1SJED

Hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjeD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjeD02
5FK9C 1SE3A 1D5MC 4O1NA 1AN8A 3R8BA 4Z9CB 2XN9C 3BVZA 1S5DD 3BZDB 3MFGA 1HQRD 3BVMA 1SJHD 2G9HD 3MC0B 1F77A 3KLSX 1STEA 1EFID 1LTRD 1TS3A 3R2IA 4RGMA 2J4XA 2TSSA 3W2DA 1PRTC 1UNSA 1D6EC 1PZID 1HA5A 4RGTA 4BWGB 4C56C 1PZKD 1SXTA 3CHBD 4RHRA 1LTBD 1CQVA 1EU4A 4NZLB 1B1ZA 1S5BD 3TSSA 1RD9D 1TS2A 3EA6A 1BCPF 1PTOH 3BYYB 2AQ3B 1LTTD 1LTAD 3DWPA 1JWSD 1CHQD 2AQ1B 1I4XA 2QEJC 1YN4A 1PTOC 1RCVD 2SEBD 5ELBA 1BCPD 5D3DA 1CT1D 1FNWA 2NTSA 2XRQD 3V05A 1LTGD 3BVGA 1RF2D 1JQYD 1PRTB 3EFXD 4ZYSA 1GOZA 1L0XB 1KLUD 1S5ED 1TS4A 1SJED 1FNUA 4OHJA 1EU3A 4DXGA 1ENFA 1I4GA 1LT5D 5I4DA 1I4RA 1L0YB 1BXTA 1UUPA 1PZJD 2ICIA 4K6LA 1YN3A 1LLRD 1PTOB 4UDUC 1LT3D 1HXYD 5ELFA 1T5XD 1B44D 3DWQA 1EEFD 1LT6D 1ESFA 1PRTD 1SE4A 2AQ2B 2CHBD 4L63B 5ELDA 1HTLD 1LTSD 1EEID 1D5XC 1YN5A 2R61A 1SBBB 1I4QA 4L6TB 1DYQA 5FKAC 1SE2A 1FGBD 2IJ0A 1I4PA 2IPKD 5TSSA 1BCPC 1CK1A 2XRSD 2QILA 4RCOA 1V1PA 1G8ZD 4TSSA 1LO5D 1TY0A 4RHSA 1LT4D 1RDPD 1CHPD 3O13A 2XNAC 1DJRD 2O2LD 3BYTB 1M4VA 1KTKA 3OWEB 1XTCD 1PRTF 4RGOS 5ELEA 1JWMD 2NTTA 3R2TA 5D3IB 2WV6D 1SEBD 4RGNA 3DWAA 1V1OA 1JWUD 1MD2D 1FD7D 1AW7A 1BCPB 1D5ZC 1I4HA 1JR0D 1V1PB 2RDGA 3URYA 4DXFA 1XXGA 1S5FD 4RFBA 1QILA 1S5CD 1JCKB 1KLGD 1PTOF 1ET6A 4RH6A 5ELCA 1EWCA 2RDHA 3SEBA 2Z8LA 1PTOD 1PYWD 1TS5A 1LTID 1ET9A 1TY2A 3GP7A 1FNVA
chains in the Genus database with same CATH superfamily
1O78A 1Q81C 2K1FA 2UU7A 1TWHH 3R8BA 2IY1B 3MXNB 4MIUA 1SIFA 4X3KA 1S3OA 3TEYA 4X66L 3D3RA 3BVMA 2C35B 3AE4B 2NN6H 1F77A 1V86A 1NENB 2F0NA 2XWJB 2RVLA 3NTKA 1LTRD 5IYDH 2BW2A 2A19A 3R2IA 5C4JH 4O42A 3CSFA 4E3CA 5LL6X 1MI0A 2B8GA 1D6EC 1Y1VG 4HMJA 4DV6Q 5LMUL 4GNXB 3Q3JA 4NPSA 3ERSX 2G4SA 4A3FH 4WQMA 3KK7A 2L0FA 4WORA 4WWMA 3DBRI 4ZRIA 2I0QA 4BY7G 1E7PB 4HJAA 1KJTA 2EIFA 4M8NA 5KRUA 2HDMA 3QJZA 3EFCA 2KA7A 5KNDA 5HY6A 2F1MA 1PTOH 3KJPA 4TKNA 4PZ7A 4W9IA 2R92G 4DR7Q 1AP0A 2G9DA 2NCNA 1GXDC 2PMVA 2LXJA 1UE5A 1Q1OA 1MSGA 3MEFA 4YY3Q 2E2IB 4KI0A 1VQGA 3KVFB 1RIPA 1PH6A 4A3GG 4DR4L 1L1OA 1MBYA 4WJPA 4KHZA 1N6ZA 5E6PA 1M1KC 2F0GA 2K5WA 2HD5B 4F1SA 1NEKB 3GE8C 4DNIA 1TTNA 3PCOB 4FP5D 5I4DA 1YJNA 1PLFA 4ODGA 2WXFA 1BXTA 1H9JA 4H7BA 2HDLA 4K6LA 4CJ0B 3AEDB 3S2DH 4TQ1A 1ESRA 1HA6A 1KDBA 1D7QA 1OFFA 2BH8A 5LMNQ 4IPDA 1L0WA 3G4SA 3KLRA 2WNMA 1H95A 3P1HA 5EKLA 1C77A 1OXVA 4L63B 1CKNA 4LF4L 1K8GA 2A1AA 3S17H 1PDXA 2MW5A 4HJKA 1LTSD 2VH2A 2L1BA 3K80C 1S72A 3AEFB 3QAQA 4I6LB 3MXUA 3L3OC 3T1YL 4XXEA 3RCZA 5M3MB 2K32A 2QA4A 5T8IA 1W2BA 1E9MA 4KKUA 4NB3A 5M3FH 4DUZL 4RM9A 1ZOYB 1SMXA 1X6OA 1AARA 3J7YW 2NPTB 2N49A 2WXHA 3APDA 4HPLB 4EGVA 1HTOA 4BOZB 1IL8A 3DBRB 2L55A 1OTRB 1LT4D 4FXCA 2P5ZX 3RNEC 3A1QB 4ILWA 4OEMB 2RBMA 3AFQA 4P2CB 4IPHA 5CV5A 3KH0A 1BMLC 2FIDA 1II3A 4DK5A 3NTHA 4LFAQ 4POFA 3I9V1 1ISNA 2N3SA 2V1CC 3NELA 3UDFA 1XNRQ 4EQ5A 2INPE 4GN1A 4MM3A 4UP8A 3W1SC 2L0TA 3NY5A 2MO0A 5J17A 4CJ1B 4J1MA 1HE8A 4LF9Q 1O7IA 1Q8KA 2CFMA 3GD7A 3S1RB 2Q2TA 2F4VQ 4URKA 5EDSA 1KRSA 4ICUA 4FXGC 1J5EQ 1QJOA 3HOUG 1STNA 3QWNA 3N9YC 5KIXA 2OOBB 5AZFA 5HGTA 4YTMB 1GNUA 5J22A 2G45B 3CWIA 4ZDVA 2FXQA 5BR8Q 3HOWG 1ZDVA 2F0LA 2M2LA 5CHWA 1JOKA 4CBVA 2MNAA 2KC1A 1S5DD 4ZRZA 1GUNA 2ZJDA 4HPMB 1HR0L 5IIFA 2DZJA 1XMQQ 2E2IH 2RDFA 1O7LA 4RF0A 3QJYA 1VQDA 4A3IG 1E1TA 4B08A 5D14A 1JB3A 1T0QC 3KBGA 2BDOA 2CWAA 3D4DA 4ZUIA 3U4VA 3B2GA 2F0VA 2QJLA 2L0CA 3PQIA 2E2DC 4B95A 4L1BA 1A8VA 4HSVA 5KNCA 2UXDQ 5C0XJ 4OWTB 3RYTA 3CCMA 3I91A 4X64L 3HOXG 1N36L 3MAQA 3I70A 2D9UA 2N9EB 1IBLQ 3PZDA 4ZRJA 2AQ1B 3VR6A 3UGBB 1PTOC 1DXMA 2VZAA 3UDXA 2LHEA 1E7UA 1QOFA 4IWOA 1L0VB 4S17A 1AZPA 1L0XB 2L15A 4J6HA 4CDDC 4C3IB 2WB1G 2EY5A 4FDBA 3MWYW 1AH9A 4HCNB 4JIOU 5M5YB 5GAGC 2DY7A 3OIQA 5LLIA 2Z6KC 4KK7A 4DR2L 1SF0A 4QUFA 1JE5A 1ENCA 5M3MH 3F2DA 3DVGX 2Q2IA 2ICIA 1QF6A 4OX9Q 4XWTA 4UDUC 5I9OA 3CCVA 1EY4A 3CQZB 1TKEA 2BKFA 1LT3D 3R3OA 1V9PA 1B53A 3IHPC 3DHQA 1KLVA 1PDQA 1EF1A 3U50C 2A6HC 1KD1C 2D3CA 3GZNI 4QY7A 1LT6D 3C2PA 2JA9A 3TIXA 1KL9A 3AU7A 2KDMA 3WANA 2V1YA 2FHTA 2PQAA 1W3SA 5C23A 2NYZD 2R93G 3VR2A 3CMEA 2PZUA 4B3TL 4JYAQ 3R3MA 4JCVE 2JK8A 3LJ3A 3SVMA 2KFKA 3G6JB 2F0QA 3S1RH 1GM5A 1I6VC 5J18A 2VQFQ 4ARIA 2MP2B 5E6JA 2D62A 4LDTD 2J0TD 2QF7A 1TKGA 3AE5B 1B3AA 3I55A 3L17A 2B2YC 4ARCA 1VJKA 4QAYA 1EL0A 5FLMH 4US8A 1DM0B 1SNPA 2NTTA 4A3KB 2JYTA 4NXMQ 3KYCD 3DWGC 4GOPC 4GXBA 4CHTB 2WXGA 1PQSA 2R3ZA 1WCMG 4DV0Q 1A3TA 4LF8L 2I1JA 3URYA 3NUHB 3SHQA 4DXFA 1FGUA 4GN3B 2BA1A 3G6EA 1NI3A 5BN4A 4ULLA 1ENAA 3W1SA 2L32A 1MHWC 5HGQA 2Z0DB 1X3EA 1G2SA 1CMXB 4DR6L 4A55A 3L54A 4U673 2IHEA 3FMCA 2Z9HA 4OELB 4DNRB 5D2MB 4IO9A 2M0AA 5GROA 1EWCA 3UQBA 2D2QA 4XYCA 2Z8LA 1ILQA 2RR9A 4G11A 5M5WB 1AYFA 4LF7Q 1C4QA 2F0SA 5IT9E 3OYYA 4WJNA 2SOBA 2JXMB 2E5LL 3OJ3A 2E76C 4GNXC 2N78A 4RKLA 3Q23A 1MI2A 1HNXL 2DWQA 4BA2I 4NXNL 3ZW3A 4NPNA 2QKIC 2VS1A 1QWYA 3DMUA 5EGTA 3PIPA 1BOSA 1K8AC 1KRHA 1V5OA 2JX5A 2KQSA 2V4LA 2G9HD 2UUBL 4K7SA 3Q24A 1O80A 1AE2A 1Y8PB 3FILB 3I72A 2JZ3B 1JOQA 4A4IA 4LNFA 4K7UA 4LNIA 1HZCA 5HURA 3HKSA 1CZGA 4C3IH 2LUEA 2W82A 4YWMA 4K1RB 5M5YH 2QIEB 1BF4A 3CHBD 2KVMA 4APVA 4DR3L 1CQVA 3UDGA 4YHHQ 2M4NA 1PFSA 3IL8A 4DAPA 1GUGA 4DAYA 2SNSA 2ZCCA 3ZRCA 4HROA 1GUOA 3CQZH 1RLFA 2KUMA 4JBWA 4DK3C 3I8ZA 2SEBD 2PW5A 2DENB 2J7ZA 5E4WC 1YIJA 2AL3A 2K6QA 2VB3X 4W9LA 4GKJL 2OXPA 3GV6A 2Z59B 1I7HA 1TS4A 1KLUD 2CKHB 3PTFC 3TBLD 4H02A 3H6MA 2QMTA 1Y14B 3ULPA 4C3HG 4DXAB 3UINB 4OO1G 1EF5A 2JZPA 3JAMi 2LS01 4W9FA 2RCNA 3ZJUA 4DA2A 3E56A 4MJSA 3VA5A 4RA8A 1N34L 3U7DA 3KF8B 2F0JA 2JA6G 3HOYG 2O2VA 5C0XI 1VQ4A 1I94L 2MBBB 2ZEQA 3OMCA 2EZVA 1HCZA 1K83B 1WRDB 4IC7B 1B44D 1YNXA 1VQJA 2CW0D 4GN4B 1Q7YC 1MJEA 1MVKA 4A3KH 4W9GA 2E3TA 1VQEA 4DUYQ 1YN5A 1OGWA 4K3CA 4IFDH 4WURA 4L6TB 2ACZB 5AJ3L 2KACA 1WRIA 1N32L 2F3WA 4FHKA 1CK1A 3VYSA 3LYYA 2B39A 3AMZA 4LNOA 3LWUA 5IOIA 3A54A 1A2TA 5CTRC 4RHSA 4JC0A 3L13A 5LHY1 4JBJA 1N5WA 1SYGA 2V4IB 3PRPB 1F9SA 2BS2B 3CW2C 2KVZA 1E1OA 1J7CA 2JVCA 4ID6A 2KOXA 4AUQC 4KGSA 5EAYA 2B2YA 3R2TA 1PYBA 2CQOA 4N9F4 5MPOA 2RHQB 3NBIA 2KANA 2OQ0A 4BAXA 4DF7A 2NVQB 4Y52H 1O7ZA 1DOLA 1D5ZC 3S24A 2ON8A 4KKTA 1TKYA 3NZ3A 5BYQA 3U4EG 5DM73 1VQHA 1UWMA 3B08A 1IW7C 4C3JG 3LX0A 2H4OA 3RLFA 3IFWB 1F9QA 3MXNA 1M94A 1Q10A 4L8JA 4IALA 4N8FA 5C3EH 1PTOF 3PUZA 2PCFB 3RZWC 2J53A 1P8LA 2PVGC 3ETRA 1Y1VB 2EY6A 2RDHA 1Z6HA 3N30A 2ZZPB 1PTOD 4LJZC 2AKWB 4GDKB 1TY2A 3DM1A 3L2PA 1SIJA 1YEZA 4N9TA 1WJJA 5C5MA 2BS3B 4Z9CB 3DPDA 2XN9C 3CRKC 3QR8A 2UXBQ 2JP1A 3AM9A 2LD9A 3Q8DA 3PUXA 1L2FA 4IURA 2RKSA 1K9MC 3EUB2 1XJVA 3DBHI 1TS3A 2IO3B 1UGJA 3GO5A 3PUWA 1H9KA 1QVCA 1FXAA 4HXDA 1OXXK 2ZM6Q 4MGKE 1JMCA 4WWPA 4TQUS 2A6HD 4MSQB 2A8VA 3GOEA 2WXPA 1YNJC 3A9JB 1Y1WB 2C9WB 4DQOC 2WXJA 1KFYB 2JA7G 2WQYB 2VL6A 3W1YA 1GUTA 3LXFA 4I7AA 2JT4B 3E9IA 2JQRB 4DV7Q 1GC7A 2CHXA 1WGGA 1YNTE 3P1MA 3NHHA 4JI7Q 1GUAB 1IYVA 1LTGD 2OEOA 4IM3A 4FYDA 3CXCA 2ASQA 1FNUA 1GC6A 3NQTA 4ABNA 1R9TB 3PO2G 4LTUA 2KT7A 1GB1A 5FO8B 4OVZA 3ABVB 2XK5A 1Y8RC 2PIAA 1S3SG 1YJWA 1NE3A 2K03A 1MG8A 1WYWB 2EJFC 4A76A 1WXQA 2WB1E 2LGIA 3OPOA 3GTMB 1RWSA 2WU5B 4CKCA 4DHZE 1X55A 2IGDA 2TMPA 2IZVB 2WXOA 2NPTA 4GLSC 2Q5WD 1HZBA 4XTCS 2PMZB 3AU5A 1VQFA 2EYFA 4JPSA 1ESFA 1VF5C 2JE6I 1XLNA 2L7RA 1Q86C 2DUDA 1NY4A 3TN2A 5IGGA 1QE6A 2DZIA 3A1QA 1I42A 1GUSA 1J9OA 1E8ZA 5HFYA 1Y69U 4BBSG 1HNWL 4KD3A 1NMFA 3PPAA 4IUPA 1YHAA 2K0PA 3Q8BA 4GN5A 1U5KA 1QUQB 3NSWA 4NJ7A 4F88A 4MHEA 1G2TA 3AE8B 3HOUB 3NZSA 1YNNC 3HGBA 3Q8FA 5EKIA 2PTLA 5IGEA 4FXKC 1WY8A 3P4SB 1XCQL 3UDIA 2DYOA 3EGRA 3F1ZA 1E22A 3AE7B 2OJRA 3MP9A 2YTXA 1T0SC 1WYGA 2GMIC 2GOWA 3QX1A 3FHWA 2ZTCA 1KDAA 2I38A 2KDFB 1WTRA 1W6JA 1FEHA 1V49A 2F0EA 1UF0A 4XC2A 3TRZA 1WTXA 3K7AB 4H13C 3CAMA 2KCTA 2LMCB 1VD2A 2B2VC 4X3SA 1XMOQ 4IWPA 2J7QB 2L1AA 2XBBC 2KOLA 3RLNA 1STAA 2K5VA 1MIUA 1XNQL 4A3DB 3P42A 4GS3A 1YX6B 2CU1A 4LFCL 2MQHA 4DV4L 1VQ6A 2L12A 3DUZA 4XT1B 1Y1WH 4O2DA 5E3FA 2E6XA 5E4XA 1RJTA 3VYRA 3DM3A 2LFNA 3RN2A 3SFEB 2GBNA 3MXGA 2D10A 1RODA 3VXWA 3J7AV 1A62A 1H9SB 3A0JA 4S3SA 4A3JG 2EQSA 5COYA 2B63B 3HHMA 4E6IA 2HJ8A 2KQ7A 1XLPA 5JAVA 2WB1B 3APFA 1X1MA 4Q0FA 1SSOA 2OWOA 4RGMA 2L5TA 2N1VA 5I2XA 5IWAL 2O5IC 4P73A 4RG1A 2XTIA 1WFQA 1OQYA 4REZA 2X38A 4XYQA 1R9TH 2JXXA 3LWEA 1VQIA 3RZOB 3X0WA 3TZDA 3HOZB 4FADA 1LTBD 3J80E 1FXIA 3NS1A 4OW0A 2ENBA 3J9CA 2N7JA 1TKWB 1S5BD 5G55A 5L37A 3GTMH 2W54A 3D32A 1HQMC 4M8MA 1LTAD 2LY7A 2NZHA 3DWPA 1N61A 1VR9A 5BYSA 1CSQA 4AYBB 3JSVB 1Y8NB 2EKIA 4J3OD 1FNWA 1WZ0A 4HAEA 4WJQA 2HQEA 2K8HA 4BVUC 5H1SE 5BYRA 2K6AA 2A73B 3H0GG 4DV3L 5BMIA 1VDVA 2VQEL 4KDLB 1S5ED 2V3NA 2R7DA 4X62Q 1PH2A 3D4RA 5AZHA 2KENA 4YIJA 1C76A 2BYEA 4ZK9B 3ZNHB 1UUPA 1ICWA 1I50B 1N63A 1C3TA 1YQ4B 1IP9A 3JC66 4KKIA 1X54A 1B9RA 1SE9A 2LVOA 2LFIA 2KC2A 3O65B 3OTOQ 1T5EA 3RMHA 3ONSA 1IW7D 1V8CA 2RSUA 3VDZA 1GHKA 1E7VA 4I6NB 5H92C 2K33A 3DBLI 2JYEA 2MP2A 5FR6A 4DNTB 4NJCA 3U9OA 2EKEC 1I4QA 1OEYA 5E1FA 1CJEA 5IP7H 2OQKA 2WKCA 1FGBD 3RZFA 1PYSB 3K7AH 3J7AF 2XRSD 2KVRA 2J0JA 3MVVA 2LGSA 4XDDA 3ER0A 3T1HL 2PZWA 3S1QB 4G50A 3NJTA 1QZHA 2NVYB 1DOMA 5JVH3 4A3DH 2AUJD 4FXDA 4M1UB 3TMEA 2N9KA 2M17A 3KDFA 2O2LD 1E90A 5EPLA 1HTPA 4N8X1 5KYLA 1PMRA 1JWUD 2PPHA 1Q1EA 2PNHA 1N33Q 2CR5A 4P75A 1ZKHA 1ZP0B 4A3CH 1XO3A 3KOJA 4TRDA 1DZ1A 2LZ6A 3PIOA 2WHIA 1CUKA 1YNJD 2QDBA 3NPPA 2C7HA 1TZ1A 4YSXB 2B63H 5LL6S 1EWHA 3M4YA 4LF6Q 3KFUA 3KBXA 2B2VA 1TQOA 4H0LC 5C44B 2QCPX 1KAWA 4ZKCB 1EO6A 1TXYA 1EYCA 1FIQA 4A3MB 3FILA 2L76A 2BWES 1Q82C 4A93B 5D7GA 4HR7B 3RZOH 1F2LA 1STBA 3I56A 4MZ9A 3CF5A 2PI2E 1D5MC 1SROA 4O1NA 4R8NA 3U9SA 2BQQA 3C1FA 2DZMA 4B9KA 4FBJB 4XWWA 1LABA 3S1MH 4DV1Q 5CV4A 3VRBB 2G4DB 1XQQA 3H94A 4QMGA 4RKBA 3RZDB 3CPFA 2MUYA 1ZW7A 2Q8TA 2BKRB 2D0PA 2K8CA 5EKKA 1WX8A 2BWFA 4WIPA 2JN4A 2EMTA 4FJZA 4WJ3M 2F0HA 4IJLA 2M56B 4Y7NB 5CHFA 5L95C 3N6RA 1EYGA 1PZID 1EUVB 3DLLA 3G7LA 1STGA 2B29A 4NNJB 1JICA 1EU4A 2HCIA 1UE6A 3BZKA 3SE0A 1GJXA 4P1BC 1I50H 4JI2L 3PZ7A 1BKBA 2JA8G 2SDFA 1OEYJ 4KGRA 3VTUA 1S1QB 4A3LH 2ZXOA 4LW1A 1WSPA 2QEJC 2QHOA 2EYLA 1UE1A 2F4IA 1YN4A 2JF5A 3A9KB 3I5JC 2IT1A 4XE0A 2MO1A 3CF6E 1QNKA 3FRPB 2AX5A 1YNND 2INNE 3D4WA 4YWLA 3PSEB 2EJMA 1XPUA 3NVWA 1BNZA 2IL8A 1VQMA 1EWIA 3S14B 4KKSA 1UEBA 2BT6A 4DXGA 1TWCH 3X3NA 1EQRA 2RCFA 1OTCA 2EXZA 3C19A 1DOYA 3A5ZB 3WAPA 1WX9A 1IGDA 1IZ6A 4P74A 2J0KA 3KYHC 4LF5Q 4K2LA 4JI3Q 2MBOA 2GVBA 4F8MA 1T0YA 1PXUA 2M19A 2V3SA 2NVYH 1HXYD 1J8CA 1EFWA 2GBMA 1H8CA 5GADC 2F52A 2X69A 3CCRA 1VCBA 3GQBA 2UXCQ 3FDTA 4DKAC 1EEFD 1PRTD 5J3BA 2WAQB 2WXKA 3M63B 5C3XA 3P4QB 3KYDD 3EROA 3HZXA 1D5XC 2KJXA 3CCJA 1XPOA 2K05A 1LACA 4LWCA 4JGHB 4LFBL 2R7ZG 1WJ4A 2G1EA 1IBKL 5HI1A 1NCVA 3HKZB 1SE2A 3NBHB 2B76B 4EVOA 1R4QB 1FRRA 5BN5A 1FFVA 2EELA 2Y5BB 2N88A 1VQLA 2BVCA 1RKNA 5C0XG 3A56A 1DGJA 3VR5A 5C44H 4DR5Q 2HHHQ 2FE8A 1U4MA 3O13A 4IDIA 4MEMA 4R3DA 5LNK1 1UWVA 1O7YA 5DPWA 4UP9A 4A3MH 2UUCL 1P7EA 3T3NA 4NQLB 1GJZA 4A93H 5KHOA 1PGAA 2EMSA 1K8RB 4K14A 4B3SQ 4GLAC 2I07B 2WV6D 1KH0A 4GLVB 2F0UA 2B3AA 3KWVA 2MSED 4C80A 1EIGA 3NTIA 3BJUA 4GDKA 1VCIA 4KJNA 1Q46A 1ZPSA 2WYQA 4TKOB 1IYFA 2JQOA 2V9HA 4NJ6A 3RZDH 3F2CA 1QILA 3TP6A 2FFKB 1P9DU 1UBIA 4B3ML 1HHVA 3N52A 4C1NI 3PIP3 2VUMH 1QOAA 4BBNC 5FLXc 3PO3G 3HOVG 2K28A 1B3QA 4Y7NH 1WJNA 3MHBA 2AEHA 3U52E 2QGQA 3AFPA 3SFDB 3AMUA 1IBMQ 2AWNA 2JA7B 3AE6B 3E0EA 2WX1A 4JV5Q 3R7QA 4IPGA 2KMMA 4OZBA 3VUXA 1Q5WB 1GG3A 4K5WA 1Y56A 2LGXA 5AUKA 1V80A 3KJOA 1YIWA 4ZRPA 3TUOA 5CV7A 2PYKA 3PRMB 2K5PA 3H7PB 5IYCH 2LJ5A 4NMZA 4HCPB 4MGYE 1K3BC 3I4LA 5DPSA 1RL2A 1EYDA 1V97A 1EFID 2K3UA 2WU2B 1YJIA 3J7A5 4R1JA 3PO2B 4NQKE 2CW0C 2AWOA 3PV0A 5IP9G 3S14H 3Q6BA 4YWGG 1HA5A 4XQJA 4G0NB 4PS8A 4PG3A 1PZKD 4J15A 4RHRA 4POGA 1JE4A 3TJPA 2HIXA 4ALPA 1PH5A 2JU6X 1B1ZA 2INDC 3Q69A 5KYIA 1I6HB 4OIKA 1C9OA 2JSOA 1HNZL 4JI6L 3M4OB 3GB1A 4JG2A 3K81C 1KC8C 1RTNA 3HM6X 4HLEA 2IHFA 4RF1A 3E0JA 2B3GA 3V05A 3KLSA 2I2YA 3HVZA 1E7ZA 4HCEA 1QZEA 4JLCA 1NBWA 4A9AA 2X6GA 1L7YA 3B9JA 4JI8Q 1FJGQ 4FJVB 2PE6B 1C4CA 4N6EB 4ZRKA 4AQ7A 2Y0SG 1VQ9A 3AECB 1Z7TA 3GTOB 3HUIA 1P7FA 2CQAA 1LYLA 3T3OA 3MXPA 3U2SC 1E6EB 4IM0A 4DHJB 2VW9A 3NWSA 1LLRD 5CMDA 2K1BA 1WI5A 4B9WA 1WD0A 3RUIB 2KQ3A 2EYOA 4DV5Q 4C4VB 1QUQA 4BXXH 4KHPQ 2HD3A 2VNUD 3R7RA 5J2RA 3FKIG 3J81c 4ZLTF 4FNFA 2XGTA 5EBDA 2NB0A 2MBEA 1ICFB 4IFDI 3GE3C 1KNAA 3AE2B 3QQ8B 5G5HA 2I5MX 4BBRG 4X66Q 4DAMA 2KJ6A 3AH7A 2NZ1D 3VTVA 1R4NI 3TEZA 2IPKD 2LHDA 4R4CA 2GI9A 3I3CA 1FVIA 4M01A 3ITPA 1G8ZD 4TSSA 1OXSC 3F2UA 1UBQA 4Q2JA 2JY6A 1JJGA 4L5SA 3JVZX 5IGFA 2KHSA 3R66C 4XGAB 1QOHA 2LMCA 1NMGA 5LMUQ 3MFYA 3K7UC 1SYDA 4WWNA 2KCMA 1KTKA 3OWEB 3AEAB 1XTCD 4YL8A 1HPCA 2SNMA 4PMCA 3AYHB 1Q90A 1WTQA 2WXRA 2JA7H 4JWSC 1V1OA 1VF7A 2BYVE 3RMKC 3BG3A 1AW7A 4I65A 2A5HA 2RDGA 1CFMA 2YLMA 2KMAA 2LEKA 4PQXA 1RFAA 5LMNW 1S5FD 2PLPA 2F0WA 5FR3A 1FO4A 1OO9B 3EIVA 2WLBA 4KZCA 3A4RA 3HIZA 4DR4Q 1HH2P 1IGCA 4GKKL 1H9SA 2KCCA 2I1KA 2VH1A 3I4MG 3HVDA 3PGEA 2Z4IA 3OSOA 2WDVB 1TWGB 3B1LX 5C4ZA 3OWFA 2K7VA 3OJ4B 5GAEC 5C5LA 2X6LA 2LJIA 4FULA 2N9PC 1IYJB 2EY2A 3DEPA 4CDCC 1I6HH 3DEOA 2M1MA 4OZCA 3ZDMC 3BZDB 1WM2A 2R7FA 3WAOA 4JQWC 4OXPA 1SJHD 3CMMB 5C2TB 3MC8A 5DPTA 1EOVA 3BWUD 2F0MA 3H0GB 5A2QE 4EFOA 2OTLA 4LF4Q 3F2BA 1L6VA 1PGBA 1R4NB 2NS5A 4KV6A 1TWFB 4PV1C 3JSVA 2UWQA 2W3RA 3ZRFA 3T1YQ 2B2WC 1IBXB 4C56C 2AYOB 2K52A 4KKJA 1JOOA 1EQQA 1B2TA 2NBVB 3D6WA 4DUZQ 1W6KA 1QQRA 2OHFA 3VAWA 3D8GA 2QDLA 2D11A 4L5QA 2K75A 1E0BA 5CV9A 3D0FA 2F3VA 2ZJRA 4A3BG 3RT3B 4HCSA 4EEWA 1JWSD 2I5HA 2N1WA 2NN6G 4JL9A 5IYDG 3DBSA 2MP1A 1C4AA 4W9DA 5JZEB 1WGYA 3VA7A 1PH7A 1PRTB 4HJ9A 2E2HB 2K04A 2W3SA 1BO0A 2OT2A 1C1YB 4HRSA 4A3PA 4PK1A 3A5UA 1QVFA 3GTPB 2MJEA 2K22A 4ZHOA 3ZNID 4A3FG 3RN5A 1ACCA 2KHWB 4IOAA 4I6PA 3KF6B 2HUGA 1B8AA 3AULA 5G5GA 4GSWA 2F0PA 1VLBA 1F9RA 2L9HA 4A3EB 4ZCKA 4OIJA 1C0AA 4ZRQA 1BUVT 3TP5A 3QC8B 3VR3A 1TWAB 3H15A 4BBNF 5BMGA 4PYZA 1R4PB 3DWQA 2QCZA 3ENEA 4ZOHC 1BR9A 2LXCA 1V8QA 4ICVA 3SD5A 3ND9A 3IFTA 4RCNA 1KRTA 4MH0E 2NWGA 5AEKB 1NR2A 4CJ2C 1N9WA 1HR0Q 5E6OA 1JORA 4DV2L 4EX5A 5C4XB 4EQOA 1UELA 4XZ4A 3NP8A 4DN4M 4RCOA 4QGUA 1VQPA 1UEAB 2LI5A 2BS4B 3DQVA 3TDQA 4WAAA 2KTFA 2Z6KA 3TEWA 2JA5G 4MH8A 3FVQA 3TL5A 2BA0A 5JEAH 1EM7A 3L4PA 2FJ2A 3QWZB 3ZKJC 2KNBA 2UU9L 2B8FA 2F3IA 3L7ZC 1M4VA 4GLXA 4IW0A 1E3PA 2PZTA 1TWGH 4E74A 3CD6A 5D3IB 3TMPB 1N36Q 4X64Q 2R2OA 1SEBD 4KTAA 1STYA 5K36H 2YEPF 3W1GA 3SDLC 1KHIA 1I4HA 1V1PB 3M9BA 4JI0L 3A55A 2IO2B 2KWUB 1AZQA 4PZ6A 4P72A 2A74C 5M3FG 3PHXB 1JQ4A 2CVRA 5FJ8H 2LXAA 1S5CD 4HK2A 4QCLA 2NBFA 2C5LC 2WX0A 3JAME 3E5SA 1V1QA 4BY1B 3TP8A 2WDQB 2KJRA 2M8SA 4K7WA 5EE9A 4DR2Q 2K5QA 3K9PB 3VR4A 1C78A 4N9PA 1GKHA 2KYWA 1NR4A 1WTOA 3IAS1 2GN5A 5M5WH 2IX0A 2CH4W 2WDTB 5KNBA 1M90C 1G6JA 2ZTEA 3PV1A 2KQ4X 3GTKB 3PZ8A 1YX5B 3BVZA 2HJ1A 2DNFA 3MFGA 5HHDG 1D1KA 1K53A 4GOPA 3DDCB 1OXTA 1WVLA 1VQAA 3W3AA 4XQNA 2IYDB 3EVQA 4HTHA 2A68D 2E2HH 4NW2A 3A9KA 3TREA 1TIID 2WKDA 4K5XA 3MA2B 1TBEA 5G3LD 3FP9A 3GTPH 3W2DA 3HOZH 5AFWA 3DVNU 1IYUA 1ZKOA 4NKLA 4CKBA 4B3TQ 1YJJA 3AE1B 4QQBX 3QA8A 2ZVOA 2VRRB 4HKZE 3UQAA 3T13A 2B2WA 3PSIA 2PW9A 2IGGA 1B9MA 2ZVNA 4J8QA 5CORA 4X3UA 3TSSA 1L1OB 4BY7B 1KF6B 1XF5L 3EA6A 2ZPNA 4PS3A 4A3EH 1KXLA 2WS3B 3K58A 1X56A 4P71A 4ZAIA 4K8JA 4KY5A 2R92B 1D4BA 4GNXA 1TWAH 5GMVA 2IBIB 1A6XA 2ZW1A 2BYFA 4CDEC 3W5UB 4A3GB 5EQ0A 5KEEA 1CSPA 3MEHA 3QG1A 4K3BA 1R7SA 2KXJA 4OHJA 4LF8Q 4CQNA 1XX8A 3IVFA 1V5TA 3J80c 3OW2A 5ELOA 2EVBA 2MBQA 4DDGD 2Q8IB 1L0YB 4DR6Q 1PZJD 5C4XH 1CA6A 2CJNA 2ASBA 2EYHA 5CV6A 4K0KL 1RM6C 2JRIB 2UYZB 4HJGE 3NBHA 3A74A 2WXMA 2FCNA 3SK6A 2Y0SE 3CCLA 3AU4A 4JI5L 1N62A 3DOWA 3EFUA 3HM3A 3P2BA 4DR1L 1CQFA 3NXWA 2E5LQ 1T0RC 3D31A 1X3QA 4OL7A 3K5OA 1STHA 1HNXQ 4JOIC 4USAA 2R2QA 1EEID 1K83H 1X3FA 4NXNQ 3B2FA 1IPGA 4MSMB 1VQ7A 1WE7A 3FPUB 5K5PA 1SSNA 3RNGC 5ISRA 5FKAC 5C6AA 5M3MG 3RNFC 2UUBQ 1WYDA 2BOSA 4RMAA 5IY0A 3GTQB 5IYBH 3SGIA 3CC4A 1VQOA 1WH3A 1MGSA 4IUVA 3K57A 3BDLA 2LWPA 3PIO3 2M00A 3B6YA 3TCAA 4KSLC 4WH4A 4BY1H 3VDYA 3AV8A 4WRDA 1WR1A 1VS0A 4MM3B 3IAM1 4DR3Q 1QOGA 1WR6E 4RGOS 1P98A 2UUAL 5DAUA 5GQOA 3ZNZB 4N58A 2L00B 3V60A 3KWLA 3QOLA 1WOCA 4EE2A 1MD2D 3LDZE 1BBUA 4HIMA 3GTKH 1JR0D 2BGFA 2FMCA 3APCA 1D8LA 4KV2A 2G3QB 2RHSB 2QEXA 2YU9B 1EY5A 2NVQH 1OXUA 2NMQA 2IY0B 4GKJQ 1MHHE 4O0AA 1WTHA 3BDOA 1JWAD 1SE8A 4IM2A 3SEBA 2KLGA 1E8WA 3D6CA 4OGQC 5FLMG 2BE5C 3RNAC 1Y1VH 3M3YB 4X3TA 4GZYC 1F9JA 1AN8A 4HJ5A 1MPEA 3DVNV 4MGIE 1N34Q 1WZ3A 3K5MA 3HOWB 4BY7H 2FCMA 1G51A 3L16A 5I6YA 5IKCM 1L2NA 1I94Q 3I57A 1J6QA 4WFN3 1HQRD 4LMQD 2VY3A 5IN7A 3PLUA 2R92H 4HPPA 1A3UA 3SK4A 5C1ZA 1QNUA 3WALA 2LVQA 1CI3M 5I6WA 1PFNA 1UD7A 4A3IB 3UIOB 1GAQB 2IX3A 4A3GH 2HT1A 1JW9D 4B3RL 1AWDA 2JEBI 1R4MB 3AE9B 3VFKA 1PRTC 3S9WA 3UI3A 5AJ3Q 5HKHA 1FMAD 1BDOA 3NE5B 4BWGB 1N32Q 3CC2A 1WX7A 1PH1A 4HJ7A 3BINA 3OLMD 1F0ZA 4JI1L 2M9VA 3HOXB 5EPJA 1E2WA 4C00A 2N4FA 4OVVA 3N1XC 3HRZC 1VQNA 3K9OB 5T1IA 2I46A 1K52A 2Y5PA 2H5XA 1VQCA 4XIGS 1SNOA 3BVGA 1JQYD 2JSVX 4II3B 3GV3A 4C4VA 1K8MA 3ZTCA 5FLXL 3AB5A 4ACFA 3HG9A 3RUZA 4JI4L 4RNAA 1PH9A 1RFKA 5D94A 2EDGA 4OVUA 4DHZB 4FO2A 3Q2AC 3GTQH 1KIXA 4EQNA 1X3PA 3IKJA 5IGDA 1PH8A 2ONQA 2Y5CA 1YQBA 1Z47A 1S40A 3SK5A 2PQAB 4PS7A 3GTGB 4U68A 4X65L 5DCNA 1WGDA 2WP9B 3W5OA 4QB4A 1GUWA 1TR5A 4K6DA 2O6VB 1Q8IA 2DLBA 1EIFA 1YOVB 4HJ8A 4ASWC 4FF1A 5FOBB 1FFUA 1F2MA 2KHJA 2XVSA 4DPGA 2Q2UA 1K51A 4JOIA 4TUUA 3SR6A 4L5RC 2PQEA 4EKUA 3ML9A 1GB4A 4DV6L 3RD2A 2R93B 1SNCA 1I3QB 1T6BX 2QILA 3A7AB 1XTDA 2KEDA 2WACA 2EPBA 3L10B 4DR7L 1WIAA 2KWVB 3B0AA 3HOUH 1WF9A 1EY9A 3DHGC 3BYTB 3DXJC 5EBCA 1HJPA 4YY3L 4A3KG 1TT2A 4LJPB 3SHLA 5DM63 3M3YH 4IFDG 3J81j 3T51B 2F0OA 4XT3B 2NZOA 4IUMB 4V190 2D3BA 1HZ6A 3ND8A 4DGZA 3HOWH 2DY8A 4HMIA 3C8YA 1WCMB 2RMMA 1XXGA 1TU2B 2YYZA 5CBEE 1U4AA 2F0IA 4RFBA 2N55A 1FCLA 5H8YE 4FVMA 3CPWA 1AFPA 1YBYA 2CWPA 1JCKB 1VDZA 3K59A 3H3VI 3N1YC 2FBWB 2A6ED 4YTNB 4L2YA 4A3IH 2K8BA 1XD3B 2LKVA 4AOFA 3QO2A 2C5CA 2KJHB 4DHJD 1YI2A 1WGKA 4K8IA 5LMNL 1RHPA 2IX1A 1ZUD2 3RNCC 4R4IA 3J81L 1FNVA 3A8JE 4M02A 4M0WB 3WOEA 3BS1A 4H44C 1SGHA 3QCAA 4A3BB 2GBJA 2KK8A 4F7ZA 2DN8A 3HOXH 1X65A 4IN3A 2OEDA 1GHJA 4I7ZC 1Z9FA 5CV8A 2IWHA 4LNQA 5IA7A 2MJDA 4ZQ3A 5C3EG 2LRWA 1EIYB 3ZVVA 2A69C 3HEJA 1HUNA 2E75C 2ZT9C 2KTRB 2NBWB 4DBGA 2JUOA 1DCZA 1P16A 3K5LA 1UNSA 4NP5A 1HNWQ 1AE3A 1IHZA 2HCCA 1JALA 5C3JB 2Z1CA 2E2JB 2GBRA 3DHHC 3PF5A 2A5UA 2KN4A 4NZLB 1Q3LA 1F2RC 1TS2A 4LFAL 2MBHA 3FAHA 3PRZA 1PFDA 5LXHA 3KF6A 4CDFC 1XNRL 4KIKB 2OCEA 3OW7A 3GTGH 3IFDA 1JJCB 3I4NG 1X3GA 1K8OA 4G7ZC 2MJ8A 3U4ZA 4LF9L 1WGRA 1RF2D 4OWXB 2F4VL 1K50A 2NBUA 2DZKA 2BF8B 2ID0A 1XLOA 1ML0D 1SJED 1J5EL 1P3QU 3P4PB 3CP0A 1EIHA 3HFZB 3VR8B 2YTYA 1WMHB 4QUCA 1C8CA 4KN7C 3UE1A 2R93H 5JEAJ 1F9PA 1I3QH 1QB5D 4C3HB 4C7ZA 3Q3NC 5BR8L 2JA5B 1P0RA 4HIOA 1XNQQ 2YTVA 2VZKD 2KEEA 3NOBA 3HOYB 2JA6B 4LFCQ 3S17B 4DV4Q 1SFOB 2WXNA 3UF8A 1FD6A 1XMQL 3Q8EA 1SYFA 4FF4A 1CA5A 3CU7A 4IFDJ 3S2AA 1V43A 2EYMA 2KDEB 3STBC 3KF8A 1C79A 3H9DA 2ZW0A 5M3FB 4DK1A 3MTSA 3A33B 2BE5D 4LLGM 1WCMH 4PT5A 1KABA 2MX2A 2UXDL 4R8IA 1EUJA 1VMCA 3IG3A 1WXMA 1E8YA 2C7MB 1V1PA 1LV9A 4DAVA 3H8HA 1YHQA 2Q2HA 5J1ZA 1CTMA 4H2AA 3P4RB 4DU9A 1SN8A 5IWAQ 1IBLL 2BPSA 3S1QH 3S1NB 3FKYA 1BBWA 5JHBA 1SNDA 4HDOA 1PRTF 2W9NA 4G57A 5NUCA 1Z5SB 5JXVA 2FINB 4ANXA 1G91A 4A3BH 1CKMA 5BMHA 4X65Q 2DBYA 3EN2A 2EXDA 2HIVA 5ELNA 3CCUA 1ILPA 1OQRA 1WM3A 2CS4A 2J52A 3JYUA 4C3JB 4IZ8A 4HEDA 1SYCA 1UAPA 1MSHA 2AMCB 4DV3Q 2VQEQ 1NYQA 1WTWA 4OX9L 2AL6A 3A8IE 3MZ5A 3ZXVA 3K0XA 3IT6B 4XX5A 5CC4A 1U0LA 1ET9A 3KUDB 2AQ3B 2I5LX 4Q5VA 1JRUA 4AWJA 4YXDB 3ONAB 1F1HA 2E2JH 1HZ5A 4EZJA 1GO3E 1YMHE 1YZ6A 2BDNA 1RRBA 1B4OA 1DOKA 4LNNA 3C46A 1KDCA 3L9AX 4RMFA 4IOCA 4JYAL 1WGHA 2A4ZA 4UP7A 2PNRC 4MNOA 2K25A 1STEA 3GDEA 3BZCA 4AP4C 1BT0A 1U4PA 4W9HA 1B70B 1LM0A 4B6WA 1J7AA 1WFYA 2J4XA 2VQFL 2IO0B 3ML8A 4RAUC 3L0WB 4HDQA 4P16A 3H3VH 3ZUNA 1PVOA 4RGTA 3AI5A 3PF4A 4F8CB 1Y1WG 1N60A 4KZ0A 4C3HH 3V96A 4OO1H 3T1HQ 4NXML 1G6PA 4CKEA 3MHZA 3N1ZC 2JA5H 1SLJA 3L08A 3BIID 4KY6A 4DV0L 3G48A 1QVGA 4BZAA 3K0YA 1ZYRC 5FO7B 3HOYH 2JA6H 2PEAA 3ALBA 1RCVD 5D3DA 3FPPA 3PHWB 2WXQA 1SFOH 3A9JA 2XK5B 3T8MA 2NVXB 5IODA 3L0OA 3AEGB 2ES2A 2PVOD 3EFXD 2JEAI 4PYUA 3V62A 2D2CC 2IY5B 3EQLC 5G2NA 5D65A 1EU3A 1XEEA 4GDLB 4TV3A 1D2BA 4FJYA 2QW7A 4L23A 4LF7L 3V6EB 5IT9c 3TS2A 2KMCA 4KMUC 3V3XA 3OMGA 4HIDA 4MGZE 4II2B 1YN3A 1EY0A 2NVTB 1PH4A 4C2MB 1WJ6A 3TP7A 2VXWA 1ZGUB 2NVUI 4QF4A 2XSCA 4FA6A 1D1IA 1E5WA 3AXCA 1YHBA 2KWCA 3S1NH 5ELFA 4EOYA 2CU3A 3TZUA 3VHTC 1HTLD 1QZGA 2N8NA 2H88B 4JBMA 4UPAA 4JW0A 2KD0A 4PMBA 2GVAA 1ZXTA 2IJ0A 4BBSB 1KQSA 1IUEA 2MEKA 4KY7A 3LNNA 1L6UA 5L83A 4X57B 1TVXA 4C3JH 4QJFA 4YHHL 1UE7A 1HZAA 3SU8X 3TQYA 1LFDA 2OJWA 3Q8AA 4ANVA 3NZUA 2A68C 4OONA 2ALYB 4IG7B 3RULA 1TYGB 4KGTA 1G6ZA 3VR9B 2A69D 3GTLB 4JI2Q 4FN2A 3IBEA 5IP7G 2L52A 1BCPB 1SRUA 1AEXA 2WGSA 3J80L 4ZHPA 2KECA 3Q6SA 3T16A 2ICEC 3KUPA 1ZDXA 2CHWA 4AJYB 5JH5C 3TEHB 1V9JA 5CYUA 1DOIA 3RFZB 1NUCA 4NAMA 2D5GA 4MTKA 4CGYB 2N7DA 1EZ6A 4A3DG 5ELCA 4US9A 2AWTA 1XCTL 1QKZA 3UIPB 2KZRA 1E10A 1A70A 4LK1C 3VTWA 3M4PA 5CHVC 5E7NA 2Z6BA 2K4KA 3VRAB 2K5DA 5FK9C 2ZXPA 3I2ZA 1WWTA 3W1BA 3S15B 2EOTA 4DUYL 3H09A 4WJOA 4A3CG 4K81A 1T9HA 3HK0A 2FUHB 4UHVA 3T9LA 2Z0SA 1VMPA 2PW7A 4MT5A 1V2YA 3P20A 2B63G 5I9PA 1FPYA 3X3MA 1NDDA 5EPKA 4A3JB 3JAMc 4LUVA 2XIWA 2KO3A 3PUYA 2HDEA 2NVXH 1KM7A 2H89B 1HEZE 2PKOA 3Q8CA 1L4DB 4XDXA 2NUCA 3AB9A 1BBXC 5JJKA 3BK1A 2F0TA 1SYBA 4LFBQ 1ZEQX 3U7ZA 3VH4B 5C4HA 1IBKQ 4GOCA 3HOZG 3Q14C 3CCQA 1SXTA 1PV4A 3H3VC 1XLQA 2BCOA 3BDCA 4AQYL 3PO2H 2HE7A 5IAAC 3DCGA 5I2YA 1VZ6A 4A3OA 2FCSA 3CIRB 4D2KA 1SNQA 1E2ZA 3STBD 4GIVA 2K6DB 2JWZA 4A8XC 2V0GA 2NVTH 1WE6A 4C2MH 2K39A 2CH4A 1T3QA 1V6EA 2VZKB 2C7NB 1NSNS 4AYBG 2O4XA 2KBNA 4ANUA 3CKIB 2L11A 3VYTA 2UUCQ 3M4OH 4G7OC 3FEWX 1YJ9A 2F0FA 2XRQD 4AIMA 3P63A 3ZDTA 1J0GA 5EJWA 2IDYA 3V6CB 4TVAB 5IOCA 3AE3B 1LGRA 2MFIA 3RR5A 3NEMA 3VUYA 3U8ZA 1SNMA 1ENFA 4LUZA 1FRDA 3IT4B 4PMWA 1EY8A 2O6VA 3PS6A 2BH2A 4BBSH 1H4RA 4B3MQ 3WOFA 1Z2MA 1MFWA 4K5VA 4JK1C 3S16B 4A3LG 3GTOH 2BB5A 5FLXE 3MTNB 1A5RA 2K5NA 2L83A 4IKGA 4KDIC 4FLHA 4LK0M 2UXBL 4XQQA 1J19A 3U58A 1EOTA 4LCDE 3CRLC 1SR3A 5GXGB 3CSTA 4YTPB 2CHBD 2AQ2B 3N3KB 1VQBA 3GTLH 5BN3A 2R61A 2IGHA 3WCQA 4ITKA 2ZM6L 1U4RA 4BOSC 1C7YA 4ME3A 2KWDA 3KDFB 2X8XX 3QIAA 1VQKA 1K73C 3H6NA 2L4NA 2JPHA 4W9KA 3VH3B 1NTGA 1LQBA 3WAMA 1G291 3K5NA 1CKOA 1PUTA 3N32A 4RWSC 1E2VA 1C48A 1RDPD 1CHPD 4LUOA 3ULLA 3J7ZC 2F0KA 3GTJB 2D3AA 1LXDA 1VZ7A 4N59A 4DV7L 3M85A 4KD4A 5JJIA 2F0DA 3M7GA 3OHXC 4JI7L 3GZNB 4TMAB 1SB3C 3ZO5B 4WAFA 4IQZA 2B2TC 3S15H 3MJ5A 4JI6Q 3RLOA 2GA4B 1HNZQ 2CCZA 2RF4A 4BS9A 3SK8A 1A63A 3NVYA 4LJOB 4M0WA 3NHEB 3PLVA 3UI2A 1V81A 5C3EB 3RN9C 3NQIA 3J81i 1FYCA 4A3JH 3Q0AA 3V2TA 5C44G 2PE9A 1ET6A 1KAAA 3CCEA 2KAJA 2RSNA 4A3MG 4JBKA 1ZYRD 4V0BA 2GB1A 3A7LA 4NAWB 1XWEA 2K50A 4A93G 2KTRA 3R93A 1F52A 2WXIA 5CGKA 2D3GA 1K3RA 3KLWA 4IWQA 3BY4B 2DJFC 2R6GA 4A6QA 2O6VD 2MLBA 1PA6A 4EZKA 4NDXA 1M8AA 1OQQA 1E8XA 3I4NB 3J81E 3MC0B 3PO0A 3RNUA 2VUMG 1K0RA 3ECIA 4A90A 4F7XA 4JWUC 4ZKBB 3EECA 4YSZB 1SDFA 4KIKA 3H0GH 1PFMA 3AN1A 3NG0A 3P75A 3W5VB 3OIPA 3SXHA 1K0SA 1TWFH 2RPVA 1JC7A 1DGSA 1F2RI 5JPNC 1JT8A 1JROA 3NWTA 3QB3A 1GVPA 2D5DA 3C1EA 2LASA 2O5JC 3S16H 1NNXA 1WMHA 3N20C 4CHKA 3AEVA 2KHIA 3BYYB 3ULJA 2PPBC 2JA8B 1WXSA 3H1UA 5IYCG 1CHQD 5FO9B 4YT0B 3ZJTA 1D3ZA 1LUZA 5ELBA 3I3TB 4R4OA 2NR2A 3ZJYC 1TZOA 4ANWA 4KN4C 4FHJA 3PGZA 1WXAA 5JPMC 2ZJQA 1MJDA 2EYJA 1XMOL 3QK0A 4ZYSA 2CJOA 2WDRB 1SMYC 3AEEB 5G3LF 3NENA 3KUZA 1QLBB 1KNEA 2GBKA 2PJHA 5CBAE 4IUTA 1NVID 4IPCA 5CR3A 1I4RA 1GD7A 1L4ZB 4HEA1 5JJZA 4DFAA 4GKKQ 2RA4A 3BU2A 3ZYYX 3H7SA 1U4LA 2JRHA 3NS8A 3ZLZA 4YCWA 4AQYQ 3GS2A 3ICEA 2V3PA 3QHTA 2WFWA 3GTJH 1EY7A 1JJ2A 2FIFA 2A6EC 1EY6A 2QDFA 2WXLA 1JRPA 3I7FA 5JHAA 2WAQG 1HFGA 1FCCC 3UE0A 1XT9B 4JPBW 5ELDA 1F2YA 1SE4A 3PT2B 2ZCBA 1Q0WB 1EZ8A 1CZWA 3ERQA 3VUWA 2G5DA 1DYQA 2K01A 2PMZE 3HKZG 4R4TA 1N8RC 1TJEA 5DEHA 4OWWB 2R7ZB 2N0SB 3Q3OC 4MDKE 3C3LA 3U30A 5J39A 3T56B 3C0RB 1BCPC 3P7JA 2K14A 4DDID 2LXKA 3QOJA 1YQ3B 4NY0A 4IUUA 1LO5D 1SYEA 5C3WA 3H91A 4BXXG 2WP8J 1C4PA 5IE8A 1CKNB 5IO9A 4IJHA 2XNAC 3NRZA 1EWYC 4QIWE 2RDBC 3PMFA 2PI2A 2D07B 3ZXRA 5ELEA 4B9XA 3TBIB 2BB6A 4CO7A 2AHOB 2INCC 2N9XA 4G4KA 3ZTDA 3ZQ4A 2YV5A 2B2TA 3S2HB 1FD7D 2AUKA 4X62L 1ASYA 2LRUA 3VQIA 3HP3A 2KX0A 4LAAA 4P6VF 3WIMA 3X23A 3IRBA 3I4NH 5DLQE 4ME5A 4KLKA 1FM0D 1PGXA 2Q8RE 4A20A 3FC4A 2KN5A 4HIKA 2CKZB 1FXTB 2ZNVB 1R4MI 2DYMA 2MJ3A 3K8AA 3OTOL 3HOVB 3PO3B 1LTID 2Z4HA 3Q22A 4EZLA 1HR0W 2FNJB 5KHQA 1U9RA 3BK2A 1IL2A 3MC9A 1SE3A 1A0IA 1FL0A 5IGCA 3RNBC 4R9WA 1Q1BA 4M00A 3SDZA 2DAJA 1NI2A 2LGDA 5DPRA 2E74C 3E3XA 2C60A 2JA8H 3OAWA 4UAIA 2DHZA 3M4QA 2LVPA 3M95A 3I73A 3E9HA 3IXSA 2RD0A 3JW0X 4AS1A 2QSDA 4WWOA 1EYAA 2KLCA 4MELA 4ZYNA 2TSSA 4J6IA 1JWBD 1WI0A 4JVZA 1YVCA 3H7PA 4DV2Q 2OTJA 1K28A 4G3XB 2RPQA 3EJIA 2MA9B 3NVVA 2HQLA 4GDLA 4LDTB 1WXVA 3DWMA 1LTTD 1N33L 1I5FA 3SR1A 2K9XA 3I63C 2UU9Q 1ASZA 2FCQA 4LNKA 3TEXA 3M3JA 3CMAA 1H9MA 2KFJA 5CX3A 1F2ZA 1A2UA 4LF6L 3DBHB 2DX5B 3MJWA 2DAFA 1GOZA 1CZPA 4KSKC 5KGUA 2BBCA 1NJIC 1S4ZA 3Q3FA 4BA1I 4KVGB 1ZE3D 2DNCA 4JI0Q 4AYBE 4L5TA 1VQ8A 1P1AA 1WJUA 1HZ9A 3DHIC 4KHVA 4QIWB 1PH3A 1TIFA 5F2DA 2Y0SB 2DNEA 2R7ZH 1LT5D 1XYIA 1UGMA 3F8TA 2VB2X 3AEBB 2L3ZA 1A15A 4RM8A 1VQ5A 2J42A 4HWIB 4W9EA 5M5XB 5JJLA 1L5PA 2WINB 4DV1L 1A3VA 5AUIA 2BTEA 5C0XH 4A75A 2ATWA 2N7EA 2C9OA 3VVWB 1MKHA 5JVG3 2MQJA 4F87A 1T5XD 3CC7A 3M7NA 3FKIB 3EHVA 5E6NA 1JMLA 1B7YB 1SBBB 1WTPA 2F03A 2HTHA 3S2HH 2KDIA 4C3IG 4B0EA 2E8GA 5GAHC 1ZXIA 4BBRB 3A8KE 1X9NA 1UH6A 3KQ4A 2LSSA 5TSSA 1TT5B 2KX3A 5DNFA 3PREA 4C7YA 1HUMA 4EQPA 2REXA 2MRPA 1LTLA 3T4AC 1BUIC 2EYPA 1TY0A 2KKCA 1UWXA 3J80i 5A2QL 3HOVH 3PO3H 3QIJA 1DJRD 1TGZB 1B50A 4PNYA 1QG7A 4YWKA 1IKMA 1JWMD 1B9NA 4P1CC 3RI7C 1GPXA 2W55A 2K5HA 4RGNA 3RD4A 4BKTA 3DWAA 3Q3MC 4GGQA 2KFKB 5BO4B 3EBEA 2NN6I 2RQXA 4BKSA 1EQVA 1J7BA 5LXIB 2WIIB 1MJCA 3PVLA 2MHJA 5IT9L 4QL5A 4BKGA 2Z0EB 2LUMA 1Q12A 5TR5A 3QARA 1IXRA 2B2UC 2D0OA 4RH6A 4LF5L 2GRIA 2YU9H 2V4DA 2KCNA 4JI3L 5JEAG 1J8IA 2FMMA 2Y3AA 1FR3A 3I4MB 1PYWD 3EC8A 1C9FA 5IP9H 3S1MB 5D6JB 3ZJVA 2UXCL 5EE3A 3HRDD 2MCNB 1DD2A 1ZXHA 2M0XA 2YVCA 5K36G 1QCBD 2BYTA 1HTQA 1SMYD 2JYOA 4K0KQ 3ZGZA 1WTVA 3CCSA 3ZIMA 1DONA 3LGJA 4BFRA 2DJGC 4JI5Q 3KW5B 4P7IA 1RTOA 1X32A 5FJ8G 4UY8C 3WDNA 4DR1Q 5IP4D 3IAYA 3KLSX 2XEWA 2XWBB 4GMVA 5HG2A 2YEPB 1YJ1A 1HFNA 2N9LA 4GB9A 2MWSB 2IW3A 2H1EA 2ZXRA 4DR5L 1JB7A 2HHHL 1PFBA 4DK6C 5JOBA 2OF1A 4HSPA 3NVZA 4WQOB 2MH7A 1DOXA 5A35A 4B3SL 1N5XA 4OO1I 1TWHB 4MACA 1RD9D 1CM9A 3M62B 1BCPF 4B0MA 5M5XH 3KUCB 2QC8A 2MPMA 1PHJA 1I4XA 3T53B 1IBXA 2FUG1 3A4SC 4EUTA 4ZUJA 1BCPD 2GLSA 1CT1D 1L1OC 2NTSA 3DVGY 3E6ZX 2UUAQ 4GU2A 4HKQA 3FKIH 1TWCB 4AH6A 2PO4A 5C4JB 4PZ8A 3E9SA 3V61A 2L8JA 1SAPA 4FF3A 4DWFA 4R4QA 1E0ZA 4IOIE 1RAXA 4K2KA 4DAYB 1I4GA 2HTME 4A3FB 1EQTA 4BBRH 2ZJPA 4W9JA 4XDCA 1LM8B 4C1NK 1QOBA 1IBML 1MG4A 3I4OA 2IO1B 1I35A 3I90A 4A3EG 4JV5L 4WJWA 4FF2A 4BKSD 4KJOA 1PTOB 4G7HC 2EY1A 4JE3B 5T1GA 4E71A 4X6AH 3NK9A 3MHSD 2DGYA 3JAML 4YCUA 2ZTDA 1MHXA 2LGYA 1NYRA 5AZGA 2RGFA 3NUCA 3W9CB 2WWZA 4TQ0A 2KDBA 4YSYB 4DK0A 4MJSB 5EE0A 3OOCA 2L05A 5IGBA 4WJ4A 5C4XG 2WAQE 1I4PA 1BVSA 2O2VB 4MTNA 1WD1A 1IKLA 3OG5A 3HS0C 4OZAA 1QT9A 4YCVA 2FAZA 3S2DB 1YITA 4CYEA 4B3RQ 2JZZA 1NBFC 3K6OA 3HKZE 1YD8U 4JX1C 3WWVA 3VYUA 1ONLA 3TS0A 3RPFC 3I4MH 2EE1A 1KOTA 2ZNVC 3G71A 2J0MA 3ZNGC 3DBLB 2EJGC 1H9RA 4S0RA 1ROEA 4IUQA 1HRJA 4M8AA 4JI1Q 4NAWA 1VZ8A 1RYJA 4JI8L 1NAPA 1FJGL 2JXTA 3WA0A 4MN3A 1VRAB 3LB8C 2DYBA 4XYOA 2MGSA 5IYBG 2VUMB 1BQQT 3PUVA 2RSOA 4KX6B 2JJQA 3AQQA 2MHVA 4IUNA 5M9OA 1KLGD 2JWUA 4HVBA 1E24A 4W9CA 4BY1G 1XPRA 2B2UA 2SAKA 5EE1A 4HN7A 4JI4Q 4DV5L 2CHZA 1TS5A 1Y8OB 4KHPL 2ZPYA 4AJWA 1UZXB 3GP7A 4GOPB
chains in the Genus database with same CATH topology
1O78A 3R8BA 4MIUA 4X3KA 3TEYA 3D3RA 3BVMA 3AE4B 2NN6H 1F77A 1NENB 2F0NA 2XWJB 2RVLA 3NTKA 1LTRD 2BW2A 3R2IA 4O42A 5LL6X 1MI0A 2B8GA 1D6EC 4HMJA 4WQMA 3KK7A 4WORA 4WWMA 1E7PB 5KRUA 2HDMA 2KA7A 5KNDA 2F1MA 1PTOH 1AP0A 2PMVA 2G9DA 1GXDC 1MSGA 2E2IB 4KI0A 1MBYA 4KHZA 2F0GA 2K5WA 1NEKB 4FP5D 5I4DA 1PLFA 4ODGA 2WXFA 1BXTA 1H9JA 4H7BA 2HDLA 4K6LA 4CJ0B 3AEDB 4TQ1A 1ESRA 1HA6A 1KDBA 1OFFA 2WNMA 3KLRA 3P1HA 5EKLA 1C77A 1OXVA 4L63B 1PDXA 1LTSD 2L1BA 3AEFB 3MXUA 3L3OC 4XXEA 5M3MB 2K32A 5T8IA 1E9MA 4KKUA 1ZOYB 2WXHA 3J7YW 4EGVA 1IL8A 2L55A 1LT4D 4FXCA 4ILWA 2RBMA 4P2CB 5CV5A 1BMLC 1II3A 3NTHA 3I9V1 2INPE 4CJ1B 4J1MA 3GD7A 3S1RB 4FXGC 1QJOA 1STNA 3QWNA 3N9YC 5KIXA 5HGTA 4YTMB 5J22A 3CWIA 1ZDVA 2F0LA 2M2LA 1JOKA 4CBVA 1S5DD 4ZRZA 1GUNA 5IIFA 2RDFA 1O7LA 4RF0A 3QJYA 4B08A 5D14A 1JB3A 3KBGA 2BDOA 3D4DA 4ZUIA 3B2GA 2F0VA 2QJLA 2L0CA 2E2DC 4L1BA 4HSVA 5KNCA 5C0XJ 3I91A 3MAQA 3I70A 2D9UA 2AQ1B 3VR6A 1PTOC 1DXMA 2LHEA 1QOFA 1L0VB 1AZPA 1L0XB 4J6HA 4C3IB 2EY5A 3MWYW 5M5YB 2DY7A 3OIQA 4KK7A 1SF0A 4QUFA 1ENCA 2ICIA 1QF6A 4XWTA 4UDUC 5I9OA 1EY4A 3CQZB 1TKEA 1LT3D 3R3OA 1B53A 3DHQA 1PDQA 2A6HC 1LT6D 3C2PA 3AU7A 2KDMA 2FHTA 2NYZD 3VR2A 2PZUA 3SVMA 3G6JB 2F0QA 1I6VC 4ARIA 5E6JA 2D62A 2J0TD 2QF7A 1TKGA 3AE5B 1B3AA 2B2YC 4ARCA 1VJKA 1EL0A 4US8A 1DM0B 1SNPA 2NTTA 4A3KB 2JYTA 3DWGC 4CHTB 2WXGA 2R3ZA 1A3TA 3URYA 3NUHB 4DXFA 2BA1A 1NI3A 5BN4A 4ULLA 1ENAA 3W1SA 2L32A 1G2SA 4A55A 4U673 3FMCA 4DNRB 2M0AA 1EWCA 2Z8LA 1ILQA 5M5WB 1AYFA 1C4QA 2F0SA 5IT9E 2SOBA 2JXMB 2E76C 4RKLA 3Q23A 1MI2A 2DWQA 4BA2I 2QKIC 3DMUA 1QWYA 5EGTA 3HUIA 2JX5A 1BOSA 1KRHA 3U2SC 2G9HD 3Q24A 1O80A 1Y8PB 3FILB 3I72A 1JOQA 5HURA 1CZGA 2W82A 2QIEB 1BF4A 3CHBD 2KVMA 1CQVA 3IL8A 4DAPA 1GUGA 4DAYA 2SNSA 4HROA 1GUOA 2KUMA 4JBWA 3I8ZA 2SEBD 2PW5A 2J7ZA 5E4WC 2VB3X 2OXPA 3GV6A 1I7HA 1TS4A 1KLUD 3H6MA 2QMTA 4C3HG 4OO1G 2JZPA 2LS01 3ZJUA 4DA2A 3E56A 3VA5A 4RA8A 2F0JA 5C0XI 3OMCA 2EZVA 1HCZA 1K83B 1B44D 2CW0D 1MVKA 2E3TA 1YN5A 4IFDH 4WURA 4L6TB 2ACZB 2KACA 1WRIA 2F3WA 1CK1A 3VYSA 3LYYA 2B39A 3AMZA 3LWUA 3A54A 1A2TA 4RHSA 5LHY1 1N5WA 1SYGA 2V4IB 1F9SA 2BS2B 1J7CA 4ID6A 4KGSA 2B2YA 3R2TA 5MPOA 3NBIA 4DF7A 2NVQB 1O7ZA 1DOLA 1D5ZC 2ON8A 3NZ3A 4KKTA 1TKYA 5BYQA 3U4EG 5DM73 1UWMA 1IW7C 4C3JG 3LX0A 2H4OA 3RLFA 1F9QA 3MXNA 1Q10A 4L8JA 4IALA 1PTOF 3PUZA 2PCFB 2J53A 2PVGC 3ETRA 1Y1VB 2EY6A 2RDHA 1Z6HA 1PTOD 4LJZC 4GDKB 1TY2A 3DM1A 1SIJA 4N9TA 5C5MA 2BS3B 4Z9CB 2XN9C 3CRKC 2JP1A 3AM9A 3PUXA 4IURA 2RKSA 3EUB2 1TS3A 1UGJA 3GO5A 3PUWA 1H9KA 1FXAA 1OXXK 4TQUS 2A6HD 2WXPA 1YNJC 1Y1WB 4DQOC 2WXJA 1KFYB 2WQYB 1GUTA 3LXFA 2JQRB 1YNTE 3P1MA 3NHHA 1IYVA 1LTGD 2OEOA 4FYDA 1FNUA 3NQTA 4ABNA 1R9TB 4LTUA 1GB1A 5FO8B 4OVZA 3ABVB 2PIAA 2K03A 2Y5CA 2LGIA 2EJFC 1WXQA 3OPOA 3GTMB 1RWSA 2WU5B 4CKCA 2IGDA 2TMPA 2WXOA 4GLSC 2Q5WD 4XTCS 2PMZB 2EYFA 4JPSA 1ESFA 1VF5C 2JE6I 1XLNA 3TN2A 5IGGA 1QE6A 1GUSA 1J9OA 5HFYA 1Y69U 4KD3A 4IUPA 2K0PA 3Q8BA 3NSWA 4F88A 4MHEA 1G2TA 3AE8B 3HOUB 1YNNC 3HGBA 5EKIA 2PTLA 5IGEA 4FXKC 3P4SB 1XCQL 2DYOA 3EGRA 3AE7B 3MP9A 1WYGA 1KDAA 2I38A 1WTRA 1W6JA 1FEHA 2F0EA 1WTXA 3K7AB 4H13C 2LMCB 2B2VC 4X3SA 2L1AA 2KOLA 1STAA 3P42A 4A3DB 2L12A 3DUZA 4XT1B 5E3FA 2E6XA 5E4XA 1RJTA 3VYRA 3SFEB 2LFNA 3MXGA 1RODA 3J7AV 1H9SB 4S3SA 5COYA 2B63B 4E6IA 1XLPA 5JAVA 2WB1B 4Q0FA 1SSOA 4RGMA 2L5TA 5I2XA 2O5IC 4REZA 2X38A 4XYQA 3LWEA 3RZOB 3TZDA 3HOZB 1LTBD 3J80E 1FXIA 3NS1A 4OW0A 2ENBA 3J9CA 2N7JA 1TKWB 1S5BD 2W54A 1HQMC 1LTAD 2LY7A 3DWPA 1VR9A 1N61A 5BYSA 4AYBB 1Y8NB 2EKIA 4J3OD 1FNWA 4HAEA 2HQEA 5BYRA 2K6AA 2A73B 5BMIA 1VDVA 1S5ED 2V3NA 3D4RA 4YIJA 1C76A 4ZK9B 1UUPA 1ICWA 1I50B 1N63A 1YQ4B 4KKIA 1B9RA 2LFIA 1T5EA 3RMHA 1IW7D 1V8CA 1GHKA 5H92C 2K33A 2JYEA 4DNTB 4NJCA 3U9OA 1I4QA 5E1FA 1CJEA 2WKCA 1FGBD 3J7AF 2XRSD 3MVVA 4XDDA 2PZWA 3S1QB 2NVYB 1DOMA 5JVH3 4FXDA 2AUJD 4M1UB 3TMEA 2N9KA 2O2LD 5EPLA 1HTPA 5KYLA 1PMRA 1JWUD 1Q1EA 1ZP0B 1XO3A 4TRDA 1DZ1A 1YNJD 3NPPA 2QDBA 4YSXB 5LL6S 1EWHA 3M4YA 3KBXA 2B2VA 1TQOA 4H0LC 5C44B 2QCPX 4ZKCB 1EYCA 1FIQA 4A3MB 3FILA 4A93B 5D7GA 4HR7B 1F2LA 1STBA 4R8NA 1D5MC 4O1NA 4XWWA 3U9SA 3C1FA 1LABA 3VRBB 5CV4A 3H94A 4QMGA 4RKBA 3RZDB 2MUYA 2Q8TA 5EKKA 4WIPA 2F0HA 2M56B 4Y7NB 3N6RA 1PZID 3G7LA 1STGA 1JICA 1EU4A 2HCIA 3SE0A 1GJXA 3PZ7A 4KGRA 2SDFA 2ZXOA 1WSPA 2QEJC 2EYLA 2F4IA 1YN4A 2IT1A 4XE0A 1QNKA 3FRPB 2AX5A 1YNND 2INNE 3D4WA 2EJMA 3NVWA 1BNZA 2IL8A 3S14B 2BT6A 4KKSA 4DXGA 3X3NA 2EXZA 1DOYA 1IGDA 4K2LA 4F8MA 2M19A 1PXUA 1HXYD 2X69A 3GQBA 3FDTA 1EEFD 1PRTD 2WXKA 2WAQB 5C3XA 3P4QB 3EROA 3HZXA 1D5XC 2KJXA 2K05A 1LACA 2G1EA 5HI1A 1NCVA 3HKZB 1SE2A 2B76B 4EVOA 1R4QB 1FRRA 5BN5A 1FFVA 2EELA 2N88A 3Q8FA 1RKNA 5C0XG 3A56A 1DGJA 3VR5A 2FE8A 4R3DA 1U4MA 3O13A 4IDIA 5LNK1 1O7YA 1P7EA 3T3NA 1PGAA 4K14A 2I07B 2WV6D 1KH0A 4C80A 2F0UA 3KWVA 1EIGA 3NTIA 1VCIA 4KJNA 1ZPSA 4TKOB 1QILA 3TP6A 2FFKB 1HHVA 3N52A 4C1NI 3PIP3 1QOAA 2K28A 3MHBA 3U52E 3SFDB 3AMUA 2AWNA 2JA7B 3AE6B 2KMMA 4OZBA 4K5WA 1Y56A 5AUKA 4ZRPA 3TUOA 5CV7A 2PYKA 2K5PA 4NMZA 3I4LA 1EYDA 1V97A 1EFID 2K3UA 2WU2B 1YJIA 3PO2B 4YWGG 2CW0C 2AWOA 3PV0A 1HA5A 4XQJA 1PZKD 4RHRA 1JE4A 2JU6X 1B1ZA 3Q69A 5KYIA 1I6HB 4OIKA 2JSOA 3GB1A 3M4OB 1RTNA 4RF1A 3E0JA 3V05A 3KLSA 2I2YA 3HVZA 4A9AA 4HCEA 2X6GA 3B9JA 1C4CA 4N6EB 4AQ7A 3AECB 1Z7TA 3GTOB 1P7FA 2CQAA 3T3OA 3MXPA 1E6EB 3NWSA 1LLRD 5CMDA 2K1BA 4B9WA 1WD0A 2KQ3A 2EYOA 2VNUD 4ZLTF 4FNFA 5EBDA 2NB0A 4IFDI 1KNAA 3AE2B 5G5HA 3AH7A 2NZ1D 3TEZA 2IPKD 2LHDA 2GI9A 3I3CA 3ITPA 1G8ZD 4TSSA 1OXSC 3F2UA 4Q2JA 5IGFA 2KHSA 1QOHA 2LMCA 3MFYA 1SYDA 1KTKA 3OWEB 3AEAB 1XTCD 1HPCA 2SNMA 4PMCA 1WTQA 1Q90A 2WXRA 4JWSC 1V1OA 1VF7A 3BG3A 1AW7A 4I65A 2A5HA 2RDGA 1CFMA 2LEKA 4PQXA 5FR3A 1FO4A 1S5FD 2PLPA 2F0WA 1OO9B 2WLBA 1IGCA 1H9SA 2KCCA 3HVDA 2Z4IA 3OSOA 2WDVB 1TWGB 5C4ZA 3OWFA 2K7VA 5C5LA 2X6LA 2LJIA 2EY2A 3DEPA 4OZCA 3DEOA 3BZDB 1SJHD 5C2TB 3BWUD 2F0MA 3H0GB 5A2QE 1L6VA 1PGBA 4KV6A 1TWFB 4PV1C 2W3RA 2B2WC 1IBXB 4C56C 4KKJA 1JOOA 1B2TA 3D6WA 1W6KA 1QQRA 2OHFA 3D8GA 1E0BA 5CV9A 2F3VA 4HCSA 1JWSD 2NN6G 2MP1A 1C4AA 3VA7A 1PRTB 2E2HB 2K04A 2W3SA 1BO0A 2OT2A 4HRSA 4ZHOA 2MJEA 3GTPB 2K22A 1ACCA 2HUGA 5G5GA 2F0PA 1VLBA 1F9RA 2L9HA 4A3EB 4OIJA 4ZRQA 1BUVT 3TP5A 3VR3A 1TWAB 5BMGA 1R4PB 3DWQA 4ZOHC 1BR9A 1V8QA 3ND9A 3IFTA 4RCNA 2NWGA 1NR2A 4CJ2C 1JORA 5C4XB 4EQOA 3NP8A 4DN4M 4RCOA 1UEAB 2BS4B 3TDQA 3TEWA 4MH8A 3FVQA 2BA0A 5JEAH 1EM7A 3L4PA 2FJ2A 2B8FA 3L7ZC 1M4VA 2PZTA 5D3IB 1SEBD 4KTAA 1STYA 5K36H 2YEPF 1I4HA 1V1PB 3A55A 1AZQA 2A74C 1JQ4A 2CVRA 1S5CD 4QCLA 2NBFA 3JAME 3E5SA 4BY1B 2WDQB 3TP8A 5EE9A 2K5QA 3VR4A 1C78A 4N9PA 1NR4A 1WTOA 3IAS1 2IX0A 5KNBA 2KQ4X 3GTKB 3PZ8A 3BVZA 3MFGA 5HHDG 1D1KA 1K53A 1OXTA 1WVLA 3W3AA 4XQNA 3EVQA 4HTHA 2A68D 4NW2A 1TIID 2WKDA 4K5XA 3MA2B 5G3LD 3W2DA 5AFWA 1IYUA 1ZKOA 4NKLA 4CKBA 1YJJA 3AE1B 4HKZE 3T13A 2B2WA 2PW9A 2IGGA 1B9MA 4J8QA 5CORA 4X3UA 3TSSA 4BY7B 1KF6B 1XF5L 3EA6A 2WS3B 3K58A 4ZAIA 4K8JA 4KY5A 2R92B 1D4BA 2ZW1A 1A6XA 3W5UB 4A3GB 5EQ0A 5KEEA 3MEHA 3QG1A 1R7SA 4CQNA 4OHJA 1XX8A 2EVBA 2Q8IB 1L0YB 2CJNA 1PZJD 1CA6A 2EYHA 5CV6A 1RM6C 4HJGE 3NBHA 2WXMA 3SK6A 1N62A 1CQFA 3NXWA 3D31A 1X3QA 4OL7A 3K5OA 1STHA 4USAA 1EEID 3B2FA 3FPUB 5K5PA 1SSNA 5ISRA 5FKAC 5C6AA 2BOSA 3GTQB 1MGSA 4IUVA 3K57A 3BDLA 3PIO3 2M00A 4WH4A 3AV8A 4MM3B 4WRDA 3IAM1 1QOGA 4RGOS 5DAUA 4N58A 3KWLA 3QOLA 4EE2A 1MD2D 1JR0D 2FMCA 2YU9B 1EY5A 2NMQA 1OXUA 1MHHE 3BDOA 1JWAD 3SEBA 3D6CA 4OGQC 2BE5C 3M3YB 4X3TA 4GZYC 1AN8A 1MPEA 3K5MA 3HOWB 5I6YA 3I57A 4WFN3 1HQRD 4LMQD 1A3UA 3SK4A 1QNUA 1CI3M 5I6WA 1PFNA 4A3IB 1GAQB 2IX3A 1JW9D 1AWDA 2JEBI 3AE9B 1PRTC 3S9WA 3UI3A 1FMAD 1BDOA 3NE5B 4BWGB 1F0ZA 2M9VA 3HOXB 5EPJA 1E2WA 3HRZC 5T1IA 2I46A 1K52A 2Y5PA 4XIGS 1SNOA 3BVGA 1JQYD 2JSVX 3GV3A 1K8MA 5FLXL 3AB5A 3HG9A 3RUZA 4RNAA 1RFKA 2EDGA 4FO2A 4EQNA 1X3PA 3IKJA 5IGDA 2ONQA 1Z47A 3SK5A 3GTGB 4U68A 2WP9B 4QB4A 1GUWA 1TR5A 4K6DA 1Q8IA 2DLBA 4FF1A 5FOBB 1FFUA 1F2MA 1K51A 2XVSA 4TMAB 3SR6A 2PQEA 1GB4A 2R93B 1SNCA 1I3QB 1T6BX 2QILA 3A7AB 2KEDA 2WACA 2EPBA 1EY9A 3BYTB 3DXJC 5EBCA 1TT2A 3SHLA 5DM63 4IFDG 3T51B 2F0OA 4XT3B 4V190 1HZ6A 3ND8A 4DGZA 2DY8A 4HMIA 3C8YA 1WCMB 2RMMA 1XXGA 5CBEE 1TU2B 2YYZA 2F0IA 4RFBA 2N55A 1FCLA 5H8YE 4FVMA 1AFPA 1JCKB 1VDZA 3K59A 2FBWB 2A6ED 4YTNB 4L2YA 2LKVA 3QO2A 2C5CA 1WGKA 4K8IA 2IX1A 1RHPA 1ZUD2 3J81L 1FNVA 3A8JE 3WOEA 3BS1A 4H44C 4A3BB 2DN8A 4IN3A 2OEDA 1GHJA 4I7ZC 5CV8A 2IWHA 2MJDA 4ZQ3A 2A69C 3HEJA 1HUNA 2E75C 2ZT9C 1DCZA 3K5LA 1UNSA 4NP5A 1IHZA 2HCCA 1JALA 5C3JB 2Z1CA 2E2JB 2KN4A 4NZLB 1Q3LA 1F2RC 1TS2A 3FAHA 1PFDA 3OW7A 3IFDA 1K8OA 4G7ZC 2MJ8A 1RF2D 1K50A 2ID0A 1XLOA 1ML0D 1SJED 3P4PB 1EIHA 3VR8B 4QUCA 1C8CA 4KN7C 5JEAJ 1F9PA 1QB5D 4C3HB 4C7ZA 2JA5B 2VZKD 2KEEA 3HOYB 2JA6B 3S17B 1SFOB 2WXNA 1FD6A 3Q8EA 1SYFA 4FF4A 1CA5A 3CU7A 4IFDJ 1V43A 2EYMA 3KF8A 1C79A 2ZW0A 5M3FB 4DK1A 3MTSA 4LLGM 2BE5D 4PT5A 1KABA 4R8IA 1VMCA 1V1PA 1LV9A 4DAVA 3H8HA 5J1ZA 1CTMA 4H2AA 3P4RB 4DU9A 3S1NB 1SNDA 1PRTF 4G57A 5NUCA 5JXVA 2FINB 1G91A 5BMHA 2DBYA 1OQRA 1ILPA 2J52A 4C3JB 4IZ8A 4HEDA 1SYCA 1UAPA 1MSHA 1NYQA 1WTWA 3A8IE 3MZ5A 3IT6B 5CC4A 1ET9A 2AQ3B 4Q5VA 4YXDB 3ONAB 1HZ5A 1YMHE 2BDNA 1B4OA 1DOKA 3C46A 1KDCA 3L9AX 2PNRC 1STEA 1U4PA 1J7AA 4P16A 2J4XA 4RAUC 4RGTA 1N60A 3V96A 4OO1H 4CKEA 3MHZA 3BIID 4KY6A 3K0YA 1ZYRC 5FO7B 1RCVD 5D3DA 3FPPA 2WXQA 2NVXB 5IODA 3AEGB 2PVOD 3EFXD 2JEAI 2D2CC 3EQLC 5D65A 1EU3A 1XEEA 4GDLB 1D2BA 4L23A 4KMUC 3V3XA 3OMGA 1YN3A 1EY0A 2NVTB 4C2MB 3TP7A 2VXWA 4QF4A 2XSCA 1D1IA 5ELFA 2CU3A 3TZUA 1HTLD 2H88B 4PMBA 1IUEA 1ZXTA 2IJ0A 4BBSB 2MEKA 4KY7A 3LNNA 1L6UA 1TVXA 3Q8AA 2A68C 1TYGB 4KGTA 1G6ZA 3VR9B 2A69D 3GTLB 2L52A 1BCPB 1AEXA 3J80L 4ZHPA 2KECA 3Q6SA 3T16A 2ICEC 3KUPA 1ZDXA 5CYUA 1DOIA 3RFZB 1NUCA 4NAMA 2D5GA 4CGYB 4US9A 1EZ6A 5ELCA 1XCTL 1QKZA 1E10A 1A70A 4LK1C 3VRAB 2K5DA 5FK9C 2ZXPA 1WWTA 3S15B 2EOTA 3H09A 1VMPA 2PW7A 4MT5A 3P20A 5I9PA 3X3MA 5EPKA 4A3JB 2XIWA 3PUYA 2HDEA 2PKOA 2H89B 1HEZE 3Q8CA 1L4DB 4XDXA 2NUCA 3AB9A 1BBXC 3BK1A 3U7ZA 2F0TA 1SYBA 1ZEQX 5C4HA 1SXTA 3H3VC 1XLQA 2BCOA 3BDCA 5I2YA 1VZ6A 3CIRB 4D2KA 1SNQA 1E2ZA 4A8XC 2V0GA 1T3QA 2VZKB 1NSNS 2O4XA 3CKIB 2L11A 3VYTA 4G7OC 3FEWX 2F0FA 2XRQD 3P63A 5EJWA 2IDYA 5IOCA 3AE3B 1SNMA 1ENFA 1FRDA 3IT4B 4PMWA 1EY8A 3WOFA 4K5VA 4JK1C 3S16B 2BB5A 5FLXE 2L83A 4IKGA 4LK0M 4XQQA 1EOTA 3CRLC 5GXGB 4YTPB 2CHBD 2AQ2B 5BN3A 2R61A 2IGHA 3WCQA 4ITKA 1U4RA 2KWDA 3QIAA 2L4NA 1G291 3K5NA 1PUTA 4RWSC 1E2VA 1C48A 1RDPD 1CHPD 3GTJB 4N59A 2F0KA 1VZ7A 3M85A 4KD4A 2F0DA 3M7GA 3OHXC 1SB3C 4WAFA 4IQZA 2B2TC 3MJ5A 2GA4B 4BS9A 3SK8A 3NVYA 4M0WA 3UI2A 5C3EB 3NQIA 1FYCA 3Q0AA 3V2TA 1ET6A 1KAAA 2KAJA 2RSNA 1ZYRD 4V0BA 2GB1A 3A7LA 4NAWB 1XWEA 3R93A 2WXIA 5CGKA 2R6GA 4A6QA 4NDXA 1M8AA 1OQQA 3I4NB 3J81E 3MC0B 3PO0A 4A90A 4F7XA 4JWUC 4ZKBB 4YSZB 1SDFA 1PFMA 3AN1A 3P75A 3W5VB 3OIPA 3SXHA 2RPVA 1JC7A 1F2RI 5JPNC 1JROA 3NWTA 3QB3A 2D5DA 3C1EA 2O5JC 3BYYB 2JA8B 2PPBC 3ZJTA 1CHQD 5FO9B 4YT0B 5ELBA 1TZOA 4KN4C 5JPMC 2EYJA 4ZYSA 2CJOA 2WDRB 1SMYC 3AEEB 5G3LF 1QLBB 1KNEA 5CBAE 4IUTA 1NVID 5CR3A 1I4RA 1L4ZB 4HEA1 5JJZA 4DFAA 2RA4A 3ZYYX 1U4LA 3GS2A 2V3PA 1EY7A 2A6EC 1EY6A 2WXLA 1JRPA 1HFGA 1FCCC 5ELDA 1F2YA 1SE4A 1EZ8A 1CZWA 3ERQA 1DYQA 2K01A 1TJEA 5DEHA 2R7ZB 2N0SB 3C3LA 5J39A 3T56B 1BCPC 3P7JA 3QOJA 1YQ3B 4IUUA 1LO5D 1SYEA 5C3WA 3H91A 2WP8J 1C4PA 2XNAC 3NRZA 1EWYC 3PMFA 5ELEA 4B9XA 3TBIB 2BB6A 4G4KA 3ZQ4A 3S2HB 2B2TA 1FD7D 2AUKA 3VQIA 3HP3A 4LAAA 4P6VF 4ME5A 1FM0D 1PGXA 2Q8RE 3FC4A 2MJ3A 2DYMA 3PO3B 3HOVB 1LTID 2Z4HA 3Q22A 1U9RA 3BK2A 1SE3A 5IGCA 4R9WA 1Q1BA 3SDZA 2E74C 4UAIA 3I73A 3IXSA 4AS1A 2QSDA 1EYAA 2TSSA 1JWBD 3EJIA 3NVVA 3DWMA 1LTTD 3SR1A 2K9XA 3TEXA 1H9MA 1F2ZA 1A2UA 1GOZA 1CZPA 5KGUA 2BBCA 1S4ZA 4BA1I 1ZE3D 2DNCA 4KHVA 4QIWB 5F2DA 2Y0SB 2DNEA 1LT5D 1XYIA 2VB2X 3AEBB 1A15A 2J42A 5M5XB 1L5PA 2WINB 1A3VA 5AUIA 2BTEA 5C0XH 2C9OA 5JVG3 4F87A 1T5XD 3M7NA 3FKIB 1JMLA 1SBBB 1WTPA 2F03A 4C3IG 4B0EA 1ZXIA 4BBRB 3A8KE 3KQ4A 5TSSA 4C7YA 5DNFA 1HUMA 4EQPA 3T4AC 1BUIC 2EYPA 1TY0A 1UWXA 5A2QL 1DJRD 1B50A 4PNYA 1QG7A 1IKMA 1JWMD 1B9NA 1GPXA 2W55A 4RGNA 3RD4A 3DWAA 2NN6I 2RQXA 1EQVA 1J7BA 2WIIB 5IT9L 2LUMA 1Q12A 2B2UC 2GRIA 4RH6A 2V4DA 2KCNA 5JEAG 1J8IA 2FMMA 2Y3AA 1FR3A 3I4MB 1PYWD 1C9FA 3S1MB 3ZJVA 5EE3A 3HRDD 1DD2A 1ZXHA 2BYTA 5K36G 1QCBD 1SMYD 2JYOA 3ZGZA 1WTVA 1DONA 1RTOA 1X32A 3WDNA 3IAYA 3KLSX 2XWBB 5HG2A 2YEPB 2N9LA 1HFNA 2IW3A 2H1EA 2ZXRA 1PFBA 5JOBA 2OF1A 4HSPA 3NVZA 1DOXA 2MH7A 5A35A 1N5XA 4OO1I 1TWHB 4MACA 1RD9D 1CM9A 1BCPF 4B0MA 2MPMA 1I4XA 3T53B 1IBXA 2FUG1 4ZUJA 1BCPD 1CT1D 2NTSA 3E6ZX 4HKQA 1TWCB 2PO4A 5C4JB 3E9SA 1SAPA 4FF3A 1E0ZA 4IOIE 4K2KA 1I4GA 2HTME 4A3FB 1EQTA 4XDCA