5IN7A

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
KAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Neuronal migration protein doublecortin
total genus 24
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5in7A00
5IP4D 5IO9A 2BQQA 2DNFA 1UF0A 5IOIA 5IKCM 1MJDA 5IN7A 1MG4A 1MFWA
chains in the Genus database with same CATH superfamily
2KVRA 5D6JB 3N20C 1H8CA 1ACCA 3DVGX 2KFKA 1MVKA 5CHWA 3NHEB 3AN1A 1JQ4A 1SF0A 2Z0EB 2JZPA 3AM9A 4FLHA 3WIMA 2XEWA 2WX0A 4MDKE 4ZOHC 2WQYB 3T3NA 2D3BA 4EE2A 3NJTA 3ZQ4A 3URYA 4GOCA 1NDDA 4F7ZA 3AE5B 3AU4A 4L1BA 2KLGA 5HKHA 2KWVB 1ET6A 2G4SA 3C0RB 5JZEB 1WF9A 3A33B 3ZRFA 2LGXA 2LRWA 3AB5A 1HQRD 1KH0A 1UGJA 4C7YA 2JZ3B 2N0SB 5DPWA 4C4VB 2KAJA 2CJNA 2K8BA 1SE2A 2ZNVC 3T9LA 2MLBA 2BYEA 4XDCA 2PPHA 2ICIA 1YJIA 1D4BA 3VRAB 4NY0A 2D3AA 4KZ0A 1WR1A 2BYFA 4EZKA 3NZSA 2WXGA 3AECB 5HFYA 3TUOA 2K9XA 2R2OA 4BFRA 5EE0A 4USAA 3QWZB 1XQQA 3PHWB 4C4VA 1JWUD 1UNSA 1E8XA 5FKAC 2L8JA 3PREA 5TR5A 4P16A 2BBCA 4XX5A 1GPXA 4ARIA 4WJQA 1WGHA 2QC8A 3UIPB 1GJZA 2N4FA 2DHZA 4MSMB 3SHQA 5G2NA 2M1MA 3IT6B 4K3BA 3RULA 1WXVA 2KNBA 4PT5A 2JRIB 1WJ6A 4XGAB 1SIJA 1S3SG 1WM2A 2CHWA 3EC8A 1WYGA 2VH2A 1I4QA 2KTFA 4ZYNA 2K8HA 2D3GA 5KHQA 3TMPB 1WGKA 2C7NB 5EE9A 2K5PA 4CYEA 2AQ2B 4EUTA 4CHKA 4L2YA 2KMMA 1D5ZC 2V3SA 2PE6B 2MSED 4ACFA 4NJ7A 1VLBA 3O65B 4M02A 5FR3A 2WWZA 4AWJA 2EKEC 3ZNHB 3IFWB 2Y5PA 2WXPA 3JW0X 1HTOA 3W1YA 3ZNZB 1PYWD 4C00A 4LCDE 3E56A 3RNCC 3L17A 3HUIA 3Q69A 3KUZA 2D3CA 1QOFA 2QHOA 4XWTA 2J53A 5EE1A 4OVZA 4FA6A 2KJ6A 2NTSA 3ZDTA 4ZYSA 5IAAC 4W9FA 3VR8B 1YJJA 3LB8C 4W9GA 1ROEA 1WE6A 2PW9A 2L0FA 1F2RC 1T5XD 4EZLA 4XYCA 1GB4A 1V1OA 4BVUC 1WJ4A 4ZRIA 1NEKB 2JF5A 1JALA 3RCZA 3QC8B 4TUUA 5FK9C 1E0ZA 2LUMA 1VZ6A 3KH0A 1YQ3B 4WWOA 4NZLB 4I6PA 4A3OA 2K0PA 5AZFA 3NOBA 5DCNA 5MPOA 4US8A 2CU3A 2Z0DB 1RFKA 1G6JA 1WXMA 3ZJVA 4FXCA 1CK1A 2KDIA 2K6QA 4BKGA 4M0WA 2KKCA 1K8RB 3VXWA 3PHXB 3IAM1 2FCMA 4S17A 2KTRB 3A1QA 2LMCA 2AQ1B 2DYBA 4MT5A 3TCAA 3X0WA 3GZNI 4NNJB 1J0GA 2KX3A 1XXGA 3WAMA 1D6EC 4KIKB 3D32A 3EFCA 4RF0A 4DHZE 1WXAA 3Q8EA 2BF8B 3VH4B 3NVWA 5D3IB 2GB1A 3UGBB 4N59A 3AE4B 2KZRA 1UBQA 1VZ8A 4W9DA 1CMXB 3BK2A 3I9V1 4W9CA 1RLFA 2LFIA 2LJIA 5TSSA 2C7MB 4OZAA 2ZJDA 4N58A 1I4RA 1NYQA 2N7DA 4O1NA 2V1YA 5L83A 3CSTA 2JU6X 2BS3B 1T0QC 1YIWA 2KDMA 3KQ4A 2L32A 4PS3A 4WWMA 1R4MI 1P1AA 1UGMA 4M8MA 5LXIB 2RD0A 2RGFA 2FCSA 5D3DA 2BGFA 3OG5A 3AE1B 4PYUA 1E8YA 2JRHA 2UWQA 2KYWA 3U52E 2V0GA 3DHIC 3ZIMA 4GGQA 3MJ5A 1V5OA 4WQMA 3Q3FA 1R7SA 2CR5A 3TIXA 4RGMA 4HDQA 1ZP0B 4FULA 1RWSA 2I38A 3DVNU 3H8HA 3SDLC 2JXTA 2DENB 3KUDB 1TS5A 3H9DA 3ETRA 4FBJB 2JXXA 3PV1A 3BYTB 3UQBA 3APDA 1IYFA 3HHMA 3ZTDA 4LJPB 5FR6A 5HG2A 1VZ7A 3ENEA 2HE7A 2MBHA 4HEA1 4MH8A 3DBLB 3C19A 1ZE3D 5JH5C 1QOAA 2LGYA 3LJ3A 1MG8A 2RMMA 4FN2A 1QOBA 1DOYA 4TQ1A 4IDIA 3IXSA 4CO7A 1VRAB 4OVVA 1IUEA 1V97A 5D2MB 2MBEA 4MACA 2PMVA 2BT6A 2PE9A 2BKRB 1EO6A 3I5JC 4DQOC 4L23A 1NI3A 4RH6A 1WWTA 5D94A 1I4PA 2ZW0A 2DYMA 2KC1A 2IO3B 2M4NA 3EA6A 3FAHA 3AXCA 3IHPC 1F77A 4W9EA 2XN9C 1VR9A 5E6OA 2HTME 4I6NB 2BVCA 2QMTA 1E9MA 5L95C 4KKJA 3Q3NC 3SD5A 1IPGA 4DXGA 2KN4A 1I4HA 2DZKA 3NZUA 2WDRB 2LZ6A 1PGBA 4G3XB 4IWPA 4BAXA 5T8IA 1YJ1A 2RPQA 4E74A 2XBBC 4AS1A 1YOVB 1MI0A 2INNE 3DOWA 4KGSA 4P1CC 1E5WA 4MSQB 3APCA 2KWDA 3IG3A 2Z8LA 2LHEA 3K9OB 1SE4A 2L0TA 1ZUD2 1XEEA 2G4DB 3RNFC 4A6QA 3BWUD 3ZYYX 4HKQA 2ZW1A 4TMAB 1M94A 4ITKA 4W9IA 1FNUA 3DWMA 1FIQA 4YTNB 4IM0A 1V2YA 2C7HA 5IN7A 4ICVA 3A9KA 1ZDVA 2RSUA 2MBOA 3AV8A 2V4LA 3U2SC 2KQ4X 3L08A 4OVUA 4EFOA 4TV3A 1E8ZA 2BPSA 2FAZA 1L0XB 1C1YB 3MC9A 5JHAA 2SAKA 1F1HA 4HJGE 1QILA 3OLMD 1LXDA 1PGXA 3Q3JA 2V3PA 1IBXB 2DZJA 4ZHOA 3IT4B 5GMVA 3QQ8B 3PRMB 4IW0A 4M8NA 2D5GA 2AX5A 4PS7A 1NBFC 1L6UA 4K7SA 5J18A 5EE3A 1WX9A 1FEHA 3MTNB 4A8XC 2O2VB 3CWIA 4EKUA 4A9AA 2GBMA 2OOBB 3M62B 4K1RB 3MC8A 4JWUC 3R7RA 3TSSA 2BYVE 2BQQA 2MBBB 3ZDMC 1WY8A 1YQBA 3UI3A 2CKHB 1WSPA 4MEMA 1XF5L 1QF6A 3Q8AA 1YN4A 1C4PA 4P6VF 3IBEA 4FADA 2WU5B 5D7GA 3PSEB 2IZVB 3AEAB 1L2NA 2DAJA 3OJ3A 4IUMB 2WNMA 4GIVA 1OTRB 4WIPA 1WI0A 2HJ1A 1DGJA 1VJKA 3KUCB 4G0NB 2LD9A 5CHFA 4RGOS 1T0YA 3AEDB 4WAAA 3S2AA 3P42A 2PEAA 4ZRKA 3P4SB 5C23A 2IO2B 1SJED 4OZBA 1VDVA 1WXSA 4GU2A 1V5TA 2LGDA 2KFJA 2K22A 5IOIA 3RD2A 2WHIA 2KJHB 1BMLC 2H88B 1FRDA 4LDTD 3AE9B 3ONSA 2V3NA 2KN5A 1IBXA 3W9CB 2QEJC 3A4RA 3M63B 2WXLA 2OJWA 3RMKC 1ET9A 2WX1A 2B76B 1L7YA 1UZXB 3OAWA 1EWYC 3N32A 1YX5B 4HPLB 1OGWA 1WH3A 5E6JA 1LFDA 3NVYA 3R8BA 2IY1B 1ENFA 2L1AA 4KSKC 2QIEB 1I7HA 1KRHA 1QZEA 3RUIB 1WE7A 3VUYA 4MELA 2GI9A 3NRZA 1KLVA 2WXKA 3DHHC 4AQ7A 2AYOB 3QJZA 2KOXA 2JQRB 1EUVB 3WANA 3I57A 2WXQA 1I4XA 3UINB 1E7VA 1LO5D 2LRUA 3B9JA 5HI1A 3A4SC 3H6NA 1KLGD 4NAWA 1FXAA 4BKSA 2IGDA 2O6VD 1EWCA 4IKGA 3X23A 2MP2B 3N1XC 4P7IA 1HZ6A 4IWOA 4MGYE 4UDUC 2IBIB 1N62A 4DWFA 3VFKA 4TQ0A 4S0RA 2ZZPB 3JSVA 1IP9A 1OFFA 2D07B 4B95A 2JWUA 4ASWC 1MG4A 3AE7B 1K51A 2GBJA 4YL8A 1QLBB 2JY6A 3A9KB 4XDDA 2FCQA 4PYZA 4WJPA 3PPAA 4NAMA 4PS8A 1UUPA 2FUG1 4GDLB 4D2KA 3RZWC 3DHGC 3EUB2 4LNFA 4WJNA 4LDTB 3BIID 2D11A 3KLSX 3DWGC 4AJYB 1XLOA 3QIJA 4K7UA 3U8ZA 2INPE 1WMHB 3W5VB 2M17A 1KFYB 1KM7A 4AP4C 1ZOYB 2BB5A 2MJEA 3WCQA 3DVGY 3JVZX 4ANWA 2Y5BB 2MRPA 1UD7A 4PK1A 4IM2A 1NI2A 1FRRA 2KVZA 4HPPA 1E7UA 3L16A 4LK0M 3ZUNA 3M95A 2NBWB 1D5MC 4RF1A 1L0YB 2K39A 2ONQA 3RZFA 1FCLA 2KX0A 2KXJA 1JW9D 1TJEA 2MX2A 3IAS1 2RDGA 3FILA 3QHTA 1XO3A 2UU7A 2DX5B 3MP9A 4K81A 3W5UB 1P98A 2Q5WD 2JWZA 1QT9A 1ISNA 3EHVA 4HDOA 1EU3A 1FXIA 2NPTB 2RDHA 2W9NA 4WQOB 2LEKA 1T0SC 2LGSA 1GB1A 1J8CA 4RFBA 4E71A 1TBEA 2LUEA 1C78A 1GC6A 2G9HD 3ZNGC 1N61A 1TKYA 2TSSA 3GE3C 4G11A 5AUKA 2WS3B 4YXDB 3TBLD 4AOFA 3V61A 1ESFA 2MJ3A 4TSSA 2W3RA 2KDEB 1UF0A 2IJ0A 1TZ1A 2L7RA 1Y56A 2Z59B 5H92C 1IGCA 2JSVX 4MH0E 1WGRA 2GLSA 1GC7A 2E6XA 2WGSA 2ZEQA 1Z5SB 2RDBC 3GS2A 3HVZA 2GBKA 2J0JA 1PDXA 3ZO5B 2HDEA 3N1YC 1QKZA 2V9HA 5BMGA 2IYDB 1XLPA 1C3TA 2QSDA 1Q1OA 2IGHA 3P1MA 2YEPF 1XLNA 3NY5A 4WWNA 1NYRA 1V9JA 3B1LX 2LGIA 2CU1A 4KIKA 2L05A 1V1PB 2JT4B 2NS5A 3AEGB 3DBRB 3KWVA 3H7PB 2PLPA 4MGZE 2N1WA 1QOGA 4WH4A 3PT2B 4G50A 1KF6B 3H7PA 1UBIA 1XT9B 3SFEB 2G45B 2KQSA 1SB3C 1WMHA 3C8YA 3M3JA 3CIRB 5CHVC 4B0EA 1I35A 1WIAA 2AEHA 1JROA 2FIFA 3CF6E 4EEWA 1TTNA 3Q3OC 3J9CA 2PTLA 1D5XC 1S1QB 4W9KA 1ZPSA 2Y5CA 3PLUA 2ZVOA 3W1SA 1SSNA 1F2RI 2LXAA 2ZCCA 2VZKD 3AI5A 3DBSA 2ZPNA 3VHTC 3JYUA 3U7DA 2J0MA 4KKIA 2WXOA 5HHDG 2X38A 1ZGUB 1HTQA 1B9RA 4YSXB 3KYCD 4JQWC 1PFDA 1D3ZA 1MJDA 1HXYD 3DBHI 1JWSD 3ZW3A 2IO0B 4LLGM 4ARCA 3PTFC 1KLUD 1YNTE 3L13A 4KV2A 2M19A 1J7AA 3PGEA 3VVWB 1K53A 3LYYA 2KTRA 1TY0A 3A1QB 1EF1A 1CQVA 1I42A 2EMSA 3V62A 4RCOA 4ANUA 2KANA 3VTUA 2FIDA 4II3B 1I4GA 2JUOA 4OHJA 2LJ5A 4YSYB 2QCZA 3B0AA 3P4QB 1Z2MA 1WFYA 2KQ7A 1GUAB 2XK5B 3KWLA 4XE0A 4WJOA 1JMLA 1SEBD 3KVFB 2PIAA 2KLCA 4KX6B 3BK1A 4DHJD 5C3JB 1FMAD 3SFDB 2BB6A 3PVLA 2KMAA 4NQLB 2WU2B 5G5HA 2KDFB 3RNGC 4HLEA 1ZW7A 3NS1A 4FHJA 4MJSB 1C9FA 4QAYA 2KO3A 3L10B 2NMQA 2K25A 3AE6B 3N3KB 1OQQA 1FCCC 2W54A 3QA8A 5BO4B 2MP2A 4BOZB 5JHBA 1FNWA 2KWCA 4GLSC 2VZKB 1V80A 2YVCA 2PVOD 5GXGB 2L83A 3WA0A 2NCNA 2IGGA 1SIFA 3QARA 3NUHB 2MQJA 2XNAC 3P63A 4FJZA 1V81A 1TKEA 2ZCBA 3W2DA 1KOTA 1FD6A 1C79A 2FBWB 5LNK1 2A4ZA 2M0AA 5DPRA 1OQYA 4KGRA 2O6VB 3A9JB 4YTMB 3HM6X 3AE2B 2O6VA 4M01A 1C76A 2INCC 3TEWA 4FJYA 3QAQA 4FHKA 4MM3A 1Q0WB 2D2QA 4KGTA 3EGRA 1TT5B 3P4PB 5E6NA 3ZVVA 3WALA 4ANVA 5JXVA 1P9DU 1AARA 1E8WA 2W3SA 2KWUB 2BWFA 3OJ4B 3BY4B 3QCAA 4JLCA 4BKSD 2LVOA 3MHSD 3H1UA 3L4PA 3EECA 1T6BX 1TS2A 2GRIA 1T3QA 1P3QU 1ZXHA 3RFZB 4JL9A 2E3TA 4BBNC 3R2IA 4RNAA 1HE8A 2VRRB 4ZHPA 1UH6A 5AZGA 3L0WB 4IM3A 4RMAA 1FFVA 1HEZE 2WXJA 3AEBB 4ZRPA 2KACA 1YQ4B 3V05A 1EM7A 4HVBA 3LDZE 3HK0A 2PJHA 2LHDA 1FM0D 4MJSA 4W9LA 4DXFA 1WM3A 2BS4B 2WXIA 2FNJB 1AWDA 3VRBB 1L4ZB 4DHJB 2AL6A 3GE8C 2DAFA 2J0KA 1PQSA 4LNKA 3Q3MC 2NTTA 3GZNB 2M56B 3QK0A 4REZA 1N5WA 2V4IB 5BYRA 2KJRA 4BBNF 4I6LB 3VR9B 1DOIA 1ZKHA 4LTUA 2YEPB 1A70A 1KJTA 5BYQA 2MW5A 2DNFA 3PZ8A 2SEBD 2N9LA 1FNVA 2WP9B 1CJEA 1V8CA 5IA7A 3WAPA 4M00A 2MH7A 2WXFA 3N30A 1XD3B 1SE9A 4ZRQA 5AUIA 1VCBA 3PZ7A 3ZXVA 4GN1A 4LNIA 2QDFA 4K3CA 2OJRA 3U30A 1GG3A 2W55A 2NBVB 4A20A 3UQAA 5C2TB 3PLVA 5G5GA 1E90A 3AH7A 4W9HA 3ML9A 3PRPB 2KDBA 1XCTL 1WJNA 4HCNB 4OW0A 4K7WA 2HD5B 3QX1A 1TZOA 1JCKB 1C4CA 1TIFA 4WWPA 3R3MA 1P7FA 2CS4A 3VAWA 2IPKD 2N9XA 1H4RA 1WR6E 4IWQA 3H7SA 4H2AA 3DQVA 1R4NB 2C9WB 1Y8RC 3Q8BA 2FCNA 4HWIB 1P7EA 2JVCA 4Q2JA 1J7CA 1ZDXA 1U4AA 1WGYA 4GSWA 2UYZB 4DK5A 1MFWA 2J42A 1WXQA 3RNAC 2WDVB 2YLMA 1UELA 3HRDD 4J6IA 4JWSC 4CQNA 3EFUA 3ECIA 4WURA 4DBGA 4HJKA 4NJCA 1AN8A 2GBRA 2RPVA 4J3OD 1J7BA 2CHXA 4URKA 1T0RC 5IP4D 3AEFB 2B3AA 3PO0A 3VH3B 1OEYA 2JZZA 2C60A 3KYDD 5IKCM 5AZHA 2LASA 1X1MA 2K8CA 3R7QA 4ANXA 4BOSC 1WX7A 2MBQA 2NBUA 3DCGA 1A5RA 1V1PA 3B08A 3MJWA 1KTKA 3TEYA 2MA9B 2BYTA 2WXMA 1SE3A 5LXHA 3Q8FA 1PUTA 1FXTB 2MJDA 1BXTA 4ZDVA 3V6CB 3RPFC 1WGGA 2A5UA 5CX3A 2REXA 2W82A 3RT3B 4A90A 1WZ3A 4YTPB 3Q6BA 1TY2A 2DLBA 2MEKA 2AQ3B 5G55A 4BKTA 4JIOU 1WRIA 2JX5A 3T3OA 1RYJA 1WRDB 2LI5A 4KVGB 2LWPA 3NVZA 1N5XA 4GMVA 1YN3A 3BINA 4R3DA 3RI7C 1GAQB 3OWEB 3NVVA 1L4DB 4HCPB 3BYYB 4HXDA 2LXCA 2JYEA 4NQKE 1F9JA 2N1VA 1TKGA 1LM8B 2XK5A 4KSLC 1MHXA 4LNOA 4DDGD 4HRSA 4B6WA 1DOXA 4A55A 4XC2A 2OHFA 1STEA 3RNEC 5I4DA 1C4AA 4MGKE 3R66C 3RN9C 3ML8A 3AMZA 4RGTA 1UWMA 3MC0B 3ZXRA 2IO1B 1CZPA 2FE8A 2BS2B 4WAFA 1QQRA 3V3XA 4AUQC 4IG7B 4DHZB 4GDKA 2N9EB 4C56C 4MGIE 2H89B 2KHWB 2DZMA 3DPDA 3ZLZA 4GDLA 3PS6A 2X8XX 2BKFA 4RM9A 1NVID 2N9KA 1WX8A 4P1BC 3SU8X 1MHHE 2L52A 3RYTA 1OQRA 1JWMD 1K52A 1FO4A 2DBYA 1WYWB 4MM3B 5BMIA 3NZ3A 3R2TA 1EU4A 3P2BA 1M4VA 3VUXA 4KDLB 3ZGZA 2DWQA 3TEXA 1K50A 2BW2A 3VTVA 3O13A 1JRPA 4XWWA 4E3CA 1R4MB 2K1FA 4YWGG 1WJUA 2ASQA 4HK2A 1HZ5A 4ICUA 4B9KA 5BYSA 4US9A 2RR9A 2ZVNA 1N60A 2KMCA 2MCNB 1GOZA 4YSZB 4GXBA 2VH1A 3HVDA 4RGNA 1YN5A 2LVPA 3V60A 2C5LC 1NENB 1J19A 2I1JA 3CMMB 3DBRI 4RM8A 5KHOA 4OZCA 3T8MA 3ZJTA 4BZAA 2G3QB 2WLBA 3UIOB 2ON8A 4AJWA 5DPSA 3TJPA 3K9PB 1YMHE 3FILB 3GOEA 2WDQB 2J7QB 1V86A 2N7EA 1F52A 1DYQA 2FUHB 2GBNA 3DBLI 3Q2AC 3B2GA 1AW7A 1SJHD 2GOWA 5J17A 2J4XA 1B1ZA 2I1KA 4N9F4 2CHZA 3RNBC 3HM3A 4W9JA 2IDYA 3L54A 1E10A 2M0XA 2R61A 4HKZE 4GDKB 1N6ZA 1AYFA 3UF8A 1PGAA 2KT7A 1E7PB 1N63A 1RAXA 3V6EB 1TS4A 3DDCB 4F1SA 1FFUA 1JWBD 1RM6C 4C80A 3P4RB 1C77A 1RRBA 1WZ0A 3AULA 2L3ZA 2Y3AA 3LXFA 3AE8B 4KZCA 1XLQA 1LQBA 2BTEA 4ZRJA 4DXAB 1TYGB 3FC4A 2K3UA 4XZ4A 1FPYA 3AU5A 1VD2A 3IVFA 4NPNA 3CSFA 3NS8A 1F0ZA 2EMTA 3DVNV 1Q5WB 4LJOB 3ALBA 2AL3A 1BUIC 5J2RA 3PRZA 3ZNID 3U4EG 4B0MA 1P0RA 3MFGA 4C7ZA 3NG0A 2ZPYA 3HIZA 4HPMB 2KK8A 1JRUA 2BWES 3ABVB 3BVGA 3N9YC 3APFA 3DBHB 3JSVB 2KD0A 3MHZA 5DPTA 1V49A 3WAOA 3KW5B 4JPSA 3TL5A 2HJ8A 2HTHA 2N7JA 4LNNA 2PVGC 2DYOA 4EOYA 2GMIC 4II2B 2K6DB 1UWXA 1SBBB 1Q10A 2L00B 2IY0B 3BZDB 3I63C 2N9PC 1TGZB 3I3TB 2MHJA 3BVZA 2INDC 2WXNA 4JX1C 1OEYJ 5EDSA 1E6EB 3AE3B 4DDID 3FKYA 1BT0A 3BVMA 5AEKB 4F8CB 1YX6B 3U7ZA 2M8SA 2PKOA 2G1EA 3Q14C 1R4NI 4N6EB 5BMHA 2J52A 2D10A 2WXRA 2JYTA 2WDTB 3N1ZC 1RFAA 5IO9A 3ZTCA 2AWTA 3ZJUA 1L6VA 1GNUA 2OEDA 2JPHA 2MWSB 4M0WB 3SEBA 2DZIA 5E6PA 3AEEB 1L0VB 3SR6A 1SGHA 1EF5A 2R2QA 3A9JA 2LVQA 2ACZB 4NAWB 1HA5A 1YD8U 5CTRC 3TEZA 5C1ZA 2QILA 1WGDA 1MPEA 2I2YA 4IOIE 2EELA 2CJOA 4TKNA 4EZJA 3ZRCA 1V6EA 4IC7B 4JGHB 3VQIA 1LGRA 4X57B 2KC2A 1JWAD 2QJLA 4FJVB 1ZXIA 3Q8CA 4GB9A 2L76A 5LLIA 3PZDA 1TS3A 3VTWA 1L5PA 3GP7A 3VDZA 2WYQA 4NJ6A 4JE3B 3B2FA 5H8YE 2O2VA 2KFKB 2WXHA 1XCQL 2NVUI 3W1SC 2ZNVB 3ZKJC 4YT0B 2NPTA 4A3PA 4HROA 1SXTA 2EKIA 1IGDA 4KDIC 2NR2A 3VUWA 3E9SA 3GB1A
chains in the Genus database with same CATH topology
5IP4D 5IO9A 2BQQA 2DNFA 1UF0A 5IOIA 5IKCM 1MJDA 5IN7A 1MG4A 1MFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP4 D;  5IO9 A;  2BQQ A;  2DNF A;  1UF0 A;  5IOI A;  5IKC M;  1MJD A;  5IN7 A;  1MG4 A;  1MFW A; 
#chains in the Genus database with same CATH topology
 2KVR A;  5D6J B;  3N20 C;  1H8C A;  1ACC A;  3DVG X;  2KFK A;  1MVK A;  5CHW A;  3NHE B;  3AN1 A;  1JQ4 A;  1SF0 A;  2Z0E B;  2JZP A;  3AM9 A;  4FLH A;  3WIM A;  2XEW A;  2WX0 A;  4MDK E;  4ZOH C;  2WQY B;  3T3N A;  2D3B A;  4EE2 A;  3NJT A;  3ZQ4 A;  3URY A;  4GOC A;  1NDD A;  4F7Z A;  3AE5 B;  3AU4 A;  4L1B A;  2KLG A;  5HKH A;  2KWV B;  1ET6 A;  2G4S A;  3C0R B;  5JZE B;  1WF9 A;  3A33 B;  3ZRF A;  2LGX A;  2LRW A;  3AB5 A;  1HQR D;  1KH0 A;  1UGJ A;  4C7Y A;  2JZ3 B;  2N0S B;  5DPW A;  4C4V B;  2KAJ A;  2CJN A;  2K8B A;  1SE2 A;  2ZNV C;  3T9L A;  2MLB A;  2BYE A;  4XDC A;  2PPH A;  2ICI A;  1YJI A;  1D4B A;  3VRA B;  4NY0 A;  2D3A A;  4KZ0 A;  1WR1 A;  2BYF A;  4EZK A;  3NZS A;  2WXG A;  3AEC B;  5HFY A;  3TUO A;  2K9X A;  2R2O A;  4BFR A;  5EE0 A;  4USA A;  3QWZ B;  1XQQ A;  3PHW B;  4C4V A;  1JWU D;  1UNS A;  1E8X A;  5FKA C;  2L8J A;  3PRE A;  5TR5 A;  4P16 A;  2BBC A;  4XX5 A;  1GPX A;  4ARI A;  4WJQ A;  1WGH A;  2QC8 A;  3UIP B;  1GJZ A;  2N4F A;  2DHZ A;  4MSM B;  3SHQ A;  5G2N A;  2M1M A;  3IT6 B;  4K3B A;  3RUL A;  1WXV A;  2KNB A;  4PT5 A;  2JRI B;  1WJ6 A;  4XGA B;  1SIJ A;  1S3S G;  1WM2 A;  2CHW A;  3EC8 A;  1WYG A;  2VH2 A;  1I4Q A;  2KTF A;  4ZYN A;  2K8H A;  2D3G A;  5KHQ A;  3TMP B;  1WGK A;  2C7N B;  5EE9 A;  2K5P A;  4CYE A;  2AQ2 B;  4EUT A;  4CHK A;  4L2Y A;  2KMM A;  1D5Z C;  2V3S A;  2PE6 B;  2MSE D;  4ACF A;  4NJ7 A;  1VLB A;  3O65 B;  4M02 A;  5FR3 A;  2WWZ A;  4AWJ A;  2EKE C;  3ZNH B;  3IFW B;  2Y5P A;  2WXP A;  3JW0 X;  1HTO A;  3W1Y A;  3ZNZ B;  1PYW D;  4C00 A;  4LCD E;  3E56 A;  3RNC C;  3L17 A;  3HUI A;  3Q69 A;  3KUZ A;  2D3C A;  1QOF A;  2QHO A;  4XWT A;  2J53 A;  5EE1 A;  4OVZ A;  4FA6 A;  2KJ6 A;  2NTS A;  3ZDT A;  4ZYS A;  5IAA C;  4W9F A;  3VR8 B;  1YJJ A;  3LB8 C;  4W9G A;  1ROE A;  1WE6 A;  2PW9 A;  2L0F A;  1F2R C;  1T5X D;  4EZL A;  4XYC A;  1GB4 A;  1V1O A;  4BVU C;  1WJ4 A;  4ZRI A;  1NEK B;  2JF5 A;  1JAL A;  3RCZ A;  3QC8 B;  4TUU A;  5FK9 C;  1E0Z A;  2LUM A;  1VZ6 A;  3KH0 A;  1YQ3 B;  4WWO A;  4NZL B;  4I6P A;  4A3O A;  2K0P A;  5AZF A;  3NOB A;  5DCN A;  5MPO A;  4US8 A;  2CU3 A;  2Z0D B;  1RFK A;  1G6J A;  1WXM A;  3ZJV A;  4FXC A;  1CK1 A;  2KDI A;  2K6Q A;  4BKG A;  4M0W A;  2KKC A;  1K8R B;  3VXW A;  3PHX B;  3IAM 1;  2FCM A;  4S17 A;  2KTR B;  3A1Q A;  2LMC A;  2AQ1 B;  2DYB A;  4MT5 A;  3TCA A;  3X0W A;  3GZN I;  4NNJ B;  1J0G A;  2KX3 A;  1XXG A;  3WAM A;  1D6E C;  4KIK B;  3D32 A;  3EFC A;  4RF0 A;  4DHZ E;  1WXA A;  3Q8E A;  2BF8 B;  3VH4 B;  3NVW A;  5D3I B;  2GB1 A;  3UGB B;  4N59 A;  3AE4 B;  2KZR A;  1UBQ A;  1VZ8 A;  4W9D A;  1CMX B;  3BK2 A;  3I9V 1;  4W9C A;  1RLF A;  2LFI A;  2LJI A;  5TSS A;  2C7M B;  4OZA A;  2ZJD A;  4N58 A;  1I4R A;  1NYQ A;  2N7D A;  4O1N A;  2V1Y A;  5L83 A;  3CST A;  2JU6 X;  2BS3 B;  1T0Q C;  1YIW A;  2KDM A;  3KQ4 A;  2L32 A;  4PS3 A;  4WWM A;  1R4M I;  1P1A A;  1UGM A;  4M8M A;  5LXI B;  2RD0 A;  2RGF A;  2FCS A;  5D3D A;  2BGF A;  3OG5 A;  3AE1 B;  4PYU A;  1E8Y A;  2JRH A;  2UWQ A;  2KYW A;  3U52 E;  2V0G A;  3DHI C;  3ZIM A;  4GGQ A;  3MJ5 A;  1V5O A;  4WQM A;  3Q3F A;  1R7S A;  2CR5 A;  3TIX A;  4RGM A;  4HDQ A;  1ZP0 B;  4FUL A;  1RWS A;  2I38 A;  3DVN U;  3H8H A;  3SDL C;  2JXT A;  2DEN B;  3KUD B;  1TS5 A;  3H9D A;  3ETR A;  4FBJ B;  2JXX A;  3PV1 A;  3BYT B;  3UQB A;  3APD A;  1IYF A;  3HHM A;  3ZTD A;  4LJP B;  5FR6 A;  5HG2 A;  1VZ7 A;  3ENE A;  2HE7 A;  2MBH A;  4HEA 1;  4MH8 A;  3DBL B;  3C19 A;  1ZE3 D;  5JH5 C;  1QOA A;  2LGY A;  3LJ3 A;  1MG8 A;  2RMM A;  4FN2 A;  1QOB A;  1DOY A;  4TQ1 A;  4IDI A;  3IXS A;  4CO7 A;  1VRA B;  4OVV A;  1IUE A;  1V97 A;  5D2M B;  2MBE A;  4MAC A;  2PMV A;  2BT6 A;  2PE9 A;  2BKR B;  1EO6 A;  3I5J C;  4DQO C;  4L23 A;  1NI3 A;  4RH6 A;  1WWT A;  5D94 A;  1I4P A;  2ZW0 A;  2DYM A;  2KC1 A;  2IO3 B;  2M4N A;  3EA6 A;  3FAH A;  3AXC A;  3IHP C;  1F77 A;  4W9E A;  2XN9 C;  1VR9 A;  5E6O A;  2HTM E;  4I6N B;  2BVC A;  2QMT A;  1E9M A;  5L95 C;  4KKJ A;  3Q3N C;  3SD5 A;  1IPG A;  4DXG A;  2KN4 A;  1I4H A;  2DZK A;  3NZU A;  2WDR B;  2LZ6 A;  1PGB A;  4G3X B;  4IWP A;  4BAX A;  5T8I A;  1YJ1 A;  2RPQ A;  4E74 A;  2XBB C;  4AS1 A;  1YOV B;  1MI0 A;  2INN E;  3DOW A;  4KGS A;  4P1C C;  1E5W A;  4MSQ B;  3APC A;  2KWD A;  3IG3 A;  2Z8L A;  2LHE A;  3K9O B;  1SE4 A;  2L0T A;  1ZUD 2;  1XEE A;  2G4D B;  3RNF C;  4A6Q A;  3BWU D;  3ZYY X;  4HKQ A;  2ZW1 A;  4TMA B;  1M94 A;  4ITK A;  4W9I A;  1FNU A;  3DWM A;  1FIQ A;  4YTN B;  4IM0 A;  1V2Y A;  2C7H A;  5IN7 A;  4ICV A;  3A9K A;  1ZDV A;  2RSU A;  2MBO A;  3AV8 A;  2V4L A;  3U2S C;  2KQ4 X;  3L08 A;  4OVU A;  4EFO A;  4TV3 A;  1E8Z A;  2BPS A;  2FAZ A;  1L0X B;  1C1Y B;  3MC9 A;  5JHA A;  2SAK A;  1F1H A;  4HJG E;  1QIL A;  3OLM D;  1LXD A;  1PGX A;  3Q3J A;  2V3P A;  1IBX B;  2DZJ A;  4ZHO A;  3IT4 B;  5GMV A;  3QQ8 B;  3PRM B;  4IW0 A;  4M8N A;  2D5G A;  2AX5 A;  4PS7 A;  1NBF C;  1L6U A;  4K7S A;  5J18 A;  5EE3 A;  1WX9 A;  1FEH A;  3MTN B;  4A8X C;  2O2V B;  3CWI A;  4EKU A;  4A9A A;  2GBM A;  2OOB B;  3M62 B;  4K1R B;  3MC8 A;  4JWU C;  3R7R A;  3TSS A;  2BYV E;  2BQQ A;  2MBB B;  3ZDM C;  1WY8 A;  1YQB A;  3UI3 A;  2CKH B;  1WSP A;  4MEM A;  1XF5 L;  1QF6 A;  3Q8A A;  1YN4 A;  1C4P A;  4P6V F;  3IBE A;  4FAD A;  2WU5 B;  5D7G A;  3PSE B;  2IZV B;  3AEA B;  1L2N A;  2DAJ A;  3OJ3 A;  4IUM B;  2WNM A;  4GIV A;  1OTR B;  4WIP A;  1WI0 A;  2HJ1 A;  1DGJ A;  1VJK A;  3KUC B;  4G0N B;  2LD9 A;  5CHF A;  4RGO S;  1T0Y A;  3AED B;  4WAA A;  3S2A A;  3P42 A;  2PEA A;  4ZRK A;  3P4S B;  5C23 A;  2IO2 B;  1SJE D;  4OZB A;  1VDV A;  1WXS A;  4GU2 A;  1V5T A;  2LGD A;  2KFJ A;  2K22 A;  5IOI A;  3RD2 A;  2WHI A;  2KJH B;  1BML C;  2H88 B;  1FRD A;  4LDT D;  3AE9 B;  3ONS A;  2V3N A;  2KN5 A;  1IBX A;  3W9C B;  2QEJ C;  3A4R A;  3M63 B;  2WXL A;  2OJW A;  3RMK C;  1ET9 A;  2WX1 A;  2B76 B;  1L7Y A;  1UZX B;  3OAW A;  1EWY C;  3N32 A;  1YX5 B;  4HPL B;  1OGW A;  1WH3 A;  5E6J A;  1LFD A;  3NVY A;  3R8B A;  2IY1 B;  1ENF A;  2L1A A;  4KSK C;  2QIE B;  1I7H A;  1KRH A;  1QZE A;  3RUI B;  1WE7 A;  3VUY A;  4MEL A;  2GI9 A;  3NRZ A;  1KLV A;  2WXK A;  3DHH C;  4AQ7 A;  2AYO B;  3QJZ A;  2KOX A;  2JQR B;  1EUV B;  3WAN A;  3I57 A;  2WXQ A;  1I4X A;  3UIN B;  1E7V A;  1LO5 D;  2LRU A;  3B9J A;  5HI1 A;  3A4S C;  3H6N A;  1KLG D;  4NAW A;  1FXA A;  4BKS A;  2IGD A;  2O6V D;  1EWC A;  4IKG A;  3X23 A;  2MP2 B;  3N1X C;  4P7I A;  1HZ6 A;  4IWO A;  4MGY E;  4UDU C;  2IBI B;  1N62 A;  4DWF A;  3VFK A;  4TQ0 A;  4S0R A;  2ZZP B;  3JSV A;  1IP9 A;  1OFF A;  2D07 B;  4B95 A;  2JWU A;  4ASW C;  1MG4 A;  3AE7 B;  1K51 A;  2GBJ A;  4YL8 A;  1QLB B;  2JY6 A;  3A9K B;  4XDD A;  2FCQ A;  4PYZ A;  4WJP A;  3PPA A;  4NAM A;  4PS8 A;  1UUP A;  2FUG 1;  4GDL B;  4D2K A;  3RZW C;  3DHG C;  3EUB 2;  4LNF A;  4WJN A;  4LDT B;  3BII D;  2D11 A;  3KLS X;  3DWG C;  4AJY B;  1XLO A;  3QIJ A;  4K7U A;  3U8Z A;  2INP E;  1WMH B;  3W5V B;  2M17 A;  1KFY B;  1KM7 A;  4AP4 C;  1ZOY B;  2BB5 A;  2MJE A;  3WCQ A;  3DVG Y;  3JVZ X;  4ANW A;  2Y5B B;  2MRP A;  1UD7 A;  4PK1 A;  4IM2 A;  1NI2 A;  1FRR A;  2KVZ A;  4HPP A;  1E7U A;  3L16 A;  4LK0 M;  3ZUN A;  3M95 A;  2NBW B;  1D5M C;  4RF1 A;  1L0Y B;  2K39 A;  2ONQ A;  3RZF A;  1FCL A;  2KX0 A;  2KXJ A;  1JW9 D;  1TJE A;  2MX2 A;  3IAS 1;  2RDG A;  3FIL A;  3QHT A;  1XO3 A;  2UU7 A;  2DX5 B;  3MP9 A;  4K81 A;  3W5U B;  1P98 A;  2Q5W D;  2JWZ A;  1QT9 A;  1ISN A;  3EHV A;  4HDO A;  1EU3 A;  1FXI A;  2NPT B;  2RDH A;  2W9N A;  4WQO B;  2LEK A;  1T0S C;  2LGS A;  1GB1 A;  1J8C A;  4RFB A;  4E71 A;  1TBE A;  2LUE A;  1C78 A;  1GC6 A;  2G9H D;  3ZNG C;  1N61 A;  1TKY A;  2TSS A;  3GE3 C;  4G11 A;  5AUK A;  2WS3 B;  4YXD B;  3TBL D;  4AOF A;  3V61 A;  1ESF A;  2MJ3 A;  4TSS A;  2W3R A;  2KDE B;  1UF0 A;  2IJ0 A;  1TZ1 A;  2L7R A;  1Y56 A;  2Z59 B;  5H92 C;  1IGC A;  2JSV X;  4MH0 E;  1WGR A;  2GLS A;  1GC7 A;  2E6X A;  2WGS A;  2ZEQ A;  1Z5S B;  2RDB C;  3GS2 A;  3HVZ A;  2GBK A;  2J0J A;  1PDX A;  3ZO5 B;  2HDE A;  3N1Y C;  1QKZ A;  2V9H A;  5BMG A;  2IYD B;  1XLP A;  1C3T A;  2QSD A;  1Q1O A;  2IGH A;  3P1M A;  2YEP F;  1XLN A;  3NY5 A;  4WWN A;  1NYR A;  1V9J A;  3B1L X;  2LGI A;  2CU1 A;  4KIK A;  2L05 A;  1V1P B;  2JT4 B;  2NS5 A;  3AEG B;  3DBR B;  3KWV A;  3H7P B;  2PLP A;  4MGZ E;  2N1W A;  1QOG A;  4WH4 A;  3PT2 B;  4G50 A;  1KF6 B;  3H7P A;  1UBI A;  1XT9 B;  3SFE B;  2G45 B;  2KQS A;  1SB3 C;  1WMH A;  3C8Y A;  3M3J A;  3CIR B;  5CHV C;  4B0E A;  1I35 A;  1WIA A;  2AEH A;  1JRO A;  2FIF A;  3CF6 E;  4EEW A;  1TTN A;  3Q3O C;  3J9C A;  2PTL A;  1D5X C;  1S1Q B;  4W9K A;  1ZPS A;  2Y5C A;  3PLU A;  2ZVO A;  3W1S A;  1SSN A;  1F2R I;  2LXA A;  2ZCC A;  2VZK D;  3AI5 A;  3DBS A;  2ZPN A;  3VHT C;  3JYU A;  3U7D A;  2J0M A;  4KKI A;  2WXO A;  5HHD G;  2X38 A;  1ZGU B;  1HTQ A;  1B9R A;  4YSX B;  3KYC D;  4JQW C;  1PFD A;  1D3Z A;  1MJD A;  1HXY D;  3DBH I;  1JWS D;  3ZW3 A;  2IO0 B;  4LLG M;  4ARC A;  3PTF C;  1KLU D;  1YNT E;  3L13 A;  4KV2 A;  2M19 A;  1J7A A;  3PGE A;  3VVW B;  1K53 A;  3LYY A;  2KTR A;  1TY0 A;  3A1Q B;  1EF1 A;  1CQV A;  1I42 A;  2EMS A;  3V62 A;  4RCO A;  4ANU A;  2KAN A;  3VTU A;  2FID A;  4II3 B;  1I4G A;  2JUO A;  4OHJ A;  2LJ5 A;  4YSY B;  2QCZ A;  3B0A A;  3P4Q B;  1Z2M A;  1WFY A;  2KQ7 A;  1GUA B;  2XK5 B;  3KWL A;  4XE0 A;  4WJO A;  1JML A;  1SEB D;  3KVF B;  2PIA A;  2KLC A;  4KX6 B;  3BK1 A;  4DHJ D;  5C3J B;  1FMA D;  3SFD B;  2BB6 A;  3PVL A;  2KMA A;  4NQL B;  2WU2 B;  5G5H A;  2KDF B;  3RNG C;  4HLE A;  1ZW7 A;  3NS1 A;  4FHJ A;  4MJS B;  1C9F A;  4QAY A;  2KO3 A;  3L10 B;  2NMQ A;  2K25 A;  3AE6 B;  3N3K B;  1OQQ A;  1FCC C;  2W54 A;  3QA8 A;  5BO4 B;  2MP2 A;  4BOZ B;  5JHB A;  1FNW A;  2KWC A;  4GLS C;  2VZK B;  1V80 A;  2YVC A;  2PVO D;  5GXG B;  2L83 A;  3WA0 A;  2NCN A;  2IGG A;  1SIF A;  3QAR A;  3NUH B;  2MQJ A;  2XNA C;  3P63 A;  4FJZ A;  1V81 A;  1TKE A;  2ZCB A;  3W2D A;  1KOT A;  1FD6 A;  1C79 A;  2FBW B;  5LNK 1;  2A4Z A;  2M0A A;  5DPR A;  1OQY A;  4KGR A;  2O6V B;  3A9J B;  4YTM B;  3HM6 X;  3AE2 B;  2O6V A;  4M01 A;  1C76 A;  2INC C;  3TEW A;  4FJY A;  3QAQ A;  4FHK A;  4MM3 A;  1Q0W B;  2D2Q A;  4KGT A;  3EGR A;  1TT5 B;  3P4P B;  5E6N A;  3ZVV A;  3WAL A;  4ANV A;  5JXV A;  1P9D U;  1AAR A;  1E8W A;  2W3S A;  2KWU B;  2BWF A;  3OJ4 B;  3BY4 B;  3QCA A;  4JLC A;  4BKS D;  2LVO A;  3MHS D;  3H1U A;  3L4P A;  3EEC A;  1T6B X;  1TS2 A;  2GRI A;  1T3Q A;  1P3Q U;  1ZXH A;  3RFZ B;  4JL9 A;  2E3T A;  4BBN C;  3R2I A;  4RNA A;  1HE8 A;  2VRR B;  4ZHP A;  1UH6 A;  5AZG A;  3L0W B;  4IM3 A;  4RMA A;  1FFV A;  1HEZ E;  2WXJ A;  3AEB B;  4ZRP A;  2KAC A;  1YQ4 B;  3V05 A;  1EM7 A;  4HVB A;  3LDZ E;  3HK0 A;  2PJH A;  2LHD A;  1FM0 D;  4MJS A;  4W9L A;  4DXF A;  1WM3 A;  2BS4 B;  2WXI A;  2FNJ B;  1AWD A;  3VRB B;  1L4Z B;  4DHJ B;  2AL6 A;  3GE8 C;  2DAF A;  2J0K A;  1PQS A;  4LNK A;  3Q3M C;  2NTT A;  3GZN B;  2M56 B;  3QK0 A;  4REZ A;  1N5W A;  2V4I B;  5BYR A;  2KJR A;  4BBN F;  4I6L B;  3VR9 B;  1DOI A;  1ZKH A;  4LTU A;  2YEP B;  1A70 A;  1KJT A;  5BYQ A;  2MW5 A;  2DNF A;  3PZ8 A;  2SEB D;  2N9L A;  1FNV A;  2WP9 B;  1CJE A;  1V8C A;  5IA7 A;  3WAP A;  4M00 A;  2MH7 A;  2WXF A;  3N30 A;  1XD3 B;  1SE9 A;  4ZRQ A;  5AUI A;  1VCB A;  3PZ7 A;  3ZXV A;  4GN1 A;  4LNI A;  2QDF A;  4K3C A;  2OJR A;  3U30 A;  1GG3 A;  2W55 A;  2NBV B;  4A20 A;  3UQA A;  5C2T B;  3PLV A;  5G5G A;  1E90 A;  3AH7 A;  4W9H A;  3ML9 A;  3PRP B;  2KDB A;  1XCT L;  1WJN A;  4HCN B;  4OW0 A;  4K7W A;  2HD5 B;  3QX1 A;  1TZO A;  1JCK B;  1C4C A;  1TIF A;  4WWP A;  3R3M A;  1P7F A;  2CS4 A;  3VAW A;  2IPK D;  2N9X A;  1H4R A;  1WR6 E;  4IWQ A;  3H7S A;  4H2A A;  3DQV A;  1R4N B;  2C9W B;  1Y8R C;  3Q8B A;  2FCN A;  4HWI B;  1P7E A;  2JVC A;  4Q2J A;  1J7C A;  1ZDX A;  1U4A A;  1WGY A;  4GSW A;  2UYZ B;  4DK5 A;  1MFW A;  2J42 A;  1WXQ A;  3RNA C;  2WDV B;  2YLM A;  1UEL A;  3HRD D;  4J6I A;  4JWS C;  4CQN A;  3EFU A;  3ECI A;  4WUR A;  4DBG A;  4HJK A;  4NJC A;  1AN8 A;  2GBR A;  2RPV A;  4J3O D;  1J7B A;  2CHX A;  4URK A;  1T0R C;  5IP4 D;  3AEF B;  2B3A A;  3PO0 A;  3VH3 B;  1OEY A;  2JZZ A;  2C60 A;  3KYD D;  5IKC M;  5AZH A;  2LAS A;  1X1M A;  2K8C A;  3R7Q A;  4ANX A;  4BOS C;  1WX7 A;  2MBQ A;  2NBU A;  3DCG A;  1A5R A;  1V1P A;  3B08 A;  3MJW A;  1KTK A;  3TEY A;  2MA9 B;  2BYT A;  2WXM A;  1SE3 A;  5LXH A;  3Q8F A;  1PUT A;  1FXT B;  2MJD A;  1BXT A;  4ZDV A;  3V6C B;  3RPF C;  1WGG A;  2A5U A;  5CX3 A;  2REX A;  2W82 A;  3RT3 B;  4A90 A;  1WZ3 A;  4YTP B;  3Q6B A;  1TY2 A;  2DLB A;  2MEK A;  2AQ3 B;  5G55 A;  4BKT A;  4JIO U;  1WRI A;  2JX5 A;  3T3O A;  1RYJ A;  1WRD B;  2LI5 A;  4KVG B;  2LWP A;  3NVZ A;  1N5X A;  4GMV A;  1YN3 A;  3BIN A;  4R3D A;  3RI7 C;  1GAQ B;  3OWE B;  3NVV A;  1L4D B;  4HCP B;  3BYY B;  4HXD A;  2LXC A;  2JYE A;  4NQK E;  1F9J A;  2N1V A;  1TKG A;  1LM8 B;  2XK5 A;  4KSL C;  1MHX A;  4LNO A;  4DDG D;  4HRS A;  4B6W A;  1DOX A;  4A55 A;  4XC2 A;  2OHF A;  1STE A;  3RNE C;  5I4D A;  1C4A A;  4MGK E;  3R66 C;  3RN9 C;  3ML8 A;  3AMZ A;  4RGT A;  1UWM A;  3MC0 B;  3ZXR A;  2IO1 B;  1CZP A;  2FE8 A;  2BS2 B;  4WAF A;  1QQR A;  3V3X A;  4AUQ C;  4IG7 B;  4DHZ B;  4GDK A;  2N9E B;  4C56 C;  4MGI E;  2H89 B;  2KHW B;  2DZM A;  3DPD A;  3ZLZ A;  4GDL A;  3PS6 A;  2X8X X;  2BKF A;  4RM9 A;  1NVI D;  2N9K A;  1WX8 A;  4P1B C;  3SU8 X;  1MHH E;  2L52 A;  3RYT A;  1OQR A;  1JWM D;  1K52 A;  1FO4 A;  2DBY A;  1WYW B;  4MM3 B;  5BMI A;  3NZ3 A;  3R2T A;  1EU4 A;  3P2B A;  1M4V A;  3VUX A;  4KDL B;  3ZGZ A;  2DWQ A;  3TEX A;  1K50 A;  2BW2 A;  3VTV A;  3O13 A;  1JRP A;  4XWW A;  4E3C A;  1R4M B;  2K1F A;  4YWG G;  1WJU A;  2ASQ A;  4HK2 A;  1HZ5 A;  4ICU A;  4B9K A;  5BYS A;  4US9 A;  2RR9 A;  2ZVN A;  1N60 A;  2KMC A;  2MCN B;  1GOZ A;  4YSZ B;  4GXB A;  2VH1 A;  3HVD A;  4RGN A;  1YN5 A;  2LVP A;  3V60 A;  2C5L C;  1NEN B;  1J19 A;  2I1J A;  3CMM B;  3DBR I;  4RM8 A;  5KHO A;  4OZC A;  3T8M A;  3ZJT A;  4BZA A;  2G3Q B;  2WLB A;  3UIO B;  2ON8 A;  4AJW A;  5DPS A;  3TJP A;  3K9P B;  1YMH E;  3FIL B;  3GOE A;  2WDQ B;  2J7Q B;  1V86 A;  2N7E A;  1F52 A;  1DYQ A;  2FUH B;  2GBN A;  3DBL I;  3Q2A C;  3B2G A;  1AW7 A;  1SJH D;  2GOW A;  5J17 A;  2J4X A;  1B1Z A;  2I1K A;  4N9F 4;  2CHZ A;  3RNB C;  3HM3 A;  4W9J A;  2IDY A;  3L54 A;  1E10 A;  2M0X A;  2R61 A;  4HKZ E;  4GDK B;  1N6Z A;  1AYF A;  3UF8 A;  1PGA A;  2KT7 A;  1E7P B;  1N63 A;  1RAX A;  3V6E B;  1TS4 A;  3DDC B;  4F1S A;  1FFU A;  1JWB D;  1RM6 C;  4C80 A;  3P4R B;  1C77 A;  1RRB A;  1WZ0 A;  3AUL A;  2L3Z A;  2Y3A A;  3LXF A;  3AE8 B;  4KZC A;  1XLQ A;  1LQB A;  2BTE A;  4ZRJ A;  4DXA B;  1TYG B;  3FC4 A;  2K3U A;  4XZ4 A;  1FPY A;  3AU5 A;  1VD2 A;  3IVF A;  4NPN A;  3CSF A;  3NS8 A;  1F0Z A;  2EMT A;  3DVN V;  1Q5W B;  4LJO B;  3ALB A;  2AL3 A;  1BUI C;  5J2R A;  3PRZ A;  3ZNI D;  3U4E G;  4B0M A;  1P0R A;  3MFG A;  4C7Z A;  3NG0 A;  2ZPY A;  3HIZ A;  4HPM B;  2KK8 A;  1JRU A;  2BWE S;  3ABV B;  3BVG A;  3N9Y C;  3APF A;  3DBH B;  3JSV B;  2KD0 A;  3MHZ A;  5DPT A;  1V49 A;  3WAO A;  3KW5 B;  4JPS A;  3TL5 A;  2HJ8 A;  2HTH A;  2N7J A;  4LNN A;  2PVG C;  2DYO A;  4EOY A;  2GMI C;  4II2 B;  2K6D B;  1UWX A;  1SBB B;  1Q10 A;  2L00 B;  2IY0 B;  3BZD B;  3I63 C;  2N9P C;  1TGZ B;  3I3T B;  2MHJ A;  3BVZ A;  2IND C;  2WXN A;  4JX1 C;  1OEY J;  5EDS A;  1E6E B;  3AE3 B;  4DDI D;  3FKY A;  1BT0 A;  3BVM A;  5AEK B;  4F8C B;  1YX6 B;  3U7Z A;  2M8S A;  2PKO A;  2G1E A;  3Q14 C;  1R4N I;  4N6E B;  5BMH A;  2J52 A;  2D10 A;  2WXR A;  2JYT A;  2WDT B;  3N1Z C;  1RFA A;  5IO9 A;  3ZTC A;  2AWT A;  3ZJU A;  1L6V A;  1GNU A;  2OED A;  2JPH A;  2MWS B;  4M0W B;  3SEB A;  2DZI A;  5E6P A;  3AEE B;  1L0V B;  3SR6 A;  1SGH A;  1EF5 A;  2R2Q A;  3A9J A;  2LVQ A;  2ACZ B;  4NAW B;  1HA5 A;  1YD8 U;  5CTR C;  3TEZ A;  5C1Z A;  2QIL A;  1WGD A;  1MPE A;  2I2Y A;  4IOI E;  2EEL A;  2CJO A;  4TKN A;  4EZJ A;  3ZRC A;  1V6E A;  4IC7 B;  4JGH B;  3VQI A;  1LGR A;  4X57 B;  2KC2 A;  1JWA D;  2QJL A;  4FJV B;  1ZXI A;  3Q8C A;  4GB9 A;  2L76 A;  5LLI A;  3PZD A;  1TS3 A;  3VTW A;  1L5P A;  3GP7 A;  3VDZ A;  2WYQ A;  4NJ6 A;  4JE3 B;  3B2F A;  5H8Y E;  2O2V A;  2KFK B;  2WXH A;  1XCQ L;  2NVU I;  3W1S C;  2ZNV B;  3ZKJ C;  4YT0 B;  2NPT A;  4A3P A;  4HRO A;  1SXT A;  2EKI A;  1IGD A;  4KDI C;  2NR2 A;  3VUW A;  3E9S A;  3GB1 A; 
#chains in the Genus database with same CATH homology
 5IP4 D;  5IO9 A;  2BQQ A;  2DNF A;  1UF0 A;  5IOI A;  5IKC M;  1MJD A;  5IN7 A;  1MG4 A;  1MFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...