2L8JA

Gabarapl-1 nbr1-lir complex structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/protein binding
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title Characterization of the Interaction of GABARAPL-1 with the LIR Motif of NBR1.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l8jA00
1J19A 2N9XA 5CHVC 5AZGA 2IBIB 3AU5A 3L0WB 3M3JA 1OGWA 5IAAC 4FLHA 1GJZA 2L0TA 4PS3A 2K8BA 2GOWA 2KNBA 3PVLA 2FUHB 1LXDA 1WX9A 2JUOA 3SDLC 2KWCA 2KLGA 2C5LC 2XBBC 3VH3B 3K9PB 1P3QU 4WJNA 1Z2MA 2M8SA 3NZSA 4FHKA 4HCNB 4JQWC 5GMVA 3APCA 1AARA 1TBEA 4FJZA 5JHAA 2IYDB 3ZLZA 2KWUB 1EO6A 5KHOA 3DVNU 1F9JA 3AI5A 4MSMB 1X1MA 2JPHA 2JF5A 2N1VA 1BT0A 4GIVA 3I3TB 2N9PC 1V86A 2QHOA 3W1SC 1E8XA 3A9KA 3L54A 4EUTA 2XK5B 2HE7A 3L13A 2D3GA 2M1MA 4ZRJA 3ML8A 1R4NI 2LVPA 2DENB 3QC8B 2KJRA 3W1SA 5D7GA 3VXWA 4DK5A 3TJPA 3NHEB 2OJRA 3RZWC 1P0RA 4HK2A 3VTVA 1H4RA 2KFKB 4I6LB 4ANUA 2IZVB 2ZZPB 5IA7A 2G4DB 4WAAA 5E6OA 2FCQA 3VDZA 1TTNA 1GNUA 4HJKA 1WJNA 3L16A 4WQOB 1Q1OA 2FIDA 2C9WB 1E7VA 1E8WA 4EFOA 1V49A 2PE6B 1G6JA 1WXSA 4GB9A 5DPTA 5J2RA 3UIOB 3APDA 3APFA 2AEHA 4IWOA 2CHZA 3N3KB 1V2YA 2MBEA 4MJSB 4GMVA 2JRHA 5C1ZA 2KVRA 2NBWB 1S1QB 2K8HA 3DVGX 3KYDD 3NY5A 1J8CA 3QHTA 2KOXA 5D6JB 2BWFA 3OLMD 3VTWA 4B6WA 1E8ZA 2KTRA 4EKUA 3WIMA 1V9JA 4II2B 1LQBA 3V62A 4KSKC 2BPSA 2BYVE 5L95C 1UBIA 2DZIA 1SIFA 2N7EA 4K7UA 4NJ7A 2DAJA 3VVWB 1EF5A 2J0MA 5G2NA 1WX7A 4EZJA 2KANA 4BKTA 2O2VA 1WR6E 1VD2A 2AL3A 4FN2A 3M63B 3A4SC 1GC6A 1WZ3A 4HPMB 3VQIA 1I42A 1E8YA 2BWES 2MW5A 2KWVB 1WXMA 2FCSA 2UYZB 3R7QA 1XQQA 2KDBA 2GBMA 1Y8RC 3EFUA 4F8CB 4MGIE 2K1FA 4GDKA 1SGHA 4TKNA 4AOFA 4HDOA 5D2MB 2G4SA 2RPQA 1WXAA 3RCZA 1UZXB 2KKCA 4GDLB 3QQ8B 2AYOB 1WGDA 4MGKE 3ZDMC 2LGYA 2MRPA 2V3SA 4BBNF 4FJYA 2ZVOA 3ZNGC 3DVNV 2JZZA 4N9F4 4DHZB 3U30A 4W9EA 2JVCA 2L8JA 3HIZA 4P7IA 4EZKA 1J0GA 2CU1A 3DBSA 2LUEA 4EOYA 2KX0A 3U7DA 4MDKE 3UQAA 3KUCB 4IC7B 3IBEA 4F1SA 2JXXA 3RT3B 3MTNB 1NBFC 1YX6B 4NQKE 3MJWA 2ZPYA 3WANA 2LVQA 4KIKB 4W9JA 2K39A 4NNJB 4NY0A 4K7WA 5C23A 2KDEB 3VAWA 5AZHA 3A1QA 3VUXA 4IM2A 1RRBA 3A9KB 4KZCA 5LXHA 2JT4B 1HE8A 2Z59B 3VUYA 5AEKB 3SD5A 3ZDTA 4G50A 3H9DA 1Q0WB 5CHFA 1E90A 3IHPC 3PSEB 4IWQA 3EC8A 1WMHB 3PGEA 3D32A 3KUZA 5CTRC 4IG7B 2JY6A 2D2QA 3JSVB 4LJPB 2PPHA 4E71A 2KC2A 2WWZA 2LD9A 4W9FA 4JGHB 4HVBA 2Y5BB 1WJ4A 3M95A 3ZKJC 2A4ZA 4DHZE 2O6VD 5CHWA 1E7UA 5E6PA 2MLBA 4K81A 4MH0E 2NVUI 3AXCA 2IO0B 4ASWC 4IM0A 4CYEA 2DX5B 2FNJB 2A5UA 4MSQB 4GXBA 4DHJD 2B3AA 2O6VA 4M8NA 1WY8A 2DYBA 3H6NA 2IO3B 3QARA 2ASQA 3A9JA 4G3XB 4DWFA 3VHTC 3ZTDA 4NPNA 4WJPA 4DBGA 5AZFA 3Q3JA 4HCPB 4WWNA 2KJ6A 4AJWA 2NBUA 1P98A 1D3ZA 2LWPA 1KJTA 3QWZB 2JWZA 3PRPB 1V81A 3PLUA 2DHZA 4TUUA 4ANWA 2O2VB 4A20A 2D11A 2NPTA 4JIOU 1WGYA 4W9HA 2DYMA 4BBNC 1IYFA 4CO7A 2DZKA 4HDQA 3WAPA 4AUQC 2ZEQA 4DXAB 2FCNA 2ZVNA 3ZNID 4TV3A 2I1KA 2Z0EB 2YVCA 3P2BA 4G11A 2GBRA 4M0WB 4AJYB 1WJ6A 3TBLD 4GDKB 2KFJA 4HPLB 2V1YA 2LXCA 3X23A 4ZDVA 3CMMB 2NBVB 2BYEA 5J18A 4IUMB 3V61A 3CSTA 3OJ3A 1OTRB 2JRIB 2L7RA 2LI5A 1GUAB 4NQLB 3NZUA 4K1RB 3KYCD 3KH0A 1E5WA 3Q3FA 3PREA 4GOCA 3H1UA 4PYUA 4AP4C 3ZIMA 2N4FA 3PHXB 3KW5B 3N32A 3QK0A 3R3MA 3KUDB 4KVGB 4PS7A 4ICUA 2NCNA 4OVVA 4E3CA 3DBLI 3T8MA 2MSED 3KVFB 3TCAA 2RSUA 4NAWA 4TQ0A 4F7ZA 1QZEA 1GC7A 3R66C 3L08A 4J6IA 3R7RA 1PQSA 2CHXA 2G3QB 2MBHA 2NS5A 2WX1A 3H7PA 3PRMB 2J0KA 4GGQA 2LGDA 2ZCBA 4GN1A 2DAFA 1WFYA 1V5OA 2UWQA 4B9KA 4AWJA 2XK5A 2MCNB 2Z0DB 4BOSC 4FBJB 1IP9A 3QIJA 2HJ8A 3BINA 5L83A 3B0AA 2N1WA 1I35A 3PRZA 4XZ4A 3L10B 3T9LA 2KHWB 2M4NA 2R2QA 2LRWA 1UD7A 3QAQA 3WALA 3IFWB 3ZUNA 2L05A 3HM3A 4A3OA 2WYQA 1UBQA 3RUIB 4WJQA 1RLFA 2L0FA 4PYZA 4KDLB 2REXA 2PEAA 2RR9A 2MWSB 3TMPB 3L17A 3ZVVA 2L3ZA 2WDTB 2O6VB 4B95A 3PZDA 2AWTA 2KN5A 3ONSA 4A3PA 2PE9A 3NOBA 3ZNHB 5FR6A 3S2AA 3ZW3A 2IO2B 4ZRIA 1Q5WB 2D07B 1WR1A 2IO1B 4K7SA 3ZTCA 4DHJB 4HLEA 1EUVB 5J17A 1M94A 2VRRB 4RM9A 1YX5B 4GSWA 1SE9A 3W1YA 2J0JA 2KDIA 3WAOA 2J7QB 4W9LA 1YQBA 1OEYA 2EKEC 2LGXA 5JH5C 1RAXA 1KOTA 1WIAA 3BY4B 2KMAA 3JYUA 1V5TA 2M0XA 3VH4B 1KLVA 1WE6A 4M8MA 2ZNVC 1T0YA 2MX2A 4WJOA 4NJ6A 3TL5A 4DDGD 4W9DA 5LXIB 4RM8A 4WWPA 1C3TA 1MG8A 4XC2A 2NR2A 1TGZB 2GBKA 2IY1B 2C7NB 4IWPA 2LZ6A 3M62B 3RULA 2GBNA 3CF6E 1UELA 1YD8U 2KMCA 1C1YB 4IW0A 2PJHA 3VUWA 2MBOA 3NS8A 4GDLA 2KTRB 4CHKA 4EEWA 4JLCA 3VTUA 4FULA 5G55A 5DCNA 5DPSA 1L7YA 4TQ1A 4BKSD 2K6DB 3ENEA 1WF9A 2KC1A 4KV2A 1NI2A 4KSLC 1WM3A 5DPRA 4BOZB 3IG3A 2MP2A 1V6EA 2KXJA 1FXTB 3PS6A 2GBJA 1WI0A 4FADA 2BYFA 2KQSA 4LDTD 4MGZE 4BKSA 4NAWB 2DZJA 2LRUA 3ZRCA 3WA0A 1WGGA 4G0NB 3V60A 5DPWA 3UINB 3H7PB 3RZFA 1WM2A 3QJZA 5TR5A 1YJ1A 2BKFA 4EZLA 4KIKA 2KLCA 3QA8A 1IPGA 1OEYJ 4LCDE 2HD5B 2WX0A 2K25A 3B1LX 3N30A 4LJOB 3PPAA 4BKGA 3CSFA 2D10A 4W9IA 1XT9B 2L00B 4MGYE 4ZRKA 2FAZA 3LDZE 2KTFA 4W9CA 1WMHA 4WWOA 1WZ0A 3DDCB 2EMTA 3JSVA 2CKHB 3X0WA 3JW0X 2YLMA 5EDSA 3PT2B 1Z5SB 3B08A 1A5RA 1JRUA 3O65B 2MQJA 4IM3A 2BGFA 2FIFA 3ZNZB 3OAWA 5LLIA 3UIPB 4MM3A 2M17A 2R2OA 5BO4B 4ZYNA 2ZCCA 3QX1A 2KO3A 2C7MB 2XEWA 2G45B 2GMIC 5CX3A 3EECA 2W9NA 1WE7A 4YL8A 2RGFA 3GOEA 3QCAA 3DBRI 4BVUC 3PTFC 2CS4A 3ML9A 4HWIB 5D94A 1CMXB 1UH6A 2N9EB 3C0RB 3DPDA 4MELA 4I6NB 2EMSA 2LJ5A 1WGHA 1WYWB 3A1QB 3IVFA 3UQBA 3LJ3A 3GZNI 3A33B 4ANXA 2K8CA 4OVUA 3ECIA 2JZ3B 1R4MI 4GU2A 1P1AA 1ISNA 4RMAA 3SU8X 1TZ1A 2KZRA 4FA6A 3ZO5B 3DVGY 4X57B 3AULA 4W9GA 1RFAA 3HHMA 1WH3A 1ZGUB 1ZW7A 2BF8B 4I6PA 2CR5A 2CHWA 2KFKA 3DOWA 1S3SG 4MEMA 3SHQA 4PS8A 1OQYA 3ALBA 3ZRFA 1EF1A 1YIWA 1WGRA 2ZJDA 1V80A 1UGMA 2KK8A 5KHQA 2ZNVB 4ICVA 3PLVA 4KDIC 2RD0A 4ANVA 5HKHA 2MBBB 2DZMA 1P9DU 1ZKHA 2C7HA 3PV1A 1WRDB 2AL6A 2V4LA 2C60A 3V6EB 3UGBB 1WJUA 4MJSA 2LVOA 2OOBB 3A9JB 3H7SA 2K6QA 2LXAA 3DQVA 3PHWB 2KD0A 3K9OB 4JL9A 1H8CA 2BKRB 3V6CB 4DDID 1NDDA 2MP2B 2ZPNA 1K8RB 1WXVA 2MBQA 2HTHA 4E74A 3A4RA 4URKA 4KZ0A 3VFKA 3RYTA 3U8ZA 2FCMA 1GG3A 1WX8A 2NPTB 3OJ4B 4XX5A 1XD3B 2IY0B 2LASA 2L76A 3DBHI 3HK0A 4LDTB 4W9KA 3TIXA 1L2NA 3EHVA 3DCGA 3RD2A 2KJHB 3WAMA 1KM7A 2KQ7A 4FHJA 4FJVB 4BFRA 2KX3A 2N7DA 3AU4A 1U4AA 4HXDA 5JZEB 5JHBA 2DYOA 4II3B 3MHSD 1LM8B 1LFDA 2MA9B 3UF8A 2I1JA 3HM6X 2KDFB 3JVZX 5E6NA 1VCBA
chains in the Genus database with same CATH superfamily
2N9XA 4NAMA 3U52E 3AU5A 1FXAA 3L0WB 1FM0D 4FLHA 2K8BA 4KX6B 2JUOA 2KWCA 3IT6B 2XBBC 3C8YA 3VH3B 1IGDA 1RYJA 1P3QU 3NZSA 4JQWC 1TBEA 2WS3B 3ZLZA 2KWUB 3DVNU 1JQ4A 2NMQA 3I3TB 1MVKA 2N9PC 4C4VA 4EUTA 1ET6A 2XK5B 1N63A 3W2DA 4ZRJA 2LVPA 2DENB 3QC8B 2KJRA 4DK5A 3TJPA 3NHEB 2OJRA 3RZWC 4HK2A 4I6LB 2IZVB 2ACZB 3AMZA 5IA7A 2BT6A 5D3DA 2V3NA 4WQOB 3BYTB 3Q69A 1VZ8A 4GB9A 3APFA 2AEHA 2CHZA 5C1ZA 2NBWB 4JE3B 3DHGC 3KYDD 1CK1A 1AWDA 2BWFA 3VTWA 4B6WA 1QOAA 1E8ZA 3WIMA 1V9JA 4II2B 3GP7A 4A8XC 3V62A 4KSKC 2BPSA 2J0MA 2KN4A 2O2VA 4FN2A 2IGHA 2INDC 4HPMB 1XO3A 2BB6A 1EU4A 1E8YA 2N7JA 2GRIA 2MW5A 1Y8RC 3BYYB 2J52A 3EFUA 1SGHA 4M00A 4TKNA 5IKCM 1EU3A 1TS2A 4GDLB 2BS2B 3QQ8B 2AYOB 3AEFB 1N6ZA 3I57A 3SEBA 2INCC 4DHZB 2JVCA 2L8JA 1AW7A 3AE6B 1J0GA 1HTOA 2LUEA 4EOYA 2KX0A 4OVZA 1SIJA 3RT3B 3MTNB 3AE1B 3MJWA 1DOIA 5C23A 1MPEA 3VUXA 3A9KB 4KZCA 2LMCA 3N9YC 5TSSA 4LTUA 3VUYA 3SD5A 3ZDTA 1F1HA 1E90A 2ZW0A 5CTRC 4R3DA 4RNAA 2JY6A 2D2QA 3W5UB 3EFCA 5BYQA 4MM3B 3M95A 5CHWA 2NVUI 3R2TA 1LO5D 4IM0A 2DX5B 2FNJB 5JXVA 4MSQB 3MJ5A 2B3AA 2KYWA 4M8NA 1SXTA 2WXJA 3H6NA 2IO3B 2QSDA 3AV8A 2ASQA 4XWTA 3ZTDA 4WJPA 5AZFA 5IO9A 4AJWA 1D3ZA 2QIEB 1K50A 1WSPA 1NVID 3QWZB 2JWZA 4C7YA 1WXQA 4JIOU 3EA6A 2DZKA 4HDQA 2L32A 1ROEA 4DXAB 1YN5A 3P2BA 1SSNA 2GBRA 1WJ6A 4GDKB 1UF0A 2KFJA 3MC8A 2WXLA 5G5GA 3MC9A 2BYEA 1OTRB 2JRIB 4C00A 3NZUA 3ZIMA 3PHXB 3KW5B 1FFVA 1SBBB 4ICUA 4LNOA 3DBLI 2MSED 4WURA 3TCAA 1ZE3D 1QZEA 1GC7A 3N20C 3R66C 3H7PA 4GGQA 4P1BC 2ZCBA 4ZRQA 4CQNA 2XK5A 3GZNB 4BOSC 4FBJB 2Y5PA 3QIJA 2HJ8A 4XZ4A 2K9XA 3L10B 3T9LA 2KHWB 2R2QA 3I63C 4K3BA 1WGKA 1FNUA 1UBQA 3GB1A 3EGRA 2REXA 2KAJA 5BMHA 2LGSA 4B95A 3PZDA 2KN5A 2D3AA 3S2AA 3ZW3A 1Q5WB 1WR1A 5FKAC 3NVWA 2M19A 1YX5B 1KFYB 4IOIE 2J0JA 2KDIA 2J7QB 1DOYA 1WIAA 1JROA 3JYUA 4NJCA 1V5TA 3VR9B 1DGJA 2INPE 2K22A 1WE6A 4WJOA 4NJ6A 4XC2A 1TGZB 5IN7A 4IWPA 2LZ6A 3M62B 2IGGA 3RULA 3EUB2 2LHEA 5AUIA 3CF6E 2DWQA 2W3RA 4RGOS 4IW0A 2OHFA 3VUWA 5EE3A 3ZJVA 4GDLA 4CHKA 4JLCA 1VDVA 4Q2JA 2PVGC 5DPRA 4BOZB 2MP2A 1V6EA 1D5MC 4LDTD 4MGZE 2DZJA 1TKEA 5TR5A 1I7HA 2KLCA 5EE1A 1C79A 1OEYJ 2HD5B 2WX0A 2K25A 3N30A 3FKYA 4LJOB 3PPAA 4WH4A 2D10A 3AE2B 4W9IA 4MGYE 4JPSA 3AEAB 3CWIA 2WXFA 1SJHD 2KTFA 2GB1A 1QQRA 2I2YA 3X0WA 2MEKA 3P4PB 2YLMA 5HI1A 3LB8C 3B08A 4MM3A 2M17A 3R8BA 5BO4B 1V97A 2G45B 1B9RA 5CX3A 1BUIC 1ZDXA 1D5ZC 3GOEA 3DBRI 2Y5CA 2WXPA 1UH6A 4MELA 4I6NB 4IDIA 2EMSA 2RDGA 3A1QB 3IVFA 3RPFC 3UQBA 1JWSD 3ETRA 1R4MI 3ZXVA 4EE2A 1ISNA 2PVOD 3SU8X 4LNFA 4FA6A 3AULA 3W5VB 1RFAA 1ZW7A 1C78A 1ZGUB 3RN9C 2CHWA 2KFKA 1S3SG 3SHQA 3ALBA 4WIPA 1WGRA 3V05A 4ICVA 4KDIC 4ANVA 2L52A 5HKHA 2MBBB 1QILA 2AL6A 2V4LA 2OOBB 3A9JB 2K6QA 2KD0A 3IXSA 1T0RC 1VZ6A 2BKRB 4DDID 2XNAC 2IDYA 1E10A 1J7CA 1K8RB 2J42A 2MBQA 2QJLA 2HTHA 3A4RA 2FCMA 3OJ4B 2LASA 2L76A 4W9KA 2H89B 4JWUC 3Q2AC 1K51A 3WAMA 2KQ7A 1UWXA 2B76B 5JZEB 1U4AA 2KQ4X 2DYOA 4II3B 3MHSD 2GI9A 2I1JA 1N5XA 2OJWA 1ZP0B 4BZAA 1J19A 3PZ7A 4AS1A 3TEZA 5AZGA 2SAKA 3SFEB 1UNSA 1I4RA 1GJZA 2WXOA 1FRRA 2L0TA 2FUHB 1WX9A 2KLGA 3AEDB 4WJNA 1HZ6A 1J7AA 4LK0M 5JHAA 3APCA 1AARA 4FJZA 1FNWA 1EO6A 1HQRD 1X1MA 1I4XA 2JF5A 2N1VA 1BT0A 4GIVA 1V86A 3W1SC 2YEPB 1E8XA 3L54A 3OWEB 3UI3A 2HE7A 3L13A 2M1MA 1XCTL 3ML8A 1NEKB 2WXMA 1R4NB 4J3OD 2FCQA 1TTNA 4HJKA 2Z8LA 4RCOA 1WJNA 3L16A 1E7VA 1E8WA 2PE6B 3APDA 3FC4A 4IWOA 3AE8B 4P1CC 1V2YA 4MJSB 3URYA 4GMVA 1S1QB 3NJTA 1J8CA 2KOXA 5D6JB 4C80A 3T3OA 1OQQA 1JWBD 2VZKB 2BYVE 4K7UA 4NJ7A 4DXFA 1WX7A 2MJ3A 4EZJA 3M63B 3A4SC 1IBXA 1WZ3A 3VQIA 3U4EG 3KQ4A 4M0WA 4MGIE 4AOFA 4HDOA 5D2MB 2W55A 2RPQA 2KKCA 1TT5B 1FMAD 1WGDA 2V4IB 5FK9C 2LGYA 3LXFA 4M02A 4UDUC 3NS1A 4W9EA 4RGMA 4EZKA 4ZHPA 1VZ7A 4N59A 3BK1A 2HTME 3BVMA 3IBEA 2JXXA 1NBFC 3KWVA 3TEXA 2N9KA 4KIKB 4W9JA 4NY0A 3A1QA 3T3NA 4IM2A 5LXHA 3Q3NC 1HE8A 2WU5B 4MT5A 1FPYA 4G50A 1Q0WB 3PSEB 1WMHB 4LJPB 2KC2A 2MH7A 2WWZA 4TMAB 4JGHB 2D3BA 1WJ4A 1ACCA 1E6EB 2O6VD 5E6PA 2MLBA 4K81A 4ASWC 1PFDA 2LHDA 4FXCA 1KH0A 4DHJD 2O6VA 2VH1A 2DYBA 5BYRA 3A9JA 4G3XB 2Y3AA 3Q3JA 4WWNA 2KJ6A 2FBWB 2KACA 2WHIA 3U7ZA 1Y56A 1PDXA 3AN1A 4GLSC 4BBNC 1IYFA 2M56B 2FUG1 4AUQC 2EELA 4G11A 4YT0B 3AE4B 1V8CA 3RNGC 3TBLD 4HPLB 4PT5A 1GPXA 4C7ZA 3CMMB 2NBVB 3N1XC 5J18A 1GUAB 4NQLB 3NVZA 4PYUA 4GOCA 1OFFA 1KRHA 2KMMA 3QK0A 1TS4A 2JYEA 2RPVA 4PS7A 1T0SC 2RSUA 4NAWA 4F7ZA 2QDFA 3L08A 2WXHA 4J6IA 2CHXA 2WX1A 3PRMB 3ZJUA 1N5WA 2UU7A 4KGSA 3Q8AA 3AEEB 1SEBD 2UWQA 3BK2A 2Z0DB 4ZHOA 1IP9A 3NRZA 3B0AA 1I35A 3VRAB 2M4NA 3QAQA 1UGJA 2V3PA 2K0PA 3RUIB 1RLFA 3PZ8A 1CJEA 1NYQA 3TMPB 2FE8A 1SF0A 3IT4B 1L4DB 4NZLB 1FNVA 2AWTA 2WNMA 2PE9A 3ZNHB 2HJ1A 3O13A 2Q5WD 2D07B 4XE0A 3C19A 4L1BA 2VRRB 2AQ2B 4RM9A 3W1YA 1ZUD2 3HUIA 3WAOA 2LGXA 1E7PB 4HKZE 1KOTA 3B9JA 1BXTA 3IAM1 2HDEA 1HA5A 2MX2A 1WYGA 2YEPF 4W9DA 1SE2A 1MG8A 2GBKA 1E9MA 3RNFC 4TSSA 3N1YC 2GBNA 1K52A 3BWUD 1UELA 2KMCA 2PJHA 3BVZA 2MBOA 1F2RC 4YSYB 4BAXA 3N1ZC 2KTRB 4EEWA 3VTUA 2WGSA 4LNIA 5G55A 5DCNA 1L7YA 3P4QB 4TQ1A 2KC1A 4KSLC 3P63A 3PS6A 4FADA 1TY2A 2AQ3B 3BVGA 5DPWA 1QT9A 2QC8A 1YJ1A 2BKFA 2KVZA 2WLBA 4KIKA 3QA8A 1IPGA 1C9FA 2FAZA 1XXGA 1WMHA 3DDCB 4HROA 2CKHB 4HJGE 4RFBA 3DHHC 1ET9A 3PT2B 1JRUA 2MQJA 4IM3A 3ZNZB 2LEKA 2R2OA 4ZYNA 1MG4A 3EECA 1WE7A 1JW9D 3QCAA 2CS4A 2N9EB 3C0RB 1FEHA 3MHZA 4ANXA 2K8CA 1TYGB 2JZ3B 4GU2A 1C4PA 4RMAA 2KZRA 3AEGB 3ZO5B 2K5PA 2E6XA 1L4ZB 1WH3A 3AEBB 2CR5A 1KLGD 2LUMA 1OQYA 3ZRFA 1MFWA 2DNFA 2KWDA 3AE3B 2KK8A 4OW0A 4A55A 1YMHE 1T3QA 2LVOA 3H7SA 4XGAB 1KTKA 3PHWB 5EE0A 3V6CB 1NDDA 2ZPNA 1PUTA 1WXVA 1FIQA 2N0SB 3VFKA 1AN8A 1I4QA 3DWGC 2NPTB 3J9CA 4XX5A 2INNE 1XD3B 1C4CA 3TIXA 1L2NA 3EHVA 2WP9B 3DCGA 2KJHB 3MFGA 1KM7A 4ARIA 4FHJA 4FJVB 4BFRA 3DBHB 4XDDA 1BMLC 1LM8B 2IGDA 1FCLA 1NYRA 3RMKC 5BYSA 2KDFB 1WWTA 4RF0A 1HZ5A 5H92C 1OGWA 2KNBA 3AB5A 2JXTA 1LXDA 1D5XC 3SDLC 1I4GA 2C5LC 1UUPA 1ZPSA 2M8SA 5GMVA 2IYDB 5KHOA 3AI5A 1I4PA 3AECB 1TKYA 2QHOA 3A9KA 2D3GA 1R4NI 4KGRA 3ZGZA 2BS4B 4WWMA 1P0RA 3VTVA 5BMGA 2N9LA 2AQ1B 5E6OA 1C76A 3VDZA 2WXRA 1Q1OA 2FIDA 2C9WB 1G6JA 4EFOA 1V49A 1WXSA 5J2RA 2ZW1A 3N3KB 2MBEA 2JRHA 3DVGX 1EWCA 3NY5A 3OLMD 4OZCA 2KTRA 4EKUA 2IPKD 1K53A 5L95C 2DZIA 1SIFA 1JWMD 1RFKA 2JYTA 2KANA 4BKTA 3AE9B 1HTQA 1WR6E 2QEJC 2AL3A 1J7BA 1I42A 2KT7A 2KDBA 1N61A 2K1FA 4GDKA 2G4SA 1XCQL 2ON8A 4MGKE 3ZDMC 2MRPA 4BBNF 2V3SA 4FJYA 2GLSA 4N9F4 3U30A 4P7IA 2R61A 3U7DA 1JCKB 3KUCB 4H2AA 4NQKE 1YX6B 2D3CA 2ZPYA 4NNJB 2KDEB 4C4VB 4S17A 1QOBA 1RRBA 3AE7B 3H9DA 3EC8A 3PGEA 3D32A 4IG7B 1STEA 3JSVB 2WXKA 1CQVA 5D3IB 2PPHA 2PTLA 1QF6A 2LD9A 2Y5BB 1QOFA 1I4HA 2PLPA 3ZKJC 4DHZE 1E7UA 4MH0E 2QILA 3AXCA 3Q8FA 1WY8A 2JU6X 4DWFA 3VHTC 3AH7A 4NPNA 4A90A 4DBGA 2WQYB 4HCPB 1QKZA 2NBUA 2LWPA 1GOZA 4YTNB 3PRPB 4TUUA 4ANWA 2O2VB 4LLGM 2D11A 2NPTA 1WGYA 2DYMA 3ZQ4A 4CO7A 3B2GA 2JWUA 3WAPA 3U2SC 2K3UA 3RNEC 1TIFA 2FCNA 2ZVNA 3ZNID 3Q8CA 4TV3A 3TSSA 2YVCA 4AJYB 1IUEA 4RGTA 2LXCA 3X23A 2BB5A 3V61A 2L7RA 2WXIA 3ZYYX 3KYCD 1E5WA 3PREA 4AP4C 1TS3A 2N4FA 1R7SA 3KUDB 4KVGB 2NCNA 3ZJTA 4E3CA 3KVFB 4YWGG 2CJNA 3FAHA 2VH2A 3R7RA 1PQSA 2MBHA 2NS5A 2LGDA 2DAFA 1V5OA 4B9KA 4AWJA 2MCNB 1ZOYB 4M01A 1JMLA 1R4MB 5L83A 1YQ4B 3PRZA 1YNTE 1UWMA 2LRWA 3IFWB 3NVYA 3ZUNA 2L05A 3HM3A 2WYQA 4RGNA 2KDMA 2JQRB 2WXQA 2PEAA 2L3ZA 3ONSA 4A3PA 1DOXA 3NOBA 3Q3OC 5FR6A 1N60A 2IO2B 4S0RA 3ZTCA 1B1ZA 1EUVB 3H8HA 5J17A 4YXDB 2BVCA 1M94A 4B0MA 4GSWA 1V1PB 1OEYA 2EKEC 5JH5C 1RAXA 2SEBD 3BY4B 2KMAA 4HPPA 1KLVA 1XLPA 3KWLA 3ZXRA 4M8MA 2ONQA 4US8A 4RM8A 1C3TA 2BW2A 1JALA 2J4XA 5FR3A 4WQMA 3NS8A 2DBYA 2V0GA 4FULA 3FILB 5DPSA 4BKSD 4XDCA 1WF9A 2L1AA 3KLSX 4AQ7A 2KQSA 3R2IA 4BKSA 3VR8B 2LRUA 1WGGA 4P6VF 3ABVB 3H7PB 2CJOA 1WM2A 3QJZA 2PW9A 3TEYA 1PGBA 4USAA 4LCDE 4LNNA 3B1LX 5IP4D 5I4DA 1IGCA 4W9CA 4WWOA 1WZ0A 3JSVA 2RMMA 1SE4A 4ITKA 3O65B 2BGFA 2FIFA 2BTEA 1GB4A 5H8YE 3QX1A 4OHJA 2XEWA 3P42A 4HKQA 2RGFA 5D94A 2G9HD 1WGHA 4HRSA 3GZNI 3A33B 4OVUA 1P1AA 1TZ1A 1AYFA 1KF6B 3NVVA 3HHMA 4DQOC 2BF8B 3SFDB 4I6PA 4PS8A 3VRBB 1EF1A 1YIWA 5KHQA 3PLVA 1YJIA 1P7EA 2RD0A 1L0VB 1XLQA 2DZMA 2LJIA 5C2TB 2XN9C 3RNBC 2C60A 1F2RI 3V6EB 3UGBB 4MJSA 4YSZB 2LXAA 2VZKD 1YN4A 1JWAD 1H8CA 5LNK1 4QAYA 3MC0B 1PGAA 2MP2B 1EWYC 4URKA 4KZ0A 1VRAB 4P16A 1GG3A 1WX8A 3CIRB 3OG5A 2IY0B 1ENFA 3DBHI 4LDTB 2CU3A 2BBCA 4KKIA 2KX3A 2N7DA 5JHBA 4HXDA 2X8XX 2MA9B 3HM6X 5E6NA 5E6JA 1VCBA 4B0EA 1L0YB 2JX5A 5CHVC 2IBIB 1VLBA 1ZXIA 4ARCA 3M3JA 5IAAC 1N62A 4PS3A 1TJEA 2GOWA 3PVLA 4KGTA 3K9PB 1F52A 4K3CA 1Z2MA 4FHKA 4HCNB 1XF5L 1F9JA 3MP9A 4MSMB 4YSXB 2JPHA 1QOGA 1XEEA 3BZDB 2WDQB 1V1PA 2BS3B 3W1SA 5D7GA 1VJKA 3VXWA 2JSVX 3NUHB 1H4RA 2KFKB 4ANUA 2ZZPB 5AUKA 1D4BA 2G4DB 4WAAA 1DYQA 1GNUA 3GE3C 1F77A 3HRDD 1ZXHA 5DPTA 3UIOB 1ZDVA 1V1OA 2KVRA 2K8HA 2QMTA 3QHTA 1NI3A 2BQQA 4L23A 3FILA 1M4VA 2PKOA 1P7FA 1LQBA 5G5HA 2W3SA 1UBIA 2N7EA 1FFUA 2LGIA 4RF1A 2DAJA 3NZ3A 2L83A 3VVWB 1EF5A 5G2NA 1VD2A 4ZRPA 1GC6A 1T5XD 4HEA1 2BWES 2KWVB 1WXMA 2FCSA 2UYZB 3R7QA 1F0ZA 1XQQA 3LYYA 2GBMA 3Q8BA 4F8CB 4O1NA 3PO0A 1WXAA 3RCZA 1UZXB 3Q14C 3V3XA 2ZVOA 1FO4A 3ZNGC 3DVNV 2JZZA 1E0ZA 3HIZA 3HVDA 2CU1A 3DBSA 4LNKA 4MDKE 3UQAA 2NTTA 3DHIC 2QCZA 4IC7B 4F1SA 3WANA 4A9AA 2LVQA 4OZAA 2K39A 4K7WA 4XYCA 3L4PA 5AZHA 3VAWA 2JT4B 2Z59B 5AEKB 2WXGA 5CHFA 3IHPC 4YTPB 4IWQA 4MH8A 1XLOA 3KUZA 4RH6A 4E71A 2PIAA 1CZPA 2BYTA 4W9FA 2RDBC 4HVBA 1PYWD 3RFZB 4YTMB 2A4ZA 4XWWA 4JX1C 2D5GA 4REZA 2IO0B 1QLBB 4A6QA 2X38A 4CYEA 2A5UA 4GXBA 4N58A 1YN3A 3QARA 1FD6A 2WU2B 3RNCC 1JWUD 1MI0A 3I5JC 1P98A 2ICIA 5C3JB 4L2YA 1KJTA 1V81A 3PLUA 2DHZA 5BMIA 3GE8C 2DLBA 4A20A 1IBXB 4W9HA 2I38A 2W82A 2ZEQA 2I1KA 2W54A 2Z0EB 3W9CB 2TSSA 4M0WB 2V1YA 2JZPA 4ZDVA 4IUMB 3CSTA 3OJ3A 2LI5A 4K1RB 3KH0A 3Q3FA 3H1UA 1FXIA 3N32A 3P1MA 3R3MA 4MACA 1MHXA 1ESFA 4OVVA 3T8MA 1A70A 4TQ0A 2G3QB 3DBLB 1T6BX 2J0KA 1L5PA 4ZYSA 2AX5A 4GN1A 1WFYA 5HHDG 3DWMA 3BINA 2N1WA 5EE9A 1KLUD 1RWSA 2MHJA 1UD7A 3WALA 2NTSA 2G1EA 4A3OA 4US9A 1HEZE 4WJQA 3Q3MC 2L0FA 4PYZA 4KDLB 1T0QC 2RR9A 5IOIA 2MWSB 3L17A 3ZVVA 2IJ0A 2O6VB 2WDTB 3TEWA 3TUOA 4ZRIA 4DHJB 1HXYD 2IO1B 2M0AA 4K7SA 4ACFA 4HLEA 1GB1A 1SE3A 1TS5A 1SE9A 3P4SB 4W9LA 1YQBA 1LGRA 1SB3C 2M0XA 3VH4B 1VR9A 2ZNVC 1T0YA 1NENB 1L0XB 3TL5A 4DDGD 5LXIB 2OEDA 4WWPA 1MJDA 2J53A 2NR2A 2IY1B 2C7NB 4D2KA 2WDRB 1YD8U 1C1YB 3E56A 1C4AA 1GAQB 1L6UA 1OQRA 2K6DB 3ENEA 4KV2A 1NI2A 1WM3A 3IG3A 2KXJA 1FXTB 2GBJA 1WI0A 3WCQA 2BYFA 4NAWB 4WAFA 3ZRCA 3WA0A 4G0NB 3V60A 1YJJA 3UINB 1FCCC 3AM9A 3RZFA 1WRIA 4EZLA 1XLNA 3BIID 1C77A 1TZOA 1JRPA 3P4RB 4BKGA 3SR6A 3CSFA 1XT9B 2L00B 4ZRKA 3LDZE 1TY0A 1YQ3B 2EMTA 3JW0X 5GXGB 5EDSA 1Z5SB 1A5RA 2LFIA 3OAWA 5LLIA 3UIPB 2ZCCA 4KKJA 2KO3A 2WDVB 2C7MB 3HVZA 2GMIC 2W9NA 2EKIA 4YL8A 4BVUC 3PTFC 1TKGA 3ML9A 4HWIB 1CMXB 3DPDA 5MPOA 4OZBA 1RM6C 1YOVB 2LJ5A 1WYWB 5T8IA 3LJ3A 3DBRB 3ECIA 4IKGA 1Q10A 3IAS1 3NG0A 3DVGY 4X57B 4C56C 4W9GA 2WXNA 4PK1A 3RI7C 3DOWA 4MEMA 4N6EB 4JWSC 5HG2A 2ZJDA 1V80A 1UGMA 2ZNVB 3AE5B 1EM7A 5HFYA 1D6EC 4ZOHC 2RDHA 1P9DU 3PV1A 1ZKHA 2C7HA 1WRDB 2E3TA 2MJEA 1WJUA 2H88B 1FRDA 3DQVA 3K9OB 3Q8EA 2MJDA 2V9HA 4JL9A 2PMVA 1L6VA 4E74A 1MHHE 4DXGA 3RYTA 3U8ZA 3B2FA 3RNAC 3HK0A 3RD2A 3GS2A 3I9V1 3AU4A 1LFDA 3E9SA 3UF8A 1PGXA 1SJED 3Q6BA 3JVZX
chains in the Genus database with same CATH topology
1J19A 2N9XA 5CHVC 5AZGA 2IBIB 3AU5A 3L0WB 3M3JA 1OGWA 5IAAC 4FLHA 1GJZA 2L0TA 4PS3A 2K8BA 2GOWA 2KNBA 3PVLA 2FUHB 1LXDA 1WX9A 2JUOA 3SDLC 2KWCA 2KLGA 2C5LC 2XBBC 3VH3B 3K9PB 1P3QU 4WJNA 1Z2MA 2M8SA 3NZSA 4FHKA 4HCNB 4JQWC 5GMVA 3APCA 1AARA 1TBEA 4FJZA 5JHAA 2IYDB 3ZLZA 2KWUB 1EO6A 5KHOA 3DVNU 1F9JA 3AI5A 4MSMB 1X1MA 2JPHA 2JF5A 2N1VA 1BT0A 4GIVA 3I3TB 2N9PC 1V86A 2QHOA 3W1SC 1E8XA 3A9KA 3L54A 4EUTA 2XK5B 2HE7A 3L13A 2D3GA 2M1MA 4ZRJA 3ML8A 1R4NI 2LVPA 2DENB 3QC8B 2KJRA 3W1SA 5D7GA 3VXWA 4DK5A 3TJPA 3NHEB 2OJRA 3RZWC 1P0RA 4HK2A 3VTVA 1H4RA 2KFKB 4I6LB 4ANUA 2IZVB 2ZZPB 5IA7A 2G4DB 4WAAA 5E6OA 2FCQA 3VDZA 1TTNA 1GNUA 4HJKA 1WJNA 3L16A 4WQOB 1Q1OA 2FIDA 2C9WB 1E7VA 1E8WA 4EFOA 1V49A 2PE6B 1G6JA 1WXSA 4GB9A 5DPTA 5J2RA 3UIOB 3APDA 3APFA 2AEHA 4IWOA 2CHZA 3N3KB 1V2YA 2MBEA 4MJSB 4GMVA 2JRHA 5C1ZA 2KVRA 2NBWB 1S1QB 2K8HA 3DVGX 3KYDD 3NY5A 1J8CA 3QHTA 2KOXA 5D6JB 2BWFA 3OLMD 3VTWA 4B6WA 1E8ZA 2KTRA 4EKUA 3WIMA 1V9JA 4II2B 1LQBA 3V62A 4KSKC 2BPSA 2BYVE 5L95C 1UBIA 2DZIA 1SIFA 2N7EA 4K7UA 4NJ7A 2DAJA 3VVWB 1EF5A 2J0MA 5G2NA 1WX7A 4EZJA 2KANA 4BKTA 2O2VA 1WR6E 1VD2A 2AL3A 4FN2A 3M63B 3A4SC 1GC6A 1WZ3A 4HPMB 3VQIA 1I42A 1E8YA 2BWES 2MW5A 2KWVB 1WXMA 2FCSA 2UYZB 3R7QA 1XQQA 2KDBA 2GBMA 1Y8RC 3EFUA 4F8CB 4MGIE 2K1FA 4GDKA 1SGHA 4TKNA 4AOFA 4HDOA 5D2MB 2G4SA 2RPQA 1WXAA 3RCZA 1UZXB 2KKCA 4GDLB 3QQ8B 2AYOB 1WGDA 4MGKE 3ZDMC 2LGYA 2MRPA 2V3SA 4BBNF 4FJYA 2ZVOA 3ZNGC 3DVNV 2JZZA 4N9F4 4DHZB 3U30A 4W9EA 2JVCA 2L8JA 3HIZA 4P7IA 4EZKA 1J0GA 2CU1A 3DBSA 2LUEA 4EOYA 2KX0A 3U7DA 4MDKE 3UQAA 3KUCB 4IC7B 3IBEA 4F1SA 2JXXA 3RT3B 3MTNB 1NBFC 1YX6B 4NQKE 3MJWA 2ZPYA 3WANA 2LVQA 4KIKB 4W9JA 2K39A 4NNJB 4NY0A 4K7WA 5C23A 2KDEB 3VAWA 5AZHA 3A1QA 3VUXA 4IM2A 1RRBA 3A9KB 4KZCA 5LXHA 2JT4B 1HE8A 2Z59B 3VUYA 5AEKB 3SD5A 3ZDTA 4G50A 3H9DA 1Q0WB 5CHFA 1E90A 3IHPC 3PSEB 4IWQA 3EC8A 1WMHB 3PGEA 3D32A 3KUZA 5CTRC 4IG7B 2JY6A 2D2QA 3JSVB 4LJPB 2PPHA 4E71A 2KC2A 2WWZA 2LD9A 4W9FA 4JGHB 4HVBA 2Y5BB 1WJ4A 3M95A 3ZKJC 2A4ZA 4DHZE 2O6VD 5CHWA 1E7UA 5E6PA 2MLBA 4K81A 4MH0E 2NVUI 3AXCA 2IO0B 4ASWC 4IM0A 4CYEA 2DX5B 2FNJB 2A5UA 4MSQB 4GXBA 4DHJD 2B3AA 2O6VA 4M8NA 1WY8A 2DYBA 3H6NA 2IO3B 3QARA 2ASQA 3A9JA 4G3XB 4DWFA 3VHTC 3ZTDA 4NPNA 4WJPA 4DBGA 5AZFA 3Q3JA 4HCPB 4WWNA 2KJ6A 4AJWA 2NBUA 1P98A 1D3ZA 2LWPA 1KJTA 3QWZB 2JWZA 3PRPB 1V81A 3PLUA 2DHZA 4TUUA 4ANWA 2O2VB 4A20A 2D11A 2NPTA 4JIOU 1WGYA 4W9HA 2DYMA 4BBNC 1IYFA 4CO7A 2DZKA 4HDQA 3WAPA 4AUQC 2ZEQA 4DXAB 2FCNA 2ZVNA 3ZNID 4TV3A 2I1KA 2Z0EB 2YVCA 3P2BA 4G11A 2GBRA 4M0WB 4AJYB 1WJ6A 3TBLD 4GDKB 2KFJA 4HPLB 2V1YA 2LXCA 3X23A 4ZDVA 3CMMB 2NBVB 2BYEA 5J18A 4IUMB 3V61A 3CSTA 3OJ3A 1OTRB 2JRIB 2L7RA 2LI5A 1GUAB 4NQLB 3NZUA 4K1RB 3KYCD 3KH0A 1E5WA 3Q3FA 3PREA 4GOCA 3H1UA 4PYUA 4AP4C 3ZIMA 2N4FA 3PHXB 3KW5B 3N32A 3QK0A 3R3MA 3KUDB 4KVGB 4PS7A 4ICUA 2NCNA 4OVVA 4E3CA 3DBLI 3T8MA 2MSED 3KVFB 3TCAA 2RSUA 4NAWA 4TQ0A 4F7ZA 1QZEA 1GC7A 3R66C 3L08A 4J6IA 3R7RA 1PQSA 2CHXA 2G3QB 2MBHA 2NS5A 2WX1A 3H7PA 3PRMB 2J0KA 4GGQA 2LGDA 2ZCBA 4GN1A 2DAFA 1WFYA 1V5OA 2UWQA 4B9KA 4AWJA 2XK5A 2MCNB 2Z0DB 4BOSC 4FBJB 1IP9A 3QIJA 2HJ8A 3BINA 5L83A 3B0AA 2N1WA 1I35A 3PRZA 4XZ4A 3L10B 3T9LA 2KHWB 2M4NA 2R2QA 2LRWA 1UD7A 3QAQA 3WALA 3IFWB 3ZUNA 2L05A 3HM3A 4A3OA 2WYQA 1UBQA 3RUIB 4WJQA 1RLFA 2L0FA 4PYZA 4KDLB 2REXA 2PEAA 2RR9A 2MWSB 3TMPB 3L17A 3ZVVA 2L3ZA 2WDTB 2O6VB 4B95A 3PZDA 2AWTA 2KN5A 3ONSA 4A3PA 2PE9A 3NOBA 3ZNHB 5FR6A 3S2AA 3ZW3A 2IO2B 4ZRIA 1Q5WB 2D07B 1WR1A 2IO1B 4K7SA 3ZTCA 4DHJB 4HLEA 1EUVB 5J17A 1M94A 2VRRB 4RM9A 1YX5B 4GSWA 1SE9A 3W1YA 2J0JA 2KDIA 3WAOA 2J7QB 4W9LA 1YQBA 1OEYA 2EKEC 2LGXA 5JH5C 1RAXA 1KOTA 1WIAA 3BY4B 2KMAA 3JYUA 1V5TA 2M0XA 3VH4B 1KLVA 1WE6A 4M8MA 2ZNVC 1T0YA 2MX2A 4WJOA 4NJ6A 3TL5A 4DDGD 4W9DA 5LXIB 4RM8A 4WWPA 1C3TA 1MG8A 4XC2A 2NR2A 1TGZB 2GBKA 2IY1B 2C7NB 4IWPA 2LZ6A 3M62B 3RULA 2GBNA 3CF6E 1UELA 1YD8U 2KMCA 1C1YB 4IW0A 2PJHA 3VUWA 2MBOA 3NS8A 4GDLA 2KTRB 4CHKA 4EEWA 4JLCA 3VTUA 4FULA 5G55A 5DCNA 5DPSA 1L7YA 4TQ1A 4BKSD 2K6DB 3ENEA 1WF9A 2KC1A 4KV2A 1NI2A 4KSLC 1WM3A 5DPRA 4BOZB 3IG3A 2MP2A 1V6EA 2KXJA 1FXTB 3PS6A 2GBJA 1WI0A 4FADA 2BYFA 2KQSA 4LDTD 4MGZE 4BKSA 4NAWB 2DZJA 2LRUA 3ZRCA 3WA0A 1WGGA 4G0NB 3V60A 5DPWA 3UINB 3H7PB 3RZFA 1WM2A 3QJZA 5TR5A 1YJ1A 2BKFA 4EZLA 4KIKA 2KLCA 3QA8A 1IPGA 1OEYJ 4LCDE 2HD5B 2WX0A 2K25A 3B1LX 3N30A 4LJOB 3PPAA 4BKGA 3CSFA 2D10A 4W9IA 1XT9B 2L00B 4MGYE 4ZRKA 2FAZA 3LDZE 2KTFA 4W9CA 1WMHA 4WWOA 1WZ0A 3DDCB 2EMTA 3JSVA 2CKHB 3X0WA 3JW0X 2YLMA 5EDSA 3PT2B 1Z5SB 3B08A 1A5RA 1JRUA 3O65B 2MQJA 4IM3A 2BGFA 2FIFA 3ZNZB 3OAWA 5LLIA 3UIPB 4MM3A 2M17A 2R2OA 5BO4B 4ZYNA 2ZCCA 3QX1A 2KO3A 2C7MB 2XEWA 2G45B 2GMIC 5CX3A 3EECA 2W9NA 1WE7A 4YL8A 2RGFA 3GOEA 3QCAA 3DBRI 4BVUC 3PTFC 2CS4A 3ML9A 4HWIB 5D94A 1CMXB 1UH6A 2N9EB 3C0RB 3DPDA 4MELA 4I6NB 2EMSA 2LJ5A 1WGHA 1WYWB 3A1QB 3IVFA 3UQBA 3LJ3A 3GZNI 3A33B 4ANXA 2K8CA 4OVUA 3ECIA 2JZ3B 1R4MI 4GU2A 1P1AA 1ISNA 4RMAA 3SU8X 1TZ1A 2KZRA 4FA6A 3ZO5B 3DVGY 4X57B 3AULA 4W9GA 1RFAA 3HHMA 1WH3A 1ZGUB 1ZW7A 2BF8B 4I6PA 2CR5A 2CHWA 2KFKA 3DOWA 1S3SG 4MEMA 3SHQA 4PS8A 1OQYA 3ALBA 3ZRFA 1EF1A 1YIWA 1WGRA 2ZJDA 1V80A 1UGMA 2KK8A 5KHQA 2ZNVB 4ICVA 3PLVA 4KDIC 2RD0A 4ANVA 5HKHA 2MBBB 2DZMA 1P9DU 1ZKHA 2C7HA 3PV1A 1WRDB 2AL6A 2V4LA 2C60A 3V6EB 3UGBB 1WJUA 4MJSA 2LVOA 2OOBB 3A9JB 3H7SA 2K6QA 2LXAA 3DQVA 3PHWB 2KD0A 3K9OB 4JL9A 1H8CA 2BKRB 3V6CB 4DDID 1NDDA 2MP2B 2ZPNA 1K8RB 1WXVA 2MBQA 2HTHA 4E74A 3A4RA 4URKA 4KZ0A 3VFKA 3RYTA 3U8ZA 2FCMA 1GG3A 1WX8A 2NPTB 3OJ4B 4XX5A 1XD3B 2IY0B 2LASA 2L76A 3DBHI 3HK0A 4LDTB 4W9KA 3TIXA 1L2NA 3EHVA 3DCGA 3RD2A 2KJHB 3WAMA 1KM7A 2KQ7A 4FHJA 4FJVB 4BFRA 2KX3A 2N7DA 3AU4A 1U4AA 4HXDA 5JZEB 5JHBA 2DYOA 4II3B 3MHSD 1LM8B 1LFDA 2MA9B 3UF8A 2I1JA 3HM6X 2KDFB 3JVZX 5E6NA 1VCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J19 A;  2N9X A;  5CHV C;  5AZG A;  2IBI B;  3AU5 A;  3L0W B;  3M3J A;  1OGW A;  5IAA C;  4FLH A;  1GJZ A;  2L0T A;  4PS3 A;  2K8B A;  2GOW A;  2KNB A;  3PVL A;  2FUH B;  1LXD A;  1WX9 A;  2JUO A;  3SDL C;  2KWC A;  2KLG A;  2C5L C;  2XBB C;  3VH3 B;  3K9P B;  1P3Q U;  4WJN A;  1Z2M A;  2M8S A;  3NZS A;  4FHK A;  4HCN B;  4JQW C;  5GMV A;  3APC A;  1AAR A;  1TBE A;  4FJZ A;  5JHA A;  2IYD B;  3ZLZ A;  2KWU B;  1EO6 A;  5KHO A;  3DVN U;  1F9J A;  3AI5 A;  4MSM B;  1X1M A;  2JPH A;  2JF5 A;  2N1V A;  1BT0 A;  4GIV A;  3I3T B;  2N9P C;  1V86 A;  2QHO A;  3W1S C;  1E8X A;  3A9K A;  3L54 A;  4EUT A;  2XK5 B;  2HE7 A;  3L13 A;  2D3G A;  2M1M A;  4ZRJ A;  3ML8 A;  1R4N I;  2LVP A;  2DEN B;  3QC8 B;  2KJR A;  3W1S A;  5D7G A;  3VXW A;  4DK5 A;  3TJP A;  3NHE B;  2OJR A;  3RZW C;  1P0R A;  4HK2 A;  3VTV A;  1H4R A;  2KFK B;  4I6L B;  4ANU A;  2IZV B;  2ZZP B;  5IA7 A;  2G4D B;  4WAA A;  5E6O A;  2FCQ A;  3VDZ A;  1TTN A;  1GNU A;  4HJK A;  1WJN A;  3L16 A;  4WQO B;  1Q1O A;  2FID A;  2C9W B;  1E7V A;  1E8W A;  4EFO A;  1V49 A;  2PE6 B;  1G6J A;  1WXS A;  4GB9 A;  5DPT A;  5J2R A;  3UIO B;  3APD A;  3APF A;  2AEH A;  4IWO A;  2CHZ A;  3N3K B;  1V2Y A;  2MBE A;  4MJS B;  4GMV A;  2JRH A;  5C1Z A;  2KVR A;  2NBW B;  1S1Q B;  2K8H A;  3DVG X;  3KYD D;  3NY5 A;  1J8C A;  3QHT A;  2KOX A;  5D6J B;  2BWF A;  3OLM D;  3VTW A;  4B6W A;  1E8Z A;  2KTR A;  4EKU A;  3WIM A;  1V9J A;  4II2 B;  1LQB A;  3V62 A;  4KSK C;  2BPS A;  2BYV E;  5L95 C;  1UBI A;  2DZI A;  1SIF A;  2N7E A;  4K7U A;  4NJ7 A;  2DAJ A;  3VVW B;  1EF5 A;  2J0M A;  5G2N A;  1WX7 A;  4EZJ A;  2KAN A;  4BKT A;  2O2V A;  1WR6 E;  1VD2 A;  2AL3 A;  4FN2 A;  3M63 B;  3A4S C;  1GC6 A;  1WZ3 A;  4HPM B;  3VQI A;  1I42 A;  1E8Y A;  2BWE S;  2MW5 A;  2KWV B;  1WXM A;  2FCS A;  2UYZ B;  3R7Q A;  1XQQ A;  2KDB A;  2GBM A;  1Y8R C;  3EFU A;  4F8C B;  4MGI E;  2K1F A;  4GDK A;  1SGH A;  4TKN A;  4AOF A;  4HDO A;  5D2M B;  2G4S A;  2RPQ A;  1WXA A;  3RCZ A;  1UZX B;  2KKC A;  4GDL B;  3QQ8 B;  2AYO B;  1WGD A;  4MGK E;  3ZDM C;  2LGY A;  2MRP A;  2V3S A;  4BBN F;  4FJY A;  2ZVO A;  3ZNG C;  3DVN V;  2JZZ A;  4N9F 4;  4DHZ B;  3U30 A;  4W9E A;  2JVC A;  2L8J A;  3HIZ A;  4P7I A;  4EZK A;  1J0G A;  2CU1 A;  3DBS A;  2LUE A;  4EOY A;  2KX0 A;  3U7D A;  4MDK E;  3UQA A;  3KUC B;  4IC7 B;  3IBE A;  4F1S A;  2JXX A;  3RT3 B;  3MTN B;  1NBF C;  1YX6 B;  4NQK E;  3MJW A;  2ZPY A;  3WAN A;  2LVQ A;  4KIK B;  4W9J A;  2K39 A;  4NNJ B;  4NY0 A;  4K7W A;  5C23 A;  2KDE B;  3VAW A;  5AZH A;  3A1Q A;  3VUX A;  4IM2 A;  1RRB A;  3A9K B;  4KZC A;  5LXH A;  2JT4 B;  1HE8 A;  2Z59 B;  3VUY A;  5AEK B;  3SD5 A;  3ZDT A;  4G50 A;  3H9D A;  1Q0W B;  5CHF A;  1E90 A;  3IHP C;  3PSE B;  4IWQ A;  3EC8 A;  1WMH B;  3PGE A;  3D32 A;  3KUZ A;  5CTR C;  4IG7 B;  2JY6 A;  2D2Q A;  3JSV B;  4LJP B;  2PPH A;  4E71 A;  2KC2 A;  2WWZ A;  2LD9 A;  4W9F A;  4JGH B;  4HVB A;  2Y5B B;  1WJ4 A;  3M95 A;  3ZKJ C;  2A4Z A;  4DHZ E;  2O6V D;  5CHW A;  1E7U A;  5E6P A;  2MLB A;  4K81 A;  4MH0 E;  2NVU I;  3AXC A;  2IO0 B;  4ASW C;  4IM0 A;  4CYE A;  2DX5 B;  2FNJ B;  2A5U A;  4MSQ B;  4GXB A;  4DHJ D;  2B3A A;  2O6V A;  4M8N A;  1WY8 A;  2DYB A;  3H6N A;  2IO3 B;  3QAR A;  2ASQ A;  3A9J A;  4G3X B;  4DWF A;  3VHT C;  3ZTD A;  4NPN A;  4WJP A;  4DBG A;  5AZF A;  3Q3J A;  4HCP B;  4WWN A;  2KJ6 A;  4AJW A;  2NBU A;  1P98 A;  1D3Z A;  2LWP A;  1KJT A;  3QWZ B;  2JWZ A;  3PRP B;  1V81 A;  3PLU A;  2DHZ A;  4TUU A;  4ANW A;  2O2V B;  4A20 A;  2D11 A;  2NPT A;  4JIO U;  1WGY A;  4W9H A;  2DYM A;  4BBN C;  1IYF A;  4CO7 A;  2DZK A;  4HDQ A;  3WAP A;  4AUQ C;  2ZEQ A;  4DXA B;  2FCN A;  2ZVN A;  3ZNI D;  4TV3 A;  2I1K A;  2Z0E B;  2YVC A;  3P2B A;  4G11 A;  2GBR A;  4M0W B;  4AJY B;  1WJ6 A;  3TBL D;  4GDK B;  2KFJ A;  4HPL B;  2V1Y A;  2LXC A;  3X23 A;  4ZDV A;  3CMM B;  2NBV B;  2BYE A;  5J18 A;  4IUM B;  3V61 A;  3CST A;  3OJ3 A;  1OTR B;  2JRI B;  2L7R A;  2LI5 A;  1GUA B;  4NQL B;  3NZU A;  4K1R B;  3KYC D;  3KH0 A;  1E5W A;  3Q3F A;  3PRE A;  4GOC A;  3H1U A;  4PYU A;  4AP4 C;  3ZIM A;  2N4F A;  3PHX B;  3KW5 B;  3N32 A;  3QK0 A;  3R3M A;  3KUD B;  4KVG B;  4PS7 A;  4ICU A;  2NCN A;  4OVV A;  4E3C A;  3DBL I;  3T8M A;  2MSE D;  3KVF B;  3TCA A;  2RSU A;  4NAW A;  4TQ0 A;  4F7Z A;  1QZE A;  1GC7 A;  3R66 C;  3L08 A;  4J6I A;  3R7R A;  1PQS A;  2CHX A;  2G3Q B;  2MBH A;  2NS5 A;  2WX1 A;  3H7P A;  3PRM B;  2J0K A;  4GGQ A;  2LGD A;  2ZCB A;  4GN1 A;  2DAF A;  1WFY A;  1V5O A;  2UWQ A;  4B9K A;  4AWJ A;  2XK5 A;  2MCN B;  2Z0D B;  4BOS C;  4FBJ B;  1IP9 A;  3QIJ A;  2HJ8 A;  3BIN A;  5L83 A;  3B0A A;  2N1W A;  1I35 A;  3PRZ A;  4XZ4 A;  3L10 B;  3T9L A;  2KHW B;  2M4N A;  2R2Q A;  2LRW A;  1UD7 A;  3QAQ A;  3WAL A;  3IFW B;  3ZUN A;  2L05 A;  3HM3 A;  4A3O A;  2WYQ A;  1UBQ A;  3RUI B;  4WJQ A;  1RLF A;  2L0F A;  4PYZ A;  4KDL B;  2REX A;  2PEA A;  2RR9 A;  2MWS B;  3TMP B;  3L17 A;  3ZVV A;  2L3Z A;  2WDT B;  2O6V B;  4B95 A;  3PZD A;  2AWT A;  2KN5 A;  3ONS A;  4A3P A;  2PE9 A;  3NOB A;  3ZNH B;  5FR6 A;  3S2A A;  3ZW3 A;  2IO2 B;  4ZRI A;  1Q5W B;  2D07 B;  1WR1 A;  2IO1 B;  4K7S A;  3ZTC A;  4DHJ B;  4HLE A;  1EUV B;  5J17 A;  1M94 A;  2VRR B;  4RM9 A;  1YX5 B;  4GSW A;  1SE9 A;  3W1Y A;  2J0J A;  2KDI A;  3WAO A;  2J7Q B;  4W9L A;  1YQB A;  1OEY A;  2EKE C;  2LGX A;  5JH5 C;  1RAX A;  1KOT A;  1WIA A;  3BY4 B;  2KMA A;  3JYU A;  1V5T A;  2M0X A;  3VH4 B;  1KLV A;  1WE6 A;  4M8M A;  2ZNV C;  1T0Y A;  2MX2 A;  4WJO A;  4NJ6 A;  3TL5 A;  4DDG D;  4W9D A;  5LXI B;  4RM8 A;  4WWP A;  1C3T A;  1MG8 A;  4XC2 A;  2NR2 A;  1TGZ B;  2GBK A;  2IY1 B;  2C7N B;  4IWP A;  2LZ6 A;  3M62 B;  3RUL A;  2GBN A;  3CF6 E;  1UEL A;  1YD8 U;  2KMC A;  1C1Y B;  4IW0 A;  2PJH A;  3VUW A;  2MBO A;  3NS8 A;  4GDL A;  2KTR B;  4CHK A;  4EEW A;  4JLC A;  3VTU A;  4FUL A;  5G55 A;  5DCN A;  5DPS A;  1L7Y A;  4TQ1 A;  4BKS D;  2K6D B;  3ENE A;  1WF9 A;  2KC1 A;  4KV2 A;  1NI2 A;  4KSL C;  1WM3 A;  5DPR A;  4BOZ B;  3IG3 A;  2MP2 A;  1V6E A;  2KXJ A;  1FXT B;  3PS6 A;  2GBJ A;  1WI0 A;  4FAD A;  2BYF A;  2KQS A;  4LDT D;  4MGZ E;  4BKS A;  4NAW B;  2DZJ A;  2LRU A;  3ZRC A;  3WA0 A;  1WGG A;  4G0N B;  3V60 A;  5DPW A;  3UIN B;  3H7P B;  3RZF A;  1WM2 A;  3QJZ A;  5TR5 A;  1YJ1 A;  2BKF A;  4EZL A;  4KIK A;  2KLC A;  3QA8 A;  1IPG A;  1OEY J;  4LCD E;  2HD5 B;  2WX0 A;  2K25 A;  3B1L X;  3N30 A;  4LJO B;  3PPA A;  4BKG A;  3CSF A;  2D10 A;  4W9I A;  1XT9 B;  2L00 B;  4MGY E;  4ZRK A;  2FAZ A;  3LDZ E;  2KTF A;  4W9C A;  1WMH A;  4WWO A;  1WZ0 A;  3DDC B;  2EMT A;  3JSV A;  2CKH B;  3X0W A;  3JW0 X;  2YLM A;  5EDS A;  3PT2 B;  1Z5S B;  3B08 A;  1A5R A;  1JRU A;  3O65 B;  2MQJ A;  4IM3 A;  2BGF A;  2FIF A;  3ZNZ B;  3OAW A;  5LLI A;  3UIP B;  4MM3 A;  2M17 A;  2R2O A;  5BO4 B;  4ZYN A;  2ZCC A;  3QX1 A;  2KO3 A;  2C7M B;  2XEW A;  2G45 B;  2GMI C;  5CX3 A;  3EEC A;  2W9N A;  1WE7 A;  4YL8 A;  2RGF A;  3GOE A;  3QCA A;  3DBR I;  4BVU C;  3PTF C;  2CS4 A;  3ML9 A;  4HWI B;  5D94 A;  1CMX B;  1UH6 A;  2N9E B;  3C0R B;  3DPD A;  4MEL A;  4I6N B;  2EMS A;  2LJ5 A;  1WGH A;  1WYW B;  3A1Q B;  3IVF A;  3UQB A;  3LJ3 A;  3GZN I;  3A33 B;  4ANX A;  2K8C A;  4OVU A;  3ECI A;  2JZ3 B;  1R4M I;  4GU2 A;  1P1A A;  1ISN A;  4RMA A;  3SU8 X;  1TZ1 A;  2KZR A;  4FA6 A;  3ZO5 B;  3DVG Y;  4X57 B;  3AUL A;  4W9G A;  1RFA A;  3HHM A;  1WH3 A;  1ZGU B;  1ZW7 A;  2BF8 B;  4I6P A;  2CR5 A;  2CHW A;  2KFK A;  3DOW A;  1S3S G;  4MEM A;  3SHQ A;  4PS8 A;  1OQY A;  3ALB A;  3ZRF A;  1EF1 A;  1YIW A;  1WGR A;  2ZJD A;  1V80 A;  1UGM A;  2KK8 A;  5KHQ A;  2ZNV B;  4ICV A;  3PLV A;  4KDI C;  2RD0 A;  4ANV A;  5HKH A;  2MBB B;  2DZM A;  1P9D U;  1ZKH A;  2C7H A;  3PV1 A;  1WRD B;  2AL6 A;  2V4L A;  2C60 A;  3V6E B;  3UGB B;  1WJU A;  4MJS A;  2LVO A;  2OOB B;  3A9J B;  3H7S A;  2K6Q A;  2LXA A;  3DQV A;  3PHW B;  2KD0 A;  3K9O B;  4JL9 A;  1H8C A;  2BKR B;  3V6C B;  4DDI D;  1NDD A;  2MP2 B;  2ZPN A;  1K8R B;  1WXV A;  2MBQ A;  2HTH A;  4E74 A;  3A4R A;  4URK A;  4KZ0 A;  3VFK A;  3RYT A;  3U8Z A;  2FCM A;  1GG3 A;  1WX8 A;  2NPT B;  3OJ4 B;  4XX5 A;  1XD3 B;  2IY0 B;  2LAS A;  2L76 A;  3DBH I;  3HK0 A;  4LDT B;  4W9K A;  3TIX A;  1L2N A;  3EHV A;  3DCG A;  3RD2 A;  2KJH B;  3WAM A;  1KM7 A;  2KQ7 A;  4FHJ A;  4FJV B;  4BFR A;  2KX3 A;  2N7D A;  3AU4 A;  1U4A A;  4HXD A;  5JZE B;  5JHB A;  2DYO A;  4II3 B;  3MHS D;  1LM8 B;  1LFD A;  2MA9 B;  3UF8 A;  2I1J A;  3HM6 X;  2KDF B;  3JVZ X;  5E6N A;  1VCB A; 
#chains in the Genus database with same CATH topology
 2N9X A;  4NAM A;  3U52 E;  3AU5 A;  1FXA A;  3L0W B;  1FM0 D;  4FLH A;  2K8B A;  4KX6 B;  2JUO A;  2KWC A;  3IT6 B;  2XBB C;  3C8Y A;  3VH3 B;  1IGD A;  1RYJ A;  1P3Q U;  3NZS A;  4JQW C;  1TBE A;  2WS3 B;  3ZLZ A;  2KWU B;  3DVN U;  1JQ4 A;  2NMQ A;  3I3T B;  1MVK A;  2N9P C;  4C4V A;  4EUT A;  1ET6 A;  2XK5 B;  1N63 A;  3W2D A;  4ZRJ A;  2LVP A;  2DEN B;  3QC8 B;  2KJR A;  4DK5 A;  3TJP A;  3NHE B;  2OJR A;  3RZW C;  4HK2 A;  4I6L B;  2IZV B;  2ACZ B;  3AMZ A;  5IA7 A;  2BT6 A;  5D3D A;  2V3N A;  4WQO B;  3BYT B;  3Q69 A;  1VZ8 A;  4GB9 A;  3APF A;  2AEH A;  2CHZ A;  5C1Z A;  2NBW B;  4JE3 B;  3DHG C;  3KYD D;  1CK1 A;  1AWD A;  2BWF A;  3VTW A;  4B6W A;  1QOA A;  1E8Z A;  3WIM A;  1V9J A;  4II2 B;  3GP7 A;  4A8X C;  3V62 A;  4KSK C;  2BPS A;  2J0M A;  2KN4 A;  2O2V A;  4FN2 A;  2IGH A;  2IND C;  4HPM B;  1XO3 A;  2BB6 A;  1EU4 A;  1E8Y A;  2N7J A;  2GRI A;  2MW5 A;  1Y8R C;  3BYY B;  2J52 A;  3EFU A;  1SGH A;  4M00 A;  4TKN A;  5IKC M;  1EU3 A;  1TS2 A;  4GDL B;  2BS2 B;  3QQ8 B;  2AYO B;  3AEF B;  1N6Z A;  3I57 A;  3SEB A;  2INC C;  4DHZ B;  2JVC A;  2L8J A;  1AW7 A;  3AE6 B;  1J0G A;  1HTO A;  2LUE A;  4EOY A;  2KX0 A;  4OVZ A;  1SIJ A;  3RT3 B;  3MTN B;  3AE1 B;  3MJW A;  1DOI A;  5C23 A;  1MPE A;  3VUX A;  3A9K B;  4KZC A;  2LMC A;  3N9Y C;  5TSS A;  4LTU A;  3VUY A;  3SD5 A;  3ZDT A;  1F1H A;  1E90 A;  2ZW0 A;  5CTR C;  4R3D A;  4RNA A;  2JY6 A;  2D2Q A;  3W5U B;  3EFC A;  5BYQ A;  4MM3 B;  3M95 A;  5CHW A;  2NVU I;  3R2T A;  1LO5 D;  4IM0 A;  2DX5 B;  2FNJ B;  5JXV A;  4MSQ B;  3MJ5 A;  2B3A A;  2KYW A;  4M8N A;  1SXT A;  2WXJ A;  3H6N A;  2IO3 B;  2QSD A;  3AV8 A;  2ASQ A;  4XWT A;  3ZTD A;  4WJP A;  5AZF A;  5IO9 A;  4AJW A;  1D3Z A;  2QIE B;  1K50 A;  1WSP A;  1NVI D;  3QWZ B;  2JWZ A;  4C7Y A;  1WXQ A;  4JIO U;  3EA6 A;  2DZK A;  4HDQ A;  2L32 A;  1ROE A;  4DXA B;  1YN5 A;  3P2B A;  1SSN A;  2GBR A;  1WJ6 A;  4GDK B;  1UF0 A;  2KFJ A;  3MC8 A;  2WXL A;  5G5G A;  3MC9 A;  2BYE A;  1OTR B;  2JRI B;  4C00 A;  3NZU A;  3ZIM A;  3PHX B;  3KW5 B;  1FFV A;  1SBB B;  4ICU A;  4LNO A;  3DBL I;  2MSE D;  4WUR A;  3TCA A;  1ZE3 D;  1QZE A;  1GC7 A;  3N20 C;  3R66 C;  3H7P A;  4GGQ A;  4P1B C;  2ZCB A;  4ZRQ A;  4CQN A;  2XK5 A;  3GZN B;  4BOS C;  4FBJ B;  2Y5P A;  3QIJ A;  2HJ8 A;  4XZ4 A;  2K9X A;  3L10 B;  3T9L A;  2KHW B;  2R2Q A;  3I63 C;  4K3B A;  1WGK A;  1FNU A;  1UBQ A;  3GB1 A;  3EGR A;  2REX A;  2KAJ A;  5BMH A;  2LGS A;  4B95 A;  3PZD A;  2KN5 A;  2D3A A;  3S2A A;  3ZW3 A;  1Q5W B;  1WR1 A;  5FKA C;  3NVW A;  2M19 A;  1YX5 B;  1KFY B;  4IOI E;  2J0J A;  2KDI A;  2J7Q B;  1DOY A;  1WIA A;  1JRO A;  3JYU A;  4NJC A;  1V5T A;  3VR9 B;  1DGJ A;  2INP E;  2K22 A;  1WE6 A;  4WJO A;  4NJ6 A;  4XC2 A;  1TGZ B;  5IN7 A;  4IWP A;  2LZ6 A;  3M62 B;  2IGG A;  3RUL A;  3EUB 2;  2LHE A;  5AUI A;  3CF6 E;  2DWQ A;  2W3R A;  4RGO S;  4IW0 A;  2OHF A;  3VUW A;  5EE3 A;  3ZJV A;  4GDL A;  4CHK A;  4JLC A;  1VDV A;  4Q2J A;  2PVG C;  5DPR A;  4BOZ B;  2MP2 A;  1V6E A;  1D5M C;  4LDT D;  4MGZ E;  2DZJ A;  1TKE A;  5TR5 A;  1I7H A;  2KLC A;  5EE1 A;  1C79 A;  1OEY J;  2HD5 B;  2WX0 A;  2K25 A;  3N30 A;  3FKY A;  4LJO B;  3PPA A;  4WH4 A;  2D10 A;  3AE2 B;  4W9I A;  4MGY E;  4JPS A;  3AEA B;  3CWI A;  2WXF A;  1SJH D;  2KTF A;  2GB1 A;  1QQR A;  2I2Y A;  3X0W A;  2MEK A;  3P4P B;  2YLM A;  5HI1 A;  3LB8 C;  3B08 A;  4MM3 A;  2M17 A;  3R8B A;  5BO4 B;  1V97 A;  2G45 B;  1B9R A;  5CX3 A;  1BUI C;  1ZDX A;  1D5Z C;  3GOE A;  3DBR I;  2Y5C A;  2WXP A;  1UH6 A;  4MEL A;  4I6N B;  4IDI A;  2EMS A;  2RDG A;  3A1Q B;  3IVF A;  3RPF C;  3UQB A;  1JWS D;  3ETR A;  1R4M I;  3ZXV A;  4EE2 A;  1ISN A;  2PVO D;  3SU8 X;  4LNF A;  4FA6 A;  3AUL A;  3W5V B;  1RFA A;  1ZW7 A;  1C78 A;  1ZGU B;  3RN9 C;  2CHW A;  2KFK A;  1S3S G;  3SHQ A;  3ALB A;  4WIP A;  1WGR A;  3V05 A;  4ICV A;  4KDI C;  4ANV A;  2L52 A;  5HKH A;  2MBB B;  1QIL A;  2AL6 A;  2V4L A;  2OOB B;  3A9J B;  2K6Q A;  2KD0 A;  3IXS A;  1T0R C;  1VZ6 A;  2BKR B;  4DDI D;  2XNA C;  2IDY A;  1E10 A;  1J7C A;  1K8R B;  2J42 A;  2MBQ A;  2QJL A;  2HTH A;  3A4R A;  2FCM A;  3OJ4 B;  2LAS A;  2L76 A;  4W9K A;  2H89 B;  4JWU C;  3Q2A C;  1K51 A;  3WAM A;  2KQ7 A;  1UWX A;  2B76 B;  5JZE B;  1U4A A;  2KQ4 X;  2DYO A;  4II3 B;  3MHS D;  2GI9 A;  2I1J A;  1N5X A;  2OJW A;  1ZP0 B;  4BZA A;  1J19 A;  3PZ7 A;  4AS1 A;  3TEZ A;  5AZG A;  2SAK A;  3SFE B;  1UNS A;  1I4R A;  1GJZ A;  2WXO A;  1FRR A;  2L0T A;  2FUH B;  1WX9 A;  2KLG A;  3AED B;  4WJN A;  1HZ6 A;  1J7A A;  4LK0 M;  5JHA A;  3APC A;  1AAR A;  4FJZ A;  1FNW A;  1EO6 A;  1HQR D;  1X1M A;  1I4X A;  2JF5 A;  2N1V A;  1BT0 A;  4GIV A;  1V86 A;  3W1S C;  2YEP B;  1E8X A;  3L54 A;  3OWE B;  3UI3 A;  2HE7 A;  3L13 A;  2M1M A;  1XCT L;  3ML8 A;  1NEK B;  2WXM A;  1R4N B;  4J3O D;  2FCQ A;  1TTN A;  4HJK A;  2Z8L A;  4RCO A;  1WJN A;  3L16 A;  1E7V A;  1E8W A;  2PE6 B;  3APD A;  3FC4 A;  4IWO A;  3AE8 B;  4P1C C;  1V2Y A;  4MJS B;  3URY A;  4GMV A;  1S1Q B;  3NJT A;  1J8C A;  2KOX A;  5D6J B;  4C80 A;  3T3O A;  1OQQ A;  1JWB D;  2VZK B;  2BYV E;  4K7U A;  4NJ7 A;  4DXF A;  1WX7 A;  2MJ3 A;  4EZJ A;  3M63 B;  3A4S C;  1IBX A;  1WZ3 A;  3VQI A;  3U4E G;  3KQ4 A;  4M0W A;  4MGI E;  4AOF A;  4HDO A;  5D2M B;  2W55 A;  2RPQ A;  2KKC A;  1TT5 B;  1FMA D;  1WGD A;  2V4I B;  5FK9 C;  2LGY A;  3LXF A;  4M02 A;  4UDU C;  3NS1 A;  4W9E A;  4RGM A;  4EZK A;  4ZHP A;  1VZ7 A;  4N59 A;  3BK1 A;  2HTM E;  3BVM A;  3IBE A;  2JXX A;  1NBF C;  3KWV A;  3TEX A;  2N9K A;  4KIK B;  4W9J A;  4NY0 A;  3A1Q A;  3T3N A;  4IM2 A;  5LXH A;  3Q3N C;  1HE8 A;  2WU5 B;  4MT5 A;  1FPY A;  4G50 A;  1Q0W B;  3PSE B;  1WMH B;  4LJP B;  2KC2 A;  2MH7 A;  2WWZ A;  4TMA B;  4JGH B;  2D3B A;  1WJ4 A;  1ACC A;  1E6E B;  2O6V D;  5E6P A;  2MLB A;  4K81 A;  4ASW C;  1PFD A;  2LHD A;  4FXC A;  1KH0 A;  4DHJ D;  2O6V A;  2VH1 A;  2DYB A;  5BYR A;  3A9J A;  4G3X B;  2Y3A A;  3Q3J A;  4WWN A;  2KJ6 A;  2FBW B;  2KAC A;  2WHI A;  3U7Z A;  1Y56 A;  1PDX A;  3AN1 A;  4GLS C;  4BBN C;  1IYF A;  2M56 B;  2FUG 1;  4AUQ C;  2EEL A;  4G11 A;  4YT0 B;  3AE4 B;  1V8C A;  3RNG C;  3TBL D;  4HPL B;  4PT5 A;  1GPX A;  4C7Z A;  3CMM B;  2NBV B;  3N1X C;  5J18 A;  1GUA B;  4NQL B;  3NVZ A;  4PYU A;  4GOC A;  1OFF A;  1KRH A;  2KMM A;  3QK0 A;  1TS4 A;  2JYE A;  2RPV A;  4PS7 A;  1T0S C;  2RSU A;  4NAW A;  4F7Z A;  2QDF A;  3L08 A;  2WXH A;  4J6I A;  2CHX A;  2WX1 A;  3PRM B;  3ZJU A;  1N5W A;  2UU7 A;  4KGS A;  3Q8A A;  3AEE B;  1SEB D;  2UWQ A;  3BK2 A;  2Z0D B;  4ZHO A;  1IP9 A;  3NRZ A;  3B0A A;  1I35 A;  3VRA B;  2M4N A;  3QAQ A;  1UGJ A;  2V3P A;  2K0P A;  3RUI B;  1RLF A;  3PZ8 A;  1CJE A;  1NYQ A;  3TMP B;  2FE8 A;  1SF0 A;  3IT4 B;  1L4D B;  4NZL B;  1FNV A;  2AWT A;  2WNM A;  2PE9 A;  3ZNH B;  2HJ1 A;  3O13 A;  2Q5W D;  2D07 B;  4XE0 A;  3C19 A;  4L1B A;  2VRR B;  2AQ2 B;  4RM9 A;  3W1Y A;  1ZUD 2;  3HUI A;  3WAO A;  2LGX A;  1E7P B;  4HKZ E;  1KOT A;  3B9J A;  1BXT A;  3IAM 1;  2HDE A;  1HA5 A;  2MX2 A;  1WYG A;  2YEP F;  4W9D A;  1SE2 A;  1MG8 A;  2GBK A;  1E9M A;  3RNF C;  4TSS A;  3N1Y C;  2GBN A;  1K52 A;  3BWU D;  1UEL A;  2KMC A;  2PJH A;  3BVZ A;  2MBO A;  1F2R C;  4YSY B;  4BAX A;  3N1Z C;  2KTR B;  4EEW A;  3VTU A;  2WGS A;  4LNI A;  5G55 A;  5DCN A;  1L7Y A;  3P4Q B;  4TQ1 A;  2KC1 A;  4KSL C;  3P63 A;  3PS6 A;  4FAD A;  1TY2 A;  2AQ3 B;  3BVG A;  5DPW A;  1QT9 A;  2QC8 A;  1YJ1 A;  2BKF A;  2KVZ A;  2WLB A;  4KIK A;  3QA8 A;  1IPG A;  1C9F A;  2FAZ A;  1XXG A;  1WMH A;  3DDC B;  4HRO A;  2CKH B;  4HJG E;  4RFB A;  3DHH C;  1ET9 A;  3PT2 B;  1JRU A;  2MQJ A;  4IM3 A;  3ZNZ B;  2LEK A;  2R2O A;  4ZYN A;  1MG4 A;  3EEC A;  1WE7 A;  1JW9 D;  3QCA A;  2CS4 A;  2N9E B;  3C0R B;  1FEH A;  3MHZ A;  4ANX A;  2K8C A;  1TYG B;  2JZ3 B;  4GU2 A;  1C4P A;  4RMA A;  2KZR A;  3AEG B;  3ZO5 B;  2K5P A;  2E6X A;  1L4Z B;  1WH3 A;  3AEB B;  2CR5 A;  1KLG D;  2LUM A;  1OQY A;  3ZRF A;  1MFW A;  2DNF A;  2KWD A;  3AE3 B;  2KK8 A;  4OW0 A;  4A55 A;  1YMH E;  1T3Q A;  2LVO A;  3H7S A;  4XGA B;  1KTK A;  3PHW B;  5EE0 A;  3V6C B;  1NDD A;  2ZPN A;  1PUT A;  1WXV A;  1FIQ A;  2N0S B;  3VFK A;  1AN8 A;  1I4Q A;  3DWG C;  2NPT B;  3J9C A;  4XX5 A;  2INN E;  1XD3 B;  1C4C A;  3TIX A;  1L2N A;  3EHV A;  2WP9 B;  3DCG A;  2KJH B;  3MFG A;  1KM7 A;  4ARI A;  4FHJ A;  4FJV B;  4BFR A;  3DBH B;  4XDD A;  1BML C;  1LM8 B;  2IGD A;  1FCL A;  1NYR A;  3RMK C;  5BYS A;  2KDF B;  1WWT A;  4RF0 A;  1HZ5 A;  5H92 C;  1OGW A;  2KNB A;  3AB5 A;  2JXT A;  1LXD A;  1D5X C;  3SDL C;  1I4G A;  2C5L C;  1UUP A;  1ZPS A;  2M8S A;  5GMV A;  2IYD B;  5KHO A;  3AI5 A;  1I4P A;  3AEC B;  1TKY A;  2QHO A;  3A9K A;  2D3G A;  1R4N I;  4KGR A;  3ZGZ A;  2BS4 B;  4WWM A;  1P0R A;  3VTV A;  5BMG A;  2N9L A;  2AQ1 B;  5E6O A;  1C76 A;  3VDZ A;  2WXR A;  1Q1O A;  2FID A;  2C9W B;  1G6J A;  4EFO A;  1V49 A;  1WXS A;  5J2R A;  2ZW1 A;  3N3K B;  2MBE A;  2JRH A;  3DVG X;  1EWC A;  3NY5 A;  3OLM D;  4OZC A;  2KTR A;  4EKU A;  2IPK D;  1K53 A;  5L95 C;  2DZI A;  1SIF A;  1JWM D;  1RFK A;  2JYT A;  2KAN A;  4BKT A;  3AE9 B;  1HTQ A;  1WR6 E;  2QEJ C;  2AL3 A;  1J7B A;  1I42 A;  2KT7 A;  2KDB A;  1N61 A;  2K1F A;  4GDK A;  2G4S A;  1XCQ L;  2ON8 A;  4MGK E;  3ZDM C;  2MRP A;  4BBN F;  2V3S A;  4FJY A;  2GLS A;  4N9F 4;  3U30 A;  4P7I A;  2R61 A;  3U7D A;  1JCK B;  3KUC B;  4H2A A;  4NQK E;  1YX6 B;  2D3C A;  2ZPY A;  4NNJ B;  2KDE B;  4C4V B;  4S17 A;  1QOB A;  1RRB A;  3AE7 B;  3H9D A;  3EC8 A;  3PGE A;  3D32 A;  4IG7 B;  1STE A;  3JSV B;  2WXK A;  1CQV A;  5D3I B;  2PPH A;  2PTL A;  1QF6 A;  2LD9 A;  2Y5B B;  1QOF A;  1I4H A;  2PLP A;  3ZKJ C;  4DHZ E;  1E7U A;  4MH0 E;  2QIL A;  3AXC A;  3Q8F A;  1WY8 A;  2JU6 X;  4DWF A;  3VHT C;  3AH7 A;  4NPN A;  4A90 A;  4DBG A;  2WQY B;  4HCP B;  1QKZ A;  2NBU A;  2LWP A;  1GOZ A;  4YTN B;  3PRP B;  4TUU A;  4ANW A;  2O2V B;  4LLG M;  2D11 A;  2NPT A;  1WGY A;  2DYM A;  3ZQ4 A;  4CO7 A;  3B2G A;  2JWU A;  3WAP A;  3U2S C;  2K3U A;  3RNE C;  1TIF A;  2FCN A;  2ZVN A;  3ZNI D;  3Q8C A;  4TV3 A;  3TSS A;  2YVC A;  4AJY B;  1IUE A;  4RGT A;  2LXC A;  3X23 A;  2BB5 A;  3V61 A;  2L7R A;  2WXI A;  3ZYY X;  3KYC D;  1E5W A;  3PRE A;  4AP4 C;  1TS3 A;  2N4F A;  1R7S A;  3KUD B;  4KVG B;  2NCN A;  3ZJT A;  4E3C A;  3KVF B;  4YWG G;  2CJN A;  3FAH A;  2VH2 A;  3R7R A;  1PQS A;  2MBH A;  2NS5 A;  2LGD A;  2DAF A;  1V5O A;  4B9K A;  4AWJ A;  2MCN B;  1ZOY B;  4M01 A;  1JML A;  1R4M B;  5L83 A;  1YQ4 B;  3PRZ A;  1YNT E;  1UWM A;  2LRW A;  3IFW B;  3NVY A;  3ZUN A;  2L05 A;  3HM3 A;  2WYQ A;  4RGN A;  2KDM A;  2JQR B;  2WXQ A;  2PEA A;  2L3Z A;  3ONS A;  4A3P A;  1DOX A;  3NOB A;  3Q3O C;  5FR6 A;  1N60 A;  2IO2 B;  4S0R A;  3ZTC A;  1B1Z A;  1EUV B;  3H8H A;  5J17 A;  4YXD B;  2BVC A;  1M94 A;  4B0M A;  4GSW A;  1V1P B;  1OEY A;  2EKE C;  5JH5 C;  1RAX A;  2SEB D;  3BY4 B;  2KMA A;  4HPP A;  1KLV A;  1XLP A;  3KWL A;  3ZXR A;  4M8M A;  2ONQ A;  4US8 A;  4RM8 A;  1C3T A;  2BW2 A;  1JAL A;  2J4X A;  5FR3 A;  4WQM A;  3NS8 A;  2DBY A;  2V0G A;  4FUL A;  3FIL B;  5DPS A;  4BKS D;  4XDC A;  1WF9 A;  2L1A A;  3KLS X;  4AQ7 A;  2KQS A;  3R2I A;  4BKS A;  3VR8 B;  2LRU A;  1WGG A;  4P6V F;  3ABV B;  3H7P B;  2CJO A;  1WM2 A;  3QJZ A;  2PW9 A;  3TEY A;  1PGB A;  4USA A;  4LCD E;  4LNN A;  3B1L X;  5IP4 D;  5I4D A;  1IGC A;  4W9C A;  4WWO A;  1WZ0 A;  3JSV A;  2RMM A;  1SE4 A;  4ITK A;  3O65 B;  2BGF A;  2FIF A;  2BTE A;  1GB4 A;  5H8Y E;  3QX1 A;  4OHJ A;  2XEW A;  3P42 A;  4HKQ A;  2RGF A;  5D94 A;  2G9H D;  1WGH A;  4HRS A;  3GZN I;  3A33 B;  4OVU A;  1P1A A;  1TZ1 A;  1AYF A;  1KF6 B;  3NVV A;  3HHM A;  4DQO C;  2BF8 B;  3SFD B;  4I6P A;  4PS8 A;  3VRB B;  1EF1 A;  1YIW A;  5KHQ A;  3PLV A;  1YJI A;  1P7E A;  2RD0 A;  1L0V B;  1XLQ A;  2DZM A;  2LJI A;  5C2T B;  2XN9 C;  3RNB C;  2C60 A;  1F2R I;  3V6E B;  3UGB B;  4MJS A;  4YSZ B;  2LXA A;  2VZK D;  1YN4 A;  1JWA D;  1H8C A;  5LNK 1;  4QAY A;  3MC0 B;  1PGA A;  2MP2 B;  1EWY C;  4URK A;  4KZ0 A;  1VRA B;  4P16 A;  1GG3 A;  1WX8 A;  3CIR B;  3OG5 A;  2IY0 B;  1ENF A;  3DBH I;  4LDT B;  2CU3 A;  2BBC A;  4KKI A;  2KX3 A;  2N7D A;  5JHB A;  4HXD A;  2X8X X;  2MA9 B;  3HM6 X;  5E6N A;  5E6J A;  1VCB A;  4B0E A;  1L0Y B;  2JX5 A;  5CHV C;  2IBI B;  1VLB A;  1ZXI A;  4ARC A;  3M3J A;  5IAA C;  1N62 A;  4PS3 A;  1TJE A;  2GOW A;  3PVL A;  4KGT A;  3K9P B;  1F52 A;  4K3C A;  1Z2M A;  4FHK A;  4HCN B;  1XF5 L;  1F9J A;  3MP9 A;  4MSM B;  4YSX B;  2JPH A;  1QOG A;  1XEE A;  3BZD B;  2WDQ B;  1V1P A;  2BS3 B;  3W1S A;  5D7G A;  1VJK A;  3VXW A;  2JSV X;  3NUH B;  1H4R A;  2KFK B;  4ANU A;  2ZZP B;  5AUK A;  1D4B A;  2G4D B;  4WAA A;  1DYQ A;  1GNU A;  3GE3 C;  1F77 A;  3HRD D;  1ZXH A;  5DPT A;  3UIO B;  1ZDV A;  1V1O A;  2KVR A;  2K8H A;  2QMT A;  3QHT A;  1NI3 A;  2BQQ A;  4L23 A;  3FIL A;  1M4V A;  2PKO A;  1P7F A;  1LQB A;  5G5H A;  2W3S A;  1UBI A;  2N7E A;  1FFU A;  2LGI A;  4RF1 A;  2DAJ A;  3NZ3 A;  2L83 A;  3VVW B;  1EF5 A;  5G2N A;  1VD2 A;  4ZRP A;  1GC6 A;  1T5X D;  4HEA 1;  2BWE S;  2KWV B;  1WXM A;  2FCS A;  2UYZ B;  3R7Q A;  1F0Z A;  1XQQ A;  3LYY A;  2GBM A;  3Q8B A;  4F8C B;  4O1N A;  3PO0 A;  1WXA A;  3RCZ A;  1UZX B;  3Q14 C;  3V3X A;  2ZVO A;  1FO4 A;  3ZNG C;  3DVN V;  2JZZ A;  1E0Z A;  3HIZ A;  3HVD A;  2CU1 A;  3DBS A;  4LNK A;  4MDK E;  3UQA A;  2NTT A;  3DHI C;  2QCZ A;  4IC7 B;  4F1S A;  3WAN A;  4A9A A;  2LVQ A;  4OZA A;  2K39 A;  4K7W A;  4XYC A;  3L4P A;  5AZH A;  3VAW A;  2JT4 B;  2Z59 B;  5AEK B;  2WXG A;  5CHF A;  3IHP C;  4YTP B;  4IWQ A;  4MH8 A;  1XLO A;  3KUZ A;  4RH6 A;  4E71 A;  2PIA A;  1CZP A;  2BYT A;  4W9F A;  2RDB C;  4HVB A;  1PYW D;  3RFZ B;  4YTM B;  2A4Z A;  4XWW A;  4JX1 C;  2D5G A;  4REZ A;  2IO0 B;  1QLB B;  4A6Q A;  2X38 A;  4CYE A;  2A5U A;  4GXB A;  4N58 A;  1YN3 A;  3QAR A;  1FD6 A;  2WU2 B;  3RNC C;  1JWU D;  1MI0 A;  3I5J C;  1P98 A;  2ICI A;  5C3J B;  4L2Y A;  1KJT A;  1V81 A;  3PLU A;  2DHZ A;  5BMI A;  3GE8 C;  2DLB A;  4A20 A;  1IBX B;  4W9H A;  2I38 A;  2W82 A;  2ZEQ A;  2I1K A;  2W54 A;  2Z0E B;  3W9C B;  2TSS A;  4M0W B;  2V1Y A;  2JZP A;  4ZDV A;  4IUM B;  3CST A;  3OJ3 A;  2LI5 A;  4K1R B;  3KH0 A;  3Q3F A;  3H1U A;  1FXI A;  3N32 A;  3P1M A;  3R3M A;  4MAC A;  1MHX A;  1ESF A;  4OVV A;  3T8M A;  1A70 A;  4TQ0 A;  2G3Q B;  3DBL B;  1T6B X;  2J0K A;  1L5P A;  4ZYS A;  2AX5 A;  4GN1 A;  1WFY A;  5HHD G;  3DWM A;  3BIN A;  2N1W A;  5EE9 A;  1KLU D;  1RWS A;  2MHJ A;  1UD7 A;  3WAL A;  2NTS A;  2G1E A;  4A3O A;  4US9 A;  1HEZ E;  4WJQ A;  3Q3M C;  2L0F A;  4PYZ A;  4KDL B;  1T0Q C;  2RR9 A;  5IOI A;  2MWS B;  3L17 A;  3ZVV A;  2IJ0 A;  2O6V B;  2WDT B;  3TEW A;  3TUO A;  4ZRI A;  4DHJ B;  1HXY D;  2IO1 B;  2M0A A;  4K7S A;  4ACF A;  4HLE A;  1GB1 A;  1SE3 A;  1TS5 A;  1SE9 A;  3P4S B;  4W9L A;  1YQB A;  1LGR A;  1SB3 C;  2M0X A;  3VH4 B;  1VR9 A;  2ZNV C;  1T0Y A;  1NEN B;  1L0X B;  3TL5 A;  4DDG D;  5LXI B;  2OED A;  4WWP A;  1MJD A;  2J53 A;  2NR2 A;  2IY1 B;  2C7N B;  4D2K A;  2WDR B;  1YD8 U;  1C1Y B;  3E56 A;  1C4A A;  1GAQ B;  1L6U A;  1OQR A;  2K6D B;  3ENE A;  4KV2 A;  1NI2 A;  1WM3 A;  3IG3 A;  2KXJ A;  1FXT B;  2GBJ A;  1WI0 A;  3WCQ A;  2BYF A;  4NAW B;  4WAF A;  3ZRC A;  3WA0 A;  4G0N B;  3V60 A;  1YJJ A;  3UIN B;  1FCC C;  3AM9 A;  3RZF A;  1WRI A;  4EZL A;  1XLN A;  3BII D;  1C77 A;  1TZO A;  1JRP A;  3P4R B;  4BKG A;  3SR6 A;  3CSF A;  1XT9 B;  2L00 B;  4ZRK A;  3LDZ E;  1TY0 A;  1YQ3 B;  2EMT A;  3JW0 X;  5GXG B;  5EDS A;  1Z5S B;  1A5R A;  2LFI A;  3OAW A;  5LLI A;  3UIP B;  2ZCC A;  4KKJ A;  2KO3 A;  2WDV B;  2C7M B;  3HVZ A;  2GMI C;  2W9N A;  2EKI A;  4YL8 A;  4BVU C;  3PTF C;  1TKG A;  3ML9 A;  4HWI B;  1CMX B;  3DPD A;  5MPO A;  4OZB A;  1RM6 C;  1YOV B;  2LJ5 A;  1WYW B;  5T8I A;  3LJ3 A;  3DBR B;  3ECI A;  4IKG A;  1Q10 A;  3IAS 1;  3NG0 A;  3DVG Y;  4X57 B;  4C56 C;  4W9G A;  2WXN A;  4PK1 A;  3RI7 C;  3DOW A;  4MEM A;  4N6E B;  4JWS C;  5HG2 A;  2ZJD A;  1V80 A;  1UGM A;  2ZNV B;  3AE5 B;  1EM7 A;  5HFY A;  1D6E C;  4ZOH C;  2RDH A;  1P9D U;  3PV1 A;  1ZKH A;  2C7H A;  1WRD B;  2E3T A;  2MJE A;  1WJU A;  2H88 B;  1FRD A;  3DQV A;  3K9O B;  3Q8E A;  2MJD A;  2V9H A;  4JL9 A;  2PMV A;  1L6V A;  4E74 A;  1MHH E;  4DXG A;  3RYT A;  3U8Z A;  3B2F A;  3RNA C;  3HK0 A;  3RD2 A;  3GS2 A;  3I9V 1;  3AU4 A;  1LFD A;  3E9S A;  3UF8 A;  1PGX A;  1SJE D;  3Q6B A;  3JVZ X; 
#chains in the Genus database with same CATH homology
 1J19 A;  2N9X A;  5CHV C;  5AZG A;  2IBI B;  3AU5 A;  3L0W B;  3M3J A;  1OGW A;  5IAA C;  4FLH A;  1GJZ A;  2L0T A;  4PS3 A;  2K8B A;  2GOW A;  2KNB A;  3PVL A;  2FUH B;  1LXD A;  1WX9 A;  2JUO A;  3SDL C;  2KWC A;  2KLG A;  2C5L C;  2XBB C;  3VH3 B;  3K9P B;  1P3Q U;  4WJN A;  1Z2M A;  2M8S A;  3NZS A;  4FHK A;  4HCN B;  4JQW C;  5GMV A;  3APC A;  1AAR A;  1TBE A;  4FJZ A;  5JHA A;  2IYD B;  3ZLZ A;  2KWU B;  1EO6 A;  5KHO A;  3DVN U;  1F9J A;  3AI5 A;  4MSM B;  1X1M A;  2JPH A;  2JF5 A;  2N1V A;  1BT0 A;  4GIV A;  3I3T B;  2N9P C;  1V86 A;  2QHO A;  3W1S C;  1E8X A;  3A9K A;  3L54 A;  4EUT A;  2XK5 B;  2HE7 A;  3L13 A;  2D3G A;  2M1M A;  4ZRJ A;  3ML8 A;  1R4N I;  2LVP A;  2DEN B;  3QC8 B;  2KJR A;  3W1S A;  5D7G A;  3VXW A;  4DK5 A;  3TJP A;  3NHE B;  2OJR A;  3RZW C;  1P0R A;  4HK2 A;  3VTV A;  1H4R A;  2KFK B;  4I6L B;  4ANU A;  2IZV B;  2ZZP B;  5IA7 A;  2G4D B;  4WAA A;  5E6O A;  2FCQ A;  3VDZ A;  1TTN A;  1GNU A;  4HJK A;  1WJN A;  3L16 A;  4WQO B;  1Q1O A;  2FID A;  2C9W B;  1E7V A;  1E8W A;  4EFO A;  1V49 A;  2PE6 B;  1G6J A;  1WXS A;  4GB9 A;  5DPT A;  5J2R A;  3UIO B;  3APD A;  3APF A;  2AEH A;  4IWO A;  2CHZ A;  3N3K B;  1V2Y A;  2MBE A;  4MJS B;  4GMV A;  2JRH A;  5C1Z A;  2KVR A;  2NBW B;  1S1Q B;  2K8H A;  3DVG X;  3KYD D;  3NY5 A;  1J8C A;  3QHT A;  2KOX A;  5D6J B;  2BWF A;  3OLM D;  3VTW A;  4B6W A;  1E8Z A;  2KTR A;  4EKU A;  3WIM A;  1V9J A;  4II2 B;  1LQB A;  3V62 A;  4KSK C;  2BPS A;  2BYV E;  5L95 C;  1UBI A;  2DZI A;  1SIF A;  2N7E A;  4K7U A;  4NJ7 A;  2DAJ A;  3VVW B;  1EF5 A;  2J0M A;  5G2N A;  1WX7 A;  4EZJ A;  2KAN A;  4BKT A;  2O2V A;  1WR6 E;  1VD2 A;  2AL3 A;  4FN2 A;  3M63 B;  3A4S C;  1GC6 A;  1WZ3 A;  4HPM B;  3VQI A;  1I42 A;  1E8Y A;  2BWE S;  2MW5 A;  2KWV B;  1WXM A;  2FCS A;  2UYZ B;  3R7Q A;  1XQQ A;  2KDB A;  2GBM A;  1Y8R C;  3EFU A;  4F8C B;  4MGI E;  2K1F A;  4GDK A;  1SGH A;  4TKN A;  4AOF A;  4HDO A;  5D2M B;  2G4S A;  2RPQ A;  1WXA A;  3RCZ A;  1UZX B;  2KKC A;  4GDL B;  3QQ8 B;  2AYO B;  1WGD A;  4MGK E;  3ZDM C;  2LGY A;  2MRP A;  2V3S A;  4BBN F;  4FJY A;  2ZVO A;  3ZNG C;  3DVN V;  2JZZ A;  4N9F 4;  4DHZ B;  3U30 A;  4W9E A;  2JVC A;  2L8J A;  3HIZ A;  4P7I A;  4EZK A;  1J0G A;  2CU1 A;  3DBS A;  2LUE A;  4EOY A;  2KX0 A;  3U7D A;  4MDK E;  3UQA A;  3KUC B;  4IC7 B;  3IBE A;  4F1S A;  2JXX A;  3RT3 B;  3MTN B;  1NBF C;  1YX6 B;  4NQK E;  3MJW A;  2ZPY A;  3WAN A;  2LVQ A;  4KIK B;  4W9J A;  2K39 A;  4NNJ B;  4NY0 A;  4K7W A;  5C23 A;  2KDE B;  3VAW A;  5AZH A;  3A1Q A;  3VUX A;  4IM2 A;  1RRB A;  3A9K B;  4KZC A;  5LXH A;  2JT4 B;  1HE8 A;  2Z59 B;  3VUY A;  5AEK B;  3SD5 A;  3ZDT A;  4G50 A;  3H9D A;  1Q0W B;  5CHF A;  1E90 A;  3IHP C;  3PSE B;  4IWQ A;  3EC8 A;  1WMH B;  3PGE A;  3D32 A;  3KUZ A;  5CTR C;  4IG7 B;  2JY6 A;  2D2Q A;  3JSV B;  4LJP B;  2PPH A;  4E71 A;  2KC2 A;  2WWZ A;  2LD9 A;  4W9F A;  4JGH B;  4HVB A;  2Y5B B;  1WJ4 A;  3M95 A;  3ZKJ C;  2A4Z A;  4DHZ E;  2O6V D;  5CHW A;  1E7U A;  5E6P A;  2MLB A;  4K81 A;  4MH0 E;  2NVU I;  3AXC A;  2IO0 B;  4ASW C;  4IM0 A;  4CYE A;  2DX5 B;  2FNJ B;  2A5U A;  4MSQ B;  4GXB A;  4DHJ D;  2B3A A;  2O6V A;  4M8N A;  1WY8 A;  2DYB A;  3H6N A;  2IO3 B;  3QAR A;  2ASQ A;  3A9J A;  4G3X B;  4DWF A;  3VHT C;  3ZTD A;  4NPN A;  4WJP A;  4DBG A;  5AZF A;  3Q3J A;  4HCP B;  4WWN A;  2KJ6 A;  4AJW A;  2NBU A;  1P98 A;  1D3Z A;  2LWP A;  1KJT A;  3QWZ B;  2JWZ A;  3PRP B;  1V81 A;  3PLU A;  2DHZ A;  4TUU A;  4ANW A;  2O2V B;  4A20 A;  2D11 A;  2NPT A;  4JIO U;  1WGY A;  4W9H A;  2DYM A;  4BBN C;  1IYF A;  4CO7 A;  2DZK A;  4HDQ A;  3WAP A;  4AUQ C;  2ZEQ A;  4DXA B;  2FCN A;  2ZVN A;  3ZNI D;  4TV3 A;  2I1K A;  2Z0E B;  2YVC A;  3P2B A;  4G11 A;  2GBR A;  4M0W B;  4AJY B;  1WJ6 A;  3TBL D;  4GDK B;  2KFJ A;  4HPL B;  2V1Y A;  2LXC A;  3X23 A;  4ZDV A;  3CMM B;  2NBV B;  2BYE A;  5J18 A;  4IUM B;  3V61 A;  3CST A;  3OJ3 A;  1OTR B;  2JRI B;  2L7R A;  2LI5 A;  1GUA B;  4NQL B;  3NZU A;  4K1R B;  3KYC D;  3KH0 A;  1E5W A;  3Q3F A;  3PRE A;  4GOC A;  3H1U A;  4PYU A;  4AP4 C;  3ZIM A;  2N4F A;  3PHX B;  3KW5 B;  3N32 A;  3QK0 A;  3R3M A;  3KUD B;  4KVG B;  4PS7 A;  4ICU A;  2NCN A;  4OVV A;  4E3C A;  3DBL I;  3T8M A;  2MSE D;  3KVF B;  3TCA A;  2RSU A;  4NAW A;  4TQ0 A;  4F7Z A;  1QZE A;  1GC7 A;  3R66 C;  3L08 A;  4J6I A;  3R7R A;  1PQS A;  2CHX A;  2G3Q B;  2MBH A;  2NS5 A;  2WX1 A;  3H7P A;  3PRM B;  2J0K A;  4GGQ A;  2LGD A;  2ZCB A;  4GN1 A;  2DAF A;  1WFY A;  1V5O A;  2UWQ A;  4B9K A;  4AWJ A;  2XK5 A;  2MCN B;  2Z0D B;  4BOS C;  4FBJ B;  1IP9 A;  3QIJ A;  2HJ8 A;  3BIN A;  5L83 A;  3B0A A;  2N1W A;  1I35 A;  3PRZ A;  4XZ4 A;  3L10 B;  3T9L A;  2KHW B;  2M4N A;  2R2Q A;  2LRW A;  1UD7 A;  3QAQ A;  3WAL A;  3IFW B;  3ZUN A;  2L05 A;  3HM3 A;  4A3O A;  2WYQ A;  1UBQ A;  3RUI B;  4WJQ A;  1RLF A;  2L0F A;  4PYZ A;  4KDL B;  2REX A;  2PEA A;  2RR9 A;  2MWS B;  3TMP B;  3L17 A;  3ZVV A;  2L3Z A;  2WDT B;  2O6V B;  4B95 A;  3PZD A;  2AWT A;  2KN5 A;  3ONS A;  4A3P A;  2PE9 A;  3NOB A;  3ZNH B;  5FR6 A;  3S2A A;  3ZW3 A;  2IO2 B;  4ZRI A;  1Q5W B;  2D07 B;  1WR1 A;  2IO1 B;  4K7S A;  3ZTC A;  4DHJ B;  4HLE A;  1EUV B;  5J17 A;  1M94 A;  2VRR B;  4RM9 A;  1YX5 B;  4GSW A;  1SE9 A;  3W1Y A;  2J0J A;  2KDI A;  3WAO A;  2J7Q B;  4W9L A;  1YQB A;  1OEY A;  2EKE C;  2LGX A;  5JH5 C;  1RAX A;  1KOT A;  1WIA A;  3BY4 B;  2KMA A;  3JYU A;  1V5T A;  2M0X A;  3VH4 B;  1KLV A;  1WE6 A;  4M8M A;  2ZNV C;  1T0Y A;  2MX2 A;  4WJO A;  4NJ6 A;  3TL5 A;  4DDG D;  4W9D A;  5LXI B;  4RM8 A;  4WWP A;  1C3T A;  1MG8 A;  4XC2 A;  2NR2 A;  1TGZ B;  2GBK A;  2IY1 B;  2C7N B;  4IWP A;  2LZ6 A;  3M62 B;  3RUL A;  2GBN A;  3CF6 E;  1UEL A;  1YD8 U;  2KMC A;  1C1Y B;  4IW0 A;  2PJH A;  3VUW A;  2MBO A;  3NS8 A;  4GDL A;  2KTR B;  4CHK A;  4EEW A;  4JLC A;  3VTU A;  4FUL A;  5G55 A;  5DCN A;  5DPS A;  1L7Y A;  4TQ1 A;  4BKS D;  2K6D B;  3ENE A;  1WF9 A;  2KC1 A;  4KV2 A;  1NI2 A;  4KSL C;  1WM3 A;  5DPR A;  4BOZ B;  3IG3 A;  2MP2 A;  1V6E A;  2KXJ A;  1FXT B;  3PS6 A;  2GBJ A;  1WI0 A;  4FAD A;  2BYF A;  2KQS A;  4LDT D;  4MGZ E;  4BKS A;  4NAW B;  2DZJ A;  2LRU A;  3ZRC A;  3WA0 A;  1WGG A;  4G0N B;  3V60 A;  5DPW A;  3UIN B;  3H7P B;  3RZF A;  1WM2 A;  3QJZ A;  5TR5 A;  1YJ1 A;  2BKF A;  4EZL A;  4KIK A;  2KLC A;  3QA8 A;  1IPG A;  1OEY J;  4LCD E;  2HD5 B;  2WX0 A;  2K25 A;  3B1L X;  3N30 A;  4LJO B;  3PPA A;  4BKG A;  3CSF A;  2D10 A;  4W9I A;  1XT9 B;  2L00 B;  4MGY E;  4ZRK A;  2FAZ A;  3LDZ E;  2KTF A;  4W9C A;  1WMH A;  4WWO A;  1WZ0 A;  3DDC B;  2EMT A;  3JSV A;  2CKH B;  3X0W A;  3JW0 X;  2YLM A;  5EDS A;  3PT2 B;  1Z5S B;  3B08 A;  1A5R A;  1JRU A;  3O65 B;  2MQJ A;  4IM3 A;  2BGF A;  2FIF A;  3ZNZ B;  3OAW A;  5LLI A;  3UIP B;  4MM3 A;  2M17 A;  2R2O A;  5BO4 B;  4ZYN A;  2ZCC A;  3QX1 A;  2KO3 A;  2C7M B;  2XEW A;  2G45 B;  2GMI C;  5CX3 A;  3EEC A;  2W9N A;  1WE7 A;  4YL8 A;  2RGF A;  3GOE A;  3QCA A;  3DBR I;  4BVU C;  3PTF C;  2CS4 A;  3ML9 A;  4HWI B;  5D94 A;  1CMX B;  1UH6 A;  2N9E B;  3C0R B;  3DPD A;  4MEL A;  4I6N B;  2EMS A;  2LJ5 A;  1WGH A;  1WYW B;  3A1Q B;  3IVF A;  3UQB A;  3LJ3 A;  3GZN I;  3A33 B;  4ANX A;  2K8C A;  4OVU A;  3ECI A;  2JZ3 B;  1R4M I;  4GU2 A;  1P1A A;  1ISN A;  4RMA A;  3SU8 X;  1TZ1 A;  2KZR A;  4FA6 A;  3ZO5 B;  3DVG Y;  4X57 B;  3AUL A;  4W9G A;  1RFA A;  3HHM A;  1WH3 A;  1ZGU B;  1ZW7 A;  2BF8 B;  4I6P A;  2CR5 A;  2CHW A;  2KFK A;  3DOW A;  1S3S G;  4MEM A;  3SHQ A;  4PS8 A;  1OQY A;  3ALB A;  3ZRF A;  1EF1 A;  1YIW A;  1WGR A;  2ZJD A;  1V80 A;  1UGM A;  2KK8 A;  5KHQ A;  2ZNV B;  4ICV A;  3PLV A;  4KDI C;  2RD0 A;  4ANV A;  5HKH A;  2MBB B;  2DZM A;  1P9D U;  1ZKH A;  2C7H A;  3PV1 A;  1WRD B;  2AL6 A;  2V4L A;  2C60 A;  3V6E B;  3UGB B;  1WJU A;  4MJS A;  2LVO A;  2OOB B;  3A9J B;  3H7S A;  2K6Q A;  2LXA A;  3DQV A;  3PHW B;  2KD0 A;  3K9O B;  4JL9 A;  1H8C A;  2BKR B;  3V6C B;  4DDI D;  1NDD A;  2MP2 B;  2ZPN A;  1K8R B;  1WXV A;  2MBQ A;  2HTH A;  4E74 A;  3A4R A;  4URK A;  4KZ0 A;  3VFK A;  3RYT A;  3U8Z A;  2FCM A;  1GG3 A;  1WX8 A;  2NPT B;  3OJ4 B;  4XX5 A;  1XD3 B;  2IY0 B;  2LAS A;  2L76 A;  3DBH I;  3HK0 A;  4LDT B;  4W9K A;  3TIX A;  1L2N A;  3EHV A;  3DCG A;  3RD2 A;  2KJH B;  3WAM A;  1KM7 A;  2KQ7 A;  4FHJ A;  4FJV B;  4BFR A;  2KX3 A;  2N7D A;  3AU4 A;  1U4A A;  4HXD A;  5JZE B;  5JHB A;  2DYO A;  4II3 B;  3MHS D;  1LM8 B;  1LFD A;  2MA9 B;  3UF8 A;  2I1J A;  3HM6 X;  2KDF B;  3JVZ X;  5E6N A;  1VCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...