1SJED

Hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A hairpin turn in a class II MHC-bound peptide orients residues outside the binding groove for T cell recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sjeD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sjeD02
4TSSA 2AQ3B 1PYWD 1ET6A 1BCPD 3EA6A 4RH6A 1LLRD 4RGOS 1PRTC 1SXTA 4RHSA 3TSSA 1CHQD 1M4VA 3CHBD 1CK1A 1SJED 2SEBD 4O1NA 1D5ZC 1SE2A 3R2TA 1RF2D 1AN8A 5ELDA 1S5DD 1S5ED 1KLUD 3OWEB 1D5MC 5ELBA 1JWMD 2J4XA 2RDHA 1PTOC 1I4HA 1SBBB 3DWPA 3GP7A 1L0XB 1TS5A 3BYYB 2R61A 5D3IB 1CHPD 2NTSA 2XRSD 1ET9A 1FNWA 1EEID 1LT5D 2TSSA 1PZKD 2RDGA 1RDPD 1CQVA 1PZJD 5TSSA 2XNAC 4DXFA 1B1ZA 1HA5A 1LTBD 4RGNA 1LTID 4Z9CB 3O13A 1YN5A 1TY0A 1I4RA 1LT4D 1LTSD 1S5BD 4NZLB 1I4XA 1HXYD 1T5XD 5FKAC 4L6TB 1DJRD 1I4GA 4ZYSA 4DXGA 3DWAA 1KLGD 1PTOH 1TS2A 1STEA 2CHBD 5ELFA 1LTAD 1PRTF 2G9HD 4RGTA 1JWSD 1V1PB 3KLSX 1LTRD 4RFBA 1LTGD 1EFID 1AW7A 1ESFA 3DWQA 1QILA 1LO5D 1FNVA 1JWUD 1KTKA 4C56C 1I4QA 1F77A 1BCPC 1PRTB 2XN9C 4K6LA 4RHRA 1D6EC 1PTOF 1ENFA 5D3DA 2QILA 1PRTD 4L63B 1JCKB 1L0YB 1UNSA 2AQ2B 1G8ZD 3SEBA 4UDUC 4BWGB 1B44D 1EEFD 1S5CD 1CT1D 4OHJA 1HTLD 1TY2A 1FNUA 1I4PA 1PTOB 1RCVD 1XTCD 3BVZA 3BVMA 5FK9C 3R8BA 1GOZA 2ICIA 3MFGA 2IJ0A 1EU4A 1PTOD 5ELEA 1D5XC 3V05A 1SEBD 1YN3A 1FD7D 3MC0B 1SE4A 1LTTD 1BCPB 2IPKD 1MD2D 1TS4A 2AQ1B 3BZDB 1SE3A 2Z8LA 1UUPA 3BVGA 1PZID 1LT3D 3R2IA 1EWCA 1DYQA 2XRQD 4RGMA 2O2LD 1BXTA 1V1PA 1XXGA 2NTTA 3EFXD 3W2DA 1S5FD 1YN4A 3URYA 4RCOA 3BYTB 1BCPF 1V1OA 1LT6D 1FGBD 5I4DA 1RD9D 1JR0D 1SJHD 1TS3A 5ELCA 1JQYD 1EU3A 1HQRD 2WV6D 2QEJC
chains in the Genus database with same CATH superfamily
5EJWA 2GA4B 1C4AA 1Z6HA 2SNMA 2PTLA 1Y1WG 5KRUA 3VVWB 3K5OA 2XSCA 4B3RQ 2RDBC 3KF8A 2F3WA 2R7ZH 3SK6A 2MWSB 5C4ZA 3RNGC 3KYCD 3C1EA 2I5HA 4P1CC 4WJQA 2UYZB 3H7PA 2WXNA 3R2TA 4BKTA 5EPJA 1CKNB 1S5DD 1DGJA 3PUWA 3W5UB 3UIPB 4BKSD 1TZOA 4KK7A 4J1MA 1IZ6A 3KDFA 3APDA 4NAWA 3R7QA 3TEXA 4BVUC 5C3JB 1TIID 2KLCA 4MSQB 4II3B 3P7JA 1HZ9A 1MJEA 5NUCA 2EY1A 1LT5D 3KF6A 1WMHA 3I5JC 3PV1A 4P16A 2HDLA 4X57B 2WAQG 3BY4B 4QAYA 1K0RA 4IFDH 2UXBQ 1YNJC 3NOBA 2B2VA 3R7RA 3VHTC 1FCLA 2NZ1D 4ALPA 1F2RC 3PVLA 3H0GH 4H7BA 3HOZH 3CF6E 1YN5A 1VQGA 2RPQA 3P1MA 3QWZB 2WP8J 1PH7A 2A68C 4FA6A 2L0TA 1I35A 2I2YA 5EDSA 1QOAA 1MGSA 3K57A 1VQAA 3H3VC 1D2BA 3L9AX 1QNKA 4HPMB 1K83H 4A3BB 2JA6B 3ONAB 3J81i 4JBWA 3K0XA 2VW9A 1KC8C 1IBLL 3DWQA 1A3TA 4EUTA 2SNSA 3I8ZA 1PUTA 3EGRA 4BAXA 4C56C 5IGDA 5C3EG 2NVXB 2Y5PA 1OXUA 5AZFA 1PTOF 1E10A 5J2RA 1JRUA 3A9KB 2RCNA 4C3JG 2VQEL 1GM5A 1IGCA 2AQ2B 2K04A 5IGBA 3SHQA 1EEFD 3E56A 3OHXC 3I3TB 1NNXA 2WWZA 2V3SA 2HD5B 3AU5A 5G5HA 2ICIA 3VTVA 4DV6Q 2Y5CA 2NZHA 1YBYA 1EWIA 5GQOA 3W1GA 2KKCA 3PT2B 4IO9A 3UE0A 3TJPA 2K14A 1L2FA 3S2DH 4M02A 4LCDE 2K1BA 4RMFA 2B8FA 2PPBC 3HOUG 1C3TA 3TP8A 2L5TA 2WKDA 2ZXOA 4IJHA 2A69D 2OXPA 4B08A 3A1QB 4EFOA 5IA7A 2ES2A 3NRZA 1NUCA 4G50A 3QAQA 4B3MQ 4YIJA 5JXVA 4PZ8A 2HHHL 4K81A 1PYSB 3L08A 3HOXG 3X0WA 1YNND 4G7ZC 3S16B 1P98A 2JQRB 3HKZE 1R9TB 2CCZA 3O65B 1RD9D 3HOVG 4YWMA 1H9MA 3I4NB 1Q86C 2HIVA 2IX3A 4OWXB 2INDC 2KMAA 5KGUA 4M8MA 1N61A 4DDGD 5FR3A 4XGAB 5J18A 2EY2A 1E8ZA 4PK1A 3PF4A 1SF0A 2M0AA 4POFA 2R7FA 2VB3X 4BY1B 4XDXA 2I07B 4LFBL 1F1HA 1KDCA 1WE6A 2D3CA 1V5OA 1GB1A 2Z9HA 1Y8RC 1V5TA 4ICVA 1II3A 2QF7A 4YWKA 2ON8A 3PO0A 4C3HG 3DWMA 2JA9A 2OJWA 3OIQA 1B7YB 3A4SC 4TQ0A 1SXTA 1ESRA 2PYKA 1XCTL 3PUZA 5IYDG 1XNQQ 1ZOYB 2NPTB 5JJLA 1N34Q 3RNFC 4L5TA 4KY5A 5T8IA 1AEXA 1U0LA 5ELDA 2X38A 4HKQA 3K7UC 2F0TA 1U4AA 2VH1A 4D2KA 3SU8X 2F0GA 3I72A 1I4HA 5CORA 4CGYB 2K5QA 3MXNB 4BBRB 1TS5A 4HIKA 1IBML 1UE5A 3S15B 4MTKA 3MP9A 3UDFA 4MJSB 2R61A 2PMZB 2V1CC 4GLAC 1K8MA 4P1BC 5IE8A 3TIXA 4QIWE 1Y1VG 2Q8TA 2TSSA 3FILB 4HROA 2F0NA 3GD7A 4MGYE 4RG1A 3GTOB 2B63B 3KLWA 4IURA 5BR8Q 4FN2A 4YCWA 1TWGB 1WXMA 3O13A 4ZHOA 2KNBA 3TP7A 2C7NB 2GLSA 1LT4D 3I73A 2N9LA 3AULA 2BB6A 5C4XH 1NEKB 4Y52H 1YJ9A 3HOYH 2LSSA 1SYBA 3NEMA 3DLLA 1SFOB 1PRTF 5I2XA 3DHQA 2L0FA 2VXWA 4A3KG 3FRPB 3GTLB 5BN4A 1EOVA 4FF1A 5D2MB 5GMVA 1WSPA 2EXDA 4XYQA 3LWUA 3VR8B 1SYGA 2IT1A 1XNRL 2XWBB 2WFWA 4CHKA 2MH7A 2LFNA 2IO0B 4QL5A 4JPBW 1ZXTA 3PCOB 2M0XA 1Q10A 3M4OB 2BYTA 1IW7C 2F1MA 3QOJA 1T0SC 4TRDA 2LJ5A 1O7LA 1SMYC 3W5VB 2N9EB 1JB3A 2MX2A 2F0UA 2LGYA 2NN6I 4AYBB 1WE7A 1ZXHA 4JI2L 2OJRA 3CAMA 4FF3A 3H6NA 1FXIA 2OT2A 4RM9A 1D5XC 4W9EA 1YN3A 2LJIA 2WHIA 2WU2B 3VR9B 3MC0B 3QG1A 4C1NK 5GXGB 2Z4HA 1QWYA 3V2TA 1U9RA 2AWTA 4MELA 3VR4A 3HM3A 4WWMA 2AQ1B 5C1ZA 1ZEQX 4DR7L 1SAPA 5BMGA 1WRIA 2HQEA 4KLKA 1KNAA 4B3SQ 1ZKHA 2JJQA 1HNWL 1OEYJ 2LMCA 4B0MA 3R2IA 1D7QA 2IGHA 5M5WB 1TKEA 3QC8B 3J9CA 4G4KA 2I5MX 3W2DA 3J81j 3A9JB 3GZNB 3URYA 3ZTCA 1E24A 3S1RH 3M4PA 4XIGS 1K3RA 3CW2C 3N6RA 4LF4L 2ZJDA 1CZGA 4IFDI 3KOJA 3FILA 4F7ZA 3Q23A 3N1XC 2RHSB 4X66Q 2R6GA 1YI2A 1QZEA 2V9HA 3A5ZB 5KEEA 1YD8U 3D0FA 3LNNA 1ZDVA 2JF5A 4PYUA 1SNCA 1EWYC 2E8GA 3S9WA 4YCVA 2LRUA 1E9MA 1XYIA 2JA5G 2R7ZB 1Z9FA 3CPWA 4BZAA 2LGIA 2JQOA 1GUTA 3FDTA 2K0PA 5IY0A 3NHHA 4ZUIA 2AUJD 4AQ7A 4EQ5A 2F4IA 3NVZA 4DFAA 2QCPX 5JPNC 1H4RA 2O6VB 2PJHA 4BKGA 4DHJD 2BF8B 3I2ZA 3H7SA 3L4PA 1VQMA 1KIXA 4LDTD 3V60A 4DR3L 1Q1BA 4JCVE 2A6ED 2BS3B 1S1QB 3RNUA 3PF5A 4JBJA 2LVQA 4WAFA 1PTOC 1U4RA 4A3GG 2A8VA 1G51A 1DOMA 3CU7A 2KUMA 3NS1A 2NTSA 1PFSA 3I4LA 4A3CG 4RA8A 3U4EG 1XMQQ 3H0GB 3HOZB 3OJ4B 4MGIE 2D3AA 5C44H 2ZVNA 3P4RB 4QY7A 1EQTA 5IO9A 2KOLA 2Q2TA 2IX0A 2L7RA 5LXIB 4BA2I 4P75A 1VD2A 3NS8A 1FFUA 1X32A 1I4GA 1Y69U 2KQ7A 3NHEB 1VCBA 2X8XX 2LS01 1MPEA 2WNMA 2JSOA 2Y5BB 4LF7L 4NJ6A 3EFCA 1WTRA 2F3VA 1JWSD 1HA6A 4BBSG 2WAQE 4DR2L 1ESFA 3IAYA 1EF1A 2W3RA 4DBGA 3ZJTA 3A7AB 4QCLA 1ILQA 1F52A 1HPCA 3IFWB 3CC4A 1C48A 1HNZQ 3LB8C 5LMUL 1HR0L 4NP5A 1ENFA 3GTPH 1TVXA 2KX3A 3PLUA 4RKLA 2J0JA 3P2BA 1QCBD 1QUQB 2A19A 5IODA 1EQQA 1MKHA 1X6OA 4LFCQ 2E75C 1TWHH 4GMVA 4RF1A 3JC66 1K8GA 3TUOA 1A2TA 4IPGA 2L12A 3RZOH 1I4PA 2PZTA 1C4CA 3DBHI 3IRBA 4K7SA 5FK9C 2DZJA 2RVLA 3J7AV 1GOZA 1RRBA 4YWGG 3ZLZA 2IY0B 3UI2A 3RN9C 5C3WA 1SNOA 3FKIG 2K6QA 4KTAA 4M1UB 3RLFA 4LF5L 2EJGC 2M1MA 3T3OA 3N1YC 4YSYB 2RSUA 4FLHA 3PUXA 1BCPB 3NZSA 3SE0A 1SYDA 1UBQA 2NVQH 4B6WA 5HFYA 1KRHA 4PMBA 5IWAQ 4I7ZC 2SDFA 2QHOA 1OXXK 1YNJD 4LF8L 3CXCA 2H88B 1Y56A 2JY6A 2YTYA 4GKKQ 2WXFA 3Q6BA 2I38A 1PH5A 1XMOL 3U7ZA 1S5FD 2N49A 2A68D 1KAWA 4A90A 3RPFC 1BCPF 2XGTA 4NW2A 5KNBA 3J80E 1R4QB 4OW0A 1WJ4A 2JZ3B 3KJOA 4ODGA 5CC4A 1C7YA 2Z6KA 1Q1EA 5HI1A 1EYDA 3X23A 3AEGB 3PUYA 4L5RC 1FJGL 1EU3A 3B2FA 1WTHA 4ZRJA 5AJ3L 1DOXA 1BO0A 1PYWD 1Q12A 2FNJB 3K59A 3U58A 2A74C 4GZYC 4XYCA 4YTNB 4IWOA 1PRTC 1A5RA 1CHQD 3CHBD 1EZ8A 1Y1WH 5AEKB 3NSWA 4OX9Q 1V6EA 1D5ZC 1BT0A 2PPHA 3T1YL 3ONSA 1I3QH 1ZYRC 3CCJA 1T0QC 2WU5B 2X6LA 1N62A 4A3LG 3WA0A 2WB1G 2PEAA 4C4VB 2YEPF 2M4NA 4HJGE 4BOZB 1KRTA 3VDYA 4EZLA 2KLGA 4R4IA 1FNWA 3RD2A 1PXUA 3IG3A 4DR1L 4HR7B 3E9HA 5JJKA 4MGZE 4TMAB 1BF4A 4FJYA 4C00A 2E3TA 5EAYA 1S40A 2HCIA 4JI6L 2KECA 4A3MH 2WXLA 4DK3C 1WCMG 2RMMA 3A7LA 3VYSA 5IT9E 4LF9Q 3DXJC 1LTSD 1BBUA 3HOYB 1B9NA 1IBKL 4BXXH 3R66C 4K2LA 2Z0DB 3NVWA 3I4MH 2VS1A 5EE1A 4XE0A 3F1ZA 3HVZA 4WURA 4JI5L 2NB0A 3K7AB 2JUOA 1LTRD 1SNDA 1OQQA 3MC8A 1TT5B 4PYZA 1VZ8A 4C3IG 1S3SG 2BS4B 3VYRA 5IP7G 1QKZA 1WGYA 1S4ZA 3ULPA 4HJ5A 3B9JA 3EN2A 5IYBG 1R4NI 4OZBA 4X64Q 2D11A 3A33B 3IL8A 1PV4A 1NI3A 4LAAA 1K9MC 1JW9D 3Q8CA 4N59A 4DV4Q 3AEEB 3TP5A 3L2PA 1G8ZD 5L37A 1R4PB 2K6AA 4ZKCB 4DK1A 1YZ6A 2KO3A 1A2UA 2KVRA 2E5LL 2KYWA 1QQRA 1FNUA 1XTDA 2UUBQ 4LF6Q 1FR3A 1DD2A 3SD5A 2WXPA 5CTRC 4ZYNA 3WWVA 1DONA 3CCMA 4YSZB 4MHEA 1WY8A 1FD7D 1VMCA 4JG2A 4F8MA 3PSEB 2JA8H 3RULA 1JWBD 3RUIB 4HJKA 1STGA 2E2IH 4YCUA 1WI0A 3A0JA 2BYFA 1WGKA 3ZNZB 2OWOA 1IBXA 5CHWA 4A3IG 1EFWA 1GG3A 4O0AA 4M8AA 1JWAD 1XQQA 3K6OA 4PS3A 2DZMA 3BK2A 4FULA 4OZAA 1TBEA 3STBC 3S1RB 4B0EA 4LNNA 3L10B 4C4VA 3PO3H 4C7ZA 5M3FG 3EUB2 4DDID 1P1AA 1EM7A 1NMGA 2W9NA 1M94A 3PO2G 1FGBD 2W54A 3MZ5A 1WJ6A 4W9CA 1PVOA 1SROA 3TEHB 5AZGA 3HZXA 2F4VQ 1HQRD 3Q6SA 4CJ0B 4JI7L 2PVGC 3BZKA 1OQYA 3DHGC 3ENEA 4XTCS 4BFRA 3KW5B 4DV5L 1G6PA 1QLBB 1BKBA 2BPSA 3HOWG 2DY8A 3SGIA 1J7AA 1CA5A 1C8CA 1ZGUB 2ZW1A 4HN7A 2Z6KC 4A93G 2I1KA 1JICA 4C3HH 1VS0A 4CQNA 1IW7D 4BA1I 3DQVA 1K8OA 2NBUA 4LJZC 1SMYD 1T0RC 2OHFA 3NJTA 3TEWA 2CS4A 1SSNA 3MFYA 2MA9B 3D32A 3ECIA 3CCVA 5JPMC 1K52A 2A5HA 1HUNA 3G6EA 1GO3E 1SE8A 2BKFA 5IT9c 2UXCQ 3EC8A 1C1YB 3APFA 1Y14B 4NXNL 3TZUA 2RCFA 3G48A 4JBMA 2BVCA 4NXMQ 5C44B 1XCQL 4II2B 2LKVA 5DNFA 2O2VA 4K5VA 5IGGA 1VZ7A 1PLFA 5MPOA 1KQSA 1YOVB 2KCCA 2D2QA 1HZAA 5BMIA 4DAYB 2MJEA 4KJNA 1MBYA 4UP9A 4KIKB 2RSOA 1VQ7A 4UY8C 1HRJA 3NBHB 3HM6X 4HTHA 4QMGA 3K5NA 1X54A 3VA5A 3UQAA 3QR8A 5JHBA 1HXYD 4XQJA 1TWAH 4K8JA 4XT1B 4DQOC 2MHVA 3Q8BA 2B2TA 4RCNA 3H1UA 3NWTA 4K5WA 4WJNA 1STEA 1GPXA 4RF0A 4LNKA 5FO8B 4ANXA 3ZJVA 4KHPQ 3F2DA 2LVOA 2V4LA 4B3RL 2WXGA 2XBBC 1M1KC 2NVTH 3VUYA 1GKHA 2EXZA 4OVVA 3AEVA 1AW7A 1I94Q 4DUZQ 1AZPA 2JSVX 5D6JB 4A75A 3TMPB 1I6HH 1E8YA 2MP2B 2RKSA 1HFNA 1H9SA 1BCPC 1HUMA 2OEOA 5IP9H 1C77A 1K53A 1OGWA 1ZE3D 2BT6A 5FLMG 1UZXB 1TWHB 3AB5A 3GB1A 4DHZE 3R3OA 4AUQC 2EJMA 1VQ6A 3RZOB 2PVOD 3N30A 1YQ4B 1Y8OB 3F8TA 3NY5A 2B76B 3T3NA 1B44D 2Z4IA 3CCEA 4BY7H 3Q0AA 4ZAIA 1ML0D 1RL2A 1LV9A 5KYLA 3MAQA 1B9RA 4GOPA 2KHSA 2A6HD 4XQQA 4C2MH 2K8BA 4KGSA 1EU4A 2Q8RE 1KRSA 1HQMC 1PTOD 4IUTA 2VUMH 4DR4Q 1VJKA 4A3DG 1WJUA 2Y3AA 4HPPA 1LACA 2UXBL 2NVQB 2LVPA 4RWSC 3H7PB 3IXSA 4A3JG 3D6CA 4C7YA 1VQDA 1O78A 1MHHE 3DBLB 2CVRA 1SB3C 1J5EQ 1KABA 1SE3A 3OOCA 2F0LA 5EBDA 2IY1B 4NAWB 3ICEA 5C0XH 2N7DA 1YNTE 4XYOA 1TQOA 3DWGC 2J0MA 2L55A 4DV0Q 1P0RA 4DR5Q 2F0PA 1Q46A 2PQEA 2WXQA 4KKTA 3I7FA 1N60A 1UWMA 3RR5A 1LFDA 1IYJB 3E6ZX 3MEHA 1RFKA 1NCVA 1C9OA 3OIPA 3F2CA 1WMHB 4ILWA 2NUCA 1EY6A 3EBEA 1YN4A 1HCZA 5IOIA 3BYTB 2IY5B 2EIFA 1HZ6A 3LDZE 4PZ6A 1MFWA 3KLRA 3ZIMA 1KLVA 2K28A 3PREA 5FO7B 2HDMA 2GMIC 2KQ4X 4TKNA 1N5WA 2NR2A 3NBHA 3NPPA 1BMLC 2OTJA 3NZ3A 4WJWA 2KCMA 2CU1A 4MH8A 1UE1A 5IYCG 3ETRA 4WJOA 4ME3A 1STAA 4IUPA 5LMNL 1GHKA 3DPDA 1I3QB 4DV6L 3CCRA 1P7EA 1MHXA 5HHDG 3KBGA 1VQBA 3QCAA 4F1SA 3QQ8B 1NR2A 2YVCA 5FJ8H 2WXKA 4JK1C 5D14A 3DM1A 3M3YB 1P16A 2RDHA 2B2WA 3DWPA 1AH9A 1B4OA 4EE2A 4P73A 3BDCA 4KY7A 1L0VB 1QT9A 3WAOA 2QDFA 2PNHA 1WXVA 2K5HA 2K75A 1SYEA 2RR9A 1MSGA 4MEMA 3VRAB 4A3MB 1N36Q 4B3ML 5E6OA 3CD6A 4IPCA 2N78A 4QUCA 2ASQA 2BH8A 1PZJD 1TT2A 2SAKA 4W9GA 2FUHB 3ZUNA 3ZXVA 3A5UA 3G7LA 2NN6H 1HA5A 2PQAA 4OWTB 4QGUA 3J81E 3AQQA 3HS0C 2DYBA 2CFMA 3PIP3 1B53A 3I4MB 2F0DA 3TBLD 2JP1A 4R3DA 2NVYH 4GLXA 1E2ZA 5HY6A 2C35B 4AS1A 4OWWB 1UWVA 1EYAA 2R93H 2WB1E 1VR9A 4FF2A 1K73C 2LI5A 2K39A 3P63A 3K9PB 4GN3B 1T0YA 2VZKB 2RDFA 1NBWA 1OEYA 2IBIB 2L3ZA 3D8GA 2RD0A 2ZVOA 4IALA 4XX5A 3MJWA 1XNQL 3W9CB 1FNVA 1N34L 1BNZA 2JXMB 3HHMA 4BBSH 1HH2P 1JOKA 3RI7C 2B2TC 1MIUA 1FMAD 2FE8A 3S24A 1BVSA 1JJ2A 4E6IA 3D4DA 4YXDB 1PRTD 3SK5A 1X3PA 4KKIA 3AV8A 4PG3A 1UBIA 3GQBA 5GROA 1L0WA 3IKJA 1CT1D 1TWFH 2K33A 1M90C 1YIWA 2L11A 1B3QA 1PTOB 1ZYRD 1UE6A 3PZDA 2FAZA 2JA8B 1ISNA 1DXMA 2KJRA 3KWLA 2HUGA 4OIJA 5M3MB 1Y8PB 2PZUA 5BYSA 1H9RA 1PDQA 4MTNA 3UE1A 2JYEA 5AUKA 1SMXA 1Z5SB 5BR8L 2XK5A 3FKIH 2DUDA 3J7AF 2ALYB 1WFYA 4K3BA 2W82A 1L7YA 1WXAA 3M4YA 3PMFA 5EKLA 1PGXA 2MLBA 3MVVA 2MEKA 3AE7B 3PO3B 1G2TA 3RZWC 3BU2A 1QJOA 2F0HA 2KDFB 3DUZA 2WP9B 5E4WC 4ZRZA 3EFXD 2C5CA 2EYPA 2OQ0A 4JL9A 3EIVA 3UIOB 4OO1G 2MBBB 4TKOB 3E5SA 5FLXE 5LMNQ 4JWUC 5TR5A 3WDNA 4N9TA 3E9IA 2GBKA 1B2TA 2L0CA 1RIPA 1JR0D 2L4NA 4DV3Q 4JV5Q 3LJ3A 1KHIA 2Y0SE 4N58A 1KDBA 1STYA 5DPTA 1JQ4A 2CHZA 4LJOB 3DBSA 4MIUA 5ISRA 5IN7A 3T53B 1QVFA 4OEMB 3I70A 4N8X1 4JWSC 3U9OA 4LNIA 1DOKA 1N33Q 2R2OA 2ID0A 3RFZB 1SYCA 4W9LA 4X3UA 4ZRKA 3A4RA 1C76A 2BTEA 2N4FA 2ZTDA 1ENCA 4K7WA 2B8GA 3T8MA 4RHSA 3KH0A 3GTQH 3V6CB 5GAEC 2PCFB 3T51B 1SE2A 1EY9A 4OZCA 3RNEC 2MP1A 5HGQA 4MNOA 1L1OA 3OWEB 1CTMA 4APVA 4K7UA 4YSXB 2KMCA 3ZNID 1PGAA 4A3BG 2JT4B 4HCNB 2JA6G 4XC2A 3KBXA 4B3SL 3IT4B 2J52A 2XVSA 1O7IA 3KVFB 4A3LH 1F2YA 3TRZA 1JE5A 1RTOA 2GRIA 2EY5A 2H89B 1KL9A 2KN4A 4WWPA 1IL8A 2FIDA 3DVGX 2KDBA 2E2JH 4GXBA 4HEDA 2NZOA 4IJLA 5CV8A 5JJZA 4EVOA 1TY0A 3ZJYC 4X62Q 2JPHA 2KDMA 2VH2A 4X66L 2AUKA 1ACCA 3STBD 2DJGC 1F9SA 2JXXA 4NB3A 5FKAC 2O6VD 1G291 3AFQA 5E4XA 5C0XI 1HE8A 2LMCB 1U5KA 2D2CC 4IUNA 4U68A 2NVTB 5ELFA 5GAGC 3NTKA 2KWVB 3N3KB 4ZOHC 2MGSA 1SYFA 3UDGA 1P8LA 2KWDA 4ABNA 4IC7B 5G2NA 1I6HB 1L6UA 2G4SA 1P3QU 2KTRA 3AE5B 5LNK1 3CMEA 4WQOB 3ERQA 1C79A 2KJHB 1LO5D 4DNRB 5DPRA 1I5FA 5CR3A 2ZM6Q 3K9OB 4I6PA 1EIYB 1PRTB 3AE4B 1SLJA 4CBVA 3RN2A 1GJXA 2DAJA 4AH6A 3CP0A 4BY7B 2QILA 5IYBH 2L76A 3SEBA 5A35A 5FOBB 2INNE 3V3XA 4MZ9A 1TYGB 3A8JE 3QJYA 1NJIC 4M00A 1I42A 4C2MB 2VUMB 4YHHQ 2P5ZX 3ZRCA 3M62B 5IGEA 3I4NG 4AOFA 3TDQA 1GNUA 4EQNA 3I63C 3C46A 1XMQL 2WQYB 2NBWB 2YTVA 2B2VC 2G3QB 3G6JB 4BY1G 1ILPA 3LX0A 4KDLB 4HJAA 1TJEA 1R7SA 3KUZA 4HAEA 2I46A 3NK9A 1UF0A 2FBWB 1WTWA 1VQKA 3BDOA 3K5MA 4DV1Q 2B3AA 5ELNA 5DAUA 1YITA 2BS2B 2XRQD 2YV5A 4A3EH 4ZQ3A 1L6VA 2O2LD 1BXTA 2K5PA 3TMEA 4MJSA 4K14A 1WI5A 4FHKA 4OONA 4B9XA 2EMSA 5D94A 1I6VC 4FJZA 2MO0A 3U50C 1YHAA 4BBRG 5M3FH 3QIJA 4USAA 3JSVB 3I90A 2IO2B 3CSTA 4JC0A 3KQ4A 2K8HA 5JEAG 2A1AA 2EYJA 1HNZL 1NTGA 3HG9A 2JA7H 1TY2A 2WV6D 5HKHA 3L54A 4YTMB 1GUNA 2A73B 4JI4Q 2TMPA 4LFCL 4ZKBB 5JJIA 1ET6A 4F88A 2B63G 1BCPD 1NR4A 4RH6A 3ALBA 2D0PA 4JI8Q 2WX1A 1CUKA 1QNUA 3WALA 3UF8A 2R92B 1F9QA 1VQFA 3A55A 1WZ0A 2DYOA 2FCSA 4FJVB 4NNJB 1J19A 1X3FA 2VY3A 4GS3A 4DNTB 5K36H 3L0OA 2DHZA 3OLMD 5AZHA 3HUIA 3SXHA 3WAMA 2CR5A 3DHIC 4GGQA 2MJ3A 1JWMD 3BK1A 3ZVVA 2UUAQ 1LGRA 5IWAL 5C4JH 5D3IB 1KH0A 2ICEC 2YLMA 3GTKH 3RT3B 1FM0D 1SNMA 4QF4A 4NMZA 5EKKA 1RHPA 4GKKL 5EPKA 1VQ9A 1O7YA 4HDQA 3SFDB 2KWCA 3VUXA 4K0KQ 1L4DB 3W1YA 1B1ZA 3RZDH 2J0KA 2JN4A 2BDNA 2NVYB 4RGNA 5ELOA 2VQFQ 3EROA 4US8A 3CWIA 2LASA 3MXUA 1PDXA 4KMUC 4DHZB 4GNXB 2R93B 3A8KE 1UAPA 2K4KA 1A6XA 1NY4A 1KNEA 5KNCA 4AYBG 4K6DA 2O5JC 1AYFA 2ZT9C 4IDIA 4PNYA 4DXGA 5LLIA 3AEFB 1S3OA 3OTOQ 1NENB 4LFAQ 2D9UA 1EYCA 4CKCA 3C2PA 1EFID 2GVAA 2FIFA 3TEZA 4NJCA 1D1IA 2E2DC 2LXJA 1HNXQ 4OX9L 3ZNGC 3SDZA 4ICUA 4J3OD 5JOBA 1JMLA 4K6LA 5H8YE 3E0JA 1WTOA 2BH2A 3KYHC 4GDKA 1WR6E 2KZRA 1PFBA 1Q3LA 3JSVA 4L8JA 1FXAA 3H6MA 4F8CB 2G4DB 1IYUA 5DEHA 4MSMB 3GV6A 1K83B 4ZCKA 2UU9Q 3R8BA 2HD3A 2DENB 2FMMA 3MFGA 4JOIA 2EZVA 1X65A 4MACA 4DGZA 4KDIC 2K52A 1SE4A 1E8WA 1RFAA 2R7ZG 4A3DH 4LF9L 1DOIA 5I2YA 1GAQB 2QIEB 4XDDA 2D5DA 1RLFA 3MWYW 1WH3A 4IG7B 3IAM1 2QC8A 1PZID 3P4PB 4W9JA 2LRWA 3MEFA 1NYQA 2LFIA 4N9F4 1PFMA 3AM9A 1V1PA 1LTLA 2UU7A 4WFN3 1SNQA 1PH8A 1UD7A 5IOCA 1SR3A 2FXQA 2K05A 1VQOA 1V1OA 1V9JA 1TZ1A 2NCNA 2WGSA 5C3XA 2WKCA 5I4DA 3KFUA 2JE6I 1HTOA 3PZ8A 4F7XA 2WXIA 3D4WA 1UGMA 2KQSA 4FNFA 4X64L 1WIAA 4JI0Q 1E7VA 2Z1CA 3S2DB 1ZW7A 1JQYD 4A76A 4IFDG 3ZJUA 3ZNHB 1T3QA 1A3UA 1E7UA 2G1EA 1QOBA 2KCNA 2AQ3B 4TSSA 4DV4L 2LWPA 3H0GG 4GNXA 2J7QB 3HOZG 3Q14C 3Q8AA 4HKZE 4P7IA 4DWFA 4A3FH 1OTCA 2PNRC 1CSPA 3ML8A 3CC7A 4ARCA 2LXKA 2RHQB 2UUBL 3PUVA 4KD4A 5M5XH 4LF6L 5L83A 4J8QA 2G5DA 4R9WA 5IYCH 1RKNA 2DAFA 1X9NA 2JEAI 3ZW3A 1AN8A 1VMPA 3CCSA 4S3SA 2KK8A 1S5ED 2W55A 3OPOA 1D5MC 2MW5A 1STBA 1HZCA 2H5XA 2ENBA 3VR5A 3I56A 2IO3B 4ITKA 3GO5A 2HQLA 2UXDQ 3DEOA 2K9XA 2GBMA 1ET9A 1FVIA 3WOFA 3BG3A 1JB7A 2OQKA 2E2JB 2BWFA 2PE9A 1SE9A 1F2MA 2VNUD 2CU3A 1UELA 3PLVA 4O2DA 4ZDVA 4CDFC 4X65Q 2YEPB 2OCEA 2GBNA 1QZGA 2PI2E 1EUJA 3RMHA 4ULLA 2HT1A 1F2LA 2EQSA 4LW1A 3IFTA 4PMWA 3FVQA 1T5XD 4IOCA 2F4VL 1IBXB 1DJRD 2B29A 4JW0A 1E5WA 5IKCM 2RPVA 2RGFA 1MVKA 5A2QE 4FP5D 1O80A 4FBJB 2N3SA 3HFZB 1EQRA 1IPGA 4CO7A 1EY8A 1VQIA 2MBOA 3TREA 3AH7A 1AE3A 2D10A 1QILA 2ZTEA 1KTKA 3K0YA 3OWFA 5E3FA 3K81C 1J7BA 3TQYA 3QO2A 1LXDA 3JVZX 5CV5A 5D3DA 4KGRA 4PS7A 1OXTA 2K03A 5AFWA 1Q8IA 5C4XB 3ML9A 1CKMA 2KD0A 3MC9A 2UXCL 2IHEA 1ICFB 1FXTB 2N1VA 1NYRA 5CBAE 4AWJA 1WM2A 5HGTA 1N32Q 4NXML 2F0KA 4YL8A 5G55A 1HFGA 2IJ0A 4KI0A 2FINB 3OAWA 4Q2JA 2R2QA 4U673 4B9KA 4QQBX 4OELB 2Y0SB 1SRUA 2F0FA 2EE1A 3MHSD 1TS4A 1QOGA 3VH3B 4B3TQ 2VB2X 2Q2UA 1VQHA 3BDLA 4A3EB 5J1ZA 5IGFA 4DV2Q 4H0LC 3IAS1 2Q8IB 1WFQA 3VR6A 2DLBA 1EWCA 4ID6A 1BBXC 3C1FA 4JOIC 2JRHA 3K80C 4DPGA 5C3EH 3PQIA 3GV3A 1NMFA 1LABA 3G71A 1K8RB 3NBIA 2JK8A 5M3FB 4KHPL 2MBQA 2O2VB 2K22A 3L16A 3DBRI 5IP4D 4C3JH 4KJOA 3CC2A 3I3CA 1B50A 2AYOB 1I94L 3CMAA 4DUZL 4EOYA 1F2RI 1LM8B 3NE5B 1V1QA 2MQHA 2JA7B 2BWES 3HKZB 1XWEA 5JEAJ 4L5SA 2L15A 2LEKA 4LK0M 3D4RA 3ULLA 1YHBA 4JPSA 2M56B 2I5LX 2IWHA 3TEYA 3UINB 4FXGC 3WOEA 3H3VI 3IHPC 4JI1Q 3CPFA 4L23A 2WDTB 4NJ7A 2RF4A 3J80c 1WYGA 2JVCA 2QCZA 3PPAA 3AEDB 2X69A 2NMQA 2HDEA 2MJ8A 1M4VA 1CKOA 2BA0A 1CFMA 3HOUH 2D3GA 1T5EA 2SEBD 2SOBA 3HOYG 1C78A 1V8CA 2FCMA 4QB4A 2ZEQA 4DR4L 1YNNC 2CJOA 3NXWA 2J0TD 3J80L 1R4NB 1IXRA 2IGDA 1H9SB 2F0EA 4WJ4A 2KT7A 4GNXC 1G2SA 1CZWA 5C4JB 2V4DA 1WTPA 2PMZE 3GTKB 1J5EL 2G45B 2WXJA 3HOXH 5G3LD 5LL6S 1NVID 2ZXRA 4DV0L 4A3BH 4DR5L 3HOVH 3RZDB 2F0WA 3A54A 3CKIB 1GB4A 2GN5A 3EFUA 4QIWB 4GOPB 1IYVA 1FRRA 4XWTA 4A6QA 2B2YA 2FHTA 2YTXA 2K8CA 2KOXA 1EY7A 5BYQA 1E2WA 2ASBA 3PGEA 2K5VA 2HTME 3QB3A 1VZ6A 4WAAA 2Z59B 3EHVA 4WRDA 2F0VA 4GN4B 5IYDH 2F0IA 4DA2A 4P2CB 3T9LA 3VR3A 1JE4A 2EVBA 4GN1A 3RNAC 4E71A 1A0IA 3HGBA 1UEAB 1LTAD 4UP8A 4XZ4A 2C5LC 3AE2B 2DGYA 2BBCA 3PRMB 1PA6A 4M0WB 3S14H 3PS6A 2N9KA 1SSOA 3PSIA 1CQFA 2H1EA 1JOQA 2HTHA 4LUOA 5IT9L 1XX8A 3EVQA 1Y1VH 1W6JA 4HCEA 3RYTA 2EYMA 2EYLA 1GJZA 4P72A 1L0YB 3WCQA 1F9JA 3M4QA 1XT9B 2EMTA 2Z0EB 2ZNVB 3QA8A 1KD1C 4NKLA 2O5IC 5FR6A 4OIKA 3KUPA 2OOBB 2CH4W 1N36L 3AXCA 2JX5A 1QOFA 5L95C 2HCCA 2DZKA 1HTPA 1G91A 1A70A 1XJVA 1Q5WB 1TKYA 3SHLA 2NYZD 3HKSA 2IPKD 2EPBA 3JAME 3VTUA 1NAPA 5F2DA 2VZKD 4KHVA 1GC7A 4A3KH 3GTPB 2XWJB 3FC4A 3GE8C 1SNPA 4G11A 4EEWA 3KJPA 2C9WB 2KVZA 2DWQA 1DYQA 4K1RB 4KVGB 1R4MI 1WYDA 5DM73 1UWXA 3AEAB 1TU2B 4WORA 1WD1A 3H9DA 4MN3A 2Q2HA 3Q3FA 1YVCA 1LT6D 2PQAB 4HSVA 5EPLA 3NTIA 4DUYQ 5ELCA 1WYWB 1V97A 2D62A 4EX5A 4WJ3M 2Q2IA 3NVYA 3P4QB 4IFDJ 1J8CA 5DPWA 3BWUD 4A3FB 5C44G 3KK7A 2GBRA 1FD6A 1WX7A 4CYEA 1NSNS 1CZPA 3I4OA 3U4ZA 5CBEE 4OL7A 1F9PA 1LLRD 2CW0C 3S2HH 1B8AA 2RA4A 4KSLC 4TVAB 4K5XA 4B95A 2CHXA 2DJFC 2KXJA 2F0QA 4I7AA 1V8QA 5IGCA 1E90A 4YY3Q 2WYQA 1NI2A 4ANWA 3U2SC 3PIO3 2AKWB 1P9DU 4M0WA 2CKZB 2G9DA 1W3SA 3CRKC 1PFDA 1EY4A 4W9DA 2EYOA 1VQPA 4HIDA 4HSPA 5H92C 3U30A 1L5PA 1HTQA 1E3PA 1SBBB 3SK4A 3N9YC 3GP7A 3TN2A 4S17A 4KN7C 5J22A 1GUWA 4Y7NH 1WZ3A 4ZUJA 2MNAA 2RDGA 3I57A 1RDPD 4GLVB 1NDDA 3FMCA 1Z7TA 4IWPA 1LQBA 3ZXRA 1Y1WB 3ERSX 2L1AA 1EIFA 2QDBA 4HJ8A 1J6QA 2WIIB 2MO1A 2JA5H 1DOLA 3ZYYX 3AE1B 4Z9CB 3APCA 3JW0X 3K5LA 1PH6A 1KXLA 2BQQA 4DV3L 4JV5L 2ONQA 2XK5B 3TS0A 1Z2MA 1ASYA 2MPMA 2EKEC 3PIPA 4NZLB 1I4XA 1STNA 4BS9A 2GBJA 3HRDD 3CCQA 4HK2A 3V62A 3AE3B 3MHBA 4DR6Q 4L6TB 2UUCQ 2VL6A 3FKYA 4LNFA 4J15A 4K2KA 3R93A 1N33L 1LUZA 3RUZA 4US9A 3NQIA 4RFBA 1OXSC 3L13A 1B70B 1JOOA 1A8VA 3OMCA 4A3GH 4I6LB 4RNAA 3GTMH 4OXPA 2WAQB 1TIFA 1I4QA 2ZJQA 4IOAA 2NWGA 4OO1I 4KD3A 4A3CH 4MGKE 3WANA 1CM9A 1GD7A 3Q3OC 1FYCA 4AQYQ 4REZA 3UDIA 2N9XA 5M5WH 4IPHA 1S5CD 1N63A 3B1LX 4G0NB 4JQWC 1CSQA 3JAMc 4CDDC 1FL0A 1RCVD 1U4LA 3AE9B 4L1BA 3QHTA 4P6VF 1X3GA 1WJJA 4NY0A 1O7ZA 1SEBD 1X56A 2MCNB 5CV6A 4G3XB 4XQNA 2K5WA 3Q22A 1PQSA 1L2NA 2YYZA 2PW9A 3QJZA 2JZZA 1MD2D 1L1OB 2BE5C 1FFVA 4X62L 3T1HQ 2IGGA 4DAPA 2V3NA 4FHJA 4UHVA 2Z8LA 4PQXA 5C3EB 2WACA 4KKSA 4A3OA 1LT3D 1WXSA 1VQCA 1HR0W 3KUDB 5DM63 3AMZA 4C3JB 2X6GA 4RGMA 1ROEA 5JVH3 3DHHC 1ZDXA 3GTGH 2M9VA 2MFIA 2KJ6A 2KC2A 2ZPYA 2AWOA 5JH5C 1TS3A 2ZM6L 1WX9A 4PZ7A 5CYUA 3VR2A 1QE6A 1CA6A 2F03A 3S17H 1YX6B 2NVUI 4HCSA 5I6YA 3OJ3A 4WIPA 5COYA 4JYAL 4A3MG 2E2IB 1E7PB 4QUFA 3S1MH 5T1IA 3ZDMC 2JU6X 1X3QA 4KHZA 3D31A 1E6EB 3HOUB 4A55A 1J0GA 4M8NA 3EA6A 5EE0A 4BXXG 3ZTDA 4YHHL 2YU9H 4K8IA 3QX1A 2IW3A 4JIOU 4GOPC 2QA4A 5KHQA 1VCIA 3RN5A 3I4MG 1G6JA 2KTRB 2CJNA 1LYLA 3WIMA 3QOLA 2MJDA 4G7HC 1V9PA 4PS8A 2JEBI 3HOXB 2KTFA 2IL8A 3M63B 4M01A 1U4PA 4RM8A 4GDLA 1D4BA 3VXWA 2IX1A 1SGHA 4V190 1I7HA 4HRSA 2WDRB 3HOVB 1A3VA 1L0XB 2Z6BA 4XDCA 4DV1L 2NS5A 5E1FA 1CHPD 3UI3A 1AARA 4KGTA 4NPNA 3M7GA 2J7ZA 4AJWA 5EBCA 5KIXA 1PHJA 2LD9A 4R1JA 1A63A 4N6EB 4C3HB 1J7CA 2DNFA 4DK6C 4WQMA 5E6PA 3Q3MC 1V80A 3UDXA 5C23A 1C4PA 1E7ZA 2ZZPB 2ZJRA 2EKIA 3KWVA 4AP4C 4DF7A 1V2YA 3BS1A 1X1MA 1FRDA 1OQRA 1DM0B 2KDIA 1S5BD 1ZKOA 4A4IA 2WXMA 4DV7Q 2IO1B 4A3PA 1VRAB 4TQUS 4R8IA 1EYGA 1WOCA 1YJIA 1YMHE 3DDCB 2JA8G 1BOSA 4GKJQ 2M00A 4H13C 4JI4L 1GC6A 2ZNVC 3AB9A 3H91A 3S14B 1KJTA 4H02A 5M3MG 4JI3Q 2ZTCA 3J81c 4DAVA 3MXGA 2MBHA 1I50H 3KLSX 4JI8L 5BN3A 5BO4B 1LTGD 1ZUD2 1Y1VB 1C4QA 3PHWB 1WF9A 1VF5C 2FMCA 5BN5A 1XPRA 2AL6A 3J81L 1CKNA 1JWUD 5BMHA 4RHRA 2PO4A 4LUZA 3PO3G 1EO6A 4N9PA 1JCKB 2B2WC 2DN8A 1YQBA 2KCTA 1TWAB 3PRZA 4CJ1B 4EQPA 2QEXA 2UUAL 1IHZA 1AWDA 2WDVB 2O4XA 2RQXA 1WCMH 1JJCB 2HIXA 2BYEA 3PRPB 2AMCB 2E2HH 4BBNF 3SFEB 4NQLB 2N9PC 4AJYB 3F2UA 3TCAA 4ACFA 4HLEA 1WD0A 1KF6B 1PGBA 4K0KL 1GVPA 4IQZA 2EYFA 1CJEA 3Q3JA 5EGTA 4A3KB 3BIID 2VQFL 1IYFA 2B3GA 1YJWA 2N1WA 1FO4A 2PI2A 3S1QH 1AFPA 2C9OA 1IL2A 3L7ZC 3VRBB 1YJNA 4MM3B 1J9OA 3SR6A 3W1SA 4C3IH 1N8RC 4KKJA 3U52E 4W9FA 5IP7H 2FCQA 2FCNA 1RJTA 4JYAQ 1T6BX 2L83A 4JGHB 1QF6A 1N9WA 4LLGM 1XXGA 3OTOL 4B9WA 5DLQE 3CF5A 1NE3A 3NTHA 4LFAL 2ACZB 3HK0A 3ZKJC 4ANVA 1MI2A 2AL3A 2F3IA 2KQ3A 5LHY1 2LHDA 3DCGA 3HIZA 1SIJA 2WDQB 1BDOA 1HNXL 2A4ZA 3GS2A 2C60A 4HVBA 3TBIB 3A9KA 2INPE 2WXOA 3M85A 3I91A 4HXDA 2IZVB 2AEHA 3S2HB 2K7VA 4KZCA 1EWHA 1IP9A 3FHWA 3HRZC 5FLXc 1WXQA 3SDLC 3BJUA 2UWQA 1H9JA 2UU9L 4H2AA 2QMTA 1IBLQ 1ASZA 5KHOA 1ONLA 1H95A 3H8HA 4L2YA 2PE6B 2DNEA 4OGQC 2BYVE 1Q0WB 3BZCA 4O1NA 5FLXL 4DNIA 1FIQA 4R4CA 3L3OC 4C1NI 4A3IH 1RF2D 2BKRB 5JVG3 2K01A 2WINB 1KLUD 4C80A 1GUGA 4L5QA 1KOTA 3VYTA 2VQEQ 3W5OA 4XT3B 4Y7NB 4POGA 4GDKB 3A1QA 1HZBA 3AMUA 4EQOA 5J39A 3ND9A 3RD4A 4MDKE 1MJDA 1BUVT 5IP9G 3PO2H 2WX0A 2XRSD 1EEID 3K7AH 2PIAA 3ULJA 3AI5A 3IFDA 4LNQA 1JORA 4GOCA 4FF4A 2GB1A 5CX3A 5J17A 1YEZA 2JA5B 1EIHA 1OTRB 3GZNI 3ND8A 4DXFA 1X55A 2N7JA 3AU4A 4BY7G 5G5GA 3V61A 3M9BA 5C2TB 3HVDA 3G4SA 3HOWH 3VQIA 3H15A 5JHAA 3P1HA 4KV6A 4IW0A 2MBEA 2VUMG 3CMMB 4JI0L 4HWIB 3ZDTA 4A93H 3AE6B 5KYIA 3EQLC 4IM2A 2BW2A 2WXRA 3DWAA 2HHHQ 1KLGD 1JJGA 2CHBD 1OFFA 3BINA 4MM3A 4WJPA 4A3GB 2OEDA 4RGTA 1V1PB 3E3XA 5LL6X 5C0XG 3GTMB 1HHVA 2NPTA 3KUCB 2KHJA 2NBVB 2WXHA 3Q8EA 4BKSA 1DOYA 2LUMA 4KY6A 1JT8A 4X3TA 3P20A 3T56B 2BGFA 1K50A 1V86A 1UE7A 1F77A 3LGJA 4NAMA 4ZRIA 2EJFC 1L1OC 1JMCA 3R3MA 1QG7A 2CW0D 2FJ2A 4LFBQ 3P4SB 3MXNA 4L63B 3QARA 1V49A 3AECB 1X3EA 4UDUC 2K5NA 2XTIA 3DMUA 4OHJA 4BWGB 4J6IA 2L00B 4S0RA 1VQ8A 2UXDL 2QW7A 1MG8A 1BQQT 3BVZA 1IKMA 3H3VH 1E8XA 4X3SA 1FCCC 5GAHC 2M19A 1RAXA 4X65L 1Y8NB 4KZ0A 4RAUC 4HMJA 3T16A 4BBSB 2C7HA 2HE7A 2IHFA 3NG0A 3BZDB 4HMIA 1QZHA 1VQNA 1IBMQ 2WS3B 1XF5L 4ANUA 4ME5A 3M3JA 3B08A 1EUVB 1UUPA 4W9HA 3DEPA 2OTLA 4CHTB 1QVGA 2MUYA 1JC7A 3B6YA 3OW7A 4OVZA 2R92G 3N32A 5KNDA 4HPLB 4IM0A 3U8ZA 4FXDA 1TWFB 3GTGB 4R4QA 5FJ8G 1WGRA 2DNCA 4GIVA 4NDXA 4QJFA 2W3SA 1SIFA 1TXYA 4DXAB 4V0BA 5FLMH 1DCZA 4EGVA 2E76C 2N55A 1NBFC 1MSHA 2BCOA 2A6HC 5CGKA 1EL0A 1XPOA 3JYUA 2FFKB 3T13A 3S17B 5DPSA 1KFYB 3QWNA 4HDOA 1YNXA 2KMMA 3S1MB 3DVGY 3W1SC 2N8NA 1BR9A 3FKIB 2Z0SA 2LGDA 1JRPA 3AE8B 2VZAA 1N5XA 4JVZA 2NN6G 4IUUA 1KAAA 2CHWA 3MA2B 3ER0A 2YU9B 2PKOA 5IAAC 4FXCA 1HJPA 4KX6B 3EJIA 1MJCA 4A3JH 4RGOS 3IT6B 2KANA 1WX8A 1H8CA 4X6AH 3J7YW 4IUQA 5E6JA 2D0OA 1TWCH 2KENA 3LWEA 1SJED 3AFPA 1N32L 1YJJA 2R93G 1D3ZA 5D7GA 1XNRQ 4IUMB 3W1BA 4GB9A 1K3BC 1PFNA 3PZ7A 2I0QA 3A56A 2R7DA 3NELA 2J4XA 5EKIA 4B3TL 2K25A 3T4AC 4HJ7A 4JBKA 4LTUA 2JYOA 4DV2L 3NENA 4FXKC 4MH0E 1PH3A 3D6WA 3VH4B 1V43A 3I55A 1PZKD 4JI2Q 3F2BA 1VDZA 1IUEA 1EF5A 2DBYA 2BE5D 2IDYA 3A9JA 3OG5A 1CQVA 3VA7A 4ASWC 4BBNC 4N8FA 3GE3C 1TTNA 4BOSC 2XNAC 4H44C 2KA7A 4UPAA 2ATWA 3GTJH 3GTQB 2B2UA 2L52A 5LXHA 1OXVA 2ZJPA 5LMNW 2MHJA 3VFKA 1A15A 4DR7Q 4KV2A 4FYDA 1Q81C 3RLNA 1YX5B 1XD3B 1HNWQ 3OMGA 3Q69A 1GHJA 1UGJA 2KFJA 1XEEA 2JZPA 2LHEA 1I50B 4ZYSA 3S1NH 3NWSA 1KDAA 1UEBA 3CCLA 1TS2A 1FEHA 1AE2A 2AX5A 4WWOA 4JI1L 2G9HD 4ZLTF 3ZO5B 1PH1A 2WB1B 5M5YH 1G6ZA 4GLSC 4A9AA 1F0ZA 1KM7A 2V4IB 2O6VA 1XPUA 5IIFA 4LF4Q 1RTNA 2N88A 1IKLA 2XN9C 1ICWA 4J6HA 4KKUA 2KFKB 2N0SB 2D5GA 4HIOA 1QVCA 1WCMB 1QB5D 3TZDA 4Q5VA 1DGSA 1WR1A 4R4TA 3DBHB 2RBMA 3FPUB 2E2HB 2KEDA 1EOTA 2BA1A 1HTLD 2N7EA 2F0JA 3AYHB 4PMCA 4F87A 3B2GA 2OF1A 5H1SE 1XLQA 1W6KA 1H9KA 4LUVA 4I6NB 3S2AA 1S72A 4MT5A 2KX0A 5ELEA 3HP3A 4CDEC 4ZRQA 5J3BA 4O42A 4DR3Q 3S1QB 5EE9A 2DX5B 4AIMA 4UAIA 3CSFA 2WLBA 2LGSA 5M9OA 1E1TA 4C3IB 4EZJA 3EECA 1DZ1A 1K28A 3CQZH 1F9RA 5CHFA 2MRPA 3BVGA 4DHJB 4LDTB 2QJLA 4TQ1A 4HEA1 1YHQA 4KN4C 2DY7A 3V96A 2NTTA 4KSKC 1RM6C 3DVNU 2J53A 1D8LA 3U4VA 2IYDB 3ZGZA 2KVMA 3MTNB 4K3CA 4XXEA 3NUHB 3AU7A 3M3YH 3UGBB 4DKAC 1QUQA 1CMXB 2QGQA 3Q3NC 1ZXIA 1K8AC 3OW2A 1VLBA 1TR5A 4LF7Q 3VDZA 2JXTA 4YT0B 3PGZA 5I9OA 4A3IB 3TSSA 4YTPB 5CV4A 3J80i 4DR2Q 5HG2A 3UQBA 2CKHB 1N6ZA 1TKGA 1HEZE 3SK8A 3NQTA 4ZK9B 1V81A 2B39A 1ZPSA 5LMUQ 1HR0Q 5CHVC 5C6AA 3H09A 1Q90A 3E9SA 4LNOA 2KN5A 3IBEA 3QK0A 3SVMA 5K5PA 1Q82C 3PO2B 2XEWA 4NQKE 1L4ZB 1B9MA 3BYYB 4A8XC 4OO1H 1AZQA 2KFKA 4IOIE 5CV9A 4I65A 1E22A 2KACA 3I9V1 3OSOA 3W3AA 2GOWA 5E7NA 2HJ8A 3TL5A 1VQEA 2KHWB 1AP0A 4E3CA 2A69C 5I6WA 2CQOA 1FPYA 5TSSA 4E74A 4LF5Q 3C8YA 1Q8KA 3V6EB 2REXA 1IGDA 3HOWB 3TS2A 2LUEA 5C4XG 1P7FA 4DK5A 4LK1C 1A62A 1XO3A 2D07B 1I4RA 4DUYL 4A93B 3RNBC 1ZP0B 3DOWA 5HURA 2AHOB 2K1FA 2LXCA 1WTXA 4IWQA 4IKGA 4LF8Q 1E2VA 3J7A5 4WH4A 2H4OA 2V1YA 1PTOH 2K3UA 1VQ5A 3FAHA 1BBWA 1E1OA 2KWUB 2B2UC 3C19A 2K50A 1XMOQ 1STHA 2Y0SG 5C0XJ 1JALA 4R8NA 1HZ5A 3OYYA 2K32A 3H94A 3C0RB 1YIJA 5M3MH 3DBRB 5DCNA 3Q24A 3ZQ4A 4HIMA 2JA6H 2LY7A 1XLPA 2C7MB 4NPSA 4YY3L 1K51A 4RMAA 4A3EG 4YWLA 3X3MA 2JWZA 1GXDC 1D6EC 1BUIC 2PLPA 1F2ZA 4CKEA 1FJGQ 2M2LA 1WM3A 3K8AA 1FGUA 2NBFA 1XLOA 5AJ3Q 1GUSA 2NVXH 1U4MA 1UNSA 1MG4A 4FDBA 4G57A 1M8AA 2PZWA 1EQVA 3RZFA 2CH4A 4IPDA 2V3PA 2BDOA 3PHXB 1MI0A 4WWNA 3FPPA 1VF7A 3NZUA 1XTCD 3LYYA 5BYRA 3BVMA 5A2QL 2ZW0A 2JA7G 3HKZG 4EZKA 1VQLA 1VQ4A 3ITPA 1GUAB 5GADC 3VYUA 3K58A 3T1YQ 4W9IA 2I1JA 3N1ZC 1PH2A 1TGZB 1EZ6A 4GU2A 4A20A 3IVFA 1OO9B 2BOSA 4W9KA 4XWWA 5C5MA 5FO9B 5D65A 4HJ9A 4JLCA 4GN5A 2MQJA 4DR6L 5K36G 1WGDA 2KDEB 1J8IA 3CCUA 3PV0A 4DR1Q 2UUCL 3AEBB 3VTWA 5EQ0A 3GDEA 2DYMA 3NP8A 2QSDA 3U7DA 1PMRA 3KLSA 3MJ5A 5AUIA 1VQJA 4JI6Q 4TUUA 3FEWX 4AYBE 1RYJA 3L0WB 1SN8A 3NUCA 2BB5A 4RCOA 1D1KA 2QDLA 4JX1C 4EKUA 2D3BA 5JAVA 2F52A 3MXPA 2Q5WD 3S16H 1IBKQ 1R9TH 2PMVA 2PW7A 4UP7A 4A3DB 2E6XA 3I4NH 1LM0A 2KAJA 4A3JB 4JI5Q 4AQYL 4Q0FA 2CWAA 4ZRPA 1TWCB 4IUVA 4BY1H 3D3RA 4GSWA 3PTFC 2F0OA 3KYDD 4LJPB 1CK1A 4DAMA 3L17A 1YJ1A 2M8SA 3DM3A 4R4OA 3PIOA 1WGGA 1WWTA 4FO2A 3DVNV 3DBLI 2KC1A 1Q1OA 5ELBA 3RCZA 3T1HL 4G7OC 2LZ6A 2E5LQ 1YQ3B 1WGHA 3P75A 2R3ZA 4BBRH 3S15H 2FUG1 2LXAA 2K5DA 3GTJB 4ZHPA 2RSNA 5JEAH 4HCPB 2ZCBA 5M5XB 3M7NA 1PH9A 2EYHA 1XLNA 2DZIA 3U9SA 3N52A 1LTBD 4DN4M 4IM3A 3VUWA 1WRDB 3WAPA 5I9PA 2K6DB 4FADA 1LTID 3GTOH 5EE3A 2B63H 4LWCA 3X3NA 1C0AA 1K0SA 5CMDA 2EOTA 4IZ8A 3RNCC 2M17A 3S1NB 1TWGH 2L05A 5E6NA 1TKWB 3E0EA 1WJNA 4X3KA 3KF8B 2L32A 5M5YB 5C5LA 2HJ1A 3VAWA 5JZEB 3CIRB 4PV1C 2JWUA 1R4MB 1QOHA 1ENAA 2XIWA 2J42A 3GOEA 4P74A 2INCC 3SR1A 1EY5A 1W2BA 1SFOH 1WVLA 2CWPA 3ZRFA 1Q7YC 3KDFB 3RMKC 2E74C 3GTLH 2GVBA 2ZCCA 1SDFA 2ZPNA 2L9HA 2CQAA 4JI7Q 5T1GA 4DU9A 2KBNA 4CDCC 4P71A 3NVVA 3KF6B 2EY6A 4CKBA 4DV5Q 2JYTA 3Q8DA 4URKA 2KEEA 1CI3M 3M4OH 2A6EC 3P42A 3FP9A 2VRRB 2AWNA 3JAMi 2EELA 2JRIB 4TV3A 4DK0A 2QKIC 4OVUA 3CRLC 1E0ZA 3Q8FA 3V05A 2LGXA 4DAYA 1GUOA 2B2YC 3M95A 3QIAA 4KIKA 2L1BA 2A5UA 3N20C 4A3FG 1LTTD 1E0BA 4IN3A 5C4HA 3CQZB 1WTVA 3HEJA 1PYBA 4RKBA 4GDLB 4JE3B 2F0SA 4CJ2C 4DV7L 3MTSA 4PT5A 5G3LF 2GI9A 2EDGA 1JROA 3ABVB 3LXFA 4NXNQ 3C3LA 3J7ZC 2L8JA 1B3AA 4GKJL 1PH4A 2ZXPA 2V0GA 2KJXA 3TP6A 4JI3L 1EY0A 2PW5A 2R92H 1UH6A 3AN1A 2F0MA 3RLOA 1MHWC 5CV7A 1RWSA 3B0AA 1RODA 2MP2A 4ARIA 4LMQD 1SJHD 1Z47A 1T9HA 4FVMA 3A8IE 3Q2AC 2KHIA 3JAML 1WTQA 3MHZA 3A74A 1C9FA 2QEJC 2MSED 1EIGA 1VDVA
chains in the Genus database with same CATH topology
5EJWA 2GA4B 1C4AA 1Z6HA 2SNMA 2PTLA 5KRUA 3K5OA 2XSCA 3KF8A 2F3WA 3SK6A 5C4ZA 3C1EA 2WXNA 3R2TA 5EPJA 1S5DD 1DGJA 3PUWA 3W5UB 1TZOA 4KK7A 4J1MA 5C3JB 3TEXA 1TIID 3P7JA 5NUCA 2EY1A 1LT5D 4P16A 2HDLA 4IFDH 1YNJC 2B2VA 1FCLA 2NZ1D 1F2RC 4H7BA 1YN5A 3P1MA 2WP8J 2A68C 2I2YA 1QOAA 1MGSA 3K57A 3H3VC 1D2BA 3L9AX 1QNKA 4A3BB 2JA6B 3ONAB 4JBWA 3DWQA 1A3TA 2SNSA 3I8ZA 1PUTA 3EGRA 4C56C 5IGDA 2NVXB 2Y5PA 1OXUA 1PTOF 1E10A 4C3JG 1IGCA 2AQ2B 2K04A 5IGBA 1EEFD 3E56A 3OHXC 5G5HA 2ICIA 2Y5CA 2K1BA 2PPBC 2B8FA 3TP8A 2L5TA 2WKDA 2ZXOA 2A69D 2OXPA 4B08A 3NRZA 1NUCA 5JXVA 4YIJA 1YNND 4G7ZC 3S16B 2JQRB 1R9TB 1RD9D 3I4NB 1H9MA 2IX3A 5FR3A 5KGUA 1N61A 2EY2A 1SF0A 2M0AA 4BY1B 2VB3X 4XDXA 2I07B 1GB1A 1KDCA 1II3A 2QF7A 2ON8A 3PO0A 4C3HG 3DWMA 3OIQA 4TQ0A 1SXTA 1ESRA 2PYKA 1XCTL 3PUZA 1ZOYB 4KY5A 5T8IA 1AEXA 5ELDA 2X38A 4HKQA 2F0TA 4D2KA 2F0GA 3I72A 1I4HA 5CORA 4CGYB 2K5QA 4BBRB 2WDQB 1TS5A 3S15B 3MP9A 2R61A 2PMZB 1K8MA 2Q8TA 2TSSA 3FILB 4HROA 2F0NA 3GD7A 3GTOB 2B63B 4IURA 1TWGB 3O13A 4ZHOA 3TP7A 1LT4D 3I73A 2N9LA 2BB6A 1NEKB 1SYBA 1SFOB 1PRTF 5I2XA 3DHQA 2VXWA 3FRPB 3GTLB 5BN4A 4FF1A 1WSPA 4XYQA 3LWUA 3VR8B 1SYGA 2IT1A 2XWBB 2MH7A 2LFNA 1ZXTA 1Q10A 3M4OB 2BYTA 1IW7C 2F1MA 3QOJA 4TRDA 1O7LA 1SMYC 3W5VB 1JB3A 2F0UA 2NN6I 4AYBB 1ZXHA 4FF3A 1FXIA 2OT2A 1D5XC 1YN3A 2LJIA 2WU2B 3VR9B 3MC0B 3QG1A 4C1NK 5GXGB 2Z4HA 1QWYA 3V2TA 1U9RA 3VR4A 4WWMA 2AQ1B 1ZEQX 1SAPA 5BMGA 1WRIA 2HQEA 1KNAA 2LMCA 4B0MA 3R2IA 2IGHA 5M5WB 1TKEA 3J9CA 4G4KA 3W2DA 3URYA 4KX6B 4XIGS 3N6RA 3FILA 1CZGA 4IFDI 3Q23A 2R6GA 5KEEA 1ZDVA 3LNNA 1SNCA 1EWYC 3S9WA 1E9MA 1XYIA 2R7ZB 2LGIA 1GUTA 3FDTA 2K0PA 3NHHA 4ZUIA 2AUJD 4AQ7A 2F4IA 3NVZA 4DFAA 2QCPX 5JPNC 3L4PA 1Q1BA 2A6ED 2BS3B 4WAFA 1PTOC 1U4RA 1DOMA 3CU7A 2KUMA 3NS1A 2NTSA 3I4LA 4RA8A 3U4EG 3H0GB 3HOZB 3P4RB 1EQTA 2KOLA 2IX0A 4BA2I 1FFUA 1X32A 1I4GA 1Y69U 5H92C 2LS01 1MPEA 2WNMA 2JSOA 1WTRA 2F3VA 1JWSD 1HA6A 1ESFA 3IAYA 2W3RA 3ZJTA 3A7AB 4QCLA 1ILQA 1HPCA 1C48A 3LB8C 4NP5A 1ENFA 1TVXA 4RKLA 1QCBD 5IODA 2E75C 4RF1A 3TUOA 1A2TA 2L12A 1I4PA 2PZTA 1C4CA 5FK9C 2RVLA 3J7AV 1GOZA 4YWGG 3UI2A 5C3WA 1SNOA 4KTAA 4M1UB 3RLFA 2EJGC 3T3OA 4YSYB 3PUXA 1BCPB 3SE0A 1SYDA 5HFYA 1KRHA 4PMBA 4I7ZC 2SDFA 1OXXK 1YNJD 2H88B 1Y56A 2WXFA 2I38A 3U7ZA 1S5FD 2A68D 4A90A 1BCPF 3J80E 4NW2A 5KNBA 4OW0A 1R4QB 4ODGA 5CC4A 1Q1EA 5HI1A 1EYDA 3AEGB 3PUYA 3B2FA 1EU3A 1DOXA 1BO0A 1PYWD 1Q12A 3K59A 2A74C 4GZYC 4YTNB 1PRTC 1CHQD 3CHBD 1EZ8A 3NSWA 1D5ZC 1ZYRC 2WU5B 2X6LA 1N62A 2YEPF 4HJGE 1FNWA 1PXUA 4HR7B 4TMAB 1BF4A 2E3TA 2HCIA 2WXLA 2KECA 2RMMA 3A7LA 3VYSA 5IT9E 3DXJC 1LTSD 3HOYB 1B9NA 4K2LA 3NVWA 5EE1A 4XE0A 3HVZA 4WURA 2NB0A 3K7AB 1LTRD 1SNDA 1OQQA 1VZ8A 4C3IG 2BS4B 3VYRA 1QKZA 1S4ZA 3B9JA 4OZBA 3IL8A 1NI3A 4LAAA 4N59A 1JW9D 3Q8CA 3AEEB 3TP5A 1G8ZD 1R4PB 2K6AA 4ZKCB 4DK1A 1A2UA 1QQRA 1FNUA 1FR3A 1DD2A 2WXPA 1DONA 4YSZB 4MHEA 1FD7D 1VMCA 4F8MA 1JWBD 1STGA 1WGKA 1IBXA 4M8AA 1JWAD 3K6OA 3BK2A 4OZAA 4B0EA 3S1RB 4C7ZA 3EUB2 1EM7A 1FGBD 2W54A 3MZ5A 3HZXA 1HQRD 4CJ0B 3Q6SA 2PVGC 4XTCS 1QLBB 2DY8A 1J7AA 1CA5A 1C8CA 2ZW1A 4HN7A 1JICA 4CQNA 1IW7D 4BA1I 1K8OA 4LJZC 1SMYD 2OHFA 1SSNA 3MFYA 5JPMC 1K52A 2A5HA 1HUNA 3TZUA 5C44B 1XCQL 2LKVA 5DNFA 4K5VA 5IGGA 1VZ7A 1PLFA 5MPOA 2KCCA 5BMIA 2MJEA 4KJNA 1MBYA 2RSOA 1HRJA 4HTHA 4QMGA 3K5NA 3VA5A 1HXYD 4XQJA 4K8JA 4XT1B 4DQOC 2MHVA 3Q8BA 2B2TA 4RCNA 3NWTA 4K5WA 1GPXA 1STEA 4RF0A 5FO8B 3ZJVA 2WXGA 2EXZA 1AW7A 1AZPA 2JSVX 2RKSA 1HFNA 1H9SA 1BCPC 1HUMA 2OEOA 1C77A 1K53A 1ZE3D 2BT6A 3AB5A 1TWHB 3GB1A 3R3OA 2EJMA 3RZOB 2PVOD 1YQ4B 1Y8OB 2B76B 3T3NA 1B44D 2Z4IA 3Q0AA 4ZAIA 1ML0D 1LV9A 5KYLA 3MAQA 1B9RA 2KHSA 2A6HD 4XQQA 4KGSA 1EU4A 2Q8RE 1PTOD 1HQMC 4IUTA 1VJKA 2Y3AA 1LACA 2NVQB 4RWSC 3IXSA 3D6CA 4C7YA 1MHHE 1O78A 2CVRA 1SB3C 1KABA 1SE3A 3OOCA 2F0LA 5EBDA 4NAWB 5C0XH 3DWGC 1YNTE 4XYOA 1TQOA 2L55A 2F0PA 2PQEA 2WXQA 4KKTA 1N60A 1UWMA 3E6ZX 3MEHA 1RFKA 1NCVA 3OIPA 4ILWA 2NUCA 1EY6A 1YN4A 1HCZA 3BYTB 1HZ6A 3KLRA 2K28A 5FO7B 2HDMA 2KQ4X 1N5WA 3NBHA 3NPPA 1BMLC 3NZ3A 4WJWA 4MH8A 3ETRA 1STAA 4IUPA 1GHKA 1I3QB 1P7EA 1MHXA 5HHDG 3KBGA 1NR2A 2WXKA 4JK1C 5D14A 3DM1A 3M3YB 2RDHA 2B2WA 3DWPA 1B4OA 4EE2A 3BDCA 4KY7A 1L0VB 1QT9A 1SYEA 1MSGA 3VRAB 4A3MB 4QUCA 1PZJD 1TT2A 2SAKA 3G7LA 2NN6H 1HA5A 3J81E 3HS0C 3PIP3 1B53A 3I4MB 2F0DA 2JP1A 4R3DA 1E2ZA 4AS1A 1EYAA 1VR9A 4FF2A 3P63A 2VZKB 2RDFA 3D8GA 4IALA 3W9CB 1FNVA 1BNZA 2JXMB 1JOKA 2B2TC 1FMAD 2FE8A 4E6IA 3D4DA 4YXDB 1PRTD 3SK5A 1X3PA 4KKIA 3AV8A 3GQBA 3IKJA 1CT1D 2K33A 2L11A 1PTOB 1ZYRD 2JA8B 1DXMA 3KWLA 2HUGA 4OIJA 5M3MB 1Y8PB 2PZUA 5BYSA 1H9RA 1PDQA 2JYEA 5AUKA 3J7AF 2W82A 3M4YA 3PMFA 5EKLA 1PGXA 3MVVA 2MEKA 3AE7B 3PO3B 1G2TA 1QJOA 2F0HA 3DUZA 2WP9B 5E4WC 4ZRZA 3EFXD 2C5CA 2EYPA 4OO1G 4TKOB 3E5SA 5FLXE 4JWUC 3WDNA 4N9TA 1B2TA 2L0CA 1JR0D 2L4NA 4N58A 1KDBA 1STYA 1JQ4A 4MIUA 5ISRA 3T53B 3I70A 4JWSC 3U9OA 1DOKA 2ID0A 3RFZB 1SYCA 4X3UA 1C76A 2BTEA 1ENCA 2B8GA 4RHSA 2PCFB 3T51B 1SE2A 1EY9A 4OZCA 2MP1A 3OWEB 1CTMA 4YSXB 1PGAA 3KBXA 3IT4B 2J52A 2XVSA 1F2YA 1RTOA 2GRIA 2EY5A 2H89B 2KN4A 1IL8A 4HEDA 5CV8A 5JJZA 4EVOA 1TY0A 2KDMA 2AUKA 1ACCA 1F9SA 5FKAC 1G291 5E4XA 5C0XI 2LMCB 2D2CC 4IUNA 4U68A 2NVTB 5ELFA 3NTKA 4ZOHC 2MGSA 1SYFA 2KWDA 4ABNA 1I6HB 1L6UA 3AE5B 5LNK1 3ERQA 1C79A 1LO5D 4DNRB 5CR3A 1PRTB 3AE4B 4CBVA 1GJXA 4BY7B 2QILA 3SEBA 5A35A 5FOBB 2INNE 3V3XA 1TYGB 3A8JE 3QJYA 4C2MB 2VUMB 5IGEA 3TDQA 4EQNA 3C46A 2WQYB 2B2VC 3G6JB 1ILPA 3LX0A 1TJEA 1R7SA 4HAEA 2I46A 3NK9A 2FBWB 1WTWA 3BDOA 3K5MA 5DAUA 2BS2B 2XRQD 4ZQ3A 1L6VA 2O2LD 1BXTA 2K5PA 3TMEA 4K14A 4B9XA 1I6VC 4USAA 3I90A 3KQ4A 5JEAG 2EYJA 3HG9A 1TY2A 2WV6D 4YTMB 1GUNA 2A73B 2TMPA 4ZKBB 1ET6A 4F88A 1BCPD 1NR4A 4RH6A 1QNUA 2R92B 1F9QA 3A55A 2DYOA 4DNTB 5K36H 3HUIA 3SXHA 2MJ3A 1JWMD 3BK1A 5D3IB 1KH0A 2ICEC 1FM0D 1SNMA 4QF4A 4NMZA 5EKKA 1RHPA 5EPKA 1O7YA 3SFDB 1L4DB 1B1ZA 2BDNA 2NVYB 4RGNA 3EROA 4US8A 3CWIA 3MXUA 1PDXA 4KMUC 2R93B 3A8KE 1UAPA 1A6XA 1KNEA 5KNCA 2O5JC 4K6DA 1AYFA 2ZT9C 4IDIA 4PNYA 4DXGA 3AEFB 1NENB 2D9UA 1EYCA 4CKCA 3C2PA 1EFID 3TEZA 4NJCA 1D1IA 2E2DC 3SDZA 4J3OD 5JOBA 1JMLA 4K6LA 5H8YE 3E0JA 1WTOA 1PFBA 1Q3LA 4L8JA 1FXAA 3H6MA 1IYUA 5DEHA 3GV6A 1K83B 3R8BA 2FMMA 3MFGA 2EZVA 4MACA 4DGZA 1SE4A 1DOIA 5I2YA 1GAQB 2QIEB 4XDDA 2D5DA 3MWYW 3IAM1 3P4PB 1PZID 1NYQA 2LFIA 1PFMA 3AM9A 1V1PA 4WFN3 1SNQA 5IOCA 2K05A 1V1OA 5C3XA 2WKCA 5I4DA 2JE6I 3PZ8A 4F7XA 2WXIA 3D4WA 4FNFA 2Z1CA 3S2DB 1JQYD 3ZJUA 4IFDG 1T3QA 1A3UA 2G1EA 1QOBA 2KCNA 2AQ3B 4TSSA 3Q8AA 4HKZE 2PNRC 4ARCA 3PUVA 4KD4A 4J8QA 4R9WA 1RKNA 2JEAI 1AN8A 1VMPA 4S3SA 1S5ED 2W55A 3OPOA 1D5MC 1STBA 2ENBA 3VR5A 4ITKA 3GO5A 3DEOA 2K9XA 1ET9A 3WOFA 3BG3A 2E2JB 1F2MA 2VNUD 2CU3A 2YEPB 3RMHA 4ULLA 1F2LA 3IFTA 4PMWA 3FVQA 1T5XD 1IBXB 1DJRD 2RPVA 1MVKA 5A2QE 4FP5D 1O80A 1EY8A 3AH7A 1QILA 1KTKA 3K0YA 3OWFA 5E3FA 1J7BA 3QO2A 5CV5A 5D3DA 4KGRA 1OXTA 2K03A 5AFWA 1Q8IA 5C4XB 1NYRA 5CBAE 5HGTA 2F0KA 1HFGA 2IJ0A 4KI0A 2FINB 4Q2JA 4U673 2Y0SB 2F0FA 2EE1A 1TS4A 1QOGA 2VB2X 3BDLA 4A3EB 5J1ZA 5IGFA 4H0LC 3IAS1 2Q8IB 2DLBA 3VR6A 1EWCA 4ID6A 1BBXC 3C1FA 3GV3A 1LABA 3NBIA 5M3FB 2K22A 4KJOA 3I3CA 1B50A 1F2RI 3NE5B 2JA7B 3HKZB 1XWEA 5JEAJ 2LEKA 4LK0M 3D4RA 4JPSA 2M56B 2IWHA 3TEYA 4FXGC 3WOEA 4L23A 1WYGA 3AEDB 2X69A 2NMQA 2HDEA 2MJ8A 1M4VA 2BA0A 1CFMA 1T5EA 2SEBD 2SOBA 1C78A 1V8CA 4QB4A 1YNNC 2CJOA 3NXWA 2J0TD 3J80L 2IGDA 1H9SB 2F0EA 1G2SA 1CZWA 5C4JB 2V4DA 1WTPA 3GTKB 2WXJA 5G3LD 5LL6S 1NVID 2ZXRA 3RZDB 2F0WA 3A54A 3CKIB 1GB4A 4QIWB 1IYVA 1FRRA 4XWTA 4A6QA 2B2YA 2FHTA 1EY7A 5BYQA 1E2WA 2HTME 3QB3A 1VZ6A 4WRDA 2F0VA 2F0IA 4DA2A 4P2CB 3VR3A 1JE4A 2EVBA 3HGBA 1UEAB 1LTAD 3AE2B 2BBCA 2N9KA 1SSOA 1CQFA 2H1EA 1JOQA 5IT9L 1XX8A 3EVQA 1W6JA 4HCEA 2EYMA 2EYLA 1L0YB 3WCQA 4NKLA 2O5IC 4OIKA 3KUPA 2JX5A 1QOFA 2HCCA 1HTPA 1G91A 1A70A 1TKYA 3SHLA 2NYZD 2IPKD 2EPBA 3JAME 1NAPA 5F2DA 2VZKD 4KHVA 3GTPB 3FC4A 2XWJB 1SNPA 2DWQA 1DYQA 5DM73 1UWXA 3AEAB 1TU2B 4WORA 1WD1A 4MN3A 1LT6D 4HSVA 5EPLA 3NTIA 5ELCA 1V97A 2D62A 3NVYA 3P4QB 4IFDJ 3BWUD 4A3FB 3KK7A 1FD6A 1NSNS 1CZPA 5CBEE 4OL7A 1F9PA 1LLRD 2CW0C 2RA4A 4K5XA 2F0QA 5IGCA 1V8QA 3U2SC 3PIO3 4M0WA 2G9DA 3CRKC 1PFDA 1EY4A 2EYOA 4HSPA 1L5PA 1SBBB 3SK4A 3N9YC 3GP7A 3TN2A 4KN7C 5J22A 1GUWA 4ZUJA 2RDGA 3I57A 1RDPD 3FMCA 1Z7TA 1Y1WB 2L1AA 2QDBA 2WIIB 3AE1B 1DOLA 3ZYYX 4Z9CB 3K5LA 2ONQA 2MPMA 4NZLB 1I4XA 1STNA 4BS9A 3HRDD 3AE3B 3MHBA 4L6TB 4K2KA 3R93A 3RUZA 4US9A 3NQIA 4RFBA 1OXSC 3OMCA 1JOOA 4RNAA 2WAQB 1I4QA 2NWGA 4OO1I 4KD3A 1CM9A 1FYCA 4REZA 1S5CD 1N63A 1RCVD 1U4LA 3AE9B 4L1BA 4P6VF 1O7ZA 1SEBD 5CV6A 4XQNA 2K5WA 3Q22A 2YYZA 2PW9A 1MD2D 2BE5C 2IGGA 1FFVA 2V3NA 4DAPA 2Z8LA 4PQXA 5C3EB 2WACA 4KKSA 1LT3D 5DM63 3AMZA 4C3JB 2X6GA 4RGMA 1ROEA 5JVH3 1ZDXA 2M9VA 2AWOA 1TS3A 5CYUA 3VR2A 1QE6A 1CA6A 2F03A 4WIPA 4HCSA 5I6YA 5COYA 2E2IB 1E7PB 4QUFA 5T1IA 2JU6X 1X3QA 4KHZA 3D31A 1E6EB 3HOUB 4A55A 3EA6A 5EE0A 4K8IA 2IW3A 1VCIA 2CJNA 3QOLA 2MJDA 4G7HC 2JEBI 3HOXB 2IL8A 1U4PA 1D4BA 2IX1A 4V190 1I7HA 4HRSA 2WDRB 3HOVB 1A3VA 1L0XB 4XDCA 5E1FA 1CHPD 3UI3A 4KGTA 3M7GA 2J7ZA 5EBCA 5KIXA 4N6EB 4WQMA 4C3HB 1J7CA 1C4PA 2EKIA 3KWVA 4DF7A 3BS1A 1FRDA 1OQRA 1DM0B 1S5BD 1ZKOA 2WXMA 1VRAB 4TQUS 4R8IA 1YJIA 1YMHE 1BOSA 2M00A 4H13C 3AB9A 3H91A 3S14B 4DAVA 3MXGA 3KLSX 5BN3A 1LTGD 1ZUD2 1Y1VB 1C4QA 1VF5C 2FMCA 5BN5A 3J81L 1JWUD 5BMHA 4RHRA 2PO4A 4N9PA 1JCKB 2B2WC 2DN8A 1TWAB 4CJ1B 4EQPA 1IHZA 1AWDA 2WDVB 2O4XA 2RQXA 3SFEB 3F2UA 1WD0A 1KF6B 1PGBA 4IQZA 2EYFA 1CJEA 5EGTA 4A3KB 3BIID 1FO4A 1AFPA 2C9OA 3L7ZC 3VRBB 4MM3B 1J9OA 3SR6A 3W1SA 4KKJA 3U52E 2L83A 1RJTA 1T6BX 1QF6A 4LLGM 1XXGA 4B9WA 2ACZB 3NTHA 1MI2A 2KQ3A 5LHY1 2LHDA 1SIJA 1BDOA 3GS2A 3TBIB 2INPE 2WXOA 3M85A 3I91A 3S2HB 2K7VA 1EWHA 3HRZC 1WXQA 1H9JA 4H2AA 2QMTA 1ONLA 3H8HA 4L2YA 2DNEA 4OGQC 3RPFC 4O1NA 1FIQA 5FLXL 4ARIA 3L3OC 4C1NI 1RF2D 5JVG3 2K01A 2WINB 1KLUD 4C80A 1GUGA 3VYTA 4XT3B 4Y7NB 4GDKB 3AMUA 4EQOA 5J39A 3ND9A 3RD4A 1BUVT 2XRSD 1EEID 2PIAA 3IFDA 1JORA 4FF4A 2GB1A 2JA5B 1EIHA 3ND8A 4DXFA 2N7JA 5G5GA 5C2TB 3HVDA 3VQIA 3P1HA 4KV6A 3AE6B 5KYIA 3EQLC 2BW2A 2WXRA 3DWAA 1KLGD 2CHBD 1OFFA 4A3GB 2OEDA 4RGTA 1V1PB 5LL6X 3GTMB 5C0XG 1HHVA 2WXHA 3Q8EA 1DOYA 2LUMA 4KY6A 4X3TA 3P20A 3T56B 1K50A 1F77A 4NAMA 2EJFC 1QG7A 2CW0D 2FJ2A 3P4SB 3MXNA 4L63B 3AECB 4UDUC 3DMUA 4BWGB 4OHJA 1BQQT 3BVZA 1IKMA 4X3SA 1FCCC 2M19A 1Y8NB 4RAUC 4HMJA 3T16A 4BBSB 3BZDB 4HMIA 2WS3B 1XF5L 4ME5A 1UUPA 3DEPA 4CHTB 2MUYA 1JC7A 3OW7A 4OVZA 5KNDA 4FXDA 1TWFB 3GTGB 2DNCA 4NDXA 2W3SA 4V0BA 1DCZA 4EGVA 2E76C 2N55A 1MSHA 2BCOA 2A6HC 5CGKA 1EL0A 2FFKB 3T13A 3S17B 1KFYB 3QWNA 2KMMA 3S1MB 1BR9A 3FKIB 3AE8B 1JRPA 1N5XA 2NN6G 4IUUA 1KAAA 3MA2B 2YU9B 2PKOA 4FXCA 3EJIA 4RGOS 3IT6B 5E6JA 3J7YW 4IUQA 3LWEA 1SJED 1YJJA 5D7GA 1PFNA 3PZ7A 3A56A 2J4XA 5EKIA 3T4AC 4LTUA 2JYOA 4FXKC 3D6WA 1V43A 1PZKD 2DBYA 1VDZA 1IUEA 2BE5D 2IDYA 1CQVA 3VA7A 2XNAC 4H44C 2KA7A 2L52A 3GTQB 2B2UA 1OXVA 1A15A 4FYDA 3OMGA 3Q69A 1GHJA 1UGJA 1XEEA 2JZPA 2LHEA 1I50B 4ZYSA 3NWSA 1KDAA 2AX5A 1TS2A 1FEHA 3TEWA 4ZLTF 2G9HD 2WB1B 4GLSC 1G6ZA 4A9AA 1F0ZA 2V4IB 5IIFA 1RTNA 2N88A 1IKLA 2XN9C 1ICWA 4J6HA 4KKUA 2N0SB 2D5GA 3TZDA 1WCMB 1QB5D 4Q5VA 2RBMA 3FPUB 2E2HB 2KEDA 1EOTA 2BA1A 1HTLD 2F0JA 4PMCA 4F87A 3B2GA 2OF1A 1XLQA 1W6KA 1H9KA 4MT5A 5ELEA 3HP3A 4ZRQA 4O42A 3S1QB 5EE9A 4UAIA 2WLBA 5M9OA 4C3IB 1DZ1A 1F9RA 3BVGA 2QJLA 4TQ1A 4HEA1 4KN4C 2DY7A 3V96A 2NTTA 1RM6C 2J53A 3ZGZA 2KVMA 4XXEA 3NUHB 3AU7A 1ZXIA 1VLBA 1TR5A 2JXTA 4YT0B 5I9OA 4A3IB 3TSSA 4YTPB 5CV4A 5HG2A 1TKGA 1HEZE 3SK8A 3NQTA 4ZK9B 2B39A 1ZPSA 5C6AA 3H09A 1Q90A 3E9SA 3SVMA 5K5PA 3PO2B 1L4ZB 1B9MA 3BYYB 4A8XC 4OO1H 1AZQA 4IOIE 5CV9A 4I65A 2KACA 3I9V1 3OSOA 3W3AA 1AP0A 2A69C 5I6WA 5TSSA 3C8YA 1IGDA 3HOWB 1P7FA 4LK1C 1XO3A 1I4RA 4A93B 1ZP0B 5HURA 1WTXA 4IKGA 1E2VA 4WH4A 2H4OA 1PTOH 2K3UA 3FAHA 1E0ZA 2B2UC 1STHA 5C0XJ 1JALA 4R8NA 1HZ5A 2K32A 3H94A 3ZQ4A 3Q24A 2LY7A 1XLPA 1K51A 3X3MA 1GXDC 1D6EC 1BUIC 2PLPA 1F2ZA 4CKEA 2M2LA 2NBFA 1XLOA 1GUSA 1U4MA 1UNSA 1M8AA 4G57A 2PZWA 1EQVA 2V3PA 2BDOA 1MI0A 3FPPA 1VF7A 5BYRA 1XTCD 3LYYA 3BVMA 5A2QL 2ZW0A 3ITPA 3K58A 3VYUA 1EZ6A 1OO9B 2BOSA 4XWWA 5C5MA 5FO9B 5D65A 5K36G 1J8IA 3PV0A 3AEBB 5EQ0A 2DYMA 3NP8A 2QSDA 1PMRA 3KLSA 3MJ5A 5AUIA 3FEWX 1RYJA 3NUCA 2BB5A 4RCOA 1D1KA 4JX1C 5JAVA 3MXPA 2Q5WD 2PMVA 2PW7A 4A3DB 2E6XA 2KAJA 4A3JB 4Q0FA 4ZRPA 1TWCB 4IUVA 3D3RA 2F0OA 1CK1A 1WWTA 4FO2A 5ELBA 4G7OC 1YQ3B 3P75A 2R3ZA 2FUG1 2K5DA 3GTJB 4ZHPA 2RSNA 5JEAH 5M5XB 3M7NA 2EYHA 1XLNA 3U9SA 3N52A 1LTBD 4DN4M 5I9PA 1LTID 5EE3A 3X3NA 5CMDA 2EOTA 4IZ8A 3S1NB 1TKWB 4X3KA 2L32A 5M5YB 5C5LA 3CIRB 4PV1C 2JWUA 1QOHA 1ENAA 2XIWA 2J42A 3SR1A 1EY5A 1WVLA 2E74C 1SDFA 2L9HA