1AN8A

Crystal structure of the streptococcal superantigen spe-c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Bacterial superantigen
molecule keywords STREPTOCOCCAL PYROGENIC EXOTOXIN C
publication title Crystal structure of the streptococcal superantigen SPE-C: dimerization and zinc binding suggest a novel mode of interaction with MHC class II molecules.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 66
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1an8A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1an8A01
3DWAA 3EFXD 1L0YB 2XN9C 2NTTA 1CK1A 1LTSD 3BVGA 2Z8LA 1B44D 4O1NA 4RHRA 1SE4A 2XRQD 4RGTA 1JCKB 2J4XA 1MD2D 1LTID 4NZLB 1V1OA 1I4XA 4K6LA 1ENFA 1L0XB 1FNUA 1ET6A 1TS5A 1PRTF 1PRTB 1RF2D 1SE2A 2XNAC 4L6TB 1S5FD 1S5BD 5I4DA 1FNVA 1YN5A 2QEJC 1LTBD 2G9HD 4RCOA 4RH6A 3BZDB 1ET9A 2XRSD 3BVMA 1LO5D 1JWUD 1SJHD 1RD9D 3W2DA 1LTGD 5FKAC 1D6EC 1LT3D 1JQYD 1PZID 3TSSA 5ELBA 1LTRD 1I4HA 1LT5D 1RDPD 3MC0B 1STEA 1JWMD 1BCPC 3GP7A 1TY0A 3OWEB 2O2LD 1PYWD 1CT1D 1EEID 3EA6A 1TS2A 2NTSA 4RHSA 1D5ZC 1XTCD 1AW7A 2IPKD 1HTLD 1SJED 2AQ3B 1PRTD 2AQ1B 1BCPF 1BCPB 3BYYB 1I4RA 5ELCA 5ELDA 5ELEA 1PTOC 1FD7D 1KTKA 1PZKD 2QILA 1LTAD 1DJRD 1I4QA 1D5XC 3MFGA 1EEFD 1SXTA 1XXGA 1PTOF 1PTOB 1FGBD 1LT4D 1RCVD 1TY2A 4RFBA 1S5CD 5D3DA 1BXTA 1T5XD 1ESFA 1EFID 4C56C 1HA5A 1QILA 2AQ2B 4OHJA 1CQVA 1LT6D 2WV6D 1FNWA 3KLSX 3CHBD 1PTOH 5FK9C 1UUPA 1SE3A 3R2IA 1YN3A 1G8ZD 1LLRD 1BCPD 3DWPA 5TSSA 4RGNA 1CHPD 1TS3A 1S5ED 1V1PA 1AN8A 3DWQA 1F77A 3URYA 4RGMA 4DXGA 1S5DD 1EWCA 2ICIA 1SBBB 4L63B 3V05A 1CHQD 2RDHA 4UDUC 1TS4A 5D3IB 1PZJD 4BWGB 1KLGD 1PTOD 3BVZA 4DXFA 4ZYSA 1PRTC 1V1PB 2SEBD 1HXYD 1I4PA 3R2TA 1HQRD 1JR0D 2CHBD 3BYTB 1KLUD 4TSSA 2RDGA 4Z9CB 1JWSD 5ELFA 1D5MC 1DYQA 1SEBD 3O13A 1I4GA 1M4VA 1UNSA 1EU3A 3SEBA 1EU4A 1GOZA 2IJ0A 1B1ZA 1LTTD 3R8BA 1YN4A 2R61A 2TSSA 4RGOS
chains in the Genus database with same CATH superfamily
4HN7A 2YEPF 4FP5D 4NDXA 2EDGA 1CSQA 2JA6G 1J7CA 1KNEA 3L4PA 3M3YB 3BVGA 3TP6A 2Z8LA 3LYYA 1DZ1A 4ZHPA 3SD5A 2KFKB 2G9DA 4G0NB 1B70B 1I5FA 2BQQA 4JL9A 1I35A 4M0WA 2JA7G 1XPUA 2AUKA 1YEZA 2O5JC 2N9LA 1Y1WG 2BTEA 2JYTA 1GUGA 3I5JC 3U4EG 2RBMA 1ZYRC 1JB7A 3C46A 3RT3B 1G6PA 4KKJA 3LXFA 4XWTA 5EPLA 1YN5A 3L0WB 1GD7A 1PH7A 4IPDA 3CCJA 4YT0B 3PF4A 2IX0A 1N33Q 2UXCL 5IWAQ 2I5HA 2XRSD 3Q6SA 3RZDB 1CJEA 4KIKA 3OJ4B 4O2DA 4CDCC 3ZNID 2KLCA 2F3IA 2ZXPA 4PZ7A 4GSWA 1VZ6A 5AJ3Q 4MJSB 1ILPA 5KEEA 1R4NI 5M3MG 1XMQL 4PMWA 4IPHA 2GRIA 2J42A 3QK0A 1PZID 4IDIA 2DNEA 3C3LA 2I5MX 4DKAC 4KVGB 1K83B 3HIZA 2KVMA 2C60A 1BCPC 2EPBA 2AYOB 1EY8A 4B9WA 1EQVA 2FBWB 2CKZB 5CV8A 3K5LA 3IT4B 2MP1A 1K8GA 1KDCA 2WP8J 3MXUA 4TUUA 1STNA 1JWAD 2D3CA 3J80c 4Y7NB 2C9WB 1B9RA 1SYBA 4CKEA 1CA6A 1TKWB 4X3KA 3T51B 4C3HB 1QOFA 3WWVA 1KOTA 4JG2A 5I6WA 1TZOA 2LWPA 3MHBA 2ES2A 4M8MA 1FCLA 2OXPA 3H0GB 3FILB 3KUZA 5EBCA 5T8IA 1KLVA 4OO1I 4JLCA 4X64Q 3PZ7A 3L0OA 1E0BA 2H5XA 3MFGA 4XZ4A 2O5IC 5L83A 1L1OA 3M4OH 1P8LA 2C7MB 3AEVA 5I9PA 4JE3B 2ZTCA 4MGZE 1MJDA 4A93G 2C5CA 2L9HA 2D0OA 3J7YW 3GTOH 1KXLA 1GC7A 2PEAA 1R4MB 4R8NA 2V3PA 4DR1Q 3L17A 4ZK9B 2GVBA 4OHJA 1DONA 2GI9A 2Y0SB 2RDFA 4B3SQ 1HTOA 4GN1A 4GLXA 1B4OA 3FDTA 4C3JB 4M1UB 1E10A 1UUPA 3DHHC 4C1NK 3AEFB 3CPFA 2N1VA 4MACA 2A5UA 3QCAA 2K3UA 3VVWB 2GN5A 4JPSA 1ICWA 1TVXA 2MBBB 2E5LQ 1Q3LA 4GGQA 4RF0A 2ICIA 3J80E 2EKIA 3V05A 2EY6A 2E2HB 4J3OD 4JI2L 4FF3A 2IDYA 4IQZA 5HURA 1PTOD 3OW2A 3VR2A 1HFNA 1PRTC 4I7ZC 1FXIA 2IYDB 3AU4A 3BZCA 5EKIA 1HXYD 1XCQL 4R9WA 2RPQA 3BYTB 1RODA 2TMPA 4CKBA 3A55A 2D3GA 2J52A 3RULA 2OJWA 4EFOA 5CORA 2E74C 3TBLD 4LF4L 1E7ZA 1GOZA 2BS4B 3I57A 2VQEQ 3NUCA 3RZWC 3DVGY 1X3GA 1T6BX 2ALYB 4RNAA 3RMHA 2OT2A 2PW9A 2B63B 1WGHA 4KI0A 3DWAA 2NWGA 1BUVT 1A6XA 1GKHA 3CWIA 4A3KB 2XK5A 3VR4A 2FE8A 4C3IG 3KDFA 1WMHA 1WGGA 5GQOA 5IYBG 3RN5A 4ZQ3A 2NVTH 1V8CA 4CQNA 3V61A 1NDDA 1Q8KA 1NVID 3PCOB 4FF4A 1I3QH 2JF5A 1AZQA 1UD7A 5ELOA 2NN6I 3HOXB 1VJKA 2IL8A 3PO2H 2WKCA 4EE2A 4DV0L 3MC8A 2KQ7A 4NJ6A 4EQNA 3NHHA 2WXMA 4IUQA 4DR5L 2KHIA 2PMZE 3CC7A 3AE2B 3QHTA 4POFA 4YTNB 3H7SA 3S14H 3DVNV 4ZDVA 3G6JB 2MJDA 2EIFA 3TEYA 1F2YA 2HT1A 2WGSA 1U4LA 2RMMA 1PDXA 3R3OA 2KJ6A 2V9HA 2WXNA 2I0QA 2PI2A 3OWEB 4X57B 1L6UA 1PYWD 2E2DC 3KWLA 1WI0A 4X65L 3R66C 4RHSA 2LVOA 1HTLD 1JORA 4ZKCB 4RM9A 5DPSA 1WCMB 4KHZA 4ALPA 4X66Q 4JWUC 1J8CA 2RCNA 3P2BA 1YNNC 2D07B 1JT8A 1SXTA 4ANWA 3V6EB 5G2NA 1RCVD 3HOYB 3Q8EA 2CHWA 4LK0M 4LNKA 2QCPX 3ONSA 3VAWA 1V1QA 1HZ5A 2G45B 2Q2IA 4JI8Q 3DLLA 3Q3OC 1HZCA 3IL8A 4LF5Q 3BK1A 3HHMA 4HRSA 1Q10A 5FK9C 5IP9H 3I4NH 1SYGA 1VQHA 3L7ZC 2EJGC 5GAEC 4LNQA 4QF4A 4GLVB 4XQJA 4FHJA 3K58A 3NTKA 1E8XA 3RFZB 5FO9B 3G48A 1FMAD 1QWYA 3NEMA 1O78A 4A3EH 1N36L 5CV7A 1IBKQ 1IPGA 3S2AA 1PDQA 3S16B 3PGEA 3PREA 4A76A 5E7NA 1VQ8A 4FF1A 1IBXB 5LMNL 2JXMB 1TS4A 4UAIA 2D9UA 1N8RC 4AQ7A 4C3HG 1J19A 2QW7A 4A3FH 1AARA 5HI1A 3HOUH 4UP9A 2NZOA 5JAVA 1XWEA 2F0IA 4HEDA 1SIJA 1EUJA 4Q5VA 2KDBA 2BE5D 2LHDA 4R3DA 1ONLA 1KNAA 5ELFA 1Q0WB 4K7UA 2WXFA 3PO0A 1LV9A 2EY2A 1MJCA 5C5MA 4DNTB 2VH1A 1YJ9A 2X8XX 1XNRL 1B2TA 2VRRB 1Z9FA 4DV6L 2Y0SG 3T9LA 1IL2A 4JYAQ 3EECA 3U2SC 2X6GA 4C3JG 1VD2A 5DPRA 4TQ0A 4QIWE 3TEHB 2FHTA 1S3OA 3H6MA 4RGOS 2BW2A 1FJGL 4GKKQ 1Y8NB 2R3ZA 4MH8A 1VCIA 2X6LA 3Q0AA 4MM3A 4LNOA 1SMYC 1JJGA 1K8OA 1V86A 2EVBA 2J53A 3GTPH 2M0XA 4IM3A 1QOBA 2JRIB 4FN2A 2VY3A 4WQOB 1JCKB 4TV3A 3NTIA 2FCQA 3PMFA 3AE3B 2VXWA 1YZ6A 4YSYB 4ULLA 3N1XC 2BWES 3GTMH 3I91A 1FNUA 1G291 2JA8G 1Z5SB 3OAWA 3SXHA 5CHVC 1VQ9A 2REXA 1VQKA 3WA0A 1U4PA 1WYGA 1HZ6A 3CW2C 1YMHE 1EIFA 2Z6KA 3I4MH 3AB9A 4ICVA 5TR5A 4N6EB 3KLWA 2XGTA 2K28A 3CQZH 4GOCA 1YVCA 4RG1A 1A3TA 1NCVA 3VYRA 1T3QA 4WRDA 4DR7L 2V1CC 2D11A 2A73B 1YX6B 3AH7A 1X3EA 1PYSB 3UINB 4LCDE 2KO3A 3RUZA 2B63G 4IUTA 4ZUIA 1HZ9A 1LTRD 1RDPD 1E2WA 4DV2Q 4CDEC 2B76B 2W3RA 1HFGA 2UUCL 1NSNS 2RHQB 5IYCG 1CT1D 2N1WA 1YIWA 1GB1A 1TIID 2QMTA 3M3JA 5J39A 5CTRC 1TQOA 4AQYQ 5E4XA 2XEWA 2DNFA 3AULA 1Y1VG 3PRMB 1I50H 1Y69U 3H91A 5GXGB 4LF7L 4LFBQ 1PTOC 3GTOB 4DR4Q 2GBJA 4L5TA 3CCUA 2EYFA 3I56A 3HKZB 2WX1A 2IW3A 1D5XC 2Z0SA 4PYZA 4ACFA 5C3EB 4C2MH 2N4FA 3CCQA 2HJ1A 3FKIG 3U58A 3PHWB 1QVFA 3Q14C 2K39A 1H9JA 3H09A 2K03A 4DGZA 4CGYB 4RCNA 2XTIA 4AOFA 4OEMB 1PGAA 1WXQA 4LF9Q 1K51A 2L3ZA 3KLSX 2B2VC 5IP7H 2RSNA 4LDTD 1UEBA 3RNGC 4FXCA 1N34Q 1G8ZD 4HJ9A 4AS1A 2LXAA 1Y8RC 4JW0A 1K3RA 1EQTA 1P7EA 3SU8X 2M00A 2R2OA 1WE7A 4A3LG 2UXDL 3AXCA 5IGEA 1RL2A 1HR0W 2SAKA 4FA6A 4ID6A 4CJ1B 1SNOA 3IAS1 5GMVA 3WANA 4DXFA 3T13A 1JICA 4DK3C 2JQRB 3HGBA 2JZZA 2KJRA 1JWBD 4F7ZA 2JYOA 3H3VI 2FAZA 5J18A 4NXNQ 3EROA 2D2CC 1YITA 3UI3A 2F4VQ 3P4PB 2BH8A 3NXWA 2QGQA 3D6WA 1MFWA 2K04A 4DV4L 2INDC 2D5DA 2KWVB 1A70A 1I7HA 1ZOYB 2UU9Q 4GDKB 1L4ZB 3HVDA 4C1NI 2WDTB 1I3QB 4S3SA 4JQWC 4ZCKA 3RLFA 3CMAA 4ZLTF 2HJ8A 5IT9E 3W1YA 3K57A 3PO2B 4NPNA 1TKYA 2SNMA 4GZYC 1WXSA 4DV7L 4O1NA 3BG3A 1K53A 4HSPA 2KAJA 2WX0A 5JH5C 5FO8B 3TEXA 2C7HA 5BYRA 2LFNA 3K5NA 5K36G 2XIWA 4XE0A 4K6LA 1XTDA 2KMCA 3S14B 3DEOA 4PZ6A 4H13C 4DR6Q 1WZ3A 2IHEA 1RF2D 3MTSA 3PVLA 3PGZA 4R4TA 1FL0A 1S5FD 1MPEA 3W3AA 1JQ4A 3PSIA 3Q23A 4B0EA 2PCFB 1A0IA 2H89B 4FLHA 3VYTA 2BVCA 2F0GA 3NBHB 2KCNA 3DBLI 1K73C 5EQ0A 1JWUD 2JA5G 1WTWA 4EZKA 1RD9D 4OWTB 2F4IA 2OEOA 1Q8IA 4MSMB 2FIFA 5M5WH 3IFDA 2C35B 4ZKBB 3WAOA 1LT5D 4JVZA 2NPTA 1STEA 2CHZA 4B08A 3V3XA 4CDDC 4DNRB 5C3XA 4JOIC 1BF4A 3IXSA 3E5SA 3J81i 3NUHB 3RNAC 3ZNHB 4FNFA 3PZ8A 1NR4A 4LNIA 1CMXB 4CYEA 1HTQA 1SYEA 2B3GA 1FPYA 2KDIA 4BBNC 2Q8IB 1OXXK 5JJKA 2F0HA 3PT2B 5E4WC 4ABNA 3PLUA 4TKNA 1KDAA 1UE7A 1YHAA 4YCUA 4JI1Q 3PQIA 1LT4D 2WNMA 2N9KA 4FADA 1HCZA 3EQLC 2KDFB 3QX1A 3K0YA 1PMRA 3S24A 3JAME 3OPOA 1Z7TA 3KK7A 1QILA 4A3EB 4EGVA 1KRHA 2Q2UA 3TZUA 4BA1I 3KVFB 5IY0A 1GJXA 5ELNA 1WX7A 1VDVA 4US9A 3ZW3A 3N1ZC 4HDOA 4A3FB 1N5WA 2IHFA 3HOUB 2B2UA 2MBEA 4FJZA 5C4XH 2A74C 1D1KA 3RZFA 5D7GA 2D10A 4X62Q 5EPJA 1WTHA 3TBIB 1I94Q 2KVZA 4W9IA 5JEAJ 1OEYA 5EE3A 5D3IB 4L5RC 1CUKA 5EPKA 3NZUA 4OO1H 4LFCL 3TCAA 1X3FA 1S1QB 5LXHA 1BVSA 1UEAB 1N33L 3HKZG 1L6VA 4AUQC 5IWAL 1I4PA 2FIDA 4WAFA 5KYLA 3X3NA 3GTJH 4R4IA 1V49A 5IO9A 3TREA 2PNRC 2ZEQA 2BBCA 2N9PC 3M4PA 5AJ3L 2RQXA 3J7AF 1I6VC 4KDLB 4DU9A 1DOYA 2L12A 3GTPB 1PLFA 4KX6B 1XYIA 5H8YE 2E76C 5A35A 2M0AA 2ZNVC 3QIJA 4A3PA 3HOWH 2MBOA 4DHZB 1SSNA 4TQ1A 2YEPB 1K8MA 4F87A 3GTMB 2CH4W 1AE3A 5FLMG 1BO0A 2JZ3B 3PO3H 2C5LC 2WYQA 3ZTCA 1IW7D 1Z47A 1QNKA 4RHRA 4DV3Q 3UDIA 1E7VA 3HOVG 3GO5A 5IGBA 1PH5A 3C2PA 4X64L 1CKMA 4HVBA 2Z9HA 5CX3A 4LNFA 1HUMA 4O0AA 1WTQA 4MTKA 1P9DU 1SMXA 3A4RA 3L13A 4F8CB 3LNNA 3BIID 2A6HC 4OX9L 2ZW0A 1FNVA 4DUZQ 1OXTA 4DR1L 2BPSA 4RH6A 1EOVA 2H88B 4E6IA 2LD9A 2BF8B 4PS7A 4GXBA 5BYQA 4US8A 1WF9A 3QJYA 4DK5A 3M95A 4U673 5C0XJ 3IFTA 2LRUA 2F0WA 2OWOA 2QHOA 2ZCBA 1C9FA 1AEXA 1NENB 2EOTA 5M3FH 3A56A 2G4DB 2KWUB 1LT3D 3I4OA 2JSOA 3T1YQ 5EJWA 2E5LL 3MZ5A 1KM7A 1WE6A 3L08A 2INNE 1ENAA 3SK4A 5HGQA 1T0QC 2KLGA 2EELA 1NNXA 3VDYA 2IO1B 3RR5A 3VRBB 3V60A 4C2MB 2V1YA 2EXZA 3T4AC 2PZWA 1LGRA 1PRTD 2NN6H 2PTLA 1LFDA 1A62A 2DN8A 1PFDA 2CR5A 3MHZA 1QZEA 1SYDA 3ZUNA 2QILA 1R9TH 2O6VD 1ZUD2 4GDLB 4GN5A 4IG7B 4OL7A 3P4QB 4EQOA 1BBXC 1VQNA 4AH6A 2L8JA 1ISNA 2B29A 2WP9B 1FGBD 2L1BA 4P1BC 3HOXH 2O2VA 4PV1C 1P16A 3H15A 3J80i 1V2YA 2I38A 1WYWB 1EFID 3NVYA 1CA5A 3PUVA 5FJ8G 2M1MA 2QIEB 4B9XA 5M5YH 4HIDA 4IWQA 2WAQB 3AYHB 3HOZH 5GAGC 2ZVOA 4GIVA 4EVOA 3B2GA 3DWPA 4HJAA 1VZ8A 1TS3A 3A9JA 3ZQ4A 4IZ8A 1F77A 3P7JA 1PQSA 2QCZA 2HHHL 3KLSA 1SBBB 2MP2A 1KD1C 1A5RA 2K75A 4W9DA 5MPOA 4Y52H 1KLGD 1JALA 3A7LA 2KHSA 2A5HA 3DXJC 4HJ7A 4DAVA 1GUAB 3T3OA 3WIMA 4S17A 5NUCA 1TZ1A 1WGRA 2ICEC 3S17H 3SHQA 3KF6A 2PPHA 5KHOA 3IHPC 3ZNGC 3ZTDA 1JB3A 4Z9CB 1GUOA 3I4NG 3VXWA 4IFDJ 4BY7G 4JI0Q 4L8JA 5JZEB 2PW7A 1AWDA 1PGBA 4DXAB 1VQAA 2AHOB 3NWTA 3HOYH 4A3EG 4DQOC 3TZDA 2ACZB 3QO2A 3R93A 3AEDB 3DHGC 3PHXB 1KH0A 1Y8PB 1HZAA 1PVOA 1P7FA 2DX5B 3EFXD 2D62A 5CV5A 3Q24A 1W2BA 4MTNA 4LJZC 4X66L 4LUVA 4BZAA 3MC9A 3NVWA 4HROA 2K5QA 1XLNA 2JWZA 2BOSA 1HJPA 1EF5A 4K7WA 4OZBA 1AE2A 3HVZA 3RNUA 1QQRA 4NJCA 1K50A 2BS2B 5M5WB 3GTKH 4DN4M 2Z4IA 1MGSA 2QEJC 1LTBD 2FNJB 1TWCB 1TIFA 1STAA 2KMMA 2KMAA 1PH4A 4M0WB 1VQBA 4JI8L 3NJTA 2MQHA 2WB1E 4HJKA 2VB2X 4LMQD 1OEYJ 4LF5L 4UHVA 4HTHA 2BB5A 2F0OA 3KUDB 4KKUA 4A9AA 3A5UA 1GHKA 2ZXOA 3DHQA 4FHKA 1LYLA 2KOXA 3P75A 2ZPNA 1XPRA 3RMKC 1XNQQ 3T3NA 4K5XA 2LRWA 2Z59B 2UXBQ 2KTRB 3K5OA 1K3BC 1DM0B 4KIKB 3TN2A 4BY1G 1HQMC 4XDXA 3PIOA 4IJHA 4W9JA 3T53B 4GOPA 4WJPA 3HRDD 2GLSA 4BKGA 3KLRA 3I4MG 2HCIA 3UF8A 1BCPF 2PZTA 3VUWA 1I4RA 3A33B 4R4OA 2RR9A 1F1HA 3U9OA 3RD4A 4QCLA 1UAPA 3RN9C 3A1QB 2MA9B 1R4NB 3HUIA 2N7JA 1CI3M 2V0GA 3CP0A 4A3BH 1I4QA 3HG9A 3S15B 5JEAH 2KYWA 1T0SC 5JXVA 2ZM6Q 2SDFA 2KEDA 3G6EA 4I65A 4JYAL 5C4XB 2QJLA 3PIP3 3ZJVA 5GADC 2WINB 1EOTA 5J1ZA 3U4VA 2NBUA 3QA8A 4GKKL 3J81j 1IGCA 1E0ZA 1L1OB 1E3PA 2JA9A 1SMYD 4ARIA 4TRDA 2NMQA 3NSWA 3S1QH 3MJWA 4AJYB 2ZJQA 2WACA 1YN3A 2PLPA 4LAAA 3P1MA 3ER0A 2KFKA 2Z0EB 3RLNA 1V1PA 1SIFA 1IW7C 1ACCA 3GTJB 3KF8A 3L10B 4UDUC 4P71A 4KGSA 1VQDA 4MSQB 1KDBA 1R4QB 1NMFA 5BR8Q 1Q5WB 2KTFA 4YTPB 4BBSH 4P16A 3M7GA 4ZUJA 2EQSA 4JI7L 3DMUA 1JE5A 3JW0X 1HR0Q 1J6QA 4OVVA 5CV4A 1J0GA 4J1MA 5C6AA 3U4ZA 5LMNW 4NNJB 5IP7G 1YX5B 1RJTA 4BAXA 2F0TA 2Q2TA 1DYQA 3HOWB 2IX3A 5C3EH 1SE9A 1EFWA 5AUKA 3SDZA 2K25A 3PO3B 3SEBA 1WIAA 4PT5A 1WFQA 4DV2L 2LASA 4WQMA 1CKNA 4KDIC 4MGIE 3NVZA 4FULA 1X54A 1S72A 1H9RA 1YN4A 2ASQA 3R7QA 1Q46A 1F2RC 2ZXRA 2JX5A 2K1FA 3Q8FA 4XYOA 3VYSA 2RD0A 4AQYL 2WFWA 1OXSC 5C0XH 4A3OA 5CBEE 4LF8Q 1WR1A 3BDLA 4A3GH 3DEPA 1C48A 4KJOA 2VQFQ 1SE4A 4F88A 5C4ZA 1YJWA 4MELA 5CGKA 4OONA 1TYGB 2FUHB 2Y0SE 1ASYA 3RD2A 5JHBA 3NY5A 4EX5A 5LMUQ 1W6JA 4B9KA 1E1OA 4C00A 3Q3FA 1C77A 3M85A 1WMHB 3KDFB 5M3FB 1U4MA 5I4DA 4CKCA 1F9JA 1KABA 4II2B 4KLKA 2NVQH 2WXQA 3IVFA 1GJZA 1N9WA 4A3IH 1WM3A 2B2YC 1WTXA 4LF9L 3F2UA 2R92G 1LO5D 4K0KQ 3IKJA 1Q86C 1IBML 1YJ1A 5BN5A 1QJOA 2GMIC 4ODGA 1WD1A 1N34L 1M90C 2VH2A 2HQEA 4B3MQ 1SF0A 3AE7B 2QSDA 1BT0A 5E6NA 3HRZC 4KY7A 2OCEA 2B2TC 1B7YB 3A9KB 2WB1G 1D4BA 4DA2A 1UF0A 2BGFA 2DYBA 4U68A 1R9TB 3UDGA 1E2VA 4R4CA 2D5GA 4UP8A 1XTCD 3I55A 1AW7A 2NB0A 3AFPA 3NELA 1DOIA 2G1EA 4PS3A 3BYYB 1TTNA 1P1AA 4BOSC 2L32A 3HS0C 1FD7D 3MVVA 4W9KA 2F4VL 1KTKA 3ITPA 1WX8A 1BUIC 1DJRD 3SR1A 5M5YB 4I6LB 1IKLA 3K80C 3J81L 2A4ZA 3KWVA 3VH3B 3D4DA 4WJOA 3HOZB 4XT3B 4M8AA 1JJ2A 2UU9L 2BYEA 1S5CD 4A3JH 2UYZB 3MXNA 3A8JE 3AQQA 2M17A 2I1KA 2KENA 2AWTA 3E0EA 2B2VA 2Y5PA 4K7SA 2RA4A 4QQBX 1Q1OA 3AV8A 3HFZB 2F0SA 4IFDH 2MO0A 1FGUA 3NENA 4R1JA 1B50A 2N78A 3AE8B 3ZO5B 1SSOA 1JOOA 5T1GA 3N20C 5IIFA 4FBJB 1VQJA 1Q7YC 2EMTA 5IGCA 3BS1A 4K2LA 2B2WA 3S17B 4P6VF 4DPGA 5CHFA 3T8MA 1YJNA 4DNIA 2R7ZH 2L5TA 2RDHA 3R3MA 3D0FA 3A0JA 4WJWA 4XC2A 2AEHA 4YHHQ 1HE8A 5CV9A 2PKOA 2MJ8A 4MZ9A 4NAMA 3IFWB 2IGDA 3C1EA 2UUAQ 3WDNA 1Z2MA 2AL3A 3DWGC 1KAWA 1RYJA 3E9HA 2F3VA 3CRLC 1E90A 2LGXA 5D2MB 3CSTA 1IYFA 1H4RA 1OXUA 1JE4A 4DK0A 2KANA 1PH3A 3X3MA 2J0KA 1IUEA 3O13A 1YNXA 3SGIA 3TRZA 2CVRA 1F9PA 2R2QA 2KCTA 2E2IH 4W9LA 3L9AX 4XDCA 4DK6C 1CTMA 2N7EA 5A2QE 3I3TB 3QC8B 1B9MA 3LGJA 1B1ZA 4K8IA 1F52A 3VRAB 3Q8DA 1EQRA 2PQAA 2OTLA 3DBSA 3DM3A 1HHVA 4OVZA 3CSFA 2F0PA 1B9NA 1WXVA 1PH8A 1HZBA 2Z4HA 3Q8CA 1CK1A 4IALA 1WJJA 1HNXL 2PYKA 5M5XH 1YIJA 1EUVB 2K1BA 2R93H 3GTKB 4MDKE 3H0GG 1FCCC 2K7VA 1FFUA 4H02A 4AYBB 3CCSA 4E71A 2J4XA 1TGZB 2NR2A 1F2LA 4USAA 2EKEC 1EWYC 2LXCA 3CD6A 1I4XA 4YWMA 5FOBB 2A8VA 1ICFB 1XCTL 4JK1C 4EQ5A 1LABA 2GBMA 1ZGUB 2N0SB 3QG1A 1SNQA 1ML0D 2OOBB 2IY5B 1ZXTA 1TWFH 1V6EA 1ZXHA 5IOIA 3RI7C 3ZJUA 2KA7A 2HTME 3W5VB 2YLMA 4KHPQ 1S3SG 2FMCA 5EKKA 2CWPA 4JI6L 1XO3A 4LFAL 1FRDA 2G4SA 2YTVA 1NE3A 1E8YA 2MHJA 4AYBE 1K52A 1PYBA 1EO6A 4MH0E 1PXUA 1MKHA 1KFYB 4A8XC 4JOIA 4GN3B 1TWHH 4DK1A 5JVG3 1I94L 1YOVB 3OSOA 4BBRH 2O2LD 4A3BB 3V62A 1VQIA 4HIMA 5IP4D 3U50C 1TS2A 4KD3A 3ECIA 4IW0A 4IOCA 2FINB 1R4PB 3QAQA 3JAMi 2HIXA 4JI3L 4HPLB 1LM8B 1AZPA 4FXKC 3VUYA 1Q82C 3V2TA 2WU2B 2IO0B 1EZ8A 2RCFA 5M3FG 3C19A 1V8QA 2D0PA 2L0CA 3GS2A 2A1AA 4RKBA 3BDCA 3L54A 1PTOF 4DR3Q 5HHDG 1WOCA 3S1QB 3ZYYX 4WH4A 1QOHA 1NJIC 4QB4A 2RSOA 4DF7A 4I6NB 3FVQA 1IZ6A 2SOBA 1RIPA 1QUQA 2JA7H 2BYVE 1B3AA 4A3KG 4B0MA 1Y1WH 1WGKA 2F0FA 1OGWA 1WYDA 3VQIA 3D31A 3I7FA 5CBAE 2V3SA 5IGFA 4BKSD 1K8RB 4DV3L 4BBSB 1UZXB 1H9KA 2LGIA 5J2RA 1BMLC 1CHPD 1U4RA 1WVLA 2QDBA 3J80L 2F03A 3APDA 1GPXA 4DFAA 3H1UA 2NBVB 3CPWA 4IN3A 3GV6A 1YQBA 2PO4A 1CHQD 4KN4C 4OIJA 4X3TA 5L37A 3HOXG 1FXTB 3ZGZA 2A6HD 1PZJD 1FEHA 4DUZL 4HDQA 4NJ7A 4IPGA 4ZRZA 2LSSA 5H92C 5JHAA 2ZZPB 4KJNA 4IUMB 2B8GA 5M3MH 5DCNA 5JPMC 1UBIA 5H1SE 2EY5A 1ASZA 1E24A 1KLUD 3AU5A 1LACA 5AUIA 3GQBA 4X3SA 1WRIA 3LDZE 1YBYA 3ZJYC 3FMCA 1T5EA 3NK9A 4JI2Q 1FYCA 1IHZA 1UNSA 3AMZA 2HTHA 1FRRA 2JSVX 3LB8C 4YSXB 4A3GB 1HUNA 1MBYA 4K3CA 4MIUA 1EU4A 2WXOA 4UP7A 2IJ0A 2IT1A 4QUCA 3MXPA 3HKZE 2R61A 5IT9c 4IM2A 4MT5A 2AWNA 2JEBI 4GU2A 3RCZA 2ID0A 1WCMG 2KD0A 1STBA 1YHBA 5LNK1 2LXJA 1WTOA 1KL9A 4YCWA 3N3KB 5EE0A 3BWUD 2NVQB 1N6ZA 4RGTA 3KH0A 4A93H 2R7FA 4HJGE 4A3IB 1BR9A 2J7ZA 2CJOA 4HCPB 4NZLB 1KRTA 5I2YA 1V1OA 4LF6Q 2M4NA 4AJWA 5JOBA 1X3PA 4KSKC 1ENFA 3HOYG 2VZKB 3PZDA 2W54A 2MSED 3Q2AC 1QZGA 4W9GA 1SE2A 3H94A 3LX0A 4NXML 2G3QB 5CV6A 3UDFA 5FR3A 4BXXG 3RNBC 4JBJA 3NRZA 4EZLA 1DXMA 1WGDA 2NVXB 4ZAIA 4H44C 4YIJA 4YY3Q 4J8QA 5G3LD 1EY7A 3AMUA 1MHXA 3FRPB 3U7ZA 5GAHC 2WXPA 2BCOA 2E8GA 4J6HA 3NQIA 1VDZA 4HKZE 3G71A 1RTNA 2BA0A 3W1GA 1JQYD 1CKOA 4NPSA 2MFIA 3QR8A 1G51A 3MC0B 2WXJA 4UY8C 1HRJA 5LXIB 1X65A 2L83A 1QG7A 4IUUA 2ZJPA 4DR5Q 2KN5A 3PRPB 4GNXB 3TS2A 5KGUA 3QWNA 3GB1A 3WOEA 2WKDA 1RRBA 3L16A 3DQVA 1D5ZC 5AZGA 3L3OC 2IPKD 2AQ3B 1XLPA 4AYBG 3DBLB 4HK2A 4OW0A 2DYMA 2NPTB 4A3JB 5ELEA 4IUVA 4C7YA 3SDLC 5HFYA 4Q0FA 1FM0D 2NS5A 3T1HQ 1X55A 2WXKA 3I90A 2F0KA 5FLXE 4Q2JA 2EMSA 5IN7A 1FVIA 3CF5A 3HK0A 4IWPA 2HDMA 5HGTA 2E6XA 2DGYA 4X65Q 1XXGA 3M4QA 3JAMc 1QZHA 2CW0D 3HM3A 1Q1EA 2D3BA 2KX0A 4BBNF 1DOXA 2PQEA 2XWBB 3O65B 2KC2A 1VQ7A 1FIQA 1TWCH 1WX9A 3KYCD 4EZJA 1EWHA 2EXDA 2GBKA 3TP7A 2AQ2B 4IOAA 1W3SA 2BWFA 4POGA 3VH4B 2DNCA 2R7ZB 1VQPA 2LHEA 1FNWA 5IOCA 3G4SA 1GM5A 3GZNI 1JRUA 3CC2A 4CJ2C 1J5EQ 3CCLA 4HR7B 1U0LA 3FKYA 4NQKE 2NBFA 1L2NA 3DWQA 3DBHB 2W55A 2K9XA 1EWCA 3DWMA 5C2TB 5KHQA 1SROA 2LZ6A 4RWSC 2N3SA 1JW9D 2IBIB 5J22A 2WS3B 3UI2A 2OQ0A 4AWJA 2L7RA 4OGQC 2E2IB 3JSVB 4DDID 1XEEA 1SAPA 2CQOA 2KCMA 4JV5Q 4IM0A 3P20A 1OFFA 1BNZA 3R7RA 4TSSA 2AWOA 1ILQA 2ZTDA 1N36Q 3OMGA 4HPMB 3AE1B 5I9OA 5HG2A 1SNMA 3S15H 1DOLA 1M4VA 4AIMA 4P7IA 2J0JA 3DBRI 2UXBL 5M5XB 1NTGA 3TP5A 2PVOD 1L0WA 4A3DB 2E2JH 2R93B 4TMAB 2R7DA 4KN7C 1ZKHA 4H0LC 1WI5A 2B8FA 2Z6KC 5DLQE 1WD0A 3Q8AA 1F0ZA 4N8FA 2VUMH 1Q81C 1Q1BA 4BBSG 2ZVNA 3F1ZA 1EYCA 4NP5A 3K9OB 2XN9C 4W9CA 1HNWQ 3HZXA 5DAUA 2CCZA 3WAPA 2WIIB 1TWGH 1NAPA 1L5PA 3NOBA 4HIOA 1XNRQ 1G91A 3EIVA 4ZRIA 1TWFB 3CKIB 4DV6Q 1J8IA 1QLBB 2M9VA 3CC4A 2DLBA 4YWGG 2CH4A 4HAEA 5C3EG 4URKA 4PMCA 4REZA 3AB5A 3PIO3 1QNUA 1E8ZA 4L1BA 4XYCA 3I2ZA 3RZOH 3SR6A 2FJ2A 3F2CA 2L11A 1ZKOA 1S4ZA 1G2TA 1N5XA 1S5BD 3MFYA 1M94A 1XT9B 3V6CB 1STHA 3MJ5A 3ZJTA 4QY7A 2KQ4X 3OHXC 1TWHB 2RPVA 3I73A 5C1ZA 3RUIB 2KJHB 4BBRB 5C0XG 4BA2I 1F9RA 1GNUA 4C4VA 4P2CB 1LQBA 3VYUA 1H9SA 2QDFA 1WTRA 2IZVB 4W9HA 1GUWA 5LL6S 1TT2A 3LJ3A 1C79A 3N32A 4KKIA 3K0XA 3VTWA 1M8AA 1I4HA 1OQQA 3OJ3A 3H8HA 4DV5Q 3M9BA 5COYA 5L95C 3K81C 1UE5A 4ZHOA 4ANUA 4YXDB 2JVCA 1EEID 3N9YC 2CU1A 1QVCA 2MPMA 3EA6A 4NAWA 2MGSA 2Z6BA 3Q69A 1F2ZA 2K6DB 1WM2A 1BCPB 3Q3MC 4A3IG 2CS4A 2JA6B 4N58A 2OQKA 1YJIA 4G4KA 3D32A 1N61A 1KJTA 4DHZE 1NUCA 1QKZA 4OXPA 3G7LA 4CHKA 4B3SL 2JA7B 3FP9A 1WGYA 4P72A 4M02A 3TDQA 1EEFD 1XX8A 4HMJA 1Y1WB 3SHLA 1YHQA 1TY2A 4ZYNA 4RFBA 4BS9A 1IBLQ 3QOLA 1A3UA 1D7QA 4LF7Q 2EYJA 4TQUS 5BN4A 2KVRA 2OHFA 3W1SC 4C80A 3CCVA 3U8ZA 4LK1C 1SN8A 4GKJQ 5T1IA 4JBKA 4JX1C 2K22A 4LF8L 4K14A 4ME5A 4K5WA 1QE6A 1PTOH 3PO2G 1SE3A 2WXRA 2O2VB 3CCEA 4IKGA 3DCGA 1IYUA 5M3MB 2ZJDA 5CMDA 1XPOA 5LMUL 2A69C 3CAMA 1STYA 3D3RA 2VZAA 1YNJC 2DZMA 1PFMA 2EY1A 4P75A 4A3JG 2DENB 2GB1A 2WXGA 5IGGA 2OEDA 3KYDD 1HNZQ 3HP3A 3I4LA 1EYAA 5HY6A 3A9JB 2VQEL 3X23A 2EYHA 5KNDA 3EC8A 2KHJA 5CYUA 1N32Q 4F1SA 4MNOA 4IFDG 2HUGA 4K0KL 3PLVA 3NZ3A 4QMGA 3K59A 1XMOQ 1EIYB 2MP2B 4XTCS 2UXDQ 1EF1A 2KOLA 2A68D 5C4HA 1F2RI 5IYCH 2RVLA 3H7PA 5J3BA 4B3ML 4WWOA 5D65A 4ZRQA 1C7YA 5JJLA 4OZAA 1Y1VH 2I07B 3KF6B 3VR3A 2L76A 3C0RB 3R8BA 2RKSA 3GTGH 1DOKA 4G50A 5BMIA 4A93B 3AE5B 2J0TD 2DHZA 1UBQA 4HIKA 4A4IA 2TSSA 2W82A 1Z6HA 2C9OA 1XJVA 5IT9L 4PZ8A 5E3FA 1SNPA 4GNXC 1XLQA 4B95A 1FO4A 1WXMA 3F2BA 4J6IA 4QL5A 3NHEB 1B44D 2FXQA 5M9OA 4DAYB 1H95A 3W5OA 5G5GA 4ZRPA 3EUB2 2NZHA 2L55A 2O6VA 4I6PA 2WAQE 4FXGC 5JJZA 5IP9G 4ZRKA 3VR8B 2DZJA 3OTOQ 1Q12A 4WWMA 3K7AH 1ET6A 4FXDA 2KWDA 2JE6I 4PYUA 2K5PA 4WWNA 3KQ4A 2CW0C 3E9SA 3Q3NC 1UE1A 4RCOA 1MHWC 1IP9A 3STBD 3OMCA 5CC4A 3EBEA 4LJPB 4ILWA 3DM1A 3BVMA 3IG3A 1C8CA 4A3FG 4OVUA 3HOUG 3D6CA 2QA4A 2RHSB 3GTQH 3ULPA 2WDQB 3B6YA 2RF4A 2LS01 2YTXA 2K5WA 4IUPA 1WJNA 4LWCA 1J7BA 2W9NA 2KFJA 3UIOB 3GP7A 5D94A 4I7AA 4N9PA 3NP8A 4YHHL 3PUXA 1YQ3B 4HJ8A 4IUNA 4HEA1 2UUAL 3VA7A 1OQRA 1XD3B 5ELCA 4G7OC 1VQEA 2L05A 4C3IB 4GLAC 3CF6E 4BOZB 2ENBA 4GOPB 2NYZD 4RAUC 2PZUA 3TS0A 4NQLB 2K6QA 1CZPA 2DAJA 1L4DB 1PFNA 2DY7A 1WXAA 2R6GA 1DCZA 1JC7A 3JAML 3FPUB 1V97A 4DUYQ 4IC7B 1T5XD 3TEZA 3PRZA 1IBKL 3SVMA 3S2HH 4GMVA 2WLBA 4HCEA 2NZ1D 4YSZB 4ZRJA 4XX5A 1A2TA 2LMCA 1BKBA 3R2IA 2IY1B 2LVPA 5DPWA 1RM6C 1S5ED 2L4NA 5C4JB 4RKLA 1IXRA 1MI2A 4KK7A 4A3MH 3URYA 4RGMA 3WOFA 2MBQA 3BJUA 3ZIMA 1KRSA 1GXDC 3OWFA 1NBFC 4KZCA 2X69A 2Q5WD 1G2SA 2K5NA 1PH6A 2OTJA 3SFEB 1NBWA 1TWAH 1DD2A 2VB3X 2DAFA 2JA5H 1V5OA 1AFPA 3IT6B 1VQGA 2GBRA 5IE8A 4L5SA 1V1PB 1IL8A 2E2JB 1C4PA 3T16A 3DPDA 3N30A 3N1YC 3KF8B 4KHPL 4IJLA 2V4IB 1GUTA 2PE9A 3ULJA 1WRDB 2VUMB 2IWHA 2I1JA 1EIGA 3SK6A 2LGDA 4PNYA 4JI4Q 3NS8A 4FJYA 4OZCA 2BYTA 1WR6E 2DY8A 3K8AA 4LFCQ 1C3TA 2LXKA 1TWGB 4DR2Q 3SFDB 2KTRA 2K8HA 2M2LA 2OJRA 1STGA 4QUFA 3OIPA 3VR6A 2UUBQ 3MEHA 4NMZA 4JI5Q 3T56B 1T0RC 3KUCB 4WJQA 1L0YB 4WJ4A 1VF5C 3UQBA 3RZOB 1TKEA 3ND8A 3M7NA 2PJHA 4FDBA 2KQSA 4P1CC 3B2FA 1CKNB 3K9PB 2ZT9C 2HCCA 4N8X1 1KHIA 1D2BA 3A1QA 1MD2D 3S9WA 2E75C 4CBVA 1GHJA 3N6RA 1HPCA 1HTPA 2ZTEA 1LM0A 1X6OA 4DR3L 1YI2A 1PRTF 1SRUA 4JIOU 4MJSA 5AZHA 2HIVA 1RWSA 4GLSC 3AE9B 4DDGD 4K6DA 1B8AA 3EVQA 1VQ5A 3ML9A 1EY0A 2WAQG 1YJJA 4ZOHC 1W6KA 3SK5A 4B3TQ 2YU9H 1TT5B 2DUDA 2QEXA 5JJIA 1HEZE 3B9JA 2EYLA 4KD4A 5EKLA 2XBBC 1LTLA 4WAAA 2K4KA 3W2DA 5FKAC 2N9EB 4B6WA 5I6YA 3AE4B 3D4WA 4DV1Q 5ISRA 4OX9Q 3J9CA 2K50A 2CQAA 4LFBL 1UGMA 1PFSA 4DR4L 4KZ0A 2A19A 3S2DH 2MH7A 4HWIB 2HD5B 1AYFA 1CZGA 3OOCA 1V9JA 4RM8A 3K6OA 3FILA 3RPFC 1QCBD 3H3VH 3EFUA 4G11A 3IAYA 3NVVA 4J15A 1R4MI 4UPAA 2AQ1B 1BOSA 3SE0A 2XK5B 2QKIC 1OTRB 1GC6A 2JPHA 4AP4C 1RKNA 1H8CA 2LUEA 2KT7A 3CXCA 2YV5A 3PF5A 4ICUA 4B3RQ 5DM63 3HM6X 1VMCA 2L15A 4P74A 4X6AH 2QF7A 4KY6A 1PTOB 1Y8OB 2KK8A 2A68C 2F0MA 1TJEA 2JA8B 1A63A 1QF6A 2IX1A 2M19A 5FLMH 2A6EC 3DVGX 4A55A 3TEWA 4LTUA 4W9EA 2NVXH 5C3JB 4LNNA 4G7ZC 3HOVH 1IYVA 1QOAA 1LT6D 4TKOB 1GO3E 4EOYA 2BKRB 2EZVA 4A6QA 3Q8BA 2JU6X 1E5WA 1S40A 5IKCM 3MXNB 2L0TA 2GBNA 3WCQA 3K7UC 4F7XA 4NXNL 1H9MA 3KFUA 4LF6L 2K33A 1S5DD 3PUZA 5IGDA 4A3CH 1WJ6A 3UDXA 1R7SA 1EWIA 2PMZB 3A8KE 3QARA 4KGTA 3U7DA 3NS1A 3ZRCA 2PVGC 2E3TA 5KNCA 1JOQA 2WWZA 1SFOH 2SEBD 4EEWA 1A15A 1Y1VB 3R2TA 4JCVE 5KNBA 5KYIA 2CHXA 1HQRD 4YY3L 3GTGB 2PE6B 4EUTA 2HHHQ 4PQXA 1NEKB 4FF2A 1D8LA 3STBC 5IYDH 2INPE 2V3NA 1WWTA 3FHWA 1F2MA 2KC1A 1E6EB 3AN1A 1II3A 2PI2E 2LI5A 2F0UA 3FKIB 3A9KA 4R8IA 2FMMA 1JJCB 3HKSA 3ND9A 4WORA 1RLFA 3NBIA 2L52A 2NVYH 2W3SA 2JUOA 3EHVA 4RMAA 4DR6L 3AECB 3K7AB 2ZW1A 4L2YA 3S1MH 2IY0B 4XGAB 3U9SA 2MO1A 3T1HL 2LJ5A 5EE9A 2PQAB 3LWUA 1IKMA 1DGSA 4ANVA 1DOMA 2K8CA 5FJ8H 3B1LX 1L0XB 3QQ8B 2JZPA 4L6TB 1TS5A 4GOPC 2N88A 5D6JB 5C4XG 2WXIA 3GTQB 1WTPA 2VUMG 4DHJD 4DHJB 4XXEA 1VQMA 3UQAA 2MLBA 4KGRA 4GN4B 3TMEA 1GUNA 3Q22A 3WAMA 4PK1A 3ZRFA 1QOGA 1ZP0B 4OO1G 4IO9A 3CMMB 4MGYE 1C4CA 3FEWX 1E7UA 4PS8A 1J5EL 1WJ4A 1ROEA 3OYYA 1FFVA 2OF1A 4CO7A 2JK8A 4HMIA 1ESRA 5C44H 4A3DH 3GD7A 1JWMD 4JWSC 2FCSA 1F9SA 5IAAC 4CJ0B 2YYZA 2K05A 2WDVB 2Y5CA 2PIAA 4XYQA 4JI1L 1O80A 4BY7H 1SGHA 1SJED 2HD3A 4NW2A 4JV5L 2Z0DB 4MM3B 3ZDMC 2MX2A 3ABVB 3TUOA 3TIXA 4KKSA 1V43A 1O7YA 4BFRA 3RLOA 1ZW7A 2EJFC 2F0DA 2B39A 1GAQB 2H4OA 2MHVA 1WFYA 2MWSB 3VUXA 3HOWG 1PZKD 2G5DA 3S2HB 2AX5A 4QIWB 1TXYA 2RDBC 5E6PA 1P3QU 1CSPA 1UWXA 3PO3G 4JBWA 3GE8C 2FCNA 4A20A 3UE0A 1L1OC 4HLEA 3PIPA 1AH9A 3FAHA 5CHWA 4WIPA 1C78A 1M1KC 1X3QA 3NTHA 4CDFC 4X62L 4A3MB 2CU3A 2HE7A 2UXCQ 2DZKA 1CQVA 1TU2B 2M8SA 1HNWL 2K14A 2KKCA 1A2UA 2VNUD 1IBXA 2KQ3A 2LGYA 1TWAB 2F3WA 1KQSA 2JA5B 1P0RA 1U9RA 1A3VA 4RGNA 1XMQQ 1MSGA 1ENCA 4OELB 3J7A5 3A7AB 1CZWA 3H6NA 1VQFA 5EGTA 1V81A 5EE1A 1QUQB 4DXGA 1L0VB 1LUZA 2X38A 1RFKA 2F0VA 1N63A 1C4QA 3PV0A 2XWJB 4JBMA 3OG5A 1PGXA 3APCA 4II3B 1PH9A 1YD8U 1VMPA 4H7BA 2JA6H 2YTYA 2MNAA 2Z1CA 2Q2HA 2CHBD 4D2KA 2NVUI 2RDGA 3NG0A 3KJOA 3NE5B 4NKLA 2JXXA 4N59A 1A8VA 1D5MC 1SEBD 4BY1H 1LXDA 2O4XA 4KY5A 1MI0A 1EU3A 4G57A 2NN6G 4KKTA 1UH6A 4KSLC 1Y56A 2KXJA 4JI7Q 5FO7B 5BYSA 3EN2A 4DV5L 4IWOA 1YQ4B 3PUWA 4G3XB 1BBWA 3MEFA 1SR3A 2AL6A 2JRHA 3MAQA 1ZDVA 1L7YA 1C1YB 1ZPSA 2NTTA 3KYHC 4JC0A 1D1IA 1VQ4A 2J0MA 3M63B 2WHIA 1EZ6A 3ALBA 2ZNVB 3Q3JA 1CQFA 3I70A 3NZSA 4NY0A 4RMFA 1B53A 4OWWB 1PV4A 3D8GA 1OQYA 2RSUA 2J7QB 4XDDA 4KTAA 4P73A 3K5MA 1VQLA 3RN2A 2BB6A 3HOZG 2YU9B 2BYFA 1EY6A 2WXLA 1MG4A 5AFWA 3M4OB 4YL8A 3DDCB 3UE1A 1IBLL 1SYCA 3BDOA 3T1YL 3E0JA 2RGFA 2G9HD 3E3XA 5K5PA 3VR9B 4HCNB 2Q8TA 3S2DB 2Y3AA 2WQYB 4GKJL 4H2AA 3LWEA 3AEGB 3ZLZA 1KF6B 1C9OA 1QT9A 1OO9B 4A75A 4WFN3 4XT1B 3B08A 1DGJA 5J17A 1RAXA 4BKSA 2I46A 1D3ZA 5ELBA 4LF4Q 1TKGA 2JP1A 2K32A 2A69D 4APVA 1TY0A 2PPBC 1GVPA 1YNJD 4KHVA 3MP9A 4XQQA 1AP0A 2LKVA 1IGDA 1QB5D 2VS1A 1MVKA 3VTVA 4KV2A 1IBMQ 2VZKD 4LDTB 1HNZL 3GTLH 5FLXc 2JYEA 3RYTA 1O7IA 5ELDA 1SNCA 1N32L 1T0YA 5C0XI 2KACA 1VCBA 2F0EA 1JRPA 1XMOL 1L2FA 5EAYA 2B2WC 2MJEA 3CMEA 4V190 1E8WA 3HOVB 3KOJA 2K5DA 4MHEA 1U4AA 2LVQA 4E74A 2JT4B 3H9DA 2UWQA 5D14A 4YTMB 1K9MC 3W1BA 1BXTA 3ML8A 3W1SA 5C3WA 4DV0Q 1C4AA 3APFA 3HEJA 1EIHA 3PS6A 5JVH3 4ASWC 1J7AA 3BZKA 2JEAI 2MQJA 1JMCA 2P5ZX 3MHSD 4OIKA 1JROA 4WWPA 2FFKB 3PUYA 3OIQA 3CCRA 2BH2A 2EYOA 1SFOB 2NVTB 4HKQA 2YVCA 3N52A 1ZXIA 2INCC 1SDFA 4QGUA 1OXVA 2H1EA 3EFCA 3MTNB 4N9TA 5AZFA 1SYFA 5F2DA 1Q90A 3DUZA 4L63B 3OTOL 3GDEA 3SK8A 1EQQA 4JI0L 2V4LA 3JVZX 5LL6X 4K81A 3ZVVA 1RFAA 2R92H 1V80A 3F8TA 2IGHA 3KBGA 3M4YA 2KZRA 2KECA 3AE6B 3DOWA 3FPPA 3BINA 3QWZB 2N8NA 3GZNB 4C3IH 3I8ZA 2MW5A 5IYBH 4WJ3M 4GDKA 4L5QA 5E1FA 1K8AC 5BMHA 2NVYB 4LUZA 3C8YA 4WJNA 4KMUC 2C7NB 4S0RA 4HJ5A 1SB3C 2MEKA 3A74A 2BT6A 3P4RB 3Q6BA 1I4GA 5A2QL 4A3MG 3S1MB 2WDRB 3VA5A 3J7AV 2BS3B 5DEHA 2L0FA 3NWSA 3IRBA 1PA6A 4A3BG 1PH2A 2JN4A 4GNXA 4YWKA 5JEAG 1E9MA 5BMGA 1CFMA 4OWXB 1MG8A 4BVUC 1YNTE 2MCNB 3CIRB 1WZ0A 4JGHB 2K5HA 1RHPA 4XIGS 2MUYA 5FR6A 4DBGA 5DPTA 4M00A 4XQNA 4IFDI 5C4JH 1WH3A 4X3UA 1I6HH 3BY4B 1B3QA 3DBRB 3ONAB 3GE3C 1K0SA 3S1NH 3S1RH 3I9V1 3PV1A 3TMPB 4GS3A 2WU5B 3NBHA 4ARCA 4DAPA 3JC66 3ERQA 2NUCA 2XNAC 5LMNQ 3M3YH 4FYDA 4K2KA 1HNXQ 3P1HA 2IGGA 4DUYL 1XNQL 1Y14B 3AEBB 5E6OA 2KJXA 1OTCA 5C44B 2F0QA 3CCMA 3KJPA 5C23A 1EYDA 3BZDB 3DVNU 1EYGA 1TBEA 1ET9A 2N7DA 1NYRA 3P4SB 3PSEB 4ME3A 2BE5C 4G7HC 1SJHD 4NB3A 4EQPA 3I4NB 1E1TA 2AKWB 1NMGA 3DBHI 4BY7B 1LTGD 1ZE3D 3C1FA 5LLIA 1KAAA 3BU2A 3KBXA 5I2XA 3AEEB 4K3BA 3MA2B 3RZDH 2JY6A 4MGKE 4WURA 4O42A 5E6JA 4C4VB 2DBYA 4A90A 1H9SB 5EBDA 3ZXRA 4JI6Q 2NTSA 1JOKA 4LFAQ 1FJGQ 3KW5B 1I42A 2LJIA 2ZM6L 3JSVA 2L00B 1K0RA 3CRKC 3S1NB 1X9NA 1WY8A 1K83H 1VLBA 3E9IA 1NYQA 3J7ZC 1HH2P 2AMCB 1ZYRD 1GB4A 4NAWB 5G55A 3ZDTA 2F0JA 3DHIC 4JI4L 4A3GG 3X0WA 1X32A 4Y7NH 4DR2L 3EGRA 4HXDA 4JI3Q 2ASBA 2DYOA 3OW7A 5D3DA 4C3HH 3VTUA 2KCCA 1HA6A 1ESFA 1X1MA 3P42A 2UUBL 3H0GH 4C56C 1HA5A 3NPPA 4JI5L 3ULLA 2FUG1 2DWQA 1MSHA 2L1AA 2F0NA 3CHBD 5BR8L 1EY4A 1PFBA 2ZJRA 1EY9A 4DR7Q 3AU7A 3TQYA 5KIXA 1HR0L 1LLRD 1BCPD 5TSSA 1QVGA 2MJ3A 3TP8A 2UU7A 1PH1A 3FC4A 3OLMD 3PTFC 1IYJB 1AN8A 1VR9A 2CKHB 3VHTC 1X56A 3ETRA 3IBEA 2EJMA 4DAMA 2UUCQ 2LUMA 2N55A 4JPBW 1V5TA 4C3JH 4BY1B 3NQTA 2MRPA 3E56A 4MEMA 1WTVA 2EE1A 3EJIA 2VW9A 3I3CA 3MXGA 3I4MB 1UGJA 3UIPB 2K52A 3ENEA 2CFMA 4RF1A 4LUOA 3JYUA 2HDLA 3CQZB 4B3TL 4GB9A 2CWAA 3BK2A 1MJEA 1KIXA 1JWSD 1NR2A 3A8IE 2E2HH 1WJUA 4IOIE 1NY4A 2XSCA 2F0LA 4K8JA 4M01A 3AI5A 2GA4B 4DV1L 1E7PB 1VQ6A 3H3VC 2JA8H 3GV3A 4A3CG 4YWLA 2VQFL 1C0AA 3QIAA 4YCVA 2KEEA 2CJNA 4F8MA 1VQCA 3RNEC 5G3LF 1SNDA 2N49A 3H7PB 3QJZA 1EL0A 1WSPA 4DWFA 1K28A 2QC8A 1BDOA 2DJFC 1T9HA 5AEKB 1TR5A 1LTSD 1RTOA 1I50B 2K6AA 4IURA 2PMVA 3F2DA 2DZIA 2F52A 1PHJA 2MBHA 4B3RL 2IO2B 2XRQD 3KUPA 2KDEB 4L23A 4E3CA 2B63H 5IYDG 1LTID 4LLGM 1VF7A 4PG3A 2KDMA 1ZEQX 2F1MA 4HCSA 3E6ZX 1E2ZA 4A3KH 1PRTB 4QJFA 3W5UB 3ERSX 5IODA 1O7LA 2A6ED 4R4QA 1N62A 4M8NA 1FR3A 4MN3A 5DNFA 5G5HA 3ZNZB 5IA7A 4TVAB 2K01A 1GUSA 2D3AA 1MHHE 2O6VB 3J81c 3B0AA 2R7ZG 4FJVB 3UGBB 4EKUA 4HPPA 2KX3A 2ZPYA 4IPCA 4KV6A 2KNBA 1UWMA 5EDSA 5HKHA 2V4DA 4NXMQ 2BKFA 3GTLB 1D6EC 3VDZA 3D4RA 2N9XA 3I72A 4DV4Q 2DJGC 1SLJA 3TSSA 1XQQA 5JPNC 2WXHA 2GOWA 3FKIH 1XLOA 5DM73 1UWVA 2M56B 2AUJD 3AFQA 4GDLA 4C7ZA 4ANXA 2K8BA 3WALA 4XWWA 1CM9A 2KN4A 3MWYW 2K0PA 4N9F4 3AEAB 5FLXL 4DV7Q 4QAYA 3CU7A 2B2YA 3L2PA 1E22A 2BDNA 2LY7A 1NI2A 1LTAD 2LGSA 2JXTA 4K1RB 2VL6A 4LJOB 3GOEA 1PUTA 1V9PA 2HQLA 5LHY1 5C44G 2R93G 1O7ZA 4A3DG 4A3LH 3J81E 1EM7A 2JWUA 1XF5L 2ZCCA 2PW5A 1WCMH 3U30A 5KRUA 3P63A 2B2TA 4RA8A 2EYPA 1VQOA 2KBNA 3ICEA 1C76A 1VS0A 3PPAA 1JMLA 3RNFC 1BBUA 3QOJA 2QDLA 2JJQA 4PMBA 2WV6D 3QB3A 1N60A 1FD6A 4CHTB 4K5VA 2R92B 1NI3A 1J9OA 2ON8A 3W9CB 2NCNA 3I63C 3VFKA 2HDEA 2LEKA 2BDOA 2JQOA 2KUMA 4DAYA 4BKTA 2XVSA 2I5LX 4V0BA 4BXXH 2KHWB 1BQQT 1F9QA 2B2UC 4HSVA 1P98A 1G6JA 2ATWA 2Y5BB 2WB1B 2FCMA 3A4SC 4W9FA 2SNSA 2KWCA 2LMCB 2K5VA 4BWGB 4FVMA 2EYMA 1ZDXA 1FXAA 3AM9A 3BVZA 4ZYSA 1MIUA 1YNND 1VRAB 2LFIA 3A54A 2BA1A 2GVAA 4BBRG 1VZ7A 3U52E 2D2QA 1JR0D 4FO2A 1EY5A 3VR5A 3S16H 2I2YA 5GROA 5K36H 2IO3B 3TJPA 3V96A 3RNCC 5BN3A 3IAM1 3ZKJC 3A5ZB 1SE8A 1KC8C 1GG3A 2B3AA 3M62B 4ITKA 1UELA 5BO4B 1UE6A 2PNHA 2NBWB 2ONQA 3TL5A 1G6ZA 1LTTD 3ZXVA 4LW1A 5CR3A 1I6HB 5C5LA 1U5KA 3S1RB 2Q8RE
chains in the Genus database with same CATH topology
4HN7A 2YEPF 4FP5D 4NDXA 2EDGA 1J7CA 3L4PA 1KNEA 3M3YB 3BVGA 3TP6A 2Z8LA 3LYYA 1DZ1A 4ZHPA 2G9DA 4M0WA 2AUKA 2O5JC 2N9LA 2BTEA 2JYTA 1GUGA 3U4EG 2RBMA 1ZYRC 3C46A 4KKJA 3LXFA 4XWTA 5EPLA 1YN5A 4YT0B 2IX0A 3Q6SA 2XRSD 3RZDB 1CJEA 2ZXPA 1VZ6A 1ILPA 5KEEA 2GRIA 4PMWA 2J42A 4IDIA 1PZID 2DNEA 3C3LA 1K83B 2KVMA 1BCPC 2EPBA 2FBWB 1EY8A 4B9WA 1EQVA 5CV8A 3K5LA 3IT4B 2MP1A 1KDCA 2WP8J 3MXUA 1STNA 1JWAD 4Y7NB 1B9RA 1SYBA 4CKEA 1CA6A 1TKWB 4X3KA 3T51B 4C3HB 1QOFA 5I6WA 1TZOA 3MHBA 1FCLA 2OXPA 3H0GB 3FILB 5T8IA 5EBCA 4OO1I 3PZ7A 1E0BA 3MFGA 2O5IC 5I9PA 4JE3B 2C5CA 2L9HA 3J7YW 4R8NA 2V3PA 4ZK9B 4OHJA 1DONA 2GI9A 2Y0SB 2RDFA 1B4OA 3FDTA 4C3JB 4M1UB 1E10A 1UUPA 4C1NK 3AEFB 4MACA 2K3UA 4JPSA 1ICWA 1TVXA 1Q3LA 4RF0A 2ICIA 3J80E 2EKIA 3V05A 2EY6A 2E2HB 4J3OD 2IDYA 4FF3A 4IQZA 5HURA 1PTOD 3VR2A 1HFNA 1PRTC 4I7ZC 1FXIA 1XCQL 5EKIA 1HXYD 4R9WA 3BYTB 1RODA 2TMPA 4CKBA 3A55A 2J52A 5CORA 2E74C 1GOZA 2BS4B 3I57A 3NUCA 1T6BX 4RNAA 3RMHA 2OT2A 2PW9A 2B63B 4KI0A 3DWAA 2NWGA 1BUVT 1A6XA 3CWIA 4A3KB 3VR4A 2FE8A 4C3IG 4ZQ3A 1V8CA 4CQNA 1NVID 4FF4A 1AZQA 2NN6I 3HOXB 1VJKA 2IL8A 2WKCA 4EE2A 4EQNA 3NHHA 2WXMA 4IUQA 3AE2B 4YTNB 3G6JB 2MJDA 3TEYA 1F2YA 1U4LA 2RMMA 1PDXA 3R3OA 2WXNA 3OWEB 1L6UA 1PYWD 2E2DC 3KWLA 4RHSA 1HTLD 1JORA 4ZKCB 1WCMB 4KHZA 4JWUC 1YNNC 1SXTA 1RCVD 3HOYB 3Q8EA 4LK0M 2QCPX 1HZ5A 3IL8A 3BK1A 4HRSA 1Q10A 5FK9C 1SYGA 3L7ZC 2EJGC 4QF4A 4XQJA 3K58A 3NTKA 3RFZB 5FO9B 1FMAD 1QWYA 1O78A 5CV7A 1PDQA 3S16B 4FF1A 1IBXB 4AQ7A 2JXMB 1TS4A 4UAIA 2D9UA 4C3HG 5HI1A 5JAVA 1XWEA 2F0IA 4HEDA 1SIJA 4Q5VA 2BE5D 2LHDA 4R3DA 1ONLA 1KNAA 5ELFA 2WXFA 3PO0A 1LV9A 2EY2A 5C5MA 4DNTB 1B2TA 3U2SC 4TQ0A 2X6GA 4C3JG 2FHTA 3H6MA 4RGOS 2BW2A 4MH8A 1Y8NB 2R3ZA 1VCIA 2X6LA 3Q0AA 1SMYC 1K8OA 2EVBA 2J53A 1QOBA 1JCKB 3NTIA 3PMFA 3AE3B 2VXWA 4YSYB 4ULLA 3I91A 1FNUA 1G291 3SXHA 1U4PA 1WYGA 1HZ6A 1YMHE 3AB9A 4N6EB 2K28A 1A3TA 1NCVA 3VYRA 1T3QA 4WRDA 2A73B 3AH7A 3RUZA 4IUTA 4ZUIA 1LTRD 1RDPD 1E2WA 2B76B 2W3RA 1HFGA 1NSNS 1CT1D 1GB1A 1TIID 2QMTA 5J39A 1TQOA 5E4XA 1Y69U 3H91A 5GXGB 1PTOC 3GTOB 2EYFA 3HKZB 2IW3A 1D5XC 5C3EB 1H9JA 3H09A 2K03A 4DGZA 4CGYB 4RCNA 1PGAA 1WXQA 1K51A 3KLSX 2B2VC 2RSNA 4FXCA 1G8ZD 4AS1A 1EQTA 1P7EA 2M00A 5IGEA 2SAKA 4ID6A 4CJ1B 1SNOA 3IAS1 4DXFA 3T13A 1JICA 2JQRB 3HGBA 1JWBD 2JYOA 3EROA 2D2CC 3UI3A 3P4PB 3NXWA 3D6WA 2K04A 2D5DA 1A70A 1I7HA 1ZOYB 4GDKB 1L4ZB 3HVDA 4C1NI 1I3QB 4S3SA 3RLFA 4ZLTF 5IT9E 3K57A 3PO2B 1TKYA 2SNMA 4GZYC 4O1NA 3BG3A 1K53A 4HSPA 2KAJA 5FO8B 3TEXA 5BYRA 2LFNA 3K5NA 5K36G 2XIWA 4XE0A 4K6LA 3S14B 3DEOA 4H13C 3MTSA 1RF2D 1S5FD 1MPEA 3W3AA 1JQ4A 3Q23A 4B0EA 2PCFB 2H89B 3VYTA 2F0GA 2KCNA 5EQ0A 1JWUD 1WTWA 1RD9D 2F4IA 2OEOA 1Q8IA 3IFDA 4ZKBB 1LT5D 1STEA 4B08A 3V3XA 4DNRB 5C3XA 1BF4A 3IXSA 3E5SA 3NUHB 4FNFA 3PZ8A 1NR4A 1SYEA 2Q8IB 1OXXK 2F0HA 5E4WC 4ABNA 1KDAA 1LT4D 2WNMA 2N9KA 1HCZA 3EQLC 3K0YA 1PMRA 3JAME 3OPOA 1Z7TA 3KK7A 1QILA 4A3EB 4EGVA 1KRHA 3TZUA 4BA1I 1GJXA 4US9A 1VDVA 4A3FB 1N5WA 3HOUB 2B2UA 2A74C 1D1KA 5D7GA 5EPJA 3TBIB 5JEAJ 5EE3A 5D3IB 5EPKA 4OO1H 1UEAB 1L6VA 1I4PA 4WAFA 5KYLA 3X3NA 2PNRC 2BBCA 2RQXA 3J7AF 1I6VC 4DU9A 1DOYA 2L12A 3GTPB 1PLFA 4KX6B 1XYIA 5H8YE 5A35A 2E76C 2M0AA 1SSNA 4TQ1A 2YEPB 1K8MA 4F87A 3GTMB 1BO0A 1IW7D 1Z47A 1QNKA 4RHRA 3GO5A 5IGBA 3C2PA 1HUMA 1WTQA 3LNNA 3BIID 2A6HC 2ZW0A 1FNVA 1OXTA 4RH6A 2H88B 4US8A 4E6IA 5BYQA 3QJYA 4U673 5C0XJ 3IFTA 2F0WA 1C9FA 1AEXA 1NENB 2EOTA 3A56A 1LT3D 2JSOA 5EJWA 3MZ5A 2INNE 1ENAA 3SK4A 2EELA 3VRBB 4C2MB 2EXZA 3T4AC 2PZWA 1PRTD 2NN6H 2PTLA 1PFDA 2DN8A 3MHZA 1SYDA 2QILA 1ZUD2 4GDLB 4OL7A 3P4QB 4EQOA 1BBXC 2WP9B 1FGBD 2L1BA 4PV1C 2I38A 3NVYA 1EFID 1CA5A 3PUVA 2QIEB 4B9XA 2WAQB 4EVOA 3B2GA 3DWPA 1VZ8A 1TS3A 3ZQ4A 4IZ8A 1F77A 3P7JA 3KLSA 1SBBB 5MPOA 1KLGD 1JALA 3A7LA 2KHSA 2A5HA 3DXJC 4DAVA 3T3OA 5NUCA 2ICEC 1JB3A 4Z9CB 1GUOA 4IFDJ 4L8JA 2PW7A 1AWDA 1PGBA 3NWTA 4DQOC 3TZDA 2ACZB 3QO2A 3R93A 3AEDB 1KH0A 1Y8PB 1P7FA 3EFXD 2D62A 5CV5A 3Q24A 4LJZC 3NVWA 4HROA 2K5QA 1XLNA 2BOSA 4OZBA 3HVZA 1QQRA 4NJCA 1K50A 2BS2B 5M5WB 4DN4M 2Z4IA 1MGSA 2QEJC 1LTBD 1TWCB 1STAA 2KMMA 2VB2X 4LMQD 4HTHA 2BB5A 2F0OA 4KKUA 4A9AA 1GHKA 2ZXOA 3DHQA 3P75A 3T3NA 4K5XA 3K5OA 1DM0B 3TN2A 1HQMC 4XDXA 3T53B 3HRDD 3KLRA 2HCIA 1BCPF 2PZTA 1I4RA 3U9OA 3RD4A 4QCLA 1UAPA 3HUIA 2N7JA 1CI3M 2V0GA 1I4QA 3HG9A 3S15B 5JEAH 5JXVA 2SDFA 2KEDA 5C4XB 4I65A 2QJLA 3PIP3 3ZJVA 2WINB 1EOTA 5J1ZA 1E0ZA 1IGCA 1SMYD 4ARIA 4TRDA 2NMQA 3NSWA 2WACA 1YN3A 2PLPA 4LAAA 3P1MA 1V1PA 1IW7C 1ACCA 3GTJB 3KF8A 4UDUC 4KGSA 1KDBA 1R4QB 4YTPB 4P16A 3M7GA 4ZUJA 3DMUA 5CV4A 4J1MA 5C6AA 1RJTA 2F0TA 3HOWB 1DYQA 2IX3A 5AUKA 3SDZA 3PO3B 3SEBA 4PT5A 4WQMA 3NVZA 1H9RA 1YN4A 1F2RC 2ZXRA 2JX5A 3Q8FA 4XYOA 3VYSA 1OXSC 5C0XH 5CBEE 3BDLA 3DEPA 1C48A 4KJOA 1SE4A 4F88A 5C4ZA 5CGKA 1TYGB 1W6JA 1C77A 3M85A 5M3FB 1U4MA 5I4DA 4CKCA 1KABA 2WXQA 2B2YC 1WTXA 3F2UA 1LO5D 3IKJA 5BN5A 1QJOA 4ODGA 1WD1A 3AE7B 2HQEA 1SF0A 2QSDA 3HRZC 4KY7A 2B2TC 1D4BA 4DA2A 4U68A 1R9TB 1E2VA 2D5GA 1XTCD 1AW7A 2NB0A 1DOIA 2G1EA 3BYYB 2L32A 3HS0C 1FD7D 3MVVA 1KTKA 3ITPA 1BUIC 1DJRD 3SR1A 5M5YB 1IKLA 3J81L 3KWVA 3D4DA 3HOZB 4XT3B 4M8AA 1S5CD 3MXNA 3A8JE 2Y5PA 2B2VA 2RA4A 3AV8A 4IFDH 2F0SA 1B50A 3AE8B 1SSOA 1JOOA 5T1GA 5IIFA 5IGCA 3BS1A 4K2LA 2B2WA 3S17B 4P6VF 2L5TA 2RDHA 4WJWA 2PKOA 5CV9A 2MJ8A 4NAMA 2IGDA 3C1EA 3WDNA 3DWGC 1RYJA 2F3VA 3CRLC 1OXUA 1JE4A 4DK0A 3X3MA 1IUEA 3O13A 2CVRA 1F9PA 4XDCA 3L9AX 1CTMA 5A2QE 1B9MA 1B1ZA 4K8IA 3VRAB 1HHVA 4OVZA 2F0PA 1B9NA 2Z4HA 3Q8CA 1CK1A 4IALA 2PYKA 2K1BA 3GTKB 1FCCC 2K7VA 1FFUA 4AYBB 2J4XA 1F2LA 4USAA 1EWYC 1I4XA 5FOBB 1XCTL 4JK1C 1LABA 2N0SB 3QG1A 1SNQA 1ML0D 1ZXTA 1ZXHA 3ZJUA 2KA7A 2HTME 3W5VB 2FMCA 5EKKA 1XO3A 1FRDA 1K52A 1PXUA 1KFYB 4A8XC 4DK1A 5JVG3 3OSOA 2O2LD 4A3BB 1TS2A 4KD3A 2FINB 1R4PB 1AZPA 4FXKC 3V2TA 2WU2B 1EZ8A 1V8QA 2L0CA 3GS2A 4RKBA 3BDCA 1PTOF 5HHDG 3S1QB 3ZYYX 4WH4A 1QOHA 4QB4A 2RSOA 4DF7A 3FVQA 2SOBA 1B3AA 4B0MA 1WGKA 2F0FA 3VQIA 3D31A 5CBAE 5IGFA 4BBSB 2LGIA 1H9KA 1BMLC 1CHPD 1U4RA 1WVLA 2QDBA 3J80L 2F03A 1GPXA 4DFAA 4IN3A 3GV6A 2PO4A 1CHQD 4KN4C 4OIJA 4X3TA 3ZGZA 2A6HD 1PZJD 1FEHA 4ZRZA 5H92C 4KJNA 2B8GA 5JPMC 2EY5A 1KLUD 1LACA 5AUIA 3GQBA 4X3SA 1WRIA 3FMCA 1T5EA 3NK9A 3AMZA 1FYCA 1IHZA 1UNSA 3LB8C 1FRRA 2JSVX 4YSXB 4A3GB 1HUNA 1MBYA 4MIUA 1EU4A 2WXOA 2IJ0A 2IT1A 4QUCA 3MXPA 2R61A 4MT5A 2AWNA 2JEBI 2ID0A 1STBA 5LNK1 1WTOA 5EE0A 3BWUD 2NVQB 4RGTA 4HJGE 4A3IB 1BR9A 2J7ZA 2CJOA 4NZLB 5I2YA 1V1OA 5JOBA 1X3PA 1ENFA 2VZKB 2W54A 1SE2A 3H94A 3LX0A 5FR3A 5CV6A 3NRZA 1DXMA 2NVXB 4ZAIA 4H44C 4YIJA 3AMUA 4J8QA 5G3LD 1EY7A 1MHXA 3FRPB 3U7ZA 2WXPA 2BCOA 4J6HA 3NQIA 1VDZA 4HKZE 1RTNA 2BA0A 1JQYD 2WXJA 3MC0B 1HRJA 2L83A 1QG7A 4IUUA 5KGUA 3QWNA 3GB1A 3WOEA 2WKDA 1D5ZC 3L3OC 2IPKD 2AQ3B 1XLPA 4OW0A 2DYMA 4C7YA 4A3JB 5ELEA 4IUVA 5HFYA 4Q0FA 1FM0D 2WXKA 3I90A 2F0KA 5FLXE 4Q2JA 2HDMA 5HGTA 2E6XA 1XXGA 2CW0D 1Q1EA 1DOXA 2PQEA 2XWBB 1FIQA 1EWHA 3TP7A 2AQ2B 2DNCA 2R7ZB 2LHEA 1FNWA 5IOCA 4CJ2C 4HR7B 2NBFA 3DWQA 2W55A 2K9XA 1EWCA 3DWMA 5C2TB 4RWSC 1JW9D 5J22A 2WS3B 3UI2A 4OGQC 2E2IB 1XEEA 1SAPA 3P20A 1OFFA 1BNZA 4TSSA 2AWOA 1ILQA 3OMGA 3AE1B 5I9OA 5HG2A 1SNMA 1DOLA 1M4VA 5M5XB 3TP5A 2PVOD 2R93B 4A3DB 4TMAB 4KN7C 4H0LC 2B8FA 1WD0A 3Q8AA 1F0ZA 1Q1BA 4NP5A 1EYCA 2XN9C 3HZXA 5DAUA 2WIIB 1L5PA 1NAPA 1G91A 1TWFB 3CKIB 1J8IA 1QLBB 2M9VA 2DLBA 4YWGG 4HAEA 4PMCA 4REZA 3AB5A 3PIO3 1QNUA 4L1BA 3SR6A 2FJ2A 2L11A 1ZKOA 1S4ZA 1G2TA 1N5XA 1S5BD 3MFYA 1STHA 3MJ5A 3ZJTA 2KQ4X 3OHXC 1TWHB 2RPVA 3I73A 4BBRB 5C0XG 4BA2I 1F9RA 4P2CB 3VYUA 1H9SA 1WTRA 1GUWA 5LL6S 1TT2A 4KKIA 1C79A 1M8AA 1I4HA 1OQQA 3H8HA 5COYA 4ZHOA 4YXDB 1EEID 3N9YC 3EA6A 2MPMA 2MGSA 3Q69A 1F2ZA 1BCPB 2JA6B 4N58A 1YJIA 4G4KA 1N61A 1NUCA 1QKZA 3G7LA 2JA7B 3TDQA 1EEFD 1XX8A 4HMJA 1Y1WB 3SHLA 1TY2A 4RFBA 4BS9A 3QOLA 1A3UA 2EYJA 4TQUS 5BN4A 2OHFA 4C80A 4LK1C 5T1IA 4JX1C 2K22A 4K14A 4ME5A 4K5WA 1QE6A 1PTOH 1SE3A 2WXRA 4IKGA 1IYUA 5M3MB 5CMDA 2A69C 1STYA 3D3RA 1YNJC 1PFMA 2EY1A 2GB1A 2WXGA 5IGGA 2OEDA 3HP3A 3I4LA 1EYAA 2EYHA 5KNDA 5CYUA 4IFDG 2HUGA 3NZ3A 4QMGA 3K59A 4XTCS 2KOLA 2A68D 5C4HA 1F2RI 4ZRQA 2RVLA 5D65A 4OZAA 2I07B 3VR3A 5BMIA 3R8BA 2RKSA 1DOKA 4A93B 3AE5B 2J0TD 2TSSA 2W82A 1Z6HA 2C9OA 5IT9L 5E3FA 1SNPA 1XLQA 1FO4A 1B44D 5M9OA 5G5GA 4ZRPA 3EUB2 2L55A 4FXGC 5JJZA 3VR8B 1Q12A 4WWMA 1ET6A 4FXDA 2KWDA 2JE6I 2K5PA 3KQ4A 2CW0C 3E9SA 4RCOA 3OMCA 5CC4A 4ILWA 3DM1A 3BVMA 1C8CA 3D6CA 2WDQB 2LS01 2K5WA 4IUPA 1J7BA 3GP7A 4N9PA 3NP8A 3PUXA 1YQ3B 4IUNA 4HEA1 3VA7A 1OQRA 5ELCA 4G7OC 4C3IB 2ENBA 2NYZD 4RAUC 2PZUA 1CZPA 1L4DB 1PFNA 2DY7A 2R6GA 1DCZA 1JC7A 3JAML 3FPUB 1V97A 3TEZA 1T5XD 3SVMA 2WLBA 4HCEA 2NZ1D 4YSZB 1A2TA 2LMCA 3R2IA 1RM6C 1S5ED 2L4NA 5C4JB 4RKLA 4KK7A 1MI2A 3URYA 4RGMA 3WOFA 1GXDC 3OWFA 2X69A 2Q5WD 1G2SA 3SFEB 1DD2A 2VB3X 3IT6B 1AFPA 1V1PB 1IL8A 2E2JB 1C4PA 3T16A 2V4IB 1GUTA 2VUMB 2IWHA 4OZCA 1EIGA 3SK6A 2BYTA 4PNYA 2DY8A 1TWGB 3SFDB 2M2LA 1STGA 4QUFA 3OIPA 3VR6A 3MEHA 4NMZA 3T56B 1L0YB 1VF5C 3RZOB 1TKEA 3ND8A 3M7NA 3B2FA 2ZT9C 2HCCA 1D2BA 1MD2D 3S9WA 2E75C 4CBVA 1GHJA 3N6RA 1HPCA 1HTPA 1PRTF 1RWSA 4GLSC 3AE9B 4K6DA 3EVQA 1EY0A 1YJJA 4ZOHC 1W6KA 3SK5A 1HEZE 3B9JA 2EYLA 4KD4A 5EKLA 3W2DA 5FKAC 5I6YA 3AE4B 3D4WA 5ISRA 3J9CA 2CQAA 2MH7A 1AYFA 1CZGA 3OOCA 3K6OA 3FILA 3RPFC 1QCBD 3IAYA 3NVVA 2AQ1B 1BOSA 3SE0A 2QKIC 1RKNA 5DM63 1VMCA 2QF7A 4KY6A 1PTOB 1Y8OB 2A68C 2F0MA 1TJEA 2JA8B 1QF6A 2IX1A 2M19A 2A6EC 4A55A 3TEWA 4LTUA 5C3JB 4G7ZC 1IYVA 1QOAA 1LT6D 4TKOB 2EZVA 4A6QA 3Q8BA 2JU6X 3WCQA 4F7XA 1H9MA 2K33A 1S5DD 3PUZA 5IGDA 1R7SA 2PMZB 3A8KE 4KGTA 3NS1A 2PVGC 2E3TA 5KNCA 1JOQA 2SEBD 1A15A 1Y1VB 3R2TA 5KNBA 5KYIA 1HQRD 3GTGB 4PQXA 1NEKB 4FF2A 2INPE 2V3NA 1WWTA 1F2MA 1E6EB 3AN1A 1II3A 2F0UA 3FKIB 4R8IA 2FMMA 3ND9A 4WORA 2L52A 2W3SA 3NBIA 3AECB 3K7AB 2ZW1A 4L2YA 3U9SA 5EE9A 3LWUA 1IKMA 1DOMA 1L0XB 2JZPA 4L6TB 1TS5A 2N88A 2WXIA 3GTQB 1WTPA 4XXEA 4KGRA 3TMEA 1GUNA 3Q22A 1QOGA 1ZP0B 4OO1G 1C4CA 3FEWX 1ROEA 1FFVA 2OF1A 4HMIA 1ESRA 3GD7A 1JWMD 4JWSC 1F9SA 4CJ0B 2YYZA 2K05A 2WDVB 2Y5CA 2PIAA 4XYQA 1O80A 4MM3B 1SJED 4NW2A 3ABVB 3TUOA 4KKSA 1V43A 1O7YA 2EJFC 2F0DA 2B39A 1GAQB 2H4OA 2MHVA 1PZKD 3S2HB 2AX5A 4QIWB 1UWXA 4JBWA 3FAHA 4WIPA 1C78A 1X3QA 3NTHA 4A3MB 2CU3A 1CQVA 1TU2B 1A2UA 2VNUD 1IBXA 2KQ3A 1TWAB 2F3WA 2JA5B 1U9RA 1A3VA 4RGNA 1MSGA 1ENCA 3A7AB 1CZWA 5EGTA 5EE1A 4DXGA 1L0VB 2X38A 1RFKA 2F0VA 1N63A 1C4QA 3PV0A 2XWJB 1PGXA 1VMPA 4H7BA 2Z1CA 2CHBD 4D2KA 2RDGA 3NE5B 4NKLA 4N59A 1D5MC 1SEBD 2O4XA 4KY5A 1MI0A 1EU3A 4G57A 2NN6G 4KKTA 1Y56A 5FO7B 5BYSA 1YQ4B 3PUWA 3MAQA 1ZDVA 1ZPSA 2NTTA 1D1IA 1EZ6A 1CQFA 3I70A 1B53A 3D8GA 4XDDA 4KTAA 3K5MA 2BB6A 2YU9B 2WXLA 1EY6A 5AFWA 3M4OB 1SYCA 3BDOA 3E0JA 2G9HD 5K5PA 3VR9B 2Q8TA 3S2DB 2Y3AA 2WQYB 4H2AA 3LWEA 3AEGB 1KF6B 1QT9A 1OO9B 4WFN3 4XT1B 1DGJA 2I46A 5ELBA 1TKGA 2JP1A 2K32A 2A69D 1TY0A 2PPBC 1YNJD 4KHVA 3MP9A 4XQQA 1AP0A 2LKVA 1IGDA 1QB5D 1MVKA 2VZKD 2JYEA 5ELDA 1SNCA 5C0XI 2KACA 2F0EA 1JRPA 2MJEA 2B2WC 4V190 3HOVB 4MHEA 2K5DA 5D14A 4YTMB 1BXTA 3W1SA 5C3WA 1C4AA 3HEJA 1EIHA 5JVH3 1J7AA 2JEAI 4OIKA 1JROA 2FFKB 3PUYA 3OIQA 2EYOA 1SFOB 2NVTB 4HKQA 3N52A 1ZXIA 1SDFA 1OXVA 2H1EA 4N9TA 1SYFA 5F2DA 1Q90A 3DUZA 4L63B 3SK8A 5LL6X 2IGHA 3KBGA 3M4YA 2KECA 3AE6B 3FPPA 3I8ZA 5BMHA 5E1FA 2NVYB 3C8YA 4KMUC 2MEKA 1SB3C 2BT6A 3P4RB 1I4GA 5A2QL 3S1MB 2WDRB 3VA5A 3J7AV 2BS3B 5DEHA 3NWSA 5JEAG 1E9MA 5BMGA 1CFMA 1YNTE 3CIRB 1RHPA 4XIGS 2MUYA 4XQNA 4IFDI 4X3UA 3I9V1 3ONAB 2WU5B 3NBHA 4ARCA 4DAPA 3ERQA 2NUCA 2XNAC 4FYDA 4K2KA 2IGGA 3P1HA 3AEBB 2KJXA 5C44B 2F0QA 1EYDA 3BZDB 1ET9A 1NYRA 3P4SB 2BE5C 4G7HC 1SJHD 4EQPA 3I4NB 4BY7B 1LTGD 1ZE3D 3C1FA 1KAAA 3KBXA 5I2XA 3AEEB 3MA2B 4WURA 5E6JA 4O42A 2DBYA 4A90A 1H9SB 5EBDA 2NTSA 1JOKA 2LJIA 3CRKC 1VLBA 1NYQA 1ZYRD 1GB4A 4NAWB 2F0JA 1X32A 3EGRA 2DYOA 3OW7A 5D3DA 2KCCA 1HA6A 1ESFA 3P42A 4C56C 1HA5A 3NPPA 2FUG1 2DWQA 1MSHA 2L1AA 2F0NA 3CHBD 1EY4A 1PFBA 1EY9A 3AU7A 5KIXA 2MJ3A 1LLRD 1BCPD 5TSSA 3FC4A 3TP8A 1AN8A 1VR9A 3ETRA 2EJMA 2LUMA 2N55A 4BY1B 3NQTA 3E56A 1WTVA 2EE1A 3EJIA 3I3CA 3MXGA 3I4MB 1UGJA 4RF1A 2HDLA 3CQZB 3BK2A 1JWSD 1NR2A 3A8IE 4IOIE 2XSCA 2F0LA 4K8JA 2GA4B 1E7PB 3H3VC 3GV3A 3QIAA 2KEEA 2CJNA 4F8MA 5G3LF 1SNDA 1EL0A 1WSPA 1BDOA 1TR5A 1LTSD 1RTOA 1I50B 2K6AA 4IURA 2PMVA 4L23A 2XRQD 3KUPA 1LTID 4LLGM 1VF7A 2KDMA 1ZEQX 2F1MA 4HCSA 3E6ZX 1E2ZA 1PRTB 3W5UB 5IODA 1O7LA 2A6ED 1N62A 1FR3A 4MN3A 5DNFA 5G5HA 2K01A 1GUSA 1MHHE 4KV6A 1UWMA 2V4DA 3GTLB 1D6EC 3D4RA 3I72A 3TSSA 5JPNC 2WXHA 1XLOA 5DM73 2M56B 2AUJD 4C7ZA 4XWWA 1CM9A 2KN4A 3MWYW 2K0PA 3AEAB 5FLXL 3CU7A 2B2YA 2BDNA 2LY7A 1LTAD 2JXTA 1PUTA 5LHY1 1EM7A 2JWUA 1O7ZA 3J81E 1XF5L 2PW5A