1SJED

Hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjeD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjeD02
1EEFD 4UDUC 5I4DA 1PRTD 1FNVA 2AQ3B 1LT4D 1T5XD 1JR0D 1LTGD 1DJRD 1BCPF 5ELDA 3OWEB 1PZJD 3CHBD 1HTLD 1PYWD 1SJED 2NTTA 1UUPA 1FD7D 1EU3A 1XXGA 1ET6A 1SE3A 1RD9D 4OHJA 1LTID 2IPKD 2RDGA 4NZLB 5ELFA 1STEA 1PRTF 2TSSA 1L0YB 4Z9CB 3BVZA 1I4HA 2XRQD 1QILA 1BCPC 1BXTA 4RGNA 1MD2D 1LTSD 2Z8LA 1TS2A 1HXYD 1YN4A 1PTOD 4TSSA 3DWQA 5FK9C 4DXGA 1I4PA 2WV6D 3BVGA 1LT3D 1JCKB 1KTKA 2XN9C 4K6LA 1JQYD 1SE4A 3EFXD 2SEBD 1RF2D 1SJHD 2J4XA 3R2IA 2NTSA 2AQ2B 4RGMA 1CQVA 5D3DA 1PTOF 1SE2A 4DXFA 1HA5A 1S5FD 3DWAA 1D6EC 1BCPB 1EFID 2R61A 3EA6A 1GOZA 3KLSX 1EU4A 2ICIA 4RH6A 1EWCA 1I4XA 1S5CD 4L6TB 1RCVD 3SEBA 1SBBB 1LO5D 1XTCD 3BZDB 1DYQA 1LTRD 1RDPD 5ELEA 5FKAC 1M4VA 1D5XC 4RGTA 1L0XB 1PRTB 4L63B 2G9HD 2AQ1B 4C56C 1PRTC 1TS3A 1I4RA 1ENFA 1LTAD 3MFGA 1BCPD 1B44D 1V1PA 2QEJC 3GP7A 1SEBD 1CK1A 5ELCA 1CT1D 4RHRA 1FNUA 3BYTB 1CHQD 1I4QA 1V1PB 3O13A 1YN5A 1G8ZD 1LTTD 4RCOA 2RDHA 1ESFA 3V05A 5TSSA 1UNSA 1AW7A 2CHBD 1PZID 1TS4A 3URYA 1I4GA 1SXTA 1FNWA 1PTOH 1S5BD 1CHPD 1D5ZC 1TY0A 3R2TA 1JWSD 1EEID 1TS5A 1KLGD 1JWMD 1PTOB 5D3IB 4O1NA 1S5ED 4RHSA 1S5DD 3R8BA 1JWUD 4ZYSA 3BYYB 1LLRD 1PTOC 2XNAC 4BWGB 3W2DA 1LT5D 1PZKD 1D5MC 2IJ0A 1LT6D 2XRSD 1FGBD 1TY2A 3DWPA 1YN3A 1AN8A 3TSSA 3BVMA 3MC0B 1LTBD 4RFBA 1ET9A 2O2LD 1KLUD 2QILA 1B1ZA 5ELBA 1F77A 4RGOS 1V1OA 1HQRD
chains in the Genus database with same CATH superfamily
1CSQA 4DK6C 1G2TA 3BZCA 2Z4HA 3K58A 1E0BA 5IA7A 2Z0SA 2UWQA 2KJXA 4A3JH 1BBXC 3PMFA 2MGSA 1JMCA 2ZCCA 2EDGA 2IY0B 3CSTA 5DCNA 2VQFL 1PYWD 4A3LH 1ILPA 1N34L 3E9HA 1A3UA 1PXUA 3A9KB 4OX9L 3I9V1 3UDIA 1GHJA 1T0YA 1MJDA 3M4OB 1XMOL 5C3JB 2C5CA 2KXJA 4LNQA 2IO2B 3DBHI 3CWIA 5BMIA 1OEYJ 2NZ1D 1HUNA 4LF5Q 1NBFC 1YQ3B 1YN4A 4A3OA 1L0VB 1AZPA 4HPLB 2F3VA 2VL6A 2SOBA 1CKNA 1Y14B 2SNMA 3CAMA 2M1MA 5CMDA 4AWJA 3U4VA 3BZKA 1N63A 1EZ6A 2HCCA 3LGJA 2HHHL 1V6EA 1WI5A 4WJQA 5HFYA 1RKNA 1EYDA 1C4AA 4M00A 3HM6X 3H1UA 2F0KA 3CMEA 4NAWA 3L13A 2NBWB 3M3YB 4A6QA 2G9DA 2FIDA 2KDBA 2PZUA 3B9JA 1J5EQ 3R2IA 3V96A 2B8FA 5J22A 3H0GH 1RWSA 1JROA 1T9HA 2I5LX 4XQJA 1WMHA 1EL0A 5KNDA 4WQMA 2KJ6A 3EIVA 1WTPA 4Q0FA 3KF6A 2EXDA 1MHXA 5JEAJ 3P4QB 1A6XA 2VH2A 1X3QA 2F0OA 3MJ5A 1AEXA 3CP0A 1WYDA 3Q3JA 3N32A 1M4VA 4H7BA 2DLBA 2BT6A 3P2BA 4YTMB 2I38A 5LMNL 4KGSA 2K1BA 2D11A 1WH3A 2D3GA 4HEA1 1X3FA 2B2WC 2EE1A 3Q8CA 4FJVB 3VTVA 1EY8A 2UU9Q 3NELA 2UXCL 1ISNA 4DV3Q 1X3GA 5M5WH 5E4WC 3GTQB 2MWSB 2K5PA 1CK1A 1SMXA 2BPSA 2KWUB 4KD3A 1NR4A 5NUCA 4LFCL 1SNCA 2IHEA 4G4KA 4RA8A 4B9KA 3S17B 1JOKA 1A70A 1PGAA 2SNSA 1JJ2A 4POGA 3UDXA 5C4HA 2HT1A 4JBWA 4GKJQ 1TZ1A 4IWQA 1NI2A 2PPBC 1EY7A 4BBSB 1YX6B 3A55A 3ZJYC 4GLAC 2K6AA 2KZRA 3AU5A 5EE1A 4X6AH 1TY0A 3DHGC 3K9PB 4J8QA 1EEID 2B2YA 1WJ4A 5ELNA 2A68C 2IX0A 4IJLA 3IG3A 3R8BA 3S15B 4YCUA 2RCFA 1LLRD 4BBNC 5M3FH 4EQPA 3BIID 4P73A 2CVRA 3I70A 3EJIA 4KMUC 5GROA 3NENA 2L76A 3VR9B 3I4NG 1YZ6A 2A6EC 2B3AA 2YEPB 4LNOA 5J17A 4ZK9B 4G3XB 4DV1Q 1O7IA 1HZ9A 1B70B 3PUXA 2GBNA 2ZJRA 1HFNA 3RUZA 5KRUA 2MO0A 3MZ5A 4DR5L 1FL0A 1JOOA 4XIGS 1A63A 4HVBA 5FR3A 1Q12A 3HOWB 1JR0D 1LTGD 3AULA 3LWEA 1DJRD 4HIOA 3NZ3A 3J81j 1GJXA 4FJZA 3G48A 3U2SC 4GDKB 4PMCA 3H6MA 2BWES 2BGFA 2KO3A 1TT5B 1N60A 3JW0X 1GHKA 4C7ZA 4OHJA 2JA5H 3CRLC 3IT4B 2ZJDA 4ZHOA 4XT1B 4LF8L 1STEA 4APVA 1PRTF 4ZRJA 3KK7A 3BVZA 2NVTH 3D8GA 1VQEA 2WHIA 4Q2JA 3CQZB 1ICFB 3B1LX 2FCMA 5E6NA 3SR1A 1TKEA 4O2DA 1YVCA 5F2DA 3L7ZC 5CR3A 1CA6A 4LDTD 4RF0A 2CU3A 1I6HH 2IYDB 4LCDE 1Z2MA 4JI1L 2FUHB 1KRHA 3GB1A 2K75A 4GN1A 5D65A 2DYBA 4B6WA 3L0OA 3VHTC 5G3LF 4JI5Q 5IWAQ 5D94A 1LFDA 1WX9A 3HOXG 1WYGA 4L2YA 4KLKA 2XN9C 1WGDA 1SF0A 2O6VD 3UI2A 2F0VA 1B4OA 4KDIC 2GBRA 5GQOA 1PLFA 4XYQA 1UBIA 3HK0A 4S17A 4CJ2C 1CI3M 2XBBC 4FO2A 1X56A 1RIPA 4A93G 5D3DA 1HNWL 1VLBA 1U4AA 2WIIB 1ZDXA 3LNNA 2N7JA 3D3RA 5DLQE 3C19A 3LJ3A 4N59A 5TR5A 1CUKA 3D4RA 4X3TA 3PO2G 3WANA 1MFWA 3DMUA 3FKIG 3CU7A 4ANWA 3VA7A 5EDSA 1I4XA 2Y0SE 1WD1A 1H9SB 3CCQA 3U4ZA 1NAPA 1C8CA 1YEZA 3T53B 4AYBG 5HKHA 1VS0A 3PQIA 5CYUA 3TQYA 4H2AA 3CC2A 4PS7A 4DKAC 3HOXH 4K1RB 5BYRA 4C56C 1F2RI 2WDRB 1U4LA 1QVFA 4A3KG 2RGFA 3A33B 4FADA 1P7EA 1RFAA 1P3QU 1XNRQ 1BCPD 4JI3L 1JRPA 4IPHA 5M5WB 1OQQA 4YXDB 4A93H 2J52A 3SK8A 3BYTB 4DV4L 3PO3B 4A3CH 2X38A 3EQLC 3K7UC 2MX2A 2VZKD 2YLMA 3QARA 1CZWA 3PO2H 2RSNA 2WAQE 1WXSA 5KHOA 4NP5A 1PGXA 3V05A 1KQSA 1TVXA 2JA6G 4IUTA 3GTKH 2C60A 5A2QL 1UBQA 1C7YA 2IGDA 4ARIA 3URYA 3VH4B 5JEAH 3ER0A 3W9CB 3H15A 1N32L 4KIKB 1FR3A 1RFKA 4M8MA 2NVQB 5H92C 2DWQA 1NI3A 2F0QA 3I73A 3TDQA 1YJNA 3ND9A 2D62A 2MJ8A 3W2DA 5C4XG 1ZP0B 3NS8A 1MHHE 3R7QA 1CMXB 2K8CA 3P4PB 1I3QH 5IO9A 1FGBD 5KHQA 4PK1A 3H7PA 3Q0AA 4REZA 2WGSA 3KLSA 3FVQA 2UUBQ 3M63B 2X6GA 2NS5A 2ZM6L 1V9JA 2I2YA 1A3TA 2VW9A 2JX5A 2O5IC 1EIHA 3GOEA 1XTDA 1ACCA 2CH4W 5BN3A 1FNVA 5COYA 3DBRB 4M8NA 2DNFA 3H09A 1NYQA 4V190 1ZGUB 4F7ZA 2IBIB 4UAIA 3S1QH 1WJ6A 4UPAA 2D5DA 4GOPA 2DNCA 2KHWB 4LNFA 2KHIA 3SK4A 1TKYA 2CHZA 1BF4A 5C4XH 3PRMB 4FVMA 1HHVA 2I1JA 4ACFA 3E6ZX 4M01A 4C7YA 1TT2A 3D31A 4OGQC 5LMUQ 3VUWA 4CKEA 3K0YA 4BKSD 2AWNA 1Y1WG 4XWWA 3I4NB 1B9MA 5FO7B 2KENA 2CJOA 2NPTA 3WAMA 2BYTA 2K5QA 3BDCA 3PTFC 5EQ0A 4OIJA 2KTRB 1QCBD 3D4WA 2IW3A 1D8LA 3FHWA 4MJSA 5BMGA 2AYOB 1GAQB 4II3B 2I5MX 2PE6B 3PRPB 1I4PA 2OJRA 3TEYA 2Q8IB 1N33L 2E2JH 2YV5A 2M00A 2G45B 4G50A 3EFXD 4N9PA 3NVVA 1MIUA 1WTRA 2WXJA 5JJLA 5C2TB 1TR5A 2KDEB 4PS3A 1YJ9A 5EJWA 3JYUA 3Q14C 4P16A 3WIMA 5DM73 3CPFA 2WDVB 4XWTA 3S24A 5LLIA 2HD3A 2AQ2B 4LF7L 2WNMA 2B2TA 4A20A 4TQ0A 4BZAA 4AQYQ 2NZHA 4K14A 1Y1WH 4B3TQ 3FPUB 1HZBA 4LJOB 4YWLA 3M9BA 1I42A 3C1EA 1NE3A 3CCUA 3QHTA 1B2TA 3E5SA 5J18A 2QSDA 3DVNV 2L0CA 2BS3B 2CJNA 1C4QA 5JOBA 4ZUJA 1EUVB 3FDTA 1FXIA 4DUYQ 1WGHA 2EMSA 2HJ1A 1H9KA 2FCSA 1Y8RC 4UHVA 3AU7A 3NHEB 3RNCC 2JRIB 2W54A 5AZGA 3JVZX 3HRDD 3HOXB 3TP5A 1F9JA 2BYVE 1KDAA 2FCQA 3PSEB 3WOFA 4IPDA 2L1BA 4AUQC 5GAHC 5EKIA 1T0SC 1P8LA 2ZPYA 5GAEC 1KF6B 5IIFA 1TJEA 1CKMA 1EFWA 4X66L 3TS0A 4R3DA 3J80c 1F0ZA 1Q0WB 1ZDVA 4A93B 3K9OB 5DPRA 2W3RA 4HJGE 4BA1I 4A3DB 1VZ7A 3S1RH 4TKNA 4MEMA 4L5RC 3LXFA 5CX3A 2BOSA 4EZJA 5HG2A 5ISRA 1LUZA 3SGIA 3PO2B 3FKIB 1EIGA 3T13A 3GTOH 3VR5A 1TS4A 2N9KA 5GADC 2YTVA 2WP9B 3UF8A 4K0KQ 4RG1A 1S5BD 3GO5A 3NVWA 1F2LA 4QB4A 2F03A 4K3CA 2LFNA 4LDTB 4MSQB 3ZDTA 3HOYG 4AYBB 5D3IB 1HEZE 2Q8TA 2R93G 2IGHA 2M4NA 4ANVA 2K6DB 3CRKC 3FPPA 4XDCA 1VF5C 1D5MC 4XQNA 4CYEA 2ES2A 4IFDJ 3QC8B 2O6VB 4DDGD 1EQVA 4A3KB 5E7NA 1WTOA 3T8MA 1S3OA 4IUPA 4WAAA 3MC0B 2BB5A 3G7LA 1VMCA 2J7QB 1DXMA 2JP1A 2ZW0A 3ZO5B 2BH8A 1MJCA 1MBYA 4NMZA 2KQ7A 2B2VA 2JZ3B 4X62L 2LHEA 3MHZA 1DCZA 3I4MG 1OEYA 2MHJA 2O4XA 3K5OA 3B0AA 1TWGB 2MO1A 4M0WB 5EE0A 1TXYA 2JA6B 1QZGA 4RKLA 3KJOA 4F88A 3HVZA 2KX0A 1F9PA 5CV8A 5ELDA 2ATWA 4NDXA 2R93H 2NCNA 1SR3A 1SMYD 3F2BA 4DR2Q 3S1QB 4A3BB 5CORA 1K53A 2MP2A 3AEFB 1N6ZA 1XXGA 5IYCG 5C4XB 3NQTA 2RDGA 5ELFA 5HGQA 3DOWA 3TRZA 4OWTB 1WX8A 1MJEA 1JB7A 2KWCA 3DQVA 1HR0W 4IM0A 2N8NA 2O5JC 2NVUI 4A75A 1BCPC 2N9EB 1E8ZA 1BXTA 3LYYA 1TWAH 3HM3A 4DR6Q 1JJCB 1EQQA 3A1QB 2VZKB 3I4MH 4WJ3M 1SNQA 2CH4A 3A54A 3FC4A 1QVGA 2ZTDA 2E5LQ 3PIP3 1VQPA 3FEWX 4DXGA 5L83A 5IYDG 4DV7L 1B3QA 4M8AA 2WXGA 4DU9A 3M7NA 4QJFA 1QF6A 2E2JB 2QIEB 2EZVA 3HFZB 1VQ6A 1WXMA 1MHWC 2F0PA 5MPOA 3Q6BA 1JE5A 1WJNA 1BMLC 5EPLA 2BH2A 5EBDA 4P6VF 1F9RA 3U52E 4JI2L 2HQLA 2BS4B 3RYTA 4DXFA 1SYEA 1E5WA 3DWAA 1K50A 4DNRB 4JI0L 1SRUA 4YWGG 3PUZA 4YT0B 1VQ5A 1GOZA 3GV6A 3PZ8A 3IAYA 1P9DU 1Y1WB 3P20A 5JVH3 4R9WA 4GNXC 1WYWB 4MGIE 1UEAB 1DOMA 4DNTB 5JJIA 2MH7A 3KYCD 4WURA 4XYCA 2KT7A 5CGKA 1CTMA 4LFAQ 1W2BA 1JMLA 2D3AA 3DM1A 4DV2L 2ZZPB 4GZYC 5IYDH 1GC6A 2KANA 4KJNA 2PLPA 4EQ5A 4IUMB 1PFBA 2DY7A 3G6JB 3ULJA 5BMHA 4HIKA 3NHHA 1XF5L 3U9OA 1QVCA 4XE0A 3ENEA 2EOTA 5E3FA 2E2HH 1V49A 4AP4C 2G1EA 1FMAD 4DR1Q 2PQAB 3SK6A 3TEZA 1TWHH 1OQYA 2XSCA 5EE9A 4NPNA 3CCSA 1FM0D 4IOIE 4K7WA 1AFPA 2W82A 4CDCC 1GXDC 4GIVA 1PQSA 4JE3B 1K8AC 5IP7G 4DUZL 1J19A 4JK1C 2DX5B 1WCMB 3MXNA 2EYFA 2OQ0A 2WACA 1O80A 2IX3A 4X64L 3T1HL 1FJGQ 2PMVA 1II3A 4IFDI 2F4IA 4S3SA 4X57B 1QE6A 4ZYSA 4HJ7A 1F9SA 4W9GA 2XNAC 1MG8A 1KHIA 3VDZA 1XWEA 5CBAE 3PF4A 2UXBQ 1JQ4A 1TY2A 4A3MG 2KWDA 2QCPX 4KV2A 5IGCA 2M56B 1E2ZA 1SSNA 3V3XA 4YTPB 4DR4L 1UD7A 5IT9c 2LVPA 3ML9A 4PV1C 4DAYB 4RGOS 1OTCA 4ANXA 3V61A 4YY3L 2BWFA 1VR9A 2N88A 5IGEA 2WINB 2WQYB 5EPKA 4EOYA 4KGRA 1K8MA 1ZYRD 4XDXA 5C5MA 2NUCA 4DA2A 1PH6A 1WVLA 4IM3A 5IGFA 3CHBD 3RMHA 1KDBA 1Q3LA 3HOYB 2OHFA 2R93B 2DYMA 4ME3A 2LXAA 1A62A 1XPUA 4IZ8A 1P98A 2R7DA 4A3MH 2E2IH 1NBWA 2Y0SG 1CFMA 4B3SQ 2YU9B 1PVOA 3KH0A 3HKZB 2B2UC 3VRBB 4IFDH 1JC7A 4EX5A 1E3PA 2C5LC 2EYOA 3ZXVA 2J0JA 4FF3A 3NBIA 5DNFA 1QILA 3PGZA 4DV0L 3PS6A 4W9DA 3GE3C 4YHHL 4J3OD 2Z8LA 1QKZA 2QCZA 1TWAB 2PO4A 3RNGC 1NTGA 2E76C 4C3IG 5FLXc 4P75A 3VUXA 2MBHA 1RJTA 3BINA 4G7OC 5AJ3L 1YNND 3TZUA 5D2MB 3FP9A 1VQAA 5C6AA 2R6GA 1SSOA 2OTJA 4L8JA 4QUCA 4HAEA 2SEBD 4KHZA 1LM8B 1H4RA 2FUG1 1DOLA 2WAQG 4LLGM 2L4NA 4HPPA 3H3VI 3VTUA 2D0OA 1NUCA 2H1EA 2R92G 2DENB 1WRDB 2RHQB 3Q3MC 4G11A 1L1OA 4BBNF 3ZYYX 4FF1A 3VR6A 1NCVA 1YHBA 2R61A 5CV4A 2V3NA 1R4QB 2WDQB 2UUAL 3S1NH 1SIJA 3Q8DA 3DWGC 4DR7L 2A68D 3GD7A 5D7GA 4NXMQ 1KFYB 3SD5A 1KOTA 1ASZA 4C3IH 2ZXPA 4M02A 3HOZG 3VR8B 2V3PA 4BOSC 2NBVB 3EECA 3I63C 2J7ZA 4XT3B 3Q3OC 3RNUA 4RGTA 4JOIC 3VQIA 4G0NB 2YEPF 3E0JA 5LHY1 3RUIB 3A74A 4MHEA 4MELA 1KABA 1HZCA 1RHPA 3GV3A 3T4AC 2KQSA 1NNXA 1L4ZB 2V1CC 4PZ6A 1ENFA 4LK0M 3MFGA 2A6ED 1L2FA 4L1BA 2N55A 2F0LA 4PQXA 2PNRC 4NAMA 2IGGA 4A4IA 1N36L 4B3MQ 1S40A 1MI0A 4WIPA 3DBLB 1C76A 3RNAC 2N9XA 2PNHA 3O13A 2KOLA 4FNFA 1VQ8A 3QG1A 3TJPA 2F3IA 1WXVA 3H3VH 2VUMH 5TSSA 2KEDA 4HJAA 4O0AA 3L16A 3IFDA 4U673 1SXTA 3HOZH 3NJTA 4POFA 4A3PA 4OONA 1JWSD 5M3MG 1RODA 5EPJA 3ZTCA 1Q1EA 5IP4D 3E3XA 2BYEA 2KFKA 1DD2A 3GZNB 4IWPA 4JI4L 4YWKA 1IGCA 3D4DA 2Q8RE 3SFDB 4MTNA 2IY5B 1IBKL 5T1GA 4LF6L 1NENB 2A5UA 4IPGA 3NWSA 3J7ZC 1MSGA 3J7AV 5K5PA 1P1AA 2CHXA 5LNK1 1K83B 2ZVOA 1S72A 2JA8B 1A3VA 4QF4A 3QIAA 4RM9A 4E74A 1A2TA 2FE8A 3DVGX 1FXAA 1KNAA 4A3JG 1KJTA 2LKVA 2Q2HA 1LT4D 4DGZA 2PMZE 3KQ4A 5M3MH 1Y8PB 4WORA 1Z6HA 3K0XA 1HH2P 1WM3A 3T1YL 1PZJD 3VRAB 1CKNB 5IGDA 3X0WA 1HTLD 3D32A 3Q8FA 4MM3B 4A3LG 1LACA 2AL3A 5M5XB 4ZAIA 3RLOA 4HJKA 1HTPA 3AU4A 2G4DB 2J42A 4NAWB 1ESRA 2NVXH 2HTME 4PYUA 4BY7B 4A3MB 2E2IB 3VFKA 1FFUA 1C4PA 2AKWB 2JT4B 1TWCH 1G6ZA 2L0TA 1KH0A 2MHVA 1VD2A 2AWTA 5KYLA 4BOZB 3OOCA 2E3TA 1U4RA 2ZJQA 3OG5A 3TP7A 1H9MA 2ZTCA 1EY6A 4NJCA 2O2VA 1EOTA 5M9OA 4HDQA 2GVBA 3SHLA 3U30A 4YSYB 2L5TA 4N9TA 2UUCQ 4JI7L 1FGUA 3LDZE 3ZKJC 3BK1A 3AE9B 3AEGB 3GTMH 1IPGA 1WJJA 4AQ7A 3H0GG 5EKLA 1KLVA 2Y0SB 3DVGY 5J1ZA 4IALA 1OGWA 1JJGA 3CXCA 1IYUA 1EU4A 2VQFQ 3GTPB 3ZGZA 1N34Q 3SEBA 2ALYB 1C9OA 2JE6I 1E10A 2EQSA 3DEPA 1IHZA 1DYQA 4OX9Q 3WOEA 1RLFA 3G4SA 4NQLB 3PF5A 1LTLA 1STBA 1UE7A 4C3IB 4Y7NH 2GRIA 1KAAA 2H5XA 1XMOQ 1JW9D 1PYBA 2PVOD 1HQMC 1J7AA 3M4PA 1OQRA 1P0RA 4OELB 2BBCA 4W9LA 4EEWA 2B2YC 1Y56A 5IY0A 1ZYRC 4II2B 4H13C 2IDYA 4DK5A 5ELOA 2KK8A 2CQOA 3CC7A 2R92B 1G6PA 3RZOB 3ZNZB 4A90A 4A3GG 3ALBA 2HHHQ 2IHFA 2FMMA 5C44G 1LQBA 1IYJB 2YTXA 1VQIA 4RMAA 4HK2A 5G2NA 3FMCA 4LW1A 4C1NK 4JW0A 1RYJA 4NNJB 4C3JB 2JSVX 1B9RA 3H3VC 1KLGD 1BOSA 2A6HD 4W9EA 3HOZB 4O1NA 3PREA 4IM2A 3PCOB 1JWUD 2HDMA 2KCTA 1BR9A 1IBML 1RRBA 1SNMA 4BWGB 2WYQA 4IN3A 3HUIA 3APDA 3J9CA 4FBJB 3OWFA 1CKOA 2IJ0A 4R8IA 3KF8B 3PIOA 5M3FG 4URKA 1OO9B 1YNNC 3OYYA 4P74A 1N5WA 1KNEA 1DOIA 4MSMB 1E7UA 1SN8A 2ON8A 2LI5A 1PH2A 3A9JB 3ZLZA 1A0IA 2KECA 2WX1A 3M62B 5LMNQ 5GXGB 3QWZB 4A3GH 4WWMA 3KVFB 5CHWA 5C44H 1K28A 3A56A 1U4MA 3RNFC 2FCNA 4R1JA 1N61A 2UXCQ 4JYAL 1PH1A 2N1WA 1T5XD 2Y5PA 1F2YA 3VYSA 2N7EA 4C1NI 4IUQA 4LFCQ 2MW5A 2BB6A 4GKJL 4ANUA 3W5UB 4DBGA 2WX0A 2NTTA 3CCVA 1XT9B 1UE1A 4JBKA 1UUPA 1IYVA 4ZCKA 5C4JH 1SE3A 4JI8L 1YD8U 2K8HA 4NJ7A 1VQ9A 1VQLA 2JA5G 2PZTA 1G6JA 5H1SE 2UXDL 2V9HA 4JIOU 2FXQA 1NSNS 1C1YB 1PH8A 1EM7A 5JPMC 1UZXB 3RZDH 2N9PC 2PE9A 1UE5A 1TWCB 1PFDA 4JVZA 5BYQA 1TS2A 1HE8A 1LYLA 2HTHA 2KVZA 1CQFA 1K3BC 1KD1C 2R7ZG 2WV6D 2L7RA 4A3JB 4JI6L 2KEEA 4OIKA 3FAHA 1WE7A 4ZRZA 1NY4A 1RF2D 2RKSA 1GD7A 4WJWA 2QJLA 4K2KA 4DR5Q 2OCEA 4QAYA 2L55A 1VQNA 2N3SA 1HA5A 4FLHA 4A3IH 1N5XA 2H88B 1DONA 1MGSA 5IGGA 1HNXL 1VZ8A 2EKIA 4JWUC 2NN6I 2D3CA 1S5CD 1QLBB 4I6PA 2OF1A 2LGDA 1HZAA 2JYEA 4KKUA 4ICUA 2PI2A 2IT1A 3I8ZA 1Q46A 1IBLL 2A1AA 3IAS1 5AEKB 1WXQA 3E56A 1PHJA 2KVMA 2R7ZH 4LF8Q 4L63B 4YSXB 3NUCA 1XNQL 1K3RA 1GUWA 2VQEL 4IO9A 4DV6L 1G2SA 4TKOB 4OZBA 3N1YC 4HWIB 3GP7A 4JI5L 2ZJPA 2WXHA 3QA8A 3NUHB 4LJZC 1Z5SB 3DPDA 4JI1Q 3BY4B 3H7PB 1CHQD 4JCVE 5LL6S 3PLUA 1V1PB 1SAPA 4A3CG 3QK0A 4XX5A 3H0GB 4JV5L 4Y52H 1FRRA 5I6YA 1L6UA 3QQ8B 2KHSA 1SNDA 4GKKL 4PT5A 3KLWA 2KKCA 4F8CB 1OXSC 1PYSB 1QG7A 5JEAG 3J80L 4QGUA 4IG7B 1HNWQ 4RHSA 3ZVVA 1OXUA 4C2MH 1MVKA 2NN6H 4PMBA 5HHDG 2INPE 2N9LA 2DJFC 1BO0A 1WSPA 3X3NA 2NR2A 3RR5A 4EE2A 1SYBA 3A5ZB 4GOPC 1VQJA 4K8IA 1OTRB 2WXLA 2VRRB 2JZZA 3HRZC 1ROEA 3B2FA 4L23A 4J6IA 4WWPA 3RI7C 1EF1A 4CGYB 3NBHB 1A2UA 2CCZA 2L9HA 3GTGH 1WFYA 4HEDA 5C3EG 4A3GB 5L95C 5C5LA 4DHZB 1K51A 3ZNGC 1DOYA 5C44B 2NPTB 2BF8B 2M17A 4IWOA 2Q5WD 5GAGC 1YNXA 3NTIA 4G57A 1JORA 1FIQA 4JI3Q 2RA4A 1SGHA 2KTFA 2CW0D 3FKYA 3NS1A 4MJSB 4CKCA 3QX1A 3BDLA 4DV4Q 4B3RL 3EGRA 1SJED 1E24A 4HCSA 3W1GA 5I9PA 1OXTA 3P63A 4GS3A 4N9F4 2EYLA 3U8ZA 2KUMA 1R9TH 5M3FB 3I3CA 2ACZB 2M9VA 2Z1CA 1RM6C 2GBMA 4ZRPA 4C00A 3DM3A 1CZPA 1LABA 2K8BA 2V4DA 4RGNA 3RMKC 1LTSD 1MD2D 5C3EH 4CJ0B 2KLGA 2MQJA 3IAM1 4HRSA 2B2TC 4B08A 2Y3AA 5T8IA 1DM0B 1QNUA 4TSSA 1K9MC 2UUBL 1FCCC 1XLNA 3Q2AC 2M19A 1T0RC 1Q8KA 3MXPA 1DZ1A 1WWTA 5FLMH 1QOGA 1XCTL 2N0SB 3PV1A 3JAML 3S16H 4R4QA 2JUOA 2K0PA 1E2VA 2PI2E 2A6HC 2K04A 5CHVC 1X1MA 2JA5B 1S5FD 3F2DA 5JHBA 4UP8A 1C48A 1D6EC 1H9SA 1EFID 2DBYA 2Z59B 5IP9H 4ALPA 5GMVA 3RT3B 2RDFA 4ZRKA 2NVTB 2ICIA 1OXVA 2L1AA 3K7AH 3Q8AA 4PNYA 1BQQT 3M85A 5CV9A 4WFN3 5HI1A 1V97A 4V0BA 2XK5B 3RD2A 2CFMA 1EYGA 1I6HB 2K39A 3OW7A 3GDEA 1PH5A 3LX0A 2IL8A 1EO6A 3AEAB 2R7ZB 1E7VA 4KVGB 3LWUA 4BA2I 3K59A 3DWMA 1BBUA 3MTSA 4P1BC 4WJOA 1XX8A 2HD5B 1NVID 5FR6A 1JE4A 4YCWA 1VQMA 1SEBD 1WGGA 1Q7YC 1BUIC 4I6LB 4KKJA 3S1MH 1KRSA 4A3EG 3I72A 2ZTEA 3H94A 5G5HA 4K2LA 3NY5A 1N33Q 1O7ZA 1ZUD2 2MBEA 4AIMA 1UAPA 2R2OA 3OMGA 3TP6A 2WXQA 4JQWC 3ZUNA 4OVVA 3IKJA 5DM63 5C3WA 1T5EA 1SFOH 4OO1I 1VMPA 3HS0C 3TBLD 2F3WA 1NDDA 4S0RA 3RZWC 1D5ZC 5BN5A 4E71A 1EOVA 1STYA 2F0DA 2B2VC 1Q90A 5CV5A 4LF7Q 1ZXHA 3AI5A 4KD4A 2X6LA 4RCNA 1ICWA 2ENBA 2B8GA 3BYYB 1CSPA 3S14H 3I91A 1K8GA 4GGQA 1X65A 1IBXB 4HSPA 1K52A 3J80i 3A8KE 4XDDA 2V0GA 1V8QA 2MP2B 2G3QB 2K52A 1EUJA 1TTNA 3KYDD 3DBSA 3C1FA 1VJKA 4KI0A 4JPSA 1WGRA 3V2TA 1S1QB 1IKLA 1LTBD 4A3EH 1KLUD 1C0AA 1YMHE 4IURA 2BQQA 3C46A 2NWGA 2E74C 1V1OA 3S9WA 2JU6X 4LWCA 4FHJA 3UI3A 4UDUC 2B63H 2JWUA 2UU7A 5DEHA 1WE6A 1UEBA 3QOLA 5AUIA 3D0FA 4NQKE 3N1XC 1GM5A 5CV6A 2EPBA 1XPRA 3GTKB 1WRIA 4GLSC 5KEEA 3NVZA 4OVUA 1Y8NB 4QCLA 3OWEB 2RSUA 4X66Q 4P1CC 2ZXOA 4OO1H 1RD9D 2WB1E 1BVSA 2IPKD 3UIPB 2PQEA 3T56B 1K8RB 1J9OA 2EY1A 1E7ZA 1I3QB 1R9TB 2LHDA 3ABVB 2JEAI 4O42A 3T9LA 2KN4A 3KDFA 2DNEA 4WWNA 1XNRL 1I6VC 1B9NA 3ECIA 1F2RC 1XD3B 1IYFA 2GMIC 1VRAB 2GOWA 1WM2A 3RN5A 1JICA 2P5ZX 4H02A 1RAXA 3VAWA 4AS1A 4K6LA 2XGTA 4LTUA 4HKQA 4L5SA 4ZHPA 1EQRA 4OWXB 3V6EB 3TUOA 4A55A 4P2CB 5C0XJ 3APFA 2KCNA 4X62Q 5A2QE 3S16B 1QOBA 2KDFB 1L0WA 4BY1H 2RSOA 2CWAA 2F4VL 4LF4L 4WWOA 2IX1A 3JAMi 1YX5B 1BCPB 1YBYA 5FO8B 2QDBA 1FCLA 2D2QA 3QR8A 4DAVA 1SBBB 3K8AA 1YJ1A 2K5WA 2JN4A 4CHTB 3WDNA 3T3OA 3AFQA 3G6EA 1L0XB 4EQOA 1F2MA 3NK9A 2BA1A 3MXNB 1QOAA 5IYBH 4W9KA 3BK2A 3JSVA 2A19A 2OTLA 1EWIA 2AWOA 3HG9A 1WFQA 2PYKA 1YJIA 3HOVG 2L00B 2CW0C 2QEJC 2H4OA 2K28A 2Q2IA 5E1FA 4ZKCB 3NOBA 3Q69A 2N1VA 3N20C 4KZ0A 4G7HC 4BFRA 1J6QA 3AXCA 5J3BA 4DV7Q 2JXTA 3S1MB 2REXA 2XIWA 4HSVA 4NJ6A 4GNXB 4EKUA 4TMAB 1WD0A 3TP8A 2DAJA 1JB3A 4I65A 3JAME 2LZ6A 2OXPA 1E1TA 3AEVA 4GSWA 4L5QA 1XLQA 5CV7A 2M0AA 1STHA 3KUPA 1I7HA 3DVNU 1I4GA 1FNWA 1PDXA 1TS5A 3ERQA 3NE5B 2W55A 4JI2Q 2TMPA 3HHMA 4OWWB 5EE3A 3WAPA 1UH6A 3WA0A 5JAVA 1QUQA 4JI0Q 3NVYA 3TN2A 3VR3A 2LASA 4F8MA 3HOVH 3P1HA 3LB8C 4US9A 1IZ6A 3PO0A 1FVIA 4MH0E 3AE3B 4IC7B 3IFWB 2F0HA 4CO7A 1ET9A 4DV2Q 2LJ5A 4BKTA 3N9YC 1SROA 1VCIA 4A3EB 1WX7A 1GUNA 4M0WA 5G55A 1BBWA 2ZPNA 3E0EA 1EY0A 4HMIA 3S1RB 1FYCA 2XWJB 4R4TA 1D4BA 2LFIA 3Q22A 2QC8A 2JVCA 3GTOB 1SYCA 4R8NA 5KGUA 3RLFA 3OTOL 4PYZA 1I50H 5G5GA 2K14A 3QOJA 1STAA 3J7YW 5JJKA 1KIXA 3KOJA 3HVDA 4FF2A 2YYZA 3KUZA 3EN2A 2LS01 4FXGC 4XGAB 2K5DA 4RAUC 4DUZQ 3CC4A 3J81L 5HURA 4WH4A 2BTEA 2JZPA 1HR0L 4IFDG 2I46A 2D5GA 2XRQD 1HJPA 2DY8A 3RLNA 4GDLB 1VZ6A 5A35A 1STGA 2OOBB 4X64Q 3T1HQ 3A1QA 4YL8A 1L1OB 4LJPB 3RN9C 5FOBB 4ODGA 4X65L 1L1OC 1EIYB 4DFAA 1XCQL 1PDQA 2VS1A 2ZT9C 4MZ9A 1M1KC 2KA7A 1WTQA 4GOCA 4MN3A 2DZMA 1XYIA 3DWQA 3MEFA 4C4VA 2FBWB 4K8JA 2MQHA 4BBRG 3M7GA 1WTVA 1N62A 3BWUD 4EFOA 2RVLA 3Q3FA 5C0XI 4DR4Q 1YITA 2NMQA 4MTKA 4KV6A 4DK3C 4DK1A 2J0KA 4DK0A 1E8YA 2EYMA 3ZRCA 4LAAA 3W5OA 3NG0A 4YY3Q 3HZXA 2ONQA 4W9HA 1J0GA 3EBEA 3A4SC 3A8IE 4FHKA 4FJYA 1QOHA 1SE2A 1UF0A 2Z6KA 5D6JB 4F7XA 4RNAA 3VTWA 3IFTA 3RNEC 4RH6A 3AE2B 3K81C 1RTNA 3L54A 4KGTA 4KX6B 5BR8L 1RDPD 3OIPA 3MJWA 4DPGA 1YIWA 2AHOB 3STBD 3I4MB 1SLJA 4BBRH 3K5NA 4J1MA 3RN2A 1TKGA 2DHZA 1TS3A 2PQAA 4J15A 1I94L 4AYBE 3M4YA 4DV0Q 4DQOC 2KFKB 4IW0A 4YHHQ 3MA2B 1QOFA 2RD0A 1VF7A 5KNCA 5JZEB 4KHPL 2LMCB 1W6KA 3W1SA 4RHRA 5EKKA 3W5VB 1YQ4B 2A8VA 2QEXA 4IOCA 1GO3E 1VQGA 1DGSA 2B76B 2B29A 4IUUA 1S4ZA 5AJ3Q 2EMTA 1FXTB 4W9IA 3SDLC 1LM0A 4IPCA 3L2PA 2F0IA 2EKEC 2F1MA 2RDHA 1ESFA 2PIAA 3DDCB 3L0WB 1C4CA 2VUMG 1GJZA 1PMRA 2ZXRA 3ZDMC 1QZHA 2JA7G 3PPAA 1WZ0A 3R3OA 4NY0A 1V1QA 3F8TA 2F0UA 4BAXA 3TIXA 3S2HH 5IKCM 3PIPA 4HCEA 4HMJA 2UUAQ 2EJMA 2YVCA 4DAMA 3IHPC 1SDFA 1V9PA 3U58A 3DWPA 4DR7Q 2LXCA 1SNOA 4DAYA 1KAWA 1CJEA 4A9AA 4KY5A 1FD6A 2E2HB 2ID0A 3AE7B 2JA9A 2VY3A 2K3UA 1E90A 2MEKA 2JXXA 3AE1B 4ICVA 1HNZL 1TWHB 4GU2A 3P42A 2JYOA 3M4QA 1U0LA 1RTOA 2K4KA 3N6RA 2FHTA 3P7JA 4K6DA 4MIUA 4R4OA 3T16A 4ZKBB 3DLLA 3I4LA 3QO2A 4QQBX 2KC2A 5JPNC 1F2ZA 1XMQL 3PIO3 2NBFA 4NB3A 2IZVB 2M8SA 1V5OA 3HP3A 4NXNL 4HJ9A 2C7HA 2JA7H 1E7PB 3F2UA 3D6WA 2OEOA 4GN4B 1N36Q 3VR4A 2O2VB 1ZXIA 1QZEA 3AQQA 1L5PA 3SFEB 4F87A 1I50B 2QW7A 1E0ZA 2E2DC 4HTHA 1O7LA 4N58A 4NZLB 3ZJVA 2M0XA 2TSSA 1QB5D 4DV5L 3TREA 3MAQA 3V62A 3KBXA 3AMZA 4TRDA 4IKGA 1EWYC 1B53A 1Q5WB 4Q5VA 1KXLA 3J81i 1IL2A 3PZ7A 3HEJA 2L32A 2K9XA 3E9SA 3O65B 4A3FG 1PTOD 4JI4Q 2RHSB 3Q3NC 4IQZA 1TU2B 3AEEB 4ME5A 1C9FA 2F0TA 1JCKB 1IBKQ 1WOCA 1KTKA 4LF6Q 1MG4A 4B0EA 2F0WA 3I56A 1MPEA 1ZKHA 1EY4A 3ZW3A 2LGSA 3RULA 2N78A 1HA6A 5I2YA 1GUSA 1OXXK 5KIXA 4HKZE 4KKSA 4NKLA 4LFBL 4DR3L 1G291 4QIWE 1YJWA 1ZOYB 3UIOB 5JH5C 3AE5B 2HCIA 4LF9L 1EYCA 3AE6B 1WR1A 3OAWA 2BKFA 4BBSH 1WY8A 3T1YQ 3EHVA 4JBMA 1X55A 3NZSA 1WMHB 2K01A 4TQUS 1YIJA 3HOWG 2BA0A 4WJ4A 4OZCA 2JQOA 3KF6B 4A3FH 1L6VA 5DPTA 5HY6A 3J81E 2KYWA 5ELEA 2L0FA 3FRPB 5KNBA 2FFKB 5LMNW 5IGBA 4EZKA 4LUOA 4I6NB 4MDKE 4BBRB 1H8CA 2ASQA 4ILWA 1YHAA 2K7VA 2LVOA 2JEBI 2SDFA 3BJUA 1SYDA 4L5TA 3C0RB 3WALA 3UQBA 3MHBA 1FNUA 3AH7A 5CC4A 1I4QA 3ZQ4A 1YN5A 1AE2A 2SAKA 4JL9A 2K22A 3B6YA 2MUYA 3GTJH 3DHHC 2VB2X 3HOWH 4JGHB 3VVWB 1U5KA 4JI7Q 2EJFC 2I07B 3S1NB 2DZIA 3PHWB 2Z0EB 4MGKE 3L9AX 2WKDA 3UGBB 1PTOH 2WB1G 1D2BA 3R2TA 2FMCA 5JJZA 1KC8C 2H89B 4MACA 4EVOA 2LUMA 3SR6A 4DNIA 5HGTA 4K7SA 4NW2A 3FILA 2JF5A 4LF5L 1PZKD 2VXWA 2ZNVB 1OFFA 3S2HB 1Q1OA 4WRDA 2ZNVC 1YN3A 3H91A 1AN8A 2DGYA 1NMFA 3CCMA 2GBJA 2BE5D 3CQZH 4RWSC 2WAQB 2L83A 3M3JA 2KQ3A 3B2GA 4KDLB 2EY2A 4PZ8A 1R4MB 3HKZE 4KKTA 4B9WA 2AL6A 2W3SA 4YWMA 4JLCA 1BNZA 3ZNHB 2WLBA 3R66C 3NRZA 1J5EL 3ZJUA 4J6HA 5H8YE 1HCZA 1U4PA 2A5HA 2VUMB 2KN5A 4MM3A 1KRTA 5KYIA 4BXXG 3PZDA 2JA7B 4LNIA 5LL6X 2NB0A 3K6OA 1R4NB 2QGQA 1KDCA 1E8WA 1FD7D 1ET6A 3PUYA 2DAFA 2D10A 3STBC 2EY5A 2K32A 3PO3G 1JOQA 2C7MB 5E6JA 4CDDC 1UWMA 3UDGA 3W1BA 5JHAA 2KMMA 4LNNA 4ZLTF 3U7ZA 4KY7A 3KBGA 3GTLH 4IUVA 2UU9L 2BS2B 4YIJA 2K25A 2MNAA 3SVMA 4DV3L 1IBMQ 3C2PA 1J8IA 1SNPA 2INNE 3CMMB 3IRBA 3DCGA 1Y1VG 2FIFA 3ZTDA 2HJ8A 2L12A 1G91A 4GB9A 1M8AA 2KCMA 4FF4A 3CW2C 3CCJA 1V5TA 4C80A 5CTRC 4ZOHC 2C7NB 3U7DA 1YQBA 4BXXH 3CKIB 5DAUA 3A7AB 1KM7A 3A9KA 5M3MB 1XEEA 3PVLA 1FRDA 3R3MA 4HPMB 4W9CA 2WU5B 3CCEA 3DBRI 1SJHD 3OW2A 3PO3H 1VQDA 2KX3A 3A0JA 1XLPA 4DXAB 4X3UA 4JYAQ 3DHIC 3I7FA 1V86A 3J7AF 3ML8A 3K5LA 4A3IG 4XTCS 2NVXB 3EA6A 2Y5CA 3EFUA 3H7SA 5C23A 2MP1A 5IODA 4UY8C 2J53A 5LXIB 4JWSC 2RR9A 5CHFA 3OLMD 1Y8OB 1ONLA 1RCVD 4LMQD 1Y1VH 3P1MA 4JI8Q 2NVQH 3TZDA 1YJJA 4A3FB 1D5XC 2JQRB 4W9FA 3ERSX 2UXDQ 5DPSA 2EIFA 2G9HD 4PZ7A 2AQ1B 4DV1L 1TKWB 4HR7B 2KC1A 3W1YA 1ZW7A 1X3EA 3SXHA 3I57A 2EVBA 2BKRB 3PT2B 5BYSA 1HPCA 1A15A 1D3ZA 5DPWA 1AARA 3GTMB 1AWDA 1AH9A 4JI6Q 4RCOA 2R3ZA 2LSSA 1F52A 2F0FA 3ITPA 2MCNB 1STNA 3MXGA 3NPPA 3CSFA 1XO3A 2CQAA 1GNUA 1H9JA 2KOXA 2B2WA 3GTJB 2LXJA 4N8FA 3TS2A 3AE4B 2OT2A 1K0SA 2DYOA 1A5RA 1VQOA 2Q2TA 2WXKA 1PTOB 4ULLA 3KF8A 4ASWC 3PRZA 3P75A 1C77A 2CS4A 4Y7NB 1PTOC 2NN6G 2WXIA 3SDZA 3BDOA 5AUKA 3CCRA 3MC8A 1HNXQ 5IE8A 3A9JA 4USAA 3AM9A 4A8XC 5IWAL 3PGEA 3I4NH 1TGZB 4MH8A 2KMAA 3AECB 2MA9B 1IBLQ 4JBJA 1P16A 1M90C 2RDBC 2KFJA 3I4OA 5FO9B 5ELBA 1XNQQ 2L8JA 3CD6A 3IT6B 1HQRD 2V1YA 1UWVA 4UP7A 3HOUG 1LGRA 2KQ4X 2VQEQ 2FINB 3PV0A 4DV6Q 4UP9A 1PRTD 2I5HA 2WFWA 3VDYA 2AQ3B 2MBQA 3F1ZA 3NTHA 4R4CA 2V4LA 1MSHA 3ZIMA 4IDIA 1IGDA 1BCPF 2WB1B 2QMTA 4K5WA 4FA6A 5C1ZA 1HRJA 3KUDB 4JV5Q 2I1KA 3DBHB 1UGMA 1J8CA 2C35B 4GOPB 1NJIC 2KLCA 1E1OA 1LTID 3L3OC 3EVQA 4HIDA 5G3LD 1SYGA 2EYPA 5T1IA 4GKKQ 4A3DG 4JC0A 1F9QA 2JWZA 1I4HA 5IAAC 3TEXA 2LXKA 2GBKA 4AJWA 4JPBW 1E6EB 1EF5A 3I90A 4XC2A 3NXWA 1NEKB 3GTLB 1ZEQX 3HOUH 1YNJD 2C9OA 3QIJA 2OQKA 4OVZA 3W3AA 4W9JA 3VYRA 5FK9C 2JYTA 1HTQA 3BS1A 4GDKA 1DOKA 2MRPA 1LT3D 4MNOA 4OL7A 1PV4A 1FPYA 4PG3A 1YHQA 1C78A 3AN1A 5FLMG 1NYRA 1SIFA 5FJ8G 3EFCA 1N9WA 1AZQA 2WXRA 3AV8A 2BDNA 2KVRA 2FJ2A 2K1FA 3N30A 1C3TA 3WAOA 3K80C 2K5VA 5C4JB 2KD0A 4RGMA 4A3DH 2HUGA 5J39A 2KDMA 1EY9A 5BN4A 1ENCA 1I35A 1N32Q 2B3GA 2WKCA 5IP9G 3FKIH 1TIID 1RL2A 3KYHC 2AMCB 4GLVB 5CBEE 4B3RQ 2BE5C 2JSOA 3SK5A 4DF7A 1WTWA 2RBMA 2XTIA 4CBVA 1FEHA 3RZDB 2DZJA 3RNBC 3BU2A 1LO5D 2W9NA 5IN7A 4XZ4A 1IKMA 1Y1VB 2EY6A 2K05A 2RCNA 4OXPA 3CMAA 4A3BG 2PVGC 4OEMB 3NZUA 2G4SA 2MJ3A 2L3ZA 5I6WA 1M94A 3ND8A 3VYTA 2EYHA 1E8XA 2UYZB 4AH6A 2Z0DB 2A73B 4A3KH 2FNJB 3KW5B 2KNBA 5FJ8H 2ZM6Q 2DJGC 1V1PA 1WGYA 1X6OA 2HQEA 3Q8EA 4WQOB 4DWFA 1WR6E 1L7YA 4FXKC 2IO3B 5IOIA 1TZOA 4TV3A 4EQNA 1VCBA 4A3IB 5I2XA 2F52A 1TWGH 1Q86C 2JA6H 1EWHA 2F0SA 1L4DB 2KBNA 1EZ8A 2CHBD 5LMUL 2CWPA 1PH4A 1JALA 4RMFA 1IXRA 3ICEA 1WZ3A 2RPQA 2A74C 1CHPD 3OHXC 2QHOA 4KSKC 4A3BH 1GC7A 1V2YA 1JWMD 1VQFA 1G51A 3CCLA 1LXDA 2INCC 4B95A 1S5DD 2BW2A 2C9WB 3QB3A 1Q10A 4P72A 2OWOA 4MGYE 1C79A 2CU1A 1XJVA 1H95A 1LT5D 1PFSA 4E6IA 1E22A 2KACA 2NVYH 4RM8A 3H6NA 1ASYA 1KL9A 4BKGA 3NBHA 4PMWA 3TL5A 1QJOA 2V3SA 5AZHA 4CDEC 3TMPB 4KJOA 4BVUC 1GG3A 4FDBA 1PGBA 3ZXRA 2BYFA 2B63G 1VQHA 3KWVA 2IWHA 3ZNID 3KDFB 3S2DH 2EELA 4KIKA 3X23A 4HJ5A 4CHKA 1DOXA 4US8A 1V43A 4AQYL 4B3TL 3M95A 5J2RA 2K6QA 1Z7TA 4KN7C 1EU3A 2KCCA 4C2MB 4OO1G 5I9OA 2HDLA 1QNKA 4DUYL 3KLRA 2KMCA 1ML0D 2INDC 2V4IB 1L0YB 1XLOA 4KHVA 2XEWA 3GE8C 4K3BA 4JG2A 3C3LA 2E8GA 3J7A5 1TIFA 4G7ZC 4KN4C 1WCMG 4HJ8A 2CHWA 2CKHB 3MHSD 5L37A 1GB4A 4H0LC 4AOFA 1TBEA 3H9DA 1HXYD 3OSOA 3GTGB 3HOUB 2WWZA 4WAFA 2YTYA 2AUJD 5IT9L 1WGKA 2RMMA 1SE4A 4DN4M 5E6OA 2GN5A 3Q23A 2WXNA 3K57A 1WXAA 4K81A 3JSVB 4KKIA 1EYAA 4K0KL 1GB1A 5IOCA 3RD4A 4QUFA 2Z4IA 2J4XA 1GUAB 3MP9A 2K33A 1Z9FA 1UWXA 4BY1G 3Q24A 1D1IA 3J80E 1SB3C 3ZJTA 1GUTA 5AZFA 2WDTB 2KTRA 1QT9A 2LGIA 2XK5A 4CJ1B 2M2LA 5M5YH 1WCMH 2PZWA 4M1UB 2LWPA 1EWCA 3JC66 4H44C 2NBUA 4HDOA 4KTAA 3X3MA 4CQNA 2PPHA 1TQOA 1XTCD 4HIMA 4FYDA 5C3EB 4XYOA 1MKHA 1QWYA 1F1HA 2AEHA 2N4FA 3EUB2 3V60A 2WS3B 1O78A 1H9RA 1PRTB 1ENAA 2L52A 2K5NA 2HDEA 4LNKA 4WJPA 3NQIA 2PJHA 5IYBG 1PRTC 1I4RA 4ZUIA 1NMGA 3HKZG 1T6BX 3OJ4B 2VZAA 1QUQB 1LTAD 1Q8IA 1PFMA 1R4PB 3R93A 2JXMB 5FLXL 3K5MA 1XPOA 4YCVA 3RCZA 3OJ3A 3MVVA 4X3KA 4DR2L 2A69D 1GVPA 1VQ4A 1Q1BA 1LTTD 3KJPA 1UE6A 2QDLA 3ETRA 3I3TB 3N1ZC 3NSWA 1AW7A 1PZID 3F2CA 2F0GA 1CA5A 3A8JE 3RFZB 2BVCA 3K7AB 2KJRA 4DHZE 3HOYH 2EJGC 1IBXA 1K8OA 3MTNB 1VQKA 1YNJC 1BDOA 4LF4Q 2F4VQ 1N8RC 1B50A 3H8HA 4EZLA 3UE1A 4DR6L 3UE0A 2LGXA 2DN8A 2NYZD 2LRWA 1SE8A 4C3HG 2YU9H 2WXMA 5D14A 4K7UA 1L2NA 1J7BA 2E5LL 3HKSA 3TEWA 2WXFA 5EBCA 2QA4A 1W3SA 5JVG3 2HE7A 2NVYB 2BCOA 4QL5A 3TEHB 1WJUA 2KJHB 1A8VA 1YI2A 2E6XA 3P4RB 3PHXB 4E3CA 5JXVA 1LV9A 2LUEA 1SYFA 4RFBA 4ZRQA 3WWVA 1JWBD 3AB9A 1TYGB 4DHJD 4RKBA 3APCA 1HUMA 4MGZE 1EEFD 2NZOA 4KY6A 3U9SA 3JAMc 2EXZA 3BG3A 1E9MA 3CPWA 1HZ6A 3WCQA 1TWFH 3N52A 2MJEA 2MSED 4I7ZC 1VDVA 3DBLI 3S2DB 3HIZA 1AE3A 1SFOB 4GN3B 4LK1C 3E9IA 2X8XX 2Z9HA 2GB1A 4C4VB 2WXPA 2F0NA 2L15A 5E4XA 2EYJA 2O6VA 5IYCH 1WTXA 3IXSA 2KDIA 5C3XA 4C3HH 2ZEQA 3S14B 2CR5A 2BDOA 4LFAL 2VNUD 1FO4A 1HFGA 3Q6SA 3L17A 2GA4B 1U9RA 4Z9CB 3KUCB 3QAQA 3OMCA 4X3SA 4F1SA 2RQXA 3GZNI 1EIFA 4P71A 1AYFA 1V8CA 2AX5A 3AYHB 2JJQA 4DR1L 2PMZB 2JRHA 3ZRFA 2Z6KC 3AE8B 3I5JC 1VDZA 3AB5A 4OZAA 4YTNB 2B63B 2N7DA 2PCFB 4U68A 1EQTA 3SE0A 2G5DA 3BVGA 3DEOA 3TMEA 2JY6A 1JQYD 4KK7A 3L4PA 4LUVA 2F0JA 3SHQA 5LXHA 4I7AA 3MC9A 4QIWB 4GN5A 2QKIC 4GXBA 1IW7D 5AFWA 4TVAB 3MXUA 3TBIB 3L10B 4ABNA 1FJGL 2RF4A 3VH3B 2JA8G 4AJYB 2HIVA 2IO1B 2IY1B 2GI9A 3DXJC 3OTOQ 1V80A 2UXBL 1YOVB 3W1SC 2WXOA 3VYUA 1Z47A 1I5FA 4L6TB 5M5YB 3VXWA 4CDFC 3C8YA 1CZGA 3BZDB 5FKAC 4NPSA 3G71A 3MFYA 3DHQA 2LY7A 3PSIA 1PH3A 2Y5BB 1ILQA 1HR0Q 2MLBA 2LJIA 2PW7A 4EGVA 4BY7G 3I2ZA 1WI0A 2DZKA 1O7YA 3AFPA 4X65Q 2K5HA 3NTKA 5EGTA 2CKZB 2XVSA 3EROA 4GNXA 2J0MA 1K83H 5IT9E 5C0XG 4IJHA 2JA8H 3AEBB 3HGBA 1UGJA 1PUTA 2LD9A 4GLXA 3NWTA 1G8ZD 4BY1B 2L05A 2KHJA 3ULPA 1GUGA 5IP7H 4ZDVA 3CF5A 4B3SL 3RZFA 2B39A 3U4EG 1ZKOA 2WP8J 1WIAA 3UINB 4QY7A 1V81A 1JRUA 2D9UA 3OPOA 4BS9A 2ZW1A 5EAYA 4HCPB 1S5ED 5M5XH 3A7LA 1ZPSA 3IVFA 2MBOA 1GUOA 4K5VA 1BT0A 2ZCBA 1LT6D 4FULA 4BY7H 1K0RA 4ID6A 2ASBA 5BR8Q 2D07B 3D6CA 1XQQA 3BVMA 2ZVNA 4OW0A 5C0XH 4P7IA 2O2LD 3IL8A 4BKSA 1B1ZA 3NEMA 4R4IA 1AP0A 4XQQA 3IBEA 3R7RA 1IL8A 1VQBA 2FAZA 4FXCA 3P4SB 1D7QA 5I4DA 1I94Q 2N49A 3T3NA 5FLXE 2LRUA 2PTLA 1ZXTA 3QJYA 2XWBB 2X69A 1FFVA 4GMVA 4WJNA 1TWFB 1CM9A 4ZQ3A 4KHPQ 3NP8A 1R4MI 2MBBB 1VQCA 3Q8BA 1YNTE 2J0TD 1Q82C 2L11A 1PH7A 1S3SG 5K36G 4MT5A 4NXML 4LUZA 2GLSA 2OJWA 4IOAA 1JT8A 1HTOA 1GKHA 3QWNA 3M4OH 4GDLA 4C3HB 1Q81C 4YSZB 3T51B 3HOVB 2A4ZA 1X32A 1BKBA 4B0MA 3VA5A 1IUEA 1R4NI 3GTPH 1SE9A 1IP9A 4K5XA 2KAJA 3L08A 3V6CB 1PH9A 2WU2B 4C3JG 2Q2UA 3A5UA 1X9NA 3PLVA 3ONSA 2AUKA 2E75C 3AMUA 2KWVB 2MFIA 2A69C 4B3ML 4B9XA 2D3BA 2HIXA 1W6JA 4ZYNA 1B3AA 4CKBA 3RPFC 3VUYA 1PFNA 4TQ1A 1MI2A 5BO4B 2PW9A 1NR2A 1X54A 4ITKA 2B2UA 5K36H 1HNZQ 3M3YH 1J7CA 3MEHA 5C4ZA 1HZ5A 4A76A 2R92H 1SMYC 1B8AA 2PW5A 3RZOH 2NTSA 2MJDA 1XMQQ 2MPMA 1CQVA 3N3KB 1PTOF 3OIQA 4FP5D 2QF7A 4XXEA 3UDFA 2K50A 4NXNQ 1P7FA 2F0MA 2JPHA 4HROA 3KLSX 4QMGA 2D0PA 2DUDA 2K03A 2RPVA 3AEDB 4BBSG 1UELA 4DHJB 4HXDA 4C3JH 2ICEC 3QJZA 4PS8A 2OEDA 1LTRD 2I0QA 4DAPA 4JX1C 3MWYW 1PA6A 1BUVT 2GVAA 4DV5Q 1T0QC 1DGJA 2LMCA 1D1KA 2VH1A 1ZE3D 3GTQH 1E2WA 1EY5A 3FILB 2D2CC 1WF9A 1X3PA 1B44D 3ONAB 2VB3X 5ELCA 3U50C 1T3QA 1CT1D 1B7YB 3S17H 3B08A 3SU8X 1K73C 4FXDA 2PEAA 2LVQA 4ARCA 2LGYA 2LEKA 3QCAA 3A4RA 3GQBA 1Y69U 3UQAA 4JOIA 4DDID 1VQ7A 3S2AA 2QDFA 2JK8A 1UNSA 3DUZA 3ULLA 4KZCA 3VR2A 3J81c 3CIRB 1QQRA 3GS2A 3S15H 1JWAD 4LFBQ 4DR3Q 2R7FA 3I55A 3KWLA 4LF9Q 5E6PA 4IUNA 3PUWA 1WTHA 2XRSD 4HN7A 3CF6E 3PUVA 4HLEA 4ZRIA 2PKOA 3EC8A 4N6EB 3KFUA 2F0EA 4HCNB 4FN2A 1GPXA 2QILA 4N8X1 2UUCL 2IO0B 4TUUA 4KSLC 4RF1A 4EUTA 3TCAA 4D2KA 1F77A 3TSSA 1IW7C 2R2QA 2Z6BA 1R7SA
chains in the Genus database with same CATH topology
1G2TA 2Z4HA 3K58A 1E0BA 2KJXA 1BBXC 3PMFA 2MGSA 2EDGA 1PYWD 1ILPA 1A3UA 1PXUA 3I9V1 1GHJA 3M4OB 5C3JB 2C5CA 5BMIA 3CWIA 2NZ1D 1HUNA 1YQ3B 1YN4A 1L0VB 1AZPA 2F3VA 2SOBA 2SNMA 5CMDA 1N63A 1EZ6A 2HCCA 5HFYA 1RKNA 1EYDA 1C4AA 2F0KA 3M3YB 4A6QA 2G9DA 2PZUA 3B9JA 3R2IA 3V96A 2B8FA 5J22A 1RWSA 1JROA 4XQJA 1EL0A 5KNDA 4WQMA 1WTPA 4Q0FA 1MHXA 5JEAJ 3P4QB 1A6XA 1X3QA 2F0OA 3MJ5A 1AEXA 1M4VA 4H7BA 2DLBA 2BT6A 4YTMB 2I38A 4KGSA 2K1BA 4HEA1 2EE1A 2B2WC 3Q8CA 1EY8A 5E4WC 3GTQB 2K5PA 1CK1A 4KD3A 1NR4A 5NUCA 1SNCA 4RA8A 4G4KA 3S17B 1JOKA 1A70A 1PGAA 2SNSA 5C4HA 4JBWA 2PPBC 1EY7A 4BBSB 3A55A 2K6AA 5EE1A 1TY0A 4J8QA 1EEID 2B2YA 2A68C 2IX0A 3R8BA 3S15B 1LLRD 4EQPA 3BIID 2CVRA 3I70A 3EJIA 4KMUC 3VR9B 2A6EC 2YEPB 4ZK9B 3PUXA 1HFNA 3RUZA 5KRUA 3MZ5A 1JOOA 4XIGS 5FR3A 1Q12A 3HOWB 1JR0D 1LTGD 3NZ3A 3LWEA 1DJRD 1GJXA 3U2SC 4GDKB 4PMCA 3H6MA 1N60A 1GHKA 4C7ZA 4OHJA 3IT4B 3CRLC 4ZHOA 4XT1B 1STEA 1PRTF 3KK7A 3BVZA 3D8GA 4Q2JA 3CQZB 3SR1A 1TKEA 5F2DA 3L7ZC 5CR3A 1CA6A 4RF0A 2CU3A 1KRHA 3GB1A 5D65A 5G3LF 1WYGA 4L2YA 2XN9C 1SF0A 3UI2A 2F0VA 1B4OA 1PLFA 4XYQA 4CJ2C 1CI3M 4FO2A 5D3DA 1VLBA 2WIIB 1ZDXA 3LNNA 2N7JA 3D3RA 4N59A 3D4RA 4X3TA 3DMUA 3CU7A 3VA7A 1I4XA 1WD1A 1H9SB 1NAPA 1C8CA 3T53B 5CYUA 4H2AA 5BYRA 4C56C 1F2RI 2WDRB 1U4LA 1P7EA 1BCPD 1JRPA 5M5WB 1OQQA 4YXDB 2J52A 3SK8A 3BYTB 3PO3B 2X38A 3EQLC 2VZKD 1CZWA 2RSNA 4NP5A 1PGXA 3V05A 1TVXA 4IUTA 5A2QL 2IGDA 4ARIA 3URYA 5JEAH 3W9CB 1FR3A 1RFKA 2NVQB 5H92C 2DWQA 1NI3A 2F0QA 3I73A 3TDQA 3ND9A 2D62A 3W2DA 2MJ8A 1ZP0B 1MHHE 3P4PB 1FGBD 3Q0AA 4REZA 3KLSA 3FVQA 2X6GA 2I2YA 1A3TA 2JX5A 2O5IC 1EIHA 1ACCA 5BN3A 1FNVA 5COYA 3H09A 1NYQA 4V190 4UAIA 2D5DA 2DNCA 3SK4A 1TKYA 1BF4A 4FVMA 1HHVA 3E6ZX 4C7YA 1TT2A 3D31A 4OGQC 4CKEA 3K0YA 2AWNA 4XWWA 3I4NB 1B9MA 5FO7B 2CJOA 2BYTA 2K5QA 3BDCA 5EQ0A 4OIJA 1QCBD 3D4WA 2IW3A 5BMGA 1GAQB 1I4PA 3TEYA 2Q8IB 2M00A 3EFXD 4N9PA 3NVVA 2WXJA 1WTRA 5C2TB 1TR5A 4P16A 5EJWA 5DM73 2WDVB 4XWTA 2AQ2B 2WNMA 2B2TA 4TQ0A 4K14A 3FPUB 3C1EA 1B2TA 3E5SA 2QSDA 2L0CA 2BS3B 2CJNA 1C4QA 5JOBA 4ZUJA 3FDTA 1FXIA 1H9KA 3AU7A 2W54A 3HOXB 3TP5A 1KDAA 3WOFA 2L1BA 5EKIA 1KF6B 5IIFA 1TJEA 4R3DA 1F0ZA 1ZDVA 4A93B 2W3RA 4HJGE 4BA1I 4A3DB 1VZ7A 3LXFA 2BOSA 5HG2A 5ISRA 3PO2B 3FKIB 1EIGA 3T13A 2N9KA 3VR5A 1TS4A 2WP9B 1S5BD 3GO5A 3NVWA 1F2LA 4QB4A 2F03A 2LFNA 4AYBB 5D3IB 1HEZE 2Q8TA 2IGHA 3CRKC 3FPPA 4XDCA 1VF5C 1D5MC 4XQNA 4IFDJ 1EQVA 4A3KB 1WTOA 4IUPA 3MC0B 2BB5A 3G7LA 1VMCA 1DXMA 2JP1A 2ZW0A 4NMZA 1MBYA 2B2VA 3MHZA 2LHEA 1DCZA 2O4XA 3K5OA 1TWGB 5EE0A 2JA6B 4RKLA 4F88A 3HVZA 1F9PA 5CV8A 5ELDA 4NDXA 1SMYD 4A3BB 3S1QB 1K53A 5CORA 3AEFB 1XXGA 5C4XB 3NQTA 2RDGA 5ELFA 2O5JC 1BCPC 3LYYA 1BXTA 2VZKB 1SNQA 3A54A 3FC4A 3PIP3 3FEWX 4DXGA 4M8AA 2WXGA 4DU9A 3M7NA 1QF6A 2E2JB 2QIEB 2EZVA 2F0PA 5MPOA 1BMLC 5EPLA 5EBDA 4P6VF 1F9RA 3U52E 2BS4B 4DXFA 1SYEA 3DWAA 1K50A 4DNRB 4YWGG 3PUZA 4YT0B 1GOZA 3GV6A 3PZ8A 3IAYA 1Y1WB 3P20A 5JVH3 4R9WA 1UEAB 1DOMA 4DNTB 2MH7A 4WURA 5CGKA 1CTMA 1JMLA 3DM1A 4GZYC 4KJNA 2PLPA 1PFBA 2DY7A 3G6JB 5BMHA 3NHHA 1XF5L 3U9OA 4XE0A 2EOTA 5E3FA 2G1EA 1FMAD 3SK6A 3TEZA 5EE9A 2XSCA 1FM0D 4IOIE 1AFPA 2W82A 1GXDC 4JE3B 4JK1C 1WCMB 3MXNA 2EYFA 2WACA 1O80A 2IX3A 2PMVA 1II3A 4IFDI 2F4IA 4S3SA 1QE6A 4ZYSA 1F9SA 2XNAC 1XWEA 5CBAE 1JQ4A 1TY2A 2KWDA 2QCPX 5IGCA 2M56B 1E2ZA 1SSNA 3V3XA 4YTPB 4PV1C 4RGOS 1VR9A 2N88A 5IGEA 2WINB 2WQYB 5EPKA 4KGRA 1K8MA 1ZYRD 4XDXA 5C5MA 2NUCA 4DA2A 1WVLA 5IGFA 3CHBD 3RMHA 1KDBA 1Q3LA 3HOYB 2OHFA 2R93B 2DYMA 4IZ8A 4US9A 1CFMA 2YU9B 3HKZB 2B2UC 3VRBB 4IFDH 1JC7A 2EYOA 4FF3A 3NBIA 5DNFA 1QILA 4J3OD 2Z8LA 1QKZA 1TWAB 2PO4A 4C3IG 2E76C 1RJTA 4G7OC 1YNND 3TZUA 5C6AA 2R6GA 1SSOA 4L8JA 4QUCA 4HAEA 2SEBD 4KHZA 2FUG1 1DOLA 4LLGM 2L4NA 1NUCA 2H1EA 3ZYYX 4FF1A 3VR6A 1NCVA 2R61A 5CV4A 2V3NA 1R4QB 2WDQB 1SIJA 3DWGC 2A68D 3GD7A 5D7GA 1KFYB 2ZXPA 3VR8B 2V3PA 2J7ZA 4XT3B 4RGTA 3VQIA 2YEPF 3E0JA 5LHY1 4MHEA 1KABA 1RHPA 3GV3A 3T4AC 1L4ZB 1ENFA 4LK0M 3MFGA 2A6ED 4L1BA 2N55A 2F0LA 4PQXA 2PNRC 4NAMA 2IGGA 1MI0A 4WIPA 1C76A 3O13A 2KOLA 4FNFA 3QG1A 5TSSA 2KEDA 3IFDA 4U673 1SXTA 1JWSD 1RODA 5EPJA 1Q1EA 1DD2A 1IGCA 3D4DA 2Q8RE 3SFDB 5T1GA 1NENB 3NWSA 3J7AV 1MSGA 5K5PA 5LNK1 1K83B 2JA8B 1A3VA 4QF4A 3QIAA 1A2TA 2FE8A 1FXAA 1KNAA 2LKVA 1LT4D 4DGZA 3KQ4A 1Y8PB 4WORA 1Z6HA 1PZJD 3VRAB 5IGDA 1HTLD 3Q8FA 4MM3B 1LACA 5M5XB 4ZAIA 1HTPA 2J42A 4NAWB 1ESRA 2HTME 4BY7B 4A3MB 2E2IB 1FFUA 1C4PA 1G6ZA 1KH0A 2MHVA 5KYLA 3OOCA 2E3TA 1U4RA 3TP7A 1H9MA 1EY6A 4NJCA 1EOTA 5M9OA 3SHLA 4YSYB 2L5TA 4N9TA 3BK1A 3AE9B 3AEGB 4AQ7A 5EKLA 2Y0SB 5J1ZA 4IALA 1IYUA 1EU4A 3GTPB 3ZGZA 3SEBA 2JE6I 1E10A 3DEPA 1IHZA 1DYQA 3WOEA 1STBA 4C3IB 2GRIA 1KAAA 1JW9D 2PVOD 1HQMC 1J7AA 1OQRA 2BBCA 2B2YC 1Y56A 1ZYRC 4H13C 2IDYA 2R92B 3RZOB 4A90A 2FMMA 3FMCA 4C1NK 1RYJA 4C3JB 2JSVX 1B9RA 3H3VC 1KLGD 1BOSA 2A6HD 3HOZB 4O1NA 1JWUD 2HDMA 3HUIA 1BR9A 4BWGB 1SNMA 4IN3A 3J9CA 3OWFA 2IJ0A 4R8IA 1OO9B 1YNNC 1N5WA 1KNEA 1DOIA 2ON8A 2KECA 5GXGB 4WWMA 3A56A 1U4MA 1N61A 1T5XD 2Y5PA 1F2YA 3VYSA 4C1NI 4IUQA 2BB6A 3W5UB 2NTTA 1UUPA 1IYVA 1SE3A 2PZTA 1NSNS 1EM7A 5JPMC 1TWCB 1PFDA 5BYQA 1TS2A 1CQFA 2WV6D 4A3JB 2KEEA 4OIKA 3FAHA 4ZRZA 1RF2D 2RKSA 4WJWA 2QJLA 4K2KA 2L55A 1HA5A 1N5XA 2H88B 1DONA 1MGSA 5IGGA 1VZ8A 2EKIA 4JWUC 2NN6I 1S5CD 1QLBB 2OF1A 2JYEA 4KKUA 2IT1A 3I8ZA 3IAS1 1WXQA 3E56A 2KVMA 4L63B 4YSXB 3NUCA 1GUWA 1G2SA 4TKOB 3GP7A 2WXHA 3NUHB 4LJZC 1CHQD 5LL6S 1V1PB 1SAPA 3H0GB 1FRRA 5I6YA 1L6UA 2KHSA 1SNDA 4PT5A 1OXSC 1QG7A 5JEAG 3J80L 4RHSA 1OXUA 1MVKA 2NN6H 4PMBA 5HHDG 2INPE 2N9LA 1BO0A 1WSPA 3X3NA 4EE2A 1SYBA 4K8IA 2WXLA 3HRZC 1ROEA 3B2FA 4L23A 4CGYB 1A2UA 2L9HA 4HEDA 4A3GB 5C5LA 1K51A 1DOYA 5C44B 2Q5WD 3NTIA 4G57A 1JORA 1FIQA 2RA4A 3NS1A 2CW0D 4CKCA 3BDLA 3EGRA 1SJED 4HCSA 5I9PA 1OXTA 3P63A 2EYLA 2KUMA 4ZRPA 5M3FB 3I3CA 2ACZB 2M9VA 2Z1CA 1RM6C 1CZPA 1LABA 2V4DA 4RGNA 1LTSD 1MD2D 3IAM1 4CJ0B 4HRSA 2B2TC 4B08A 2Y3AA 5T8IA 1DM0B 1QNUA 4TSSA 1FCCC 1XLNA 2M19A 3MXPA 1DZ1A 1WWTA 1QOGA 1XCTL 2N0SB 3JAML 2K0PA 1E2VA 2A6HC 2K04A 2JA5B 1S5FD 1C48A 1D6EC 1H9SA 1EFID 2DBYA 2RDFA 2NVTB 2ICIA 1OXVA 2L1AA 3Q8AA 4PNYA 1BQQT 3M85A 5CV9A 4WFN3 5HI1A 1V97A 4V0BA 1I6HB 3OW7A 3LX0A 2IL8A 3AEAB 2R7ZB 3LWUA 4BA2I 3K59A 3DWMA 3MTSA 1XX8A 1NVID 1JE4A 1SEBD 1BUIC 4KKJA 3I72A 3H94A 5G5HA 4K2LA 1ZUD2 1O7ZA 1UAPA 3OMGA 3TP6A 2WXQA 3IKJA 5DM63 5C3WA 1T5EA 4OO1I 1VMPA 3HS0C 2F3WA 1D5ZC 5BN5A 1STYA 2F0DA 5CV5A 2B2VC 1Q90A 1ZXHA 4KD4A 2X6LA 4RCNA 1ICWA 2ENBA 2B8GA 3BYYB 3I91A 1IBXB 4HSPA 1K52A 4XDDA 3A8KE 2V0GA 1V8QA 3C1FA 1VJKA 4KI0A 4JPSA 3V2TA 1IKLA 1LTBD 1KLUD 1YMHE 4IURA 3C46A 2NWGA 2E74C 1V1OA 3S9WA 2JU6X 3UI3A 4UDUC 2JWUA 5DEHA 5AUIA 3QOLA 5CV6A 2EPBA 4GLSC 3GTKB 1WRIA 5KEEA 3NVZA 1Y8NB 4QCLA 3OWEB 2ZXOA 4OO1H 1RD9D 2IPKD 2PQEA 3T56B 1J9OA 2EY1A 1I3QB 1R9TB 2LHDA 3ABVB 2JEAI 4O42A 2KN4A 2DNEA 1I6VC 1B9NA 1F2RC 1VRAB 1JICA 4AS1A 4K6LA 4LTUA 4HKQA 4ZHPA 3TUOA 4A55A 4P2CB 5C0XJ 2KCNA 3S16B 5A2QE 1QOBA 2RSOA 2IX1A 1BCPB 5FO8B 2QDBA 1FCLA 4DAVA 1SBBB 2K5WA 4CHTB 3WDNA 3T3OA 1L0XB 4EQOA 1F2MA 3NK9A 2BA1A 1QOAA 3BK2A 2AWOA 3HG9A 2PYKA 1YJIA 2CW0C 2QEJC 2H4OA 2K28A 5E1FA 4ZKCB 3Q69A 4G7HC 2JXTA 3S1MB 2XIWA 4HSVA 4TMAB 1WD0A 3TP8A 1JB3A 4I65A 3JAME 2OXPA 1XLQA 5CV7A 2M0AA 1STHA 3KUPA 1I7HA 1I4GA 1FNWA 1PDXA 1TS5A 3ERQA 3NE5B 2W55A 2TMPA 5EE3A 5JAVA 3NVYA 3TN2A 3VR3A 4F8MA 3P1HA 3LB8C 3PO0A 3AE3B 2F0HA 1ET9A 3N9YC 1VCIA 4A3EB 1GUNA 4M0WA 1EY0A 4HMIA 3S1RB 1FYCA 2XWJB 1D4BA 2LFIA 3Q22A 3GTOB 1SYCA 4R8NA 5KGUA 3RLFA 5G5GA 3QOJA 1STAA 3J7YW 3HVDA 4FF2A 2YYZA 2LS01 4FXGC 2K5DA 4RAUC 3J81L 5HURA 4WH4A 2BTEA 2JZPA 4IFDG 2I46A 2D5GA 2XRQD 2DY8A 4GDLB 1VZ6A 5A35A 1STGA 5FOBB 4ODGA 3HRDD 4DFAA 1XCQL 1PDQA 2ZT9C 2KA7A 1WTQA 4MN3A 1XYIA 3DWQA 2FBWB 4K8JA 3M7GA 1WTVA 1N62A 3BWUD 2RVLA 5C0XI 2NMQA 4KV6A 4DK1A 4DK0A 2EYMA 4LAAA 3HZXA 2ONQA 3A8IE 1QOHA 1SE2A 4F7XA 4RNAA 3IFTA 4RH6A 3AE2B 1RTNA 4KGTA 4KX6B 1RDPD 3OIPA 3I4MB 3K5NA 4J1MA 1TKGA 1TS3A 4DQOC 3M4YA 3MA2B 1QOFA 1VF7A 5KNCA 2LMCB 1W6KA 3W1SA 4RHRA 5EKKA 3W5VB 1YQ4B 2B76B 4IUUA 1S4ZA 2F0IA 2F1MA 2RDHA 1ESFA 2PIAA 1C4CA 1PMRA 2ZXRA 3R3OA 2F0UA 4HCEA 4HMJA 2EJMA 1SDFA 3DWPA 1SNOA 4DAYA 1CJEA 1FD6A 4A9AA 4KY5A 2E2HB 2ID0A 3AE7B 2K3UA 3AE1B 2MEKA 1TWHB 3P42A 2JYOA 4K6DA 3N6RA 1RTOA 3P7JA 4MIUA 2FHTA 3T16A 4ZKBB 3I4LA 3QO2A 5JPNC 1F2ZA 3PIO3 2NBFA 3HP3A 1E7PB 3F2UA 3D6WA 2OEOA 3VR4A 1ZXIA 1L5PA 3SFEB 4F87A 1I50B 1E0ZA 2E2DC 4HTHA 1O7LA 4N58A 4NZLB 3ZJVA 2TSSA 1QB5D 3MAQA 3KBXA 3AMZA 4TRDA 4IKGA 1EWYC 1B53A 4Q5VA 3PZ7A 3HEJA 2L32A 2K9XA 3E9SA 1PTOD 4IQZA 1TU2B 3AEEB 4ME5A 1C9FA 2F0TA 1JCKB 1KTKA 4B0EA 2F0WA 1MPEA 1EY4A 1HA6A 5I2YA 1GUSA 1OXXK 5KIXA 4HKZE 4KKSA 4NKLA 1ZOYB 1G291 3AE5B 2HCIA 3AE6B 1EYCA 2K01A 4TQUS 4OZCA 2BA0A 1L6VA 3J81E 5ELEA 3FRPB 5KNBA 2FFKB 5IGBA 4BBRB 4ILWA 2K7VA 2JEBI 2SDFA 1SYDA 3MHBA 1FNUA 3AH7A 5CC4A 1I4QA 3ZQ4A 1YN5A 2SAKA 2K22A 2MUYA 2VB2X 2EJFC 2I07B 3S1NB 3L9AX 2WKDA 1PTOH 1D2BA 3R2TA 2FMCA 5JJZA 4MACA 2H89B 4EVOA 2LUMA 3SR6A 5HGTA 4NW2A 3FILA 1PZKD 2VXWA 1OFFA 3S2HB 4WRDA 1YN3A 1AN8A 3H91A 2BE5D 4RWSC 2WAQB 2L83A 2KQ3A 3B2GA 2EY2A 2W3SA 4KKTA 4B9WA 1BNZA 2WLBA 3NRZA 3ZJUA 4J6HA 5H8YE 1HCZA 1U4PA 2A5HA 2VUMB 5KYIA 2JA7B 5LL6X 2NB0A 3K6OA 1KDCA 1FD7D 1ET6A 3PUYA 2EY5A 2K32A 1JOQA 5E6JA 1UWMA 2KMMA 4ZLTF 3U7ZA 4KY7A 3KBGA 4IUVA 2BS2B 4YIJA 3SVMA 3C2PA 2INNE 1J8IA 1SNPA 2L12A 1G91A 1M8AA 4FF4A 4C80A 4ZOHC 3CKIB 5DAUA 3A7AB 5M3MB 1XEEA 1FRDA 2WU5B 1SJHD 1XLPA 4X3UA 3J7AF 3K5LA 2Y5CA 4XTCS 2NVXB 3EA6A 2MP1A 5IODA 2J53A 4JWSC 1Y8OB 1ONLA 1RCVD 4LMQD 3P1MA 3TZDA 1YJJA 4A3FB 1D5XC 2JQRB 2G9HD 2AQ1B 1TKWB 4HR7B 3SXHA 3I57A 2EVBA 5BYSA 1HPCA 1A15A 3GTMB 1AWDA 4RCOA 2R3ZA 2F0FA 3ITPA 1STNA 3MXGA 3NPPA 1XO3A 2CQAA 1H9JA 2B2WA 3GTJB 3AE4B 2OT2A 2DYOA 2WXKA 4ULLA 1PTOB 3KF8A 3P75A 1C77A 4Y7NB 1PTOC 2NN6G 2WXIA 3SDZA 3BDOA 5AUKA 4USAA 3AM9A 4A8XC 4MH8A 3AECB 5FO9B 5ELBA 3IT6B 1HQRD 2KQ4X 2FINB 3PV0A 1PRTD 2AQ3B 3NTHA 1MSHA 4IDIA 1IGDA 1BCPF 2WB1B 2QMTA 4K5WA 1HRJA 1LTID 3L3OC 3EVQA 5G3LD 1SYGA 2EYPA 5T1IA 1F9QA 1I4HA 3TEXA 1E6EB 3I90A 3NXWA 1NEKB 3GTLB 1ZEQX 1YNJD 2C9OA 4OVZA 3W3AA 3VYRA 5FK9C 2JYTA 3BS1A 1DOKA 1LT3D 4OL7A 1C78A 3AN1A 1NYRA 1AZQA 2WXRA 3AV8A 2BDNA 2FJ2A 5C4JB 4RGMA 2HUGA 5J39A 2KDMA 1EY9A 5BN4A 1ENCA 2WKCA 1TIID 5CBEE 2BE5C 2JSOA 3SK5A 4DF7A 1WTWA 2RBMA 1FEHA 4CBVA 3RZDB 1LO5D 1IKMA 1Y1VB 2EY6A 2K05A 2PVGC 2MJ3A 5I6WA 3ND8A 3VYTA 2EYHA 2A73B 1V1PA 2HQEA 3Q8EA 4FXKC 1TZOA 4EQNA 4A3IB 5I2XA 1EWHA 2F0SA 1L4DB 1EZ8A 2CHBD 1JALA 2A74C 1CHPD 3OHXC 1JWMD 1S5DD 2BW2A 3QB3A 1Q10A 1C79A 1LT5D 4E6IA 2KACA 3NBHA 4PMWA 1QJOA 4KJOA 1PGBA 3KWVA 2IWHA 2EELA 1DOXA 4US8A 1V43A 1Z7TA 4KN7C 1EU3A 2KCCA 4C2MB 4OO1G 5I9OA 2HDLA 1QNKA 3KLRA 1ML0D 2V4IB 1L0YB 1XLOA 4KHVA 3C3LA 4G7ZC 4KN4C 1GB4A 4H0LC 1HXYD 3OSOA 3GTGB 3HOUB 4WAFA 2AUJD 5IT9L 1WGKA 2RMMA 1SE4A 4DN4M 3Q23A 2WXNA 3K57A 4KKIA 1EYAA 1GB1A 5IOCA 3RD4A 4QUFA 2Z4IA 2J4XA 3MP9A 2K33A 1UWXA 3Q24A 1D1IA 3J80E 1SB3C 3ZJTA 1GUTA 1QT9A 2LGIA 4CJ1B 2M2LA 2PZWA 4M1UB 1EWCA 4H44C 4KTAA 3X3MA 4CQNA 1TQOA 1XTCD 4FYDA 5C3EB 4XYOA 1QWYA 3EUB2 2WS3B 1O78A 1H9RA 1PRTB 1ENAA 2L52A 2HDEA 3NQIA 1PRTC 1I4RA 4ZUIA 1T6BX 3K5MA 4OZBA 1LTAD 1Q8IA 1PFMA 1R4PB 3R93A 2JXMB 5FLXL 3MVVA 4X3KA 2A69D 1Q1BA 1LTTD 3ETRA 3NSWA 1AW7A 1PZID 2F0GA 1CA5A 3A8JE 3RFZB 3K7AB 2EJGC 1IBXA 1K8OA 1YNJC 1BDOA 3H8HA 1B50A 2WXMA 2DN8A 2NYZD 4C3HG 5D14A 1J7BA 3TEWA 2WXFA 5EBCA 5JVG3 2NVYB 2BCOA 3P4RB 5JXVA 2E6XA 1LV9A 4ZRQA 1SYFA 4RFBA 1JWBD 3AB9A 1TYGB 4RKBA 1HUMA 1EEFD 1HZ6A 4KY6A 3U9SA 2EXZA 3BG3A 1E9MA 3WCQA 3N52A 2MJEA 4I7ZC 1VDVA 3S2DB 1SFOB 4LK1C 2GB1A 2WXPA 2F0NA 5E4XA 2EYJA 3IXSA 1WTXA 5C3XA 3S14B 2BDOA 2VNUD 1FO4A 1HFGA 3Q6SA 2GA4B 1U9RA 4Z9CB 3OMCA 4X3SA 2RQXA 1AYFA 1V8CA 2AX5A 2PMZB 3AE8B 1VDZA 3AB5A 4OZAA 4YTNB 2B63B 2PCFB 4U68A 1EQTA 3SE0A 3BVGA 3DEOA 3TMEA 1JQYD 4KK7A 3L4PA 2F0JA 4QIWB 2QKIC 1IW7D 5AFWA 3MXUA 3TBIB 4ABNA 2GI9A 3DXJC 2WXOA 3VYUA 1Z47A 4L6TB 5M5YB 3C8YA 1CZGA 3BZDB 5FKAC 3MFYA 3DHQA 2LY7A 1ILQA 2LJIA 2PW7A 4EGVA 1O7YA 3NTKA 5EGTA 2XVSA 3EROA 5IT9E 5C0XG 3AEBB 3HGBA 1UGJA 1PUTA 3NWTA 1G8ZD 4BY1B 1GUGA 2B39A 3U4EG 1ZKOA 2WP8J 2D9UA 3OPOA 4BS9A 2ZW1A 1S5ED 3A7LA 1ZPSA 1GUOA 4K5VA 1LT6D 4ID6A 3D6CA 3BVMA 4OW0A 5C0XH 2O2LD 3IL8A 1B1ZA 1AP0A 4XQQA 1IL8A 4FXCA 3P4SB 5I4DA 3T3NA 5FLXE 2PTLA 1ZXTA 3QJYA 2XWBB 2X69A 1FFVA 1TWFB 1CM9A 4ZQ3A 3NP8A 3Q8BA 1YNTE 2J0TD 2L11A 5K36G 4MT5A 3QWNA 4C3HB 4YSZB 3T51B 3HOVB 1X32A 4B0MA 3VA5A 1IUEA 4K5XA 2KAJA 2WU2B 4C3JG 2AUKA 2E75C 3AMUA 2A69C 4B9XA 1W6JA 3RPFC 1B3AA 4CKBA 1PFNA 4TQ1A 1MI2A 2PW9A 1NR2A 4ITKA 2B2UA 5K36H 1J7CA 3MEHA 5C4ZA 1HZ5A 1SMYC 2PW5A