3V6EB

Crystal structure of usp2 and a mutant form of ubiquitin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
80
Chain Sequence
b'GLVPRGSMQIFVNTLSGHITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 2
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 22
structure length 80
sequence length 81
ec nomenclature
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v6eB00
3PS6A 3PHXB 2UYZB 1LXDA 2D2QA 3H7PB 2L8JA 2ZVOA 1I35A 3LJ3A 1WRDB 3HM3A 4ZRKA 4ANUA 3IBEA 5E6PA 3PLVA 2JXXA 3OLMD 4MGIE 4NPNA 3ZRCA 4BKSD 2CR5A 4FBJB 4DHZE 3X23A 2KTRA 4BBNC 5C23A 1JRUA 2KWUB 3EFUA 1H8CA 2WX1A 2BGFA 2IYDB 4GIVA 3IG3A 4GOCA 3ZO5B 1WJUA 3L10B 3WAMA 1I42A 4HDQA 4HPMB 4TV3A 2KXJA 1OGWA 3M95A 1LM8B 4PS7A 5KHQA 1P9DU 3L17A 4I6NB 2MCNB 2KHWB 2RD0A 2HJ8A 2NPTB 3APCA 2MP2B 4KSLC 4W9JA 3TCAA 2AWTA 3SD5A 5AZFA 2A5UA 5DPSA 4KDIC 4IWQA 4E3CA 2IO3B 2FCNA 2LGXA 1J19A 3UF8A 3ML8A 2KDBA 2FCQA 3ECIA 2L0TA 2B3AA 3DVGY 2AEHA 3L0WB 3ZIMA 2KQSA 2R2QA 2BKRB 1Q5WB 2DYMA 3DBHI 5LXHA 4OVUA 4K7WA 1KOTA 2EMSA 4EFOA 1E90A 2MX2A 2KTRB 1WIAA 2MBOA 2IY0B 1V5OA 1AARA 4PS8A 1WZ0A 5LXIB 1EO6A 2NR2A 2OJRA 3N32A 4HWIB 2MSED 1RLFA 3MHSD 2L05A 1L7YA 2KX0A 3WAPA 1V6EA 2C5LC 4WJQA 2LGDA 3ZNZB 5EDSA 3VDZA 4FHKA 2CU1A 2N7DA 2NBWB 3CSTA 2KLGA 4AOFA 5E6OA 2KMAA 3BY4B 4KSKC 4ANXA 2PPHA 2FIFA 4J6IA 3KUCB 1Z2MA 4MM3A 1SIFA 3JYUA 1WXVA 3EC8A 1NBFC 3QX1A 4CHKA 2NS5A 3LDZE 1YIWA 2J7QB 4IM3A 2G45B 2O6VD 2V4LA 3ZDMC 3QAQA 3UIOB 3D32A 2JRHA 4NQLB 3A33B 1WM3A 3IHPC 2JZ3B 4LDTD 4GU2A 5J18A 1S3SG 1C1YB 4MJSA 4WJNA 4W9KA 3UQAA 3VH4B 1WH3A 2FCSA 1YD8U 2CHXA 2KWVB 1HE8A 2M8SA 5AZHA 1E8XA 2BYEA 2JZZA 2MBBB 2L3ZA 2J0MA 4NAWA 1WX8A 2REXA 4B95A 3V6EB 2RR9A 4AWJA 3N3KB 1RRBA 1OEYJ 1WJ6A 2IO2B 3Q3FA 2WX0A 4A20A 1QZEA 2YLMA 5LLIA 2KVRA 2N9PC 1WFYA 4NJ6A 3JVZX 1Z5SB 3W1SC 2KFKA 4E71A 4GXBA 4X57B 4ZYNA 4HLEA 1WMHB 1NDDA 3DBSA 3RYTA 3IFWB 4TQ1A 2JPHA 3ZW3A 4DHJD 3RZWC 1V81A 1ISNA 3MTNB 2L0FA 1RFAA 2L00B 3DOWA 2CHWA 2LZ6A 3CMMB 1C3TA 2YVCA 5DPWA 4W9GA 4ICUA 1GUAB 3VTVA 2ZVNA 1TTNA 4JIOU 1PQSA 4MJSB 2N9XA 2XBBC 4B9KA 4WWPA 2K6DB 3PT2B 3PZDA 3AU5A 3PRZA 3GOEA 4GSWA 4LJOB 3RULA 3NZUA 3VTWA 2KJ6A 3DBLI 4NAWB 4NJ7A 5JH5C 2KN5A 2M4NA 1WY8A 3ALBA 3EHVA 1LQBA 2IO0B 2NBUA 4BKSA 4W9IA 4II3B 4DXAB 5JHAA 3PRPB 2OOBB 3JW0X 5D94A 1V9JA 4EEWA 1GNUA 2KFKB 1UBIA 4IM2A 3L16A 4MELA 2D07B 1WE7A 2KX3A 2BWES 3IVFA 3GZNI 4IWOA 2XK5A 4NY0A 4EOYA 4WJOA 4I6LB 2WDTB 2O2VA 1EF1A 1WI0A 2I1JA 2JUOA 1GC7A 2MBQA 4PYZA 3NS8A 4BBNF 2V1YA 4XX5A 4ANWA 2LUEA 2MLBA 4PYUA 3PGEA 3AULA 3ZLZA 3A4RA 2MBEA 3O65B 1YX5B 2QHOA 2MBHA 4G0NB 4FADA 3QJZA 4HVBA 4F1SA 2LWPA 3H9DA 2DX5B 1E5WA 3V6CB 3WAOA 1UBQA 2ZEQA 2ZZPB 1M94A 2K8HA 1E8YA 2PEAA 3AXCA 1UD7A 5TR5A 4W9FA 2LXAA 1SE9A 5KHOA 3JSVA 1U4AA 2XEWA 2PE6B 4KVGB 1V5TA 3QIJA 4HCNB 1D3ZA 2DHZA 3DDCB 2C7MB 1P0RA 3HHMA 4IC7B 4LJPB 3QWZB 4ZDVA 1ZKHA 2WYQA 3M3JA 3QK0A 4AUQC 3NHEB 4TQ0A 3V60A 4HXDA 2D10A 2ZPYA 5G55A 2XK5B 3KYCD 3UGBB 4W9DA 1V80A 1YQBA 4AJYB 5D7GA 2O2VB 5FR6A 3NZSA 4II2B 2M17A 3EECA 2KDFB 2DZIA 4A3OA 4IM0A 1RAXA 2JRIB 2IO1B 2PJHA 1XQQA 1L2NA 1WXSA 3ZNGC 2V3SA 2JWZA 1BT0A 2LD9A 4HJKA 4BOZB 3H6NA 3WANA 3A4SC 3APDA 4A3PA 5IA7A 3PVLA 3HIZA 2L76A 3VUXA 2MA9B 1WMHA 2DYOA 4M8NA 2KDEB 2LVOA 2CS4A 4RM8A 4OVVA 4HK2A 3ML9A 3KW5B 2O6VA 1WR6E 1YX6B 1VCBA 4BKGA 4K7UA 2Z0DB 4B6WA 3U8ZA 3ZUNA 2GMIC 4CO7A 2KMCA 3JSVB 3VHTC 1WX7A 4DWFA 1J8CA 2AYOB 4W9EA 4GDLA 1IP9A 4KZCA 3CSFA 4GN1A 4ZRJA 3NOBA 2J0JA 1T0YA 2FUHB 2JY6A 2LJ5A 2WWZA 3DVGX 1NI2A 5J17A 2IZVB 3ZKJC 3ZTDA 1H4RA 3A9KA 2LVQA 1LFDA 2K8BA 3W1SA 1Q0WB 3V61A 3QHTA 1SGHA 4MEMA 1Y8RC 4DDID 1GG3A 2FIDA 3PLUA 4YL8A 4NQKE 2Z0EB 2DAFA 1ZW7A 1E7VA 4K1RB 3RUIB 3TBLD 3TIXA 1WGDA 1GJZA 2GBRA 2KFJA 2ZPNA 2CHZA 3DPDA 3DBRI 4JQWC 2K1FA 3OAWA 2MW5A 4G50A 3T8MA 2D3GA 3ZNHB 3VUYA 3VUWA 2PE9A 3TMPB 2I1KA 2BYVE 2KC2A 4DK5A 1FXTB 2LRWA 2W9NA 2O6VB 5DPTA 4BVUC 2N9EB 2BPSA 3A9JA 2N7EA 4XZ4A 1WX9A 4LDTB 4EZJA 1WF9A 2J0KA 1OEYA 3PTFC 4GDLB 2KTFA 2DZKA 3TJPA 4MH0E 3R7QA 3NY5A 1WGHA 2VRRB 1GC6A 4IW0A 5CHWA 3RCZA 3A9KB 2ASQA 4IWPA 2NBVB 3RD2A 2DYBA 3ZRFA 4FA6A 2C9WB 2MWSB 1R4MI 1A5RA 3OJ4B 4E74A 1G6JA 3APFA 3H1UA 2IY1B 2KJRA 3OJ3A 3ZVVA 4ANVA 3QCAA 3ZNID 1EF5A 3H7SA 2GBJA 1UGMA 2C7NB 2N1VA 2KK8A 2GBKA 2NCNA 2Z59B 3CF6E 4MGYE 3R7RA 3VFKA 2N4FA 3R3MA 5AZGA 3PPAA 3MJWA 3DVNU 1V2YA 3PRMB 5CHVC 3ZTCA 1P1AA 3N30A 3QARA 4DHJB 1V49A 3BINA 4EZLA 2C7HA 4KDLB 5HKHA 4FN2A 1TBEA 4RMAA 4MSMB 3WIMA 4FJYA 1WZ3A 5GMVA 4F7ZA 3A9JB 1WJ4A 4M0WB 2JF5A 2KLCA 3QC8B 5BO4B 5G2NA 1OTRB 1IPGA 4HPLB 1IYFA 2GOWA 1UZXB 3QQ8B 3DCGA 3T9LA 4AP4C 3L13A 3R66C 3S2AA 2MRPA 1OQYA 3I3TB 3PSEB 3VVWB 4GB9A 1TGZB 3K9OB 2DENB 2KD0A 4MGKE 4BOSC 2A4ZA 5DCNA 2AL3A 2BF8B 4AJWA 2ZCBA 5CX3A 3AI5A 1J0GA 1WGGA 1P98A 4RM9A 3ZDTA 3PHWB 4HDOA 4FLHA 2KOXA 1EUVB 2EMTA 2LI5A 3WA0A 2KQ7A 3SU8X 1P3QU 4N9F4 2C60A 1X1MA 3K9PB 3KH0A 3L54A 2HD5B 3U30A 2LGYA 2KKCA 4BKTA 2K6QA 2FCMA 2DZJA 4P7IA 1WE6A 3A1QA 5L95C 3DQVA 5IAAC 3B1LX 1WGYA 3Q3JA 3M63B 4M8MA 5D2MB 2FNJB 2Y5BB 4BFRA 4DDGD 2N1WA 1ZGUB 4I6PA 3B0AA 2M0XA 2AL6A 4FJZA 4ASWC 1WYWB 4WJPA 4IG7B 3RT3B 1WGRA 4JGHB 3PV1A 4PS3A 2GBMA 5CTRC 5DPRA 2KC1A 5J2RA 2BYFA 2D11A 4FULA 3P2BA 3SDLC 4JL9A 2LXCA 3HK0A 3UIPB 4MDKE 1R4NI 4EZKA 4EKUA 5CHFA 5E6NA 4KIKA 4IUMB 2FAZA 4EUTA 1KM7A 3UQBA 1WM2A 3M62B 1WXMA 3W1YA 1V86A 2G4SA 4FJVB 2LVPA 3C0RB 3L08A 4JLCA 1WR1A 2RSUA 3B08A 4G3XB 4K7SA 4TKNA 3VXWA 3WALA 2G4DB 3VQIA 1E7UA 1K8RB 2K39A 2KZRA 2BKFA 2RGFA 3A1QB 3KUDB 3PREA 2KO3A 3X0WA 4CYEA 3HM6X 2HE7A 1WXAA 4URKA 4W9CA 2UWQA 3ENEA 3V62A 3KUZA 5L83A 4WWNA 1CMXB 5AEKB 1E8ZA 4GDKA 4KV2A 4F8CB 1KLVA 3QA8A 4FHJA 4TUUA 3TL5A 2ZNVC 1MG8A 3H7PA 2KJHB 4GMVA 2EKEC 3RZFA 3U7DA 4XC2A 2GBNA 2KWCA 4WAAA 2JT4B 1F9JA 3VTUA 3SHQA 4W9HA 4DHZB 2K8CA 1VD2A 2HTHA 2KDIA 2IBIB 2G3QB 4KIKB 4MGZE 4DBGA 4ICVA 1XD3B 5C1ZA 2LASA 3VAWA 4WQOB 4K81A 1UELA 5D6JB 1XT9B 2CKHB 2MQJA 2L7RA 2NVUI 3AU4A 4KZ0A 2DZMA 4MSQB 3DVNV 2DAJA 4ZRIA 2RPQA 4WWOA 2LRUA 2BWFA 3KVFB 5JZEB 2ZCCA 2M1MA 4W9LA 2ZNVB 3VH3B 2ZJDA 3KYDD 1E8WA 3UINB 1KJTA 1TZ1A 2NPTA 2MP2A 2R2OA 5JHBA 2KANA 2K25A 1WJNA 1S1QB 3ONSA 1UH6A 1YJ1A 2JVCA 4GDKB 2KNBA 4G11A 4GGQA 4HCPB 4LCDE 1Q1OA 4NNJB
chains in the Genus database with same CATH superfamily
3PS6A 1FCCC 2UYZB 1I35A 3IBEA 5E6PA 1QOAA 3PLVA 3DHHC 1I4XA 4MGIE 2GI9A 4RGMA 2G9HD 1JRUA 2VZKB 2IYDB 1WJUA 3L10B 1FXIA 1I42A 1ESFA 4USAA 5KHQA 3IT6B 3TCAA 3SD5A 4KDIC 5C2TB 4E3CA 1J19A 4ZOHC 1V1PA 2FCQA 3DVGY 3ZIMA 2WXLA 1FFVA 1Q5WB 1YQ3B 4EFOA 1E90A 2MX2A 1WIAA 2MBOA 2OEDA 2IY0B 3AEEB 1WZ0A 4JWUC 4HWIB 2MSED 1RLFA 1L7YA 2E3TA 3RI7C 3N20C 4ZHOA 2K0PA 2KMAA 2PPHA 1L0VB 1TS3A 2D3CA 1NBFC 1KH0A 2G45B 4NQLB 1K53A 2JZ3B 4GU2A 5J18A 1KTKA 1OFFA 2INDC 2LGIA 1B1ZA 2MBBB 2CJOA 2RDHA 1OQQA 4NAWA 2PLPA 3PZ8A 3I5JC 2WX0A 1HZ6A 5LLIA 1NYQA 1WFYA 1Z5SB 3W1SC 4RGOS 1XEEA 4GXBA 4X57B 4MM3B 3ZW3A 1J7BA 2D3AA 2L0FA 1RFAA 2L00B 2RDGA 1SB3C 2ZVNA 3CIRB 1SSNA 3EA6A 3PT2B 1ACCA 2H88B 2PW9A 2Y3AA 3T3NA 3RULA 4GSWA 3NZUA 3VTWA 3DBLI 5EE9A 2M4NA 1VJKA 3RNBC 5H92C 2IO0B 4DXAB 4XE0A 3N1ZC 4IM2A 1JRPA 1F0ZA 4IWOA 2QILA 2O2VA 1WI0A 2INNE 2JUOA 1JWMD 4ANWA 2MLBA 4PYUA 1XLOA 3CWIA 2MBEA 2IPKD 2MBHA 4G0NB 2DNFA 4HVBA 2MH7A 3NZ3A 2BBCA 4YTPB 1ZP0B 2WXMA 2ZEQA 4US9A 5D3IB 2LUMA 2LXAA 1SE2A 2KT7A 2PE6B 2DHZA 4ZDVA 2WYQA 4BAXA 3V60A 2NMQA 1MG4A 3KYCD 3UGBB 5D7GA 5FR6A 3NZSA 4A3OA 1RAXA 2WNMA 1L2NA 1WXSA 2V3SA 4HJKA 2N7JA 2DLBA 1JROA 4M8NA 1L4DB 1FD6A 3ML9A 2O6VA 3UI3A 4N58A 5T8IA 4A90A 3ZUNA 4CO7A 2KMCA 4DWFA 2WDQB 4GDLA 4D2KA 3CSFA 4GN1A 3RNGC 1T0YA 2FUHB 2JQRB 3ZKJC 1JQ4A 3MP9A 1CK1A 2K8BA 2JU6X 3PLUA 2AQ2B 1IUEA 4K1RB 3TIXA 5JXVA 1WGDA 1GJZA 2KFJA 3DPDA 3DBRI 2K1FA 2MW5A 3IT4B 3VUYA 3VUWA 3TMPB 2BYVE 2PKOA 2LRWA 2OHFA 2H89B 2N9EB 2VH1A 4LDTB 3PTFC 2DZKA 3TJPA 4MH0E 1MJDA 4IW0A 4M01A 2OJWA 4ITKA 5FK9C 1R4MI 1FNWA 4B0EA 4E74A 3H1UA 3R2IA 2L83A 3ZVVA 3H7SA 1KLGD 3R3MA 4BZAA 2VH2A 1FM0D 2WXRA 4XDCA 4WIPA 3ZJUA 2KVZA 3GZNB 3W5VB 2V3PA 1WZ3A 4FJYA 1CZPA 3A9JB 4M0WB 2XN9C 1IYFA 1OTRB 3V05A 4HPLB 2GOWA 4DQOC 5IO9A 4IKGA 1QKZA 1OQYA 2MRPA 4R3DA 4LK0M 2ICIA 2AL3A 1B9RA 4K3BA 2KOXA 3WA0A 1C77A 1WRIA 1N62A 4N9F4 3KH0A 3U30A 2PMVA 2DZJA 4P7IA 3TEWA 2BTEA 5L95C 1MHHE 1NVID 1GOZA 5C3JB 2L52A 4I6PA 3B0AA 2G1EA 2J53A 3RT3B 1WGRA 2BYFA 3HVDA 2D11A 3P2BA 5HHDG 4EUTA 2FAZA 1WXMA 1OQRA 1V86A 2BB6A 5BYQA 1JALA 3MJ5A 3Q6BA 3L08A 2RSUA 3B08A 3WALA 1K8RB 2KZRA 1DYQA 3KUDB 2KO3A 3X0WA 2HE7A 2WS3B 3ENEA 4WWNA 1YJIA 2N9LA 2V3NA 4KV2A 4GDKA 3P4RB 1KLVA 3QA8A 4TUUA 4KX6B 2KJHB 2EKEC 1LO5D 3U7DA 4B0MA 3P42A 5FR3A 1ET9A 4DBGA 1Y56A 1E10A 2BS4B 4K81A 1VLBA 1UELA 4YTMB 1ZPSA 2DZMA 3AEDB 3KVFB 2WGSA 5JZEB 5BMGA 2JX5A 2ZJDA 2K25A 2SEBD 1FFUA 3ONSA 1UH6A 3U2SC 2KNBA 1LXDA 2D2QA 3HM3A 3U7ZA 2JXXA 3EGRA 3VR8B 4NPNA 1JW9D 4BKSD 4FBJB 4KGRA 4BBNC 4C80A 2KWUB 3EFUA 2BGFA 2D3BA 3IG3A 1IBXA 4TV3A 3MC9A 4HPMB 2KXJA 3PZ7A 4WURA 4PS7A 1P9DU 2UU7A 1XCQL 3L17A 2IDYA 4I6NB 2MCNB 2RD0A 1C9FA 2NPTB 2MP2B 1TZOA 4W9JA 5AZFA 3BVGA 1MI0A 4ZRPA 4IWQA 2IO3B 2LGXA 3AV8A 3UF8A 3ECIA 2L0TA 2B3AA 2AEHA 1GB1A 4YXDB 2R2QA 3DBHI 1SBBB 3DBHB 4OVUA 2EMSA 5BMHA 4PK1A 1UNSA 3GP7A 3ZGZA 1V5OA 1AARA 3V3XA 2INCC 1EO6A 3N32A 2KX0A 2NTTA 5EDSA 3C19A 2CU1A 2KLGA 3I9V1 1C79A 4AOFA 3BY4B 1I4HA 2JSVX 4PT5A 1FRRA 2CU3A 4MM3A 3EC8A 1E0ZA 3AE6B 2NS5A 2D5GA 4L1BA 3FC4A 1XLNA 3QAQA 3UIOB 1T0SC 1C1YB 3VH4B 1WH3A 1YD8U 2KWVB 3PO0A 4RCOA 5AZHA 1E8XA 4GLSC 1WX8A 2RR9A 4AWJA 3AECB 1WJ6A 1OEYJ 2IO2B 3Q3FA 2KVRA 4NJ6A 3BIID 1JMLA 1UWMA 4HLEA 3DBSA 1PGBA 2JPHA 3RZWC 1V81A 2WDVB 1ISNA 3MTNB 3CMMB 2QEJC 1I7HA 4HPPA 1TTNA 4MJSB 4WWPA 2IGHA 3PZDA 3AU5A 4IOIE 3GOEA 3H8HA 1F1HA 1WY8A 3EHVA 2L1AA 4W9IA 1DGJA 2OOBB 5IOIA 4XGAB 1V9JA 1GNUA 2KFKB 3L16A 4MELA 2D07B 3FILB 2I2YA 1HA5A 1XO3A 3BK1A 4K3CA 2K9XA 2I1JA 4PYZA 3NS8A 4ARCA 3AH7A 2LUEA 4WH4A 5EE1A 2QC8A 2QHOA 2RMMA 2K22A 2LWPA 4OZBA 4IDIA 3OG5A 5TSSA 2BQQA 1E8YA 5EE3A 1HTQA 1SE9A 5KHOA 1U4AA 2XEWA 1YOVB 1K51A 4IC7B 2M19A 4OW0A 1ZKHA 4AUQC 3M3JA 3E9SA 4HXDA 2D10A 2ZPYA 2XK5B 4AJYB 1UUPA 2M17A 3EECA 2KDFB 5BYSA 2JWZA 3A4SC 3AEFB 3DHGC 4A3PA 3HIZA 2L76A 4ZRQA 2MA9B 1L5PA 1WMHA 4RM8A 4FXCA 3RPFC 1VCBA 4TSSA 4K7UA 1TS2A 2GMIC 1AWDA 3JSVB 3NOBA 1JWAD 2J0JA 2JY6A 3W9CB 3ZTDA 1H4RA 2J52A 3AE9B 1LGRA 4TMAB 3ETRA 1L0YB 3V61A 1SGHA 2FIDA 5IN7A 4RF0A 5I4DA 1E7VA 3RUIB 4OZCA 1BUIC 2FE8A 5G5HA 1P7EA 4JQWC 2FBWB 2QJLA 3ZNHB 3MFGA 2PE9A 2I1KA 4DK5A 5DPTA 4BVUC 3W2DA 2BPSA 3NUHB 3A9JA 4M0WA 2CJNA 4XZ4A 3LXFA 1WF9A 2J0KA 5BYRA 4JE3B 2BVCA 2IJ0A 1T3QA 1GC6A 3P4QB 3ZRFA 2ASQA 2LMCA 3RD2A 2C9WB 1A5RA 3OJ4B 3DBLB 3OJ3A 3ZNID 4HDOA 2KMMA 1UGMA 2N1VA 3CF6E 4MGYE 1HTOA 3Q14C 3MJWA 3DVNU 3PRMB 2WXNA 3GE3C 2C7HA 4MSMB 4F7ZA 2XNAC 3Q8AA 4P6VF 1N63A 5BO4B 1ROEA 5G2NA 1IPGA 1UZXB 4AP4C 3L13A 3R66C 3I3TB 1KFYB 3E56A 3VVWB 1TGZB 2J4XA 1MPEA 2LHDA 2DENB 3O13A 3B2GA 2A4ZA 3HRDD 2GRIA 3AE1B 4A6QA 4WAFA 1RM6C 2BF8B 2ZCBA 5CX3A 3AI5A 3L4PA 1D6EC 3ZDTA 1TJEA 4FLHA 1EUVB 2EMTA 2KQ7A 1BXTA 3SU8X 2C60A 1X1MA 3K9PB 1HEZE 2K6QA 2N0SB 4NAMA 3DQVA 1UWXA 3B1LX 4NZLB 3NS1A 2Y5BB 3VR9B 2N1WA 4UDUC 2AL6A 1WYWB 4WJPA 3BYTB 4PS3A 3PV1A 2GBMA 5DPRA 4FULA 4JL9A 2LXCA 3HK0A 4MDKE 1QILA 1R4NI 2HJ1A 4EKUA 4EZKA 2MHJA 5E6NA 4REZA 4LLGM 2X38A 1PDXA 2LVPA 3C0RB 3LB8C 3VXWA 2BKFA 3RNFC 3Q2AC 2JZPA 4NJCA 1TIFA 3DBRB 4LNNA 3HM6X 1PYWD 1WXAA 3DWGC 4W9CA 3U52E 4URKA 2UWQA 3MHZA 1SE3A 3TUOA 3V62A 1E8ZA 3BK2A 1NEKB 2X8XX 4US8A 2ZNVC 4HROA 2JT4B 4W9HA 1VD2A 2G3QB 1I4GA 2L32A 4ICVA 4L2YA 1CQVA 2LASA 3VAWA 4WQOB 1R4MB 5D6JB 3AU4A 2L7RA 2NVUI 3DVNV 1N61A 2DAJA 2RPQA 2LRUA 1GPXA 1UGJA 4LNFA 2ZNVB 1E8WA 3ZJVA 2NPTA 1BMLC 1V8CA 2MP2A 2R2OA 1PUTA 2KANA 3VRAB 2JVCA 4LCDE 1SE4A 2MJEA 4LNOA 3Q8BA 2L8JA 2LEKA 1WRDB 1QOFA 4ZRKA 5E6JA 1SEBD 3ZRCA 2CR5A 4KGSA 3ZXVA 3SFEB 5C23A 1NYRA 1H8CA 2WX1A 4JWSC 2PTLA 3RNEC 1GAQB 4N6EB 3OWEB 1VRAB 5HG2A 2AX5A 2HJ8A 3APCA 1QT9A 2QDFA 3NVYA 5DPSA 3AE7B 3Q8EA 2WXKA 1L6UA 3ML8A 1TS5A 1YMHE 5LXHA 4K7WA 1D5ZC 2KTRB 4MACA 1E9MA 1EU3A 2NR2A 1L4ZB 1IGDA 2M56B 2OJRA 1V6EA 2C5LC 2LGDA 3ZNZB 2QSDA 3MC0B 1VZ8A 2QMTA 4ANXA 5E6OA 4KSKC 1JWBD 4J6IA 3KUCB 1Z2MA 4LNKA 1SIFA 1WXVA 4CHKA 1YIWA 1N60A 2O6VD 2V4LA 3N1YC 3D32A 2JRHA 3ZQ4A 4DXGA 3A33B 1WM3A 1YNTE 3IXSA 4MJSA 3J9CA 3UQAA 2FCSA 2V9HA 2CHXA 1ZE3D 1YN5A 1F2RC 2M8SA 2JZZA 2JXTA 2L3ZA 2J0MA 4O1NA 2INPE 1D5MC 4B95A 3V6EB 3MC8A 3N3KB 2N9PC 4C56C 3JVZX 1FNVA 2Y5PA 3DHIC 2KFKA 3FILA 3IFWB 4TQ1A 4DHJD 1ZDVA 1F2RI 1T0RC 1XCTL 2LZ6A 1C3TA 2YVCA 1WGKA 2WXIA 1QQRA 3ZYYX 5DPWA 3VTVA 4DXFA 1HXYD 4JIOU 5EE0A 2N9XA 4B9KA 2WXFA 1EWYC 2WLBA 2KJ6A 1R7SA 4LNIA 4NJ7A 1FO4A 1DOYA 3ALBA 4ZYSA 4ACFA 1LQBA 2DWQA 2WU2B 4II3B 5JHAA 3TEXA 3JW0X 1F77A 3Q8FA 1WE7A 4KKIA 3IVFA 1VDVA 2XK5A 4WJOA 3I57A 4YWGG 5FKAC 1EU4A 2MBQA 1GC7A 2K3UA 4BBNF 2V1YA 4XX5A 2EKIA 3PGEA 2Q5WD 3AULA 3ZLZA 3A4RA 3O65B 4FADA 1L6VA 1FEHA 1TY2A 4F1SA 2KDMA 1D5XC 3H9DA 3V6CB 3WAOA 1UBQA 3Q69A 1M94A 2K8HA 1P7FA 5TR5A 2PIAA 3JSVA 1V5TA 1PGXA 3QIJA 4HCNB 1D3ZA 3DDCB 1NI3A 4LJPB 1P0RA 3AE8B 3QK0A 3NHEB 4TQ0A 1TY0A 5G55A 2AQ3B 4W9DA 1V80A 1YQBA 4II2B 4M00A 3EFCA 3P1MA 4IM0A 1ZUD2 2PJHA 2LD9A 4BOZB 3H6NA 1QOGA 3APDA 2DYOA 1MHXA 2KDEB 2DBYA 2CS4A 2LVOA 4HK2A 1YX6B 2Z0DB 4B6WA 2W82A 2WDRB 3VHTC 2ACZB 1WX7A 2AYOB 2BS3B 2W3SA 1ZOYB 2WWZA 3AEGB 4C4VB 2IZVB 2LVQA 3W1SA 2WXGA 4ZHPA 3QHTA 4MEMA 3NJTA 1Y8RC 4DDID 1GG3A 3RNAC 2Z0EB 4RGNA 2GBRA 2ZPNA 2CHZA 4OVZA 1YQ4B 4G50A 4RF1A 3T8MA 2D3GA 5LNK1 2KC2A 4HEA1 1FXTB 2W9NA 3IAS1 3P4SB 2N7EA 1WX9A 1OEYA 2R61A 2AQ1B 2KTFA 1C76A 4YSZB 1EWCA 3NY5A 1JWSD 1WGHA 2VRRB 2V0GA 3ABVB 4JX1C 2E6XA 5CHWA 3RCZA 3A9KB 2NBVB 2DYBA 2MWSB 2VZKD 4AQ7A 2IY1B 5GXGB 4ANVA 3AE2B 2GBJA 5H8YE 2C7NB 2GBKA 2NCNA 2N4FA 3PPAA 1F52A 5CHVC 3ZTCA 2QIEB 1TS4A 1P1AA 3N30A 3QARA 3BINA 4FN2A 1XF5L 4RMAA 3WIMA 4WWMA 4XYCA 1WJ4A 1DOIA 2JF5A 2KLCA 4P1CC 5D3DA 3QC8B 2HDEA 3QQ8B 3S2AA 1TYGB 3PSEB 2WXPA 3K9OB 4HKQA 2KD0A 1XLQA 4AJWA 1P98A 1QLBB 4M02A 3IAM1 2LI5A 4C7YA 5AUIA 1RFKA 2HD5B 1KLUD 2LGYA 1FIQA 2GLSA 2KKCA 3AMZA 1T0QC 1M4VA 1WGYA 2RPVA 5D2MB 1I4RA 2FNJB 2WQYB 1PGAA 1ZGUB 2WU5B 1QF6A 2M0XA 2WXOA 4FJZA 4ASWC 1IBXB 1GB4A 3NVWA 4IG7B 4JGHB 5CTRC 5J2RA 3KWLA 4EE2A 3B2FA 4S17A 3SFDB 2WHIA 3NVZA 5AUKA 3UQBA 3M62B 1FCLA 3P4PB 2G4SA 4FJVB 1WR1A 4G3XB 1C4PA 3AEBB 2KN4A 4TKNA 2G4DB 1E7UA 2RGFA 2LHEA 3A1QB 4P16A 1NENB 4YSYB 2N9KA 5AEKB 3EUB2 3TL5A 5IP4D 1N5XA 3N9YC 2I38A 4XC2A 2GBNA 2KWCA 4WAAA 1SIJA 3VTUA 3SHQA 4DHZB 2IBIB 4KIKB 4MGZE 5C1ZA 4A9AA 4YSXB 1XT9B 2MQJA 4MSQB 1L0XB 3ZJTA 4WWOA 2BWFA 1SJED 4W9LA 3KYDD 1KF6B 1SF0A 1TZ1A 2MEKA 4RFBA 1WJNA 1YJ1A 3Q8CA 2K5PA 4XDDA 2HTME 1Q1OA 3URYA 1ZDXA 4NNJB 3PHXB 3RFZB 3BYYB 2KWDA 1JCKB 3H7PB 2ZVOA 3LJ3A 4ANUA 1JWUD 5HFYA 1ET6A 3OLMD 3U4EG 2LJIA 4DHZE 3X23A 2KTRA 3KQ4A 4GIVA 4GOCA 3ZO5B 1VR9A 3WAMA 4HDQA 1OGWA 3M95A 1LM8B 4C00A 1J7CA 2KHWB 2V4IB 1N5WA 4KSLC 2IGDA 1I4PA 2AWTA 1AYFA 1V1OA 2A5UA 2FCNA 4RGTA 2KDBA 1FNUA 1MVKA 3L0WB 2KQSA 2BKRB 2DYMA 1KOTA 4PS8A 5LXIB 2BYTA 1J7AA 1I4QA 3MHSD 1EM7A 2L05A 3WAPA 2QCZA 4WJQA 3VDZA 1FPYA 4FHKA 2N7DA 2NBWB 3CSTA 2B76B 1RWSA 4Q2JA 1R4NB 3FAHA 4J3OD 2FIFA 3BVZA 3WCQA 3TSSA 3JYUA 3N1XC 4JPSA 1TKGA 1N6ZA 3QX1A 3LDZE 2J7QB 1V1PB 4IM3A 2Z8LA 3ZDMC 3KLSX 3SEBA 3IHPC 4LDTD 1SXTA 1AN8A 1S3SG 4WJNA 4W9KA 5HI1A 4KGTA 4L23A 1VZ6A 3HVZA 2PVOD 4OHJA 1HE8A 2BYEA 1SJHD 3GS2A 2REXA 4WQMA 1STEA 3RNCC 1RRBA 4A20A 1QZEA 2YLMA 1WSPA 3RN9C 1RYJA 1V97A 4E71A 4ZYNA 1WMHB 1NDDA 3RYTA 2TSSA 2GB1A 4P1BC 1UF0A 4HKZE 3DOWA 2CHWA 3P63A 1KRHA 5MPOA 4W9GA 4ICUA 2RDBC 1GUAB 4C7ZA 1PQSA 5IKCM 2XBBC 2K6DB 3PRZA 1PFDA 1WYGA 4LJOB 1E6EB 4NAWB 4RNAA 3W5UB 5JH5C 2WXJA 2W55A 1TT5B 2KN5A 2BB5A 2NBUA 4BKSA 2ON8A 1ENFA 3PRPB 5D94A 4EEWA 3ZXRA 1UBIA 2KX3A 2J42A 3AEAB 2BWES 2MJDA 3NVVA 3GZNI 4NY0A 4EOYA 4I6LB 2WDTB 1EF1A 1C78A 2WXHA 3R8BA 1YX5B 3QJZA 2MJ3A 1XLPA 2DX5B 1E5WA 2ZZPB 2PEAA 3NRZA 2JYTA 3AXCA 1UD7A 3T3OA 4W9FA 1C4AA 2WP9B 2Y5CA 4KVGB 3HHMA 2C7MB 3QWZB 4C4VA 1IGCA 3BZDB 1YN4A 1QOBA 1FXAA 2O2VB 3AB5A 2DZIA 2JRIB 3C8YA 1YN3A 2IO1B 1XQQA 2JWUA 3ZNGC 1MFWA 1BT0A 3WANA 5IA7A 3PVLA 3VUXA 4AS1A 4N59A 3SR6A 4OVVA 3RMKC 1VZ7A 3KW5B 1DOXA 1WR6E 1TKYA 1WXQA 4BKGA 3TEZA 3U8ZA 1YJJA 3AN1A 4CQNA 1J8CA 4H2AA 4W9EA 1IP9A 4KZCA 4ZRJA 2SAKA 2LJ5A 3DVGX 1NI2A 1A70A 1E7PB 5J17A 3A9KA 3AM9A 1LFDA 1Q0WB 1FMAD 2KAJA 4YL8A 2W54A 4NQKE 2DAFA 1ZW7A 3TBLD 3Q3MC 3BVMA 4LTUA 2BW2A 3OAWA 3FKYA 2W3RA 2O6VB 2PVGC 2EELA 3LYYA 4EZJA 2ZW1A 4GDLB 3R7QA 3AE3B 2KQ4X 1CJEA 4RH6A 4IWPA 2ZW0A 4FA6A 1G6JA 3APFA 2KJRA 3QCAA 1EF5A 3HUIA 3R7RA 2KK8A 2Z59B 3Q3OC 3VFKA 3AE5B 2LGSA 5AZGA 1D4BA 1V2YA 2M0AA 4A55A 1T6BX 4DHJB 1V49A 4EZLA 4KDLB 5HKHA 1TBEA 3AE4B 5GMVA 4YT0B 3VRBB 2KYWA 4OZAA 4HJGE 3DCGA 3T9LA 3R2TA 4YTNB 4GB9A 4MH8A 4HRSA 2LFIA 2FUG1 3BWUD 4MGKE 4BOSC 3GB1A 1K52A 1TKEA 3TEYA 5DCNA 3B9JA 1J0GA 4MT5A 1WGGA 4RM9A 2JYEA 3PHWB 5BMIA 4S0RA 4ARIA 1P3QU 3L54A 3DWMA 4BKTA 2FCMA 3KWVA 1WE6A 3A1QA 5IAAC 3Q3JA 3M63B 4M8MA 4QAYA 4BFRA 4DDGD 4KKJA 3GE8C 2ONQA 1K50A 1HQRD 4A8XC 1FRDA 2KC1A 2NTSA 3SDLC 3UIPB 5CHFA 4KIKA 1HZ5A 4IUMB 1KM7A 1WM2A 3W1YA 3NG0A 4JLCA 1ZXHA 4K7SA 4XWWA 3VQIA 2K39A 3PREA 3I63C 2YEPF 4CYEA 1Q10A 1XXGA 3KUZA 2WXQA 5L83A 1CMXB 2BT6A 4F8CB 1WWTA 4FHJA 2YEPB 1MG8A 3H7PA 1AW7A 1T5XD 4GMVA 3RZFA 1F9JA 2BS2B 2K8CA 2KDIA 2HTHA 2KACA 4XWTA 1XD3B 2CKHB 1ZXIA 4KZ0A 4ZRIA 1C4CA 2ZCCA 3Q3NC 2M1MA 3VH3B 3UINB 1KJTA 5JHBA 1S1QB 2IGGA 4GDKB 4G11A 4GGQA 4HCPB 5G5GA
chains in the Genus database with same CATH topology
3PS6A 3PHXB 2UYZB 1LXDA 2D2QA 3H7PB 2L8JA 2ZVOA 1I35A 3LJ3A 1WRDB 3HM3A 4ZRKA 4ANUA 3IBEA 5E6PA 3PLVA 2JXXA 3OLMD 4MGIE 4NPNA 3ZRCA 4BKSD 2CR5A 4FBJB 4DHZE 3X23A 2KTRA 4BBNC 5C23A 1JRUA 2KWUB 3EFUA 1H8CA 2WX1A 2BGFA 2IYDB 4GIVA 3IG3A 4GOCA 3ZO5B 1WJUA 3L10B 3WAMA 1I42A 4HDQA 4HPMB 4TV3A 2KXJA 1OGWA 3M95A 1LM8B 4PS7A 5KHQA 1P9DU 3L17A 4I6NB 2MCNB 2KHWB 2RD0A 2HJ8A 2NPTB 3APCA 2MP2B 4KSLC 4W9JA 3TCAA 2AWTA 3SD5A 5AZFA 2A5UA 5DPSA 4KDIC 4IWQA 4E3CA 2IO3B 2FCNA 2LGXA 1J19A 3UF8A 3ML8A 2KDBA 2FCQA 3ECIA 2L0TA 2B3AA 3DVGY 2AEHA 3L0WB 3ZIMA 2KQSA 2R2QA 2BKRB 1Q5WB 2DYMA 3DBHI 5LXHA 4OVUA 4K7WA 1KOTA 2EMSA 4EFOA 1E90A 2MX2A 2KTRB 1WIAA 2MBOA 2IY0B 1V5OA 1AARA 4PS8A 1WZ0A 5LXIB 1EO6A 2NR2A 2OJRA 3N32A 4HWIB 2MSED 1RLFA 3MHSD 2L05A 1L7YA 2KX0A 3WAPA 1V6EA 2C5LC 4WJQA 2LGDA 3ZNZB 5EDSA 3VDZA 4FHKA 2CU1A 2N7DA 2NBWB 3CSTA 2KLGA 4AOFA 5E6OA 2KMAA 3BY4B 4KSKC 4ANXA 2PPHA 2FIFA 4J6IA 3KUCB 1Z2MA 4MM3A 1SIFA 3JYUA 1WXVA 3EC8A 1NBFC 3QX1A 4CHKA 2NS5A 3LDZE 1YIWA 2J7QB 4IM3A 2G45B 2O6VD 2V4LA 3ZDMC 3QAQA 3UIOB 3D32A 2JRHA 4NQLB 3A33B 1WM3A 3IHPC 2JZ3B 4LDTD 4GU2A 5J18A 1S3SG 1C1YB 4MJSA 4WJNA 4W9KA 3UQAA 3VH4B 1WH3A 2FCSA 1YD8U 2CHXA 2KWVB 1HE8A 2M8SA 5AZHA 1E8XA 2BYEA 2JZZA 2MBBB 2L3ZA 2J0MA 4NAWA 1WX8A 2REXA 4B95A 3V6EB 2RR9A 4AWJA 3N3KB 1RRBA 1OEYJ 1WJ6A 2IO2B 3Q3FA 2WX0A 4A20A 1QZEA 2YLMA 5LLIA 2KVRA 2N9PC 1WFYA 4NJ6A 3JVZX 1Z5SB 3W1SC 2KFKA 4E71A 4GXBA 4X57B 4ZYNA 4HLEA 1WMHB 1NDDA 3DBSA 3RYTA 3IFWB 4TQ1A 2JPHA 3ZW3A 4DHJD 3RZWC 1V81A 1ISNA 3MTNB 2L0FA 1RFAA 2L00B 3DOWA 2CHWA 2LZ6A 3CMMB 1C3TA 2YVCA 5DPWA 4W9GA 4ICUA 1GUAB 3VTVA 2ZVNA 1TTNA 4JIOU 1PQSA 4MJSB 2N9XA 2XBBC 4B9KA 4WWPA 2K6DB 3PT2B 3PZDA 3AU5A 3PRZA 3GOEA 4GSWA 4LJOB 3RULA 3NZUA 3VTWA 2KJ6A 3DBLI 4NAWB 4NJ7A 5JH5C 2KN5A 2M4NA 1WY8A 3ALBA 3EHVA 1LQBA 2IO0B 2NBUA 4BKSA 4W9IA 4II3B 4DXAB 5JHAA 3PRPB 2OOBB 3JW0X 5D94A 1V9JA 4EEWA 1GNUA 2KFKB 1UBIA 4IM2A 3L16A 4MELA 2D07B 1WE7A 2KX3A 2BWES 3IVFA 3GZNI 4IWOA 2XK5A 4NY0A 4EOYA 4WJOA 4I6LB 2WDTB 2O2VA 1EF1A 1WI0A 2I1JA 2JUOA 1GC7A 2MBQA 4PYZA 3NS8A 4BBNF 2V1YA 4XX5A 4ANWA 2LUEA 2MLBA 4PYUA 3PGEA 3AULA 3ZLZA 3A4RA 2MBEA 3O65B 1YX5B 2QHOA 2MBHA 4G0NB 4FADA 3QJZA 4HVBA 4F1SA 2LWPA 3H9DA 2DX5B 1E5WA 3V6CB 3WAOA 1UBQA 2ZEQA 2ZZPB 1M94A 2K8HA 1E8YA 2PEAA 3AXCA 1UD7A 5TR5A 4W9FA 2LXAA 1SE9A 5KHOA 3JSVA 1U4AA 2XEWA 2PE6B 4KVGB 1V5TA 3QIJA 4HCNB 1D3ZA 2DHZA 3DDCB 2C7MB 1P0RA 3HHMA 4IC7B 4LJPB 3QWZB 4ZDVA 1ZKHA 2WYQA 3M3JA 3QK0A 4AUQC 3NHEB 4TQ0A 3V60A 4HXDA 2D10A 2ZPYA 5G55A 2XK5B 3KYCD 3UGBB 4W9DA 1V80A 1YQBA 4AJYB 5D7GA 2O2VB 5FR6A 3NZSA 4II2B 2M17A 3EECA 2KDFB 2DZIA 4A3OA 4IM0A 1RAXA 2JRIB 2IO1B 2PJHA 1XQQA 1L2NA 1WXSA 3ZNGC 2V3SA 2JWZA 1BT0A 2LD9A 4HJKA 4BOZB 3H6NA 3WANA 3A4SC 3APDA 4A3PA 5IA7A 3PVLA 3HIZA 2L76A 3VUXA 2MA9B 1WMHA 2DYOA 4M8NA 2KDEB 2LVOA 2CS4A 4RM8A 4OVVA 4HK2A 3ML9A 3KW5B 2O6VA 1WR6E 1YX6B 1VCBA 4BKGA 4K7UA 2Z0DB 4B6WA 3U8ZA 3ZUNA 2GMIC 4CO7A 2KMCA 3JSVB 3VHTC 1WX7A 4DWFA 1J8CA 2AYOB 4W9EA 4GDLA 1IP9A 4KZCA 3CSFA 4GN1A 4ZRJA 3NOBA 2J0JA 1T0YA 2FUHB 2JY6A 2LJ5A 2WWZA 3DVGX 1NI2A 5J17A 2IZVB 3ZKJC 3ZTDA 1H4RA 3A9KA 2LVQA 1LFDA 2K8BA 3W1SA 1Q0WB 3V61A 3QHTA 1SGHA 4MEMA 1Y8RC 4DDID 1GG3A 2FIDA 3PLUA 4YL8A 4NQKE 2Z0EB 2DAFA 1ZW7A 1E7VA 4K1RB 3RUIB 3TBLD 3TIXA 1WGDA 1GJZA 2GBRA 2KFJA 2ZPNA 2CHZA 3DPDA 3DBRI 4JQWC 2K1FA 3OAWA 2MW5A 4G50A 3T8MA 2D3GA 3ZNHB 3VUYA 3VUWA 2PE9A 3TMPB 2I1KA 2BYVE 2KC2A 4DK5A 1FXTB 2LRWA 2W9NA 2O6VB 5DPTA 4BVUC 2N9EB 2BPSA 3A9JA 2N7EA 4XZ4A 1WX9A 4LDTB 4EZJA 1WF9A 2J0KA 1OEYA 3PTFC 4GDLB 2KTFA 2DZKA 3TJPA 4MH0E 3R7QA 3NY5A 1WGHA 2VRRB 1GC6A 4IW0A 5CHWA 3RCZA 3A9KB 2ASQA 4IWPA 2NBVB 3RD2A 2DYBA 3ZRFA 4FA6A 2C9WB 2MWSB 1R4MI 1A5RA 3OJ4B 4E74A 1G6JA 3APFA 3H1UA 2IY1B 2KJRA 3OJ3A 3ZVVA 4ANVA 3QCAA 3ZNID 1EF5A 3H7SA 2GBJA 1UGMA 2C7NB 2N1VA 2KK8A 2GBKA 2NCNA 2Z59B 3CF6E 4MGYE 3R7RA 3VFKA 2N4FA 3R3MA 5AZGA 3PPAA 3MJWA 3DVNU 1V2YA 3PRMB 5CHVC 3ZTCA 1P1AA 3N30A 3QARA 4DHJB 1V49A 3BINA 4EZLA 2C7HA 4KDLB 5HKHA 4FN2A 1TBEA 4RMAA 4MSMB 3WIMA 4FJYA 1WZ3A 5GMVA 4F7ZA 3A9JB 1WJ4A 4M0WB 2JF5A 2KLCA 3QC8B 5BO4B 5G2NA 1OTRB 1IPGA 4HPLB 1IYFA 2GOWA 1UZXB 3QQ8B 3DCGA 3T9LA 4AP4C 3L13A 3R66C 3S2AA 2MRPA 1OQYA 3I3TB 3PSEB 3VVWB 4GB9A 1TGZB 3K9OB 2DENB 2KD0A 4MGKE 4BOSC 2A4ZA 5DCNA 2AL3A 2BF8B 4AJWA 2ZCBA 5CX3A 3AI5A 1J0GA 1WGGA 1P98A 4RM9A 3ZDTA 3PHWB 4HDOA 4FLHA 2KOXA 1EUVB 2EMTA 2LI5A 3WA0A 2KQ7A 3SU8X 1P3QU 4N9F4 2C60A 1X1MA 3K9PB 3KH0A 3L54A 2HD5B 3U30A 2LGYA 2KKCA 4BKTA 2K6QA 2FCMA 2DZJA 4P7IA 1WE6A 3A1QA 5L95C 3DQVA 5IAAC 3B1LX 1WGYA 3Q3JA 3M63B 4M8MA 5D2MB 2FNJB 2Y5BB 4BFRA 4DDGD 2N1WA 1ZGUB 4I6PA 3B0AA 2M0XA 2AL6A 4FJZA 4ASWC 1WYWB 4WJPA 4IG7B 3RT3B 1WGRA 4JGHB 3PV1A 4PS3A 2GBMA 5CTRC 5DPRA 2KC1A 5J2RA 2BYFA 2D11A 4FULA 3P2BA 3SDLC 4JL9A 2LXCA 3HK0A 3UIPB 4MDKE 1R4NI 4EZKA 4EKUA 5CHFA 5E6NA 4KIKA 4IUMB 2FAZA 4EUTA 1KM7A 3UQBA 1WM2A 3M62B 1WXMA 3W1YA 1V86A 2G4SA 4FJVB 2LVPA 3C0RB 3L08A 4JLCA 1WR1A 2RSUA 3B08A 4G3XB 4K7SA 4TKNA 3VXWA 3WALA 2G4DB 3VQIA 1E7UA 1K8RB 2K39A 2KZRA 2BKFA 2RGFA 3A1QB 3KUDB 3PREA 2KO3A 3X0WA 4CYEA 3HM6X 2HE7A 1WXAA 4URKA 4W9CA 2UWQA 3ENEA 3V62A 3KUZA 5L83A 4WWNA 1CMXB 5AEKB 1E8ZA 4GDKA 4KV2A 4F8CB 1KLVA 3QA8A 4FHJA 4TUUA 3TL5A 2ZNVC 1MG8A 3H7PA 2KJHB 4GMVA 2EKEC 3RZFA 3U7DA 4XC2A 2GBNA 2KWCA 4WAAA 2JT4B 1F9JA 3VTUA 3SHQA 4W9HA 4DHZB 2K8CA 1VD2A 2HTHA 2KDIA 2IBIB 2G3QB 4KIKB 4MGZE 4DBGA 4ICVA 1XD3B 5C1ZA 2LASA 3VAWA 4WQOB 4K81A 1UELA 5D6JB 1XT9B 2CKHB 2MQJA 2L7RA 2NVUI 3AU4A 4KZ0A 2DZMA 4MSQB 3DVNV 2DAJA 4ZRIA 2RPQA 4WWOA 2LRUA 2BWFA 3KVFB 5JZEB 2ZCCA 2M1MA 4W9LA 2ZNVB 3VH3B 2ZJDA 3KYDD 1E8WA 3UINB 1KJTA 1TZ1A 2NPTA 2MP2A 2R2OA 5JHBA 2KANA 2K25A 1WJNA 1S1QB 3ONSA 1UH6A 1YJ1A 2JVCA 4GDKB 2KNBA 4G11A 4GGQA 4HCPB 4LCDE 1Q1OA 4NNJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS6 A;  3PHX B;  2UYZ B;  1LXD A;  2D2Q A;  3H7P B;  2L8J A;  2ZVO A;  1I35 A;  3LJ3 A;  1WRD B;  3HM3 A;  4ZRK A;  4ANU A;  3IBE A;  5E6P A;  3PLV A;  2JXX A;  3OLM D;  4MGI E;  4NPN A;  3ZRC A;  4BKS D;  2CR5 A;  4FBJ B;  4DHZ E;  3X23 A;  2KTR A;  4BBN C;  5C23 A;  1JRU A;  2KWU B;  3EFU A;  1H8C A;  2WX1 A;  2BGF A;  2IYD B;  4GIV A;  3IG3 A;  4GOC A;  3ZO5 B;  1WJU A;  3L10 B;  3WAM A;  1I42 A;  4HDQ A;  4HPM B;  4TV3 A;  2KXJ A;  1OGW A;  3M95 A;  1LM8 B;  4PS7 A;  5KHQ A;  1P9D U;  3L17 A;  4I6N B;  2MCN B;  2KHW B;  2RD0 A;  2HJ8 A;  2NPT B;  3APC A;  2MP2 B;  4KSL C;  4W9J A;  3TCA A;  2AWT A;  3SD5 A;  5AZF A;  2A5U A;  5DPS A;  4KDI C;  4IWQ A;  4E3C A;  2IO3 B;  2FCN A;  2LGX A;  1J19 A;  3UF8 A;  3ML8 A;  2KDB A;  2FCQ A;  3ECI A;  2L0T A;  2B3A A;  3DVG Y;  2AEH A;  3L0W B;  3ZIM A;  2KQS A;  2R2Q A;  2BKR B;  1Q5W B;  2DYM A;  3DBH I;  5LXH A;  4OVU A;  4K7W A;  1KOT A;  2EMS A;  4EFO A;  1E90 A;  2MX2 A;  2KTR B;  1WIA A;  2MBO A;  2IY0 B;  1V5O A;  1AAR A;  4PS8 A;  1WZ0 A;  5LXI B;  1EO6 A;  2NR2 A;  2OJR A;  3N32 A;  4HWI B;  2MSE D;  1RLF A;  3MHS D;  2L05 A;  1L7Y A;  2KX0 A;  3WAP A;  1V6E A;  2C5L C;  4WJQ A;  2LGD A;  3ZNZ B;  5EDS A;  3VDZ A;  4FHK A;  2CU1 A;  2N7D A;  2NBW B;  3CST A;  2KLG A;  4AOF A;  5E6O A;  2KMA A;  3BY4 B;  4KSK C;  4ANX A;  2PPH A;  2FIF A;  4J6I A;  3KUC B;  1Z2M A;  4MM3 A;  1SIF A;  3JYU A;  1WXV A;  3EC8 A;  1NBF C;  3QX1 A;  4CHK A;  2NS5 A;  3LDZ E;  1YIW A;  2J7Q B;  4IM3 A;  2G45 B;  2O6V D;  2V4L A;  3ZDM C;  3QAQ A;  3UIO B;  3D32 A;  2JRH A;  4NQL B;  3A33 B;  1WM3 A;  3IHP C;  2JZ3 B;  4LDT D;  4GU2 A;  5J18 A;  1S3S G;  1C1Y B;  4MJS A;  4WJN A;  4W9K A;  3UQA A;  3VH4 B;  1WH3 A;  2FCS A;  1YD8 U;  2CHX A;  2KWV B;  1HE8 A;  2M8S A;  5AZH A;  1E8X A;  2BYE A;  2JZZ A;  2MBB B;  2L3Z A;  2J0M A;  4NAW A;  1WX8 A;  2REX A;  4B95 A;  3V6E B;  2RR9 A;  4AWJ A;  3N3K B;  1RRB A;  1OEY J;  1WJ6 A;  2IO2 B;  3Q3F A;  2WX0 A;  4A20 A;  1QZE A;  2YLM A;  5LLI A;  2KVR A;  2N9P C;  1WFY A;  4NJ6 A;  3JVZ X;  1Z5S B;  3W1S C;  2KFK A;  4E71 A;  4GXB A;  4X57 B;  4ZYN A;  4HLE A;  1WMH B;  1NDD A;  3DBS A;  3RYT A;  3IFW B;  4TQ1 A;  2JPH A;  3ZW3 A;  4DHJ D;  3RZW C;  1V81 A;  1ISN A;  3MTN B;  2L0F A;  1RFA A;  2L00 B;  3DOW A;  2CHW A;  2LZ6 A;  3CMM B;  1C3T A;  2YVC A;  5DPW A;  4W9G A;  4ICU A;  1GUA B;  3VTV A;  2ZVN A;  1TTN A;  4JIO U;  1PQS A;  4MJS B;  2N9X A;  2XBB C;  4B9K A;  4WWP A;  2K6D B;  3PT2 B;  3PZD A;  3AU5 A;  3PRZ A;  3GOE A;  4GSW A;  4LJO B;  3RUL A;  3NZU A;  3VTW A;  2KJ6 A;  3DBL I;  4NAW B;  4NJ7 A;  5JH5 C;  2KN5 A;  2M4N A;  1WY8 A;  3ALB A;  3EHV A;  1LQB A;  2IO0 B;  2NBU A;  4BKS A;  4W9I A;  4II3 B;  4DXA B;  5JHA A;  3PRP B;  2OOB B;  3JW0 X;  5D94 A;  1V9J A;  4EEW A;  1GNU A;  2KFK B;  1UBI A;  4IM2 A;  3L16 A;  4MEL A;  2D07 B;  1WE7 A;  2KX3 A;  2BWE S;  3IVF A;  3GZN I;  4IWO A;  2XK5 A;  4NY0 A;  4EOY A;  4WJO A;  4I6L B;  2WDT B;  2O2V A;  1EF1 A;  1WI0 A;  2I1J A;  2JUO A;  1GC7 A;  2MBQ A;  4PYZ A;  3NS8 A;  4BBN F;  2V1Y A;  4XX5 A;  4ANW A;  2LUE A;  2MLB A;  4PYU A;  3PGE A;  3AUL A;  3ZLZ A;  3A4R A;  2MBE A;  3O65 B;  1YX5 B;  2QHO A;  2MBH A;  4G0N B;  4FAD A;  3QJZ A;  4HVB A;  4F1S A;  2LWP A;  3H9D A;  2DX5 B;  1E5W A;  3V6C B;  3WAO A;  1UBQ A;  2ZEQ A;  2ZZP B;  1M94 A;  2K8H A;  1E8Y A;  2PEA A;  3AXC A;  1UD7 A;  5TR5 A;  4W9F A;  2LXA A;  1SE9 A;  5KHO A;  3JSV A;  1U4A A;  2XEW A;  2PE6 B;  4KVG B;  1V5T A;  3QIJ A;  4HCN B;  1D3Z A;  2DHZ A;  3DDC B;  2C7M B;  1P0R A;  3HHM A;  4IC7 B;  4LJP B;  3QWZ B;  4ZDV A;  1ZKH A;  2WYQ A;  3M3J A;  3QK0 A;  4AUQ C;  3NHE B;  4TQ0 A;  3V60 A;  4HXD A;  2D10 A;  2ZPY A;  5G55 A;  2XK5 B;  3KYC D;  3UGB B;  4W9D A;  1V80 A;  1YQB A;  4AJY B;  5D7G A;  2O2V B;  5FR6 A;  3NZS A;  4II2 B;  2M17 A;  3EEC A;  2KDF B;  2DZI A;  4A3O A;  4IM0 A;  1RAX A;  2JRI B;  2IO1 B;  2PJH A;  1XQQ A;  1L2N A;  1WXS A;  3ZNG C;  2V3S A;  2JWZ A;  1BT0 A;  2LD9 A;  4HJK A;  4BOZ B;  3H6N A;  3WAN A;  3A4S C;  3APD A;  4A3P A;  5IA7 A;  3PVL A;  3HIZ A;  2L76 A;  3VUX A;  2MA9 B;  1WMH A;  2DYO A;  4M8N A;  2KDE B;  2LVO A;  2CS4 A;  4RM8 A;  4OVV A;  4HK2 A;  3ML9 A;  3KW5 B;  2O6V A;  1WR6 E;  1YX6 B;  1VCB A;  4BKG A;  4K7U A;  2Z0D B;  4B6W A;  3U8Z A;  3ZUN A;  2GMI C;  4CO7 A;  2KMC A;  3JSV B;  3VHT C;  1WX7 A;  4DWF A;  1J8C A;  2AYO B;  4W9E A;  4GDL A;  1IP9 A;  4KZC A;  3CSF A;  4GN1 A;  4ZRJ A;  3NOB A;  2J0J A;  1T0Y A;  2FUH B;  2JY6 A;  2LJ5 A;  2WWZ A;  3DVG X;  1NI2 A;  5J17 A;  2IZV B;  3ZKJ C;  3ZTD A;  1H4R A;  3A9K A;  2LVQ A;  1LFD A;  2K8B A;  3W1S A;  1Q0W B;  3V61 A;  3QHT A;  1SGH A;  4MEM A;  1Y8R C;  4DDI D;  1GG3 A;  2FID A;  3PLU A;  4YL8 A;  4NQK E;  2Z0E B;  2DAF A;  1ZW7 A;  1E7V A;  4K1R B;  3RUI B;  3TBL D;  3TIX A;  1WGD A;  1GJZ A;  2GBR A;  2KFJ A;  2ZPN A;  2CHZ A;  3DPD A;  3DBR I;  4JQW C;  2K1F A;  3OAW A;  2MW5 A;  4G50 A;  3T8M A;  2D3G A;  3ZNH B;  3VUY A;  3VUW A;  2PE9 A;  3TMP B;  2I1K A;  2BYV E;  2KC2 A;  4DK5 A;  1FXT B;  2LRW A;  2W9N A;  2O6V B;  5DPT A;  4BVU C;  2N9E B;  2BPS A;  3A9J A;  2N7E A;  4XZ4 A;  1WX9 A;  4LDT B;  4EZJ A;  1WF9 A;  2J0K A;  1OEY A;  3PTF C;  4GDL B;  2KTF A;  2DZK A;  3TJP A;  4MH0 E;  3R7Q A;  3NY5 A;  1WGH A;  2VRR B;  1GC6 A;  4IW0 A;  5CHW A;  3RCZ A;  3A9K B;  2ASQ A;  4IWP A;  2NBV B;  3RD2 A;  2DYB A;  3ZRF A;  4FA6 A;  2C9W B;  2MWS B;  1R4M I;  1A5R A;  3OJ4 B;  4E74 A;  1G6J A;  3APF A;  3H1U A;  2IY1 B;  2KJR A;  3OJ3 A;  3ZVV A;  4ANV A;  3QCA A;  3ZNI D;  1EF5 A;  3H7S A;  2GBJ A;  1UGM A;  2C7N B;  2N1V A;  2KK8 A;  2GBK A;  2NCN A;  2Z59 B;  3CF6 E;  4MGY E;  3R7R A;  3VFK A;  2N4F A;  3R3M A;  5AZG A;  3PPA A;  3MJW A;  3DVN U;  1V2Y A;  3PRM B;  5CHV C;  3ZTC A;  1P1A A;  3N30 A;  3QAR A;  4DHJ B;  1V49 A;  3BIN A;  4EZL A;  2C7H A;  4KDL B;  5HKH A;  4FN2 A;  1TBE A;  4RMA A;  4MSM B;  3WIM A;  4FJY A;  1WZ3 A;  5GMV A;  4F7Z A;  3A9J B;  1WJ4 A;  4M0W B;  2JF5 A;  2KLC A;  3QC8 B;  5BO4 B;  5G2N A;  1OTR B;  1IPG A;  4HPL B;  1IYF A;  2GOW A;  1UZX B;  3QQ8 B;  3DCG A;  3T9L A;  4AP4 C;  3L13 A;  3R66 C;  3S2A A;  2MRP A;  1OQY A;  3I3T B;  3PSE B;  3VVW B;  4GB9 A;  1TGZ B;  3K9O B;  2DEN B;  2KD0 A;  4MGK E;  4BOS C;  2A4Z A;  5DCN A;  2AL3 A;  2BF8 B;  4AJW A;  2ZCB A;  5CX3 A;  3AI5 A;  1J0G A;  1WGG A;  1P98 A;  4RM9 A;  3ZDT A;  3PHW B;  4HDO A;  4FLH A;  2KOX A;  1EUV B;  2EMT A;  2LI5 A;  3WA0 A;  2KQ7 A;  3SU8 X;  1P3Q U;  4N9F 4;  2C60 A;  1X1M A;  3K9P B;  3KH0 A;  3L54 A;  2HD5 B;  3U30 A;  2LGY A;  2KKC A;  4BKT A;  2K6Q A;  2FCM A;  2DZJ A;  4P7I A;  1WE6 A;  3A1Q A;  5L95 C;  3DQV A;  5IAA C;  3B1L X;  1WGY A;  3Q3J A;  3M63 B;  4M8M A;  5D2M B;  2FNJ B;  2Y5B B;  4BFR A;  4DDG D;  2N1W A;  1ZGU B;  4I6P A;  3B0A A;  2M0X A;  2AL6 A;  4FJZ A;  4ASW C;  1WYW B;  4WJP A;  4IG7 B;  3RT3 B;  1WGR A;  4JGH B;  3PV1 A;  4PS3 A;  2GBM A;  5CTR C;  5DPR A;  2KC1 A;  5J2R A;  2BYF A;  2D11 A;  4FUL A;  3P2B A;  3SDL C;  4JL9 A;  2LXC A;  3HK0 A;  3UIP B;  4MDK E;  1R4N I;  4EZK A;  4EKU A;  5CHF A;  5E6N A;  4KIK A;  4IUM B;  2FAZ A;  4EUT A;  1KM7 A;  3UQB A;  1WM2 A;  3M62 B;  1WXM A;  3W1Y A;  1V86 A;  2G4S A;  4FJV B;  2LVP A;  3C0R B;  3L08 A;  4JLC A;  1WR1 A;  2RSU A;  3B08 A;  4G3X B;  4K7S A;  4TKN A;  3VXW A;  3WAL A;  2G4D B;  3VQI A;  1E7U A;  1K8R B;  2K39 A;  2KZR A;  2BKF A;  2RGF A;  3A1Q B;  3KUD B;  3PRE A;  2KO3 A;  3X0W A;  4CYE A;  3HM6 X;  2HE7 A;  1WXA A;  4URK A;  4W9C A;  2UWQ A;  3ENE A;  3V62 A;  3KUZ A;  5L83 A;  4WWN A;  1CMX B;  5AEK B;  1E8Z A;  4GDK A;  4KV2 A;  4F8C B;  1KLV A;  3QA8 A;  4FHJ A;  4TUU A;  3TL5 A;  2ZNV C;  1MG8 A;  3H7P A;  2KJH B;  4GMV A;  2EKE C;  3RZF A;  3U7D A;  4XC2 A;  2GBN A;  2KWC A;  4WAA A;  2JT4 B;  1F9J A;  3VTU A;  3SHQ A;  4W9H A;  4DHZ B;  2K8C A;  1VD2 A;  2HTH A;  2KDI A;  2IBI B;  2G3Q B;  4KIK B;  4MGZ E;  4DBG A;  4ICV A;  1XD3 B;  5C1Z A;  2LAS A;  3VAW A;  4WQO B;  4K81 A;  1UEL A;  5D6J B;  1XT9 B;  2CKH B;  2MQJ A;  2L7R A;  2NVU I;  3AU4 A;  4KZ0 A;  2DZM A;  4MSQ B;  3DVN V;  2DAJ A;  4ZRI A;  2RPQ A;  4WWO A;  2LRU A;  2BWF A;  3KVF B;  5JZE B;  2ZCC A;  2M1M A;  4W9L A;  2ZNV B;  3VH3 B;  2ZJD A;  3KYD D;  1E8W A;  3UIN B;  1KJT A;  1TZ1 A;  2NPT A;  2MP2 A;  2R2O A;  5JHB A;  2KAN A;  2K25 A;  1WJN A;  1S1Q B;  3ONS A;  1UH6 A;  1YJ1 A;  2JVC A;  4GDK B;  2KNB A;  4G11 A;  4GGQ A;  4HCP B;  4LCD E;  1Q1O A;  4NNJ B; 
#chains in the Genus database with same CATH topology
 3PS6 A;  1FCC C;  2UYZ B;  1I35 A;  3IBE A;  5E6P A;  1QOA A;  3PLV A;  3DHH C;  1I4X A;  4MGI E;  2GI9 A;  4RGM A;  2G9H D;  1JRU A;  2VZK B;  2IYD B;  1WJU A;  3L10 B;  1FXI A;  1I42 A;  1ESF A;  4USA A;  5KHQ A;  3IT6 B;  3TCA A;  3SD5 A;  4KDI C;  5C2T B;  4E3C A;  1J19 A;  4ZOH C;  1V1P A;  2FCQ A;  3DVG Y;  3ZIM A;  2WXL A;  1FFV A;  1Q5W B;  1YQ3 B;  4EFO A;  1E90 A;  2MX2 A;  1WIA A;  2MBO A;  2OED A;  2IY0 B;  3AEE B;  1WZ0 A;  4JWU C;  4HWI B;  2MSE D;  1RLF A;  1L7Y A;  2E3T A;  3RI7 C;  3N20 C;  4ZHO A;  2K0P A;  2KMA A;  2PPH A;  1L0V B;  1TS3 A;  2D3C A;  1NBF C;  1KH0 A;  2G45 B;  4NQL B;  1K53 A;  2JZ3 B;  4GU2 A;  5J18 A;  1KTK A;  1OFF A;  2IND C;  2LGI A;  1B1Z A;  2MBB B;  2CJO A;  2RDH A;  1OQQ A;  4NAW A;  2PLP A;  3PZ8 A;  3I5J C;  2WX0 A;  1HZ6 A;  5LLI A;  1NYQ A;  1WFY A;  1Z5S B;  3W1S C;  4RGO S;  1XEE A;  4GXB A;  4X57 B;  4MM3 B;  3ZW3 A;  1J7B A;  2D3A A;  2L0F A;  1RFA A;  2L00 B;  2RDG A;  1SB3 C;  2ZVN A;  3CIR B;  1SSN A;  3EA6 A;  3PT2 B;  1ACC A;  2H88 B;  2PW9 A;  2Y3A A;  3T3N A;  3RUL A;  4GSW A;  3NZU A;  3VTW A;  3DBL I;  5EE9 A;  2M4N A;  1VJK A;  3RNB C;  5H92 C;  2IO0 B;  4DXA B;  4XE0 A;  3N1Z C;  4IM2 A;  1JRP A;  1F0Z A;  4IWO A;  2QIL A;  2O2V A;  1WI0 A;  2INN E;  2JUO A;  1JWM D;  4ANW A;  2MLB A;  4PYU A;  1XLO A;  3CWI A;  2MBE A;  2IPK D;  2MBH A;  4G0N B;  2DNF A;  4HVB A;  2MH7 A;  3NZ3 A;  2BBC A;  4YTP B;  1ZP0 B;  2WXM A;  2ZEQ A;  4US9 A;  5D3I B;  2LUM A;  2LXA A;  1SE2 A;  2KT7 A;  2PE6 B;  2DHZ A;  4ZDV A;  2WYQ A;  4BAX A;  3V60 A;  2NMQ A;  1MG4 A;  3KYC D;  3UGB B;  5D7G A;  5FR6 A;  3NZS A;  4A3O A;  1RAX A;  2WNM A;  1L2N A;  1WXS A;  2V3S A;  4HJK A;  2N7J A;  2DLB A;  1JRO A;  4M8N A;  1L4D B;  1FD6 A;  3ML9 A;  2O6V A;  3UI3 A;  4N58 A;  5T8I A;  4A90 A;  3ZUN A;  4CO7 A;  2KMC A;  4DWF A;  2WDQ B;  4GDL A;  4D2K A;  3CSF A;  4GN1 A;  3RNG C;  1T0Y A;  2FUH B;  2JQR B;  3ZKJ C;  1JQ4 A;  3MP9 A;  1CK1 A;  2K8B A;  2JU6 X;  3PLU A;  2AQ2 B;  1IUE A;  4K1R B;  3TIX A;  5JXV A;  1WGD A;  1GJZ A;  2KFJ A;  3DPD A;  3DBR I;  2K1F A;  2MW5 A;  3IT4 B;  3VUY A;  3VUW A;  3TMP B;  2BYV E;  2PKO A;  2LRW A;  2OHF A;  2H89 B;  2N9E B;  2VH1 A;  4LDT B;  3PTF C;  2DZK A;  3TJP A;  4MH0 E;  1MJD A;  4IW0 A;  4M01 A;  2OJW A;  4ITK A;  5FK9 C;  1R4M I;  1FNW A;  4B0E A;  4E74 A;  3H1U A;  3R2I A;  2L83 A;  3ZVV A;  3H7S A;  1KLG D;  3R3M A;  4BZA A;  2VH2 A;  1FM0 D;  2WXR A;  4XDC A;  4WIP A;  3ZJU A;  2KVZ A;  3GZN B;  3W5V B;  2V3P A;  1WZ3 A;  4FJY A;  1CZP A;  3A9J B;  4M0W B;  2XN9 C;  1IYF A;  1OTR B;  3V05 A;  4HPL B;  2GOW A;  4DQO C;  5IO9 A;  4IKG A;  1QKZ A;  1OQY A;  2MRP A;  4R3D A;  4LK0 M;  2ICI A;  2AL3 A;  1B9R A;  4K3B A;  2KOX A;  3WA0 A;  1C77 A;  1WRI A;  1N62 A;  4N9F 4;  3KH0 A;  3U30 A;  2PMV A;  2DZJ A;  4P7I A;  3TEW A;  2BTE A;  5L95 C;  1MHH E;  1NVI D;  1GOZ A;  5C3J B;  2L52 A;  4I6P A;  3B0A A;  2G1E A;  2J53 A;  3RT3 B;  1WGR A;  2BYF A;  3HVD A;  2D11 A;  3P2B A;  5HHD G;  4EUT A;  2FAZ A;  1WXM A;  1OQR A;  1V86 A;  2BB6 A;  5BYQ A;  1JAL A;  3MJ5 A;  3Q6B A;  3L08 A;  2RSU A;  3B08 A;  3WAL A;  1K8R B;  2KZR A;  1DYQ A;  3KUD B;  2KO3 A;  3X0W A;  2HE7 A;  2WS3 B;  3ENE A;  4WWN A;  1YJI A;  2N9L A;  2V3N A;  4KV2 A;  4GDK A;  3P4R B;  1KLV A;  3QA8 A;  4TUU A;  4KX6 B;  2KJH B;  2EKE C;  1LO5 D;  3U7D A;  4B0M A;  3P42 A;  5FR3 A;  1ET9 A;  4DBG A;  1Y56 A;  1E10 A;  2BS4 B;  4K81 A;  1VLB A;  1UEL A;  4YTM B;  1ZPS A;  2DZM A;  3AED B;  3KVF B;  2WGS A;  5JZE B;  5BMG A;  2JX5 A;  2ZJD A;  2K25 A;  2SEB D;  1FFU A;  3ONS A;  1UH6 A;  3U2S C;  2KNB A;  1LXD A;  2D2Q A;  3HM3 A;  3U7Z A;  2JXX A;  3EGR A;  3VR8 B;  4NPN A;  1JW9 D;  4BKS D;  4FBJ B;  4KGR A;  4BBN C;  4C80 A;  2KWU B;  3EFU A;  2BGF A;  2D3B A;  3IG3 A;  1IBX A;  4TV3 A;  3MC9 A;  4HPM B;  2KXJ A;  3PZ7 A;  4WUR A;  4PS7 A;  1P9D U;  2UU7 A;  1XCQ L;  3L17 A;  2IDY A;  4I6N B;  2MCN B;  2RD0 A;  1C9F A;  2NPT B;  2MP2 B;  1TZO A;  4W9J A;  5AZF A;  3BVG A;  1MI0 A;  4ZRP A;  4IWQ A;  2IO3 B;  2LGX A;  3AV8 A;  3UF8 A;  3ECI A;  2L0T A;  2B3A A;  2AEH A;  1GB1 A;  4YXD B;  2R2Q A;  3DBH I;  1SBB B;  3DBH B;  4OVU A;  2EMS A;  5BMH A;  4PK1 A;  1UNS A;  3GP7 A;  3ZGZ A;  1V5O A;  1AAR A;  3V3X A;  2INC C;  1EO6 A;  3N32 A;  2KX0 A;  2NTT A;  5EDS A;  3C19 A;  2CU1 A;  2KLG A;  3I9V 1;  1C79 A;  4AOF A;  3BY4 B;  1I4H A;  2JSV X;  4PT5 A;  1FRR A;  2CU3 A;  4MM3 A;  3EC8 A;  1E0Z A;  3AE6 B;  2NS5 A;  2D5G A;  4L1B A;  3FC4 A;  1XLN A;  3QAQ A;  3UIO B;  1T0S C;  1C1Y B;  3VH4 B;  1WH3 A;  1YD8 U;  2KWV B;  3PO0 A;  4RCO A;  5AZH A;  1E8X A;  4GLS C;  1WX8 A;  2RR9 A;  4AWJ A;  3AEC B;  1WJ6 A;  1OEY J;  2IO2 B;  3Q3F A;  2KVR A;  4NJ6 A;  3BII D;  1JML A;  1UWM A;  4HLE A;  3DBS A;  1PGB A;  2JPH A;  3RZW C;  1V81 A;  2WDV B;  1ISN A;  3MTN B;  3CMM B;  2QEJ C;  1I7H A;  4HPP A;  1TTN A;  4MJS B;  4WWP A;  2IGH A;  3PZD A;  3AU5 A;  4IOI E;  3GOE A;  3H8H A;  1F1H A;  1WY8 A;  3EHV A;  2L1A A;  4W9I A;  1DGJ A;  2OOB B;  5IOI A;  4XGA B;  1V9J A;  1GNU A;  2KFK B;  3L16 A;  4MEL A;  2D07 B;  3FIL B;  2I2Y A;  1HA5 A;  1XO3 A;  3BK1 A;  4K3C A;  2K9X A;  2I1J A;  4PYZ A;  3NS8 A;  4ARC A;  3AH7 A;  2LUE A;  4WH4 A;  5EE1 A;  2QC8 A;  2QHO A;  2RMM A;  2K22 A;  2LWP A;  4OZB A;  4IDI A;  3OG5 A;  5TSS A;  2BQQ A;  1E8Y A;  5EE3 A;  1HTQ A;  1SE9 A;  5KHO A;  1U4A A;  2XEW A;  1YOV B;  1K51 A;  4IC7 B;  2M19 A;  4OW0 A;  1ZKH A;  4AUQ C;  3M3J A;  3E9S A;  4HXD A;  2D10 A;  2ZPY A;  2XK5 B;  4AJY B;  1UUP A;  2M17 A;  3EEC A;  2KDF B;  5BYS A;  2JWZ A;  3A4S C;  3AEF B;  3DHG C;  4A3P A;  3HIZ A;  2L76 A;  4ZRQ A;  2MA9 B;  1L5P A;  1WMH A;  4RM8 A;  4FXC A;  3RPF C;  1VCB A;  4TSS A;  4K7U A;  1TS2 A;  2GMI C;  1AWD A;  3JSV B;  3NOB A;  1JWA D;  2J0J A;  2JY6 A;  3W9C B;  3ZTD A;  1H4R A;  2J52 A;  3AE9 B;  1LGR A;  4TMA B;  3ETR A;  1L0Y B;  3V61 A;  1SGH A;  2FID A;  5IN7 A;  4RF0 A;  5I4D A;  1E7V A;  3RUI B;  4OZC A;  1BUI C;  2FE8 A;  5G5H A;  1P7E A;  4JQW C;  2FBW B;  2QJL A;  3ZNH B;  3MFG A;  2PE9 A;  2I1K A;  4DK5 A;  5DPT A;  4BVU C;  3W2D A;  2BPS A;  3NUH B;  3A9J A;  4M0W A;  2CJN A;  4XZ4 A;  3LXF A;  1WF9 A;  2J0K A;  5BYR A;  4JE3 B;  2BVC A;  2IJ0 A;  1T3Q A;  1GC6 A;  3P4Q B;  3ZRF A;  2ASQ A;  2LMC A;  3RD2 A;  2C9W B;  1A5R A;  3OJ4 B;  3DBL B;  3OJ3 A;  3ZNI D;  4HDO A;  2KMM A;  1UGM A;  2N1V A;  3CF6 E;  4MGY E;  1HTO A;  3Q14 C;  3MJW A;  3DVN U;  3PRM B;  2WXN A;  3GE3 C;  2C7H A;  4MSM B;  4F7Z A;  2XNA C;  3Q8A A;  4P6V F;  1N63 A;  5BO4 B;  1ROE A;  5G2N A;  1IPG A;  1UZX B;  4AP4 C;  3L13 A;  3R66 C;  3I3T B;  1KFY B;  3E56 A;  3VVW B;  1TGZ B;  2J4X A;  1MPE A;  2LHD A;  2DEN B;  3O13 A;  3B2G A;  2A4Z A;  3HRD D;  2GRI A;  3AE1 B;  4A6Q A;  4WAF A;  1RM6 C;  2BF8 B;  2ZCB A;  5CX3 A;  3AI5 A;  3L4P A;  1D6E C;  3ZDT A;  1TJE A;  4FLH A;  1EUV B;  2EMT A;  2KQ7 A;  1BXT A;  3SU8 X;  2C60 A;  1X1M A;  3K9P B;  1HEZ E;  2K6Q A;  2N0S B;  4NAM A;  3DQV A;  1UWX A;  3B1L X;  4NZL B;  3NS1 A;  2Y5B B;  3VR9 B;  2N1W A;  4UDU C;  2AL6 A;  1WYW B;  4WJP A;  3BYT B;  4PS3 A;  3PV1 A;  2GBM A;  5DPR A;  4FUL A;  4JL9 A;  2LXC A;  3HK0 A;  4MDK E;  1QIL A;  1R4N I;  2HJ1 A;  4EKU A;  4EZK A;  2MHJ A;  5E6N A;  4REZ A;  4LLG M;  2X38 A;  1PDX A;  2LVP A;  3C0R B;  3LB8 C;  3VXW A;  2BKF A;  3RNF C;  3Q2A C;  2JZP A;  4NJC A;  1TIF A;  3DBR B;  4LNN A;  3HM6 X;  1PYW D;  1WXA A;  3DWG C;  4W9C A;  3U52 E;  4URK A;  2UWQ A;  3MHZ A;  1SE3 A;  3TUO A;  3V62 A;  1E8Z A;  3BK2 A;  1NEK B;  2X8X X;  4US8 A;  2ZNV C;  4HRO A;  2JT4 B;  4W9H A;  1VD2 A;  2G3Q B;  1I4G A;  2L32 A;  4ICV A;  4L2Y A;  1CQV A;  2LAS A;  3VAW A;  4WQO B;  1R4M B;  5D6J B;  3AU4 A;  2L7R A;  2NVU I;  3DVN V;  1N61 A;  2DAJ A;  2RPQ A;  2LRU A;  1GPX A;  1UGJ A;  4LNF A;  2ZNV B;  1E8W A;  3ZJV A;  2NPT A;  1BML C;  1V8C A;  2MP2 A;  2R2O A;  1PUT A;  2KAN A;  3VRA B;  2JVC A;  4LCD E;  1SE4 A;  2MJE A;  4LNO A;  3Q8B A;  2L8J A;  2LEK A;  1WRD B;  1QOF A;  4ZRK A;  5E6J A;  1SEB D;  3ZRC A;  2CR5 A;  4KGS A;  3ZXV A;  3SFE B;  5C23 A;  1NYR A;  1H8C A;  2WX1 A;  4JWS C;  2PTL A;  3RNE C;  1GAQ B;  4N6E B;  3OWE B;  1VRA B;  5HG2 A;  2AX5 A;  2HJ8 A;  3APC A;  1QT9 A;  2QDF A;  3NVY A;  5DPS A;  3AE7 B;  3Q8E A;  2WXK A;  1L6U A;  3ML8 A;  1TS5 A;  1YMH E;  5LXH A;  4K7W A;  1D5Z C;  2KTR B;  4MAC A;  1E9M A;  1EU3 A;  2NR2 A;  1L4Z B;  1IGD A;  2M56 B;  2OJR A;  1V6E A;  2C5L C;  2LGD A;  3ZNZ B;  2QSD A;  3MC0 B;  1VZ8 A;  2QMT A;  4ANX A;  5E6O A;  4KSK C;  1JWB D;  4J6I A;  3KUC B;  1Z2M A;  4LNK A;  1SIF A;  1WXV A;  4CHK A;  1YIW A;  1N60 A;  2O6V D;  2V4L A;  3N1Y C;  3D32 A;  2JRH A;  3ZQ4 A;  4DXG A;  3A33 B;  1WM3 A;  1YNT E;  3IXS A;  4MJS A;  3J9C A;  3UQA A;  2FCS A;  2V9H A;  2CHX A;  1ZE3 D;  1YN5 A;  1F2R C;  2M8S A;  2JZZ A;  2JXT A;  2L3Z A;  2J0M A;  4O1N A;  2INP E;  1D5M C;  4B95 A;  3V6E B;  3MC8 A;  3N3K B;  2N9P C;  4C56 C;  3JVZ X;  1FNV A;  2Y5P A;  3DHI C;  2KFK A;  3FIL A;  3IFW B;  4TQ1 A;  4DHJ D;  1ZDV A;  1F2R I;  1T0R C;  1XCT L;  2LZ6 A;  1C3T A;  2YVC A;  1WGK A;  2WXI A;  1QQR A;  3ZYY X;  5DPW A;  3VTV A;  4DXF A;  1HXY D;  4JIO U;  5EE0 A;  2N9X A;  4B9K A;  2WXF A;  1EWY C;  2WLB A;  2KJ6 A;  1R7S A;  4LNI A;  4NJ7 A;  1FO4 A;  1DOY A;  3ALB A;  4ZYS A;  4ACF A;  1LQB A;  2DWQ A;  2WU2 B;  4II3 B;  5JHA A;  3TEX A;  3JW0 X;  1F77 A;  3Q8F A;  1WE7 A;  4KKI A;  3IVF A;  1VDV A;  2XK5 A;  4WJO A;  3I57 A;  4YWG G;  5FKA C;  1EU4 A;  2MBQ A;  1GC7 A;  2K3U A;  4BBN F;  2V1Y A;  4XX5 A;  2EKI A;  3PGE A;  2Q5W D;  3AUL A;  3ZLZ A;  3A4R A;  3O65 B;  4FAD A;  1L6V A;  1FEH A;  1TY2 A;  4F1S A;  2KDM A;  1D5X C;  3H9D A;  3V6C B;  3WAO A;  1UBQ A;  3Q69 A;  1M94 A;  2K8H A;  1P7F A;  5TR5 A;  2PIA A;  3JSV A;  1V5T A;  1PGX A;  3QIJ A;  4HCN B;  1D3Z A;  3DDC B;  1NI3 A;  4LJP B;  1P0R A;  3AE8 B;  3QK0 A;  3NHE B;  4TQ0 A;  1TY0 A;  5G55 A;  2AQ3 B;  4W9D A;  1V80 A;  1YQB A;  4II2 B;  4M00 A;  3EFC A;  3P1M A;  4IM0 A;  1ZUD 2;  2PJH A;  2LD9 A;  4BOZ B;  3H6N A;  1QOG A;  3APD A;  2DYO A;  1MHX A;  2KDE B;  2DBY A;  2CS4 A;  2LVO A;  4HK2 A;  1YX6 B;  2Z0D B;  4B6W A;  2W82 A;  2WDR B;  3VHT C;  2ACZ B;  1WX7 A;  2AYO B;  2BS3 B;  2W3S A;  1ZOY B;  2WWZ A;  3AEG B;  4C4V B;  2IZV B;  2LVQ A;  3W1S A;  2WXG A;  4ZHP A;  3QHT A;  4MEM A;  3NJT A;  1Y8R C;  4DDI D;  1GG3 A;  3RNA C;  2Z0E B;  4RGN A;  2GBR A;  2ZPN A;  2CHZ A;  4OVZ A;  1YQ4 B;  4G50 A;  4RF1 A;  3T8M A;  2D3G A;  5LNK 1;  2KC2 A;  4HEA 1;  1FXT B;  2W9N A;  3IAS 1;  3P4S B;  2N7E A;  1WX9 A;  1OEY A;  2R61 A;  2AQ1 B;  2KTF A;  1C76 A;  4YSZ B;  1EWC A;  3NY5 A;  1JWS D;  1WGH A;  2VRR B;  2V0G A;  3ABV B;  4JX1 C;  2E6X A;  5CHW A;  3RCZ A;  3A9K B;  2NBV B;  2DYB A;  2MWS B;  2VZK D;  4AQ7 A;  2IY1 B;  5GXG B;  4ANV A;  3AE2 B;  2GBJ A;  5H8Y E;  2C7N B;  2GBK A;  2NCN A;  2N4F A;  3PPA A;  1F52 A;  5CHV C;  3ZTC A;  2QIE B;  1TS4 A;  1P1A A;  3N30 A;  3QAR A;  3BIN A;  4FN2 A;  1XF5 L;  4RMA A;  3WIM A;  4WWM A;  4XYC A;  1WJ4 A;  1DOI A;  2JF5 A;  2KLC A;  4P1C C;  5D3D A;  3QC8 B;  2HDE A;  3QQ8 B;  3S2A A;  1TYG B;  3PSE B;  2WXP A;  3K9O B;  4HKQ A;  2KD0 A;  1XLQ A;  4AJW A;  1P98 A;  1QLB B;  4M02 A;  3IAM 1;  2LI5 A;  4C7Y A;  5AUI A;  1RFK A;  2HD5 B;  1KLU D;  2LGY A;  1FIQ A;  2GLS A;  2KKC A;  3AMZ A;  1T0Q C;  1M4V A;  1WGY A;  2RPV A;  5D2M B;  1I4R A;  2FNJ B;  2WQY B;  1PGA A;  1ZGU B;  2WU5 B;  1QF6 A;  2M0X A;  2WXO A;  4FJZ A;  4ASW C;  1IBX B;  1GB4 A;  3NVW A;  4IG7 B;  4JGH B;  5CTR C;  5J2R A;  3KWL A;  4EE2 A;  3B2F A;  4S17 A;  3SFD B;  2WHI A;  3NVZ A;  5AUK A;  3UQB A;  3M62 B;  1FCL A;  3P4P B;  2G4S A;  4FJV B;  1WR1 A;  4G3X B;  1C4P A;  3AEB B;  2KN4 A;  4TKN A;  2G4D B;  1E7U A;  2RGF A;  2LHE A;  3A1Q B;  4P16 A;  1NEN B;  4YSY B;  2N9K A;  5AEK B;  3EUB 2;  3TL5 A;  5IP4 D;  1N5X A;  3N9Y C;  2I38 A;  4XC2 A;  2GBN A;  2KWC A;  4WAA A;  1SIJ A;  3VTU A;  3SHQ A;  4DHZ B;  2IBI B;  4KIK B;  4MGZ E;  5C1Z A;  4A9A A;  4YSX B;  1XT9 B;  2MQJ A;  4MSQ B;  1L0X B;  3ZJT A;  4WWO A;  2BWF A;  1SJE D;  4W9L A;  3KYD D;  1KF6 B;  1SF0 A;  1TZ1 A;  2MEK A;  4RFB A;  1WJN A;  1YJ1 A;  3Q8C A;  2K5P A;  4XDD A;  2HTM E;  1Q1O A;  3URY A;  1ZDX A;  4NNJ B;  3PHX B;  3RFZ B;  3BYY B;  2KWD A;  1JCK B;  3H7P B;  2ZVO A;  3LJ3 A;  4ANU A;  1JWU D;  5HFY A;  1ET6 A;  3OLM D;  3U4E G;  2LJI A;  4DHZ E;  3X23 A;  2KTR A;  3KQ4 A;  4GIV A;  4GOC A;  3ZO5 B;  1VR9 A;  3WAM A;  4HDQ A;  1OGW A;  3M95 A;  1LM8 B;  4C00 A;  1J7C A;  2KHW B;  2V4I B;  1N5W A;  4KSL C;  2IGD A;  1I4P A;  2AWT A;  1AYF A;  1V1O A;  2A5U A;  2FCN A;  4RGT A;  2KDB A;  1FNU A;  1MVK A;  3L0W B;  2KQS A;  2BKR B;  2DYM A;  1KOT A;  4PS8 A;  5LXI B;  2BYT A;  1J7A A;  1I4Q A;  3MHS D;  1EM7 A;  2L05 A;  3WAP A;  2QCZ A;  4WJQ A;  3VDZ A;  1FPY A;  4FHK A;  2N7D A;  2NBW B;  3CST A;  2B76 B;  1RWS A;  4Q2J A;  1R4N B;  3FAH A;  4J3O D;  2FIF A;  3BVZ A;  3WCQ A;  3TSS A;  3JYU A;  3N1X C;  4JPS A;  1TKG A;  1N6Z A;  3QX1 A;  3LDZ E;  2J7Q B;  1V1P B;  4IM3 A;  2Z8L A;  3ZDM C;  3KLS X;  3SEB A;  3IHP C;  4LDT D;  1SXT A;  1AN8 A;  1S3S G;  4WJN A;  4W9K A;  5HI1 A;  4KGT A;  4L23 A;  1VZ6 A;  3HVZ A;  2PVO D;  4OHJ A;  1HE8 A;  2BYE A;  1SJH D;  3GS2 A;  2REX A;  4WQM A;  1STE A;  3RNC C;  1RRB A;  4A20 A;  1QZE A;  2YLM A;  1WSP A;  3RN9 C;  1RYJ A;  1V97 A;  4E71 A;  4ZYN A;  1WMH B;  1NDD A;  3RYT A;  2TSS A;  2GB1 A;  4P1B C;  1UF0 A;  4HKZ E;  3DOW A;  2CHW A;  3P63 A;  1KRH A;  5MPO A;  4W9G A;  4ICU A;  2RDB C;  1GUA B;  4C7Z A;  1PQS A;  5IKC M;  2XBB C;  2K6D B;  3PRZ A;  1PFD A;  1WYG A;  4LJO B;  1E6E B;  4NAW B;  4RNA A;  3W5U B;  5JH5 C;  2WXJ A;  2W55 A;  1TT5 B;  2KN5 A;  2BB5 A;  2NBU A;  4BKS A;  2ON8 A;  1ENF A;  3PRP B;  5D94 A;  4EEW A;  3ZXR A;  1UBI A;  2KX3 A;  2J42 A;  3AEA B;  2BWE S;  2MJD A;  3NVV A;  3GZN I;  4NY0 A;  4EOY A;  4I6L B;  2WDT B;  1EF1 A;  1C78 A;  2WXH A;  3R8B A;  1YX5 B;  3QJZ A;  2MJ3 A;  1XLP A;  2DX5 B;  1E5W A;  2ZZP B;  2PEA A;  3NRZ A;  2JYT A;  3AXC A;  1UD7 A;  3T3O A;  4W9F A;  1C4A A;  2WP9 B;  2Y5C A;  4KVG B;  3HHM A;  2C7M B;  3QWZ B;  4C4V A;  1IGC A;  3BZD B;  1YN4 A;  1QOB A;  1FXA A;  2O2V B;  3AB5 A;  2DZI A;  2JRI B;  3C8Y A;  1YN3 A;  2IO1 B;  1XQQ A;  2JWU A;  3ZNG C;  1MFW A;  1BT0 A;  3WAN A;  5IA7 A;  3PVL A;  3VUX A;  4AS1 A;  4N59 A;  3SR6 A;  4OVV A;  3RMK C;  1VZ7 A;  3KW5 B;  1DOX A;  1WR6 E;  1TKY A;  1WXQ A;  4BKG A;  3TEZ A;  3U8Z A;  1YJJ A;  3AN1 A;  4CQN A;  1J8C A;  4H2A A;  4W9E A;  1IP9 A;  4KZC A;  4ZRJ A;  2SAK A;  2LJ5 A;  3DVG X;  1NI2 A;  1A70 A;  1E7P B;  5J17 A;  3A9K A;  3AM9 A;  1LFD A;  1Q0W B;  1FMA D;  2KAJ A;  4YL8 A;  2W54 A;  4NQK E;  2DAF A;  1ZW7 A;  3TBL D;  3Q3M C;  3BVM A;  4LTU A;  2BW2 A;  3OAW A;  3FKY A;  2W3R A;  2O6V B;  2PVG C;  2EEL A;  3LYY A;  4EZJ A;  2ZW1 A;  4GDL B;  3R7Q A;  3AE3 B;  2KQ4 X;  1CJE A;  4RH6 A;  4IWP A;  2ZW0 A;  4FA6 A;  1G6J A;  3APF A;  2KJR A;  3QCA A;  1EF5 A;  3HUI A;  3R7R A;  2KK8 A;  2Z59 B;  3Q3O C;  3VFK A;  3AE5 B;  2LGS A;  5AZG A;  1D4B A;  1V2Y A;  2M0A A;  4A55 A;  1T6B X;  4DHJ B;  1V49 A;  4EZL A;  4KDL B;  5HKH A;  1TBE A;  3AE4 B;  5GMV A;  4YT0 B;  3VRB B;  2KYW A;  4OZA A;  4HJG E;  3DCG A;  3T9L A;  3R2T A;  4YTN B;  4GB9 A;  4MH8 A;  4HRS A;  2LFI A;  2FUG 1;  3BWU D;  4MGK E;  4BOS C;  3GB1 A;  1K52 A;  1TKE A;  3TEY A;  5DCN A;  3B9J A;  1J0G A;  4MT5 A;  1WGG A;  4RM9 A;  2JYE A;  3PHW B;  5BMI A;  4S0R A;  4ARI A;  1P3Q U;  3L54 A;  3DWM A;  4BKT A;  2FCM A;  3KWV A;  1WE6 A;  3A1Q A;  5IAA C;  3Q3J A;  3M63 B;  4M8M A;  4QAY A;  4BFR A;  4DDG D;  4KKJ A;  3GE8 C;  2ONQ A;  1K50 A;  1HQR D;  4A8X C;  1FRD A;  2KC1 A;  2NTS A;  3SDL C;  3UIP B;  5CHF A;  4KIK A;  1HZ5 A;  4IUM B;  1KM7 A;  1WM2 A;  3W1Y A;  3NG0 A;  4JLC A;  1ZXH A;  4K7S A;  4XWW A;  3VQI A;  2K39 A;  3PRE A;  3I63 C;  2YEP F;  4CYE A;  1Q10 A;  1XXG A;  3KUZ A;  2WXQ A;  5L83 A;  1CMX B;  2BT6 A;  4F8C B;  1WWT A;  4FHJ A;  2YEP B;  1MG8 A;  3H7P A;  1AW7 A;  1T5X D;  4GMV A;  3RZF A;  1F9J A;  2BS2 B;  2K8C A;  2KDI A;  2HTH A;  2KAC A;  4XWT A;  1XD3 B;  2CKH B;  1ZXI A;  4KZ0 A;  4ZRI A;  1C4C A;  2ZCC A;  3Q3N C;  2M1M A;  3VH3 B;  3UIN B;  1KJT A;  5JHB A;  1S1Q B;  2IGG A;  4GDK B;  4G11 A;  4GGQ A;  4HCP B;  5G5G A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  3PHX B;  2UYZ B;  1LXD A;  2D2Q A;  3H7P B;  2L8J A;  2ZVO A;  1I35 A;  3LJ3 A;  1WRD B;  3HM3 A;  4ZRK A;  4ANU A;  3IBE A;  5E6P A;  3PLV A;  2JXX A;  3OLM D;  4MGI E;  4NPN A;  3ZRC A;  4BKS D;  2CR5 A;  4FBJ B;  4DHZ E;  3X23 A;  2KTR A;  4BBN C;  5C23 A;  1JRU A;  2KWU B;  3EFU A;  1H8C A;  2WX1 A;  2BGF A;  2IYD B;  4GIV A;  3IG3 A;  4GOC A;  3ZO5 B;  1WJU A;  3L10 B;  3WAM A;  1I42 A;  4HDQ A;  4HPM B;  4TV3 A;  2KXJ A;  1OGW A;  3M95 A;  1LM8 B;  4PS7 A;  5KHQ A;  1P9D U;  3L17 A;  4I6N B;  2MCN B;  2KHW B;  2RD0 A;  2HJ8 A;  2NPT B;  3APC A;  2MP2 B;  4KSL C;  4W9J A;  3TCA A;  2AWT A;  3SD5 A;  5AZF A;  2A5U A;  5DPS A;  4KDI C;  4IWQ A;  4E3C A;  2IO3 B;  2FCN A;  2LGX A;  1J19 A;  3UF8 A;  3ML8 A;  2KDB A;  2FCQ A;  3ECI A;  2L0T A;  2B3A A;  3DVG Y;  2AEH A;  3L0W B;  3ZIM A;  2KQS A;  2R2Q A;  2BKR B;  1Q5W B;  2DYM A;  3DBH I;  5LXH A;  4OVU A;  4K7W A;  1KOT A;  2EMS A;  4EFO A;  1E90 A;  2MX2 A;  2KTR B;  1WIA A;  2MBO A;  2IY0 B;  1V5O A;  1AAR A;  4PS8 A;  1WZ0 A;  5LXI B;  1EO6 A;  2NR2 A;  2OJR A;  3N32 A;  4HWI B;  2MSE D;  1RLF A;  3MHS D;  2L05 A;  1L7Y A;  2KX0 A;  3WAP A;  1V6E A;  2C5L C;  4WJQ A;  2LGD A;  3ZNZ B;  5EDS A;  3VDZ A;  4FHK A;  2CU1 A;  2N7D A;  2NBW B;  3CST A;  2KLG A;  4AOF A;  5E6O A;  2KMA A;  3BY4 B;  4KSK C;  4ANX A;  2PPH A;  2FIF A;  4J6I A;  3KUC B;  1Z2M A;  4MM3 A;  1SIF A;  3JYU A;  1WXV A;  3EC8 A;  1NBF C;  3QX1 A;  4CHK A;  2NS5 A;  3LDZ E;  1YIW A;  2J7Q B;  4IM3 A;  2G45 B;  2O6V D;  2V4L A;  3ZDM C;  3QAQ A;  3UIO B;  3D32 A;  2JRH A;  4NQL B;  3A33 B;  1WM3 A;  3IHP C;  2JZ3 B;  4LDT D;  4GU2 A;  5J18 A;  1S3S G;  1C1Y B;  4MJS A;  4WJN A;  4W9K A;  3UQA A;  3VH4 B;  1WH3 A;  2FCS A;  1YD8 U;  2CHX A;  2KWV B;  1HE8 A;  2M8S A;  5AZH A;  1E8X A;  2BYE A;  2JZZ A;  2MBB B;  2L3Z A;  2J0M A;  4NAW A;  1WX8 A;  2REX A;  4B95 A;  3V6E B;  2RR9 A;  4AWJ A;  3N3K B;  1RRB A;  1OEY J;  1WJ6 A;  2IO2 B;  3Q3F A;  2WX0 A;  4A20 A;  1QZE A;  2YLM A;  5LLI A;  2KVR A;  2N9P C;  1WFY A;  4NJ6 A;  3JVZ X;  1Z5S B;  3W1S C;  2KFK A;  4E71 A;  4GXB A;  4X57 B;  4ZYN A;  4HLE A;  1WMH B;  1NDD A;  3DBS A;  3RYT A;  3IFW B;  4TQ1 A;  2JPH A;  3ZW3 A;  4DHJ D;  3RZW C;  1V81 A;  1ISN A;  3MTN B;  2L0F A;  1RFA A;  2L00 B;  3DOW A;  2CHW A;  2LZ6 A;  3CMM B;  1C3T A;  2YVC A;  5DPW A;  4W9G A;  4ICU A;  1GUA B;  3VTV A;  2ZVN A;  1TTN A;  4JIO U;  1PQS A;  4MJS B;  2N9X A;  2XBB C;  4B9K A;  4WWP A;  2K6D B;  3PT2 B;  3PZD A;  3AU5 A;  3PRZ A;  3GOE A;  4GSW A;  4LJO B;  3RUL A;  3NZU A;  3VTW A;  2KJ6 A;  3DBL I;  4NAW B;  4NJ7 A;  5JH5 C;  2KN5 A;  2M4N A;  1WY8 A;  3ALB A;  3EHV A;  1LQB A;  2IO0 B;  2NBU A;  4BKS A;  4W9I A;  4II3 B;  4DXA B;  5JHA A;  3PRP B;  2OOB B;  3JW0 X;  5D94 A;  1V9J A;  4EEW A;  1GNU A;  2KFK B;  1UBI A;  4IM2 A;  3L16 A;  4MEL A;  2D07 B;  1WE7 A;  2KX3 A;  2BWE S;  3IVF A;  3GZN I;  4IWO A;  2XK5 A;  4NY0 A;  4EOY A;  4WJO A;  4I6L B;  2WDT B;  2O2V A;  1EF1 A;  1WI0 A;  2I1J A;  2JUO A;  1GC7 A;  2MBQ A;  4PYZ A;  3NS8 A;  4BBN F;  2V1Y A;  4XX5 A;  4ANW A;  2LUE A;  2MLB A;  4PYU A;  3PGE A;  3AUL A;  3ZLZ A;  3A4R A;  2MBE A;  3O65 B;  1YX5 B;  2QHO A;  2MBH A;  4G0N B;  4FAD A;  3QJZ A;  4HVB A;  4F1S A;  2LWP A;  3H9D A;  2DX5 B;  1E5W A;  3V6C B;  3WAO A;  1UBQ A;  2ZEQ A;  2ZZP B;  1M94 A;  2K8H A;  1E8Y A;  2PEA A;  3AXC A;  1UD7 A;  5TR5 A;  4W9F A;  2LXA A;  1SE9 A;  5KHO A;  3JSV A;  1U4A A;  2XEW A;  2PE6 B;  4KVG B;  1V5T A;  3QIJ A;  4HCN B;  1D3Z A;  2DHZ A;  3DDC B;  2C7M B;  1P0R A;  3HHM A;  4IC7 B;  4LJP B;  3QWZ B;  4ZDV A;  1ZKH A;  2WYQ A;  3M3J A;  3QK0 A;  4AUQ C;  3NHE B;  4TQ0 A;  3V60 A;  4HXD A;  2D10 A;  2ZPY A;  5G55 A;  2XK5 B;  3KYC D;  3UGB B;  4W9D A;  1V80 A;  1YQB A;  4AJY B;  5D7G A;  2O2V B;  5FR6 A;  3NZS A;  4II2 B;  2M17 A;  3EEC A;  2KDF B;  2DZI A;  4A3O A;  4IM0 A;  1RAX A;  2JRI B;  2IO1 B;  2PJH A;  1XQQ A;  1L2N A;  1WXS A;  3ZNG C;  2V3S A;  2JWZ A;  1BT0 A;  2LD9 A;  4HJK A;  4BOZ B;  3H6N A;  3WAN A;  3A4S C;  3APD A;  4A3P A;  5IA7 A;  3PVL A;  3HIZ A;  2L76 A;  3VUX A;  2MA9 B;  1WMH A;  2DYO A;  4M8N A;  2KDE B;  2LVO A;  2CS4 A;  4RM8 A;  4OVV A;  4HK2 A;  3ML9 A;  3KW5 B;  2O6V A;  1WR6 E;  1YX6 B;  1VCB A;  4BKG A;  4K7U A;  2Z0D B;  4B6W A;  3U8Z A;  3ZUN A;  2GMI C;  4CO7 A;  2KMC A;  3JSV B;  3VHT C;  1WX7 A;  4DWF A;  1J8C A;  2AYO B;  4W9E A;  4GDL A;  1IP9 A;  4KZC A;  3CSF A;  4GN1 A;  4ZRJ A;  3NOB A;  2J0J A;  1T0Y A;  2FUH B;  2JY6 A;  2LJ5 A;  2WWZ A;  3DVG X;  1NI2 A;  5J17 A;  2IZV B;  3ZKJ C;  3ZTD A;  1H4R A;  3A9K A;  2LVQ A;  1LFD A;  2K8B A;  3W1S A;  1Q0W B;  3V61 A;  3QHT A;  1SGH A;  4MEM A;  1Y8R C;  4DDI D;  1GG3 A;  2FID A;  3PLU A;  4YL8 A;  4NQK E;  2Z0E B;  2DAF A;  1ZW7 A;  1E7V A;  4K1R B;  3RUI B;  3TBL D;  3TIX A;  1WGD A;  1GJZ A;  2GBR A;  2KFJ A;  2ZPN A;  2CHZ A;  3DPD A;  3DBR I;  4JQW C;  2K1F A;  3OAW A;  2MW5 A;  4G50 A;  3T8M A;  2D3G A;  3ZNH B;  3VUY A;  3VUW A;  2PE9 A;  3TMP B;  2I1K A;  2BYV E;  2KC2 A;  4DK5 A;  1FXT B;  2LRW A;  2W9N A;  2O6V B;  5DPT A;  4BVU C;  2N9E B;  2BPS A;  3A9J A;  2N7E A;  4XZ4 A;  1WX9 A;  4LDT B;  4EZJ A;  1WF9 A;  2J0K A;  1OEY A;  3PTF C;  4GDL B;  2KTF A;  2DZK A;  3TJP A;  4MH0 E;  3R7Q A;  3NY5 A;  1WGH A;  2VRR B;  1GC6 A;  4IW0 A;  5CHW A;  3RCZ A;  3A9K B;  2ASQ A;  4IWP A;  2NBV B;  3RD2 A;  2DYB A;  3ZRF A;  4FA6 A;  2C9W B;  2MWS B;  1R4M I;  1A5R A;  3OJ4 B;  4E74 A;  1G6J A;  3APF A;  3H1U A;  2IY1 B;  2KJR A;  3OJ3 A;  3ZVV A;  4ANV A;  3QCA A;  3ZNI D;  1EF5 A;  3H7S A;  2GBJ A;  1UGM A;  2C7N B;  2N1V A;  2KK8 A;  2GBK A;  2NCN A;  2Z59 B;  3CF6 E;  4MGY E;  3R7R A;  3VFK A;  2N4F A;  3R3M A;  5AZG A;  3PPA A;  3MJW A;  3DVN U;  1V2Y A;  3PRM B;  5CHV C;  3ZTC A;  1P1A A;  3N30 A;  3QAR A;  4DHJ B;  1V49 A;  3BIN A;  4EZL A;  2C7H A;  4KDL B;  5HKH A;  4FN2 A;  1TBE A;  4RMA A;  4MSM B;  3WIM A;  4FJY A;  1WZ3 A;  5GMV A;  4F7Z A;  3A9J B;  1WJ4 A;  4M0W B;  2JF5 A;  2KLC A;  3QC8 B;  5BO4 B;  5G2N A;  1OTR B;  1IPG A;  4HPL B;  1IYF A;  2GOW A;  1UZX B;  3QQ8 B;  3DCG A;  3T9L A;  4AP4 C;  3L13 A;  3R66 C;  3S2A A;  2MRP A;  1OQY A;  3I3T B;  3PSE B;  3VVW B;  4GB9 A;  1TGZ B;  3K9O B;  2DEN B;  2KD0 A;  4MGK E;  4BOS C;  2A4Z A;  5DCN A;  2AL3 A;  2BF8 B;  4AJW A;  2ZCB A;  5CX3 A;  3AI5 A;  1J0G A;  1WGG A;  1P98 A;  4RM9 A;  3ZDT A;  3PHW B;  4HDO A;  4FLH A;  2KOX A;  1EUV B;  2EMT A;  2LI5 A;  3WA0 A;  2KQ7 A;  3SU8 X;  1P3Q U;  4N9F 4;  2C60 A;  1X1M A;  3K9P B;  3KH0 A;  3L54 A;  2HD5 B;  3U30 A;  2LGY A;  2KKC A;  4BKT A;  2K6Q A;  2FCM A;  2DZJ A;  4P7I A;  1WE6 A;  3A1Q A;  5L95 C;  3DQV A;  5IAA C;  3B1L X;  1WGY A;  3Q3J A;  3M63 B;  4M8M A;  5D2M B;  2FNJ B;  2Y5B B;  4BFR A;  4DDG D;  2N1W A;  1ZGU B;  4I6P A;  3B0A A;  2M0X A;  2AL6 A;  4FJZ A;  4ASW C;  1WYW B;  4WJP A;  4IG7 B;  3RT3 B;  1WGR A;  4JGH B;  3PV1 A;  4PS3 A;  2GBM A;  5CTR C;  5DPR A;  2KC1 A;  5J2R A;  2BYF A;  2D11 A;  4FUL A;  3P2B A;  3SDL C;  4JL9 A;  2LXC A;  3HK0 A;  3UIP B;  4MDK E;  1R4N I;  4EZK A;  4EKU A;  5CHF A;  5E6N A;  4KIK A;  4IUM B;  2FAZ A;  4EUT A;  1KM7 A;  3UQB A;  1WM2 A;  3M62 B;  1WXM A;  3W1Y A;  1V86 A;  2G4S A;  4FJV B;  2LVP A;  3C0R B;  3L08 A;  4JLC A;  1WR1 A;  2RSU A;  3B08 A;  4G3X B;  4K7S A;  4TKN A;  3VXW A;  3WAL A;  2G4D B;  3VQI A;  1E7U A;  1K8R B;  2K39 A;  2KZR A;  2BKF A;  2RGF A;  3A1Q B;  3KUD B;  3PRE A;  2KO3 A;  3X0W A;  4CYE A;  3HM6 X;  2HE7 A;  1WXA A;  4URK A;  4W9C A;  2UWQ A;  3ENE A;  3V62 A;  3KUZ A;  5L83 A;  4WWN A;  1CMX B;  5AEK B;  1E8Z A;  4GDK A;  4KV2 A;  4F8C B;  1KLV A;  3QA8 A;  4FHJ A;  4TUU A;  3TL5 A;  2ZNV C;  1MG8 A;  3H7P A;  2KJH B;  4GMV A;  2EKE C;  3RZF A;  3U7D A;  4XC2 A;  2GBN A;  2KWC A;  4WAA A;  2JT4 B;  1F9J A;  3VTU A;  3SHQ A;  4W9H A;  4DHZ B;  2K8C A;  1VD2 A;  2HTH A;  2KDI A;  2IBI B;  2G3Q B;  4KIK B;  4MGZ E;  4DBG A;  4ICV A;  1XD3 B;  5C1Z A;  2LAS A;  3VAW A;  4WQO B;  4K81 A;  1UEL A;  5D6J B;  1XT9 B;  2CKH B;  2MQJ A;  2L7R A;  2NVU I;  3AU4 A;  4KZ0 A;  2DZM A;  4MSQ B;  3DVN V;  2DAJ A;  4ZRI A;  2RPQ A;  4WWO A;  2LRU A;  2BWF A;  3KVF B;  5JZE B;  2ZCC A;  2M1M A;  4W9L A;  2ZNV B;  3VH3 B;  2ZJD A;  3KYD D;  1E8W A;  3UIN B;  1KJT A;  1TZ1 A;  2NPT A;  2MP2 A;  2R2O A;  5JHB A;  2KAN A;  2K25 A;  1WJN A;  1S1Q B;  3ONS A;  1UH6 A;  1YJ1 A;  2JVC A;  4GDK B;  2KNB A;  4G11 A;  4GGQ A;  4HCP B;  4LCD E;  1Q1O A;  4NNJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...