2L8JA

Gabarapl-1 nbr1-lir complex structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title Characterization of the Interaction of GABARAPL-1 with the LIR Motif of NBR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l8jA00
2L8JA 2PJHA 3ENEA 3AULA 2N1VA 5CHVC 2KTFA 4EZKA 4EZLA 2A5UA 2K8HA 5C1ZA 3SHQA 3CMMB 4GU2A 3A4RA 4TV3A 2KWCA 2ZNVC 4M0WB 2AWTA 2LI5A 2MA9B 3TMPB 3PTFC 3TCAA 4IWPA 1AARA 2DZMA 1E8WA 1IP9A 1V9JA 2M17A 2HTHA 1GNUA 2L76A 3ZIMA 2ASQA 2V4LA 4DHJD 2CS4A 5IAAC 1S1QB 1V86A 1WX8A 4WWPA 1WY8A 1WGHA 3QX1A 4GXBA 4ZYNA 1FXTB 2CU1A 1WJUA 2MBBB 3C0RB 2D07B 4K7WA 4EZJA 1RRBA 1GC7A 4DDGD 3TL5A 4W9LA 3PHXB 2OOBB 3JW0X 4K1RB 2ZZPB 3TBLD 3AU4A 2IY1B 4PS7A 2BGFA 1WGYA 3AXCA 4A3OA 5JHAA 5G55A 4BFRA 3A1QA 1MG8A 2KD0A 4MSMB 2KMAA 2CR5A 3UINB 3JYUA 2LVPA 2D10A 1H4RA 3WAMA 1C1YB 4IUMB 3EHVA 4XC2A 2G45B 2PE9A 3ECIA 3APFA 2M0XA 1E5WA 2RR9A 3WALA 3NS8A 2ZPNA 5LLIA 3DPDA 3KUZA 3VH4B 3KYDD 3V6EB 3KW5B 1WGGA 2LVQA 3H7SA 1WXVA 2MRPA 2BWES 5DPWA 3VUYA 2KFKB 2K6QA 1YD8U 1QZEA 2FIDA 2MLBA 4MGZE 3H7PB 3V6CB 2KJ6A 5C23A 3VDZA 4URKA 3X0WA 1YIWA 3NHEB 3M95A 3ZDTA 4LDTB 3PT2B 4EUTA 4HVBA 4K7SA 1IPGA 3PV1A 3AU5A 3M63B 5EDSA 4HDQA 1WR1A 2RSUA 3VTWA 4EEWA 2ZVOA 2EMSA 2XK5B 2L00B 1KOTA 2MW5A 2KANA 2NPTB 3M3JA 2KC1A 3DCGA 2I1JA 3L54A 1X1MA 1Q1OA 2G4DB 2KX3A 2KOXA 2GBKA 3Q3JA 4W9CA 4GB9A 2C7MB 1V2YA 3QCAA 1J19A 3S2AA 3RYTA 4PS3A 4DHZB 2BKRB 3NZSA 3W1SA 5JZEB 2JRHA 4HWIB 1R4NI 2LGDA 1UGMA 1WJ6A 3QK0A 4BOSC 4A20A 1WM3A 5KHOA 1BT0A 1EF5A 2KO3A 4GDKB 3H6NA 1WX9A 4CO7A 5LXHA 2BWFA 2GBMA 4JIOU 2M4NA 2JPHA 3HM6X 2FIFA 3QHTA 4F1SA 2KMCA 3RULA 4HCNB 4FHJA 3VHTC 2LASA 5DPRA 2YLMA 1P98A 1LQBA 5AZHA 1F9JA 2Z0EB 3AI5A 4NQLB 4WWNA 2L7RA 4J6IA 4HK2A 1I35A 1UBQA 3L17A 5AEKB 4ASWC 3A9KA 4G11A 4IWOA 2C7HA 4IWQA 2KX0A 2C60A 3P2BA 4HJKA 4MM3A 3ZO5B 4WJOA 4AJYB 4DBGA 3PPAA 3HHMA 2K8BA 2GOWA 3W1YA 2BYFA 2FNJB 1WXMA 3D32A 2DAJA 2LGYA 2O6VB 1UBIA 1XD3B 2PPHA 5HKHA 3PRMB 2PE6B 3ML8A 2DZIA 2NCNA 2ZCCA 4MGYE 2KVRA 4BOZB 1ZW7A 4HCPB 1SIFA 4BKSD 2C7NB 1P1AA 4N9F4 4FJVB 4ZRIA 3T9LA 1GC6A 2LXAA 3PLUA 4GIVA 4WWOA 3U8ZA 5J2RA 1YX5B 2DAFA 1V81A 4II3B 2RD0A 4KZCA 1WH3A 2V1YA 4MJSB 2RGFA 4NPNA 5CHWA 2ZEQA 2Y5BB 4BBNC 3VUXA 3M62B 4JLCA 4AUQC 2IO0B 1Z5SB 2UWQA 3HM3A 1H8CA 1WE7A 4HPLB 3ZTDA 1E90A 1UZXB 2KNBA 2KQ7A 2Z0DB 2DZJA 3B1LX 3N32A 1J0GA 2G4SA 4LCDE 4G3XB 4MGKE 1GUAB 4I6PA 2MBOA 3QA8A 3RT3B 2LUEA 4GN1A 3DBLI 3PREA 4RMAA 2OJRA 2YVCA 4KIKB 1LXDA 4X57B 2WYQA 4JQWC 4IW0A 2NBVB 4ZRKA 3CSFA 4FBJB 3IFWB 3MJWA 4BVUC 2BF8B 2KJHB 5JH5C 2L0TA 4ZRJA 3ZNGC 3ZW3A 3ZUNA 4HLEA 1I42A 4EFOA 3TIXA 2O2VB 3ZNZB 2AL3A 1SE9A 4KDLB 4W9HA 2N1WA 3DBHI 2D2QA 2KDBA 4PYUA 1RFAA 1P3QU 2KTRA 3JSVA 4FN2A 4AJWA 1NI2A 3IBEA 3PVLA 1V49A 4F8CB 4FJZA 1J8CA 2G3QB 2B3AA 3RCZA 2XEWA 4KV2A 1OEYA 4ANWA 2LWPA 3CSTA 3WIMA 3K9PB 2K1FA 4BKSA 1VCBA 4E3CA 4IM2A 2XBBC 4G0NB 1WXAA 2D3GA 3K9OB 5KHQA 2CKHB 4GDKA 4WJQA 1EO6A 2AEHA 1KLVA 1WF9A 4NNJB 1V80A 2JZZA 3DBRI 3TJPA 3X23A 2N7DA 4M8MA 1YJ1A 1RAXA 1KJTA 1L2NA 5D2MB 3WAOA 2MBQA 5E6NA 1E8XA 3A4SC 1ZGUB 2ZVNA 3QQ8B 5D6JB 4W9KA 4KDIC 2KDIA 4A3PA 2REXA 3EFUA 4WJPA 3SDLC 4TKNA 5DPSA 3VQIA 4DK5A 3A1QB 3OLMD 5CHFA 3R7QA 1WZ3A 4CHKA 2JWZA 1WE6A 3A9JA 5IA7A 3MTNB 5CTRC 3RD2A 3VXWA 4HPMB 1R4MI 3QIJA 3DVNV 2BYEA 1WR6E 4NY0A 2CHZA 4IM0A 2IBIB 4KZ0A 1OTRB 4ICUA 3CF6E 1E7VA 2JUOA 1IYFA 2LD9A 2K25A 3ML9A 3PSEB 2WX1A 3BY4B 3ALBA 3H9DA 3PRZA 2FAZA 2WX0A 2MP2A 2N4FA 2LRUA 2DZKA 4MDKE 2NVUI 3OJ3A 5D7GA 5AZFA 1XQQA 3VTVA 2DHZA 1Y8RC 3RZWC 5FR6A 3NY5A 3R3MA 4FLHA 3U30A 4FA6A 4TQ0A 3ZLZA 1UH6A 4FADA 1YX6B 2IZVB 4NJ7A 3GZNI 1WFYA 1TBEA 2HD5B 3ZNHB 3KUDB 2PEAA 3IHPC 5JHBA 4GGQA 4NJ6A 1E8YA 1Z2MA 1OGWA 3ONSA 4MGIE 2ZCBA 4W9FA 2LZ6A 2DYMA 3H1UA 4ZDVA 2J0JA 1WXSA 2KHWB 3HIZA 2MX2A 1P0RA 3L13A 1XT9B 3R66C 4K81A 1V5TA 4LJPB 3U7DA 3V61A 4DHJB 1V6EA 5D94A 4NAWB 2RPQA 4W9DA 3ZKJC 2BYVE 3APCA 1L7YA 2MQJA 4LJOB 4KIKA 2AYOB 4GMVA 2L05A 1U4AA 3IVFA 4KVGB 4GDLB 2K39A 3HK0A 3IG3A 2JT4B 4W9IA 5CX3A 1E7UA 1WMHB 3PRPB 2NR2A 4IC7B 4KSLC 4W9GA 2AL6A 2LGXA 2A4ZA 5DPTA 2IY0B 2KC2A 3OAWA 2JY6A 3ZTCA 3VTUA 1PQSA 1WM2A 1D3ZA 2O2VA 3DOWA 3DDCB 2N9EB 2CHWA 3A9KB 4AP4C 1JRUA 3LDZE 3DVGY 2J0KA 1EF1A 4FJYA 4BKGA 3ZVVA 3ZRCA 3SU8X 4TUUA 2K6DB 2DENB 4PYZA 2KXJA 2UYZB 3KH0A 1Q5WB 3O65B 5J18A 1WJNA 4FULA 2M8SA 4WQOB 3QC8B 2O6VD 2GBRA 4ANVA 5E6OA 1WRDB 2GBJA 4YL8A 2KFKA 5DCNA 3H7PA 4B95A 4JGHB 4NQKE 1WGRA 3UF8A 4EKUA 1OEYJ 2ZJDA 4JL9A 3UIOB 3UIPB 2J7QB 4W9JA 3V60A 3KUCB 1ZKHA 3MHSD 3APDA 3W1SC 2XK5A 2V3SA 4XX5A 2NPTA 2FCSA 1GG3A 2HJ8A 2JVCA 2NS5A 5GMVA 3GOEA 2EKEC 3VVWB 1WZ0A 1WGDA 2IO3B 4WAAA 3WAPA 1P9DU 4MH0E 2WDTB 1GJZA 2QHOA 3B08A 2IO1B 3N3KB 3V62A 4E71A 1SGHA 2R2QA 5BO4B 4EOYA 2CHXA 2WWZA 2LVOA 4XZ4A 2LXCA 1E8ZA 2Z59B 2MCNB 3L08A 3UQBA 2N7EA 1NBFC 2FCMA 3A33B 4PS8A 5L95C 4FHKA 4TQ1A 1K8RB 2DYBA 3EC8A 4B9KA 4WJNA 3B0AA 2NBUA 3DVNU 3KYCD 5G2NA 1G6JA 2KDEB 4E74A 1M94A 1LM8B 3NOBA 3VFKA 4BKTA 3QARA 4ANUA 4ICVA 4HXDA 3QAQA 4BBNF 1TZ1A 2KWUB 3KVFB 2MBHA 3I3TB 3RUIB 2MBEA 4DXAB 3OJ4B 3WA0A 2BKFA 2MWSB 1CMXB 2EMTA 1LFDA 4DDID 5J17A 1VD2A 3UGBB 2DYOA 1TTNA 2J0MA 2BPSA 4DWFA 2VRRB 1WX7A 2GBNA 2KTRB 3Q3FA 3JSVB 4F7ZA 1NDDA 3EECA 1YQBA 1KM7A 2O6VA 3BINA 1TGZB 1HE8A 3VAWA 2KK8A 2ZPYA 4ANXA 3UQAA 3ZNID 3R7RA 2FUHB 2KDFB 3WANA 2IO2B 2KZRA 4MSQB 5TR5A 2IYDB 2LJ5A 4MELA 4NAWA 1UELA 2I1KA 4LDTD 4MEMA 2R2OA 5LXIB 3VUWA 1RLFA 2DX5B 2ZNVB 2JXXA 1S3SG 2C5LC 2KLGA 4IM3A 4MJSA 1C3TA 2HE7A 1Q0WB 2KWVB 3QJZA 4KSKC 3QWZB 5L83A 4GDLA 1OQYA 2L3ZA 1WMHA 4I6LB 4DHZE 4HDOA 2KFJA 4B6WA 3DQVA 3JVZX 4CYEA 2D11A 2KLCA 2N9XA 1V5OA 4AOFA 1ISNA 2NBWB 5E6PA 4AWJA 2KQSA 3L10B 2FCQA 3PZDA 4II2B 2KJRA 2L0FA 5AZGA 4G50A 2K8CA 2M1MA 4P7IA 4OVUA 2LRWA 3PLVA 2FCNA 3A9JB 3ZRFA 4GOCA 4IG7B 2MSED 3L0WB 1T0YA 2C9WB 2KN5A 4W9EA 2KKCA 2W9NA 1WI0A 2GMIC 3ZDMC 2JF5A 4GSWA 3DVGX 4RM8A 3RZFA 3NZUA 3PHWB 1UD7A 3DBSA 3VH3B 3T8MA 1A5RA 4RM9A 3PS6A 2JZ3B 2JRIB 1WYWB 1WIAA 2N9PC 4M8NA 4K7UA 2MP2B 1WJ4A 4I6NB 3LJ3A 3N30A 3PGEA 4OVVA 3SD5A 1EUVB 3L16A
chains in the Genus database with same CATH superfamily
2N1VA 2KTFA 3CIRB 3CMMB 4TV3A 3GP7A 4M0WB 1ZP0B 3TMPB 4S0RA 1AARA 2Y5CA 4L2YA 2AX5A 4DQOC 1GNUA 2FE8A 4DHJD 3GZNB 5IAAC 4ZYNA 4C4VA 2CU1A 1WJUA 2M0AA 2MBBB 4EZJA 1QF6A 4K1RB 2ZZPB 2K22A 2IY1B 5HI1A 5G55A 3BK2A 1NI3A 4HKQA 2CJOA 3Q3OC 1TS3A 2DBYA 2G45B 2PE9A 1V8CA 3ABVB 1V97A 3WALA 1E5WA 2ZPNA 3ZXRA 4KGTA 2BWES 2KFKB 1QZEA 4MGZE 3H7PB 1YIWA 3ZDTA 1IPGA 1WYGA 4HDQA 1WR1A 4OZAA 3VTWA 1ZDXA 2XK5B 1KOTA 1PUTA 2BQQA 2KC1A 1Q1OA 2KX3A 3AM9A 2WXFA 4GB9A 1L0XB 3S2AA 4DHZB 4HWIB 1R4NI 5H8YE 3FAHA 4A20A 1I4HA 5KHOA 4BZAA 2BWFA 2JPHA 1FRRA 3QHTA 4F1SA 2KMCA 4FHJA 5I4DA 3BVGA 2LASA 5DPRA 1LQBA 3P4SB 5AZHA 1F9JA 4WWNA 1UBQA 5AEKB 3NUHB 1HQRD 4IWQA 3IAS1 3R8BA 4DBGA 4R3DA 3HHMA 3KWVA 3D32A 2DAJA 2O6VB 1UBIA 3ML8A 2KVRA 1EU4A 1ZW7A 4N9F4 4ZRIA 3AECB 2K3UA 1XXGA 2UU7A 4II3B 2RD0A 4MJSB 5CHWA 2RGFA 2ZEQA 2QIEB 2SEBD 4JLCA 4AUQC 2IO0B 1WE7A 4HPLB 4MT5A 1TKGA 2I38A 2KNBA 2Z0DB 2MBOA 2LUEA 2OJRA 2YVCA 4X57B 3AEFB 4JQWC 2NBVB 1WXQA 1T0QC 4FBJB 4BVUC 2BF8B 2KJHB 4ZRJA 2WXMA 1C4CA 3CWIA 2N1WA 2GLSA 3DBHI 2KDBA 3E56A 1YN5A 1VZ8A 1NI2A 3NVYA 2JX5A 1J8CA 2G3QB 5IN7A 3CSTA 3WIMA 3K9PB 4BKSA 4E3CA 1T0SC 4USAA 2K5PA 2XBBC 4G0NB 4HPPA 1T0RC 2CKHB 2XN9C 2AEHA 1WF9A 4TMAB 4NNJB 4C4VB 5D3DA 3Q14C 2CU3A 2LEKA 3PZ7A 4ZRQA 4RF1A 5E6NA 3A4SC 1ZGUB 2CJNA 1FXAA 5HHDG 3MC8A 3OLMD 3RD2A 3VXWA 3NVZA 4FXCA 4IM0A 3WCQA 3PSEB 2QJLA 1IUEA 3GB1A 3H9DA 1C79A 1OQQA 2N4FA 4MDKE 4US8A 3Q8EA 5AZFA 3TEXA 3VTVA 2DHZA 2WU5B 4P6VF 4FLHA 1N60A 4FA6A 4TQ0A 4FADA 1YX6B 2IZVB 4NJ7A 3GZNI 2BVCA 3P1MA 2HD5B 3L4PA 1IBXB 3KUDB 1E8YA 2KMMA 2W54A 2J0JA 1XT9B 2IDYA 1GOZA 1F2RI 3T3NA 1V6EA 5D94A 3ZKJC 1L7YA 3AEEB 3ZJTA 4KVGB 1NENB 1GB4A 2K39A 3HK0A 1E7UA 1WMHB 4IDIA 4W9GA 4IC7B 4N6EB 4A6QA 2A4ZA 2RDGA 3AEDB 2KC2A 4M00A 3DHGC 1PQSA 1D3ZA 2O2VA 1JMLA 2BW2A 4NAMA 3DVGY 1EF1A 4FJYA 3ZRCA 4KGRA 1C76A 1FFVA 2K6DB 4RGOS 1WJNA 2GBRA 4ANVA 3PZ8A 1WRDB 2GBJA 1WGKA 4B95A 4NQKE 2MJ3A 2GI9A 1OEYJ 4JL9A 4W9JA 3KUCB 1XEEA 4HJGE 2FCSA 3N1ZC 1TZOA 5GMVA 2KWDA 2EKEC 3VVWB 4MH0E 3B08A 4YXDB 5BO4B 1SIJA 5FK9C 3HVZA 1HXYD 1FFUA 2IPKD 4O1NA 2N7EA 2AQ3B 2V9HA 1JWSD 4FHKA 4TQ1A 1N62A 4B9KA 1AWDA 4WJNA 3B0AA 2NBUA 3DVNU 1JWBD 4E74A 3NOBA 1LM8B 3VFKA 2DLBA 4BBNF 2KWUB 2MBHA 3I3TB 1F0ZA 3IAM1 1CMXB 1VD2A 2DYOA 3BZDB 2NTTA 4ACFA 2BPSA 4DWFA 4F7ZA 1NDDA 1YQBA 2KK8A 2Y3AA 3ZNID 5GXGB 2LHEA 2PVOD 4MSQB 4MELA 1UELA 1MG4A 1PFDA 2I1KA 3EA6A 4MEMA 2R2OA 3P42A 5LXIB 1RLFA 2JXXA 4IM3A 4KSKC 3NG0A 1KF6B 1HTOA 3JVZX 2D11A 3NVWA 4Q2JA 1ISNA 4YWGG 5E6PA 2FCQA 2KJRA 4US9A 4G50A 3ZRFA 1NYQA 2MSED 1AN8A 5IOIA 2W9NA 2E6XA 3SEBA 3DVGX 3NZUA 4B0MA 3T8MA 3PS6A 3RNAC 4M01A 3Q8CA 1FXIA 1AYFA 4WURA 3OWEB 3L16A 2L8JA 5C2TB 2JYTA 2L1AA 5CHVC 4EZKA 2A5UA 2K8HA 5C1ZA 1SJHD 3SHQA 3A4RA 2KWCA 2ZNVC 2AWTA 2LI5A 2WS3B 4AQ7A 3DWMA 2WXHA 1V86A 1WGHA 2VZKB 3NVVA 4GXBA 2WXNA 3HRDD 4A9AA 2D07B 4K7WA 1TY2A 3PHXB 3Q69A 3JW0X 3TBLD 2X8XX 3AU4A 2M19A 3TEWA 1WGYA 3ZQ4A 2W82A 4MSMB 1T3QA 3J9CA 2CR5A 1H4RA 3AMZA 5BYQA 2M0XA 3NS8A 4RF0A 3GE8C 1WGGA 2LVQA 1WXVA 2K6QA 2FIDA 3AE7B 4KX6B 4EUTA 3M95A 4HVBA 4K7SA 2GB1A 1ET6A 4LTUA 5G5GA 1XO3A 3M3JA 3KLSX 2KOXA 4W9CA 2SAKA 3QCAA 2JXTA 4PS3A 2BKRB 3NZSA 2JRHA 3QK0A 2W3RA 1UUPA 4BOSC 3LYYA 4OZBA 1WM3A 3Q8BA 2KVZA 4CO7A 4JIOU 2M4NA 3HM6X 2FIFA 3AE4B 1E10A 3VR9B 3RULA 2WGSA 4KKIA 1P98A 2WXOA 4NQLB 4J6IA 1GB1A 3Q6BA 3BYYB 4G11A 2AQ2B 4WH4A 4UDUC 1I4GA 2KX0A 2BS3B 3NZ3A 4MM3A 4DXFA 2VH1A 4LNOA 2GOWA 3W1YA 2BYFA 2FNJB 3BVZA 1XD3B 4YTNB 1B1ZA 2PE6B 4RFBA 2DZIA 1UF0A 1SE3A 1SIFA 3PLUA 4C80A 3Q3MC 2DAFA 2RDBC 1WH3A 2WDRB 2E3TA 3RFZB 1L6UA 3N1YC 2Y5BB 4BBNC 2FBWB 2UWQA 1UNSA 1IGDA 1E7PB 3B9JA 2DZJA 3N9YC 1J0GA 2G4SA 4MGKE 3QA8A 3RT3B 4GN1A 3DBLI 4IKGA 4KIKB 2WYQA 3IT4B 2MJEA 3N20C 2BB6A 5JH5C 2L0TA 2KN4A 3ZW3A 1PGXA 4LNFA 3ZNZB 2AL3A 1I7HA 1SE9A 4KDLB 1EM7A 1RFAA 3O13A 4AJWA 1V49A 1EWCA 2B3AA 2ACZB 1WXAA 4C00A 3I63C 4GDKA 1V80A 3RI7C 1XLQA 3DBRI 1P7FA 2N7DA 2MH7A 1QKZA 5D2MB 3AB5A 2MBQA 2VH2A 2KT7A 2ZVNA 4W9KA 1E0ZA 2KDIA 4WJPA 3SDLC 5DPSA 2PKOA 5CHFA 4CHKA 1VJKA 1WE6A 5IA7A 5CTRC 4S17A 4XE0A 4NY0A 1DOYA 4ICUA 3CF6E 2K25A 2WX1A 3T3OA 3ALBA 3PRZA 4OHJA 2FAZA 4YSXB 2LRUA 2NVUI 1RM6C 3RZWC 2WQYB 4RCOA 5FR6A 2PIAA 2PEAA 5JHBA 1CJEA 4ARCA 3ONSA 1OGWA 2ZCBA 4W9FA 4ZDVA 2KHWB 4YT0B 1JROA 2MX2A 1P0RA 4K81A 2MEKA 2H89B 3U7DA 1V1PA 1UWXA 3EUB2 4LJOB 1SXTA 4GMVA 2L05A 2N7JA 3IVFA 4GDLB 2LUMA 2Y5PA 3PRPB 2NR2A 4KSLC 1TT5B 5DPTA 2JWUA 3VTUA 3OG5A 1R4MB 1K52A 2WU2B 1JRUA 2J0KA 3SU8X 3SFDB 2M8SA 3QC8B 2O6VD 1JWAD 4YL8A 2WXRA 5DCNA 3ZYYX 1WGRA 3RPFC 2INCC 3UIPB 3MHSD 2Q5WD 2LJIA 4XX5A 2NPTA 5HFYA 1BUIC 3VR8B 2NS5A 3GOEA 4WAAA 2IGHA 3WAPA 1TS5A 2QHOA 3N3KB 2R2QA 2MHJA 4XZ4A 2OHFA 1ROEA 3ETRA 1YQ3B 2MCNB 3C8YA 3LXFA 2FCMA 4OW0A 4PS8A 1K8RB 3EC8A 1C4PA 1QOGA 2RPVA 3PO0A 5TSSA 1P7EA 5G5HA 1QILA 1M94A 3QARA 2MWSB 1YJIA 2WXKA 1TTNA 2YEPB 2KQ4X 1MPEA 1FNWA 2GBNA 4P1CC 5T8IA 3BINA 2QC8A 4LNKA 2KDFB 3WANA 2WHIA 2ZW1A 3HUIA 4NAWA 1F2RC 4LDTD 2ZNVB 1SJED 1S3SG 2K9XA 2HE7A 2KWVB 2L3ZA 2BTEA 4YSYB 2KFJA 2M56B 2GRIA 3B2FA 2NBWB 2B76B 2KQSA 2WXQA 4WQMA 2FCNA 4LNIA 4GOCA 3L0WB 4GLSC 2C9WB 2KN5A 2KKCA 4XGAB 4IOIE 5LNK1 4YTPB 3RZFA 3PHWB 1VRAB 3DBSA 3VH3B 4RM9A 2JRIB 2ONQA 4K7UA 4I6NB 1J7AA 2PJHA 1QQRA 2QILA 1R7SA 4GU2A 1FNUA 3PTFC 2DZMA 1IP9A 1V9JA 1C4AA 3ZIMA 2L76A 4RNAA 2ASQA 2ZW0A 2V4LA 3VRAB 1I4RA 5H92C 2WNMA 1ACCA 1WY8A 1NYRA 5MPOA 2AQ1B 3DHHC 1GC7A 2N0SB 1VZ6A 2HTME 2D3AA 4P16A 4PS7A 4BFRA 3A1QA 2KD0A 2KMAA 3JYUA 1ZUD2 1C1YB 3EHVA 4LNNA 5LLIA 3V6EB 3KW5B 3H7SA 2MRPA 1TY0A 1Q10A 2MLBA 4P1BC 3VDZA 3V6CB 4URKA 4HKZE 3NHEB 1UWMA 1ZE3D 5EDSA 3M63B 2RSUA 4EEWA 2EMSA 2L00B 2MW5A 1DOIA 2KANA 2NPTB 2I1JA 3L54A 3ZJVA 2G4DB 1F52A 2C7MB 1V2YA 1J19A 1QOBA 2V0GA 4YTMB 2LGDA 1EF5A 1N6ZA 1WX9A 4MH8A 2GBMA 5BYRA 4LK0M 1KLGD 3VHTC 4ITKA 1QOAA 1C77A 2Z0EB 1MVKA 1FRDA 3R2TA 4ASWC 3A9KA 1C9FA 4EE2A 1C78A 3TUOA 2C7HA 3ZXVA 1JWMD 3P2BA 4AJYB 1UGJA 4WJOA 3HVDA 2V3PA 2LGYA 2D5GA 2NCNA 2ZCCA 4CQNA 3U7ZA 3H8HA 4BKSD 2C7NB 1P1AA 4FJVB 3T9LA 5J2RA 3U8ZA 4K3BA 1YX5B 5FR3A 1V81A 2BB5A 5BMHA 3EFCA 3VUXA 1VZ7A 3HM3A 1H8CA 2LGSA 1YJJA 3ZTDA 2DNFA 2KQ7A 3B1LX 1GUAB 4I6PA 3BYTB 4RMAA 1LXDA 4NJCA 5BYSA 1ENFA 4L23A 2PVGC 3CSFA 4ZRKA 3MJWA 1I4XA 3NS1A 2WXGA 3ZNGC 1I42A 2W3SA 3TIXA 1VR9A 4ZYSA 2O2VB 3E9SA 1KFYB 2KACA 2QMTA 2D2QA 4PYUA 4JX1C 2KTRA 1FO4A 3JSVA 3IBEA 3PVLA 3VRBB 1MJDA 3FKYA 3RCZA 4KV2A 1OEYA 4ANWA 4MACA 1HTQA 1NVID 1TS4A 4A90A 2D3GA 3K9OB 1JALA 3MHZA 2WDVB 5KHQA 2V3NA 2EKIA 4WJQA 1FIQA 1JCKB 1EO6A 1JWUD 3LB8C 1KLVA 2VZKD 1FCCC 2JZZA 3TJPA 3KWLA 3X23A 2QEJC 3RNBC 1YJ1A 1RAXA 3ZJUA 2J53A 4A3PA 3EFUA 4REZA 3A1QB 3RNCC 3TEYA 3V3XA 2JWZA 1QOFA 2JYEA 1BXTA 1XLOA 1WR6E 2CHZA 2IBIB 1KTKA 4KZ0A 2JUOA 1IYFA 2LD9A 1ESFA 2RDHA 3BY4B 1FPYA 3DBHB 2WX0A 1PGAA 3OJ3A 2HDEA 1XQQA 1Y8RC 1CZPA 1ZOYB 3R3MA 1F77A 2MJDA 5AUKA 3I5JC 1MHHE 1D5MC 4DXGA 3IHPC 4JPSA 4GGQA 4MGIE 2LZ6A 3N1XC 4AS1A 3EGRA 3L13A 4L1BA 1HEZE 3R66C 1V5TA 3MC0B 3V61A 4DHJB 3AH7A 1SEBD 1U4AA 4B0EA 2J4XA 1E9MA 3IG3A 4W9IA 5CX3A 3AE1B 2AL6A 2LGXA 3OAWA 2JY6A 3ZTCA 1WM2A 3AEBB 4RGTA 1WWTA 2N9EB 1N5WA 2CHWA 2HJ1A 3A9KB 3ZVVA 2BYTA 2WXPA 2KXJA 2UYZB 1Q5WB 5J18A 1XLPA 2G1EA 4WQOB 2Z8LA 1Y56A 4RH6A 5E6OA 1ZPSA 1DOXA 4JGHB 3NRZA 1I4QA 1ZKHA 3APDA 3W1SC 2V3SA 4C56C 1GG3A 1HZ5A 2HJ8A 2JVCA 2EELA 1WZ0A 1WGDA 1P9DU 1SE4A 2WDTB 2IO1B 3FILA 4E71A 1SGHA 2D3BA 4RGNA 1D6EC 5JXVA 2CHXA 2WWZA 3IT6B 1N61A 4QAYA 1E8ZA 1VLBA 3L08A 3UQBA 1FMAD 4YSZB 1GPXA 5L95C 3A33B 4N59A 2LFIA 2DYBA 1LO5D 2J52A 3BVMA 2KDEB 5EE0A 3FC4A 4ICVA 4HXDA 3QAQA 1TZ1A 3RUIB 1CQVA 3KQ4A 2MBEA 2XNAC 3OJ4B 3WA0A 1L0YB 5J17A 1D5ZC 5HG2A 2IGGA 3AE8B 1PYWD 2J0MA 1TIFA 2NMQA 2VRRB 1IBXA 2KTRB 3Q3FA 3JSVB 1JRPA 4N58A 3EECA 1KM7A 1TGZB 1HE8A 1M4VA 2ZPYA 1K53A 3UQAA 2INNE 2IO2B 2KZRA 2IYDB 3RN9C 3VUWA 3AEGB 2C5LC 2KLGA 1Q0WB 5L83A 1PGBA 3QWZB 1JW9D 1WMHA 2QDFA 4DHZE 2ICIA 1TKYA 4J3OD 3DQVA 4CYEA 1B9RA 2N9XA 4AOFA 1OFFA 1KRHA 4PK1A 3L10B 3PZDA 4II2B 2L0FA 1XCQL 2M1MA 4P7IA 3PLVA 5FKAC 1DGJA 3MP9A 1XCTL 1L6VA 1JQ4A 1WI0A 2GMIC 4PT5A 2JF5A 2R61A 1RWSA 1IGCA 4GSWA 2PLPA 3P4RB 5IP4D 1A5RA 4WAFA 2JZ3B 1HZ6A 1WIAA 3W9CB 2N9PC 4XDDA 4OVVA 3PGEA 5AUIA 3U2SC 3ENEA 3AULA 4MM3B 4EZLA 3I57A 2MA9B 3TCAA 5IO9A 4IWPA 1E8WA 2M17A 2HTHA 2BT6A 5EE9A 1K51A 2CS4A 1J7CA 1S1QB 1WX8A 4WWPA 3QX1A 4XWTA 5BMIA 1FXTB 3C0RB 1EU3A 1RRBA 4DDGD 3TL5A 4W9LA 4ARIA 2RMMA 2OOBB 2I2YA 5D3IB 2BGFA 3RMKC 3AXCA 4A3OA 1L4ZB 4A55A 3BK1A 5JHAA 3AN1A 1MG8A 1YNTE 1ET9A 3ZGZA 3UINB 1D5XC 2LVPA 2JU6X 2D10A 3WAMA 4IUMB 4XC2A 3SFEB 3ECIA 3APFA 2RR9A 2BBCA 3Q8AA 1TS2A 4C7YA 3DPDA 3KUZA 3VH4B 3KYDD 2W55A 5DPWA 2WLBA 3VUYA 1YD8U 2TSSA 2KJ6A 5C23A 1GAQB 3X0WA 4LDTB 3PT2B 1KH0A 1CK1A 1J7BA 2YEPF 3PV1A 5C3JB 3AU5A 1L4DB 3R2IA 2ZVOA 3DCGA 5BMGA 1X1MA 1YN4A 3Q3JA 2GBKA 3SR6A 5EE1A 3RYTA 5JZEB 3DWGC 3W1SA 4TSSA 1RYJA 1UGMA 1WJ6A 1YQ4B 1ZXHA 3FILB 1BT0A 2KO3A 4GDKB 3H6NA 1T5XD 5LXHA 1SB3C 1QLBB 1N5XA 3W2DA 4HEA1 4HCNB 4XWWA 2YLMA 2IGDA 2WXLA 2WXIA 4XYCA 3AI5A 2L7RA 4HK2A 1I35A 3L17A 4IWOA 2C60A 3W5UB 2PTLA 4HJKA 3ZO5B 4ZHPA 3PPAA 2JZPA 4KGSA 2K8BA 2L32A 1WXMA 3AE3B 3RNGC 2PPHA 5HKHA 3BIID 3PRMB 4NZLB 4BOZB 4MGYE 4HCPB 3TSSA 1GC6A 1V1OA 2LXAA 4GIVA 4WWOA 2J42A 4KZCA 4NPNA 2V1YA 3MFGA 1FCLA 3IXSA 3M62B 4HRSA 1TYGB 1Z5SB 2WP9B 3AEAB 1E90A 1UZXB 3GE3C 3B2GA 4H2AA 3N32A 4LCDE 4G3XB 1VDVA 3MJ5A 2KAJA 3GS2A 1V1PB 3PREA 1TKEA 3P4QB 2PMVA 4IW0A 1E6EB 3IFWB 3URYA 4XDCA 1PDXA 1OQRA 3ZUNA 4HLEA 1RFKA 4EFOA 3TEZA 2OJWA 1XLNA 1BMLC 4W9HA 5IKCM 3MC9A 1P3QU 4FN2A 2L83A 4F8CB 4FJZA 1LGRA 4ZHOA 2XEWA 2LWPA 2K1FA 1VCBA 3V05A 4IM2A 2DWQA 2K0PA 2ON8A 2QCZA 4C7ZA 4M8MA 1KJTA 4ZRPA 3U4EG 1L2NA 4LLGM 1HA5A 3WAOA 1E8XA 1A70A 1STEA 5D6JB 3QQ8B 3DBLB 4KDIC 1DYQA 2REXA 2JSVX 4TKNA 3VQIA 4OZCA 4DK5A 3AE5B 3R7QA 1WZ3A 3A9JA 3MTNB 3P63A 2H88B 3U52E 4HPMB 1R4MI 3QIJA 3DVNV 2BYEA 1D4BA 1OTRB 1T6BX 1N63A 3UI3A 4D2KA 1E7VA 3ML9A 3AE9B 2QSDA 1YN3A 2MP2A 3AE2B 2DZKA 4K3CA 5D7GA 1QT9A 3NY5A 3U30A 4ZOHC 3ZLZA 1UH6A 4KKJA 4RGMA 1WFYA 1TBEA 2OEDA 3ZNHB 1SSNA 4M0WA 3Q2AC 4NJ6A 4JE3B 1Z2MA 2DYMA 1XF5L 3H1UA 1WXSA 1K50A 3HIZA 4LJPB 2WDQB 1EWYC 3DBRB 4NAWB 2PW9A 2RPQA 4W9DA 2BYVE 2BS4B 4WWMA 1MHXA 3APCA 2MQJA 4OVZA 4KIKA 2AYOB 2KDMA 1TJEA 2JT4B 2LHDA 1R4NB 4JWUC 3RNFC 2IY0B 1I4PA 3DOWA 2JQRB 3DDCB 4AP4C 4BAXA 3LDZE 1NEKB 4BKGA 4A8XC 1WRIA 5E6JA 4TUUA 2DENB 4PYZA 3KH0A 3O65B 3NJTA 4FULA 2BS2B 2KFKA 3H7PA 3P4PB 3UF8A 4EKUA 2ZJDA 1AW7A 3UIOB 1FD6A 1SBBB 2J7QB 3V60A 1KLUD 1F1HA 2XK5A 2V4IB 2FUG1 2N9KA 2IO3B 1GJZA 3V62A 1MI0A 1SE2A 4EOYA 2LVOA 3AE6B 2LXCA 2Z59B 3AV8A 3C19A 3W5VB 4HROA 1NBFC 1ZDVA 1YOVB 2NTSA 3KYCD 5G2NA 1G6JA 4BKTA 3I9V1 4ANUA 3KVFB 4DXAB 3DHIC 1FNVA 2BKFA 2EMTA 3Q8FA 3RNEC 1LFDA 4DDID 3UGBB 4M02A 2INDC 1WX7A 3Q3NC 2N9LA 2X38A 2O6VA 3VAWA 4ANXA 3R7RA 2FUHB 2INPE 5TR5A 2LJ5A 2LGIA 2IJ0A 2DX5B 1WSPA 4MJSA 1C3TA 2D3CA 1ZXIA 3QJZA 4GDLA 4WIPA 1OQYA 4I6LB 4HDOA 4JWSC 1YMHE 4B6WA 2KLCA 1V5OA 1L0VB 1MFWA 2LMCA 4AWJA 5AZGA 2L52A 2K8CA 4OVUA 2LRWA 5EE3A 3A9JB 4IG7B 1SF0A 1T0YA 1FM0D 4W9EA 2WXJA 2KYWA 3ZDMC 3BWUD 4RM8A 1L5PA 1UD7A 1WYWB 4M8NA 2MP2B 1WJ4A 3LJ3A 3N30A 3SD5A 1EUVB 2G9HD 1FEHA
chains in the Genus database with same CATH topology
2L8JA 2PJHA 3ENEA 3AULA 2N1VA 5CHVC 2KTFA 4EZKA 4EZLA 2A5UA 2K8HA 5C1ZA 3SHQA 3CMMB 4GU2A 3A4RA 4TV3A 2KWCA 2ZNVC 4M0WB 2AWTA 2LI5A 2MA9B 3TMPB 3PTFC 3TCAA 4IWPA 1AARA 2DZMA 1E8WA 1IP9A 1V9JA 2M17A 2HTHA 1GNUA 2L76A 3ZIMA 2ASQA 2V4LA 4DHJD 2CS4A 5IAAC 1S1QB 1V86A 1WX8A 4WWPA 1WY8A 1WGHA 3QX1A 4GXBA 4ZYNA 1FXTB 2CU1A 1WJUA 2MBBB 3C0RB 2D07B 4K7WA 4EZJA 1RRBA 1GC7A 4DDGD 3TL5A 4W9LA 3PHXB 2OOBB 3JW0X 4K1RB 2ZZPB 3TBLD 3AU4A 2IY1B 4PS7A 2BGFA 1WGYA 3AXCA 4A3OA 5JHAA 5G55A 4BFRA 3A1QA 1MG8A 2KD0A 4MSMB 2KMAA 2CR5A 3UINB 3JYUA 2LVPA 2D10A 1H4RA 3WAMA 1C1YB 4IUMB 3EHVA 4XC2A 2G45B 2PE9A 3ECIA 3APFA 2M0XA 1E5WA 2RR9A 3WALA 3NS8A 2ZPNA 5LLIA 3DPDA 3KUZA 3VH4B 3KYDD 3V6EB 3KW5B 1WGGA 2LVQA 3H7SA 1WXVA 2MRPA 2BWES 5DPWA 3VUYA 2KFKB 2K6QA 1YD8U 1QZEA 2FIDA 2MLBA 4MGZE 3H7PB 3V6CB 2KJ6A 5C23A 3VDZA 4URKA 3X0WA 1YIWA 3NHEB 3M95A 3ZDTA 4LDTB 3PT2B 4EUTA 4HVBA 4K7SA 1IPGA 3PV1A 3AU5A 3M63B 5EDSA 4HDQA 1WR1A 2RSUA 3VTWA 4EEWA 2ZVOA 2EMSA 2XK5B 2L00B 1KOTA 2MW5A 2KANA 2NPTB 3M3JA 2KC1A 3DCGA 2I1JA 3L54A 1X1MA 1Q1OA 2G4DB 2KX3A 2KOXA 2GBKA 3Q3JA 4W9CA 4GB9A 2C7MB 1V2YA 3QCAA 1J19A 3S2AA 3RYTA 4PS3A 4DHZB 2BKRB 3NZSA 3W1SA 5JZEB 2JRHA 4HWIB 1R4NI 2LGDA 1UGMA 1WJ6A 3QK0A 4BOSC 4A20A 1WM3A 5KHOA 1BT0A 1EF5A 2KO3A 4GDKB 3H6NA 1WX9A 4CO7A 5LXHA 2BWFA 2GBMA 4JIOU 2M4NA 2JPHA 3HM6X 2FIFA 3QHTA 4F1SA 2KMCA 3RULA 4HCNB 4FHJA 3VHTC 2LASA 5DPRA 2YLMA 1P98A 1LQBA 5AZHA 1F9JA 2Z0EB 3AI5A 4NQLB 4WWNA 2L7RA 4J6IA 4HK2A 1I35A 1UBQA 3L17A 5AEKB 4ASWC 3A9KA 4G11A 4IWOA 2C7HA 4IWQA 2KX0A 2C60A 3P2BA 4HJKA 4MM3A 3ZO5B 4WJOA 4AJYB 4DBGA 3PPAA 3HHMA 2K8BA 2GOWA 3W1YA 2BYFA 2FNJB 1WXMA 3D32A 2DAJA 2LGYA 2O6VB 1UBIA 1XD3B 2PPHA 5HKHA 3PRMB 2PE6B 3ML8A 2DZIA 2NCNA 2ZCCA 4MGYE 2KVRA 4BOZB 1ZW7A 4HCPB 1SIFA 4BKSD 2C7NB 1P1AA 4N9F4 4FJVB 4ZRIA 3T9LA 1GC6A 2LXAA 3PLUA 4GIVA 4WWOA 3U8ZA 5J2RA 1YX5B 2DAFA 1V81A 4II3B 2RD0A 4KZCA 1WH3A 2V1YA 4MJSB 2RGFA 4NPNA 5CHWA 2ZEQA 2Y5BB 4BBNC 3VUXA 3M62B 4JLCA 4AUQC 2IO0B 1Z5SB 2UWQA 3HM3A 1H8CA 1WE7A 4HPLB 3ZTDA 1E90A 1UZXB 2KNBA 2KQ7A 2Z0DB 2DZJA 3B1LX 3N32A 1J0GA 2G4SA 4LCDE 4G3XB 4MGKE 1GUAB 4I6PA 2MBOA 3QA8A 3RT3B 2LUEA 4GN1A 3DBLI 3PREA 4RMAA 2OJRA 2YVCA 4KIKB 1LXDA 4X57B 2WYQA 4JQWC 4IW0A 2NBVB 4ZRKA 3CSFA 4FBJB 3IFWB 3MJWA 4BVUC 2BF8B 2KJHB 5JH5C 2L0TA 4ZRJA 3ZNGC 3ZW3A 3ZUNA 4HLEA 1I42A 4EFOA 3TIXA 2O2VB 3ZNZB 2AL3A 1SE9A 4KDLB 4W9HA 2N1WA 3DBHI 2D2QA 2KDBA 4PYUA 1RFAA 1P3QU 2KTRA 3JSVA 4FN2A 4AJWA 1NI2A 3IBEA 3PVLA 1V49A 4F8CB 4FJZA 1J8CA 2G3QB 2B3AA 3RCZA 2XEWA 4KV2A 1OEYA 4ANWA 2LWPA 3CSTA 3WIMA 3K9PB 2K1FA 4BKSA 1VCBA 4E3CA 4IM2A 2XBBC 4G0NB 1WXAA 2D3GA 3K9OB 5KHQA 2CKHB 4GDKA 4WJQA 1EO6A 2AEHA 1KLVA 1WF9A 4NNJB 1V80A 2JZZA 3DBRI 3TJPA 3X23A 2N7DA 4M8MA 1YJ1A 1RAXA 1KJTA 1L2NA 5D2MB 3WAOA 2MBQA 5E6NA 1E8XA 3A4SC 1ZGUB 2ZVNA 3QQ8B 5D6JB 4W9KA 4KDIC 2KDIA 4A3PA 2REXA 3EFUA 4WJPA 3SDLC 4TKNA 5DPSA 3VQIA 4DK5A 3A1QB 3OLMD 5CHFA 3R7QA 1WZ3A 4CHKA 2JWZA 1WE6A 3A9JA 5IA7A 3MTNB 5CTRC 3RD2A 3VXWA 4HPMB 1R4MI 3QIJA 3DVNV 2BYEA 1WR6E 4NY0A 2CHZA 4IM0A 2IBIB 4KZ0A 1OTRB 4ICUA 3CF6E 1E7VA 2JUOA 1IYFA 2LD9A 2K25A 3ML9A 3PSEB 2WX1A 3BY4B 3ALBA 3H9DA 3PRZA 2FAZA 2WX0A 2MP2A 2N4FA 2LRUA 2DZKA 4MDKE 2NVUI 3OJ3A 5D7GA 5AZFA 1XQQA 3VTVA 2DHZA 1Y8RC 3RZWC 5FR6A 3NY5A 3R3MA 4FLHA 3U30A 4FA6A 4TQ0A 3ZLZA 1UH6A 4FADA 1YX6B 2IZVB 4NJ7A 3GZNI 1WFYA 1TBEA 2HD5B 3ZNHB 3KUDB 2PEAA 3IHPC 5JHBA 4GGQA 4NJ6A 1E8YA 1Z2MA 1OGWA 3ONSA 4MGIE 2ZCBA 4W9FA 2LZ6A 2DYMA 3H1UA 4ZDVA 2J0JA 1WXSA 2KHWB 3HIZA 2MX2A 1P0RA 3L13A 1XT9B 3R66C 4K81A 1V5TA 4LJPB 3U7DA 3V61A 4DHJB 1V6EA 5D94A 4NAWB 2RPQA 4W9DA 3ZKJC 2BYVE 3APCA 1L7YA 2MQJA 4LJOB 4KIKA 2AYOB 4GMVA 2L05A 1U4AA 3IVFA 4KVGB 4GDLB 2K39A 3HK0A 3IG3A 2JT4B 4W9IA 5CX3A 1E7UA 1WMHB 3PRPB 2NR2A 4IC7B 4KSLC 4W9GA 2AL6A 2LGXA 2A4ZA 5DPTA 2IY0B 2KC2A 3OAWA 2JY6A 3ZTCA 3VTUA 1PQSA 1WM2A 1D3ZA 2O2VA 3DOWA 3DDCB 2N9EB 2CHWA 3A9KB 4AP4C 1JRUA 3LDZE 3DVGY 2J0KA 1EF1A 4FJYA 4BKGA 3ZVVA 3ZRCA 3SU8X 4TUUA 2K6DB 2DENB 4PYZA 2KXJA 2UYZB 3KH0A 1Q5WB 3O65B 5J18A 1WJNA 4FULA 2M8SA 4WQOB 3QC8B 2O6VD 2GBRA 4ANVA 5E6OA 1WRDB 2GBJA 4YL8A 2KFKA 5DCNA 3H7PA 4B95A 4JGHB 4NQKE 1WGRA 3UF8A 4EKUA 1OEYJ 2ZJDA 4JL9A 3UIOB 3UIPB 2J7QB 4W9JA 3V60A 3KUCB 1ZKHA 3MHSD 3APDA 3W1SC 2XK5A 2V3SA 4XX5A 2NPTA 2FCSA 1GG3A 2HJ8A 2JVCA 2NS5A 5GMVA 3GOEA 2EKEC 3VVWB 1WZ0A 1WGDA 2IO3B 4WAAA 3WAPA 1P9DU 4MH0E 2WDTB 1GJZA 2QHOA 3B08A 2IO1B 3N3KB 3V62A 4E71A 1SGHA 2R2QA 5BO4B 4EOYA 2CHXA 2WWZA 2LVOA 4XZ4A 2LXCA 1E8ZA 2Z59B 2MCNB 3L08A 3UQBA 2N7EA 1NBFC 2FCMA 3A33B 4PS8A 5L95C 4FHKA 4TQ1A 1K8RB 2DYBA 3EC8A 4B9KA 4WJNA 3B0AA 2NBUA 3DVNU 3KYCD 5G2NA 1G6JA 2KDEB 4E74A 1M94A 1LM8B 3NOBA 3VFKA 4BKTA 3QARA 4ANUA 4ICVA 4HXDA 3QAQA 4BBNF 1TZ1A 2KWUB 3KVFB 2MBHA 3I3TB 3RUIB 2MBEA 4DXAB 3OJ4B 3WA0A 2BKFA 2MWSB 1CMXB 2EMTA 1LFDA 4DDID 5J17A 1VD2A 3UGBB 2DYOA 1TTNA 2J0MA 2BPSA 4DWFA 2VRRB 1WX7A 2GBNA 2KTRB 3Q3FA 3JSVB 4F7ZA 1NDDA 3EECA 1YQBA 1KM7A 2O6VA 3BINA 1TGZB 1HE8A 3VAWA 2KK8A 2ZPYA 4ANXA 3UQAA 3ZNID 3R7RA 2FUHB 2KDFB 3WANA 2IO2B 2KZRA 4MSQB 5TR5A 2IYDB 2LJ5A 4MELA 4NAWA 1UELA 2I1KA 4LDTD 4MEMA 2R2OA 5LXIB 3VUWA 1RLFA 2DX5B 2ZNVB 2JXXA 1S3SG 2C5LC 2KLGA 4IM3A 4MJSA 1C3TA 2HE7A 1Q0WB 2KWVB 3QJZA 4KSKC 3QWZB 5L83A 4GDLA 1OQYA 2L3ZA 1WMHA 4I6LB 4DHZE 4HDOA 2KFJA 4B6WA 3DQVA 3JVZX 4CYEA 2D11A 2KLCA 2N9XA 1V5OA 4AOFA 1ISNA 2NBWB 5E6PA 4AWJA 2KQSA 3L10B 2FCQA 3PZDA 4II2B 2KJRA 2L0FA 5AZGA 4G50A 2K8CA 2M1MA 4P7IA 4OVUA 2LRWA 3PLVA 2FCNA 3A9JB 3ZRFA 4GOCA 4IG7B 2MSED 3L0WB 1T0YA 2C9WB 2KN5A 4W9EA 2KKCA 2W9NA 1WI0A 2GMIC 3ZDMC 2JF5A 4GSWA 3DVGX 4RM8A 3RZFA 3NZUA 3PHWB 1UD7A 3DBSA 3VH3B 3T8MA 1A5RA 4RM9A 3PS6A 2JZ3B 2JRIB 1WYWB 1WIAA 2N9PC 4M8NA 4K7UA 2MP2B 1WJ4A 4I6NB 3LJ3A 3N30A 3PGEA 4OVVA 3SD5A 1EUVB 3L16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8J A;  2PJH A;  3ENE A;  3AUL A;  2N1V A;  5CHV C;  2KTF A;  4EZK A;  4EZL A;  2A5U A;  2K8H A;  5C1Z A;  3SHQ A;  3CMM B;  4GU2 A;  3A4R A;  4TV3 A;  2KWC A;  2ZNV C;  4M0W B;  2AWT A;  2LI5 A;  2MA9 B;  3TMP B;  3PTF C;  3TCA A;  4IWP A;  1AAR A;  2DZM A;  1E8W A;  1IP9 A;  1V9J A;  2M17 A;  2HTH A;  1GNU A;  2L76 A;  3ZIM A;  2ASQ A;  2V4L A;  4DHJ D;  2CS4 A;  5IAA C;  1S1Q B;  1V86 A;  1WX8 A;  4WWP A;  1WY8 A;  1WGH A;  3QX1 A;  4GXB A;  4ZYN A;  1FXT B;  2CU1 A;  1WJU A;  2MBB B;  3C0R B;  2D07 B;  4K7W A;  4EZJ A;  1RRB A;  1GC7 A;  4DDG D;  3TL5 A;  4W9L A;  3PHX B;  2OOB B;  3JW0 X;  4K1R B;  2ZZP B;  3TBL D;  3AU4 A;  2IY1 B;  4PS7 A;  2BGF A;  1WGY A;  3AXC A;  4A3O A;  5JHA A;  5G55 A;  4BFR A;  3A1Q A;  1MG8 A;  2KD0 A;  4MSM B;  2KMA A;  2CR5 A;  3UIN B;  3JYU A;  2LVP A;  2D10 A;  1H4R A;  3WAM A;  1C1Y B;  4IUM B;  3EHV A;  4XC2 A;  2G45 B;  2PE9 A;  3ECI A;  3APF A;  2M0X A;  1E5W A;  2RR9 A;  3WAL A;  3NS8 A;  2ZPN A;  5LLI A;  3DPD A;  3KUZ A;  3VH4 B;  3KYD D;  3V6E B;  3KW5 B;  1WGG A;  2LVQ A;  3H7S A;  1WXV A;  2MRP A;  2BWE S;  5DPW A;  3VUY A;  2KFK B;  2K6Q A;  1YD8 U;  1QZE A;  2FID A;  2MLB A;  4MGZ E;  3H7P B;  3V6C B;  2KJ6 A;  5C23 A;  3VDZ A;  4URK A;  3X0W A;  1YIW A;  3NHE B;  3M95 A;  3ZDT A;  4LDT B;  3PT2 B;  4EUT A;  4HVB A;  4K7S A;  1IPG A;  3PV1 A;  3AU5 A;  3M63 B;  5EDS A;  4HDQ A;  1WR1 A;  2RSU A;  3VTW A;  4EEW A;  2ZVO A;  2EMS A;  2XK5 B;  2L00 B;  1KOT A;  2MW5 A;  2KAN A;  2NPT B;  3M3J A;  2KC1 A;  3DCG A;  2I1J A;  3L54 A;  1X1M A;  1Q1O A;  2G4D B;  2KX3 A;  2KOX A;  2GBK A;  3Q3J A;  4W9C A;  4GB9 A;  2C7M B;  1V2Y A;  3QCA A;  1J19 A;  3S2A A;  3RYT A;  4PS3 A;  4DHZ B;  2BKR B;  3NZS A;  3W1S A;  5JZE B;  2JRH A;  4HWI B;  1R4N I;  2LGD A;  1UGM A;  1WJ6 A;  3QK0 A;  4BOS C;  4A20 A;  1WM3 A;  5KHO A;  1BT0 A;  1EF5 A;  2KO3 A;  4GDK B;  3H6N A;  1WX9 A;  4CO7 A;  5LXH A;  2BWF A;  2GBM A;  4JIO U;  2M4N A;  2JPH A;  3HM6 X;  2FIF A;  3QHT A;  4F1S A;  2KMC A;  3RUL A;  4HCN B;  4FHJ A;  3VHT C;  2LAS A;  5DPR A;  2YLM A;  1P98 A;  1LQB A;  5AZH A;  1F9J A;  2Z0E B;  3AI5 A;  4NQL B;  4WWN A;  2L7R A;  4J6I A;  4HK2 A;  1I35 A;  1UBQ A;  3L17 A;  5AEK B;  4ASW C;  3A9K A;  4G11 A;  4IWO A;  2C7H A;  4IWQ A;  2KX0 A;  2C60 A;  3P2B A;  4HJK A;  4MM3 A;  3ZO5 B;  4WJO A;  4AJY B;  4DBG A;  3PPA A;  3HHM A;  2K8B A;  2GOW A;  3W1Y A;  2BYF A;  2FNJ B;  1WXM A;  3D32 A;  2DAJ A;  2LGY A;  2O6V B;  1UBI A;  1XD3 B;  2PPH A;  5HKH A;  3PRM B;  2PE6 B;  3ML8 A;  2DZI A;  2NCN A;  2ZCC A;  4MGY E;  2KVR A;  4BOZ B;  1ZW7 A;  4HCP B;  1SIF A;  4BKS D;  2C7N B;  1P1A A;  4N9F 4;  4FJV B;  4ZRI A;  3T9L A;  1GC6 A;  2LXA A;  3PLU A;  4GIV A;  4WWO A;  3U8Z A;  5J2R A;  1YX5 B;  2DAF A;  1V81 A;  4II3 B;  2RD0 A;  4KZC A;  1WH3 A;  2V1Y A;  4MJS B;  2RGF A;  4NPN A;  5CHW A;  2ZEQ A;  2Y5B B;  4BBN C;  3VUX A;  3M62 B;  4JLC A;  4AUQ C;  2IO0 B;  1Z5S B;  2UWQ A;  3HM3 A;  1H8C A;  1WE7 A;  4HPL B;  3ZTD A;  1E90 A;  1UZX B;  2KNB A;  2KQ7 A;  2Z0D B;  2DZJ A;  3B1L X;  3N32 A;  1J0G A;  2G4S A;  4LCD E;  4G3X B;  4MGK E;  1GUA B;  4I6P A;  2MBO A;  3QA8 A;  3RT3 B;  2LUE A;  4GN1 A;  3DBL I;  3PRE A;  4RMA A;  2OJR A;  2YVC A;  4KIK B;  1LXD A;  4X57 B;  2WYQ A;  4JQW C;  4IW0 A;  2NBV B;  4ZRK A;  3CSF A;  4FBJ B;  3IFW B;  3MJW A;  4BVU C;  2BF8 B;  2KJH B;  5JH5 C;  2L0T A;  4ZRJ A;  3ZNG C;  3ZW3 A;  3ZUN A;  4HLE A;  1I42 A;  4EFO A;  3TIX A;  2O2V B;  3ZNZ B;  2AL3 A;  1SE9 A;  4KDL B;  4W9H A;  2N1W A;  3DBH I;  2D2Q A;  2KDB A;  4PYU A;  1RFA A;  1P3Q U;  2KTR A;  3JSV A;  4FN2 A;  4AJW A;  1NI2 A;  3IBE A;  3PVL A;  1V49 A;  4F8C B;  4FJZ A;  1J8C A;  2G3Q B;  2B3A A;  3RCZ A;  2XEW A;  4KV2 A;  1OEY A;  4ANW A;  2LWP A;  3CST A;  3WIM A;  3K9P B;  2K1F A;  4BKS A;  1VCB A;  4E3C A;  4IM2 A;  2XBB C;  4G0N B;  1WXA A;  2D3G A;  3K9O B;  5KHQ A;  2CKH B;  4GDK A;  4WJQ A;  1EO6 A;  2AEH A;  1KLV A;  1WF9 A;  4NNJ B;  1V80 A;  2JZZ A;  3DBR I;  3TJP A;  3X23 A;  2N7D A;  4M8M A;  1YJ1 A;  1RAX A;  1KJT A;  1L2N A;  5D2M B;  3WAO A;  2MBQ A;  5E6N A;  1E8X A;  3A4S C;  1ZGU B;  2ZVN A;  3QQ8 B;  5D6J B;  4W9K A;  4KDI C;  2KDI A;  4A3P A;  2REX A;  3EFU A;  4WJP A;  3SDL C;  4TKN A;  5DPS A;  3VQI A;  4DK5 A;  3A1Q B;  3OLM D;  5CHF A;  3R7Q A;  1WZ3 A;  4CHK A;  2JWZ A;  1WE6 A;  3A9J A;  5IA7 A;  3MTN B;  5CTR C;  3RD2 A;  3VXW A;  4HPM B;  1R4M I;  3QIJ A;  3DVN V;  2BYE A;  1WR6 E;  4NY0 A;  2CHZ A;  4IM0 A;  2IBI B;  4KZ0 A;  1OTR B;  4ICU A;  3CF6 E;  1E7V A;  2JUO A;  1IYF A;  2LD9 A;  2K25 A;  3ML9 A;  3PSE B;  2WX1 A;  3BY4 B;  3ALB A;  3H9D A;  3PRZ A;  2FAZ A;  2WX0 A;  2MP2 A;  2N4F A;  2LRU A;  2DZK A;  4MDK E;  2NVU I;  3OJ3 A;  5D7G A;  5AZF A;  1XQQ A;  3VTV A;  2DHZ A;  1Y8R C;  3RZW C;  5FR6 A;  3NY5 A;  3R3M A;  4FLH A;  3U30 A;  4FA6 A;  4TQ0 A;  3ZLZ A;  1UH6 A;  4FAD A;  1YX6 B;  2IZV B;  4NJ7 A;  3GZN I;  1WFY A;  1TBE A;  2HD5 B;  3ZNH B;  3KUD B;  2PEA A;  3IHP C;  5JHB A;  4GGQ A;  4NJ6 A;  1E8Y A;  1Z2M A;  1OGW A;  3ONS A;  4MGI E;  2ZCB A;  4W9F A;  2LZ6 A;  2DYM A;  3H1U A;  4ZDV A;  2J0J A;  1WXS A;  2KHW B;  3HIZ A;  2MX2 A;  1P0R A;  3L13 A;  1XT9 B;  3R66 C;  4K81 A;  1V5T A;  4LJP B;  3U7D A;  3V61 A;  4DHJ B;  1V6E A;  5D94 A;  4NAW B;  2RPQ A;  4W9D A;  3ZKJ C;  2BYV E;  3APC A;  1L7Y A;  2MQJ A;  4LJO B;  4KIK A;  2AYO B;  4GMV A;  2L05 A;  1U4A A;  3IVF A;  4KVG B;  4GDL B;  2K39 A;  3HK0 A;  3IG3 A;  2JT4 B;  4W9I A;  5CX3 A;  1E7U A;  1WMH B;  3PRP B;  2NR2 A;  4IC7 B;  4KSL C;  4W9G A;  2AL6 A;  2LGX A;  2A4Z A;  5DPT A;  2IY0 B;  2KC2 A;  3OAW A;  2JY6 A;  3ZTC A;  3VTU A;  1PQS A;  1WM2 A;  1D3Z A;  2O2V A;  3DOW A;  3DDC B;  2N9E B;  2CHW A;  3A9K B;  4AP4 C;  1JRU A;  3LDZ E;  3DVG Y;  2J0K A;  1EF1 A;  4FJY A;  4BKG A;  3ZVV A;  3ZRC A;  3SU8 X;  4TUU A;  2K6D B;  2DEN B;  4PYZ A;  2KXJ A;  2UYZ B;  3KH0 A;  1Q5W B;  3O65 B;  5J18 A;  1WJN A;  4FUL A;  2M8S A;  4WQO B;  3QC8 B;  2O6V D;  2GBR A;  4ANV A;  5E6O A;  1WRD B;  2GBJ A;  4YL8 A;  2KFK A;  5DCN A;  3H7P A;  4B95 A;  4JGH B;  4NQK E;  1WGR A;  3UF8 A;  4EKU A;  1OEY J;  2ZJD A;  4JL9 A;  3UIO B;  3UIP B;  2J7Q B;  4W9J A;  3V60 A;  3KUC B;  1ZKH A;  3MHS D;  3APD A;  3W1S C;  2XK5 A;  2V3S A;  4XX5 A;  2NPT A;  2FCS A;  1GG3 A;  2HJ8 A;  2JVC A;  2NS5 A;  5GMV A;  3GOE A;  2EKE C;  3VVW B;  1WZ0 A;  1WGD A;  2IO3 B;  4WAA A;  3WAP A;  1P9D U;  4MH0 E;  2WDT B;  1GJZ A;  2QHO A;  3B08 A;  2IO1 B;  3N3K B;  3V62 A;  4E71 A;  1SGH A;  2R2Q A;  5BO4 B;  4EOY A;  2CHX A;  2WWZ A;  2LVO A;  4XZ4 A;  2LXC A;  1E8Z A;  2Z59 B;  2MCN B;  3L08 A;  3UQB A;  2N7E A;  1NBF C;  2FCM A;  3A33 B;  4PS8 A;  5L95 C;  4FHK A;  4TQ1 A;  1K8R B;  2DYB A;  3EC8 A;  4B9K A;  4WJN A;  3B0A A;  2NBU A;  3DVN U;  3KYC D;  5G2N A;  1G6J A;  2KDE B;  4E74 A;  1M94 A;  1LM8 B;  3NOB A;  3VFK A;  4BKT A;  3QAR A;  4ANU A;  4ICV A;  4HXD A;  3QAQ A;  4BBN F;  1TZ1 A;  2KWU B;  3KVF B;  2MBH A;  3I3T B;  3RUI B;  2MBE A;  4DXA B;  3OJ4 B;  3WA0 A;  2BKF A;  2MWS B;  1CMX B;  2EMT A;  1LFD A;  4DDI D;  5J17 A;  1VD2 A;  3UGB B;  2DYO A;  1TTN A;  2J0M A;  2BPS A;  4DWF A;  2VRR B;  1WX7 A;  2GBN A;  2KTR B;  3Q3F A;  3JSV B;  4F7Z A;  1NDD A;  3EEC A;  1YQB A;  1KM7 A;  2O6V A;  3BIN A;  1TGZ B;  1HE8 A;  3VAW A;  2KK8 A;  2ZPY A;  4ANX A;  3UQA A;  3ZNI D;  3R7R A;  2FUH B;  2KDF B;  3WAN A;  2IO2 B;  2KZR A;  4MSQ B;  5TR5 A;  2IYD B;  2LJ5 A;  4MEL A;  4NAW A;  1UEL A;  2I1K A;  4LDT D;  4MEM A;  2R2O A;  5LXI B;  3VUW A;  1RLF A;  2DX5 B;  2ZNV B;  2JXX A;  1S3S G;  2C5L C;  2KLG A;  4IM3 A;  4MJS A;  1C3T A;  2HE7 A;  1Q0W B;  2KWV B;  3QJZ A;  4KSK C;  3QWZ B;  5L83 A;  4GDL A;  1OQY A;  2L3Z A;  1WMH A;  4I6L B;  4DHZ E;  4HDO A;  2KFJ A;  4B6W A;  3DQV A;  3JVZ X;  4CYE A;  2D11 A;  2KLC A;  2N9X A;  1V5O A;  4AOF A;  1ISN A;  2NBW B;  5E6P A;  4AWJ A;  2KQS A;  3L10 B;  2FCQ A;  3PZD A;  4II2 B;  2KJR A;  2L0F A;  5AZG A;  4G50 A;  2K8C A;  2M1M A;  4P7I A;  4OVU A;  2LRW A;  3PLV A;  2FCN A;  3A9J B;  3ZRF A;  4GOC A;  4IG7 B;  2MSE D;  3L0W B;  1T0Y A;  2C9W B;  2KN5 A;  4W9E A;  2KKC A;  2W9N A;  1WI0 A;  2GMI C;  3ZDM C;  2JF5 A;  4GSW A;  3DVG X;  4RM8 A;  3RZF A;  3NZU A;  3PHW B;  1UD7 A;  3DBS A;  3VH3 B;  3T8M A;  1A5R A;  4RM9 A;  3PS6 A;  2JZ3 B;  2JRI B;  1WYW B;  1WIA A;  2N9P C;  4M8N A;  4K7U A;  2MP2 B;  1WJ4 A;  4I6N B;  3LJ3 A;  3N30 A;  3PGE A;  4OVV A;  3SD5 A;  1EUV B;  3L16 A; 
#chains in the Genus database with same CATH topology
 2N1V A;  2KTF A;  3CIR B;  3CMM B;  4TV3 A;  3GP7 A;  4M0W B;  1ZP0 B;  3TMP B;  4S0R A;  1AAR A;  2Y5C A;  4L2Y A;  2AX5 A;  4DQO C;  1GNU A;  2FE8 A;  4DHJ D;  3GZN B;  5IAA C;  4ZYN A;  4C4V A;  2CU1 A;  1WJU A;  2M0A A;  2MBB B;  4EZJ A;  1QF6 A;  4K1R B;  2ZZP B;  2K22 A;  2IY1 B;  5HI1 A;  5G55 A;  3BK2 A;  1NI3 A;  4HKQ A;  2CJO A;  3Q3O C;  1TS3 A;  2DBY A;  2G45 B;  2PE9 A;  1V8C A;  3ABV B;  1V97 A;  3WAL A;  1E5W A;  2ZPN A;  3ZXR A;  4KGT A;  2BWE S;  2KFK B;  1QZE A;  4MGZ E;  3H7P B;  1YIW A;  3ZDT A;  1IPG A;  1WYG A;  4HDQ A;  1WR1 A;  4OZA A;  3VTW A;  1ZDX A;  2XK5 B;  1KOT A;  1PUT A;  2BQQ A;  2KC1 A;  1Q1O A;  2KX3 A;  3AM9 A;  2WXF A;  4GB9 A;  1L0X B;  3S2A A;  4DHZ B;  4HWI B;  1R4N I;  5H8Y E;  3FAH A;  4A20 A;  1I4H A;  5KHO A;  4BZA A;  2BWF A;  2JPH A;  1FRR A;  3QHT A;  4F1S A;  2KMC A;  4FHJ A;  5I4D A;  3BVG A;  2LAS A;  5DPR A;  1LQB A;  3P4S B;  5AZH A;  1F9J A;  4WWN A;  1UBQ A;  5AEK B;  3NUH B;  1HQR D;  4IWQ A;  3IAS 1;  3R8B A;  4DBG A;  4R3D A;  3HHM A;  3KWV A;  3D32 A;  2DAJ A;  2O6V B;  1UBI A;  3ML8 A;  2KVR A;  1EU4 A;  1ZW7 A;  4N9F 4;  4ZRI A;  3AEC B;  2K3U A;  1XXG A;  2UU7 A;  4II3 B;  2RD0 A;  4MJS B;  5CHW A;  2RGF A;  2ZEQ A;  2QIE B;  2SEB D;  4JLC A;  4AUQ C;  2IO0 B;  1WE7 A;  4HPL B;  4MT5 A;  1TKG A;  2I38 A;  2KNB A;  2Z0D B;  2MBO A;  2LUE A;  2OJR A;  2YVC A;  4X57 B;  3AEF B;  4JQW C;  2NBV B;  1WXQ A;  1T0Q C;  4FBJ B;  4BVU C;  2BF8 B;  2KJH B;  4ZRJ A;  2WXM A;  1C4C A;  3CWI A;  2N1W A;  2GLS A;  3DBH I;  2KDB A;  3E56 A;  1YN5 A;  1VZ8 A;  1NI2 A;  3NVY A;  2JX5 A;  1J8C A;  2G3Q B;  5IN7 A;  3CST A;  3WIM A;  3K9P B;  4BKS A;  4E3C A;  1T0S C;  4USA A;  2K5P A;  2XBB C;  4G0N B;  4HPP A;  1T0R C;  2CKH B;  2XN9 C;  2AEH A;  1WF9 A;  4TMA B;  4NNJ B;  4C4V B;  5D3D A;  3Q14 C;  2CU3 A;  2LEK A;  3PZ7 A;  4ZRQ A;  4RF1 A;  5E6N A;  3A4S C;  1ZGU B;  2CJN A;  1FXA A;  5HHD G;  3MC8 A;  3OLM D;  3RD2 A;  3VXW A;  3NVZ A;  4FXC A;  4IM0 A;  3WCQ A;  3PSE B;  2QJL A;  1IUE A;  3GB1 A;  3H9D A;  1C79 A;  1OQQ A;  2N4F A;  4MDK E;  4US8 A;  3Q8E A;  5AZF A;  3TEX A;  3VTV A;  2DHZ A;  2WU5 B;  4P6V F;  4FLH A;  1N60 A;  4FA6 A;  4TQ0 A;  4FAD A;  1YX6 B;  2IZV B;  4NJ7 A;  3GZN I;  2BVC A;  3P1M A;  2HD5 B;  3L4P A;  1IBX B;  3KUD B;  1E8Y A;  2KMM A;  2W54 A;  2J0J A;  1XT9 B;  2IDY A;  1GOZ A;  1F2R I;  3T3N A;  1V6E A;  5D94 A;  3ZKJ C;  1L7Y A;  3AEE B;  3ZJT A;  4KVG B;  1NEN B;  1GB4 A;  2K39 A;  3HK0 A;  1E7U A;  1WMH B;  4IDI A;  4W9G A;  4IC7 B;  4N6E B;  4A6Q A;  2A4Z A;  2RDG A;  3AED B;  2KC2 A;  4M00 A;  3DHG C;  1PQS A;  1D3Z A;  2O2V A;  1JML A;  2BW2 A;  4NAM A;  3DVG Y;  1EF1 A;  4FJY A;  3ZRC A;  4KGR A;  1C76 A;  1FFV A;  2K6D B;  4RGO S;  1WJN A;  2GBR A;  4ANV A;  3PZ8 A;  1WRD B;  2GBJ A;  1WGK A;  4B95 A;  4NQK E;  2MJ3 A;  2GI9 A;  1OEY J;  4JL9 A;  4W9J A;  3KUC B;  1XEE A;  4HJG E;  2FCS A;  3N1Z C;  1TZO A;  5GMV A;  2KWD A;  2EKE C;  3VVW B;  4MH0 E;  3B08 A;  4YXD B;  5BO4 B;  1SIJ A;  5FK9 C;  3HVZ A;  1HXY D;  1FFU A;  2IPK D;  4O1N A;  2N7E A;  2AQ3 B;  2V9H A;  1JWS D;  4FHK A;  4TQ1 A;  1N62 A;  4B9K A;  1AWD A;  4WJN A;  3B0A A;  2NBU A;  3DVN U;  1JWB D;  4E74 A;  3NOB A;  1LM8 B;  3VFK A;  2DLB A;  4BBN F;  2KWU B;  2MBH A;  3I3T B;  1F0Z A;  3IAM 1;  1CMX B;  1VD2 A;  2DYO A;  3BZD B;  2NTT A;  4ACF A;  2BPS A;  4DWF A;  4F7Z A;  1NDD A;  1YQB A;  2KK8 A;  2Y3A A;  3ZNI D;  5GXG B;  2LHE A;  2PVO D;  4MSQ B;  4MEL A;  1UEL A;  1MG4 A;  1PFD A;  2I1K A;  3EA6 A;  4MEM A;  2R2O A;  3P42 A;  5LXI B;  1RLF A;  2JXX A;  4IM3 A;  4KSK C;  3NG0 A;  1KF6 B;  1HTO A;  3JVZ X;  2D11 A;  3NVW A;  4Q2J A;  1ISN A;  4YWG G;  5E6P A;  2FCQ A;  2KJR A;  4US9 A;  4G50 A;  3ZRF A;  1NYQ A;  2MSE D;  1AN8 A;  5IOI A;  2W9N A;  2E6X A;  3SEB A;  3DVG X;  3NZU A;  4B0M A;  3T8M A;  3PS6 A;  3RNA C;  4M01 A;  3Q8C A;  1FXI A;  1AYF A;  4WUR A;  3OWE B;  3L16 A;  2L8J A;  5C2T B;  2JYT A;  2L1A A;  5CHV C;  4EZK A;  2A5U A;  2K8H A;  5C1Z A;  1SJH D;  3SHQ A;  3A4R A;  2KWC A;  2ZNV C;  2AWT A;  2LI5 A;  2WS3 B;  4AQ7 A;  3DWM A;  2WXH A;  1V86 A;  1WGH A;  2VZK B;  3NVV A;  4GXB A;  2WXN A;  3HRD D;  4A9A A;  2D07 B;  4K7W A;  1TY2 A;  3PHX B;  3Q69 A;  3JW0 X;  3TBL D;  2X8X X;  3AU4 A;  2M19 A;  3TEW A;  1WGY A;  3ZQ4 A;  2W82 A;  4MSM B;  1T3Q A;  3J9C A;  2CR5 A;  1H4R A;  3AMZ A;  5BYQ A;  2M0X A;  3NS8 A;  4RF0 A;  3GE8 C;  1WGG A;  2LVQ A;  1WXV A;  2K6Q A;  2FID A;  3AE7 B;  4KX6 B;  4EUT A;  3M95 A;  4HVB A;  4K7S A;  2GB1 A;  1ET6 A;  4LTU A;  5G5G A;  1XO3 A;  3M3J A;  3KLS X;  2KOX A;  4W9C A;  2SAK A;  3QCA A;  2JXT A;  4PS3 A;  2BKR B;  3NZS A;  2JRH A;  3QK0 A;  2W3R A;  1UUP A;  4BOS C;  3LYY A;  4OZB A;  1WM3 A;  3Q8B A;  2KVZ A;  4CO7 A;  4JIO U;  2M4N A;  3HM6 X;  2FIF A;  3AE4 B;  1E10 A;  3VR9 B;  3RUL A;  2WGS A;  4KKI A;  1P98 A;  2WXO A;  4NQL B;  4J6I A;  1GB1 A;  3Q6B A;  3BYY B;  4G11 A;  2AQ2 B;  4WH4 A;  4UDU C;  1I4G A;  2KX0 A;  2BS3 B;  3NZ3 A;  4MM3 A;  4DXF A;  2VH1 A;  4LNO A;  2GOW A;  3W1Y A;  2BYF A;  2FNJ B;  3BVZ A;  1XD3 B;  4YTN B;  1B1Z A;  2PE6 B;  4RFB A;  2DZI A;  1UF0 A;  1SE3 A;  1SIF A;  3PLU A;  4C80 A;  3Q3M C;  2DAF A;  2RDB C;  1WH3 A;  2WDR B;  2E3T A;  3RFZ B;  1L6U A;  3N1Y C;  2Y5B B;  4BBN C;  2FBW B;  2UWQ A;  1UNS A;  1IGD A;  1E7P B;  3B9J A;  2DZJ A;  3N9Y C;  1J0G A;  2G4S A;  4MGK E;  3QA8 A;  3RT3 B;  4GN1 A;  3DBL I;  4IKG A;  4KIK B;  2WYQ A;  3IT4 B;  2MJE A;  3N20 C;  2BB6 A;  5JH5 C;  2L0T A;  2KN4 A;  3ZW3 A;  1PGX A;  4LNF A;  3ZNZ B;  2AL3 A;  1I7H A;  1SE9 A;  4KDL B;  1EM7 A;  1RFA A;  3O13 A;  4AJW A;  1V49 A;  1EWC A;  2B3A A;  2ACZ B;  1WXA A;  4C00 A;  3I63 C;  4GDK A;  1V80 A;  3RI7 C;  1XLQ A;  3DBR I;  1P7F A;  2N7D A;  2MH7 A;  1QKZ A;  5D2M B;  3AB5 A;  2MBQ A;  2VH2 A;  2KT7 A;  2ZVN A;  4W9K A;  1E0Z A;  2KDI A;  4WJP A;  3SDL C;  5DPS A;  2PKO A;  5CHF A;  4CHK A;  1VJK A;  1WE6 A;  5IA7 A;  5CTR C;  4S17 A;  4XE0 A;  4NY0 A;  1DOY A;  4ICU A;  3CF6 E;  2K25 A;  2WX1 A;  3T3O A;  3ALB A;  3PRZ A;  4OHJ A;  2FAZ A;  4YSX B;  2LRU A;  2NVU I;  1RM6 C;  3RZW C;  2WQY B;  4RCO A;  5FR6 A;  2PIA A;  2PEA A;  5JHB A;  1CJE A;  4ARC A;  3ONS A;  1OGW A;  2ZCB A;  4W9F A;  4ZDV A;  2KHW B;  4YT0 B;  1JRO A;  2MX2 A;  1P0R A;  4K81 A;  2MEK A;  2H89 B;  3U7D A;  1V1P A;  1UWX A;  3EUB 2;  4LJO B;  1SXT A;  4GMV A;  2L05 A;  2N7J A;  3IVF A;  4GDL B;  2LUM A;  2Y5P A;  3PRP B;  2NR2 A;  4KSL C;  1TT5 B;  5DPT A;  2JWU A;  3VTU A;  3OG5 A;  1R4M B;  1K52 A;  2WU2 B;  1JRU A;  2J0K A;  3SU8 X;  3SFD B;  2M8S A;  3QC8 B;  2O6V D;  1JWA D;  4YL8 A;  2WXR A;  5DCN A;  3ZYY X;  1WGR A;  3RPF C;  2INC C;  3UIP B;  3MHS D;  2Q5W D;  2LJI A;  4XX5 A;  2NPT A;  5HFY A;  1BUI C;  3VR8 B;  2NS5 A;  3GOE A;  4WAA A;  2IGH A;  3WAP A;  1TS5 A;  2QHO A;  3N3K B;  2R2Q A;  2MHJ A;  4XZ4 A;  2OHF A;  1ROE A;  3ETR A;  1YQ3 B;  2MCN B;  3C8Y A;  3LXF A;  2FCM A;  4OW0 A;  4PS8 A;  1K8R B;  3EC8 A;  1C4P A;  1QOG A;  2RPV A;  3PO0 A;  5TSS A;  1P7E A;  5G5H A;  1QIL A;  1M94 A;  3QAR A;  2MWS B;  1YJI A;  2WXK A;  1TTN A;  2YEP B;  2KQ4 X;  1MPE A;  1FNW A;  2GBN A;  4P1C C;  5T8I A;  3BIN A;  2QC8 A;  4LNK A;  2KDF B;  3WAN A;  2WHI A;  2ZW1 A;  3HUI A;  4NAW A;  1F2R C;  4LDT D;  2ZNV B;  1SJE D;  1S3S G;  2K9X A;  2HE7 A;  2KWV B;  2L3Z A;  2BTE A;  4YSY B;  2KFJ A;  2M56 B;  2GRI A;  3B2F A;  2NBW B;  2B76 B;  2KQS A;  2WXQ A;  4WQM A;  2FCN A;  4LNI A;  4GOC A;  3L0W B;  4GLS C;  2C9W B;  2KN5 A;  2KKC A;  4XGA B;  4IOI E;  5LNK 1;  4YTP B;  3RZF A;  3PHW B;  1VRA B;  3DBS A;  3VH3 B;  4RM9 A;  2JRI B;  2ONQ A;  4K7U A;  4I6N B;  1J7A A;  2PJH A;  1QQR A;  2QIL A;  1R7S A;  4GU2 A;  1FNU A;  3PTF C;  2DZM A;  1IP9 A;  1V9J A;  1C4A A;  3ZIM A;  2L76 A;  4RNA A;  2ASQ A;  2ZW0 A;  2V4L A;  3VRA B;  1I4R A;  5H92 C;  2WNM A;  1ACC A;  1WY8 A;  1NYR A;  5MPO A;  2AQ1 B;  3DHH C;  1GC7 A;  2N0S B;  1VZ6 A;  2HTM E;  2D3A A;  4P16 A;  4PS7 A;  4BFR A;  3A1Q A;  2KD0 A;  2KMA A;  3JYU A;  1ZUD 2;  1C1Y B;  3EHV A;  4LNN A;  5LLI A;  3V6E B;  3KW5 B;  3H7S A;  2MRP A;  1TY0 A;  1Q10 A;  2MLB A;  4P1B C;  3VDZ A;  3V6C B;  4URK A;  4HKZ E;  3NHE B;  1UWM A;  1ZE3 D;  5EDS A;  3M63 B;  2RSU A;  4EEW A;  2EMS A;  2L00 B;  2MW5 A;  1DOI A;  2KAN A;  2NPT B;  2I1J A;  3L54 A;  3ZJV A;  2G4D B;  1F52 A;  2C7M B;  1V2Y A;  1J19 A;  1QOB A;  2V0G A;  4YTM B;  2LGD A;  1EF5 A;  1N6Z A;  1WX9 A;  4MH8 A;  2GBM A;  5BYR A;  4LK0 M;  1KLG D;  3VHT C;  4ITK A;  1QOA A;  1C77 A;  2Z0E B;  1MVK A;  1FRD A;  3R2T A;  4ASW C;  3A9K A;  1C9F A;  4EE2 A;  1C78 A;  3TUO A;  2C7H A;  3ZXV A;  1JWM D;  3P2B A;  4AJY B;  1UGJ A;  4WJO A;  3HVD A;  2V3P A;  2LGY A;  2D5G A;  2NCN A;  2ZCC A;  4CQN A;  3U7Z A;  3H8H A;  4BKS D;  2C7N B;  1P1A A;  4FJV B;  3T9L A;  5J2R A;  3U8Z A;  4K3B A;  1YX5 B;  5FR3 A;  1V81 A;  2BB5 A;  5BMH A;  3EFC A;  3VUX A;  1VZ7 A;  3HM3 A;  1H8C A;  2LGS A;  1YJJ A;  3ZTD A;  2DNF A;  2KQ7 A;  3B1L X;  1GUA B;  4I6P A;  3BYT B;  4RMA A;  1LXD A;  4NJC A;  5BYS A;  1ENF A;  4L23 A;  2PVG C;  3CSF A;  4ZRK A;  3MJW A;  1I4X A;  3NS1 A;  2WXG A;  3ZNG C;  1I42 A;  2W3S A;  3TIX A;  1VR9 A;  4ZYS A;  2O2V B;  3E9S A;  1KFY B;  2KAC A;  2QMT A;  2D2Q A;  4PYU A;  4JX1 C;  2KTR A;  1FO4 A;  3JSV A;  3IBE A;  3PVL A;  3VRB B;  1MJD A;  3FKY A;  3RCZ A;  4KV2 A;  1OEY A;  4ANW A;  4MAC A;  1HTQ A;  1NVI D;  1TS4 A;  4A90 A;  2D3G A;  3K9O B;  1JAL A;  3MHZ A;  2WDV B;  5KHQ A;  2V3N A;  2EKI A;  4WJQ A;  1FIQ A;  1JCK B;  1EO6 A;  1JWU D;  3LB8 C;  1KLV A;  2VZK D;  1FCC C;  2JZZ A;  3TJP A;  3KWL A;  3X23 A;  2QEJ C;  3RNB C;  1YJ1 A;  1RAX A;  3ZJU A;  2J53 A;  4A3P A;  3EFU A;  4REZ A;  3A1Q B;  3RNC C;  3TEY A;  3V3X A;  2JWZ A;  1QOF A;  2JYE A;  1BXT A;  1XLO A;  1WR6 E;  2CHZ A;  2IBI B;  1KTK A;  4KZ0 A;  2JUO A;  1IYF A;  2LD9 A;  1ESF A;  2RDH A;  3BY4 B;  1FPY A;  3DBH B;  2WX0 A;  1PGA A;  3OJ3 A;  2HDE A;  1XQQ A;  1Y8R C;  1CZP A;  1ZOY B;  3R3M A;  1F77 A;  2MJD A;  5AUK A;  3I5J C;  1MHH E;  1D5M C;  4DXG A;  3IHP C;  4JPS A;  4GGQ A;  4MGI E;  2LZ6 A;  3N1X C;  4AS1 A;  3EGR A;  3L13 A;  4L1B A;  1HEZ E;  3R66 C;  1V5T A;  3MC0 B;  3V61 A;  4DHJ B;  3AH7 A;  1SEB D;  1U4A A;  4B0E A;  2J4X A;  1E9M A;  3IG3 A;  4W9I A;  5CX3 A;  3AE1 B;  2AL6 A;  2LGX A;  3OAW A;  2JY6 A;  3ZTC A;  1WM2 A;  3AEB B;  4RGT A;  1WWT A;  2N9E B;  1N5W A;  2CHW A;  2HJ1 A;  3A9K B;  3ZVV A;  2BYT A;  2WXP A;  2KXJ A;  2UYZ B;  1Q5W B;  5J18 A;  1XLP A;  2G1E A;  4WQO B;  2Z8L A;  1Y56 A;  4RH6 A;  5E6O A;  1ZPS A;  1DOX A;  4JGH B;  3NRZ A;  1I4Q A;  1ZKH A;  3APD A;  3W1S C;  2V3S A;  4C56 C;  1GG3 A;  1HZ5 A;  2HJ8 A;  2JVC A;  2EEL A;  1WZ0 A;  1WGD A;  1P9D U;  1SE4 A;  2WDT B;  2IO1 B;  3FIL A;  4E71 A;  1SGH A;  2D3B A;  4RGN A;  1D6E C;  5JXV A;  2CHX A;  2WWZ A;  3IT6 B;  1N61 A;  4QAY A;  1E8Z A;  1VLB A;  3L08 A;  3UQB A;  1FMA D;  4YSZ B;  1GPX A;  5L95 C;  3A33 B;  4N59 A;  2LFI A;  2DYB A;  1LO5 D;  2J52 A;  3BVM A;  2KDE B;  5EE0 A;  3FC4 A;  4ICV A;  4HXD A;  3QAQ A;  1TZ1 A;  3RUI B;  1CQV A;  3KQ4 A;  2MBE A;  2XNA C;  3OJ4 B;  3WA0 A;  1L0Y B;  5J17 A;  1D5Z C;  5HG2 A;  2IGG A;  3AE8 B;  1PYW D;  2J0M A;  1TIF A;  2NMQ A;  2VRR B;  1IBX A;  2KTR B;  3Q3F A;  3JSV B;  1JRP A;  4N58 A;  3EEC A;  1KM7 A;  1TGZ B;  1HE8 A;  1M4V A;  2ZPY A;  1K53 A;  3UQA A;  2INN E;  2IO2 B;  2KZR A;  2IYD B;  3RN9 C;  3VUW A;  3AEG B;  2C5L C;  2KLG A;  1Q0W B;  5L83 A;  1PGB A;  3QWZ B;  1JW9 D;  1WMH A;  2QDF A;  4DHZ E;  2ICI A;  1TKY A;  4J3O D;  3DQV A;  4CYE A;  1B9R A;  2N9X A;  4AOF A;  1OFF A;  1KRH A;  4PK1 A;  3L10 B;  3PZD A;  4II2 B;  2L0F A;  1XCQ L;  2M1M A;  4P7I A;  3PLV A;  5FKA C;  1DGJ A;  3MP9 A;  1XCT L;  1L6V A;  1JQ4 A;  1WI0 A;  2GMI C;  4PT5 A;  2JF5 A;  2R61 A;  1RWS A;  1IGC A;  4GSW A;  2PLP A;  3P4R B;  5IP4 D;  1A5R A;  4WAF A;  2JZ3 B;  1HZ6 A;  1WIA A;  3W9C B;  2N9P C;  4XDD A;  4OVV A;  3PGE A;  5AUI A;  3U2S C;  3ENE A;  3AUL A;  4MM3 B;  4EZL A;  3I57 A;  2MA9 B;  3TCA A;  5IO9 A;  4IWP A;  1E8W A;  2M17 A;  2HTH A;  2BT6 A;  5EE9 A;  1K51 A;  2CS4 A;  1J7C A;  1S1Q B;  1WX8 A;  4WWP A;  3QX1 A;  4XWT A;  5BMI A;  1FXT B;  3C0R B;  1EU3 A;  1RRB A;  4DDG D;  3TL5 A;  4W9L A;  4ARI A;  2RMM A;  2OOB B;  2I2Y A;  5D3I B;  2BGF A;  3RMK C;  3AXC A;  4A3O A;  1L4Z B;  4A55 A;  3BK1 A;  5JHA A;  3AN1 A;  1MG8 A;  1YNT E;  1ET9 A;  3ZGZ A;  3UIN B;  1D5X C;  2LVP A;  2JU6 X;  2D10 A;  3WAM A;  4IUM B;  4XC2 A;  3SFE B;  3ECI A;  3APF A;  2RR9 A;  2BBC A;  3Q8A A;  1TS2 A;  4C7Y A;  3DPD A;  3KUZ A;  3VH4 B;  3KYD D;  2W55 A;  5DPW A;  2WLB A;  3VUY A;  1YD8 U;  2TSS A;  2KJ6 A;  5C23 A;  1GAQ B;  3X0W A;  4LDT B;  3PT2 B;  1KH0 A;  1CK1 A;  1J7B A;  2YEP F;  3PV1 A;  5C3J B;  3AU5 A;  1L4D B;  3R2I A;  2ZVO A;  3DCG A;  5BMG A;  1X1M A;  1YN4 A;  3Q3J A;  2GBK A;  3SR6 A;  5EE1 A;  3RYT A;  5JZE B;  3DWG C;  3W1S A;  4TSS A;  1RYJ A;  1UGM A;  1WJ6 A;  1YQ4 B;  1ZXH A;  3FIL B;  1BT0 A;  2KO3 A;  4GDK B;  3H6N A;  1T5X D;  5LXH A;  1SB3 C;  1QLB B;  1N5X A;  3W2D A;  4HEA 1;  4HCN B;  4XWW A;  2YLM A;  2IGD A;  2WXL A;  2WXI A;  4XYC A;  3AI5 A;  2L7R A;  4HK2 A;  1I35 A;  3L17 A;  4IWO A;  2C60 A;  3W5U B;  2PTL A;  4HJK A;  3ZO5 B;  4ZHP A;  3PPA A;  2JZP A;  4KGS A;  2K8B A;  2L32 A;  1WXM A;  3AE3 B;  3RNG C;  2PPH A;  5HKH A;  3BII D;  3PRM B;  4NZL B;  4BOZ B;  4MGY E;  4HCP B;  3TSS A;  1GC6 A;  1V1O A;  2LXA A;  4GIV A;  4WWO A;  2J42 A;  4KZC A;  4NPN A;  2V1Y A;  3MFG A;  1FCL A;  3IXS A;  3M62 B;  4HRS A;  1TYG B;  1Z5S B;  2WP9 B;  3AEA B;  1E90 A;  1UZX B;  3GE3 C;  3B2G A;  4H2A A;  3N32 A;  4LCD E;  4G3X B;  1VDV A;  3MJ5 A;  2KAJ A;  3GS2 A;  1V1P B;  3PRE A;  1TKE A;  3P4Q B;  2PMV A;  4IW0 A;  1E6E B;  3IFW B;  3URY A;  4XDC A;  1PDX A;  1OQR A;  3ZUN A;  4HLE A;  1RFK A;  4EFO A;  3TEZ A;  2OJW A;  1XLN A;  1BML C;  4W9H A;  5IKC M;  3MC9 A;  1P3Q U;  4FN2 A;  2L83 A;  4F8C B;  4FJZ A;  1LGR A;  4ZHO A;  2XEW A;  2LWP A;  2K1F A;  1VCB A;  3V05 A;  4IM2 A;  2DWQ A;  2K0P A;  2ON8 A;  2QCZ A;  4C7Z A;  4M8M A;  1KJT A;  4ZRP A;  3U4E G;  1L2N A;  4LLG M;  1HA5 A;  3WAO A;  1E8X A;  1A70 A;  1STE A;  5D6J B;  3QQ8 B;  3DBL B;  4KDI C;  1DYQ A;  2REX A;  2JSV X;  4TKN A;  3VQI A;  4OZC A;  4DK5 A;  3AE5 B;  3R7Q A;  1WZ3 A;  3A9J A;  3MTN B;  3P63 A;  2H88 B;  3U52 E;  4HPM B;  1R4M I;  3QIJ A;  3DVN V;  2BYE A;  1D4B A;  1OTR B;  1T6B X;  1N63 A;  3UI3 A;  4D2K A;  1E7V A;  3ML9 A;  3AE9 B;  2QSD A;  1YN3 A;  2MP2 A;  3AE2 B;  2DZK A;  4K3C A;  5D7G A;  1QT9 A;  3NY5 A;  3U30 A;  4ZOH C;  3ZLZ A;  1UH6 A;  4KKJ A;  4RGM A;  1WFY A;  1TBE A;  2OED A;  3ZNH B;  1SSN A;  4M0W A;  3Q2A C;  4NJ6 A;  4JE3 B;  1Z2M A;  2DYM A;  1XF5 L;  3H1U A;  1WXS A;  1K50 A;  3HIZ A;  4LJP B;  2WDQ B;  1EWY C;  3DBR B;  4NAW B;  2PW9 A;  2RPQ A;  4W9D A;  2BYV E;  2BS4 B;  4WWM A;  1MHX A;  3APC A;  2MQJ A;  4OVZ A;  4KIK A;  2AYO B;  2KDM A;  1TJE A;  2JT4 B;  2LHD A;  1R4N B;  4JWU C;  3RNF C;  2IY0 B;  1I4P A;  3DOW A;  2JQR B;  3DDC B;  4AP4 C;  4BAX A;  3LDZ E;  1NEK B;  4BKG A;  4A8X C;  1WRI A;  5E6J A;  4TUU A;  2DEN B;  4PYZ A;  3KH0 A;  3O65 B;  3NJT A;  4FUL A;  2BS2 B;  2KFK A;  3H7P A;  3P4P B;  3UF8 A;  4EKU A;  2ZJD A;  1AW7 A;  3UIO B;  1FD6 A;  1SBB B;  2J7Q B;  3V60 A;  1KLU D;  1F1H A;  2XK5 A;  2V4I B;  2FUG 1;  2N9K A;  2IO3 B;  1GJZ A;  3V62 A;  1MI0 A;  1SE2 A;  4EOY A;  2LVO A;  3AE6 B;  2LXC A;  2Z59 B;  3AV8 A;  3C19 A;  3W5V B;  4HRO A;  1NBF C;  1ZDV A;  1YOV B;  2NTS A;  3KYC D;  5G2N A;  1G6J A;  4BKT A;  3I9V 1;  4ANU A;  3KVF B;  4DXA B;  3DHI C;  1FNV A;  2BKF A;  2EMT A;  3Q8F A;  3RNE C;  1LFD A;  4DDI D;  3UGB B;  4M02 A;  2IND C;  1WX7 A;  3Q3N C;  2N9L A;  2X38 A;  2O6V A;  3VAW A;  4ANX A;  3R7R A;  2FUH B;  2INP E;  5TR5 A;  2LJ5 A;  2LGI A;  2IJ0 A;  2DX5 B;  1WSP A;  4MJS A;  1C3T A;  2D3C A;  1ZXI A;  3QJZ A;  4GDL A;  4WIP A;  1OQY A;  4I6L B;  4HDO A;  4JWS C;  1YMH E;  4B6W A;  2KLC A;  1V5O A;  1L0V B;  1MFW A;  2LMC A;  4AWJ A;  5AZG A;  2L52 A;  2K8C A;  4OVU A;  2LRW A;  5EE3 A;  3A9J B;  4IG7 B;  1SF0 A;  1T0Y A;  1FM0 D;  4W9E A;  2WXJ A;  2KYW A;  3ZDM C;  3BWU D;  4RM8 A;  1L5P A;  1UD7 A;  1WYW B;  4M8N A;  2MP2 B;  1WJ4 A;  3LJ3 A;  3N30 A;  3SD5 A;  1EUV B;  2G9H D;  1FEH A; 
#chains in the Genus database with same CATH homology
 2L8J A;  2PJH A;  3ENE A;  3AUL A;  2N1V A;  5CHV C;  2KTF A;  4EZK A;  4EZL A;  2A5U A;  2K8H A;  5C1Z A;  3SHQ A;  3CMM B;  4GU2 A;  3A4R A;  4TV3 A;  2KWC A;  2ZNV C;  4M0W B;  2AWT A;  2LI5 A;  2MA9 B;  3TMP B;  3PTF C;  3TCA A;  4IWP A;  1AAR A;  2DZM A;  1E8W A;  1IP9 A;  1V9J A;  2M17 A;  2HTH A;  1GNU A;  2L76 A;  3ZIM A;  2ASQ A;  2V4L A;  4DHJ D;  2CS4 A;  5IAA C;  1S1Q B;  1V86 A;  1WX8 A;  4WWP A;  1WY8 A;  1WGH A;  3QX1 A;  4GXB A;  4ZYN A;  1FXT B;  2CU1 A;  1WJU A;  2MBB B;  3C0R B;  2D07 B;  4K7W A;  4EZJ A;  1RRB A;  1GC7 A;  4DDG D;  3TL5 A;  4W9L A;  3PHX B;  2OOB B;  3JW0 X;  4K1R B;  2ZZP B;  3TBL D;  3AU4 A;  2IY1 B;  4PS7 A;  2BGF A;  1WGY A;  3AXC A;  4A3O A;  5JHA A;  5G55 A;  4BFR A;  3A1Q A;  1MG8 A;  2KD0 A;  4MSM B;  2KMA A;  2CR5 A;  3UIN B;  3JYU A;  2LVP A;  2D10 A;  1H4R A;  3WAM A;  1C1Y B;  4IUM B;  3EHV A;  4XC2 A;  2G45 B;  2PE9 A;  3ECI A;  3APF A;  2M0X A;  1E5W A;  2RR9 A;  3WAL A;  3NS8 A;  2ZPN A;  5LLI A;  3DPD A;  3KUZ A;  3VH4 B;  3KYD D;  3V6E B;  3KW5 B;  1WGG A;  2LVQ A;  3H7S A;  1WXV A;  2MRP A;  2BWE S;  5DPW A;  3VUY A;  2KFK B;  2K6Q A;  1YD8 U;  1QZE A;  2FID A;  2MLB A;  4MGZ E;  3H7P B;  3V6C B;  2KJ6 A;  5C23 A;  3VDZ A;  4URK A;  3X0W A;  1YIW A;  3NHE B;  3M95 A;  3ZDT A;  4LDT B;  3PT2 B;  4EUT A;  4HVB A;  4K7S A;  1IPG A;  3PV1 A;  3AU5 A;  3M63 B;  5EDS A;  4HDQ A;  1WR1 A;  2RSU A;  3VTW A;  4EEW A;  2ZVO A;  2EMS A;  2XK5 B;  2L00 B;  1KOT A;  2MW5 A;  2KAN A;  2NPT B;  3M3J A;  2KC1 A;  3DCG A;  2I1J A;  3L54 A;  1X1M A;  1Q1O A;  2G4D B;  2KX3 A;  2KOX A;  2GBK A;  3Q3J A;  4W9C A;  4GB9 A;  2C7M B;  1V2Y A;  3QCA A;  1J19 A;  3S2A A;  3RYT A;  4PS3 A;  4DHZ B;  2BKR B;  3NZS A;  3W1S A;  5JZE B;  2JRH A;  4HWI B;  1R4N I;  2LGD A;  1UGM A;  1WJ6 A;  3QK0 A;  4BOS C;  4A20 A;  1WM3 A;  5KHO A;  1BT0 A;  1EF5 A;  2KO3 A;  4GDK B;  3H6N A;  1WX9 A;  4CO7 A;  5LXH A;  2BWF A;  2GBM A;  4JIO U;  2M4N A;  2JPH A;  3HM6 X;  2FIF A;  3QHT A;  4F1S A;  2KMC A;  3RUL A;  4HCN B;  4FHJ A;  3VHT C;  2LAS A;  5DPR A;  2YLM A;  1P98 A;  1LQB A;  5AZH A;  1F9J A;  2Z0E B;  3AI5 A;  4NQL B;  4WWN A;  2L7R A;  4J6I A;  4HK2 A;  1I35 A;  1UBQ A;  3L17 A;  5AEK B;  4ASW C;  3A9K A;  4G11 A;  4IWO A;  2C7H A;  4IWQ A;  2KX0 A;  2C60 A;  3P2B A;  4HJK A;  4MM3 A;  3ZO5 B;  4WJO A;  4AJY B;  4DBG A;  3PPA A;  3HHM A;  2K8B A;  2GOW A;  3W1Y A;  2BYF A;  2FNJ B;  1WXM A;  3D32 A;  2DAJ A;  2LGY A;  2O6V B;  1UBI A;  1XD3 B;  2PPH A;  5HKH A;  3PRM B;  2PE6 B;  3ML8 A;  2DZI A;  2NCN A;  2ZCC A;  4MGY E;  2KVR A;  4BOZ B;  1ZW7 A;  4HCP B;  1SIF A;  4BKS D;  2C7N B;  1P1A A;  4N9F 4;  4FJV B;  4ZRI A;  3T9L A;  1GC6 A;  2LXA A;  3PLU A;  4GIV A;  4WWO A;  3U8Z A;  5J2R A;  1YX5 B;  2DAF A;  1V81 A;  4II3 B;  2RD0 A;  4KZC A;  1WH3 A;  2V1Y A;  4MJS B;  2RGF A;  4NPN A;  5CHW A;  2ZEQ A;  2Y5B B;  4BBN C;  3VUX A;  3M62 B;  4JLC A;  4AUQ C;  2IO0 B;  1Z5S B;  2UWQ A;  3HM3 A;  1H8C A;  1WE7 A;  4HPL B;  3ZTD A;  1E90 A;  1UZX B;  2KNB A;  2KQ7 A;  2Z0D B;  2DZJ A;  3B1L X;  3N32 A;  1J0G A;  2G4S A;  4LCD E;  4G3X B;  4MGK E;  1GUA B;  4I6P A;  2MBO A;  3QA8 A;  3RT3 B;  2LUE A;  4GN1 A;  3DBL I;  3PRE A;  4RMA A;  2OJR A;  2YVC A;  4KIK B;  1LXD A;  4X57 B;  2WYQ A;  4JQW C;  4IW0 A;  2NBV B;  4ZRK A;  3CSF A;  4FBJ B;  3IFW B;  3MJW A;  4BVU C;  2BF8 B;  2KJH B;  5JH5 C;  2L0T A;  4ZRJ A;  3ZNG C;  3ZW3 A;  3ZUN A;  4HLE A;  1I42 A;  4EFO A;  3TIX A;  2O2V B;  3ZNZ B;  2AL3 A;  1SE9 A;  4KDL B;  4W9H A;  2N1W A;  3DBH I;  2D2Q A;  2KDB A;  4PYU A;  1RFA A;  1P3Q U;  2KTR A;  3JSV A;  4FN2 A;  4AJW A;  1NI2 A;  3IBE A;  3PVL A;  1V49 A;  4F8C B;  4FJZ A;  1J8C A;  2G3Q B;  2B3A A;  3RCZ A;  2XEW A;  4KV2 A;  1OEY A;  4ANW A;  2LWP A;  3CST A;  3WIM A;  3K9P B;  2K1F A;  4BKS A;  1VCB A;  4E3C A;  4IM2 A;  2XBB C;  4G0N B;  1WXA A;  2D3G A;  3K9O B;  5KHQ A;  2CKH B;  4GDK A;  4WJQ A;  1EO6 A;  2AEH A;  1KLV A;  1WF9 A;  4NNJ B;  1V80 A;  2JZZ A;  3DBR I;  3TJP A;  3X23 A;  2N7D A;  4M8M A;  1YJ1 A;  1RAX A;  1KJT A;  1L2N A;  5D2M B;  3WAO A;  2MBQ A;  5E6N A;  1E8X A;  3A4S C;  1ZGU B;  2ZVN A;  3QQ8 B;  5D6J B;  4W9K A;  4KDI C;  2KDI A;  4A3P A;  2REX A;  3EFU A;  4WJP A;  3SDL C;  4TKN A;  5DPS A;  3VQI A;  4DK5 A;  3A1Q B;  3OLM D;  5CHF A;  3R7Q A;  1WZ3 A;  4CHK A;  2JWZ A;  1WE6 A;  3A9J A;  5IA7 A;  3MTN B;  5CTR C;  3RD2 A;  3VXW A;  4HPM B;  1R4M I;  3QIJ A;  3DVN V;  2BYE A;  1WR6 E;  4NY0 A;  2CHZ A;  4IM0 A;  2IBI B;  4KZ0 A;  1OTR B;  4ICU A;  3CF6 E;  1E7V A;  2JUO A;  1IYF A;  2LD9 A;  2K25 A;  3ML9 A;  3PSE B;  2WX1 A;  3BY4 B;  3ALB A;  3H9D A;  3PRZ A;  2FAZ A;  2WX0 A;  2MP2 A;  2N4F A;  2LRU A;  2DZK A;  4MDK E;  2NVU I;  3OJ3 A;  5D7G A;  5AZF A;  1XQQ A;  3VTV A;  2DHZ A;  1Y8R C;  3RZW C;  5FR6 A;  3NY5 A;  3R3M A;  4FLH A;  3U30 A;  4FA6 A;  4TQ0 A;  3ZLZ A;  1UH6 A;  4FAD A;  1YX6 B;  2IZV B;  4NJ7 A;  3GZN I;  1WFY A;  1TBE A;  2HD5 B;  3ZNH B;  3KUD B;  2PEA A;  3IHP C;  5JHB A;  4GGQ A;  4NJ6 A;  1E8Y A;  1Z2M A;  1OGW A;  3ONS A;  4MGI E;  2ZCB A;  4W9F A;  2LZ6 A;  2DYM A;  3H1U A;  4ZDV A;  2J0J A;  1WXS A;  2KHW B;  3HIZ A;  2MX2 A;  1P0R A;  3L13 A;  1XT9 B;  3R66 C;  4K81 A;  1V5T A;  4LJP B;  3U7D A;  3V61 A;  4DHJ B;  1V6E A;  5D94 A;  4NAW B;  2RPQ A;  4W9D A;  3ZKJ C;  2BYV E;  3APC A;  1L7Y A;  2MQJ A;  4LJO B;  4KIK A;  2AYO B;  4GMV A;  2L05 A;  1U4A A;  3IVF A;  4KVG B;  4GDL B;  2K39 A;  3HK0 A;  3IG3 A;  2JT4 B;  4W9I A;  5CX3 A;  1E7U A;  1WMH B;  3PRP B;  2NR2 A;  4IC7 B;  4KSL C;  4W9G A;  2AL6 A;  2LGX A;  2A4Z A;  5DPT A;  2IY0 B;  2KC2 A;  3OAW A;  2JY6 A;  3ZTC A;  3VTU A;  1PQS A;  1WM2 A;  1D3Z A;  2O2V A;  3DOW A;  3DDC B;  2N9E B;  2CHW A;  3A9K B;  4AP4 C;  1JRU A;  3LDZ E;  3DVG Y;  2J0K A;  1EF1 A;  4FJY A;  4BKG A;  3ZVV A;  3ZRC A;  3SU8 X;  4TUU A;  2K6D B;  2DEN B;  4PYZ A;  2KXJ A;  2UYZ B;  3KH0 A;  1Q5W B;  3O65 B;  5J18 A;  1WJN A;  4FUL A;  2M8S A;  4WQO B;  3QC8 B;  2O6V D;  2GBR A;  4ANV A;  5E6O A;  1WRD B;  2GBJ A;  4YL8 A;  2KFK A;  5DCN A;  3H7P A;  4B95 A;  4JGH B;  4NQK E;  1WGR A;  3UF8 A;  4EKU A;  1OEY J;  2ZJD A;  4JL9 A;  3UIO B;  3UIP B;  2J7Q B;  4W9J A;  3V60 A;  3KUC B;  1ZKH A;  3MHS D;  3APD A;  3W1S C;  2XK5 A;  2V3S A;  4XX5 A;  2NPT A;  2FCS A;  1GG3 A;  2HJ8 A;  2JVC A;  2NS5 A;  5GMV A;  3GOE A;  2EKE C;  3VVW B;  1WZ0 A;  1WGD A;  2IO3 B;  4WAA A;  3WAP A;  1P9D U;  4MH0 E;  2WDT B;  1GJZ A;  2QHO A;  3B08 A;  2IO1 B;  3N3K B;  3V62 A;  4E71 A;  1SGH A;  2R2Q A;  5BO4 B;  4EOY A;  2CHX A;  2WWZ A;  2LVO A;  4XZ4 A;  2LXC A;  1E8Z A;  2Z59 B;  2MCN B;  3L08 A;  3UQB A;  2N7E A;  1NBF C;  2FCM A;  3A33 B;  4PS8 A;  5L95 C;  4FHK A;  4TQ1 A;  1K8R B;  2DYB A;  3EC8 A;  4B9K A;  4WJN A;  3B0A A;  2NBU A;  3DVN U;  3KYC D;  5G2N A;  1G6J A;  2KDE B;  4E74 A;  1M94 A;  1LM8 B;  3NOB A;  3VFK A;  4BKT A;  3QAR A;  4ANU A;  4ICV A;  4HXD A;  3QAQ A;  4BBN F;  1TZ1 A;  2KWU B;  3KVF B;  2MBH A;  3I3T B;  3RUI B;  2MBE A;  4DXA B;  3OJ4 B;  3WA0 A;  2BKF A;  2MWS B;  1CMX B;  2EMT A;  1LFD A;  4DDI D;  5J17 A;  1VD2 A;  3UGB B;  2DYO A;  1TTN A;  2J0M A;  2BPS A;  4DWF A;  2VRR B;  1WX7 A;  2GBN A;  2KTR B;  3Q3F A;  3JSV B;  4F7Z A;  1NDD A;  3EEC A;  1YQB A;  1KM7 A;  2O6V A;  3BIN A;  1TGZ B;  1HE8 A;  3VAW A;  2KK8 A;  2ZPY A;  4ANX A;  3UQA A;  3ZNI D;  3R7R A;  2FUH B;  2KDF B;  3WAN A;  2IO2 B;  2KZR A;  4MSQ B;  5TR5 A;  2IYD B;  2LJ5 A;  4MEL A;  4NAW A;  1UEL A;  2I1K A;  4LDT D;  4MEM A;  2R2O A;  5LXI B;  3VUW A;  1RLF A;  2DX5 B;  2ZNV B;  2JXX A;  1S3S G;  2C5L C;  2KLG A;  4IM3 A;  4MJS A;  1C3T A;  2HE7 A;  1Q0W B;  2KWV B;  3QJZ A;  4KSK C;  3QWZ B;  5L83 A;  4GDL A;  1OQY A;  2L3Z A;  1WMH A;  4I6L B;  4DHZ E;  4HDO A;  2KFJ A;  4B6W A;  3DQV A;  3JVZ X;  4CYE A;  2D11 A;  2KLC A;  2N9X A;  1V5O A;  4AOF A;  1ISN A;  2NBW B;  5E6P A;  4AWJ A;  2KQS A;  3L10 B;  2FCQ A;  3PZD A;  4II2 B;  2KJR A;  2L0F A;  5AZG A;  4G50 A;  2K8C A;  2M1M A;  4P7I A;  4OVU A;  2LRW A;  3PLV A;  2FCN A;  3A9J B;  3ZRF A;  4GOC A;  4IG7 B;  2MSE D;  3L0W B;  1T0Y A;  2C9W B;  2KN5 A;  4W9E A;  2KKC A;  2W9N A;  1WI0 A;  2GMI C;  3ZDM C;  2JF5 A;  4GSW A;  3DVG X;  4RM8 A;  3RZF A;  3NZU A;  3PHW B;  1UD7 A;  3DBS A;  3VH3 B;  3T8M A;  1A5R A;  4RM9 A;  3PS6 A;  2JZ3 B;  2JRI B;  1WYW B;  1WIA A;  2N9P C;  4M8N A;  4K7U A;  2MP2 B;  1WJ4 A;  4I6N B;  3LJ3 A;  3N30 A;  3PGE A;  4OVV A;  3SD5 A;  1EUV B;  3L16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...