D 1NYRA 4ZRPA 4L8JA 3J7YW 4JBWA 2RBMA 3EJIA 1SMYC 4IN3A 1GOZA 2NTSA 3NZ3A 2A69C 3AMZA 4MACA 5C0XI 1QCBD 3W2DA 1STNA 3TN2A 5C5MA 2V4DA 1OQQA 1EZ8A 5ISRA 3W9CB 3GTPB 5CC4A 2WDQB 4DQOC 1SE3A 3D3RA 2EKIA 1TQOA 4DXGA 1RM6C 2IT1A 2OXPA 1C4AA 2DLBA 4HROA 3E9SA 4A3KB 4O42A 5EE1A 1C4QA 3T16A 1LV9A 1WTOA 5CYUA 1ZDVA 1F2ZA 4TKOB 1F9RA 1FMAD 1N61A 4KY6A 1PRTC 1SDFA 1R7SA 5IOCA 1RTOA 1LTRD 3VR8B 2K32A 2ZW1A 4C3JG 1EZ6A 3PMFA 1OFFA 5C6AA 4OHJA 2PW7A 3OWEB 1BCPD 2MP1A 5HGTA 2IX1A 5BN4A 5C44B 3V05A 1DM0B 2RA4A 2SOBA 2W55A 4IDIA 2WDRB 3BK2A 3K0YA 1SSNA 3QIAA 1BOSA 2BDNA 2EPBA 2BDOA 4RFBA 5A2QE 3A8JE 1BO0A 3VYUA 4WFN3 2BA0A 3VYRA 4OW0A 2K1BA 3T51B 3CIRB 1O78A 2FJ2A 2LFNA 4HTHA 2JEBI 3OHXC 1GB1A 2BB5A 2XRQD 4Z9CB 3GB1A 2HCCA 2F0FA 1TVXA 1I3QB 2HDEA 4I7ZC 5KYIA 4XQJA 1A70A 2F0JA 3W1SA 3TEYA 1G8ZD 1NSNS 1K53A 1XLPA 4QMGA 1MSHA 5JVG3 4PT5A 3P75A 1N60A 4RA8A 3Q8CA 2BW2A 4P2CB 1RTNA 2EYMA 4HKQA 1RF2D 1SYBA 5BMHA 3OMGA 4FYDA 4KGRA 1ROEA 3BIID 4DFAA 1MI2A 3GS2A 2F4IA 2K03A 3NPPA 1C9FA 2EYHA 2F0DA 3L9AX 1WD1A