3V6EB

Crystal structure of usp2 and a mutant form of ubiquitin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
80
Chain Sequence
GLVPRGSMQIFVNTLSGHITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein
molecule keywords Ubiquitin carboxyl-terminal hydrolase 2
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 80
sequence length 81
ec nomenclature
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v6eB00
2BF8B 3B1LX 3V62A 4RM8A 2KLCA 3ZTDA 1GJZA 2L0TA 3QAQA 4NNJB 2AL6A 4IUMB 2PE9A 4ZDVA 5AEKB 4PS3A 1Q5WB 4IWOA 4MSMB 3L13A 1E8WA 2DHZA 4NPNA 1WI0A 1V9JA 3ZVVA 3U30A 1Z2MA 1OGWA 4M8NA 2KFKA 3M3JA 4DHZB 4LJOB 3OAWA 3AU4A 5LXIB 3DVGY 4DWFA 5L83A 1IYFA 3ECIA 1WJ4A 2CHWA 2Z0DB 4II2B 1Q0WB 2MBHA 2ZCCA 5CX3A 3RT3B 2C9WB 3UIOB 3NHEB 3K9PB 5TR5A 4IM2A 2C7HA 2R2QA 1KM7A 2GOWA 2LD9A 1WM2A 1P0RA 2L0FA 5DCNA 2GBJA 1PQSA 1WXMA 2J0JA 2KNBA 3PHXB 3RZWC 4II3B 3X23A 3VH3B 1BT0A 2J0MA 1WIAA 2EKEC 1WGGA 2N7DA 2RPQA 3A1QB 4GXBA 2J0KA 3TIXA 3L16A 2AL3A 3APFA 4TUUA 4FHKA 4IC7B 4K7UA 2GBKA 3PV1A 2FCMA 5J17A 3VTWA 4EEWA 4DHJD 3JYUA 4ICUA 3A1QA 2KTRB 4HPMB 3TMPB 1WE7A 3VUXA 5E6OA 4B95A 1L7YA 1YD8U 4HDOA 1XD3B 2O2VB 3WIMA 2IO2B 4IWPA 1EO6A 4K1RB 2M8SA 4WJPA 4GDLB 3WA0A 4W9HA 4NJ7A 4ANUA 3DCGA 2KTRA 2NBWB 2MW5A 2G4DB 1WGDA 3UIPB 1J19A 2O2VA 3A4RA 4ANXA 1WXSA 3VFKA 2GBRA 1U4AA 3QA8A 3QQ8B 5JZEB 2UYZB 2KC2A 4W9CA 2GMIC 2KFJA 2LJ5A 3CSFA 1WRDB 3BINA 2RSUA 2L00B 1QZEA 1WX7A 2Z0EB 3L54A 2EMTA 1YQBA 3LJ3A 4GN1A 4HCNB 4KDLB 3SDLC 1LXDA 2FCQA 3DOWA 1Y8RC 3OLMD 4KIKB 2C5LC 2DYOA 2KK8A 3ZNHB 3M63B 4HVBA 4FLHA 1WE6A 1LFDA 2JUOA 2BKFA 2KWUB 1EF5A 2N1VA 4DHZE 4B6WA 4KIKA 4FADA 3KYCD 1WJUA 2UWQA 1LQBA 5IAAC 5CHFA 4WJQA 4WWOA 2G3QB 1WH3A 2LVOA 1UBQA 1TBEA 2IYDB 4ANWA 4K81A 3VQIA 2FCNA 1EUVB 2FIDA 4DHJB 2MBQA 4W9IA 1E8XA 1CMXB 2V3SA 1S1QB 4BKGA 3KUCB 4A20A 4GIVA 4HDQA 4BVUC 2IO0B 3MHSD 4I6PA 2N7EA 3V61A 3ZKJC 3U7DA 3KW5B 1SE9A 4BKSA 2MWSB 4PS7A 4PYUA 1UGMA 3VTVA 4MSQB 3V6EB 3A9KA 4EOYA 2PE6B 3VH4B 2W9NA 3TCAA 2PEAA 1GUAB 4JQWC 5E6NA 3UGBB 2LGYA 2C7NB 4G3XB 5L95C 3A9JB 3N32A 2A5UA 2KHWB 3W1SC 2CU1A 3DBHI 2NPTA 1E7UA 3VTUA 3H7PB 4AWJA 4KSLC 5HKHA 4FJYA 3NOBA 2K8HA 2KTFA 2MLBA 2NCNA 4YL8A 5JHAA 2DZMA 4HJKA 3DDCB 4ZYNA 1Z5SB 2K25A 1HE8A 4DDID 3H7PA 3DBSA 2IO3B 2IY0B 4W9FA 1J0GA 1TGZB 3IHPC 5CHWA 3PVLA 3SU8X 3QX1A 3PRPB 4DBGA 2KN5A 1IPGA 1V6EA 3KH0A 1V80A 5BO4B 2DAJA 3ZRCA 2O6VB 2FNJB 1MG8A 1ISNA 4RM9A 3H6NA 3Q3JA 4FBJB 4W9KA 4GMVA 2KO3A 2FAZA 3HK0A 4G0NB 1WGHA 1WXVA 5AZHA 3BY4B 3UF8A 2CS4A 2O6VA 1NI2A 4GB9A 3AI5A 2K6QA 4E74A 5IA7A 2WX0A 2JT4B 4TKNA 5D7GA 4B9KA 2N1WA 3KUZA 3P2BA 3DPDA 1NBFC 4IM3A 5JH5C 1R4MI 4NAWB 3WAMA 3MTNB 1KOTA 1OEYJ 1P98A 1UZXB 2I1KA 3L0WB 2K8CA 4MJSB 3PHWB 3CF6E 2N4FA 1SGHA 1H4RA 2ZEQA 4MGYE 3IG3A 2JY6A 2M17A 2REXA 4NAWA 3ZO5B 2JXXA 2KMAA 1G6JA 5DPSA 3SHQA 5D94A 3PGEA 4P7IA 2WX1A 4WQOB 4XX5A 2DYMA 2MP2B 1I35A 2A4ZA 2G45B 3RD2A 2KLGA 1WF9A 3QWZB 2J7QB 1GG3A 4DDGD 5JHBA 2LWPA 3DBLI 2KOXA 4OVUA 3QIJA 3A4SC 4AUQC 2LVQA 2MP2A 2DZJA 4G50A 3VUYA 3B0AA 2KDIA 1F9JA 1WMHB 2KC1A 3IFWB 4GDLA 4PYZA 1J8CA 1KLVA 3RCZA 3IVFA 2GBMA 2LRUA 3ML9A 3WAOA 2V1YA 2L8JA 4MGIE 4WWNA 4ZRJA 1EF1A 2DZKA 1D3ZA 2N9XA 4NQKE 1WMHA 2BKRB 1P1AA 2KJHB 3U8ZA 4FA6A 3PZDA 1WX8A 2L3ZA 3KYDD 2XK5B 2KWVB 4KZ0A 1S3SG 2FIFA 3R3MA 1E5WA 4FULA 2YVCA 2NVUI 1RFAA 2RD0A 3KVFB 3NZSA 2YLMA 4FHJA 3PLUA 3UQAA 2MCNB 4GDKB 3R7RA 2N9EB 2LZ6A 3ENEA 4W9EA 2BGFA 2XK5A 2ZCBA 2BWFA 1WY8A 4EZJA 3EC8A 3DQVA 3HHMA 4JIOU 3JVZX 2MSED 4FN2A 1UBIA 4HLEA 3WALA 4GU2A 2LUEA 1V2YA 3ZNGC 2K8BA 4A3PA 4DXAB 4BOZB 4BBNC 1GC7A 1RRBA 4K7SA 4MELA 1V5TA 1ZGUB 2K39A 3NY5A 1XT9B 4F8CB 3DVNU 4A3OA 1NDDA 3M62B 3V60A 1P9DU 2IY1B 2BWES 2HTHA 3ZDTA 3ZIMA 4IM0A 2B3AA 2CHXA 4KV2A 2MA9B 1YX6B 2IO1B 3N3KB 3ONSA 2M0XA 3ALBA 3W1SA 2ZJDA 4KDIC 2MRPA 3HM3A 3APDA 4MGKE 2CKHB 5D2MB 5G55A 3JSVB 3RULA 3VAWA 2HJ8A 3PRMB 4ANVA 3QARA 2KANA 1YIWA 2OOBB 4FJVB 4LDTD 2PPHA 2JVCA 4I6NB 1WFYA 3T9LA 2IZVB 2AYOB 3CMMB 2RR9A 2V4LA 2JZ3B 3HM6X 4IG7B 4ICVA 1JRUA 3JSVA 4TQ1A 3QHTA 4EKUA 1C3TA 1C1YB 2GBNA 2ZNVB 1V81A 2WWZA 3A9JA 3UQBA 4IW0A 3WAPA 2KVRA 3H1UA 2BYFA 1VD2A 2EMSA 2D07B 3Q3FA 5CTRC 4BKTA 1UD7A 2BPSA 2DX5B 2WDTB 5GMVA 4CHKA 3VXWA 4AJWA 2DAFA 4PS8A 5C23A 3ZDMC 4DK5A 2MBBB 3X0WA 3N30A 4XZ4A 4GSWA 1R4NI 2LGDA 3ZRFA 5J2RA 3H7SA 4WJNA 1KJTA 4W9JA 1V5OA 3V6CB 2LGXA 1M94A 2ZNVC 4RMAA 4F7ZA 4JGHB 4KSKC 2NS5A 2KFKB 3AU5A 2KQSA 1AARA 2KD0A 1E90A 2LI5A 5CHVC 2KZRA 2G4SA 3VUWA 4M8MA 2KMCA 3DVNV 3KUDB 3PREA 1H8CA 3PRZA 2MBOA 1OEYA 3T8MA 3MJWA 4GOCA 1LM8B 2LVPA 2L05A 2M1MA 5DPRA 4MDKE 4WJOA 1WGRA 4KZCA 2CHZA 3IBEA 5FR6A 1UELA 1WZ3A 4LDTB 2KX3A 4EZLA 4G11A 5DPTA 2CR5A 2WYQA 5J18A 4AJYB 3C0RB 3M95A 3AXCA 4N9F4 3PTFC 4OVVA 5C1ZA 4M0WB 4TV3A 4MJSA 1E7VA 3HIZA 4EUTA 3RUIB 2VRRB 4GGQA 2M4NA 4E3CA 2KXJA 5LXHA 1A5RA 3DBRI 4MGZE 1WR1A 2I1JA 3ZNID 2JF5A 1WXAA 4LJPB 2JZZA 4W9LA 2D2QA 4FJZA 2D11A 3EFUA 3RYTA 3S2AA 1OQYA 2PJHA 4BOSC 3OJ4B 3QK0A 3WANA 2K1FA 4XC2A 3ZTCA 1WR6E 3OJ3A 3A33B 3DVGX 3B08A 1RAXA 1WM3A 2JWZA 1TTNA 4KVGB 4W9GA 4BKSD 4HCPB 4F1SA 4EFOA 2KDFB 3R66C 3GOEA 3AULA 3VVWB 2FCSA 2K6DB 3PT2B 4MM3A 4BFRA 2KX0A 2Y5BB 4I6LB 1OTRB 4IWQA 2JPHA 2KDBA 2AEHA 4AP4C 1K8RB 3EHVA 3PPAA 4EZKA 2C60A 1WYWB 1X1MA 2D3GA 2KWCA 4MH0E 4WWPA 2MBEA 1V49A 2LXAA 2MQJA 1WZ0A 4HXDA 3RZFA 4CYEA 2LXCA 2DZIA 2OJRA 1E8YA 2ZPYA 4NY0A 5KHOA 2LASA 2KDEB 2XBBC 4ZRKA 2NBUA 4GDKA 3QCAA 2AWTA 2HE7A 3R7QA 1YX5B 4CO7A 4BBNF 3PS6A 1YJ1A 3VDZA 3NZUA 2D10A 4JL9A 3SD5A 1WGYA 1GC6A 2BYVE 3H9DA 3QJZA 3TL5A 5LLIA 2ASQA 1V86A 2Z59B 2ZVNA 1TZ1A 2ZPNA 3QC8B 4LCDE 2MX2A 2QHOA 3K9OB 4J6IA 2KJ6A 3D32A 2XEWA 3VHTC 5G2NA 1XQQA 4NJ6A 5D6JB 4E71A 5DPWA 2DYBA 4HPLB 2BYEA 4ZRIA 3ZUNA 2C7MB 1IP9A 3GZNI 1WX9A 4HWIB 1RLFA 3L17A 3EECA 2KKCA 4W9DA 2KJRA 2O6VD 4HK2A 1UH6A 5E6PA 3ZW3A 4URKA 2RGFA 5KHQA 4WAAA 1VCBA 2DENB 3JW0X 4X57B 2HD5B 2ZZPB 4JLCA 1I42A 3A9KB 2NBVB 3ZNZB 3I3TB 1WJNA 4ASWC 4AOFA 2R2OA 4TQ0A 2JRIB 3ZLZA 1Q1OA 1FXTB 3TBLD 3TJPA 1SIFA 5EDSA 3PSEB 5AZGA 2IBIB 1L2NA 1P3QU 2L7RA 4NQLB 3ML8A 2N9PC 2KQ7A 2JRHA 2FUHB 1GNUA 3W1YA 3UINB 1E8ZA 2NPTB 2NR2A 3CSTA 1WJ6A 1T0YA 1ZW7A 4MEMA 3APCA 2L76A 2ZVOA 3O65B 2LRWA 3L10B 1ZKHA 5AZFA 3LDZE 3L08A 3NS8A 3PLVA 4K7WA
chains in the Genus database with same CATH superfamily
2JZPA 3B1LX 3V62A 3ZTDA 2L0TA 1QOGA 2AL6A 1E8WA 4OZCA 1Z2MA 1OGWA 1AYFA 2HDEA 1FCCC 4OW0A 3Q8CA 3Q14C 2CHWA 2Z0DB 1Q0WB 2PTLA 2C9WB 3NHEB 1MI0A 4IM2A 2IGHA 3FKYA 1KM7A 3N1YC 3AECB 2CU3A 1PQSA 2J0JA 3RZWC 1BT0A 2J0MA 3ZJUA 1HZ5A 4FHKA 5J17A 2FCMA 1PDXA 4DHJD 4ICUA 2AX5A 1IGCA 4HPMB 1WE7A 1F2RI 3E56A 4YTPB 4IWPA 3RNGC 2WS3B 1SSNA 4GDLB 4NJ7A 2I2YA 1FRDA 2NBWB 5IOIA 3Q8BA 1JWBD 1P7FA 3VFKA 2GBRA 3DHIC 1YNTE 2GMIC 5BYRA 1HXYD 3HUIA 1FIQA 2RSUA 1D5XC 1YQBA 1Y8RC 4KIKB 2KK8A 3ZNHB 4FLHA 1SBBB 1LFDA 2K3UA 4DHZE 2PMVA 4KIKA 2UWQA 3I5JC 3BIID 5IAAC 2QEJC 4PT5A 5CHFA 4RH6A 4WWOA 2LVOA 1UBQA 4K81A 1NVID 1EUVB 1XCTL 2MBQA 4BZAA 2V3SA 1S1QB 3W2DA 3KUCB 4RCOA 4HDQA 2IO0B 3MHSD 4RFBA 1CZPA 3V61A 3U7DA 2M56B 4YSYB 3NUHB 1NI3A 3IT6B 2PE6B 2PEAA 1GUAB 4JQWC 5EE0A 1C9FA 3W5UB 4USAA 4G3XB 5L95C 1IBXB 2A5UA 2KHWB 1F77A 2NPTA 3VTUA 3H7PB 5HKHA 2PIAA 2MLBA 1IBXA 3DDCB 2K25A 3P4RB 1WYGA 3H7PA 2IO3B 2IY0B 3AB5A 3IHPC 1XLQA 3SU8X 2INPE 1IPGA 5BO4B 1HA5A 1V80A 3AE9B 2O6VB 1TS3A 1MG8A 1VJKA 4FBJB 2WP9B 1SF0A 4ZYSA 1ESFA 1WGHA 4DQOC 3BY4B 1BUIC 5IA7A 2O6VA 1ZUD2 2Z8LA 4B9KA 1SE4A 4H2AA 1R4MI 4FXCA 3MTNB 1B9RA 4C80A 2H88B 1P98A 4K3BA 3BWUD 3L0WB 2K8CA 3N9YC 3MC0B 3CF6E 3NJTA 1SGHA 1ZP0B 3IG3A 2M17A 1DOYA 5DPSA 2KN4A 5D94A 5HI1A 2WX1A 4XX5A 1M4VA 1V1OA 1WF9A 2J7QB 2QC8A 2K22A 3DBLI 2KOXA 3AEBB 3TEWA 3VUYA 1ZXIA 4MM3B 4A9AA 2KC1A 4PYZA 1I4HA 3NVYA 3DBRB 2V1YA 2L8JA 4MGIE 4WWNA 2GRIA 2N9XA 3PZDA 5C3JB 5BMHA 2KWVB 3KVFB 3CIRB 1SJHD 3PLUA 3R2IA 2BGFA 4NAMA 1HQRD 2BWFA 1WY8A 1KLGD 3AMZA 4JIOU 4WQMA 4QAYA 1T6BX 1V2YA 2K8BA 4K7SA 3N1XC 1GAQB 1KRHA 4P16A 3DVNU 4A3OA 3V60A 1P9DU 4CQNA 2BWES 1V97A 1J7AA 3I63C 4WH4A 3N3KB 2M0XA 5D3DA 3W1SA 4A6QA 2WXKA 2J52A 3BK1A 2MRPA 4MGKE 1FNWA 1MG4A 2HJ8A 2OOBB 4FJVB 2JVCA 1WFYA 2W55A 3CMMB 2RR9A 3GZNB 4P1BC 1I4QA 1V81A 2JWUA 2WWZA 3A9JA 3UQBA 5H8YE 3WAPA 3WCQA 2YEPB 5CTRC 5GMVA 2BPSA 2I38A 3VXWA 3AEAB 4AJWA 2DAFA 1R4NI 4L23A 1KJTA 1D4BA 3W9CB 2KFKB 1L6VA 1AARA 3AE3B 5CHVC 2J4XA 2GLSA 2G4SA 3VUWA 3DVNV 3MJWA 4LNIA 1LM8B 2LVPA 1DYQA 3I57A 4MT5A 4WJOA 2CHZA 3IBEA 3C8YA 1WZ3A 4EZLA 4KKJA 5IP4D 3I9V1 4G11A 4YXDB 5J18A 4AJYB 3U52E 4N9F4 4OVVA 5C1ZA 2QDFA 3Q69A 4GLSC 3B9JA 1YJIA 2FE8A 4FJZA 1XLOA 2XNAC 1OQYA 4BOSC 1AN8A 3QK0A 2WXIA 3DWMA 3OJ3A 1WM3A 4EFOA 3AULA 3PT2B 2BBCA 1OTRB 2AEHA 2INNE 2QILA 2MQJA 3NS1A 4CYEA 2HJ1A 2LXCA 4NY0A 4ZRKA 3QCAA 1TKEA 2AWTA 2HE7A 4A8XC 1SIJA 3SD5A 2D10A 2BYVE 3H9DA 5IKCM 1V86A 2RDBC 1TZ1A 3K9OB 2XEWA 2WQYB 5DPWA 1XQQA 2WHIA 2BYEA 1IP9A 4HWIB 1RLFA 2MH7A 3GS2A 1FM0D 5GXGB 2O6VD 3B2GA 3DHHC 1N61A 4X57B 2JXTA 4LTUA 3AN1A 2NBVB 1WJNA 3ZLZA 1Q1OA 3TJPA 1ZDXA 2QIEB 3PSEB 4OHJA 1XO3A 1E8ZA 4HJGE 1I4RA 1WSPA 2LRWA 3L10B 1N63A 5AZFA 3PLVA 2MJDA 1FXIA 2KLCA 1YN3A 2PE9A 4ZDVA 4PS3A 2NMQA 3BZDB 3M3JA 2PVGC 4LJOB 2JQRB 1JRPA 2V3PA 1VZ7A 5LXIB 1Y56A 1IYFA 4KGRA 2IGGA 4II2B 2MBHA 4O1NA 5TR5A 3RNAC 2R2QA 2GOWA 2LD9A 4ZRQA 3GB1A 1P0RA 2L0FA 2GBJA 1YJJA 3X23A 4M0WA 3P1MA 3TEZA 1WGGA 2N7DA 1JWSD 3A1QB 2J0KA 3L16A 2AL3A 3APFA 4TUUA 4XDDA 4IC7B 3PV1A 4JX1C 3Q2AC 2WXFA 1YOVB 3VTWA 1HZ6A 3JYUA 1JROA 1R4MB 3A1QA 2KT7A 5E6OA 1MHXA 1XD3B 3BVGA 2WXJA 2G4DB 1QKZA 1U4AA 5JZEB 1ZPSA 2W3RA 3DBLB 2Y5PA 3EA6A 2L00B 3H8HA 2WDQB 1QZEA 1WX7A 1SB3C 4HCNB 4KDLB 3SDLC 1JALA 1BMLC 4EE2A 2KDMA 4HVBA 1SJED 2KWUB 4B6WA 5E6JA 2BYTA 4IOIE 2G3QB 1WH3A 1R7SA 4ANWA 2FCNA 3MFGA 1E8XA 3VR8B 3TEXA 1STEA 4A20A 2QJLA 4BVUC 3Q3MC 2FUG1 3ZKJC 1SE9A 4PS7A 2H89B 4DXGA 1MJDA 1C4PA 3A9KA 1LO5D 1WGKA 2L32A 5E6NA 3UGBB 1I7HA 2C7NB 1CK1A 3N32A 3W1SC 3DBHI 1TIFA 3Q8FA 1VZ6A 3AH7A 4AWJA 1C4CA 4KSLC 3NOBA 2NCNA 1E7PB 1OFFA 4DDID 5H92C 1RFKA 1TGZB 1K52A 3ZXVA 2KN5A 3KH0A 3BYYB 2FNJB 3Q3JA 1JWMD 4W9KA 4GMVA 3O13A 1T5XD 3HK0A 2HTME 1T0RC 2CS4A 3AI5A 2WX0A 3P63A 1R4NB 3KUZA 1ENFA 1NBFC 2BQQA 1ACCA 1TY2A 4MGYE 1G6JA 2K0PA 3SHQA 4WQOB 2DYMA 4J3OD 2A4ZA 3RD2A 3QWZB 1GG3A 3AE2B 2LVQA 1MHHE 2DZJA 2V3NA 1ET9A 3IFWB 4GDLA 1J8CA 3P4PB 3RCZA 4L1BA 4ZRJA 1QOAA 4NQKE 4REZA 2BKRB 1P1AA 2KJHB 1WX8A 2L3ZA 3IT4B 2LUMA 2XK5B 3AE4B 1NENB 2LMCA 1S3SG 3R3MA 3N1ZC 3NZSA 1SXTA 3UQAA 3R7RA 2KYWA 2XK5A 1N62A 1F52A 4EZJA 1XCQL 3DQVA 3HHMA 2D5GA 2MJEA 1C78A 2NTSA 1UBIA 2LUEA 4B0EA 4DXAB 4BBNC 1GC7A 1AW7A 2PKOA 4MELA 1V5TA 3NY5A 1XT9B 2OJWA 1E9MA 2WDVB 2IY1B 3ZDTA 2HTHA 3ZIMA 2CHXA 4KV2A 2MA9B 2GI9A 2IO1B 2ZJDA 4KDIC 4JWSC 2BVCA 3TEYA 3HM3A 1DOXA 4ANVA 2KANA 1YIWA 2RMMA 1B1ZA 2AQ2B 2W82A 2IZVB 2AYOB 2V4LA 3HM6X 1JRUA 1C3TA 1XEEA 3QHTA 1FD6A 1C1YB 4P6VF 2ZNVB 2KVRA 2D07B 1UD7A 2DX5B 4PS8A 1XLPA 1I4GA 3X0WA 4LK0M 3N30A 4XZ4A 5J2RA 3L4PA 4WJNA 5EE1A 3V6CB 4M01A 1M94A 4JGHB 4KSKC 2KD0A 1A70A 2XN9C 1E90A 4M8MA 1OEYA 2L05A 1FO4A 4MDKE 1WGRA 5FR6A 1UELA 4LDTB 1PGBA 5HHDG 3T3OA 3PTFC 4TV3A 4BAXA 2VRRB 5LXHA 1A5RA 4MGZE 1WR1A 2I1JA 2EKIA 2JF5A 4HKQA 2JZZA 3RFZB 2N0SB 1TY0A 2LGIA 3OJ4B 2K1FA 1E6EB 2WXGA 3B08A 3MJ5A 2IDYA 1N60A 2INCC 4HCPB 3GOEA 4MM3A 2KX0A 4HEA1 3Q8EA 1J7BA 2X8XX 4AP4C 4XGAB 3BK2A 4EZKA 1UWMA 2KWCA 1X1MA 4MH0E 5HG2A 1PYWD 3TUOA 1EWYC 2WXMA 4HXDA 2NBUA 4NJCA 1IUEA 1YJ1A 1GB1A 1GC6A 3DHGC 3QJZA 3PO0A 5LLIA 2ASQA 2ZVNA 3QC8B 4LCDE 4YTNB 2PVOD 1NYRA 4KKIA 3VHTC 5G2NA 4E71A 5D6JB 2JX5A 3ZUNA 1WX9A 2KKCA 2ZW0A 4W9DA 2KJRA 5KHQA 1QLBB 2LEKA 3EFCA 2ZZPB 3SEBA 4JLCA 4UDUC 1I42A 4S17A 4AOFA 2KVZA 2MJ3A 1SIFA 2IBIB 1P3QU 1LGRA 2L7RA 4NQLB 2KQ7A 2FUHB 2KMMA 1EWCA 1WJ6A 1T0YA 1ZW7A 3RNEC 3O65B 1GPXA 2LJIA 1JWAD 3ZJTA 2BF8B 3N20C 3VRBB 1GJZA 3QAQA 3AEFB 4ZOHC 5I4DA 3RNFC 4IWOA 3L13A 2DHZA 1V9JA 1OQQA 2WNMA 3DBHB 4M8NA 2KFKA 3RN9C 3OAWA 3AU4A 4LNKA 3DVGY 4HPPA 3ECIA 1KF6B 2ZCCA 5CX3A 3RT3B 2X38A 3UIOB 3HVDA 3K9PB 1YQ4B 4RGMA 1IGDA 3PHXB 4II3B 1WIAA 2EKEC 2BB6A 4GXBA 2MHJA 4XDCA 3TIXA 1PGAA 4K7UA 2GBKA 4EEWA 1YN4A 3IXSA 3TMPB 1YD8U 2MEKA 2O2VB 2Y5CA 3WIMA 1QILA 3B2FA 4ANUA 3DCGA 2MW5A 1J19A 2LGSA 2O2VA 3AEGB 1WXSA 3URYA 1KTKA 4ANXA 3QQ8B 1QT9A 2UYZB 2KFJA 3DWGC 2LJ5A 1D5ZC 3BINA 3V3XA 1D6EC 5BYQA 2Z0EB 3LJ3A 1LXDA 2FCQA 2N9KA 3OLMD 2C5LC 2DYOA 3M63B 1WE6A 1EF5A 2N1VA 1ET6A 4FADA 2LFIA 3KYCD 1WJUA 4MACA 3UI3A 4WJQA 1TBEA 1Q10A 2ZW1A 4DHJB 3AV8A 4W9IA 1JQ4A 1N5WA 3Q3NC 4BKGA 4GIVA 4I6PA 1DOIA 2JSVX 2IPKD 3AE1B 4XYCA 4BKSA 1UGMA 3RNBC 2D3BA 4N6EB 3VTVA 4MSQB 3V6EB 1UWXA 3VH4B 5HFYA 1L0VB 1NYQA 2LGYA 1QF6A 5FK9C 3R8BA 1ZE3D 2B76B 1OQRA 1F1HA 2QSDA 4JE3B 1FRRA 2DZMA 4HJKA 5G5HA 4ZYNA 1HE8A 2WXRA 1J0GA 5CHWA 3PVLA 4ITKA 3PRPB 4DBGA 1BXTA 4RGNA 1ZOYB 3CWIA 2DAJA 2ON8A 1E10A 3ZRCA 4RNAA 1ISNA 4RM9A 3IAS1 1WXVA 5AZHA 3UF8A 1ZDVA 4R3DA 4E74A 2JT4B 2R61A 3SFEB 4TKNA 5D7GA 1QOBA 2N1WA 3P2BA 3DPDA 4IM3A 4D2KA 4M00A 5JH5C 1JWUD 4NAWB 2UU7A 1F0ZA 2Y3AA 3R2TA 4K3CA 1DGJA 4M02A 4MJSB 2KAJA 2N4FA 1H4RA 2ZEQA 1NEKB 4NAWA 1WWTA 2KMAA 1SEBD 2FBWB 4JPSA 4P1CC 4P7IA 4HRSA 2MP2B 1I35A 3NVWA 2G45B 1UGJA 5JHBA 1E0ZA 1WXQA 3QIJA 3A4SC 4AUQC 4LNFA 2MP2A 2WXNA 3B0AA 2J42A 1F9JA 3OWEB 3IVFA 4C56C 3ML9A 3ABVB 4MH8A 2DZKA 5T8IA 4FA6A 4IDIA 2WDRB 3SFDB 4C00A 4FULA 2FIFA 3S2AA 1E5WA 2YVCA 2NVUI 1RFAA 2RD0A 2YLMA 4WAFA 2MCNB 1GOZA 4GDKB 2K5PA 2E6XA 3E9SA 4IKGA 3Q3OC 4TSSA 1TS5A 3EC8A 1C76A 1J7CA 1KH0A 3JVZX 4HLEA 3WALA 4A3PA 4BOZB 2WXPA 1CJEA 1RRBA 1ZGUB 4F8CB 3P4SB 1HTOA 3M62B 4IM0A 2L1AA 2B3AA 1V8CA 1WRIA 3ONSA 5IN7A 2CKHB 1FPYA 5D2MB 3JSVB 3RULA 3PRMB 2DNFA 4I6NB 5MPOA 2NTTA 4RF1A 4RGOS 4YTMB 4IG7B 3JSVA 4US8A 4IW0A 1T0QC 4YWGG 5G5GA 2PW9A 3ZXRA 2EMSA 2INDC 4PK1A 3NVZA 2D3CA 4GSWA 2LGDA 3ZRFA 3BVMA 2ICIA 3H7SA 3T3NA 4W9JA 1XLNA 2LGXA 4RMAA 3AU5A 3MC9A 1TS2A 2KQSA 3P4QB 2LI5A 1TKGA 2LHEA 1MPEA 2E3TA 2KZRA 2IGDA 2KMCA 3PRZA 2MBOA 4GOCA 4TMAB 2WXHA 4KZCA 2G1EA 2LHDA 5DPTA 2CR5A 3C0RB 3M95A 3AXCA 2W54A 3HIZA 1XF5L 2M4NA 4E3CA 1FFUA 1L0YB 3EFUA 3RYTA 3HVZA 3MP9A 2BT6A 2PJHA 2WXOA 3WANA 4XC2A 3ZTCA 3A33B 3DVGX 2G9HD 2JWZA 4KVGB 4BKSD 4F1SA 3VVWB 3ZGZA 2K6DB 1VLBA 4I6LB 2KDBA 1K8RB 3LYYA 3PPAA 2C60A 1WYWB 2GB1A 4WWPA 2LXAA 4OZAA 1V1PB 3RZFA 1WZ0A 3U4EG 2ZPYA 2OJRA 1T3QA 2XBBC 1N6ZA 3KQ4A 3PZ7A 1V1PA 2CJOA 1EU4A 3VDZA 4JL9A 1WGYA 2VZKB 3TL5A 2Z59B 1SE2A 2RDHA 1JW9D 2MX2A 4J6IA 3D32A 1F2RC 4HPLB 5TSSA 4ZRIA 5EE3A 4WURA 3EECA 2DBYA 3AE5B 4HK2A 1UH6A 1QQRA 5E6PA 3ZW3A 4URKA 1VCBA 2DENB 3JW0X 3EGRA 1TJEA 3AE6B 2W3SA 1L4ZB 3ZNZB 1RYJA 1N5XA 2R2OA 4TQ0A 5AUIA 1FXTB 2SEBD 1VZ8A 5AZGA 4HROA 1L2NA 3ML8A 2JRHA 1GNUA 2J53A 3W1YA 2NPTB 2NR2A 1C79A 1KFYB 4MEMA 3APCA 1VDVA 2L76A 2D3AA 2ZVOA 4ACFA 1ZKHA 3LDZE 4K7WA 4C7ZA 4RM8A 3V05A 4NNJB 4ZHPA 3AE7B 4IUMB 4DXFA 5AEKB 2KWDA 1Q5WB 3P42A 4MSMB 4C7YA 3MHZA 4NPNA 1WI0A 3ZVVA 3U30A 4YSZB 4LLGM 3NVVA 4DHZB 1RWSA 4DWFA 5L83A 2V0GA 5BMIA 1WJ4A 3KLSX 2C7HA 2BS2B 4YSXB 1PFDA 1WM2A 5DCNA 4XWTA 1WXMA 2KNBA 2ACZB 3VH3B 1TKYA 2SAKA 2RPQA 1L5PA 4AS1A 1UNSA 2WU2B 2KTRB 3VUXA 4B95A 1L7YA 2DLBA 3NZ3A 4HDOA 2BB5A 2IO2B 1EO6A 3ZJVA 4K1RB 2M8SA 2WXLA 4WJPA 1FXAA 3WA0A 4W9HA 5JXVA 1GB4A 2KTRA 3J9CA 1WGDA 3BVZA 3UIPB 1XXGA 3A4RA 3C19A 3VRAB 3QA8A 5D3IB 2KC2A 4W9CA 3KWVA 1JMLA 3ETRA 4A90A 3CSFA 1WRDB 3L54A 1UUPA 3AEEB 2EMTA 4GN1A 3DOWA 2JYEA 3Q8AA 2JUOA 2BKFA 2AQ1B 2L52A 2ONQA 1LQBA 2WXQA 3FILB 2IYDB 3VQIA 5BYSA 2FIDA 2IJ0A 1K51A 1CMXB 5IO9A 3FILA 4B0MA 1MFWA 2PLPA 2N7EA 3KW5B 2MWSB 5BMGA 4PYUA 2WGSA 3Q6BA 2DWQA 1I4PA 4EOYA 2W9NA 3TCAA 1FNVA 4KX6B 1HTQA 5AUKA 1PGXA 1ROEA 3RNCC 3A9JB 2CU1A 1E7UA 2BS3B 4FJYA 2K8HA 2KTFA 4WIPA 5JHAA 4YL8A 1SE3A 2AQ3B 1Z5SB 3DBSA 4W9FA 1K53A 1TZOA 3QX1A 1YMHE 1FNUA 2KACA 1V6EA 4WWMA 3H6NA 4XE0A 2KO3A 3MC8A 2FAZA 4G0NB 1PUTA 4S0RA 3ZYYX 1NI2A 2RPVA 4GB9A 2K6QA 2L83A 1JCKB 3VR9B 2JYTA 2QMTA 1HEZE 3WAMA 1VRAB 1KOTA 1OEYJ 1UZXB 2I1KA 1KLUD 4OVZA 3PHWB 2JY6A 2REXA 3ZO5B 2JXXA 3AEDB 3PGEA 2VZKD 2OEDA 4N59A 4YT0B 1L0XB 2KLGA 4KGSA 2BW2A 3FC4A 4DDGD 2LWPA 4OVUA 4G50A 2WU5B 2KDIA 1C77A 1WMHB 1KLVA 3FAHA 1YN5A 2GBMA 2LRUA 3WAOA 1EF1A 1UF0A 1D3ZA 1RM6C 1WMHA 3U8ZA 4LNNA 2K9XA 2JU6X 3KYDD 4KZ0A 2QCZA 4BFRA 4F7ZA 2RDGA 2V4IB 4FHJA 2N9EB 2LZ6A 1FCLA 3ENEA 4W9EA 5EE9A 2ZCBA 1I4XA 2MSED 4FN2A 1FEHA 1EU3A 4GU2A 3RPFC 3ZNGC 1FMAD 2EELA 3AM9A 4ZRPA 2K39A 2TSSA 4JWUC 3W5VB 4US9A 1NDDA 1T0SC 1QOFA 3GE8C 1YX6B 4RF0A 4NZLB 3ALBA 3U2SC 3APDA 5G55A 3VAWA 3QARA 4LDTD 4RGTA 2PPHA 1TYGB 3T9LA 4ICVA 5C2TB 2JZ3B 4TQ1A 4EKUA 2GBNA 3H1UA 2BYFA 4AQ7A 1VD2A 3Q3FA 4BKTA 4CHKA 2VH2A 2WDTB 5C23A 3ZDMC 4DK5A 2MBBB 1TT5B 2N9LA 3RI7C 2CJNA 1V5OA 5LNK1 2ZNVC 2NS5A 3HRDD 3ZQ4A 1FFVA 4KGTA 2YEPF 4OZBA 3KUDB 5FR3A 3PREA 1H8CA 3PZ8A 3T8MA 5DPRA 2M1MA 3LB8C 1VR9A 3TSSA 1K50A 2KX3A 2M19A 2WYQA 4Q2JA 4M0WB 4MJSA 1E7VA 4EUTA 4LNOA 3RUIB 4GGQA 4ZHOA 2KXJA 3DBRI 3ZNID 4A55A 1WXAA 4LJPB 4W9LA 2D2QA 3IAM1 2D11A 4HKZE 2OHFA 1WR6E 1RAXA 3U7ZA 1TTNA 4W9GA 1L4DB 2KDFB 3R66C 2FCSA 2Y5BB 4XWWA 4IWQA 2JPHA 2V9HA 3EHVA 1P7EA 4ARIA 1ZXHA 2D3GA 2N7JA 3NRZA 2MBEA 1V49A 3KWLA 1D5MC 5FKAC 2DZIA 1E8YA 3BYTB 5KHOA 2LASA 2KDEB 4GDKA 4N58A 3R7QA 1YX5B 4CO7A 3AE8B 3NG0A 4BBNF 3PS6A 1AWDA 3NZUA 2BS4B 2ZPNA 2QHOA 3LXFA 4L2YA 2KJ6A 2WLBA 4NJ6A 1MVKA 2DYBA 3GP7A 3GE3C 2Q5WD 1EM7A 1YQ3B 2C7MB 3RMKC 3GZNI 3L17A 2RGFA 4WAAA 2HD5B 3A9KB 3EUB2 1TS4A 3I3TB 4C4VB 4ASWC 2BTEA 1CQVA 2JRIB 3TBLD 5EDSA 2M0AA 2N9PC 4C4VA 3UINB 2KQ4X 4ARCA 2VH1A 3CSTA 3SR6A 1C4AA 3OG5A 1L6UA 3L08A 3NS8A
chains in the Genus database with same CATH topology
2BF8B 3B1LX 3V62A 4RM8A 2KLCA 3ZTDA 1GJZA 2L0TA 3QAQA 4NNJB 2AL6A 4IUMB 2PE9A 4ZDVA 5AEKB 4PS3A 1Q5WB 4IWOA 4MSMB 3L13A 1E8WA 2DHZA 4NPNA 1WI0A 1V9JA 3ZVVA 3U30A 1Z2MA 1OGWA 4M8NA 2KFKA 3M3JA 4DHZB 4LJOB 3OAWA 3AU4A 5LXIB 3DVGY 4DWFA 5L83A 1IYFA 3ECIA 1WJ4A 2CHWA 2Z0DB 4II2B 1Q0WB 2MBHA 2ZCCA 5CX3A 3RT3B 2C9WB 3UIOB 3NHEB 3K9PB 5TR5A 4IM2A 2C7HA 2R2QA 1KM7A 2GOWA 2LD9A 1WM2A 1P0RA 2L0FA 5DCNA 2GBJA 1PQSA 1WXMA 2J0JA 2KNBA 3PHXB 3RZWC 4II3B 3X23A 3VH3B 1BT0A 2J0MA 1WIAA 2EKEC 1WGGA 2N7DA 2RPQA 3A1QB 4GXBA 2J0KA 3TIXA 3L16A 2AL3A 3APFA 4TUUA 4FHKA 4IC7B 4K7UA 2GBKA 3PV1A 2FCMA 5J17A 3VTWA 4EEWA 4DHJD 3JYUA 4ICUA 3A1QA 2KTRB 4HPMB 3TMPB 1WE7A 3VUXA 5E6OA 4B95A 1L7YA 1YD8U 4HDOA 1XD3B 2O2VB 3WIMA 2IO2B 4IWPA 1EO6A 4K1RB 2M8SA 4WJPA 4GDLB 3WA0A 4W9HA 4NJ7A 4ANUA 3DCGA 2KTRA 2NBWB 2MW5A 2G4DB 1WGDA 3UIPB 1J19A 2O2VA 3A4RA 4ANXA 1WXSA 3VFKA 2GBRA 1U4AA 3QA8A 3QQ8B 5JZEB 2UYZB 2KC2A 4W9CA 2GMIC 2KFJA 2LJ5A 3CSFA 1WRDB 3BINA 2RSUA 2L00B 1QZEA 1WX7A 2Z0EB 3L54A 2EMTA 1YQBA 3LJ3A 4GN1A 4HCNB 4KDLB 3SDLC 1LXDA 2FCQA 3DOWA 1Y8RC 3OLMD 4KIKB 2C5LC 2DYOA 2KK8A 3ZNHB 3M63B 4HVBA 4FLHA 1WE6A 1LFDA 2JUOA 2BKFA 2KWUB 1EF5A 2N1VA 4DHZE 4B6WA 4KIKA 4FADA 3KYCD 1WJUA 2UWQA 1LQBA 5IAAC 5CHFA 4WJQA 4WWOA 2G3QB 1WH3A 2LVOA 1UBQA 1TBEA 2IYDB 4ANWA 4K81A 3VQIA 2FCNA 1EUVB 2FIDA 4DHJB 2MBQA 4W9IA 1E8XA 1CMXB 2V3SA 1S1QB 4BKGA 3KUCB 4A20A 4GIVA 4HDQA 4BVUC 2IO0B 3MHSD 4I6PA 2N7EA 3V61A 3ZKJC 3U7DA 3KW5B 1SE9A 4BKSA 2MWSB 4PS7A 4PYUA 1UGMA 3VTVA 4MSQB 3V6EB 3A9KA 4EOYA 2PE6B 3VH4B 2W9NA 3TCAA 2PEAA 1GUAB 4JQWC 5E6NA 3UGBB 2LGYA 2C7NB 4G3XB 5L95C 3A9JB 3N32A 2A5UA 2KHWB 3W1SC 2CU1A 3DBHI 2NPTA 1E7UA 3VTUA 3H7PB 4AWJA 4KSLC 5HKHA 4FJYA 3NOBA 2K8HA 2KTFA 2MLBA 2NCNA 4YL8A 5JHAA 2DZMA 4HJKA 3DDCB 4ZYNA 1Z5SB 2K25A 1HE8A 4DDID 3H7PA 3DBSA 2IO3B 2IY0B 4W9FA 1J0GA 1TGZB 3IHPC 5CHWA 3PVLA 3SU8X 3QX1A 3PRPB 4DBGA 2KN5A 1IPGA 1V6EA 3KH0A 1V80A 5BO4B 2DAJA 3ZRCA 2O6VB 2FNJB 1MG8A 1ISNA 4RM9A 3H6NA 3Q3JA 4FBJB 4W9KA 4GMVA 2KO3A 2FAZA 3HK0A 4G0NB 1WGHA 1WXVA 5AZHA 3BY4B 3UF8A 2CS4A 2O6VA 1NI2A 4GB9A 3AI5A 2K6QA 4E74A 5IA7A 2WX0A 2JT4B 4TKNA 5D7GA 4B9KA 2N1WA 3KUZA 3P2BA 3DPDA 1NBFC 4IM3A 5JH5C 1R4MI 4NAWB 3WAMA 3MTNB 1KOTA 1OEYJ 1P98A 1UZXB 2I1KA 3L0WB 2K8CA 4MJSB 3PHWB 3CF6E 2N4FA 1SGHA 1H4RA 2ZEQA 4MGYE 3IG3A 2JY6A 2M17A 2REXA 4NAWA 3ZO5B 2JXXA 2KMAA 1G6JA 5DPSA 3SHQA 5D94A 3PGEA 4P7IA 2WX1A 4WQOB 4XX5A 2DYMA 2MP2B 1I35A 2A4ZA 2G45B 3RD2A 2KLGA 1WF9A 3QWZB 2J7QB 1GG3A 4DDGD 5JHBA 2LWPA 3DBLI 2KOXA 4OVUA 3QIJA 3A4SC 4AUQC 2LVQA 2MP2A 2DZJA 4G50A 3VUYA 3B0AA 2KDIA 1F9JA 1WMHB 2KC1A 3IFWB 4GDLA 4PYZA 1J8CA 1KLVA 3RCZA 3IVFA 2GBMA 2LRUA 3ML9A 3WAOA 2V1YA 2L8JA 4MGIE 4WWNA 4ZRJA 1EF1A 2DZKA 1D3ZA 2N9XA 4NQKE 1WMHA 2BKRB 1P1AA 2KJHB 3U8ZA 4FA6A 3PZDA 1WX8A 2L3ZA 3KYDD 2XK5B 2KWVB 4KZ0A 1S3SG 2FIFA 3R3MA 1E5WA 4FULA 2YVCA 2NVUI 1RFAA 2RD0A 3KVFB 3NZSA 2YLMA 4FHJA 3PLUA 3UQAA 2MCNB 4GDKB 3R7RA 2N9EB 2LZ6A 3ENEA 4W9EA 2BGFA 2XK5A 2ZCBA 2BWFA 1WY8A 4EZJA 3EC8A 3DQVA 3HHMA 4JIOU 3JVZX 2MSED 4FN2A 1UBIA 4HLEA 3WALA 4GU2A 2LUEA 1V2YA 3ZNGC 2K8BA 4A3PA 4DXAB 4BOZB 4BBNC 1GC7A 1RRBA 4K7SA 4MELA 1V5TA 1ZGUB 2K39A 3NY5A 1XT9B 4F8CB 3DVNU 4A3OA 1NDDA 3M62B 3V60A 1P9DU 2IY1B 2BWES 2HTHA 3ZDTA 3ZIMA 4IM0A 2B3AA 2CHXA 4KV2A 2MA9B 1YX6B 2IO1B 3N3KB 3ONSA 2M0XA 3ALBA 3W1SA 2ZJDA 4KDIC 2MRPA 3HM3A 3APDA 4MGKE 2CKHB 5D2MB 5G55A 3JSVB 3RULA 3VAWA 2HJ8A 3PRMB 4ANVA 3QARA 2KANA 1YIWA 2OOBB 4FJVB 4LDTD 2PPHA 2JVCA 4I6NB 1WFYA 3T9LA 2IZVB 2AYOB 3CMMB 2RR9A 2V4LA 2JZ3B 3HM6X 4IG7B 4ICVA 1JRUA 3JSVA 4TQ1A 3QHTA 4EKUA 1C3TA 1C1YB 2GBNA 2ZNVB 1V81A 2WWZA 3A9JA 3UQBA 4IW0A 3WAPA 2KVRA 3H1UA 2BYFA 1VD2A 2EMSA 2D07B 3Q3FA 5CTRC 4BKTA 1UD7A 2BPSA 2DX5B 2WDTB 5GMVA 4CHKA 3VXWA 4AJWA 2DAFA 4PS8A 5C23A 3ZDMC 4DK5A 2MBBB 3X0WA 3N30A 4XZ4A 4GSWA 1R4NI 2LGDA 3ZRFA 5J2RA 3H7SA 4WJNA 1KJTA 4W9JA 1V5OA 3V6CB 2LGXA 1M94A 2ZNVC 4RMAA 4F7ZA 4JGHB 4KSKC 2NS5A 2KFKB 3AU5A 2KQSA 1AARA 2KD0A 1E90A 2LI5A 5CHVC 2KZRA 2G4SA 3VUWA 4M8MA 2KMCA 3DVNV 3KUDB 3PREA 1H8CA 3PRZA 2MBOA 1OEYA 3T8MA 3MJWA 4GOCA 1LM8B 2LVPA 2L05A 2M1MA 5DPRA 4MDKE 4WJOA 1WGRA 4KZCA 2CHZA 3IBEA 5FR6A 1UELA 1WZ3A 4LDTB 2KX3A 4EZLA 4G11A 5DPTA 2CR5A 2WYQA 5J18A 4AJYB 3C0RB 3M95A 3AXCA 4N9F4 3PTFC 4OVVA 5C1ZA 4M0WB 4TV3A 4MJSA 1E7VA 3HIZA 4EUTA 3RUIB 2VRRB 4GGQA 2M4NA 4E3CA 2KXJA 5LXHA 1A5RA 3DBRI 4MGZE 1WR1A 2I1JA 3ZNID 2JF5A 1WXAA 4LJPB 2JZZA 4W9LA 2D2QA 4FJZA 2D11A 3EFUA 3RYTA 3S2AA 1OQYA 2PJHA 4BOSC 3OJ4B 3QK0A 3WANA 2K1FA 4XC2A 3ZTCA 1WR6E 3OJ3A 3A33B 3DVGX 3B08A 1RAXA 1WM3A 2JWZA 1TTNA 4KVGB 4W9GA 4BKSD 4HCPB 4F1SA 4EFOA 2KDFB 3R66C 3GOEA 3AULA 3VVWB 2FCSA 2K6DB 3PT2B 4MM3A 4BFRA 2KX0A 2Y5BB 4I6LB 1OTRB 4IWQA 2JPHA 2KDBA 2AEHA 4AP4C 1K8RB 3EHVA 3PPAA 4EZKA 2C60A 1WYWB 1X1MA 2D3GA 2KWCA 4MH0E 4WWPA 2MBEA 1V49A 2LXAA 2MQJA 1WZ0A 4HXDA 3RZFA 4CYEA 2LXCA 2DZIA 2OJRA 1E8YA 2ZPYA 4NY0A 5KHOA 2LASA 2KDEB 2XBBC 4ZRKA 2NBUA 4GDKA 3QCAA 2AWTA 2HE7A 3R7QA 1YX5B 4CO7A 4BBNF 3PS6A 1YJ1A 3VDZA 3NZUA 2D10A 4JL9A 3SD5A 1WGYA 1GC6A 2BYVE 3H9DA 3QJZA 3TL5A 5LLIA 2ASQA 1V86A 2Z59B 2ZVNA 1TZ1A 2ZPNA 3QC8B 4LCDE 2MX2A 2QHOA 3K9OB 4J6IA 2KJ6A 3D32A 2XEWA 3VHTC 5G2NA 1XQQA 4NJ6A 5D6JB 4E71A 5DPWA 2DYBA 4HPLB 2BYEA 4ZRIA 3ZUNA 2C7MB 1IP9A 3GZNI 1WX9A 4HWIB 1RLFA 3L17A 3EECA 2KKCA 4W9DA 2KJRA 2O6VD 4HK2A 1UH6A 5E6PA 3ZW3A 4URKA 2RGFA 5KHQA 4WAAA 1VCBA 2DENB 3JW0X 4X57B 2HD5B 2ZZPB 4JLCA 1I42A 3A9KB 2NBVB 3ZNZB 3I3TB 1WJNA 4ASWC 4AOFA 2R2OA 4TQ0A 2JRIB 3ZLZA 1Q1OA 1FXTB 3TBLD 3TJPA 1SIFA 5EDSA 3PSEB 5AZGA 2IBIB 1L2NA 1P3QU 2L7RA 4NQLB 3ML8A 2N9PC 2KQ7A 2JRHA 2FUHB 1GNUA 3W1YA 3UINB 1E8ZA 2NPTB 2NR2A 3CSTA 1WJ6A 1T0YA 1ZW7A 4MEMA 3APCA 2L76A 2ZVOA 3O65B 2LRWA 3L10B 1ZKHA 5AZFA 3LDZE 3L08A 3NS8A 3PLVA 4K7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF8 B;  3B1L X;  3V62 A;  4RM8 A;  2KLC A;  3ZTD A;  1GJZ A;  2L0T A;  3QAQ A;  4NNJ B;  2AL6 A;  4IUM B;  2PE9 A;  4ZDV A;  5AEK B;  4PS3 A;  1Q5W B;  4IWO A;  4MSM B;  3L13 A;  1E8W A;  2DHZ A;  4NPN A;  1WI0 A;  1V9J A;  3ZVV A;  3U30 A;  1Z2M A;  1OGW A;  4M8N A;  2KFK A;  3M3J A;  4DHZ B;  4LJO B;  3OAW A;  3AU4 A;  5LXI B;  3DVG Y;  4DWF A;  5L83 A;  1IYF A;  3ECI A;  1WJ4 A;  2CHW A;  2Z0D B;  4II2 B;  1Q0W B;  2MBH A;  2ZCC A;  5CX3 A;  3RT3 B;  2C9W B;  3UIO B;  3NHE B;  3K9P B;  5TR5 A;  4IM2 A;  2C7H A;  2R2Q A;  1KM7 A;  2GOW A;  2LD9 A;  1WM2 A;  1P0R A;  2L0F A;  5DCN A;  2GBJ A;  1PQS A;  1WXM A;  2J0J A;  2KNB A;  3PHX B;  3RZW C;  4II3 B;  3X23 A;  3VH3 B;  1BT0 A;  2J0M A;  1WIA A;  2EKE C;  1WGG A;  2N7D A;  2RPQ A;  3A1Q B;  4GXB A;  2J0K A;  3TIX A;  3L16 A;  2AL3 A;  3APF A;  4TUU A;  4FHK A;  4IC7 B;  4K7U A;  2GBK A;  3PV1 A;  2FCM A;  5J17 A;  3VTW A;  4EEW A;  4DHJ D;  3JYU A;  4ICU A;  3A1Q A;  2KTR B;  4HPM B;  3TMP B;  1WE7 A;  3VUX A;  5E6O A;  4B95 A;  1L7Y A;  1YD8 U;  4HDO A;  1XD3 B;  2O2V B;  3WIM A;  2IO2 B;  4IWP A;  1EO6 A;  4K1R B;  2M8S A;  4WJP A;  4GDL B;  3WA0 A;  4W9H A;  4NJ7 A;  4ANU A;  3DCG A;  2KTR A;  2NBW B;  2MW5 A;  2G4D B;  1WGD A;  3UIP B;  1J19 A;  2O2V A;  3A4R A;  4ANX A;  1WXS A;  3VFK A;  2GBR A;  1U4A A;  3QA8 A;  3QQ8 B;  5JZE B;  2UYZ B;  2KC2 A;  4W9C A;  2GMI C;  2KFJ A;  2LJ5 A;  3CSF A;  1WRD B;  3BIN A;  2RSU A;  2L00 B;  1QZE A;  1WX7 A;  2Z0E B;  3L54 A;  2EMT A;  1YQB A;  3LJ3 A;  4GN1 A;  4HCN B;  4KDL B;  3SDL C;  1LXD A;  2FCQ A;  3DOW A;  1Y8R C;  3OLM D;  4KIK B;  2C5L C;  2DYO A;  2KK8 A;  3ZNH B;  3M63 B;  4HVB A;  4FLH A;  1WE6 A;  1LFD A;  2JUO A;  2BKF A;  2KWU B;  1EF5 A;  2N1V A;  4DHZ E;  4B6W A;  4KIK A;  4FAD A;  3KYC D;  1WJU A;  2UWQ A;  1LQB A;  5IAA C;  5CHF A;  4WJQ A;  4WWO A;  2G3Q B;  1WH3 A;  2LVO A;  1UBQ A;  1TBE A;  2IYD B;  4ANW A;  4K81 A;  3VQI A;  2FCN A;  1EUV B;  2FID A;  4DHJ B;  2MBQ A;  4W9I A;  1E8X A;  1CMX B;  2V3S A;  1S1Q B;  4BKG A;  3KUC B;  4A20 A;  4GIV A;  4HDQ A;  4BVU C;  2IO0 B;  3MHS D;  4I6P A;  2N7E A;  3V61 A;  3ZKJ C;  3U7D A;  3KW5 B;  1SE9 A;  4BKS A;  2MWS B;  4PS7 A;  4PYU A;  1UGM A;  3VTV A;  4MSQ B;  3V6E B;  3A9K A;  4EOY A;  2PE6 B;  3VH4 B;  2W9N A;  3TCA A;  2PEA A;  1GUA B;  4JQW C;  5E6N A;  3UGB B;  2LGY A;  2C7N B;  4G3X B;  5L95 C;  3A9J B;  3N32 A;  2A5U A;  2KHW B;  3W1S C;  2CU1 A;  3DBH I;  2NPT A;  1E7U A;  3VTU A;  3H7P B;  4AWJ A;  4KSL C;  5HKH A;  4FJY A;  3NOB A;  2K8H A;  2KTF A;  2MLB A;  2NCN A;  4YL8 A;  5JHA A;  2DZM A;  4HJK A;  3DDC B;  4ZYN A;  1Z5S B;  2K25 A;  1HE8 A;  4DDI D;  3H7P A;  3DBS A;  2IO3 B;  2IY0 B;  4W9F A;  1J0G A;  1TGZ B;  3IHP C;  5CHW A;  3PVL A;  3SU8 X;  3QX1 A;  3PRP B;  4DBG A;  2KN5 A;  1IPG A;  1V6E A;  3KH0 A;  1V80 A;  5BO4 B;  2DAJ A;  3ZRC A;  2O6V B;  2FNJ B;  1MG8 A;  1ISN A;  4RM9 A;  3H6N A;  3Q3J A;  4FBJ B;  4W9K A;  4GMV A;  2KO3 A;  2FAZ A;  3HK0 A;  4G0N B;  1WGH A;  1WXV A;  5AZH A;  3BY4 B;  3UF8 A;  2CS4 A;  2O6V A;  1NI2 A;  4GB9 A;  3AI5 A;  2K6Q A;  4E74 A;  5IA7 A;  2WX0 A;  2JT4 B;  4TKN A;  5D7G A;  4B9K A;  2N1W A;  3KUZ A;  3P2B A;  3DPD A;  1NBF C;  4IM3 A;  5JH5 C;  1R4M I;  4NAW B;  3WAM A;  3MTN B;  1KOT A;  1OEY J;  1P98 A;  1UZX B;  2I1K A;  3L0W B;  2K8C A;  4MJS B;  3PHW B;  3CF6 E;  2N4F A;  1SGH A;  1H4R A;  2ZEQ A;  4MGY E;  3IG3 A;  2JY6 A;  2M17 A;  2REX A;  4NAW A;  3ZO5 B;  2JXX A;  2KMA A;  1G6J A;  5DPS A;  3SHQ A;  5D94 A;  3PGE A;  4P7I A;  2WX1 A;  4WQO B;  4XX5 A;  2DYM A;  2MP2 B;  1I35 A;  2A4Z A;  2G45 B;  3RD2 A;  2KLG A;  1WF9 A;  3QWZ B;  2J7Q B;  1GG3 A;  4DDG D;  5JHB A;  2LWP A;  3DBL I;  2KOX A;  4OVU A;  3QIJ A;  3A4S C;  4AUQ C;  2LVQ A;  2MP2 A;  2DZJ A;  4G50 A;  3VUY A;  3B0A A;  2KDI A;  1F9J A;  1WMH B;  2KC1 A;  3IFW B;  4GDL A;  4PYZ A;  1J8C A;  1KLV A;  3RCZ A;  3IVF A;  2GBM A;  2LRU A;  3ML9 A;  3WAO A;  2V1Y A;  2L8J A;  4MGI E;  4WWN A;  4ZRJ A;  1EF1 A;  2DZK A;  1D3Z A;  2N9X A;  4NQK E;  1WMH A;  2BKR B;  1P1A A;  2KJH B;  3U8Z A;  4FA6 A;  3PZD A;  1WX8 A;  2L3Z A;  3KYD D;  2XK5 B;  2KWV B;  4KZ0 A;  1S3S G;  2FIF A;  3R3M A;  1E5W A;  4FUL A;  2YVC A;  2NVU I;  1RFA A;  2RD0 A;  3KVF B;  3NZS A;  2YLM A;  4FHJ A;  3PLU A;  3UQA A;  2MCN B;  4GDK B;  3R7R A;  2N9E B;  2LZ6 A;  3ENE A;  4W9E A;  2BGF A;  2XK5 A;  2ZCB A;  2BWF A;  1WY8 A;  4EZJ A;  3EC8 A;  3DQV A;  3HHM A;  4JIO U;  3JVZ X;  2MSE D;  4FN2 A;  1UBI A;  4HLE A;  3WAL A;  4GU2 A;  2LUE A;  1V2Y A;  3ZNG C;  2K8B A;  4A3P A;  4DXA B;  4BOZ B;  4BBN C;  1GC7 A;  1RRB A;  4K7S A;  4MEL A;  1V5T A;  1ZGU B;  2K39 A;  3NY5 A;  1XT9 B;  4F8C B;  3DVN U;  4A3O A;  1NDD A;  3M62 B;  3V60 A;  1P9D U;  2IY1 B;  2BWE S;  2HTH A;  3ZDT A;  3ZIM A;  4IM0 A;  2B3A A;  2CHX A;  4KV2 A;  2MA9 B;  1YX6 B;  2IO1 B;  3N3K B;  3ONS A;  2M0X A;  3ALB A;  3W1S A;  2ZJD A;  4KDI C;  2MRP A;  3HM3 A;  3APD A;  4MGK E;  2CKH B;  5D2M B;  5G55 A;  3JSV B;  3RUL A;  3VAW A;  2HJ8 A;  3PRM B;  4ANV A;  3QAR A;  2KAN A;  1YIW A;  2OOB B;  4FJV B;  4LDT D;  2PPH A;  2JVC A;  4I6N B;  1WFY A;  3T9L A;  2IZV B;  2AYO B;  3CMM B;  2RR9 A;  2V4L A;  2JZ3 B;  3HM6 X;  4IG7 B;  4ICV A;  1JRU A;  3JSV A;  4TQ1 A;  3QHT A;  4EKU A;  1C3T A;  1C1Y B;  2GBN A;  2ZNV B;  1V81 A;  2WWZ A;  3A9J A;  3UQB A;  4IW0 A;  3WAP A;  2KVR A;  3H1U A;  2BYF A;  1VD2 A;  2EMS A;  2D07 B;  3Q3F A;  5CTR C;  4BKT A;  1UD7 A;  2BPS A;  2DX5 B;  2WDT B;  5GMV A;  4CHK A;  3VXW A;  4AJW A;  2DAF A;  4PS8 A;  5C23 A;  3ZDM C;  4DK5 A;  2MBB B;  3X0W A;  3N30 A;  4XZ4 A;  4GSW A;  1R4N I;  2LGD A;  3ZRF A;  5J2R A;  3H7S A;  4WJN A;  1KJT A;  4W9J A;  1V5O A;  3V6C B;  2LGX A;  1M94 A;  2ZNV C;  4RMA A;  4F7Z A;  4JGH B;  4KSK C;  2NS5 A;  2KFK B;  3AU5 A;  2KQS A;  1AAR A;  2KD0 A;  1E90 A;  2LI5 A;  5CHV C;  2KZR A;  2G4S A;  3VUW A;  4M8M A;  2KMC A;  3DVN V;  3KUD B;  3PRE A;  1H8C A;  3PRZ A;  2MBO A;  1OEY A;  3T8M A;  3MJW A;  4GOC A;  1LM8 B;  2LVP A;  2L05 A;  2M1M A;  5DPR A;  4MDK E;  4WJO A;  1WGR A;  4KZC A;  2CHZ A;  3IBE A;  5FR6 A;  1UEL A;  1WZ3 A;  4LDT B;  2KX3 A;  4EZL A;  4G11 A;  5DPT A;  2CR5 A;  2WYQ A;  5J18 A;  4AJY B;  3C0R B;  3M95 A;  3AXC A;  4N9F 4;  3PTF C;  4OVV A;  5C1Z A;  4M0W B;  4TV3 A;  4MJS A;  1E7V A;  3HIZ A;  4EUT A;  3RUI B;  2VRR B;  4GGQ A;  2M4N A;  4E3C A;  2KXJ A;  5LXH A;  1A5R A;  3DBR I;  4MGZ E;  1WR1 A;  2I1J A;  3ZNI D;  2JF5 A;  1WXA A;  4LJP B;  2JZZ A;  4W9L A;  2D2Q A;  4FJZ A;  2D11 A;  3EFU A;  3RYT A;  3S2A A;  1OQY A;  2PJH A;  4BOS C;  3OJ4 B;  3QK0 A;  3WAN A;  2K1F A;  4XC2 A;  3ZTC A;  1WR6 E;  3OJ3 A;  3A33 B;  3DVG X;  3B08 A;  1RAX A;  1WM3 A;  2JWZ A;  1TTN A;  4KVG B;  4W9G A;  4BKS D;  4HCP B;  4F1S A;  4EFO A;  2KDF B;  3R66 C;  3GOE A;  3AUL A;  3VVW B;  2FCS A;  2K6D B;  3PT2 B;  4MM3 A;  4BFR A;  2KX0 A;  2Y5B B;  4I6L B;  1OTR B;  4IWQ A;  2JPH A;  2KDB A;  2AEH A;  4AP4 C;  1K8R B;  3EHV A;  3PPA A;  4EZK A;  2C60 A;  1WYW B;  1X1M A;  2D3G A;  2KWC A;  4MH0 E;  4WWP A;  2MBE A;  1V49 A;  2LXA A;  2MQJ A;  1WZ0 A;  4HXD A;  3RZF A;  4CYE A;  2LXC A;  2DZI A;  2OJR A;  1E8Y A;  2ZPY A;  4NY0 A;  5KHO A;  2LAS A;  2KDE B;  2XBB C;  4ZRK A;  2NBU A;  4GDK A;  3QCA A;  2AWT A;  2HE7 A;  3R7Q A;  1YX5 B;  4CO7 A;  4BBN F;  3PS6 A;  1YJ1 A;  3VDZ A;  3NZU A;  2D10 A;  4JL9 A;  3SD5 A;  1WGY A;  1GC6 A;  2BYV E;  3H9D A;  3QJZ A;  3TL5 A;  5LLI A;  2ASQ A;  1V86 A;  2Z59 B;  2ZVN A;  1TZ1 A;  2ZPN A;  3QC8 B;  4LCD E;  2MX2 A;  2QHO A;  3K9O B;  4J6I A;  2KJ6 A;  3D32 A;  2XEW A;  3VHT C;  5G2N A;  1XQQ A;  4NJ6 A;  5D6J B;  4E71 A;  5DPW A;  2DYB A;  4HPL B;  2BYE A;  4ZRI A;  3ZUN A;  2C7M B;  1IP9 A;  3GZN I;  1WX9 A;  4HWI B;  1RLF A;  3L17 A;  3EEC A;  2KKC A;  4W9D A;  2KJR A;  2O6V D;  4HK2 A;  1UH6 A;  5E6P A;  3ZW3 A;  4URK A;  2RGF A;  5KHQ A;  4WAA A;  1VCB A;  2DEN B;  3JW0 X;  4X57 B;  2HD5 B;  2ZZP B;  4JLC A;  1I42 A;  3A9K B;  2NBV B;  3ZNZ B;  3I3T B;  1WJN A;  4ASW C;  4AOF A;  2R2O A;  4TQ0 A;  2JRI B;  3ZLZ A;  1Q1O A;  1FXT B;  3TBL D;  3TJP A;  1SIF A;  5EDS A;  3PSE B;  5AZG A;  2IBI B;  1L2N A;  1P3Q U;  2L7R A;  4NQL B;  3ML8 A;  2N9P C;  2KQ7 A;  2JRH A;  2FUH B;  1GNU A;  3W1Y A;  3UIN B;  1E8Z A;  2NPT B;  2NR2 A;  3CST A;  1WJ6 A;  1T0Y A;  1ZW7 A;  4MEM A;  3APC A;  2L76 A;  2ZVO A;  3O65 B;  2LRW A;  3L10 B;  1ZKH A;  5AZF A;  3LDZ E;  3L08 A;  3NS8 A;  3PLV A;  4K7W A; 
#chains in the Genus database with same CATH topology
 2JZP A;  3B1L X;  3V62 A;  3ZTD A;  2L0T A;  1QOG A;  2AL6 A;  1E8W A;  4OZC A;  1Z2M A;  1OGW A;  1AYF A;  2HDE A;  1FCC C;  4OW0 A;  3Q8C A;  3Q14 C;  2CHW A;  2Z0D B;  1Q0W B;  2PTL A;  2C9W B;  3NHE B;  1MI0 A;  4IM2 A;  2IGH A;  3FKY A;  1KM7 A;  3N1Y C;  3AEC B;  2CU3 A;  1PQS A;  2J0J A;  3RZW C;  1BT0 A;  2J0M A;  3ZJU A;  1HZ5 A;  4FHK A;  5J17 A;  2FCM A;  1PDX A;  4DHJ D;  4ICU A;  2AX5 A;  1IGC A;  4HPM B;  1WE7 A;  1F2R I;  3E56 A;  4YTP B;  4IWP A;  3RNG C;  2WS3 B;  1SSN A;  4GDL B;  4NJ7 A;  2I2Y A;  1FRD A;  2NBW B;  5IOI A;  3Q8B A;  1JWB D;  1P7F A;  3VFK A;  2GBR A;  3DHI C;  1YNT E;  2GMI C;  5BYR A;  1HXY D;  3HUI A;  1FIQ A;  2RSU A;  1D5X C;  1YQB A;  1Y8R C;  4KIK B;  2KK8 A;  3ZNH B;  4FLH A;  1SBB B;  1LFD A;  2K3U A;  4DHZ E;  2PMV A;  4KIK A;  2UWQ A;  3I5J C;  3BII D;  5IAA C;  2QEJ C;  4PT5 A;  5CHF A;  4RH6 A;  4WWO A;  2LVO A;  1UBQ A;  4K81 A;  1NVI D;  1EUV B;  1XCT L;  2MBQ A;  4BZA A;  2V3S A;  1S1Q B;  3W2D A;  3KUC B;  4RCO A;  4HDQ A;  2IO0 B;  3MHS D;  4RFB A;  1CZP A;  3V61 A;  3U7D A;  2M56 B;  4YSY B;  3NUH B;  1NI3 A;  3IT6 B;  2PE6 B;  2PEA A;  1GUA B;  4JQW C;  5EE0 A;  1C9F A;  3W5U B;  4USA A;  4G3X B;  5L95 C;  1IBX B;  2A5U A;  2KHW B;  1F77 A;  2NPT A;  3VTU A;  3H7P B;  5HKH A;  2PIA A;  2MLB A;  1IBX A;  3DDC B;  2K25 A;  3P4R B;  1WYG A;  3H7P A;  2IO3 B;  2IY0 B;  3AB5 A;  3IHP C;  1XLQ A;  3SU8 X;  2INP E;  1IPG A;  5BO4 B;  1HA5 A;  1V80 A;  3AE9 B;  2O6V B;  1TS3 A;  1MG8 A;  1VJK A;  4FBJ B;  2WP9 B;  1SF0 A;  4ZYS A;  1ESF A;  1WGH A;  4DQO C;  3BY4 B;  1BUI C;  5IA7 A;  2O6V A;  1ZUD 2;  2Z8L A;  4B9K A;  1SE4 A;  4H2A A;  1R4M I;  4FXC A;  3MTN B;  1B9R A;  4C80 A;  2H88 B;  1P98 A;  4K3B A;  3BWU D;  3L0W B;  2K8C A;  3N9Y C;  3MC0 B;  3CF6 E;  3NJT A;  1SGH A;  1ZP0 B;  3IG3 A;  2M17 A;  1DOY A;  5DPS A;  2KN4 A;  5D94 A;  5HI1 A;  2WX1 A;  4XX5 A;  1M4V A;  1V1O A;  1WF9 A;  2J7Q B;  2QC8 A;  2K22 A;  3DBL I;  2KOX A;  3AEB B;  3TEW A;  3VUY A;  1ZXI A;  4MM3 B;  4A9A A;  2KC1 A;  4PYZ A;  1I4H A;  3NVY A;  3DBR B;  2V1Y A;  2L8J A;  4MGI E;  4WWN A;  2GRI A;  2N9X A;  3PZD A;  5C3J B;  5BMH A;  2KWV B;  3KVF B;  3CIR B;  1SJH D;  3PLU A;  3R2I A;  2BGF A;  4NAM A;  1HQR D;  2BWF A;  1WY8 A;  1KLG D;  3AMZ A;  4JIO U;  4WQM A;  4QAY A;  1T6B X;  1V2Y A;  2K8B A;  4K7S A;  3N1X C;  1GAQ B;  1KRH A;  4P16 A;  3DVN U;  4A3O A;  3V60 A;  1P9D U;  4CQN A;  2BWE S;  1V97 A;  1J7A A;  3I63 C;  4WH4 A;  3N3K B;  2M0X A;  5D3D A;  3W1S A;  4A6Q A;  2WXK A;  2J52 A;  3BK1 A;  2MRP A;  4MGK E;  1FNW A;  1MG4 A;  2HJ8 A;  2OOB B;  4FJV B;  2JVC A;  1WFY A;  2W55 A;  3CMM B;  2RR9 A;  3GZN B;  4P1B C;  1I4Q A;  1V81 A;  2JWU A;  2WWZ A;  3A9J A;  3UQB A;  5H8Y E;  3WAP A;  3WCQ A;  2YEP B;  5CTR C;  5GMV A;  2BPS A;  2I38 A;  3VXW A;  3AEA B;  4AJW A;  2DAF A;  1R4N I;  4L23 A;  1KJT A;  1D4B A;  3W9C B;  2KFK B;  1L6V A;  1AAR A;  3AE3 B;  5CHV C;  2J4X A;  2GLS A;  2G4S A;  3VUW A;  3DVN V;  3MJW A;  4LNI A;  1LM8 B;  2LVP A;  1DYQ A;  3I57 A;  4MT5 A;  4WJO A;  2CHZ A;  3IBE A;  3C8Y A;  1WZ3 A;  4EZL A;  4KKJ A;  5IP4 D;  3I9V 1;  4G11 A;  4YXD B;  5J18 A;  4AJY B;  3U52 E;  4N9F 4;  4OVV A;  5C1Z A;  2QDF A;  3Q69 A;  4GLS C;  3B9J A;  1YJI A;  2FE8 A;  4FJZ A;  1XLO A;  2XNA C;  1OQY A;  4BOS C;  1AN8 A;  3QK0 A;  2WXI A;  3DWM A;  3OJ3 A;  1WM3 A;  4EFO A;  3AUL A;  3PT2 B;  2BBC A;  1OTR B;  2AEH A;  2INN E;  2QIL A;  2MQJ A;  3NS1 A;  4CYE A;  2HJ1 A;  2LXC A;  4NY0 A;  4ZRK A;  3QCA A;  1TKE A;  2AWT A;  2HE7 A;  4A8X C;  1SIJ A;  3SD5 A;  2D10 A;  2BYV E;  3H9D A;  5IKC M;  1V86 A;  2RDB C;  1TZ1 A;  3K9O B;  2XEW A;  2WQY B;  5DPW A;  1XQQ A;  2WHI A;  2BYE A;  1IP9 A;  4HWI B;  1RLF A;  2MH7 A;  3GS2 A;  1FM0 D;  5GXG B;  2O6V D;  3B2G A;  3DHH C;  1N61 A;  4X57 B;  2JXT A;  4LTU A;  3AN1 A;  2NBV B;  1WJN A;  3ZLZ A;  1Q1O A;  3TJP A;  1ZDX A;  2QIE B;  3PSE B;  4OHJ A;  1XO3 A;  1E8Z A;  4HJG E;  1I4R A;  1WSP A;  2LRW A;  3L10 B;  1N63 A;  5AZF A;  3PLV A;  2MJD A;  1FXI A;  2KLC A;  1YN3 A;  2PE9 A;  4ZDV A;  4PS3 A;  2NMQ A;  3BZD B;  3M3J A;  2PVG C;  4LJO B;  2JQR B;  1JRP A;  2V3P A;  1VZ7 A;  5LXI B;  1Y56 A;  1IYF A;  4KGR A;  2IGG A;  4II2 B;  2MBH A;  4O1N A;  5TR5 A;  3RNA C;  2R2Q A;  2GOW A;  2LD9 A;  4ZRQ A;  3GB1 A;  1P0R A;  2L0F A;  2GBJ A;  1YJJ A;  3X23 A;  4M0W A;  3P1M A;  3TEZ A;  1WGG A;  2N7D A;  1JWS D;  3A1Q B;  2J0K A;  3L16 A;  2AL3 A;  3APF A;  4TUU A;  4XDD A;  4IC7 B;  3PV1 A;  4JX1 C;  3Q2A C;  2WXF A;  1YOV B;  3VTW A;  1HZ6 A;  3JYU A;  1JRO A;  1R4M B;  3A1Q A;  2KT7 A;  5E6O A;  1MHX A;  1XD3 B;  3BVG A;  2WXJ A;  2G4D B;  1QKZ A;  1U4A A;  5JZE B;  1ZPS A;  2W3R A;  3DBL B;  2Y5P A;  3EA6 A;  2L00 B;  3H8H A;  2WDQ B;  1QZE A;  1WX7 A;  1SB3 C;  4HCN B;  4KDL B;  3SDL C;  1JAL A;  1BML C;  4EE2 A;  2KDM A;  4HVB A;  1SJE D;  2KWU B;  4B6W A;  5E6J A;  2BYT A;  4IOI E;  2G3Q B;  1WH3 A;  1R7S A;  4ANW A;  2FCN A;  3MFG A;  1E8X A;  3VR8 B;  3TEX A;  1STE A;  4A20 A;  2QJL A;  4BVU C;  3Q3M C;  2FUG 1;  3ZKJ C;  1SE9 A;  4PS7 A;  2H89 B;  4DXG A;  1MJD A;  1C4P A;  3A9K A;  1LO5 D;  1WGK A;  2L32 A;  5E6N A;  3UGB B;  1I7H A;  2C7N B;  1CK1 A;  3N32 A;  3W1S C;  3DBH I;  1TIF A;  3Q8F A;  1VZ6 A;  3AH7 A;  4AWJ A;  1C4C A;  4KSL C;  3NOB A;  2NCN A;  1E7P B;  1OFF A;  4DDI D;  5H92 C;  1RFK A;  1TGZ B;  1K52 A;  3ZXV A;  2KN5 A;  3KH0 A;  3BYY B;  2FNJ B;  3Q3J A;  1JWM D;  4W9K A;  4GMV A;  3O13 A;  1T5X D;  3HK0 A;  2HTM E;  1T0R C;  2CS4 A;  3AI5 A;  2WX0 A;  3P63 A;  1R4N B;  3KUZ A;  1ENF A;  1NBF C;  2BQQ A;  1ACC A;  1TY2 A;  4MGY E;  1G6J A;  2K0P A;  3SHQ A;  4WQO B;  2DYM A;  4J3O D;  2A4Z A;  3RD2 A;  3QWZ B;  1GG3 A;  3AE2 B;  2LVQ A;  1MHH E;  2DZJ A;  2V3N A;  1ET9 A;  3IFW B;  4GDL A;  1J8C A;  3P4P B;  3RCZ A;  4L1B A;  4ZRJ A;  1QOA A;  4NQK E;  4REZ A;  2BKR B;  1P1A A;  2KJH B;  1WX8 A;  2L3Z A;  3IT4 B;  2LUM A;  2XK5 B;  3AE4 B;  1NEN B;  2LMC A;  1S3S G;  3R3M A;  3N1Z C;  3NZS A;  1SXT A;  3UQA A;  3R7R A;  2KYW A;  2XK5 A;  1N62 A;  1F52 A;  4EZJ A;  1XCQ L;  3DQV A;  3HHM A;  2D5G A;  2MJE A;  1C78 A;  2NTS A;  1UBI A;  2LUE A;  4B0E A;  4DXA B;  4BBN C;  1GC7 A;  1AW7 A;  2PKO A;  4MEL A;  1V5T A;  3NY5 A;  1XT9 B;  2OJW A;  1E9M A;  2WDV B;  2IY1 B;  3ZDT A;  2HTH A;  3ZIM A;  2CHX A;  4KV2 A;  2MA9 B;  2GI9 A;  2IO1 B;  2ZJD A;  4KDI C;  4JWS C;  2BVC A;  3TEY A;  3HM3 A;  1DOX A;  4ANV A;  2KAN A;  1YIW A;  2RMM A;  1B1Z A;  2AQ2 B;  2W82 A;  2IZV B;  2AYO B;  2V4L A;  3HM6 X;  1JRU A;  1C3T A;  1XEE A;  3QHT A;  1FD6 A;  1C1Y B;  4P6V F;  2ZNV B;  2KVR A;  2D07 B;  1UD7 A;  2DX5 B;  4PS8 A;  1XLP A;  1I4G A;  3X0W A;  4LK0 M;  3N30 A;  4XZ4 A;  5J2R A;  3L4P A;  4WJN A;  5EE1 A;  3V6C B;  4M01 A;  1M94 A;  4JGH B;  4KSK C;  2KD0 A;  1A70 A;  2XN9 C;  1E90 A;  4M8M A;  1OEY A;  2L05 A;  1FO4 A;  4MDK E;  1WGR A;  5FR6 A;  1UEL A;  4LDT B;  1PGB A;  5HHD G;  3T3O A;  3PTF C;  4TV3 A;  4BAX A;  2VRR B;  5LXH A;  1A5R A;  4MGZ E;  1WR1 A;  2I1J A;  2EKI A;  2JF5 A;  4HKQ A;  2JZZ A;  3RFZ B;  2N0S B;  1TY0 A;  2LGI A;  3OJ4 B;  2K1F A;  1E6E B;  2WXG A;  3B08 A;  3MJ5 A;  2IDY A;  1N60 A;  2INC C;  4HCP B;  3GOE A;  4MM3 A;  2KX0 A;  4HEA 1;  3Q8E A;  1J7B A;  2X8X X;  4AP4 C;  4XGA B;  3BK2 A;  4EZK A;  1UWM A;  2KWC A;  1X1M A;  4MH0 E;  5HG2 A;  1PYW D;  3TUO A;  1EWY C;  2WXM A;  4HXD A;  2NBU A;  4NJC A;  1IUE A;  1YJ1 A;  1GB1 A;  1GC6 A;  3DHG C;  3QJZ A;  3PO0 A;  5LLI A;  2ASQ A;  2ZVN A;  3QC8 B;  4LCD E;  4YTN B;  2PVO D;  1NYR A;  4KKI A;  3VHT C;  5G2N A;  4E71 A;  5D6J B;  2JX5 A;  3ZUN A;  1WX9 A;  2KKC A;  2ZW0 A;  4W9D A;  2KJR A;  5KHQ A;  1QLB B;  2LEK A;  3EFC A;  2ZZP B;  3SEB A;  4JLC A;  4UDU C;  1I42 A;  4S17 A;  4AOF A;  2KVZ A;  2MJ3 A;  1SIF A;  2IBI B;  1P3Q U;  1LGR A;  2L7R A;  4NQL B;  2KQ7 A;  2FUH B;  2KMM A;  1EWC A;  1WJ6 A;  1T0Y A;  1ZW7 A;  3RNE C;  3O65 B;  1GPX A;  2LJI A;  1JWA D;  3ZJT A;  2BF8 B;  3N20 C;  3VRB B;  1GJZ A;  3QAQ A;  3AEF B;  4ZOH C;  5I4D A;  3RNF C;  4IWO A;  3L13 A;  2DHZ A;  1V9J A;  1OQQ A;  2WNM A;  3DBH B;  4M8N A;  2KFK A;  3RN9 C;  3OAW A;  3AU4 A;  4LNK A;  3DVG Y;  4HPP A;  3ECI A;  1KF6 B;  2ZCC A;  5CX3 A;  3RT3 B;  2X38 A;  3UIO B;  3HVD A;  3K9P B;  1YQ4 B;  4RGM A;  1IGD A;  3PHX B;  4II3 B;  1WIA A;  2EKE C;  2BB6 A;  4GXB A;  2MHJ A;  4XDC A;  3TIX A;  1PGA A;  4K7U A;  2GBK A;  4EEW A;  1YN4 A;  3IXS A;  3TMP B;  1YD8 U;  2MEK A;  2O2V B;  2Y5C A;  3WIM A;  1QIL A;  3B2F A;  4ANU A;  3DCG A;  2MW5 A;  1J19 A;  2LGS A;  2O2V A;  3AEG B;  1WXS A;  3URY A;  1KTK A;  4ANX A;  3QQ8 B;  1QT9 A;  2UYZ B;  2KFJ A;  3DWG C;  2LJ5 A;  1D5Z C;  3BIN A;  3V3X A;  1D6E C;  5BYQ A;  2Z0E B;  3LJ3 A;  1LXD A;  2FCQ A;  2N9K A;  3OLM D;  2C5L C;  2DYO A;  3M63 B;  1WE6 A;  1EF5 A;  2N1V A;  1ET6 A;  4FAD A;  2LFI A;  3KYC D;  1WJU A;  4MAC A;  3UI3 A;  4WJQ A;  1TBE A;  1Q10 A;  2ZW1 A;  4DHJ B;  3AV8 A;  4W9I A;  1JQ4 A;  1N5W A;  3Q3N C;  4BKG A;  4GIV A;  4I6P A;  1DOI A;  2JSV X;  2IPK D;  3AE1 B;  4XYC A;  4BKS A;  1UGM A;  3RNB C;  2D3B A;  4N6E B;  3VTV A;  4MSQ B;  3V6E B;  1UWX A;  3VH4 B;  5HFY A;  1L0V B;  1NYQ A;  2LGY A;  1QF6 A;  5FK9 C;  3R8B A;  1ZE3 D;  2B76 B;  1OQR A;  1F1H A;  2QSD A;  4JE3 B;  1FRR A;  2DZM A;  4HJK A;  5G5H A;  4ZYN A;  1HE8 A;  2WXR A;  1J0G A;  5CHW A;  3PVL A;  4ITK A;  3PRP B;  4DBG A;  1BXT A;  4RGN A;  1ZOY B;  3CWI A;  2DAJ A;  2ON8 A;  1E10 A;  3ZRC A;  4RNA A;  1ISN A;  4RM9 A;  3IAS 1;  1WXV A;  5AZH A;  3UF8 A;  1ZDV A;  4R3D A;  4E74 A;  2JT4 B;  2R61 A;  3SFE B;  4TKN A;  5D7G A;  1QOB A;  2N1W A;  3P2B A;  3DPD A;  4IM3 A;  4D2K A;  4M00 A;  5JH5 C;  1JWU D;  4NAW B;  2UU7 A;  1F0Z A;  2Y3A A;  3R2T A;  4K3C A;  1DGJ A;  4M02 A;  4MJS B;  2KAJ A;  2N4F A;  1H4R A;  2ZEQ A;  1NEK B;  4NAW A;  1WWT A;  2KMA A;  1SEB D;  2FBW B;  4JPS A;  4P1C C;  4P7I A;  4HRS A;  2MP2 B;  1I35 A;  3NVW A;  2G45 B;  1UGJ A;  5JHB A;  1E0Z A;  1WXQ A;  3QIJ A;  3A4S C;  4AUQ C;  4LNF A;  2MP2 A;  2WXN A;  3B0A A;  2J42 A;  1F9J A;  3OWE B;  3IVF A;  4C56 C;  3ML9 A;  3ABV B;  4MH8 A;  2DZK A;  5T8I A;  4FA6 A;  4IDI A;  2WDR B;  3SFD B;  4C00 A;  4FUL A;  2FIF A;  3S2A A;  1E5W A;  2YVC A;  2NVU I;  1RFA A;  2RD0 A;  2YLM A;  4WAF A;  2MCN B;  1GOZ A;  4GDK B;  2K5P A;  2E6X A;  3E9S A;  4IKG A;  3Q3O C;  4TSS A;  1TS5 A;  3EC8 A;  1C76 A;  1J7C A;  1KH0 A;  3JVZ X;  4HLE A;  3WAL A;  4A3P A;  4BOZ B;  2WXP A;  1CJE A;  1RRB A;  1ZGU B;  4F8C B;  3P4S B;  1HTO A;  3M62 B;  4IM0 A;  2L1A A;  2B3A A;  1V8C A;  1WRI A;  3ONS A;  5IN7 A;  2CKH B;  1FPY A;  5D2M B;  3JSV B;  3RUL A;  3PRM B;  2DNF A;  4I6N B;  5MPO A;  2NTT A;  4RF1 A;  4RGO S;  4YTM B;  4IG7 B;  3JSV A;  4US8 A;  4IW0 A;  1T0Q C;  4YWG G;  5G5G A;  2PW9 A;  3ZXR A;  2EMS A;  2IND C;  4PK1 A;  3NVZ A;  2D3C A;  4GSW A;  2LGD A;  3ZRF A;  3BVM A;  2ICI A;  3H7S A;  3T3N A;  4W9J A;  1XLN A;  2LGX A;  4RMA A;  3AU5 A;  3MC9 A;  1TS2 A;  2KQS A;  3P4Q B;  2LI5 A;  1TKG A;  2LHE A;  1MPE A;  2E3T A;  2KZR A;  2IGD A;  2KMC A;  3PRZ A;  2MBO A;  4GOC A;  4TMA B;  2WXH A;  4KZC A;  2G1E A;  2LHD A;  5DPT A;  2CR5 A;  3C0R B;  3M95 A;  3AXC A;  2W54 A;  3HIZ A;  1XF5 L;  2M4N A;  4E3C A;  1FFU A;  1L0Y B;  3EFU A;  3RYT A;  3HVZ A;  3MP9 A;  2BT6 A;  2PJH A;  2WXO A;  3WAN A;  4XC2 A;  3ZTC A;  3A33 B;  3DVG X;  2G9H D;  2JWZ A;  4KVG B;  4BKS D;  4F1S A;  3VVW B;  3ZGZ A;  2K6D B;  1VLB A;  4I6L B;  2KDB A;  1K8R B;  3LYY A;  3PPA A;  2C60 A;  1WYW B;  2GB1 A;  4WWP A;  2LXA A;  4OZA A;  1V1P B;  3RZF A;  1WZ0 A;  3U4E G;  2ZPY A;  2OJR A;  1T3Q A;  2XBB C;  1N6Z A;  3KQ4 A;  3PZ7 A;  1V1P A;  2CJO A;  1EU4 A;  3VDZ A;  4JL9 A;  1WGY A;  2VZK B;  3TL5 A;  2Z59 B;  1SE2 A;  2RDH A;  1JW9 D;  2MX2 A;  4J6I A;  3D32 A;  1F2R C;  4HPL B;  5TSS A;  4ZRI A;  5EE3 A;  4WUR A;  3EEC A;  2DBY A;  3AE5 B;  4HK2 A;  1UH6 A;  1QQR A;  5E6P A;  3ZW3 A;  4URK A;  1VCB A;  2DEN B;  3JW0 X;  3EGR A;  1TJE A;  3AE6 B;  2W3S A;  1L4Z B;  3ZNZ B;  1RYJ A;  1N5X A;  2R2O A;  4TQ0 A;  5AUI A;  1FXT B;  2SEB D;  1VZ8 A;  5AZG A;  4HRO A;  1L2N A;  3ML8 A;  2JRH A;  1GNU A;  2J53 A;  3W1Y A;  2NPT B;  2NR2 A;  1C79 A;  1KFY B;  4MEM A;  3APC A;  1VDV A;  2L76 A;  2D3A A;  2ZVO A;  4ACF A;  1ZKH A;  3LDZ E;  4K7W A;  4C7Z A;  4RM8 A;  3V05 A;  4NNJ B;  4ZHP A;  3AE7 B;  4IUM B;  4DXF A;  5AEK B;  2KWD A;  1Q5W B;  3P42 A;  4MSM B;  4C7Y A;  3MHZ A;  4NPN A;  1WI0 A;  3ZVV A;  3U30 A;  4YSZ B;  4LLG M;  3NVV A;  4DHZ B;  1RWS A;  4DWF A;  5L83 A;  2V0G A;  5BMI A;  1WJ4 A;  3KLS X;  2C7H A;  2BS2 B;  4YSX B;  1PFD A;  1WM2 A;  5DCN A;  4XWT A;  1WXM A;  2KNB A;  2ACZ B;  3VH3 B;  1TKY A;  2SAK A;  2RPQ A;  1L5P A;  4AS1 A;  1UNS A;  2WU2 B;  2KTR B;  3VUX A;  4B95 A;  1L7Y A;  2DLB A;  3NZ3 A;  4HDO A;  2BB5 A;  2IO2 B;  1EO6 A;  3ZJV A;  4K1R B;  2M8S A;  2WXL A;  4WJP A;  1FXA A;  3WA0 A;  4W9H A;  5JXV A;  1GB4 A;  2KTR A;  3J9C A;  1WGD A;  3BVZ A;  3UIP B;  1XXG A;  3A4R A;  3C19 A;  3VRA B;  3QA8 A;  5D3I B;  2KC2 A;  4W9C A;  3KWV A;  1JML A;  3ETR A;  4A90 A;  3CSF A;  1WRD B;  3L54 A;  1UUP A;  3AEE B;  2EMT A;  4GN1 A;  3DOW A;  2JYE A;  3Q8A A;  2JUO A;  2BKF A;  2AQ1 B;  2L52 A;  2ONQ A;  1LQB A;  2WXQ A;  3FIL B;  2IYD B;  3VQI A;  5BYS A;  2FID A;  2IJ0 A;  1K51 A;  1CMX B;  5IO9 A;  3FIL A;  4B0M A;  1MFW A;  2PLP A;  2N7E A;  3KW5 B;  2MWS B;  5BMG A;  4PYU A;  2WGS A;  3Q6B A;  2DWQ A;  1I4P A;  4EOY A;  2W9N A;  3TCA A;  1FNV A;  4KX6 B;  1HTQ A;  5AUK A;  1PGX A;  1ROE A;  3RNC C;  3A9J B;  2CU1 A;  1E7U A;  2BS3 B;  4FJY A;  2K8H A;  2KTF A;  4WIP A;  5JHA A;  4YL8 A;  1SE3 A;  2AQ3 B;  1Z5S B;  3DBS A;  4W9F A;  1K53 A;  1TZO A;  3QX1 A;  1YMH E;  1FNU A;  2KAC A;  1V6E A;  4WWM A;  3H6N A;  4XE0 A;  2KO3 A;  3MC8 A;  2FAZ A;  4G0N B;  1PUT A;  4S0R A;  3ZYY X;  1NI2 A;  2RPV A;  4GB9 A;  2K6Q A;  2L83 A;  1JCK B;  3VR9 B;  2JYT A;  2QMT A;  1HEZ E;  3WAM A;  1VRA B;  1KOT A;  1OEY J;  1UZX B;  2I1K A;  1KLU D;  4OVZ A;  3PHW B;  2JY6 A;  2REX A;  3ZO5 B;  2JXX A;  3AED B;  3PGE A;  2VZK D;  2OED A;  4N59 A;  4YT0 B;  1L0X B;  2KLG A;  4KGS A;  2BW2 A;  3FC4 A;  4DDG D;  2LWP A;  4OVU A;  4G50 A;  2WU5 B;  2KDI A;  1C77 A;  1WMH B;  1KLV A;  3FAH A;  1YN5 A;  2GBM A;  2LRU A;  3WAO A;  1EF1 A;  1UF0 A;  1D3Z A;  1RM6 C;  1WMH A;  3U8Z A;  4LNN A;  2K9X A;  2JU6 X;  3KYD D;  4KZ0 A;  2QCZ A;  4BFR A;  4F7Z A;  2RDG A;  2V4I B;  4FHJ A;  2N9E B;  2LZ6 A;  1FCL A;  3ENE A;  4W9E A;  5EE9 A;  2ZCB A;  1I4X A;  2MSE D;  4FN2 A;  1FEH A;  1EU3 A;  4GU2 A;  3RPF C;  3ZNG C;  1FMA D;  2EEL A;  3AM9 A;  4ZRP A;  2K39 A;  2TSS A;  4JWU C;  3W5V B;  4US9 A;  1NDD A;  1T0S C;  1QOF A;  3GE8 C;  1YX6 B;  4RF0 A;  4NZL B;  3ALB A;  3U2S C;  3APD A;  5G55 A;  3VAW A;  3QAR A;  4LDT D;  4RGT A;  2PPH A;  1TYG B;  3T9L A;  4ICV A;  5C2T B;  2JZ3 B;  4TQ1 A;  4EKU A;  2GBN A;  3H1U A;  2BYF A;  4AQ7 A;  1VD2 A;  3Q3F A;  4BKT A;  4CHK A;  2VH2 A;  2WDT B;  5C23 A;  3ZDM C;  4DK5 A;  2MBB B;  1TT5 B;  2N9L A;  3RI7 C;  2CJN A;  1V5O A;  5LNK 1;  2ZNV C;  2NS5 A;  3HRD D;  3ZQ4 A;  1FFV A;  4KGT A;  2YEP F;  4OZB A;  3KUD B;  5FR3 A;  3PRE A;  1H8C A;  3PZ8 A;  3T8M A;  5DPR A;  2M1M A;  3LB8 C;  1VR9 A;  3TSS A;  1K50 A;  2KX3 A;  2M19 A;  2WYQ A;  4Q2J A;  4M0W B;  4MJS A;  1E7V A;  4EUT A;  4LNO A;  3RUI B;  4GGQ A;  4ZHO A;  2KXJ A;  3DBR I;  3ZNI D;  4A55 A;  1WXA A;  4LJP B;  4W9L A;  2D2Q A;  3IAM 1;  2D11 A;  4HKZ E;  2OHF A;  1WR6 E;  1RAX A;  3U7Z A;  1TTN A;  4W9G A;  1L4D B;  2KDF B;  3R66 C;  2FCS A;  2Y5B B;  4XWW A;  4IWQ A;  2JPH A;  2V9H A;  3EHV A;  1P7E A;  4ARI A;  1ZXH A;  2D3G A;  2N7J A;  3NRZ A;  2MBE A;  1V49 A;  3KWL A;  1D5M C;  5FKA C;  2DZI A;  1E8Y A;  3BYT B;  5KHO A;  2LAS A;  2KDE B;  4GDK A;  4N58 A;  3R7Q A;  1YX5 B;  4CO7 A;  3AE8 B;  3NG0 A;  4BBN F;  3PS6 A;  1AWD A;  3NZU A;  2BS4 B;  2ZPN A;  2QHO A;  3LXF A;  4L2Y A;  2KJ6 A;  2WLB A;  4NJ6 A;  1MVK A;  2DYB A;  3GP7 A;  3GE3 C;  2Q5W D;  1EM7 A;  1YQ3 B;  2C7M B;  3RMK C;  3GZN I;  3L17 A;  2RGF A;  4WAA A;  2HD5 B;  3A9K B;  3EUB 2;  1TS4 A;  3I3T B;  4C4V B;  4ASW C;  2BTE A;  1CQV A;  2JRI B;  3TBL D;  5EDS A;  2M0A A;  2N9P C;  4C4V A;  3UIN B;  2KQ4 X;  4ARC A;  2VH1 A;  3CST A;  3SR6 A;  1C4A A;  3OG5 A;  1L6U A;  3L08 A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 2BF8 B;  3B1L X;  3V62 A;  4RM8 A;  2KLC A;  3ZTD A;  1GJZ A;  2L0T A;  3QAQ A;  4NNJ B;  2AL6 A;  4IUM B;  2PE9 A;  4ZDV A;  5AEK B;  4PS3 A;  1Q5W B;  4IWO A;  4MSM B;  3L13 A;  1E8W A;  2DHZ A;  4NPN A;  1WI0 A;  1V9J A;  3ZVV A;  3U30 A;  1Z2M A;  1OGW A;  4M8N A;  2KFK A;  3M3J A;  4DHZ B;  4LJO B;  3OAW A;  3AU4 A;  5LXI B;  3DVG Y;  4DWF A;  5L83 A;  1IYF A;  3ECI A;  1WJ4 A;  2CHW A;  2Z0D B;  4II2 B;  1Q0W B;  2MBH A;  2ZCC A;  5CX3 A;  3RT3 B;  2C9W B;  3UIO B;  3NHE B;  3K9P B;  5TR5 A;  4IM2 A;  2C7H A;  2R2Q A;  1KM7 A;  2GOW A;  2LD9 A;  1WM2 A;  1P0R A;  2L0F A;  5DCN A;  2GBJ A;  1PQS A;  1WXM A;  2J0J A;  2KNB A;  3PHX B;  3RZW C;  4II3 B;  3X23 A;  3VH3 B;  1BT0 A;  2J0M A;  1WIA A;  2EKE C;  1WGG A;  2N7D A;  2RPQ A;  3A1Q B;  4GXB A;  2J0K A;  3TIX A;  3L16 A;  2AL3 A;  3APF A;  4TUU A;  4FHK A;  4IC7 B;  4K7U A;  2GBK A;  3PV1 A;  2FCM A;  5J17 A;  3VTW A;  4EEW A;  4DHJ D;  3JYU A;  4ICU A;  3A1Q A;  2KTR B;  4HPM B;  3TMP B;  1WE7 A;  3VUX A;  5E6O A;  4B95 A;  1L7Y A;  1YD8 U;  4HDO A;  1XD3 B;  2O2V B;  3WIM A;  2IO2 B;  4IWP A;  1EO6 A;  4K1R B;  2M8S A;  4WJP A;  4GDL B;  3WA0 A;  4W9H A;  4NJ7 A;  4ANU A;  3DCG A;  2KTR A;  2NBW B;  2MW5 A;  2G4D B;  1WGD A;  3UIP B;  1J19 A;  2O2V A;  3A4R A;  4ANX A;  1WXS A;  3VFK A;  2GBR A;  1U4A A;  3QA8 A;  3QQ8 B;  5JZE B;  2UYZ B;  2KC2 A;  4W9C A;  2GMI C;  2KFJ A;  2LJ5 A;  3CSF A;  1WRD B;  3BIN A;  2RSU A;  2L00 B;  1QZE A;  1WX7 A;  2Z0E B;  3L54 A;  2EMT A;  1YQB A;  3LJ3 A;  4GN1 A;  4HCN B;  4KDL B;  3SDL C;  1LXD A;  2FCQ A;  3DOW A;  1Y8R C;  3OLM D;  4KIK B;  2C5L C;  2DYO A;  2KK8 A;  3ZNH B;  3M63 B;  4HVB A;  4FLH A;  1WE6 A;  1LFD A;  2JUO A;  2BKF A;  2KWU B;  1EF5 A;  2N1V A;  4DHZ E;  4B6W A;  4KIK A;  4FAD A;  3KYC D;  1WJU A;  2UWQ A;  1LQB A;  5IAA C;  5CHF A;  4WJQ A;  4WWO A;  2G3Q B;  1WH3 A;  2LVO A;  1UBQ A;  1TBE A;  2IYD B;  4ANW A;  4K81 A;  3VQI A;  2FCN A;  1EUV B;  2FID A;  4DHJ B;  2MBQ A;  4W9I A;  1E8X A;  1CMX B;  2V3S A;  1S1Q B;  4BKG A;  3KUC B;  4A20 A;  4GIV A;  4HDQ A;  4BVU C;  2IO0 B;  3MHS D;  4I6P A;  2N7E A;  3V61 A;  3ZKJ C;  3U7D A;  3KW5 B;  1SE9 A;  4BKS A;  2MWS B;  4PS7 A;  4PYU A;  1UGM A;  3VTV A;  4MSQ B;  3V6E B;  3A9K A;  4EOY A;  2PE6 B;  3VH4 B;  2W9N A;  3TCA A;  2PEA A;  1GUA B;  4JQW C;  5E6N A;  3UGB B;  2LGY A;  2C7N B;  4G3X B;  5L95 C;  3A9J B;  3N32 A;  2A5U A;  2KHW B;  3W1S C;  2CU1 A;  3DBH I;  2NPT A;  1E7U A;  3VTU A;  3H7P B;  4AWJ A;  4KSL C;  5HKH A;  4FJY A;  3NOB A;  2K8H A;  2KTF A;  2MLB A;  2NCN A;  4YL8 A;  5JHA A;  2DZM A;  4HJK A;  3DDC B;  4ZYN A;  1Z5S B;  2K25 A;  1HE8 A;  4DDI D;  3H7P A;  3DBS A;  2IO3 B;  2IY0 B;  4W9F A;  1J0G A;  1TGZ B;  3IHP C;  5CHW A;  3PVL A;  3SU8 X;  3QX1 A;  3PRP B;  4DBG A;  2KN5 A;  1IPG A;  1V6E A;  3KH0 A;  1V80 A;  5BO4 B;  2DAJ A;  3ZRC A;  2O6V B;  2FNJ B;  1MG8 A;  1ISN A;  4RM9 A;  3H6N A;  3Q3J A;  4FBJ B;  4W9K A;  4GMV A;  2KO3 A;  2FAZ A;  3HK0 A;  4G0N B;  1WGH A;  1WXV A;  5AZH A;  3BY4 B;  3UF8 A;  2CS4 A;  2O6V A;  1NI2 A;  4GB9 A;  3AI5 A;  2K6Q A;  4E74 A;  5IA7 A;  2WX0 A;  2JT4 B;  4TKN A;  5D7G A;  4B9K A;  2N1W A;  3KUZ A;  3P2B A;  3DPD A;  1NBF C;  4IM3 A;  5JH5 C;  1R4M I;  4NAW B;  3WAM A;  3MTN B;  1KOT A;  1OEY J;  1P98 A;  1UZX B;  2I1K A;  3L0W B;  2K8C A;  4MJS B;  3PHW B;  3CF6 E;  2N4F A;  1SGH A;  1H4R A;  2ZEQ A;  4MGY E;  3IG3 A;  2JY6 A;  2M17 A;  2REX A;  4NAW A;  3ZO5 B;  2JXX A;  2KMA A;  1G6J A;  5DPS A;  3SHQ A;  5D94 A;  3PGE A;  4P7I A;  2WX1 A;  4WQO B;  4XX5 A;  2DYM A;  2MP2 B;  1I35 A;  2A4Z A;  2G45 B;  3RD2 A;  2KLG A;  1WF9 A;  3QWZ B;  2J7Q B;  1GG3 A;  4DDG D;  5JHB A;  2LWP A;  3DBL I;  2KOX A;  4OVU A;  3QIJ A;  3A4S C;  4AUQ C;  2LVQ A;  2MP2 A;  2DZJ A;  4G50 A;  3VUY A;  3B0A A;  2KDI A;  1F9J A;  1WMH B;  2KC1 A;  3IFW B;  4GDL A;  4PYZ A;  1J8C A;  1KLV A;  3RCZ A;  3IVF A;  2GBM A;  2LRU A;  3ML9 A;  3WAO A;  2V1Y A;  2L8J A;  4MGI E;  4WWN A;  4ZRJ A;  1EF1 A;  2DZK A;  1D3Z A;  2N9X A;  4NQK E;  1WMH A;  2BKR B;  1P1A A;  2KJH B;  3U8Z A;  4FA6 A;  3PZD A;  1WX8 A;  2L3Z A;  3KYD D;  2XK5 B;  2KWV B;  4KZ0 A;  1S3S G;  2FIF A;  3R3M A;  1E5W A;  4FUL A;  2YVC A;  2NVU I;  1RFA A;  2RD0 A;  3KVF B;  3NZS A;  2YLM A;  4FHJ A;  3PLU A;  3UQA A;  2MCN B;  4GDK B;  3R7R A;  2N9E B;  2LZ6 A;  3ENE A;  4W9E A;  2BGF A;  2XK5 A;  2ZCB A;  2BWF A;  1WY8 A;  4EZJ A;  3EC8 A;  3DQV A;  3HHM A;  4JIO U;  3JVZ X;  2MSE D;  4FN2 A;  1UBI A;  4HLE A;  3WAL A;  4GU2 A;  2LUE A;  1V2Y A;  3ZNG C;  2K8B A;  4A3P A;  4DXA B;  4BOZ B;  4BBN C;  1GC7 A;  1RRB A;  4K7S A;  4MEL A;  1V5T A;  1ZGU B;  2K39 A;  3NY5 A;  1XT9 B;  4F8C B;  3DVN U;  4A3O A;  1NDD A;  3M62 B;  3V60 A;  1P9D U;  2IY1 B;  2BWE S;  2HTH A;  3ZDT A;  3ZIM A;  4IM0 A;  2B3A A;  2CHX A;  4KV2 A;  2MA9 B;  1YX6 B;  2IO1 B;  3N3K B;  3ONS A;  2M0X A;  3ALB A;  3W1S A;  2ZJD A;  4KDI C;  2MRP A;  3HM3 A;  3APD A;  4MGK E;  2CKH B;  5D2M B;  5G55 A;  3JSV B;  3RUL A;  3VAW A;  2HJ8 A;  3PRM B;  4ANV A;  3QAR A;  2KAN A;  1YIW A;  2OOB B;  4FJV B;  4LDT D;  2PPH A;  2JVC A;  4I6N B;  1WFY A;  3T9L A;  2IZV B;  2AYO B;  3CMM B;  2RR9 A;  2V4L A;  2JZ3 B;  3HM6 X;  4IG7 B;  4ICV A;  1JRU A;  3JSV A;  4TQ1 A;  3QHT A;  4EKU A;  1C3T A;  1C1Y B;  2GBN A;  2ZNV B;  1V81 A;  2WWZ A;  3A9J A;  3UQB A;  4IW0 A;  3WAP A;  2KVR A;  3H1U A;  2BYF A;  1VD2 A;  2EMS A;  2D07 B;  3Q3F A;  5CTR C;  4BKT A;  1UD7 A;  2BPS A;  2DX5 B;  2WDT B;  5GMV A;  4CHK A;  3VXW A;  4AJW A;  2DAF A;  4PS8 A;  5C23 A;  3ZDM C;  4DK5 A;  2MBB B;  3X0W A;  3N30 A;  4XZ4 A;  4GSW A;  1R4N I;  2LGD A;  3ZRF A;  5J2R A;  3H7S A;  4WJN A;  1KJT A;  4W9J A;  1V5O A;  3V6C B;  2LGX A;  1M94 A;  2ZNV C;  4RMA A;  4F7Z A;  4JGH B;  4KSK C;  2NS5 A;  2KFK B;  3AU5 A;  2KQS A;  1AAR A;  2KD0 A;  1E90 A;  2LI5 A;  5CHV C;  2KZR A;  2G4S A;  3VUW A;  4M8M A;  2KMC A;  3DVN V;  3KUD B;  3PRE A;  1H8C A;  3PRZ A;  2MBO A;  1OEY A;  3T8M A;  3MJW A;  4GOC A;  1LM8 B;  2LVP A;  2L05 A;  2M1M A;  5DPR A;  4MDK E;  4WJO A;  1WGR A;  4KZC A;  2CHZ A;  3IBE A;  5FR6 A;  1UEL A;  1WZ3 A;  4LDT B;  2KX3 A;  4EZL A;  4G11 A;  5DPT A;  2CR5 A;  2WYQ A;  5J18 A;  4AJY B;  3C0R B;  3M95 A;  3AXC A;  4N9F 4;  3PTF C;  4OVV A;  5C1Z A;  4M0W B;  4TV3 A;  4MJS A;  1E7V A;  3HIZ A;  4EUT A;  3RUI B;  2VRR B;  4GGQ A;  2M4N A;  4E3C A;  2KXJ A;  5LXH A;  1A5R A;  3DBR I;  4MGZ E;  1WR1 A;  2I1J A;  3ZNI D;  2JF5 A;  1WXA A;  4LJP B;  2JZZ A;  4W9L A;  2D2Q A;  4FJZ A;  2D11 A;  3EFU A;  3RYT A;  3S2A A;  1OQY A;  2PJH A;  4BOS C;  3OJ4 B;  3QK0 A;  3WAN A;  2K1F A;  4XC2 A;  3ZTC A;  1WR6 E;  3OJ3 A;  3A33 B;  3DVG X;  3B08 A;  1RAX A;  1WM3 A;  2JWZ A;  1TTN A;  4KVG B;  4W9G A;  4BKS D;  4HCP B;  4F1S A;  4EFO A;  2KDF B;  3R66 C;  3GOE A;  3AUL A;  3VVW B;  2FCS A;  2K6D B;  3PT2 B;  4MM3 A;  4BFR A;  2KX0 A;  2Y5B B;  4I6L B;  1OTR B;  4IWQ A;  2JPH A;  2KDB A;  2AEH A;  4AP4 C;  1K8R B;  3EHV A;  3PPA A;  4EZK A;  2C60 A;  1WYW B;  1X1M A;  2D3G A;  2KWC A;  4MH0 E;  4WWP A;  2MBE A;  1V49 A;  2LXA A;  2MQJ A;  1WZ0 A;  4HXD A;  3RZF A;  4CYE A;  2LXC A;  2DZI A;  2OJR A;  1E8Y A;  2ZPY A;  4NY0 A;  5KHO A;  2LAS A;  2KDE B;  2XBB C;  4ZRK A;  2NBU A;  4GDK A;  3QCA A;  2AWT A;  2HE7 A;  3R7Q A;  1YX5 B;  4CO7 A;  4BBN F;  3PS6 A;  1YJ1 A;  3VDZ A;  3NZU A;  2D10 A;  4JL9 A;  3SD5 A;  1WGY A;  1GC6 A;  2BYV E;  3H9D A;  3QJZ A;  3TL5 A;  5LLI A;  2ASQ A;  1V86 A;  2Z59 B;  2ZVN A;  1TZ1 A;  2ZPN A;  3QC8 B;  4LCD E;  2MX2 A;  2QHO A;  3K9O B;  4J6I A;  2KJ6 A;  3D32 A;  2XEW A;  3VHT C;  5G2N A;  1XQQ A;  4NJ6 A;  5D6J B;  4E71 A;  5DPW A;  2DYB A;  4HPL B;  2BYE A;  4ZRI A;  3ZUN A;  2C7M B;  1IP9 A;  3GZN I;  1WX9 A;  4HWI B;  1RLF A;  3L17 A;  3EEC A;  2KKC A;  4W9D A;  2KJR A;  2O6V D;  4HK2 A;  1UH6 A;  5E6P A;  3ZW3 A;  4URK A;  2RGF A;  5KHQ A;  4WAA A;  1VCB A;  2DEN B;  3JW0 X;  4X57 B;  2HD5 B;  2ZZP B;  4JLC A;  1I42 A;  3A9K B;  2NBV B;  3ZNZ B;  3I3T B;  1WJN A;  4ASW C;  4AOF A;  2R2O A;  4TQ0 A;  2JRI B;  3ZLZ A;  1Q1O A;  1FXT B;  3TBL D;  3TJP A;  1SIF A;  5EDS A;  3PSE B;  5AZG A;  2IBI B;  1L2N A;  1P3Q U;  2L7R A;  4NQL B;  3ML8 A;  2N9P C;  2KQ7 A;  2JRH A;  2FUH B;  1GNU A;  3W1Y A;  3UIN B;  1E8Z A;  2NPT B;  2NR2 A;  3CST A;  1WJ6 A;  1T0Y A;  1ZW7 A;  4MEM A;  3APC A;  2L76 A;  2ZVO A;  3O65 B;  2LRW A;  3L10 B;  1ZKH A;  5AZF A;  3LDZ E;  3L08 A;  3NS8 A;  3PLV A;  4K7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...