3B2GA

Leptolyngbya boryana ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
b'PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
molecule tags Electron transport
source organism Leptolyngbya boryana
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2gA00
1RFKA 2PVGC 3AEEB 1QOBA 1KFYB 2MJEA 1CZPA 1L0VB 1WRIA 3LB8C 4US8A 1ZUD2 3LXFA 2N0SB 3SFDB 1KRHA 3AE4B 2LEKA 4YTPB 4YSXB 1PDXA 1JWAD 3DWMA 4YSZB 1N61A 4YXDB 1JQ4A 2WDQB 3VRBB 2EKIA 1NI3A 5MPOA 1RWSA 3FC4A 1OFFA 3NRZA 3CWIA 1ZOYB 1XLQA 3FAHA 3L4PA 1TYGB 4JWUC 1NENB 2KAJA 1T3QA 2WQYB 2PIAA 3B2FA 4A9AA 4JWSC 3AB5A 2WDVB 3ETRA 1VDVA 1N60A 2Y5CA 4N6EB 4P6VF 1FFVA 1FO4A 1B9RA 2OHFA 1N63A 1VJKA 3NVZA 1WGKA 4ZOHC 3BIID 1L6UA 1WWTA 1GAQB 3CIRB 1YJJA 2PKOA 1R7SA 1KF6B 3VRAB 1RM6C 5H8YE 1V97A 1QOGA 3AE7B 3AEAB 1FRDA 5G5HA 5C3JB 1F0ZA 1TKEA 1I7HA 1UWMA 1NYQA 3AE3B 2BS2B 2K5PA 1YQ4B 2W3RA 5EE0A 1RYJA 1XO3A 3P4SB 5EE1A 2W55A 3SFEB 3PO0A 3P4RB 2CU3A 4YT0B 4C7YA 2L52A 4ZHOA 1XLOA 5EE3A 1JWBD 1TKYA 3AN1A 3NVWA 1FXAA 2WS3B 1E6EB 2HTME 3AMZA 1WYGA 2WLBA 1FM0D 4HROA 5H92C 4C7ZA 1L6VA 1N5XA 3AV8A 2JQRB 4ITKA 1NYRA 1YJIA 4KX6B 1DOYA 1E7PB 3HUIA 1FRRA 1JROA 2PVOD 1AWDA 4WWMA 4LTUA 1E9MA 2CJNA 1CJEA 3P4QB 3P4PB 4HRSA 3AE8B 2Q5WD 2AX5A 4JX1C 1AYFA 2K22A 2WU5B 4YTNB 3VR9B 3AE5B 2QJLA 1L5PA 2JX5A 3NS1A 1QLBB 5G5GA 5GXGB 4C80A 3HVZA 2BT6A 3VR8B 2MJDA 2W3SA 1SIJA 1TJEA 3P1MA 3W5UB 1VLBA 1QOFA 1ZP0B 5C2TB 3AEGB 3NVYA 1FXIA 3NVVA 1DOXA 2W54A 1XLPA 1N5WA 3SR6A 1E0ZA 3B2GA 1SB3C 3AEDB 3P63A 1A70A 1EWYC 1SF0A 2CJOA 2DWQA 2KMMA 2WDRB 3AE2B 1ROEA 3HRDD 4FXCA 2E3TA 4YSYB 1E10A 2L83A 3AEBB 3AH7A 3AM9A 4US9A 2M19A 1ZXIA 3KWLA 4N58A 2DBYA 1JALA 4WQMA 3RPFC 4ZHPA 1QT9A 2G1EA 2WP9B 3AEFB 1PFDA 2H89B 5EE9A 1IUEA 3W9CB 2MJ3A 5AUKA 1XLNA 4IDIA 3AE6B 3W5VB 2MH7A 1OQQA 2B76B 1J7AA 3AE9B 1JW9D 1WXQA 1NVID 2BS4B 2H88B 4N59A 3B9JA 2WU2B 1YQ3B 5AUIA 2ACZB 1OQRA 3AECB 1N62A 2M56B 1PUTA 1QF6A 1FFUA 1V8CA 2FBWB 1FIQA 3WCQA 1TKGA 1J7CA 1DOIA 1DGJA 3ZYYX 2QIEB 3DWGC 3ABVB 4YTMB 1NEKB 3AE1B 3EUB2 4USAA 2K9XA 1J7BA 1GPXA 1FMAD 1JRPA 1QOAA 2BS3B
chains in the Genus database with same CATH superfamily
3PZ7A 1QOBA 1KFYB 5D3IB 2KMCA 3N1XC 1WGDA 4NPNA 2CHXA 3MHSD 1SSNA 1YNTE 4BKSD 4TQ1A 3IAM1 3IBEA 1TY0A 2G4DB 2NBWB 2EMTA 2N7DA 3ZUNA 4KZ0A 1GAQB 2IGGA 4W9JA 1YN3A 2KTFA 1R4NI 3H7SA 3BZDB 4MH8A 2MBOA 3P2BA 4FADA 3MTNB 2L1AA 3VUYA 1X1MA 4A8XC 3BYYB 2CHZA 3WIMA 4KGTA 3KLSX 5JHAA 2GB1A 2XK5B 5BYRA 4LTUA 2HJ8A 3HHMA 3W2DA 3ZJVA 2Q5WD 4HLEA 1PGBA 2I1JA 4YTNB 4F8CB 1SIJA 3N9YC 2KJ6A 4ANUA 3T8MA 1BMLC 1N6ZA 1EWYC 2CJOA 2HE7A 2L83A 4US9A 2I1KA 2ONQA 5IO9A 1ZKHA 1F2RC 1SE3A 2MJ3A 4IDIA 5DPWA 4M8NA 3RMKC 4QAYA 1NVID 1GB1A 3W1SC 2KWVB 1HZ5A 1WJUA 1TKGA 3ZYYX 1KM7A 3VXWA 1UH6A 4BAXA 5LXIB 2ON8A 1CK1A 4W9GA 2BB5A 3ZO5B 1I4RA 1ZUD2 1GOZA 1XCTL 4RGTA 3U8ZA 1QILA 1FCLA 3DWMA 2KHWB 4A55A 3KVFB 5D3DA 2UU7A 1T5XD 1KTKA 4MACA 3V62A 3R7RA 2OEDA 4JWSC 1N60A 2Y5CA 3PHWB 3OJ3A 4L1BA 5AZGA 3BK1A 1WE7A 2V9HA 5L95C 3AI5A 4N9F4 2REXA 4KDIC 2QC8A 4MM3A 4W9CA 1XD3B 2TSSA 1XO3A 1YN5A 4KZCA 1GB4A 3L0WB 3NHEB 1I4PA 4OVVA 4K7WA 4KIKA 3T3OA 3VR9B 2C7NB 1PGAA 4BKTA 1I4GA 3PRMB 5G5GA 2AQ3B 2YLMA 1C4AA 3NZSA 5C2TB 4WH4A 1MFWA 3RNFC 5BMIA 2GBMA 4GDLB 4YL8A 4KGSA 2V1YA 1SJED 2HD5B 2KXJA 2DZIA 2N4FA 1IUEA 3W9CB 5FR3A 1TT5B 1TIFA 3VTUA 3T3NA 4RH6A 4OVZA 1HTOA 1JW9D 1V1PB 2ZW0A 4REZA 3IVFA 2JRHA 2M0XA 3A1QA 3N30A 1UELA 3RNAC 1FMAD 2WLBA 3BK2A 3VUWA 1R4MI 5DCNA 3RULA 3Q8AA 2ZNVC 2MA9B 4BKGA 1JWAD 1TS5A 1NI3A 2IJ0A 3DVNV 3JVZX 1HA5A 2MSED 2BPSA 1J19A 3KUCB 4LK0M 2OOBB 4ZRJA 5JZEB 2QCZA 3I5JC 2K8CA 4RGNA 1L6UA 1WWTA 1RM6C 1I7HA 1UWMA 2X8XX 2K5PA 3IAS1 1EO6A 1H4RA 1RYJA 3DOWA 3OJ4B 2W55A 2INPE 4EE2A 2VZKD 2J0MA 2BF8B 1KLVA 5D2MB 2K39A 3VH4B 2IPKD 1E8XA 2IO0B 4MJSB 4HK2A 4UDUC 4WWMA 4ZYNA 1XT9B 3UINB 2AX5A 2IGHA 2BYFA 4LCDE 2WXLA 2UWQA 1WJ4A 1G6JA 5J17A 4XE0A 3P63A 3HRDD 3ZNGC 1ROEA 1HZ6A 3SHQA 3V3XA 4FHJA 4JLCA 4FULA 4PS3A 1K8RB 1D5MC 2J0KA 4G3XB 3WA0A 3AE6B 2MH7A 3OG5A 3HVDA 1M4VA 2B76B 2Y5PA 4K7SA 2SAKA 1V1PA 2ZCCA 3RCZA 3Q14C 4XYCA 3TBLD 2K25A 4G11A 5LNK1 1FIQA 1KH0A 2L32A 1KOTA 1UD7A 2FCQA 1ZW7A 5HHDG 3GB1A 2LGSA 1VZ7A 2BWFA 2JXTA 2YEPF 4MGZE 2A4ZA 1D4BA 2EKEC 3V6EB 3VRBB 5MPOA 2OJRA 3ZVVA 4R3DA 1YMHE 3VTWA 2O6VD 1WMHA 3RNBC 3CF6E 3GS2A 4NQLB 1ISNA 3ETRA 4J3OD 4NQKE 3CSFA 2DLBA 3AEAB 3RT3B 4JIOU 3SFEB 3IG3A 1V1OA 1T0SC 4FLHA 5J2RA 3SDLC 2BKFA 3AMZA 2LGDA 2KWDA 2AYOB 1NYRA 2N9XA 2LRUA 4WJOA 4Q2JA 1WXAA 1M94A 4HRSA 2MWSB 2Z0DB 1IBXB 1LM8B 4K3CA 5GXGB 4GXBA 3R2IA 3CSTA 3P1MA 4GDKB 3W1YA 2WXOA 3NVVA 3RN9C 1T0QC 1DOXA 3HM6X 1SF0A 1IBXA 2J42A 3A9JB 2GBRA 1YOVB 3PRZA 2V3PA 4S0RA 2RD0A 1PFDA 3VFKA 5EE9A 1T0RC 3U30A 3RNGC 1S1QB 4IG7B 2V3NA 1E5WA 3IT4B 4IWOA 1OQRA 3KW5B 4RGOS 2D11A 3NZ3A 3ABVB 3KQ4A 1GPXA 2Y5BB 2KWUB 2QILA 2G3QB 1RFKA 4LNKA 1XEEA 1KRHA 4YTPB 4YSXB 3UI3A 4K81A 3FC4A 2BGFA 2XBBC 3BINA 1WE6A 2WDVB 1HQRD 4B0MA 1FFVA 3KYCD 2MP2B 5FKAC 3DVGY 4GOCA 4ZOHC 2AL6A 5D94A 3TJPA 2KX0A 4DHZB 3AE7B 4P16A 2RPVA 2WXGA 5AZHA 2W3RA 5EE0A 2LGXA 3VDZA 2DZMA 3TEZA 3ZW3A 4YT0B 3ZTCA 4C7YA 2J53A 1UUPA 4W9LA 2JWUA 3Q2AC 4JQWC 1MHXA 5CHVC 1GC7A 4X57B 2VH1A 3P4PB 5JXVA 1RFAA 3PPAA 1L5PA 2KNBA 1E7VA 4K1RB 2KJRA 2MJDA 1TJEA 2DHZA 3W5UB 4E74A 3U7DA 3NVYA 1F2RI 3NOBA 2N9EB 2MCNB 4JGHB 1WJNA 2JZ3B 2FIFA 2LUEA 3ML8A 4I6PA 1FNUA 3MJ5A 2ZZPB 1R4MB 5E6OA 3RUIB 2WU2B 2INDC 2M56B 2GOWA 3D32A 4RM8A 1LO5D 2KC2A 2CU1A 2QIEB 4NZLB 2NR2A 4XDDA 1EUVB 3ZIMA 4M0WB 2D3AA 3AEEB 1VR9A 1L0VB 4GDKA 1XQQA 3KWVA 2R2OA 1MHHE 5IAAC 4MGYE 2NCNA 3AXCA 4TKNA 1UGMA 4JWUC 3APFA 2DAFA 1ET9A 2JSVX 4B9KA 2IY1B 1B9RA 4G50A 1WGKA 4BBNF 1HEZE 3ENEA 3QJZA 4WJQA 1YJJA 2GRIA 1YX5B 3ZNHB 1PQSA 1FRDA 1WR6E 3VTVA 1C1YB 2NTTA 1LXDA 4EFOA 1F9JA 5CTRC 3ZRCA 1WGHA 2LXAA 2WXNA 1UNSA 2L05A 5BYQA 1P9DU 1TZ1A 4EOYA 2JQRB 3NJTA 4J6IA 1I42A 1JROA 2PJHA 3DCGA 2LFIA 4DBGA 2GBNA 3R2TA 3VR8B 4AQ7A 1KJTA 3AEGB 3U52E 4ZRQA 1WM3A 4W9KA 5D7GA 1WSPA 5TR5A 1YQBA 3DBHB 2WXQA 4OVUA 1V9JA 1XXGA 2JZPA 4WQMA 3AEFB 3L08A 4PT5A 4FJZA 3R66C 2IYDB 5BMHA 3TUOA 1C4PA 3E9SA 4HCNB 1H8CA 1WXQA 4MJSA 2WDTB 4N59A 2OJWA 3Q8FA 1TS3A 4FN2A 4EUTA 2KT7A 5E6NA 3AECB 2IO2B 2MP2A 3WCQA 1IGDA 1DOIA 3EFCA 4XC2A 3AE1B 3TL5A 3M62B 4RM9A 1V80A 1JRPA 4IM2A 4II3B 4URKA 2Z0EB 1MPEA 4PYZA 3LB8C 3VAWA 2PPHA 4TUUA 2WDQB 3ML9A 1OFFA 4RFBA 3ZGZA 1ZOYB 3T9LA 1NENB 2KAJA 3FILB 1L0YB 4HKZE 4GGQA 3UIPB 1FO4A 1TY2A 2KC1A 2L7RA 2V4IB 1XCQL 2W82A 1ET6A 1RLFA 2INCC 2L8JA 3Q8EA 5C1ZA 4LJPB 1CQVA 2N7JA 1YQ4B 2IGDA 4MM3B 2C60A 4WWNA 1OQYA 1E6EB 1BT0A 1MJDA 5H92C 4C7ZA 4FA6A 2NMQA 3AV8A 3H8HA 2M17A 2DAJA 4DQOC 4RF1A 3TIXA 1S3SG 3BWUD 4CO7A 4II2B 1WYWB 2DNFA 2KVRA 1E8ZA 5C23A 1YD8U 4A3PA 2W3SA 4LNIA 2JWZA 1RRBA 4H2AA 3AEDB 5I4DA 3BY4B 3V6CB 2KFKA 1AARA 2HDEA 4M0WA 4BOZB 4NJ7A 3TCAA 3DBLI 1SJHD 3RPFC 1QT9A 4ZHPA 2CKHB 1WGRA 1ACCA 4AWJA 3MJWA 2QHOA 4S17A 2LJIA 2GMIC 3JW0X 1YQ3B 2AL3A 3EHVA 1QF6A 1WY8A 3BYTB 4GDLA 4HPPA 1ESFA 1D3ZA 4WJNA 2PMVA 2RSUA 1ZXHA 3AE2B 4AP4C 1SE9A 2GI9A 1WMHB 2VH2A 5DPRA 4IM3A 2IO3B 4OW0A 2KDBA 4GMVA 3PREA 3N32A 2E6XA 2LZ6A 1IYFA 1XLQA 2LGYA 2WGSA 1SIFA 3PT2B 1WZ3A 3ZNID 2DYBA 3R3MA 5GMVA 1TS2A 2IZVB 3Q3JA 1L4DB 2DZJA 3MHZA 3CIRB 1SBBB 4NAMA 4HJGE 5H8YE 2MX2A 1QOGA 4KKIA 5D6JB 2X38A 5EDSA 3AE3B 3OLMD 3OWEB 4WQOB 3DHGC 4EEWA 2M8SA 4AJYB 2D3GA 3PV1A 4HROA 2LD9A 5IP4D 4MDKE 5DPTA 2KTRA 1EF1A 2CJNA 3P4QB 2KO3A 4K7UA 1EU3A 1AYFA 3ZTDA 4W9IA 1TBEA 1P7FA 4C80A 1P0RA 4B0EA 4YWGG 4HVBA 4MH0E 4XWWA 1J0GA 2IDYA 3L16A 1FXIA 4HDOA 2W54A 2YVCA 2WXFA 4IM0A 4DK5A 2B3AA 2PE9A 4LDTD 2WDRB 4DHJD 4M01A 4HKQA 2M19A 4W9FA 2BYVE 2WP9B 2J7QB 3L17A 3MC9A 4CHKA 1SXTA 1BXTA 2BS4B 2BQQA 5KHOA 2ZVNA 4GN1A 2WX1A 3QCAA 1F1HA 1V8CA 3ZDTA 2KANA 4I6NB 3DBSA 1WGGA 4P1CC 2PVGC 2KWCA 4US8A 3AE4B 4L2YA 2KVZA 1N61A 1LQBA 3NRZA 1L0XB 4WIPA 3GE8C 1L7YA 2RDHA 5HG2A 2PIAA 3PVLA 2K8HA 3AB5A 4XGAB 3DDCB 1VDVA 2GBJA 3QA8A 3HIZA 1VJKA 2XNAC 2WXPA 3BVMA 1I4HA 3O65B 3UIOB 1Q1OA 4F1SA 4IWQA 2KQSA 4MELA 3I57A 1JWBD 2NBUA 2KFJA 4NY0A 1WYGA 2LVPA 1N5XA 4ITKA 2IY0B 1YJIA 4KDLB 4A90A 3M95A 5BYSA 4FHKA 1FD6A 2WXIA 1WXVA 3MP9A 3ZQ4A 4CYEA 3EFUA 2JUOA 3ZRFA 4NJCA 1N5WA 3RNCC 2DWQA 1K51A 2RDGA 3DHHC 2ZW1A 3AH7A 3KH0A 4HEA1 4HDQA 3KYDD 2C5LC 1XLNA 2MBQA 1ZDVA 4BKSA 2KQ7A 2H88B 2MBBB 2ZCBA 3QWZB 1UBQA 3Q3OC 3RZFA 2BYTA 1WGYA 1B1ZA 1WI0A 2N9PC 3DBRB 1NEKB 1J7BA 4CQNA 1QZEA 4DDID 4KIKB 1VRAB 4LNOA 2AQ1B 5AEKB 4TSSA 4DHZE 1OTRB 4C4VB 2RPQA 5G2NA 3X0WA 2LI5A 5TSSA 2LJ5A 5BO4B 1Z2MA 3DHIC 1VZ6A 2WXHA 2WHIA 2WWZA 4P6VF 1HTQA 2KTRB 1N63A 2D07B 4W9EA 1PGXA 2LUMA 1Q10A 2BB6A 3Q6BA 1KF6B 4ICUA 5LLIA 1F0ZA 5HFYA 1LFDA 1EM7A 3JSVA 2KDEB 3PO0A 1WXMA 2QMTA 4NNJB 1PYWD 2KD0A 2DZKA 2KN5A 2I38A 3QHTA 1DOYA 4JL9A 2PE6B 1K50A 2BTEA 2BBCA 4LNNA 4B6WA 4MGIE 2MHJA 2JX5A 1EWCA 3QK0A 2D10A 3HVZA 4RCOA 1WF9A 3K9PB 3A4RA 4FJYA 2LVQA 3SR6A 3B2GA 1SB3C 4M8MA 3VUXA 3PGEA 1KLGD 2L0TA 4RMAA 4N58A 1RAXA 2KK8A 2KYWA 4ZDVA 3L54A 1P98A 1DYQA 3MFGA 5IOIA 2SEBD 1VCBA 2MW5A 1PUTA 1VZ8A 1C4CA 3KUZA 4D2KA 1TGZB 2K9XA 2Z8LA 4WWPA 2FCMA 1NDDA 2KLCA 2KQ4X 3ZXVA 3URYA 5IKCM 1I35A 3LXFA 3Q8BA 4JE3B 3U2SC 3SFDB 1NBFC 3IXSA 1RWSA 2O6VA 2VRRB 1EU4A 1V2YA 1T3QA 1P7EA 4HCPB 3HK0A 1UGJA 3PLVA 4F7ZA 1J8CA 4W9HA 2IO1B 2KOXA 2FCSA 3UQBA 3DVNU 1R7SA 3Q3MC 1V86A 1TS4A 2KJHB 1OEYJ 3ONSA 2Y3AA 3WANA 2WXMA 3DBRI 4ANVA 2LHEA 3UGBB 1TKYA 1FXAA 2PTLA 3NZUA 3LJ3A 3H9DA 2ICIA 4ANXA 3HUIA 3TEYA 1IGCA 3AE8B 4KV2A 1K52A 4GU2A 3X23A 4ARIA 3N1YC 5HKHA 3PZDA 2K0PA 4IKGA 2MEKA 1E90A 4FXCA 4E3CA 1C3TA 2FCNA 2PLPA 5IA7A 1WH3A 3QAQA 2KZRA 5BMGA 2H89B 3RI7C 2NVUI 1MVKA 2K1FA 3DPDA 5JHBA 1TZOA 4ANWA 1WIAA 3ZDMC 2WNMA 4LLGM 4OZCA 2ZEQA 2M0AA 2LMCA 2ACZB 3J9CA 1WX7A 2FBWB 3VH3B 4XDCA 1E7UA 1DGJA 4M00A 2MLBA 2V4LA 4WAAA 3U7ZA 3BIID 2NS5A 3EECA 1QOAA 3ZXRA 2ZVOA 1WRIA 2JXXA 2LEKA 2JYTA 4YSZB 1WFYA 4YXDB 3PHXB 3TMPB 2LRWA 1D6EC 3JYUA 4FJVB 2FAZA 1Y56A 1I4QA 3FAHA 1TYGB 2BW2A 2UYZB 1ZDXA 3DBHI 4A9AA 2IBIB 2WXKA 4A20A 2FE8A 1OGWA 4NAWA 2XK5A 5HI1A 1QQRA 1C76A 1V49A 2C7MB 5JH5C 1QKZA 3DBLB 3WAMA 3TEXA 1AN8A 2K3UA 1NYQA 3QIJA 1UZXB 4AUQC 2A5UA 2L00B 2FIDA 4KKJA 2RGFA 2D3CA 3AN1A 3L10B 5E6JA 1V81A 3WAPA 3H6NA 4KX6B 3NUHB 4B95A 5LXHA 2AEHA 3APDA 1FRRA 4TMAB 3APCA 5DPSA 4KSLC 1CJEA 4LNFA 2MQJA 2BWES 2XEWA 2O6VB 1SE2A 2BKRB 1UWXA 3AE5B 3EGRA 2J52A 1MI0A 2PW9A 2FUHB 2MBHA 2M1MA 2GBKA 4A6QA 1JMLA 2DENB 1XLPA 3OAWA 3KUDB 4PYUA 1Q5WB 2HJ1A 2LWPA 3AM9A 1L2NA 3PS6A 1WR1A 2G4SA 3DQVA 5AUKA 2CR5A 2LVOA 2RR9A 3FKYA 4BVUC 4EZKA 2V0GA 1P3QU 2XN9C 4JPSA 1C78A 2WXJA 4HWIB 4EZJA 4M02A 5AUIA 1FFUA 4NAWB 4ARCA 3HM3A 3GZNB 3JSVB 3FILA 1T0YA 2N0SB 3Q3NC 1PDXA 3ZLZA 2EKIA 1STEA 4GB9A 1FPYA 4AOFA 4PS7A 2WXRA 2Z59B 2WQYB 4ZRKA 3W1SA 4BOSC 2OHFA 4ACFA 2CS4A 3NVZA 1UBIA 3NS8A 2PKOA 4KGRA 2VZKB 2W9NA 3VRAB 1V97A 3AULA 1TKEA 1F77A 3GE3C 5G55A 4AS1A 4RGMA 5EE3A 4XWTA 4DXGA 2WS3B 3A9KB 1FM0D 1HXYD 1L6VA 2EMSA 2KLGA 2QEJC 1E7PB 3EC8A 1IPGA 2WYQA 1AWDA 3DVGX 3Q69A 2O2VA 1JWMD 4WAFA 2QJLA 3NS1A 1QLBB 4LJOB 2BT6A 4P7IA 1VLBA 3N1ZC 2FNJB 3PTFC 3VQIA 3UQAA 2JF5A 2E3TA 3LDZE 2R2QA 1JALA 1C77A 2G1EA 5E6PA 3WALA 1Q0WB 3CMMB 4L23A 2G9HD 2MRPA 2ASQA 3O13A 3V61A 2K8BA 2JT4B 3VHTC 3Q8CA 2KDMA 3BVZA 3QQ8B 1V5TA 1F52A 3EUB2 4WJPA 4USAA 3B08A 4DHJB 1WJ6A 2BS3B 4PS8A 2MJEA 1CZPA 2D5GA 1C9FA 3VVWB 2HTHA 1FNVA 2FUG1 5CHFA 2JU6X 4N6EB 2LXCA 1WZ0A 3H7PB 5FK9C 4BFRA 3C8YA 4O1NA 2KDIA 2BS2B 2LASA 3PRPB 1WXSA 3P4SB 3R7QA 5KHQA 3QC8B 2NTSA 3Q3FA 1ZE3D 2CU3A 3ZNZB 2L52A 3PSEB 3ECIA 4P1BC 3IFWB 1E8YA 2K6DB 1UF0A 3V60A 2KX3A 4HJKA 4HXDA 1YIWA 1R4NB 3IT6B 2K6QA 3B0AA 4IWPA 3I63C 3V05A 2PVOD 4HPLB 2INNE 2JVCA 3IHPC 1I4XA 2N9KA 3RYTA 2RMMA 3H7PA 3N20C 4KSKC 2D2QA 2QSDA 3GOEA 1WRDB 2KN4A 3I9V1 2L76A 1ZP0B 1OEYA 3BVGA 1E0ZA 3AEBB 3KWLA 2NPTA 5AZFA 4MGKE 1YJ1A 4RF0A 4BZAA 3A33B 2WX0A 3A1QB 1AW7A 2JPHA 3W5VB 3AU4A 3AU5A 1OQQA 2L0FA 2N9LA 1J7AA 2LHDA 5J18A 2KKCA 4WWOA 4ICVA 3ZKJC 3K9OB 4MEMA 1N62A 4LDTB 1C79A 1J7CA 4YTMB 1Y8RC 2NPTB 1XLOA 2ZPYA 4AJWA 1GG3A 1NI2A 3QX1A 4TQ0A 4ZRPA 1L4ZB 1JQ4A 2DX5B 3NY5A 3P42A 1TTNA 4MSMB 3CWIA 4PK1A 4EZLA 3L4PA 2NBVB 3B2FA 2J0JA 2I2YA 1Z5SB 3U4EG 3E56A 1GC6A 3TSSA 3L13A 3H1UA 1MG4A 3B1LX 1GUAB 4KVGB 5C3JB 3R8BA 4XZ4A 2N7EA 2PEAA 2AWTA 4FBJB 5EE1A 3MC0B 3PZ8A 4DDGD 3C19A 3NG0A 5T8IA 2HTME 4A3OA 2AQ2B 4DXFA 3ALBA 4GSWA 3SU8X 2RDBC 2K22A 2WU5B 4GIVA 4WURA 4IUMB 2ZNVB 2R61A 1ZPSA 1WM2A 1QOFA 2BVCA 1FCCC 2JYEA 4OZAA 1FXTB 1KLUD 3RD2A 3C0RB 2KMMA 1WX8A 2JZZA 2O2VB 4RNAA 3UF8A 1ZXIA 3RZWC 1LGRA 4ZRIA 2BYEA 4OHJA 4DXAB 2J4XA 3GP7A 1D5ZC 4BBNC 2KACA 5IN7A 1T6BX 1EF5A 4E71A 4TV3A 4ASWC 1JWSD 4I6LB 3ZJTA 2KFKB 2ZPNA 4XX5A 3EA6A 3RNEC 2JRIB 1SEBD 2N1WA 4W9DA 1WX9A 1SGHA 5L83A 2YEPB 1HE8A 2KMAA 1JWUD 1ENFA 2GLSA 1V5OA 1SE4A 4G0NB 1XF5L 4GLSC 2G45B 5CX3A 1FNWA 5G5HA 4C00A 1ZGUB 3QARA 4OZBA 1V6EA 4MSQB 5CHWA 1IP9A 3P4RB 4ZHOA 3NVWA 3SEBA 1GNUA 2C7HA 4ZYSA 4IC7B 1P1AA 2DYMA 1D5XC 1JRUA 2N1VA 1GJZA 1E9MA 3A9JA 1YX6B 4JX1C 4MT5A 2QDFA 3MC8A 2EELA 3TEWA 3ZJUA 1E8WA 1BUIC 1FEHA 5FR6A 4C4VA 3RFZB 1A5RA 1VD2A 1A70A 4HPMB 4YSYB 2L3ZA 2ZJDA 1E10A 3N3KB 2CHWA 3A4SC 3WAOA 4EKUA 2DBYA 4IOIE 1YN4A 1JCKB 2MBEA 2M4NA 3PLUA 3LYYA 1CMXB 4NJ6A 3AE9B 2KDFB 2JY6A 3B9JA 3GZNI 2C9WB 3A9KA 3M63B 1MG8A 2LGIA 3I3TB 1K53A 3S2AA 2DYOA 1U4AA 3M3JA 3SD5A 4IW0A 4DWFA 3DWGC 4K3BA 4C56C 2V3SA 2D3BA
chains in the Genus database with same CATH topology
1RFKA 2PVGC 3PZ7A 1QOBA 1KFYB 5D3IB 4US8A 1XEEA 2N0SB 1KRHA 3AE4B 4YTPB 4L2YA 4YSXB 1PDXA 3UI3A 1N61A 2EKIA 1STEA 3FC4A 3NRZA 1SSNA 1YNTE 1L0XB 2WXRA 4WIPA 4TQ1A 3IAM1 2RDHA 5HG2A 2WQYB 2PIAA 3W1SA 3AB5A 1TY0A 2WDVB 1HQRD 1VDVA 4B0MA 1FFVA 2OHFA 5FKAC 1VJKA 2XNAC 2WXPA 3NVZA 3BVMA 4ZOHC 1I4HA 1GAQB 2IGGA 2PKOA 4KGRA 2VZKB 3VRAB 1V97A 1YN3A 3AE7B 4P16A 1TKEA 3BZDB 4MH8A 1F77A 2RPVA 2WXGA 2W3RA 5EE0A 4AS1A 3TEZA 3I57A 4YT0B 4C7YA 2J53A 4RGMA 5EE3A 1UUPA 1JWBD 2L1AA 4XWTA 2JWUA 4DXGA 2WS3B 4A8XC 1WYGA 1FM0D 1MHXA 3BYYB 1HXYD 1L6VA 1N5XA 2QEJC 4ITKA 1YJIA 1E7PB 4KGTA 3KLSX 2GB1A 4A90A 1AWDA 5BYRA 3Q69A 4LTUA 1JWMD 4WAFA 3W2DA 3P4PB 3ZJVA 5BYSA 2Q5WD 5JXVA 1PGBA 4YTNB 1FD6A 2QJLA 1L5PA 2WXIA 3NS1A 1QLBB 2BT6A 2MJDA 1SIJA 1TJEA 3N9YC 1VLBA 3MP9A 3W5UB 3ZQ4A 3NVYA 1F2RI 4NJCA 3VQIA 1N5WA 1BMLC 2DWQA 1EWYC 1K51A 2CJOA 2RDGA 2E3TA 2L83A 2ZW1A 3AH7A 4HEA1 4US9A 1JALA 2ONQA 1C77A 2G1EA 1F2RC 1SE3A 2MJ3A 1XLNA 4IDIA 4L23A 2G9HD 1FNUA 3MJ5A 3O13A 1ZDVA 1NVID 2H88B 1GB1A 2WU2B 2M56B 3Q8CA 2KDMA 3BVZA 1HZ5A 2BYTA 1B1ZA 1TKGA 1LO5D 3ZYYX 2QIEB 4NZLB 1NEKB 3EUB2 4USAA 1J7BA 4XDDA 4CQNA 2BS3B 2ON8A 3AEEB 2MJEA 1CK1A 1VR9A 1VRAB 1CZPA 1L0VB 2AQ1B 2BB5A 2D5GA 1I4RA 1ZUD2 1GOZA 1XCTL 4RGTA 1QILA 1FCLA 3KWVA 3DWMA 1C9FA 1MHHE 4TSSA 4A55A 5D3DA 1T5XD 5TSSA 1KTKA 1FNVA 2FUG1 4MACA 4JWUC 1VZ6A 2WXHA 2OEDA 1ET9A 4JWSC 2JSVX 2JU6X 1N60A 2Y5CA 4N6EB 4P6VF 1B9RA 4L1BA 1N63A 1WGKA 1HEZE 3BK1A 1PGXA 2LUMA 1YJJA 1Q10A 2BB6A 2GRIA 1KF6B 5FK9C 1FRDA 3C8YA 4O1NA 1F0ZA 5HFYA 2NTTA 2BS2B 2TSSA 1XO3A 1EM7A 3P4SB 2NTSA 1YN5A 3PO0A 2QMTA 2WXNA 5BYQA 1UNSA 1ZE3D 2CU3A 2L52A 1GB4A 1PYWD 1I4PA 2I38A 2JQRB 1DOYA 3IT6B 1JROA 2PVOD 3V05A 2INNE 1K50A 2BTEA 1I4XA 2N9KA 2BBCA 3T3OA 2RMMA 2LFIA 3VR9B 1PGAA 2JX5A 1I4GA 1EWCA 5G5GA 2AQ3B 2QSDA 3HVZA 3R2TA 4RCOA 3VR8B 1C4AA 2KN4A 4AQ7A 3I9V1 1ZP0B 5C2TB 3AEGB 3U52E 4WH4A 3BVGA 5BMIA 4ZRQA 3SR6A 1E0ZA 3B2GA 1SB3C 5D7GA 1WSPA 4GDLB 4KGSA 2WXQA 1KLGD 3AEBB 1XXGA 3KWLA 2JZPA 4RF0A 1SJED 4N58A 4WQMA 3AEFB 1AW7A 1IUEA 4PT5A 3W9CB 5FR3A 3W5VB 1DYQA 3MFGA 5BMHA 3TUOA 1OQQA 3T3NA 1C4PA 4RH6A 2N9LA 3E9SA 1J7AA 4OVZA 1JW9D 2LHDA 1V1PB 1WXQA 2SEBD 2ZW0A 4N59A 3Q8FA 4REZA 1TS3A 3AECB 1N62A 1PUTA 1C79A 3WCQA 1IGDA 1C4CA 1J7CA 1VZ8A 1DOIA 4D2KA 4YTMB 3AE1B 2K9XA 2Z8LA 1FMAD 2WLBA 1XLOA 1JRPA 3BK2A 1MPEA 2KQ4X 3LB8C 3URYA 3LXFA 3Q8BA 4JE3B 3U2SC 3Q8AA 3SFDB 4TQ0A 4ZRPA 1L4ZB 1JWAD 1TS5A 1JQ4A 2WDQB 3IXSA 1NI3A 3P42A 1RWSA 2IJ0A 1OFFA 4RFBA 3ZGZA 1EU4A 1HA5A 1ZOYB 3CWIA 3L4PA 1NENB 2KAJA 1T3QA 1P7EA 3FILB 1L0YB 4HKZE 1UGJA 3B2FA 2I2YA 4LK0M 3U4EG 1FO4A 3E56A 1TY2A 2V4IB 1XCQL 3TSSA 2W82A 4RGNA 1ET6A 1L6UA 1WWTA 3Q8EA 1R7SA 1RM6C 5C3JB 3R8BA 1CQVA 2N7JA 1I7HA 1UWMA 1TS4A 2K5PA 1YQ4B 3IAS1 2Y3AA 1RYJA 5EE1A 2W55A 2IGDA 3MC0B 2INPE 4EE2A 2VZKD 3PZ8A 4MM3B 2WXMA 2LHEA 1TKYA 5T8IA 1FXAA 2PTLA 1E6EB 2HTME 2AQ2B 5H92C 4DXFA 4C7ZA 2NMQA 2IPKD 3AV8A 3H8HA 4DQOC 2ICIA 4RF1A 4UDUC 3HUIA 4WWMA 3TEYA 1IGCA 3BWUD 3AE8B 2AX5A 2IGHA 1K52A 2K22A 2WU5B 4WURA 2R61A 1ZPSA 2WXLA 4ARIA 2W3SA 1QOFA 1FCCC 2JYEA 2K0PA 4OZAA 4H2AA 4IKGA 2MEKA 1KLUD 3AEDB 4XE0A 3P63A 5I4DA 3HRDD 2KMMA 1ROEA 4FXCA 1HZ6A 3V3XA 4RNAA 2HDEA 4M0WA 1ZXIA 2PLPA 3RPFC 1SJHD 4ZHPA 1QT9A 5BMGA 1D5MC 2H89B 4OHJA 1ACCA 1MVKA 3AE6B 2MH7A 1TZOA 2J4XA 1M4VA 2B76B 3GP7A 3HVDA 2Y5PA 1D5ZC 2LJIA 2SAKA 2WNMA 2KACA 4LLGM 4OZCA 1V1PA 1T6BX 1YQ3B 2M0AA 2LMCA 2ACZB 3J9CA 1JWSD 1QF6A 2FBWB 4XDCA 3BYTB 3ZJTA 5LNK1 1FIQA 2L32A 1KH0A 1DGJA 1ESFA 3U7ZA 2PMVA 3BIID 3GB1A 5HHDG 1ZXHA 1QOAA 3AE2B 3EA6A 2GI9A 1VZ7A 1WRIA 2JXTA 2YEPF 1SEBD 2LEKA 2JYTA 4OW0A 1D4BA 4YSZB 4YXDB 3VRBB 5MPOA 1D6EC 2E6XA 1Y56A 1I4QA 4R3DA 1YMHE 1XLQA 3FAHA 1TYGB 2YEPB 2BW2A 1ZDXA 3GS2A 4A9AA 2WXKA 1JWUD 3ETRA 1ENFA 2FE8A 1TS2A 1SE4A 1XF5L 4GLSC 5HI1A 1L4DB 1QQRA 1FNWA 4J3OD 1C76A 3MHZA 3CIRB 1SBBB 4NAMA 4HJGE 5H8YE 2DLBA 1QKZA 1QOGA 3AEAB 5G5HA 3TEXA 1AN8A 2K3UA 4KKIA 2X38A 1NYQA 3AE3B 4OZBA 3SFEB 3OWEB 4KKJA 1V1OA 3P4RB 4ZHOA 3AN1A 3NVWA 5E6JA 3SEBA 3AMZA 2KWDA 4ZYSA 4HROA 2DYMA 4KX6B 1NYRA 3NUHB 1D5XC 1FRRA 4TMAB 4Q2JA 1E9MA 2CJNA 1CJEA 3P4QB 4HRSA 1IBXB 1EU3A 1SE2A 4JX1C 1AYFA 4MT5A 1UWXA 3AE5B 1P7FA 3EGRA 4C80A 2J52A 5GXGB 4B0EA 1MI0A 3R2IA 2EELA 4YWGG 2PW9A 3TEWA 3ZJUA 3P1MA 1BUIC 4GDKB 1FEHA 2WXOA 4A6QA 4XWWA 1JMLA 3RFZB 2IDYA 1FXIA 3NVVA 1DOXA 2W54A 1XLPA 2WXFA 1A70A 1SF0A 1IBXA 2J42A 4YSYB 2WDRB 1E10A 3AM9A 4HKQA 2M19A 2V3PA 2DBYA 4IOIE 1YN4A 2WP9B 1JCKB 1PFDA 5EE9A 5AUKA 3LYYA 3AE9B 2V0GA 1SXTA 1BXTA 2XN9C 2BS4B 3FILA 4JPSA 2V3NA 1C78A 3IT4B 2WXJA 3B9JA 5AUIA 1OQRA 2LGIA 1FFUA 1V8CA 4RGOS 1K53A 2DYOA 4NAWB 4ARCA 3NZ3A 3DWGC 3ABVB 3KQ4A 1GPXA 4C56C 2QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFK A;  2PVG C;  3AEE B;  1QOB A;  1KFY B;  2MJE A;  1CZP A;  1L0V B;  1WRI A;  3LB8 C;  4US8 A;  1ZUD 2;  3LXF A;  2N0S B;  3SFD B;  1KRH A;  3AE4 B;  2LEK A;  4YTP B;  4YSX B;  1PDX A;  1JWA D;  3DWM A;  4YSZ B;  1N61 A;  4YXD B;  1JQ4 A;  2WDQ B;  3VRB B;  2EKI A;  1NI3 A;  5MPO A;  1RWS A;  3FC4 A;  1OFF A;  3NRZ A;  3CWI A;  1ZOY B;  1XLQ A;  3FAH A;  3L4P A;  1TYG B;  4JWU C;  1NEN B;  2KAJ A;  1T3Q A;  2WQY B;  2PIA A;  3B2F A;  4A9A A;  4JWS C;  3AB5 A;  2WDV B;  3ETR A;  1VDV A;  1N60 A;  2Y5C A;  4N6E B;  4P6V F;  1FFV A;  1FO4 A;  1B9R A;  2OHF A;  1N63 A;  1VJK A;  3NVZ A;  1WGK A;  4ZOH C;  3BII D;  1L6U A;  1WWT A;  1GAQ B;  3CIR B;  1YJJ A;  2PKO A;  1R7S A;  1KF6 B;  3VRA B;  1RM6 C;  5H8Y E;  1V97 A;  1QOG A;  3AE7 B;  3AEA B;  1FRD A;  5G5H A;  5C3J B;  1F0Z A;  1TKE A;  1I7H A;  1UWM A;  1NYQ A;  3AE3 B;  2BS2 B;  2K5P A;  1YQ4 B;  2W3R A;  5EE0 A;  1RYJ A;  1XO3 A;  3P4S B;  5EE1 A;  2W55 A;  3SFE B;  3PO0 A;  3P4R B;  2CU3 A;  4YT0 B;  4C7Y A;  2L52 A;  4ZHO A;  1XLO A;  5EE3 A;  1JWB D;  1TKY A;  3AN1 A;  3NVW A;  1FXA A;  2WS3 B;  1E6E B;  2HTM E;  3AMZ A;  1WYG A;  2WLB A;  1FM0 D;  4HRO A;  5H92 C;  4C7Z A;  1L6V A;  1N5X A;  3AV8 A;  2JQR B;  4ITK A;  1NYR A;  1YJI A;  4KX6 B;  1DOY A;  1E7P B;  3HUI A;  1FRR A;  1JRO A;  2PVO D;  1AWD A;  4WWM A;  4LTU A;  1E9M A;  2CJN A;  1CJE A;  3P4Q B;  3P4P B;  4HRS A;  3AE8 B;  2Q5W D;  2AX5 A;  4JX1 C;  1AYF A;  2K22 A;  2WU5 B;  4YTN B;  3VR9 B;  3AE5 B;  2QJL A;  1L5P A;  2JX5 A;  3NS1 A;  1QLB B;  5G5G A;  5GXG B;  4C80 A;  3HVZ A;  2BT6 A;  3VR8 B;  2MJD A;  2W3S A;  1SIJ A;  1TJE A;  3P1M A;  3W5U B;  1VLB A;  1QOF A;  1ZP0 B;  5C2T B;  3AEG B;  3NVY A;  1FXI A;  3NVV A;  1DOX A;  2W54 A;  1XLP A;  1N5W A;  3SR6 A;  1E0Z A;  3B2G A;  1SB3 C;  3AED B;  3P63 A;  1A70 A;  1EWY C;  1SF0 A;  2CJO A;  2DWQ A;  2KMM A;  2WDR B;  3AE2 B;  1ROE A;  3HRD D;  4FXC A;  2E3T A;  4YSY B;  1E10 A;  2L83 A;  3AEB B;  3AH7 A;  3AM9 A;  4US9 A;  2M19 A;  1ZXI A;  3KWL A;  4N58 A;  2DBY A;  1JAL A;  4WQM A;  3RPF C;  4ZHP A;  1QT9 A;  2G1E A;  2WP9 B;  3AEF B;  1PFD A;  2H89 B;  5EE9 A;  1IUE A;  3W9C B;  2MJ3 A;  5AUK A;  1XLN A;  4IDI A;  3AE6 B;  3W5V B;  2MH7 A;  1OQQ A;  2B76 B;  1J7A A;  3AE9 B;  1JW9 D;  1WXQ A;  1NVI D;  2BS4 B;  2H88 B;  4N59 A;  3B9J A;  2WU2 B;  1YQ3 B;  5AUI A;  2ACZ B;  1OQR A;  3AEC B;  1N62 A;  2M56 B;  1PUT A;  1QF6 A;  1FFU A;  1V8C A;  2FBW B;  1FIQ A;  3WCQ A;  1TKG A;  1J7C A;  1DOI A;  1DGJ A;  3ZYY X;  2QIE B;  3DWG C;  3ABV B;  4YTM B;  1NEK B;  3AE1 B;  3EUB 2;  4USA A;  2K9X A;  1J7B A;  1GPX A;  1FMA D;  1JRP A;  1QOA A;  2BS3 B; 
#chains in the Genus database with same CATH topology
 3PZ7 A;  1QOB A;  1KFY B;  5D3I B;  2KMC A;  3N1X C;  1WGD A;  4NPN A;  2CHX A;  3MHS D;  1SSN A;  1YNT E;  4BKS D;  4TQ1 A;  3IAM 1;  3IBE A;  1TY0 A;  2G4D B;  2NBW B;  2EMT A;  2N7D A;  3ZUN A;  4KZ0 A;  1GAQ B;  2IGG A;  4W9J A;  1YN3 A;  2KTF A;  1R4N I;  3H7S A;  3BZD B;  4MH8 A;  2MBO A;  3P2B A;  4FAD A;  3MTN B;  2L1A A;  3VUY A;  1X1M A;  4A8X C;  3BYY B;  2CHZ A;  3WIM A;  4KGT A;  3KLS X;  5JHA A;  2GB1 A;  2XK5 B;  5BYR A;  4LTU A;  2HJ8 A;  3HHM A;  3W2D A;  3ZJV A;  2Q5W D;  4HLE A;  1PGB A;  2I1J A;  4YTN B;  4F8C B;  1SIJ A;  3N9Y C;  2KJ6 A;  4ANU A;  3T8M A;  1BML C;  1N6Z A;  1EWY C;  2CJO A;  2HE7 A;  2L83 A;  4US9 A;  2I1K A;  2ONQ A;  5IO9 A;  1ZKH A;  1F2R C;  1SE3 A;  2MJ3 A;  4IDI A;  5DPW A;  4M8N A;  3RMK C;  4QAY A;  1NVI D;  1GB1 A;  3W1S C;  2KWV B;  1HZ5 A;  1WJU A;  1TKG A;  3ZYY X;  1KM7 A;  3VXW A;  1UH6 A;  4BAX A;  5LXI B;  2ON8 A;  1CK1 A;  4W9G A;  2BB5 A;  3ZO5 B;  1I4R A;  1ZUD 2;  1GOZ A;  1XCT L;  4RGT A;  3U8Z A;  1QIL A;  1FCL A;  3DWM A;  2KHW B;  4A55 A;  3KVF B;  5D3D A;  2UU7 A;  1T5X D;  1KTK A;  4MAC A;  3V62 A;  3R7R A;  2OED A;  4JWS C;  1N60 A;  2Y5C A;  3PHW B;  3OJ3 A;  4L1B A;  5AZG A;  3BK1 A;  1WE7 A;  2V9H A;  5L95 C;  3AI5 A;  4N9F 4;  2REX A;  4KDI C;  2QC8 A;  4MM3 A;  4W9C A;  1XD3 B;  2TSS A;  1XO3 A;  1YN5 A;  4KZC A;  1GB4 A;  3L0W B;  3NHE B;  1I4P A;  4OVV A;  4K7W A;  4KIK A;  3T3O A;  3VR9 B;  2C7N B;  1PGA A;  4BKT A;  1I4G A;  3PRM B;  5G5G A;  2AQ3 B;  2YLM A;  1C4A A;  3NZS A;  5C2T B;  4WH4 A;  1MFW A;  3RNF C;  5BMI A;  2GBM A;  4GDL B;  4YL8 A;  4KGS A;  2V1Y A;  1SJE D;  2HD5 B;  2KXJ A;  2DZI A;  2N4F A;  1IUE A;  3W9C B;  5FR3 A;  1TT5 B;  1TIF A;  3VTU A;  3T3N A;  4RH6 A;  4OVZ A;  1HTO A;  1JW9 D;  1V1P B;  2ZW0 A;  4REZ A;  3IVF A;  2JRH A;  2M0X A;  3A1Q A;  3N30 A;  1UEL A;  3RNA C;  1FMA D;  2WLB A;  3BK2 A;  3VUW A;  1R4M I;  5DCN A;  3RUL A;  3Q8A A;  2ZNV C;  2MA9 B;  4BKG A;  1JWA D;  1TS5 A;  1NI3 A;  2IJ0 A;  3DVN V;  3JVZ X;  1HA5 A;  2MSE D;  2BPS A;  1J19 A;  3KUC B;  4LK0 M;  2OOB B;  4ZRJ A;  5JZE B;  2QCZ A;  3I5J C;  2K8C A;  4RGN A;  1L6U A;  1WWT A;  1RM6 C;  1I7H A;  1UWM A;  2X8X X;  2K5P A;  3IAS 1;  1EO6 A;  1H4R A;  1RYJ A;  3DOW A;  3OJ4 B;  2W55 A;  2INP E;  4EE2 A;  2VZK D;  2J0M A;  2BF8 B;  1KLV A;  5D2M B;  2K39 A;  3VH4 B;  2IPK D;  1E8X A;  2IO0 B;  4MJS B;  4HK2 A;  4UDU C;  4WWM A;  4ZYN A;  1XT9 B;  3UIN B;  2AX5 A;  2IGH A;  2BYF A;  4LCD E;  2WXL A;  2UWQ A;  1WJ4 A;  1G6J A;  5J17 A;  4XE0 A;  3P63 A;  3HRD D;  3ZNG C;  1ROE A;  1HZ6 A;  3SHQ A;  3V3X A;  4FHJ A;  4JLC A;  4FUL A;  4PS3 A;  1K8R B;  1D5M C;  2J0K A;  4G3X B;  3WA0 A;  3AE6 B;  2MH7 A;  3OG5 A;  3HVD A;  1M4V A;  2B76 B;  2Y5P A;  4K7S A;  2SAK A;  1V1P A;  2ZCC A;  3RCZ A;  3Q14 C;  4XYC A;  3TBL D;  2K25 A;  4G11 A;  5LNK 1;  1FIQ A;  1KH0 A;  2L32 A;  1KOT A;  1UD7 A;  2FCQ A;  1ZW7 A;  5HHD G;  3GB1 A;  2LGS A;  1VZ7 A;  2BWF A;  2JXT A;  2YEP F;  4MGZ E;  2A4Z A;  1D4B A;  2EKE C;  3V6E B;  3VRB B;  5MPO A;  2OJR A;  3ZVV A;  4R3D A;  1YMH E;  3VTW A;  2O6V D;  1WMH A;  3RNB C;  3CF6 E;  3GS2 A;  4NQL B;  1ISN A;  3ETR A;  4J3O D;  4NQK E;  3CSF A;  2DLB A;  3AEA B;  3RT3 B;  4JIO U;  3SFE B;  3IG3 A;  1V1O A;  1T0S C;  4FLH A;  5J2R A;  3SDL C;  2BKF A;  3AMZ A;  2LGD A;  2KWD A;  2AYO B;  1NYR A;  2N9X A;  2LRU A;  4WJO A;  4Q2J A;  1WXA A;  1M94 A;  4HRS A;  2MWS B;  2Z0D B;  1IBX B;  1LM8 B;  4K3C A;  5GXG B;  4GXB A;  3R2I A;  3CST A;  3P1M A;  4GDK B;  3W1Y A;  2WXO A;  3NVV A;  3RN9 C;  1T0Q C;  1DOX A;  3HM6 X;  1SF0 A;  1IBX A;  2J42 A;  3A9J B;  2GBR A;  1YOV B;  3PRZ A;  2V3P A;  4S0R A;  2RD0 A;  1PFD A;  3VFK A;  5EE9 A;  1T0R C;  3U30 A;  3RNG C;  1S1Q B;  4IG7 B;  2V3N A;  1E5W A;  3IT4 B;  4IWO A;  1OQR A;  3KW5 B;  4RGO S;  2D11 A;  3NZ3 A;  3ABV B;  3KQ4 A;  1GPX A;  2Y5B B;  2KWU B;  2QIL A;  2G3Q B;  1RFK A;  4LNK A;  1XEE A;  1KRH A;  4YTP B;  4YSX B;  3UI3 A;  4K81 A;  3FC4 A;  2BGF A;  2XBB C;  3BIN A;  1WE6 A;  2WDV B;  1HQR D;  4B0M A;  1FFV A;  3KYC D;  2MP2 B;  5FKA C;  3DVG Y;  4GOC A;  4ZOH C;  2AL6 A;  5D94 A;  3TJP A;  2KX0 A;  4DHZ B;  3AE7 B;  4P16 A;  2RPV A;  2WXG A;  5AZH A;  2W3R A;  5EE0 A;  2LGX A;  3VDZ A;  2DZM A;  3TEZ A;  3ZW3 A;  4YT0 B;  3ZTC A;  4C7Y A;  2J53 A;  1UUP A;  4W9L A;  2JWU A;  3Q2A C;  4JQW C;  1MHX A;  5CHV C;  1GC7 A;  4X57 B;  2VH1 A;  3P4P B;  5JXV A;  1RFA A;  3PPA A;  1L5P A;  2KNB A;  1E7V A;  4K1R B;  2KJR A;  2MJD A;  1TJE A;  2DHZ A;  3W5U B;  4E74 A;  3U7D A;  3NVY A;  1F2R I;  3NOB A;  2N9E B;  2MCN B;  4JGH B;  1WJN A;  2JZ3 B;  2FIF A;  2LUE A;  3ML8 A;  4I6P A;  1FNU A;  3MJ5 A;  2ZZP B;  1R4M B;  5E6O A;  3RUI B;  2WU2 B;  2IND C;  2M56 B;  2GOW A;  3D32 A;  4RM8 A;  1LO5 D;  2KC2 A;  2CU1 A;  2QIE B;  4NZL B;  2NR2 A;  4XDD A;  1EUV B;  3ZIM A;  4M0W B;  2D3A A;  3AEE B;  1VR9 A;  1L0V B;  4GDK A;  1XQQ A;  3KWV A;  2R2O A;  1MHH E;  5IAA C;  4MGY E;  2NCN A;  3AXC A;  4TKN A;  1UGM A;  4JWU C;  3APF A;  2DAF A;  1ET9 A;  2JSV X;  4B9K A;  2IY1 B;  1B9R A;  4G50 A;  1WGK A;  4BBN F;  1HEZ E;  3ENE A;  3QJZ A;  4WJQ A;  1YJJ A;  2GRI A;  1YX5 B;  3ZNH B;  1PQS A;  1FRD A;  1WR6 E;  3VTV A;  1C1Y B;  2NTT A;  1LXD A;  4EFO A;  1F9J A;  5CTR C;  3ZRC A;  1WGH A;  2LXA A;  2WXN A;  1UNS A;  2L05 A;  5BYQ A;  1P9D U;  1TZ1 A;  4EOY A;  2JQR B;  3NJT A;  4J6I A;  1I42 A;  1JRO A;  2PJH A;  3DCG A;  2LFI A;  4DBG A;  2GBN A;  3R2T A;  3VR8 B;  4AQ7 A;  1KJT A;  3AEG B;  3U52 E;  4ZRQ A;  1WM3 A;  4W9K A;  5D7G A;  1WSP A;  5TR5 A;  1YQB A;  3DBH B;  2WXQ A;  4OVU A;  1V9J A;  1XXG A;  2JZP A;  4WQM A;  3AEF B;  3L08 A;  4PT5 A;  4FJZ A;  3R66 C;  2IYD B;  5BMH A;  3TUO A;  1C4P A;  3E9S A;  4HCN B;  1H8C A;  1WXQ A;  4MJS A;  2WDT B;  4N59 A;  2OJW A;  3Q8F A;  1TS3 A;  4FN2 A;  4EUT A;  2KT7 A;  5E6N A;  3AEC B;  2IO2 B;  2MP2 A;  3WCQ A;  1IGD A;  1DOI A;  3EFC A;  4XC2 A;  3AE1 B;  3TL5 A;  3M62 B;  4RM9 A;  1V80 A;  1JRP A;  4IM2 A;  4II3 B;  4URK A;  2Z0E B;  1MPE A;  4PYZ A;  3LB8 C;  3VAW A;  2PPH A;  4TUU A;  2WDQ B;  3ML9 A;  1OFF A;  4RFB A;  3ZGZ A;  1ZOY B;  3T9L A;  1NEN B;  2KAJ A;  3FIL B;  1L0Y B;  4HKZ E;  4GGQ A;  3UIP B;  1FO4 A;  1TY2 A;  2KC1 A;  2L7R A;  2V4I B;  1XCQ L;  2W82 A;  1ET6 A;  1RLF A;  2INC C;  2L8J A;  3Q8E A;  5C1Z A;  4LJP B;  1CQV A;  2N7J A;  1YQ4 B;  2IGD A;  4MM3 B;  2C60 A;  4WWN A;  1OQY A;  1E6E B;  1BT0 A;  1MJD A;  5H92 C;  4C7Z A;  4FA6 A;  2NMQ A;  3AV8 A;  3H8H A;  2M17 A;  2DAJ A;  4DQO C;  4RF1 A;  3TIX A;  1S3S G;  3BWU D;  4CO7 A;  4II2 B;  1WYW B;  2DNF A;  2KVR A;  1E8Z A;  5C23 A;  1YD8 U;  4A3P A;  2W3S A;  4LNI A;  2JWZ A;  1RRB A;  4H2A A;  3AED B;  5I4D A;  3BY4 B;  3V6C B;  2KFK A;  1AAR A;  2HDE A;  4M0W A;  4BOZ B;  4NJ7 A;  3TCA A;  3DBL I;  1SJH D;  3RPF C;  1QT9 A;  4ZHP A;  2CKH B;  1WGR A;  1ACC A;  4AWJ A;  3MJW A;  2QHO A;  4S17 A;  2LJI A;  2GMI C;  3JW0 X;  1YQ3 B;  2AL3 A;  3EHV A;  1QF6 A;  1WY8 A;  3BYT B;  4GDL A;  4HPP A;  1ESF A;  1D3Z A;  4WJN A;  2PMV A;  2RSU A;  1ZXH A;  3AE2 B;  4AP4 C;  1SE9 A;  2GI9 A;  1WMH B;  2VH2 A;  5DPR A;  4IM3 A;  2IO3 B;  4OW0 A;  2KDB A;  4GMV A;  3PRE A;  3N32 A;  2E6X A;  2LZ6 A;  1IYF A;  1XLQ A;  2LGY A;  2WGS A;  1SIF A;  3PT2 B;  1WZ3 A;  3ZNI D;  2DYB A;  3R3M A;  5GMV A;  1TS2 A;  2IZV B;  3Q3J A;  1L4D B;  2DZJ A;  3MHZ A;  3CIR B;  1SBB B;  4NAM A;  4HJG E;  5H8Y E;  2MX2 A;  1QOG A;  4KKI A;  5D6J B;  2X38 A;  5EDS A;  3AE3 B;  3OLM D;  3OWE B;  4WQO B;  3DHG C;  4EEW A;  2M8S A;  4AJY B;  2D3G A;  3PV1 A;  4HRO A;  2LD9 A;  5IP4 D;  4MDK E;  5DPT A;  2KTR A;  1EF1 A;  2CJN A;  3P4Q B;  2KO3 A;  4K7U A;  1EU3 A;  1AYF A;  3ZTD A;  4W9I A;  1TBE A;  1P7F A;  4C80 A;  1P0R A;  4B0E A;  4YWG G;  4HVB A;  4MH0 E;  4XWW A;  1J0G A;  2IDY A;  3L16 A;  1FXI A;  4HDO A;  2W54 A;  2YVC A;  2WXF A;  4IM0 A;  4DK5 A;  2B3A A;  2PE9 A;  4LDT D;  2WDR B;  4DHJ D;  4M01 A;  4HKQ A;  2M19 A;  4W9F A;  2BYV E;  2WP9 B;  2J7Q B;  3L17 A;  3MC9 A;  4CHK A;  1SXT A;  1BXT A;  2BS4 B;  2BQQ A;  5KHO A;  2ZVN A;  4GN1 A;  2WX1 A;  3QCA A;  1F1H A;  1V8C A;  3ZDT A;  2KAN A;  4I6N B;  3DBS A;  1WGG A;  4P1C C;  2PVG C;  2KWC A;  4US8 A;  3AE4 B;  4L2Y A;  2KVZ A;  1N61 A;  1LQB A;  3NRZ A;  1L0X B;  4WIP A;  3GE8 C;  1L7Y A;  2RDH A;  5HG2 A;  2PIA A;  3PVL A;  2K8H A;  3AB5 A;  4XGA B;  3DDC B;  1VDV A;  2GBJ A;  3QA8 A;  3HIZ A;  1VJK A;  2XNA C;  2WXP A;  3BVM A;  1I4H A;  3O65 B;  3UIO B;  1Q1O A;  4F1S A;  4IWQ A;  2KQS A;  4MEL A;  3I57 A;  1JWB D;  2NBU A;  2KFJ A;  4NY0 A;  1WYG A;  2LVP A;  1N5X A;  4ITK A;  2IY0 B;  1YJI A;  4KDL B;  4A90 A;  3M95 A;  5BYS A;  4FHK A;  1FD6 A;  2WXI A;  1WXV A;  3MP9 A;  3ZQ4 A;  4CYE A;  3EFU A;  2JUO A;  3ZRF A;  4NJC A;  1N5W A;  3RNC C;  2DWQ A;  1K51 A;  2RDG A;  3DHH C;  2ZW1 A;  3AH7 A;  3KH0 A;  4HEA 1;  4HDQ A;  3KYD D;  2C5L C;  1XLN A;  2MBQ A;  1ZDV A;  4BKS A;  2KQ7 A;  2H88 B;  2MBB B;  2ZCB A;  3QWZ B;  1UBQ A;  3Q3O C;  3RZF A;  2BYT A;  1WGY A;  1B1Z A;  1WI0 A;  2N9P C;  3DBR B;  1NEK B;  1J7B A;  4CQN A;  1QZE A;  4DDI D;  4KIK B;  1VRA B;  4LNO A;  2AQ1 B;  5AEK B;  4TSS A;  4DHZ E;  1OTR B;  4C4V B;  2RPQ A;  5G2N A;  3X0W A;  2LI5 A;  5TSS A;  2LJ5 A;  5BO4 B;  1Z2M A;  3DHI C;  1VZ6 A;  2WXH A;  2WHI A;  2WWZ A;  4P6V F;  1HTQ A;  2KTR B;  1N63 A;  2D07 B;  4W9E A;  1PGX A;  2LUM A;  1Q10 A;  2BB6 A;  3Q6B A;  1KF6 B;  4ICU A;  5LLI A;  1F0Z A;  5HFY A;  1LFD A;  1EM7 A;  3JSV A;  2KDE B;  3PO0 A;  1WXM A;  2QMT A;  4NNJ B;  1PYW D;  2KD0 A;  2DZK A;  2KN5 A;  2I38 A;  3QHT A;  1DOY A;  4JL9 A;  2PE6 B;  1K50 A;  2BTE A;  2BBC A;  4LNN A;  4B6W A;  4MGI E;  2MHJ A;  2JX5 A;  1EWC A;  3QK0 A;  2D10 A;  3HVZ A;  4RCO A;  1WF9 A;  3K9P B;  3A4R A;  4FJY A;  2LVQ A;  3SR6 A;  3B2G A;  1SB3 C;  4M8M A;  3VUX A;  3PGE A;  1KLG D;  2L0T A;  4RMA A;  4N58 A;  1RAX A;  2KK8 A;  2KYW A;  4ZDV A;  3L54 A;  1P98 A;  1DYQ A;  3MFG A;  5IOI A;  2SEB D;  1VCB A;  2MW5 A;  1PUT A;  1VZ8 A;  1C4C A;  3KUZ A;  4D2K A;  1TGZ B;  2K9X A;  2Z8L A;  4WWP A;  2FCM A;  1NDD A;  2KLC A;  2KQ4 X;  3ZXV A;  3URY A;  5IKC M;  1I35 A;  3LXF A;  3Q8B A;  4JE3 B;  3U2S C;  3SFD B;  1NBF C;  3IXS A;  1RWS A;  2O6V A;  2VRR B;  1EU4 A;  1V2Y A;  1T3Q A;  1P7E A;  4HCP B;  3HK0 A;  1UGJ A;  3PLV A;  4F7Z A;  1J8C A;  4W9H A;  2IO1 B;  2KOX A;  2FCS A;  3UQB A;  3DVN U;  1R7S A;  3Q3M C;  1V86 A;  1TS4 A;  2KJH B;  1OEY J;  3ONS A;  2Y3A A;  3WAN A;  2WXM A;  3DBR I;  4ANV A;  2LHE A;  3UGB B;  1TKY A;  1FXA A;  2PTL A;  3NZU A;  3LJ3 A;  3H9D A;  2ICI A;  4ANX A;  3HUI A;  3TEY A;  1IGC A;  3AE8 B;  4KV2 A;  1K52 A;  4GU2 A;  3X23 A;  4ARI A;  3N1Y C;  5HKH A;  3PZD A;  2K0P A;  4IKG A;  2MEK A;  1E90 A;  4FXC A;  4E3C A;  1C3T A;  2FCN A;  2PLP A;  5IA7 A;  1WH3 A;  3QAQ A;  2KZR A;  5BMG A;  2H89 B;  3RI7 C;  2NVU I;  1MVK A;  2K1F A;  3DPD A;  5JHB A;  1TZO A;  4ANW A;  1WIA A;  3ZDM C;  2WNM A;  4LLG M;  4OZC A;  2ZEQ A;  2M0A A;  2LMC A;  2ACZ B;  3J9C A;  1WX7 A;  2FBW B;  3VH3 B;  4XDC A;  1E7U A;  1DGJ A;  4M00 A;  2MLB A;  2V4L A;  4WAA A;  3U7Z A;  3BII D;  2NS5 A;  3EEC A;  1QOA A;  3ZXR A;  2ZVO A;  1WRI A;  2JXX A;  2LEK A;  2JYT A;  4YSZ B;  1WFY A;  4YXD B;  3PHX B;  3TMP B;  2LRW A;  1D6E C;  3JYU A;  4FJV B;  2FAZ A;  1Y56 A;  1I4Q A;  3FAH A;  1TYG B;  2BW2 A;  2UYZ B;  1ZDX A;  3DBH I;  4A9A A;  2IBI B;  2WXK A;  4A20 A;  2FE8 A;  1OGW A;  4NAW A;  2XK5 A;  5HI1 A;  1QQR A;  1C76 A;  1V49 A;  2C7M B;  5JH5 C;  1QKZ A;  3DBL B;  3WAM A;  3TEX A;  1AN8 A;  2K3U A;  1NYQ A;  3QIJ A;  1UZX B;  4AUQ C;  2A5U A;  2L00 B;  2FID A;  4KKJ A;  2RGF A;  2D3C A;  3AN1 A;  3L10 B;  5E6J A;  1V81 A;  3WAP A;  3H6N A;  4KX6 B;  3NUH B;  4B95 A;  5LXH A;  2AEH A;  3APD A;  1FRR A;  4TMA B;  3APC A;  5DPS A;  4KSL C;  1CJE A;  4LNF A;  2MQJ A;  2BWE S;  2XEW A;  2O6V B;  1SE2 A;  2BKR B;  1UWX A;  3AE5 B;  3EGR A;  2J52 A;  1MI0 A;  2PW9 A;  2FUH B;  2MBH A;  2M1M A;  2GBK A;  4A6Q A;  1JML A;  2DEN B;  1XLP A;  3OAW A;  3KUD B;  4PYU A;  1Q5W B;  2HJ1 A;  2LWP A;  3AM9 A;  1L2N A;  3PS6 A;  1WR1 A;  2G4S A;  3DQV A;  5AUK A;  2CR5 A;  2LVO A;  2RR9 A;  3FKY A;  4BVU C;  4EZK A;  2V0G A;  1P3Q U;  2XN9 C;  4JPS A;  1C78 A;  2WXJ A;  4HWI B;  4EZJ A;  4M02 A;  5AUI A;  1FFU A;  4NAW B;  4ARC A;  3HM3 A;  3GZN B;  3JSV B;  3FIL A;  1T0Y A;  2N0S B;  3Q3N C;  1PDX A;  3ZLZ A;  2EKI A;  1STE A;  4GB9 A;  1FPY A;  4AOF A;  4PS7 A;  2WXR A;  2Z59 B;  2WQY B;  4ZRK A;  3W1S A;  4BOS C;  2OHF A;  4ACF A;  2CS4 A;  3NVZ A;  1UBI A;  3NS8 A;  2PKO A;  4KGR A;  2VZK B;  2W9N A;  3VRA B;  1V97 A;  3AUL A;  1TKE A;  1F77 A;  3GE3 C;  5G55 A;  4AS1 A;  4RGM A;  5EE3 A;  4XWT A;  4DXG A;  2WS3 B;  3A9K B;  1FM0 D;  1HXY D;  1L6V A;  2EMS A;  2KLG A;  2QEJ C;  1E7P B;  3EC8 A;  1IPG A;  2WYQ A;  1AWD A;  3DVG X;  3Q69 A;  2O2V A;  1JWM D;  4WAF A;  2QJL A;  3NS1 A;  1QLB B;  4LJO B;  2BT6 A;  4P7I A;  1VLB A;  3N1Z C;  2FNJ B;  3PTF C;  3VQI A;  3UQA A;  2JF5 A;  2E3T A;  3LDZ E;  2R2Q A;  1JAL A;  1C77 A;  2G1E A;  5E6P A;  3WAL A;  1Q0W B;  3CMM B;  4L23 A;  2G9H D;  2MRP A;  2ASQ A;  3O13 A;  3V61 A;  2K8B A;  2JT4 B;  3VHT C;  3Q8C A;  2KDM A;  3BVZ A;  3QQ8 B;  1V5T A;  1F52 A;  3EUB 2;  4WJP A;  4USA A;  3B08 A;  4DHJ B;  1WJ6 A;  2BS3 B;  4PS8 A;  2MJE A;  1CZP A;  2D5G A;  1C9F A;  3VVW B;  2HTH A;  1FNV A;  2FUG 1;  5CHF A;  2JU6 X;  4N6E B;  2LXC A;  1WZ0 A;  3H7P B;  5FK9 C;  4BFR A;  3C8Y A;  4O1N A;  2KDI A;  2BS2 B;  2LAS A;  3PRP B;  1WXS A;  3P4S B;  3R7Q A;  5KHQ A;  3QC8 B;  2NTS A;  3Q3F A;  1ZE3 D;  2CU3 A;  3ZNZ B;  2L52 A;  3PSE B;  3ECI A;  4P1B C;  3IFW B;  1E8Y A;  2K6D B;  1UF0 A;  3V60 A;  2KX3 A;  4HJK A;  4HXD A;  1YIW A;  1R4N B;  3IT6 B;  2K6Q A;  3B0A A;  4IWP A;  3I63 C;  3V05 A;  2PVO D;  4HPL B;  2INN E;  2JVC A;  3IHP C;  1I4X A;  2N9K A;  3RYT A;  2RMM A;  3H7P A;  3N20 C;  4KSK C;  2D2Q A;  2QSD A;  3GOE A;  1WRD B;  2KN4 A;  3I9V 1;  2L76 A;  1ZP0 B;  1OEY A;  3BVG A;  1E0Z A;  3AEB B;  3KWL A;  2NPT A;  5AZF A;  4MGK E;  1YJ1 A;  4RF0 A;  4BZA A;  3A33 B;  2WX0 A;  3A1Q B;  1AW7 A;  2JPH A;  3W5V B;  3AU4 A;  3AU5 A;  1OQQ A;  2L0F A;  2N9L A;  1J7A A;  2LHD A;  5J18 A;  2KKC A;  4WWO A;  4ICV A;  3ZKJ C;  3K9O B;  4MEM A;  1N62 A;  4LDT B;  1C79 A;  1J7C A;  4YTM B;  1Y8R C;  2NPT B;  1XLO A;  2ZPY A;  4AJW A;  1GG3 A;  1NI2 A;  3QX1 A;  4TQ0 A;  4ZRP A;  1L4Z B;  1JQ4 A;  2DX5 B;  3NY5 A;  3P42 A;  1TTN A;  4MSM B;  3CWI A;  4PK1 A;  4EZL A;  3L4P A;  2NBV B;  3B2F A;  2J0J A;  2I2Y A;  1Z5S B;  3U4E G;  3E56 A;  1GC6 A;  3TSS A;  3L13 A;  3H1U A;  1MG4 A;  3B1L X;  1GUA B;  4KVG B;  5C3J B;  3R8B A;  4XZ4 A;  2N7E A;  2PEA A;  2AWT A;  4FBJ B;  5EE1 A;  3MC0 B;  3PZ8 A;  4DDG D;  3C19 A;  3NG0 A;  5T8I A;  2HTM E;  4A3O A;  2AQ2 B;  4DXF A;  3ALB A;  4GSW A;  3SU8 X;  2RDB C;  2K22 A;  2WU5 B;  4GIV A;  4WUR A;  4IUM B;  2ZNV B;  2R61 A;  1ZPS A;  1WM2 A;  1QOF A;  2BVC A;  1FCC C;  2JYE A;  4OZA A;  1FXT B;  1KLU D;  3RD2 A;  3C0R B;  2KMM A;  1WX8 A;  2JZZ A;  2O2V B;  4RNA A;  3UF8 A;  1ZXI A;  3RZW C;  1LGR A;  4ZRI A;  2BYE A;  4OHJ A;  4DXA B;  2J4X A;  3GP7 A;  1D5Z C;  4BBN C;  2KAC A;  5IN7 A;  1T6B X;  1EF5 A;  4E71 A;  4TV3 A;  4ASW C;  1JWS D;  4I6L B;  3ZJT A;  2KFK B;  2ZPN A;  4XX5 A;  3EA6 A;  3RNE C;  2JRI B;  1SEB D;  2N1W A;  4W9D A;  1WX9 A;  1SGH A;  5L83 A;  2YEP B;  1HE8 A;  2KMA A;  1JWU D;  1ENF A;  2GLS A;  1V5O A;  1SE4 A;  4G0N B;  1XF5 L;  4GLS C;  2G45 B;  5CX3 A;  1FNW A;  5G5H A;  4C00 A;  1ZGU B;  3QAR A;  4OZB A;  1V6E A;  4MSQ B;  5CHW A;  1IP9 A;  3P4R B;  4ZHO A;  3NVW A;  3SEB A;  1GNU A;  2C7H A;  4ZYS A;  4IC7 B;  1P1A A;  2DYM A;  1D5X C;  1JRU A;  2N1V A;  1GJZ A;  1E9M A;  3A9J A;  1YX6 B;  4JX1 C;  4MT5 A;  2QDF A;  3MC8 A;  2EEL A;  3TEW A;  3ZJU A;  1E8W A;  1BUI C;  1FEH A;  5FR6 A;  4C4V A;  3RFZ B;  1A5R A;  1VD2 A;  1A70 A;  4HPM B;  4YSY B;  2L3Z A;  2ZJD A;  1E10 A;  3N3K B;  2CHW A;  3A4S C;  3WAO A;  4EKU A;  2DBY A;  4IOI E;  1YN4 A;  1JCK B;  2MBE A;  2M4N A;  3PLU A;  3LYY A;  1CMX B;  4NJ6 A;  3AE9 B;  2KDF B;  2JY6 A;  3B9J A;  3GZN I;  2C9W B;  3A9K A;  3M63 B;  1MG8 A;  2LGI A;  3I3T B;  1K53 A;  3S2A A;  2DYO A;  1U4A A;  3M3J A;  3SD5 A;  4IW0 A;  4DWF A;  3DWG C;  4K3B A;  4C56 C;  2V3S A;  2D3B A; 
#chains in the Genus database with same CATH homology
 1RFK A;  2PVG C;  3PZ7 A;  1QOB A;  1KFY B;  5D3I B;  4US8 A;  1XEE A;  2N0S B;  1KRH A;  3AE4 B;  4YTP B;  4L2Y A;  4YSX B;  1PDX A;  3UI3 A;  1N61 A;  2EKI A;  1STE A;  3FC4 A;  3NRZ A;  1SSN A;  1YNT E;  1L0X B;  2WXR A;  4WIP A;  4TQ1 A;  3IAM 1;  2RDH A;  5HG2 A;  2WQY B;  2PIA A;  3W1S A;  3AB5 A;  1TY0 A;  2WDV B;  1HQR D;  1VDV A;  4B0M A;  1FFV A;  2OHF A;  5FKA C;  1VJK A;  2XNA C;  2WXP A;  3NVZ A;  3BVM A;  4ZOH C;  1I4H A;  1GAQ B;  2IGG A;  2PKO A;  4KGR A;  2VZK B;  3VRA B;  1V97 A;  1YN3 A;  3AE7 B;  4P16 A;  1TKE A;  3BZD B;  4MH8 A;  1F77 A;  2RPV A;  2WXG A;  2W3R A;  5EE0 A;  4AS1 A;  3TEZ A;  3I57 A;  4YT0 B;  4C7Y A;  2J53 A;  4RGM A;  5EE3 A;  1UUP A;  1JWB D;  2L1A A;  4XWT A;  2JWU A;  4DXG A;  2WS3 B;  4A8X C;  1WYG A;  1FM0 D;  1MHX A;  3BYY B;  1HXY D;  1L6V A;  1N5X A;  2QEJ C;  4ITK A;  1YJI A;  1E7P B;  4KGT A;  3KLS X;  2GB1 A;  4A90 A;  1AWD A;  5BYR A;  3Q69 A;  4LTU A;  1JWM D;  4WAF A;  3W2D A;  3P4P B;  3ZJV A;  5BYS A;  2Q5W D;  5JXV A;  1PGB A;  4YTN B;  1FD6 A;  2QJL A;  1L5P A;  2WXI A;  3NS1 A;  1QLB B;  2BT6 A;  2MJD A;  1SIJ A;  1TJE A;  3N9Y C;  1VLB A;  3MP9 A;  3W5U B;  3ZQ4 A;  3NVY A;  1F2R I;  4NJC A;  3VQI A;  1N5W A;  1BML C;  2DWQ A;  1EWY C;  1K51 A;  2CJO A;  2RDG A;  2E3T A;  2L83 A;  2ZW1 A;  3AH7 A;  4HEA 1;  4US9 A;  1JAL A;  2ONQ A;  1C77 A;  2G1E A;  1F2R C;  1SE3 A;  2MJ3 A;  1XLN A;  4IDI A;  4L23 A;  2G9H D;  1FNU A;  3MJ5 A;  3O13 A;  1ZDV A;  1NVI D;  2H88 B;  1GB1 A;  2WU2 B;  2M56 B;  3Q8C A;  2KDM A;  3BVZ A;  1HZ5 A;  2BYT A;  1B1Z A;  1TKG A;  1LO5 D;  3ZYY X;  2QIE B;  4NZL B;  1NEK B;  3EUB 2;  4USA A;  1J7B A;  4XDD A;  4CQN A;  2BS3 B;  2ON8 A;  3AEE B;  2MJE A;  1CK1 A;  1VR9 A;  1VRA B;  1CZP A;  1L0V B;  2AQ1 B;  2BB5 A;  2D5G A;  1I4R A;  1ZUD 2;  1GOZ A;  1XCT L;  4RGT A;  1QIL A;  1FCL A;  3KWV A;  3DWM A;  1C9F A;  1MHH E;  4TSS A;  4A55 A;  5D3D A;  1T5X D;  5TSS A;  1KTK A;  1FNV A;  2FUG 1;  4MAC A;  4JWU C;  1VZ6 A;  2WXH A;  2OED A;  1ET9 A;  4JWS C;  2JSV X;  2JU6 X;  1N60 A;  2Y5C A;  4N6E B;  4P6V F;  1B9R A;  4L1B A;  1N63 A;  1WGK A;  1HEZ E;  3BK1 A;  1PGX A;  2LUM A;  1YJJ A;  1Q10 A;  2BB6 A;  2GRI A;  1KF6 B;  5FK9 C;  1FRD A;  3C8Y A;  4O1N A;  1F0Z A;  5HFY A;  2NTT A;  2BS2 B;  2TSS A;  1XO3 A;  1EM7 A;  3P4S B;  2NTS A;  1YN5 A;  3PO0 A;  2QMT A;  2WXN A;  5BYQ A;  1UNS A;  1ZE3 D;  2CU3 A;  2L52 A;  1GB4 A;  1PYW D;  1I4P A;  2I38 A;  2JQR B;  1DOY A;  3IT6 B;  1JRO A;  2PVO D;  3V05 A;  2INN E;  1K50 A;  2BTE A;  1I4X A;  2N9K A;  2BBC A;  3T3O A;  2RMM A;  2LFI A;  3VR9 B;  1PGA A;  2JX5 A;  1I4G A;  1EWC A;  5G5G A;  2AQ3 B;  2QSD A;  3HVZ A;  3R2T A;  4RCO A;  3VR8 B;  1C4A A;  2KN4 A;  4AQ7 A;  3I9V 1;  1ZP0 B;  5C2T B;  3AEG B;  3U52 E;  4WH4 A;  3BVG A;  5BMI A;  4ZRQ A;  3SR6 A;  1E0Z A;  3B2G A;  1SB3 C;  5D7G A;  1WSP A;  4GDL B;  4KGS A;  2WXQ A;  1KLG D;  3AEB B;  1XXG A;  3KWL A;  2JZP A;  4RF0 A;  1SJE D;  4N58 A;  4WQM A;  3AEF B;  1AW7 A;  1IUE A;  4PT5 A;  3W9C B;  5FR3 A;  3W5V B;  1DYQ A;  3MFG A;  5BMH A;  3TUO A;  1OQQ A;  3T3N A;  1C4P A;  4RH6 A;  2N9L A;  3E9S A;  1J7A A;  4OVZ A;  1JW9 D;  2LHD A;  1V1P B;  1WXQ A;  2SEB D;  2ZW0 A;  4N59 A;  3Q8F A;  4REZ A;  1TS3 A;  3AEC B;  1N62 A;  1PUT A;  1C79 A;  3WCQ A;  1IGD A;  1C4C A;  1J7C A;  1VZ8 A;  1DOI A;  4D2K A;  4YTM B;  3AE1 B;  2K9X A;  2Z8L A;  1FMA D;  2WLB A;  1XLO A;  1JRP A;  3BK2 A;  1MPE A;  2KQ4 X;  3LB8 C;  3URY A;  3LXF A;  3Q8B A;  4JE3 B;  3U2S C;  3Q8A A;  3SFD B;  4TQ0 A;  4ZRP A;  1L4Z B;  1JWA D;  1TS5 A;  1JQ4 A;  2WDQ B;  3IXS A;  1NI3 A;  3P42 A;  1RWS A;  2IJ0 A;  1OFF A;  4RFB A;  3ZGZ A;  1EU4 A;  1HA5 A;  1ZOY B;  3CWI A;  3L4P A;  1NEN B;  2KAJ A;  1T3Q A;  1P7E A;  3FIL B;  1L0Y B;  4HKZ E;  1UGJ A;  3B2F A;  2I2Y A;  4LK0 M;  3U4E G;  1FO4 A;  3E56 A;  1TY2 A;  2V4I B;  1XCQ L;  3TSS A;  2W82 A;  4RGN A;  1ET6 A;  1L6U A;  1WWT A;  3Q8E A;  1R7S A;  1RM6 C;  5C3J B;  3R8B A;  1CQV A;  2N7J A;  1I7H A;  1UWM A;  1TS4 A;  2K5P A;  1YQ4 B;  3IAS 1;  2Y3A A;  1RYJ A;  5EE1 A;  2W55 A;  2IGD A;  3MC0 B;  2INP E;  4EE2 A;  2VZK D;  3PZ8 A;  4MM3 B;  2WXM A;  2LHE A;  1TKY A;  5T8I A;  1FXA A;  2PTL A;  1E6E B;  2HTM E;  2AQ2 B;  5H92 C;  4DXF A;  4C7Z A;  2NMQ A;  2IPK D;  3AV8 A;  3H8H A;  4DQO C;  2ICI A;  4RF1 A;  4UDU C;  3HUI A;  4WWM A;  3TEY A;  1IGC A;  3BWU D;  3AE8 B;  2AX5 A;  2IGH A;  1K52 A;  2K22 A;  2WU5 B;  4WUR A;  2R61 A;  1ZPS A;  2WXL A;  4ARI A;  2W3S A;  1QOF A;  1FCC C;  2JYE A;  2K0P A;  4OZA A;  4H2A A;  4IKG A;  2MEK A;  1KLU D;  3AED B;  4XE0 A;  3P63 A;  5I4D A;  3HRD D;  2KMM A;  1ROE A;  4FXC A;  1HZ6 A;  3V3X A;  4RNA A;  2HDE A;  4M0W A;  1ZXI A;  2PLP A;  3RPF C;  1SJH D;  4ZHP A;  1QT9 A;  5BMG A;  1D5M C;  2H89 B;  4OHJ A;  1ACC A;  1MVK A;  3AE6 B;  2MH7 A;  1TZO A;  2J4X A;  1M4V A;  2B76 B;  3GP7 A;  3HVD A;  2Y5P A;  1D5Z C;  2LJI A;  2SAK A;  2WNM A;  2KAC A;  4LLG M;  4OZC A;  1V1P A;  1T6B X;  1YQ3 B;  2M0A A;  2LMC A;  2ACZ B;  3J9C A;  1JWS D;  1QF6 A;  2FBW B;  4XDC A;  3BYT B;  3ZJT A;  5LNK 1;  1FIQ A;  2L32 A;  1KH0 A;  1DGJ A;  1ESF A;  3U7Z A;  2PMV A;  3BII D;  3GB1 A;  5HHD G;  1ZXH A;  1QOA A;  3AE2 B;  3EA6 A;  2GI9 A;  1VZ7 A;  1WRI A;  2JXT A;  2YEP F;  1SEB D;  2LEK A;  2JYT A;  4OW0 A;  1D4B A;  4YSZ B;  4YXD B;  3VRB B;  5MPO A;  1D6E C;  2E6X A;  1Y56 A;  1I4Q A;  4R3D A;  1YMH E;  1XLQ A;  3FAH A;  1TYG B;  2YEP B;  2BW2 A;  1ZDX A;  3GS2 A;  4A9A A;  2WXK A;  1JWU D;  3ETR A;  1ENF A;  2FE8 A;  1TS2 A;  1SE4 A;  1XF5 L;  4GLS C;  5HI1 A;  1L4D B;  1QQR A;  1FNW A;  4J3O D;  1C76 A;  3MHZ A;  3CIR B;  1SBB B;  4NAM A;  4HJG E;  5H8Y E;  2DLB A;  1QKZ A;  1QOG A;  3AEA B;  5G5H A;  3TEX A;  1AN8 A;  2K3U A;  4KKI A;  2X38 A;  1NYQ A;  3AE3 B;  4OZB A;  3SFE B;  3OWE B;  4KKJ A;  1V1O A;  3P4R B;  4ZHO A;  3AN1 A;  3NVW A;  5E6J A;  3SEB A;  3AMZ A;  2KWD A;  4ZYS A;  4HRO A;  2DYM A;  4KX6 B;  1NYR A;  3NUH B;  1D5X C;  1FRR A;  4TMA B;  4Q2J A;  1E9M A;  2CJN A;  1CJE A;  3P4Q B;  4HRS A;  1IBX B;  1EU3 A;  1SE2 A;  4JX1 C;  1AYF A;  4MT5 A;  1UWX A;  3AE5 B;  1P7F A;  3EGR A;  4C80 A;  2J52 A;  5GXG B;  4B0E A;  1MI0 A;  3R2I A;  2EEL A;  4YWG G;  2PW9 A;  3TEW A;  3ZJU A;  3P1M A;  1BUI C;  4GDK B;  1FEH A;  2WXO A;  4A6Q A;  4XWW A;  1JML A;  3RFZ B;  2IDY A;  1FXI A;  3NVV A;  1DOX A;  2W54 A;  1XLP A;  2WXF A;  1A70 A;  1SF0 A;  1IBX A;  2J42 A;  4YSY B;  2WDR B;  1E10 A;  3AM9 A;  4HKQ A;  2M19 A;  2V3P A;  2DBY A;  4IOI E;  1YN4 A;  2WP9 B;  1JCK B;  1PFD A;  5EE9 A;  5AUK A;  3LYY A;  3AE9 B;  2V0G A;  1SXT A;  1BXT A;  2XN9 C;  2BS4 B;  3FIL A;  4JPS A;  2V3N A;  1C78 A;  3IT4 B;  2WXJ A;  3B9J A;  5AUI A;  1OQR A;  2LGI A;  1FFU A;  1V8C A;  4RGO S;  1K53 A;  2DYO A;  4NAW B;  4ARC A;  3NZ3 A;  3DWG C;  3ABV B;  3KQ4 A;  1GPX A;  4C56 C;  2QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...