3B2GA

Leptolyngbya boryana ferredoxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-1
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Leptolyngbya boryana
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2gA00
3W9CB 4LTUA 1PFDA 1FXAA 1JWAD 3AEDB 4USAA 4N6EB 4ZHPA 2H89B 3VRBB 1PUTA 1DOXA 4WQMA 1IUEA 1XLOA 1JROA 3SFEB 4YSXB 4N58A 1FRDA 1QLBB 1XO3A 3LXFA 1RYJA 1WRIA 2MH7A 2MJ3A 2PKOA 2JX5A 2BT6A 2WDRB 3AMZA 1L6UA 4YSYB 4YSZB 4ITKA 1QOBA 3P4PB 3AEGB 2K5PA 1WWTA 1YJJA 2FBWB 2JQRB 3AEEB 3B2FA 4C80A 1OQQA 1E9MA 2H88B 1T3QA 1J7CA 1VLBA 1L0VB 1J7BA 3RPFC 3ETRA 3AN1A 4YTPB 3ZYYX 1ZOYB 3HUIA 1JW9D 5MPOA 3AE6B 2CU3A 4A9AA 1YQ3B 3VR9B 3L4PA 2PVGC 1EWYC 1SIJA 2HTME 3NS1A 3P4RB 2W54A 1UWMA 1FMAD 2BS2B 1QOGA 1JALA 3AE8B 3BIID 3VRAB 1XLPA 1OQRA 2WS3B 4N59A 1N63A 1TKEA 3W5UB 3B2GA 2ACZB 5G5HA 1TKGA 1VJKA 2E3TA 4YXDB 4JX1C 2B76B 1R7SA 4YT0B 1RFKA 1N5XA 1NEKB 1QF6A 1XLQA 3CIRB 1NVID 3FC4A 1SB3C 2EKIA 2WP9B 1N61A 3CWIA 4US9A 1TJEA 5EE9A 1RM6C 3P4QB 1KFYB 3AM9A 2KMMA 2CJOA 1E0ZA 1YJIA 5H92C 5EE0A 4C7ZA 1N60A 1N5WA 1QOAA 2LEKA 3P1MA 1ROEA 1OFFA 1NI3A 2BS4B 4ZHOA 2K9XA 1V8CA 1ZP0B 1TKYA 3NVYA 3NVVA 5GXGB 5G5GA 3DWMA 1WYGA 5AUKA 3P63A 2DBYA 2CJNA 4YTNB 1GPXA 2Q5WD 1NENB 4ZOHC 1FRRA 4KX6B 1SF0A 1ZUD2 3KWLA 5EE3A 1F0ZA 1FFVA 1JWBD 1JRPA 2N0SB 3NRZA 1AWDA 1L5PA 1JQ4A 2BS3B 3AECB 3B9JA 3P4SB 3W5VB 2WLBA 2OHFA 2M56B 3HRDD 1J7AA 1TYGB 3AE3B 4US8A 1DOYA 2DWQA 2QIEB 3PO0A 5AUIA 5C2TB 1E10A 1PDXA 4WWMA 4C7YA 3FAHA 2K22A 2WU5B 2WQYB 3LB8C 2PVOD 1WGKA 1RWSA 1FO4A 1NYQA 1FM0D 1L6VA 2AX5A 4YTMB 1KF6B 3AV8A 1XLNA 1I7HA 1NYRA 1AYFA 1QOFA 2WDVB 3DWGC 3EUB2 1A70A 3AH7A 3NVZA 4HRSA 3SFDB 1FFUA 2W3RA 3AE5B 2G1EA 1KRHA 2W3SA 3WCQA 2MJEA 3AEBB 3AEFB 3HVZA 1YQ4B 3VR8B 4P6VF 1DOIA 2MJDA 1E7PB 1ZXIA 1VDVA 3AE1B 1B9RA 1QT9A 3AEAB 3AE2B 4FXCA 4HROA 5C3JB 1V97A 3AB5A 1CJEA 1E6EB 2M19A 3ABVB 4JWSC 2KAJA 1CZPA 1FXIA 2W55A 3AE9B 3NVWA 4JWUC 5EE1A 2QJLA 1WXQA 2WDQB 2Y5CA 1DGJA 2WU2B 5H8YE 1N62A 2L52A 2L83A 1FIQA 2PIAA 1GAQB 3AE4B 3SR6A 4IDIA 3AE7B
chains in the Genus database with same CATH superfamily
4PYUA 3ZIMA 1DOXA 3ZQ4A 2EELA 1JROA 4YSXB 2N1VA 2D5GA 3EGRA 2WDRB 1P3QU 2AYOB 1S1QB 3FILA 1FPYA 1EF1A 1SGHA 3RNAC 1T3QA 4X57B 4Q2JA 1HTQA 5MPOA 3P4RB 2KDEB 3AE8B 4ZRIA 1E7UA 4W9KA 3ZUNA 3QWZB 4WWNA 2J42A 5G5HA 1TY0A 1KTKA 2LWPA 1F52A 1R7SA 5G2NA 2WX0A 1WR1A 2LXAA 2WP9B 4LNOA 3W1YA 2I2YA 1WH3A 2CJOA 1UBQA 2G3QB 3ZLZA 1WGYA 4ZHOA 5GXGB 4LLGM 4NJ7A 4A55A 3ZTDA 1L0XB 3ZGZA 1GC7A 2Y3AA 4ANUA 3C0RB 1YMHE 1AWDA 2DNFA 4MGYE 1LM8B 2LVOA 2YEPF 2LUMA 1YQBA 3CF6E 1WMHB 2V1YA 4NAWA 5AUIA 2PE6B 2KDFB 4WWMA 3SHQA 1NYQA 2LUEA 3N20C 3A1QA 4XYCA 3ALBA 3ZJVA 3MC9A 1VZ6A 2KD0A 4IKGA 2JU6X 3ZVVA 3T9LA 3IT4B 2D07B 2IY0B 2W3SA 3PHWB 4DHJD 4M0WB 1E7VA 3E56A 5E6JA 1TIFA 2EMTA 3PPAA 2D3BA 4JPSA 1E6EB 3T3NA 2KAJA 3EECA 2ZW1A 4P16A 1ZDVA 2Y5CA 4XWTA 1DGJA 1WSPA 2PIAA 3AE4B 2I1KA 3ZNID 2NCNA 4ZHPA 1PUTA 1C77A 3ZDTA 4K1RB 3P1MA 4AS1A 2PMVA 3GOEA 4YSZB 1QOBA 2V3NA 3P2BA 1WWTA 2FIDA 3Q8CA 3AEEB 3B2FA 4GIVA 4YWGG 3PGEA 3JSVB 3ETRA 3PTFC 3V60A 4K3BA 3RNGC 4A9AA 1F2RC 3EA6A 2M0AA 3FILB 4HPLB 1UWMA 2L7RA 5E6OA 1T0RC 2BBCA 3W5UB 1JWUD 1V1PA 1NVID 2DYMA 3P42A 1YD8U 4BKSA 3BWUD 4LJOB 2C7HA 4CYEA 2C60A 1HZ5A 4EEWA 1WYGA 4G11A 3W2DA 1C3TA 4UDUC 2Y5BB 5EE3A 3GZNI 5DPTA 2MQJA 2XBBC 1P98A 2V0GA 1J8CA 1AN8A 1Z5SB 3DVNU 2G4DB 5KHOA 3AU4A 3PVLA 3UGBB 5BYRA 3MTNB 4GXBA 1F1HA 3N9YC 2JXXA 1L6VA 3ZJTA 1KF6B 2VH2A 3C19A 1GB4A 4NAWB 1A70A 4BKSD 2KJ6A 3HHMA 3VR8B 3A1QB 2NVUI 3QCAA 3ECIA 3E9SA 1Q0WB 4JWSC 2ZNVB 3OWEB 2J4XA 5C23A 1UZXB 3BYYB 4IDIA 2WXHA 3R2IA 3DOWA 3J9CA 4AWJA 1WFYA 1FEHA 2G9HD 2WXQA 3Q3NC 2JVCA 3AI5A 3VUWA 4ITKA 3OJ4B 1V81A 2DX5B 3W1SC 2AEHA 2K3UA 4IWOA 2RDHA 2LGXA 1YQ3B 2CHWA 2ZPYA 3NY5A 1M4VA 4RGTA 4F8CB 2ACZB 1LXDA 3DCGA 2JZPA 4MACA 1NEKB 2N7DA 1FXTB 4OVVA 2R2OA 4KDIC 1RM6C 4EZLA 5LXHA 4TQ0A 4KGSA 4W9IA 4L2YA 4WJNA 2NBWB 1E90A 1V1PB 4II2B 4MGKE 3RCZA 1F0ZA 2LZ6A 1OEYJ 3ZXRA 1MFWA 1FD6A 2HJ1A 2WLBA 3R8BA 2N7EA 2Z0EB 2KWCA 3DHIC 1Y8RC 1SBBB 3BVMA 2GBJA 2J0KA 4K7UA 2FCSA 2N7JA 1GUAB 1PGAA 3KW5B 3IXSA 1FO4A 2QC8A 4KGTA 1FCCC 1QKZA 4TMAB 1ZKHA 3AV8A 1WE7A 1AYFA 3CSFA 1QOFA 4WURA 3SFDB 3AE5B 2G1EA 3BK1A 2KJRA 1Q5WB 4MSQB 2I1JA 3TBLD 1SE4A 2AL3A 2J0JA 4HDQA 1V97A 3EC8A 1I4XA 1IGCA 1TT5B 1V80A 2OOBB 1N62A 5CHWA 2IY1B 3TCAA 3U8ZA 3RFZB 2MCNB 2H89B 2LRUA 4FJYA 4WQMA 2KDBA 3DHGC 1IUEA 3SFEB 2PKOA 4LDTD 1UH6A 1MHXA 2FE8A 4QAYA 5J2RA 4WWPA 2KLGA 2L8JA 3A33B 1WGRA 4ZRPA 4KZCA 1NI2A 1ZOYB 1SSNA 2HTME 3ZNZB 4A20A 2CHZA 4IOIE 1ZE3D 4W9JA 2VH1A 1HZ6A 4HDOA 5BMHA 1E5WA 4H2AA 4ZRJA 3CWIA 3RZFA 4EZKA 4FA6A 1N5WA 2D10A 1NI3A 5EDSA 2KNBA 4HCNB 2DHZA 3BINA 2X8XX 1GPXA 1IP9A 4GSWA 1MG4A 4WH4A 4C00A 3UQBA 1K53A 4OZAA 2FCQA 3APFA 4WJOA 3MJ5A 4GMVA 2INCC 4I6NB 2PVOD 2AX5A 2LVQA 2GBKA 2LHDA 2WYQA 1XQQA 2NS5A 3DBSA 2CHXA 3V6EB 2W3RA 3MFGA 2J0MA 2WXPA 2VRRB 1JWSD 2WXKA 2NPTA 1E7PB 3AEAB 3T8MA 3APDA 2KLCA 2LD9A 3PZ8A 3BVGA 2AL6A 2WX1A 2REXA 2C7MB 4HLEA 3RNBC 1JWAD 3DBLB 1STEA 2GOWA 4XDDA 4K7SA 1SEBD 3NZ3A 2MJ3A 2BT6A 3V61A 2ASQA 4DHZE 2K5PA 3V6CB 4S0RA 4C80A 1OQQA 3HVDA 1ZDXA 1SXTA 3VR9B 1FCLA 2JXTA 1SIJA 2AWTA 3NJTA 2KN4A 4HKZE 2INDC 3L08A 4G3XB 4RNAA 2ZJDA 1XEEA 3QJZA 1SB3C 4WJQA 1MPEA 2XN9C 4IW0A 1ROEA 1YN3A 3N1ZC 3Q3OC 4LNIA 1CMXB 3L13A 4DHZB 3UF8A 2M17A 1EU3A 2NTSA 1JWBD 2N0SB 3NOBA 2LI5A 4BZAA 3I9V1 3ZO5B 3LYYA 1YX5B 2DWQA 3NZSA 1D5ZC 1JMLA 3AXCA 5JZEB 2K22A 2FNJB 3MHZA 2KC2A 1TTNA 5BMIA 3VH3B 1I7HA 1NYRA 4PT5A 4OZBA 1WMHA 3NVZA 3VVWB 3OG5A 2FCNA 4BKGA 1GG3A 2GBRA 3B0AA 2D3AA 2BVCA 1H8CA 2MJDA 2JYTA 3UQAA 1LFDA 4PK1A 1UNSA 2HJ8A 4FULA 2NPTB 1KM7A 1PFDA 3SD5A 4HXDA 1K50A 1WX9A 1FRDA 1QLBB 3Q3MC 4B0MA 1VR9A 5HI1A 1CK1A 3DBHB 3P4PB 5FR3A 2RDBC 4MGZE 1SE3A 2R2QA 2UWQA 4W9GA 1I4PA 4WAFA 2K8BA 4KSKC 4REZA 3HUIA 1A5RA 2DENB 1XXGA 2WS3B 2L0FA 1L4DB 1L7YA 1TKGA 2E3TA 4ZRKA 5G55A 3JSVA 3CIRB 4EE2A 3DVGY 4K81A 2KKCA 3R7RA 3GP7A 1E0ZA 2LJIA 1KLUD 1LGRA 1N60A 3U7DA 2BS4B 3DVNV 2ZEQA 3NVVA 2CKHB 2RGFA 4TSSA 1RFAA 2MEKA 5FR6A 2BKRB 2JPHA 1P7FA 4LK0M 2V9HA 4E3CA 3A9JA 1J7AA 4US8A 2FIFA 2BB6A 3PO0A 2KC1A 3H6NA 2I38A 2W9NA 3RN9C 1PYWD 3JW0X 4DBGA 2WQYB 1J19A 2IJ0A 4XGAB 1T0QC 2QEJC 4KIKA 2AQ1B 5LXIB 3OJ3A 1N6ZA 2WWZA 1FFUA 2DLBA 3IAM1 2UU7A 2RSUA 1AW7A 3AE9B 4GOCA 4ACFA 1WXQA 4K7WA 3NZUA 4M8NA 1WZ0A 3VUXA 3ZRCA 1ZXHA 2SAKA 2KMCA 2M0XA 2V3PA 1WX8A 2BYFA 4ZRQA 1ACCA 2KX3A 3QX1A 3L54A 5CTRC 2JX5A 3N32A 4DWFA 1TBEA 4LNFA 3ML9A 1HEZE 1E9MA 4MELA 3K9PB 4MSMB 2Z0DB 2W54A 3TJPA 1JALA 3WALA 4WIPA 1WJ4A 2FAZA 1N63A 3L16A 4EKUA 1QF6A 4EZJA 4RFBA 4RM9A 3PZ7A 4HVBA 3P4QB 5BYQA 1IYFA 2DAFA 5TR5A 2JYEA 2K9XA 3NVYA 3NUHB 4IM2A 1YOVB 5AUKA 3BY4B 4AUQC 1XT9B 2PLPA 5D3DA 3KWLA 4ZDVA 1WJ6A 3V3XA 1L5PA 2L1AA 2Z8LA 5JXVA 5E6PA 3AULA 1SE9A 5J18A 1TYGB 5LNK1 2KFJA 1WGGA 4RF0A 4S17A 4C7YA 1WX7A 3EFUA 5JHBA 1RWSA 3A9JB 2RPQA 3AU5A 3U2SC 3PLVA 4DHJB 3DWGC 4F1SA 4IG7B 3ZNGC 3RMKC 4P6VF 4KIKB 2ZW0A 1WXAA 4G50A 1E8WA 1F77A 2MBBB 2TSSA 1BT0A 2MX2A 2QMTA 1WJNA 3GE3C 2HTHA 2ZCCA 4I6PA 1TY2A 4I6LB 3APCA 4JE3B 4USAA 4HPPA 4AJWA 1D5XC 3LXFA 4GDKA 2E6XA 3R7QA 2INNE 2BYEA 1VLBA 2KVRA 2KK8A 5BYSA 1TS2A 4AOFA 1KOTA 4B95A 4MT5A 3RYTA 3KUCB 3OLMD 3VXWA 3QC8B 4WJPA 1SJED 2K6DB 1ENFA 4RGNA 2ON8A 3H7SA 1Z2MA 1V6EA 1WXVA 1N61A 3DDCB 4FHJA 5IO9A 4LCDE 2G45B 3QAQA 2MBHA 1K52A 1X1MA 3IAS1 4EFOA 1D4BA 1TKYA 4II3B 1UWXA 1UUPA 4RGOS 1EU4A 1C79A 2XK5A 1JCKB 1S3SG 2ZNVC 3AECB 2VZKD 2J52A 3AE3B 4ANVA 3A4SC 1KH0A 1MJDA 3EHVA 4DDID 1FM0D 3L17A 2MP2A 4B9KA 2JWZA 3AEBB 2BKFA 1YN5A 2BYVE 4B6WA 4KDLB 1C76A 1Q1OA 1WYWB 2M19A 2NMQA 4BBNF 4GN1A 3SEBA 3UI3A 3M63B 3RD2A 5AZGA 3GZNB 2KHWB 1OGWA 4M00A 2EMSA 1IGDA 2FUG1 4C4VB 5IP4D 3X0WA 3Q8BA 1RYJA 1VRAB 4IM3A 1IPGA 3VDZA 2WXIA 3WIMA 2RDGA 1J7BA 4XZ4A 4GDKB 2V3SA 1BUIC 2PJHA 4TUUA 3BIID 3WA0A 3KYDD 3RNFC 2N9EB 3RI7C 1PGXA 2OJRA 2PE9A 3AM9A 3DHHC 2ZVOA 5H92C 2Z59B 4XE0A 4IWQA 4ZYNA 1WJUA 2LEKA 2BB5A 2YLMA 4FBJB 1V8CA 3QARA 1EO6A 4NQLB 2KTFA 1WGHA 3PREA 4ZYSA 2KDMA 2MA9B 5HFYA 3VTUA 3B9JA 2RD0A 2M56B 3N3KB 4FHKA 2WGSA 1WY8A 2XK5B 4HJGE 4GLSC 2O6VD 1R4MI 2QDFA 2ZVNA 2LRWA 2N9XA 2WDVB 4AQ7A 2GMIC 1VD2A 1EUVB 4HCPB 2IZVB 1Y56A 2DZIA 3VAWA 1DOIA 2KDIA 2MP2B 4NQKE 4ICVA 4NNJB 3CSTA 1I4QA 3PHXB 4R3DA 4IUMB 1EWCA 2K0PA 4A3OA 2UYZB 2WXLA 4DXFA 3R3MA 4ARIA 2KO3A 2RR9A 1GC6A 4W9FA 4DK5A 3H9DA 4LDTB 3FKYA 4JLCA 2JSVX 2KACA 2K39A 1J7CA 1E8XA 1L0VB 5DPWA 3RPFC 3AN1A 5JHAA 3DVGX 2D2QA 3AE6B 1EWYC 1TGZB 3GB1A 1D6EC 4N59A 3B2GA 4DXGA 1WXMA 2LFIA 1SE2A 5E6NA 4G0NB 2LXCA 4CHKA 5DCNA 1QOAA 5DPRA 3RT3B 2CU1A 5D2MB 2KQ4X 3WAOA 4BKTA 3D32A 3I57A 3L10B 2KWVB 3CMMB 3L0WB 1XCTL 2BS3B 2LGIA 5JH5C 3PRZA 1WIAA 2K8HA 3BYTB 1DOYA 4NJCA 4EOYA 2QIEB 2N9KA 4KKJA 3EFCA 2KFKA 4RM8A 1TZOA 4XC2A 4JIOU 3N30A 2GLSA 5J17A 3PLUA 1AARA 4IWPA 1UGJA 2IPKD 3PZDA 4KKIA 1P0RA 3DPDA 1KRHA 2L05A 3Q8AA 1MVKA 1ET6A 3X23A 4JGHB 1ZXIA 2L3ZA 3I3TB 2LVPA 1R4MB 3MHSD 5EE1A 5AZFA 4BOSC 1BMLC 1HXYD 4JL9A 5IOIA 3A9KB 5H8YE 3SR6A 1D3ZA 4WWOA 2KTRB 2BYTA 2A4ZA 3ZDMC 3AEGB 2MLBA 1IBXA 1B1ZA 3RNCC 1VCBA 5IAAC 1WE6A 4OW0A 2K1FA 3MC0B 3L4PA 3NS1A 4B0EA 1WZ3A 1KLVA 3M95A 3VTWA 4YT0B 4PS7A 1XLQA 4URKA 3Q3JA 1TJEA 1HE8A 2ICIA 1KFYB 1F2RI 4C7ZA 1I4GA 4JQWC 3TL5A 2IGGA 2DBYA 2CJNA 4NJ6A 5TSSA 3TEZA 1FRRA 4KZ0A 3WANA 1HA5A 2JY6A 1G6JA 1R4NI 3PRPB 3W5VB 3C8YA 3HM6X 4AP4C 2KJHB 2R61A 2XEWA 1E10A 1PDXA 4ICUA 1UGMA 1WGKA 4ANXA 3VUYA 2DYBA 1T0SC 1XLNA 4MM3B 4NPNA 4A90A 3PT2B 3AH7A 4LNNA 2KFKB 5CHVC 3ONSA 1V2YA 2JF5A 3MP9A 1FNUA 2AQ2B 1C78A 1LQBA 1T0YA 3AE2B 2GBMA 4JWUC 2W82A 2W55A 3NVWA 2KT7A 1SJHD 3AE7B 3IG3A 1I35A 4O1NA 4W9LA 3OAWA 3LJ3A 4PS3A 3QK0A 4W9HA 1XLOA 3ZKJC 4N58A 2JRIB 2LJ5A 3NHEB 3UIPB 2KYWA 3AMZA 2HDEA 2WXOA 1LO5D 1YJJA 4LNKA 3QIJA 1OQYA 1C4CA 4YTPB 1ISNA 2CU3A 3VFKA 1QOGA 3VRAB 1IBXB 4IC7B 3ZXVA 1C4AA 3Q69A 2PW9A 2C7NB 3BZDB 2N9LA 1L4ZB 1YIWA 3K9OB 1UF0A 4PYZA 1WRDB 5HG2A 2O2VA 2D3CA 3W1SA 4GB9A 1WM2A 1I4RA 5CX3A 3H7PA 2MRPA 3LDZE 2JZZA 5IA7A 1ZUD2 5L83A 3NRZA 1V5TA 5IKCM 4IM0A 3UINB 3VHTC 4P1CC 1KLGD 3HIZA 2ONQA 1NDDA 4KGRA 3A4RA 1BXTA 4YTMB 1R4NB 1P7EA 3DQVA 3Q6BA 4K3CA 3V05A 2D3GA 4PS8A 2ZCBA 4C56C 5AEKB 4RH6A 4HROA 4FXCA 1V9JA 2KXJA 3Q14C 2YEPB 4TV3A 3AB5A 3GE8C 1CZPA 1FXIA 2QJLA 3RULA 4HEA1 2L52A 2KZRA 4HJKA 4HKQA 4ANWA 1FXAA 3VQIA 1RAXA 4N6EB 2IO3B 5KHQA 2MWSB 4DQOC 2NTTA 1U4AA 1XO3A 3H8HA 4KVGB 3R2TA 4YSYB 3TEXA 1L6UA 4RF1A 2JQRB 2ZPNA 4FJVB 3SDLC 4MDKE 4C4VA 2GBNA 2IO1B 3PRMB 4TQ1A 4BAXA 2PVGC 4A3PA 3ZW3A 3NG0A 1YN4A 1XLPA 2KANA 4FJZA 3Q3FA 4FADA 2B76B 1N5XA 4BOZB 3FC4A 4US9A 2KMAA 5EE9A 3GS2A 3MC8A 5EE0A 1WF9A 3B1LX 3RUIB 2BTEA 2OEDA 2RMMA 2IO2B 3QQ8B 3P63A 4YTNB 2MBOA 5FK9C 2IO0B 2O2VB 2KQ7A 1F9JA 4XDCA 1JQ4A 1EM7A 3H7PB 4F7ZA 2NR2A 2QCZA 4W9EA 1PQSA 2ZZPB 2KQSA 1YX6B 2C9WB 2KWUB 2WNMA 4OHJA 1UBIA 1GNUA 4W9CA 2RPVA 1XD3B 1C1YB 2BGFA 3BVZA 2FUHB 3AEFB 1TS5A 2XNAC 4YL8A 3Q8EA 1B9RA 3M3JA 4M02A 2L32A 1HTOA 2WXNA 3U30A 2MW5A 3TEYA 1T6BX 2M4NA 2JUOA 3AEDB 3M62B 3U4EG 2JWUA 3TSSA 2MH7A 1ZW7A 3N1XC 1WXSA 3S2AA 3ZNHB 1K8RB 2DZKA 1OEYA 2D11A 3KQ4A 2H88B 3H1UA 3Q2AC 4E71A 2JZ3B 1GB1A 1EF5A 5AZHA 1NBFC 1C4PA 4CQNA 2L0TA 1KJTA 2WDTB 4A8XC 1T5XD 4HWIB 1V49A 2LGYA 1TKEA 5D6JB 4DDGD 1VJKA 1QQRA 1MG8A 2CR5A 1M94A 2PEAA 1ZGUB 2IGHA 4NZLB 5D3IB 2KOXA 2JRHA 4A6QA 1HQRD 1OFFA 3IT6B 1GJZA 1ZP0B 4ASWC 2INPE 5G5GA 3PV1A 3DWMA 1OTRB 1P9DU 1J0GA 4WAAA 4ZOHC 4ARCA 2BW2A 2AQ3B 5I4DA 3KVFB 5HHDG 2O6VA 2QHOA 2VZKB 4L1BA 1V1OA 2WXJA 3DBLI 3KH0A 4OVUA 2BPSA 1MHHE 4W9DA 4MH8A 3HM3A 3SU8X 3KYCD 2HE7A 2L00B 5C1ZA 2IYDB 5BMGA 3NS8A 3IFWB 3DBRI 1MI0A 2A5UA 3WAPA 3Q8FA 3WAMA 4HRSA 2PPHA 1I4HA 4GU2A 4CO7A 2DYOA 3RZWC 5CHFA 1TS3A 5IN7A 1VDVA 4BVUC 1QZEA 2WXRA 1Q10A 4NY0A 4LJPB 4MH0E 1K51A 3PSEB 1L2NA 2KWDA 1FIQA 1GAQB 1WGDA 2KVZA 3W9CB 3I5JC 1XCQL 3VRBB 2IDYA 2M1MA 4GDLA 4XWWA 3ZJUA 2V4LA 1H4RA 3A9KA 1VZ7A 2WHIA 4BBNC 4OZCA 2MSED 2KTRA 4MJSA 3TUOA 4N9F4 2J53A 2J7QB 5BO4B 1FMAD 3IBEA 5D94A 2MBQA 3R66C 3ZRFA 4MEMA 4JX1C 2WXGA 3BK2A 4FLHA 2EKIA 4NAMA 4RMAA 2V4IB 3TIXA 1V5OA 1YJIA 1E8YA 4P7IA 4L23A 3VH4B 2DZMA 2BF8B 1QILA 2SEBD 3ML8A 2YVCA 4MGIE 1NENB 5HKHA 1ESFA 2LASA 4KX6B 1YJ1A 1FFVA 5DPSA 4J3OD 2LGSA 3ZTCA 1DYQA 2G4SA 2N1WA 1E8ZA 5C2TB 3DBHI 2O6VB 4EUTA 3FAHA 3IHPC 3LB8C 4D2KA 2BWFA 4TKNA 2K8CA 2DAJA 2BWES 3N1YC 2OJWA 4RGMA 2X38A 1SIFA 2MJEA 1YQ4B 2GI9A 2LGDA 2Y5PA 4M8MA 2L76A 3VTVA 3AE1B 1CQVA 1QT9A 3JYUA 4MM3A 3O13A 1CJEA 4FN2A 1WM3A 3T3OA 3UIOB 2GB1A 3DBRB 4OVZA 2L83A 2LMCA 4LTUA 2KX0A 2HD5B 3ENEA 4BFRA 4HK2A 3TMPB 1L0YB 3KLSX 1PGBA 2PTLA 1WRIA 3JVZX 4XX5A 2GRIA 4KV2A 4P1BC 1ET9A 2FBWB 4E74A 4KSLC 1TZ1A 3PS6A 1UD7A 3I63C 4GDLB 2C5LC 2IGDA 5FKAC 3ZYYX 1JW9D 4AJYB 2BS2B 1VZ8A 4WQOB 1FNWA 3HK0A 1OQRA 2WXFA 2IBIB 1JRUA 4YXDB 1RFKA 4MJSB 2K25A 2CS4A 1XF5L 1FNVA 3U7ZA 2KMMA 3B08A 1JWMD 5D7GA 4GGQA 2KN5A 3TEWA 2JT4B 3KUZA 2DZJA 4HPMB 4DXAB 2LHEA 2Q5WD 3MJWA 2QSDA 4M01A 1RRBA 1SF0A 3IVFA 1JRPA 2B3AA 5T8IA 1WR6E 3P4SB 2OHFA 3HRDD 2M8SA 2MBEA 2WXMA 5L95C 1YNTE 3KWVA 1D5MC 2WU5B 5LLIA 3KUDB 1TS4A 3O65B 2EKEC 4M0WA 2N4FA 3RNEC 4J6IA 1RLFA 3EUB2 4RCOA 3QHTA 3U52E 1I42A 3WCQA 3HVZA 1C9FA 1GOZA 3URYA 1P1AA 2K6QA 2NBVB 1WI0A 1UELA 1V86A 2BQQA 5C3JB 2FCMA 3ABVB 2MHJA 2QILA 1ZPSA 2WDQB 2NBUA 2WU2B 3V62A 3QA8A 2N9PC 5GMVA
chains in the Genus database with same CATH topology
1FXAA 3VQIA 1JWAD 4N6EB 1IGDA 2FUG1 1STEA 1DOXA 4XDDA 3ZQ4A 2EELA 1JROA 4DQOC 4YSXB 1SEBD 2D5GA 3EGRA 2NTTA 3H8HA 1XO3A 3NZ3A 1RYJA 2MJ3A 3Q8BA 1VRAB 3R2TA 4YSYB 2BT6A 2WDRB 3TEXA 1L6UA 4RF1A 3FILA 2K5PA 2JQRB 4C80A 2WXIA 1OQQA 3HVDA 1ZDXA 1SXTA 1T3QA 2RDGA 1J7BA 4Q2JA 4TQ1A 4GDKB 5MPOA 3VR9B 1FCLA 2PVGC 1BUIC 1SIJA 2JXTA 3P4RB 2KN4A 4HKZE 3AE8B 3BIID 1YN4A 1XLPA 4RNAA 5G5HA 2J42A 1KTKA 1TY0A 2B76B 1R7SA 1N5XA 1XEEA 3FC4A 4US9A 1SB3C 2WP9B 1PGXA 5EE9A 3AM9A 2I2YA 3GS2A 2CJOA 5H92C 5EE0A 4XE0A 1MPEA 2XN9C 2BTEA 2OEDA 2LEKA 1ROEA 1YN3A 2BB5A 4ZHOA 1V8CA 2RMMA 5GXGB 4LLGM 4ZYSA 4A55A 1L0XB 2KDMA 3P63A 4YTNB 3ZGZA 5FK9C 2Y3AA 1EU3A 5HFYA 2NTSA 1JWBD 2N0SB 4XDCA 1YMHE 1AWDA 1EM7A 1JQ4A 3I9V1 2YEPF 2LUMA 3B9JA 2M56B 3LYYA 2DWQA 1D5ZC 5AUIA 4HJGE 4GLSC 1JMLA 4WWMA 2WNMA 2K22A 3MHZA 4OHJA 1NYQA 5BMIA 1I7HA 1NYRA 4PT5A 3ZJVA 1VZ6A 2WDVB 4IKGA 4OZBA 2JU6X 2RPVA 3NVZA 4AQ7A 3IT4B 3BVZA 2W3SA 3AEFB 1Y56A 1TS5A 3E56A 1DOIA 2XNAC 2MJDA 2JYTA 3Q8EA 5E6JA 1B9RA 1I4QA 4JPSA 4R3DA 1E6EB 2L32A 3T3NA 2KAJA 2ZW1A 1EWCA 2WXNA 1ZDVA 4P16A 2Y5CA 1UNSA 4XWTA 2K0PA 1DGJA 3TEYA 1T6BX 1WSPA 2PIAA 2WXLA 4DXFA 3AE4B 4ARIA 1PFDA 3AEDB 4ZHPA 3U4EG 1PUTA 1C77A 1K50A 2JWUA 1FRDA 1QLBB 3TSSA 3P1MA 1VR9A 2JSVX 2KACA 2MH7A 4B0MA 2PMVA 4AS1A 5HI1A 4YSZB 1CK1A 1QOBA 2V3NA 3P4PB 5FR3A 1WWTA 3Q8CA 3AEEB 3B2FA 1SE3A 3KQ4A 2H88B 4YWGG 1J7CA 1I4PA 1GB1A 1L0VB 4WAFA 3RPFC 3ETRA 3AN1A 4REZA 3HUIA 1C4PA 4CQNA 3AE6B 4A9AA 1F2RC 3EA6A 1EWYC 2M0AA 3FILB 1UWMA 3GB1A 4A8XC 1T5XD 1XXGA 1D6EC 2BBCA 2WS3B 1L4DB 4N59A 1TKEA 3W5UB 3B2GA 1TKGA 1VJKA 2E3TA 4DXGA 2LFIA 1JWUD 1QQRA 1V1PA 3CIRB 1NVID 1SE2A 4EE2A 2DYMA 3P42A 3BWUD 3GP7A 1E0ZA 2LJIA 2IGHA 4NZLB 5D3IB 1KLUD 1N60A 1QOAA 4A6QA 1HQRD 1OFFA 2BS4B 3IT6B 1ZP0B 1HZ5A 3NVVA 2INPE 5G5GA 3DWMA 1WYGA 4TSSA 3W2DA 2MEKA 4UDUC 4ZOHC 4ARCA 2BW2A 2KQ4X 2AQ3B 5I4DA 5HHDG 1P7FA 5EE3A 4LK0M 3I57A 2VZKB 4L1BA 1V1OA 2WXJA 1XCTL 2BS3B 2LGIA 2V0GA 1AN8A 1MHHE 4MH8A 1J7AA 3BYTB 4US8A 1DOYA 4NJCA 2BB6A 5BYRA 2QIEB 3PO0A 2N9KA 4KKJA 2I38A 1PYWD 3N9YC 2WQYB 1TZOA 2IJ0A 5BMGA 1L6VA 2QEJC 3ZJTA 2AQ1B 1KF6B 1GB4A 4NAWB 1MI0A 3Q8FA 1A70A 1UGJA 2IPKD 4HRSA 4KKIA 1FFUA 1I4HA 1KRHA 3Q8AA 2DLBA 2DYOA 1MVKA 1ET6A 3IAM1 3VR8B 1TS3A 1ZXIA 1VDVA 1AW7A 2WXRA 1Q10A 3E9SA 4JWSC 3OWEB 3AE9B 5EE1A 1BMLC 1HXYD 1WXQA 1K51A 2J4XA 5H8YE 2KWDA 3BYYB 1FIQA 1GAQB 3SR6A 1ZXHA 2SAKA 4IDIA 3W9CB 1XCQL 3VRBB 2V3PA 2IDYA 2WXHA 4ZRQA 4XWWA 1ACCA 3R2IA 3ZJUA 3J9CA 2BYTA 1FEHA 2JX5A 2G9HD 1VZ7A 2WXQA 4ITKA 3AEGB 1IBXA 1HEZE 1B1ZA 1E9MA 4OZCA 4OW0A 3MC0B 2K3UA 2RDHA 3TUOA 1YQ3B 2J53A 3L4PA 3NS1A 2W54A 1FMAD 1JALA 4WIPA 4B0EA 1M4VA 4RGTA 1N63A 2ACZB 4JX1C 2JZPA 2WXGA 4MACA 4YT0B 1NEKB 3BK2A 1XLQA 1QF6A 4RFBA 2EKIA 3PZ7A 4NAMA 1TJEA 2V4IB 1RM6C 2ICIA 1KFYB 3P4QB 5BYQA 4TQ0A 1F2RI 1YJIA 4KGSA 4L23A 4C7ZA 4L2YA 1QILA 1I4GA 2JYEA 2K9XA 2SEBD 3NVYA 1V1PB 3NUHB 5AUKA 2IGGA 2DBYA 2CJNA 5TSSA 2PLPA 1NENB 3TEZA 1FRRA 1ESFA 4KX6B 5D3DA 3KWLA 1HA5A 1F0ZA 1FFVA 3V3XA 1L5PA 1FD6A 4J3OD 2L1AA 2Z8LA 3C8YA 3W5VB 2WLBA 1DYQA 3R8BA 5JXVA 1TYGB 5LNK1 2R61A 1SBBB 3BVMA 5C2TB 4RF0A 1E10A 1PDXA 4C7YA 3FAHA 4D2KA 3LB8C 2N7JA 1PGAA 1WGKA 1RWSA 3IXSA 1FO4A 4KGTA 1FCCC 1QKZA 4TMAB 3AV8A 1XLNA 4MM3B 3U2SC 1AYFA 4A90A 1QOFA 3DWGC 4WURA 3AH7A 3SFDB 3AE5B 2X38A 4RGMA 2G1EA 3BK1A 3MP9A 2MJEA 1YQ4B 2GI9A 1FNUA 2AQ2B 1C78A 2Y5PA 4P6VF 1SE4A 2ZW0A 3AE1B 1F77A 1CQVA 1QT9A 2TSSA 3AE2B 1V97A 1I4XA 1CJEA 3O13A 2QMTA 4JWUC 2W82A 2W55A 3NVWA 1IGCA 3T3OA 2GB1A 4OVZA 1N62A 2L83A 1SJHD 1TY2A 2LMCA 3AE7B 4O1NA 4LTUA 4JE3B 4USAA 3RFZB 2H89B 4WQMA 1IUEA 1XLOA 3SFEB 1L0YB 4N58A 1D5XC 3KLSX 1PGBA 3LXFA 2PTLA 1WRIA 2PKOA 2E6XA 3AMZA 2GRIA 2HDEA 1MHXA 2WXOA 2FE8A 1ET9A 1LO5D 1YJJA 2FBWB 2INNE 4GDLB 1VLBA 1C4CA 2IGDA 4ZRPA 5BYSA 1TS2A 4YTPB 5FKAC 3ZYYX 1ZOYB 1JW9D 2CU3A 1SSNA 2HTME 4IOIE 2BS2B 1ZE3D 1QOGA 1VZ8A 3VRAB 1IBXB 4MT5A 1FNWA 1C4AA 3Q69A 1OQRA 2WXFA 2PW9A 1HZ6A 3BZDB 1SJED 1ENFA 5BMHA 4YXDB 4RGNA 1RFKA 2ON8A 2N9LA 1L4ZB 4H2AA 1N61A 3CWIA 1XF5L 1FNVA 3U7ZA 2KMMA 5HG2A 1JWMD 5D7GA 3W1SA 1N5WA 1K52A 3IAS1 1NI3A 1I4RA 1D4BA 1TKYA 3TEWA 1UWXA 1UUPA 4RGOS 1GPXA 1EU4A 2LHEA 2Q5WD 2QSDA 1C79A 1SF0A 1ZUD2 4WH4A 1JCKB 3NRZA 1JRPA 5T8IA 1K53A 3AECB 4OZAA 3P4SB 2VZKD 2J52A 2OHFA 3HRDD 3MJ5A 3AE3B 2WXMA 1YNTE 3KWVA 1KLGD 1D5MC 1KH0A 2ONQA 4KGRA 2WU5B 2PVOD 1TS4A 1BXTA 1FM0D 2AX5A 4M0WA 4YTMB 1P7EA 2LHDA 3EUB2 3V05A 4RCOA 3U52E 4C56C 2W3RA 3MFGA 2WXPA 3WCQA 3AEBB 3HVZA 1C9FA 1YN5A 1GOZA 1JWSD 3URYA 2WXKA 1E7PB 4RH6A 1C76A 3AEAB 4HROA 4FXCA 5C3JB 2YEPB 3AB5A 3PZ8A 2M19A 2NMQA 3ABVB 3BVGA 1CZPA 1FXIA 2QILA 1ZPSA 2QJLA 2WDQB 3SEBA 3UI3A 2WU2B 4HEA1 2L52A 4HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W9C B;  4LTU A;  1PFD A;  1FXA A;  1JWA D;  3AED B;  4USA A;  4N6E B;  4ZHP A;  2H89 B;  3VRB B;  1PUT A;  1DOX A;  4WQM A;  1IUE A;  1XLO A;  1JRO A;  3SFE B;  4YSX B;  4N58 A;  1FRD A;  1QLB B;  1XO3 A;  3LXF A;  1RYJ A;  1WRI A;  2MH7 A;  2MJ3 A;  2PKO A;  2JX5 A;  2BT6 A;  2WDR B;  3AMZ A;  1L6U A;  4YSY B;  4YSZ B;  4ITK A;  1QOB A;  3P4P B;  3AEG B;  2K5P A;  1WWT A;  1YJJ A;  2FBW B;  2JQR B;  3AEE B;  3B2F A;  4C80 A;  1OQQ A;  1E9M A;  2H88 B;  1T3Q A;  1J7C A;  1VLB A;  1L0V B;  1J7B A;  3RPF C;  3ETR A;  3AN1 A;  4YTP B;  3ZYY X;  1ZOY B;  3HUI A;  1JW9 D;  5MPO A;  3AE6 B;  2CU3 A;  4A9A A;  1YQ3 B;  3VR9 B;  3L4P A;  2PVG C;  1EWY C;  1SIJ A;  2HTM E;  3NS1 A;  3P4R B;  2W54 A;  1UWM A;  1FMA D;  2BS2 B;  1QOG A;  1JAL A;  3AE8 B;  3BII D;  3VRA B;  1XLP A;  1OQR A;  2WS3 B;  4N59 A;  1N63 A;  1TKE A;  3W5U B;  3B2G A;  2ACZ B;  5G5H A;  1TKG A;  1VJK A;  2E3T A;  4YXD B;  4JX1 C;  2B76 B;  1R7S A;  4YT0 B;  1RFK A;  1N5X A;  1NEK B;  1QF6 A;  1XLQ A;  3CIR B;  1NVI D;  3FC4 A;  1SB3 C;  2EKI A;  2WP9 B;  1N61 A;  3CWI A;  4US9 A;  1TJE A;  5EE9 A;  1RM6 C;  3P4Q B;  1KFY B;  3AM9 A;  2KMM A;  2CJO A;  1E0Z A;  1YJI A;  5H92 C;  5EE0 A;  4C7Z A;  1N60 A;  1N5W A;  1QOA A;  2LEK A;  3P1M A;  1ROE A;  1OFF A;  1NI3 A;  2BS4 B;  4ZHO A;  2K9X A;  1V8C A;  1ZP0 B;  1TKY A;  3NVY A;  3NVV A;  5GXG B;  5G5G A;  3DWM A;  1WYG A;  5AUK A;  3P63 A;  2DBY A;  2CJN A;  4YTN B;  1GPX A;  2Q5W D;  1NEN B;  4ZOH C;  1FRR A;  4KX6 B;  1SF0 A;  1ZUD 2;  3KWL A;  5EE3 A;  1F0Z A;  1FFV A;  1JWB D;  1JRP A;  2N0S B;  3NRZ A;  1AWD A;  1L5P A;  1JQ4 A;  2BS3 B;  3AEC B;  3B9J A;  3P4S B;  3W5V B;  2WLB A;  2OHF A;  2M56 B;  3HRD D;  1J7A A;  1TYG B;  3AE3 B;  4US8 A;  1DOY A;  2DWQ A;  2QIE B;  3PO0 A;  5AUI A;  5C2T B;  1E10 A;  1PDX A;  4WWM A;  4C7Y A;  3FAH A;  2K22 A;  2WU5 B;  2WQY B;  3LB8 C;  2PVO D;  1WGK A;  1RWS A;  1FO4 A;  1NYQ A;  1FM0 D;  1L6V A;  2AX5 A;  4YTM B;  1KF6 B;  3AV8 A;  1XLN A;  1I7H A;  1NYR A;  1AYF A;  1QOF A;  2WDV B;  3DWG C;  3EUB 2;  1A70 A;  3AH7 A;  3NVZ A;  4HRS A;  3SFD B;  1FFU A;  2W3R A;  3AE5 B;  2G1E A;  1KRH A;  2W3S A;  3WCQ A;  2MJE A;  3AEB B;  3AEF B;  3HVZ A;  1YQ4 B;  3VR8 B;  4P6V F;  1DOI A;  2MJD A;  1E7P B;  1ZXI A;  1VDV A;  3AE1 B;  1B9R A;  1QT9 A;  3AEA B;  3AE2 B;  4FXC A;  4HRO A;  5C3J B;  1V97 A;  3AB5 A;  1CJE A;  1E6E B;  2M19 A;  3ABV B;  4JWS C;  2KAJ A;  1CZP A;  1FXI A;  2W55 A;  3AE9 B;  3NVW A;  4JWU C;  5EE1 A;  2QJL A;  1WXQ A;  2WDQ B;  2Y5C A;  1DGJ A;  2WU2 B;  5H8Y E;  1N62 A;  2L52 A;  2L83 A;  1FIQ A;  2PIA A;  1GAQ B;  3AE4 B;  3SR6 A;  4IDI A;  3AE7 B; 
#chains in the Genus database with same CATH topology
 4PYU A;  3ZIM A;  1DOX A;  3ZQ4 A;  2EEL A;  1JRO A;  4YSX B;  2N1V A;  2D5G A;  3EGR A;  2WDR B;  1P3Q U;  2AYO B;  1S1Q B;  3FIL A;  1FPY A;  1EF1 A;  1SGH A;  3RNA C;  1T3Q A;  4X57 B;  4Q2J A;  1HTQ A;  5MPO A;  3P4R B;  2KDE B;  3AE8 B;  4ZRI A;  1E7U A;  4W9K A;  3ZUN A;  3QWZ B;  4WWN A;  2J42 A;  5G5H A;  1TY0 A;  1KTK A;  2LWP A;  1F52 A;  1R7S A;  5G2N A;  2WX0 A;  1WR1 A;  2LXA A;  2WP9 B;  4LNO A;  3W1Y A;  2I2Y A;  1WH3 A;  2CJO A;  1UBQ A;  2G3Q B;  3ZLZ A;  1WGY A;  4ZHO A;  5GXG B;  4LLG M;  4NJ7 A;  4A55 A;  3ZTD A;  1L0X B;  3ZGZ A;  1GC7 A;  2Y3A A;  4ANU A;  3C0R B;  1YMH E;  1AWD A;  2DNF A;  4MGY E;  1LM8 B;  2LVO A;  2YEP F;  2LUM A;  1YQB A;  3CF6 E;  1WMH B;  2V1Y A;  4NAW A;  5AUI A;  2PE6 B;  2KDF B;  4WWM A;  3SHQ A;  1NYQ A;  2LUE A;  3N20 C;  3A1Q A;  4XYC A;  3ALB A;  3ZJV A;  3MC9 A;  1VZ6 A;  2KD0 A;  4IKG A;  2JU6 X;  3ZVV A;  3T9L A;  3IT4 B;  2D07 B;  2IY0 B;  2W3S A;  3PHW B;  4DHJ D;  4M0W B;  1E7V A;  3E56 A;  5E6J A;  1TIF A;  2EMT A;  3PPA A;  2D3B A;  4JPS A;  1E6E B;  3T3N A;  2KAJ A;  3EEC A;  2ZW1 A;  4P16 A;  1ZDV A;  2Y5C A;  4XWT A;  1DGJ A;  1WSP A;  2PIA A;  3AE4 B;  2I1K A;  3ZNI D;  2NCN A;  4ZHP A;  1PUT A;  1C77 A;  3ZDT A;  4K1R B;  3P1M A;  4AS1 A;  2PMV A;  3GOE A;  4YSZ B;  1QOB A;  2V3N A;  3P2B A;  1WWT A;  2FID A;  3Q8C A;  3AEE B;  3B2F A;  4GIV A;  4YWG G;  3PGE A;  3JSV B;  3ETR A;  3PTF C;  3V60 A;  4K3B A;  3RNG C;  4A9A A;  1F2R C;  3EA6 A;  2M0A A;  3FIL B;  4HPL B;  1UWM A;  2L7R A;  5E6O A;  1T0R C;  2BBC A;  3W5U B;  1JWU D;  1V1P A;  1NVI D;  2DYM A;  3P42 A;  1YD8 U;  4BKS A;  3BWU D;  4LJO B;  2C7H A;  4CYE A;  2C60 A;  1HZ5 A;  4EEW A;  1WYG A;  4G11 A;  3W2D A;  1C3T A;  4UDU C;  2Y5B B;  5EE3 A;  3GZN I;  5DPT A;  2MQJ A;  2XBB C;  1P98 A;  2V0G A;  1J8C A;  1AN8 A;  1Z5S B;  3DVN U;  2G4D B;  5KHO A;  3AU4 A;  3PVL A;  3UGB B;  5BYR A;  3MTN B;  4GXB A;  1F1H A;  3N9Y C;  2JXX A;  1L6V A;  3ZJT A;  1KF6 B;  2VH2 A;  3C19 A;  1GB4 A;  4NAW B;  1A70 A;  4BKS D;  2KJ6 A;  3HHM A;  3VR8 B;  3A1Q B;  2NVU I;  3QCA A;  3ECI A;  3E9S A;  1Q0W B;  4JWS C;  2ZNV B;  3OWE B;  2J4X A;  5C23 A;  1UZX B;  3BYY B;  4IDI A;  2WXH A;  3R2I A;  3DOW A;  3J9C A;  4AWJ A;  1WFY A;  1FEH A;  2G9H D;  2WXQ A;  3Q3N C;  2JVC A;  3AI5 A;  3VUW A;  4ITK A;  3OJ4 B;  1V81 A;  2DX5 B;  3W1S C;  2AEH A;  2K3U A;  4IWO A;  2RDH A;  2LGX A;  1YQ3 B;  2CHW A;  2ZPY A;  3NY5 A;  1M4V A;  4RGT A;  4F8C B;  2ACZ B;  1LXD A;  3DCG A;  2JZP A;  4MAC A;  1NEK B;  2N7D A;  1FXT B;  4OVV A;  2R2O A;  4KDI C;  1RM6 C;  4EZL A;  5LXH A;  4TQ0 A;  4KGS A;  4W9I A;  4L2Y A;  4WJN A;  2NBW B;  1E90 A;  1V1P B;  4II2 B;  4MGK E;  3RCZ A;  1F0Z A;  2LZ6 A;  1OEY J;  3ZXR A;  1MFW A;  1FD6 A;  2HJ1 A;  2WLB A;  3R8B A;  2N7E A;  2Z0E B;  2KWC A;  3DHI C;  1Y8R C;  1SBB B;  3BVM A;  2GBJ A;  2J0K A;  4K7U A;  2FCS A;  2N7J A;  1GUA B;  1PGA A;  3KW5 B;  3IXS A;  1FO4 A;  2QC8 A;  4KGT A;  1FCC C;  1QKZ A;  4TMA B;  1ZKH A;  3AV8 A;  1WE7 A;  1AYF A;  3CSF A;  1QOF A;  4WUR A;  3SFD B;  3AE5 B;  2G1E A;  3BK1 A;  2KJR A;  1Q5W B;  4MSQ B;  2I1J A;  3TBL D;  1SE4 A;  2AL3 A;  2J0J A;  4HDQ A;  1V97 A;  3EC8 A;  1I4X A;  1IGC A;  1TT5 B;  1V80 A;  2OOB B;  1N62 A;  5CHW A;  2IY1 B;  3TCA A;  3U8Z A;  3RFZ B;  2MCN B;  2H89 B;  2LRU A;  4FJY A;  4WQM A;  2KDB A;  3DHG C;  1IUE A;  3SFE B;  2PKO A;  4LDT D;  1UH6 A;  1MHX A;  2FE8 A;  4QAY A;  5J2R A;  4WWP A;  2KLG A;  2L8J A;  3A33 B;  1WGR A;  4ZRP A;  4KZC A;  1NI2 A;  1ZOY B;  1SSN A;  2HTM E;  3ZNZ B;  4A20 A;  2CHZ A;  4IOI E;  1ZE3 D;  4W9J A;  2VH1 A;  1HZ6 A;  4HDO A;  5BMH A;  1E5W A;  4H2A A;  4ZRJ A;  3CWI A;  3RZF A;  4EZK A;  4FA6 A;  1N5W A;  2D10 A;  1NI3 A;  5EDS A;  2KNB A;  4HCN B;  2DHZ A;  3BIN A;  2X8X X;  1GPX A;  1IP9 A;  4GSW A;  1MG4 A;  4WH4 A;  4C00 A;  3UQB A;  1K53 A;  4OZA A;  2FCQ A;  3APF A;  4WJO A;  3MJ5 A;  4GMV A;  2INC C;  4I6N B;  2PVO D;  2AX5 A;  2LVQ A;  2GBK A;  2LHD A;  2WYQ A;  1XQQ A;  2NS5 A;  3DBS A;  2CHX A;  3V6E B;  2W3R A;  3MFG A;  2J0M A;  2WXP A;  2VRR B;  1JWS D;  2WXK A;  2NPT A;  1E7P B;  3AEA B;  3T8M A;  3APD A;  2KLC A;  2LD9 A;  3PZ8 A;  3BVG A;  2AL6 A;  2WX1 A;  2REX A;  2C7M B;  4HLE A;  3RNB C;  1JWA D;  3DBL B;  1STE A;  2GOW A;  4XDD A;  4K7S A;  1SEB D;  3NZ3 A;  2MJ3 A;  2BT6 A;  3V61 A;  2ASQ A;  4DHZ E;  2K5P A;  3V6C B;  4S0R A;  4C80 A;  1OQQ A;  3HVD A;  1ZDX A;  1SXT A;  3VR9 B;  1FCL A;  2JXT A;  1SIJ A;  2AWT A;  3NJT A;  2KN4 A;  4HKZ E;  2IND C;  3L08 A;  4G3X B;  4RNA A;  2ZJD A;  1XEE A;  3QJZ A;  1SB3 C;  4WJQ A;  1MPE A;  2XN9 C;  4IW0 A;  1ROE A;  1YN3 A;  3N1Z C;  3Q3O C;  4LNI A;  1CMX B;  3L13 A;  4DHZ B;  3UF8 A;  2M17 A;  1EU3 A;  2NTS A;  1JWB D;  2N0S B;  3NOB A;  2LI5 A;  4BZA A;  3I9V 1;  3ZO5 B;  3LYY A;  1YX5 B;  2DWQ A;  3NZS A;  1D5Z C;  1JML A;  3AXC A;  5JZE B;  2K22 A;  2FNJ B;  3MHZ A;  2KC2 A;  1TTN A;  5BMI A;  3VH3 B;  1I7H A;  1NYR A;  4PT5 A;  4OZB A;  1WMH A;  3NVZ A;  3VVW B;  3OG5 A;  2FCN A;  4BKG A;  1GG3 A;  2GBR A;  3B0A A;  2D3A A;  2BVC A;  1H8C A;  2MJD A;  2JYT A;  3UQA A;  1LFD A;  4PK1 A;  1UNS A;  2HJ8 A;  4FUL A;  2NPT B;  1KM7 A;  1PFD A;  3SD5 A;  4HXD A;  1K50 A;  1WX9 A;  1FRD A;  1QLB B;  3Q3M C;  4B0M A;  1VR9 A;  5HI1 A;  1CK1 A;  3DBH B;  3P4P B;  5FR3 A;  2RDB C;  4MGZ E;  1SE3 A;  2R2Q A;  2UWQ A;  4W9G A;  1I4P A;  4WAF A;  2K8B A;  4KSK C;  4REZ A;  3HUI A;  1A5R A;  2DEN B;  1XXG A;  2WS3 B;  2L0F A;  1L4D B;  1L7Y A;  1TKG A;  2E3T A;  4ZRK A;  5G55 A;  3JSV A;  3CIR B;  4EE2 A;  3DVG Y;  4K81 A;  2KKC A;  3R7R A;  3GP7 A;  1E0Z A;  2LJI A;  1KLU D;  1LGR A;  1N60 A;  3U7D A;  2BS4 B;  3DVN V;  2ZEQ A;  3NVV A;  2CKH B;  2RGF A;  4TSS A;  1RFA A;  2MEK A;  5FR6 A;  2BKR B;  2JPH A;  1P7F A;  4LK0 M;  2V9H A;  4E3C A;  3A9J A;  1J7A A;  4US8 A;  2FIF A;  2BB6 A;  3PO0 A;  2KC1 A;  3H6N A;  2I38 A;  2W9N A;  3RN9 C;  1PYW D;  3JW0 X;  4DBG A;  2WQY B;  1J19 A;  2IJ0 A;  4XGA B;  1T0Q C;  2QEJ C;  4KIK A;  2AQ1 B;  5LXI B;  3OJ3 A;  1N6Z A;  2WWZ A;  1FFU A;  2DLB A;  3IAM 1;  2UU7 A;  2RSU A;  1AW7 A;  3AE9 B;  4GOC A;  4ACF A;  1WXQ A;  4K7W A;  3NZU A;  4M8N A;  1WZ0 A;  3VUX A;  3ZRC A;  1ZXH A;  2SAK A;  2KMC A;  2M0X A;  2V3P A;  1WX8 A;  2BYF A;  4ZRQ A;  1ACC A;  2KX3 A;  3QX1 A;  3L54 A;  5CTR C;  2JX5 A;  3N32 A;  4DWF A;  1TBE A;  4LNF A;  3ML9 A;  1HEZ E;  1E9M A;  4MEL A;  3K9P B;  4MSM B;  2Z0D B;  2W54 A;  3TJP A;  1JAL A;  3WAL A;  4WIP A;  1WJ4 A;  2FAZ A;  1N63 A;  3L16 A;  4EKU A;  1QF6 A;  4EZJ A;  4RFB A;  4RM9 A;  3PZ7 A;  4HVB A;  3P4Q B;  5BYQ A;  1IYF A;  2DAF A;  5TR5 A;  2JYE A;  2K9X A;  3NVY A;  3NUH B;  4IM2 A;  1YOV B;  5AUK A;  3BY4 B;  4AUQ C;  1XT9 B;  2PLP A;  5D3D A;  3KWL A;  4ZDV A;  1WJ6 A;  3V3X A;  1L5P A;  2L1A A;  2Z8L A;  5JXV A;  5E6P A;  3AUL A;  1SE9 A;  5J18 A;  1TYG B;  5LNK 1;  2KFJ A;  1WGG A;  4RF0 A;  4S17 A;  4C7Y A;  1WX7 A;  3EFU A;  5JHB A;  1RWS A;  3A9J B;  2RPQ A;  3AU5 A;  3U2S C;  3PLV A;  4DHJ B;  3DWG C;  4F1S A;  4IG7 B;  3ZNG C;  3RMK C;  4P6V F;  4KIK B;  2ZW0 A;  1WXA A;  4G50 A;  1E8W A;  1F77 A;  2MBB B;  2TSS A;  1BT0 A;  2MX2 A;  2QMT A;  1WJN A;  3GE3 C;  2HTH A;  2ZCC A;  4I6P A;  1TY2 A;  4I6L B;  3APC A;  4JE3 B;  4USA A;  4HPP A;  4AJW A;  1D5X C;  3LXF A;  4GDK A;  2E6X A;  3R7Q A;  2INN E;  2BYE A;  1VLB A;  2KVR A;  2KK8 A;  5BYS A;  1TS2 A;  4AOF A;  1KOT A;  4B95 A;  4MT5 A;  3RYT A;  3KUC B;  3OLM D;  3VXW A;  3QC8 B;  4WJP A;  1SJE D;  2K6D B;  1ENF A;  4RGN A;  2ON8 A;  3H7S A;  1Z2M A;  1V6E A;  1WXV A;  1N61 A;  3DDC B;  4FHJ A;  5IO9 A;  4LCD E;  2G45 B;  3QAQ A;  2MBH A;  1K52 A;  1X1M A;  3IAS 1;  4EFO A;  1D4B A;  1TKY A;  4II3 B;  1UWX A;  1UUP A;  4RGO S;  1EU4 A;  1C79 A;  2XK5 A;  1JCK B;  1S3S G;  2ZNV C;  3AEC B;  2VZK D;  2J52 A;  3AE3 B;  4ANV A;  3A4S C;  1KH0 A;  1MJD A;  3EHV A;  4DDI D;  1FM0 D;  3L17 A;  2MP2 A;  4B9K A;  2JWZ A;  3AEB B;  2BKF A;  1YN5 A;  2BYV E;  4B6W A;  4KDL B;  1C76 A;  1Q1O A;  1WYW B;  2M19 A;  2NMQ A;  4BBN F;  4GN1 A;  3SEB A;  3UI3 A;  3M63 B;  3RD2 A;  5AZG A;  3GZN B;  2KHW B;  1OGW A;  4M00 A;  2EMS A;  1IGD A;  2FUG 1;  4C4V B;  5IP4 D;  3X0W A;  3Q8B A;  1RYJ A;  1VRA B;  4IM3 A;  1IPG A;  3VDZ A;  2WXI A;  3WIM A;  2RDG A;  1J7B A;  4XZ4 A;  4GDK B;  2V3S A;  1BUI C;  2PJH A;  4TUU A;  3BII D;  3WA0 A;  3KYD D;  3RNF C;  2N9E B;  3RI7 C;  1PGX A;  2OJR A;  2PE9 A;  3AM9 A;  3DHH C;  2ZVO A;  5H92 C;  2Z59 B;  4XE0 A;  4IWQ A;  4ZYN A;  1WJU A;  2LEK A;  2BB5 A;  2YLM A;  4FBJ B;  1V8C A;  3QAR A;  1EO6 A;  4NQL B;  2KTF A;  1WGH A;  3PRE A;  4ZYS A;  2KDM A;  2MA9 B;  5HFY A;  3VTU A;  3B9J A;  2RD0 A;  2M56 B;  3N3K B;  4FHK A;  2WGS A;  1WY8 A;  2XK5 B;  4HJG E;  4GLS C;  2O6V D;  1R4M I;  2QDF A;  2ZVN A;  2LRW A;  2N9X A;  2WDV B;  4AQ7 A;  2GMI C;  1VD2 A;  1EUV B;  4HCP B;  2IZV B;  1Y56 A;  2DZI A;  3VAW A;  1DOI A;  2KDI A;  2MP2 B;  4NQK E;  4ICV A;  4NNJ B;  3CST A;  1I4Q A;  3PHX B;  4R3D A;  4IUM B;  1EWC A;  2K0P A;  4A3O A;  2UYZ B;  2WXL A;  4DXF A;  3R3M A;  4ARI A;  2KO3 A;  2RR9 A;  1GC6 A;  4W9F A;  4DK5 A;  3H9D A;  4LDT B;  3FKY A;  4JLC A;  2JSV X;  2KAC A;  2K39 A;  1J7C A;  1E8X A;  1L0V B;  5DPW A;  3RPF C;  3AN1 A;  5JHA A;  3DVG X;  2D2Q A;  3AE6 B;  1EWY C;  1TGZ B;  3GB1 A;  1D6E C;  4N59 A;  3B2G A;  4DXG A;  1WXM A;  2LFI A;  1SE2 A;  5E6N A;  4G0N B;  2LXC A;  4CHK A;  5DCN A;  1QOA A;  5DPR A;  3RT3 B;  2CU1 A;  5D2M B;  2KQ4 X;  3WAO A;  4BKT A;  3D32 A;  3I57 A;  3L10 B;  2KWV B;  3CMM B;  3L0W B;  1XCT L;  2BS3 B;  2LGI A;  5JH5 C;  3PRZ A;  1WIA A;  2K8H A;  3BYT B;  1DOY A;  4NJC A;  4EOY A;  2QIE B;  2N9K A;  4KKJ A;  3EFC A;  2KFK A;  4RM8 A;  1TZO A;  4XC2 A;  4JIO U;  3N30 A;  2GLS A;  5J17 A;  3PLU A;  1AAR A;  4IWP A;  1UGJ A;  2IPK D;  3PZD A;  4KKI A;  1P0R A;  3DPD A;  1KRH A;  2L05 A;  3Q8A A;  1MVK A;  1ET6 A;  3X23 A;  4JGH B;  1ZXI A;  2L3Z A;  3I3T B;  2LVP A;  1R4M B;  3MHS D;  5EE1 A;  5AZF A;  4BOS C;  1BML C;  1HXY D;  4JL9 A;  5IOI A;  3A9K B;  5H8Y E;  3SR6 A;  1D3Z A;  4WWO A;  2KTR B;  2BYT A;  2A4Z A;  3ZDM C;  3AEG B;  2MLB A;  1IBX A;  1B1Z A;  3RNC C;  1VCB A;  5IAA C;  1WE6 A;  4OW0 A;  2K1F A;  3MC0 B;  3L4P A;  3NS1 A;  4B0E A;  1WZ3 A;  1KLV A;  3M95 A;  3VTW A;  4YT0 B;  4PS7 A;  1XLQ A;  4URK A;  3Q3J A;  1TJE A;  1HE8 A;  2ICI A;  1KFY B;  1F2R I;  4C7Z A;  1I4G A;  4JQW C;  3TL5 A;  2IGG A;  2DBY A;  2CJN A;  4NJ6 A;  5TSS A;  3TEZ A;  1FRR A;  4KZ0 A;  3WAN A;  1HA5 A;  2JY6 A;  1G6J A;  1R4N I;  3PRP B;  3W5V B;  3C8Y A;  3HM6 X;  4AP4 C;  2KJH B;  2R61 A;  2XEW A;  1E10 A;  1PDX A;  4ICU A;  1UGM A;  1WGK A;  4ANX A;  3VUY A;  2DYB A;  1T0S C;  1XLN A;  4MM3 B;  4NPN A;  4A90 A;  3PT2 B;  3AH7 A;  4LNN A;  2KFK B;  5CHV C;  3ONS A;  1V2Y A;  2JF5 A;  3MP9 A;  1FNU A;  2AQ2 B;  1C78 A;  1LQB A;  1T0Y A;  3AE2 B;  2GBM A;  4JWU C;  2W82 A;  2W55 A;  3NVW A;  2KT7 A;  1SJH D;  3AE7 B;  3IG3 A;  1I35 A;  4O1N A;  4W9L A;  3OAW A;  3LJ3 A;  4PS3 A;  3QK0 A;  4W9H A;  1XLO A;  3ZKJ C;  4N58 A;  2JRI B;  2LJ5 A;  3NHE B;  3UIP B;  2KYW A;  3AMZ A;  2HDE A;  2WXO A;  1LO5 D;  1YJJ A;  4LNK A;  3QIJ A;  1OQY A;  1C4C A;  4YTP B;  1ISN A;  2CU3 A;  3VFK A;  1QOG A;  3VRA B;  1IBX B;  4IC7 B;  3ZXV A;  1C4A A;  3Q69 A;  2PW9 A;  2C7N B;  3BZD B;  2N9L A;  1L4Z B;  1YIW A;  3K9O B;  1UF0 A;  4PYZ A;  1WRD B;  5HG2 A;  2O2V A;  2D3C A;  3W1S A;  4GB9 A;  1WM2 A;  1I4R A;  5CX3 A;  3H7P A;  2MRP A;  3LDZ E;  2JZZ A;  5IA7 A;  1ZUD 2;  5L83 A;  3NRZ A;  1V5T A;  5IKC M;  4IM0 A;  3UIN B;  3VHT C;  4P1C C;  1KLG D;  3HIZ A;  2ONQ A;  1NDD A;  4KGR A;  3A4R A;  1BXT A;  4YTM B;  1R4N B;  1P7E A;  3DQV A;  3Q6B A;  4K3C A;  3V05 A;  2D3G A;  4PS8 A;  2ZCB A;  4C56 C;  5AEK B;  4RH6 A;  4HRO A;  4FXC A;  1V9J A;  2KXJ A;  3Q14 C;  2YEP B;  4TV3 A;  3AB5 A;  3GE8 C;  1CZP A;  1FXI A;  2QJL A;  3RUL A;  4HEA 1;  2L52 A;  2KZR A;  4HJK A;  4HKQ A;  4ANW A;  1FXA A;  3VQI A;  1RAX A;  4N6E B;  2IO3 B;  5KHQ A;  2MWS B;  4DQO C;  2NTT A;  1U4A A;  1XO3 A;  3H8H A;  4KVG B;  3R2T A;  4YSY B;  3TEX A;  1L6U A;  4RF1 A;  2JQR B;  2ZPN A;  4FJV B;  3SDL C;  4MDK E;  4C4V A;  2GBN A;  2IO1 B;  3PRM B;  4TQ1 A;  4BAX A;  2PVG C;  4A3P A;  3ZW3 A;  3NG0 A;  1YN4 A;  1XLP A;  2KAN A;  4FJZ A;  3Q3F A;  4FAD A;  2B76 B;  1N5X A;  4BOZ B;  3FC4 A;  4US9 A;  2KMA A;  5EE9 A;  3GS2 A;  3MC8 A;  5EE0 A;  1WF9 A;  3B1L X;  3RUI B;  2BTE A;  2OED A;  2RMM A;  2IO2 B;  3QQ8 B;  3P63 A;  4YTN B;  2MBO A;  5FK9 C;  2IO0 B;  2O2V B;  2KQ7 A;  1F9J A;  4XDC A;  1JQ4 A;  1EM7 A;  3H7P B;  4F7Z A;  2NR2 A;  2QCZ A;  4W9E A;  1PQS A;  2ZZP B;  2KQS A;  1YX6 B;  2C9W B;  2KWU B;  2WNM A;  4OHJ A;  1UBI A;  1GNU A;  4W9C A;  2RPV A;  1XD3 B;  1C1Y B;  2BGF A;  3BVZ A;  2FUH B;  3AEF B;  1TS5 A;  2XNA C;  4YL8 A;  3Q8E A;  1B9R A;  3M3J A;  4M02 A;  2L32 A;  1HTO A;  2WXN A;  3U30 A;  2MW5 A;  3TEY A;  1T6B X;  2M4N A;  2JUO A;  3AED B;  3M62 B;  3U4E G;  2JWU A;  3TSS A;  2MH7 A;  1ZW7 A;  3N1X C;  1WXS A;  3S2A A;  3ZNH B;  1K8R B;  2DZK A;  1OEY A;  2D11 A;  3KQ4 A;  2H88 B;  3H1U A;  3Q2A C;  4E71 A;  2JZ3 B;  1GB1 A;  1EF5 A;  5AZH A;  1NBF C;  1C4P A;  4CQN A;  2L0T A;  1KJT A;  2WDT B;  4A8X C;  1T5X D;  4HWI B;  1V49 A;  2LGY A;  1TKE A;  5D6J B;  4DDG D;  1VJK A;  1QQR A;  1MG8 A;  2CR5 A;  1M94 A;  2PEA A;  1ZGU B;  2IGH A;  4NZL B;  5D3I B;  2KOX A;  2JRH A;  4A6Q A;  1HQR D;  1OFF A;  3IT6 B;  1GJZ A;  1ZP0 B;  4ASW C;  2INP E;  5G5G A;  3PV1 A;  3DWM A;  1OTR B;  1P9D U;  1J0G A;  4WAA A;  4ZOH C;  4ARC A;  2BW2 A;  2AQ3 B;  5I4D A;  3KVF B;  5HHD G;  2O6V A;  2QHO A;  2VZK B;  4L1B A;  1V1O A;  2WXJ A;  3DBL I;  3KH0 A;  4OVU A;  2BPS A;  1MHH E;  4W9D A;  4MH8 A;  3HM3 A;  3SU8 X;  3KYC D;  2HE7 A;  2L00 B;  5C1Z A;  2IYD B;  5BMG A;  3NS8 A;  3IFW B;  3DBR I;  1MI0 A;  2A5U A;  3WAP A;  3Q8F A;  3WAM A;  4HRS A;  2PPH A;  1I4H A;  4GU2 A;  4CO7 A;  2DYO A;  3RZW C;  5CHF A;  1TS3 A;  5IN7 A;  1VDV A;  4BVU C;  1QZE A;  2WXR A;  1Q10 A;  4NY0 A;  4LJP B;  4MH0 E;  1K51 A;  3PSE B;  1L2N A;  2KWD A;  1FIQ A;  1GAQ B;  1WGD A;  2KVZ A;  3W9C B;  3I5J C;  1XCQ L;  3VRB B;  2IDY A;  2M1M A;  4GDL A;  4XWW A;  3ZJU A;  2V4L A;  1H4R A;  3A9K A;  1VZ7 A;  2WHI A;  4BBN C;  4OZC A;  2MSE D;  2KTR A;  4MJS A;  3TUO A;  4N9F 4;  2J53 A;  2J7Q B;  5BO4 B;  1FMA D;  3IBE A;  5D94 A;  2MBQ A;  3R66 C;  3ZRF A;  4MEM A;  4JX1 C;  2WXG A;  3BK2 A;  4FLH A;  2EKI A;  4NAM A;  4RMA A;  2V4I B;  3TIX A;  1V5O A;  1YJI A;  1E8Y A;  4P7I A;  4L23 A;  3VH4 B;  2DZM A;  2BF8 B;  1QIL A;  2SEB D;  3ML8 A;  2YVC A;  4MGI E;  1NEN B;  5HKH A;  1ESF A;  2LAS A;  4KX6 B;  1YJ1 A;  1FFV A;  5DPS A;  4J3O D;  2LGS A;  3ZTC A;  1DYQ A;  2G4S A;  2N1W A;  1E8Z A;  5C2T B;  3DBH I;  2O6V B;  4EUT A;  3FAH A;  3IHP C;  3LB8 C;  4D2K A;  2BWF A;  4TKN A;  2K8C A;  2DAJ A;  2BWE S;  3N1Y C;  2OJW A;  4RGM A;  2X38 A;  1SIF A;  2MJE A;  1YQ4 B;  2GI9 A;  2LGD A;  2Y5P A;  4M8M A;  2L76 A;  3VTV A;  3AE1 B;  1CQV A;  1QT9 A;  3JYU A;  4MM3 A;  3O13 A;  1CJE A;  4FN2 A;  1WM3 A;  3T3O A;  3UIO B;  2GB1 A;  3DBR B;  4OVZ A;  2L83 A;  2LMC A;  4LTU A;  2KX0 A;  2HD5 B;  3ENE A;  4BFR A;  4HK2 A;  3TMP B;  1L0Y B;  3KLS X;  1PGB A;  2PTL A;  1WRI A;  3JVZ X;  4XX5 A;  2GRI A;  4KV2 A;  4P1B C;  1ET9 A;  2FBW B;  4E74 A;  4KSL C;  1TZ1 A;  3PS6 A;  1UD7 A;  3I63 C;  4GDL B;  2C5L C;  2IGD A;  5FKA C;  3ZYY X;  1JW9 D;  4AJY B;  2BS2 B;  1VZ8 A;  4WQO B;  1FNW A;  3HK0 A;  1OQR A;  2WXF A;  2IBI B;  1JRU A;  4YXD B;  1RFK A;  4MJS B;  2K25 A;  2CS4 A;  1XF5 L;  1FNV A;  3U7Z A;  2KMM A;  3B08 A;  1JWM D;  5D7G A;  4GGQ A;  2KN5 A;  3TEW A;  2JT4 B;  3KUZ A;  2DZJ A;  4HPM B;  4DXA B;  2LHE A;  2Q5W D;  3MJW A;  2QSD A;  4M01 A;  1RRB A;  1SF0 A;  3IVF A;  1JRP A;  2B3A A;  5T8I A;  1WR6 E;  3P4S B;  2OHF A;  3HRD D;  2M8S A;  2MBE A;  2WXM A;  5L95 C;  1YNT E;  3KWV A;  1D5M C;  2WU5 B;  5LLI A;  3KUD B;  1TS4 A;  3O65 B;  2EKE C;  4M0W A;  2N4F A;  3RNE C;  4J6I A;  1RLF A;  3EUB 2;  4RCO A;  3QHT A;  3U52 E;  1I42 A;  3WCQ A;  3HVZ A;  1C9F A;  1GOZ A;  3URY A;  1P1A A;  2K6Q A;  2NBV B;  1WI0 A;  1UEL A;  1V86 A;  2BQQ A;  5C3J B;  2FCM A;  3ABV B;  2MHJ A;  2QIL A;  1ZPS A;  2WDQ B;  2NBU A;  2WU2 B;  3V62 A;  3QA8 A;  2N9P C;  5GMV A; 
#chains in the Genus database with same CATH homology
 1FXA A;  3VQI A;  1JWA D;  4N6E B;  1IGD A;  2FUG 1;  1STE A;  1DOX A;  4XDD A;  3ZQ4 A;  2EEL A;  1JRO A;  4DQO C;  4YSX B;  1SEB D;  2D5G A;  3EGR A;  2NTT A;  3H8H A;  1XO3 A;  3NZ3 A;  1RYJ A;  2MJ3 A;  3Q8B A;  1VRA B;  3R2T A;  4YSY B;  2BT6 A;  2WDR B;  3TEX A;  1L6U A;  4RF1 A;  3FIL A;  2K5P A;  2JQR B;  4C80 A;  2WXI A;  1OQQ A;  3HVD A;  1ZDX A;  1SXT A;  1T3Q A;  2RDG A;  1J7B A;  4Q2J A;  4TQ1 A;  4GDK B;  5MPO A;  3VR9 B;  1FCL A;  2PVG C;  1BUI C;  1SIJ A;  2JXT A;  3P4R B;  2KN4 A;  4HKZ E;  3AE8 B;  3BII D;  1YN4 A;  1XLP A;  4RNA A;  5G5H A;  2J42 A;  1KTK A;  1TY0 A;  2B76 B;  1R7S A;  1N5X A;  1XEE A;  3FC4 A;  4US9 A;  1SB3 C;  2WP9 B;  1PGX A;  5EE9 A;  3AM9 A;  2I2Y A;  3GS2 A;  2CJO A;  5H92 C;  5EE0 A;  4XE0 A;  1MPE A;  2XN9 C;  2BTE A;  2OED A;  2LEK A;  1ROE A;  1YN3 A;  2BB5 A;  4ZHO A;  1V8C A;  2RMM A;  5GXG B;  4LLG M;  4ZYS A;  4A55 A;  1L0X B;  2KDM A;  3P63 A;  4YTN B;  3ZGZ A;  5FK9 C;  2Y3A A;  1EU3 A;  5HFY A;  2NTS A;  1JWB D;  2N0S B;  4XDC A;  1YMH E;  1AWD A;  1EM7 A;  1JQ4 A;  3I9V 1;  2YEP F;  2LUM A;  3B9J A;  2M56 B;  3LYY A;  2DWQ A;  1D5Z C;  5AUI A;  4HJG E;  4GLS C;  1JML A;  4WWM A;  2WNM A;  2K22 A;  3MHZ A;  4OHJ A;  1NYQ A;  5BMI A;  1I7H A;  1NYR A;  4PT5 A;  3ZJV A;  1VZ6 A;  2WDV B;  4IKG A;  4OZB A;  2JU6 X;  2RPV A;  3NVZ A;  4AQ7 A;  3IT4 B;  3BVZ A;  2W3S A;  3AEF B;  1Y56 A;  1TS5 A;  3E56 A;  1DOI A;  2XNA C;  2MJD A;  2JYT A;  3Q8E A;  5E6J A;  1B9R A;  1I4Q A;  4JPS A;  4R3D A;  1E6E B;  2L32 A;  3T3N A;  2KAJ A;  2ZW1 A;  1EWC A;  2WXN A;  1ZDV A;  4P16 A;  2Y5C A;  1UNS A;  4XWT A;  2K0P A;  1DGJ A;  3TEY A;  1T6B X;  1WSP A;  2PIA A;  2WXL A;  4DXF A;  3AE4 B;  4ARI A;  1PFD A;  3AED B;  4ZHP A;  3U4E G;  1PUT A;  1C77 A;  1K50 A;  2JWU A;  1FRD A;  1QLB B;  3TSS A;  3P1M A;  1VR9 A;  2JSV X;  2KAC A;  2MH7 A;  4B0M A;  2PMV A;  4AS1 A;  5HI1 A;  4YSZ B;  1CK1 A;  1QOB A;  2V3N A;  3P4P B;  5FR3 A;  1WWT A;  3Q8C A;  3AEE B;  3B2F A;  1SE3 A;  3KQ4 A;  2H88 B;  4YWG G;  1J7C A;  1I4P A;  1GB1 A;  1L0V B;  4WAF A;  3RPF C;  3ETR A;  3AN1 A;  4REZ A;  3HUI A;  1C4P A;  4CQN A;  3AE6 B;  4A9A A;  1F2R C;  3EA6 A;  1EWY C;  2M0A A;  3FIL B;  1UWM A;  3GB1 A;  4A8X C;  1T5X D;  1XXG A;  1D6E C;  2BBC A;  2WS3 B;  1L4D B;  4N59 A;  1TKE A;  3W5U B;  3B2G A;  1TKG A;  1VJK A;  2E3T A;  4DXG A;  2LFI A;  1JWU D;  1QQR A;  1V1P A;  3CIR B;  1NVI D;  1SE2 A;  4EE2 A;  2DYM A;  3P42 A;  3BWU D;  3GP7 A;  1E0Z A;  2LJI A;  2IGH A;  4NZL B;  5D3I B;  1KLU D;  1N60 A;  1QOA A;  4A6Q A;  1HQR D;  1OFF A;  2BS4 B;  3IT6 B;  1ZP0 B;  1HZ5 A;  3NVV A;  2INP E;  5G5G A;  3DWM A;  1WYG A;  4TSS A;  3W2D A;  2MEK A;  4UDU C;  4ZOH C;  4ARC A;  2BW2 A;  2KQ4 X;  2AQ3 B;  5I4D A;  5HHD G;  1P7F A;  5EE3 A;  4LK0 M;  3I57 A;  2VZK B;  4L1B A;  1V1O A;  2WXJ A;  1XCT L;  2BS3 B;  2LGI A;  2V0G A;  1AN8 A;  1MHH E;  4MH8 A;  1J7A A;  3BYT B;  4US8 A;  1DOY A;  4NJC A;  2BB6 A;  5BYR A;  2QIE B;  3PO0 A;  2N9K A;  4KKJ A;  2I38 A;  1PYW D;  3N9Y C;  2WQY B;  1TZO A;  2IJ0 A;  5BMG A;  1L6V A;  2QEJ C;  3ZJT A;  2AQ1 B;  1KF6 B;  1GB4 A;  4NAW B;  1MI0 A;  3Q8F A;  1A70 A;  1UGJ A;  2IPK D;  4HRS A;  4KKI A;  1FFU A;  1I4H A;  1KRH A;  3Q8A A;  2DLB A;  2DYO A;  1MVK A;  1ET6 A;  3IAM 1;  3VR8 B;  1TS3 A;  1ZXI A;  1VDV A;  1AW7 A;  2WXR A;  1Q10 A;  3E9S A;  4JWS C;  3OWE B;  3AE9 B;  5EE1 A;  1BML C;  1HXY D;  1WXQ A;  1K51 A;  2J4X A;  5H8Y E;  2KWD A;  3BYY B;  1FIQ A;  1GAQ B;  3SR6 A;  1ZXH A;  2SAK A;  4IDI A;  3W9C B;  1XCQ L;  3VRB B;  2V3P A;  2IDY A;  2WXH A;  4ZRQ A;  4XWW A;  1ACC A;  3R2I A;  3ZJU A;  3J9C A;  2BYT A;  1FEH A;  2JX5 A;  2G9H D;  1VZ7 A;  2WXQ A;  4ITK A;  3AEG B;  1IBX A;  1HEZ E;  1B1Z A;  1E9M A;  4OZC A;  4OW0 A;  3MC0 B;  2K3U A;  2RDH A;  3TUO A;  1YQ3 B;  2J53 A;  3L4P A;  3NS1 A;  2W54 A;  1FMA D;  1JAL A;  4WIP A;  4B0E A;  1M4V A;  4RGT A;  1N63 A;  2ACZ B;  4JX1 C;  2JZP A;  2WXG A;  4MAC A;  4YT0 B;  1NEK B;  3BK2 A;  1XLQ A;  1QF6 A;  4RFB A;  2EKI A;  3PZ7 A;  4NAM A;  1TJE A;  2V4I B;  1RM6 C;  2ICI A;  1KFY B;  3P4Q B;  5BYQ A;  4TQ0 A;  1F2R I;  1YJI A;  4KGS A;  4L23 A;  4C7Z A;  4L2Y A;  1QIL A;  1I4G A;  2JYE A;  2K9X A;  2SEB D;  3NVY A;  1V1P B;  3NUH B;  5AUK A;  2IGG A;  2DBY A;  2CJN A;  5TSS A;  2PLP A;  1NEN B;  3TEZ A;  1FRR A;  1ESF A;  4KX6 B;  5D3D A;  3KWL A;  1HA5 A;  1F0Z A;  1FFV A;  3V3X A;  1L5P A;  1FD6 A;  4J3O D;  2L1A A;  2Z8L A;  3C8Y A;  3W5V B;  2WLB A;  1DYQ A;  3R8B A;  5JXV A;  1TYG B;  5LNK 1;  2R61 A;  1SBB B;  3BVM A;  5C2T B;  4RF0 A;  1E10 A;  1PDX A;  4C7Y A;  3FAH A;  4D2K A;  3LB8 C;  2N7J A;  1PGA A;  1WGK A;  1RWS A;  3IXS A;  1FO4 A;  4KGT A;  1FCC C;  1QKZ A;  4TMA B;  3AV8 A;  1XLN A;  4MM3 B;  3U2S C;  1AYF A;  4A90 A;  1QOF A;  3DWG C;  4WUR A;  3AH7 A;  3SFD B;  3AE5 B;  2X38 A;  4RGM A;  2G1E A;  3BK1 A;  3MP9 A;  2MJE A;  1YQ4 B;  2GI9 A;  1FNU A;  2AQ2 B;  1C78 A;  2Y5P A;  4P6V F;  1SE4 A;  2ZW0 A;  3AE1 B;  1F77 A;  1CQV A;  1QT9 A;  2TSS A;  3AE2 B;  1V97 A;  1I4X A;  1CJE A;  3O13 A;  2QMT A;  4JWU C;  2W82 A;  2W55 A;  3NVW A;  1IGC A;  3T3O A;  2GB1 A;  4OVZ A;  1N62 A;  2L83 A;  1SJH D;  1TY2 A;  2LMC A;  3AE7 B;  4O1N A;  4LTU A;  4JE3 B;  4USA A;  3RFZ B;  2H89 B;  4WQM A;  1IUE A;  1XLO A;  3SFE B;  1L0Y B;  4N58 A;  1D5X C;  3KLS X;  1PGB A;  3LXF A;  2PTL A;  1WRI A;  2PKO A;  2E6X A;  3AMZ A;  2GRI A;  2HDE A;  1MHX A;  2WXO A;  2FE8 A;  1ET9 A;  1LO5 D;  1YJJ A;  2FBW B;  2INN E;  4GDL B;  1VLB A;  1C4C A;  2IGD A;  4ZRP A;  5BYS A;  1TS2 A;  4YTP B;  5FKA C;  3ZYY X;  1ZOY B;  1JW9 D;  2CU3 A;  1SSN A;  2HTM E;  4IOI E;  2BS2 B;  1ZE3 D;  1QOG A;  1VZ8 A;  3VRA B;  1IBX B;  4MT5 A;  1FNW A;  1C4A A;  3Q69 A;  1OQR A;  2WXF A;  2PW9 A;  1HZ6 A;  3BZD B;  1SJE D;  1ENF A;  5BMH A;  4YXD B;  4RGN A;  1RFK A;  2ON8 A;  2N9L A;  1L4Z B;  4H2A A;  1N61 A;  3CWI A;  1XF5 L;  1FNV A;  3U7Z A;  2KMM A;  5HG2 A;  1JWM D;  5D7G A;  3W1S A;  1N5W A;  1K52 A;  3IAS 1;  1NI3 A;  1I4R A;  1D4B A;  1TKY A;  3TEW A;  1UWX A;  1UUP A;  4RGO S;  1GPX A;  1EU4 A;  2LHE A;  2Q5W D;  2QSD A;  1C79 A;  1SF0 A;  1ZUD 2;  4WH4 A;  1JCK B;  3NRZ A;  1JRP A;  5T8I A;  1K53 A;  3AEC B;  4OZA A;  3P4S B;  2VZK D;  2J52 A;  2OHF A;  3HRD D;  3MJ5 A;  3AE3 B;  2WXM A;  1YNT E;  3KWV A;  1KLG D;  1D5M C;  1KH0 A;  2ONQ A;  4KGR A;  2WU5 B;  2PVO D;  1TS4 A;  1BXT A;  1FM0 D;  2AX5 A;  4M0W A;  4YTM B;  1P7E A;  2LHD A;  3EUB 2;  3V05 A;  4RCO A;  3U52 E;  4C56 C;  2W3R A;  3MFG A;  2WXP A;  3WCQ A;  3AEB B;  3HVZ A;  1C9F A;  1YN5 A;  1GOZ A;  1JWS D;  3URY A;  2WXK A;  1E7P B;  4RH6 A;  1C76 A;  3AEA B;  4HRO A;  4FXC A;  5C3J B;  2YEP B;  3AB5 A;  3PZ8 A;  2M19 A;  2NMQ A;  3ABV B;  3BVG A;  1CZP A;  1FXI A;  2QIL A;  1ZPS A;  2QJL A;  2WDQ B;  3SEB A;  3UI3 A;  2WU2 B;  4HEA 1;  2L52 A;  4HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...