5IN7A

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
KAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5in7A00
5IO9A 1MG4A 1MFWA 5IP4D 2BQQA 2DNFA 1MJDA 5IOIA 1UF0A 5IN7A 5IKCM
chains in the Genus database with same CATH superfamily
1MFWA 2B76B 4DWFA 3DHGC 4KGRA 3X0WA 5BMIA 3CWIA 1WF9A 1V49A 5KHOA 1L6UA 2BW2A 2CU1A 3RYTA 4NZLB 3CF6E 1LQBA 3MHZA 1TGZB 2BS4B 1RLFA 3WALA 1WZ3A 4GDKA 2N9XA 3QX1A 4C7ZA 3GS2A 4US9A 2JYTA 4K7WA 2WU2B 3HRDD 3U7ZA 1C9FA 3DDCB 1NI2A 4C80A 4M0WA 3SHQA 1V80A 1ACCA 1BT0A 1L6VA 2K1FA 2WXMA 3HM3A 4EUTA 1KLVA 1FNWA 2LVQA 1C77A 3PPAA 4N9F4 4GLSC 1XLOA 4JIOU 5D3DA 1TYGB 4MDKE 4US8A 4NJ7A 3A4RA 3VDZA 3VH4B 2MBOA 1YMHE 3VVWB 1SE3A 1VJKA 1YIWA 4BKSA 2ZJDA 3MC9A 1D4BA 1CJEA 3CSTA 4MGYE 2N9EB 3BINA 4MJSA 1IYFA 1I4RA 2ZNVB 3IFWB 3W1SC 2JYEA 2L0FA 1JW9D 3ALBA 2K0PA 4RFBA 1MJDA 5JZEB 2PLPA 2KFJA 3KYCD 4O1NA 4IOIE 2BB5A 2V4LA 1JWSD 4OZBA 2RPVA 3TMPB 1VCBA 1EUVB 1P3QU 2KX3A 4WH4A 2J53A 1LGRA 4EEWA 4NY0A 2W3RA 2WYQA 5HKHA 4YWGG 3A33B 3HHMA 1WH3A 1WR6E 2HD5B 3A9KB 3VUXA 2IPKD 1DGJA 1KTKA 3H7PA 1UELA 4YTPB 3IAS1 1CQVA 5CHFA 1IBXA 2WX1A 4A6QA 2MBQA 3N9YC 2EMTA 3V62A 2QEJC 3JVZX 2M4NA 4W9IA 2JRIB 4RGTA 4TQ1A 4ARIA 4XC2A 2WDRB 4FLHA 2IYDB 3W1YA 4TSSA 3P63A 2ZVNA 1R4NB 1ZKHA 1JQ4A 4AJYB 3PO0A 2MCNB 4G11A 3H1UA 3QHTA 4G3XB 2VZKB 1WJUA 1VRAB 4FULA 1SE4A 1YX6B 2W82A 1F9JA 2RDBC 2PIAA 4WJPA 4WWNA 1L0VB 3ZGZA 2KWUB 3TUOA 3RPFC 2M56B 4DXGA 5C1ZA 3H7SA 4RF1A 2DX5B 1IP9A 1SE9A 1R7SA 4WAFA 3AEBB 4E74A 3GB1A 2KN4A 1YNTE 5AZFA 2Z0EB 4K1RB 4S0RA 2PE9A 1N60A 4FJZA 2JPHA 4OW0A 3VXWA 3Q8EA 4KVGB 1WX7A 1EWCA 1WE6A 2PJHA 1SJED 2N9KA 2KDIA 2W54A 1V1OA 3IAM1 2FUG1 4C7YA 3ABVB 1WM2A 2N7JA 3KLSX 2MJ3A 4A8XC 5CHWA 2L05A 1PFDA 2M0AA 3AULA 4YSXB 5AZHA 1K52A 2KVZA 1V86A 3AXCA 4X57B 3UQBA 4EE2A 3H7PB 4W9DA 3NZ3A 3VUWA 2WXQA 1J19A 1UZXB 4W9GA 1IBXB 4DHJD 5EDSA 4KGTA 3VR8B 2JU6X 3NJTA 2CHZA 2W3SA 2HE7A 2LJ5A 2LZ6A 2FBWB 3KUZA 4GOCA 4ZYNA 2QC8A 4YTNB 3EFCA 3IHPC 1EWYC 4NJCA 3GZNI 1JWBD 3RCZA 4KX6B 1QOAA 4L23A 5DPWA 2KACA 1R4MI 2JXXA 2G9HD 2JUOA 3DHIC 3A1QA 5G5GA 3PV1A 2W9NA 1PYWD 2WHIA 1SBBB 3FAHA 1EU4A 1YD8U 3UQAA 2NMQA 2BWFA 3IBEA 1Y8RC 4I6NB 1XF5L 2PEAA 1OEYA 2XBBC 2L3ZA 5G5HA 1WWTA 3P2BA 2KX0A 1I7HA 3H9DA 1P9DU 1I42A 1IPGA 4GMVA 3M62B 2WWZA 1MHHE 2G4DB 2FIFA 2BVCA 2KDFB 2HTHA 2O6VD 3ZJVA 4PK1A 2KMMA 1RFAA 2NVUI 3Q3MC 4YSYB 5LXHA 5DPSA 4CYEA 2VZKD 4AUQC 3GE8C 2KAJA 1HQRD 4TV3A 1J7AA 2AL6A 2WXPA 1WJNA 2JQRB 1HEZE 2LXAA 5J2RA 4II2B 2DBYA 4A3OA 1TS2A 4IUMB 1KH0A 2ONQA 2XN9C 3MJ5A 3SU8X 1NYQA 2G4SA 2KQ7A 3OJ4B 1E8XA 4GU2A 1N6ZA 5AUKA 2HJ8A 4B0MA 3URYA 4OZCA 2OJRA 1YN5A 3NHEB 4F7ZA 2KHWB 4CQNA 2KC1A 2L0TA 1TTNA 3AE2B 2LEKA 4GDLB 2K6DB 1D5ZC 3MHSD 2QILA 2M8SA 4WJOA 3N1YC 3NG0A 1ZXIA 1P7FA 2JZPA 1FXTB 2H89B 2YEPB 2M17A 2QDFA 1WXVA 3HM6X 2KTRB 3NRZA 1X1MA 1WYWB 2Y3AA 3AEEB 4B0EA 3NZUA 2FCSA 3L10B 1M4VA 3W9CB 2D5GA 3AE9B 1STEA 1ZP0B 2QCZA 4ASWC 2HTME 2ZVOA 2J0JA 2A4ZA 1R4NI 5G2NA 3A1QB 1OFFA 3DWGC 3KVFB 5D6JB 1WGYA 1N63A 2WXOA 2SEBD 1WR1A 2GBNA 1PDXA 2LD9A 4HCNB 1TT5B 1TBEA 3ZKJC 5IKCM 1JWAD 3B08A 1E7UA 3UINB 4C4VA 3RNGC 4LNIA 4C56C 1T5XD 3CIRB 2WDQB 2KZRA 3K9PB 2RSUA 4JWSC 3P4SB 3UI3A 1UWXA 1WXSA 1LXDA 3W5UB 4DQOC 3K9OB 1F52A 3VTWA 4WJQA 4XDCA 3SFDB 1YJJA 2N7EA 4PS7A 5HFYA 5E6PA 4ZOHC 1WX8A 2INDC 2ZW1A 4H2AA 2BYEA 2KO3A 4ANWA 2RD0A 2MA9B 4J6IA 2J4XA 1VZ8A 3MP9A 4N59A 5TR5A 1D6EC 1WI0A 3VFKA 1C79A 4KSLC 4HEA1 4TKNA 1XCQL 1YN4A 3S2AA 3BYTB 3L0WB 1V2YA 4WWPA 1V9JA 1AW7A 3AE7B 4IM0A 1QF6A 1ZW7A 3EHVA 1F0ZA 2OHFA 4TQ0A 4ICVA 4GSWA 2BGFA 1PGXA 1V1PB 2D3CA 3BIID 1F77A 3ZNZB 4J3OD 2GOWA 4IWOA 2J0MA 1SIFA 1KRHA 1UGJA 2K8CA 2ZEQA 3NUHB 1TS4A 3PTFC 1E0ZA 2IO0B 1JWUD 2LGYA 2LRWA 4ZHPA 3VHTC 3U2SC 1XLPA 1GB4A 2PVOD 3NOBA 3T3OA 3RZFA 1U4AA 1V81A 3A9KA 4FJVB 5GXGB 4NAWA 3R2TA 4AWJA 2KQSA 1HXYD 3ZNID 1M94A 2WDVB 3PZ7A 4IW0A 1L4DB 1UNSA 2CJNA 4R3DA 4YXDB 3DQVA 3AE4B 2IO2B 1V5OA 2DLBA 3JSVA 4KGSA 2MJDA 4C4VB 5L95C 5KHQA 2G45B 3N30A 5IOIA 3TEXA 2WXLA 4HJKA 2WXGA 3APFA 1QZEA 3GZNB 1ZPSA 4RGMA 3RULA 3Q3NC 1R4MB 2O6VA 5D7GA 2YEPF 1C76A 3L13A 3AE8B 3KW5B 3DVGX 4HCPB 4XX5A 2IY0B 2K8BA 1L2NA 1RWSA 2K3UA 3N32A 4UDUC 4HKQA 3IT4B 4K3BA 2B3AA 5LLIA 3IXSA 3RNCC 2O2VB 4W9EA 3BYYB 1H8CA 2QIEB 3B0AA 2N1WA 2KWVB 2D3BA 3KWLA 3C19A 1C3TA 2Y5CA 3HK0A 1I4GA 2WXIA 3L54A 4HPMB 4MSQB 5CX3A 1E6EB 2BYFA 2OJWA 2BKFA 3B2GA 2ZZPB 4N6EB 5J17A 4W9HA 2INNE 4OVVA 2WX0A 3MC8A 1L7YA 3KUDB 3NVZA 4BOSC 4DHJB 2BS2B 2JT4B 3ZRCA 4K81A 1FNUA 3P1MA 2N0SB 1PUTA 2JSVX 1P0RA 1FRRA 5J18A 1WJ4A 2WS3B 1WXQA 4XGAB 4XYCA 5TSSA 2WQYB 5JHBA 2NBWB 4GN1A 2X8XX 5C23A 1S1QB 1ZUD2 3A4SC 4HROA 5JH5C 1UD7A 2PVGC 5EE3A 2KKCA 1WE7A 4FXCA 4NAWB 2DWQA 2BF8B 5LNK1 4BBNF 2G3QB 3KYDD 1I4XA 1SIJA 4L2YA 3I9V1 4LJPB 1S3SG 3L17A 2C9WB 1QKZA 3L16A 1GAQB 3AEAB 3R66C 4LDTB 3JSVB 1F2RI 2E3TA 3R7QA 3DBHI 4IG7B 1RFKA 3N3KB 2DZJA 3AE6B 4WAAA 3ZDMC 1TKYA 2Q5WD 2O6VB 5HG2A 1ESFA 1G6JA 2IGDA 4KZ0A 1T0QC 3ZJUA 1J8CA 1GB1A 2D07B 3BVZA 4RM9A 2X38A 2D10A 3EGRA 1KLGD 1D5XC 2LXCA 3PS6A 3ZVVA 3M3JA 1NBFC 3AH7A 3BY4B 1IUEA 2D11A 1LO5D 2FCMA 1K8RB 1WGKA 1JRPA 2ZNVC 1C4AA 4B6WA 1WX9A 2AX5A 3DPDA 1WM3A 3VUYA 1T6BX 2KVRA 1Z5SB 3ZXRA 1UGMA 2H88B 4JX1C 3HIZA 4MSMB 3FKYA 5BMHA 1V6EA 1NEKB 2XEWA 2C7HA 3B2FA 1GOZA 3ZXVA 2K22A 4ZHOA 5D3IB 1FO4A 4FHJA 2Y5BB 3TSSA 1K53A 2KJHB 5BO4B 4ZDVA 4JE3B 2L7RA 2WNMA 5CTRC 2G1EA 2J0KA 1CK1A 4PT5A 1E10A 1QQRA 1YX5B 5FR6A 4PYZA 2PE6B 3WCQA 1NENB 1IGDA 3NVVA 2VH2A 1OEYJ 3TEYA 1N62A 2YVCA 3Q8FA 3VRAB 1EM7A 2NPTB 2DHZA 4NNJB 2CHWA 4ZRPA 3DOWA 3B1LX 3MFGA 3PT2B 4KIKB 5AUIA 3U4EG 3N1XC 5LXIB 3TIXA 1TKGA 5JHAA 1OQYA 2RMMA 3Q8BA 2LUMA 4NQLB 3PREA 1KOTA 1UBQA 1XQQA 1JWMD 2K9XA 2WLBA 2MW5A 3ZW3A 1WSPA 4GDLA 1H4RA 1KM7A 3IG3A 3JYUA 4HJGE 3LB8C 3QWZB 3Q8AA 2MLBA 3QARA 3ENEA 2LHEA 4FJYA 2MRPA 4HVBA 3SR6A 3Q2AC 2WXFA 1QOFA 4RM8A 2KTRA 3ZIMA 4P6VF 4LK0M 2DNFA 3AE3B 1VLBA 4Q2JA 3GP7A 2AQ3B 2OEDA 2CHXA 3OAWA 4M01A 4N58A 2UYZB 2EKIA 4AQ7A 3DVGY 4ICUA 3TCAA 1WZ0A 2K8HA 2Z8LA 1WJ6A 4E71A 2QHOA 4LTUA 1E7VA 1E8WA 2EELA 2J52A 4DDID 1KJTA 4PS3A 2KWDA 1VZ6A 1VDVA 1YJ1A 3TEWA 2J7QB 3WAMA 3VAWA 2FIDA 3EC8A 4HPLB 1WY8A 2NBVB 4LDTD 3W5VB 1T3QA 2NTSA 2L76A 4A55A 3W2DA 2KNBA 2GMIC 3DBRB 3ECIA 2KMCA 3KQ4A 1WGHA 1PGAA 3DWMA 3RNBC 1SF0A 4HK2A 2KT7A 2SAKA 3AMZA 4F1SA 2DENB 2MBEA 4HDOA 3PLUA 2ZCBA 2D3GA 1J0GA 3E9SA 3PZ8A 2KTFA 4NJ6A 4W9CA 3RI7C 2WU5B 2DYMA 4WIPA 3QK0A 2CU3A 3SD5A 3U8ZA 1WXAA 1QILA 1E8YA 4HXDA 1K51A 2I2YA 2FCNA 1TY2A 4IM3A 3FILB 2FAZA 3AU4A 2KJ6A 2LJIA 3ZYYX 3L4PA 1D5MC 3U7DA 3PSEB 2KDBA 1N5XA 3DVNU 1AWDA 2ZCCA 1C78A 2RR9A 1XD3B 2GBMA 1PGBA 2YLMA 4B95A 2NBUA 1V1PA 1BXTA 4DBGA 1E7PB 3BK2A 1VR9A 3ZDTA 3NS8A 3PGEA 3T3NA 2C7NB 2V3SA 1KF6B 4BKSD 1K50A 3V61A 5HHDG 2K25A 4FBJB 3PRPB 2MHJA 4EZLA 3EA6A 1LM8B 3BVMA 1YQ4B 2R2QA 4BAXA 3RZWC 1FXAA 2RDHA 2GBKA 4MM3B 3DVNV 4K7SA 3ZRFA 2WXHA 3JW0X 2LGDA 4ANXA 2JRHA 1KFYB 4KSKC 2JXTA 1FMAD 2CS4A 4P1CC 2ZPYA 3N20C 2L32A 1MG8A 1ZOYB 4IC7B 4A20A 2V0GA 2MJEA 3HVZA 3TJPA 3VQIA 3APDA 3MJWA 3DBHB 4URKA 3C0RB 4M8MA 2KANA 4GB9A 3BK1A 3Q69A 1FCCC 4DDGD 2JWUA 4MGKE 1NVID 5E6OA 2BB6A 3RNFC 1FRDA 4MGIE 1TJEA 1ZDVA 3I57A 1NDDA 1C1YB 4W9JA 5DCNA 1IGCA 3HVDA 2V1YA 2BS3B 2O2VA 2BPSA 1UF0A 2WDTB 1HA5A 1TZOA 1FXIA 1EF1A 3PRMB 3TEZA 3Q14C 3WANA 2HJ1A 1ISNA 2IDYA 3AE5B 3NY5A 1GNUA 3NVWA 2C5LC 2JF5A 2BKRB 3DCGA 2KOXA 4LNKA 3P4PB 3BVGA 2L00B 2MQJA 1MHXA 1N61A 2HDEA 4TMAB 2JVCA 3ZO5B 2KJRA 1NYRA 3L08A 3M95A 5IAAC 1FNVA 1XLQA 4HWIB 4LCDE 1T0SC 3V6EB 1UBIA 3LDZE 1MG4A 1OGWA 2WXJA 5FKAC 2A5UA 3P4RB 2ACZB 4RCOA 3EUB2 4IWPA 3O65B 2NCNA 2JZ3B 2GLSA 5HI1A 1JMLA 1Q5WB 2J42A 4USAA 4XDDA 3KWVA 1F2RC 2KC2A 3APCA 4DK5A 4P1BC 2NS5A 1T0RC 3Q8CA 4MEMA 2MEKA 4BFRA 1E9MA 3V05A 4OHJA 1HTQA 1Y56A 3A9JB 3MC0B 3TL5A 4DXAB 2INCC 3Q3FA 2PW9A 4GXBA 3VTVA 1Z2MA 3R2IA 4ZYSA 1SE2A 5JXVA 2EKEC 3MTNB 4AS1A 1QLBB 2DYOA 1Q1OA 3VTUA 1WGGA 2R2OA 1WXMA 2MSED 3T8MA 3WA0A 3BZDB 3DBRI 2KFKB 5T8IA 4GGQA 3FC4A 3ML9A 2AQ1B 1FIQA 1OQRA 4BBNC 4ZRIA 3QA8A 2LI5A 1UH6A 4LLGM 4WWOA 5C3JB 3OJ3A 2AYOB 2N1VA 4YSZB 1I4PA 2M0XA 2XNAC 2L52A 3RMKC 4YL8A 1C4CA 3TBLD 2N9LA 1Q0WB 2KD0A 4RH6A 3PRZA 3U52E 4RNAA 2KLGA 4LNNA 1SEBD 1ZE3D 2MP2B 4JLCA 3ML8A 4MH8A 5BYRA 2V4IB 1XO3A 1I35A 1A5RA 1WRDB 2K39A 2L83A 4EZJA 3Q3JA 2LFIA 4ZRJA 4M02A 3DBLB 4WJNA 3RNEC 1HE8A 2KQ4X 1Q10A 4KDLB 4A3PA 2CKHB 3KUCB 5EE9A 1SSNA 2DAJA 2I1KA 4M00A 4ITKA 4YTMB 2UU7A 3EFUA 5G55A 1I4HA 2D2QA 1T0YA 2M1MA 3ZQ4A 2KDEB 4ANVA 3I5JC 4MGZE 3OG5A 2NPTA 2MWSB 4FADA 4RGNA 4LNFA 1L0YB 4TUUA 4KIKA 2W55A 1FM0D 1FD6A 3AM9A 4OZAA 3QC8B 1C4PA 1BUIC 4DHZB 2XK5B 5D94A 2LGIA 1ZGUB 4XZ4A 5DPRA 3VRBB 3VR9B 1QOBA 1FCLA 3QCAA 4DHZE 1WMHB 4JGHB 3RD2A 3QQ8B 4ARCA 1DOYA 1L4ZB 2KN5A 3OLMD 2MBHA 4AJWA 2RDGA 3ZNHB 1P7EA 2Y5PA 5H92C 3UIPB 2QMTA 1HZ5A 2WXNA 1E90A 5BYQA 4L1BA 2WP9B 2EMSA 2LGSA 3V60A 3C8YA 2QJLA 2IO1B 2INPE 1WRIA 1BMLC 3SDLC 4REZA 4BKGA 2KYWA 4EFOA 1GUAB 1UUPA 3E56A 1FFVA 5FK9C 2V9HA 4EOYA 1AN8A 1J7BA 3AECB 4G0NB 3UGBB 4GDKB 2ON8A 1JROA 1LFDA 2LVPA 4P16A 4EZKA 1I4QA 2WXRA 3I63C 1AYFA 3AEDB 2GB1A 2FNJB 3AU5A 4M0WB 3ZLZA 4I6PA 2DZKA 2UWQA 5FR3A 1JCKB 2R61A 2BBCA 5D2MB 2AWTA 3SEBA 4W9FA 1ZDXA 4ZRKA 4HDQA 1RRBA 4AOFA 1XLNA 2LRUA 2LUEA 4IKGA 4BKTA 2C60A 4AP4C 3FILA 3AB5A 3WAOA 5GMVA 4FN2A 5CHVC 4ANUA 2Z0DB 3U30A 4C00A 1DYQA 2NTTA 4MJSB 3GE3C 4MT5A 2BQQA 2PKOA 1ROEA 4WQOB 1YN3A 1ET9A 1MVKA 4JPSA 1WGDA 4NQKE 3H8HA 2KWCA 4ZRQA 4A9AA 1YJIA 1EU3A 2FCQA 3HUIA 2ZW0A 1XXGA 2NR2A 4KKIA 2REXA 4XE0A 2FUHB 1FFUA 3SFEB 5DPTA 5E6NA 3LJ3A 1AARA 1VD2A 2K6QA 3OWEB 2WXKA 3B9JA 1SXTA 1CMXB 4WURA 2BTEA 1ZXHA 4LNOA 4MM3A 4RGOS 1WYGA 3V3XA 2KXJA 1NI3A 4OVZA 4YT0B 4S17A 1FEHA 2ICIA 1DOIA 1TKEA 1SB3C 3ZTCA 3NZSA 1XEEA 4XWWA 2DYBA 2GI9A 3D32A 4PYUA 3RUIB 1GPXA 2RGFA 2JX5A 4I6LB 4P7IA 2KLCA 3PHXB 3DHHC 2IY1B 3RT3B 3RFZB 2CR5A 1WFYA 2WGSA 3R3MA 5AZGA 2N9PC 4FHKA 3DBLI 5H8YE 2FE8A 2VH1A 4IWQA 4NAMA 3PVLA 1HZ6A 2KK8A 2LWPA 4IDIA 2V3PA 2LMCA 4KDIC 1EO6A 4BVUC 5C2TB 3Q3OC 1B9RA 3AE1B 3BWUD 3I3TB 2AQ2B 4OVUA 5L83A 4KKJA 4MELA 2IZVB 1XCTL 5AEKB 4RMAA 1SGHA 3DBSA 2BT6A 4CHKA 3IT6B 4EKUA 4MACA 4DXFA 1YOVB 4WWMA 2PPHA 3QJZA 3T9LA 4E3CA 2AEHA 1EF5A 2IGGA 2AL3A 2Z59B 1SJHD 2CJOA 4BZAA 2LGXA 1B1ZA 2GBJA 2JY6A 4W9KA 5IN7A 3J9CA 2DAFA 1TS3A 2ZPNA 3AI5A 2C7MB 4HPPA 3IVFA 4IM2A 5IP4D 2VRRB 1ET6A 1E5WA 4PS8A 2D3AA 1A70A 3R7RA 2IBIB 2M19A 4HRSA 4ACFA 3CSFA 2I38A 3PLVA 3A9JA 4JWUC 4FA6A 1TIFA 4II3B 4LJOB 2LHDA 1GC7A 2MBBB 3ZTDA 2KMAA 2TSSA 4RF0A 4MH0E 1MPEA 3AN1A 3W1SA 1QT9A 3UF8A 1RM6C 3AEGB 2LVOA 3Q6BA 1RAXA 2E6XA 3NS1A 2L1AA 1GG3A 1WGRA 3PHWB 2KFKA 3UIOB 4QAYA 2IJ0A 3GOEA 4CO7A 1V97A 3PZDA 3LXFA 4K3CA 4KV2A 1L5PA 3P4QB 1N5WA 1TZ1A 3EECA 3P42A 1VZ7A 1TY0A 2MX2A 2V3NA 3VH3B 1UWMA 3AEFB 2K5PA 1TS5A 3RN9C 2GRIA 5IO9A 1D3ZA 2IO3B 5EE0A 1GC6A 2MP2A 3H6NA 4W9LA 4JL9A 3NVYA 1V5TA 4F8CB 3R8BA 1FPYA 1ENFA 5MPOA 4A90A 1XT9B 2N4FA 3CMMB 1GJZA 4XWTA 4D2KA 2BWES 5E6JA 1CZPA 2PMVA 4K7UA 3RNAC 2PTLA 3KH0A 1E8ZA 2LASA 5IA7A 2IGHA 4B9KA 3AV8A 1L0XB 3O13A 4HLEA 2OOBB 2JZZA 1DOXA 1KLUD 1HTOA 1YQ3B 2DZIA 2L8JA 4GIVA 1RYJA 1PQSA 3ZUNA 1OTRB 4JQWC 1J7CA 5EE1A 5BMGA 1P1AA 2RPQA 3ETRA 3QIJA 2GBRA 4HKZE 2DZMA 1JALA 1JRUA 1F1HA 2N7DA 1WIAA 4KZCA 4NPNA 2MH7A 2XK5A 3LYYA 2BYVE 3QAQA 1QOGA 2QSDA 3WAPA 2I1JA 4BOZB 2JWZA 4WQMA 1WMHA 1OQQA 5I4DA 3ZNGC 3N1ZC 3V6CB 1MI0A 2BYTA 1V8CA 3X23A 4G50A 2KDMA 2ASQA 5BYSA 4M8NA 3ONSA 1P98A 3WIMA 3ZJTA 1YQBA 3M63B
chains in the Genus database with same CATH topology
5IO9A 1MG4A 1MFWA 5IP4D 2BQQA 2DNFA 1MJDA 5IOIA 1UF0A 5IN7A 5IKCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  1MG4 A;  1MFW A;  5IP4 D;  2BQQ A;  2DNF A;  1MJD A;  5IOI A;  1UF0 A;  5IN7 A;  5IKC M; 
#chains in the Genus database with same CATH topology
 1MFW A;  2B76 B;  4DWF A;  3DHG C;  4KGR A;  3X0W A;  5BMI A;  3CWI A;  1WF9 A;  1V49 A;  5KHO A;  1L6U A;  2BW2 A;  2CU1 A;  3RYT A;  4NZL B;  3CF6 E;  1LQB A;  3MHZ A;  1TGZ B;  2BS4 B;  1RLF A;  3WAL A;  1WZ3 A;  4GDK A;  2N9X A;  3QX1 A;  4C7Z A;  3GS2 A;  4US9 A;  2JYT A;  4K7W A;  2WU2 B;  3HRD D;  3U7Z A;  1C9F A;  3DDC B;  1NI2 A;  4C80 A;  4M0W A;  3SHQ A;  1V80 A;  1ACC A;  1BT0 A;  1L6V A;  2K1F A;  2WXM A;  3HM3 A;  4EUT A;  1KLV A;  1FNW A;  2LVQ A;  1C77 A;  3PPA A;  4N9F 4;  4GLS C;  1XLO A;  4JIO U;  5D3D A;  1TYG B;  4MDK E;  4US8 A;  4NJ7 A;  3A4R A;  3VDZ A;  3VH4 B;  2MBO A;  1YMH E;  3VVW B;  1SE3 A;  1VJK A;  1YIW A;  4BKS A;  2ZJD A;  3MC9 A;  1D4B A;  1CJE A;  3CST A;  4MGY E;  2N9E B;  3BIN A;  4MJS A;  1IYF A;  1I4R A;  2ZNV B;  3IFW B;  3W1S C;  2JYE A;  2L0F A;  1JW9 D;  3ALB A;  2K0P A;  4RFB A;  1MJD A;  5JZE B;  2PLP A;  2KFJ A;  3KYC D;  4O1N A;  4IOI E;  2BB5 A;  2V4L A;  1JWS D;  4OZB A;  2RPV A;  3TMP B;  1VCB A;  1EUV B;  1P3Q U;  2KX3 A;  4WH4 A;  2J53 A;  1LGR A;  4EEW A;  4NY0 A;  2W3R A;  2WYQ A;  5HKH A;  4YWG G;  3A33 B;  3HHM A;  1WH3 A;  1WR6 E;  2HD5 B;  3A9K B;  3VUX A;  2IPK D;  1DGJ A;  1KTK A;  3H7P A;  1UEL A;  4YTP B;  3IAS 1;  1CQV A;  5CHF A;  1IBX A;  2WX1 A;  4A6Q A;  2MBQ A;  3N9Y C;  2EMT A;  3V62 A;  2QEJ C;  3JVZ X;  2M4N A;  4W9I A;  2JRI B;  4RGT A;  4TQ1 A;  4ARI A;  4XC2 A;  2WDR B;  4FLH A;  2IYD B;  3W1Y A;  4TSS A;  3P63 A;  2ZVN A;  1R4N B;  1ZKH A;  1JQ4 A;  4AJY B;  3PO0 A;  2MCN B;  4G11 A;  3H1U A;  3QHT A;  4G3X B;  2VZK B;  1WJU A;  1VRA B;  4FUL A;  1SE4 A;  1YX6 B;  2W82 A;  1F9J A;  2RDB C;  2PIA A;  4WJP A;  4WWN A;  1L0V B;  3ZGZ A;  2KWU B;  3TUO A;  3RPF C;  2M56 B;  4DXG A;  5C1Z A;  3H7S A;  4RF1 A;  2DX5 B;  1IP9 A;  1SE9 A;  1R7S A;  4WAF A;  3AEB B;  4E74 A;  3GB1 A;  2KN4 A;  1YNT E;  5AZF A;  2Z0E B;  4K1R B;  4S0R A;  2PE9 A;  1N60 A;  4FJZ A;  2JPH A;  4OW0 A;  3VXW A;  3Q8E A;  4KVG B;  1WX7 A;  1EWC A;  1WE6 A;  2PJH A;  1SJE D;  2N9K A;  2KDI A;  2W54 A;  1V1O A;  3IAM 1;  2FUG 1;  4C7Y A;  3ABV B;  1WM2 A;  2N7J A;  3KLS X;  2MJ3 A;  4A8X C;  5CHW A;  2L05 A;  1PFD A;  2M0A A;  3AUL A;  4YSX B;  5AZH A;  1K52 A;  2KVZ A;  1V86 A;  3AXC A;  4X57 B;  3UQB A;  4EE2 A;  3H7P B;  4W9D A;  3NZ3 A;  3VUW A;  2WXQ A;  1J19 A;  1UZX B;  4W9G A;  1IBX B;  4DHJ D;  5EDS A;  4KGT A;  3VR8 B;  2JU6 X;  3NJT A;  2CHZ A;  2W3S A;  2HE7 A;  2LJ5 A;  2LZ6 A;  2FBW B;  3KUZ A;  4GOC A;  4ZYN A;  2QC8 A;  4YTN B;  3EFC A;  3IHP C;  1EWY C;  4NJC A;  3GZN I;  1JWB D;  3RCZ A;  4KX6 B;  1QOA A;  4L23 A;  5DPW A;  2KAC A;  1R4M I;  2JXX A;  2G9H D;  2JUO A;  3DHI C;  3A1Q A;  5G5G A;  3PV1 A;  2W9N A;  1PYW D;  2WHI A;  1SBB B;  3FAH A;  1EU4 A;  1YD8 U;  3UQA A;  2NMQ A;  2BWF A;  3IBE A;  1Y8R C;  4I6N B;  1XF5 L;  2PEA A;  1OEY A;  2XBB C;  2L3Z A;  5G5H A;  1WWT A;  3P2B A;  2KX0 A;  1I7H A;  3H9D A;  1P9D U;  1I42 A;  1IPG A;  4GMV A;  3M62 B;  2WWZ A;  1MHH E;  2G4D B;  2FIF A;  2BVC A;  2KDF B;  2HTH A;  2O6V D;  3ZJV A;  4PK1 A;  2KMM A;  1RFA A;  2NVU I;  3Q3M C;  4YSY B;  5LXH A;  5DPS A;  4CYE A;  2VZK D;  4AUQ C;  3GE8 C;  2KAJ A;  1HQR D;  4TV3 A;  1J7A A;  2AL6 A;  2WXP A;  1WJN A;  2JQR B;  1HEZ E;  2LXA A;  5J2R A;  4II2 B;  2DBY A;  4A3O A;  1TS2 A;  4IUM B;  1KH0 A;  2ONQ A;  2XN9 C;  3MJ5 A;  3SU8 X;  1NYQ A;  2G4S A;  2KQ7 A;  3OJ4 B;  1E8X A;  4GU2 A;  1N6Z A;  5AUK A;  2HJ8 A;  4B0M A;  3URY A;  4OZC A;  2OJR A;  1YN5 A;  3NHE B;  4F7Z A;  2KHW B;  4CQN A;  2KC1 A;  2L0T A;  1TTN A;  3AE2 B;  2LEK A;  4GDL B;  2K6D B;  1D5Z C;  3MHS D;  2QIL A;  2M8S A;  4WJO A;  3N1Y C;  3NG0 A;  1ZXI A;  1P7F A;  2JZP A;  1FXT B;  2H89 B;  2YEP B;  2M17 A;  2QDF A;  1WXV A;  3HM6 X;  2KTR B;  3NRZ A;  1X1M A;  1WYW B;  2Y3A A;  3AEE B;  4B0E A;  3NZU A;  2FCS A;  3L10 B;  1M4V A;  3W9C B;  2D5G A;  3AE9 B;  1STE A;  1ZP0 B;  2QCZ A;  4ASW C;  2HTM E;  2ZVO A;  2J0J A;  2A4Z A;  1R4N I;  5G2N A;  3A1Q B;  1OFF A;  3DWG C;  3KVF B;  5D6J B;  1WGY A;  1N63 A;  2WXO A;  2SEB D;  1WR1 A;  2GBN A;  1PDX A;  2LD9 A;  4HCN B;  1TT5 B;  1TBE A;  3ZKJ C;  5IKC M;  1JWA D;  3B08 A;  1E7U A;  3UIN B;  4C4V A;  3RNG C;  4LNI A;  4C56 C;  1T5X D;  3CIR B;  2WDQ B;  2KZR A;  3K9P B;  2RSU A;  4JWS C;  3P4S B;  3UI3 A;  1UWX A;  1WXS A;  1LXD A;  3W5U B;  4DQO C;  3K9O B;  1F52 A;  3VTW A;  4WJQ A;  4XDC A;  3SFD B;  1YJJ A;  2N7E A;  4PS7 A;  5HFY A;  5E6P A;  4ZOH C;  1WX8 A;  2IND C;  2ZW1 A;  4H2A A;  2BYE A;  2KO3 A;  4ANW A;  2RD0 A;  2MA9 B;  4J6I A;  2J4X A;  1VZ8 A;  3MP9 A;  4N59 A;  5TR5 A;  1D6E C;  1WI0 A;  3VFK A;  1C79 A;  4KSL C;  4HEA 1;  4TKN A;  1XCQ L;  1YN4 A;  3S2A A;  3BYT B;  3L0W B;  1V2Y A;  4WWP A;  1V9J A;  1AW7 A;  3AE7 B;  4IM0 A;  1QF6 A;  1ZW7 A;  3EHV A;  1F0Z A;  2OHF A;  4TQ0 A;  4ICV A;  4GSW A;  2BGF A;  1PGX A;  1V1P B;  2D3C A;  3BII D;  1F77 A;  3ZNZ B;  4J3O D;  2GOW A;  4IWO A;  2J0M A;  1SIF A;  1KRH A;  1UGJ A;  2K8C A;  2ZEQ A;  3NUH B;  1TS4 A;  3PTF C;  1E0Z A;  2IO0 B;  1JWU D;  2LGY A;  2LRW A;  4ZHP A;  3VHT C;  3U2S C;  1XLP A;  1GB4 A;  2PVO D;  3NOB A;  3T3O A;  3RZF A;  1U4A A;  1V81 A;  3A9K A;  4FJV B;  5GXG B;  4NAW A;  3R2T A;  4AWJ A;  2KQS A;  1HXY D;  3ZNI D;  1M94 A;  2WDV B;  3PZ7 A;  4IW0 A;  1L4D B;  1UNS A;  2CJN A;  4R3D A;  4YXD B;  3DQV A;  3AE4 B;  2IO2 B;  1V5O A;  2DLB A;  3JSV A;  4KGS A;  2MJD A;  4C4V B;  5L95 C;  5KHQ A;  2G45 B;  3N30 A;  5IOI A;  3TEX A;  2WXL A;  4HJK A;  2WXG A;  3APF A;  1QZE A;  3GZN B;  1ZPS A;  4RGM A;  3RUL A;  3Q3N C;  1R4M B;  2O6V A;  5D7G A;  2YEP F;  1C76 A;  3L13 A;  3AE8 B;  3KW5 B;  3DVG X;  4HCP B;  4XX5 A;  2IY0 B;  2K8B A;  1L2N A;  1RWS A;  2K3U A;  3N32 A;  4UDU C;  4HKQ A;  3IT4 B;  4K3B A;  2B3A A;  5LLI A;  3IXS A;  3RNC C;  2O2V B;  4W9E A;  3BYY B;  1H8C A;  2QIE B;  3B0A A;  2N1W A;  2KWV B;  2D3B A;  3KWL A;  3C19 A;  1C3T A;  2Y5C A;  3HK0 A;  1I4G A;  2WXI A;  3L54 A;  4HPM B;  4MSQ B;  5CX3 A;  1E6E B;  2BYF A;  2OJW A;  2BKF A;  3B2G A;  2ZZP B;  4N6E B;  5J17 A;  4W9H A;  2INN E;  4OVV A;  2WX0 A;  3MC8 A;  1L7Y A;  3KUD B;  3NVZ A;  4BOS C;  4DHJ B;  2BS2 B;  2JT4 B;  3ZRC A;  4K81 A;  1FNU A;  3P1M A;  2N0S B;  1PUT A;  2JSV X;  1P0R A;  1FRR A;  5J18 A;  1WJ4 A;  2WS3 B;  1WXQ A;  4XGA B;  4XYC A;  5TSS A;  2WQY B;  5JHB A;  2NBW B;  4GN1 A;  2X8X X;  5C23 A;  1S1Q B;  1ZUD 2;  3A4S C;  4HRO A;  5JH5 C;  1UD7 A;  2PVG C;  5EE3 A;  2KKC A;  1WE7 A;  4FXC A;  4NAW B;  2DWQ A;  2BF8 B;  5LNK 1;  4BBN F;  2G3Q B;  3KYD D;  1I4X A;  1SIJ A;  4L2Y A;  3I9V 1;  4LJP B;  1S3S G;  3L17 A;  2C9W B;  1QKZ A;  3L16 A;  1GAQ B;  3AEA B;  3R66 C;  4LDT B;  3JSV B;  1F2R I;  2E3T A;  3R7Q A;  3DBH I;  4IG7 B;  1RFK A;  3N3K B;  2DZJ A;  3AE6 B;  4WAA A;  3ZDM C;  1TKY A;  2Q5W D;  2O6V B;  5HG2 A;  1ESF A;  1G6J A;  2IGD A;  4KZ0 A;  1T0Q C;  3ZJU A;  1J8C A;  1GB1 A;  2D07 B;  3BVZ A;  4RM9 A;  2X38 A;  2D10 A;  3EGR A;  1KLG D;  1D5X C;  2LXC A;  3PS6 A;  3ZVV A;  3M3J A;  1NBF C;  3AH7 A;  3BY4 B;  1IUE A;  2D11 A;  1LO5 D;  2FCM A;  1K8R B;  1WGK A;  1JRP A;  2ZNV C;  1C4A A;  4B6W A;  1WX9 A;  2AX5 A;  3DPD A;  1WM3 A;  3VUY A;  1T6B X;  2KVR A;  1Z5S B;  3ZXR A;  1UGM A;  2H88 B;  4JX1 C;  3HIZ A;  4MSM B;  3FKY A;  5BMH A;  1V6E A;  1NEK B;  2XEW A;  2C7H A;  3B2F A;  1GOZ A;  3ZXV A;  2K22 A;  4ZHO A;  5D3I B;  1FO4 A;  4FHJ A;  2Y5B B;  3TSS A;  1K53 A;  2KJH B;  5BO4 B;  4ZDV A;  4JE3 B;  2L7R A;  2WNM A;  5CTR C;  2G1E A;  2J0K A;  1CK1 A;  4PT5 A;  1E10 A;  1QQR A;  1YX5 B;  5FR6 A;  4PYZ A;  2PE6 B;  3WCQ A;  1NEN B;  1IGD A;  3NVV A;  2VH2 A;  1OEY J;  3TEY A;  1N62 A;  2YVC A;  3Q8F A;  3VRA B;  1EM7 A;  2NPT B;  2DHZ A;  4NNJ B;  2CHW A;  4ZRP A;  3DOW A;  3B1L X;  3MFG A;  3PT2 B;  4KIK B;  5AUI A;  3U4E G;  3N1X C;  5LXI B;  3TIX A;  1TKG A;  5JHA A;  1OQY A;  2RMM A;  3Q8B A;  2LUM A;  4NQL B;  3PRE A;  1KOT A;  1UBQ A;  1XQQ A;  1JWM D;  2K9X A;  2WLB A;  2MW5 A;  3ZW3 A;  1WSP A;  4GDL A;  1H4R A;  1KM7 A;  3IG3 A;  3JYU A;  4HJG E;  3LB8 C;  3QWZ B;  3Q8A A;  2MLB A;  3QAR A;  3ENE A;  2LHE A;  4FJY A;  2MRP A;  4HVB A;  3SR6 A;  3Q2A C;  2WXF A;  1QOF A;  4RM8 A;  2KTR A;  3ZIM A;  4P6V F;  4LK0 M;  2DNF A;  3AE3 B;  1VLB A;  4Q2J A;  3GP7 A;  2AQ3 B;  2OED A;  2CHX A;  3OAW A;  4M01 A;  4N58 A;  2UYZ B;  2EKI A;  4AQ7 A;  3DVG Y;  4ICU A;  3TCA A;  1WZ0 A;  2K8H A;  2Z8L A;  1WJ6 A;  4E71 A;  2QHO A;  4LTU A;  1E7V A;  1E8W A;  2EEL A;  2J52 A;  4DDI D;  1KJT A;  4PS3 A;  2KWD A;  1VZ6 A;  1VDV A;  1YJ1 A;  3TEW A;  2J7Q B;  3WAM A;  3VAW A;  2FID A;  3EC8 A;  4HPL B;  1WY8 A;  2NBV B;  4LDT D;  3W5V B;  1T3Q A;  2NTS A;  2L76 A;  4A55 A;  3W2D A;  2KNB A;  2GMI C;  3DBR B;  3ECI A;  2KMC A;  3KQ4 A;  1WGH A;  1PGA A;  3DWM A;  3RNB C;  1SF0 A;  4HK2 A;  2KT7 A;  2SAK A;  3AMZ A;  4F1S A;  2DEN B;  2MBE A;  4HDO A;  3PLU A;  2ZCB A;  2D3G A;  1J0G A;  3E9S A;  3PZ8 A;  2KTF A;  4NJ6 A;  4W9C A;  3RI7 C;  2WU5 B;  2DYM A;  4WIP A;  3QK0 A;  2CU3 A;  3SD5 A;  3U8Z A;  1WXA A;  1QIL A;  1E8Y A;  4HXD A;  1K51 A;  2I2Y A;  2FCN A;  1TY2 A;  4IM3 A;  3FIL B;  2FAZ A;  3AU4 A;  2KJ6 A;  2LJI A;  3ZYY X;  3L4P A;  1D5M C;  3U7D A;  3PSE B;  2KDB A;  1N5X A;  3DVN U;  1AWD A;  2ZCC A;  1C78 A;  2RR9 A;  1XD3 B;  2GBM A;  1PGB A;  2YLM A;  4B95 A;  2NBU A;  1V1P A;  1BXT A;  4DBG A;  1E7P B;  3BK2 A;  1VR9 A;  3ZDT A;  3NS8 A;  3PGE A;  3T3N A;  2C7N B;  2V3S A;  1KF6 B;  4BKS D;  1K50 A;  3V61 A;  5HHD G;  2K25 A;  4FBJ B;  3PRP B;  2MHJ A;  4EZL A;  3EA6 A;  1LM8 B;  3BVM A;  1YQ4 B;  2R2Q A;  4BAX A;  3RZW C;  1FXA A;  2RDH A;  2GBK A;  4MM3 B;  3DVN V;  4K7S A;  3ZRF A;  2WXH A;  3JW0 X;  2LGD A;  4ANX A;  2JRH A;  1KFY B;  4KSK C;  2JXT A;  1FMA D;  2CS4 A;  4P1C C;  2ZPY A;  3N20 C;  2L32 A;  1MG8 A;  1ZOY B;  4IC7 B;  4A20 A;  2V0G A;  2MJE A;  3HVZ A;  3TJP A;  3VQI A;  3APD A;  3MJW A;  3DBH B;  4URK A;  3C0R B;  4M8M A;  2KAN A;  4GB9 A;  3BK1 A;  3Q69 A;  1FCC C;  4DDG D;  2JWU A;  4MGK E;  1NVI D;  5E6O A;  2BB6 A;  3RNF C;  1FRD A;  4MGI E;  1TJE A;  1ZDV A;  3I57 A;  1NDD A;  1C1Y B;  4W9J A;  5DCN A;  1IGC A;  3HVD A;  2V1Y A;  2BS3 B;  2O2V A;  2BPS A;  1UF0 A;  2WDT B;  1HA5 A;  1TZO A;  1FXI A;  1EF1 A;  3PRM B;  3TEZ A;  3Q14 C;  3WAN A;  2HJ1 A;  1ISN A;  2IDY A;  3AE5 B;  3NY5 A;  1GNU A;  3NVW A;  2C5L C;  2JF5 A;  2BKR B;  3DCG A;  2KOX A;  4LNK A;  3P4P B;  3BVG A;  2L00 B;  2MQJ A;  1MHX A;  1N61 A;  2HDE A;  4TMA B;  2JVC A;  3ZO5 B;  2KJR A;  1NYR A;  3L08 A;  3M95 A;  5IAA C;  1FNV A;  1XLQ A;  4HWI B;  4LCD E;  1T0S C;  3V6E B;  1UBI A;  3LDZ E;  1MG4 A;  1OGW A;  2WXJ A;  5FKA C;  2A5U A;  3P4R B;  2ACZ B;  4RCO A;  3EUB 2;  4IWP A;  3O65 B;  2NCN A;  2JZ3 B;  2GLS A;  5HI1 A;  1JML A;  1Q5W B;  2J42 A;  4USA A;  4XDD A;  3KWV A;  1F2R C;  2KC2 A;  3APC A;  4DK5 A;  4P1B C;  2NS5 A;  1T0R C;  3Q8C A;  4MEM A;  2MEK A;  4BFR A;  1E9M A;  3V05 A;  4OHJ A;  1HTQ A;  1Y56 A;  3A9J B;  3MC0 B;  3TL5 A;  4DXA B;  2INC C;  3Q3F A;  2PW9 A;  4GXB A;  3VTV A;  1Z2M A;  3R2I A;  4ZYS A;  1SE2 A;  5JXV A;  2EKE C;  3MTN B;  4AS1 A;  1QLB B;  2DYO A;  1Q1O A;  3VTU A;  1WGG A;  2R2O A;  1WXM A;  2MSE D;  3T8M A;  3WA0 A;  3BZD B;  3DBR I;  2KFK B;  5T8I A;  4GGQ A;  3FC4 A;  3ML9 A;  2AQ1 B;  1FIQ A;  1OQR A;  4BBN C;  4ZRI A;  3QA8 A;  2LI5 A;  1UH6 A;  4LLG M;  4WWO A;  5C3J B;  3OJ3 A;  2AYO B;  2N1V A;  4YSZ B;  1I4P A;  2M0X A;  2XNA C;  2L52 A;  3RMK C;  4YL8 A;  1C4C A;  3TBL D;  2N9L A;  1Q0W B;  2KD0 A;  4RH6 A;  3PRZ A;  3U52 E;  4RNA A;  2KLG A;  4LNN A;  1SEB D;  1ZE3 D;  2MP2 B;  4JLC A;  3ML8 A;  4MH8 A;  5BYR A;  2V4I B;  1XO3 A;  1I35 A;  1A5R A;  1WRD B;  2K39 A;  2L83 A;  4EZJ A;  3Q3J A;  2LFI A;  4ZRJ A;  4M02 A;  3DBL B;  4WJN A;  3RNE C;  1HE8 A;  2KQ4 X;  1Q10 A;  4KDL B;  4A3P A;  2CKH B;  3KUC B;  5EE9 A;  1SSN A;  2DAJ A;  2I1K A;  4M00 A;  4ITK A;  4YTM B;  2UU7 A;  3EFU A;  5G55 A;  1I4H A;  2D2Q A;  1T0Y A;  2M1M A;  3ZQ4 A;  2KDE B;  4ANV A;  3I5J C;  4MGZ E;  3OG5 A;  2NPT A;  2MWS B;  4FAD A;  4RGN A;  4LNF A;  1L0Y B;  4TUU A;  4KIK A;  2W55 A;  1FM0 D;  1FD6 A;  3AM9 A;  4OZA A;  3QC8 B;  1C4P A;  1BUI C;  4DHZ B;  2XK5 B;  5D94 A;  2LGI A;  1ZGU B;  4XZ4 A;  5DPR A;  3VRB B;  3VR9 B;  1QOB A;  1FCL A;  3QCA A;  4DHZ E;  1WMH B;  4JGH B;  3RD2 A;  3QQ8 B;  4ARC A;  1DOY A;  1L4Z B;  2KN5 A;  3OLM D;  2MBH A;  4AJW A;  2RDG A;  3ZNH B;  1P7E A;  2Y5P A;  5H92 C;  3UIP B;  2QMT A;  1HZ5 A;  2WXN A;  1E90 A;  5BYQ A;  4L1B A;  2WP9 B;  2EMS A;  2LGS A;  3V60 A;  3C8Y A;  2QJL A;  2IO1 B;  2INP E;  1WRI A;  1BML C;  3SDL C;  4REZ A;  4BKG A;  2KYW A;  4EFO A;  1GUA B;  1UUP A;  3E56 A;  1FFV A;  5FK9 C;  2V9H A;  4EOY A;  1AN8 A;  1J7B A;  3AEC B;  4G0N B;  3UGB B;  4GDK B;  2ON8 A;  1JRO A;  1LFD A;  2LVP A;  4P16 A;  4EZK A;  1I4Q A;  2WXR A;  3I63 C;  1AYF A;  3AED B;  2GB1 A;  2FNJ B;  3AU5 A;  4M0W B;  3ZLZ A;  4I6P A;  2DZK A;  2UWQ A;  5FR3 A;  1JCK B;  2R61 A;  2BBC A;  5D2M B;  2AWT A;  3SEB A;  4W9F A;  1ZDX A;  4ZRK A;  4HDQ A;  1RRB A;  4AOF A;  1XLN A;  2LRU A;  2LUE A;  4IKG A;  4BKT A;  2C60 A;  4AP4 C;  3FIL A;  3AB5 A;  3WAO A;  5GMV A;  4FN2 A;  5CHV C;  4ANU A;  2Z0D B;  3U30 A;  4C00 A;  1DYQ A;  2NTT A;  4MJS B;  3GE3 C;  4MT5 A;  2BQQ A;  2PKO A;  1ROE A;  4WQO B;  1YN3 A;  1ET9 A;  1MVK A;  4JPS A;  1WGD A;  4NQK E;  3H8H A;  2KWC A;  4ZRQ A;  4A9A A;  1YJI A;  1EU3 A;  2FCQ A;  3HUI A;  2ZW0 A;  1XXG A;  2NR2 A;  4KKI A;  2REX A;  4XE0 A;  2FUH B;  1FFU A;  3SFE B;  5DPT A;  5E6N A;  3LJ3 A;  1AAR A;  1VD2 A;  2K6Q A;  3OWE B;  2WXK A;  3B9J A;  1SXT A;  1CMX B;  4WUR A;  2BTE A;  1ZXH A;  4LNO A;  4MM3 A;  4RGO S;  1WYG A;  3V3X A;  2KXJ A;  1NI3 A;  4OVZ A;  4YT0 B;  4S17 A;  1FEH A;  2ICI A;  1DOI A;  1TKE A;  1SB3 C;  3ZTC A;  3NZS A;  1XEE A;  4XWW A;  2DYB A;  2GI9 A;  3D32 A;  4PYU A;  3RUI B;  1GPX A;  2RGF A;  2JX5 A;  4I6L B;  4P7I A;  2KLC A;  3PHX B;  3DHH C;  2IY1 B;  3RT3 B;  3RFZ B;  2CR5 A;  1WFY A;  2WGS A;  3R3M A;  5AZG A;  2N9P C;  4FHK A;  3DBL I;  5H8Y E;  2FE8 A;  2VH1 A;  4IWQ A;  4NAM A;  3PVL A;  1HZ6 A;  2KK8 A;  2LWP A;  4IDI A;  2V3P A;  2LMC A;  4KDI C;  1EO6 A;  4BVU C;  5C2T B;  3Q3O C;  1B9R A;  3AE1 B;  3BWU D;  3I3T B;  2AQ2 B;  4OVU A;  5L83 A;  4KKJ A;  4MEL A;  2IZV B;  1XCT L;  5AEK B;  4RMA A;  1SGH A;  3DBS A;  2BT6 A;  4CHK A;  3IT6 B;  4EKU A;  4MAC A;  4DXF A;  1YOV B;  4WWM A;  2PPH A;  3QJZ A;  3T9L A;  4E3C A;  2AEH A;  1EF5 A;  2IGG A;  2AL3 A;  2Z59 B;  1SJH D;  2CJO A;  4BZA A;  2LGX A;  1B1Z A;  2GBJ A;  2JY6 A;  4W9K A;  5IN7 A;  3J9C A;  2DAF A;  1TS3 A;  2ZPN A;  3AI5 A;  2C7M B;  4HPP A;  3IVF A;  4IM2 A;  5IP4 D;  2VRR B;  1ET6 A;  1E5W A;  4PS8 A;  2D3A A;  1A70 A;  3R7R A;  2IBI B;  2M19 A;  4HRS A;  4ACF A;  3CSF A;  2I38 A;  3PLV A;  3A9J A;  4JWU C;  4FA6 A;  1TIF A;  4II3 B;  4LJO B;  2LHD A;  1GC7 A;  2MBB B;  3ZTD A;  2KMA A;  2TSS A;  4RF0 A;  4MH0 E;  1MPE A;  3AN1 A;  3W1S A;  1QT9 A;  3UF8 A;  1RM6 C;  3AEG B;  2LVO A;  3Q6B A;  1RAX A;  2E6X A;  3NS1 A;  2L1A A;  1GG3 A;  1WGR A;  3PHW B;  2KFK A;  3UIO B;  4QAY A;  2IJ0 A;  3GOE A;  4CO7 A;  1V97 A;  3PZD A;  3LXF A;  4K3C A;  4KV2 A;  1L5P A;  3P4Q B;  1N5W A;  1TZ1 A;  3EEC A;  3P42 A;  1VZ7 A;  1TY0 A;  2MX2 A;  2V3N A;  3VH3 B;  1UWM A;  3AEF B;  2K5P A;  1TS5 A;  3RN9 C;  2GRI A;  5IO9 A;  1D3Z A;  2IO3 B;  5EE0 A;  1GC6 A;  2MP2 A;  3H6N A;  4W9L A;  4JL9 A;  3NVY A;  1V5T A;  4F8C B;  3R8B A;  1FPY A;  1ENF A;  5MPO A;  4A90 A;  1XT9 B;  2N4F A;  3CMM B;  1GJZ A;  4XWT A;  4D2K A;  2BWE S;  5E6J A;  1CZP A;  2PMV A;  4K7U A;  3RNA C;  2PTL A;  3KH0 A;  1E8Z A;  2LAS A;  5IA7 A;  2IGH A;  4B9K A;  3AV8 A;  1L0X B;  3O13 A;  4HLE A;  2OOB B;  2JZZ A;  1DOX A;  1KLU D;  1HTO A;  1YQ3 B;  2DZI A;  2L8J A;  4GIV A;  1RYJ A;  1PQS A;  3ZUN A;  1OTR B;  4JQW C;  1J7C A;  5EE1 A;  5BMG A;  1P1A A;  2RPQ A;  3ETR A;  3QIJ A;  2GBR A;  4HKZ E;  2DZM A;  1JAL A;  1JRU A;  1F1H A;  2N7D A;  1WIA A;  4KZC A;  4NPN A;  2MH7 A;  2XK5 A;  3LYY A;  2BYV E;  3QAQ A;  1QOG A;  2QSD A;  3WAP A;  2I1J A;  4BOZ B;  2JWZ A;  4WQM A;  1WMH A;  1OQQ A;  5I4D A;  3ZNG C;  3N1Z C;  3V6C B;  1MI0 A;  2BYT A;  1V8C A;  3X23 A;  4G50 A;  2KDM A;  2ASQ A;  5BYS A;  4M8N A;  3ONS A;  1P98 A;  3WIM A;  3ZJT A;  1YQB A;  3M63 B; 
#chains in the Genus database with same CATH homology
 5IO9 A;  1MG4 A;  1MFW A;  5IP4 D;  2BQQ A;  2DNF A;  1MJD A;  5IOI A;  1UF0 A;  5IN7 A;  5IKC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...