1AN8A

Crystal structure of the streptococcal superantigen spe-c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the streptococcal superantigen SPE-C: dimerization and zinc binding suggest a novel mode of interaction with MHC class II molecules.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Bacterial superantigen
molecule keywords STREPTOCOCCAL PYROGENIC EXOTOXIN C
total genus 66
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1an8A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1an8A01
2IPKD 1V1PB 1FNVA 1D5ZC 2XN9C 1V1PA 2G9HD 1JQYD 3DWPA 1HXYD 1I4QA 1BCPD 4RCOA 4UDUC 1PTOB 4C56C 5FK9C 1V1OA 1PTOC 1LTBD 4RGNA 4DXFA 4NZLB 1EEID 1TS4A 1LT3D 1BXTA 3BVGA 2ICIA 1LT5D 1DJRD 1M4VA 1PRTF 3R8BA 3EA6A 1RD9D 4Z9CB 1JR0D 4RGMA 5ELCA 1FGBD 1HQRD 1JWSD 1SXTA 1UUPA 3MC0B 3SEBA 1KLGD 1S5DD 3O13A 1I4HA 1LTRD 5FKAC 1I4PA 3BYTB 4OHJA 5D3DA 3TSSA 1HTLD 2QEJC 1L0XB 1T5XD 5TSSA 1PRTB 1AW7A 2SEBD 1PRTC 3W2DA 2XNAC 1DYQA 2QILA 2NTTA 1PTOF 4RHRA 1TY0A 1YN3A 1ENFA 1LO5D 1L0YB 1CHQD 1LTTD 3GP7A 1LTID 1EFID 1CK1A 1UNSA 3MFGA 2R61A 1LT6D 3BVMA 1CT1D 3DWAA 1PRTD 5D3IB 1PTOD 1PYWD 1S5ED 1LLRD 1G8ZD 1TS3A 3KLSX 5ELBA 5ELFA 1RDPD 1F77A 1SEBD 2RDHA 2CHBD 3BVZA 1D6EC 1PTOH 1SE2A 1XTCD 1XXGA 2J4XA 1ESFA 1TS5A 3CHBD 1JWMD 1SBBB 2TSSA 4L63B 1BCPF 4RGOS 1EU4A 4RGTA 1LTAD 1S5BD 1BCPC 2WV6D 1ET6A 1S5CD 4RFBA 4TSSA 3DWQA 1RF2D 2XRQD 1FD7D 5ELDA 4L6TB 1SJHD 4BWGB 1AN8A 4K6LA 2O2LD 1EWCA 1PZID 1RCVD 1KTKA 3BYYB 3OWEB 1TY2A 1LT4D 1B1ZA 1D5XC 3V05A 1CQVA 1S5FD 1YN4A 1HA5A 2AQ2B 5I4DA 1D5MC 2AQ3B 1JCKB 3URYA 4RHSA 2AQ1B 1JWUD 2NTSA 3R2IA 2RDGA 1SE4A 3BZDB 1BCPB 4ZYSA 1STEA 1LTSD 4RH6A 1GOZA 3EFXD 4O1NA 1CHPD 1EEFD 1I4RA 1SE3A 2XRSD 4DXGA 1FNUA 1SJED 1LTGD 1I4XA 1I4GA 1PZKD 1TS2A 1B44D 2Z8LA 5ELEA 2IJ0A 1FNWA 3R2TA 1EU3A 1ET9A 1PZJD 1YN5A 1KLUD 1MD2D 1QILA
chains in the Genus database with same CATH superfamily
5C0XI 1ESRA 1V1PB 2A1AA 1QT9A 2IZVB 2VZKD 2N49A 1KRHA 2KTRA 4MEMA 2SAKA 1NSNS 4W9LA 4IOAA 2SOBA 4G57A 5JJKA 3RCZA 1W6KA 3GTLH 3PO2H 2MJ3A 5ELNA 4A76A 3H91A 2KZRA 3SFEB 2F3WA 2L0FA 2FCQA 2KMMA 1L7YA 2R3ZA 2MNAA 4NXMQ 2KK8A 2F0NA 2VNUD 1TGZB 3K5MA 4WJ3M 2E2IH 4DPGA 4HCSA 4YHHQ 3PS6A 3CC7A 3DHIC 1JJGA 1PGXA 3UIPB 4DV5Q 4XYQA 1SYCA 3ZKJC 5C3WA 4JI1L 1U0LA 1T5XD 1B9NA 1NR2A 4K5XA 3W1GA 1H4RA 1QLBB 1LACA 1X3PA 2HQLA 3DDCB 1PHJA 4CKEA 4JI3L 2D07B 2M0AA 1G91A 3A56A 3A55A 4XYOA 2UUAQ 1ZGUB 3AE5B 3AEBB 2B2TA 3CMAA 1RL2A 3GTMH 1CHQD 1LTID 2VH2A 3UDXA 2C5LC 4YWGG 2BWFA 1HR0W 2R61A 5FLXc 4B3RQ 3ZTCA 1I42A 3VH4B 3HOUH 1TWHH 2L0CA 1EIFA 4RKLA 4HROA 4A55A 3OPOA 1TS3A 3KJPA 5ELBA 1ZOYB 1SFOB 2GLSA 1SROA 4YY3Q 1B50A 2F0QA 1IBLL 1IYVA 1F77A 3TDQA 4KSKC 1UE5A 2NWGA 3WAMA 1PTOH 4JI6L 1XLOA 1G51A 2LXCA 1MGSA 2LFNA 2EQSA 2WINB 3CCRA 2TSSA 2O2VB 2OEDA 4K81A 5BN5A 2UXDL 1DGSA 1JE4A 2KTRB 4WWNA 3E0EA 2F52A 1B9MA 1JALA 2UXBQ 4KIKB 4LK0M 1IBKL 5CBAE 2CU1A 2JA7B 4R1JA 1UBIA 3QJYA 3N1ZC 2EPBA 1AARA 3ITPA 3U4ZA 4RCNA 3K0YA 2IY5B 4CDCC 1C4CA 2KTFA 1F9QA 1TKWB 3D4DA 1T0YA 1EOVA 4HJGE 5J39A 1W2BA 2R92H 1LM8B 3ZUNA 3M4QA 3QG1A 3MHBA 1OEYA 1Q7YC 4P1CC 2DYMA 3L4PA 1HA5A 2WDVB 4O0AA 3S1RH 3ZLZA 2N7DA 1BVSA 3OSOA 3RNFC 2LXAA 2RDGA 3E5SA 3PO3H 3OMCA 3TN2A 1KNAA 3NQIA 1XCQL 3EQLC 2XK5A 3HOYH 4A3EH 4A3GB 3DMUA 4XQQA 3AE4B 3HG9A 3ZJVA 2Y5PA 3C46A 2ASBA 1JOQA 1CHPD 1RHPA 4LF6Q 2R7ZB 4BBRG 1IW7D 3STBC 2XRSD 2QDBA 1KJTA 2K1FA 5KHOA 1F2RI 1JOKA 3MXPA 1G6PA 1UEAB 2D11A 2M56B 3RZDB 2MA9B 2WS3B 2IY1B 5I9PA 3NXWA 2Y5CA 1Z2MA 2EY5A 4EEWA 4EX5A 1PA6A 4IALA 4GOPC 3E9IA 1AFPA 3M85A 3AEEB 3HGBA 1XT9B 4GKKQ 2KDIA 4BBNF 4DV2L 1O7ZA 3EECA 2NN6I 2ZTDA 3GQBA 4RCOA 1QNUA 2V1YA 2GVBA 4DV0L 2BE5D 2KWVB 3HVDA 3VR3A 1NENB 2VXWA 3LXFA 1EWYC 2WKCA 1LABA 2B8FA 2YTXA 4IO9A 1BXTA 2YEPF 3IFWB 1QE6A 4EKUA 5C2TB 1I3QB 4GNXC 1I35A 4OO1H 4JI7Q 1I5FA 5IWAL 4IFDI 4A3CG 1CA6A 4JQWC 4F8MA 2JN4A 3WWVA 2NBVB 5I6WA 3QJZA 3GV6A 5AZFA 4KMUC 4DR3Q 1WGGA 1EQQA 2HTME 5E6JA 3J81i 1Q86C 1VQKA 4JVZA 2QEXA 3NVWA 2WGSA 2F0DA 4XDDA 3RI7C 3KWVA 3CU7A 1GUSA 2MLBA 1GC6A 4XX5A 4RHRA 3RNBC 4DV6Q 2KCCA 3OMGA 1J9OA 1PGBA 4TKNA 3ONAB 1LTTD 2BBCA 1D2BA 2W55A 3UQAA 4DR3L 1VQ6A 4DV4L 1IL8A 3SE0A 2SNMA 1MPEA 1CSPA 2KC2A 1EQTA 4LNIA 1IKMA 4KZCA 3K81C 4GZYC 1CT1D 3VA5A 4CHTB 4K5WA 1YIWA 3A7AB 5C23A 2BE5C 2GBJA 1I6HH 1N63A 2BCOA 1SR3A 1D6EC 3K5NA 1VQNA 4JI2Q 3CHBD 3I2ZA 3S24A 2EYFA 4AWJA 4QCLA 1TT2A 2MPMA 2ZVNA 4LWCA 4QUFA 1KDBA 4MZ9A 5GADC 2KD0A 4GN3B 2LVQA 2LFIA 4NXNQ 1I94L 2JF5A 2F4VQ 1UE1A 3IL8A 4GKKL 2YLMA 4B3RL 2VH1A 1OXXK 4L2YA 1MFWA 2C60A 1ILQA 2JVCA 3SU8X 1BKBA 4MSMB 2HT1A 2K7VA 3A9KA 1NY4A 1Y8OB 2XWJB 2JA8H 1DOYA 3PSEB 2IY0B 1TY2A 3HS0C 3JAMc 1ZW7A 4B3MQ 3KF6A 2JEAI 3B2GA 3Q6BA 3QHTA 3LJ3A 3H8HA 2WDTB 3RZOH 3BU2A 4WWMA 3NWSA 3H0GH 2F4VL 2F3VA 5CBEE 2JQOA 5IAAC 1C79A 1A70A 1QVFA 1CKOA 1XYIA 3FILA 2L83A 2N7EA 1RIPA 1X56A 3HOZG 3AE2B 3Q8DA 2E5LQ 4HRSA 5C44H 4LUVA 3SK4A 4DAYB 1X1MA 1F9SA 4GMVA 2FMCA 4NQKE 1E8YA 1Q1BA 2KT7A 2WDRB 3JAMi 4DK0A 1F9JA 2D2QA 5BMHA 1TIID 3S14H 4A3BB 2O6VB 2R7ZH 4KJOA 2QDLA 1AP0A 4G7OC 4DFAA 2R7FA 1L1OA 3TMPB 1UE7A 5EGTA 1UD7A 5G5HA 4YXDB 1CQFA 4A3DH 3RMHA 1O7YA 1KLUD 1TS5A 2XEWA 1EQRA 2NVTH 1UGJA 4JI8Q 3JAME 4JGHB 4C56C 3H0GB 5FLXE 3IFTA 1TWCB 3CCLA 2KANA 3PRPB 3Q8EA 2B2WA 3C19A 1A3TA 4ANUA 3T1HQ 5NUCA 4KDIC 5C4XG 1TWGB 3K7UC 4IQZA 2ICIA 2ZM6L 5LL6X 4IOCA 4PG3A 4A3FG 4NXML 4BBSB 2E2HB 2V3PA 5D14A 5CV5A 3V62A 2BYFA 2DHZA 1A8VA 2DZKA 4M8MA 3U52E 2BB5A 4AYBB 2VW9A 2LWPA 2B76B 3A0JA 1SXTA 4IZ8A 3AE1B 4QQBX 3FP9A 1PH1A 1VQLA 3R93A 1VMCA 1BOSA 2V4LA 2O5IC 4BOZB 4Y7NH 2IHFA 5H1SE 1QOGA 3AFQA 3VR8B 2CWPA 2M4NA 2IGGA 2ZM6Q 3UDIA 2VB2X 5DPSA 4BKTA 2FAZA 1LQBA 2XNAC 4BKGA 1MJCA 4BY1B 2CKZB 3PSIA 3BWUD 4FXCA 1EIYB 2BT6A 1ENFA 1SMYD 2JXTA 1U4MA 3NTHA 2F0WA 1YHQA 4PS7A 4X57B 1AYFA 2Z0SA 1Q8IA 1BF4A 4KN7C 1I7HA 1IYFA 4FNFA 4QJFA 5D6JB 2W9NA 2F0LA 4WWPA 1OTCA 3WAPA 4DV7L 1PYWD 3I91A 3P7JA 4LK1C 2IDYA 1CZPA 1HTOA 2WXQA 1E24A 1ILPA 1QNKA 1SEBD 2CS4A 2LUEA 2K28A 1X32A 2KVMA 1C3TA 3OLMD 3K80C 2W82A 3TQYA 5LHY1 3I4NB 2L55A 3AU5A 2KFKA 3L9AX 3KH0A 5MPOA 3M3YB 4KD3A 1HFNA 3AFPA 1BCPC 1JOOA 4K5VA 1GHKA 2O6VD 4A3GG 1TZ1A 4KGSA 1WOCA 2A69C 3T1YQ 2F0VA 4JWSC 3S17H 1JJCB 2IT1A 1G2SA 3JAML 2GB1A 1M8AA 2UU9Q 3H7SA 3Q0AA 2HCIA 2JA8B 2ZXPA 5FO7B 1K52A 2VRRB 5AUKA 1KLVA 4W9FA 2J52A 2JX5A 2PW9A 1HH2P 5C3EB 1CI3M 1Y69U 3VVWB 3J81E 4L5QA 1RTNA 4HSPA 1H9SB 4R8NA 1PH6A 1FFVA 2JUOA 2W54A 1HZ6A 3S17B 4C3IG 3Q6SA 4AYBG 2RDBC 1S5FD 1XTDA 4NW2A 5LXHA 2V0GA 4H13C 3SK6A 2AQ3B 2LRWA 1JCKB 2L1AA 2WQYB 4F88A 1CM9A 1SNPA 2BWES 4I6NB 1H9SA 1SE4A 4JPBW 1C8CA 4M00A 3AB9A 3TMEA 2KX0A 3C3LA 2JYEA 3PRZA 5IP4D 4N8FA 4ZHPA 2FFKB 5C6AA 5AJ3Q 3BK1A 1FNUA 4JI6Q 5EJWA 4C7YA 1HR0L 1RAXA 3OOCA 4BY7B 5G55A 1YNND 1IBML 2DBYA 4YWLA 1DD2A 2NVTB 5EAYA 3J81L 4LFBL 4R4IA 2B2TC 2JA9A 1Y1WH 3F2DA 4JE3B 4KSLC 5L95C 1HQMC 4LUZA 2K39A 5JJLA 3NS8A 1T3QA 3SR6A 4OX9Q 1QILA 5IP7H 3TS0A 4C3JG 1YBYA 3W1SA 3T13A 3DXJC 4HIKA 5CV8A 1JICA 1E7PB 1V1PA 3W9CB 2ZJPA 1XWEA 4A3FB 2JA5B 2KYWA 2MWSB 1DZ1A 3NY5A 2E2JB 1NR4A 2PZUA 2X38A 4OW0A 5G3LD 4I6PA 2EIFA 5I2YA 4OXPA 4LF4Q 3HOXG 4LLGM 3TP6A 4K8JA 3M4PA 1BBUA 4BBSH 1U9RA 2MX2A 2KEDA 2RSNA 1GHJA 1SF0A 1NYRA 3QIJA 2AWNA 3H7PA 1KHIA 1Y1VH 3SVMA 2K6AA 4DV3L 1A2TA 1PH5A 3H3VC 3RZOB 3DQVA 4ANWA 3X0WA 4X65L 2VQEL 1XLNA 1HTLD 2F0OA 2BYVE 3CSTA 1HHVA 1EYGA 4IUQA 3AI5A 3M4OB 1NBWA 2ASQA 1NBFC 1TQOA 1PYBA 5EQ0A 2D5GA 1I50H 1DOKA 1YJWA 4A3JH 1N62A 1WX8A 2LGYA 4BY7G 3C0RB 1HTPA 4Q2JA 4US9A 1WJ4A 3D32A 2RPVA 2D62A 1E0ZA 4HN7A 5M5WH 2KQ4X 3NUCA 3I4NH 3VR9B 1GJZA 4N8X1 4CKCA 4JIOU 1QWYA 1BO0A 2PYKA 1V5OA 2NB0A 3J9CA 2JA5G 4L63B 1UWMA 1SBBB 3M4YA 5M3FB 2CHZA 2JXXA 4LF9L 1HNXL 4W9EA 5KRUA 2Y3AA 5J2RA 3BDLA 4C3JB 1LGRA 4JBKA 3QIAA 2KKCA 4RFBA 4FXKC 2MFIA 3OAWA 4RF1A 1Q0WB 2WXKA 1STNA 2XRQD 3J81j 1V9PA 1BNZA 3ICEA 5D2MB 5M3FH 3VR5A 2BH2A 4K0KL 5BR8Q 1L6VA 2EYLA 1H95A 1E1TA 5JJIA 1JRPA 1EWCA 3U2SC 3CQZH 5AEKB 4M01A 1HNXQ 1UF0A 2KXJA 2JZ3B 2PTLA 2DYBA 3NENA 2KMCA 2OJWA 4WJQA 4MGZE 2HCCA 1WGHA 4H44C 4B9XA 3ZDTA 2Y0SG 3C1FA 4MNOA 1HE8A 1X65A 4X64Q 2IX1A 3KDFA 2RKSA 4KX6B 3J80E 4DN4M 3L3OC 1VF7A 1YNJD 3BZDB 4A93G 2DX5B 4OELB 4IPCA 3I3TB 3P4RB 4HDQA 4J3OD 1DOXA 2KUMA 1VQ4A 1XD3B 4HKZE 5LMNQ 2V4IB 2R93G 2W3SA 2WXLA 3PZ8A 1Q8KA 1QF6A 1SE3A 3CAMA 3PGZA 4DXGA 3GTGH 1OQRA 2K3UA 3ND8A 3R3OA 3UI3A 3EIVA 4WFN3 3DBLI 2ES2A 5ELEA 1YNJC 4IUVA 3CC4A 4CQNA 3ULPA 4LUOA 4BY1G 1ET9A 3N6RA 1P7EA 1E8WA 4OVUA 3NG0A 3VRAB 3RR5A 3WALA 4JBMA 1SSOA 5IGFA 2LJIA 4PS8A 1JMLA 4EUTA 5JEAH 1S72A 3ZJTA 1WGYA 4KJNA 3IFDA 1LYLA 1QZGA 3D0FA 4AQYQ 4HIOA 2PZTA 4A9AA 1EWHA 1WCMB 1QCBD 4V190 1ZYRD 3ZNGC 3NBHB 5FK9C 1R7SA 4HMIA 3T3NA 4L23A 5EE9A 1ZKHA 4PMWA 2WXHA 4A3JB 4KHVA 2YYZA 1CTMA 1V86A 1XLQA 4LF9Q 5L37A 2DYOA 1KAAA 2L0TA 2Z1CA 3KWLA 2BKRB 4B6WA 5BMIA 1L5PA 1B4OA 4M02A 1C76A 2MGSA 1RODA 4W9CA 3WANA 2KDBA 4ZRJA 3PMFA 1M94A 1TWFB 1YIJA 2NZOA 2MQHA 1GUNA 1LTRD 4IUUA 5JAVA 3QB3A 2QJLA 4N59A 2A69D 1KF6B 5DCNA 3VH3B 1IXRA 3QO2A 3NJTA 1K83H 1MKHA 2NUCA 1MVKA 2O5JC 3CKIB 1TYGB 2M1MA 1HNWQ 1WGRA 1E7VA 2WXPA 4C3IB 2B2VA 1NNXA 4ULLA 4CKBA 3T9LA 1L0YB 1Y8PB 1EYCA 5J1ZA 4LF4L 4QAYA 4KY5A 5C3EG 4DF7A 5J22A 2LUMA 3BVMA 4LFAL 4KKTA 3DUZA 2GVAA 4HEA1 2FHTA 2LHDA 3UE1A 4XWTA 2CHBD 4C1NI 2PEAA 3N3KB 3TEXA 3EN2A 1EUVB 3OWFA 3K9PB 4P71A 5EPKA 4B9WA 4C3JH 4N58A 4XDXA 3K7AH 2K6QA 4CDEC 1V2YA 4B0MA 1RTOA 4DK6C 2NYZD 1EYAA 5ISRA 3DLLA 4HEDA 3JC66 2V4DA 3PO2B 1J7BA 4A3OA 3NBIA 3TJPA 2N0SB 1Y14B 2QCPX 3AQQA 1NJIC 5DPWA 4D2KA 3AE8B 2RHQB 5CYUA 4IPHA 3JVZX 1K3BC 4A3MH 4JI2L 2C7NB 4XT1B 4WJ4A 2KLCA 3PT2B 4DNIA 1RCVD 4NB3A 1E7ZA 4BBRB 3S2DB 1WJ6A 3JYUA 4TUUA 1B1ZA 1WTHA 2OCEA 2DY7A 4ICVA 3MTSA 2M00A 3KF6B 2C35B 5E4WC 2PVGC 3ML9A 4K2KA 2OQKA 3G4SA 4IM2A 3PUYA 3SDLC 3Q3MC 1EYDA 2KFKB 3IRBA 4BBNC 2ON8A 3J7AF 1BT0A 4JWUC 4ZK9B 3J7AV 2IWHA 1YNNC 1C1YB 3J80L 2J53A 4FF1A 1K51A 4N6EB 3L10B 3ER0A 2F03A 1C7YA 4GS3A 5C4JB 5C5MA 2RHSB 2ZCBA 3HM3A 3DWMA 4LJOB 1HUNA 2ZXRA 1LTGD 4JI0Q 1R4NB 1WF9A 3A1QB 1PZKD 2MHVA 1STHA 2L11A 2Z8LA 3TZUA 4HJAA 4GGQA 5LXIB 5LL6S 2EYMA 3R66C 2LGIA 1FCCC 2HE7A 1B70B 4YL8A 4ID6A 4LNQA 2HHHL 2KENA 2L15A 5L83A 2UYZB 4GKJL 2UWQA 2KX3A 4ZRIA 2G9HD 2WHIA 3WCQA 3MJWA 1PTOB 2WWZA 2NVUI 4RGNA 4EQNA 4LF6L 4KV6A 3DVNU 1MSGA 2B29A 1V5TA 1T0RC 1TS4A 5M5XB 1QJOA 5E3FA 3QR8A 2GBRA 3AH7A 1DJRD 2BOSA 3Q3FA 5IYDG 3P2BA 5JEAJ 3BS1A 1KOTA 3D6WA 4XIGS 1ZEQX 2JYOA 1STYA 4PZ7A 4DV4Q 2UUAL 1XNRQ 2CR5A 4MSQB 1J0GA 2EE1A 2R92G 1N9WA 2R2QA 3J7YW 3X3NA 3AEFB 5HI1A 3RNEC 2GBMA 2HIXA 3GTLB 4X62L 2UUBQ 1WZ3A 1ZE3D 3TSSA 2NVYB 3HOVG 2R92B 2LGXA 1L0XB 3ZVVA 2BYTA 1FCLA 2NVQH 3D3RA 4A93H 2BS3B 2LGDA 2QILA 4S0RA 4EGVA 4AYBE 3DBHB 4NMZA 1YN3A 1J8CA 4J1MA 2I07B 3GO5A 2JZZA 1B3AA 5C3JB 1IGCA 3MP9A 2L1BA 1SMYC 2L76A 4WJNA 4QGUA 2JA6B 2K5WA 3WIMA 2K03A 1SNMA 1CKNA 1JMCA 4JOIA 2CW0D 2K25A 2N9EB 4H2AA 2UUCL 1UEBA 1XNQQ 5EDSA 2PE9A 1OXVA 1WTQA 1QOAA 5K5PA 5I2XA 1SE2A 2FE8A 2M0XA 2RA4A 1WZ0A 1WXVA 2G3QB 4RGOS 2D5DA 3HOUB 1LTAD 3K59A 3G6EA 3ZNID 4GLXA 5C0XJ 3NRZA 2WV6D 5IGEA 1D1IA 5COYA 4KKJA 1MSHA 5FJ8H 4TSSA 1VQOA 1IUEA 3TRZA 2G1EA 5F2DA 4KHPL 2PW5A 4DKAC 4II2B 2FJ2A 3W1SC 1TKGA 2E2HH 3L16A 4YWMA 1WCMG 1WR6E 4ABNA 4X65Q 2VQEQ 1QB5D 4K6LA 3AM9A 4QB4A 2O2LD 1UBQA 2ZVOA 3VTWA 2N1WA 1F9RA 4NP5A 4EZKA 4WQOB 4LFCQ 3FAHA 2EVBA 4DWFA 3U8ZA 1CQVA 1EZ8A 4DAPA 2WP9B 2B63G 3VAWA 1IBXA 4DR4Q 2XSCA 1HZ5A 2IO3B 2EY2A 2K9XA 2N9PC 3QWZB 3K58A 4ALPA 1QQRA 3GTQB 2UXCL 2LHEA 3ONSA 4EFOA 5LMNL 3QARA 4A3IH 2QMTA 2A73B 2C7MB 1VCIA 2FCMA 2I5HA 4O42A 3M7GA 2LGSA 4UP8A 3ZNZB 3ZQ4A 2K01A 3MEHA 1EM7A 1UELA 1I4XA 1TKYA 4E71A 2Z0DB 5T1GA 2NPTB 3GDEA 1SYEA 2KDMA 3STBD 5KYIA 4KN4C 1VQBA 3DEPA 3J7ZC 4B3SL 4AQ7A 5IP9H 2RCFA 5JXVA 1KD1C 2VZAA 2PO4A 3I90A 3OTOL 4OX9L 5G5GA 2XN9C 5AJ3L 2MQJA 2X6GA 2WXNA 1JQYD 3DWPA 1GUAB 1R4MB 2L3ZA 1QZHA 4IPDA 2KECA 5M5XH 3CMEA 1OO9B 5DAUA 3A9JB 1WJUA 1AH9A 4RF0A 2E2IB 4P7IA 4BKSA 4UP9A 1SE9A 5JPMC 1AE2A 3S2HH 3L17A 4PMCA 2N78A 4LFBQ 4IUMB 3DOWA 3QA8A 2BB6A 1QOBA 4BKSD 2BVCA 4WIPA 1NMFA 1RD9D 3Q22A 5CHWA 4RGMA 4UPAA 3SHLA 2XK5B 1N33Q 4X6AH 1H8CA 2ZXOA 2INNE 1YITA 2L12A 1J5EQ 5M3MB 3FHWA 1KQSA 5IN7A 3O13A 4WORA 4HPMB 1YJJA 2A74C 1YNXA 2SNSA 3BYTB 4OHJA 3H0GG 4GOPB 4DA2A 3I56A 4II3B 3AMZA 1SLJA 3NSWA 5KIXA 4S17A 1EIGA 2N55A 2A5UA 2ONQA 3AV8A 4HXDA 2K05A 5C3XA 5A2QL 2EZVA 5D94A 3KYHC 4B0EA 3DBSA 2PNRC 1XX8A 3T1HL 2KQSA 3PGEA 2LI5A 1GUTA 2MCNB 3ZO5B 1XPOA 4MN3A 4DXAB 2DN8A 3QQ8B 3H3VI 3VDYA 3ZXRA 5E1FA 2JRIB 1LO5D 3SDZA 2K5PA 3BINA 4K7UA 1E0BA 1TT5B 2H4OA 4DUYQ 4JLCA 1JW9D 1A63A 3SR1A 1LT6D 2VB3X 3IAM1 3Q24A 4LF7L 1H9RA 1Q46A 5CV9A 4X62Q 1LXDA 1ZXTA 2J0JA 3Q3JA 4I7ZC 5J3BA 1RDPD 2F0MA 4E3CA 3V6CB 2MJ8A 1OTRB 3K8AA 2G9DA 1IKLA 1G2TA 4GLSC 4B3TL 4JI4L 1XXGA 1Z9FA 1EFWA 2L52A 4C4VA 1BBXC 4GNXA 4DUYL 2E75C 4A3PA 4HIDA 1I94Q 3KFUA 2BQQA 3QX1A 1S5BD 1S4ZA 5E6PA 4ZRQA 4URKA 3GTGB 1P7FA 5BN4A 5E4XA 2L00B 4P1BC 5KNCA 4L1BA 2REXA 2WKDA 2HIVA 1K8GA 3Q14C 3DWQA 2PPBC 1EZ6A 2K75A 5DLQE 1VDZA 2XVSA 5CR3A 2IYDB 3K7AB 3NEMA 1BUIC 1TIFA 3RUIB 5C4HA 1SYBA 1A6XA 1PZID 2N4FA 4NJCA 1YI2A 2L9HA 5IIFA 3RFZB 2KJ6A 3ZRCA 5CGKA 1YHAA 3N9YC 4DR5L 4G11A 2WACA 1PH7A 1RWSA 1TBEA 4MDKE 3VXWA 2ZJQA 4IFDH 4YT0B 2XIWA 5EPLA 4KKIA 4HVBA 2CHXA 5KHQA 2E5LL 2V9HA 1JC7A 4IKGA 3S15H 4JW0A 4S3SA 2OTLA 4X3SA 2D3AA 3UDGA 2PMVA 4GDLB 4M0WB 2IL8A 2YTYA 2KO3A 4EE2A 1STEA 4X3KA 4DNTB 1O78A 2HTHA 4ZDVA 2I2YA 4IDIA 2WAQE 3HM6X 1EEFD 4KZ0A 1ZKOA 4JI8L 4WAFA 3ND9A 2YU9B 3FPPA 4WQMA 3KK7A 4CBVA 1GG3A 2KDEB 5E6NA 1PV4A 1HZ9A 4WJOA 4ODGA 3CF6E 1XEEA 1FJGQ 3GS2A 1Q10A 2NN6G 1R9TB 2FUG1 5HURA 2EELA 2PCFB 1CFMA 2QA4A 4W9DA 5C4ZA 1GXDC 2YU9H 4DV5L 3MFYA 3P63A 2EY1A 4NJ7A 3U30A 3APCA 2D2CC 5AZHA 3GZNI 1D5ZC 2K8HA 3DBRI 3BZKA 1PUTA 4AQYL 1PFNA 3RYTA 4M8AA 4NKLA 4MH0E 5M3MH 2KN4A 1EEID 2WB1B 4C3HB 4MGYE 1K0SA 2C7HA 1HCZA 2BTEA 3HP3A 2GRIA 3CCVA 3VUYA 1XNRL 2EYOA 3EA6A 3DM3A 2F0UA 2JA8G 2K33A 3AMUA 1JWSD 2DJGC 2BA1A 4X3UA 3QAQA 1PVOA 2AKWB 1SNOA 3H15A 3QK0A 4ACFA 1F2ZA 2SDFA 4IURA 1G6JA 4L5SA 5TSSA 3T53B 5H92C 3PO3B 2FIFA 5KNBA 3PZ7A 3U58A 2JYTA 2RGFA 4LNKA 2VL6A 1WXAA 1PTOF 2ZTCA 5KGUA 1WXSA 2L8JA 4FYDA 1L1OC 5C1ZA 2VUMH 4G7ZC 4YTMB 3HRZC 3PF4A 1Q12A 3J80i 5M5YH 3EGRA 3MFGA 1S3OA 5IT9E 2EYJA 3A8JE 2K5QA 4IUTA 1JROA 4DHZE 2RVLA 3DWAA 3KF8A 1N34L 3FKIB 4DR1Q 4R4OA 5G3LF 1B53A 1LLRD 2EJFC 4HJ5A 4JX1C 3ABVB 4FJZA 1WTRA 2EKIA 4DK1A 2K14A 1TWCH 1E2WA 1HUMA 2K52A 3CW2C 5IP7G 3X23A 2VQFQ 5BYSA 2B2UC 2WIIB 4IWPA 1STBA 1GUOA 1C9OA 5IOIA 5T1IA 2PE6B 5H8YE 1DOIA 2HD5B 2B2YA 3MZ5A 3KF8B 2FXQA 3I4LA 3GTKH 2QC8A 2PNHA 3W5VB 2RPQA 1YJIA 2MBHA 1CKMA 1F0ZA 1QOFA 1IYJB 3Q8AA 5C4XH 3HVZA 1FD7D 3AU7A 4FADA 4P75A 1M90C 3B1LX 1TWHB 3VUWA 4G7HC 4OVVA 2VQFL 2PZWA 1FVIA 1K0RA 2WP8J 2AX5A 3WDNA 2MW5A 2GOWA 4UP7A 4LNFA 1D5XC 1HNZL 1V1QA 1ZXHA 3B0AA 3V60A 1PDQA 2WXGA 3RLNA 1E8XA 3ML8A 2R7DA 1T5EA 2D3CA 2RDFA 2L32A 3Q3NC 5JJZA 3R2IA 3PV1A 4DR2Q 4K7SA 4J15A 3TEHB 2NMQA 1E22A 1E8ZA 2QHOA 4MACA 4BOSC 4IJLA 4PV1C 2DLBA 3H7PB 4HK2A 1AZPA 3EFXD 1PMRA 3S1NB 1YMHE 4P74A 4H7BA 1X3FA 4PQXA 3RD4A 1TTNA 1N5WA 3KW5B 1SGHA 1NCVA 4MHEA 4K3BA 4WURA 5G2NA 2D9UA 4E74A 2CU3A 4ZRZA 1TS2A 3J7A5 1FNWA 1KRSA 5JVH3 2ZW1A 3NE5B 4NPNA 2Q2IA 1ENCA 3K5OA 2D10A 2OOBB 1EF5A 2HDEA 3KLWA 4MELA 1O7LA 1SMXA 5CORA 4YCUA 2PI2A 2L5TA 2IPKD 3ZTDA 4MM3B 2Q8IB 2Z4HA 1P98A 1WD1A 1M1KC 3E0JA 2KDFB 1F52A 2KLGA 1B7YB 2DJFC 1UE6A 2I46A 2CCZA 1RRBA 4EZJA 4BXXG 1V1OA 4NZLB 1EWIA 1SB3C 3W5OA 5FO8B 2OWOA 4NNJB 2YV5A 3E6ZX 4LFCL 3IXSA 2WX1A 5M3FG 4JI3Q 2ZCCA 3C1EA 1L0WA 2JWUA 1V49A 2KVZA 2JWZA 3S1NH 2CW0C 5GAEC 4HWIB 4NAMA 1PQSA 4HR7B 2RQXA 2XTIA 1PH3A 2ATWA 2HUGA 4DK3C 1EIHA 1GUGA 5EPJA 4KGTA 3M62B 2QEJC 4WH4A 3PO0A 2BDOA 2BF8B 4F7XA 3BDCA 2EJGC 2EY6A 3KVFB 3Q8BA 2CH4A 2N3SA 1KNEA 3CXCA 1Y8NB 3HOWG 4A3EG 1DYQA 2M17A 5DPRA 4ZHOA 1ZXIA 2MBBB 4ZUIA 3KLRA 4FF4A 1EUJA 5K36G 3GTQH 3DBLB 5A35A 1EFID 3FKYA 2INCC 4W9IA 3SHQA 4K8IA 1LUZA 2NR2A 4GSWA 1JWAD 3VYRA 4POFA 1YX5B 5M5YB 1X6OA 3A8IE 3CCQA 1IBKQ 2X69A 1XO3A 2FCSA 3L0WB 4MT5A 4OVZA 3RNAC 5J18A 2LXJA 1Y1WG 2WYQA 1FXTB 2FINB 3I4MG 3NUHB 4P6VF 4F8CB 2LD9A 2ZZPB 4TQUS 5JEAG 2CFMA 3I63C 2F0SA 3D8GA 3TUOA 4DHJD 1NE3A 3HKZE 4B9KA 3ZJYC 3GV3A 2JXMB 5IOCA 2ZJRA 1AZQA 2B63B 4KGRA 5M3MG 5DEHA 1WFQA 3CRLC 2PW7A 3DM1A 4C3HH 2INDC 4FP5D 2NVQB 1N36L 2RF4A 3NS1A 4I7AA 3TS2A 5BR8L 4A6QA 5FLMG 3A9KB 1Z6HA 2LSSA 1V80A 1VQ8A 2LJ5A 3RN9C 2F0JA 2K5DA 2N7JA 4REZA 2F3IA 3J80c 3BK2A 3ECIA 3KQ4A 3IT4B 5BO4B 2B2WC 2K0PA 2KJXA 1Y1VG 2EXZA 3I57A 2KHSA 1L0VB 2PVOD 3AULA 3U7DA 4DV1L 3GTPB 4N9TA 1J7CA 1HEZE 2WU2B 1CUKA 4A3KH 4QMGA 1JB7A 2JA7G 2DWQA 2XBBC 4ILWA 1DGJA 2AWOA 1YQ4B 4KY6A 4HPLB 2BA0A 1J6QA 2H88B 5HY6A 1PXUA 2A68D 1NMGA 2P5ZX 2VUMG 4A3BH 3S14B 2DAFA 2BKFA 3VTUA 4FO2A 4KKUA 1Z5SB 1SJED 4A75A 4YSZB 2B2UA 4L5TA 5C0XG 2IO2B 4DBGA 4QUCA 4HCEA 3CPWA 2NCNA 1SAPA 2FUHB 4MH8A 1HR0Q 4Q5VA 2IJ0A 4EQPA 3BJUA 3MXGA 1EU3A 3EC8A 2NPTA 3IAS1 3NTKA 1K83B 3S1QB 1SNDA 5DM73 2C5CA 3CQZB 3PVLA 5CTRC 2BH8A 1RYJA 2TMPA 1I3QH 3PIPA 2H89B 2QGQA 4YY3L 1HXYD 1I4QA 3UQBA 1ML0D 1H9MA 1TWGH 2A5HA 1PTOC 4KLKA 4DXFA 3AE3B 3B9JA 1KDCA 1ENAA 4HTHA 1K73C 4NJ6A 4I6LB 3T8MA 1P8LA 1GVPA 1LT3D 4DAVA 4XZ4A 2ZEQA 1BBWA 3NQTA 2FIDA 3FILB 4KD4A 5EKIA 2R6GA 4WJWA 2L7RA 2CH4W 4Z9CB 1JR0D 3NZUA 1JWBD 2AHOB 4MGKE 2CJNA 4YSYB 3CPFA 2EXDA 3MC0B 2CHWA 1DOMA 4DAYA 2KA7A 1N33L 3TP5A 4JI5Q 4A3LH 2K1BA 3TP8A 3DPDA 5HG2A 4JG2A 2E6XA 3AYHB 2A6HC 2KMAA 4M1UB 5D3DA 3AE6B 4CO7A 1IBXB 2A6HD 3FRPB 4LFAQ 5KEEA 1G6ZA 2KVRA 2B3GA 1PRTB 3RNUA 3PO3G 1VRAB 4JI7L 3S9WA 5IT9L 2CQOA 2D0OA 5LNK1 3S2AA 4A3IB 1F2MA 1VCBA 3HRDD 2N9KA 1YD8U 4FJVB 2LXKA 2JZPA 4MM3A 2Z0EB 4DDID 1VZ8A 1RKNA 2IHEA 1Q82C 1XQQA 4XYCA 1PTOD 3KLSX 3EJIA 3F2BA 2WXFA 4JCVE 5BMGA 2RD0A 4BY1H 2F0KA 3GTOB 3I4MB 4RMAA 5CV4A 3I55A 2E2DC 4XQJA 2ICEC 3KBGA 1ICFB 1K9MC 2NBUA 2PIAA 2OXPA 1JWMD 1FFUA 4KY7A 4JBJA 5IGBA 2MBQA 1QUQA 1XMOL 1YJ1A 3OG5A 1IP9A 1A0IA 1ZYRC 2D3GA 3T4AC 2JT4B 5EE0A 3MEFA 4ZLTF 3V2TA 3PIOA 4R4CA 1NVID 3MAQA 1AEXA 4JV5Q 2BYEA 4NY0A 4GDKA 4XTCS 4G0NB 3H6NA 4PMBA 4JI4Q 1II3A 1DOLA 2A68C 1TJEA 1GAQB 4A3CH 3L0OA 1KABA 4ZYNA 2N88A 4IJHA 1HFGA 1MI2A 1HRJA 4TV3A 4HLEA 4BVUC 3RN2A 1R9TH 4BS9A 1KC8C 3ETRA 2B2VC 2LMCA 5I4DA 2UXDQ 1BR9A 3DWGC 4FN2A 4DR2L 1CA5A 1SSNA 1JWUD 2PQAA 4OWXB 2EDGA 3LX0A 2LY7A 5DM63 4XT3B 3GTPH 4EVOA 3NP8A 1WTWA 4LF5Q 2K8CA 4DV7Q 1EOTA 3PREA 3SK8A 2AL3A 3KYCD 1D8LA 5DNFA 3CC2A 1X3EA 3QOLA 5I6YA 2IO0B 4TMAB 3ZNHB 1C9FA 1C48A 3A5ZB 3I8ZA 4USAA 1XJVA 2JRHA 1Q5WB 1TU2B 4BFRA 1B44D 3HKZB 4OZCA 4RM9A 3RLFA 3DBRB 4L8JA 5GAGC 4LNOA 1V6EA 1FJGL 4WJPA 3T1YL 4GKJQ 1JORA 4PZ8A 1D1KA 4DV3Q 3RPFC 4IWQA 4WAAA 5EBDA 1UWXA 2WAQB 3JSVA 3RUZA 2WU5B 3O65B 1C4AA 5LMUQ 4F1SA 5FJ8G 1UAPA 2LRUA 3FKIH 3ZGZA 3KUPA 1LT5D 3BZCA 4TRDA 1N8RC 1WXQA 3M7NA 1MG4A 1LFDA 4ZRPA 2KNBA 2JQRB 5GROA 2B2YC 1EY9A 1F2RC 4HJKA 1PH4A 2JEBI 1SIFA 3NVYA 2I1KA 1QZEA 4JV5L 3VRBB 2DGYA 1C4QA 4N9F4 4OL7A 5LMUL 1WSPA 2LMCB 1STGA 2MO0A 4HJ8A 2B63H 3NZ3A 3M4OH 4IOIE 1F2LA 1EO6A 1AE3A 4C4VB 1PH9A 1D7QA 2N8NA 1E2ZA 4LW1A 2CKHB 3PLUA 3OJ3A 4BZAA 4OZBA 1OQYA 3TIXA 4IUPA 4A3IG 1HZBA 2LZ6A 2BPSA 3EBEA 4GOPA 5EKKA 2OEOA 4NPSA 3CF5A 3V3XA 2GI9A 3WOEA 2JA6G 3RZWC 4WRDA 1V9JA 3CWIA 1RFAA 5C0XH 3T56B 2YVCA 5D3IB 2H5XA 1CKNB 1VQMA 2B3AA 5ELFA 1EY7A 4U673 1U5KA 2RDHA 3BVZA 2WX0A 2KJRA 2ZNVB 3R7RA 2I0QA 5HHDG 2Z6KA 1F1HA 1GNUA 4EZLA 2JP1A 1NUCA 2LVOA 2ZT9C 4JYAL 2NBFA 1S40A 2WXIA 1BDOA 4M0WA 4BAXA 3I7FA 3J81c 2KEEA 5D65A 2RCNA 2K32A 3Q8CA 2GA4B 3JW0X 3U50C 3S2HB 3W3AA 3M95A 2PKOA 1VQ9A 3VUXA 2EKEC 4LTUA 3HOXH 4YCVA 1VQCA 5FLXL 1KM7A 4PS3A 1VJKA 3BYYB 5IE8A 1OXTA 1QOHA 3F2UA 2KN5A 1UH6A 4YCWA 3N32A 3GOEA 3MC9A 1GC7A 2G4DB 1OXSC 3PUWA 1XMOQ 3AXCA 3FC4A 3UIOB 2JJQA 3U9SA 3ZDMC 3A4SC 2JK8A 2K5HA 1P3QU 4P2CB 4JOIC 4UY8C 2PQEA 2VZKB 2F4IA 5KNDA 3RMKC 4C1NK 3PIO3 5GMVA 4W9JA 1P1AA 1GO3E 1XMQL 3PV0A 1GOZA 4K14A 1IW7C 4W9GA 3OTOQ 1W3SA 1I4RA 3L13A 2KOLA 1FMAD 2KQ7A 4AOFA 1MJEA 3VA7A 1WXMA 2G45B 1ONLA 3HOUG 2V3SA 4FHJA 4K3CA 4OIJA 1K8RB 2J7QB 3Q3OC 1IYUA 5C4XB 4ZKCB 2LASA 4GDLA 2Y0SE 3T16A 1VQPA 4HSVA 2R2OA 3P4SB 2HD3A 3DHQA 3CSFA 1SIJA 4GOCA 4RKBA 3WOFA 1ZUD2 2AL6A 1L4DB 3W1BA 3N1YC 4NAWB 4OONA 1P16A 1BCPD 1V8QA 3UGBB 3VDZA 1A15A 4RG1A 3KBXA 1WX9A 1GM5A 2Z4IA 2XWBB 2OT2A 1IL2A 4LNNA 3PHXB 1QG7A 4HAEA 3DVNV 1JE5A 3UF8A 3HKZG 4PT5A 4A90A 2DNCA 2KHIA 4CYEA 3SGIA 5E7NA 3A54A 2QSDA 3MHSD 3U7ZA 4JI5L 3AECB 1UUPA 1WJNA 4DHJB 2F0PA 3PZDA 1E7UA 3P1MA 1MBYA 2HQEA 2MBEA 1JQ4A 4IFDG 3V61A 3OW7A 2FCNA 4TKOB 3M9BA 2IBIB 2DY8A 2KWUB 1AW7A 2MBOA 3W2DA 4CDDC 5LMNW 5HGQA 3HOYG 1VR9A 3S1RB 1ICWA 1FL0A 3UE0A 4K1RB 5A2QE 4B3TQ 5HFYA 3K57A 1OXUA 2ZNVC 1UNSA 1WYDA 1A3VA 2A6ED 3NPPA 1KXLA 2KJHB 3A4RA 4IPGA 4JI1Q 1MHHE 3EHVA 2DZMA 2CJOA 3IHPC 4KKSA 1Q90A 4QL5A 2Q8TA 3V96A 1XMQQ 2K5VA 2A6EC 3NOBA 3PHWB 1VQDA 2DZJA 3AE9B 3T51B 2JY6A 3FVQA 3NK9A 1DXMA 5IP9G 1IBLQ 3KJOA 4DR7Q 2W3RA 1XF5L 2WXJA 3GE8C 4ITKA 3UINB 2LEKA 3PF5A 4A3KB 4FF2A 4BA2I 3ZIMA 4HPPA 1WH3A 4LF8L 1YQBA 3P20A 1PFDA 1N60A 3A1QA 1V43A 1WIAA 2X8XX 1L2NA 3PO2G 5JHBA 3BIID 4PZ6A 4H02A 4IFDJ 1Q81C 1IZ6A 1YQ3B 1GB1A 2INPE 4HJ7A 1LM0A 1K28A 2ZPYA 4BWGB 3DCGA 4DAMA 3ALBA 4A8XC 4DNRB 3CCEA 1KRTA 3G48A 3TL5A 3GB1A 4ZKBB 5BN3A 1MG8A 5IGGA 5JHAA 2HDLA 1YJ9A 4XGAB 1XPUA 1ZDVA 4A4IA 2BS2B 4JYAQ 1D5MC 1AWDA 1B3QA 3Q2AC 4J8QA 1FM0D 3GTJH 3LWUA 2MHJA 3MHZA 2WB1E 5C4JH 4IN3A 5FO9B 2UU9L 2KBNA 3PUZA 2MUYA 3L7ZC 2KACA 4BY7H 1WRDB 3F8TA 1UWVA 4P72A 4X66Q 4FHKA 2Z6KC 2JA6H 1CMXB 2Q2HA 3D4WA 5KYLA 1PYSB 3PPAA 2D0PA 3Q23A 4ASWC 4HKQA 4GU2A 1NI3A 3PUVA 1U4PA 1V97A 3R2TA 1ROEA 2VS1A 4MTKA 2OQ0A 1JT8A 1MD2D 2JA5H 4C2MB 2OJRA 4B3SQ 1XPRA 1B2TA 3GE3C 3IVFA 2VUMB 2F0GA 2CVRA 3QCAA 5IT9c 3VR6A 1RFKA 3PUXA 1SNQA 3D31A 4KV2A 2F0TA 1IGDA 3K9OB 1XLPA 4ANXA 5BYQA 1LTBD 1L1OB 5HGTA 4APVA 4ARIA 1JJ2A 4CDFC 1L4ZB 4GLVB 2MEKA 5EE3A 1M4VA 1PLFA 1PRTF 1O80A 4LJZC 4HCPB 4A3MG 4YSXB 5HKHA 1V8CA 1Y1VB 2AEHA 3F1ZA 4G3XB 1HQRD 5M9OA 3HHMA 4DV2Q 3SEBA 1S5DD 4FF3A 1PDXA 2ALYB 5FKAC 2JE6I 1UZXB 2BDNA 2X6LA 3M63B 1KAWA 3P42A 3DEOA 4YIJA 2SEBD 2J0TD 1VMPA 1SDFA 1CSQA 1PFMA 2PMZE 4X3TA 4CJ0B 3OW2A 3HOZH 2E3TA 5CC4A 3SFDB 1IHZA 3TREA 1FPYA 3IT6B 3HIZA 3C2PA 4A93B 1FXAA 2BGFA 4TVAB 4BBRH 1TKEA 1FGUA 1N61A 3PQIA 1XCTL 4JPSA 2RSUA 5D7GA 2E74C 4GNXB 1UGMA 5IKCM 4U68A 4YHHL 3T3OA 3MJ5A 4KDLB 2B8GA 2V1CC 4JK1C 4NDXA 4P73A 1R4QB 1R4NI 4PYZA 1CZWA 4F87A 3H1UA 1BUVT 3CCMA 4LF7Q 1NDDA 1A2UA 5JPNC 3VR4A 2JPHA 3AEGB 4OWWB 2Q2TA 3UI2A 3B6YA 4LMQD 5CV6A 1VQ7A 2WLBA 4RGTA 3OHXC 3HZXA 1PH2A 1HNZQ 2HJ8A 2DUDA 2RBMA 3TEYA 2IW3A 1C0AA 2B39A 2AUKA 3APDA 2N9LA 3EFCA 5IODA 3Q8FA 2IGHA 5E6OA 3D6CA 1GPXA 3NHHA 1E6EB 1SJHD 2EYHA 1N32L 3M3YH 1S3SG 1GJXA 4UAIA 1KTKA 2R93B 3CP0A 4BA1I 1F2YA 1J7AA 3FDTA 3G6JB 2MH7A 3AU4A 3N1XC 3RNGC 5J17A 1T0QC 2K22A 1K3RA 3H6MA 4NXNL 3V05A 2Q2UA 4B3ML 1VZ7A 3GZNB 2WXOA 3N20C 4PNYA 4JI0L 3TEWA 3HOVH 1LTLA 5GQOA 5BYRA 2AQ1B 1K8AC 2MO1A 1TVXA 1OGWA 1DCZA 3KDFB 3MXUA 1SRUA 2M19A 3A8KE 3N30A 4LDTB 1VQIA 4RH6A 2UUCQ 2FNJB 2K6DB 3BG3A 3K6OA 3B2FA 4J6IA 4OZAA 2GN5A 2NZ1D 2E76C 3P1HA 3RD2A 3CMMB 2A8VA 2PI2E 1IBMQ 3FMCA 4WWOA 1S1QB 1H9KA 3OYYA 4IM3A 4K6DA 4V0BA 5IWAQ 2QF7A 1E3PA 1WX7A 4US8A 4GLAC 4HCNB 2IGDA 3GTOH 3I4MH 1VDVA 3A74A 3RN5A 2WXMA 4KHPQ 4AH6A 4MJSA 1N34Q 2KAJA 3P4QB 1WI5A 3I70A 4UDUC 1K8MA 2LKVA 3RT3B 4R4QA 4CJ1B 5IGCA 3MA2B 2RMMA 1TWFH 1EY6A 1Y1WB 2GBNA 3E9SA 1N6ZA 4OGQC 1K53A 4AIMA 1WVLA 4IG7B 1TR5A 1FXIA 2AWTA 5FLMH 2A4ZA 2KOXA 5EE1A 4GN5A 3QC8B 4G50A 4GXBA 1Y56A 3R8BA 1V81A 2AMCB 3L2PA 4DR4L 4RA8A 4KI0A 5ELCA 4XC2A 5CMDA 3ZYYX 2ENBA 1Y8RC 1E10A 4C3IH 4TQ0A 4HJ9A 2UXCQ 5IYBG 4KIKA 3S1MH 1X3QA 1A5RA 1TWAH 3HOWB 4MTNA 2I1JA 3RULA 5JH5C 3HOZB 3MXNB 4I65A 1SYGA 1C78A 4R4TA 2JA7H 3WA0A 4LJPB 4OEMB 1FR3A 1PRTC 1B8AA 2J42A 2QW7A 2KFJA 2NTTA 3S16H 1TY0A 1A3UA 5C44G 3S1MB 2PMZB 3ENEA 1NEKB 3ZXVA 1NTGA 4PK1A 3ULJA 4DUZL 3VHTC 2LS01 3ULLA 4ARCA 3NWTA 1R4PB 4A3DB 3HOXB 3TZDA 2R7ZG 4IM0A 2Q8RE 1WTXA 2G4SA 2KQ3A 1S5ED 3ERQA 1WJJA 3S16B 3NHEB 1G291 5DPTA 3S1QH 3UDFA 4A3DG 2XGTA 1T9HA 2DAJA 5JZEB 3IAYA 3A5UA 1XTCD 3KOJA 2J4XA 3E9HA 1T6BX 1ZDXA 4FDBA 4LF8Q 4ME5A 4NQLB 1BCPF 4A3MB 3JSVB 5TR5A 2NBWB 1PFSA 1TWAB 2UXBL 4DV6L 4Y7NB 3LDZE 5GAHC 4IW0A 1N5XA 1ASZA 1J5EL 1OQQA 2M9VA 3I73A 4O2DA 4MGIE 1YX6B 4A3FH 4F7ZA 4AS1A 2F1MA 4L6TB 1WTOA 1FYCA 1VQHA 2L4NA 5GXGB 1AN8A 4PYUA 4BBSG 3X3MA 2ZW0A 1PGAA 2Z59B 3DVGY 2IO1B 1E5WA 5T8IA 3D4RA 1K50A 3FEWX 4A3LG 2MRPA 1YN4A 2LVPA 2IX0A 1QVCA 2O4XA 3CRKC 2DZIA 1GB4A 4AUQC 1D3ZA 2M2LA 2AUJD 1WGDA 3URYA 4RHSA 3V6EB 2EJMA 2NTSA 1KDAA 3CIRB 3AN1A 1VD2A 2EMTA 2D3BA 3RLOA 4RAUC 3H09A 1BCPB 2UUBL 1VF5C 2QIEB 4ZYSA 2KHJA 4K2LA 2N1VA 1LTSD 2JU6X 3KUCB 4A3JG 2MP2B 2O2VA 1H9JA 4ME3A 4O1NA 3S15B 1WTPA 4P16A 2RSOA 4OIKA 1WYGA 3MTNB 3PLVA 2DENB 3I5JC 1MIUA 3LYYA 4DQOC 1E9MA 4RWSC 4QY7A 3DHGC 2ID0A 1HJPA 3VTVA 5FOBB 2KCMA 1YVCA 1DONA 4QIWE 1WY8A 3I4NG 4CGYB 4A3EB 1WGKA 2E2JH 3AE7B 3HUIA 3W1YA 4R3DA 2JSOA 2J7ZA 3BDOA 1B9RA 5FR3A 1RLFA 1FRRA 2MP1A 4FVMA 1NAPA 4LDTD 1FNVA 4GN4B 1RM6C 2OF1A 3EUB2 4KHZA 4A3GH 2V3NA 3VYUA 4EQ5A 1ASYA 1TZOA 2WB1G 4C3HG 3HK0A 2K4KA 2QKIC 2NVYH 2MP2A 3K5LA 3CCJA 2H1EA 4DR5Q 1WCMH 2AYOB 3L54A 3RZDH 3M3JA 2PPHA 3LGJA 1YEZA 4GIVA 1FGBD 3EROA 1CJEA 3E56A 1EY4A 1WYWB 1KLGD 1I50B 2G5DA 3U4EG 2GBKA 4LAAA 1ACCA 2NVXH 1U4RA 5C5LA 1CZGA 4RMFA 1WWTA 4FA6A 1KH0A 1SE8A 4A3KG 4POGA 2YEPB 3RZFA 3ZW3A 5CX3A 5ELOA 2GMIC 4FBJB 3CCSA 2K5NA 4IUNA 1X9NA 3C8YA 1VQJA 2KC1A 1SFOH 1FRDA 2CWAA 3NBHA 1R4MI 1A62A 4A3BG 2DNFA 1BMLC 4AJYB 3GP7A 1Q1OA 4ZAIA 4NAWA 1EY8A 5IYCH 1L2FA 2F0IA 3LWEA 3TCAA 1VLBA 2J0KA 1TXYA 4DHZB 3DBHI 1PRTD 1GD7A 2Y5BB 3I4OA 1G8ZD 1FD6A 3PRMB 4C00A 3SXHA 3I9V1 3H94A 4E6IA 2EMSA 2I38A 3OJ4B 3E3XA 3NELA 3NVZA 1WMHB 2NZHA 1J19A 4HMJA 4ANVA 1VQEA 4CHKA 1KFYB 5EKLA 1FEHA 3U9OA 1VQAA 3NZSA 3CD6A 1WI0A 1NI2A 3ERSX 3DHHC 4CJ2C 2O6VA 3R7QA 5JOBA 4KK7A 1EL0A 4HDOA 1ET6A 3IKJA 3QOJA 4DUZQ 1I6HB 1E90A 3NVVA 3W5UB 3GTKB 3Q69A 1QVGA 3HFZB 4FXDA 1HA6A 4GDKB 3MXNA 4KVGB 2K50A 4ZUJA 1T0SC 1SYDA 2Z9HA 3EVQA 4XXEA 1P9DU 4DU9A 1XNQL 1STAA 4B08A 4K0KQ 1FO4A 4ZOHC 3CCUA 2WNMA 3LNNA 2FMMA 5LLIA 4ZRKA 1JB3A 5IYBH 1LV9A 4G4KA 1GUWA 2L05A 4ZQ3A 5M5WB 1WD0A 3HEJA 4C2MH 1RJTA 3VR2A 4DV1Q 2Q5WD 4W9HA 2OTJA 1VZ6A 1WM2A 3MVVA 1YJNA 1J8IA 4DR1L 2KWCA 4RNAA 2QCZA 4OWTB 2KHWB 2MJDA 1Z47A 5IY0A 1ZPSA 1DM0B 1HZAA 3PCOB 4UHVA 4MJSB 4JC0A 3VQIA 2EYPA 4FLHA 2C9OA 4AP4C 4GB9A 4XQNA 1MHWC 4XDCA 4YTNB 1L6UA 1HTQA 4R8IA 2BS4B 2CQAA 1MHXA 1GKHA 1OFFA 1PZJD 2ZPNA 4AJWA 3G71A 5AUIA 1VQGA 2ACZB 4GN1A 1E1OA 2F0FA 1I6VC 5CHVC 2I5LX 1WR1A 1P0RA 1VS0A 1YOVB 2KCTA 4EQOA 3VFKA 2C9WB 4DR6L 4DV0Q 1K8OA 1OEYJ 3BVGA 2JSVX 5IGDA 3ZRFA 3AB5A 1HPCA 4XE0A 3VYSA 1VQ5A 2NS5A 1D4BA 2Z6BA 2OHFA 3IG3A 4C7ZA 3G7LA 4MIUA 4YTPB 5IA7A 1U4LA 1I4HA 2QDFA 3IBEA 3B08A 4C80A 1I4PA 4DDGD 1KL9A 1QUQB 3U4VA 4A20A 3H9DA 5IO9A 4DR7L 2I5MX 1X54A 3NTIA 2N9XA 3GTJB 3K0XA 4RM8A 1BQQT 1SYFA 1F9PA 2A19A 2F0HA 3DVGX 1QKZA 2ZJDA 2ZTEA 3KUDB 3I72A 2M8SA 2PJHA 3ZJUA 4L5RC 5JVG3 2MSED 3OIQA 3S2DH 1NYQA 2UU7A 1EY5A 3GD7A 4HIMA 2R93H 3TBLD 1CK1A 1N36Q 1Z7TA 4K7WA 4B95A 4DK5A 2HHHQ 3MWYW 4Y52H 1SNCA 3A9JA 3BY4B 3SK5A 3GTMB 2MJEA 2J0MA 1EQVA 4DGZA 4ICUA 1WE7A 4ZCKA 3HKSA 4R9WA 5AFWA 2NN6H 5FR6A 1Q1EA 3RNCC 1HNWL 1WRIA 4JL9A 4FXGC 3SD5A 3P4PB 1KIXA 1ESFA 3N52A 2E8GA 3WAOA 1X55A 1EF1A 5I9OA 1EU4A 3TBIB 2KCNA 2YTVA 3KUZA 3H3VH 4W9KA 4YWKA 4OO1I 4X64L 3I3CA 4QIWB 4J6HA 3F2CA 4BXXH 4Q0FA 2VY3A 5CHFA 4LCDE 2DNEA 2K04A 1S5CD 3A7LA 3FKIG 1RF2D 2BW2A 1HZCA 3HOVB 5ELDA 3PTFC 2IX3A 5IYDH 4JBWA 4OO1G 4X66L 1WM3A 2PQAB 2WAQG 3OIPA 1YNTE 1MI0A 2WXRA 4QF4A 1N32Q 3VYTA 1W6JA 1ISNA 4DR6Q 3OWEB 3P75A 3EFUA 4FJYA 2HDMA 1LT4D 4IC7B 1YZ6A 5AZGA 4FULA 3A33B 2KWDA 5C44B 4XWWA 2HJ1A 1X3GA 3KLSA 3R3MA 1JRUA 4M8NA 2AQ2B 1U4AA 3FPUB 3MC8A 1WFYA 2PLPA 2WDQB 1MJDA 2K8BA 1YHBA 3L08A 1IPGA 2EOTA 3HOWH 1PH8A 1C77A 2FBWB 2RR9A 1SN8A 3KYDD 3LB8C 1ZP0B 4LF5L 2F0EA 3PIP3 5K36H 1PFBA 3HOYB 1WMHA 3AEDB 1VQFA 4KTAA 1Q3LA 5IYCG 4N9PA 2WFWA 5C3EH 1WTVA 5CV7A 1C4PA 1E2VA 1I4GA 1EY0A 4TQ1A 5EBCA 3QWNA 3TEZA 2Y0SB 2NVXB 3AEAB 1O7IA 3TP7A 1YN5A 4IWOA 4H0LC 3AEVA 4EOYA 1FIQA 1WE6A 3APFA
chains in the Genus database with same CATH topology
5C0XI 1ESRA 1V1PB 1QT9A 2VZKD 1KRHA 2SAKA 1NSNS 2SOBA 4G57A 1W6KA 2MJ3A 3H91A 3SFEB 2F3WA 2KMMA 2R3ZA 2F0NA 2VNUD 3K5MA 4HCSA 1PGXA 4XYQA 1SYCA 5C3WA 1T5XD 1B9NA 1NR2A 4K5XA 2I2YA 1QLBB 1LACA 1X3PA 4CKEA 2M0AA 1G91A 3A56A 3A55A 4XYOA 3AE5B 3AEBB 2B2TA 1CHQD 1LTID 4YWGG 2R61A 2L0CA 4RKLA 4HROA 4A55A 3OPOA 1TS3A 5ELBA 1ZOYB 1SFOB 1B50A 2F0QA 1IYVA 1F77A 3TDQA 2NWGA 1PTOH 1XLOA 1MGSA 2LFNA 2WINB 2OEDA 2TSSA 5BN5A 1JE4A 1B9MA 1JALA 4LK0M 5CBAE 2JA7B 3QJYA 2EPBA 3ITPA 4RCNA 3K0YA 1C4CA 1F9QA 1TKWB 3D4DA 4HJGE 5J39A 3QG1A 3MHBA 2DYMA 3L4PA 1HA5A 2WDVB 3OSOA 2RDGA 3E5SA 3OMCA 3TN2A 1KNAA 3NQIA 1XCQL 3EQLC 4A3GB 3DMUA 4XQQA 3AE4B 3HG9A 3ZJVA 2Y5PA 3C46A 1JOQA 1CHPD 1RHPA 2R7ZB 1IW7D 2XRSD 2QDBA 1F2RI 1JOKA 3MXPA 2WS3B 1UEAB 2M56B 3RZDB 5I9PA 3NXWA 2Y5CA 2EY5A 4IALA 1AFPA 3M85A 3AEEB 3HGBA 1O7ZA 2NN6I 3GQBA 4RCOA 1QNUA 2BE5D 3HVDA 3VR3A 1NENB 2VXWA 3LXFA 1EWYC 2WKCA 1LABA 2B8FA 1BXTA 2YEPF 1QE6A 5C2TB 1I3QB 4OO1H 4IFDI 1CA6A 4F8MA 5I6WA 3GV6A 4KMUC 2HTME 5E6JA 3NVWA 2F0DA 4XDDA 3KWVA 3CU7A 1GUSA 4RHRA 2KCCA 3OMGA 1J9OA 1PGBA 3ONAB 1LTTD 2BBCA 1D2BA 2W55A 1IL8A 3SE0A 2SNMA 1MPEA 1EQTA 1IKMA 4GZYC 1CT1D 3VA5A 4CHTB 4K5WA 3A7AB 2BE5C 1N63A 2BCOA 1D6EC 3K5NA 3CHBD 2EYFA 4QCLA 1TT2A 2MPMA 4QUFA 1KDBA 2LFIA 3IL8A 1OXXK 4L2YA 1ILQA 2K7VA 1Y8OB 2XWJB 1DOYA 1TY2A 3HS0C 2JEAI 3B2GA 3H8HA 4WWMA 3NWSA 2F3VA 5CBEE 1C79A 1A70A 1XYIA 3FILA 2L83A 3AE2B 4HRSA 3SK4A 1F9SA 2FMCA 1Q1BA 2WDRB 4DK0A 5BMHA 1TIID 4A3BB 4KJOA 1AP0A 4G7OC 4DFAA 4YXDB 5EGTA 5G5HA 1CQFA 3RMHA 1O7YA 1TS5A 1KLUD 1UGJA 3JAME 4C56C 3H0GB 5FLXE 3IFTA 1TWCB 3Q8EA 2B2WA 1A3TA 5NUCA 1TWGB 4IQZA 4BBSB 2ICIA 5LL6X 2E2HB 2V3PA 5D14A 5CV5A 3U52E 2BB5A 4AYBB 2B76B 1SXTA 4IZ8A 3AE1B 3R93A 1VMCA 1BOSA 2O5IC 1QOGA 3VR8B 2IGGA 2VB2X 2XNAC 4BY1B 3BWUD 4FXCA 2JXTA 2BT6A 1ENFA 1SMYD 1U4MA 3NTHA 2F0WA 1AYFA 1Q8IA 1BF4A 4KN7C 1I7HA 4FNFA 2F0LA 1PYWD 3I91A 3P7JA 4LK1C 2IDYA 1CZPA 2WXQA 1ILPA 1QNKA 1SEBD 2K28A 1X32A 2KVMA 2W82A 5LHY1 3I4NB 2L55A 5MPOA 3L9AX 3M3YB 4KD3A 1HFNA 1BCPC 1JOOA 4K5VA 1GHKA 4KGSA 2A69C 4JWSC 2F0VA 2IT1A 3JAML 1G2SA 2GB1A 1M8AA 3Q0AA 2HCIA 2JA8B 2ZXPA 5FO7B 1K52A 5AUKA 2J52A 2JX5A 2PW9A 5C3EB 1CI3M 1Y69U 3J81E 1RTNA 4HSPA 1H9SB 4R8NA 1FFVA 2W54A 1HZ6A 3S17B 4C3IG 3Q6SA 1S5FD 4NW2A 2V0GA 4H13C 3SK6A 2AQ3B 1JCKB 2L1AA 2WQYB 4F88A 1CM9A 1SNPA 1H9SA 1SE4A 1C8CA 3AB9A 3TMEA 3C3LA 2JYEA 4ZHPA 2FFKB 5C6AA 3BK1A 1FNUA 5EJWA 4C7YA 3OOCA 4BY7B 1YNND 2DBYA 1DD2A 2NVTB 3J81L 2B2TC 4JE3B 1HQMC 3SR6A 1T3QA 1QILA 4C3JG 3W1SA 3T13A 3DXJC 5CV8A 1JICA 1E7PB 1V1PA 3W9CB 1XWEA 4A3FB 2JA5B 1DZ1A 2E2JB 1NR4A 2PZUA 2X38A 4OW0A 5G3LD 5I2YA 4LLGM 3TP6A 4K8JA 1U9RA 2KEDA 2RSNA 1GHJA 1SF0A 1NYRA 2AWNA 3SVMA 2K6AA 1A2TA 3H3VC 3RZOB 1XLNA 1HTLD 2F0OA 1HHVA 4IUQA 3M4OB 1TQOA 5EQ0A 2D5GA 1DOKA 1N62A 1HTPA 4Q2JA 4US9A 1E0ZA 2RPVA 2D62A 4HN7A 2KQ4X 3NUCA 3VR9B 4CKCA 1QWYA 1BO0A 2PYKA 2NB0A 3J9CA 4L63B 1UWMA 1SBBB 3M4YA 5M3FB 5KRUA 2Y3AA 3BDLA 4C3JB 3QIAA 4RFBA 4FXKC 4RF1A 2WXKA 1STNA 2XRQD 1BNZA 3VR5A 1L6VA 2EYLA 1JRPA 1EWCA 3U2SC 2PTLA 2HCCA 4H44C 4B9XA 3C1FA 2IX1A 2RKSA 4KX6B 3J80E 4DN4M 3L3OC 1VF7A 1YNJD 3BZDB 3P4RB 4J3OD 1DOXA 2KUMA 4HKZE 2V4IB 2W3SA 2WXLA 3PZ8A 1QF6A 1SE3A 4DXGA 1OQRA 2K3UA 3ND8A 3R3OA 3UI3A 4WFN3 5ELEA 1YNJC 4IUVA 4CQNA 1ET9A 3N6RA 1P7EA 3VRAB 1SSOA 5IGFA 2LJIA 3ZJTA 1JMLA 5JEAH 4KJNA 3IFDA 4A9AA 2PZTA 1EWHA 1WCMB 1QCBD 4V190 1ZYRD 5FK9C 1R7SA 4HMIA 3T3NA 4L23A 5EE9A 4PMWA 2WXHA 4A3JB 4KHVA 2YYZA 1CTMA 1XLQA 2DYOA 3KWLA 1KAAA 2Z1CA 5BMIA 1L5PA 1B4OA 1C76A 2MGSA 1RODA 3PMFA 1TWFB 2QJLA 1GUNA 1LTRD 4IUUA 5JAVA 3QB3A 4N59A 2A69D 1KF6B 3QO2A 2NUCA 1MVKA 2O5JC 3CKIB 1TYGB 2WXPA 4C3IB 2B2VA 4CKBA 4ULLA 1L0YB 1Y8PB 1EYCA 5J1ZA 4KY5A 4DF7A 5J22A 2LUMA 3BVMA 4KKTA 3DUZA 4HEA1 2FHTA 2LHDA 4XWTA 2CHBD 4C1NI 3TEXA 3OWFA 4B9WA 5EPKA 4N58A 4XDXA 4B0MA 1RTOA 2NYZD 1EYAA 5ISRA 4HEDA 2V4DA 3PO2B 1J7BA 3NBIA 2N0SB 2QCPX 4D2KA 3AE8B 5CYUA 4XT1B 5AUIA 1RCVD 4BBRB 3S2DB 1B1ZA 2DY7A 3MTSA 2M00A 5E4WC 2PVGC 4K2KA 3PUYA 1EYDA 2ON8A 3J7AF 4JWUC 3J7AV 4ZK9B 2IWHA 1YNNC 3J80L 2J53A 4FF1A 1K51A 4N6EB 2F03A 5C4JB 5C5MA 3DWMA 1HUNA 2ZXRA 1LTGD 1PZKD 2MHVA 1STHA 2L11A 2Z8LA 3TZUA 5LL6S 2EYMA 2LGIA 1FCCC 4ID6A 3WCQA 2G9HD 1PTOB 4RGNA 4EQNA 4KV6A 1MSGA 1TS4A 5M5XB 1QJOA 5E3FA 3AH7A 1DJRD 2BOSA 5JEAJ 3BS1A 3D6WA 4XIGS 1ZEQX 2JYOA 1STYA 2EE1A 3J7YW 3X3NA 3AEFB 5HI1A 3GTLB 1ZE3D 3TSSA 2NVYB 2R92B 2BYTA 1L0XB 1FCLA 3D3RA 2BS3B 2QILA 4EGVA 4NMZA 1YN3A 4J1MA 2I07B 3GO5A 1B3AA 5C3JB 1IGCA 3MP9A 2L1BA 1SMYC 2JA6B 2K5WA 2K03A 1SNMA 2CW0D 4H2AA 1OXVA 1WTQA 1QOAA 5K5PA 5I2XA 1SE2A 2FE8A 2RA4A 4RGOS 2D5DA 3HOUB 1LTAD 3K59A 3NRZA 5C0XJ 2WV6D 5IGEA 1D1IA 5COYA 4KKJA 1MSHA 4TSSA 1IUEA 2G1EA 5F2DA 2PW5A 2FJ2A 1TKGA 4ABNA 1QB5D 4K6LA 3AM9A 4QB4A 2O2LD 1F9RA 4NP5A 3FAHA 2EVBA 1CQVA 1EZ8A 4DAPA 2WP9B 1IBXA 2XSCA 1HZ5A 2EY2A 2K9XA 3K58A 1QQRA 3GTQB 2LHEA 2QMTA 2A73B 1VCIA 4O42A 3M7GA 3ZQ4A 2K01A 3MEHA 1EM7A 1I4XA 1TKYA 5T1GA 1SYEA 2KDMA 5KYIA 4KN4C 3DEPA 5JXVA 2PO4A 3I90A 5G5GA 2XN9C 2X6GA 2WXNA 1JQYD 3DWPA 2KECA 1OO9B 5DAUA 4RF0A 2E2IB 5JPMC 4PMCA 2BB6A 1QOBA 4WIPA 1RD9D 3Q22A 4RGMA 3SHLA 2ZXOA 2INNE 2L12A 5M3MB 3O13A 4WORA 1YJJA 2A74C 2SNSA 3BYTB 4OHJA 4DA2A 3AMZA 3NSWA 5KIXA 1EIGA 2N55A 2ONQA 3AV8A 2K05A 5C3XA 5A2QL 2EZVA 4B0EA 2PNRC 1XX8A 1GUTA 4MN3A 2DN8A 5E1FA 2K5PA 1LO5D 3SDZA 1E0BA 2H4OA 1JW9D 3SR1A 1LT6D 2VB3X 3IAM1 3Q24A 1H9RA 5CV9A 1ZXTA 4I7ZC 1RDPD 2F0MA 2MJ8A 2G9DA 1IKLA 1G2TA 4GLSC 1XXGA 2L52A 1BBXC 2E75C 1S5BD 1S4ZA 4ZRQA 3GTGB 1P7FA 5BN4A 5E4XA 5KNCA 4L1BA 2WKDA 3DWQA 2PPBC 1EZ6A 1VDZA 2XVSA 5CR3A 3K7AB 1BUIC 5C4HA 1SYBA 1A6XA 1PZID 4NJCA 2L9HA 5IIFA 3RFZB 5CGKA 3N9YC 2WACA 1RWSA 4IFDH 4YT0B 2XIWA 5EPLA 4KKIA 4IKGA 1JC7A 4S3SA 4X3SA 4GDLB 2PMVA 2IL8A 4EE2A 1STEA 4X3KA 4DNTB 1O78A 4IDIA 1EEFD 1ZKOA 4WAFA 3ND9A 2YU9B 3FPPA 4WQMA 3KK7A 4CBVA 4ODGA 1XEEA 3GS2A 1Q10A 2NN6G 1R9TB 2FUG1 5HURA 2EELA 2PCFB 1CFMA 5C4ZA 1GXDC 3MFYA 3P63A 2EY1A 2D2CC 1D5ZC 1PUTA 1PFNA 4M8AA 4NKLA 2KN4A 1EEID 2WB1B 4C3HB 1HCZA 2BTEA 3HP3A 2GRIA 2EYOA 3EA6A 2F0UA 2K33A 3AMUA 1JWSD 2BA1A 4X3UA 1SNOA 1F2ZA 2SDFA 4IURA 5H92C 5TSSA 3T53B 3PO3B 3PZ7A 5KNBA 2JYTA 1PTOF 5KGUA 4FYDA 4G7ZC 4YTMB 3HRZC 1Q12A 3EGRA 3MFGA 5IT9E 2EYJA 3A8JE 2K5QA 4IUTA 1JROA 2RVLA 3DWAA 3KF8A 3FKIB 4JX1C 5G3LF 1B53A 1LLRD 2EJFC 3ABVB 1WTRA 2EKIA 4DK1A 1E2WA 1HUMA 5BYSA 2B2UC 2WIIB 1STBA 1GUOA 5T1IA 5H8YE 1DOIA 2B2YA 3MZ5A 3I4LA 3W5VB 1YJIA 1F0ZA 1QOFA 3Q8AA 3HVZA 1FD7D 3AU7A 1TWHB 4G7HC 2PZWA 2AX5A 2WP8J 3WDNA 1D5XC 1ZXHA 1PDQA 2WXGA 1T5EA 2RDFA 2L32A 5JJZA 3R2IA 2NMQA 4MACA 4PV1C 2DLBA 1AZPA 3EFXD 1PMRA 3S1NB 1YMHE 4H7BA 4PQXA 3RD4A 1N5WA 1NCVA 4MHEA 4WURA 2D9UA 2CU3A 4ZRZA 1TS2A 1FNWA 5JVH3 2ZW1A 3NE5B 1ENCA 3K5OA 2HDEA 1O7LA 5CORA 2L5TA 2IPKD 4MM3B 2Q8IB 2Z4HA 1WD1A 3E0JA 2I46A 4NZLB 1V1OA 1SB3C 5FO8B 3E6ZX 3IXSA 3C1EA 2JWUA 2CW0C 4NAMA 4HR7B 2RQXA 2HUGA 1EIHA 1GUGA 5EPJA 4KGTA 2QEJC 4WH4A 3PO0A 2BDOA 4F7XA 3BDCA 2EJGC 2EY6A 3Q8BA 1KNEA 1Y8NB 1DYQA 4ZHOA 1ZXIA 4ZUIA 3KLRA 4FF4A 5K36G 5A35A 1EFID 4K8IA 1JWAD 3VYRA 5M5YB 4OVZA 3A8IE 1XO3A 4MT5A 2X69A 2FINB 3NUHB 4P6VF 4TQUS 5JEAG 2F0SA 3D8GA 3TUOA 3GV3A 2JXMB 5IOCA 1AZQA 2B63B 4KGRA 5DEHA 3CRLC 2PW7A 3DM1A 4FP5D 2NVQB 3NS1A 4A6QA 1Z6HA 2F0JA 2K5DA 2N7JA 4REZA 3BK2A 3KQ4A 3IT4B 2B2WC 2K0PA 2KJXA 2EXZA 3I57A 2KHSA 1L0VB 2PVOD 3GTPB 4N9TA 1J7CA 1HEZE 2WU2B 4QMGA 2DWQA 4ILWA 1DGJA 2AWOA 1YQ4B 4KY6A 2BA0A 2H88B 1PXUA 2A68D 3S14B 4FO2A 4KKUA 1SJED 4YSZB 2B2UA 5C0XG 4QUCA 4HCEA 1SAPA 4MH8A 4Q5VA 2IJ0A 4EQPA 3MXGA 1EU3A 3IAS1 3NTKA 1K83B 3S1QB 1SNDA 5DM73 2C5CA 3CQZB 1RYJA 2TMPA 2H89B 1HXYD 1I4QA 1ML0D 1H9MA 2A5HA 1PTOC 4DXFA 3AE3B 3B9JA 1KDCA 1ENAA 4HTHA 1LT3D 4DAVA 3NQTA 3FILB 4KD4A 5EKIA 2R6GA 4WJWA 4Z9CB 1JR0D 4YSYB 1JWBD 2CJNA 3MC0B 1DOMA 4DAYA 2KA7A 3TP5A 2K1BA 3TP8A 5HG2A 1IBXB 2E6XA 3AE6B 2A6HC 4M1UB 5D3DA 2A6HD 3FRPB 5KEEA 1G6ZA 1PRTB 1VRAB 3S9WA 5IT9L 5LNK1 4A3IB 1F2MA 3HRDD 2N9KA 2JZPA 1VZ8A 1RKNA 1PTOD 3KLSX 3EJIA 2WXFA 5BMGA 2F0KA 3GTOB 3I4MB 5CV4A 2E2DC 4XQJA 2ICEC 3KBGA 2PIAA 2OXPA 1JWMD 1FFUA 4KY7A 5IGBA 1ZYRC 5EE0A 3T4AC 4ZLTF 3V2TA 1NVID 3MAQA 1AEXA 4XTCS 4PMBA 1II3A 1DOLA 2A68C 1TJEA 1GAQB 1KABA 2N88A 1HFGA 1MI2A 1HRJA 4BS9A 3ETRA 2B2VC 2LMCA 5I4DA 3DWGC 1BR9A 1CA5A 1SSNA 1JWUD 2EDGA 3LX0A 2LY7A 5DM63 4XT3B 4EVOA 3NP8A 1WTWA 1EOTA 3SK8A 5DNFA 3QOLA 5I6YA 4TMAB 1C9FA 1C48A 3I8ZA 4USAA 1TU2B 1B44D 3HKZB 4OZCA 3RLFA 4L8JA 1JORA 1D1KA 3RPFC 5EBDA 1UWXA 2WAQB 3RUZA 2WU5B 1C4AA 1UAPA 3ZGZA 3KUPA 1LT5D 4TRDA 1WXQA 3M7NA 4ZRPA 2JQRB 2B2YC 1EY9A 1F2RC 2JEBI 3NVYA 3VRBB 1C4QA 4OL7A 1WSPA 2LMCB 1STGA 3NZ3A 4IOIE 1F2LA 1E2ZA 4OZBA 4IUPA 5EKKA 2OEOA 3V3XA 2GI9A 3WOEA 4WRDA 3CWIA 5C0XH 3T56B 5D3IB 5ELFA 4U673 1EY7A 2RDHA 3BVZA 5HHDG 2JP1A 1NUCA 2ZT9C 2NBFA 2WXIA 1BDOA 4M0WA 2KEEA 5D65A 3Q8CA 2K32A 2GA4B 3S2HB 3W3AA 2PKOA 4LTUA 5FLXL 1VJKA 3BYYB 1OXTA 1QOHA 3F2UA 1OXSC 3PUWA 3FC4A 3U9SA 4P2CB 2PQEA 2VZKB 2F4IA 5KNDA 4C1NK 3PIO3 3PV0A 1GOZA 4K14A 1IW7C 1I4RA 2KOLA 1FMAD 3VA7A 1ONLA 4OIJA 1IYUA 5C4XB 4ZKCB 3T16A 4HSVA 3P4SB 3DHQA 1SIJA 4RKBA 3WOFA 1ZUD2 1L4DB 4NAWB 1BCPD 1V8QA 1A15A 3KBXA 2Z4IA 2XWBB 2OT2A 1QG7A 4HAEA 4PT5A 4A90A 2DNCA 3A54A 2QSDA 3U7ZA 3AECB 1UUPA 2F0PA 3P1MA 1MBYA 2HQEA 1JQ4A 4IFDG 3OW7A 4TKOB 2DY8A 1AW7A 3W2DA 1VR9A 3S1RB 1ICWA 5A2QE 5HFYA 3K57A 1OXUA 1UNSA 1A3VA 2A6ED 3NPPA 1MHHE 2CJOA 4KKSA 1Q90A 2Q8TA 3V96A 2A6EC 3AE9B 3T51B 3FVQA 3NK9A 1DXMA 2W3RA 1XF5L 2WXJA 4ITKA 2LEKA 4FF2A 4A3KB 4BA2I 3P20A 1PFDA 1N60A 1V43A 3BIID 4IFDJ 1GB1A 1YQ3B 2INPE 4BWGB 4A8XC 4DNRB 3GB1A 4ZKBB 5BN3A 5IGGA 2HDLA 1ZDVA 2BS2B 1D5MC 1AWDA 4J8QA 1FM0D 3LWUA 3MHZA 4IN3A 5FO9B 3PUZA 2MUYA 3L7ZC 2KACA 5KYLA 3D4WA 3Q23A 4HKQA 1NI3A 3PUVA 1U4PA 1V97A 3R2TA 1ROEA 1MD2D 4C2MB 1B2TA 2VUMB 2F0GA 2CVRA 3VR6A 1RFKA 3PUXA 1SNQA 3D31A 2F0TA 1IGDA 1XLPA 5BYQA 1LTBD 5HGTA 4ARIA 1L4ZB 2MEKA 5EE3A 1M4VA 1PLFA 1PRTF 1O80A 4LJZC 4YSXB 1V8CA 1Y1VB 1HQRD 5M9OA 3SEBA 1S5DD 4FF3A 1PDXA 5FKAC 2JE6I 2BDNA 2X6LA 3P42A 3DEOA 4YIJA 2SEBD 2J0TD 1VMPA 1SDFA 1PFMA 4X3TA 4CJ0B 2E3TA 5CC4A 3SFDB 1IHZA 3IT6B 3C2PA 4A93B 1FXAA 1TKEA 1N61A 1XCTL 4JPSA 5D7GA 2E74C 4U68A 3T3OA 3MJ5A 2B8GA 4JK1C 4NDXA 1R4QB 1CZWA 4F87A 1BUVT 3AEGB 1A2UA 5JPNC 3VR4A 3UI2A 4LMQD 5CV6A 2WLBA 4RGTA 3OHXC 3HZXA 2RBMA 3TEYA 2IW3A 2B39A 2AUKA 2N9LA 5IODA 3Q8FA 2IGHA 1GPXA 3D6CA 3NHHA 1E6EB 1SJHD 2EYHA 1GJXA 4UAIA 1KTKA 2R93B 2MH7A 4BA1I 1F2YA 1J7AA 3FDTA 3G6JB 2K22A 3H6MA 3V05A 1VZ7A 2WXOA 4PNYA 3TEWA 5BYRA 2AQ1B 1TVXA 1DCZA 3MXUA 2M19A 3A8KE 4RH6A 3B2FA 4OZAA 3BG3A 3K6OA 2NZ1D 2E76C 3P1HA 3FMCA 1H9KA 4K6DA 4V0BA 2QF7A 4US8A 2IGDA 1VDVA 2WXMA 2KAJA 3P4QB 3I70A 4UDUC 1K8MA 2LKVA 4CJ1B 5IGCA 3MA2B 2RMMA 3E9SA 1EY6A 1Y1WB 4OGQC 1K53A 1WVLA 1TR5A 1FXIA 5EE1A 1Y56A 3R8BA 4RA8A 4KI0A 5ELCA 5CMDA 3ZYYX 2ENBA 1E10A 4TQ0A 1X3QA 3HOWB 3HOZB 4I65A 1SYGA 1C78A 1FR3A 1PRTC 2J42A 2NTTA 1TY0A 1A3UA 3S1MB 2PMZB 1NEKB 2LS01 4ARCA 3NWTA 1R4PB 4A3DB 3HOXB 3TZDA 2Q8RE 1WTXA 2KQ3A 1S5ED 3ERQA 3S16B 1G291 3IAYA 1XTCD 1T6BX 2J4XA 1ZDXA 4AQ7A 4ME5A 1BCPF 4A3MB 1TWAB 4Y7NB 1N5XA 1OQQA 2M9VA 3I73A 4AS1A 2F1MA 4L6TB 1WTOA 1FYCA 2L4NA 5GXGB 1AN8A 3X3MA 2ZW0A 1PGAA 5T8IA 3D4RA 1K50A 3FEWX 1YN4A 2IX0A 2O4XA 3CRKC 1GB4A 2M2LA 2AUJD 3URYA 4RHSA 2EJMA 2NTSA 1KDAA 3CIRB 3AN1A 4RAUC 3H09A 1BCPB 1VF5C 2QIEB 4ZYSA 4K2LA 1LTSD 2JU6X 1H9JA 4O1NA 3S15B 1WTPA 4P16A 2RSOA 4OIKA 1WYGA 4DQOC 3LYYA 1E9MA 4RWSC 2ID0A 5FOBB 1DONA 4CGYB 4A3EB 1WGKA 3AE7B 3HUIA 4R3DA 2JSOA 2J7ZA 3BDOA 1B9RA 5FR3A 1FRRA 2MP1A 4FVMA 1NAPA 1FNVA 1RM6C 2OF1A 3EUB2 4KHZA 2V3NA 3VYUA 1TZOA 4C3HG 2QKIC 3K5LA 2H1EA 1FGBD 3EROA 1CJEA 3E56A 1EY4A 1KLGD 1I50B 3U4EG 4LAAA 1ACCA 1U4RA 5C5LA 1CZGA 1WWTA 1KH0A 2YEPB 4IUNA 3C8YA 1FRDA 3NBHA 1BMLC 3GP7A 4ZAIA 1EY8A 2F0IA 3LWEA 1VLBA 1PRTD 1G8ZD 1FD6A 3SXHA 3I9V1 3H94A 4E6IA 2I38A 3NVZA 4HMJA 1KFYB 5EKLA 1FEHA 3U9OA 4CJ2C 5JOBA 4KK7A 1EL0A 1ET6A 3IKJA 3QOJA 1I6HB 3NVVA 3W5UB 3GTKB 3Q69A 4FXDA 1HA6A 4GDKB 3MXNA 4ZUJA 1SYDA 3EVQA 4XXEA 4DU9A 1STAA 4B08A 1FO4A 4ZOHC 2WNMA 3LNNA 2FMMA 1JB3A 1LV9A 4G4KA 1GUWA 4ZQ3A 5M5WB 1WD0A 3HEJA 1RJTA 3VR2A 2Q5WD 1VZ6A 3MVVA 1J8IA 4RNAA 2MJDA 1Z47A 1ZPSA 1DM0B 3VQIA 2EYPA 2C9OA 4XQNA 4XDCA 4YTNB 1L6UA 4R8IA 2BS4B 2CQAA 1MHXA 1OFFA 1PZJD 2ACZB 2F0FA 1I6VC 4EQOA 1K8OA 3BVGA 2JSVX 5IGDA 3AB5A 1HPCA 4XE0A 3VYSA 1D4BA 2OHFA 4C7ZA 3G7LA 4MIUA 4YTPB 1U4LA 1I4HA 4C80A 1I4PA 3NTIA 3GTJB 1BQQT 1SYFA 1F9PA 2F0HA 1QKZA 3I72A 3ZJUA 5JVG3 3OIQA 1NYQA 1EY5A 3GD7A 1CK1A 1Z7TA 3MWYW 1SNCA 3SK5A 3GTMB 2MJEA 4DGZA 1EQVA 4R9WA 5AFWA 2NN6H 1Q1EA 1WRIA 4FXGC 3P4PB 1ESFA 3N52A 5I9OA 1EU4A