3B2GA

Leptolyngbya boryana ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Leptolyngbya boryana
molecule tags Electron transport
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2gA00
1V97A 1L6UA 1PDXA 5H8YE 4YT0B 5GXGB 1A70A 3AV8A 1N61A 2PVOD 5C2TB 1QT9A 1RFKA 1J7BA 1OQQA 5MPOA 4YTPB 3CWIA 1KF6B 4C7YA 2HTME 3SR6A 3HUIA 2WP9B 4ZHPA 3NVYA 3AE5B 1OFFA 3B2FA 3FC4A 1L5PA 1PUTA 2L83A 2MH7A 3AEEB 3AEFB 2KAJA 1L0VB 1NYQA 1WRIA 2N0SB 3ZYYX 4YSZB 1FXAA 1SIJA 2E3TA 5EE3A 1NENB 4ITKA 3EUB2 1JROA 1UWMA 2K22A 3DWMA 1FRRA 1L6VA 3AECB 3W5UB 3VRBB 3VR9B 1ZOYB 1I7HA 2W3SA 1VDVA 1EWYC 2PVGC 2WDQB 2WDRB 3AE4B 2DWQA 1FMAD 2W3RA 3AE3B 3FAHA 1FFVA 1VLBA 4JWUC 2QJLA 4N59A 1OQRA 1QOFA 1TYGB 1JALA 3NVZA 2DBYA 2BS2B 2W55A 3ETRA 4KX6B 1N5WA 3BIID 2FBWB 2WU5B 4P6VF 1JRPA 3VRAB 3AEAB 1JWAD 1E7PB 3NVWA 3AE2B 1F0ZA 3DWGC 3LXFA 2H89B 2JX5A 3B2GA 1SF0A 2BS3B 1J7AA 1NYRA 3AEGB 1YJJA 1QOAA 3KWLA 4WQMA 3SFEB 2QIEB 1N63A 1VJKA 2MJDA 2ACZB 1ZXIA 3AN1A 2EKIA 3WCQA 2CJOA 2H88B 3HRDD 1TJEA 3HVZA 5EE9A 1RM6C 1DOYA 2K5PA 1JQ4A 2MJ3A 1GPXA 4C7ZA 1V8CA 3AMZA 3LB8C 2B76B 1FIQA 1N60A 1TKEA 2WLBA 3AM9A 4YSYB 4YSXB 3P4SB 4N6EB 5G5HA 2KMMA 2JQRB 1RWSA 4YXDB 1XO3A 1E9MA 2M19A 2BT6A 3B9JA 2PKOA 1KRHA 3AE1B 1CZPA 1SB3C 3AH7A 1RYJA 1T3QA 2MJEA 4ZOHC 3P4RB 3AB5A 1IUEA 2M56B 1XLOA 3ABVB 1FM0D 2Q5WD 1N62A 2K9XA 1QOBA 2OHFA 3AEDB 1DOIA 2WU2B 1J7CA 4A9AA 4HROA 1CJEA 1QF6A 3P4PB 1FXIA 1QOGA 4US8A 1FO4A 1NI3A 3CIRB 1FRDA 1AWDA 5C3JB 1AYFA 1E0ZA 2WDVB 1YQ4B 2CJNA 1NEKB 3AE6B 5AUIA 4US9A 4YTMB 1ZUD2 1YJIA 5H92C 1E10A 2CU3A 2PIAA 3AE8B 3AE7B 5EE0A 1DOXA 4FXCA 4YTNB 3L4PA 1KFYB 3P1MA 4JX1C 1E6EB 1FFUA 4IDIA 5AUKA 1TKGA 1XLQA 2WQYB 3NS1A 2BS4B 1WXQA 1WWTA 3AEBB 4USAA 1ZP0B 3RPFC 1QLBB 1WGKA 1JW9D 3VR8B 3W5VB 1XLNA 1YQ3B 3P4QB 3P63A 4LTUA 4HRSA 4WWMA 5G5GA 4N58A 1GAQB 1JWBD 4JWSC 2W54A 2Y5CA 1PFDA 1N5XA 2AX5A 1XLPA 3NVVA 1DGJA 1B9RA 1ROEA 1NVID 1TKYA 1WYGA 2LEKA 3AE9B 3NRZA 3SFDB 3W9CB 2L52A 4ZHOA 2WS3B 2G1EA 4C80A 5EE1A 1R7SA 3PO0A
chains in the Genus database with same CATH superfamily
4FBJB 5JH5C 2BKRB 2V4LA 3ZQ4A 1D5ZC 4K7WA 4JLCA 4A3PA 3UI3A 4F1SA 3AE5B 1TZOA 2DLBA 3VHTC 2K0PA 3AEFB 1GB4A 3KQ4A 4II3B 2QDFA 1NENB 4ZRPA 3R2TA 1E8YA 2BGFA 3AECB 1GUAB 2WXGA 1ZOYB 2ZJDA 2W3RA 2V3SA 3U52E 2KQ4X 1GJZA 4MGKE 5E6PA 3BIID 3T9LA 2V4IB 3NG0A 1I4PA 4ZRQA 5JHAA 4PS7A 3LXFA 3MHZA 2HDEA 3B2GA 2FIFA 4URKA 4L23A 2QIEB 2WGSA 2BVCA 3IXSA 3VH4B 2K5PA 3RUIB 2AEHA 1V1PA 1FIQA 4YSXB 4YWGG 4GIVA 4M0WB 5G5HA 5BMGA 2M19A 2BT6A 2RDGA 1SB3C 1Y8RC 3Q14C 4HPMB 1SJED 2LUEA 3AEDB 2D3GA 2V9HA 4TMAB 2ONQA 3A9JB 4OZAA 1S3SG 3MTNB 4LNIA 3WAPA 3ZJTA 3MC8A 4XYCA 1D5XC 5LXHA 2KFKB 1K53A 3QC8B 1HE8A 4B6WA 2WQYB 1WF9A 4NJCA 4ZRJA 3W5VB 2EMSA 4LTUA 1WJ4A 2C5LC 1I35A 3Q8CA 1WYGA 4M01A 1K50A 1B1ZA 1P1AA 3Q3MC 5AEKB 4HVBA 2HE7A 2QC8A 1A70A 3I9V1 1JWMD 1QT9A 3EECA 1I4XA 2GBNA 1WM3A 3NZ3A 1NYQA 2N0SB 4A3OA 1PGBA 4PYZA 2B3AA 2WXOA 1VZ8A 1FCCC 3O65B 1WX7A 4KV2A 3H8HA 4OHJA 4HDOA 4MDKE 3X0WA 3FILA 1L0YB 4FJZA 2KMCA 3DVNU 1G6JA 4IOIE 5CX3A 2VZKB 1XQQA 2FAZA 1VJKA 1ET9A 2ACZB 4GDLB 4PYUA 3BYTB 2NMQA 4IWQA 2KJRA 2D3CA 3TBLD 4OZCA 1IBXA 4O1NA 1FNVA 5CHVC 3AB5A 2FCSA 4W9EA 2KC1A 2JY6A 4HCNB 1FXIA 2D5GA 1CK1A 3A1QB 2JUOA 3QJZA 2G4DB 1AYFA 4F8CB 2NR2A 4KVGB 3TEWA 4AQ7A 3KUZA 1WIAA 3ZNID 4FXCA 4KGTA 1KFYB 1YN4A 1E6EB 1Q0WB 4P1CC 3D32A 4XZ4A 2D3BA 1UELA 1WGYA 3RT3B 3RULA 1RAXA 4RM8A 1ACCA 2LMCA 4RH6A 4MH8A 2JSVX 3RNFC 4A6QA 2UU7A 1Z2MA 4QAYA 1T0QC 4YL8A 2NBVB 2L52A 3H7SA 3UF8A 4F7ZA 2RGFA 1M94A 2M0AA 1PGXA 3H6NA 4HEA1 4HLEA 2WP9B 2JRIB 3DDCB 3B2FA 1YMHE 2O2VA 4WAFA 1L0VB 4AWJA 4ZRIA 2WXMA 2W82A 1L6VA 3VR9B 2MP2A 3RNGC 3KYCD 4LDTD 3O13A 2L0TA 2K8CA 4DHJB 1EM7A 2WU5B 3SHQA 3VRAB 2MRPA 4TQ1A 1WGDA 2HTHA 1EWCA 3AEGB 4II2B 3Q69A 3U7ZA 3WCQA 4XC2A 1TJEA 1LXDA 1V8CA 3AMZA 4DHZB 1HTOA 3I57A 1GC7A 1L0XB 1JRUA 3NS8A 1K52A 3FKYA 4HKZE 1OGWA 4ZOHC 2D11A 4JGHB 2ZPNA 2IDYA 2AQ1B 2Z59B 1JMLA 4KDIC 1LFDA 1C4CA 3TEXA 2LJIA 1P9DU 2GBRA 1UGJA 3C19A 2JZ3B 4I6PA 3HM3A 2O6VB 3UINB 3DBHI 2XBBC 3AEBB 3TIXA 2LASA 4ARIA 2IGGA 1N5XA 1B9RA 3Q8AA 2ZNVB 3ZNZB 4ZHOA 2VRRB 2MBOA 3ZTDA 3ZTCA 3EHVA 2MA9B 3OAWA 4XDDA 1L6UA 2J42A 1RRBA 4M00A 1UNSA 3SDLC 1J19A 4RGTA 5FR6A 4G11A 2MSED 1ENFA 1R4MI 3ZUNA 4KGSA 2W9NA 3ZYYX 4G50A 1SJHD 3PV1A 1HZ6A 3QA8A 4BOSC 3W5UB 2LFIA 3L0WB 3VRBB 1GOZA 1I4RA 2QJLA 4ACFA 1J8CA 3NVZA 2GRIA 2D3AA 3DBRI 1RFAA 1KLVA 2FBWB 1P7FA 3IT6B 4TQ0A 1D4BA 2BS3B 1MJDA 4WQMA 1C4PA 2FUHB 3UGBB 4KIKA 2WX0A 2C7NB 2WXHA 5HFYA 3LB8C 2DAFA 1EUVB 4N6EB 4WQOB 3RCZA 3N20C 2JQRB 4YXDB 4KSKC 4WWOA 2DYMA 2KJ6A 2NPTB 2MJEA 3I5JC 3QHTA 1XLOA 3RN9C 3DPDA 3ECIA 3EGRA 2OHFA 4M02A 2R61A 4TV3A 3RNAC 5AUIA 2MBBB 2TSSA 2MWSB 1R4NB 1KH0A 4HKQA 3ENEA 1TIFA 4IDIA 1WWTA 2QMTA 1ZP0B 4JIOU 2BBCA 3U4EG 2KDIA 1J0GA 1WGKA 2LWPA 1QZEA 4K7UA 2WYQA 3ZLZA 5L95C 1V5OA 1ROEA 3AE9B 2KO3A 1C3TA 3H1UA 1PGAA 3LJ3A 4BKGA 3RFZB 3KW5B 3DHHC 3ZXVA 4BVUC 4EOYA 1FNWA 2FE8A 4XWTA 2KWUB 4A20A 1FD6A 3ZJUA 1C78A 4YSZB 1P3QU 1IPGA 1ZDVA 2K22A 1UWMA 2SAKA 3OLMD 4RMAA 3FAHA 3QIJA 4AOFA 5IP4D 2DHZA 1OQRA 1MG8A 3DQVA 2V0GA 3C8YA 3PS6A 3OJ3A 4AS1A 1E7PB 5KHOA 2KDMA 1NYRA 2LRUA 2K8BA 4G3XB 2K1FA 2WXRA 1BUIC 2GBMA 3RNCC 2CHXA 3AM9A 2NBUA 4BAXA 1ZDXA 1D5MC 3DOWA 4REZA 5DPWA 3MC0B 3VUXA 2IZVB 1VRAB 4WIPA 1HZ5A 3P4RB 3BK2A 1E5WA 1V1PB 2LVQA 2KDFB 2DNFA 2KQSA 1UGMA 5G2NA 5H92C 4HPPA 3GP7A 3QARA 2D10A 1MPEA 3ZDTA 2L1AA 2AYOB 2KTRA 3J9CA 3VR8B 1XLNA 3P63A 4BBNC 3V3XA 4DDID 4B0EA 1YX6B 1TTNA 2JT4B 3SD5A 1SGHA 2M1MA 2WS3B 3KWVA 3Q8FA 2NBWB 3A4SC 4ANVA 2DAJA 4BKSA 4LNOA 2G45B 1XXGA 2BKFA 3PTFC 4LJOB 4W9CA 2GLSA 2PMVA 4RF1A 3WAMA 3SR6A 4DDGD 2OJRA 3Q2AC 1OFFA 4JPSA 2SEBD 2NCNA 3V05A 4LNKA 4GDKA 3M62B 2IO2B 3DWMA 2YEPB 2WX1A 3M63B 3AULA 2K3UA 3Q8EA 3AE4B 2JRHA 1KOTA 3A4RA 4BFRA 1TYGB 3TJPA 2KZRA 3IAS1 3TEYA 4EZKA 3NVWA 3AU4A 3AE2B 2H89B 1WJUA 5LLIA 4DBGA 1Y56A 1QOAA 4MH0E 2G9HD 4FHKA 1GB1A 3FILB 4E71A 3CF6E 3HVZA 3MJ5A 2ZW0A 1YN5A 3OJ4B 1N60A 5D3IB 3VTWA 3N32A 4ASWC 3NZUA 3B9JA 4NQLB 4E3CA 2WXNA 1PQSA 2J52A 4XGAB 4RM9A 1I4QA 2K25A 2WHIA 1SIFA 2ICIA 3B08A 3SU8X 3CIRB 4KZCA 2BWFA 2G3QB 2L7RA 2INNE 2IPKD 2Z0EB 3VQIA 3R3MA 3APFA 3NZSA 4RFBA 3JW0X 3BZDB 1Q5WB 4BKSD 4KGRA 4JWSC 2MBEA 1EU3A 1IGDA 4ZDVA 2IGHA 3RNEC 5HKHA 3K9OB 5AZFA 3PPAA 2ZW1A 2WWZA 2WDTB 1F9JA 5H8YE 1EF5A 4G0NB 3AV8A 1FCLA 3ZXRA 4CYEA 4RF0A 1KF6B 3U2SC 4C7YA 5JHBA 3NVYA 2C7MB 2Y5PA 2L83A 5CHWA 3X23A 2GI9A 1JROA 4P16A 1WJ6A 1VR9A 1TZ1A 2MX2A 2O2VB 2QHOA 5FR3A 1MHHE 2W55A 2IO1B 4A8XC 4P6VF 1F0ZA 1HTQA 2NTSA 2Y5BB 2MP2B 4GLSC 1E90A 2WXKA 2FCQA 4J6IA 2MBQA 3E56A 1GNUA 2WXJA 1C79A 5CTRC 3PLVA 1HA5A 4DQOC 5D94A 2PKOA 2YLMA 1T3QA 1T0RC 4WURA 2KWCA 4GXBA 1IYFA 1FNUA 2N7EA 2VH1A 2KMAA 4A9AA 2CHWA 4JE3B 1FO4A 2N9PC 2BYFA 1F1HA 3ZO5B 3KUDB 5I4DA 4YTNB 3HHMA 4DHZE 3L4PA 3BVZA 4MM3A 3LDZE 4B0MA 1I42A 5KHQA 2KLCA 1XEEA 1WFYA 5E6NA 2OJWA 1WX9A 4GGQA 2PEAA 1SXTA 2L8JA 2REXA 4HJKA 3JVZX 2N9KA 2LVPA 5DPSA 1WGHA 4W9HA 3T3NA 4C4VA 3MHSD 1E8WA 2M17A 5GXGB 5JXVA 1X1MA 4W9FA 2NVUI 2HTME 3L10B 3PVLA 2PTLA 1SE4A 4MJSA 1T0SC 1I7HA 4S17A 3EA6A 2L00B 5J17A 2KT7A 3GZNB 1ZKHA 2ZVOA 2EELA 4NAMA 4W9GA 5C23A 2VH2A 4MGZE 1BMLC 3VUYA 2A5UA 2OOBB 1YJJA 3SFEB 2NS5A 1WXMA 3L13A 1BXTA 3VUWA 3HVDA 2QSDA 3N1YC 1SSNA 2G4SA 3APDA 3IBEA 1VZ6A 1MG4A 4P1BC 3H9DA 3HK0A 3MJWA 4TUUA 4I6LB 4EE2A 2LGDA 1TGZB 2LGYA 4KIKB 1VCBA 2IGDA 1QILA 1QOBA 2RD0A 1QF6A 3P4PB 5D2MB 4RCOA 3R66C 4NQKE 1LM8B 3L54A 1JWSD 1E0ZA 3AU5A 3H7PA 2LRWA 3Q3OC 1V86A 3WANA 2JYTA 3WIMA 4IC7B 4MELA 1XLQA 1JWUD 1YOVB 3L08A 1SE2A 2Z8LA 3QAQA 4AJWA 2W54A 1A5RA 3EFCA 1XF5L 1GC6A 3DHIC 1E8XA 2KANA 2PE6B 3QX1A 1UBQA 4MGIE 2PVOD 3R7QA 4IKGA 1J7BA 4YTPB 1WY8A 3GOEA 5CHFA 1VD2A 3DHGC 2C9WB 2KD0A 1WH3A 1FXAA 2L0FA 3NY5A 1TS2A 4B9KA 3PT2B 2KACA 3W1SA 2KWDA 3WAOA 4KDLB 1FFVA 2M8SA 4N59A 2IO0B 3VVWB 4OVZA 5D6JB 3JSVA 2RSUA 2AQ3B 3EFUA 2ON8A 4DXGA 1WXSA 2MJDA 1R4NI 1HEZE 3W1SC 2D07B 2B76B 2WLBA 2KMMA 2V1YA 3GS2A 4PT5A 1E9MA 4A55A 1GG3A 2MHJA 1WMHA 1N62A 2N9LA 1WRDB 3T8MA 2KDEB 3IT4B 1E7VA 4KKIA 2DZMA 1QOGA 4US8A 4B95A 2DYBA 3P2BA 2I1KA 3WA0A 4AUQC 2CU3A 2KXJA 3PZDA 1DOXA 1WR1A 3P1MA 5IOIA 2UWQA 4R3DA 5DPTA 4WJOA 1JW9D 2VZKD 1TT5B 4W9LA 4WWMA 1IP9A 3Q3NC 2J0KA 3RZWC 2RPVA 2BPSA 3NVVA 2WXIA 1TKYA 2BWES 2XK5B 3BK1A 2JPHA 3IVFA 2KTRB 5HHDG 4EEWA 4W9KA 4FJYA 3ML9A 3KLSX 2MBHA 3ZJVA 3HUIA 1L5PA 4ZYNA 5J18A 3N1XC 2HJ8A 1ISNA 1SEBD 5IN7A 2N7DA 2GBJA 1C4AA 2UYZB 3QWZB 5IKCM 4W9IA 1K51A 5BYRA 2WNMA 4OW0A 4GDKB 2BTEA 3Q3FA 3IFWB 1WJNA 1JRPA 2KKCA 3DBLI 3QCAA 4NAWA 4N9F4 2ZEQA 4WWNA 2I2YA 5HG2A 3V62A 3A9KA 3K9PB 1I4GA 3L16A 4YSYB 1V80A 3CSTA 1WE7A 5T8IA 1FPYA 5AZHA 2V3PA 4FJVB 1XO3A 4HDQA 4D2KA 1UWXA 4IM2A 3AE1B 3AH7A 3Q8BA 2JWZA 4KKJA 2PJHA 3ABVB 1FM0D 4K3BA 2LGIA 1Q10A 3GE3C 4TSSA 1YJ1A 2CR5A 2CHZA 1FRDA 2KDBA 4IWPA 4ANUA 1MI0A 2PIAA 2KFJA 4DHJD 4OVVA 4FLHA 5AUKA 3LYYA 3KUCB 4ICVA 2LZ6A 4HCPB 2MEKA 2DZIA 3ZNGC 4HJGE 4HWIB 2D2QA 3DBSA 2BB5A 2MCNB 3ML8A 1DGJA 2G1EA 2E6XA 3VTUA 1V97A 1C9FA 4BOZB 2IJ0A 2C60A 4ANXA 2N9XA 1YX5B 2X38A 3VTVA 3UQBA 2KC2A 5D3DA 2FIDA 4ZHPA 5LXIB 4XX5A 4C56C 2RPQA 1TY0A 3EUB2 2HD5B 2N7JA 3E9SA 1EF1A 1V81A 2KN5A 1E8ZA 2O6VD 3R7RA 1VLBA 1YIWA 4AJYB 4JL9A 1NBFC 3ETRA 4DK5A 4XWWA 4K7SA 4MEMA 2YVCA 2KQ7A 1WSPA 3QQ8B 2XN9C 1ET6A 1SF0A 1MFWA 2FUG1 4RGMA 3V6CB 3DCGA 3AN1A 2AWTA 2CJOA 4IM3A 4OZBA 1DOYA 4K3CA 4LNFA 3W1YA 2XNAC 2PPHA 2EKEC 1RWSA 2IY0B 2KX3A 1D3ZA 1UUPA 4NY0A 2GBKA 1XD3B 2KK8A 2M4NA 1DOIA 2I38A 2MQJA 3VAWA 1OTRB 2JU6X 2MW5A 3SEBA 2WXPA 3N30A 4US9A 3V6EB 5E6JA 4GOCA 3M3JA 3AE7B 1IGCA 1KM7A 1FFUA 1TKGA 2J4XA 5L83A 3RPFC 2EMTA 4GMVA 3PHWB 4LDTB 2DYOA 4LCDE 3APCA 1YQ3B 4HRSA 2IYDB 1ZGUB 1JWBD 1OEYA 3PZ7A 4MM3B 1AN8A 4HXDA 1NVID 1ZXHA 3TMPB 3DVGX 1IBXB 2QEJC 3V60A 1L7YA 4TKNA 1RFKA 4I6NB 1CQVA 3CWIA 5AZGA 2INCC 1V49A 3Q3JA 3PZ8A 1PUTA 2MH7A 2KAJA 4WAAA 2E3TA 4C4VB 5IO9A 5GMVA 3I3TB 4WWPA 1BT0A 3P42A 2PVGC 3ZVVA 3M95A 1KLGD 3OG5A 4IG7B 3BVGA 1Q1OA 1V6EA 2DBYA 4CO7A 2BS2B 4MJSB 1N5WA 2X8XX 1UD7A 3ZW3A 3AEAB 4H2AA 1JWAD 3IAM1 2WXQA 4GU2A 1CMXB 4DWFA 2AL6A 3KWLA 1UBIA 2PLPA 3HRDD 1GPXA 3QK0A 1LO5D 2ZPYA 1S1QB 5IA7A 2IBIB 4IUMB 1KRHA 1CZPA 4HPLB 4NJ6A 4HK2A 2AL3A 3HM6X 4CQNA 4MSQB 2Q5WD 1UZXB 2K9XA 3VH3B 1WXVA 2LGSA 1CJEA 2ZVNA 4ARCA 1H4RA 1XT9B 1NDDA 2N1VA 4JX1C 5JZEB 1MHXA 3NS1A 2PE9A 1QLBB 2LI5A 1V2YA 2IO3B 5J2RA 3H7PB 1L4DB 2KTFA 1PFDA 2L3ZA 4GN1A 4K81A 3NRZA 3ONSA 2YEPF 2K8HA 3GZNI 3BVMA 1R7SA 4K1RB 1K8RB 3JYUA 1ZW7A 4RGOS 3VDZA 1N61A 3URYA 2Y3AA 1YQBA 5LNK1 2BYTA 2IY1B 5EE3A 2DX5B 3U30A 5DPRA 2LHEA 1Z5SB 3AXCA 4X57B 1YD8U 1EWYC 3UQAA 2DWQA 1FMAD 3IG3A 3ALBA 1ESFA 1QOFA 2LGXA 5FKAC 4KX6B 2L05A 3PHXB 3N1ZC 1KLUD 3ZKJC 4LJPB 4M0WA 1J7AA 3DVGY 3ZIMA 3JSVB 3ZGZA 3BYYB 2LD9A 4NNJB 1PYWD 3UIPB 1V9JA 4EZLA 4MSMB 4UDUC 2PW9A 1WM2A 3A9JA 3RZFA 2KFKA 4LK0M 2KVRA 3TCAA 3MC9A 4WH4A 3W2DA 2DZJA 2N1WA 2CJNA 2L76A 4A90A 1YJIA 2JWUA 1WMHB 4L1BA 3RNBC 1AW7A 2DZKA 3V61A 3VFKA 1TS3A 1WZ3A 2ZCCA 4IWOA 4EFOA 2FNJB 4PK1A 5D7GA 1GAQB 2LHDA 2XEWA 3CMMB 1D6EC 2LEKA 3W9CB 1ZPSA 1WXAA 2RR9A 3WALA 4EUTA 1LGRA 2R2QA 3PRZA 1PDXA 1F2RI 4YT0B 1OQQA 2FCNA 2LUMA 3AEEB 3RYTA 1SIJA 4ITKA 3RMKC 1EU4A 3KH0A 1FRRA 3ZDMC 4ZRKA 1JCKB 1HQRD 2WDRB 5HI1A 2DENB 4JQWC 4CHKA 1F52A 4PS3A 2GOWA 4XE0A 1L2NA 1UH6A 4GDLA 3AI5A 1TS4A 3UIOB 2KJHB 1RLFA 3U8ZA 4C00A 1M4VA 4FHJA 1EO6A 1HXYD 2LJ5A 5EE9A 2H88B 1P7EA 4C7ZA 4NAWB 1WGGA 2WXFA 4M8NA 2AQ2B 2I1JA 3A1QA 4NJ7A 2JVCA 1YNTE 2BYEA 4IW0A 1U4AA 3A9KB 2RDHA 5IAAC 2WU2B 5G55A 4HROA 4P7IA 3KYDD 5C3JB 1YQ4B 1NEKB 3AE6B 3TSSA 1XCQL 3ZRCA 4USAA 3NOBA 3PRMB 3I63C 3N9YC 5TSSA 2J0MA 1T6BX 2KN4A 4N58A 2J0JA 5BYSA 3VXWA 2KYWA 2Y5CA 5FK9C 2L32A 3TEZA 2KWVB 3SFDB 2LVOA 1WYWB 3B0AA 5EE1A 2JYEA 2ZCBA 1E7UA 1KJTA 2FCMA 2K6DB 1FEHA 3KVFB 4BZAA 5MPOA 4XDCA 4M8MA 1STEA 4OVUA 3DBHB 2LXCA 2A4ZA 3FC4A 4EKUA 3T3OA 1WRIA 3MFGA 3PRPB 1ZE3D 2CU1A 3R8BA 1QKZA 2W3SA 3BINA 3AE3B 2V3NA 2KLGA 2WDQB 4JWUC 1DYQA 3PGEA 1H8CA 1TY2A 1XCTL 3RI7C 2JZPA 1OEYJ 1SBBB 1VZ7A 1C77A 2JX5A 3PSEB 1R4MB 3R2IA 3TUOA 4W9DA 2INPE 4Q2JA 4RGNA 4ANWA 1ZXIA 1RM6C 2JXXA 5DCNA 5TR5A 4FN2A 1V1OA 1QQRA 4WJPA 4MGYE 2BW2A 4RNAA 2BQQA 2K39A 4GSWA 5BMHA 2N4FA 3DBRB 1C76A 2O6VA 1AARA 2KX0A 2JXTA 4KZ0A 1AWDA 1V5TA 1ZUD2 4DXAB 4J3OD 3BY4B 3S2AA 2OEDA 3PLUA 4NZLB 3ZNHB 1WXQA 3N3KB 2KVZA 1F77A 2JZZA 2K6QA 5G5GA 4KSLC 4ZYSA 2ASQA 2RMMA 4BKTA 2AX5A 1XLPA 1KTKA 5E6OA 1WX8A 4LNNA 4C80A 1YN3A 3PO0A 3CSFA 2GB1A 3U7DA 5C2TB 2RDBC 4ICUA 3C0RB 4MT5A 2KHWB 2ZNVC 1SE3A 1NI2A 1FXTB 5C1ZA 4FADA 4IM0A 2KNBA 1OQYA 4E74A 4FULA 1F2RC 1VDVA 3TL5A 2BF8B 3B1LX 2MLBA 4WJNA 1I4HA 4WJQA 1JALA 1SE9A 4LLGM 2N9EB 1P0RA 3BWUD 2GMIC 4NPNA 1MVKA 4PS8A 3DWGC 3ZRFA 3DBLB 2M0XA 4DXFA 2CS4A 2WXLA 5BMIA 1N63A 1WZ0A 4W9JA 2NPTA 3RD2A 1JQ4A 4BBNF 3OWEB 2MJ3A 3HIZA 3L17A 1TKEA 3P4SB 2LXAA 3EC8A 2Z0DB 2XK5A 2QCZA 4GB9A 3Q6BA 1RYJA 3GE8C 3DVNV 1LQBA 1IUEA 2M56B 4AP4C 1J7CA 3A33B 1C1YB 1WGRA 2CKHB 4MACA 3NUHB 1L4ZB 3MP9A 1NI3A 1T5XD 2WDVB 2QILA 4YTMB 2ZZPB 1WI0A 3GB1A 1E10A 3AE8B 3IHPC 5EE0A 3PREA 2INDC 3NJTA 3NHEB 2BS4B 1WE6A 2HJ1A 2J7QB 5BO4B 2J53A 5EDSA 1TS5A 2BB6A 3P4QB 5BYQA 4L2YA 2JF5A 4EZJA 2BYVE 1TBEA 4S0RA 1N6ZA 2KOXA 1WR6E 2NTTA 1T0YA 1P98A 2C7HA 2R2OA 4FA6A 2EKIA 1UF0A
chains in the Genus database with same CATH topology
1FNWA 2FE8A 4XWTA 4RGOS 1N61A 2PVOD 3URYA 4IKGA 1J7BA 3ZQ4A 4YTPB 2Y3AA 1FD6A 3ZJUA 1D5ZC 5LNK1 3UI3A 3AE5B 2BYTA 1TZOA 2DLBA 1C78A 2K0PA 3AEFB 1GB4A 3KQ4A 4YSZB 1FXAA 1ZDVA 5EE3A 1NENB 1TS2A 4ZRPA 2K22A 1UWMA 2SAKA 3R2TA 2LHEA 3AECB 2KACA 3W1SA 2KWDA 2WXGA 1ZOYB 1EWYC 3FAHA 2DWQA 1FMAD 2W3RA 1FFVA 4N59A 1OQRA 3U52E 1ESFA 1QOFA 2KQ4X 2V0GA 5FKAC 4KX6B 4OVZA 3C8YA 3BIID 2V4IB 1I4PA 1KLUD 4ZRQA 4AS1A 1E7PB 2AQ3B 3LXFA 3MHZA 2ON8A 2HDEA 2KDMA 3B2GA 4L23A 4M0WA 1J7AA 1NYRA 4DXGA 2QIEB 3IXSA 2MJDA 3ZGZA 2WXRA 3BYYB 1BUIC 2K5PA 1HEZE 1PYWD 1V1PA 1FIQA 2B76B 2WLBA 3AM9A 4YWGG 4YSXB 4UDUC 2PW9A 1ZDXA 1D5MC 4REZA 5G5HA 2KMMA 5BMGA 3GS2A 3MC0B 2M19A 1E9MA 4PT5A 2BT6A 4A55A 2RDGA 1SB3C 1VRAB 4WIPA 1HZ5A 3P4RB 3BK2A 1N62A 1SJED 2N9LA 3AEDB 1V1PB 4LK0M 4TMAB 3IT4B 4KKIA 1QOGA 4US8A 2ONQA 4WH4A 3W2DA 4OZAA 2CJNA 3ZJTA 4A90A 1YJIA 2JWUA 5H92C 2CU3A 1D5XC 1K53A 1DOXA 3GP7A 3P1MA 4L1BA 2WQYB 4R3DA 1AW7A 1TS3A 1MPEA 4NJCA 2L1AA 1JW9D 2VZKD 3J9CA 3VR8B 3W5VB 1XLNA 3P63A 4LTUA 4WWMA 3V3XA 5D7GA 1GAQB 2LHDA 4B0EA 2RPVA 3Q8CA 3NVVA 2WXIA 1D6EC 1TKYA 1WYGA 1ZPSA 2LEKA 3W9CB 3BK1A 2WS3B 1K50A 3KWVA 1B1ZA 3Q8FA 5HHDG 1PDXA 1F2RI 4YT0B 1A70A 3I9V1 3KLSX 1JWMD 1QT9A 1XXGA 1OQQA 1I4XA 2PMVA 4RF1A 3SR6A 3ZJVA 3HUIA 2LUMA 1OFFA 4JPSA 2SEBD 1L5PA 3NZ3A 3AEEB 1NYQA 2N0SB 3V05A 1SIJA 1PGBA 1SEBD 4ITKA 1EU4A 3DWMA 1FRRA 2YEPB 2K3UA 3Q8EA 2WXOA 1JCKB 1VZ8A 1C4AA 1HQRD 3AE4B 2WDRB 5HI1A 1FCCC 1TYGB 1K51A 5BYRA 2WNMA 3H8HA 4OW0A 4GDKB 2BTEA 3IAS1 4OHJA 4XE0A 3FILA 3TEYA 1JRPA 1L0YB 1TS4A 3NVWA 3AE2B 2H89B 1M4VA 1Y56A 4IOIE 1QOAA 2VZKB 2I2YA 2G9HD 1HXYD 5HG2A 1VJKA 1ET9A 2ACZB 4GDLB 3FILB 1GB1A 5EE9A 2H88B 3HVZA 3MJ5A 1P7EA 2ZW0A 1I4GA 1YN5A 4C7ZA 4NAWB 1N60A 4YSYB 3BYTB 2NMQA 5D3IB 2WXFA 2AQ2B 5T8IA 4OZCA 2V3PA 4D2KA 1XO3A 1YNTE 1UWXA 3B9JA 1IBXA 3AE1B 3AH7A 2WXNA 4O1NA 1FNVA 3Q8BA 2J52A 3AB5A 4KKJA 3ABVB 1FM0D 2RDHA 1I4QA 2LGIA 2WU2B 1Q10A 2ICIA 4HROA 4TSSA 1FXIA 2D5GA 1CK1A 3CIRB 1FRDA 5C3JB 1AYFA 1YQ4B 1NEKB 3AE6B 1MI0A 3TEWA 3TSSA 4AQ7A 2PIAA 2INNE 2IPKD 4FXCA 4KGTA 1KFYB 1XCQL 1YN4A 1E6EB 5AUKA 3VQIA 3LYYA 4USAA 1R7SA 4RFBA 2MEKA 3N9YC 4HJGE 5TSSA 1ACCA 3BZDB 2LMCA 4RH6A 1T6BX 2JSVX 2KN4A 4KGRA 4MH8A 4N58A 4JWSC 5BYSA 2BB5A 4A6QA 2Y5CA 5FK9C 1EU3A 1IGDA 2L32A 3TEZA 1DGJA 2IGHA 3SFDB 2L52A 2ZW1A 2G1EA 2E6XA 5EE1A 1V97A 1C9FA 2JYEA 5H8YE 2IJ0A 1FEHA 2X38A 3AV8A 1FCLA 5MPOA 2M0AA 1PGXA 4RF0A 4HEA1 5D3DA 1KF6B 4XDCA 3U2SC 4C7YA 1STEA 2WP9B 4ZHPA 3NVYA 3B2FA 3FC4A 1YMHE 2Y5PA 2L83A 4WAFA 3T3OA 1L0VB 1WRIA 3MFGA 1ZE3D 2WXMA 4C56C 2GI9A 1TY0A 2W82A 1JROA 3EUB2 4P16A 1L6VA 2N7JA 3R8BA 1QKZA 3E9SA 3VR9B 1VR9A 2W3SA 3AE3B 2V3NA 2WDQB 4JWUC 1DYQA 1VLBA 5FR3A 1TY2A 1MHHE 1XCTL 2W55A 3ETRA 3O13A 4XWWA 4A8XC 1EM7A 2JZPA 2WU5B 4P6VF 3VRAB 1SBBB 1VZ7A 1C77A 1WSPA 1F0ZA 2XN9C 4TQ1A 2JX5A 1ET6A 1EWCA 1SF0A 2NTSA 3R2IA 4GLSC 3TUOA 3AEGB 2WXKA 2FUG1 2INPE 3Q69A 4RGMA 3U7ZA 4Q2JA 4RGNA 3E56A 2WXJA 3AN1A 1ZXIA 3WCQA 2CJOA 4OZBA 1TJEA 1C79A 1DOYA 1RM6C 1V8CA 3AMZA 1HA5A 4DQOC 1V1OA 1QQRA 2XNAC 3I57A 1RWSA 2BW2A 4RNAA 1L0XB 2PKOA 1K52A 1UUPA 1T3QA 4WURA 4HKZE 5BMHA 4ZOHC 1C76A 1FNUA 2IDYA 2AQ1B 1DOIA 4A9AA 2I38A 2JXTA 4JE3B 1FO4A 1AWDA 1JMLA 2JU6X 3SEBA 2WXPA 4US9A 5E6JA 1ZUD2 1C4CA 3TEXA 4J3OD 2LJIA 3AE7B 2OEDA 5I4DA 1UGJA 4YTNB 3L4PA 1IGCA 3BVZA 1FFUA 1TKGA 2J4XA 4B0MA 4NZLB 1WXQA 3AEBB 3RPFC 2DYOA 1XEEA 1YQ3B 1F77A 5G5GA 4HRSA 1JWBD 1SXTA 4ZYSA 4ARIA 2RMMA 2IGGA 1N5XA 2AX5A 1XLPA 3PZ7A 4MM3B 1AN8A 1B9RA 1KTKA 1NVID 1ZXHA 3Q8AA 2N9KA 4ZHOA 1IBXB 4C80A 2QEJC 1YN3A 3PO0A 4XDDA 1L6UA 2J42A 3T3NA 2GB1A 5JXVA 5GXGB 1UNSA 5C2TB 4RGTA 1RFKA 1CQVA 3CWIA 4MT5A 2HTME 1ENFA 3PZ8A 1SE3A 4KGSA 1PUTA 2MH7A 2PTLA 1SE4A 2KAJA 3ZYYX 2E3TA 1SJHD 1HZ6A 3W5UB 2LFIA 3VRBB 1F2RC 1I7HA 1VDVA 3P42A 1GOZA 2PVGC 3EA6A 1I4RA 2QJLA 1KLGD 1I4HA 1JALA 3NVZA 3BVGA 2DBYA 2BS2B 2EELA 4LLGM 4NAMA 2GRIA 3BWUD 1N5WA 2FBWB 3AEAB 4H2AA 1JWAD 3IAM1 1MVKA 1P7FA 3IT6B 1BMLC 4TQ0A 3DWGC 1D4BA 2WXQA 2BS3B 1YJJA 3KWLA 4WQMA 1C4PA 3SFEB 4DXFA 2WXLA 5BMIA 1N63A 1BXTA 3HVDA 2QSDA 2PLPA 2WXHA 3HRDD 1JQ4A 3OWEB 5HFYA 2MJ3A 1SSNA 1GPXA 1LO5D 3LB8C 1TKEA 1VZ6A 3P4SB 4N6EB 2JQRB 4YXDB 4EE2A 1KRHA 1CZPA 1RYJA 2DYMA 2IGDA 2MJEA 4CQNA 1IUEA 2M56B 1XLOA 2Q5WD 2K9XA 1QILA 1QOBA 2OHFA 3EGRA 2R61A 1J7CA 1CJEA 4ARCA 3P4PB 1QF6A 4RCOA 4MACA 3NUHB 1L4ZB 3MP9A 1NI3A 1T5XD 1JWSD 1E0ZA 2WDVB 2QILA 5AUIA 4YTMB 2TSSA 3GB1A 1E10A 3AE8B 5EE0A 1KH0A 4HKQA 2JYTA 4JX1C 4IDIA 1XLQA 1MHXA 1JWUD 3NS1A 2BS4B 1WWTA 2QMTA 1ZP0B 2BBCA 1QLBB 1SE2A 2J53A 1WGKA 3U4EG 1TS5A 2Z8LA 2BB6A 3P4QB 5BYQA 4L2YA 2W54A 1L4DB 1PFDA 1ROEA 3AE9B 2YEPF 3NRZA 1XF5L 1PGAA 2NTTA 3RFZB 3BVMA 2EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  1L6U A;  1PDX A;  5H8Y E;  4YT0 B;  5GXG B;  1A70 A;  3AV8 A;  1N61 A;  2PVO D;  5C2T B;  1QT9 A;  1RFK A;  1J7B A;  1OQQ A;  5MPO A;  4YTP B;  3CWI A;  1KF6 B;  4C7Y A;  2HTM E;  3SR6 A;  3HUI A;  2WP9 B;  4ZHP A;  3NVY A;  3AE5 B;  1OFF A;  3B2F A;  3FC4 A;  1L5P A;  1PUT A;  2L83 A;  2MH7 A;  3AEE B;  3AEF B;  2KAJ A;  1L0V B;  1NYQ A;  1WRI A;  2N0S B;  3ZYY X;  4YSZ B;  1FXA A;  1SIJ A;  2E3T A;  5EE3 A;  1NEN B;  4ITK A;  3EUB 2;  1JRO A;  1UWM A;  2K22 A;  3DWM A;  1FRR A;  1L6V A;  3AEC B;  3W5U B;  3VRB B;  3VR9 B;  1ZOY B;  1I7H A;  2W3S A;  1VDV A;  1EWY C;  2PVG C;  2WDQ B;  2WDR B;  3AE4 B;  2DWQ A;  1FMA D;  2W3R A;  3AE3 B;  3FAH A;  1FFV A;  1VLB A;  4JWU C;  2QJL A;  4N59 A;  1OQR A;  1QOF A;  1TYG B;  1JAL A;  3NVZ A;  2DBY A;  2BS2 B;  2W55 A;  3ETR A;  4KX6 B;  1N5W A;  3BII D;  2FBW B;  2WU5 B;  4P6V F;  1JRP A;  3VRA B;  3AEA B;  1JWA D;  1E7P B;  3NVW A;  3AE2 B;  1F0Z A;  3DWG C;  3LXF A;  2H89 B;  2JX5 A;  3B2G A;  1SF0 A;  2BS3 B;  1J7A A;  1NYR A;  3AEG B;  1YJJ A;  1QOA A;  3KWL A;  4WQM A;  3SFE B;  2QIE B;  1N63 A;  1VJK A;  2MJD A;  2ACZ B;  1ZXI A;  3AN1 A;  2EKI A;  3WCQ A;  2CJO A;  2H88 B;  3HRD D;  1TJE A;  3HVZ A;  5EE9 A;  1RM6 C;  1DOY A;  2K5P A;  1JQ4 A;  2MJ3 A;  1GPX A;  4C7Z A;  1V8C A;  3AMZ A;  3LB8 C;  2B76 B;  1FIQ A;  1N60 A;  1TKE A;  2WLB A;  3AM9 A;  4YSY B;  4YSX B;  3P4S B;  4N6E B;  5G5H A;  2KMM A;  2JQR B;  1RWS A;  4YXD B;  1XO3 A;  1E9M A;  2M19 A;  2BT6 A;  3B9J A;  2PKO A;  1KRH A;  3AE1 B;  1CZP A;  1SB3 C;  3AH7 A;  1RYJ A;  1T3Q A;  2MJE A;  4ZOH C;  3P4R B;  3AB5 A;  1IUE A;  2M56 B;  1XLO A;  3ABV B;  1FM0 D;  2Q5W D;  1N62 A;  2K9X A;  1QOB A;  2OHF A;  3AED B;  1DOI A;  2WU2 B;  1J7C A;  4A9A A;  4HRO A;  1CJE A;  1QF6 A;  3P4P B;  1FXI A;  1QOG A;  4US8 A;  1FO4 A;  1NI3 A;  3CIR B;  1FRD A;  1AWD A;  5C3J B;  1AYF A;  1E0Z A;  2WDV B;  1YQ4 B;  2CJN A;  1NEK B;  3AE6 B;  5AUI A;  4US9 A;  4YTM B;  1ZUD 2;  1YJI A;  5H92 C;  1E10 A;  2CU3 A;  2PIA A;  3AE8 B;  3AE7 B;  5EE0 A;  1DOX A;  4FXC A;  4YTN B;  3L4P A;  1KFY B;  3P1M A;  4JX1 C;  1E6E B;  1FFU A;  4IDI A;  5AUK A;  1TKG A;  1XLQ A;  2WQY B;  3NS1 A;  2BS4 B;  1WXQ A;  1WWT A;  3AEB B;  4USA A;  1ZP0 B;  3RPF C;  1QLB B;  1WGK A;  1JW9 D;  3VR8 B;  3W5V B;  1XLN A;  1YQ3 B;  3P4Q B;  3P63 A;  4LTU A;  4HRS A;  4WWM A;  5G5G A;  4N58 A;  1GAQ B;  1JWB D;  4JWS C;  2W54 A;  2Y5C A;  1PFD A;  1N5X A;  2AX5 A;  1XLP A;  3NVV A;  1DGJ A;  1B9R A;  1ROE A;  1NVI D;  1TKY A;  1WYG A;  2LEK A;  3AE9 B;  3NRZ A;  3SFD B;  3W9C B;  2L52 A;  4ZHO A;  2WS3 B;  2G1E A;  4C80 A;  5EE1 A;  1R7S A;  3PO0 A; 
#chains in the Genus database with same CATH topology
 4FBJ B;  5JH5 C;  2BKR B;  2V4L A;  3ZQ4 A;  1D5Z C;  4K7W A;  4JLC A;  4A3P A;  3UI3 A;  4F1S A;  3AE5 B;  1TZO A;  2DLB A;  3VHT C;  2K0P A;  3AEF B;  1GB4 A;  3KQ4 A;  4II3 B;  2QDF A;  1NEN B;  4ZRP A;  3R2T A;  1E8Y A;  2BGF A;  3AEC B;  1GUA B;  2WXG A;  1ZOY B;  2ZJD A;  2W3R A;  2V3S A;  3U52 E;  2KQ4 X;  1GJZ A;  4MGK E;  5E6P A;  3BII D;  3T9L A;  2V4I B;  3NG0 A;  1I4P A;  4ZRQ A;  5JHA A;  4PS7 A;  3LXF A;  3MHZ A;  2HDE A;  3B2G A;  2FIF A;  4URK A;  4L23 A;  2QIE B;  2WGS A;  2BVC A;  3IXS A;  3VH4 B;  2K5P A;  3RUI B;  2AEH A;  1V1P A;  1FIQ A;  4YSX B;  4YWG G;  4GIV A;  4M0W B;  5G5H A;  5BMG A;  2M19 A;  2BT6 A;  2RDG A;  1SB3 C;  1Y8R C;  3Q14 C;  4HPM B;  1SJE D;  2LUE A;  3AED B;  2D3G A;  2V9H A;  4TMA B;  2ONQ A;  3A9J B;  4OZA A;  1S3S G;  3MTN B;  4LNI A;  3WAP A;  3ZJT A;  3MC8 A;  4XYC A;  1D5X C;  5LXH A;  2KFK B;  1K53 A;  3QC8 B;  1HE8 A;  4B6W A;  2WQY B;  1WF9 A;  4NJC A;  4ZRJ A;  3W5V B;  2EMS A;  4LTU A;  1WJ4 A;  2C5L C;  1I35 A;  3Q8C A;  1WYG A;  4M01 A;  1K50 A;  1B1Z A;  1P1A A;  3Q3M C;  5AEK B;  4HVB A;  2HE7 A;  2QC8 A;  1A70 A;  3I9V 1;  1JWM D;  1QT9 A;  3EEC A;  1I4X A;  2GBN A;  1WM3 A;  3NZ3 A;  1NYQ A;  2N0S B;  4A3O A;  1PGB A;  4PYZ A;  2B3A A;  2WXO A;  1VZ8 A;  1FCC C;  3O65 B;  1WX7 A;  4KV2 A;  3H8H A;  4OHJ A;  4HDO A;  4MDK E;  3X0W A;  3FIL A;  1L0Y B;  4FJZ A;  2KMC A;  3DVN U;  1G6J A;  4IOI E;  5CX3 A;  2VZK B;  1XQQ A;  2FAZ A;  1VJK A;  1ET9 A;  2ACZ B;  4GDL B;  4PYU A;  3BYT B;  2NMQ A;  4IWQ A;  2KJR A;  2D3C A;  3TBL D;  4OZC A;  1IBX A;  4O1N A;  1FNV A;  5CHV C;  3AB5 A;  2FCS A;  4W9E A;  2KC1 A;  2JY6 A;  4HCN B;  1FXI A;  2D5G A;  1CK1 A;  3A1Q B;  2JUO A;  3QJZ A;  2G4D B;  1AYF A;  4F8C B;  2NR2 A;  4KVG B;  3TEW A;  4AQ7 A;  3KUZ A;  1WIA A;  3ZNI D;  4FXC A;  4KGT A;  1KFY B;  1YN4 A;  1E6E B;  1Q0W B;  4P1C C;  3D32 A;  4XZ4 A;  2D3B A;  1UEL A;  1WGY A;  3RT3 B;  3RUL A;  1RAX A;  4RM8 A;  1ACC A;  2LMC A;  4RH6 A;  4MH8 A;  2JSV X;  3RNF C;  4A6Q A;  2UU7 A;  1Z2M A;  4QAY A;  1T0Q C;  4YL8 A;  2NBV B;  2L52 A;  3H7S A;  3UF8 A;  4F7Z A;  2RGF A;  1M94 A;  2M0A A;  1PGX A;  3H6N A;  4HEA 1;  4HLE A;  2WP9 B;  2JRI B;  3DDC B;  3B2F A;  1YMH E;  2O2V A;  4WAF A;  1L0V B;  4AWJ A;  4ZRI A;  2WXM A;  2W82 A;  1L6V A;  3VR9 B;  2MP2 A;  3RNG C;  3KYC D;  4LDT D;  3O13 A;  2L0T A;  2K8C A;  4DHJ B;  1EM7 A;  2WU5 B;  3SHQ A;  3VRA B;  2MRP A;  4TQ1 A;  1WGD A;  2HTH A;  1EWC A;  3AEG B;  4II2 B;  3Q69 A;  3U7Z A;  3WCQ A;  4XC2 A;  1TJE A;  1LXD A;  1V8C A;  3AMZ A;  4DHZ B;  1HTO A;  3I57 A;  1GC7 A;  1L0X B;  1JRU A;  3NS8 A;  1K52 A;  3FKY A;  4HKZ E;  1OGW A;  4ZOH C;  2D11 A;  4JGH B;  2ZPN A;  2IDY A;  2AQ1 B;  2Z59 B;  1JML A;  4KDI C;  1LFD A;  1C4C A;  3TEX A;  2LJI A;  1P9D U;  2GBR A;  1UGJ A;  3C19 A;  2JZ3 B;  4I6P A;  3HM3 A;  2O6V B;  3UIN B;  3DBH I;  2XBB C;  3AEB B;  3TIX A;  2LAS A;  4ARI A;  2IGG A;  1N5X A;  1B9R A;  3Q8A A;  2ZNV B;  3ZNZ B;  4ZHO A;  2VRR B;  2MBO A;  3ZTD A;  3ZTC A;  3EHV A;  2MA9 B;  3OAW A;  4XDD A;  1L6U A;  2J42 A;  1RRB A;  4M00 A;  1UNS A;  3SDL C;  1J19 A;  4RGT A;  5FR6 A;  4G11 A;  2MSE D;  1ENF A;  1R4M I;  3ZUN A;  4KGS A;  2W9N A;  3ZYY X;  4G50 A;  1SJH D;  3PV1 A;  1HZ6 A;  3QA8 A;  4BOS C;  3W5U B;  2LFI A;  3L0W B;  3VRB B;  1GOZ A;  1I4R A;  2QJL A;  4ACF A;  1J8C A;  3NVZ A;  2GRI A;  2D3A A;  3DBR I;  1RFA A;  1KLV A;  2FBW B;  1P7F A;  3IT6 B;  4TQ0 A;  1D4B A;  2BS3 B;  1MJD A;  4WQM A;  1C4P A;  2FUH B;  3UGB B;  4KIK A;  2WX0 A;  2C7N B;  2WXH A;  5HFY A;  3LB8 C;  2DAF A;  1EUV B;  4N6E B;  4WQO B;  3RCZ A;  3N20 C;  2JQR B;  4YXD B;  4KSK C;  4WWO A;  2DYM A;  2KJ6 A;  2NPT B;  2MJE A;  3I5J C;  3QHT A;  1XLO A;  3RN9 C;  3DPD A;  3ECI A;  3EGR A;  2OHF A;  4M02 A;  2R61 A;  4TV3 A;  3RNA C;  5AUI A;  2MBB B;  2TSS A;  2MWS B;  1R4N B;  1KH0 A;  4HKQ A;  3ENE A;  1TIF A;  4IDI A;  1WWT A;  2QMT A;  1ZP0 B;  4JIO U;  2BBC A;  3U4E G;  2KDI A;  1J0G A;  1WGK A;  2LWP A;  1QZE A;  4K7U A;  2WYQ A;  3ZLZ A;  5L95 C;  1V5O A;  1ROE A;  3AE9 B;  2KO3 A;  1C3T A;  3H1U A;  1PGA A;  3LJ3 A;  4BKG A;  3RFZ B;  3KW5 B;  3DHH C;  3ZXV A;  4BVU C;  4EOY A;  1FNW A;  2FE8 A;  4XWT A;  2KWU B;  4A20 A;  1FD6 A;  3ZJU A;  1C78 A;  4YSZ B;  1P3Q U;  1IPG A;  1ZDV A;  2K22 A;  1UWM A;  2SAK A;  3OLM D;  4RMA A;  3FAH A;  3QIJ A;  4AOF A;  5IP4 D;  2DHZ A;  1OQR A;  1MG8 A;  3DQV A;  2V0G A;  3C8Y A;  3PS6 A;  3OJ3 A;  4AS1 A;  1E7P B;  5KHO A;  2KDM A;  1NYR A;  2LRU A;  2K8B A;  4G3X B;  2K1F A;  2WXR A;  1BUI C;  2GBM A;  3RNC C;  2CHX A;  3AM9 A;  2NBU A;  4BAX A;  1ZDX A;  1D5M C;  3DOW A;  4REZ A;  5DPW A;  3MC0 B;  3VUX A;  2IZV B;  1VRA B;  4WIP A;  1HZ5 A;  3P4R B;  3BK2 A;  1E5W A;  1V1P B;  2LVQ A;  2KDF B;  2DNF A;  2KQS A;  1UGM A;  5G2N A;  5H92 C;  4HPP A;  3GP7 A;  3QAR A;  2D10 A;  1MPE A;  3ZDT A;  2L1A A;  2AYO B;  2KTR A;  3J9C A;  3VR8 B;  1XLN A;  3P63 A;  4BBN C;  3V3X A;  4DDI D;  4B0E A;  1YX6 B;  1TTN A;  2JT4 B;  3SD5 A;  1SGH A;  2M1M A;  2WS3 B;  3KWV A;  3Q8F A;  2NBW B;  3A4S C;  4ANV A;  2DAJ A;  4BKS A;  4LNO A;  2G45 B;  1XXG A;  2BKF A;  3PTF C;  4LJO B;  4W9C A;  2GLS A;  2PMV A;  4RF1 A;  3WAM A;  3SR6 A;  4DDG D;  2OJR A;  3Q2A C;  1OFF A;  4JPS A;  2SEB D;  2NCN A;  3V05 A;  4LNK A;  4GDK A;  3M62 B;  2IO2 B;  3DWM A;  2YEP B;  2WX1 A;  3M63 B;  3AUL A;  2K3U A;  3Q8E A;  3AE4 B;  2JRH A;  1KOT A;  3A4R A;  4BFR A;  1TYG B;  3TJP A;  2KZR A;  3IAS 1;  3TEY A;  4EZK A;  3NVW A;  3AU4 A;  3AE2 B;  2H89 B;  1WJU A;  5LLI A;  4DBG A;  1Y56 A;  1QOA A;  4MH0 E;  2G9H D;  4FHK A;  1GB1 A;  3FIL B;  4E71 A;  3CF6 E;  3HVZ A;  3MJ5 A;  2ZW0 A;  1YN5 A;  3OJ4 B;  1N60 A;  5D3I B;  3VTW A;  3N32 A;  4ASW C;  3NZU A;  3B9J A;  4NQL B;  4E3C A;  2WXN A;  1PQS A;  2J52 A;  4XGA B;  4RM9 A;  1I4Q A;  2K25 A;  2WHI A;  1SIF A;  2ICI A;  3B08 A;  3SU8 X;  3CIR B;  4KZC A;  2BWF A;  2G3Q B;  2L7R A;  2INN E;  2IPK D;  2Z0E B;  3VQI A;  3R3M A;  3APF A;  3NZS A;  4RFB A;  3JW0 X;  3BZD B;  1Q5W B;  4BKS D;  4KGR A;  4JWS C;  2MBE A;  1EU3 A;  1IGD A;  4ZDV A;  2IGH A;  3RNE C;  5HKH A;  3K9O B;  5AZF A;  3PPA A;  2ZW1 A;  2WWZ A;  2WDT B;  1F9J A;  5H8Y E;  1EF5 A;  4G0N B;  3AV8 A;  1FCL A;  3ZXR A;  4CYE A;  4RF0 A;  1KF6 B;  3U2S C;  4C7Y A;  5JHB A;  3NVY A;  2C7M B;  2Y5P A;  2L83 A;  5CHW A;  3X23 A;  2GI9 A;  1JRO A;  4P16 A;  1WJ6 A;  1VR9 A;  1TZ1 A;  2MX2 A;  2O2V B;  2QHO A;  5FR3 A;  1MHH E;  2W55 A;  2IO1 B;  4A8X C;  4P6V F;  1F0Z A;  1HTQ A;  2NTS A;  2Y5B B;  2MP2 B;  4GLS C;  1E90 A;  2WXK A;  2FCQ A;  4J6I A;  2MBQ A;  3E56 A;  1GNU A;  2WXJ A;  1C79 A;  5CTR C;  3PLV A;  1HA5 A;  4DQO C;  5D94 A;  2PKO A;  2YLM A;  1T3Q A;  1T0R C;  4WUR A;  2KWC A;  4GXB A;  1IYF A;  1FNU A;  2N7E A;  2VH1 A;  2KMA A;  4A9A A;  2CHW A;  4JE3 B;  1FO4 A;  2N9P C;  2BYF A;  1F1H A;  3ZO5 B;  3KUD B;  5I4D A;  4YTN B;  3HHM A;  4DHZ E;  3L4P A;  3BVZ A;  4MM3 A;  3LDZ E;  4B0M A;  1I42 A;  5KHQ A;  2KLC A;  1XEE A;  1WFY A;  5E6N A;  2OJW A;  1WX9 A;  4GGQ A;  2PEA A;  1SXT A;  2L8J A;  2REX A;  4HJK A;  3JVZ X;  2N9K A;  2LVP A;  5DPS A;  1WGH A;  4W9H A;  3T3N A;  4C4V A;  3MHS D;  1E8W A;  2M17 A;  5GXG B;  5JXV A;  1X1M A;  4W9F A;  2NVU I;  2HTM E;  3L10 B;  3PVL A;  2PTL A;  1SE4 A;  4MJS A;  1T0S C;  1I7H A;  4S17 A;  3EA6 A;  2L00 B;  5J17 A;  2KT7 A;  3GZN B;  1ZKH A;  2ZVO A;  2EEL A;  4NAM A;  4W9G A;  5C23 A;  2VH2 A;  4MGZ E;  1BML C;  3VUY A;  2A5U A;  2OOB B;  1YJJ A;  3SFE B;  2NS5 A;  1WXM A;  3L13 A;  1BXT A;  3VUW A;  3HVD A;  2QSD A;  3N1Y C;  1SSN A;  2G4S A;  3APD A;  3IBE A;  1VZ6 A;  1MG4 A;  4P1B C;  3H9D A;  3HK0 A;  3MJW A;  4TUU A;  4I6L B;  4EE2 A;  2LGD A;  1TGZ B;  2LGY A;  4KIK B;  1VCB A;  2IGD A;  1QIL A;  1QOB A;  2RD0 A;  1QF6 A;  3P4P B;  5D2M B;  4RCO A;  3R66 C;  4NQK E;  1LM8 B;  3L54 A;  1JWS D;  1E0Z A;  3AU5 A;  3H7P A;  2LRW A;  3Q3O C;  1V86 A;  3WAN A;  2JYT A;  3WIM A;  4IC7 B;  4MEL A;  1XLQ A;  1JWU D;  1YOV B;  3L08 A;  1SE2 A;  2Z8L A;  3QAQ A;  4AJW A;  2W54 A;  1A5R A;  3EFC A;  1XF5 L;  1GC6 A;  3DHI C;  1E8X A;  2KAN A;  2PE6 B;  3QX1 A;  1UBQ A;  4MGI E;  2PVO D;  3R7Q A;  4IKG A;  1J7B A;  4YTP B;  1WY8 A;  3GOE A;  5CHF A;  1VD2 A;  3DHG C;  2C9W B;  2KD0 A;  1WH3 A;  1FXA A;  2L0F A;  3NY5 A;  1TS2 A;  4B9K A;  3PT2 B;  2KAC A;  3W1S A;  2KWD A;  3WAO A;  4KDL B;  1FFV A;  2M8S A;  4N59 A;  2IO0 B;  3VVW B;  4OVZ A;  5D6J B;  3JSV A;  2RSU A;  2AQ3 B;  3EFU A;  2ON8 A;  4DXG A;  1WXS A;  2MJD A;  1R4N I;  1HEZ E;  3W1S C;  2D07 B;  2B76 B;  2WLB A;  2KMM A;  2V1Y A;  3GS2 A;  4PT5 A;  1E9M A;  4A55 A;  1GG3 A;  2MHJ A;  1WMH A;  1N62 A;  2N9L A;  1WRD B;  3T8M A;  2KDE B;  3IT4 B;  1E7V A;  4KKI A;  2DZM A;  1QOG A;  4US8 A;  4B95 A;  2DYB A;  3P2B A;  2I1K A;  3WA0 A;  4AUQ C;  2CU3 A;  2KXJ A;  3PZD A;  1DOX A;  1WR1 A;  3P1M A;  5IOI A;  2UWQ A;  4R3D A;  5DPT A;  4WJO A;  1JW9 D;  2VZK D;  1TT5 B;  4W9L A;  4WWM A;  1IP9 A;  3Q3N C;  2J0K A;  3RZW C;  2RPV A;  2BPS A;  3NVV A;  2WXI A;  1TKY A;  2BWE S;  2XK5 B;  3BK1 A;  2JPH A;  3IVF A;  2KTR B;  5HHD G;  4EEW A;  4W9K A;  4FJY A;  3ML9 A;  3KLS X;  2MBH A;  3ZJV A;  3HUI A;  1L5P A;  4ZYN A;  5J18 A;  3N1X C;  2HJ8 A;  1ISN A;  1SEB D;  5IN7 A;  2N7D A;  2GBJ A;  1C4A A;  2UYZ B;  3QWZ B;  5IKC M;  4W9I A;  1K51 A;  5BYR A;  2WNM A;  4OW0 A;  4GDK B;  2BTE A;  3Q3F A;  3IFW B;  1WJN A;  1JRP A;  2KKC A;  3DBL I;  3QCA A;  4NAW A;  4N9F 4;  2ZEQ A;  4WWN A;  2I2Y A;  5HG2 A;  3V62 A;  3A9K A;  3K9P B;  1I4G A;  3L16 A;  4YSY B;  1V80 A;  3CST A;  1WE7 A;  5T8I A;  1FPY A;  5AZH A;  2V3P A;  4FJV B;  1XO3 A;  4HDQ A;  4D2K A;  1UWX A;  4IM2 A;  3AE1 B;  3AH7 A;  3Q8B A;  2JWZ A;  4KKJ A;  2PJH A;  3ABV B;  1FM0 D;  4K3B A;  2LGI A;  1Q10 A;  3GE3 C;  4TSS A;  1YJ1 A;  2CR5 A;  2CHZ A;  1FRD A;  2KDB A;  4IWP A;  4ANU A;  1MI0 A;  2PIA A;  2KFJ A;  4DHJ D;  4OVV A;  4FLH A;  5AUK A;  3LYY A;  3KUC B;  4ICV A;  2LZ6 A;  4HCP B;  2MEK A;  2DZI A;  3ZNG C;  4HJG E;  4HWI B;  2D2Q A;  3DBS A;  2BB5 A;  2MCN B;  3ML8 A;  1DGJ A;  2G1E A;  2E6X A;  3VTU A;  1V97 A;  1C9F A;  4BOZ B;  2IJ0 A;  2C60 A;  4ANX A;  2N9X A;  1YX5 B;  2X38 A;  3VTV A;  3UQB A;  2KC2 A;  5D3D A;  2FID A;  4ZHP A;  5LXI B;  4XX5 A;  4C56 C;  2RPQ A;  1TY0 A;  3EUB 2;  2HD5 B;  2N7J A;  3E9S A;  1EF1 A;  1V81 A;  2KN5 A;  1E8Z A;  2O6V D;  3R7R A;  1VLB A;  1YIW A;  4AJY B;  4JL9 A;  1NBF C;  3ETR A;  4DK5 A;  4XWW A;  4K7S A;  4MEM A;  2YVC A;  2KQ7 A;  1WSP A;  3QQ8 B;  2XN9 C;  1ET6 A;  1SF0 A;  1MFW A;  2FUG 1;  4RGM A;  3V6C B;  3DCG A;  3AN1 A;  2AWT A;  2CJO A;  4IM3 A;  4OZB A;  1DOY A;  4K3C A;  4LNF A;  3W1Y A;  2XNA C;  2PPH A;  2EKE C;  1RWS A;  2IY0 B;  2KX3 A;  1D3Z A;  1UUP A;  4NY0 A;  2GBK A;  1XD3 B;  2KK8 A;  2M4N A;  1DOI A;  2I38 A;  2MQJ A;  3VAW A;  1OTR B;  2JU6 X;  2MW5 A;  3SEB A;  2WXP A;  3N30 A;  4US9 A;  3V6E B;  5E6J A;  4GOC A;  3M3J A;  3AE7 B;  1IGC A;  1KM7 A;  1FFU A;  1TKG A;  2J4X A;  5L83 A;  3RPF C;  2EMT A;  4GMV A;  3PHW B;  4LDT B;  2DYO A;  4LCD E;  3APC A;  1YQ3 B;  4HRS A;  2IYD B;  1ZGU B;  1JWB D;  1OEY A;  3PZ7 A;  4MM3 B;  1AN8 A;  4HXD A;  1NVI D;  1ZXH A;  3TMP B;  3DVG X;  1IBX B;  2QEJ C;  3V60 A;  1L7Y A;  4TKN A;  1RFK A;  4I6N B;  1CQV A;  3CWI A;  5AZG A;  2INC C;  1V49 A;  3Q3J A;  3PZ8 A;  1PUT A;  2MH7 A;  2KAJ A;  4WAA A;  2E3T A;  4C4V B;  5IO9 A;  5GMV A;  3I3T B;  4WWP A;  1BT0 A;  3P42 A;  2PVG C;  3ZVV A;  3M95 A;  1KLG D;  3OG5 A;  4IG7 B;  3BVG A;  1Q1O A;  1V6E A;  2DBY A;  4CO7 A;  2BS2 B;  4MJS B;  1N5W A;  2X8X X;  1UD7 A;  3ZW3 A;  3AEA B;  4H2A A;  1JWA D;  3IAM 1;  2WXQ A;  4GU2 A;  1CMX B;  4DWF A;  2AL6 A;  3KWL A;  1UBI A;  2PLP A;  3HRD D;  1GPX A;  3QK0 A;  1LO5 D;  2ZPY A;  1S1Q B;  5IA7 A;  2IBI B;  4IUM B;  1KRH A;  1CZP A;  4HPL B;  4NJ6 A;  4HK2 A;  2AL3 A;  3HM6 X;  4CQN A;  4MSQ B;  2Q5W D;  1UZX B;  2K9X A;  3VH3 B;  1WXV A;  2LGS A;  1CJE A;  2ZVN A;  4ARC A;  1H4R A;  1XT9 B;  1NDD A;  2N1V A;  4JX1 C;  5JZE B;  1MHX A;  3NS1 A;  2PE9 A;  1QLB B;  2LI5 A;  1V2Y A;  2IO3 B;  5J2R A;  3H7P B;  1L4D B;  2KTF A;  1PFD A;  2L3Z A;  4GN1 A;  4K81 A;  3NRZ A;  3ONS A;  2YEP F;  2K8H A;  3GZN I;  3BVM A;  1R7S A;  4K1R B;  1K8R B;  3JYU A;  1ZW7 A;  4RGO S;  3VDZ A;  1N61 A;  3URY A;  2Y3A A;  1YQB A;  5LNK 1;  2BYT A;  2IY1 B;  5EE3 A;  2DX5 B;  3U30 A;  5DPR A;  2LHE A;  1Z5S B;  3AXC A;  4X57 B;  1YD8 U;  1EWY C;  3UQA A;  2DWQ A;  1FMA D;  3IG3 A;  3ALB A;  1ESF A;  1QOF A;  2LGX A;  5FKA C;  4KX6 B;  2L05 A;  3PHX B;  3N1Z C;  1KLU D;  3ZKJ C;  4LJP B;  4M0W A;  1J7A A;  3DVG Y;  3ZIM A;  3JSV B;  3ZGZ A;  3BYY B;  2LD9 A;  4NNJ B;  1PYW D;  3UIP B;  1V9J A;  4EZL A;  4MSM B;  4UDU C;  2PW9 A;  1WM2 A;  3A9J A;  3RZF A;  2KFK A;  4LK0 M;  2KVR A;  3TCA A;  3MC9 A;  4WH4 A;  3W2D A;  2DZJ A;  2N1W A;  2CJN A;  2L76 A;  4A90 A;  1YJI A;  2JWU A;  1WMH B;  4L1B A;  3RNB C;  1AW7 A;  2DZK A;  3V61 A;  3VFK A;  1TS3 A;  1WZ3 A;  2ZCC A;  4IWO A;  4EFO A;  2FNJ B;  4PK1 A;  5D7G A;  1GAQ B;  2LHD A;  2XEW A;  3CMM B;  1D6E C;  2LEK A;  3W9C B;  1ZPS A;  1WXA A;  2RR9 A;  3WAL A;  4EUT A;  1LGR A;  2R2Q A;  3PRZ A;  1PDX A;  1F2R I;  4YT0 B;  1OQQ A;  2FCN A;  2LUM A;  3AEE B;  3RYT A;  1SIJ A;  4ITK A;  3RMK C;  1EU4 A;  3KH0 A;  1FRR A;  3ZDM C;  4ZRK A;  1JCK B;  1HQR D;  2WDR B;  5HI1 A;  2DEN B;  4JQW C;  4CHK A;  1F52 A;  4PS3 A;  2GOW A;  4XE0 A;  1L2N A;  1UH6 A;  4GDL A;  3AI5 A;  1TS4 A;  3UIO B;  2KJH B;  1RLF A;  3U8Z A;  4C00 A;  1M4V A;  4FHJ A;  1EO6 A;  1HXY D;  2LJ5 A;  5EE9 A;  2H88 B;  1P7E A;  4C7Z A;  4NAW B;  1WGG A;  2WXF A;  4M8N A;  2AQ2 B;  2I1J A;  3A1Q A;  4NJ7 A;  2JVC A;  1YNT E;  2BYE A;  4IW0 A;  1U4A A;  3A9K B;  2RDH A;  5IAA C;  2WU2 B;  5G55 A;  4HRO A;  4P7I A;  3KYD D;  5C3J B;  1YQ4 B;  1NEK B;  3AE6 B;  3TSS A;  1XCQ L;  3ZRC A;  4USA A;  3NOB A;  3PRM B;  3I63 C;  3N9Y C;  5TSS A;  2J0M A;  1T6B X;  2KN4 A;  4N58 A;  2J0J A;  5BYS A;  3VXW A;  2KYW A;  2Y5C A;  5FK9 C;  2L32 A;  3TEZ A;  2KWV B;  3SFD B;  2LVO A;  1WYW B;  3B0A A;  5EE1 A;  2JYE A;  2ZCB A;  1E7U A;  1KJT A;  2FCM A;  2K6D B;  1FEH A;  3KVF B;  4BZA A;  5MPO A;  4XDC A;  4M8M A;  1STE A;  4OVU A;  3DBH B;  2LXC A;  2A4Z A;  3FC4 A;  4EKU A;  3T3O A;  1WRI A;  3MFG A;  3PRP B;  1ZE3 D;  2CU1 A;  3R8B A;  1QKZ A;  2W3S A;  3BIN A;  3AE3 B;  2V3N A;  2KLG A;  2WDQ B;  4JWU C;  1DYQ A;  3PGE A;  1H8C A;  1TY2 A;  1XCT L;  3RI7 C;  2JZP A;  1OEY J;  1SBB B;  1VZ7 A;  1C77 A;  2JX5 A;  3PSE B;  1R4M B;  3R2I A;  3TUO A;  4W9D A;  2INP E;  4Q2J A;  4RGN A;  4ANW A;  1ZXI A;  1RM6 C;  2JXX A;  5DCN A;  5TR5 A;  4FN2 A;  1V1O A;  1QQR A;  4WJP A;  4MGY E;  2BW2 A;  4RNA A;  2BQQ A;  2K39 A;  4GSW A;  5BMH A;  2N4F A;  3DBR B;  1C76 A;  2O6V A;  1AAR A;  2KX0 A;  2JXT A;  4KZ0 A;  1AWD A;  1V5T A;  1ZUD 2;  4DXA B;  4J3O D;  3BY4 B;  3S2A A;  2OED A;  3PLU A;  4NZL B;  3ZNH B;  1WXQ A;  3N3K B;  2KVZ A;  1F77 A;  2JZZ A;  2K6Q A;  5G5G A;  4KSL C;  4ZYS A;  2ASQ A;  2RMM A;  4BKT A;  2AX5 A;  1XLP A;  1KTK A;  5E6O A;  1WX8 A;  4LNN A;  4C80 A;  1YN3 A;  3PO0 A;  3CSF A;  2GB1 A;  3U7D A;  5C2T B;  2RDB C;  4ICU A;  3C0R B;  4MT5 A;  2KHW B;  2ZNV C;  1SE3 A;  1NI2 A;  1FXT B;  5C1Z A;  4FAD A;  4IM0 A;  2KNB A;  1OQY A;  4E74 A;  4FUL A;  1F2R C;  1VDV A;  3TL5 A;  2BF8 B;  3B1L X;  2MLB A;  4WJN A;  1I4H A;  4WJQ A;  1JAL A;  1SE9 A;  4LLG M;  2N9E B;  1P0R A;  3BWU D;  2GMI C;  4NPN A;  1MVK A;  4PS8 A;  3DWG C;  3ZRF A;  3DBL B;  2M0X A;  4DXF A;  2CS4 A;  2WXL A;  5BMI A;  1N63 A;  1WZ0 A;  4W9J A;  2NPT A;  3RD2 A;  1JQ4 A;  4BBN F;  3OWE B;  2MJ3 A;  3HIZ A;  3L17 A;  1TKE A;  3P4S B;  2LXA A;  3EC8 A;  2Z0D B;  2XK5 A;  2QCZ A;  4GB9 A;  3Q6B A;  1RYJ A;  3GE8 C;  3DVN V;  1LQB A;  1IUE A;  2M56 B;  4AP4 C;  1J7C A;  3A33 B;  1C1Y B;  1WGR A;  2CKH B;  4MAC A;  3NUH B;  1L4Z B;  3MP9 A;  1NI3 A;  1T5X D;  2WDV B;  2QIL A;  4YTM B;  2ZZP B;  1WI0 A;  3GB1 A;  1E10 A;  3AE8 B;  3IHP C;  5EE0 A;  3PRE A;  2IND C;  3NJT A;  3NHE B;  2BS4 B;  1WE6 A;  2HJ1 A;  2J7Q B;  5BO4 B;  2J53 A;  5EDS A;  1TS5 A;  2BB6 A;  3P4Q B;  5BYQ A;  4L2Y A;  2JF5 A;  4EZJ A;  2BYV E;  1TBE A;  4S0R A;  1N6Z A;  2KOX A;  1WR6 E;  2NTT A;  1T0Y A;  1P98 A;  2C7H A;  2R2O A;  4FA6 A;  2EKI A;  1UF0 A; 
#chains in the Genus database with same CATH homology
 1FNW A;  2FE8 A;  4XWT A;  4RGO S;  1N61 A;  2PVO D;  3URY A;  4IKG A;  1J7B A;  3ZQ4 A;  4YTP B;  2Y3A A;  1FD6 A;  3ZJU A;  1D5Z C;  5LNK 1;  3UI3 A;  3AE5 B;  2BYT A;  1TZO A;  2DLB A;  1C78 A;  2K0P A;  3AEF B;  1GB4 A;  3KQ4 A;  4YSZ B;  1FXA A;  1ZDV A;  5EE3 A;  1NEN B;  1TS2 A;  4ZRP A;  2K22 A;  1UWM A;  2SAK A;  3R2T A;  2LHE A;  3AEC B;  2KAC A;  3W1S A;  2KWD A;  2WXG A;  1ZOY B;  1EWY C;  3FAH A;  2DWQ A;  1FMA D;  2W3R A;  1FFV A;  4N59 A;  1OQR A;  3U52 E;  1ESF A;  1QOF A;  2KQ4 X;  2V0G A;  5FKA C;  4KX6 B;  4OVZ A;  3C8Y A;  3BII D;  2V4I B;  1I4P A;  1KLU D;  4ZRQ A;  4AS1 A;  1E7P B;  2AQ3 B;  3LXF A;  3MHZ A;  2ON8 A;  2HDE A;  2KDM A;  3B2G A;  4L23 A;  4M0W A;  1J7A A;  1NYR A;  4DXG A;  2QIE B;  3IXS A;  2MJD A;  3ZGZ A;  2WXR A;  3BYY B;  1BUI C;  2K5P A;  1HEZ E;  1PYW D;  1V1P A;  1FIQ A;  2B76 B;  2WLB A;  3AM9 A;  4YWG G;  4YSX B;  4UDU C;  2PW9 A;  1ZDX A;  1D5M C;  4REZ A;  5G5H A;  2KMM A;  5BMG A;  3GS2 A;  3MC0 B;  2M19 A;  1E9M A;  4PT5 A;  2BT6 A;  4A55 A;  2RDG A;  1SB3 C;  1VRA B;  4WIP A;  1HZ5 A;  3P4R B;  3BK2 A;  1N62 A;  1SJE D;  2N9L A;  3AED B;  1V1P B;  4LK0 M;  4TMA B;  3IT4 B;  4KKI A;  1QOG A;  4US8 A;  2ONQ A;  4WH4 A;  3W2D A;  4OZA A;  2CJN A;  3ZJT A;  4A90 A;  1YJI A;  2JWU A;  5H92 C;  2CU3 A;  1D5X C;  1K53 A;  1DOX A;  3GP7 A;  3P1M A;  4L1B A;  2WQY B;  4R3D A;  1AW7 A;  1TS3 A;  1MPE A;  4NJC A;  2L1A A;  1JW9 D;  2VZK D;  3J9C A;  3VR8 B;  3W5V B;  1XLN A;  3P63 A;  4LTU A;  4WWM A;  3V3X A;  5D7G A;  1GAQ B;  2LHD A;  4B0E A;  2RPV A;  3Q8C A;  3NVV A;  2WXI A;  1D6E C;  1TKY A;  1WYG A;  1ZPS A;  2LEK A;  3W9C B;  3BK1 A;  2WS3 B;  1K50 A;  3KWV A;  1B1Z A;  3Q8F A;  5HHD G;  1PDX A;  1F2R I;  4YT0 B;  1A70 A;  3I9V 1;  3KLS X;  1JWM D;  1QT9 A;  1XXG A;  1OQQ A;  1I4X A;  2PMV A;  4RF1 A;  3SR6 A;  3ZJV A;  3HUI A;  2LUM A;  1OFF A;  4JPS A;  2SEB D;  1L5P A;  3NZ3 A;  3AEE B;  1NYQ A;  2N0S B;  3V05 A;  1SIJ A;  1PGB A;  1SEB D;  4ITK A;  1EU4 A;  3DWM A;  1FRR A;  2YEP B;  2K3U A;  3Q8E A;  2WXO A;  1JCK B;  1VZ8 A;  1C4A A;  1HQR D;  3AE4 B;  2WDR B;  5HI1 A;  1FCC C;  1TYG B;  1K51 A;  5BYR A;  2WNM A;  3H8H A;  4OW0 A;  4GDK B;  2BTE A;  3IAS 1;  4OHJ A;  4XE0 A;  3FIL A;  3TEY A;  1JRP A;  1L0Y B;  1TS4 A;  3NVW A;  3AE2 B;  2H89 B;  1M4V A;  1Y56 A;  4IOI E;  1QOA A;  2VZK B;  2I2Y A;  2G9H D;  1HXY D;  5HG2 A;  1VJK A;  1ET9 A;  2ACZ B;  4GDL B;  3FIL B;  1GB1 A;  5EE9 A;  2H88 B;  3HVZ A;  3MJ5 A;  1P7E A;  2ZW0 A;  1I4G A;  1YN5 A;  4C7Z A;  4NAW B;  1N60 A;  4YSY B;  3BYT B;  2NMQ A;  5D3I B;  2WXF A;  2AQ2 B;  5T8I A;  4OZC A;  2V3P A;  4D2K A;  1XO3 A;  1YNT E;  1UWX A;  3B9J A;  1IBX A;  3AE1 B;  3AH7 A;  2WXN A;  4O1N A;  1FNV A;  3Q8B A;  2J52 A;  3AB5 A;  4KKJ A;  3ABV B;  1FM0 D;  2RDH A;  1I4Q A;  2LGI A;  2WU2 B;  1Q10 A;  2ICI A;  4HRO A;  4TSS A;  1FXI A;  2D5G A;  1CK1 A;  3CIR B;  1FRD A;  5C3J B;  1AYF A;  1YQ4 B;  1NEK B;  3AE6 B;  1MI0 A;  3TEW A;  3TSS A;  4AQ7 A;  2PIA A;  2INN E;  2IPK D;  4FXC A;  4KGT A;  1KFY B;  1XCQ L;  1YN4 A;  1E6E B;  5AUK A;  3VQI A;  3LYY A;  4USA A;  1R7S A;  4RFB A;  2MEK A;  3N9Y C;  4HJG E;  5TSS A;  1ACC A;  3BZD B;  2LMC A;  4RH6 A;  1T6B X;  2JSV X;  2KN4 A;  4KGR A;  4MH8 A;  4N58 A;  4JWS C;  5BYS A;  2BB5 A;  4A6Q A;  2Y5C A;  5FK9 C;  1EU3 A;  1IGD A;  2L32 A;  3TEZ A;  1DGJ A;  2IGH A;  3SFD B;  2L52 A;  2ZW1 A;  2G1E A;  2E6X A;  5EE1 A;  1V97 A;  1C9F A;  2JYE A;  5H8Y E;  2IJ0 A;  1FEH A;  2X38 A;  3AV8 A;  1FCL A;  5MPO A;  2M0A A;  1PGX A;  4RF0 A;  4HEA 1;  5D3D A;  1KF6 B;  4XDC A;  3U2S C;  4C7Y A;  1STE A;  2WP9 B;  4ZHP A;  3NVY A;  3B2F A;  3FC4 A;  1YMH E;  2Y5P A;  2L83 A;  4WAF A;  3T3O A;  1L0V B;  1WRI A;  3MFG A;  1ZE3 D;  2WXM A;  4C56 C;  2GI9 A;  1TY0 A;  2W82 A;  1JRO A;  3EUB 2;  4P16 A;  1L6V A;  2N7J A;  3R8B A;  1QKZ A;  3E9S A;  3VR9 B;  1VR9 A;  2W3S A;  3AE3 B;  2V3N A;  2WDQ B;  4JWU C;  1DYQ A;  1VLB A;  5FR3 A;  1TY2 A;  1MHH E;  1XCT L;  2W55 A;  3ETR A;  3O13 A;  4XWW A;  4A8X C;  1EM7 A;  2JZP A;  2WU5 B;  4P6V F;  3VRA B;  1SBB B;  1VZ7 A;  1C77 A;  1WSP A;  1F0Z A;  2XN9 C;  4TQ1 A;  2JX5 A;  1ET6 A;  1EWC A;  1SF0 A;  2NTS A;  3R2I A;  4GLS C;  3TUO A;  3AEG B;  2WXK A;  2FUG 1;  2INP E;  3Q69 A;  4RGM A;  3U7Z A;  4Q2J A;  4RGN A;  3E56 A;  2WXJ A;  3AN1 A;  1ZXI A;  3WCQ A;  2CJO A;  4OZB A;  1TJE A;  1C79 A;  1DOY A;  1RM6 C;  1V8C A;  3AMZ A;  1HA5 A;  4DQO C;  1V1O A;  1QQR A;  2XNA C;  3I57 A;  1RWS A;  2BW2 A;  4RNA A;  1L0X B;  2PKO A;  1K52 A;  1UUP A;  1T3Q A;  4WUR A;  4HKZ E;  5BMH A;  4ZOH C;  1C76 A;  1FNU A;  2IDY A;  2AQ1 B;  1DOI A;  4A9A A;  2I38 A;  2JXT A;  4JE3 B;  1FO4 A;  1AWD A;  1JML A;  2JU6 X;  3SEB A;  2WXP A;  4US9 A;  5E6J A;  1ZUD 2;  1C4C A;  3TEX A;  4J3O D;  2LJI A;  3AE7 B;  2OED A;  5I4D A;  1UGJ A;  4YTN B;  3L4P A;  1IGC A;  3BVZ A;  1FFU A;  1TKG A;  2J4X A;  4B0M A;  4NZL B;  1WXQ A;  3AEB B;  3RPF C;  2DYO A;  1XEE A;  1YQ3 B;  1F77 A;  5G5G A;  4HRS A;  1JWB D;  1SXT A;  4ZYS A;  4ARI A;  2RMM A;  2IGG A;  1N5X A;  2AX5 A;  1XLP A;  3PZ7 A;  4MM3 B;  1AN8 A;  1B9R A;  1KTK A;  1NVI D;  1ZXH A;  3Q8A A;  2N9K A;  4ZHO A;  1IBX B;  4C80 A;  2QEJ C;  1YN3 A;  3PO0 A;  4XDD A;  1L6U A;  2J42 A;  3T3N A;  2GB1 A;  5JXV A;  5GXG B;  1UNS A;  5C2T B;  4RGT A;  1RFK A;  1CQV A;  3CWI A;  4MT5 A;  2HTM E;  1ENF A;  3PZ8 A;  1SE3 A;  4KGS A;  1PUT A;  2MH7 A;  2PTL A;  1SE4 A;  2KAJ A;  3ZYY X;  2E3T A;  1SJH D;  1HZ6 A;  3W5U B;  2LFI A;  3VRB B;  1F2R C;  1I7H A;  1VDV A;  3P42 A;  1GOZ A;  2PVG C;  3EA6 A;  1I4R A;  2QJL A;  1KLG D;  1I4H A;  1JAL A;  3NVZ A;  3BVG A;  2DBY A;  2BS2 B;  2EEL A;  4LLG M;  4NAM A;  2GRI A;  3BWU D;  1N5W A;  2FBW B;  3AEA B;  4H2A A;  1JWA D;  3IAM 1;  1MVK A;  1P7F A;  3IT6 B;  1BML C;  4TQ0 A;  3DWG C;  1D4B A;  2WXQ A;  2BS3 B;  1YJJ A;  3KWL A;  4WQM A;  1C4P A;  3SFE B;  4DXF A;  2WXL A;  5BMI A;  1N63 A;  1BXT A;  3HVD A;  2QSD A;  2PLP A;  2WXH A;  3HRD D;  1JQ4 A;  3OWE B;  5HFY A;  2MJ3 A;  1SSN A;  1GPX A;  1LO5 D;  3LB8 C;  1TKE A;  1VZ6 A;  3P4S B;  4N6E B;  2JQR B;  4YXD B;  4EE2 A;  1KRH A;  1CZP A;  1RYJ A;  2DYM A;  2IGD A;  2MJE A;  4CQN A;  1IUE A;  2M56 B;  1XLO A;  2Q5W D;  2K9X A;  1QIL A;  1QOB A;  2OHF A;  3EGR A;  2R61 A;  1J7C A;  1CJE A;  4ARC A;  3P4P B;  1QF6 A;  4RCO A;  4MAC A;  3NUH B;  1L4Z B;  3MP9 A;  1NI3 A;  1T5X D;  1JWS D;  1E0Z A;  2WDV B;  2QIL A;  5AUI A;  4YTM B;  2TSS A;  3GB1 A;  1E10 A;  3AE8 B;  5EE0 A;  1KH0 A;  4HKQ A;  2JYT A;  4JX1 C;  4IDI A;  1XLQ A;  1MHX A;  1JWU D;  3NS1 A;  2BS4 B;  1WWT A;  2QMT A;  1ZP0 B;  2BBC A;  1QLB B;  1SE2 A;  2J53 A;  1WGK A;  3U4E G;  1TS5 A;  2Z8L A;  2BB6 A;  3P4Q B;  5BYQ A;  4L2Y A;  2W54 A;  1L4D B;  1PFD A;  1ROE A;  3AE9 B;  2YEP F;  3NRZ A;  1XF5 L;  1PGA A;  2NTT A;  3RFZ B;  3BVM A;  2EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...