5IN7A

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
KAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5in7A00
1MG4A 5IO9A 2DNFA 1MJDA 5IOIA 2BQQA 1MFWA 5IN7A 5IP4D 5IKCM 1UF0A
chains in the Genus database with same CATH superfamily
4EZLA 2NPTA 3DVNU 3DBHB 3HHMA 2WXMA 4YXDB 1NDDA 3GZNB 4FXCA 3I5JC 2RD0A 4AWJA 1BT0A 1I42A 3CMMB 3HK0A 2C7HA 1Q0WB 2Z59B 4A6QA 1FFVA 2I1JA 2M4NA 3M95A 3ML8A 2LVQA 2M1MA 3T8MA 4MM3A 3N1XC 3WAPA 1E9MA 2JSVX 4ZRIA 1SBBB 4JL9A 3I57A 2ON8A 4LCDE 4ANVA 1KJTA 4II3B 2ZCCA 1OQYA 2ZNVB 3JVZX 3AE2B 4JPSA 4ZRJA 2GBKA 4W9DA 1P3QU 1R4NI 2KN4A 4ANXA 3NVYA 3V60A 2PIAA 4HRSA 2YVCA 1WF9A 1FRRA 2KJ6A 2GB1A 1HZ6A 2D3CA 4DQOC 3B0AA 3UIPB 3PREA 3WAOA 3Q8BA 1LM8B 4B0EA 3AB5A 3A1QB 3L13A 4IKGA 1E8YA 4GDLB 1I4GA 4IG7B 1WXVA 2Z0DB 2D11A 1HTOA 4JE3B 4XZ4A 4KDLB 1WXSA 3IG3A 1WZ0A 1RFAA 1HA5A 3PHWB 4ACFA 4P1BC 4J6IA 3NOBA 1L5PA 2BKRB 3AE8B 4N6EB 2FCQA 3TEYA 3APCA 2VZKD 2HTME 4GN1A 1FNVA 1C4AA 2I38A 2IO2B 1UGMA 3DBRB 2JQRB 4GIVA 1K50A 3DBHI 3ZGZA 1NI3A 4PS8A 2UYZB 2MX2A 1XO3A 3Q8CA 5G5GA 3L16A 1AW7A 1KRHA 3AE7B 4XWTA 4IOIE 1CMXB 4XWWA 2MCNB 2PJHA 3KYCD 1SGHA 1L4ZB 4N58A 4TQ0A 1FD6A 2V3NA 4IM2A 1GC7A 1VRAB 1B1ZA 3NY5A 2YLMA 4GSWA 4HK2A 2N9EB 1RYJA 3TL5A 1XLQA 1XLPA 3WCQA 1F1HA 1HEZE 1N62A 1P1AA 4TSSA 4WAAA 1YD8U 2LVPA 2UWQA 2VRRB 4MJSA 1V81A 3FILB 3N1YC 1ACCA 1T5XD 2JPHA 1D4BA 3QA8A 2GBMA 4PS3A 2KJHB 1VLBA 3RT3B 1MG8A 3C0RB 1I4PA 4K81A 1A70A 5BYQA 5JH5C 1FPYA 3JSVB 1E8WA 4RGOS 1FCLA 3N32A 1Q5WB 3L0WB 5E6PA 4M01A 2KD0A 2C9WB 3ZJTA 1ENFA 1TS3A 2WDTB 4MH0E 3MTNB 2V0GA 1YJIA 2WXNA 1V1OA 3ENEA 2G4SA 1TS2A 3QC8B 4B0MA 5IO9A 1SSNA 4TQ1A 1WGDA 3VUWA 1WGKA 3H9DA 3BYYB 3J9CA 1C4CA 4LNNA 4MSMB 2DENB 1PGBA 2ONQA 3Q8FA 4XC2A 4WJOA 2E6XA 4HKZE 1E8ZA 2IO3B 5HG2A 4KVGB 1FFUA 1FCCC 4IUMB 3AH7A 2R61A 4OZAA 3DBSA 2IYDB 4GOCA 1V5OA 3Q3NC 5G2NA 1PDXA 2XK5A 3DBRI 1NEKB 3APFA 3B08A 1RAXA 4KKIA 3H1UA 2ZJDA 1VZ8A 2PTLA 5LXHA 3L17A 3P4QB 4L23A 2BB6A 1MJDA 3KUZA 4S0RA 1EF1A 3SEBA 4GXBA 2FE8A 2KWCA 2LWPA 3H6NA 2N9LA 4HROA 2LZ6A 1J19A 2WHIA 4DDID 3A4RA 4ASWC 1F77A 2WGSA 1WRIA 4M8NA 3HM6X 1HXYD 3ZXVA 1YX6B 2JXTA 2DLBA 2JXXA 1YNTE 1IYFA 1E7UA 2G1EA 1T0SC 4HPMB 2QC8A 1I4QA 4BZAA 2ZW1A 3WALA 3AXCA 5C1ZA 4YTNB 1F2RI 1Q1OA 3ZRCA 3TJPA 3LDZE 3RZWC 1L2NA 1PYWD 2FIFA 4K3CA 2PPHA 4KKJA 1LFDA 3ZQ4A 2NBWB 3TMPB 1DGJA 3Q69A 1XQQA 4FULA 5LXIB 1JWBD 1QOFA 3AI5A 4IM3A 3VUXA 3N9YC 1KLUD 4ZHOA 3SHQA 1ZKHA 2N1WA 1WYGA 2BT6A 4P6VF 2NBUA 5C2TB 1HQRD 2IY0B 1ZDXA 3QWZB 3OLMD 2KDBA 2IO1B 1NYQA 4K1RB 1IBXB 4LLGM 4KGTA 3AU4A 5G5HA 3IAM1 2X38A 2V3PA 1GNUA 2J53A 2VZKB 4DK5A 4W9HA 4RH6A 3TEZA 3A9KB 1KH0A 2V9HA 5BMHA 3HVDA 4P16A 4B6WA 1KTKA 4MACA 2FCSA 1JMLA 1DOYA 5IKCM 4EUTA 1Y56A 1M4VA 1WJ6A 4WAFA 1L4DB 2GBRA 2MRPA 3KUCB 2MP2A 3AE1B 3PVLA 2XN9C 1E90A 1WX8A 5H8YE 2KLGA 3DPDA 3IT4B 2CHXA 4PS7A 3QJZA 1VZ7A 4PT5A 4NAWB 2DZIA 3R7RA 1V86A 3RNAC 2MWSB 5D2MB 1XLNA 2AQ3B 1WR1A 2AYOB 1C4PA 4ZRKA 1GC6A 2J42A 2DAFA 4ZDVA 2KJRA 1ZUD2 4KV2A 2NMQA 2W54A 1L7YA 1JW9D 1NENB 3NVVA 1D6EC 3I9V1 4W9FA 3PZ7A 1XXGA 1UBIA 5IN7A 3CSFA 1QOBA 2QHOA 2KTFA 1T0QC 4MGYE 2AX5A 2V1YA 3NHEB 1D5MC 3IVFA 1LXDA 2KFKB 2X8XX 4LK0M 1YJJA 4KIKB 2RSUA 3PT2B 1X1MA 2L05A 4C80A 3ETRA 2WXQA 2WDRB 3KUDB 2BTEA 4C7ZA 2KWVB 1IGCA 2KYWA 1DOXA 1BMLC 4FA6A 2HJ8A 1DYQA 3L54A 2L1AA 3U4EG 5HI1A 1K53A 3RCZA 2OOBB 3H7SA 1CJEA 2MBQA 5DPTA 1TZ1A 3MJ5A 4C4VB 3ECIA 3RYTA 2L52A 3RNEC 4WQOB 3A1QA 2C60A 3SDLC 2W9NA 2WX1A 4W9GA 4GDLA 1H8CA 4A8XC 1EM7A 2MW5A 2N9KA 1WY8A 2DZJA 4HKQA 3MP9A 4YSYB 4WWPA 3AEAB 1HE8A 3NZUA 4DXAB 1IP9A 3GOEA 4N59A 4BKSA 2MBHA 1VJKA 1L6VA 1P9DU 5KHQA 3UGBB 3D32A 2KWUB 2LXCA 4J3OD 1YJ1A 3IFWB 1J8CA 2LMCA 2WP9B 2IGDA 1ZP0B 3QARA 1KLGD 4LNFA 2CU3A 5BYRA 4RFBA 2WU5B 1G6JA 2BKFA 2BYFA 1ZXHA 4RF0A 2JZZA 4OHJA 2O6VD 2JY6A 4K7WA 2KTRB 2FBWB 1L0VB 4JLCA 1WSPA 1WXAA 3ZDTA 2W3RA 3B2GA 3RFZB 1E0ZA 1GJZA 2GMIC 2INCC 3Q6BA 2IGHA 4LDTB 2DYOA 1N5WA 3HVZA 4M0WB 2BB5A 4WJNA 4HDOA 5E6OA 1N5XA 4DBGA 4MEMA 1WFYA 2KC2A 3AEEB 2KDMA 4REZA 2C7NB 1MHXA 2FCMA 5HKHA 3VAWA 3FILA 4ICVA 2BWFA 4K7SA 1R4MI 2N1VA 2NTSA 2WXRA 3PRPB 2TSSA 3AECB 2AQ2B 1JQ4A 1WGHA 1EU3A 1STEA 3R2IA 3JSVA 4X57B 2KMAA 2RPQA 3UQBA 2PE6B 4YTMB 2IDYA 2LEKA 4LNKA 3HM3A 2ZNVC 1JWAD 4OZBA 4GB9A 2MBOA 2L83A 3I63C 3WAMA 1L0YB 3GP7A 2DNFA 2Y3AA 5J18A 1V1PB 1P7EA 4IM0A 1TY2A 2WS3B 3PO0A 3AEBB 3UQAA 5GXGB 1RM6C 3L10B 4PYZA 4MGKE 3ZW3A 3UIOB 4B95A 3W5VB 5D3IB 3PLUA 2CR5A 4ZOHC 3R7QA 3SU8X 1WM2A 5JHBA 4II2B 4UDUC 1C3TA 3N20C 3AEFB 2JYEA 5D94A 1QT9A 4LNIA 4AJWA 3EC8A 4WQMA 2HE7A 3EGRA 5AZHA 3K9OB 3N1ZC 1XEEA 1XF5L 1TTNA 2ASQA 3BYTB 1K8RB 1WIAA 2Y5BB 1OQRA 1J0GA 2JZPA 2DAJA 5J2RA 5E6NA 3VQIA 4WJPA 1FO4A 3GZNI 4US8A 3PLVA 2KACA 2OJWA 4XDCA 2KOXA 3TEWA 5KHOA 2KFJA 2PE9A 3IAS1 4RM8A 4OVUA 2WXOA 1E7PB 2LI5A 3ZIMA 2OEDA 3ZNGC 2GRIA 4IWPA 3PSEB 3GS2A 1UF0A 3EECA 5JHAA 1WJNA 2MBEA 3RZFA 2C7MB 4DHJD 3IT6B 1NI2A 2KT7A 3AM9A 4YSXB 1JALA 2WX0A 3T3NA 2N7EA 3B2FA 4K3BA 1Z2MA 3RNGC 1BXTA 2KNBA 1Q10A 2JYTA 5EE3A 4PK1A 4USAA 1KLVA 1EF5A 3TUOA 4TUUA 1F2RC 2JZ3B 4EKUA 4MSQB 1UUPA 2INNE 1WXQA 2RDHA 1TZOA 3ONSA 1TS4A 5CHFA 3GE8C 2ZEQA 3ZLZA 1V49A 4MGIE 4FJVB 4XE0A 4HVBA 2XNAC 1UBQA 2V3SA 2WU2B 4XYCA 3ZO5B 1KFYB 1EWCA 3A9JB 3KH0A 2HJ1A 1IBXA 1FXIA 2K22A 3NS8A 4FJZA 2IZVB 4C00A 4FADA 1WX7A 3AE9B 3MFGA 3OAWA 2DYMA 2K1FA 3A9KA 3P1MA 3AN1A 1RWSA 2FAZA 4A90A 1N61A 4JIOU 2GBJA 1YX5B 1SXTA 3VR9B 2M8SA 3V6EB 2KVZA 2O6VB 2KDIA 2LFIA 3R3MA 1AARA 4A55A 4IWOA 1I7HA 2IBIB 4NJCA 3VHTC 2NBVB 3MHZA 2G4DB 3CF6E 4A3PA 4L1BA 4W9EA 3FC4A 2KAJA 3EHVA 4HDQA 2FUG1 1D3ZA 3IBEA 3W9CB 3KWVA 1QKZA 5AUKA 2LD9A 5AUIA 1TKGA 4E3CA 1N6ZA 4TV3A 4NAWA 4W9CA 4KGSA 2PMVA 1WGGA 4ANWA 5CX3A 1DOIA 1OEYJ 2WXLA 3BVZA 4BFRA 2ZPNA 1GPXA 3FAHA 2LJ5A 4DHZB 1ROEA 1IPGA 2MSED 2KN5A 1YN4A 3E9SA 2MH7A 2M19A 2MEKA 4RF1A 2WLBA 4LDTD 2DHZA 1LO5D 4JX1C 1P7FA 2BQQA 1WH3A 3U30A 2UU7A 1J7CA 5DPRA 1EO6A 2KFKA 1SE3A 1FMAD 3P4SB 3EUB2 5L83A 4EFOA 3E56A 4KIKA 5D3DA 2LUMA 2XBBC 2RPVA 1AYFA 3LB8C 2SAKA 3Q3FA 1UH6A 3ABVB 3TEXA 2JWUA 3ZRFA 1NVID 5IP4D 5CHWA 3VDZA 4AOFA 3Q8EA 1JCKB 3AU5A 3VFKA 2CKHB 4RMAA 4BVUC 2LHDA 2K5PA 2MA9B 1LQBA 3QQ8B 2KQ4X 4GDKB 2N7JA 4NJ7A 2K8HA 2QJLA 3AE5B 3PHXB 1XD3B 1SB3C 1SEBD 3QAQA 2RDGA 4ZHPA 2DWQA 2IPKD 4M00A 4HXDA 4C4VA 5H92C 4OW0A 3U2SC 1QILA 4HJKA 2Y5CA 1SE9A 1JWMD 3KQ4A 2KXJA 3H8HA 4YT0B 3ZNHB 4XDDA 3KW5B 3LJ3A 3C19A 3DBLB 3PZ8A 4H2AA 2ZCBA 3PPAA 3W1SA 5AEKB 2LUEA 2D3BA 1OGWA 4BKGA 1JWUD 4HCNB 2ZVNA 3DWGC 2EMTA 5DCNA 2RR9A 4PYUA 5IAAC 4CHKA 2Z0EB 4FLHA 3P63A 1MHHE 1UGJA 4E71A 2KANA 4HJGE 5G55A 1VZ6A 3PV1A 4CYEA 1P98A 2MBBB 3EFCA 4YWGG 3APDA 1KOTA 3UINB 1WYWB 1ZXIA 2O2VB 4ZRQA 2KTRA 2DZMA 4DHJB 2L3ZA 2PVGC 4GLSC 4RCOA 4HCPB 3RMKC 2CHZA 2KX0A 3RN9C 2ZVOA 3RNFC 1J7AA 2JRHA 3VR8B 4O1NA 3Q3OC 3GE3C 4M0WA 1PUTA 2PEAA 4HPLB 1UELA 4DXFA 2VH2A 1E8XA 4ZYSA 3AE3B 4A20A 2CU1A 4BBNF 4G11A 5GMVA 1V8CA 1AN8A 2QILA 4IDIA 4JGHB 1H4RA 1ZW7A 4EOYA 2WDVB 2BS4B 5EE9A 2BS3B 4G50A 4KDIC 1C77A 1RFKA 2FIDA 1D5ZC 4ITKA 2JX5A 3NRZA 4MH8A 3NVZA 2MJ3A 3N3KB 4BBNC 1FRDA 2J52A 2GOWA 4WWOA 2PW9A 3ZVVA 2AL3A 1V97A 1SIFA 3MC0B 1GG3A 1YQ3B 3AE6B 3S2AA 3DQVA 1V1PA 1UZXB 3VH4B 2EMSA 2BS2B 1YQ4B 2N7DA 3R2TA 4IC7B 4MDKE 3DOWA 4G3XB 2FCNA 5CTRC 3PTFC 3NVWA 1V5TA 4BOSC 4E74A 4MGZE 1QOGA 4CO7A 2MQJA 4P7IA 1MFWA 2QCZA 4FN2A 1SE4A 2XEWA 2JVCA 4EEWA 2PKOA 4OVZA 2L32A 1C9FA 4F7ZA 3R66C 3L08A 5FR6A 1N63A 4DDGD 2DX5B 1UNSA 1AWDA 1R4NB 2ZW0A 4MELA 2EKIA 1SIJA 1K51A 4NJ6A 3OJ4B 3RPFC 4A3OA 1WZ3A 3RNBC 5BYSA 2I2YA 1FM0D 3DHIC 1S3SG 3RULA 1OTRB 3P2BA 2J0KA 1T6BX 2IO0B 2W82A 2KDEB 3BZDB 4WH4A 2NVUI 4I6NB 2LVOA 5TR5A 3KYDD 3BIID 3MC9A 2K8BA 3BY4B 2AL6A 3TSSA 3KLSX 2E3TA 1ET9A 4WURA 5JZEB 2KMMA 2JU6X 3ZTCA 1EUVB 4GMVA 3VTUA 2D07B 3PZDA 2IJ0A 2DBYA 1SJED 2L0TA 3WANA 4YTPB 1HZ5A 3CIRB 4FBJB 4LJOB 3V61A 1PFDA 5C3JB 1UWMA 4AQ7A 4NY0A 3RD2A 3P4RB 1S1QB 1HTQA 2AQ1B 4RNAA 4W9JA 1T3QA 4HWIB 2AEHA 3LYYA 1BUIC 1CZPA 1Z5SB 5D6JB 3ZUNA 2ZZPB 3FKYA 1C79A 2MJDA 2CJOA 2D5GA 1VCBA 4QAYA 2Y5PA 3A4SC 3R8BA 2KX3A 3ZNID 4S17A 1WJUA 2M0AA 2H88B 3U7DA 3ALBA 2LGYA 2N0SB 1T0YA 3VTVA 2N9XA 2ICIA 2K9XA 1SF0A 1IGDA 4N9F4 4WWNA 4KX6B 2WXHA 1Y8RC 1T0RC 1K52A 4OZCA 3NZ3A 5J17A 1WXMA 2K3UA 1ET6A 2IGGA 1C76A 2LJIA 3M3JA 2L7RA 2OHFA 4IWQA 1ZPSA 4KSKC 4LJPB 4NAMA 3MHSD 1KF6B 1IUEA 3A9JA 4NNJB 1CK1A 5EE1A 3SR6A 1R7SA 2N9PC 1YIWA 3HIZA 2J7QB 1TY0A 3Q3MC 3C8YA 1A5RA 1I4RA 2O6VA 2RDBC 1NBFC 1TIFA 2N4FA 4KZ0A 2PVOD 3EFUA 2DZKA 3VXWA 3W2DA 4WWMA 1QOAA 5HHDG 3ZXRA 1GB1A 2B3AA 3ZJUA 2RMMA 2SEBD 3ML9A 1MPEA 3K9PB 5TSSA 3H7PB 4YSZB 2GBNA 1SJHD 3BK1A 3HUIA 1F0ZA 4RGNA 1TBEA 2C5LC 3ZJVA 3NS1A 4RGTA 5AZFA 2D10A 2R2QA 4B9KA 3P42A 3BINA 3KVFB 1QF6A 4RGMA 2KQSA 2MHJA 4KZCA 1ZE3D 1TKEA 1D5XC 1WMHB 4W9KA 2JWZA 1ZDVA 1WJ4A 2D3AA 2NPTB 1CQVA 3PGEA 5T8IA 2G45B 2KMCA 1M94A 2WNMA 3UI3A 5FKAC 1GAQB 2LGDA 2M56B 3OG5A 5E6JA 3QX1A 1U4AA 1XLOA 3IXSA 3BWUD 2KVRA 2BYTA 1F9JA 5D7GA 2CS4A 2WXKA 2JF5A 5DPSA 3I3TB 1OEYA 1WGYA 4MM3B 3OJ3A 3CWIA 2D3GA 3NG0A 2YEPF 4GDKA 3V05A 2K8CA 2M17A 2EKEC 2MLBA 4US9A 4FHJA 2BGFA 2LGIA 2DYBA 1XT9B 2BWES 2KHWB 1MVKA 1LGRA 3SD5A 3AMZA 1JROA 1UD7A 4K7UA 4JWUC 2WXGA 2LGXA 3VH3B 1FNUA 4R3DA 2G3QB 2J0JA 1OQQA 2A4ZA 4XX5A 4URKA 2FNJB 4GGQA 4HPPA 1WRDB 1ZOYB 3Q8AA 2WXFA 3DVNV 4C7YA 2YEPB 4DHZE 3NZSA 4KGRA 3DHHC 4JQWC 4YL8A 1C1YB 3KWLA 4WIPA 2KZRA 1NYRA 2NCNA 1YMHE 1B9RA 2I1KA 2O2VA 2J4XA 3Q14C 2L8JA 2REXA 2BF8B 2G9HD 4WJQA 3ZKJC 4F1SA 1V9JA 4HLEA 4M8MA 5FK9C 4W9LA 4P1CC 1WE7A 2LASA 3ZYYX 1N60A 4LNOA 3DDCB 3M63B 2LHEA 4RM9A 2H89B 4NQLB 3X23A 2KWDA 3LXFA 1WM3A 2BYEA 3DVGY 2AWTA 2W55A 4MT5A 3Q2AC 3NUHB 3QCAA 3RUIB 2L0FA 3ZNZB 2WQYB 1MI0A 2M0XA 3AULA 4ARIA 3A33B 2QSDA 3TCAA 1VDVA 3QHTA 2JT4B 2Q5WD 2WYQA 1GOZA 5IA7A 1E10A 2NS5A 4HEA1 2LRUA 4MJSB 1QLBB 2QMTA 2W3SA 3AE4B 3AV8A 2GI9A 1OFFA 4ZRPA 3VTWA 1VR9A 3SFEB 3V6CB 1QZEA 4ICUA 3N30A 1VD2A 4KSLC 1WE6A 3BK2A 2EELA 2KQ7A 2WXIA 3DVGX 2LRWA 3O13A 2K25A 2NTTA 1KM7A 2A5UA 2GLSA 5DPWA 3AEDB 3P4PB 2KKCA 4DXGA 2BW2A 1ESFA 3BVGA 1FXTB 4AUQC 3BVMA 3DWMA 1TJEA 1FNWA 1EU4A 2WWZA 4G0NB 2HD5B 1GUAB 4NQKE 4XGAB 1P0RA 3ZDMC 5EDSA 1QQRA 3VVWB 4BOZB 5AZGA 2IY1B 1TS5A 2WXPA 3MC8A 1YOVB 5L95C 3DHGC 3VRBB 1JRPA 1ISNA 2V4LA 2HDEA 4AP4C 5MPOA 1L6UA 3PRMB 4GU2A 2KC1A 5LLIA 2XK5B 4I6PA 4TMAB 4ARCA 2MJEA 1E6EB 1FIQA 3UF8A 1WI0A 1RLFA 1V80A 2VH1A 1ZGUB 2R2OA 3W1YA 5FR3A 4BKSD 4FJYA 1PGXA 1I4HA 3X0WA 4BAXA 4Q2JA 1TT5B 1TKYA 2LXAA 3IHPC 2WXJA 2FUHB 3URYA 4AJYB 5EE0A 3V3XA 2KDFB 5IOIA 3T9LA 2D2QA 1E7VA 3M62B 3OWEB 4DWFA 4L2YA 1YQBA 3L4PA 3RI7C 2HTHA 1WGRA 4OVVA 1I35A 2QDFA 3NJTA 4EZJA 2CHWA 1V2YA 2PLPA 3U8ZA 5LNK1 2QIEB 2ZPYA 3B1LX 1EWYC 1UWXA 3PS6A 1SE2A 2BPSA 2K6DB 5HFYA 1GB4A 4TKNA 3ZTDA 2KLCA 5BO4B 4NPNA 1R4MB 1J7BA 3HRDD 2RGFA 1RRBA 3SFDB 2LGSA 2K6QA 3DBLI 5CHVC 3VUYA 4BKTA 3QIJA 3JW0X 1WX9A 1E5WA 1XCQL 1TYGB 4EZKA 2L76A 1F52A 4I6LB 4FHKA 3T3OA 2BVCA 5I4DA 4IW0A 5BMIA 3WA0A 3Q3JA 1FEHA 3GB1A 3O65B 2CJNA 4AS1A 2BYVE 2K39A 1PGAA 1YN5A 2V4IB 3VRAB 1JRUA 4C56C 2KK8A 3W1SC 2INDC 4F8CB 3MJWA 3QK0A 2NR2A 4W9IA 2K0PA 3JYUA 2WDQB 2J0MA 2JUOA 2Z8LA 1I4XA 4ZYNA 1C78A 5BMGA 1L0XB 3CSTA 2OJRA 3DCGA 3W5UB 3TIXA 3U7ZA 1V6EA 2INPE 2QEJC 1YN3A 1WWTA 2JRIB 4D2KA 3V62A 4NZLB 4A9AA 5C23A 1XCTL 3WIMA 2B76B 4LTUA 3TBLD 1JWSD 1FXAA 2KO3A 3H7PA 1WR6E 3AEGB 2ACZB 3U52E 3B9JA 2MP2B 2L00B 1MG4A 1PQSA 3RNCC 4M02A 4JWSC 4ANUA 5JXVA 3PRZA 4EE2A 1WMHA 2BBCA 1TGZB 4CQNA 3EA6A
chains in the Genus database with same CATH topology
1MG4A 5IO9A 2DNFA 1MJDA 5IOIA 2BQQA 1MFWA 5IN7A 5IP4D 5IKCM 1UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG4 A;  5IO9 A;  2DNF A;  1MJD A;  5IOI A;  2BQQ A;  1MFW A;  5IN7 A;  5IP4 D;  5IKC M;  1UF0 A; 
#chains in the Genus database with same CATH topology
 4EZL A;  2NPT A;  3DVN U;  3DBH B;  3HHM A;  2WXM A;  4YXD B;  1NDD A;  3GZN B;  4FXC A;  3I5J C;  2RD0 A;  4AWJ A;  1BT0 A;  1I42 A;  3CMM B;  3HK0 A;  2C7H A;  1Q0W B;  2Z59 B;  4A6Q A;  1FFV A;  2I1J A;  2M4N A;  3M95 A;  3ML8 A;  2LVQ A;  2M1M A;  3T8M A;  4MM3 A;  3N1X C;  3WAP A;  1E9M A;  2JSV X;  4ZRI A;  1SBB B;  4JL9 A;  3I57 A;  2ON8 A;  4LCD E;  4ANV A;  1KJT A;  4II3 B;  2ZCC A;  1OQY A;  2ZNV B;  3JVZ X;  3AE2 B;  4JPS A;  4ZRJ A;  2GBK A;  4W9D A;  1P3Q U;  1R4N I;  2KN4 A;  4ANX A;  3NVY A;  3V60 A;  2PIA A;  4HRS A;  2YVC A;  1WF9 A;  1FRR A;  2KJ6 A;  2GB1 A;  1HZ6 A;  2D3C A;  4DQO C;  3B0A A;  3UIP B;  3PRE A;  3WAO A;  3Q8B A;  1LM8 B;  4B0E A;  3AB5 A;  3A1Q B;  3L13 A;  4IKG A;  1E8Y A;  4GDL B;  1I4G A;  4IG7 B;  1WXV A;  2Z0D B;  2D11 A;  1HTO A;  4JE3 B;  4XZ4 A;  4KDL B;  1WXS A;  3IG3 A;  1WZ0 A;  1RFA A;  1HA5 A;  3PHW B;  4ACF A;  4P1B C;  4J6I A;  3NOB A;  1L5P A;  2BKR B;  3AE8 B;  4N6E B;  2FCQ A;  3TEY A;  3APC A;  2VZK D;  2HTM E;  4GN1 A;  1FNV A;  1C4A A;  2I38 A;  2IO2 B;  1UGM A;  3DBR B;  2JQR B;  4GIV A;  1K50 A;  3DBH I;  3ZGZ A;  1NI3 A;  4PS8 A;  2UYZ B;  2MX2 A;  1XO3 A;  3Q8C A;  5G5G A;  3L16 A;  1AW7 A;  1KRH A;  3AE7 B;  4XWT A;  4IOI E;  1CMX B;  4XWW A;  2MCN B;  2PJH A;  3KYC D;  1SGH A;  1L4Z B;  4N58 A;  4TQ0 A;  1FD6 A;  2V3N A;  4IM2 A;  1GC7 A;  1VRA B;  1B1Z A;  3NY5 A;  2YLM A;  4GSW A;  4HK2 A;  2N9E B;  1RYJ A;  3TL5 A;  1XLQ A;  1XLP A;  3WCQ A;  1F1H A;  1HEZ E;  1N62 A;  1P1A A;  4TSS A;  4WAA A;  1YD8 U;  2LVP A;  2UWQ A;  2VRR B;  4MJS A;  1V81 A;  3FIL B;  3N1Y C;  1ACC A;  1T5X D;  2JPH A;  1D4B A;  3QA8 A;  2GBM A;  4PS3 A;  2KJH B;  1VLB A;  3RT3 B;  1MG8 A;  3C0R B;  1I4P A;  4K81 A;  1A70 A;  5BYQ A;  5JH5 C;  1FPY A;  3JSV B;  1E8W A;  4RGO S;  1FCL A;  3N32 A;  1Q5W B;  3L0W B;  5E6P A;  4M01 A;  2KD0 A;  2C9W B;  3ZJT A;  1ENF A;  1TS3 A;  2WDT B;  4MH0 E;  3MTN B;  2V0G A;  1YJI A;  2WXN A;  1V1O A;  3ENE A;  2G4S A;  1TS2 A;  3QC8 B;  4B0M A;  5IO9 A;  1SSN A;  4TQ1 A;  1WGD A;  3VUW A;  1WGK A;  3H9D A;  3BYY B;  3J9C A;  1C4C A;  4LNN A;  4MSM B;  2DEN B;  1PGB A;  2ONQ A;  3Q8F A;  4XC2 A;  4WJO A;  2E6X A;  4HKZ E;  1E8Z A;  2IO3 B;  5HG2 A;  4KVG B;  1FFU A;  1FCC C;  4IUM B;  3AH7 A;  2R61 A;  4OZA A;  3DBS A;  2IYD B;  4GOC A;  1V5O A;  3Q3N C;  5G2N A;  1PDX A;  2XK5 A;  3DBR I;  1NEK B;  3APF A;  3B08 A;  1RAX A;  4KKI A;  3H1U A;  2ZJD A;  1VZ8 A;  2PTL A;  5LXH A;  3L17 A;  3P4Q B;  4L23 A;  2BB6 A;  1MJD A;  3KUZ A;  4S0R A;  1EF1 A;  3SEB A;  4GXB A;  2FE8 A;  2KWC A;  2LWP A;  3H6N A;  2N9L A;  4HRO A;  2LZ6 A;  1J19 A;  2WHI A;  4DDI D;  3A4R A;  4ASW C;  1F77 A;  2WGS A;  1WRI A;  4M8N A;  3HM6 X;  1HXY D;  3ZXV A;  1YX6 B;  2JXT A;  2DLB A;  2JXX A;  1YNT E;  1IYF A;  1E7U A;  2G1E A;  1T0S C;  4HPM B;  2QC8 A;  1I4Q A;  4BZA A;  2ZW1 A;  3WAL A;  3AXC A;  5C1Z A;  4YTN B;  1F2R I;  1Q1O A;  3ZRC A;  3TJP A;  3LDZ E;  3RZW C;  1L2N A;  1PYW D;  2FIF A;  4K3C A;  2PPH A;  4KKJ A;  1LFD A;  3ZQ4 A;  2NBW B;  3TMP B;  1DGJ A;  3Q69 A;  1XQQ A;  4FUL A;  5LXI B;  1JWB D;  1QOF A;  3AI5 A;  4IM3 A;  3VUX A;  3N9Y C;  1KLU D;  4ZHO A;  3SHQ A;  1ZKH A;  2N1W A;  1WYG A;  2BT6 A;  4P6V F;  2NBU A;  5C2T B;  1HQR D;  2IY0 B;  1ZDX A;  3QWZ B;  3OLM D;  2KDB A;  2IO1 B;  1NYQ A;  4K1R B;  1IBX B;  4LLG M;  4KGT A;  3AU4 A;  5G5H A;  3IAM 1;  2X38 A;  2V3P A;  1GNU A;  2J53 A;  2VZK B;  4DK5 A;  4W9H A;  4RH6 A;  3TEZ A;  3A9K B;  1KH0 A;  2V9H A;  5BMH A;  3HVD A;  4P16 A;  4B6W A;  1KTK A;  4MAC A;  2FCS A;  1JML A;  1DOY A;  5IKC M;  4EUT A;  1Y56 A;  1M4V A;  1WJ6 A;  4WAF A;  1L4D B;  2GBR A;  2MRP A;  3KUC B;  2MP2 A;  3AE1 B;  3PVL A;  2XN9 C;  1E90 A;  1WX8 A;  5H8Y E;  2KLG A;  3DPD A;  3IT4 B;  2CHX A;  4PS7 A;  3QJZ A;  1VZ7 A;  4PT5 A;  4NAW B;  2DZI A;  3R7R A;  1V86 A;  3RNA C;  2MWS B;  5D2M B;  1XLN A;  2AQ3 B;  1WR1 A;  2AYO B;  1C4P A;  4ZRK A;  1GC6 A;  2J42 A;  2DAF A;  4ZDV A;  2KJR A;  1ZUD 2;  4KV2 A;  2NMQ A;  2W54 A;  1L7Y A;  1JW9 D;  1NEN B;  3NVV A;  1D6E C;  3I9V 1;  4W9F A;  3PZ7 A;  1XXG A;  1UBI A;  5IN7 A;  3CSF A;  1QOB A;  2QHO A;  2KTF A;  1T0Q C;  4MGY E;  2AX5 A;  2V1Y A;  3NHE B;  1D5M C;  3IVF A;  1LXD A;  2KFK B;  2X8X X;  4LK0 M;  1YJJ A;  4KIK B;  2RSU A;  3PT2 B;  1X1M A;  2L05 A;  4C80 A;  3ETR A;  2WXQ A;  2WDR B;  3KUD B;  2BTE A;  4C7Z A;  2KWV B;  1IGC A;  2KYW A;  1DOX A;  1BML C;  4FA6 A;  2HJ8 A;  1DYQ A;  3L54 A;  2L1A A;  3U4E G;  5HI1 A;  1K53 A;  3RCZ A;  2OOB B;  3H7S A;  1CJE A;  2MBQ A;  5DPT A;  1TZ1 A;  3MJ5 A;  4C4V B;  3ECI A;  3RYT A;  2L52 A;  3RNE C;  4WQO B;  3A1Q A;  2C60 A;  3SDL C;  2W9N A;  2WX1 A;  4W9G A;  4GDL A;  1H8C A;  4A8X C;  1EM7 A;  2MW5 A;  2N9K A;  1WY8 A;  2DZJ A;  4HKQ A;  3MP9 A;  4YSY B;  4WWP A;  3AEA B;  1HE8 A;  3NZU A;  4DXA B;  1IP9 A;  3GOE A;  4N59 A;  4BKS A;  2MBH A;  1VJK A;  1L6V A;  1P9D U;  5KHQ A;  3UGB B;  3D32 A;  2KWU B;  2LXC A;  4J3O D;  1YJ1 A;  3IFW B;  1J8C A;  2LMC A;  2WP9 B;  2IGD A;  1ZP0 B;  3QAR A;  1KLG D;  4LNF A;  2CU3 A;  5BYR A;  4RFB A;  2WU5 B;  1G6J A;  2BKF A;  2BYF A;  1ZXH A;  4RF0 A;  2JZZ A;  4OHJ A;  2O6V D;  2JY6 A;  4K7W A;  2KTR B;  2FBW B;  1L0V B;  4JLC A;  1WSP A;  1WXA A;  3ZDT A;  2W3R A;  3B2G A;  3RFZ B;  1E0Z A;  1GJZ A;  2GMI C;  2INC C;  3Q6B A;  2IGH A;  4LDT B;  2DYO A;  1N5W A;  3HVZ A;  4M0W B;  2BB5 A;  4WJN A;  4HDO A;  5E6O A;  1N5X A;  4DBG A;  4MEM A;  1WFY A;  2KC2 A;  3AEE B;  2KDM A;  4REZ A;  2C7N B;  1MHX A;  2FCM A;  5HKH A;  3VAW A;  3FIL A;  4ICV A;  2BWF A;  4K7S A;  1R4M I;  2N1V A;  2NTS A;  2WXR A;  3PRP B;  2TSS A;  3AEC B;  2AQ2 B;  1JQ4 A;  1WGH A;  1EU3 A;  1STE A;  3R2I A;  3JSV A;  4X57 B;  2KMA A;  2RPQ A;  3UQB A;  2PE6 B;  4YTM B;  2IDY A;  2LEK A;  4LNK A;  3HM3 A;  2ZNV C;  1JWA D;  4OZB A;  4GB9 A;  2MBO A;  2L83 A;  3I63 C;  3WAM A;  1L0Y B;  3GP7 A;  2DNF A;  2Y3A A;  5J18 A;  1V1P B;  1P7E A;  4IM0 A;  1TY2 A;  2WS3 B;  3PO0 A;  3AEB B;  3UQA A;  5GXG B;  1RM6 C;  3L10 B;  4PYZ A;  4MGK E;  3ZW3 A;  3UIO B;  4B95 A;  3W5V B;  5D3I B;  3PLU A;  2CR5 A;  4ZOH C;  3R7Q A;  3SU8 X;  1WM2 A;  5JHB A;  4II2 B;  4UDU C;  1C3T A;  3N20 C;  3AEF B;  2JYE A;  5D94 A;  1QT9 A;  4LNI A;  4AJW A;  3EC8 A;  4WQM A;  2HE7 A;  3EGR A;  5AZH A;  3K9O B;  3N1Z C;  1XEE A;  1XF5 L;  1TTN A;  2ASQ A;  3BYT B;  1K8R B;  1WIA A;  2Y5B B;  1OQR A;  1J0G A;  2JZP A;  2DAJ A;  5J2R A;  5E6N A;  3VQI A;  4WJP A;  1FO4 A;  3GZN I;  4US8 A;  3PLV A;  2KAC A;  2OJW A;  4XDC A;  2KOX A;  3TEW A;  5KHO A;  2KFJ A;  2PE9 A;  3IAS 1;  4RM8 A;  4OVU A;  2WXO A;  1E7P B;  2LI5 A;  3ZIM A;  2OED A;  3ZNG C;  2GRI A;  4IWP A;  3PSE B;  3GS2 A;  1UF0 A;  3EEC A;  5JHA A;  1WJN A;  2MBE A;  3RZF A;  2C7M B;  4DHJ D;  3IT6 B;  1NI2 A;  2KT7 A;  3AM9 A;  4YSX B;  1JAL A;  2WX0 A;  3T3N A;  2N7E A;  3B2F A;  4K3B A;  1Z2M A;  3RNG C;  1BXT A;  2KNB A;  1Q10 A;  2JYT A;  5EE3 A;  4PK1 A;  4USA A;  1KLV A;  1EF5 A;  3TUO A;  4TUU A;  1F2R C;  2JZ3 B;  4EKU A;  4MSQ B;  1UUP A;  2INN E;  1WXQ A;  2RDH A;  1TZO A;  3ONS A;  1TS4 A;  5CHF A;  3GE8 C;  2ZEQ A;  3ZLZ A;  1V49 A;  4MGI E;  4FJV B;  4XE0 A;  4HVB A;  2XNA C;  1UBQ A;  2V3S A;  2WU2 B;  4XYC A;  3ZO5 B;  1KFY B;  1EWC A;  3A9J B;  3KH0 A;  2HJ1 A;  1IBX A;  1FXI A;  2K22 A;  3NS8 A;  4FJZ A;  2IZV B;  4C00 A;  4FAD A;  1WX7 A;  3AE9 B;  3MFG A;  3OAW A;  2DYM A;  2K1F A;  3A9K A;  3P1M A;  3AN1 A;  1RWS A;  2FAZ A;  4A90 A;  1N61 A;  4JIO U;  2GBJ A;  1YX5 B;  1SXT A;  3VR9 B;  2M8S A;  3V6E B;  2KVZ A;  2O6V B;  2KDI A;  2LFI A;  3R3M A;  1AAR A;  4A55 A;  4IWO A;  1I7H A;  2IBI B;  4NJC A;  3VHT C;  2NBV B;  3MHZ A;  2G4D B;  3CF6 E;  4A3P A;  4L1B A;  4W9E A;  3FC4 A;  2KAJ A;  3EHV A;  4HDQ A;  2FUG 1;  1D3Z A;  3IBE A;  3W9C B;  3KWV A;  1QKZ A;  5AUK A;  2LD9 A;  5AUI A;  1TKG A;  4E3C A;  1N6Z A;  4TV3 A;  4NAW A;  4W9C A;  4KGS A;  2PMV A;  1WGG A;  4ANW A;  5CX3 A;  1DOI A;  1OEY J;  2WXL A;  3BVZ A;  4BFR A;  2ZPN A;  1GPX A;  3FAH A;  2LJ5 A;  4DHZ B;  1ROE A;  1IPG A;  2MSE D;  2KN5 A;  1YN4 A;  3E9S A;  2MH7 A;  2M19 A;  2MEK A;  4RF1 A;  2WLB A;  4LDT D;  2DHZ A;  1LO5 D;  4JX1 C;  1P7F A;  2BQQ A;  1WH3 A;  3U30 A;  2UU7 A;  1J7C A;  5DPR A;  1EO6 A;  2KFK A;  1SE3 A;  1FMA D;  3P4S B;  3EUB 2;  5L83 A;  4EFO A;  3E56 A;  4KIK A;  5D3D A;  2LUM A;  2XBB C;  2RPV A;  1AYF A;  3LB8 C;  2SAK A;  3Q3F A;  1UH6 A;  3ABV B;  3TEX A;  2JWU A;  3ZRF A;  1NVI D;  5IP4 D;  5CHW A;  3VDZ A;  4AOF A;  3Q8E A;  1JCK B;  3AU5 A;  3VFK A;  2CKH B;  4RMA A;  4BVU C;  2LHD A;  2K5P A;  2MA9 B;  1LQB A;  3QQ8 B;  2KQ4 X;  4GDK B;  2N7J A;  4NJ7 A;  2K8H A;  2QJL A;  3AE5 B;  3PHX B;  1XD3 B;  1SB3 C;  1SEB D;  3QAQ A;  2RDG A;  4ZHP A;  2DWQ A;  2IPK D;  4M00 A;  4HXD A;  4C4V A;  5H92 C;  4OW0 A;  3U2S C;  1QIL A;  4HJK A;  2Y5C A;  1SE9 A;  1JWM D;  3KQ4 A;  2KXJ A;  3H8H A;  4YT0 B;  3ZNH B;  4XDD A;  3KW5 B;  3LJ3 A;  3C19 A;  3DBL B;  3PZ8 A;  4H2A A;  2ZCB A;  3PPA A;  3W1S A;  5AEK B;  2LUE A;  2D3B A;  1OGW A;  4BKG A;  1JWU D;  4HCN B;  2ZVN A;  3DWG C;  2EMT A;  5DCN A;  2RR9 A;  4PYU A;  5IAA C;  4CHK A;  2Z0E B;  4FLH A;  3P63 A;  1MHH E;  1UGJ A;  4E71 A;  2KAN A;  4HJG E;  5G55 A;  1VZ6 A;  3PV1 A;  4CYE A;  1P98 A;  2MBB B;  3EFC A;  4YWG G;  3APD A;  1KOT A;  3UIN B;  1WYW B;  1ZXI A;  2O2V B;  4ZRQ A;  2KTR A;  2DZM A;  4DHJ B;  2L3Z A;  2PVG C;  4GLS C;  4RCO A;  4HCP B;  3RMK C;  2CHZ A;  2KX0 A;  3RN9 C;  2ZVO A;  3RNF C;  1J7A A;  2JRH A;  3VR8 B;  4O1N A;  3Q3O C;  3GE3 C;  4M0W A;  1PUT A;  2PEA A;  4HPL B;  1UEL A;  4DXF A;  2VH2 A;  1E8X A;  4ZYS A;  3AE3 B;  4A20 A;  2CU1 A;  4BBN F;  4G11 A;  5GMV A;  1V8C A;  1AN8 A;  2QIL A;  4IDI A;  4JGH B;  1H4R A;  1ZW7 A;  4EOY A;  2WDV B;  2BS4 B;  5EE9 A;  2BS3 B;  4G50 A;  4KDI C;  1C77 A;  1RFK A;  2FID A;  1D5Z C;  4ITK A;  2JX5 A;  3NRZ A;  4MH8 A;  3NVZ A;  2MJ3 A;  3N3K B;  4BBN C;  1FRD A;  2J52 A;  2GOW A;  4WWO A;  2PW9 A;  3ZVV A;  2AL3 A;  1V97 A;  1SIF A;  3MC0 B;  1GG3 A;  1YQ3 B;  3AE6 B;  3S2A A;  3DQV A;  1V1P A;  1UZX B;  3VH4 B;  2EMS A;  2BS2 B;  1YQ4 B;  2N7D A;  3R2T A;  4IC7 B;  4MDK E;  3DOW A;  4G3X B;  2FCN A;  5CTR C;  3PTF C;  3NVW A;  1V5T A;  4BOS C;  4E74 A;  4MGZ E;  1QOG A;  4CO7 A;  2MQJ A;  4P7I A;  1MFW A;  2QCZ A;  4FN2 A;  1SE4 A;  2XEW A;  2JVC A;  4EEW A;  2PKO A;  4OVZ A;  2L32 A;  1C9F A;  4F7Z A;  3R66 C;  3L08 A;  5FR6 A;  1N63 A;  4DDG D;  2DX5 B;  1UNS A;  1AWD A;  1R4N B;  2ZW0 A;  4MEL A;  2EKI A;  1SIJ A;  1K51 A;  4NJ6 A;  3OJ4 B;  3RPF C;  4A3O A;  1WZ3 A;  3RNB C;  5BYS A;  2I2Y A;  1FM0 D;  3DHI C;  1S3S G;  3RUL A;  1OTR B;  3P2B A;  2J0K A;  1T6B X;  2IO0 B;  2W82 A;  2KDE B;  3BZD B;  4WH4 A;  2NVU I;  4I6N B;  2LVO A;  5TR5 A;  3KYD D;  3BII D;  3MC9 A;  2K8B A;  3BY4 B;  2AL6 A;  3TSS A;  3KLS X;  2E3T A;  1ET9 A;  4WUR A;  5JZE B;  2KMM A;  2JU6 X;  3ZTC A;  1EUV B;  4GMV A;  3VTU A;  2D07 B;  3PZD A;  2IJ0 A;  2DBY A;  1SJE D;  2L0T A;  3WAN A;  4YTP B;  1HZ5 A;  3CIR B;  4FBJ B;  4LJO B;  3V61 A;  1PFD A;  5C3J B;  1UWM A;  4AQ7 A;  4NY0 A;  3RD2 A;  3P4R B;  1S1Q B;  1HTQ A;  2AQ1 B;  4RNA A;  4W9J A;  1T3Q A;  4HWI B;  2AEH A;  3LYY A;  1BUI C;  1CZP A;  1Z5S B;  5D6J B;  3ZUN A;  2ZZP B;  3FKY A;  1C79 A;  2MJD A;  2CJO A;  2D5G A;  1VCB A;  4QAY A;  2Y5P A;  3A4S C;  3R8B A;  2KX3 A;  3ZNI D;  4S17 A;  1WJU A;  2M0A A;  2H88 B;  3U7D A;  3ALB A;  2LGY A;  2N0S B;  1T0Y A;  3VTV A;  2N9X A;  2ICI A;  2K9X A;  1SF0 A;  1IGD A;  4N9F 4;  4WWN A;  4KX6 B;  2WXH A;  1Y8R C;  1T0R C;  1K52 A;  4OZC A;  3NZ3 A;  5J17 A;  1WXM A;  2K3U A;  1ET6 A;  2IGG A;  1C76 A;  2LJI A;  3M3J A;  2L7R A;  2OHF A;  4IWQ A;  1ZPS A;  4KSK C;  4LJP B;  4NAM A;  3MHS D;  1KF6 B;  1IUE A;  3A9J A;  4NNJ B;  1CK1 A;  5EE1 A;  3SR6 A;  1R7S A;  2N9P C;  1YIW A;  3HIZ A;  2J7Q B;  1TY0 A;  3Q3M C;  3C8Y A;  1A5R A;  1I4R A;  2O6V A;  2RDB C;  1NBF C;  1TIF A;  2N4F A;  4KZ0 A;  2PVO D;  3EFU A;  2DZK A;  3VXW A;  3W2D A;  4WWM A;  1QOA A;  5HHD G;  3ZXR A;  1GB1 A;  2B3A A;  3ZJU A;  2RMM A;  2SEB D;  3ML9 A;  1MPE A;  3K9P B;  5TSS A;  3H7P B;  4YSZ B;  2GBN A;  1SJH D;  3BK1 A;  3HUI A;  1F0Z A;  4RGN A;  1TBE A;  2C5L C;  3ZJV A;  3NS1 A;  4RGT A;  5AZF A;  2D10 A;  2R2Q A;  4B9K A;  3P42 A;  3BIN A;  3KVF B;  1QF6 A;  4RGM A;  2KQS A;  2MHJ A;  4KZC A;  1ZE3 D;  1TKE A;  1D5X C;  1WMH B;  4W9K A;  2JWZ A;  1ZDV A;  1WJ4 A;  2D3A A;  2NPT B;  1CQV A;  3PGE A;  5T8I A;  2G45 B;  2KMC A;  1M94 A;  2WNM A;  3UI3 A;  5FKA C;  1GAQ B;  2LGD A;  2M56 B;  3OG5 A;  5E6J A;  3QX1 A;  1U4A A;  1XLO A;  3IXS A;  3BWU D;  2KVR A;  2BYT A;  1F9J A;  5D7G A;  2CS4 A;  2WXK A;  2JF5 A;  5DPS A;  3I3T B;  1OEY A;  1WGY A;  4MM3 B;  3OJ3 A;  3CWI A;  2D3G A;  3NG0 A;  2YEP F;  4GDK A;  3V05 A;  2K8C A;  2M17 A;  2EKE C;  2MLB A;  4US9 A;  4FHJ A;  2BGF A;  2LGI A;  2DYB A;  1XT9 B;  2BWE S;  2KHW B;  1MVK A;  1LGR A;  3SD5 A;  3AMZ A;  1JRO A;  1UD7 A;  4K7U A;  4JWU C;  2WXG A;  2LGX A;  3VH3 B;  1FNU A;  4R3D A;  2G3Q B;  2J0J A;  1OQQ A;  2A4Z A;  4XX5 A;  4URK A;  2FNJ B;  4GGQ A;  4HPP A;  1WRD B;  1ZOY B;  3Q8A A;  2WXF A;  3DVN V;  4C7Y A;  2YEP B;  4DHZ E;  3NZS A;  4KGR A;  3DHH C;  4JQW C;  4YL8 A;  1C1Y B;  3KWL A;  4WIP A;  2KZR A;  1NYR A;  2NCN A;  1YMH E;  1B9R A;  2I1K A;  2O2V A;  2J4X A;  3Q14 C;  2L8J A;  2REX A;  2BF8 B;  2G9H D;  4WJQ A;  3ZKJ C;  4F1S A;  1V9J A;  4HLE A;  4M8M A;  5FK9 C;  4W9L A;  4P1C C;  1WE7 A;  2LAS A;  3ZYY X;  1N60 A;  4LNO A;  3DDC B;  3M63 B;  2LHE A;  4RM9 A;  2H89 B;  4NQL B;  3X23 A;  2KWD A;  3LXF A;  1WM3 A;  2BYE A;  3DVG Y;  2AWT A;  2W55 A;  4MT5 A;  3Q2A C;  3NUH B;  3QCA A;  3RUI B;  2L0F A;  3ZNZ B;  2WQY B;  1MI0 A;  2M0X A;  3AUL A;  4ARI A;  3A33 B;  2QSD A;  3TCA A;  1VDV A;  3QHT A;  2JT4 B;  2Q5W D;  2WYQ A;  1GOZ A;  5IA7 A;  1E10 A;  2NS5 A;  4HEA 1;  2LRU A;  4MJS B;  1QLB B;  2QMT A;  2W3S A;  3AE4 B;  3AV8 A;  2GI9 A;  1OFF A;  4ZRP A;  3VTW A;  1VR9 A;  3SFE B;  3V6C B;  1QZE A;  4ICU A;  3N30 A;  1VD2 A;  4KSL C;  1WE6 A;  3BK2 A;  2EEL A;  2KQ7 A;  2WXI A;  3DVG X;  2LRW A;  3O13 A;  2K25 A;  2NTT A;  1KM7 A;  2A5U A;  2GLS A;  5DPW A;  3AED B;  3P4P B;  2KKC A;  4DXG A;  2BW2 A;  1ESF A;  3BVG A;  1FXT B;  4AUQ C;  3BVM A;  3DWM A;  1TJE A;  1FNW A;  1EU4 A;  2WWZ A;  4G0N B;  2HD5 B;  1GUA B;  4NQK E;  4XGA B;  1P0R A;  3ZDM C;  5EDS A;  1QQR A;  3VVW B;  4BOZ B;  5AZG A;  2IY1 B;  1TS5 A;  2WXP A;  3MC8 A;  1YOV B;  5L95 C;  3DHG C;  3VRB B;  1JRP A;  1ISN A;  2V4L A;  2HDE A;  4AP4 C;  5MPO A;  1L6U A;  3PRM B;  4GU2 A;  2KC1 A;  5LLI A;  2XK5 B;  4I6P A;  4TMA B;  4ARC A;  2MJE A;  1E6E B;  1FIQ A;  3UF8 A;  1WI0 A;  1RLF A;  1V80 A;  2VH1 A;  1ZGU B;  2R2O A;  3W1Y A;  5FR3 A;  4BKS D;  4FJY A;  1PGX A;  1I4H A;  3X0W A;  4BAX A;  4Q2J A;  1TT5 B;  1TKY A;  2LXA A;  3IHP C;  2WXJ A;  2FUH B;  3URY A;  4AJY B;  5EE0 A;  3V3X A;  2KDF B;  5IOI A;  3T9L A;  2D2Q A;  1E7V A;  3M62 B;  3OWE B;  4DWF A;  4L2Y A;  1YQB A;  3L4P A;  3RI7 C;  2HTH A;  1WGR A;  4OVV A;  1I35 A;  2QDF A;  3NJT A;  4EZJ A;  2CHW A;  1V2Y A;  2PLP A;  3U8Z A;  5LNK 1;  2QIE B;  2ZPY A;  3B1L X;  1EWY C;  1UWX A;  3PS6 A;  1SE2 A;  2BPS A;  2K6D B;  5HFY A;  1GB4 A;  4TKN A;  3ZTD A;  2KLC A;  5BO4 B;  4NPN A;  1R4M B;  1J7B A;  3HRD D;  2RGF A;  1RRB A;  3SFD B;  2LGS A;  2K6Q A;  3DBL I;  5CHV C;  3VUY A;  4BKT A;  3QIJ A;  3JW0 X;  1WX9 A;  1E5W A;  1XCQ L;  1TYG B;  4EZK A;  2L76 A;  1F52 A;  4I6L B;  4FHK A;  3T3O A;  2BVC A;  5I4D A;  4IW0 A;  5BMI A;  3WA0 A;  3Q3J A;  1FEH A;  3GB1 A;  3O65 B;  2CJN A;  4AS1 A;  2BYV E;  2K39 A;  1PGA A;  1YN5 A;  2V4I B;  3VRA B;  1JRU A;  4C56 C;  2KK8 A;  3W1S C;  2IND C;  4F8C B;  3MJW A;  3QK0 A;  2NR2 A;  4W9I A;  2K0P A;  3JYU A;  2WDQ B;  2J0M A;  2JUO A;  2Z8L A;  1I4X A;  4ZYN A;  1C78 A;  5BMG A;  1L0X B;  3CST A;  2OJR A;  3DCG A;  3W5U B;  3TIX A;  3U7Z A;  1V6E A;  2INP E;  2QEJ C;  1YN3 A;  1WWT A;  2JRI B;  4D2K A;  3V62 A;  4NZL B;  4A9A A;  5C23 A;  1XCT L;  3WIM A;  2B76 B;  4LTU A;  3TBL D;  1JWS D;  1FXA A;  2KO3 A;  3H7P A;  1WR6 E;  3AEG B;  2ACZ B;  3U52 E;  3B9J A;  2MP2 B;  2L00 B;  1MG4 A;  1PQS A;  3RNC C;  4M02 A;  4JWS C;  4ANU A;  5JXV A;  3PRZ A;  4EE2 A;  1WMH A;  2BBC A;  1TGZ B;  4CQN A;  3EA6 A; 
#chains in the Genus database with same CATH homology
 1MG4 A;  5IO9 A;  2DNF A;  1MJD A;  5IOI A;  2BQQ A;  1MFW A;  5IN7 A;  5IP4 D;  5IKC M;  1UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...