1SJED

Hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjeD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjeD02
4DXFA 4C56C 1I4XA 2O2LD 1EWCA 1SXTA 1PTOF 3DWQA 3TSSA 4Z9CB 1XXGA 5ELBA 4RGMA 1SBBB 1XTCD 3BYTB 5D3IB 1DJRD 4OHJA 5ELEA 2RDGA 1YN4A 3MC0B 1M4VA 1BCPC 2AQ3B 2QEJC 4K6LA 1S5ED 1TS2A 3R8BA 3KLSX 1L0XB 4L6TB 1SE4A 3URYA 4NZLB 2R61A 1S5BD 1FD7D 2XNAC 3BYYB 1BCPD 5TSSA 1HTLD 1D5XC 1SE2A 1SJHD 1FNUA 2XN9C 1PRTB 1G8ZD 3BVGA 1I4RA 1V1OA 1SJED 2IPKD 2XRQD 1TS5A 1S5CD 2J4XA 2TSSA 1PZID 5D3DA 1STEA 1YN5A 1AN8A 1ESFA 4RCOA 1BCPF 5ELCA 3O13A 1CT1D 1LO5D 1I4QA 1QILA 2NTSA 2SEBD 4ZYSA 4L63B 1ENFA 1LTBD 1PTOB 1LTRD 5FK9C 2CHBD 1TS4A 1B1ZA 1EU4A 1EEID 3CHBD 5ELDA 1YN3A 1AW7A 1DYQA 1D6EC 3MFGA 3GP7A 1TS3A 1JWSD 1ET9A 2IJ0A 3BVMA 1KLGD 2G9HD 1KLUD 3SEBA 3BZDB 2AQ1B 1JQYD 4DXGA 1LT5D 1KTKA 3R2TA 1B44D 1D5MC 1CHPD 4TSSA 1JWUD 1LT6D 3EFXD 1UUPA 1JCKB 1FGBD 4UDUC 2NTTA 4RHRA 1V1PB 1F77A 4RFBA 1I4PA 4RGTA 1HXYD 1L0YB 1EFID 3R2IA 1LT4D 3EA6A 1I4HA 3DWAA 1S5DD 1CHQD 1EEFD 1BCPB 1LTTD 1RDPD 4RH6A 1ET6A 1SE3A 1RF2D 4RGNA 1PRTC 3BVZA 5ELFA 1PZKD 1BXTA 1FNVA 1SEBD 1LT3D 5FKAC 5I4DA 1PYWD 1HQRD 1T5XD 1HA5A 1D5ZC 1LTID 4RGOS 1EU3A 4BWGB 1PRTD 2RDHA 1PTOH 1UNSA 1PTOC 2QILA 3OWEB 1MD2D 2WV6D 1TY0A 1RCVD 2ICIA 1GOZA 3V05A 1TY2A 2AQ2B 1V1PA 1CQVA 1LTGD 3W2DA 1PTOD 1CK1A 2Z8LA 1S5FD 1PRTF 1JR0D 1JWMD 3DWPA 1PZJD 1I4GA 4O1NA 1FNWA 2XRSD 1LTAD 1LTSD 1LLRD 4RHSA 1RD9D
chains in the Genus database with same CATH superfamily
3H7PA 2N4FA 3G7LA 3KF8B 5C6AA 2CKHB 4JI4Q 3TSSA 3HOVH 4FDBA 2JUOA 3WIMA 2JA6G 2PI2A 3BYTB 4DV2Q 3L16A 2JYOA 4JL9A 3R7RA 4OGQC 3ZDTA 3NELA 2XWBB 2XVSA 4FF3A 2FCMA 3WAOA 1TKEA 3HEJA 4KZCA 2WIIB 3KK7A 1SMYD 3KFUA 3WOFA 4E3CA 4V0BA 2HIXA 2LGSA 3KLSX 2ZW1A 1TWFB 2R2OA 3GTKH 2JA7B 4MZ9A 4KY5A 1PH7A 1MGSA 2VNUD 2KN4A 4N6EB 5JVH3 1Q1BA 5H8YE 4NQKE 3OIQA 2L83A 1B9RA 4LDTB 2MX2A 4JI0L 2EXDA 4FYDA 1VRAB 4KGTA 1G8ZD 2PTLA 3NVVA 3TBIB 5CV4A 2KAJA 3QK0A 4A3KB 3TMEA 4BOSC 3SU8X 4CO7A 1KQSA 4DHJD 5BN5A 2KMCA 3K6OA 2J0KA 3VYRA 2NVUI 2J4XA 1TWGB 4FXCA 3UIOB 4FP5D 4ZKCB 4LNQA 2N1WA 1ZDXA 1GUTA 5E7NA 1KJTA 2KC2A 4HIKA 4JI5L 5FR3A 2ZT9C 4LUVA 4GS3A 5M3FB 1NSNS 3M7NA 1EQQA 2WXJA 5M3MG 1K0RA 3GD7A 3FKIG 1IW7C 2XSCA 2E5LQ 1WMHB 1MI0A 5IAAC 2WACA 4JVZA 2Q2TA 5KHOA 4XWTA 3A55A 4DV0L 1EY4A 1LT5D 1RFKA 2IBIB 3R2TA 5M5XB 4G7ZC 4HK2A 1PFDA 2HDLA 3CC7A 4L1BA 5DAUA 4IFDH 1E2ZA 1HR0W 1KFYB 1T0QC 3I3CA 1FL0A 3B6YA 2K50A 3OHXC 5FO8B 1XO3A 2L1AA 2EY1A 1TWHB 3W1YA 5AUIA 1ILPA 3EA6A 2EDGA 1XT9B 2L00B 1IUEA 1QZEA 1UEAB 3Q0AA 4CKBA 1N33L 5CC4A 3TP5A 3ENEA 2INPE 3QIJA 2R93B 4WRDA 1PZKD 5KGUA 1EUJA 4X66L 1B9NA 1WJJA 1GJXA 1MIUA 1T5XD 1Y8RC 3J81j 4W9CA 4GN4B 3VTVA 5DCNA 5KNCA 1XMOQ 3NK9A 5LLIA 1Y1WH 1JWAD 1WYWB 5CV7A 1YNJC 4K8IA 4DV3Q 1BNZA 1JW9D 2RDFA 2KECA 2MW5A 3R3MA 3VA5A 4WIPA 4IUNA 2UUCQ 1XMQL 3WWVA 1V1PA 2IDYA 4KJNA 1HZAA 4R4OA 4A3GB 2Z1CA 4OVZA 2NVYH 3CD6A 1PTOD 3OG5A 4HEDA 1N63A 3MHBA 1JWMD 5CX3A 4DR4Q 3D6CA 2BVCA 4MGZE 3ZRCA 2WXLA 4EEWA 4RM9A 3ZKJC 3BS1A 4C3IB 3HM6X 4IALA 2IW3A 1EIGA 4C1NK 1WTPA 2IHEA 2JXTA 3A8JE 2KO3A 2ZCCA 3ZXRA 4DXFA 3ZNID 1U4MA 3SFDB 2JYEA 4S17A 2F0WA 3U58A 3ZRFA 5GXGB 5MPOA 3FKIH 3J81i 4EKUA 3PF4A 1YJ1A 3MFYA 1M4VA 1V5OA 2KACA 4B3TL 3DQVA 2KVZA 2EY6A 5AEKB 1TS2A 2HCCA 5KIXA 2PJHA 1V2YA 2WDVB 2PO4A 5CV9A 4A3JG 1SYCA 1PXUA 3NBHA 4NZLB 1EF5A 4DV4L 3NRZA 4X3SA 1M94A 5NUCA 3I55A 1P98A 4JCVE 3NBIA 3HKZG 2L52A 1WE6A 4QY7A 4GNXA 1J6QA 5DLQE 2B2YC 1WE7A 1OO9B 1HNXQ 3CC4A 1EY0A 3H3VH 1P9DU 3I63C 4WAFA 4IUUA 3D4RA 1U4PA 4FXDA 1TS5A 4PQXA 1AE2A 2A6EC 4FLHA 4XGAB 5EE0A 2I2YA 1K3RA 4DR5L 1STEA 3I4OA 4LF6Q 4CBVA 1WD0A 4O42A 5FO7B 3NY5A 3SHQA 2KENA 4DUYQ 1K9MC 3RFZB 4A3IG 4OIKA 4AIMA 2LMCA 3U7ZA 1F2LA 2Q8RE 3K9PB 4MIUA 1EF1A 3CWIA 4YSZB 2WXOA 2WKCA 1P3QU 1RKNA 3EIVA 2WGSA 2I0QA 5M5YH 2A5HA 4LF9L 3BINA 4EQOA 3MC9A 4DV7L 4A3EB 1JORA 2N7JA 3BK1A 4JX1C 3OW7A 2K5WA 3S2HB 1UH6A 2F0VA 4H44C 5IY0A 3LNNA 2WAQB 3P7JA 1PH4A 3SEBA 1CSPA 1ISNA 1BVSA 5C2TB 4LDTD 4K3BA 2ONQA 4ARIA 1BF4A 3SK5A 1IL8A 2L15A 2EVBA 2Z6BA 3EN2A 3S17H 2MBHA 2PE6B 4DR3L 1BMLC 2WXIA 1TJEA 2NTTA 5L37A 4F7ZA 1I4PA 3D0FA 2A4ZA 1FJGQ 1L0YB 2CJOA 1DGJA 1NE3A 3A54A 5FO9B 2FUG1 3ZTDA 1FIQA 1S5DD 3G48A 4MTNA 3ZW3A 1K8OA 1RDPD 2EYPA 2F3WA 1SE3A 2B2VC 5I6YA 3BIID 4KGSA 2JA7G 4OVVA 1UF0A 4NXNQ 2WDTB 3WANA 2OXPA 2F0NA 2MP2B 2KWUB 4WWPA 1K8GA 4JC0A 2M17A 5JEAG 1FNVA 4FF2A 4JV5Q 2ID0A 1ZKHA 3KF6B 2KDBA 1OXUA 1PTOH 3PZ8A 4OWXB 5BR8L 4RCNA 2WB1B 2MP1A 1B7YB 2F0TA 4PG3A 1MI2A 1G6ZA 1V8CA 2DZKA 1D3ZA 4MM3B 1CI3M 2VB2X 4PZ6A 1SYDA 5JAVA 2LJ5A 3MXGA 4KY6A 1Z2MA 1HEZE 3L08A 4C2MH 5M3FG 2NB0A 4IURA 3C2PA 2PE9A 2K52A 1EWYC 3M63B 1XD3B 2YYZA 3BK2A 3S9WA 4QGUA 2KN5A 4IWQA 3MWYW 3K57A 1KABA 1HR0Q 1PDQA 1S40A 2K1BA 2PPBC 4W9HA 3H6MA 5IWAQ 4Y7NH 3UINB 4C56C 3N20C 4ZLTF 2O2LD 4DV2L 2RDBC 4HAEA 4A3IH 4USAA 3RYTA 1LABA 1U9RA 2X6LA 4B0MA 2M4NA 1XTCD 1HNZQ 1GG3A 4LJPB 4LNFA 1QVCA 1TKYA 4IUVA 3VXWA 1I35A 1L7YA 2KHIA 2RDGA 4JI7L 3J7A5 4RM8A 3JAMi 3MC0B 4AJWA 1E10A 2KJ6A 1IPGA 2HJ1A 3R66C 1XQQA 3R8BA 4L6TB 3VHTC 1YNJD 4YWKA 1Q5WB 4RMAA 4DXAB 3NUHB 4BY1H 2X6GA 5C4ZA 2XNAC 3I4NB 2R93G 4IFDJ 4TVAB 4B9XA 4YTPB 2RA4A 3S1RB 3NENA 2KOLA 1TWCB 1NMGA 2E2JB 2EY5A 1WI5A 4DV1Q 5E6PA 5G2NA 4LF4Q 3GTOB 2V4IB 3DWGC 3BY4B 1VQ7A 2PW5A 5ELCA 3K9OB 1C8CA 3PPAA 1YNNC 1QILA 3VH3B 4BKSD 1ENFA 3L2PA 1Q46A 1K50A 4HTHA 1VQ6A 4IZ8A 1U4RA 3HIZA 3HOWH 2JXXA 3VUXA 1GUSA 4YIJA 5ELDA 2FMCA 2K9XA 4EOYA 1T5EA 1FD6A 3AFQA 4CJ1B 4YL8A 4KSKC 4DPGA 4C3IG 5AZFA 1V6EA 2INDC 1JWSD 2KK8A 3PZDA 3CW2C 5FLMH 2QCPX 2BH2A 4HCEA 2O6VB 3BZDB 5EE3A 3T13A 2LASA 1JQYD 2VY3A 3NVYA 1JALA 1E2VA 3CRKC 4IJHA 4QF4A 2TMPA 2LI5A 1UUPA 1JCKB 2R3ZA 3VDZA 2D0OA 4ANVA 1JRUA 1GD7A 2L7RA 2WHIA 1H95A 2LVOA 2MPMA 3OSOA 3D6WA 4LCDE 4P73A 4YWGG 2ZPNA 3LGJA 2KDFB 1LM0A 1VQIA 1EFID 1QJOA 3AE1B 3NVWA 3W1SC 1EIFA 4GN3B 3IVFA 4I6NB 2GN5A 3LX0A 1TIFA 2A6ED 1XLOA 1BCPB 1IBLL 2KVMA 4HKZE 2BBCA 2H89B 2KQ3A 3M3YH 1PRTC 5ELFA 4OWWB 1YOVB 1IZ6A 4Q5VA 4DV5L 2INCC 3OYYA 2V3SA 1DD2A 4EQNA 1XMOL 2LJIA 2ZVNA 2NVXB 2ASBA 1XYIA 1J5EQ 4GZYC 2E2HB 2X38A 1OXSC 3DEPA 1Y56A 1CA6A 2UXCL 2O5JC 3CCVA 4GLSC 4E71A 2RQXA 4AQYL 3T4AC 1VQOA 1OTCA 3DVNV 3J81L 2O2VA 1RCVD 2IO2B 3HK0A 2KCTA 1KHIA 3NHEB 2YVCA 5AJ3Q 2PLPA 1FEHA 1PFSA 4RF0A 3IBEA 2YEPB 2R7ZH 2I5MX 2GLSA 5D65A 3AYHB 3PQIA 4ZUJA 4YSYB 1UGMA 1E0BA 5I2XA 3CCMA 3SK4A 4DKAC 2EQSA 1J7BA 3WAPA 1NY4A 2D2QA 5CHVC 3A33B 1IBXB 1WTVA 1EYCA 1Y8PB 3AU7A 2NZ1D 2L8JA 3OLMD 3JSVA 4IO9A 4NPNA 4L8JA 1C7YA 4HLEA 3S16B 4JIOU 4URKA 1MFWA 1BO0A 3KUCB 4FNFA 4KD3A 4RGMA 5ELBA 2UU9L 4B3MQ 3ZNHB 1DJRD 2K22A 1WGKA 3A9JB 4MSQB 5IT9L 1GHJA 5EBDA 4LFBQ 2A19A 1N32L 1T0YA 3MJWA 1Y14B 3IAM1 4K81A 1AH9A 4XC2A 4IWPA 1AZPA 1CKMA 4K5WA 3RZDH 2KLCA 4A3FH 2OQKA 1YHQA 3MXNB 4GKJL 3QHTA 1SAPA 3E56A 1HNXL 3H0GG 4A6QA 2SDFA 3I72A 2CW0C 4BBRB 1XCTL 1XEEA 2DYOA 3MXUA 3BVGA 4ZAIA 4WQOB 1KNEA 4A3CG 1SF0A 4OZCA 3GO5A 1FM0D 4LF6L 4IUMB 5K36H 2OTLA 4DUYL 3HOZG 2NN6G 4ILWA 5E1FA 3OTOL 4A3LG 4NW2A 2LXJA 5GQOA 1VQ5A 3TEWA 1CM9A 2K33A 4XTCS 3CPFA 2CHBD 3VYUA 2CU3A 2SAKA 2F0HA 2BF8B 1Q82C 4IM0A 1C1YB 3KLSA 4LF7L 3RNEC 3A1QA 3S24A 3Q6SA 2Z4IA 4KZ0A 2I5HA 2HD3A 2J52A 2UUBL 3GTKB 2OHFA 5KHQA 2NPTA 2KJRA 2ZXOA 4RA8A 2V4LA 2EMTA 4A9AA 2NZOA 5CORA 3UQAA 1WRDB 1ZKOA 4W9KA 2VB3X 1RJTA 1F0ZA 3VR2A 4P1CC 3M4YA 1YQBA 4WWNA 2NUCA 4BOZB 1R4MB 3K7AB 1AE3A 2IX0A 1DXMA 5C0XH 2W3RA 1CJEA 3MP9A 2NBWB 4TQ1A 2NN6I 3LWUA 4LNNA 5GAGC 4EZJA 4C3HH 3PIO3 1Z9FA 4YTNB 3GE8C 4HN7A 4WJNA 4NDXA 1CHQD 1WWTA 1X3GA 4RH6A 1QLBB 3H91A 4J8QA 3PV1A 1RF2D 3ABVB 1HZCA 1YNND 1CKNA 3RLFA 1HPCA 1ROEA 4C80A 4XWWA 4M8NA 1GXDC 1WXMA 3RD2A 4JI2L 3ZUNA 4AUQC 3G4SA 4ZRKA 1YX5B 2W9NA 4ANXA 1LTID 4QUCA 2ZJRA 4HXDA 2WDRB 5H92C 4AWJA 3Q6BA 2ZPYA 4ALPA 3HOYB 3RZFA 1R4QB 1IBKL 2VH2A 1WVLA 4WWMA 2ICIA 4A3OA 1MBYA 3HKSA 3JAML 4LF5L 2IYDB 2JT4B 1WCMB 3Q3OC 4UPAA 3DM3A 1EOVA 1QVGA 4FF4A 3ULLA 4A3MB 2N88A 5FJ8H 4LLGM 3MAQA 2JK8A 5H1SE 4Q0FA 1PRTF 1C4QA 1JR0D 5E4XA 1EZ6A 1WM2A 4MGKE 3S2AA 1GO3E 1I4GA 4ZHPA 3ER0A 2XRSD 4FULA 2Y0SE 3RZOB 2WAQE 1HUNA 4R4QA 2F0MA 4OW0A 2H88B 4ZRJA 3P42A 1C4PA 3HOZH 1RL2A 2OWOA 4OXPA 1YITA 4DF7A 4GXBA 1N36Q 1VDVA 2FINB 2DAFA 5HGQA 2K25A 4HJKA 2LGYA 4DUZL 1NENB 4DR1Q 1VQJA 4JI8Q 1MVKA 2JF5A 1STNA 3PMFA 3TREA 2HDEA 1G2SA 4KDLB 4IUPA 2C7HA 4I6PA 4R4TA 5AFWA 3GTLH 1SDFA 3T16A 5EAYA 4BKSA 5IYDG 2GI9A 4NJCA 4JI1L 4KVGB 1LTLA 5FOBB 1W2BA 3U7DA 3TMPB 4HRSA 3U4ZA 2KCNA 1QUQA 2QF7A 2A5UA 5BYSA 4M8MA 3BZKA 1WRIA 3IXSA 3DHHC 2K1FA 3T9LA 4JBWA 4WJQA 1WR6E 2KA7A 3R3OA 1IGDA 2XBBC 2MHJA 2X8XX 3HVDA 1BKBA 4WQMA 4GGQA 1F9PA 1JB7A 2EKIA 3DHIC 5J2RA 3PUXA 3HRZC 3SDZA 3ZNZB 2PVOD 1II3A 2QKIC 3KH0A 3D32A 4FF1A 1L6VA 1TQOA 2CQAA 3AE5B 1MJCA 2WB1E 3KJOA 2GB1A 1S5CD 3U2SC 3GTJB 3TS0A 2AX5A 2DZMA 4G50A 4K7UA 3S14B 2W82A 3Q3NC 1JMLA 4P74A 2JZ3B 3AXCA 1SNQA 4CDFC 3W5VB 1PFNA 3I9V1 3CCRA 4XX5A 1VZ8A 1DOXA 1AW7A 2N78A 4ZHOA 4L5QA 3NWTA 3MEHA 3AMUA 1S4ZA 2D2CC 4C4VB 4W9DA 1X3PA 4U673 2B8GA 3ZXVA 2BYEA 4GKKL 1YJ9A 1MKHA 4TV3A 2OT2A 1SNMA 3DHQA 1D5MC 2HE7A 1CHPD 1Y1VB 4ZKBB 2JY6A 5FLXL 4HSVA 2N9EB 2Q8TA 4IOAA 5GAEC 1PFMA 2N8NA 5IP7G 3U9SA 1I50B 4HIMA 1PH3A 3PHWB 4YY3Q 2FHTA 2EYMA 2CW0D 5KNDA 4K6DA 1XLNA 5G3LD 2LUEA 1CQFA 4A3PA 2N49A 1DOYA 3DWAA 4LFCL 4TQUS 3PO3H 1SN8A 3PLVA 3DBRB 2BPSA 4CHTB 4FVMA 1J5EL 4GDKB 2OF1A 2K5HA 2QMTA 2W3SA 4XT3B 1RLFA 2KCMA 3HS0C 4BBRG 5KRUA 1NBWA 5IYDH 2W54A 4WJ3M 1C9OA 2WINB 4HVBA 2L4NA 3BU2A 2J53A 3TIXA 4KN4C 1PTOC 4PMCA 2C9OA 5CBEE 1GUOA 1N60A 1HTPA 4AYBE 1OQYA 5EJWA 1SFOH 1SIFA 2UUAQ 3T3NA 5DPWA 3PF5A 1TY2A 3CCSA 1DOIA 3NJTA 4MSMB 1GJZA 2IO0B 5K5PA 1KDCA 2GOWA 4C7ZA 3H94A 1X54A 3PO2G 2KJXA 1TKGA 5CHWA 2GVAA 1WOCA 4JG2A 1L1OA 1K52A 4NP5A 2L05A 5AZGA 1R4PB 1PH9A 1HA6A 1WGDA 5CYUA 4W9FA 5L83A 2WU5B 2ICEC 1BBUA 2GMIC 3ML8A 3PUYA 2PI2E 4DFAA 1GUNA 4K0KQ 4PYUA 4W9JA 3HM3A 1ZUD2 1HZBA 2HQLA 1N9WA 1A3UA 2I1KA 2LFIA 2PQAA 1W6JA 3S1NH 2M9VA 1KOTA 2EOTA 2KTRB 2K5PA 2KHWB 1NAPA 2D10A 1EYAA 2D9UA 4EQ5A 2ZTCA 1WIAA 3IFWB 2EYLA 2DGYA 4LFBL 3KOJA 1R4NB 2ZW0A 3IFDA 1YN4A 2V3NA 3FILB 1EYDA 2PZTA 3ML9A 1A15A 4LFAQ 5GAHC 2DYMA 2E8GA 2DJFC 3TDQA 2HTHA 2MH7A 1S5ED 4GLVB 4KX6B 2IY0B 2KZRA 3KBGA 4GDLA 1KNAA 1B3QA 1TYGB 4WJ4A 1T0SC 5LMUL 1GC7A 2LHEA 5HHDG 1YMHE 2CHXA 2R61A 3TBLD 5IO9A 1FD7D 3F2CA 2N0SB 3DVNU 1JWBD 4PMBA 1I94L 2BWES 3L54A 2ZNVB 5C0XJ 4BBNC 4H13C 4ULLA 3HOXH 1K53A 4IUQA 2XRQD 3A0JA 2YU9H 3P75A 4PS7A 2IO1B 2CHZA 1SRUA 3HOYG 1XJVA 3QJYA 2LVQA 2HIVA 3Q2AC 1YBYA 1ZYRD 4DNTB 2QEXA 3S1MB 2KMMA 1WGGA 2WS3B 1LTRD 1WCMG 3OOCA 4F87A 1A3VA 3CF5A 1AFPA 2CFMA 4A3MG 2M00A 5IGCA 1R4MI 2K8CA 4W9EA 1H9MA 4DAYB 4A75A 4MT5A 3VAWA 3C1EA 4KHPQ 4JYAQ 2BS3B 1E6EB 1F9SA 1D6EC 5LL6X 4XDXA 4BS9A 3K5LA 3K58A 2KKCA 2A6HC 1EM7A 1N8RC 1FCCC 1E2WA 2O4XA 3SK6A 1ENAA 1V9JA 2KFKA 3G6EA 4GB9A 3CQZH 4R8NA 2EE1A 1BUIC 4KSLC 4BBSB 2NS5A 3OWFA 1I6HH 1WYDA 1Y69U 5C3WA 5C4XH 3V96A 3PO2H 2VH1A 4BAXA 1SYEA 4WORA 3RR5A 3GTQB 1K83H 2UXDL 2NVQH 4NNJB 4P16A 3NTHA 2WQYB 2JA8B 3V3XA 2KHJA 1LQBA 4LF8Q 1IGCA 4G11A 3K0XA 1STBA 3QWZB 1QVFA 1VQNA 2MBEA 5CV6A 1SLJA 4A3BB 3ECIA 3W1SA 3MTSA 1BXTA 1LT3D 2DY7A 2JA5B 1HQRD 1ICFB 2IHFA 3TEZA 4IW0A 2DWQA 4WWOA 3RUZA 1Z5SB 1ACCA 1X32A 3RNBC 4ODGA 5C4JB 4JBJA 1QNKA 5T1IA 1C79A 1RTNA 4KIKB 4X3UA 4BY7G 2KWDA 1VQMA 4KK7A 1JC7A 1ASYA 1MJDA 3HG9A 2A68C 2EYHA 2L32A 1R9TB 1Y8OB 4A93B 4QAYA 1N34Q 4BVUC 2K3UA 1YJNA 1FVIA 2KDIA 1RRBA 1F9QA 1I3QB 2VZKB 3IG3A 4HMIA 1PGAA 1FCLA 2JA6H 4DR1L 4GSWA 4JI8L 3M3YB 1SSNA 3AE2B 5IYCG 3NVZA 3UE1A 4QCLA 1I4XA 4JQWC 3GTMH 3E5SA 1PTOF 1VQ8A 1B2TA 4Z9CB 1WYGA 1D1KA 2FIDA 1FGUA 3DXJC 4A76A 5JHBA 3R93A 3K5MA 1WJUA 3KDFB 3M4OH 3A9KA 3V6EB 2DJGC 2YTXA 2I46A 2BDOA 2F4IA 4NXMQ 3NS8A 3I91A 1IYFA 2PIAA 4X62Q 1R7SA 4BA2I 2QEJC 1T6BX 4OX9Q 4X57B 4J3OD 3ND9A 5JJZA 3EGRA 4LNIA 1O7YA 2F0GA 2BS4B 1SE4A 5M5WB 3U4EG 1GNUA 2BA0A 4JI6Q 3WOEA 3B08A 3CIRB 2KHSA 3PGZA 1XNQL 1XTDA 4RF1A 4EGVA 4TMAB 3QIAA 3AEBB 4S0RA 3AEVA 1UEBA 2KX0A 5HGTA 4NAWB 4A8XC 3I4MB 3NZUA 1M8AA 4K8JA 1E8XA 2ZM6L 3AEGB 1F9JA 1H9JA 3J7AF 4UHVA 1YN5A 4PV1C 5M3MH 3EFUA 3VQIA 3U4VA 2NVTH 2FAZA 1LTBD 1WXSA 3L0WB 1HUMA 3VR4A 1TS4A 1WFQA 1WZ0A 1H9RA 2F0EA 4DR6Q 1LV9A 4EVOA 3PIPA 1EEID 3NP8A 2AYOB 1TWAB 2HD5B 3VRAB 1KIXA 1F2YA 2QA4A 1FXIA 3P4QB 4OWTB 4BBNF 3BVMA 4N8X1 1P16A 1TBEA 1FO4A 1FRRA 2N9KA 3DBRI 4M0WB 2WXNA 4BY7H 5LMNW 5EDSA 2RPVA 5EKKA 2CVRA 3ZLZA 2F03A 2MHVA 4A3DB 5IP9G 4R4IA 4II2B 4JI3L 1WD1A 1V80A 1HXYD 3DEOA 5DPSA 3VYTA 1ESRA 2KTFA 3AI5A 3GTPH 3E0JA 3D3RA 2E2IB 1K51A 1K28A 5IYCH 2E2DC 3CMAA 3NPPA 2KWVB 3AH7A 2F0JA 3LJ3A 2XK5B 4CKCA 1HTOA 3HP3A 4ZUIA 2JP1A 1Q1EA 2Y0SB 1PYWD 3CKIB 4X64L 5C3EB 1IBMQ 2AEHA 3U30A 1D5ZC 2Z4HA 4BWGB 2MGSA 3QJZA 3K7UC 1H9SB 2E74C 2UUAL 4HCPB 3RPFC 2A6HD 3L10B 3QC8B 4P1BC 4J6HA 5IGDA 1YIWA 4HROA 4DAMA 3V05A 3LDZE 5BMIA 3STBC 2DX5B 1CQVA 4L5RC 1R4NI 5DM73 5C4HA 4DK5A 2BE5C 1E7UA 1YX6B 4DWFA 2WXHA 4P71A 3DWPA 1KRHA 3CU7A 2D5DA 4C3HB 2G1EA 2QDBA 5KYIA 2WU2B 3VR9B 1LTAD 2VUMB 2OOBB 3QARA 2PVGC 4WJOA 3NHHA 2F3VA 4AP4C 2OEOA 3K0YA 2CH4A 1EFWA 1YJWA 1SNPA 4A3KG 1HFGA 5I9PA 4BBSG 1FPYA 2HTME 4JOIC 1K8AC 2JRIB 2RHSB 1LGRA 4ARCA 4OVUA 1A6XA 3B1LX 3Q8FA 5IGFA 2ZJDA 1YJJA 4B3SL 4J6IA 1L1OC 1D2BA 1GB4A 5IGGA 4A3JH 5E6NA 3ZNGC 2D5GA 1EY8A 2JQOA 1ONLA 1X3QA 4L5SA 1AWDA 2D3CA 1JOOA 4X65L 2NBUA 3I5JC 3ZTCA 1KDAA 4W9LA 1TT2A 3IL8A 2MBQA 4K7SA 1P8LA 3DM1A 4A3BG 1QE6A 1B70B 2DNFA 3GTGH 4X6AH 4V190 3GDEA 5IP9H 3PUZA 3MHZA 2PNRC 4JI4L 2JEAI 2A68D 2JA5G 4MJSA 4B3RQ 3T53B 3SGIA 1PV4A 3FMCA 1V1OA 4N9F4 2K14A 2L5TA 2PZUA 2TSSA 1YVCA 2LXAA 5D3DA 4LWCA 3M85A 1ESFA 3SXHA 2A1AA 3M4PA 4W9IA 2ACZB 3N52A 4NQLB 1Q0WB 4HDQA 3SR6A 4M00A 4DK1A 4JYAL 4KHPL 1RWSA 2FFKB 2Q2IA 4TKNA 1PH6A 2KNBA 2C9WB 3CHBD 2BB6A 2A8VA 1ZDVA 2A69D 5EPLA 2F0QA 5CTRC 3RNUA 4A93G 1ZGUB 4DR7Q 1SYFA 3AULA 3KBXA 2HT1A 3HHMA 1TS3A 3ZQ4A 3S15B 3BG3A 2K32A 1KLGD 5JVG3 2JSOA 2C60A 1O7IA 2INNE 2WX0A 3AFPA 4IJLA 2PQEA 4IQZA 4GOPB 4KGRA 4HJAA 1FXTB 2B2TC 4K14A 2K75A 2M8SA 4F8MA 2R2QA 3ONSA 4GU2A 1AP0A 4H2AA 2DZIA 1TWFH 1I7HA 1I42A 2ZXPA 1UGJA 5TR5A 2JA7H 4AYBB 1F52A 4AJYB 2R6GA 2KQSA 1VS0A 3L7ZC 2X69A 4A3GG 4LK0M 2E5LL 3KLWA 3X3NA 5JEAH 3O65B 1O7ZA 1LTTD 1STYA 2K5QA 2KFJA 5CV5A 3NQTA 3RCZA 1T3QA 3BVZA 4DAPA 4A3KH 1HFNA 2EJMA 5EBCA 3PRZA 3H7PB 1LUZA 1VMPA 4O2DA 4P72A 4EX5A 1KC8C 1TWGH 4DA2A 2NR2A 3VDYA 1XNRQ 1GC6A 3W5UB 2PCFB 2RF4A 1M1KC 3FPUB 3I4MG 1EU3A 1V43A 5JOBA 3P1MA 2XGTA 5M3FH 1RHPA 2UU7A 1L2FA 3GV3A 3Q24A 1J9OA 2WV6D 4HR7B 2ZJPA 3RN2A 2CS4A 1WR1A 5IP4D 2EZVA 3I70A 5G5HA 5EE9A 3ZVVA 5LMNQ 2J7QB 2QC8A 5AUKA 3I56A 5F2DA 2RPQA 4IM2A 5JZEB 2GRIA 2M1MA 2EYOA 5M5XH 3CCUA 2R92B 3K59A 2BGFA 4K5XA 4HJ5A 3H7SA 3HRDD 3VTWA 4DK3C 1QQRA 3QCAA 3NTIA 1CZGA 3DWQA 3HFZB 4DK0A 4DV3L 1SNOA 1NTGA 1G6PA 1XXGA 1VD2A 1TWHH 4JWUC 4NY0A 3RUIB 4IPDA 3TJPA 3I90A 3TEYA 3I7FA 2UUCL 1NMFA 4PZ8A 4X62L 1J8IA 2RHQB 3A8KE 2QSDA 3T1YQ 2V3PA 2B63B 1EIHA 5JJLA 3A7LA 1IKMA 1NI3A 1E7PB 1Z6HA 3TN2A 2R93H 3DCGA 1STGA 2DBYA 1K8MA 4DR4L 3G6JB 1VQCA 2BYTA 3CSFA 1EIYB 1XF5L 1VQ4A 2Y3AA 4HJ8A 4JBMA 3ZGZA 2RGFA 2K04A 4A3EG 1T0RC 3STBD 3P2BA 3P20A 1WGHA 4QIWE 4XT1B 4C3JB 4ACFA 2AWNA 2EMSA 2Y0SG 1PRTB 2BE5D 3BDLA 2WAQG 5C3EG 2JX5A 4NAMA 3CC2A 3DUZA 4KJOA 1H8CA 1Q8IA 1SJED 2IPKD 3AE8B 1Q12A 3BWUD 3KF8A 2HJ8A 1ZW7A 4A3GH 3UDGA 1QZHA 5BN3A 2LKVA 2DZJA 3DHGC 4WJPA 3S1QB 3O13A 1XPOA 1M90C 1I4QA 4DR6L 4FJZA 2FXQA 3H6NA 5J18A 2E75C 5FK9C 4MELA 1WTHA 4ME5A 4C3IH 1Q86C 2KX3A 2Y5BB 3HOUB 1WGYA 4MHEA 5C44B 2HHHQ 1WSPA 1YN3A 1QOHA 4C7YA 2CKZB 1AYFA 3AE6B 3MFGA 1GUAB 3HZXA 2PYKA 1BQQT 2RBMA 1WJNA 3GP7A 3DPDA 2J0JA 1YNXA 2J0TD 2EIFA 3D4WA 2VUMG 1UWMA 2E76C 4ICVA 4P6VF 2EY2A 2L3ZA 3VTUA 2CR5A 3QO2A 1K73C 2AQ1B 3HGBA 2G4DB 3GZNB 3RMHA 1A70A 1B44D 2I38A 3N1XC 2WYQA 5BYQA 1PHJA 1TZOA 2D07B 3CCQA 1V1PB 3NTKA 2WB1G 3Q3MC 2YU9B 2F0LA 2K4KA 3E3XA 3HOVB 5T8IA 3J7YW 1QT9A 4RKLA 3QG1A 3KQ4A 2IZVB 2F0KA 4LJOB 1WTOA 1KF6B 4QB4A 2MSED 4EUTA 2FCSA 4US9A 2SNMA 1D7QA 2I07B 4DV6Q 2G5DA 4M02A 1WMHA 3E9IA 4WURA 3ULJA 5J22A 3Q8BA 4Y52H 4XDDA 3CCJA 2LEKA 2F52A 1L6UA 3I3TB 4MDKE 4L5TA 3AEDB 1SROA 1FJGL 1OXTA 2B29A 1NBFC 2KXJA 3C46A 4QQBX 2C7NB 1UD7A 1X3FA 2EYFA 2JA9A 4HIDA 5IKCM 4A3EH 1XLPA 1IHZA 3NBHB 2Z6KA 3S2HH 1YHAA 4NXNL 2UXBQ 4IWOA 3TL5A 3NE5B 3CXCA 4GNXB 3I4NG 4JV5L 2PMVA 4ANWA 4RHSA 1YZ6A 1RD9D 2JZPA 4NPSA 3V6CB 3I4LA 4TRDA 5LNK1 5CV8A 2O6VD 4HSPA 3RNFC 4NJ7A 5GROA 1X9NA 1X65A 1SBBB 4FA6A 2ZXRA 5D3IB 2LMCB 3B0AA 2CJNA 4Q2JA 3IRBA 4DAVA 1F2MA 4AYBG 2WKDA 3I2ZA 1ZPSA 3GOEA 4AS1A 3H0GH 1HR0L 4OO1I 2BKFA 2SNSA 4CDCC 2DN8A 2N9PC 3PRMB 1SE9A 1O7LA 4A3CH 5IWAL 1BCPD 1F2ZA 3MVVA 1C76A 4HDOA 1BDOA 4BXXG 1ASZA 4MNOA 1ZYRC 3BDCA 4OELB 3VUWA 3IFTA 2NN6H 4IUTA 5C3XA 4BZAA 4A3LH 4POGA 4UAIA 2C5LC 3IKJA 1QOBA 1XCQL 1HNZL 3RD4A 5D6JB 3QOJA 3P4SB 2LXKA 3RMKC 5JEAJ 1YHBA 2OJRA 2H1EA 2HQEA 4RCOA 1C4CA 2EKEC 2MA9B 2QIEB 1LO5D 4ZYSA 2BH8A 2Y5CA 4KV6A 1S1QB 1Y1WB 2FNJB 4LUOA 1A62A 2K7VA 2G45B 1U5KA 4DR7L 2L1BA 4HPPA 1DZ1A 1QCBD 5LXIB 2DNCA 2QGQA 4IPCA 4RWSC 4KKSA 2D3BA 2Q5WD 4YT0B 2JEBI 1FFVA 4GN1A 3KJPA 1SSOA 2MNAA 2CCZA 4S3SA 5E6JA 2NVYB 3ERSX 2R92G 3S2DH 1DOKA 2F0OA 1B53A 3BJUA 4DV1L 2AUJD 4XXEA 2LWPA 4FJVB 1KM7A 4JE3B 2J7ZA 4KMUC 1RIPA 2AUKA 3C1FA 4X66Q 4LF4L 5BMGA 2DYBA 1LT6D 1VQKA 1VQFA 4CJ0B 1NCVA 2IO3B 4NB3A 2Z0DB 3K5OA 2B63G 1TKWB 4DQOC 1YI2A 1XPRA 3PGEA 1PYBA 1F1HA 1YQ4B 3R2IA 1LT4D 2LS01 1E8ZA 3I4NH 4NJ6A 2MCNB 1QG7A 3FKIB 1PDXA 4B95A 2PMZE 3S1RH 2PEAA 1EL0A 2BWFA 4GMVA 1TWCH 4ME3A 5EKLA 2E2JH 2WXRA 1YQ3B 1DM0B 5IYBG 1QWYA 4FADA 4C3JG 3MJ5A 3GTOH 5G3LF 1UBIA 1XLQA 1VF7A 3J80c 3Q8AA 4IOCA 1EY7A 4PZ7A 1J0GA 3RNGC 1B3AA 1UNSA 3CMEA 2CHWA 1F2RI 3FRPB 1UWVA 4R1JA 2AWOA 2FCNA 3VR8B 3QOLA 1L0WA 2ZTEA 1WZ3A 3H09A 3KWLA 4MEMA 1E5WA 2B2WC 3ZJYC 3PS6A 3RT3B 1J8CA 4LNKA 2EYJA 1TT5B 3W2DA 3HOUG 1MSGA 3X3MA 2D11A 5HY6A 5C44G 4BKTA 1S5FD 4DDGD 5J17A 3ICEA 1PVOA 3OJ4B 4HIOA 3ALBA 3J9CA 4XZ4A 3UF8A 4O1NA 3KUDB 1ZOYB 5GMVA 2OTJA 3J80E 2RSUA 2H5XA 5EGTA 5JHAA 1LLRD 3D8GA 3FHWA 2KCCA 2KD0A 5M5YB 2MP2A 1L2NA 4XYOA 1KD1C 2LD9A 2FBWB 1SXTA 1VQGA 3SHLA 1VJKA 3DBSA 3KF6A 5DEHA 3PCOB 5AJ3L 1SIJA 4OHJA 3WCQA 1P1AA 4DR5Q 1QOFA 1NNXA 3S17B 1HQMC 2AQ3B 3TS2A 2RR9A 2V1YA 3AM9A 4ICUA 4GN5A 4MM3A 2ON8A 4JOIA 3NS1A 2IGDA 2NCNA 2Z9HA 2KQ7A 4PYZA 3ZJTA 2NVXH 2E2HH 3B9JA 3AU5A 3T56B 3N6RA 4YWMA 4C1NI 4EQPA 4DV7Q 1VQLA 1FNUA 3IAYA 1MPEA 2GBJA 3KLRA 1Q81C 1MHWC 2JQRB 3GS2A 4TUUA 1VDZA 4LK1C 4I7AA 4XQJA 2QHOA 4EE2A 2HCIA 4B3ML 3AEEB 1BUVT 1MSHA 3UI3A 5KNBA 3A8IE 3PUWA 4I65A 3GZNI 3VR6A 1A3TA 1E1TA 5CBAE 4DR3Q 1Z7TA 1N61A 1PTOB 1PH2A 5J3BA 2KDEB 3GB1A 3X23A 2VS1A 3KVFB 1ILQA 1I5FA 2LXCA 5D94A 3M62B 2F0SA 2ZTDA 3LYYA 4CJ2C 1SGHA 1STAA 4XYCA 2XTIA 2OEDA 1K3BC 1HE8A 4C2MB 4IG7B 2L76A 3S16H 2LRWA 4L23A 1V86A 2RD0A 5IN7A 3CF6E 3U9OA 5A2QE 4P75A 2JJQA 3L13A 3OJ3A 2DENB 2C35B 5IP7H 1EZ8A 1TXYA 3NOBA 1HH2P 1SE8A 3E6ZX 1BBWA 1HJPA 2N9XA 3AECB 2WP9B 2J42A 4R9WA 5IGBA 1G6JA 1WI0A 1EO6A 2O2VB 4ZCKA 4Y7NB 3PV0A 1EY5A 5C23A 1VQDA 4PNYA 3P1HA 1N5WA 3NEMA 5BR8Q 5GADC 4A3IB 2RVLA 4CYEA 4IFDG 1E8YA 2CWAA 1I4HA 2B2TA 4ANUA 1V5TA 3CMMB 4DV6L 1C0AA 4BBRH 2REXA 4RGNA 1I6VC 5EPKA 3BZCA 4FHKA 3M7GA 1JOKA 2K8HA 3JSVB 3ZIMA 4X3KA 3DWMA 2RSOA 3M95A 3UDXA 5DM63 1EUVB 4BY1B 2B3GA 3Q23A 4HKQA 3E9SA 1ML0D 2O6VA 1D1IA 2XIWA 1QB5D 3NXWA 3A4SC 3QQ8B 3NUCA 3A5UA 1HTQA 1TU2B 2FJ2A 5CGKA 4B9WA 2BYVE 1X55A 3ND8A 5BYRA 3IT6B 3ONAB 1KL9A 2LY7A 1GOZA 1UBQA 4B0EA 3NQIA 1Y1WG 2H4OA 4JI7Q 1PQSA 2UXBL 3U8ZA 1D8LA 3LWEA 1CK1A 1CMXB 1CA5A 4IFDI 1MG8A 1PZJD 3ZO5B 3L17A 2JWUA 1PH5A 3HOWB 1WX7A 3IT4B 3VUYA 1CKOA 4G4KA 2VW9A 2Q8IB 2WXPA 4OIJA 2WP8J 1OXVA 1U4AA 2HDMA 2GBRA 4YSXB 3VYSA 1OXXK 1QNUA 1C77A 4QIWB 1EWCA 3K7AH 4IM3A 3PREA 1PYSB 1U0LA 2ALYB 2Z6KC 3LXFA 1TVXA 3OW2A 1A0IA 4G0NB 2VXWA 3D31A 1OFFA 2MRPA 2KEDA 3QR8A 1VQHA 4RG1A 5G5GA 5ELNA 4QMGA 1KAAA 3DDCB 1WTWA 4HCSA 4UP8A 1GAQB 2A74C 1PGBA 3A1QB 2ZCBA 4K3CA 1U4LA 4E74A 3UE0A 4F7XA 3E0EA 3RZWC 3TZDA 1XPUA 2NPTB 2NMQA 3J7AV 3HVZA 1JICA 1N36L 3AV8A 1B9MA 4CGYB 2XN9C 2WXFA 5C1ZA 3HOYH 3EHVA 4F8CB 1IBXA 1WXVA 4JK1C 2FCQA 2M19A 4OZAA 2EJGC 2XWJB 4ZRZA 3JVZX 1WTRA 3EECA 4O0AA 4IN3A 1Y1VG 1WCMH 1PZID 3UGBB 1N62A 4A3MH 1F9RA 3B2FA 3KW5B 2A69C 3Q3JA 3T1HQ 2NTSA 4AQ7A 2KBNA 4BKGA 4L63B 3PLUA 2G9DA 4PS8A 3A9JA 1C78A 1WJ4A 1WX8A 3RZOH 2LHDA 2KMAA 3OIPA 3PSEB 3Q69A 1CZWA 3ZJUA 4D2KA 5IODA 4KV2A 1PH8A 1X3EA 1CKNB 1EY6A 4KKTA 4XE0A 1DYQA 1XWEA 3VA7A 1ZE3D 3Q14C 1X56A 4LAAA 1IBLQ 1B8AA 3TCAA 1QF6A 2R7ZB 1NDDA 3MXNA 1XX8A 2Q2UA 1BR9A 1KDBA 1V1QA 3AEAB 5JJKA 3I57A 5LHY1 4DV5Q 5C5LA 4G3XB 1YNTE 3CCEA 4L2YA 5E4WC 2DLBA 2BDNA 3C0RB 1WF9A 3MXPA 4ZRQA 4G57A 1F77A 4RFBA 2VQFQ 2UXCQ 3C3LA 5CHFA 4DBGA 2DY8A 3APFA 4AQYQ 4YCWA 1PUTA 3A56A 2VQEQ 4DR2Q 3H3VI 1OTRB 3D4DA 1KRSA 1NR2A 3MEFA 1QOGA 4JW0A 1L4DB 2BQQA 4J1MA 5IOIA 2K28A 1MJEA 2KC1A 4K1RB 4OEMB 2KVRA 2KT7A 1JE4A 1SNCA 1AARA 3RZDB 3GTJH 5M9OA 4A3FB 3SVMA 4DNIA 1NJIC 2VRRB 2I1JA 2RMMA 1UE7A 3S14H 3QA8A 5C5MA 4RGOS 5I2YA 5HI1A 4N9TA 1CSQA 2RDHA 3PHXB 2M2LA 4YY3L 2QDFA 2F0IA 4ASWC 4UY8C 1HNWQ 2EPBA 3ITPA 1UZXB 1KLVA 1EYGA 2UU9Q 1STHA 1QUQB 1ZEQX 1YD8U 1WTQA 2M0XA 2PNHA 4POFA 3VH4B 4ZYNA 2K39A 2Z8LA 1YEZA 1N32Q 5EPJA 1S3SG 2F0DA 4YCVA 2JXMB 3T3OA 4KI0A 3ZYYX 2PW7A 2JRHA 4G7HC 2QDLA 1AEXA 4QJFA 2MEKA 1Y1VH 1LTSD 1NI2A 2MQJA 3RN9C 4NMZA 4GKJQ 1IYVA 4HCNB 5JXVA 1GPXA 1S72A 1WXAA 4A55A 1I50H 4CQNA 5JH5C 2EJFC 4YWLA 1WY8A 1A5RA 4M01A 3UIPB 1CFMA 1OEYA 2V1CC 3MTNB 4KY7A 3APDA 1HCZA 4KN7C 3CP0A 1JJ2A 5ELEA 2F1MA 3PUVA 1QZGA 2LGXA 2K03A 3OTOQ 4WAAA 1AZQA 2K6AA 4UP9A 3DLLA 3EBEA 4YXDB 1L0XB 3P4PB 4MACA 1ZXTA 2XEWA 3ERQA 1VLBA 5TSSA 4K0KL 3AU4A 4UP7A 1Q1OA 4LF7Q 1HTLD 1D5XC 1J7CA 2FIFA 2YTYA 3QWNA 3FEWX 2LUMA 3EJIA 2K01A 2UUBQ 1H9KA 4BY1G 3NWSA 4YCUA 3MHSD 3AMZA 1K0SA 2D3GA 2ZVOA 4KKUA 1RYJA 4LFAL 3K5NA 1Q90A 2SEBD 3C8YA 1OQQA 3FPPA 4RMFA 4LMQD 4A20A 3JYUA 1C9FA 1V49A 2GBKA 2RCFA 1P7FA 3FVQA 2SOBA 1B1ZA 2BS2B 2KOXA 1ZXHA 2JA8G 1VZ7A 3F2DA 3L4PA 3H0GB 2PMZB 3HOWG 4JGHB 4RNAA 1EQVA 2MJDA 2C5CA 1Q8KA 1GVPA 2ES2A 5DPTA 1KLUD 2L0TA 3W9CB 4DXGA 2VZKD 4JI2Q 1IW7D 1KTKA 4A90A 4A4IA 1O80A 4TSSA 2N9LA 4DN4M 5FLMG 3HOZB 5D7GA 3PZ7A 1N5XA 2WXQA 4UDUC 5IIFA 2I5LX 4GLXA 1NEKB 4RHRA 2FUHB 1PMRA 4RGTA 5A35A 2P5ZX 2K8BA 3SFEB 1IBKQ 2IL8A 3V2TA 2IT1A 2NYZD 4LF5Q 4K2LA 3GTLB 2BYFA 1L1OB 1G91A 3TEXA 2WLBA 4FHJA 1EEFD 4ZK9B 2ENBA 1ET6A 1FRDA 1L5PA 1V97A 2DHZA 2QCZA 3PRPB 4GOPC 1KH0A 4MGIE 1S3OA 1W3SA 1UAPA 5CR3A 1Q10A 4N58A 4C00A 2PQAB 1SEBD 5FKAC 5I4DA 4C4VA 3TUOA 2B2UC 4APVA 3S2DB 3S1MH 1HZ5A 3RULA 4FXKC 1JJGA 4N59A 3IAS1 3QX1A 3J80i 1GB1A 2L55A 1KXLA 4IPHA 3TQYA 1EWIA 4DUZQ 4HJ9A 1NYRA 3OWEB 4XQNA 2JPHA 3CPWA 1UELA 1MD2D 2MJ3A 5KEEA 4YHHQ 3DVGX 3QB3A 1OEYJ 4GDLB 2IX1A 1P0RA 4LF8L 4JI1Q 1LTGD 2AKWB 4WJWA 3PIP3 2YTVA 3FP9A 3P63A 3T8MA 3HKZE 4QUFA 1WJ6A 2KANA 2L9HA 2K0PA 1FNWA 3KUPA 4BFRA 2R7ZG 2B2WA 4BBSH 1ICWA 1G291 4M8AA 2WFWA 1E22A 4GDKA 4E6IA 3J7ZC 3RNCC 3A5ZB 3HUIA 3W1BA 2HUGA 3GTQH 5G55A 4CDDC 3RN5A 1VQBA 4GIVA 2VZAA 3F2BA 1GHKA 1TR5A 2JA8H 3TZUA 1Q3LA 2JVCA 1BCPC 4DHZE 3H1UA 3CSTA 1BT0A 4AH6A 4H7BA 3PIOA 4A3BH 1H4RA 2GBMA 5HG2A 1IKLA 1HRJA 1N34L 4TQ0A 4H0LC 2K5VA 5BN4A 3IHPC 2JA5H 1V81A 1EQTA 3GQBA 1F2RC 3R7QA 2CH4W 1S5BD 1BBXC 2JE6I 3VR3A 1FFUA 1UWXA 5HURA 2KFKB 2NBVB 3TP7A 2ASQA 1OGWA 3N32A 3PTFC 3PO3B 3M9BA 2BW2A 2B3AA 5C4JH 2LZ6A 4A3FG 4ITKA 4OONA 3U50C 4WFN3 4GKKQ 2BB5A 4DK6C 4DDID 4KDIC 3T1HL 1IYUA 4CKEA 2MO0A 4A3DG 3ZDMC 4NXML 2QJLA 1AN8A 4KHVA 2KTRA 4JLCA 2CU1A 1CT1D 3KYCD 4FN2A 2F4VQ 2A73B 4OX9L 1E1OA 5K36G 1R9TH 4A93H 2PZWA 3FILA 4KD4A 3A4RA 5IOCA 3DBLB 1SFOB 3OPOA 1I3QH 4RAUC 1EU4A 2IX3A 3K80C 2D0PA 1DOMA 4N9PA 5ELOA 4JI6L 2YLMA 2R7DA 3AEFB 2UYZB 3M3JA 2ZEQA 2N7DA 4LFCQ 1RTOA 2BCOA 2ZZPB 4K2KA 3AE7B 1L0VB 2BTEA 2F0PA 2B39A 3UDFA 5IE8A 5FR6A 2KJHB 5DPRA 1CTMA 2M0AA 2G4SA 1G51A 1JWUD 3EFXD 2QW7A 2VQFL 1IXRA 2N7EA 2PKOA 4CDEC 1PH1A 4XDCA 3VRBB 5CMDA 2VQEL 4ZQ3A 4DR2L 2JSVX 1QKZA 3Q8DA 3S1NB 2LVPA 5M5WH 1B4OA 4JBKA 1TTNA 2GA4B 5C3JB 1JOQA 1HHVA 2E3TA 3T51B 5C0XG 3Q8CA 2RCNA 4FO2A 2LGIA 4DAYA 3BDOA 4C3HG 4IDIA 3I4MH 4HPLB 1WTXA 1KAWA 4EZLA 1HNWL 3OAWA 1TGZB 3GV6A 3FKYA 1E8WA 2WWZA 3A9KB 2F3IA 3DMUA 3PT2B 4FJYA 2KEEA 2L0CA 1W6KA 4QL5A 1SB3C 1DCZA 3MZ5A 4XQQA 3HOXB 1L4ZB 1E24A 3DBHB 1TWAH 1WFYA 2M56B 3AB5A 3SR1A 3QAQA 1SNDA 4ABNA 1UE6A 3EQLC 3AE4B 1QOAA 1LACA 4JWSC 3TP8A 3X0WA 1E0ZA 4US8A 5FJ8G 5LMUQ 3SDLC 5C0XI 1IBML 4A3DH 1J19A 3W3AA 2PPHA 4IPGA 1NR4A 2ZJQA 1I94Q 3P4RB 5HFYA 5I6WA 3I8ZA 3SK8A 4KKIA 3J81c 4PK1A 3H15A 3WALA 1N6ZA 3PO0A 3CQZB 1T9HA 3A7AB 2K6QA 5AZHA 2E2IH 3KYHC 1I6HB 2KDMA 4OO1G 1EY9A 4KIKA 1A63A 2W55A 3Q8EA 2K05A 4K6LA 4GNXC 5C4XB 3EFCA 3PO2B 4FBJB 2E6XA 1IL2A 1DONA 3AB9A 1K83B 5J1ZA 2AWTA 1JE5A 5C3EH 2IGGA 2NVQB 1WXQA 2MBOA 2N1VA 1SE2A 1SJHD 3M4QA 3U52E 1JQ4A 2K5DA 3F2UA 1EWHA 1VCBA 2FMMA 2D3AA 2WX1A 4I6LB 3J81E 2BKRB 5E3FA 2MO1A 1I4RA 2NWGA 3F1ZA 4XYQA 1K8RB 4FXGC 1VQEA 4JI0Q 2IWHA 5J39A 4II3B 4W9GA 2IY1B 3ZJVA 2Q2HA 2D62A 2OCEA 1A2UA 1PA6A 1SYGA 5IT9c 3C19A 2BA1A 3N1ZC 1BCPF 1E3PA 5IGEA 4HPMB 3N3KB 1DGSA 2LGDA 2WXKA 3I73A 3KDFA 4LTUA 4MGYE 1SYBA 4EFOA 2LSSA 3UI2A 1YIJA 1DOLA 1RFAA 3SE0A 2VUMH 2UXDQ 2KQ4X 4JI5Q 1ENCA 1ZP0B 2L12A 3KUZA 1HZ9A 5HKHA 3NZSA 1V8QA 4OL7A 4ZRIA 1RM6C 4B9KA 3JC66 5EQ0A 1G2TA 2MWSB 2WDQB 5IA7A 4B3RL 1VR9A 4KTAA 2MBBB 2JYTA 2G9HD 2EXZA 3L9AX 5IT9E 2Z0SA 3AE9B 3GE3C 3W1GA 3J80L 4ID6A 1MG4A 2YEPF 4NAWA 4DV0Q 2JA6B 4P7IA 1FGBD 1NVID 4G7OC 4P2CB 3GTMB 4KKJA 2EELA 3Q22A 2BOSA 1E7VA 1WM3A 2L0FA 3JW0X 5BMHA 3FAHA 3M4OB 4F1SA 2DAJA 4PS3A 4I7ZC 2CQOA 1V9PA 3RLOA 2F0FA 3SD5A 1NUCA 5DNFA 2IY5B 1D4BA 1A8VA 2CWPA 2L11A 1N33Q 1JJCB 2KUMA 4JPSA 3PO3G 1C48A 2AL3A 1UE5A 4R8IA 4HWIB 4REZA 3EROA 3WA0A 1GUGA 4PT5A 1SMYC 4M0WA 3RNAC 1PRTD 4OO1H 2F0UA 5LL6S 4YHHL 2QILA 2K5NA 1ZXIA 2AHOB 3L3OC 1PFBA 2LFNA 2AL6A 1WGRA 4MTKA 3DVGY 1JB3A 3AQQA 3CAMA 4GLAC 3CCLA 3N1YC 3H8HA 2KLGA 5D2MB 3Q3FA 4ZDVA 1BOSA 1XMQQ 5M3MB 1NYQA 5E6OA 3S15H 3CRLC 2NVTB 3WAMA 3PSIA 2OJWA 4CHKA 3MC8A 4K7WA 4IOIE 1VF5C 1VQAA 4B08A 1VZ6A 3VVWB 1XNRL 3N30A 4MJSB 2AMCB 2Y5PA 3ETRA 2OQ0A 4HMJA 1XNQQ 1FYCA 1UE1A 2XK5A 4IKGA 4MH8A 4DHJB 5EKIA 3H3VC 4LJZC 1KRTA 4PMWA 4K5VA 3UDIA 1VQ9A 1LYLA 1PLFA 4KLKA 2Z59B 2LRUA 5A2QL 5JJIA 3JAMc 4BY7B 1H9SA 2ZM6Q 1JMCA 2B2YA 2NZHA 5LMNL 2MUYA 1FR3A 3VFKA 4XIGS 1SMXA 2V4DA 2DUDA 1Q7YC 5LXHA 3A74A 4LUZA 3N9YC 4BXXH 1EOTA 3AN1A 4B3TQ 4GOCA 2Z0EB 1A2TA 1TIID 4KHZA 3URYA 3DBLI 3BYYB 3GTPB 3TP6A 1P7EA 1E9MA 3PVLA 3OMGA 1X6OA 2MJ8A 4DV4Q 3KYDD 2JN4A 1MHXA 3E9HA 2RSNA 3JAME 2KYWA 3T1YL 4DNRB 2F4VL 3FDTA 1J7AA 5ISRA 1RAXA 4JPBW 4B6WA 3HOXG 2BT6A 2IGHA 2O5IC 2PW9A 4JI3Q 3WDNA 3HOVG 1GUWA 3MA2B 1PGXA 2MJEA 3DOWA 2V0GA 1HZ6A 2R92H 4OZBA 2WXMA 1E7ZA 4DGZA 1FXAA 1C3TA 3NG0A 4MH0E 3H9DA 1OQRA 3APCA 2GVBA 3V60A 1EQRA 2N55A 1LM8B 1Y8NB 1WH3A 4BA1I 1C4AA 2V9HA 3EUB2 2FE8A 1VQPA 4LF9Q 1ET9A 1SR3A 2IJ0A 4H02A 3F8TA 2ATWA 1X1MA 2YV5A 1IYJB 4U68A 2R7FA 1Z47A 2JWZA 2B2VA 2B63H 4RKBA 1CZPA 4N8FA 2MLBA 4X64Q 2JZZA 2J0MA 4LW1A 4R3DA 3L0OA 4TKOB 1FMAD 1IP9A 3FC4A 1LXDA 4R4CA 3EC8A 2JU6X 1JRPA 5EE1A 4F88A 3TEHB 4DU9A 1E90A 2HHHL 2B8FA 1WX9A 5C4XG 4AOFA 4HJGE 1VCIA 5IYBH 1JROA 5JPNC 3DBHI 3K8AA 4C3JH 1O78A 1GM5A 3KWVA 4IC7B 1YJIA 4A3JB 2B76B 5BO4B 2MFIA 2ZNVC 2K6DB 5L95C 3HKZB 3VR5A 3AE3B 3NZ3A 4J15A 4WH4A 3UQBA 1MHHE 2NBFA 2MQHA 2WXGA 5T1GA 5JPMC 1HA5A 3S1QH 4ZRPA 3RI7C 5FLXc 3NSWA 1JT8A 1RODA 4GOPA 3GTGB 1TZ1A 4NKLA 1B50A 2WNMA 4M1UB 3TRZA 4LNOA 5D14A 3OMCA 3HOUH 3LB8C 1TY0A 5C44H 2RKSA 4ZOHC 2GBNA 2N3SA 2AQ2B 2B2UA 5COYA 4B3SQ 1VMCA 2VL6A 3EVQA 4YTMB 4X3TA 1LFDA 3B2GA 2C7MB 3ULPA 3V61A 3W5OA 1CUKA 4MN3A 5I9OA 4HEA1 4DHZB 3K81C 3RLNA 4X65Q 2UWQA 4HJ7A 2G3QB 2DNEA 1GKHA 3G71A 3V62A 5FLXE 4EZKA 2KWCA 5KYLA
chains in the Genus database with same CATH topology
3G7LA 5C6AA 3TSSA 3BYTB 2JYOA 4OGQC 2XWBB 2XVSA 4FF3A 1TKEA 3HEJA 2WIIB 3KK7A 1SMYD 3WOFA 4V0BA 2ZW1A 3KLSX 1TWFB 2JA7B 2VNUD 4KY5A 5H8YE 1MGSA 2KN4A 4N6EB 5JVH3 1Q1BA 3OIQA 2L83A 1B9RA 4FYDA 1VRAB 4KGTA 1G8ZD 2PTLA 3NVVA 3TBIB 5CV4A 2KAJA 4A3KB 3TMEA 5BN5A 3K6OA 3VYRA 2J4XA 1TWGB 4FP5D 4ZKCB 1ZDXA 1GUTA 5FR3A 2ZT9C 5M3FB 1NSNS 3M7NA 2WXJA 3GD7A 1IW7C 2XSCA 1MI0A 2WACA 4XWTA 3A55A 1EY4A 1LT5D 1RFKA 3R2TA 5M5XB 4G7ZC 1PFDA 2HDLA 4L1BA 5DAUA 4IFDH 1E2ZA 1KFYB 3I3CA 1XO3A 3OHXC 5FO8B 2L1AA 2EY1A 1TWHB 5AUIA 1ILPA 3EA6A 2EDGA 1IUEA 1UEAB 3Q0AA 4CKBA 5CC4A 3TP5A 2INPE 2R93B 4WRDA 1PZKD 5KGUA 1B9NA 1GJXA 1T5XD 5KNCA 3NK9A 1JWAD 5CV7A 1YNJC 4K8IA 1BNZA 1JW9D 2RDFA 2KECA 4WIPA 3VA5A 4IUNA 1V1PA 2IDYA 4KJNA 4A3GB 2Z1CA 4OVZA 1PTOD 4HEDA 1N63A 3MHBA 1JWMD 3D6CA 2WXLA 3BS1A 4C3IB 4IALA 2IW3A 1EIGA 4C1NK 1WTPA 2JXTA 3A8JE 4DXFA 1U4MA 3SFDB 2JYEA 2F0WA 5GXGB 5MPOA 3MFYA 1M4VA 2KACA 2EY6A 1TS2A 2HCCA 5KIXA 2WDVB 2PO4A 5CV9A 1SYCA 1PXUA 3NBHA 4NZLB 3NRZA 4X3SA 5NUCA 3NBIA 2L52A 2B2YC 1OO9B 1EY0A 4WAFA 4IUUA 3D4RA 1U4PA 4FXDA 1TS5A 4PQXA 5EE0A 2A6EC 2I2YA 1STEA 4CBVA 1WD0A 4O42A 5FO7B 3RFZB 4OIKA 2LMCA 3U7ZA 1F2LA 2Q8RE 4MIUA 3CWIA 4YSZB 2WXOA 2WKCA 1RKNA 2A5HA 4EQOA 4A3EB 1JORA 2N7JA 3BK1A 4JX1C 3OW7A 2K5WA 3S2HB 2F0VA 4H44C 3LNNA 2WAQB 3P7JA 3SEBA 5C2TB 2ONQA 4ARIA 1BF4A 3SK5A 1IL8A 2EVBA 2WXIA 1BMLC 1TJEA 2NTTA 1I4PA 1L0YB 2CJOA 1DGJA 3A54A 5FO9B 2FUG1 1FIQA 1S5DD 1K8OA 1RDPD 2EYPA 2F3WA 1SE3A 2B2VC 5I6YA 3BIID 4KGSA 2OXPA 2F0NA 5JEAG 1FNVA 4FF2A 2ID0A 1OXUA 1PTOH 3PZ8A 4RCNA 2WB1B 2MP1A 2F0TA 1G6ZA 1V8CA 1MI2A 4MM3B 1CI3M 2VB2X 1SYDA 5JAVA 3MXGA 4KY6A 1HEZE 2NB0A 4IURA 3C2PA 1EWYC 2YYZA 3BK2A 3S9WA 3MWYW 3K57A 1KABA 1PDQA 2K1BA 2PPBC 3H6MA 4C56C 4ZLTF 2O2LD 4HAEA 4USAA 1LABA 1U9RA 2X6LA 4B0MA 1XTCD 1TKYA 4IUVA 2RDGA 3MC0B 3R8BA 4L6TB 1YNJD 3NUHB 2X6GA 5C4ZA 2XNAC 3I4NB 4IFDJ 4B9XA 4YTPB 2RA4A 3S1RB 2KOLA 1TWCB 2E2JB 2EY5A 3GTOB 2V4IB 3DWGC 2PW5A 5ELCA 1C8CA 1YNNC 1QILA 1ENFA 1K50A 4HTHA 4IZ8A 1U4RA 1GUSA 4YIJA 5ELDA 2FMCA 2K9XA 1FD6A 1T5EA 4CJ1B 4C3IG 1JWSD 2QCPX 4HCEA 3BZDB 5EE3A 3T13A 1JQYD 3NVYA 1JALA 1E2VA 3CRKC 4QF4A 2TMPA 1UUPA 1JCKB 2R3ZA 2MPMA 3OSOA 3D6WA 4YWGG 3AE1B 1EFID 1QJOA 3NVWA 3LX0A 1XLOA 2A6ED 1BCPB 2KVMA 4HKZE 2BBCA 2H89B 2KQ3A 1PRTC 5ELFA 4Q5VA 1DD2A 4EQNA 2LJIA 2NVXB 2E2HB 1XYIA 4GZYC 2X38A 1OXSC 3DEPA 1Y56A 1CA6A 2O5JC 4GLSC 2RQXA 3T4AC 3J81L 1RCVD 2PLPA 1FEHA 4RF0A 2YEPB 5D65A 4ZUJA 4YSYB 1E0BA 5I2XA 1J7BA 3SK4A 1IBXB 1WTVA 1EYCA 1Y8PB 3AU7A 2NZ1D 4L8JA 3S16B 1BO0A 4FNFA 4KD3A 4RGMA 5ELBA 1DJRD 2K22A 1WGKA 5IT9L 1GHJA 5EBDA 3IAM1 1AZPA 4K5WA 1SAPA 3E56A 4A6QA 2SDFA 3I72A 2CW0C 4BBRB 1XCTL 1XEEA 2DYOA 3MXUA 3BVGA 4ZAIA 1KNEA 1SF0A 4OZCA 3GO5A 1FM0D 5K36H 2NN6G 4ILWA 5E1FA 4NW2A 3TEWA 1CM9A 2K33A 4XTCS 2CHBD 3VYUA 2CU3A 2SAKA 2F0HA 3KLSA 3Q6SA 2Z4IA 2J52A 3GTKB 2OHFA 2ZXOA 4RA8A 4A9AA 5CORA 1ZKOA 2VB3X 1RJTA 1F0ZA 3VR2A 3M4YA 2NUCA 3K7AB 2IX0A 1DXMA 5C0XH 2W3RA 1CJEA 3MP9A 4TQ1A 2NN6I 3LWUA 3PIO3 4YTNB 4HN7A 4NDXA 1CHQD 1WWTA 4RH6A 1QLBB 3H91A 4J8QA 1RF2D 3ABVB 1YNND 3RLFA 1HPCA 1ROEA 4C80A 4XWWA 1GXDC 1LTID 4QUCA 2WDRB 5H92C 3HOYB 1R4QB 4WWMA 1WVLA 2ICIA 1MBYA 3JAML 1WCMB 4FF4A 4A3MB 4LLGM 2N88A 3MAQA 4Q0FA 1PRTF 1C4QA 1JR0D 5E4XA 1EZ6A 1I4GA 4ZHPA 2XRSD 3RZOB 1HUNA 2F0MA 4OW0A 2H88B 3P42A 1C4PA 4DF7A 1VDVA 2FINB 1NENB 1MVKA 1STNA 3PMFA 2HDEA 1G2SA 4IUPA 5AFWA 1SDFA 3T16A 2GI9A 4NJCA 5FOBB 4HRSA 2KCNA 2QF7A 5BYSA 1WRIA 3IXSA 4JBWA 2KA7A 3R3OA 1IGDA 3HVDA 4WQMA 1F9PA 2EKIA 3PUXA 3HRZC 3SDZA 2PVOD 1II3A 2QKIC 4FF1A 1L6VA 1TQOA 2CQAA 3AE5B 2GB1A 3U2SC 1S5CD 3GTJB 2AX5A 3S14B 2W82A 1JMLA 1SNQA 3W5VB 1PFNA 3I9V1 1VZ8A 1DOXA 1AW7A 4ZHOA 3NWTA 3MEHA 3AMUA 1S4ZA 2D2CC 1X3PA 4U673 2B8GA 2OT2A 1SNMA 3DHQA 1D5MC 1CHPD 1Y1VB 4ZKBB 5FLXL 4HSVA 2Q8TA 1PFMA 3U9SA 1I50B 2FHTA 2EYMA 2CW0D 5KNDA 4K6DA 1XLNA 5G3LD 1CQFA 1DOYA 3DWAA 4TQUS 4CHTB 4FVMA 4GDKB 2OF1A 2W3SA 2QMTA 4XT3B 3HS0C 5KRUA 2W54A 2WINB 2L4NA 2J53A 4KN4C 1PTOC 4PMCA 2C9OA 5CBEE 1GUOA 1N60A 1HTPA 3T3NA 5EJWA 1TY2A 1DOIA 5K5PA 1KDCA 4C7ZA 3H94A 2KJXA 1TKGA 1K52A 4NP5A 1R4PB 1HA6A 5CYUA 2WU5B 2ICEC 3PUYA 4DFAA 1GUNA 1ZUD2 2LFIA 1A3UA 1W6JA 2M9VA 2EOTA 2K5PA 1NAPA 1EYAA 2D9UA 2EYLA 2ZW0A 3IFDA 1YN4A 2V3NA 3FILB 1EYDA 2PZTA 1A15A 2DYMA 3TDQA 2MH7A 1S5ED 4KX6B 3KBGA 1KNAA 1TYGB 2LHEA 5HHDG 1YMHE 2R61A 1FD7D 2N0SB 1JWBD 4PMBA 5C0XJ 4H13C 4ULLA 1K53A 4IUQA 2XRQD 3P75A 3QJYA 1ZYRD 4DNTB 3S1MB 2KMMA 2WS3B 1LTRD 3OOCA 4F87A 1AFPA 1A3VA 2M00A 5IGCA 1H9MA 4MT5A 3C1EA 2BS3B 1E6EB 1F9SA 1D6EC 5LL6X 4XDXA 4BS9A 3K5LA 3K58A 2A6HC 1EM7A 1FCCC 1E2WA 2O4XA 3SK6A 1ENAA 4R8NA 1BUIC 2EE1A 4BBSB 3OWFA 1Y69U 5C3WA 3V96A 1SYEA 4WORA 3GTQB 4P16A 3NTHA 2WQYB 2JA8B 3V3XA 1IGCA 1STBA 5CV6A 4A3BB 3W1SA 3MTSA 1BXTA 1LT3D 2DY7A 2JA5B 1HQRD 3TEZA 2DWQA 3RUZA 1ACCA 1X32A 4ODGA 5C4JB 1QNKA 5T1IA 1C79A 1RTNA 4X3UA 2KWDA 4KK7A 1JC7A 3HG9A 2A68C 2EYHA 2L32A 1R9TB 1Y8OB 4A93B 2K3UA 1F9QA 1I3QB 2VZKB 4HMIA 1PGAA 1FCLA 3M3YB 1SSNA 3AE2B 3NVZA 4QCLA 1I4XA 3E5SA 1PTOF 1B2TA 1WYGA 4Z9CB 1D1KA 3DXJC 3R93A 3K5MA 2I46A 2BDOA 2F4IA 3I91A 2PIAA 1R7SA 4BA2I 2QEJC 1T6BX 4J3OD 3ND9A 5JJZA 3EGRA 1O7YA 2F0GA 2BS4B 1SE4A 5M5WB 3U4EG 2BA0A 3WOEA 3CIRB 2KHSA 4RF1A 4EGVA 4TMAB 3QIAA 3AEBB 5HGTA 4NAWB 4A8XC 3I4MB 1M8AA 4K8JA 3AEGB 1H9JA 3J7AF 1YN5A 4PV1C 3VQIA 1LTBD 1HUMA 3VR4A 1TS4A 1H9RA 2F0EA 1LV9A 4EVOA 1EEID 3NP8A 1TWAB 3VRAB 1F2YA 1FXIA 3P4QB 3BVMA 1FO4A 1FRRA 2N9KA 2WXNA 2RPVA 5EKKA 2CVRA 2F03A 2MHVA 4A3DB 1WD1A 1HXYD 3DEOA 3VYTA 1ESRA 3E0JA 3D3RA 2E2IB 1K51A 2E2DC 3NPPA 3AH7A 2F0JA 4CKCA 3HP3A 4ZUIA 2JP1A 1Q1EA 2Y0SB 1PYWD 3CKIB 5C3EB 1D5ZC 4BWGB 2Z4HA 2MGSA 3RPFC 1H9SB 2E74C 2A6HD 4J6HA 5IGDA 4HROA 3V05A 5BMIA 1CQVA 5DM73 5C4HA 2BE5C 2WXHA 3DWPA 1KRHA 3CU7A 2D5DA 4C3HB 2G1EA 2QDBA 5KYIA 2WU2B 3VR9B 1LTAD 2VUMB 2PVGC 3NHHA 2F3VA 2OEOA 3K0YA 1SNPA 1HFGA 5I9PA 2HTME 4ARCA 1A6XA 3Q8FA 5IGFA 1YJJA 1D2BA 1GB4A 5IGGA 2D5GA 1EY8A 1ONLA 1X3QA 1AWDA 1JOOA 1KDAA 1TT2A 3IL8A 3DM1A 1QE6A 3MHZA 4V190 3PUZA 2PNRC 2JEAI 2A68D 3T53B 3FMCA 1V1OA 2L5TA 2PZUA 2TSSA 5D3DA 3M85A 1ESFA 3SXHA 2ACZB 3N52A 3SR6A 4DK1A 1RWSA 2FFKB 3CHBD 2BB6A 1ZDVA 2A69D 5EPLA 2F0QA 1SYFA 3KBXA 1TS3A 3ZQ4A 3S15B 3BG3A 2K32A 1KLGD 5JVG3 2JSOA 2INNE 4IQZA 4KGRA 2PQEA 2B2TC 4K14A 4F8MA 4H2AA 1AP0A 1I7HA 2ZXPA 1UGJA 4AYBB 2R6GA 3L7ZC 2X69A 4LK0M 3X3NA 5JEAH 1O7ZA 1LTTD 1STYA 2K5QA 5CV5A 3NQTA 1T3QA 3BVZA 4DAPA 1HFNA 2EJMA 5EBCA 1VMPA 4DA2A 3W5UB 2PCFB 3FPUB 1EU3A 1V43A 5JOBA 3P1MA 1RHPA 3GV3A 3Q24A 1J9OA 2WV6D 4HR7B 2EZVA 3I70A 5G5HA 5EE9A 5AUKA 5F2DA 2GRIA 2EYOA 2R92B 3K59A 3HRDD 4K5XA 1QQRA 3NTIA 1CZGA 3DWQA 4DK0A 1SNOA 1XXGA 4JWUC 3I90A 3TEYA 1J8IA 3A8KE 2QSDA 2V3PA 2B63B 1EIHA 3A7LA 1IKMA 1NI3A 1E7PB 1Z6HA 3TN2A 1STGA 2DBYA 1K8MA 3G6JB 2BYTA 1XF5L 2Y3AA 3ZGZA 2K04A 3P20A 4XT1B 4C3JB 2AWNA 1PRTB 2BE5D 3BDLA 2JX5A 4NAMA 3DUZA 4KJOA 1Q8IA 1SJED 2IPKD 3AE8B 1Q12A 3BWUD 3KF8A 5BN3A 2LKVA 3S1QB 3O13A 1I4QA 2E75C 5FK9C 4ME5A 3HOUB 4MHEA 5C44B 1WSPA 1YN3A 1QOHA 4C7YA 1AYFA 3AE6B 3MFGA 3HZXA 2PYKA 1BQQT 2RBMA 3GP7A 2J0TD 4P6VF 3D4WA 1UWMA 2E76C 2EY2A 3QO2A 2AQ1B 3HGBA 3RMHA 1A70A 1B44D 2I38A 5BYQA 1TZOA 1V1PB 3NTKA 2YU9B 2F0LA 3HOVB 5T8IA 3J7YW 1QT9A 4RKLA 3QG1A 3KQ4A 2F0KA 1WTOA 1KF6B 4QB4A 4US9A 2SNMA 2I07B 4WURA 5J22A 3Q8BA 4XDDA 2LEKA 1L6UA 3AEDB 1OXTA 3C46A 2EYFA 1XLPA 1IHZA 3NE5B 2PMVA 4RHSA 1RD9D 2JZPA 3I4LA 4TRDA 5LNK1 5CV8A 4HSPA 1SBBB 2ZXRA 5D3IB 2LMCB 2CJNA 4Q2JA 4DAVA 1F2MA 2WKDA 1ZPSA 4AS1A 4OO1I 2SNSA 2DN8A 1O7LA 1BCPD 1F2ZA 3MVVA 1C76A 1BDOA 1ZYRC 3BDCA 3IFTA 2NN6H 4IUTA 5C3XA 4UAIA 3IKJA 1QOBA 1XCQL 3RD4A 3QOJA 3P4SB 5JEAJ 2H1EA 2HQEA 4RCOA 1C4CA 2QIEB 1LO5D 4ZYSA 2Y5CA 4KV6A 1Y1WB 2K7VA 2L1BA 1DZ1A 1QCBD 2DNCA 2Q5WD 4RWSC 4YT0B 4KKSA 2JEBI 1FFVA 1SSOA 4S3SA 5E6JA 2NVYB 1DOKA 2F0OA 1B53A 2AUJD 4XXEA 4JE3B 2J7ZA 4KMUC 2AUKA 3C1FA 5BMGA 1LT6D 4CJ0B 1NCVA 3K5OA 1TKWB 4DQOC 1YQ4B 3R2IA 1LT4D 2LS01 1QG7A 3FKIB 1PDXA 1EL0A 5EKLA 2WXRA 1YQ3B 1DM0B 1QWYA 4C3JG 3MJ5A 5G3LF 1XLQA 1VF7A 3Q8AA 1EY7A 1B3AA 1UNSA 1F2RI 3FRPB 2AWOA 3VR8B 3QOLA 3KWLA 1E10A 3H09A 2B2WC 2EYJA 3W2DA 1MSGA 3X3MA 1S5FD 3J9CA 4O1NA 1ZOYB 3J80E 5EGTA 1LLRD 3D8GA 2KCCA 5M5YB 4XYOA 2FBWB 1SXTA 3SHLA 1VJKA 5DEHA 1SIJA 4OHJA 3WCQA 1QOFA 3S17B 1HQMC 2AQ3B 3AM9A 2ON8A 3NS1A 2IGDA 3ZJTA 3B9JA 3T56B 3N6RA 4EQPA 4C1NI 2JQRB 3IAYA 1FNUA 1MPEA 3GS2A 3KLRA 1VDZA 4LK1C 4XQJA 4EE2A 2HCIA 3AEEB 1BUVT 1MSHA 3UI3A 5KNBA 3A8IE 3PUWA 4I65A 3VR6A 1A3TA 5CBAE 1Z7TA 1N61A 1PTOB 3GB1A 1ILQA 2F0SA 3LYYA 4CJ2C 1STAA 2OEDA 4C2MB 3U9OA 5A2QE 1EZ8A 3E6ZX 3AECB 2WP9B 2J42A 4R9WA 5IGBA 4Y7NB 3PV0A 1EY5A 4PNYA 3P1HA 1N5WA 4A3IB 2RVLA 4IFDG 1I4HA 2B2TA 4RGNA 1I6VC 5EPKA 3M7GA 1JOKA 4X3KA 3DWMA 2RSOA 5DM63 4BY1B 3Q23A 4HKQA 3E9SA 1ML0D 1D1IA 2XIWA 1QB5D 3NXWA 3NUCA 1TU2B 2FJ2A 5CGKA 4B9WA 3ND8A 5BYRA 3IT6B 3ONAB 2LY7A 1GOZA 4B0EA 3NQIA 2H4OA 3LWEA 1CK1A 1CA5A 4IFDI 1PZJD 2JWUA 3HOWB 3IT4B 4G4KA 2Q8IB 2WXPA 4OIJA 2WP8J 1OXVA 2HDMA 4YSXB 3VYSA 1OXXK 1QNUA 1C77A 4QIWB 1EWCA 3LXFA 1TVXA 2VXWA 3D31A 1OFFA 2KEDA 4QMGA 1KAAA 1WTWA 4HCSA 1GAQB 2A74C 1PGBA 1U4LA 4F7XA 3TZDA 2NMQA 3J7AV 3HVZA 1JICA 3AV8A 1B9MA 4CGYB 2XN9C 2WXFA 1IBXA 4JK1C 2M19A 4OZAA 2EJGC 2XWJB 4ZRZA 1WTRA 4IN3A 1PZID 1N62A 1F9RA 3B2FA 2A69C 2NTSA 4AQ7A 4L63B 2G9DA 1C78A 4FXCA 3ZJUA 2LHDA 3Q69A 3OIPA 1CZWA 4D2KA 5IODA 1EY6A 4KKTA 4XE0A 1DYQA 1XWEA 3VA7A 1ZE3D 1QF6A 4LAAA 2R7ZB 3MXNA 1XX8A 1BR9A 1KDBA 3I57A 3AEAB 5LHY1 5C5LA 1YNTE 4L2YA 5E4WC 2DLBA 2BDNA 3MXPA 4ZRQA 4G57A 1F77A 4RFBA 3C3LA 2DY8A 1PUTA 3A56A 3D4DA 1NR2A 1QOGA 1L4DB 4J1MA 2K28A 1JE4A 1SNCA 5G5GA 3RZDB 5M9OA 4A3FB 3SVMA 2RMMA 5C5MA 4RGOS 5I2YA 5HI1A 4N9TA 2RDHA 2M2LA 2F0IA 2EPBA 3ITPA 1STHA 1ZEQX 1WTQA 2Z8LA 5EPJA 2F0DA 2JXMB 3T3OA 4KI0A 3ZYYX 2PW7A 4G7HC 1AEXA 2MEKA 1LTSD 4NMZA 1IYVA 5JXVA 1GPXA 4A55A 4CQNA 2EJFC 1CFMA 4KY7A 1HCZA 4KN7C 5ELEA 2F1MA 3PUVA 2K03A 1AZQA 2K6AA 4YXDB 1L0XB 3P4PB 4MACA 1ZXTA 3ERQA 1VLBA 5TSSA 1HTLD 1D5XC 1J7CA 3QWNA 3FEWX 2LUMA 3EJIA 2K01A 1H9KA 3NWSA 3AMZA 4KKUA 1RYJA 3K5NA 1Q90A 2SEBD 3C8YA 1OQQA 3FPPA 4LMQD 1C9FA 1P7FA 3FVQA 2SOBA 1B1ZA 2BS2B 1ZXHA 1VZ7A 3L4PA 3H0GB 2PMZB 4RNAA 1EQVA 2MJDA 2C5CA 1KLUD 3W9CB 4DXGA 2VZKD 1IW7D 1KTKA 4A90A 1O80A 4TSSA 2N9LA 4DN4M 3HOZB 5D7GA 3PZ7A 1N5XA 2WXQA 4UDUC 5IIFA 1NEKB 4RHRA 1PMRA 4RGTA 5A35A 3SFEB 2IL8A 3V2TA 2IT1A 2NYZD 4K2LA 3GTLB 1G91A 3TEXA 2WLBA 1EEFD 4ZK9B 2ENBA 1ET6A 1FRDA 1L5PA 1V97A 1KH0A 1UAPA 5CR3A 1Q10A 4N58A 1SEBD 5FKAC 5I4DA 3TUOA 2B2UC 3S2DB 1HZ5A 4FXKC 4N59A 1GB1A 3IAS1 2L55A 1NYRA 3OWEB 4XQNA 1MD2D 2MJ3A 5KEEA 3QB3A 4GDLB 2IX1A 1LTGD 4WJWA 3PIP3 3P63A 4QUFA 2L9HA 2K0PA 1FNWA 3KUPA 2B2WA 1ICWA 1G291 4M8AA 4E6IA 3HUIA 2HUGA 1GHKA 1TR5A 3TZUA 1Q3LA 1BCPC 4H7BA 5HG2A 1IKLA 1HRJA 4TQ0A 4H0LC 5BN4A 1EQTA 3GQBA 1F2RC 1BBXC 1S5BD 1UWXA 2JE6I 3VR3A 1FFUA 4L23A 5HURA 3TP7A 3PO3B 2BW2A 4ITKA 4WFN3 2BB5A 1IYUA 4CKEA 2QJLA 1AN8A 4KHVA 1CT1D 2A73B 5K36G 2PZWA 3FILA 4KD4A 5IOCA 1SFOB 3OPOA 4RAUC 1EU4A 2IX3A 4N9PA 1DOMA 3AEFB 1RTOA 2BCOA 4K2KA 3AE7B 1L0VB 2BTEA 2F0PA 2B39A 1CTMA 2M0AA 1JWUD 3EFXD 2PKOA 4XDCA 3VRBB 5CMDA 4ZQ3A 2JSVX 1QKZA 3S1NB 1B4OA 2GA4B 5C3JB 1JOQA 1HHVA 2E3TA 3T51B 5C0XG 3Q8CA 4FO2A 2LGIA 4DAYA 3BDOA 4C3HG 4IDIA 1WTXA 3GV6A 3DMUA 2KEEA 2L0CA 1W6KA 1SB3C 1DCZA 3MZ5A 4XQQA 3HOXB 1L4ZB 2M56B 3AB5A 3SR1A 1SNDA 4ABNA 3EQLC 3AE4B 1QOAA 1LACA 4JWSC 3TP8A 1E0ZA 4US8A 5C0XI 3W3AA 1NR4A 3P4RB 5HFYA 5I6WA 3I8ZA 3SK8A 4KKIA 3PO0A 3CQZB 3A7AB 1I6HB 2KDMA 4OO1G 1EY9A 2W55A 3Q8EA 2K05A 4K6LA 5C4XB 3PO2B 2E6XA 1DONA 3AB9A 1K83B 5J1ZA 2IGGA 2NVQB 1WXQA 1SE2A 1SJHD 1JQ4A 3U52E 2K5DA 3F2UA 1EWHA 2FMMA 3J81E 5E3FA 1I4RA 2NWGA 4XYQA 4FXGC 2IWHA 5J39A 3ZJVA 2D62A 1A2UA 1SYGA 2BA1A 1BCPF 5IGEA 4LTUA 2WXKA 3I73A 1SYBA 3UI2A 1DOLA 3SE0A 2KQ4X 1ENCA 1ZP0B 2L12A 1V8QA 4OL7A 1RM6C 1G2TA 5EQ0A 2WDQB 1VR9A 4KTAA 2JYTA 2G9HD 2EXZA 3L9AX 5IT9E 3AE9B 3J80L 4ID6A 2YEPF 2JA6B 1FGBD 1NVID 4G7OC 4P2CB 3GTMB 4KKJA 2EELA 3Q22A 2BOSA 5BMHA 3FAHA 3M4OB 4I7ZC 2F0FA 1NUCA 5DNFA 1D4BA 2L11A 2KUMA 4JPSA 1C48A 4REZA 4R8IA 3EROA 1GUGA 4PT5A 1SMYC 4M0WA 1PRTD 4OO1H 2F0UA 5LL6S 2QILA 1ZXIA 3L3OC 1PFBA 2LFNA 1JB3A 3H8HA 1BOSA 5M3MB 1NYQA 3CRLC 2NVTB 4IOIE 1VF5C 4B08A 1VZ6A 2Y5PA 3ETRA 4HMJA 4MH8A 1FYCA 4IKGA 5EKIA 3H3VC 4LJZC 4PMWA 4K5VA 1PLFA 5A2QL 4BY7B 1H9SA 2B2YA 2MUYA 1FR3A 4XIGS 2V4DA 3N9YC 1EOTA 3AN1A 1A2TA 1TIID 4KHZA 3URYA 3BYYB 3GTPB 3TP6A 1P7EA 1E9MA 2MJ8A 3OMGA 1MHXA 2RSNA 3JAME 4DNRB 3FDTA 1J7AA 5ISRA 2BT6A 2IGHA 2O5IC 2PW9A 3WDNA 1GUWA 3MA2B 1PGXA 2MJEA 2V0GA 1HZ6A 4OZBA 2WXMA 4DGZA 1FXAA 1OQRA 2N55A 1Y8NB 4BA1I