3B2GA

Leptolyngbya boryana ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
b'PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Leptolyngbya boryana
molecule tags Electron transport
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2gA00
2WQYB 5H8YE 2W54A 3AEFB 3AE4B 4YT0B 3AE3B 1FFUA 3HUIA 1QOGA 1DOXA 2H89B 2M19A 1E7PB 4ITKA 3VR8B 2G1EA 4ZHOA 1FO4A 3NRZA 1PDXA 1J7CA 1T3QA 2M56B 3FAHA 3KWLA 4YTNB 3RPFC 1TKEA 2DBYA 3ZYYX 4C80A 3NVVA 1DOYA 2BT6A 5C2TB 1XLNA 3P1MA 4WWMA 5EE3A 3AEGB 3AV8A 1SF0A 3AE6B 1YJIA 3AE9B 1B9RA 2CJNA 1OQQA 5EE0A 1E6EB 1F0ZA 1XO3A 1FXIA 1IUEA 4USAA 4C7YA 3AB5A 1XLPA 1XLOA 2H88B 3AEAB 3NS1A 1JQ4A 1RYJA 3AE8B 4JWSC 4FXCA 4IDIA 3DWMA 2KAJA 2WDRB 3PO0A 4KX6B 1FXAA 3VRAB 5AUIA 2K9XA 1KFYB 1JALA 4US9A 1VDVA 1N5XA 2ACZB 4YSXB 1RFKA 2MH7A 2E3TA 1FIQA 2N0SB 3NVWA 3HVZA 2Y5CA 3AE5B 1EWYC 1L6VA 2L52A 3P4QB 2PVOD 3B9JA 1XLQA 1QOBA 3CIRB 5H92C 2FBWB 3FC4A 2JX5A 3DWGC 4JWUC 3AE2B 1AWDA 1R7SA 1CZPA 2MJ3A 2WU2B 3NVZA 1ZUD2 2HTME 2JQRB 3VR9B 1TKYA 3EUB2 5G5HA 1L5PA 3AE7B 3WCQA 1E0ZA 1FMAD 2LEKA 3LXFA 5EE9A 3AN1A 1NYRA 4WQMA 2WLBA 1FRDA 3L4PA 3AMZA 3P4SB 3AM9A 2QJLA 1QOFA 4US8A 3LB8C 1WYGA 4A9AA 1PUTA 1V97A 2MJDA 1J7AA 2W3SA 1JROA 1JRPA 2PKOA 2CU3A 1V8CA 1NVID 3W9CB 1YJJA 1YQ4B 2W3RA 3SFDB 4YSZB 1N5WA 1WXQA 1DOIA 3SFEB 2OHFA 1VLBA 1AYFA 1N60A 1ZP0B 4YTMB 4P6VF 1N62A 1QOAA 4LTUA 1J7BA 3ETRA 1GAQB 3CWIA 1NENB 1PFDA 1N61A 1TJEA 2AX5A 3B2GA 3AE1B 2Q5WD 1NYQA 4N6EB 4JX1C 5GXGB 5G5GA 3AEDB 4N59A 1WRIA 1ZOYB 3P4RB 3AEEB 1WGKA 1KF6B 1SB3C 2QIEB 1FM0D 1GPXA 1E9MA 1JWAD 2WU5B 3P4PB 2KMMA 2PIAA 5C3JB 4YXDB 3AECB 1QT9A 1CJEA 3BIID 2BS2B 1KRHA 2EKIA 4ZHPA 2L83A 1NI3A 2DWQA 2MJEA 2WDVB 4HROA 1ZXIA 5MPOA 3W5VB 1JW9D 2B76B 1ROEA 3W5UB 1I7HA 1WWTA 3ABVB 3B2FA 1TKGA 1L6UA 1UWMA 3NVYA 5EE1A 1FFVA 4YSYB 1DGJA 4YTPB 3AH7A 1FRRA 2WP9B 5AUKA 2BS3B 2WS3B 4C7ZA 2WDQB 1E10A 1RWSA 1RM6C 2K22A 2W55A 4N58A 1QF6A 1TYGB 3HRDD 2CJOA 1SIJA 1A70A 1L0VB 1OFFA 1VJKA 2K5PA 2PVGC 3P63A 4ZOHC 1NEKB 4HRSA 3VRBB 1OQRA 3AEBB 3SR6A 1YQ3B 2BS4B 1JWBD 1QLBB 1N63A
chains in the Genus database with same CATH superfamily
3LJ3A 1T0QC 3VUWA 4EZJA 2PJHA 1EWCA 2QEJC 3NRZA 3RPFC 1FD6A 1ZXHA 4W9JA 2QHOA 2GB1A 4OVVA 1T0SC 3AE6B 1SEBD 4DWFA 3Q14C 2GBKA 2QILA 2BTEA 4G11A 2RDHA 4KVGB 3V60A 4JWSC 3KW5B 4NJCA 4DQOC 2L05A 1FXAA 1KFYB 2N9EB 4LJOB 4M00A 4BOSC 2K6QA 2IPKD 2N9XA 4I6PA 1Q10A 2L52A 4NQKE 3B9JA 3CIRB 1WSPA 3DVNU 3EFUA 2JX5A 1AWDA 2N9PC 2C9WB 4YL8A 1Q5WB 1PYWD 1TZOA 5E6JA 3AM9A 2LUMA 1V97A 3H1UA 4KKJA 2NS5A 1GB4A 3Q3NC 4C00A 2KN5A 1STEA 4RGTA 2KFKA 1NBFC 1WE6A 3QWZB 2ZJDA 3NG0A 2WXGA 4ZYSA 2G9HD 1QZEA 1WFYA 5AZHA 4ZRKA 5IOIA 1FNUA 2R61A 1V1PB 2V3NA 3V6EB 3U7ZA 1FCLA 1I7HA 3WIMA 1SIFA 2K25A 2ZEQA 4NJ6A 1RWSA 4GSWA 1RM6C 1C76A 2EKEC 4LNOA 4DHJD 3P42A 1OQRA 3VXWA 4G3XB 3AEBB 4DXGA 3DVGY 3PZ7A 2GLSA 5CHWA 5L83A 2KTRA 1ZPSA 1T3QA 5AZFA 1OTRB 3VTWA 3KYDD 4ANWA 1D5XC 2J52A 3UIOB 1FXIA 5GMVA 4RH6A 3N1YC 1RYJA 2BYVE 4K7UA 4P16A 3VRAB 3S2AA 3OAWA 5IP4D 1N5XA 1ISNA 3EECA 3KLSX 3HVZA 5IA7A 4LK0M 2KHWB 3NVZA 3WCQA 2LJIA 3RI7C 3DVNV 4K81A 3OJ3A 2VZKB 2MW5A 3J9CA 3VAWA 1J7AA 3L17A 2SEBD 2W3RA 2DZKA 3TEWA 3V3XA 2AL3A 2NTTA 4A90A 3NZUA 1UZXB 3OLMD 1J7BA 3RZWC 3V05A 4HKQA 2PW9A 1NYQA 1K8RB 1L2NA 2DAFA 2O6VB 1XD3B 1WX7A 3DQVA 3MP9A 3HM3A 3RULA 3AECB 1V5TA 3BIID 3KUCB 2EKIA 2RPVA 3VHTC 1EF1A 3L08A 2WDVB 2MEKA 3Q8CA 4GXBA 4YSYB 5AUKA 2EELA 2WS3B 3AULA 1WRDB 2K8HA 1E10A 2K5PA 4HRSA 4M0WA 1QLBB 1P1AA 3QC8B 1R4NI 1P98A 4XC2A 3EHVA 2DX5B 1I4GA 1TKEA 5KHOA 2PMVA 1LXDA 1ZDVA 1WGRA 2WXMA 4B0MA 3AV8A 3ZIMA 3C8YA 5DPWA 2CJNA 2VRRB 4X57B 1WF9A 1I42A 3ZXVA 4MH0E 4HCNB 4ARIA 4JQWC 2LUEA 4JE3B 4MJSA 1YJ1A 3QHTA 1WM2A 2MQJA 2YEPF 3AE2B 1E0ZA 1FMAD 3PREA 4WQMA 2XEWA 3RNBC 1QOFA 1RFAA 4A9AA 3ZKJC 2L0TA 4GMVA 2GBJA 1JWUD 2FCSA 1NVID 1YJJA 2K1FA 4YSZB 2KLCA 3BK1A 3FILA 3DCGA 1I35A 2PPHA 2UU7A 4FJVB 1WXMA 1WRIA 2J0MA 1SBBB 1TIFA 4ARCA 4WJNA 2PLPA 2WGSA 3BZDB 2AWTA 1IBXA 4B0EA 4ZHPA 1U4AA 4XWTA 1IGCA 1OEYA 3L10B 1QF6A 1JRUA 2INPE 3T9LA 1UNSA 3U30A 2WXRA 3QCAA 3ALBA 4HK2A 1XCTL 2N7JA 3A4SC 5HFYA 4C56C 3BY4B 4NZLB 3VDZA 1AW7A 4FN2A 1GC6A 1WJUA 2HD5B 2IGDA 1NI2A 3N32A 4AOFA 1TS2A 4NY0A 3OJ4B 3W2DA 3FAHA 2AQ3B 3A1QB 4A3PA 5G2NA 2DBYA 2IGHA 5BYQA 2D3GA 3MJ5A 4LDTB 4MH8A 3ML9A 5EE0A 1UWXA 2M0XA 4KZCA 4FA6A 1ET9A 4LCDE 3TEYA 5BYSA 3DWMA 3ZNID 4ASWC 3R8BA 4KKIA 4YSXB 5JHBA 3KH0A 2FCMA 4IOIE 4WWPA 5H92C 4HWIB 4MDKE 2QMTA 5AEKB 2MBHA 2JQRB 1YNTE 2N9KA 2V9HA 3R2IA 2IGGA 3NS8A 4ICVA 1EU4A 2MHJA 5IO9A 2MA9B 2KVZA 2M1MA 4A20A 2PKOA 4MM3B 2BB6A 4WQOB 2MX2A 2GBNA 2LJ5A 5JXVA 3M63B 4TV3A 2D10A 1C4CA 4ZDVA 2RDBC 1HTOA 1ZOYB 3BINA 3OG5A 1WGKA 4FHKA 4MGZE 3A9KA 1NI3A 3NOBA 2IZVB 2LGYA 4A8XC 1WIAA 3I3TB 1D4BA 5D6JB 2L0FA 1SIJA 1DOIA 2WWZA 1FFUA 2H89B 3EC8A 2KWCA 4II2B 3ML8A 3VTUA 4M02A 3PRZA 2JVCA 1UUPA 4B6WA 5C2TB 4BVUC 1J8CA 4R3DA 1I4XA 2PE9A 3NJTA 4QAYA 4K7SA 3UINB 4IG7B 4PK1A 2XK5B 1A5RA 4AUQC 4BKTA 2KQ4X 3PO0A 1DYQA 3K9PB 5C1ZA 1SE3A 4EUTA 4TUUA 4HPLB 4KGTA 3DBLB 2D2QA 3URYA 1XCQL 3NVWA 1QOBA 3Q3OC 3VTVA 2MP2B 2N1VA 2INNE 2V3SA 3O65B 5HKHA 2KD0A 1L5PA 1C1YB 2RD0A 3RFZB 1FRDA 3L54A 3N1XC 4ICUA 3P4SB 4PS7A 3AXCA 2MJDA 3M3JA 3D32A 2LVQA 1F2RC 1WJNA 2OJRA 4IWPA 4GDLB 3Q3MC 1N60A 4P6VF 1KLVA 3H8HA 1L0YB 2O2VB 3B2GA 4AWJA 3PZDA 2WYQA 5EDSA 4N59A 2QDFA 2DZJA 1WGGA 1TY2A 1YMHE 2ZVOA 2BS2B 2N1WA 3MTNB 2ZNVC 3WAPA 3WA0A 3ZNHB 4F7ZA 3B2FA 3NVYA 1FRRA 2QSDA 4JL9A 2BS3B 2G4DB 3I63C 2W55A 5CHVC 1G6JA 1VZ7A 2JF5A 1OGWA 1E7UA 2BGFA 1WMHA 1WJ6A 1PGBA 1RLFA 2W54A 4II3B 4WAAA 1D5MC 3PTFC 1HE8A 1E7VA 2NVUI 3H7PB 2G1EA 3VUYA 4IM3A 3L16A 2L1AA 3ZQ4A 3NVVA 4W9EA 1SGHA 2DYMA 4RMAA 2WXJA 4GIVA 4NAWA 4FXCA 2HJ1A 4OVUA 1K52A 3TMPB 2CHXA 3PRPB 4US9A 3OWEB 1C9FA 1I4QA 1UBQA 1ZDXA 4MSMB 2D11A 2JZPA 2KQSA 2DZIA 1MI0A 2V3PA 2JYTA 2J4XA 4GDKA 3MHSD 1KLUD 2N9LA 3HHMA 2RMMA 4DDGD 1M4VA 4KGRA 1D3ZA 3RNAC 2NPTB 4GB9A 1IPGA 4FBJB 3SFEB 1AYFA 2KANA 1Q1OA 3ZNZB 3JSVA 3JW0X 1Z2MA 2WXPA 2I1JA 4JX1C 2L32A 2WXOA 4KZ0A 1JCKB 4HVBA 4P1BC 2IY0B 1K53A 2KMAA 4YXDB 3UIPB 2IJ0A 4OZBA 3PPAA 3L13A 2Z59B 4YWGG 3U52E 3RMKC 5IN7A 1L6UA 4JIOU 3PZ8A 2HTHA 4FHJA 4C7ZA 4N58A 1LM8B 1VJKA 1NEKB 3VRBB 4LJPB 1YQ3B 5E6OA 4W9CA 2FCNA 4YT0B 4BBNF 1DOXA 1UGMA 4F1SA 4WJQA 5BYRA 2M56B 3KWLA 3DOWA 3HM6X 2K8CA 1WYWB 4D2KA 1SF0A 2NMQA 4K3CA 1E6EB 4RNAA 3NS1A 2KX3A 4AP4C 3I57A 4EFOA 3TSSA 1OQYA 1T0RC 3N30A 5J17A 2N0SB 5FKAC 1EWYC 2L76A 2PEAA 4Q2JA 3ZDMC 2LVOA 2N4FA 3RCZA 1CZPA 5FK9C 5FR6A 3RNEC 2INDC 1NYRA 2WLBA 5IKCM 2EMTA 1E8YA 2V4IB 3WAMA 3AU5A 1PUTA 4BFRA 3IBEA 2LASA 1CMXB 2N7EA 4RGNA 2JWUA 2Z8LA 3X23A 1VZ6A 1YX6B 3ZLZA 3DPDA 1L4DB 4PYUA 2MLBA 3A33B 3DBLI 4HPMB 1E8WA 3EA6A 4B95A 3GE8C 4ACFA 1S3SG 2JYEA 3IFWB 4MGKE 3M62B 3PHXB 1JW9D 1VD2A 1H8CA 4WIPA 4TQ1A 1RAXA 2A5UA 4E3CA 1GJZA 2WHIA 3TCAA 1L0VB 1PGXA 4ZOHC 3ZTCA 1WGHA 2ZCBA 3I5JC 2JRHA 3AE4B 2NTSA 4NJ7A 4C4VB 1HTQA 1J19A 1FNVA 4G50A 3NHEB 3PSEB 2XN9C 4EZLA 2IY1B 3AE9B 4C7YA 4USAA 2UYZB 2WXIA 4EKUA 4IDIA 2BB5A 3A9JB 1L7YA 3ONSA 1VDVA 4BKGA 2RDGA 2CS4A 3RNCC 1MJDA 2MH7A 2BVCA 2Y5CA 2WX1A 2ZNVB 2KACA 2KC1A 4KIKB 1EF5A 3ZJUA 3U7DA 4WWOA 2ICIA 3SDLC 3DBRI 4L2YA 1F1HA 2LEKA 2Z0EB 5EE9A 2C5LC 2IO1B 3AU4A 1XEEA 2DENB 3BVGA 1E8XA 2C7NB 1TGZB 4LLGM 3TJPA 4RF0A 2W3SA 1XF5L 3R3MA 5C23A 3Q8BA 1VR9A 4HJKA 4CYEA 2KWDA 3KQ4A 1I4PA 4OW0A 2OHFA 1E5WA 3R66C 4W9IA 4YTMB 2FIDA 3M95A 3E9SA 2AX5A 3DBSA 3U2SC 3ZGZA 4S17A 2KJ6A 2REXA 1TBEA 3QX1A 5G5GA 1MVKA 1K50A 2BYTA 4XGAB 1D6EC 2FUG1 2PIAA 1D5ZC 4HCPB 1C79A 2LXAA 2OJWA 2MWSB 2MBQA 4HROA 1GG3A 3MFGA 1WWTA 4XE0A 1UWMA 3ZW3A 1DGJA 1ESFA 1BT0A 5I4DA 1C78A 2K22A 5AZGA 4EOYA 3HRDD 3P63A 3DBHB 5DCNA 3DDCB 1VCBA 5HHDG 3CSTA 3ENEA 4HDOA 2PTLA 4XYCA 1VZ8A 5DPRA 1XXGA 1UELA 2K39A 4I6NB 2G45B 4F8CB 4ZHOA 3V6CB 3NZSA 1IP9A 3X0WA 2ZPNA 3PT2B 1RRBA 2N7DA 2BQQA 2RGFA 1OQQA 5TR5A 1F0ZA 2J53A 2LHEA 2M4NA 3MHZA 3AB5A 1JQ4A 2LXCA 4KX6B 5AUIA 2LWPA 3TEXA 3WAOA 1LQBA 2KO3A 2ACZB 4ANVA 2LGIA 2VZKD 4GN1A 1WX8A 4RCOA 3U4EG 4HKZE 2K6DB 1L6VA 3P4QB 3IT4B 3WALA 2KDMA 4P1CC 3ZNGC 2MBEA 2ZVNA 4XDCA 2K0PA 3AE7B 4K7WA 4WAFA 4CO7A 2JUOA 3N1ZC 1V1PA 4MACA 4PYZA 1JRPA 1ACCA 2O6VD 1GOZA 1TS3A 3CF6E 1WI0A 3TIXA 2WDTB 1VLBA 1QOAA 1YN5A 4HXDA 5HG2A 2JU6X 3KUDB 3Q3FA 4KSKC 2LGSA 2V4LA 1V6EA 3AEDB 2C60A 5E6PA 4W9DA 4IM0A 1WM3A 4ZRIA 1FM0D 1GPXA 1EO6A 2KJHB 1QILA 5LXHA 2KLGA 4CQNA 1C3TA 2MJEA 2W82A 3W1SA 5D2MB 3APFA 1TKGA 2KTFA 3VQIA 4LNKA 1MHXA 4IWOA 2KFKB 2Z0DB 1YQBA 3U8ZA 2GMIC 2PE6B 2ZPYA 2KJRA 3EGRA 3SR6A 5T8IA 2OOBB 2UWQA 2R2OA 1KM7A 3HUIA 3RUIB 1UBIA 1Y8RC 3QQ8B 5G55A 1TT5B 1WGDA 4NPNA 3P1MA 5EE3A 4IC7B 2KWVB 3AEGB 2RPQA 1SE9A 1B9RA 1I4RA 1WXSA 4LNNA 1V9JA 2E6XA 3B08A 1V2YA 1MG8A 2B3AA 2W9NA 2NR2A 3VH3B 1TTNA 2KTRB 4S0RA 2LRWA 1FIQA 4MEMA 2G4SA 2IO0B 1HZ6A 2M17A 2IO3B 4EEWA 2FBWB 4LNIA 2DHZA 2IBIB 4W9HA 2BF8B 1QQRA 1KH0A 2O6VA 2WXKA 2L7RA 1SJHD 1PGAA 3UI3A 4W9GA 1F2RI 3PRMB 5CTRC 4REZA 4BOZB 3EFCA 2BWFA 2ON8A 3SFDB 1IGDA 3O13A 1WXVA 2K8BA 5J2RA 3SEBA 2QCZA 1GAQB 1PFDA 4ANXA 2ZW0A 1V5OA 3TUOA 3FKYA 3SD5A 4BZAA 4KV2A 4OHJA 3AEEB 3IHPC 1JMLA 3W1YA 2G3QB 3P4PB 1EUVB 4PS8A 4K3BA 3ZO5B 5BMHA 3ZJVA 4P7IA 3AI5A 2HE7A 4XZ4A 5MPOA 2ZCCA 3ABVB 1AN8A 4YTPB 3AH7A 1MFWA 1ET6A 4FULA 4ZRPA 3V62A 4HJGE 2CJOA 1WY8A 3CMMB 2BKFA 2JXXA 1JWBD 1MHHE 1LO5D 1N63A 4LDTD 3VVWB 2NBUA 5FR3A 2HJ8A 3DHIC 3BK2A 2OEDA 3QA8A 1E7PB 2LGDA 3GS2A 4PT5A 1GNUA 2JSVX 2MSED 3KUZA 3RZFA 4DHJB 2C7MB 5J18A 3R7RA 4TMAB 2DYBA 5JZEB 3DVGX 1P0RA 2MRPA 1YOVB 1LFDA 1V81A 4M0WB 1F9JA 2BYEA 2KQ7A 3GB1A 2NBWB 5LXIB 1WR6E 2E3TA 3P2BA 2KT7A 3DHGC 2BYFA 3DBHI 2PVOD 1WGYA 1XLQA 2HTME 1TKYA 3HK0A 2MBOA 2DNFA 3Q8EA 1ENFA 2KYWA 3MC8A 2CU3A 3MC0B 4AQ7A 3V61A 4A3OA 3T3OA 4MJSB 1WXQA 4ZRQA 4BAXA 4OVZA 1N62A 2BPSA 1SE2A 2WX0A 1N61A 1TJEA 3AE1B 4N6EB 4DXFA 3PGEA 1YD8U 3B1LX 4GU2A 1TY0A 4MGYE 1KF6B 1L4ZB 3Q3JA 1QT9A 1E90A 3A1QA 2JT4B 4FLHA 2L00B 2DWQA 2J0KA 1ROEA 3ZUNA 4IUMB 2LGXA 1FFVA 1ZGUB 4OZAA 3FILB 1V86A 3RYTA 2ZW1A 2WDQB 5D7GA 1QKZA 2PVGC 3BVMA 1BMLC 3RN9C 1MG4A 1V80A 2KNBA 4HPPA 4KDIC 4ITKA 1IBXB 1F77A 4YTNB 3ZYYX 2BKRB 2KFJA 4N9F4 2J7QB 1C77A 2WXQA 3I9V1 2WDRB 4MM3A 3SU8X 1YIWA 2ASQA 5TSSA 2R2QA 1UF0A 3VH4B 3CSFA 5LNK1 1R7SA 3GOEA 1FEHA 2GRIA 3QJZA 4HEA1 4BKSD 2QJLA 1L0XB 3LB8C 3E56A 2CHWA 4AJWA 4URKA 2LZ6A 1E8ZA 2WXLA 3ETRA 3Q8FA 4UDUC 3RNFC 4DXAB 2CU1A 4ANUA 1J0GA 1LGRA 3RT3B 3PS6A 3ZVVA 2ZZPB 1T6BX 1KOTA 1JWAD 2KMMA 1BXTA 3PLUA 3IXSA 2L83A 1ZXIA 3W5VB 3UGBB 1SSNA 3APCA 2HDEA 4RGMA 2IYDB 4L23A 5D94A 4MSQB 2FNJB 2XK5A 3ECIA 4RFBA 4LNFA 4MELA 4WURA 3AE3B 1C4PA 1QOGA 3IG3A 3A9KB 1Z5SB 1DOYA 3GZNB 3BYTB 3H7SA 2MP2A 1CK1A 1YJIA 3BWUD 1XO3A 1IUEA 2K3UA 1XLPA 1XLOA 2DYOA 3AE8B 2YLMA 5JHAA 2X38A 3IAM1 4GDLA 1WZ0A 4RM9A 3BVZA 4XX5A 3AE5B 4BKSA 2O2VA 1V49A 1GUAB 1ZUD2 4OZCA 3EUB2 4AS1A 4NAMA 4FJZA 3N20C 2RSUA 4DBGA 4TSSA 3AMZA 3PHWB 1HA5A 2D5GA 2EMSA 2J0JA 4MGIE 3TL5A 3W9CB 1FNWA 3SHQA 4LTUA 5BO4B 1WR1A 4IKGA 3ZTDA 4FADA 3H6NA 2AQ1B 5DPSA 4EZKA 2FCQA 3QIJA 1SB3C 3H7PA 1UH6A 1M94A 4M8NA 1FPYA 4PS3A 4RGOS 2XBBC 4RM8A 4MT5A 1AARA 1EU3A 3MC9A 2YEPB 1ZW7A 1WE7A 1TS4A 3Q2AC 2INCC 4EE2A 1TYGB 1A70A 2FIFA 1VRAB 4XWWA 1GC7A 3PV1A 2JWZA 3AEFB 4IM2A 2D3AA 1C4AA 2CR5A 3VR8B 2WXNA 3KWVA 1PDXA 1J7CA 2VH2A 2L8JA 2AQ2B 1P7FA 3JVZX 2KX0A 5BMGA 3MJWA 3H9DA 2H88B 1R4MB 4TQ0A 2KAJA 4JLCA 3K9OB 1WMHB 2NPTA 4RF1A 4W9FA 3TEZA 2KN4A 2KC2A 1JWMD 3WANA 3FC4A 3DWGC 4JWUC 4NQLB 2NCNA 4DHZE 1GB1A 2LFIA 3C0RB 1T0YA 1WH3A 3NUHB 3T8MA 4JGHB 4NAWB 2AEHA 4KGSA 1V8CA 2GOWA 4HDQA 2JZ3B 1WX9A 5D3IB 3PVLA 1KLGD 1HXYD 3KVFB 2JZZA 3CWIA 2Q5WD 2BW2A 1H4RA 3APDA 2KDEB 1YX5B 2I1KA 4GDKB 3IT6B 2NBVB 2JY6A 1T5XD 1MPEA 5C3JB 2M0AA 3QARA 2X8XX 2B76B 4ZRJA 1FCCC 3W5UB 1XQQA 5EE1A 5CX3A 3VFKA 3PLVA 5HI1A 4GLSC 3JSVB 1HEZE 4BBNC 1CQVA 1XT9B 1N6ZA 2SAKA 4DHZB 2BS4B 3Q8AA 5H8YE 4XDDA 4WJOA 4DDID 2I2YA 3N3KB 4J6IA 4H2AA 2KDBA 4IWQA 2C7HA 4CHKA 2L3ZA 2LRUA 4WWMA 2QC8A 4ZYNA 2KOXA 5JH5C 1ZE3D 4A55A 2JXTA 1BUIC 3AEAB 4TKNA 3RD2A 1HZ5A 2D07B 3L0WB 4KSLC 2K9XA 1OEYJ 1SXTA 2BBCA 2JRIB 1RFKA 5BMIA 2VH1A 1B1ZA 2CKHB 1UGJA 2GI9A 1FXTB 4W9LA 1Y56A 2WU2B 1NDDA 2AYOB 3LXFA 2TSSA 3HIZA 2FAZA 3ZRCA 2J42A 4HLEA 1WYGA 1WXAA 3GZNI 4B9KA 4K1RB 3W1SC 1P7EA 2IDYA 1WJ4A 3VUXA 1N5WA 1F52A 4GGQA 2FE8A 2KMCA 1ZP0B 3GE3C 2KZRA 2KK8A 2A4ZA 4FJYA 2ONQA 2BWES 2MCNB 2V0GA 3ZRFA 1TZ1A 4GOCA 5IAAC 4C4VA 2WU5B 1Q0WB 1X1MA 1YN3A 1CJEA 1KRHA 3N9YC 4G0NB 5LLIA 2WNMA 2KDIA 2I38A 3LDZE 2WP9B 2Y5PA 3A4RA 3QAQA 1KTKA 1EM7A 1P3QU 1OFFA 1UD7A 3T3NA 2GBMA 2DAJA 2WQYB 3A9JA 2JPHA 2M19A 2WXHA 2GBRA 1FO4A 1JWSD 2KKCA 4WJPA 4C80A 1KJTA 3LYYA 2BT6A 2KXJA 4AJYB 1XLNA 3HVDA 3JYUA 3DHHC 4KIKA 2LD9A 4L1BA 3C19A 3UQAA 2YVCA 4E74A 2M8SA 3IAS1 3ZJTA 1WZ3A 2FUHB 4WWNA 1HQRD 1V1OA 2IO2B 2Y3AA 5L95C 5DPTA 3Q6BA 1JALA 3NZ3A 1YN4A 2CHZA 3R2TA 2LI5A 5D3DA 4I6LB 3GP7A 3KYCD 3B0AA 1TS5A 3BYYB 4NNJB 2D3BA 2MJ3A 3VR9B 1S1QB 5G5HA 3UF8A 3AN1A 1K51A 4WH4A 2Y5BB 3L4PA 3RNGC 4DK5A 4US8A 1I4HA 4JPSA 2AL6A 5CHFA 1JROA 2DLBA 3R7QA 1YQ4B 2KVRA 2V1YA 1R4NB 1PQSA 2LMCA 1R4MI 3ZXRA 1NENB 2WXFA 3UQBA 4KDLB 3IVFA 2MBBB 5GXGB 4E71A 3P4RB 4W9KA 3TBLD 1IYFA 4J3OD 1SE4A 2QIEB 3NY5A 3DBRB 1P9DU 5KHQA 4M8MA 1E9MA 4IW0A 4O1NA 3ZDTA 3QK0A 1ZKHA 2LHDA 2RR9A 2KWUB 2LVPA 2XNAC 3Q69A 4A6QA 2D3CA 5E6NA 1SJED 2KDFB 4M01A 2DZMA
chains in the Genus database with same CATH topology
5HHDG 4WURA 3AE3B 1C4PA 1FFUA 1QOGA 2PTLA 2H89B 1VZ8A 1XXGA 1EWCA 4ZHOA 2QEJC 3NRZA 3RPFC 1UUPA 1DOYA 1FD6A 1ZXHA 3BYTB 5C2TB 1CK1A 2GB1A 4R3DA 1I4XA 3AE6B 1YJIA 1SEBD 1OQQA 3BWUD 1F0ZA 1XO3A 2J53A 1IUEA 2K3UA 2LHEA 3MHZA 3AB5A 1XLPA 2QILA 1XLOA 2BTEA 1JQ4A 2DYOA 2RDHA 3AE8B 2X38A 4JWSC 2KQ4X 4NJCA 4DQOC 3PO0A 4KX6B 1FXAA 1DYQA 5AUIA 1KFYB 3TEXA 3IAM1 1SE3A 2ACZB 2LGIA 2VZKD 4KGTA 4RCOA 3U4EG 3URYA 3BVZA 2IPKD 4HKZE 1XCQL 3NVWA 1Q10A 3AE5B 1L6VA 2L52A 3P4QB 3B9JA 3IT4B 3CIRB 1QOBA 1WSPA 2JX5A 1AWDA 2KDMA 1ZUD2 2INNE 4OZCA 3EUB2 2K0PA 4NAMA 1L5PA 3AE7B 4XDCA 4AS1A 1PYWD 3RFZB 1FRDA 4WAFA 1TZOA 4TSSA 3AMZA 3P4SB 5E6JA 3AM9A 1HA5A 2D5GA 2LUMA 1V97A 2MJDA 1V1PA 4MACA 1JRPA 1ACCA 3W9CB 4KKJA 1F2RC 1FNWA 1GOZA 1GB4A 4GDLB 1TS3A 1VLBA 1N60A 1STEA 4P6VF 1QOAA 1YN5A 4LTUA 4RGTA 3H8HA 5HG2A 2JU6X 1L0YB 3B2GA 4IKGA 2AQ1B 3AEDB 4N59A 2WXGA 4ZYSA 2G9HD 1SB3C 1FM0D 1GPXA 1TY2A 1YMHE 1QILA 1FNUA 2R61A 2BS2B 1V1PB 4RGOS 4CQNA 2V3NA 3U7ZA 2MJEA 2W82A 3W1SA 1FCLA 4MT5A 1EU3A 1I7HA 3B2FA 3NVYA 1TKGA 2YEPB 3VQIA 1FRRA 2QSDA 2BS3B 1MHXA 1RWSA 1TS4A 1RM6C 1C76A 2W55A 4EE2A 1TYGB 1A70A 1VRAB 3P42A 4XWWA 3EGRA 1OQRA 4DXGA 1VZ7A 3AEBB 3SR6A 5T8IA 2W54A 1PGBA 3AEFB 1D5MC 3PZ7A 3HUIA 1C4AA 3VR8B 2G1EA 1ZPSA 2WXNA 3KWVA 1PDXA 1J7CA 1T3QA 2L1AA 3ZQ4A 3NVVA 2AQ2B 1P7FA 3P1MA 1D5XC 5EE3A 2J52A 3AEGB 2DYMA 1B9RA 1I4RA 5BMGA 1FXIA 4RH6A 2WXJA 2E6XA 2H88B 1RYJA 4TQ0A 4FXCA 4P16A 2KAJA 3VRAB 1K52A 4RF1A 4US9A 3OWEB 3TEZA 1N5XA 2KN4A 1C9FA 1JWMD 1I4QA 1FIQA 3KLSX 3HVZA 1ZDXA 1HZ6A 2JZPA 2FBWB 3FC4A 3DWGC 4JWUC 4LK0M 3NVZA 1MI0A 3WCQA 2LJIA 2JYTA 2J4XA 2LFIA 2V3PA 1GB1A 1QQRA 1KH0A 1KLUD 2WXKA 2N9LA 2RMMA 2VZKB 1M4VA 1SJHD 3NUHB 1PGAA 3UI3A 3J9CA 4NAWB 1J7AA 1F2RI 4KGRA 2SEBD 1V8CA 4KGSA 4REZA 2ON8A 2W3RA 3TEWA 3V3XA 3SFDB 5D3IB 1IGDA 3O13A 3SFEB 2NTTA 4A90A 1KLGD 1HXYD 1AYFA 3SEBA 1J7BA 1GAQB 3CWIA 3V05A 1PFDA 2ZW0A 2Q5WD 4HKQA 2BW2A 2PW9A 1NYQA 2WXPA 3TUOA 4JX1C 2L32A 4GDKB 4OHJA 2WXOA 3AEEB 3IT6B 1JMLA 3MP9A 1JCKB 1T5XD 1MPEA 3P4PB 1K53A 5C3JB 4YXDB 2IJ0A 3AECB 2M0AA 5BMHA 3BIID 4OZBA 2EKIA 3ZJVA 2RPVA 2WDVB 5MPOA 4YWGG 3U52E 2MEKA 3Q8CA 2B76B 1FCCC 3W5UB 3ABVB 5EE1A 1L6UA 4YSYB 1AN8A 3PZ8A 4YTPB 3AH7A 5AUKA 1ET6A 2EELA 2WS3B 5HI1A 4GLSC 4C7ZA 4ZRPA 1E10A 1HEZE 4N58A 4HJGE 2CJOA 1CQVA 1VJKA 2K5PA 1NEKB 2SAKA 4HRSA 3VRBB 4M0WA 1YQ3B 2BS4B 1JWBD 1QLBB 1MHHE 1LO5D 1N63A 3Q8AA 5H8YE 5FR3A 4XDDA 3BK2A 4YT0B 2I2YA 1DOXA 2OEDA 1E7PB 5BYRA 1I4GA 2M56B 3KWLA 1TKEA 4H2AA 3GS2A 4PT5A 2PMVA 2JSVX 4WWMA 1ZDVA 2WXMA 4B0MA 3AV8A 4TMAB 1SF0A 2NMQA 3C8YA 4D2KA 1ZE3D 2CJNA 1E6EB 4A55A 2JXTA 4RNAA 1BUIC 3AEAB 3NS1A 1HZ5A 3I57A 4ARIA 3GB1A 2K9XA 3TSSA 1SXTA 2BBCA 4JE3B 1RFKA 5BMIA 2E3TA 1B1ZA 2N0SB 5FKAC 1EWYC 4Q2JA 1UGJA 2GI9A 2PVOD 1XLQA 2YEPF 3AE2B 1Y56A 1CZPA 2WU2B 5FK9C 2HTME 1E0ZA 1TKYA 1FMAD 3LXFA 3Q8EA 2TSSA 1NYRA 4WQMA 2WLBA 2V4IB 2J42A 1QOFA 1WYGA 4A9AA 1PUTA 1ENFA 1JWUD 2CU3A 1NVID 1YJJA 3MC0B 1P7EA 4AQ7A 2IDYA 4YSZB 1N5WA 3T3OA 1WXQA 3BK1A 4ZRQA 2FE8A 3FILA 4OVZA 1ZP0B 1N62A 1SE2A 4RGNA 1N61A 1TJEA 2JWUA 2Z8LA 1VZ6A 3AE1B 2ONQA 4N6EB 2V0GA 1L4DB 4DXFA 1WRIA 1TY0A 1KF6B 1SBBB 4ARCA 2WU5B 1L4ZB 2PLPA 3EA6A 1YN3A 3BZDB 1QT9A 1IBXA 1CJEA 1KRHA 3N9YC 4B0EA 2JYEA 4ZHPA 2DWQA 2WNMA 4XWTA 1IGCA 1JW9D 1ROEA 4WIPA 1QF6A 4TQ1A 2INPE 1FFVA 1UNSA 2I38A 4OZAA 3FILB 2WP9B 2WXRA 2ZW1A 2Y5PA 2WDQB 1KTKA 1QKZA 5D7GA 1EM7A 1XCTL 2N7JA 1L0VB 1OFFA 1PGXA 2PVGC 3BVMA 1BMLC 4ZOHC 5HFYA 4C56C 3T3NA 4NZLB 1AW7A 2WQYB 2IGDA 3AE4B 2NTSA 2M19A 1TS2A 2WXHA 4ITKA 1FO4A 1JWSD 1FNVA 3W2DA 3FAHA 1IBXB 2AQ3B 1F77A 4YTNB 4C80A 3ZYYX 2DBYA 3LYYA 2IGHA 5BYQA 2BT6A 1XLNA 2XN9C 3HVDA 4L1BA 3MJ5A 1C77A 3AE9B 4MH8A 5EE0A 4C7YA 4USAA 3IAS1 3ZJTA 1UWXA 2WXQA 2WXIA 1ET9A 1HQRD 3TEYA 1V1OA 5BYSA 4IDIA 3I9V1 2Y3AA 3DWMA 2WDRB 2BB5A 1JALA 1VDVA 3NZ3A 2RDGA 5TSSA 3R8BA 1YN4A 4KKIA 4YSXB 3R2TA 2MH7A 5D3DA 3GP7A 2Y5CA 1TS5A 4IOIE 2KACA 5H92C 5LNK1 3BYYB 2MJ3A 1R7SA 2QMTA 3ZJUA 2ICIA 2JQRB 4L2YA 3VR9B 5G5HA 1YNTE 2N9KA 2LEKA 5EE9A 3R2IA 2IGGA 3AN1A 1FEHA 1K51A 2GRIA 4WH4A 4HEA1 3L4PA 1EU4A 1XEEA 3BVGA 4US8A 2QJLA 1L0XB 3LB8C 1I4HA 3E56A 4LLGM 4JPSA 2W3SA 4RF0A 1JROA 1XF5L 2PKOA 3Q8BA 1VR9A 2DLBA 4MM3B 1YQ4B 2KWDA 3KQ4A 2BB6A 1I4PA 4OW0A 2OHFA 2LMCA 5JXVA 4YTMB 2WXLA 3ETRA 3Q8FA 3E9SA 4UDUC 1C4CA 1NENB 2AX5A 2WXFA 3U2SC 3ZGZA 5GXGB 5G5GA 1MVKA 1ZOYB 3P4RB 4J3OD 1K50A 1SE4A 1WGKA 2BYTA 1T6BX 2QIEB 1E9MA 1JWAD 1D6EC 2FUG1 2KMMA 2PIAA 1D5ZC 1BXTA 3IXSA 4O1NA 1C79A 2L83A 1NI3A 2LHDA 4HROA 1ZXIA 3W5VB 1SSNA 3MFGA 1WWTA 4A8XC 4XE0A 1UWMA 2HDEA 4RGMA 1D4BA 1DGJA 2XNAC 3Q69A 1ESFA 4A6QA 5I4DA 4L23A 1C78A 2K22A 3HRDD 1SJED 1SIJA 3P63A 4RFBA 1DOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQY B;  5H8Y E;  2W54 A;  3AEF B;  3AE4 B;  4YT0 B;  3AE3 B;  1FFU A;  3HUI A;  1QOG A;  1DOX A;  2H89 B;  2M19 A;  1E7P B;  4ITK A;  3VR8 B;  2G1E A;  4ZHO A;  1FO4 A;  3NRZ A;  1PDX A;  1J7C A;  1T3Q A;  2M56 B;  3FAH A;  3KWL A;  4YTN B;  3RPF C;  1TKE A;  2DBY A;  3ZYY X;  4C80 A;  3NVV A;  1DOY A;  2BT6 A;  5C2T B;  1XLN A;  3P1M A;  4WWM A;  5EE3 A;  3AEG B;  3AV8 A;  1SF0 A;  3AE6 B;  1YJI A;  3AE9 B;  1B9R A;  2CJN A;  1OQQ A;  5EE0 A;  1E6E B;  1F0Z A;  1XO3 A;  1FXI A;  1IUE A;  4USA A;  4C7Y A;  3AB5 A;  1XLP A;  1XLO A;  2H88 B;  3AEA B;  3NS1 A;  1JQ4 A;  1RYJ A;  3AE8 B;  4JWS C;  4FXC A;  4IDI A;  3DWM A;  2KAJ A;  2WDR B;  3PO0 A;  4KX6 B;  1FXA A;  3VRA B;  5AUI A;  2K9X A;  1KFY B;  1JAL A;  4US9 A;  1VDV A;  1N5X A;  2ACZ B;  4YSX B;  1RFK A;  2MH7 A;  2E3T A;  1FIQ A;  2N0S B;  3NVW A;  3HVZ A;  2Y5C A;  3AE5 B;  1EWY C;  1L6V A;  2L52 A;  3P4Q B;  2PVO D;  3B9J A;  1XLQ A;  1QOB A;  3CIR B;  5H92 C;  2FBW B;  3FC4 A;  2JX5 A;  3DWG C;  4JWU C;  3AE2 B;  1AWD A;  1R7S A;  1CZP A;  2MJ3 A;  2WU2 B;  3NVZ A;  1ZUD 2;  2HTM E;  2JQR B;  3VR9 B;  1TKY A;  3EUB 2;  5G5H A;  1L5P A;  3AE7 B;  3WCQ A;  1E0Z A;  1FMA D;  2LEK A;  3LXF A;  5EE9 A;  3AN1 A;  1NYR A;  4WQM A;  2WLB A;  1FRD A;  3L4P A;  3AMZ A;  3P4S B;  3AM9 A;  2QJL A;  1QOF A;  4US8 A;  3LB8 C;  1WYG A;  4A9A A;  1PUT A;  1V97 A;  2MJD A;  1J7A A;  2W3S A;  1JRO A;  1JRP A;  2PKO A;  2CU3 A;  1V8C A;  1NVI D;  3W9C B;  1YJJ A;  1YQ4 B;  2W3R A;  3SFD B;  4YSZ B;  1N5W A;  1WXQ A;  1DOI A;  3SFE B;  2OHF A;  1VLB A;  1AYF A;  1N60 A;  1ZP0 B;  4YTM B;  4P6V F;  1N62 A;  1QOA A;  4LTU A;  1J7B A;  3ETR A;  1GAQ B;  3CWI A;  1NEN B;  1PFD A;  1N61 A;  1TJE A;  2AX5 A;  3B2G A;  3AE1 B;  2Q5W D;  1NYQ A;  4N6E B;  4JX1 C;  5GXG B;  5G5G A;  3AED B;  4N59 A;  1WRI A;  1ZOY B;  3P4R B;  3AEE B;  1WGK A;  1KF6 B;  1SB3 C;  2QIE B;  1FM0 D;  1GPX A;  1E9M A;  1JWA D;  2WU5 B;  3P4P B;  2KMM A;  2PIA A;  5C3J B;  4YXD B;  3AEC B;  1QT9 A;  1CJE A;  3BII D;  2BS2 B;  1KRH A;  2EKI A;  4ZHP A;  2L83 A;  1NI3 A;  2DWQ A;  2MJE A;  2WDV B;  4HRO A;  1ZXI A;  5MPO A;  3W5V B;  1JW9 D;  2B76 B;  1ROE A;  3W5U B;  1I7H A;  1WWT A;  3ABV B;  3B2F A;  1TKG A;  1L6U A;  1UWM A;  3NVY A;  5EE1 A;  1FFV A;  4YSY B;  1DGJ A;  4YTP B;  3AH7 A;  1FRR A;  2WP9 B;  5AUK A;  2BS3 B;  2WS3 B;  4C7Z A;  2WDQ B;  1E10 A;  1RWS A;  1RM6 C;  2K22 A;  2W55 A;  4N58 A;  1QF6 A;  1TYG B;  3HRD D;  2CJO A;  1SIJ A;  1A70 A;  1L0V B;  1OFF A;  1VJK A;  2K5P A;  2PVG C;  3P63 A;  4ZOH C;  1NEK B;  4HRS A;  3VRB B;  1OQR A;  3AEB B;  3SR6 A;  1YQ3 B;  2BS4 B;  1JWB D;  1QLB B;  1N63 A; 
#chains in the Genus database with same CATH topology
 3LJ3 A;  1T0Q C;  3VUW A;  4EZJ A;  2PJH A;  1EWC A;  2QEJ C;  3NRZ A;  3RPF C;  1FD6 A;  1ZXH A;  4W9J A;  2QHO A;  2GB1 A;  4OVV A;  1T0S C;  3AE6 B;  1SEB D;  4DWF A;  3Q14 C;  2GBK A;  2QIL A;  2BTE A;  4G11 A;  2RDH A;  4KVG B;  3V60 A;  4JWS C;  3KW5 B;  4NJC A;  4DQO C;  2L05 A;  1FXA A;  1KFY B;  2N9E B;  4LJO B;  4M00 A;  4BOS C;  2K6Q A;  2IPK D;  2N9X A;  4I6P A;  1Q10 A;  2L52 A;  4NQK E;  3B9J A;  3CIR B;  1WSP A;  3DVN U;  3EFU A;  2JX5 A;  1AWD A;  2N9P C;  2C9W B;  4YL8 A;  1Q5W B;  1PYW D;  1TZO A;  5E6J A;  3AM9 A;  2LUM A;  1V97 A;  3H1U A;  4KKJ A;  2NS5 A;  1GB4 A;  3Q3N C;  4C00 A;  2KN5 A;  1STE A;  4RGT A;  2KFK A;  1NBF C;  1WE6 A;  3QWZ B;  2ZJD A;  3NG0 A;  2WXG A;  4ZYS A;  2G9H D;  1QZE A;  1WFY A;  5AZH A;  4ZRK A;  5IOI A;  1FNU A;  2R61 A;  1V1P B;  2V3N A;  3V6E B;  3U7Z A;  1FCL A;  1I7H A;  3WIM A;  1SIF A;  2K25 A;  2ZEQ A;  4NJ6 A;  1RWS A;  4GSW A;  1RM6 C;  1C76 A;  2EKE C;  4LNO A;  4DHJ D;  3P42 A;  1OQR A;  3VXW A;  4G3X B;  3AEB B;  4DXG A;  3DVG Y;  3PZ7 A;  2GLS A;  5CHW A;  5L83 A;  2KTR A;  1ZPS A;  1T3Q A;  5AZF A;  1OTR B;  3VTW A;  3KYD D;  4ANW A;  1D5X C;  2J52 A;  3UIO B;  1FXI A;  5GMV A;  4RH6 A;  3N1Y C;  1RYJ A;  2BYV E;  4K7U A;  4P16 A;  3VRA B;  3S2A A;  3OAW A;  5IP4 D;  1N5X A;  1ISN A;  3EEC A;  3KLS X;  3HVZ A;  5IA7 A;  4LK0 M;  2KHW B;  3NVZ A;  3WCQ A;  2LJI A;  3RI7 C;  3DVN V;  4K81 A;  3OJ3 A;  2VZK B;  2MW5 A;  3J9C A;  3VAW A;  1J7A A;  3L17 A;  2SEB D;  2W3R A;  2DZK A;  3TEW A;  3V3X A;  2AL3 A;  2NTT A;  4A90 A;  3NZU A;  1UZX B;  3OLM D;  1J7B A;  3RZW C;  3V05 A;  4HKQ A;  2PW9 A;  1NYQ A;  1K8R B;  1L2N A;  2DAF A;  2O6V B;  1XD3 B;  1WX7 A;  3DQV A;  3MP9 A;  3HM3 A;  3RUL A;  3AEC B;  1V5T A;  3BII D;  3KUC B;  2EKI A;  2RPV A;  3VHT C;  1EF1 A;  3L08 A;  2WDV B;  2MEK A;  3Q8C A;  4GXB A;  4YSY B;  5AUK A;  2EEL A;  2WS3 B;  3AUL A;  1WRD B;  2K8H A;  1E10 A;  2K5P A;  4HRS A;  4M0W A;  1QLB B;  1P1A A;  3QC8 B;  1R4N I;  1P98 A;  4XC2 A;  3EHV A;  2DX5 B;  1I4G A;  1TKE A;  5KHO A;  2PMV A;  1LXD A;  1ZDV A;  1WGR A;  2WXM A;  4B0M A;  3AV8 A;  3ZIM A;  3C8Y A;  5DPW A;  2CJN A;  2VRR B;  4X57 B;  1WF9 A;  1I42 A;  3ZXV A;  4MH0 E;  4HCN B;  4ARI A;  4JQW C;  2LUE A;  4JE3 B;  4MJS A;  1YJ1 A;  3QHT A;  1WM2 A;  2MQJ A;  2YEP F;  3AE2 B;  1E0Z A;  1FMA D;  3PRE A;  4WQM A;  2XEW A;  3RNB C;  1QOF A;  1RFA A;  4A9A A;  3ZKJ C;  2L0T A;  4GMV A;  2GBJ A;  1JWU D;  2FCS A;  1NVI D;  1YJJ A;  2K1F A;  4YSZ B;  2KLC A;  3BK1 A;  3FIL A;  3DCG A;  1I35 A;  2PPH A;  2UU7 A;  4FJV B;  1WXM A;  1WRI A;  2J0M A;  1SBB B;  1TIF A;  4ARC A;  4WJN A;  2PLP A;  2WGS A;  3BZD B;  2AWT A;  1IBX A;  4B0E A;  4ZHP A;  1U4A A;  4XWT A;  1IGC A;  1OEY A;  3L10 B;  1QF6 A;  1JRU A;  2INP E;  3T9L A;  1UNS A;  3U30 A;  2WXR A;  3QCA A;  3ALB A;  4HK2 A;  1XCT L;  2N7J A;  3A4S C;  5HFY A;  4C56 C;  3BY4 B;  4NZL B;  3VDZ A;  1AW7 A;  4FN2 A;  1GC6 A;  1WJU A;  2HD5 B;  2IGD A;  1NI2 A;  3N32 A;  4AOF A;  1TS2 A;  4NY0 A;  3OJ4 B;  3W2D A;  3FAH A;  2AQ3 B;  3A1Q B;  4A3P A;  5G2N A;  2DBY A;  2IGH A;  5BYQ A;  2D3G A;  3MJ5 A;  4LDT B;  4MH8 A;  3ML9 A;  5EE0 A;  1UWX A;  2M0X A;  4KZC A;  4FA6 A;  1ET9 A;  4LCD E;  3TEY A;  5BYS A;  3DWM A;  3ZNI D;  4ASW C;  3R8B A;  4KKI A;  4YSX B;  5JHB A;  3KH0 A;  2FCM A;  4IOI E;  4WWP A;  5H92 C;  4HWI B;  4MDK E;  2QMT A;  5AEK B;  2MBH A;  2JQR B;  1YNT E;  2N9K A;  2V9H A;  3R2I A;  2IGG A;  3NS8 A;  4ICV A;  1EU4 A;  2MHJ A;  5IO9 A;  2MA9 B;  2KVZ A;  2M1M A;  4A20 A;  2PKO A;  4MM3 B;  2BB6 A;  4WQO B;  2MX2 A;  2GBN A;  2LJ5 A;  5JXV A;  3M63 B;  4TV3 A;  2D10 A;  1C4C A;  4ZDV A;  2RDB C;  1HTO A;  1ZOY B;  3BIN A;  3OG5 A;  1WGK A;  4FHK A;  4MGZ E;  3A9K A;  1NI3 A;  3NOB A;  2IZV B;  2LGY A;  4A8X C;  1WIA A;  3I3T B;  1D4B A;  5D6J B;  2L0F A;  1SIJ A;  1DOI A;  2WWZ A;  1FFU A;  2H89 B;  3EC8 A;  2KWC A;  4II2 B;  3ML8 A;  3VTU A;  4M02 A;  3PRZ A;  2JVC A;  1UUP A;  4B6W A;  5C2T B;  4BVU C;  1J8C A;  4R3D A;  1I4X A;  2PE9 A;  3NJT A;  4QAY A;  4K7S A;  3UIN B;  4IG7 B;  4PK1 A;  2XK5 B;  1A5R A;  4AUQ C;  4BKT A;  2KQ4 X;  3PO0 A;  1DYQ A;  3K9P B;  5C1Z A;  1SE3 A;  4EUT A;  4TUU A;  4HPL B;  4KGT A;  3DBL B;  2D2Q A;  3URY A;  1XCQ L;  3NVW A;  1QOB A;  3Q3O C;  3VTV A;  2MP2 B;  2N1V A;  2INN E;  2V3S A;  3O65 B;  5HKH A;  2KD0 A;  1L5P A;  1C1Y B;  2RD0 A;  3RFZ B;  1FRD A;  3L54 A;  3N1X C;  4ICU A;  3P4S B;  4PS7 A;  3AXC A;  2MJD A;  3M3J A;  3D32 A;  2LVQ A;  1F2R C;  1WJN A;  2OJR A;  4IWP A;  4GDL B;  3Q3M C;  1N60 A;  4P6V F;  1KLV A;  3H8H A;  1L0Y B;  2O2V B;  3B2G A;  4AWJ A;  3PZD A;  2WYQ A;  5EDS A;  4N59 A;  2QDF A;  2DZJ A;  1WGG A;  1TY2 A;  1YMH E;  2ZVO A;  2BS2 B;  2N1W A;  3MTN B;  2ZNV C;  3WAP A;  3WA0 A;  3ZNH B;  4F7Z A;  3B2F A;  3NVY A;  1FRR A;  2QSD A;  4JL9 A;  2BS3 B;  2G4D B;  3I63 C;  2W55 A;  5CHV C;  1G6J A;  1VZ7 A;  2JF5 A;  1OGW A;  1E7U A;  2BGF A;  1WMH A;  1WJ6 A;  1PGB A;  1RLF A;  2W54 A;  4II3 B;  4WAA A;  1D5M C;  3PTF C;  1HE8 A;  1E7V A;  2NVU I;  3H7P B;  2G1E A;  3VUY A;  4IM3 A;  3L16 A;  2L1A A;  3ZQ4 A;  3NVV A;  4W9E A;  1SGH A;  2DYM A;  4RMA A;  2WXJ A;  4GIV A;  4NAW A;  4FXC A;  2HJ1 A;  4OVU A;  1K52 A;  3TMP B;  2CHX A;  3PRP B;  4US9 A;  3OWE B;  1C9F A;  1I4Q A;  1UBQ A;  1ZDX A;  4MSM B;  2D11 A;  2JZP A;  2KQS A;  2DZI A;  1MI0 A;  2V3P A;  2JYT A;  2J4X A;  4GDK A;  3MHS D;  1KLU D;  2N9L A;  3HHM A;  2RMM A;  4DDG D;  1M4V A;  4KGR A;  1D3Z A;  3RNA C;  2NPT B;  4GB9 A;  1IPG A;  4FBJ B;  3SFE B;  1AYF A;  2KAN A;  1Q1O A;  3ZNZ B;  3JSV A;  3JW0 X;  1Z2M A;  2WXP A;  2I1J A;  4JX1 C;  2L32 A;  2WXO A;  4KZ0 A;  1JCK B;  4HVB A;  4P1B C;  2IY0 B;  1K53 A;  2KMA A;  4YXD B;  3UIP B;  2IJ0 A;  4OZB A;  3PPA A;  3L13 A;  2Z59 B;  4YWG G;  3U52 E;  3RMK C;  5IN7 A;  1L6U A;  4JIO U;  3PZ8 A;  2HTH A;  4FHJ A;  4C7Z A;  4N58 A;  1LM8 B;  1VJK A;  1NEK B;  3VRB B;  4LJP B;  1YQ3 B;  5E6O A;  4W9C A;  2FCN A;  4YT0 B;  4BBN F;  1DOX A;  1UGM A;  4F1S A;  4WJQ A;  5BYR A;  2M56 B;  3KWL A;  3DOW A;  3HM6 X;  2K8C A;  1WYW B;  4D2K A;  1SF0 A;  2NMQ A;  4K3C A;  1E6E B;  4RNA A;  3NS1 A;  2KX3 A;  4AP4 C;  3I57 A;  4EFO A;  3TSS A;  1OQY A;  1T0R C;  3N30 A;  5J17 A;  2N0S B;  5FKA C;  1EWY C;  2L76 A;  2PEA A;  4Q2J A;  3ZDM C;  2LVO A;  2N4F A;  3RCZ A;  1CZP A;  5FK9 C;  5FR6 A;  3RNE C;  2IND C;  1NYR A;  2WLB A;  5IKC M;  2EMT A;  1E8Y A;  2V4I B;  3WAM A;  3AU5 A;  1PUT A;  4BFR A;  3IBE A;  2LAS A;  1CMX B;  2N7E A;  4RGN A;  2JWU A;  2Z8L A;  3X23 A;  1VZ6 A;  1YX6 B;  3ZLZ A;  3DPD A;  1L4D B;  4PYU A;  2MLB A;  3A33 B;  3DBL I;  4HPM B;  1E8W A;  3EA6 A;  4B95 A;  3GE8 C;  4ACF A;  1S3S G;  2JYE A;  3IFW B;  4MGK E;  3M62 B;  3PHX B;  1JW9 D;  1VD2 A;  1H8C A;  4WIP A;  4TQ1 A;  1RAX A;  2A5U A;  4E3C A;  1GJZ A;  2WHI A;  3TCA A;  1L0V B;  1PGX A;  4ZOH C;  3ZTC A;  1WGH A;  2ZCB A;  3I5J C;  2JRH A;  3AE4 B;  2NTS A;  4NJ7 A;  4C4V B;  1HTQ A;  1J19 A;  1FNV A;  4G50 A;  3NHE B;  3PSE B;  2XN9 C;  4EZL A;  2IY1 B;  3AE9 B;  4C7Y A;  4USA A;  2UYZ B;  2WXI A;  4EKU A;  4IDI A;  2BB5 A;  3A9J B;  1L7Y A;  3ONS A;  1VDV A;  4BKG A;  2RDG A;  2CS4 A;  3RNC C;  1MJD A;  2MH7 A;  2BVC A;  2Y5C A;  2WX1 A;  2ZNV B;  2KAC A;  2KC1 A;  4KIK B;  1EF5 A;  3ZJU A;  3U7D A;  4WWO A;  2ICI A;  3SDL C;  3DBR I;  4L2Y A;  1F1H A;  2LEK A;  2Z0E B;  5EE9 A;  2C5L C;  2IO1 B;  3AU4 A;  1XEE A;  2DEN B;  3BVG A;  1E8X A;  2C7N B;  1TGZ B;  4LLG M;  3TJP A;  4RF0 A;  2W3S A;  1XF5 L;  3R3M A;  5C23 A;  3Q8B A;  1VR9 A;  4HJK A;  4CYE A;  2KWD A;  3KQ4 A;  1I4P A;  4OW0 A;  2OHF A;  1E5W A;  3R66 C;  4W9I A;  4YTM B;  2FID A;  3M95 A;  3E9S A;  2AX5 A;  3DBS A;  3U2S C;  3ZGZ A;  4S17 A;  2KJ6 A;  2REX A;  1TBE A;  3QX1 A;  5G5G A;  1MVK A;  1K50 A;  2BYT A;  4XGA B;  1D6E C;  2FUG 1;  2PIA A;  1D5Z C;  4HCP B;  1C79 A;  2LXA A;  2OJW A;  2MWS B;  2MBQ A;  4HRO A;  1GG3 A;  3MFG A;  1WWT A;  4XE0 A;  1UWM A;  3ZW3 A;  1DGJ A;  1ESF A;  1BT0 A;  5I4D A;  1C78 A;  2K22 A;  5AZG A;  4EOY A;  3HRD D;  3P63 A;  3DBH B;  5DCN A;  3DDC B;  1VCB A;  5HHD G;  3CST A;  3ENE A;  4HDO A;  2PTL A;  4XYC A;  1VZ8 A;  5DPR A;  1XXG A;  1UEL A;  2K39 A;  4I6N B;  2G45 B;  4F8C B;  4ZHO A;  3V6C B;  3NZS A;  1IP9 A;  3X0W A;  2ZPN A;  3PT2 B;  1RRB A;  2N7D A;  2BQQ A;  2RGF A;  1OQQ A;  5TR5 A;  1F0Z A;  2J53 A;  2LHE A;  2M4N A;  3MHZ A;  3AB5 A;  1JQ4 A;  2LXC A;  4KX6 B;  5AUI A;  2LWP A;  3TEX A;  3WAO A;  1LQB A;  2KO3 A;  2ACZ B;  4ANV A;  2LGI A;  2VZK D;  4GN1 A;  1WX8 A;  4RCO A;  3U4E G;  4HKZ E;  2K6D B;  1L6V A;  3P4Q B;  3IT4 B;  3WAL A;  2KDM A;  4P1C C;  3ZNG C;  2MBE A;  2ZVN A;  4XDC A;  2K0P A;  3AE7 B;  4K7W A;  4WAF A;  4CO7 A;  2JUO A;  3N1Z C;  1V1P A;  4MAC A;  4PYZ A;  1JRP A;  1ACC A;  2O6V D;  1GOZ A;  1TS3 A;  3CF6 E;  1WI0 A;  3TIX A;  2WDT B;  1VLB A;  1QOA A;  1YN5 A;  4HXD A;  5HG2 A;  2JU6 X;  3KUD B;  3Q3F A;  4KSK C;  2LGS A;  2V4L A;  1V6E A;  3AED B;  2C60 A;  5E6P A;  4W9D A;  4IM0 A;  1WM3 A;  4ZRI A;  1FM0 D;  1GPX A;  1EO6 A;  2KJH B;  1QIL A;  5LXH A;  2KLG A;  4CQN A;  1C3T A;  2MJE A;  2W82 A;  3W1S A;  5D2M B;  3APF A;  1TKG A;  2KTF A;  3VQI A;  4LNK A;  1MHX A;  4IWO A;  2KFK B;  2Z0D B;  1YQB A;  3U8Z A;  2GMI C;  2PE6 B;  2ZPY A;  2KJR A;  3EGR A;  3SR6 A;  5T8I A;  2OOB B;  2UWQ A;  2R2O A;  1KM7 A;  3HUI A;  3RUI B;  1UBI A;  1Y8R C;  3QQ8 B;  5G55 A;  1TT5 B;  1WGD A;  4NPN A;  3P1M A;  5EE3 A;  4IC7 B;  2KWV B;  3AEG B;  2RPQ A;  1SE9 A;  1B9R A;  1I4R A;  1WXS A;  4LNN A;  1V9J A;  2E6X A;  3B08 A;  1V2Y A;  1MG8 A;  2B3A A;  2W9N A;  2NR2 A;  3VH3 B;  1TTN A;  2KTR B;  4S0R A;  2LRW A;  1FIQ A;  4MEM A;  2G4S A;  2IO0 B;  1HZ6 A;  2M17 A;  2IO3 B;  4EEW A;  2FBW B;  4LNI A;  2DHZ A;  2IBI B;  4W9H A;  2BF8 B;  1QQR A;  1KH0 A;  2O6V A;  2WXK A;  2L7R A;  1SJH D;  1PGA A;  3UI3 A;  4W9G A;  1F2R I;  3PRM B;  5CTR C;  4REZ A;  4BOZ B;  3EFC A;  2BWF A;  2ON8 A;  3SFD B;  1IGD A;  3O13 A;  1WXV A;  2K8B A;  5J2R A;  3SEB A;  2QCZ A;  1GAQ B;  1PFD A;  4ANX A;  2ZW0 A;  1V5O A;  3TUO A;  3FKY A;  3SD5 A;  4BZA A;  4KV2 A;  4OHJ A;  3AEE B;  3IHP C;  1JML A;  3W1Y A;  2G3Q B;  3P4P B;  1EUV B;  4PS8 A;  4K3B A;  3ZO5 B;  5BMH A;  3ZJV A;  4P7I A;  3AI5 A;  2HE7 A;  4XZ4 A;  5MPO A;  2ZCC A;  3ABV B;  1AN8 A;  4YTP B;  3AH7 A;  1MFW A;  1ET6 A;  4FUL A;  4ZRP A;  3V62 A;  4HJG E;  2CJO A;  1WY8 A;  3CMM B;  2BKF A;  2JXX A;  1JWB D;  1MHH E;  1LO5 D;  1N63 A;  4LDT D;  3VVW B;  2NBU A;  5FR3 A;  2HJ8 A;  3DHI C;  3BK2 A;  2OED A;  3QA8 A;  1E7P B;  2LGD A;  3GS2 A;  4PT5 A;  1GNU A;  2JSV X;  2MSE D;  3KUZ A;  3RZF A;  4DHJ B;  2C7M B;  5J18 A;  3R7R A;  4TMA B;  2DYB A;  5JZE B;  3DVG X;  1P0R A;  2MRP A;  1YOV B;  1LFD A;  1V81 A;  4M0W B;  1F9J A;  2BYE A;  2KQ7 A;  3GB1 A;  2NBW B;  5LXI B;  1WR6 E;  2E3T A;  3P2B A;  2KT7 A;  3DHG C;  2BYF A;  3DBH I;  2PVO D;  1WGY A;  1XLQ A;  2HTM E;  1TKY A;  3HK0 A;  2MBO A;  2DNF A;  3Q8E A;  1ENF A;  2KYW A;  3MC8 A;  2CU3 A;  3MC0 B;  4AQ7 A;  3V61 A;  4A3O A;  3T3O A;  4MJS B;  1WXQ A;  4ZRQ A;  4BAX A;  4OVZ A;  1N62 A;  2BPS A;  1SE2 A;  2WX0 A;  1N61 A;  1TJE A;  3AE1 B;  4N6E B;  4DXF A;  3PGE A;  1YD8 U;  3B1L X;  4GU2 A;  1TY0 A;  4MGY E;  1KF6 B;  1L4Z B;  3Q3J A;  1QT9 A;  1E90 A;  3A1Q A;  2JT4 B;  4FLH A;  2L00 B;  2DWQ A;  2J0K A;  1ROE A;  3ZUN A;  4IUM B;  2LGX A;  1FFV A;  1ZGU B;  4OZA A;  3FIL B;  1V86 A;  3RYT A;  2ZW1 A;  2WDQ B;  5D7G A;  1QKZ A;  2PVG C;  3BVM A;  1BML C;  3RN9 C;  1MG4 A;  1V80 A;  2KNB A;  4HPP A;  4KDI C;  4ITK A;  1IBX B;  1F77 A;  4YTN B;  3ZYY X;  2BKR B;  2KFJ A;  4N9F 4;  2J7Q B;  1C77 A;  2WXQ A;  3I9V 1;  2WDR B;  4MM3 A;  3SU8 X;  1YIW A;  2ASQ A;  5TSS A;  2R2Q A;  1UF0 A;  3VH4 B;  3CSF A;  5LNK 1;  1R7S A;  3GOE A;  1FEH A;  2GRI A;  3QJZ A;  4HEA 1;  4BKS D;  2QJL A;  1L0X B;  3LB8 C;  3E56 A;  2CHW A;  4AJW A;  4URK A;  2LZ6 A;  1E8Z A;  2WXL A;  3ETR A;  3Q8F A;  4UDU C;  3RNF C;  4DXA B;  2CU1 A;  4ANU A;  1J0G A;  1LGR A;  3RT3 B;  3PS6 A;  3ZVV A;  2ZZP B;  1T6B X;  1KOT A;  1JWA D;  2KMM A;  1BXT A;  3PLU A;  3IXS A;  2L83 A;  1ZXI A;  3W5V B;  3UGB B;  1SSN A;  3APC A;  2HDE A;  4RGM A;  2IYD B;  4L23 A;  5D94 A;  4MSQ B;  2FNJ B;  2XK5 A;  3ECI A;  4RFB A;  4LNF A;  4MEL A;  4WUR A;  3AE3 B;  1C4P A;  1QOG A;  3IG3 A;  3A9K B;  1Z5S B;  1DOY A;  3GZN B;  3BYT B;  3H7S A;  2MP2 A;  1CK1 A;  1YJI A;  3BWU D;  1XO3 A;  1IUE A;  2K3U A;  1XLP A;  1XLO A;  2DYO A;  3AE8 B;  2YLM A;  5JHA A;  2X38 A;  3IAM 1;  4GDL A;  1WZ0 A;  4RM9 A;  3BVZ A;  4XX5 A;  3AE5 B;  4BKS A;  2O2V A;  1V49 A;  1GUA B;  1ZUD 2;  4OZC A;  3EUB 2;  4AS1 A;  4NAM A;  4FJZ A;  3N20 C;  2RSU A;  4DBG A;  4TSS A;  3AMZ A;  3PHW B;  1HA5 A;  2D5G A;  2EMS A;  2J0J A;  4MGI E;  3TL5 A;  3W9C B;  1FNW A;  3SHQ A;  4LTU A;  5BO4 B;  1WR1 A;  4IKG A;  3ZTD A;  4FAD A;  3H6N A;  2AQ1 B;  5DPS A;  4EZK A;  2FCQ A;  3QIJ A;  1SB3 C;  3H7P A;  1UH6 A;  1M94 A;  4M8N A;  1FPY A;  4PS3 A;  4RGO S;  2XBB C;  4RM8 A;  4MT5 A;  1AAR A;  1EU3 A;  3MC9 A;  2YEP B;  1ZW7 A;  1WE7 A;  1TS4 A;  3Q2A C;  2INC C;  4EE2 A;  1TYG B;  1A70 A;  2FIF A;  1VRA B;  4XWW A;  1GC7 A;  3PV1 A;  2JWZ A;  3AEF B;  4IM2 A;  2D3A A;  1C4A A;  2CR5 A;  3VR8 B;  2WXN A;  3KWV A;  1PDX A;  1J7C A;  2VH2 A;  2L8J A;  2AQ2 B;  1P7F A;  3JVZ X;  2KX0 A;  5BMG A;  3MJW A;  3H9D A;  2H88 B;  1R4M B;  4TQ0 A;  2KAJ A;  4JLC A;  3K9O B;  1WMH B;  2NPT A;  4RF1 A;  4W9F A;  3TEZ A;  2KN4 A;  2KC2 A;  1JWM D;  3WAN A;  3FC4 A;  3DWG C;  4JWU C;  4NQL B;  2NCN A;  4DHZ E;  1GB1 A;  2LFI A;  3C0R B;  1T0Y A;  1WH3 A;  3NUH B;  3T8M A;  4JGH B;  4NAW B;  2AEH A;  4KGS A;  1V8C A;  2GOW A;  4HDQ A;  2JZ3 B;  1WX9 A;  5D3I B;  3PVL A;  1KLG D;  1HXY D;  3KVF B;  2JZZ A;  3CWI A;  2Q5W D;  2BW2 A;  1H4R A;  3APD A;  2KDE B;  1YX5 B;  2I1K A;  4GDK B;  3IT6 B;  2NBV B;  2JY6 A;  1T5X D;  1MPE A;  5C3J B;  2M0A A;  3QAR A;  2X8X X;  2B76 B;  4ZRJ A;  1FCC C;  3W5U B;  1XQQ A;  5EE1 A;  5CX3 A;  3VFK A;  3PLV A;  5HI1 A;  4GLS C;  3JSV B;  1HEZ E;  4BBN C;  1CQV A;  1XT9 B;  1N6Z A;  2SAK A;  4DHZ B;  2BS4 B;  3Q8A A;  5H8Y E;  4XDD A;  4WJO A;  4DDI D;  2I2Y A;  3N3K B;  4J6I A;  4H2A A;  2KDB A;  4IWQ A;  2C7H A;  4CHK A;  2L3Z A;  2LRU A;  4WWM A;  2QC8 A;  4ZYN A;  2KOX A;  5JH5 C;  1ZE3 D;  4A55 A;  2JXT A;  1BUI C;  3AEA B;  4TKN A;  3RD2 A;  1HZ5 A;  2D07 B;  3L0W B;  4KSL C;  2K9X A;  1OEY J;  1SXT A;  2BBC A;  2JRI B;  1RFK A;  5BMI A;  2VH1 A;  1B1Z A;  2CKH B;  1UGJ A;  2GI9 A;  1FXT B;  4W9L A;  1Y56 A;  2WU2 B;  1NDD A;  2AYO B;  3LXF A;  2TSS A;  3HIZ A;  2FAZ A;  3ZRC A;  2J42 A;  4HLE A;  1WYG A;  1WXA A;  3GZN I;  4B9K A;  4K1R B;  3W1S C;  1P7E A;  2IDY A;  1WJ4 A;  3VUX A;  1N5W A;  1F52 A;  4GGQ A;  2FE8 A;  2KMC A;  1ZP0 B;  3GE3 C;  2KZR A;  2KK8 A;  2A4Z A;  4FJY A;  2ONQ A;  2BWE S;  2MCN B;  2V0G A;  3ZRF A;  1TZ1 A;  4GOC A;  5IAA C;  4C4V A;  2WU5 B;  1Q0W B;  1X1M A;  1YN3 A;  1CJE A;  1KRH A;  3N9Y C;  4G0N B;  5LLI A;  2WNM A;  2KDI A;  2I38 A;  3LDZ E;  2WP9 B;  2Y5P A;  3A4R A;  3QAQ A;  1KTK A;  1EM7 A;  1P3Q U;  1OFF A;  1UD7 A;  3T3N A;  2GBM A;  2DAJ A;  2WQY B;  3A9J A;  2JPH A;  2M19 A;  2WXH A;  2GBR A;  1FO4 A;  1JWS D;  2KKC A;  4WJP A;  4C80 A;  1KJT A;  3LYY A;  2BT6 A;  2KXJ A;  4AJY B;  1XLN A;  3HVD A;  3JYU A;  3DHH C;  4KIK A;  2LD9 A;  4L1B A;  3C19 A;  3UQA A;  2YVC A;  4E74 A;  2M8S A;  3IAS 1;  3ZJT A;  1WZ3 A;  2FUH B;  4WWN A;  1HQR D;  1V1O A;  2IO2 B;  2Y3A A;  5L95 C;  5DPT A;  3Q6B A;  1JAL A;  3NZ3 A;  1YN4 A;  2CHZ A;  3R2T A;  2LI5 A;  5D3D A;  4I6L B;  3GP7 A;  3KYC D;  3B0A A;  1TS5 A;  3BYY B;  4NNJ B;  2D3B A;  2MJ3 A;  3VR9 B;  1S1Q B;  5G5H A;  3UF8 A;  3AN1 A;  1K51 A;  4WH4 A;  2Y5B B;  3L4P A;  3RNG C;  4DK5 A;  4US8 A;  1I4H A;  4JPS A;  2AL6 A;  5CHF A;  1JRO A;  2DLB A;  3R7Q A;  1YQ4 B;  2KVR A;  2V1Y A;  1R4N B;  1PQS A;  2LMC A;  1R4M I;  3ZXR A;  1NEN B;  2WXF A;  3UQB A;  4KDL B;  3IVF A;  2MBB B;  5GXG B;  4E71 A;  3P4R B;  4W9K A;  3TBL D;  1IYF A;  4J3O D;  1SE4 A;  2QIE B;  3NY5 A;  3DBR B;  1P9D U;  5KHQ A;  4M8M A;  1E9M A;  4IW0 A;  4O1N A;  3ZDT A;  3QK0 A;  1ZKH A;  2LHD A;  2RR9 A;  2KWU B;  2LVP A;  2XNA C;  3Q69 A;  4A6Q A;  2D3C A;  5E6N A;  1SJE D;  2KDF B;  4M01 A;  2DZM A; 
#chains in the Genus database with same CATH homology
 5HHD G;  4WUR A;  3AE3 B;  1C4P A;  1FFU A;  1QOG A;  2PTL A;  2H89 B;  1VZ8 A;  1XXG A;  1EWC A;  4ZHO A;  2QEJ C;  3NRZ A;  3RPF C;  1UUP A;  1DOY A;  1FD6 A;  1ZXH A;  3BYT B;  5C2T B;  1CK1 A;  2GB1 A;  4R3D A;  1I4X A;  3AE6 B;  1YJI A;  1SEB D;  1OQQ A;  3BWU D;  1F0Z A;  1XO3 A;  2J53 A;  1IUE A;  2K3U A;  2LHE A;  3MHZ A;  3AB5 A;  1XLP A;  2QIL A;  1XLO A;  2BTE A;  1JQ4 A;  2DYO A;  2RDH A;  3AE8 B;  2X38 A;  4JWS C;  2KQ4 X;  4NJC A;  4DQO C;  3PO0 A;  4KX6 B;  1FXA A;  1DYQ A;  5AUI A;  1KFY B;  3TEX A;  3IAM 1;  1SE3 A;  2ACZ B;  2LGI A;  2VZK D;  4KGT A;  4RCO A;  3U4E G;  3URY A;  3BVZ A;  2IPK D;  4HKZ E;  1XCQ L;  3NVW A;  1Q10 A;  3AE5 B;  1L6V A;  2L52 A;  3P4Q B;  3B9J A;  3IT4 B;  3CIR B;  1QOB A;  1WSP A;  2JX5 A;  1AWD A;  2KDM A;  1ZUD 2;  2INN E;  4OZC A;  3EUB 2;  2K0P A;  4NAM A;  1L5P A;  3AE7 B;  4XDC A;  4AS1 A;  1PYW D;  3RFZ B;  1FRD A;  4WAF A;  1TZO A;  4TSS A;  3AMZ A;  3P4S B;  5E6J A;  3AM9 A;  1HA5 A;  2D5G A;  2LUM A;  1V97 A;  2MJD A;  1V1P A;  4MAC A;  1JRP A;  1ACC A;  3W9C B;  4KKJ A;  1F2R C;  1FNW A;  1GOZ A;  1GB4 A;  4GDL B;  1TS3 A;  1VLB A;  1N60 A;  1STE A;  4P6V F;  1QOA A;  1YN5 A;  4LTU A;  4RGT A;  3H8H A;  5HG2 A;  2JU6 X;  1L0Y B;  3B2G A;  4IKG A;  2AQ1 B;  3AED B;  4N59 A;  2WXG A;  4ZYS A;  2G9H D;  1SB3 C;  1FM0 D;  1GPX A;  1TY2 A;  1YMH E;  1QIL A;  1FNU A;  2R61 A;  2BS2 B;  1V1P B;  4RGO S;  4CQN A;  2V3N A;  3U7Z A;  2MJE A;  2W82 A;  3W1S A;  1FCL A;  4MT5 A;  1EU3 A;  1I7H A;  3B2F A;  3NVY A;  1TKG A;  2YEP B;  3VQI A;  1FRR A;  2QSD A;  2BS3 B;  1MHX A;  1RWS A;  1TS4 A;  1RM6 C;  1C76 A;  2W55 A;  4EE2 A;  1TYG B;  1A70 A;  1VRA B;  3P42 A;  4XWW A;  3EGR A;  1OQR A;  4DXG A;  1VZ7 A;  3AEB B;  3SR6 A;  5T8I A;  2W54 A;  1PGB A;  3AEF B;  1D5M C;  3PZ7 A;  3HUI A;  1C4A A;  3VR8 B;  2G1E A;  1ZPS A;  2WXN A;  3KWV A;  1PDX A;  1J7C A;  1T3Q A;  2L1A A;  3ZQ4 A;  3NVV A;  2AQ2 B;  1P7F A;  3P1M A;  1D5X C;  5EE3 A;  2J52 A;  3AEG B;  2DYM A;  1B9R A;  1I4R A;  5BMG A;  1FXI A;  4RH6 A;  2WXJ A;  2E6X A;  2H88 B;  1RYJ A;  4TQ0 A;  4FXC A;  4P16 A;  2KAJ A;  3VRA B;  1K52 A;  4RF1 A;  4US9 A;  3OWE B;  3TEZ A;  1N5X A;  2KN4 A;  1C9F A;  1JWM D;  1I4Q A;  1FIQ A;  3KLS X;  3HVZ A;  1ZDX A;  1HZ6 A;  2JZP A;  2FBW B;  3FC4 A;  3DWG C;  4JWU C;  4LK0 M;  3NVZ A;  1MI0 A;  3WCQ A;  2LJI A;  2JYT A;  2J4X A;  2LFI A;  2V3P A;  1GB1 A;  1QQR A;  1KH0 A;  1KLU D;  2WXK A;  2N9L A;  2RMM A;  2VZK B;  1M4V A;  1SJH D;  3NUH B;  1PGA A;  3UI3 A;  3J9C A;  4NAW B;  1J7A A;  1F2R I;  4KGR A;  2SEB D;  1V8C A;  4KGS A;  4REZ A;  2ON8 A;  2W3R A;  3TEW A;  3V3X A;  3SFD B;  5D3I B;  1IGD A;  3O13 A;  3SFE B;  2NTT A;  4A90 A;  1KLG D;  1HXY D;  1AYF A;  3SEB A;  1J7B A;  1GAQ B;  3CWI A;  3V05 A;  1PFD A;  2ZW0 A;  2Q5W D;  4HKQ A;  2BW2 A;  2PW9 A;  1NYQ A;  2WXP A;  3TUO A;  4JX1 C;  2L32 A;  4GDK B;  4OHJ A;  2WXO A;  3AEE B;  3IT6 B;  1JML A;  3MP9 A;  1JCK B;  1T5X D;  1MPE A;  3P4P B;  1K53 A;  5C3J B;  4YXD B;  2IJ0 A;  3AEC B;  2M0A A;  5BMH A;  3BII D;  4OZB A;  2EKI A;  3ZJV A;  2RPV A;  2WDV B;  5MPO A;  4YWG G;  3U52 E;  2MEK A;  3Q8C A;  2B76 B;  1FCC C;  3W5U B;  3ABV B;  5EE1 A;  1L6U A;  4YSY B;  1AN8 A;  3PZ8 A;  4YTP B;  3AH7 A;  5AUK A;  1ET6 A;  2EEL A;  2WS3 B;  5HI1 A;  4GLS C;  4C7Z A;  4ZRP A;  1E10 A;  1HEZ E;  4N58 A;  4HJG E;  2CJO A;  1CQV A;  1VJK A;  2K5P A;  1NEK B;  2SAK A;  4HRS A;  3VRB B;  4M0W A;  1YQ3 B;  2BS4 B;  1JWB D;  1QLB B;  1MHH E;  1LO5 D;  1N63 A;  3Q8A A;  5H8Y E;  5FR3 A;  4XDD A;  3BK2 A;  4YT0 B;  2I2Y A;  1DOX A;  2OED A;  1E7P B;  5BYR A;  1I4G A;  2M56 B;  3KWL A;  1TKE A;  4H2A A;  3GS2 A;  4PT5 A;  2PMV A;  2JSV X;  4WWM A;  1ZDV A;  2WXM A;  4B0M A;  3AV8 A;  4TMA B;  1SF0 A;  2NMQ A;  3C8Y A;  4D2K A;  1ZE3 D;  2CJN A;  1E6E B;  4A55 A;  2JXT A;  4RNA A;  1BUI C;  3AEA B;  3NS1 A;  1HZ5 A;  3I57 A;  4ARI A;  3GB1 A;  2K9X A;  3TSS A;  1SXT A;  2BBC A;  4JE3 B;  1RFK A;  5BMI A;  2E3T A;  1B1Z A;  2N0S B;  5FKA C;  1EWY C;  4Q2J A;  1UGJ A;  2GI9 A;  2PVO D;  1XLQ A;  2YEP F;  3AE2 B;  1Y56 A;  1CZP A;  2WU2 B;  5FK9 C;  2HTM E;  1E0Z A;  1TKY A;  1FMA D;  3LXF A;  3Q8E A;  2TSS A;  1NYR A;  4WQM A;  2WLB A;  2V4I B;  2J42 A;  1QOF A;  1WYG A;  4A9A A;  1PUT A;  1ENF A;  1JWU D;  2CU3 A;  1NVI D;  1YJJ A;  3MC0 B;  1P7E A;  4AQ7 A;  2IDY A;  4YSZ B;  1N5W A;  3T3O A;  1WXQ A;  3BK1 A;  4ZRQ A;  2FE8 A;  3FIL A;  4OVZ A;  1ZP0 B;  1N62 A;  1SE2 A;  4RGN A;  1N61 A;  1TJE A;  2JWU A;  2Z8L A;  1VZ6 A;  3AE1 B;  2ONQ A;  4N6E B;  2V0G A;  1L4D B;  4DXF A;  1WRI A;  1TY0 A;  1KF6 B;  1SBB B;  4ARC A;  2WU5 B;  1L4Z B;  2PLP A;  3EA6 A;  1YN3 A;  3BZD B;  1QT9 A;  1IBX A;  1CJE A;  1KRH A;  3N9Y C;  4B0E A;  2JYE A;  4ZHP A;  2DWQ A;  2WNM A;  4XWT A;  1IGC A;  1JW9 D;  1ROE A;  4WIP A;  1QF6 A;  4TQ1 A;  2INP E;  1FFV A;  1UNS A;  2I38 A;  4OZA A;  3FIL B;  2WP9 B;  2WXR A;  2ZW1 A;  2Y5P A;  2WDQ B;  1KTK A;  1QKZ A;  5D7G A;  1EM7 A;  1XCT L;  2N7J A;  1L0V B;  1OFF A;  1PGX A;  2PVG C;  3BVM A;  1BML C;  4ZOH C;  5HFY A;  4C56 C;  3T3N A;  4NZL B;  1AW7 A;  2WQY B;  2IGD A;  3AE4 B;  2NTS A;  2M19 A;  1TS2 A;  2WXH A;  4ITK A;  1FO4 A;  1JWS D;  1FNV A;  3W2D A;  3FAH A;  1IBX B;  2AQ3 B;  1F77 A;  4YTN B;  4C80 A;  3ZYY X;  2DBY A;  3LYY A;  2IGH A;  5BYQ A;  2BT6 A;  1XLN A;  2XN9 C;  3HVD A;  4L1B A;  3MJ5 A;  1C77 A;  3AE9 B;  4MH8 A;  5EE0 A;  4C7Y A;  4USA A;  3IAS 1;  3ZJT A;  1UWX A;  2WXQ A;  2WXI A;  1ET9 A;  1HQR D;  3TEY A;  1V1O A;  5BYS A;  4IDI A;  3I9V 1;  2Y3A A;  3DWM A;  2WDR B;  2BB5 A;  1JAL A;  1VDV A;  3NZ3 A;  2RDG A;  5TSS A;  3R8B A;  1YN4 A;  4KKI A;  4YSX B;  3R2T A;  2MH7 A;  5D3D A;  3GP7 A;  2Y5C A;  1TS5 A;  4IOI E;  2KAC A;  5H92 C;  5LNK 1;  3BYY B;  2MJ3 A;  1R7S A;  2QMT A;  3ZJU A;  2ICI A;  2JQR B;  4L2Y A;  3VR9 B;  5G5H A;  1YNT E;  2N9K A;  2LEK A;  5EE9 A;  3R2I A;  2IGG A;  3AN1 A;  1FEH A;  1K51 A;  2GRI A;  4WH4 A;  4HEA 1;  3L4P A;  1EU4 A;  1XEE A;  3BVG A;  4US8 A;  2QJL A;  1L0X B;  3LB8 C;  1I4H A;  3E56 A;  4LLG M;  4JPS A;  2W3S A;  4RF0 A;  1JRO A;  1XF5 L;  2PKO A;  3Q8B A;  1VR9 A;  2DLB A;  4MM3 B;  1YQ4 B;  2KWD A;  3KQ4 A;  2BB6 A;  1I4P A;  4OW0 A;  2OHF A;  2LMC A;  5JXV A;  4YTM B;  2WXL A;  3ETR A;  3Q8F A;  3E9S A;  4UDU C;  1C4C A;  1NEN B;  2AX5 A;  2WXF A;  3U2S C;  3ZGZ A;  5GXG B;  5G5G A;  1MVK A;  1ZOY B;  3P4R B;  4J3O D;  1K50 A;  1SE4 A;  1WGK A;  2BYT A;  1T6B X;  2QIE B;  1E9M A;  1JWA D;  1D6E C;  2FUG 1;  2KMM A;  2PIA A;  1D5Z C;  1BXT A;  3IXS A;  4O1N A;  1C79 A;  2L83 A;  1NI3 A;  2LHD A;  4HRO A;  1ZXI A;  3W5V B;  1SSN A;  3MFG A;  1WWT A;  4A8X C;  4XE0 A;  1UWM A;  2HDE A;  4RGM A;  1D4B A;  1DGJ A;  2XNA C;  3Q69 A;  1ESF A;  4A6Q A;  5I4D A;  4L23 A;  1C78 A;  2K22 A;  3HRD D;  1SJE D;  1SIJ A;  3P63 A;  4RFB A;  1DOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...